1K0NA

Chloride intracellular channel 1 (clic1) complexed with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
226
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a soluble form of the intracellular chloride ion channel CLIC1 (NCC27) at 1.4-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords CHLORIDE INTRACELLULAR CHANNEL PROTEIN 1
total genus 76
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1k0nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1k0nA01
4ZBAA 1ZOFA 4QQ7A 2L6DA 1DBYA 3GH9A 1M7TA 5J5NA 1SJ6A 3GA4A 2DMMA 3M9KA 1BG5A 3KIJA 4EF0A 1X9MB 3ZL5A 1EGOA 1YY7A 1GTAA 3IV4A 2OE3A 4ZL8A 1DUGA 2MMAA 2BMXA 1SD8A 1UA5A 1A8YA 2NPBA 1JZRA 1EOHA 1O81A 2CA8A 2OE0A 1WE0A 1SKRB 2HLSA 3Q19A 2YV7A 1Q4JA 3CRUA 2HRFA 4JU5A 3TRPA 2HRKB 2DIYA 1OVNA 3F9UA 1VF2A 1NW2A 4JRRA 4JE1A 3F6FA 4GWRA 2L59A 3KJYA 2JU5A 2LQQA 4YQVA 3KTLA 4I2TA 3QFAC 1G7OA 3VI5A 2GSTA 2XC2A 3EMXA 1UN2A 2EIRA 2IJYA 3ZIVA 3QAGA 5J4UA 5IOXA 5IM9A 5GAPD 2K8SA 3QPMA 3HZ4A 2GTUA 4FIWA 4HZ4A 1VF3A 4X43A 1TOFA 2JZTA 5LD0A 3GX0A 1IYIA 3A3TA 2MMNA 5CAXA 4K1FA 3HD5A 3VLNA 2C8UA 5ECMB 1TU8A 4LA1A 1BJXA 20GSA 4BL7B 3UVHA 3Q74A 3EURA 2H6YA 1GUKA 4WR5A 2J23A 2EIOA 5ECIB 1S3DA 2LJKA 3S9FA 1PKWA 2LTKA 2HRNA 1W89A 1M0UA 5KEJA 4Q5RA 4RI6A 2GZYA 4TR0A 4ACSA 3FW2A 2HZEB 2TIRA 4TW5A 1X5CA 3ZZXA 4PTSA 4IHUA 2ES7A 2VL3A 3F4TA 3ZIJA 2GLRA 4NMUA 1EWXA 3ERWA 4MH2A 4WBRD 3VPQA 2VL2C 3HA9A 1XW5A 1RW1A 3VI7A 3ZLPA 2OA7A 3L78A 5ECSA 2I3YA 4RQRA 2NBSA 5A5KA 1T7PB 4K7OA 1SYRA 1EZKA 1G6YA 1HNAA 2ZNMA 1TI1A 3I6AA 4PUFC 2G2QA 1K0CA 2VIMA 1AIUA 3W8SA 3UIWA 5C04A 5CRGA 4F03A 4GSSA 1TP9A 3QMXA 1YKCA 1XZOA 5D73A 1OKTA 4JR6A 2P0GA 3DVXA 2FLSA 1K3OA 2LUSA 1Q98A 2XPDA 3TJJA 3IR4A 4OO4A 2TRXA 3VWVA 3TGZA 3P7XA 2CVBA 4MJCA 2RM6A 1TI3A 3F4SA 4ML6A 5IPHA 2DJ1A 3DD3A 2IFQB 2E0QA 1SL1B 5GZZB 2CZ2A 2VCTA 1YKAA 3HJMA 4MPFA 5HR2A 2HT9A 1K3LA 1PD21 1M2AA 4ZIJA 3HYPA 4TKYA 1WIKA 1OC9A 4KA0A 4TN8A 5CO3A 4V2LA 1PN9A 3GYKA 2DC5A 4RQXA 2IIYA 3MNGA 2VOCA 4F2IA 2HE3A 2ON5A 5ENUA 3M9JA 3TKRA 3WGXA 3ZMLA 2GZPA 5IMVA 3GTUB 2FWFA 2B5YA 4PUAA 1Z7RA 3TUEA 1NHYA 4NAXA 1BYEA 3W6GA 2DMLA 3GHAA 1U3AA 4ML1A 3UEMA 5J3RA 2PVQA 1GSSA 1F2EA 3PH9A 1GSEA 1BQ7A 3ERFA 3GX8A 5LCZA 2H1DA 3TRQA 1TRUA 2PUKC 1QGVA 4K7NA 4V2MA 2R2JA 1VGLA 4ECCA 1OC8A 5KN1A 2JSYA 1K0AA 4KDXA 1MDKA 2AUVA 2MMOA 3GH6A 4XRDA 3TKSA 2F3MA 1X9SB 6GSVA 1GRXA 4KCEA 1ERTA 5DBQA 3EVIA 2I4AA 2B3SA 2MBTA 4O92A 4GLTA 4V1Ag 2MBSA 2C3TA 2WULA 2WZ9A 1FAAA 4OFTA 2VCZA 3C8EA 4XIHA 3U6VA 3UL3A 3KH9A 1X0RA 1Z3EA 2JACA 1OKDA 2A2SA 5HQPA 1GH2A 4EL1A 1N8JA 3R2QA 3G7YA 4TXOA 3LYPA 3GN3A 4ECBA 4NPBA 2XPEA 4TVEA 3IC8A 4HDEA 2LJRA 2WCIA 1HNBA 2L4QA 4MF5A 4KCAA 4HQZA 1KNGA 4ZL9A 4NHZA 1G0TA 4TRXA 1LJRA 3QOUA 2AYTA 5DQYA 1UC7A 2H1GA 4G2EA 4BVXB 4MJAA 2OKAA 3RPNA 2PGTA 5KN3A 3M8NA 3BCKA 5G5FA 2R37A 2C0EA 2M80A 5D93A 2C0DA 3GNJA 3ZITA 4F9ZA 3QAWA 1OE8A 1PSQA 3NZNA 2GGTA 3AY8A 3ZREA 2GS3A 4Q5FA 2GSQA 3BJ5A 3WGEA 5IQYA 1Y6EA 3GIXA 4IN0A 2ON7A 4OD7A 2LJAA 3F3RA 2FNOA 4WKWA 3LORA 2L57A 1K0DA 4L0WA 5ECQB 2N5AA 3P8WA 3RPPA 4BVYB 2V6KA 2X8CA 4ZBBA 1BEDA 2NVLA 1A23A 4O32A 3EU4A 5G1KA 3DYRA 4USSA 3H1NA 3WT1A 2AB6A 5F0GA 1GULA 5B8BA 4DEJA 1ZYQB 5AIXA 1U88A 2G0FA 1NM3A 2FD3A 4MZBA 4HU7A 4TOPA 1XXUA 1TTZA 1ZZYA 2PU9C 1HYUA 3RBTA 1OC3A 3R3EA 1QUWA 4FYBA 19GSA 3LQ7A 2M72A 1DE1A 1YF1A 2H1BA 3D6IA 2DJKA 4KGIA 4XS6A 6GSSA 1TW9A 2D2ZA 3IK9A 1K0NA 1ERUA 1V40A 5H5RA 4HQSA 4IJIA 1SK1A 3J7Yk 4MK3A 4HZ2A 3ZVJA 3W8JA 3KP9A 2LS5A 5IMDA 1QXHA 1DSBA 3E3EA 2B5XA 2O7KA 1ACVA 3E9JB 5G31A 1YQ1A 5CNWA 4HI7A 3ED3A 4IVFA 2V32A 2I81A 1A0RP 5E4WA 5ECHB 2MYGA 2HSMB 3GKMA 2LRNA 3IAM2 1MDJA 2PBJA 3HXSA 3GKXA 2H66A 4K8MA 5LNKe 4JR4A 1SU9A 4WXTA 3PPUA 4ZB9A 2YP6A 1E2YA 4K7IA 2R4VA 22GSA 5DALB 5F06A 3FR3A 2VCXA 4RI7A 5IMAA 5IO2A 5B8AA 3C71A 5JWRB 1YZXA 1SYXA 5G5EA 1H4OA 4NWYA 3KMNA 5B7CA 2WGRA 5ECOB 2OADA 4TXOB 4OFMA 3GMFA 5ID2A 3A2VA 1G6WA 1B9YC 2H70A 1J08A 1FO5A 4I2UA 1XOBA 4OWYA 18GSA 5A4UA 2RIIA 2VLTA 1XVWA 3UBLA 3RAZA 4MCUA 2C3NA 2LRTA 4IQAA 5FHIA 2YJ7A 3FHKA 2VO4A 3BOAA 2V41A 1GWCA 1YF0A 1O7UA 3RDWA 2VAFA 2C4JA 4OO5A 5ECLB 1HNCA 3KH7A 5F07A 5ECNB 1KTEA 4J2FA 4KSMA 2XHFA 3RHBA 4WF5A 1J0FA 1F9MA 2AV4A 1VF1A 2YANA 1HD2A 1SKWB 3D4TA 3F8UA 1A2LA 4GSTA 4AF2A 2FWHA 2P5RA 3KCMA 4IQ1A 2RUEA 4MJEA 2IFQA 1O6JA 1XIYA 1Y25A 4DSRA 2HSMA 3ISOA 3IXRA 4BA7A 4AGSA 1UVZA 1ERVA 1F37A 2HXKA 3GTUA 1A24A 2LNTA 1USBA 5CREA 5D9XA 2H0GA 1JLVA 4WR4A 2V6OA 1TK8B 2VM1A 1K0OA 4KH7A 5HR3A 5G2ZA 3ZVJD 3WD6A 1AQVA 4AJ8A 4HUAA 3QD9A 3DEXA 4D73B 1SKSB 2KP2A 3QFBC 4EXJA 1E6BA 1ST9A 2H01A 8GSSA 5A4VA 1O8XA 3IHQA 4AJ7A 2AJQB 1K3YA 2I9HA 2YV9A 2IMIA 4EKZA 2FWGA 3ZFLA 3GUSA 1A2MA 2QGVA 2XBIA 3IK7A 2IMFA 2FHEA 1XWGA 2H8LA 1ZGNA 2CAQA 2NDOA 4N0ZA 3A2XA 4TR3A 4DSQA 1RQMA 5DCGA 2L5OA 2PWJA 2MMZA 4XRAA 1I9DA 2YN1A 3LFLA 1V58A 3GSTA 4BPYA 2YJHA 2LEGA 3Q6OA 5JWQB 1MD3A 4MA9A 2PN8A 3HZ8A 3HY2A 4OCEA 1BAYA 4XHMA 3VWUA 1AW9A 1K0BA 2CVDA 2IWTA 4DVCA 4AJ6A 4JZQA 2WS2A 2F8AA 4J57E 3HJPA 4TR4A 3M3MA 1WPIA 3FY7A 3EE2A 6GSUA 2N5FA 3ERGA 3KD0A 2OACA 3TDGA 1AQXA 2CX3A 1GSYA 2H71A 3H4KA 5EL8A 5ID2B 4EUYA 1GTIA 2H1AA 1OC9B 4I6XA 3DXBA 3IA1A 1A2JA 3CRTA 4CDOA 1XVQA 1U6TA 3ZTLA 14GSA 1GP1A 3H79A 4IJ3A 4N0VA 2FGXA 4G0LA 2Z9SA 2K8VA 1BX9A 5C00A 1ILOA 4YQUA 3TOTA 4N11A 3GKKA 4NXIA 1XFLA 1A0FA 1V9WA 2XBQA 1HQOA 4FO5A 1ZMAA 3QCPA 1NHOA 2B1KA 5E59A 4PNGA 1B48A 4EDYA 2YWMA 3BD2A 1R5PA 2X64A 1PX6A 2PERA 1GNWA 3LWAA 3EC3A 5B6MA 5KN2A 2A4VA 3LYKA 4L5OA 4K6XA 1YDKA 1TRSA 3KZQA 3TJKA 5AISA 2QSIA 1IYHA 3FRCA 3QDNA 1T4YA 2WB9A 5DDLA 2GSRA 3FYGA 2FA8A 1X5EA 4DSSA 5D9VA 5B6NA 5EY6A 3H93A 2YPMA 5EVOA 1TK0B 1XBSA 5GAND 4BWQA 4Q5QA 5HR1A 3HVXA 13GSA 5D96A 4WEYA 2O89A 3UBKA 3VWWA 1B4QA 3APSA 1ML6A 4ECIA 2YCDA 1U3IA 2ZUPA 1URMA 3L4NA 5DJLA 2PMTA 3D5JA 3C1RA 2B7KA 4ID0A 3D0ZA 3GFKA 5COHA 2VUPA 1V98A 1EEJA 2B6MA 4ZB6A 3SWLA 5D9WA 3UOMA 4QL7A 2HZFA 1FB6A 2DJ2A 1Z7PA 5D9TA 2IPAA 2HFDA 3UJ1A 4X0XA 2YZUA 2CAIA 3QAVA 2B1LA 5IMZA 3G7IA 2H6ZA 1TU7A 2HNLA 4PGTA 5IMFA 4F0BA 3DRNA 3I69A 3L9VA 1B4PA 2O85A 4KF9A 1GLPA 3CMIA 1B9XC 2H30A 5DALA 3FZ9A 2REMA 2YZHA 1GUMA 4LMWA 4OMVA 4FQUA 6GSTA 1MD4A 1PL1A 2VLUA 4GCIA 2LKUA 2OBIA 1V2AA 1TK5B 4HS1A 1CQGA 2VL9A 3TJBA 3HHVA 3BBYA 2MZCA 3DMLA 4HJ2A 2JZRA 2VD0A 1AAZA 2C1YA 1PA3A 1M9BA 4MJBA 2AAWA 1TDIA 4NHWA 2F51A 1XW6A 3UARA 5FWGA 3H8QA 3FK8A 4KUNA 2H73A 5IO0A 3GRXA 2L6CA 4I97A 4POBA 4GSNA 4GQFA 3IE3A 4F0CA 1O85A 4N30A 2WDUA 3BCIA 3VWXA 3G9BA 2P5QA 1KBNA 2FWEA 5FT3A 6GSWA 3F0IA 1M9AA 3IAS2 4KAEA 4HEA2 3HCZA 3TKSC 4MF6A 3TRXA 1MEKA 4PQ1A 5ABRA 1FB0A 2FCHA 2GQMA 4XS4B 1QQ2A 1GTBA 2FA4A 3GURA 3L0HA 1EV4A 1KEBA 1B8XA 5JWOB 4CHSA 3IOSA 5AIVA 3EWLA 3HVVA 1F3AA 4IKHA 1PKZA 5L71A 9GSSA 3VK9A 1LU4A 3LSZA 3I9V2 3KP8A 1GSQA 3O3TA 4MF7A 4BL7A 1PX7A 2HSHA 4YH2A 6GSXA 3QR6A 4K0GA 1YJ6A 1WRYA 2YWIA 1PGTA 2C3QA 3VURA 2FUG2 1GTUA 2VCVA 3F63A 4PX1A 5G30A 3US3A 2V2GA 2WJUA 1X5DA 3CYNA 2CQ9A 4F82A 3KTBA 3IPZA 1CQHA 1MTCA 3FZ5A 1ABAA 4IS0A 4BVXA 5GSTA 4KSOA 2M46A 2O87A 2F8FA 4IGJA 1ZL9A 4IBPA 2LRCA 4E8EA 1T00A 3CSHA 3P90A 2EC4A 4ZB8A 3N9JA 4KDUA 2GT5A 5DQSA 3FZ4A 4I8BA 5ECRB 10GSA 2P31A 1XWAA 4K9ZA 3TJFA 1GLQA 4MPGA 1XWBA 3MAKA 2C0GA 1ZCPA 6GSYA 1XOAA 4BVYA 3FZAA 4TR1B 2VCWA 3ZMKA 1SK0A 2WRTA 2ALBA 1EV9A 2FY6A 4NV5A 3KMOA 2E2GA 3ZFBA 5J9BA 2EIQA 4G0IA 1T1VA 1R5AA 3GV1A 5DVBA 4ZILA 2IN3A 3D22A 4MZCA 3EU3A 3CXGA 2OJLA 2OE1A 5G1LA 2GSSA 5KN0A 3HDCA 3MWHA 2GDRA 2H75A 5CRDA 4PQHA 2GQKA 3PR8A 3D21A 5AN1A 1U87A 2UZ8A 4MZWA 1JZOA 1SJIA 3FR6A 1M2BA 3KGKA 4WETA 3DWVA 3WGDA 2ZCTA 3TKQA 1SK2A 1XWKA 1T3BA 2B7JA 3I43A 1F6MC 2L5LA 4L8EA 2VL2A 1THOA 1WOUA 2HRAA 3TCOA 5DCHA 2L4CA 4JBBA 2VLVA 3K8NA 4G19A 4ISDA 2O8VB 1S3AA 2B5EA 1TXXA 1EP7A 4YAPA 1R7HA 3CBUA 5IOWA 5HFGA 4EDZA 5BMUA 2KUCA 5DAKB 3V1WA 4PURA 3SBCA 4KW6A 2F9SA 4EE0A 12GSA 1PQNA 4PNFA 1EEMA 2LQOA 4ZL7A 3GL5A 5DJMA 3PGTA 2HYXA 3APQA 1T8EB 2R3XA 5D8IA 1EOGA 3HJOA 3IRAA 3TJGA 4LL1B 2GT6A 2HSYA 5AGYA 3P2AA 5J9CA 1EP8A 4G0KA 2C0FA 4L5LA 5J41A 2DSAA 4FYCA 2DIZA 4TR1A 5CP1A 4XS4A 1EGRA 4MABA 2E2MA 3A5WA 3A2WA 2DJ0A 4MDCA 4ECJA 2QKEA 5IMCA 1FOVA 5IPGA 1QFNA 3DIEA 1PMTA 1S3CA 1OAZA 3NOFA 3C73A 1XW9A 2H74A 4KX4A 1FVJA 1R4WA 3DKSA 4IP6A 2KLXA 1O73A 4V2NA 3GL3A 3CSIA 4K0NA 1XCCA 11GSA 1NSWA 5HFKA 4O5RA 2J9HA 4OCFA 4JEDA 5IIZA 2YNXA 4L0UA 1FG4A 2KP1A 1LBKA 1T4ZA 4WF4A 3C7MA 1TKDB 3WYWA 2CV4A 4FH8A 2LNSA 4ZXGA 3J7Yb 4IELA 1A8LA 2R6KA 1DE2A 2JADA 4POKA 2H19A 3ZRDA 5JCGA 1V57A 2BTOT 3UVTA 1Z6MA 2HSNB 3LEFA 3EYTA 1FW1A 1O8WA 3MSZA 3LXZA 1QMVA 2H76A 1TJDA 3ME7A 3VFIA 3VPTA 2JZSA 4E8HA 1RK4A 4PXOA 3CTGA 2R5GA 3O76A 4GRFA 2IL3A 2HQTA 2YWOA 3IDVA 1WJKA 2YWNA 3D4MA 4YAVA 3LG6A 1PRXA 1THXA 3DVWA 2E7PA 3F3QA 1SL0B 2VD1A 4K2DA 4MLYA 1FVKA 4DSSB 1PL2A 1YEXA 5INYA 2IMEA 2VCQA 3EMPA 3KM6A 1SENA 4GF0A 3ME8A 2TRCP 4IW9A 2NTOA 1G7EA 4KE3A 2PPTA 1JZWA 4XCSA 3L9SA 4ULXA 3JCML 4EO3A 3OR5A 1ZYEA 2CT6A 4PQIA 3LGCA 4HJMA 1OYJA 1H75A 1AXDA 2JL4A 3APOA 1JHBA 2K9FA 2BJXA 4IP1A 4POMA 4Q5NA 5CRWA 5DAKA 3TOUA 2HZEA 4XTSA 4O7HA 4TXVA 3N5OA 3FKFA 3G7JA 4QL9A 5HR0A 1GNEA 1Z5YE 3FR9A 2GZZA 2VM2A 1TRVA 1WMJA 5F05A 4G10A 2H6XA 2CVKA 4FYUA 1N2AA 3TKPA 1JLWA 4HOJA 1M99A 2X99A 5JCUA 1TRWA 1GSDA 2AHEA 2RUFA 2K6VA 3F4RA 4KNDA 2H0HA 1SJZA 5H5SA 7GSSA 1C72A 1WWJA 1M2DA 3UMAA 1R26A 2IMKA 1SD9A 2HRKA 3CTFA 4KB3A 1XWCA 4H86A 1AC1A 1ON4A 3RHCA 5H5QA 5ECKB 1QK8A 5JCWA 4NV2A 4LL4B 1K0MA 5HFIA 4POLA 2RM5A 5EPFA 1GL8A 2HI7A 4KDYA 3HKRA 2DJJA 3ZYWA 4D73A 4Z7XA 4J56E 3DGQA 5CYYA 2CX4A 2KOKA 1JZDA 3M1GA 1AUCA 4WBJA 2KHPA 1ERWA 5ECPB 4P3YB 2H72A 1GSUA 3MDKA 1YEPA 2OBKA 4GTUA 4V1Ap 3TKSE 4EVMA 1Z6NA 2IMDA 2LV3A 17GSA 1Z9HA 5A4WA 4G9HA 1I5GA 1OE7A 2JSZA 2A2RA 4BWSA 5GSSA 4GXZA 3LXTA 2DLXA 2YOIA 4MMMA 3EINA 3E0UA 3CSJA 4EC0A 2I1UA 3U5RE 1FHEA 4CW9A 3C1SA 3M0FA 4N10A 5CRHA 2N5BA 4I5QA 4XS1A 3O6TA 3L9UA 4MP4A 2QC7A 3IC4A 2H0IA 3HVSA 1GSFA 4YQMA 5ELAA 3KEBA 3KXOA 1GUHA 3LJRA 3F6DA 4ILFA 1VF4A 2X8HA 4MH3A 2X8GA 3PINA 2DBCA 4RUVA 3FEUA 2RLIA 2CZ3A 4OFNA 3GKNA 3WT2A 3IBHA 1MDIA 3Q18A 2V1MA 2GVPA 4GQCA 4LLRA 2PVOC 1X9WB 2GQLA 1W4VA 2K18A 2DJ3A 3TB2A 1J9BA 4HU9A 1AQWA 1F3BA 1XPVA 2C80A 1SL2B 5F8BA 4X1UA 4ZBDA 16GSA 1WP0A 1VRSD 5ELGA 3UAPA 1JFUA 2WFCA 3NIVA 4LMVA 3GSSA 2LSTA
chains in the Genus database with same CATH superfamily
4ZBAA 1ZOFA 4QQ7A 2L6DA 1DBYA 3GH9A 1M7TA 5J5NA 1SJ6A 3GA4A 2DMMA 3M9KA 1BG5A 3KIJA 4EF0A 1X9MB 3ZL5A 1EGOA 1YY7A 1GTAA 3IV4A 2OE3A 4ZL8A 4E68A 1DUGA 2MMAA 2BMXA 1SD8A 1UA5A 1A8YA 2NPBA 1JZRA 1EOHA 1O81A 2CA8A 2OE0A 3RGBC 1WE0A 1SKRB 2HLSA 3Q19A 2YV7A 1Q4JA 3CRUA 2HRFA 4JU5A 3TRPA 2HRKB 2DIYA 1OVNA 3F9UA 1VF2A 1NW2A 4JRRA 4JE1A 3F6FA 4GWRA 2L59A 3KJYA 2JU5A 2HSNA 5KOWA 2LQQA 4YQVA 2R0PA 3KTLA 4I2TA 3QFAC 1G7OA 3VI5A 2GSTA 2XC2A 3EMXA 1UN2A 2EIRA 2IJYA 3ZIVA 3QAGA 5J4UA 5IOXA 5IM9A 5GAPD 2K8SA 3QPMA 3HZ4A 2GTUA 4FIWA 4HZ4A 1VF3A 4X43A 1TOFA 2JZTA 5LD0A 3GX0A 1IYIA 3A3TA 2MMNA 5CAXA 4K1FA 3HD5A 3TU3B 5A5HA 3VLNA 2C8UA 5ECMB 1TU8A 4LA1A 1BJXA 20GSA 4BL7B 3UVHA 3Q74A 3EURA 2H6YA 1GUKA 4WR5A 2J23A 2EIOA 5ECIB 1S3DA 2LJKA 3S9FA 1PKWA 2LTKA 2HRNA 1W89A 1M0UA 5KEJA 4Q5RA 4RI6A 2GZYA 4TR0A 4ACSA 3FW2A 2HZEB 2TIRA 4TW5A 1X5CA 3ZZXA 4PTSA 4IHUA 2ES7A 2VL3A 3F4TA 3ZIJA 2GLRA 4NMUA 1EWXA 3ERWA 4MH2A 4WBRD 3VPQA 2VL2C 3HA9A 5J4YA 1XW5A 1RW1A 3VI7A 3ZLPA 2OA7A 3L78A 5ECSA 2I3YA 4RQRA 2NBSA 5A5KA 1T7PB 4K7OA 1SYRA 1EZKA 1G6YA 1HNAA 2ZNMA 1TI1A 3I6AA 4PUFC 2G2QA 1K0CA 2VIMA 1AIUA 3W8SA 3UIWA 5C04A 5CRGA 4F03A 4GSSA 1TP9A 3QMXA 1YKCA 1XZOA 5D73A 3IHGA 1OKTA 4JR6A 2P0GA 4ZB7A 3DVXA 2FLSA 1K3OA 2LUSA 4PI2C 4AI6A 1Q98A 1PN0A 2XPDA 3TJJA 3IR4A 4OO4A 2TRXA 3VWVA 3TGZA 3P7XA 2CVBA 4MJCA 2RM6A 1TI3A 3F4SA 4ML6A 5IPHA 2DJ1A 3DD3A 2IFQB 2E0QA 1SL1B 5GZZB 2CZ2A 2VCTA 1YKAA 3HJMA 4MPFA 1TXUA 5A34B 5HR2A 2HT9A 1K3LA 1PD21 3CHXC 1M2AA 4ZIJA 3MYDA 3HYPA 1BF5A 5J4VA 4TKYA 1WIKA 1OC9A 4KA0A 4TN8A 5CO3A 4V2LA 1PN9A 3GYKA 2DC5A 4RQXA 2IIYA 3MNGA 2VOCA 4F2IA 2HE3A 2ON5A 5ENUA 3M9JA 3MIXA 3TKRA 3WGXA 3ZMLA 2GZPA 5IMVA 3GTUB 2FWFA 2B5YA 4PUAA 1Z7RA 3TUEA 1NHYA 4NAXA 1BYEA 3W6GA 2DMLA 3GHAA 1U3AA 4ML1A 3UEMA 5J3RA 2PVQA 1GSSA 1F2EA 3PH9A 1GSEA 1BQ7A 3ERFA 3GX8A 5LCZA 2H1DA 3TRQA 1TRUA 2PUKC 1QGVA 4K7NA 4V2MA 4EIPA 2R2JA 1VGLA 4ECCA 1OC8A 5KN1A 2JSYA 1K0AA 4KDXA 1MDKA 2AUVA 2MMOA 4AKHA 3GH6A 4XRDA 3TKSA 2F3MA 1X9SB 6GSVA 1GRXA 4KCEA 1ERTA 5DBQA 3EVIA 2I4AA 2B3SA 2MBTA 4O92A 4GLTA 4V1Ag 2MBSA 2C3TA 2WULA 2WZ9A 1FAAA 2WVXB 4OFTA 2VCZA 3C8EA 4XIHA 3U6VA 3UL3A 3KH9A 1X0RA 1Z3EA 2JACA 1OKDA 5J40A 4BIKA 2A2SA 5HQPA 1GH2A 4EL1A 1N8JA 1M3IA 3R2QA 3G7YA 4TXOA 3LYPA 3GN3A 4ECBA 4NPBA 2XPEA 4TVEA 3IC8A 4HDEA 2LJRA 2WCIA 1HNBA 2L4QA 4MF5A 4KCAA 4HQZA 1KNGA 4ZL9A 4NHZA 1G0TA 4TRXA 1LJRA 3QOUA 2AYTA 2H1GA 1UC7A 5DQYA 4G2EA 4BVXB 4MJAA 2WW0A 2OKAA 3RPNA 2PGTA 5KN3A 3M8NA 3BCKA 5G5FA 2R37A 2C0EA 2M80A 5D93A 2C0DA 2O3EA 3GNJA 3ZITA 4F9ZA 3QAWA 1OE8A 1PSQA 3NZNA 2GGTA 3AY8A 1XG8A 3ZREA 2GS3A 4Q5FA 2GSQA 3BJ5A 3WGEA 5IQYA 1Y6EA 3GIXA 4IN0A 2ON7A 4OD7A 2LJAA 3F3RA 2FNOA 4WKWA 3LORA 2L57A 1K0DA 4L0WA 5ECQB 2N5AA 3P8WA 3RPPA 4BVYB 2V6KA 2X8CA 4ZBBA 1BEDA 2NVLA 1A23A 4O32A 3EU4A 1FOHA 5G1KA 3DYRA 4USSA 3H1NA 3WT1A 2AB6A 5F0GA 1GULA 5B8BA 4DEJA 1ZYQB 5AIXA 1U88A 2G0FA 1NM3A 2FD3A 4MZBA 4HU7A 4TOPA 1XXUA 1TTZA 1ZZYA 2PU9C 1HYUA 3RBTA 1OC3A 3R3EA 1QUWA 4FYBA 19GSA 3LQ7A 2M72A 1DE1A 1YF1A 2H1BA 3D6IA 2DJKA 4KGIA 4XS6A 6GSSA 1TW9A 2D2ZA 3IK9A 4AKIA 1K0NA 1ERUA 1V40A 5H5RA 4HQSA 4IJIA 1SK1A 3J7Yk 4MK3A 4HZ2A 3ZVJA 3W8JA 3KP9A 2LS5A 5IMDA 1QXHA 1DSBA 3E3EA 2B5XA 2O7KA 1ACVA 3E9JB 5G31A 1YQ1A 5CNWA 2VKZG 4HI7A 3ED3A 1I1IP 4IVFA 2V32A 1BG1A 2I81A 1A0RP 5E4WA 5ECHB 2MYGA 2HSMB 3GKMA 2LRNA 3IAM2 1MDJA 2PBJA 3HXSA 3GKXA 2H66A 4K8MA 5LNKe 4JR4A 1SU9A 4WXTA 3PPUA 4ZB9A 2YP6A 1E2YA 4K7IA 2R4VA 22GSA 5DALB 5F06A 3FR3A 2VCXA 4RI7A 2DKIA 5IMAA 5IO2A 5B8AA 3C71A 5JWRB 1YZXA 1SYXA 5G5EA 1H4OA 4NWYA 3KMNA 5B7CA 1YVLA 2WGRA 1S4BP 5ECOB 2OADA 4TXOB 4OFMA 3GMFA 5ID2A 3A2VA 1G6WA 1B9YC 2H70A 1J08A 1FO5A 4I2UA 1XOBA 4OWYA 18GSA 5A4UA 2RIIA 2VLTA 1XVWA 3UBLA 3RAZA 4MCUA 2C3NA 2LRTA 4IQAA 5FHIA 2YJ7A 3FHKA 2VO4A 3BOAA 2V41A 1GWCA 4HSCX 1YF0A 1O7UA 3RDWA 2VAFA 2C4JA 4OO5A 5ECLB 1HNCA 3KH7A 5F07A 5ECNB 4K5RA 1KTEA 4J2FA 4KSMA 2XHFA 3RHBA 4WF5A 1J0FA 1F9MA 2AV4A 1VF1A 2YANA 1HD2A 1SKWB 3EPTA 3D4TA 3F8UA 1A2LA 4GSTA 4AF2A 2FWHA 2P5RA 3KCMA 4IQ1A 2RUEA 4MJEA 2IFQA 1O6JA 2X4AA 1XIYA 1Y25A 4DSRA 2HSMA 3ISOA 3IXRA 4BA7A 4AGSA 1ZYPA 1UVZA 1ERVA 1F37A 2HXKA 3GTUA 1A24A 2LNTA 1USBA 5CREA 5D9XA 2H0GA 1JLVA 4WR4A 2V6OA 1TK8B 5BMUB 2VM1A 1K0OA 4KH7A 5HR3A 5G2ZA 3ZVJD 3WD6A 1AQVA 4AJ8A 4HUAA 3QD9A 3DEXA 4D73B 1SKSB 2KP2A 3QFBC 4EXJA 1E6BA 1ST9A 1ZYNA 2H01A 8GSSA 5A4VA 1O8XA 3IHQA 4AJ7A 2AJQB 1K3YA 2I9HA 2YV9A 5A5HB 2IMIA 4EKZA 2FWGA 3ZFLA 3GUSA 1A2MA 2QGVA 2XBIA 3IK7A 2A4HA 2IMFA 2FHEA 1XWGA 2H8LA 1ZGNA 2CAQA 2NDOA 4N0ZA 3A2XA 4TR3A 4DSQA 1RQMA 5DCGA 4GDFA 2L5OA 2PWJA 2MMZA 4XRAA 1I9DA 2YN1A 3LFLA 1V58A 3GSTA 4BPYA 2YJHA 2LEGA 3Q6OA 5JWQB 1MD3A 4MA9A 2PN8A 3HZ8A 3HY2A 4OCEA 1BAYA 4XHMA 3VWUA 1AW9A 1K0BA 2CVDA 2IWTA 4DVCA 4AJ6A 4JZQA 2WS2A 2F8AA 4J57E 3HJPA 4TR4A 3M3MA 1WPIA 3FY7A 3EE2A 6GSUA 2N5FA 3ERGA 3KD0A 2OACA 3TDGA 1AQXA 2CX3A 1GSYA 2H71A 3H4KA 4K2XA 5EL8A 5ID2B 4EUYA 1YEWC 1GTIA 2H1AA 1OC9B 4I6XA 3DXBA 3IA1A 1A2JA 3CRTA 4CDOA 1XVQA 1U6TA 3ZTLA 14GSA 1PFOA 1GP1A 3H79A 4IJ3A 4N0VA 2FGXA 4G0LA 2Z9SA 2K8VA 1BX9A 5C00A 1ILOA 2WZSA 4NXIA 4YQUA 2WW1A 3TOTA 3GKKA 4N11A 1XFLA 1A0FA 1V9WA 2XBQA 1HQOA 4FO5A 1ZMAA 3QCPA 1NHOA 2B1KA 5E59A 4PNGA 1B48A 4EDYA 2YWMA 3BD2A 1R5PA 2X64A 1PX6A 2PERA 1GNWA 3LWAA 3EC3A 5B6MA 4Z2TA 4CY8A 5KN2A 2A4VA 3LYKA 4L5OA 4K6XA 1YDKA 1TRSA 3KZQA 3TJKA 4W66A 5AISA 2QSIA 1IYHA 3A5IA 3FRCA 3QDNA 1T4YA 2WB9A 5DDLA 2GSRA 3FYGA 2FA8A 1X5EA 4DSSA 5D9VA 5B6NA 5EY6A 3H93A 2O36A 2YPMA 5EVOA 1TK0B 1XBSA 5GAND 4BWQA 4Q5QA 5HR1A 3HVXA 13GSA 5D96A 4WEYA 2O89A 3UBKA 3VWWA 1B4QA 3APSA 1ML6A 4ECIA 2YCDA 1U3IA 2ZUPA 1URMA 3L4NA 5DJLA 2PMTA 3D5JA 3C1RA 2B7KA 4ID0A 3D0ZA 3GFKA 5COHA 2VUPA 1V98A 1EEJA 2B6MA 1N25A 4ZB6A 3SWLA 5D9WA 3UOMA 4QL7A 2R0GA 2HZFA 1FB6A 2DJ2A 1Z7PA 5D9TA 2IPAA 2HFDA 3UJ1A 4X0XA 2YZUA 2CAIA 3QAVA 2B1LA 5IMZA 3G7IA 2H6ZA 1TU7A 2HNLA 4PGTA 5IMFA 4F0BA 3DRNA 4CY6A 3I69A 3L9VA 1B4PA 2O85A 4KF9A 1GLPA 5A34A 3CMIA 1B9XC 4A5PA 2H30A 5DALA 3FZ9A 2REMA 2YZHA 5KOXA 1GUMA 4LMWA 4OMVA 4FQUA 6GSTA 1MD4A 1PL1A 2VLUA 4GCIA 2LKUA 2OBIA 1V2AA 1TK5B 4HS1A 1CQGA 2VL9A 3TJBA 3HHVA 3BBYA 2MZCA 3DMLA 4HJ2A 2JZRA 2VD0A 1AAZA 2C1YA 1PA3A 4MJBA 1M9BA 4PHZC 2AAWA 1TDIA 4NHWA 2OT3A 2F51A 1XW6A 4YKFA 3UARA 5FWGA 3H8QA 3FK8A 4KUNA 2H73A 5IO0A 3GRXA 2L6CA 4I97A 4POBA 4GSNA 4GQFA 3IE3A 4F0CA 1SVOA 1O85A 4N30A 2WDUA 3BCIA 3VWXA 3G9BA 2P5QA 1KBNA 2FWEA 5FT3A 2EFEA 2EFHA 6GSWA 3F0IA 1M9AA 3IAS2 4KAEA 4HEA2 3HCZA 3TKSC 4MF6A 3TRXA 1MEKA 4PQ1A 5ABRA 1FB0A 2FCHA 2GQMA 4XS4B 1QQ2A 1GTBA 2FA4A 3GURA 3L0HA 1EV4A 1KEBA 1B8XA 4YKGA 5JWOB 3FMWA 4CHSA 3IOSA 5AIVA 3EWLA 3HVVA 1F3AA 4IKHA 1PKZA 5L71A 9GSSA 3VK9A 1LU4A 3LSZA 3I9V2 3KP8A 1GSQA 3O3TA 4MF7A 4BL7A 1PX7A 2HSHA 4YH2A 6GSXA 3QR6A 4K0GA 1YJ6A 1WRYA 2YWIA 1PGTA 2C3QA 3VURA 2FUG2 3CQFA 3CWGA 1GTUA 2VCVA 3F63A 4PX1A 2EFCA 5G30A 3US3A 2V2GA 2WJUA 2WVXA 1X5DA 3CYNA 1SVLA 2CQ9A 4F82A 3KTBA 3IPZA 1CQHA 1MTCA 3FZ5A 1ABAA 4IS0A 4BVXA 5GSTA 3HMJG 4KSOA 2M46A 2O87A 2F8FA 4IGJA 1ZL9A 2WW3A 1M3JA 4FXYP 4IBPA 2LRCA 4E8EA 1T00A 3CSHA 3P90A 2EC4A 4ZB8A 3N9JA 4KDUA 2GT5A 5DQSA 5A1NA 3FZ4A 4I8BA 5ECRB 10GSA 2P31A 1XWAA 4K9ZA 3TJFA 1GLQA 4MPGA 1XWBA 3MAKA 2C0GA 1ZCPA 6GSYA 1XOAA 4BVYA 3FZAA 4TR1B 2QA1A 2VCWA 3ZMKA 1SK0A 2WRTA 2ALBA 1EV9A 2FY6A 4NV5A 3KMOA 2E2GA 3ZFBA 5J9BA 2EIQA 4G0IA 2H1LA 1T1VA 1R5AA 3GV1A 5DVBA 4ZILA 2IN3A 3D22A 4MZCA 3EU3A 3CXGA 2OJLA 2OE1A 5G1LA 2GSSA 5KN0A 3RFRC 3HDCA 3MWHA 2GDRA 2H75A 5CRDA 2WVZA 4PQHA 2GQKA 3PR8A 3D21A 5AN1A 1U87A 2UZ8A 4MZWA 1JZOA 5BRTA 1SJIA 3FR6A 1M2BA 3KGKA 4WETA 3DWVA 3WGDA 2ZCTA 3TKQA 5J47A 1SK2A 1XWKA 1T3BA 2B7JA 3I43A 1F6MC 2L5LA 4L8EA 2VL2A 1THOA 1WOUA 2HRAA 3TCOA 5DCHA 2L4CA 4JBBA 2VLVA 3K8NA 4G19A 4ISDA 2O8VB 1S3AA 2B5EA 1TXXA 1EP7A 1SVMA 4YAPA 1R7HA 3CBUA 5IOWA 5HFGA 4EDZA 1Y1UA 5BMUA 2KUCA 5DAKB 3V1WA 4PURA 3SBCA 4KW6A 2F9SA 4EE0A 12GSA 1PQNA 4PNFA 1EEMA 2LQOA 4ZL7A 3GL5A 5DJMA 3PGTA 2HYXA 3APQA 1T8EB 2R3XA 5D8IA 1EOGA 3HJOA 3IRAA 3TJGA 4LL1B 2GT6A 2HSYA 5AGYA 3P2AA 5J9CA 1EP8A 2O5VA 4G0KA 2C0FA 4L5LA 5J41A 2DSAA 4FYCA 2DIZA 4TR1A 5CP1A 4XS4A 1EGRA 4MABA 2E2MA 3A5WA 3A2WA 2DJ0A 4MDCA 4ECJA 2QKEA 5IMCA 1FOVA 3HVNA 5IPGA 1QFNA 3DIEA 1PMTA 1S3CA 1OAZA 3NOFA 3C73A 1XW9A 2H74A 4KX4A 1FVJA 1R4WA 3DKSA 4IP6A 2KLXA 1O73A 4V2NA 3GL3A 3CSIA 4K0NA 1XCCA 11GSA 1NSWA 5HFKA 4O5RA 2J9HA 4OCFA 4JEDA 5IIZA 2YNXA 4L0UA 1FG4A 2KP1A 1LBKA 1T4ZA 4WF4A 3C7MA 1TKDB 3WYWA 2CV4A 4FH8A 2LNSA 4ZXGA 3J7Yb 4IELA 1A8LA 2R6KA 1DE2A 2UV8G 2JADA 4POKA 2H19A 4EIQA 3ZRDA 5JCGA 1V57A 2BTOT 3UVTA 1Z6MA 2HSNB 3LEFA 3LW9A 3EYTA 1FW1A 1O8WA 3MSZA 3LXZA 1QMVA 2H76A 1TJDA 3ME7A 3VFIA 3VPTA 2JZSA 4E8HA 4Z2UA 1RK4A 4PXOA 3CTGA 2R5GA 3O76A 4GRFA 2IL3A 2HQTA 2YWOA 3IDVA 1WJKA 2YWNA 3D4MA 4YAVA 3LG6A 5A1NB 1PRXA 1THXA 3DVWA 2E7PA 3F3QA 1SL0B 2A2PA 2VD1A 4K2DA 4MLYA 1FVKA 4DSSB 1PL2A 1YEXA 5INYA 2IMEA 2VCQA 3EMPA 3KM6A 1SENA 4GF0A 4PI0C 3ME8A 2X49A 2TRCP 4IW9A 2NTOA 1G7EA 4KE3A 2PPTA 1JZWA 4XCSA 3L9SA 4ULXA 3JCML 4EO3A 3OR5A 1ZYEA 2CT6A 4PQIA 3LGCA 4HJMA 1OYJA 1H75A 1AXDA 2JL4A 3APOA 1JHBA 1S3RA 2DKHA 2BJXA 2K9FA 4IP1A 4POMA 4Q5NA 5CRWA 5DAKA 3TOUA 2HZEA 4AKXB 4XTSA 2R0CA 4O7HA 4TXVA 3N5OA 3FKFA 3G7JA 4QL9A 5HR0A 1GNEA 1Z5YE 3FR9A 2GZZA 2VM2A 1TRVA 1WMJA 5F05A 4G10A 2H6XA 2CVKA 4MNNA 4FYUA 1N2AA 3TKPA 1JLWA 4HOJA 1M99A 2X99A 5JCUA 1TRWA 1GSDA 2AHEA 2RUFA 2K6VA 3F4RA 4KNDA 2H0HA 1SJZA 4K5SA 4QMKA 5H5SA 7GSSA 1C72A 1WWJA 1M2DA 3UMAA 1R26A 2IMKA 1SD9A 2HRKA 2WVYA 3CTFA 4KB3A 1XWCA 4H86A 1AC1A 1ON4A 3RHCA 5H5QA 5ECKB 1QK8A 5JCWA 4NV2A 4LL4B 1K0MA 5HFIA 4POLA 2RM5A 5EPFA 1GL8A 2HI7A 4Z2RA 4O5UA 4KDYA 3HKRA 2DJJA 3ZYWA 4D73A 4Z7XA 4J56E 2EFDA 3DGQA 5CYYA 2CX4A 2KOKA 1JZDA 3M1GA 1AUCA 4WBJA 2KHPA 4N3ZA 1ERWA 5ECPB 4P3YB 2H72A 1GSUA 3MDKA 1YEPA 2OBKA 4GTUA 4V1Ap 3TKSE 4EVMA 1Z6NA 2IMDA 2LV3A 17GSA 1Z9HA 5A4WA 4G9HA 1I5GA 1OE7A 2JSZA 2A2RA 4BWSA 2QA2A 5GSSA 4GXZA 3LXTA 4G01A 2DLXA 2YOIA 4MMMA 3EINA 3E0UA 3CSJA 4EC0A 2I1UA 3U5RE 1FHEA 4CW9A 4O5QA 3C1SA 3M0FA 2WW2A 4N10A 5CRHA 2N5BA 4I5QA 4XS1A 3O6TA 3L9UA 4MP4A 2QC7A 3IC4A 2H0IA 3HVSA 1GSFA 4YQMA 5ELAA 3KEBA 3KXOA 1GUHA 3LJRA 3F6DA 4ILFA 1VF4A 2X8HA 4MH3A 2X8GA 3PINA 2DBCA 4RUVA 3FEUA 2RLIA 2CZ3A 4OFNA 3GKNA 3WT2A 3IBHA 1MDIA 3Q18A 2V1MA 2GVPA 4GQCA 4LLRA 2PVOC 1X9WB 2GQLA 1W4VA 2K18A 2DJ3A 3TB2A 4HU9A 1J9BA 1AQWA 4AKGA 1F3BA 1XPVA 2C80A 1SL2B 4X4JA 5F8BA 4X1UA 4ZBDA 16GSA 1WP0A 1VRSD 4ICYA 5ELGA 3UAPA 1JFUA 2WFCA 3NIVA 4LMVA 3GSSA 2LSTA
chains in the Genus database with same CATH topology
4ZBAA 1ZOFA 4QQ7A 2L6DA 1DBYA 3GH9A 1M7TA 5J5NA 1SJ6A 3GA4A 2DMMA 3M9KA 1BG5A 3KIJA 4EF0A 1X9MB 3ZL5A 1EGOA 1YY7A 1GTAA 3IV4A 2OE3A 4ZL8A 4E68A 1DUGA 2MMAA 2BMXA 1SD8A 1UA5A 1A8YA 2NPBA 1JZRA 1EOHA 1O81A 2CA8A 2OE0A 1WE0A 1SKRB 2HLSA 3Q19A 2YV7A 1Q4JA 3CRUA 2HRFA 4JU5A 3TRPA 2HRKB 2DIYA 1OVNA 3F9UA 1VF2A 1NW2A 4JRRA 4JE1A 3F6FA 4GWRA 2L59A 3KJYA 2JU5A 2HSNA 5KOWA 2LQQA 4YQVA 2R0PA 3KTLA 4I2TA 3QFAC 1G7OA 3VI5A 2GSTA 2XC2A 3EMXA 1UN2A 2EIRA 2IJYA 3ZIVA 3QAGA 5J4UA 5IOXA 5IM9A 5GAPD 2K8SA 3QPMA 3HZ4A 2GTUA 4FIWA 4HZ4A 1VF3A 4X43A 1TOFA 2JZTA 5LD0A 3GX0A 1IYIA 3A3TA 2MMNA 5CAXA 4K1FA 3HD5A 3TU3B 5A5HA 3VLNA 2C8UA 5ECMB 1TU8A 4LA1A 1BJXA 20GSA 4BL7B 3UVHA 3Q74A 3EURA 2H6YA 1GUKA 4WR5A 2J23A 2EIOA 5ECIB 1S3DA 2LJKA 3S9FA 1PKWA 2LTKA 2HRNA 1W89A 1M0UA 5KEJA 4Q5RA 4RI6A 2GZYA 4TR0A 4ACSA 3FW2A 2HZEB 2TIRA 4TW5A 1X5CA 3ZZXA 4PTSA 4IHUA 2ES7A 2VL3A 3F4TA 3ZIJA 2GLRA 4NMUA 1EWXA 3ERWA 4MH2A 4WBRD 3VPQA 2VL2C 3HA9A 5J4YA 1XW5A 1RW1A 3VI7A 3ZLPA 2OA7A 3L78A 5ECSA 2I3YA 4RQRA 2NBSA 5A5KA 1T7PB 4K7OA 1SYRA 1EZKA 1G6YA 1HNAA 2ZNMA 1TI1A 3I6AA 4PUFC 2G2QA 1K0CA 2VIMA 1AIUA 3W8SA 3UIWA 5C04A 5CRGA 4F03A 4GSSA 1TP9A 3QMXA 1YKCA 1XZOA 5D73A 3IHGA 1OKTA 4JR6A 2P0GA 4ZB7A 3DVXA 2FLSA 1K3OA 2LUSA 4AI6A 1Q98A 1PN0A 2XPDA 3TJJA 3IR4A 4OO4A 2TRXA 3VWVA 3TGZA 3P7XA 2CVBA 4MJCA 2RM6A 1TI3A 3F4SA 4ML6A 5IPHA 2DJ1A 3DD3A 2IFQB 2E0QA 1SL1B 5GZZB 2CZ2A 2VCTA 1YKAA 3HJMA 4MPFA 1TXUA 5A34B 5HR2A 2HT9A 1K3LA 1PD21 1M2AA 4ZIJA 3MYDA 3HYPA 1BF5A 5J4VA 4TKYA 1WIKA 1OC9A 4KA0A 4TN8A 5CO3A 4V2LA 1PN9A 3GYKA 2DC5A 4RQXA 2IIYA 3MNGA 2VOCA 4F2IA 2HE3A 2ON5A 5ENUA 3M9JA 3MIXA 3TKRA 3WGXA 3ZMLA 2GZPA 5IMVA 3GTUB 2FWFA 2B5YA 4PUAA 1Z7RA 3TUEA 1NHYA 4NAXA 1BYEA 3W6GA 2DMLA 3GHAA 1U3AA 4ML1A 3UEMA 5J3RA 2PVQA 1GSSA 1F2EA 3PH9A 1GSEA 1BQ7A 3ERFA 3GX8A 5LCZA 2H1DA 3TRQA 1TRUA 2PUKC 1QGVA 4K7NA 4V2MA 4EIPA 2R2JA 1VGLA 4ECCA 1OC8A 5KN1A 2JSYA 1K0AA 4KDXA 1MDKA 2AUVA 2MMOA 4AKHA 3GH6A 4XRDA 3TKSA 2F3MA 1X9SB 6GSVA 1GRXA 4KCEA 1ERTA 5DBQA 3EVIA 2I4AA 2B3SA 2MBTA 4O92A 4GLTA 4V1Ag 2MBSA 2C3TA 2WULA 2WZ9A 1FAAA 4OFTA 2VCZA 3C8EA 4XIHA 3U6VA 3UL3A 3KH9A 1X0RA 1Z3EA 2JACA 1OKDA 5J40A 2A2SA 5HQPA 1GH2A 4EL1A 1N8JA 3R2QA 3G7YA 4TXOA 3LYPA 3GN3A 4ECBA 4NPBA 2XPEA 4TVEA 3IC8A 4HDEA 2LJRA 2WCIA 1HNBA 2L4QA 4MF5A 4KCAA 4HQZA 1KNGA 4ZL9A 4NHZA 1G0TA 4TRXA 1LJRA 3QOUA 2AYTA 2H1GA 1UC7A 5DQYA 4G2EA 4BVXB 4MJAA 2OKAA 3RPNA 2PGTA 5KN3A 3M8NA 3BCKA 5G5FA 2R37A 2C0EA 2M80A 5D93A 2C0DA 3GNJA 3ZITA 4F9ZA 3QAWA 1OE8A 1PSQA 3NZNA 2GGTA 3AY8A 3ZREA 2GS3A 4Q5FA 2GSQA 3BJ5A 3WGEA 5IQYA 1Y6EA 3GIXA 4IN0A 2ON7A 4OD7A 2LJAA 3F3RA 2FNOA 4WKWA 3LORA 2L57A 1K0DA 4L0WA 5ECQB 2N5AA 3P8WA 3RPPA 4BVYB 2V6KA 2X8CA 4ZBBA 1BEDA 2NVLA 1A23A 4O32A 3EU4A 1FOHA 5G1KA 3DYRA 4USSA 3H1NA 3WT1A 2AB6A 5F0GA 1GULA 5B8BA 4DEJA 1ZYQB 5AIXA 1U88A 2G0FA 1NM3A 2FD3A 4MZBA 4HU7A 4TOPA 1XXUA 1TTZA 1ZZYA 2PU9C 1HYUA 3RBTA 1OC3A 3R3EA 1QUWA 4FYBA 19GSA 3LQ7A 2M72A 1DE1A 1YF1A 2H1BA 3D6IA 2DJKA 4KGIA 4XS6A 6GSSA 1TW9A 2D2ZA 3IK9A 4AKIA 1K0NA 1ERUA 1V40A 5H5RA 4HQSA 4IJIA 1SK1A 3J7Yk 4MK3A 4HZ2A 3ZVJA 3W8JA 3KP9A 2LS5A 5IMDA 1QXHA 1DSBA 3E3EA 2B5XA 2O7KA 1ACVA 3E9JB 5G31A 1YQ1A 5CNWA 2VKZG 4HI7A 3ED3A 4IVFA 2V32A 1BG1A 2I81A 1A0RP 5E4WA 5ECHB 2MYGA 2HSMB 3GKMA 2LRNA 3IAM2 1MDJA 2PBJA 3HXSA 3GKXA 2H66A 4K8MA 5LNKe 4JR4A 1SU9A 4WXTA 3PPUA 4ZB9A 2YP6A 1E2YA 4K7IA 2R4VA 22GSA 5DALB 5F06A 3FR3A 2VCXA 4RI7A 2DKIA 5IMAA 5IO2A 5B8AA 3C71A 5JWRB 1YZXA 1SYXA 5G5EA 1H4OA 4NWYA 3KMNA 5B7CA 1YVLA 2WGRA 5ECOB 2OADA 4TXOB 4OFMA 3GMFA 5ID2A 3A2VA 1G6WA 1B9YC 2H70A 1J08A 1FO5A 4I2UA 1XOBA 4OWYA 18GSA 5A4UA 2RIIA 2VLTA 1XVWA 3UBLA 3RAZA 4MCUA 2C3NA 2LRTA 4IQAA 5FHIA 2YJ7A 3FHKA 2VO4A 3BOAA 2V41A 1GWCA 1YF0A 1O7UA 3RDWA 2VAFA 2C4JA 4OO5A 5ECLB 1HNCA 3KH7A 5F07A 5ECNB 4K5RA 1KTEA 4J2FA 4KSMA 2XHFA 3RHBA 4WF5A 1J0FA 1F9MA 2AV4A 1VF1A 2YANA 1HD2A 1SKWB 3EPTA 3D4TA 3F8UA 1A2LA 4GSTA 4AF2A 2FWHA 2P5RA 3KCMA 4IQ1A 2RUEA 4MJEA 2IFQA 1O6JA 2X4AA 1XIYA 1Y25A 4DSRA 2HSMA 3ISOA 3IXRA 4BA7A 4AGSA 1ZYPA 1UVZA 1ERVA 1F37A 2HXKA 3GTUA 1A24A 2LNTA 1USBA 5CREA 5D9XA 2H0GA 1JLVA 4WR4A 2V6OA 1TK8B 5BMUB 2VM1A 1K0OA 4KH7A 5HR3A 5G2ZA 3ZVJD 3WD6A 1AQVA 4AJ8A 4HUAA 3QD9A 3DEXA 4D73B 1SKSB 2KP2A 3QFBC 4EXJA 1E6BA 1ST9A 1ZYNA 2H01A 8GSSA 5A4VA 1O8XA 3IHQA 4AJ7A 2AJQB 1K3YA 2I9HA 2YV9A 5A5HB 2IMIA 4EKZA 2FWGA 3ZFLA 3GUSA 1A2MA 2QGVA 2XBIA 3IK7A 2A4HA 2IMFA 2FHEA 1XWGA 2H8LA 1ZGNA 2CAQA 2NDOA 4N0ZA 3A2XA 4TR3A 4DSQA 1RQMA 5DCGA 4GDFA 2L5OA 2PWJA 2MMZA 4XRAA 1I9DA 2YN1A 3LFLA 1V58A 3GSTA 4BPYA 2YJHA 2LEGA 3Q6OA 5JWQB 1MD3A 4MA9A 2PN8A 3HZ8A 3HY2A 4OCEA 1BAYA 4XHMA 3VWUA 1AW9A 1K0BA 2CVDA 2IWTA 4DVCA 4AJ6A 4JZQA 2WS2A 2F8AA 4J57E 3HJPA 4TR4A 3M3MA 1WPIA 3FY7A 3EE2A 6GSUA 2N5FA 3ERGA 3KD0A 2OACA 3TDGA 1AQXA 2CX3A 1GSYA 2H71A 3H4KA 4K2XA 5EL8A 5ID2B 4EUYA 1GTIA 2H1AA 1OC9B 4I6XA 3DXBA 3IA1A 1A2JA 3CRTA 4CDOA 1XVQA 1U6TA 3ZTLA 14GSA 1GP1A 3H79A 4IJ3A 4N0VA 2FGXA 4G0LA 2Z9SA 2K8VA 1BX9A 5C00A 1ILOA 4YQUA 3TOTA 4N11A 3GKKA 4NXIA 1XFLA 1A0FA 1V9WA 2XBQA 1HQOA 4FO5A 1ZMAA 3QCPA 1NHOA 2B1KA 5E59A 4PNGA 1B48A 4EDYA 2YWMA 3BD2A 1R5PA 2X64A 1PX6A 2PERA 1GNWA 3LWAA 3EC3A 5B6MA 4Z2TA 4CY8A 5KN2A 2A4VA 3LYKA 4L5OA 4K6XA 1YDKA 1TRSA 3KZQA 3TJKA 4W66A 5AISA 2QSIA 1IYHA 3A5IA 3FRCA 3QDNA 1T4YA 2WB9A 5DDLA 2GSRA 3FYGA 2FA8A 1X5EA 4DSSA 5D9VA 5B6NA 5EY6A 3H93A 2YPMA 5EVOA 1TK0B 1XBSA 5GAND 4BWQA 4Q5QA 5HR1A 3HVXA 13GSA 5D96A 4WEYA 2O89A 3UBKA 3VWWA 1B4QA 3APSA 1ML6A 4ECIA 2YCDA 1U3IA 2ZUPA 1URMA 3L4NA 5DJLA 2PMTA 3D5JA 3C1RA 2B7KA 4ID0A 3D0ZA 3GFKA 5COHA 2VUPA 1V98A 1EEJA 2B6MA 1N25A 4ZB6A 3SWLA 5D9WA 3UOMA 4QL7A 2R0GA 2HZFA 1FB6A 2DJ2A 1Z7PA 5D9TA 2IPAA 2HFDA 3UJ1A 4X0XA 2YZUA 2CAIA 3QAVA 2B1LA 5IMZA 3G7IA 2H6ZA 1TU7A 2HNLA 4PGTA 5IMFA 4F0BA 3DRNA 4CY6A 3I69A 3L9VA 1B4PA 2O85A 4KF9A 1GLPA 5A34A 3CMIA 1B9XC 4A5PA 2H30A 5DALA 3FZ9A 2REMA 2YZHA 5KOXA 1GUMA 4LMWA 4OMVA 4FQUA 6GSTA 1MD4A 1PL1A 2VLUA 4GCIA 2LKUA 2OBIA 1V2AA 1TK5B 4HS1A 1CQGA 2VL9A 3TJBA 3HHVA 3BBYA 2MZCA 3DMLA 4HJ2A 2JZRA 2VD0A 1AAZA 2C1YA 1PA3A 1M9BA 4MJBA 2AAWA 1TDIA 4NHWA 2OT3A 2F51A 1XW6A 4YKFA 3UARA 5FWGA 3H8QA 3FK8A 4KUNA 2H73A 5IO0A 3GRXA 2L6CA 4I97A 4POBA 4GSNA 4GQFA 3IE3A 4F0CA 1SVOA 1O85A 4N30A 2WDUA 3BCIA 3VWXA 3G9BA 2P5QA 1KBNA 2FWEA 5FT3A 2EFEA 2EFHA 6GSWA 3F0IA 1M9AA 3IAS2 4KAEA 4HEA2 3HCZA 3TKSC 4MF6A 3TRXA 1MEKA 4PQ1A 5ABRA 1FB0A 2FCHA 2GQMA 4XS4B 1QQ2A 1GTBA 2FA4A 3GURA 3L0HA 1EV4A 1KEBA 1B8XA 4YKGA 5JWOB 3FMWA 4CHSA 3IOSA 5AIVA 3EWLA 3HVVA 1F3AA 4IKHA 1PKZA 5L71A 9GSSA 3VK9A 1LU4A 3LSZA 3I9V2 3KP8A 1GSQA 3O3TA 4MF7A 4BL7A 1PX7A 2HSHA 4YH2A 6GSXA 3QR6A 4K0GA 1YJ6A 1WRYA 2YWIA 1PGTA 2C3QA 3VURA 2FUG2 3CWGA 1GTUA 2VCVA 3F63A 4PX1A 2EFCA 5G30A 3US3A 2V2GA 2WJUA 1X5DA 3CYNA 1SVLA 2CQ9A 4F82A 3KTBA 3IPZA 1CQHA 1MTCA 3FZ5A 1ABAA 4IS0A 4BVXA 5GSTA 3HMJG 4KSOA 2M46A 2O87A 2F8FA 4IGJA 1ZL9A 4IBPA 2LRCA 4E8EA 1T00A 3CSHA 3P90A 2EC4A 4ZB8A 3N9JA 4KDUA 2GT5A 5DQSA 5A1NA 3FZ4A 4I8BA 5ECRB 10GSA 2P31A 1XWAA 4K9ZA 3TJFA 1GLQA 4MPGA 1XWBA 3MAKA 2C0GA 1ZCPA 6GSYA 1XOAA 4BVYA 3FZAA 4TR1B 2QA1A 2VCWA 3ZMKA 1SK0A 2WRTA 2ALBA 1EV9A 2FY6A 4NV5A 3KMOA 2E2GA 3ZFBA 5J9BA 2EIQA 4G0IA 2H1LA 1T1VA 1R5AA 3GV1A 5DVBA 4ZILA 2IN3A 3D22A 4MZCA 3EU3A 3CXGA 2OJLA 2OE1A 5G1LA 2GSSA 5KN0A 3HDCA 3MWHA 2GDRA 2H75A 5CRDA 4PQHA 2GQKA 3PR8A 3D21A 5AN1A 1U87A 2UZ8A 4MZWA 1JZOA 5BRTA 1SJIA 3FR6A 1M2BA 3KGKA 4WETA 3DWVA 3WGDA 2ZCTA 3TKQA 5J47A 1SK2A 1XWKA 1T3BA 2B7JA 3I43A 1F6MC 2L5LA 4L8EA 2VL2A 1THOA 1WOUA 2HRAA 3TCOA 5DCHA 2L4CA 4JBBA 2VLVA 3K8NA 4G19A 4ISDA 2O8VB 1S3AA 2B5EA 1TXXA 1EP7A 1SVMA 4YAPA 1R7HA 3CBUA 5IOWA 5HFGA 4EDZA 1Y1UA 5BMUA 2KUCA 5DAKB 3V1WA 4PURA 3SBCA 4KW6A 2F9SA 4EE0A 12GSA 1PQNA 4PNFA 1EEMA 2LQOA 4ZL7A 3GL5A 5DJMA 3PGTA 2HYXA 3APQA 1T8EB 2R3XA 5D8IA 1EOGA 3HJOA 3IRAA 3TJGA 4LL1B 2GT6A 2HSYA 5AGYA 3P2AA 5J9CA 1EP8A 2O5VA 4G0KA 2C0FA 4L5LA 5J41A 2DSAA 4FYCA 2DIZA 4TR1A 5CP1A 4XS4A 1EGRA 4MABA 2E2MA 3A5WA 3A2WA 2DJ0A 4MDCA 4ECJA 2QKEA 5IMCA 1FOVA 5IPGA 1QFNA 3DIEA 1PMTA 1S3CA 1OAZA 3NOFA 3C73A 1XW9A 2H74A 4KX4A 1FVJA 1R4WA 3DKSA 4IP6A 2KLXA 1O73A 4V2NA 3GL3A 3CSIA 4K0NA 1XCCA 11GSA 1NSWA 5HFKA 4O5RA 2J9HA 4OCFA 4JEDA 5IIZA 2YNXA 4L0UA 1FG4A 2KP1A 1LBKA 1T4ZA 4WF4A 3C7MA 1TKDB 3WYWA 2CV4A 4FH8A 2LNSA 4ZXGA 3J7Yb 4IELA 1A8LA 2R6KA 1DE2A 2UV8G 2JADA 4POKA 2H19A 4EIQA 3ZRDA 5JCGA 1V57A 2BTOT 3UVTA 1Z6MA 2HSNB 3LEFA 3LW9A 3EYTA 1FW1A 1O8WA 3MSZA 3LXZA 1QMVA 2H76A 1TJDA 3ME7A 3VFIA 3VPTA 2JZSA 4E8HA 4Z2UA 1RK4A 4PXOA 3CTGA 2R5GA 3O76A 4GRFA 2IL3A 2HQTA 2YWOA 3IDVA 1WJKA 2YWNA 3D4MA 4YAVA 3LG6A 5A1NB 1PRXA 1THXA 3DVWA 2E7PA 3F3QA 1SL0B 2A2PA 2VD1A 4K2DA 4MLYA 1FVKA 4DSSB 1PL2A 1YEXA 5INYA 2IMEA 2VCQA 3EMPA 3KM6A 1SENA 4GF0A 3ME8A 2X49A 2TRCP 4IW9A 2NTOA 1G7EA 4KE3A 2PPTA 1JZWA 4XCSA 3L9SA 4ULXA 3JCML 4EO3A 3OR5A 1ZYEA 2CT6A 4PQIA 3LGCA 4HJMA 1OYJA 1H75A 1AXDA 2JL4A 3APOA 1JHBA 2DKHA 2BJXA 2K9FA 4IP1A 4POMA 4Q5NA 5CRWA 5DAKA 3TOUA 2HZEA 4AKXB 4XTSA 2R0CA 4O7HA 4TXVA 3N5OA 3FKFA 3G7JA 4QL9A 5HR0A 1GNEA 1Z5YE 3FR9A 2GZZA 2VM2A 1TRVA 1WMJA 5F05A 4G10A 2H6XA 2CVKA 4MNNA 4FYUA 1N2AA 3TKPA 1JLWA 4HOJA 1M99A 2X99A 5JCUA 1TRWA 1GSDA 2AHEA 2RUFA 2K6VA 3F4RA 4KNDA 2H0HA 1SJZA 4K5SA 4QMKA 5H5SA 7GSSA 1C72A 1WWJA 1M2DA 3UMAA 1R26A 2IMKA 1SD9A 2HRKA 3CTFA 4KB3A 1XWCA 4H86A 1AC1A 1ON4A 3RHCA 5H5QA 5ECKB 1QK8A 5JCWA 4NV2A 4LL4B 1K0MA 5HFIA 4POLA 2RM5A 5EPFA 1GL8A 2HI7A 4Z2RA 4O5UA 4KDYA 3HKRA 2DJJA 3ZYWA 4D73A 4Z7XA 4J56E 2EFDA 3DGQA 5CYYA 2CX4A 2KOKA 1JZDA 3M1GA 1AUCA 4WBJA 2KHPA 4N3ZA 1ERWA 5ECPB 4P3YB 2H72A 1GSUA 3MDKA 1YEPA 2OBKA 4GTUA 4V1Ap 3TKSE 4EVMA 1Z6NA 2IMDA 2LV3A 17GSA 1Z9HA 5A4WA 4G9HA 1I5GA 1OE7A 2JSZA 2A2RA 4BWSA 2QA2A 5GSSA 4GXZA 3LXTA 4G01A 2DLXA 2YOIA 4MMMA 3EINA 3E0UA 3CSJA 4EC0A 2I1UA 3U5RE 1FHEA 4CW9A 4O5QA 3C1SA 3M0FA 4N10A 5CRHA 2N5BA 4I5QA 4XS1A 3O6TA 3L9UA 4MP4A 2QC7A 3IC4A 2H0IA 3HVSA 1GSFA 4YQMA 5ELAA 3KEBA 3KXOA 1GUHA 3LJRA 3F6DA 4ILFA 1VF4A 2X8HA 4MH3A 2X8GA 3PINA 2DBCA 4RUVA 3FEUA 2RLIA 2CZ3A 4OFNA 3GKNA 3WT2A 3IBHA 1MDIA 3Q18A 2V1MA 2GVPA 4GQCA 4LLRA 2PVOC 1X9WB 2GQLA 1W4VA 2K18A 2DJ3A 3TB2A 1J9BA 4HU9A 1AQWA 4AKGA 1F3BA 1XPVA 2C80A 1SL2B 4X4JA 5F8BA 4X1UA 4ZBDA 16GSA 1WP0A 1VRSD 4ICYA 5ELGA 3UAPA 1JFUA 2WFCA 3NIVA 4LMVA 3GSSA 2LSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBA A;  1ZOF A;  4QQ7 A;  2L6D A;  1DBY A;  3GH9 A;  1M7T A;  5J5N A;  1SJ6 A;  3GA4 A;  2DMM A;  3M9K A;  1BG5 A;  3KIJ A;  4EF0 A;  1X9M B;  3ZL5 A;  1EGO A;  1YY7 A;  1GTA A;  3IV4 A;  2OE3 A;  4ZL8 A;  1DUG A;  2MMA A;  2BMX A;  1SD8 A;  1UA5 A;  1A8Y A;  2NPB A;  1JZR A;  1EOH A;  1O81 A;  2CA8 A;  2OE0 A;  1WE0 A;  1SKR B;  2HLS A;  3Q19 A;  2YV7 A;  1Q4J A;  3CRU A;  2HRF A;  4JU5 A;  3TRP A;  2HRK B;  2DIY A;  1OVN A;  3F9U A;  1VF2 A;  1NW2 A;  4JRR A;  4JE1 A;  3F6F A;  4GWR A;  2L59 A;  3KJY A;  2JU5 A;  2LQQ A;  4YQV A;  3KTL A;  4I2T A;  3QFA C;  1G7O A;  3VI5 A;  2GST A;  2XC2 A;  3EMX A;  1UN2 A;  2EIR A;  2IJY A;  3ZIV A;  3QAG A;  5J4U A;  5IOX A;  5IM9 A;  5GAP D;  2K8S A;  3QPM A;  3HZ4 A;  2GTU A;  4FIW A;  4HZ4 A;  1VF3 A;  4X43 A;  1TOF A;  2JZT A;  5LD0 A;  3GX0 A;  1IYI A;  3A3T A;  2MMN A;  5CAX A;  4K1F A;  3HD5 A;  3VLN A;  2C8U A;  5ECM B;  1TU8 A;  4LA1 A;  1BJX A;  20GS A;  4BL7 B;  3UVH A;  3Q74 A;  3EUR A;  2H6Y A;  1GUK A;  4WR5 A;  2J23 A;  2EIO A;  5ECI B;  1S3D A;  2LJK A;  3S9F A;  1PKW A;  2LTK A;  2HRN A;  1W89 A;  1M0U A;  5KEJ A;  4Q5R A;  4RI6 A;  2GZY A;  4TR0 A;  4ACS A;  3FW2 A;  2HZE B;  2TIR A;  4TW5 A;  1X5C A;  3ZZX A;  4PTS A;  4IHU A;  2ES7 A;  2VL3 A;  3F4T A;  3ZIJ A;  2GLR A;  4NMU A;  1EWX A;  3ERW A;  4MH2 A;  4WBR D;  3VPQ A;  2VL2 C;  3HA9 A;  1XW5 A;  1RW1 A;  3VI7 A;  3ZLP A;  2OA7 A;  3L78 A;  5ECS A;  2I3Y A;  4RQR A;  2NBS A;  5A5K A;  1T7P B;  4K7O A;  1SYR A;  1EZK A;  1G6Y A;  1HNA A;  2ZNM A;  1TI1 A;  3I6A A;  4PUF C;  2G2Q A;  1K0C A;  2VIM A;  1AIU A;  3W8S A;  3UIW A;  5C04 A;  5CRG A;  4F03 A;  4GSS A;  1TP9 A;  3QMX A;  1YKC A;  1XZO A;  5D73 A;  1OKT A;  4JR6 A;  2P0G A;  3DVX A;  2FLS A;  1K3O A;  2LUS A;  1Q98 A;  2XPD A;  3TJJ A;  3IR4 A;  4OO4 A;  2TRX A;  3VWV A;  3TGZ A;  3P7X A;  2CVB A;  4MJC A;  2RM6 A;  1TI3 A;  3F4S A;  4ML6 A;  5IPH A;  2DJ1 A;  3DD3 A;  2IFQ B;  2E0Q A;  1SL1 B;  5GZZ B;  2CZ2 A;  2VCT A;  1YKA A;  3HJM A;  4MPF A;  5HR2 A;  2HT9 A;  1K3L A;  1PD2 1;  1M2A A;  4ZIJ A;  3HYP A;  4TKY A;  1WIK A;  1OC9 A;  4KA0 A;  4TN8 A;  5CO3 A;  4V2L A;  1PN9 A;  3GYK A;  2DC5 A;  4RQX A;  2IIY A;  3MNG A;  2VOC A;  4F2I A;  2HE3 A;  2ON5 A;  5ENU A;  3M9J A;  3TKR A;  3WGX A;  3ZML A;  2GZP A;  5IMV A;  3GTU B;  2FWF A;  2B5Y A;  4PUA A;  1Z7R A;  3TUE A;  1NHY A;  4NAX A;  1BYE A;  3W6G A;  2DML A;  3GHA A;  1U3A A;  4ML1 A;  3UEM A;  5J3R A;  2PVQ A;  1GSS A;  1F2E A;  3PH9 A;  1GSE A;  1BQ7 A;  3ERF A;  3GX8 A;  5LCZ A;  2H1D A;  3TRQ A;  1TRU A;  2PUK C;  1QGV A;  4K7N A;  4V2M A;  2R2J A;  1VGL A;  4ECC A;  1OC8 A;  5KN1 A;  2JSY A;  1K0A A;  4KDX A;  1MDK A;  2AUV A;  2MMO A;  3GH6 A;  4XRD A;  3TKS A;  2F3M A;  1X9S B;  6GSV A;  1GRX A;  4KCE A;  1ERT A;  5DBQ A;  3EVI A;  2I4A A;  2B3S A;  2MBT A;  4O92 A;  4GLT A;  4V1A g;  2MBS A;  2C3T A;  2WUL A;  2WZ9 A;  1FAA A;  4OFT A;  2VCZ A;  3C8E A;  4XIH A;  3U6V A;  3UL3 A;  3KH9 A;  1X0R A;  1Z3E A;  2JAC A;  1OKD A;  2A2S A;  5HQP A;  1GH2 A;  4EL1 A;  1N8J A;  3R2Q A;  3G7Y A;  4TXO A;  3LYP A;  3GN3 A;  4ECB A;  4NPB A;  2XPE A;  4TVE A;  3IC8 A;  4HDE A;  2LJR A;  2WCI A;  1HNB A;  2L4Q A;  4MF5 A;  4KCA A;  4HQZ A;  1KNG A;  4ZL9 A;  4NHZ A;  1G0T A;  4TRX A;  1LJR A;  3QOU A;  2AYT A;  5DQY A;  1UC7 A;  2H1G A;  4G2E A;  4BVX B;  4MJA A;  2OKA A;  3RPN A;  2PGT A;  5KN3 A;  3M8N A;  3BCK A;  5G5F A;  2R37 A;  2C0E A;  2M80 A;  5D93 A;  2C0D A;  3GNJ A;  3ZIT A;  4F9Z A;  3QAW A;  1OE8 A;  1PSQ A;  3NZN A;  2GGT A;  3AY8 A;  3ZRE A;  2GS3 A;  4Q5F A;  2GSQ A;  3BJ5 A;  3WGE A;  5IQY A;  1Y6E A;  3GIX A;  4IN0 A;  2ON7 A;  4OD7 A;  2LJA A;  3F3R A;  2FNO A;  4WKW A;  3LOR A;  2L57 A;  1K0D A;  4L0W A;  5ECQ B;  2N5A A;  3P8W A;  3RPP A;  4BVY B;  2V6K A;  2X8C A;  4ZBB A;  1BED A;  2NVL A;  1A23 A;  4O32 A;  3EU4 A;  5G1K A;  3DYR A;  4USS A;  3H1N A;  3WT1 A;  2AB6 A;  5F0G A;  1GUL A;  5B8B A;  4DEJ A;  1ZYQ B;  5AIX A;  1U88 A;  2G0F A;  1NM3 A;  2FD3 A;  4MZB A;  4HU7 A;  4TOP A;  1XXU A;  1TTZ A;  1ZZY A;  2PU9 C;  1HYU A;  3RBT A;  1OC3 A;  3R3E A;  1QUW A;  4FYB A;  19GS A;  3LQ7 A;  2M72 A;  1DE1 A;  1YF1 A;  2H1B A;  3D6I A;  2DJK A;  4KGI A;  4XS6 A;  6GSS A;  1TW9 A;  2D2Z A;  3IK9 A;  1K0N A;  1ERU A;  1V40 A;  5H5R A;  4HQS A;  4IJI A;  1SK1 A;  3J7Y k;  4MK3 A;  4HZ2 A;  3ZVJ A;  3W8J A;  3KP9 A;  2LS5 A;  5IMD A;  1QXH A;  1DSB A;  3E3E A;  2B5X A;  2O7K A;  1ACV A;  3E9J B;  5G31 A;  1YQ1 A;  5CNW A;  4HI7 A;  3ED3 A;  4IVF A;  2V32 A;  2I81 A;  1A0R P;  5E4W A;  5ECH B;  2MYG A;  2HSM B;  3GKM A;  2LRN A;  3IAM 2;  1MDJ A;  2PBJ A;  3HXS A;  3GKX A;  2H66 A;  4K8M A;  5LNK e;  4JR4 A;  1SU9 A;  4WXT A;  3PPU A;  4ZB9 A;  2YP6 A;  1E2Y A;  4K7I A;  2R4V A;  22GS A;  5DAL B;  5F06 A;  3FR3 A;  2VCX A;  4RI7 A;  5IMA A;  5IO2 A;  5B8A A;  3C71 A;  5JWR B;  1YZX A;  1SYX A;  5G5E A;  1H4O A;  4NWY A;  3KMN A;  5B7C A;  2WGR A;  5ECO B;  2OAD A;  4TXO B;  4OFM A;  3GMF A;  5ID2 A;  3A2V A;  1G6W A;  1B9Y C;  2H70 A;  1J08 A;  1FO5 A;  4I2U A;  1XOB A;  4OWY A;  18GS A;  5A4U A;  2RII A;  2VLT A;  1XVW A;  3UBL A;  3RAZ A;  4MCU A;  2C3N A;  2LRT A;  4IQA A;  5FHI A;  2YJ7 A;  3FHK A;  2VO4 A;  3BOA A;  2V41 A;  1GWC A;  1YF0 A;  1O7U A;  3RDW A;  2VAF A;  2C4J A;  4OO5 A;  5ECL B;  1HNC A;  3KH7 A;  5F07 A;  5ECN B;  1KTE A;  4J2F A;  4KSM A;  2XHF A;  3RHB A;  4WF5 A;  1J0F A;  1F9M A;  2AV4 A;  1VF1 A;  2YAN A;  1HD2 A;  1SKW B;  3D4T A;  3F8U A;  1A2L A;  4GST A;  4AF2 A;  2FWH A;  2P5R A;  3KCM A;  4IQ1 A;  2RUE A;  4MJE A;  2IFQ A;  1O6J A;  1XIY A;  1Y25 A;  4DSR A;  2HSM A;  3ISO A;  3IXR A;  4BA7 A;  4AGS A;  1UVZ A;  1ERV A;  1F37 A;  2HXK A;  3GTU A;  1A24 A;  2LNT A;  1USB A;  5CRE A;  5D9X A;  2H0G A;  1JLV A;  4WR4 A;  2V6O A;  1TK8 B;  2VM1 A;  1K0O A;  4KH7 A;  5HR3 A;  5G2Z A;  3ZVJ D;  3WD6 A;  1AQV A;  4AJ8 A;  4HUA A;  3QD9 A;  3DEX A;  4D73 B;  1SKS B;  2KP2 A;  3QFB C;  4EXJ A;  1E6B A;  1ST9 A;  2H01 A;  8GSS A;  5A4V A;  1O8X A;  3IHQ A;  4AJ7 A;  2AJQ B;  1K3Y A;  2I9H A;  2YV9 A;  2IMI A;  4EKZ A;  2FWG A;  3ZFL A;  3GUS A;  1A2M A;  2QGV A;  2XBI A;  3IK7 A;  2IMF A;  2FHE A;  1XWG A;  2H8L A;  1ZGN A;  2CAQ A;  2NDO A;  4N0Z A;  3A2X A;  4TR3 A;  4DSQ A;  1RQM A;  5DCG A;  2L5O A;  2PWJ A;  2MMZ A;  4XRA A;  1I9D A;  2YN1 A;  3LFL A;  1V58 A;  3GST A;  4BPY A;  2YJH A;  2LEG A;  3Q6O A;  5JWQ B;  1MD3 A;  4MA9 A;  2PN8 A;  3HZ8 A;  3HY2 A;  4OCE A;  1BAY A;  4XHM A;  3VWU A;  1AW9 A;  1K0B A;  2CVD A;  2IWT A;  4DVC A;  4AJ6 A;  4JZQ A;  2WS2 A;  2F8A A;  4J57 E;  3HJP A;  4TR4 A;  3M3M A;  1WPI A;  3FY7 A;  3EE2 A;  6GSU A;  2N5F A;  3ERG A;  3KD0 A;  2OAC A;  3TDG A;  1AQX A;  2CX3 A;  1GSY A;  2H71 A;  3H4K A;  5EL8 A;  5ID2 B;  4EUY A;  1GTI A;  2H1A A;  1OC9 B;  4I6X A;  3DXB A;  3IA1 A;  1A2J A;  3CRT A;  4CDO A;  1XVQ A;  1U6T A;  3ZTL A;  14GS A;  1GP1 A;  3H79 A;  4IJ3 A;  4N0V A;  2FGX A;  4G0L A;  2Z9S A;  2K8V A;  1BX9 A;  5C00 A;  1ILO A;  4YQU A;  3TOT A;  4N11 A;  3GKK A;  4NXI A;  1XFL A;  1A0F A;  1V9W A;  2XBQ A;  1HQO A;  4FO5 A;  1ZMA A;  3QCP A;  1NHO A;  2B1K A;  5E59 A;  4PNG A;  1B48 A;  4EDY A;  2YWM A;  3BD2 A;  1R5P A;  2X64 A;  1PX6 A;  2PER A;  1GNW A;  3LWA A;  3EC3 A;  5B6M A;  5KN2 A;  2A4V A;  3LYK A;  4L5O A;  4K6X A;  1YDK A;  1TRS A;  3KZQ A;  3TJK A;  5AIS A;  2QSI A;  1IYH A;  3FRC A;  3QDN A;  1T4Y A;  2WB9 A;  5DDL A;  2GSR A;  3FYG A;  2FA8 A;  1X5E A;  4DSS A;  5D9V A;  5B6N A;  5EY6 A;  3H93 A;  2YPM A;  5EVO A;  1TK0 B;  1XBS A;  5GAN D;  4BWQ A;  4Q5Q A;  5HR1 A;  3HVX A;  13GS A;  5D96 A;  4WEY A;  2O89 A;  3UBK A;  3VWW A;  1B4Q A;  3APS A;  1ML6 A;  4ECI A;  2YCD A;  1U3I A;  2ZUP A;  1URM A;  3L4N A;  5DJL A;  2PMT A;  3D5J A;  3C1R A;  2B7K A;  4ID0 A;  3D0Z A;  3GFK A;  5COH A;  2VUP A;  1V98 A;  1EEJ A;  2B6M A;  4ZB6 A;  3SWL A;  5D9W A;  3UOM A;  4QL7 A;  2HZF A;  1FB6 A;  2DJ2 A;  1Z7P A;  5D9T A;  2IPA A;  2HFD A;  3UJ1 A;  4X0X A;  2YZU A;  2CAI A;  3QAV A;  2B1L A;  5IMZ A;  3G7I A;  2H6Z A;  1TU7 A;  2HNL A;  4PGT A;  5IMF A;  4F0B A;  3DRN A;  3I69 A;  3L9V A;  1B4P A;  2O85 A;  4KF9 A;  1GLP A;  3CMI A;  1B9X C;  2H30 A;  5DAL A;  3FZ9 A;  2REM A;  2YZH A;  1GUM A;  4LMW A;  4OMV A;  4FQU A;  6GST A;  1MD4 A;  1PL1 A;  2VLU A;  4GCI A;  2LKU A;  2OBI A;  1V2A A;  1TK5 B;  4HS1 A;  1CQG A;  2VL9 A;  3TJB A;  3HHV A;  3BBY A;  2MZC A;  3DML A;  4HJ2 A;  2JZR A;  2VD0 A;  1AAZ A;  2C1Y A;  1PA3 A;  1M9B A;  4MJB A;  2AAW A;  1TDI A;  4NHW A;  2F51 A;  1XW6 A;  3UAR A;  5FWG A;  3H8Q A;  3FK8 A;  4KUN A;  2H73 A;  5IO0 A;  3GRX A;  2L6C A;  4I97 A;  4POB A;  4GSN A;  4GQF A;  3IE3 A;  4F0C A;  1O85 A;  4N30 A;  2WDU A;  3BCI A;  3VWX A;  3G9B A;  2P5Q A;  1KBN A;  2FWE A;  5FT3 A;  6GSW A;  3F0I A;  1M9A A;  3IAS 2;  4KAE A;  4HEA 2;  3HCZ A;  3TKS C;  4MF6 A;  3TRX A;  1MEK A;  4PQ1 A;  5ABR A;  1FB0 A;  2FCH A;  2GQM A;  4XS4 B;  1QQ2 A;  1GTB A;  2FA4 A;  3GUR A;  3L0H A;  1EV4 A;  1KEB A;  1B8X A;  5JWO B;  4CHS A;  3IOS A;  5AIV A;  3EWL A;  3HVV A;  1F3A A;  4IKH A;  1PKZ A;  5L71 A;  9GSS A;  3VK9 A;  1LU4 A;  3LSZ A;  3I9V 2;  3KP8 A;  1GSQ A;  3O3T A;  4MF7 A;  4BL7 A;  1PX7 A;  2HSH A;  4YH2 A;  6GSX A;  3QR6 A;  4K0G A;  1YJ6 A;  1WRY A;  2YWI A;  1PGT A;  2C3Q A;  3VUR A;  2FUG 2;  1GTU A;  2VCV A;  3F63 A;  4PX1 A;  5G30 A;  3US3 A;  2V2G A;  2WJU A;  1X5D A;  3CYN A;  2CQ9 A;  4F82 A;  3KTB A;  3IPZ A;  1CQH A;  1MTC A;  3FZ5 A;  1ABA A;  4IS0 A;  4BVX A;  5GST A;  4KSO A;  2M46 A;  2O87 A;  2F8F A;  4IGJ A;  1ZL9 A;  4IBP A;  2LRC A;  4E8E A;  1T00 A;  3CSH A;  3P90 A;  2EC4 A;  4ZB8 A;  3N9J A;  4KDU A;  2GT5 A;  5DQS A;  3FZ4 A;  4I8B A;  5ECR B;  10GS A;  2P31 A;  1XWA A;  4K9Z A;  3TJF A;  1GLQ A;  4MPG A;  1XWB A;  3MAK A;  2C0G A;  1ZCP A;  6GSY A;  1XOA A;  4BVY A;  3FZA A;  4TR1 B;  2VCW A;  3ZMK A;  1SK0 A;  2WRT A;  2ALB A;  1EV9 A;  2FY6 A;  4NV5 A;  3KMO A;  2E2G A;  3ZFB A;  5J9B A;  2EIQ A;  4G0I A;  1T1V A;  1R5A A;  3GV1 A;  5DVB A;  4ZIL A;  2IN3 A;  3D22 A;  4MZC A;  3EU3 A;  3CXG A;  2OJL A;  2OE1 A;  5G1L A;  2GSS A;  5KN0 A;  3HDC A;  3MWH A;  2GDR A;  2H75 A;  5CRD A;  4PQH A;  2GQK A;  3PR8 A;  3D21 A;  5AN1 A;  1U87 A;  2UZ8 A;  4MZW A;  1JZO A;  1SJI A;  3FR6 A;  1M2B A;  3KGK A;  4WET A;  3DWV A;  3WGD A;  2ZCT A;  3TKQ A;  1SK2 A;  1XWK A;  1T3B A;  2B7J A;  3I43 A;  1F6M C;  2L5L A;  4L8E A;  2VL2 A;  1THO A;  1WOU A;  2HRA A;  3TCO A;  5DCH A;  2L4C A;  4JBB A;  2VLV A;  3K8N A;  4G19 A;  4ISD A;  2O8V B;  1S3A A;  2B5E A;  1TXX A;  1EP7 A;  4YAP A;  1R7H A;  3CBU A;  5IOW A;  5HFG A;  4EDZ A;  5BMU A;  2KUC A;  5DAK B;  3V1W A;  4PUR A;  3SBC A;  4KW6 A;  2F9S A;  4EE0 A;  12GS A;  1PQN A;  4PNF A;  1EEM A;  2LQO A;  4ZL7 A;  3GL5 A;  5DJM A;  3PGT A;  2HYX A;  3APQ A;  1T8E B;  2R3X A;  5D8I A;  1EOG A;  3HJO A;  3IRA A;  3TJG A;  4LL1 B;  2GT6 A;  2HSY A;  5AGY A;  3P2A A;  5J9C A;  1EP8 A;  4G0K A;  2C0F A;  4L5L A;  5J41 A;  2DSA A;  4FYC A;  2DIZ A;  4TR1 A;  5CP1 A;  4XS4 A;  1EGR A;  4MAB A;  2E2M A;  3A5W A;  3A2W A;  2DJ0 A;  4MDC A;  4ECJ A;  2QKE A;  5IMC A;  1FOV A;  5IPG A;  1QFN A;  3DIE A;  1PMT A;  1S3C A;  1OAZ A;  3NOF A;  3C73 A;  1XW9 A;  2H74 A;  4KX4 A;  1FVJ A;  1R4W A;  3DKS A;  4IP6 A;  2KLX A;  1O73 A;  4V2N A;  3GL3 A;  3CSI A;  4K0N A;  1XCC A;  11GS A;  1NSW A;  5HFK A;  4O5R A;  2J9H A;  4OCF A;  4JED A;  5IIZ A;  2YNX A;  4L0U A;  1FG4 A;  2KP1 A;  1LBK A;  1T4Z A;  4WF4 A;  3C7M A;  1TKD B;  3WYW A;  2CV4 A;  4FH8 A;  2LNS A;  4ZXG A;  3J7Y b;  4IEL A;  1A8L A;  2R6K A;  1DE2 A;  2JAD A;  4POK A;  2H19 A;  3ZRD A;  5JCG A;  1V57 A;  2BTO T;  3UVT A;  1Z6M A;  2HSN B;  3LEF A;  3EYT A;  1FW1 A;  1O8W A;  3MSZ A;  3LXZ A;  1QMV A;  2H76 A;  1TJD A;  3ME7 A;  3VFI A;  3VPT A;  2JZS A;  4E8H A;  1RK4 A;  4PXO A;  3CTG A;  2R5G A;  3O76 A;  4GRF A;  2IL3 A;  2HQT A;  2YWO A;  3IDV A;  1WJK A;  2YWN A;  3D4M A;  4YAV A;  3LG6 A;  1PRX A;  1THX A;  3DVW A;  2E7P A;  3F3Q A;  1SL0 B;  2VD1 A;  4K2D A;  4MLY A;  1FVK A;  4DSS B;  1PL2 A;  1YEX A;  5INY A;  2IME A;  2VCQ A;  3EMP A;  3KM6 A;  1SEN A;  4GF0 A;  3ME8 A;  2TRC P;  4IW9 A;  2NTO A;  1G7E A;  4KE3 A;  2PPT A;  1JZW A;  4XCS A;  3L9S A;  4ULX A;  3JCM L;  4EO3 A;  3OR5 A;  1ZYE A;  2CT6 A;  4PQI A;  3LGC A;  4HJM A;  1OYJ A;  1H75 A;  1AXD A;  2JL4 A;  3APO A;  1JHB A;  2K9F A;  2BJX A;  4IP1 A;  4POM A;  4Q5N A;  5CRW A;  5DAK A;  3TOU A;  2HZE A;  4XTS A;  4O7H A;  4TXV A;  3N5O A;  3FKF A;  3G7J A;  4QL9 A;  5HR0 A;  1GNE A;  1Z5Y E;  3FR9 A;  2GZZ A;  2VM2 A;  1TRV A;  1WMJ A;  5F05 A;  4G10 A;  2H6X A;  2CVK A;  4FYU A;  1N2A A;  3TKP A;  1JLW A;  4HOJ A;  1M99 A;  2X99 A;  5JCU A;  1TRW A;  1GSD A;  2AHE A;  2RUF A;  2K6V A;  3F4R A;  4KND A;  2H0H A;  1SJZ A;  5H5S A;  7GSS A;  1C72 A;  1WWJ A;  1M2D A;  3UMA A;  1R26 A;  2IMK A;  1SD9 A;  2HRK A;  3CTF A;  4KB3 A;  1XWC A;  4H86 A;  1AC1 A;  1ON4 A;  3RHC A;  5H5Q A;  5ECK B;  1QK8 A;  5JCW A;  4NV2 A;  4LL4 B;  1K0M A;  5HFI A;  4POL A;  2RM5 A;  5EPF A;  1GL8 A;  2HI7 A;  4KDY A;  3HKR A;  2DJJ A;  3ZYW A;  4D73 A;  4Z7X A;  4J56 E;  3DGQ A;  5CYY A;  2CX4 A;  2KOK A;  1JZD A;  3M1G A;  1AUC A;  4WBJ A;  2KHP A;  1ERW A;  5ECP B;  4P3Y B;  2H72 A;  1GSU A;  3MDK A;  1YEP A;  2OBK A;  4GTU A;  4V1A p;  3TKS E;  4EVM A;  1Z6N A;  2IMD A;  2LV3 A;  17GS A;  1Z9H A;  5A4W A;  4G9H A;  1I5G A;  1OE7 A;  2JSZ A;  2A2R A;  4BWS A;  5GSS A;  4GXZ A;  3LXT A;  2DLX A;  2YOI A;  4MMM A;  3EIN A;  3E0U A;  3CSJ A;  4EC0 A;  2I1U A;  3U5R E;  1FHE A;  4CW9 A;  3C1S A;  3M0F A;  4N10 A;  5CRH A;  2N5B A;  4I5Q A;  4XS1 A;  3O6T A;  3L9U A;  4MP4 A;  2QC7 A;  3IC4 A;  2H0I A;  3HVS A;  1GSF A;  4YQM A;  5ELA A;  3KEB A;  3KXO A;  1GUH A;  3LJR A;  3F6D A;  4ILF A;  1VF4 A;  2X8H A;  4MH3 A;  2X8G A;  3PIN A;  2DBC A;  4RUV A;  3FEU A;  2RLI A;  2CZ3 A;  4OFN A;  3GKN A;  3WT2 A;  3IBH A;  1MDI A;  3Q18 A;  2V1M A;  2GVP A;  4GQC A;  4LLR A;  2PVO C;  1X9W B;  2GQL A;  1W4V A;  2K18 A;  2DJ3 A;  3TB2 A;  1J9B A;  4HU9 A;  1AQW A;  1F3B A;  1XPV A;  2C80 A;  1SL2 B;  5F8B A;  4X1U A;  4ZBD A;  16GS A;  1WP0 A;  1VRS D;  5ELG A;  3UAP A;  1JFU A;  2WFC A;  3NIV A;  4LMV A;  3GSS A;  2LST A; 
#chains in the Genus database with same CATH topology
 4ZBA A;  1ZOF A;  4QQ7 A;  2L6D A;  1DBY A;  3GH9 A;  1M7T A;  5J5N A;  1SJ6 A;  3GA4 A;  2DMM A;  3M9K A;  1BG5 A;  3KIJ A;  4EF0 A;  1X9M B;  3ZL5 A;  1EGO A;  1YY7 A;  1GTA A;  3IV4 A;  2OE3 A;  4ZL8 A;  4E68 A;  1DUG A;  2MMA A;  2BMX A;  1SD8 A;  1UA5 A;  1A8Y A;  2NPB A;  1JZR A;  1EOH A;  1O81 A;  2CA8 A;  2OE0 A;  3RGB C;  1WE0 A;  1SKR B;  2HLS A;  3Q19 A;  2YV7 A;  1Q4J A;  3CRU A;  2HRF A;  4JU5 A;  3TRP A;  2HRK B;  2DIY A;  1OVN A;  3F9U A;  1VF2 A;  1NW2 A;  4JRR A;  4JE1 A;  3F6F A;  4GWR A;  2L59 A;  3KJY A;  2JU5 A;  2HSN A;  5KOW A;  2LQQ A;  4YQV A;  2R0P A;  3KTL A;  4I2T A;  3QFA C;  1G7O A;  3VI5 A;  2GST A;  2XC2 A;  3EMX A;  1UN2 A;  2EIR A;  2IJY A;  3ZIV A;  3QAG A;  5J4U A;  5IOX A;  5IM9 A;  5GAP D;  2K8S A;  3QPM A;  3HZ4 A;  2GTU A;  4FIW A;  4HZ4 A;  1VF3 A;  4X43 A;  1TOF A;  2JZT A;  5LD0 A;  3GX0 A;  1IYI A;  3A3T A;  2MMN A;  5CAX A;  4K1F A;  3HD5 A;  3TU3 B;  5A5H A;  3VLN A;  2C8U A;  5ECM B;  1TU8 A;  4LA1 A;  1BJX A;  20GS A;  4BL7 B;  3UVH A;  3Q74 A;  3EUR A;  2H6Y A;  1GUK A;  4WR5 A;  2J23 A;  2EIO A;  5ECI B;  1S3D A;  2LJK A;  3S9F A;  1PKW A;  2LTK A;  2HRN A;  1W89 A;  1M0U A;  5KEJ A;  4Q5R A;  4RI6 A;  2GZY A;  4TR0 A;  4ACS A;  3FW2 A;  2HZE B;  2TIR A;  4TW5 A;  1X5C A;  3ZZX A;  4PTS A;  4IHU A;  2ES7 A;  2VL3 A;  3F4T A;  3ZIJ A;  2GLR A;  4NMU A;  1EWX A;  3ERW A;  4MH2 A;  4WBR D;  3VPQ A;  2VL2 C;  3HA9 A;  5J4Y A;  1XW5 A;  1RW1 A;  3VI7 A;  3ZLP A;  2OA7 A;  3L78 A;  5ECS A;  2I3Y A;  4RQR A;  2NBS A;  5A5K A;  1T7P B;  4K7O A;  1SYR A;  1EZK A;  1G6Y A;  1HNA A;  2ZNM A;  1TI1 A;  3I6A A;  4PUF C;  2G2Q A;  1K0C A;  2VIM A;  1AIU A;  3W8S A;  3UIW A;  5C04 A;  5CRG A;  4F03 A;  4GSS A;  1TP9 A;  3QMX A;  1YKC A;  1XZO A;  5D73 A;  3IHG A;  1OKT A;  4JR6 A;  2P0G A;  4ZB7 A;  3DVX A;  2FLS A;  1K3O A;  2LUS A;  4PI2 C;  4AI6 A;  1Q98 A;  1PN0 A;  2XPD A;  3TJJ A;  3IR4 A;  4OO4 A;  2TRX A;  3VWV A;  3TGZ A;  3P7X A;  2CVB A;  4MJC A;  2RM6 A;  1TI3 A;  3F4S A;  4ML6 A;  5IPH A;  2DJ1 A;  3DD3 A;  2IFQ B;  2E0Q A;  1SL1 B;  5GZZ B;  2CZ2 A;  2VCT A;  1YKA A;  3HJM A;  4MPF A;  1TXU A;  5A34 B;  5HR2 A;  2HT9 A;  1K3L A;  1PD2 1;  3CHX C;  1M2A A;  4ZIJ A;  3MYD A;  3HYP A;  1BF5 A;  5J4V A;  4TKY A;  1WIK A;  1OC9 A;  4KA0 A;  4TN8 A;  5CO3 A;  4V2L A;  1PN9 A;  3GYK A;  2DC5 A;  4RQX A;  2IIY A;  3MNG A;  2VOC A;  4F2I A;  2HE3 A;  2ON5 A;  5ENU A;  3M9J A;  3MIX A;  3TKR A;  3WGX A;  3ZML A;  2GZP A;  5IMV A;  3GTU B;  2FWF A;  2B5Y A;  4PUA A;  1Z7R A;  3TUE A;  1NHY A;  4NAX A;  1BYE A;  3W6G A;  2DML A;  3GHA A;  1U3A A;  4ML1 A;  3UEM A;  5J3R A;  2PVQ A;  1GSS A;  1F2E A;  3PH9 A;  1GSE A;  1BQ7 A;  3ERF A;  3GX8 A;  5LCZ A;  2H1D A;  3TRQ A;  1TRU A;  2PUK C;  1QGV A;  4K7N A;  4V2M A;  4EIP A;  2R2J A;  1VGL A;  4ECC A;  1OC8 A;  5KN1 A;  2JSY A;  1K0A A;  4KDX A;  1MDK A;  2AUV A;  2MMO A;  4AKH A;  3GH6 A;  4XRD A;  3TKS A;  2F3M A;  1X9S B;  6GSV A;  1GRX A;  4KCE A;  1ERT A;  5DBQ A;  3EVI A;  2I4A A;  2B3S A;  2MBT A;  4O92 A;  4GLT A;  4V1A g;  2MBS A;  2C3T A;  2WUL A;  2WZ9 A;  1FAA A;  2WVX B;  4OFT A;  2VCZ A;  3C8E A;  4XIH A;  3U6V A;  3UL3 A;  3KH9 A;  1X0R A;  1Z3E A;  2JAC A;  1OKD A;  5J40 A;  4BIK A;  2A2S A;  5HQP A;  1GH2 A;  4EL1 A;  1N8J A;  1M3I A;  3R2Q A;  3G7Y A;  4TXO A;  3LYP A;  3GN3 A;  4ECB A;  4NPB A;  2XPE A;  4TVE A;  3IC8 A;  4HDE A;  2LJR A;  2WCI A;  1HNB A;  2L4Q A;  4MF5 A;  4KCA A;  4HQZ A;  1KNG A;  4ZL9 A;  4NHZ A;  1G0T A;  4TRX A;  1LJR A;  3QOU A;  2AYT A;  2H1G A;  1UC7 A;  5DQY A;  4G2E A;  4BVX B;  4MJA A;  2WW0 A;  2OKA A;  3RPN A;  2PGT A;  5KN3 A;  3M8N A;  3BCK A;  5G5F A;  2R37 A;  2C0E A;  2M80 A;  5D93 A;  2C0D A;  2O3E A;  3GNJ A;  3ZIT A;  4F9Z A;  3QAW A;  1OE8 A;  1PSQ A;  3NZN A;  2GGT A;  3AY8 A;  1XG8 A;  3ZRE A;  2GS3 A;  4Q5F A;  2GSQ A;  3BJ5 A;  3WGE A;  5IQY A;  1Y6E A;  3GIX A;  4IN0 A;  2ON7 A;  4OD7 A;  2LJA A;  3F3R A;  2FNO A;  4WKW A;  3LOR A;  2L57 A;  1K0D A;  4L0W A;  5ECQ B;  2N5A A;  3P8W A;  3RPP A;  4BVY B;  2V6K A;  2X8C A;  4ZBB A;  1BED A;  2NVL A;  1A23 A;  4O32 A;  3EU4 A;  1FOH A;  5G1K A;  3DYR A;  4USS A;  3H1N A;  3WT1 A;  2AB6 A;  5F0G A;  1GUL A;  5B8B A;  4DEJ A;  1ZYQ B;  5AIX A;  1U88 A;  2G0F A;  1NM3 A;  2FD3 A;  4MZB A;  4HU7 A;  4TOP A;  1XXU A;  1TTZ A;  1ZZY A;  2PU9 C;  1HYU A;  3RBT A;  1OC3 A;  3R3E A;  1QUW A;  4FYB A;  19GS A;  3LQ7 A;  2M72 A;  1DE1 A;  1YF1 A;  2H1B A;  3D6I A;  2DJK A;  4KGI A;  4XS6 A;  6GSS A;  1TW9 A;  2D2Z A;  3IK9 A;  4AKI A;  1K0N A;  1ERU A;  1V40 A;  5H5R A;  4HQS A;  4IJI A;  1SK1 A;  3J7Y k;  4MK3 A;  4HZ2 A;  3ZVJ A;  3W8J A;  3KP9 A;  2LS5 A;  5IMD A;  1QXH A;  1DSB A;  3E3E A;  2B5X A;  2O7K A;  1ACV A;  3E9J B;  5G31 A;  1YQ1 A;  5CNW A;  2VKZ G;  4HI7 A;  3ED3 A;  1I1I P;  4IVF A;  2V32 A;  1BG1 A;  2I81 A;  1A0R P;  5E4W A;  5ECH B;  2MYG A;  2HSM B;  3GKM A;  2LRN A;  3IAM 2;  1MDJ A;  2PBJ A;  3HXS A;  3GKX A;  2H66 A;  4K8M A;  5LNK e;  4JR4 A;  1SU9 A;  4WXT A;  3PPU A;  4ZB9 A;  2YP6 A;  1E2Y A;  4K7I A;  2R4V A;  22GS A;  5DAL B;  5F06 A;  3FR3 A;  2VCX A;  4RI7 A;  2DKI A;  5IMA A;  5IO2 A;  5B8A A;  3C71 A;  5JWR B;  1YZX A;  1SYX A;  5G5E A;  1H4O A;  4NWY A;  3KMN A;  5B7C A;  1YVL A;  2WGR A;  1S4B P;  5ECO B;  2OAD A;  4TXO B;  4OFM A;  3GMF A;  5ID2 A;  3A2V A;  1G6W A;  1B9Y C;  2H70 A;  1J08 A;  1FO5 A;  4I2U A;  1XOB A;  4OWY A;  18GS A;  5A4U A;  2RII A;  2VLT A;  1XVW A;  3UBL A;  3RAZ A;  4MCU A;  2C3N A;  2LRT A;  4IQA A;  5FHI A;  2YJ7 A;  3FHK A;  2VO4 A;  3BOA A;  2V41 A;  1GWC A;  4HSC X;  1YF0 A;  1O7U A;  3RDW A;  2VAF A;  2C4J A;  4OO5 A;  5ECL B;  1HNC A;  3KH7 A;  5F07 A;  5ECN B;  4K5R A;  1KTE A;  4J2F A;  4KSM A;  2XHF A;  3RHB A;  4WF5 A;  1J0F A;  1F9M A;  2AV4 A;  1VF1 A;  2YAN A;  1HD2 A;  1SKW B;  3EPT A;  3D4T A;  3F8U A;  1A2L A;  4GST A;  4AF2 A;  2FWH A;  2P5R A;  3KCM A;  4IQ1 A;  2RUE A;  4MJE A;  2IFQ A;  1O6J A;  2X4A A;  1XIY A;  1Y25 A;  4DSR A;  2HSM A;  3ISO A;  3IXR A;  4BA7 A;  4AGS A;  1ZYP A;  1UVZ A;  1ERV A;  1F37 A;  2HXK A;  3GTU A;  1A24 A;  2LNT A;  1USB A;  5CRE A;  5D9X A;  2H0G A;  1JLV A;  4WR4 A;  2V6O A;  1TK8 B;  5BMU B;  2VM1 A;  1K0O A;  4KH7 A;  5HR3 A;  5G2Z A;  3ZVJ D;  3WD6 A;  1AQV A;  4AJ8 A;  4HUA A;  3QD9 A;  3DEX A;  4D73 B;  1SKS B;  2KP2 A;  3QFB C;  4EXJ A;  1E6B A;  1ST9 A;  1ZYN A;  2H01 A;  8GSS A;  5A4V A;  1O8X A;  3IHQ A;  4AJ7 A;  2AJQ B;  1K3Y A;  2I9H A;  2YV9 A;  5A5H B;  2IMI A;  4EKZ A;  2FWG A;  3ZFL A;  3GUS A;  1A2M A;  2QGV A;  2XBI A;  3IK7 A;  2A4H A;  2IMF A;  2FHE A;  1XWG A;  2H8L A;  1ZGN A;  2CAQ A;  2NDO A;  4N0Z A;  3A2X A;  4TR3 A;  4DSQ A;  1RQM A;  5DCG A;  4GDF A;  2L5O A;  2PWJ A;  2MMZ A;  4XRA A;  1I9D A;  2YN1 A;  3LFL A;  1V58 A;  3GST A;  4BPY A;  2YJH A;  2LEG A;  3Q6O A;  5JWQ B;  1MD3 A;  4MA9 A;  2PN8 A;  3HZ8 A;  3HY2 A;  4OCE A;  1BAY A;  4XHM A;  3VWU A;  1AW9 A;  1K0B A;  2CVD A;  2IWT A;  4DVC A;  4AJ6 A;  4JZQ A;  2WS2 A;  2F8A A;  4J57 E;  3HJP A;  4TR4 A;  3M3M A;  1WPI A;  3FY7 A;  3EE2 A;  6GSU A;  2N5F A;  3ERG A;  3KD0 A;  2OAC A;  3TDG A;  1AQX A;  2CX3 A;  1GSY A;  2H71 A;  3H4K A;  4K2X A;  5EL8 A;  5ID2 B;  4EUY A;  1YEW C;  1GTI A;  2H1A A;  1OC9 B;  4I6X A;  3DXB A;  3IA1 A;  1A2J A;  3CRT A;  4CDO A;  1XVQ A;  1U6T A;  3ZTL A;  14GS A;  1PFO A;  1GP1 A;  3H79 A;  4IJ3 A;  4N0V A;  2FGX A;  4G0L A;  2Z9S A;  2K8V A;  1BX9 A;  5C00 A;  1ILO A;  2WZS A;  4NXI A;  4YQU A;  2WW1 A;  3TOT A;  3GKK A;  4N11 A;  1XFL A;  1A0F A;  1V9W A;  2XBQ A;  1HQO A;  4FO5 A;  1ZMA A;  3QCP A;  1NHO A;  2B1K A;  5E59 A;  4PNG A;  1B48 A;  4EDY A;  2YWM A;  3BD2 A;  1R5P A;  2X64 A;  1PX6 A;  2PER A;  1GNW A;  3LWA A;  3EC3 A;  5B6M A;  4Z2T A;  4CY8 A;  5KN2 A;  2A4V A;  3LYK A;  4L5O A;  4K6X A;  1YDK A;  1TRS A;  3KZQ A;  3TJK A;  4W66 A;  5AIS A;  2QSI A;  1IYH A;  3A5I A;  3FRC A;  3QDN A;  1T4Y A;  2WB9 A;  5DDL A;  2GSR A;  3FYG A;  2FA8 A;  1X5E A;  4DSS A;  5D9V A;  5B6N A;  5EY6 A;  3H93 A;  2O36 A;  2YPM A;  5EVO A;  1TK0 B;  1XBS A;  5GAN D;  4BWQ A;  4Q5Q A;  5HR1 A;  3HVX A;  13GS A;  5D96 A;  4WEY A;  2O89 A;  3UBK A;  3VWW A;  1B4Q A;  3APS A;  1ML6 A;  4ECI A;  2YCD A;  1U3I A;  2ZUP A;  1URM A;  3L4N A;  5DJL A;  2PMT A;  3D5J A;  3C1R A;  2B7K A;  4ID0 A;  3D0Z A;  3GFK A;  5COH A;  2VUP A;  1V98 A;  1EEJ A;  2B6M A;  1N25 A;  4ZB6 A;  3SWL A;  5D9W A;  3UOM A;  4QL7 A;  2R0G A;  2HZF A;  1FB6 A;  2DJ2 A;  1Z7P A;  5D9T A;  2IPA A;  2HFD A;  3UJ1 A;  4X0X A;  2YZU A;  2CAI A;  3QAV A;  2B1L A;  5IMZ A;  3G7I A;  2H6Z A;  1TU7 A;  2HNL A;  4PGT A;  5IMF A;  4F0B A;  3DRN A;  4CY6 A;  3I69 A;  3L9V A;  1B4P A;  2O85 A;  4KF9 A;  1GLP A;  5A34 A;  3CMI A;  1B9X C;  4A5P A;  2H30 A;  5DAL A;  3FZ9 A;  2REM A;  2YZH A;  5KOX A;  1GUM A;  4LMW A;  4OMV A;  4FQU A;  6GST A;  1MD4 A;  1PL1 A;  2VLU A;  4GCI A;  2LKU A;  2OBI A;  1V2A A;  1TK5 B;  4HS1 A;  1CQG A;  2VL9 A;  3TJB A;  3HHV A;  3BBY A;  2MZC A;  3DML A;  4HJ2 A;  2JZR A;  2VD0 A;  1AAZ A;  2C1Y A;  1PA3 A;  4MJB A;  1M9B A;  4PHZ C;  2AAW A;  1TDI A;  4NHW A;  2OT3 A;  2F51 A;  1XW6 A;  4YKF A;  3UAR A;  5FWG A;  3H8Q A;  3FK8 A;  4KUN A;  2H73 A;  5IO0 A;  3GRX A;  2L6C A;  4I97 A;  4POB A;  4GSN A;  4GQF A;  3IE3 A;  4F0C A;  1SVO A;  1O85 A;  4N30 A;  2WDU A;  3BCI A;  3VWX A;  3G9B A;  2P5Q A;  1KBN A;  2FWE A;  5FT3 A;  2EFE A;  2EFH A;  6GSW A;  3F0I A;  1M9A A;  3IAS 2;  4KAE A;  4HEA 2;  3HCZ A;  3TKS C;  4MF6 A;  3TRX A;  1MEK A;  4PQ1 A;  5ABR A;  1FB0 A;  2FCH A;  2GQM A;  4XS4 B;  1QQ2 A;  1GTB A;  2FA4 A;  3GUR A;  3L0H A;  1EV4 A;  1KEB A;  1B8X A;  4YKG A;  5JWO B;  3FMW A;  4CHS A;  3IOS A;  5AIV A;  3EWL A;  3HVV A;  1F3A A;  4IKH A;  1PKZ A;  5L71 A;  9GSS A;  3VK9 A;  1LU4 A;  3LSZ A;  3I9V 2;  3KP8 A;  1GSQ A;  3O3T A;  4MF7 A;  4BL7 A;  1PX7 A;  2HSH A;  4YH2 A;  6GSX A;  3QR6 A;  4K0G A;  1YJ6 A;  1WRY A;  2YWI A;  1PGT A;  2C3Q A;  3VUR A;  2FUG 2;  3CQF A;  3CWG A;  1GTU A;  2VCV A;  3F63 A;  4PX1 A;  2EFC A;  5G30 A;  3US3 A;  2V2G A;  2WJU A;  2WVX A;  1X5D A;  3CYN A;  1SVL A;  2CQ9 A;  4F82 A;  3KTB A;  3IPZ A;  1CQH A;  1MTC A;  3FZ5 A;  1ABA A;  4IS0 A;  4BVX A;  5GST A;  3HMJ G;  4KSO A;  2M46 A;  2O87 A;  2F8F A;  4IGJ A;  1ZL9 A;  2WW3 A;  1M3J A;  4FXY P;  4IBP A;  2LRC A;  4E8E A;  1T00 A;  3CSH A;  3P90 A;  2EC4 A;  4ZB8 A;  3N9J A;  4KDU A;  2GT5 A;  5DQS A;  5A1N A;  3FZ4 A;  4I8B A;  5ECR B;  10GS A;  2P31 A;  1XWA A;  4K9Z A;  3TJF A;  1GLQ A;  4MPG A;  1XWB A;  3MAK A;  2C0G A;  1ZCP A;  6GSY A;  1XOA A;  4BVY A;  3FZA A;  4TR1 B;  2QA1 A;  2VCW A;  3ZMK A;  1SK0 A;  2WRT A;  2ALB A;  1EV9 A;  2FY6 A;  4NV5 A;  3KMO A;  2E2G A;  3ZFB A;  5J9B A;  2EIQ A;  4G0I A;  2H1L A;  1T1V A;  1R5A A;  3GV1 A;  5DVB A;  4ZIL A;  2IN3 A;  3D22 A;  4MZC A;  3EU3 A;  3CXG A;  2OJL A;  2OE1 A;  5G1L A;  2GSS A;  5KN0 A;  3RFR C;  3HDC A;  3MWH A;  2GDR A;  2H75 A;  5CRD A;  2WVZ A;  4PQH A;  2GQK A;  3PR8 A;  3D21 A;  5AN1 A;  1U87 A;  2UZ8 A;  4MZW A;  1JZO A;  5BRT A;  1SJI A;  3FR6 A;  1M2B A;  3KGK A;  4WET A;  3DWV A;  3WGD A;  2ZCT A;  3TKQ A;  5J47 A;  1SK2 A;  1XWK A;  1T3B A;  2B7J A;  3I43 A;  1F6M C;  2L5L A;  4L8E A;  2VL2 A;  1THO A;  1WOU A;  2HRA A;  3TCO A;  5DCH A;  2L4C A;  4JBB A;  2VLV A;  3K8N A;  4G19 A;  4ISD A;  2O8V B;  1S3A A;  2B5E A;  1TXX A;  1EP7 A;  1SVM A;  4YAP A;  1R7H A;  3CBU A;  5IOW A;  5HFG A;  4EDZ A;  1Y1U A;  5BMU A;  2KUC A;  5DAK B;  3V1W A;  4PUR A;  3SBC A;  4KW6 A;  2F9S A;  4EE0 A;  12GS A;  1PQN A;  4PNF A;  1EEM A;  2LQO A;  4ZL7 A;  3GL5 A;  5DJM A;  3PGT A;  2HYX A;  3APQ A;  1T8E B;  2R3X A;  5D8I A;  1EOG A;  3HJO A;  3IRA A;  3TJG A;  4LL1 B;  2GT6 A;  2HSY A;  5AGY A;  3P2A A;  5J9C A;  1EP8 A;  2O5V A;  4G0K A;  2C0F A;  4L5L A;  5J41 A;  2DSA A;  4FYC A;  2DIZ A;  4TR1 A;  5CP1 A;  4XS4 A;  1EGR A;  4MAB A;  2E2M A;  3A5W A;  3A2W A;  2DJ0 A;  4MDC A;  4ECJ A;  2QKE A;  5IMC A;  1FOV A;  3HVN A;  5IPG A;  1QFN A;  3DIE A;  1PMT A;  1S3C A;  1OAZ A;  3NOF A;  3C73 A;  1XW9 A;  2H74 A;  4KX4 A;  1FVJ A;  1R4W A;  3DKS A;  4IP6 A;  2KLX A;  1O73 A;  4V2N A;  3GL3 A;  3CSI A;  4K0N A;  1XCC A;  11GS A;  1NSW A;  5HFK A;  4O5R A;  2J9H A;  4OCF A;  4JED A;  5IIZ A;  2YNX A;  4L0U A;  1FG4 A;  2KP1 A;  1LBK A;  1T4Z A;  4WF4 A;  3C7M A;  1TKD B;  3WYW A;  2CV4 A;  4FH8 A;  2LNS A;  4ZXG A;  3J7Y b;  4IEL A;  1A8L A;  2R6K A;  1DE2 A;  2UV8 G;  2JAD A;  4POK A;  2H19 A;  4EIQ A;  3ZRD A;  5JCG A;  1V57 A;  2BTO T;  3UVT A;  1Z6M A;  2HSN B;  3LEF A;  3LW9 A;  3EYT A;  1FW1 A;  1O8W A;  3MSZ A;  3LXZ A;  1QMV A;  2H76 A;  1TJD A;  3ME7 A;  3VFI A;  3VPT A;  2JZS A;  4E8H A;  4Z2U A;  1RK4 A;  4PXO A;  3CTG A;  2R5G A;  3O76 A;  4GRF A;  2IL3 A;  2HQT A;  2YWO A;  3IDV A;  1WJK A;  2YWN A;  3D4M A;  4YAV A;  3LG6 A;  5A1N B;  1PRX A;  1THX A;  3DVW A;  2E7P A;  3F3Q A;  1SL0 B;  2A2P A;  2VD1 A;  4K2D A;  4MLY A;  1FVK A;  4DSS B;  1PL2 A;  1YEX A;  5INY A;  2IME A;  2VCQ A;  3EMP A;  3KM6 A;  1SEN A;  4GF0 A;  4PI0 C;  3ME8 A;  2X49 A;  2TRC P;  4IW9 A;  2NTO A;  1G7E A;  4KE3 A;  2PPT A;  1JZW A;  4XCS A;  3L9S A;  4ULX A;  3JCM L;  4EO3 A;  3OR5 A;  1ZYE A;  2CT6 A;  4PQI A;  3LGC A;  4HJM A;  1OYJ A;  1H75 A;  1AXD A;  2JL4 A;  3APO A;  1JHB A;  1S3R A;  2DKH A;  2BJX A;  2K9F A;  4IP1 A;  4POM A;  4Q5N A;  5CRW A;  5DAK A;  3TOU A;  2HZE A;  4AKX B;  4XTS A;  2R0C A;  4O7H A;  4TXV A;  3N5O A;  3FKF A;  3G7J A;  4QL9 A;  5HR0 A;  1GNE A;  1Z5Y E;  3FR9 A;  2GZZ A;  2VM2 A;  1TRV A;  1WMJ A;  5F05 A;  4G10 A;  2H6X A;  2CVK A;  4MNN A;  4FYU A;  1N2A A;  3TKP A;  1JLW A;  4HOJ A;  1M99 A;  2X99 A;  5JCU A;  1TRW A;  1GSD A;  2AHE A;  2RUF A;  2K6V A;  3F4R A;  4KND A;  2H0H A;  1SJZ A;  4K5S A;  4QMK A;  5H5S A;  7GSS A;  1C72 A;  1WWJ A;  1M2D A;  3UMA A;  1R26 A;  2IMK A;  1SD9 A;  2HRK A;  2WVY A;  3CTF A;  4KB3 A;  1XWC A;  4H86 A;  1AC1 A;  1ON4 A;  3RHC A;  5H5Q A;  5ECK B;  1QK8 A;  5JCW A;  4NV2 A;  4LL4 B;  1K0M A;  5HFI A;  4POL A;  2RM5 A;  5EPF A;  1GL8 A;  2HI7 A;  4Z2R A;  4O5U A;  4KDY A;  3HKR A;  2DJJ A;  3ZYW A;  4D73 A;  4Z7X A;  4J56 E;  2EFD A;  3DGQ A;  5CYY A;  2CX4 A;  2KOK A;  1JZD A;  3M1G A;  1AUC A;  4WBJ A;  2KHP A;  4N3Z A;  1ERW A;  5ECP B;  4P3Y B;  2H72 A;  1GSU A;  3MDK A;  1YEP A;  2OBK A;  4GTU A;  4V1A p;  3TKS E;  4EVM A;  1Z6N A;  2IMD A;  2LV3 A;  17GS A;  1Z9H A;  5A4W A;  4G9H A;  1I5G A;  1OE7 A;  2JSZ A;  2A2R A;  4BWS A;  2QA2 A;  5GSS A;  4GXZ A;  3LXT A;  4G01 A;  2DLX A;  2YOI A;  4MMM A;  3EIN A;  3E0U A;  3CSJ A;  4EC0 A;  2I1U A;  3U5R E;  1FHE A;  4CW9 A;  4O5Q A;  3C1S A;  3M0F A;  2WW2 A;  4N10 A;  5CRH A;  2N5B A;  4I5Q A;  4XS1 A;  3O6T A;  3L9U A;  4MP4 A;  2QC7 A;  3IC4 A;  2H0I A;  3HVS A;  1GSF A;  4YQM A;  5ELA A;  3KEB A;  3KXO A;  1GUH A;  3LJR A;  3F6D A;  4ILF A;  1VF4 A;  2X8H A;  4MH3 A;  2X8G A;  3PIN A;  2DBC A;  4RUV A;  3FEU A;  2RLI A;  2CZ3 A;  4OFN A;  3GKN A;  3WT2 A;  3IBH A;  1MDI A;  3Q18 A;  2V1M A;  2GVP A;  4GQC A;  4LLR A;  2PVO C;  1X9W B;  2GQL A;  1W4V A;  2K18 A;  2DJ3 A;  3TB2 A;  4HU9 A;  1J9B A;  1AQW A;  4AKG A;  1F3B A;  1XPV A;  2C80 A;  1SL2 B;  4X4J A;  5F8B A;  4X1U A;  4ZBD A;  16GS A;  1WP0 A;  1VRS D;  4ICY A;  5ELG A;  3UAP A;  1JFU A;  2WFC A;  3NIV A;  4LMV A;  3GSS A;  2LST A; 
#chains in the Genus database with same CATH homology
 4ZBA A;  1ZOF A;  4QQ7 A;  2L6D A;  1DBY A;  3GH9 A;  1M7T A;  5J5N A;  1SJ6 A;  3GA4 A;  2DMM A;  3M9K A;  1BG5 A;  3KIJ A;  4EF0 A;  1X9M B;  3ZL5 A;  1EGO A;  1YY7 A;  1GTA A;  3IV4 A;  2OE3 A;  4ZL8 A;  4E68 A;  1DUG A;  2MMA A;  2BMX A;  1SD8 A;  1UA5 A;  1A8Y A;  2NPB A;  1JZR A;  1EOH A;  1O81 A;  2CA8 A;  2OE0 A;  1WE0 A;  1SKR B;  2HLS A;  3Q19 A;  2YV7 A;  1Q4J A;  3CRU A;  2HRF A;  4JU5 A;  3TRP A;  2HRK B;  2DIY A;  1OVN A;  3F9U A;  1VF2 A;  1NW2 A;  4JRR A;  4JE1 A;  3F6F A;  4GWR A;  2L59 A;  3KJY A;  2JU5 A;  2HSN A;  5KOW A;  2LQQ A;  4YQV A;  2R0P A;  3KTL A;  4I2T A;  3QFA C;  1G7O A;  3VI5 A;  2GST A;  2XC2 A;  3EMX A;  1UN2 A;  2EIR A;  2IJY A;  3ZIV A;  3QAG A;  5J4U A;  5IOX A;  5IM9 A;  5GAP D;  2K8S A;  3QPM A;  3HZ4 A;  2GTU A;  4FIW A;  4HZ4 A;  1VF3 A;  4X43 A;  1TOF A;  2JZT A;  5LD0 A;  3GX0 A;  1IYI A;  3A3T A;  2MMN A;  5CAX A;  4K1F A;  3HD5 A;  3TU3 B;  5A5H A;  3VLN A;  2C8U A;  5ECM B;  1TU8 A;  4LA1 A;  1BJX A;  20GS A;  4BL7 B;  3UVH A;  3Q74 A;  3EUR A;  2H6Y A;  1GUK A;  4WR5 A;  2J23 A;  2EIO A;  5ECI B;  1S3D A;  2LJK A;  3S9F A;  1PKW A;  2LTK A;  2HRN A;  1W89 A;  1M0U A;  5KEJ A;  4Q5R A;  4RI6 A;  2GZY A;  4TR0 A;  4ACS A;  3FW2 A;  2HZE B;  2TIR A;  4TW5 A;  1X5C A;  3ZZX A;  4PTS A;  4IHU A;  2ES7 A;  2VL3 A;  3F4T A;  3ZIJ A;  2GLR A;  4NMU A;  1EWX A;  3ERW A;  4MH2 A;  4WBR D;  3VPQ A;  2VL2 C;  3HA9 A;  5J4Y A;  1XW5 A;  1RW1 A;  3VI7 A;  3ZLP A;  2OA7 A;  3L78 A;  5ECS A;  2I3Y A;  4RQR A;  2NBS A;  5A5K A;  1T7P B;  4K7O A;  1SYR A;  1EZK A;  1G6Y A;  1HNA A;  2ZNM A;  1TI1 A;  3I6A A;  4PUF C;  2G2Q A;  1K0C A;  2VIM A;  1AIU A;  3W8S A;  3UIW A;  5C04 A;  5CRG A;  4F03 A;  4GSS A;  1TP9 A;  3QMX A;  1YKC A;  1XZO A;  5D73 A;  3IHG A;  1OKT A;  4JR6 A;  2P0G A;  4ZB7 A;  3DVX A;  2FLS A;  1K3O A;  2LUS A;  4AI6 A;  1Q98 A;  1PN0 A;  2XPD A;  3TJJ A;  3IR4 A;  4OO4 A;  2TRX A;  3VWV A;  3TGZ A;  3P7X A;  2CVB A;  4MJC A;  2RM6 A;  1TI3 A;  3F4S A;  4ML6 A;  5IPH A;  2DJ1 A;  3DD3 A;  2IFQ B;  2E0Q A;  1SL1 B;  5GZZ B;  2CZ2 A;  2VCT A;  1YKA A;  3HJM A;  4MPF A;  1TXU A;  5A34 B;  5HR2 A;  2HT9 A;  1K3L A;  1PD2 1;  1M2A A;  4ZIJ A;  3MYD A;  3HYP A;  1BF5 A;  5J4V A;  4TKY A;  1WIK A;  1OC9 A;  4KA0 A;  4TN8 A;  5CO3 A;  4V2L A;  1PN9 A;  3GYK A;  2DC5 A;  4RQX A;  2IIY A;  3MNG A;  2VOC A;  4F2I A;  2HE3 A;  2ON5 A;  5ENU A;  3M9J A;  3MIX A;  3TKR A;  3WGX A;  3ZML A;  2GZP A;  5IMV A;  3GTU B;  2FWF A;  2B5Y A;  4PUA A;  1Z7R A;  3TUE A;  1NHY A;  4NAX A;  1BYE A;  3W6G A;  2DML A;  3GHA A;  1U3A A;  4ML1 A;  3UEM A;  5J3R A;  2PVQ A;  1GSS A;  1F2E A;  3PH9 A;  1GSE A;  1BQ7 A;  3ERF A;  3GX8 A;  5LCZ A;  2H1D A;  3TRQ A;  1TRU A;  2PUK C;  1QGV A;  4K7N A;  4V2M A;  4EIP A;  2R2J A;  1VGL A;  4ECC A;  1OC8 A;  5KN1 A;  2JSY A;  1K0A A;  4KDX A;  1MDK A;  2AUV A;  2MMO A;  4AKH A;  3GH6 A;  4XRD A;  3TKS A;  2F3M A;  1X9S B;  6GSV A;  1GRX A;  4KCE A;  1ERT A;  5DBQ A;  3EVI A;  2I4A A;  2B3S A;  2MBT A;  4O92 A;  4GLT A;  4V1A g;  2MBS A;  2C3T A;  2WUL A;  2WZ9 A;  1FAA A;  4OFT A;  2VCZ A;  3C8E A;  4XIH A;  3U6V A;  3UL3 A;  3KH9 A;  1X0R A;  1Z3E A;  2JAC A;  1OKD A;  5J40 A;  2A2S A;  5HQP A;  1GH2 A;  4EL1 A;  1N8J A;  3R2Q A;  3G7Y A;  4TXO A;  3LYP A;  3GN3 A;  4ECB A;  4NPB A;  2XPE A;  4TVE A;  3IC8 A;  4HDE A;  2LJR A;  2WCI A;  1HNB A;  2L4Q A;  4MF5 A;  4KCA A;  4HQZ A;  1KNG A;  4ZL9 A;  4NHZ A;  1G0T A;  4TRX A;  1LJR A;  3QOU A;  2AYT A;  2H1G A;  1UC7 A;  5DQY A;  4G2E A;  4BVX B;  4MJA A;  2OKA A;  3RPN A;  2PGT A;  5KN3 A;  3M8N A;  3BCK A;  5G5F A;  2R37 A;  2C0E A;  2M80 A;  5D93 A;  2C0D A;  3GNJ A;  3ZIT A;  4F9Z A;  3QAW A;  1OE8 A;  1PSQ A;  3NZN A;  2GGT A;  3AY8 A;  3ZRE A;  2GS3 A;  4Q5F A;  2GSQ A;  3BJ5 A;  3WGE A;  5IQY A;  1Y6E A;  3GIX A;  4IN0 A;  2ON7 A;  4OD7 A;  2LJA A;  3F3R A;  2FNO A;  4WKW A;  3LOR A;  2L57 A;  1K0D A;  4L0W A;  5ECQ B;  2N5A A;  3P8W A;  3RPP A;  4BVY B;  2V6K A;  2X8C A;  4ZBB A;  1BED A;  2NVL A;  1A23 A;  4O32 A;  3EU4 A;  1FOH A;  5G1K A;  3DYR A;  4USS A;  3H1N A;  3WT1 A;  2AB6 A;  5F0G A;  1GUL A;  5B8B A;  4DEJ A;  1ZYQ B;  5AIX A;  1U88 A;  2G0F A;  1NM3 A;  2FD3 A;  4MZB A;  4HU7 A;  4TOP A;  1XXU A;  1TTZ A;  1ZZY A;  2PU9 C;  1HYU A;  3RBT A;  1OC3 A;  3R3E A;  1QUW A;  4FYB A;  19GS A;  3LQ7 A;  2M72 A;  1DE1 A;  1YF1 A;  2H1B A;  3D6I A;  2DJK A;  4KGI A;  4XS6 A;  6GSS A;  1TW9 A;  2D2Z A;  3IK9 A;  4AKI A;  1K0N A;  1ERU A;  1V40 A;  5H5R A;  4HQS A;  4IJI A;  1SK1 A;  3J7Y k;  4MK3 A;  4HZ2 A;  3ZVJ A;  3W8J A;  3KP9 A;  2LS5 A;  5IMD A;  1QXH A;  1DSB A;  3E3E A;  2B5X A;  2O7K A;  1ACV A;  3E9J B;  5G31 A;  1YQ1 A;  5CNW A;  2VKZ G;  4HI7 A;  3ED3 A;  4IVF A;  2V32 A;  1BG1 A;  2I81 A;  1A0R P;  5E4W A;  5ECH B;  2MYG A;  2HSM B;  3GKM A;  2LRN A;  3IAM 2;  1MDJ A;  2PBJ A;  3HXS A;  3GKX A;  2H66 A;  4K8M A;  5LNK e;  4JR4 A;  1SU9 A;  4WXT A;  3PPU A;  4ZB9 A;  2YP6 A;  1E2Y A;  4K7I A;  2R4V A;  22GS A;  5DAL B;  5F06 A;  3FR3 A;  2VCX A;  4RI7 A;  2DKI A;  5IMA A;  5IO2 A;  5B8A A;  3C71 A;  5JWR B;  1YZX A;  1SYX A;  5G5E A;  1H4O A;  4NWY A;  3KMN A;  5B7C A;  1YVL A;  2WGR A;  5ECO B;  2OAD A;  4TXO B;  4OFM A;  3GMF A;  5ID2 A;  3A2V A;  1G6W A;  1B9Y C;  2H70 A;  1J08 A;  1FO5 A;  4I2U A;  1XOB A;  4OWY A;  18GS A;  5A4U A;  2RII A;  2VLT A;  1XVW A;  3UBL A;  3RAZ A;  4MCU A;  2C3N A;  2LRT A;  4IQA A;  5FHI A;  2YJ7 A;  3FHK A;  2VO4 A;  3BOA A;  2V41 A;  1GWC A;  1YF0 A;  1O7U A;  3RDW A;  2VAF A;  2C4J A;  4OO5 A;  5ECL B;  1HNC A;  3KH7 A;  5F07 A;  5ECN B;  4K5R A;  1KTE A;  4J2F A;  4KSM A;  2XHF A;  3RHB A;  4WF5 A;  1J0F A;  1F9M A;  2AV4 A;  1VF1 A;  2YAN A;  1HD2 A;  1SKW B;  3EPT A;  3D4T A;  3F8U A;  1A2L A;  4GST A;  4AF2 A;  2FWH A;  2P5R A;  3KCM A;  4IQ1 A;  2RUE A;  4MJE A;  2IFQ A;  1O6J A;  2X4A A;  1XIY A;  1Y25 A;  4DSR A;  2HSM A;  3ISO A;  3IXR A;  4BA7 A;  4AGS A;  1ZYP A;  1UVZ A;  1ERV A;  1F37 A;  2HXK A;  3GTU A;  1A24 A;  2LNT A;  1USB A;  5CRE A;  5D9X A;  2H0G A;  1JLV A;  4WR4 A;  2V6O A;  1TK8 B;  5BMU B;  2VM1 A;  1K0O A;  4KH7 A;  5HR3 A;  5G2Z A;  3ZVJ D;  3WD6 A;  1AQV A;  4AJ8 A;  4HUA A;  3QD9 A;  3DEX A;  4D73 B;  1SKS B;  2KP2 A;  3QFB C;  4EXJ A;  1E6B A;  1ST9 A;  1ZYN A;  2H01 A;  8GSS A;  5A4V A;  1O8X A;  3IHQ A;  4AJ7 A;  2AJQ B;  1K3Y A;  2I9H A;  2YV9 A;  5A5H B;  2IMI A;  4EKZ A;  2FWG A;  3ZFL A;  3GUS A;  1A2M A;  2QGV A;  2XBI A;  3IK7 A;  2A4H A;  2IMF A;  2FHE A;  1XWG A;  2H8L A;  1ZGN A;  2CAQ A;  2NDO A;  4N0Z A;  3A2X A;  4TR3 A;  4DSQ A;  1RQM A;  5DCG A;  4GDF A;  2L5O A;  2PWJ A;  2MMZ A;  4XRA A;  1I9D A;  2YN1 A;  3LFL A;  1V58 A;  3GST A;  4BPY A;  2YJH A;  2LEG A;  3Q6O A;  5JWQ B;  1MD3 A;  4MA9 A;  2PN8 A;  3HZ8 A;  3HY2 A;  4OCE A;  1BAY A;  4XHM A;  3VWU A;  1AW9 A;  1K0B A;  2CVD A;  2IWT A;  4DVC A;  4AJ6 A;  4JZQ A;  2WS2 A;  2F8A A;  4J57 E;  3HJP A;  4TR4 A;  3M3M A;  1WPI A;  3FY7 A;  3EE2 A;  6GSU A;  2N5F A;  3ERG A;  3KD0 A;  2OAC A;  3TDG A;  1AQX A;  2CX3 A;  1GSY A;  2H71 A;  3H4K A;  4K2X A;  5EL8 A;  5ID2 B;  4EUY A;  1GTI A;  2H1A A;  1OC9 B;  4I6X A;  3DXB A;  3IA1 A;  1A2J A;  3CRT A;  4CDO A;  1XVQ A;  1U6T A;  3ZTL A;  14GS A;  1GP1 A;  3H79 A;  4IJ3 A;  4N0V A;  2FGX A;  4G0L A;  2Z9S A;  2K8V A;  1BX9 A;  5C00 A;  1ILO A;  4YQU A;  3TOT A;  4N11 A;  3GKK A;  4NXI A;  1XFL A;  1A0F A;  1V9W A;  2XBQ A;  1HQO A;  4FO5 A;  1ZMA A;  3QCP A;  1NHO A;  2B1K A;  5E59 A;  4PNG A;  1B48 A;  4EDY A;  2YWM A;  3BD2 A;  1R5P A;  2X64 A;  1PX6 A;  2PER A;  1GNW A;  3LWA A;  3EC3 A;  5B6M A;  4Z2T A;  4CY8 A;  5KN2 A;  2A4V A;  3LYK A;  4L5O A;  4K6X A;  1YDK A;  1TRS A;  3KZQ A;  3TJK A;  4W66 A;  5AIS A;  2QSI A;  1IYH A;  3A5I A;  3FRC A;  3QDN A;  1T4Y A;  2WB9 A;  5DDL A;  2GSR A;  3FYG A;  2FA8 A;  1X5E A;  4DSS A;  5D9V A;  5B6N A;  5EY6 A;  3H93 A;  2YPM A;  5EVO A;  1TK0 B;  1XBS A;  5GAN D;  4BWQ A;  4Q5Q A;  5HR1 A;  3HVX A;  13GS A;  5D96 A;  4WEY A;  2O89 A;  3UBK A;  3VWW A;  1B4Q A;  3APS A;  1ML6 A;  4ECI A;  2YCD A;  1U3I A;  2ZUP A;  1URM A;  3L4N A;  5DJL A;  2PMT A;  3D5J A;  3C1R A;  2B7K A;  4ID0 A;  3D0Z A;  3GFK A;  5COH A;  2VUP A;  1V98 A;  1EEJ A;  2B6M A;  1N25 A;  4ZB6 A;  3SWL A;  5D9W A;  3UOM A;  4QL7 A;  2R0G A;  2HZF A;  1FB6 A;  2DJ2 A;  1Z7P A;  5D9T A;  2IPA A;  2HFD A;  3UJ1 A;  4X0X A;  2YZU A;  2CAI A;  3QAV A;  2B1L A;  5IMZ A;  3G7I A;  2H6Z A;  1TU7 A;  2HNL A;  4PGT A;  5IMF A;  4F0B A;  3DRN A;  4CY6 A;  3I69 A;  3L9V A;  1B4P A;  2O85 A;  4KF9 A;  1GLP A;  5A34 A;  3CMI A;  1B9X C;  4A5P A;  2H30 A;  5DAL A;  3FZ9 A;  2REM A;  2YZH A;  5KOX A;  1GUM A;  4LMW A;  4OMV A;  4FQU A;  6GST A;  1MD4 A;  1PL1 A;  2VLU A;  4GCI A;  2LKU A;  2OBI A;  1V2A A;  1TK5 B;  4HS1 A;  1CQG A;  2VL9 A;  3TJB A;  3HHV A;  3BBY A;  2MZC A;  3DML A;  4HJ2 A;  2JZR A;  2VD0 A;  1AAZ A;  2C1Y A;  1PA3 A;  1M9B A;  4MJB A;  2AAW A;  1TDI A;  4NHW A;  2OT3 A;  2F51 A;  1XW6 A;  4YKF A;  3UAR A;  5FWG A;  3H8Q A;  3FK8 A;  4KUN A;  2H73 A;  5IO0 A;  3GRX A;  2L6C A;  4I97 A;  4POB A;  4GSN A;  4GQF A;  3IE3 A;  4F0C A;  1SVO A;  1O85 A;  4N30 A;  2WDU A;  3BCI A;  3VWX A;  3G9B A;  2P5Q A;  1KBN A;  2FWE A;  5FT3 A;  2EFE A;  2EFH A;  6GSW A;  3F0I A;  1M9A A;  3IAS 2;  4KAE A;  4HEA 2;  3HCZ A;  3TKS C;  4MF6 A;  3TRX A;  1MEK A;  4PQ1 A;  5ABR A;  1FB0 A;  2FCH A;  2GQM A;  4XS4 B;  1QQ2 A;  1GTB A;  2FA4 A;  3GUR A;  3L0H A;  1EV4 A;  1KEB A;  1B8X A;  4YKG A;  5JWO B;  3FMW A;  4CHS A;  3IOS A;  5AIV A;  3EWL A;  3HVV A;  1F3A A;  4IKH A;  1PKZ A;  5L71 A;  9GSS A;  3VK9 A;  1LU4 A;  3LSZ A;  3I9V 2;  3KP8 A;  1GSQ A;  3O3T A;  4MF7 A;  4BL7 A;  1PX7 A;  2HSH A;  4YH2 A;  6GSX A;  3QR6 A;  4K0G A;  1YJ6 A;  1WRY A;  2YWI A;  1PGT A;  2C3Q A;  3VUR A;  2FUG 2;  3CWG A;  1GTU A;  2VCV A;  3F63 A;  4PX1 A;  2EFC A;  5G30 A;  3US3 A;  2V2G A;  2WJU A;  1X5D A;  3CYN A;  1SVL A;  2CQ9 A;  4F82 A;  3KTB A;  3IPZ A;  1CQH A;  1MTC A;  3FZ5 A;  1ABA A;  4IS0 A;  4BVX A;  5GST A;  3HMJ G;  4KSO A;  2M46 A;  2O87 A;  2F8F A;  4IGJ A;  1ZL9 A;  4IBP A;  2LRC A;  4E8E A;  1T00 A;  3CSH A;  3P90 A;  2EC4 A;  4ZB8 A;  3N9J A;  4KDU A;  2GT5 A;  5DQS A;  5A1N A;  3FZ4 A;  4I8B A;  5ECR B;  10GS A;  2P31 A;  1XWA A;  4K9Z A;  3TJF A;  1GLQ A;  4MPG A;  1XWB A;  3MAK A;  2C0G A;  1ZCP A;  6GSY A;  1XOA A;  4BVY A;  3FZA A;  4TR1 B;  2QA1 A;  2VCW A;  3ZMK A;  1SK0 A;  2WRT A;  2ALB A;  1EV9 A;  2FY6 A;  4NV5 A;  3KMO A;  2E2G A;  3ZFB A;  5J9B A;  2EIQ A;  4G0I A;  2H1L A;  1T1V A;  1R5A A;  3GV1 A;  5DVB A;  4ZIL A;  2IN3 A;  3D22 A;  4MZC A;  3EU3 A;  3CXG A;  2OJL A;  2OE1 A;  5G1L A;  2GSS A;  5KN0 A;  3HDC A;  3MWH A;  2GDR A;  2H75 A;  5CRD A;  4PQH A;  2GQK A;  3PR8 A;  3D21 A;  5AN1 A;  1U87 A;  2UZ8 A;  4MZW A;  1JZO A;  5BRT A;  1SJI A;  3FR6 A;  1M2B A;  3KGK A;  4WET A;  3DWV A;  3WGD A;  2ZCT A;  3TKQ A;  5J47 A;  1SK2 A;  1XWK A;  1T3B A;  2B7J A;  3I43 A;  1F6M C;  2L5L A;  4L8E A;  2VL2 A;  1THO A;  1WOU A;  2HRA A;  3TCO A;  5DCH A;  2L4C A;  4JBB A;  2VLV A;  3K8N A;  4G19 A;  4ISD A;  2O8V B;  1S3A A;  2B5E A;  1TXX A;  1EP7 A;  1SVM A;  4YAP A;  1R7H A;  3CBU A;  5IOW A;  5HFG A;  4EDZ A;  1Y1U A;  5BMU A;  2KUC A;  5DAK B;  3V1W A;  4PUR A;  3SBC A;  4KW6 A;  2F9S A;  4EE0 A;  12GS A;  1PQN A;  4PNF A;  1EEM A;  2LQO A;  4ZL7 A;  3GL5 A;  5DJM A;  3PGT A;  2HYX A;  3APQ A;  1T8E B;  2R3X A;  5D8I A;  1EOG A;  3HJO A;  3IRA A;  3TJG A;  4LL1 B;  2GT6 A;  2HSY A;  5AGY A;  3P2A A;  5J9C A;  1EP8 A;  2O5V A;  4G0K A;  2C0F A;  4L5L A;  5J41 A;  2DSA A;  4FYC A;  2DIZ A;  4TR1 A;  5CP1 A;  4XS4 A;  1EGR A;  4MAB A;  2E2M A;  3A5W A;  3A2W A;  2DJ0 A;  4MDC A;  4ECJ A;  2QKE A;  5IMC A;  1FOV A;  5IPG A;  1QFN A;  3DIE A;  1PMT A;  1S3C A;  1OAZ A;  3NOF A;  3C73 A;  1XW9 A;  2H74 A;  4KX4 A;  1FVJ A;  1R4W A;  3DKS A;  4IP6 A;  2KLX A;  1O73 A;  4V2N A;  3GL3 A;  3CSI A;  4K0N A;  1XCC A;  11GS A;  1NSW A;  5HFK A;  4O5R A;  2J9H A;  4OCF A;  4JED A;  5IIZ A;  2YNX A;  4L0U A;  1FG4 A;  2KP1 A;  1LBK A;  1T4Z A;  4WF4 A;  3C7M A;  1TKD B;  3WYW A;  2CV4 A;  4FH8 A;  2LNS A;  4ZXG A;  3J7Y b;  4IEL A;  1A8L A;  2R6K A;  1DE2 A;  2UV8 G;  2JAD A;  4POK A;  2H19 A;  4EIQ A;  3ZRD A;  5JCG A;  1V57 A;  2BTO T;  3UVT A;  1Z6M A;  2HSN B;  3LEF A;  3LW9 A;  3EYT A;  1FW1 A;  1O8W A;  3MSZ A;  3LXZ A;  1QMV A;  2H76 A;  1TJD A;  3ME7 A;  3VFI A;  3VPT A;  2JZS A;  4E8H A;  4Z2U A;  1RK4 A;  4PXO A;  3CTG A;  2R5G A;  3O76 A;  4GRF A;  2IL3 A;  2HQT A;  2YWO A;  3IDV A;  1WJK A;  2YWN A;  3D4M A;  4YAV A;  3LG6 A;  5A1N B;  1PRX A;  1THX A;  3DVW A;  2E7P A;  3F3Q A;  1SL0 B;  2A2P A;  2VD1 A;  4K2D A;  4MLY A;  1FVK A;  4DSS B;  1PL2 A;  1YEX A;  5INY A;  2IME A;  2VCQ A;  3EMP A;  3KM6 A;  1SEN A;  4GF0 A;  3ME8 A;  2X49 A;  2TRC P;  4IW9 A;  2NTO A;  1G7E A;  4KE3 A;  2PPT A;  1JZW A;  4XCS A;  3L9S A;  4ULX A;  3JCM L;  4EO3 A;  3OR5 A;  1ZYE A;  2CT6 A;  4PQI A;  3LGC A;  4HJM A;  1OYJ A;  1H75 A;  1AXD A;  2JL4 A;  3APO A;  1JHB A;  2DKH A;  2BJX A;  2K9F A;  4IP1 A;  4POM A;  4Q5N A;  5CRW A;  5DAK A;  3TOU A;  2HZE A;  4AKX B;  4XTS A;  2R0C A;  4O7H A;  4TXV A;  3N5O A;  3FKF A;  3G7J A;  4QL9 A;  5HR0 A;  1GNE A;  1Z5Y E;  3FR9 A;  2GZZ A;  2VM2 A;  1TRV A;  1WMJ A;  5F05 A;  4G10 A;  2H6X A;  2CVK A;  4MNN A;  4FYU A;  1N2A A;  3TKP A;  1JLW A;  4HOJ A;  1M99 A;  2X99 A;  5JCU A;  1TRW A;  1GSD A;  2AHE A;  2RUF A;  2K6V A;  3F4R A;  4KND A;  2H0H A;  1SJZ A;  4K5S A;  4QMK A;  5H5S A;  7GSS A;  1C72 A;  1WWJ A;  1M2D A;  3UMA A;  1R26 A;  2IMK A;  1SD9 A;  2HRK A;  3CTF A;  4KB3 A;  1XWC A;  4H86 A;  1AC1 A;  1ON4 A;  3RHC A;  5H5Q A;  5ECK B;  1QK8 A;  5JCW A;  4NV2 A;  4LL4 B;  1K0M A;  5HFI A;  4POL A;  2RM5 A;  5EPF A;  1GL8 A;  2HI7 A;  4Z2R A;  4O5U A;  4KDY A;  3HKR A;  2DJJ A;  3ZYW A;  4D73 A;  4Z7X A;  4J56 E;  2EFD A;  3DGQ A;  5CYY A;  2CX4 A;  2KOK A;  1JZD A;  3M1G A;  1AUC A;  4WBJ A;  2KHP A;  4N3Z A;  1ERW A;  5ECP B;  4P3Y B;  2H72 A;  1GSU A;  3MDK A;  1YEP A;  2OBK A;  4GTU A;  4V1A p;  3TKS E;  4EVM A;  1Z6N A;  2IMD A;  2LV3 A;  17GS A;  1Z9H A;  5A4W A;  4G9H A;  1I5G A;  1OE7 A;  2JSZ A;  2A2R A;  4BWS A;  2QA2 A;  5GSS A;  4GXZ A;  3LXT A;  4G01 A;  2DLX A;  2YOI A;  4MMM A;  3EIN A;  3E0U A;  3CSJ A;  4EC0 A;  2I1U A;  3U5R E;  1FHE A;  4CW9 A;  4O5Q A;  3C1S A;  3M0F A;  4N10 A;  5CRH A;  2N5B A;  4I5Q A;  4XS1 A;  3O6T A;  3L9U A;  4MP4 A;  2QC7 A;  3IC4 A;  2H0I A;  3HVS A;  1GSF A;  4YQM A;  5ELA A;  3KEB A;  3KXO A;  1GUH A;  3LJR A;  3F6D A;  4ILF A;  1VF4 A;  2X8H A;  4MH3 A;  2X8G A;  3PIN A;  2DBC A;  4RUV A;  3FEU A;  2RLI A;  2CZ3 A;  4OFN A;  3GKN A;  3WT2 A;  3IBH A;  1MDI A;  3Q18 A;  2V1M A;  2GVP A;  4GQC A;  4LLR A;  2PVO C;  1X9W B;  2GQL A;  1W4V A;  2K18 A;  2DJ3 A;  3TB2 A;  1J9B A;  4HU9 A;  1AQW A;  4AKG A;  1F3B A;  1XPV A;  2C80 A;  1SL2 B;  4X4J A;  5F8B A;  4X1U A;  4ZBD A;  16GS A;  1WP0 A;  1VRS D;  4ICY A;  5ELG A;  3UAP A;  1JFU A;  2WFC A;  3NIV A;  4LMV A;  3GSS A;  2LST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...