3HJMA

Crystal structure of human glutathione transferase pi y108v mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Influence of the H-site residue 108 on human glutathione transferase P1-1 ligand binding: structure-thermodynamic relationships and thermal stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3hjmA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hjmA01
1HNAA 4PTSA 2GQMA 3WT2A 1T00A 1TI1A 1GUKA 1M9AA 4GQFA 2LKUA 5D73A 2BTOT 2NDOA 4YQVA 2ON5A 4TVEA 2AJQB 2VL2C 5IIZA 4KDUA 1K0DA 4Q5FA 2AHEA 1EV9A 4EC0A 1TRVA 4KSOA 3ME8A 1XPVA 1M9BA 3LSZA 3GTUA 3DVXA 5E59A 4PQ1A 1YY7A 3RHCA 2B7KA 2IFQA 3IBHA 5ID2A 2GS3A 2B1LA 5ECNB 2TRCP 4LL4B 3FZAA 1SD8A 4IELA 4MP4A 2GSQA 5D93A 1GTIA 2VM2A 3GNJA 1SL0B 2B5EA 1TK0B 3DGQA 5J3RA 2B5YA 1VGLA 4XRDA 2YV9A 3QCPA 4IQ1A 3ZFLA 1J9BA 2DJ3A 4L5LA 3UARA 2VCWA 3W8SA 1Q4JA 2V6OA 3GKMA 3L0HA 2C3NA 1THXA 4G9HA 2DMMA 1HD2A 1XOBA 4MZCA 3F63A 1XW6A 3Q74A 1FG4A 1SK2A 3GH9A 3QAVA 3E3EA 2VCVA 1YEPA 4QQ7A 1XFLA 2H71A 5H5SA 1JHBA 5CREA 3TRPA 3IRAA 2VL9A 2HQTA 3I6AA 2MMZA 3KM6A 3Q18A 4V1Ag 5HR1A 4QL7A 1NM3A 1OVNA 3HJPA 3QPMA 2X8GA 2AB6A 1PGTA 1JLWA 3BD2A 2VCQA 3GA4A 1EP8A 4NXIA 4ECJA 3ZL5A 4KSMA 2FWEA 5D8IA 1MD4A 3TJFA 3L78A 1SKWB 2WRTA 3CRTA 2HE3A 4IJIA 4DVCA 3LGCA 4EUYA 2HFDA 1F9MA 5L71A 1ERTA 5GSSA 3VWVA 3HD5A 5ECHB 4ZB6A 3LWAA 2H6YA 2L4QA 4G19A 4YH2A 4DSQA 3SWLA 3IK7A 2C0FA 4G0KA 2DBCA 4O92A 3RPPA 4I97A 1GULA 1OC3A 3GIXA 2H74A 3DMLA 1F3AA 3QMXA 3F6FA 2O89A 4MABA 3G7IA 2CQ9A 2H1AA 3UEMA 3M3MA 5JCUA 3TRXA 1U6TA 4POLA 1EEMA 1GWCA 2D2ZA 4EF0A 4HDEA 1MDJA 2VD1A 1T4ZA 3N5OA 2MBTA 2RLIA 4KNDA 3R3EA 5IOXA 3J7Yb 4WBJA 2DJ0A 1IYHA 3TJBA 1URMA 1Y6EA 1GSEA 5D9XA 5ECOB 3G9BA 4I5QA 4TXOB 3EU4A 4I2TA 1SKSB 13GSA 2REMA 2CT6A 2LTKA 3HVSA 1JZWA 3HA9A 3VI5A 4FYBA 4GXZA 3RBTA 3Q6OA 3HZ4A 3HY2A 3FRCA 3RHBA 4PGTA 4WKWA 2FUG2 5IPGA 2G2QA 1K0AA 4IS0A 3TJKA 4EO3A 4OCFA 1A2LA 5IO2A 2PBJA 1V98A 2KHPA 3LXTA 4OFMA 2RUEA 3ZIJA 5DVBA 4L0UA 2VLUA 3UVTA 2JZRA 1TRSA 1O7UA 4ZBAA 3FR6A 3IDVA 1N8JA 6GSSA 2PVOC 1YDKA 3RDWA 4BVYB 2XBIA 1V40A 9GSSA 5AIXA 4ZXGA 3CBUA 2N5AA 3TRQA 4LLRA 4JE1A 3HKRA 1GSSA 2VD0A 12GSA 3GMFA 1FO5A 2X99A 4NV5A 1F6MC 1W89A 3KGKA 2DJ2A 2LRCA 2YOIA 2HSMA 2OJLA 2YNXA 3KP8A 2AAWA 2LSTA 3KH7A 2IL3A 2H01A 3CSJA 1XWKA 3DVWA 1OE7A 4TXOA 3FR3A 4ZBDA 1ST9A 1FW1A 4TRXA 3ZREA 2IN3A 1WPIA 1VF3A 4OD7A 5KN2A 3FYGA 5LD0A 1HNBA 5CRGA 3MNGA 2YANA 1T3BA 4MJBA 1H75A 3IV4A 1H4OA 3VPTA 5JCWA 4ECCA 5H5QA 4F82A 4K1FA 4BL7B 2FWHA 2I4AA 3HCZA 5EL8A 5ENUA 2DSAA 5KN3A 2OA7A 3DRNA 5D9WA 4WF5A 4BVXA 2WB9A 2IWTA 4GF0A 4WR5A 3EINA 5DQYA 4K7OA 1X9WB 5C00A 1TRWA 5G2ZA 2O85A 4BVYA 2A2SA 2B1KA 5HFIA 3C71A 3VPQA 2YWOA 3GURA 4HZ2A 2C0EA 1O81A 1GRXA 2CAIA 4CHSA 5B6MA 5IMZA 1B4QA 3IC8A 2JU5A 3ZFBA 1SJIA 1UN2A 3FY7A 2LRNA 4FIWA 4POBA 2OBKA 2H72A 1B8XA 1ON4A 3QFAC 2HSYA 3KMOA 1XCCA 1FVJA 3RPNA 4NWYA 3UL3A 3M0FA 3EVIA 2PWJA 2DLXA 1PSQA 2ZCTA 4POKA 2R4VA 1FVKA 2YWMA 4F9ZA 4ZL8A 1T8EB 1EGRA 2R3XA 2VO4A 5AISA 1SL1B 4EE0A 2LRTA 2QGVA 4JBBA 2L6DA 1TU8A 2HRKB 4HU7A 3ZVJD 4JR4A 4KF9A 3KP9A 5IO0A 1FAAA 3MAKA 1SENA 3LG6A 2DIYA 3NIVA 4BWQA 4EDZA 3LXZA 4GSSA 4J56E 4NPBA 4ID0A 1K0CA 5CNWA 2C4JA 1ZYEA 2MYGA 3TKSC 4FH8A 1IYIA 2WDUA 18GSA 1Z9HA 2L5OA 2HNLA 3O6TA 3BOAA 5GAND 4XRAA 4F2IA 1PA3A 3TKSA 2IMKA 4LL1B 1KBNA 2FGXA 2OACA 1JLVA 3GX0A 1MEKA 4GSTA 4D73A 4PURA 3SBCA 3FW2A 2OE1A 5J4UA 1RQMA 1SYXA 4N11A 4GSNA 1GSFA 3EE2A 2E2MA 4BWSA 4FYUA 2H66A 1AC1A 2O87A 2JZTA 4KCAA 2F9SA 4OWYA 1XWGA 5IMCA 4KDYA 1PL2A 1EGOA 2DJJA 1TP9A 1K3LA 4OFNA 2J9HA 2VCTA 2F8AA 1R5AA 2HRKA 1X5EA 5AGYA 1T1VA 3D4TA 1J0FA 11GSA 2VL2A 2WGRA 5D96A 3KTLA 2HT9A 3D21A 1GNWA 2H1DA 1TW9A 5F06A 3APSA 2PERA 1XWCA 2B5XA 1ZYQB 1S3AA 3GKKA 3UMAA 3I43A 3GYKA 5ABRA 2H75A 3L9SA 1N2AA 3TKRA 2R2JA 3DIEA 2OKAA 3VLNA 1AAZA 2H76A 2YP6A 2C3TA 3DWVA 1KNGA 3IR4A 4K0NA 2NBSA 3QAGA 3M8NA 2K9FA 1A8LA 4PX1A 3IPZA 4N10A 2E2GA 3EWLA 5G5EA 1E2YA 2JACA 3A2VA 5JWRB 3PR8A 3C1RA 1BG5A 3KJYA 4IQAA 2B6MA 2UZ8A 3ZVJA 2WJUA 1B4PA 3F4TA 3ERWA 5F07A 3VWXA 2FWGA 1U88A 4KH7A 1VF4A 3ME7A 2V6KA 1Z7PA 2VAFA 3C73A 1DE1A 1X0RA 2AYTA 3PINA 5AIVA 1GTUA 4ZL9A 3HVXA 4XS1A 4XS4B 4MF7A 1J08A 3GKNA 3O76A 2YV7A 5ECLB 5KEJA 2DJKA 2GGTA 4K2DA 2F8FA 4KCEA 2IMDA 2F51A 2FLSA 1T4YA 3EC3A 1R26A 20GSA 3VWWA 1A8YA 2LQOA 4K7IA 4MPGA 1OYJA 1WRYA 3H93A 1TTZA 5A4UA 4TR1B 1VRSD 1BQ7A 3QAWA 3U5RE 2GTUA 2MMOA 5CO3A 5G30A 4LMWA 5EY6A 3KCMA 1XBSA 1G7OA 5HR0A 4RI7A 4TXVA 1AXDA 2LQQA 2N5BA 2L59A 1K3YA 2G0FA 2KP1A 1AIUA 2HYXA 1B9XC 1AQWA 3D22A 1OE8A 1CQHA 2PU9C 3WGDA 2M46A 1EV4A 1R4WA 1DE2A 4IKHA 5FT3A 2IMEA 2JSZA 2OE3A 5GAPD 1DBYA 2AUVA 1K0MA 5B6NA 2QSIA 3I9V2 2X8HA 1GP1A 1AQVA 4EXJA 1PKWA 3LFLA 4MH3A 1G0TA 4MJEA 5F0GA 3L4NA 4OO4A 5ECPB 2C8UA 4MF5A 1FB6A 1R7HA 1WIKA 2CVBA 1MD3A 5KN0A 1LBKA 4XS4A 2YZHA 3GSSA 3LQ7A 5F05A 2FWFA 1A24A 1M2DA 1JZDA 5ELGA 1QFNA 2MZCA 4P3YB 1ZZYA 3O3TA 1B9YC 5H5RA 3DD3A 3FK8A 1OC9B 2PGTA 1QMVA 3MDKA 5CRWA 2L6CA 4N30A 1MTCA 17GSA 4TR1A 3TOUA 5A4VA 4TN8A 1PN9A 2EIQA 1Z7RA 3QDNA 1TDIA 3ZZXA 3IE3A 3TKQA 4WEYA 2KUCA 3ZMKA 5B7CA 2FY6A 4WBRD 4G0LA 4G10A 2H0HA 3KZQA 4KB3A 4IN0A 1RW1A 2TIRA 3TOTA 4AJ8A 3TCOA 4ML1A 1SJZA 2IMIA 4OCEA 3TUEA 3NOFA 4V1Ap 3PPUA 2R5GA 2BJXA 2MMAA 1X5CA 1XW5A 4AJ6A 1WP0A 4K6XA 2ES7A 5LCZA 1M0UA 1SK0A 1QUWA 1I9DA 4FYCA 3HZ8A 4HUAA 1TI3A 3EYTA 6GSYA 5CYYA 3W6GA 1PQNA 2RM5A 5HFKA 5ECMB 3ZTLA 3LEFA 1OC9A 1TK8B 3A5WA 1Z6MA 3PH9A 2H6ZA 4KGIA 4HEA2 5HR2A 4N0ZA 1Z3EA 4FQUA 1V2AA 1YZXA 1GSUA 2H70A 2H19A 2OBIA 1ERVA 3FR9A 4PUFC 4RQRA 3HYPA 1E6BA 2CAQA 3A2WA 4GTUA 4L5OA 3GHAA 4YQUA 4MMMA 4NHWA 1PX7A 4F0BA 4ACSA 1EEJA 2P5QA 3GH6A 2CVDA 1XW9A 5IMFA 1XVQA 2WCIA 1PKZA 5CRHA 2CVKA 1ZGNA 1F2EA 4IW9A 5INYA 3P90A 1FB0A 4KW6A 1BEDA 2YWIA 2HSNB 5G1LA 1SU9A 4V2MA 14GSA 4TR4A 1G6YA 1NSWA 1QGVA 2O8VB 4KA0A 4PQIA 3IA1A 1EP7A 2IMFA 1JZRA 2C1YA 2LNTA 2L4CA 3GRXA 5FHIA 4ML6A 3FKFA 4RUVA 1YJ6A 2YPMA 2CX4A 3IAM2 3APQA 3HJOA 2GZYA 3ZLPA 4TKYA 3EMXA 2CA8A 1UVZA 4GRFA 4Q5RA 1LJRA 4USSA 1PX6A 1FOVA 1X9MB 5DQSA 1QQ2A 4NV2A 3ERFA 2KLXA 3ED3A 3GSTA 4L8EA 3DYRA 5GSTA 4KUNA 3ZIVA 4PXOA 2PN8A 19GSA 4CDOA 4K8MA 1V9WA 4NAXA 1SYRA 4KDXA 1VF2A 2FCHA 5ECQB 1BX9A 5ELAA 3S9FA 1THOA 4XS6A 1TKDB 4IBPA 3ZMLA 2WZ9A 4ZILA 3IAS2 3CTFA 5IM9A 3TDGA 2HRAA 3FZ9A 4BL7A 1V58A 3DEXA 2XBQA 4OMVA 2A4VA 4TOPA 4AGSA 1O8XA 1TJDA 4BPYA 10GSA 2YCDA 2C3QA 4EDYA 2LJRA 5D9VA 5DBQA 5J9CA 1USBA 2XPEA 2M80A 3QD9A 4NHZA 2FA4A 1PMTA 1UC7A 4F0CA 3IOSA 1GTAA 2P31A 3OR5A 2RIIA 3M1GA 1M2AA 3FZ4A 5J9BA 1SD9A 1K0BA 4POMA 3ZYWA 1W4VA 3HJMA 2FHEA 2VCXA 2V32A 2WULA 2I81A 3C1SA 3BBYA 2DIZA 5JWOB 2ON7A 3EMPA 5FWGA 2WFCA 2I3YA 4RQXA 1YKCA 2H6XA 2MBSA 2K6VA 2JL4A 4KAEA 3WT1A 3F3QA 4LMVA 1A2MA 1GUHA 5DDLA 4JZQA 1WOUA 3GN3A 1PD21 2RM6A 4JU5A 5G5FA 3TKPA 2HSHA 1MDIA 2NTOA 4ILFA 1K0NA 3ZITA 3ISOA 3F8UA 1M7TA 4V2LA 3U6VA 1XVWA 4I8BA 2NPBA 2VOCA 6GSUA 2LJKA 4ZIJA 1ERWA 2H73A 4GLTA 1YQ1A 1ZOFA 2EC4A 2NVLA 1Y25A 4X0XA 2H1BA 1FHEA 6GSXA 2V2GA 1AW9A 2HZEB 4I2UA 2FNOA 4KX4A 3IK9A 1XZOA 2HZFA 1G6WA 3IHQA 1A2JA 3HHVA 4ISDA 3KEBA 6GSTA 4MK3A 2ZNMA 2GVPA 2PUKC 3KIJA 2ALBA 3F6DA 3DKSA 2H8LA 2YZUA 3R2QA 5IOWA 1EOHA 2K8VA 1X5DA 3P7XA 4MLYA 3TJGA 1ABAA 3A3TA 3LYPA 3Q19A 3GKXA 3WGEA 4ULXA 3TJJA 3VI7A 1GL8A 1DSBA 1M2BA 3D0ZA 1SL2B 3GUSA 1A23A 2H30A 1C72A 5DJMA 5D9TA 1SJ6A 3IC4A 5KN1A 2KOKA 4ZB8A 2HRFA 5DAKB 4ECIA 3GFKA 4MZWA 2GSTA 4MF6A 5HR3A 1GSYA 2ZUPA 1DUGA 1XIYA 1JFUA 3GX8A 1ZMAA 3M9KA 2TRXA 3CMIA 2L57A 3HXSA 1HNCA 3QR6A 5DCGA 3UAPA 1GH2A 1O85A 2DJ1A 2GSRA 4K9ZA 3KTBA 3FEUA 5CAXA 4J57E 2H0GA 3WD6A 2GQKA 4DSRA 3VURA 4IGJA 2HZEA 2LNSA 2GDRA 2QC7A 4HOJA 3IXRA 3F4RA 2IPAA 2DMLA 5DJLA 4WF4A 3LJRA 2J23A 1TXXA 16GSA 1ERUA 1WJKA 3PGTA 3ERGA 1NW2A 5JWQB 1TOFA 2VCZA 2X8CA 2LUSA 1BYEA 4G0IA 1A0RP 2P0GA 2EIOA 5A5KA 4EKZA 2FD3A 4AF2A 2C0DA 3C8EA 3H1NA 3TKSE 2RUFA 2P5RA 1HYUA 2I9HA 4MH2A 3F3RA 4TR0A 4Z7XA 1AQXA 2E0QA 3L9VA 2LJAA 1GLPA 3APOA 1X9SB 2E7PA 3ZRDA 5ECRB 1GNEA 4Q5QA 1GUMA 1QXHA 5DAKA 2Z9SA 3F4SA 1KEBA 4V2NA 1WE0A 2GZPA 3W8JA 1BAYA 4TR3A 2V41A 1TU7A 3D5JA 2YJHA 1VF1A 3LORA 3D6IA 2EIRA 4KE3A 1Z6NA 4Q5NA 2OADA 3H8QA 2GSSA 2F3MA 4E8HA 1EWXA 2YJ7A 1XXUA 5CRDA 1M99A 4HQZA 1SKRB 4L0WA 2LS5A 4AJ7A 1GSQA 2HSMB 3CYNA 3G7YA 3GL5A 4JRRA 2GZZA 3RAZA 3AY8A 5DALB 3N9JA 2GT6A 3CRUA 2JZSA 4YAPA 1U87A 2VIMA 4EL1A 3MWHA 4PNGA 1K3OA 2VM1A 1V57A 3EURA 3FZ5A 4MDCA 1YEXA 1XWAA 4IJ3A 1AUCA 4RI6A 3VWUA 4PNFA 3EU3A 2H0IA 1T7PB 2LEGA 3BCIA 2YN1A 4DEJA 1U3AA 2B7JA 1YF1A 3VFIA 4HQSA 2CZ2A 1Q98A 3CSIA 3GV1A 4X43A 2YWNA 1OC8A 5IMAA 2PPTA 3UIWA 2GLRA 3C7MA 4MCUA 2I1UA 3NZNA 1A0FA 5EPFA 4HI7A 4YAVA 1ACVA 4HZ4A 1GTBA 1JZOA 4OFTA 4JR6A 3GL3A 5J41A 4HU9A 2CZ3A 5ECKB 2XHFA 4MJCA 4BVXB 4IVFA 1RK4A 5AN1A 5B8AA 1G7EA 4IHUA 2XPDA 1SK1A 2CV4A 3KD0A 2GQLA 3D4MA 3K8NA 1OKTA 1O6JA 3DXBA 4PUAA 1EOGA 4HJ2A 4E8EA 1S3DA 5G1KA 3UJ1A 2WS2A 5DALA 4WETA 2DC5A 4XCSA 4WXTA 4HJMA 4IP1A 1WMJA 3KH9A 5E4WA 4CW9A 2N5FA 4EVMA 2R37A 4K7NA 1S3CA 3CTGA 3TGZA 1UA5A 3CSHA 1O8WA 1WWJA 4HS1A 4G2EA 3WGXA 2JADA 1NHOA 6GSWA 3H79A 2CX3A 3UVHA 1MDKA 1ZL9A 3F0IA 2JSYA 3UBLA 4K0GA 2C0GA 1R5PA 2VLVA 3VK9A 1PRXA 4F03A 3QFBC 1QK8A 5ECIB 4GQCA 2O7KA 4O5RA 3QOUA 2C80A 3JCML 4LA1A 5EVOA 3FHKA 4XHMA 1U3IA 4PQHA 5HQPA 1XOAA 2QKEA 4BA7A 1BJXA 5LNKe 3M9JA 4XIHA 4TW5A 22GSA 3HVVA 1OAZA 1KTEA 3P8WA 2PMTA 3WYWA 1EZKA 3BCKA 4IP6A 3A2XA 2GT5A 4O32A 3UOMA 2FA8A 2HXKA 4X1UA 1B48A 4N0VA 5BMUA 4MA9A 3H4KA 3E9JB 5G31A 4O7HA 1GSDA 1PL1A 5IMDA 4FO5A 1ZCPA 4MJAA 4DSSB 3E0UA 5J5NA 2K8SA 4D73B 1ILOA 3P2AA 3KMNA 3I69A 3KXOA 2MMNA 5C04A 5CP1A 1YKAA 4ZBBA 2HRNA 5DCHA 4XTSA 7GSSA 4H86A 5GZZB 4GCIA 2B3SA 5ECSA 2LV3A 3CXGA 2VLTA 5JCGA 3V1WA 5B8BA 4ZL7A 4GWRA 1TRUA 1HQOA 1YF0A 3TB2A 2VUPA 6GSVA 2VL3A 3GTUB 3J7Yk 1TK5B 2R6KA 4JEDA 2V1MA 4WR4A 2IFQB 2AV4A 3UBKA 5F8BA 5ID2B 2OE0A 8GSSA 1Z5YE 5HFGA 1GLQA 2M72A 2HI7A 3US3A 2IJYA 2XC2A 1CQGA 5IPHA 3LYKA 5COHA 1XWBA 1F3BA 2L5LA 3G7JA 4MZBA 1ML6A 3MSZA 2BMXA 4ZB9A 4ECBA 3BJ5A 2HLSA 4I6XA 1LU4A 1F37A 1I5GA 3L9UA 2IIYA 4MPFA 2H1GA 1K0OA 1OKDA 3F9UA 4OO5A 4DSSA 4QL9A 4YQMA 1NHYA 1O73A 2K18A 5A4WA 2KP2A 5IQYA 2X64A 5IMVA 2PVQA 4NMUA 2A2RA 3HDCA 4J2FA
chains in the Genus database with same CATH superfamily
1HNAA 4PTSA 2GQMA 3WT2A 1T00A 1TI1A 1GUKA 1M9AA 4GQFA 2LKUA 5D73A 2BTOT 2NDOA 4YQVA 2ON5A 4TVEA 2AJQB 2VL2C 5IIZA 4KDUA 1K0DA 4Q5FA 2AHEA 1EV9A 4EC0A 1TRVA 4KSOA 3ME8A 1XPVA 1M9BA 3LSZA 3GTUA 3DVXA 5E59A 2EFHA 4PQ1A 1YY7A 3RHCA 2B7KA 2IFQA 3IBHA 5ID2A 2GS3A 2B1LA 1ZYNA 5ECNB 2TRCP 4LL4B 3FZAA 1SD8A 4IELA 4MP4A 2GSQA 5D93A 1GTIA 2VM2A 3GNJA 1SL0B 2B5EA 4E68A 1TK0B 3DGQA 5J3RA 2B5YA 1VGLA 4XRDA 2YV9A 2O36A 3QCPA 4IQ1A 3ZFLA 1J9BA 2DJ3A 4L5LA 3UARA 2VCWA 3W8SA 1Q4JA 2V6OA 3GKMA 3L0HA 2C3NA 1THXA 4G9HA 1S4BP 1HD2A 1XOBA 2DMMA 4MZCA 3F63A 1XW6A 3Q74A 1SVOA 1FG4A 1SK2A 3GH9A 5J4YA 3QAVA 3E3EA 2VCVA 1YEPA 4QQ7A 1XFLA 2H71A 5H5SA 1JHBA 4YKGA 5CREA 3TRPA 3IRAA 2VL9A 2HQTA 1S3RA 3I6AA 2MMZA 3KM6A 3Q18A 4V1Ag 5HR1A 4PI2C 4QL7A 1NM3A 1OVNA 3HJPA 3QPMA 2X8GA 2AB6A 1PGTA 1JLWA 3BD2A 2VCQA 2R0PA 3GA4A 1EP8A 4NXIA 4ECJA 3ZL5A 4KSMA 2FWEA 5D8IA 1MD4A 3TJFA 3L78A 1SKWB 2WRTA 3CRTA 2HE3A 4IJIA 4DVCA 3LGCA 4EUYA 2HFDA 1F9MA 5L71A 1ERTA 5GSSA 3VWVA 3HD5A 5ECHB 5BRTA 4ZB6A 3LWAA 1YVLA 2H6YA 2L4QA 4G19A 4PHZC 4YH2A 4DSQA 3SWLA 3IK7A 2C0FA 4G0KA 2DBCA 4O92A 3RPPA 4I97A 1GULA 1OC3A 3GIXA 2H74A 3DMLA 1F3AA 3QMXA 3F6FA 2O89A 4MABA 3G7IA 2CQ9A 2H1AA 3UEMA 3M3MA 5JCUA 3TRXA 2EFDA 1U6TA 4POLA 1EEMA 1GWCA 2D2ZA 4EF0A 4GDFA 4HDEA 1MDJA 2VD1A 1T4ZA 3N5OA 2MBTA 2RLIA 4KNDA 3R3EA 5IOXA 3J7Yb 4WBJA 2DJ0A 1IYHA 3TJBA 1URMA 1Y6EA 1GSEA 5D9XA 5ECOB 4K5RA 3G9BA 4I5QA 4TXOB 3EU4A 4I2TA 1SKSB 13GSA 2REMA 2CT6A 2LTKA 3HVSA 1JZWA 3HA9A 3VI5A 4FYBA 4GXZA 3RBTA 3Q6OA 3HZ4A 3HY2A 3FRCA 3RHBA 4ICYA 4PGTA 4WKWA 2FUG2 5IPGA 2G2QA 1K0AA 4IS0A 3TJKA 4EO3A 4OCFA 1A2LA 5IO2A 2PBJA 1V98A 2KHPA 3LXTA 4OFMA 2RUEA 3ZIJA 5DVBA 4L0UA 2VLUA 3UVTA 2JZRA 1TRSA 1O7UA 4ZBAA 3FR6A 3IDVA 4EIPA 1N8JA 6GSSA 2PVOC 1YDKA 3RDWA 4BVYB 2XBIA 1V40A 9GSSA 5AIXA 4ZXGA 3CBUA 2N5AA 3TRQA 4LLRA 3HKRA 4JE1A 1GSSA 2VD0A 12GSA 3GMFA 1FO5A 2X99A 4NV5A 1F6MC 1W89A 3KGKA 2DJ2A 2LRCA 2YOIA 2HSMA 2OJLA 2YNXA 3KP8A 2AAWA 2LSTA 3KH7A 2IL3A 2H01A 3CSJA 1XWKA 3DVWA 1OE7A 4TXOA 3FR3A 4ZBDA 4K5SA 1ST9A 1FW1A 4TRXA 3ZREA 2IN3A 1WPIA 1VF3A 4OD7A 5KN2A 3FYGA 4AI6A 5LD0A 1HNBA 5CRGA 3MNGA 2YANA 1T3BA 4MJBA 1H75A 3IV4A 4HSCX 1H4OA 3VPTA 5JCWA 4ECCA 1SVMA 5H5QA 4F82A 4K1FA 4BL7B 2FWHA 2I4AA 3HCZA 5EL8A 5ENUA 2DSAA 5KN3A 2OA7A 3DRNA 5D9WA 4WF5A 4BVXA 2WW1A 2WB9A 2IWTA 4GF0A 4WR5A 3EINA 5DQYA 1PN0A 4K7OA 1X9WB 5C00A 1TRWA 5G2ZA 2O85A 4BVYA 2A2SA 2B1KA 5HFIA 3C71A 3VPQA 3A5IA 2YWOA 3GURA 4HZ2A 2C0EA 1O81A 4W66A 1GRXA 2CAIA 2QA2A 2WVZA 4CHSA 5B6MA 1YEWC 5IMZA 1B4QA 3IC8A 2JU5A 3ZFBA 1SJIA 1UN2A 2UV8G 3HMJG 3FY7A 2LRNA 4FIWA 4POBA 2OBKA 2H72A 1B8XA 1ON4A 3QFAC 2HSYA 3KMOA 1XCCA 1FVJA 3RPNA 4NWYA 3UL3A 3M0FA 3EVIA 4FXYP 2PWJA 2DLXA 1PSQA 2ZCTA 4POKA 4A5PA 2R4VA 1FVKA 2YWMA 4F9ZA 4ZL8A 1T8EB 1EGRA 2R3XA 4AKXB 2VO4A 5AISA 1SL1B 4EE0A 2LRTA 2QGVA 4JBBA 2L6DA 4EIQA 1TU8A 2HRKB 4HU7A 3ZVJD 4JR4A 4KF9A 3KP9A 5IO0A 1FAAA 3MAKA 1SENA 3LG6A 2DIYA 4G01A 3NIVA 4BWQA 4EDZA 3LXZA 4GSSA 4J56E 4NPBA 4ID0A 1K0CA 5CNWA 2C4JA 1ZYEA 2MYGA 3TKSC 4FH8A 4O5QA 1IYIA 2WDUA 18GSA 1Z9HA 2L5OA 2HNLA 3O6TA 3BOAA 5GAND 4XRAA 4F2IA 1PA3A 3TKSA 2IMKA 4LL1B 1KBNA 2FGXA 2OACA 1JLVA 3GX0A 1MEKA 4GSTA 4D73A 4PURA 3EPTA 3FW2A 3SBCA 2OE1A 5J4UA 1RQMA 1SYXA 4N11A 4GSNA 1GSFA 3EE2A 2E2MA 4BWSA 4FYUA 2H66A 1AC1A 2O87A 2JZTA 4KCAA 2F9SA 4OWYA 1XWGA 5IMCA 4KDYA 1PL2A 1EGOA 2QA1A 2DJJA 1BF5A 1TP9A 1K3LA 2WW3A 4OFNA 2J9HA 2VCTA 2F8AA 1R5AA 2HRKA 1X5EA 5AGYA 4Z2TA 1T1VA 3D4TA 1J0FA 11GSA 2VL2A 2WGRA 5D96A 3KTLA 2HT9A 3D21A 1GNWA 2H1DA 1TW9A 5F06A 3CHXC 3APSA 2PERA 1XWCA 2B5XA 1ZYQB 2R0CA 1S3AA 3GKKA 3UMAA 3I43A 3GYKA 5ABRA 2H75A 3L9SA 1N2AA 3TKRA 2R2JA 3DIEA 2OKAA 3VLNA 1AAZA 2H76A 2YP6A 2C3TA 3DWVA 1KNGA 2WVYA 3IR4A 4K0NA 2NBSA 3QAGA 3M8NA 2K9FA 4O5UA 1A8LA 4PX1A 3IPZA 4N10A 2E2GA 3EWLA 5G5EA 1E2YA 2JACA 3A2VA 5JWRB 3PR8A 3C1RA 1BG5A 3KJYA 4IQAA 2B6MA 2UZ8A 3ZVJA 2WJUA 1B4PA 4CY8A 4CY6A 3F4TA 3ERWA 5F07A 3VWXA 2FWGA 1U88A 4KH7A 1VF4A 3ME7A 2V6KA 1Z7PA 2VAFA 3C73A 1DE1A 1X0RA 2AYTA 3PINA 5AIVA 1GTUA 4ZL9A 3HVXA 4XS1A 4XS4B 4MF7A 1J08A 3GKNA 3O76A 2YV7A 1SVLA 5ECLB 5KEJA 2DJKA 2GGTA 4K2DA 2F8FA 4KCEA 2IMDA 2F51A 2FLSA 1T4YA 3EC3A 1R26A 20GSA 3VWWA 1A8YA 2LQOA 4K7IA 4MPGA 1OYJA 1WRYA 3H93A 1TTZA 5A4UA 4TR1B 1VRSD 1BQ7A 3QAWA 3U5RE 2GTUA 2MMOA 5CO3A 5G30A 4LMWA 5EY6A 3KCMA 1XBSA 1G7OA 5HR0A 4RI7A 4TXVA 1AXDA 2LQQA 2N5BA 2L59A 1K3YA 2G0FA 2KP1A 1AIUA 2HYXA 1B9XC 1AQWA 3D22A 1OE8A 1CQHA 2PU9C 3WGDA 2M46A 1EV4A 1R4WA 1DE2A 4IKHA 5FT3A 2IMEA 2JSZA 2OE3A 5GAPD 1DBYA 2AUVA 1K0MA 5B6NA 2QSIA 3I9V2 2X8HA 1GP1A 1AQVA 4EXJA 1PKWA 3LFLA 4MH3A 1G0TA 4MJEA 5F0GA 3L4NA 4ZB7A 4OO4A 5ECPB 2C8UA 4MF5A 1FB6A 1FOHA 1R7HA 1WIKA 2CVBA 1MD3A 5KN0A 1LBKA 4XS4A 2YZHA 3GSSA 3LQ7A 5F05A 2FWFA 1A24A 1M2DA 1JZDA 5ELGA 1QFNA 2MZCA 4P3YB 1ZZYA 3O3TA 1B9YC 5H5RA 3DD3A 3FK8A 1OC9B 4BIKA 2PGTA 1QMVA 3MDKA 5CRWA 2L6CA 4N30A 1MTCA 17GSA 4TR1A 3TOUA 5A4VA 4TN8A 1PN9A 2EIQA 1BG1A 1Z7RA 3QDNA 1TDIA 3ZZXA 3IE3A 3TKQA 4WEYA 2KUCA 3ZMKA 5B7CA 2FY6A 4WBRD 4G0LA 4G10A 2H0HA 3KZQA 4KB3A 4IN0A 1RW1A 2TIRA 3TOTA 4AJ8A 3TCOA 4ML1A 1SJZA 2IMIA 4OCEA 3MYDA 3TUEA 3NOFA 4V1Ap 3PPUA 2R5GA 2BJXA 2MMAA 1X5CA 1XW5A 4AJ6A 1WP0A 4K6XA 2ES7A 5LCZA 4X4JA 1M0UA 1SK0A 1QUWA 1I9DA 4FYCA 3HZ8A 4HUAA 3LW9A 1TI3A 3EYTA 6GSYA 5CYYA 3W6GA 1PQNA 2X49A 2RM5A 5HFKA 5ECMB 3ZTLA 3LEFA 2WW2A 1OC9A 1TK8B 3A5WA 1Z6MA 3PH9A 2H6ZA 4KGIA 4HEA2 5HR2A 4N0ZA 1Z3EA 4FQUA 1V2AA 1YZXA 1GSUA 2H70A 2H19A 2OBIA 1ERVA 3FR9A 3RGBC 4PUFC 4RQRA 5KOWA 3HYPA 1E6BA 2CAQA 3A2WA 4GTUA 4L5OA 3GHAA 4YQUA 4MMMA 4NHWA 1PX7A 4F0BA 4ACSA 1EEJA 2P5QA 3GH6A 2CVDA 1XW9A 5IMFA 1XVQA 2WCIA 1PKZA 5CRHA 2CVKA 1ZGNA 1TXUA 1F2EA 4IW9A 5INYA 3P90A 1FB0A 4KW6A 1BEDA 2YWIA 2HSNB 5G1LA 1SU9A 4V2MA 14GSA 4TR4A 1G6YA 1NSWA 1QGVA 2O8VB 4KA0A 4PQIA 3IA1A 1EP7A 2IMFA 1JZRA 2C1YA 2LNTA 2L4CA 3GRXA 3CWGA 5FHIA 4ML6A 3FKFA 4RUVA 1YJ6A 2YPMA 2CX4A 3IAM2 3APQA 3HJOA 2GZYA 3ZLPA 4TKYA 3EMXA 2CA8A 1UVZA 4GRFA 1XG8A 3MIXA 4Q5RA 1LJRA 4USSA 1PX6A 1FOVA 1X9MB 5DQSA 1QQ2A 4NV2A 3ERFA 2KLXA 3ED3A 3GSTA 4L8EA 4AKIA 3DYRA 2EFCA 5GSTA 4KUNA 3ZIVA 4PXOA 2PN8A 19GSA 4CDOA 4K8MA 1V9WA 4NAXA 1SYRA 4KDXA 1VF2A 2FCHA 5ECQB 1BX9A 5ELAA 3S9FA 1ZYPA 1THOA 4XS6A 1TKDB 4IBPA 3ZMLA 2WZ9A 4ZILA 3FMWA 3IAS2 3CTFA 5IM9A 3TDGA 2HRAA 3FZ9A 4BL7A 1V58A 2R0GA 3DEXA 2XBQA 4OMVA 2A4VA 4TOPA 5J47A 4AGSA 1O8XA 1TJDA 4BPYA 2WVXB 10GSA 2YCDA 2C3QA 4EDYA 2LJRA 5D9VA 2HSNA 5DBQA 5J9CA 1USBA 2XPEA 2M80A 3QD9A 4NHZA 2FA4A 1I1IP 1PMTA 1UC7A 4F0CA 3IOSA 1GTAA 2P31A 3OR5A 2RIIA 3M1GA 1M2AA 3FZ4A 5J9BA 1SD9A 1K0BA 5A5HB 4POMA 3ZYWA 1W4VA 3HJMA 2X4AA 2FHEA 2VCXA 2V32A 2WULA 2I81A 3C1SA 3BBYA 2DIZA 5JWOB 2DKIA 2ON7A 3EMPA 5FWGA 2WFCA 4YKFA 2I3YA 4RQXA 2DKHA 1YKCA 2H6XA 2MBSA 2K6VA 2JL4A 4KAEA 3WT1A 3F3QA 4AKGA 4LMVA 1A2MA 1GUHA 5DDLA 4JZQA 3HVNA 1WOUA 3GN3A 1PD21 2RM6A 4JU5A 5G5FA 3TKPA 2HSHA 1MDIA 2NTOA 4ILFA 1K0NA 3ZITA 3ISOA 3F8UA 1M7TA 4AKHA 4V2LA 3U6VA 1XVWA 4I8BA 2NPBA 2VOCA 6GSUA 2LJKA 4ZIJA 1ERWA 2H73A 4GLTA 2WVXA 1YQ1A 1ZOFA 2EC4A 1M3JA 2EFEA 2NVLA 1Y25A 4X0XA 2H1BA 1FHEA 6GSXA 2V2GA 1AW9A 2HZEB 2VKZG 4I2UA 2FNOA 4KX4A 3IK9A 1XZOA 2HZFA 5A1NB 1G6WA 3IHQA 1A2JA 3HHVA 4ISDA 3KEBA 6GSTA 4MK3A 2ZNMA 2A4HA 2GVPA 2PUKC 3KIJA 2ALBA 3F6DA 5A5HA 3DKSA 2H8LA 2YZUA 3R2QA 5IOWA 1EOHA 2K8VA 1X5DA 3P7XA 4MLYA 3TJGA 1ABAA 3A3TA 3LYPA 3Q19A 3GKXA 3WGEA 4ULXA 3TJJA 3VI7A 1GL8A 1DSBA 1M2BA 3D0ZA 1SL2B 3GUSA 1A23A 2H30A 1C72A 5DJMA 5D9TA 1SJ6A 3IC4A 5KN1A 2KOKA 4ZB8A 2HRFA 5DAKB 4ECIA 3GFKA 4MZWA 2GSTA 4MF6A 5HR3A 1GSYA 2ZUPA 1DUGA 1XIYA 1JFUA 3GX8A 1ZMAA 3M9KA 2TRXA 3CMIA 2L57A 3HXSA 1HNCA 3QR6A 5DCGA 3UAPA 1GH2A 1O85A 2DJ1A 2GSRA 4K9ZA 3KTBA 3FEUA 5CAXA 4J57E 2H0GA 3WD6A 2GQKA 4DSRA 3VURA 4IGJA 3TU3B 2HZEA 2LNSA 2GDRA 2QC7A 4HOJA 3IXRA 3F4RA 4MNNA 2IPAA 2DMLA 5DJLA 4WF4A 3LJRA 2J23A 1TXXA 16GSA 5A1NA 1ERUA 3RFRC 1WJKA 3PGTA 3ERGA 1NW2A 5JWQB 1TOFA 2VCZA 2X8CA 3IHGA 2LUSA 1BYEA 4G0IA 1A0RP 2P0GA 2EIOA 5A5KA 4EKZA 2A2PA 2FD3A 4AF2A 2C0DA 3C8EA 3H1NA 4N3ZA 3TKSE 1M3IA 2RUFA 2P5RA 1HYUA 2I9HA 4MH2A 3F3RA 4TR0A 4Z7XA 1AQXA 2E0QA 3L9VA 2LJAA 1GLPA 3APOA 1X9SB 2E7PA 3ZRDA 5ECRB 1GNEA 4Q5QA 1GUMA 1QXHA 5DAKA 2Z9SA 3F4SA 1KEBA 4V2NA 1WE0A 2GZPA 3W8JA 1BAYA 4TR3A 2V41A 1TU7A 3D5JA 2YJHA 1VF1A 3LORA 2O5VA 3D6IA 2EIRA 4KE3A 1Z6NA 4Q5NA 2OADA 3H8QA 2GSSA 1PFOA 2F3MA 4E8HA 1EWXA 2YJ7A 1XXUA 5CRDA 1M99A 4HQZA 4Z2RA 1SKRB 4L0WA 2LS5A 4AJ7A 1GSQA 2HSMB 3CYNA 3G7YA 3GL5A 4JRRA 2GZZA 3RAZA 3AY8A 5DALB 3N9JA 2GT6A 3CRUA 2JZSA 4YAPA 1U87A 2VIMA 4EL1A 3MWHA 4PNGA 1K3OA 2VM1A 1V57A 2OT3A 3EURA 4QMKA 3FZ5A 4MDCA 1YEXA 1XWAA 4IJ3A 1AUCA 5A34B 2H1LA 4RI6A 1N25A 3VWUA 4PNFA 3EU3A 2H0IA 1T7PB 2LEGA 3BCIA 2YN1A 4DEJA 1U3AA 2B7JA 1YF1A 3VFIA 4HQSA 2CZ2A 1Q98A 3CSIA 3GV1A 4X43A 2YWNA 1OC8A 5IMAA 2PPTA 3UIWA 2GLRA 3C7MA 4MCUA 2I1UA 3NZNA 1A0FA 5EPFA 4HI7A 4YAVA 1ACVA 4HZ4A 1GTBA 1JZOA 4OFTA 4JR6A 3GL3A 5J41A 4HU9A 2CZ3A 5ECKB 2XHFA 4MJCA 4BVXB 4IVFA 1RK4A 5AN1A 5B8AA 1G7EA 4IHUA 2XPDA 1SK1A 2CV4A 3KD0A 2GQLA 3D4MA 3K8NA 1OKTA 1O6JA 3DXBA 5BMUB 4PUAA 1EOGA 4HJ2A 4E8EA 1S3DA 5G1KA 3UJ1A 2WS2A 5DALA 4WETA 2DC5A 4XCSA 4WXTA 4PI0C 4HJMA 4IP1A 1WMJA 3KH9A 5E4WA 4CW9A 2N5FA 4EVMA 2R37A 4K7NA 5A34A 1S3CA 3CTGA 3TGZA 1UA5A 3CSHA 1O8WA 1WWJA 4HS1A 4G2EA 3WGXA 2JADA 1NHOA 6GSWA 3H79A 2CX3A 3UVHA 1MDKA 1ZL9A 3F0IA 2JSYA 3UBLA 4K0GA 2C0GA 1R5PA 2VLVA 3VK9A 1PRXA 4F03A 3QFBC 1QK8A 5ECIB 4Z2UA 4GQCA 2O7KA 4O5RA 3QOUA 2C80A 3JCML 4LA1A 5EVOA 3FHKA 4XHMA 1U3IA 1Y1UA 4PQHA 5HQPA 1XOAA 2QKEA 4BA7A 1BJXA 3CQFA 5LNKe 3M9JA 4XIHA 4TW5A 22GSA 3HVVA 1OAZA 1KTEA 3P8WA 2PMTA 3WYWA 1EZKA 3BCKA 4IP6A 3A2XA 2GT5A 4O32A 3UOMA 2FA8A 2HXKA 4X1UA 1B48A 4N0VA 5BMUA 4MA9A 3H4KA 3E9JB 5J4VA 5KOXA 5G31A 4O7HA 1GSDA 1PL1A 5IMDA 4FO5A 1ZCPA 4MJAA 4DSSB 3E0UA 5J5NA 2K8SA 4D73B 1ILOA 3P2AA 3KMNA 3I69A 3KXOA 2MMNA 5C04A 5CP1A 1YKAA 4ZBBA 2HRNA 5DCHA 4XTSA 7GSSA 4H86A 5GZZB 4GCIA 2B3SA 5ECSA 2LV3A 3CXGA 2VLTA 5JCGA 3V1WA 5B8BA 4ZL7A 4GWRA 1TRUA 1HQOA 1YF0A 3TB2A 2VUPA 6GSVA 2WW0A 2VL3A 3GTUB 3J7Yk 1TK5B 2R6KA 5J40A 4JEDA 2V1MA 4WR4A 2IFQB 2AV4A 3UBKA 5F8BA 5ID2B 2OE0A 8GSSA 1Z5YE 5HFGA 1GLQA 2M72A 2HI7A 3US3A 2IJYA 2XC2A 1CQGA 5IPHA 3LYKA 5COHA 1XWBA 1F3BA 2L5LA 3G7JA 4MZBA 1ML6A 3MSZA 2BMXA 4ZB9A 4ECBA 3BJ5A 2HLSA 4I6XA 1LU4A 1F37A 1I5GA 3L9UA 2IIYA 4MPFA 2H1GA 1K0OA 1OKDA 3F9UA 4OO5A 4DSSA 4QL9A 4YQMA 2O3EA 1NHYA 1O73A 2K18A 5A4WA 2KP2A 5IQYA 2X64A 2WZSA 5IMVA 2PVQA 4K2XA 4NMUA 2A2RA 3HDCA 4J2FA
chains in the Genus database with same CATH topology
1HNAA 4PTSA 2GQMA 3WT2A 1T00A 1TI1A 1GUKA 1M9AA 4GQFA 2LKUA 5D73A 2BTOT 2NDOA 4YQVA 2ON5A 4TVEA 2AJQB 2VL2C 5IIZA 4KDUA 1K0DA 4Q5FA 2AHEA 1EV9A 4EC0A 1TRVA 4KSOA 3ME8A 1XPVA 1M9BA 3LSZA 3GTUA 3DVXA 5E59A 2EFHA 4PQ1A 1YY7A 3RHCA 2B7KA 2IFQA 3IBHA 5ID2A 2GS3A 2B1LA 1ZYNA 5ECNB 2TRCP 4LL4B 3FZAA 1SD8A 4IELA 4MP4A 2GSQA 5D93A 1GTIA 2VM2A 3GNJA 1SL0B 2B5EA 4E68A 1TK0B 3DGQA 5J3RA 2B5YA 1VGLA 4XRDA 2YV9A 3QCPA 4IQ1A 3ZFLA 1J9BA 2DJ3A 4L5LA 3UARA 2VCWA 3W8SA 1Q4JA 2V6OA 3GKMA 3L0HA 2C3NA 1THXA 4G9HA 2DMMA 1HD2A 1XOBA 4MZCA 3F63A 1XW6A 3Q74A 1SVOA 1FG4A 1SK2A 3GH9A 5J4YA 3QAVA 3E3EA 2VCVA 1YEPA 4QQ7A 1XFLA 2H71A 5H5SA 1JHBA 4YKGA 5CREA 3TRPA 3IRAA 2VL9A 2HQTA 3I6AA 2MMZA 3KM6A 3Q18A 4V1Ag 5HR1A 4QL7A 1NM3A 1OVNA 3HJPA 3QPMA 2X8GA 2AB6A 1PGTA 1JLWA 3BD2A 2VCQA 2R0PA 3GA4A 1EP8A 4NXIA 4ECJA 3ZL5A 4KSMA 2FWEA 5D8IA 1MD4A 3TJFA 3L78A 1SKWB 2WRTA 3CRTA 2HE3A 4IJIA 4DVCA 3LGCA 4EUYA 2HFDA 1F9MA 5L71A 1ERTA 5GSSA 3VWVA 3HD5A 5ECHB 5BRTA 4ZB6A 3LWAA 1YVLA 2H6YA 2L4QA 4G19A 4YH2A 4DSQA 3SWLA 3IK7A 2C0FA 4G0KA 2DBCA 4O92A 3RPPA 4I97A 1GULA 1OC3A 3GIXA 2H74A 3DMLA 1F3AA 3QMXA 3F6FA 2O89A 4MABA 3G7IA 2CQ9A 2H1AA 3UEMA 3M3MA 5JCUA 3TRXA 2EFDA 1U6TA 4POLA 1EEMA 1GWCA 2D2ZA 4EF0A 4GDFA 4HDEA 1MDJA 2VD1A 1T4ZA 3N5OA 2MBTA 2RLIA 4KNDA 3R3EA 5IOXA 3J7Yb 4WBJA 2DJ0A 1IYHA 3TJBA 1URMA 1Y6EA 1GSEA 5D9XA 5ECOB 4K5RA 3G9BA 4I5QA 4TXOB 3EU4A 4I2TA 1SKSB 13GSA 2REMA 2CT6A 2LTKA 3HVSA 1JZWA 3HA9A 3VI5A 4FYBA 4GXZA 3RBTA 3Q6OA 3HZ4A 3HY2A 3FRCA 3RHBA 4ICYA 4PGTA 4WKWA 2FUG2 5IPGA 2G2QA 1K0AA 4IS0A 3TJKA 4EO3A 4OCFA 1A2LA 5IO2A 2PBJA 1V98A 2KHPA 3LXTA 4OFMA 2RUEA 3ZIJA 5DVBA 4L0UA 2VLUA 3UVTA 2JZRA 1TRSA 1O7UA 4ZBAA 3FR6A 3IDVA 4EIPA 1N8JA 6GSSA 2PVOC 1YDKA 3RDWA 4BVYB 2XBIA 1V40A 9GSSA 5AIXA 4ZXGA 3CBUA 2N5AA 3TRQA 4LLRA 3HKRA 4JE1A 1GSSA 2VD0A 12GSA 3GMFA 1FO5A 2X99A 4NV5A 1F6MC 1W89A 3KGKA 2DJ2A 2LRCA 2YOIA 2HSMA 2OJLA 2YNXA 3KP8A 2AAWA 2LSTA 3KH7A 2IL3A 2H01A 3CSJA 1XWKA 3DVWA 1OE7A 4TXOA 3FR3A 4ZBDA 4K5SA 1ST9A 1FW1A 4TRXA 3ZREA 2IN3A 1WPIA 1VF3A 4OD7A 5KN2A 3FYGA 4AI6A 5LD0A 1HNBA 5CRGA 3MNGA 2YANA 1T3BA 4MJBA 1H75A 3IV4A 1H4OA 3VPTA 5JCWA 4ECCA 1SVMA 5H5QA 4F82A 4K1FA 4BL7B 2FWHA 2I4AA 3HCZA 5EL8A 5ENUA 2DSAA 5KN3A 2OA7A 3DRNA 5D9WA 4WF5A 4BVXA 2WB9A 2IWTA 4GF0A 4WR5A 3EINA 5DQYA 1PN0A 4K7OA 1X9WB 5C00A 1TRWA 5G2ZA 2O85A 4BVYA 2A2SA 2B1KA 5HFIA 3C71A 3VPQA 3A5IA 2YWOA 3GURA 4HZ2A 2C0EA 1O81A 4W66A 1GRXA 2CAIA 2QA2A 4CHSA 5B6MA 5IMZA 1B4QA 3IC8A 2JU5A 3ZFBA 1SJIA 1UN2A 2UV8G 3HMJG 3FY7A 2LRNA 4FIWA 4POBA 2OBKA 2H72A 1B8XA 1ON4A 3QFAC 2HSYA 3KMOA 1XCCA 1FVJA 3RPNA 4NWYA 3UL3A 3M0FA 3EVIA 2PWJA 2DLXA 1PSQA 2ZCTA 4POKA 4A5PA 2R4VA 1FVKA 2YWMA 4F9ZA 4ZL8A 1T8EB 1EGRA 2R3XA 4AKXB 2VO4A 5AISA 1SL1B 4EE0A 2LRTA 2QGVA 4JBBA 2L6DA 4EIQA 1TU8A 2HRKB 4HU7A 3ZVJD 4JR4A 4KF9A 3KP9A 5IO0A 1FAAA 3MAKA 1SENA 3LG6A 2DIYA 4G01A 3NIVA 4BWQA 4EDZA 3LXZA 4GSSA 4J56E 4NPBA 4ID0A 1K0CA 5CNWA 2C4JA 1ZYEA 2MYGA 3TKSC 4FH8A 4O5QA 1IYIA 2WDUA 18GSA 1Z9HA 2L5OA 2HNLA 3O6TA 3BOAA 5GAND 4XRAA 4F2IA 1PA3A 3TKSA 2IMKA 4LL1B 1KBNA 2FGXA 2OACA 1JLVA 3GX0A 1MEKA 4GSTA 4D73A 4PURA 3EPTA 3FW2A 3SBCA 2OE1A 5J4UA 1RQMA 1SYXA 4N11A 4GSNA 1GSFA 3EE2A 2E2MA 4BWSA 4FYUA 2H66A 1AC1A 2O87A 2JZTA 4KCAA 2F9SA 4OWYA 1XWGA 5IMCA 4KDYA 1PL2A 1EGOA 2QA1A 2DJJA 1BF5A 1TP9A 1K3LA 4OFNA 2J9HA 2VCTA 2F8AA 1R5AA 2HRKA 1X5EA 5AGYA 4Z2TA 1T1VA 3D4TA 1J0FA 11GSA 2VL2A 2WGRA 5D96A 3KTLA 2HT9A 3D21A 1GNWA 2H1DA 1TW9A 5F06A 3APSA 2PERA 1XWCA 2B5XA 1ZYQB 2R0CA 1S3AA 3GKKA 3UMAA 3I43A 3GYKA 5ABRA 2H75A 3L9SA 1N2AA 3TKRA 2R2JA 3DIEA 2OKAA 3VLNA 1AAZA 2H76A 2YP6A 2C3TA 3DWVA 1KNGA 3IR4A 4K0NA 2NBSA 3QAGA 3M8NA 2K9FA 4O5UA 1A8LA 4PX1A 3IPZA 4N10A 2E2GA 3EWLA 5G5EA 1E2YA 2JACA 3A2VA 5JWRB 3PR8A 3C1RA 1BG5A 3KJYA 4IQAA 2B6MA 2UZ8A 3ZVJA 2WJUA 1B4PA 4CY8A 4CY6A 3F4TA 3ERWA 5F07A 3VWXA 2FWGA 1U88A 4KH7A 1VF4A 3ME7A 2V6KA 1Z7PA 2VAFA 3C73A 1DE1A 1X0RA 2AYTA 3PINA 5AIVA 1GTUA 4ZL9A 3HVXA 4XS1A 4XS4B 4MF7A 1J08A 3GKNA 3O76A 2YV7A 1SVLA 5ECLB 5KEJA 2DJKA 2GGTA 4K2DA 2F8FA 4KCEA 2IMDA 2F51A 2FLSA 1T4YA 3EC3A 1R26A 20GSA 3VWWA 1A8YA 2LQOA 4K7IA 4MPGA 1OYJA 1WRYA 3H93A 1TTZA 5A4UA 4TR1B 1VRSD 1BQ7A 3QAWA 3U5RE 2GTUA 2MMOA 5CO3A 5G30A 4LMWA 5EY6A 3KCMA 1XBSA 1G7OA 5HR0A 4RI7A 4TXVA 1AXDA 2LQQA 2N5BA 2L59A 1K3YA 2G0FA 2KP1A 1AIUA 2HYXA 1B9XC 1AQWA 3D22A 1OE8A 1CQHA 2PU9C 3WGDA 2M46A 1EV4A 1R4WA 1DE2A 4IKHA 5FT3A 2IMEA 2JSZA 2OE3A 5GAPD 1DBYA 2AUVA 1K0MA 5B6NA 2QSIA 3I9V2 2X8HA 1GP1A 1AQVA 4EXJA 1PKWA 3LFLA 4MH3A 1G0TA 4MJEA 5F0GA 3L4NA 4ZB7A 4OO4A 5ECPB 2C8UA 4MF5A 1FB6A 1FOHA 1R7HA 1WIKA 2CVBA 1MD3A 5KN0A 1LBKA 4XS4A 2YZHA 3GSSA 3LQ7A 5F05A 2FWFA 1A24A 1M2DA 1JZDA 5ELGA 1QFNA 2MZCA 4P3YB 1ZZYA 3O3TA 1B9YC 5H5RA 3DD3A 3FK8A 1OC9B 2PGTA 1QMVA 3MDKA 5CRWA 2L6CA 4N30A 1MTCA 17GSA 4TR1A 3TOUA 5A4VA 4TN8A 1PN9A 2EIQA 1BG1A 1Z7RA 3QDNA 1TDIA 3ZZXA 3IE3A 3TKQA 4WEYA 2KUCA 3ZMKA 5B7CA 2FY6A 4WBRD 4G0LA 4G10A 2H0HA 3KZQA 4KB3A 4IN0A 1RW1A 2TIRA 3TOTA 4AJ8A 3TCOA 4ML1A 1SJZA 2IMIA 4OCEA 3MYDA 3TUEA 3NOFA 4V1Ap 3PPUA 2R5GA 2BJXA 2MMAA 1X5CA 1XW5A 4AJ6A 1WP0A 4K6XA 2ES7A 5LCZA 4X4JA 1M0UA 1SK0A 1QUWA 1I9DA 4FYCA 3HZ8A 4HUAA 3LW9A 1TI3A 3EYTA 6GSYA 5CYYA 3W6GA 1PQNA 2X49A 2RM5A 5HFKA 5ECMB 3ZTLA 3LEFA 1OC9A 1TK8B 3A5WA 1Z6MA 3PH9A 2H6ZA 4KGIA 4HEA2 5HR2A 4N0ZA 1Z3EA 4FQUA 1V2AA 1YZXA 1GSUA 2H70A 2H19A 2OBIA 1ERVA 3FR9A 4PUFC 4RQRA 5KOWA 3HYPA 1E6BA 2CAQA 3A2WA 4GTUA 4L5OA 3GHAA 4YQUA 4MMMA 4NHWA 1PX7A 4F0BA 4ACSA 1EEJA 2P5QA 3GH6A 2CVDA 1XW9A 5IMFA 1XVQA 2WCIA 1PKZA 5CRHA 2CVKA 1ZGNA 1TXUA 1F2EA 4IW9A 5INYA 3P90A 1FB0A 4KW6A 1BEDA 2YWIA 2HSNB 5G1LA 1SU9A 4V2MA 14GSA 4TR4A 1G6YA 1NSWA 1QGVA 2O8VB 4KA0A 4PQIA 3IA1A 1EP7A 2IMFA 1JZRA 2C1YA 2LNTA 2L4CA 3GRXA 3CWGA 5FHIA 4ML6A 3FKFA 4RUVA 1YJ6A 2YPMA 2CX4A 3IAM2 3APQA 3HJOA 2GZYA 3ZLPA 4TKYA 3EMXA 2CA8A 1UVZA 4GRFA 3MIXA 4Q5RA 1LJRA 4USSA 1PX6A 1FOVA 1X9MB 5DQSA 1QQ2A 4NV2A 3ERFA 2KLXA 3ED3A 3GSTA 4L8EA 4AKIA 3DYRA 2EFCA 5GSTA 4KUNA 3ZIVA 4PXOA 2PN8A 19GSA 4CDOA 4K8MA 1V9WA 4NAXA 1SYRA 4KDXA 1VF2A 2FCHA 5ECQB 1BX9A 5ELAA 3S9FA 1ZYPA 1THOA 4XS6A 1TKDB 4IBPA 3ZMLA 2WZ9A 4ZILA 3FMWA 3IAS2 3CTFA 5IM9A 3TDGA 2HRAA 3FZ9A 4BL7A 1V58A 2R0GA 3DEXA 2XBQA 4OMVA 2A4VA 4TOPA 5J47A 4AGSA 1O8XA 1TJDA 4BPYA 10GSA 2YCDA 2C3QA 4EDYA 2LJRA 5D9VA 2HSNA 5DBQA 5J9CA 1USBA 2XPEA 2M80A 3QD9A 4NHZA 2FA4A 1PMTA 1UC7A 4F0CA 3IOSA 1GTAA 2P31A 3OR5A 2RIIA 3M1GA 1M2AA 3FZ4A 5J9BA 1SD9A 1K0BA 5A5HB 4POMA 3ZYWA 1W4VA 3HJMA 2X4AA 2FHEA 2VCXA 2V32A 2WULA 2I81A 3C1SA 3BBYA 2DIZA 5JWOB 2DKIA 2ON7A 3EMPA 5FWGA 2WFCA 4YKFA 2I3YA 4RQXA 2DKHA 1YKCA 2H6XA 2MBSA 2K6VA 2JL4A 4KAEA 3WT1A 3F3QA 4AKGA 4LMVA 1A2MA 1GUHA 5DDLA 4JZQA 1WOUA 3GN3A 1PD21 2RM6A 4JU5A 5G5FA 3TKPA 2HSHA 1MDIA 2NTOA 4ILFA 1K0NA 3ZITA 3ISOA 3F8UA 1M7TA 4AKHA 4V2LA 3U6VA 1XVWA 4I8BA 2NPBA 2VOCA 6GSUA 2LJKA 4ZIJA 1ERWA 2H73A 4GLTA 1YQ1A 1ZOFA 2EC4A 2EFEA 2NVLA 1Y25A 4X0XA 2H1BA 1FHEA 6GSXA 2V2GA 1AW9A 2HZEB 2VKZG 4I2UA 2FNOA 4KX4A 3IK9A 1XZOA 2HZFA 5A1NB 1G6WA 3IHQA 1A2JA 3HHVA 4ISDA 3KEBA 6GSTA 4MK3A 2ZNMA 2A4HA 2GVPA 2PUKC 3KIJA 2ALBA 3F6DA 5A5HA 3DKSA 2H8LA 2YZUA 3R2QA 5IOWA 1EOHA 2K8VA 1X5DA 3P7XA 4MLYA 3TJGA 1ABAA 3A3TA 3LYPA 3Q19A 3GKXA 3WGEA 4ULXA 3TJJA 3VI7A 1GL8A 1DSBA 1M2BA 3D0ZA 1SL2B 3GUSA 1A23A 2H30A 1C72A 5DJMA 5D9TA 1SJ6A 3IC4A 5KN1A 2KOKA 4ZB8A 2HRFA 5DAKB 4ECIA 3GFKA 4MZWA 2GSTA 4MF6A 5HR3A 1GSYA 2ZUPA 1DUGA 1XIYA 1JFUA 3GX8A 1ZMAA 3M9KA 2TRXA 3CMIA 2L57A 3HXSA 1HNCA 3QR6A 5DCGA 3UAPA 1GH2A 1O85A 2DJ1A 2GSRA 4K9ZA 3KTBA 3FEUA 5CAXA 4J57E 2H0GA 3WD6A 2GQKA 4DSRA 3VURA 4IGJA 3TU3B 2HZEA 2LNSA 2GDRA 2QC7A 4HOJA 3IXRA 3F4RA 4MNNA 2IPAA 2DMLA 5DJLA 4WF4A 3LJRA 2J23A 1TXXA 16GSA 5A1NA 1ERUA 1WJKA 3PGTA 3ERGA 1NW2A 5JWQB 1TOFA 2VCZA 2X8CA 3IHGA 2LUSA 1BYEA 4G0IA 1A0RP 2P0GA 2EIOA 5A5KA 4EKZA 2A2PA 2FD3A 4AF2A 2C0DA 3C8EA 3H1NA 4N3ZA 3TKSE 2RUFA 2P5RA 1HYUA 2I9HA 4MH2A 3F3RA 4TR0A 4Z7XA 1AQXA 2E0QA 3L9VA 2LJAA 1GLPA 3APOA 1X9SB 2E7PA 3ZRDA 5ECRB 1GNEA 4Q5QA 1GUMA 1QXHA 5DAKA 2Z9SA 3F4SA 1KEBA 4V2NA 1WE0A 2GZPA 3W8JA 1BAYA 4TR3A 2V41A 1TU7A 3D5JA 2YJHA 1VF1A 3LORA 2O5VA 3D6IA 2EIRA 4KE3A 1Z6NA 4Q5NA 2OADA 3H8QA 2GSSA 2F3MA 4E8HA 1EWXA 2YJ7A 1XXUA 5CRDA 1M99A 4HQZA 4Z2RA 1SKRB 4L0WA 2LS5A 4AJ7A 1GSQA 2HSMB 3CYNA 3G7YA 3GL5A 4JRRA 2GZZA 3RAZA 3AY8A 5DALB 3N9JA 2GT6A 3CRUA 2JZSA 4YAPA 1U87A 2VIMA 4EL1A 3MWHA 4PNGA 1K3OA 2VM1A 1V57A 2OT3A 3EURA 4QMKA 3FZ5A 4MDCA 1YEXA 1XWAA 4IJ3A 1AUCA 5A34B 2H1LA 4RI6A 1N25A 3VWUA 4PNFA 3EU3A 2H0IA 1T7PB 2LEGA 3BCIA 2YN1A 4DEJA 1U3AA 2B7JA 1YF1A 3VFIA 4HQSA 2CZ2A 1Q98A 3CSIA 3GV1A 4X43A 2YWNA 1OC8A 5IMAA 2PPTA 3UIWA 2GLRA 3C7MA 4MCUA 2I1UA 3NZNA 1A0FA 5EPFA 4HI7A 4YAVA 1ACVA 4HZ4A 1GTBA 1JZOA 4OFTA 4JR6A 3GL3A 5J41A 4HU9A 2CZ3A 5ECKB 2XHFA 4MJCA 4BVXB 4IVFA 1RK4A 5AN1A 5B8AA 1G7EA 4IHUA 2XPDA 1SK1A 2CV4A 3KD0A 2GQLA 3D4MA 3K8NA 1OKTA 1O6JA 3DXBA 5BMUB 4PUAA 1EOGA 4HJ2A 4E8EA 1S3DA 5G1KA 3UJ1A 2WS2A 5DALA 4WETA 2DC5A 4XCSA 4WXTA 4HJMA 4IP1A 1WMJA 3KH9A 5E4WA 4CW9A 2N5FA 4EVMA 2R37A 4K7NA 5A34A 1S3CA 3CTGA 3TGZA 1UA5A 3CSHA 1O8WA 1WWJA 4HS1A 4G2EA 3WGXA 2JADA 1NHOA 6GSWA 3H79A 2CX3A 3UVHA 1MDKA 1ZL9A 3F0IA 2JSYA 3UBLA 4K0GA 2C0GA 1R5PA 2VLVA 3VK9A 1PRXA 4F03A 3QFBC 1QK8A 5ECIB 4Z2UA 4GQCA 2O7KA 4O5RA 3QOUA 2C80A 3JCML 4LA1A 5EVOA 3FHKA 4XHMA 1U3IA 1Y1UA 4PQHA 5HQPA 1XOAA 2QKEA 4BA7A 1BJXA 5LNKe 3M9JA 4XIHA 4TW5A 22GSA 3HVVA 1OAZA 1KTEA 3P8WA 2PMTA 3WYWA 1EZKA 3BCKA 4IP6A 3A2XA 2GT5A 4O32A 3UOMA 2FA8A 2HXKA 4X1UA 1B48A 4N0VA 5BMUA 4MA9A 3H4KA 3E9JB 5J4VA 5KOXA 5G31A 4O7HA 1GSDA 1PL1A 5IMDA 4FO5A 1ZCPA 4MJAA 4DSSB 3E0UA 5J5NA 2K8SA 4D73B 1ILOA 3P2AA 3KMNA 3I69A 3KXOA 2MMNA 5C04A 5CP1A 1YKAA 4ZBBA 2HRNA 5DCHA 4XTSA 7GSSA 4H86A 5GZZB 4GCIA 2B3SA 5ECSA 2LV3A 3CXGA 2VLTA 5JCGA 3V1WA 5B8BA 4ZL7A 4GWRA 1TRUA 1HQOA 1YF0A 3TB2A 2VUPA 6GSVA 2VL3A 3GTUB 3J7Yk 1TK5B 2R6KA 5J40A 4JEDA 2V1MA 4WR4A 2IFQB 2AV4A 3UBKA 5F8BA 5ID2B 2OE0A 8GSSA 1Z5YE 5HFGA 1GLQA 2M72A 2HI7A 3US3A 2IJYA 2XC2A 1CQGA 5IPHA 3LYKA 5COHA 1XWBA 1F3BA 2L5LA 3G7JA 4MZBA 1ML6A 3MSZA 2BMXA 4ZB9A 4ECBA 3BJ5A 2HLSA 4I6XA 1LU4A 1F37A 1I5GA 3L9UA 2IIYA 4MPFA 2H1GA 1K0OA 1OKDA 3F9UA 4OO5A 4DSSA 4QL9A 4YQMA 1NHYA 1O73A 2K18A 5A4WA 2KP2A 5IQYA 2X64A 5IMVA 2PVQA 4K2XA 4NMUA 2A2RA 3HDCA 4J2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNA A;  4PTS A;  2GQM A;  3WT2 A;  1T00 A;  1TI1 A;  1GUK A;  1M9A A;  4GQF A;  2LKU A;  5D73 A;  2BTO T;  2NDO A;  4YQV A;  2ON5 A;  4TVE A;  2AJQ B;  2VL2 C;  5IIZ A;  4KDU A;  1K0D A;  4Q5F A;  2AHE A;  1EV9 A;  4EC0 A;  1TRV A;  4KSO A;  3ME8 A;  1XPV A;  1M9B A;  3LSZ A;  3GTU A;  3DVX A;  5E59 A;  4PQ1 A;  1YY7 A;  3RHC A;  2B7K A;  2IFQ A;  3IBH A;  5ID2 A;  2GS3 A;  2B1L A;  5ECN B;  2TRC P;  4LL4 B;  3FZA A;  1SD8 A;  4IEL A;  4MP4 A;  2GSQ A;  5D93 A;  1GTI A;  2VM2 A;  3GNJ A;  1SL0 B;  2B5E A;  1TK0 B;  3DGQ A;  5J3R A;  2B5Y A;  1VGL A;  4XRD A;  2YV9 A;  3QCP A;  4IQ1 A;  3ZFL A;  1J9B A;  2DJ3 A;  4L5L A;  3UAR A;  2VCW A;  3W8S A;  1Q4J A;  2V6O A;  3GKM A;  3L0H A;  2C3N A;  1THX A;  4G9H A;  2DMM A;  1HD2 A;  1XOB A;  4MZC A;  3F63 A;  1XW6 A;  3Q74 A;  1FG4 A;  1SK2 A;  3GH9 A;  3QAV A;  3E3E A;  2VCV A;  1YEP A;  4QQ7 A;  1XFL A;  2H71 A;  5H5S A;  1JHB A;  5CRE A;  3TRP A;  3IRA A;  2VL9 A;  2HQT A;  3I6A A;  2MMZ A;  3KM6 A;  3Q18 A;  4V1A g;  5HR1 A;  4QL7 A;  1NM3 A;  1OVN A;  3HJP A;  3QPM A;  2X8G A;  2AB6 A;  1PGT A;  1JLW A;  3BD2 A;  2VCQ A;  3GA4 A;  1EP8 A;  4NXI A;  4ECJ A;  3ZL5 A;  4KSM A;  2FWE A;  5D8I A;  1MD4 A;  3TJF A;  3L78 A;  1SKW B;  2WRT A;  3CRT A;  2HE3 A;  4IJI A;  4DVC A;  3LGC A;  4EUY A;  2HFD A;  1F9M A;  5L71 A;  1ERT A;  5GSS A;  3VWV A;  3HD5 A;  5ECH B;  4ZB6 A;  3LWA A;  2H6Y A;  2L4Q A;  4G19 A;  4YH2 A;  4DSQ A;  3SWL A;  3IK7 A;  2C0F A;  4G0K A;  2DBC A;  4O92 A;  3RPP A;  4I97 A;  1GUL A;  1OC3 A;  3GIX A;  2H74 A;  3DML A;  1F3A A;  3QMX A;  3F6F A;  2O89 A;  4MAB A;  3G7I A;  2CQ9 A;  2H1A A;  3UEM A;  3M3M A;  5JCU A;  3TRX A;  1U6T A;  4POL A;  1EEM A;  1GWC A;  2D2Z A;  4EF0 A;  4HDE A;  1MDJ A;  2VD1 A;  1T4Z A;  3N5O A;  2MBT A;  2RLI A;  4KND A;  3R3E A;  5IOX A;  3J7Y b;  4WBJ A;  2DJ0 A;  1IYH A;  3TJB A;  1URM A;  1Y6E A;  1GSE A;  5D9X A;  5ECO B;  3G9B A;  4I5Q A;  4TXO B;  3EU4 A;  4I2T A;  1SKS B;  13GS A;  2REM A;  2CT6 A;  2LTK A;  3HVS A;  1JZW A;  3HA9 A;  3VI5 A;  4FYB A;  4GXZ A;  3RBT A;  3Q6O A;  3HZ4 A;  3HY2 A;  3FRC A;  3RHB A;  4PGT A;  4WKW A;  2FUG 2;  5IPG A;  2G2Q A;  1K0A A;  4IS0 A;  3TJK A;  4EO3 A;  4OCF A;  1A2L A;  5IO2 A;  2PBJ A;  1V98 A;  2KHP A;  3LXT A;  4OFM A;  2RUE A;  3ZIJ A;  5DVB A;  4L0U A;  2VLU A;  3UVT A;  2JZR A;  1TRS A;  1O7U A;  4ZBA A;  3FR6 A;  3IDV A;  1N8J A;  6GSS A;  2PVO C;  1YDK A;  3RDW A;  4BVY B;  2XBI A;  1V40 A;  9GSS A;  5AIX A;  4ZXG A;  3CBU A;  2N5A A;  3TRQ A;  4LLR A;  4JE1 A;  3HKR A;  1GSS A;  2VD0 A;  12GS A;  3GMF A;  1FO5 A;  2X99 A;  4NV5 A;  1F6M C;  1W89 A;  3KGK A;  2DJ2 A;  2LRC A;  2YOI A;  2HSM A;  2OJL A;  2YNX A;  3KP8 A;  2AAW A;  2LST A;  3KH7 A;  2IL3 A;  2H01 A;  3CSJ A;  1XWK A;  3DVW A;  1OE7 A;  4TXO A;  3FR3 A;  4ZBD A;  1ST9 A;  1FW1 A;  4TRX A;  3ZRE A;  2IN3 A;  1WPI A;  1VF3 A;  4OD7 A;  5KN2 A;  3FYG A;  5LD0 A;  1HNB A;  5CRG A;  3MNG A;  2YAN A;  1T3B A;  4MJB A;  1H75 A;  3IV4 A;  1H4O A;  3VPT A;  5JCW A;  4ECC A;  5H5Q A;  4F82 A;  4K1F A;  4BL7 B;  2FWH A;  2I4A A;  3HCZ A;  5EL8 A;  5ENU A;  2DSA A;  5KN3 A;  2OA7 A;  3DRN A;  5D9W A;  4WF5 A;  4BVX A;  2WB9 A;  2IWT A;  4GF0 A;  4WR5 A;  3EIN A;  5DQY A;  4K7O A;  1X9W B;  5C00 A;  1TRW A;  5G2Z A;  2O85 A;  4BVY A;  2A2S A;  2B1K A;  5HFI A;  3C71 A;  3VPQ A;  2YWO A;  3GUR A;  4HZ2 A;  2C0E A;  1O81 A;  1GRX A;  2CAI A;  4CHS A;  5B6M A;  5IMZ A;  1B4Q A;  3IC8 A;  2JU5 A;  3ZFB A;  1SJI A;  1UN2 A;  3FY7 A;  2LRN A;  4FIW A;  4POB A;  2OBK A;  2H72 A;  1B8X A;  1ON4 A;  3QFA C;  2HSY A;  3KMO A;  1XCC A;  1FVJ A;  3RPN A;  4NWY A;  3UL3 A;  3M0F A;  3EVI A;  2PWJ A;  2DLX A;  1PSQ A;  2ZCT A;  4POK A;  2R4V A;  1FVK A;  2YWM A;  4F9Z A;  4ZL8 A;  1T8E B;  1EGR A;  2R3X A;  2VO4 A;  5AIS A;  1SL1 B;  4EE0 A;  2LRT A;  2QGV A;  4JBB A;  2L6D A;  1TU8 A;  2HRK B;  4HU7 A;  3ZVJ D;  4JR4 A;  4KF9 A;  3KP9 A;  5IO0 A;  1FAA A;  3MAK A;  1SEN A;  3LG6 A;  2DIY A;  3NIV A;  4BWQ A;  4EDZ A;  3LXZ A;  4GSS A;  4J56 E;  4NPB A;  4ID0 A;  1K0C A;  5CNW A;  2C4J A;  1ZYE A;  2MYG A;  3TKS C;  4FH8 A;  1IYI A;  2WDU A;  18GS A;  1Z9H A;  2L5O A;  2HNL A;  3O6T A;  3BOA A;  5GAN D;  4XRA A;  4F2I A;  1PA3 A;  3TKS A;  2IMK A;  4LL1 B;  1KBN A;  2FGX A;  2OAC A;  1JLV A;  3GX0 A;  1MEK A;  4GST A;  4D73 A;  4PUR A;  3SBC A;  3FW2 A;  2OE1 A;  5J4U A;  1RQM A;  1SYX A;  4N11 A;  4GSN A;  1GSF A;  3EE2 A;  2E2M A;  4BWS A;  4FYU A;  2H66 A;  1AC1 A;  2O87 A;  2JZT A;  4KCA A;  2F9S A;  4OWY A;  1XWG A;  5IMC A;  4KDY A;  1PL2 A;  1EGO A;  2DJJ A;  1TP9 A;  1K3L A;  4OFN A;  2J9H A;  2VCT A;  2F8A A;  1R5A A;  2HRK A;  1X5E A;  5AGY A;  1T1V A;  3D4T A;  1J0F A;  11GS A;  2VL2 A;  2WGR A;  5D96 A;  3KTL A;  2HT9 A;  3D21 A;  1GNW A;  2H1D A;  1TW9 A;  5F06 A;  3APS A;  2PER A;  1XWC A;  2B5X A;  1ZYQ B;  1S3A A;  3GKK A;  3UMA A;  3I43 A;  3GYK A;  5ABR A;  2H75 A;  3L9S A;  1N2A A;  3TKR A;  2R2J A;  3DIE A;  2OKA A;  3VLN A;  1AAZ A;  2H76 A;  2YP6 A;  2C3T A;  3DWV A;  1KNG A;  3IR4 A;  4K0N A;  2NBS A;  3QAG A;  3M8N A;  2K9F A;  1A8L A;  4PX1 A;  3IPZ A;  4N10 A;  2E2G A;  3EWL A;  5G5E A;  1E2Y A;  2JAC A;  3A2V A;  5JWR B;  3PR8 A;  3C1R A;  1BG5 A;  3KJY A;  4IQA A;  2B6M A;  2UZ8 A;  3ZVJ A;  2WJU A;  1B4P A;  3F4T A;  3ERW A;  5F07 A;  3VWX A;  2FWG A;  1U88 A;  4KH7 A;  1VF4 A;  3ME7 A;  2V6K A;  1Z7P A;  2VAF A;  3C73 A;  1DE1 A;  1X0R A;  2AYT A;  3PIN A;  5AIV A;  1GTU A;  4ZL9 A;  3HVX A;  4XS1 A;  4XS4 B;  4MF7 A;  1J08 A;  3GKN A;  3O76 A;  2YV7 A;  5ECL B;  5KEJ A;  2DJK A;  2GGT A;  4K2D A;  2F8F A;  4KCE A;  2IMD A;  2F51 A;  2FLS A;  1T4Y A;  3EC3 A;  1R26 A;  20GS A;  3VWW A;  1A8Y A;  2LQO A;  4K7I A;  4MPG A;  1OYJ A;  1WRY A;  3H93 A;  1TTZ A;  5A4U A;  4TR1 B;  1VRS D;  1BQ7 A;  3QAW A;  3U5R E;  2GTU A;  2MMO A;  5CO3 A;  5G30 A;  4LMW A;  5EY6 A;  3KCM A;  1XBS A;  1G7O A;  5HR0 A;  4RI7 A;  4TXV A;  1AXD A;  2LQQ A;  2N5B A;  2L59 A;  1K3Y A;  2G0F A;  2KP1 A;  1AIU A;  2HYX A;  1B9X C;  1AQW A;  3D22 A;  1OE8 A;  1CQH A;  2PU9 C;  3WGD A;  2M46 A;  1EV4 A;  1R4W A;  1DE2 A;  4IKH A;  5FT3 A;  2IME A;  2JSZ A;  2OE3 A;  5GAP D;  1DBY A;  2AUV A;  1K0M A;  5B6N A;  2QSI A;  3I9V 2;  2X8H A;  1GP1 A;  1AQV A;  4EXJ A;  1PKW A;  3LFL A;  4MH3 A;  1G0T A;  4MJE A;  5F0G A;  3L4N A;  4OO4 A;  5ECP B;  2C8U A;  4MF5 A;  1FB6 A;  1R7H A;  1WIK A;  2CVB A;  1MD3 A;  5KN0 A;  1LBK A;  4XS4 A;  2YZH A;  3GSS A;  3LQ7 A;  5F05 A;  2FWF A;  1A24 A;  1M2D A;  1JZD A;  5ELG A;  1QFN A;  2MZC A;  4P3Y B;  1ZZY A;  3O3T A;  1B9Y C;  5H5R A;  3DD3 A;  3FK8 A;  1OC9 B;  2PGT A;  1QMV A;  3MDK A;  5CRW A;  2L6C A;  4N30 A;  1MTC A;  17GS A;  4TR1 A;  3TOU A;  5A4V A;  4TN8 A;  1PN9 A;  2EIQ A;  1Z7R A;  3QDN A;  1TDI A;  3ZZX A;  3IE3 A;  3TKQ A;  4WEY A;  2KUC A;  3ZMK A;  5B7C A;  2FY6 A;  4WBR D;  4G0L A;  4G10 A;  2H0H A;  3KZQ A;  4KB3 A;  4IN0 A;  1RW1 A;  2TIR A;  3TOT A;  4AJ8 A;  3TCO A;  4ML1 A;  1SJZ A;  2IMI A;  4OCE A;  3TUE A;  3NOF A;  4V1A p;  3PPU A;  2R5G A;  2BJX A;  2MMA A;  1X5C A;  1XW5 A;  4AJ6 A;  1WP0 A;  4K6X A;  2ES7 A;  5LCZ A;  1M0U A;  1SK0 A;  1QUW A;  1I9D A;  4FYC A;  3HZ8 A;  4HUA A;  1TI3 A;  3EYT A;  6GSY A;  5CYY A;  3W6G A;  1PQN A;  2RM5 A;  5HFK A;  5ECM B;  3ZTL A;  3LEF A;  1OC9 A;  1TK8 B;  3A5W A;  1Z6M A;  3PH9 A;  2H6Z A;  4KGI A;  4HEA 2;  5HR2 A;  4N0Z A;  1Z3E A;  4FQU A;  1V2A A;  1YZX A;  1GSU A;  2H70 A;  2H19 A;  2OBI A;  1ERV A;  3FR9 A;  4PUF C;  4RQR A;  3HYP A;  1E6B A;  2CAQ A;  3A2W A;  4GTU A;  4L5O A;  3GHA A;  4YQU A;  4MMM A;  4NHW A;  1PX7 A;  4F0B A;  4ACS A;  1EEJ A;  2P5Q A;  3GH6 A;  2CVD A;  1XW9 A;  5IMF A;  1XVQ A;  2WCI A;  1PKZ A;  5CRH A;  2CVK A;  1ZGN A;  1F2E A;  4IW9 A;  5INY A;  3P90 A;  1FB0 A;  4KW6 A;  1BED A;  2YWI A;  2HSN B;  5G1L A;  1SU9 A;  4V2M A;  14GS A;  4TR4 A;  1G6Y A;  1NSW A;  1QGV A;  2O8V B;  4KA0 A;  4PQI A;  3IA1 A;  1EP7 A;  2IMF A;  1JZR A;  2C1Y A;  2LNT A;  2L4C A;  3GRX A;  5FHI A;  4ML6 A;  3FKF A;  4RUV A;  1YJ6 A;  2YPM A;  2CX4 A;  3IAM 2;  3APQ A;  3HJO A;  2GZY A;  3ZLP A;  4TKY A;  3EMX A;  2CA8 A;  1UVZ A;  4GRF A;  4Q5R A;  1LJR A;  4USS A;  1PX6 A;  1FOV A;  1X9M B;  5DQS A;  1QQ2 A;  4NV2 A;  3ERF A;  2KLX A;  3ED3 A;  3GST A;  4L8E A;  3DYR A;  5GST A;  4KUN A;  3ZIV A;  4PXO A;  2PN8 A;  19GS A;  4CDO A;  4K8M A;  1V9W A;  4NAX A;  1SYR A;  4KDX A;  1VF2 A;  2FCH A;  5ECQ B;  1BX9 A;  5ELA A;  3S9F A;  1THO A;  4XS6 A;  1TKD B;  4IBP A;  3ZML A;  2WZ9 A;  4ZIL A;  3IAS 2;  3CTF A;  5IM9 A;  3TDG A;  2HRA A;  3FZ9 A;  4BL7 A;  1V58 A;  3DEX A;  2XBQ A;  4OMV A;  2A4V A;  4TOP A;  4AGS A;  1O8X A;  1TJD A;  4BPY A;  10GS A;  2YCD A;  2C3Q A;  4EDY A;  2LJR A;  5D9V A;  5DBQ A;  5J9C A;  1USB A;  2XPE A;  2M80 A;  3QD9 A;  4NHZ A;  2FA4 A;  1PMT A;  1UC7 A;  4F0C A;  3IOS A;  1GTA A;  2P31 A;  3OR5 A;  2RII A;  3M1G A;  1M2A A;  3FZ4 A;  5J9B A;  1SD9 A;  1K0B A;  4POM A;  3ZYW A;  1W4V A;  3HJM A;  2FHE A;  2VCX A;  2V32 A;  2WUL A;  2I81 A;  3C1S A;  3BBY A;  2DIZ A;  5JWO B;  2ON7 A;  3EMP A;  5FWG A;  2WFC A;  2I3Y A;  4RQX A;  1YKC A;  2H6X A;  2MBS A;  2K6V A;  2JL4 A;  4KAE A;  3WT1 A;  3F3Q A;  4LMV A;  1A2M A;  1GUH A;  5DDL A;  4JZQ A;  1WOU A;  3GN3 A;  1PD2 1;  2RM6 A;  4JU5 A;  5G5F A;  3TKP A;  2HSH A;  1MDI A;  2NTO A;  4ILF A;  1K0N A;  3ZIT A;  3ISO A;  3F8U A;  1M7T A;  4V2L A;  3U6V A;  1XVW A;  4I8B A;  2NPB A;  2VOC A;  6GSU A;  2LJK A;  4ZIJ A;  1ERW A;  2H73 A;  4GLT A;  1YQ1 A;  1ZOF A;  2EC4 A;  2NVL A;  1Y25 A;  4X0X A;  2H1B A;  1FHE A;  6GSX A;  2V2G A;  1AW9 A;  2HZE B;  4I2U A;  2FNO A;  4KX4 A;  3IK9 A;  1XZO A;  2HZF A;  1G6W A;  3IHQ A;  1A2J A;  3HHV A;  4ISD A;  3KEB A;  6GST A;  4MK3 A;  2ZNM A;  2GVP A;  2PUK C;  3KIJ A;  2ALB A;  3F6D A;  3DKS A;  2H8L A;  2YZU A;  3R2Q A;  5IOW A;  1EOH A;  2K8V A;  1X5D A;  3P7X A;  4MLY A;  3TJG A;  1ABA A;  3A3T A;  3LYP A;  3Q19 A;  3GKX A;  3WGE A;  4ULX A;  3TJJ A;  3VI7 A;  1GL8 A;  1DSB A;  1M2B A;  3D0Z A;  1SL2 B;  3GUS A;  1A23 A;  2H30 A;  1C72 A;  5DJM A;  5D9T A;  1SJ6 A;  3IC4 A;  5KN1 A;  2KOK A;  4ZB8 A;  2HRF A;  5DAK B;  4ECI A;  3GFK A;  4MZW A;  2GST A;  4MF6 A;  5HR3 A;  1GSY A;  2ZUP A;  1DUG A;  1XIY A;  1JFU A;  3GX8 A;  1ZMA A;  3M9K A;  2TRX A;  3CMI A;  2L57 A;  3HXS A;  1HNC A;  3QR6 A;  5DCG A;  3UAP A;  1GH2 A;  1O85 A;  2DJ1 A;  2GSR A;  4K9Z A;  3KTB A;  3FEU A;  5CAX A;  4J57 E;  2H0G A;  3WD6 A;  2GQK A;  4DSR A;  3VUR A;  4IGJ A;  2HZE A;  2LNS A;  2GDR A;  2QC7 A;  4HOJ A;  3IXR A;  3F4R A;  2IPA A;  2DML A;  5DJL A;  4WF4 A;  3LJR A;  2J23 A;  1TXX A;  16GS A;  1ERU A;  1WJK A;  3PGT A;  3ERG A;  1NW2 A;  5JWQ B;  1TOF A;  2VCZ A;  2X8C A;  2LUS A;  1BYE A;  4G0I A;  1A0R P;  2P0G A;  2EIO A;  5A5K A;  4EKZ A;  2FD3 A;  4AF2 A;  2C0D A;  3C8E A;  3H1N A;  3TKS E;  2RUF A;  2P5R A;  1HYU A;  2I9H A;  4MH2 A;  3F3R A;  4TR0 A;  4Z7X A;  1AQX A;  2E0Q A;  3L9V A;  2LJA A;  1GLP A;  3APO A;  1X9S B;  2E7P A;  3ZRD A;  5ECR B;  1GNE A;  4Q5Q A;  1GUM A;  1QXH A;  5DAK A;  2Z9S A;  3F4S A;  1KEB A;  4V2N A;  1WE0 A;  2GZP A;  3W8J A;  1BAY A;  4TR3 A;  2V41 A;  1TU7 A;  3D5J A;  2YJH A;  1VF1 A;  3LOR A;  3D6I A;  2EIR A;  4KE3 A;  1Z6N A;  4Q5N A;  2OAD A;  3H8Q A;  2GSS A;  2F3M A;  4E8H A;  1EWX A;  2YJ7 A;  1XXU A;  5CRD A;  1M99 A;  4HQZ A;  1SKR B;  4L0W A;  2LS5 A;  4AJ7 A;  1GSQ A;  2HSM B;  3CYN A;  3G7Y A;  3GL5 A;  4JRR A;  2GZZ A;  3RAZ A;  3AY8 A;  5DAL B;  3N9J A;  2GT6 A;  3CRU A;  2JZS A;  4YAP A;  1U87 A;  2VIM A;  4EL1 A;  3MWH A;  4PNG A;  1K3O A;  2VM1 A;  1V57 A;  3EUR A;  3FZ5 A;  4MDC A;  1YEX A;  1XWA A;  4IJ3 A;  1AUC A;  4RI6 A;  3VWU A;  4PNF A;  3EU3 A;  2H0I A;  1T7P B;  2LEG A;  3BCI A;  2YN1 A;  4DEJ A;  1U3A A;  2B7J A;  1YF1 A;  3VFI A;  4HQS A;  2CZ2 A;  1Q98 A;  3CSI A;  3GV1 A;  4X43 A;  2YWN A;  1OC8 A;  5IMA A;  2PPT A;  3UIW A;  2GLR A;  3C7M A;  4MCU A;  2I1U A;  3NZN A;  1A0F A;  5EPF A;  4HI7 A;  4YAV A;  1ACV A;  4HZ4 A;  1GTB A;  1JZO A;  4OFT A;  4JR6 A;  3GL3 A;  5J41 A;  4HU9 A;  2CZ3 A;  5ECK B;  2XHF A;  4MJC A;  4BVX B;  4IVF A;  1RK4 A;  5AN1 A;  5B8A A;  1G7E A;  4IHU A;  2XPD A;  1SK1 A;  2CV4 A;  3KD0 A;  2GQL A;  3D4M A;  3K8N A;  1OKT A;  1O6J A;  3DXB A;  4PUA A;  1EOG A;  4HJ2 A;  4E8E A;  1S3D A;  5G1K A;  3UJ1 A;  2WS2 A;  5DAL A;  4WET A;  2DC5 A;  4XCS A;  4WXT A;  4HJM A;  4IP1 A;  1WMJ A;  3KH9 A;  5E4W A;  4CW9 A;  2N5F A;  4EVM A;  2R37 A;  4K7N A;  1S3C A;  3CTG A;  3TGZ A;  1UA5 A;  3CSH A;  1O8W A;  1WWJ A;  4HS1 A;  4G2E A;  3WGX A;  2JAD A;  1NHO A;  6GSW A;  3H79 A;  2CX3 A;  3UVH A;  1MDK A;  1ZL9 A;  3F0I A;  2JSY A;  3UBL A;  4K0G A;  2C0G A;  1R5P A;  2VLV A;  3VK9 A;  1PRX A;  4F03 A;  3QFB C;  1QK8 A;  5ECI B;  4GQC A;  2O7K A;  4O5R A;  3QOU A;  2C80 A;  3JCM L;  4LA1 A;  5EVO A;  3FHK A;  4XHM A;  1U3I A;  4PQH A;  5HQP A;  1XOA A;  2QKE A;  4BA7 A;  1BJX A;  5LNK e;  3M9J A;  4XIH A;  4TW5 A;  22GS A;  3HVV A;  1OAZ A;  1KTE A;  3P8W A;  2PMT A;  3WYW A;  1EZK A;  3BCK A;  4IP6 A;  3A2X A;  2GT5 A;  4O32 A;  3UOM A;  2FA8 A;  2HXK A;  4X1U A;  1B48 A;  4N0V A;  5BMU A;  4MA9 A;  3H4K A;  3E9J B;  5G31 A;  4O7H A;  1GSD A;  1PL1 A;  5IMD A;  4FO5 A;  1ZCP A;  4MJA A;  4DSS B;  3E0U A;  5J5N A;  2K8S A;  4D73 B;  1ILO A;  3P2A A;  3KMN A;  3I69 A;  3KXO A;  2MMN A;  5C04 A;  5CP1 A;  1YKA A;  4ZBB A;  2HRN A;  5DCH A;  4XTS A;  7GSS A;  4H86 A;  5GZZ B;  4GCI A;  2B3S A;  5ECS A;  2LV3 A;  3CXG A;  2VLT A;  5JCG A;  3V1W A;  5B8B A;  4ZL7 A;  4GWR A;  1TRU A;  1HQO A;  1YF0 A;  3TB2 A;  2VUP A;  6GSV A;  2VL3 A;  3GTU B;  3J7Y k;  1TK5 B;  2R6K A;  4JED A;  2V1M A;  4WR4 A;  2IFQ B;  2AV4 A;  3UBK A;  5F8B A;  5ID2 B;  2OE0 A;  8GSS A;  1Z5Y E;  5HFG A;  1GLQ A;  2M72 A;  2HI7 A;  3US3 A;  2IJY A;  2XC2 A;  1CQG A;  5IPH A;  3LYK A;  5COH A;  1XWB A;  1F3B A;  2L5L A;  3G7J A;  4MZB A;  1ML6 A;  3MSZ A;  2BMX A;  4ZB9 A;  4ECB A;  3BJ5 A;  2HLS A;  4I6X A;  1LU4 A;  1F37 A;  1I5G A;  3L9U A;  2IIY A;  4MPF A;  2H1G A;  1K0O A;  1OKD A;  3F9U A;  4OO5 A;  4DSS A;  4QL9 A;  4YQM A;  1NHY A;  1O73 A;  2K18 A;  5A4W A;  2KP2 A;  5IQY A;  2X64 A;  5IMV A;  2PVQ A;  4NMU A;  2A2R A;  3HDC A;  4J2F A; 
#chains in the Genus database with same CATH topology
 1HNA A;  4PTS A;  2GQM A;  3WT2 A;  1T00 A;  1TI1 A;  1GUK A;  1M9A A;  4GQF A;  2LKU A;  5D73 A;  2BTO T;  2NDO A;  4YQV A;  2ON5 A;  4TVE A;  2AJQ B;  2VL2 C;  5IIZ A;  4KDU A;  1K0D A;  4Q5F A;  2AHE A;  1EV9 A;  4EC0 A;  1TRV A;  4KSO A;  3ME8 A;  1XPV A;  1M9B A;  3LSZ A;  3GTU A;  3DVX A;  5E59 A;  2EFH A;  4PQ1 A;  1YY7 A;  3RHC A;  2B7K A;  2IFQ A;  3IBH A;  5ID2 A;  2GS3 A;  2B1L A;  1ZYN A;  5ECN B;  2TRC P;  4LL4 B;  3FZA A;  1SD8 A;  4IEL A;  4MP4 A;  2GSQ A;  5D93 A;  1GTI A;  2VM2 A;  3GNJ A;  1SL0 B;  2B5E A;  4E68 A;  1TK0 B;  3DGQ A;  5J3R A;  2B5Y A;  1VGL A;  4XRD A;  2YV9 A;  2O36 A;  3QCP A;  4IQ1 A;  3ZFL A;  1J9B A;  2DJ3 A;  4L5L A;  3UAR A;  2VCW A;  3W8S A;  1Q4J A;  2V6O A;  3GKM A;  3L0H A;  2C3N A;  1THX A;  4G9H A;  1S4B P;  1HD2 A;  1XOB A;  2DMM A;  4MZC A;  3F63 A;  1XW6 A;  3Q74 A;  1SVO A;  1FG4 A;  1SK2 A;  3GH9 A;  5J4Y A;  3QAV A;  3E3E A;  2VCV A;  1YEP A;  4QQ7 A;  1XFL A;  2H71 A;  5H5S A;  1JHB A;  4YKG A;  5CRE A;  3TRP A;  3IRA A;  2VL9 A;  2HQT A;  1S3R A;  3I6A A;  2MMZ A;  3KM6 A;  3Q18 A;  4V1A g;  5HR1 A;  4PI2 C;  4QL7 A;  1NM3 A;  1OVN A;  3HJP A;  3QPM A;  2X8G A;  2AB6 A;  1PGT A;  1JLW A;  3BD2 A;  2VCQ A;  2R0P A;  3GA4 A;  1EP8 A;  4NXI A;  4ECJ A;  3ZL5 A;  4KSM A;  2FWE A;  5D8I A;  1MD4 A;  3TJF A;  3L78 A;  1SKW B;  2WRT A;  3CRT A;  2HE3 A;  4IJI A;  4DVC A;  3LGC A;  4EUY A;  2HFD A;  1F9M A;  5L71 A;  1ERT A;  5GSS A;  3VWV A;  3HD5 A;  5ECH B;  5BRT A;  4ZB6 A;  3LWA A;  1YVL A;  2H6Y A;  2L4Q A;  4G19 A;  4PHZ C;  4YH2 A;  4DSQ A;  3SWL A;  3IK7 A;  2C0F A;  4G0K A;  2DBC A;  4O92 A;  3RPP A;  4I97 A;  1GUL A;  1OC3 A;  3GIX A;  2H74 A;  3DML A;  1F3A A;  3QMX A;  3F6F A;  2O89 A;  4MAB A;  3G7I A;  2CQ9 A;  2H1A A;  3UEM A;  3M3M A;  5JCU A;  3TRX A;  2EFD A;  1U6T A;  4POL A;  1EEM A;  1GWC A;  2D2Z A;  4EF0 A;  4GDF A;  4HDE A;  1MDJ A;  2VD1 A;  1T4Z A;  3N5O A;  2MBT A;  2RLI A;  4KND A;  3R3E A;  5IOX A;  3J7Y b;  4WBJ A;  2DJ0 A;  1IYH A;  3TJB A;  1URM A;  1Y6E A;  1GSE A;  5D9X A;  5ECO B;  4K5R A;  3G9B A;  4I5Q A;  4TXO B;  3EU4 A;  4I2T A;  1SKS B;  13GS A;  2REM A;  2CT6 A;  2LTK A;  3HVS A;  1JZW A;  3HA9 A;  3VI5 A;  4FYB A;  4GXZ A;  3RBT A;  3Q6O A;  3HZ4 A;  3HY2 A;  3FRC A;  3RHB A;  4ICY A;  4PGT A;  4WKW A;  2FUG 2;  5IPG A;  2G2Q A;  1K0A A;  4IS0 A;  3TJK A;  4EO3 A;  4OCF A;  1A2L A;  5IO2 A;  2PBJ A;  1V98 A;  2KHP A;  3LXT A;  4OFM A;  2RUE A;  3ZIJ A;  5DVB A;  4L0U A;  2VLU A;  3UVT A;  2JZR A;  1TRS A;  1O7U A;  4ZBA A;  3FR6 A;  3IDV A;  4EIP A;  1N8J A;  6GSS A;  2PVO C;  1YDK A;  3RDW A;  4BVY B;  2XBI A;  1V40 A;  9GSS A;  5AIX A;  4ZXG A;  3CBU A;  2N5A A;  3TRQ A;  4LLR A;  3HKR A;  4JE1 A;  1GSS A;  2VD0 A;  12GS A;  3GMF A;  1FO5 A;  2X99 A;  4NV5 A;  1F6M C;  1W89 A;  3KGK A;  2DJ2 A;  2LRC A;  2YOI A;  2HSM A;  2OJL A;  2YNX A;  3KP8 A;  2AAW A;  2LST A;  3KH7 A;  2IL3 A;  2H01 A;  3CSJ A;  1XWK A;  3DVW A;  1OE7 A;  4TXO A;  3FR3 A;  4ZBD A;  4K5S A;  1ST9 A;  1FW1 A;  4TRX A;  3ZRE A;  2IN3 A;  1WPI A;  1VF3 A;  4OD7 A;  5KN2 A;  3FYG A;  4AI6 A;  5LD0 A;  1HNB A;  5CRG A;  3MNG A;  2YAN A;  1T3B A;  4MJB A;  1H75 A;  3IV4 A;  4HSC X;  1H4O A;  3VPT A;  5JCW A;  4ECC A;  1SVM A;  5H5Q A;  4F82 A;  4K1F A;  4BL7 B;  2FWH A;  2I4A A;  3HCZ A;  5EL8 A;  5ENU A;  2DSA A;  5KN3 A;  2OA7 A;  3DRN A;  5D9W A;  4WF5 A;  4BVX A;  2WW1 A;  2WB9 A;  2IWT A;  4GF0 A;  4WR5 A;  3EIN A;  5DQY A;  1PN0 A;  4K7O A;  1X9W B;  5C00 A;  1TRW A;  5G2Z A;  2O85 A;  4BVY A;  2A2S A;  2B1K A;  5HFI A;  3C71 A;  3VPQ A;  3A5I A;  2YWO A;  3GUR A;  4HZ2 A;  2C0E A;  1O81 A;  4W66 A;  1GRX A;  2CAI A;  2QA2 A;  2WVZ A;  4CHS A;  5B6M A;  1YEW C;  5IMZ A;  1B4Q A;  3IC8 A;  2JU5 A;  3ZFB A;  1SJI A;  1UN2 A;  2UV8 G;  3HMJ G;  3FY7 A;  2LRN A;  4FIW A;  4POB A;  2OBK A;  2H72 A;  1B8X A;  1ON4 A;  3QFA C;  2HSY A;  3KMO A;  1XCC A;  1FVJ A;  3RPN A;  4NWY A;  3UL3 A;  3M0F A;  3EVI A;  4FXY P;  2PWJ A;  2DLX A;  1PSQ A;  2ZCT A;  4POK A;  4A5P A;  2R4V A;  1FVK A;  2YWM A;  4F9Z A;  4ZL8 A;  1T8E B;  1EGR A;  2R3X A;  4AKX B;  2VO4 A;  5AIS A;  1SL1 B;  4EE0 A;  2LRT A;  2QGV A;  4JBB A;  2L6D A;  4EIQ A;  1TU8 A;  2HRK B;  4HU7 A;  3ZVJ D;  4JR4 A;  4KF9 A;  3KP9 A;  5IO0 A;  1FAA A;  3MAK A;  1SEN A;  3LG6 A;  2DIY A;  4G01 A;  3NIV A;  4BWQ A;  4EDZ A;  3LXZ A;  4GSS A;  4J56 E;  4NPB A;  4ID0 A;  1K0C A;  5CNW A;  2C4J A;  1ZYE A;  2MYG A;  3TKS C;  4FH8 A;  4O5Q A;  1IYI A;  2WDU A;  18GS A;  1Z9H A;  2L5O A;  2HNL A;  3O6T A;  3BOA A;  5GAN D;  4XRA A;  4F2I A;  1PA3 A;  3TKS A;  2IMK A;  4LL1 B;  1KBN A;  2FGX A;  2OAC A;  1JLV A;  3GX0 A;  1MEK A;  4GST A;  4D73 A;  4PUR A;  3EPT A;  3FW2 A;  3SBC A;  2OE1 A;  5J4U A;  1RQM A;  1SYX A;  4N11 A;  4GSN A;  1GSF A;  3EE2 A;  2E2M A;  4BWS A;  4FYU A;  2H66 A;  1AC1 A;  2O87 A;  2JZT A;  4KCA A;  2F9S A;  4OWY A;  1XWG A;  5IMC A;  4KDY A;  1PL2 A;  1EGO A;  2QA1 A;  2DJJ A;  1BF5 A;  1TP9 A;  1K3L A;  2WW3 A;  4OFN A;  2J9H A;  2VCT A;  2F8A A;  1R5A A;  2HRK A;  1X5E A;  5AGY A;  4Z2T A;  1T1V A;  3D4T A;  1J0F A;  11GS A;  2VL2 A;  2WGR A;  5D96 A;  3KTL A;  2HT9 A;  3D21 A;  1GNW A;  2H1D A;  1TW9 A;  5F06 A;  3CHX C;  3APS A;  2PER A;  1XWC A;  2B5X A;  1ZYQ B;  2R0C A;  1S3A A;  3GKK A;  3UMA A;  3I43 A;  3GYK A;  5ABR A;  2H75 A;  3L9S A;  1N2A A;  3TKR A;  2R2J A;  3DIE A;  2OKA A;  3VLN A;  1AAZ A;  2H76 A;  2YP6 A;  2C3T A;  3DWV A;  1KNG A;  2WVY A;  3IR4 A;  4K0N A;  2NBS A;  3QAG A;  3M8N A;  2K9F A;  4O5U A;  1A8L A;  4PX1 A;  3IPZ A;  4N10 A;  2E2G A;  3EWL A;  5G5E A;  1E2Y A;  2JAC A;  3A2V A;  5JWR B;  3PR8 A;  3C1R A;  1BG5 A;  3KJY A;  4IQA A;  2B6M A;  2UZ8 A;  3ZVJ A;  2WJU A;  1B4P A;  4CY8 A;  4CY6 A;  3F4T A;  3ERW A;  5F07 A;  3VWX A;  2FWG A;  1U88 A;  4KH7 A;  1VF4 A;  3ME7 A;  2V6K A;  1Z7P A;  2VAF A;  3C73 A;  1DE1 A;  1X0R A;  2AYT A;  3PIN A;  5AIV A;  1GTU A;  4ZL9 A;  3HVX A;  4XS1 A;  4XS4 B;  4MF7 A;  1J08 A;  3GKN A;  3O76 A;  2YV7 A;  1SVL A;  5ECL B;  5KEJ A;  2DJK A;  2GGT A;  4K2D A;  2F8F A;  4KCE A;  2IMD A;  2F51 A;  2FLS A;  1T4Y A;  3EC3 A;  1R26 A;  20GS A;  3VWW A;  1A8Y A;  2LQO A;  4K7I A;  4MPG A;  1OYJ A;  1WRY A;  3H93 A;  1TTZ A;  5A4U A;  4TR1 B;  1VRS D;  1BQ7 A;  3QAW A;  3U5R E;  2GTU A;  2MMO A;  5CO3 A;  5G30 A;  4LMW A;  5EY6 A;  3KCM A;  1XBS A;  1G7O A;  5HR0 A;  4RI7 A;  4TXV A;  1AXD A;  2LQQ A;  2N5B A;  2L59 A;  1K3Y A;  2G0F A;  2KP1 A;  1AIU A;  2HYX A;  1B9X C;  1AQW A;  3D22 A;  1OE8 A;  1CQH A;  2PU9 C;  3WGD A;  2M46 A;  1EV4 A;  1R4W A;  1DE2 A;  4IKH A;  5FT3 A;  2IME A;  2JSZ A;  2OE3 A;  5GAP D;  1DBY A;  2AUV A;  1K0M A;  5B6N A;  2QSI A;  3I9V 2;  2X8H A;  1GP1 A;  1AQV A;  4EXJ A;  1PKW A;  3LFL A;  4MH3 A;  1G0T A;  4MJE A;  5F0G A;  3L4N A;  4ZB7 A;  4OO4 A;  5ECP B;  2C8U A;  4MF5 A;  1FB6 A;  1FOH A;  1R7H A;  1WIK A;  2CVB A;  1MD3 A;  5KN0 A;  1LBK A;  4XS4 A;  2YZH A;  3GSS A;  3LQ7 A;  5F05 A;  2FWF A;  1A24 A;  1M2D A;  1JZD A;  5ELG A;  1QFN A;  2MZC A;  4P3Y B;  1ZZY A;  3O3T A;  1B9Y C;  5H5R A;  3DD3 A;  3FK8 A;  1OC9 B;  4BIK A;  2PGT A;  1QMV A;  3MDK A;  5CRW A;  2L6C A;  4N30 A;  1MTC A;  17GS A;  4TR1 A;  3TOU A;  5A4V A;  4TN8 A;  1PN9 A;  2EIQ A;  1BG1 A;  1Z7R A;  3QDN A;  1TDI A;  3ZZX A;  3IE3 A;  3TKQ A;  4WEY A;  2KUC A;  3ZMK A;  5B7C A;  2FY6 A;  4WBR D;  4G0L A;  4G10 A;  2H0H A;  3KZQ A;  4KB3 A;  4IN0 A;  1RW1 A;  2TIR A;  3TOT A;  4AJ8 A;  3TCO A;  4ML1 A;  1SJZ A;  2IMI A;  4OCE A;  3MYD A;  3TUE A;  3NOF A;  4V1A p;  3PPU A;  2R5G A;  2BJX A;  2MMA A;  1X5C A;  1XW5 A;  4AJ6 A;  1WP0 A;  4K6X A;  2ES7 A;  5LCZ A;  4X4J A;  1M0U A;  1SK0 A;  1QUW A;  1I9D A;  4FYC A;  3HZ8 A;  4HUA A;  3LW9 A;  1TI3 A;  3EYT A;  6GSY A;  5CYY A;  3W6G A;  1PQN A;  2X49 A;  2RM5 A;  5HFK A;  5ECM B;  3ZTL A;  3LEF A;  2WW2 A;  1OC9 A;  1TK8 B;  3A5W A;  1Z6M A;  3PH9 A;  2H6Z A;  4KGI A;  4HEA 2;  5HR2 A;  4N0Z A;  1Z3E A;  4FQU A;  1V2A A;  1YZX A;  1GSU A;  2H70 A;  2H19 A;  2OBI A;  1ERV A;  3FR9 A;  3RGB C;  4PUF C;  4RQR A;  5KOW A;  3HYP A;  1E6B A;  2CAQ A;  3A2W A;  4GTU A;  4L5O A;  3GHA A;  4YQU A;  4MMM A;  4NHW A;  1PX7 A;  4F0B A;  4ACS A;  1EEJ A;  2P5Q A;  3GH6 A;  2CVD A;  1XW9 A;  5IMF A;  1XVQ A;  2WCI A;  1PKZ A;  5CRH A;  2CVK A;  1ZGN A;  1TXU A;  1F2E A;  4IW9 A;  5INY A;  3P90 A;  1FB0 A;  4KW6 A;  1BED A;  2YWI A;  2HSN B;  5G1L A;  1SU9 A;  4V2M A;  14GS A;  4TR4 A;  1G6Y A;  1NSW A;  1QGV A;  2O8V B;  4KA0 A;  4PQI A;  3IA1 A;  1EP7 A;  2IMF A;  1JZR A;  2C1Y A;  2LNT A;  2L4C A;  3GRX A;  3CWG A;  5FHI A;  4ML6 A;  3FKF A;  4RUV A;  1YJ6 A;  2YPM A;  2CX4 A;  3IAM 2;  3APQ A;  3HJO A;  2GZY A;  3ZLP A;  4TKY A;  3EMX A;  2CA8 A;  1UVZ A;  4GRF A;  1XG8 A;  3MIX A;  4Q5R A;  1LJR A;  4USS A;  1PX6 A;  1FOV A;  1X9M B;  5DQS A;  1QQ2 A;  4NV2 A;  3ERF A;  2KLX A;  3ED3 A;  3GST A;  4L8E A;  4AKI A;  3DYR A;  2EFC A;  5GST A;  4KUN A;  3ZIV A;  4PXO A;  2PN8 A;  19GS A;  4CDO A;  4K8M A;  1V9W A;  4NAX A;  1SYR A;  4KDX A;  1VF2 A;  2FCH A;  5ECQ B;  1BX9 A;  5ELA A;  3S9F A;  1ZYP A;  1THO A;  4XS6 A;  1TKD B;  4IBP A;  3ZML A;  2WZ9 A;  4ZIL A;  3FMW A;  3IAS 2;  3CTF A;  5IM9 A;  3TDG A;  2HRA A;  3FZ9 A;  4BL7 A;  1V58 A;  2R0G A;  3DEX A;  2XBQ A;  4OMV A;  2A4V A;  4TOP A;  5J47 A;  4AGS A;  1O8X A;  1TJD A;  4BPY A;  2WVX B;  10GS A;  2YCD A;  2C3Q A;  4EDY A;  2LJR A;  5D9V A;  2HSN A;  5DBQ A;  5J9C A;  1USB A;  2XPE A;  2M80 A;  3QD9 A;  4NHZ A;  2FA4 A;  1I1I P;  1PMT A;  1UC7 A;  4F0C A;  3IOS A;  1GTA A;  2P31 A;  3OR5 A;  2RII A;  3M1G A;  1M2A A;  3FZ4 A;  5J9B A;  1SD9 A;  1K0B A;  5A5H B;  4POM A;  3ZYW A;  1W4V A;  3HJM A;  2X4A A;  2FHE A;  2VCX A;  2V32 A;  2WUL A;  2I81 A;  3C1S A;  3BBY A;  2DIZ A;  5JWO B;  2DKI A;  2ON7 A;  3EMP A;  5FWG A;  2WFC A;  4YKF A;  2I3Y A;  4RQX A;  2DKH A;  1YKC A;  2H6X A;  2MBS A;  2K6V A;  2JL4 A;  4KAE A;  3WT1 A;  3F3Q A;  4AKG A;  4LMV A;  1A2M A;  1GUH A;  5DDL A;  4JZQ A;  3HVN A;  1WOU A;  3GN3 A;  1PD2 1;  2RM6 A;  4JU5 A;  5G5F A;  3TKP A;  2HSH A;  1MDI A;  2NTO A;  4ILF A;  1K0N A;  3ZIT A;  3ISO A;  3F8U A;  1M7T A;  4AKH A;  4V2L A;  3U6V A;  1XVW A;  4I8B A;  2NPB A;  2VOC A;  6GSU A;  2LJK A;  4ZIJ A;  1ERW A;  2H73 A;  4GLT A;  2WVX A;  1YQ1 A;  1ZOF A;  2EC4 A;  1M3J A;  2EFE A;  2NVL A;  1Y25 A;  4X0X A;  2H1B A;  1FHE A;  6GSX A;  2V2G A;  1AW9 A;  2HZE B;  2VKZ G;  4I2U A;  2FNO A;  4KX4 A;  3IK9 A;  1XZO A;  2HZF A;  5A1N B;  1G6W A;  3IHQ A;  1A2J A;  3HHV A;  4ISD A;  3KEB A;  6GST A;  4MK3 A;  2ZNM A;  2A4H A;  2GVP A;  2PUK C;  3KIJ A;  2ALB A;  3F6D A;  5A5H A;  3DKS A;  2H8L A;  2YZU A;  3R2Q A;  5IOW A;  1EOH A;  2K8V A;  1X5D A;  3P7X A;  4MLY A;  3TJG A;  1ABA A;  3A3T A;  3LYP A;  3Q19 A;  3GKX A;  3WGE A;  4ULX A;  3TJJ A;  3VI7 A;  1GL8 A;  1DSB A;  1M2B A;  3D0Z A;  1SL2 B;  3GUS A;  1A23 A;  2H30 A;  1C72 A;  5DJM A;  5D9T A;  1SJ6 A;  3IC4 A;  5KN1 A;  2KOK A;  4ZB8 A;  2HRF A;  5DAK B;  4ECI A;  3GFK A;  4MZW A;  2GST A;  4MF6 A;  5HR3 A;  1GSY A;  2ZUP A;  1DUG A;  1XIY A;  1JFU A;  3GX8 A;  1ZMA A;  3M9K A;  2TRX A;  3CMI A;  2L57 A;  3HXS A;  1HNC A;  3QR6 A;  5DCG A;  3UAP A;  1GH2 A;  1O85 A;  2DJ1 A;  2GSR A;  4K9Z A;  3KTB A;  3FEU A;  5CAX A;  4J57 E;  2H0G A;  3WD6 A;  2GQK A;  4DSR A;  3VUR A;  4IGJ A;  3TU3 B;  2HZE A;  2LNS A;  2GDR A;  2QC7 A;  4HOJ A;  3IXR A;  3F4R A;  4MNN A;  2IPA A;  2DML A;  5DJL A;  4WF4 A;  3LJR A;  2J23 A;  1TXX A;  16GS A;  5A1N A;  1ERU A;  3RFR C;  1WJK A;  3PGT A;  3ERG A;  1NW2 A;  5JWQ B;  1TOF A;  2VCZ A;  2X8C A;  3IHG A;  2LUS A;  1BYE A;  4G0I A;  1A0R P;  2P0G A;  2EIO A;  5A5K A;  4EKZ A;  2A2P A;  2FD3 A;  4AF2 A;  2C0D A;  3C8E A;  3H1N A;  4N3Z A;  3TKS E;  1M3I A;  2RUF A;  2P5R A;  1HYU A;  2I9H A;  4MH2 A;  3F3R A;  4TR0 A;  4Z7X A;  1AQX A;  2E0Q A;  3L9V A;  2LJA A;  1GLP A;  3APO A;  1X9S B;  2E7P A;  3ZRD A;  5ECR B;  1GNE A;  4Q5Q A;  1GUM A;  1QXH A;  5DAK A;  2Z9S A;  3F4S A;  1KEB A;  4V2N A;  1WE0 A;  2GZP A;  3W8J A;  1BAY A;  4TR3 A;  2V41 A;  1TU7 A;  3D5J A;  2YJH A;  1VF1 A;  3LOR A;  2O5V A;  3D6I A;  2EIR A;  4KE3 A;  1Z6N A;  4Q5N A;  2OAD A;  3H8Q A;  2GSS A;  1PFO A;  2F3M A;  4E8H A;  1EWX A;  2YJ7 A;  1XXU A;  5CRD A;  1M99 A;  4HQZ A;  4Z2R A;  1SKR B;  4L0W A;  2LS5 A;  4AJ7 A;  1GSQ A;  2HSM B;  3CYN A;  3G7Y A;  3GL5 A;  4JRR A;  2GZZ A;  3RAZ A;  3AY8 A;  5DAL B;  3N9J A;  2GT6 A;  3CRU A;  2JZS A;  4YAP A;  1U87 A;  2VIM A;  4EL1 A;  3MWH A;  4PNG A;  1K3O A;  2VM1 A;  1V57 A;  2OT3 A;  3EUR A;  4QMK A;  3FZ5 A;  4MDC A;  1YEX A;  1XWA A;  4IJ3 A;  1AUC A;  5A34 B;  2H1L A;  4RI6 A;  1N25 A;  3VWU A;  4PNF A;  3EU3 A;  2H0I A;  1T7P B;  2LEG A;  3BCI A;  2YN1 A;  4DEJ A;  1U3A A;  2B7J A;  1YF1 A;  3VFI A;  4HQS A;  2CZ2 A;  1Q98 A;  3CSI A;  3GV1 A;  4X43 A;  2YWN A;  1OC8 A;  5IMA A;  2PPT A;  3UIW A;  2GLR A;  3C7M A;  4MCU A;  2I1U A;  3NZN A;  1A0F A;  5EPF A;  4HI7 A;  4YAV A;  1ACV A;  4HZ4 A;  1GTB A;  1JZO A;  4OFT A;  4JR6 A;  3GL3 A;  5J41 A;  4HU9 A;  2CZ3 A;  5ECK B;  2XHF A;  4MJC A;  4BVX B;  4IVF A;  1RK4 A;  5AN1 A;  5B8A A;  1G7E A;  4IHU A;  2XPD A;  1SK1 A;  2CV4 A;  3KD0 A;  2GQL A;  3D4M A;  3K8N A;  1OKT A;  1O6J A;  3DXB A;  5BMU B;  4PUA A;  1EOG A;  4HJ2 A;  4E8E A;  1S3D A;  5G1K A;  3UJ1 A;  2WS2 A;  5DAL A;  4WET A;  2DC5 A;  4XCS A;  4WXT A;  4PI0 C;  4HJM A;  4IP1 A;  1WMJ A;  3KH9 A;  5E4W A;  4CW9 A;  2N5F A;  4EVM A;  2R37 A;  4K7N A;  5A34 A;  1S3C A;  3CTG A;  3TGZ A;  1UA5 A;  3CSH A;  1O8W A;  1WWJ A;  4HS1 A;  4G2E A;  3WGX A;  2JAD A;  1NHO A;  6GSW A;  3H79 A;  2CX3 A;  3UVH A;  1MDK A;  1ZL9 A;  3F0I A;  2JSY A;  3UBL A;  4K0G A;  2C0G A;  1R5P A;  2VLV A;  3VK9 A;  1PRX A;  4F03 A;  3QFB C;  1QK8 A;  5ECI B;  4Z2U A;  4GQC A;  2O7K A;  4O5R A;  3QOU A;  2C80 A;  3JCM L;  4LA1 A;  5EVO A;  3FHK A;  4XHM A;  1U3I A;  1Y1U A;  4PQH A;  5HQP A;  1XOA A;  2QKE A;  4BA7 A;  1BJX A;  3CQF A;  5LNK e;  3M9J A;  4XIH A;  4TW5 A;  22GS A;  3HVV A;  1OAZ A;  1KTE A;  3P8W A;  2PMT A;  3WYW A;  1EZK A;  3BCK A;  4IP6 A;  3A2X A;  2GT5 A;  4O32 A;  3UOM A;  2FA8 A;  2HXK A;  4X1U A;  1B48 A;  4N0V A;  5BMU A;  4MA9 A;  3H4K A;  3E9J B;  5J4V A;  5KOX A;  5G31 A;  4O7H A;  1GSD A;  1PL1 A;  5IMD A;  4FO5 A;  1ZCP A;  4MJA A;  4DSS B;  3E0U A;  5J5N A;  2K8S A;  4D73 B;  1ILO A;  3P2A A;  3KMN A;  3I69 A;  3KXO A;  2MMN A;  5C04 A;  5CP1 A;  1YKA A;  4ZBB A;  2HRN A;  5DCH A;  4XTS A;  7GSS A;  4H86 A;  5GZZ B;  4GCI A;  2B3S A;  5ECS A;  2LV3 A;  3CXG A;  2VLT A;  5JCG A;  3V1W A;  5B8B A;  4ZL7 A;  4GWR A;  1TRU A;  1HQO A;  1YF0 A;  3TB2 A;  2VUP A;  6GSV A;  2WW0 A;  2VL3 A;  3GTU B;  3J7Y k;  1TK5 B;  2R6K A;  5J40 A;  4JED A;  2V1M A;  4WR4 A;  2IFQ B;  2AV4 A;  3UBK A;  5F8B A;  5ID2 B;  2OE0 A;  8GSS A;  1Z5Y E;  5HFG A;  1GLQ A;  2M72 A;  2HI7 A;  3US3 A;  2IJY A;  2XC2 A;  1CQG A;  5IPH A;  3LYK A;  5COH A;  1XWB A;  1F3B A;  2L5L A;  3G7J A;  4MZB A;  1ML6 A;  3MSZ A;  2BMX A;  4ZB9 A;  4ECB A;  3BJ5 A;  2HLS A;  4I6X A;  1LU4 A;  1F37 A;  1I5G A;  3L9U A;  2IIY A;  4MPF A;  2H1G A;  1K0O A;  1OKD A;  3F9U A;  4OO5 A;  4DSS A;  4QL9 A;  4YQM A;  2O3E A;  1NHY A;  1O73 A;  2K18 A;  5A4W A;  2KP2 A;  5IQY A;  2X64 A;  2WZS A;  5IMV A;  2PVQ A;  4K2X A;  4NMU A;  2A2R A;  3HDC A;  4J2F A; 
#chains in the Genus database with same CATH homology
 1HNA A;  4PTS A;  2GQM A;  3WT2 A;  1T00 A;  1TI1 A;  1GUK A;  1M9A A;  4GQF A;  2LKU A;  5D73 A;  2BTO T;  2NDO A;  4YQV A;  2ON5 A;  4TVE A;  2AJQ B;  2VL2 C;  5IIZ A;  4KDU A;  1K0D A;  4Q5F A;  2AHE A;  1EV9 A;  4EC0 A;  1TRV A;  4KSO A;  3ME8 A;  1XPV A;  1M9B A;  3LSZ A;  3GTU A;  3DVX A;  5E59 A;  2EFH A;  4PQ1 A;  1YY7 A;  3RHC A;  2B7K A;  2IFQ A;  3IBH A;  5ID2 A;  2GS3 A;  2B1L A;  1ZYN A;  5ECN B;  2TRC P;  4LL4 B;  3FZA A;  1SD8 A;  4IEL A;  4MP4 A;  2GSQ A;  5D93 A;  1GTI A;  2VM2 A;  3GNJ A;  1SL0 B;  2B5E A;  4E68 A;  1TK0 B;  3DGQ A;  5J3R A;  2B5Y A;  1VGL A;  4XRD A;  2YV9 A;  3QCP A;  4IQ1 A;  3ZFL A;  1J9B A;  2DJ3 A;  4L5L A;  3UAR A;  2VCW A;  3W8S A;  1Q4J A;  2V6O A;  3GKM A;  3L0H A;  2C3N A;  1THX A;  4G9H A;  2DMM A;  1HD2 A;  1XOB A;  4MZC A;  3F63 A;  1XW6 A;  3Q74 A;  1SVO A;  1FG4 A;  1SK2 A;  3GH9 A;  5J4Y A;  3QAV A;  3E3E A;  2VCV A;  1YEP A;  4QQ7 A;  1XFL A;  2H71 A;  5H5S A;  1JHB A;  4YKG A;  5CRE A;  3TRP A;  3IRA A;  2VL9 A;  2HQT A;  3I6A A;  2MMZ A;  3KM6 A;  3Q18 A;  4V1A g;  5HR1 A;  4QL7 A;  1NM3 A;  1OVN A;  3HJP A;  3QPM A;  2X8G A;  2AB6 A;  1PGT A;  1JLW A;  3BD2 A;  2VCQ A;  2R0P A;  3GA4 A;  1EP8 A;  4NXI A;  4ECJ A;  3ZL5 A;  4KSM A;  2FWE A;  5D8I A;  1MD4 A;  3TJF A;  3L78 A;  1SKW B;  2WRT A;  3CRT A;  2HE3 A;  4IJI A;  4DVC A;  3LGC A;  4EUY A;  2HFD A;  1F9M A;  5L71 A;  1ERT A;  5GSS A;  3VWV A;  3HD5 A;  5ECH B;  5BRT A;  4ZB6 A;  3LWA A;  1YVL A;  2H6Y A;  2L4Q A;  4G19 A;  4YH2 A;  4DSQ A;  3SWL A;  3IK7 A;  2C0F A;  4G0K A;  2DBC A;  4O92 A;  3RPP A;  4I97 A;  1GUL A;  1OC3 A;  3GIX A;  2H74 A;  3DML A;  1F3A A;  3QMX A;  3F6F A;  2O89 A;  4MAB A;  3G7I A;  2CQ9 A;  2H1A A;  3UEM A;  3M3M A;  5JCU A;  3TRX A;  2EFD A;  1U6T A;  4POL A;  1EEM A;  1GWC A;  2D2Z A;  4EF0 A;  4GDF A;  4HDE A;  1MDJ A;  2VD1 A;  1T4Z A;  3N5O A;  2MBT A;  2RLI A;  4KND A;  3R3E A;  5IOX A;  3J7Y b;  4WBJ A;  2DJ0 A;  1IYH A;  3TJB A;  1URM A;  1Y6E A;  1GSE A;  5D9X A;  5ECO B;  4K5R A;  3G9B A;  4I5Q A;  4TXO B;  3EU4 A;  4I2T A;  1SKS B;  13GS A;  2REM A;  2CT6 A;  2LTK A;  3HVS A;  1JZW A;  3HA9 A;  3VI5 A;  4FYB A;  4GXZ A;  3RBT A;  3Q6O A;  3HZ4 A;  3HY2 A;  3FRC A;  3RHB A;  4ICY A;  4PGT A;  4WKW A;  2FUG 2;  5IPG A;  2G2Q A;  1K0A A;  4IS0 A;  3TJK A;  4EO3 A;  4OCF A;  1A2L A;  5IO2 A;  2PBJ A;  1V98 A;  2KHP A;  3LXT A;  4OFM A;  2RUE A;  3ZIJ A;  5DVB A;  4L0U A;  2VLU A;  3UVT A;  2JZR A;  1TRS A;  1O7U A;  4ZBA A;  3FR6 A;  3IDV A;  4EIP A;  1N8J A;  6GSS A;  2PVO C;  1YDK A;  3RDW A;  4BVY B;  2XBI A;  1V40 A;  9GSS A;  5AIX A;  4ZXG A;  3CBU A;  2N5A A;  3TRQ A;  4LLR A;  3HKR A;  4JE1 A;  1GSS A;  2VD0 A;  12GS A;  3GMF A;  1FO5 A;  2X99 A;  4NV5 A;  1F6M C;  1W89 A;  3KGK A;  2DJ2 A;  2LRC A;  2YOI A;  2HSM A;  2OJL A;  2YNX A;  3KP8 A;  2AAW A;  2LST A;  3KH7 A;  2IL3 A;  2H01 A;  3CSJ A;  1XWK A;  3DVW A;  1OE7 A;  4TXO A;  3FR3 A;  4ZBD A;  4K5S A;  1ST9 A;  1FW1 A;  4TRX A;  3ZRE A;  2IN3 A;  1WPI A;  1VF3 A;  4OD7 A;  5KN2 A;  3FYG A;  4AI6 A;  5LD0 A;  1HNB A;  5CRG A;  3MNG A;  2YAN A;  1T3B A;  4MJB A;  1H75 A;  3IV4 A;  1H4O A;  3VPT A;  5JCW A;  4ECC A;  1SVM A;  5H5Q A;  4F82 A;  4K1F A;  4BL7 B;  2FWH A;  2I4A A;  3HCZ A;  5EL8 A;  5ENU A;  2DSA A;  5KN3 A;  2OA7 A;  3DRN A;  5D9W A;  4WF5 A;  4BVX A;  2WB9 A;  2IWT A;  4GF0 A;  4WR5 A;  3EIN A;  5DQY A;  1PN0 A;  4K7O A;  1X9W B;  5C00 A;  1TRW A;  5G2Z A;  2O85 A;  4BVY A;  2A2S A;  2B1K A;  5HFI A;  3C71 A;  3VPQ A;  3A5I A;  2YWO A;  3GUR A;  4HZ2 A;  2C0E A;  1O81 A;  4W66 A;  1GRX A;  2CAI A;  2QA2 A;  4CHS A;  5B6M A;  5IMZ A;  1B4Q A;  3IC8 A;  2JU5 A;  3ZFB A;  1SJI A;  1UN2 A;  2UV8 G;  3HMJ G;  3FY7 A;  2LRN A;  4FIW A;  4POB A;  2OBK A;  2H72 A;  1B8X A;  1ON4 A;  3QFA C;  2HSY A;  3KMO A;  1XCC A;  1FVJ A;  3RPN A;  4NWY A;  3UL3 A;  3M0F A;  3EVI A;  2PWJ A;  2DLX A;  1PSQ A;  2ZCT A;  4POK A;  4A5P A;  2R4V A;  1FVK A;  2YWM A;  4F9Z A;  4ZL8 A;  1T8E B;  1EGR A;  2R3X A;  4AKX B;  2VO4 A;  5AIS A;  1SL1 B;  4EE0 A;  2LRT A;  2QGV A;  4JBB A;  2L6D A;  4EIQ A;  1TU8 A;  2HRK B;  4HU7 A;  3ZVJ D;  4JR4 A;  4KF9 A;  3KP9 A;  5IO0 A;  1FAA A;  3MAK A;  1SEN A;  3LG6 A;  2DIY A;  4G01 A;  3NIV A;  4BWQ A;  4EDZ A;  3LXZ A;  4GSS A;  4J56 E;  4NPB A;  4ID0 A;  1K0C A;  5CNW A;  2C4J A;  1ZYE A;  2MYG A;  3TKS C;  4FH8 A;  4O5Q A;  1IYI A;  2WDU A;  18GS A;  1Z9H A;  2L5O A;  2HNL A;  3O6T A;  3BOA A;  5GAN D;  4XRA A;  4F2I A;  1PA3 A;  3TKS A;  2IMK A;  4LL1 B;  1KBN A;  2FGX A;  2OAC A;  1JLV A;  3GX0 A;  1MEK A;  4GST A;  4D73 A;  4PUR A;  3EPT A;  3FW2 A;  3SBC A;  2OE1 A;  5J4U A;  1RQM A;  1SYX A;  4N11 A;  4GSN A;  1GSF A;  3EE2 A;  2E2M A;  4BWS A;  4FYU A;  2H66 A;  1AC1 A;  2O87 A;  2JZT A;  4KCA A;  2F9S A;  4OWY A;  1XWG A;  5IMC A;  4KDY A;  1PL2 A;  1EGO A;  2QA1 A;  2DJJ A;  1BF5 A;  1TP9 A;  1K3L A;  4OFN A;  2J9H A;  2VCT A;  2F8A A;  1R5A A;  2HRK A;  1X5E A;  5AGY A;  4Z2T A;  1T1V A;  3D4T A;  1J0F A;  11GS A;  2VL2 A;  2WGR A;  5D96 A;  3KTL A;  2HT9 A;  3D21 A;  1GNW A;  2H1D A;  1TW9 A;  5F06 A;  3APS A;  2PER A;  1XWC A;  2B5X A;  1ZYQ B;  2R0C A;  1S3A A;  3GKK A;  3UMA A;  3I43 A;  3GYK A;  5ABR A;  2H75 A;  3L9S A;  1N2A A;  3TKR A;  2R2J A;  3DIE A;  2OKA A;  3VLN A;  1AAZ A;  2H76 A;  2YP6 A;  2C3T A;  3DWV A;  1KNG A;  3IR4 A;  4K0N A;  2NBS A;  3QAG A;  3M8N A;  2K9F A;  4O5U A;  1A8L A;  4PX1 A;  3IPZ A;  4N10 A;  2E2G A;  3EWL A;  5G5E A;  1E2Y A;  2JAC A;  3A2V A;  5JWR B;  3PR8 A;  3C1R A;  1BG5 A;  3KJY A;  4IQA A;  2B6M A;  2UZ8 A;  3ZVJ A;  2WJU A;  1B4P A;  4CY8 A;  4CY6 A;  3F4T A;  3ERW A;  5F07 A;  3VWX A;  2FWG A;  1U88 A;  4KH7 A;  1VF4 A;  3ME7 A;  2V6K A;  1Z7P A;  2VAF A;  3C73 A;  1DE1 A;  1X0R A;  2AYT A;  3PIN A;  5AIV A;  1GTU A;  4ZL9 A;  3HVX A;  4XS1 A;  4XS4 B;  4MF7 A;  1J08 A;  3GKN A;  3O76 A;  2YV7 A;  1SVL A;  5ECL B;  5KEJ A;  2DJK A;  2GGT A;  4K2D A;  2F8F A;  4KCE A;  2IMD A;  2F51 A;  2FLS A;  1T4Y A;  3EC3 A;  1R26 A;  20GS A;  3VWW A;  1A8Y A;  2LQO A;  4K7I A;  4MPG A;  1OYJ A;  1WRY A;  3H93 A;  1TTZ A;  5A4U A;  4TR1 B;  1VRS D;  1BQ7 A;  3QAW A;  3U5R E;  2GTU A;  2MMO A;  5CO3 A;  5G30 A;  4LMW A;  5EY6 A;  3KCM A;  1XBS A;  1G7O A;  5HR0 A;  4RI7 A;  4TXV A;  1AXD A;  2LQQ A;  2N5B A;  2L59 A;  1K3Y A;  2G0F A;  2KP1 A;  1AIU A;  2HYX A;  1B9X C;  1AQW A;  3D22 A;  1OE8 A;  1CQH A;  2PU9 C;  3WGD A;  2M46 A;  1EV4 A;  1R4W A;  1DE2 A;  4IKH A;  5FT3 A;  2IME A;  2JSZ A;  2OE3 A;  5GAP D;  1DBY A;  2AUV A;  1K0M A;  5B6N A;  2QSI A;  3I9V 2;  2X8H A;  1GP1 A;  1AQV A;  4EXJ A;  1PKW A;  3LFL A;  4MH3 A;  1G0T A;  4MJE A;  5F0G A;  3L4N A;  4ZB7 A;  4OO4 A;  5ECP B;  2C8U A;  4MF5 A;  1FB6 A;  1FOH A;  1R7H A;  1WIK A;  2CVB A;  1MD3 A;  5KN0 A;  1LBK A;  4XS4 A;  2YZH A;  3GSS A;  3LQ7 A;  5F05 A;  2FWF A;  1A24 A;  1M2D A;  1JZD A;  5ELG A;  1QFN A;  2MZC A;  4P3Y B;  1ZZY A;  3O3T A;  1B9Y C;  5H5R A;  3DD3 A;  3FK8 A;  1OC9 B;  2PGT A;  1QMV A;  3MDK A;  5CRW A;  2L6C A;  4N30 A;  1MTC A;  17GS A;  4TR1 A;  3TOU A;  5A4V A;  4TN8 A;  1PN9 A;  2EIQ A;  1BG1 A;  1Z7R A;  3QDN A;  1TDI A;  3ZZX A;  3IE3 A;  3TKQ A;  4WEY A;  2KUC A;  3ZMK A;  5B7C A;  2FY6 A;  4WBR D;  4G0L A;  4G10 A;  2H0H A;  3KZQ A;  4KB3 A;  4IN0 A;  1RW1 A;  2TIR A;  3TOT A;  4AJ8 A;  3TCO A;  4ML1 A;  1SJZ A;  2IMI A;  4OCE A;  3MYD A;  3TUE A;  3NOF A;  4V1A p;  3PPU A;  2R5G A;  2BJX A;  2MMA A;  1X5C A;  1XW5 A;  4AJ6 A;  1WP0 A;  4K6X A;  2ES7 A;  5LCZ A;  4X4J A;  1M0U A;  1SK0 A;  1QUW A;  1I9D A;  4FYC A;  3HZ8 A;  4HUA A;  3LW9 A;  1TI3 A;  3EYT A;  6GSY A;  5CYY A;  3W6G A;  1PQN A;  2X49 A;  2RM5 A;  5HFK A;  5ECM B;  3ZTL A;  3LEF A;  1OC9 A;  1TK8 B;  3A5W A;  1Z6M A;  3PH9 A;  2H6Z A;  4KGI A;  4HEA 2;  5HR2 A;  4N0Z A;  1Z3E A;  4FQU A;  1V2A A;  1YZX A;  1GSU A;  2H70 A;  2H19 A;  2OBI A;  1ERV A;  3FR9 A;  4PUF C;  4RQR A;  5KOW A;  3HYP A;  1E6B A;  2CAQ A;  3A2W A;  4GTU A;  4L5O A;  3GHA A;  4YQU A;  4MMM A;  4NHW A;  1PX7 A;  4F0B A;  4ACS A;  1EEJ A;  2P5Q A;  3GH6 A;  2CVD A;  1XW9 A;  5IMF A;  1XVQ A;  2WCI A;  1PKZ A;  5CRH A;  2CVK A;  1ZGN A;  1TXU A;  1F2E A;  4IW9 A;  5INY A;  3P90 A;  1FB0 A;  4KW6 A;  1BED A;  2YWI A;  2HSN B;  5G1L A;  1SU9 A;  4V2M A;  14GS A;  4TR4 A;  1G6Y A;  1NSW A;  1QGV A;  2O8V B;  4KA0 A;  4PQI A;  3IA1 A;  1EP7 A;  2IMF A;  1JZR A;  2C1Y A;  2LNT A;  2L4C A;  3GRX A;  3CWG A;  5FHI A;  4ML6 A;  3FKF A;  4RUV A;  1YJ6 A;  2YPM A;  2CX4 A;  3IAM 2;  3APQ A;  3HJO A;  2GZY A;  3ZLP A;  4TKY A;  3EMX A;  2CA8 A;  1UVZ A;  4GRF A;  3MIX A;  4Q5R A;  1LJR A;  4USS A;  1PX6 A;  1FOV A;  1X9M B;  5DQS A;  1QQ2 A;  4NV2 A;  3ERF A;  2KLX A;  3ED3 A;  3GST A;  4L8E A;  4AKI A;  3DYR A;  2EFC A;  5GST A;  4KUN A;  3ZIV A;  4PXO A;  2PN8 A;  19GS A;  4CDO A;  4K8M A;  1V9W A;  4NAX A;  1SYR A;  4KDX A;  1VF2 A;  2FCH A;  5ECQ B;  1BX9 A;  5ELA A;  3S9F A;  1ZYP A;  1THO A;  4XS6 A;  1TKD B;  4IBP A;  3ZML A;  2WZ9 A;  4ZIL A;  3FMW A;  3IAS 2;  3CTF A;  5IM9 A;  3TDG A;  2HRA A;  3FZ9 A;  4BL7 A;  1V58 A;  2R0G A;  3DEX A;  2XBQ A;  4OMV A;  2A4V A;  4TOP A;  5J47 A;  4AGS A;  1O8X A;  1TJD A;  4BPY A;  10GS A;  2YCD A;  2C3Q A;  4EDY A;  2LJR A;  5D9V A;  2HSN A;  5DBQ A;  5J9C A;  1USB A;  2XPE A;  2M80 A;  3QD9 A;  4NHZ A;  2FA4 A;  1PMT A;  1UC7 A;  4F0C A;  3IOS A;  1GTA A;  2P31 A;  3OR5 A;  2RII A;  3M1G A;  1M2A A;  3FZ4 A;  5J9B A;  1SD9 A;  1K0B A;  5A5H B;  4POM A;  3ZYW A;  1W4V A;  3HJM A;  2X4A A;  2FHE A;  2VCX A;  2V32 A;  2WUL A;  2I81 A;  3C1S A;  3BBY A;  2DIZ A;  5JWO B;  2DKI A;  2ON7 A;  3EMP A;  5FWG A;  2WFC A;  4YKF A;  2I3Y A;  4RQX A;  2DKH A;  1YKC A;  2H6X A;  2MBS A;  2K6V A;  2JL4 A;  4KAE A;  3WT1 A;  3F3Q A;  4AKG A;  4LMV A;  1A2M A;  1GUH A;  5DDL A;  4JZQ A;  1WOU A;  3GN3 A;  1PD2 1;  2RM6 A;  4JU5 A;  5G5F A;  3TKP A;  2HSH A;  1MDI A;  2NTO A;  4ILF A;  1K0N A;  3ZIT A;  3ISO A;  3F8U A;  1M7T A;  4AKH A;  4V2L A;  3U6V A;  1XVW A;  4I8B A;  2NPB A;  2VOC A;  6GSU A;  2LJK A;  4ZIJ A;  1ERW A;  2H73 A;  4GLT A;  1YQ1 A;  1ZOF A;  2EC4 A;  2EFE A;  2NVL A;  1Y25 A;  4X0X A;  2H1B A;  1FHE A;  6GSX A;  2V2G A;  1AW9 A;  2HZE B;  2VKZ G;  4I2U A;  2FNO A;  4KX4 A;  3IK9 A;  1XZO A;  2HZF A;  5A1N B;  1G6W A;  3IHQ A;  1A2J A;  3HHV A;  4ISD A;  3KEB A;  6GST A;  4MK3 A;  2ZNM A;  2A4H A;  2GVP A;  2PUK C;  3KIJ A;  2ALB A;  3F6D A;  5A5H A;  3DKS A;  2H8L A;  2YZU A;  3R2Q A;  5IOW A;  1EOH A;  2K8V A;  1X5D A;  3P7X A;  4MLY A;  3TJG A;  1ABA A;  3A3T A;  3LYP A;  3Q19 A;  3GKX A;  3WGE A;  4ULX A;  3TJJ A;  3VI7 A;  1GL8 A;  1DSB A;  1M2B A;  3D0Z A;  1SL2 B;  3GUS A;  1A23 A;  2H30 A;  1C72 A;  5DJM A;  5D9T A;  1SJ6 A;  3IC4 A;  5KN1 A;  2KOK A;  4ZB8 A;  2HRF A;  5DAK B;  4ECI A;  3GFK A;  4MZW A;  2GST A;  4MF6 A;  5HR3 A;  1GSY A;  2ZUP A;  1DUG A;  1XIY A;  1JFU A;  3GX8 A;  1ZMA A;  3M9K A;  2TRX A;  3CMI A;  2L57 A;  3HXS A;  1HNC A;  3QR6 A;  5DCG A;  3UAP A;  1GH2 A;  1O85 A;  2DJ1 A;  2GSR A;  4K9Z A;  3KTB A;  3FEU A;  5CAX A;  4J57 E;  2H0G A;  3WD6 A;  2GQK A;  4DSR A;  3VUR A;  4IGJ A;  3TU3 B;  2HZE A;  2LNS A;  2GDR A;  2QC7 A;  4HOJ A;  3IXR A;  3F4R A;  4MNN A;  2IPA A;  2DML A;  5DJL A;  4WF4 A;  3LJR A;  2J23 A;  1TXX A;  16GS A;  5A1N A;  1ERU A;  1WJK A;  3PGT A;  3ERG A;  1NW2 A;  5JWQ B;  1TOF A;  2VCZ A;  2X8C A;  3IHG A;  2LUS A;  1BYE A;  4G0I A;  1A0R P;  2P0G A;  2EIO A;  5A5K A;  4EKZ A;  2A2P A;  2FD3 A;  4AF2 A;  2C0D A;  3C8E A;  3H1N A;  4N3Z A;  3TKS E;  2RUF A;  2P5R A;  1HYU A;  2I9H A;  4MH2 A;  3F3R A;  4TR0 A;  4Z7X A;  1AQX A;  2E0Q A;  3L9V A;  2LJA A;  1GLP A;  3APO A;  1X9S B;  2E7P A;  3ZRD A;  5ECR B;  1GNE A;  4Q5Q A;  1GUM A;  1QXH A;  5DAK A;  2Z9S A;  3F4S A;  1KEB A;  4V2N A;  1WE0 A;  2GZP A;  3W8J A;  1BAY A;  4TR3 A;  2V41 A;  1TU7 A;  3D5J A;  2YJH A;  1VF1 A;  3LOR A;  2O5V A;  3D6I A;  2EIR A;  4KE3 A;  1Z6N A;  4Q5N A;  2OAD A;  3H8Q A;  2GSS A;  2F3M A;  4E8H A;  1EWX A;  2YJ7 A;  1XXU A;  5CRD A;  1M99 A;  4HQZ A;  4Z2R A;  1SKR B;  4L0W A;  2LS5 A;  4AJ7 A;  1GSQ A;  2HSM B;  3CYN A;  3G7Y A;  3GL5 A;  4JRR A;  2GZZ A;  3RAZ A;  3AY8 A;  5DAL B;  3N9J A;  2GT6 A;  3CRU A;  2JZS A;  4YAP A;  1U87 A;  2VIM A;  4EL1 A;  3MWH A;  4PNG A;  1K3O A;  2VM1 A;  1V57 A;  2OT3 A;  3EUR A;  4QMK A;  3FZ5 A;  4MDC A;  1YEX A;  1XWA A;  4IJ3 A;  1AUC A;  5A34 B;  2H1L A;  4RI6 A;  1N25 A;  3VWU A;  4PNF A;  3EU3 A;  2H0I A;  1T7P B;  2LEG A;  3BCI A;  2YN1 A;  4DEJ A;  1U3A A;  2B7J A;  1YF1 A;  3VFI A;  4HQS A;  2CZ2 A;  1Q98 A;  3CSI A;  3GV1 A;  4X43 A;  2YWN A;  1OC8 A;  5IMA A;  2PPT A;  3UIW A;  2GLR A;  3C7M A;  4MCU A;  2I1U A;  3NZN A;  1A0F A;  5EPF A;  4HI7 A;  4YAV A;  1ACV A;  4HZ4 A;  1GTB A;  1JZO A;  4OFT A;  4JR6 A;  3GL3 A;  5J41 A;  4HU9 A;  2CZ3 A;  5ECK B;  2XHF A;  4MJC A;  4BVX B;  4IVF A;  1RK4 A;  5AN1 A;  5B8A A;  1G7E A;  4IHU A;  2XPD A;  1SK1 A;  2CV4 A;  3KD0 A;  2GQL A;  3D4M A;  3K8N A;  1OKT A;  1O6J A;  3DXB A;  5BMU B;  4PUA A;  1EOG A;  4HJ2 A;  4E8E A;  1S3D A;  5G1K A;  3UJ1 A;  2WS2 A;  5DAL A;  4WET A;  2DC5 A;  4XCS A;  4WXT A;  4HJM A;  4IP1 A;  1WMJ A;  3KH9 A;  5E4W A;  4CW9 A;  2N5F A;  4EVM A;  2R37 A;  4K7N A;  5A34 A;  1S3C A;  3CTG A;  3TGZ A;  1UA5 A;  3CSH A;  1O8W A;  1WWJ A;  4HS1 A;  4G2E A;  3WGX A;  2JAD A;  1NHO A;  6GSW A;  3H79 A;  2CX3 A;  3UVH A;  1MDK A;  1ZL9 A;  3F0I A;  2JSY A;  3UBL A;  4K0G A;  2C0G A;  1R5P A;  2VLV A;  3VK9 A;  1PRX A;  4F03 A;  3QFB C;  1QK8 A;  5ECI B;  4Z2U A;  4GQC A;  2O7K A;  4O5R A;  3QOU A;  2C80 A;  3JCM L;  4LA1 A;  5EVO A;  3FHK A;  4XHM A;  1U3I A;  1Y1U A;  4PQH A;  5HQP A;  1XOA A;  2QKE A;  4BA7 A;  1BJX A;  5LNK e;  3M9J A;  4XIH A;  4TW5 A;  22GS A;  3HVV A;  1OAZ A;  1KTE A;  3P8W A;  2PMT A;  3WYW A;  1EZK A;  3BCK A;  4IP6 A;  3A2X A;  2GT5 A;  4O32 A;  3UOM A;  2FA8 A;  2HXK A;  4X1U A;  1B48 A;  4N0V A;  5BMU A;  4MA9 A;  3H4K A;  3E9J B;  5J4V A;  5KOX A;  5G31 A;  4O7H A;  1GSD A;  1PL1 A;  5IMD A;  4FO5 A;  1ZCP A;  4MJA A;  4DSS B;  3E0U A;  5J5N A;  2K8S A;  4D73 B;  1ILO A;  3P2A A;  3KMN A;  3I69 A;  3KXO A;  2MMN A;  5C04 A;  5CP1 A;  1YKA A;  4ZBB A;  2HRN A;  5DCH A;  4XTS A;  7GSS A;  4H86 A;  5GZZ B;  4GCI A;  2B3S A;  5ECS A;  2LV3 A;  3CXG A;  2VLT A;  5JCG A;  3V1W A;  5B8B A;  4ZL7 A;  4GWR A;  1TRU A;  1HQO A;  1YF0 A;  3TB2 A;  2VUP A;  6GSV A;  2VL3 A;  3GTU B;  3J7Y k;  1TK5 B;  2R6K A;  5J40 A;  4JED A;  2V1M A;  4WR4 A;  2IFQ B;  2AV4 A;  3UBK A;  5F8B A;  5ID2 B;  2OE0 A;  8GSS A;  1Z5Y E;  5HFG A;  1GLQ A;  2M72 A;  2HI7 A;  3US3 A;  2IJY A;  2XC2 A;  1CQG A;  5IPH A;  3LYK A;  5COH A;  1XWB A;  1F3B A;  2L5L A;  3G7J A;  4MZB A;  1ML6 A;  3MSZ A;  2BMX A;  4ZB9 A;  4ECB A;  3BJ5 A;  2HLS A;  4I6X A;  1LU4 A;  1F37 A;  1I5G A;  3L9U A;  2IIY A;  4MPF A;  2H1G A;  1K0O A;  1OKD A;  3F9U A;  4OO5 A;  4DSS A;  4QL9 A;  4YQM A;  1NHY A;  1O73 A;  2K18 A;  5A4W A;  2KP2 A;  5IQY A;  2X64 A;  5IMV A;  2PVQ A;  4K2X A;  4NMU A;  2A2R A;  3HDC A;  4J2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...