1AQVA

Glutathione s-transferase in complex with p-bromobenzylglutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of class pi glutathione S-transferase from human placenta in complex with substrate, transition-state analogue and inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1aqvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1aqvA01
5ECNB 5E59A 2V41A 2H1BA 4G0KA 5F05A 4Q5RA 3KH7A 5HQPA 2FWEA 2CA8A 1MDJA 1C72A 3GSSA 1EV4A 2VLUA 1PSQA 5DALB 4KA0A 2YOIA 5IMVA 2AYTA 4N30A 4FYUA 1JLWA 1A0FA 2DJJA 1NSWA 2VM1A 2X8CA 2H74A 1MDKA 6GSSA 5D9VA 2GQLA 3VFIA 2H72A 3HZ8A 4KAEA 2PPTA 4X1UA 3J7Yb 1T4YA 5B7CA 4OWYA 1GSDA 2C0EA 1UVZA 2XBIA 4L0WA 1JLVA 4YQVA 4F2IA 1NHYA 2DBCA 4O7HA 1SL0B 4MF7A 2LRNA 3M9JA 1B9XC 2B5YA 1V2AA 1OC9A 3M0FA 2FUG2 2CAQA 3GX8A 2C3NA 5FWGA 2MYGA 1SJIA 2LTKA 1OE8A 4N0VA 4MDCA 2FWGA 4ZIJA 1M9AA 2C3QA 4WEYA 4RI6A 4TW5A 2MBTA 3UVTA 3PH9A 4YQUA 3I43A 3GTUB 3F8UA 3O76A 3VWUA 3TCOA 3D4MA 3IOSA 2H0GA 5HFGA 4TKYA 2LJAA 3L78A 3ME7A 2CZ3A 3ERWA 3FY7A 1BAYA 3HZ4A 2DJ0A 1GTAA 4TXOB 5LCZA 4POMA 2LQOA 1GP1A 4I6XA 4NWYA 2VCXA 3CMIA 1RW1A 3DKSA 3PGTA 3IA1A 2IL3A 3ED3A 2RLIA 4FYBA 3IE3A 5IMZA 2LQQA 2BMXA 1JHBA 2B5XA 4MABA 2L4QA 3CYNA 2EIQA 2C8UA 4BL7A 4TRXA 4F03A 2H1DA 1UA5A 4NHWA 1OC8A 4XHMA 2OADA 2B7KA 2GZZA 3FR6A 2HSHA 3GFKA 5ID2A 1SK1A 1TK5B 1GLQA 4BVXB 1QGVA 5IMDA 3TKQA 5H5SA 5L71A 5CRHA 3HJMA 2AV4A 4NV2A 5HR3A 2H19A 4EKZA 3RHBA 5A5KA 3FW2A 1LBKA 3HDCA 1QK8A 3H1NA 1VF3A 4KCEA 4YQMA 3FZ9A 4PQIA 2C80A 4IGJA 1XWCA 3Q18A 2ALBA 1TW9A 2LEGA 4IQ1A 2F8AA 3F4SA 1PL1A 1A2JA 4PXOA 5ECPB 4CHSA 3HY2A 5GAPD 4O5RA 1O73A 2H76A 4JEDA 3ZVJD 4HQSA 5ECKB 5DAKB 4XCSA 2CX4A 1MEKA 1XOBA 2IJYA 1SU9A 4G2EA 2MMNA 3KP9A 3TRQA 1GUMA 1EEJA 4GQCA 1TU8A 2VCTA 2L6DA 2GTUA 1VF2A 3FYGA 1KNGA 1QUWA 4L8EA 5G2ZA 4AJ6A 3C7MA 3RAZA 2VL2A 2HXKA 5DCGA 1PKZA 3US3A 1B4QA 1ZYQB 3GMFA 4H86A 20GSA 4Q5FA 4TN8A 1PX6A 4HJ2A 3WGXA 4EO3A 3IC8A 5A4VA 4MCUA 10GSA 3FZ5A 1O6JA 2P31A 4TOPA 1PKWA 1VF1A 4EUYA 2IMDA 1Z9HA 2I1UA 2GDRA 4FIWA 2O8VB 4YAVA 3D4TA 1DE1A 1X5EA 1X5DA 2HSMB 1N2AA 3TJGA 2VCZA 4LL4B 5DJLA 4D73B 3RPNA 1WIKA 2GVPA 2D2ZA 3EINA 4KCAA 3DVWA 3NIVA 2REMA 5JCWA 3KZQA 3A5WA 2B1LA 2I9HA 2HZFA 5GZZB 2I3YA 1M0UA 1AQWA 12GSA 3GL5A 3P7XA 3TJFA 2CQ9A 2H70A 4TR3A 1ZGNA 5CRGA 1G6WA 4DSRA 4MMMA 3ZLPA 3EU4A 3TKPA 2OACA 4IQAA 5GSTA 5J41A 3LEFA 4ECCA 5IOWA 2DSAA 1USBA 2DMMA 1SD9A 1Z6NA 1PQNA 3FEUA 1NHOA 1F6MC 2KHPA 2M80A 1EWXA 3L9UA 2YJHA 1TU7A 2HSNB 1MD3A 3H79A 5KN2A 4WF5A 5B8AA 3D21A 3M9KA 1IYHA 1FVJA 2RUFA 1R4WA 4K7NA 1XXUA 2VO4A 3I6AA 4E8EA 1PL2A 1Y25A 5EL8A 4MF5A 2ES7A 1M2BA 1YKAA 4RUVA 6GSVA 4IW9A 2LNSA 5AIXA 3OR5A 2KP2A 1SKWB 1O85A 4DEJA 2WFCA 3IRAA 2L57A 4KW6A 7GSSA 3QMXA 2VCVA 5HR1A 3P2AA 3DYRA 2ON5A 3Q19A 1KBNA 2QGVA 3GIXA 1XW6A 1VGLA 1FVKA 2FGXA 3BCKA 5F07A 1WMJA 1PX7A 1GTBA 3GH9A 3ZITA 4ID0A 2BJXA 1V9WA 1GSFA 5HFKA 4JE1A 2K8VA 4MK3A 5EPFA 2O7KA 2GQMA 5IMAA 1X0RA 2B3SA 1M2DA 1YQ1A 3LWAA 4TR0A 1JZRA 1GNWA 4FQUA 2GZYA 1YEPA 4Q5QA 4GSSA 4POKA 3A2XA 1XW5A 5ECSA 3LQ7A 4HU9A 5KN0A 5CRDA 3P90A 3UJ1A 4KNDA 1GTIA 5C04A 4L5LA 3LSZA 3FKFA 1THXA 2UZ8A 4HQZA 3WT1A 1K0AA 3GL3A 4JR4A 3EU3A 2HE3A 2XBQA 1URMA 2C3TA 3KXOA 3ME8A 3GURA 1TRUA 4WKWA 1R7HA 2MMZA 3TJBA 1R5PA 2LJKA 2YWMA 1O8WA 4LMVA 2H6XA 3KTBA 1GL8A 2FLSA 4K0NA 4PNGA 2KOKA 5D96A 5G1LA 4KDUA 1B48A 1V98A 1XVWA 1KTEA 3TJKA 1ZYEA 4JRRA 3F4RA 1ST9A 3U6VA 3PPUA 5ELAA 1OC9B 2BTOT 2ZNMA 3L0HA 5J9CA 4KF9A 4K2DA 4EC0A 3BBYA 3CXGA 4I5QA 4BA7A 1AIUA 3IK7A 1EP7A 1EP8A 1GSSA 4O32A 4V1Ap 3W8SA 1JZWA 2KP1A 5AN1A 3FK8A 3LG6A 4BWSA 4EDYA 1X9WB 3HD5A 3ZVJA 4HS1A 4P3YB 3F4TA 1E2YA 3W8JA 2B1KA 4DSQA 1EV9A 3KJYA 3APOA 2IWTA 1HD2A 4AJ8A 3UMAA 5JCUA 4OCEA 4MZWA 1AQXA 1U87A 2M46A 3RPPA 1T7PB 5B8BA 5HR0A 3TKRA 2GS3A 1K0MA 2OE3A 3C8EA 3BD2A 5IOXA 3ZMKA 1BYEA 3EYTA 3IPZA 5KN3A 2ZCTA 4DSSA 4XS1A 1HNAA 2CVDA 2VCQA 4BL7B 3KMOA 1AUCA 5JWQB 3KIJA 2K8SA 2GLRA 4GQFA 1ML6A 2YV9A 2H0IA 3QPMA 3GKXA 5ECHB 2MMOA 3TGZA 2VL3A 4HJMA 4K1FA 2PMTA 3TOTA 3NZNA 1GNEA 4RQXA 3J7Yk 1J0FA 1FOVA 4NHZA 3N9JA 3HHVA 1MD4A 2IMFA 5J3RA 3D5JA 2XPDA 3TKSE 1CQHA 1EOGA 2QC7A 1R5AA 4ZL8A 3L9VA 5ABRA 4PQHA 1Z7PA 4POBA 4TVEA 1F2EA 3UBKA 5H5QA 2VLTA 4RI7A 2HQTA 4PURA 4BWQA 3QFBC 2H66A 22GSA 4GCIA 1O8XA 1XWAA 1JZOA 2TRXA 5AISA 3KD0A 1RQMA 2O89A 4X43A 1OE7A 1YY7A 2N5FA 1Z3EA 3H93A 1XBSA 3ZIJA 3PINA 1AQVA 2R37A 2WZ9A 3LXZA 2IIYA 3BOAA 2AUVA 5IO2A 2HFDA 3EVIA 4DVCA 2PN8A 2FA8A 1H75A 2OA7A 3GKKA 2IMIA 4TR4A 3R2QA 1O81A 1HYUA 1SL2B 3Q6OA 3UBLA 2WB9A 4HZ2A 1UC7A 5DQSA 2L5LA 2LRCA 3CTFA 1TJDA 2WRTA 1XCCA 4MLYA 2M72A 3H4KA 1NM3A 1G0TA 1ERTA 2ON7A 3C71A 2HSYA 4ILFA 9GSSA 4IBPA 2E7PA 2X8HA 4ECBA 5G1KA 2DJ1A 4XIHA 1EOHA 1TP9A 13GSA 4LMWA 3QAVA 1J9BA 3VPQA 2HLSA 3GKNA 5ECRB 4ECIA 5GSSA 4MJAA 3LYPA 2B7JA 1VRSD 2F8FA 4KE3A 1A24A 3BCIA 1S3DA 3DRNA 3FZ4A 4V2LA 1U6TA 2EIOA 4ML1A 4PUFC 3M1GA 1V40A 1B4PA 2VAFA 3EWLA 4WR5A 2IMKA 1K3OA 2H73A 5F06A 3DEXA 2H30A 1SYXA 5IMCA 1M99A 2I4AA 1DE2A 3Q74A 3ZFLA 2NPBA 3GV1A 1M2AA 1BJXA 3GTUA 2HZEB 2C0FA 3GNJA 2VIMA 2YN1A 3G7YA 1PGTA 3ZZXA 2WS2A 3UOMA 1PMTA 3CSIA 2FD3A 2P0GA 4N10A 2YJ7A 1XW9A 4TXOA 1FB6A 2GGTA 1AC1A 4WBRD 3TJJA 4JBBA 3KCMA 5COHA 4J56E 2YP6A 5DJMA 2PERA 1Q98A 4MJCA 2PUKC 1EGOA 2P5RA 3ZRDA 3EMPA 2E0QA 3VK9A 2GSRA 2JADA 3IC4A 1FW1A 2HI7A 2VCWA 4WETA 5FHIA 3FR3A 2WGRA 2CV4A 2L5OA 3E0UA 6GSWA 2R5GA 3TDGA 1SJZA 1XVQA 5HFIA 4BVXA 2O85A 3O3TA 4HEA2 2LV3A 3H8QA 2C0GA 4ZBBA 4LL1B 4OFTA 2HRKB 3W6GA 4KX4A 3IK9A 1M9BA 2F51A 2H6ZA 5A4WA 2CAIA 2OBKA 1K0OA 5D9XA 3APQA 1GSEA 4IHUA 1F37A 2E2MA 3C1RA 1B8XA 3I9V2 4ECJA 3O6TA 2PVQA 4MPFA 3F6DA 4I97A 2VD0A 1SD8A 2XHFA 5BMUA 1A8LA 3RBTA 2IFQB 2RM5A 3FHKA 4ML6A 3R3EA 4MJBA 1DUGA 2YPMA 4OCFA 4OD7A 3F63A 1J08A 4XTSA 4I2UA 1YDKA 3TRXA 2DJKA 3LJRA 1ERVA 1Q4JA 1XWBA 1AAZA 1CQGA 2DIYA 1GLPA 1ERUA 1YEXA 3JCML 2FA4A 2GSSA 4ZB8A 3DMLA 2XPEA 4K8MA 2GQKA 5C00A 4IN0A 3ZTLA 2R3XA 4G10A 1SYRA 4HOJA 1K0BA 1Z7RA 4IP6A 3FR9A 3KMNA 4ZL7A 2H0HA 2JZTA 4LA1A 5G5FA 2DLXA 2C4JA 5IO0A 1K0DA 4YAPA 1TK0B 2KUCA 4MH3A 4Z7XA 3LXTA 1TOFA 3E3EA 3GN3A 1W89A 2P5QA 3TKSA 4D73A 3CTGA 2B5EA 1SKRB 4TR1A 5G5EA 2L6CA 14GSA 4BVYA 4GWRA 4X0XA 1OVNA 4EF0A 3L9SA 4HUAA 1R26A 1K3LA 5CO3A 3HVXA 4NMUA 4WF4A 1X9MB 1EEMA 2TIRA 5D93A 2HT9A 4DSSB 4OO4A 2V2GA 1OKTA 2VM2A 3E9JB 2YWIA 2NVLA 2I81A 2JSZA 3EMXA 4MH2A 4QL7A 1XWGA 1OAZA 1H4OA 4EVMA 2LUSA 3IAS2 3DWVA 2FWFA 4KSMA 4E8HA 6GSUA 1S3AA 3EE2A 1A2MA 3MNGA 3QFAC 2GT6A 2K9FA 3EC3A 4MZCA 4XRAA 4K7OA 2MBSA 3UL3A 1Z6MA 1ILOA 3ZFBA 2LNTA 1XWKA 1BQ7A 5A4UA 1A8YA 2F3MA 3L4NA 2VUPA 5JWOB 1K3YA 1A2LA 2YNXA 4IJ3A 4ZBDA 3CBUA 2A4VA 4GRFA 2C0DA 3GKMA 5FT3A 3WGEA 5CYYA 4OFNA 2YCDA 3DD3A 2QKEA 11GSA 1A0RP 2YWNA 3WD6A 5D73A 2L4CA 3GA4A 1WJKA 5DCHA 4FYCA 1TI3A 1PN9A 1V58A 1XZOA 4IELA 5AIVA 1B9YC 2YANA 4KUNA 3F0IA 4XS4A 1GTUA 2DIZA 2YZHA 4WBJA 2JACA 5D8IA 5KEJA 3I69A 1M7TA 4IP1A 2A2RA 2F9SA 3A2VA 1I5GA 5ECQB 5ID2B 4PX1A 2J9HA 5IQYA 2DMLA 2LKUA 3SWLA 4PTSA 4FH8A 2CVKA 2O87A 5B6NA 3WGDA 1ZOFA 5EY6A 3C1SA 3VURA 4HDEA 2ZUPA 3QR6A 4PGTA 4MP4A 3U5RE 2OBIA 5ELGA 4IKHA 4JZQA 3IV4A 3KGKA 2X8GA 3ZMLA 1QFNA 1U3IA 1TRWA 3HXSA 3ZL5A 3HVSA 4N0ZA 4JU5A 1QXHA 3F3RA 3F6FA 4HU7A 2K18A 1FO5A 1SK0A 3QCPA 3F3QA 19GSA 2WCIA 2HNLA 2Z9SA 2KLXA 5CRWA 1GH2A 3KTLA 1BG5A 4FO5A 4EL1A 4ULXA 4GXZA 3N5OA 2FY6A 5LD0A 1F3BA 2GT5A 4G0LA 2MMAA 4ZILA 1E6BA 3UIWA 4ISDA 1T1VA 4IJIA 4V1Ag 3IBHA 1ACVA 1JFUA 5KN1A 5HR2A 4GF0A 2VOCA 1U88A 1G7OA 4EE0A 2DJ3A 1ERWA 2H8LA 1G6YA 3CRTA 4LLRA 3VI7A 2R2JA 1WWJA 3HKRA 1XOAA 1WPIA 1WRYA 4K0GA 2V32A 3QAGA 2JL4A 1THOA 5F8BA 3FRCA 2JZRA 5EVOA 4V2MA 2FWHA 4NAXA 1HNBA 3RDWA 1ZCPA 3CSJA 1TRSA 5DALA 1BX9A 2CVBA 1SK2A 1SENA 3LYKA 3HJOA 3VLNA 4NV5A 2H75A 1GULA 3HCZA 2PGTA 5J4UA 2N5AA 18GSA 4EDZA 4AGSA 6GSXA 3IHQA 4AJ7A 4MZBA 2HRFA 5LNKe 2X99A 1GRXA 2R4VA 2CX3A 4L0UA 5G30A 5D9TA 5B6MA 1RK4A 4PUAA 2RM6A 2GSTA 1DBYA 2YZUA 4OFMA 1U3AA 1V57A 1F9MA 2EIRA 5H5RA 1WP0A 2IMEA 4EXJA 2HRAA 17GSA 3IR4A 3QOUA 2H6YA 1GSQA 2NDOA 2MZCA 5GAND 4YH2A 3FZAA 3NOFA 1FB0A 1I9DA 2X64A 3D6IA 3AY8A 1OC3A 2C1YA 1HQOA 4XS6A 1YZXA 1FAAA 4PQ1A 2H71A 2N5BA 4ZBAA 2PWJA 4Q5NA 16GSA 2VL9A 4ZL9A 2LSTA 5JCGA 1ZL9A 1XIYA 4I8BA 1X9SB 1GUHA 5JWRB 2RUEA 1T00A 5ENUA 1BEDA 4GSNA 3GHAA 4WR4A 2WULA 3P8WA 2YWOA 2OKAA 3GUSA 2A2SA 1W4VA 4MF6A 4I2TA 1GWCA 3TOUA 4AF2A 1HNCA 2VLVA 3G7JA 2J23A 1X5CA 2LRTA 3M8NA 4MJEA 4ZXGA 4HI7A 2EC4A 2JZSA 2IPAA 4L5OA 1QQ2A 3KH9A 2WDUA 2CT6A 4F9ZA 3HVVA 1DSBA 5CREA 4ACSA 2VL2C 1FG4A 1MDIA 3KM6A 2PU9C 4XRDA 3PR8A 1LU4A 5DQYA 2G2QA 4OO5A 1K0CA 5DBQA 2H01A 1T3BA 4WXTA 3ERFA 4TR1B 3TB2A 4BVYB 4V2NA 1ZZYA 4IS0A 1TTZA 4QL9A 3V1WA 2HRNA 1QMVA 1EGRA 3WT2A 3ISOA 1YJ6A 2OE1A 2HYXA 3GX0A 1MTCA 3HYPA 3KP8A 5DAKA 4NXIA 1AW9A 1YKCA 4OMVA 3LFLA 1TXXA 5IMFA 1NW2A 4K7IA 1PRXA 5D9WA 3IAM2 2HZEA 4GTUA 2GSQA 3S9FA 2GZPA 1OKDA 1VF4A 3VWXA 1PD21 2E2GA 1WE0A 3G7IA 4GLTA 2VD1A 1Z5YE 5E4WA 2RIIA 5F0GA 1SJ6A 5ECOB 2AJQB 2NBSA 1N8JA 4CW9A 3GSTA 1AXDA 3MAKA 1EZKA 1WOUA 4O92A 1KEBA 1TKDB 3IDVA 6GSTA 3DXBA 4J57E 3UVHA 3M3MA 1UN2A 4KDYA 3SBCA 2B6MA 2AAWA 3QDNA 3VPTA 2L59A 2JSYA 4F82A 4KB3A 5ECMB 3A2WA 2AHEA 4KGIA 1TRVA 4J2FA 3K8NA 1Y6EA 2HSMA 1ZMAA 2FHEA 1A23A 1O7UA 4K6XA 4N11A 3UARA 3CRUA 2AB6A 1S3CA 3MWHA 3TRPA 3ERGA 2HRKA 1YF1A 5ECIB 3ZREA 4TXVA 2XC2A 1GSYA 3HJPA 1G7EA 2DJ2A 2WJUA 3G9BA 3CSHA 5IM9A 4CDOA 4ZB9A 1TDIA 2LJRA 4ZB6A 2QSIA 3GYKA 3UEMA 4NPBA 4KDXA 1TK8B 1K0NA 1T4ZA 3TUEA 4MA9A 3VWVA 5G31A 2JU5A 1ON4A 2G0FA 4HZ4A 3A3TA 4XS4B 4MPGA 2FNOA 2FCHA 1LJRA 4GSTA 5DVBA 3VWWA 3EURA 1XPVA 4F0CA 4G9HA 4G0IA 3ZYWA 2NTOA 2IFQA 4JR6A 1OYJA 5DDLA 5CP1A 3VI5A 5J9BA 6GSYA 4KSOA 3KEBA 3TKSC 1GSUA 3WYWA 4RQRA 4K9ZA 4BPYA 3DGQA 3GH6A 3HA9A 3IXRA 2CZ2A 2LS5A 1TI1A 3RHCA 1YF0A 2K6VA 2OE0A 5INYA 3APSA 8GSSA 2YV7A 5ECLB 1PA3A 1SL1B 2TRCP 4G19A 1XFLA 1T8EB 1FHEA 5AGYA 2IN3A 5IIZA 2PVOC 3BJ5A 2H1AA 5J5NA 3LORA 1JZDA 3MDKA 3QAWA 2R6KA 2V1MA 5CAXA 3D0ZA 1ABAA 3DIEA 3DVXA 5CNWA 2V6KA 1GUKA 5IPGA 4QQ7A 3UAPA 3MSZA 4PNFA 4F0BA 1F3AA 2DC5A 2V6OA 3C73A 4KH7A 3LGCA 1IYIA 3GRXA 1SKSB 4POLA 4IVFA 2PBJA 3QD9A 3F9UA 3D22A 2OJLA 3ZIVA 4USSA 5IPHA 2H1GA
chains in the Genus database with same CATH superfamily
5ECNB 5E59A 2V41A 2H1BA 4G0KA 5F05A 4Q5RA 3KH7A 5HQPA 2FWEA 2CA8A 1MDJA 1C72A 3GSSA 1EV4A 2VLUA 1PSQA 5DALB 4KA0A 2YOIA 5IMVA 2AYTA 4N30A 4FYUA 1JLWA 1A0FA 2DJJA 1NSWA 2VM1A 2X8CA 2H74A 1MDKA 6GSSA 5D9VA 2GQLA 2OT3A 3VFIA 2H72A 3HZ8A 4KAEA 2PPTA 4X1UA 3J7Yb 1T4YA 5B7CA 4OWYA 1GSDA 2C0EA 1UVZA 2XBIA 4L0WA 1JLVA 4YQVA 4K5SA 4F2IA 1NHYA 2DBCA 4O7HA 1SL0B 4MF7A 2LRNA 3M9JA 1B9XC 2B5YA 1V2AA 1OC9A 3M0FA 2FUG2 4PI0C 2CAQA 3GX8A 2C3NA 5FWGA 2MYGA 1SJIA 2LTKA 1OE8A 4N0VA 4MDCA 2FWGA 4ZIJA 1M9AA 2C3QA 4WEYA 4RI6A 4TW5A 2MBTA 3UVTA 3PH9A 4YQUA 3I43A 4N3ZA 3GTUB 3F8UA 3O76A 3VWUA 3TCOA 3D4MA 3IOSA 2H0GA 5HFGA 4TKYA 2LJAA 3L78A 3ME7A 2CZ3A 3ERWA 3FY7A 1BAYA 3HZ4A 2DJ0A 1GTAA 4TXOB 5LCZA 4POMA 2LQOA 1GP1A 4I6XA 4NWYA 2VCXA 3CMIA 4CY6A 1RW1A 3DKSA 3PGTA 3IA1A 2IL3A 3ED3A 2RLIA 4FYBA 3IE3A 5IMZA 2LQQA 2BMXA 1JHBA 2B5XA 4MABA 2L4QA 3CYNA 2EIQA 2C8UA 4BL7A 4TRXA 4F03A 2H1DA 1UA5A 4NHWA 1OC8A 4XHMA 2OADA 2B7KA 5A5HB 2GZZA 3FR6A 3GFKA 2HSHA 5ID2A 1SK1A 1TK5B 1GLQA 4BVXB 1QGVA 5IMDA 3TKQA 5H5SA 5L71A 5CRHA 3HJMA 2AV4A 4NV2A 5HR3A 2H19A 4EKZA 3RHBA 3RFRC 5A5KA 3FW2A 1LBKA 3HDCA 1QK8A 3H1NA 1VF3A 4KCEA 4YQMA 3FZ9A 4PQIA 2C80A 4IGJA 1XWCA 3Q18A 2ALBA 1TW9A 2LEGA 3CQFA 4IQ1A 2F8AA 3F4SA 1PL1A 1A2JA 4PXOA 1I1IP 5ECPB 4CHSA 3HY2A 5GAPD 4O5RA 1O73A 2H76A 4JEDA 3ZVJD 4HQSA 5ECKB 5DAKB 4XCSA 2CX4A 1MEKA 1XOBA 2IJYA 1SU9A 4G2EA 2MMNA 3KP9A 3TRQA 1GUMA 1EEJA 4ICYA 4GQCA 1TU8A 2VCTA 2L6DA 2GTUA 1VF2A 3FYGA 1KNGA 1QUWA 4L8EA 5G2ZA 4AJ6A 3C7MA 3RAZA 2VL2A 2HXKA 5DCGA 1PKZA 3US3A 1B4QA 1ZYQB 4AKIA 3CHXC 3GMFA 4H86A 20GSA 4Q5FA 4TN8A 1PX6A 4HJ2A 3WGXA 4EO3A 3IC8A 5A4VA 4MCUA 10GSA 3HMJG 3FZ5A 1O6JA 2P31A 4TOPA 1PKWA 1VF1A 4EUYA 2IMDA 1Z9HA 2I1UA 2GDRA 4FIWA 2O8VB 4YAVA 3D4TA 1DE1A 1X5EA 1X5DA 4EIPA 2HSMB 1N2AA 3TJGA 2VCZA 4LL4B 5DJLA 4D73B 3RPNA 1YEWC 1WIKA 2GVPA 2D2ZA 3EINA 4KCAA 3DVWA 3NIVA 2REMA 5JCWA 3KZQA 3A5WA 2B1LA 2I9HA 2HZFA 5GZZB 2I3YA 1M0UA 1AQWA 12GSA 3GL5A 3P7XA 3TJFA 2CQ9A 2H70A 4TR3A 1ZGNA 5CRGA 1G6WA 3HVNA 4DSRA 4MMMA 3ZLPA 3EU4A 3TKPA 2OACA 4IQAA 5GSTA 5J41A 3LEFA 4ECCA 5IOWA 2DSAA 1USBA 2DMMA 1SD9A 1Z6NA 1PQNA 3FEUA 2WVYA 1NHOA 1F6MC 2KHPA 2M80A 1EWXA 3L9UA 2YJHA 1TU7A 2HSNB 1MD3A 3H79A 4AI6A 5KN2A 4WF5A 5B8AA 3D21A 3M9KA 1IYHA 1FVJA 2RUFA 1R4WA 4K7NA 1XXUA 2VO4A 3I6AA 4E8EA 1PL2A 1Y25A 5EL8A 4MF5A 2ES7A 1M2BA 1YKAA 4RUVA 6GSVA 4IW9A 2LNSA 5AIXA 3OR5A 2KP2A 1SKWB 1O85A 4DEJA 2WFCA 3IRAA 2L57A 4KW6A 7GSSA 3QMXA 2VCVA 5HR1A 3P2AA 3DYRA 2ON5A 3Q19A 1KBNA 2QGVA 3GIXA 1XW6A 1VGLA 1FVKA 2FGXA 3BCKA 5F07A 1WMJA 1PX7A 1GTBA 3GH9A 3ZITA 4ID0A 2BJXA 1V9WA 1GSFA 5HFKA 4JE1A 2K8VA 2EFEA 4MK3A 5EPFA 2O7KA 2GQMA 5IMAA 1X0RA 2B3SA 1M2DA 1YQ1A 3LWAA 4TR0A 1JZRA 1GNWA 5J40A 4FQUA 2GZYA 1YEPA 4Q5QA 4GSSA 4POKA 3A2XA 1XW5A 2O36A 5ECSA 3LQ7A 4HU9A 5KN0A 5CRDA 3P90A 3UJ1A 4KNDA 1GTIA 2A4HA 5C04A 4L5LA 4O5UA 3LSZA 3FKFA 1THXA 2UZ8A 4HQZA 3WT1A 1K0AA 3GL3A 4JR4A 3EU3A 2HE3A 2XBQA 1URMA 2C3TA 3KXOA 3ME8A 3GURA 2WW1A 1TRUA 4WKWA 1R7HA 2MMZA 3TJBA 1R5PA 2LJKA 2YWMA 1O8WA 4LMVA 2H6XA 3KTBA 1GL8A 2FLSA 4K0NA 4PNGA 2KOKA 5D96A 5G1LA 4KDUA 1B48A 1V98A 1XVWA 1KTEA 3TJKA 1ZYEA 4JRRA 3F4RA 2WZSA 1ST9A 3U6VA 1YVLA 3PPUA 5ELAA 1OC9B 2BTOT 2ZNMA 3L0HA 5J9CA 4KF9A 4K2DA 4EC0A 3BBYA 3CXGA 4I5QA 4BA7A 1AIUA 3IK7A 1EP7A 1EP8A 1GSSA 4O32A 4V1Ap 3W8SA 1JZWA 2KP1A 5AN1A 3FK8A 3LG6A 4BWSA 4EDYA 1X9WB 3HD5A 3ZVJA 4HS1A 4P3YB 3F4TA 1E2YA 3W8JA 2B1KA 4DSQA 1EV9A 3KJYA 3APOA 4K5RA 2IWTA 1HD2A 4AJ8A 3UMAA 5JCUA 4OCEA 4MZWA 1AQXA 1U87A 2M46A 3RPPA 1T7PB 5B8BA 5HR0A 3TKRA 2GS3A 1K0MA 2OE3A 3C8EA 3BD2A 5IOXA 3ZMKA 1BYEA 3EYTA 3IPZA 2R0PA 5KN3A 2ZCTA 4DSSA 4XS1A 1HNAA 2CVDA 2VCQA 4BL7B 3KMOA 1AUCA 5JWQB 5KOWA 3KIJA 2K8SA 2GLRA 4GQFA 1ML6A 2YV9A 2H0IA 3QPMA 3GKXA 2WVXB 5ECHB 1Y1UA 3TGZA 2MMOA 2VL3A 4HJMA 4K1FA 2PMTA 3TOTA 3NZNA 1GNEA 4RQXA 3J7Yk 1J0FA 1FOVA 4NHZA 3N9JA 3HHVA 1MD4A 2IMFA 4Z2RA 5J3RA 3D5JA 2XPDA 2R0GA 3TKSE 1CQHA 1EOGA 2QC7A 1R5AA 4ZL8A 3L9VA 5ABRA 4PQHA 1Z7PA 4POBA 4TVEA 1F2EA 3UBKA 5H5QA 2VLTA 4RI7A 2HQTA 4PURA 4BWQA 3QFBC 2H66A 22GSA 4GCIA 1O8XA 1XWAA 1JZOA 2TRXA 3EPTA 5AISA 3KD0A 1RQMA 2O89A 4X43A 1SVLA 1OE7A 1YY7A 2N5FA 1Z3EA 3H93A 1XBSA 3ZIJA 3PINA 1AQVA 2R37A 2WZ9A 1N25A 3LXZA 2IIYA 3BOAA 2AUVA 5IO2A 2HFDA 3EVIA 4DVCA 2PN8A 2FA8A 2O5VA 1H75A 5A34A 2OA7A 3GKKA 2IMIA 4TR4A 3R2QA 1O81A 1HYUA 1SL2B 3Q6OA 3UBLA 5J4VA 4AKGA 2WB9A 4HZ2A 1UC7A 5DQSA 2L5LA 2LRCA 3CTFA 1TJDA 2WRTA 1XCCA 4MLYA 2M72A 3H4KA 1NM3A 1G0TA 1ERTA 2ON7A 3C71A 2HSYA 4ILFA 9GSSA 4IBPA 2E7PA 2X8HA 4ECBA 5G1KA 1SVOA 2DJ1A 4XIHA 1EOHA 1TP9A 13GSA 4LMWA 3QAVA 1J9BA 3VPQA 2HLSA 3GKNA 5ECRB 4ECIA 5GSSA 4MJAA 3LYPA 2B7JA 1VRSD 2F8FA 4KE3A 1A24A 3BCIA 1S3DA 3DRNA 3FZ4A 4V2LA 1U6TA 2EIOA 4ZB7A 4ML1A 4PUFC 3M1GA 1V40A 1B4PA 2VAFA 3EWLA 4WR5A 2IMKA 1K3OA 2H73A 5F06A 3DEXA 2H30A 1SYXA 5IMCA 1M99A 2I4AA 1DE2A 3Q74A 3ZFLA 2NPBA 3GV1A 2WW2A 1M2AA 1BJXA 3GTUA 2HZEB 2C0FA 3GNJA 2VIMA 5J4YA 2YN1A 3G7YA 1PGTA 3ZZXA 2WS2A 3UOMA 1PMTA 3CSIA 2FD3A 2P0GA 4N10A 2YJ7A 1XW9A 4TXOA 1FB6A 2GGTA 1AC1A 4WBRD 3TJJA 4JBBA 3KCMA 5COHA 4J56E 2YP6A 5DJMA 2PERA 1Q98A 4MJCA 2PUKC 1EGOA 2P5RA 3ZRDA 3EMPA 2E0QA 3VK9A 2GSRA 2JADA 3IC4A 1FW1A 2HI7A 2VCWA 4WETA 5FHIA 3FR3A 2WGRA 2CV4A 2L5OA 3E0UA 6GSWA 2R5GA 3TDGA 1SJZA 1XVQA 5HFIA 4BVXA 2O85A 3O3TA 1M3IA 4HEA2 2LV3A 3H8QA 2C0GA 4ZBBA 4LL1B 4OFTA 2HRKB 5KOXA 4QMKA 3W6GA 4KX4A 3IK9A 1M9BA 2F51A 2H6ZA 4AKHA 5A4WA 2CAIA 2OBKA 4K2XA 1K0OA 5D9XA 4Z2TA 3APQA 1GSEA 4IHUA 1F37A 2E2MA 3C1RA 1B8XA 3I9V2 4ECJA 3O6TA 2PVQA 4MPFA 3F6DA 4I97A 2VD0A 1SD8A 3TU3B 2XHFA 5BMUA 1A8LA 3RBTA 2IFQB 2RM5A 3FHKA 4ML6A 3R3EA 4MJBA 1DUGA 2YPMA 4OCFA 4OD7A 3F63A 1J08A 4XTSA 4I2UA 1YDKA 3TRXA 2DJKA 3LJRA 1ERVA 1Q4JA 1XWBA 1AAZA 1CQGA 2DIYA 1GLPA 1ERUA 1YEXA 3JCML 2FA4A 2GSSA 4ZB8A 3DMLA 2XPEA 4K8MA 2GQKA 5C00A 4IN0A 3ZTLA 2R3XA 4G10A 1SYRA 4HOJA 1K0BA 1Z7RA 4IP6A 3FR9A 3KMNA 4ZL7A 2H0HA 2JZTA 4LA1A 5G5FA 2DLXA 2C4JA 5IO0A 1K0DA 4YAPA 1TK0B 2KUCA 4MH3A 4Z7XA 4AKXB 3LXTA 1TOFA 2DKHA 3E3EA 2QA1A 3GN3A 1W89A 2P5QA 3TKSA 4D73A 3CTGA 2B5EA 1SKRB 4TR1A 5G5EA 2L6CA 14GSA 4BVYA 4GWRA 4X0XA 1OVNA 4EF0A 3L9SA 4HUAA 1R26A 1K3LA 5CO3A 3MIXA 3HVXA 4NMUA 4WF4A 1X9MB 1EEMA 3LW9A 2TIRA 5D93A 4O5QA 2HT9A 4DSSB 4OO4A 2V2GA 1OKTA 2VM2A 3E9JB 4GDFA 2YWIA 2NVLA 1TXUA 2I81A 2JSZA 3EMXA 4MH2A 4QL7A 2O3EA 1SVMA 1XWGA 1OAZA 1H4OA 4EVMA 2HSNA 2LUSA 3IAS2 3DWVA 2FWFA 4KSMA 4E8HA 6GSUA 1S3AA 3EE2A 1A2MA 3MNGA 3QFAC 2GT6A 2K9FA 3EC3A 4MZCA 4XRAA 1ZYPA 4K7OA 2MBSA 3UL3A 1Z6MA 1ILOA 1ZYNA 3ZFBA 2LNTA 1XWKA 1BQ7A 5A4UA 4Z2UA 1A8YA 2F3MA 3L4NA 2VUPA 5JWOB 1PFOA 1K3YA 1A2LA 2YNXA 4IJ3A 4ZBDA 3CBUA 2A4VA 4GRFA 2C0DA 3GKMA 5FT3A 3CWGA 3WGEA 5CYYA 2WW3A 4OFNA 2YCDA 3DD3A 2QKEA 11GSA 1A0RP 2YWNA 4CY8A 3WD6A 5D73A 2L4CA 3GA4A 1WJKA 5DCHA 4FYCA 1TI3A 1PN9A 1V58A 1XZOA 4IELA 5AIVA 1B9YC 2YANA 4KUNA 3F0IA 4XS4A 1GTUA 2DIZA 2UV8G 2YZHA 4WBJA 2JACA 5D8IA 5KEJA 3I69A 1M7TA 4IP1A 2A2RA 2F9SA 3A2VA 1I5GA 5ECQB 5ID2B 4PX1A 2J9HA 5IQYA 2DMLA 2LKUA 3SWLA 4PTSA 4YKFA 4FH8A 4HSCX 2CVKA 2O87A 5B6NA 3WGDA 1ZOFA 5EY6A 3C1SA 3VURA 4HDEA 2ZUPA 3QR6A 4PGTA 4MP4A 3U5RE 1FOHA 2OBIA 5ELGA 4IKHA 4JZQA 3IV4A 3KGKA 2EFDA 1PN0A 2X8GA 3ZMLA 1QFNA 1U3IA 1TRWA 3HXSA 3ZL5A 3HVSA 4N0ZA 4JU5A 1QXHA 3F3RA 3F6FA 4HU7A 2K18A 1FO5A 1SK0A 3QCPA 3F3QA 4X4JA 19GSA 2WCIA 2DKIA 2HNLA 3IHGA 2Z9SA 2KLXA 5CRWA 1GH2A 5A1NA 3KTLA 1BG5A 4FO5A 4EL1A 4ULXA 4GXZA 3N5OA 2FY6A 5LD0A 3A5IA 1F3BA 2GT5A 4G0LA 2MMAA 4ZILA 1E6BA 3UIWA 4ISDA 1T1VA 4IJIA 3MYDA 4V1Ag 3IBHA 1ACVA 1JFUA 5KN1A 5HR2A 4GF0A 2VOCA 1U88A 1G7OA 4EE0A 2DJ3A 1ERWA 2H8LA 1G6YA 3CRTA 4LLRA 3VI7A 2R2JA 1WWJA 3HKRA 1S4BP 1XOAA 1WPIA 1WRYA 4K0GA 2V32A 3QAGA 2JL4A 3FMWA 1THOA 5F8BA 3FRCA 2JZRA 5EVOA 4V2MA 2FWHA 4NAXA 1HNBA 3RDWA 1ZCPA 3CSJA 1TRSA 5DALA 1BX9A 2CVBA 1SK2A 1SENA 3LYKA 3HJOA 3VLNA 4NV5A 2H75A 1GULA 3HCZA 2PGTA 2WVXA 5J4UA 2N5AA 18GSA 4EDZA 4AGSA 6GSXA 3IHQA 2X49A 4AJ7A 1BG1A 4MZBA 2HRFA 5LNKe 2X99A 1GRXA 2R4VA 2CX3A 4L0UA 5G30A 5D9TA 5B6MA 1RK4A 4PUAA 2RM6A 2GSTA 1DBYA 2YZUA 4OFMA 1U3AA 1V57A 1F9MA 2WW0A 2EIRA 5H5RA 1WP0A 2IMEA 4EXJA 2HRAA 17GSA 3IR4A 3QOUA 2H6YA 1GSQA 2NDOA 4FXYP 2MZCA 5GAND 4YH2A 3FZAA 3NOFA 1FB0A 1I9DA 2X64A 3D6IA 3AY8A 1OC3A 2C1YA 1HQOA 4XS6A 1YZXA 1FAAA 4PQ1A 2H71A 2N5BA 5BMUB 4ZBAA 2PWJA 4Q5NA 16GSA 2VL9A 4ZL9A 2LSTA 5JCGA 1ZL9A 1XIYA 4I8BA 1X9SB 1GUHA 5JWRB 2RUEA 1T00A 5ENUA 1BEDA 4GSNA 3GHAA 5BRTA 4WR4A 2WULA 3P8WA 2YWOA 2OKAA 3GUSA 4EIQA 2A2SA 1W4VA 4MF6A 1BF5A 4I2TA 1GWCA 3TOUA 5A5HA 4AF2A 1HNCA 2VLVA 3G7JA 2J23A 1X5CA 2LRTA 3M8NA 4MJEA 4ZXGA 4HI7A 2EC4A 2JZSA 2IPAA 4L5OA 1QQ2A 3KH9A 2WDUA 2CT6A 4F9ZA 2R0CA 3HVVA 1DSBA 5CREA 4ACSA 2VL2C 1FG4A 1MDIA 3KM6A 2PU9C 4XRDA 3PR8A 1LU4A 5DQYA 2G2QA 4OO5A 1K0CA 5DBQA 2H01A 1T3BA 4WXTA 3ERFA 4TR1B 3TB2A 4BVYB 4V2NA 4MNNA 1ZZYA 4IS0A 1TTZA 4QL9A 3V1WA 2HRNA 1QMVA 1EGRA 4A5PA 3WT2A 3ISOA 1YJ6A 2OE1A 2HYXA 3GX0A 1MTCA 3HYPA 3KP8A 5DAKA 4NXIA 1AW9A 1YKCA 4OMVA 3LFLA 1TXXA 5IMFA 1NW2A 4K7IA 1PRXA 5D9WA 3IAM2 2HZEA 4GTUA 2GSQA 3S9FA 2GZPA 4PHZC 1OKDA 2A2PA 1VF4A 3VWXA 1PD21 2E2GA 1WE0A 3G7IA 4GLTA 2VD1A 1Z5YE 5E4WA 2RIIA 5F0GA 1SJ6A 5ECOB 2AJQB 2NBSA 1N8JA 4CW9A 3GSTA 1AXDA 3MAKA 2H1LA 1EZKA 1WOUA 4O92A 1KEBA 1TKDB 3IDVA 6GSTA 3DXBA 4J57E 3UVHA 3M3MA 1UN2A 4YKGA 4KDYA 3SBCA 2B6MA 2AAWA 3QDNA 4G01A 3VPTA 2L59A 2JSYA 4BIKA 4F82A 4KB3A 5ECMB 3A2WA 2AHEA 4KGIA 1TRVA 4J2FA 3K8NA 2WVZA 1Y6EA 2HSMA 1ZMAA 2FHEA 4W66A 1A23A 1O7UA 4K6XA 4N11A 3UARA 3CRUA 2AB6A 1S3CA 3MWHA 3TRPA 3ERGA 2HRKA 1YF1A 5ECIB 3ZREA 4TXVA 2XC2A 1GSYA 3HJPA 1G7EA 2DJ2A 2WJUA 3G9BA 3CSHA 5IM9A 4CDOA 4ZB9A 1TDIA 2LJRA 4ZB6A 2QSIA 3GYKA 4PI2C 3UEMA 4NPBA 4KDXA 1TK8B 1K0NA 1T4ZA 3TUEA 4MA9A 3VWVA 5G31A 2JU5A 1ON4A 2G0FA 4HZ4A 3A3TA 4XS4B 4MPGA 2FNOA 2FCHA 1LJRA 4GSTA 1S3RA 5DVBA 3VWWA 3EURA 1XPVA 4F0CA 4G9HA 4G0IA 3ZYWA 2NTOA 2IFQA 4JR6A 1OYJA 4E68A 5DDLA 5CP1A 3VI5A 2X4AA 1M3JA 5J9BA 6GSYA 4KSOA 3KEBA 3TKSC 1GSUA 5J47A 3WYWA 4RQRA 4K9ZA 4BPYA 3DGQA 3GH6A 3HA9A 3IXRA 2CZ2A 2LS5A 2QA2A 1TI1A 3RHCA 1YF0A 2K6VA 2OE0A 5INYA 3APSA 8GSSA 2YV7A 5ECLB 1PA3A 1SL1B 2TRCP 4G19A 1XFLA 1T8EB 1FHEA 5AGYA 2IN3A 5IIZA 2PVOC 2EFCA 3BJ5A 1XG8A 2H1AA 5J5NA 2VKZG 3LORA 1JZDA 2EFHA 3MDKA 3QAWA 2R6KA 5A1NB 2V1MA 5CAXA 3D0ZA 1ABAA 3DIEA 3DVXA 5CNWA 2V6KA 1GUKA 5IPGA 4QQ7A 3UAPA 3MSZA 4PNFA 4F0BA 3RGBC 1F3AA 2DC5A 2V6OA 3C73A 4KH7A 3LGCA 1IYIA 3GRXA 1SKSB 4POLA 4IVFA 5A34B 2PBJA 3QD9A 3F9UA 3D22A 2OJLA 3ZIVA 4USSA 5IPHA 2H1GA
chains in the Genus database with same CATH topology
5ECNB 5E59A 2V41A 2H1BA 4G0KA 5F05A 4Q5RA 3KH7A 5HQPA 2FWEA 2CA8A 1MDJA 1C72A 3GSSA 1EV4A 2VLUA 1PSQA 5DALB 4KA0A 2YOIA 5IMVA 2AYTA 4N30A 4FYUA 1JLWA 1A0FA 2DJJA 1NSWA 2VM1A 2X8CA 2H74A 1MDKA 6GSSA 5D9VA 2GQLA 2OT3A 3VFIA 2H72A 3HZ8A 4KAEA 2PPTA 4X1UA 3J7Yb 1T4YA 5B7CA 4OWYA 1GSDA 2C0EA 1UVZA 2XBIA 4L0WA 1JLVA 4YQVA 4K5SA 4F2IA 1NHYA 2DBCA 4O7HA 1SL0B 4MF7A 2LRNA 3M9JA 1B9XC 2B5YA 1V2AA 1OC9A 3M0FA 2FUG2 2CAQA 3GX8A 2C3NA 5FWGA 2MYGA 1SJIA 2LTKA 1OE8A 4N0VA 4MDCA 2FWGA 4ZIJA 1M9AA 2C3QA 4WEYA 4RI6A 4TW5A 2MBTA 3UVTA 3PH9A 4YQUA 3I43A 4N3ZA 3GTUB 3F8UA 3O76A 3VWUA 3TCOA 3D4MA 3IOSA 2H0GA 5HFGA 4TKYA 2LJAA 3L78A 3ME7A 2CZ3A 3ERWA 3FY7A 1BAYA 3HZ4A 2DJ0A 1GTAA 4TXOB 5LCZA 4POMA 2LQOA 1GP1A 4I6XA 4NWYA 2VCXA 3CMIA 4CY6A 1RW1A 3DKSA 3PGTA 3IA1A 2IL3A 3ED3A 2RLIA 4FYBA 3IE3A 5IMZA 2LQQA 2BMXA 1JHBA 2B5XA 4MABA 2L4QA 3CYNA 2EIQA 2C8UA 4BL7A 4TRXA 4F03A 2H1DA 1UA5A 4NHWA 1OC8A 4XHMA 2OADA 2B7KA 5A5HB 2GZZA 3FR6A 3GFKA 2HSHA 5ID2A 1SK1A 1TK5B 1GLQA 4BVXB 1QGVA 5IMDA 3TKQA 5H5SA 5L71A 5CRHA 3HJMA 2AV4A 4NV2A 5HR3A 2H19A 4EKZA 3RHBA 5A5KA 3FW2A 1LBKA 3HDCA 1QK8A 3H1NA 1VF3A 4KCEA 4YQMA 3FZ9A 4PQIA 2C80A 4IGJA 1XWCA 3Q18A 2ALBA 1TW9A 2LEGA 4IQ1A 2F8AA 3F4SA 1PL1A 1A2JA 4PXOA 5ECPB 4CHSA 3HY2A 5GAPD 4O5RA 1O73A 2H76A 4JEDA 3ZVJD 4HQSA 5ECKB 5DAKB 4XCSA 2CX4A 1MEKA 1XOBA 2IJYA 1SU9A 4G2EA 2MMNA 3KP9A 3TRQA 1GUMA 1EEJA 4ICYA 4GQCA 1TU8A 2VCTA 2L6DA 2GTUA 1VF2A 3FYGA 1KNGA 1QUWA 4L8EA 5G2ZA 4AJ6A 3C7MA 3RAZA 2VL2A 2HXKA 5DCGA 1PKZA 3US3A 1B4QA 1ZYQB 4AKIA 3GMFA 4H86A 20GSA 4Q5FA 4TN8A 1PX6A 4HJ2A 3WGXA 4EO3A 3IC8A 5A4VA 4MCUA 10GSA 3HMJG 3FZ5A 1O6JA 2P31A 4TOPA 1PKWA 1VF1A 4EUYA 2IMDA 1Z9HA 2I1UA 2GDRA 4FIWA 2O8VB 4YAVA 3D4TA 1DE1A 1X5EA 1X5DA 4EIPA 2HSMB 1N2AA 3TJGA 2VCZA 4LL4B 5DJLA 4D73B 3RPNA 1WIKA 2GVPA 2D2ZA 3EINA 4KCAA 3DVWA 3NIVA 2REMA 5JCWA 3KZQA 3A5WA 2B1LA 2I9HA 2HZFA 5GZZB 2I3YA 1M0UA 1AQWA 12GSA 3GL5A 3P7XA 3TJFA 2CQ9A 2H70A 4TR3A 1ZGNA 5CRGA 1G6WA 4DSRA 4MMMA 3ZLPA 3EU4A 3TKPA 2OACA 4IQAA 5GSTA 5J41A 3LEFA 4ECCA 5IOWA 2DSAA 1USBA 2DMMA 1SD9A 1Z6NA 1PQNA 3FEUA 1NHOA 1F6MC 2KHPA 2M80A 1EWXA 3L9UA 2YJHA 1TU7A 2HSNB 1MD3A 3H79A 4AI6A 5KN2A 4WF5A 5B8AA 3D21A 3M9KA 1IYHA 1FVJA 2RUFA 1R4WA 4K7NA 1XXUA 2VO4A 3I6AA 4E8EA 1PL2A 1Y25A 5EL8A 4MF5A 2ES7A 1M2BA 1YKAA 4RUVA 6GSVA 4IW9A 2LNSA 5AIXA 3OR5A 2KP2A 1SKWB 1O85A 4DEJA 2WFCA 3IRAA 2L57A 4KW6A 7GSSA 3QMXA 2VCVA 5HR1A 3P2AA 3DYRA 2ON5A 3Q19A 1KBNA 2QGVA 3GIXA 1XW6A 1VGLA 1FVKA 2FGXA 3BCKA 5F07A 1WMJA 1PX7A 1GTBA 3GH9A 3ZITA 4ID0A 2BJXA 1V9WA 1GSFA 5HFKA 4JE1A 2K8VA 2EFEA 4MK3A 5EPFA 2O7KA 2GQMA 5IMAA 1X0RA 2B3SA 1M2DA 1YQ1A 3LWAA 4TR0A 1JZRA 1GNWA 5J40A 4FQUA 2GZYA 1YEPA 4Q5QA 4GSSA 4POKA 3A2XA 1XW5A 5ECSA 3LQ7A 4HU9A 5KN0A 5CRDA 3P90A 3UJ1A 4KNDA 1GTIA 2A4HA 5C04A 4L5LA 4O5UA 3LSZA 3FKFA 1THXA 2UZ8A 4HQZA 3WT1A 1K0AA 3GL3A 4JR4A 3EU3A 2HE3A 2XBQA 1URMA 2C3TA 3KXOA 3ME8A 3GURA 1TRUA 4WKWA 1R7HA 2MMZA 3TJBA 1R5PA 2LJKA 2YWMA 1O8WA 4LMVA 2H6XA 3KTBA 1GL8A 2FLSA 4K0NA 4PNGA 2KOKA 5D96A 5G1LA 4KDUA 1B48A 1V98A 1XVWA 1KTEA 3TJKA 1ZYEA 4JRRA 3F4RA 1ST9A 3U6VA 1YVLA 3PPUA 5ELAA 1OC9B 2BTOT 2ZNMA 3L0HA 5J9CA 4KF9A 4K2DA 4EC0A 3BBYA 3CXGA 4I5QA 4BA7A 1AIUA 3IK7A 1EP7A 1EP8A 1GSSA 4O32A 4V1Ap 3W8SA 1JZWA 2KP1A 5AN1A 3FK8A 3LG6A 4BWSA 4EDYA 1X9WB 3HD5A 3ZVJA 4HS1A 4P3YB 3F4TA 1E2YA 3W8JA 2B1KA 4DSQA 1EV9A 3KJYA 3APOA 4K5RA 2IWTA 1HD2A 4AJ8A 3UMAA 5JCUA 4OCEA 4MZWA 1AQXA 1U87A 2M46A 3RPPA 1T7PB 5B8BA 5HR0A 3TKRA 2GS3A 1K0MA 2OE3A 3C8EA 3BD2A 5IOXA 3ZMKA 1BYEA 3EYTA 3IPZA 2R0PA 5KN3A 2ZCTA 4DSSA 4XS1A 1HNAA 2CVDA 2VCQA 4BL7B 3KMOA 1AUCA 5JWQB 5KOWA 3KIJA 2K8SA 2GLRA 4GQFA 1ML6A 2YV9A 2H0IA 3QPMA 3GKXA 5ECHB 1Y1UA 3TGZA 2MMOA 2VL3A 4HJMA 4K1FA 2PMTA 3TOTA 3NZNA 1GNEA 4RQXA 3J7Yk 1J0FA 1FOVA 4NHZA 3N9JA 3HHVA 1MD4A 2IMFA 4Z2RA 5J3RA 3D5JA 2XPDA 2R0GA 3TKSE 1CQHA 1EOGA 2QC7A 1R5AA 4ZL8A 3L9VA 5ABRA 4PQHA 1Z7PA 4POBA 4TVEA 1F2EA 3UBKA 5H5QA 2VLTA 4RI7A 2HQTA 4PURA 4BWQA 3QFBC 2H66A 22GSA 4GCIA 1O8XA 1XWAA 1JZOA 2TRXA 3EPTA 5AISA 3KD0A 1RQMA 2O89A 4X43A 1SVLA 1OE7A 1YY7A 2N5FA 1Z3EA 3H93A 1XBSA 3ZIJA 3PINA 1AQVA 2R37A 2WZ9A 1N25A 3LXZA 2IIYA 3BOAA 2AUVA 5IO2A 2HFDA 3EVIA 4DVCA 2PN8A 2FA8A 2O5VA 1H75A 5A34A 2OA7A 3GKKA 2IMIA 4TR4A 3R2QA 1O81A 1HYUA 1SL2B 3Q6OA 3UBLA 5J4VA 4AKGA 2WB9A 4HZ2A 1UC7A 5DQSA 2L5LA 2LRCA 3CTFA 1TJDA 2WRTA 1XCCA 4MLYA 2M72A 3H4KA 1NM3A 1G0TA 1ERTA 2ON7A 3C71A 2HSYA 4ILFA 9GSSA 4IBPA 2E7PA 2X8HA 4ECBA 5G1KA 1SVOA 2DJ1A 4XIHA 1EOHA 1TP9A 13GSA 4LMWA 3QAVA 1J9BA 3VPQA 2HLSA 3GKNA 5ECRB 4ECIA 5GSSA 4MJAA 3LYPA 2B7JA 1VRSD 2F8FA 4KE3A 1A24A 3BCIA 1S3DA 3DRNA 3FZ4A 4V2LA 1U6TA 2EIOA 4ZB7A 4ML1A 4PUFC 3M1GA 1V40A 1B4PA 2VAFA 3EWLA 4WR5A 2IMKA 1K3OA 2H73A 5F06A 3DEXA 2H30A 1SYXA 5IMCA 1M99A 2I4AA 1DE2A 3Q74A 3ZFLA 2NPBA 3GV1A 1M2AA 1BJXA 3GTUA 2HZEB 2C0FA 3GNJA 2VIMA 5J4YA 2YN1A 3G7YA 1PGTA 3ZZXA 2WS2A 3UOMA 1PMTA 3CSIA 2FD3A 2P0GA 4N10A 2YJ7A 1XW9A 4TXOA 1FB6A 2GGTA 1AC1A 4WBRD 3TJJA 4JBBA 3KCMA 5COHA 4J56E 2YP6A 5DJMA 2PERA 1Q98A 4MJCA 2PUKC 1EGOA 2P5RA 3ZRDA 3EMPA 2E0QA 3VK9A 2GSRA 2JADA 3IC4A 1FW1A 2HI7A 2VCWA 4WETA 5FHIA 3FR3A 2WGRA 2CV4A 2L5OA 3E0UA 6GSWA 2R5GA 3TDGA 1SJZA 1XVQA 5HFIA 4BVXA 2O85A 3O3TA 4HEA2 2LV3A 3H8QA 2C0GA 4ZBBA 4LL1B 4OFTA 2HRKB 5KOXA 4QMKA 3W6GA 4KX4A 3IK9A 1M9BA 2F51A 2H6ZA 4AKHA 5A4WA 2CAIA 2OBKA 4K2XA 1K0OA 5D9XA 4Z2TA 3APQA 1GSEA 4IHUA 1F37A 2E2MA 3C1RA 1B8XA 3I9V2 4ECJA 3O6TA 2PVQA 4MPFA 3F6DA 4I97A 2VD0A 1SD8A 3TU3B 2XHFA 5BMUA 1A8LA 3RBTA 2IFQB 2RM5A 3FHKA 4ML6A 3R3EA 4MJBA 1DUGA 2YPMA 4OCFA 4OD7A 3F63A 1J08A 4XTSA 4I2UA 1YDKA 3TRXA 2DJKA 3LJRA 1ERVA 1Q4JA 1XWBA 1AAZA 1CQGA 2DIYA 1GLPA 1ERUA 1YEXA 3JCML 2FA4A 2GSSA 4ZB8A 3DMLA 2XPEA 4K8MA 2GQKA 5C00A 4IN0A 3ZTLA 2R3XA 4G10A 1SYRA 4HOJA 1K0BA 1Z7RA 4IP6A 3FR9A 3KMNA 4ZL7A 2H0HA 2JZTA 4LA1A 5G5FA 2DLXA 2C4JA 5IO0A 1K0DA 4YAPA 1TK0B 2KUCA 4MH3A 4Z7XA 4AKXB 3LXTA 1TOFA 2DKHA 3E3EA 2QA1A 3GN3A 1W89A 2P5QA 3TKSA 4D73A 3CTGA 2B5EA 1SKRB 4TR1A 5G5EA 2L6CA 14GSA 4BVYA 4GWRA 4X0XA 1OVNA 4EF0A 3L9SA 4HUAA 1R26A 1K3LA 5CO3A 3MIXA 3HVXA 4NMUA 4WF4A 1X9MB 1EEMA 3LW9A 2TIRA 5D93A 4O5QA 2HT9A 4DSSB 4OO4A 2V2GA 1OKTA 2VM2A 3E9JB 4GDFA 2YWIA 2NVLA 1TXUA 2I81A 2JSZA 3EMXA 4MH2A 4QL7A 1SVMA 1XWGA 1OAZA 1H4OA 4EVMA 2HSNA 2LUSA 3IAS2 3DWVA 2FWFA 4KSMA 4E8HA 6GSUA 1S3AA 3EE2A 1A2MA 3MNGA 3QFAC 2GT6A 2K9FA 3EC3A 4MZCA 4XRAA 1ZYPA 4K7OA 2MBSA 3UL3A 1Z6MA 1ILOA 1ZYNA 3ZFBA 2LNTA 1XWKA 1BQ7A 5A4UA 4Z2UA 1A8YA 2F3MA 3L4NA 2VUPA 5JWOB 1K3YA 1A2LA 2YNXA 4IJ3A 4ZBDA 3CBUA 2A4VA 4GRFA 2C0DA 3GKMA 5FT3A 3CWGA 3WGEA 5CYYA 4OFNA 2YCDA 3DD3A 2QKEA 11GSA 1A0RP 2YWNA 4CY8A 3WD6A 5D73A 2L4CA 3GA4A 1WJKA 5DCHA 4FYCA 1TI3A 1PN9A 1V58A 1XZOA 4IELA 5AIVA 1B9YC 2YANA 4KUNA 3F0IA 4XS4A 1GTUA 2DIZA 2UV8G 2YZHA 4WBJA 2JACA 5D8IA 5KEJA 3I69A 1M7TA 4IP1A 2A2RA 2F9SA 3A2VA 1I5GA 5ECQB 5ID2B 4PX1A 2J9HA 5IQYA 2DMLA 2LKUA 3SWLA 4PTSA 4YKFA 4FH8A 2CVKA 2O87A 5B6NA 3WGDA 1ZOFA 5EY6A 3C1SA 3VURA 4HDEA 2ZUPA 3QR6A 4PGTA 4MP4A 3U5RE 1FOHA 2OBIA 5ELGA 4IKHA 4JZQA 3IV4A 3KGKA 2EFDA 1PN0A 2X8GA 3ZMLA 1QFNA 1U3IA 1TRWA 3HXSA 3ZL5A 3HVSA 4N0ZA 4JU5A 1QXHA 3F3RA 3F6FA 4HU7A 2K18A 1FO5A 1SK0A 3QCPA 3F3QA 4X4JA 19GSA 2WCIA 2DKIA 2HNLA 3IHGA 2Z9SA 2KLXA 5CRWA 1GH2A 5A1NA 3KTLA 1BG5A 4FO5A 4EL1A 4ULXA 4GXZA 3N5OA 2FY6A 5LD0A 3A5IA 1F3BA 2GT5A 4G0LA 2MMAA 4ZILA 1E6BA 3UIWA 4ISDA 1T1VA 4IJIA 3MYDA 4V1Ag 3IBHA 1ACVA 1JFUA 5KN1A 5HR2A 4GF0A 2VOCA 1U88A 1G7OA 4EE0A 2DJ3A 1ERWA 2H8LA 1G6YA 3CRTA 4LLRA 3VI7A 2R2JA 1WWJA 3HKRA 1XOAA 1WPIA 1WRYA 4K0GA 2V32A 3QAGA 2JL4A 3FMWA 1THOA 5F8BA 3FRCA 2JZRA 5EVOA 4V2MA 2FWHA 4NAXA 1HNBA 3RDWA 1ZCPA 3CSJA 1TRSA 5DALA 1BX9A 2CVBA 1SK2A 1SENA 3LYKA 3HJOA 3VLNA 4NV5A 2H75A 1GULA 3HCZA 2PGTA 5J4UA 2N5AA 18GSA 4EDZA 4AGSA 6GSXA 3IHQA 2X49A 4AJ7A 1BG1A 4MZBA 2HRFA 5LNKe 2X99A 1GRXA 2R4VA 2CX3A 4L0UA 5G30A 5D9TA 5B6MA 1RK4A 4PUAA 2RM6A 2GSTA 1DBYA 2YZUA 4OFMA 1U3AA 1V57A 1F9MA 2EIRA 5H5RA 1WP0A 2IMEA 4EXJA 2HRAA 17GSA 3IR4A 3QOUA 2H6YA 1GSQA 2NDOA 2MZCA 5GAND 4YH2A 3FZAA 3NOFA 1FB0A 1I9DA 2X64A 3D6IA 3AY8A 1OC3A 2C1YA 1HQOA 4XS6A 1YZXA 1FAAA 4PQ1A 2H71A 2N5BA 5BMUB 4ZBAA 2PWJA 4Q5NA 16GSA 2VL9A 4ZL9A 2LSTA 5JCGA 1ZL9A 1XIYA 4I8BA 1X9SB 1GUHA 5JWRB 2RUEA 1T00A 5ENUA 1BEDA 4GSNA 3GHAA 5BRTA 4WR4A 2WULA 3P8WA 2YWOA 2OKAA 3GUSA 4EIQA 2A2SA 1W4VA 4MF6A 1BF5A 4I2TA 1GWCA 3TOUA 5A5HA 4AF2A 1HNCA 2VLVA 3G7JA 2J23A 1X5CA 2LRTA 3M8NA 4MJEA 4ZXGA 4HI7A 2EC4A 2JZSA 2IPAA 4L5OA 1QQ2A 3KH9A 2WDUA 2CT6A 4F9ZA 2R0CA 3HVVA 1DSBA 5CREA 4ACSA 2VL2C 1FG4A 1MDIA 3KM6A 2PU9C 4XRDA 3PR8A 1LU4A 5DQYA 2G2QA 4OO5A 1K0CA 5DBQA 2H01A 1T3BA 4WXTA 3ERFA 4TR1B 3TB2A 4BVYB 4V2NA 4MNNA 1ZZYA 4IS0A 1TTZA 4QL9A 3V1WA 2HRNA 1QMVA 1EGRA 4A5PA 3WT2A 3ISOA 1YJ6A 2OE1A 2HYXA 3GX0A 1MTCA 3HYPA 3KP8A 5DAKA 4NXIA 1AW9A 1YKCA 4OMVA 3LFLA 1TXXA 5IMFA 1NW2A 4K7IA 1PRXA 5D9WA 3IAM2 2HZEA 4GTUA 2GSQA 3S9FA 2GZPA 1OKDA 2A2PA 1VF4A 3VWXA 1PD21 2E2GA 1WE0A 3G7IA 4GLTA 2VD1A 1Z5YE 5E4WA 2RIIA 5F0GA 1SJ6A 5ECOB 2AJQB 2NBSA 1N8JA 4CW9A 3GSTA 1AXDA 3MAKA 2H1LA 1EZKA 1WOUA 4O92A 1KEBA 1TKDB 3IDVA 6GSTA 3DXBA 4J57E 3UVHA 3M3MA 1UN2A 4YKGA 4KDYA 3SBCA 2B6MA 2AAWA 3QDNA 4G01A 3VPTA 2L59A 2JSYA 4F82A 4KB3A 5ECMB 3A2WA 2AHEA 4KGIA 1TRVA 4J2FA 3K8NA 1Y6EA 2HSMA 1ZMAA 2FHEA 4W66A 1A23A 1O7UA 4K6XA 4N11A 3UARA 3CRUA 2AB6A 1S3CA 3MWHA 3TRPA 3ERGA 2HRKA 1YF1A 5ECIB 3ZREA 4TXVA 2XC2A 1GSYA 3HJPA 1G7EA 2DJ2A 2WJUA 3G9BA 3CSHA 5IM9A 4CDOA 4ZB9A 1TDIA 2LJRA 4ZB6A 2QSIA 3GYKA 3UEMA 4NPBA 4KDXA 1TK8B 1K0NA 1T4ZA 3TUEA 4MA9A 3VWVA 5G31A 2JU5A 1ON4A 2G0FA 4HZ4A 3A3TA 4XS4B 4MPGA 2FNOA 2FCHA 1LJRA 4GSTA 5DVBA 3VWWA 3EURA 1XPVA 4F0CA 4G9HA 4G0IA 3ZYWA 2NTOA 2IFQA 4JR6A 1OYJA 4E68A 5DDLA 5CP1A 3VI5A 2X4AA 5J9BA 6GSYA 4KSOA 3KEBA 3TKSC 1GSUA 5J47A 3WYWA 4RQRA 4K9ZA 4BPYA 3DGQA 3GH6A 3HA9A 3IXRA 2CZ2A 2LS5A 2QA2A 1TI1A 3RHCA 1YF0A 2K6VA 2OE0A 5INYA 3APSA 8GSSA 2YV7A 5ECLB 1PA3A 1SL1B 2TRCP 4G19A 1XFLA 1T8EB 1FHEA 5AGYA 2IN3A 5IIZA 2PVOC 2EFCA 3BJ5A 2H1AA 5J5NA 2VKZG 3LORA 1JZDA 2EFHA 3MDKA 3QAWA 2R6KA 5A1NB 2V1MA 5CAXA 3D0ZA 1ABAA 3DIEA 3DVXA 5CNWA 2V6KA 1GUKA 5IPGA 4QQ7A 3UAPA 3MSZA 4PNFA 4F0BA 1F3AA 2DC5A 2V6OA 3C73A 4KH7A 3LGCA 1IYIA 3GRXA 1SKSB 4POLA 4IVFA 5A34B 2PBJA 3QD9A 3F9UA 3D22A 2OJLA 3ZIVA 4USSA 5IPHA 2H1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECN B;  5E59 A;  2V41 A;  2H1B A;  4G0K A;  5F05 A;  4Q5R A;  3KH7 A;  5HQP A;  2FWE A;  2CA8 A;  1MDJ A;  1C72 A;  3GSS A;  1EV4 A;  2VLU A;  1PSQ A;  5DAL B;  4KA0 A;  2YOI A;  5IMV A;  2AYT A;  4N30 A;  4FYU A;  1JLW A;  1A0F A;  2DJJ A;  1NSW A;  2VM1 A;  2X8C A;  2H74 A;  1MDK A;  6GSS A;  5D9V A;  2GQL A;  3VFI A;  2H72 A;  3HZ8 A;  4KAE A;  2PPT A;  4X1U A;  3J7Y b;  1T4Y A;  5B7C A;  4OWY A;  1GSD A;  2C0E A;  1UVZ A;  2XBI A;  4L0W A;  1JLV A;  4YQV A;  4F2I A;  1NHY A;  2DBC A;  4O7H A;  1SL0 B;  4MF7 A;  2LRN A;  3M9J A;  1B9X C;  2B5Y A;  1V2A A;  1OC9 A;  3M0F A;  2FUG 2;  2CAQ A;  3GX8 A;  2C3N A;  5FWG A;  2MYG A;  1SJI A;  2LTK A;  1OE8 A;  4N0V A;  4MDC A;  2FWG A;  4ZIJ A;  1M9A A;  2C3Q A;  4WEY A;  4RI6 A;  4TW5 A;  2MBT A;  3UVT A;  3PH9 A;  4YQU A;  3I43 A;  3GTU B;  3F8U A;  3O76 A;  3VWU A;  3TCO A;  3D4M A;  3IOS A;  2H0G A;  5HFG A;  4TKY A;  2LJA A;  3L78 A;  3ME7 A;  2CZ3 A;  3ERW A;  3FY7 A;  1BAY A;  3HZ4 A;  2DJ0 A;  1GTA A;  4TXO B;  5LCZ A;  4POM A;  2LQO A;  1GP1 A;  4I6X A;  4NWY A;  2VCX A;  3CMI A;  1RW1 A;  3DKS A;  3PGT A;  3IA1 A;  2IL3 A;  3ED3 A;  2RLI A;  4FYB A;  3IE3 A;  5IMZ A;  2LQQ A;  2BMX A;  1JHB A;  2B5X A;  4MAB A;  2L4Q A;  3CYN A;  2EIQ A;  2C8U A;  4BL7 A;  4TRX A;  4F03 A;  2H1D A;  1UA5 A;  4NHW A;  1OC8 A;  4XHM A;  2OAD A;  2B7K A;  2GZZ A;  3FR6 A;  2HSH A;  3GFK A;  5ID2 A;  1SK1 A;  1TK5 B;  1GLQ A;  4BVX B;  1QGV A;  5IMD A;  3TKQ A;  5H5S A;  5L71 A;  5CRH A;  3HJM A;  2AV4 A;  4NV2 A;  5HR3 A;  2H19 A;  4EKZ A;  3RHB A;  5A5K A;  3FW2 A;  1LBK A;  3HDC A;  1QK8 A;  3H1N A;  1VF3 A;  4KCE A;  4YQM A;  3FZ9 A;  4PQI A;  2C80 A;  4IGJ A;  1XWC A;  3Q18 A;  2ALB A;  1TW9 A;  2LEG A;  4IQ1 A;  2F8A A;  3F4S A;  1PL1 A;  1A2J A;  4PXO A;  5ECP B;  4CHS A;  3HY2 A;  5GAP D;  4O5R A;  1O73 A;  2H76 A;  4JED A;  3ZVJ D;  4HQS A;  5ECK B;  5DAK B;  4XCS A;  2CX4 A;  1MEK A;  1XOB A;  2IJY A;  1SU9 A;  4G2E A;  2MMN A;  3KP9 A;  3TRQ A;  1GUM A;  1EEJ A;  4GQC A;  1TU8 A;  2VCT A;  2L6D A;  2GTU A;  1VF2 A;  3FYG A;  1KNG A;  1QUW A;  4L8E A;  5G2Z A;  4AJ6 A;  3C7M A;  3RAZ A;  2VL2 A;  2HXK A;  5DCG A;  1PKZ A;  3US3 A;  1B4Q A;  1ZYQ B;  3GMF A;  4H86 A;  20GS A;  4Q5F A;  4TN8 A;  1PX6 A;  4HJ2 A;  3WGX A;  4EO3 A;  3IC8 A;  5A4V A;  4MCU A;  10GS A;  3FZ5 A;  1O6J A;  2P31 A;  4TOP A;  1PKW A;  1VF1 A;  4EUY A;  2IMD A;  1Z9H A;  2I1U A;  2GDR A;  4FIW A;  2O8V B;  4YAV A;  3D4T A;  1DE1 A;  1X5E A;  1X5D A;  2HSM B;  1N2A A;  3TJG A;  2VCZ A;  4LL4 B;  5DJL A;  4D73 B;  3RPN A;  1WIK A;  2GVP A;  2D2Z A;  3EIN A;  4KCA A;  3DVW A;  3NIV A;  2REM A;  5JCW A;  3KZQ A;  3A5W A;  2B1L A;  2I9H A;  2HZF A;  5GZZ B;  2I3Y A;  1M0U A;  1AQW A;  12GS A;  3GL5 A;  3P7X A;  3TJF A;  2CQ9 A;  2H70 A;  4TR3 A;  1ZGN A;  5CRG A;  1G6W A;  4DSR A;  4MMM A;  3ZLP A;  3EU4 A;  3TKP A;  2OAC A;  4IQA A;  5GST A;  5J41 A;  3LEF A;  4ECC A;  5IOW A;  2DSA A;  1USB A;  2DMM A;  1SD9 A;  1Z6N A;  1PQN A;  3FEU A;  1NHO A;  1F6M C;  2KHP A;  2M80 A;  1EWX A;  3L9U A;  2YJH A;  1TU7 A;  2HSN B;  1MD3 A;  3H79 A;  5KN2 A;  4WF5 A;  5B8A A;  3D21 A;  3M9K A;  1IYH A;  1FVJ A;  2RUF A;  1R4W A;  4K7N A;  1XXU A;  2VO4 A;  3I6A A;  4E8E A;  1PL2 A;  1Y25 A;  5EL8 A;  4MF5 A;  2ES7 A;  1M2B A;  1YKA A;  4RUV A;  6GSV A;  4IW9 A;  2LNS A;  5AIX A;  3OR5 A;  2KP2 A;  1SKW B;  1O85 A;  4DEJ A;  2WFC A;  3IRA A;  2L57 A;  4KW6 A;  7GSS A;  3QMX A;  2VCV A;  5HR1 A;  3P2A A;  3DYR A;  2ON5 A;  3Q19 A;  1KBN A;  2QGV A;  3GIX A;  1XW6 A;  1VGL A;  1FVK A;  2FGX A;  3BCK A;  5F07 A;  1WMJ A;  1PX7 A;  1GTB A;  3GH9 A;  3ZIT A;  4ID0 A;  2BJX A;  1V9W A;  1GSF A;  5HFK A;  4JE1 A;  2K8V A;  4MK3 A;  5EPF A;  2O7K A;  2GQM A;  5IMA A;  1X0R A;  2B3S A;  1M2D A;  1YQ1 A;  3LWA A;  4TR0 A;  1JZR A;  1GNW A;  4FQU A;  2GZY A;  1YEP A;  4Q5Q A;  4GSS A;  4POK A;  3A2X A;  1XW5 A;  5ECS A;  3LQ7 A;  4HU9 A;  5KN0 A;  5CRD A;  3P90 A;  3UJ1 A;  4KND A;  1GTI A;  5C04 A;  4L5L A;  3LSZ A;  3FKF A;  1THX A;  2UZ8 A;  4HQZ A;  3WT1 A;  1K0A A;  3GL3 A;  4JR4 A;  3EU3 A;  2HE3 A;  2XBQ A;  1URM A;  2C3T A;  3KXO A;  3ME8 A;  3GUR A;  1TRU A;  4WKW A;  1R7H A;  2MMZ A;  3TJB A;  1R5P A;  2LJK A;  2YWM A;  1O8W A;  4LMV A;  2H6X A;  3KTB A;  1GL8 A;  2FLS A;  4K0N A;  4PNG A;  2KOK A;  5D96 A;  5G1L A;  4KDU A;  1B48 A;  1V98 A;  1XVW A;  1KTE A;  3TJK A;  1ZYE A;  4JRR A;  3F4R A;  1ST9 A;  3U6V A;  3PPU A;  5ELA A;  1OC9 B;  2BTO T;  2ZNM A;  3L0H A;  5J9C A;  4KF9 A;  4K2D A;  4EC0 A;  3BBY A;  3CXG A;  4I5Q A;  4BA7 A;  1AIU A;  3IK7 A;  1EP7 A;  1EP8 A;  1GSS A;  4O32 A;  4V1A p;  3W8S A;  1JZW A;  2KP1 A;  5AN1 A;  3FK8 A;  3LG6 A;  4BWS A;  4EDY A;  1X9W B;  3HD5 A;  3ZVJ A;  4HS1 A;  4P3Y B;  3F4T A;  1E2Y A;  3W8J A;  2B1K A;  4DSQ A;  1EV9 A;  3KJY A;  3APO A;  2IWT A;  1HD2 A;  4AJ8 A;  3UMA A;  5JCU A;  4OCE A;  4MZW A;  1AQX A;  1U87 A;  2M46 A;  3RPP A;  1T7P B;  5B8B A;  5HR0 A;  3TKR A;  2GS3 A;  1K0M A;  2OE3 A;  3C8E A;  3BD2 A;  5IOX A;  3ZMK A;  1BYE A;  3EYT A;  3IPZ A;  5KN3 A;  2ZCT A;  4DSS A;  4XS1 A;  1HNA A;  2CVD A;  2VCQ A;  4BL7 B;  3KMO A;  1AUC A;  5JWQ B;  3KIJ A;  2K8S A;  2GLR A;  4GQF A;  1ML6 A;  2YV9 A;  2H0I A;  3QPM A;  3GKX A;  5ECH B;  2MMO A;  3TGZ A;  2VL3 A;  4HJM A;  4K1F A;  2PMT A;  3TOT A;  3NZN A;  1GNE A;  4RQX A;  3J7Y k;  1J0F A;  1FOV A;  4NHZ A;  3N9J A;  3HHV A;  1MD4 A;  2IMF A;  5J3R A;  3D5J A;  2XPD A;  3TKS E;  1CQH A;  1EOG A;  2QC7 A;  1R5A A;  4ZL8 A;  3L9V A;  5ABR A;  4PQH A;  1Z7P A;  4POB A;  4TVE A;  1F2E A;  3UBK A;  5H5Q A;  2VLT A;  4RI7 A;  2HQT A;  4PUR A;  4BWQ A;  3QFB C;  2H66 A;  22GS A;  4GCI A;  1O8X A;  1XWA A;  1JZO A;  2TRX A;  5AIS A;  3KD0 A;  1RQM A;  2O89 A;  4X43 A;  1OE7 A;  1YY7 A;  2N5F A;  1Z3E A;  3H93 A;  1XBS A;  3ZIJ A;  3PIN A;  1AQV A;  2R37 A;  2WZ9 A;  3LXZ A;  2IIY A;  3BOA A;  2AUV A;  5IO2 A;  2HFD A;  3EVI A;  4DVC A;  2PN8 A;  2FA8 A;  1H75 A;  2OA7 A;  3GKK A;  2IMI A;  4TR4 A;  3R2Q A;  1O81 A;  1HYU A;  1SL2 B;  3Q6O A;  3UBL A;  2WB9 A;  4HZ2 A;  1UC7 A;  5DQS A;  2L5L A;  2LRC A;  3CTF A;  1TJD A;  2WRT A;  1XCC A;  4MLY A;  2M72 A;  3H4K A;  1NM3 A;  1G0T A;  1ERT A;  2ON7 A;  3C71 A;  2HSY A;  4ILF A;  9GSS A;  4IBP A;  2E7P A;  2X8H A;  4ECB A;  5G1K A;  2DJ1 A;  4XIH A;  1EOH A;  1TP9 A;  13GS A;  4LMW A;  3QAV A;  1J9B A;  3VPQ A;  2HLS A;  3GKN A;  5ECR B;  4ECI A;  5GSS A;  4MJA A;  3LYP A;  2B7J A;  1VRS D;  2F8F A;  4KE3 A;  1A24 A;  3BCI A;  1S3D A;  3DRN A;  3FZ4 A;  4V2L A;  1U6T A;  2EIO A;  4ML1 A;  4PUF C;  3M1G A;  1V40 A;  1B4P A;  2VAF A;  3EWL A;  4WR5 A;  2IMK A;  1K3O A;  2H73 A;  5F06 A;  3DEX A;  2H30 A;  1SYX A;  5IMC A;  1M99 A;  2I4A A;  1DE2 A;  3Q74 A;  3ZFL A;  2NPB A;  3GV1 A;  1M2A A;  1BJX A;  3GTU A;  2HZE B;  2C0F A;  3GNJ A;  2VIM A;  2YN1 A;  3G7Y A;  1PGT A;  3ZZX A;  2WS2 A;  3UOM A;  1PMT A;  3CSI A;  2FD3 A;  2P0G A;  4N10 A;  2YJ7 A;  1XW9 A;  4TXO A;  1FB6 A;  2GGT A;  1AC1 A;  4WBR D;  3TJJ A;  4JBB A;  3KCM A;  5COH A;  4J56 E;  2YP6 A;  5DJM A;  2PER A;  1Q98 A;  4MJC A;  2PUK C;  1EGO A;  2P5R A;  3ZRD A;  3EMP A;  2E0Q A;  3VK9 A;  2GSR A;  2JAD A;  3IC4 A;  1FW1 A;  2HI7 A;  2VCW A;  4WET A;  5FHI A;  3FR3 A;  2WGR A;  2CV4 A;  2L5O A;  3E0U A;  6GSW A;  2R5G A;  3TDG A;  1SJZ A;  1XVQ A;  5HFI A;  4BVX A;  2O85 A;  3O3T A;  4HEA 2;  2LV3 A;  3H8Q A;  2C0G A;  4ZBB A;  4LL1 B;  4OFT A;  2HRK B;  3W6G A;  4KX4 A;  3IK9 A;  1M9B A;  2F51 A;  2H6Z A;  5A4W A;  2CAI A;  2OBK A;  1K0O A;  5D9X A;  3APQ A;  1GSE A;  4IHU A;  1F37 A;  2E2M A;  3C1R A;  1B8X A;  3I9V 2;  4ECJ A;  3O6T A;  2PVQ A;  4MPF A;  3F6D A;  4I97 A;  2VD0 A;  1SD8 A;  2XHF A;  5BMU A;  1A8L A;  3RBT A;  2IFQ B;  2RM5 A;  3FHK A;  4ML6 A;  3R3E A;  4MJB A;  1DUG A;  2YPM A;  4OCF A;  4OD7 A;  3F63 A;  1J08 A;  4XTS A;  4I2U A;  1YDK A;  3TRX A;  2DJK A;  3LJR A;  1ERV A;  1Q4J A;  1XWB A;  1AAZ A;  1CQG A;  2DIY A;  1GLP A;  1ERU A;  1YEX A;  3JCM L;  2FA4 A;  2GSS A;  4ZB8 A;  3DML A;  2XPE A;  4K8M A;  2GQK A;  5C00 A;  4IN0 A;  3ZTL A;  2R3X A;  4G10 A;  1SYR A;  4HOJ A;  1K0B A;  1Z7R A;  4IP6 A;  3FR9 A;  3KMN A;  4ZL7 A;  2H0H A;  2JZT A;  4LA1 A;  5G5F A;  2DLX A;  2C4J A;  5IO0 A;  1K0D A;  4YAP A;  1TK0 B;  2KUC A;  4MH3 A;  4Z7X A;  3LXT A;  1TOF A;  3E3E A;  3GN3 A;  1W89 A;  2P5Q A;  3TKS A;  4D73 A;  3CTG A;  2B5E A;  1SKR B;  4TR1 A;  5G5E A;  2L6C A;  14GS A;  4BVY A;  4GWR A;  4X0X A;  1OVN A;  4EF0 A;  3L9S A;  4HUA A;  1R26 A;  1K3L A;  5CO3 A;  3HVX A;  4NMU A;  4WF4 A;  1X9M B;  1EEM A;  2TIR A;  5D93 A;  2HT9 A;  4DSS B;  4OO4 A;  2V2G A;  1OKT A;  2VM2 A;  3E9J B;  2YWI A;  2NVL A;  2I81 A;  2JSZ A;  3EMX A;  4MH2 A;  4QL7 A;  1XWG A;  1OAZ A;  1H4O A;  4EVM A;  2LUS A;  3IAS 2;  3DWV A;  2FWF A;  4KSM A;  4E8H A;  6GSU A;  1S3A A;  3EE2 A;  1A2M A;  3MNG A;  3QFA C;  2GT6 A;  2K9F A;  3EC3 A;  4MZC A;  4XRA A;  4K7O A;  2MBS A;  3UL3 A;  1Z6M A;  1ILO A;  3ZFB A;  2LNT A;  1XWK A;  1BQ7 A;  5A4U A;  1A8Y A;  2F3M A;  3L4N A;  2VUP A;  5JWO B;  1K3Y A;  1A2L A;  2YNX A;  4IJ3 A;  4ZBD A;  3CBU A;  2A4V A;  4GRF A;  2C0D A;  3GKM A;  5FT3 A;  3WGE A;  5CYY A;  4OFN A;  2YCD A;  3DD3 A;  2QKE A;  11GS A;  1A0R P;  2YWN A;  3WD6 A;  5D73 A;  2L4C A;  3GA4 A;  1WJK A;  5DCH A;  4FYC A;  1TI3 A;  1PN9 A;  1V58 A;  1XZO A;  4IEL A;  5AIV A;  1B9Y C;  2YAN A;  4KUN A;  3F0I A;  4XS4 A;  1GTU A;  2DIZ A;  2YZH A;  4WBJ A;  2JAC A;  5D8I A;  5KEJ A;  3I69 A;  1M7T A;  4IP1 A;  2A2R A;  2F9S A;  3A2V A;  1I5G A;  5ECQ B;  5ID2 B;  4PX1 A;  2J9H A;  5IQY A;  2DML A;  2LKU A;  3SWL A;  4PTS A;  4FH8 A;  2CVK A;  2O87 A;  5B6N A;  3WGD A;  1ZOF A;  5EY6 A;  3C1S A;  3VUR A;  4HDE A;  2ZUP A;  3QR6 A;  4PGT A;  4MP4 A;  3U5R E;  2OBI A;  5ELG A;  4IKH A;  4JZQ A;  3IV4 A;  3KGK A;  2X8G A;  3ZML A;  1QFN A;  1U3I A;  1TRW A;  3HXS A;  3ZL5 A;  3HVS A;  4N0Z A;  4JU5 A;  1QXH A;  3F3R A;  3F6F A;  4HU7 A;  2K18 A;  1FO5 A;  1SK0 A;  3QCP A;  3F3Q A;  19GS A;  2WCI A;  2HNL A;  2Z9S A;  2KLX A;  5CRW A;  1GH2 A;  3KTL A;  1BG5 A;  4FO5 A;  4EL1 A;  4ULX A;  4GXZ A;  3N5O A;  2FY6 A;  5LD0 A;  1F3B A;  2GT5 A;  4G0L A;  2MMA A;  4ZIL A;  1E6B A;  3UIW A;  4ISD A;  1T1V A;  4IJI A;  4V1A g;  3IBH A;  1ACV A;  1JFU A;  5KN1 A;  5HR2 A;  4GF0 A;  2VOC A;  1U88 A;  1G7O A;  4EE0 A;  2DJ3 A;  1ERW A;  2H8L A;  1G6Y A;  3CRT A;  4LLR A;  3VI7 A;  2R2J A;  1WWJ A;  3HKR A;  1XOA A;  1WPI A;  1WRY A;  4K0G A;  2V32 A;  3QAG A;  2JL4 A;  1THO A;  5F8B A;  3FRC A;  2JZR A;  5EVO A;  4V2M A;  2FWH A;  4NAX A;  1HNB A;  3RDW A;  1ZCP A;  3CSJ A;  1TRS A;  5DAL A;  1BX9 A;  2CVB A;  1SK2 A;  1SEN A;  3LYK A;  3HJO A;  3VLN A;  4NV5 A;  2H75 A;  1GUL A;  3HCZ A;  2PGT A;  5J4U A;  2N5A A;  18GS A;  4EDZ A;  4AGS A;  6GSX A;  3IHQ A;  4AJ7 A;  4MZB A;  2HRF A;  5LNK e;  2X99 A;  1GRX A;  2R4V A;  2CX3 A;  4L0U A;  5G30 A;  5D9T A;  5B6M A;  1RK4 A;  4PUA A;  2RM6 A;  2GST A;  1DBY A;  2YZU A;  4OFM A;  1U3A A;  1V57 A;  1F9M A;  2EIR A;  5H5R A;  1WP0 A;  2IME A;  4EXJ A;  2HRA A;  17GS A;  3IR4 A;  3QOU A;  2H6Y A;  1GSQ A;  2NDO A;  2MZC A;  5GAN D;  4YH2 A;  3FZA A;  3NOF A;  1FB0 A;  1I9D A;  2X64 A;  3D6I A;  3AY8 A;  1OC3 A;  2C1Y A;  1HQO A;  4XS6 A;  1YZX A;  1FAA A;  4PQ1 A;  2H71 A;  2N5B A;  4ZBA A;  2PWJ A;  4Q5N A;  16GS A;  2VL9 A;  4ZL9 A;  2LST A;  5JCG A;  1ZL9 A;  1XIY A;  4I8B A;  1X9S B;  1GUH A;  5JWR B;  2RUE A;  1T00 A;  5ENU A;  1BED A;  4GSN A;  3GHA A;  4WR4 A;  2WUL A;  3P8W A;  2YWO A;  2OKA A;  3GUS A;  2A2S A;  1W4V A;  4MF6 A;  4I2T A;  1GWC A;  3TOU A;  4AF2 A;  1HNC A;  2VLV A;  3G7J A;  2J23 A;  1X5C A;  2LRT A;  3M8N A;  4MJE A;  4ZXG A;  4HI7 A;  2EC4 A;  2JZS A;  2IPA A;  4L5O A;  1QQ2 A;  3KH9 A;  2WDU A;  2CT6 A;  4F9Z A;  3HVV A;  1DSB A;  5CRE A;  4ACS A;  2VL2 C;  1FG4 A;  1MDI A;  3KM6 A;  2PU9 C;  4XRD A;  3PR8 A;  1LU4 A;  5DQY A;  2G2Q A;  4OO5 A;  1K0C A;  5DBQ A;  2H01 A;  1T3B A;  4WXT A;  3ERF A;  4TR1 B;  3TB2 A;  4BVY B;  4V2N A;  1ZZY A;  4IS0 A;  1TTZ A;  4QL9 A;  3V1W A;  2HRN A;  1QMV A;  1EGR A;  3WT2 A;  3ISO A;  1YJ6 A;  2OE1 A;  2HYX A;  3GX0 A;  1MTC A;  3HYP A;  3KP8 A;  5DAK A;  4NXI A;  1AW9 A;  1YKC A;  4OMV A;  3LFL A;  1TXX A;  5IMF A;  1NW2 A;  4K7I A;  1PRX A;  5D9W A;  3IAM 2;  2HZE A;  4GTU A;  2GSQ A;  3S9F A;  2GZP A;  1OKD A;  1VF4 A;  3VWX A;  1PD2 1;  2E2G A;  1WE0 A;  3G7I A;  4GLT A;  2VD1 A;  1Z5Y E;  5E4W A;  2RII A;  5F0G A;  1SJ6 A;  5ECO B;  2AJQ B;  2NBS A;  1N8J A;  4CW9 A;  3GST A;  1AXD A;  3MAK A;  1EZK A;  1WOU A;  4O92 A;  1KEB A;  1TKD B;  3IDV A;  6GST A;  3DXB A;  4J57 E;  3UVH A;  3M3M A;  1UN2 A;  4KDY A;  3SBC A;  2B6M A;  2AAW A;  3QDN A;  3VPT A;  2L59 A;  2JSY A;  4F82 A;  4KB3 A;  5ECM B;  3A2W A;  2AHE A;  4KGI A;  1TRV A;  4J2F A;  3K8N A;  1Y6E A;  2HSM A;  1ZMA A;  2FHE A;  1A23 A;  1O7U A;  4K6X A;  4N11 A;  3UAR A;  3CRU A;  2AB6 A;  1S3C A;  3MWH A;  3TRP A;  3ERG A;  2HRK A;  1YF1 A;  5ECI B;  3ZRE A;  4TXV A;  2XC2 A;  1GSY A;  3HJP A;  1G7E A;  2DJ2 A;  2WJU A;  3G9B A;  3CSH A;  5IM9 A;  4CDO A;  4ZB9 A;  1TDI A;  2LJR A;  4ZB6 A;  2QSI A;  3GYK A;  3UEM A;  4NPB A;  4KDX A;  1TK8 B;  1K0N A;  1T4Z A;  3TUE A;  4MA9 A;  3VWV A;  5G31 A;  2JU5 A;  1ON4 A;  2G0F A;  4HZ4 A;  3A3T A;  4XS4 B;  4MPG A;  2FNO A;  2FCH A;  1LJR A;  4GST A;  5DVB A;  3VWW A;  3EUR A;  1XPV A;  4F0C A;  4G9H A;  4G0I A;  3ZYW A;  2NTO A;  2IFQ A;  4JR6 A;  1OYJ A;  5DDL A;  5CP1 A;  3VI5 A;  5J9B A;  6GSY A;  4KSO A;  3KEB A;  3TKS C;  1GSU A;  3WYW A;  4RQR A;  4K9Z A;  4BPY A;  3DGQ A;  3GH6 A;  3HA9 A;  3IXR A;  2CZ2 A;  2LS5 A;  1TI1 A;  3RHC A;  1YF0 A;  2K6V A;  2OE0 A;  5INY A;  3APS A;  8GSS A;  2YV7 A;  5ECL B;  1PA3 A;  1SL1 B;  2TRC P;  4G19 A;  1XFL A;  1T8E B;  1FHE A;  5AGY A;  2IN3 A;  5IIZ A;  2PVO C;  3BJ5 A;  2H1A A;  5J5N A;  3LOR A;  1JZD A;  3MDK A;  3QAW A;  2R6K A;  2V1M A;  5CAX A;  3D0Z A;  1ABA A;  3DIE A;  3DVX A;  5CNW A;  2V6K A;  1GUK A;  5IPG A;  4QQ7 A;  3UAP A;  3MSZ A;  4PNF A;  4F0B A;  1F3A A;  2DC5 A;  2V6O A;  3C73 A;  4KH7 A;  3LGC A;  1IYI A;  3GRX A;  1SKS B;  4POL A;  4IVF A;  2PBJ A;  3QD9 A;  3F9U A;  3D22 A;  2OJL A;  3ZIV A;  4USS A;  5IPH A;  2H1G A; 
#chains in the Genus database with same CATH topology
 5ECN B;  5E59 A;  2V41 A;  2H1B A;  4G0K A;  5F05 A;  4Q5R A;  3KH7 A;  5HQP A;  2FWE A;  2CA8 A;  1MDJ A;  1C72 A;  3GSS A;  1EV4 A;  2VLU A;  1PSQ A;  5DAL B;  4KA0 A;  2YOI A;  5IMV A;  2AYT A;  4N30 A;  4FYU A;  1JLW A;  1A0F A;  2DJJ A;  1NSW A;  2VM1 A;  2X8C A;  2H74 A;  1MDK A;  6GSS A;  5D9V A;  2GQL A;  2OT3 A;  3VFI A;  2H72 A;  3HZ8 A;  4KAE A;  2PPT A;  4X1U A;  3J7Y b;  1T4Y A;  5B7C A;  4OWY A;  1GSD A;  2C0E A;  1UVZ A;  2XBI A;  4L0W A;  1JLV A;  4YQV A;  4K5S A;  4F2I A;  1NHY A;  2DBC A;  4O7H A;  1SL0 B;  4MF7 A;  2LRN A;  3M9J A;  1B9X C;  2B5Y A;  1V2A A;  1OC9 A;  3M0F A;  2FUG 2;  4PI0 C;  2CAQ A;  3GX8 A;  2C3N A;  5FWG A;  2MYG A;  1SJI A;  2LTK A;  1OE8 A;  4N0V A;  4MDC A;  2FWG A;  4ZIJ A;  1M9A A;  2C3Q A;  4WEY A;  4RI6 A;  4TW5 A;  2MBT A;  3UVT A;  3PH9 A;  4YQU A;  3I43 A;  4N3Z A;  3GTU B;  3F8U A;  3O76 A;  3VWU A;  3TCO A;  3D4M A;  3IOS A;  2H0G A;  5HFG A;  4TKY A;  2LJA A;  3L78 A;  3ME7 A;  2CZ3 A;  3ERW A;  3FY7 A;  1BAY A;  3HZ4 A;  2DJ0 A;  1GTA A;  4TXO B;  5LCZ A;  4POM A;  2LQO A;  1GP1 A;  4I6X A;  4NWY A;  2VCX A;  3CMI A;  4CY6 A;  1RW1 A;  3DKS A;  3PGT A;  3IA1 A;  2IL3 A;  3ED3 A;  2RLI A;  4FYB A;  3IE3 A;  5IMZ A;  2LQQ A;  2BMX A;  1JHB A;  2B5X A;  4MAB A;  2L4Q A;  3CYN A;  2EIQ A;  2C8U A;  4BL7 A;  4TRX A;  4F03 A;  2H1D A;  1UA5 A;  4NHW A;  1OC8 A;  4XHM A;  2OAD A;  2B7K A;  5A5H B;  2GZZ A;  3FR6 A;  3GFK A;  2HSH A;  5ID2 A;  1SK1 A;  1TK5 B;  1GLQ A;  4BVX B;  1QGV A;  5IMD A;  3TKQ A;  5H5S A;  5L71 A;  5CRH A;  3HJM A;  2AV4 A;  4NV2 A;  5HR3 A;  2H19 A;  4EKZ A;  3RHB A;  3RFR C;  5A5K A;  3FW2 A;  1LBK A;  3HDC A;  1QK8 A;  3H1N A;  1VF3 A;  4KCE A;  4YQM A;  3FZ9 A;  4PQI A;  2C80 A;  4IGJ A;  1XWC A;  3Q18 A;  2ALB A;  1TW9 A;  2LEG A;  3CQF A;  4IQ1 A;  2F8A A;  3F4S A;  1PL1 A;  1A2J A;  4PXO A;  1I1I P;  5ECP B;  4CHS A;  3HY2 A;  5GAP D;  4O5R A;  1O73 A;  2H76 A;  4JED A;  3ZVJ D;  4HQS A;  5ECK B;  5DAK B;  4XCS A;  2CX4 A;  1MEK A;  1XOB A;  2IJY A;  1SU9 A;  4G2E A;  2MMN A;  3KP9 A;  3TRQ A;  1GUM A;  1EEJ A;  4ICY A;  4GQC A;  1TU8 A;  2VCT A;  2L6D A;  2GTU A;  1VF2 A;  3FYG A;  1KNG A;  1QUW A;  4L8E A;  5G2Z A;  4AJ6 A;  3C7M A;  3RAZ A;  2VL2 A;  2HXK A;  5DCG A;  1PKZ A;  3US3 A;  1B4Q A;  1ZYQ B;  4AKI A;  3CHX C;  3GMF A;  4H86 A;  20GS A;  4Q5F A;  4TN8 A;  1PX6 A;  4HJ2 A;  3WGX A;  4EO3 A;  3IC8 A;  5A4V A;  4MCU A;  10GS A;  3HMJ G;  3FZ5 A;  1O6J A;  2P31 A;  4TOP A;  1PKW A;  1VF1 A;  4EUY A;  2IMD A;  1Z9H A;  2I1U A;  2GDR A;  4FIW A;  2O8V B;  4YAV A;  3D4T A;  1DE1 A;  1X5E A;  1X5D A;  4EIP A;  2HSM B;  1N2A A;  3TJG A;  2VCZ A;  4LL4 B;  5DJL A;  4D73 B;  3RPN A;  1YEW C;  1WIK A;  2GVP A;  2D2Z A;  3EIN A;  4KCA A;  3DVW A;  3NIV A;  2REM A;  5JCW A;  3KZQ A;  3A5W A;  2B1L A;  2I9H A;  2HZF A;  5GZZ B;  2I3Y A;  1M0U A;  1AQW A;  12GS A;  3GL5 A;  3P7X A;  3TJF A;  2CQ9 A;  2H70 A;  4TR3 A;  1ZGN A;  5CRG A;  1G6W A;  3HVN A;  4DSR A;  4MMM A;  3ZLP A;  3EU4 A;  3TKP A;  2OAC A;  4IQA A;  5GST A;  5J41 A;  3LEF A;  4ECC A;  5IOW A;  2DSA A;  1USB A;  2DMM A;  1SD9 A;  1Z6N A;  1PQN A;  3FEU A;  2WVY A;  1NHO A;  1F6M C;  2KHP A;  2M80 A;  1EWX A;  3L9U A;  2YJH A;  1TU7 A;  2HSN B;  1MD3 A;  3H79 A;  4AI6 A;  5KN2 A;  4WF5 A;  5B8A A;  3D21 A;  3M9K A;  1IYH A;  1FVJ A;  2RUF A;  1R4W A;  4K7N A;  1XXU A;  2VO4 A;  3I6A A;  4E8E A;  1PL2 A;  1Y25 A;  5EL8 A;  4MF5 A;  2ES7 A;  1M2B A;  1YKA A;  4RUV A;  6GSV A;  4IW9 A;  2LNS A;  5AIX A;  3OR5 A;  2KP2 A;  1SKW B;  1O85 A;  4DEJ A;  2WFC A;  3IRA A;  2L57 A;  4KW6 A;  7GSS A;  3QMX A;  2VCV A;  5HR1 A;  3P2A A;  3DYR A;  2ON5 A;  3Q19 A;  1KBN A;  2QGV A;  3GIX A;  1XW6 A;  1VGL A;  1FVK A;  2FGX A;  3BCK A;  5F07 A;  1WMJ A;  1PX7 A;  1GTB A;  3GH9 A;  3ZIT A;  4ID0 A;  2BJX A;  1V9W A;  1GSF A;  5HFK A;  4JE1 A;  2K8V A;  2EFE A;  4MK3 A;  5EPF A;  2O7K A;  2GQM A;  5IMA A;  1X0R A;  2B3S A;  1M2D A;  1YQ1 A;  3LWA A;  4TR0 A;  1JZR A;  1GNW A;  5J40 A;  4FQU A;  2GZY A;  1YEP A;  4Q5Q A;  4GSS A;  4POK A;  3A2X A;  1XW5 A;  2O36 A;  5ECS A;  3LQ7 A;  4HU9 A;  5KN0 A;  5CRD A;  3P90 A;  3UJ1 A;  4KND A;  1GTI A;  2A4H A;  5C04 A;  4L5L A;  4O5U A;  3LSZ A;  3FKF A;  1THX A;  2UZ8 A;  4HQZ A;  3WT1 A;  1K0A A;  3GL3 A;  4JR4 A;  3EU3 A;  2HE3 A;  2XBQ A;  1URM A;  2C3T A;  3KXO A;  3ME8 A;  3GUR A;  2WW1 A;  1TRU A;  4WKW A;  1R7H A;  2MMZ A;  3TJB A;  1R5P A;  2LJK A;  2YWM A;  1O8W A;  4LMV A;  2H6X A;  3KTB A;  1GL8 A;  2FLS A;  4K0N A;  4PNG A;  2KOK A;  5D96 A;  5G1L A;  4KDU A;  1B48 A;  1V98 A;  1XVW A;  1KTE A;  3TJK A;  1ZYE A;  4JRR A;  3F4R A;  2WZS A;  1ST9 A;  3U6V A;  1YVL A;  3PPU A;  5ELA A;  1OC9 B;  2BTO T;  2ZNM A;  3L0H A;  5J9C A;  4KF9 A;  4K2D A;  4EC0 A;  3BBY A;  3CXG A;  4I5Q A;  4BA7 A;  1AIU A;  3IK7 A;  1EP7 A;  1EP8 A;  1GSS A;  4O32 A;  4V1A p;  3W8S A;  1JZW A;  2KP1 A;  5AN1 A;  3FK8 A;  3LG6 A;  4BWS A;  4EDY A;  1X9W B;  3HD5 A;  3ZVJ A;  4HS1 A;  4P3Y B;  3F4T A;  1E2Y A;  3W8J A;  2B1K A;  4DSQ A;  1EV9 A;  3KJY A;  3APO A;  4K5R A;  2IWT A;  1HD2 A;  4AJ8 A;  3UMA A;  5JCU A;  4OCE A;  4MZW A;  1AQX A;  1U87 A;  2M46 A;  3RPP A;  1T7P B;  5B8B A;  5HR0 A;  3TKR A;  2GS3 A;  1K0M A;  2OE3 A;  3C8E A;  3BD2 A;  5IOX A;  3ZMK A;  1BYE A;  3EYT A;  3IPZ A;  2R0P A;  5KN3 A;  2ZCT A;  4DSS A;  4XS1 A;  1HNA A;  2CVD A;  2VCQ A;  4BL7 B;  3KMO A;  1AUC A;  5JWQ B;  5KOW A;  3KIJ A;  2K8S A;  2GLR A;  4GQF A;  1ML6 A;  2YV9 A;  2H0I A;  3QPM A;  3GKX A;  2WVX B;  5ECH B;  1Y1U A;  3TGZ A;  2MMO A;  2VL3 A;  4HJM A;  4K1F A;  2PMT A;  3TOT A;  3NZN A;  1GNE A;  4RQX A;  3J7Y k;  1J0F A;  1FOV A;  4NHZ A;  3N9J A;  3HHV A;  1MD4 A;  2IMF A;  4Z2R A;  5J3R A;  3D5J A;  2XPD A;  2R0G A;  3TKS E;  1CQH A;  1EOG A;  2QC7 A;  1R5A A;  4ZL8 A;  3L9V A;  5ABR A;  4PQH A;  1Z7P A;  4POB A;  4TVE A;  1F2E A;  3UBK A;  5H5Q A;  2VLT A;  4RI7 A;  2HQT A;  4PUR A;  4BWQ A;  3QFB C;  2H66 A;  22GS A;  4GCI A;  1O8X A;  1XWA A;  1JZO A;  2TRX A;  3EPT A;  5AIS A;  3KD0 A;  1RQM A;  2O89 A;  4X43 A;  1SVL A;  1OE7 A;  1YY7 A;  2N5F A;  1Z3E A;  3H93 A;  1XBS A;  3ZIJ A;  3PIN A;  1AQV A;  2R37 A;  2WZ9 A;  1N25 A;  3LXZ A;  2IIY A;  3BOA A;  2AUV A;  5IO2 A;  2HFD A;  3EVI A;  4DVC A;  2PN8 A;  2FA8 A;  2O5V A;  1H75 A;  5A34 A;  2OA7 A;  3GKK A;  2IMI A;  4TR4 A;  3R2Q A;  1O81 A;  1HYU A;  1SL2 B;  3Q6O A;  3UBL A;  5J4V A;  4AKG A;  2WB9 A;  4HZ2 A;  1UC7 A;  5DQS A;  2L5L A;  2LRC A;  3CTF A;  1TJD A;  2WRT A;  1XCC A;  4MLY A;  2M72 A;  3H4K A;  1NM3 A;  1G0T A;  1ERT A;  2ON7 A;  3C71 A;  2HSY A;  4ILF A;  9GSS A;  4IBP A;  2E7P A;  2X8H A;  4ECB A;  5G1K A;  1SVO A;  2DJ1 A;  4XIH A;  1EOH A;  1TP9 A;  13GS A;  4LMW A;  3QAV A;  1J9B A;  3VPQ A;  2HLS A;  3GKN A;  5ECR B;  4ECI A;  5GSS A;  4MJA A;  3LYP A;  2B7J A;  1VRS D;  2F8F A;  4KE3 A;  1A24 A;  3BCI A;  1S3D A;  3DRN A;  3FZ4 A;  4V2L A;  1U6T A;  2EIO A;  4ZB7 A;  4ML1 A;  4PUF C;  3M1G A;  1V40 A;  1B4P A;  2VAF A;  3EWL A;  4WR5 A;  2IMK A;  1K3O A;  2H73 A;  5F06 A;  3DEX A;  2H30 A;  1SYX A;  5IMC A;  1M99 A;  2I4A A;  1DE2 A;  3Q74 A;  3ZFL A;  2NPB A;  3GV1 A;  2WW2 A;  1M2A A;  1BJX A;  3GTU A;  2HZE B;  2C0F A;  3GNJ A;  2VIM A;  5J4Y A;  2YN1 A;  3G7Y A;  1PGT A;  3ZZX A;  2WS2 A;  3UOM A;  1PMT A;  3CSI A;  2FD3 A;  2P0G A;  4N10 A;  2YJ7 A;  1XW9 A;  4TXO A;  1FB6 A;  2GGT A;  1AC1 A;  4WBR D;  3TJJ A;  4JBB A;  3KCM A;  5COH A;  4J56 E;  2YP6 A;  5DJM A;  2PER A;  1Q98 A;  4MJC A;  2PUK C;  1EGO A;  2P5R A;  3ZRD A;  3EMP A;  2E0Q A;  3VK9 A;  2GSR A;  2JAD A;  3IC4 A;  1FW1 A;  2HI7 A;  2VCW A;  4WET A;  5FHI A;  3FR3 A;  2WGR A;  2CV4 A;  2L5O A;  3E0U A;  6GSW A;  2R5G A;  3TDG A;  1SJZ A;  1XVQ A;  5HFI A;  4BVX A;  2O85 A;  3O3T A;  1M3I A;  4HEA 2;  2LV3 A;  3H8Q A;  2C0G A;  4ZBB A;  4LL1 B;  4OFT A;  2HRK B;  5KOX A;  4QMK A;  3W6G A;  4KX4 A;  3IK9 A;  1M9B A;  2F51 A;  2H6Z A;  4AKH A;  5A4W A;  2CAI A;  2OBK A;  4K2X A;  1K0O A;  5D9X A;  4Z2T A;  3APQ A;  1GSE A;  4IHU A;  1F37 A;  2E2M A;  3C1R A;  1B8X A;  3I9V 2;  4ECJ A;  3O6T A;  2PVQ A;  4MPF A;  3F6D A;  4I97 A;  2VD0 A;  1SD8 A;  3TU3 B;  2XHF A;  5BMU A;  1A8L A;  3RBT A;  2IFQ B;  2RM5 A;  3FHK A;  4ML6 A;  3R3E A;  4MJB A;  1DUG A;  2YPM A;  4OCF A;  4OD7 A;  3F63 A;  1J08 A;  4XTS A;  4I2U A;  1YDK A;  3TRX A;  2DJK A;  3LJR A;  1ERV A;  1Q4J A;  1XWB A;  1AAZ A;  1CQG A;  2DIY A;  1GLP A;  1ERU A;  1YEX A;  3JCM L;  2FA4 A;  2GSS A;  4ZB8 A;  3DML A;  2XPE A;  4K8M A;  2GQK A;  5C00 A;  4IN0 A;  3ZTL A;  2R3X A;  4G10 A;  1SYR A;  4HOJ A;  1K0B A;  1Z7R A;  4IP6 A;  3FR9 A;  3KMN A;  4ZL7 A;  2H0H A;  2JZT A;  4LA1 A;  5G5F A;  2DLX A;  2C4J A;  5IO0 A;  1K0D A;  4YAP A;  1TK0 B;  2KUC A;  4MH3 A;  4Z7X A;  4AKX B;  3LXT A;  1TOF A;  2DKH A;  3E3E A;  2QA1 A;  3GN3 A;  1W89 A;  2P5Q A;  3TKS A;  4D73 A;  3CTG A;  2B5E A;  1SKR B;  4TR1 A;  5G5E A;  2L6C A;  14GS A;  4BVY A;  4GWR A;  4X0X A;  1OVN A;  4EF0 A;  3L9S A;  4HUA A;  1R26 A;  1K3L A;  5CO3 A;  3MIX A;  3HVX A;  4NMU A;  4WF4 A;  1X9M B;  1EEM A;  3LW9 A;  2TIR A;  5D93 A;  4O5Q A;  2HT9 A;  4DSS B;  4OO4 A;  2V2G A;  1OKT A;  2VM2 A;  3E9J B;  4GDF A;  2YWI A;  2NVL A;  1TXU A;  2I81 A;  2JSZ A;  3EMX A;  4MH2 A;  4QL7 A;  2O3E A;  1SVM A;  1XWG A;  1OAZ A;  1H4O A;  4EVM A;  2HSN A;  2LUS A;  3IAS 2;  3DWV A;  2FWF A;  4KSM A;  4E8H A;  6GSU A;  1S3A A;  3EE2 A;  1A2M A;  3MNG A;  3QFA C;  2GT6 A;  2K9F A;  3EC3 A;  4MZC A;  4XRA A;  1ZYP A;  4K7O A;  2MBS A;  3UL3 A;  1Z6M A;  1ILO A;  1ZYN A;  3ZFB A;  2LNT A;  1XWK A;  1BQ7 A;  5A4U A;  4Z2U A;  1A8Y A;  2F3M A;  3L4N A;  2VUP A;  5JWO B;  1PFO A;  1K3Y A;  1A2L A;  2YNX A;  4IJ3 A;  4ZBD A;  3CBU A;  2A4V A;  4GRF A;  2C0D A;  3GKM A;  5FT3 A;  3CWG A;  3WGE A;  5CYY A;  2WW3 A;  4OFN A;  2YCD A;  3DD3 A;  2QKE A;  11GS A;  1A0R P;  2YWN A;  4CY8 A;  3WD6 A;  5D73 A;  2L4C A;  3GA4 A;  1WJK A;  5DCH A;  4FYC A;  1TI3 A;  1PN9 A;  1V58 A;  1XZO A;  4IEL A;  5AIV A;  1B9Y C;  2YAN A;  4KUN A;  3F0I A;  4XS4 A;  1GTU A;  2DIZ A;  2UV8 G;  2YZH A;  4WBJ A;  2JAC A;  5D8I A;  5KEJ A;  3I69 A;  1M7T A;  4IP1 A;  2A2R A;  2F9S A;  3A2V A;  1I5G A;  5ECQ B;  5ID2 B;  4PX1 A;  2J9H A;  5IQY A;  2DML A;  2LKU A;  3SWL A;  4PTS A;  4YKF A;  4FH8 A;  4HSC X;  2CVK A;  2O87 A;  5B6N A;  3WGD A;  1ZOF A;  5EY6 A;  3C1S A;  3VUR A;  4HDE A;  2ZUP A;  3QR6 A;  4PGT A;  4MP4 A;  3U5R E;  1FOH A;  2OBI A;  5ELG A;  4IKH A;  4JZQ A;  3IV4 A;  3KGK A;  2EFD A;  1PN0 A;  2X8G A;  3ZML A;  1QFN A;  1U3I A;  1TRW A;  3HXS A;  3ZL5 A;  3HVS A;  4N0Z A;  4JU5 A;  1QXH A;  3F3R A;  3F6F A;  4HU7 A;  2K18 A;  1FO5 A;  1SK0 A;  3QCP A;  3F3Q A;  4X4J A;  19GS A;  2WCI A;  2DKI A;  2HNL A;  3IHG A;  2Z9S A;  2KLX A;  5CRW A;  1GH2 A;  5A1N A;  3KTL A;  1BG5 A;  4FO5 A;  4EL1 A;  4ULX A;  4GXZ A;  3N5O A;  2FY6 A;  5LD0 A;  3A5I A;  1F3B A;  2GT5 A;  4G0L A;  2MMA A;  4ZIL A;  1E6B A;  3UIW A;  4ISD A;  1T1V A;  4IJI A;  3MYD A;  4V1A g;  3IBH A;  1ACV A;  1JFU A;  5KN1 A;  5HR2 A;  4GF0 A;  2VOC A;  1U88 A;  1G7O A;  4EE0 A;  2DJ3 A;  1ERW A;  2H8L A;  1G6Y A;  3CRT A;  4LLR A;  3VI7 A;  2R2J A;  1WWJ A;  3HKR A;  1S4B P;  1XOA A;  1WPI A;  1WRY A;  4K0G A;  2V32 A;  3QAG A;  2JL4 A;  3FMW A;  1THO A;  5F8B A;  3FRC A;  2JZR A;  5EVO A;  4V2M A;  2FWH A;  4NAX A;  1HNB A;  3RDW A;  1ZCP A;  3CSJ A;  1TRS A;  5DAL A;  1BX9 A;  2CVB A;  1SK2 A;  1SEN A;  3LYK A;  3HJO A;  3VLN A;  4NV5 A;  2H75 A;  1GUL A;  3HCZ A;  2PGT A;  2WVX A;  5J4U A;  2N5A A;  18GS A;  4EDZ A;  4AGS A;  6GSX A;  3IHQ A;  2X49 A;  4AJ7 A;  1BG1 A;  4MZB A;  2HRF A;  5LNK e;  2X99 A;  1GRX A;  2R4V A;  2CX3 A;  4L0U A;  5G30 A;  5D9T A;  5B6M A;  1RK4 A;  4PUA A;  2RM6 A;  2GST A;  1DBY A;  2YZU A;  4OFM A;  1U3A A;  1V57 A;  1F9M A;  2WW0 A;  2EIR A;  5H5R A;  1WP0 A;  2IME A;  4EXJ A;  2HRA A;  17GS A;  3IR4 A;  3QOU A;  2H6Y A;  1GSQ A;  2NDO A;  4FXY P;  2MZC A;  5GAN D;  4YH2 A;  3FZA A;  3NOF A;  1FB0 A;  1I9D A;  2X64 A;  3D6I A;  3AY8 A;  1OC3 A;  2C1Y A;  1HQO A;  4XS6 A;  1YZX A;  1FAA A;  4PQ1 A;  2H71 A;  2N5B A;  5BMU B;  4ZBA A;  2PWJ A;  4Q5N A;  16GS A;  2VL9 A;  4ZL9 A;  2LST A;  5JCG A;  1ZL9 A;  1XIY A;  4I8B A;  1X9S B;  1GUH A;  5JWR B;  2RUE A;  1T00 A;  5ENU A;  1BED A;  4GSN A;  3GHA A;  5BRT A;  4WR4 A;  2WUL A;  3P8W A;  2YWO A;  2OKA A;  3GUS A;  4EIQ A;  2A2S A;  1W4V A;  4MF6 A;  1BF5 A;  4I2T A;  1GWC A;  3TOU A;  5A5H A;  4AF2 A;  1HNC A;  2VLV A;  3G7J A;  2J23 A;  1X5C A;  2LRT A;  3M8N A;  4MJE A;  4ZXG A;  4HI7 A;  2EC4 A;  2JZS A;  2IPA A;  4L5O A;  1QQ2 A;  3KH9 A;  2WDU A;  2CT6 A;  4F9Z A;  2R0C A;  3HVV A;  1DSB A;  5CRE A;  4ACS A;  2VL2 C;  1FG4 A;  1MDI A;  3KM6 A;  2PU9 C;  4XRD A;  3PR8 A;  1LU4 A;  5DQY A;  2G2Q A;  4OO5 A;  1K0C A;  5DBQ A;  2H01 A;  1T3B A;  4WXT A;  3ERF A;  4TR1 B;  3TB2 A;  4BVY B;  4V2N A;  4MNN A;  1ZZY A;  4IS0 A;  1TTZ A;  4QL9 A;  3V1W A;  2HRN A;  1QMV A;  1EGR A;  4A5P A;  3WT2 A;  3ISO A;  1YJ6 A;  2OE1 A;  2HYX A;  3GX0 A;  1MTC A;  3HYP A;  3KP8 A;  5DAK A;  4NXI A;  1AW9 A;  1YKC A;  4OMV A;  3LFL A;  1TXX A;  5IMF A;  1NW2 A;  4K7I A;  1PRX A;  5D9W A;  3IAM 2;  2HZE A;  4GTU A;  2GSQ A;  3S9F A;  2GZP A;  4PHZ C;  1OKD A;  2A2P A;  1VF4 A;  3VWX A;  1PD2 1;  2E2G A;  1WE0 A;  3G7I A;  4GLT A;  2VD1 A;  1Z5Y E;  5E4W A;  2RII A;  5F0G A;  1SJ6 A;  5ECO B;  2AJQ B;  2NBS A;  1N8J A;  4CW9 A;  3GST A;  1AXD A;  3MAK A;  2H1L A;  1EZK A;  1WOU A;  4O92 A;  1KEB A;  1TKD B;  3IDV A;  6GST A;  3DXB A;  4J57 E;  3UVH A;  3M3M A;  1UN2 A;  4YKG A;  4KDY A;  3SBC A;  2B6M A;  2AAW A;  3QDN A;  4G01 A;  3VPT A;  2L59 A;  2JSY A;  4BIK A;  4F82 A;  4KB3 A;  5ECM B;  3A2W A;  2AHE A;  4KGI A;  1TRV A;  4J2F A;  3K8N A;  2WVZ A;  1Y6E A;  2HSM A;  1ZMA A;  2FHE A;  4W66 A;  1A23 A;  1O7U A;  4K6X A;  4N11 A;  3UAR A;  3CRU A;  2AB6 A;  1S3C A;  3MWH A;  3TRP A;  3ERG A;  2HRK A;  1YF1 A;  5ECI B;  3ZRE A;  4TXV A;  2XC2 A;  1GSY A;  3HJP A;  1G7E A;  2DJ2 A;  2WJU A;  3G9B A;  3CSH A;  5IM9 A;  4CDO A;  4ZB9 A;  1TDI A;  2LJR A;  4ZB6 A;  2QSI A;  3GYK A;  4PI2 C;  3UEM A;  4NPB A;  4KDX A;  1TK8 B;  1K0N A;  1T4Z A;  3TUE A;  4MA9 A;  3VWV A;  5G31 A;  2JU5 A;  1ON4 A;  2G0F A;  4HZ4 A;  3A3T A;  4XS4 B;  4MPG A;  2FNO A;  2FCH A;  1LJR A;  4GST A;  1S3R A;  5DVB A;  3VWW A;  3EUR A;  1XPV A;  4F0C A;  4G9H A;  4G0I A;  3ZYW A;  2NTO A;  2IFQ A;  4JR6 A;  1OYJ A;  4E68 A;  5DDL A;  5CP1 A;  3VI5 A;  2X4A A;  1M3J A;  5J9B A;  6GSY A;  4KSO A;  3KEB A;  3TKS C;  1GSU A;  5J47 A;  3WYW A;  4RQR A;  4K9Z A;  4BPY A;  3DGQ A;  3GH6 A;  3HA9 A;  3IXR A;  2CZ2 A;  2LS5 A;  2QA2 A;  1TI1 A;  3RHC A;  1YF0 A;  2K6V A;  2OE0 A;  5INY A;  3APS A;  8GSS A;  2YV7 A;  5ECL B;  1PA3 A;  1SL1 B;  2TRC P;  4G19 A;  1XFL A;  1T8E B;  1FHE A;  5AGY A;  2IN3 A;  5IIZ A;  2PVO C;  2EFC A;  3BJ5 A;  1XG8 A;  2H1A A;  5J5N A;  2VKZ G;  3LOR A;  1JZD A;  2EFH A;  3MDK A;  3QAW A;  2R6K A;  5A1N B;  2V1M A;  5CAX A;  3D0Z A;  1ABA A;  3DIE A;  3DVX A;  5CNW A;  2V6K A;  1GUK A;  5IPG A;  4QQ7 A;  3UAP A;  3MSZ A;  4PNF A;  4F0B A;  3RGB C;  1F3A A;  2DC5 A;  2V6O A;  3C73 A;  4KH7 A;  3LGC A;  1IYI A;  3GRX A;  1SKS B;  4POL A;  4IVF A;  5A34 B;  2PBJ A;  3QD9 A;  3F9U A;  3D22 A;  2OJL A;  3ZIV A;  4USS A;  5IPH A;  2H1G A; 
#chains in the Genus database with same CATH homology
 5ECN B;  5E59 A;  2V41 A;  2H1B A;  4G0K A;  5F05 A;  4Q5R A;  3KH7 A;  5HQP A;  2FWE A;  2CA8 A;  1MDJ A;  1C72 A;  3GSS A;  1EV4 A;  2VLU A;  1PSQ A;  5DAL B;  4KA0 A;  2YOI A;  5IMV A;  2AYT A;  4N30 A;  4FYU A;  1JLW A;  1A0F A;  2DJJ A;  1NSW A;  2VM1 A;  2X8C A;  2H74 A;  1MDK A;  6GSS A;  5D9V A;  2GQL A;  2OT3 A;  3VFI A;  2H72 A;  3HZ8 A;  4KAE A;  2PPT A;  4X1U A;  3J7Y b;  1T4Y A;  5B7C A;  4OWY A;  1GSD A;  2C0E A;  1UVZ A;  2XBI A;  4L0W A;  1JLV A;  4YQV A;  4K5S A;  4F2I A;  1NHY A;  2DBC A;  4O7H A;  1SL0 B;  4MF7 A;  2LRN A;  3M9J A;  1B9X C;  2B5Y A;  1V2A A;  1OC9 A;  3M0F A;  2FUG 2;  2CAQ A;  3GX8 A;  2C3N A;  5FWG A;  2MYG A;  1SJI A;  2LTK A;  1OE8 A;  4N0V A;  4MDC A;  2FWG A;  4ZIJ A;  1M9A A;  2C3Q A;  4WEY A;  4RI6 A;  4TW5 A;  2MBT A;  3UVT A;  3PH9 A;  4YQU A;  3I43 A;  4N3Z A;  3GTU B;  3F8U A;  3O76 A;  3VWU A;  3TCO A;  3D4M A;  3IOS A;  2H0G A;  5HFG A;  4TKY A;  2LJA A;  3L78 A;  3ME7 A;  2CZ3 A;  3ERW A;  3FY7 A;  1BAY A;  3HZ4 A;  2DJ0 A;  1GTA A;  4TXO B;  5LCZ A;  4POM A;  2LQO A;  1GP1 A;  4I6X A;  4NWY A;  2VCX A;  3CMI A;  4CY6 A;  1RW1 A;  3DKS A;  3PGT A;  3IA1 A;  2IL3 A;  3ED3 A;  2RLI A;  4FYB A;  3IE3 A;  5IMZ A;  2LQQ A;  2BMX A;  1JHB A;  2B5X A;  4MAB A;  2L4Q A;  3CYN A;  2EIQ A;  2C8U A;  4BL7 A;  4TRX A;  4F03 A;  2H1D A;  1UA5 A;  4NHW A;  1OC8 A;  4XHM A;  2OAD A;  2B7K A;  5A5H B;  2GZZ A;  3FR6 A;  3GFK A;  2HSH A;  5ID2 A;  1SK1 A;  1TK5 B;  1GLQ A;  4BVX B;  1QGV A;  5IMD A;  3TKQ A;  5H5S A;  5L71 A;  5CRH A;  3HJM A;  2AV4 A;  4NV2 A;  5HR3 A;  2H19 A;  4EKZ A;  3RHB A;  5A5K A;  3FW2 A;  1LBK A;  3HDC A;  1QK8 A;  3H1N A;  1VF3 A;  4KCE A;  4YQM A;  3FZ9 A;  4PQI A;  2C80 A;  4IGJ A;  1XWC A;  3Q18 A;  2ALB A;  1TW9 A;  2LEG A;  4IQ1 A;  2F8A A;  3F4S A;  1PL1 A;  1A2J A;  4PXO A;  5ECP B;  4CHS A;  3HY2 A;  5GAP D;  4O5R A;  1O73 A;  2H76 A;  4JED A;  3ZVJ D;  4HQS A;  5ECK B;  5DAK B;  4XCS A;  2CX4 A;  1MEK A;  1XOB A;  2IJY A;  1SU9 A;  4G2E A;  2MMN A;  3KP9 A;  3TRQ A;  1GUM A;  1EEJ A;  4ICY A;  4GQC A;  1TU8 A;  2VCT A;  2L6D A;  2GTU A;  1VF2 A;  3FYG A;  1KNG A;  1QUW A;  4L8E A;  5G2Z A;  4AJ6 A;  3C7M A;  3RAZ A;  2VL2 A;  2HXK A;  5DCG A;  1PKZ A;  3US3 A;  1B4Q A;  1ZYQ B;  4AKI A;  3GMF A;  4H86 A;  20GS A;  4Q5F A;  4TN8 A;  1PX6 A;  4HJ2 A;  3WGX A;  4EO3 A;  3IC8 A;  5A4V A;  4MCU A;  10GS A;  3HMJ G;  3FZ5 A;  1O6J A;  2P31 A;  4TOP A;  1PKW A;  1VF1 A;  4EUY A;  2IMD A;  1Z9H A;  2I1U A;  2GDR A;  4FIW A;  2O8V B;  4YAV A;  3D4T A;  1DE1 A;  1X5E A;  1X5D A;  4EIP A;  2HSM B;  1N2A A;  3TJG A;  2VCZ A;  4LL4 B;  5DJL A;  4D73 B;  3RPN A;  1WIK A;  2GVP A;  2D2Z A;  3EIN A;  4KCA A;  3DVW A;  3NIV A;  2REM A;  5JCW A;  3KZQ A;  3A5W A;  2B1L A;  2I9H A;  2HZF A;  5GZZ B;  2I3Y A;  1M0U A;  1AQW A;  12GS A;  3GL5 A;  3P7X A;  3TJF A;  2CQ9 A;  2H70 A;  4TR3 A;  1ZGN A;  5CRG A;  1G6W A;  4DSR A;  4MMM A;  3ZLP A;  3EU4 A;  3TKP A;  2OAC A;  4IQA A;  5GST A;  5J41 A;  3LEF A;  4ECC A;  5IOW A;  2DSA A;  1USB A;  2DMM A;  1SD9 A;  1Z6N A;  1PQN A;  3FEU A;  1NHO A;  1F6M C;  2KHP A;  2M80 A;  1EWX A;  3L9U A;  2YJH A;  1TU7 A;  2HSN B;  1MD3 A;  3H79 A;  4AI6 A;  5KN2 A;  4WF5 A;  5B8A A;  3D21 A;  3M9K A;  1IYH A;  1FVJ A;  2RUF A;  1R4W A;  4K7N A;  1XXU A;  2VO4 A;  3I6A A;  4E8E A;  1PL2 A;  1Y25 A;  5EL8 A;  4MF5 A;  2ES7 A;  1M2B A;  1YKA A;  4RUV A;  6GSV A;  4IW9 A;  2LNS A;  5AIX A;  3OR5 A;  2KP2 A;  1SKW B;  1O85 A;  4DEJ A;  2WFC A;  3IRA A;  2L57 A;  4KW6 A;  7GSS A;  3QMX A;  2VCV A;  5HR1 A;  3P2A A;  3DYR A;  2ON5 A;  3Q19 A;  1KBN A;  2QGV A;  3GIX A;  1XW6 A;  1VGL A;  1FVK A;  2FGX A;  3BCK A;  5F07 A;  1WMJ A;  1PX7 A;  1GTB A;  3GH9 A;  3ZIT A;  4ID0 A;  2BJX A;  1V9W A;  1GSF A;  5HFK A;  4JE1 A;  2K8V A;  2EFE A;  4MK3 A;  5EPF A;  2O7K A;  2GQM A;  5IMA A;  1X0R A;  2B3S A;  1M2D A;  1YQ1 A;  3LWA A;  4TR0 A;  1JZR A;  1GNW A;  5J40 A;  4FQU A;  2GZY A;  1YEP A;  4Q5Q A;  4GSS A;  4POK A;  3A2X A;  1XW5 A;  5ECS A;  3LQ7 A;  4HU9 A;  5KN0 A;  5CRD A;  3P90 A;  3UJ1 A;  4KND A;  1GTI A;  2A4H A;  5C04 A;  4L5L A;  4O5U A;  3LSZ A;  3FKF A;  1THX A;  2UZ8 A;  4HQZ A;  3WT1 A;  1K0A A;  3GL3 A;  4JR4 A;  3EU3 A;  2HE3 A;  2XBQ A;  1URM A;  2C3T A;  3KXO A;  3ME8 A;  3GUR A;  1TRU A;  4WKW A;  1R7H A;  2MMZ A;  3TJB A;  1R5P A;  2LJK A;  2YWM A;  1O8W A;  4LMV A;  2H6X A;  3KTB A;  1GL8 A;  2FLS A;  4K0N A;  4PNG A;  2KOK A;  5D96 A;  5G1L A;  4KDU A;  1B48 A;  1V98 A;  1XVW A;  1KTE A;  3TJK A;  1ZYE A;  4JRR A;  3F4R A;  1ST9 A;  3U6V A;  1YVL A;  3PPU A;  5ELA A;  1OC9 B;  2BTO T;  2ZNM A;  3L0H A;  5J9C A;  4KF9 A;  4K2D A;  4EC0 A;  3BBY A;  3CXG A;  4I5Q A;  4BA7 A;  1AIU A;  3IK7 A;  1EP7 A;  1EP8 A;  1GSS A;  4O32 A;  4V1A p;  3W8S A;  1JZW A;  2KP1 A;  5AN1 A;  3FK8 A;  3LG6 A;  4BWS A;  4EDY A;  1X9W B;  3HD5 A;  3ZVJ A;  4HS1 A;  4P3Y B;  3F4T A;  1E2Y A;  3W8J A;  2B1K A;  4DSQ A;  1EV9 A;  3KJY A;  3APO A;  4K5R A;  2IWT A;  1HD2 A;  4AJ8 A;  3UMA A;  5JCU A;  4OCE A;  4MZW A;  1AQX A;  1U87 A;  2M46 A;  3RPP A;  1T7P B;  5B8B A;  5HR0 A;  3TKR A;  2GS3 A;  1K0M A;  2OE3 A;  3C8E A;  3BD2 A;  5IOX A;  3ZMK A;  1BYE A;  3EYT A;  3IPZ A;  2R0P A;  5KN3 A;  2ZCT A;  4DSS A;  4XS1 A;  1HNA A;  2CVD A;  2VCQ A;  4BL7 B;  3KMO A;  1AUC A;  5JWQ B;  5KOW A;  3KIJ A;  2K8S A;  2GLR A;  4GQF A;  1ML6 A;  2YV9 A;  2H0I A;  3QPM A;  3GKX A;  5ECH B;  1Y1U A;  3TGZ A;  2MMO A;  2VL3 A;  4HJM A;  4K1F A;  2PMT A;  3TOT A;  3NZN A;  1GNE A;  4RQX A;  3J7Y k;  1J0F A;  1FOV A;  4NHZ A;  3N9J A;  3HHV A;  1MD4 A;  2IMF A;  4Z2R A;  5J3R A;  3D5J A;  2XPD A;  2R0G A;  3TKS E;  1CQH A;  1EOG A;  2QC7 A;  1R5A A;  4ZL8 A;  3L9V A;  5ABR A;  4PQH A;  1Z7P A;  4POB A;  4TVE A;  1F2E A;  3UBK A;  5H5Q A;  2VLT A;  4RI7 A;  2HQT A;  4PUR A;  4BWQ A;  3QFB C;  2H66 A;  22GS A;  4GCI A;  1O8X A;  1XWA A;  1JZO A;  2TRX A;  3EPT A;  5AIS A;  3KD0 A;  1RQM A;  2O89 A;  4X43 A;  1SVL A;  1OE7 A;  1YY7 A;  2N5F A;  1Z3E A;  3H93 A;  1XBS A;  3ZIJ A;  3PIN A;  1AQV A;  2R37 A;  2WZ9 A;  1N25 A;  3LXZ A;  2IIY A;  3BOA A;  2AUV A;  5IO2 A;  2HFD A;  3EVI A;  4DVC A;  2PN8 A;  2FA8 A;  2O5V A;  1H75 A;  5A34 A;  2OA7 A;  3GKK A;  2IMI A;  4TR4 A;  3R2Q A;  1O81 A;  1HYU A;  1SL2 B;  3Q6O A;  3UBL A;  5J4V A;  4AKG A;  2WB9 A;  4HZ2 A;  1UC7 A;  5DQS A;  2L5L A;  2LRC A;  3CTF A;  1TJD A;  2WRT A;  1XCC A;  4MLY A;  2M72 A;  3H4K A;  1NM3 A;  1G0T A;  1ERT A;  2ON7 A;  3C71 A;  2HSY A;  4ILF A;  9GSS A;  4IBP A;  2E7P A;  2X8H A;  4ECB A;  5G1K A;  1SVO A;  2DJ1 A;  4XIH A;  1EOH A;  1TP9 A;  13GS A;  4LMW A;  3QAV A;  1J9B A;  3VPQ A;  2HLS A;  3GKN A;  5ECR B;  4ECI A;  5GSS A;  4MJA A;  3LYP A;  2B7J A;  1VRS D;  2F8F A;  4KE3 A;  1A24 A;  3BCI A;  1S3D A;  3DRN A;  3FZ4 A;  4V2L A;  1U6T A;  2EIO A;  4ZB7 A;  4ML1 A;  4PUF C;  3M1G A;  1V40 A;  1B4P A;  2VAF A;  3EWL A;  4WR5 A;  2IMK A;  1K3O A;  2H73 A;  5F06 A;  3DEX A;  2H30 A;  1SYX A;  5IMC A;  1M99 A;  2I4A A;  1DE2 A;  3Q74 A;  3ZFL A;  2NPB A;  3GV1 A;  1M2A A;  1BJX A;  3GTU A;  2HZE B;  2C0F A;  3GNJ A;  2VIM A;  5J4Y A;  2YN1 A;  3G7Y A;  1PGT A;  3ZZX A;  2WS2 A;  3UOM A;  1PMT A;  3CSI A;  2FD3 A;  2P0G A;  4N10 A;  2YJ7 A;  1XW9 A;  4TXO A;  1FB6 A;  2GGT A;  1AC1 A;  4WBR D;  3TJJ A;  4JBB A;  3KCM A;  5COH A;  4J56 E;  2YP6 A;  5DJM A;  2PER A;  1Q98 A;  4MJC A;  2PUK C;  1EGO A;  2P5R A;  3ZRD A;  3EMP A;  2E0Q A;  3VK9 A;  2GSR A;  2JAD A;  3IC4 A;  1FW1 A;  2HI7 A;  2VCW A;  4WET A;  5FHI A;  3FR3 A;  2WGR A;  2CV4 A;  2L5O A;  3E0U A;  6GSW A;  2R5G A;  3TDG A;  1SJZ A;  1XVQ A;  5HFI A;  4BVX A;  2O85 A;  3O3T A;  4HEA 2;  2LV3 A;  3H8Q A;  2C0G A;  4ZBB A;  4LL1 B;  4OFT A;  2HRK B;  5KOX A;  4QMK A;  3W6G A;  4KX4 A;  3IK9 A;  1M9B A;  2F51 A;  2H6Z A;  4AKH A;  5A4W A;  2CAI A;  2OBK A;  4K2X A;  1K0O A;  5D9X A;  4Z2T A;  3APQ A;  1GSE A;  4IHU A;  1F37 A;  2E2M A;  3C1R A;  1B8X A;  3I9V 2;  4ECJ A;  3O6T A;  2PVQ A;  4MPF A;  3F6D A;  4I97 A;  2VD0 A;  1SD8 A;  3TU3 B;  2XHF A;  5BMU A;  1A8L A;  3RBT A;  2IFQ B;  2RM5 A;  3FHK A;  4ML6 A;  3R3E A;  4MJB A;  1DUG A;  2YPM A;  4OCF A;  4OD7 A;  3F63 A;  1J08 A;  4XTS A;  4I2U A;  1YDK A;  3TRX A;  2DJK A;  3LJR A;  1ERV A;  1Q4J A;  1XWB A;  1AAZ A;  1CQG A;  2DIY A;  1GLP A;  1ERU A;  1YEX A;  3JCM L;  2FA4 A;  2GSS A;  4ZB8 A;  3DML A;  2XPE A;  4K8M A;  2GQK A;  5C00 A;  4IN0 A;  3ZTL A;  2R3X A;  4G10 A;  1SYR A;  4HOJ A;  1K0B A;  1Z7R A;  4IP6 A;  3FR9 A;  3KMN A;  4ZL7 A;  2H0H A;  2JZT A;  4LA1 A;  5G5F A;  2DLX A;  2C4J A;  5IO0 A;  1K0D A;  4YAP A;  1TK0 B;  2KUC A;  4MH3 A;  4Z7X A;  4AKX B;  3LXT A;  1TOF A;  2DKH A;  3E3E A;  2QA1 A;  3GN3 A;  1W89 A;  2P5Q A;  3TKS A;  4D73 A;  3CTG A;  2B5E A;  1SKR B;  4TR1 A;  5G5E A;  2L6C A;  14GS A;  4BVY A;  4GWR A;  4X0X A;  1OVN A;  4EF0 A;  3L9S A;  4HUA A;  1R26 A;  1K3L A;  5CO3 A;  3MIX A;  3HVX A;  4NMU A;  4WF4 A;  1X9M B;  1EEM A;  3LW9 A;  2TIR A;  5D93 A;  4O5Q A;  2HT9 A;  4DSS B;  4OO4 A;  2V2G A;  1OKT A;  2VM2 A;  3E9J B;  4GDF A;  2YWI A;  2NVL A;  1TXU A;  2I81 A;  2JSZ A;  3EMX A;  4MH2 A;  4QL7 A;  1SVM A;  1XWG A;  1OAZ A;  1H4O A;  4EVM A;  2HSN A;  2LUS A;  3IAS 2;  3DWV A;  2FWF A;  4KSM A;  4E8H A;  6GSU A;  1S3A A;  3EE2 A;  1A2M A;  3MNG A;  3QFA C;  2GT6 A;  2K9F A;  3EC3 A;  4MZC A;  4XRA A;  1ZYP A;  4K7O A;  2MBS A;  3UL3 A;  1Z6M A;  1ILO A;  1ZYN A;  3ZFB A;  2LNT A;  1XWK A;  1BQ7 A;  5A4U A;  4Z2U A;  1A8Y A;  2F3M A;  3L4N A;  2VUP A;  5JWO B;  1K3Y A;  1A2L A;  2YNX A;  4IJ3 A;  4ZBD A;  3CBU A;  2A4V A;  4GRF A;  2C0D A;  3GKM A;  5FT3 A;  3CWG A;  3WGE A;  5CYY A;  4OFN A;  2YCD A;  3DD3 A;  2QKE A;  11GS A;  1A0R P;  2YWN A;  4CY8 A;  3WD6 A;  5D73 A;  2L4C A;  3GA4 A;  1WJK A;  5DCH A;  4FYC A;  1TI3 A;  1PN9 A;  1V58 A;  1XZO A;  4IEL A;  5AIV A;  1B9Y C;  2YAN A;  4KUN A;  3F0I A;  4XS4 A;  1GTU A;  2DIZ A;  2UV8 G;  2YZH A;  4WBJ A;  2JAC A;  5D8I A;  5KEJ A;  3I69 A;  1M7T A;  4IP1 A;  2A2R A;  2F9S A;  3A2V A;  1I5G A;  5ECQ B;  5ID2 B;  4PX1 A;  2J9H A;  5IQY A;  2DML A;  2LKU A;  3SWL A;  4PTS A;  4YKF A;  4FH8 A;  2CVK A;  2O87 A;  5B6N A;  3WGD A;  1ZOF A;  5EY6 A;  3C1S A;  3VUR A;  4HDE A;  2ZUP A;  3QR6 A;  4PGT A;  4MP4 A;  3U5R E;  1FOH A;  2OBI A;  5ELG A;  4IKH A;  4JZQ A;  3IV4 A;  3KGK A;  2EFD A;  1PN0 A;  2X8G A;  3ZML A;  1QFN A;  1U3I A;  1TRW A;  3HXS A;  3ZL5 A;  3HVS A;  4N0Z A;  4JU5 A;  1QXH A;  3F3R A;  3F6F A;  4HU7 A;  2K18 A;  1FO5 A;  1SK0 A;  3QCP A;  3F3Q A;  4X4J A;  19GS A;  2WCI A;  2DKI A;  2HNL A;  3IHG A;  2Z9S A;  2KLX A;  5CRW A;  1GH2 A;  5A1N A;  3KTL A;  1BG5 A;  4FO5 A;  4EL1 A;  4ULX A;  4GXZ A;  3N5O A;  2FY6 A;  5LD0 A;  3A5I A;  1F3B A;  2GT5 A;  4G0L A;  2MMA A;  4ZIL A;  1E6B A;  3UIW A;  4ISD A;  1T1V A;  4IJI A;  3MYD A;  4V1A g;  3IBH A;  1ACV A;  1JFU A;  5KN1 A;  5HR2 A;  4GF0 A;  2VOC A;  1U88 A;  1G7O A;  4EE0 A;  2DJ3 A;  1ERW A;  2H8L A;  1G6Y A;  3CRT A;  4LLR A;  3VI7 A;  2R2J A;  1WWJ A;  3HKR A;  1XOA A;  1WPI A;  1WRY A;  4K0G A;  2V32 A;  3QAG A;  2JL4 A;  3FMW A;  1THO A;  5F8B A;  3FRC A;  2JZR A;  5EVO A;  4V2M A;  2FWH A;  4NAX A;  1HNB A;  3RDW A;  1ZCP A;  3CSJ A;  1TRS A;  5DAL A;  1BX9 A;  2CVB A;  1SK2 A;  1SEN A;  3LYK A;  3HJO A;  3VLN A;  4NV5 A;  2H75 A;  1GUL A;  3HCZ A;  2PGT A;  5J4U A;  2N5A A;  18GS A;  4EDZ A;  4AGS A;  6GSX A;  3IHQ A;  2X49 A;  4AJ7 A;  1BG1 A;  4MZB A;  2HRF A;  5LNK e;  2X99 A;  1GRX A;  2R4V A;  2CX3 A;  4L0U A;  5G30 A;  5D9T A;  5B6M A;  1RK4 A;  4PUA A;  2RM6 A;  2GST A;  1DBY A;  2YZU A;  4OFM A;  1U3A A;  1V57 A;  1F9M A;  2EIR A;  5H5R A;  1WP0 A;  2IME A;  4EXJ A;  2HRA A;  17GS A;  3IR4 A;  3QOU A;  2H6Y A;  1GSQ A;  2NDO A;  2MZC A;  5GAN D;  4YH2 A;  3FZA A;  3NOF A;  1FB0 A;  1I9D A;  2X64 A;  3D6I A;  3AY8 A;  1OC3 A;  2C1Y A;  1HQO A;  4XS6 A;  1YZX A;  1FAA A;  4PQ1 A;  2H71 A;  2N5B A;  5BMU B;  4ZBA A;  2PWJ A;  4Q5N A;  16GS A;  2VL9 A;  4ZL9 A;  2LST A;  5JCG A;  1ZL9 A;  1XIY A;  4I8B A;  1X9S B;  1GUH A;  5JWR B;  2RUE A;  1T00 A;  5ENU A;  1BED A;  4GSN A;  3GHA A;  5BRT A;  4WR4 A;  2WUL A;  3P8W A;  2YWO A;  2OKA A;  3GUS A;  4EIQ A;  2A2S A;  1W4V A;  4MF6 A;  1BF5 A;  4I2T A;  1GWC A;  3TOU A;  5A5H A;  4AF2 A;  1HNC A;  2VLV A;  3G7J A;  2J23 A;  1X5C A;  2LRT A;  3M8N A;  4MJE A;  4ZXG A;  4HI7 A;  2EC4 A;  2JZS A;  2IPA A;  4L5O A;  1QQ2 A;  3KH9 A;  2WDU A;  2CT6 A;  4F9Z A;  2R0C A;  3HVV A;  1DSB A;  5CRE A;  4ACS A;  2VL2 C;  1FG4 A;  1MDI A;  3KM6 A;  2PU9 C;  4XRD A;  3PR8 A;  1LU4 A;  5DQY A;  2G2Q A;  4OO5 A;  1K0C A;  5DBQ A;  2H01 A;  1T3B A;  4WXT A;  3ERF A;  4TR1 B;  3TB2 A;  4BVY B;  4V2N A;  4MNN A;  1ZZY A;  4IS0 A;  1TTZ A;  4QL9 A;  3V1W A;  2HRN A;  1QMV A;  1EGR A;  4A5P A;  3WT2 A;  3ISO A;  1YJ6 A;  2OE1 A;  2HYX A;  3GX0 A;  1MTC A;  3HYP A;  3KP8 A;  5DAK A;  4NXI A;  1AW9 A;  1YKC A;  4OMV A;  3LFL A;  1TXX A;  5IMF A;  1NW2 A;  4K7I A;  1PRX A;  5D9W A;  3IAM 2;  2HZE A;  4GTU A;  2GSQ A;  3S9F A;  2GZP A;  1OKD A;  2A2P A;  1VF4 A;  3VWX A;  1PD2 1;  2E2G A;  1WE0 A;  3G7I A;  4GLT A;  2VD1 A;  1Z5Y E;  5E4W A;  2RII A;  5F0G A;  1SJ6 A;  5ECO B;  2AJQ B;  2NBS A;  1N8J A;  4CW9 A;  3GST A;  1AXD A;  3MAK A;  2H1L A;  1EZK A;  1WOU A;  4O92 A;  1KEB A;  1TKD B;  3IDV A;  6GST A;  3DXB A;  4J57 E;  3UVH A;  3M3M A;  1UN2 A;  4YKG A;  4KDY A;  3SBC A;  2B6M A;  2AAW A;  3QDN A;  4G01 A;  3VPT A;  2L59 A;  2JSY A;  4F82 A;  4KB3 A;  5ECM B;  3A2W A;  2AHE A;  4KGI A;  1TRV A;  4J2F A;  3K8N A;  1Y6E A;  2HSM A;  1ZMA A;  2FHE A;  4W66 A;  1A23 A;  1O7U A;  4K6X A;  4N11 A;  3UAR A;  3CRU A;  2AB6 A;  1S3C A;  3MWH A;  3TRP A;  3ERG A;  2HRK A;  1YF1 A;  5ECI B;  3ZRE A;  4TXV A;  2XC2 A;  1GSY A;  3HJP A;  1G7E A;  2DJ2 A;  2WJU A;  3G9B A;  3CSH A;  5IM9 A;  4CDO A;  4ZB9 A;  1TDI A;  2LJR A;  4ZB6 A;  2QSI A;  3GYK A;  3UEM A;  4NPB A;  4KDX A;  1TK8 B;  1K0N A;  1T4Z A;  3TUE A;  4MA9 A;  3VWV A;  5G31 A;  2JU5 A;  1ON4 A;  2G0F A;  4HZ4 A;  3A3T A;  4XS4 B;  4MPG A;  2FNO A;  2FCH A;  1LJR A;  4GST A;  5DVB A;  3VWW A;  3EUR A;  1XPV A;  4F0C A;  4G9H A;  4G0I A;  3ZYW A;  2NTO A;  2IFQ A;  4JR6 A;  1OYJ A;  4E68 A;  5DDL A;  5CP1 A;  3VI5 A;  2X4A A;  5J9B A;  6GSY A;  4KSO A;  3KEB A;  3TKS C;  1GSU A;  5J47 A;  3WYW A;  4RQR A;  4K9Z A;  4BPY A;  3DGQ A;  3GH6 A;  3HA9 A;  3IXR A;  2CZ2 A;  2LS5 A;  2QA2 A;  1TI1 A;  3RHC A;  1YF0 A;  2K6V A;  2OE0 A;  5INY A;  3APS A;  8GSS A;  2YV7 A;  5ECL B;  1PA3 A;  1SL1 B;  2TRC P;  4G19 A;  1XFL A;  1T8E B;  1FHE A;  5AGY A;  2IN3 A;  5IIZ A;  2PVO C;  2EFC A;  3BJ5 A;  2H1A A;  5J5N A;  2VKZ G;  3LOR A;  1JZD A;  2EFH A;  3MDK A;  3QAW A;  2R6K A;  5A1N B;  2V1M A;  5CAX A;  3D0Z A;  1ABA A;  3DIE A;  3DVX A;  5CNW A;  2V6K A;  1GUK A;  5IPG A;  4QQ7 A;  3UAP A;  3MSZ A;  4PNF A;  4F0B A;  1F3A A;  2DC5 A;  2V6O A;  3C73 A;  4KH7 A;  3LGC A;  1IYI A;  3GRX A;  1SKS B;  4POL A;  4IVF A;  5A34 B;  2PBJ A;  3QD9 A;  3F9U A;  3D22 A;  2OJL A;  3ZIV A;  4USS A;  5IPH A;  2H1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...