3HJMA

Crystal structure of human glutathione transferase pi y108v mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hjmA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hjmA01
1XW5A 4DSSA 5KN1A 1ERWA 3ZFLA 1S3AA 2IMFA 2YV9A 16GSA 4MJCA 3LXTA 4JR6A 4TXOA 3ZLPA 3VPQA 3ZVJD 5IPGA 2WRTA 2YP6A 4HJMA 4HOJA 3LG6A 5ECIB 3ISOA 11GSA 5J9BA 2VCVA 2AUVA 1KEBA 1FB0A 6GSYA 5GAPD 2R5GA 1K0CA 2TIRA 4JE1A 5INYA 3E3EA 1BX9A 2DJJA 3CTGA 1WIKA 3GURA 1NHYA 1XPVA 2VM2A 3J7Yb 1VF1A 1AUCA 5B7CA 3I69A 1Y25A 4WEYA 1SJIA 3LGCA 2HZEA 2FGXA 5HFIA 1QXHA 5EVOA 2P0GA 3TKSC 1OC9A 4QL7A 1A0FA 4FYBA 4J57E 2WULA 1HYUA 4Q5NA 1T4YA 1Z9HA 4GSSA 1SKSB 4BVYB 1TU7A 2V1MA 1PKZA 1F37A 1SL1B 2H6YA 4Q5RA 2C3NA 4BA7A 5A5KA 2AHEA 1HD2A 2OE0A 4G19A 3HA9A 2LRTA 2HNLA 2IN3A 2GZYA 3LFLA 2L6DA 4WR5A 2QGVA 1ERTA 3MAKA 1O73A 1XVQA 3TRQA 2K18A 4K7OA 4XS6A 4GLTA 1KBNA 1B4QA 5DCHA 1MEKA 1OE7A 2H0GA 1A8YA 4N30A 1SK2A 2DBCA 4ZBBA 2DJ0A 4MPFA 4BL7A 1A24A 2EIQA 4PXOA 4N0VA 3J7Yk 4IJIA 2HI7A 3D4MA 4WF4A 3BJ5A 4KCEA 3TJJA 1IYHA 1AQWA 4RUVA 1OKTA 4OO4A 1IYIA 3LQ7A 5ABRA 6GSVA 2VLUA 1GH2A 2AYTA 1GTBA 4FYUA 1ZOFA 5ENUA 3IPZA 2P5QA 1VF2A 2GS3A 3ZIVA 2VD0A 3QR6A 4IS0A 2B5YA 1YDKA 2IFQA 4JEDA 4AJ6A 4ECCA 2EIOA 2XBIA 4CW9A 5HR3A 1R5PA 2GLRA 1XVWA 5KN0A 1QK8A 1PMTA 3ZYWA 1G6YA 4KDXA 2HRNA 3GRXA 1V2AA 2IMDA 2GT6A 4LLRA 4G9HA 4LL1B 4MZCA 1SL0B 3IRAA 2RUEA 3UBKA 2X64A 3ME8A 3TB2A 4L8EA 1TK0B 4DSQA 5IM9A 2TRCP 2L6CA 2L4QA 3DIEA 2F8AA 4WF5A 3DVWA 3GN3A 2CVBA 5B6MA 5D9XA 3GSTA 2WFCA 2NDOA 2G2QA 1R7HA 5IMVA 4GSNA 2H0HA 5COHA 1PX7A 1EOHA 2I81A 1LJRA 1K0AA 2N5AA 3KTLA 3FHKA 4L5LA 2ZCTA 1XW6A 5LD0A 2QKEA 2ES7A 2N5FA 4MMMA 5BMUA 3WT1A 2PN8A 1GSSA 5IPHA 5ELGA 2GGTA 2CVKA 5JCWA 3A2XA 3GMFA 5IMZA 4IP6A 3ZVJA 3CSHA 2KHPA 4K1FA 2PUKC 1O8WA 5ECPB 5JCGA 4F03A 4OCFA 2CVDA 3UAPA 2HZFA 3LJRA 1WOUA 5D8IA 3HHVA 5DJMA 4K8MA 1FHEA 3VFIA 3UBLA 3QDNA 3KD0A 1W89A 4YQUA 1MD4A 1JFUA 3ZMKA 3L9SA 4IP1A 1PGTA 3CSIA 1Z5YE 3GV1A 5DALA 1GSFA 3QMXA 2LNSA 4IGJA 2JZSA 3PINA 1KTEA 2EIRA 4TVEA 4GCIA 1EV9A 4IJ3A 5ECOB 3FZ4A 1M2DA 1SK1A 2RM6A 1S3DA 1GRXA 4NWYA 4MDCA 1XWCA 2LQOA 4MJBA 1PSQA 1XIYA 6GSSA 1UN2A 4WKWA 4PX1A 3QOUA 2C8UA 3KP8A 1TOFA 3TKSA 2MMOA 1CQGA 3L4NA 5F05A 5IO0A 2IWTA 2VCQA 1BEDA 1GSEA 2HT9A 3M9KA 2NTOA 4LL4B 1O7UA 2FUG2 4D73B 1J08A 5G31A 1OVNA 5KEJA 5CO3A 1JZRA 3HY2A 3KCMA 1TKDB 3M1GA 4TR1A 3R2QA 2CAIA 1N8JA 1JLWA 3KGKA 1NSWA 4WXTA 4GXZA 4KCAA 4HJ2A 1YZXA 3G7IA 5IQYA 1U87A 1SJZA 4MF5A 1XWGA 2R3XA 2JADA 3Q6OA 5JCUA 2HYXA 1BJXA 4LMWA 2O85A 2HRKA 5IOWA 1ABAA 6GSXA 1HNAA 3IC4A 1ZL9A 2PPTA 1B48A 1AXDA 1WMJA 3C1RA 1ACVA 2YZHA 1DE2A 1Y6EA 2CT6A 1VRSD 4MJAA 4I97A 4MZWA 5FWGA 2LEGA 2OA7A 2A4VA 8GSSA 5IMDA 2HSMA 3HKRA 14GSA 1G7OA 2CX4A 2VCTA 5CREA 3CBUA 2K8SA 1GNWA 2H76A 2B7KA 3O3TA 1XW9A 2F51A 2X8CA 2X99A 2LV3A 4GSTA 3TDGA 1FB6A 2P5RA 4KH7A 2C3TA 1V58A 3DYRA 3L9UA 2H71A 2H74A 1ZYQB 2HSYA 2VUPA 4OWYA 4MK3A 5E4WA 2EC4A 5EPFA 2GSSA 10GSA 2IMKA 2YWOA 3CRUA 1AAZA 5F06A 5DAKA 3IXRA 2AAWA 5KN2A 1O6JA 6GSUA 6GSWA 5D96A 3FZ5A 13GSA 2R2JA 1ERVA 2C3QA 5GSTA 3W8SA 1BG5A 3I9V2 1T00A 3GKKA 3WD6A 4RQXA 2L5LA 1AIUA 1N2AA 3QD9A 3IE3A 4PQIA 1FVKA 3F6DA 3GL5A 3IDVA 2GSQA 2H30A 4K7IA 4MZBA 2JL4A 1SJ6A 4BWSA 4MLYA 1M9AA 2IJYA 1ST9A 1YY7A 1J0FA 1A0RP 3GIXA 4J2FA 3I6AA 4K9ZA 5CP1A 2VO4A 1TI1A 1EWXA 5J4UA 5D9TA 3E0UA 4KGIA 4NHZA 2GTUA 2VL2C 4PNGA 2GSRA 5A4WA 3EURA 4KB3A 2WCIA 4DSSB 4L0UA 2YV7A 4EVMA 2XPEA 3UL3A 4TR3A 2NPBA 4CHSA 4TXOB 3TKPA 1YKCA 1XWKA 2F9SA 3A5WA 1RW1A 2KP1A 1T1VA 3R3EA 1B4PA 3FEUA 2V6KA 4NV2A 2L57A 5B8AA 1ERUA 4PQ1A 5G30A 3VPTA 1XOBA 3NZNA 2NVLA 3GKNA 2CZ2A 4ML6A 4OCEA 4V2NA 2B7JA 2JZRA 3A3TA 1LU4A 1YEPA 1T3BA 4EKZA 2QSIA 1A2JA 5L71A 3TJGA 4PNFA 2B1LA 3IC8A 1EP8A 1SL2B 1OC3A 3GKMA 1U3AA 3GHAA 3QAVA 2LS5A 1TK5B 1ZCPA 4N11A 4HU9A 1G0TA 3IK7A 1TK8B 3GTUB 1ZMAA 3ERFA 4WBRD 2M72A 2HZEB 4IW9A 3OR5A 1DBYA 3L0HA 1OC9B 1FVJA 2YWNA 5GZZB 2WS2A 2DSAA 4XCSA 3IAM2 3E9JB 1URMA 3VWUA 4GF0A 1M0UA 3TRXA 3IA1A 3LSZA 1RK4A 3HD5A 2XC2A 3VWWA 1ML6A 1AW9A 5AISA 4K7NA 3F4RA 3SWLA 3RHCA 3EU4A 3PPUA 3FR9A 2VLTA 2GT5A 1Q98A 4EUYA 1OE8A 5J5NA 2MMNA 3EWLA 4PUAA 3U5RE 3WGXA 3KTBA 1M9BA 4IELA 2LTKA 4G2EA 2JSYA 3US3A 2LSTA 2WJUA 3KP9A 3TJFA 3FW2A 4OFNA 1V98A 4ZB8A 3ED3A 1MDKA 4BL7B 3Q18A 3F4TA 1H4OA 4HS1A 4XS1A 5IO2A 2G0FA 2KOKA 1THXA 4I5QA 3HVSA 2C1YA 1UVZA 3CSJA 5HFKA 2B3SA 4OFMA 1ON4A 1F2EA 1XXUA 2XHFA 3F9UA 4HDEA 3WGEA 1GL8A 1GUKA 4G0LA 2OBIA 3MSZA 3EMPA 4YAVA 5CYYA 5D73A 1QUWA 2GDRA 3LYPA 3FY7A 3D5JA 1MDJA 4BVXA 3H93A 3KMNA 4QL9A 5G5EA 2DIYA 4WETA 5B8BA 2H1DA 4FIWA 4K0GA 2IIYA 4POMA 2CA8A 2YCDA 1GTAA 4HZ2A 4V1Ap 4V2LA 2R4VA 4TXVA 4HQZA 2LJKA 5F07A 2B6MA 3UVHA 3HZ4A 4PTSA 3HCZA 2PU9C 1FG4A 1XWBA 4GRFA 4IN0A 1T7PB 1YQ1A 3L9VA 5DVBA 1BAYA 2OJLA 4ZL8A 2VCWA 3EE2A 2VLVA 1O85A 2V32A 3KMOA 2ALBA 1GP1A 2WB9A 5HR1A 2QC7A 4OMVA 2FWGA 2ZUPA 1A2LA 4NAXA 4JRRA 3A2VA 4EL1A 3GH9A 1XWAA 2VD1A 5G1LA 1TDIA 3GUSA 3RDWA 5E59A 5DCGA 2FNOA 2TRXA 3G7YA 1A2MA 2IMIA 1JZOA 1FW1A 1M2AA 2HXKA 4PQHA 1TJDA 1GSUA 2FWEA 3ERGA 1QMVA 2JACA 1SU9A 2C0GA 2F3MA 2VCZA 2VL2A 1B9YC 1B9XC 4O5RA 4MF6A 5ECNB 4XS4A 3ZL5A 3V1WA 5D9WA 2VM1A 1K3OA 4HU7A 2V2GA 1WJKA 2H72A 2MBTA 1Z6NA 3D22A 2DJ2A 3WYWA 3FR3A 2E7PA 2LJAA 5F8BA 3LWAA 2LNTA 4E8HA 2OE1A 4PGTA 1X5CA 3FR6A 5HQPA 1ILOA 1AQXA 1BQ7A 4POKA 3ERWA 2O7KA 2VL9A 4EDZA 2HRAA 4JBBA 1ZZYA 5DJLA 1PX6A 2VL3A 5DALB 1U88A 3A2WA 1K0BA 5G1KA 2I4AA 4KW6A 3IBHA 4TW5A 4ZXGA 1EGOA 3G7JA 2OE3A 3QFBC 2DMMA 3HVXA 4X0XA 1U6TA 2H66A 3TJKA 2O89A 1X5EA 2JU5A 3F3QA 3JCML 3DD3A 5IIZA 4ZL7A 5B6NA 3GX0A 1K0NA 2R6KA 3QPMA 1X5DA 1EGRA 3CMIA 1PL2A 2H0IA 2NBSA 3P8WA 5H5RA 1PN9A 3KZQA 1DUGA 3GL3A 3GFKA 2AB6A 2WZ9A 6GSTA 2YOIA 1I9DA 1K0DA 3HJPA 3APSA 3GA4A 4POBA 1TW9A 2VAFA 2C0FA 1EOGA 2FWFA 2LUSA 1K3YA 3C7MA 3ME7A 3TKSE 5IOXA 2MZCA 2GZZA 1VGLA 2IL3A 4HI7A 4TR1B 3FZ9A 1XBSA 5HR0A 1YEXA 5CRGA 1YF1A 1M7TA 2Z9SA 2O87A 1UC7A 3IAS2 1DSBA 3F3RA 5G5FA 2HLSA 1SK0A 4ILFA 5EL8A 3FRCA 4WBJA 4EO3A 4AJ7A 3ZFBA 4N0ZA 4MP4A 2GQLA 2B5XA 3HYPA 5DQYA 4I8BA 3FKFA 2HRKB 3D6IA 4BPYA 1GNEA 5JWRB 4RQRA 2IPAA 2LJRA 3L78A 5FHIA 2M80A 3P2AA 3NIVA 1G6WA 22GSA 1JZWA 2HSMB 2K8VA 4DEJA 3GSSA 3TOUA 4J56E 3N9JA 1TI3A 3VWXA 3D0ZA 4PUFC 3PGTA 5FT3A 4E8EA 1SKWB 4O7HA 3ZIJA 1G7EA 3H8QA 3W6GA 4ZL9A 2CZ3A 4OD7A 4F0BA 2PERA 1O81A 2MMZA 3UARA 3UJ1A 2JSZA 1HQOA 1GTIA 3TOTA 2X8GA 2WDUA 3KH9A 3KIJA 4V2MA 2BMXA 3M0FA 3P7XA 2MMAA 4LA1A 1FO5A 1XZOA 5CRWA 5D93A 4FH8A 3CTFA 1EZKA 4NHWA 2RUFA 5CAXA 1F9MA 2DC5A 2K6VA 3LEFA 1EP7A 2ON5A 3H1NA 1X9MB 3HJOA 4CDOA 4TKYA 2IMEA 2F8FA 1U3IA 4KE3A 2KUCA 3PR8A 2H70A 5D9VA 4FO5A 4MA9A 4GTUA 3IV4A 1YF0A 4G0KA 4XHMA 2VIMA 4MABA 5ELAA 2AV4A 5ID2A 2VOCA 4DVCA 1TU8A 1USBA 1YJ6A 1K0OA 1E6BA 2FA4A 2I1UA 4OO5A 1F3AA 3LXZA 2YWMA 4PURA 3VI7A 3VURA 3FYGA 5ECKB 20GSA 3GH6A 3FZAA 3HVVA 1WP0A 2KP2A 3EMXA 2FY6A 5AN1A 3RBTA 3HXSA 3IHQA 4MJEA 1M2BA 3O6TA 4KUNA 3BOAA 4MF7A 2JZTA 2LRNA 2H1AA 4KX4A 3MDKA 1Z7PA 4HEA2 1I5GA 4P3YB 1QQ2A 4ACSA 4F2IA 3D21A 1SD8A 4KNDA 4K6XA 3DMLA 5J3RA 4OFTA 1MTCA 1R26A 4RI7A 4AGSA 3EC3A 5ECSA 3M9JA 5GSSA 3ZREA 1F3BA 1GSQA 5ECQB 3PH9A 2YN1A 5ECRB 2O8VB 2CV4A 2DJ1A 1O8XA 1LBKA 5HFGA 5IMCA 3F0IA 2DJ3A 2XBQA 5G2ZA 3EVIA 3GTUA 2PVQA 3MWHA 2CQ9A 1XCCA 1GSYA 1PD21 5GAND 4BVYA 4GQFA 5DDLA 2OKAA 4MH3A 2P31A 5KN3A 1SYXA 3KXOA 2M46A 4G0IA 3CRTA 4F82A 1EV4A 3ZRDA 3RPPA 2GQMA 2HSHA 4KF9A 3DKSA 2FHEA 2RM5A 3M3MA 4ECBA 2FA8A 5IMFA 3ZZXA 2FWHA 4K2DA 1V9WA 5JWOB 3QAGA 1RQMA 1Z6MA 4IQAA 2B1KA 1GLQA 2N5BA 3C8EA 1GTUA 4G10A 2HFDA 3EINA 4EF0A 3DVXA 3ZITA 3WT2A 4POLA 4ISDA 17GSA 1EEMA 2YJHA 3TRPA 3F4SA 5ECLB 5LNKe 4HUAA 2AJQB 2C0EA 3SBCA 3TCOA 3GYKA 4NMUA 3APOA 3ZTLA 3TKQA 3KH7A 1Z3EA 5F0GA 3H4KA 5C00A 1E2YA 5CRHA 4ML1A 3QAWA 2LKUA 3DRNA 4TN8A 3VI5A 2IFQB 5LCZA 3DWVA 4XIHA 1GWCA 2H6XA 4ECJA 1HNBA 4BVXB 3IR4A 1C72A 1XFLA 3ZMLA 5ECHB 3KM6A 1FAAA 1KNGA 3MNGA 1S3CA 2PBJA 2GSTA 1TRWA 3F6FA 12GSA 1K0MA 4YH2A 1JHBA 5CNWA 2FLSA 4AF2A 2KLXA 1B8XA 3HZ8A 1OKDA 4HZ4A 1SKRB 4TR4A 3EU3A 1A23A 1GLPA 4XTSA 4WR4A 1PQNA 1T8EB 1JLVA 3TGZA 1TP9A 2V41A 3GNJA 3TJBA 4DSRA 1J9BA 3NOFA 4RI6A 4X43A 3KJYA 1V57A 3GX8A 3C1SA 2LRCA 2R37A 1XOAA 2H6ZA 3W8JA 18GSA 4FYCA 4MCUA 1DE1A 3RPNA 4USSA 4GWRA 1R5AA 1HNCA 1YKAA 4JU5A 4L0WA 1ZGNA 3M8NA 4FQUA 2L5OA 3CYNA 3IK9A 4MPGA 3LORA 1PL1A 3O76A 2PMTA 3F63A 5A4VA 2YJ7A 2C0DA 4ZBAA 4BWQA 5AGYA 1K3LA 2E2GA 3UVTA 2E2MA 4KAEA 4ZB6A 1H75A 2J9HA 2VCXA 2YNXA 1TXXA 4YAPA 4XS4B 5ECMB 4JZQA 4EXJA 2OBKA 5H5SA 5J41A 4XRDA 4V1Ag 1UA5A 2WGRA 2MYGA 4TRXA 1QGVA 1JZDA 4YQMA 4EC0A 3BBYA 1Q4JA 1WWJA 2RIIA 2A2RA 4ULXA 2HRFA 2L59A 4IHUA 3HJMA 1Z7RA 3I43A 1THOA 1AC1A 2HSNB 4JR4A 2YWIA 4F9ZA 3HDCA 4IQ1A 1R4WA 4ZBDA 4EE0A 1PKWA 1V40A 4TOPA 2L4CA 2OADA 2DLXA 3TUEA 2DMLA 1SENA 1CQHA 4KDYA 2HQTA 9GSSA 2H19A 3TKRA 3H79A 1MDIA 1WE0A 3DEXA 3P90A 1GSDA 2HE3A 2PWJA 3C73A 1SD9A 1SYRA 3S9FA 3Q74A 2C80A 2H8LA 1OC8A 3WGDA 1QFNA 3UOMA 4NPBA 2ZNMA 3VWVA 2LQQA 2X8HA 4D73A 4ZIJA 4LMVA 2GZPA 4IKHA 2MBSA 3LYKA 4IBPA 2H01A 1ZYEA 4TR0A 4HQSA 2J23A 1VF4A 3KEBA 1PA3A 1W4VA 3BCKA 4ZB9A 1TRVA 4I2TA 1OAZA 4ID0A 5CRDA 1AQVA 2H75A 2BTOT 3UMAA 4QQ7A 1BYEA 2H1GA 4NXIA 4F0CA 1X9WB 4H86A 5DQSA 4KSOA 2C4JA 1NM3A 2GVPA 2REMA 4Z7XA 3Q19A 3CXGA 2K9FA 4IVFA 3F8UA 3GKXA 3D4TA 1NHOA 4GQCA 2XPDA 3IOSA 3QFAC 1TRUA 4NV5A 5HR2A 3DGQA 2V6OA 5EY6A 1TTZA 4I6XA 3BCIA 2CX3A 5C04A 4X1UA 2YZUA 3VLNA 2D2ZA 2FCHA 4XRAA 4O92A 4YQVA 4I2UA 4L5OA 3APQA 4KSMA 1GUHA 5DAKB 1MD3A 5A4UA 4EDYA 3RAZA 4KDUA 2UZ8A 2RLIA 4AJ8A 3DXBA 3RHBA 2PGTA 3UIWA 2H1BA 5H5QA 5IMAA 2PVOC 5DBQA 5JWQB 4K0NA 1NW2A 2I3YA 1X9SB 1TRSA 4ZILA 3C71A 1GULA 1WRYA 1OYJA 2ON7A 3FK8A 1GUMA 1X0RA 4MH2A 1EEJA 3K8NA 2H73A 2OACA 3BD2A 1M99A 5J9CA 19GSA 2DJKA 4O32A 4KA0A 2YPMA 1T4ZA 2DIZA 1WPIA 4ECIA 3EYTA 3N5OA 3UEMA 2A2SA 3U6VA 2GQKA 3QCPA 2BJXA 5ID2B 5AIVA 3AY8A 2I9HA 2YANA 2E0QA 1FOVA 3G9BA 1PRXA 2CAQA 5AIXA 7GSSA 4N10A 1F6MC 2B5EA 2FD3A 4Q5QA 4Q5FA 1VF3A 1A8LA 3VK9A
chains in the Genus database with same CATH superfamily
1XW5A 4DSSA 5KN1A 1ERWA 3ZFLA 1S3AA 2IMFA 2YV9A 16GSA 4MJCA 3LXTA 4JR6A 4TXOA 3ZLPA 3VPQA 3ZVJD 5IPGA 2WRTA 2YP6A 4HJMA 4HOJA 3LG6A 5ECIB 3ISOA 11GSA 5J9BA 2VCVA 2AUVA 1KEBA 3HMJG 1FB0A 6GSYA 5GAPD 2R5GA 1K0CA 2A2PA 2TIRA 4JE1A 5INYA 3E3EA 1BX9A 2DJJA 3CTGA 1WIKA 3GURA 1NHYA 1XPVA 2VM2A 3J7Yb 1VF1A 1AUCA 5B7CA 3I69A 1Y25A 4WEYA 1SJIA 3LGCA 2HZEA 2FGXA 5HFIA 1QXHA 5EVOA 2P0GA 3TKSC 1OC9A 4QL7A 1A0FA 4FYBA 4J57E 2WULA 1HYUA 4Q5NA 1T4YA 1Z9HA 3MYDA 4GSSA 1SKSB 4BVYB 1TU7A 2V1MA 1PKZA 1F37A 1SL1B 2H6YA 4Q5RA 2C3NA 4BA7A 5A5KA 2AHEA 1HD2A 1ZYPA 2OE0A 4G19A 3HA9A 2LRTA 2HNLA 2IN3A 2GZYA 3LFLA 2L6DA 4WR5A 2QGVA 1ERTA 3MAKA 1O73A 1XVQA 3TRQA 2K18A 4K7OA 4XS6A 4GLTA 1KBNA 1B4QA 5DCHA 1MEKA 1OE7A 2H0GA 1A8YA 4N30A 1SK2A 2DBCA 4ZBBA 3LW9A 2DJ0A 4MPFA 4BL7A 1A24A 2EIQA 4PXOA 4N0VA 3J7Yk 4IJIA 2HI7A 3D4MA 4WF4A 3BJ5A 4KCEA 3TJJA 1IYHA 1AQWA 4RUVA 1OKTA 4OO4A 1IYIA 3LQ7A 5ABRA 6GSVA 2VLUA 1GH2A 2AYTA 1GTBA 4FYUA 1ZOFA 5ENUA 3IPZA 2P5QA 1VF2A 2GS3A 3ZIVA 2VD0A 3QR6A 4IS0A 2B5YA 1YDKA 2IFQA 4JEDA 4AJ6A 2VKZG 4X4JA 4ECCA 2EIOA 2XBIA 4CW9A 5HR3A 1R5PA 2GLRA 5A34B 1XVWA 5KN0A 4Z2TA 1QK8A 1PMTA 5A1NA 3ZYWA 1G6YA 4KDXA 2HRNA 3GRXA 1V2AA 2IMDA 2GT6A 4LLRA 4G9HA 4LL1B 4MZCA 1SL0B 3IRAA 2RUEA 3UBKA 2X64A 3ME8A 3TB2A 4L8EA 1TK0B 4DSQA 5IM9A 2TRCP 2L6CA 2L4QA 3DIEA 2F8AA 4WF5A 4K5SA 3DVWA 3GN3A 2CVBA 5B6MA 5D9XA 3GSTA 2WFCA 2NDOA 2G2QA 1R7HA 5IMVA 4EIPA 4GSNA 2H0HA 5COHA 1PX7A 1EOHA 2I81A 1LJRA 2OT3A 1K0AA 2DKIA 2N5AA 2WVXA 3KTLA 3FHKA 4L5LA 2ZCTA 1XW6A 5LD0A 2QKEA 2ES7A 2N5FA 4MMMA 5BMUA 3WT1A 2PN8A 1GSSA 5IPHA 5ELGA 2GGTA 2CVKA 5JCWA 3A2XA 3GMFA 5IMZA 4IP6A 3ZVJA 3CSHA 2KHPA 4K1FA 4W66A 2PUKC 1O8WA 5ECPB 5JCGA 4F03A 4OCFA 2CVDA 3UAPA 2HZFA 3LJRA 1WOUA 5D8IA 4AKHA 3HHVA 5DJMA 4K8MA 1FHEA 3VFIA 3UBLA 3QDNA 3KD0A 1W89A 1FOHA 4YQUA 4CY6A 1MD4A 4Z2UA 1JFUA 3ZMKA 3L9SA 4IP1A 1PGTA 3CSIA 1Z5YE 3GV1A 5DALA 1S4BP 2HSNA 3RGBC 1GSFA 3QMXA 2LNSA 4IGJA 4QMKA 2JZSA 3PINA 1KTEA 2EIRA 4TVEA 4GCIA 1EV9A 4IJ3A 5ECOB 5J4VA 3FZ4A 1M2DA 1SK1A 2RM6A 1S3DA 1GRXA 4NWYA 4MDCA 1XWCA 2LQOA 4MJBA 1PSQA 2WW3A 1XIYA 6GSSA 1UN2A 4WKWA 4PX1A 3QOUA 3CQFA 2C8UA 3KP8A 1TOFA 3TKSA 2MMOA 1CQGA 3L4NA 5F05A 5IO0A 2IWTA 2VCQA 1BEDA 1GSEA 2HT9A 3M9KA 2NTOA 4LL4B 1O7UA 2FUG2 4D73B 1J08A 5G31A 1OVNA 5KEJA 5CO3A 1JZRA 5J40A 3HY2A 3KCMA 1TKDB 3M1GA 4TR1A 3R2QA 2CAIA 1N8JA 1JLWA 3KGKA 1NSWA 4WXTA 4GXZA 4KCAA 4HJ2A 1YZXA 3G7IA 1M3IA 5IQYA 1U87A 1SJZA 4MF5A 1XWGA 2R3XA 2JADA 3Q6OA 5JCUA 1I1IP 2HYXA 2R0CA 1BJXA 4LMWA 2O85A 2HRKA 5IOWA 1ABAA 2WW2A 6GSXA 1HNAA 3IC4A 1ZL9A 2PPTA 1B48A 1AXDA 1WMJA 5KOXA 3C1RA 1ACVA 2YZHA 1DE2A 1Y6EA 2CT6A 1VRSD 4MJAA 4I97A 4MZWA 5FWGA 2LEGA 5J47A 2OA7A 2A4VA 8GSSA 5IMDA 2HSMA 3HKRA 14GSA 1G7OA 2CX4A 2VCTA 5CREA 3CBUA 2K8SA 1GNWA 2H76A 2B7KA 3O3TA 1XW9A 2X8CA 3CHXC 2F51A 2X99A 2LV3A 4GSTA 3TDGA 1FB6A 2P5RA 4KH7A 2C3TA 1V58A 3DYRA 3L9UA 2H71A 2H74A 1ZYQB 2HSYA 2VUPA 4OWYA 4MK3A 5E4WA 2EC4A 5EPFA 2GSSA 10GSA 2IMKA 2YWOA 3CRUA 1AAZA 5F06A 5DAKA 3IXRA 2AAWA 5KN2A 1O6JA 6GSUA 6GSWA 5D96A 3FZ5A 13GSA 2R2JA 1ERVA 1YVLA 2C3QA 5GSTA 3W8SA 1BG5A 2X4AA 3I9V2 1T00A 3GKKA 3WD6A 4RQXA 2L5LA 1AIUA 1N2AA 3QD9A 3IE3A 4EIQA 4PQIA 1FVKA 3F6DA 3GL5A 3IDVA 2GSQA 2H30A 4K7IA 4MZBA 2JL4A 1SJ6A 4BWSA 4MLYA 1M9AA 2IJYA 1ST9A 1YY7A 1J0FA 1A0RP 3GIXA 5A5HB 2O5VA 4J2FA 3I6AA 4K9ZA 5CP1A 2VO4A 1TI1A 1EWXA 5J4UA 5D9TA 3E0UA 4KGIA 4NHZA 2GTUA 2EFDA 2VL2C 4PNGA 2GSRA 5A4WA 3EURA 4KB3A 2WCIA 4DSSB 4L0UA 2YV7A 4EVMA 2XPEA 3UL3A 4TR3A 2NPBA 4CHSA 4TXOB 3TKPA 1YKCA 1XWKA 1SVMA 2F9SA 3A5WA 1RW1A 2KP1A 1T1VA 3R3EA 1B4PA 3FEUA 2V6KA 4NV2A 2L57A 5B8AA 1ERUA 4PQ1A 5G30A 3VPTA 1XOBA 3NZNA 2NVLA 3GKNA 2CZ2A 4ML6A 4OCEA 4AI6A 4V2NA 2B7JA 2JZRA 3A3TA 1LU4A 1YEPA 1T3BA 4EKZA 2QSIA 1A2JA 5L71A 3TJGA 4PNFA 2B1LA 3IC8A 1EP8A 1SL2B 1OC3A 3GKMA 1U3AA 3GHAA 3QAVA 2LS5A 1TK5B 1ZCPA 4N11A 2WVZA 4HU9A 1G0TA 3IK7A 1TK8B 3GTUB 1ZMAA 3ERFA 4WBRD 2M72A 2HZEB 4IW9A 3OR5A 1DBYA 3L0HA 1OC9B 1FVJA 2YWNA 5GZZB 2WS2A 2DSAA 4XCSA 3IAM2 4AKIA 3E9JB 1URMA 3VWUA 4GF0A 1M0UA 3TRXA 3IA1A 3LSZA 1RK4A 3HD5A 2EFEA 2XC2A 3VWWA 1ML6A 1AW9A 5AISA 4K7NA 3F4RA 3SWLA 3RHCA 3EU4A 3PPUA 3FR9A 2VLTA 2GT5A 1Q98A 4EUYA 1OE8A 5J5NA 2MMNA 3EWLA 4PUAA 3U5RE 3WGXA 3KTBA 1M9BA 4IELA 2LTKA 4G2EA 2JSYA 3US3A 2LSTA 2WJUA 3KP9A 3TJFA 3FW2A 4OFNA 4Z2RA 1V98A 4ZB8A 3ED3A 1MDKA 4BL7B 3Q18A 3F4TA 1H4OA 4HS1A 4XS1A 5IO2A 2G0FA 2KOKA 1THXA 4I5QA 3HVSA 2C1YA 1UVZA 3CSJA 5HFKA 2B3SA 4OFMA 1ON4A 1F2EA 1XXUA 2XHFA 3F9UA 1TXUA 4HDEA 3WGEA 1GL8A 1GUKA 4G0LA 2OBIA 3MSZA 3EMPA 4YAVA 5CYYA 5D73A 1QUWA 2GDRA 3LYPA 3FY7A 3D5JA 1MDJA 4BVXA 3H93A 3KMNA 4QL9A 5G5EA 2DIYA 4WETA 5B8BA 2H1DA 4FIWA 5A1NB 4K0GA 2IIYA 4POMA 2CA8A 2YCDA 1GTAA 4HZ2A 2X49A 4V1Ap 4V2LA 2R4VA 4PI0C 4TXVA 4HQZA 2LJKA 5F07A 2B6MA 3UVHA 3HZ4A 4PTSA 3HCZA 3HVNA 2PU9C 1FG4A 2QA1A 1XWBA 4GRFA 4IN0A 1T7PB 1YQ1A 3L9VA 5DVBA 1BAYA 2OJLA 4ZL8A 2VCWA 3TU3B 3EE2A 2VLVA 1O85A 2V32A 3KMOA 4K5RA 3A5IA 2ALBA 1GP1A 2WB9A 5HR1A 2QC7A 4OMVA 2FWGA 2ZUPA 1S3RA 1A2LA 4NAXA 4JRRA 3A2VA 4EL1A 2WW1A 3GH9A 1XWAA 2VD1A 5G1LA 1TDIA 3GUSA 3RDWA 5E59A 2WVXB 5DCGA 2FNOA 2TRXA 3G7YA 1A2MA 2IMIA 1JZOA 1FW1A 1M2AA 2HXKA 4PQHA 1TJDA 1GSUA 2FWEA 3ERGA 5BMUB 1QMVA 2JACA 1SU9A 2C0GA 2F3MA 2VCZA 2VL2A 1B9YC 1B9XC 4O5RA 4MF6A 5ECNB 4XS4A 3ZL5A 3V1WA 5D9WA 2VM1A 1K3OA 4HU7A 2V2GA 1WJKA 2H72A 2MBTA 1Z6NA 3D22A 2DJ2A 3WYWA 3FR3A 2E7PA 2LJAA 5F8BA 3LWAA 2LNTA 4E8HA 2OE1A 4PGTA 4AKXB 3FR6A 1X5CA 5HQPA 1ILOA 1AQXA 1BQ7A 4POKA 3ERWA 2O7KA 2VL9A 4EDZA 2HRAA 4JBBA 1ZZYA 5DJLA 1PX6A 2VL3A 5DALB 1U88A 3A2WA 1K0BA 5G1KA 2I4AA 4KW6A 3IBHA 4TW5A 4ZXGA 1EGOA 3G7JA 4O5QA 2OE3A 3QFBC 2DMMA 3HVXA 4X0XA 1U6TA 2H66A 3TJKA 2O89A 1X5EA 2JU5A 3F3QA 3JCML 3DD3A 5IIZA 4ZL7A 5B6NA 3GX0A 1K0NA 2R6KA 3QPMA 1X5DA 1EGRA 3CMIA 1PL2A 2H0IA 2NBSA 3P8WA 5H5RA 1PN9A 3KZQA 1DUGA 3GL3A 1PFOA 3GFKA 2AB6A 2WZ9A 6GSTA 2YOIA 1I9DA 1K0DA 3HJPA 3APSA 3GA4A 4PHZC 4POBA 1TW9A 2VAFA 4FXYP 2C0FA 1EOGA 2FWFA 2LUSA 1K3YA 3C7MA 3ME7A 3TKSE 1XG8A 5IOXA 1PN0A 2MZCA 2GZZA 1VGLA 2IL3A 4HI7A 4TR1B 3FZ9A 1XBSA 5HR0A 1YEXA 5CRGA 1YF1A 1M7TA 2Z9SA 2O87A 4YKGA 1UC7A 3IAS2 1DSBA 3F3RA 2WW0A 5G5FA 2HLSA 1SK0A 4ILFA 5EL8A 3FRCA 4WBJA 4EO3A 4AJ7A 3ZFBA 4N0ZA 4MP4A 2GQLA 2B5XA 3HYPA 5DQYA 2WZSA 4I8BA 3FKFA 2HRKB 3D6IA 4BPYA 1GNEA 2R0GA 5JWRB 4RQRA 2IPAA 2LJRA 2EFHA 3L78A 5FHIA 2M80A 3P2AA 3NIVA 1G6WA 22GSA 1JZWA 2HSMB 2K8VA 4DEJA 3GSSA 3TOUA 4J56E 3N9JA 1TI3A 3VWXA 3FMWA 3D0ZA 4PUFC 3PGTA 5FT3A 4E8EA 1SKWB 4O7HA 3ZIJA 1G7EA 3H8QA 3W6GA 4ZL9A 2CZ3A 4OD7A 4F0BA 2PERA 1O81A 2MMZA 3UARA 3UJ1A 2JSZA 1HQOA 1GTIA 3TOTA 2X8GA 2WDUA 3KH9A 3KIJA 4V2MA 2BMXA 3M0FA 3P7XA 2MMAA 4LA1A 1FO5A 1XZOA 5CRWA 5D93A 4FH8A 3CTFA 1EZKA 4NHWA 2RUFA 2R0PA 5CAXA 1F9MA 4ICYA 2DC5A 2K6VA 3LEFA 1EP7A 2ON5A 3H1NA 1X9MB 3HJOA 4CDOA 4TKYA 2IMEA 2F8FA 1U3IA 4KE3A 2KUCA 3PR8A 2H70A 5D9VA 4FO5A 4MA9A 4GTUA 1Y1UA 3IV4A 5A5HA 4G0KA 1YF0A 4XHMA 2VIMA 4MABA 5ELAA 2AV4A 5ID2A 2VOCA 4DVCA 1TU8A 1USBA 1YJ6A 1K0OA 1E6BA 3RFRC 2FA4A 2I1UA 4OO5A 1F3AA 3LXZA 2YWMA 4PURA 3VI7A 3VURA 3FYGA 5ECKB 20GSA 3GH6A 1M3JA 3FZAA 3HVVA 1WP0A 2KP2A 3EMXA 2FY6A 5AN1A 3RBTA 3HXSA 3IHQA 4MJEA 1M2BA 3O6TA 4KUNA 3BOAA 4MF7A 2JZTA 4BIKA 2LRNA 2H1AA 4KX4A 3MDKA 1Z7PA 4HEA2 1I5GA 4P3YB 1QQ2A 4ACSA 4F2IA 3D21A 1SD8A 4KNDA 4K6XA 3DMLA 5J3RA 4OFTA 1MTCA 1R26A 4RI7A 4AGSA 2UV8G 2H1LA 3EC3A 5ECSA 3M9JA 5GSSA 3ZREA 1F3BA 1GSQA 5ECQB 3PH9A 2YN1A 5ECRB 2O8VB 2CV4A 2DJ1A 3IHGA 1O8XA 1LBKA 5HFGA 5IMCA 3F0IA 2DJ3A 2XBQA 5G2ZA 3EVIA 3GTUA 2PVQA 3MWHA 2CQ9A 1XCCA 1GSYA 1PD21 5GAND 4BVYA 4GQFA 5DDLA 2OKAA 4MH3A 2P31A 5KN3A 1SYXA 3KXOA 2M46A 4G0IA 3CRTA 4F82A 1EV4A 3ZRDA 3RPPA 2GQMA 2HSHA 4KF9A 3DKSA 4E68A 2FHEA 2RM5A 3M3MA 5BRTA 4GDFA 4ECBA 2FA8A 5IMFA 3ZZXA 2FWHA 4K2DA 1V9WA 5JWOB 3QAGA 1RQMA 1Z6MA 4IQAA 2B1KA 1GLQA 2N5BA 3C8EA 1GTUA 4G10A 2HFDA 3EINA 4EF0A 3DVXA 3ZITA 3WT2A 4POLA 4ISDA 17GSA 1EEMA 2YJHA 2QA2A 3TRPA 3F4SA 5ECLB 5LNKe 4HUAA 4N3ZA 2AJQB 2C0EA 3SBCA 3TCOA 3GYKA 4NMUA 3APOA 3ZTLA 3TKQA 3KH7A 1Z3EA 4A5PA 5F0GA 3H4KA 1BG1A 5C00A 1E2YA 5CRHA 4ML1A 3QAWA 1N25A 2LKUA 3DRNA 4TN8A 3VI5A 2IFQB 5LCZA 3DWVA 4XIHA 1GWCA 2H6XA 4ECJA 1HNBA 5J4YA 4BVXB 5A34A 3IR4A 1C72A 1XFLA 3ZMLA 5ECHB 3KM6A 1FAAA 1KNGA 3MNGA 1S3CA 2PBJA 2GSTA 1TRWA 3F6FA 12GSA 1K0MA 4YH2A 1JHBA 5CNWA 2FLSA 4AF2A 4ZB7A 2KLXA 1B8XA 3HZ8A 1OKDA 4HZ4A 2DKHA 1SKRB 4TR4A 3EU3A 1A23A 4G01A 1GLPA 4XTSA 4WR4A 1PQNA 1T8EB 1JLVA 3TGZA 1TP9A 2V41A 3GNJA 3TJBA 4DSRA 1J9BA 3NOFA 4RI6A 4X43A 3KJYA 1V57A 3GX8A 3C1SA 2LRCA 2R37A 1XOAA 2H6ZA 3W8JA 18GSA 4FYCA 4MCUA 1DE1A 2WVYA 3RPNA 4USSA 4GWRA 1R5AA 1HNCA 1YKAA 4JU5A 4L0WA 1ZGNA 3M8NA 4FQUA 2L5OA 3CYNA 3IK9A 4MPGA 3LORA 1PL1A 3O76A 2PMTA 3F63A 5A4VA 1SVOA 2YJ7A 2C0DA 4ZBAA 4BWQA 5AGYA 1K3LA 2E2GA 3UVTA 2E2MA 4KAEA 4ZB6A 1H75A 2J9HA 4PI2C 2VCXA 2YNXA 1TXXA 4YAPA 4XS4B 5ECMB 4JZQA 4EXJA 2OBKA 5H5SA 5J41A 4XRDA 4V1Ag 1UA5A 2WGRA 2MYGA 4TRXA 1QGVA 1JZDA 4YQMA 4EC0A 3BBYA 2A4HA 1Q4JA 1WWJA 2RIIA 2A2RA 4ULXA 2HRFA 2L59A 4IHUA 3HJMA 1Z7RA 3I43A 1THOA 1AC1A 2HSNB 4JR4A 2YWIA 4MNNA 4F9ZA 3HDCA 4IQ1A 1R4WA 4ZBDA 4EE0A 1PKWA 3EPTA 1V40A 4TOPA 2L4CA 2OADA 2DLXA 3TUEA 2DMLA 1SENA 1CQHA 4KDYA 2HQTA 9GSSA 2H19A 3TKRA 3H79A 1MDIA 1WE0A 4HSCX 3DEXA 3P90A 1GSDA 2HE3A 2PWJA 3C73A 1SD9A 1SYRA 3S9FA 3Q74A 2C80A 2H8LA 1OC8A 4O5UA 3WGDA 1QFNA 3UOMA 3CWGA 4NPBA 2ZNMA 3VWVA 2LQQA 2X8HA 4D73A 4ZIJA 4LMVA 2GZPA 4IKHA 2O3EA 4AKGA 2MBSA 3LYKA 4IBPA 2H01A 1ZYEA 4TR0A 4HQSA 2J23A 1VF4A 3KEBA 1PA3A 1W4VA 3BCKA 4ZB9A 4CY8A 1TRVA 4I2TA 1OAZA 4ID0A 5CRDA 1AQVA 2H75A 2BTOT 3UMAA 4QQ7A 1BYEA 2H1GA 4NXIA 4F0CA 1BF5A 1X9WB 4H86A 5DQSA 4KSOA 2C4JA 1NM3A 2GVPA 2REMA 4Z7XA 1YEWC 3Q19A 3CXGA 2K9FA 4IVFA 3F8UA 3GKXA 3D4TA 1NHOA 4GQCA 2XPDA 4YKFA 3IOSA 3QFAC 1ZYNA 1TRUA 4NV5A 5HR2A 3DGQA 2V6OA 5EY6A 1TTZA 4I6XA 3BCIA 2CX3A 5C04A 4X1UA 2YZUA 3VLNA 2D2ZA 2FCHA 4XRAA 4O92A 4YQVA 4I2UA 4L5OA 3APQA 4KSMA 1GUHA 5DAKB 1MD3A 5A4UA 4EDYA 3RAZA 4KDUA 2UZ8A 2RLIA 4AJ8A 3DXBA 3RHBA 2PGTA 3UIWA 2H1BA 5H5QA 5IMAA 2PVOC 5DBQA 5JWQB 4K0NA 1NW2A 2I3YA 1X9SB 1TRSA 4ZILA 1SVLA 3C71A 1GULA 1WRYA 1OYJA 2ON7A 3FK8A 1GUMA 1X0RA 4MH2A 1EEJA 3K8NA 2H73A 2OACA 3BD2A 2O36A 3MIXA 1M99A 5J9CA 19GSA 2DJKA 4O32A 4KA0A 2YPMA 1T4ZA 2DIZA 1WPIA 4K2XA 4ECIA 3EYTA 3N5OA 5KOWA 3UEMA 2A2SA 3U6VA 2GQKA 3QCPA 2BJXA 5ID2B 5AIVA 2EFCA 3AY8A 2I9HA 2YANA 2E0QA 1FOVA 3G9BA 1PRXA 2CAQA 5AIXA 7GSSA 4N10A 2FD3A 1F6MC 2B5EA 4Q5QA 4Q5FA 1VF3A 1A8LA 3VK9A
chains in the Genus database with same CATH topology
1XW5A 4DSSA 5KN1A 1ERWA 3ZFLA 1S3AA 2IMFA 2YV9A 16GSA 4MJCA 3LXTA 4JR6A 4TXOA 3ZLPA 3VPQA 3ZVJD 5IPGA 2WRTA 2YP6A 4HJMA 4HOJA 3LG6A 5ECIB 3ISOA 11GSA 5J9BA 2VCVA 2AUVA 1KEBA 3HMJG 1FB0A 6GSYA 5GAPD 2R5GA 1K0CA 2A2PA 2TIRA 4JE1A 5INYA 3E3EA 1BX9A 2DJJA 3CTGA 1WIKA 3GURA 1NHYA 1XPVA 2VM2A 3J7Yb 1VF1A 1AUCA 5B7CA 3I69A 1Y25A 4WEYA 1SJIA 3LGCA 2HZEA 2FGXA 5HFIA 1QXHA 5EVOA 2P0GA 3TKSC 1OC9A 4QL7A 1A0FA 4FYBA 4J57E 2WULA 1HYUA 4Q5NA 1T4YA 1Z9HA 3MYDA 4GSSA 1SKSB 4BVYB 1TU7A 2V1MA 1PKZA 1F37A 1SL1B 2H6YA 4Q5RA 2C3NA 4BA7A 5A5KA 2AHEA 1HD2A 1ZYPA 2OE0A 4G19A 3HA9A 2LRTA 2HNLA 2IN3A 2GZYA 3LFLA 2L6DA 4WR5A 2QGVA 1ERTA 3MAKA 1O73A 1XVQA 3TRQA 2K18A 4K7OA 4XS6A 4GLTA 1KBNA 1B4QA 5DCHA 1MEKA 1OE7A 2H0GA 1A8YA 4N30A 1SK2A 2DBCA 4ZBBA 3LW9A 2DJ0A 4MPFA 4BL7A 1A24A 2EIQA 4PXOA 4N0VA 3J7Yk 4IJIA 2HI7A 3D4MA 4WF4A 3BJ5A 4KCEA 3TJJA 1IYHA 1AQWA 4RUVA 1OKTA 4OO4A 1IYIA 3LQ7A 5ABRA 6GSVA 2VLUA 1GH2A 2AYTA 1GTBA 4FYUA 1ZOFA 5ENUA 3IPZA 2P5QA 1VF2A 2GS3A 3ZIVA 2VD0A 3QR6A 4IS0A 2B5YA 1YDKA 2IFQA 4JEDA 4AJ6A 2VKZG 4X4JA 4ECCA 2EIOA 2XBIA 4CW9A 5HR3A 1R5PA 2GLRA 5A34B 1XVWA 5KN0A 4Z2TA 1QK8A 1PMTA 5A1NA 3ZYWA 1G6YA 4KDXA 2HRNA 3GRXA 1V2AA 2IMDA 2GT6A 4LLRA 4G9HA 4LL1B 4MZCA 1SL0B 3IRAA 2RUEA 3UBKA 2X64A 3ME8A 3TB2A 4L8EA 1TK0B 4DSQA 5IM9A 2TRCP 2L6CA 2L4QA 3DIEA 2F8AA 4WF5A 4K5SA 3DVWA 3GN3A 2CVBA 5B6MA 5D9XA 3GSTA 2WFCA 2NDOA 2G2QA 1R7HA 5IMVA 4EIPA 4GSNA 2H0HA 5COHA 1PX7A 1EOHA 2I81A 1LJRA 2OT3A 1K0AA 2DKIA 2N5AA 3KTLA 3FHKA 4L5LA 2ZCTA 1XW6A 5LD0A 2QKEA 2ES7A 2N5FA 4MMMA 5BMUA 3WT1A 2PN8A 1GSSA 5IPHA 5ELGA 2GGTA 2CVKA 5JCWA 3A2XA 3GMFA 5IMZA 4IP6A 3ZVJA 3CSHA 2KHPA 4K1FA 4W66A 2PUKC 1O8WA 5ECPB 5JCGA 4F03A 4OCFA 2CVDA 3UAPA 2HZFA 3LJRA 1WOUA 5D8IA 4AKHA 3HHVA 5DJMA 4K8MA 1FHEA 3VFIA 3UBLA 3QDNA 3KD0A 1W89A 1FOHA 4YQUA 4CY6A 1MD4A 4Z2UA 1JFUA 3ZMKA 3L9SA 4IP1A 1PGTA 3CSIA 1Z5YE 3GV1A 5DALA 2HSNA 1GSFA 3QMXA 2LNSA 4IGJA 4QMKA 2JZSA 3PINA 1KTEA 2EIRA 4TVEA 4GCIA 1EV9A 4IJ3A 5ECOB 5J4VA 3FZ4A 1M2DA 1SK1A 2RM6A 1S3DA 1GRXA 4NWYA 4MDCA 1XWCA 2LQOA 4MJBA 1PSQA 1XIYA 6GSSA 1UN2A 4WKWA 4PX1A 3QOUA 2C8UA 3KP8A 1TOFA 3TKSA 2MMOA 1CQGA 3L4NA 5F05A 5IO0A 2IWTA 2VCQA 1BEDA 1GSEA 2HT9A 3M9KA 2NTOA 4LL4B 1O7UA 2FUG2 4D73B 1J08A 5G31A 1OVNA 5KEJA 5CO3A 1JZRA 5J40A 3HY2A 3KCMA 1TKDB 3M1GA 4TR1A 3R2QA 2CAIA 1N8JA 1JLWA 3KGKA 1NSWA 4WXTA 4GXZA 4KCAA 4HJ2A 1YZXA 3G7IA 5IQYA 1U87A 1SJZA 4MF5A 1XWGA 2R3XA 2JADA 3Q6OA 5JCUA 2HYXA 2R0CA 1BJXA 4LMWA 2O85A 2HRKA 5IOWA 1ABAA 6GSXA 1HNAA 3IC4A 1ZL9A 2PPTA 1B48A 1AXDA 1WMJA 5KOXA 3C1RA 1ACVA 2YZHA 1DE2A 1Y6EA 2CT6A 1VRSD 4MJAA 4I97A 4MZWA 5FWGA 2LEGA 5J47A 2OA7A 2A4VA 8GSSA 5IMDA 2HSMA 3HKRA 14GSA 1G7OA 2CX4A 2VCTA 5CREA 3CBUA 2K8SA 1GNWA 2H76A 2B7KA 3O3TA 1XW9A 2F51A 2X8CA 2X99A 2LV3A 4GSTA 3TDGA 1FB6A 2P5RA 4KH7A 2C3TA 1V58A 3DYRA 3L9UA 2H71A 2H74A 1ZYQB 2HSYA 2VUPA 4OWYA 4MK3A 5E4WA 2EC4A 5EPFA 2GSSA 10GSA 2IMKA 2YWOA 3CRUA 1AAZA 5F06A 5DAKA 3IXRA 2AAWA 5KN2A 1O6JA 6GSUA 6GSWA 5D96A 3FZ5A 13GSA 2R2JA 1ERVA 1YVLA 2C3QA 5GSTA 3W8SA 1BG5A 2X4AA 3I9V2 1T00A 3GKKA 3WD6A 4RQXA 2L5LA 1AIUA 1N2AA 3QD9A 3IE3A 4EIQA 4PQIA 1FVKA 3F6DA 3GL5A 3IDVA 2GSQA 2H30A 4K7IA 4MZBA 2JL4A 1SJ6A 4BWSA 4MLYA 1M9AA 2IJYA 1ST9A 1YY7A 1J0FA 1A0RP 3GIXA 5A5HB 2O5VA 4J2FA 3I6AA 4K9ZA 5CP1A 2VO4A 1TI1A 1EWXA 5J4UA 5D9TA 3E0UA 4KGIA 4NHZA 2GTUA 2EFDA 2VL2C 4PNGA 2GSRA 5A4WA 3EURA 4KB3A 2WCIA 4DSSB 4L0UA 2YV7A 4EVMA 2XPEA 3UL3A 4TR3A 2NPBA 4CHSA 4TXOB 3TKPA 1YKCA 1XWKA 1SVMA 2F9SA 3A5WA 1RW1A 2KP1A 1T1VA 3R3EA 1B4PA 3FEUA 2V6KA 4NV2A 2L57A 5B8AA 1ERUA 4PQ1A 5G30A 3VPTA 1XOBA 3NZNA 2NVLA 3GKNA 2CZ2A 4ML6A 4OCEA 4AI6A 4V2NA 2B7JA 2JZRA 3A3TA 1LU4A 1YEPA 1T3BA 4EKZA 2QSIA 1A2JA 5L71A 3TJGA 4PNFA 2B1LA 3IC8A 1EP8A 1SL2B 1OC3A 3GKMA 1U3AA 3GHAA 3QAVA 2LS5A 1TK5B 1ZCPA 4N11A 4HU9A 1G0TA 3IK7A 1TK8B 3GTUB 1ZMAA 3ERFA 4WBRD 2M72A 2HZEB 4IW9A 3OR5A 1DBYA 3L0HA 1OC9B 1FVJA 2YWNA 5GZZB 2WS2A 2DSAA 4XCSA 3IAM2 4AKIA 3E9JB 1URMA 3VWUA 4GF0A 1M0UA 3TRXA 3IA1A 3LSZA 1RK4A 3HD5A 2EFEA 2XC2A 3VWWA 1ML6A 1AW9A 5AISA 4K7NA 3F4RA 3SWLA 3RHCA 3EU4A 3PPUA 3FR9A 2VLTA 2GT5A 1Q98A 4EUYA 1OE8A 5J5NA 2MMNA 3EWLA 4PUAA 3U5RE 3WGXA 3KTBA 1M9BA 4IELA 2LTKA 4G2EA 2JSYA 3US3A 2LSTA 2WJUA 3KP9A 3TJFA 3FW2A 4OFNA 4Z2RA 1V98A 4ZB8A 3ED3A 1MDKA 4BL7B 3Q18A 3F4TA 1H4OA 4HS1A 4XS1A 5IO2A 2G0FA 2KOKA 1THXA 4I5QA 3HVSA 2C1YA 1UVZA 3CSJA 5HFKA 2B3SA 4OFMA 1ON4A 1F2EA 1XXUA 2XHFA 3F9UA 1TXUA 4HDEA 3WGEA 1GL8A 1GUKA 4G0LA 2OBIA 3MSZA 3EMPA 4YAVA 5CYYA 5D73A 1QUWA 2GDRA 3LYPA 3FY7A 3D5JA 1MDJA 4BVXA 3H93A 3KMNA 4QL9A 5G5EA 2DIYA 4WETA 5B8BA 2H1DA 4FIWA 5A1NB 4K0GA 2IIYA 4POMA 2CA8A 2YCDA 1GTAA 4HZ2A 2X49A 4V1Ap 4V2LA 2R4VA 4TXVA 4HQZA 2LJKA 5F07A 2B6MA 3UVHA 3HZ4A 4PTSA 3HCZA 2PU9C 1FG4A 2QA1A 1XWBA 4GRFA 4IN0A 1T7PB 1YQ1A 3L9VA 5DVBA 1BAYA 2OJLA 4ZL8A 2VCWA 3TU3B 3EE2A 2VLVA 1O85A 2V32A 3KMOA 4K5RA 3A5IA 2ALBA 1GP1A 2WB9A 5HR1A 2QC7A 4OMVA 2FWGA 2ZUPA 1A2LA 4NAXA 4JRRA 3A2VA 4EL1A 3GH9A 1XWAA 2VD1A 5G1LA 1TDIA 3GUSA 3RDWA 5E59A 5DCGA 2FNOA 2TRXA 3G7YA 1A2MA 2IMIA 1JZOA 1FW1A 1M2AA 2HXKA 4PQHA 1TJDA 1GSUA 2FWEA 3ERGA 5BMUB 1QMVA 2JACA 1SU9A 2C0GA 2F3MA 2VCZA 2VL2A 1B9YC 1B9XC 4O5RA 4MF6A 5ECNB 4XS4A 3ZL5A 3V1WA 5D9WA 2VM1A 1K3OA 4HU7A 2V2GA 1WJKA 2H72A 2MBTA 1Z6NA 3D22A 2DJ2A 3WYWA 3FR3A 2E7PA 2LJAA 5F8BA 3LWAA 2LNTA 4E8HA 2OE1A 4PGTA 4AKXB 3FR6A 1X5CA 5HQPA 1ILOA 1AQXA 1BQ7A 4POKA 3ERWA 2O7KA 2VL9A 4EDZA 2HRAA 4JBBA 1ZZYA 5DJLA 1PX6A 2VL3A 5DALB 1U88A 3A2WA 1K0BA 5G1KA 2I4AA 4KW6A 3IBHA 4TW5A 4ZXGA 1EGOA 3G7JA 4O5QA 2OE3A 3QFBC 2DMMA 3HVXA 4X0XA 1U6TA 2H66A 3TJKA 2O89A 1X5EA 2JU5A 3F3QA 3JCML 3DD3A 5IIZA 4ZL7A 5B6NA 3GX0A 1K0NA 2R6KA 3QPMA 1X5DA 1EGRA 3CMIA 1PL2A 2H0IA 2NBSA 3P8WA 5H5RA 1PN9A 3KZQA 1DUGA 3GL3A 3GFKA 2AB6A 2WZ9A 6GSTA 2YOIA 1I9DA 1K0DA 3HJPA 3APSA 3GA4A 4POBA 1TW9A 2VAFA 2C0FA 1EOGA 2FWFA 2LUSA 1K3YA 3C7MA 3ME7A 3TKSE 5IOXA 1PN0A 2MZCA 2GZZA 1VGLA 2IL3A 4HI7A 4TR1B 3FZ9A 1XBSA 5HR0A 1YEXA 5CRGA 1YF1A 1M7TA 2Z9SA 2O87A 4YKGA 1UC7A 3IAS2 1DSBA 3F3RA 5G5FA 2HLSA 1SK0A 4ILFA 5EL8A 3FRCA 4WBJA 4EO3A 4AJ7A 3ZFBA 4N0ZA 4MP4A 2GQLA 2B5XA 3HYPA 5DQYA 4I8BA 3FKFA 2HRKB 3D6IA 4BPYA 1GNEA 2R0GA 5JWRB 4RQRA 2IPAA 2LJRA 2EFHA 3L78A 5FHIA 2M80A 3P2AA 3NIVA 1G6WA 22GSA 1JZWA 2HSMB 2K8VA 4DEJA 3GSSA 3TOUA 4J56E 3N9JA 1TI3A 3VWXA 3FMWA 3D0ZA 4PUFC 3PGTA 5FT3A 4E8EA 1SKWB 4O7HA 3ZIJA 1G7EA 3H8QA 3W6GA 4ZL9A 2CZ3A 4OD7A 4F0BA 2PERA 1O81A 2MMZA 3UARA 3UJ1A 2JSZA 1HQOA 1GTIA 3TOTA 2X8GA 2WDUA 3KH9A 3KIJA 4V2MA 2BMXA 3M0FA 3P7XA 2MMAA 4LA1A 1FO5A 1XZOA 5CRWA 5D93A 4FH8A 3CTFA 1EZKA 4NHWA 2RUFA 2R0PA 5CAXA 1F9MA 4ICYA 2DC5A 2K6VA 3LEFA 1EP7A 2ON5A 3H1NA 1X9MB 3HJOA 4CDOA 4TKYA 2IMEA 2F8FA 1U3IA 4KE3A 2KUCA 3PR8A 2H70A 5D9VA 4FO5A 4MA9A 4GTUA 1Y1UA 3IV4A 5A5HA 4G0KA 1YF0A 4XHMA 2VIMA 4MABA 5ELAA 2AV4A 5ID2A 2VOCA 4DVCA 1TU8A 1USBA 1YJ6A 1K0OA 1E6BA 2FA4A 2I1UA 4OO5A 1F3AA 3LXZA 2YWMA 4PURA 3VI7A 3VURA 3FYGA 5ECKB 20GSA 3GH6A 3FZAA 3HVVA 1WP0A 2KP2A 3EMXA 2FY6A 5AN1A 3RBTA 3HXSA 3IHQA 4MJEA 1M2BA 3O6TA 4KUNA 3BOAA 4MF7A 2JZTA 2LRNA 2H1AA 4KX4A 3MDKA 1Z7PA 4HEA2 1I5GA 4P3YB 1QQ2A 4ACSA 4F2IA 3D21A 1SD8A 4KNDA 4K6XA 3DMLA 5J3RA 4OFTA 1MTCA 1R26A 4RI7A 4AGSA 2UV8G 2H1LA 3EC3A 5ECSA 3M9JA 5GSSA 3ZREA 1F3BA 1GSQA 5ECQB 3PH9A 2YN1A 5ECRB 2O8VB 2CV4A 2DJ1A 3IHGA 1O8XA 1LBKA 5HFGA 5IMCA 3F0IA 2DJ3A 2XBQA 5G2ZA 3EVIA 3GTUA 2PVQA 3MWHA 2CQ9A 1XCCA 1GSYA 1PD21 5GAND 4BVYA 4GQFA 5DDLA 2OKAA 4MH3A 2P31A 5KN3A 1SYXA 3KXOA 2M46A 4G0IA 3CRTA 4F82A 1EV4A 3ZRDA 3RPPA 2GQMA 2HSHA 4KF9A 3DKSA 4E68A 2FHEA 2RM5A 3M3MA 5BRTA 4GDFA 4ECBA 2FA8A 5IMFA 3ZZXA 2FWHA 4K2DA 1V9WA 5JWOB 3QAGA 1RQMA 1Z6MA 4IQAA 2B1KA 1GLQA 2N5BA 3C8EA 1GTUA 4G10A 2HFDA 3EINA 4EF0A 3DVXA 3ZITA 3WT2A 4POLA 4ISDA 17GSA 1EEMA 2YJHA 2QA2A 3TRPA 3F4SA 5ECLB 5LNKe 4HUAA 4N3ZA 2AJQB 2C0EA 3SBCA 3TCOA 3GYKA 4NMUA 3APOA 3ZTLA 3TKQA 3KH7A 1Z3EA 4A5PA 5F0GA 3H4KA 1BG1A 5C00A 1E2YA 5CRHA 4ML1A 3QAWA 1N25A 2LKUA 3DRNA 4TN8A 3VI5A 2IFQB 5LCZA 3DWVA 4XIHA 1GWCA 2H6XA 4ECJA 1HNBA 5J4YA 4BVXB 5A34A 3IR4A 1C72A 1XFLA 3ZMLA 5ECHB 3KM6A 1FAAA 1KNGA 3MNGA 1S3CA 2PBJA 2GSTA 1TRWA 3F6FA 12GSA 1K0MA 4YH2A 1JHBA 5CNWA 2FLSA 4AF2A 4ZB7A 2KLXA 1B8XA 3HZ8A 1OKDA 4HZ4A 2DKHA 1SKRB 4TR4A 3EU3A 1A23A 4G01A 1GLPA 4XTSA 4WR4A 1PQNA 1T8EB 1JLVA 3TGZA 1TP9A 2V41A 3GNJA 3TJBA 4DSRA 1J9BA 3NOFA 4RI6A 4X43A 3KJYA 1V57A 3GX8A 3C1SA 2LRCA 2R37A 1XOAA 2H6ZA 3W8JA 18GSA 4FYCA 4MCUA 1DE1A 3RPNA 4USSA 4GWRA 1R5AA 1HNCA 1YKAA 4JU5A 4L0WA 1ZGNA 3M8NA 4FQUA 2L5OA 3CYNA 3IK9A 4MPGA 3LORA 1PL1A 3O76A 2PMTA 3F63A 5A4VA 1SVOA 2YJ7A 2C0DA 4ZBAA 4BWQA 5AGYA 1K3LA 2E2GA 3UVTA 2E2MA 4KAEA 4ZB6A 1H75A 2J9HA 2VCXA 2YNXA 1TXXA 4YAPA 4XS4B 5ECMB 4JZQA 4EXJA 2OBKA 5H5SA 5J41A 4XRDA 4V1Ag 1UA5A 2WGRA 2MYGA 4TRXA 1QGVA 1JZDA 4YQMA 4EC0A 3BBYA 2A4HA 1Q4JA 1WWJA 2RIIA 2A2RA 4ULXA 2HRFA 2L59A 4IHUA 3HJMA 1Z7RA 3I43A 1THOA 1AC1A 2HSNB 4JR4A 2YWIA 4MNNA 4F9ZA 3HDCA 4IQ1A 1R4WA 4ZBDA 4EE0A 1PKWA 3EPTA 1V40A 4TOPA 2L4CA 2OADA 2DLXA 3TUEA 2DMLA 1SENA 1CQHA 4KDYA 2HQTA 9GSSA 2H19A 3TKRA 3H79A 1MDIA 1WE0A 3DEXA 3P90A 1GSDA 2HE3A 2PWJA 3C73A 1SD9A 1SYRA 3S9FA 3Q74A 2C80A 2H8LA 1OC8A 4O5UA 3WGDA 1QFNA 3UOMA 3CWGA 4NPBA 2ZNMA 3VWVA 2LQQA 2X8HA 4D73A 4ZIJA 4LMVA 2GZPA 4IKHA 4AKGA 2MBSA 3LYKA 4IBPA 2H01A 1ZYEA 4TR0A 4HQSA 2J23A 1VF4A 3KEBA 1PA3A 1W4VA 3BCKA 4ZB9A 4CY8A 1TRVA 4I2TA 1OAZA 4ID0A 5CRDA 1AQVA 2H75A 2BTOT 3UMAA 4QQ7A 1BYEA 2H1GA 4NXIA 4F0CA 1BF5A 1X9WB 4H86A 5DQSA 4KSOA 2C4JA 1NM3A 2GVPA 2REMA 4Z7XA 3Q19A 3CXGA 2K9FA 4IVFA 3F8UA 3GKXA 3D4TA 1NHOA 4GQCA 2XPDA 4YKFA 3IOSA 3QFAC 1ZYNA 1TRUA 4NV5A 5HR2A 3DGQA 2V6OA 5EY6A 1TTZA 4I6XA 3BCIA 2CX3A 5C04A 4X1UA 2YZUA 3VLNA 2D2ZA 2FCHA 4XRAA 4O92A 4YQVA 4I2UA 4L5OA 3APQA 4KSMA 1GUHA 5DAKB 1MD3A 5A4UA 4EDYA 3RAZA 4KDUA 2UZ8A 2RLIA 4AJ8A 3DXBA 3RHBA 2PGTA 3UIWA 2H1BA 5H5QA 5IMAA 2PVOC 5DBQA 5JWQB 4K0NA 1NW2A 2I3YA 1X9SB 1TRSA 4ZILA 1SVLA 3C71A 1GULA 1WRYA 1OYJA 2ON7A 3FK8A 1GUMA 1X0RA 4MH2A 1EEJA 3K8NA 2H73A 2OACA 3BD2A 3MIXA 1M99A 5J9CA 19GSA 2DJKA 4O32A 4KA0A 2YPMA 1T4ZA 2DIZA 1WPIA 4K2XA 4ECIA 3EYTA 3N5OA 5KOWA 3UEMA 2A2SA 3U6VA 2GQKA 3QCPA 2BJXA 5ID2B 5AIVA 2EFCA 3AY8A 2I9HA 2YANA 2E0QA 1FOVA 3G9BA 1PRXA 2CAQA 5AIXA 7GSSA 4N10A 1F6MC 2B5EA 2FD3A 4Q5QA 4Q5FA 1VF3A 1A8LA 3VK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XW5 A;  4DSS A;  5KN1 A;  1ERW A;  3ZFL A;  1S3A A;  2IMF A;  2YV9 A;  16GS A;  4MJC A;  3LXT A;  4JR6 A;  4TXO A;  3ZLP A;  3VPQ A;  3ZVJ D;  5IPG A;  2WRT A;  2YP6 A;  4HJM A;  4HOJ A;  3LG6 A;  5ECI B;  3ISO A;  11GS A;  5J9B A;  2VCV A;  2AUV A;  1KEB A;  1FB0 A;  6GSY A;  5GAP D;  2R5G A;  1K0C A;  2TIR A;  4JE1 A;  5INY A;  3E3E A;  1BX9 A;  2DJJ A;  3CTG A;  1WIK A;  3GUR A;  1NHY A;  1XPV A;  2VM2 A;  3J7Y b;  1VF1 A;  1AUC A;  5B7C A;  3I69 A;  1Y25 A;  4WEY A;  1SJI A;  3LGC A;  2HZE A;  2FGX A;  5HFI A;  1QXH A;  5EVO A;  2P0G A;  3TKS C;  1OC9 A;  4QL7 A;  1A0F A;  4FYB A;  4J57 E;  2WUL A;  1HYU A;  4Q5N A;  1T4Y A;  1Z9H A;  4GSS A;  1SKS B;  4BVY B;  1TU7 A;  2V1M A;  1PKZ A;  1F37 A;  1SL1 B;  2H6Y A;  4Q5R A;  2C3N A;  4BA7 A;  5A5K A;  2AHE A;  1HD2 A;  2OE0 A;  4G19 A;  3HA9 A;  2LRT A;  2HNL A;  2IN3 A;  2GZY A;  3LFL A;  2L6D A;  4WR5 A;  2QGV A;  1ERT A;  3MAK A;  1O73 A;  1XVQ A;  3TRQ A;  2K18 A;  4K7O A;  4XS6 A;  4GLT A;  1KBN A;  1B4Q A;  5DCH A;  1MEK A;  1OE7 A;  2H0G A;  1A8Y A;  4N30 A;  1SK2 A;  2DBC A;  4ZBB A;  2DJ0 A;  4MPF A;  4BL7 A;  1A24 A;  2EIQ A;  4PXO A;  4N0V A;  3J7Y k;  4IJI A;  2HI7 A;  3D4M A;  4WF4 A;  3BJ5 A;  4KCE A;  3TJJ A;  1IYH A;  1AQW A;  4RUV A;  1OKT A;  4OO4 A;  1IYI A;  3LQ7 A;  5ABR A;  6GSV A;  2VLU A;  1GH2 A;  2AYT A;  1GTB A;  4FYU A;  1ZOF A;  5ENU A;  3IPZ A;  2P5Q A;  1VF2 A;  2GS3 A;  3ZIV A;  2VD0 A;  3QR6 A;  4IS0 A;  2B5Y A;  1YDK A;  2IFQ A;  4JED A;  4AJ6 A;  4ECC A;  2EIO A;  2XBI A;  4CW9 A;  5HR3 A;  1R5P A;  2GLR A;  1XVW A;  5KN0 A;  1QK8 A;  1PMT A;  3ZYW A;  1G6Y A;  4KDX A;  2HRN A;  3GRX A;  1V2A A;  2IMD A;  2GT6 A;  4LLR A;  4G9H A;  4LL1 B;  4MZC A;  1SL0 B;  3IRA A;  2RUE A;  3UBK A;  2X64 A;  3ME8 A;  3TB2 A;  4L8E A;  1TK0 B;  4DSQ A;  5IM9 A;  2TRC P;  2L6C A;  2L4Q A;  3DIE A;  2F8A A;  4WF5 A;  3DVW A;  3GN3 A;  2CVB A;  5B6M A;  5D9X A;  3GST A;  2WFC A;  2NDO A;  2G2Q A;  1R7H A;  5IMV A;  4GSN A;  2H0H A;  5COH A;  1PX7 A;  1EOH A;  2I81 A;  1LJR A;  1K0A A;  2N5A A;  3KTL A;  3FHK A;  4L5L A;  2ZCT A;  1XW6 A;  5LD0 A;  2QKE A;  2ES7 A;  2N5F A;  4MMM A;  5BMU A;  3WT1 A;  2PN8 A;  1GSS A;  5IPH A;  5ELG A;  2GGT A;  2CVK A;  5JCW A;  3A2X A;  3GMF A;  5IMZ A;  4IP6 A;  3ZVJ A;  3CSH A;  2KHP A;  4K1F A;  2PUK C;  1O8W A;  5ECP B;  5JCG A;  4F03 A;  4OCF A;  2CVD A;  3UAP A;  2HZF A;  3LJR A;  1WOU A;  5D8I A;  3HHV A;  5DJM A;  4K8M A;  1FHE A;  3VFI A;  3UBL A;  3QDN A;  3KD0 A;  1W89 A;  4YQU A;  1MD4 A;  1JFU A;  3ZMK A;  3L9S A;  4IP1 A;  1PGT A;  3CSI A;  1Z5Y E;  3GV1 A;  5DAL A;  1GSF A;  3QMX A;  2LNS A;  4IGJ A;  2JZS A;  3PIN A;  1KTE A;  2EIR A;  4TVE A;  4GCI A;  1EV9 A;  4IJ3 A;  5ECO B;  3FZ4 A;  1M2D A;  1SK1 A;  2RM6 A;  1S3D A;  1GRX A;  4NWY A;  4MDC A;  1XWC A;  2LQO A;  4MJB A;  1PSQ A;  1XIY A;  6GSS A;  1UN2 A;  4WKW A;  4PX1 A;  3QOU A;  2C8U A;  3KP8 A;  1TOF A;  3TKS A;  2MMO A;  1CQG A;  3L4N A;  5F05 A;  5IO0 A;  2IWT A;  2VCQ A;  1BED A;  1GSE A;  2HT9 A;  3M9K A;  2NTO A;  4LL4 B;  1O7U A;  2FUG 2;  4D73 B;  1J08 A;  5G31 A;  1OVN A;  5KEJ A;  5CO3 A;  1JZR A;  3HY2 A;  3KCM A;  1TKD B;  3M1G A;  4TR1 A;  3R2Q A;  2CAI A;  1N8J A;  1JLW A;  3KGK A;  1NSW A;  4WXT A;  4GXZ A;  4KCA A;  4HJ2 A;  1YZX A;  3G7I A;  5IQY A;  1U87 A;  1SJZ A;  4MF5 A;  1XWG A;  2R3X A;  2JAD A;  3Q6O A;  5JCU A;  2HYX A;  1BJX A;  4LMW A;  2O85 A;  2HRK A;  5IOW A;  1ABA A;  6GSX A;  1HNA A;  3IC4 A;  1ZL9 A;  2PPT A;  1B48 A;  1AXD A;  1WMJ A;  3C1R A;  1ACV A;  2YZH A;  1DE2 A;  1Y6E A;  2CT6 A;  1VRS D;  4MJA A;  4I97 A;  4MZW A;  5FWG A;  2LEG A;  2OA7 A;  2A4V A;  8GSS A;  5IMD A;  2HSM A;  3HKR A;  14GS A;  1G7O A;  2CX4 A;  2VCT A;  5CRE A;  3CBU A;  2K8S A;  1GNW A;  2H76 A;  2B7K A;  3O3T A;  1XW9 A;  2F51 A;  2X8C A;  2X99 A;  2LV3 A;  4GST A;  3TDG A;  1FB6 A;  2P5R A;  4KH7 A;  2C3T A;  1V58 A;  3DYR A;  3L9U A;  2H71 A;  2H74 A;  1ZYQ B;  2HSY A;  2VUP A;  4OWY A;  4MK3 A;  5E4W A;  2EC4 A;  5EPF A;  2GSS A;  10GS A;  2IMK A;  2YWO A;  3CRU A;  1AAZ A;  5F06 A;  5DAK A;  3IXR A;  2AAW A;  5KN2 A;  1O6J A;  6GSU A;  6GSW A;  5D96 A;  3FZ5 A;  13GS A;  2R2J A;  1ERV A;  2C3Q A;  5GST A;  3W8S A;  1BG5 A;  3I9V 2;  1T00 A;  3GKK A;  3WD6 A;  4RQX A;  2L5L A;  1AIU A;  1N2A A;  3QD9 A;  3IE3 A;  4PQI A;  1FVK A;  3F6D A;  3GL5 A;  3IDV A;  2GSQ A;  2H30 A;  4K7I A;  4MZB A;  2JL4 A;  1SJ6 A;  4BWS A;  4MLY A;  1M9A A;  2IJY A;  1ST9 A;  1YY7 A;  1J0F A;  1A0R P;  3GIX A;  4J2F A;  3I6A A;  4K9Z A;  5CP1 A;  2VO4 A;  1TI1 A;  1EWX A;  5J4U A;  5D9T A;  3E0U A;  4KGI A;  4NHZ A;  2GTU A;  2VL2 C;  4PNG A;  2GSR A;  5A4W A;  3EUR A;  4KB3 A;  2WCI A;  4DSS B;  4L0U A;  2YV7 A;  4EVM A;  2XPE A;  3UL3 A;  4TR3 A;  2NPB A;  4CHS A;  4TXO B;  3TKP A;  1YKC A;  1XWK A;  2F9S A;  3A5W A;  1RW1 A;  2KP1 A;  1T1V A;  3R3E A;  1B4P A;  3FEU A;  2V6K A;  4NV2 A;  2L57 A;  5B8A A;  1ERU A;  4PQ1 A;  5G30 A;  3VPT A;  1XOB A;  3NZN A;  2NVL A;  3GKN A;  2CZ2 A;  4ML6 A;  4OCE A;  4V2N A;  2B7J A;  2JZR A;  3A3T A;  1LU4 A;  1YEP A;  1T3B A;  4EKZ A;  2QSI A;  1A2J A;  5L71 A;  3TJG A;  4PNF A;  2B1L A;  3IC8 A;  1EP8 A;  1SL2 B;  1OC3 A;  3GKM A;  1U3A A;  3GHA A;  3QAV A;  2LS5 A;  1TK5 B;  1ZCP A;  4N11 A;  4HU9 A;  1G0T A;  3IK7 A;  1TK8 B;  3GTU B;  1ZMA A;  3ERF A;  4WBR D;  2M72 A;  2HZE B;  4IW9 A;  3OR5 A;  1DBY A;  3L0H A;  1OC9 B;  1FVJ A;  2YWN A;  5GZZ B;  2WS2 A;  2DSA A;  4XCS A;  3IAM 2;  3E9J B;  1URM A;  3VWU A;  4GF0 A;  1M0U A;  3TRX A;  3IA1 A;  3LSZ A;  1RK4 A;  3HD5 A;  2XC2 A;  3VWW A;  1ML6 A;  1AW9 A;  5AIS A;  4K7N A;  3F4R A;  3SWL A;  3RHC A;  3EU4 A;  3PPU A;  3FR9 A;  2VLT A;  2GT5 A;  1Q98 A;  4EUY A;  1OE8 A;  5J5N A;  2MMN A;  3EWL A;  4PUA A;  3U5R E;  3WGX A;  3KTB A;  1M9B A;  4IEL A;  2LTK A;  4G2E A;  2JSY A;  3US3 A;  2LST A;  2WJU A;  3KP9 A;  3TJF A;  3FW2 A;  4OFN A;  1V98 A;  4ZB8 A;  3ED3 A;  1MDK A;  4BL7 B;  3Q18 A;  3F4T A;  1H4O A;  4HS1 A;  4XS1 A;  5IO2 A;  2G0F A;  2KOK A;  1THX A;  4I5Q A;  3HVS A;  2C1Y A;  1UVZ A;  3CSJ A;  5HFK A;  2B3S A;  4OFM A;  1ON4 A;  1F2E A;  1XXU A;  2XHF A;  3F9U A;  4HDE A;  3WGE A;  1GL8 A;  1GUK A;  4G0L A;  2OBI A;  3MSZ A;  3EMP A;  4YAV A;  5CYY A;  5D73 A;  1QUW A;  2GDR A;  3LYP A;  3FY7 A;  3D5J A;  1MDJ A;  4BVX A;  3H93 A;  3KMN A;  4QL9 A;  5G5E A;  2DIY A;  4WET A;  5B8B A;  2H1D A;  4FIW A;  4K0G A;  2IIY A;  4POM A;  2CA8 A;  2YCD A;  1GTA A;  4HZ2 A;  4V1A p;  4V2L A;  2R4V A;  4TXV A;  4HQZ A;  2LJK A;  5F07 A;  2B6M A;  3UVH A;  3HZ4 A;  4PTS A;  3HCZ A;  2PU9 C;  1FG4 A;  1XWB A;  4GRF A;  4IN0 A;  1T7P B;  1YQ1 A;  3L9V A;  5DVB A;  1BAY A;  2OJL A;  4ZL8 A;  2VCW A;  3EE2 A;  2VLV A;  1O85 A;  2V32 A;  3KMO A;  2ALB A;  1GP1 A;  2WB9 A;  5HR1 A;  2QC7 A;  4OMV A;  2FWG A;  2ZUP A;  1A2L A;  4NAX A;  4JRR A;  3A2V A;  4EL1 A;  3GH9 A;  1XWA A;  2VD1 A;  5G1L A;  1TDI A;  3GUS A;  3RDW A;  5E59 A;  5DCG A;  2FNO A;  2TRX A;  3G7Y A;  1A2M A;  2IMI A;  1JZO A;  1FW1 A;  1M2A A;  2HXK A;  4PQH A;  1TJD A;  1GSU A;  2FWE A;  3ERG A;  1QMV A;  2JAC A;  1SU9 A;  2C0G A;  2F3M A;  2VCZ A;  2VL2 A;  1B9Y C;  1B9X C;  4O5R A;  4MF6 A;  5ECN B;  4XS4 A;  3ZL5 A;  3V1W A;  5D9W A;  2VM1 A;  1K3O A;  4HU7 A;  2V2G A;  1WJK A;  2H72 A;  2MBT A;  1Z6N A;  3D22 A;  2DJ2 A;  3WYW A;  3FR3 A;  2E7P A;  2LJA A;  5F8B A;  3LWA A;  2LNT A;  4E8H A;  2OE1 A;  4PGT A;  1X5C A;  3FR6 A;  5HQP A;  1ILO A;  1AQX A;  1BQ7 A;  4POK A;  3ERW A;  2O7K A;  2VL9 A;  4EDZ A;  2HRA A;  4JBB A;  1ZZY A;  5DJL A;  1PX6 A;  2VL3 A;  5DAL B;  1U88 A;  3A2W A;  1K0B A;  5G1K A;  2I4A A;  4KW6 A;  3IBH A;  4TW5 A;  4ZXG A;  1EGO A;  3G7J A;  2OE3 A;  3QFB C;  2DMM A;  3HVX A;  4X0X A;  1U6T A;  2H66 A;  3TJK A;  2O89 A;  1X5E A;  2JU5 A;  3F3Q A;  3JCM L;  3DD3 A;  5IIZ A;  4ZL7 A;  5B6N A;  3GX0 A;  1K0N A;  2R6K A;  3QPM A;  1X5D A;  1EGR A;  3CMI A;  1PL2 A;  2H0I A;  2NBS A;  3P8W A;  5H5R A;  1PN9 A;  3KZQ A;  1DUG A;  3GL3 A;  3GFK A;  2AB6 A;  2WZ9 A;  6GST A;  2YOI A;  1I9D A;  1K0D A;  3HJP A;  3APS A;  3GA4 A;  4POB A;  1TW9 A;  2VAF A;  2C0F A;  1EOG A;  2FWF A;  2LUS A;  1K3Y A;  3C7M A;  3ME7 A;  3TKS E;  5IOX A;  2MZC A;  2GZZ A;  1VGL A;  2IL3 A;  4HI7 A;  4TR1 B;  3FZ9 A;  1XBS A;  5HR0 A;  1YEX A;  5CRG A;  1YF1 A;  1M7T A;  2Z9S A;  2O87 A;  1UC7 A;  3IAS 2;  1DSB A;  3F3R A;  5G5F A;  2HLS A;  1SK0 A;  4ILF A;  5EL8 A;  3FRC A;  4WBJ A;  4EO3 A;  4AJ7 A;  3ZFB A;  4N0Z A;  4MP4 A;  2GQL A;  2B5X A;  3HYP A;  5DQY A;  4I8B A;  3FKF A;  2HRK B;  3D6I A;  4BPY A;  1GNE A;  5JWR B;  4RQR A;  2IPA A;  2LJR A;  3L78 A;  5FHI A;  2M80 A;  3P2A A;  3NIV A;  1G6W A;  22GS A;  1JZW A;  2HSM B;  2K8V A;  4DEJ A;  3GSS A;  3TOU A;  4J56 E;  3N9J A;  1TI3 A;  3VWX A;  3D0Z A;  4PUF C;  3PGT A;  5FT3 A;  4E8E A;  1SKW B;  4O7H A;  3ZIJ A;  1G7E A;  3H8Q A;  3W6G A;  4ZL9 A;  2CZ3 A;  4OD7 A;  4F0B A;  2PER A;  1O81 A;  2MMZ A;  3UAR A;  3UJ1 A;  2JSZ A;  1HQO A;  1GTI A;  3TOT A;  2X8G A;  2WDU A;  3KH9 A;  3KIJ A;  4V2M A;  2BMX A;  3M0F A;  3P7X A;  2MMA A;  4LA1 A;  1FO5 A;  1XZO A;  5CRW A;  5D93 A;  4FH8 A;  3CTF A;  1EZK A;  4NHW A;  2RUF A;  5CAX A;  1F9M A;  2DC5 A;  2K6V A;  3LEF A;  1EP7 A;  2ON5 A;  3H1N A;  1X9M B;  3HJO A;  4CDO A;  4TKY A;  2IME A;  2F8F A;  1U3I A;  4KE3 A;  2KUC A;  3PR8 A;  2H70 A;  5D9V A;  4FO5 A;  4MA9 A;  4GTU A;  3IV4 A;  1YF0 A;  4G0K A;  4XHM A;  2VIM A;  4MAB A;  5ELA A;  2AV4 A;  5ID2 A;  2VOC A;  4DVC A;  1TU8 A;  1USB A;  1YJ6 A;  1K0O A;  1E6B A;  2FA4 A;  2I1U A;  4OO5 A;  1F3A A;  3LXZ A;  2YWM A;  4PUR A;  3VI7 A;  3VUR A;  3FYG A;  5ECK B;  20GS A;  3GH6 A;  3FZA A;  3HVV A;  1WP0 A;  2KP2 A;  3EMX A;  2FY6 A;  5AN1 A;  3RBT A;  3HXS A;  3IHQ A;  4MJE A;  1M2B A;  3O6T A;  4KUN A;  3BOA A;  4MF7 A;  2JZT A;  2LRN A;  2H1A A;  4KX4 A;  3MDK A;  1Z7P A;  4HEA 2;  1I5G A;  4P3Y B;  1QQ2 A;  4ACS A;  4F2I A;  3D21 A;  1SD8 A;  4KND A;  4K6X A;  3DML A;  5J3R A;  4OFT A;  1MTC A;  1R26 A;  4RI7 A;  4AGS A;  3EC3 A;  5ECS A;  3M9J A;  5GSS A;  3ZRE A;  1F3B A;  1GSQ A;  5ECQ B;  3PH9 A;  2YN1 A;  5ECR B;  2O8V B;  2CV4 A;  2DJ1 A;  1O8X A;  1LBK A;  5HFG A;  5IMC A;  3F0I A;  2DJ3 A;  2XBQ A;  5G2Z A;  3EVI A;  3GTU A;  2PVQ A;  3MWH A;  2CQ9 A;  1XCC A;  1GSY A;  1PD2 1;  5GAN D;  4BVY A;  4GQF A;  5DDL A;  2OKA A;  4MH3 A;  2P31 A;  5KN3 A;  1SYX A;  3KXO A;  2M46 A;  4G0I A;  3CRT A;  4F82 A;  1EV4 A;  3ZRD A;  3RPP A;  2GQM A;  2HSH A;  4KF9 A;  3DKS A;  2FHE A;  2RM5 A;  3M3M A;  4ECB A;  2FA8 A;  5IMF A;  3ZZX A;  2FWH A;  4K2D A;  1V9W A;  5JWO B;  3QAG A;  1RQM A;  1Z6M A;  4IQA A;  2B1K A;  1GLQ A;  2N5B A;  3C8E A;  1GTU A;  4G10 A;  2HFD A;  3EIN A;  4EF0 A;  3DVX A;  3ZIT A;  3WT2 A;  4POL A;  4ISD A;  17GS A;  1EEM A;  2YJH A;  3TRP A;  3F4S A;  5ECL B;  5LNK e;  4HUA A;  2AJQ B;  2C0E A;  3SBC A;  3TCO A;  3GYK A;  4NMU A;  3APO A;  3ZTL A;  3TKQ A;  3KH7 A;  1Z3E A;  5F0G A;  3H4K A;  5C00 A;  1E2Y A;  5CRH A;  4ML1 A;  3QAW A;  2LKU A;  3DRN A;  4TN8 A;  3VI5 A;  2IFQ B;  5LCZ A;  3DWV A;  4XIH A;  1GWC A;  2H6X A;  4ECJ A;  1HNB A;  4BVX B;  3IR4 A;  1C72 A;  1XFL A;  3ZML A;  5ECH B;  3KM6 A;  1FAA A;  1KNG A;  3MNG A;  1S3C A;  2PBJ A;  2GST A;  1TRW A;  3F6F A;  12GS A;  1K0M A;  4YH2 A;  1JHB A;  5CNW A;  2FLS A;  4AF2 A;  2KLX A;  1B8X A;  3HZ8 A;  1OKD A;  4HZ4 A;  1SKR B;  4TR4 A;  3EU3 A;  1A23 A;  1GLP A;  4XTS A;  4WR4 A;  1PQN A;  1T8E B;  1JLV A;  3TGZ A;  1TP9 A;  2V41 A;  3GNJ A;  3TJB A;  4DSR A;  1J9B A;  3NOF A;  4RI6 A;  4X43 A;  3KJY A;  1V57 A;  3GX8 A;  3C1S A;  2LRC A;  2R37 A;  1XOA A;  2H6Z A;  3W8J A;  18GS A;  4FYC A;  4MCU A;  1DE1 A;  3RPN A;  4USS A;  4GWR A;  1R5A A;  1HNC A;  1YKA A;  4JU5 A;  4L0W A;  1ZGN A;  3M8N A;  4FQU A;  2L5O A;  3CYN A;  3IK9 A;  4MPG A;  3LOR A;  1PL1 A;  3O76 A;  2PMT A;  3F63 A;  5A4V A;  2YJ7 A;  2C0D A;  4ZBA A;  4BWQ A;  5AGY A;  1K3L A;  2E2G A;  3UVT A;  2E2M A;  4KAE A;  4ZB6 A;  1H75 A;  2J9H A;  2VCX A;  2YNX A;  1TXX A;  4YAP A;  4XS4 B;  5ECM B;  4JZQ A;  4EXJ A;  2OBK A;  5H5S A;  5J41 A;  4XRD A;  4V1A g;  1UA5 A;  2WGR A;  2MYG A;  4TRX A;  1QGV A;  1JZD A;  4YQM A;  4EC0 A;  3BBY A;  1Q4J A;  1WWJ A;  2RII A;  2A2R A;  4ULX A;  2HRF A;  2L59 A;  4IHU A;  3HJM A;  1Z7R A;  3I43 A;  1THO A;  1AC1 A;  2HSN B;  4JR4 A;  2YWI A;  4F9Z A;  3HDC A;  4IQ1 A;  1R4W A;  4ZBD A;  4EE0 A;  1PKW A;  1V40 A;  4TOP A;  2L4C A;  2OAD A;  2DLX A;  3TUE A;  2DML A;  1SEN A;  1CQH A;  4KDY A;  2HQT A;  9GSS A;  2H19 A;  3TKR A;  3H79 A;  1MDI A;  1WE0 A;  3DEX A;  3P90 A;  1GSD A;  2HE3 A;  2PWJ A;  3C73 A;  1SD9 A;  1SYR A;  3S9F A;  3Q74 A;  2C80 A;  2H8L A;  1OC8 A;  3WGD A;  1QFN A;  3UOM A;  4NPB A;  2ZNM A;  3VWV A;  2LQQ A;  2X8H A;  4D73 A;  4ZIJ A;  4LMV A;  2GZP A;  4IKH A;  2MBS A;  3LYK A;  4IBP A;  2H01 A;  1ZYE A;  4TR0 A;  4HQS A;  2J23 A;  1VF4 A;  3KEB A;  1PA3 A;  1W4V A;  3BCK A;  4ZB9 A;  1TRV A;  4I2T A;  1OAZ A;  4ID0 A;  5CRD A;  1AQV A;  2H75 A;  2BTO T;  3UMA A;  4QQ7 A;  1BYE A;  2H1G A;  4NXI A;  4F0C A;  1X9W B;  4H86 A;  5DQS A;  4KSO A;  2C4J A;  1NM3 A;  2GVP A;  2REM A;  4Z7X A;  3Q19 A;  3CXG A;  2K9F A;  4IVF A;  3F8U A;  3GKX A;  3D4T A;  1NHO A;  4GQC A;  2XPD A;  3IOS A;  3QFA C;  1TRU A;  4NV5 A;  5HR2 A;  3DGQ A;  2V6O A;  5EY6 A;  1TTZ A;  4I6X A;  3BCI A;  2CX3 A;  5C04 A;  4X1U A;  2YZU A;  3VLN A;  2D2Z A;  2FCH A;  4XRA A;  4O92 A;  4YQV A;  4I2U A;  4L5O A;  3APQ A;  4KSM A;  1GUH A;  5DAK B;  1MD3 A;  5A4U A;  4EDY A;  3RAZ A;  4KDU A;  2UZ8 A;  2RLI A;  4AJ8 A;  3DXB A;  3RHB A;  2PGT A;  3UIW A;  2H1B A;  5H5Q A;  5IMA A;  2PVO C;  5DBQ A;  5JWQ B;  4K0N A;  1NW2 A;  2I3Y A;  1X9S B;  1TRS A;  4ZIL A;  3C71 A;  1GUL A;  1WRY A;  1OYJ A;  2ON7 A;  3FK8 A;  1GUM A;  1X0R A;  4MH2 A;  1EEJ A;  3K8N A;  2H73 A;  2OAC A;  3BD2 A;  1M99 A;  5J9C A;  19GS A;  2DJK A;  4O32 A;  4KA0 A;  2YPM A;  1T4Z A;  2DIZ A;  1WPI A;  4ECI A;  3EYT A;  3N5O A;  3UEM A;  2A2S A;  3U6V A;  2GQK A;  3QCP A;  2BJX A;  5ID2 B;  5AIV A;  3AY8 A;  2I9H A;  2YAN A;  2E0Q A;  1FOV A;  3G9B A;  1PRX A;  2CAQ A;  5AIX A;  7GSS A;  4N10 A;  1F6M C;  2B5E A;  2FD3 A;  4Q5Q A;  4Q5F A;  1VF3 A;  1A8L A;  3VK9 A; 
#chains in the Genus database with same CATH topology
 1XW5 A;  4DSS A;  5KN1 A;  1ERW A;  3ZFL A;  1S3A A;  2IMF A;  2YV9 A;  16GS A;  4MJC A;  3LXT A;  4JR6 A;  4TXO A;  3ZLP A;  3VPQ A;  3ZVJ D;  5IPG A;  2WRT A;  2YP6 A;  4HJM A;  4HOJ A;  3LG6 A;  5ECI B;  3ISO A;  11GS A;  5J9B A;  2VCV A;  2AUV A;  1KEB A;  3HMJ G;  1FB0 A;  6GSY A;  5GAP D;  2R5G A;  1K0C A;  2A2P A;  2TIR A;  4JE1 A;  5INY A;  3E3E A;  1BX9 A;  2DJJ A;  3CTG A;  1WIK A;  3GUR A;  1NHY A;  1XPV A;  2VM2 A;  3J7Y b;  1VF1 A;  1AUC A;  5B7C A;  3I69 A;  1Y25 A;  4WEY A;  1SJI A;  3LGC A;  2HZE A;  2FGX A;  5HFI A;  1QXH A;  5EVO A;  2P0G A;  3TKS C;  1OC9 A;  4QL7 A;  1A0F A;  4FYB A;  4J57 E;  2WUL A;  1HYU A;  4Q5N A;  1T4Y A;  1Z9H A;  3MYD A;  4GSS A;  1SKS B;  4BVY B;  1TU7 A;  2V1M A;  1PKZ A;  1F37 A;  1SL1 B;  2H6Y A;  4Q5R A;  2C3N A;  4BA7 A;  5A5K A;  2AHE A;  1HD2 A;  1ZYP A;  2OE0 A;  4G19 A;  3HA9 A;  2LRT A;  2HNL A;  2IN3 A;  2GZY A;  3LFL A;  2L6D A;  4WR5 A;  2QGV A;  1ERT A;  3MAK A;  1O73 A;  1XVQ A;  3TRQ A;  2K18 A;  4K7O A;  4XS6 A;  4GLT A;  1KBN A;  1B4Q A;  5DCH A;  1MEK A;  1OE7 A;  2H0G A;  1A8Y A;  4N30 A;  1SK2 A;  2DBC A;  4ZBB A;  3LW9 A;  2DJ0 A;  4MPF A;  4BL7 A;  1A24 A;  2EIQ A;  4PXO A;  4N0V A;  3J7Y k;  4IJI A;  2HI7 A;  3D4M A;  4WF4 A;  3BJ5 A;  4KCE A;  3TJJ A;  1IYH A;  1AQW A;  4RUV A;  1OKT A;  4OO4 A;  1IYI A;  3LQ7 A;  5ABR A;  6GSV A;  2VLU A;  1GH2 A;  2AYT A;  1GTB A;  4FYU A;  1ZOF A;  5ENU A;  3IPZ A;  2P5Q A;  1VF2 A;  2GS3 A;  3ZIV A;  2VD0 A;  3QR6 A;  4IS0 A;  2B5Y A;  1YDK A;  2IFQ A;  4JED A;  4AJ6 A;  2VKZ G;  4X4J A;  4ECC A;  2EIO A;  2XBI A;  4CW9 A;  5HR3 A;  1R5P A;  2GLR A;  5A34 B;  1XVW A;  5KN0 A;  4Z2T A;  1QK8 A;  1PMT A;  5A1N A;  3ZYW A;  1G6Y A;  4KDX A;  2HRN A;  3GRX A;  1V2A A;  2IMD A;  2GT6 A;  4LLR A;  4G9H A;  4LL1 B;  4MZC A;  1SL0 B;  3IRA A;  2RUE A;  3UBK A;  2X64 A;  3ME8 A;  3TB2 A;  4L8E A;  1TK0 B;  4DSQ A;  5IM9 A;  2TRC P;  2L6C A;  2L4Q A;  3DIE A;  2F8A A;  4WF5 A;  4K5S A;  3DVW A;  3GN3 A;  2CVB A;  5B6M A;  5D9X A;  3GST A;  2WFC A;  2NDO A;  2G2Q A;  1R7H A;  5IMV A;  4EIP A;  4GSN A;  2H0H A;  5COH A;  1PX7 A;  1EOH A;  2I81 A;  1LJR A;  2OT3 A;  1K0A A;  2DKI A;  2N5A A;  2WVX A;  3KTL A;  3FHK A;  4L5L A;  2ZCT A;  1XW6 A;  5LD0 A;  2QKE A;  2ES7 A;  2N5F A;  4MMM A;  5BMU A;  3WT1 A;  2PN8 A;  1GSS A;  5IPH A;  5ELG A;  2GGT A;  2CVK A;  5JCW A;  3A2X A;  3GMF A;  5IMZ A;  4IP6 A;  3ZVJ A;  3CSH A;  2KHP A;  4K1F A;  4W66 A;  2PUK C;  1O8W A;  5ECP B;  5JCG A;  4F03 A;  4OCF A;  2CVD A;  3UAP A;  2HZF A;  3LJR A;  1WOU A;  5D8I A;  4AKH A;  3HHV A;  5DJM A;  4K8M A;  1FHE A;  3VFI A;  3UBL A;  3QDN A;  3KD0 A;  1W89 A;  1FOH A;  4YQU A;  4CY6 A;  1MD4 A;  4Z2U A;  1JFU A;  3ZMK A;  3L9S A;  4IP1 A;  1PGT A;  3CSI A;  1Z5Y E;  3GV1 A;  5DAL A;  1S4B P;  2HSN A;  3RGB C;  1GSF A;  3QMX A;  2LNS A;  4IGJ A;  4QMK A;  2JZS A;  3PIN A;  1KTE A;  2EIR A;  4TVE A;  4GCI A;  1EV9 A;  4IJ3 A;  5ECO B;  5J4V A;  3FZ4 A;  1M2D A;  1SK1 A;  2RM6 A;  1S3D A;  1GRX A;  4NWY A;  4MDC A;  1XWC A;  2LQO A;  4MJB A;  1PSQ A;  2WW3 A;  1XIY A;  6GSS A;  1UN2 A;  4WKW A;  4PX1 A;  3QOU A;  3CQF A;  2C8U A;  3KP8 A;  1TOF A;  3TKS A;  2MMO A;  1CQG A;  3L4N A;  5F05 A;  5IO0 A;  2IWT A;  2VCQ A;  1BED A;  1GSE A;  2HT9 A;  3M9K A;  2NTO A;  4LL4 B;  1O7U A;  2FUG 2;  4D73 B;  1J08 A;  5G31 A;  1OVN A;  5KEJ A;  5CO3 A;  1JZR A;  5J40 A;  3HY2 A;  3KCM A;  1TKD B;  3M1G A;  4TR1 A;  3R2Q A;  2CAI A;  1N8J A;  1JLW A;  3KGK A;  1NSW A;  4WXT A;  4GXZ A;  4KCA A;  4HJ2 A;  1YZX A;  3G7I A;  1M3I A;  5IQY A;  1U87 A;  1SJZ A;  4MF5 A;  1XWG A;  2R3X A;  2JAD A;  3Q6O A;  5JCU A;  1I1I P;  2HYX A;  2R0C A;  1BJX A;  4LMW A;  2O85 A;  2HRK A;  5IOW A;  1ABA A;  2WW2 A;  6GSX A;  1HNA A;  3IC4 A;  1ZL9 A;  2PPT A;  1B48 A;  1AXD A;  1WMJ A;  5KOX A;  3C1R A;  1ACV A;  2YZH A;  1DE2 A;  1Y6E A;  2CT6 A;  1VRS D;  4MJA A;  4I97 A;  4MZW A;  5FWG A;  2LEG A;  5J47 A;  2OA7 A;  2A4V A;  8GSS A;  5IMD A;  2HSM A;  3HKR A;  14GS A;  1G7O A;  2CX4 A;  2VCT A;  5CRE A;  3CBU A;  2K8S A;  1GNW A;  2H76 A;  2B7K A;  3O3T A;  1XW9 A;  2X8C A;  3CHX C;  2F51 A;  2X99 A;  2LV3 A;  4GST A;  3TDG A;  1FB6 A;  2P5R A;  4KH7 A;  2C3T A;  1V58 A;  3DYR A;  3L9U A;  2H71 A;  2H74 A;  1ZYQ B;  2HSY A;  2VUP A;  4OWY A;  4MK3 A;  5E4W A;  2EC4 A;  5EPF A;  2GSS A;  10GS A;  2IMK A;  2YWO A;  3CRU A;  1AAZ A;  5F06 A;  5DAK A;  3IXR A;  2AAW A;  5KN2 A;  1O6J A;  6GSU A;  6GSW A;  5D96 A;  3FZ5 A;  13GS A;  2R2J A;  1ERV A;  1YVL A;  2C3Q A;  5GST A;  3W8S A;  1BG5 A;  2X4A A;  3I9V 2;  1T00 A;  3GKK A;  3WD6 A;  4RQX A;  2L5L A;  1AIU A;  1N2A A;  3QD9 A;  3IE3 A;  4EIQ A;  4PQI A;  1FVK A;  3F6D A;  3GL5 A;  3IDV A;  2GSQ A;  2H30 A;  4K7I A;  4MZB A;  2JL4 A;  1SJ6 A;  4BWS A;  4MLY A;  1M9A A;  2IJY A;  1ST9 A;  1YY7 A;  1J0F A;  1A0R P;  3GIX A;  5A5H B;  2O5V A;  4J2F A;  3I6A A;  4K9Z A;  5CP1 A;  2VO4 A;  1TI1 A;  1EWX A;  5J4U A;  5D9T A;  3E0U A;  4KGI A;  4NHZ A;  2GTU A;  2EFD A;  2VL2 C;  4PNG A;  2GSR A;  5A4W A;  3EUR A;  4KB3 A;  2WCI A;  4DSS B;  4L0U A;  2YV7 A;  4EVM A;  2XPE A;  3UL3 A;  4TR3 A;  2NPB A;  4CHS A;  4TXO B;  3TKP A;  1YKC A;  1XWK A;  1SVM A;  2F9S A;  3A5W A;  1RW1 A;  2KP1 A;  1T1V A;  3R3E A;  1B4P A;  3FEU A;  2V6K A;  4NV2 A;  2L57 A;  5B8A A;  1ERU A;  4PQ1 A;  5G30 A;  3VPT A;  1XOB A;  3NZN A;  2NVL A;  3GKN A;  2CZ2 A;  4ML6 A;  4OCE A;  4AI6 A;  4V2N A;  2B7J A;  2JZR A;  3A3T A;  1LU4 A;  1YEP A;  1T3B A;  4EKZ A;  2QSI A;  1A2J A;  5L71 A;  3TJG A;  4PNF A;  2B1L A;  3IC8 A;  1EP8 A;  1SL2 B;  1OC3 A;  3GKM A;  1U3A A;  3GHA A;  3QAV A;  2LS5 A;  1TK5 B;  1ZCP A;  4N11 A;  2WVZ A;  4HU9 A;  1G0T A;  3IK7 A;  1TK8 B;  3GTU B;  1ZMA A;  3ERF A;  4WBR D;  2M72 A;  2HZE B;  4IW9 A;  3OR5 A;  1DBY A;  3L0H A;  1OC9 B;  1FVJ A;  2YWN A;  5GZZ B;  2WS2 A;  2DSA A;  4XCS A;  3IAM 2;  4AKI A;  3E9J B;  1URM A;  3VWU A;  4GF0 A;  1M0U A;  3TRX A;  3IA1 A;  3LSZ A;  1RK4 A;  3HD5 A;  2EFE A;  2XC2 A;  3VWW A;  1ML6 A;  1AW9 A;  5AIS A;  4K7N A;  3F4R A;  3SWL A;  3RHC A;  3EU4 A;  3PPU A;  3FR9 A;  2VLT A;  2GT5 A;  1Q98 A;  4EUY A;  1OE8 A;  5J5N A;  2MMN A;  3EWL A;  4PUA A;  3U5R E;  3WGX A;  3KTB A;  1M9B A;  4IEL A;  2LTK A;  4G2E A;  2JSY A;  3US3 A;  2LST A;  2WJU A;  3KP9 A;  3TJF A;  3FW2 A;  4OFN A;  4Z2R A;  1V98 A;  4ZB8 A;  3ED3 A;  1MDK A;  4BL7 B;  3Q18 A;  3F4T A;  1H4O A;  4HS1 A;  4XS1 A;  5IO2 A;  2G0F A;  2KOK A;  1THX A;  4I5Q A;  3HVS A;  2C1Y A;  1UVZ A;  3CSJ A;  5HFK A;  2B3S A;  4OFM A;  1ON4 A;  1F2E A;  1XXU A;  2XHF A;  3F9U A;  1TXU A;  4HDE A;  3WGE A;  1GL8 A;  1GUK A;  4G0L A;  2OBI A;  3MSZ A;  3EMP A;  4YAV A;  5CYY A;  5D73 A;  1QUW A;  2GDR A;  3LYP A;  3FY7 A;  3D5J A;  1MDJ A;  4BVX A;  3H93 A;  3KMN A;  4QL9 A;  5G5E A;  2DIY A;  4WET A;  5B8B A;  2H1D A;  4FIW A;  5A1N B;  4K0G A;  2IIY A;  4POM A;  2CA8 A;  2YCD A;  1GTA A;  4HZ2 A;  2X49 A;  4V1A p;  4V2L A;  2R4V A;  4PI0 C;  4TXV A;  4HQZ A;  2LJK A;  5F07 A;  2B6M A;  3UVH A;  3HZ4 A;  4PTS A;  3HCZ A;  3HVN A;  2PU9 C;  1FG4 A;  2QA1 A;  1XWB A;  4GRF A;  4IN0 A;  1T7P B;  1YQ1 A;  3L9V A;  5DVB A;  1BAY A;  2OJL A;  4ZL8 A;  2VCW A;  3TU3 B;  3EE2 A;  2VLV A;  1O85 A;  2V32 A;  3KMO A;  4K5R A;  3A5I A;  2ALB A;  1GP1 A;  2WB9 A;  5HR1 A;  2QC7 A;  4OMV A;  2FWG A;  2ZUP A;  1S3R A;  1A2L A;  4NAX A;  4JRR A;  3A2V A;  4EL1 A;  2WW1 A;  3GH9 A;  1XWA A;  2VD1 A;  5G1L A;  1TDI A;  3GUS A;  3RDW A;  5E59 A;  2WVX B;  5DCG A;  2FNO A;  2TRX A;  3G7Y A;  1A2M A;  2IMI A;  1JZO A;  1FW1 A;  1M2A A;  2HXK A;  4PQH A;  1TJD A;  1GSU A;  2FWE A;  3ERG A;  5BMU B;  1QMV A;  2JAC A;  1SU9 A;  2C0G A;  2F3M A;  2VCZ A;  2VL2 A;  1B9Y C;  1B9X C;  4O5R A;  4MF6 A;  5ECN B;  4XS4 A;  3ZL5 A;  3V1W A;  5D9W A;  2VM1 A;  1K3O A;  4HU7 A;  2V2G A;  1WJK A;  2H72 A;  2MBT A;  1Z6N A;  3D22 A;  2DJ2 A;  3WYW A;  3FR3 A;  2E7P A;  2LJA A;  5F8B A;  3LWA A;  2LNT A;  4E8H A;  2OE1 A;  4PGT A;  4AKX B;  3FR6 A;  1X5C A;  5HQP A;  1ILO A;  1AQX A;  1BQ7 A;  4POK A;  3ERW A;  2O7K A;  2VL9 A;  4EDZ A;  2HRA A;  4JBB A;  1ZZY A;  5DJL A;  1PX6 A;  2VL3 A;  5DAL B;  1U88 A;  3A2W A;  1K0B A;  5G1K A;  2I4A A;  4KW6 A;  3IBH A;  4TW5 A;  4ZXG A;  1EGO A;  3G7J A;  4O5Q A;  2OE3 A;  3QFB C;  2DMM A;  3HVX A;  4X0X A;  1U6T A;  2H66 A;  3TJK A;  2O89 A;  1X5E A;  2JU5 A;  3F3Q A;  3JCM L;  3DD3 A;  5IIZ A;  4ZL7 A;  5B6N A;  3GX0 A;  1K0N A;  2R6K A;  3QPM A;  1X5D A;  1EGR A;  3CMI A;  1PL2 A;  2H0I A;  2NBS A;  3P8W A;  5H5R A;  1PN9 A;  3KZQ A;  1DUG A;  3GL3 A;  1PFO A;  3GFK A;  2AB6 A;  2WZ9 A;  6GST A;  2YOI A;  1I9D A;  1K0D A;  3HJP A;  3APS A;  3GA4 A;  4PHZ C;  4POB A;  1TW9 A;  2VAF A;  4FXY P;  2C0F A;  1EOG A;  2FWF A;  2LUS A;  1K3Y A;  3C7M A;  3ME7 A;  3TKS E;  1XG8 A;  5IOX A;  1PN0 A;  2MZC A;  2GZZ A;  1VGL A;  2IL3 A;  4HI7 A;  4TR1 B;  3FZ9 A;  1XBS A;  5HR0 A;  1YEX A;  5CRG A;  1YF1 A;  1M7T A;  2Z9S A;  2O87 A;  4YKG A;  1UC7 A;  3IAS 2;  1DSB A;  3F3R A;  2WW0 A;  5G5F A;  2HLS A;  1SK0 A;  4ILF A;  5EL8 A;  3FRC A;  4WBJ A;  4EO3 A;  4AJ7 A;  3ZFB A;  4N0Z A;  4MP4 A;  2GQL A;  2B5X A;  3HYP A;  5DQY A;  2WZS A;  4I8B A;  3FKF A;  2HRK B;  3D6I A;  4BPY A;  1GNE A;  2R0G A;  5JWR B;  4RQR A;  2IPA A;  2LJR A;  2EFH A;  3L78 A;  5FHI A;  2M80 A;  3P2A A;  3NIV A;  1G6W A;  22GS A;  1JZW A;  2HSM B;  2K8V A;  4DEJ A;  3GSS A;  3TOU A;  4J56 E;  3N9J A;  1TI3 A;  3VWX A;  3FMW A;  3D0Z A;  4PUF C;  3PGT A;  5FT3 A;  4E8E A;  1SKW B;  4O7H A;  3ZIJ A;  1G7E A;  3H8Q A;  3W6G A;  4ZL9 A;  2CZ3 A;  4OD7 A;  4F0B A;  2PER A;  1O81 A;  2MMZ A;  3UAR A;  3UJ1 A;  2JSZ A;  1HQO A;  1GTI A;  3TOT A;  2X8G A;  2WDU A;  3KH9 A;  3KIJ A;  4V2M A;  2BMX A;  3M0F A;  3P7X A;  2MMA A;  4LA1 A;  1FO5 A;  1XZO A;  5CRW A;  5D93 A;  4FH8 A;  3CTF A;  1EZK A;  4NHW A;  2RUF A;  2R0P A;  5CAX A;  1F9M A;  4ICY A;  2DC5 A;  2K6V A;  3LEF A;  1EP7 A;  2ON5 A;  3H1N A;  1X9M B;  3HJO A;  4CDO A;  4TKY A;  2IME A;  2F8F A;  1U3I A;  4KE3 A;  2KUC A;  3PR8 A;  2H70 A;  5D9V A;  4FO5 A;  4MA9 A;  4GTU A;  1Y1U A;  3IV4 A;  5A5H A;  4G0K A;  1YF0 A;  4XHM A;  2VIM A;  4MAB A;  5ELA A;  2AV4 A;  5ID2 A;  2VOC A;  4DVC A;  1TU8 A;  1USB A;  1YJ6 A;  1K0O A;  1E6B A;  3RFR C;  2FA4 A;  2I1U A;  4OO5 A;  1F3A A;  3LXZ A;  2YWM A;  4PUR A;  3VI7 A;  3VUR A;  3FYG A;  5ECK B;  20GS A;  3GH6 A;  1M3J A;  3FZA A;  3HVV A;  1WP0 A;  2KP2 A;  3EMX A;  2FY6 A;  5AN1 A;  3RBT A;  3HXS A;  3IHQ A;  4MJE A;  1M2B A;  3O6T A;  4KUN A;  3BOA A;  4MF7 A;  2JZT A;  4BIK A;  2LRN A;  2H1A A;  4KX4 A;  3MDK A;  1Z7P A;  4HEA 2;  1I5G A;  4P3Y B;  1QQ2 A;  4ACS A;  4F2I A;  3D21 A;  1SD8 A;  4KND A;  4K6X A;  3DML A;  5J3R A;  4OFT A;  1MTC A;  1R26 A;  4RI7 A;  4AGS A;  2UV8 G;  2H1L A;  3EC3 A;  5ECS A;  3M9J A;  5GSS A;  3ZRE A;  1F3B A;  1GSQ A;  5ECQ B;  3PH9 A;  2YN1 A;  5ECR B;  2O8V B;  2CV4 A;  2DJ1 A;  3IHG A;  1O8X A;  1LBK A;  5HFG A;  5IMC A;  3F0I A;  2DJ3 A;  2XBQ A;  5G2Z A;  3EVI A;  3GTU A;  2PVQ A;  3MWH A;  2CQ9 A;  1XCC A;  1GSY A;  1PD2 1;  5GAN D;  4BVY A;  4GQF A;  5DDL A;  2OKA A;  4MH3 A;  2P31 A;  5KN3 A;  1SYX A;  3KXO A;  2M46 A;  4G0I A;  3CRT A;  4F82 A;  1EV4 A;  3ZRD A;  3RPP A;  2GQM A;  2HSH A;  4KF9 A;  3DKS A;  4E68 A;  2FHE A;  2RM5 A;  3M3M A;  5BRT A;  4GDF A;  4ECB A;  2FA8 A;  5IMF A;  3ZZX A;  2FWH A;  4K2D A;  1V9W A;  5JWO B;  3QAG A;  1RQM A;  1Z6M A;  4IQA A;  2B1K A;  1GLQ A;  2N5B A;  3C8E A;  1GTU A;  4G10 A;  2HFD A;  3EIN A;  4EF0 A;  3DVX A;  3ZIT A;  3WT2 A;  4POL A;  4ISD A;  17GS A;  1EEM A;  2YJH A;  2QA2 A;  3TRP A;  3F4S A;  5ECL B;  5LNK e;  4HUA A;  4N3Z A;  2AJQ B;  2C0E A;  3SBC A;  3TCO A;  3GYK A;  4NMU A;  3APO A;  3ZTL A;  3TKQ A;  3KH7 A;  1Z3E A;  4A5P A;  5F0G A;  3H4K A;  1BG1 A;  5C00 A;  1E2Y A;  5CRH A;  4ML1 A;  3QAW A;  1N25 A;  2LKU A;  3DRN A;  4TN8 A;  3VI5 A;  2IFQ B;  5LCZ A;  3DWV A;  4XIH A;  1GWC A;  2H6X A;  4ECJ A;  1HNB A;  5J4Y A;  4BVX B;  5A34 A;  3IR4 A;  1C72 A;  1XFL A;  3ZML A;  5ECH B;  3KM6 A;  1FAA A;  1KNG A;  3MNG A;  1S3C A;  2PBJ A;  2GST A;  1TRW A;  3F6F A;  12GS A;  1K0M A;  4YH2 A;  1JHB A;  5CNW A;  2FLS A;  4AF2 A;  4ZB7 A;  2KLX A;  1B8X A;  3HZ8 A;  1OKD A;  4HZ4 A;  2DKH A;  1SKR B;  4TR4 A;  3EU3 A;  1A23 A;  4G01 A;  1GLP A;  4XTS A;  4WR4 A;  1PQN A;  1T8E B;  1JLV A;  3TGZ A;  1TP9 A;  2V41 A;  3GNJ A;  3TJB A;  4DSR A;  1J9B A;  3NOF A;  4RI6 A;  4X43 A;  3KJY A;  1V57 A;  3GX8 A;  3C1S A;  2LRC A;  2R37 A;  1XOA A;  2H6Z A;  3W8J A;  18GS A;  4FYC A;  4MCU A;  1DE1 A;  2WVY A;  3RPN A;  4USS A;  4GWR A;  1R5A A;  1HNC A;  1YKA A;  4JU5 A;  4L0W A;  1ZGN A;  3M8N A;  4FQU A;  2L5O A;  3CYN A;  3IK9 A;  4MPG A;  3LOR A;  1PL1 A;  3O76 A;  2PMT A;  3F63 A;  5A4V A;  1SVO A;  2YJ7 A;  2C0D A;  4ZBA A;  4BWQ A;  5AGY A;  1K3L A;  2E2G A;  3UVT A;  2E2M A;  4KAE A;  4ZB6 A;  1H75 A;  2J9H A;  4PI2 C;  2VCX A;  2YNX A;  1TXX A;  4YAP A;  4XS4 B;  5ECM B;  4JZQ A;  4EXJ A;  2OBK A;  5H5S A;  5J41 A;  4XRD A;  4V1A g;  1UA5 A;  2WGR A;  2MYG A;  4TRX A;  1QGV A;  1JZD A;  4YQM A;  4EC0 A;  3BBY A;  2A4H A;  1Q4J A;  1WWJ A;  2RII A;  2A2R A;  4ULX A;  2HRF A;  2L59 A;  4IHU A;  3HJM A;  1Z7R A;  3I43 A;  1THO A;  1AC1 A;  2HSN B;  4JR4 A;  2YWI A;  4MNN A;  4F9Z A;  3HDC A;  4IQ1 A;  1R4W A;  4ZBD A;  4EE0 A;  1PKW A;  3EPT A;  1V40 A;  4TOP A;  2L4C A;  2OAD A;  2DLX A;  3TUE A;  2DML A;  1SEN A;  1CQH A;  4KDY A;  2HQT A;  9GSS A;  2H19 A;  3TKR A;  3H79 A;  1MDI A;  1WE0 A;  4HSC X;  3DEX A;  3P90 A;  1GSD A;  2HE3 A;  2PWJ A;  3C73 A;  1SD9 A;  1SYR A;  3S9F A;  3Q74 A;  2C80 A;  2H8L A;  1OC8 A;  4O5U A;  3WGD A;  1QFN A;  3UOM A;  3CWG A;  4NPB A;  2ZNM A;  3VWV A;  2LQQ A;  2X8H A;  4D73 A;  4ZIJ A;  4LMV A;  2GZP A;  4IKH A;  2O3E A;  4AKG A;  2MBS A;  3LYK A;  4IBP A;  2H01 A;  1ZYE A;  4TR0 A;  4HQS A;  2J23 A;  1VF4 A;  3KEB A;  1PA3 A;  1W4V A;  3BCK A;  4ZB9 A;  4CY8 A;  1TRV A;  4I2T A;  1OAZ A;  4ID0 A;  5CRD A;  1AQV A;  2H75 A;  2BTO T;  3UMA A;  4QQ7 A;  1BYE A;  2H1G A;  4NXI A;  4F0C A;  1BF5 A;  1X9W B;  4H86 A;  5DQS A;  4KSO A;  2C4J A;  1NM3 A;  2GVP A;  2REM A;  4Z7X A;  1YEW C;  3Q19 A;  3CXG A;  2K9F A;  4IVF A;  3F8U A;  3GKX A;  3D4T A;  1NHO A;  4GQC A;  2XPD A;  4YKF A;  3IOS A;  3QFA C;  1ZYN A;  1TRU A;  4NV5 A;  5HR2 A;  3DGQ A;  2V6O A;  5EY6 A;  1TTZ A;  4I6X A;  3BCI A;  2CX3 A;  5C04 A;  4X1U A;  2YZU A;  3VLN A;  2D2Z A;  2FCH A;  4XRA A;  4O92 A;  4YQV A;  4I2U A;  4L5O A;  3APQ A;  4KSM A;  1GUH A;  5DAK B;  1MD3 A;  5A4U A;  4EDY A;  3RAZ A;  4KDU A;  2UZ8 A;  2RLI A;  4AJ8 A;  3DXB A;  3RHB A;  2PGT A;  3UIW A;  2H1B A;  5H5Q A;  5IMA A;  2PVO C;  5DBQ A;  5JWQ B;  4K0N A;  1NW2 A;  2I3Y A;  1X9S B;  1TRS A;  4ZIL A;  1SVL A;  3C71 A;  1GUL A;  1WRY A;  1OYJ A;  2ON7 A;  3FK8 A;  1GUM A;  1X0R A;  4MH2 A;  1EEJ A;  3K8N A;  2H73 A;  2OAC A;  3BD2 A;  2O36 A;  3MIX A;  1M99 A;  5J9C A;  19GS A;  2DJK A;  4O32 A;  4KA0 A;  2YPM A;  1T4Z A;  2DIZ A;  1WPI A;  4K2X A;  4ECI A;  3EYT A;  3N5O A;  5KOW A;  3UEM A;  2A2S A;  3U6V A;  2GQK A;  3QCP A;  2BJX A;  5ID2 B;  5AIV A;  2EFC A;  3AY8 A;  2I9H A;  2YAN A;  2E0Q A;  1FOV A;  3G9B A;  1PRX A;  2CAQ A;  5AIX A;  7GSS A;  4N10 A;  2FD3 A;  1F6M C;  2B5E A;  4Q5Q A;  4Q5F A;  1VF3 A;  1A8L A;  3VK9 A; 
#chains in the Genus database with same CATH homology
 1XW5 A;  4DSS A;  5KN1 A;  1ERW A;  3ZFL A;  1S3A A;  2IMF A;  2YV9 A;  16GS A;  4MJC A;  3LXT A;  4JR6 A;  4TXO A;  3ZLP A;  3VPQ A;  3ZVJ D;  5IPG A;  2WRT A;  2YP6 A;  4HJM A;  4HOJ A;  3LG6 A;  5ECI B;  3ISO A;  11GS A;  5J9B A;  2VCV A;  2AUV A;  1KEB A;  3HMJ G;  1FB0 A;  6GSY A;  5GAP D;  2R5G A;  1K0C A;  2A2P A;  2TIR A;  4JE1 A;  5INY A;  3E3E A;  1BX9 A;  2DJJ A;  3CTG A;  1WIK A;  3GUR A;  1NHY A;  1XPV A;  2VM2 A;  3J7Y b;  1VF1 A;  1AUC A;  5B7C A;  3I69 A;  1Y25 A;  4WEY A;  1SJI A;  3LGC A;  2HZE A;  2FGX A;  5HFI A;  1QXH A;  5EVO A;  2P0G A;  3TKS C;  1OC9 A;  4QL7 A;  1A0F A;  4FYB A;  4J57 E;  2WUL A;  1HYU A;  4Q5N A;  1T4Y A;  1Z9H A;  3MYD A;  4GSS A;  1SKS B;  4BVY B;  1TU7 A;  2V1M A;  1PKZ A;  1F37 A;  1SL1 B;  2H6Y A;  4Q5R A;  2C3N A;  4BA7 A;  5A5K A;  2AHE A;  1HD2 A;  1ZYP A;  2OE0 A;  4G19 A;  3HA9 A;  2LRT A;  2HNL A;  2IN3 A;  2GZY A;  3LFL A;  2L6D A;  4WR5 A;  2QGV A;  1ERT A;  3MAK A;  1O73 A;  1XVQ A;  3TRQ A;  2K18 A;  4K7O A;  4XS6 A;  4GLT A;  1KBN A;  1B4Q A;  5DCH A;  1MEK A;  1OE7 A;  2H0G A;  1A8Y A;  4N30 A;  1SK2 A;  2DBC A;  4ZBB A;  3LW9 A;  2DJ0 A;  4MPF A;  4BL7 A;  1A24 A;  2EIQ A;  4PXO A;  4N0V A;  3J7Y k;  4IJI A;  2HI7 A;  3D4M A;  4WF4 A;  3BJ5 A;  4KCE A;  3TJJ A;  1IYH A;  1AQW A;  4RUV A;  1OKT A;  4OO4 A;  1IYI A;  3LQ7 A;  5ABR A;  6GSV A;  2VLU A;  1GH2 A;  2AYT A;  1GTB A;  4FYU A;  1ZOF A;  5ENU A;  3IPZ A;  2P5Q A;  1VF2 A;  2GS3 A;  3ZIV A;  2VD0 A;  3QR6 A;  4IS0 A;  2B5Y A;  1YDK A;  2IFQ A;  4JED A;  4AJ6 A;  2VKZ G;  4X4J A;  4ECC A;  2EIO A;  2XBI A;  4CW9 A;  5HR3 A;  1R5P A;  2GLR A;  5A34 B;  1XVW A;  5KN0 A;  4Z2T A;  1QK8 A;  1PMT A;  5A1N A;  3ZYW A;  1G6Y A;  4KDX A;  2HRN A;  3GRX A;  1V2A A;  2IMD A;  2GT6 A;  4LLR A;  4G9H A;  4LL1 B;  4MZC A;  1SL0 B;  3IRA A;  2RUE A;  3UBK A;  2X64 A;  3ME8 A;  3TB2 A;  4L8E A;  1TK0 B;  4DSQ A;  5IM9 A;  2TRC P;  2L6C A;  2L4Q A;  3DIE A;  2F8A A;  4WF5 A;  4K5S A;  3DVW A;  3GN3 A;  2CVB A;  5B6M A;  5D9X A;  3GST A;  2WFC A;  2NDO A;  2G2Q A;  1R7H A;  5IMV A;  4EIP A;  4GSN A;  2H0H A;  5COH A;  1PX7 A;  1EOH A;  2I81 A;  1LJR A;  2OT3 A;  1K0A A;  2DKI A;  2N5A A;  3KTL A;  3FHK A;  4L5L A;  2ZCT A;  1XW6 A;  5LD0 A;  2QKE A;  2ES7 A;  2N5F A;  4MMM A;  5BMU A;  3WT1 A;  2PN8 A;  1GSS A;  5IPH A;  5ELG A;  2GGT A;  2CVK A;  5JCW A;  3A2X A;  3GMF A;  5IMZ A;  4IP6 A;  3ZVJ A;  3CSH A;  2KHP A;  4K1F A;  4W66 A;  2PUK C;  1O8W A;  5ECP B;  5JCG A;  4F03 A;  4OCF A;  2CVD A;  3UAP A;  2HZF A;  3LJR A;  1WOU A;  5D8I A;  4AKH A;  3HHV A;  5DJM A;  4K8M A;  1FHE A;  3VFI A;  3UBL A;  3QDN A;  3KD0 A;  1W89 A;  1FOH A;  4YQU A;  4CY6 A;  1MD4 A;  4Z2U A;  1JFU A;  3ZMK A;  3L9S A;  4IP1 A;  1PGT A;  3CSI A;  1Z5Y E;  3GV1 A;  5DAL A;  2HSN A;  1GSF A;  3QMX A;  2LNS A;  4IGJ A;  4QMK A;  2JZS A;  3PIN A;  1KTE A;  2EIR A;  4TVE A;  4GCI A;  1EV9 A;  4IJ3 A;  5ECO B;  5J4V A;  3FZ4 A;  1M2D A;  1SK1 A;  2RM6 A;  1S3D A;  1GRX A;  4NWY A;  4MDC A;  1XWC A;  2LQO A;  4MJB A;  1PSQ A;  1XIY A;  6GSS A;  1UN2 A;  4WKW A;  4PX1 A;  3QOU A;  2C8U A;  3KP8 A;  1TOF A;  3TKS A;  2MMO A;  1CQG A;  3L4N A;  5F05 A;  5IO0 A;  2IWT A;  2VCQ A;  1BED A;  1GSE A;  2HT9 A;  3M9K A;  2NTO A;  4LL4 B;  1O7U A;  2FUG 2;  4D73 B;  1J08 A;  5G31 A;  1OVN A;  5KEJ A;  5CO3 A;  1JZR A;  5J40 A;  3HY2 A;  3KCM A;  1TKD B;  3M1G A;  4TR1 A;  3R2Q A;  2CAI A;  1N8J A;  1JLW A;  3KGK A;  1NSW A;  4WXT A;  4GXZ A;  4KCA A;  4HJ2 A;  1YZX A;  3G7I A;  5IQY A;  1U87 A;  1SJZ A;  4MF5 A;  1XWG A;  2R3X A;  2JAD A;  3Q6O A;  5JCU A;  2HYX A;  2R0C A;  1BJX A;  4LMW A;  2O85 A;  2HRK A;  5IOW A;  1ABA A;  6GSX A;  1HNA A;  3IC4 A;  1ZL9 A;  2PPT A;  1B48 A;  1AXD A;  1WMJ A;  5KOX A;  3C1R A;  1ACV A;  2YZH A;  1DE2 A;  1Y6E A;  2CT6 A;  1VRS D;  4MJA A;  4I97 A;  4MZW A;  5FWG A;  2LEG A;  5J47 A;  2OA7 A;  2A4V A;  8GSS A;  5IMD A;  2HSM A;  3HKR A;  14GS A;  1G7O A;  2CX4 A;  2VCT A;  5CRE A;  3CBU A;  2K8S A;  1GNW A;  2H76 A;  2B7K A;  3O3T A;  1XW9 A;  2F51 A;  2X8C A;  2X99 A;  2LV3 A;  4GST A;  3TDG A;  1FB6 A;  2P5R A;  4KH7 A;  2C3T A;  1V58 A;  3DYR A;  3L9U A;  2H71 A;  2H74 A;  1ZYQ B;  2HSY A;  2VUP A;  4OWY A;  4MK3 A;  5E4W A;  2EC4 A;  5EPF A;  2GSS A;  10GS A;  2IMK A;  2YWO A;  3CRU A;  1AAZ A;  5F06 A;  5DAK A;  3IXR A;  2AAW A;  5KN2 A;  1O6J A;  6GSU A;  6GSW A;  5D96 A;  3FZ5 A;  13GS A;  2R2J A;  1ERV A;  1YVL A;  2C3Q A;  5GST A;  3W8S A;  1BG5 A;  2X4A A;  3I9V 2;  1T00 A;  3GKK A;  3WD6 A;  4RQX A;  2L5L A;  1AIU A;  1N2A A;  3QD9 A;  3IE3 A;  4EIQ A;  4PQI A;  1FVK A;  3F6D A;  3GL5 A;  3IDV A;  2GSQ A;  2H30 A;  4K7I A;  4MZB A;  2JL4 A;  1SJ6 A;  4BWS A;  4MLY A;  1M9A A;  2IJY A;  1ST9 A;  1YY7 A;  1J0F A;  1A0R P;  3GIX A;  5A5H B;  2O5V A;  4J2F A;  3I6A A;  4K9Z A;  5CP1 A;  2VO4 A;  1TI1 A;  1EWX A;  5J4U A;  5D9T A;  3E0U A;  4KGI A;  4NHZ A;  2GTU A;  2EFD A;  2VL2 C;  4PNG A;  2GSR A;  5A4W A;  3EUR A;  4KB3 A;  2WCI A;  4DSS B;  4L0U A;  2YV7 A;  4EVM A;  2XPE A;  3UL3 A;  4TR3 A;  2NPB A;  4CHS A;  4TXO B;  3TKP A;  1YKC A;  1XWK A;  1SVM A;  2F9S A;  3A5W A;  1RW1 A;  2KP1 A;  1T1V A;  3R3E A;  1B4P A;  3FEU A;  2V6K A;  4NV2 A;  2L57 A;  5B8A A;  1ERU A;  4PQ1 A;  5G30 A;  3VPT A;  1XOB A;  3NZN A;  2NVL A;  3GKN A;  2CZ2 A;  4ML6 A;  4OCE A;  4AI6 A;  4V2N A;  2B7J A;  2JZR A;  3A3T A;  1LU4 A;  1YEP A;  1T3B A;  4EKZ A;  2QSI A;  1A2J A;  5L71 A;  3TJG A;  4PNF A;  2B1L A;  3IC8 A;  1EP8 A;  1SL2 B;  1OC3 A;  3GKM A;  1U3A A;  3GHA A;  3QAV A;  2LS5 A;  1TK5 B;  1ZCP A;  4N11 A;  4HU9 A;  1G0T A;  3IK7 A;  1TK8 B;  3GTU B;  1ZMA A;  3ERF A;  4WBR D;  2M72 A;  2HZE B;  4IW9 A;  3OR5 A;  1DBY A;  3L0H A;  1OC9 B;  1FVJ A;  2YWN A;  5GZZ B;  2WS2 A;  2DSA A;  4XCS A;  3IAM 2;  4AKI A;  3E9J B;  1URM A;  3VWU A;  4GF0 A;  1M0U A;  3TRX A;  3IA1 A;  3LSZ A;  1RK4 A;  3HD5 A;  2EFE A;  2XC2 A;  3VWW A;  1ML6 A;  1AW9 A;  5AIS A;  4K7N A;  3F4R A;  3SWL A;  3RHC A;  3EU4 A;  3PPU A;  3FR9 A;  2VLT A;  2GT5 A;  1Q98 A;  4EUY A;  1OE8 A;  5J5N A;  2MMN A;  3EWL A;  4PUA A;  3U5R E;  3WGX A;  3KTB A;  1M9B A;  4IEL A;  2LTK A;  4G2E A;  2JSY A;  3US3 A;  2LST A;  2WJU A;  3KP9 A;  3TJF A;  3FW2 A;  4OFN A;  4Z2R A;  1V98 A;  4ZB8 A;  3ED3 A;  1MDK A;  4BL7 B;  3Q18 A;  3F4T A;  1H4O A;  4HS1 A;  4XS1 A;  5IO2 A;  2G0F A;  2KOK A;  1THX A;  4I5Q A;  3HVS A;  2C1Y A;  1UVZ A;  3CSJ A;  5HFK A;  2B3S A;  4OFM A;  1ON4 A;  1F2E A;  1XXU A;  2XHF A;  3F9U A;  1TXU A;  4HDE A;  3WGE A;  1GL8 A;  1GUK A;  4G0L A;  2OBI A;  3MSZ A;  3EMP A;  4YAV A;  5CYY A;  5D73 A;  1QUW A;  2GDR A;  3LYP A;  3FY7 A;  3D5J A;  1MDJ A;  4BVX A;  3H93 A;  3KMN A;  4QL9 A;  5G5E A;  2DIY A;  4WET A;  5B8B A;  2H1D A;  4FIW A;  5A1N B;  4K0G A;  2IIY A;  4POM A;  2CA8 A;  2YCD A;  1GTA A;  4HZ2 A;  2X49 A;  4V1A p;  4V2L A;  2R4V A;  4TXV A;  4HQZ A;  2LJK A;  5F07 A;  2B6M A;  3UVH A;  3HZ4 A;  4PTS A;  3HCZ A;  2PU9 C;  1FG4 A;  2QA1 A;  1XWB A;  4GRF A;  4IN0 A;  1T7P B;  1YQ1 A;  3L9V A;  5DVB A;  1BAY A;  2OJL A;  4ZL8 A;  2VCW A;  3TU3 B;  3EE2 A;  2VLV A;  1O85 A;  2V32 A;  3KMO A;  4K5R A;  3A5I A;  2ALB A;  1GP1 A;  2WB9 A;  5HR1 A;  2QC7 A;  4OMV A;  2FWG A;  2ZUP A;  1A2L A;  4NAX A;  4JRR A;  3A2V A;  4EL1 A;  3GH9 A;  1XWA A;  2VD1 A;  5G1L A;  1TDI A;  3GUS A;  3RDW A;  5E59 A;  5DCG A;  2FNO A;  2TRX A;  3G7Y A;  1A2M A;  2IMI A;  1JZO A;  1FW1 A;  1M2A A;  2HXK A;  4PQH A;  1TJD A;  1GSU A;  2FWE A;  3ERG A;  5BMU B;  1QMV A;  2JAC A;  1SU9 A;  2C0G A;  2F3M A;  2VCZ A;  2VL2 A;  1B9Y C;  1B9X C;  4O5R A;  4MF6 A;  5ECN B;  4XS4 A;  3ZL5 A;  3V1W A;  5D9W A;  2VM1 A;  1K3O A;  4HU7 A;  2V2G A;  1WJK A;  2H72 A;  2MBT A;  1Z6N A;  3D22 A;  2DJ2 A;  3WYW A;  3FR3 A;  2E7P A;  2LJA A;  5F8B A;  3LWA A;  2LNT A;  4E8H A;  2OE1 A;  4PGT A;  4AKX B;  3FR6 A;  1X5C A;  5HQP A;  1ILO A;  1AQX A;  1BQ7 A;  4POK A;  3ERW A;  2O7K A;  2VL9 A;  4EDZ A;  2HRA A;  4JBB A;  1ZZY A;  5DJL A;  1PX6 A;  2VL3 A;  5DAL B;  1U88 A;  3A2W A;  1K0B A;  5G1K A;  2I4A A;  4KW6 A;  3IBH A;  4TW5 A;  4ZXG A;  1EGO A;  3G7J A;  4O5Q A;  2OE3 A;  3QFB C;  2DMM A;  3HVX A;  4X0X A;  1U6T A;  2H66 A;  3TJK A;  2O89 A;  1X5E A;  2JU5 A;  3F3Q A;  3JCM L;  3DD3 A;  5IIZ A;  4ZL7 A;  5B6N A;  3GX0 A;  1K0N A;  2R6K A;  3QPM A;  1X5D A;  1EGR A;  3CMI A;  1PL2 A;  2H0I A;  2NBS A;  3P8W A;  5H5R A;  1PN9 A;  3KZQ A;  1DUG A;  3GL3 A;  3GFK A;  2AB6 A;  2WZ9 A;  6GST A;  2YOI A;  1I9D A;  1K0D A;  3HJP A;  3APS A;  3GA4 A;  4POB A;  1TW9 A;  2VAF A;  2C0F A;  1EOG A;  2FWF A;  2LUS A;  1K3Y A;  3C7M A;  3ME7 A;  3TKS E;  5IOX A;  1PN0 A;  2MZC A;  2GZZ A;  1VGL A;  2IL3 A;  4HI7 A;  4TR1 B;  3FZ9 A;  1XBS A;  5HR0 A;  1YEX A;  5CRG A;  1YF1 A;  1M7T A;  2Z9S A;  2O87 A;  4YKG A;  1UC7 A;  3IAS 2;  1DSB A;  3F3R A;  5G5F A;  2HLS A;  1SK0 A;  4ILF A;  5EL8 A;  3FRC A;  4WBJ A;  4EO3 A;  4AJ7 A;  3ZFB A;  4N0Z A;  4MP4 A;  2GQL A;  2B5X A;  3HYP A;  5DQY A;  4I8B A;  3FKF A;  2HRK B;  3D6I A;  4BPY A;  1GNE A;  2R0G A;  5JWR B;  4RQR A;  2IPA A;  2LJR A;  2EFH A;  3L78 A;  5FHI A;  2M80 A;  3P2A A;  3NIV A;  1G6W A;  22GS A;  1JZW A;  2HSM B;  2K8V A;  4DEJ A;  3GSS A;  3TOU A;  4J56 E;  3N9J A;  1TI3 A;  3VWX A;  3FMW A;  3D0Z A;  4PUF C;  3PGT A;  5FT3 A;  4E8E A;  1SKW B;  4O7H A;  3ZIJ A;  1G7E A;  3H8Q A;  3W6G A;  4ZL9 A;  2CZ3 A;  4OD7 A;  4F0B A;  2PER A;  1O81 A;  2MMZ A;  3UAR A;  3UJ1 A;  2JSZ A;  1HQO A;  1GTI A;  3TOT A;  2X8G A;  2WDU A;  3KH9 A;  3KIJ A;  4V2M A;  2BMX A;  3M0F A;  3P7X A;  2MMA A;  4LA1 A;  1FO5 A;  1XZO A;  5CRW A;  5D93 A;  4FH8 A;  3CTF A;  1EZK A;  4NHW A;  2RUF A;  2R0P A;  5CAX A;  1F9M A;  4ICY A;  2DC5 A;  2K6V A;  3LEF A;  1EP7 A;  2ON5 A;  3H1N A;  1X9M B;  3HJO A;  4CDO A;  4TKY A;  2IME A;  2F8F A;  1U3I A;  4KE3 A;  2KUC A;  3PR8 A;  2H70 A;  5D9V A;  4FO5 A;  4MA9 A;  4GTU A;  1Y1U A;  3IV4 A;  5A5H A;  4G0K A;  1YF0 A;  4XHM A;  2VIM A;  4MAB A;  5ELA A;  2AV4 A;  5ID2 A;  2VOC A;  4DVC A;  1TU8 A;  1USB A;  1YJ6 A;  1K0O A;  1E6B A;  2FA4 A;  2I1U A;  4OO5 A;  1F3A A;  3LXZ A;  2YWM A;  4PUR A;  3VI7 A;  3VUR A;  3FYG A;  5ECK B;  20GS A;  3GH6 A;  3FZA A;  3HVV A;  1WP0 A;  2KP2 A;  3EMX A;  2FY6 A;  5AN1 A;  3RBT A;  3HXS A;  3IHQ A;  4MJE A;  1M2B A;  3O6T A;  4KUN A;  3BOA A;  4MF7 A;  2JZT A;  2LRN A;  2H1A A;  4KX4 A;  3MDK A;  1Z7P A;  4HEA 2;  1I5G A;  4P3Y B;  1QQ2 A;  4ACS A;  4F2I A;  3D21 A;  1SD8 A;  4KND A;  4K6X A;  3DML A;  5J3R A;  4OFT A;  1MTC A;  1R26 A;  4RI7 A;  4AGS A;  2UV8 G;  2H1L A;  3EC3 A;  5ECS A;  3M9J A;  5GSS A;  3ZRE A;  1F3B A;  1GSQ A;  5ECQ B;  3PH9 A;  2YN1 A;  5ECR B;  2O8V B;  2CV4 A;  2DJ1 A;  3IHG A;  1O8X A;  1LBK A;  5HFG A;  5IMC A;  3F0I A;  2DJ3 A;  2XBQ A;  5G2Z A;  3EVI A;  3GTU A;  2PVQ A;  3MWH A;  2CQ9 A;  1XCC A;  1GSY A;  1PD2 1;  5GAN D;  4BVY A;  4GQF A;  5DDL A;  2OKA A;  4MH3 A;  2P31 A;  5KN3 A;  1SYX A;  3KXO A;  2M46 A;  4G0I A;  3CRT A;  4F82 A;  1EV4 A;  3ZRD A;  3RPP A;  2GQM A;  2HSH A;  4KF9 A;  3DKS A;  4E68 A;  2FHE A;  2RM5 A;  3M3M A;  5BRT A;  4GDF A;  4ECB A;  2FA8 A;  5IMF A;  3ZZX A;  2FWH A;  4K2D A;  1V9W A;  5JWO B;  3QAG A;  1RQM A;  1Z6M A;  4IQA A;  2B1K A;  1GLQ A;  2N5B A;  3C8E A;  1GTU A;  4G10 A;  2HFD A;  3EIN A;  4EF0 A;  3DVX A;  3ZIT A;  3WT2 A;  4POL A;  4ISD A;  17GS A;  1EEM A;  2YJH A;  2QA2 A;  3TRP A;  3F4S A;  5ECL B;  5LNK e;  4HUA A;  4N3Z A;  2AJQ B;  2C0E A;  3SBC A;  3TCO A;  3GYK A;  4NMU A;  3APO A;  3ZTL A;  3TKQ A;  3KH7 A;  1Z3E A;  4A5P A;  5F0G A;  3H4K A;  1BG1 A;  5C00 A;  1E2Y A;  5CRH A;  4ML1 A;  3QAW A;  1N25 A;  2LKU A;  3DRN A;  4TN8 A;  3VI5 A;  2IFQ B;  5LCZ A;  3DWV A;  4XIH A;  1GWC A;  2H6X A;  4ECJ A;  1HNB A;  5J4Y A;  4BVX B;  5A34 A;  3IR4 A;  1C72 A;  1XFL A;  3ZML A;  5ECH B;  3KM6 A;  1FAA A;  1KNG A;  3MNG A;  1S3C A;  2PBJ A;  2GST A;  1TRW A;  3F6F A;  12GS A;  1K0M A;  4YH2 A;  1JHB A;  5CNW A;  2FLS A;  4AF2 A;  4ZB7 A;  2KLX A;  1B8X A;  3HZ8 A;  1OKD A;  4HZ4 A;  2DKH A;  1SKR B;  4TR4 A;  3EU3 A;  1A23 A;  4G01 A;  1GLP A;  4XTS A;  4WR4 A;  1PQN A;  1T8E B;  1JLV A;  3TGZ A;  1TP9 A;  2V41 A;  3GNJ A;  3TJB A;  4DSR A;  1J9B A;  3NOF A;  4RI6 A;  4X43 A;  3KJY A;  1V57 A;  3GX8 A;  3C1S A;  2LRC A;  2R37 A;  1XOA A;  2H6Z A;  3W8J A;  18GS A;  4FYC A;  4MCU A;  1DE1 A;  3RPN A;  4USS A;  4GWR A;  1R5A A;  1HNC A;  1YKA A;  4JU5 A;  4L0W A;  1ZGN A;  3M8N A;  4FQU A;  2L5O A;  3CYN A;  3IK9 A;  4MPG A;  3LOR A;  1PL1 A;  3O76 A;  2PMT A;  3F63 A;  5A4V A;  1SVO A;  2YJ7 A;  2C0D A;  4ZBA A;  4BWQ A;  5AGY A;  1K3L A;  2E2G A;  3UVT A;  2E2M A;  4KAE A;  4ZB6 A;  1H75 A;  2J9H A;  2VCX A;  2YNX A;  1TXX A;  4YAP A;  4XS4 B;  5ECM B;  4JZQ A;  4EXJ A;  2OBK A;  5H5S A;  5J41 A;  4XRD A;  4V1A g;  1UA5 A;  2WGR A;  2MYG A;  4TRX A;  1QGV A;  1JZD A;  4YQM A;  4EC0 A;  3BBY A;  2A4H A;  1Q4J A;  1WWJ A;  2RII A;  2A2R A;  4ULX A;  2HRF A;  2L59 A;  4IHU A;  3HJM A;  1Z7R A;  3I43 A;  1THO A;  1AC1 A;  2HSN B;  4JR4 A;  2YWI A;  4MNN A;  4F9Z A;  3HDC A;  4IQ1 A;  1R4W A;  4ZBD A;  4EE0 A;  1PKW A;  3EPT A;  1V40 A;  4TOP A;  2L4C A;  2OAD A;  2DLX A;  3TUE A;  2DML A;  1SEN A;  1CQH A;  4KDY A;  2HQT A;  9GSS A;  2H19 A;  3TKR A;  3H79 A;  1MDI A;  1WE0 A;  3DEX A;  3P90 A;  1GSD A;  2HE3 A;  2PWJ A;  3C73 A;  1SD9 A;  1SYR A;  3S9F A;  3Q74 A;  2C80 A;  2H8L A;  1OC8 A;  4O5U A;  3WGD A;  1QFN A;  3UOM A;  3CWG A;  4NPB A;  2ZNM A;  3VWV A;  2LQQ A;  2X8H A;  4D73 A;  4ZIJ A;  4LMV A;  2GZP A;  4IKH A;  4AKG A;  2MBS A;  3LYK A;  4IBP A;  2H01 A;  1ZYE A;  4TR0 A;  4HQS A;  2J23 A;  1VF4 A;  3KEB A;  1PA3 A;  1W4V A;  3BCK A;  4ZB9 A;  4CY8 A;  1TRV A;  4I2T A;  1OAZ A;  4ID0 A;  5CRD A;  1AQV A;  2H75 A;  2BTO T;  3UMA A;  4QQ7 A;  1BYE A;  2H1G A;  4NXI A;  4F0C A;  1BF5 A;  1X9W B;  4H86 A;  5DQS A;  4KSO A;  2C4J A;  1NM3 A;  2GVP A;  2REM A;  4Z7X A;  3Q19 A;  3CXG A;  2K9F A;  4IVF A;  3F8U A;  3GKX A;  3D4T A;  1NHO A;  4GQC A;  2XPD A;  4YKF A;  3IOS A;  3QFA C;  1ZYN A;  1TRU A;  4NV5 A;  5HR2 A;  3DGQ A;  2V6O A;  5EY6 A;  1TTZ A;  4I6X A;  3BCI A;  2CX3 A;  5C04 A;  4X1U A;  2YZU A;  3VLN A;  2D2Z A;  2FCH A;  4XRA A;  4O92 A;  4YQV A;  4I2U A;  4L5O A;  3APQ A;  4KSM A;  1GUH A;  5DAK B;  1MD3 A;  5A4U A;  4EDY A;  3RAZ A;  4KDU A;  2UZ8 A;  2RLI A;  4AJ8 A;  3DXB A;  3RHB A;  2PGT A;  3UIW A;  2H1B A;  5H5Q A;  5IMA A;  2PVO C;  5DBQ A;  5JWQ B;  4K0N A;  1NW2 A;  2I3Y A;  1X9S B;  1TRS A;  4ZIL A;  1SVL A;  3C71 A;  1GUL A;  1WRY A;  1OYJ A;  2ON7 A;  3FK8 A;  1GUM A;  1X0R A;  4MH2 A;  1EEJ A;  3K8N A;  2H73 A;  2OAC A;  3BD2 A;  3MIX A;  1M99 A;  5J9C A;  19GS A;  2DJK A;  4O32 A;  4KA0 A;  2YPM A;  1T4Z A;  2DIZ A;  1WPI A;  4K2X A;  4ECI A;  3EYT A;  3N5O A;  5KOW A;  3UEM A;  2A2S A;  3U6V A;  2GQK A;  3QCP A;  2BJX A;  5ID2 B;  5AIV A;  2EFC A;  3AY8 A;  2I9H A;  2YAN A;  2E0Q A;  1FOV A;  3G9B A;  1PRX A;  2CAQ A;  5AIX A;  7GSS A;  4N10 A;  1F6M C;  2B5E A;  2FD3 A;  4Q5Q A;  4Q5F A;  1VF3 A;  1A8L A;  3VK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...