1K0NA

Chloride intracellular channel 1 (clic1) complexed with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
226
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORIDE INTRACELLULAR CHANNEL PROTEIN 1
publication title Crystal structure of a soluble form of the intracellular chloride ion channel CLIC1 (NCC27) at 1.4-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 76
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1k0nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1k0nA01
1XOBA 1I9DA 3F63A 3Q19A 3LXZA 3KJYA 3VURA 1X9WB 5J9CA 2C3TA 4DSQA 2REMA 1M9AA 3LJRA 3GTUA 4Q5RA 4WEYA 4PUFC 2V2GA 2N5FA 4JZQA 3VI5A 2M80A 3TRQA 4ZXGA 4BL7A 2HZFA 4HZ4A 1RW1A 2JADA 2FWHA 5IOWA 4N10A 1ZGNA 5DQSA 3TKSE 2K8SA 4TKYA 3E0UA 1EZKA 8GSSA 2H66A 4HI7A 4MK3A 5JWQB 5CREA 4IVFA 2O8VB 2GSSA 2VL2C 3TKSC 2VM2A 4POMA 2AV4A 1XWGA 3IBHA 2K9FA 4FYCA 5DJMA 2TIRA 1QUWA 4PTSA 1A0FA 4TXOA 2WDUA 1GL8A 1GP1A 3IHQA 3CBUA 5ECIB 2K8VA 2VUPA 2DJJA 1THXA 1CQHA 4MZBA 4K6XA 1Z7RA 1NSWA 2B1LA 2QGVA 1V58A 4WR4A 1XWBA 1EV4A 4FIWA 1G7OA 2DJKA 1SKSB 4AJ7A 4CW9A 1A0RP 2R2JA 4LL4B 1GSSA 5G5EA 1SL1B 1C72A 1SYRA 3DXBA 3ZYWA 4PNFA 2NTOA 1AC1A 1GTIA 2V41A 2YJ7A 5EY6A 4TR4A 3F8UA 1WJKA 2IMIA 4GF0A 1TW9A 4PXOA 3C71A 4ECCA 2YCDA 4I2UA 4XS1A 2IN3A 2JSYA 5LNKe 2LV3A 4MPGA 4G0KA 4OMVA 1TRVA 1WE0A 3FZ4A 1F3BA 1NHOA 2DSAA 1OKDA 2WULA 4N0ZA 1K0DA 1PKWA 1MTCA 3ZTLA 4MP4A 1S3CA 3FW2A 1SENA 5DVBA 1A2MA 4H86A 3D5JA 1XVQA 3LORA 4F9ZA 3IAS2 1U87A 3TKRA 2HI7A 1G6YA 2MYGA 2VCQA 1Q4JA 3DIEA 4EVMA 5DCGA 3KMOA 4KUNA 3RAZA 3FYGA 4V1Ap 5ECOB 3BCKA 4KCEA 1GTUA 2H8LA 1KBNA 3UAPA 1EP7A 1PA3A 5KN2A 1O6JA 2V32A 1WRYA 1EV9A 1EEJA 2VCZA 1ERTA 2ZCTA 4USSA 2PGTA 1T3BA 1TDIA 1FVKA 1SKWB 3HXSA 14GSA 2CT6A 5IO0A 2YJHA 1K0NA 3HZ8A 3ZL5A 4GTUA 3GH6A 2XPDA 5D8IA 1B4PA 3D4TA 4FQUA 2E7PA 4ZBBA 3LXTA 2LJRA 2X8HA 4MA9A 3ZMLA 2X8GA 1M7TA 3KMNA 1U88A 3SWLA 3HKRA 2FY6A 1M9BA 2AYTA 4KGIA 1GUMA 1FAAA 4NHZA 3KP8A 3M3MA 2VM1A 4ZL7A 3MSZA 1G6WA 4JR4A 2IJYA 2VCWA 4KNDA 4WKWA 3HJMA 2LUSA 2A2SA 2GLRA 3KGKA 1ZMAA 2RM6A 4AJ8A 4MZCA 1TRSA 4K7NA 2B5EA 1PD21 3K8NA 1VF1A 3UL3A 4FO5A 3FR3A 3IE3A 3UMAA 12GSA 4PX1A 5ID2B 4PQIA 2P5RA 3KTLA 3A3TA 2NPBA 1TRUA 2P31A 3KTBA 2V1MA 4ZB8A 4ACSA 1YDKA 1LBKA 1J08A 4OO5A 1KTEA 5HR0A 1YQ1A 5KN3A 1XFLA 1XWKA 2C3QA 3DD3A 4NV5A 5IMCA 3U5RE 4BVYB 3QAWA 1H75A 2WB9A 3TRPA 1XBSA 1O8XA 2KP2A 2PPTA 1S3DA 4MJAA 1M2DA 5IMDA 2DLXA 3D21A 2PN8A 1GSYA 2PVOC 4HU9A 5HR1A 3LYKA 4OCEA 5JCWA 2L4CA 4HZ2A 4I5QA 3VWUA 4MMMA 1XW5A 1ZL9A 2GQLA 2PVQA 3P7XA 2G2QA 4IS0A 4K7IA 2H30A 2EIOA 4EDYA 5IMAA 2OE1A 1BEDA 5ECPB 4HOJA 1UN2A 2BJXA 2H73A 1XXUA 2TRXA 5HR3A 3W8SA 2HRNA 1WP0A 5ECSA 3DVWA 2HT9A 5ID2A 1A8YA 1QFNA 5ECLB 1MDIA 2KHPA 2J23A 16GSA 2GT5A 4MF5A 3N5OA 2IMFA 6GSYA 4GSNA 2LRNA 1T00A 3FK8A 5DALB 1UVZA 2JACA 1AW9A 2D2ZA 4F2IA 4JU5A 3UBLA 1K3YA 5D9WA 4O7HA 2IIYA 1K0OA 1OE7A 1PSQA 4BVYA 2YWIA 4TRXA 3KM6A 2H6XA 4BWQA 1TRWA 2YWMA 1X0RA 5A4WA 3F9UA 4BPYA 2EC4A 4YQVA 2O87A 2LKUA 3HJOA 5CRGA 5IMZA 2CVBA 3CRUA 3FRCA 4XRDA 1DE1A 1T1VA 2ON5A 4QL7A 4I6XA 3VWVA 2X8CA 1QK8A 2H6ZA 2DJ1A 2CVKA 4G10A 3I69A 2BMXA 4O5RA 1AIUA 3RHBA 5IQYA 2BTOT 2VIMA 3PR8A 2L59A 3GKNA 2VAFA 3EWLA 4NAXA 1SL2B 1XPVA 2QC7A 1UA5A 1A2JA 1R5PA 1J9BA 3PINA 2RLIA 4ZL8A 5F06A 3D22A 3ED3A 1WIKA 4RUVA 3ZFBA 4HU7A 3TKQA 4KA0A 1TOFA 3BOAA 4MF6A 2ALBA 3TJJA 1PKZA 3D0ZA 5DALA 2CA8A 3O76A 3KD0A 1TI3A 2RUEA 4YQUA 4DSRA 3QAGA 1FVJA 3EYTA 3C73A 4DSSB 3LGCA 2GQMA 5CO3A 4IGJA 4L0WA 1OKTA 2O85A 3MWHA 1LU4A 4XCSA 3WT2A 2RUFA 2L57A 2WFCA 1ERVA 4K0GA 4OCFA 2UZ8A 1GH2A 4EL1A 3VPTA 2VO4A 1TKDB 4Z7XA 5G1LA 1X5EA 3FKFA 2ES7A 2LEGA 1X5DA 1FOVA 3NOFA 1OE8A 3QMXA 1ST9A 2H71A 1O73A 2GZZA 3TOUA 1OC8A 5HQPA 9GSSA 5D9XA 3NIVA 4ECBA 2DBCA 1XCCA 1PL1A 6GSTA 1W4VA 4HJ2A 3KZQA 22GSA 2FA4A 1YKAA 2LRTA 13GSA 3F6DA 4HEA2 2FCHA 1YKCA 3APQA 4KX4A 5A4VA 1SK0A 2CAIA 3QOUA 4X1UA 2B1KA 3L9SA 4CDOA 2HRKB 4G19A 1XWCA 2C80A 2WZ9A 1Z7PA 2YWOA 1N8JA 3ZREA 3HYPA 6GSSA 3US3A 3TOTA 4HQSA 2O89A 2RIIA 2VOCA 1Z6MA 1R26A 3F4TA 3HDCA 3VFIA 5F05A 1BJXA 4F03A 2K18A 1JZDA 4DVCA 2NVLA 1UC7A 4IJ3A 2MMAA 3QCPA 4YAVA 2X64A 2YWNA 2GSTA 4TOPA 1GTBA 5CP1A 3VK9A 5JWRB 3UOMA 1ERWA 3ZLPA 5E4WA 4WF4A 2FA8A 3LG6A 2F9SA 5B6NA 5DBQA 4WBJA 3CSIA 4NXIA 3H8QA 4ILFA 1N2AA 1XOAA 5A4UA 2HSNB 5E59A 1MEKA 1GLQA 3FR6A 1TJDA 2LSTA 1QXHA 3VWXA 2CVDA 1SKRB 3M0FA 1T8EB 4YH2A 2H1AA 2FLSA 2C3NA 4GSSA 2XHFA 2F8AA 4AGSA 1K0MA 3CTGA 4HDEA 3FY7A 2G0FA 5HFIA 3H93A 1XVWA 2HRKA 3I6AA 1X9SB 1W89A 5GSTA 2VD1A 2VCXA 3GNJA 3ME8A 5H5SA 2HNLA 2AHEA 4ZB9A 3ZVJA 2LNSA 4MCUA 1FHEA 2IL3A 1GUKA 4KH7A 2LTKA 5J3RA 2E2GA 20GSA 5FWGA 3L9UA 4EO3A 1SJ6A 2LRCA 4V2NA 3L78A 3GA4A 3FZ5A 5DQYA 5DJLA 4WF5A 2HZEB 2H72A 1GWCA 4GWRA 3EINA 1GNEA 4IP1A 3P8WA 4K0NA 2CAQA 3E9JB 4KSOA 2K6VA 5JCUA 4JEDA 1NW2A 1SU9A 2IMEA 4I97A 2LJAA 2WCIA 2ZUPA 3O3TA 1QMVA 1AAZA 1A24A 7GSSA 3FHKA 3DEXA 1USBA 3Q6OA 3LEFA 4G0IA 1GNWA 4KDXA 1K0CA 3ZVJD 1DBYA 3GHAA 5D9TA 4EC0A 2VL2A 3TKSA 2OBIA 3EU4A 1Z5YE 5A5KA 3GKXA 3PH9A 2GVPA 1CQGA 1XWAA 2C1YA 2HSYA 1YY7A 3GMFA 1MDKA 1K3OA 1ILOA 4ML1A 3GX0A 4IBPA 1SJIA 3IPZA 1THOA 2WS2A 2GZPA 2WRTA 3F4SA 2WGRA 3IAM2 3DGQA 3MDKA 3PPUA 1V98A 5JCGA 3RPNA 3TJGA 2OKAA 3L0HA 3ZIVA 5CRWA 3C8EA 1PX6A 2H70A 2VLVA 2LNTA 2HZEA 1V2AA 1SJZA 2R3XA 4OFMA 4WXTA 2WJUA 3EU3A 3VWWA 1BQ7A 4GLTA 2JZTA 4MDCA 3IRAA 1EEMA 1EOHA 2HQTA 5IPGA 3ZITA 2OBKA 3VPQA 3CMIA 4N30A 2C0DA 2F8FA 1JLVA 1VF2A 5J5NA 4QQ7A 2QSIA 3EC3A 2HFDA 3LYPA 2JZSA 4BVXB 3ZIJA 3IC4A 4FYBA 2R37A 4EF0A 2JSZA 1M0UA 4TN8A 3GSTA 3GRXA 6GSWA 3BCIA 5CYYA 4IW9A 5EPFA 1Y25A 5G5FA 4JR6A 3S9FA 4KE3A 2FGXA 3G9BA 3W6GA 2YZUA 4L5LA 4KSMA 2HSHA 1G7EA 1ZOFA 4MABA 3CYNA 1XZOA 4ID0A 3WGDA 2B3SA 4LA1A 5FT3A 2H01A 1VRSD 4ZB6A 3OR5A 2E0QA 1O8WA 5ECKB 4P3YB 2YZHA 1FO5A 1SYXA 3TGZA 2H1GA 2FUG2 2L5OA 3HZ4A 1VF4A 1TK8B 1GLPA 3HJPA 5B8AA 3VLNA 2GGTA 1KEBA 3EE2A 3G7IA 4EE0A 3IR4A 1IYIA 1AQVA 2N5AA 2H0HA 4XIHA 4NHWA 2E2MA 1A8LA 1HNCA 1Z3EA 1ZZYA 2L6DA 2MMZA 1JLWA 4F82A 4L0UA 1GSDA 3KEBA 3J7Yb 1WMJA 1YJ6A 4BVXA 1YF0A 3TB2A 1WOUA 3TUEA 2I1UA 3IXRA 4XRAA 5GAPD 5COHA 2YPMA 3IV4A 2CV4A 5HR2A 3A2WA 4O32A 3EURA 3AY8A 1B8XA 4K8MA 3ERFA 4D73B 5EVOA 2IMKA 1F9MA 1HD2A 1DUGA 1Y6EA 1EP8A 3QDNA 2YN1A 1EGRA 5ELGA 4MH3A 3A2XA 5ECNB 1ML6A 1PGTA 3V1WA 18GSA 2M72A 2O7KA 3EMXA 3H79A 3EMPA 5G31A 1GSQA 3GURA 5J9BA 3CSJA 3MAKA 1SK1A 4WBRD 2FHEA 3WD6A 4TW5A 2H6YA 3Q18A 2I9HA 4AJ6A 1B48A 1DE2A 2IWTA 4Q5NA 4WR5A 4I2TA 4WETA 4ULXA 2B7JA 1URMA 2KLXA 3QFAC 4KCAA 1XIYA 2PBJA 3I43A 2OE3A 4GXZA 3GTUB 5CAXA 3FZ9A 1PMTA 1HNBA 5GSSA 1YZXA 3QR6A 1I5GA 1V9WA 2XBQA 1JHBA 2J9HA 4IELA 1R7HA 1AUCA 2H0IA 17GSA 5IOXA 4BL7B 3DVXA 3IA1A 1SL0B 4IN0A 1TK5B 3HVXA 1O7UA 3C7MA 2M46A 4NV2A 1K0AA 1PRXA 3I9V2 2B6MA 3HHVA 2MBTA 4MJBA 4YQMA 5L71A 3H1NA 1TTZA 2C8UA 4D73A 3F6FA 2PUKC 2CZ3A 5EL8A 1TP9A 3QFBC 1O85A 4L5OA 2B5YA 3UARA 4LLRA 2GDRA 5HFKA 1QGVA 2AUVA 1T7PB 4IP6A 3E3EA 2A4VA 1EOGA 4K9ZA 5IMFA 3FR9A 5ABRA 5D73A 3ME7A 3RDWA 2VD0A 1XW6A 1PL2A 4MF7A 2CX4A 1U3IA 5KEJA 4TVEA 2RM5A 2KUCA 1WWJA 5DCHA 4XS6A 2DMMA 1TU8A 2EIQA 2OACA 3EVIA 4AF2A 2NBSA 2C0FA 2ZNMA 5IMVA 4OD7A 2R6KA 3VI7A 4ISDA 1R4WA 5KN1A 2YV7A 2C4JA 2QKEA 4MJCA 3H4KA 5AN1A 2GS3A 1F37A 1K0BA 1E2YA 1ZCPA 1PN9A 5GZZB 1T4YA 4PNGA 3M1GA 1JZOA 2OE0A 3BBYA 4BWSA 4PQ1A 2FWGA 2DMLA 4OO4A 2PERA 4N0VA 3PGTA 1V57A 5G30A 3F0IA 1A23A 2H0GA 3GV1A 1H4OA 3CXGA 4DSSA 3APSA 3QD9A 5ECQB 5B7CA 2GZYA 1QQ2A 2OJLA 5G2ZA 4V2LA 1NM3A 1ZYQB 1B9XC 4OFNA 2C0GA 4Q5FA 3G7YA 3HVSA 2DJ2A 1GSFA 2VLUA 1FG4A 10GSA 3W8JA 1X9MB 2XBIA 5HFGA 3ZMKA 2FWEA 1ACVA 4FH8A 5CRHA 2DJ0A 5AGYA 2JU5A 4KDYA 1KNGA 1S3AA 1PX7A 3ISOA 2P0GA 2IMDA 3KH9A 2VCVA 4J56E 3MNGA 3O6TA 3JCML 4ZL9A 4MH2A 2Z9SA 1F3AA 1HNAA 2HRAA 5LCZA 6GSXA 4J57E 2MZCA 1B4QA 2I3YA 3LQ7A 4GRFA 1T4ZA 3FEUA 3GL3A 1M2AA 3CTFA 5J41A 5C04A 4NMUA 1WPIA 2H74A 4ZBDA 1B9YC 3P90A 3RBTA 5D96A 1J0FA 2HE3A 1JZRA 1RK4A 3HA9A 1RQMA 3APOA 5H5RA 1R5AA 3D6IA 1IYHA 3A5WA 4J2FA 3DMLA 3GSSA 1GSEA 1FW1A 4Q5QA 3RPPA 2TRCP 3WGEA 1ON4A 1X5CA 2C0EA 2L4QA 4GQCA 4YAPA 3F4RA 2V6KA 3UVTA 4OWYA 11GSA 2HRFA 5C00A 2VL3A 3TDGA 3WGXA 5BMUA 1AQWA 2GSQA 1M2BA 3WYWA 4E8HA 3UIWA 2PU9C 1GULA 3KP9A 2L5LA 1F2EA 4ECIA 1HYUA 5F07A 4IQ1A 2FNOA 1SD8A 4XS4B 1NHYA 2LQQA 3ZFLA 2FWFA 4KAEA 1MD4A 2GT6A 2EIRA 2H1DA 4EXJA 2IFQB 2N5BA 2MMOA 1GRXA 2F3MA 3DWVA 5ECMB 1AXDA 3IK9A 5G1KA 5JWOB 4HUAA 2LQOA 2AJQB 3D4MA 3HCZA 5INYA 3C1RA 19GSA 2VCTA 1VGLA 4ECJA 5AISA 3UBKA 2X99A 2YANA 2NDOA 1O81A 4X0XA 3IOSA 5LD0A 1G0TA 1MDJA 4E8EA 4KF9A 5DDLA 3SBCA 5F8BA 4ML6A 1VF3A 1A2LA 2XPEA 1XW9A 3HY2A 2FD3A 4DEJA 3KXOA 1LJRA 4KB3A 5IO2A 4PURA 5CRDA 3P2AA 2I4AA 5H5QA 3LFLA 2GTUA 1BAYA 1ZYEA 4PGTA 2I81A 3M9KA 3M8NA 4F0BA 4HS1A 2IPAA 1DSBA 4MJEA 3ERGA 4JRRA 3QPMA 2OADA 4I8BA 4MZWA 3G7JA 3L9VA 5DAKB 2YP6A 5J4UA 1JZWA 3RHCA 4V1Ag 2KP1A 5D93A 3Q74A 4XS4A 1FB0A 4XHMA 5CNWA 2H1BA 4NPBA 2JL4A 6GSUA 4K7OA 3GX8A 4X43A 4ZIJA 3NZNA 4IJIA 2IFQA 4KW6A 4IKHA 2XC2A 4MLYA 1FB6A 2HSMB 3N9JA 3GH9A 4ZBAA 3HVVA 1E6BA 5ECHB 4F0CA 4K2DA 4RQXA 4LMWA 1SK2A 2H19A 4OFTA 3IC8A 3WT1A 5FHIA 1TXXA 3UJ1A 2VLTA 2AB6A 1YEPA 4G9HA 3QAVA 4LMVA 4IQAA 4TR1B 1BG5A 1GSUA 3M9JA 4N11A 3KH7A 4ZILA 3R3EA 2CX3A 4K1FA 5F0GA 3LSZA 4MPFA 1K3LA 1OC9B 3A2VA 2A2RA 1U6TA 3GKKA 1GUHA 4EDZA 3KIJA 3ERWA 1EWXA 4NWYA 2YNXA 2L6CA 3IK7A 1U3AA 4BA7A 1Z6NA 5ECRB 3TKPA 1Q98A 4JBBA 3L4NA 5DAKA 5AIVA 3DYRA 3TCOA 3KCMA 3GIXA 3BJ5A 4PQHA 1GTAA 1YF1A 3UEMA 1OC3A 2DIZA 3TRXA 4KDUA 4RQRA 5KN0A 3UVHA 2DC5A 1BX9A 3ZZXA 2HSMA 3C1SA 2GSRA 2H75A 1F6MC 1OYJA 2OA7A 3U6VA 5IM9A 3BD2A 3GKMA 1OVNA 4GQFA 5AIXA 4FYUA 2R4VA 4G2EA 5B8BA 1TU7A 1ABAA 3F3RA 4EUYA 2YV9A 4G0LA 3FZAA 4HQZA 2F51A 2V6OA 4TR1A 1OAZA 4JE1A 1YEXA 1HQOA 2YOIA 2AAWA 1TI1A 2HXKA 4POKA 4RI7A 1OC9A 5B6MA 4POBA 4L8EA 3HD5A 2ON7A 2GQKA 2R5GA 1MD3A 5D9VA 3GFKA 2LJKA 4POLA 4HJMA 5IPHA 2LS5A 4IHUA 4CHSA 4PUAA 4GCIA 5IIZA 4EKZA 2CZ2A 1JFUA 4O92A 1M99A 1PQNA 4TR3A 1SD9A 1V40A 3CRTA 2KOKA 3TJFA 3J7Yk 6GSVA 3R2QA 4XTSA 3IDVA 2PMTA 4RI6A 5ENUA 3TJKA 2JZRA 5GAND 2MBSA 2HLSA 4QL9A 1BYEA 4TXVA 4LL1B 3F3QA 4TR0A 2B5XA 2B7KA 3DKSA 3GYKA 1TK0B 2MMNA 3CSHA 1EGOA 3ZRDA 2CQ9A 4V2MA 2DJ3A 2HYXA 3DRNA 3GN3A 2P5QA 2VL9A 3GL5A 5ELAA 4TXOB 4GSTA 2DIYA 1AQXA 1ERUA 2H76A 3GUSA 2PWJA 3TJBA 1Z9HA 3LWAA
chains in the Genus database with same CATH superfamily
1XOBA 1I9DA 3F63A 3Q19A 3LXZA 3KJYA 3VURA 1X9WB 5J9CA 2C3TA 4K5SA 4DSQA 2REMA 1M9AA 3LJRA 2X4AA 3GTUA 4Q5RA 4WEYA 4PUFC 2V2GA 2N5FA 4JZQA 3VI5A 2M80A 3TRQA 4ZXGA 4BL7A 2HZFA 3RFRC 4HZ4A 1RW1A 2JADA 2FWHA 2QA1A 5IOWA 4N10A 1ZGNA 5DQSA 3TKSE 2K8SA 4TKYA 3E0UA 1EZKA 8GSSA 2H66A 4HI7A 4MK3A 5JWQB 5CREA 4IVFA 2O8VB 2GSSA 2VL2C 3TKSC 2VM2A 4POMA 2AV4A 1XWGA 3IBHA 2K9FA 4FYCA 5DJMA 2TIRA 1QUWA 4PTSA 1A0FA 4TXOA 2WDUA 1GL8A 1GP1A 3IHQA 3CBUA 5ECIB 2K8VA 2VUPA 2DJJA 1THXA 1CQHA 4MZBA 4K6XA 1Z7RA 1NSWA 2B1LA 2QGVA 1V58A 2R0PA 4WR4A 1XWBA 1EV4A 4G01A 4FIWA 1G7OA 2DJKA 1SKSB 4AJ7A 4CW9A 1A0RP 2R2JA 4LL4B 1GSSA 5G5EA 1SL1B 1C72A 1SYRA 5KOWA 3DXBA 3ZYWA 4PNFA 2NTOA 1AC1A 1GTIA 2V41A 2YJ7A 5EY6A 4TR4A 3F8UA 1WJKA 2IMIA 4GF0A 4AI6A 1TW9A 4K2XA 1XG8A 4PXOA 3C71A 4ECCA 2YCDA 4I2UA 4XS1A 4BIKA 4GDFA 2IN3A 2JSYA 5A5HB 5LNKe 2LV3A 4MPGA 4G0KA 4OMVA 1TRVA 1WE0A 3FZ4A 1F3BA 1NHOA 2DSAA 1OKDA 2WULA 4N0ZA 1K0DA 1PKWA 1MTCA 3ZTLA 4MP4A 1S3CA 3FW2A 1SENA 5DVBA 1A2MA 4H86A 2WW3A 3D5JA 1XVQA 3LORA 4F9ZA 3IAS2 1U87A 3TKRA 2HI7A 1G6YA 2MYGA 2VCQA 1Q4JA 3DIEA 4EVMA 5DCGA 3KMOA 4KUNA 3RAZA 3FYGA 4V1Ap 5ECOB 3BCKA 4KCEA 1GTUA 2H8LA 1KBNA 3UAPA 1EP7A 1M3IA 1PA3A 5KN2A 1O6JA 2V32A 1WRYA 1EV9A 1EEJA 2VCZA 3MIXA 1ERTA 2ZCTA 4EIQA 2WZSA 4USSA 2PGTA 1T3BA 2EFCA 1TDIA 3FMWA 1FVKA 1SKWB 2H1LA 3HXSA 14GSA 2CT6A 5IO0A 2YJHA 5A5HA 1K0NA 3HZ8A 3ZL5A 4GTUA 3GH6A 2XPDA 5D8IA 1B4PA 1FOHA 3D4TA 4FQUA 1N25A 1ZYNA 2E7PA 4EIPA 4ZBBA 4AKIA 3LXTA 2LJRA 2X8HA 4MA9A 3ZMLA 2X8GA 1M7TA 3KMNA 1U88A 3SWLA 3HKRA 2FY6A 1M9BA 2AYTA 4KGIA 1GUMA 1FAAA 4NHZA 3KP8A 1SVOA 3M3MA 2VM1A 4ZL7A 3MSZA 1G6WA 4JR4A 2IJYA 2VCWA 4KNDA 4WKWA 3HJMA 2LUSA 2A2SA 2GLRA 3KGKA 1ZMAA 2RM6A 4AJ8A 4MZCA 1TRSA 4K7NA 2B5EA 1PD21 3K8NA 1VF1A 3UL3A 4FO5A 3FR3A 3TU3B 3IE3A 3UMAA 12GSA 4PX1A 5ID2B 4PQIA 2P5RA 3KTLA 3A3TA 2NPBA 1TRUA 2P31A 3KTBA 2V1MA 4ZB8A 4ACSA 1YDKA 1LBKA 1J08A 4OO5A 1KTEA 5HR0A 1YQ1A 5KN3A 1XFLA 1XWKA 2C3QA 3DD3A 4NV5A 5IMCA 3U5RE 4BVYB 3QAWA 1H75A 2WB9A 3TRPA 1XBSA 1O8XA 2KP2A 2PPTA 1S3DA 4MJAA 1M2DA 5IMDA 2DLXA 3D21A 2PN8A 1GSYA 2PVOC 4HU9A 5HR1A 3LYKA 4OCEA 5JCWA 2L4CA 4HZ2A 4I5QA 3VWUA 4MMMA 1XW5A 1ZL9A 2GQLA 2PVQA 3P7XA 2G2QA 4IS0A 4E68A 4K7IA 2H30A 2EIOA 4EDYA 5IMAA 2OE1A 4CY6A 1BEDA 5ECPB 4HOJA 1UN2A 2BJXA 2H73A 1XXUA 2TRXA 5HR3A 3W8SA 2HRNA 1WP0A 5ECSA 3DVWA 2HT9A 5ID2A 1A8YA 1QFNA 5ECLB 1MDIA 2KHPA 2J23A 16GSA 2GT5A 4MF5A 3N5OA 2O36A 2IMFA 6GSYA 4GSNA 2LRNA 1T00A 3FK8A 5DALB 1UVZA 2JACA 1AW9A 3CHXC 2D2ZA 4F2IA 4JU5A 1Y1UA 3UBLA 1K3YA 5D9WA 4O7HA 2IIYA 1K0OA 1OE7A 1PSQA 4BVYA 2YWIA 4TRXA 3KM6A 2H6XA 4BWQA 1TRWA 2YWMA 1X0RA 5A4WA 3F9UA 4BPYA 2EC4A 4YQVA 2O87A 2LKUA 3HJOA 3IHGA 5CRGA 5IMZA 2CVBA 3CRUA 3FRCA 4XRDA 1DE1A 1PN0A 1T1VA 2ON5A 4QL7A 4I6XA 3VWVA 2X8CA 1QK8A 2H6ZA 3A5IA 2DJ1A 2CVKA 4G10A 2QA2A 3I69A 2BMXA 4O5RA 1AIUA 3RHBA 5IQYA 3EPTA 2BTOT 2VIMA 3PR8A 2L59A 3GKNA 2VAFA 3EWLA 4NAXA 1SL2B 1XPVA 2QC7A 1UA5A 1A2JA 1R5PA 1J9BA 3PINA 2RLIA 4ZL8A 5F06A 3D22A 3ED3A 1WIKA 4RUVA 3ZFBA 4HU7A 3TKQA 4KA0A 1TOFA 3BOAA 5J40A 4MF6A 2ALBA 3TJJA 1PKZA 3D0ZA 5DALA 2CA8A 3O76A 3KD0A 1TI3A 2RUEA 4YQUA 4DSRA 3QAGA 1FVJA 3EYTA 3C73A 4DSSB 3LGCA 2GQMA 5CO3A 4IGJA 4L0WA 1OKTA 2O85A 3MWHA 1SVLA 1LU4A 4XCSA 3WT2A 2RUFA 2L57A 2WFCA 1ERVA 4K0GA 4OCFA 2UZ8A 1GH2A 4EL1A 3VPTA 2VO4A 1TKDB 4Z7XA 5G1LA 1YVLA 1X5EA 3FKFA 2ES7A 2LEGA 1X5DA 1FOVA 3NOFA 1OE8A 3QMXA 1ST9A 2H71A 1O73A 2GZZA 3TOUA 1OC8A 5HQPA 9GSSA 5D9XA 3NIVA 4ECBA 2DBCA 1XCCA 1PL1A 5A34B 6GSTA 1W4VA 4HJ2A 3KZQA 22GSA 2FA4A 1YKAA 2LRTA 13GSA 3F6DA 4HEA2 2FCHA 1YKCA 3APQA 4KX4A 5A4VA 1SK0A 2CAIA 3QOUA 4FXYP 4X1UA 2B1KA 3L9SA 4CDOA 2HRKB 4G19A 1XWCA 2C80A 2WZ9A 1Z7PA 2YWOA 1N8JA 3ZREA 3HYPA 4O5UA 6GSSA 3US3A 3TOTA 4HQSA 2O89A 2RIIA 2VOCA 1Z6MA 1R26A 3F4TA 3HDCA 3VFIA 5F05A 1BJXA 4F03A 2K18A 1JZDA 4DVCA 2NVLA 2R0GA 1UC7A 4IJ3A 2MMAA 3QCPA 4YAVA 2X64A 2YWNA 2GSTA 4TOPA 1GTBA 5CP1A 3VK9A 5JWRB 3UOMA 1ERWA 3ZLPA 5E4WA 1TXUA 4WF4A 2FA8A 3LG6A 2VKZG 2F9SA 5B6NA 5DBQA 4WBJA 3CSIA 4NXIA 3H8QA 4ILFA 1N2AA 1XOAA 5A4UA 2HSNB 5E59A 1MEKA 1GLQA 3FR6A 3HVNA 1TJDA 2LSTA 1QXHA 3VWXA 2CVDA 1SKRB 3M0FA 1T8EB 4YH2A 2H1AA 2FLSA 2C3NA 4Z2TA 4GSSA 4MNNA 2XHFA 2F8AA 4AGSA 1K0MA 3CTGA 4HDEA 3FY7A 2G0FA 5HFIA 3H93A 2WW2A 1XVWA 2HRKA 3I6AA 1X9SB 1W89A 5GSTA 2VD1A 2VCXA 3GNJA 3ME8A 5H5SA 2HNLA 2AHEA 4ZB9A 3ZVJA 2LNSA 4MCUA 1FHEA 2IL3A 5A1NB 1GUKA 4KH7A 2LTKA 5J3RA 2E2GA 20GSA 5FWGA 3L9UA 4EO3A 1SJ6A 2LRCA 4V2NA 3L78A 3GA4A 3FZ5A 5DQYA 5DJLA 4WF5A 2HZEB 2H72A 1GWCA 4GWRA 3EINA 1GNEA 4IP1A 3P8WA 4K0NA 2CAQA 3E9JB 4KSOA 2O5VA 2K6VA 5JCUA 2WVZA 4JEDA 1NW2A 1SU9A 2IMEA 4I97A 2LJAA 2WCIA 2ZUPA 3O3TA 1QMVA 1AAZA 1A24A 7GSSA 3FHKA 3DEXA 1USBA 3Q6OA 3LEFA 4G0IA 1GNWA 4KDXA 1K0CA 3ZVJD 5J4VA 3GHAA 1DBYA 5D9TA 4EC0A 2VL2A 3TKSA 2OBIA 3EU4A 1Z5YE 5A5KA 3GKXA 3PH9A 2GVPA 1CQGA 2EFEA 1XWAA 2C1YA 2HSYA 1YY7A 3GMFA 1MDKA 1K3OA 1ILOA 4ML1A 3GX0A 1I1IP 4IBPA 1SJIA 2UV8G 1THOA 3IPZA 2WS2A 2GZPA 2WRTA 3F4SA 5A1NA 2WGRA 3IAM2 3DGQA 3MDKA 3PPUA 1V98A 5JCGA 3RPNA 3TJGA 2OKAA 3L0HA 3ZIVA 5CRWA 3C8EA 1PX6A 2H70A 2VLVA 2LNTA 2HZEA 1V2AA 1SJZA 4HSCX 2R3XA 4OFMA 4WXTA 2WJUA 3EU3A 3VWWA 1BQ7A 2O3EA 4GLTA 5J4YA 2JZTA 4MDCA 3IRAA 1EEMA 1EOHA 2HQTA 2WVYA 5IPGA 3ZITA 2OBKA 3VPQA 3CMIA 4N30A 2C0DA 2F8FA 1JLVA 1VF2A 5J5NA 4QQ7A 2QSIA 3EC3A 2HFDA 3LYPA 2JZSA 4BVXB 3ZIJA 3IC4A 4FYBA 2R37A 4EF0A 2JSZA 1M0UA 4TN8A 3GSTA 3GRXA 2WW0A 6GSWA 3BCIA 5CYYA 2OT3A 4IW9A 5EPFA 1Y25A 5G5FA 4JR6A 3S9FA 4KE3A 2FGXA 3G9BA 3W6GA 2YZUA 4L5LA 4KSMA 2HSHA 1G7EA 1ZOFA 4MABA 3CYNA 1XZOA 4ID0A 3WGDA 2B3SA 4LA1A 5FT3A 2H01A 1VRSD 4ZB6A 3OR5A 2E0QA 1O8WA 5ECKB 4P3YB 2YZHA 1FO5A 1SYXA 3TGZA 2H1GA 2FUG2 2L5OA 2EFDA 1VF4A 3HZ4A 1TK8B 1GLPA 3HJPA 5B8AA 3VLNA 2GGTA 1KEBA 3EE2A 3G7IA 4EE0A 3IR4A 1IYIA 1AQVA 2N5AA 1ZYPA 2H0HA 4XIHA 4NHWA 2E2MA 1A8LA 1HNCA 1Z3EA 4W66A 1ZZYA 2L6DA 2MMZA 1JLWA 4F82A 4L0UA 1GSDA 3KEBA 3J7Yb 1WMJA 1YJ6A 1BF5A 4BVXA 1YF0A 4PI2C 3TB2A 1WOUA 3TUEA 2DKHA 2I1UA 3IXRA 4XRAA 5GAPD 5COHA 2YPMA 3IV4A 2CV4A 5HR2A 3A2WA 4O32A 3EURA 3AY8A 1B8XA 4YKGA 4K8MA 3ERFA 4D73B 5EVOA 2IMKA 1F9MA 1HD2A 1DUGA 1Y6EA 1EP8A 3QDNA 2YN1A 1EGRA 5ELGA 4X4JA 4MH3A 3A2XA 5ECNB 1ML6A 1PGTA 3V1WA 18GSA 2M72A 2O7KA 3EMXA 3H79A 3EMPA 5G31A 1GSQA 3GURA 5J9BA 3CSJA 3MAKA 1SK1A 4WBRD 2FHEA 3WD6A 4TW5A 2H6YA 3Q18A 2I9HA 4AJ6A 1B48A 1DE2A 2IWTA 4Q5NA 4WR5A 4I2TA 4WETA 4ULXA 2B7JA 1URMA 2KLXA 3QFAC 4KCAA 1XIYA 4AKGA 2PBJA 3I43A 2OE3A 4GXZA 3GTUB 5CAXA 3FZ9A 1PMTA 1HNBA 5GSSA 1YZXA 3QR6A 1I5GA 1V9WA 2XBQA 1JHBA 2J9HA 4IELA 1R7HA 1AUCA 2H0IA 4ICYA 17GSA 5IOXA 4BL7B 3DVXA 3IA1A 1SL0B 4IN0A 1TK5B 3HVXA 1O7UA 3C7MA 2M46A 4NV2A 1K0AA 1PRXA 3I9V2 2B6MA 3HHVA 2MBTA 4MJBA 4YQMA 5L71A 3H1NA 1TTZA 2C8UA 4D73A 3F6FA 2PUKC 1BG1A 2CZ3A 5EL8A 1TP9A 3QFBC 1O85A 4L5OA 2B5YA 3UARA 4LLRA 2GDRA 5HFKA 1QGVA 2AUVA 4YKFA 1T7PB 4IP6A 3E3EA 2A4VA 1EOGA 4K9ZA 5IMFA 3FR9A 5ABRA 5D73A 3ME7A 1M3JA 2VD0A 3RDWA 2X49A 1XW6A 5BRTA 1PL2A 4MF7A 2CX4A 1U3IA 2DKIA 5KEJA 4TVEA 2RM5A 2KUCA 1WWJA 5DCHA 4XS6A 2DMMA 1TU8A 2EIQA 2OACA 3EVIA 4AF2A 2NBSA 2C0FA 2ZNMA 5IMVA 4OD7A 2R6KA 3VI7A 4ISDA 1R4WA 5KN1A 2YV7A 2C4JA 2QKEA 4MJCA 3H4KA 5AN1A 4AKHA 2GS3A 1F37A 1K0BA 1E2YA 1ZCPA 1PN9A 5GZZB 1T4YA 4PNGA 3M1GA 1JZOA 2OE0A 3BBYA 4BWSA 4PQ1A 2FWGA 2DMLA 4OO4A 2PERA 4N0VA 3PGTA 1V57A 5G30A 3F0IA 1A23A 2H0GA 5KOXA 3GV1A 1H4OA 3CXGA 4DSSA 3APSA 3QD9A 5ECQB 5B7CA 2GZYA 1QQ2A 2OJLA 5G2ZA 4V2LA 1NM3A 1ZYQB 4PHZC 1B9XC 4OFNA 2C0GA 4Q5FA 3G7YA 5BMUB 3HVSA 2DJ2A 4Z2RA 1GSFA 2VLUA 1FG4A 10GSA 3W8JA 1X9MB 2XBIA 5HFGA 3ZMKA 3RGBC 2FWEA 1ACVA 4FH8A 5CRHA 2DJ0A 5AGYA 2JU5A 4KDYA 1KNGA 1S3AA 5A34A 1PX7A 3ISOA 2P0GA 2IMDA 3KH9A 2VCVA 4J56E 3MNGA 3O6TA 3JCML 4ZL9A 4MH2A 2Z9SA 1F3AA 1HNAA 2HRAA 5LCZA 6GSXA 4J57E 2MZCA 1B4QA 2I3YA 3LQ7A 4GRFA 1T4ZA 3FEUA 3GL3A 1M2AA 3CTFA 5J41A 5C04A 4NMUA 1WPIA 2H74A 4ZBDA 1B9YC 3P90A 3RBTA 5D96A 1J0FA 2HE3A 1JZRA 1RK4A 3HA9A 4N3ZA 1RQMA 3APOA 5H5RA 1R5AA 3D6IA 1IYHA 3A5WA 4J2FA 3DMLA 3GSSA 1GSEA 1FW1A 4Q5QA 3RPPA 2TRCP 3WGEA 1ON4A 1X5CA 2C0EA 2L4QA 4GQCA 4YAPA 4CY8A 3F4RA 3HMJG 2V6KA 3UVTA 4OWYA 11GSA 2HRFA 5C00A 2VL3A 3TDGA 3WGXA 5BMUA 1AQWA 2GSQA 1M2BA 3WYWA 4E8HA 3UIWA 2PU9C 1GULA 3KP9A 2L5LA 1F2EA 4ECIA 3CWGA 4QMKA 1HYUA 5F07A 4IQ1A 2FNOA 1SD8A 4XS4B 2HSNA 1NHYA 2LQQA 3ZFLA 2FWFA 4KAEA 1MD4A 2GT6A 2EIRA 2H1DA 4EXJA 2IFQB 2N5BA 2MMOA 1GRXA 2F3MA 3DWVA 5ECMB 4A5PA 1AXDA 3IK9A 5G1KA 5JWOB 4HUAA 2LQOA 2AJQB 3D4MA 3HCZA 5INYA 3C1RA 19GSA 2VCTA 1VGLA 4ECJA 5AISA 3UBKA 2X99A 2YANA 2NDOA 4O5QA 1O81A 4X0XA 3IOSA 5LD0A 1G0TA 1MDJA 4E8EA 4KF9A 5DDLA 3SBCA 5F8BA 4ML6A 1VF3A 1A2LA 2XPEA 1XW9A 3HY2A 2FD3A 4DEJA 3KXOA 2A4HA 1LJRA 4KB3A 5IO2A 4PURA 5CRDA 3P2AA 2I4AA 5H5QA 3LFLA 4ZB7A 2GTUA 1BAYA 1ZYEA 2EFHA 4PGTA 2I81A 3M9KA 3M8NA 4F0BA 4HS1A 2IPAA 1DSBA 4MJEA 3ERGA 4JRRA 3QPMA 2OADA 4MZWA 4I8BA 3G7JA 3L9VA 5DAKB 2YP6A 5J4UA 1JZWA 3RHCA 4V1Ag 2KP1A 5D93A 3Q74A 4XS4A 1FB0A 4XHMA 5CNWA 2WVXB 2H1BA 4NPBA 2JL4A 6GSUA 4K7OA 3GX8A 4X43A 4ZIJA 3NZNA 4IJIA 2IFQA 4KW6A 4IKHA 2XC2A 4MLYA 1FB6A 2HSMB 3N9JA 3GH9A 4ZBAA 3HVVA 1E6BA 5ECHB 4F0CA 4K2DA 4RQXA 4LMWA 1SK2A 2H19A 4OFTA 3IC8A 3WT1A 5FHIA 1TXXA 3UJ1A 2VLTA 2AB6A 1YEPA 4G9HA 3QAVA 4LMVA 4IQAA 4TR1B 1BG5A 1GSUA 3M9JA 4N11A 3KH7A 4ZILA 3R3EA 2CX3A 4K1FA 5F0GA 3LSZA 4MPFA 1K3LA 1OC9B 3A2VA 2A2RA 1U6TA 3GKKA 1GUHA 2A2PA 4EDZA 3KIJA 3ERWA 1EWXA 4NWYA 2YNXA 2L6CA 3IK7A 1U3AA 4BA7A 1YEWC 1Z6NA 5ECRB 3TKPA 1Q98A 4JBBA 3L4NA 5DAKA 5AIVA 3DYRA 3TCOA 3KCMA 3GIXA 3BJ5A 4PQHA 1GTAA 2WVXA 1S3RA 1YF1A 3UEMA 1OC3A 2DIZA 3TRXA 4KDUA 1S4BP 4RQRA 5KN0A 3UVHA 2DC5A 1BX9A 3ZZXA 2HSMA 3C1SA 2GSRA 2H75A 1F6MC 1OYJA 2OA7A 3U6VA 5IM9A 3BD2A 3GKMA 1OVNA 4GQFA 5AIXA 4FYUA 2R4VA 4G2EA 5B8BA 1TU7A 1ABAA 3F3RA 4EUYA 2YV9A 4G0LA 3FZAA 4HQZA 2F51A 2V6OA 4TR1A 3LW9A 1OAZA 4JE1A 1YEXA 1HQOA 2YOIA 2AAWA 1TI1A 2HXKA 4POKA 4RI7A 1OC9A 5B6MA 4POBA 4L8EA 3HD5A 2ON7A 2GQKA 2R5GA 1MD3A 5D9VA 3GFKA 2LJKA 4POLA 4HJMA 5IPHA 2LS5A 4IHUA 4CHSA 4PUAA 4GCIA 5IIZA 4EKZA 2CZ2A 1JFUA 4K5RA 4O92A 1M99A 1SVMA 1PQNA 4TR3A 1SD9A 1V40A 3CRTA 2KOKA 3TJFA 3J7Yk 6GSVA 3R2QA 4XTSA 3IDVA 2PMTA 4RI6A 5ENUA 3TJKA 2JZRA 1PFOA 5GAND 2MBSA 2HLSA 4QL9A 1BYEA 4TXVA 5J47A 4LL1B 3F3QA 4TR0A 2B5XA 2B7KA 3DKSA 3GYKA 2R0CA 1TK0B 2MMNA 3CSHA 1EGOA 3ZRDA 2CQ9A 4V2MA 2DJ3A 2WW1A 2HYXA 3DRNA 3GN3A 2P5QA 2VL9A 3GL5A 5ELAA 4TXOB 4GSTA 2DIYA 4AKXB 4PI0C 1AQXA 1ERUA 2H76A 3GUSA 4Z2UA 3CQFA 2PWJA 3MYDA 3TJBA 1Z9HA 3LWAA
chains in the Genus database with same CATH topology
1XOBA 1I9DA 3F63A 3Q19A 3LXZA 3KJYA 3VURA 1X9WB 5J9CA 2C3TA 4K5SA 4DSQA 2REMA 1M9AA 3LJRA 2X4AA 3GTUA 4Q5RA 4WEYA 4PUFC 2V2GA 2N5FA 4JZQA 3VI5A 2M80A 3TRQA 4ZXGA 4BL7A 2HZFA 4HZ4A 1RW1A 2JADA 2FWHA 2QA1A 5IOWA 4N10A 1ZGNA 5DQSA 3TKSE 2K8SA 4TKYA 3E0UA 1EZKA 8GSSA 2H66A 4HI7A 4MK3A 5JWQB 5CREA 4IVFA 2O8VB 2GSSA 2VL2C 3TKSC 2VM2A 4POMA 2AV4A 1XWGA 3IBHA 2K9FA 4FYCA 5DJMA 2TIRA 1QUWA 4PTSA 1A0FA 4TXOA 2WDUA 1GL8A 1GP1A 3IHQA 3CBUA 5ECIB 2K8VA 2VUPA 2DJJA 1THXA 1CQHA 4MZBA 4K6XA 1Z7RA 1NSWA 2B1LA 2QGVA 1V58A 2R0PA 4WR4A 1XWBA 1EV4A 4G01A 4FIWA 1G7OA 2DJKA 1SKSB 4AJ7A 4CW9A 1A0RP 2R2JA 4LL4B 1GSSA 5G5EA 1SL1B 1C72A 1SYRA 5KOWA 3DXBA 3ZYWA 4PNFA 2NTOA 1AC1A 1GTIA 2V41A 2YJ7A 5EY6A 4TR4A 3F8UA 1WJKA 2IMIA 4GF0A 4AI6A 1TW9A 4K2XA 4PXOA 3C71A 4ECCA 2YCDA 4I2UA 4XS1A 4GDFA 2IN3A 2JSYA 5A5HB 5LNKe 2LV3A 4MPGA 4G0KA 4OMVA 1TRVA 1WE0A 3FZ4A 1F3BA 1NHOA 2DSAA 1OKDA 2WULA 4N0ZA 1K0DA 1PKWA 1MTCA 3ZTLA 4MP4A 1S3CA 3FW2A 1SENA 5DVBA 1A2MA 4H86A 3D5JA 1XVQA 3LORA 4F9ZA 3IAS2 1U87A 3TKRA 2HI7A 1G6YA 2MYGA 2VCQA 1Q4JA 3DIEA 4EVMA 5DCGA 3KMOA 4KUNA 3RAZA 3FYGA 4V1Ap 5ECOB 3BCKA 4KCEA 1GTUA 2H8LA 1KBNA 3UAPA 1EP7A 1PA3A 5KN2A 1O6JA 2V32A 1WRYA 1EV9A 1EEJA 2VCZA 3MIXA 1ERTA 2ZCTA 4EIQA 4USSA 2PGTA 1T3BA 2EFCA 1TDIA 3FMWA 1FVKA 1SKWB 2H1LA 3HXSA 14GSA 2CT6A 5IO0A 2YJHA 5A5HA 1K0NA 3HZ8A 3ZL5A 4GTUA 3GH6A 2XPDA 5D8IA 1B4PA 1FOHA 3D4TA 4FQUA 1N25A 1ZYNA 2E7PA 4EIPA 4ZBBA 4AKIA 3LXTA 2LJRA 2X8HA 4MA9A 3ZMLA 2X8GA 1M7TA 3KMNA 1U88A 3SWLA 3HKRA 2FY6A 1M9BA 2AYTA 4KGIA 1GUMA 1FAAA 4NHZA 3KP8A 1SVOA 3M3MA 2VM1A 4ZL7A 3MSZA 1G6WA 4JR4A 2IJYA 2VCWA 4KNDA 4WKWA 3HJMA 2LUSA 2A2SA 2GLRA 3KGKA 1ZMAA 2RM6A 4AJ8A 4MZCA 1TRSA 4K7NA 2B5EA 1PD21 3K8NA 1VF1A 3UL3A 4FO5A 3FR3A 3TU3B 3IE3A 3UMAA 12GSA 4PX1A 5ID2B 4PQIA 2P5RA 3KTLA 3A3TA 2NPBA 1TRUA 2P31A 3KTBA 2V1MA 4ZB8A 4ACSA 1YDKA 1LBKA 1J08A 4OO5A 1KTEA 5HR0A 1YQ1A 5KN3A 1XFLA 1XWKA 2C3QA 3DD3A 4NV5A 5IMCA 3U5RE 4BVYB 3QAWA 1H75A 2WB9A 3TRPA 1XBSA 1O8XA 2KP2A 2PPTA 1S3DA 4MJAA 1M2DA 5IMDA 2DLXA 3D21A 2PN8A 1GSYA 2PVOC 4HU9A 5HR1A 3LYKA 4OCEA 5JCWA 2L4CA 4HZ2A 4I5QA 3VWUA 4MMMA 1XW5A 1ZL9A 2GQLA 2PVQA 3P7XA 2G2QA 4IS0A 4E68A 4K7IA 2H30A 2EIOA 4EDYA 5IMAA 2OE1A 4CY6A 1BEDA 5ECPB 4HOJA 1UN2A 2BJXA 2H73A 1XXUA 2TRXA 5HR3A 3W8SA 2HRNA 1WP0A 5ECSA 3DVWA 2HT9A 5ID2A 1A8YA 1QFNA 5ECLB 1MDIA 2KHPA 2J23A 16GSA 2GT5A 4MF5A 3N5OA 2IMFA 6GSYA 4GSNA 2LRNA 1T00A 3FK8A 5DALB 1UVZA 2JACA 1AW9A 2D2ZA 4F2IA 4JU5A 1Y1UA 3UBLA 1K3YA 5D9WA 4O7HA 2IIYA 1K0OA 1OE7A 1PSQA 4BVYA 2YWIA 4TRXA 3KM6A 2H6XA 4BWQA 1TRWA 2YWMA 1X0RA 5A4WA 3F9UA 4BPYA 2EC4A 4YQVA 2O87A 2LKUA 3HJOA 3IHGA 5CRGA 5IMZA 2CVBA 3CRUA 3FRCA 4XRDA 1DE1A 1PN0A 1T1VA 2ON5A 4QL7A 4I6XA 3VWVA 2X8CA 1QK8A 2H6ZA 3A5IA 2DJ1A 2CVKA 4G10A 2QA2A 3I69A 2BMXA 4O5RA 1AIUA 3RHBA 5IQYA 3EPTA 2BTOT 2VIMA 3PR8A 2L59A 3GKNA 2VAFA 3EWLA 4NAXA 1SL2B 1XPVA 2QC7A 1UA5A 1A2JA 1R5PA 1J9BA 3PINA 2RLIA 4ZL8A 5F06A 3D22A 3ED3A 1WIKA 4RUVA 3ZFBA 4HU7A 3TKQA 4KA0A 1TOFA 3BOAA 5J40A 4MF6A 2ALBA 3TJJA 1PKZA 3D0ZA 5DALA 2CA8A 3O76A 3KD0A 1TI3A 2RUEA 4YQUA 4DSRA 3QAGA 1FVJA 3EYTA 3C73A 4DSSB 3LGCA 2GQMA 5CO3A 4IGJA 4L0WA 1OKTA 2O85A 3MWHA 1SVLA 1LU4A 4XCSA 3WT2A 2RUFA 2L57A 2WFCA 1ERVA 4K0GA 4OCFA 2UZ8A 1GH2A 4EL1A 3VPTA 2VO4A 1TKDB 4Z7XA 5G1LA 1YVLA 1X5EA 3FKFA 2ES7A 2LEGA 1X5DA 1FOVA 3NOFA 1OE8A 3QMXA 1ST9A 2H71A 1O73A 2GZZA 3TOUA 1OC8A 5HQPA 9GSSA 5D9XA 3NIVA 4ECBA 2DBCA 1XCCA 1PL1A 5A34B 6GSTA 1W4VA 4HJ2A 3KZQA 22GSA 2FA4A 1YKAA 2LRTA 13GSA 3F6DA 4HEA2 2FCHA 1YKCA 3APQA 4KX4A 5A4VA 1SK0A 2CAIA 3QOUA 4X1UA 2B1KA 3L9SA 4CDOA 2HRKB 4G19A 1XWCA 2C80A 2WZ9A 1Z7PA 2YWOA 1N8JA 3ZREA 3HYPA 4O5UA 6GSSA 3US3A 3TOTA 4HQSA 2O89A 2RIIA 2VOCA 1Z6MA 1R26A 3F4TA 3HDCA 3VFIA 5F05A 1BJXA 4F03A 2K18A 1JZDA 4DVCA 2NVLA 2R0GA 1UC7A 4IJ3A 2MMAA 3QCPA 4YAVA 2X64A 2YWNA 2GSTA 4TOPA 1GTBA 5CP1A 3VK9A 5JWRB 3UOMA 1ERWA 3ZLPA 5E4WA 1TXUA 4WF4A 2FA8A 3LG6A 2VKZG 2F9SA 5B6NA 5DBQA 4WBJA 3CSIA 4NXIA 3H8QA 4ILFA 1N2AA 1XOAA 5A4UA 2HSNB 5E59A 1MEKA 1GLQA 3FR6A 1TJDA 2LSTA 1QXHA 3VWXA 2CVDA 1SKRB 3M0FA 1T8EB 4YH2A 2H1AA 2FLSA 2C3NA 4Z2TA 4GSSA 4MNNA 2XHFA 2F8AA 4AGSA 1K0MA 3CTGA 4HDEA 3FY7A 2G0FA 5HFIA 3H93A 1XVWA 2HRKA 3I6AA 1X9SB 1W89A 5GSTA 2VD1A 3ME8A 2VCXA 3GNJA 5H5SA 2HNLA 2AHEA 4ZB9A 3ZVJA 2LNSA 4MCUA 1FHEA 2IL3A 5A1NB 1GUKA 4KH7A 2LTKA 5J3RA 2E2GA 20GSA 5FWGA 3L9UA 4EO3A 1SJ6A 2LRCA 4V2NA 3L78A 3GA4A 3FZ5A 5DQYA 5DJLA 4WF5A 2HZEB 2H72A 1GWCA 4GWRA 3EINA 1GNEA 4IP1A 3P8WA 4K0NA 2CAQA 3E9JB 4KSOA 2O5VA 2K6VA 5JCUA 4JEDA 1NW2A 1SU9A 2IMEA 4I97A 2LJAA 2WCIA 2ZUPA 3O3TA 1QMVA 1AAZA 1A24A 7GSSA 3FHKA 3DEXA 1USBA 3Q6OA 3LEFA 4G0IA 1GNWA 4KDXA 1K0CA 3ZVJD 5J4VA 3GHAA 1DBYA 5D9TA 4EC0A 2VL2A 3TKSA 2OBIA 3EU4A 1Z5YE 5A5KA 3GKXA 3PH9A 2GVPA 1CQGA 2EFEA 1XWAA 2C1YA 2HSYA 1YY7A 3GMFA 1MDKA 1K3OA 1ILOA 4ML1A 3GX0A 4IBPA 1SJIA 2UV8G 1THOA 3IPZA 2WS2A 2GZPA 2WRTA 3F4SA 5A1NA 2WGRA 3IAM2 3DGQA 3MDKA 3PPUA 1V98A 5JCGA 3RPNA 3TJGA 2OKAA 3L0HA 3ZIVA 5CRWA 3C8EA 1PX6A 2H70A 2VLVA 2LNTA 2HZEA 1V2AA 1SJZA 2R3XA 4OFMA 4WXTA 2WJUA 3EU3A 3VWWA 1BQ7A 4GLTA 5J4YA 2JZTA 4MDCA 3IRAA 1EEMA 1EOHA 2HQTA 5IPGA 3ZITA 2OBKA 3VPQA 3CMIA 4N30A 2C0DA 2F8FA 1JLVA 1VF2A 5J5NA 4QQ7A 2QSIA 3EC3A 2HFDA 3LYPA 2JZSA 4BVXB 3ZIJA 3IC4A 4FYBA 2R37A 4EF0A 2JSZA 1M0UA 4TN8A 3GSTA 3GRXA 6GSWA 3BCIA 5CYYA 2OT3A 4IW9A 5EPFA 1Y25A 5G5FA 4JR6A 3S9FA 4KE3A 2FGXA 3G9BA 3W6GA 2YZUA 4L5LA 4KSMA 2HSHA 1G7EA 1ZOFA 4MABA 3CYNA 1XZOA 4ID0A 3WGDA 2B3SA 4LA1A 5FT3A 2H01A 1VRSD 4ZB6A 3OR5A 2E0QA 1O8WA 5ECKB 4P3YB 2YZHA 1FO5A 1SYXA 3TGZA 2H1GA 2FUG2 2L5OA 2EFDA 1VF4A 3HZ4A 1TK8B 1GLPA 3HJPA 5B8AA 3VLNA 2GGTA 1KEBA 3EE2A 3G7IA 4EE0A 3IR4A 1IYIA 1AQVA 2N5AA 1ZYPA 2H0HA 4XIHA 4NHWA 2E2MA 1A8LA 1HNCA 1Z3EA 4W66A 1ZZYA 2L6DA 2MMZA 1JLWA 4F82A 4L0UA 1GSDA 3KEBA 3J7Yb 1WMJA 1YJ6A 1BF5A 4BVXA 1YF0A 3TB2A 1WOUA 3TUEA 2DKHA 2I1UA 3IXRA 4XRAA 5GAPD 5COHA 2YPMA 3IV4A 2CV4A 5HR2A 3A2WA 4O32A 3EURA 3AY8A 1B8XA 4YKGA 4K8MA 3ERFA 4D73B 5EVOA 2IMKA 1F9MA 1HD2A 1DUGA 1Y6EA 1EP8A 3QDNA 2YN1A 1EGRA 5ELGA 4X4JA 4MH3A 3A2XA 5ECNB 1ML6A 1PGTA 3V1WA 18GSA 2M72A 2O7KA 3EMXA 3H79A 3EMPA 5G31A 1GSQA 3GURA 5J9BA 3CSJA 3MAKA 1SK1A 4WBRD 2FHEA 3WD6A 4TW5A 2H6YA 3Q18A 2I9HA 4AJ6A 1B48A 1DE2A 2IWTA 4Q5NA 4WR5A 4I2TA 4WETA 4ULXA 2B7JA 1URMA 2KLXA 3QFAC 4KCAA 1XIYA 4AKGA 2PBJA 3I43A 2OE3A 4GXZA 3GTUB 5CAXA 3FZ9A 1PMTA 1HNBA 5GSSA 1YZXA 3QR6A 1I5GA 1V9WA 2XBQA 1JHBA 2J9HA 4IELA 1R7HA 1AUCA 2H0IA 4ICYA 17GSA 5IOXA 4BL7B 3DVXA 3IA1A 1SL0B 4IN0A 1TK5B 3HVXA 1O7UA 3C7MA 2M46A 4NV2A 1K0AA 1PRXA 3I9V2 2B6MA 3HHVA 2MBTA 4MJBA 4YQMA 5L71A 3H1NA 1TTZA 2C8UA 4D73A 3F6FA 2PUKC 1BG1A 2CZ3A 5EL8A 1TP9A 3QFBC 1O85A 4L5OA 2B5YA 3UARA 4LLRA 2GDRA 5HFKA 1QGVA 2AUVA 4YKFA 1T7PB 4IP6A 3E3EA 2A4VA 1EOGA 4K9ZA 5IMFA 3FR9A 5ABRA 5D73A 3ME7A 3RDWA 2VD0A 2X49A 1XW6A 5BRTA 1PL2A 4MF7A 2CX4A 1U3IA 2DKIA 5KEJA 4TVEA 2RM5A 2KUCA 1WWJA 5DCHA 4XS6A 2DMMA 1TU8A 2EIQA 2OACA 3EVIA 4AF2A 2NBSA 2C0FA 2ZNMA 5IMVA 4OD7A 2R6KA 3VI7A 4ISDA 1R4WA 5KN1A 2YV7A 2C4JA 2QKEA 4MJCA 3H4KA 5AN1A 4AKHA 2GS3A 1F37A 1K0BA 1E2YA 1ZCPA 1PN9A 5GZZB 1T4YA 4PNGA 3M1GA 1JZOA 2OE0A 3BBYA 4BWSA 4PQ1A 2FWGA 2DMLA 4OO4A 2PERA 4N0VA 3PGTA 1V57A 5G30A 3F0IA 1A23A 2H0GA 5KOXA 3GV1A 1H4OA 3CXGA 4DSSA 3APSA 3QD9A 5ECQB 5B7CA 2GZYA 1QQ2A 2OJLA 5G2ZA 4V2LA 1NM3A 1ZYQB 1B9XC 4OFNA 2C0GA 4Q5FA 3G7YA 5BMUB 3HVSA 2DJ2A 4Z2RA 1GSFA 2VLUA 1FG4A 10GSA 3W8JA 1X9MB 2XBIA 5HFGA 3ZMKA 2FWEA 1ACVA 4FH8A 5CRHA 2DJ0A 5AGYA 2JU5A 4KDYA 1KNGA 1S3AA 5A34A 1PX7A 3ISOA 2P0GA 2IMDA 3KH9A 2VCVA 4J56E 3MNGA 3O6TA 3JCML 4ZL9A 4MH2A 2Z9SA 1F3AA 1HNAA 2HRAA 5LCZA 6GSXA 4J57E 2MZCA 1B4QA 2I3YA 3LQ7A 4GRFA 1T4ZA 3FEUA 3GL3A 1M2AA 3CTFA 5J41A 5C04A 4NMUA 1WPIA 2H74A 4ZBDA 1B9YC 3P90A 3RBTA 5D96A 1J0FA 2HE3A 1JZRA 1RK4A 3HA9A 4N3ZA 1RQMA 3APOA 5H5RA 1R5AA 3D6IA 1IYHA 3A5WA 4J2FA 3DMLA 3GSSA 1GSEA 1FW1A 4Q5QA 3RPPA 2TRCP 3WGEA 1ON4A 1X5CA 2C0EA 2L4QA 4GQCA 4YAPA 4CY8A 3F4RA 3HMJG 2V6KA 3UVTA 4OWYA 11GSA 2HRFA 5C00A 2VL3A 3TDGA 3WGXA 5BMUA 1AQWA 2GSQA 1M2BA 3WYWA 4E8HA 3UIWA 2PU9C 1GULA 3KP9A 2L5LA 1F2EA 4ECIA 3CWGA 4QMKA 1HYUA 5F07A 4IQ1A 2FNOA 1SD8A 4XS4B 2HSNA 1NHYA 2LQQA 3ZFLA 2FWFA 4KAEA 1MD4A 2GT6A 2EIRA 2H1DA 4EXJA 2IFQB 2N5BA 2MMOA 1GRXA 2F3MA 3DWVA 5ECMB 4A5PA 1AXDA 3IK9A 5G1KA 5JWOB 4HUAA 2LQOA 2AJQB 3D4MA 3HCZA 5INYA 3C1RA 19GSA 2VCTA 1VGLA 4ECJA 5AISA 3UBKA 2X99A 2YANA 2NDOA 4O5QA 1O81A 4X0XA 3IOSA 5LD0A 1G0TA 1MDJA 4E8EA 4KF9A 5DDLA 3SBCA 5F8BA 4ML6A 1VF3A 1A2LA 2XPEA 1XW9A 3HY2A 2FD3A 4DEJA 3KXOA 2A4HA 1LJRA 4KB3A 5IO2A 4PURA 5CRDA 3P2AA 2I4AA 5H5QA 3LFLA 4ZB7A 2GTUA 1BAYA 1ZYEA 2EFHA 4PGTA 2I81A 3M9KA 3M8NA 4F0BA 4HS1A 2IPAA 1DSBA 4MJEA 3ERGA 4JRRA 3QPMA 2OADA 4MZWA 4I8BA 3G7JA 3L9VA 5DAKB 2YP6A 5J4UA 1JZWA 3RHCA 4V1Ag 2KP1A 5D93A 3Q74A 4XS4A 1FB0A 4XHMA 5CNWA 2H1BA 4NPBA 2JL4A 6GSUA 4K7OA 3GX8A 4X43A 4ZIJA 3NZNA 4IJIA 2IFQA 4KW6A 4IKHA 2XC2A 4MLYA 1FB6A 2HSMB 3N9JA 3GH9A 4ZBAA 3HVVA 1E6BA 5ECHB 4F0CA 4K2DA 4RQXA 4LMWA 1SK2A 2H19A 4OFTA 3IC8A 3WT1A 5FHIA 1TXXA 3UJ1A 2VLTA 2AB6A 1YEPA 4G9HA 3QAVA 4LMVA 4IQAA 4TR1B 1BG5A 1GSUA 3M9JA 4N11A 3KH7A 4ZILA 3R3EA 2CX3A 4K1FA 5F0GA 3LSZA 4MPFA 1K3LA 1OC9B 3A2VA 2A2RA 1U6TA 3GKKA 1GUHA 2A2PA 4EDZA 3KIJA 3ERWA 1EWXA 4NWYA 2YNXA 2L6CA 3IK7A 1U3AA 4BA7A 1Z6NA 5ECRB 3TKPA 1Q98A 4JBBA 3L4NA 5DAKA 5AIVA 3DYRA 3TCOA 3KCMA 3GIXA 3BJ5A 4PQHA 1GTAA 1YF1A 3UEMA 1OC3A 2DIZA 3TRXA 4KDUA 4RQRA 5KN0A 3UVHA 2DC5A 1BX9A 3ZZXA 2HSMA 3C1SA 2GSRA 2H75A 1F6MC 1OYJA 2OA7A 3U6VA 5IM9A 3BD2A 3GKMA 1OVNA 4GQFA 5AIXA 4FYUA 2R4VA 4G2EA 5B8BA 1TU7A 1ABAA 3F3RA 4EUYA 2YV9A 4G0LA 3FZAA 4HQZA 2F51A 2V6OA 4TR1A 3LW9A 1OAZA 4JE1A 1YEXA 1HQOA 2YOIA 2AAWA 1TI1A 2HXKA 4POKA 4RI7A 1OC9A 5B6MA 4POBA 4L8EA 3HD5A 2ON7A 2GQKA 2R5GA 1MD3A 5D9VA 3GFKA 2LJKA 4POLA 4HJMA 5IPHA 2LS5A 4IHUA 4CHSA 4PUAA 4GCIA 5IIZA 4EKZA 2CZ2A 1JFUA 4K5RA 4O92A 1M99A 1SVMA 1PQNA 4TR3A 1SD9A 1V40A 3CRTA 2KOKA 3TJFA 3J7Yk 6GSVA 3R2QA 4XTSA 3IDVA 2PMTA 4RI6A 5ENUA 3TJKA 2JZRA 5GAND 2MBSA 2HLSA 4QL9A 1BYEA 4TXVA 5J47A 4LL1B 3F3QA 4TR0A 2B5XA 2B7KA 3DKSA 3GYKA 2R0CA 1TK0B 2MMNA 3CSHA 1EGOA 3ZRDA 2CQ9A 4V2MA 2DJ3A 2HYXA 3DRNA 3GN3A 2P5QA 2VL9A 3GL5A 5ELAA 4TXOB 4GSTA 2DIYA 4AKXB 1AQXA 1ERUA 2H76A 3GUSA 4Z2UA 2PWJA 3MYDA 3TJBA 1Z9HA 3LWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOB A;  1I9D A;  3F63 A;  3Q19 A;  3LXZ A;  3KJY A;  3VUR A;  1X9W B;  5J9C A;  2C3T A;  4DSQ A;  2REM A;  1M9A A;  3LJR A;  3GTU A;  4Q5R A;  4WEY A;  4PUF C;  2V2G A;  2N5F A;  4JZQ A;  3VI5 A;  2M80 A;  3TRQ A;  4ZXG A;  4BL7 A;  2HZF A;  4HZ4 A;  1RW1 A;  2JAD A;  2FWH A;  5IOW A;  4N10 A;  1ZGN A;  5DQS A;  3TKS E;  2K8S A;  4TKY A;  3E0U A;  1EZK A;  8GSS A;  2H66 A;  4HI7 A;  4MK3 A;  5JWQ B;  5CRE A;  4IVF A;  2O8V B;  2GSS A;  2VL2 C;  3TKS C;  2VM2 A;  4POM A;  2AV4 A;  1XWG A;  3IBH A;  2K9F A;  4FYC A;  5DJM A;  2TIR A;  1QUW A;  4PTS A;  1A0F A;  4TXO A;  2WDU A;  1GL8 A;  1GP1 A;  3IHQ A;  3CBU A;  5ECI B;  2K8V A;  2VUP A;  2DJJ A;  1THX A;  1CQH A;  4MZB A;  4K6X A;  1Z7R A;  1NSW A;  2B1L A;  2QGV A;  1V58 A;  4WR4 A;  1XWB A;  1EV4 A;  4FIW A;  1G7O A;  2DJK A;  1SKS B;  4AJ7 A;  4CW9 A;  1A0R P;  2R2J A;  4LL4 B;  1GSS A;  5G5E A;  1SL1 B;  1C72 A;  1SYR A;  3DXB A;  3ZYW A;  4PNF A;  2NTO A;  1AC1 A;  1GTI A;  2V41 A;  2YJ7 A;  5EY6 A;  4TR4 A;  3F8U A;  1WJK A;  2IMI A;  4GF0 A;  1TW9 A;  4PXO A;  3C71 A;  4ECC A;  2YCD A;  4I2U A;  4XS1 A;  2IN3 A;  2JSY A;  5LNK e;  2LV3 A;  4MPG A;  4G0K A;  4OMV A;  1TRV A;  1WE0 A;  3FZ4 A;  1F3B A;  1NHO A;  2DSA A;  1OKD A;  2WUL A;  4N0Z A;  1K0D A;  1PKW A;  1MTC A;  3ZTL A;  4MP4 A;  1S3C A;  3FW2 A;  1SEN A;  5DVB A;  1A2M A;  4H86 A;  3D5J A;  1XVQ A;  3LOR A;  4F9Z A;  3IAS 2;  1U87 A;  3TKR A;  2HI7 A;  1G6Y A;  2MYG A;  2VCQ A;  1Q4J A;  3DIE A;  4EVM A;  5DCG A;  3KMO A;  4KUN A;  3RAZ A;  3FYG A;  4V1A p;  5ECO B;  3BCK A;  4KCE A;  1GTU A;  2H8L A;  1KBN A;  3UAP A;  1EP7 A;  1PA3 A;  5KN2 A;  1O6J A;  2V32 A;  1WRY A;  1EV9 A;  1EEJ A;  2VCZ A;  1ERT A;  2ZCT A;  4USS A;  2PGT A;  1T3B A;  1TDI A;  1FVK A;  1SKW B;  3HXS A;  14GS A;  2CT6 A;  5IO0 A;  2YJH A;  1K0N A;  3HZ8 A;  3ZL5 A;  4GTU A;  3GH6 A;  2XPD A;  5D8I A;  1B4P A;  3D4T A;  4FQU A;  2E7P A;  4ZBB A;  3LXT A;  2LJR A;  2X8H A;  4MA9 A;  3ZML A;  2X8G A;  1M7T A;  3KMN A;  1U88 A;  3SWL A;  3HKR A;  2FY6 A;  1M9B A;  2AYT A;  4KGI A;  1GUM A;  1FAA A;  4NHZ A;  3KP8 A;  3M3M A;  2VM1 A;  4ZL7 A;  3MSZ A;  1G6W A;  4JR4 A;  2IJY A;  2VCW A;  4KND A;  4WKW A;  3HJM A;  2LUS A;  2A2S A;  2GLR A;  3KGK A;  1ZMA A;  2RM6 A;  4AJ8 A;  4MZC A;  1TRS A;  4K7N A;  2B5E A;  1PD2 1;  3K8N A;  1VF1 A;  3UL3 A;  4FO5 A;  3FR3 A;  3IE3 A;  3UMA A;  12GS A;  4PX1 A;  5ID2 B;  4PQI A;  2P5R A;  3KTL A;  3A3T A;  2NPB A;  1TRU A;  2P31 A;  3KTB A;  2V1M A;  4ZB8 A;  4ACS A;  1YDK A;  1LBK A;  1J08 A;  4OO5 A;  1KTE A;  5HR0 A;  1YQ1 A;  5KN3 A;  1XFL A;  1XWK A;  2C3Q A;  3DD3 A;  4NV5 A;  5IMC A;  3U5R E;  4BVY B;  3QAW A;  1H75 A;  2WB9 A;  3TRP A;  1XBS A;  1O8X A;  2KP2 A;  2PPT A;  1S3D A;  4MJA A;  1M2D A;  5IMD A;  2DLX A;  3D21 A;  2PN8 A;  1GSY A;  2PVO C;  4HU9 A;  5HR1 A;  3LYK A;  4OCE A;  5JCW A;  2L4C A;  4HZ2 A;  4I5Q A;  3VWU A;  4MMM A;  1XW5 A;  1ZL9 A;  2GQL A;  2PVQ A;  3P7X A;  2G2Q A;  4IS0 A;  4K7I A;  2H30 A;  2EIO A;  4EDY A;  5IMA A;  2OE1 A;  1BED A;  5ECP B;  4HOJ A;  1UN2 A;  2BJX A;  2H73 A;  1XXU A;  2TRX A;  5HR3 A;  3W8S A;  2HRN A;  1WP0 A;  5ECS A;  3DVW A;  2HT9 A;  5ID2 A;  1A8Y A;  1QFN A;  5ECL B;  1MDI A;  2KHP A;  2J23 A;  16GS A;  2GT5 A;  4MF5 A;  3N5O A;  2IMF A;  6GSY A;  4GSN A;  2LRN A;  1T00 A;  3FK8 A;  5DAL B;  1UVZ A;  2JAC A;  1AW9 A;  2D2Z A;  4F2I A;  4JU5 A;  3UBL A;  1K3Y A;  5D9W A;  4O7H A;  2IIY A;  1K0O A;  1OE7 A;  1PSQ A;  4BVY A;  2YWI A;  4TRX A;  3KM6 A;  2H6X A;  4BWQ A;  1TRW A;  2YWM A;  1X0R A;  5A4W A;  3F9U A;  4BPY A;  2EC4 A;  4YQV A;  2O87 A;  2LKU A;  3HJO A;  5CRG A;  5IMZ A;  2CVB A;  3CRU A;  3FRC A;  4XRD A;  1DE1 A;  1T1V A;  2ON5 A;  4QL7 A;  4I6X A;  3VWV A;  2X8C A;  1QK8 A;  2H6Z A;  2DJ1 A;  2CVK A;  4G10 A;  3I69 A;  2BMX A;  4O5R A;  1AIU A;  3RHB A;  5IQY A;  2BTO T;  2VIM A;  3PR8 A;  2L59 A;  3GKN A;  2VAF A;  3EWL A;  4NAX A;  1SL2 B;  1XPV A;  2QC7 A;  1UA5 A;  1A2J A;  1R5P A;  1J9B A;  3PIN A;  2RLI A;  4ZL8 A;  5F06 A;  3D22 A;  3ED3 A;  1WIK A;  4RUV A;  3ZFB A;  4HU7 A;  3TKQ A;  4KA0 A;  1TOF A;  3BOA A;  4MF6 A;  2ALB A;  3TJJ A;  1PKZ A;  3D0Z A;  5DAL A;  2CA8 A;  3O76 A;  3KD0 A;  1TI3 A;  2RUE A;  4YQU A;  4DSR A;  3QAG A;  1FVJ A;  3EYT A;  3C73 A;  4DSS B;  3LGC A;  2GQM A;  5CO3 A;  4IGJ A;  4L0W A;  1OKT A;  2O85 A;  3MWH A;  1LU4 A;  4XCS A;  3WT2 A;  2RUF A;  2L57 A;  2WFC A;  1ERV A;  4K0G A;  4OCF A;  2UZ8 A;  1GH2 A;  4EL1 A;  3VPT A;  2VO4 A;  1TKD B;  4Z7X A;  5G1L A;  1X5E A;  3FKF A;  2ES7 A;  2LEG A;  1X5D A;  1FOV A;  3NOF A;  1OE8 A;  3QMX A;  1ST9 A;  2H71 A;  1O73 A;  2GZZ A;  3TOU A;  1OC8 A;  5HQP A;  9GSS A;  5D9X A;  3NIV A;  4ECB A;  2DBC A;  1XCC A;  1PL1 A;  6GST A;  1W4V A;  4HJ2 A;  3KZQ A;  22GS A;  2FA4 A;  1YKA A;  2LRT A;  13GS A;  3F6D A;  4HEA 2;  2FCH A;  1YKC A;  3APQ A;  4KX4 A;  5A4V A;  1SK0 A;  2CAI A;  3QOU A;  4X1U A;  2B1K A;  3L9S A;  4CDO A;  2HRK B;  4G19 A;  1XWC A;  2C80 A;  2WZ9 A;  1Z7P A;  2YWO A;  1N8J A;  3ZRE A;  3HYP A;  6GSS A;  3US3 A;  3TOT A;  4HQS A;  2O89 A;  2RII A;  2VOC A;  1Z6M A;  1R26 A;  3F4T A;  3HDC A;  3VFI A;  5F05 A;  1BJX A;  4F03 A;  2K18 A;  1JZD A;  4DVC A;  2NVL A;  1UC7 A;  4IJ3 A;  2MMA A;  3QCP A;  4YAV A;  2X64 A;  2YWN A;  2GST A;  4TOP A;  1GTB A;  5CP1 A;  3VK9 A;  5JWR B;  3UOM A;  1ERW A;  3ZLP A;  5E4W A;  4WF4 A;  2FA8 A;  3LG6 A;  2F9S A;  5B6N A;  5DBQ A;  4WBJ A;  3CSI A;  4NXI A;  3H8Q A;  4ILF A;  1N2A A;  1XOA A;  5A4U A;  2HSN B;  5E59 A;  1MEK A;  1GLQ A;  3FR6 A;  1TJD A;  2LST A;  1QXH A;  3VWX A;  2CVD A;  1SKR B;  3M0F A;  1T8E B;  4YH2 A;  2H1A A;  2FLS A;  2C3N A;  4GSS A;  2XHF A;  2F8A A;  4AGS A;  1K0M A;  3CTG A;  4HDE A;  3FY7 A;  2G0F A;  5HFI A;  3H93 A;  1XVW A;  2HRK A;  3I6A A;  1X9S B;  1W89 A;  5GST A;  2VD1 A;  2VCX A;  3GNJ A;  3ME8 A;  5H5S A;  2HNL A;  2AHE A;  4ZB9 A;  3ZVJ A;  2LNS A;  4MCU A;  1FHE A;  2IL3 A;  1GUK A;  4KH7 A;  2LTK A;  5J3R A;  2E2G A;  20GS A;  5FWG A;  3L9U A;  4EO3 A;  1SJ6 A;  2LRC A;  4V2N A;  3L78 A;  3GA4 A;  3FZ5 A;  5DQY A;  5DJL A;  4WF5 A;  2HZE B;  2H72 A;  1GWC A;  4GWR A;  3EIN A;  1GNE A;  4IP1 A;  3P8W A;  4K0N A;  2CAQ A;  3E9J B;  4KSO A;  2K6V A;  5JCU A;  4JED A;  1NW2 A;  1SU9 A;  2IME A;  4I97 A;  2LJA A;  2WCI A;  2ZUP A;  3O3T A;  1QMV A;  1AAZ A;  1A24 A;  7GSS A;  3FHK A;  3DEX A;  1USB A;  3Q6O A;  3LEF A;  4G0I A;  1GNW A;  4KDX A;  1K0C A;  3ZVJ D;  1DBY A;  3GHA A;  5D9T A;  4EC0 A;  2VL2 A;  3TKS A;  2OBI A;  3EU4 A;  1Z5Y E;  5A5K A;  3GKX A;  3PH9 A;  2GVP A;  1CQG A;  1XWA A;  2C1Y A;  2HSY A;  1YY7 A;  3GMF A;  1MDK A;  1K3O A;  1ILO A;  4ML1 A;  3GX0 A;  4IBP A;  1SJI A;  3IPZ A;  1THO A;  2WS2 A;  2GZP A;  2WRT A;  3F4S A;  2WGR A;  3IAM 2;  3DGQ A;  3MDK A;  3PPU A;  1V98 A;  5JCG A;  3RPN A;  3TJG A;  2OKA A;  3L0H A;  3ZIV A;  5CRW A;  3C8E A;  1PX6 A;  2H70 A;  2VLV A;  2LNT A;  2HZE A;  1V2A A;  1SJZ A;  2R3X A;  4OFM A;  4WXT A;  2WJU A;  3EU3 A;  3VWW A;  1BQ7 A;  4GLT A;  2JZT A;  4MDC A;  3IRA A;  1EEM A;  1EOH A;  2HQT A;  5IPG A;  3ZIT A;  2OBK A;  3VPQ A;  3CMI A;  4N30 A;  2C0D A;  2F8F A;  1JLV A;  1VF2 A;  5J5N A;  4QQ7 A;  2QSI A;  3EC3 A;  2HFD A;  3LYP A;  2JZS A;  4BVX B;  3ZIJ A;  3IC4 A;  4FYB A;  2R37 A;  4EF0 A;  2JSZ A;  1M0U A;  4TN8 A;  3GST A;  3GRX A;  6GSW A;  3BCI A;  5CYY A;  4IW9 A;  5EPF A;  1Y25 A;  5G5F A;  4JR6 A;  3S9F A;  4KE3 A;  2FGX A;  3G9B A;  3W6G A;  2YZU A;  4L5L A;  4KSM A;  2HSH A;  1G7E A;  1ZOF A;  4MAB A;  3CYN A;  1XZO A;  4ID0 A;  3WGD A;  2B3S A;  4LA1 A;  5FT3 A;  2H01 A;  1VRS D;  4ZB6 A;  3OR5 A;  2E0Q A;  1O8W A;  5ECK B;  4P3Y B;  2YZH A;  1FO5 A;  1SYX A;  3TGZ A;  2H1G A;  2FUG 2;  2L5O A;  3HZ4 A;  1VF4 A;  1TK8 B;  1GLP A;  3HJP A;  5B8A A;  3VLN A;  2GGT A;  1KEB A;  3EE2 A;  3G7I A;  4EE0 A;  3IR4 A;  1IYI A;  1AQV A;  2N5A A;  2H0H A;  4XIH A;  4NHW A;  2E2M A;  1A8L A;  1HNC A;  1Z3E A;  1ZZY A;  2L6D A;  2MMZ A;  1JLW A;  4F82 A;  4L0U A;  1GSD A;  3KEB A;  3J7Y b;  1WMJ A;  1YJ6 A;  4BVX A;  1YF0 A;  3TB2 A;  1WOU A;  3TUE A;  2I1U A;  3IXR A;  4XRA A;  5GAP D;  5COH A;  2YPM A;  3IV4 A;  2CV4 A;  5HR2 A;  3A2W A;  4O32 A;  3EUR A;  3AY8 A;  1B8X A;  4K8M A;  3ERF A;  4D73 B;  5EVO A;  2IMK A;  1F9M A;  1HD2 A;  1DUG A;  1Y6E A;  1EP8 A;  3QDN A;  2YN1 A;  1EGR A;  5ELG A;  4MH3 A;  3A2X A;  5ECN B;  1ML6 A;  1PGT A;  3V1W A;  18GS A;  2M72 A;  2O7K A;  3EMX A;  3H79 A;  3EMP A;  5G31 A;  1GSQ A;  3GUR A;  5J9B A;  3CSJ A;  3MAK A;  1SK1 A;  4WBR D;  2FHE A;  3WD6 A;  4TW5 A;  2H6Y A;  3Q18 A;  2I9H A;  4AJ6 A;  1B48 A;  1DE2 A;  2IWT A;  4Q5N A;  4WR5 A;  4I2T A;  4WET A;  4ULX A;  2B7J A;  1URM A;  2KLX A;  3QFA C;  4KCA A;  1XIY A;  2PBJ A;  3I43 A;  2OE3 A;  4GXZ A;  3GTU B;  5CAX A;  3FZ9 A;  1PMT A;  1HNB A;  5GSS A;  1YZX A;  3QR6 A;  1I5G A;  1V9W A;  2XBQ A;  1JHB A;  2J9H A;  4IEL A;  1R7H A;  1AUC A;  2H0I A;  17GS A;  5IOX A;  4BL7 B;  3DVX A;  3IA1 A;  1SL0 B;  4IN0 A;  1TK5 B;  3HVX A;  1O7U A;  3C7M A;  2M46 A;  4NV2 A;  1K0A A;  1PRX A;  3I9V 2;  2B6M A;  3HHV A;  2MBT A;  4MJB A;  4YQM A;  5L71 A;  3H1N A;  1TTZ A;  2C8U A;  4D73 A;  3F6F A;  2PUK C;  2CZ3 A;  5EL8 A;  1TP9 A;  3QFB C;  1O85 A;  4L5O A;  2B5Y A;  3UAR A;  4LLR A;  2GDR A;  5HFK A;  1QGV A;  2AUV A;  1T7P B;  4IP6 A;  3E3E A;  2A4V A;  1EOG A;  4K9Z A;  5IMF A;  3FR9 A;  5ABR A;  5D73 A;  3ME7 A;  3RDW A;  2VD0 A;  1XW6 A;  1PL2 A;  4MF7 A;  2CX4 A;  1U3I A;  5KEJ A;  4TVE A;  2RM5 A;  2KUC A;  1WWJ A;  5DCH A;  4XS6 A;  2DMM A;  1TU8 A;  2EIQ A;  2OAC A;  3EVI A;  4AF2 A;  2NBS A;  2C0F A;  2ZNM A;  5IMV A;  4OD7 A;  2R6K A;  3VI7 A;  4ISD A;  1R4W A;  5KN1 A;  2YV7 A;  2C4J A;  2QKE A;  4MJC A;  3H4K A;  5AN1 A;  2GS3 A;  1F37 A;  1K0B A;  1E2Y A;  1ZCP A;  1PN9 A;  5GZZ B;  1T4Y A;  4PNG A;  3M1G A;  1JZO A;  2OE0 A;  3BBY A;  4BWS A;  4PQ1 A;  2FWG A;  2DML A;  4OO4 A;  2PER A;  4N0V A;  3PGT A;  1V57 A;  5G30 A;  3F0I A;  1A23 A;  2H0G A;  3GV1 A;  1H4O A;  3CXG A;  4DSS A;  3APS A;  3QD9 A;  5ECQ B;  5B7C A;  2GZY A;  1QQ2 A;  2OJL A;  5G2Z A;  4V2L A;  1NM3 A;  1ZYQ B;  1B9X C;  4OFN A;  2C0G A;  4Q5F A;  3G7Y A;  3HVS A;  2DJ2 A;  1GSF A;  2VLU A;  1FG4 A;  10GS A;  3W8J A;  1X9M B;  2XBI A;  5HFG A;  3ZMK A;  2FWE A;  1ACV A;  4FH8 A;  5CRH A;  2DJ0 A;  5AGY A;  2JU5 A;  4KDY A;  1KNG A;  1S3A A;  1PX7 A;  3ISO A;  2P0G A;  2IMD A;  3KH9 A;  2VCV A;  4J56 E;  3MNG A;  3O6T A;  3JCM L;  4ZL9 A;  4MH2 A;  2Z9S A;  1F3A A;  1HNA A;  2HRA A;  5LCZ A;  6GSX A;  4J57 E;  2MZC A;  1B4Q A;  2I3Y A;  3LQ7 A;  4GRF A;  1T4Z A;  3FEU A;  3GL3 A;  1M2A A;  3CTF A;  5J41 A;  5C04 A;  4NMU A;  1WPI A;  2H74 A;  4ZBD A;  1B9Y C;  3P90 A;  3RBT A;  5D96 A;  1J0F A;  2HE3 A;  1JZR A;  1RK4 A;  3HA9 A;  1RQM A;  3APO A;  5H5R A;  1R5A A;  3D6I A;  1IYH A;  3A5W A;  4J2F A;  3DML A;  3GSS A;  1GSE A;  1FW1 A;  4Q5Q A;  3RPP A;  2TRC P;  3WGE A;  1ON4 A;  1X5C A;  2C0E A;  2L4Q A;  4GQC A;  4YAP A;  3F4R A;  2V6K A;  3UVT A;  4OWY A;  11GS A;  2HRF A;  5C00 A;  2VL3 A;  3TDG A;  3WGX A;  5BMU A;  1AQW A;  2GSQ A;  1M2B A;  3WYW A;  4E8H A;  3UIW A;  2PU9 C;  1GUL A;  3KP9 A;  2L5L A;  1F2E A;  4ECI A;  1HYU A;  5F07 A;  4IQ1 A;  2FNO A;  1SD8 A;  4XS4 B;  1NHY A;  2LQQ A;  3ZFL A;  2FWF A;  4KAE A;  1MD4 A;  2GT6 A;  2EIR A;  2H1D A;  4EXJ A;  2IFQ B;  2N5B A;  2MMO A;  1GRX A;  2F3M A;  3DWV A;  5ECM B;  1AXD A;  3IK9 A;  5G1K A;  5JWO B;  4HUA A;  2LQO A;  2AJQ B;  3D4M A;  3HCZ A;  5INY A;  3C1R A;  19GS A;  2VCT A;  1VGL A;  4ECJ A;  5AIS A;  3UBK A;  2X99 A;  2YAN A;  2NDO A;  1O81 A;  4X0X A;  3IOS A;  5LD0 A;  1G0T A;  1MDJ A;  4E8E A;  4KF9 A;  5DDL A;  3SBC A;  5F8B A;  4ML6 A;  1VF3 A;  1A2L A;  2XPE A;  1XW9 A;  3HY2 A;  2FD3 A;  4DEJ A;  3KXO A;  1LJR A;  4KB3 A;  5IO2 A;  4PUR A;  5CRD A;  3P2A A;  2I4A A;  5H5Q A;  3LFL A;  2GTU A;  1BAY A;  1ZYE A;  4PGT A;  2I81 A;  3M9K A;  3M8N A;  4F0B A;  4HS1 A;  2IPA A;  1DSB A;  4MJE A;  3ERG A;  4JRR A;  3QPM A;  2OAD A;  4I8B A;  4MZW A;  3G7J A;  3L9V A;  5DAK B;  2YP6 A;  5J4U A;  1JZW A;  3RHC A;  4V1A g;  2KP1 A;  5D93 A;  3Q74 A;  4XS4 A;  1FB0 A;  4XHM A;  5CNW A;  2H1B A;  4NPB A;  2JL4 A;  6GSU A;  4K7O A;  3GX8 A;  4X43 A;  4ZIJ A;  3NZN A;  4IJI A;  2IFQ A;  4KW6 A;  4IKH A;  2XC2 A;  4MLY A;  1FB6 A;  2HSM B;  3N9J A;  3GH9 A;  4ZBA A;  3HVV A;  1E6B A;  5ECH B;  4F0C A;  4K2D A;  4RQX A;  4LMW A;  1SK2 A;  2H19 A;  4OFT A;  3IC8 A;  3WT1 A;  5FHI A;  1TXX A;  3UJ1 A;  2VLT A;  2AB6 A;  1YEP A;  4G9H A;  3QAV A;  4LMV A;  4IQA A;  4TR1 B;  1BG5 A;  1GSU A;  3M9J A;  4N11 A;  3KH7 A;  4ZIL A;  3R3E A;  2CX3 A;  4K1F A;  5F0G A;  3LSZ A;  4MPF A;  1K3L A;  1OC9 B;  3A2V A;  2A2R A;  1U6T A;  3GKK A;  1GUH A;  4EDZ A;  3KIJ A;  3ERW A;  1EWX A;  4NWY A;  2YNX A;  2L6C A;  3IK7 A;  1U3A A;  4BA7 A;  1Z6N A;  5ECR B;  3TKP A;  1Q98 A;  4JBB A;  3L4N A;  5DAK A;  5AIV A;  3DYR A;  3TCO A;  3KCM A;  3GIX A;  3BJ5 A;  4PQH A;  1GTA A;  1YF1 A;  3UEM A;  1OC3 A;  2DIZ A;  3TRX A;  4KDU A;  4RQR A;  5KN0 A;  3UVH A;  2DC5 A;  1BX9 A;  3ZZX A;  2HSM A;  3C1S A;  2GSR A;  2H75 A;  1F6M C;  1OYJ A;  2OA7 A;  3U6V A;  5IM9 A;  3BD2 A;  3GKM A;  1OVN A;  4GQF A;  5AIX A;  4FYU A;  2R4V A;  4G2E A;  5B8B A;  1TU7 A;  1ABA A;  3F3R A;  4EUY A;  2YV9 A;  4G0L A;  3FZA A;  4HQZ A;  2F51 A;  2V6O A;  4TR1 A;  1OAZ A;  4JE1 A;  1YEX A;  1HQO A;  2YOI A;  2AAW A;  1TI1 A;  2HXK A;  4POK A;  4RI7 A;  1OC9 A;  5B6M A;  4POB A;  4L8E A;  3HD5 A;  2ON7 A;  2GQK A;  2R5G A;  1MD3 A;  5D9V A;  3GFK A;  2LJK A;  4POL A;  4HJM A;  5IPH A;  2LS5 A;  4IHU A;  4CHS A;  4PUA A;  4GCI A;  5IIZ A;  4EKZ A;  2CZ2 A;  1JFU A;  4O92 A;  1M99 A;  1PQN A;  4TR3 A;  1SD9 A;  1V40 A;  3CRT A;  2KOK A;  3TJF A;  3J7Y k;  6GSV A;  3R2Q A;  4XTS A;  3IDV A;  2PMT A;  4RI6 A;  5ENU A;  3TJK A;  2JZR A;  5GAN D;  2MBS A;  2HLS A;  4QL9 A;  1BYE A;  4TXV A;  4LL1 B;  3F3Q A;  4TR0 A;  2B5X A;  2B7K A;  3DKS A;  3GYK A;  1TK0 B;  2MMN A;  3CSH A;  1EGO A;  3ZRD A;  2CQ9 A;  4V2M A;  2DJ3 A;  2HYX A;  3DRN A;  3GN3 A;  2P5Q A;  2VL9 A;  3GL5 A;  5ELA A;  4TXO B;  4GST A;  2DIY A;  1AQX A;  1ERU A;  2H76 A;  3GUS A;  2PWJ A;  3TJB A;  1Z9H A;  3LWA A; 
#chains in the Genus database with same CATH topology
 1XOB A;  1I9D A;  3F63 A;  3Q19 A;  3LXZ A;  3KJY A;  3VUR A;  1X9W B;  5J9C A;  2C3T A;  4K5S A;  4DSQ A;  2REM A;  1M9A A;  3LJR A;  2X4A A;  3GTU A;  4Q5R A;  4WEY A;  4PUF C;  2V2G A;  2N5F A;  4JZQ A;  3VI5 A;  2M80 A;  3TRQ A;  4ZXG A;  4BL7 A;  2HZF A;  3RFR C;  4HZ4 A;  1RW1 A;  2JAD A;  2FWH A;  2QA1 A;  5IOW A;  4N10 A;  1ZGN A;  5DQS A;  3TKS E;  2K8S A;  4TKY A;  3E0U A;  1EZK A;  8GSS A;  2H66 A;  4HI7 A;  4MK3 A;  5JWQ B;  5CRE A;  4IVF A;  2O8V B;  2GSS A;  2VL2 C;  3TKS C;  2VM2 A;  4POM A;  2AV4 A;  1XWG A;  3IBH A;  2K9F A;  4FYC A;  5DJM A;  2TIR A;  1QUW A;  4PTS A;  1A0F A;  4TXO A;  2WDU A;  1GL8 A;  1GP1 A;  3IHQ A;  3CBU A;  5ECI B;  2K8V A;  2VUP A;  2DJJ A;  1THX A;  1CQH A;  4MZB A;  4K6X A;  1Z7R A;  1NSW A;  2B1L A;  2QGV A;  1V58 A;  2R0P A;  4WR4 A;  1XWB A;  1EV4 A;  4G01 A;  4FIW A;  1G7O A;  2DJK A;  1SKS B;  4AJ7 A;  4CW9 A;  1A0R P;  2R2J A;  4LL4 B;  1GSS A;  5G5E A;  1SL1 B;  1C72 A;  1SYR A;  5KOW A;  3DXB A;  3ZYW A;  4PNF A;  2NTO A;  1AC1 A;  1GTI A;  2V41 A;  2YJ7 A;  5EY6 A;  4TR4 A;  3F8U A;  1WJK A;  2IMI A;  4GF0 A;  4AI6 A;  1TW9 A;  4K2X A;  1XG8 A;  4PXO A;  3C71 A;  4ECC A;  2YCD A;  4I2U A;  4XS1 A;  4BIK A;  4GDF A;  2IN3 A;  2JSY A;  5A5H B;  5LNK e;  2LV3 A;  4MPG A;  4G0K A;  4OMV A;  1TRV A;  1WE0 A;  3FZ4 A;  1F3B A;  1NHO A;  2DSA A;  1OKD A;  2WUL A;  4N0Z A;  1K0D A;  1PKW A;  1MTC A;  3ZTL A;  4MP4 A;  1S3C A;  3FW2 A;  1SEN A;  5DVB A;  1A2M A;  4H86 A;  2WW3 A;  3D5J A;  1XVQ A;  3LOR A;  4F9Z A;  3IAS 2;  1U87 A;  3TKR A;  2HI7 A;  1G6Y A;  2MYG A;  2VCQ A;  1Q4J A;  3DIE A;  4EVM A;  5DCG A;  3KMO A;  4KUN A;  3RAZ A;  3FYG A;  4V1A p;  5ECO B;  3BCK A;  4KCE A;  1GTU A;  2H8L A;  1KBN A;  3UAP A;  1EP7 A;  1M3I A;  1PA3 A;  5KN2 A;  1O6J A;  2V32 A;  1WRY A;  1EV9 A;  1EEJ A;  2VCZ A;  3MIX A;  1ERT A;  2ZCT A;  4EIQ A;  2WZS A;  4USS A;  2PGT A;  1T3B A;  2EFC A;  1TDI A;  3FMW A;  1FVK A;  1SKW B;  2H1L A;  3HXS A;  14GS A;  2CT6 A;  5IO0 A;  2YJH A;  5A5H A;  1K0N A;  3HZ8 A;  3ZL5 A;  4GTU A;  3GH6 A;  2XPD A;  5D8I A;  1B4P A;  1FOH A;  3D4T A;  4FQU A;  1N25 A;  1ZYN A;  2E7P A;  4EIP A;  4ZBB A;  4AKI A;  3LXT A;  2LJR A;  2X8H A;  4MA9 A;  3ZML A;  2X8G A;  1M7T A;  3KMN A;  1U88 A;  3SWL A;  3HKR A;  2FY6 A;  1M9B A;  2AYT A;  4KGI A;  1GUM A;  1FAA A;  4NHZ A;  3KP8 A;  1SVO A;  3M3M A;  2VM1 A;  4ZL7 A;  3MSZ A;  1G6W A;  4JR4 A;  2IJY A;  2VCW A;  4KND A;  4WKW A;  3HJM A;  2LUS A;  2A2S A;  2GLR A;  3KGK A;  1ZMA A;  2RM6 A;  4AJ8 A;  4MZC A;  1TRS A;  4K7N A;  2B5E A;  1PD2 1;  3K8N A;  1VF1 A;  3UL3 A;  4FO5 A;  3FR3 A;  3TU3 B;  3IE3 A;  3UMA A;  12GS A;  4PX1 A;  5ID2 B;  4PQI A;  2P5R A;  3KTL A;  3A3T A;  2NPB A;  1TRU A;  2P31 A;  3KTB A;  2V1M A;  4ZB8 A;  4ACS A;  1YDK A;  1LBK A;  1J08 A;  4OO5 A;  1KTE A;  5HR0 A;  1YQ1 A;  5KN3 A;  1XFL A;  1XWK A;  2C3Q A;  3DD3 A;  4NV5 A;  5IMC A;  3U5R E;  4BVY B;  3QAW A;  1H75 A;  2WB9 A;  3TRP A;  1XBS A;  1O8X A;  2KP2 A;  2PPT A;  1S3D A;  4MJA A;  1M2D A;  5IMD A;  2DLX A;  3D21 A;  2PN8 A;  1GSY A;  2PVO C;  4HU9 A;  5HR1 A;  3LYK A;  4OCE A;  5JCW A;  2L4C A;  4HZ2 A;  4I5Q A;  3VWU A;  4MMM A;  1XW5 A;  1ZL9 A;  2GQL A;  2PVQ A;  3P7X A;  2G2Q A;  4IS0 A;  4E68 A;  4K7I A;  2H30 A;  2EIO A;  4EDY A;  5IMA A;  2OE1 A;  4CY6 A;  1BED A;  5ECP B;  4HOJ A;  1UN2 A;  2BJX A;  2H73 A;  1XXU A;  2TRX A;  5HR3 A;  3W8S A;  2HRN A;  1WP0 A;  5ECS A;  3DVW A;  2HT9 A;  5ID2 A;  1A8Y A;  1QFN A;  5ECL B;  1MDI A;  2KHP A;  2J23 A;  16GS A;  2GT5 A;  4MF5 A;  3N5O A;  2O36 A;  2IMF A;  6GSY A;  4GSN A;  2LRN A;  1T00 A;  3FK8 A;  5DAL B;  1UVZ A;  2JAC A;  1AW9 A;  3CHX C;  2D2Z A;  4F2I A;  4JU5 A;  1Y1U A;  3UBL A;  1K3Y A;  5D9W A;  4O7H A;  2IIY A;  1K0O A;  1OE7 A;  1PSQ A;  4BVY A;  2YWI A;  4TRX A;  3KM6 A;  2H6X A;  4BWQ A;  1TRW A;  2YWM A;  1X0R A;  5A4W A;  3F9U A;  4BPY A;  2EC4 A;  4YQV A;  2O87 A;  2LKU A;  3HJO A;  3IHG A;  5CRG A;  5IMZ A;  2CVB A;  3CRU A;  3FRC A;  4XRD A;  1DE1 A;  1PN0 A;  1T1V A;  2ON5 A;  4QL7 A;  4I6X A;  3VWV A;  2X8C A;  1QK8 A;  2H6Z A;  3A5I A;  2DJ1 A;  2CVK A;  4G10 A;  2QA2 A;  3I69 A;  2BMX A;  4O5R A;  1AIU A;  3RHB A;  5IQY A;  3EPT A;  2BTO T;  2VIM A;  3PR8 A;  2L59 A;  3GKN A;  2VAF A;  3EWL A;  4NAX A;  1SL2 B;  1XPV A;  2QC7 A;  1UA5 A;  1A2J A;  1R5P A;  1J9B A;  3PIN A;  2RLI A;  4ZL8 A;  5F06 A;  3D22 A;  3ED3 A;  1WIK A;  4RUV A;  3ZFB A;  4HU7 A;  3TKQ A;  4KA0 A;  1TOF A;  3BOA A;  5J40 A;  4MF6 A;  2ALB A;  3TJJ A;  1PKZ A;  3D0Z A;  5DAL A;  2CA8 A;  3O76 A;  3KD0 A;  1TI3 A;  2RUE A;  4YQU A;  4DSR A;  3QAG A;  1FVJ A;  3EYT A;  3C73 A;  4DSS B;  3LGC A;  2GQM A;  5CO3 A;  4IGJ A;  4L0W A;  1OKT A;  2O85 A;  3MWH A;  1SVL A;  1LU4 A;  4XCS A;  3WT2 A;  2RUF A;  2L57 A;  2WFC A;  1ERV A;  4K0G A;  4OCF A;  2UZ8 A;  1GH2 A;  4EL1 A;  3VPT A;  2VO4 A;  1TKD B;  4Z7X A;  5G1L A;  1YVL A;  1X5E A;  3FKF A;  2ES7 A;  2LEG A;  1X5D A;  1FOV A;  3NOF A;  1OE8 A;  3QMX A;  1ST9 A;  2H71 A;  1O73 A;  2GZZ A;  3TOU A;  1OC8 A;  5HQP A;  9GSS A;  5D9X A;  3NIV A;  4ECB A;  2DBC A;  1XCC A;  1PL1 A;  5A34 B;  6GST A;  1W4V A;  4HJ2 A;  3KZQ A;  22GS A;  2FA4 A;  1YKA A;  2LRT A;  13GS A;  3F6D A;  4HEA 2;  2FCH A;  1YKC A;  3APQ A;  4KX4 A;  5A4V A;  1SK0 A;  2CAI A;  3QOU A;  4FXY P;  4X1U A;  2B1K A;  3L9S A;  4CDO A;  2HRK B;  4G19 A;  1XWC A;  2C80 A;  2WZ9 A;  1Z7P A;  2YWO A;  1N8J A;  3ZRE A;  3HYP A;  4O5U A;  6GSS A;  3US3 A;  3TOT A;  4HQS A;  2O89 A;  2RII A;  2VOC A;  1Z6M A;  1R26 A;  3F4T A;  3HDC A;  3VFI A;  5F05 A;  1BJX A;  4F03 A;  2K18 A;  1JZD A;  4DVC A;  2NVL A;  2R0G A;  1UC7 A;  4IJ3 A;  2MMA A;  3QCP A;  4YAV A;  2X64 A;  2YWN A;  2GST A;  4TOP A;  1GTB A;  5CP1 A;  3VK9 A;  5JWR B;  3UOM A;  1ERW A;  3ZLP A;  5E4W A;  1TXU A;  4WF4 A;  2FA8 A;  3LG6 A;  2VKZ G;  2F9S A;  5B6N A;  5DBQ A;  4WBJ A;  3CSI A;  4NXI A;  3H8Q A;  4ILF A;  1N2A A;  1XOA A;  5A4U A;  2HSN B;  5E59 A;  1MEK A;  1GLQ A;  3FR6 A;  3HVN A;  1TJD A;  2LST A;  1QXH A;  3VWX A;  2CVD A;  1SKR B;  3M0F A;  1T8E B;  4YH2 A;  2H1A A;  2FLS A;  2C3N A;  4Z2T A;  4GSS A;  4MNN A;  2XHF A;  2F8A A;  4AGS A;  1K0M A;  3CTG A;  4HDE A;  3FY7 A;  2G0F A;  5HFI A;  3H93 A;  2WW2 A;  1XVW A;  2HRK A;  3I6A A;  1X9S B;  1W89 A;  5GST A;  2VD1 A;  2VCX A;  3GNJ A;  3ME8 A;  5H5S A;  2HNL A;  2AHE A;  4ZB9 A;  3ZVJ A;  2LNS A;  4MCU A;  1FHE A;  2IL3 A;  5A1N B;  1GUK A;  4KH7 A;  2LTK A;  5J3R A;  2E2G A;  20GS A;  5FWG A;  3L9U A;  4EO3 A;  1SJ6 A;  2LRC A;  4V2N A;  3L78 A;  3GA4 A;  3FZ5 A;  5DQY A;  5DJL A;  4WF5 A;  2HZE B;  2H72 A;  1GWC A;  4GWR A;  3EIN A;  1GNE A;  4IP1 A;  3P8W A;  4K0N A;  2CAQ A;  3E9J B;  4KSO A;  2O5V A;  2K6V A;  5JCU A;  2WVZ A;  4JED A;  1NW2 A;  1SU9 A;  2IME A;  4I97 A;  2LJA A;  2WCI A;  2ZUP A;  3O3T A;  1QMV A;  1AAZ A;  1A24 A;  7GSS A;  3FHK A;  3DEX A;  1USB A;  3Q6O A;  3LEF A;  4G0I A;  1GNW A;  4KDX A;  1K0C A;  3ZVJ D;  5J4V A;  3GHA A;  1DBY A;  5D9T A;  4EC0 A;  2VL2 A;  3TKS A;  2OBI A;  3EU4 A;  1Z5Y E;  5A5K A;  3GKX A;  3PH9 A;  2GVP A;  1CQG A;  2EFE A;  1XWA A;  2C1Y A;  2HSY A;  1YY7 A;  3GMF A;  1MDK A;  1K3O A;  1ILO A;  4ML1 A;  3GX0 A;  1I1I P;  4IBP A;  1SJI A;  2UV8 G;  1THO A;  3IPZ A;  2WS2 A;  2GZP A;  2WRT A;  3F4S A;  5A1N A;  2WGR A;  3IAM 2;  3DGQ A;  3MDK A;  3PPU A;  1V98 A;  5JCG A;  3RPN A;  3TJG A;  2OKA A;  3L0H A;  3ZIV A;  5CRW A;  3C8E A;  1PX6 A;  2H70 A;  2VLV A;  2LNT A;  2HZE A;  1V2A A;  1SJZ A;  4HSC X;  2R3X A;  4OFM A;  4WXT A;  2WJU A;  3EU3 A;  3VWW A;  1BQ7 A;  2O3E A;  4GLT A;  5J4Y A;  2JZT A;  4MDC A;  3IRA A;  1EEM A;  1EOH A;  2HQT A;  2WVY A;  5IPG A;  3ZIT A;  2OBK A;  3VPQ A;  3CMI A;  4N30 A;  2C0D A;  2F8F A;  1JLV A;  1VF2 A;  5J5N A;  4QQ7 A;  2QSI A;  3EC3 A;  2HFD A;  3LYP A;  2JZS A;  4BVX B;  3ZIJ A;  3IC4 A;  4FYB A;  2R37 A;  4EF0 A;  2JSZ A;  1M0U A;  4TN8 A;  3GST A;  3GRX A;  2WW0 A;  6GSW A;  3BCI A;  5CYY A;  2OT3 A;  4IW9 A;  5EPF A;  1Y25 A;  5G5F A;  4JR6 A;  3S9F A;  4KE3 A;  2FGX A;  3G9B A;  3W6G A;  2YZU A;  4L5L A;  4KSM A;  2HSH A;  1G7E A;  1ZOF A;  4MAB A;  3CYN A;  1XZO A;  4ID0 A;  3WGD A;  2B3S A;  4LA1 A;  5FT3 A;  2H01 A;  1VRS D;  4ZB6 A;  3OR5 A;  2E0Q A;  1O8W A;  5ECK B;  4P3Y B;  2YZH A;  1FO5 A;  1SYX A;  3TGZ A;  2H1G A;  2FUG 2;  2L5O A;  2EFD A;  1VF4 A;  3HZ4 A;  1TK8 B;  1GLP A;  3HJP A;  5B8A A;  3VLN A;  2GGT A;  1KEB A;  3EE2 A;  3G7I A;  4EE0 A;  3IR4 A;  1IYI A;  1AQV A;  2N5A A;  1ZYP A;  2H0H A;  4XIH A;  4NHW A;  2E2M A;  1A8L A;  1HNC A;  1Z3E A;  4W66 A;  1ZZY A;  2L6D A;  2MMZ A;  1JLW A;  4F82 A;  4L0U A;  1GSD A;  3KEB A;  3J7Y b;  1WMJ A;  1YJ6 A;  1BF5 A;  4BVX A;  1YF0 A;  4PI2 C;  3TB2 A;  1WOU A;  3TUE A;  2DKH A;  2I1U A;  3IXR A;  4XRA A;  5GAP D;  5COH A;  2YPM A;  3IV4 A;  2CV4 A;  5HR2 A;  3A2W A;  4O32 A;  3EUR A;  3AY8 A;  1B8X A;  4YKG A;  4K8M A;  3ERF A;  4D73 B;  5EVO A;  2IMK A;  1F9M A;  1HD2 A;  1DUG A;  1Y6E A;  1EP8 A;  3QDN A;  2YN1 A;  1EGR A;  5ELG A;  4X4J A;  4MH3 A;  3A2X A;  5ECN B;  1ML6 A;  1PGT A;  3V1W A;  18GS A;  2M72 A;  2O7K A;  3EMX A;  3H79 A;  3EMP A;  5G31 A;  1GSQ A;  3GUR A;  5J9B A;  3CSJ A;  3MAK A;  1SK1 A;  4WBR D;  2FHE A;  3WD6 A;  4TW5 A;  2H6Y A;  3Q18 A;  2I9H A;  4AJ6 A;  1B48 A;  1DE2 A;  2IWT A;  4Q5N A;  4WR5 A;  4I2T A;  4WET A;  4ULX A;  2B7J A;  1URM A;  2KLX A;  3QFA C;  4KCA A;  1XIY A;  4AKG A;  2PBJ A;  3I43 A;  2OE3 A;  4GXZ A;  3GTU B;  5CAX A;  3FZ9 A;  1PMT A;  1HNB A;  5GSS A;  1YZX A;  3QR6 A;  1I5G A;  1V9W A;  2XBQ A;  1JHB A;  2J9H A;  4IEL A;  1R7H A;  1AUC A;  2H0I A;  4ICY A;  17GS A;  5IOX A;  4BL7 B;  3DVX A;  3IA1 A;  1SL0 B;  4IN0 A;  1TK5 B;  3HVX A;  1O7U A;  3C7M A;  2M46 A;  4NV2 A;  1K0A A;  1PRX A;  3I9V 2;  2B6M A;  3HHV A;  2MBT A;  4MJB A;  4YQM A;  5L71 A;  3H1N A;  1TTZ A;  2C8U A;  4D73 A;  3F6F A;  2PUK C;  1BG1 A;  2CZ3 A;  5EL8 A;  1TP9 A;  3QFB C;  1O85 A;  4L5O A;  2B5Y A;  3UAR A;  4LLR A;  2GDR A;  5HFK A;  1QGV A;  2AUV A;  4YKF A;  1T7P B;  4IP6 A;  3E3E A;  2A4V A;  1EOG A;  4K9Z A;  5IMF A;  3FR9 A;  5ABR A;  5D73 A;  3ME7 A;  1M3J A;  2VD0 A;  3RDW A;  2X49 A;  1XW6 A;  5BRT A;  1PL2 A;  4MF7 A;  2CX4 A;  1U3I A;  2DKI A;  5KEJ A;  4TVE A;  2RM5 A;  2KUC A;  1WWJ A;  5DCH A;  4XS6 A;  2DMM A;  1TU8 A;  2EIQ A;  2OAC A;  3EVI A;  4AF2 A;  2NBS A;  2C0F A;  2ZNM A;  5IMV A;  4OD7 A;  2R6K A;  3VI7 A;  4ISD A;  1R4W A;  5KN1 A;  2YV7 A;  2C4J A;  2QKE A;  4MJC A;  3H4K A;  5AN1 A;  4AKH A;  2GS3 A;  1F37 A;  1K0B A;  1E2Y A;  1ZCP A;  1PN9 A;  5GZZ B;  1T4Y A;  4PNG A;  3M1G A;  1JZO A;  2OE0 A;  3BBY A;  4BWS A;  4PQ1 A;  2FWG A;  2DML A;  4OO4 A;  2PER A;  4N0V A;  3PGT A;  1V57 A;  5G30 A;  3F0I A;  1A23 A;  2H0G A;  5KOX A;  3GV1 A;  1H4O A;  3CXG A;  4DSS A;  3APS A;  3QD9 A;  5ECQ B;  5B7C A;  2GZY A;  1QQ2 A;  2OJL A;  5G2Z A;  4V2L A;  1NM3 A;  1ZYQ B;  4PHZ C;  1B9X C;  4OFN A;  2C0G A;  4Q5F A;  3G7Y A;  5BMU B;  3HVS A;  2DJ2 A;  4Z2R A;  1GSF A;  2VLU A;  1FG4 A;  10GS A;  3W8J A;  1X9M B;  2XBI A;  5HFG A;  3ZMK A;  3RGB C;  2FWE A;  1ACV A;  4FH8 A;  5CRH A;  2DJ0 A;  5AGY A;  2JU5 A;  4KDY A;  1KNG A;  1S3A A;  5A34 A;  1PX7 A;  3ISO A;  2P0G A;  2IMD A;  3KH9 A;  2VCV A;  4J56 E;  3MNG A;  3O6T A;  3JCM L;  4ZL9 A;  4MH2 A;  2Z9S A;  1F3A A;  1HNA A;  2HRA A;  5LCZ A;  6GSX A;  4J57 E;  2MZC A;  1B4Q A;  2I3Y A;  3LQ7 A;  4GRF A;  1T4Z A;  3FEU A;  3GL3 A;  1M2A A;  3CTF A;  5J41 A;  5C04 A;  4NMU A;  1WPI A;  2H74 A;  4ZBD A;  1B9Y C;  3P90 A;  3RBT A;  5D96 A;  1J0F A;  2HE3 A;  1JZR A;  1RK4 A;  3HA9 A;  4N3Z A;  1RQM A;  3APO A;  5H5R A;  1R5A A;  3D6I A;  1IYH A;  3A5W A;  4J2F A;  3DML A;  3GSS A;  1GSE A;  1FW1 A;  4Q5Q A;  3RPP A;  2TRC P;  3WGE A;  1ON4 A;  1X5C A;  2C0E A;  2L4Q A;  4GQC A;  4YAP A;  4CY8 A;  3F4R A;  3HMJ G;  2V6K A;  3UVT A;  4OWY A;  11GS A;  2HRF A;  5C00 A;  2VL3 A;  3TDG A;  3WGX A;  5BMU A;  1AQW A;  2GSQ A;  1M2B A;  3WYW A;  4E8H A;  3UIW A;  2PU9 C;  1GUL A;  3KP9 A;  2L5L A;  1F2E A;  4ECI A;  3CWG A;  4QMK A;  1HYU A;  5F07 A;  4IQ1 A;  2FNO A;  1SD8 A;  4XS4 B;  2HSN A;  1NHY A;  2LQQ A;  3ZFL A;  2FWF A;  4KAE A;  1MD4 A;  2GT6 A;  2EIR A;  2H1D A;  4EXJ A;  2IFQ B;  2N5B A;  2MMO A;  1GRX A;  2F3M A;  3DWV A;  5ECM B;  4A5P A;  1AXD A;  3IK9 A;  5G1K A;  5JWO B;  4HUA A;  2LQO A;  2AJQ B;  3D4M A;  3HCZ A;  5INY A;  3C1R A;  19GS A;  2VCT A;  1VGL A;  4ECJ A;  5AIS A;  3UBK A;  2X99 A;  2YAN A;  2NDO A;  4O5Q A;  1O81 A;  4X0X A;  3IOS A;  5LD0 A;  1G0T A;  1MDJ A;  4E8E A;  4KF9 A;  5DDL A;  3SBC A;  5F8B A;  4ML6 A;  1VF3 A;  1A2L A;  2XPE A;  1XW9 A;  3HY2 A;  2FD3 A;  4DEJ A;  3KXO A;  2A4H A;  1LJR A;  4KB3 A;  5IO2 A;  4PUR A;  5CRD A;  3P2A A;  2I4A A;  5H5Q A;  3LFL A;  4ZB7 A;  2GTU A;  1BAY A;  1ZYE A;  2EFH A;  4PGT A;  2I81 A;  3M9K A;  3M8N A;  4F0B A;  4HS1 A;  2IPA A;  1DSB A;  4MJE A;  3ERG A;  4JRR A;  3QPM A;  2OAD A;  4MZW A;  4I8B A;  3G7J A;  3L9V A;  5DAK B;  2YP6 A;  5J4U A;  1JZW A;  3RHC A;  4V1A g;  2KP1 A;  5D93 A;  3Q74 A;  4XS4 A;  1FB0 A;  4XHM A;  5CNW A;  2WVX B;  2H1B A;  4NPB A;  2JL4 A;  6GSU A;  4K7O A;  3GX8 A;  4X43 A;  4ZIJ A;  3NZN A;  4IJI A;  2IFQ A;  4KW6 A;  4IKH A;  2XC2 A;  4MLY A;  1FB6 A;  2HSM B;  3N9J A;  3GH9 A;  4ZBA A;  3HVV A;  1E6B A;  5ECH B;  4F0C A;  4K2D A;  4RQX A;  4LMW A;  1SK2 A;  2H19 A;  4OFT A;  3IC8 A;  3WT1 A;  5FHI A;  1TXX A;  3UJ1 A;  2VLT A;  2AB6 A;  1YEP A;  4G9H A;  3QAV A;  4LMV A;  4IQA A;  4TR1 B;  1BG5 A;  1GSU A;  3M9J A;  4N11 A;  3KH7 A;  4ZIL A;  3R3E A;  2CX3 A;  4K1F A;  5F0G A;  3LSZ A;  4MPF A;  1K3L A;  1OC9 B;  3A2V A;  2A2R A;  1U6T A;  3GKK A;  1GUH A;  2A2P A;  4EDZ A;  3KIJ A;  3ERW A;  1EWX A;  4NWY A;  2YNX A;  2L6C A;  3IK7 A;  1U3A A;  4BA7 A;  1YEW C;  1Z6N A;  5ECR B;  3TKP A;  1Q98 A;  4JBB A;  3L4N A;  5DAK A;  5AIV A;  3DYR A;  3TCO A;  3KCM A;  3GIX A;  3BJ5 A;  4PQH A;  1GTA A;  2WVX A;  1S3R A;  1YF1 A;  3UEM A;  1OC3 A;  2DIZ A;  3TRX A;  4KDU A;  1S4B P;  4RQR A;  5KN0 A;  3UVH A;  2DC5 A;  1BX9 A;  3ZZX A;  2HSM A;  3C1S A;  2GSR A;  2H75 A;  1F6M C;  1OYJ A;  2OA7 A;  3U6V A;  5IM9 A;  3BD2 A;  3GKM A;  1OVN A;  4GQF A;  5AIX A;  4FYU A;  2R4V A;  4G2E A;  5B8B A;  1TU7 A;  1ABA A;  3F3R A;  4EUY A;  2YV9 A;  4G0L A;  3FZA A;  4HQZ A;  2F51 A;  2V6O A;  4TR1 A;  3LW9 A;  1OAZ A;  4JE1 A;  1YEX A;  1HQO A;  2YOI A;  2AAW A;  1TI1 A;  2HXK A;  4POK A;  4RI7 A;  1OC9 A;  5B6M A;  4POB A;  4L8E A;  3HD5 A;  2ON7 A;  2GQK A;  2R5G A;  1MD3 A;  5D9V A;  3GFK A;  2LJK A;  4POL A;  4HJM A;  5IPH A;  2LS5 A;  4IHU A;  4CHS A;  4PUA A;  4GCI A;  5IIZ A;  4EKZ A;  2CZ2 A;  1JFU A;  4K5R A;  4O92 A;  1M99 A;  1SVM A;  1PQN A;  4TR3 A;  1SD9 A;  1V40 A;  3CRT A;  2KOK A;  3TJF A;  3J7Y k;  6GSV A;  3R2Q A;  4XTS A;  3IDV A;  2PMT A;  4RI6 A;  5ENU A;  3TJK A;  2JZR A;  1PFO A;  5GAN D;  2MBS A;  2HLS A;  4QL9 A;  1BYE A;  4TXV A;  5J47 A;  4LL1 B;  3F3Q A;  4TR0 A;  2B5X A;  2B7K A;  3DKS A;  3GYK A;  2R0C A;  1TK0 B;  2MMN A;  3CSH A;  1EGO A;  3ZRD A;  2CQ9 A;  4V2M A;  2DJ3 A;  2WW1 A;  2HYX A;  3DRN A;  3GN3 A;  2P5Q A;  2VL9 A;  3GL5 A;  5ELA A;  4TXO B;  4GST A;  2DIY A;  4AKX B;  4PI0 C;  1AQX A;  1ERU A;  2H76 A;  3GUS A;  4Z2U A;  3CQF A;  2PWJ A;  3MYD A;  3TJB A;  1Z9H A;  3LWA A; 
#chains in the Genus database with same CATH homology
 1XOB A;  1I9D A;  3F63 A;  3Q19 A;  3LXZ A;  3KJY A;  3VUR A;  1X9W B;  5J9C A;  2C3T A;  4K5S A;  4DSQ A;  2REM A;  1M9A A;  3LJR A;  2X4A A;  3GTU A;  4Q5R A;  4WEY A;  4PUF C;  2V2G A;  2N5F A;  4JZQ A;  3VI5 A;  2M80 A;  3TRQ A;  4ZXG A;  4BL7 A;  2HZF A;  4HZ4 A;  1RW1 A;  2JAD A;  2FWH A;  2QA1 A;  5IOW A;  4N10 A;  1ZGN A;  5DQS A;  3TKS E;  2K8S A;  4TKY A;  3E0U A;  1EZK A;  8GSS A;  2H66 A;  4HI7 A;  4MK3 A;  5JWQ B;  5CRE A;  4IVF A;  2O8V B;  2GSS A;  2VL2 C;  3TKS C;  2VM2 A;  4POM A;  2AV4 A;  1XWG A;  3IBH A;  2K9F A;  4FYC A;  5DJM A;  2TIR A;  1QUW A;  4PTS A;  1A0F A;  4TXO A;  2WDU A;  1GL8 A;  1GP1 A;  3IHQ A;  3CBU A;  5ECI B;  2K8V A;  2VUP A;  2DJJ A;  1THX A;  1CQH A;  4MZB A;  4K6X A;  1Z7R A;  1NSW A;  2B1L A;  2QGV A;  1V58 A;  2R0P A;  4WR4 A;  1XWB A;  1EV4 A;  4G01 A;  4FIW A;  1G7O A;  2DJK A;  1SKS B;  4AJ7 A;  4CW9 A;  1A0R P;  2R2J A;  4LL4 B;  1GSS A;  5G5E A;  1SL1 B;  1C72 A;  1SYR A;  5KOW A;  3DXB A;  3ZYW A;  4PNF A;  2NTO A;  1AC1 A;  1GTI A;  2V41 A;  2YJ7 A;  5EY6 A;  4TR4 A;  3F8U A;  1WJK A;  2IMI A;  4GF0 A;  4AI6 A;  1TW9 A;  4K2X A;  4PXO A;  3C71 A;  4ECC A;  2YCD A;  4I2U A;  4XS1 A;  4GDF A;  2IN3 A;  2JSY A;  5A5H B;  5LNK e;  2LV3 A;  4MPG A;  4G0K A;  4OMV A;  1TRV A;  1WE0 A;  3FZ4 A;  1F3B A;  1NHO A;  2DSA A;  1OKD A;  2WUL A;  4N0Z A;  1K0D A;  1PKW A;  1MTC A;  3ZTL A;  4MP4 A;  1S3C A;  3FW2 A;  1SEN A;  5DVB A;  1A2M A;  4H86 A;  3D5J A;  1XVQ A;  3LOR A;  4F9Z A;  3IAS 2;  1U87 A;  3TKR A;  2HI7 A;  1G6Y A;  2MYG A;  2VCQ A;  1Q4J A;  3DIE A;  4EVM A;  5DCG A;  3KMO A;  4KUN A;  3RAZ A;  3FYG A;  4V1A p;  5ECO B;  3BCK A;  4KCE A;  1GTU A;  2H8L A;  1KBN A;  3UAP A;  1EP7 A;  1PA3 A;  5KN2 A;  1O6J A;  2V32 A;  1WRY A;  1EV9 A;  1EEJ A;  2VCZ A;  3MIX A;  1ERT A;  2ZCT A;  4EIQ A;  4USS A;  2PGT A;  1T3B A;  2EFC A;  1TDI A;  3FMW A;  1FVK A;  1SKW B;  2H1L A;  3HXS A;  14GS A;  2CT6 A;  5IO0 A;  2YJH A;  5A5H A;  1K0N A;  3HZ8 A;  3ZL5 A;  4GTU A;  3GH6 A;  2XPD A;  5D8I A;  1B4P A;  1FOH A;  3D4T A;  4FQU A;  1N25 A;  1ZYN A;  2E7P A;  4EIP A;  4ZBB A;  4AKI A;  3LXT A;  2LJR A;  2X8H A;  4MA9 A;  3ZML A;  2X8G A;  1M7T A;  3KMN A;  1U88 A;  3SWL A;  3HKR A;  2FY6 A;  1M9B A;  2AYT A;  4KGI A;  1GUM A;  1FAA A;  4NHZ A;  3KP8 A;  1SVO A;  3M3M A;  2VM1 A;  4ZL7 A;  3MSZ A;  1G6W A;  4JR4 A;  2IJY A;  2VCW A;  4KND A;  4WKW A;  3HJM A;  2LUS A;  2A2S A;  2GLR A;  3KGK A;  1ZMA A;  2RM6 A;  4AJ8 A;  4MZC A;  1TRS A;  4K7N A;  2B5E A;  1PD2 1;  3K8N A;  1VF1 A;  3UL3 A;  4FO5 A;  3FR3 A;  3TU3 B;  3IE3 A;  3UMA A;  12GS A;  4PX1 A;  5ID2 B;  4PQI A;  2P5R A;  3KTL A;  3A3T A;  2NPB A;  1TRU A;  2P31 A;  3KTB A;  2V1M A;  4ZB8 A;  4ACS A;  1YDK A;  1LBK A;  1J08 A;  4OO5 A;  1KTE A;  5HR0 A;  1YQ1 A;  5KN3 A;  1XFL A;  1XWK A;  2C3Q A;  3DD3 A;  4NV5 A;  5IMC A;  3U5R E;  4BVY B;  3QAW A;  1H75 A;  2WB9 A;  3TRP A;  1XBS A;  1O8X A;  2KP2 A;  2PPT A;  1S3D A;  4MJA A;  1M2D A;  5IMD A;  2DLX A;  3D21 A;  2PN8 A;  1GSY A;  2PVO C;  4HU9 A;  5HR1 A;  3LYK A;  4OCE A;  5JCW A;  2L4C A;  4HZ2 A;  4I5Q A;  3VWU A;  4MMM A;  1XW5 A;  1ZL9 A;  2GQL A;  2PVQ A;  3P7X A;  2G2Q A;  4IS0 A;  4E68 A;  4K7I A;  2H30 A;  2EIO A;  4EDY A;  5IMA A;  2OE1 A;  4CY6 A;  1BED A;  5ECP B;  4HOJ A;  1UN2 A;  2BJX A;  2H73 A;  1XXU A;  2TRX A;  5HR3 A;  3W8S A;  2HRN A;  1WP0 A;  5ECS A;  3DVW A;  2HT9 A;  5ID2 A;  1A8Y A;  1QFN A;  5ECL B;  1MDI A;  2KHP A;  2J23 A;  16GS A;  2GT5 A;  4MF5 A;  3N5O A;  2IMF A;  6GSY A;  4GSN A;  2LRN A;  1T00 A;  3FK8 A;  5DAL B;  1UVZ A;  2JAC A;  1AW9 A;  2D2Z A;  4F2I A;  4JU5 A;  1Y1U A;  3UBL A;  1K3Y A;  5D9W A;  4O7H A;  2IIY A;  1K0O A;  1OE7 A;  1PSQ A;  4BVY A;  2YWI A;  4TRX A;  3KM6 A;  2H6X A;  4BWQ A;  1TRW A;  2YWM A;  1X0R A;  5A4W A;  3F9U A;  4BPY A;  2EC4 A;  4YQV A;  2O87 A;  2LKU A;  3HJO A;  3IHG A;  5CRG A;  5IMZ A;  2CVB A;  3CRU A;  3FRC A;  4XRD A;  1DE1 A;  1PN0 A;  1T1V A;  2ON5 A;  4QL7 A;  4I6X A;  3VWV A;  2X8C A;  1QK8 A;  2H6Z A;  3A5I A;  2DJ1 A;  2CVK A;  4G10 A;  2QA2 A;  3I69 A;  2BMX A;  4O5R A;  1AIU A;  3RHB A;  5IQY A;  3EPT A;  2BTO T;  2VIM A;  3PR8 A;  2L59 A;  3GKN A;  2VAF A;  3EWL A;  4NAX A;  1SL2 B;  1XPV A;  2QC7 A;  1UA5 A;  1A2J A;  1R5P A;  1J9B A;  3PIN A;  2RLI A;  4ZL8 A;  5F06 A;  3D22 A;  3ED3 A;  1WIK A;  4RUV A;  3ZFB A;  4HU7 A;  3TKQ A;  4KA0 A;  1TOF A;  3BOA A;  5J40 A;  4MF6 A;  2ALB A;  3TJJ A;  1PKZ A;  3D0Z A;  5DAL A;  2CA8 A;  3O76 A;  3KD0 A;  1TI3 A;  2RUE A;  4YQU A;  4DSR A;  3QAG A;  1FVJ A;  3EYT A;  3C73 A;  4DSS B;  3LGC A;  2GQM A;  5CO3 A;  4IGJ A;  4L0W A;  1OKT A;  2O85 A;  3MWH A;  1SVL A;  1LU4 A;  4XCS A;  3WT2 A;  2RUF A;  2L57 A;  2WFC A;  1ERV A;  4K0G A;  4OCF A;  2UZ8 A;  1GH2 A;  4EL1 A;  3VPT A;  2VO4 A;  1TKD B;  4Z7X A;  5G1L A;  1YVL A;  1X5E A;  3FKF A;  2ES7 A;  2LEG A;  1X5D A;  1FOV A;  3NOF A;  1OE8 A;  3QMX A;  1ST9 A;  2H71 A;  1O73 A;  2GZZ A;  3TOU A;  1OC8 A;  5HQP A;  9GSS A;  5D9X A;  3NIV A;  4ECB A;  2DBC A;  1XCC A;  1PL1 A;  5A34 B;  6GST A;  1W4V A;  4HJ2 A;  3KZQ A;  22GS A;  2FA4 A;  1YKA A;  2LRT A;  13GS A;  3F6D A;  4HEA 2;  2FCH A;  1YKC A;  3APQ A;  4KX4 A;  5A4V A;  1SK0 A;  2CAI A;  3QOU A;  4X1U A;  2B1K A;  3L9S A;  4CDO A;  2HRK B;  4G19 A;  1XWC A;  2C80 A;  2WZ9 A;  1Z7P A;  2YWO A;  1N8J A;  3ZRE A;  3HYP A;  4O5U A;  6GSS A;  3US3 A;  3TOT A;  4HQS A;  2O89 A;  2RII A;  2VOC A;  1Z6M A;  1R26 A;  3F4T A;  3HDC A;  3VFI A;  5F05 A;  1BJX A;  4F03 A;  2K18 A;  1JZD A;  4DVC A;  2NVL A;  2R0G A;  1UC7 A;  4IJ3 A;  2MMA A;  3QCP A;  4YAV A;  2X64 A;  2YWN A;  2GST A;  4TOP A;  1GTB A;  5CP1 A;  3VK9 A;  5JWR B;  3UOM A;  1ERW A;  3ZLP A;  5E4W A;  1TXU A;  4WF4 A;  2FA8 A;  3LG6 A;  2VKZ G;  2F9S A;  5B6N A;  5DBQ A;  4WBJ A;  3CSI A;  4NXI A;  3H8Q A;  4ILF A;  1N2A A;  1XOA A;  5A4U A;  2HSN B;  5E59 A;  1MEK A;  1GLQ A;  3FR6 A;  1TJD A;  2LST A;  1QXH A;  3VWX A;  2CVD A;  1SKR B;  3M0F A;  1T8E B;  4YH2 A;  2H1A A;  2FLS A;  2C3N A;  4Z2T A;  4GSS A;  4MNN A;  2XHF A;  2F8A A;  4AGS A;  1K0M A;  3CTG A;  4HDE A;  3FY7 A;  2G0F A;  5HFI A;  3H93 A;  1XVW A;  2HRK A;  3I6A A;  1X9S B;  1W89 A;  5GST A;  2VD1 A;  3ME8 A;  2VCX A;  3GNJ A;  5H5S A;  2HNL A;  2AHE A;  4ZB9 A;  3ZVJ A;  2LNS A;  4MCU A;  1FHE A;  2IL3 A;  5A1N B;  1GUK A;  4KH7 A;  2LTK A;  5J3R A;  2E2G A;  20GS A;  5FWG A;  3L9U A;  4EO3 A;  1SJ6 A;  2LRC A;  4V2N A;  3L78 A;  3GA4 A;  3FZ5 A;  5DQY A;  5DJL A;  4WF5 A;  2HZE B;  2H72 A;  1GWC A;  4GWR A;  3EIN A;  1GNE A;  4IP1 A;  3P8W A;  4K0N A;  2CAQ A;  3E9J B;  4KSO A;  2O5V A;  2K6V A;  5JCU A;  4JED A;  1NW2 A;  1SU9 A;  2IME A;  4I97 A;  2LJA A;  2WCI A;  2ZUP A;  3O3T A;  1QMV A;  1AAZ A;  1A24 A;  7GSS A;  3FHK A;  3DEX A;  1USB A;  3Q6O A;  3LEF A;  4G0I A;  1GNW A;  4KDX A;  1K0C A;  3ZVJ D;  5J4V A;  3GHA A;  1DBY A;  5D9T A;  4EC0 A;  2VL2 A;  3TKS A;  2OBI A;  3EU4 A;  1Z5Y E;  5A5K A;  3GKX A;  3PH9 A;  2GVP A;  1CQG A;  2EFE A;  1XWA A;  2C1Y A;  2HSY A;  1YY7 A;  3GMF A;  1MDK A;  1K3O A;  1ILO A;  4ML1 A;  3GX0 A;  4IBP A;  1SJI A;  2UV8 G;  1THO A;  3IPZ A;  2WS2 A;  2GZP A;  2WRT A;  3F4S A;  5A1N A;  2WGR A;  3IAM 2;  3DGQ A;  3MDK A;  3PPU A;  1V98 A;  5JCG A;  3RPN A;  3TJG A;  2OKA A;  3L0H A;  3ZIV A;  5CRW A;  3C8E A;  1PX6 A;  2H70 A;  2VLV A;  2LNT A;  2HZE A;  1V2A A;  1SJZ A;  2R3X A;  4OFM A;  4WXT A;  2WJU A;  3EU3 A;  3VWW A;  1BQ7 A;  4GLT A;  5J4Y A;  2JZT A;  4MDC A;  3IRA A;  1EEM A;  1EOH A;  2HQT A;  5IPG A;  3ZIT A;  2OBK A;  3VPQ A;  3CMI A;  4N30 A;  2C0D A;  2F8F A;  1JLV A;  1VF2 A;  5J5N A;  4QQ7 A;  2QSI A;  3EC3 A;  2HFD A;  3LYP A;  2JZS A;  4BVX B;  3ZIJ A;  3IC4 A;  4FYB A;  2R37 A;  4EF0 A;  2JSZ A;  1M0U A;  4TN8 A;  3GST A;  3GRX A;  6GSW A;  3BCI A;  5CYY A;  2OT3 A;  4IW9 A;  5EPF A;  1Y25 A;  5G5F A;  4JR6 A;  3S9F A;  4KE3 A;  2FGX A;  3G9B A;  3W6G A;  2YZU A;  4L5L A;  4KSM A;  2HSH A;  1G7E A;  1ZOF A;  4MAB A;  3CYN A;  1XZO A;  4ID0 A;  3WGD A;  2B3S A;  4LA1 A;  5FT3 A;  2H01 A;  1VRS D;  4ZB6 A;  3OR5 A;  2E0Q A;  1O8W A;  5ECK B;  4P3Y B;  2YZH A;  1FO5 A;  1SYX A;  3TGZ A;  2H1G A;  2FUG 2;  2L5O A;  2EFD A;  1VF4 A;  3HZ4 A;  1TK8 B;  1GLP A;  3HJP A;  5B8A A;  3VLN A;  2GGT A;  1KEB A;  3EE2 A;  3G7I A;  4EE0 A;  3IR4 A;  1IYI A;  1AQV A;  2N5A A;  1ZYP A;  2H0H A;  4XIH A;  4NHW A;  2E2M A;  1A8L A;  1HNC A;  1Z3E A;  4W66 A;  1ZZY A;  2L6D A;  2MMZ A;  1JLW A;  4F82 A;  4L0U A;  1GSD A;  3KEB A;  3J7Y b;  1WMJ A;  1YJ6 A;  1BF5 A;  4BVX A;  1YF0 A;  3TB2 A;  1WOU A;  3TUE A;  2DKH A;  2I1U A;  3IXR A;  4XRA A;  5GAP D;  5COH A;  2YPM A;  3IV4 A;  2CV4 A;  5HR2 A;  3A2W A;  4O32 A;  3EUR A;  3AY8 A;  1B8X A;  4YKG A;  4K8M A;  3ERF A;  4D73 B;  5EVO A;  2IMK A;  1F9M A;  1HD2 A;  1DUG A;  1Y6E A;  1EP8 A;  3QDN A;  2YN1 A;  1EGR A;  5ELG A;  4X4J A;  4MH3 A;  3A2X A;  5ECN B;  1ML6 A;  1PGT A;  3V1W A;  18GS A;  2M72 A;  2O7K A;  3EMX A;  3H79 A;  3EMP A;  5G31 A;  1GSQ A;  3GUR A;  5J9B A;  3CSJ A;  3MAK A;  1SK1 A;  4WBR D;  2FHE A;  3WD6 A;  4TW5 A;  2H6Y A;  3Q18 A;  2I9H A;  4AJ6 A;  1B48 A;  1DE2 A;  2IWT A;  4Q5N A;  4WR5 A;  4I2T A;  4WET A;  4ULX A;  2B7J A;  1URM A;  2KLX A;  3QFA C;  4KCA A;  1XIY A;  4AKG A;  2PBJ A;  3I43 A;  2OE3 A;  4GXZ A;  3GTU B;  5CAX A;  3FZ9 A;  1PMT A;  1HNB A;  5GSS A;  1YZX A;  3QR6 A;  1I5G A;  1V9W A;  2XBQ A;  1JHB A;  2J9H A;  4IEL A;  1R7H A;  1AUC A;  2H0I A;  4ICY A;  17GS A;  5IOX A;  4BL7 B;  3DVX A;  3IA1 A;  1SL0 B;  4IN0 A;  1TK5 B;  3HVX A;  1O7U A;  3C7M A;  2M46 A;  4NV2 A;  1K0A A;  1PRX A;  3I9V 2;  2B6M A;  3HHV A;  2MBT A;  4MJB A;  4YQM A;  5L71 A;  3H1N A;  1TTZ A;  2C8U A;  4D73 A;  3F6F A;  2PUK C;  1BG1 A;  2CZ3 A;  5EL8 A;  1TP9 A;  3QFB C;  1O85 A;  4L5O A;  2B5Y A;  3UAR A;  4LLR A;  2GDR A;  5HFK A;  1QGV A;  2AUV A;  4YKF A;  1T7P B;  4IP6 A;  3E3E A;  2A4V A;  1EOG A;  4K9Z A;  5IMF A;  3FR9 A;  5ABR A;  5D73 A;  3ME7 A;  3RDW A;  2VD0 A;  2X49 A;  1XW6 A;  5BRT A;  1PL2 A;  4MF7 A;  2CX4 A;  1U3I A;  2DKI A;  5KEJ A;  4TVE A;  2RM5 A;  2KUC A;  1WWJ A;  5DCH A;  4XS6 A;  2DMM A;  1TU8 A;  2EIQ A;  2OAC A;  3EVI A;  4AF2 A;  2NBS A;  2C0F A;  2ZNM A;  5IMV A;  4OD7 A;  2R6K A;  3VI7 A;  4ISD A;  1R4W A;  5KN1 A;  2YV7 A;  2C4J A;  2QKE A;  4MJC A;  3H4K A;  5AN1 A;  4AKH A;  2GS3 A;  1F37 A;  1K0B A;  1E2Y A;  1ZCP A;  1PN9 A;  5GZZ B;  1T4Y A;  4PNG A;  3M1G A;  1JZO A;  2OE0 A;  3BBY A;  4BWS A;  4PQ1 A;  2FWG A;  2DML A;  4OO4 A;  2PER A;  4N0V A;  3PGT A;  1V57 A;  5G30 A;  3F0I A;  1A23 A;  2H0G A;  5KOX A;  3GV1 A;  1H4O A;  3CXG A;  4DSS A;  3APS A;  3QD9 A;  5ECQ B;  5B7C A;  2GZY A;  1QQ2 A;  2OJL A;  5G2Z A;  4V2L A;  1NM3 A;  1ZYQ B;  1B9X C;  4OFN A;  2C0G A;  4Q5F A;  3G7Y A;  5BMU B;  3HVS A;  2DJ2 A;  4Z2R A;  1GSF A;  2VLU A;  1FG4 A;  10GS A;  3W8J A;  1X9M B;  2XBI A;  5HFG A;  3ZMK A;  2FWE A;  1ACV A;  4FH8 A;  5CRH A;  2DJ0 A;  5AGY A;  2JU5 A;  4KDY A;  1KNG A;  1S3A A;  5A34 A;  1PX7 A;  3ISO A;  2P0G A;  2IMD A;  3KH9 A;  2VCV A;  4J56 E;  3MNG A;  3O6T A;  3JCM L;  4ZL9 A;  4MH2 A;  2Z9S A;  1F3A A;  1HNA A;  2HRA A;  5LCZ A;  6GSX A;  4J57 E;  2MZC A;  1B4Q A;  2I3Y A;  3LQ7 A;  4GRF A;  1T4Z A;  3FEU A;  3GL3 A;  1M2A A;  3CTF A;  5J41 A;  5C04 A;  4NMU A;  1WPI A;  2H74 A;  4ZBD A;  1B9Y C;  3P90 A;  3RBT A;  5D96 A;  1J0F A;  2HE3 A;  1JZR A;  1RK4 A;  3HA9 A;  4N3Z A;  1RQM A;  3APO A;  5H5R A;  1R5A A;  3D6I A;  1IYH A;  3A5W A;  4J2F A;  3DML A;  3GSS A;  1GSE A;  1FW1 A;  4Q5Q A;  3RPP A;  2TRC P;  3WGE A;  1ON4 A;  1X5C A;  2C0E A;  2L4Q A;  4GQC A;  4YAP A;  4CY8 A;  3F4R A;  3HMJ G;  2V6K A;  3UVT A;  4OWY A;  11GS A;  2HRF A;  5C00 A;  2VL3 A;  3TDG A;  3WGX A;  5BMU A;  1AQW A;  2GSQ A;  1M2B A;  3WYW A;  4E8H A;  3UIW A;  2PU9 C;  1GUL A;  3KP9 A;  2L5L A;  1F2E A;  4ECI A;  3CWG A;  4QMK A;  1HYU A;  5F07 A;  4IQ1 A;  2FNO A;  1SD8 A;  4XS4 B;  2HSN A;  1NHY A;  2LQQ A;  3ZFL A;  2FWF A;  4KAE A;  1MD4 A;  2GT6 A;  2EIR A;  2H1D A;  4EXJ A;  2IFQ B;  2N5B A;  2MMO A;  1GRX A;  2F3M A;  3DWV A;  5ECM B;  4A5P A;  1AXD A;  3IK9 A;  5G1K A;  5JWO B;  4HUA A;  2LQO A;  2AJQ B;  3D4M A;  3HCZ A;  5INY A;  3C1R A;  19GS A;  2VCT A;  1VGL A;  4ECJ A;  5AIS A;  3UBK A;  2X99 A;  2YAN A;  2NDO A;  4O5Q A;  1O81 A;  4X0X A;  3IOS A;  5LD0 A;  1G0T A;  1MDJ A;  4E8E A;  4KF9 A;  5DDL A;  3SBC A;  5F8B A;  4ML6 A;  1VF3 A;  1A2L A;  2XPE A;  1XW9 A;  3HY2 A;  2FD3 A;  4DEJ A;  3KXO A;  2A4H A;  1LJR A;  4KB3 A;  5IO2 A;  4PUR A;  5CRD A;  3P2A A;  2I4A A;  5H5Q A;  3LFL A;  4ZB7 A;  2GTU A;  1BAY A;  1ZYE A;  2EFH A;  4PGT A;  2I81 A;  3M9K A;  3M8N A;  4F0B A;  4HS1 A;  2IPA A;  1DSB A;  4MJE A;  3ERG A;  4JRR A;  3QPM A;  2OAD A;  4MZW A;  4I8B A;  3G7J A;  3L9V A;  5DAK B;  2YP6 A;  5J4U A;  1JZW A;  3RHC A;  4V1A g;  2KP1 A;  5D93 A;  3Q74 A;  4XS4 A;  1FB0 A;  4XHM A;  5CNW A;  2H1B A;  4NPB A;  2JL4 A;  6GSU A;  4K7O A;  3GX8 A;  4X43 A;  4ZIJ A;  3NZN A;  4IJI A;  2IFQ A;  4KW6 A;  4IKH A;  2XC2 A;  4MLY A;  1FB6 A;  2HSM B;  3N9J A;  3GH9 A;  4ZBA A;  3HVV A;  1E6B A;  5ECH B;  4F0C A;  4K2D A;  4RQX A;  4LMW A;  1SK2 A;  2H19 A;  4OFT A;  3IC8 A;  3WT1 A;  5FHI A;  1TXX A;  3UJ1 A;  2VLT A;  2AB6 A;  1YEP A;  4G9H A;  3QAV A;  4LMV A;  4IQA A;  4TR1 B;  1BG5 A;  1GSU A;  3M9J A;  4N11 A;  3KH7 A;  4ZIL A;  3R3E A;  2CX3 A;  4K1F A;  5F0G A;  3LSZ A;  4MPF A;  1K3L A;  1OC9 B;  3A2V A;  2A2R A;  1U6T A;  3GKK A;  1GUH A;  2A2P A;  4EDZ A;  3KIJ A;  3ERW A;  1EWX A;  4NWY A;  2YNX A;  2L6C A;  3IK7 A;  1U3A A;  4BA7 A;  1Z6N A;  5ECR B;  3TKP A;  1Q98 A;  4JBB A;  3L4N A;  5DAK A;  5AIV A;  3DYR A;  3TCO A;  3KCM A;  3GIX A;  3BJ5 A;  4PQH A;  1GTA A;  1YF1 A;  3UEM A;  1OC3 A;  2DIZ A;  3TRX A;  4KDU A;  4RQR A;  5KN0 A;  3UVH A;  2DC5 A;  1BX9 A;  3ZZX A;  2HSM A;  3C1S A;  2GSR A;  2H75 A;  1F6M C;  1OYJ A;  2OA7 A;  3U6V A;  5IM9 A;  3BD2 A;  3GKM A;  1OVN A;  4GQF A;  5AIX A;  4FYU A;  2R4V A;  4G2E A;  5B8B A;  1TU7 A;  1ABA A;  3F3R A;  4EUY A;  2YV9 A;  4G0L A;  3FZA A;  4HQZ A;  2F51 A;  2V6O A;  4TR1 A;  3LW9 A;  1OAZ A;  4JE1 A;  1YEX A;  1HQO A;  2YOI A;  2AAW A;  1TI1 A;  2HXK A;  4POK A;  4RI7 A;  1OC9 A;  5B6M A;  4POB A;  4L8E A;  3HD5 A;  2ON7 A;  2GQK A;  2R5G A;  1MD3 A;  5D9V A;  3GFK A;  2LJK A;  4POL A;  4HJM A;  5IPH A;  2LS5 A;  4IHU A;  4CHS A;  4PUA A;  4GCI A;  5IIZ A;  4EKZ A;  2CZ2 A;  1JFU A;  4K5R A;  4O92 A;  1M99 A;  1SVM A;  1PQN A;  4TR3 A;  1SD9 A;  1V40 A;  3CRT A;  2KOK A;  3TJF A;  3J7Y k;  6GSV A;  3R2Q A;  4XTS A;  3IDV A;  2PMT A;  4RI6 A;  5ENU A;  3TJK A;  2JZR A;  5GAN D;  2MBS A;  2HLS A;  4QL9 A;  1BYE A;  4TXV A;  5J47 A;  4LL1 B;  3F3Q A;  4TR0 A;  2B5X A;  2B7K A;  3DKS A;  3GYK A;  2R0C A;  1TK0 B;  2MMN A;  3CSH A;  1EGO A;  3ZRD A;  2CQ9 A;  4V2M A;  2DJ3 A;  2HYX A;  3DRN A;  3GN3 A;  2P5Q A;  2VL9 A;  3GL5 A;  5ELA A;  4TXO B;  4GST A;  2DIY A;  4AKX B;  1AQX A;  1ERU A;  2H76 A;  3GUS A;  4Z2U A;  2PWJ A;  3MYD A;  3TJB A;  1Z9H A;  3LWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...