1AQVA

Glutathione s-transferase in complex with p-bromobenzylglutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of class pi glutathione S-transferase from human placenta in complex with substrate, transition-state analogue and inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1aqvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1aqvA01
4NV2A 4NXIA 1GNEA 4F82A 4EDYA 2C0EA 1XPVA 3SWLA 1BEDA 3TKSA 2LS5A 3LFLA 2VLUA 1SKWB 2RUEA 3RBTA 3UBKA 1X5EA 1R7HA 4YAVA 4O32A 3QOUA 4MA9A 3VPTA 3A2XA 1Z7RA 4L0WA 1GSUA 2GTUA 1GSSA 4EKZA 2VCTA 2KOKA 4EVMA 1ZL9A 3FZ4A 4ECCA 4JU5A 3TJKA 5HR0A 2O87A 2MMNA 2IJYA 1ZMAA 5IMCA 3RHBA 2XPDA 4USSA 5IMAA 4KSOA 1FB0A 3GX8A 2VL3A 5C04A 5IO2A 2IIYA 2K18A 1JZDA 2CAIA 3QAVA 1K3LA 2VUPA 3ZVJD 2VM2A 2DMMA 3DVWA 2HFDA 3TKSC 2VCZA 3KH7A 3PGTA 4EDZA 3PH9A 1QGVA 2GT5A 3U5RE 2CAQA 2CVKA 1ERVA 1EGRA 3CSJA 1NHYA 2O7KA 3TJJA 4ECJA 1CQHA 1U3AA 1GP1A 5ECSA 2L5LA 3W6GA 5DALB 2VCWA 5HFGA 1FHEA 2WZ9A 3NZNA 2G2QA 5ECRB 3FK8A 3IAS2 4N10A 1EWXA 2DJ0A 1JFUA 1BJXA 2YWOA 1RW1A 4KB3A 3DXBA 5ECHB 1FB6A 1UA5A 4POBA 4AJ7A 3F9UA 6GSVA 3HXSA 4TOPA 2MZCA 2ES7A 4GTUA 3C8EA 3U6VA 1PN9A 2B7JA 2M80A 1K3YA 3IR4A 4FH8A 3H1NA 2YPMA 2HSMB 1KNGA 2MMZA 3KP9A 3L4NA 1OC3A 1A8LA 4TR1B 4BL7B 4ZL9A 5ELAA 4EXJA 4HDEA 1PGTA 2L5OA 4ZB9A 2JSYA 3CRUA 1PX7A 4XS4A 4MDCA 5GSTA 1PKZA 3HVVA 4HZ4A 4K9ZA 2YANA 3US3A 3IE3A 3OR5A 3KMNA 3F6DA 4F9ZA 2KHPA 3FR9A 1SENA 1SK0A 1TU7A 1SKSB 4G2EA 4K6XA 3BBYA 2I4AA 1GSEA 4KGIA 1A0FA 3ED3A 3LYKA 2CZ3A 4PQ1A 4Q5RA 1FO5A 3PINA 5IMFA 3TUEA 3D6IA 4JRRA 2C0FA 5LCZA 2PERA 4YH2A 4E8HA 5ID2B 1XWKA 2DLXA 3RPNA 4KE3A 1E6BA 2L59A 3A2WA 1HYUA 1BX9A 3DKSA 20GSA 5D93A 4FYCA 2C4JA 2GT6A 4I6XA 1YKAA 3KCMA 3F4TA 3KP8A 3QMXA 2X8GA 1AC1A 2YWNA 3GKXA 3HVXA 2WCIA 3HY2A 4L8EA 2VAFA 4K0NA 1TTZA 3KJYA 3UOMA 1N8JA 1F3BA 4GQCA 4NHZA 4MH3A 5DJMA 4YQVA 1MDJA 5D73A 2IFQA 4KAEA 1GH2A 4WKWA 5GZZB 2E2MA 2WS2A 3GMFA 2KP2A 1TKDB 1PKWA 3D4MA 2G0FA 3MDKA 2ON7A 3GTUA 1A2MA 1QMVA 4ZIJA 2NDOA 2DSAA 4MJCA 1GTAA 2PMTA 2IMEA 1U3IA 2YCDA 4PUAA 4KCEA 3G9BA 2HRKB 3GNJA 4WEYA 5CRHA 5HFIA 4WF5A 3L78A 4ZBBA 2WULA 3ERWA 4PQHA 5DQYA 4MCUA 4TR4A 3C71A 3L9UA 3HYPA 4EL1A 2HT9A 4TXVA 3UAPA 6GSTA 1LU4A 4IQAA 4FO5A 4WF4A 5ECIB 2DJ1A 2R3XA 2HRAA 5DDLA 1JLWA 4IS0A 1AQWA 3JCML 5KN2A 1GLQA 4BPYA 3M3MA 2JADA 2EIQA 2PN8A 1V40A 3VI7A 4MP4A 4V1Ag 4NWYA 4WXTA 2H6ZA 1M0UA 4HUAA 5CRWA 3V1WA 3ME7A 3H79A 4YQUA 1R4WA 1TK0B 4IGJA 1KEBA 3EWLA 1B8XA 1KBNA 4JBBA 3FRCA 3I9V2 2FWHA 5CNWA 1Z6MA 4GQFA 3GSSA 2F9SA 1FOVA 1EOGA 3GSTA 2REMA 1XXUA 1TXXA 5IIZA 5J9CA 2HLSA 5G1LA 4I8BA 3VLNA 5A5KA 4HJ2A 1OYJA 1W89A 6GSXA 3ME8A 1M7TA 2VL9A 5DAKB 1JLVA 1PL2A 2E2GA 2L57A 4GF0A 4G0KA 2H0IA 4HS1A 5AIVA 1A24A 1YY7A 1O8WA 1GSYA 2C3QA 2NTOA 3ZMKA 3UIWA 4ZILA 4F2IA 1TRVA 4MPGA 3UARA 4XRDA 1G6WA 4O7HA 1SD8A 5IMZA 2F3MA 3G7JA 4ZBAA 4RQRA 2LNTA 3N9JA 2B5YA 3HA9A 1OC9B 13GSA 3D5JA 2L6DA 2GSRA 4ECIA 3HJPA 1XWCA 5HR2A 2E7PA 5DJLA 3MAKA 11GSA 1O6JA 2DBCA 2WRTA 4MH2A 3C1SA 1OVNA 2V2GA 2H71A 3O6TA 5A4VA 1O8XA 3IPZA 3WT1A 3KMOA 3F3RA 1RQMA 5LD0A 1ERTA 2IMFA 3L9VA 4FYUA 2HSHA 4OFTA 4QL7A 4ZXGA 1V57A 1T8EB 2XC2A 3VWWA 3H8QA 4QQ7A 1TW9A 4MZCA 1SJ6A 5IPGA 1HNAA 4G0LA 3TDGA 5DALA 3TOTA 4WR4A 1GUHA 4ML1A 3LSZA 1PSQA 4NPBA 3W8SA 1EOHA 2R6KA 1YF1A 4K7NA 1Z6NA 2DJ3A 1I5GA 4ECBA 2H19A 3GN3A 3HZ4A 2FHEA 1GSQA 1ERUA 4IP6A 3HJOA 4IJIA 4EE0A 1WP0A 3ZYWA 1WRYA 2H75A 4O5RA 4Z7XA 2XPEA 4GRFA 2I1UA 4Q5QA 4RQXA 1WOUA 1THOA 3R3EA 2FA4A 1JZRA 4KH7A 1RK4A 10GSA 3GKNA 3TRPA 1GUMA 3FR6A 3IA1A 1Z5YE 3KTBA 4BL7A 4EF0A 2V41A 4EUYA 4HZ2A 1ILOA 2HE3A 1MD3A 1VF1A 3APQA 5EVOA 1JHBA 5D9WA 3PR8A 4IQ1A 3IXRA 4E8EA 2VM1A 4JR4A 3M9KA 2NVLA 5J3RA 2QC7A 1SYRA 2GQKA 3HJMA 1QFNA 1YJ6A 3ZIVA 5ECKB 3EU3A 4N0ZA 2KUCA 4IN0A 2GS3A 4PURA 4DVCA 5HR3A 3EMXA 3P90A 5HR1A 4EO3A 8GSSA 1YEPA 4NHWA 3GA4A 1F9MA 2F8AA 1S3AA 3L9SA 3ZFLA 2VCQA 3TCOA 5AIXA 3KZQA 3HHVA 4TKYA 1Z9HA 3CMIA 3E0UA 1AUCA 1SL2B 4OCFA 5GAND 5L71A 3DWVA 4KF9A 2FWFA 4LA1A 2YP6A 3TB2A 2OBIA 1O73A 4XS6A 3GKMA 2RIIA 4BWQA 3APOA 1LJRA 2B5XA 1N2AA 2FGXA 2H0GA 5E4WA 3ERGA 1G7OA 4JE1A 3UJ1A 2X8CA 4GLTA 2MYGA 3DIEA 2X64A 3LYPA 2GZYA 1K3OA 5EPFA 3EE2A 4N11A 1XIYA 3ZVJA 5EL8A 2HRNA 2H8LA 4OO5A 2MMOA 4DSSB 4H86A 1Q4JA 4RI7A 1XWBA 1WIKA 1DBYA 2YV9A 2HRKA 2HZEB 2MMAA 3BD2A 5ECQB 1G6YA 2H6XA 1BQ7A 5ABRA 3N5OA 4LMVA 2OE0A 3GV1A 2BTOT 1SD9A 4MABA 3WYWA 3P2AA 3FZ9A 1MDKA 2QGVA 2VD1A 1SK1A 1U87A 2OA7A 1ACVA 3GKKA 1XCCA 4V2LA 3ZTLA 1A2LA 4TXOA 1V9WA 4MMMA 3L0HA 3WGDA 1YF0A 1FW1A 5GSSA 1QK8A 1TOFA 4KW6A 2CT6A 3VURA 2B1KA 4IVFA 1YEXA 2GSSA 2NBSA 1LBKA 4O92A 2F51A 1Y6EA 4IBPA 3EYTA 3R2QA 5BMUA 3IOSA 3WGEA 4MZBA 2HYXA 1TRWA 1UVZA 3GRXA 1IYHA 4PUFC 3VK9A 3MNGA 3M0FA 2O89A 3O3TA 2V1MA 4PX1A 2R4VA 4KDUA 4MF7A 1XZOA 1XFLA 2JSZA 5HQPA 4RUVA 2X99A 1PX6A 2CVBA 1X9WB 2PU9C 4N30A 1ZYQB 1GRXA 4ZL8A 5ECNB 2VIMA 3KIJA 1O85A 5DAKA 2LTKA 1QUWA 2JU5A 3DRNA 1T4YA 2FWGA 1V98A 1T7PB 2IPAA 1VF3A 1XBSA 3VPQA 1DE1A 3EINA 3SBCA 1OKTA 4WBJA 5CP1A 4FIWA 3TOUA 3S9FA 2NPBA 4FQUA 5CREA 3W8JA 3IV4A 1SKRB 3TKPA 2GGTA 2VL2A 4HOJA 1GTBA 4BVXB 2VLVA 2RUFA 3J7Yk 1PL1A 2C80A 1OC9A 2A2RA 4TVEA 4OFNA 5J41A 5CAXA 5IPHA 4ISDA 2JL4A 3ZZXA 1THXA 4OO4A 1F2EA 1SK2A 4K2DA 3EMPA 2PVOC 4ML6A 1AIUA 3CSIA 1HD2A 2YWIA 3A3TA 4HI7A 1TJDA 2CX3A 1FG4A 3KXOA 3BCKA 1HQOA 5D8IA 1S3DA 2LRNA 4YQMA 4XIHA 3FR3A 4WETA 1PD21 1C72A 2GZZA 1TK8B 2LRCA 2H01A 4I2UA 5D9TA 2MBSA 3AY8A 5IQYA 4L5LA 2VL2C 4GXZA 2EIRA 4Q5NA 2K8VA 3PPUA 4KCAA 5JWRB 1Z7PA 1OC8A 4ULXA 2WFCA 3LXTA 3K8NA 3HD5A 4NMUA 4MJEA 6GSWA 2CV4A 1MD4A 1TDIA 3D0ZA 3F8UA 1O81A 4X0XA 3ZRDA 5ECMB 2H1DA 1I9DA 1J9BA 3M9JA 3Q6OA 4K1FA 2H66A 4TR3A 2IL3A 1O7UA 1NM3A 2O8VB 2LSTA 1PQNA 2H1GA 3ZMLA 1ZZYA 5C00A 4D73B 3M8NA 5IM9A 1M99A 2YOIA 3F4SA 1AQXA 4ILFA 6GSUA 5ECLB 1GNWA 3FEUA 5CRDA 3LQ7A 4MF6A 1XVWA 2FD3A 1XWGA 1B9XC 1GWCA 4PXOA 3RHCA 5H5SA 2GQMA 1B4PA 5DQSA 1SJZA 3C7MA 1WE0A 3HDCA 1XW5A 3ZREA 2PGTA 5A4WA 4X1UA 2JZTA 4HU7A 2VCVA 1WJKA 3FHKA 3IC4A 4AJ8A 2WB9A 1SJIA 3GL3A 2WJUA 2DJ2A 2AV4A 2P31A 3IC8A 2ZUPA 2IMKA 2N5BA 2CA8A 3GIXA 1XOAA 1YDKA 5HFKA 14GSA 3I6AA 2HNLA 4NV5A 1SL1B 3F63A 2YWMA 3QCPA 2UZ8A 2IFQB 2AB6A 1VGLA 2I9HA 2L4QA 2HSYA 3UEMA 2DC5A 3GTUB 3TKRA 2AAWA 3UVTA 1BG5A 4GWRA 5EY6A 3LORA 2DIYA 3BJ5A 4KUNA 1XW6A 5D9XA 2LJRA 2VCXA 2H30A 1OKDA 1CQGA 2HZFA 1GULA 4PGTA 3WD6A 1ZGNA 3O76A 4DSSA 3QDNA 2ALBA 4L5OA 4IW9A 1GSFA 2DIZA 3DEXA 4OCEA 4DSQA 1AAZA 2RLIA 2FY6A 2HZEA 16GSA 5KN1A 2GDRA 3GHAA 2LJKA 4BVYB 3F0IA 2ON5A 3IBHA 4TR0A 1V58A 1HNBA 2TIRA 1M2DA 1K0BA 1YQ1A 5ENUA 2YZHA 4GSSA 5JWQB 1PA3A 1SYXA 5AGYA 1MEKA 2HSMA 1Q98A 1SU9A 2C1YA 1K0AA 4OFMA 2WDUA 4TR1A 5FHIA 1WWJA 4HQZA 3LWAA 1T00A 1DSBA 2H76A 2VO4A 1QXHA 2PWJA 4CDOA 3KD0A 1EV9A 1MTCA 4TRXA 4AGSA 2LUSA 1URMA 3DYRA 3IHQA 2PVQA 3QD9A 4GSNA 3HVSA 2QKEA 3ZLPA 1EGOA 3F6FA 4PTSA 1JZWA 2FA8A 2EC4A 3DVXA 2KLXA 2LKUA 5F0GA 2M72A 1UN2A 3F3QA 1K0OA 5F07A 4L0UA 3DMLA 1B48A 1XOBA 4KA0A 3UL3A 4F03A 3DGQA 3RPPA 1S3CA 2I3YA 4XS1A 3FZAA 3CRTA 2J23A 22GSA 4CHSA 3GURA 4ZB8A 3FW2A 5ID2A 3WT2A 3VI5A 2CX4A 1M2AA 2RM6A 1TRSA 5G5EA 2A2SA 2EIOA 1FAAA 4G9HA 4X43A 1TK5B 3H4KA 3RDWA 1AQVA 3P8WA 1VRSD 3BCIA 4LLRA 1K0CA 2GLRA 5E59A 2YV7A 4N0VA 3DD3A 4KDYA 1YKCA 1DUGA 3F4RA 3BOAA 2C3NA 4I5QA 3LJRA 1USBA 3KM6A 1MDIA 1TU8A 1EEJA 1VF4A 5A4UA 1XWAA 1QQ2A 4BA7A 4BVXA 1GLPA 3HZ8A 4F0BA 2AYTA 3IRAA 4MF5A 2VOCA 2KP1A 2VLTA 3CBUA 4G19A 3IK7A 3FZ5A 5CYYA 5JCGA 4MLYA 4G0IA 4AJ6A 4HQSA 5B8AA 2H72A 5KN0A 3UMAA 2ZNMA 2OBKA 3TJGA 4IP1A 3CYNA 3G7IA 2YN1A 5J9BA 5G31A 2FUG2 3C73A 5H5QA 4OMVA 2OJLA 1T3BA 5B7CA 4KNDA 4YAPA 2I81A 5COHA 2K9FA 3Q18A 2PPTA 4ID0A 1EEMA 4V1Ap 2LRTA 4NAXA 1X5DA 3QPMA 5IOXA 9GSSA 4XRAA 3QAGA 2OE1A 4G10A 4TW5A 2AHEA 1M9BA 2DJKA 2LQQA 3M1GA 1OE7A 2C0DA 2XHFA 1PRXA 1A0RP 1OAZA 4ZB6A 3I69A 4KDXA 5H5RA 1A2JA 2V6KA 2FLSA 4FYBA 3J7Yb 2L6CA 1A23A 2XBIA 2H0HA 2J9HA 1X5CA 4LL4B 2YZUA 2GQLA 4MJBA 1ZOFA 5IMDA 3MSZA 4MK3A 3IDVA 1DE2A 3QFAC 4MZWA 3NOFA 4P3YB 3TRXA 1ABAA 1GL8A 2O85A 2GZPA 2LV3A 5JWOB 1F3AA 3QAWA 4J2FA 4CW9A 3TJFA 5LNKe 1TP9A 3Q74A 4XHMA 4GSTA 4D73A 4LMWA 3TRQA 2QSIA 5CRGA 4Q5FA 3QFBC 3WGXA 2LEGA 4JEDA 5B8BA 2XBQA 3GUSA 4QL9A 1A8YA 2HRFA 1G0TA 3APSA 1X9SB 4JZQA 1YZXA 3EU4A 5AISA 2H74A 2H6YA 5G5FA 4POMA 1WPIA 1GSDA 1ST9A 4HEA2 5INYA 3KH9A 2AJQB 4DEJA 3UVHA 3UBLA 2TRCP 2LNSA 4ZBDA 1BAYA 1J0FA 1NSWA 1G7EA 3E9JB 2P5RA 4I2TA 2OADA 3ZFBA 3CXGA 1PMTA 2JACA 3TJBA 3HCZA 2GSQA 1AXDA 3LG6A 5ELGA 1R26A 3CTGA 4V2MA 1IYIA 1F37A 2OKAA 3GX0A 5ECOB 1F6MC 5IO0A 1GUKA 4OWYA 4IKHA 1M2BA 3RAZA 4WBRD 2B5EA 2YNXA 7GSSA 3LGCA 3TGZA 5IOWA 2V32A 3NIVA 5F06A 2B7KA 5JCUA 6GSYA 3I43A 4IHUA 4OD7A 3FKFA 1Y25A 3IK9A 1K0NA 5G2ZA 3GFKA 4HU9A 1EP8A 2GVPA 5FT3A 4JR6A 4BWSA 2YJHA 4BVYA 1JZOA 5CO3A 3KTLA 2GSTA 4TXOB 1HNCA 1H75A 1U88A 2A4VA 3H93A 1NW2A 2BMXA 2IMIA 5KN3A 1KTEA 2JZSA 1Z3EA 1TI1A 2C0GA 4J57E 5B6NA 2AUVA 1AW9A 4WR5A 4XS4B 2TRXA 2R2JA 1K0MA 2R5GA 3EURA 1J08A 2BJXA 2X8HA 2Z9SA 2D2ZA 2H73A 3VWXA 1EZKA 3GL5A 2HSNB 1TRUA 1X9MB 1SL0B 1H4OA 4KX4A 3ZITA 5AN1A 1E2YA 3VWUA 1ML6A 4MJAA 2CVDA 4K7OA 5DCGA 2OE3A 4GCIA 5F05A 4HJMA 4K7IA 2ZCTA 1B4QA 2FWEA 3Q19A 3D21A 2N5AA 4PNFA 4AF2A 1M9AA 3ISOA 4EC0A 4IJ3A 2H1BA 4POLA 3A5WA 2HXKA 3HKRA 4F0CA 1TI3A 2B1LA 2V6OA 2YJ7A 1ERWA 2H70A 1FVKA 1R5AA 5D9VA 5KEJA 3FYGA 3CTFA 18GSA 2HQTA 1FVJA 2CZ2A 1V2AA 2LJAA 2P0GA 3IAM2 3GH9A 1GTUA 3D22A 3QR6A 3FY7A 1B9YC 1XVQA 2OACA 3EC3A 2PBJA 5J5NA 1X0RA 3CSHA 2L4CA 4I97A 2RM5A 2CQ9A 1T4ZA 3KEBA 4K8MA 1ZCPA 5F8BA 5J4UA 3G7YA 3ZL5A 1OE8A 4PQIA 5G1KA 19GSA 1T1VA 4XCSA 6GSSA 4ZL7A 4XTSA 5B6MA 3VFIA 2F8FA 2IWTA 5FWGA 3P7XA 4V2NA 4PNGA 1R5PA 2C8UA 3TKSE 3D4TA 2C3TA 17GSA 3EVIA 2K6VA 1VF2A 4IELA 1ZYEA 5DBQA 1NHOA 1U6TA 2R37A 3MWHA 2PUKC 3ERFA 2JZRA 1EP7A 1UC7A 1EV4A 2H1AA 2M46A 2MBTA 5JCWA 3VWVA 5G30A 2DJJA 2P5QA 3LEFA 4DSRA 3KGKA 3A2VA 3GH6A 4LL1B 1XW9A 2DMLA 3ZIJA 2LQOA 4KSMA 4RI6A 4POKA 2IMDA 2FCHA 2E0QA 2HI7A 3TKQA 3LXZA 4ACSA 2WGRA 5DCHA 1GTIA 4K0GA 5ECPB 2VD0A 1K0DA 1WMJA 12GSA 5DVBA 2IN3A 5D96A 1W4VA 5GAPD 2B3SA 2N5FA 3GYKA 4MPFA 3E3EA 4TN8A 3C1RA 4J56E 2K8SA 2B6MA 5IMVA 1BYEA 2FNOA 1ON4A
chains in the Genus database with same CATH superfamily
4NV2A 3RGBC 4NXIA 2O3EA 1GNEA 4F82A 4EDYA 2C0EA 1XPVA 2EFCA 3SWLA 1BEDA 3TKSA 2LS5A 3LFLA 2VLUA 1SKWB 2RUEA 3RBTA 3UBKA 1X5EA 1R7HA 4YAVA 4O32A 3QOUA 4MA9A 3VPTA 3A2XA 1Z7RA 4L0WA 1GSUA 2GTUA 1GSSA 4EKZA 2VCTA 2KOKA 4EVMA 2WZSA 1ZL9A 3FZ4A 4ECCA 4JU5A 3TJKA 5HR0A 2O87A 2MMNA 2IJYA 1ZMAA 5IMCA 3RHBA 2XPDA 4USSA 5IMAA 4KSOA 1FB0A 3GX8A 2VL3A 5C04A 5IO2A 2IIYA 2K18A 1JZDA 2CAIA 3QAVA 1K3LA 2VUPA 3ZVJD 2VM2A 2DMMA 3DVWA 2HFDA 3TKSC 2VCZA 3KH7A 3PGTA 4EDZA 3PH9A 1QGVA 2GT5A 3U5RE 2CAQA 2CVKA 1ERVA 1EGRA 3CSJA 1NHYA 2O7KA 2EFDA 3TJJA 4ECJA 1CQHA 1U3AA 1GP1A 5ECSA 2L5LA 3W6GA 2WVXB 5DALB 2VCWA 5HFGA 1FHEA 2WZ9A 3NZNA 4PHZC 2G2QA 5ECRB 3FK8A 3IAS2 4N10A 3TU3B 1EWXA 2DJ0A 1JFUA 1BJXA 2YWOA 1RW1A 4KB3A 3DXBA 5ECHB 1FB6A 1UA5A 4POBA 4AJ7A 3F9UA 6GSVA 3HXSA 4TOPA 2MZCA 2ES7A 4GTUA 3C8EA 3U6VA 1PN9A 2B7JA 2M80A 1K3YA 3IR4A 4FH8A 3H1NA 3RFRC 2YPMA 2HSMB 1KNGA 2MMZA 3KP9A 3L4NA 1OC3A 1A8LA 4TR1B 4BL7B 4ZL9A 5ELAA 4EXJA 4HDEA 1PGTA 2L5OA 4ZB9A 2JSYA 3CRUA 1PX7A 4XS4A 4MDCA 5GSTA 1PKZA 3HVVA 4HZ4A 2YANA 4K9ZA 3US3A 3IE3A 3OR5A 3KMNA 3F6DA 4F9ZA 2KHPA 3FR9A 1SENA 1SK0A 1TU7A 1SKSB 2HSNA 4G2EA 4K6XA 3BBYA 2X4AA 2I4AA 1GSEA 4KGIA 1A0FA 3ED3A 3LYKA 2CZ3A 4PQ1A 4Q5RA 2QA2A 1FO5A 3PINA 5IMFA 3TUEA 3D6IA 4JRRA 2C0FA 5LCZA 2PERA 4YH2A 4E8HA 5ID2B 1XWKA 2DLXA 3RPNA 4KE3A 1E6BA 2L59A 3A2WA 1HYUA 1BX9A 5J40A 3DKSA 20GSA 5D93A 4FYCA 2C4JA 2GT6A 4I6XA 1YKAA 3KCMA 3F4TA 3KP8A 3QMXA 2X8GA 1AC1A 2YWNA 3GKXA 3HVXA 2WCIA 3HY2A 4L8EA 2VAFA 4K0NA 1TTZA 3KJYA 3UOMA 1N8JA 1F3BA 4GQCA 4NHZA 4MH3A 5DJMA 4YQVA 1MDJA 5D73A 2IFQA 4KAEA 1GH2A 4WKWA 5GZZB 2E2MA 2WS2A 3GMFA 2KP2A 1TKDB 4QMKA 1PKWA 3D4MA 2G0FA 3MDKA 2ON7A 3GTUA 1A2MA 1QMVA 4ZIJA 2NDOA 2DSAA 4MJCA 1GTAA 2PMTA 2IMEA 1U3IA 2YCDA 4PUAA 4KCEA 3G9BA 2HRKB 3GNJA 5J4VA 4WEYA 5CRHA 5HFIA 4WF5A 3L78A 4ZBBA 2WULA 3ERWA 4PQHA 5DQYA 4MCUA 4TR4A 3C71A 5A5HB 3L9UA 3HYPA 4EL1A 4CY8A 2HT9A 4TXVA 3UAPA 6GSTA 1LU4A 4IQAA 4FO5A 4WF4A 5ECIB 2DJ1A 2R3XA 2HRAA 5DDLA 1JLWA 4IS0A 1AQWA 3JCML 5KN2A 1GLQA 3A5IA 4BPYA 3M3MA 2JADA 2EIQA 2PN8A 1V40A 3VI7A 4MP4A 4V1Ag 4NWYA 4WXTA 2H6ZA 1M0UA 4HUAA 3HVNA 5CRWA 3V1WA 3ME7A 3H79A 4YQUA 1R4WA 1TK0B 5BMUB 4IGJA 1KEBA 3EWLA 1B8XA 1KBNA 4JBBA 3FRCA 3I9V2 2FWHA 5CNWA 1Z6MA 4GQFA 3GSSA 2WW1A 4GDFA 2F9SA 1FOVA 1ZYNA 1EOGA 3GSTA 2REMA 1XXUA 1TXXA 5IIZA 5J9CA 2HLSA 5G1LA 4I8BA 3VLNA 5KOXA 5A5KA 4HJ2A 1OYJA 1W89A 6GSXA 3ME8A 1M7TA 2VL9A 5DAKB 1JLVA 1PL2A 2E2GA 2L57A 4GF0A 4G0KA 2H0IA 4HS1A 1I1IP 5AIVA 1A24A 1YY7A 1O8WA 1GSYA 2C3QA 2NTOA 3ZMKA 3UIWA 4ZILA 4F2IA 1TRVA 4MPGA 3UARA 4XRDA 1G6WA 4O7HA 1SD8A 5IMZA 2F3MA 3G7JA 4ZBAA 4RQRA 2LNTA 3N9JA 2A2PA 2B5YA 3HA9A 1OC9B 13GSA 3D5JA 2L6DA 2GSRA 4ECIA 3HJPA 1XWCA 5HR2A 2E7PA 5DJLA 3MAKA 11GSA 1O6JA 2DBCA 2WRTA 4MH2A 3C1SA 1OVNA 2V2GA 2H71A 3O6TA 5A4VA 1O8XA 3IPZA 3WT1A 3KMOA 3F3RA 1RQMA 5LD0A 1ERTA 2IMFA 3L9VA 4FYUA 2HSHA 4OFTA 4QL7A 4ZXGA 1V57A 1T8EB 3HMJG 2XC2A 3VWWA 3H8QA 4QQ7A 4Z2RA 1TW9A 4MZCA 1SJ6A 5IPGA 1HNAA 4G0LA 3TDGA 2WVXA 5DALA 3IHGA 3TOTA 4WR4A 1GUHA 4ML1A 3LSZA 1PSQA 4NPBA 3W8SA 1EOHA 2R6KA 1YF1A 4K7NA 1Z6NA 2DJ3A 1I5GA 4ECBA 2H19A 3GN3A 3HZ4A 2FHEA 5BRTA 1GSQA 1ERUA 4IP6A 3CWGA 3HJOA 4IJIA 4EE0A 1WP0A 3ZYWA 1WRYA 2H75A 4O5RA 2R0GA 4Z7XA 2XPEA 4GRFA 2I1UA 4Q5QA 4RQXA 1WOUA 1THOA 3R3EA 2FA4A 1JZRA 4KH7A 1RK4A 10GSA 3GKNA 3TRPA 1GUMA 4EIPA 3FR6A 3IA1A 1Z5YE 3KTBA 2X49A 4BL7A 4EF0A 2V41A 4EUYA 4HZ2A 1ILOA 2HE3A 1MD3A 1VF1A 3APQA 5EVOA 1JHBA 5D9WA 3PR8A 4IQ1A 3IXRA 4E8EA 2VM1A 4JR4A 3M9KA 2NVLA 5J3RA 2QC7A 4PI2C 1SYRA 3HJMA 2GQKA 1QFNA 1YJ6A 3ZIVA 5ECKB 3EU3A 4N0ZA 2KUCA 4IN0A 2GS3A 4PURA 4DVCA 5HR3A 3EMXA 3P90A 5HR1A 4EO3A 8GSSA 1YEPA 4NHWA 3GA4A 1N25A 1F9MA 2F8AA 1S3AA 3L9SA 3ZFLA 2VCQA 3TCOA 5AIXA 3KZQA 3HHVA 4TKYA 1Z9HA 3CMIA 3E0UA 1AUCA 1SL2B 4OCFA 5GAND 5L71A 3DWVA 4KF9A 2FWFA 4LA1A 4AKGA 2YP6A 3TB2A 2OBIA 1O73A 4XS6A 3GKMA 2RIIA 4BWQA 3APOA 2OT3A 1LJRA 2B5XA 1N2AA 2FGXA 2H0GA 5E4WA 3ERGA 1G7OA 4JE1A 3UJ1A 2X8CA 4GLTA 2MYGA 3DIEA 2X64A 3LYPA 2GZYA 1K3OA 5EPFA 3EE2A 4N11A 1XIYA 3ZVJA 5EL8A 2HRNA 2H8LA 4OO5A 2MMOA 4DSSB 4ZB7A 4AKXB 4H86A 4A5PA 1Q4JA 4RI7A 1XWBA 4FXYP 1WIKA 1DBYA 2YV9A 2HRKA 2HZEB 2MMAA 3BD2A 5A34B 5ECQB 1G6YA 2H6XA 1BQ7A 5ABRA 3N5OA 4LMVA 5A5HA 2OE0A 3GV1A 2BTOT 1SD9A 4MABA 3WYWA 3P2AA 3FZ9A 1MDKA 2QGVA 2VD1A 1SK1A 1U87A 2OA7A 1ACVA 3GKKA 1XCCA 4V2LA 3ZTLA 1A2LA 4TXOA 1V9WA 4MMMA 3L0HA 3WGDA 1YF0A 1FW1A 2EFEA 5GSSA 1QK8A 1TOFA 4KW6A 2CT6A 3VURA 5J4YA 2B1KA 4IVFA 1YEXA 2GSSA 2NBSA 1LBKA 4O92A 2R0CA 2F51A 4AKIA 1Y6EA 4IBPA 3EYTA 3R2QA 5BMUA 3IOSA 3WGEA 4MZBA 3LW9A 2HYXA 1TRWA 1UVZA 3GRXA 1IYHA 4PUFC 3VK9A 3MNGA 3M0FA 2O89A 3O3TA 2V1MA 4PX1A 2R4VA 4KDUA 4MF7A 1XZOA 1XFLA 2JSZA 5HQPA 4RUVA 2X99A 1PX6A 2CVBA 1X9WB 2PU9C 4N30A 1ZYQB 1GRXA 4ZL8A 5ECNB 2VIMA 3KIJA 1O85A 5DAKA 2LTKA 1QUWA 2JU5A 3DRNA 1T4YA 4PI0C 2FWGA 1V98A 5KOWA 1T7PB 2IPAA 1FOHA 1VF3A 1XBSA 3VPQA 1DE1A 3EINA 1ZYPA 3SBCA 1OKTA 4WBJA 5CP1A 5A1NB 4FIWA 3TOUA 3S9FA 2NPBA 4FQUA 5CREA 3W8JA 3IV4A 1SKRB 3TKPA 2GGTA 2VL2A 4HOJA 1GTBA 4BVXB 2VLVA 2RUFA 3J7Yk 1PL1A 2C80A 1OC9A 2A2RA 4TVEA 4OFNA 5J41A 5CAXA 5IPHA 4ISDA 2JL4A 3ZZXA 1THXA 4X4JA 4OO4A 1F2EA 1SK2A 4K2DA 3EMPA 2PVOC 4ML6A 1AIUA 3CSIA 1HD2A 2YWIA 3A3TA 4HI7A 1TJDA 1BF5A 4N3ZA 2CX3A 1FG4A 3KXOA 3BCKA 1HQOA 5D8IA 1S3DA 2LRNA 4YQMA 4XIHA 3FR3A 4WETA 1PD21 1C72A 2GZZA 1TK8B 2LRCA 2H01A 4I2UA 5D9TA 2MBSA 3AY8A 5IQYA 1S3RA 4L5LA 2VL2C 4GXZA 2EIRA 4Q5NA 2K8VA 3PPUA 4KCAA 5JWRB 1Z7PA 1OC8A 1M3IA 4ULXA 2WFCA 3LXTA 3K8NA 3HD5A 4NMUA 4MJEA 6GSWA 2CV4A 2A4HA 1MD4A 1TDIA 3D0ZA 3F8UA 1O81A 4X0XA 3ZRDA 5ECMB 2H1DA 1I9DA 1J9BA 3M9JA 3Q6OA 3CQFA 4K1FA 2H66A 4TR3A 2IL3A 1O7UA 1NM3A 2O8VB 2LSTA 1PQNA 2H1GA 3ZMLA 1ZZYA 4BIKA 5C00A 4D73B 3M8NA 5IM9A 1M99A 2YOIA 3F4SA 1AQXA 4ILFA 6GSUA 5ECLB 1GNWA 3FEUA 4AKHA 5CRDA 3LQ7A 4MF6A 1XVWA 2FD3A 1XWGA 1B9XC 1GWCA 4PXOA 3MYDA 3RHCA 5H5SA 2GQMA 1B4PA 5DQSA 1SJZA 3C7MA 1WE0A 3HDCA 1XW5A 3ZREA 2PGTA 5A4WA 4X1UA 2JZTA 4HU7A 2VCVA 1WJKA 3FHKA 3IC4A 4AJ8A 2WB9A 1SJIA 3GL3A 2WJUA 2DJ2A 2AV4A 2P31A 3IC8A 2ZUPA 2IMKA 2N5BA 2CA8A 3GIXA 4K5RA 1XOAA 1YDKA 5HFKA 14GSA 1TXUA 3I6AA 2HNLA 4NV5A 1SL1B 3F63A 2YWMA 3QCPA 2UZ8A 2IFQB 2WW2A 4O5UA 1XG8A 2AB6A 1VGLA 2I9HA 2L4QA 2UV8G 2HSYA 4ICYA 3UEMA 4K2XA 2DC5A 3GTUB 3TKRA 2AAWA 3UVTA 1BG5A 4GWRA 5EY6A 3LORA 2DIYA 3BJ5A 4KUNA 1XW6A 1BG1A 5D9XA 2LJRA 2VCXA 2H30A 1OKDA 1CQGA 2HZFA 1PFOA 1GULA 4PGTA 3WD6A 1ZGNA 3O76A 4DSSA 3QDNA 2ALBA 4L5OA 4IW9A 4O5QA 1GSFA 2DIZA 3DEXA 4OCEA 4DSQA 1AAZA 2RLIA 2FY6A 2HZEA 16GSA 5A34A 5KN1A 2GDRA 3GHAA 2LJKA 4BVYB 3F0IA 2ON5A 3IBHA 4TR0A 1V58A 4YKFA 4YKGA 1HNBA 2TIRA 1M2DA 1K0BA 1YQ1A 5ENUA 2YZHA 4GSSA 5JWQB 1PA3A 1SYXA 5AGYA 1MEKA 2HSMA 1Q98A 1SU9A 2C1YA 1K0AA 4Z2UA 4OFMA 2WDUA 4TR1A 5FHIA 1WWJA 4HQZA 3LWAA 1PN0A 1T00A 1DSBA 2H76A 2VO4A 1QXHA 2PWJA 4CDOA 3KD0A 1EV9A 1MTCA 4TRXA 4AGSA 2LUSA 1URMA 3DYRA 3IHQA 2PVQA 3QD9A 4GSNA 3HVSA 2QKEA 3ZLPA 1EGOA 3F6FA 4PTSA 1JZWA 2FA8A 2EC4A 3DVXA 2KLXA 2LKUA 5F0GA 2M72A 1UN2A 3F3QA 1K0OA 2EFHA 5F07A 4L0UA 3DMLA 1B48A 1XOBA 4KA0A 3UL3A 4F03A 3DGQA 3RPPA 1S3CA 2I3YA 4XS1A 3FZAA 3CRTA 2J23A 22GSA 4CHSA 3GURA 4ZB8A 3FW2A 5ID2A 3WT2A 3VI5A 2CX4A 1M2AA 2RM6A 4K5SA 1TRSA 5G5EA 2A2SA 2EIOA 1FAAA 1S4BP 4G9HA 4X43A 1TK5B 3H4KA 3RDWA 1AQVA 3P8WA 1VRSD 3BCIA 4LLRA 1K0CA 2GLRA 5E59A 2YV7A 4N0VA 3DD3A 4KDYA 1YKCA 1DUGA 3F4RA 3BOAA 2C3NA 5A1NA 4I5QA 3LJRA 1USBA 3KM6A 1MDIA 1TU8A 1EEJA 1Y1UA 1VF4A 5A4UA 1XWAA 1QQ2A 4BA7A 4BVXA 1GLPA 3HZ8A 4F0BA 2AYTA 3IRAA 4MF5A 2VOCA 2KP1A 2VLTA 3CBUA 4G19A 3IK7A 3FZ5A 5CYYA 5JCGA 4MLYA 4G0IA 4AJ6A 4HQSA 5B8AA 2H72A 5KN0A 3UMAA 2ZNMA 2OBKA 3TJGA 4IP1A 3CYNA 3G7IA 2YN1A 5J9BA 4EIQA 2WVZA 5G31A 2FUG2 3C73A 5H5QA 4OMVA 2OJLA 1T3BA 5B7CA 4KNDA 1YVLA 4YAPA 2I81A 5COHA 3EPTA 2K9FA 3Q18A 2PPTA 4ID0A 1EEMA 4V1Ap 2LRTA 4NAXA 2O5VA 1X5DA 3QPMA 5IOXA 9GSSA 4XRAA 3QAGA 2OE1A 4G10A 4TW5A 2AHEA 1M9BA 2DJKA 2LQQA 3M1GA 1OE7A 2C0DA 2XHFA 1PRXA 1A0RP 1OAZA 4ZB6A 3I69A 4KDXA 5H5RA 1A2JA 2V6KA 2FLSA 4FYBA 3J7Yb 2L6CA 1A23A 2XBIA 2H0HA 2J9HA 1X5CA 1SVMA 4LL4B 2YZUA 2GQLA 4MJBA 1ZOFA 5IMDA 3MSZA 4MK3A 3IDVA 1DE2A 3QFAC 2DKIA 4MZWA 3NOFA 4P3YB 3TRXA 1ABAA 1GL8A 2O85A 2GZPA 2LV3A 5JWOB 1F3AA 3QAWA 4J2FA 4CW9A 3TJFA 5LNKe 1TP9A 3Q74A 4XHMA 4GSTA 4D73A 4LMWA 3TRQA 2QSIA 5CRGA 4Q5FA 3QFBC 3WGXA 2LEGA 4JEDA 5B8BA 2XBQA 3GUSA 4QL9A 1A8YA 2HRFA 1G0TA 3APSA 1X9SB 4JZQA 1YZXA 3EU4A 5AISA 2H74A 2H6YA 5G5FA 4POMA 1WPIA 1GSDA 1ST9A 4HEA2 5INYA 3KH9A 2AJQB 4DEJA 3UVHA 3UBLA 2TRCP 2LNSA 4ZBDA 1BAYA 1J0FA 1NSWA 1G7EA 3E9JB 2P5RA 4I2TA 2WW3A 2OADA 3ZFBA 3CXGA 1PMTA 2JACA 3TJBA 3HCZA 2GSQA 1AXDA 3LG6A 5ELGA 1R26A 3CTGA 4V2MA 1IYIA 1F37A 2OKAA 3GX0A 5ECOB 1F6MC 5IO0A 1GUKA 4OWYA 4IKHA 1M2BA 3RAZA 4WBRD 4Z2TA 2B5EA 2YNXA 7GSSA 3LGCA 3TGZA 5IOWA 2V32A 3NIVA 5F06A 2B7KA 5JCUA 6GSYA 3I43A 4IHUA 4OD7A 3FKFA 1Y25A 3IK9A 1K0NA 2DKHA 5G2ZA 3GFKA 4HU9A 1EP8A 2GVPA 5FT3A 4JR6A 4BWSA 2YJHA 4BVYA 1JZOA 5CO3A 3KTLA 2GSTA 4TXOB 1HNCA 2WVYA 1SVOA 1H75A 1U88A 2A4VA 3H93A 1NW2A 2BMXA 4W66A 2IMIA 5KN3A 1KTEA 2JZSA 1Z3EA 1TI1A 2C0GA 4J57E 5B6NA 2AUVA 1AW9A 4WR5A 4XS4B 2TRXA 2R2JA 1K0MA 2R5GA 3EURA 1J08A 2BJXA 2X8HA 2Z9SA 3MIXA 2D2ZA 2H73A 3VWXA 1EZKA 3GL5A 2HSNB 1TRUA 1X9MB 1SL0B 1H4OA 4KX4A 3ZITA 5AN1A 1E2YA 3VWUA 1ML6A 4MJAA 2CVDA 3FMWA 4K7OA 5DCGA 2OE3A 4GCIA 5F05A 4HJMA 4K7IA 2ZCTA 1B4QA 2FWEA 3Q19A 3D21A 2N5AA 4PNFA 4AF2A 1M9AA 3ISOA 4EC0A 4IJ3A 2H1BA 4POLA 3A5WA 2HXKA 3HKRA 4F0CA 1TI3A 2B1LA 2V6OA 2YJ7A 1M3JA 1ERWA 2H70A 1FVKA 1R5AA 5D9VA 5KEJA 3FYGA 3CTFA 18GSA 2HQTA 1FVJA 2CZ2A 1V2AA 2LJAA 2P0GA 3IAM2 3GH9A 4E68A 1GTUA 3D22A 3QR6A 3FY7A 1B9YC 1XVQA 2OACA 3EC3A 2PBJA 5J5NA 1X0RA 3CSHA 2L4CA 4I97A 2RM5A 2CQ9A 1T4ZA 3KEBA 4K8MA 1SVLA 1ZCPA 5F8BA 5J4UA 4MNNA 3G7YA 3ZL5A 1OE8A 4HSCX 2WW0A 4PQIA 5G1KA 19GSA 2R0PA 1T1VA 4XCSA 2O36A 6GSSA 4ZL7A 4XTSA 5B6MA 3VFIA 2F8FA 2IWTA 5FWGA 3P7XA 4V2NA 4PNGA 1R5PA 2VKZG 1YEWC 2C8UA 3TKSE 3D4TA 2C3TA 3CHXC 17GSA 3EVIA 2K6VA 1VF2A 4IELA 1ZYEA 5DBQA 1NHOA 1U6TA 2R37A 3MWHA 2PUKC 4G01A 3ERFA 2JZRA 1EP7A 1UC7A 1EV4A 2H1AA 2M46A 2MBTA 5JCWA 3VWVA 5G30A 2DJJA 2P5QA 3LEFA 4DSRA 3KGKA 4CY6A 3A2VA 3GH6A 4LL1B 1XW9A 4AI6A 2DMLA 3ZIJA 2LQOA 4KSMA 4RI6A 4POKA 2IMDA 2FCHA 2E0QA 2HI7A 3TKQA 3LXZA 4ACSA 2WGRA 5DCHA 1GTIA 4K0GA 5ECPB 2VD0A 1K0DA 1WMJA 12GSA 5DVBA 2IN3A 5D96A 1W4VA 5GAPD 2B3SA 2N5FA 3GYKA 4MPFA 3E3EA 5J47A 4TN8A 3C1RA 4J56E 2K8SA 2B6MA 2H1LA 2QA1A 5IMVA 1BYEA 2FNOA 1ON4A
chains in the Genus database with same CATH topology
4NV2A 4NXIA 1GNEA 4F82A 4EDYA 2C0EA 1XPVA 2EFCA 3SWLA 1BEDA 3TKSA 2LS5A 3LFLA 2VLUA 1SKWB 2RUEA 3RBTA 3UBKA 1X5EA 1R7HA 4YAVA 4O32A 3QOUA 4MA9A 3VPTA 3A2XA 1Z7RA 4L0WA 1GSUA 2GTUA 1GSSA 4EKZA 2VCTA 2KOKA 4EVMA 1ZL9A 3FZ4A 4ECCA 4JU5A 3TJKA 5HR0A 2O87A 2MMNA 2IJYA 1ZMAA 5IMCA 3RHBA 2XPDA 4USSA 5IMAA 4KSOA 1FB0A 3GX8A 2VL3A 5C04A 5IO2A 2IIYA 2K18A 1JZDA 2CAIA 3QAVA 1K3LA 2VUPA 3ZVJD 2VM2A 2DMMA 3DVWA 2HFDA 3TKSC 2VCZA 3KH7A 3PGTA 4EDZA 3PH9A 1QGVA 2GT5A 3U5RE 2CAQA 2CVKA 1ERVA 1EGRA 3CSJA 1NHYA 2O7KA 2EFDA 3TJJA 4ECJA 1CQHA 1U3AA 1GP1A 5ECSA 2L5LA 3W6GA 5DALB 2VCWA 5HFGA 1FHEA 2WZ9A 3NZNA 2G2QA 5ECRB 3FK8A 3IAS2 4N10A 3TU3B 1EWXA 2DJ0A 1JFUA 1BJXA 2YWOA 1RW1A 4KB3A 3DXBA 5ECHB 1FB6A 1UA5A 4POBA 4AJ7A 3F9UA 6GSVA 3HXSA 4TOPA 2MZCA 2ES7A 4GTUA 3C8EA 3U6VA 1PN9A 2B7JA 2M80A 1K3YA 3IR4A 4FH8A 3H1NA 2YPMA 2HSMB 1KNGA 2MMZA 3KP9A 3L4NA 1OC3A 1A8LA 4TR1B 4BL7B 4ZL9A 5ELAA 4EXJA 4HDEA 1PGTA 2L5OA 4ZB9A 2JSYA 3CRUA 1PX7A 4XS4A 4MDCA 5GSTA 1PKZA 3HVVA 4HZ4A 2YANA 4K9ZA 3US3A 3IE3A 3OR5A 3KMNA 3F6DA 4F9ZA 2KHPA 3FR9A 1SENA 1SK0A 1TU7A 1SKSB 2HSNA 4G2EA 4K6XA 3BBYA 2X4AA 2I4AA 1GSEA 4KGIA 1A0FA 3ED3A 3LYKA 2CZ3A 4PQ1A 4Q5RA 2QA2A 1FO5A 3PINA 5IMFA 3TUEA 3D6IA 4JRRA 2C0FA 5LCZA 2PERA 4YH2A 4E8HA 5ID2B 1XWKA 2DLXA 3RPNA 4KE3A 1E6BA 2L59A 3A2WA 1HYUA 1BX9A 5J40A 3DKSA 20GSA 5D93A 4FYCA 2C4JA 2GT6A 4I6XA 1YKAA 3KCMA 3F4TA 3KP8A 3QMXA 2X8GA 1AC1A 2YWNA 3GKXA 3HVXA 2WCIA 3HY2A 4L8EA 2VAFA 4K0NA 1TTZA 3KJYA 3UOMA 1N8JA 1F3BA 4GQCA 4NHZA 4MH3A 5DJMA 4YQVA 1MDJA 5D73A 2IFQA 4KAEA 1GH2A 4WKWA 5GZZB 2E2MA 2WS2A 3GMFA 2KP2A 1TKDB 4QMKA 1PKWA 3D4MA 2G0FA 3MDKA 2ON7A 3GTUA 1A2MA 1QMVA 4ZIJA 2NDOA 2DSAA 4MJCA 1GTAA 2PMTA 2IMEA 1U3IA 2YCDA 4PUAA 4KCEA 3G9BA 2HRKB 3GNJA 5J4VA 4WEYA 5CRHA 5HFIA 4WF5A 3L78A 4ZBBA 2WULA 3ERWA 4PQHA 5DQYA 4MCUA 4TR4A 3C71A 5A5HB 3L9UA 3HYPA 4EL1A 4CY8A 2HT9A 4TXVA 3UAPA 6GSTA 1LU4A 4IQAA 4FO5A 4WF4A 5ECIB 2DJ1A 2R3XA 2HRAA 5DDLA 1JLWA 4IS0A 1AQWA 3JCML 5KN2A 1GLQA 3A5IA 4BPYA 3M3MA 2JADA 2EIQA 2PN8A 1V40A 3VI7A 4MP4A 4V1Ag 4NWYA 4WXTA 2H6ZA 1M0UA 4HUAA 5CRWA 3V1WA 3ME7A 3H79A 4YQUA 1R4WA 1TK0B 5BMUB 4IGJA 1KEBA 3EWLA 1B8XA 1KBNA 4JBBA 3FRCA 3I9V2 2FWHA 5CNWA 1Z6MA 4GQFA 3GSSA 4GDFA 2F9SA 1FOVA 1ZYNA 1EOGA 3GSTA 2REMA 1XXUA 1TXXA 5IIZA 5J9CA 2HLSA 5G1LA 4I8BA 3VLNA 5KOXA 5A5KA 4HJ2A 1OYJA 1W89A 6GSXA 3ME8A 1M7TA 2VL9A 5DAKB 1JLVA 1PL2A 2E2GA 2L57A 4GF0A 4G0KA 2H0IA 4HS1A 5AIVA 1A24A 1YY7A 1O8WA 1GSYA 2C3QA 2NTOA 3ZMKA 3UIWA 4ZILA 4F2IA 1TRVA 4MPGA 3UARA 4XRDA 1G6WA 4O7HA 1SD8A 5IMZA 2F3MA 3G7JA 4ZBAA 4RQRA 2LNTA 3N9JA 2A2PA 2B5YA 3HA9A 1OC9B 13GSA 3D5JA 2L6DA 2GSRA 4ECIA 3HJPA 1XWCA 5HR2A 2E7PA 5DJLA 3MAKA 11GSA 1O6JA 2DBCA 2WRTA 4MH2A 3C1SA 1OVNA 2V2GA 2H71A 3O6TA 5A4VA 1O8XA 3IPZA 3WT1A 3KMOA 3F3RA 1RQMA 5LD0A 1ERTA 2IMFA 3L9VA 4FYUA 2HSHA 4OFTA 4QL7A 4ZXGA 1V57A 1T8EB 3HMJG 2XC2A 3VWWA 3H8QA 4QQ7A 4Z2RA 1TW9A 4MZCA 1SJ6A 5IPGA 1HNAA 4G0LA 3TDGA 5DALA 3IHGA 3TOTA 4WR4A 1GUHA 4ML1A 3LSZA 1PSQA 4NPBA 3W8SA 1EOHA 2R6KA 1YF1A 4K7NA 1Z6NA 2DJ3A 1I5GA 4ECBA 2H19A 3GN3A 3HZ4A 2FHEA 5BRTA 1GSQA 1ERUA 4IP6A 3CWGA 3HJOA 4IJIA 4EE0A 1WP0A 3ZYWA 1WRYA 2H75A 4O5RA 2R0GA 4Z7XA 2XPEA 4GRFA 2I1UA 4Q5QA 4RQXA 1WOUA 1THOA 3R3EA 2FA4A 1JZRA 4KH7A 1RK4A 10GSA 3GKNA 3TRPA 1GUMA 4EIPA 3FR6A 3IA1A 1Z5YE 3KTBA 2X49A 4BL7A 4EF0A 2V41A 4EUYA 4HZ2A 1ILOA 2HE3A 1MD3A 1VF1A 3APQA 5EVOA 1JHBA 5D9WA 3PR8A 4IQ1A 3IXRA 4E8EA 2VM1A 4JR4A 3M9KA 2NVLA 5J3RA 2QC7A 1SYRA 2GQKA 3HJMA 1QFNA 1YJ6A 3ZIVA 5ECKB 3EU3A 4N0ZA 2KUCA 4IN0A 2GS3A 4PURA 4DVCA 5HR3A 3EMXA 3P90A 5HR1A 4EO3A 8GSSA 1YEPA 4NHWA 3GA4A 1N25A 1F9MA 2F8AA 1S3AA 3L9SA 3ZFLA 2VCQA 3TCOA 5AIXA 3KZQA 3HHVA 4TKYA 1Z9HA 3CMIA 3E0UA 1AUCA 1SL2B 4OCFA 5GAND 5L71A 3DWVA 4KF9A 2FWFA 4LA1A 4AKGA 2YP6A 3TB2A 2OBIA 1O73A 4XS6A 3GKMA 2RIIA 4BWQA 3APOA 2OT3A 1LJRA 2B5XA 1N2AA 2FGXA 2H0GA 5E4WA 3ERGA 1G7OA 4JE1A 3UJ1A 2X8CA 4GLTA 2MYGA 3DIEA 2X64A 3LYPA 2GZYA 1K3OA 5EPFA 3EE2A 4N11A 1XIYA 3ZVJA 5EL8A 2HRNA 2H8LA 4OO5A 2MMOA 4DSSB 4ZB7A 4AKXB 4H86A 4A5PA 1Q4JA 4RI7A 1XWBA 1WIKA 1DBYA 2YV9A 2HRKA 2HZEB 2MMAA 3BD2A 5A34B 5ECQB 1G6YA 2H6XA 1BQ7A 5ABRA 3N5OA 4LMVA 5A5HA 2OE0A 3GV1A 2BTOT 1SD9A 4MABA 3WYWA 3P2AA 3FZ9A 1MDKA 2QGVA 2VD1A 1SK1A 1U87A 2OA7A 1ACVA 3GKKA 1XCCA 4V2LA 3ZTLA 1A2LA 4TXOA 1V9WA 4MMMA 3L0HA 3WGDA 1YF0A 1FW1A 2EFEA 5GSSA 1QK8A 1TOFA 4KW6A 2CT6A 3VURA 5J4YA 2B1KA 4IVFA 1YEXA 2GSSA 2NBSA 1LBKA 4O92A 2R0CA 2F51A 4AKIA 1Y6EA 4IBPA 3EYTA 3R2QA 5BMUA 3IOSA 3WGEA 4MZBA 3LW9A 2HYXA 1TRWA 1UVZA 3GRXA 1IYHA 4PUFC 3VK9A 3MNGA 3M0FA 2O89A 3O3TA 2V1MA 4PX1A 2R4VA 4KDUA 4MF7A 1XZOA 1XFLA 2JSZA 5HQPA 4RUVA 2X99A 1PX6A 2CVBA 1X9WB 2PU9C 4N30A 1ZYQB 1GRXA 4ZL8A 5ECNB 2VIMA 3KIJA 1O85A 5DAKA 2LTKA 1QUWA 2JU5A 3DRNA 1T4YA 2FWGA 1V98A 5KOWA 1T7PB 2IPAA 1FOHA 1VF3A 1XBSA 3VPQA 1DE1A 3EINA 1ZYPA 3SBCA 1OKTA 4WBJA 5CP1A 5A1NB 4FIWA 3TOUA 3S9FA 2NPBA 4FQUA 5CREA 3W8JA 3IV4A 1SKRB 3TKPA 2GGTA 2VL2A 4HOJA 1GTBA 4BVXB 2VLVA 2RUFA 3J7Yk 1PL1A 2C80A 1OC9A 2A2RA 4TVEA 4OFNA 5J41A 5CAXA 5IPHA 4ISDA 2JL4A 3ZZXA 1THXA 4X4JA 4OO4A 1F2EA 1SK2A 4K2DA 3EMPA 2PVOC 4ML6A 1AIUA 3CSIA 1HD2A 2YWIA 3A3TA 4HI7A 1TJDA 1BF5A 4N3ZA 2CX3A 1FG4A 3KXOA 3BCKA 1HQOA 5D8IA 1S3DA 2LRNA 4YQMA 4XIHA 3FR3A 4WETA 1PD21 1C72A 2GZZA 1TK8B 2LRCA 2H01A 4I2UA 5D9TA 2MBSA 3AY8A 5IQYA 4L5LA 2VL2C 4GXZA 2EIRA 4Q5NA 2K8VA 3PPUA 4KCAA 5JWRB 1Z7PA 1OC8A 4ULXA 2WFCA 3LXTA 3K8NA 3HD5A 4NMUA 4MJEA 6GSWA 2CV4A 2A4HA 1MD4A 1TDIA 3D0ZA 3F8UA 1O81A 4X0XA 3ZRDA 5ECMB 2H1DA 1I9DA 1J9BA 3M9JA 3Q6OA 4K1FA 2H66A 4TR3A 2IL3A 1O7UA 1NM3A 2O8VB 2LSTA 1PQNA 2H1GA 3ZMLA 1ZZYA 5C00A 4D73B 3M8NA 5IM9A 1M99A 2YOIA 3F4SA 1AQXA 4ILFA 6GSUA 5ECLB 1GNWA 3FEUA 4AKHA 5CRDA 3LQ7A 4MF6A 1XVWA 2FD3A 1XWGA 1B9XC 1GWCA 4PXOA 3MYDA 3RHCA 5H5SA 2GQMA 1B4PA 5DQSA 1SJZA 3C7MA 1WE0A 3HDCA 1XW5A 3ZREA 2PGTA 5A4WA 4X1UA 2JZTA 4HU7A 2VCVA 1WJKA 3FHKA 3IC4A 4AJ8A 2WB9A 1SJIA 3GL3A 2WJUA 2DJ2A 2AV4A 2P31A 3IC8A 2ZUPA 2IMKA 2N5BA 2CA8A 3GIXA 4K5RA 1XOAA 1YDKA 5HFKA 14GSA 1TXUA 3I6AA 2HNLA 4NV5A 1SL1B 3F63A 2YWMA 3QCPA 2UZ8A 2IFQB 4O5UA 2AB6A 1VGLA 2I9HA 2L4QA 2UV8G 2HSYA 4ICYA 3UEMA 4K2XA 2DC5A 3GTUB 3TKRA 2AAWA 3UVTA 1BG5A 4GWRA 5EY6A 3LORA 2DIYA 3BJ5A 4KUNA 1XW6A 1BG1A 5D9XA 2LJRA 2VCXA 2H30A 1OKDA 1CQGA 2HZFA 1GULA 4PGTA 3WD6A 1ZGNA 3O76A 4DSSA 3QDNA 2ALBA 4L5OA 4IW9A 4O5QA 1GSFA 2DIZA 3DEXA 4OCEA 4DSQA 1AAZA 2RLIA 2FY6A 2HZEA 16GSA 5A34A 5KN1A 2GDRA 3GHAA 2LJKA 4BVYB 3F0IA 2ON5A 3IBHA 4TR0A 1V58A 4YKFA 4YKGA 1HNBA 2TIRA 1M2DA 1K0BA 1YQ1A 5ENUA 2YZHA 4GSSA 5JWQB 1PA3A 1SYXA 5AGYA 1MEKA 2HSMA 1Q98A 1SU9A 2C1YA 1K0AA 4Z2UA 4OFMA 2WDUA 4TR1A 5FHIA 1WWJA 4HQZA 3LWAA 1PN0A 1T00A 1DSBA 2H76A 2VO4A 1QXHA 2PWJA 4CDOA 3KD0A 1EV9A 1MTCA 4TRXA 4AGSA 2LUSA 1URMA 3DYRA 3IHQA 2PVQA 3QD9A 4GSNA 3HVSA 2QKEA 3ZLPA 1EGOA 3F6FA 4PTSA 1JZWA 2FA8A 2EC4A 3DVXA 2KLXA 2LKUA 5F0GA 2M72A 1UN2A 3F3QA 1K0OA 2EFHA 5F07A 4L0UA 3DMLA 1B48A 1XOBA 4KA0A 3UL3A 4F03A 3DGQA 3RPPA 1S3CA 2I3YA 4XS1A 3FZAA 3CRTA 2J23A 22GSA 4CHSA 3GURA 4ZB8A 3FW2A 5ID2A 3WT2A 3VI5A 2CX4A 1M2AA 2RM6A 4K5SA 1TRSA 5G5EA 2A2SA 2EIOA 1FAAA 4G9HA 4X43A 1TK5B 3H4KA 3RDWA 1AQVA 3P8WA 1VRSD 3BCIA 4LLRA 1K0CA 2GLRA 5E59A 2YV7A 4N0VA 3DD3A 4KDYA 1YKCA 1DUGA 3F4RA 3BOAA 2C3NA 5A1NA 4I5QA 3LJRA 1USBA 3KM6A 1MDIA 1TU8A 1EEJA 1Y1UA 1VF4A 5A4UA 1XWAA 1QQ2A 4BA7A 4BVXA 1GLPA 3HZ8A 4F0BA 2AYTA 3IRAA 4MF5A 2VOCA 2KP1A 2VLTA 3CBUA 4G19A 3IK7A 3FZ5A 5CYYA 5JCGA 4MLYA 4G0IA 4AJ6A 4HQSA 5B8AA 2H72A 5KN0A 3UMAA 2ZNMA 2OBKA 3TJGA 4IP1A 3CYNA 3G7IA 2YN1A 5J9BA 4EIQA 5G31A 2FUG2 3C73A 5H5QA 4OMVA 2OJLA 1T3BA 5B7CA 4KNDA 1YVLA 4YAPA 2I81A 5COHA 3EPTA 2K9FA 3Q18A 2PPTA 4ID0A 1EEMA 4V1Ap 2LRTA 4NAXA 2O5VA 1X5DA 3QPMA 5IOXA 9GSSA 4XRAA 3QAGA 2OE1A 4G10A 4TW5A 2AHEA 1M9BA 2DJKA 2LQQA 3M1GA 1OE7A 2C0DA 2XHFA 1PRXA 1A0RP 1OAZA 4ZB6A 3I69A 4KDXA 5H5RA 1A2JA 2V6KA 2FLSA 4FYBA 3J7Yb 2L6CA 1A23A 2XBIA 2H0HA 2J9HA 1X5CA 1SVMA 4LL4B 2YZUA 2GQLA 4MJBA 1ZOFA 5IMDA 3MSZA 4MK3A 3IDVA 1DE2A 3QFAC 2DKIA 4MZWA 3NOFA 4P3YB 3TRXA 1ABAA 1GL8A 2O85A 2GZPA 2LV3A 5JWOB 1F3AA 3QAWA 4J2FA 4CW9A 3TJFA 5LNKe 1TP9A 3Q74A 4XHMA 4GSTA 4D73A 4LMWA 3TRQA 2QSIA 5CRGA 4Q5FA 3QFBC 3WGXA 2LEGA 4JEDA 5B8BA 2XBQA 3GUSA 4QL9A 1A8YA 2HRFA 1G0TA 3APSA 1X9SB 4JZQA 1YZXA 3EU4A 5AISA 2H74A 2H6YA 5G5FA 4POMA 1WPIA 1GSDA 1ST9A 4HEA2 5INYA 3KH9A 2AJQB 4DEJA 3UVHA 3UBLA 2TRCP 2LNSA 4ZBDA 1BAYA 1J0FA 1NSWA 1G7EA 3E9JB 2P5RA 4I2TA 2OADA 3ZFBA 3CXGA 1PMTA 2JACA 3TJBA 3HCZA 2GSQA 1AXDA 3LG6A 5ELGA 1R26A 3CTGA 4V2MA 1IYIA 1F37A 2OKAA 3GX0A 5ECOB 1F6MC 5IO0A 1GUKA 4OWYA 4IKHA 1M2BA 3RAZA 4WBRD 4Z2TA 2B5EA 2YNXA 7GSSA 3LGCA 3TGZA 5IOWA 2V32A 3NIVA 5F06A 2B7KA 5JCUA 6GSYA 3I43A 4IHUA 4OD7A 3FKFA 1Y25A 3IK9A 1K0NA 2DKHA 5G2ZA 3GFKA 4HU9A 1EP8A 2GVPA 5FT3A 4JR6A 4BWSA 2YJHA 4BVYA 1JZOA 5CO3A 3KTLA 2GSTA 4TXOB 1HNCA 1SVOA 1H75A 1U88A 2A4VA 3H93A 1NW2A 2BMXA 4W66A 2IMIA 5KN3A 1KTEA 2JZSA 1Z3EA 1TI1A 2C0GA 4J57E 5B6NA 2AUVA 1AW9A 4WR5A 4XS4B 2TRXA 2R2JA 1K0MA 2R5GA 3EURA 1J08A 2BJXA 2X8HA 2Z9SA 3MIXA 2D2ZA 2H73A 3VWXA 1EZKA 3GL5A 2HSNB 1TRUA 1X9MB 1SL0B 1H4OA 4KX4A 3ZITA 5AN1A 1E2YA 3VWUA 1ML6A 4MJAA 2CVDA 3FMWA 4K7OA 5DCGA 2OE3A 4GCIA 5F05A 4HJMA 4K7IA 2ZCTA 1B4QA 2FWEA 3Q19A 3D21A 2N5AA 4PNFA 4AF2A 1M9AA 3ISOA 4EC0A 4IJ3A 2H1BA 4POLA 3A5WA 2HXKA 3HKRA 4F0CA 1TI3A 2B1LA 2V6OA 2YJ7A 1ERWA 2H70A 1FVKA 1R5AA 5D9VA 5KEJA 3FYGA 3CTFA 18GSA 2HQTA 1FVJA 2CZ2A 1V2AA 2LJAA 2P0GA 3IAM2 3GH9A 4E68A 1GTUA 3D22A 3QR6A 3FY7A 1B9YC 1XVQA 2OACA 3EC3A 2PBJA 5J5NA 1X0RA 3CSHA 2L4CA 4I97A 2RM5A 2CQ9A 1T4ZA 3KEBA 4K8MA 1SVLA 1ZCPA 5F8BA 5J4UA 4MNNA 3G7YA 3ZL5A 1OE8A 4PQIA 5G1KA 19GSA 2R0PA 1T1VA 4XCSA 6GSSA 4ZL7A 4XTSA 5B6MA 3VFIA 2F8FA 2IWTA 5FWGA 3P7XA 4V2NA 4PNGA 1R5PA 2VKZG 2C8UA 3TKSE 3D4TA 2C3TA 17GSA 3EVIA 2K6VA 1VF2A 4IELA 1ZYEA 5DBQA 1NHOA 1U6TA 2R37A 3MWHA 2PUKC 4G01A 3ERFA 2JZRA 1EP7A 1UC7A 1EV4A 2H1AA 2M46A 2MBTA 5JCWA 3VWVA 5G30A 2DJJA 2P5QA 3LEFA 4DSRA 3KGKA 4CY6A 3A2VA 3GH6A 4LL1B 1XW9A 4AI6A 2DMLA 3ZIJA 2LQOA 4KSMA 4RI6A 4POKA 2IMDA 2FCHA 2E0QA 2HI7A 3TKQA 3LXZA 4ACSA 2WGRA 5DCHA 1GTIA 4K0GA 5ECPB 2VD0A 1K0DA 1WMJA 12GSA 5DVBA 2IN3A 5D96A 1W4VA 5GAPD 2B3SA 2N5FA 3GYKA 4MPFA 3E3EA 5J47A 4TN8A 3C1RA 4J56E 2K8SA 2B6MA 2H1LA 2QA1A 5IMVA 1BYEA 2FNOA 1ON4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NV2 A;  4NXI A;  1GNE A;  4F82 A;  4EDY A;  2C0E A;  1XPV A;  3SWL A;  1BED A;  3TKS A;  2LS5 A;  3LFL A;  2VLU A;  1SKW B;  2RUE A;  3RBT A;  3UBK A;  1X5E A;  1R7H A;  4YAV A;  4O32 A;  3QOU A;  4MA9 A;  3VPT A;  3A2X A;  1Z7R A;  4L0W A;  1GSU A;  2GTU A;  1GSS A;  4EKZ A;  2VCT A;  2KOK A;  4EVM A;  1ZL9 A;  3FZ4 A;  4ECC A;  4JU5 A;  3TJK A;  5HR0 A;  2O87 A;  2MMN A;  2IJY A;  1ZMA A;  5IMC A;  3RHB A;  2XPD A;  4USS A;  5IMA A;  4KSO A;  1FB0 A;  3GX8 A;  2VL3 A;  5C04 A;  5IO2 A;  2IIY A;  2K18 A;  1JZD A;  2CAI A;  3QAV A;  1K3L A;  2VUP A;  3ZVJ D;  2VM2 A;  2DMM A;  3DVW A;  2HFD A;  3TKS C;  2VCZ A;  3KH7 A;  3PGT A;  4EDZ A;  3PH9 A;  1QGV A;  2GT5 A;  3U5R E;  2CAQ A;  2CVK A;  1ERV A;  1EGR A;  3CSJ A;  1NHY A;  2O7K A;  3TJJ A;  4ECJ A;  1CQH A;  1U3A A;  1GP1 A;  5ECS A;  2L5L A;  3W6G A;  5DAL B;  2VCW A;  5HFG A;  1FHE A;  2WZ9 A;  3NZN A;  2G2Q A;  5ECR B;  3FK8 A;  3IAS 2;  4N10 A;  1EWX A;  2DJ0 A;  1JFU A;  1BJX A;  2YWO A;  1RW1 A;  4KB3 A;  3DXB A;  5ECH B;  1FB6 A;  1UA5 A;  4POB A;  4AJ7 A;  3F9U A;  6GSV A;  3HXS A;  4TOP A;  2MZC A;  2ES7 A;  4GTU A;  3C8E A;  3U6V A;  1PN9 A;  2B7J A;  2M80 A;  1K3Y A;  3IR4 A;  4FH8 A;  3H1N A;  2YPM A;  2HSM B;  1KNG A;  2MMZ A;  3KP9 A;  3L4N A;  1OC3 A;  1A8L A;  4TR1 B;  4BL7 B;  4ZL9 A;  5ELA A;  4EXJ A;  4HDE A;  1PGT A;  2L5O A;  4ZB9 A;  2JSY A;  3CRU A;  1PX7 A;  4XS4 A;  4MDC A;  5GST A;  1PKZ A;  3HVV A;  4HZ4 A;  4K9Z A;  2YAN A;  3US3 A;  3IE3 A;  3OR5 A;  3KMN A;  3F6D A;  4F9Z A;  2KHP A;  3FR9 A;  1SEN A;  1SK0 A;  1TU7 A;  1SKS B;  4G2E A;  4K6X A;  3BBY A;  2I4A A;  1GSE A;  4KGI A;  1A0F A;  3ED3 A;  3LYK A;  2CZ3 A;  4PQ1 A;  4Q5R A;  1FO5 A;  3PIN A;  5IMF A;  3TUE A;  3D6I A;  4JRR A;  2C0F A;  5LCZ A;  2PER A;  4YH2 A;  4E8H A;  5ID2 B;  1XWK A;  2DLX A;  3RPN A;  4KE3 A;  1E6B A;  2L59 A;  3A2W A;  1HYU A;  1BX9 A;  3DKS A;  20GS A;  5D93 A;  4FYC A;  2C4J A;  2GT6 A;  4I6X A;  1YKA A;  3KCM A;  3F4T A;  3KP8 A;  3QMX A;  2X8G A;  1AC1 A;  2YWN A;  3GKX A;  3HVX A;  2WCI A;  3HY2 A;  4L8E A;  2VAF A;  4K0N A;  1TTZ A;  3KJY A;  3UOM A;  1N8J A;  1F3B A;  4GQC A;  4NHZ A;  4MH3 A;  5DJM A;  4YQV A;  1MDJ A;  5D73 A;  2IFQ A;  4KAE A;  1GH2 A;  4WKW A;  5GZZ B;  2E2M A;  2WS2 A;  3GMF A;  2KP2 A;  1TKD B;  1PKW A;  3D4M A;  2G0F A;  3MDK A;  2ON7 A;  3GTU A;  1A2M A;  1QMV A;  4ZIJ A;  2NDO A;  2DSA A;  4MJC A;  1GTA A;  2PMT A;  2IME A;  1U3I A;  2YCD A;  4PUA A;  4KCE A;  3G9B A;  2HRK B;  3GNJ A;  4WEY A;  5CRH A;  5HFI A;  4WF5 A;  3L78 A;  4ZBB A;  2WUL A;  3ERW A;  4PQH A;  5DQY A;  4MCU A;  4TR4 A;  3C71 A;  3L9U A;  3HYP A;  4EL1 A;  2HT9 A;  4TXV A;  3UAP A;  6GST A;  1LU4 A;  4IQA A;  4FO5 A;  4WF4 A;  5ECI B;  2DJ1 A;  2R3X A;  2HRA A;  5DDL A;  1JLW A;  4IS0 A;  1AQW A;  3JCM L;  5KN2 A;  1GLQ A;  4BPY A;  3M3M A;  2JAD A;  2EIQ A;  2PN8 A;  1V40 A;  3VI7 A;  4MP4 A;  4V1A g;  4NWY A;  4WXT A;  2H6Z A;  1M0U A;  4HUA A;  5CRW A;  3V1W A;  3ME7 A;  3H79 A;  4YQU A;  1R4W A;  1TK0 B;  4IGJ A;  1KEB A;  3EWL A;  1B8X A;  1KBN A;  4JBB A;  3FRC A;  3I9V 2;  2FWH A;  5CNW A;  1Z6M A;  4GQF A;  3GSS A;  2F9S A;  1FOV A;  1EOG A;  3GST A;  2REM A;  1XXU A;  1TXX A;  5IIZ A;  5J9C A;  2HLS A;  5G1L A;  4I8B A;  3VLN A;  5A5K A;  4HJ2 A;  1OYJ A;  1W89 A;  6GSX A;  3ME8 A;  1M7T A;  2VL9 A;  5DAK B;  1JLV A;  1PL2 A;  2E2G A;  2L57 A;  4GF0 A;  4G0K A;  2H0I A;  4HS1 A;  5AIV A;  1A24 A;  1YY7 A;  1O8W A;  1GSY A;  2C3Q A;  2NTO A;  3ZMK A;  3UIW A;  4ZIL A;  4F2I A;  1TRV A;  4MPG A;  3UAR A;  4XRD A;  1G6W A;  4O7H A;  1SD8 A;  5IMZ A;  2F3M A;  3G7J A;  4ZBA A;  4RQR A;  2LNT A;  3N9J A;  2B5Y A;  3HA9 A;  1OC9 B;  13GS A;  3D5J A;  2L6D A;  2GSR A;  4ECI A;  3HJP A;  1XWC A;  5HR2 A;  2E7P A;  5DJL A;  3MAK A;  11GS A;  1O6J A;  2DBC A;  2WRT A;  4MH2 A;  3C1S A;  1OVN A;  2V2G A;  2H71 A;  3O6T A;  5A4V A;  1O8X A;  3IPZ A;  3WT1 A;  3KMO A;  3F3R A;  1RQM A;  5LD0 A;  1ERT A;  2IMF A;  3L9V A;  4FYU A;  2HSH A;  4OFT A;  4QL7 A;  4ZXG A;  1V57 A;  1T8E B;  2XC2 A;  3VWW A;  3H8Q A;  4QQ7 A;  1TW9 A;  4MZC A;  1SJ6 A;  5IPG A;  1HNA A;  4G0L A;  3TDG A;  5DAL A;  3TOT A;  4WR4 A;  1GUH A;  4ML1 A;  3LSZ A;  1PSQ A;  4NPB A;  3W8S A;  1EOH A;  2R6K A;  1YF1 A;  4K7N A;  1Z6N A;  2DJ3 A;  1I5G A;  4ECB A;  2H19 A;  3GN3 A;  3HZ4 A;  2FHE A;  1GSQ A;  1ERU A;  4IP6 A;  3HJO A;  4IJI A;  4EE0 A;  1WP0 A;  3ZYW A;  1WRY A;  2H75 A;  4O5R A;  4Z7X A;  2XPE A;  4GRF A;  2I1U A;  4Q5Q A;  4RQX A;  1WOU A;  1THO A;  3R3E A;  2FA4 A;  1JZR A;  4KH7 A;  1RK4 A;  10GS A;  3GKN A;  3TRP A;  1GUM A;  3FR6 A;  3IA1 A;  1Z5Y E;  3KTB A;  4BL7 A;  4EF0 A;  2V41 A;  4EUY A;  4HZ2 A;  1ILO A;  2HE3 A;  1MD3 A;  1VF1 A;  3APQ A;  5EVO A;  1JHB A;  5D9W A;  3PR8 A;  4IQ1 A;  3IXR A;  4E8E A;  2VM1 A;  4JR4 A;  3M9K A;  2NVL A;  5J3R A;  2QC7 A;  1SYR A;  2GQK A;  3HJM A;  1QFN A;  1YJ6 A;  3ZIV A;  5ECK B;  3EU3 A;  4N0Z A;  2KUC A;  4IN0 A;  2GS3 A;  4PUR A;  4DVC A;  5HR3 A;  3EMX A;  3P90 A;  5HR1 A;  4EO3 A;  8GSS A;  1YEP A;  4NHW A;  3GA4 A;  1F9M A;  2F8A A;  1S3A A;  3L9S A;  3ZFL A;  2VCQ A;  3TCO A;  5AIX A;  3KZQ A;  3HHV A;  4TKY A;  1Z9H A;  3CMI A;  3E0U A;  1AUC A;  1SL2 B;  4OCF A;  5GAN D;  5L71 A;  3DWV A;  4KF9 A;  2FWF A;  4LA1 A;  2YP6 A;  3TB2 A;  2OBI A;  1O73 A;  4XS6 A;  3GKM A;  2RII A;  4BWQ A;  3APO A;  1LJR A;  2B5X A;  1N2A A;  2FGX A;  2H0G A;  5E4W A;  3ERG A;  1G7O A;  4JE1 A;  3UJ1 A;  2X8C A;  4GLT A;  2MYG A;  3DIE A;  2X64 A;  3LYP A;  2GZY A;  1K3O A;  5EPF A;  3EE2 A;  4N11 A;  1XIY A;  3ZVJ A;  5EL8 A;  2HRN A;  2H8L A;  4OO5 A;  2MMO A;  4DSS B;  4H86 A;  1Q4J A;  4RI7 A;  1XWB A;  1WIK A;  1DBY A;  2YV9 A;  2HRK A;  2HZE B;  2MMA A;  3BD2 A;  5ECQ B;  1G6Y A;  2H6X A;  1BQ7 A;  5ABR A;  3N5O A;  4LMV A;  2OE0 A;  3GV1 A;  2BTO T;  1SD9 A;  4MAB A;  3WYW A;  3P2A A;  3FZ9 A;  1MDK A;  2QGV A;  2VD1 A;  1SK1 A;  1U87 A;  2OA7 A;  1ACV A;  3GKK A;  1XCC A;  4V2L A;  3ZTL A;  1A2L A;  4TXO A;  1V9W A;  4MMM A;  3L0H A;  3WGD A;  1YF0 A;  1FW1 A;  5GSS A;  1QK8 A;  1TOF A;  4KW6 A;  2CT6 A;  3VUR A;  2B1K A;  4IVF A;  1YEX A;  2GSS A;  2NBS A;  1LBK A;  4O92 A;  2F51 A;  1Y6E A;  4IBP A;  3EYT A;  3R2Q A;  5BMU A;  3IOS A;  3WGE A;  4MZB A;  2HYX A;  1TRW A;  1UVZ A;  3GRX A;  1IYH A;  4PUF C;  3VK9 A;  3MNG A;  3M0F A;  2O89 A;  3O3T A;  2V1M A;  4PX1 A;  2R4V A;  4KDU A;  4MF7 A;  1XZO A;  1XFL A;  2JSZ A;  5HQP A;  4RUV A;  2X99 A;  1PX6 A;  2CVB A;  1X9W B;  2PU9 C;  4N30 A;  1ZYQ B;  1GRX A;  4ZL8 A;  5ECN B;  2VIM A;  3KIJ A;  1O85 A;  5DAK A;  2LTK A;  1QUW A;  2JU5 A;  3DRN A;  1T4Y A;  2FWG A;  1V98 A;  1T7P B;  2IPA A;  1VF3 A;  1XBS A;  3VPQ A;  1DE1 A;  3EIN A;  3SBC A;  1OKT A;  4WBJ A;  5CP1 A;  4FIW A;  3TOU A;  3S9F A;  2NPB A;  4FQU A;  5CRE A;  3W8J A;  3IV4 A;  1SKR B;  3TKP A;  2GGT A;  2VL2 A;  4HOJ A;  1GTB A;  4BVX B;  2VLV A;  2RUF A;  3J7Y k;  1PL1 A;  2C80 A;  1OC9 A;  2A2R A;  4TVE A;  4OFN A;  5J41 A;  5CAX A;  5IPH A;  4ISD A;  2JL4 A;  3ZZX A;  1THX A;  4OO4 A;  1F2E A;  1SK2 A;  4K2D A;  3EMP A;  2PVO C;  4ML6 A;  1AIU A;  3CSI A;  1HD2 A;  2YWI A;  3A3T A;  4HI7 A;  1TJD A;  2CX3 A;  1FG4 A;  3KXO A;  3BCK A;  1HQO A;  5D8I A;  1S3D A;  2LRN A;  4YQM A;  4XIH A;  3FR3 A;  4WET A;  1PD2 1;  1C72 A;  2GZZ A;  1TK8 B;  2LRC A;  2H01 A;  4I2U A;  5D9T A;  2MBS A;  3AY8 A;  5IQY A;  4L5L A;  2VL2 C;  4GXZ A;  2EIR A;  4Q5N A;  2K8V A;  3PPU A;  4KCA A;  5JWR B;  1Z7P A;  1OC8 A;  4ULX A;  2WFC A;  3LXT A;  3K8N A;  3HD5 A;  4NMU A;  4MJE A;  6GSW A;  2CV4 A;  1MD4 A;  1TDI A;  3D0Z A;  3F8U A;  1O81 A;  4X0X A;  3ZRD A;  5ECM B;  2H1D A;  1I9D A;  1J9B A;  3M9J A;  3Q6O A;  4K1F A;  2H66 A;  4TR3 A;  2IL3 A;  1O7U A;  1NM3 A;  2O8V B;  2LST A;  1PQN A;  2H1G A;  3ZML A;  1ZZY A;  5C00 A;  4D73 B;  3M8N A;  5IM9 A;  1M99 A;  2YOI A;  3F4S A;  1AQX A;  4ILF A;  6GSU A;  5ECL B;  1GNW A;  3FEU A;  5CRD A;  3LQ7 A;  4MF6 A;  1XVW A;  2FD3 A;  1XWG A;  1B9X C;  1GWC A;  4PXO A;  3RHC A;  5H5S A;  2GQM A;  1B4P A;  5DQS A;  1SJZ A;  3C7M A;  1WE0 A;  3HDC A;  1XW5 A;  3ZRE A;  2PGT A;  5A4W A;  4X1U A;  2JZT A;  4HU7 A;  2VCV A;  1WJK A;  3FHK A;  3IC4 A;  4AJ8 A;  2WB9 A;  1SJI A;  3GL3 A;  2WJU A;  2DJ2 A;  2AV4 A;  2P31 A;  3IC8 A;  2ZUP A;  2IMK A;  2N5B A;  2CA8 A;  3GIX A;  1XOA A;  1YDK A;  5HFK A;  14GS A;  3I6A A;  2HNL A;  4NV5 A;  1SL1 B;  3F63 A;  2YWM A;  3QCP A;  2UZ8 A;  2IFQ B;  2AB6 A;  1VGL A;  2I9H A;  2L4Q A;  2HSY A;  3UEM A;  2DC5 A;  3GTU B;  3TKR A;  2AAW A;  3UVT A;  1BG5 A;  4GWR A;  5EY6 A;  3LOR A;  2DIY A;  3BJ5 A;  4KUN A;  1XW6 A;  5D9X A;  2LJR A;  2VCX A;  2H30 A;  1OKD A;  1CQG A;  2HZF A;  1GUL A;  4PGT A;  3WD6 A;  1ZGN A;  3O76 A;  4DSS A;  3QDN A;  2ALB A;  4L5O A;  4IW9 A;  1GSF A;  2DIZ A;  3DEX A;  4OCE A;  4DSQ A;  1AAZ A;  2RLI A;  2FY6 A;  2HZE A;  16GS A;  5KN1 A;  2GDR A;  3GHA A;  2LJK A;  4BVY B;  3F0I A;  2ON5 A;  3IBH A;  4TR0 A;  1V58 A;  1HNB A;  2TIR A;  1M2D A;  1K0B A;  1YQ1 A;  5ENU A;  2YZH A;  4GSS A;  5JWQ B;  1PA3 A;  1SYX A;  5AGY A;  1MEK A;  2HSM A;  1Q98 A;  1SU9 A;  2C1Y A;  1K0A A;  4OFM A;  2WDU A;  4TR1 A;  5FHI A;  1WWJ A;  4HQZ A;  3LWA A;  1T00 A;  1DSB A;  2H76 A;  2VO4 A;  1QXH A;  2PWJ A;  4CDO A;  3KD0 A;  1EV9 A;  1MTC A;  4TRX A;  4AGS A;  2LUS A;  1URM A;  3DYR A;  3IHQ A;  2PVQ A;  3QD9 A;  4GSN A;  3HVS A;  2QKE A;  3ZLP A;  1EGO A;  3F6F A;  4PTS A;  1JZW A;  2FA8 A;  2EC4 A;  3DVX A;  2KLX A;  2LKU A;  5F0G A;  2M72 A;  1UN2 A;  3F3Q A;  1K0O A;  5F07 A;  4L0U A;  3DML A;  1B48 A;  1XOB A;  4KA0 A;  3UL3 A;  4F03 A;  3DGQ A;  3RPP A;  1S3C A;  2I3Y A;  4XS1 A;  3FZA A;  3CRT A;  2J23 A;  22GS A;  4CHS A;  3GUR A;  4ZB8 A;  3FW2 A;  5ID2 A;  3WT2 A;  3VI5 A;  2CX4 A;  1M2A A;  2RM6 A;  1TRS A;  5G5E A;  2A2S A;  2EIO A;  1FAA A;  4G9H A;  4X43 A;  1TK5 B;  3H4K A;  3RDW A;  1AQV A;  3P8W A;  1VRS D;  3BCI A;  4LLR A;  1K0C A;  2GLR A;  5E59 A;  2YV7 A;  4N0V A;  3DD3 A;  4KDY A;  1YKC A;  1DUG A;  3F4R A;  3BOA A;  2C3N A;  4I5Q A;  3LJR A;  1USB A;  3KM6 A;  1MDI A;  1TU8 A;  1EEJ A;  1VF4 A;  5A4U A;  1XWA A;  1QQ2 A;  4BA7 A;  4BVX A;  1GLP A;  3HZ8 A;  4F0B A;  2AYT A;  3IRA A;  4MF5 A;  2VOC A;  2KP1 A;  2VLT A;  3CBU A;  4G19 A;  3IK7 A;  3FZ5 A;  5CYY A;  5JCG A;  4MLY A;  4G0I A;  4AJ6 A;  4HQS A;  5B8A A;  2H72 A;  5KN0 A;  3UMA A;  2ZNM A;  2OBK A;  3TJG A;  4IP1 A;  3CYN A;  3G7I A;  2YN1 A;  5J9B A;  5G31 A;  2FUG 2;  3C73 A;  5H5Q A;  4OMV A;  2OJL A;  1T3B A;  5B7C A;  4KND A;  4YAP A;  2I81 A;  5COH A;  2K9F A;  3Q18 A;  2PPT A;  4ID0 A;  1EEM A;  4V1A p;  2LRT A;  4NAX A;  1X5D A;  3QPM A;  5IOX A;  9GSS A;  4XRA A;  3QAG A;  2OE1 A;  4G10 A;  4TW5 A;  2AHE A;  1M9B A;  2DJK A;  2LQQ A;  3M1G A;  1OE7 A;  2C0D A;  2XHF A;  1PRX A;  1A0R P;  1OAZ A;  4ZB6 A;  3I69 A;  4KDX A;  5H5R A;  1A2J A;  2V6K A;  2FLS A;  4FYB A;  3J7Y b;  2L6C A;  1A23 A;  2XBI A;  2H0H A;  2J9H A;  1X5C A;  4LL4 B;  2YZU A;  2GQL A;  4MJB A;  1ZOF A;  5IMD A;  3MSZ A;  4MK3 A;  3IDV A;  1DE2 A;  3QFA C;  4MZW A;  3NOF A;  4P3Y B;  3TRX A;  1ABA A;  1GL8 A;  2O85 A;  2GZP A;  2LV3 A;  5JWO B;  1F3A A;  3QAW A;  4J2F A;  4CW9 A;  3TJF A;  5LNK e;  1TP9 A;  3Q74 A;  4XHM A;  4GST A;  4D73 A;  4LMW A;  3TRQ A;  2QSI A;  5CRG A;  4Q5F A;  3QFB C;  3WGX A;  2LEG A;  4JED A;  5B8B A;  2XBQ A;  3GUS A;  4QL9 A;  1A8Y A;  2HRF A;  1G0T A;  3APS A;  1X9S B;  4JZQ A;  1YZX A;  3EU4 A;  5AIS A;  2H74 A;  2H6Y A;  5G5F A;  4POM A;  1WPI A;  1GSD A;  1ST9 A;  4HEA 2;  5INY A;  3KH9 A;  2AJQ B;  4DEJ A;  3UVH A;  3UBL A;  2TRC P;  2LNS A;  4ZBD A;  1BAY A;  1J0F A;  1NSW A;  1G7E A;  3E9J B;  2P5R A;  4I2T A;  2OAD A;  3ZFB A;  3CXG A;  1PMT A;  2JAC A;  3TJB A;  3HCZ A;  2GSQ A;  1AXD A;  3LG6 A;  5ELG A;  1R26 A;  3CTG A;  4V2M A;  1IYI A;  1F37 A;  2OKA A;  3GX0 A;  5ECO B;  1F6M C;  5IO0 A;  1GUK A;  4OWY A;  4IKH A;  1M2B A;  3RAZ A;  4WBR D;  2B5E A;  2YNX A;  7GSS A;  3LGC A;  3TGZ A;  5IOW A;  2V32 A;  3NIV A;  5F06 A;  2B7K A;  5JCU A;  6GSY A;  3I43 A;  4IHU A;  4OD7 A;  3FKF A;  1Y25 A;  3IK9 A;  1K0N A;  5G2Z A;  3GFK A;  4HU9 A;  1EP8 A;  2GVP A;  5FT3 A;  4JR6 A;  4BWS A;  2YJH A;  4BVY A;  1JZO A;  5CO3 A;  3KTL A;  2GST A;  4TXO B;  1HNC A;  1H75 A;  1U88 A;  2A4V A;  3H93 A;  1NW2 A;  2BMX A;  2IMI A;  5KN3 A;  1KTE A;  2JZS A;  1Z3E A;  1TI1 A;  2C0G A;  4J57 E;  5B6N A;  2AUV A;  1AW9 A;  4WR5 A;  4XS4 B;  2TRX A;  2R2J A;  1K0M A;  2R5G A;  3EUR A;  1J08 A;  2BJX A;  2X8H A;  2Z9S A;  2D2Z A;  2H73 A;  3VWX A;  1EZK A;  3GL5 A;  2HSN B;  1TRU A;  1X9M B;  1SL0 B;  1H4O A;  4KX4 A;  3ZIT A;  5AN1 A;  1E2Y A;  3VWU A;  1ML6 A;  4MJA A;  2CVD A;  4K7O A;  5DCG A;  2OE3 A;  4GCI A;  5F05 A;  4HJM A;  4K7I A;  2ZCT A;  1B4Q A;  2FWE A;  3Q19 A;  3D21 A;  2N5A A;  4PNF A;  4AF2 A;  1M9A A;  3ISO A;  4EC0 A;  4IJ3 A;  2H1B A;  4POL A;  3A5W A;  2HXK A;  3HKR A;  4F0C A;  1TI3 A;  2B1L A;  2V6O A;  2YJ7 A;  1ERW A;  2H70 A;  1FVK A;  1R5A A;  5D9V A;  5KEJ A;  3FYG A;  3CTF A;  18GS A;  2HQT A;  1FVJ A;  2CZ2 A;  1V2A A;  2LJA A;  2P0G A;  3IAM 2;  3GH9 A;  1GTU A;  3D22 A;  3QR6 A;  3FY7 A;  1B9Y C;  1XVQ A;  2OAC A;  3EC3 A;  2PBJ A;  5J5N A;  1X0R A;  3CSH A;  2L4C A;  4I97 A;  2RM5 A;  2CQ9 A;  1T4Z A;  3KEB A;  4K8M A;  1ZCP A;  5F8B A;  5J4U A;  3G7Y A;  3ZL5 A;  1OE8 A;  4PQI A;  5G1K A;  19GS A;  1T1V A;  4XCS A;  6GSS A;  4ZL7 A;  4XTS A;  5B6M A;  3VFI A;  2F8F A;  2IWT A;  5FWG A;  3P7X A;  4V2N A;  4PNG A;  1R5P A;  2C8U A;  3TKS E;  3D4T A;  2C3T A;  17GS A;  3EVI A;  2K6V A;  1VF2 A;  4IEL A;  1ZYE A;  5DBQ A;  1NHO A;  1U6T A;  2R37 A;  3MWH A;  2PUK C;  3ERF A;  2JZR A;  1EP7 A;  1UC7 A;  1EV4 A;  2H1A A;  2M46 A;  2MBT A;  5JCW A;  3VWV A;  5G30 A;  2DJJ A;  2P5Q A;  3LEF A;  4DSR A;  3KGK A;  3A2V A;  3GH6 A;  4LL1 B;  1XW9 A;  2DML A;  3ZIJ A;  2LQO A;  4KSM A;  4RI6 A;  4POK A;  2IMD A;  2FCH A;  2E0Q A;  2HI7 A;  3TKQ A;  3LXZ A;  4ACS A;  2WGR A;  5DCH A;  1GTI A;  4K0G A;  5ECP B;  2VD0 A;  1K0D A;  1WMJ A;  12GS A;  5DVB A;  2IN3 A;  5D96 A;  1W4V A;  5GAP D;  2B3S A;  2N5F A;  3GYK A;  4MPF A;  3E3E A;  4TN8 A;  3C1R A;  4J56 E;  2K8S A;  2B6M A;  5IMV A;  1BYE A;  2FNO A;  1ON4 A; 
#chains in the Genus database with same CATH topology
 4NV2 A;  3RGB C;  4NXI A;  2O3E A;  1GNE A;  4F82 A;  4EDY A;  2C0E A;  1XPV A;  2EFC A;  3SWL A;  1BED A;  3TKS A;  2LS5 A;  3LFL A;  2VLU A;  1SKW B;  2RUE A;  3RBT A;  3UBK A;  1X5E A;  1R7H A;  4YAV A;  4O32 A;  3QOU A;  4MA9 A;  3VPT A;  3A2X A;  1Z7R A;  4L0W A;  1GSU A;  2GTU A;  1GSS A;  4EKZ A;  2VCT A;  2KOK A;  4EVM A;  2WZS A;  1ZL9 A;  3FZ4 A;  4ECC A;  4JU5 A;  3TJK A;  5HR0 A;  2O87 A;  2MMN A;  2IJY A;  1ZMA A;  5IMC A;  3RHB A;  2XPD A;  4USS A;  5IMA A;  4KSO A;  1FB0 A;  3GX8 A;  2VL3 A;  5C04 A;  5IO2 A;  2IIY A;  2K18 A;  1JZD A;  2CAI A;  3QAV A;  1K3L A;  2VUP A;  3ZVJ D;  2VM2 A;  2DMM A;  3DVW A;  2HFD A;  3TKS C;  2VCZ A;  3KH7 A;  3PGT A;  4EDZ A;  3PH9 A;  1QGV A;  2GT5 A;  3U5R E;  2CAQ A;  2CVK A;  1ERV A;  1EGR A;  3CSJ A;  1NHY A;  2O7K A;  2EFD A;  3TJJ A;  4ECJ A;  1CQH A;  1U3A A;  1GP1 A;  5ECS A;  2L5L A;  3W6G A;  2WVX B;  5DAL B;  2VCW A;  5HFG A;  1FHE A;  2WZ9 A;  3NZN A;  4PHZ C;  2G2Q A;  5ECR B;  3FK8 A;  3IAS 2;  4N10 A;  3TU3 B;  1EWX A;  2DJ0 A;  1JFU A;  1BJX A;  2YWO A;  1RW1 A;  4KB3 A;  3DXB A;  5ECH B;  1FB6 A;  1UA5 A;  4POB A;  4AJ7 A;  3F9U A;  6GSV A;  3HXS A;  4TOP A;  2MZC A;  2ES7 A;  4GTU A;  3C8E A;  3U6V A;  1PN9 A;  2B7J A;  2M80 A;  1K3Y A;  3IR4 A;  4FH8 A;  3H1N A;  3RFR C;  2YPM A;  2HSM B;  1KNG A;  2MMZ A;  3KP9 A;  3L4N A;  1OC3 A;  1A8L A;  4TR1 B;  4BL7 B;  4ZL9 A;  5ELA A;  4EXJ A;  4HDE A;  1PGT A;  2L5O A;  4ZB9 A;  2JSY A;  3CRU A;  1PX7 A;  4XS4 A;  4MDC A;  5GST A;  1PKZ A;  3HVV A;  4HZ4 A;  2YAN A;  4K9Z A;  3US3 A;  3IE3 A;  3OR5 A;  3KMN A;  3F6D A;  4F9Z A;  2KHP A;  3FR9 A;  1SEN A;  1SK0 A;  1TU7 A;  1SKS B;  2HSN A;  4G2E A;  4K6X A;  3BBY A;  2X4A A;  2I4A A;  1GSE A;  4KGI A;  1A0F A;  3ED3 A;  3LYK A;  2CZ3 A;  4PQ1 A;  4Q5R A;  2QA2 A;  1FO5 A;  3PIN A;  5IMF A;  3TUE A;  3D6I A;  4JRR A;  2C0F A;  5LCZ A;  2PER A;  4YH2 A;  4E8H A;  5ID2 B;  1XWK A;  2DLX A;  3RPN A;  4KE3 A;  1E6B A;  2L59 A;  3A2W A;  1HYU A;  1BX9 A;  5J40 A;  3DKS A;  20GS A;  5D93 A;  4FYC A;  2C4J A;  2GT6 A;  4I6X A;  1YKA A;  3KCM A;  3F4T A;  3KP8 A;  3QMX A;  2X8G A;  1AC1 A;  2YWN A;  3GKX A;  3HVX A;  2WCI A;  3HY2 A;  4L8E A;  2VAF A;  4K0N A;  1TTZ A;  3KJY A;  3UOM A;  1N8J A;  1F3B A;  4GQC A;  4NHZ A;  4MH3 A;  5DJM A;  4YQV A;  1MDJ A;  5D73 A;  2IFQ A;  4KAE A;  1GH2 A;  4WKW A;  5GZZ B;  2E2M A;  2WS2 A;  3GMF A;  2KP2 A;  1TKD B;  4QMK A;  1PKW A;  3D4M A;  2G0F A;  3MDK A;  2ON7 A;  3GTU A;  1A2M A;  1QMV A;  4ZIJ A;  2NDO A;  2DSA A;  4MJC A;  1GTA A;  2PMT A;  2IME A;  1U3I A;  2YCD A;  4PUA A;  4KCE A;  3G9B A;  2HRK B;  3GNJ A;  5J4V A;  4WEY A;  5CRH A;  5HFI A;  4WF5 A;  3L78 A;  4ZBB A;  2WUL A;  3ERW A;  4PQH A;  5DQY A;  4MCU A;  4TR4 A;  3C71 A;  5A5H B;  3L9U A;  3HYP A;  4EL1 A;  4CY8 A;  2HT9 A;  4TXV A;  3UAP A;  6GST A;  1LU4 A;  4IQA A;  4FO5 A;  4WF4 A;  5ECI B;  2DJ1 A;  2R3X A;  2HRA A;  5DDL A;  1JLW A;  4IS0 A;  1AQW A;  3JCM L;  5KN2 A;  1GLQ A;  3A5I A;  4BPY A;  3M3M A;  2JAD A;  2EIQ A;  2PN8 A;  1V40 A;  3VI7 A;  4MP4 A;  4V1A g;  4NWY A;  4WXT A;  2H6Z A;  1M0U A;  4HUA A;  3HVN A;  5CRW A;  3V1W A;  3ME7 A;  3H79 A;  4YQU A;  1R4W A;  1TK0 B;  5BMU B;  4IGJ A;  1KEB A;  3EWL A;  1B8X A;  1KBN A;  4JBB A;  3FRC A;  3I9V 2;  2FWH A;  5CNW A;  1Z6M A;  4GQF A;  3GSS A;  2WW1 A;  4GDF A;  2F9S A;  1FOV A;  1ZYN A;  1EOG A;  3GST A;  2REM A;  1XXU A;  1TXX A;  5IIZ A;  5J9C A;  2HLS A;  5G1L A;  4I8B A;  3VLN A;  5KOX A;  5A5K A;  4HJ2 A;  1OYJ A;  1W89 A;  6GSX A;  3ME8 A;  1M7T A;  2VL9 A;  5DAK B;  1JLV A;  1PL2 A;  2E2G A;  2L57 A;  4GF0 A;  4G0K A;  2H0I A;  4HS1 A;  1I1I P;  5AIV A;  1A24 A;  1YY7 A;  1O8W A;  1GSY A;  2C3Q A;  2NTO A;  3ZMK A;  3UIW A;  4ZIL A;  4F2I A;  1TRV A;  4MPG A;  3UAR A;  4XRD A;  1G6W A;  4O7H A;  1SD8 A;  5IMZ A;  2F3M A;  3G7J A;  4ZBA A;  4RQR A;  2LNT A;  3N9J A;  2A2P A;  2B5Y A;  3HA9 A;  1OC9 B;  13GS A;  3D5J A;  2L6D A;  2GSR A;  4ECI A;  3HJP A;  1XWC A;  5HR2 A;  2E7P A;  5DJL A;  3MAK A;  11GS A;  1O6J A;  2DBC A;  2WRT A;  4MH2 A;  3C1S A;  1OVN A;  2V2G A;  2H71 A;  3O6T A;  5A4V A;  1O8X A;  3IPZ A;  3WT1 A;  3KMO A;  3F3R A;  1RQM A;  5LD0 A;  1ERT A;  2IMF A;  3L9V A;  4FYU A;  2HSH A;  4OFT A;  4QL7 A;  4ZXG A;  1V57 A;  1T8E B;  3HMJ G;  2XC2 A;  3VWW A;  3H8Q A;  4QQ7 A;  4Z2R A;  1TW9 A;  4MZC A;  1SJ6 A;  5IPG A;  1HNA A;  4G0L A;  3TDG A;  2WVX A;  5DAL A;  3IHG A;  3TOT A;  4WR4 A;  1GUH A;  4ML1 A;  3LSZ A;  1PSQ A;  4NPB A;  3W8S A;  1EOH A;  2R6K A;  1YF1 A;  4K7N A;  1Z6N A;  2DJ3 A;  1I5G A;  4ECB A;  2H19 A;  3GN3 A;  3HZ4 A;  2FHE A;  5BRT A;  1GSQ A;  1ERU A;  4IP6 A;  3CWG A;  3HJO A;  4IJI A;  4EE0 A;  1WP0 A;  3ZYW A;  1WRY A;  2H75 A;  4O5R A;  2R0G A;  4Z7X A;  2XPE A;  4GRF A;  2I1U A;  4Q5Q A;  4RQX A;  1WOU A;  1THO A;  3R3E A;  2FA4 A;  1JZR A;  4KH7 A;  1RK4 A;  10GS A;  3GKN A;  3TRP A;  1GUM A;  4EIP A;  3FR6 A;  3IA1 A;  1Z5Y E;  3KTB A;  2X49 A;  4BL7 A;  4EF0 A;  2V41 A;  4EUY A;  4HZ2 A;  1ILO A;  2HE3 A;  1MD3 A;  1VF1 A;  3APQ A;  5EVO A;  1JHB A;  5D9W A;  3PR8 A;  4IQ1 A;  3IXR A;  4E8E A;  2VM1 A;  4JR4 A;  3M9K A;  2NVL A;  5J3R A;  2QC7 A;  4PI2 C;  1SYR A;  3HJM A;  2GQK A;  1QFN A;  1YJ6 A;  3ZIV A;  5ECK B;  3EU3 A;  4N0Z A;  2KUC A;  4IN0 A;  2GS3 A;  4PUR A;  4DVC A;  5HR3 A;  3EMX A;  3P90 A;  5HR1 A;  4EO3 A;  8GSS A;  1YEP A;  4NHW A;  3GA4 A;  1N25 A;  1F9M A;  2F8A A;  1S3A A;  3L9S A;  3ZFL A;  2VCQ A;  3TCO A;  5AIX A;  3KZQ A;  3HHV A;  4TKY A;  1Z9H A;  3CMI A;  3E0U A;  1AUC A;  1SL2 B;  4OCF A;  5GAN D;  5L71 A;  3DWV A;  4KF9 A;  2FWF A;  4LA1 A;  4AKG A;  2YP6 A;  3TB2 A;  2OBI A;  1O73 A;  4XS6 A;  3GKM A;  2RII A;  4BWQ A;  3APO A;  2OT3 A;  1LJR A;  2B5X A;  1N2A A;  2FGX A;  2H0G A;  5E4W A;  3ERG A;  1G7O A;  4JE1 A;  3UJ1 A;  2X8C A;  4GLT A;  2MYG A;  3DIE A;  2X64 A;  3LYP A;  2GZY A;  1K3O A;  5EPF A;  3EE2 A;  4N11 A;  1XIY A;  3ZVJ A;  5EL8 A;  2HRN A;  2H8L A;  4OO5 A;  2MMO A;  4DSS B;  4ZB7 A;  4AKX B;  4H86 A;  4A5P A;  1Q4J A;  4RI7 A;  1XWB A;  4FXY P;  1WIK A;  1DBY A;  2YV9 A;  2HRK A;  2HZE B;  2MMA A;  3BD2 A;  5A34 B;  5ECQ B;  1G6Y A;  2H6X A;  1BQ7 A;  5ABR A;  3N5O A;  4LMV A;  5A5H A;  2OE0 A;  3GV1 A;  2BTO T;  1SD9 A;  4MAB A;  3WYW A;  3P2A A;  3FZ9 A;  1MDK A;  2QGV A;  2VD1 A;  1SK1 A;  1U87 A;  2OA7 A;  1ACV A;  3GKK A;  1XCC A;  4V2L A;  3ZTL A;  1A2L A;  4TXO A;  1V9W A;  4MMM A;  3L0H A;  3WGD A;  1YF0 A;  1FW1 A;  2EFE A;  5GSS A;  1QK8 A;  1TOF A;  4KW6 A;  2CT6 A;  3VUR A;  5J4Y A;  2B1K A;  4IVF A;  1YEX A;  2GSS A;  2NBS A;  1LBK A;  4O92 A;  2R0C A;  2F51 A;  4AKI A;  1Y6E A;  4IBP A;  3EYT A;  3R2Q A;  5BMU A;  3IOS A;  3WGE A;  4MZB A;  3LW9 A;  2HYX A;  1TRW A;  1UVZ A;  3GRX A;  1IYH A;  4PUF C;  3VK9 A;  3MNG A;  3M0F A;  2O89 A;  3O3T A;  2V1M A;  4PX1 A;  2R4V A;  4KDU A;  4MF7 A;  1XZO A;  1XFL A;  2JSZ A;  5HQP A;  4RUV A;  2X99 A;  1PX6 A;  2CVB A;  1X9W B;  2PU9 C;  4N30 A;  1ZYQ B;  1GRX A;  4ZL8 A;  5ECN B;  2VIM A;  3KIJ A;  1O85 A;  5DAK A;  2LTK A;  1QUW A;  2JU5 A;  3DRN A;  1T4Y A;  4PI0 C;  2FWG A;  1V98 A;  5KOW A;  1T7P B;  2IPA A;  1FOH A;  1VF3 A;  1XBS A;  3VPQ A;  1DE1 A;  3EIN A;  1ZYP A;  3SBC A;  1OKT A;  4WBJ A;  5CP1 A;  5A1N B;  4FIW A;  3TOU A;  3S9F A;  2NPB A;  4FQU A;  5CRE A;  3W8J A;  3IV4 A;  1SKR B;  3TKP A;  2GGT A;  2VL2 A;  4HOJ A;  1GTB A;  4BVX B;  2VLV A;  2RUF A;  3J7Y k;  1PL1 A;  2C80 A;  1OC9 A;  2A2R A;  4TVE A;  4OFN A;  5J41 A;  5CAX A;  5IPH A;  4ISD A;  2JL4 A;  3ZZX A;  1THX A;  4X4J A;  4OO4 A;  1F2E A;  1SK2 A;  4K2D A;  3EMP A;  2PVO C;  4ML6 A;  1AIU A;  3CSI A;  1HD2 A;  2YWI A;  3A3T A;  4HI7 A;  1TJD A;  1BF5 A;  4N3Z A;  2CX3 A;  1FG4 A;  3KXO A;  3BCK A;  1HQO A;  5D8I A;  1S3D A;  2LRN A;  4YQM A;  4XIH A;  3FR3 A;  4WET A;  1PD2 1;  1C72 A;  2GZZ A;  1TK8 B;  2LRC A;  2H01 A;  4I2U A;  5D9T A;  2MBS A;  3AY8 A;  5IQY A;  1S3R A;  4L5L A;  2VL2 C;  4GXZ A;  2EIR A;  4Q5N A;  2K8V A;  3PPU A;  4KCA A;  5JWR B;  1Z7P A;  1OC8 A;  1M3I A;  4ULX A;  2WFC A;  3LXT A;  3K8N A;  3HD5 A;  4NMU A;  4MJE A;  6GSW A;  2CV4 A;  2A4H A;  1MD4 A;  1TDI A;  3D0Z A;  3F8U A;  1O81 A;  4X0X A;  3ZRD A;  5ECM B;  2H1D A;  1I9D A;  1J9B A;  3M9J A;  3Q6O A;  3CQF A;  4K1F A;  2H66 A;  4TR3 A;  2IL3 A;  1O7U A;  1NM3 A;  2O8V B;  2LST A;  1PQN A;  2H1G A;  3ZML A;  1ZZY A;  4BIK A;  5C00 A;  4D73 B;  3M8N A;  5IM9 A;  1M99 A;  2YOI A;  3F4S A;  1AQX A;  4ILF A;  6GSU A;  5ECL B;  1GNW A;  3FEU A;  4AKH A;  5CRD A;  3LQ7 A;  4MF6 A;  1XVW A;  2FD3 A;  1XWG A;  1B9X C;  1GWC A;  4PXO A;  3MYD A;  3RHC A;  5H5S A;  2GQM A;  1B4P A;  5DQS A;  1SJZ A;  3C7M A;  1WE0 A;  3HDC A;  1XW5 A;  3ZRE A;  2PGT A;  5A4W A;  4X1U A;  2JZT A;  4HU7 A;  2VCV A;  1WJK A;  3FHK A;  3IC4 A;  4AJ8 A;  2WB9 A;  1SJI A;  3GL3 A;  2WJU A;  2DJ2 A;  2AV4 A;  2P31 A;  3IC8 A;  2ZUP A;  2IMK A;  2N5B A;  2CA8 A;  3GIX A;  4K5R A;  1XOA A;  1YDK A;  5HFK A;  14GS A;  1TXU A;  3I6A A;  2HNL A;  4NV5 A;  1SL1 B;  3F63 A;  2YWM A;  3QCP A;  2UZ8 A;  2IFQ B;  2WW2 A;  4O5U A;  1XG8 A;  2AB6 A;  1VGL A;  2I9H A;  2L4Q A;  2UV8 G;  2HSY A;  4ICY A;  3UEM A;  4K2X A;  2DC5 A;  3GTU B;  3TKR A;  2AAW A;  3UVT A;  1BG5 A;  4GWR A;  5EY6 A;  3LOR A;  2DIY A;  3BJ5 A;  4KUN A;  1XW6 A;  1BG1 A;  5D9X A;  2LJR A;  2VCX A;  2H30 A;  1OKD A;  1CQG A;  2HZF A;  1PFO A;  1GUL A;  4PGT A;  3WD6 A;  1ZGN A;  3O76 A;  4DSS A;  3QDN A;  2ALB A;  4L5O A;  4IW9 A;  4O5Q A;  1GSF A;  2DIZ A;  3DEX A;  4OCE A;  4DSQ A;  1AAZ A;  2RLI A;  2FY6 A;  2HZE A;  16GS A;  5A34 A;  5KN1 A;  2GDR A;  3GHA A;  2LJK A;  4BVY B;  3F0I A;  2ON5 A;  3IBH A;  4TR0 A;  1V58 A;  4YKF A;  4YKG A;  1HNB A;  2TIR A;  1M2D A;  1K0B A;  1YQ1 A;  5ENU A;  2YZH A;  4GSS A;  5JWQ B;  1PA3 A;  1SYX A;  5AGY A;  1MEK A;  2HSM A;  1Q98 A;  1SU9 A;  2C1Y A;  1K0A A;  4Z2U A;  4OFM A;  2WDU A;  4TR1 A;  5FHI A;  1WWJ A;  4HQZ A;  3LWA A;  1PN0 A;  1T00 A;  1DSB A;  2H76 A;  2VO4 A;  1QXH A;  2PWJ A;  4CDO A;  3KD0 A;  1EV9 A;  1MTC A;  4TRX A;  4AGS A;  2LUS A;  1URM A;  3DYR A;  3IHQ A;  2PVQ A;  3QD9 A;  4GSN A;  3HVS A;  2QKE A;  3ZLP A;  1EGO A;  3F6F A;  4PTS A;  1JZW A;  2FA8 A;  2EC4 A;  3DVX A;  2KLX A;  2LKU A;  5F0G A;  2M72 A;  1UN2 A;  3F3Q A;  1K0O A;  2EFH A;  5F07 A;  4L0U A;  3DML A;  1B48 A;  1XOB A;  4KA0 A;  3UL3 A;  4F03 A;  3DGQ A;  3RPP A;  1S3C A;  2I3Y A;  4XS1 A;  3FZA A;  3CRT A;  2J23 A;  22GS A;  4CHS A;  3GUR A;  4ZB8 A;  3FW2 A;  5ID2 A;  3WT2 A;  3VI5 A;  2CX4 A;  1M2A A;  2RM6 A;  4K5S A;  1TRS A;  5G5E A;  2A2S A;  2EIO A;  1FAA A;  1S4B P;  4G9H A;  4X43 A;  1TK5 B;  3H4K A;  3RDW A;  1AQV A;  3P8W A;  1VRS D;  3BCI A;  4LLR A;  1K0C A;  2GLR A;  5E59 A;  2YV7 A;  4N0V A;  3DD3 A;  4KDY A;  1YKC A;  1DUG A;  3F4R A;  3BOA A;  2C3N A;  5A1N A;  4I5Q A;  3LJR A;  1USB A;  3KM6 A;  1MDI A;  1TU8 A;  1EEJ A;  1Y1U A;  1VF4 A;  5A4U A;  1XWA A;  1QQ2 A;  4BA7 A;  4BVX A;  1GLP A;  3HZ8 A;  4F0B A;  2AYT A;  3IRA A;  4MF5 A;  2VOC A;  2KP1 A;  2VLT A;  3CBU A;  4G19 A;  3IK7 A;  3FZ5 A;  5CYY A;  5JCG A;  4MLY A;  4G0I A;  4AJ6 A;  4HQS A;  5B8A A;  2H72 A;  5KN0 A;  3UMA A;  2ZNM A;  2OBK A;  3TJG A;  4IP1 A;  3CYN A;  3G7I A;  2YN1 A;  5J9B A;  4EIQ A;  2WVZ A;  5G31 A;  2FUG 2;  3C73 A;  5H5Q A;  4OMV A;  2OJL A;  1T3B A;  5B7C A;  4KND A;  1YVL A;  4YAP A;  2I81 A;  5COH A;  3EPT A;  2K9F A;  3Q18 A;  2PPT A;  4ID0 A;  1EEM A;  4V1A p;  2LRT A;  4NAX A;  2O5V A;  1X5D A;  3QPM A;  5IOX A;  9GSS A;  4XRA A;  3QAG A;  2OE1 A;  4G10 A;  4TW5 A;  2AHE A;  1M9B A;  2DJK A;  2LQQ A;  3M1G A;  1OE7 A;  2C0D A;  2XHF A;  1PRX A;  1A0R P;  1OAZ A;  4ZB6 A;  3I69 A;  4KDX A;  5H5R A;  1A2J A;  2V6K A;  2FLS A;  4FYB A;  3J7Y b;  2L6C A;  1A23 A;  2XBI A;  2H0H A;  2J9H A;  1X5C A;  1SVM A;  4LL4 B;  2YZU A;  2GQL A;  4MJB A;  1ZOF A;  5IMD A;  3MSZ A;  4MK3 A;  3IDV A;  1DE2 A;  3QFA C;  2DKI A;  4MZW A;  3NOF A;  4P3Y B;  3TRX A;  1ABA A;  1GL8 A;  2O85 A;  2GZP A;  2LV3 A;  5JWO B;  1F3A A;  3QAW A;  4J2F A;  4CW9 A;  3TJF A;  5LNK e;  1TP9 A;  3Q74 A;  4XHM A;  4GST A;  4D73 A;  4LMW A;  3TRQ A;  2QSI A;  5CRG A;  4Q5F A;  3QFB C;  3WGX A;  2LEG A;  4JED A;  5B8B A;  2XBQ A;  3GUS A;  4QL9 A;  1A8Y A;  2HRF A;  1G0T A;  3APS A;  1X9S B;  4JZQ A;  1YZX A;  3EU4 A;  5AIS A;  2H74 A;  2H6Y A;  5G5F A;  4POM A;  1WPI A;  1GSD A;  1ST9 A;  4HEA 2;  5INY A;  3KH9 A;  2AJQ B;  4DEJ A;  3UVH A;  3UBL A;  2TRC P;  2LNS A;  4ZBD A;  1BAY A;  1J0F A;  1NSW A;  1G7E A;  3E9J B;  2P5R A;  4I2T A;  2WW3 A;  2OAD A;  3ZFB A;  3CXG A;  1PMT A;  2JAC A;  3TJB A;  3HCZ A;  2GSQ A;  1AXD A;  3LG6 A;  5ELG A;  1R26 A;  3CTG A;  4V2M A;  1IYI A;  1F37 A;  2OKA A;  3GX0 A;  5ECO B;  1F6M C;  5IO0 A;  1GUK A;  4OWY A;  4IKH A;  1M2B A;  3RAZ A;  4WBR D;  4Z2T A;  2B5E A;  2YNX A;  7GSS A;  3LGC A;  3TGZ A;  5IOW A;  2V32 A;  3NIV A;  5F06 A;  2B7K A;  5JCU A;  6GSY A;  3I43 A;  4IHU A;  4OD7 A;  3FKF A;  1Y25 A;  3IK9 A;  1K0N A;  2DKH A;  5G2Z A;  3GFK A;  4HU9 A;  1EP8 A;  2GVP A;  5FT3 A;  4JR6 A;  4BWS A;  2YJH A;  4BVY A;  1JZO A;  5CO3 A;  3KTL A;  2GST A;  4TXO B;  1HNC A;  2WVY A;  1SVO A;  1H75 A;  1U88 A;  2A4V A;  3H93 A;  1NW2 A;  2BMX A;  4W66 A;  2IMI A;  5KN3 A;  1KTE A;  2JZS A;  1Z3E A;  1TI1 A;  2C0G A;  4J57 E;  5B6N A;  2AUV A;  1AW9 A;  4WR5 A;  4XS4 B;  2TRX A;  2R2J A;  1K0M A;  2R5G A;  3EUR A;  1J08 A;  2BJX A;  2X8H A;  2Z9S A;  3MIX A;  2D2Z A;  2H73 A;  3VWX A;  1EZK A;  3GL5 A;  2HSN B;  1TRU A;  1X9M B;  1SL0 B;  1H4O A;  4KX4 A;  3ZIT A;  5AN1 A;  1E2Y A;  3VWU A;  1ML6 A;  4MJA A;  2CVD A;  3FMW A;  4K7O A;  5DCG A;  2OE3 A;  4GCI A;  5F05 A;  4HJM A;  4K7I A;  2ZCT A;  1B4Q A;  2FWE A;  3Q19 A;  3D21 A;  2N5A A;  4PNF A;  4AF2 A;  1M9A A;  3ISO A;  4EC0 A;  4IJ3 A;  2H1B A;  4POL A;  3A5W A;  2HXK A;  3HKR A;  4F0C A;  1TI3 A;  2B1L A;  2V6O A;  2YJ7 A;  1M3J A;  1ERW A;  2H70 A;  1FVK A;  1R5A A;  5D9V A;  5KEJ A;  3FYG A;  3CTF A;  18GS A;  2HQT A;  1FVJ A;  2CZ2 A;  1V2A A;  2LJA A;  2P0G A;  3IAM 2;  3GH9 A;  4E68 A;  1GTU A;  3D22 A;  3QR6 A;  3FY7 A;  1B9Y C;  1XVQ A;  2OAC A;  3EC3 A;  2PBJ A;  5J5N A;  1X0R A;  3CSH A;  2L4C A;  4I97 A;  2RM5 A;  2CQ9 A;  1T4Z A;  3KEB A;  4K8M A;  1SVL A;  1ZCP A;  5F8B A;  5J4U A;  4MNN A;  3G7Y A;  3ZL5 A;  1OE8 A;  4HSC X;  2WW0 A;  4PQI A;  5G1K A;  19GS A;  2R0P A;  1T1V A;  4XCS A;  2O36 A;  6GSS A;  4ZL7 A;  4XTS A;  5B6M A;  3VFI A;  2F8F A;  2IWT A;  5FWG A;  3P7X A;  4V2N A;  4PNG A;  1R5P A;  2VKZ G;  1YEW C;  2C8U A;  3TKS E;  3D4T A;  2C3T A;  3CHX C;  17GS A;  3EVI A;  2K6V A;  1VF2 A;  4IEL A;  1ZYE A;  5DBQ A;  1NHO A;  1U6T A;  2R37 A;  3MWH A;  2PUK C;  4G01 A;  3ERF A;  2JZR A;  1EP7 A;  1UC7 A;  1EV4 A;  2H1A A;  2M46 A;  2MBT A;  5JCW A;  3VWV A;  5G30 A;  2DJJ A;  2P5Q A;  3LEF A;  4DSR A;  3KGK A;  4CY6 A;  3A2V A;  3GH6 A;  4LL1 B;  1XW9 A;  4AI6 A;  2DML A;  3ZIJ A;  2LQO A;  4KSM A;  4RI6 A;  4POK A;  2IMD A;  2FCH A;  2E0Q A;  2HI7 A;  3TKQ A;  3LXZ A;  4ACS A;  2WGR A;  5DCH A;  1GTI A;  4K0G A;  5ECP B;  2VD0 A;  1K0D A;  1WMJ A;  12GS A;  5DVB A;  2IN3 A;  5D96 A;  1W4V A;  5GAP D;  2B3S A;  2N5F A;  3GYK A;  4MPF A;  3E3E A;  5J47 A;  4TN8 A;  3C1R A;  4J56 E;  2K8S A;  2B6M A;  2H1L A;  2QA1 A;  5IMV A;  1BYE A;  2FNO A;  1ON4 A; 
#chains in the Genus database with same CATH homology
 4NV2 A;  4NXI A;  1GNE A;  4F82 A;  4EDY A;  2C0E A;  1XPV A;  2EFC A;  3SWL A;  1BED A;  3TKS A;  2LS5 A;  3LFL A;  2VLU A;  1SKW B;  2RUE A;  3RBT A;  3UBK A;  1X5E A;  1R7H A;  4YAV A;  4O32 A;  3QOU A;  4MA9 A;  3VPT A;  3A2X A;  1Z7R A;  4L0W A;  1GSU A;  2GTU A;  1GSS A;  4EKZ A;  2VCT A;  2KOK A;  4EVM A;  1ZL9 A;  3FZ4 A;  4ECC A;  4JU5 A;  3TJK A;  5HR0 A;  2O87 A;  2MMN A;  2IJY A;  1ZMA A;  5IMC A;  3RHB A;  2XPD A;  4USS A;  5IMA A;  4KSO A;  1FB0 A;  3GX8 A;  2VL3 A;  5C04 A;  5IO2 A;  2IIY A;  2K18 A;  1JZD A;  2CAI A;  3QAV A;  1K3L A;  2VUP A;  3ZVJ D;  2VM2 A;  2DMM A;  3DVW A;  2HFD A;  3TKS C;  2VCZ A;  3KH7 A;  3PGT A;  4EDZ A;  3PH9 A;  1QGV A;  2GT5 A;  3U5R E;  2CAQ A;  2CVK A;  1ERV A;  1EGR A;  3CSJ A;  1NHY A;  2O7K A;  2EFD A;  3TJJ A;  4ECJ A;  1CQH A;  1U3A A;  1GP1 A;  5ECS A;  2L5L A;  3W6G A;  5DAL B;  2VCW A;  5HFG A;  1FHE A;  2WZ9 A;  3NZN A;  2G2Q A;  5ECR B;  3FK8 A;  3IAS 2;  4N10 A;  3TU3 B;  1EWX A;  2DJ0 A;  1JFU A;  1BJX A;  2YWO A;  1RW1 A;  4KB3 A;  3DXB A;  5ECH B;  1FB6 A;  1UA5 A;  4POB A;  4AJ7 A;  3F9U A;  6GSV A;  3HXS A;  4TOP A;  2MZC A;  2ES7 A;  4GTU A;  3C8E A;  3U6V A;  1PN9 A;  2B7J A;  2M80 A;  1K3Y A;  3IR4 A;  4FH8 A;  3H1N A;  2YPM A;  2HSM B;  1KNG A;  2MMZ A;  3KP9 A;  3L4N A;  1OC3 A;  1A8L A;  4TR1 B;  4BL7 B;  4ZL9 A;  5ELA A;  4EXJ A;  4HDE A;  1PGT A;  2L5O A;  4ZB9 A;  2JSY A;  3CRU A;  1PX7 A;  4XS4 A;  4MDC A;  5GST A;  1PKZ A;  3HVV A;  4HZ4 A;  2YAN A;  4K9Z A;  3US3 A;  3IE3 A;  3OR5 A;  3KMN A;  3F6D A;  4F9Z A;  2KHP A;  3FR9 A;  1SEN A;  1SK0 A;  1TU7 A;  1SKS B;  2HSN A;  4G2E A;  4K6X A;  3BBY A;  2X4A A;  2I4A A;  1GSE A;  4KGI A;  1A0F A;  3ED3 A;  3LYK A;  2CZ3 A;  4PQ1 A;  4Q5R A;  2QA2 A;  1FO5 A;  3PIN A;  5IMF A;  3TUE A;  3D6I A;  4JRR A;  2C0F A;  5LCZ A;  2PER A;  4YH2 A;  4E8H A;  5ID2 B;  1XWK A;  2DLX A;  3RPN A;  4KE3 A;  1E6B A;  2L59 A;  3A2W A;  1HYU A;  1BX9 A;  5J40 A;  3DKS A;  20GS A;  5D93 A;  4FYC A;  2C4J A;  2GT6 A;  4I6X A;  1YKA A;  3KCM A;  3F4T A;  3KP8 A;  3QMX A;  2X8G A;  1AC1 A;  2YWN A;  3GKX A;  3HVX A;  2WCI A;  3HY2 A;  4L8E A;  2VAF A;  4K0N A;  1TTZ A;  3KJY A;  3UOM A;  1N8J A;  1F3B A;  4GQC A;  4NHZ A;  4MH3 A;  5DJM A;  4YQV A;  1MDJ A;  5D73 A;  2IFQ A;  4KAE A;  1GH2 A;  4WKW A;  5GZZ B;  2E2M A;  2WS2 A;  3GMF A;  2KP2 A;  1TKD B;  4QMK A;  1PKW A;  3D4M A;  2G0F A;  3MDK A;  2ON7 A;  3GTU A;  1A2M A;  1QMV A;  4ZIJ A;  2NDO A;  2DSA A;  4MJC A;  1GTA A;  2PMT A;  2IME A;  1U3I A;  2YCD A;  4PUA A;  4KCE A;  3G9B A;  2HRK B;  3GNJ A;  5J4V A;  4WEY A;  5CRH A;  5HFI A;  4WF5 A;  3L78 A;  4ZBB A;  2WUL A;  3ERW A;  4PQH A;  5DQY A;  4MCU A;  4TR4 A;  3C71 A;  5A5H B;  3L9U A;  3HYP A;  4EL1 A;  4CY8 A;  2HT9 A;  4TXV A;  3UAP A;  6GST A;  1LU4 A;  4IQA A;  4FO5 A;  4WF4 A;  5ECI B;  2DJ1 A;  2R3X A;  2HRA A;  5DDL A;  1JLW A;  4IS0 A;  1AQW A;  3JCM L;  5KN2 A;  1GLQ A;  3A5I A;  4BPY A;  3M3M A;  2JAD A;  2EIQ A;  2PN8 A;  1V40 A;  3VI7 A;  4MP4 A;  4V1A g;  4NWY A;  4WXT A;  2H6Z A;  1M0U A;  4HUA A;  5CRW A;  3V1W A;  3ME7 A;  3H79 A;  4YQU A;  1R4W A;  1TK0 B;  5BMU B;  4IGJ A;  1KEB A;  3EWL A;  1B8X A;  1KBN A;  4JBB A;  3FRC A;  3I9V 2;  2FWH A;  5CNW A;  1Z6M A;  4GQF A;  3GSS A;  4GDF A;  2F9S A;  1FOV A;  1ZYN A;  1EOG A;  3GST A;  2REM A;  1XXU A;  1TXX A;  5IIZ A;  5J9C A;  2HLS A;  5G1L A;  4I8B A;  3VLN A;  5KOX A;  5A5K A;  4HJ2 A;  1OYJ A;  1W89 A;  6GSX A;  3ME8 A;  1M7T A;  2VL9 A;  5DAK B;  1JLV A;  1PL2 A;  2E2G A;  2L57 A;  4GF0 A;  4G0K A;  2H0I A;  4HS1 A;  5AIV A;  1A24 A;  1YY7 A;  1O8W A;  1GSY A;  2C3Q A;  2NTO A;  3ZMK A;  3UIW A;  4ZIL A;  4F2I A;  1TRV A;  4MPG A;  3UAR A;  4XRD A;  1G6W A;  4O7H A;  1SD8 A;  5IMZ A;  2F3M A;  3G7J A;  4ZBA A;  4RQR A;  2LNT A;  3N9J A;  2A2P A;  2B5Y A;  3HA9 A;  1OC9 B;  13GS A;  3D5J A;  2L6D A;  2GSR A;  4ECI A;  3HJP A;  1XWC A;  5HR2 A;  2E7P A;  5DJL A;  3MAK A;  11GS A;  1O6J A;  2DBC A;  2WRT A;  4MH2 A;  3C1S A;  1OVN A;  2V2G A;  2H71 A;  3O6T A;  5A4V A;  1O8X A;  3IPZ A;  3WT1 A;  3KMO A;  3F3R A;  1RQM A;  5LD0 A;  1ERT A;  2IMF A;  3L9V A;  4FYU A;  2HSH A;  4OFT A;  4QL7 A;  4ZXG A;  1V57 A;  1T8E B;  3HMJ G;  2XC2 A;  3VWW A;  3H8Q A;  4QQ7 A;  4Z2R A;  1TW9 A;  4MZC A;  1SJ6 A;  5IPG A;  1HNA A;  4G0L A;  3TDG A;  5DAL A;  3IHG A;  3TOT A;  4WR4 A;  1GUH A;  4ML1 A;  3LSZ A;  1PSQ A;  4NPB A;  3W8S A;  1EOH A;  2R6K A;  1YF1 A;  4K7N A;  1Z6N A;  2DJ3 A;  1I5G A;  4ECB A;  2H19 A;  3GN3 A;  3HZ4 A;  2FHE A;  5BRT A;  1GSQ A;  1ERU A;  4IP6 A;  3CWG A;  3HJO A;  4IJI A;  4EE0 A;  1WP0 A;  3ZYW A;  1WRY A;  2H75 A;  4O5R A;  2R0G A;  4Z7X A;  2XPE A;  4GRF A;  2I1U A;  4Q5Q A;  4RQX A;  1WOU A;  1THO A;  3R3E A;  2FA4 A;  1JZR A;  4KH7 A;  1RK4 A;  10GS A;  3GKN A;  3TRP A;  1GUM A;  4EIP A;  3FR6 A;  3IA1 A;  1Z5Y E;  3KTB A;  2X49 A;  4BL7 A;  4EF0 A;  2V41 A;  4EUY A;  4HZ2 A;  1ILO A;  2HE3 A;  1MD3 A;  1VF1 A;  3APQ A;  5EVO A;  1JHB A;  5D9W A;  3PR8 A;  4IQ1 A;  3IXR A;  4E8E A;  2VM1 A;  4JR4 A;  3M9K A;  2NVL A;  5J3R A;  2QC7 A;  1SYR A;  2GQK A;  3HJM A;  1QFN A;  1YJ6 A;  3ZIV A;  5ECK B;  3EU3 A;  4N0Z A;  2KUC A;  4IN0 A;  2GS3 A;  4PUR A;  4DVC A;  5HR3 A;  3EMX A;  3P90 A;  5HR1 A;  4EO3 A;  8GSS A;  1YEP A;  4NHW A;  3GA4 A;  1N25 A;  1F9M A;  2F8A A;  1S3A A;  3L9S A;  3ZFL A;  2VCQ A;  3TCO A;  5AIX A;  3KZQ A;  3HHV A;  4TKY A;  1Z9H A;  3CMI A;  3E0U A;  1AUC A;  1SL2 B;  4OCF A;  5GAN D;  5L71 A;  3DWV A;  4KF9 A;  2FWF A;  4LA1 A;  4AKG A;  2YP6 A;  3TB2 A;  2OBI A;  1O73 A;  4XS6 A;  3GKM A;  2RII A;  4BWQ A;  3APO A;  2OT3 A;  1LJR A;  2B5X A;  1N2A A;  2FGX A;  2H0G A;  5E4W A;  3ERG A;  1G7O A;  4JE1 A;  3UJ1 A;  2X8C A;  4GLT A;  2MYG A;  3DIE A;  2X64 A;  3LYP A;  2GZY A;  1K3O A;  5EPF A;  3EE2 A;  4N11 A;  1XIY A;  3ZVJ A;  5EL8 A;  2HRN A;  2H8L A;  4OO5 A;  2MMO A;  4DSS B;  4ZB7 A;  4AKX B;  4H86 A;  4A5P A;  1Q4J A;  4RI7 A;  1XWB A;  1WIK A;  1DBY A;  2YV9 A;  2HRK A;  2HZE B;  2MMA A;  3BD2 A;  5A34 B;  5ECQ B;  1G6Y A;  2H6X A;  1BQ7 A;  5ABR A;  3N5O A;  4LMV A;  5A5H A;  2OE0 A;  3GV1 A;  2BTO T;  1SD9 A;  4MAB A;  3WYW A;  3P2A A;  3FZ9 A;  1MDK A;  2QGV A;  2VD1 A;  1SK1 A;  1U87 A;  2OA7 A;  1ACV A;  3GKK A;  1XCC A;  4V2L A;  3ZTL A;  1A2L A;  4TXO A;  1V9W A;  4MMM A;  3L0H A;  3WGD A;  1YF0 A;  1FW1 A;  2EFE A;  5GSS A;  1QK8 A;  1TOF A;  4KW6 A;  2CT6 A;  3VUR A;  5J4Y A;  2B1K A;  4IVF A;  1YEX A;  2GSS A;  2NBS A;  1LBK A;  4O92 A;  2R0C A;  2F51 A;  4AKI A;  1Y6E A;  4IBP A;  3EYT A;  3R2Q A;  5BMU A;  3IOS A;  3WGE A;  4MZB A;  3LW9 A;  2HYX A;  1TRW A;  1UVZ A;  3GRX A;  1IYH A;  4PUF C;  3VK9 A;  3MNG A;  3M0F A;  2O89 A;  3O3T A;  2V1M A;  4PX1 A;  2R4V A;  4KDU A;  4MF7 A;  1XZO A;  1XFL A;  2JSZ A;  5HQP A;  4RUV A;  2X99 A;  1PX6 A;  2CVB A;  1X9W B;  2PU9 C;  4N30 A;  1ZYQ B;  1GRX A;  4ZL8 A;  5ECN B;  2VIM A;  3KIJ A;  1O85 A;  5DAK A;  2LTK A;  1QUW A;  2JU5 A;  3DRN A;  1T4Y A;  2FWG A;  1V98 A;  5KOW A;  1T7P B;  2IPA A;  1FOH A;  1VF3 A;  1XBS A;  3VPQ A;  1DE1 A;  3EIN A;  1ZYP A;  3SBC A;  1OKT A;  4WBJ A;  5CP1 A;  5A1N B;  4FIW A;  3TOU A;  3S9F A;  2NPB A;  4FQU A;  5CRE A;  3W8J A;  3IV4 A;  1SKR B;  3TKP A;  2GGT A;  2VL2 A;  4HOJ A;  1GTB A;  4BVX B;  2VLV A;  2RUF A;  3J7Y k;  1PL1 A;  2C80 A;  1OC9 A;  2A2R A;  4TVE A;  4OFN A;  5J41 A;  5CAX A;  5IPH A;  4ISD A;  2JL4 A;  3ZZX A;  1THX A;  4X4J A;  4OO4 A;  1F2E A;  1SK2 A;  4K2D A;  3EMP A;  2PVO C;  4ML6 A;  1AIU A;  3CSI A;  1HD2 A;  2YWI A;  3A3T A;  4HI7 A;  1TJD A;  1BF5 A;  4N3Z A;  2CX3 A;  1FG4 A;  3KXO A;  3BCK A;  1HQO A;  5D8I A;  1S3D A;  2LRN A;  4YQM A;  4XIH A;  3FR3 A;  4WET A;  1PD2 1;  1C72 A;  2GZZ A;  1TK8 B;  2LRC A;  2H01 A;  4I2U A;  5D9T A;  2MBS A;  3AY8 A;  5IQY A;  4L5L A;  2VL2 C;  4GXZ A;  2EIR A;  4Q5N A;  2K8V A;  3PPU A;  4KCA A;  5JWR B;  1Z7P A;  1OC8 A;  4ULX A;  2WFC A;  3LXT A;  3K8N A;  3HD5 A;  4NMU A;  4MJE A;  6GSW A;  2CV4 A;  2A4H A;  1MD4 A;  1TDI A;  3D0Z A;  3F8U A;  1O81 A;  4X0X A;  3ZRD A;  5ECM B;  2H1D A;  1I9D A;  1J9B A;  3M9J A;  3Q6O A;  4K1F A;  2H66 A;  4TR3 A;  2IL3 A;  1O7U A;  1NM3 A;  2O8V B;  2LST A;  1PQN A;  2H1G A;  3ZML A;  1ZZY A;  5C00 A;  4D73 B;  3M8N A;  5IM9 A;  1M99 A;  2YOI A;  3F4S A;  1AQX A;  4ILF A;  6GSU A;  5ECL B;  1GNW A;  3FEU A;  4AKH A;  5CRD A;  3LQ7 A;  4MF6 A;  1XVW A;  2FD3 A;  1XWG A;  1B9X C;  1GWC A;  4PXO A;  3MYD A;  3RHC A;  5H5S A;  2GQM A;  1B4P A;  5DQS A;  1SJZ A;  3C7M A;  1WE0 A;  3HDC A;  1XW5 A;  3ZRE A;  2PGT A;  5A4W A;  4X1U A;  2JZT A;  4HU7 A;  2VCV A;  1WJK A;  3FHK A;  3IC4 A;  4AJ8 A;  2WB9 A;  1SJI A;  3GL3 A;  2WJU A;  2DJ2 A;  2AV4 A;  2P31 A;  3IC8 A;  2ZUP A;  2IMK A;  2N5B A;  2CA8 A;  3GIX A;  4K5R A;  1XOA A;  1YDK A;  5HFK A;  14GS A;  1TXU A;  3I6A A;  2HNL A;  4NV5 A;  1SL1 B;  3F63 A;  2YWM A;  3QCP A;  2UZ8 A;  2IFQ B;  4O5U A;  2AB6 A;  1VGL A;  2I9H A;  2L4Q A;  2UV8 G;  2HSY A;  4ICY A;  3UEM A;  4K2X A;  2DC5 A;  3GTU B;  3TKR A;  2AAW A;  3UVT A;  1BG5 A;  4GWR A;  5EY6 A;  3LOR A;  2DIY A;  3BJ5 A;  4KUN A;  1XW6 A;  1BG1 A;  5D9X A;  2LJR A;  2VCX A;  2H30 A;  1OKD A;  1CQG A;  2HZF A;  1GUL A;  4PGT A;  3WD6 A;  1ZGN A;  3O76 A;  4DSS A;  3QDN A;  2ALB A;  4L5O A;  4IW9 A;  4O5Q A;  1GSF A;  2DIZ A;  3DEX A;  4OCE A;  4DSQ A;  1AAZ A;  2RLI A;  2FY6 A;  2HZE A;  16GS A;  5A34 A;  5KN1 A;  2GDR A;  3GHA A;  2LJK A;  4BVY B;  3F0I A;  2ON5 A;  3IBH A;  4TR0 A;  1V58 A;  4YKF A;  4YKG A;  1HNB A;  2TIR A;  1M2D A;  1K0B A;  1YQ1 A;  5ENU A;  2YZH A;  4GSS A;  5JWQ B;  1PA3 A;  1SYX A;  5AGY A;  1MEK A;  2HSM A;  1Q98 A;  1SU9 A;  2C1Y A;  1K0A A;  4Z2U A;  4OFM A;  2WDU A;  4TR1 A;  5FHI A;  1WWJ A;  4HQZ A;  3LWA A;  1PN0 A;  1T00 A;  1DSB A;  2H76 A;  2VO4 A;  1QXH A;  2PWJ A;  4CDO A;  3KD0 A;  1EV9 A;  1MTC A;  4TRX A;  4AGS A;  2LUS A;  1URM A;  3DYR A;  3IHQ A;  2PVQ A;  3QD9 A;  4GSN A;  3HVS A;  2QKE A;  3ZLP A;  1EGO A;  3F6F A;  4PTS A;  1JZW A;  2FA8 A;  2EC4 A;  3DVX A;  2KLX A;  2LKU A;  5F0G A;  2M72 A;  1UN2 A;  3F3Q A;  1K0O A;  2EFH A;  5F07 A;  4L0U A;  3DML A;  1B48 A;  1XOB A;  4KA0 A;  3UL3 A;  4F03 A;  3DGQ A;  3RPP A;  1S3C A;  2I3Y A;  4XS1 A;  3FZA A;  3CRT A;  2J23 A;  22GS A;  4CHS A;  3GUR A;  4ZB8 A;  3FW2 A;  5ID2 A;  3WT2 A;  3VI5 A;  2CX4 A;  1M2A A;  2RM6 A;  4K5S A;  1TRS A;  5G5E A;  2A2S A;  2EIO A;  1FAA A;  4G9H A;  4X43 A;  1TK5 B;  3H4K A;  3RDW A;  1AQV A;  3P8W A;  1VRS D;  3BCI A;  4LLR A;  1K0C A;  2GLR A;  5E59 A;  2YV7 A;  4N0V A;  3DD3 A;  4KDY A;  1YKC A;  1DUG A;  3F4R A;  3BOA A;  2C3N A;  5A1N A;  4I5Q A;  3LJR A;  1USB A;  3KM6 A;  1MDI A;  1TU8 A;  1EEJ A;  1Y1U A;  1VF4 A;  5A4U A;  1XWA A;  1QQ2 A;  4BA7 A;  4BVX A;  1GLP A;  3HZ8 A;  4F0B A;  2AYT A;  3IRA A;  4MF5 A;  2VOC A;  2KP1 A;  2VLT A;  3CBU A;  4G19 A;  3IK7 A;  3FZ5 A;  5CYY A;  5JCG A;  4MLY A;  4G0I A;  4AJ6 A;  4HQS A;  5B8A A;  2H72 A;  5KN0 A;  3UMA A;  2ZNM A;  2OBK A;  3TJG A;  4IP1 A;  3CYN A;  3G7I A;  2YN1 A;  5J9B A;  4EIQ A;  5G31 A;  2FUG 2;  3C73 A;  5H5Q A;  4OMV A;  2OJL A;  1T3B A;  5B7C A;  4KND A;  1YVL A;  4YAP A;  2I81 A;  5COH A;  3EPT A;  2K9F A;  3Q18 A;  2PPT A;  4ID0 A;  1EEM A;  4V1A p;  2LRT A;  4NAX A;  2O5V A;  1X5D A;  3QPM A;  5IOX A;  9GSS A;  4XRA A;  3QAG A;  2OE1 A;  4G10 A;  4TW5 A;  2AHE A;  1M9B A;  2DJK A;  2LQQ A;  3M1G A;  1OE7 A;  2C0D A;  2XHF A;  1PRX A;  1A0R P;  1OAZ A;  4ZB6 A;  3I69 A;  4KDX A;  5H5R A;  1A2J A;  2V6K A;  2FLS A;  4FYB A;  3J7Y b;  2L6C A;  1A23 A;  2XBI A;  2H0H A;  2J9H A;  1X5C A;  1SVM A;  4LL4 B;  2YZU A;  2GQL A;  4MJB A;  1ZOF A;  5IMD A;  3MSZ A;  4MK3 A;  3IDV A;  1DE2 A;  3QFA C;  2DKI A;  4MZW A;  3NOF A;  4P3Y B;  3TRX A;  1ABA A;  1GL8 A;  2O85 A;  2GZP A;  2LV3 A;  5JWO B;  1F3A A;  3QAW A;  4J2F A;  4CW9 A;  3TJF A;  5LNK e;  1TP9 A;  3Q74 A;  4XHM A;  4GST A;  4D73 A;  4LMW A;  3TRQ A;  2QSI A;  5CRG A;  4Q5F A;  3QFB C;  3WGX A;  2LEG A;  4JED A;  5B8B A;  2XBQ A;  3GUS A;  4QL9 A;  1A8Y A;  2HRF A;  1G0T A;  3APS A;  1X9S B;  4JZQ A;  1YZX A;  3EU4 A;  5AIS A;  2H74 A;  2H6Y A;  5G5F A;  4POM A;  1WPI A;  1GSD A;  1ST9 A;  4HEA 2;  5INY A;  3KH9 A;  2AJQ B;  4DEJ A;  3UVH A;  3UBL A;  2TRC P;  2LNS A;  4ZBD A;  1BAY A;  1J0F A;  1NSW A;  1G7E A;  3E9J B;  2P5R A;  4I2T A;  2OAD A;  3ZFB A;  3CXG A;  1PMT A;  2JAC A;  3TJB A;  3HCZ A;  2GSQ A;  1AXD A;  3LG6 A;  5ELG A;  1R26 A;  3CTG A;  4V2M A;  1IYI A;  1F37 A;  2OKA A;  3GX0 A;  5ECO B;  1F6M C;  5IO0 A;  1GUK A;  4OWY A;  4IKH A;  1M2B A;  3RAZ A;  4WBR D;  4Z2T A;  2B5E A;  2YNX A;  7GSS A;  3LGC A;  3TGZ A;  5IOW A;  2V32 A;  3NIV A;  5F06 A;  2B7K A;  5JCU A;  6GSY A;  3I43 A;  4IHU A;  4OD7 A;  3FKF A;  1Y25 A;  3IK9 A;  1K0N A;  2DKH A;  5G2Z A;  3GFK A;  4HU9 A;  1EP8 A;  2GVP A;  5FT3 A;  4JR6 A;  4BWS A;  2YJH A;  4BVY A;  1JZO A;  5CO3 A;  3KTL A;  2GST A;  4TXO B;  1HNC A;  1SVO A;  1H75 A;  1U88 A;  2A4V A;  3H93 A;  1NW2 A;  2BMX A;  4W66 A;  2IMI A;  5KN3 A;  1KTE A;  2JZS A;  1Z3E A;  1TI1 A;  2C0G A;  4J57 E;  5B6N A;  2AUV A;  1AW9 A;  4WR5 A;  4XS4 B;  2TRX A;  2R2J A;  1K0M A;  2R5G A;  3EUR A;  1J08 A;  2BJX A;  2X8H A;  2Z9S A;  3MIX A;  2D2Z A;  2H73 A;  3VWX A;  1EZK A;  3GL5 A;  2HSN B;  1TRU A;  1X9M B;  1SL0 B;  1H4O A;  4KX4 A;  3ZIT A;  5AN1 A;  1E2Y A;  3VWU A;  1ML6 A;  4MJA A;  2CVD A;  3FMW A;  4K7O A;  5DCG A;  2OE3 A;  4GCI A;  5F05 A;  4HJM A;  4K7I A;  2ZCT A;  1B4Q A;  2FWE A;  3Q19 A;  3D21 A;  2N5A A;  4PNF A;  4AF2 A;  1M9A A;  3ISO A;  4EC0 A;  4IJ3 A;  2H1B A;  4POL A;  3A5W A;  2HXK A;  3HKR A;  4F0C A;  1TI3 A;  2B1L A;  2V6O A;  2YJ7 A;  1ERW A;  2H70 A;  1FVK A;  1R5A A;  5D9V A;  5KEJ A;  3FYG A;  3CTF A;  18GS A;  2HQT A;  1FVJ A;  2CZ2 A;  1V2A A;  2LJA A;  2P0G A;  3IAM 2;  3GH9 A;  4E68 A;  1GTU A;  3D22 A;  3QR6 A;  3FY7 A;  1B9Y C;  1XVQ A;  2OAC A;  3EC3 A;  2PBJ A;  5J5N A;  1X0R A;  3CSH A;  2L4C A;  4I97 A;  2RM5 A;  2CQ9 A;  1T4Z A;  3KEB A;  4K8M A;  1SVL A;  1ZCP A;  5F8B A;  5J4U A;  4MNN A;  3G7Y A;  3ZL5 A;  1OE8 A;  4PQI A;  5G1K A;  19GS A;  2R0P A;  1T1V A;  4XCS A;  6GSS A;  4ZL7 A;  4XTS A;  5B6M A;  3VFI A;  2F8F A;  2IWT A;  5FWG A;  3P7X A;  4V2N A;  4PNG A;  1R5P A;  2VKZ G;  2C8U A;  3TKS E;  3D4T A;  2C3T A;  17GS A;  3EVI A;  2K6V A;  1VF2 A;  4IEL A;  1ZYE A;  5DBQ A;  1NHO A;  1U6T A;  2R37 A;  3MWH A;  2PUK C;  4G01 A;  3ERF A;  2JZR A;  1EP7 A;  1UC7 A;  1EV4 A;  2H1A A;  2M46 A;  2MBT A;  5JCW A;  3VWV A;  5G30 A;  2DJJ A;  2P5Q A;  3LEF A;  4DSR A;  3KGK A;  4CY6 A;  3A2V A;  3GH6 A;  4LL1 B;  1XW9 A;  4AI6 A;  2DML A;  3ZIJ A;  2LQO A;  4KSM A;  4RI6 A;  4POK A;  2IMD A;  2FCH A;  2E0Q A;  2HI7 A;  3TKQ A;  3LXZ A;  4ACS A;  2WGR A;  5DCH A;  1GTI A;  4K0G A;  5ECP B;  2VD0 A;  1K0D A;  1WMJ A;  12GS A;  5DVB A;  2IN3 A;  5D96 A;  1W4V A;  5GAP D;  2B3S A;  2N5F A;  3GYK A;  4MPF A;  3E3E A;  5J47 A;  4TN8 A;  3C1R A;  4J56 E;  2K8S A;  2B6M A;  2H1L A;  2QA1 A;  5IMV A;  1BYE A;  2FNO A;  1ON4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...