1K0NA

Chloride intracellular channel 1 (clic1) complexed with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
226
Chain Sequence
b'PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORIDE INTRACELLULAR CHANNEL PROTEIN 1
publication title Crystal structure of a soluble form of the intracellular chloride ion channel CLIC1 (NCC27) at 1.4-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 76
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1k0nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1k0nA01
2HSNB 2J23A 3GFKA 2CA8A 3H93A 3ZIVA 3F0IA 4WKWA 1AC1A 4HU9A 4POMA 3A3TA 4ZL8A 4HJ2A 5ECIB 3GN3A 3QOUA 2JACA 5ECOB 4OMVA 1M9BA 3VI5A 1PN9A 1BAYA 2FA8A 1GRXA 1O8WA 3KEBA 4Q5NA 1S3CA 4HZ4A 3IRAA 1DE2A 3MDKA 4KX4A 1M0UA 1QXHA 4PXOA 2REMA 1TOFA 3F9UA 3VFIA 1BJXA 4FQUA 2YP6A 2B5XA 2OACA 4V2LA 2GZZA 1T4ZA 2ZUPA 2IMFA 2HXKA 4KCEA 4L0UA 2H1AA 3VWXA 1GP1A 4K6XA 3J7Yb 3H1NA 2DMMA 3GH9A 2KLXA 1SK0A 1ERTA 5CRDA 1VF2A 4ZBBA 1WMJA 3GMFA 4WBJA 4OD7A 2H1BA 1Q4JA 1SKSB 2B1KA 2OA7A 5D93A 4GSSA 5E4WA 1K0CA 1ZCPA 4ZXGA 4IW9A 2XBQA 5F8BA 2O87A 2FGXA 2O7KA 3UMAA 1DSBA 2LRCA 5AGYA 4WF5A 5KN2A 1ZYEA 5G1KA 2IIYA 2CZ3A 3VLNA 2YJ7A 5GAND 4IKHA 5IQYA 5DALA 4EL1A 1RQMA 4KH7A 3IOSA 2VCZA 5AISA 2MBSA 1YDKA 3F3QA 5ID2A 3LORA 1M99A 1GL8A 20GSA 1UA5A 4NAXA 3ZFLA 4BVYB 4LA1A 2IMKA 5CRGA 1XPVA 3CMIA 1W89A 1JFUA 2C3TA 2ZNMA 1SKWB 3DGQA 5ECLB 3FR3A 1AQXA 3IR4A 1DE1A 4KDYA 4H86A 4GF0A 6GSVA 1XVQA 1Z9HA 4Q5FA 3A2WA 3TCOA 4EF0A 4PNGA 5DCHA 3KMNA 4HU7A 2GT6A 2LQOA 1NW2A 1EEMA 2XBIA 5A4VA 4MJBA 3W6GA 1B4QA 3GA4A 14GSA 2D2ZA 4X43A 3GH6A 2H01A 1ZOFA 3DRNA 4V2NA 3VPQA 3G9BA 1OKDA 3C71A 2H76A 3CSIA 1DBYA 3L4NA 3WYWA 2WJUA 2GZYA 2KOKA 1EGRA 6GSTA 2L6DA 5DAKB 1GNEA 4MCUA 3GL3A 1VRSD 3ZZXA 11GSA 2HZFA 5INYA 2LNTA 1TKDB 3TUEA 3GURA 3P90A 3EU4A 3ZTLA 1MDJA 5ELGA 2QC7A 1OC8A 6GSSA 2IFQA 1PKWA 2XC2A 4I2UA 2DJ2A 4OO5A 5IMZA 2AHEA 2AJQB 2H72A 2PVQA 1TDIA 1YF1A 4HUAA 4MPGA 1SJ6A 2JU5A 2VCXA 2B6MA 5D9XA 1K0MA 1GSQA 2HRAA 1WOUA 3QFBC 2VUPA 1TK0B 2FD3A 5AIXA 2V41A 5AN1A 4HEA2 2PVOC 3M9JA 2G0FA 3D22A 2FWGA 4ZL7A 2HSMB 4WBRD 4ZB8A 1GNWA 3IXRA 4FYCA 2K6VA 3FZ9A 1G6WA 4EO3A 2OKAA 3F4RA 1BQ7A 3U5RE 5A4WA 4G19A 4KNDA 1JLWA 5IPGA 4MLYA 4TR1B 2V32A 2H75A 2KHPA 4HDEA 3ERFA 2BMXA 2FY6A 2E2MA 5H5SA 1THOA 1QMVA 3TKPA 1BYEA 4K0GA 2E7PA 3V1WA 1B4PA 4QQ7A 2HRKA 4KGIA 5HR2A 2DBCA 1V2AA 3GTUA 3KMOA 1YKAA 1UVZA 5J9BA 4X0XA 2YZHA 1SL0B 4WXTA 5EL8A 5IMAA 5CNWA 1U3AA 2HZEB 2XPEA 5G31A 3TJGA 2CVDA 2Z9SA 1TK8B 1J9BA 1KBNA 1HNCA 5J41A 5CRHA 2WRTA 2MZCA 2OJLA 3UBKA 5DCGA 3NIVA 1GTBA 2VCQA 2PERA 2UZ8A 3IDVA 1K0DA 1OE7A 5D9VA 3I69A 3WGDA 1Q98A 3UVHA 2H74A 2C80A 1TRSA 3H4KA 2GQLA 3NOFA 1QFNA 22GSA 2TRXA 1R4WA 2LJKA 1A8LA 4TRXA 1B9XC 2CV4A 4ZIJA 3L0HA 4DEJA 4G0IA 3ZRDA 4ECCA 1V40A 5DQYA 2YCDA 5D96A 3KD0A 4IVFA 4I6XA 1YKCA 1T3BA 4KE3A 2EIRA 4OFMA 4ECIA 2FWFA 4OO4A 2EIOA 1ACVA 1S3AA 3DIEA 5DVBA 5D9TA 3ZMKA 2HFDA 1ILOA 4V2MA 2R4VA 4TN8A 3KP9A 3GSSA 1F6MC 3KH7A 12GSA 2WB9A 5H5QA 3RAZA 2YV7A 1EZKA 4EVMA 4IGJA 4LMVA 10GSA 2PBJA 1E2YA 1ZYQB 2VL9A 2PGTA 5JCUA 1OC9B 3QCPA 3WGXA 3VWUA 4GWRA 2GSRA 3FEUA 5B6NA 4PQ1A 3EMXA 3Q74A 4POKA 1PGTA 4TXVA 4MJCA 1H75A 1K3LA 2QGVA 2N5AA 3GYKA 3FRCA 5G1LA 3TGZA 3QFAC 3GHAA 5CAXA 2R6KA 2ON7A 3KTLA 1WP0A 1J08A 1TI3A 3O3TA 4EKZA 4ZL9A 1THXA 1SK2A 2GQMA 1WRYA 2H1GA 4KDUA 2LEGA 3TOUA 4KCAA 1Z6NA 2DC5A 5KEJA 1EOHA 2FWEA 5F0GA 3PINA 5JWRB 1CQHA 5IOXA 4PX1A 3HA9A 4MPFA 1XW9A 2O8VB 1R5AA 2R2JA 1V57A 3UAPA 4JU5A 1I5GA 3N5OA 2L6CA 1Y25A 2TRCP 3D21A 3R2QA 4KSOA 3HJOA 1M7TA 1DUGA 1XVWA 5F07A 4ZBAA 4P3YB 1ABAA 2CVKA 2VL3A 3HJPA 4ML6A 4ISDA 2V6KA 4IHUA 1GH2A 2LJRA 4O7HA 5GSSA 1XOAA 1T00A 1PSQA 5F06A 2C8UA 3DEXA 3TKSA 2HE3A 2F3MA 4IS0A 3WT2A 2I1UA 3GKXA 4KW6A 3BOAA 3GSTA 1K0BA 3M9KA 2M80A 4KB3A 1GLPA 3PPUA 2XHFA 2TIRA 5C00A 1YEPA 1QGVA 4LL4B 1PQNA 3VI7A 3A2XA 4BVYA 3GRXA 2P5RA 3LWAA 4BL7B 4IBPA 3LYPA 4K0NA 4WR4A 4MH2A 3FYGA 2X8CA 4Z7XA 2I3YA 2A2RA 1TRUA 4FYUA 5ENUA 5DJMA 3M8NA 1JHBA 4YAPA 1Z3EA 2CT6A 4YAVA 1X5EA 1GTUA 4F03A 5COHA 4ILFA 1A2JA 4MABA 4OFTA 1SD9A 4JBBA 2NBSA 5DDLA 3EE2A 1JZOA 4K7NA 3TJBA 3HDCA 8GSSA 1UC7A 2DSAA 1A2MA 3GIXA 4FYBA 1GSEA 3PGTA 2EIQA 4IJIA 3HHVA 3GL5A 1TTZA 1BX9A 5DAKA 4GSNA 1GSFA 4PQHA 3IBHA 2B5YA 1WE0A 4GSTA 1SJIA 2NTOA 2HI7A 1FHEA 3C7MA 2GLRA 4F0CA 4AJ8A 4BVXB 4NXIA 5HR1A 1X9MB 3UOMA 1TRVA 4D73B 3SWLA 2WDUA 4LMWA 1K0AA 1W4VA 5IMVA 2H19A 5B8AA 2WZ9A 3D0ZA 4MZWA 4TR4A 2QSIA 2DJKA 1XWAA 2GS3A 5CRWA 2EC4A 3N9JA 2HSMA 3GUSA 3K8NA 1USBA 3S9FA 3UBLA 3I43A 2GZPA 4YQMA 5G5EA 1PX6A 1EGOA 4RQXA 2C3QA 2FLSA 5ECNB 3BCIA 2C4JA 2RUEA 2HSYA 2PN8A 3L9SA 1TK5B 4TR1A 3EVIA 3KZQA 1OVNA 3IAS2 1SYRA 3U6VA 4DSSA 2DJ1A 2RLIA 3IK9A 6GSYA 4RQRA 3IAM2 1GUMA 2H8LA 2MMOA 1YEXA 1B48A 2H0GA 1XWCA 1RW1A 9GSSA 3QPMA 2M46A 3L78A 4RI6A 3CSJA 2DIZA 4K1FA 2VIMA 3RHBA 4WR5A 4G0LA 5D8IA 4GQFA 4ECJA 4Q5QA 18GSA 2YWNA 1KEBA 3C1SA 4RUVA 2YPMA 2YN1A 5C04A 4I8BA 4NHZA 1Z5YE 1E6BA 5DALB 2RM5A 4ZBDA 3ERWA 1R26A 3PR8A 2LS5A 3KXOA 2YANA 6GSWA 1FB6A 3E9JB 2C0DA 4J57E 1FB0A 1SKRB 1O81A 1U87A 3ZVJA 5G5FA 2R37A 1XFLA 1IYIA 4N11A 2LQQA 6GSXA 1T1VA 4JE1A 1GTAA 2V2GA 4AF2A 5JWOB 1OE8A 2L59A 3HD5A 5EVOA 1F37A 4XTSA 2O89A 3TB2A 1ZZYA 3M1GA 1X9WB 5FHIA 1EV4A 4AJ7A 3W8JA 4TXOB 3CTFA 4YH2A 2PPTA 4JR6A 2F8FA 1FAAA 4DVCA 1A0FA 3QAVA 1A8YA 2GGTA 2VL2A 2CX4A 4MF6A 2YNXA 2CVBA 2A4VA 3LQ7A 4I97A 1GSUA 2LKUA 4Q5RA 1KTEA 2LSTA 1F3BA 4N0VA 1X9SB 3LG6A 1V58A 4EDZA 4NWYA 1XIYA 4TOPA 1OC9A 2R5GA 1PA3A 4N0ZA 2B7KA 1PD21 3JCML 4MF5A 4F2IA 2JADA 5IPHA 5ABRA 1QQ2A 3AY8A 1M2DA 5JWQB 2CAQA 2L4QA 5G30A 4L5OA 4JZQA 3C8EA 1UN2A 3CRUA 3FHKA 1U3IA 1HD2A 2NVLA 4JRRA 2IFQB 3MNGA 1SYXA 7GSSA 2H0HA 2F9SA 1V98A 3O6TA 4ZB9A 2G2QA 3ME7A 1CQGA 2K8VA 3F6DA 5CYYA 4KDXA 1F3AA 4MJEA 1A24A 3ZFBA 1N8JA 2HYXA 2HNLA 3APOA 3MSZA 4HQZA 5LNKe 1JLVA 5CREA 3HJMA 3FZ5A 2AYTA 5HFIA 2PU9C 2X8HA 3UIWA 3FR9A 4O32A 2FWHA 1FVKA 4KF9A 2VM2A 5CP1A 3TJFA 2L57A 2LUSA 4IQ1A 4F0BA 3IC8A 3F63A 1TW9A 4G10A 3H79A 3F4TA 4G9HA 2NPBA 5D73A 4F9ZA 5GZZB 1SENA 1AQWA 1ON4A 1X5CA 4N30A 4K2DA 4HZ2A 1XXUA 3TJJA 5JCWA 5IO2A 3F8UA 1Z7RA 1BEDA 4XS4B 3MAKA 2V1MA 3FY7A 4GLTA 3DD3A 5ECPB 2K8SA 1O85A 2DJ3A 3H8QA 5ECKB 1JZDA 3E3EA 1F2EA 2N5BA 4CW9A 3NZNA 2VM1A 4LLRA 1H4OA 5HQPA 3LJRA 4YQUA 3HZ4A 1N2AA 3KGKA 4BL7A 2GVPA 1LJRA 3LXTA 2IMEA 1Z6MA 1PMTA 4V1Ag 1X5DA 2O85A 1SD8A 3HVSA 19GSA 5FT3A 4JEDA 4MA9A 3UARA 1GLQA 1MEKA 2OBKA 5IMFA 5KN3A 4MP4A 3PH9A 5ECRB 1ZL9A 5B6MA 2H71A 3KTBA 1YJ6A 3GKKA 4WETA 4ID0A 4IJ3A 2VLUA 1RK4A 3BCKA 3G7YA 1O73A 2LTKA 4NV5A 1O6JA 2H6XA 3RPPA 2VLVA 3GX0A 1R7HA 4PUFC 3BJ5A 1GTIA 1B8XA 2B7JA 1T4YA 2RIIA 1XBSA 3IV4A 2YWOA 2VCVA 3HVVA 5IOWA 2GDRA 1HNBA 1TU7A 3VPTA 1X0RA 2HSHA 4AJ6A 2M72A 2QKEA 1AIUA 1OC3A 4O5RA 1NSWA 2GTUA 2VO4A 4HJMA 2H1DA 1URMA 1YZXA 3HCZA 5ECSA 1BG5A 4F82A 5J5NA 3TOTA 4AGSA 5J9CA 2CX3A 5HR3A 4BVXA 3C1RA 3US3A 2P5QA 1QK8A 4POLA 4OWYA 5HFGA 1TU8A 1TRWA 5G2ZA 5L71A 3D4TA 5DQSA 2IWTA 3P2AA 2L5LA 3IHQA 2N5FA 3IPZA 2FUG2 3QAGA 4MJAA 2H66A 2NDOA 2VAFA 4I5QA 5GAPD 3I9V2 1SL2B 5F05A 5DBQA 2R3XA 4YQVA 2F8AA 3QR6A 3DYRA 5KN0A 2YV9A 4GCIA 4O92A 3KJYA 2DMLA 2HRFA 1XWKA 1EV9A 2AB6A 3DXBA 2ALBA 5IM9A 4JR4A 1XOBA 1QUWA 2H0IA 5AIVA 3GNJA 2B3SA 1YY7A 1ST9A 1OYJA 3L9VA 4MMMA 3FZAA 3ME8A 2IN3A 2HT9A 3ZLPA 3UJ1A 2YJHA 4IP1A 4ZB6A 4HQSA 2JL4A 2IMIA 3EMPA 1Z7PA 1LU4A 3D6IA 1ERUA 1SJZA 1K0NA 3SBCA 4KUNA 4MZCA 2C1YA 1GSYA 5ECHB 1HNAA 4K8MA 2OBIA 1VF1A 4NV2A 3QD9A 1YQ1A 3KH9A 4MDCA 2IJYA 2MMZA 1MD3A 2FCHA 2HRNA 2KP1A 2YWMA 1EOGA 1K3YA 3TKSC 3FR6A 3CYNA 3GKMA 2OE0A 1AXDA 3A5WA 3D5JA 2XPDA 4E8EA 4DSQA 3CTGA 1IYHA 4L5LA 3HYPA 1A2LA 1XW6A 5ECQB 4N10A 5CO3A 3TRXA 3GKNA 1MTCA 4XHMA 2H73A 3CRTA 2PUKC 3WGEA 1GWCA 4ZILA 1GSSA 1FG4A 3FW2A 1TJDA 4MF7A 1AW9A 4K7OA 1K0OA 4CDOA 1TI1A 5BMUA 3DKSA 2BTOT 4TXOA 2ES7A 3F3RA 4ECBA 5JCGA 2H6YA 2E2GA 3DVXA 5H5RA 4MK3A 2GSTA 16GSA 2H30A 2L4CA 4J2FA 2WULA 3J7Yk 4USSA 4PURA 4FO5A 4GQCA 1XCCA 4EXJA 1XZOA 3DVWA 3EU3A 4ML1A 4KAEA 1O8XA 2HLSA 4KA0A 3KP8A 1PX7A 2VOCA 3Q18A 4L8EA 2K18A 2VCTA 1F9MA 3ERGA 3GX8A 1V9WA 4V1Ap 4NHWA 4XS6A 3HY2A 3DMLA 4RI7A 1HYUA 1NHOA 3RBTA 3IE3A 3WT1A 3F4SA 2VD1A 2IPAA 3KM6A 2HZEA 3ZITA 3QAWA 3CBUA 2H6ZA 4J56E 4K7IA 1U88A 2CAIA 3W8SA 1SU9A 4BA7A 2RUFA 3APQA 3EINA 4KSMA 1AQVA 2YOIA 3VWVA 3DWVA 3TKQA 1R5PA 3UL3A 1M2BA 4XCSA 4EC0A 2C0EA 3M0FA 2CZ2A 1PKZA 5KN1A 3P7XA 1Y6EA 3EYTA 2AV4A 3A2VA 4ACSA 3D4MA 3OR5A 5ID2B 1SK1A 2MYGA 3CSHA 2L5OA 1PRXA 2PWJA 1PL1A 4TKYA 2A2SA 4QL9A 2OE1A 2F51A 1VF3A 1EWXA 3TKRA 2LRNA 1MDIA 4X1UA 3LFLA 4NMUA 4EDYA 3O76A 1OAZA 4K9ZA 2GSQA 3LYKA 2K9FA 2LNSA 4XS1A 3FK8A 5J4UA 4TVEA 2GT5A 3HVXA 1XWGA 1T8EB 3GV1A 1MDKA 1O7UA 3EURA 2WFCA 4BPYA 2MBTA 4CHSA 4IN0A 1WJKA 2VLTA 3EWLA 1KNGA 3VK9A 4PUAA 3QMXA 4DSSB 5EPFA 1FOVA 5LCZA 2P31A 2VD0A 2YWIA 1GUKA 3ZREA 4PGTA 1EP7A 4XS4A 2DLXA 5A5KA 5J3RA 1WIKA 2FA4A 1SL1B 5B7CA 2X8GA 4FH8A 3UEMA 2HQTA 3FZ4A 1FW1A 4GRFA 1ERWA 3LXZA 2J9HA 4OCFA 2JSYA 5ECMB 4EE0A 1OKTA 5LD0A 3ZIJA 4G0KA 3E0UA 3IK7A 2C0GA 5EY6A 1I9DA 2OE3A 2WGRA 3QDNA 1ERVA 4BWQA 5A4UA 2E0QA 3CXGA 2DJJA 3EC3A 2LRTA 4WEYA 4HI7A 5IO0A 3C73A 6GSUA 1G0TA 3APSA 3L9UA 1GULA 1B9YC 2DJ0A 4HS1A 1LBKA 1WWJA 1FVJA 2IL3A 3TDGA 1EP8A 1K3OA 5E59A 2GSSA 1C72A 3FKFA 4LL1B 3KIJA 2KP2A 2FNOA 5IIZA 3F6FA 1G6YA 1T7PB 2ON5A 2CQ9A 3ED3A 2X64A 1YF0A 4TW5A 2BJXA 2MMAA 2ZCTA 4XRAA 1AUCA 3RDWA 3R3EA 3ZMLA 2VL2C 2WS2A 4POBA 2GQKA 3ZVJD 5B8BA 2I4AA 3G7IA 2HRKB 1NHYA 1XWBA 1HQOA 1U6TA 3KCMA 3IC4A 3GTUB 4IQAA 2YZUA 5GSTA 1WPIA 3P8WA 2JZSA 3UVTA 5DJLA 5IMDA 3Q19A 2X99A 2I81A 5IMCA 1S3DA 3I6AA 2WCIA 3G7JA 2C3NA 3HKRA 2OADA 1M9AA 2IMDA 3RHCA 3ISOA 1A23A 3RPNA 2I9HA 4I2TA 1GUHA 3IA1A 1XW5A 5D9WA 2JZRA 2KUCA 4NPBA 3VWWA 4BWSA 2LJAA 2AAWA 2B1LA 4PNFA 2DIYA 1VF4A 3ZL5A 4DSRA 1VGLA 4PQIA 3MWHA 4GXZA 1NM3A 2FHEA 4MZBA 17GSA 4WF4A 3LSZA 3M3MA 3TRPA 3BBYA 4G2EA 2B5EA 4FIWA 1PL2A 1ZGNA 1TXXA 4QL7A 4OCEA 4E8HA 2MMNA 3TJKA 4IELA 4MH3A 3TKSE 4TR0A 2LV3A 4EUYA 1TP9A 3LEFA 1AAZA 2P0GA 3TRQA 5FWGA 1ML6A 2H70A 2C0FA 4XIHA 3ZYWA 4HOJA 5HFKA 5ELAA 1G7OA 1JZWA 2VCWA 1J0FA 3Q6OA 4XRDA 4PTSA 1EEJA 1MD4A 1M2AA 3HZ8A 4GTUA 2RM6A 1JZRA 4TR3A 4IP6A 4L0WA 1A0RP 3BD2A 3HXSA 5HR0A 4OFNA 2V6OA 4D73A 1FO5A 1ZMAA 3LGCA 1GSDA 3WD6A 2PMTA 2AUVA 2JZTA 3VURA 2JSZA 1G7EA 13GSA 4ULXA
chains in the Genus database with same CATH superfamily
2HSNB 2J23A 3GFKA 2CA8A 3H93A 2WW2A 3ZIVA 3F0IA 4WKWA 1AC1A 4HU9A 4POMA 3A3TA 4ZL8A 4HJ2A 5ECIB 3GN3A 3QOUA 2JACA 5ECOB 4OMVA 1M9BA 3VI5A 1PN9A 1I1IP 1BAYA 2FA8A 1GRXA 1O8WA 3KEBA 4Q5NA 1S3CA 2WW1A 4AKIA 4HZ4A 3IRAA 1DE2A 3MDKA 4KX4A 4K2XA 1M0UA 1QXHA 4PXOA 2REMA 1TOFA 3F9UA 3VFIA 1BJXA 4FQUA 2YP6A 2B5XA 2OACA 4V2LA 2GZZA 1T4ZA 2ZUPA 2IMFA 2HXKA 4KCEA 4L0UA 2H1AA 3RGBC 3VWXA 1GP1A 4K6XA 3J7Yb 3H1NA 2DMMA 3GH9A 2KLXA 1SK0A 1M3IA 1ERTA 5CRDA 1VF2A 4ZBBA 1WMJA 3GMFA 4WBJA 4OD7A 4HSCX 2H1BA 1Q4JA 1SKSB 2B1KA 2OA7A 5D93A 4GSSA 5E4WA 1K0CA 1ZCPA 4ZXGA 4IW9A 2XBQA 5F8BA 2O87A 2FGXA 2O7KA 3UMAA 1DSBA 2LRCA 5AGYA 4WF5A 5KN2A 1ZYEA 4CY6A 5G1KA 2IIYA 2CZ3A 3VLNA 2YJ7A 4Z2RA 5GAND 4IKHA 5IQYA 5DALA 4EL1A 1RQMA 4KH7A 3IOSA 2VCZA 5AISA 2MBSA 1YDKA 3F3QA 5ID2A 3LORA 1M99A 1GL8A 20GSA 1UA5A 4NAXA 3ZFLA 4BVYB 4LA1A 2IMKA 5CRGA 1XPVA 3CMIA 1W89A 1JFUA 2C3TA 2ZNMA 1SKWB 3DGQA 5ECLB 3FR3A 1AQXA 3IR4A 1DE1A 4KDYA 4H86A 1YVLA 4GF0A 6GSVA 1XVQA 1Z9HA 4Q5FA 3A2WA 3TCOA 4EF0A 4PNGA 5DCHA 3KMNA 4HU7A 3MIXA 2GT6A 3FMWA 2LQOA 1NW2A 1EEMA 2XBIA 5A4VA 4MJBA 3W6GA 1B4QA 3GA4A 14GSA 2D2ZA 4X43A 3GH6A 2H01A 1ZOFA 3DRNA 4V2NA 3VPQA 3G9BA 1OKDA 3C71A 2H76A 3CSIA 3LW9A 1DBYA 2O3EA 3L4NA 3WYWA 2WJUA 5KOXA 2WVXB 2GZYA 2KOKA 1EGRA 6GSTA 2L6DA 5DAKB 1GNEA 4MCUA 3GL3A 1VRSD 3ZZXA 11GSA 2HZFA 5INYA 2LNTA 1TKDB 3TUEA 3GURA 3P90A 3EU4A 3ZTLA 1MDJA 5ELGA 2QC7A 1OC8A 6GSSA 2IFQA 1PKWA 2XC2A 4I2UA 2DJ2A 4OO5A 5IMZA 2AHEA 2AJQB 2H72A 2PVQA 1TDIA 1YF1A 4HUAA 4MPGA 1SJ6A 2JU5A 2VCXA 2B6MA 5D9XA 1K0MA 1GSQA 2HRAA 1WOUA 2O36A 3QFBC 2VUPA 1TK0B 5A34A 2FD3A 5AIXA 2V41A 5AN1A 4HEA2 2PVOC 3M9JA 2G0FA 3D22A 4ZB7A 2FWGA 4ZL7A 2HSMB 4WBRD 4ZB8A 1GNWA 3IXRA 4O5QA 4FYCA 2K6VA 3FZ9A 1G6WA 4EO3A 2OKAA 5BMUB 3F4RA 1BQ7A 3U5RE 5A4WA 4G19A 4KNDA 1JLWA 5IPGA 4MLYA 4TR1B 2V32A 2H75A 2KHPA 4HDEA 4Z2TA 3ERFA 2BMXA 2FY6A 2E2MA 5H5SA 1THOA 2O5VA 1QMVA 3TKPA 1BYEA 4K0GA 2E7PA 3V1WA 1B4PA 4QQ7A 2HRKA 4KGIA 5HR2A 2DBCA 1V2AA 3GTUA 3KMOA 1YKAA 1UVZA 5J9BA 4X0XA 2YZHA 1SL0B 4WXTA 5EL8A 5IMAA 2EFHA 5CNWA 1U3AA 2HZEB 2XPEA 5G31A 3TJGA 2CVDA 2Z9SA 1TK8B 1J9BA 1KBNA 1HNCA 5J41A 5CRHA 2WRTA 2MZCA 2OJLA 3UBKA 5DCGA 3NIVA 1GTBA 2VCQA 2PERA 2UZ8A 3IDVA 1K0DA 1OE7A 5D9VA 3I69A 2X4AA 3WGDA 1Q98A 1TXUA 2H1LA 3UVHA 2H74A 4AKHA 2C80A 1TRSA 3H4KA 2GQLA 3NOFA 1QFNA 22GSA 2TRXA 1R4WA 2LJKA 1A8LA 4TRXA 1B9XC 2CV4A 4ZIJA 3L0HA 4DEJA 5A1NA 4G0IA 3ZRDA 4ECCA 1V40A 5DQYA 2YCDA 5D96A 3KD0A 4IVFA 4I6XA 1YKCA 1T3BA 4KE3A 2EIRA 4OFMA 4ECIA 2FWFA 4OO4A 2EIOA 1ACVA 1S3AA 3DIEA 5DVBA 5D9TA 3ZMKA 2HFDA 1ILOA 4V2MA 2R4VA 4TN8A 3GSSA 3KP9A 1F6MC 3CHXC 3KH7A 12GSA 2WB9A 5H5QA 3RAZA 2YV7A 1EZKA 4EVMA 4IGJA 4LMVA 10GSA 2PBJA 1E2YA 1ZYQB 2VL9A 2PGTA 5JCUA 1OC9B 3QCPA 3WGXA 3VWUA 4GWRA 2GSRA 4K5SA 3FEUA 5B6NA 4PQ1A 3EMXA 4CY8A 1M3JA 3Q74A 4POKA 1PGTA 4TXVA 4MJCA 1H75A 1K3LA 2QGVA 2N5AA 3GYKA 3FRCA 5G1LA 3TGZA 3QFAC 3GHAA 5CAXA 2R6KA 2ON7A 3KTLA 1WP0A 1J08A 1TI3A 3O3TA 4EKZA 4ZL9A 1THXA 1SK2A 2GQMA 1WRYA 2H1GA 4KDUA 2LEGA 4PHZC 3TOUA 4KCAA 1Z6NA 2DC5A 5KEJA 1EOHA 2FWEA 5F0GA 1PN0A 3PINA 4AKGA 3RFRC 5JWRB 1CQHA 5IOXA 4PX1A 3HA9A 4MPFA 1XW9A 2O8VB 1R5AA 2R2JA 1V57A 2X49A 3UAPA 4JU5A 1I5GA 4EIQA 3N5OA 2L6CA 1Y25A 2TRCP 3D21A 3R2QA 4KSOA 3HJOA 1M7TA 1DUGA 1XVWA 2WW0A 5F07A 4ZBAA 4P3YB 1ABAA 2CVKA 2VL3A 3HJPA 4ICYA 4ML6A 4ISDA 2V6KA 4IHUA 1GH2A 2LJRA 4AI6A 4O7HA 5GSSA 1XOAA 1T00A 1PSQA 5F06A 3CQFA 3IHGA 2C8UA 2OT3A 3DEXA 3TKSA 2HE3A 2F3MA 4IS0A 3WT2A 2I1UA 5A5HB 3GKXA 1S3RA 4KW6A 3BOAA 3GSTA 1K0BA 3M9KA 2M80A 4KB3A 1GLPA 3PPUA 2XHFA 2TIRA 5C00A 1YEPA 1QGVA 4LL4B 2WZSA 4PI0C 1PQNA 3VI7A 3A2XA 3EPTA 4BVYA 3GRXA 2P5RA 4GDFA 3LWAA 4BL7B 4IBPA 3LYPA 4K0NA 4WR4A 4MH2A 3FYGA 2X8CA 4Z7XA 2I3YA 2A2RA 1TRUA 4FYUA 5ENUA 5DJMA 3M8NA 1JHBA 4YAPA 2R0CA 1Z3EA 2CT6A 4YAVA 1X5EA 1GTUA 4F03A 1ZYPA 5COHA 4ILFA 1A2JA 4MABA 4OFTA 1SD9A 4JBBA 2NBSA 5DDLA 3EE2A 1JZOA 4K7NA 3TJBA 3HDCA 8GSSA 1UC7A 2DSAA 3MYDA 1A2MA 3GIXA 4FYBA 1GSEA 3PGTA 2WVXA 2EIQA 4IJIA 3HHVA 3GL5A 1TTZA 1BX9A 5DAKA 4GSNA 1GSFA 4PQHA 3IBHA 2B5YA 1WE0A 4GSTA 1SJIA 2NTOA 1BF5A 2HI7A 1FHEA 3C7MA 2GLRA 4F0CA 4AJ8A 4BVXB 4NXIA 5HR1A 1X9MB 3UOMA 1TRVA 4D73B 3SWLA 2WDUA 4LMWA 1K0AA 1W4VA 5IMVA 2H19A 5B8AA 2WZ9A 3D0ZA 4MZWA 4TR4A 2QSIA 2EFDA 3HMJG 4MNNA 2DJKA 1XWAA 2GS3A 2DKIA 5CRWA 2EC4A 3N9JA 2HSMA 3GUSA 3K8NA 1USBA 3S9FA 2WVZA 3UBLA 3I43A 2GZPA 4YQMA 5G5EA 1PX6A 2WW3A 1EGOA 4RQXA 2C3QA 2FLSA 5ECNB 3BCIA 2C4JA 2RUEA 2HSYA 4QMKA 2PN8A 4BIKA 3L9SA 1TK5B 4TR1A 3EVIA 3KZQA 1OVNA 3IAS2 1SYRA 3U6VA 4DSSA 1ZYNA 2DJ1A 2RLIA 3IK9A 6GSYA 4RQRA 3IAM2 1GUMA 2H8LA 5J47A 2MMOA 1YEXA 1N25A 1B48A 2QA2A 2H0GA 1XWCA 1RW1A 9GSSA 4E68A 3QPMA 2M46A 3L78A 4RI6A 3CSJA 2DIZA 4K1FA 2VIMA 3RHBA 4WR5A 4G0LA 5D8IA 4GQFA 4ECJA 4Q5QA 18GSA 2YWNA 1KEBA 3C1SA 4RUVA 2YPMA 2YN1A 5C04A 4I8BA 4NHZA 1Z5YE 1E6BA 5DALB 2RM5A 4ZBDA 3ERWA 1R26A 3PR8A 2LS5A 3KXOA 2YANA 6GSWA 1FB6A 3E9JB 2C0DA 4J57E 2A2PA 1FB0A 1SKRB 1O81A 1U87A 3ZVJA 5G5FA 2R37A 1XFLA 1IYIA 4N11A 4EIPA 2LQQA 5J4VA 6GSXA 1T1VA 4JE1A 1GTAA 2V2GA 4AF2A 5JWOB 1OE8A 2L59A 3HD5A 5EVOA 1F37A 4XTSA 2O89A 3TB2A 1ZZYA 3M1GA 1X9WB 5FHIA 1EV4A 4AJ7A 1Y1UA 3W8JA 4TXOB 3CTFA 4YH2A 2PPTA 4JR6A 2F8FA 1FAAA 4DVCA 1A0FA 3QAVA 1A8YA 2GGTA 2VL2A 2CX4A 4MF6A 2YNXA 2CVBA 4O5UA 2A4VA 3LQ7A 4I97A 1GSUA 2LKUA 4Q5RA 1KTEA 2LSTA 1F3BA 4N0VA 4X4JA 1X9SB 3LG6A 1V58A 4EDZA 4NWYA 1XIYA 4TOPA 1OC9A 2R5GA 4N3ZA 1PA3A 4N0ZA 2B7KA 1PD21 3JCML 4MF5A 4F2IA 2JADA 5IPHA 5ABRA 1QQ2A 3AY8A 1M2DA 5JWQB 2CAQA 2L4QA 5G30A 4L5OA 4JZQA 1S4BP 3C8EA 1UN2A 3CRUA 3FHKA 1U3IA 1HD2A 2NVLA 4JRRA 2IFQB 3MNGA 1SYXA 7GSSA 2H0HA 2F9SA 1V98A 3O6TA 4ZB9A 2G2QA 3ME7A 1CQGA 2K8VA 3F6DA 5CYYA 4KDXA 1F3AA 4MJEA 1A24A 3ZFBA 1N8JA 2HYXA 2HNLA 3APOA 3MSZA 4HQZA 5LNKe 1JLVA 5CREA 3HJMA 3FZ5A 2AYTA 5HFIA 2PU9C 2X8HA 3UIWA 3FR9A 4O32A 2FWHA 1FVKA 4KF9A 2VM2A 5CP1A 3TJFA 2L57A 2LUSA 4IQ1A 4F0BA 3IC8A 3F63A 2R0PA 1TW9A 4G10A 3H79A 3F4TA 4G9HA 2NPBA 5D73A 4F9ZA 5GZZB 1SENA 1AQWA 1ON4A 1X5CA 4N30A 4K2DA 4HZ2A 1XXUA 3TJJA 5JCWA 5IO2A 2HSNA 3F8UA 1Z7RA 1BEDA 4XS4B 3MAKA 2V1MA 3FY7A 4GLTA 3DD3A 5ECPB 2K8SA 1O85A 2DJ3A 3H8QA 5ECKB 1JZDA 3E3EA 1F2EA 2N5BA 4CW9A 3NZNA 2VM1A 4LLRA 1H4OA 5HQPA 3LJRA 2A4HA 4YQUA 3HZ4A 1N2AA 3KGKA 4BL7A 2GVPA 4A5PA 1LJRA 3LXTA 2IMEA 1Z6MA 1PMTA 4V1Ag 1X5DA 2O85A 1SD8A 3HVSA 19GSA 5FT3A 4JEDA 4MA9A 3UARA 1GLQA 1MEKA 2OBKA 5IMFA 5KN3A 4MP4A 3PH9A 5ECRB 1ZL9A 5B6MA 2H71A 3KTBA 1YJ6A 3GKKA 4WETA 4ID0A 4IJ3A 2VLUA 1RK4A 3BCKA 3G7YA 1O73A 2LTKA 4NV5A 1O6JA 2H6XA 3RPPA 2VLVA 3GX0A 1R7HA 4PUFC 3BJ5A 1GTIA 1B8XA 2B7JA 1T4YA 5A1NB 2RIIA 1XBSA 3IV4A 2YWOA 1PFOA 2VCVA 3HVVA 5IOWA 2GDRA 1HNBA 1TU7A 3VPTA 1X0RA 2HSHA 4AJ6A 2M72A 2QKEA 1AIUA 1OC3A 4O5RA 1NSWA 2GTUA 2VO4A 4HJMA 2H1DA 2EFEA 1URMA 1YZXA 3HCZA 5ECSA 1BG5A 4F82A 5J5NA 3TOTA 4AGSA 2DKHA 5J9CA 2CX3A 5HR3A 4BVXA 3C1RA 3US3A 2P5QA 1QK8A 4POLA 4OWYA 5HFGA 1TU8A 1TRWA 5G2ZA 5L71A 3D4TA 5DQSA 2IWTA 3P2AA 2L5LA 3IHQA 2N5FA 3IPZA 2FUG2 3QAGA 4MJAA 2H66A 2NDOA 2VAFA 4I5QA 5GAPD 3I9V2 1SL2B 5F05A 5DBQA 2R3XA 4YQVA 2F8AA 3QR6A 3DYRA 5KN0A 2YV9A 4GCIA 4O92A 3KJYA 2DMLA 2HRFA 1XWKA 1EV9A 2AB6A 3DXBA 2ALBA 5IM9A 4JR4A 1XOBA 1QUWA 2H0IA 5AIVA 3GNJA 2B3SA 1YY7A 1ST9A 1OYJA 3L9VA 4MMMA 3FZAA 3ME8A 2IN3A 4YKGA 2HT9A 3ZLPA 3UJ1A 2YJHA 4IP1A 4ZB6A 4HQSA 2JL4A 2IMIA 3EMPA 1Z7PA 1LU4A 3D6IA 1ERUA 1SJZA 1K0NA 4PI2C 3SBCA 4KUNA 4MZCA 2C1YA 1GSYA 5ECHB 1HNAA 2QA1A 4K8MA 2OBIA 1VF1A 4NV2A 3QD9A 1YQ1A 3KH9A 4MDCA 1XG8A 2IJYA 2MMZA 1MD3A 2FCHA 2HRNA 2KP1A 2YWMA 1EOGA 1K3YA 3TKSC 3FR6A 3CYNA 3GKMA 2OE0A 1AXDA 3A5WA 3D5JA 2XPDA 4E8EA 4DSQA 3CTGA 1IYHA 4L5LA 1SVMA 3HYPA 1SVOA 1A2LA 1XW6A 5ECQB 4N10A 5CO3A 3TRXA 3GKNA 1MTCA 4XHMA 2H73A 3CRTA 2PUKC 5J40A 3WGEA 1GWCA 4ZILA 1GSSA 1FG4A 4FXYP 3FW2A 1TJDA 4MF7A 1AW9A 4K7OA 1K0OA 4CDOA 1TI1A 5BMUA 3DKSA 2BTOT 4TXOA 2ES7A 3F3RA 4ECBA 5JCGA 2H6YA 2E2GA 3DVXA 5H5RA 4MK3A 2GSTA 16GSA 4Z2UA 2H30A 2L4CA 4J2FA 2WULA 3J7Yk 4USSA 4PURA 4FO5A 4GQCA 1XCCA 4EXJA 1XZOA 3DVWA 3EU3A 4ML1A 4KAEA 1O8XA 2HLSA 4KA0A 3KP8A 1PX7A 2VOCA 3Q18A 4L8EA 2K18A 2VCTA 1F9MA 3ERGA 3GX8A 1V9WA 4V1Ap 4NHWA 4XS6A 3HY2A 3DMLA 4RI7A 1HYUA 1NHOA 3RBTA 3IE3A 3WT1A 3F4SA 2VD1A 2IPAA 3KM6A 2HZEA 3ZITA 3QAWA 1SVLA 3CBUA 2H6ZA 4J56E 4K7IA 1U88A 2CAIA 3W8SA 1SU9A 4BA7A 2RUFA 3A5IA 3APQA 3EINA 4KSMA 1AQVA 2YOIA 3VWVA 3DWVA 3TKQA 1R5PA 3UL3A 1M2BA 4XCSA 4EC0A 2C0EA 3M0FA 2CZ2A 1PKZA 5KN1A 3P7XA 1Y6EA 3EYTA 2AV4A 3A2VA 4ACSA 3D4MA 3OR5A 4K5RA 5ID2B 1SK1A 2MYGA 3CSHA 2L5OA 1PRXA 2PWJA 1PL1A 4TKYA 2A2SA 4QL9A 2OE1A 2F51A 1VF3A 3HVNA 1EWXA 3TKRA 2LRNA 1MDIA 4X1UA 3LFLA 4NMUA 4EDYA 3O76A 1OAZA 4K9ZA 2GSQA 3LYKA 2K9FA 2LNSA 4XS1A 3FK8A 5J4UA 4TVEA 2GT5A 3HVXA 1XWGA 1T8EB 3GV1A 1MDKA 1O7UA 2VKZG 3EURA 2WFCA 4BPYA 2MBTA 4CHSA 4IN0A 1WJKA 2VLTA 3EWLA 1BG1A 1KNGA 3VK9A 4PUAA 3QMXA 4DSSB 5EPFA 1FOVA 5LCZA 2P31A 2VD0A 2YWIA 1GUKA 3ZREA 4PGTA 1EP7A 4XS4A 2DLXA 5A5KA 5J3RA 1WIKA 2FA4A 1SL1B 5B7CA 2X8GA 4FH8A 3UEMA 2HQTA 3FZ4A 1FW1A 4GRFA 1ERWA 3LXZA 2J9HA 4OCFA 2JSYA 5ECMB 4EE0A 1OKTA 5LD0A 2UV8G 5KOWA 3ZIJA 4G0KA 3E0UA 3IK7A 2C0GA 5EY6A 5J4YA 1I9DA 2OE3A 2WGRA 3QDNA 1ERVA 4BWQA 5A4UA 2E0QA 3CXGA 2DJJA 3EC3A 1YEWC 2LRTA 4WEYA 5A34B 2WVYA 4HI7A 5IO0A 3C73A 6GSUA 1G0TA 3APSA 3L9UA 1GULA 1B9YC 2DJ0A 4HS1A 1LBKA 1WWJA 1FVJA 2IL3A 3TDGA 1EP8A 1K3OA 5E59A 2GSSA 1C72A 3FKFA 4LL1B 3KIJA 3CWGA 2KP2A 2FNOA 5IIZA 3F6FA 1G6YA 1T7PB 2ON5A 2CQ9A 3ED3A 2X64A 1YF0A 4TW5A 2BJXA 2MMAA 2ZCTA 4XRAA 1AUCA 4YKFA 3RDWA 3R3EA 3ZMLA 2VL2C 4W66A 5A5HA 2WS2A 4POBA 2R0GA 2GQKA 3ZVJD 5B8BA 2I4AA 3G7IA 2HRKB 1NHYA 1XWBA 1HQOA 1U6TA 3KCMA 3IC4A 3GTUB 4IQAA 4G01A 2YZUA 5GSTA 1WPIA 3P8WA 2JZSA 3UVTA 5DJLA 5IMDA 3Q19A 2EFCA 2X99A 2I81A 5IMCA 1S3DA 3I6AA 2WCIA 3G7JA 2C3NA 3TU3B 3HKRA 2OADA 1M9AA 2IMDA 3RHCA 3ISOA 1A23A 3RPNA 2I9HA 4I2TA 1GUHA 3IA1A 1XW5A 5D9WA 2JZRA 2KUCA 4NPBA 3VWWA 4BWSA 2LJAA 2AAWA 2B1LA 4PNFA 2DIYA 1VF4A 3ZL5A 4DSRA 1VGLA 4PQIA 3MWHA 4GXZA 1NM3A 2FHEA 4MZBA 17GSA 4WF4A 3LSZA 3M3MA 3TRPA 3BBYA 4G2EA 2B5EA 4FIWA 1PL2A 4AKXB 1ZGNA 1TXXA 4QL7A 4OCEA 4E8HA 2MMNA 3TJKA 4IELA 4MH3A 3TKSE 4TR0A 2LV3A 4EUYA 1TP9A 3LEFA 1AAZA 2P0GA 3TRQA 5FWGA 1ML6A 2H70A 2C0FA 4XIHA 5BRTA 3ZYWA 4HOJA 5HFKA 1FOHA 5ELAA 1G7OA 1JZWA 2VCWA 1J0FA 3Q6OA 4XRDA 4PTSA 1EEJA 1MD4A 1M2AA 3HZ8A 4GTUA 2RM6A 1JZRA 4TR3A 4IP6A 4L0WA 1A0RP 3BD2A 3HXSA 5HR0A 4OFNA 2V6OA 4D73A 1FO5A 1ZMAA 3LGCA 1GSDA 3WD6A 2PMTA 2AUVA 2JZTA 3VURA 2JSZA 1G7EA 13GSA 4ULXA
chains in the Genus database with same CATH topology
2HSNB 2J23A 3GFKA 2CA8A 3H93A 3ZIVA 3F0IA 4WKWA 1AC1A 4HU9A 4POMA 3A3TA 4ZL8A 4HJ2A 5ECIB 3GN3A 3QOUA 2JACA 5ECOB 4OMVA 1M9BA 3VI5A 1PN9A 1BAYA 2FA8A 1GRXA 1O8WA 3KEBA 4Q5NA 1S3CA 4AKIA 4HZ4A 3IRAA 1DE2A 3MDKA 4KX4A 4K2XA 1M0UA 1QXHA 4PXOA 2REMA 1TOFA 3F9UA 3VFIA 1BJXA 4FQUA 2YP6A 2B5XA 2OACA 4V2LA 2GZZA 1T4ZA 2ZUPA 2IMFA 2HXKA 4KCEA 4L0UA 2H1AA 3VWXA 1GP1A 4K6XA 3J7Yb 3H1NA 2DMMA 3GH9A 2KLXA 1SK0A 1ERTA 5CRDA 1VF2A 4ZBBA 1WMJA 3GMFA 4WBJA 4OD7A 2H1BA 1Q4JA 1SKSB 2B1KA 2OA7A 5D93A 4GSSA 5E4WA 1K0CA 1ZCPA 4ZXGA 4IW9A 2XBQA 5F8BA 2O87A 2FGXA 2O7KA 3UMAA 1DSBA 2LRCA 5AGYA 4WF5A 5KN2A 1ZYEA 4CY6A 5G1KA 2IIYA 2CZ3A 3VLNA 2YJ7A 4Z2RA 5GAND 4IKHA 5IQYA 5DALA 4EL1A 1RQMA 4KH7A 3IOSA 2VCZA 5AISA 2MBSA 1YDKA 3F3QA 5ID2A 3LORA 1M99A 1GL8A 20GSA 1UA5A 4NAXA 3ZFLA 4BVYB 4LA1A 2IMKA 5CRGA 1XPVA 3CMIA 1W89A 1JFUA 2C3TA 2ZNMA 1SKWB 3DGQA 5ECLB 3FR3A 1AQXA 3IR4A 1DE1A 4KDYA 4H86A 1YVLA 4GF0A 6GSVA 1XVQA 1Z9HA 4Q5FA 3A2WA 3TCOA 4EF0A 4PNGA 5DCHA 3KMNA 4HU7A 3MIXA 2GT6A 3FMWA 2LQOA 1NW2A 1EEMA 2XBIA 5A4VA 4MJBA 3W6GA 1B4QA 3GA4A 14GSA 2D2ZA 4X43A 3GH6A 2H01A 1ZOFA 3DRNA 4V2NA 3VPQA 3G9BA 1OKDA 3C71A 2H76A 3CSIA 3LW9A 1DBYA 3L4NA 3WYWA 2WJUA 5KOXA 2GZYA 2KOKA 1EGRA 6GSTA 2L6DA 5DAKB 1GNEA 4MCUA 3GL3A 1VRSD 3ZZXA 11GSA 2HZFA 5INYA 2LNTA 1TKDB 3TUEA 3GURA 3P90A 3EU4A 3ZTLA 1MDJA 5ELGA 2QC7A 1OC8A 6GSSA 2IFQA 1PKWA 2XC2A 4I2UA 2DJ2A 4OO5A 5IMZA 2AHEA 2AJQB 2H72A 2PVQA 1TDIA 1YF1A 4HUAA 4MPGA 1SJ6A 2JU5A 2VCXA 2B6MA 5D9XA 1K0MA 1GSQA 2HRAA 1WOUA 3QFBC 2VUPA 1TK0B 5A34A 2FD3A 5AIXA 2V41A 5AN1A 4HEA2 2PVOC 3M9JA 2G0FA 3D22A 4ZB7A 2FWGA 4ZL7A 2HSMB 4WBRD 4ZB8A 1GNWA 3IXRA 4O5QA 4FYCA 2K6VA 3FZ9A 1G6WA 4EO3A 2OKAA 5BMUB 3F4RA 1BQ7A 3U5RE 5A4WA 4G19A 4KNDA 1JLWA 5IPGA 4MLYA 4TR1B 2V32A 2H75A 2KHPA 4HDEA 4Z2TA 3ERFA 2BMXA 2FY6A 2E2MA 5H5SA 1THOA 2O5VA 1QMVA 3TKPA 1BYEA 4K0GA 2E7PA 3V1WA 1B4PA 4QQ7A 2HRKA 4KGIA 5HR2A 2DBCA 1V2AA 3GTUA 3KMOA 1YKAA 1UVZA 5J9BA 4X0XA 2YZHA 1SL0B 4WXTA 5EL8A 5IMAA 2EFHA 5CNWA 1U3AA 2HZEB 2XPEA 5G31A 3TJGA 2CVDA 2Z9SA 1TK8B 1J9BA 1KBNA 1HNCA 5J41A 5CRHA 2WRTA 2MZCA 2OJLA 3UBKA 5DCGA 3NIVA 1GTBA 2VCQA 2PERA 2UZ8A 3IDVA 1K0DA 1OE7A 5D9VA 3I69A 2X4AA 3WGDA 1Q98A 1TXUA 2H1LA 3UVHA 2H74A 4AKHA 2C80A 1TRSA 3H4KA 2GQLA 3NOFA 1QFNA 22GSA 2TRXA 1R4WA 2LJKA 1A8LA 4TRXA 1B9XC 2CV4A 4ZIJA 3L0HA 4DEJA 5A1NA 4G0IA 3ZRDA 4ECCA 1V40A 5DQYA 2YCDA 5D96A 3KD0A 4IVFA 4I6XA 1YKCA 1T3BA 4KE3A 2EIRA 4OFMA 4ECIA 2FWFA 4OO4A 2EIOA 1ACVA 1S3AA 3DIEA 5DVBA 5D9TA 3ZMKA 2HFDA 1ILOA 4V2MA 2R4VA 4TN8A 3KP9A 3GSSA 1F6MC 3KH7A 12GSA 2WB9A 5H5QA 3RAZA 2YV7A 1EZKA 4EVMA 4IGJA 4LMVA 10GSA 2PBJA 1E2YA 1ZYQB 2VL9A 2PGTA 5JCUA 1OC9B 3QCPA 3WGXA 3VWUA 4GWRA 2GSRA 4K5SA 3FEUA 5B6NA 4PQ1A 3EMXA 4CY8A 3Q74A 4POKA 1PGTA 4TXVA 4MJCA 1H75A 1K3LA 2QGVA 2N5AA 3GYKA 3FRCA 5G1LA 3TGZA 3QFAC 3GHAA 5CAXA 2R6KA 2ON7A 3KTLA 1WP0A 1J08A 1TI3A 3O3TA 4EKZA 4ZL9A 1THXA 1SK2A 2GQMA 1WRYA 2H1GA 4KDUA 2LEGA 3TOUA 4KCAA 1Z6NA 2DC5A 5KEJA 1EOHA 2FWEA 5F0GA 1PN0A 3PINA 4AKGA 5JWRB 1CQHA 5IOXA 4PX1A 3HA9A 4MPFA 1XW9A 2O8VB 1R5AA 2R2JA 1V57A 2X49A 3UAPA 4JU5A 1I5GA 4EIQA 3N5OA 2L6CA 1Y25A 2TRCP 3D21A 3R2QA 4KSOA 3HJOA 1M7TA 1DUGA 1XVWA 5F07A 4ZBAA 4P3YB 1ABAA 2CVKA 2VL3A 3HJPA 4ICYA 4ML6A 4ISDA 2V6KA 4IHUA 1GH2A 2LJRA 4AI6A 4O7HA 5GSSA 1XOAA 1T00A 1PSQA 5F06A 3IHGA 2C8UA 2OT3A 3DEXA 3TKSA 2HE3A 2F3MA 4IS0A 3WT2A 2I1UA 5A5HB 3GKXA 4KW6A 3BOAA 3GSTA 1K0BA 3M9KA 2M80A 4KB3A 1GLPA 3PPUA 2XHFA 2TIRA 5C00A 1YEPA 1QGVA 4LL4B 1PQNA 3VI7A 3A2XA 3EPTA 4BVYA 3GRXA 2P5RA 4GDFA 3LWAA 4BL7B 4IBPA 3LYPA 4K0NA 4WR4A 4MH2A 3FYGA 2X8CA 4Z7XA 2I3YA 2A2RA 1TRUA 4FYUA 5ENUA 5DJMA 3M8NA 1JHBA 4YAPA 2R0CA 1Z3EA 2CT6A 4YAVA 1X5EA 1GTUA 4F03A 1ZYPA 5COHA 4ILFA 1A2JA 4MABA 4OFTA 1SD9A 4JBBA 2NBSA 5DDLA 3EE2A 1JZOA 4K7NA 3TJBA 3HDCA 8GSSA 1UC7A 2DSAA 3MYDA 1A2MA 3GIXA 4FYBA 1GSEA 3PGTA 2EIQA 4IJIA 3HHVA 3GL5A 1TTZA 1BX9A 5DAKA 4GSNA 1GSFA 4PQHA 3IBHA 2B5YA 1WE0A 4GSTA 1SJIA 2NTOA 1BF5A 2HI7A 1FHEA 3C7MA 2GLRA 4F0CA 4AJ8A 4BVXB 4NXIA 5HR1A 1X9MB 3UOMA 1TRVA 4D73B 3SWLA 2WDUA 4LMWA 1K0AA 1W4VA 5IMVA 2H19A 5B8AA 2WZ9A 3D0ZA 4MZWA 4TR4A 2QSIA 2EFDA 3HMJG 4MNNA 2DJKA 1XWAA 2GS3A 2DKIA 5CRWA 2EC4A 3N9JA 2HSMA 3GUSA 3K8NA 1USBA 3S9FA 3UBLA 3I43A 2GZPA 4YQMA 5G5EA 1PX6A 1EGOA 4RQXA 2C3QA 2FLSA 5ECNB 3BCIA 2C4JA 2RUEA 2HSYA 4QMKA 2PN8A 3L9SA 1TK5B 4TR1A 3EVIA 3KZQA 1OVNA 3IAS2 1SYRA 3U6VA 4DSSA 1ZYNA 2DJ1A 2RLIA 3IK9A 6GSYA 4RQRA 3IAM2 1GUMA 2H8LA 5J47A 2MMOA 1YEXA 1N25A 1B48A 2QA2A 2H0GA 1XWCA 1RW1A 9GSSA 4E68A 3QPMA 2M46A 3L78A 4RI6A 3CSJA 2DIZA 4K1FA 2VIMA 3RHBA 4WR5A 4G0LA 5D8IA 4GQFA 4ECJA 4Q5QA 18GSA 2YWNA 1KEBA 3C1SA 4RUVA 2YPMA 2YN1A 5C04A 4I8BA 4NHZA 1Z5YE 1E6BA 5DALB 2RM5A 4ZBDA 3ERWA 1R26A 3PR8A 2LS5A 3KXOA 2YANA 6GSWA 1FB6A 3E9JB 2C0DA 4J57E 2A2PA 1FB0A 1SKRB 1O81A 1U87A 3ZVJA 5G5FA 2R37A 1XFLA 1IYIA 4N11A 4EIPA 2LQQA 5J4VA 6GSXA 1T1VA 4JE1A 1GTAA 2V2GA 4AF2A 5JWOB 1OE8A 2L59A 3HD5A 5EVOA 1F37A 4XTSA 2O89A 3TB2A 1ZZYA 3M1GA 1X9WB 5FHIA 1EV4A 4AJ7A 1Y1UA 3W8JA 4TXOB 3CTFA 4YH2A 2PPTA 4JR6A 2F8FA 1FAAA 4DVCA 1A0FA 3QAVA 1A8YA 2GGTA 2VL2A 2CX4A 4MF6A 2YNXA 2CVBA 4O5UA 2A4VA 3LQ7A 4I97A 1GSUA 2LKUA 4Q5RA 1KTEA 2LSTA 1F3BA 4N0VA 4X4JA 1X9SB 3LG6A 1V58A 4EDZA 4NWYA 1XIYA 4TOPA 1OC9A 2R5GA 4N3ZA 1PA3A 4N0ZA 2B7KA 1PD21 3JCML 4MF5A 4F2IA 2JADA 5IPHA 5ABRA 1QQ2A 3AY8A 1M2DA 5JWQB 2CAQA 2L4QA 5G30A 4L5OA 4JZQA 3C8EA 1UN2A 3CRUA 3FHKA 1U3IA 1HD2A 2NVLA 4JRRA 2IFQB 3MNGA 1SYXA 7GSSA 2H0HA 2F9SA 1V98A 3O6TA 4ZB9A 2G2QA 3ME7A 1CQGA 2K8VA 3F6DA 5CYYA 4KDXA 1F3AA 4MJEA 1A24A 3ZFBA 1N8JA 2HYXA 2HNLA 3APOA 3MSZA 4HQZA 5LNKe 1JLVA 5CREA 3HJMA 3FZ5A 2AYTA 5HFIA 2PU9C 2X8HA 3UIWA 3FR9A 4O32A 2FWHA 1FVKA 4KF9A 2VM2A 5CP1A 3TJFA 2L57A 2LUSA 4IQ1A 4F0BA 3IC8A 3F63A 2R0PA 1TW9A 4G10A 3H79A 3F4TA 4G9HA 2NPBA 5D73A 4F9ZA 5GZZB 1SENA 1AQWA 1ON4A 1X5CA 4N30A 4K2DA 4HZ2A 1XXUA 3TJJA 5JCWA 5IO2A 2HSNA 3F8UA 1Z7RA 1BEDA 4XS4B 3MAKA 2V1MA 3FY7A 4GLTA 3DD3A 5ECPB 2K8SA 1O85A 2DJ3A 3H8QA 5ECKB 1JZDA 3E3EA 1F2EA 2N5BA 4CW9A 3NZNA 2VM1A 4LLRA 1H4OA 5HQPA 3LJRA 2A4HA 4YQUA 3HZ4A 1N2AA 3KGKA 4BL7A 2GVPA 4A5PA 1LJRA 3LXTA 2IMEA 1Z6MA 1PMTA 4V1Ag 1X5DA 2O85A 1SD8A 3HVSA 19GSA 5FT3A 4JEDA 4MA9A 3UARA 1GLQA 1MEKA 2OBKA 5IMFA 5KN3A 4MP4A 3PH9A 5ECRB 1ZL9A 5B6MA 2H71A 3KTBA 1YJ6A 3GKKA 4WETA 4ID0A 4IJ3A 2VLUA 1RK4A 3BCKA 3G7YA 1O73A 2LTKA 4NV5A 1O6JA 2H6XA 3RPPA 2VLVA 3GX0A 1R7HA 4PUFC 3BJ5A 1GTIA 1B8XA 2B7JA 1T4YA 5A1NB 2RIIA 1XBSA 3IV4A 2YWOA 2VCVA 3HVVA 5IOWA 2GDRA 1HNBA 1TU7A 3VPTA 1X0RA 2HSHA 4AJ6A 2M72A 2QKEA 1AIUA 1OC3A 4O5RA 1NSWA 2GTUA 2VO4A 4HJMA 2H1DA 2EFEA 1URMA 1YZXA 3HCZA 5ECSA 1BG5A 4F82A 5J5NA 3TOTA 4AGSA 2DKHA 5J9CA 2CX3A 5HR3A 4BVXA 3C1RA 3US3A 2P5QA 1QK8A 4POLA 4OWYA 5HFGA 1TU8A 1TRWA 5G2ZA 5L71A 3D4TA 5DQSA 2IWTA 3P2AA 2L5LA 3IHQA 2N5FA 3IPZA 2FUG2 3QAGA 4MJAA 2H66A 2NDOA 2VAFA 4I5QA 5GAPD 3I9V2 1SL2B 5F05A 5DBQA 2R3XA 4YQVA 2F8AA 3QR6A 3DYRA 5KN0A 2YV9A 4GCIA 4O92A 3KJYA 2DMLA 2HRFA 1XWKA 1EV9A 2AB6A 3DXBA 2ALBA 5IM9A 4JR4A 1XOBA 1QUWA 2H0IA 5AIVA 3GNJA 2B3SA 1YY7A 1ST9A 1OYJA 3L9VA 4MMMA 3FZAA 3ME8A 2IN3A 4YKGA 2HT9A 3ZLPA 3UJ1A 2YJHA 4IP1A 4ZB6A 4HQSA 2JL4A 2IMIA 3EMPA 1Z7PA 1LU4A 3D6IA 1ERUA 1SJZA 1K0NA 3SBCA 4KUNA 4MZCA 2C1YA 1GSYA 5ECHB 1HNAA 2QA1A 4K8MA 2OBIA 1VF1A 4NV2A 3QD9A 1YQ1A 3KH9A 4MDCA 2IJYA 2MMZA 1MD3A 2FCHA 2HRNA 2KP1A 2YWMA 1EOGA 1K3YA 3TKSC 3FR6A 3CYNA 3GKMA 2OE0A 1AXDA 3A5WA 3D5JA 2XPDA 4E8EA 4DSQA 3CTGA 1IYHA 4L5LA 1SVMA 3HYPA 1SVOA 1A2LA 1XW6A 5ECQB 4N10A 5CO3A 3TRXA 3GKNA 1MTCA 4XHMA 2H73A 3CRTA 2PUKC 5J40A 3WGEA 1GWCA 4ZILA 1GSSA 1FG4A 3FW2A 1TJDA 4MF7A 1AW9A 4K7OA 1K0OA 4CDOA 1TI1A 5BMUA 3DKSA 2BTOT 4TXOA 2ES7A 3F3RA 4ECBA 5JCGA 2H6YA 2E2GA 3DVXA 5H5RA 4MK3A 2GSTA 16GSA 4Z2UA 2H30A 2L4CA 4J2FA 2WULA 3J7Yk 4USSA 4PURA 4FO5A 4GQCA 1XCCA 4EXJA 1XZOA 3DVWA 3EU3A 4ML1A 4KAEA 1O8XA 2HLSA 4KA0A 3KP8A 1PX7A 2VOCA 3Q18A 4L8EA 2K18A 2VCTA 1F9MA 3ERGA 3GX8A 1V9WA 4V1Ap 4NHWA 4XS6A 3HY2A 3DMLA 4RI7A 1HYUA 1NHOA 3RBTA 3IE3A 3WT1A 3F4SA 2VD1A 2IPAA 3KM6A 2HZEA 3ZITA 3QAWA 1SVLA 3CBUA 2H6ZA 4J56E 4K7IA 1U88A 2CAIA 3W8SA 1SU9A 4BA7A 2RUFA 3A5IA 3APQA 3EINA 4KSMA 1AQVA 2YOIA 3VWVA 3DWVA 3TKQA 1R5PA 3UL3A 1M2BA 4XCSA 4EC0A 2C0EA 3M0FA 2CZ2A 1PKZA 5KN1A 3P7XA 1Y6EA 3EYTA 2AV4A 3A2VA 4ACSA 3D4MA 3OR5A 4K5RA 5ID2B 1SK1A 2MYGA 3CSHA 2L5OA 1PRXA 2PWJA 1PL1A 4TKYA 2A2SA 4QL9A 2OE1A 2F51A 1VF3A 1EWXA 3TKRA 2LRNA 1MDIA 4X1UA 3LFLA 4NMUA 4EDYA 3O76A 1OAZA 4K9ZA 2GSQA 3LYKA 2K9FA 2LNSA 4XS1A 3FK8A 5J4UA 4TVEA 2GT5A 3HVXA 1XWGA 1T8EB 3GV1A 1MDKA 1O7UA 2VKZG 3EURA 2WFCA 4BPYA 2MBTA 4CHSA 4IN0A 1WJKA 2VLTA 3EWLA 1BG1A 1KNGA 3VK9A 4PUAA 3QMXA 4DSSB 5EPFA 1FOVA 5LCZA 2P31A 2VD0A 2YWIA 1GUKA 3ZREA 4PGTA 1EP7A 4XS4A 2DLXA 5A5KA 5J3RA 1WIKA 2FA4A 1SL1B 5B7CA 2X8GA 4FH8A 3UEMA 2HQTA 3FZ4A 1FW1A 4GRFA 1ERWA 3LXZA 2J9HA 4OCFA 2JSYA 5ECMB 4EE0A 1OKTA 5LD0A 2UV8G 5KOWA 3ZIJA 4G0KA 3E0UA 3IK7A 2C0GA 5EY6A 5J4YA 1I9DA 2OE3A 2WGRA 3QDNA 1ERVA 4BWQA 5A4UA 2E0QA 3CXGA 2DJJA 3EC3A 2LRTA 4WEYA 5A34B 4HI7A 5IO0A 3C73A 6GSUA 1G0TA 3APSA 3L9UA 1GULA 1B9YC 2DJ0A 4HS1A 1LBKA 1WWJA 1FVJA 2IL3A 3TDGA 1EP8A 1K3OA 5E59A 2GSSA 1C72A 3FKFA 4LL1B 3KIJA 3CWGA 2KP2A 2FNOA 5IIZA 3F6FA 1G6YA 1T7PB 2ON5A 2CQ9A 3ED3A 2X64A 1YF0A 4TW5A 2BJXA 2MMAA 2ZCTA 4XRAA 1AUCA 4YKFA 3RDWA 3R3EA 3ZMLA 2VL2C 4W66A 5A5HA 2WS2A 4POBA 2R0GA 2GQKA 3ZVJD 5B8BA 2I4AA 3G7IA 2HRKB 1NHYA 1XWBA 1HQOA 1U6TA 3KCMA 3IC4A 3GTUB 4IQAA 4G01A 2YZUA 5GSTA 1WPIA 3P8WA 2JZSA 3UVTA 5DJLA 5IMDA 3Q19A 2EFCA 2X99A 2I81A 5IMCA 1S3DA 3I6AA 2WCIA 3G7JA 2C3NA 3TU3B 3HKRA 2OADA 1M9AA 2IMDA 3RHCA 3ISOA 1A23A 3RPNA 2I9HA 4I2TA 1GUHA 3IA1A 1XW5A 5D9WA 2JZRA 2KUCA 4NPBA 3VWWA 4BWSA 2LJAA 2AAWA 2B1LA 4PNFA 2DIYA 1VF4A 3ZL5A 4DSRA 1VGLA 4PQIA 3MWHA 4GXZA 1NM3A 2FHEA 4MZBA 17GSA 4WF4A 3LSZA 3M3MA 3TRPA 3BBYA 4G2EA 2B5EA 4FIWA 1PL2A 4AKXB 1ZGNA 1TXXA 4QL7A 4OCEA 4E8HA 2MMNA 3TJKA 4IELA 4MH3A 3TKSE 4TR0A 2LV3A 4EUYA 1TP9A 3LEFA 1AAZA 2P0GA 3TRQA 5FWGA 1ML6A 2H70A 2C0FA 4XIHA 5BRTA 3ZYWA 4HOJA 5HFKA 1FOHA 5ELAA 1G7OA 1JZWA 2VCWA 1J0FA 3Q6OA 4XRDA 4PTSA 1EEJA 1MD4A 1M2AA 3HZ8A 4GTUA 2RM6A 1JZRA 4TR3A 4IP6A 4L0WA 1A0RP 3BD2A 3HXSA 5HR0A 4OFNA 2V6OA 4D73A 1FO5A 1ZMAA 3LGCA 1GSDA 3WD6A 2PMTA 2AUVA 2JZTA 3VURA 2JSZA 1G7EA 13GSA 4ULXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSN B;  2J23 A;  3GFK A;  2CA8 A;  3H93 A;  3ZIV A;  3F0I A;  4WKW A;  1AC1 A;  4HU9 A;  4POM A;  3A3T A;  4ZL8 A;  4HJ2 A;  5ECI B;  3GN3 A;  3QOU A;  2JAC A;  5ECO B;  4OMV A;  1M9B A;  3VI5 A;  1PN9 A;  1BAY A;  2FA8 A;  1GRX A;  1O8W A;  3KEB A;  4Q5N A;  1S3C A;  4HZ4 A;  3IRA A;  1DE2 A;  3MDK A;  4KX4 A;  1M0U A;  1QXH A;  4PXO A;  2REM A;  1TOF A;  3F9U A;  3VFI A;  1BJX A;  4FQU A;  2YP6 A;  2B5X A;  2OAC A;  4V2L A;  2GZZ A;  1T4Z A;  2ZUP A;  2IMF A;  2HXK A;  4KCE A;  4L0U A;  2H1A A;  3VWX A;  1GP1 A;  4K6X A;  3J7Y b;  3H1N A;  2DMM A;  3GH9 A;  2KLX A;  1SK0 A;  1ERT A;  5CRD A;  1VF2 A;  4ZBB A;  1WMJ A;  3GMF A;  4WBJ A;  4OD7 A;  2H1B A;  1Q4J A;  1SKS B;  2B1K A;  2OA7 A;  5D93 A;  4GSS A;  5E4W A;  1K0C A;  1ZCP A;  4ZXG A;  4IW9 A;  2XBQ A;  5F8B A;  2O87 A;  2FGX A;  2O7K A;  3UMA A;  1DSB A;  2LRC A;  5AGY A;  4WF5 A;  5KN2 A;  1ZYE A;  5G1K A;  2IIY A;  2CZ3 A;  3VLN A;  2YJ7 A;  5GAN D;  4IKH A;  5IQY A;  5DAL A;  4EL1 A;  1RQM A;  4KH7 A;  3IOS A;  2VCZ A;  5AIS A;  2MBS A;  1YDK A;  3F3Q A;  5ID2 A;  3LOR A;  1M99 A;  1GL8 A;  20GS A;  1UA5 A;  4NAX A;  3ZFL A;  4BVY B;  4LA1 A;  2IMK A;  5CRG A;  1XPV A;  3CMI A;  1W89 A;  1JFU A;  2C3T A;  2ZNM A;  1SKW B;  3DGQ A;  5ECL B;  3FR3 A;  1AQX A;  3IR4 A;  1DE1 A;  4KDY A;  4H86 A;  4GF0 A;  6GSV A;  1XVQ A;  1Z9H A;  4Q5F A;  3A2W A;  3TCO A;  4EF0 A;  4PNG A;  5DCH A;  3KMN A;  4HU7 A;  2GT6 A;  2LQO A;  1NW2 A;  1EEM A;  2XBI A;  5A4V A;  4MJB A;  3W6G A;  1B4Q A;  3GA4 A;  14GS A;  2D2Z A;  4X43 A;  3GH6 A;  2H01 A;  1ZOF A;  3DRN A;  4V2N A;  3VPQ A;  3G9B A;  1OKD A;  3C71 A;  2H76 A;  3CSI A;  1DBY A;  3L4N A;  3WYW A;  2WJU A;  2GZY A;  2KOK A;  1EGR A;  6GST A;  2L6D A;  5DAK B;  1GNE A;  4MCU A;  3GL3 A;  1VRS D;  3ZZX A;  11GS A;  2HZF A;  5INY A;  2LNT A;  1TKD B;  3TUE A;  3GUR A;  3P90 A;  3EU4 A;  3ZTL A;  1MDJ A;  5ELG A;  2QC7 A;  1OC8 A;  6GSS A;  2IFQ A;  1PKW A;  2XC2 A;  4I2U A;  2DJ2 A;  4OO5 A;  5IMZ A;  2AHE A;  2AJQ B;  2H72 A;  2PVQ A;  1TDI A;  1YF1 A;  4HUA A;  4MPG A;  1SJ6 A;  2JU5 A;  2VCX A;  2B6M A;  5D9X A;  1K0M A;  1GSQ A;  2HRA A;  1WOU A;  3QFB C;  2VUP A;  1TK0 B;  2FD3 A;  5AIX A;  2V41 A;  5AN1 A;  4HEA 2;  2PVO C;  3M9J A;  2G0F A;  3D22 A;  2FWG A;  4ZL7 A;  2HSM B;  4WBR D;  4ZB8 A;  1GNW A;  3IXR A;  4FYC A;  2K6V A;  3FZ9 A;  1G6W A;  4EO3 A;  2OKA A;  3F4R A;  1BQ7 A;  3U5R E;  5A4W A;  4G19 A;  4KND A;  1JLW A;  5IPG A;  4MLY A;  4TR1 B;  2V32 A;  2H75 A;  2KHP A;  4HDE A;  3ERF A;  2BMX A;  2FY6 A;  2E2M A;  5H5S A;  1THO A;  1QMV A;  3TKP A;  1BYE A;  4K0G A;  2E7P A;  3V1W A;  1B4P A;  4QQ7 A;  2HRK A;  4KGI A;  5HR2 A;  2DBC A;  1V2A A;  3GTU A;  3KMO A;  1YKA A;  1UVZ A;  5J9B A;  4X0X A;  2YZH A;  1SL0 B;  4WXT A;  5EL8 A;  5IMA A;  5CNW A;  1U3A A;  2HZE B;  2XPE A;  5G31 A;  3TJG A;  2CVD A;  2Z9S A;  1TK8 B;  1J9B A;  1KBN A;  1HNC A;  5J41 A;  5CRH A;  2WRT A;  2MZC A;  2OJL A;  3UBK A;  5DCG A;  3NIV A;  1GTB A;  2VCQ A;  2PER A;  2UZ8 A;  3IDV A;  1K0D A;  1OE7 A;  5D9V A;  3I69 A;  3WGD A;  1Q98 A;  3UVH A;  2H74 A;  2C80 A;  1TRS A;  3H4K A;  2GQL A;  3NOF A;  1QFN A;  22GS A;  2TRX A;  1R4W A;  2LJK A;  1A8L A;  4TRX A;  1B9X C;  2CV4 A;  4ZIJ A;  3L0H A;  4DEJ A;  4G0I A;  3ZRD A;  4ECC A;  1V40 A;  5DQY A;  2YCD A;  5D96 A;  3KD0 A;  4IVF A;  4I6X A;  1YKC A;  1T3B A;  4KE3 A;  2EIR A;  4OFM A;  4ECI A;  2FWF A;  4OO4 A;  2EIO A;  1ACV A;  1S3A A;  3DIE A;  5DVB A;  5D9T A;  3ZMK A;  2HFD A;  1ILO A;  4V2M A;  2R4V A;  4TN8 A;  3KP9 A;  3GSS A;  1F6M C;  3KH7 A;  12GS A;  2WB9 A;  5H5Q A;  3RAZ A;  2YV7 A;  1EZK A;  4EVM A;  4IGJ A;  4LMV A;  10GS A;  2PBJ A;  1E2Y A;  1ZYQ B;  2VL9 A;  2PGT A;  5JCU A;  1OC9 B;  3QCP A;  3WGX A;  3VWU A;  4GWR A;  2GSR A;  3FEU A;  5B6N A;  4PQ1 A;  3EMX A;  3Q74 A;  4POK A;  1PGT A;  4TXV A;  4MJC A;  1H75 A;  1K3L A;  2QGV A;  2N5A A;  3GYK A;  3FRC A;  5G1L A;  3TGZ A;  3QFA C;  3GHA A;  5CAX A;  2R6K A;  2ON7 A;  3KTL A;  1WP0 A;  1J08 A;  1TI3 A;  3O3T A;  4EKZ A;  4ZL9 A;  1THX A;  1SK2 A;  2GQM A;  1WRY A;  2H1G A;  4KDU A;  2LEG A;  3TOU A;  4KCA A;  1Z6N A;  2DC5 A;  5KEJ A;  1EOH A;  2FWE A;  5F0G A;  3PIN A;  5JWR B;  1CQH A;  5IOX A;  4PX1 A;  3HA9 A;  4MPF A;  1XW9 A;  2O8V B;  1R5A A;  2R2J A;  1V57 A;  3UAP A;  4JU5 A;  1I5G A;  3N5O A;  2L6C A;  1Y25 A;  2TRC P;  3D21 A;  3R2Q A;  4KSO A;  3HJO A;  1M7T A;  1DUG A;  1XVW A;  5F07 A;  4ZBA A;  4P3Y B;  1ABA A;  2CVK A;  2VL3 A;  3HJP A;  4ML6 A;  4ISD A;  2V6K A;  4IHU A;  1GH2 A;  2LJR A;  4O7H A;  5GSS A;  1XOA A;  1T00 A;  1PSQ A;  5F06 A;  2C8U A;  3DEX A;  3TKS A;  2HE3 A;  2F3M A;  4IS0 A;  3WT2 A;  2I1U A;  3GKX A;  4KW6 A;  3BOA A;  3GST A;  1K0B A;  3M9K A;  2M80 A;  4KB3 A;  1GLP A;  3PPU A;  2XHF A;  2TIR A;  5C00 A;  1YEP A;  1QGV A;  4LL4 B;  1PQN A;  3VI7 A;  3A2X A;  4BVY A;  3GRX A;  2P5R A;  3LWA A;  4BL7 B;  4IBP A;  3LYP A;  4K0N A;  4WR4 A;  4MH2 A;  3FYG A;  2X8C A;  4Z7X A;  2I3Y A;  2A2R A;  1TRU A;  4FYU A;  5ENU A;  5DJM A;  3M8N A;  1JHB A;  4YAP A;  1Z3E A;  2CT6 A;  4YAV A;  1X5E A;  1GTU A;  4F03 A;  5COH A;  4ILF A;  1A2J A;  4MAB A;  4OFT A;  1SD9 A;  4JBB A;  2NBS A;  5DDL A;  3EE2 A;  1JZO A;  4K7N A;  3TJB A;  3HDC A;  8GSS A;  1UC7 A;  2DSA A;  1A2M A;  3GIX A;  4FYB A;  1GSE A;  3PGT A;  2EIQ A;  4IJI A;  3HHV A;  3GL5 A;  1TTZ A;  1BX9 A;  5DAK A;  4GSN A;  1GSF A;  4PQH A;  3IBH A;  2B5Y A;  1WE0 A;  4GST A;  1SJI A;  2NTO A;  2HI7 A;  1FHE A;  3C7M A;  2GLR A;  4F0C A;  4AJ8 A;  4BVX B;  4NXI A;  5HR1 A;  1X9M B;  3UOM A;  1TRV A;  4D73 B;  3SWL A;  2WDU A;  4LMW A;  1K0A A;  1W4V A;  5IMV A;  2H19 A;  5B8A A;  2WZ9 A;  3D0Z A;  4MZW A;  4TR4 A;  2QSI A;  2DJK A;  1XWA A;  2GS3 A;  5CRW A;  2EC4 A;  3N9J A;  2HSM A;  3GUS A;  3K8N A;  1USB A;  3S9F A;  3UBL A;  3I43 A;  2GZP A;  4YQM A;  5G5E A;  1PX6 A;  1EGO A;  4RQX A;  2C3Q A;  2FLS A;  5ECN B;  3BCI A;  2C4J A;  2RUE A;  2HSY A;  2PN8 A;  3L9S A;  1TK5 B;  4TR1 A;  3EVI A;  3KZQ A;  1OVN A;  3IAS 2;  1SYR A;  3U6V A;  4DSS A;  2DJ1 A;  2RLI A;  3IK9 A;  6GSY A;  4RQR A;  3IAM 2;  1GUM A;  2H8L A;  2MMO A;  1YEX A;  1B48 A;  2H0G A;  1XWC A;  1RW1 A;  9GSS A;  3QPM A;  2M46 A;  3L78 A;  4RI6 A;  3CSJ A;  2DIZ A;  4K1F A;  2VIM A;  3RHB A;  4WR5 A;  4G0L A;  5D8I A;  4GQF A;  4ECJ A;  4Q5Q A;  18GS A;  2YWN A;  1KEB A;  3C1S A;  4RUV A;  2YPM A;  2YN1 A;  5C04 A;  4I8B A;  4NHZ A;  1Z5Y E;  1E6B A;  5DAL B;  2RM5 A;  4ZBD A;  3ERW A;  1R26 A;  3PR8 A;  2LS5 A;  3KXO A;  2YAN A;  6GSW A;  1FB6 A;  3E9J B;  2C0D A;  4J57 E;  1FB0 A;  1SKR B;  1O81 A;  1U87 A;  3ZVJ A;  5G5F A;  2R37 A;  1XFL A;  1IYI A;  4N11 A;  2LQQ A;  6GSX A;  1T1V A;  4JE1 A;  1GTA A;  2V2G A;  4AF2 A;  5JWO B;  1OE8 A;  2L59 A;  3HD5 A;  5EVO A;  1F37 A;  4XTS A;  2O89 A;  3TB2 A;  1ZZY A;  3M1G A;  1X9W B;  5FHI A;  1EV4 A;  4AJ7 A;  3W8J A;  4TXO B;  3CTF A;  4YH2 A;  2PPT A;  4JR6 A;  2F8F A;  1FAA A;  4DVC A;  1A0F A;  3QAV A;  1A8Y A;  2GGT A;  2VL2 A;  2CX4 A;  4MF6 A;  2YNX A;  2CVB A;  2A4V A;  3LQ7 A;  4I97 A;  1GSU A;  2LKU A;  4Q5R A;  1KTE A;  2LST A;  1F3B A;  4N0V A;  1X9S B;  3LG6 A;  1V58 A;  4EDZ A;  4NWY A;  1XIY A;  4TOP A;  1OC9 A;  2R5G A;  1PA3 A;  4N0Z A;  2B7K A;  1PD2 1;  3JCM L;  4MF5 A;  4F2I A;  2JAD A;  5IPH A;  5ABR A;  1QQ2 A;  3AY8 A;  1M2D A;  5JWQ B;  2CAQ A;  2L4Q A;  5G30 A;  4L5O A;  4JZQ A;  3C8E A;  1UN2 A;  3CRU A;  3FHK A;  1U3I A;  1HD2 A;  2NVL A;  4JRR A;  2IFQ B;  3MNG A;  1SYX A;  7GSS A;  2H0H A;  2F9S A;  1V98 A;  3O6T A;  4ZB9 A;  2G2Q A;  3ME7 A;  1CQG A;  2K8V A;  3F6D A;  5CYY A;  4KDX A;  1F3A A;  4MJE A;  1A24 A;  3ZFB A;  1N8J A;  2HYX A;  2HNL A;  3APO A;  3MSZ A;  4HQZ A;  5LNK e;  1JLV A;  5CRE A;  3HJM A;  3FZ5 A;  2AYT A;  5HFI A;  2PU9 C;  2X8H A;  3UIW A;  3FR9 A;  4O32 A;  2FWH A;  1FVK A;  4KF9 A;  2VM2 A;  5CP1 A;  3TJF A;  2L57 A;  2LUS A;  4IQ1 A;  4F0B A;  3IC8 A;  3F63 A;  1TW9 A;  4G10 A;  3H79 A;  3F4T A;  4G9H A;  2NPB A;  5D73 A;  4F9Z A;  5GZZ B;  1SEN A;  1AQW A;  1ON4 A;  1X5C A;  4N30 A;  4K2D A;  4HZ2 A;  1XXU A;  3TJJ A;  5JCW A;  5IO2 A;  3F8U A;  1Z7R A;  1BED A;  4XS4 B;  3MAK A;  2V1M A;  3FY7 A;  4GLT A;  3DD3 A;  5ECP B;  2K8S A;  1O85 A;  2DJ3 A;  3H8Q A;  5ECK B;  1JZD A;  3E3E A;  1F2E A;  2N5B A;  4CW9 A;  3NZN A;  2VM1 A;  4LLR A;  1H4O A;  5HQP A;  3LJR A;  4YQU A;  3HZ4 A;  1N2A A;  3KGK A;  4BL7 A;  2GVP A;  1LJR A;  3LXT A;  2IME A;  1Z6M A;  1PMT A;  4V1A g;  1X5D A;  2O85 A;  1SD8 A;  3HVS A;  19GS A;  5FT3 A;  4JED A;  4MA9 A;  3UAR A;  1GLQ A;  1MEK A;  2OBK A;  5IMF A;  5KN3 A;  4MP4 A;  3PH9 A;  5ECR B;  1ZL9 A;  5B6M A;  2H71 A;  3KTB A;  1YJ6 A;  3GKK A;  4WET A;  4ID0 A;  4IJ3 A;  2VLU A;  1RK4 A;  3BCK A;  3G7Y A;  1O73 A;  2LTK A;  4NV5 A;  1O6J A;  2H6X A;  3RPP A;  2VLV A;  3GX0 A;  1R7H A;  4PUF C;  3BJ5 A;  1GTI A;  1B8X A;  2B7J A;  1T4Y A;  2RII A;  1XBS A;  3IV4 A;  2YWO A;  2VCV A;  3HVV A;  5IOW A;  2GDR A;  1HNB A;  1TU7 A;  3VPT A;  1X0R A;  2HSH A;  4AJ6 A;  2M72 A;  2QKE A;  1AIU A;  1OC3 A;  4O5R A;  1NSW A;  2GTU A;  2VO4 A;  4HJM A;  2H1D A;  1URM A;  1YZX A;  3HCZ A;  5ECS A;  1BG5 A;  4F82 A;  5J5N A;  3TOT A;  4AGS A;  5J9C A;  2CX3 A;  5HR3 A;  4BVX A;  3C1R A;  3US3 A;  2P5Q A;  1QK8 A;  4POL A;  4OWY A;  5HFG A;  1TU8 A;  1TRW A;  5G2Z A;  5L71 A;  3D4T A;  5DQS A;  2IWT A;  3P2A A;  2L5L A;  3IHQ A;  2N5F A;  3IPZ A;  2FUG 2;  3QAG A;  4MJA A;  2H66 A;  2NDO A;  2VAF A;  4I5Q A;  5GAP D;  3I9V 2;  1SL2 B;  5F05 A;  5DBQ A;  2R3X A;  4YQV A;  2F8A A;  3QR6 A;  3DYR A;  5KN0 A;  2YV9 A;  4GCI A;  4O92 A;  3KJY A;  2DML A;  2HRF A;  1XWK A;  1EV9 A;  2AB6 A;  3DXB A;  2ALB A;  5IM9 A;  4JR4 A;  1XOB A;  1QUW A;  2H0I A;  5AIV A;  3GNJ A;  2B3S A;  1YY7 A;  1ST9 A;  1OYJ A;  3L9V A;  4MMM A;  3FZA A;  3ME8 A;  2IN3 A;  2HT9 A;  3ZLP A;  3UJ1 A;  2YJH A;  4IP1 A;  4ZB6 A;  4HQS A;  2JL4 A;  2IMI A;  3EMP A;  1Z7P A;  1LU4 A;  3D6I A;  1ERU A;  1SJZ A;  1K0N A;  3SBC A;  4KUN A;  4MZC A;  2C1Y A;  1GSY A;  5ECH B;  1HNA A;  4K8M A;  2OBI A;  1VF1 A;  4NV2 A;  3QD9 A;  1YQ1 A;  3KH9 A;  4MDC A;  2IJY A;  2MMZ A;  1MD3 A;  2FCH A;  2HRN A;  2KP1 A;  2YWM A;  1EOG A;  1K3Y A;  3TKS C;  3FR6 A;  3CYN A;  3GKM A;  2OE0 A;  1AXD A;  3A5W A;  3D5J A;  2XPD A;  4E8E A;  4DSQ A;  3CTG A;  1IYH A;  4L5L A;  3HYP A;  1A2L A;  1XW6 A;  5ECQ B;  4N10 A;  5CO3 A;  3TRX A;  3GKN A;  1MTC A;  4XHM A;  2H73 A;  3CRT A;  2PUK C;  3WGE A;  1GWC A;  4ZIL A;  1GSS A;  1FG4 A;  3FW2 A;  1TJD A;  4MF7 A;  1AW9 A;  4K7O A;  1K0O A;  4CDO A;  1TI1 A;  5BMU A;  3DKS A;  2BTO T;  4TXO A;  2ES7 A;  3F3R A;  4ECB A;  5JCG A;  2H6Y A;  2E2G A;  3DVX A;  5H5R A;  4MK3 A;  2GST A;  16GS A;  2H30 A;  2L4C A;  4J2F A;  2WUL A;  3J7Y k;  4USS A;  4PUR A;  4FO5 A;  4GQC A;  1XCC A;  4EXJ A;  1XZO A;  3DVW A;  3EU3 A;  4ML1 A;  4KAE A;  1O8X A;  2HLS A;  4KA0 A;  3KP8 A;  1PX7 A;  2VOC A;  3Q18 A;  4L8E A;  2K18 A;  2VCT A;  1F9M A;  3ERG A;  3GX8 A;  1V9W A;  4V1A p;  4NHW A;  4XS6 A;  3HY2 A;  3DML A;  4RI7 A;  1HYU A;  1NHO A;  3RBT A;  3IE3 A;  3WT1 A;  3F4S A;  2VD1 A;  2IPA A;  3KM6 A;  2HZE A;  3ZIT A;  3QAW A;  3CBU A;  2H6Z A;  4J56 E;  4K7I A;  1U88 A;  2CAI A;  3W8S A;  1SU9 A;  4BA7 A;  2RUF A;  3APQ A;  3EIN A;  4KSM A;  1AQV A;  2YOI A;  3VWV A;  3DWV A;  3TKQ A;  1R5P A;  3UL3 A;  1M2B A;  4XCS A;  4EC0 A;  2C0E A;  3M0F A;  2CZ2 A;  1PKZ A;  5KN1 A;  3P7X A;  1Y6E A;  3EYT A;  2AV4 A;  3A2V A;  4ACS A;  3D4M A;  3OR5 A;  5ID2 B;  1SK1 A;  2MYG A;  3CSH A;  2L5O A;  1PRX A;  2PWJ A;  1PL1 A;  4TKY A;  2A2S A;  4QL9 A;  2OE1 A;  2F51 A;  1VF3 A;  1EWX A;  3TKR A;  2LRN A;  1MDI A;  4X1U A;  3LFL A;  4NMU A;  4EDY A;  3O76 A;  1OAZ A;  4K9Z A;  2GSQ A;  3LYK A;  2K9F A;  2LNS A;  4XS1 A;  3FK8 A;  5J4U A;  4TVE A;  2GT5 A;  3HVX A;  1XWG A;  1T8E B;  3GV1 A;  1MDK A;  1O7U A;  3EUR A;  2WFC A;  4BPY A;  2MBT A;  4CHS A;  4IN0 A;  1WJK A;  2VLT A;  3EWL A;  1KNG A;  3VK9 A;  4PUA A;  3QMX A;  4DSS B;  5EPF A;  1FOV A;  5LCZ A;  2P31 A;  2VD0 A;  2YWI A;  1GUK A;  3ZRE A;  4PGT A;  1EP7 A;  4XS4 A;  2DLX A;  5A5K A;  5J3R A;  1WIK A;  2FA4 A;  1SL1 B;  5B7C A;  2X8G A;  4FH8 A;  3UEM A;  2HQT A;  3FZ4 A;  1FW1 A;  4GRF A;  1ERW A;  3LXZ A;  2J9H A;  4OCF A;  2JSY A;  5ECM B;  4EE0 A;  1OKT A;  5LD0 A;  3ZIJ A;  4G0K A;  3E0U A;  3IK7 A;  2C0G A;  5EY6 A;  1I9D A;  2OE3 A;  2WGR A;  3QDN A;  1ERV A;  4BWQ A;  5A4U A;  2E0Q A;  3CXG A;  2DJJ A;  3EC3 A;  2LRT A;  4WEY A;  4HI7 A;  5IO0 A;  3C73 A;  6GSU A;  1G0T A;  3APS A;  3L9U A;  1GUL A;  1B9Y C;  2DJ0 A;  4HS1 A;  1LBK A;  1WWJ A;  1FVJ A;  2IL3 A;  3TDG A;  1EP8 A;  1K3O A;  5E59 A;  2GSS A;  1C72 A;  3FKF A;  4LL1 B;  3KIJ A;  2KP2 A;  2FNO A;  5IIZ A;  3F6F A;  1G6Y A;  1T7P B;  2ON5 A;  2CQ9 A;  3ED3 A;  2X64 A;  1YF0 A;  4TW5 A;  2BJX A;  2MMA A;  2ZCT A;  4XRA A;  1AUC A;  3RDW A;  3R3E A;  3ZML A;  2VL2 C;  2WS2 A;  4POB A;  2GQK A;  3ZVJ D;  5B8B A;  2I4A A;  3G7I A;  2HRK B;  1NHY A;  1XWB A;  1HQO A;  1U6T A;  3KCM A;  3IC4 A;  3GTU B;  4IQA A;  2YZU A;  5GST A;  1WPI A;  3P8W A;  2JZS A;  3UVT A;  5DJL A;  5IMD A;  3Q19 A;  2X99 A;  2I81 A;  5IMC A;  1S3D A;  3I6A A;  2WCI A;  3G7J A;  2C3N A;  3HKR A;  2OAD A;  1M9A A;  2IMD A;  3RHC A;  3ISO A;  1A23 A;  3RPN A;  2I9H A;  4I2T A;  1GUH A;  3IA1 A;  1XW5 A;  5D9W A;  2JZR A;  2KUC A;  4NPB A;  3VWW A;  4BWS A;  2LJA A;  2AAW A;  2B1L A;  4PNF A;  2DIY A;  1VF4 A;  3ZL5 A;  4DSR A;  1VGL A;  4PQI A;  3MWH A;  4GXZ A;  1NM3 A;  2FHE A;  4MZB A;  17GS A;  4WF4 A;  3LSZ A;  3M3M A;  3TRP A;  3BBY A;  4G2E A;  2B5E A;  4FIW A;  1PL2 A;  1ZGN A;  1TXX A;  4QL7 A;  4OCE A;  4E8H A;  2MMN A;  3TJK A;  4IEL A;  4MH3 A;  3TKS E;  4TR0 A;  2LV3 A;  4EUY A;  1TP9 A;  3LEF A;  1AAZ A;  2P0G A;  3TRQ A;  5FWG A;  1ML6 A;  2H70 A;  2C0F A;  4XIH A;  3ZYW A;  4HOJ A;  5HFK A;  5ELA A;  1G7O A;  1JZW A;  2VCW A;  1J0F A;  3Q6O A;  4XRD A;  4PTS A;  1EEJ A;  1MD4 A;  1M2A A;  3HZ8 A;  4GTU A;  2RM6 A;  1JZR A;  4TR3 A;  4IP6 A;  4L0W A;  1A0R P;  3BD2 A;  3HXS A;  5HR0 A;  4OFN A;  2V6O A;  4D73 A;  1FO5 A;  1ZMA A;  3LGC A;  1GSD A;  3WD6 A;  2PMT A;  2AUV A;  2JZT A;  3VUR A;  2JSZ A;  1G7E A;  13GS A;  4ULX A; 
#chains in the Genus database with same CATH topology
 2HSN B;  2J23 A;  3GFK A;  2CA8 A;  3H93 A;  2WW2 A;  3ZIV A;  3F0I A;  4WKW A;  1AC1 A;  4HU9 A;  4POM A;  3A3T A;  4ZL8 A;  4HJ2 A;  5ECI B;  3GN3 A;  3QOU A;  2JAC A;  5ECO B;  4OMV A;  1M9B A;  3VI5 A;  1PN9 A;  1I1I P;  1BAY A;  2FA8 A;  1GRX A;  1O8W A;  3KEB A;  4Q5N A;  1S3C A;  2WW1 A;  4AKI A;  4HZ4 A;  3IRA A;  1DE2 A;  3MDK A;  4KX4 A;  4K2X A;  1M0U A;  1QXH A;  4PXO A;  2REM A;  1TOF A;  3F9U A;  3VFI A;  1BJX A;  4FQU A;  2YP6 A;  2B5X A;  2OAC A;  4V2L A;  2GZZ A;  1T4Z A;  2ZUP A;  2IMF A;  2HXK A;  4KCE A;  4L0U A;  2H1A A;  3RGB C;  3VWX A;  1GP1 A;  4K6X A;  3J7Y b;  3H1N A;  2DMM A;  3GH9 A;  2KLX A;  1SK0 A;  1M3I A;  1ERT A;  5CRD A;  1VF2 A;  4ZBB A;  1WMJ A;  3GMF A;  4WBJ A;  4OD7 A;  4HSC X;  2H1B A;  1Q4J A;  1SKS B;  2B1K A;  2OA7 A;  5D93 A;  4GSS A;  5E4W A;  1K0C A;  1ZCP A;  4ZXG A;  4IW9 A;  2XBQ A;  5F8B A;  2O87 A;  2FGX A;  2O7K A;  3UMA A;  1DSB A;  2LRC A;  5AGY A;  4WF5 A;  5KN2 A;  1ZYE A;  4CY6 A;  5G1K A;  2IIY A;  2CZ3 A;  3VLN A;  2YJ7 A;  4Z2R A;  5GAN D;  4IKH A;  5IQY A;  5DAL A;  4EL1 A;  1RQM A;  4KH7 A;  3IOS A;  2VCZ A;  5AIS A;  2MBS A;  1YDK A;  3F3Q A;  5ID2 A;  3LOR A;  1M99 A;  1GL8 A;  20GS A;  1UA5 A;  4NAX A;  3ZFL A;  4BVY B;  4LA1 A;  2IMK A;  5CRG A;  1XPV A;  3CMI A;  1W89 A;  1JFU A;  2C3T A;  2ZNM A;  1SKW B;  3DGQ A;  5ECL B;  3FR3 A;  1AQX A;  3IR4 A;  1DE1 A;  4KDY A;  4H86 A;  1YVL A;  4GF0 A;  6GSV A;  1XVQ A;  1Z9H A;  4Q5F A;  3A2W A;  3TCO A;  4EF0 A;  4PNG A;  5DCH A;  3KMN A;  4HU7 A;  3MIX A;  2GT6 A;  3FMW A;  2LQO A;  1NW2 A;  1EEM A;  2XBI A;  5A4V A;  4MJB A;  3W6G A;  1B4Q A;  3GA4 A;  14GS A;  2D2Z A;  4X43 A;  3GH6 A;  2H01 A;  1ZOF A;  3DRN A;  4V2N A;  3VPQ A;  3G9B A;  1OKD A;  3C71 A;  2H76 A;  3CSI A;  3LW9 A;  1DBY A;  2O3E A;  3L4N A;  3WYW A;  2WJU A;  5KOX A;  2WVX B;  2GZY A;  2KOK A;  1EGR A;  6GST A;  2L6D A;  5DAK B;  1GNE A;  4MCU A;  3GL3 A;  1VRS D;  3ZZX A;  11GS A;  2HZF A;  5INY A;  2LNT A;  1TKD B;  3TUE A;  3GUR A;  3P90 A;  3EU4 A;  3ZTL A;  1MDJ A;  5ELG A;  2QC7 A;  1OC8 A;  6GSS A;  2IFQ A;  1PKW A;  2XC2 A;  4I2U A;  2DJ2 A;  4OO5 A;  5IMZ A;  2AHE A;  2AJQ B;  2H72 A;  2PVQ A;  1TDI A;  1YF1 A;  4HUA A;  4MPG A;  1SJ6 A;  2JU5 A;  2VCX A;  2B6M A;  5D9X A;  1K0M A;  1GSQ A;  2HRA A;  1WOU A;  2O36 A;  3QFB C;  2VUP A;  1TK0 B;  5A34 A;  2FD3 A;  5AIX A;  2V41 A;  5AN1 A;  4HEA 2;  2PVO C;  3M9J A;  2G0F A;  3D22 A;  4ZB7 A;  2FWG A;  4ZL7 A;  2HSM B;  4WBR D;  4ZB8 A;  1GNW A;  3IXR A;  4O5Q A;  4FYC A;  2K6V A;  3FZ9 A;  1G6W A;  4EO3 A;  2OKA A;  5BMU B;  3F4R A;  1BQ7 A;  3U5R E;  5A4W A;  4G19 A;  4KND A;  1JLW A;  5IPG A;  4MLY A;  4TR1 B;  2V32 A;  2H75 A;  2KHP A;  4HDE A;  4Z2T A;  3ERF A;  2BMX A;  2FY6 A;  2E2M A;  5H5S A;  1THO A;  2O5V A;  1QMV A;  3TKP A;  1BYE A;  4K0G A;  2E7P A;  3V1W A;  1B4P A;  4QQ7 A;  2HRK A;  4KGI A;  5HR2 A;  2DBC A;  1V2A A;  3GTU A;  3KMO A;  1YKA A;  1UVZ A;  5J9B A;  4X0X A;  2YZH A;  1SL0 B;  4WXT A;  5EL8 A;  5IMA A;  2EFH A;  5CNW A;  1U3A A;  2HZE B;  2XPE A;  5G31 A;  3TJG A;  2CVD A;  2Z9S A;  1TK8 B;  1J9B A;  1KBN A;  1HNC A;  5J41 A;  5CRH A;  2WRT A;  2MZC A;  2OJL A;  3UBK A;  5DCG A;  3NIV A;  1GTB A;  2VCQ A;  2PER A;  2UZ8 A;  3IDV A;  1K0D A;  1OE7 A;  5D9V A;  3I69 A;  2X4A A;  3WGD A;  1Q98 A;  1TXU A;  2H1L A;  3UVH A;  2H74 A;  4AKH A;  2C80 A;  1TRS A;  3H4K A;  2GQL A;  3NOF A;  1QFN A;  22GS A;  2TRX A;  1R4W A;  2LJK A;  1A8L A;  4TRX A;  1B9X C;  2CV4 A;  4ZIJ A;  3L0H A;  4DEJ A;  5A1N A;  4G0I A;  3ZRD A;  4ECC A;  1V40 A;  5DQY A;  2YCD A;  5D96 A;  3KD0 A;  4IVF A;  4I6X A;  1YKC A;  1T3B A;  4KE3 A;  2EIR A;  4OFM A;  4ECI A;  2FWF A;  4OO4 A;  2EIO A;  1ACV A;  1S3A A;  3DIE A;  5DVB A;  5D9T A;  3ZMK A;  2HFD A;  1ILO A;  4V2M A;  2R4V A;  4TN8 A;  3GSS A;  3KP9 A;  1F6M C;  3CHX C;  3KH7 A;  12GS A;  2WB9 A;  5H5Q A;  3RAZ A;  2YV7 A;  1EZK A;  4EVM A;  4IGJ A;  4LMV A;  10GS A;  2PBJ A;  1E2Y A;  1ZYQ B;  2VL9 A;  2PGT A;  5JCU A;  1OC9 B;  3QCP A;  3WGX A;  3VWU A;  4GWR A;  2GSR A;  4K5S A;  3FEU A;  5B6N A;  4PQ1 A;  3EMX A;  4CY8 A;  1M3J A;  3Q74 A;  4POK A;  1PGT A;  4TXV A;  4MJC A;  1H75 A;  1K3L A;  2QGV A;  2N5A A;  3GYK A;  3FRC A;  5G1L A;  3TGZ A;  3QFA C;  3GHA A;  5CAX A;  2R6K A;  2ON7 A;  3KTL A;  1WP0 A;  1J08 A;  1TI3 A;  3O3T A;  4EKZ A;  4ZL9 A;  1THX A;  1SK2 A;  2GQM A;  1WRY A;  2H1G A;  4KDU A;  2LEG A;  4PHZ C;  3TOU A;  4KCA A;  1Z6N A;  2DC5 A;  5KEJ A;  1EOH A;  2FWE A;  5F0G A;  1PN0 A;  3PIN A;  4AKG A;  3RFR C;  5JWR B;  1CQH A;  5IOX A;  4PX1 A;  3HA9 A;  4MPF A;  1XW9 A;  2O8V B;  1R5A A;  2R2J A;  1V57 A;  2X49 A;  3UAP A;  4JU5 A;  1I5G A;  4EIQ A;  3N5O A;  2L6C A;  1Y25 A;  2TRC P;  3D21 A;  3R2Q A;  4KSO A;  3HJO A;  1M7T A;  1DUG A;  1XVW A;  2WW0 A;  5F07 A;  4ZBA A;  4P3Y B;  1ABA A;  2CVK A;  2VL3 A;  3HJP A;  4ICY A;  4ML6 A;  4ISD A;  2V6K A;  4IHU A;  1GH2 A;  2LJR A;  4AI6 A;  4O7H A;  5GSS A;  1XOA A;  1T00 A;  1PSQ A;  5F06 A;  3CQF A;  3IHG A;  2C8U A;  2OT3 A;  3DEX A;  3TKS A;  2HE3 A;  2F3M A;  4IS0 A;  3WT2 A;  2I1U A;  5A5H B;  3GKX A;  1S3R A;  4KW6 A;  3BOA A;  3GST A;  1K0B A;  3M9K A;  2M80 A;  4KB3 A;  1GLP A;  3PPU A;  2XHF A;  2TIR A;  5C00 A;  1YEP A;  1QGV A;  4LL4 B;  2WZS A;  4PI0 C;  1PQN A;  3VI7 A;  3A2X A;  3EPT A;  4BVY A;  3GRX A;  2P5R A;  4GDF A;  3LWA A;  4BL7 B;  4IBP A;  3LYP A;  4K0N A;  4WR4 A;  4MH2 A;  3FYG A;  2X8C A;  4Z7X A;  2I3Y A;  2A2R A;  1TRU A;  4FYU A;  5ENU A;  5DJM A;  3M8N A;  1JHB A;  4YAP A;  2R0C A;  1Z3E A;  2CT6 A;  4YAV A;  1X5E A;  1GTU A;  4F03 A;  1ZYP A;  5COH A;  4ILF A;  1A2J A;  4MAB A;  4OFT A;  1SD9 A;  4JBB A;  2NBS A;  5DDL A;  3EE2 A;  1JZO A;  4K7N A;  3TJB A;  3HDC A;  8GSS A;  1UC7 A;  2DSA A;  3MYD A;  1A2M A;  3GIX A;  4FYB A;  1GSE A;  3PGT A;  2WVX A;  2EIQ A;  4IJI A;  3HHV A;  3GL5 A;  1TTZ A;  1BX9 A;  5DAK A;  4GSN A;  1GSF A;  4PQH A;  3IBH A;  2B5Y A;  1WE0 A;  4GST A;  1SJI A;  2NTO A;  1BF5 A;  2HI7 A;  1FHE A;  3C7M A;  2GLR A;  4F0C A;  4AJ8 A;  4BVX B;  4NXI A;  5HR1 A;  1X9M B;  3UOM A;  1TRV A;  4D73 B;  3SWL A;  2WDU A;  4LMW A;  1K0A A;  1W4V A;  5IMV A;  2H19 A;  5B8A A;  2WZ9 A;  3D0Z A;  4MZW A;  4TR4 A;  2QSI A;  2EFD A;  3HMJ G;  4MNN A;  2DJK A;  1XWA A;  2GS3 A;  2DKI A;  5CRW A;  2EC4 A;  3N9J A;  2HSM A;  3GUS A;  3K8N A;  1USB A;  3S9F A;  2WVZ A;  3UBL A;  3I43 A;  2GZP A;  4YQM A;  5G5E A;  1PX6 A;  2WW3 A;  1EGO A;  4RQX A;  2C3Q A;  2FLS A;  5ECN B;  3BCI A;  2C4J A;  2RUE A;  2HSY A;  4QMK A;  2PN8 A;  4BIK A;  3L9S A;  1TK5 B;  4TR1 A;  3EVI A;  3KZQ A;  1OVN A;  3IAS 2;  1SYR A;  3U6V A;  4DSS A;  1ZYN A;  2DJ1 A;  2RLI A;  3IK9 A;  6GSY A;  4RQR A;  3IAM 2;  1GUM A;  2H8L A;  5J47 A;  2MMO A;  1YEX A;  1N25 A;  1B48 A;  2QA2 A;  2H0G A;  1XWC A;  1RW1 A;  9GSS A;  4E68 A;  3QPM A;  2M46 A;  3L78 A;  4RI6 A;  3CSJ A;  2DIZ A;  4K1F A;  2VIM A;  3RHB A;  4WR5 A;  4G0L A;  5D8I A;  4GQF A;  4ECJ A;  4Q5Q A;  18GS A;  2YWN A;  1KEB A;  3C1S A;  4RUV A;  2YPM A;  2YN1 A;  5C04 A;  4I8B A;  4NHZ A;  1Z5Y E;  1E6B A;  5DAL B;  2RM5 A;  4ZBD A;  3ERW A;  1R26 A;  3PR8 A;  2LS5 A;  3KXO A;  2YAN A;  6GSW A;  1FB6 A;  3E9J B;  2C0D A;  4J57 E;  2A2P A;  1FB0 A;  1SKR B;  1O81 A;  1U87 A;  3ZVJ A;  5G5F A;  2R37 A;  1XFL A;  1IYI A;  4N11 A;  4EIP A;  2LQQ A;  5J4V A;  6GSX A;  1T1V A;  4JE1 A;  1GTA A;  2V2G A;  4AF2 A;  5JWO B;  1OE8 A;  2L59 A;  3HD5 A;  5EVO A;  1F37 A;  4XTS A;  2O89 A;  3TB2 A;  1ZZY A;  3M1G A;  1X9W B;  5FHI A;  1EV4 A;  4AJ7 A;  1Y1U A;  3W8J A;  4TXO B;  3CTF A;  4YH2 A;  2PPT A;  4JR6 A;  2F8F A;  1FAA A;  4DVC A;  1A0F A;  3QAV A;  1A8Y A;  2GGT A;  2VL2 A;  2CX4 A;  4MF6 A;  2YNX A;  2CVB A;  4O5U A;  2A4V A;  3LQ7 A;  4I97 A;  1GSU A;  2LKU A;  4Q5R A;  1KTE A;  2LST A;  1F3B A;  4N0V A;  4X4J A;  1X9S B;  3LG6 A;  1V58 A;  4EDZ A;  4NWY A;  1XIY A;  4TOP A;  1OC9 A;  2R5G A;  4N3Z A;  1PA3 A;  4N0Z A;  2B7K A;  1PD2 1;  3JCM L;  4MF5 A;  4F2I A;  2JAD A;  5IPH A;  5ABR A;  1QQ2 A;  3AY8 A;  1M2D A;  5JWQ B;  2CAQ A;  2L4Q A;  5G30 A;  4L5O A;  4JZQ A;  1S4B P;  3C8E A;  1UN2 A;  3CRU A;  3FHK A;  1U3I A;  1HD2 A;  2NVL A;  4JRR A;  2IFQ B;  3MNG A;  1SYX A;  7GSS A;  2H0H A;  2F9S A;  1V98 A;  3O6T A;  4ZB9 A;  2G2Q A;  3ME7 A;  1CQG A;  2K8V A;  3F6D A;  5CYY A;  4KDX A;  1F3A A;  4MJE A;  1A24 A;  3ZFB A;  1N8J A;  2HYX A;  2HNL A;  3APO A;  3MSZ A;  4HQZ A;  5LNK e;  1JLV A;  5CRE A;  3HJM A;  3FZ5 A;  2AYT A;  5HFI A;  2PU9 C;  2X8H A;  3UIW A;  3FR9 A;  4O32 A;  2FWH A;  1FVK A;  4KF9 A;  2VM2 A;  5CP1 A;  3TJF A;  2L57 A;  2LUS A;  4IQ1 A;  4F0B A;  3IC8 A;  3F63 A;  2R0P A;  1TW9 A;  4G10 A;  3H79 A;  3F4T A;  4G9H A;  2NPB A;  5D73 A;  4F9Z A;  5GZZ B;  1SEN A;  1AQW A;  1ON4 A;  1X5C A;  4N30 A;  4K2D A;  4HZ2 A;  1XXU A;  3TJJ A;  5JCW A;  5IO2 A;  2HSN A;  3F8U A;  1Z7R A;  1BED A;  4XS4 B;  3MAK A;  2V1M A;  3FY7 A;  4GLT A;  3DD3 A;  5ECP B;  2K8S A;  1O85 A;  2DJ3 A;  3H8Q A;  5ECK B;  1JZD A;  3E3E A;  1F2E A;  2N5B A;  4CW9 A;  3NZN A;  2VM1 A;  4LLR A;  1H4O A;  5HQP A;  3LJR A;  2A4H A;  4YQU A;  3HZ4 A;  1N2A A;  3KGK A;  4BL7 A;  2GVP A;  4A5P A;  1LJR A;  3LXT A;  2IME A;  1Z6M A;  1PMT A;  4V1A g;  1X5D A;  2O85 A;  1SD8 A;  3HVS A;  19GS A;  5FT3 A;  4JED A;  4MA9 A;  3UAR A;  1GLQ A;  1MEK A;  2OBK A;  5IMF A;  5KN3 A;  4MP4 A;  3PH9 A;  5ECR B;  1ZL9 A;  5B6M A;  2H71 A;  3KTB A;  1YJ6 A;  3GKK A;  4WET A;  4ID0 A;  4IJ3 A;  2VLU A;  1RK4 A;  3BCK A;  3G7Y A;  1O73 A;  2LTK A;  4NV5 A;  1O6J A;  2H6X A;  3RPP A;  2VLV A;  3GX0 A;  1R7H A;  4PUF C;  3BJ5 A;  1GTI A;  1B8X A;  2B7J A;  1T4Y A;  5A1N B;  2RII A;  1XBS A;  3IV4 A;  2YWO A;  1PFO A;  2VCV A;  3HVV A;  5IOW A;  2GDR A;  1HNB A;  1TU7 A;  3VPT A;  1X0R A;  2HSH A;  4AJ6 A;  2M72 A;  2QKE A;  1AIU A;  1OC3 A;  4O5R A;  1NSW A;  2GTU A;  2VO4 A;  4HJM A;  2H1D A;  2EFE A;  1URM A;  1YZX A;  3HCZ A;  5ECS A;  1BG5 A;  4F82 A;  5J5N A;  3TOT A;  4AGS A;  2DKH A;  5J9C A;  2CX3 A;  5HR3 A;  4BVX A;  3C1R A;  3US3 A;  2P5Q A;  1QK8 A;  4POL A;  4OWY A;  5HFG A;  1TU8 A;  1TRW A;  5G2Z A;  5L71 A;  3D4T A;  5DQS A;  2IWT A;  3P2A A;  2L5L A;  3IHQ A;  2N5F A;  3IPZ A;  2FUG 2;  3QAG A;  4MJA A;  2H66 A;  2NDO A;  2VAF A;  4I5Q A;  5GAP D;  3I9V 2;  1SL2 B;  5F05 A;  5DBQ A;  2R3X A;  4YQV A;  2F8A A;  3QR6 A;  3DYR A;  5KN0 A;  2YV9 A;  4GCI A;  4O92 A;  3KJY A;  2DML A;  2HRF A;  1XWK A;  1EV9 A;  2AB6 A;  3DXB A;  2ALB A;  5IM9 A;  4JR4 A;  1XOB A;  1QUW A;  2H0I A;  5AIV A;  3GNJ A;  2B3S A;  1YY7 A;  1ST9 A;  1OYJ A;  3L9V A;  4MMM A;  3FZA A;  3ME8 A;  2IN3 A;  4YKG A;  2HT9 A;  3ZLP A;  3UJ1 A;  2YJH A;  4IP1 A;  4ZB6 A;  4HQS A;  2JL4 A;  2IMI A;  3EMP A;  1Z7P A;  1LU4 A;  3D6I A;  1ERU A;  1SJZ A;  1K0N A;  4PI2 C;  3SBC A;  4KUN A;  4MZC A;  2C1Y A;  1GSY A;  5ECH B;  1HNA A;  2QA1 A;  4K8M A;  2OBI A;  1VF1 A;  4NV2 A;  3QD9 A;  1YQ1 A;  3KH9 A;  4MDC A;  1XG8 A;  2IJY A;  2MMZ A;  1MD3 A;  2FCH A;  2HRN A;  2KP1 A;  2YWM A;  1EOG A;  1K3Y A;  3TKS C;  3FR6 A;  3CYN A;  3GKM A;  2OE0 A;  1AXD A;  3A5W A;  3D5J A;  2XPD A;  4E8E A;  4DSQ A;  3CTG A;  1IYH A;  4L5L A;  1SVM A;  3HYP A;  1SVO A;  1A2L A;  1XW6 A;  5ECQ B;  4N10 A;  5CO3 A;  3TRX A;  3GKN A;  1MTC A;  4XHM A;  2H73 A;  3CRT A;  2PUK C;  5J40 A;  3WGE A;  1GWC A;  4ZIL A;  1GSS A;  1FG4 A;  4FXY P;  3FW2 A;  1TJD A;  4MF7 A;  1AW9 A;  4K7O A;  1K0O A;  4CDO A;  1TI1 A;  5BMU A;  3DKS A;  2BTO T;  4TXO A;  2ES7 A;  3F3R A;  4ECB A;  5JCG A;  2H6Y A;  2E2G A;  3DVX A;  5H5R A;  4MK3 A;  2GST A;  16GS A;  4Z2U A;  2H30 A;  2L4C A;  4J2F A;  2WUL A;  3J7Y k;  4USS A;  4PUR A;  4FO5 A;  4GQC A;  1XCC A;  4EXJ A;  1XZO A;  3DVW A;  3EU3 A;  4ML1 A;  4KAE A;  1O8X A;  2HLS A;  4KA0 A;  3KP8 A;  1PX7 A;  2VOC A;  3Q18 A;  4L8E A;  2K18 A;  2VCT A;  1F9M A;  3ERG A;  3GX8 A;  1V9W A;  4V1A p;  4NHW A;  4XS6 A;  3HY2 A;  3DML A;  4RI7 A;  1HYU A;  1NHO A;  3RBT A;  3IE3 A;  3WT1 A;  3F4S A;  2VD1 A;  2IPA A;  3KM6 A;  2HZE A;  3ZIT A;  3QAW A;  1SVL A;  3CBU A;  2H6Z A;  4J56 E;  4K7I A;  1U88 A;  2CAI A;  3W8S A;  1SU9 A;  4BA7 A;  2RUF A;  3A5I A;  3APQ A;  3EIN A;  4KSM A;  1AQV A;  2YOI A;  3VWV A;  3DWV A;  3TKQ A;  1R5P A;  3UL3 A;  1M2B A;  4XCS A;  4EC0 A;  2C0E A;  3M0F A;  2CZ2 A;  1PKZ A;  5KN1 A;  3P7X A;  1Y6E A;  3EYT A;  2AV4 A;  3A2V A;  4ACS A;  3D4M A;  3OR5 A;  4K5R A;  5ID2 B;  1SK1 A;  2MYG A;  3CSH A;  2L5O A;  1PRX A;  2PWJ A;  1PL1 A;  4TKY A;  2A2S A;  4QL9 A;  2OE1 A;  2F51 A;  1VF3 A;  3HVN A;  1EWX A;  3TKR A;  2LRN A;  1MDI A;  4X1U A;  3LFL A;  4NMU A;  4EDY A;  3O76 A;  1OAZ A;  4K9Z A;  2GSQ A;  3LYK A;  2K9F A;  2LNS A;  4XS1 A;  3FK8 A;  5J4U A;  4TVE A;  2GT5 A;  3HVX A;  1XWG A;  1T8E B;  3GV1 A;  1MDK A;  1O7U A;  2VKZ G;  3EUR A;  2WFC A;  4BPY A;  2MBT A;  4CHS A;  4IN0 A;  1WJK A;  2VLT A;  3EWL A;  1BG1 A;  1KNG A;  3VK9 A;  4PUA A;  3QMX A;  4DSS B;  5EPF A;  1FOV A;  5LCZ A;  2P31 A;  2VD0 A;  2YWI A;  1GUK A;  3ZRE A;  4PGT A;  1EP7 A;  4XS4 A;  2DLX A;  5A5K A;  5J3R A;  1WIK A;  2FA4 A;  1SL1 B;  5B7C A;  2X8G A;  4FH8 A;  3UEM A;  2HQT A;  3FZ4 A;  1FW1 A;  4GRF A;  1ERW A;  3LXZ A;  2J9H A;  4OCF A;  2JSY A;  5ECM B;  4EE0 A;  1OKT A;  5LD0 A;  2UV8 G;  5KOW A;  3ZIJ A;  4G0K A;  3E0U A;  3IK7 A;  2C0G A;  5EY6 A;  5J4Y A;  1I9D A;  2OE3 A;  2WGR A;  3QDN A;  1ERV A;  4BWQ A;  5A4U A;  2E0Q A;  3CXG A;  2DJJ A;  3EC3 A;  1YEW C;  2LRT A;  4WEY A;  5A34 B;  2WVY A;  4HI7 A;  5IO0 A;  3C73 A;  6GSU A;  1G0T A;  3APS A;  3L9U A;  1GUL A;  1B9Y C;  2DJ0 A;  4HS1 A;  1LBK A;  1WWJ A;  1FVJ A;  2IL3 A;  3TDG A;  1EP8 A;  1K3O A;  5E59 A;  2GSS A;  1C72 A;  3FKF A;  4LL1 B;  3KIJ A;  3CWG A;  2KP2 A;  2FNO A;  5IIZ A;  3F6F A;  1G6Y A;  1T7P B;  2ON5 A;  2CQ9 A;  3ED3 A;  2X64 A;  1YF0 A;  4TW5 A;  2BJX A;  2MMA A;  2ZCT A;  4XRA A;  1AUC A;  4YKF A;  3RDW A;  3R3E A;  3ZML A;  2VL2 C;  4W66 A;  5A5H A;  2WS2 A;  4POB A;  2R0G A;  2GQK A;  3ZVJ D;  5B8B A;  2I4A A;  3G7I A;  2HRK B;  1NHY A;  1XWB A;  1HQO A;  1U6T A;  3KCM A;  3IC4 A;  3GTU B;  4IQA A;  4G01 A;  2YZU A;  5GST A;  1WPI A;  3P8W A;  2JZS A;  3UVT A;  5DJL A;  5IMD A;  3Q19 A;  2EFC A;  2X99 A;  2I81 A;  5IMC A;  1S3D A;  3I6A A;  2WCI A;  3G7J A;  2C3N A;  3TU3 B;  3HKR A;  2OAD A;  1M9A A;  2IMD A;  3RHC A;  3ISO A;  1A23 A;  3RPN A;  2I9H A;  4I2T A;  1GUH A;  3IA1 A;  1XW5 A;  5D9W A;  2JZR A;  2KUC A;  4NPB A;  3VWW A;  4BWS A;  2LJA A;  2AAW A;  2B1L A;  4PNF A;  2DIY A;  1VF4 A;  3ZL5 A;  4DSR A;  1VGL A;  4PQI A;  3MWH A;  4GXZ A;  1NM3 A;  2FHE A;  4MZB A;  17GS A;  4WF4 A;  3LSZ A;  3M3M A;  3TRP A;  3BBY A;  4G2E A;  2B5E A;  4FIW A;  1PL2 A;  4AKX B;  1ZGN A;  1TXX A;  4QL7 A;  4OCE A;  4E8H A;  2MMN A;  3TJK A;  4IEL A;  4MH3 A;  3TKS E;  4TR0 A;  2LV3 A;  4EUY A;  1TP9 A;  3LEF A;  1AAZ A;  2P0G A;  3TRQ A;  5FWG A;  1ML6 A;  2H70 A;  2C0F A;  4XIH A;  5BRT A;  3ZYW A;  4HOJ A;  5HFK A;  1FOH A;  5ELA A;  1G7O A;  1JZW A;  2VCW A;  1J0F A;  3Q6O A;  4XRD A;  4PTS A;  1EEJ A;  1MD4 A;  1M2A A;  3HZ8 A;  4GTU A;  2RM6 A;  1JZR A;  4TR3 A;  4IP6 A;  4L0W A;  1A0R P;  3BD2 A;  3HXS A;  5HR0 A;  4OFN A;  2V6O A;  4D73 A;  1FO5 A;  1ZMA A;  3LGC A;  1GSD A;  3WD6 A;  2PMT A;  2AUV A;  2JZT A;  3VUR A;  2JSZ A;  1G7E A;  13GS A;  4ULX A; 
#chains in the Genus database with same CATH homology
 2HSN B;  2J23 A;  3GFK A;  2CA8 A;  3H93 A;  3ZIV A;  3F0I A;  4WKW A;  1AC1 A;  4HU9 A;  4POM A;  3A3T A;  4ZL8 A;  4HJ2 A;  5ECI B;  3GN3 A;  3QOU A;  2JAC A;  5ECO B;  4OMV A;  1M9B A;  3VI5 A;  1PN9 A;  1BAY A;  2FA8 A;  1GRX A;  1O8W A;  3KEB A;  4Q5N A;  1S3C A;  4AKI A;  4HZ4 A;  3IRA A;  1DE2 A;  3MDK A;  4KX4 A;  4K2X A;  1M0U A;  1QXH A;  4PXO A;  2REM A;  1TOF A;  3F9U A;  3VFI A;  1BJX A;  4FQU A;  2YP6 A;  2B5X A;  2OAC A;  4V2L A;  2GZZ A;  1T4Z A;  2ZUP A;  2IMF A;  2HXK A;  4KCE A;  4L0U A;  2H1A A;  3VWX A;  1GP1 A;  4K6X A;  3J7Y b;  3H1N A;  2DMM A;  3GH9 A;  2KLX A;  1SK0 A;  1ERT A;  5CRD A;  1VF2 A;  4ZBB A;  1WMJ A;  3GMF A;  4WBJ A;  4OD7 A;  2H1B A;  1Q4J A;  1SKS B;  2B1K A;  2OA7 A;  5D93 A;  4GSS A;  5E4W A;  1K0C A;  1ZCP A;  4ZXG A;  4IW9 A;  2XBQ A;  5F8B A;  2O87 A;  2FGX A;  2O7K A;  3UMA A;  1DSB A;  2LRC A;  5AGY A;  4WF5 A;  5KN2 A;  1ZYE A;  4CY6 A;  5G1K A;  2IIY A;  2CZ3 A;  3VLN A;  2YJ7 A;  4Z2R A;  5GAN D;  4IKH A;  5IQY A;  5DAL A;  4EL1 A;  1RQM A;  4KH7 A;  3IOS A;  2VCZ A;  5AIS A;  2MBS A;  1YDK A;  3F3Q A;  5ID2 A;  3LOR A;  1M99 A;  1GL8 A;  20GS A;  1UA5 A;  4NAX A;  3ZFL A;  4BVY B;  4LA1 A;  2IMK A;  5CRG A;  1XPV A;  3CMI A;  1W89 A;  1JFU A;  2C3T A;  2ZNM A;  1SKW B;  3DGQ A;  5ECL B;  3FR3 A;  1AQX A;  3IR4 A;  1DE1 A;  4KDY A;  4H86 A;  1YVL A;  4GF0 A;  6GSV A;  1XVQ A;  1Z9H A;  4Q5F A;  3A2W A;  3TCO A;  4EF0 A;  4PNG A;  5DCH A;  3KMN A;  4HU7 A;  3MIX A;  2GT6 A;  3FMW A;  2LQO A;  1NW2 A;  1EEM A;  2XBI A;  5A4V A;  4MJB A;  3W6G A;  1B4Q A;  3GA4 A;  14GS A;  2D2Z A;  4X43 A;  3GH6 A;  2H01 A;  1ZOF A;  3DRN A;  4V2N A;  3VPQ A;  3G9B A;  1OKD A;  3C71 A;  2H76 A;  3CSI A;  3LW9 A;  1DBY A;  3L4N A;  3WYW A;  2WJU A;  5KOX A;  2GZY A;  2KOK A;  1EGR A;  6GST A;  2L6D A;  5DAK B;  1GNE A;  4MCU A;  3GL3 A;  1VRS D;  3ZZX A;  11GS A;  2HZF A;  5INY A;  2LNT A;  1TKD B;  3TUE A;  3GUR A;  3P90 A;  3EU4 A;  3ZTL A;  1MDJ A;  5ELG A;  2QC7 A;  1OC8 A;  6GSS A;  2IFQ A;  1PKW A;  2XC2 A;  4I2U A;  2DJ2 A;  4OO5 A;  5IMZ A;  2AHE A;  2AJQ B;  2H72 A;  2PVQ A;  1TDI A;  1YF1 A;  4HUA A;  4MPG A;  1SJ6 A;  2JU5 A;  2VCX A;  2B6M A;  5D9X A;  1K0M A;  1GSQ A;  2HRA A;  1WOU A;  3QFB C;  2VUP A;  1TK0 B;  5A34 A;  2FD3 A;  5AIX A;  2V41 A;  5AN1 A;  4HEA 2;  2PVO C;  3M9J A;  2G0F A;  3D22 A;  4ZB7 A;  2FWG A;  4ZL7 A;  2HSM B;  4WBR D;  4ZB8 A;  1GNW A;  3IXR A;  4O5Q A;  4FYC A;  2K6V A;  3FZ9 A;  1G6W A;  4EO3 A;  2OKA A;  5BMU B;  3F4R A;  1BQ7 A;  3U5R E;  5A4W A;  4G19 A;  4KND A;  1JLW A;  5IPG A;  4MLY A;  4TR1 B;  2V32 A;  2H75 A;  2KHP A;  4HDE A;  4Z2T A;  3ERF A;  2BMX A;  2FY6 A;  2E2M A;  5H5S A;  1THO A;  2O5V A;  1QMV A;  3TKP A;  1BYE A;  4K0G A;  2E7P A;  3V1W A;  1B4P A;  4QQ7 A;  2HRK A;  4KGI A;  5HR2 A;  2DBC A;  1V2A A;  3GTU A;  3KMO A;  1YKA A;  1UVZ A;  5J9B A;  4X0X A;  2YZH A;  1SL0 B;  4WXT A;  5EL8 A;  5IMA A;  2EFH A;  5CNW A;  1U3A A;  2HZE B;  2XPE A;  5G31 A;  3TJG A;  2CVD A;  2Z9S A;  1TK8 B;  1J9B A;  1KBN A;  1HNC A;  5J41 A;  5CRH A;  2WRT A;  2MZC A;  2OJL A;  3UBK A;  5DCG A;  3NIV A;  1GTB A;  2VCQ A;  2PER A;  2UZ8 A;  3IDV A;  1K0D A;  1OE7 A;  5D9V A;  3I69 A;  2X4A A;  3WGD A;  1Q98 A;  1TXU A;  2H1L A;  3UVH A;  2H74 A;  4AKH A;  2C80 A;  1TRS A;  3H4K A;  2GQL A;  3NOF A;  1QFN A;  22GS A;  2TRX A;  1R4W A;  2LJK A;  1A8L A;  4TRX A;  1B9X C;  2CV4 A;  4ZIJ A;  3L0H A;  4DEJ A;  5A1N A;  4G0I A;  3ZRD A;  4ECC A;  1V40 A;  5DQY A;  2YCD A;  5D96 A;  3KD0 A;  4IVF A;  4I6X A;  1YKC A;  1T3B A;  4KE3 A;  2EIR A;  4OFM A;  4ECI A;  2FWF A;  4OO4 A;  2EIO A;  1ACV A;  1S3A A;  3DIE A;  5DVB A;  5D9T A;  3ZMK A;  2HFD A;  1ILO A;  4V2M A;  2R4V A;  4TN8 A;  3KP9 A;  3GSS A;  1F6M C;  3KH7 A;  12GS A;  2WB9 A;  5H5Q A;  3RAZ A;  2YV7 A;  1EZK A;  4EVM A;  4IGJ A;  4LMV A;  10GS A;  2PBJ A;  1E2Y A;  1ZYQ B;  2VL9 A;  2PGT A;  5JCU A;  1OC9 B;  3QCP A;  3WGX A;  3VWU A;  4GWR A;  2GSR A;  4K5S A;  3FEU A;  5B6N A;  4PQ1 A;  3EMX A;  4CY8 A;  3Q74 A;  4POK A;  1PGT A;  4TXV A;  4MJC A;  1H75 A;  1K3L A;  2QGV A;  2N5A A;  3GYK A;  3FRC A;  5G1L A;  3TGZ A;  3QFA C;  3GHA A;  5CAX A;  2R6K A;  2ON7 A;  3KTL A;  1WP0 A;  1J08 A;  1TI3 A;  3O3T A;  4EKZ A;  4ZL9 A;  1THX A;  1SK2 A;  2GQM A;  1WRY A;  2H1G A;  4KDU A;  2LEG A;  3TOU A;  4KCA A;  1Z6N A;  2DC5 A;  5KEJ A;  1EOH A;  2FWE A;  5F0G A;  1PN0 A;  3PIN A;  4AKG A;  5JWR B;  1CQH A;  5IOX A;  4PX1 A;  3HA9 A;  4MPF A;  1XW9 A;  2O8V B;  1R5A A;  2R2J A;  1V57 A;  2X49 A;  3UAP A;  4JU5 A;  1I5G A;  4EIQ A;  3N5O A;  2L6C A;  1Y25 A;  2TRC P;  3D21 A;  3R2Q A;  4KSO A;  3HJO A;  1M7T A;  1DUG A;  1XVW A;  5F07 A;  4ZBA A;  4P3Y B;  1ABA A;  2CVK A;  2VL3 A;  3HJP A;  4ICY A;  4ML6 A;  4ISD A;  2V6K A;  4IHU A;  1GH2 A;  2LJR A;  4AI6 A;  4O7H A;  5GSS A;  1XOA A;  1T00 A;  1PSQ A;  5F06 A;  3IHG A;  2C8U A;  2OT3 A;  3DEX A;  3TKS A;  2HE3 A;  2F3M A;  4IS0 A;  3WT2 A;  2I1U A;  5A5H B;  3GKX A;  4KW6 A;  3BOA A;  3GST A;  1K0B A;  3M9K A;  2M80 A;  4KB3 A;  1GLP A;  3PPU A;  2XHF A;  2TIR A;  5C00 A;  1YEP A;  1QGV A;  4LL4 B;  1PQN A;  3VI7 A;  3A2X A;  3EPT A;  4BVY A;  3GRX A;  2P5R A;  4GDF A;  3LWA A;  4BL7 B;  4IBP A;  3LYP A;  4K0N A;  4WR4 A;  4MH2 A;  3FYG A;  2X8C A;  4Z7X A;  2I3Y A;  2A2R A;  1TRU A;  4FYU A;  5ENU A;  5DJM A;  3M8N A;  1JHB A;  4YAP A;  2R0C A;  1Z3E A;  2CT6 A;  4YAV A;  1X5E A;  1GTU A;  4F03 A;  1ZYP A;  5COH A;  4ILF A;  1A2J A;  4MAB A;  4OFT A;  1SD9 A;  4JBB A;  2NBS A;  5DDL A;  3EE2 A;  1JZO A;  4K7N A;  3TJB A;  3HDC A;  8GSS A;  1UC7 A;  2DSA A;  3MYD A;  1A2M A;  3GIX A;  4FYB A;  1GSE A;  3PGT A;  2EIQ A;  4IJI A;  3HHV A;  3GL5 A;  1TTZ A;  1BX9 A;  5DAK A;  4GSN A;  1GSF A;  4PQH A;  3IBH A;  2B5Y A;  1WE0 A;  4GST A;  1SJI A;  2NTO A;  1BF5 A;  2HI7 A;  1FHE A;  3C7M A;  2GLR A;  4F0C A;  4AJ8 A;  4BVX B;  4NXI A;  5HR1 A;  1X9M B;  3UOM A;  1TRV A;  4D73 B;  3SWL A;  2WDU A;  4LMW A;  1K0A A;  1W4V A;  5IMV A;  2H19 A;  5B8A A;  2WZ9 A;  3D0Z A;  4MZW A;  4TR4 A;  2QSI A;  2EFD A;  3HMJ G;  4MNN A;  2DJK A;  1XWA A;  2GS3 A;  2DKI A;  5CRW A;  2EC4 A;  3N9J A;  2HSM A;  3GUS A;  3K8N A;  1USB A;  3S9F A;  3UBL A;  3I43 A;  2GZP A;  4YQM A;  5G5E A;  1PX6 A;  1EGO A;  4RQX A;  2C3Q A;  2FLS A;  5ECN B;  3BCI A;  2C4J A;  2RUE A;  2HSY A;  4QMK A;  2PN8 A;  3L9S A;  1TK5 B;  4TR1 A;  3EVI A;  3KZQ A;  1OVN A;  3IAS 2;  1SYR A;  3U6V A;  4DSS A;  1ZYN A;  2DJ1 A;  2RLI A;  3IK9 A;  6GSY A;  4RQR A;  3IAM 2;  1GUM A;  2H8L A;  5J47 A;  2MMO A;  1YEX A;  1N25 A;  1B48 A;  2QA2 A;  2H0G A;  1XWC A;  1RW1 A;  9GSS A;  4E68 A;  3QPM A;  2M46 A;  3L78 A;  4RI6 A;  3CSJ A;  2DIZ A;  4K1F A;  2VIM A;  3RHB A;  4WR5 A;  4G0L A;  5D8I A;  4GQF A;  4ECJ A;  4Q5Q A;  18GS A;  2YWN A;  1KEB A;  3C1S A;  4RUV A;  2YPM A;  2YN1 A;  5C04 A;  4I8B A;  4NHZ A;  1Z5Y E;  1E6B A;  5DAL B;  2RM5 A;  4ZBD A;  3ERW A;  1R26 A;  3PR8 A;  2LS5 A;  3KXO A;  2YAN A;  6GSW A;  1FB6 A;  3E9J B;  2C0D A;  4J57 E;  2A2P A;  1FB0 A;  1SKR B;  1O81 A;  1U87 A;  3ZVJ A;  5G5F A;  2R37 A;  1XFL A;  1IYI A;  4N11 A;  4EIP A;  2LQQ A;  5J4V A;  6GSX A;  1T1V A;  4JE1 A;  1GTA A;  2V2G A;  4AF2 A;  5JWO B;  1OE8 A;  2L59 A;  3HD5 A;  5EVO A;  1F37 A;  4XTS A;  2O89 A;  3TB2 A;  1ZZY A;  3M1G A;  1X9W B;  5FHI A;  1EV4 A;  4AJ7 A;  1Y1U A;  3W8J A;  4TXO B;  3CTF A;  4YH2 A;  2PPT A;  4JR6 A;  2F8F A;  1FAA A;  4DVC A;  1A0F A;  3QAV A;  1A8Y A;  2GGT A;  2VL2 A;  2CX4 A;  4MF6 A;  2YNX A;  2CVB A;  4O5U A;  2A4V A;  3LQ7 A;  4I97 A;  1GSU A;  2LKU A;  4Q5R A;  1KTE A;  2LST A;  1F3B A;  4N0V A;  4X4J A;  1X9S B;  3LG6 A;  1V58 A;  4EDZ A;  4NWY A;  1XIY A;  4TOP A;  1OC9 A;  2R5G A;  4N3Z A;  1PA3 A;  4N0Z A;  2B7K A;  1PD2 1;  3JCM L;  4MF5 A;  4F2I A;  2JAD A;  5IPH A;  5ABR A;  1QQ2 A;  3AY8 A;  1M2D A;  5JWQ B;  2CAQ A;  2L4Q A;  5G30 A;  4L5O A;  4JZQ A;  3C8E A;  1UN2 A;  3CRU A;  3FHK A;  1U3I A;  1HD2 A;  2NVL A;  4JRR A;  2IFQ B;  3MNG A;  1SYX A;  7GSS A;  2H0H A;  2F9S A;  1V98 A;  3O6T A;  4ZB9 A;  2G2Q A;  3ME7 A;  1CQG A;  2K8V A;  3F6D A;  5CYY A;  4KDX A;  1F3A A;  4MJE A;  1A24 A;  3ZFB A;  1N8J A;  2HYX A;  2HNL A;  3APO A;  3MSZ A;  4HQZ A;  5LNK e;  1JLV A;  5CRE A;  3HJM A;  3FZ5 A;  2AYT A;  5HFI A;  2PU9 C;  2X8H A;  3UIW A;  3FR9 A;  4O32 A;  2FWH A;  1FVK A;  4KF9 A;  2VM2 A;  5CP1 A;  3TJF A;  2L57 A;  2LUS A;  4IQ1 A;  4F0B A;  3IC8 A;  3F63 A;  2R0P A;  1TW9 A;  4G10 A;  3H79 A;  3F4T A;  4G9H A;  2NPB A;  5D73 A;  4F9Z A;  5GZZ B;  1SEN A;  1AQW A;  1ON4 A;  1X5C A;  4N30 A;  4K2D A;  4HZ2 A;  1XXU A;  3TJJ A;  5JCW A;  5IO2 A;  2HSN A;  3F8U A;  1Z7R A;  1BED A;  4XS4 B;  3MAK A;  2V1M A;  3FY7 A;  4GLT A;  3DD3 A;  5ECP B;  2K8S A;  1O85 A;  2DJ3 A;  3H8Q A;  5ECK B;  1JZD A;  3E3E A;  1F2E A;  2N5B A;  4CW9 A;  3NZN A;  2VM1 A;  4LLR A;  1H4O A;  5HQP A;  3LJR A;  2A4H A;  4YQU A;  3HZ4 A;  1N2A A;  3KGK A;  4BL7 A;  2GVP A;  4A5P A;  1LJR A;  3LXT A;  2IME A;  1Z6M A;  1PMT A;  4V1A g;  1X5D A;  2O85 A;  1SD8 A;  3HVS A;  19GS A;  5FT3 A;  4JED A;  4MA9 A;  3UAR A;  1GLQ A;  1MEK A;  2OBK A;  5IMF A;  5KN3 A;  4MP4 A;  3PH9 A;  5ECR B;  1ZL9 A;  5B6M A;  2H71 A;  3KTB A;  1YJ6 A;  3GKK A;  4WET A;  4ID0 A;  4IJ3 A;  2VLU A;  1RK4 A;  3BCK A;  3G7Y A;  1O73 A;  2LTK A;  4NV5 A;  1O6J A;  2H6X A;  3RPP A;  2VLV A;  3GX0 A;  1R7H A;  4PUF C;  3BJ5 A;  1GTI A;  1B8X A;  2B7J A;  1T4Y A;  5A1N B;  2RII A;  1XBS A;  3IV4 A;  2YWO A;  2VCV A;  3HVV A;  5IOW A;  2GDR A;  1HNB A;  1TU7 A;  3VPT A;  1X0R A;  2HSH A;  4AJ6 A;  2M72 A;  2QKE A;  1AIU A;  1OC3 A;  4O5R A;  1NSW A;  2GTU A;  2VO4 A;  4HJM A;  2H1D A;  2EFE A;  1URM A;  1YZX A;  3HCZ A;  5ECS A;  1BG5 A;  4F82 A;  5J5N A;  3TOT A;  4AGS A;  2DKH A;  5J9C A;  2CX3 A;  5HR3 A;  4BVX A;  3C1R A;  3US3 A;  2P5Q A;  1QK8 A;  4POL A;  4OWY A;  5HFG A;  1TU8 A;  1TRW A;  5G2Z A;  5L71 A;  3D4T A;  5DQS A;  2IWT A;  3P2A A;  2L5L A;  3IHQ A;  2N5F A;  3IPZ A;  2FUG 2;  3QAG A;  4MJA A;  2H66 A;  2NDO A;  2VAF A;  4I5Q A;  5GAP D;  3I9V 2;  1SL2 B;  5F05 A;  5DBQ A;  2R3X A;  4YQV A;  2F8A A;  3QR6 A;  3DYR A;  5KN0 A;  2YV9 A;  4GCI A;  4O92 A;  3KJY A;  2DML A;  2HRF A;  1XWK A;  1EV9 A;  2AB6 A;  3DXB A;  2ALB A;  5IM9 A;  4JR4 A;  1XOB A;  1QUW A;  2H0I A;  5AIV A;  3GNJ A;  2B3S A;  1YY7 A;  1ST9 A;  1OYJ A;  3L9V A;  4MMM A;  3FZA A;  3ME8 A;  2IN3 A;  4YKG A;  2HT9 A;  3ZLP A;  3UJ1 A;  2YJH A;  4IP1 A;  4ZB6 A;  4HQS A;  2JL4 A;  2IMI A;  3EMP A;  1Z7P A;  1LU4 A;  3D6I A;  1ERU A;  1SJZ A;  1K0N A;  3SBC A;  4KUN A;  4MZC A;  2C1Y A;  1GSY A;  5ECH B;  1HNA A;  2QA1 A;  4K8M A;  2OBI A;  1VF1 A;  4NV2 A;  3QD9 A;  1YQ1 A;  3KH9 A;  4MDC A;  2IJY A;  2MMZ A;  1MD3 A;  2FCH A;  2HRN A;  2KP1 A;  2YWM A;  1EOG A;  1K3Y A;  3TKS C;  3FR6 A;  3CYN A;  3GKM A;  2OE0 A;  1AXD A;  3A5W A;  3D5J A;  2XPD A;  4E8E A;  4DSQ A;  3CTG A;  1IYH A;  4L5L A;  1SVM A;  3HYP A;  1SVO A;  1A2L A;  1XW6 A;  5ECQ B;  4N10 A;  5CO3 A;  3TRX A;  3GKN A;  1MTC A;  4XHM A;  2H73 A;  3CRT A;  2PUK C;  5J40 A;  3WGE A;  1GWC A;  4ZIL A;  1GSS A;  1FG4 A;  3FW2 A;  1TJD A;  4MF7 A;  1AW9 A;  4K7O A;  1K0O A;  4CDO A;  1TI1 A;  5BMU A;  3DKS A;  2BTO T;  4TXO A;  2ES7 A;  3F3R A;  4ECB A;  5JCG A;  2H6Y A;  2E2G A;  3DVX A;  5H5R A;  4MK3 A;  2GST A;  16GS A;  4Z2U A;  2H30 A;  2L4C A;  4J2F A;  2WUL A;  3J7Y k;  4USS A;  4PUR A;  4FO5 A;  4GQC A;  1XCC A;  4EXJ A;  1XZO A;  3DVW A;  3EU3 A;  4ML1 A;  4KAE A;  1O8X A;  2HLS A;  4KA0 A;  3KP8 A;  1PX7 A;  2VOC A;  3Q18 A;  4L8E A;  2K18 A;  2VCT A;  1F9M A;  3ERG A;  3GX8 A;  1V9W A;  4V1A p;  4NHW A;  4XS6 A;  3HY2 A;  3DML A;  4RI7 A;  1HYU A;  1NHO A;  3RBT A;  3IE3 A;  3WT1 A;  3F4S A;  2VD1 A;  2IPA A;  3KM6 A;  2HZE A;  3ZIT A;  3QAW A;  1SVL A;  3CBU A;  2H6Z A;  4J56 E;  4K7I A;  1U88 A;  2CAI A;  3W8S A;  1SU9 A;  4BA7 A;  2RUF A;  3A5I A;  3APQ A;  3EIN A;  4KSM A;  1AQV A;  2YOI A;  3VWV A;  3DWV A;  3TKQ A;  1R5P A;  3UL3 A;  1M2B A;  4XCS A;  4EC0 A;  2C0E A;  3M0F A;  2CZ2 A;  1PKZ A;  5KN1 A;  3P7X A;  1Y6E A;  3EYT A;  2AV4 A;  3A2V A;  4ACS A;  3D4M A;  3OR5 A;  4K5R A;  5ID2 B;  1SK1 A;  2MYG A;  3CSH A;  2L5O A;  1PRX A;  2PWJ A;  1PL1 A;  4TKY A;  2A2S A;  4QL9 A;  2OE1 A;  2F51 A;  1VF3 A;  1EWX A;  3TKR A;  2LRN A;  1MDI A;  4X1U A;  3LFL A;  4NMU A;  4EDY A;  3O76 A;  1OAZ A;  4K9Z A;  2GSQ A;  3LYK A;  2K9F A;  2LNS A;  4XS1 A;  3FK8 A;  5J4U A;  4TVE A;  2GT5 A;  3HVX A;  1XWG A;  1T8E B;  3GV1 A;  1MDK A;  1O7U A;  2VKZ G;  3EUR A;  2WFC A;  4BPY A;  2MBT A;  4CHS A;  4IN0 A;  1WJK A;  2VLT A;  3EWL A;  1BG1 A;  1KNG A;  3VK9 A;  4PUA A;  3QMX A;  4DSS B;  5EPF A;  1FOV A;  5LCZ A;  2P31 A;  2VD0 A;  2YWI A;  1GUK A;  3ZRE A;  4PGT A;  1EP7 A;  4XS4 A;  2DLX A;  5A5K A;  5J3R A;  1WIK A;  2FA4 A;  1SL1 B;  5B7C A;  2X8G A;  4FH8 A;  3UEM A;  2HQT A;  3FZ4 A;  1FW1 A;  4GRF A;  1ERW A;  3LXZ A;  2J9H A;  4OCF A;  2JSY A;  5ECM B;  4EE0 A;  1OKT A;  5LD0 A;  2UV8 G;  5KOW A;  3ZIJ A;  4G0K A;  3E0U A;  3IK7 A;  2C0G A;  5EY6 A;  5J4Y A;  1I9D A;  2OE3 A;  2WGR A;  3QDN A;  1ERV A;  4BWQ A;  5A4U A;  2E0Q A;  3CXG A;  2DJJ A;  3EC3 A;  2LRT A;  4WEY A;  5A34 B;  4HI7 A;  5IO0 A;  3C73 A;  6GSU A;  1G0T A;  3APS A;  3L9U A;  1GUL A;  1B9Y C;  2DJ0 A;  4HS1 A;  1LBK A;  1WWJ A;  1FVJ A;  2IL3 A;  3TDG A;  1EP8 A;  1K3O A;  5E59 A;  2GSS A;  1C72 A;  3FKF A;  4LL1 B;  3KIJ A;  3CWG A;  2KP2 A;  2FNO A;  5IIZ A;  3F6F A;  1G6Y A;  1T7P B;  2ON5 A;  2CQ9 A;  3ED3 A;  2X64 A;  1YF0 A;  4TW5 A;  2BJX A;  2MMA A;  2ZCT A;  4XRA A;  1AUC A;  4YKF A;  3RDW A;  3R3E A;  3ZML A;  2VL2 C;  4W66 A;  5A5H A;  2WS2 A;  4POB A;  2R0G A;  2GQK A;  3ZVJ D;  5B8B A;  2I4A A;  3G7I A;  2HRK B;  1NHY A;  1XWB A;  1HQO A;  1U6T A;  3KCM A;  3IC4 A;  3GTU B;  4IQA A;  4G01 A;  2YZU A;  5GST A;  1WPI A;  3P8W A;  2JZS A;  3UVT A;  5DJL A;  5IMD A;  3Q19 A;  2EFC A;  2X99 A;  2I81 A;  5IMC A;  1S3D A;  3I6A A;  2WCI A;  3G7J A;  2C3N A;  3TU3 B;  3HKR A;  2OAD A;  1M9A A;  2IMD A;  3RHC A;  3ISO A;  1A23 A;  3RPN A;  2I9H A;  4I2T A;  1GUH A;  3IA1 A;  1XW5 A;  5D9W A;  2JZR A;  2KUC A;  4NPB A;  3VWW A;  4BWS A;  2LJA A;  2AAW A;  2B1L A;  4PNF A;  2DIY A;  1VF4 A;  3ZL5 A;  4DSR A;  1VGL A;  4PQI A;  3MWH A;  4GXZ A;  1NM3 A;  2FHE A;  4MZB A;  17GS A;  4WF4 A;  3LSZ A;  3M3M A;  3TRP A;  3BBY A;  4G2E A;  2B5E A;  4FIW A;  1PL2 A;  4AKX B;  1ZGN A;  1TXX A;  4QL7 A;  4OCE A;  4E8H A;  2MMN A;  3TJK A;  4IEL A;  4MH3 A;  3TKS E;  4TR0 A;  2LV3 A;  4EUY A;  1TP9 A;  3LEF A;  1AAZ A;  2P0G A;  3TRQ A;  5FWG A;  1ML6 A;  2H70 A;  2C0F A;  4XIH A;  5BRT A;  3ZYW A;  4HOJ A;  5HFK A;  1FOH A;  5ELA A;  1G7O A;  1JZW A;  2VCW A;  1J0F A;  3Q6O A;  4XRD A;  4PTS A;  1EEJ A;  1MD4 A;  1M2A A;  3HZ8 A;  4GTU A;  2RM6 A;  1JZR A;  4TR3 A;  4IP6 A;  4L0W A;  1A0R P;  3BD2 A;  3HXS A;  5HR0 A;  4OFN A;  2V6O A;  4D73 A;  1FO5 A;  1ZMA A;  3LGC A;  1GSD A;  3WD6 A;  2PMT A;  2AUV A;  2JZT A;  3VUR A;  2JSZ A;  1G7E A;  13GS A;  4ULX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...