1K0NA

Chloride intracellular channel 1 (clic1) complexed with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
226
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords CHLORIDE INTRACELLULAR CHANNEL PROTEIN 1
publication title Crystal structure of a soluble form of the intracellular chloride ion channel CLIC1 (NCC27) at 1.4-A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1k0nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1k0nA01
2X99A 1X9WB 5CRHA 2B7JA 4HU9A 3KIJA 3PGTA 3HXSA 3KH7A 2O89A 4TXVA 3OR5A 1GUHA 4L5LA 2C3NA 2A2RA 4KDYA 3F6DA 2OADA 2LJRA 1QUWA 4TRXA 2MYGA 5IOWA 2TRXA 1GSDA 1MDKA 4DEJA 4ID0A 2DJKA 4LL4B 1EEJA 5BMUA 4OCEA 4WXTA 1SL1B 2PPTA 4WR4A 1YKAA 4ECCA 3F6FA 2YWMA 2CAIA 1MD4A 1ZYEA 4QL9A 1AIUA 3IBHA 1SJ6A 4HEA2 1E6BA 2V32A 1HNBA 3SWLA 3E0UA 4PGTA 1EGOA 1JLWA 2HQTA 1G7OA 2BMXA 3IE3A 2KP1A 4TXOB 3EINA 2VL9A 1ERWA 2H75A 3F3RA 1N8JA 3CSIA 1SD8A 4KGIA 2HYXA 4GXZA 3QPMA 4K2DA 1XCCA 2WS2A 2B5EA 7GSSA 1DE2A 3UL3A 5G1LA 1OE7A 5INYA 2ON5A 5H5QA 4O5RA 1TP9A 2WJUA 1VF3A 4TR4A 1SKSB 3HY2A 4PUFC 2IJYA 4HUAA 3U6VA 1OC3A 1GTUA 3E3EA 1KTEA 5CREA 2HRKB 3LYKA 2HRNA 2HSNB 2QSIA 4EDZA 3RPPA 2VL2C 2JADA 1GL8A 4Q5FA 2TRCP 2JSYA 4EVMA 2YJHA 3BCKA 2LKUA 5GSTA 2LRTA 2O87A 2LTKA 3LQ7A 3QR6A 2XPEA 1EV9A 4L0UA 2DMLA 1GSYA 4NXIA 1XOBA 1XOAA 1T00A 3EU3A 14GSA 1SYXA 3MAKA 3FR3A 3GNJA 2X64A 2KOKA 4N11A 4N30A 3FY7A 4JBBA 4G19A 4NMUA 2DJ2A 2IFQB 1SL0B 5DJLA 5JWOB 3L78A 4BVYB 4RI7A 3GMFA 3Q74A 3QCPA 3UIWA 2OBIA 3GTUB 4KA0A 2WFCA 5F05A 1PKZA 4MF7A 2IMKA 2C1YA 3ZRDA 3RPNA 6GSSA 2D2ZA 2ZNMA 4PQ1A 1I5GA 5B8BA 3GV1A 1TOFA 4EC0A 5LCZA 1OKDA 1ON4A 1U3IA 4MH2A 4NV2A 3ERWA 5CRWA 4PNGA 3TRPA 3ED3A 4XCSA 4NV5A 2DJ1A 3VPTA 2M80A 4HDEA 4KX4A 4POKA 2VOCA 4LMVA 3O3TA 2TIRA 5A4VA 18GSA 5G30A 2I9HA 2FA8A 19GSA 3M8NA 4O92A 4RI6A 1N2AA 2PWJA 2FWGA 2LSTA 4OO4A 4F2IA 2C0DA 2RIIA 2IWTA 1GNEA 3KTLA 2FWEA 4G2EA 3CSHA 2HE3A 1TK5B 4PX1A 4WF5A 1AXDA 1XW6A 3ZL5A 2AHEA 6GSXA 2P5RA 1TK0B 4EUYA 1V57A 1XBSA 2HNLA 4Q5NA 1M2AA 3US3A 1TDIA 1A8LA 2WRTA 2DSAA 3QAVA 3ZLPA 2VM1A 2ES7A 2XHFA 2FLSA 4RQXA 4I5QA 1GSEA 5KN0A 2OE0A 4V1Ag 2LJKA 3LGCA 5D9VA 5DVBA 3GSSA 1M0UA 2K18A 3R2QA 5G2ZA 1J08A 5JWRB 2WZ9A 2OE1A 5ELGA 1EP7A 3UARA 3G7JA 2LUSA 2EC4A 1JFUA 3L4NA 1AUCA 4OFNA 2VLVA 3WD6A 1OC9A 2H1AA 2B3SA 1MTCA 1Z6NA 4IELA 5GAND 1UN2A 3IAM2 3D21A 3F4TA 4YH2A 5ECNB 2VL2A 4FH8A 3LWAA 4XRDA 1SKRB 4DVCA 3UAPA 1PMTA 5FWGA 5IPGA 2DIZA 2H71A 5DCGA 4G0LA 2K8SA 2HZEB 3FZ9A 1PKWA 22GSA 2FA4A 4Q5QA 2ALBA 4F82A 2GLRA 3QD9A 5F07A 3N9JA 4TR1A 4X0XA 5AN1A 4AJ7A 5IMVA 1THOA 2GT5A 2ZUPA 1OKTA 2GSSA 1FOVA 4XS1A 1IYHA 2IN3A 3TKQA 3ZVJD 4MDCA 5CO3A 3TJJA 3GIXA 1K0MA 2XC2A 3F9UA 1EGRA 3EU4A 1Q98A 5AGYA 4ML1A 4JRRA 1TU8A 3QFBC 4QQ7A 2KP2A 1SKWB 3I9V2 4BVXB 2ZCTA 5D8IA 4BL7A 3CXGA 3ME8A 2YCDA 4L0WA 4RUVA 1KBNA 3IK7A 2H6YA 1BEDA 3HYPA 1T3BA 5HQPA 3VI7A 1RQMA 4IP6A 3EWLA 3Q18A 4XTSA 4MJAA 1NW2A 3TUEA 1BAYA 4I8BA 3FW2A 1QGVA 4HZ4A 3HKRA 2CV4A 4Q5RA 2H6XA 4IJIA 3U5RE 1GTIA 4HOJA 6GSVA 3D0ZA 2YN1A 1WJKA 4IN0A 3VWXA 4YQMA 2VCQA 2VAFA 1O73A 4GRFA 1TRVA 2GDRA 1QFNA 4TXOA 4MJCA 1SU9A 5J5NA 4L8EA 2M46A 1WRYA 3ZFLA 2RM6A 2PN8A 5DALB 4FQUA 3GKXA 4POBA 3IAS2 1NHOA 1XVWA 6GSUA 3CRTA 2RUEA 2PU9C 4KNDA 1AW9A 2H0HA 1GSSA 5IQYA 2GTUA 1B9YC 3QAWA 1H4OA 1LBKA 3DMLA 3MSZA 1JZOA 4ISDA 1OC9B 2JL4A 2PVOC 5DDLA 3FR6A 4K8MA 4IGJA 5B6NA 4EXJA 2C0FA 4ZBDA 2GZZA 3J7Yk 5CP1A 3A5WA 3DVXA 5J41A 1V9WA 1S3CA 16GSA 2HRKA 2HLSA 3C71A 2HRFA 4BA7A 10GSA 5A4WA 3KJYA 3KGKA 3TKPA 3DKSA 2OJLA 5IPHA 2N5BA 4XHMA 1K0NA 2H6ZA 2ON7A 3GRXA 5F8BA 1FG4A 4H86A 1G6WA 4PUAA 4KUNA 1QMVA 3ZFBA 4WKWA 1G0TA 2B5XA 4HJMA 3TJKA 4PXOA 3UBLA 1XW5A 1SK2A 4GCIA 1V98A 4OCFA 4Z7XA 5ABRA 4POMA 1Z5YE 2HFDA 3FHKA 4BPYA 3LYPA 5IM9A 4BL7B 4X1UA 2OBKA 3IDVA 2H70A 1NM3A 3ZZXA 1F37A 2IFQA 3D4TA 4X43A 3GH6A 1GUMA 4P3YB 5ECPB 4BVYA 2REMA 1K0CA 1RW1A 2B1KA 4O32A 1YY7A 2VCXA 2R4VA 2GZPA 1XWGA 3APOA 3G7YA 1R5AA 4WBJA 3NIVA 3E9JB 5CYYA 2H66A 3GTUA 4KE3A 4RQRA 1K3OA 3G7IA 2L6CA 2C0EA 2F8AA 2L6DA 5EPFA 1X9MB 4TR3A 4TOPA 2R3XA 3QAGA 3CYNA 3FRCA 2I1UA 2CX4A 4G9HA 4BWQA 3L9SA 5KN2A 4LA1A 1J0FA 2XBQA 2C80A 2FWFA 5DAKB 1VF4A 1SJZA 2H74A 3A3TA 5G31A 5IMAA 2VLTA 2WDUA 3HZ8A 1R7HA 4XS4A 4XS6A 1RK4A 2DJ3A 5CRDA 1GTAA 2L5LA 2V2GA 3H93A 1XFLA 2C8UA 3CSJA 4JZQA 5CNWA 1M9BA 4N0ZA 1I9DA 2CX3A 1XWBA 4WEYA 3ME7A 2JZSA 1GTBA 2R37A 5AISA 2L5OA 4XRAA 1HQOA 3UVHA 3TKSC 3VURA 2DLXA 1XPVA 1EEMA 2YJ7A 2AYTA 3BJ5A 1Q4JA 5D9WA 2CQ9A 2KLXA 4NHZA 1Z7RA 2V6OA 3I6AA 3ERFA 4HQZA 2MBSA 4ECBA 2IMFA 4POLA 2DC5A 3SBCA 4NWYA 4KH7A 2H76A 3HVSA 1GNWA 2HZFA 2WCIA 2UZ8A 3HZ4A 3O6TA 5A5KA 2H72A 3GKKA 4YQUA 1K3LA 4USSA 3H8QA 3H79A 2H1GA 2J23A 4V2LA 3KZQA 2FWHA 2VD1A 2V41A 1JZDA 1ZCPA 4ZBAA 5G5EA 3I43A 3ZIVA 3HD5A 2DJ0A 3HCZA 3N5OA 1TI3A 4IS0A 2FGXA 5F06A 1V2AA 4MH3A 1X0RA 1O8XA 4G0IA 1PX7A 2CZ3A 2HZEA 2HSMB 3TKSE 4L5OA 1YF0A 2AV4A 1W89A 3A2XA 4HS1A 1F3BA 5IOXA 1GP1A 4IP1A 4PURA 3AY8A 3FK8A 1WP0A 1KEBA 1AQWA 1ERTA 1SD9A 4MJBA 5GAPD 4LMWA 1T1VA 3IR4A 2PGTA 2HT9A 3APQA 1WWJA 3KD0A 4I6XA 4F9ZA 4MZBA 2LNSA 5EL8A 3DWVA 2CVBA 3Q19A 3RAZA 5H5SA 5KN1A 5AIVA 5ECQB 1U3AA 3WGDA 3VLNA 4BVXA 3TGZA 3TJBA 5J3RA 2GSRA 4HI7A 3FZAA 2VO4A 1XWCA 2YWOA 1OYJA 1NHYA 5HR0A 3D6IA 2HSHA 1K0DA 2O7KA 2IMIA 4CDOA 1XIYA 1G7EA 1T4YA 4XS4B 3VPQA 4GWRA 4ZB8A 1MEKA 4IJ3A 3VI5A 5IIZA 1WMJA 3BD2A 4FYCA 5HR2A 1PN9A 1Z7PA 3TDGA 1PA3A 2AJQB 3WT2A 3IRAA 4J57E 3HJPA 1PQNA 4ML6A 1Z3EA 5JCGA 2HXKA 4K9ZA 2MMAA 1U6TA 2N5FA 1K3YA 4IQAA 2P5QA 4WBRD 2NVLA 1SL2B 3FEUA 2CT6A 1A0RP 4ZXGA 5DALA 5EVOA 1SK0A 5E59A 3EYTA 1ZL9A 4JR6A 4TR0A 1A24A 1USBA 3TCOA 4TKYA 5ENUA 2LQQA 2C3QA 1X5DA 2LRCA 3F63A 1XW9A 3W8JA 4WETA 1GULA 1QQ2A 4J56E 5COHA 3L9UA 2JACA 1A2MA 2F3MA 4KSOA 5J9CA 1THXA 2GSQA 3TKSA 2CZ2A 2X8CA 1EZKA 5DQYA 3P2AA 1HYUA 3ISOA 2PMTA 1PRXA 5D9TA 5ELAA 1U88A 3VK9A 3ZYWA 4ZB9A 5IO2A 1FW1A 2H0GA 3GA4A 3NZNA 2HRAA 2YPMA 4IVFA 1PGTA 2YV7A 4YAVA 2EIRA 5ECIB 4DSRA 3KH9A 1T8EB 4DSQA 2VL3A 3O76A 1QK8A 2N5AA 4WR5A 2YZHA 2B6MA 1W4VA 1T4ZA 2MBTA 6GSWA 5H5RA 2F9SA 1ERVA 1A8YA 4FYBA 1FVKA 3F8UA 1YEPA 4KB3A 4HJ2A 2YANA 4PTSA 3C1SA 1NSWA 3PR8A 4GQFA 5ECKB 4N0VA 1SENA 2DIYA 5ID2B 2WULA 3A2WA 2YP6A 2O85A 1O85A 4EF0A 1FB0A 4K7IA 1TI1A 1ML6A 2GZYA 3HA9A 3L0HA 1Z9HA 1FHEA 1GWCA 2J9HA 1ST9A 5G1KA 2L57A 1YJ6A 1MD3A 4MZWA 2MMNA 3P90A 3GN3A 2G2QA 4MK3A 1HNAA 5IMZA 2CAQA 3C73A 3HVVA 3JCML 2NTOA 5FHIA 4JR4A 2GSTA 4NHWA 3LG6A 3EE2A 2VLUA 3ZITA 3D22A 5DCHA 4F0CA 5DAKA 4EL1A 2L59A 4LL1B 1B4QA 5HFIA 2JU5A 4IW9A 4GSSA 4NAXA 1M2DA 2H19A 3TB2A 3VWVA 2B5YA 3TKRA 1IYIA 4YQVA 2VCTA 3HJMA 5G5FA 6GSTA 1FAAA 1GLPA 3PINA 3EVIA 4TW5A 2PUKC 3FZ5A 5HFKA 3S9FA 4E8HA 2F8FA 3FR9A 3ZVJA 2VM2A 3H4KA 1F6MC 5A4UA 1V58A 1ZOFA 1X9SB 4KW6A 4K0NA 2QGVA 1H75A 4I97A 2FD3A 1GRXA 3UOMA 1WOUA 2LQOA 1ZZYA 2YWNA 1FB6A 1K0BA 2LV3A 2RLIA 2PERA 4PQHA 3CTFA 3CBUA 2RM5A 4IKHA 1DBYA 1C72A 4AJ6A 6GSYA 5L71A 2KUCA 4HQSA 1YKCA 4OWYA 2H8LA 1A23A 2IMDA 1TK8B 4GSNA 3NOFA 4BWSA 3KP9A 2HSMA 5DBQA 20GSA 4V2NA 4FO5A 5D73A 3P7XA 2MMZA 1OVNA 2X8GA 3DGQA 4DSSA 2OA7A 5HR1A 3QMXA 3EC3A 4NPBA 1CQGA 9GSSA 3GL3A 3QOUA 1T7PB 4F0BA 1CQHA 1E2YA 1S3AA 1DUGA 1TRWA 5J4UA 2LRNA 5AIXA 1X5EA 4K6XA 1J9BA 3MDKA 11GSA 3APSA 3IC4A 3RHBA 3TJFA 5D9XA 3FZ4A 4GSTA 5B8AA 1GSUA 3IXRA 4GQCA 2XBIA 1SYRA 4ZIJA 3KP8A 4IBPA 3DVWA 4CHSA 3RHCA 3BBYA 4WF4A 2A4VA 3C1RA 1UA5A 5ECHB 2H1BA 2MZCA 5HFGA 4ECJA 2FUG2 4K7OA 1A2JA 2WB9A 2FCHA 5EY6A 1EOGA 4ULXA 1FVJA 3KCMA 5CRGA 4V2MA 3H1NA 2QC7A 2IMEA 3FYGA 4IQ1A 4MPGA 1BJXA 2E0QA 2JZRA 1M99A 3W6GA 3DIEA 2A2SA 2CVDA 2IL3A 2VD0A 2R2JA 1GSQA 3GH9A 1JZRA 3C8EA 4OFTA 5D93A 3D5JA 2PBJA 4OFMA 3KM6A 2E7PA 1EV4A 5B7CA 2GS3A 4ZILA 2VCWA 4D73A 4CW9A 2I4AA 3P8WA 1VGLA 3CMIA 2FHEA 4K1FA 3KMNA 2V1MA 2JZTA 3QFAC 4JEDA 2O8VB 3PPUA 4MP4A 5ECMB 2H1DA 1S3DA 3CTGA 2C4JA 4I2UA 1MDIA 2GT6A 3FKFA 1LJRA 2VCZA 3LJRA 3GKMA 2OACA 1AAZA 4KCAA 1O7UA 2VIMA 3QDNA 3MNGA 1TU7A 1OC8A 4MABA 3F0IA 4MLYA 1B8XA 4KDUA 3UBKA 12GSA 3ERGA 5IO0A 2K9FA 2GVPA 3C7MA 3PH9A 2QKEA 2K6VA 2C0GA 4E8EA 2DBCA 2I81A 4DSSB 4HU7A 2F51A 1Z6MA 2H73A 4TN8A 5JCUA 3TOUA 1WE0A 3LSZA 4LLRA 1LU4A 1VF2A 2X8HA 2P0GA 1YF1A 3A2VA 3F4RA 3DYRA 1XVQA 4MZCA 3TOTA 4AF2A 3F4SA 2H01A 2CA8A 3LXTA 2AB6A 4J2FA 1XZOA 3IOSA 3IPZA 2AAWA 5D96A 3RBTA 2L4QA 3LEFA 2JSZA 2HI7A 1M9AA 2G0FA 2P31A 4N10A 1A2LA 1TRUA 1B48A 1O8WA 4GTUA 2L4CA 1F3AA 1AQVA 4ZL7A 2WGRA 1SK1A 3W8SA 3GSTA 5GZZB 3KTBA 1R5PA 1ACVA 1YDKA 3M9JA 3HDCA 1TTZA 4ZBBA 3TJGA 3LORA 5ID2A 1JHBA 4ZB6A 4F03A 3WGXA 1ZGNA 8GSSA 1TJDA 3DRNA 3G9BA 2GQMA 3M1GA 1HD2A 4ZL8A 4OMVA 4MF5A 3ZIJA 1GH2A 4ECIA 2VCVA 3RDWA 4EO3A 2FNOA 5LNKe 1GUKA 2H0IA 1JLVA 3BOAA 13GSA 4D73B 4GLTA 3GFKA 4QL7A 4K0GA 1BYEA 4G0KA 5JWQB 3WGEA 3M9KA 3TRXA 1HNCA 1Y25A 1WIKA 5ECSA 2HSYA 1XWAA 2LNTA 3K8NA 3M3MA 3I69A 1GLQA 1M7TA 2E2MA 1F2EA 2XPDA 2PVQA 1PX6A 2RUFA 3BCIA 4MPFA 4MCUA 1TW9A 2LS5A 1K0AA 3GL5A 2IPAA 2B1LA 3M0FA 1B4PA 3DEXA 1M2BA 1DSBA 1YEXA 4EKZA 5IMFA 2V6KA 2YWIA 3HVXA 4EE0A 2OE3A 1A0FA 1O6JA 1F9MA 4V1Ap 1TXXA 2BJXA 4HZ2A 3ZREA 3GX8A 3WYWA 3GYKA 3ZMLA 4AJ8A 1PL2A 1JZWA 2NDOA 2MMOA 5ECLB 3KXOA 4EDYA 1O81A 1BG5A 3GUSA 3R3EA 4I2TA 2AUVA 1R4WA 1AC1A 3J7Yb 3UJ1A 2BTOT 2CVKA 2YOIA 2DJJA 3F3QA 5E4WA 4MA9A 2FY6A 4MMMA 2E2GA 1TRSA 3WT1A 1ERUA 5KN3A 4ILFA 2Z9SA 1EWXA 1Y6EA 5LD0A 4IHUA 1UC7A 5F0GA 1ZMAA 4O7HA 4ACSA 3DD3A 2LJAA 1GSFA 1XWKA 5ECRB 1ZYQB 1U87A 2EIOA 2R5GA 1XXUA 3VWWA 3GHAA 3UVTA 3D4MA 3GX0A 2I3YA 2GQLA 4TVEA 2C3TA 1PSQA 1ILOA 3L9VA 1KNGA 2M72A 3VFIA 4KSMA 3UEMA 1YZXA 3ZTLA 2K8VA 3UMAA 5DJMA 4KCEA 1OAZA 2KHPA 5C00A 1FO5A 4ZL9A 2NPBA 4FIWA 3IV4A 3V1WA 5IMDA 1DE1A 5FT3A 4K7NA 5CAXA 2YZUA 4XIHA 1YQ1A 1VF1A 3GURA 3IHQA 2DMMA 5ECOB 4KDXA 1BX9A 5IMCA 3VWUA 4G10A 17GSA 2OKAA 3EURA 3LFLA 1K0OA 1PL1A 3MWHA 4OO5A 1V40A 3EMXA 5KEJA 1EP8A 1R26A 4MF6A 5C04A 4OD7A 2B7KA 4GF0A 1SJIA 2YV9A 1TKDB 4PNFA 1BQ7A 3DXBA 3KEBA 4MJEA 5HR3A 1EOHA 3KMOA 1OE8A 5DQSA 4AGSA 4FYUA 5JCWA 2NBSA 2LEGA 1MDJA 3Q6OA 3CRUA 3EMPA 2YNXA 3ZMKA 2VUPA 1WPIA 1G6YA 2EIQA 3IA1A 3IC8A 2IIYA 5GSSA 1VRSD 5J9BA 1PD21 1URMA 2GGTA 4TR1B 3HJOA 4JU5A 2H30A 4KAEA 5B6MA 4PQIA 4YAPA 4JE1A 3IK9A 3TRQA 3HHVA 4KF9A 2R6KA 1AQXA 1B9XC 3GKNA 2GQKA 1QXHA 1X5CA 1ABAA 3LXZA 1UVZA
chains in the Genus database with same CATH superfamily
2X99A 1X9WB 5CRHA 2B7JA 3FMWA 4HU9A 3KIJA 3PGTA 5BRTA 3HXSA 3KH7A 2O89A 4TXVA 3OR5A 1GUHA 4L5LA 2C3NA 2A2RA 4KDYA 3F6DA 2OADA 2LJRA 1QUWA 4TRXA 2MYGA 5IOWA 2TRXA 1GSDA 1MDKA 4DEJA 4ID0A 2DJKA 4LL4B 1EEJA 5BMUA 4OCEA 4WXTA 1SL1B 2PPTA 4WR4A 1YKAA 4ECCA 3F6FA 2YWMA 2CAIA 1MD4A 1ZYEA 4YKGA 4QL9A 1AIUA 3IBHA 1SJ6A 4HEA2 1E6BA 2V32A 1HNBA 3SWLA 3E0UA 4PGTA 1EGOA 1JLWA 2HQTA 1G7OA 2BMXA 3IE3A 2KP1A 4TXOB 3EINA 2VL9A 1ERWA 2H75A 3F3RA 1N8JA 3CSIA 3IHGA 1SD8A 4KGIA 2HYXA 4GXZA 3QPMA 4K2DA 1XCCA 2WS2A 2B5EA 7GSSA 1DE2A 3UL3A 5G1LA 1OE7A 5INYA 2ON5A 2DKHA 5H5QA 4O5RA 1TP9A 2WJUA 1VF3A 4TR4A 1SKSB 3HY2A 4PUFC 2IJYA 4HUAA 3U6VA 1OC3A 1GTUA 3E3EA 1KTEA 5CREA 2HRKB 2QA2A 3LYKA 2HRNA 2HSNB 2QSIA 4EDZA 3RPPA 2VL2C 2JADA 1GL8A 4Q5FA 2TRCP 4CY8A 2JSYA 4EVMA 2YJHA 3BCKA 2LKUA 5GSTA 2LRTA 2O87A 2LTKA 3LQ7A 3QR6A 2XPEA 1EV9A 4L0UA 5J4YA 2DMLA 1GSYA 4NXIA 1XOBA 1XOAA 1T00A 3EU3A 14GSA 1SYXA 4AKHA 3MAKA 3FR3A 3GNJA 2X64A 2KOKA 4N11A 4N30A 3FY7A 4JBBA 4G19A 4NMUA 2DJ2A 4Z2TA 2IFQB 1SL0B 5DJLA 5A5HB 5JWOB 3L78A 4BVYB 4RI7A 3GMFA 3Q74A 3QCPA 3UIWA 2OBIA 3GTUB 4KA0A 2WFCA 5F05A 1PKZA 4MF7A 2IMKA 2C1YA 3ZRDA 3RPNA 6GSSA 2D2ZA 2ZNMA 4PQ1A 1I5GA 5B8BA 3GV1A 1TOFA 4EC0A 5LCZA 1M3JA 1OKDA 1ON4A 1U3IA 4MH2A 4NV2A 2WW2A 3ERWA 5CRWA 4PNGA 3TRPA 3ED3A 4XCSA 4NV5A 2DJ1A 3VPTA 2M80A 4HDEA 4KX4A 4POKA 2VOCA 4LMVA 3O3TA 2TIRA 5A4VA 1SVLA 18GSA 5G30A 2I9HA 2FA8A 19GSA 3M8NA 4O92A 4RI6A 1N2AA 2PWJA 2FWGA 2LSTA 4OO4A 4F2IA 2C0DA 2RIIA 2IWTA 1GNEA 3KTLA 2FWEA 4G2EA 3CSHA 2HE3A 1TK5B 4PX1A 4WF5A 1AXDA 1XW6A 3ZL5A 2AHEA 6GSXA 2P5RA 4G01A 1TK0B 4EUYA 1V57A 1XBSA 2HNLA 4Q5NA 1M2AA 3US3A 1TDIA 1YEWC 1A8LA 2WRTA 2DSAA 3QAVA 3ZLPA 2VM1A 2ES7A 2XHFA 2FLSA 4RQXA 4I5QA 1GSEA 5KN0A 2OE0A 4V1Ag 2LJKA 3LGCA 2WW1A 5D9VA 5DVBA 3GSSA 1M0UA 4O5QA 2K18A 3R2QA 5G2ZA 1J08A 5JWRB 2WZ9A 2OE1A 5ELGA 1EP7A 3UARA 3G7JA 2LUSA 2EC4A 1JFUA 3L4NA 1AUCA 4OFNA 2VLVA 3WD6A 1OC9A 2H1AA 2B3SA 1MTCA 1Z6NA 4IELA 5GAND 1UN2A 3IAM2 3D21A 3F4TA 4YH2A 5ECNB 2VL2A 4FH8A 3LWAA 4XRDA 1SKRB 4DVCA 3UAPA 1PMTA 5FWGA 5IPGA 2DIZA 2H71A 5DCGA 4G0LA 2K8SA 2HZEB 3FZ9A 1PKWA 22GSA 2FA4A 4Q5QA 2ALBA 4F82A 2GLRA 3QD9A 5F07A 3N9JA 4TR1A 4X0XA 5AN1A 4AJ7A 4HSCX 5IMVA 2VKZG 1THOA 2GT5A 2ZUPA 1OKTA 2GSSA 1FOVA 4XS1A 1IYHA 2IN3A 3TKQA 3ZVJD 4MDCA 5CO3A 3TJJA 3GIXA 1K0MA 4O5UA 2XC2A 3F9UA 1EGRA 3EU4A 1Q98A 5AGYA 4ML1A 4JRRA 1TU8A 3QFBC 4QQ7A 2KP2A 1SKWB 3I9V2 4BVXB 2ZCTA 5D8IA 1N25A 4BL7A 3CXGA 3ME8A 5J47A 1I1IP 2YCDA 4L0WA 4RUVA 1KBNA 3IK7A 2H6YA 1BEDA 3HYPA 1T3BA 5HQPA 3VI7A 1RQMA 4IP6A 3EWLA 3Q18A 4XTSA 4MJAA 1NW2A 3TUEA 1BAYA 4I8BA 3FW2A 1QGVA 4HZ4A 3HKRA 2CV4A 4Q5RA 2R0PA 2H6XA 4IJIA 3U5RE 1GTIA 4HOJA 2DKIA 6GSVA 3D0ZA 2YN1A 1WJKA 4IN0A 3VWXA 4YQMA 2VCQA 2VAFA 1O73A 4GRFA 1TRVA 2GDRA 1QFNA 4TXOA 4MJCA 1SU9A 5J5NA 4L8EA 2M46A 4AKXB 1WRYA 3ZFLA 2RM6A 2PN8A 5DALB 5A1NB 4FQUA 3GKXA 4W66A 4POBA 3IAS2 1NHOA 1XVWA 6GSUA 3CRTA 2RUEA 2PU9C 4KNDA 1AW9A 2H0HA 1GSSA 5IQYA 2GTUA 5A34A 1B9YC 3QAWA 1BF5A 1H4OA 1LBKA 3DMLA 3MSZA 1JZOA 4ISDA 1OC9B 2JL4A 2PVOC 5DDLA 3FR6A 4K8MA 4IGJA 5B6NA 4EXJA 2C0FA 4ZBDA 2GZZA 3J7Yk 5CP1A 3A5WA 3DVXA 5J41A 1V9WA 1S3CA 16GSA 2HRKA 2HLSA 3C71A 2HRFA 2HSNA 4BA7A 10GSA 5A4WA 3KJYA 3KGKA 3TKPA 3DKSA 2OJLA 5IPHA 2N5BA 4XHMA 2EFHA 1K0NA 2H6ZA 2ON7A 3GRXA 5F8BA 1FG4A 2EFEA 4H86A 1G6WA 4PUAA 4KUNA 4PI0C 1QMVA 3ZFBA 4WKWA 1G0TA 2B5XA 4HJMA 3TJKA 4PXOA 3UBLA 1XW5A 1SK2A 4GCIA 1V98A 4OCFA 4Z7XA 5ABRA 4POMA 1Z5YE 2HFDA 3FHKA 4BPYA 3LYPA 5IM9A 4BL7B 4X1UA 2OBKA 3IDVA 2H70A 1NM3A 4ZB7A 3ZZXA 1F37A 2IFQA 3D4TA 4X43A 5A5HA 3GH6A 1GUMA 4P3YB 5ECPB 4BVYA 2REMA 1K0CA 1RW1A 2B1KA 4O32A 1YY7A 2VCXA 2R4VA 2GZPA 1XWGA 3APOA 3G7YA 1R5AA 4WBJA 3NIVA 4A5PA 3E9JB 5CYYA 2H66A 3GTUA 4KE3A 4RQRA 1K3OA 3G7IA 2L6CA 4GDFA 4K2XA 2C0EA 2F8AA 2L6DA 5EPFA 1X9MB 4TR3A 4TOPA 2R3XA 3QAGA 3CYNA 3FRCA 2I1UA 2CX4A 3CHXC 4G9HA 4BWQA 3L9SA 5KN2A 4LA1A 1J0FA 2XBQA 2C80A 2FWFA 5DAKB 1VF4A 1SJZA 2H74A 3A3TA 5G31A 5A34B 5IMAA 2VLTA 2WDUA 3HZ8A 1R7HA 4XS4A 4XS6A 1RK4A 2DJ3A 5CRDA 3MYDA 1GTAA 2L5LA 2V2GA 3H93A 1XFLA 2C8UA 3CSJA 4JZQA 5CNWA 1M9BA 4N0ZA 1I9DA 3HVNA 2CX3A 1XWBA 4WEYA 3ME7A 2JZSA 1GTBA 2R37A 5AISA 2O5VA 2L5OA 4XRAA 1HQOA 3UVHA 3TKSC 3VURA 2DLXA 1XPVA 1EEMA 2YJ7A 2AYTA 3BJ5A 1Q4JA 5D9WA 2CQ9A 2KLXA 4NHZA 1Z7RA 2V6OA 3I6AA 3ERFA 4HQZA 2MBSA 4ECBA 2IMFA 4POLA 2DC5A 3SBCA 4NWYA 4KH7A 2H76A 3HVSA 1GNWA 2HZFA 2WCIA 2UZ8A 3HZ4A 3O6TA 5A5KA 2H72A 2WVZA 3GKKA 4YQUA 1K3LA 4USSA 3H8QA 3H79A 2H1GA 2J23A 4V2LA 3KZQA 2FWHA 2VD1A 2V41A 4AKIA 1JZDA 1ZCPA 4ZBAA 5G5EA 3I43A 3ZIVA 3HD5A 2DJ0A 3HCZA 3N5OA 1TI3A 1M3IA 4IS0A 2FGXA 5F06A 1V2AA 4MH3A 1X0RA 1O8XA 4G0IA 1PX7A 2CZ3A 2HZEA 2HSMB 3CWGA 3TKSE 1BG1A 4L5OA 1YF0A 2AV4A 1W89A 3A2XA 2R0GA 4HS1A 1F3BA 5IOXA 1GP1A 4IP1A 4PURA 3AY8A 3FK8A 1WP0A 1KEBA 1AQWA 1ERTA 1SD9A 4MJBA 5GAPD 4LMWA 1T1VA 3IR4A 2PGTA 2HT9A 3APQA 1WWJA 3KD0A 4I6XA 4F9ZA 4MZBA 2LNSA 1SVOA 5EL8A 3DWVA 2CVBA 3Q19A 3RAZA 5H5SA 5KN1A 5AIVA 5ECQB 1U3AA 3WGDA 3VLNA 4BVXA 3TGZA 3TJBA 5J3RA 2GSRA 4HI7A 3FZAA 2VO4A 1XWCA 2YWOA 1OYJA 1NHYA 5HR0A 3D6IA 2HSHA 1K0DA 2O7KA 2IMIA 4CDOA 1XIYA 1G7EA 1T4YA 4XS4B 3VPQA 4GWRA 4ZB8A 1MEKA 4IJ3A 3VI5A 5IIZA 1WMJA 3BD2A 4FYCA 5HR2A 1ZYNA 1PN9A 1Z7PA 3TDGA 1PA3A 2AJQB 3RFRC 4MNNA 3WT2A 3IRAA 4J57E 3HJPA 1PQNA 4ML6A 5J40A 4Z2RA 1Z3EA 5JCGA 2HXKA 4K9ZA 4QMKA 2MMAA 1U6TA 2N5FA 1K3YA 4IQAA 2P5QA 4WBRD 2NVLA 1SL2B 3FEUA 2CT6A 1A0RP 4ZXGA 5DALA 5A1NA 5EVOA 1SK0A 5E59A 3EYTA 1ZL9A 4JR6A 4TR0A 1A24A 1USBA 3TCOA 4TKYA 5ENUA 2LQQA 1SVMA 2C3QA 1X5DA 2LRCA 4FXYP 3F63A 1XW9A 3W8JA 4WETA 1GULA 1QQ2A 4J56E 5COHA 3L9UA 2JACA 1A2MA 2F3MA 4KSOA 5J9CA 1THXA 2GSQA 2A4HA 3TKSA 2CZ2A 2X8CA 1EZKA 5DQYA 3P2AA 1HYUA 2O36A 3ISOA 2PMTA 1PRXA 5D9TA 5ELAA 1U88A 3VK9A 3ZYWA 4ZB9A 5KOXA 5IO2A 1FW1A 2H0GA 3GA4A 3NZNA 2HRAA 2YPMA 4IVFA 1PGTA 2YV7A 4YAVA 2EIRA 5ECIB 4DSRA 3KH9A 1T8EB 4DSQA 2VL3A 3O76A 1QK8A 2N5AA 4WR5A 2YZHA 2B6MA 1W4VA 1T4ZA 2MBTA 6GSWA 5H5RA 2F9SA 1ERVA 1A8YA 4FYBA 1FVKA 3F8UA 1YEPA 4KB3A 4HJ2A 2YANA 4PTSA 3C1SA 1NSWA 3PR8A 4GQFA 5ECKB 4N0VA 1SENA 2DIYA 1ZYPA 2WULA 5ID2B 4EIQA 3A2WA 2YP6A 2O85A 1O85A 4EF0A 1FB0A 4K7IA 1TI1A 1ML6A 2GZYA 3HA9A 3L0HA 1Z9HA 1FHEA 1GWCA 2J9HA 1ST9A 5G1KA 2L57A 1XG8A 1YJ6A 1MD3A 4MZWA 2MMNA 3P90A 3GN3A 2G2QA 4MK3A 1HNAA 5IMZA 2CAQA 3C73A 3HVVA 1FOHA 1PN0A 3JCML 2NTOA 5FHIA 4JR4A 2GSTA 4NHWA 3LG6A 3EE2A 2VLUA 3ZITA 3D22A 5DCHA 4F0CA 5DAKA 4EL1A 2L59A 4LL1B 1B4QA 5HFIA 2JU5A 4IW9A 4GSSA 4NAXA 1M2DA 2H19A 3TB2A 3VWVA 2B5YA 3TKRA 2X49A 1IYIA 4YQVA 2VCTA 3HJMA 5G5FA 6GSTA 1FAAA 1GLPA 3PINA 3EVIA 4TW5A 4Z2UA 2EFCA 2PUKC 3FZ5A 4X4JA 5HFKA 3S9FA 4E8HA 2F8FA 3FR9A 3ZVJA 2VM2A 5KOWA 3H4KA 1F6MC 5A4UA 1V58A 1ZOFA 1X9SB 4KW6A 2H1LA 4K0NA 2QGVA 1H75A 1TXUA 4I97A 2FD3A 1GRXA 3UOMA 1WOUA 2LQOA 2WW3A 1ZZYA 2YWNA 1FB6A 1K0BA 2LV3A 2RLIA 1S4BP 2PERA 4PQHA 3CTFA 3CBUA 2RM5A 4IKHA 1DBYA 1C72A 2QA1A 4AJ6A 6GSYA 5L71A 4EIPA 2KUCA 4HQSA 1YKCA 4OWYA 2H8LA 1A23A 2IMDA 1TK8B 4GSNA 3NOFA 4BWSA 3KP9A 2HSMA 5DBQA 20GSA 4V2NA 4FO5A 5D73A 3P7XA 2MMZA 1OVNA 2X8GA 3DGQA 4DSSA 2OA7A 5HR1A 3QMXA 3EC3A 4NPBA 4K5SA 1CQGA 9GSSA 3GL3A 3QOUA 1T7PB 4F0BA 1CQHA 1E2YA 1S3AA 1DUGA 1TRWA 5J4UA 2LRNA 2WVXB 5AIXA 1X5EA 4K6XA 1J9BA 3MDKA 11GSA 3APSA 3IC4A 3RHBA 3TJFA 5D9XA 2O3EA 3FZ4A 4GSTA 5B8AA 1GSUA 3IXRA 4GQCA 2XBIA 4PHZC 1SYRA 4ZIJA 3KP8A 4IBPA 3DVWA 4CHSA 3RHCA 3BBYA 4WF4A 2A4VA 3C1RA 4K5RA 1UA5A 5ECHB 2H1BA 2MZCA 5HFGA 4ECJA 2FUG2 4K7OA 1A2JA 2WB9A 2FCHA 5EY6A 1EOGA 4ULXA 1FVJA 3KCMA 5CRGA 4V2MA 4PI2C 3H1NA 2QC7A 2IMEA 3FYGA 4IQ1A 4MPGA 1BJXA 2E0QA 2JZRA 1M99A 3W6GA 3DIEA 2A2SA 2CVDA 2IL3A 2VD0A 4AKGA 2R2JA 1GSQA 3GH9A 1JZRA 3TU3B 3C8EA 4OFTA 5D93A 3D5JA 2PBJA 4OFMA 3KM6A 2E7PA 1EV4A 5B7CA 2GS3A 4ZILA 2VCWA 4D73A 4CW9A 2I4AA 3P8WA 1VGLA 3CMIA 2FHEA 4K1FA 3KMNA 2V1MA 2JZTA 3QFAC 4JEDA 2O8VB 3PPUA 4MP4A 5ECMB 2H1DA 1S3DA 3CTGA 2C4JA 4I2UA 1MDIA 2GT6A 3FKFA 1LJRA 2VCZA 3LJRA 3GKMA 2OACA 1AAZA 4KCAA 1O7UA 2VIMA 3QDNA 3MNGA 2UV8G 1TU7A 1OC8A 4MABA 3F0IA 4MLYA 1B8XA 4KDUA 3UBKA 12GSA 3LW9A 3ERGA 5IO0A 2K9FA 2GVPA 3C7MA 3PH9A 2QKEA 2K6VA 2C0GA 4E8EA 3EPTA 2DBCA 2I81A 4DSSB 4HU7A 2F51A 1Z6MA 2H73A 4TN8A 5JCUA 3TOUA 1WE0A 3LSZA 4LLRA 1LU4A 1VF2A 2X8HA 2P0GA 1YF1A 3A2VA 3F4RA 3DYRA 1XVQA 4MZCA 3TOTA 4AF2A 5BMUB 2X4AA 3F4SA 2H01A 2CA8A 3LXTA 2AB6A 4J2FA 1XZOA 2A2PA 3IOSA 3IPZA 2AAWA 5D96A 3RBTA 2L4QA 3LEFA 2JSZA 2HI7A 1M9AA 4AI6A 2G0FA 1YVLA 2P31A 4N10A 1A2LA 1TRUA 1B48A 1O8WA 4GTUA 2L4CA 1F3AA 1AQVA 4ZL7A 2WGRA 4E68A 1SK1A 3W8SA 3GSTA 5GZZB 3KTBA 1R5PA 1ACVA 1YDKA 3M9JA 3HDCA 1TTZA 4ZBBA 3TJGA 3LORA 5ID2A 1JHBA 4ZB6A 4F03A 3WGXA 1ZGNA 8GSSA 1TJDA 3DRNA 3G9BA 2GQMA 3M1GA 1HD2A 4ZL8A 3MIXA 4OMVA 4MF5A 3ZIJA 1GH2A 4ECIA 2VCVA 3RDWA 4EO3A 2FNOA 5LNKe 1GUKA 2WZSA 2H0IA 1JLVA 3BOAA 13GSA 4D73B 3RGBC 4GLTA 3GFKA 4QL7A 4K0GA 1BYEA 4G0KA 5JWQB 3WGEA 3M9KA 3TRXA 1HNCA 1Y25A 1WIKA 5ECSA 2HSYA 1XWAA 2LNTA 3K8NA 3M3MA 3I69A 1GLQA 1M7TA 2E2MA 1F2EA 2XPDA 2PVQA 1PX6A 2RUFA 3BCIA 4MPFA 4MCUA 1TW9A 2LS5A 1K0AA 3GL5A 2R0CA 2IPAA 2B1LA 3M0FA 1B4PA 3DEXA 1M2BA 1DSBA 1YEXA 4EKZA 5IMFA 2V6KA 2YWIA 3HVXA 4EE0A 2OE3A 1A0FA 1O6JA 1F9MA 4V1Ap 1TXXA 2BJXA 4HZ2A 3ZREA 3GX8A 3WYWA 3GYKA 3ZMLA 4AJ8A 1PL2A 1JZWA 2NDOA 2MMOA 2WW0A 5ECLB 3KXOA 4EDYA 1O81A 1BG5A 3GUSA 3R3EA 4I2TA 2AUVA 1R4WA 1AC1A 4YKFA 3J7Yb 3UJ1A 2BTOT 2CVKA 2YOIA 2DJJA 2EFDA 3F3QA 5E4WA 1PFOA 4MA9A 2FY6A 4MMMA 5J4VA 2E2GA 1TRSA 3WT1A 1ERUA 5KN3A 4ILFA 2WVYA 2Z9SA 1EWXA 1Y6EA 5LD0A 4IHUA 1UC7A 5F0GA 1ZMAA 4O7HA 4ACSA 3DD3A 2LJAA 1GSFA 1XWKA 5ECRB 1ZYQB 1U87A 2EIOA 2R5GA 1XXUA 3VWWA 3GHAA 3UVTA 3D4MA 3GX0A 2I3YA 2GQLA 4TVEA 2C3TA 1PSQA 1ILOA 4N3ZA 3L9VA 1KNGA 2M72A 3VFIA 4KSMA 3UEMA 1YZXA 3ZTLA 2K8VA 3UMAA 2WVXA 5DJMA 4KCEA 1OAZA 2KHPA 5C00A 1FO5A 4ZL9A 2NPBA 4FIWA 3IV4A 3V1WA 5IMDA 1DE1A 5FT3A 4K7NA 5CAXA 2YZUA 4XIHA 1YQ1A 1VF1A 4BIKA 3GURA 3IHQA 2DMMA 5ECOB 4KDXA 4ICYA 1BX9A 5IMCA 3CQFA 3VWUA 4G10A 17GSA 2OKAA 3EURA 3LFLA 1K0OA 1PL1A 3MWHA 4OO5A 1V40A 3EMXA 5KEJA 1EP8A 1R26A 4MF6A 5C04A 4OD7A 2B7KA 4GF0A 1SJIA 2YV9A 1S3RA 1TKDB 4PNFA 1BQ7A 3DXBA 3KEBA 4MJEA 5HR3A 1EOHA 3KMOA 1OE8A 3HMJG 5DQSA 4AGSA 4FYUA 5JCWA 2NBSA 2LEGA 1MDJA 3A5IA 3Q6OA 2OT3A 3CRUA 3EMPA 2YNXA 3ZMKA 2VUPA 1WPIA 1G6YA 2EIQA 3IA1A 3IC8A 2IIYA 5GSSA 1Y1UA 4CY6A 1VRSD 5J9BA 1PD21 1URMA 2GGTA 4TR1B 3HJOA 4JU5A 2H30A 4KAEA 5B6MA 4PQIA 4YAPA 4JE1A 3IK9A 3TRQA 3HHVA 4KF9A 2R6KA 1AQXA 1B9XC 3GKNA 2GQKA 1QXHA 1X5CA 1ABAA 3LXZA 1UVZA
chains in the Genus database with same CATH topology
2X99A 1X9WB 5CRHA 2B7JA 3FMWA 4HU9A 3KIJA 3PGTA 5BRTA 3HXSA 3KH7A 2O89A 4TXVA 3OR5A 1GUHA 4L5LA 2C3NA 2A2RA 4KDYA 3F6DA 2OADA 2LJRA 1QUWA 4TRXA 2MYGA 5IOWA 2TRXA 1GSDA 1MDKA 4DEJA 4ID0A 2DJKA 4LL4B 1EEJA 5BMUA 4OCEA 4WXTA 1SL1B 2PPTA 4WR4A 1YKAA 4ECCA 3F6FA 2YWMA 2CAIA 1MD4A 1ZYEA 4YKGA 4QL9A 1AIUA 3IBHA 1SJ6A 4HEA2 1E6BA 2V32A 1HNBA 3SWLA 3E0UA 4PGTA 1EGOA 1JLWA 2HQTA 1G7OA 2BMXA 3IE3A 2KP1A 4TXOB 3EINA 2VL9A 1ERWA 2H75A 3F3RA 1N8JA 3CSIA 3IHGA 1SD8A 4KGIA 2HYXA 4GXZA 3QPMA 4K2DA 1XCCA 2WS2A 2B5EA 7GSSA 1DE2A 3UL3A 5G1LA 1OE7A 5INYA 2ON5A 2DKHA 5H5QA 4O5RA 1TP9A 2WJUA 1VF3A 4TR4A 1SKSB 3HY2A 4PUFC 2IJYA 4HUAA 3U6VA 1OC3A 1GTUA 3E3EA 1KTEA 5CREA 2HRKB 2QA2A 3LYKA 2HRNA 2HSNB 2QSIA 4EDZA 3RPPA 2VL2C 2JADA 1GL8A 4Q5FA 2TRCP 4CY8A 2JSYA 4EVMA 2YJHA 3BCKA 2LKUA 5GSTA 2LRTA 2O87A 2LTKA 3LQ7A 3QR6A 2XPEA 1EV9A 4L0UA 5J4YA 2DMLA 1GSYA 4NXIA 1XOBA 1XOAA 1T00A 3EU3A 14GSA 1SYXA 4AKHA 3MAKA 3FR3A 3GNJA 2X64A 2KOKA 4N11A 4N30A 3FY7A 4JBBA 4G19A 4NMUA 2DJ2A 4Z2TA 2IFQB 1SL0B 5DJLA 5A5HB 5JWOB 3L78A 4BVYB 4RI7A 3GMFA 3Q74A 3QCPA 3UIWA 2OBIA 3GTUB 4KA0A 2WFCA 5F05A 1PKZA 4MF7A 2IMKA 2C1YA 3ZRDA 3RPNA 6GSSA 2D2ZA 2ZNMA 4PQ1A 1I5GA 5B8BA 3GV1A 1TOFA 4EC0A 5LCZA 1OKDA 1ON4A 1U3IA 4MH2A 4NV2A 3ERWA 5CRWA 4PNGA 3TRPA 3ED3A 4XCSA 4NV5A 2DJ1A 3VPTA 2M80A 4HDEA 4KX4A 4POKA 2VOCA 4LMVA 3O3TA 2TIRA 5A4VA 1SVLA 18GSA 5G30A 2I9HA 2FA8A 19GSA 3M8NA 4O92A 4RI6A 1N2AA 2PWJA 2FWGA 2LSTA 4OO4A 4F2IA 2C0DA 2RIIA 2IWTA 1GNEA 3KTLA 2FWEA 4G2EA 3CSHA 2HE3A 1TK5B 4PX1A 4WF5A 1AXDA 1XW6A 3ZL5A 2AHEA 6GSXA 2P5RA 4G01A 1TK0B 4EUYA 1V57A 1XBSA 2HNLA 4Q5NA 1M2AA 3US3A 1TDIA 1A8LA 2WRTA 2DSAA 3QAVA 3ZLPA 2VM1A 2ES7A 2XHFA 2FLSA 4RQXA 4I5QA 1GSEA 5KN0A 2OE0A 4V1Ag 2LJKA 3LGCA 5D9VA 5DVBA 3GSSA 1M0UA 4O5QA 2K18A 3R2QA 5G2ZA 1J08A 5JWRB 2WZ9A 2OE1A 5ELGA 1EP7A 3UARA 3G7JA 2LUSA 2EC4A 1JFUA 3L4NA 1AUCA 4OFNA 2VLVA 3WD6A 1OC9A 2H1AA 2B3SA 1MTCA 1Z6NA 4IELA 5GAND 1UN2A 3IAM2 3D21A 3F4TA 4YH2A 5ECNB 2VL2A 4FH8A 3LWAA 4XRDA 1SKRB 4DVCA 3UAPA 1PMTA 5FWGA 5IPGA 2DIZA 2H71A 5DCGA 4G0LA 2K8SA 2HZEB 3FZ9A 1PKWA 22GSA 2FA4A 4Q5QA 2ALBA 4F82A 2GLRA 3QD9A 5F07A 3N9JA 4TR1A 4X0XA 5AN1A 4AJ7A 5IMVA 2VKZG 1THOA 2GT5A 2ZUPA 1OKTA 2GSSA 1FOVA 4XS1A 1IYHA 2IN3A 3TKQA 3ZVJD 4MDCA 5CO3A 3TJJA 3GIXA 1K0MA 4O5UA 2XC2A 3F9UA 1EGRA 3EU4A 1Q98A 5AGYA 4ML1A 4JRRA 1TU8A 3QFBC 4QQ7A 2KP2A 1SKWB 3I9V2 4BVXB 2ZCTA 5D8IA 1N25A 4BL7A 3CXGA 3ME8A 5J47A 2YCDA 4L0WA 4RUVA 1KBNA 3IK7A 2H6YA 1BEDA 3HYPA 1T3BA 5HQPA 3VI7A 1RQMA 4IP6A 3EWLA 3Q18A 4XTSA 4MJAA 1NW2A 3TUEA 1BAYA 4I8BA 3FW2A 1QGVA 4HZ4A 3HKRA 2CV4A 4Q5RA 2R0PA 2H6XA 4IJIA 3U5RE 1GTIA 4HOJA 2DKIA 6GSVA 3D0ZA 2YN1A 1WJKA 4IN0A 3VWXA 4YQMA 2VCQA 2VAFA 1O73A 4GRFA 1TRVA 2GDRA 1QFNA 4TXOA 4MJCA 1SU9A 5J5NA 4L8EA 2M46A 4AKXB 1WRYA 3ZFLA 2RM6A 2PN8A 5DALB 5A1NB 4FQUA 3GKXA 4W66A 4POBA 3IAS2 1NHOA 1XVWA 6GSUA 3CRTA 2RUEA 2PU9C 4KNDA 1AW9A 2H0HA 1GSSA 5IQYA 2GTUA 5A34A 1B9YC 3QAWA 1BF5A 1H4OA 1LBKA 3DMLA 3MSZA 1JZOA 4ISDA 1OC9B 2JL4A 2PVOC 5DDLA 3FR6A 4K8MA 4IGJA 5B6NA 4EXJA 2C0FA 4ZBDA 2GZZA 3J7Yk 5CP1A 3A5WA 3DVXA 5J41A 1V9WA 1S3CA 16GSA 2HRKA 2HLSA 3C71A 2HRFA 2HSNA 4BA7A 10GSA 5A4WA 3KJYA 3KGKA 3TKPA 3DKSA 2OJLA 5IPHA 2N5BA 4XHMA 2EFHA 1K0NA 2H6ZA 2ON7A 3GRXA 5F8BA 1FG4A 2EFEA 4H86A 1G6WA 4PUAA 4KUNA 1QMVA 3ZFBA 4WKWA 1G0TA 2B5XA 4HJMA 3TJKA 4PXOA 3UBLA 1XW5A 1SK2A 4GCIA 1V98A 4OCFA 4Z7XA 5ABRA 4POMA 1Z5YE 2HFDA 3FHKA 4BPYA 3LYPA 5IM9A 4BL7B 4X1UA 2OBKA 3IDVA 2H70A 1NM3A 4ZB7A 3ZZXA 1F37A 2IFQA 3D4TA 4X43A 5A5HA 3GH6A 1GUMA 4P3YB 5ECPB 4BVYA 2REMA 1K0CA 1RW1A 2B1KA 4O32A 1YY7A 2VCXA 2R4VA 2GZPA 1XWGA 3APOA 3G7YA 1R5AA 4WBJA 3NIVA 4A5PA 3E9JB 5CYYA 2H66A 3GTUA 4KE3A 4RQRA 1K3OA 3G7IA 2L6CA 4GDFA 4K2XA 2C0EA 2F8AA 2L6DA 5EPFA 1X9MB 4TR3A 4TOPA 2R3XA 3QAGA 3CYNA 3FRCA 2I1UA 2CX4A 4G9HA 4BWQA 3L9SA 5KN2A 4LA1A 1J0FA 2XBQA 2C80A 2FWFA 5DAKB 1VF4A 1SJZA 2H74A 3A3TA 5G31A 5A34B 5IMAA 2VLTA 2WDUA 3HZ8A 1R7HA 4XS4A 4XS6A 1RK4A 2DJ3A 5CRDA 3MYDA 1GTAA 2L5LA 2V2GA 3H93A 1XFLA 2C8UA 3CSJA 4JZQA 5CNWA 1M9BA 4N0ZA 1I9DA 2CX3A 1XWBA 4WEYA 3ME7A 2JZSA 1GTBA 2R37A 5AISA 2O5VA 2L5OA 4XRAA 1HQOA 3UVHA 3TKSC 3VURA 2DLXA 1XPVA 1EEMA 2YJ7A 2AYTA 3BJ5A 1Q4JA 5D9WA 2CQ9A 2KLXA 4NHZA 1Z7RA 2V6OA 3I6AA 3ERFA 4HQZA 2MBSA 4ECBA 2IMFA 4POLA 2DC5A 3SBCA 4NWYA 4KH7A 2H76A 3HVSA 1GNWA 2HZFA 2WCIA 2UZ8A 3HZ4A 3O6TA 5A5KA 2H72A 3GKKA 4YQUA 1K3LA 4USSA 3H8QA 3H79A 2H1GA 2J23A 4V2LA 3KZQA 2FWHA 2VD1A 2V41A 4AKIA 1JZDA 1ZCPA 4ZBAA 5G5EA 3I43A 3ZIVA 3HD5A 2DJ0A 3HCZA 3N5OA 1TI3A 4IS0A 2FGXA 5F06A 1V2AA 4MH3A 1X0RA 1O8XA 4G0IA 1PX7A 2CZ3A 2HZEA 2HSMB 3CWGA 3TKSE 1BG1A 4L5OA 1YF0A 2AV4A 1W89A 3A2XA 2R0GA 4HS1A 1F3BA 5IOXA 1GP1A 4IP1A 4PURA 3AY8A 3FK8A 1WP0A 1KEBA 1AQWA 1ERTA 1SD9A 4MJBA 5GAPD 4LMWA 1T1VA 3IR4A 2PGTA 2HT9A 3APQA 1WWJA 3KD0A 4I6XA 4F9ZA 4MZBA 2LNSA 1SVOA 5EL8A 3DWVA 2CVBA 3Q19A 3RAZA 5H5SA 5KN1A 5AIVA 5ECQB 1U3AA 3WGDA 3VLNA 4BVXA 3TGZA 3TJBA 5J3RA 2GSRA 4HI7A 3FZAA 2VO4A 1XWCA 2YWOA 1OYJA 1NHYA 5HR0A 3D6IA 2HSHA 1K0DA 2O7KA 2IMIA 4CDOA 1XIYA 1G7EA 1T4YA 4XS4B 3VPQA 4GWRA 4ZB8A 1MEKA 4IJ3A 3VI5A 5IIZA 1WMJA 3BD2A 4FYCA 5HR2A 1ZYNA 1PN9A 1Z7PA 3TDGA 1PA3A 2AJQB 4MNNA 3WT2A 3IRAA 4J57E 3HJPA 1PQNA 4ML6A 5J40A 4Z2RA 1Z3EA 5JCGA 2HXKA 4K9ZA 4QMKA 2MMAA 1U6TA 2N5FA 1K3YA 4IQAA 2P5QA 4WBRD 2NVLA 1SL2B 3FEUA 2CT6A 1A0RP 4ZXGA 5DALA 5A1NA 5EVOA 1SK0A 5E59A 3EYTA 1ZL9A 4JR6A 4TR0A 1A24A 1USBA 3TCOA 4TKYA 5ENUA 2LQQA 1SVMA 2C3QA 1X5DA 2LRCA 3F63A 1XW9A 3W8JA 4WETA 1GULA 1QQ2A 4J56E 5COHA 3L9UA 2JACA 1A2MA 2F3MA 4KSOA 5J9CA 1THXA 2GSQA 2A4HA 3TKSA 2CZ2A 2X8CA 1EZKA 5DQYA 3P2AA 1HYUA 3ISOA 2PMTA 1PRXA 5D9TA 5ELAA 1U88A 3VK9A 3ZYWA 4ZB9A 5KOXA 5IO2A 1FW1A 2H0GA 3GA4A 3NZNA 2HRAA 2YPMA 4IVFA 1PGTA 2YV7A 4YAVA 2EIRA 5ECIB 4DSRA 3KH9A 1T8EB 4DSQA 2VL3A 3O76A 1QK8A 2N5AA 4WR5A 2YZHA 2B6MA 1W4VA 1T4ZA 2MBTA 6GSWA 5H5RA 2F9SA 1ERVA 1A8YA 4FYBA 1FVKA 3F8UA 1YEPA 4KB3A 4HJ2A 2YANA 4PTSA 3C1SA 1NSWA 3PR8A 4GQFA 5ECKB 4N0VA 1SENA 2DIYA 1ZYPA 2WULA 5ID2B 4EIQA 3A2WA 2YP6A 2O85A 1O85A 4EF0A 1FB0A 4K7IA 1TI1A 1ML6A 2GZYA 3HA9A 3L0HA 1Z9HA 1FHEA 1GWCA 2J9HA 1ST9A 5G1KA 2L57A 1YJ6A 1MD3A 4MZWA 2MMNA 3P90A 3GN3A 2G2QA 4MK3A 1HNAA 5IMZA 2CAQA 3C73A 3HVVA 1FOHA 1PN0A 3JCML 2NTOA 5FHIA 4JR4A 2GSTA 4NHWA 3LG6A 3EE2A 2VLUA 3ZITA 3D22A 5DCHA 4F0CA 5DAKA 4EL1A 2L59A 4LL1B 1B4QA 5HFIA 2JU5A 4IW9A 4GSSA 4NAXA 1M2DA 2H19A 3TB2A 3VWVA 2B5YA 3TKRA 2X49A 1IYIA 4YQVA 2VCTA 3HJMA 5G5FA 6GSTA 1FAAA 1GLPA 3PINA 3EVIA 4TW5A 4Z2UA 2EFCA 2PUKC 3FZ5A 4X4JA 5HFKA 3S9FA 4E8HA 2F8FA 3FR9A 3ZVJA 2VM2A 5KOWA 3H4KA 1F6MC 5A4UA 1V58A 1ZOFA 1X9SB 4KW6A 2H1LA 4K0NA 2QGVA 1H75A 1TXUA 4I97A 2FD3A 1GRXA 3UOMA 1WOUA 2LQOA 1ZZYA 2YWNA 1FB6A 1K0BA 2LV3A 2RLIA 2PERA 4PQHA 3CTFA 3CBUA 2RM5A 4IKHA 1DBYA 1C72A 2QA1A 4AJ6A 6GSYA 5L71A 4EIPA 2KUCA 4HQSA 1YKCA 4OWYA 2H8LA 1A23A 2IMDA 1TK8B 4GSNA 3NOFA 4BWSA 3KP9A 2HSMA 5DBQA 20GSA 4V2NA 4FO5A 5D73A 3P7XA 2MMZA 1OVNA 2X8GA 3DGQA 4DSSA 2OA7A 5HR1A 3QMXA 3EC3A 4NPBA 4K5SA 1CQGA 9GSSA 3GL3A 3QOUA 1T7PB 4F0BA 1CQHA 1E2YA 1S3AA 1DUGA 1TRWA 5J4UA 2LRNA 5AIXA 1X5EA 4K6XA 1J9BA 3MDKA 11GSA 3APSA 3IC4A 3RHBA 3TJFA 5D9XA 3FZ4A 4GSTA 5B8AA 1GSUA 3IXRA 4GQCA 2XBIA 1SYRA 4ZIJA 3KP8A 4IBPA 3DVWA 4CHSA 3RHCA 3BBYA 4WF4A 2A4VA 3C1RA 4K5RA 1UA5A 5ECHB 2H1BA 2MZCA 5HFGA 4ECJA 2FUG2 4K7OA 1A2JA 2WB9A 2FCHA 5EY6A 1EOGA 4ULXA 1FVJA 3KCMA 5CRGA 4V2MA 3H1NA 2QC7A 2IMEA 3FYGA 4IQ1A 4MPGA 1BJXA 2E0QA 2JZRA 1M99A 3W6GA 3DIEA 2A2SA 2CVDA 2IL3A 2VD0A 4AKGA 2R2JA 1GSQA 3GH9A 1JZRA 3TU3B 3C8EA 4OFTA 5D93A 3D5JA 2PBJA 4OFMA 3KM6A 2E7PA 1EV4A 5B7CA 2GS3A 4ZILA 2VCWA 4D73A 4CW9A 2I4AA 3P8WA 1VGLA 3CMIA 2FHEA 4K1FA 3KMNA 2V1MA 2JZTA 3QFAC 4JEDA 2O8VB 3PPUA 4MP4A 5ECMB 2H1DA 1S3DA 3CTGA 2C4JA 4I2UA 1MDIA 2GT6A 3FKFA 1LJRA 2VCZA 3LJRA 3GKMA 2OACA 1AAZA 4KCAA 1O7UA 2VIMA 3QDNA 3MNGA 2UV8G 1TU7A 1OC8A 4MABA 3F0IA 4MLYA 1B8XA 4KDUA 3UBKA 12GSA 3LW9A 3ERGA 5IO0A 2K9FA 2GVPA 3C7MA 3PH9A 2QKEA 2K6VA 2C0GA 4E8EA 3EPTA 2DBCA 2I81A 4DSSB 4HU7A 2F51A 1Z6MA 2H73A 4TN8A 5JCUA 3TOUA 1WE0A 3LSZA 4LLRA 1LU4A 1VF2A 2X8HA 2P0GA 1YF1A 3A2VA 3F4RA 3DYRA 1XVQA 4MZCA 3TOTA 4AF2A 5BMUB 2X4AA 3F4SA 2H01A 2CA8A 3LXTA 2AB6A 4J2FA 1XZOA 2A2PA 3IOSA 3IPZA 2AAWA 5D96A 3RBTA 2L4QA 3LEFA 2JSZA 2HI7A 1M9AA 4AI6A 2G0FA 1YVLA 2P31A 4N10A 1A2LA 1TRUA 1B48A 1O8WA 4GTUA 2L4CA 1F3AA 1AQVA 4ZL7A 2WGRA 4E68A 1SK1A 3W8SA 3GSTA 5GZZB 3KTBA 1R5PA 1ACVA 1YDKA 3M9JA 3HDCA 1TTZA 4ZBBA 3TJGA 3LORA 5ID2A 1JHBA 4ZB6A 4F03A 3WGXA 1ZGNA 8GSSA 1TJDA 3DRNA 3G9BA 2GQMA 3M1GA 1HD2A 4ZL8A 3MIXA 4OMVA 4MF5A 3ZIJA 1GH2A 4ECIA 2VCVA 3RDWA 4EO3A 2FNOA 5LNKe 1GUKA 2H0IA 1JLVA 3BOAA 13GSA 4D73B 4GLTA 3GFKA 4QL7A 4K0GA 1BYEA 4G0KA 5JWQB 3WGEA 3M9KA 3TRXA 1HNCA 1Y25A 1WIKA 5ECSA 2HSYA 1XWAA 2LNTA 3K8NA 3M3MA 3I69A 1GLQA 1M7TA 2E2MA 1F2EA 2XPDA 2PVQA 1PX6A 2RUFA 3BCIA 4MPFA 4MCUA 1TW9A 2LS5A 1K0AA 3GL5A 2R0CA 2IPAA 2B1LA 3M0FA 1B4PA 3DEXA 1M2BA 1DSBA 1YEXA 4EKZA 5IMFA 2V6KA 2YWIA 3HVXA 4EE0A 2OE3A 1A0FA 1O6JA 1F9MA 4V1Ap 1TXXA 2BJXA 4HZ2A 3ZREA 3GX8A 3WYWA 3GYKA 3ZMLA 4AJ8A 1PL2A 1JZWA 2NDOA 2MMOA 5ECLB 3KXOA 4EDYA 1O81A 1BG5A 3GUSA 3R3EA 4I2TA 2AUVA 1R4WA 1AC1A 4YKFA 3J7Yb 3UJ1A 2BTOT 2CVKA 2YOIA 2DJJA 2EFDA 3F3QA 5E4WA 4MA9A 2FY6A 4MMMA 5J4VA 2E2GA 1TRSA 3WT1A 1ERUA 5KN3A 4ILFA 2Z9SA 1EWXA 1Y6EA 5LD0A 4IHUA 1UC7A 5F0GA 1ZMAA 4O7HA 4ACSA 3DD3A 2LJAA 1GSFA 1XWKA 5ECRB 1ZYQB 1U87A 2EIOA 2R5GA 1XXUA 3VWWA 3GHAA 3UVTA 3D4MA 3GX0A 2I3YA 2GQLA 4TVEA 2C3TA 1PSQA 1ILOA 4N3ZA 3L9VA 1KNGA 2M72A 3VFIA 4KSMA 3UEMA 1YZXA 3ZTLA 2K8VA 3UMAA 5DJMA 4KCEA 1OAZA 2KHPA 5C00A 1FO5A 4ZL9A 2NPBA 4FIWA 3IV4A 3V1WA 5IMDA 1DE1A 5FT3A 4K7NA 5CAXA 2YZUA 4XIHA 1YQ1A 1VF1A 3GURA 3IHQA 2DMMA 5ECOB 4KDXA 4ICYA 1BX9A 5IMCA 3VWUA 4G10A 17GSA 2OKAA 3EURA 3LFLA 1K0OA 1PL1A 3MWHA 4OO5A 1V40A 3EMXA 5KEJA 1EP8A 1R26A 4MF6A 5C04A 4OD7A 2B7KA 4GF0A 1SJIA 2YV9A 1TKDB 4PNFA 1BQ7A 3DXBA 3KEBA 4MJEA 5HR3A 1EOHA 3KMOA 1OE8A 3HMJG 5DQSA 4AGSA 4FYUA 5JCWA 2NBSA 2LEGA 1MDJA 3A5IA 3Q6OA 2OT3A 3CRUA 3EMPA 2YNXA 3ZMKA 2VUPA 1WPIA 1G6YA 2EIQA 3IA1A 3IC8A 2IIYA 5GSSA 1Y1UA 4CY6A 1VRSD 5J9BA 1PD21 1URMA 2GGTA 4TR1B 3HJOA 4JU5A 2H30A 4KAEA 5B6MA 4PQIA 4YAPA 4JE1A 3IK9A 3TRQA 3HHVA 4KF9A 2R6KA 1AQXA 1B9XC 3GKNA 2GQKA 1QXHA 1X5CA 1ABAA 3LXZA 1UVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X99 A;  1X9W B;  5CRH A;  2B7J A;  4HU9 A;  3KIJ A;  3PGT A;  3HXS A;  3KH7 A;  2O89 A;  4TXV A;  3OR5 A;  1GUH A;  4L5L A;  2C3N A;  2A2R A;  4KDY A;  3F6D A;  2OAD A;  2LJR A;  1QUW A;  4TRX A;  2MYG A;  5IOW A;  2TRX A;  1GSD A;  1MDK A;  4DEJ A;  4ID0 A;  2DJK A;  4LL4 B;  1EEJ A;  5BMU A;  4OCE A;  4WXT A;  1SL1 B;  2PPT A;  4WR4 A;  1YKA A;  4ECC A;  3F6F A;  2YWM A;  2CAI A;  1MD4 A;  1ZYE A;  4QL9 A;  1AIU A;  3IBH A;  1SJ6 A;  4HEA 2;  1E6B A;  2V32 A;  1HNB A;  3SWL A;  3E0U A;  4PGT A;  1EGO A;  1JLW A;  2HQT A;  1G7O A;  2BMX A;  3IE3 A;  2KP1 A;  4TXO B;  3EIN A;  2VL9 A;  1ERW A;  2H75 A;  3F3R A;  1N8J A;  3CSI A;  1SD8 A;  4KGI A;  2HYX A;  4GXZ A;  3QPM A;  4K2D A;  1XCC A;  2WS2 A;  2B5E A;  7GSS A;  1DE2 A;  3UL3 A;  5G1L A;  1OE7 A;  5INY A;  2ON5 A;  5H5Q A;  4O5R A;  1TP9 A;  2WJU A;  1VF3 A;  4TR4 A;  1SKS B;  3HY2 A;  4PUF C;  2IJY A;  4HUA A;  3U6V A;  1OC3 A;  1GTU A;  3E3E A;  1KTE A;  5CRE A;  2HRK B;  3LYK A;  2HRN A;  2HSN B;  2QSI A;  4EDZ A;  3RPP A;  2VL2 C;  2JAD A;  1GL8 A;  4Q5F A;  2TRC P;  2JSY A;  4EVM A;  2YJH A;  3BCK A;  2LKU A;  5GST A;  2LRT A;  2O87 A;  2LTK A;  3LQ7 A;  3QR6 A;  2XPE A;  1EV9 A;  4L0U A;  2DML A;  1GSY A;  4NXI A;  1XOB A;  1XOA A;  1T00 A;  3EU3 A;  14GS A;  1SYX A;  3MAK A;  3FR3 A;  3GNJ A;  2X64 A;  2KOK A;  4N11 A;  4N30 A;  3FY7 A;  4JBB A;  4G19 A;  4NMU A;  2DJ2 A;  2IFQ B;  1SL0 B;  5DJL A;  5JWO B;  3L78 A;  4BVY B;  4RI7 A;  3GMF A;  3Q74 A;  3QCP A;  3UIW A;  2OBI A;  3GTU B;  4KA0 A;  2WFC A;  5F05 A;  1PKZ A;  4MF7 A;  2IMK A;  2C1Y A;  3ZRD A;  3RPN A;  6GSS A;  2D2Z A;  2ZNM A;  4PQ1 A;  1I5G A;  5B8B A;  3GV1 A;  1TOF A;  4EC0 A;  5LCZ A;  1OKD A;  1ON4 A;  1U3I A;  4MH2 A;  4NV2 A;  3ERW A;  5CRW A;  4PNG A;  3TRP A;  3ED3 A;  4XCS A;  4NV5 A;  2DJ1 A;  3VPT A;  2M80 A;  4HDE A;  4KX4 A;  4POK A;  2VOC A;  4LMV A;  3O3T A;  2TIR A;  5A4V A;  18GS A;  5G30 A;  2I9H A;  2FA8 A;  19GS A;  3M8N A;  4O92 A;  4RI6 A;  1N2A A;  2PWJ A;  2FWG A;  2LST A;  4OO4 A;  4F2I A;  2C0D A;  2RII A;  2IWT A;  1GNE A;  3KTL A;  2FWE A;  4G2E A;  3CSH A;  2HE3 A;  1TK5 B;  4PX1 A;  4WF5 A;  1AXD A;  1XW6 A;  3ZL5 A;  2AHE A;  6GSX A;  2P5R A;  1TK0 B;  4EUY A;  1V57 A;  1XBS A;  2HNL A;  4Q5N A;  1M2A A;  3US3 A;  1TDI A;  1A8L A;  2WRT A;  2DSA A;  3QAV A;  3ZLP A;  2VM1 A;  2ES7 A;  2XHF A;  2FLS A;  4RQX A;  4I5Q A;  1GSE A;  5KN0 A;  2OE0 A;  4V1A g;  2LJK A;  3LGC A;  5D9V A;  5DVB A;  3GSS A;  1M0U A;  2K18 A;  3R2Q A;  5G2Z A;  1J08 A;  5JWR B;  2WZ9 A;  2OE1 A;  5ELG A;  1EP7 A;  3UAR A;  3G7J A;  2LUS A;  2EC4 A;  1JFU A;  3L4N A;  1AUC A;  4OFN A;  2VLV A;  3WD6 A;  1OC9 A;  2H1A A;  2B3S A;  1MTC A;  1Z6N A;  4IEL A;  5GAN D;  1UN2 A;  3IAM 2;  3D21 A;  3F4T A;  4YH2 A;  5ECN B;  2VL2 A;  4FH8 A;  3LWA A;  4XRD A;  1SKR B;  4DVC A;  3UAP A;  1PMT A;  5FWG A;  5IPG A;  2DIZ A;  2H71 A;  5DCG A;  4G0L A;  2K8S A;  2HZE B;  3FZ9 A;  1PKW A;  22GS A;  2FA4 A;  4Q5Q A;  2ALB A;  4F82 A;  2GLR A;  3QD9 A;  5F07 A;  3N9J A;  4TR1 A;  4X0X A;  5AN1 A;  4AJ7 A;  5IMV A;  1THO A;  2GT5 A;  2ZUP A;  1OKT A;  2GSS A;  1FOV A;  4XS1 A;  1IYH A;  2IN3 A;  3TKQ A;  3ZVJ D;  4MDC A;  5CO3 A;  3TJJ A;  3GIX A;  1K0M A;  2XC2 A;  3F9U A;  1EGR A;  3EU4 A;  1Q98 A;  5AGY A;  4ML1 A;  4JRR A;  1TU8 A;  3QFB C;  4QQ7 A;  2KP2 A;  1SKW B;  3I9V 2;  4BVX B;  2ZCT A;  5D8I A;  4BL7 A;  3CXG A;  3ME8 A;  2YCD A;  4L0W A;  4RUV A;  1KBN A;  3IK7 A;  2H6Y A;  1BED A;  3HYP A;  1T3B A;  5HQP A;  3VI7 A;  1RQM A;  4IP6 A;  3EWL A;  3Q18 A;  4XTS A;  4MJA A;  1NW2 A;  3TUE A;  1BAY A;  4I8B A;  3FW2 A;  1QGV A;  4HZ4 A;  3HKR A;  2CV4 A;  4Q5R A;  2H6X A;  4IJI A;  3U5R E;  1GTI A;  4HOJ A;  6GSV A;  3D0Z A;  2YN1 A;  1WJK A;  4IN0 A;  3VWX A;  4YQM A;  2VCQ A;  2VAF A;  1O73 A;  4GRF A;  1TRV A;  2GDR A;  1QFN A;  4TXO A;  4MJC A;  1SU9 A;  5J5N A;  4L8E A;  2M46 A;  1WRY A;  3ZFL A;  2RM6 A;  2PN8 A;  5DAL B;  4FQU A;  3GKX A;  4POB A;  3IAS 2;  1NHO A;  1XVW A;  6GSU A;  3CRT A;  2RUE A;  2PU9 C;  4KND A;  1AW9 A;  2H0H A;  1GSS A;  5IQY A;  2GTU A;  1B9Y C;  3QAW A;  1H4O A;  1LBK A;  3DML A;  3MSZ A;  1JZO A;  4ISD A;  1OC9 B;  2JL4 A;  2PVO C;  5DDL A;  3FR6 A;  4K8M A;  4IGJ A;  5B6N A;  4EXJ A;  2C0F A;  4ZBD A;  2GZZ A;  3J7Y k;  5CP1 A;  3A5W A;  3DVX A;  5J41 A;  1V9W A;  1S3C A;  16GS A;  2HRK A;  2HLS A;  3C71 A;  2HRF A;  4BA7 A;  10GS A;  5A4W A;  3KJY A;  3KGK A;  3TKP A;  3DKS A;  2OJL A;  5IPH A;  2N5B A;  4XHM A;  1K0N A;  2H6Z A;  2ON7 A;  3GRX A;  5F8B A;  1FG4 A;  4H86 A;  1G6W A;  4PUA A;  4KUN A;  1QMV A;  3ZFB A;  4WKW A;  1G0T A;  2B5X A;  4HJM A;  3TJK A;  4PXO A;  3UBL A;  1XW5 A;  1SK2 A;  4GCI A;  1V98 A;  4OCF A;  4Z7X A;  5ABR A;  4POM A;  1Z5Y E;  2HFD A;  3FHK A;  4BPY A;  3LYP A;  5IM9 A;  4BL7 B;  4X1U A;  2OBK A;  3IDV A;  2H70 A;  1NM3 A;  3ZZX A;  1F37 A;  2IFQ A;  3D4T A;  4X43 A;  3GH6 A;  1GUM A;  4P3Y B;  5ECP B;  4BVY A;  2REM A;  1K0C A;  1RW1 A;  2B1K A;  4O32 A;  1YY7 A;  2VCX A;  2R4V A;  2GZP A;  1XWG A;  3APO A;  3G7Y A;  1R5A A;  4WBJ A;  3NIV A;  3E9J B;  5CYY A;  2H66 A;  3GTU A;  4KE3 A;  4RQR A;  1K3O A;  3G7I A;  2L6C A;  2C0E A;  2F8A A;  2L6D A;  5EPF A;  1X9M B;  4TR3 A;  4TOP A;  2R3X A;  3QAG A;  3CYN A;  3FRC A;  2I1U A;  2CX4 A;  4G9H A;  4BWQ A;  3L9S A;  5KN2 A;  4LA1 A;  1J0F A;  2XBQ A;  2C80 A;  2FWF A;  5DAK B;  1VF4 A;  1SJZ A;  2H74 A;  3A3T A;  5G31 A;  5IMA A;  2VLT A;  2WDU A;  3HZ8 A;  1R7H A;  4XS4 A;  4XS6 A;  1RK4 A;  2DJ3 A;  5CRD A;  1GTA A;  2L5L A;  2V2G A;  3H93 A;  1XFL A;  2C8U A;  3CSJ A;  4JZQ A;  5CNW A;  1M9B A;  4N0Z A;  1I9D A;  2CX3 A;  1XWB A;  4WEY A;  3ME7 A;  2JZS A;  1GTB A;  2R37 A;  5AIS A;  2L5O A;  4XRA A;  1HQO A;  3UVH A;  3TKS C;  3VUR A;  2DLX A;  1XPV A;  1EEM A;  2YJ7 A;  2AYT A;  3BJ5 A;  1Q4J A;  5D9W A;  2CQ9 A;  2KLX A;  4NHZ A;  1Z7R A;  2V6O A;  3I6A A;  3ERF A;  4HQZ A;  2MBS A;  4ECB A;  2IMF A;  4POL A;  2DC5 A;  3SBC A;  4NWY A;  4KH7 A;  2H76 A;  3HVS A;  1GNW A;  2HZF A;  2WCI A;  2UZ8 A;  3HZ4 A;  3O6T A;  5A5K A;  2H72 A;  3GKK A;  4YQU A;  1K3L A;  4USS A;  3H8Q A;  3H79 A;  2H1G A;  2J23 A;  4V2L A;  3KZQ A;  2FWH A;  2VD1 A;  2V41 A;  1JZD A;  1ZCP A;  4ZBA A;  5G5E A;  3I43 A;  3ZIV A;  3HD5 A;  2DJ0 A;  3HCZ A;  3N5O A;  1TI3 A;  4IS0 A;  2FGX A;  5F06 A;  1V2A A;  4MH3 A;  1X0R A;  1O8X A;  4G0I A;  1PX7 A;  2CZ3 A;  2HZE A;  2HSM B;  3TKS E;  4L5O A;  1YF0 A;  2AV4 A;  1W89 A;  3A2X A;  4HS1 A;  1F3B A;  5IOX A;  1GP1 A;  4IP1 A;  4PUR A;  3AY8 A;  3FK8 A;  1WP0 A;  1KEB A;  1AQW A;  1ERT A;  1SD9 A;  4MJB A;  5GAP D;  4LMW A;  1T1V A;  3IR4 A;  2PGT A;  2HT9 A;  3APQ A;  1WWJ A;  3KD0 A;  4I6X A;  4F9Z A;  4MZB A;  2LNS A;  5EL8 A;  3DWV A;  2CVB A;  3Q19 A;  3RAZ A;  5H5S A;  5KN1 A;  5AIV A;  5ECQ B;  1U3A A;  3WGD A;  3VLN A;  4BVX A;  3TGZ A;  3TJB A;  5J3R A;  2GSR A;  4HI7 A;  3FZA A;  2VO4 A;  1XWC A;  2YWO A;  1OYJ A;  1NHY A;  5HR0 A;  3D6I A;  2HSH A;  1K0D A;  2O7K A;  2IMI A;  4CDO A;  1XIY A;  1G7E A;  1T4Y A;  4XS4 B;  3VPQ A;  4GWR A;  4ZB8 A;  1MEK A;  4IJ3 A;  3VI5 A;  5IIZ A;  1WMJ A;  3BD2 A;  4FYC A;  5HR2 A;  1PN9 A;  1Z7P A;  3TDG A;  1PA3 A;  2AJQ B;  3WT2 A;  3IRA A;  4J57 E;  3HJP A;  1PQN A;  4ML6 A;  1Z3E A;  5JCG A;  2HXK A;  4K9Z A;  2MMA A;  1U6T A;  2N5F A;  1K3Y A;  4IQA A;  2P5Q A;  4WBR D;  2NVL A;  1SL2 B;  3FEU A;  2CT6 A;  1A0R P;  4ZXG A;  5DAL A;  5EVO A;  1SK0 A;  5E59 A;  3EYT A;  1ZL9 A;  4JR6 A;  4TR0 A;  1A24 A;  1USB A;  3TCO A;  4TKY A;  5ENU A;  2LQQ A;  2C3Q A;  1X5D A;  2LRC A;  3F63 A;  1XW9 A;  3W8J A;  4WET A;  1GUL A;  1QQ2 A;  4J56 E;  5COH A;  3L9U A;  2JAC A;  1A2M A;  2F3M A;  4KSO A;  5J9C A;  1THX A;  2GSQ A;  3TKS A;  2CZ2 A;  2X8C A;  1EZK A;  5DQY A;  3P2A A;  1HYU A;  3ISO A;  2PMT A;  1PRX A;  5D9T A;  5ELA A;  1U88 A;  3VK9 A;  3ZYW A;  4ZB9 A;  5IO2 A;  1FW1 A;  2H0G A;  3GA4 A;  3NZN A;  2HRA A;  2YPM A;  4IVF A;  1PGT A;  2YV7 A;  4YAV A;  2EIR A;  5ECI B;  4DSR A;  3KH9 A;  1T8E B;  4DSQ A;  2VL3 A;  3O76 A;  1QK8 A;  2N5A A;  4WR5 A;  2YZH A;  2B6M A;  1W4V A;  1T4Z A;  2MBT A;  6GSW A;  5H5R A;  2F9S A;  1ERV A;  1A8Y A;  4FYB A;  1FVK A;  3F8U A;  1YEP A;  4KB3 A;  4HJ2 A;  2YAN A;  4PTS A;  3C1S A;  1NSW A;  3PR8 A;  4GQF A;  5ECK B;  4N0V A;  1SEN A;  2DIY A;  5ID2 B;  2WUL A;  3A2W A;  2YP6 A;  2O85 A;  1O85 A;  4EF0 A;  1FB0 A;  4K7I A;  1TI1 A;  1ML6 A;  2GZY A;  3HA9 A;  3L0H A;  1Z9H A;  1FHE A;  1GWC A;  2J9H A;  1ST9 A;  5G1K A;  2L57 A;  1YJ6 A;  1MD3 A;  4MZW A;  2MMN A;  3P90 A;  3GN3 A;  2G2Q A;  4MK3 A;  1HNA A;  5IMZ A;  2CAQ A;  3C73 A;  3HVV A;  3JCM L;  2NTO A;  5FHI A;  4JR4 A;  2GST A;  4NHW A;  3LG6 A;  3EE2 A;  2VLU A;  3ZIT A;  3D22 A;  5DCH A;  4F0C A;  5DAK A;  4EL1 A;  2L59 A;  4LL1 B;  1B4Q A;  5HFI A;  2JU5 A;  4IW9 A;  4GSS A;  4NAX A;  1M2D A;  2H19 A;  3TB2 A;  3VWV A;  2B5Y A;  3TKR A;  1IYI A;  4YQV A;  2VCT A;  3HJM A;  5G5F A;  6GST A;  1FAA A;  1GLP A;  3PIN A;  3EVI A;  4TW5 A;  2PUK C;  3FZ5 A;  5HFK A;  3S9F A;  4E8H A;  2F8F A;  3FR9 A;  3ZVJ A;  2VM2 A;  3H4K A;  1F6M C;  5A4U A;  1V58 A;  1ZOF A;  1X9S B;  4KW6 A;  4K0N A;  2QGV A;  1H75 A;  4I97 A;  2FD3 A;  1GRX A;  3UOM A;  1WOU A;  2LQO A;  1ZZY A;  2YWN A;  1FB6 A;  1K0B A;  2LV3 A;  2RLI A;  2PER A;  4PQH A;  3CTF A;  3CBU A;  2RM5 A;  4IKH A;  1DBY A;  1C72 A;  4AJ6 A;  6GSY A;  5L71 A;  2KUC A;  4HQS A;  1YKC A;  4OWY A;  2H8L A;  1A23 A;  2IMD A;  1TK8 B;  4GSN A;  3NOF A;  4BWS A;  3KP9 A;  2HSM A;  5DBQ A;  20GS A;  4V2N A;  4FO5 A;  5D73 A;  3P7X A;  2MMZ A;  1OVN A;  2X8G A;  3DGQ A;  4DSS A;  2OA7 A;  5HR1 A;  3QMX A;  3EC3 A;  4NPB A;  1CQG A;  9GSS A;  3GL3 A;  3QOU A;  1T7P B;  4F0B A;  1CQH A;  1E2Y A;  1S3A A;  1DUG A;  1TRW A;  5J4U A;  2LRN A;  5AIX A;  1X5E A;  4K6X A;  1J9B A;  3MDK A;  11GS A;  3APS A;  3IC4 A;  3RHB A;  3TJF A;  5D9X A;  3FZ4 A;  4GST A;  5B8A A;  1GSU A;  3IXR A;  4GQC A;  2XBI A;  1SYR A;  4ZIJ A;  3KP8 A;  4IBP A;  3DVW A;  4CHS A;  3RHC A;  3BBY A;  4WF4 A;  2A4V A;  3C1R A;  1UA5 A;  5ECH B;  2H1B A;  2MZC A;  5HFG A;  4ECJ A;  2FUG 2;  4K7O A;  1A2J A;  2WB9 A;  2FCH A;  5EY6 A;  1EOG A;  4ULX A;  1FVJ A;  3KCM A;  5CRG A;  4V2M A;  3H1N A;  2QC7 A;  2IME A;  3FYG A;  4IQ1 A;  4MPG A;  1BJX A;  2E0Q A;  2JZR A;  1M99 A;  3W6G A;  3DIE A;  2A2S A;  2CVD A;  2IL3 A;  2VD0 A;  2R2J A;  1GSQ A;  3GH9 A;  1JZR A;  3C8E A;  4OFT A;  5D93 A;  3D5J A;  2PBJ A;  4OFM A;  3KM6 A;  2E7P A;  1EV4 A;  5B7C A;  2GS3 A;  4ZIL A;  2VCW A;  4D73 A;  4CW9 A;  2I4A A;  3P8W A;  1VGL A;  3CMI A;  2FHE A;  4K1F A;  3KMN A;  2V1M A;  2JZT A;  3QFA C;  4JED A;  2O8V B;  3PPU A;  4MP4 A;  5ECM B;  2H1D A;  1S3D A;  3CTG A;  2C4J A;  4I2U A;  1MDI A;  2GT6 A;  3FKF A;  1LJR A;  2VCZ A;  3LJR A;  3GKM A;  2OAC A;  1AAZ A;  4KCA A;  1O7U A;  2VIM A;  3QDN A;  3MNG A;  1TU7 A;  1OC8 A;  4MAB A;  3F0I A;  4MLY A;  1B8X A;  4KDU A;  3UBK A;  12GS A;  3ERG A;  5IO0 A;  2K9F A;  2GVP A;  3C7M A;  3PH9 A;  2QKE A;  2K6V A;  2C0G A;  4E8E A;  2DBC A;  2I81 A;  4DSS B;  4HU7 A;  2F51 A;  1Z6M A;  2H73 A;  4TN8 A;  5JCU A;  3TOU A;  1WE0 A;  3LSZ A;  4LLR A;  1LU4 A;  1VF2 A;  2X8H A;  2P0G A;  1YF1 A;  3A2V A;  3F4R A;  3DYR A;  1XVQ A;  4MZC A;  3TOT A;  4AF2 A;  3F4S A;  2H01 A;  2CA8 A;  3LXT A;  2AB6 A;  4J2F A;  1XZO A;  3IOS A;  3IPZ A;  2AAW A;  5D96 A;  3RBT A;  2L4Q A;  3LEF A;  2JSZ A;  2HI7 A;  1M9A A;  2G0F A;  2P31 A;  4N10 A;  1A2L A;  1TRU A;  1B48 A;  1O8W A;  4GTU A;  2L4C A;  1F3A A;  1AQV A;  4ZL7 A;  2WGR A;  1SK1 A;  3W8S A;  3GST A;  5GZZ B;  3KTB A;  1R5P A;  1ACV A;  1YDK A;  3M9J A;  3HDC A;  1TTZ A;  4ZBB A;  3TJG A;  3LOR A;  5ID2 A;  1JHB A;  4ZB6 A;  4F03 A;  3WGX A;  1ZGN A;  8GSS A;  1TJD A;  3DRN A;  3G9B A;  2GQM A;  3M1G A;  1HD2 A;  4ZL8 A;  4OMV A;  4MF5 A;  3ZIJ A;  1GH2 A;  4ECI A;  2VCV A;  3RDW A;  4EO3 A;  2FNO A;  5LNK e;  1GUK A;  2H0I A;  1JLV A;  3BOA A;  13GS A;  4D73 B;  4GLT A;  3GFK A;  4QL7 A;  4K0G A;  1BYE A;  4G0K A;  5JWQ B;  3WGE A;  3M9K A;  3TRX A;  1HNC A;  1Y25 A;  1WIK A;  5ECS A;  2HSY A;  1XWA A;  2LNT A;  3K8N A;  3M3M A;  3I69 A;  1GLQ A;  1M7T A;  2E2M A;  1F2E A;  2XPD A;  2PVQ A;  1PX6 A;  2RUF A;  3BCI A;  4MPF A;  4MCU A;  1TW9 A;  2LS5 A;  1K0A A;  3GL5 A;  2IPA A;  2B1L A;  3M0F A;  1B4P A;  3DEX A;  1M2B A;  1DSB A;  1YEX A;  4EKZ A;  5IMF A;  2V6K A;  2YWI A;  3HVX A;  4EE0 A;  2OE3 A;  1A0F A;  1O6J A;  1F9M A;  4V1A p;  1TXX A;  2BJX A;  4HZ2 A;  3ZRE A;  3GX8 A;  3WYW A;  3GYK A;  3ZML A;  4AJ8 A;  1PL2 A;  1JZW A;  2NDO A;  2MMO A;  5ECL B;  3KXO A;  4EDY A;  1O81 A;  1BG5 A;  3GUS A;  3R3E A;  4I2T A;  2AUV A;  1R4W A;  1AC1 A;  3J7Y b;  3UJ1 A;  2BTO T;  2CVK A;  2YOI A;  2DJJ A;  3F3Q A;  5E4W A;  4MA9 A;  2FY6 A;  4MMM A;  2E2G A;  1TRS A;  3WT1 A;  1ERU A;  5KN3 A;  4ILF A;  2Z9S A;  1EWX A;  1Y6E A;  5LD0 A;  4IHU A;  1UC7 A;  5F0G A;  1ZMA A;  4O7H A;  4ACS A;  3DD3 A;  2LJA A;  1GSF A;  1XWK A;  5ECR B;  1ZYQ B;  1U87 A;  2EIO A;  2R5G A;  1XXU A;  3VWW A;  3GHA A;  3UVT A;  3D4M A;  3GX0 A;  2I3Y A;  2GQL A;  4TVE A;  2C3T A;  1PSQ A;  1ILO A;  3L9V A;  1KNG A;  2M72 A;  3VFI A;  4KSM A;  3UEM A;  1YZX A;  3ZTL A;  2K8V A;  3UMA A;  5DJM A;  4KCE A;  1OAZ A;  2KHP A;  5C00 A;  1FO5 A;  4ZL9 A;  2NPB A;  4FIW A;  3IV4 A;  3V1W A;  5IMD A;  1DE1 A;  5FT3 A;  4K7N A;  5CAX A;  2YZU A;  4XIH A;  1YQ1 A;  1VF1 A;  3GUR A;  3IHQ A;  2DMM A;  5ECO B;  4KDX A;  1BX9 A;  5IMC A;  3VWU A;  4G10 A;  17GS A;  2OKA A;  3EUR A;  3LFL A;  1K0O A;  1PL1 A;  3MWH A;  4OO5 A;  1V40 A;  3EMX A;  5KEJ A;  1EP8 A;  1R26 A;  4MF6 A;  5C04 A;  4OD7 A;  2B7K A;  4GF0 A;  1SJI A;  2YV9 A;  1TKD B;  4PNF A;  1BQ7 A;  3DXB A;  3KEB A;  4MJE A;  5HR3 A;  1EOH A;  3KMO A;  1OE8 A;  5DQS A;  4AGS A;  4FYU A;  5JCW A;  2NBS A;  2LEG A;  1MDJ A;  3Q6O A;  3CRU A;  3EMP A;  2YNX A;  3ZMK A;  2VUP A;  1WPI A;  1G6Y A;  2EIQ A;  3IA1 A;  3IC8 A;  2IIY A;  5GSS A;  1VRS D;  5J9B A;  1PD2 1;  1URM A;  2GGT A;  4TR1 B;  3HJO A;  4JU5 A;  2H30 A;  4KAE A;  5B6M A;  4PQI A;  4YAP A;  4JE1 A;  3IK9 A;  3TRQ A;  3HHV A;  4KF9 A;  2R6K A;  1AQX A;  1B9X C;  3GKN A;  2GQK A;  1QXH A;  1X5C A;  1ABA A;  3LXZ A;  1UVZ A; 
#chains in the Genus database with same CATH topology
 2X99 A;  1X9W B;  5CRH A;  2B7J A;  3FMW A;  4HU9 A;  3KIJ A;  3PGT A;  5BRT A;  3HXS A;  3KH7 A;  2O89 A;  4TXV A;  3OR5 A;  1GUH A;  4L5L A;  2C3N A;  2A2R A;  4KDY A;  3F6D A;  2OAD A;  2LJR A;  1QUW A;  4TRX A;  2MYG A;  5IOW A;  2TRX A;  1GSD A;  1MDK A;  4DEJ A;  4ID0 A;  2DJK A;  4LL4 B;  1EEJ A;  5BMU A;  4OCE A;  4WXT A;  1SL1 B;  2PPT A;  4WR4 A;  1YKA A;  4ECC A;  3F6F A;  2YWM A;  2CAI A;  1MD4 A;  1ZYE A;  4YKG A;  4QL9 A;  1AIU A;  3IBH A;  1SJ6 A;  4HEA 2;  1E6B A;  2V32 A;  1HNB A;  3SWL A;  3E0U A;  4PGT A;  1EGO A;  1JLW A;  2HQT A;  1G7O A;  2BMX A;  3IE3 A;  2KP1 A;  4TXO B;  3EIN A;  2VL9 A;  1ERW A;  2H75 A;  3F3R A;  1N8J A;  3CSI A;  3IHG A;  1SD8 A;  4KGI A;  2HYX A;  4GXZ A;  3QPM A;  4K2D A;  1XCC A;  2WS2 A;  2B5E A;  7GSS A;  1DE2 A;  3UL3 A;  5G1L A;  1OE7 A;  5INY A;  2ON5 A;  2DKH A;  5H5Q A;  4O5R A;  1TP9 A;  2WJU A;  1VF3 A;  4TR4 A;  1SKS B;  3HY2 A;  4PUF C;  2IJY A;  4HUA A;  3U6V A;  1OC3 A;  1GTU A;  3E3E A;  1KTE A;  5CRE A;  2HRK B;  2QA2 A;  3LYK A;  2HRN A;  2HSN B;  2QSI A;  4EDZ A;  3RPP A;  2VL2 C;  2JAD A;  1GL8 A;  4Q5F A;  2TRC P;  4CY8 A;  2JSY A;  4EVM A;  2YJH A;  3BCK A;  2LKU A;  5GST A;  2LRT A;  2O87 A;  2LTK A;  3LQ7 A;  3QR6 A;  2XPE A;  1EV9 A;  4L0U A;  5J4Y A;  2DML A;  1GSY A;  4NXI A;  1XOB A;  1XOA A;  1T00 A;  3EU3 A;  14GS A;  1SYX A;  4AKH A;  3MAK A;  3FR3 A;  3GNJ A;  2X64 A;  2KOK A;  4N11 A;  4N30 A;  3FY7 A;  4JBB A;  4G19 A;  4NMU A;  2DJ2 A;  4Z2T A;  2IFQ B;  1SL0 B;  5DJL A;  5A5H B;  5JWO B;  3L78 A;  4BVY B;  4RI7 A;  3GMF A;  3Q74 A;  3QCP A;  3UIW A;  2OBI A;  3GTU B;  4KA0 A;  2WFC A;  5F05 A;  1PKZ A;  4MF7 A;  2IMK A;  2C1Y A;  3ZRD A;  3RPN A;  6GSS A;  2D2Z A;  2ZNM A;  4PQ1 A;  1I5G A;  5B8B A;  3GV1 A;  1TOF A;  4EC0 A;  5LCZ A;  1M3J A;  1OKD A;  1ON4 A;  1U3I A;  4MH2 A;  4NV2 A;  2WW2 A;  3ERW A;  5CRW A;  4PNG A;  3TRP A;  3ED3 A;  4XCS A;  4NV5 A;  2DJ1 A;  3VPT A;  2M80 A;  4HDE A;  4KX4 A;  4POK A;  2VOC A;  4LMV A;  3O3T A;  2TIR A;  5A4V A;  1SVL A;  18GS A;  5G30 A;  2I9H A;  2FA8 A;  19GS A;  3M8N A;  4O92 A;  4RI6 A;  1N2A A;  2PWJ A;  2FWG A;  2LST A;  4OO4 A;  4F2I A;  2C0D A;  2RII A;  2IWT A;  1GNE A;  3KTL A;  2FWE A;  4G2E A;  3CSH A;  2HE3 A;  1TK5 B;  4PX1 A;  4WF5 A;  1AXD A;  1XW6 A;  3ZL5 A;  2AHE A;  6GSX A;  2P5R A;  4G01 A;  1TK0 B;  4EUY A;  1V57 A;  1XBS A;  2HNL A;  4Q5N A;  1M2A A;  3US3 A;  1TDI A;  1YEW C;  1A8L A;  2WRT A;  2DSA A;  3QAV A;  3ZLP A;  2VM1 A;  2ES7 A;  2XHF A;  2FLS A;  4RQX A;  4I5Q A;  1GSE A;  5KN0 A;  2OE0 A;  4V1A g;  2LJK A;  3LGC A;  2WW1 A;  5D9V A;  5DVB A;  3GSS A;  1M0U A;  4O5Q A;  2K18 A;  3R2Q A;  5G2Z A;  1J08 A;  5JWR B;  2WZ9 A;  2OE1 A;  5ELG A;  1EP7 A;  3UAR A;  3G7J A;  2LUS A;  2EC4 A;  1JFU A;  3L4N A;  1AUC A;  4OFN A;  2VLV A;  3WD6 A;  1OC9 A;  2H1A A;  2B3S A;  1MTC A;  1Z6N A;  4IEL A;  5GAN D;  1UN2 A;  3IAM 2;  3D21 A;  3F4T A;  4YH2 A;  5ECN B;  2VL2 A;  4FH8 A;  3LWA A;  4XRD A;  1SKR B;  4DVC A;  3UAP A;  1PMT A;  5FWG A;  5IPG A;  2DIZ A;  2H71 A;  5DCG A;  4G0L A;  2K8S A;  2HZE B;  3FZ9 A;  1PKW A;  22GS A;  2FA4 A;  4Q5Q A;  2ALB A;  4F82 A;  2GLR A;  3QD9 A;  5F07 A;  3N9J A;  4TR1 A;  4X0X A;  5AN1 A;  4AJ7 A;  4HSC X;  5IMV A;  2VKZ G;  1THO A;  2GT5 A;  2ZUP A;  1OKT A;  2GSS A;  1FOV A;  4XS1 A;  1IYH A;  2IN3 A;  3TKQ A;  3ZVJ D;  4MDC A;  5CO3 A;  3TJJ A;  3GIX A;  1K0M A;  4O5U A;  2XC2 A;  3F9U A;  1EGR A;  3EU4 A;  1Q98 A;  5AGY A;  4ML1 A;  4JRR A;  1TU8 A;  3QFB C;  4QQ7 A;  2KP2 A;  1SKW B;  3I9V 2;  4BVX B;  2ZCT A;  5D8I A;  1N25 A;  4BL7 A;  3CXG A;  3ME8 A;  5J47 A;  1I1I P;  2YCD A;  4L0W A;  4RUV A;  1KBN A;  3IK7 A;  2H6Y A;  1BED A;  3HYP A;  1T3B A;  5HQP A;  3VI7 A;  1RQM A;  4IP6 A;  3EWL A;  3Q18 A;  4XTS A;  4MJA A;  1NW2 A;  3TUE A;  1BAY A;  4I8B A;  3FW2 A;  1QGV A;  4HZ4 A;  3HKR A;  2CV4 A;  4Q5R A;  2R0P A;  2H6X A;  4IJI A;  3U5R E;  1GTI A;  4HOJ A;  2DKI A;  6GSV A;  3D0Z A;  2YN1 A;  1WJK A;  4IN0 A;  3VWX A;  4YQM A;  2VCQ A;  2VAF A;  1O73 A;  4GRF A;  1TRV A;  2GDR A;  1QFN A;  4TXO A;  4MJC A;  1SU9 A;  5J5N A;  4L8E A;  2M46 A;  4AKX B;  1WRY A;  3ZFL A;  2RM6 A;  2PN8 A;  5DAL B;  5A1N B;  4FQU A;  3GKX A;  4W66 A;  4POB A;  3IAS 2;  1NHO A;  1XVW A;  6GSU A;  3CRT A;  2RUE A;  2PU9 C;  4KND A;  1AW9 A;  2H0H A;  1GSS A;  5IQY A;  2GTU A;  5A34 A;  1B9Y C;  3QAW A;  1BF5 A;  1H4O A;  1LBK A;  3DML A;  3MSZ A;  1JZO A;  4ISD A;  1OC9 B;  2JL4 A;  2PVO C;  5DDL A;  3FR6 A;  4K8M A;  4IGJ A;  5B6N A;  4EXJ A;  2C0F A;  4ZBD A;  2GZZ A;  3J7Y k;  5CP1 A;  3A5W A;  3DVX A;  5J41 A;  1V9W A;  1S3C A;  16GS A;  2HRK A;  2HLS A;  3C71 A;  2HRF A;  2HSN A;  4BA7 A;  10GS A;  5A4W A;  3KJY A;  3KGK A;  3TKP A;  3DKS A;  2OJL A;  5IPH A;  2N5B A;  4XHM A;  2EFH A;  1K0N A;  2H6Z A;  2ON7 A;  3GRX A;  5F8B A;  1FG4 A;  2EFE A;  4H86 A;  1G6W A;  4PUA A;  4KUN A;  4PI0 C;  1QMV A;  3ZFB A;  4WKW A;  1G0T A;  2B5X A;  4HJM A;  3TJK A;  4PXO A;  3UBL A;  1XW5 A;  1SK2 A;  4GCI A;  1V98 A;  4OCF A;  4Z7X A;  5ABR A;  4POM A;  1Z5Y E;  2HFD A;  3FHK A;  4BPY A;  3LYP A;  5IM9 A;  4BL7 B;  4X1U A;  2OBK A;  3IDV A;  2H70 A;  1NM3 A;  4ZB7 A;  3ZZX A;  1F37 A;  2IFQ A;  3D4T A;  4X43 A;  5A5H A;  3GH6 A;  1GUM A;  4P3Y B;  5ECP B;  4BVY A;  2REM A;  1K0C A;  1RW1 A;  2B1K A;  4O32 A;  1YY7 A;  2VCX A;  2R4V A;  2GZP A;  1XWG A;  3APO A;  3G7Y A;  1R5A A;  4WBJ A;  3NIV A;  4A5P A;  3E9J B;  5CYY A;  2H66 A;  3GTU A;  4KE3 A;  4RQR A;  1K3O A;  3G7I A;  2L6C A;  4GDF A;  4K2X A;  2C0E A;  2F8A A;  2L6D A;  5EPF A;  1X9M B;  4TR3 A;  4TOP A;  2R3X A;  3QAG A;  3CYN A;  3FRC A;  2I1U A;  2CX4 A;  3CHX C;  4G9H A;  4BWQ A;  3L9S A;  5KN2 A;  4LA1 A;  1J0F A;  2XBQ A;  2C80 A;  2FWF A;  5DAK B;  1VF4 A;  1SJZ A;  2H74 A;  3A3T A;  5G31 A;  5A34 B;  5IMA A;  2VLT A;  2WDU A;  3HZ8 A;  1R7H A;  4XS4 A;  4XS6 A;  1RK4 A;  2DJ3 A;  5CRD A;  3MYD A;  1GTA A;  2L5L A;  2V2G A;  3H93 A;  1XFL A;  2C8U A;  3CSJ A;  4JZQ A;  5CNW A;  1M9B A;  4N0Z A;  1I9D A;  3HVN A;  2CX3 A;  1XWB A;  4WEY A;  3ME7 A;  2JZS A;  1GTB A;  2R37 A;  5AIS A;  2O5V A;  2L5O A;  4XRA A;  1HQO A;  3UVH A;  3TKS C;  3VUR A;  2DLX A;  1XPV A;  1EEM A;  2YJ7 A;  2AYT A;  3BJ5 A;  1Q4J A;  5D9W A;  2CQ9 A;  2KLX A;  4NHZ A;  1Z7R A;  2V6O A;  3I6A A;  3ERF A;  4HQZ A;  2MBS A;  4ECB A;  2IMF A;  4POL A;  2DC5 A;  3SBC A;  4NWY A;  4KH7 A;  2H76 A;  3HVS A;  1GNW A;  2HZF A;  2WCI A;  2UZ8 A;  3HZ4 A;  3O6T A;  5A5K A;  2H72 A;  2WVZ A;  3GKK A;  4YQU A;  1K3L A;  4USS A;  3H8Q A;  3H79 A;  2H1G A;  2J23 A;  4V2L A;  3KZQ A;  2FWH A;  2VD1 A;  2V41 A;  4AKI A;  1JZD A;  1ZCP A;  4ZBA A;  5G5E A;  3I43 A;  3ZIV A;  3HD5 A;  2DJ0 A;  3HCZ A;  3N5O A;  1TI3 A;  1M3I A;  4IS0 A;  2FGX A;  5F06 A;  1V2A A;  4MH3 A;  1X0R A;  1O8X A;  4G0I A;  1PX7 A;  2CZ3 A;  2HZE A;  2HSM B;  3CWG A;  3TKS E;  1BG1 A;  4L5O A;  1YF0 A;  2AV4 A;  1W89 A;  3A2X A;  2R0G A;  4HS1 A;  1F3B A;  5IOX A;  1GP1 A;  4IP1 A;  4PUR A;  3AY8 A;  3FK8 A;  1WP0 A;  1KEB A;  1AQW A;  1ERT A;  1SD9 A;  4MJB A;  5GAP D;  4LMW A;  1T1V A;  3IR4 A;  2PGT A;  2HT9 A;  3APQ A;  1WWJ A;  3KD0 A;  4I6X A;  4F9Z A;  4MZB A;  2LNS A;  1SVO A;  5EL8 A;  3DWV A;  2CVB A;  3Q19 A;  3RAZ A;  5H5S A;  5KN1 A;  5AIV A;  5ECQ B;  1U3A A;  3WGD A;  3VLN A;  4BVX A;  3TGZ A;  3TJB A;  5J3R A;  2GSR A;  4HI7 A;  3FZA A;  2VO4 A;  1XWC A;  2YWO A;  1OYJ A;  1NHY A;  5HR0 A;  3D6I A;  2HSH A;  1K0D A;  2O7K A;  2IMI A;  4CDO A;  1XIY A;  1G7E A;  1T4Y A;  4XS4 B;  3VPQ A;  4GWR A;  4ZB8 A;  1MEK A;  4IJ3 A;  3VI5 A;  5IIZ A;  1WMJ A;  3BD2 A;  4FYC A;  5HR2 A;  1ZYN A;  1PN9 A;  1Z7P A;  3TDG A;  1PA3 A;  2AJQ B;  3RFR C;  4MNN A;  3WT2 A;  3IRA A;  4J57 E;  3HJP A;  1PQN A;  4ML6 A;  5J40 A;  4Z2R A;  1Z3E A;  5JCG A;  2HXK A;  4K9Z A;  4QMK A;  2MMA A;  1U6T A;  2N5F A;  1K3Y A;  4IQA A;  2P5Q A;  4WBR D;  2NVL A;  1SL2 B;  3FEU A;  2CT6 A;  1A0R P;  4ZXG A;  5DAL A;  5A1N A;  5EVO A;  1SK0 A;  5E59 A;  3EYT A;  1ZL9 A;  4JR6 A;  4TR0 A;  1A24 A;  1USB A;  3TCO A;  4TKY A;  5ENU A;  2LQQ A;  1SVM A;  2C3Q A;  1X5D A;  2LRC A;  4FXY P;  3F63 A;  1XW9 A;  3W8J A;  4WET A;  1GUL A;  1QQ2 A;  4J56 E;  5COH A;  3L9U A;  2JAC A;  1A2M A;  2F3M A;  4KSO A;  5J9C A;  1THX A;  2GSQ A;  2A4H A;  3TKS A;  2CZ2 A;  2X8C A;  1EZK A;  5DQY A;  3P2A A;  1HYU A;  2O36 A;  3ISO A;  2PMT A;  1PRX A;  5D9T A;  5ELA A;  1U88 A;  3VK9 A;  3ZYW A;  4ZB9 A;  5KOX A;  5IO2 A;  1FW1 A;  2H0G A;  3GA4 A;  3NZN A;  2HRA A;  2YPM A;  4IVF A;  1PGT A;  2YV7 A;  4YAV A;  2EIR A;  5ECI B;  4DSR A;  3KH9 A;  1T8E B;  4DSQ A;  2VL3 A;  3O76 A;  1QK8 A;  2N5A A;  4WR5 A;  2YZH A;  2B6M A;  1W4V A;  1T4Z A;  2MBT A;  6GSW A;  5H5R A;  2F9S A;  1ERV A;  1A8Y A;  4FYB A;  1FVK A;  3F8U A;  1YEP A;  4KB3 A;  4HJ2 A;  2YAN A;  4PTS A;  3C1S A;  1NSW A;  3PR8 A;  4GQF A;  5ECK B;  4N0V A;  1SEN A;  2DIY A;  1ZYP A;  2WUL A;  5ID2 B;  4EIQ A;  3A2W A;  2YP6 A;  2O85 A;  1O85 A;  4EF0 A;  1FB0 A;  4K7I A;  1TI1 A;  1ML6 A;  2GZY A;  3HA9 A;  3L0H A;  1Z9H A;  1FHE A;  1GWC A;  2J9H A;  1ST9 A;  5G1K A;  2L57 A;  1XG8 A;  1YJ6 A;  1MD3 A;  4MZW A;  2MMN A;  3P90 A;  3GN3 A;  2G2Q A;  4MK3 A;  1HNA A;  5IMZ A;  2CAQ A;  3C73 A;  3HVV A;  1FOH A;  1PN0 A;  3JCM L;  2NTO A;  5FHI A;  4JR4 A;  2GST A;  4NHW A;  3LG6 A;  3EE2 A;  2VLU A;  3ZIT A;  3D22 A;  5DCH A;  4F0C A;  5DAK A;  4EL1 A;  2L59 A;  4LL1 B;  1B4Q A;  5HFI A;  2JU5 A;  4IW9 A;  4GSS A;  4NAX A;  1M2D A;  2H19 A;  3TB2 A;  3VWV A;  2B5Y A;  3TKR A;  2X49 A;  1IYI A;  4YQV A;  2VCT A;  3HJM A;  5G5F A;  6GST A;  1FAA A;  1GLP A;  3PIN A;  3EVI A;  4TW5 A;  4Z2U A;  2EFC A;  2PUK C;  3FZ5 A;  4X4J A;  5HFK A;  3S9F A;  4E8H A;  2F8F A;  3FR9 A;  3ZVJ A;  2VM2 A;  5KOW A;  3H4K A;  1F6M C;  5A4U A;  1V58 A;  1ZOF A;  1X9S B;  4KW6 A;  2H1L A;  4K0N A;  2QGV A;  1H75 A;  1TXU A;  4I97 A;  2FD3 A;  1GRX A;  3UOM A;  1WOU A;  2LQO A;  2WW3 A;  1ZZY A;  2YWN A;  1FB6 A;  1K0B A;  2LV3 A;  2RLI A;  1S4B P;  2PER A;  4PQH A;  3CTF A;  3CBU A;  2RM5 A;  4IKH A;  1DBY A;  1C72 A;  2QA1 A;  4AJ6 A;  6GSY A;  5L71 A;  4EIP A;  2KUC A;  4HQS A;  1YKC A;  4OWY A;  2H8L A;  1A23 A;  2IMD A;  1TK8 B;  4GSN A;  3NOF A;  4BWS A;  3KP9 A;  2HSM A;  5DBQ A;  20GS A;  4V2N A;  4FO5 A;  5D73 A;  3P7X A;  2MMZ A;  1OVN A;  2X8G A;  3DGQ A;  4DSS A;  2OA7 A;  5HR1 A;  3QMX A;  3EC3 A;  4NPB A;  4K5S A;  1CQG A;  9GSS A;  3GL3 A;  3QOU A;  1T7P B;  4F0B A;  1CQH A;  1E2Y A;  1S3A A;  1DUG A;  1TRW A;  5J4U A;  2LRN A;  2WVX B;  5AIX A;  1X5E A;  4K6X A;  1J9B A;  3MDK A;  11GS A;  3APS A;  3IC4 A;  3RHB A;  3TJF A;  5D9X A;  2O3E A;  3FZ4 A;  4GST A;  5B8A A;  1GSU A;  3IXR A;  4GQC A;  2XBI A;  4PHZ C;  1SYR A;  4ZIJ A;  3KP8 A;  4IBP A;  3DVW A;  4CHS A;  3RHC A;  3BBY A;  4WF4 A;  2A4V A;  3C1R A;  4K5R A;  1UA5 A;  5ECH B;  2H1B A;  2MZC A;  5HFG A;  4ECJ A;  2FUG 2;  4K7O A;  1A2J A;  2WB9 A;  2FCH A;  5EY6 A;  1EOG A;  4ULX A;  1FVJ A;  3KCM A;  5CRG A;  4V2M A;  4PI2 C;  3H1N A;  2QC7 A;  2IME A;  3FYG A;  4IQ1 A;  4MPG A;  1BJX A;  2E0Q A;  2JZR A;  1M99 A;  3W6G A;  3DIE A;  2A2S A;  2CVD A;  2IL3 A;  2VD0 A;  4AKG A;  2R2J A;  1GSQ A;  3GH9 A;  1JZR A;  3TU3 B;  3C8E A;  4OFT A;  5D93 A;  3D5J A;  2PBJ A;  4OFM A;  3KM6 A;  2E7P A;  1EV4 A;  5B7C A;  2GS3 A;  4ZIL A;  2VCW A;  4D73 A;  4CW9 A;  2I4A A;  3P8W A;  1VGL A;  3CMI A;  2FHE A;  4K1F A;  3KMN A;  2V1M A;  2JZT A;  3QFA C;  4JED A;  2O8V B;  3PPU A;  4MP4 A;  5ECM B;  2H1D A;  1S3D A;  3CTG A;  2C4J A;  4I2U A;  1MDI A;  2GT6 A;  3FKF A;  1LJR A;  2VCZ A;  3LJR A;  3GKM A;  2OAC A;  1AAZ A;  4KCA A;  1O7U A;  2VIM A;  3QDN A;  3MNG A;  2UV8 G;  1TU7 A;  1OC8 A;  4MAB A;  3F0I A;  4MLY A;  1B8X A;  4KDU A;  3UBK A;  12GS A;  3LW9 A;  3ERG A;  5IO0 A;  2K9F A;  2GVP A;  3C7M A;  3PH9 A;  2QKE A;  2K6V A;  2C0G A;  4E8E A;  3EPT A;  2DBC A;  2I81 A;  4DSS B;  4HU7 A;  2F51 A;  1Z6M A;  2H73 A;  4TN8 A;  5JCU A;  3TOU A;  1WE0 A;  3LSZ A;  4LLR A;  1LU4 A;  1VF2 A;  2X8H A;  2P0G A;  1YF1 A;  3A2V A;  3F4R A;  3DYR A;  1XVQ A;  4MZC A;  3TOT A;  4AF2 A;  5BMU B;  2X4A A;  3F4S A;  2H01 A;  2CA8 A;  3LXT A;  2AB6 A;  4J2F A;  1XZO A;  2A2P A;  3IOS A;  3IPZ A;  2AAW A;  5D96 A;  3RBT A;  2L4Q A;  3LEF A;  2JSZ A;  2HI7 A;  1M9A A;  4AI6 A;  2G0F A;  1YVL A;  2P31 A;  4N10 A;  1A2L A;  1TRU A;  1B48 A;  1O8W A;  4GTU A;  2L4C A;  1F3A A;  1AQV A;  4ZL7 A;  2WGR A;  4E68 A;  1SK1 A;  3W8S A;  3GST A;  5GZZ B;  3KTB A;  1R5P A;  1ACV A;  1YDK A;  3M9J A;  3HDC A;  1TTZ A;  4ZBB A;  3TJG A;  3LOR A;  5ID2 A;  1JHB A;  4ZB6 A;  4F03 A;  3WGX A;  1ZGN A;  8GSS A;  1TJD A;  3DRN A;  3G9B A;  2GQM A;  3M1G A;  1HD2 A;  4ZL8 A;  3MIX A;  4OMV A;  4MF5 A;  3ZIJ A;  1GH2 A;  4ECI A;  2VCV A;  3RDW A;  4EO3 A;  2FNO A;  5LNK e;  1GUK A;  2WZS A;  2H0I A;  1JLV A;  3BOA A;  13GS A;  4D73 B;  3RGB C;  4GLT A;  3GFK A;  4QL7 A;  4K0G A;  1BYE A;  4G0K A;  5JWQ B;  3WGE A;  3M9K A;  3TRX A;  1HNC A;  1Y25 A;  1WIK A;  5ECS A;  2HSY A;  1XWA A;  2LNT A;  3K8N A;  3M3M A;  3I69 A;  1GLQ A;  1M7T A;  2E2M A;  1F2E A;  2XPD A;  2PVQ A;  1PX6 A;  2RUF A;  3BCI A;  4MPF A;  4MCU A;  1TW9 A;  2LS5 A;  1K0A A;  3GL5 A;  2R0C A;  2IPA A;  2B1L A;  3M0F A;  1B4P A;  3DEX A;  1M2B A;  1DSB A;  1YEX A;  4EKZ A;  5IMF A;  2V6K A;  2YWI A;  3HVX A;  4EE0 A;  2OE3 A;  1A0F A;  1O6J A;  1F9M A;  4V1A p;  1TXX A;  2BJX A;  4HZ2 A;  3ZRE A;  3GX8 A;  3WYW A;  3GYK A;  3ZML A;  4AJ8 A;  1PL2 A;  1JZW A;  2NDO A;  2MMO A;  2WW0 A;  5ECL B;  3KXO A;  4EDY A;  1O81 A;  1BG5 A;  3GUS A;  3R3E A;  4I2T A;  2AUV A;  1R4W A;  1AC1 A;  4YKF A;  3J7Y b;  3UJ1 A;  2BTO T;  2CVK A;  2YOI A;  2DJJ A;  2EFD A;  3F3Q A;  5E4W A;  1PFO A;  4MA9 A;  2FY6 A;  4MMM A;  5J4V A;  2E2G A;  1TRS A;  3WT1 A;  1ERU A;  5KN3 A;  4ILF A;  2WVY A;  2Z9S A;  1EWX A;  1Y6E A;  5LD0 A;  4IHU A;  1UC7 A;  5F0G A;  1ZMA A;  4O7H A;  4ACS A;  3DD3 A;  2LJA A;  1GSF A;  1XWK A;  5ECR B;  1ZYQ B;  1U87 A;  2EIO A;  2R5G A;  1XXU A;  3VWW A;  3GHA A;  3UVT A;  3D4M A;  3GX0 A;  2I3Y A;  2GQL A;  4TVE A;  2C3T A;  1PSQ A;  1ILO A;  4N3Z A;  3L9V A;  1KNG A;  2M72 A;  3VFI A;  4KSM A;  3UEM A;  1YZX A;  3ZTL A;  2K8V A;  3UMA A;  2WVX A;  5DJM A;  4KCE A;  1OAZ A;  2KHP A;  5C00 A;  1FO5 A;  4ZL9 A;  2NPB A;  4FIW A;  3IV4 A;  3V1W A;  5IMD A;  1DE1 A;  5FT3 A;  4K7N A;  5CAX A;  2YZU A;  4XIH A;  1YQ1 A;  1VF1 A;  4BIK A;  3GUR A;  3IHQ A;  2DMM A;  5ECO B;  4KDX A;  4ICY A;  1BX9 A;  5IMC A;  3CQF A;  3VWU A;  4G10 A;  17GS A;  2OKA A;  3EUR A;  3LFL A;  1K0O A;  1PL1 A;  3MWH A;  4OO5 A;  1V40 A;  3EMX A;  5KEJ A;  1EP8 A;  1R26 A;  4MF6 A;  5C04 A;  4OD7 A;  2B7K A;  4GF0 A;  1SJI A;  2YV9 A;  1S3R A;  1TKD B;  4PNF A;  1BQ7 A;  3DXB A;  3KEB A;  4MJE A;  5HR3 A;  1EOH A;  3KMO A;  1OE8 A;  3HMJ G;  5DQS A;  4AGS A;  4FYU A;  5JCW A;  2NBS A;  2LEG A;  1MDJ A;  3A5I A;  3Q6O A;  2OT3 A;  3CRU A;  3EMP A;  2YNX A;  3ZMK A;  2VUP A;  1WPI A;  1G6Y A;  2EIQ A;  3IA1 A;  3IC8 A;  2IIY A;  5GSS A;  1Y1U A;  4CY6 A;  1VRS D;  5J9B A;  1PD2 1;  1URM A;  2GGT A;  4TR1 B;  3HJO A;  4JU5 A;  2H30 A;  4KAE A;  5B6M A;  4PQI A;  4YAP A;  4JE1 A;  3IK9 A;  3TRQ A;  3HHV A;  4KF9 A;  2R6K A;  1AQX A;  1B9X C;  3GKN A;  2GQK A;  1QXH A;  1X5C A;  1ABA A;  3LXZ A;  1UVZ A; 
#chains in the Genus database with same CATH homology
 2X99 A;  1X9W B;  5CRH A;  2B7J A;  3FMW A;  4HU9 A;  3KIJ A;  3PGT A;  5BRT A;  3HXS A;  3KH7 A;  2O89 A;  4TXV A;  3OR5 A;  1GUH A;  4L5L A;  2C3N A;  2A2R A;  4KDY A;  3F6D A;  2OAD A;  2LJR A;  1QUW A;  4TRX A;  2MYG A;  5IOW A;  2TRX A;  1GSD A;  1MDK A;  4DEJ A;  4ID0 A;  2DJK A;  4LL4 B;  1EEJ A;  5BMU A;  4OCE A;  4WXT A;  1SL1 B;  2PPT A;  4WR4 A;  1YKA A;  4ECC A;  3F6F A;  2YWM A;  2CAI A;  1MD4 A;  1ZYE A;  4YKG A;  4QL9 A;  1AIU A;  3IBH A;  1SJ6 A;  4HEA 2;  1E6B A;  2V32 A;  1HNB A;  3SWL A;  3E0U A;  4PGT A;  1EGO A;  1JLW A;  2HQT A;  1G7O A;  2BMX A;  3IE3 A;  2KP1 A;  4TXO B;  3EIN A;  2VL9 A;  1ERW A;  2H75 A;  3F3R A;  1N8J A;  3CSI A;  3IHG A;  1SD8 A;  4KGI A;  2HYX A;  4GXZ A;  3QPM A;  4K2D A;  1XCC A;  2WS2 A;  2B5E A;  7GSS A;  1DE2 A;  3UL3 A;  5G1L A;  1OE7 A;  5INY A;  2ON5 A;  2DKH A;  5H5Q A;  4O5R A;  1TP9 A;  2WJU A;  1VF3 A;  4TR4 A;  1SKS B;  3HY2 A;  4PUF C;  2IJY A;  4HUA A;  3U6V A;  1OC3 A;  1GTU A;  3E3E A;  1KTE A;  5CRE A;  2HRK B;  2QA2 A;  3LYK A;  2HRN A;  2HSN B;  2QSI A;  4EDZ A;  3RPP A;  2VL2 C;  2JAD A;  1GL8 A;  4Q5F A;  2TRC P;  4CY8 A;  2JSY A;  4EVM A;  2YJH A;  3BCK A;  2LKU A;  5GST A;  2LRT A;  2O87 A;  2LTK A;  3LQ7 A;  3QR6 A;  2XPE A;  1EV9 A;  4L0U A;  5J4Y A;  2DML A;  1GSY A;  4NXI A;  1XOB A;  1XOA A;  1T00 A;  3EU3 A;  14GS A;  1SYX A;  4AKH A;  3MAK A;  3FR3 A;  3GNJ A;  2X64 A;  2KOK A;  4N11 A;  4N30 A;  3FY7 A;  4JBB A;  4G19 A;  4NMU A;  2DJ2 A;  4Z2T A;  2IFQ B;  1SL0 B;  5DJL A;  5A5H B;  5JWO B;  3L78 A;  4BVY B;  4RI7 A;  3GMF A;  3Q74 A;  3QCP A;  3UIW A;  2OBI A;  3GTU B;  4KA0 A;  2WFC A;  5F05 A;  1PKZ A;  4MF7 A;  2IMK A;  2C1Y A;  3ZRD A;  3RPN A;  6GSS A;  2D2Z A;  2ZNM A;  4PQ1 A;  1I5G A;  5B8B A;  3GV1 A;  1TOF A;  4EC0 A;  5LCZ A;  1OKD A;  1ON4 A;  1U3I A;  4MH2 A;  4NV2 A;  3ERW A;  5CRW A;  4PNG A;  3TRP A;  3ED3 A;  4XCS A;  4NV5 A;  2DJ1 A;  3VPT A;  2M80 A;  4HDE A;  4KX4 A;  4POK A;  2VOC A;  4LMV A;  3O3T A;  2TIR A;  5A4V A;  1SVL A;  18GS A;  5G30 A;  2I9H A;  2FA8 A;  19GS A;  3M8N A;  4O92 A;  4RI6 A;  1N2A A;  2PWJ A;  2FWG A;  2LST A;  4OO4 A;  4F2I A;  2C0D A;  2RII A;  2IWT A;  1GNE A;  3KTL A;  2FWE A;  4G2E A;  3CSH A;  2HE3 A;  1TK5 B;  4PX1 A;  4WF5 A;  1AXD A;  1XW6 A;  3ZL5 A;  2AHE A;  6GSX A;  2P5R A;  4G01 A;  1TK0 B;  4EUY A;  1V57 A;  1XBS A;  2HNL A;  4Q5N A;  1M2A A;  3US3 A;  1TDI A;  1A8L A;  2WRT A;  2DSA A;  3QAV A;  3ZLP A;  2VM1 A;  2ES7 A;  2XHF A;  2FLS A;  4RQX A;  4I5Q A;  1GSE A;  5KN0 A;  2OE0 A;  4V1A g;  2LJK A;  3LGC A;  5D9V A;  5DVB A;  3GSS A;  1M0U A;  4O5Q A;  2K18 A;  3R2Q A;  5G2Z A;  1J08 A;  5JWR B;  2WZ9 A;  2OE1 A;  5ELG A;  1EP7 A;  3UAR A;  3G7J A;  2LUS A;  2EC4 A;  1JFU A;  3L4N A;  1AUC A;  4OFN A;  2VLV A;  3WD6 A;  1OC9 A;  2H1A A;  2B3S A;  1MTC A;  1Z6N A;  4IEL A;  5GAN D;  1UN2 A;  3IAM 2;  3D21 A;  3F4T A;  4YH2 A;  5ECN B;  2VL2 A;  4FH8 A;  3LWA A;  4XRD A;  1SKR B;  4DVC A;  3UAP A;  1PMT A;  5FWG A;  5IPG A;  2DIZ A;  2H71 A;  5DCG A;  4G0L A;  2K8S A;  2HZE B;  3FZ9 A;  1PKW A;  22GS A;  2FA4 A;  4Q5Q A;  2ALB A;  4F82 A;  2GLR A;  3QD9 A;  5F07 A;  3N9J A;  4TR1 A;  4X0X A;  5AN1 A;  4AJ7 A;  5IMV A;  2VKZ G;  1THO A;  2GT5 A;  2ZUP A;  1OKT A;  2GSS A;  1FOV A;  4XS1 A;  1IYH A;  2IN3 A;  3TKQ A;  3ZVJ D;  4MDC A;  5CO3 A;  3TJJ A;  3GIX A;  1K0M A;  4O5U A;  2XC2 A;  3F9U A;  1EGR A;  3EU4 A;  1Q98 A;  5AGY A;  4ML1 A;  4JRR A;  1TU8 A;  3QFB C;  4QQ7 A;  2KP2 A;  1SKW B;  3I9V 2;  4BVX B;  2ZCT A;  5D8I A;  1N25 A;  4BL7 A;  3CXG A;  3ME8 A;  5J47 A;  2YCD A;  4L0W A;  4RUV A;  1KBN A;  3IK7 A;  2H6Y A;  1BED A;  3HYP A;  1T3B A;  5HQP A;  3VI7 A;  1RQM A;  4IP6 A;  3EWL A;  3Q18 A;  4XTS A;  4MJA A;  1NW2 A;  3TUE A;  1BAY A;  4I8B A;  3FW2 A;  1QGV A;  4HZ4 A;  3HKR A;  2CV4 A;  4Q5R A;  2R0P A;  2H6X A;  4IJI A;  3U5R E;  1GTI A;  4HOJ A;  2DKI A;  6GSV A;  3D0Z A;  2YN1 A;  1WJK A;  4IN0 A;  3VWX A;  4YQM A;  2VCQ A;  2VAF A;  1O73 A;  4GRF A;  1TRV A;  2GDR A;  1QFN A;  4TXO A;  4MJC A;  1SU9 A;  5J5N A;  4L8E A;  2M46 A;  4AKX B;  1WRY A;  3ZFL A;  2RM6 A;  2PN8 A;  5DAL B;  5A1N B;  4FQU A;  3GKX A;  4W66 A;  4POB A;  3IAS 2;  1NHO A;  1XVW A;  6GSU A;  3CRT A;  2RUE A;  2PU9 C;  4KND A;  1AW9 A;  2H0H A;  1GSS A;  5IQY A;  2GTU A;  5A34 A;  1B9Y C;  3QAW A;  1BF5 A;  1H4O A;  1LBK A;  3DML A;  3MSZ A;  1JZO A;  4ISD A;  1OC9 B;  2JL4 A;  2PVO C;  5DDL A;  3FR6 A;  4K8M A;  4IGJ A;  5B6N A;  4EXJ A;  2C0F A;  4ZBD A;  2GZZ A;  3J7Y k;  5CP1 A;  3A5W A;  3DVX A;  5J41 A;  1V9W A;  1S3C A;  16GS A;  2HRK A;  2HLS A;  3C71 A;  2HRF A;  2HSN A;  4BA7 A;  10GS A;  5A4W A;  3KJY A;  3KGK A;  3TKP A;  3DKS A;  2OJL A;  5IPH A;  2N5B A;  4XHM A;  2EFH A;  1K0N A;  2H6Z A;  2ON7 A;  3GRX A;  5F8B A;  1FG4 A;  2EFE A;  4H86 A;  1G6W A;  4PUA A;  4KUN A;  1QMV A;  3ZFB A;  4WKW A;  1G0T A;  2B5X A;  4HJM A;  3TJK A;  4PXO A;  3UBL A;  1XW5 A;  1SK2 A;  4GCI A;  1V98 A;  4OCF A;  4Z7X A;  5ABR A;  4POM A;  1Z5Y E;  2HFD A;  3FHK A;  4BPY A;  3LYP A;  5IM9 A;  4BL7 B;  4X1U A;  2OBK A;  3IDV A;  2H70 A;  1NM3 A;  4ZB7 A;  3ZZX A;  1F37 A;  2IFQ A;  3D4T A;  4X43 A;  5A5H A;  3GH6 A;  1GUM A;  4P3Y B;  5ECP B;  4BVY A;  2REM A;  1K0C A;  1RW1 A;  2B1K A;  4O32 A;  1YY7 A;  2VCX A;  2R4V A;  2GZP A;  1XWG A;  3APO A;  3G7Y A;  1R5A A;  4WBJ A;  3NIV A;  4A5P A;  3E9J B;  5CYY A;  2H66 A;  3GTU A;  4KE3 A;  4RQR A;  1K3O A;  3G7I A;  2L6C A;  4GDF A;  4K2X A;  2C0E A;  2F8A A;  2L6D A;  5EPF A;  1X9M B;  4TR3 A;  4TOP A;  2R3X A;  3QAG A;  3CYN A;  3FRC A;  2I1U A;  2CX4 A;  4G9H A;  4BWQ A;  3L9S A;  5KN2 A;  4LA1 A;  1J0F A;  2XBQ A;  2C80 A;  2FWF A;  5DAK B;  1VF4 A;  1SJZ A;  2H74 A;  3A3T A;  5G31 A;  5A34 B;  5IMA A;  2VLT A;  2WDU A;  3HZ8 A;  1R7H A;  4XS4 A;  4XS6 A;  1RK4 A;  2DJ3 A;  5CRD A;  3MYD A;  1GTA A;  2L5L A;  2V2G A;  3H93 A;  1XFL A;  2C8U A;  3CSJ A;  4JZQ A;  5CNW A;  1M9B A;  4N0Z A;  1I9D A;  2CX3 A;  1XWB A;  4WEY A;  3ME7 A;  2JZS A;  1GTB A;  2R37 A;  5AIS A;  2O5V A;  2L5O A;  4XRA A;  1HQO A;  3UVH A;  3TKS C;  3VUR A;  2DLX A;  1XPV A;  1EEM A;  2YJ7 A;  2AYT A;  3BJ5 A;  1Q4J A;  5D9W A;  2CQ9 A;  2KLX A;  4NHZ A;  1Z7R A;  2V6O A;  3I6A A;  3ERF A;  4HQZ A;  2MBS A;  4ECB A;  2IMF A;  4POL A;  2DC5 A;  3SBC A;  4NWY A;  4KH7 A;  2H76 A;  3HVS A;  1GNW A;  2HZF A;  2WCI A;  2UZ8 A;  3HZ4 A;  3O6T A;  5A5K A;  2H72 A;  3GKK A;  4YQU A;  1K3L A;  4USS A;  3H8Q A;  3H79 A;  2H1G A;  2J23 A;  4V2L A;  3KZQ A;  2FWH A;  2VD1 A;  2V41 A;  4AKI A;  1JZD A;  1ZCP A;  4ZBA A;  5G5E A;  3I43 A;  3ZIV A;  3HD5 A;  2DJ0 A;  3HCZ A;  3N5O A;  1TI3 A;  4IS0 A;  2FGX A;  5F06 A;  1V2A A;  4MH3 A;  1X0R A;  1O8X A;  4G0I A;  1PX7 A;  2CZ3 A;  2HZE A;  2HSM B;  3CWG A;  3TKS E;  1BG1 A;  4L5O A;  1YF0 A;  2AV4 A;  1W89 A;  3A2X A;  2R0G A;  4HS1 A;  1F3B A;  5IOX A;  1GP1 A;  4IP1 A;  4PUR A;  3AY8 A;  3FK8 A;  1WP0 A;  1KEB A;  1AQW A;  1ERT A;  1SD9 A;  4MJB A;  5GAP D;  4LMW A;  1T1V A;  3IR4 A;  2PGT A;  2HT9 A;  3APQ A;  1WWJ A;  3KD0 A;  4I6X A;  4F9Z A;  4MZB A;  2LNS A;  1SVO A;  5EL8 A;  3DWV A;  2CVB A;  3Q19 A;  3RAZ A;  5H5S A;  5KN1 A;  5AIV A;  5ECQ B;  1U3A A;  3WGD A;  3VLN A;  4BVX A;  3TGZ A;  3TJB A;  5J3R A;  2GSR A;  4HI7 A;  3FZA A;  2VO4 A;  1XWC A;  2YWO A;  1OYJ A;  1NHY A;  5HR0 A;  3D6I A;  2HSH A;  1K0D A;  2O7K A;  2IMI A;  4CDO A;  1XIY A;  1G7E A;  1T4Y A;  4XS4 B;  3VPQ A;  4GWR A;  4ZB8 A;  1MEK A;  4IJ3 A;  3VI5 A;  5IIZ A;  1WMJ A;  3BD2 A;  4FYC A;  5HR2 A;  1ZYN A;  1PN9 A;  1Z7P A;  3TDG A;  1PA3 A;  2AJQ B;  4MNN A;  3WT2 A;  3IRA A;  4J57 E;  3HJP A;  1PQN A;  4ML6 A;  5J40 A;  4Z2R A;  1Z3E A;  5JCG A;  2HXK A;  4K9Z A;  4QMK A;  2MMA A;  1U6T A;  2N5F A;  1K3Y A;  4IQA A;  2P5Q A;  4WBR D;  2NVL A;  1SL2 B;  3FEU A;  2CT6 A;  1A0R P;  4ZXG A;  5DAL A;  5A1N A;  5EVO A;  1SK0 A;  5E59 A;  3EYT A;  1ZL9 A;  4JR6 A;  4TR0 A;  1A24 A;  1USB A;  3TCO A;  4TKY A;  5ENU A;  2LQQ A;  1SVM A;  2C3Q A;  1X5D A;  2LRC A;  3F63 A;  1XW9 A;  3W8J A;  4WET A;  1GUL A;  1QQ2 A;  4J56 E;  5COH A;  3L9U A;  2JAC A;  1A2M A;  2F3M A;  4KSO A;  5J9C A;  1THX A;  2GSQ A;  2A4H A;  3TKS A;  2CZ2 A;  2X8C A;  1EZK A;  5DQY A;  3P2A A;  1HYU A;  3ISO A;  2PMT A;  1PRX A;  5D9T A;  5ELA A;  1U88 A;  3VK9 A;  3ZYW A;  4ZB9 A;  5KOX A;  5IO2 A;  1FW1 A;  2H0G A;  3GA4 A;  3NZN A;  2HRA A;  2YPM A;  4IVF A;  1PGT A;  2YV7 A;  4YAV A;  2EIR A;  5ECI B;  4DSR A;  3KH9 A;  1T8E B;  4DSQ A;  2VL3 A;  3O76 A;  1QK8 A;  2N5A A;  4WR5 A;  2YZH A;  2B6M A;  1W4V A;  1T4Z A;  2MBT A;  6GSW A;  5H5R A;  2F9S A;  1ERV A;  1A8Y A;  4FYB A;  1FVK A;  3F8U A;  1YEP A;  4KB3 A;  4HJ2 A;  2YAN A;  4PTS A;  3C1S A;  1NSW A;  3PR8 A;  4GQF A;  5ECK B;  4N0V A;  1SEN A;  2DIY A;  1ZYP A;  2WUL A;  5ID2 B;  4EIQ A;  3A2W A;  2YP6 A;  2O85 A;  1O85 A;  4EF0 A;  1FB0 A;  4K7I A;  1TI1 A;  1ML6 A;  2GZY A;  3HA9 A;  3L0H A;  1Z9H A;  1FHE A;  1GWC A;  2J9H A;  1ST9 A;  5G1K A;  2L57 A;  1YJ6 A;  1MD3 A;  4MZW A;  2MMN A;  3P90 A;  3GN3 A;  2G2Q A;  4MK3 A;  1HNA A;  5IMZ A;  2CAQ A;  3C73 A;  3HVV A;  1FOH A;  1PN0 A;  3JCM L;  2NTO A;  5FHI A;  4JR4 A;  2GST A;  4NHW A;  3LG6 A;  3EE2 A;  2VLU A;  3ZIT A;  3D22 A;  5DCH A;  4F0C A;  5DAK A;  4EL1 A;  2L59 A;  4LL1 B;  1B4Q A;  5HFI A;  2JU5 A;  4IW9 A;  4GSS A;  4NAX A;  1M2D A;  2H19 A;  3TB2 A;  3VWV A;  2B5Y A;  3TKR A;  2X49 A;  1IYI A;  4YQV A;  2VCT A;  3HJM A;  5G5F A;  6GST A;  1FAA A;  1GLP A;  3PIN A;  3EVI A;  4TW5 A;  4Z2U A;  2EFC A;  2PUK C;  3FZ5 A;  4X4J A;  5HFK A;  3S9F A;  4E8H A;  2F8F A;  3FR9 A;  3ZVJ A;  2VM2 A;  5KOW A;  3H4K A;  1F6M C;  5A4U A;  1V58 A;  1ZOF A;  1X9S B;  4KW6 A;  2H1L A;  4K0N A;  2QGV A;  1H75 A;  1TXU A;  4I97 A;  2FD3 A;  1GRX A;  3UOM A;  1WOU A;  2LQO A;  1ZZY A;  2YWN A;  1FB6 A;  1K0B A;  2LV3 A;  2RLI A;  2PER A;  4PQH A;  3CTF A;  3CBU A;  2RM5 A;  4IKH A;  1DBY A;  1C72 A;  2QA1 A;  4AJ6 A;  6GSY A;  5L71 A;  4EIP A;  2KUC A;  4HQS A;  1YKC A;  4OWY A;  2H8L A;  1A23 A;  2IMD A;  1TK8 B;  4GSN A;  3NOF A;  4BWS A;  3KP9 A;  2HSM A;  5DBQ A;  20GS A;  4V2N A;  4FO5 A;  5D73 A;  3P7X A;  2MMZ A;  1OVN A;  2X8G A;  3DGQ A;  4DSS A;  2OA7 A;  5HR1 A;  3QMX A;  3EC3 A;  4NPB A;  4K5S A;  1CQG A;  9GSS A;  3GL3 A;  3QOU A;  1T7P B;  4F0B A;  1CQH A;  1E2Y A;  1S3A A;  1DUG A;  1TRW A;  5J4U A;  2LRN A;  5AIX A;  1X5E A;  4K6X A;  1J9B A;  3MDK A;  11GS A;  3APS A;  3IC4 A;  3RHB A;  3TJF A;  5D9X A;  3FZ4 A;  4GST A;  5B8A A;  1GSU A;  3IXR A;  4GQC A;  2XBI A;  1SYR A;  4ZIJ A;  3KP8 A;  4IBP A;  3DVW A;  4CHS A;  3RHC A;  3BBY A;  4WF4 A;  2A4V A;  3C1R A;  4K5R A;  1UA5 A;  5ECH B;  2H1B A;  2MZC A;  5HFG A;  4ECJ A;  2FUG 2;  4K7O A;  1A2J A;  2WB9 A;  2FCH A;  5EY6 A;  1EOG A;  4ULX A;  1FVJ A;  3KCM A;  5CRG A;  4V2M A;  3H1N A;  2QC7 A;  2IME A;  3FYG A;  4IQ1 A;  4MPG A;  1BJX A;  2E0Q A;  2JZR A;  1M99 A;  3W6G A;  3DIE A;  2A2S A;  2CVD A;  2IL3 A;  2VD0 A;  4AKG A;  2R2J A;  1GSQ A;  3GH9 A;  1JZR A;  3TU3 B;  3C8E A;  4OFT A;  5D93 A;  3D5J A;  2PBJ A;  4OFM A;  3KM6 A;  2E7P A;  1EV4 A;  5B7C A;  2GS3 A;  4ZIL A;  2VCW A;  4D73 A;  4CW9 A;  2I4A A;  3P8W A;  1VGL A;  3CMI A;  2FHE A;  4K1F A;  3KMN A;  2V1M A;  2JZT A;  3QFA C;  4JED A;  2O8V B;  3PPU A;  4MP4 A;  5ECM B;  2H1D A;  1S3D A;  3CTG A;  2C4J A;  4I2U A;  1MDI A;  2GT6 A;  3FKF A;  1LJR A;  2VCZ A;  3LJR A;  3GKM A;  2OAC A;  1AAZ A;  4KCA A;  1O7U A;  2VIM A;  3QDN A;  3MNG A;  2UV8 G;  1TU7 A;  1OC8 A;  4MAB A;  3F0I A;  4MLY A;  1B8X A;  4KDU A;  3UBK A;  12GS A;  3LW9 A;  3ERG A;  5IO0 A;  2K9F A;  2GVP A;  3C7M A;  3PH9 A;  2QKE A;  2K6V A;  2C0G A;  4E8E A;  3EPT A;  2DBC A;  2I81 A;  4DSS B;  4HU7 A;  2F51 A;  1Z6M A;  2H73 A;  4TN8 A;  5JCU A;  3TOU A;  1WE0 A;  3LSZ A;  4LLR A;  1LU4 A;  1VF2 A;  2X8H A;  2P0G A;  1YF1 A;  3A2V A;  3F4R A;  3DYR A;  1XVQ A;  4MZC A;  3TOT A;  4AF2 A;  5BMU B;  2X4A A;  3F4S A;  2H01 A;  2CA8 A;  3LXT A;  2AB6 A;  4J2F A;  1XZO A;  2A2P A;  3IOS A;  3IPZ A;  2AAW A;  5D96 A;  3RBT A;  2L4Q A;  3LEF A;  2JSZ A;  2HI7 A;  1M9A A;  4AI6 A;  2G0F A;  1YVL A;  2P31 A;  4N10 A;  1A2L A;  1TRU A;  1B48 A;  1O8W A;  4GTU A;  2L4C A;  1F3A A;  1AQV A;  4ZL7 A;  2WGR A;  4E68 A;  1SK1 A;  3W8S A;  3GST A;  5GZZ B;  3KTB A;  1R5P A;  1ACV A;  1YDK A;  3M9J A;  3HDC A;  1TTZ A;  4ZBB A;  3TJG A;  3LOR A;  5ID2 A;  1JHB A;  4ZB6 A;  4F03 A;  3WGX A;  1ZGN A;  8GSS A;  1TJD A;  3DRN A;  3G9B A;  2GQM A;  3M1G A;  1HD2 A;  4ZL8 A;  3MIX A;  4OMV A;  4MF5 A;  3ZIJ A;  1GH2 A;  4ECI A;  2VCV A;  3RDW A;  4EO3 A;  2FNO A;  5LNK e;  1GUK A;  2H0I A;  1JLV A;  3BOA A;  13GS A;  4D73 B;  4GLT A;  3GFK A;  4QL7 A;  4K0G A;  1BYE A;  4G0K A;  5JWQ B;  3WGE A;  3M9K A;  3TRX A;  1HNC A;  1Y25 A;  1WIK A;  5ECS A;  2HSY A;  1XWA A;  2LNT A;  3K8N A;  3M3M A;  3I69 A;  1GLQ A;  1M7T A;  2E2M A;  1F2E A;  2XPD A;  2PVQ A;  1PX6 A;  2RUF A;  3BCI A;  4MPF A;  4MCU A;  1TW9 A;  2LS5 A;  1K0A A;  3GL5 A;  2R0C A;  2IPA A;  2B1L A;  3M0F A;  1B4P A;  3DEX A;  1M2B A;  1DSB A;  1YEX A;  4EKZ A;  5IMF A;  2V6K A;  2YWI A;  3HVX A;  4EE0 A;  2OE3 A;  1A0F A;  1O6J A;  1F9M A;  4V1A p;  1TXX A;  2BJX A;  4HZ2 A;  3ZRE A;  3GX8 A;  3WYW A;  3GYK A;  3ZML A;  4AJ8 A;  1PL2 A;  1JZW A;  2NDO A;  2MMO A;  5ECL B;  3KXO A;  4EDY A;  1O81 A;  1BG5 A;  3GUS A;  3R3E A;  4I2T A;  2AUV A;  1R4W A;  1AC1 A;  4YKF A;  3J7Y b;  3UJ1 A;  2BTO T;  2CVK A;  2YOI A;  2DJJ A;  2EFD A;  3F3Q A;  5E4W A;  4MA9 A;  2FY6 A;  4MMM A;  5J4V A;  2E2G A;  1TRS A;  3WT1 A;  1ERU A;  5KN3 A;  4ILF A;  2Z9S A;  1EWX A;  1Y6E A;  5LD0 A;  4IHU A;  1UC7 A;  5F0G A;  1ZMA A;  4O7H A;  4ACS A;  3DD3 A;  2LJA A;  1GSF A;  1XWK A;  5ECR B;  1ZYQ B;  1U87 A;  2EIO A;  2R5G A;  1XXU A;  3VWW A;  3GHA A;  3UVT A;  3D4M A;  3GX0 A;  2I3Y A;  2GQL A;  4TVE A;  2C3T A;  1PSQ A;  1ILO A;  4N3Z A;  3L9V A;  1KNG A;  2M72 A;  3VFI A;  4KSM A;  3UEM A;  1YZX A;  3ZTL A;  2K8V A;  3UMA A;  5DJM A;  4KCE A;  1OAZ A;  2KHP A;  5C00 A;  1FO5 A;  4ZL9 A;  2NPB A;  4FIW A;  3IV4 A;  3V1W A;  5IMD A;  1DE1 A;  5FT3 A;  4K7N A;  5CAX A;  2YZU A;  4XIH A;  1YQ1 A;  1VF1 A;  3GUR A;  3IHQ A;  2DMM A;  5ECO B;  4KDX A;  4ICY A;  1BX9 A;  5IMC A;  3VWU A;  4G10 A;  17GS A;  2OKA A;  3EUR A;  3LFL A;  1K0O A;  1PL1 A;  3MWH A;  4OO5 A;  1V40 A;  3EMX A;  5KEJ A;  1EP8 A;  1R26 A;  4MF6 A;  5C04 A;  4OD7 A;  2B7K A;  4GF0 A;  1SJI A;  2YV9 A;  1TKD B;  4PNF A;  1BQ7 A;  3DXB A;  3KEB A;  4MJE A;  5HR3 A;  1EOH A;  3KMO A;  1OE8 A;  3HMJ G;  5DQS A;  4AGS A;  4FYU A;  5JCW A;  2NBS A;  2LEG A;  1MDJ A;  3A5I A;  3Q6O A;  2OT3 A;  3CRU A;  3EMP A;  2YNX A;  3ZMK A;  2VUP A;  1WPI A;  1G6Y A;  2EIQ A;  3IA1 A;  3IC8 A;  2IIY A;  5GSS A;  1Y1U A;  4CY6 A;  1VRS D;  5J9B A;  1PD2 1;  1URM A;  2GGT A;  4TR1 B;  3HJO A;  4JU5 A;  2H30 A;  4KAE A;  5B6M A;  4PQI A;  4YAP A;  4JE1 A;  3IK9 A;  3TRQ A;  3HHV A;  4KF9 A;  2R6K A;  1AQX A;  1B9X C;  3GKN A;  2GQK A;  1QXH A;  1X5C A;  1ABA A;  3LXZ A;  1UVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...