1GTBA

Crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
b'MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structures of a schistosomal drug and vaccine target: glutathione S-transferase from Schistosoma japonica and its complex with the leading antischistosomal drug praziquantel.
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Glutathione transferase
total genus 65
structure length 218
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1994-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gtbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gtbA01
1ZGNA 4ML1A 1QQ2A 3F4SA 3TOTA 2GSTA 3DEXA 2HZEA 3MSZA 3F6DA 3CBUA 2RM5A 4ECIA 1GTBA 6GSTA 2I1UA 4N30A 5IPHA 4G10A 3KZQA 5B8AA 3GKKA 2PUKC 1X9SB 3P7XA 1WPIA 3KGKA 1GP1A 1SD8A 2O7KA 3GKNA 4GRFA 2GVPA 2XPDA 2VLUA 3TDGA 1EGRA 4MCUA 2H74A 2VAFA 16GSA 4LL1B 5JCWA 2H66A 4MZBA 3LXTA 3VWWA 5ECNB 3WGDA 4ID0A 4WEYA 3VPTA 1PMTA 5CYYA 3Q74A 1AW9A 2IN3A 3HY2A 3GRXA 6GSVA 2YOIA 1TI3A 4BVYB 5AIXA 4CDOA 2CAIA 2OE1A 4X1UA 2NTOA 2IPAA 9GSSA 4IP6A 2EIRA 1HD2A 1TW9A 2VCQA 4HZ2A 3NOFA 4GLTA 1EP8A 2JACA 1ZOFA 4NV2A 4OFMA 1M99A 2GSQA 2P0GA 2K9FA 3BCKA 4WR4A 3TKPA 3HDCA 2LS5A 1O73A 3CYNA 2O89A 2FY6A 5ECRB 2K8VA 1EEJA 2IFQA 1WWJA 1NW2A 1SKSB 5F8BA 1EOHA 3MNGA 4MA9A 2FWFA 4HU9A 2VD1A 5G5FA 5IQYA 2C8UA 1DUGA 4XCSA 2P31A 1TJDA 2NDOA 4P3YB 1QK8A 4ECJA 3GIXA 4XS6A 1THOA 4GWRA 3APSA 3TJGA 1TTZA 4K6XA 3D22A 3TJKA 1A24A 4KW6A 4N0ZA 1Z6NA 4FO5A 1W4VA 1TRSA 4FYCA 2IIYA 4YQMA 4JZQA 4IJIA 1PGTA 2C1YA 2WCIA 2HRKB 1X9MB 2DJ2A 3HXSA 3OR5A 1K0BA 2RLIA 1M2AA 4OD7A 5C00A 4JU5A 2CX4A 1IYHA 3KTLA 5H5RA 1X9WB 2X8CA 3RHBA 3LQ7A 3IC4A 4G9HA 1GSFA 3GSSA 4MPGA 1ZZYA 1FHEA 1PA3A 1WIKA 3A2VA 2H1GA 2F51A 4IELA 1C72A 4ML6A 3PGTA 1UC7A 5IOXA 5J9BA 3H79A 2AB6A 4DSSA 5EL8A 2YZHA 1QUWA 5G5EA 1OC9B 2GS3A 7GSSA 5AGYA 5B7CA 2VCVA 5KN2A 4KSOA 4Q5NA 2TRCP 3F63A 4KDYA 1HNAA 3LSZA 4PQ1A 1TDIA 3I6AA 4BVXA 1R7HA 1T4ZA 1GSSA 1SKRB 3O76A 4OO4A 2FGXA 1EWXA 5ELAA 2EC4A 2OBIA 5J4UA 2K6VA 3HHVA 5HFKA 1V58A 1UVZA 2V2GA 1S3AA 3Q19A 4EKZA 2R4VA 2WS2A 3ERGA 2I81A 4K0NA 4NPBA 4YQVA 5F05A 2YNXA 1K3LA 1T4YA 5HQPA 3LXZA 2H8LA 5CP1A 1R5AA 1LJRA 1K3OA 1O6JA 1HYUA 3RDWA 2YV7A 3GYKA 3M9KA 1M2BA 4XRDA 4MDCA 2KP2A 5ABRA 2CVBA 1A2LA 3SBCA 1JLWA 4G0IA 4QL9A 5JWOB 4O92A 5J5NA 1AQVA 3G7IA 1VRSD 2JU5A 2WRTA 3RHCA 3GH9A 3ERFA 4KF9A 4IJ3A 5IMDA 3TKSA 3M1GA 4MJEA 3ZFBA 1F9MA 3IV4A 1K0OA 4HI7A 3FKFA 2B5EA 2FA4A 5DQSA 4NMUA 4L5LA 3LWAA 3BD2A 3FEUA 1ZCPA 4MK3A 5B8BA 5AN1A 2E7PA 1BJXA 1BQ7A 5DALB 3CTFA 4J57E 4PUAA 2YWNA 5KN3A 1S3DA 5IMFA 5CREA 2L59A 2WULA 2E0QA 4K8MA 2FWGA 2V6KA 1RQMA 5ENUA 4LLRA 3IK7A 1YJ6A 4MF5A 4EDZA 3KM6A 3TCOA 2OJLA 2HSMB 2WGRA 5CRHA 3U5RE 3D6IA 1Z3EA 3ZFLA 4AGSA 3CRUA 2V32A 3EMPA 1GNEA 3PPUA 1MDIA 2H01A 5L71A 1V9WA 2JADA 2LSTA 3EURA 5KN1A 3L78A 3A2WA 4I5QA 5E4WA 3EINA 1A2MA 4I2UA 2XPEA 2H30A 3IBHA 3KIJA 4O7HA 2FHEA 4IKHA 1E2YA 2PU9C 2EIQA 2KLXA 2ZCTA 1PX6A 1YZXA 1WP0A 3RAZA 5G1LA 3C1RA 2CA8A 1K0MA 1B9XC 1EV4A 4MJBA 1TXXA 5CAXA 1YKAA 2B3SA 4OMVA 1GSYA 3CXGA 4ECCA 5GSTA 5HR3A 4PUFC 2EIOA 3WGXA 4GTUA 4G19A 4BVYA 3TKRA 3EU3A 3FZAA 2ON5A 1GUKA 1TRWA 2VD0A 2AV4A 3F4TA 2ON7A 2AHEA 5IO2A 5F07A 2OKAA 2L6CA 5HFGA 4L5OA 1B48A 1DE1A 4NHWA 4ACSA 4I97A 2DBCA 2H0HA 4ZBBA 4HU7A 4GXZA 1SJ6A 4TR1B 4XHMA 3MDKA 1TOFA 13GSA 2PWJA 10GSA 1O8WA 4IP1A 4PQHA 1JFUA 3GN3A 1XOBA 1T7PB 2GQMA 1XCCA 1DSBA 3E9JB 3HZ4A 1O7UA 1OC3A 2YWOA 1PKZA 1I5GA 4K7NA 1W89A 1PD21 2B6MA 4HS1A 3BBYA 2IWTA 3P90A 1Z9HA 1TU7A 2H1BA 1V2AA 3EE2A 4EF0A 2B7KA 1TK8B 1AAZA 3FZ5A 1QFNA 6GSXA 1BYEA 3APOA 1USBA 3AY8A 2AJQB 1SL2B 4JBBA 2QKEA 2NBSA 4EUYA 2H1AA 3EVIA 5CO3A 4KUNA 2CT6A 3H4KA 3UVTA 1K0DA 5J3RA 4TXOB 5ECPB 2GTUA 2C0DA 1R5PA 3EC3A 3F3QA 3FRCA 2LNSA 4POBA 1VGLA 3V1WA 3VURA 3L9SA 2VL2C 4WETA 2R2JA 3BJ5A 2HRKA 4TXVA 2N5BA 2XHFA 3ZRDA 3ZLPA 1ERWA 2KHPA 3HVSA 1J0FA 4O32A 4N10A 4HEA2 2UZ8A 2A2RA 4FQUA 5D9WA 3FR6A 1U87A 1A0FA 1O8XA 3QPMA 3QFBC 1FB6A 5HR0A 1S3CA 4TW5A 4KA0A 2X99A 2LRTA 4USSA 1J08A 4AF2A 4TN8A 5B6NA 3HA9A 1Q4JA 4N0VA 3D21A 1ZYEA 1GUMA 1FW1A 3BOAA 5A4VA 3QCPA 3ZYWA 1OC9A 2CZ3A 4AJ8A 2ALBA 2LJRA 3GKXA 3KEBA 2IJYA 2YWMA 2IMFA 3DXBA 2NVLA 1TKDB 14GSA 5BMUA 2FCHA 4KDXA 1Y6EA 2LUSA 4Q5QA 4CHSA 2C3QA 5AISA 4KH7A 2DJJA 1MDJA 3ERWA 2M72A 3HZ8A 4NV5A 4POMA 12GSA 1G7EA 1GSDA 2LQOA 3KCMA 3CSHA 4DSQA 3FZ4A 2BMXA 2TRXA 4GSNA 3JCML 1V40A 2C3NA 3D4TA 4OCFA 2REMA 1ZL9A 1WJKA 4RQRA 1PL1A 4F2IA 5FT3A 2MMOA 4GSTA 2F9SA 3GL5A 2VM1A 2JSYA 2VO4A 19GSA 2IL3A 1XBSA 3IAS2 4KGIA 3TKQA 4TR3A 3UOMA 2DIZA 4WF5A 1KBNA 4PXOA 2DMMA 5DJLA 4LMVA 5IO0A 4XIHA 1ML6A 3TRQA 1N2AA 2DMLA 1XWGA 4LMWA 1R26A 1Z5YE 2GT6A 3HKRA 3O3TA 2IMEA 4L8EA 3HVXA 2HI7A 3ISOA 5DALA 3M9JA 4KX4A 1TU8A 4AJ6A 3ZL5A 2C0GA 1V57A 2C0FA 4DVCA 2J23A 3IHQA 4MJAA 5C04A 1X5CA 4F82A 4BWQA 2HZFA 1ACVA 2M80A 5IMVA 2VL9A 4HJMA 1AC1A 4ZILA 2PERA 3QAVA 2HSMA 5A4UA 2LJKA 4MJCA 1F6MC 3M0FA 1F2EA 1OC8A 1TK5B 5HFIA 2HSHA 3ZZXA 2YV9A 1XZOA 1XFLA 3KXOA 4I8BA 1WMJA 3GV1A 2AYTA 3FR9A 4I6XA 3HJMA 2OBKA 5ECKB 4BPYA 2O8VB 5JCUA 2H71A 4FH8A 1MD4A 4PURA 3KP8A 4HJ2A 1CQHA 1GUHA 4IS0A 1PN9A 2I3YA 1GL8A 2GLRA 2VLTA 3MWHA 3VFIA 4HZ4A 5H5QA 5IMCA 1DE2A 5D9VA 3ZITA 2LTKA 1VF1A 3RPNA 1ZMAA 1K0AA 17GSA 1GSQA 3DVXA 5J41A 3CSJA 5D9TA 4V1Ag 1DBYA 4PQIA 1Z7RA 3UMAA 3EU4A 2CX3A 2P5QA 2V6OA 4TKYA 5INYA 3N5OA 3CRTA 2L4CA 2O87A 2TIRA 3KH9A 1E6BA 2IMDA 4YQUA 5LNKe 3U6VA 1BG5A 2DJKA 3W6GA 1GLQA 2IMIA 5GZZB 4EXJA 2XBIA 4Q5RA 3SWLA 3TJBA 1ZYQB 4MH3A 5DCHA 4TR1A 3IXRA 3LYKA 2B5XA 2XBQA 4FIWA 1SJIA 4EE0A 2DJ0A 4HQSA 1OKTA 4HDEA 4K1FA 3GX8A 4TOPA 1URMA 3FY7A 3C73A 2ES7A 3W8JA 1GWCA 2H76A 2WFCA 1RW1A 2HQTA 3DVWA 4G0KA 1GSUA 3F8UA 4DEJA 3FHKA 2H6YA 2Z9SA 1OYJA 4BA7A 3GNJA 1B4QA 3QDNA 2H6XA 5HR2A 2VCTA 2GZZA 5EPFA 1F3BA 2YN1A 5GSSA 3Q6OA 1VF2A 3A5WA 3GTUB 4D73B 4F9ZA 3LEFA 1LBKA 1X0RA 2O85A 5ECMB 3P8WA 1Y25A 4TXOA 5ID2B 1G7OA 2KUCA 4ZL7A 1AQXA 2X64A 3C1SA 3F9UA 1Z6MA 4PX1A 3J7Yk 5G31A 3G9BA 3ZREA 1EGOA 5DDLA 2MMAA 4NWYA 4EL1A 4K0GA 2R37A 2MMNA 3CTGA 1TI1A 2CAQA 3M3MA 3W8SA 3HD5A 3ZMLA 3KJYA 1BX9A 3WGEA 1FB0A 4MP4A 1XW9A 3F6FA 3R3EA 3QAWA 4WKWA 2FUG2 5D9XA 4KE3A 2LRCA 4V2MA 3EWLA 4G2EA 4QQ7A 1TRUA 2D2ZA 3IAM2 4JE1A 3NZNA 1BAYA 4KDUA 1SYXA 5LD0A 1M7TA 5J9CA 5B6MA 3US3A 2MZCA 5FWGA 1XWKA 2YZUA 1TK0B 2FD3A 3IR4A 3G7YA 5ECLB 5KN0A 4ZB6A 4KAEA 2HNLA 3TKSE 2DSAA 2L6DA 2LNTA 3KH7A 1XWBA 3TJFA 3L4NA 4ZBDA 2G0FA 1V98A 2B1LA 2FWEA 2HYXA 2MYGA 1CQGA 1FO5A 1JZWA 2LRNA 3APQA 5A4WA 3FR3A 1SD9A 2GSRA 4WXTA 2YPMA 2F8FA 4IBPA 1GH2A 4HOJA 2AAWA 3HJOA 1XVWA 3D4MA 5COHA 4GQCA 1A8LA 4I2TA 1H4OA 2DJ1A 4Q5FA 1SENA 4XRAA 1GULA 4IHUA 2N5AA 1GTIA 1YKCA 4PNGA 3LGCA 4ZB8A 4X43A 4NHZA 4ZIJA 5G30A 3LJRA 4MH2A 4LL4B 2LEGA 2MBSA 1G6YA 5DVBA 3O6TA 3NIVA 2C4JA 4RUVA 3VWVA 5ECQB 2OA7A 4K2DA 4PGTA 5H5SA 2RUFA 5DBQA 2VL3A 2B5YA 1YF1A 2H72A 1IYIA 1X5DA 3CSIA 2P5RA 2A4VA 3F3RA 4OO5A 5CRGA 1YY7A 3GL3A 4RI6A 4ULXA 2FLSA 4MLYA 1XIYA 1K0NA 20GSA 1K0CA 3G7JA 1KNGA 4K7OA 5FHIA 2PVOC 2HRFA 2OADA 2L4QA 4KSMA 1T8EB 3F4RA 3L9UA 1NHOA 2VCZA 2R5GA 5D93A 2PVQA 2KP1A 2LJAA 5KEJA 3D0ZA 2IMKA 1G6WA 2CV4A 3DD3A 1SK0A 2C80A 2HRNA 3IDVA 6GSYA 1FG4A 1U88A 1N8JA 1SYRA 3TKSC 3VLNA 2M46A 5EY6A 4LA1A 1AIUA 4RQXA 2VCXA 2I4AA 3KD0A 2PN8A 1QXHA 2GSSA 2H75A 2E2GA 1GTUA 1GLPA 3DMLA 3PINA 5JWQB 4MPFA 2B7JA 5HR1A 2QGVA 4ZB9A 3DRNA 4O5RA 1G0TA 1FVKA 4MF6A 3P2AA 3GSTA 2H19A 4K9ZA 1EZKA 4E8EA 3QOUA 5ELGA 1MDKA 3E0UA 5DAKB 3QAGA 2CZ2A 3TB2A 4MZWA 2ZNMA 3WD6A 4BL7B 1TP9A 1M9BA 3H93A 4ILFA 2OE3A 2VOCA 2H70A 1OE8A 22GSA 3H8QA 3FZ9A 3VK9A 3IC8A 4HUAA 1ILOA 5DCGA 5A5KA 4V1Ap 3DGQA 2JL4A 3C8EA 4GSSA 4L0UA 2YJHA 2HT9A 3UVHA 3L0HA 3ED3A 1T3BA 2G2QA 3FYGA 3QR6A 3TRXA 5GAND 3R2QA 3IRAA 5ECSA 3HJPA 5LCZA 3E3EA 1ERUA 1XW6A 2PBJA 4WR5A 2VIMA 3QD9A 3RBTA 1RK4A 4YH2A 2DC5A 3UARA 3VWXA 1U3IA 4TVEA 3K8NA 5EVOA 4XS4B 5D73A 6GSUA 4TRXA 5CRWA 2FA8A 5AIVA 3DWVA 1F3AA 3TOUA 1A2JA 5IM9A 3Q18A 2H73A 3GMFA 3QFAC 4RI7A 4JEDA 4EDYA 3GTUA 2LV3A 2WB9A 4XS1A 3IE3A 4KB3A 4QL7A 3WT2A 4D73A 2BTOT 2DJ3A 4OWYA 5JWRB 2VM2A 4PNFA 5ID2A 4IGJA 4IQAA 1TRVA 3RPPA 4POLA 3GHAA 1T1VA 4K7IA 1YEXA 5IMZA 2GZYA 1QMVA 1OAZA 4WBJA 3HVVA 1A0RP 1PQNA 3I9V2 1J9BA 2H0GA 2HZEB 1XOAA 3L9VA 3FK8A 4E8HA 1X5EA 4J2FA 3ZTLA 4V2NA 1R4WA 3EMXA 5F0GA 2GQKA 1O85A 4WBRD 5F06A 3LYPA 4BWSA 1THXA 3I43A 2K18A 1ERTA 2HXKA 4L0WA 2HFDA 4XTSA 3ME8A 1ABAA 2GDRA 6GSWA 1UN2A 4H86A 4TR0A 1AXDA 5GAPD 1EP7A 2N5FA 4ISDA 3GKMA 3WT1A 1QGVA 3GFKA 2FNOA 1MEKA 1HNCA 1WE0A 2WJUA 3ZMKA 3VI7A 3IOSA 3BCIA 4MZCA 1MD3A 4AJ7A 2FWHA 3IPZA 3H1NA 3KP9A 3GX0A 2B1KA 1GSEA 1B4PA 1WOUA 4YAPA 1U6TA 3ZVJD 1NM3A 1XXUA 4F0BA 2DIYA 4G0LA 1EEMA 2K8SA 1YQ1A 2GGTA 1XWAA 3GH6A 3KTBA 1YF0A 2C0EA 3LORA 4TR4A 1A23A 2BJXA 4GQFA 3M8NA 4GF0A 2QC7A 1Q98A 2VL2A 4DSRA 4ECBA 2IFQB 3N9JA 2L5LA 3ME7A 4FYBA 1GTAA 2YCDA 1SK1A 3PH9A 2YP6A 4ZL8A 5D96A 1LU4A 2HRAA 1M9AA 4F03A 4F0CA 1JHBA 1B9YC 1ON4A 1PL2A 3TRPA 3VWUA 3UJ1A 3F0IA 2YWIA 11GSA 3ZIJA 4ZBAA 1JZRA 4MF7A 2LKUA 3CMIA 3FW2A 2L5OA 2E2MA 1I9DA 1A8YA 1OVNA 5E59A 1NSWA 5DQYA 1YDKA 3A2XA 2RM6A 2L57A 4OFNA 1JZDA 1OE7A 2C3TA 2R3XA 1MTCA 5IPGA 1PKWA 3ZIVA 1KTEA 1FVJA 2JZSA 2MBTA 2V1MA 3D5JA 1PRXA 4V2LA 4EO3A 2I9HA 3MAKA 4CW9A 2J9HA 4FYUA 4NXIA 18GSA 1VF4A 3J7Yb 2HSYA 8GSSA 4HQZA 1HQOA 1SJZA 4JRRA 4EC0A 1YEPA 1NHYA 3DKSA 2A2SA 3DIEA 2VCWA 3IA1A 3DYRA 1WRYA 1XVQA 2OE0A 1ST9A 4KCEA 5CRDA 3WYWA 3TJJA 5ECOB 1F37A 1PSQA 4IN0A 1GRXA 4YAVA 4GCIA 1ERVA 2GZPA 1XPVA 2YANA 5D8IA 2NPBA 2H6ZA 1SL1B 4IQ1A 4DSSB 1GNWA 4NAXA 2AUVA 1HNBA 1Z7PA 4PTSA 5JCGA 2VUPA 5DAKA 4MMMA 3TGZA 1AQWA 3LG6A 4IVFA 4BL7A 1EOGA 5IIZA 4BVXB 1UA5A 2CQ9A 2F8AA 2ZUPA 5ECHB 5CNWA 4OCEA 3C71A 1PX7A 2GQLA 5G2ZA 2PGTA 4J56E 2JZTA 2F3MA 1XWCA 2H0IA 1SL0B 3KMNA 3UEMA 2GT5A 2OACA 2XC2A 2CVDA 4KCAA 4ZL9A 2HLSA 3GURA 2V41A 4X0XA 3VPQA 2RUEA 1EV9A 4N11A 2X8GA 2LQQA 3IK9A 2DLXA 3PR8A 2KOKA 1T00A 1XW5A 6GSSA 3HYPA 1SKWB 1SU9A 4JR4A 4KNDA 2QSIA 5G1KA 4JR6A 1SK2A 3HCZA 1JLVA 4WF4A 5DJMA 1B8XA 1H75A 3C7MA 1KEBA 2PMTA 2R6KA 2WDUA 2X8HA 3S9FA 3TUEA 4XS4A 3UAPA 4EVMA 3VI5A 4MABA 2MMZA 2PPTA 2WZ9A 4Z7XA 1VF3A 2JSZA 1BEDA 2H1DA 5IMAA 2RIIA 1K3YA 3QMXA 3A3TA 1M2DA 3ZVJA 1FAAA 3UL3A 3UBKA 5IOWA 1OKDA 1O81A 3GA4A 1AUCA 3LFLA 3KMOA 4POKA 2CVKA 4IW9A 2YJ7A 1FOVA 2HSNB 1U3AA 1JZOA 2VLVA 1M0UA 2HE3A 3UIWA 3GUSA 5ECIB 3UBLA 4OFTA 2JZRA 3I69A 3EYTA 4ZXGA
chains in the Genus database with same CATH superfamily
1ZGNA 4ML1A 1QQ2A 3F4SA 3TOTA 2GSTA 3DEXA 2HZEA 3MSZA 3F6DA 3CBUA 2RM5A 4ECIA 1GTBA 6GSTA 2I1UA 4N30A 5IPHA 4G10A 3KZQA 1ZYNA 5B8AA 3GKKA 2PUKC 1X9SB 3P7XA 4HSCX 1WPIA 3KGKA 4AKHA 1GP1A 1SD8A 2O7KA 3GKNA 4GRFA 2GVPA 2XPDA 2VLUA 3TDGA 1EGRA 4MCUA 2H74A 5J4YA 2VAFA 16GSA 4LL1B 5JCWA 2H66A 4MZBA 3LXTA 3VWWA 5ECNB 3WGDA 4ID0A 4WEYA 3VPTA 1PMTA 5CYYA 3Q74A 1AW9A 2IN3A 3HY2A 3LW9A 3GRXA 6GSVA 2YOIA 1TI3A 4BVYB 5AIXA 4CDOA 2CAIA 2OE1A 4X1UA 2NTOA 2IPAA 4A5PA 9GSSA 4IP6A 2EIRA 1HD2A 1TW9A 2VCQA 4ICYA 4HZ2A 3NOFA 4GLTA 1EP8A 1S3RA 2JACA 1ZOFA 4NV2A 4OFMA 1M99A 2GSQA 2P0GA 2K9FA 3BCKA 4WR4A 3TKPA 3HDCA 2LS5A 5BRTA 1O73A 3CYNA 2O89A 2FY6A 5ECRB 2K8VA 1EEJA 2IFQA 1WWJA 1NW2A 1SKSB 5F8BA 1EOHA 3MNGA 4MA9A 2FWFA 4HU9A 2VD1A 5G5FA 5IQYA 2H1LA 2C8UA 1DUGA 4XCSA 2P31A 1TJDA 2NDOA 4P3YB 1QK8A 4ECJA 3GIXA 4XS6A 1THOA 4GWRA 3APSA 3TJGA 1SVOA 1TTZA 4K6XA 3D22A 3TJKA 1A24A 4KW6A 4N0ZA 1Z6NA 4FO5A 1W4VA 1TRSA 4YKFA 4FYCA 2IIYA 4YQMA 4JZQA 4IJIA 1PGTA 2C1YA 2WCIA 2HRKB 1X9MB 2DJ2A 3HXSA 3OR5A 1K0BA 2RLIA 1M2AA 4OD7A 5C00A 4JU5A 2CX4A 1IYHA 3KTLA 5H5RA 1X9WB 2X8CA 3RHBA 3LQ7A 3IC4A 4G9HA 4AKIA 5A5HA 1GSFA 3GSSA 4MPGA 1ZZYA 1FHEA 1PA3A 1WIKA 4AKXB 3A2VA 2H1GA 2F51A 4IELA 1C72A 4ML6A 3PGTA 1UC7A 5IOXA 5J9BA 3H79A 2AB6A 4DSSA 5EL8A 2YZHA 1QUWA 5G5EA 1OC9B 2GS3A 7GSSA 5AGYA 5B7CA 2VCVA 5KN2A 4KSOA 4Q5NA 2TRCP 5BMUB 3F63A 4KDYA 1HNAA 3LSZA 4PQ1A 1TDIA 3I6AA 1PFOA 4BVXA 1R7HA 1T4ZA 1GSSA 1SKRB 3O76A 4K5SA 4OO4A 2FGXA 1EWXA 5ELAA 2EC4A 2OBIA 5J4UA 2K6VA 3HHVA 5HFKA 1V58A 1UVZA 2V2GA 1S3AA 3Q19A 4EKZA 2R4VA 1TXUA 2WS2A 3ERGA 2I81A 4K0NA 4NPBA 4YQVA 1N25A 5F05A 2YNXA 1K3LA 1T4YA 5HQPA 3LXZA 2H8LA 5CP1A 1R5AA 1LJRA 1K3OA 1O6JA 1HYUA 3RDWA 2YV7A 3GYKA 3M9KA 1M2BA 4XRDA 4MDCA 2KP2A 5ABRA 2CVBA 1A2LA 4PI2C 3SBCA 1JLWA 4G0IA 4QL9A 5JWOB 4O92A 5J5NA 1AQVA 3G7IA 1VRSD 2JU5A 2WRTA 3RHCA 3GH9A 3ERFA 4KF9A 4IJ3A 5IMDA 3TKSA 3M1GA 4MJEA 3ZFBA 1F9MA 3IV4A 1K0OA 2VKZG 4HI7A 3FKFA 2B5EA 2FA4A 5DQSA 4NMUA 4L5LA 3LWAA 3BD2A 3FEUA 1ZCPA 2WVXA 4MK3A 5KOWA 5B8BA 5AN1A 2E7PA 1BJXA 1BQ7A 5DALB 3CTFA 4J57E 4PUAA 2YWNA 1ZYPA 5KN3A 1S3DA 5IMFA 5CREA 1PN0A 2L59A 4CY8A 2WULA 2HSNA 3FMWA 2E0QA 4K8MA 2FWGA 2V6KA 1RQMA 5ENUA 4LLRA 3IK7A 1YJ6A 4MF5A 4EDZA 3KM6A 3TCOA 2OJLA 2HSMB 2WGRA 5CRHA 3U5RE 3D6IA 1M3JA 1Z3EA 3ZFLA 4AGSA 2O36A 3CRUA 2V32A 3EMPA 1GNEA 3PPUA 1MDIA 2H01A 5L71A 1V9WA 2JADA 2LSTA 3EURA 5KN1A 3L78A 3A2WA 4I5QA 5E4WA 3EINA 1A2MA 4I2UA 2XPEA 2H30A 3IBHA 3KIJA 4O7HA 2FHEA 4IKHA 1E2YA 2PU9C 2EIQA 2KLXA 2ZCTA 1PX6A 1M3IA 1YZXA 1WP0A 3RAZA 5G1LA 3C1RA 3EPTA 2CA8A 1I1IP 1K0MA 1B9XC 1EV4A 4MJBA 1TXXA 5CAXA 1YKAA 2B3SA 4OMVA 1GSYA 3CXGA 4ECCA 5GSTA 5HR3A 4PUFC 2OT3A 2EIOA 3WGXA 4GTUA 4G19A 4BVYA 3TKRA 3EU3A 3FZAA 2ON5A 1GUKA 1TRWA 2VD0A 2AV4A 3F4TA 2ON7A 2AHEA 5IO2A 5F07A 2OKAA 2L6CA 5HFGA 4L5OA 1B48A 1DE1A 4NHWA 4ACSA 4I97A 2DBCA 2H0HA 4ZBBA 4HU7A 4GXZA 1SJ6A 4TR1B 4XHMA 3MDKA 1TOFA 13GSA 2PWJA 10GSA 1O8WA 4IP1A 4PQHA 1JFUA 3GN3A 1XOBA 1T7PB 2GQMA 1YEWC 1XCCA 1DSBA 3E9JB 3HZ4A 1O7UA 1OC3A 2YWOA 1PKZA 1I5GA 1W89A 4K7NA 1PD21 2B6MA 4HS1A 3BBYA 2IWTA 3P90A 1Z9HA 1TU7A 2H1BA 1V2AA 3EE2A 4EF0A 2B7KA 1TK8B 1AAZA 3FZ5A 1QFNA 6GSXA 1BYEA 3APOA 1USBA 3AY8A 2AJQB 1SL2B 4JBBA 2QKEA 2NBSA 4EUYA 2H1AA 3EVIA 5CO3A 4KUNA 2CT6A 3H4KA 3UVTA 1K0DA 5J3RA 4TXOB 5ECPB 2GTUA 2C0DA 1R5PA 3EC3A 4O5QA 3F3QA 3FRCA 2LNSA 4POBA 1VGLA 3V1WA 3VURA 3L9SA 2VL2C 4WETA 2R2JA 3BJ5A 2HRKA 4MNNA 4TXVA 2N5BA 2X4AA 2XHFA 3ZRDA 3ZLPA 1ERWA 2KHPA 3HVSA 1J0FA 4O32A 4N10A 4HEA2 2UZ8A 2A2RA 4FQUA 5D9WA 2WZSA 4Z2TA 3FR6A 1U87A 1A0FA 1O8XA 3QPMA 3QFBC 1FB6A 5HR0A 1S3CA 4TW5A 4KA0A 2X99A 2LRTA 4USSA 1J08A 4AF2A 4TN8A 5B6NA 3HA9A 1Q4JA 4N0VA 3D21A 1ZYEA 1GUMA 1FW1A 3BOAA 5A4VA 3QCPA 3ZYWA 4Z2RA 1OC9A 2CZ3A 4AJ8A 2ALBA 2LJRA 3GKXA 3KEBA 2IJYA 2YWMA 2IMFA 3DXBA 2NVLA 1TKDB 14GSA 5BMUA 2FCHA 4KDXA 1Y6EA 2LUSA 4Q5QA 2O5VA 4CHSA 2C3QA 5AISA 4KH7A 2DJJA 4G01A 1MDJA 3ERWA 2M72A 3HZ8A 4NV5A 4POMA 12GSA 1G7EA 1GSDA 2LQOA 3KCMA 3CSHA 4DSQA 3FZ4A 2BMXA 2TRXA 4AI6A 4GSNA 3JCML 4EIQA 1V40A 2C3NA 3D4TA 4OCFA 2REMA 1ZL9A 1FOHA 1WJKA 4RQRA 1PL1A 4F2IA 5FT3A 2MMOA 4GSTA 2F9SA 3GL5A 2VM1A 2JSYA 2VO4A 19GSA 2IL3A 1XBSA 3IAS2 1SVLA 4KGIA 3TKQA 4TR3A 3UOMA 2DIZA 4WF5A 1KBNA 4PXOA 2DMMA 5DJLA 4LMVA 5IO0A 5J4VA 4XIHA 1ML6A 3TRQA 1N2AA 2DMLA 3A5IA 1XWGA 4LMWA 2WVYA 1R26A 1Z5YE 2GT6A 3HKRA 3O3TA 2IMEA 4L8EA 3HVXA 2HI7A 2EFCA 3ISOA 5DALA 3M9JA 4KX4A 1TU8A 4AJ6A 3ZL5A 4PHZC 2C0GA 1V57A 2C0FA 4DVCA 2J23A 3IHQA 4MJAA 5C04A 1X5CA 4F82A 3HMJG 4BWQA 2HZFA 1ACVA 2M80A 5IMVA 2VL9A 4HJMA 1AC1A 4ZILA 2PERA 3QAVA 2HSMA 5A4UA 2LJKA 4MJCA 1F6MC 1XG8A 3M0FA 1F2EA 1OC8A 1TK5B 5HFIA 2HSHA 3ZZXA 2YV9A 1XZOA 1XFLA 3KXOA 4I8BA 1WMJA 3GV1A 2AYTA 3FR9A 4I6XA 3HJMA 2OBKA 5ECKB 4BPYA 2O8VB 5JCUA 2H71A 4FH8A 1MD4A 4PURA 3KP8A 4HJ2A 1CQHA 1GUHA 4IS0A 1PN9A 2I3YA 1GL8A 2GLRA 2VLTA 3MWHA 3VFIA 4HZ4A 5H5QA 5IMCA 1DE2A 5A34B 5D9VA 3ZITA 2LTKA 1VF1A 3RPNA 1ZMAA 1K0AA 17GSA 1GSQA 3DVXA 5J41A 3CSJA 5D9TA 4V1Ag 1DBYA 4PQIA 1Z7RA 3UMAA 3EU4A 2CX3A 2P5QA 2V6OA 4TKYA 5INYA 3N5OA 3CRTA 2L4CA 4K2XA 2O87A 2TIRA 3KH9A 1E6BA 2IMDA 4YQUA 5LNKe 4YKGA 3U6VA 1BG5A 5J40A 2DJKA 3W6GA 1GLQA 2IMIA 5GZZB 4EXJA 2XBIA 4Q5RA 3SWLA 3TJBA 1ZYQB 4MH3A 5DCHA 4TR1A 3IXRA 3LYKA 2B5XA 2XBQA 4FIWA 1SJIA 4FXYP 4EE0A 2DJ0A 4HQSA 1OKTA 4HDEA 4K1FA 3GX8A 4TOPA 1URMA 3FY7A 3C73A 2ES7A 4Z2UA 3W8JA 1GWCA 2H76A 2WFCA 1RW1A 2HQTA 3DVWA 4G0KA 1GSUA 5J47A 3F8UA 4DEJA 3FHKA 4PI0C 2H6YA 2Z9SA 1OYJA 4BA7A 3GNJA 1B4QA 3QDNA 2H6XA 2X49A 5HR2A 2VCTA 2GZZA 5EPFA 1SVMA 1F3BA 2YN1A 5GSSA 3Q6OA 1VF2A 3A5WA 3GTUB 4D73B 4F9ZA 3LEFA 1LBKA 1X0RA 2O85A 5ECMB 3P8WA 1Y25A 4TXOA 5ID2B 1G7OA 2KUCA 4ZL7A 1AQXA 2X64A 3C1SA 3F9UA 1Z6MA 4PX1A 3J7Yk 5G31A 3G9BA 3ZREA 1EGOA 5DDLA 2MMAA 4NWYA 4EL1A 4K0GA 2R37A 2MMNA 3CTGA 1TI1A 2CAQA 3M3MA 3W8SA 3HD5A 3ZMLA 3KJYA 1BX9A 3WGEA 1FB0A 4MP4A 1XW9A 3F6FA 3R3EA 3QAWA 4WKWA 2FUG2 5A1NB 5D9XA 4KE3A 2WW3A 2LRCA 4GDFA 4EIPA 4V2MA 3EWLA 4G2EA 4QQ7A 1TRUA 2D2ZA 3IAM2 4JE1A 3NZNA 1BAYA 4KDUA 1SYXA 5LD0A 1M7TA 2EFDA 5J9CA 3IHGA 5B6MA 3US3A 2MZCA 5FWGA 1XWKA 2YZUA 1TK0B 2FD3A 3IR4A 3G7YA 5ECLB 2UV8G 5KN0A 4E68A 4ZB6A 4KAEA 4W66A 2HNLA 3TKSE 2DSAA 2L6DA 2LNTA 3KH7A 4O5UA 1XWBA 3TJFA 3L4NA 4ZBDA 2G0FA 1V98A 2B1LA 2FWEA 4CY6A 2HYXA 2MYGA 1CQGA 1FO5A 1JZWA 2LRNA 3APQA 5A4WA 3FR3A 1SD9A 2GSRA 4WXTA 2YPMA 2F8FA 4IBPA 1GH2A 4HOJA 2AAWA 3HJOA 1XVWA 3D4MA 5COHA 4GQCA 1A8LA 4I2TA 1H4OA 2DJ1A 4Q5FA 1SENA 4XRAA 1GULA 4IHUA 2N5AA 1GTIA 1YKCA 4PNGA 3LGCA 4ZB8A 4X43A 4NHZA 4ZIJA 5G30A 2WVZA 3LJRA 4MH2A 4LL4B 2LEGA 3CHXC 4ZB7A 2MBSA 1G6YA 5DVBA 2EFHA 3O6TA 4BIKA 3NIVA 2C4JA 4RUVA 3VWVA 5ECQB 2OA7A 4K2DA 4PGTA 2O3EA 5H5SA 2RUFA 5DBQA 2VL3A 2B5YA 1YF1A 2H72A 1IYIA 1X5DA 3CSIA 2P5RA 2A4VA 3F3RA 4OO5A 5CRGA 1YY7A 3GL3A 4RI6A 4ULXA 2FLSA 4MLYA 1XIYA 1K0NA 20GSA 1K0CA 3G7JA 1KNGA 4K7OA 5FHIA 2PVOC 2HRFA 2OADA 2L4QA 4KSMA 1T8EB 2WW2A 3F4RA 3L9UA 1NHOA 2VCZA 2R5GA 5D93A 2PVQA 2KP1A 2LJAA 5KEJA 3D0ZA 2IMKA 1G6WA 2CV4A 3DD3A 1SK0A 2C80A 2HRNA 3IDVA 2R0GA 6GSYA 1FG4A 2WW1A 1U88A 1N8JA 1SYRA 2DKIA 3TKSC 3VLNA 2M46A 5EY6A 4LA1A 1AIUA 4RQXA 2VCXA 2I4AA 3KD0A 2PN8A 1QXHA 2GSSA 2H75A 2E2GA 1GTUA 1GLPA 3DMLA 3PINA 5JWQB 4MPFA 2B7JA 5HR1A 2QGVA 4ZB9A 3DRNA 4O5RA 1G0TA 1FVKA 4MF6A 3P2AA 3GSTA 2H19A 4K9ZA 1EZKA 4E8EA 3QOUA 5ELGA 1MDKA 5A34A 3E0UA 5DAKB 3QAGA 2CZ2A 3TB2A 3RFRC 4MZWA 2ZNMA 3WD6A 4BL7B 1TP9A 1M9BA 3H93A 4ILFA 2A4HA 2OE3A 2VOCA 2H70A 3TU3B 1OE8A 22GSA 3H8QA 3CWGA 3FZ9A 3VK9A 3IC8A 4HUAA 1ILOA 5DCGA 5A5KA 4V1Ap 3DGQA 2JL4A 3C8EA 4GSSA 4L0UA 2YJHA 2HT9A 3UVHA 3L0HA 3ED3A 1T3BA 2QA2A 2G2QA 3FYGA 3QR6A 3TRXA 5GAND 3R2QA 3IRAA 5ECSA 3HJPA 5LCZA 3E3EA 1ERUA 1XW6A 2PBJA 4WR5A 2VIMA 3QD9A 3RBTA 1RK4A 4YH2A 1YVLA 2DC5A 3UARA 3VWXA 5KOXA 1U3IA 4TVEA 3K8NA 5EVOA 4XS4B 5D73A 6GSUA 4TRXA 5CRWA 2FA8A 5AIVA 3DWVA 1F3AA 3TOUA 1A2JA 2QA1A 5IM9A 3Q18A 2H73A 3GMFA 3QFAC 4RI7A 4JEDA 4EDYA 3GTUA 2LV3A 2WB9A 4XS1A 3IE3A 4KB3A 4QL7A 3WT2A 4D73A 2BTOT 2DJ3A 4OWYA 5JWRB 2VM2A 4PNFA 5ID2A 4IGJA 4IQAA 1TRVA 3RPPA 4POLA 3GHAA 4X4JA 3MIXA 1T1VA 4K7IA 1YEXA 5IMZA 2GZYA 1QMVA 4N3ZA 1OAZA 4WBJA 1S4BP 3HVVA 1A0RP 1PQNA 5A1NA 3I9V2 1J9BA 2H0GA 2HZEB 1XOAA 3L9VA 3FK8A 4E8HA 1X5EA 4J2FA 3ZTLA 4V2NA 1R4WA 3EMXA 5F0GA 2GQKA 1O85A 2EFEA 4WBRD 5F06A 3LYPA 4BWSA 1THXA 3I43A 2K18A 1ERTA 2HXKA 4L0WA 2HFDA 4XTSA 3ME8A 1ABAA 2GDRA 6GSWA 1BG1A 1UN2A 4H86A 2WW0A 4TR0A 1AXDA 5GAPD 1EP7A 2N5FA 4ISDA 3GKMA 3WT1A 1QGVA 3GFKA 2FNOA 1MEKA 1HNCA 1WE0A 2WJUA 3ZMKA 3VI7A 3IOSA 3BCIA 4MZCA 1MD3A 4AJ7A 2FWHA 3IPZA 3H1NA 3KP9A 3GX0A 2B1KA 1GSEA 1B4PA 1WOUA 4YAPA 1U6TA 3ZVJD 1NM3A 1XXUA 4F0BA 2DIYA 4G0LA 1EEMA 2K8SA 1YQ1A 2GGTA 1XWAA 3GH6A 3KTBA 1YF0A 2C0EA 3LORA 4TR4A 1A23A 2BJXA 4GQFA 3M8NA 4GF0A 2QC7A 1Q98A 2VL2A 4DSRA 4ECBA 2IFQB 3N9JA 2L5LA 4QMKA 3ME7A 4FYBA 1GTAA 2YCDA 1SK1A 2R0PA 3PH9A 2YP6A 4ZL8A 5D96A 1LU4A 2HRAA 1M9AA 4F03A 4F0CA 1JHBA 1B9YC 1ON4A 1PL2A 3TRPA 3VWUA 3UJ1A 3F0IA 2YWIA 11GSA 3ZIJA 4ZBAA 1JZRA 4MF7A 2LKUA 3CMIA 3FW2A 2L5OA 2E2MA 1I9DA 1A8YA 1OVNA 5E59A 1NSWA 5DQYA 1YDKA 3A2XA 2RM6A 2L57A 4OFNA 1JZDA 1OE7A 2C3TA 2R3XA 1MTCA 5IPGA 3RGBC 1PKWA 3ZIVA 1KTEA 1FVJA 2JZSA 2MBTA 2V1MA 3D5JA 1PRXA 4V2LA 4EO3A 2I9HA 3MAKA 4CW9A 2J9HA 4FYUA 4NXIA 18GSA 1VF4A 3J7Yb 2HSYA 8GSSA 4HQZA 1HQOA 1SJZA 4JRRA 4EC0A 1YEPA 1NHYA 3DKSA 2A2SA 3DIEA 2VCWA 3IA1A 3DYRA 1WRYA 1XVQA 2OE0A 1ST9A 4KCEA 5CRDA 3WYWA 3TJJA 5ECOB 1F37A 1PSQA 4IN0A 5A5HB 1GRXA 4YAVA 4GCIA 1ERVA 2GZPA 1XPVA 2YANA 5D8IA 2NPBA 2H6ZA 1SL1B 4IQ1A 4DSSB 1GNWA 4NAXA 2AUVA 1HNBA 1Z7PA 1Y1UA 4PTSA 3MYDA 5JCGA 2VUPA 5DAKA 2R0CA 2A2PA 4MMMA 3TGZA 1AQWA 3LG6A 4IVFA 4BL7A 1EOGA 5IIZA 4BVXB 1UA5A 2CQ9A 2F8AA 2ZUPA 5ECHB 5CNWA 4OCEA 3C71A 1PX7A 2GQLA 5G2ZA 2PGTA 4AKGA 4J56E 2JZTA 2F3MA 1XWCA 2H0IA 1SL0B 3CQFA 3KMNA 3UEMA 2GT5A 2OACA 2XC2A 2CVDA 4KCAA 4ZL9A 2HLSA 3GURA 1BF5A 2V41A 4X0XA 3VPQA 2RUEA 1EV9A 4N11A 2DKHA 2X8GA 2LQQA 3IK9A 2DLXA 3PR8A 2KOKA 1T00A 1XW5A 6GSSA 3HYPA 1SKWB 1SU9A 4JR4A 4KNDA 2QSIA 5G1KA 4JR6A 1SK2A 3HCZA 1JLVA 4WF4A 5DJMA 1B8XA 1H75A 3C7MA 1KEBA 2PMTA 2R6KA 2WDUA 2X8HA 3S9FA 3TUEA 4XS4A 3UAPA 4EVMA 3VI5A 4MABA 4K5RA 2MMZA 2PPTA 2WZ9A 4Z7XA 1VF3A 2JSZA 1BEDA 2H1DA 3HVNA 5IMAA 2RIIA 2WVXB 1K3YA 3QMXA 3A3TA 1M2DA 3ZVJA 1FAAA 3UL3A 3UBKA 5IOWA 1OKDA 1O81A 3GA4A 1AUCA 3LFLA 3KMOA 4POKA 2CVKA 4IW9A 2YJ7A 1FOVA 2HSNB 1U3AA 1JZOA 2VLVA 1M0UA 2HE3A 3UIWA 3GUSA 5ECIB 3UBLA 4OFTA 2JZRA 3I69A 3EYTA 4ZXGA
chains in the Genus database with same CATH topology
1ZGNA 4ML1A 1QQ2A 3F4SA 3TOTA 2GSTA 3DEXA 2HZEA 3MSZA 3F6DA 3CBUA 2RM5A 4ECIA 1GTBA 6GSTA 2I1UA 4N30A 5IPHA 4G10A 3KZQA 1ZYNA 5B8AA 3GKKA 2PUKC 1X9SB 3P7XA 1WPIA 3KGKA 4AKHA 1GP1A 1SD8A 2O7KA 3GKNA 4GRFA 2GVPA 2XPDA 2VLUA 3TDGA 1EGRA 4MCUA 2H74A 5J4YA 2VAFA 16GSA 4LL1B 5JCWA 2H66A 4MZBA 3LXTA 3VWWA 5ECNB 3WGDA 4ID0A 4WEYA 3VPTA 1PMTA 5CYYA 3Q74A 1AW9A 2IN3A 3HY2A 3LW9A 3GRXA 6GSVA 2YOIA 1TI3A 4BVYB 5AIXA 4CDOA 2CAIA 2OE1A 4X1UA 2NTOA 2IPAA 4A5PA 9GSSA 4IP6A 2EIRA 1HD2A 1TW9A 2VCQA 4ICYA 4HZ2A 3NOFA 4GLTA 1EP8A 2JACA 1ZOFA 4NV2A 4OFMA 1M99A 2GSQA 2P0GA 2K9FA 3BCKA 4WR4A 3TKPA 3HDCA 2LS5A 5BRTA 1O73A 3CYNA 2O89A 2FY6A 5ECRB 2K8VA 1EEJA 2IFQA 1WWJA 1NW2A 1SKSB 5F8BA 1EOHA 3MNGA 4MA9A 2FWFA 4HU9A 2VD1A 5G5FA 5IQYA 2H1LA 2C8UA 1DUGA 4XCSA 2P31A 1TJDA 2NDOA 4P3YB 1QK8A 4ECJA 3GIXA 4XS6A 1THOA 4GWRA 3APSA 3TJGA 1SVOA 1TTZA 4K6XA 3D22A 3TJKA 1A24A 4KW6A 4N0ZA 1Z6NA 4FO5A 1W4VA 1TRSA 4YKFA 4FYCA 2IIYA 4YQMA 4JZQA 4IJIA 1PGTA 2C1YA 2WCIA 2HRKB 1X9MB 2DJ2A 3HXSA 3OR5A 1K0BA 2RLIA 1M2AA 4OD7A 5C00A 4JU5A 2CX4A 1IYHA 3KTLA 5H5RA 1X9WB 2X8CA 3RHBA 3LQ7A 3IC4A 4G9HA 4AKIA 5A5HA 1GSFA 3GSSA 4MPGA 1ZZYA 1FHEA 1PA3A 1WIKA 4AKXB 3A2VA 2H1GA 2F51A 4IELA 1C72A 4ML6A 3PGTA 1UC7A 5IOXA 5J9BA 3H79A 2AB6A 4DSSA 5EL8A 2YZHA 1QUWA 5G5EA 1OC9B 2GS3A 7GSSA 5AGYA 5B7CA 2VCVA 5KN2A 4KSOA 4Q5NA 2TRCP 5BMUB 3F63A 4KDYA 1HNAA 3LSZA 4PQ1A 1TDIA 3I6AA 4BVXA 1R7HA 1T4ZA 1GSSA 1SKRB 3O76A 4K5SA 4OO4A 2FGXA 1EWXA 5ELAA 2EC4A 2OBIA 5J4UA 2K6VA 3HHVA 5HFKA 1V58A 1UVZA 2V2GA 1S3AA 3Q19A 4EKZA 2R4VA 1TXUA 2WS2A 3ERGA 2I81A 4K0NA 4NPBA 4YQVA 1N25A 5F05A 2YNXA 1K3LA 1T4YA 5HQPA 3LXZA 2H8LA 5CP1A 1R5AA 1LJRA 1K3OA 1O6JA 1HYUA 3RDWA 2YV7A 3GYKA 3M9KA 1M2BA 4XRDA 4MDCA 2KP2A 5ABRA 2CVBA 1A2LA 3SBCA 1JLWA 4G0IA 4QL9A 5JWOB 4O92A 5J5NA 1AQVA 3G7IA 1VRSD 2JU5A 2WRTA 3RHCA 3GH9A 3ERFA 4KF9A 4IJ3A 5IMDA 3TKSA 3M1GA 4MJEA 3ZFBA 1F9MA 3IV4A 1K0OA 2VKZG 4HI7A 3FKFA 2B5EA 2FA4A 5DQSA 4NMUA 4L5LA 3LWAA 3BD2A 3FEUA 1ZCPA 4MK3A 5KOWA 5B8BA 5AN1A 2E7PA 1BJXA 1BQ7A 5DALB 3CTFA 4J57E 4PUAA 2YWNA 1ZYPA 5KN3A 1S3DA 5IMFA 5CREA 1PN0A 2L59A 4CY8A 2WULA 2HSNA 3FMWA 2E0QA 4K8MA 2FWGA 2V6KA 1RQMA 5ENUA 4LLRA 3IK7A 1YJ6A 4MF5A 4EDZA 3KM6A 3TCOA 2OJLA 2HSMB 2WGRA 5CRHA 3U5RE 3D6IA 1Z3EA 3ZFLA 4AGSA 3CRUA 2V32A 3EMPA 1GNEA 3PPUA 1MDIA 2H01A 5L71A 1V9WA 2JADA 2LSTA 3EURA 5KN1A 3L78A 3A2WA 4I5QA 5E4WA 3EINA 1A2MA 4I2UA 2XPEA 2H30A 3IBHA 3KIJA 4O7HA 2FHEA 4IKHA 1E2YA 2PU9C 2EIQA 2KLXA 2ZCTA 1PX6A 1YZXA 1WP0A 3RAZA 5G1LA 3C1RA 3EPTA 2CA8A 1K0MA 1B9XC 1EV4A 4MJBA 1TXXA 5CAXA 1YKAA 2B3SA 4OMVA 1GSYA 3CXGA 4ECCA 5GSTA 5HR3A 4PUFC 2OT3A 2EIOA 3WGXA 4GTUA 4G19A 4BVYA 3TKRA 3EU3A 3FZAA 2ON5A 1GUKA 1TRWA 2VD0A 2AV4A 3F4TA 2ON7A 2AHEA 5IO2A 5F07A 2OKAA 2L6CA 5HFGA 4L5OA 1B48A 1DE1A 4NHWA 4ACSA 4I97A 2DBCA 2H0HA 4ZBBA 4HU7A 4GXZA 1SJ6A 4TR1B 4XHMA 3MDKA 1TOFA 13GSA 2PWJA 10GSA 1O8WA 4IP1A 4PQHA 1JFUA 3GN3A 1XOBA 1T7PB 2GQMA 1XCCA 1DSBA 3E9JB 3HZ4A 1O7UA 1OC3A 2YWOA 1PKZA 1I5GA 1W89A 4K7NA 1PD21 2B6MA 4HS1A 3BBYA 2IWTA 3P90A 1Z9HA 1TU7A 2H1BA 1V2AA 3EE2A 4EF0A 2B7KA 1TK8B 1AAZA 3FZ5A 1QFNA 6GSXA 1BYEA 3APOA 1USBA 3AY8A 2AJQB 1SL2B 4JBBA 2QKEA 2NBSA 4EUYA 2H1AA 3EVIA 5CO3A 4KUNA 2CT6A 3H4KA 3UVTA 1K0DA 5J3RA 4TXOB 5ECPB 2GTUA 2C0DA 1R5PA 3EC3A 4O5QA 3F3QA 3FRCA 2LNSA 4POBA 1VGLA 3V1WA 3VURA 3L9SA 2VL2C 4WETA 2R2JA 3BJ5A 2HRKA 4MNNA 4TXVA 2N5BA 2X4AA 2XHFA 3ZRDA 3ZLPA 1ERWA 2KHPA 3HVSA 1J0FA 4O32A 4N10A 4HEA2 2UZ8A 2A2RA 4FQUA 5D9WA 4Z2TA 3FR6A 1U87A 1A0FA 1O8XA 3QPMA 3QFBC 1FB6A 5HR0A 1S3CA 4TW5A 4KA0A 2X99A 2LRTA 4USSA 1J08A 4AF2A 4TN8A 5B6NA 3HA9A 1Q4JA 4N0VA 3D21A 1ZYEA 1GUMA 1FW1A 3BOAA 5A4VA 3QCPA 3ZYWA 4Z2RA 1OC9A 2CZ3A 4AJ8A 2ALBA 2LJRA 3GKXA 3KEBA 2IJYA 2YWMA 2IMFA 3DXBA 2NVLA 1TKDB 14GSA 5BMUA 2FCHA 4KDXA 1Y6EA 2LUSA 4Q5QA 2O5VA 4CHSA 2C3QA 5AISA 4KH7A 2DJJA 4G01A 1MDJA 3ERWA 2M72A 3HZ8A 4NV5A 4POMA 12GSA 1G7EA 1GSDA 2LQOA 3KCMA 3CSHA 4DSQA 3FZ4A 2BMXA 2TRXA 4AI6A 4GSNA 3JCML 4EIQA 1V40A 2C3NA 3D4TA 4OCFA 2REMA 1ZL9A 1FOHA 1WJKA 4RQRA 1PL1A 4F2IA 5FT3A 2MMOA 4GSTA 2F9SA 3GL5A 2VM1A 2JSYA 2VO4A 19GSA 2IL3A 1XBSA 3IAS2 1SVLA 4KGIA 3TKQA 4TR3A 3UOMA 2DIZA 4WF5A 1KBNA 4PXOA 2DMMA 5DJLA 4LMVA 5IO0A 5J4VA 4XIHA 1ML6A 3TRQA 1N2AA 2DMLA 3A5IA 1XWGA 4LMWA 1R26A 1Z5YE 2GT6A 3HKRA 3O3TA 2IMEA 4L8EA 3HVXA 2HI7A 2EFCA 3ISOA 5DALA 3M9JA 4KX4A 1TU8A 4AJ6A 3ZL5A 2C0GA 1V57A 2C0FA 4DVCA 2J23A 3IHQA 4MJAA 5C04A 1X5CA 4F82A 3HMJG 4BWQA 2HZFA 1ACVA 2M80A 5IMVA 2VL9A 4HJMA 1AC1A 4ZILA 2PERA 3QAVA 2HSMA 5A4UA 2LJKA 4MJCA 1F6MC 3M0FA 1F2EA 1OC8A 1TK5B 5HFIA 2HSHA 3ZZXA 2YV9A 1XZOA 1XFLA 3KXOA 4I8BA 1WMJA 3GV1A 2AYTA 3FR9A 4I6XA 3HJMA 2OBKA 5ECKB 4BPYA 2O8VB 5JCUA 2H71A 4FH8A 1MD4A 4PURA 3KP8A 4HJ2A 1CQHA 1GUHA 4IS0A 1PN9A 2I3YA 1GL8A 2GLRA 2VLTA 3MWHA 3VFIA 4HZ4A 5H5QA 5IMCA 1DE2A 5A34B 5D9VA 3ZITA 2LTKA 1VF1A 3RPNA 1ZMAA 1K0AA 17GSA 1GSQA 3DVXA 5J41A 3CSJA 5D9TA 4V1Ag 1DBYA 4PQIA 1Z7RA 3UMAA 3EU4A 2CX3A 2P5QA 2V6OA 4TKYA 5INYA 3N5OA 3CRTA 2L4CA 4K2XA 2O87A 2TIRA 3KH9A 1E6BA 2IMDA 4YQUA 5LNKe 4YKGA 3U6VA 1BG5A 5J40A 2DJKA 3W6GA 1GLQA 2IMIA 5GZZB 4EXJA 2XBIA 4Q5RA 3SWLA 3TJBA 1ZYQB 4MH3A 5DCHA 4TR1A 3IXRA 3LYKA 2B5XA 2XBQA 4FIWA 1SJIA 4EE0A 2DJ0A 4HQSA 1OKTA 4HDEA 4K1FA 3GX8A 4TOPA 1URMA 3FY7A 3C73A 2ES7A 4Z2UA 3W8JA 1GWCA 2H76A 2WFCA 1RW1A 2HQTA 3DVWA 4G0KA 1GSUA 5J47A 3F8UA 4DEJA 3FHKA 2H6YA 2Z9SA 1OYJA 4BA7A 3GNJA 1B4QA 3QDNA 2H6XA 2X49A 5HR2A 2VCTA 2GZZA 5EPFA 1SVMA 1F3BA 2YN1A 5GSSA 3Q6OA 1VF2A 3A5WA 3GTUB 4D73B 4F9ZA 3LEFA 1LBKA 1X0RA 2O85A 5ECMB 3P8WA 1Y25A 4TXOA 5ID2B 1G7OA 2KUCA 4ZL7A 1AQXA 2X64A 3C1SA 3F9UA 1Z6MA 4PX1A 3J7Yk 5G31A 3G9BA 3ZREA 1EGOA 5DDLA 2MMAA 4NWYA 4EL1A 4K0GA 2R37A 2MMNA 3CTGA 1TI1A 2CAQA 3M3MA 3W8SA 3HD5A 3ZMLA 3KJYA 1BX9A 3WGEA 1FB0A 4MP4A 1XW9A 3F6FA 3R3EA 3QAWA 4WKWA 2FUG2 5A1NB 5D9XA 4KE3A 2LRCA 4GDFA 4EIPA 4V2MA 3EWLA 4G2EA 4QQ7A 1TRUA 2D2ZA 3IAM2 4JE1A 3NZNA 1BAYA 4KDUA 1SYXA 5LD0A 1M7TA 2EFDA 5J9CA 3IHGA 5B6MA 3US3A 2MZCA 5FWGA 1XWKA 2YZUA 1TK0B 2FD3A 3IR4A 3G7YA 5ECLB 2UV8G 5KN0A 4E68A 4ZB6A 4KAEA 4W66A 2HNLA 3TKSE 2DSAA 2L6DA 2LNTA 3KH7A 4O5UA 1XWBA 3TJFA 3L4NA 4ZBDA 2G0FA 1V98A 2B1LA 2FWEA 4CY6A 2HYXA 2MYGA 1CQGA 1FO5A 1JZWA 2LRNA 3APQA 5A4WA 3FR3A 1SD9A 2GSRA 4WXTA 2YPMA 2F8FA 4IBPA 1GH2A 4HOJA 2AAWA 3HJOA 1XVWA 3D4MA 5COHA 4GQCA 1A8LA 4I2TA 1H4OA 2DJ1A 4Q5FA 1SENA 4XRAA 1GULA 4IHUA 2N5AA 1GTIA 1YKCA 4PNGA 3LGCA 4ZB8A 4X43A 4NHZA 4ZIJA 5G30A 3LJRA 4MH2A 4LL4B 2LEGA 4ZB7A 2MBSA 1G6YA 5DVBA 2EFHA 3O6TA 3NIVA 2C4JA 4RUVA 3VWVA 5ECQB 2OA7A 4K2DA 4PGTA 5H5SA 2RUFA 5DBQA 2VL3A 2B5YA 1YF1A 2H72A 1IYIA 1X5DA 3CSIA 2P5RA 2A4VA 3F3RA 4OO5A 5CRGA 1YY7A 3GL3A 4RI6A 4ULXA 2FLSA 4MLYA 1XIYA 1K0NA 20GSA 1K0CA 3G7JA 1KNGA 4K7OA 5FHIA 2PVOC 2HRFA 2OADA 2L4QA 4KSMA 1T8EB 3F4RA 3L9UA 1NHOA 2VCZA 2R5GA 5D93A 2PVQA 2KP1A 2LJAA 5KEJA 3D0ZA 2IMKA 1G6WA 2CV4A 3DD3A 1SK0A 2C80A 2HRNA 3IDVA 2R0GA 6GSYA 1FG4A 1U88A 1N8JA 1SYRA 2DKIA 3TKSC 3VLNA 2M46A 5EY6A 4LA1A 1AIUA 4RQXA 2VCXA 2I4AA 3KD0A 2PN8A 1QXHA 2GSSA 2H75A 2E2GA 1GTUA 1GLPA 3DMLA 3PINA 5JWQB 4MPFA 2B7JA 5HR1A 2QGVA 4ZB9A 3DRNA 4O5RA 1G0TA 1FVKA 4MF6A 3P2AA 3GSTA 2H19A 4K9ZA 1EZKA 4E8EA 3QOUA 5ELGA 1MDKA 5A34A 3E0UA 5DAKB 3QAGA 2CZ2A 3TB2A 4MZWA 2ZNMA 3WD6A 4BL7B 1TP9A 1M9BA 3H93A 4ILFA 2A4HA 2OE3A 2VOCA 2H70A 3TU3B 1OE8A 22GSA 3H8QA 3CWGA 3FZ9A 3VK9A 3IC8A 4HUAA 1ILOA 5DCGA 5A5KA 4V1Ap 3DGQA 2JL4A 3C8EA 4GSSA 4L0UA 2YJHA 2HT9A 3UVHA 3L0HA 3ED3A 1T3BA 2QA2A 2G2QA 3FYGA 3QR6A 3TRXA 5GAND 3R2QA 3IRAA 5ECSA 3HJPA 5LCZA 3E3EA 1ERUA 1XW6A 2PBJA 4WR5A 2VIMA 3QD9A 3RBTA 1RK4A 4YH2A 1YVLA 2DC5A 3UARA 3VWXA 5KOXA 1U3IA 4TVEA 3K8NA 5EVOA 4XS4B 5D73A 6GSUA 4TRXA 5CRWA 2FA8A 5AIVA 3DWVA 1F3AA 3TOUA 1A2JA 2QA1A 5IM9A 3Q18A 2H73A 3GMFA 3QFAC 4RI7A 4JEDA 4EDYA 3GTUA 2LV3A 2WB9A 4XS1A 3IE3A 4KB3A 4QL7A 3WT2A 4D73A 2BTOT 2DJ3A 4OWYA 5JWRB 2VM2A 4PNFA 5ID2A 4IGJA 4IQAA 1TRVA 3RPPA 4POLA 3GHAA 4X4JA 3MIXA 1T1VA 4K7IA 1YEXA 5IMZA 2GZYA 1QMVA 4N3ZA 1OAZA 4WBJA 3HVVA 1A0RP 1PQNA 5A1NA 3I9V2 1J9BA 2H0GA 2HZEB 1XOAA 3L9VA 3FK8A 4E8HA 1X5EA 4J2FA 3ZTLA 4V2NA 1R4WA 3EMXA 5F0GA 2GQKA 1O85A 2EFEA 4WBRD 5F06A 3LYPA 4BWSA 1THXA 3I43A 2K18A 1ERTA 2HXKA 4L0WA 2HFDA 4XTSA 3ME8A 1ABAA 2GDRA 6GSWA 1BG1A 1UN2A 4H86A 4TR0A 1AXDA 5GAPD 1EP7A 2N5FA 4ISDA 3GKMA 3WT1A 1QGVA 3GFKA 2FNOA 1MEKA 1HNCA 1WE0A 2WJUA 3ZMKA 3VI7A 3IOSA 3BCIA 4MZCA 1MD3A 4AJ7A 2FWHA 3IPZA 3H1NA 3KP9A 3GX0A 2B1KA 1GSEA 1B4PA 1WOUA 4YAPA 1U6TA 3ZVJD 1NM3A 1XXUA 4F0BA 2DIYA 4G0LA 1EEMA 2K8SA 1YQ1A 2GGTA 1XWAA 3GH6A 3KTBA 1YF0A 2C0EA 3LORA 4TR4A 1A23A 2BJXA 4GQFA 3M8NA 4GF0A 2QC7A 1Q98A 2VL2A 4DSRA 4ECBA 2IFQB 3N9JA 2L5LA 4QMKA 3ME7A 4FYBA 1GTAA 2YCDA 1SK1A 2R0PA 3PH9A 2YP6A 4ZL8A 5D96A 1LU4A 2HRAA 1M9AA 4F03A 4F0CA 1JHBA 1B9YC 1ON4A 1PL2A 3TRPA 3VWUA 3UJ1A 3F0IA 2YWIA 11GSA 3ZIJA 4ZBAA 1JZRA 4MF7A 2LKUA 3CMIA 3FW2A 2L5OA 2E2MA 1I9DA 1A8YA 1OVNA 5E59A 1NSWA 5DQYA 1YDKA 3A2XA 2RM6A 2L57A 4OFNA 1JZDA 1OE7A 2C3TA 2R3XA 1MTCA 5IPGA 1PKWA 3ZIVA 1KTEA 1FVJA 2JZSA 2MBTA 2V1MA 3D5JA 1PRXA 4V2LA 4EO3A 2I9HA 3MAKA 4CW9A 2J9HA 4FYUA 4NXIA 18GSA 1VF4A 3J7Yb 2HSYA 8GSSA 4HQZA 1HQOA 1SJZA 4JRRA 4EC0A 1YEPA 1NHYA 3DKSA 2A2SA 3DIEA 2VCWA 3IA1A 3DYRA 1WRYA 1XVQA 2OE0A 1ST9A 4KCEA 5CRDA 3WYWA 3TJJA 5ECOB 1F37A 1PSQA 4IN0A 5A5HB 1GRXA 4YAVA 4GCIA 1ERVA 2GZPA 1XPVA 2YANA 5D8IA 2NPBA 2H6ZA 1SL1B 4IQ1A 4DSSB 1GNWA 4NAXA 2AUVA 1HNBA 1Z7PA 1Y1UA 4PTSA 3MYDA 5JCGA 2VUPA 5DAKA 2R0CA 2A2PA 4MMMA 3TGZA 1AQWA 3LG6A 4IVFA 4BL7A 1EOGA 5IIZA 4BVXB 1UA5A 2CQ9A 2F8AA 2ZUPA 5ECHB 5CNWA 4OCEA 3C71A 1PX7A 2GQLA 5G2ZA 2PGTA 4AKGA 4J56E 2JZTA 2F3MA 1XWCA 2H0IA 1SL0B 3KMNA 3UEMA 2GT5A 2OACA 2XC2A 2CVDA 4KCAA 4ZL9A 2HLSA 3GURA 1BF5A 2V41A 4X0XA 3VPQA 2RUEA 1EV9A 4N11A 2DKHA 2X8GA 2LQQA 3IK9A 2DLXA 3PR8A 2KOKA 1T00A 1XW5A 6GSSA 3HYPA 1SKWB 1SU9A 4JR4A 4KNDA 2QSIA 5G1KA 4JR6A 1SK2A 3HCZA 1JLVA 4WF4A 5DJMA 1B8XA 1H75A 3C7MA 1KEBA 2PMTA 2R6KA 2WDUA 2X8HA 3S9FA 3TUEA 4XS4A 3UAPA 4EVMA 3VI5A 4MABA 4K5RA 2MMZA 2PPTA 2WZ9A 4Z7XA 1VF3A 2JSZA 1BEDA 2H1DA 5IMAA 2RIIA 1K3YA 3QMXA 3A3TA 1M2DA 3ZVJA 1FAAA 3UL3A 3UBKA 5IOWA 1OKDA 1O81A 3GA4A 1AUCA 3LFLA 3KMOA 4POKA 2CVKA 4IW9A 2YJ7A 1FOVA 2HSNB 1U3AA 1JZOA 2VLVA 1M0UA 2HE3A 3UIWA 3GUSA 5ECIB 3UBLA 4OFTA 2JZRA 3I69A 3EYTA 4ZXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGN A;  4ML1 A;  1QQ2 A;  3F4S A;  3TOT A;  2GST A;  3DEX A;  2HZE A;  3MSZ A;  3F6D A;  3CBU A;  2RM5 A;  4ECI A;  1GTB A;  6GST A;  2I1U A;  4N30 A;  5IPH A;  4G10 A;  3KZQ A;  5B8A A;  3GKK A;  2PUK C;  1X9S B;  3P7X A;  1WPI A;  3KGK A;  1GP1 A;  1SD8 A;  2O7K A;  3GKN A;  4GRF A;  2GVP A;  2XPD A;  2VLU A;  3TDG A;  1EGR A;  4MCU A;  2H74 A;  2VAF A;  16GS A;  4LL1 B;  5JCW A;  2H66 A;  4MZB A;  3LXT A;  3VWW A;  5ECN B;  3WGD A;  4ID0 A;  4WEY A;  3VPT A;  1PMT A;  5CYY A;  3Q74 A;  1AW9 A;  2IN3 A;  3HY2 A;  3GRX A;  6GSV A;  2YOI A;  1TI3 A;  4BVY B;  5AIX A;  4CDO A;  2CAI A;  2OE1 A;  4X1U A;  2NTO A;  2IPA A;  9GSS A;  4IP6 A;  2EIR A;  1HD2 A;  1TW9 A;  2VCQ A;  4HZ2 A;  3NOF A;  4GLT A;  1EP8 A;  2JAC A;  1ZOF A;  4NV2 A;  4OFM A;  1M99 A;  2GSQ A;  2P0G A;  2K9F A;  3BCK A;  4WR4 A;  3TKP A;  3HDC A;  2LS5 A;  1O73 A;  3CYN A;  2O89 A;  2FY6 A;  5ECR B;  2K8V A;  1EEJ A;  2IFQ A;  1WWJ A;  1NW2 A;  1SKS B;  5F8B A;  1EOH A;  3MNG A;  4MA9 A;  2FWF A;  4HU9 A;  2VD1 A;  5G5F A;  5IQY A;  2C8U A;  1DUG A;  4XCS A;  2P31 A;  1TJD A;  2NDO A;  4P3Y B;  1QK8 A;  4ECJ A;  3GIX A;  4XS6 A;  1THO A;  4GWR A;  3APS A;  3TJG A;  1TTZ A;  4K6X A;  3D22 A;  3TJK A;  1A24 A;  4KW6 A;  4N0Z A;  1Z6N A;  4FO5 A;  1W4V A;  1TRS A;  4FYC A;  2IIY A;  4YQM A;  4JZQ A;  4IJI A;  1PGT A;  2C1Y A;  2WCI A;  2HRK B;  1X9M B;  2DJ2 A;  3HXS A;  3OR5 A;  1K0B A;  2RLI A;  1M2A A;  4OD7 A;  5C00 A;  4JU5 A;  2CX4 A;  1IYH A;  3KTL A;  5H5R A;  1X9W B;  2X8C A;  3RHB A;  3LQ7 A;  3IC4 A;  4G9H A;  1GSF A;  3GSS A;  4MPG A;  1ZZY A;  1FHE A;  1PA3 A;  1WIK A;  3A2V A;  2H1G A;  2F51 A;  4IEL A;  1C72 A;  4ML6 A;  3PGT A;  1UC7 A;  5IOX A;  5J9B A;  3H79 A;  2AB6 A;  4DSS A;  5EL8 A;  2YZH A;  1QUW A;  5G5E A;  1OC9 B;  2GS3 A;  7GSS A;  5AGY A;  5B7C A;  2VCV A;  5KN2 A;  4KSO A;  4Q5N A;  2TRC P;  3F63 A;  4KDY A;  1HNA A;  3LSZ A;  4PQ1 A;  1TDI A;  3I6A A;  4BVX A;  1R7H A;  1T4Z A;  1GSS A;  1SKR B;  3O76 A;  4OO4 A;  2FGX A;  1EWX A;  5ELA A;  2EC4 A;  2OBI A;  5J4U A;  2K6V A;  3HHV A;  5HFK A;  1V58 A;  1UVZ A;  2V2G A;  1S3A A;  3Q19 A;  4EKZ A;  2R4V A;  2WS2 A;  3ERG A;  2I81 A;  4K0N A;  4NPB A;  4YQV A;  5F05 A;  2YNX A;  1K3L A;  1T4Y A;  5HQP A;  3LXZ A;  2H8L A;  5CP1 A;  1R5A A;  1LJR A;  1K3O A;  1O6J A;  1HYU A;  3RDW A;  2YV7 A;  3GYK A;  3M9K A;  1M2B A;  4XRD A;  4MDC A;  2KP2 A;  5ABR A;  2CVB A;  1A2L A;  3SBC A;  1JLW A;  4G0I A;  4QL9 A;  5JWO B;  4O92 A;  5J5N A;  1AQV A;  3G7I A;  1VRS D;  2JU5 A;  2WRT A;  3RHC A;  3GH9 A;  3ERF A;  4KF9 A;  4IJ3 A;  5IMD A;  3TKS A;  3M1G A;  4MJE A;  3ZFB A;  1F9M A;  3IV4 A;  1K0O A;  4HI7 A;  3FKF A;  2B5E A;  2FA4 A;  5DQS A;  4NMU A;  4L5L A;  3LWA A;  3BD2 A;  3FEU A;  1ZCP A;  4MK3 A;  5B8B A;  5AN1 A;  2E7P A;  1BJX A;  1BQ7 A;  5DAL B;  3CTF A;  4J57 E;  4PUA A;  2YWN A;  5KN3 A;  1S3D A;  5IMF A;  5CRE A;  2L59 A;  2WUL A;  2E0Q A;  4K8M A;  2FWG A;  2V6K A;  1RQM A;  5ENU A;  4LLR A;  3IK7 A;  1YJ6 A;  4MF5 A;  4EDZ A;  3KM6 A;  3TCO A;  2OJL A;  2HSM B;  2WGR A;  5CRH A;  3U5R E;  3D6I A;  1Z3E A;  3ZFL A;  4AGS A;  3CRU A;  2V32 A;  3EMP A;  1GNE A;  3PPU A;  1MDI A;  2H01 A;  5L71 A;  1V9W A;  2JAD A;  2LST A;  3EUR A;  5KN1 A;  3L78 A;  3A2W A;  4I5Q A;  5E4W A;  3EIN A;  1A2M A;  4I2U A;  2XPE A;  2H30 A;  3IBH A;  3KIJ A;  4O7H A;  2FHE A;  4IKH A;  1E2Y A;  2PU9 C;  2EIQ A;  2KLX A;  2ZCT A;  1PX6 A;  1YZX A;  1WP0 A;  3RAZ A;  5G1L A;  3C1R A;  2CA8 A;  1K0M A;  1B9X C;  1EV4 A;  4MJB A;  1TXX A;  5CAX A;  1YKA A;  2B3S A;  4OMV A;  1GSY A;  3CXG A;  4ECC A;  5GST A;  5HR3 A;  4PUF C;  2EIO A;  3WGX A;  4GTU A;  4G19 A;  4BVY A;  3TKR A;  3EU3 A;  3FZA A;  2ON5 A;  1GUK A;  1TRW A;  2VD0 A;  2AV4 A;  3F4T A;  2ON7 A;  2AHE A;  5IO2 A;  5F07 A;  2OKA A;  2L6C A;  5HFG A;  4L5O A;  1B48 A;  1DE1 A;  4NHW A;  4ACS A;  4I97 A;  2DBC A;  2H0H A;  4ZBB A;  4HU7 A;  4GXZ A;  1SJ6 A;  4TR1 B;  4XHM A;  3MDK A;  1TOF A;  13GS A;  2PWJ A;  10GS A;  1O8W A;  4IP1 A;  4PQH A;  1JFU A;  3GN3 A;  1XOB A;  1T7P B;  2GQM A;  1XCC A;  1DSB A;  3E9J B;  3HZ4 A;  1O7U A;  1OC3 A;  2YWO A;  1PKZ A;  1I5G A;  4K7N A;  1W89 A;  1PD2 1;  2B6M A;  4HS1 A;  3BBY A;  2IWT A;  3P90 A;  1Z9H A;  1TU7 A;  2H1B A;  1V2A A;  3EE2 A;  4EF0 A;  2B7K A;  1TK8 B;  1AAZ A;  3FZ5 A;  1QFN A;  6GSX A;  1BYE A;  3APO A;  1USB A;  3AY8 A;  2AJQ B;  1SL2 B;  4JBB A;  2QKE A;  2NBS A;  4EUY A;  2H1A A;  3EVI A;  5CO3 A;  4KUN A;  2CT6 A;  3H4K A;  3UVT A;  1K0D A;  5J3R A;  4TXO B;  5ECP B;  2GTU A;  2C0D A;  1R5P A;  3EC3 A;  3F3Q A;  3FRC A;  2LNS A;  4POB A;  1VGL A;  3V1W A;  3VUR A;  3L9S A;  2VL2 C;  4WET A;  2R2J A;  3BJ5 A;  2HRK A;  4TXV A;  2N5B A;  2XHF A;  3ZRD A;  3ZLP A;  1ERW A;  2KHP A;  3HVS A;  1J0F A;  4O32 A;  4N10 A;  4HEA 2;  2UZ8 A;  2A2R A;  4FQU A;  5D9W A;  3FR6 A;  1U87 A;  1A0F A;  1O8X A;  3QPM A;  3QFB C;  1FB6 A;  5HR0 A;  1S3C A;  4TW5 A;  4KA0 A;  2X99 A;  2LRT A;  4USS A;  1J08 A;  4AF2 A;  4TN8 A;  5B6N A;  3HA9 A;  1Q4J A;  4N0V A;  3D21 A;  1ZYE A;  1GUM A;  1FW1 A;  3BOA A;  5A4V A;  3QCP A;  3ZYW A;  1OC9 A;  2CZ3 A;  4AJ8 A;  2ALB A;  2LJR A;  3GKX A;  3KEB A;  2IJY A;  2YWM A;  2IMF A;  3DXB A;  2NVL A;  1TKD B;  14GS A;  5BMU A;  2FCH A;  4KDX A;  1Y6E A;  2LUS A;  4Q5Q A;  4CHS A;  2C3Q A;  5AIS A;  4KH7 A;  2DJJ A;  1MDJ A;  3ERW A;  2M72 A;  3HZ8 A;  4NV5 A;  4POM A;  12GS A;  1G7E A;  1GSD A;  2LQO A;  3KCM A;  3CSH A;  4DSQ A;  3FZ4 A;  2BMX A;  2TRX A;  4GSN A;  3JCM L;  1V40 A;  2C3N A;  3D4T A;  4OCF A;  2REM A;  1ZL9 A;  1WJK A;  4RQR A;  1PL1 A;  4F2I A;  5FT3 A;  2MMO A;  4GST A;  2F9S A;  3GL5 A;  2VM1 A;  2JSY A;  2VO4 A;  19GS A;  2IL3 A;  1XBS A;  3IAS 2;  4KGI A;  3TKQ A;  4TR3 A;  3UOM A;  2DIZ A;  4WF5 A;  1KBN A;  4PXO A;  2DMM A;  5DJL A;  4LMV A;  5IO0 A;  4XIH A;  1ML6 A;  3TRQ A;  1N2A A;  2DML A;  1XWG A;  4LMW A;  1R26 A;  1Z5Y E;  2GT6 A;  3HKR A;  3O3T A;  2IME A;  4L8E A;  3HVX A;  2HI7 A;  3ISO A;  5DAL A;  3M9J A;  4KX4 A;  1TU8 A;  4AJ6 A;  3ZL5 A;  2C0G A;  1V57 A;  2C0F A;  4DVC A;  2J23 A;  3IHQ A;  4MJA A;  5C04 A;  1X5C A;  4F82 A;  4BWQ A;  2HZF A;  1ACV A;  2M80 A;  5IMV A;  2VL9 A;  4HJM A;  1AC1 A;  4ZIL A;  2PER A;  3QAV A;  2HSM A;  5A4U A;  2LJK A;  4MJC A;  1F6M C;  3M0F A;  1F2E A;  1OC8 A;  1TK5 B;  5HFI A;  2HSH A;  3ZZX A;  2YV9 A;  1XZO A;  1XFL A;  3KXO A;  4I8B A;  1WMJ A;  3GV1 A;  2AYT A;  3FR9 A;  4I6X A;  3HJM A;  2OBK A;  5ECK B;  4BPY A;  2O8V B;  5JCU A;  2H71 A;  4FH8 A;  1MD4 A;  4PUR A;  3KP8 A;  4HJ2 A;  1CQH A;  1GUH A;  4IS0 A;  1PN9 A;  2I3Y A;  1GL8 A;  2GLR A;  2VLT A;  3MWH A;  3VFI A;  4HZ4 A;  5H5Q A;  5IMC A;  1DE2 A;  5D9V A;  3ZIT A;  2LTK A;  1VF1 A;  3RPN A;  1ZMA A;  1K0A A;  17GS A;  1GSQ A;  3DVX A;  5J41 A;  3CSJ A;  5D9T A;  4V1A g;  1DBY A;  4PQI A;  1Z7R A;  3UMA A;  3EU4 A;  2CX3 A;  2P5Q A;  2V6O A;  4TKY A;  5INY A;  3N5O A;  3CRT A;  2L4C A;  2O87 A;  2TIR A;  3KH9 A;  1E6B A;  2IMD A;  4YQU A;  5LNK e;  3U6V A;  1BG5 A;  2DJK A;  3W6G A;  1GLQ A;  2IMI A;  5GZZ B;  4EXJ A;  2XBI A;  4Q5R A;  3SWL A;  3TJB A;  1ZYQ B;  4MH3 A;  5DCH A;  4TR1 A;  3IXR A;  3LYK A;  2B5X A;  2XBQ A;  4FIW A;  1SJI A;  4EE0 A;  2DJ0 A;  4HQS A;  1OKT A;  4HDE A;  4K1F A;  3GX8 A;  4TOP A;  1URM A;  3FY7 A;  3C73 A;  2ES7 A;  3W8J A;  1GWC A;  2H76 A;  2WFC A;  1RW1 A;  2HQT A;  3DVW A;  4G0K A;  1GSU A;  3F8U A;  4DEJ A;  3FHK A;  2H6Y A;  2Z9S A;  1OYJ A;  4BA7 A;  3GNJ A;  1B4Q A;  3QDN A;  2H6X A;  5HR2 A;  2VCT A;  2GZZ A;  5EPF A;  1F3B A;  2YN1 A;  5GSS A;  3Q6O A;  1VF2 A;  3A5W A;  3GTU B;  4D73 B;  4F9Z A;  3LEF A;  1LBK A;  1X0R A;  2O85 A;  5ECM B;  3P8W A;  1Y25 A;  4TXO A;  5ID2 B;  1G7O A;  2KUC A;  4ZL7 A;  1AQX A;  2X64 A;  3C1S A;  3F9U A;  1Z6M A;  4PX1 A;  3J7Y k;  5G31 A;  3G9B A;  3ZRE A;  1EGO A;  5DDL A;  2MMA A;  4NWY A;  4EL1 A;  4K0G A;  2R37 A;  2MMN A;  3CTG A;  1TI1 A;  2CAQ A;  3M3M A;  3W8S A;  3HD5 A;  3ZML A;  3KJY A;  1BX9 A;  3WGE A;  1FB0 A;  4MP4 A;  1XW9 A;  3F6F A;  3R3E A;  3QAW A;  4WKW A;  2FUG 2;  5D9X A;  4KE3 A;  2LRC A;  4V2M A;  3EWL A;  4G2E A;  4QQ7 A;  1TRU A;  2D2Z A;  3IAM 2;  4JE1 A;  3NZN A;  1BAY A;  4KDU A;  1SYX A;  5LD0 A;  1M7T A;  5J9C A;  5B6M A;  3US3 A;  2MZC A;  5FWG A;  1XWK A;  2YZU A;  1TK0 B;  2FD3 A;  3IR4 A;  3G7Y A;  5ECL B;  5KN0 A;  4ZB6 A;  4KAE A;  2HNL A;  3TKS E;  2DSA A;  2L6D A;  2LNT A;  3KH7 A;  1XWB A;  3TJF A;  3L4N A;  4ZBD A;  2G0F A;  1V98 A;  2B1L A;  2FWE A;  2HYX A;  2MYG A;  1CQG A;  1FO5 A;  1JZW A;  2LRN A;  3APQ A;  5A4W A;  3FR3 A;  1SD9 A;  2GSR A;  4WXT A;  2YPM A;  2F8F A;  4IBP A;  1GH2 A;  4HOJ A;  2AAW A;  3HJO A;  1XVW A;  3D4M A;  5COH A;  4GQC A;  1A8L A;  4I2T A;  1H4O A;  2DJ1 A;  4Q5F A;  1SEN A;  4XRA A;  1GUL A;  4IHU A;  2N5A A;  1GTI A;  1YKC A;  4PNG A;  3LGC A;  4ZB8 A;  4X43 A;  4NHZ A;  4ZIJ A;  5G30 A;  3LJR A;  4MH2 A;  4LL4 B;  2LEG A;  2MBS A;  1G6Y A;  5DVB A;  3O6T A;  3NIV A;  2C4J A;  4RUV A;  3VWV A;  5ECQ B;  2OA7 A;  4K2D A;  4PGT A;  5H5S A;  2RUF A;  5DBQ A;  2VL3 A;  2B5Y A;  1YF1 A;  2H72 A;  1IYI A;  1X5D A;  3CSI A;  2P5R A;  2A4V A;  3F3R A;  4OO5 A;  5CRG A;  1YY7 A;  3GL3 A;  4RI6 A;  4ULX A;  2FLS A;  4MLY A;  1XIY A;  1K0N A;  20GS A;  1K0C A;  3G7J A;  1KNG A;  4K7O A;  5FHI A;  2PVO C;  2HRF A;  2OAD A;  2L4Q A;  4KSM A;  1T8E B;  3F4R A;  3L9U A;  1NHO A;  2VCZ A;  2R5G A;  5D93 A;  2PVQ A;  2KP1 A;  2LJA A;  5KEJ A;  3D0Z A;  2IMK A;  1G6W A;  2CV4 A;  3DD3 A;  1SK0 A;  2C80 A;  2HRN A;  3IDV A;  6GSY A;  1FG4 A;  1U88 A;  1N8J A;  1SYR A;  3TKS C;  3VLN A;  2M46 A;  5EY6 A;  4LA1 A;  1AIU A;  4RQX A;  2VCX A;  2I4A A;  3KD0 A;  2PN8 A;  1QXH A;  2GSS A;  2H75 A;  2E2G A;  1GTU A;  1GLP A;  3DML A;  3PIN A;  5JWQ B;  4MPF A;  2B7J A;  5HR1 A;  2QGV A;  4ZB9 A;  3DRN A;  4O5R A;  1G0T A;  1FVK A;  4MF6 A;  3P2A A;  3GST A;  2H19 A;  4K9Z A;  1EZK A;  4E8E A;  3QOU A;  5ELG A;  1MDK A;  3E0U A;  5DAK B;  3QAG A;  2CZ2 A;  3TB2 A;  4MZW A;  2ZNM A;  3WD6 A;  4BL7 B;  1TP9 A;  1M9B A;  3H93 A;  4ILF A;  2OE3 A;  2VOC A;  2H70 A;  1OE8 A;  22GS A;  3H8Q A;  3FZ9 A;  3VK9 A;  3IC8 A;  4HUA A;  1ILO A;  5DCG A;  5A5K A;  4V1A p;  3DGQ A;  2JL4 A;  3C8E A;  4GSS A;  4L0U A;  2YJH A;  2HT9 A;  3UVH A;  3L0H A;  3ED3 A;  1T3B A;  2G2Q A;  3FYG A;  3QR6 A;  3TRX A;  5GAN D;  3R2Q A;  3IRA A;  5ECS A;  3HJP A;  5LCZ A;  3E3E A;  1ERU A;  1XW6 A;  2PBJ A;  4WR5 A;  2VIM A;  3QD9 A;  3RBT A;  1RK4 A;  4YH2 A;  2DC5 A;  3UAR A;  3VWX A;  1U3I A;  4TVE A;  3K8N A;  5EVO A;  4XS4 B;  5D73 A;  6GSU A;  4TRX A;  5CRW A;  2FA8 A;  5AIV A;  3DWV A;  1F3A A;  3TOU A;  1A2J A;  5IM9 A;  3Q18 A;  2H73 A;  3GMF A;  3QFA C;  4RI7 A;  4JED A;  4EDY A;  3GTU A;  2LV3 A;  2WB9 A;  4XS1 A;  3IE3 A;  4KB3 A;  4QL7 A;  3WT2 A;  4D73 A;  2BTO T;  2DJ3 A;  4OWY A;  5JWR B;  2VM2 A;  4PNF A;  5ID2 A;  4IGJ A;  4IQA A;  1TRV A;  3RPP A;  4POL A;  3GHA A;  1T1V A;  4K7I A;  1YEX A;  5IMZ A;  2GZY A;  1QMV A;  1OAZ A;  4WBJ A;  3HVV A;  1A0R P;  1PQN A;  3I9V 2;  1J9B A;  2H0G A;  2HZE B;  1XOA A;  3L9V A;  3FK8 A;  4E8H A;  1X5E A;  4J2F A;  3ZTL A;  4V2N A;  1R4W A;  3EMX A;  5F0G A;  2GQK A;  1O85 A;  4WBR D;  5F06 A;  3LYP A;  4BWS A;  1THX A;  3I43 A;  2K18 A;  1ERT A;  2HXK A;  4L0W A;  2HFD A;  4XTS A;  3ME8 A;  1ABA A;  2GDR A;  6GSW A;  1UN2 A;  4H86 A;  4TR0 A;  1AXD A;  5GAP D;  1EP7 A;  2N5F A;  4ISD A;  3GKM A;  3WT1 A;  1QGV A;  3GFK A;  2FNO A;  1MEK A;  1HNC A;  1WE0 A;  2WJU A;  3ZMK A;  3VI7 A;  3IOS A;  3BCI A;  4MZC A;  1MD3 A;  4AJ7 A;  2FWH A;  3IPZ A;  3H1N A;  3KP9 A;  3GX0 A;  2B1K A;  1GSE A;  1B4P A;  1WOU A;  4YAP A;  1U6T A;  3ZVJ D;  1NM3 A;  1XXU A;  4F0B A;  2DIY A;  4G0L A;  1EEM A;  2K8S A;  1YQ1 A;  2GGT A;  1XWA A;  3GH6 A;  3KTB A;  1YF0 A;  2C0E A;  3LOR A;  4TR4 A;  1A23 A;  2BJX A;  4GQF A;  3M8N A;  4GF0 A;  2QC7 A;  1Q98 A;  2VL2 A;  4DSR A;  4ECB A;  2IFQ B;  3N9J A;  2L5L A;  3ME7 A;  4FYB A;  1GTA A;  2YCD A;  1SK1 A;  3PH9 A;  2YP6 A;  4ZL8 A;  5D96 A;  1LU4 A;  2HRA A;  1M9A A;  4F03 A;  4F0C A;  1JHB A;  1B9Y C;  1ON4 A;  1PL2 A;  3TRP A;  3VWU A;  3UJ1 A;  3F0I A;  2YWI A;  11GS A;  3ZIJ A;  4ZBA A;  1JZR A;  4MF7 A;  2LKU A;  3CMI A;  3FW2 A;  2L5O A;  2E2M A;  1I9D A;  1A8Y A;  1OVN A;  5E59 A;  1NSW A;  5DQY A;  1YDK A;  3A2X A;  2RM6 A;  2L57 A;  4OFN A;  1JZD A;  1OE7 A;  2C3T A;  2R3X A;  1MTC A;  5IPG A;  1PKW A;  3ZIV A;  1KTE A;  1FVJ A;  2JZS A;  2MBT A;  2V1M A;  3D5J A;  1PRX A;  4V2L A;  4EO3 A;  2I9H A;  3MAK A;  4CW9 A;  2J9H A;  4FYU A;  4NXI A;  18GS A;  1VF4 A;  3J7Y b;  2HSY A;  8GSS A;  4HQZ A;  1HQO A;  1SJZ A;  4JRR A;  4EC0 A;  1YEP A;  1NHY A;  3DKS A;  2A2S A;  3DIE A;  2VCW A;  3IA1 A;  3DYR A;  1WRY A;  1XVQ A;  2OE0 A;  1ST9 A;  4KCE A;  5CRD A;  3WYW A;  3TJJ A;  5ECO B;  1F37 A;  1PSQ A;  4IN0 A;  1GRX A;  4YAV A;  4GCI A;  1ERV A;  2GZP A;  1XPV A;  2YAN A;  5D8I A;  2NPB A;  2H6Z A;  1SL1 B;  4IQ1 A;  4DSS B;  1GNW A;  4NAX A;  2AUV A;  1HNB A;  1Z7P A;  4PTS A;  5JCG A;  2VUP A;  5DAK A;  4MMM A;  3TGZ A;  1AQW A;  3LG6 A;  4IVF A;  4BL7 A;  1EOG A;  5IIZ A;  4BVX B;  1UA5 A;  2CQ9 A;  2F8A A;  2ZUP A;  5ECH B;  5CNW A;  4OCE A;  3C71 A;  1PX7 A;  2GQL A;  5G2Z A;  2PGT A;  4J56 E;  2JZT A;  2F3M A;  1XWC A;  2H0I A;  1SL0 B;  3KMN A;  3UEM A;  2GT5 A;  2OAC A;  2XC2 A;  2CVD A;  4KCA A;  4ZL9 A;  2HLS A;  3GUR A;  2V41 A;  4X0X A;  3VPQ A;  2RUE A;  1EV9 A;  4N11 A;  2X8G A;  2LQQ A;  3IK9 A;  2DLX A;  3PR8 A;  2KOK A;  1T00 A;  1XW5 A;  6GSS A;  3HYP A;  1SKW B;  1SU9 A;  4JR4 A;  4KND A;  2QSI A;  5G1K A;  4JR6 A;  1SK2 A;  3HCZ A;  1JLV A;  4WF4 A;  5DJM A;  1B8X A;  1H75 A;  3C7M A;  1KEB A;  2PMT A;  2R6K A;  2WDU A;  2X8H A;  3S9F A;  3TUE A;  4XS4 A;  3UAP A;  4EVM A;  3VI5 A;  4MAB A;  2MMZ A;  2PPT A;  2WZ9 A;  4Z7X A;  1VF3 A;  2JSZ A;  1BED A;  2H1D A;  5IMA A;  2RII A;  1K3Y A;  3QMX A;  3A3T A;  1M2D A;  3ZVJ A;  1FAA A;  3UL3 A;  3UBK A;  5IOW A;  1OKD A;  1O81 A;  3GA4 A;  1AUC A;  3LFL A;  3KMO A;  4POK A;  2CVK A;  4IW9 A;  2YJ7 A;  1FOV A;  2HSN B;  1U3A A;  1JZO A;  2VLV A;  1M0U A;  2HE3 A;  3UIW A;  3GUS A;  5ECI B;  3UBL A;  4OFT A;  2JZR A;  3I69 A;  3EYT A;  4ZXG A; 
#chains in the Genus database with same CATH topology
 1ZGN A;  4ML1 A;  1QQ2 A;  3F4S A;  3TOT A;  2GST A;  3DEX A;  2HZE A;  3MSZ A;  3F6D A;  3CBU A;  2RM5 A;  4ECI A;  1GTB A;  6GST A;  2I1U A;  4N30 A;  5IPH A;  4G10 A;  3KZQ A;  1ZYN A;  5B8A A;  3GKK A;  2PUK C;  1X9S B;  3P7X A;  4HSC X;  1WPI A;  3KGK A;  4AKH A;  1GP1 A;  1SD8 A;  2O7K A;  3GKN A;  4GRF A;  2GVP A;  2XPD A;  2VLU A;  3TDG A;  1EGR A;  4MCU A;  2H74 A;  5J4Y A;  2VAF A;  16GS A;  4LL1 B;  5JCW A;  2H66 A;  4MZB A;  3LXT A;  3VWW A;  5ECN B;  3WGD A;  4ID0 A;  4WEY A;  3VPT A;  1PMT A;  5CYY A;  3Q74 A;  1AW9 A;  2IN3 A;  3HY2 A;  3LW9 A;  3GRX A;  6GSV A;  2YOI A;  1TI3 A;  4BVY B;  5AIX A;  4CDO A;  2CAI A;  2OE1 A;  4X1U A;  2NTO A;  2IPA A;  4A5P A;  9GSS A;  4IP6 A;  2EIR A;  1HD2 A;  1TW9 A;  2VCQ A;  4ICY A;  4HZ2 A;  3NOF A;  4GLT A;  1EP8 A;  1S3R A;  2JAC A;  1ZOF A;  4NV2 A;  4OFM A;  1M99 A;  2GSQ A;  2P0G A;  2K9F A;  3BCK A;  4WR4 A;  3TKP A;  3HDC A;  2LS5 A;  5BRT A;  1O73 A;  3CYN A;  2O89 A;  2FY6 A;  5ECR B;  2K8V A;  1EEJ A;  2IFQ A;  1WWJ A;  1NW2 A;  1SKS B;  5F8B A;  1EOH A;  3MNG A;  4MA9 A;  2FWF A;  4HU9 A;  2VD1 A;  5G5F A;  5IQY A;  2H1L A;  2C8U A;  1DUG A;  4XCS A;  2P31 A;  1TJD A;  2NDO A;  4P3Y B;  1QK8 A;  4ECJ A;  3GIX A;  4XS6 A;  1THO A;  4GWR A;  3APS A;  3TJG A;  1SVO A;  1TTZ A;  4K6X A;  3D22 A;  3TJK A;  1A24 A;  4KW6 A;  4N0Z A;  1Z6N A;  4FO5 A;  1W4V A;  1TRS A;  4YKF A;  4FYC A;  2IIY A;  4YQM A;  4JZQ A;  4IJI A;  1PGT A;  2C1Y A;  2WCI A;  2HRK B;  1X9M B;  2DJ2 A;  3HXS A;  3OR5 A;  1K0B A;  2RLI A;  1M2A A;  4OD7 A;  5C00 A;  4JU5 A;  2CX4 A;  1IYH A;  3KTL A;  5H5R A;  1X9W B;  2X8C A;  3RHB A;  3LQ7 A;  3IC4 A;  4G9H A;  4AKI A;  5A5H A;  1GSF A;  3GSS A;  4MPG A;  1ZZY A;  1FHE A;  1PA3 A;  1WIK A;  4AKX B;  3A2V A;  2H1G A;  2F51 A;  4IEL A;  1C72 A;  4ML6 A;  3PGT A;  1UC7 A;  5IOX A;  5J9B A;  3H79 A;  2AB6 A;  4DSS A;  5EL8 A;  2YZH A;  1QUW A;  5G5E A;  1OC9 B;  2GS3 A;  7GSS A;  5AGY A;  5B7C A;  2VCV A;  5KN2 A;  4KSO A;  4Q5N A;  2TRC P;  5BMU B;  3F63 A;  4KDY A;  1HNA A;  3LSZ A;  4PQ1 A;  1TDI A;  3I6A A;  1PFO A;  4BVX A;  1R7H A;  1T4Z A;  1GSS A;  1SKR B;  3O76 A;  4K5S A;  4OO4 A;  2FGX A;  1EWX A;  5ELA A;  2EC4 A;  2OBI A;  5J4U A;  2K6V A;  3HHV A;  5HFK A;  1V58 A;  1UVZ A;  2V2G A;  1S3A A;  3Q19 A;  4EKZ A;  2R4V A;  1TXU A;  2WS2 A;  3ERG A;  2I81 A;  4K0N A;  4NPB A;  4YQV A;  1N25 A;  5F05 A;  2YNX A;  1K3L A;  1T4Y A;  5HQP A;  3LXZ A;  2H8L A;  5CP1 A;  1R5A A;  1LJR A;  1K3O A;  1O6J A;  1HYU A;  3RDW A;  2YV7 A;  3GYK A;  3M9K A;  1M2B A;  4XRD A;  4MDC A;  2KP2 A;  5ABR A;  2CVB A;  1A2L A;  4PI2 C;  3SBC A;  1JLW A;  4G0I A;  4QL9 A;  5JWO B;  4O92 A;  5J5N A;  1AQV A;  3G7I A;  1VRS D;  2JU5 A;  2WRT A;  3RHC A;  3GH9 A;  3ERF A;  4KF9 A;  4IJ3 A;  5IMD A;  3TKS A;  3M1G A;  4MJE A;  3ZFB A;  1F9M A;  3IV4 A;  1K0O A;  2VKZ G;  4HI7 A;  3FKF A;  2B5E A;  2FA4 A;  5DQS A;  4NMU A;  4L5L A;  3LWA A;  3BD2 A;  3FEU A;  1ZCP A;  2WVX A;  4MK3 A;  5KOW A;  5B8B A;  5AN1 A;  2E7P A;  1BJX A;  1BQ7 A;  5DAL B;  3CTF A;  4J57 E;  4PUA A;  2YWN A;  1ZYP A;  5KN3 A;  1S3D A;  5IMF A;  5CRE A;  1PN0 A;  2L59 A;  4CY8 A;  2WUL A;  2HSN A;  3FMW A;  2E0Q A;  4K8M A;  2FWG A;  2V6K A;  1RQM A;  5ENU A;  4LLR A;  3IK7 A;  1YJ6 A;  4MF5 A;  4EDZ A;  3KM6 A;  3TCO A;  2OJL A;  2HSM B;  2WGR A;  5CRH A;  3U5R E;  3D6I A;  1M3J A;  1Z3E A;  3ZFL A;  4AGS A;  2O36 A;  3CRU A;  2V32 A;  3EMP A;  1GNE A;  3PPU A;  1MDI A;  2H01 A;  5L71 A;  1V9W A;  2JAD A;  2LST A;  3EUR A;  5KN1 A;  3L78 A;  3A2W A;  4I5Q A;  5E4W A;  3EIN A;  1A2M A;  4I2U A;  2XPE A;  2H30 A;  3IBH A;  3KIJ A;  4O7H A;  2FHE A;  4IKH A;  1E2Y A;  2PU9 C;  2EIQ A;  2KLX A;  2ZCT A;  1PX6 A;  1M3I A;  1YZX A;  1WP0 A;  3RAZ A;  5G1L A;  3C1R A;  3EPT A;  2CA8 A;  1I1I P;  1K0M A;  1B9X C;  1EV4 A;  4MJB A;  1TXX A;  5CAX A;  1YKA A;  2B3S A;  4OMV A;  1GSY A;  3CXG A;  4ECC A;  5GST A;  5HR3 A;  4PUF C;  2OT3 A;  2EIO A;  3WGX A;  4GTU A;  4G19 A;  4BVY A;  3TKR A;  3EU3 A;  3FZA A;  2ON5 A;  1GUK A;  1TRW A;  2VD0 A;  2AV4 A;  3F4T A;  2ON7 A;  2AHE A;  5IO2 A;  5F07 A;  2OKA A;  2L6C A;  5HFG A;  4L5O A;  1B48 A;  1DE1 A;  4NHW A;  4ACS A;  4I97 A;  2DBC A;  2H0H A;  4ZBB A;  4HU7 A;  4GXZ A;  1SJ6 A;  4TR1 B;  4XHM A;  3MDK A;  1TOF A;  13GS A;  2PWJ A;  10GS A;  1O8W A;  4IP1 A;  4PQH A;  1JFU A;  3GN3 A;  1XOB A;  1T7P B;  2GQM A;  1YEW C;  1XCC A;  1DSB A;  3E9J B;  3HZ4 A;  1O7U A;  1OC3 A;  2YWO A;  1PKZ A;  1I5G A;  1W89 A;  4K7N A;  1PD2 1;  2B6M A;  4HS1 A;  3BBY A;  2IWT A;  3P90 A;  1Z9H A;  1TU7 A;  2H1B A;  1V2A A;  3EE2 A;  4EF0 A;  2B7K A;  1TK8 B;  1AAZ A;  3FZ5 A;  1QFN A;  6GSX A;  1BYE A;  3APO A;  1USB A;  3AY8 A;  2AJQ B;  1SL2 B;  4JBB A;  2QKE A;  2NBS A;  4EUY A;  2H1A A;  3EVI A;  5CO3 A;  4KUN A;  2CT6 A;  3H4K A;  3UVT A;  1K0D A;  5J3R A;  4TXO B;  5ECP B;  2GTU A;  2C0D A;  1R5P A;  3EC3 A;  4O5Q A;  3F3Q A;  3FRC A;  2LNS A;  4POB A;  1VGL A;  3V1W A;  3VUR A;  3L9S A;  2VL2 C;  4WET A;  2R2J A;  3BJ5 A;  2HRK A;  4MNN A;  4TXV A;  2N5B A;  2X4A A;  2XHF A;  3ZRD A;  3ZLP A;  1ERW A;  2KHP A;  3HVS A;  1J0F A;  4O32 A;  4N10 A;  4HEA 2;  2UZ8 A;  2A2R A;  4FQU A;  5D9W A;  2WZS A;  4Z2T A;  3FR6 A;  1U87 A;  1A0F A;  1O8X A;  3QPM A;  3QFB C;  1FB6 A;  5HR0 A;  1S3C A;  4TW5 A;  4KA0 A;  2X99 A;  2LRT A;  4USS A;  1J08 A;  4AF2 A;  4TN8 A;  5B6N A;  3HA9 A;  1Q4J A;  4N0V A;  3D21 A;  1ZYE A;  1GUM A;  1FW1 A;  3BOA A;  5A4V A;  3QCP A;  3ZYW A;  4Z2R A;  1OC9 A;  2CZ3 A;  4AJ8 A;  2ALB A;  2LJR A;  3GKX A;  3KEB A;  2IJY A;  2YWM A;  2IMF A;  3DXB A;  2NVL A;  1TKD B;  14GS A;  5BMU A;  2FCH A;  4KDX A;  1Y6E A;  2LUS A;  4Q5Q A;  2O5V A;  4CHS A;  2C3Q A;  5AIS A;  4KH7 A;  2DJJ A;  4G01 A;  1MDJ A;  3ERW A;  2M72 A;  3HZ8 A;  4NV5 A;  4POM A;  12GS A;  1G7E A;  1GSD A;  2LQO A;  3KCM A;  3CSH A;  4DSQ A;  3FZ4 A;  2BMX A;  2TRX A;  4AI6 A;  4GSN A;  3JCM L;  4EIQ A;  1V40 A;  2C3N A;  3D4T A;  4OCF A;  2REM A;  1ZL9 A;  1FOH A;  1WJK A;  4RQR A;  1PL1 A;  4F2I A;  5FT3 A;  2MMO A;  4GST A;  2F9S A;  3GL5 A;  2VM1 A;  2JSY A;  2VO4 A;  19GS A;  2IL3 A;  1XBS A;  3IAS 2;  1SVL A;  4KGI A;  3TKQ A;  4TR3 A;  3UOM A;  2DIZ A;  4WF5 A;  1KBN A;  4PXO A;  2DMM A;  5DJL A;  4LMV A;  5IO0 A;  5J4V A;  4XIH A;  1ML6 A;  3TRQ A;  1N2A A;  2DML A;  3A5I A;  1XWG A;  4LMW A;  2WVY A;  1R26 A;  1Z5Y E;  2GT6 A;  3HKR A;  3O3T A;  2IME A;  4L8E A;  3HVX A;  2HI7 A;  2EFC A;  3ISO A;  5DAL A;  3M9J A;  4KX4 A;  1TU8 A;  4AJ6 A;  3ZL5 A;  4PHZ C;  2C0G A;  1V57 A;  2C0F A;  4DVC A;  2J23 A;  3IHQ A;  4MJA A;  5C04 A;  1X5C A;  4F82 A;  3HMJ G;  4BWQ A;  2HZF A;  1ACV A;  2M80 A;  5IMV A;  2VL9 A;  4HJM A;  1AC1 A;  4ZIL A;  2PER A;  3QAV A;  2HSM A;  5A4U A;  2LJK A;  4MJC A;  1F6M C;  1XG8 A;  3M0F A;  1F2E A;  1OC8 A;  1TK5 B;  5HFI A;  2HSH A;  3ZZX A;  2YV9 A;  1XZO A;  1XFL A;  3KXO A;  4I8B A;  1WMJ A;  3GV1 A;  2AYT A;  3FR9 A;  4I6X A;  3HJM A;  2OBK A;  5ECK B;  4BPY A;  2O8V B;  5JCU A;  2H71 A;  4FH8 A;  1MD4 A;  4PUR A;  3KP8 A;  4HJ2 A;  1CQH A;  1GUH A;  4IS0 A;  1PN9 A;  2I3Y A;  1GL8 A;  2GLR A;  2VLT A;  3MWH A;  3VFI A;  4HZ4 A;  5H5Q A;  5IMC A;  1DE2 A;  5A34 B;  5D9V A;  3ZIT A;  2LTK A;  1VF1 A;  3RPN A;  1ZMA A;  1K0A A;  17GS A;  1GSQ A;  3DVX A;  5J41 A;  3CSJ A;  5D9T A;  4V1A g;  1DBY A;  4PQI A;  1Z7R A;  3UMA A;  3EU4 A;  2CX3 A;  2P5Q A;  2V6O A;  4TKY A;  5INY A;  3N5O A;  3CRT A;  2L4C A;  4K2X A;  2O87 A;  2TIR A;  3KH9 A;  1E6B A;  2IMD A;  4YQU A;  5LNK e;  4YKG A;  3U6V A;  1BG5 A;  5J40 A;  2DJK A;  3W6G A;  1GLQ A;  2IMI A;  5GZZ B;  4EXJ A;  2XBI A;  4Q5R A;  3SWL A;  3TJB A;  1ZYQ B;  4MH3 A;  5DCH A;  4TR1 A;  3IXR A;  3LYK A;  2B5X A;  2XBQ A;  4FIW A;  1SJI A;  4FXY P;  4EE0 A;  2DJ0 A;  4HQS A;  1OKT A;  4HDE A;  4K1F A;  3GX8 A;  4TOP A;  1URM A;  3FY7 A;  3C73 A;  2ES7 A;  4Z2U A;  3W8J A;  1GWC A;  2H76 A;  2WFC A;  1RW1 A;  2HQT A;  3DVW A;  4G0K A;  1GSU A;  5J47 A;  3F8U A;  4DEJ A;  3FHK A;  4PI0 C;  2H6Y A;  2Z9S A;  1OYJ A;  4BA7 A;  3GNJ A;  1B4Q A;  3QDN A;  2H6X A;  2X49 A;  5HR2 A;  2VCT A;  2GZZ A;  5EPF A;  1SVM A;  1F3B A;  2YN1 A;  5GSS A;  3Q6O A;  1VF2 A;  3A5W A;  3GTU B;  4D73 B;  4F9Z A;  3LEF A;  1LBK A;  1X0R A;  2O85 A;  5ECM B;  3P8W A;  1Y25 A;  4TXO A;  5ID2 B;  1G7O A;  2KUC A;  4ZL7 A;  1AQX A;  2X64 A;  3C1S A;  3F9U A;  1Z6M A;  4PX1 A;  3J7Y k;  5G31 A;  3G9B A;  3ZRE A;  1EGO A;  5DDL A;  2MMA A;  4NWY A;  4EL1 A;  4K0G A;  2R37 A;  2MMN A;  3CTG A;  1TI1 A;  2CAQ A;  3M3M A;  3W8S A;  3HD5 A;  3ZML A;  3KJY A;  1BX9 A;  3WGE A;  1FB0 A;  4MP4 A;  1XW9 A;  3F6F A;  3R3E A;  3QAW A;  4WKW A;  2FUG 2;  5A1N B;  5D9X A;  4KE3 A;  2WW3 A;  2LRC A;  4GDF A;  4EIP A;  4V2M A;  3EWL A;  4G2E A;  4QQ7 A;  1TRU A;  2D2Z A;  3IAM 2;  4JE1 A;  3NZN A;  1BAY A;  4KDU A;  1SYX A;  5LD0 A;  1M7T A;  2EFD A;  5J9C A;  3IHG A;  5B6M A;  3US3 A;  2MZC A;  5FWG A;  1XWK A;  2YZU A;  1TK0 B;  2FD3 A;  3IR4 A;  3G7Y A;  5ECL B;  2UV8 G;  5KN0 A;  4E68 A;  4ZB6 A;  4KAE A;  4W66 A;  2HNL A;  3TKS E;  2DSA A;  2L6D A;  2LNT A;  3KH7 A;  4O5U A;  1XWB A;  3TJF A;  3L4N A;  4ZBD A;  2G0F A;  1V98 A;  2B1L A;  2FWE A;  4CY6 A;  2HYX A;  2MYG A;  1CQG A;  1FO5 A;  1JZW A;  2LRN A;  3APQ A;  5A4W A;  3FR3 A;  1SD9 A;  2GSR A;  4WXT A;  2YPM A;  2F8F A;  4IBP A;  1GH2 A;  4HOJ A;  2AAW A;  3HJO A;  1XVW A;  3D4M A;  5COH A;  4GQC A;  1A8L A;  4I2T A;  1H4O A;  2DJ1 A;  4Q5F A;  1SEN A;  4XRA A;  1GUL A;  4IHU A;  2N5A A;  1GTI A;  1YKC A;  4PNG A;  3LGC A;  4ZB8 A;  4X43 A;  4NHZ A;  4ZIJ A;  5G30 A;  2WVZ A;  3LJR A;  4MH2 A;  4LL4 B;  2LEG A;  3CHX C;  4ZB7 A;  2MBS A;  1G6Y A;  5DVB A;  2EFH A;  3O6T A;  4BIK A;  3NIV A;  2C4J A;  4RUV A;  3VWV A;  5ECQ B;  2OA7 A;  4K2D A;  4PGT A;  2O3E A;  5H5S A;  2RUF A;  5DBQ A;  2VL3 A;  2B5Y A;  1YF1 A;  2H72 A;  1IYI A;  1X5D A;  3CSI A;  2P5R A;  2A4V A;  3F3R A;  4OO5 A;  5CRG A;  1YY7 A;  3GL3 A;  4RI6 A;  4ULX A;  2FLS A;  4MLY A;  1XIY A;  1K0N A;  20GS A;  1K0C A;  3G7J A;  1KNG A;  4K7O A;  5FHI A;  2PVO C;  2HRF A;  2OAD A;  2L4Q A;  4KSM A;  1T8E B;  2WW2 A;  3F4R A;  3L9U A;  1NHO A;  2VCZ A;  2R5G A;  5D93 A;  2PVQ A;  2KP1 A;  2LJA A;  5KEJ A;  3D0Z A;  2IMK A;  1G6W A;  2CV4 A;  3DD3 A;  1SK0 A;  2C80 A;  2HRN A;  3IDV A;  2R0G A;  6GSY A;  1FG4 A;  2WW1 A;  1U88 A;  1N8J A;  1SYR A;  2DKI A;  3TKS C;  3VLN A;  2M46 A;  5EY6 A;  4LA1 A;  1AIU A;  4RQX A;  2VCX A;  2I4A A;  3KD0 A;  2PN8 A;  1QXH A;  2GSS A;  2H75 A;  2E2G A;  1GTU A;  1GLP A;  3DML A;  3PIN A;  5JWQ B;  4MPF A;  2B7J A;  5HR1 A;  2QGV A;  4ZB9 A;  3DRN A;  4O5R A;  1G0T A;  1FVK A;  4MF6 A;  3P2A A;  3GST A;  2H19 A;  4K9Z A;  1EZK A;  4E8E A;  3QOU A;  5ELG A;  1MDK A;  5A34 A;  3E0U A;  5DAK B;  3QAG A;  2CZ2 A;  3TB2 A;  3RFR C;  4MZW A;  2ZNM A;  3WD6 A;  4BL7 B;  1TP9 A;  1M9B A;  3H93 A;  4ILF A;  2A4H A;  2OE3 A;  2VOC A;  2H70 A;  3TU3 B;  1OE8 A;  22GS A;  3H8Q A;  3CWG A;  3FZ9 A;  3VK9 A;  3IC8 A;  4HUA A;  1ILO A;  5DCG A;  5A5K A;  4V1A p;  3DGQ A;  2JL4 A;  3C8E A;  4GSS A;  4L0U A;  2YJH A;  2HT9 A;  3UVH A;  3L0H A;  3ED3 A;  1T3B A;  2QA2 A;  2G2Q A;  3FYG A;  3QR6 A;  3TRX A;  5GAN D;  3R2Q A;  3IRA A;  5ECS A;  3HJP A;  5LCZ A;  3E3E A;  1ERU A;  1XW6 A;  2PBJ A;  4WR5 A;  2VIM A;  3QD9 A;  3RBT A;  1RK4 A;  4YH2 A;  1YVL A;  2DC5 A;  3UAR A;  3VWX A;  5KOX A;  1U3I A;  4TVE A;  3K8N A;  5EVO A;  4XS4 B;  5D73 A;  6GSU A;  4TRX A;  5CRW A;  2FA8 A;  5AIV A;  3DWV A;  1F3A A;  3TOU A;  1A2J A;  2QA1 A;  5IM9 A;  3Q18 A;  2H73 A;  3GMF A;  3QFA C;  4RI7 A;  4JED A;  4EDY A;  3GTU A;  2LV3 A;  2WB9 A;  4XS1 A;  3IE3 A;  4KB3 A;  4QL7 A;  3WT2 A;  4D73 A;  2BTO T;  2DJ3 A;  4OWY A;  5JWR B;  2VM2 A;  4PNF A;  5ID2 A;  4IGJ A;  4IQA A;  1TRV A;  3RPP A;  4POL A;  3GHA A;  4X4J A;  3MIX A;  1T1V A;  4K7I A;  1YEX A;  5IMZ A;  2GZY A;  1QMV A;  4N3Z A;  1OAZ A;  4WBJ A;  1S4B P;  3HVV A;  1A0R P;  1PQN A;  5A1N A;  3I9V 2;  1J9B A;  2H0G A;  2HZE B;  1XOA A;  3L9V A;  3FK8 A;  4E8H A;  1X5E A;  4J2F A;  3ZTL A;  4V2N A;  1R4W A;  3EMX A;  5F0G A;  2GQK A;  1O85 A;  2EFE A;  4WBR D;  5F06 A;  3LYP A;  4BWS A;  1THX A;  3I43 A;  2K18 A;  1ERT A;  2HXK A;  4L0W A;  2HFD A;  4XTS A;  3ME8 A;  1ABA A;  2GDR A;  6GSW A;  1BG1 A;  1UN2 A;  4H86 A;  2WW0 A;  4TR0 A;  1AXD A;  5GAP D;  1EP7 A;  2N5F A;  4ISD A;  3GKM A;  3WT1 A;  1QGV A;  3GFK A;  2FNO A;  1MEK A;  1HNC A;  1WE0 A;  2WJU A;  3ZMK A;  3VI7 A;  3IOS A;  3BCI A;  4MZC A;  1MD3 A;  4AJ7 A;  2FWH A;  3IPZ A;  3H1N A;  3KP9 A;  3GX0 A;  2B1K A;  1GSE A;  1B4P A;  1WOU A;  4YAP A;  1U6T A;  3ZVJ D;  1NM3 A;  1XXU A;  4F0B A;  2DIY A;  4G0L A;  1EEM A;  2K8S A;  1YQ1 A;  2GGT A;  1XWA A;  3GH6 A;  3KTB A;  1YF0 A;  2C0E A;  3LOR A;  4TR4 A;  1A23 A;  2BJX A;  4GQF A;  3M8N A;  4GF0 A;  2QC7 A;  1Q98 A;  2VL2 A;  4DSR A;  4ECB A;  2IFQ B;  3N9J A;  2L5L A;  4QMK A;  3ME7 A;  4FYB A;  1GTA A;  2YCD A;  1SK1 A;  2R0P A;  3PH9 A;  2YP6 A;  4ZL8 A;  5D96 A;  1LU4 A;  2HRA A;  1M9A A;  4F03 A;  4F0C A;  1JHB A;  1B9Y C;  1ON4 A;  1PL2 A;  3TRP A;  3VWU A;  3UJ1 A;  3F0I A;  2YWI A;  11GS A;  3ZIJ A;  4ZBA A;  1JZR A;  4MF7 A;  2LKU A;  3CMI A;  3FW2 A;  2L5O A;  2E2M A;  1I9D A;  1A8Y A;  1OVN A;  5E59 A;  1NSW A;  5DQY A;  1YDK A;  3A2X A;  2RM6 A;  2L57 A;  4OFN A;  1JZD A;  1OE7 A;  2C3T A;  2R3X A;  1MTC A;  5IPG A;  3RGB C;  1PKW A;  3ZIV A;  1KTE A;  1FVJ A;  2JZS A;  2MBT A;  2V1M A;  3D5J A;  1PRX A;  4V2L A;  4EO3 A;  2I9H A;  3MAK A;  4CW9 A;  2J9H A;  4FYU A;  4NXI A;  18GS A;  1VF4 A;  3J7Y b;  2HSY A;  8GSS A;  4HQZ A;  1HQO A;  1SJZ A;  4JRR A;  4EC0 A;  1YEP A;  1NHY A;  3DKS A;  2A2S A;  3DIE A;  2VCW A;  3IA1 A;  3DYR A;  1WRY A;  1XVQ A;  2OE0 A;  1ST9 A;  4KCE A;  5CRD A;  3WYW A;  3TJJ A;  5ECO B;  1F37 A;  1PSQ A;  4IN0 A;  5A5H B;  1GRX A;  4YAV A;  4GCI A;  1ERV A;  2GZP A;  1XPV A;  2YAN A;  5D8I A;  2NPB A;  2H6Z A;  1SL1 B;  4IQ1 A;  4DSS B;  1GNW A;  4NAX A;  2AUV A;  1HNB A;  1Z7P A;  1Y1U A;  4PTS A;  3MYD A;  5JCG A;  2VUP A;  5DAK A;  2R0C A;  2A2P A;  4MMM A;  3TGZ A;  1AQW A;  3LG6 A;  4IVF A;  4BL7 A;  1EOG A;  5IIZ A;  4BVX B;  1UA5 A;  2CQ9 A;  2F8A A;  2ZUP A;  5ECH B;  5CNW A;  4OCE A;  3C71 A;  1PX7 A;  2GQL A;  5G2Z A;  2PGT A;  4AKG A;  4J56 E;  2JZT A;  2F3M A;  1XWC A;  2H0I A;  1SL0 B;  3CQF A;  3KMN A;  3UEM A;  2GT5 A;  2OAC A;  2XC2 A;  2CVD A;  4KCA A;  4ZL9 A;  2HLS A;  3GUR A;  1BF5 A;  2V41 A;  4X0X A;  3VPQ A;  2RUE A;  1EV9 A;  4N11 A;  2DKH A;  2X8G A;  2LQQ A;  3IK9 A;  2DLX A;  3PR8 A;  2KOK A;  1T00 A;  1XW5 A;  6GSS A;  3HYP A;  1SKW B;  1SU9 A;  4JR4 A;  4KND A;  2QSI A;  5G1K A;  4JR6 A;  1SK2 A;  3HCZ A;  1JLV A;  4WF4 A;  5DJM A;  1B8X A;  1H75 A;  3C7M A;  1KEB A;  2PMT A;  2R6K A;  2WDU A;  2X8H A;  3S9F A;  3TUE A;  4XS4 A;  3UAP A;  4EVM A;  3VI5 A;  4MAB A;  4K5R A;  2MMZ A;  2PPT A;  2WZ9 A;  4Z7X A;  1VF3 A;  2JSZ A;  1BED A;  2H1D A;  3HVN A;  5IMA A;  2RII A;  2WVX B;  1K3Y A;  3QMX A;  3A3T A;  1M2D A;  3ZVJ A;  1FAA A;  3UL3 A;  3UBK A;  5IOW A;  1OKD A;  1O81 A;  3GA4 A;  1AUC A;  3LFL A;  3KMO A;  4POK A;  2CVK A;  4IW9 A;  2YJ7 A;  1FOV A;  2HSN B;  1U3A A;  1JZO A;  2VLV A;  1M0U A;  2HE3 A;  3UIW A;  3GUS A;  5ECI B;  3UBL A;  4OFT A;  2JZR A;  3I69 A;  3EYT A;  4ZXG A; 
#chains in the Genus database with same CATH homology
 1ZGN A;  4ML1 A;  1QQ2 A;  3F4S A;  3TOT A;  2GST A;  3DEX A;  2HZE A;  3MSZ A;  3F6D A;  3CBU A;  2RM5 A;  4ECI A;  1GTB A;  6GST A;  2I1U A;  4N30 A;  5IPH A;  4G10 A;  3KZQ A;  1ZYN A;  5B8A A;  3GKK A;  2PUK C;  1X9S B;  3P7X A;  1WPI A;  3KGK A;  4AKH A;  1GP1 A;  1SD8 A;  2O7K A;  3GKN A;  4GRF A;  2GVP A;  2XPD A;  2VLU A;  3TDG A;  1EGR A;  4MCU A;  2H74 A;  5J4Y A;  2VAF A;  16GS A;  4LL1 B;  5JCW A;  2H66 A;  4MZB A;  3LXT A;  3VWW A;  5ECN B;  3WGD A;  4ID0 A;  4WEY A;  3VPT A;  1PMT A;  5CYY A;  3Q74 A;  1AW9 A;  2IN3 A;  3HY2 A;  3LW9 A;  3GRX A;  6GSV A;  2YOI A;  1TI3 A;  4BVY B;  5AIX A;  4CDO A;  2CAI A;  2OE1 A;  4X1U A;  2NTO A;  2IPA A;  4A5P A;  9GSS A;  4IP6 A;  2EIR A;  1HD2 A;  1TW9 A;  2VCQ A;  4ICY A;  4HZ2 A;  3NOF A;  4GLT A;  1EP8 A;  2JAC A;  1ZOF A;  4NV2 A;  4OFM A;  1M99 A;  2GSQ A;  2P0G A;  2K9F A;  3BCK A;  4WR4 A;  3TKP A;  3HDC A;  2LS5 A;  5BRT A;  1O73 A;  3CYN A;  2O89 A;  2FY6 A;  5ECR B;  2K8V A;  1EEJ A;  2IFQ A;  1WWJ A;  1NW2 A;  1SKS B;  5F8B A;  1EOH A;  3MNG A;  4MA9 A;  2FWF A;  4HU9 A;  2VD1 A;  5G5F A;  5IQY A;  2H1L A;  2C8U A;  1DUG A;  4XCS A;  2P31 A;  1TJD A;  2NDO A;  4P3Y B;  1QK8 A;  4ECJ A;  3GIX A;  4XS6 A;  1THO A;  4GWR A;  3APS A;  3TJG A;  1SVO A;  1TTZ A;  4K6X A;  3D22 A;  3TJK A;  1A24 A;  4KW6 A;  4N0Z A;  1Z6N A;  4FO5 A;  1W4V A;  1TRS A;  4YKF A;  4FYC A;  2IIY A;  4YQM A;  4JZQ A;  4IJI A;  1PGT A;  2C1Y A;  2WCI A;  2HRK B;  1X9M B;  2DJ2 A;  3HXS A;  3OR5 A;  1K0B A;  2RLI A;  1M2A A;  4OD7 A;  5C00 A;  4JU5 A;  2CX4 A;  1IYH A;  3KTL A;  5H5R A;  1X9W B;  2X8C A;  3RHB A;  3LQ7 A;  3IC4 A;  4G9H A;  4AKI A;  5A5H A;  1GSF A;  3GSS A;  4MPG A;  1ZZY A;  1FHE A;  1PA3 A;  1WIK A;  4AKX B;  3A2V A;  2H1G A;  2F51 A;  4IEL A;  1C72 A;  4ML6 A;  3PGT A;  1UC7 A;  5IOX A;  5J9B A;  3H79 A;  2AB6 A;  4DSS A;  5EL8 A;  2YZH A;  1QUW A;  5G5E A;  1OC9 B;  2GS3 A;  7GSS A;  5AGY A;  5B7C A;  2VCV A;  5KN2 A;  4KSO A;  4Q5N A;  2TRC P;  5BMU B;  3F63 A;  4KDY A;  1HNA A;  3LSZ A;  4PQ1 A;  1TDI A;  3I6A A;  4BVX A;  1R7H A;  1T4Z A;  1GSS A;  1SKR B;  3O76 A;  4K5S A;  4OO4 A;  2FGX A;  1EWX A;  5ELA A;  2EC4 A;  2OBI A;  5J4U A;  2K6V A;  3HHV A;  5HFK A;  1V58 A;  1UVZ A;  2V2G A;  1S3A A;  3Q19 A;  4EKZ A;  2R4V A;  1TXU A;  2WS2 A;  3ERG A;  2I81 A;  4K0N A;  4NPB A;  4YQV A;  1N25 A;  5F05 A;  2YNX A;  1K3L A;  1T4Y A;  5HQP A;  3LXZ A;  2H8L A;  5CP1 A;  1R5A A;  1LJR A;  1K3O A;  1O6J A;  1HYU A;  3RDW A;  2YV7 A;  3GYK A;  3M9K A;  1M2B A;  4XRD A;  4MDC A;  2KP2 A;  5ABR A;  2CVB A;  1A2L A;  3SBC A;  1JLW A;  4G0I A;  4QL9 A;  5JWO B;  4O92 A;  5J5N A;  1AQV A;  3G7I A;  1VRS D;  2JU5 A;  2WRT A;  3RHC A;  3GH9 A;  3ERF A;  4KF9 A;  4IJ3 A;  5IMD A;  3TKS A;  3M1G A;  4MJE A;  3ZFB A;  1F9M A;  3IV4 A;  1K0O A;  2VKZ G;  4HI7 A;  3FKF A;  2B5E A;  2FA4 A;  5DQS A;  4NMU A;  4L5L A;  3LWA A;  3BD2 A;  3FEU A;  1ZCP A;  4MK3 A;  5KOW A;  5B8B A;  5AN1 A;  2E7P A;  1BJX A;  1BQ7 A;  5DAL B;  3CTF A;  4J57 E;  4PUA A;  2YWN A;  1ZYP A;  5KN3 A;  1S3D A;  5IMF A;  5CRE A;  1PN0 A;  2L59 A;  4CY8 A;  2WUL A;  2HSN A;  3FMW A;  2E0Q A;  4K8M A;  2FWG A;  2V6K A;  1RQM A;  5ENU A;  4LLR A;  3IK7 A;  1YJ6 A;  4MF5 A;  4EDZ A;  3KM6 A;  3TCO A;  2OJL A;  2HSM B;  2WGR A;  5CRH A;  3U5R E;  3D6I A;  1Z3E A;  3ZFL A;  4AGS A;  3CRU A;  2V32 A;  3EMP A;  1GNE A;  3PPU A;  1MDI A;  2H01 A;  5L71 A;  1V9W A;  2JAD A;  2LST A;  3EUR A;  5KN1 A;  3L78 A;  3A2W A;  4I5Q A;  5E4W A;  3EIN A;  1A2M A;  4I2U A;  2XPE A;  2H30 A;  3IBH A;  3KIJ A;  4O7H A;  2FHE A;  4IKH A;  1E2Y A;  2PU9 C;  2EIQ A;  2KLX A;  2ZCT A;  1PX6 A;  1YZX A;  1WP0 A;  3RAZ A;  5G1L A;  3C1R A;  3EPT A;  2CA8 A;  1K0M A;  1B9X C;  1EV4 A;  4MJB A;  1TXX A;  5CAX A;  1YKA A;  2B3S A;  4OMV A;  1GSY A;  3CXG A;  4ECC A;  5GST A;  5HR3 A;  4PUF C;  2OT3 A;  2EIO A;  3WGX A;  4GTU A;  4G19 A;  4BVY A;  3TKR A;  3EU3 A;  3FZA A;  2ON5 A;  1GUK A;  1TRW A;  2VD0 A;  2AV4 A;  3F4T A;  2ON7 A;  2AHE A;  5IO2 A;  5F07 A;  2OKA A;  2L6C A;  5HFG A;  4L5O A;  1B48 A;  1DE1 A;  4NHW A;  4ACS A;  4I97 A;  2DBC A;  2H0H A;  4ZBB A;  4HU7 A;  4GXZ A;  1SJ6 A;  4TR1 B;  4XHM A;  3MDK A;  1TOF A;  13GS A;  2PWJ A;  10GS A;  1O8W A;  4IP1 A;  4PQH A;  1JFU A;  3GN3 A;  1XOB A;  1T7P B;  2GQM A;  1XCC A;  1DSB A;  3E9J B;  3HZ4 A;  1O7U A;  1OC3 A;  2YWO A;  1PKZ A;  1I5G A;  1W89 A;  4K7N A;  1PD2 1;  2B6M A;  4HS1 A;  3BBY A;  2IWT A;  3P90 A;  1Z9H A;  1TU7 A;  2H1B A;  1V2A A;  3EE2 A;  4EF0 A;  2B7K A;  1TK8 B;  1AAZ A;  3FZ5 A;  1QFN A;  6GSX A;  1BYE A;  3APO A;  1USB A;  3AY8 A;  2AJQ B;  1SL2 B;  4JBB A;  2QKE A;  2NBS A;  4EUY A;  2H1A A;  3EVI A;  5CO3 A;  4KUN A;  2CT6 A;  3H4K A;  3UVT A;  1K0D A;  5J3R A;  4TXO B;  5ECP B;  2GTU A;  2C0D A;  1R5P A;  3EC3 A;  4O5Q A;  3F3Q A;  3FRC A;  2LNS A;  4POB A;  1VGL A;  3V1W A;  3VUR A;  3L9S A;  2VL2 C;  4WET A;  2R2J A;  3BJ5 A;  2HRK A;  4MNN A;  4TXV A;  2N5B A;  2X4A A;  2XHF A;  3ZRD A;  3ZLP A;  1ERW A;  2KHP A;  3HVS A;  1J0F A;  4O32 A;  4N10 A;  4HEA 2;  2UZ8 A;  2A2R A;  4FQU A;  5D9W A;  4Z2T A;  3FR6 A;  1U87 A;  1A0F A;  1O8X A;  3QPM A;  3QFB C;  1FB6 A;  5HR0 A;  1S3C A;  4TW5 A;  4KA0 A;  2X99 A;  2LRT A;  4USS A;  1J08 A;  4AF2 A;  4TN8 A;  5B6N A;  3HA9 A;  1Q4J A;  4N0V A;  3D21 A;  1ZYE A;  1GUM A;  1FW1 A;  3BOA A;  5A4V A;  3QCP A;  3ZYW A;  4Z2R A;  1OC9 A;  2CZ3 A;  4AJ8 A;  2ALB A;  2LJR A;  3GKX A;  3KEB A;  2IJY A;  2YWM A;  2IMF A;  3DXB A;  2NVL A;  1TKD B;  14GS A;  5BMU A;  2FCH A;  4KDX A;  1Y6E A;  2LUS A;  4Q5Q A;  2O5V A;  4CHS A;  2C3Q A;  5AIS A;  4KH7 A;  2DJJ A;  4G01 A;  1MDJ A;  3ERW A;  2M72 A;  3HZ8 A;  4NV5 A;  4POM A;  12GS A;  1G7E A;  1GSD A;  2LQO A;  3KCM A;  3CSH A;  4DSQ A;  3FZ4 A;  2BMX A;  2TRX A;  4AI6 A;  4GSN A;  3JCM L;  4EIQ A;  1V40 A;  2C3N A;  3D4T A;  4OCF A;  2REM A;  1ZL9 A;  1FOH A;  1WJK A;  4RQR A;  1PL1 A;  4F2I A;  5FT3 A;  2MMO A;  4GST A;  2F9S A;  3GL5 A;  2VM1 A;  2JSY A;  2VO4 A;  19GS A;  2IL3 A;  1XBS A;  3IAS 2;  1SVL A;  4KGI A;  3TKQ A;  4TR3 A;  3UOM A;  2DIZ A;  4WF5 A;  1KBN A;  4PXO A;  2DMM A;  5DJL A;  4LMV A;  5IO0 A;  5J4V A;  4XIH A;  1ML6 A;  3TRQ A;  1N2A A;  2DML A;  3A5I A;  1XWG A;  4LMW A;  1R26 A;  1Z5Y E;  2GT6 A;  3HKR A;  3O3T A;  2IME A;  4L8E A;  3HVX A;  2HI7 A;  2EFC A;  3ISO A;  5DAL A;  3M9J A;  4KX4 A;  1TU8 A;  4AJ6 A;  3ZL5 A;  2C0G A;  1V57 A;  2C0F A;  4DVC A;  2J23 A;  3IHQ A;  4MJA A;  5C04 A;  1X5C A;  4F82 A;  3HMJ G;  4BWQ A;  2HZF A;  1ACV A;  2M80 A;  5IMV A;  2VL9 A;  4HJM A;  1AC1 A;  4ZIL A;  2PER A;  3QAV A;  2HSM A;  5A4U A;  2LJK A;  4MJC A;  1F6M C;  3M0F A;  1F2E A;  1OC8 A;  1TK5 B;  5HFI A;  2HSH A;  3ZZX A;  2YV9 A;  1XZO A;  1XFL A;  3KXO A;  4I8B A;  1WMJ A;  3GV1 A;  2AYT A;  3FR9 A;  4I6X A;  3HJM A;  2OBK A;  5ECK B;  4BPY A;  2O8V B;  5JCU A;  2H71 A;  4FH8 A;  1MD4 A;  4PUR A;  3KP8 A;  4HJ2 A;  1CQH A;  1GUH A;  4IS0 A;  1PN9 A;  2I3Y A;  1GL8 A;  2GLR A;  2VLT A;  3MWH A;  3VFI A;  4HZ4 A;  5H5Q A;  5IMC A;  1DE2 A;  5A34 B;  5D9V A;  3ZIT A;  2LTK A;  1VF1 A;  3RPN A;  1ZMA A;  1K0A A;  17GS A;  1GSQ A;  3DVX A;  5J41 A;  3CSJ A;  5D9T A;  4V1A g;  1DBY A;  4PQI A;  1Z7R A;  3UMA A;  3EU4 A;  2CX3 A;  2P5Q A;  2V6O A;  4TKY A;  5INY A;  3N5O A;  3CRT A;  2L4C A;  4K2X A;  2O87 A;  2TIR A;  3KH9 A;  1E6B A;  2IMD A;  4YQU A;  5LNK e;  4YKG A;  3U6V A;  1BG5 A;  5J40 A;  2DJK A;  3W6G A;  1GLQ A;  2IMI A;  5GZZ B;  4EXJ A;  2XBI A;  4Q5R A;  3SWL A;  3TJB A;  1ZYQ B;  4MH3 A;  5DCH A;  4TR1 A;  3IXR A;  3LYK A;  2B5X A;  2XBQ A;  4FIW A;  1SJI A;  4EE0 A;  2DJ0 A;  4HQS A;  1OKT A;  4HDE A;  4K1F A;  3GX8 A;  4TOP A;  1URM A;  3FY7 A;  3C73 A;  2ES7 A;  4Z2U A;  3W8J A;  1GWC A;  2H76 A;  2WFC A;  1RW1 A;  2HQT A;  3DVW A;  4G0K A;  1GSU A;  5J47 A;  3F8U A;  4DEJ A;  3FHK A;  2H6Y A;  2Z9S A;  1OYJ A;  4BA7 A;  3GNJ A;  1B4Q A;  3QDN A;  2H6X A;  2X49 A;  5HR2 A;  2VCT A;  2GZZ A;  5EPF A;  1SVM A;  1F3B A;  2YN1 A;  5GSS A;  3Q6O A;  1VF2 A;  3A5W A;  3GTU B;  4D73 B;  4F9Z A;  3LEF A;  1LBK A;  1X0R A;  2O85 A;  5ECM B;  3P8W A;  1Y25 A;  4TXO A;  5ID2 B;  1G7O A;  2KUC A;  4ZL7 A;  1AQX A;  2X64 A;  3C1S A;  3F9U A;  1Z6M A;  4PX1 A;  3J7Y k;  5G31 A;  3G9B A;  3ZRE A;  1EGO A;  5DDL A;  2MMA A;  4NWY A;  4EL1 A;  4K0G A;  2R37 A;  2MMN A;  3CTG A;  1TI1 A;  2CAQ A;  3M3M A;  3W8S A;  3HD5 A;  3ZML A;  3KJY A;  1BX9 A;  3WGE A;  1FB0 A;  4MP4 A;  1XW9 A;  3F6F A;  3R3E A;  3QAW A;  4WKW A;  2FUG 2;  5A1N B;  5D9X A;  4KE3 A;  2LRC A;  4GDF A;  4EIP A;  4V2M A;  3EWL A;  4G2E A;  4QQ7 A;  1TRU A;  2D2Z A;  3IAM 2;  4JE1 A;  3NZN A;  1BAY A;  4KDU A;  1SYX A;  5LD0 A;  1M7T A;  2EFD A;  5J9C A;  3IHG A;  5B6M A;  3US3 A;  2MZC A;  5FWG A;  1XWK A;  2YZU A;  1TK0 B;  2FD3 A;  3IR4 A;  3G7Y A;  5ECL B;  2UV8 G;  5KN0 A;  4E68 A;  4ZB6 A;  4KAE A;  4W66 A;  2HNL A;  3TKS E;  2DSA A;  2L6D A;  2LNT A;  3KH7 A;  4O5U A;  1XWB A;  3TJF A;  3L4N A;  4ZBD A;  2G0F A;  1V98 A;  2B1L A;  2FWE A;  4CY6 A;  2HYX A;  2MYG A;  1CQG A;  1FO5 A;  1JZW A;  2LRN A;  3APQ A;  5A4W A;  3FR3 A;  1SD9 A;  2GSR A;  4WXT A;  2YPM A;  2F8F A;  4IBP A;  1GH2 A;  4HOJ A;  2AAW A;  3HJO A;  1XVW A;  3D4M A;  5COH A;  4GQC A;  1A8L A;  4I2T A;  1H4O A;  2DJ1 A;  4Q5F A;  1SEN A;  4XRA A;  1GUL A;  4IHU A;  2N5A A;  1GTI A;  1YKC A;  4PNG A;  3LGC A;  4ZB8 A;  4X43 A;  4NHZ A;  4ZIJ A;  5G30 A;  3LJR A;  4MH2 A;  4LL4 B;  2LEG A;  4ZB7 A;  2MBS A;  1G6Y A;  5DVB A;  2EFH A;  3O6T A;  3NIV A;  2C4J A;  4RUV A;  3VWV A;  5ECQ B;  2OA7 A;  4K2D A;  4PGT A;  5H5S A;  2RUF A;  5DBQ A;  2VL3 A;  2B5Y A;  1YF1 A;  2H72 A;  1IYI A;  1X5D A;  3CSI A;  2P5R A;  2A4V A;  3F3R A;  4OO5 A;  5CRG A;  1YY7 A;  3GL3 A;  4RI6 A;  4ULX A;  2FLS A;  4MLY A;  1XIY A;  1K0N A;  20GS A;  1K0C A;  3G7J A;  1KNG A;  4K7O A;  5FHI A;  2PVO C;  2HRF A;  2OAD A;  2L4Q A;  4KSM A;  1T8E B;  3F4R A;  3L9U A;  1NHO A;  2VCZ A;  2R5G A;  5D93 A;  2PVQ A;  2KP1 A;  2LJA A;  5KEJ A;  3D0Z A;  2IMK A;  1G6W A;  2CV4 A;  3DD3 A;  1SK0 A;  2C80 A;  2HRN A;  3IDV A;  2R0G A;  6GSY A;  1FG4 A;  1U88 A;  1N8J A;  1SYR A;  2DKI A;  3TKS C;  3VLN A;  2M46 A;  5EY6 A;  4LA1 A;  1AIU A;  4RQX A;  2VCX A;  2I4A A;  3KD0 A;  2PN8 A;  1QXH A;  2GSS A;  2H75 A;  2E2G A;  1GTU A;  1GLP A;  3DML A;  3PIN A;  5JWQ B;  4MPF A;  2B7J A;  5HR1 A;  2QGV A;  4ZB9 A;  3DRN A;  4O5R A;  1G0T A;  1FVK A;  4MF6 A;  3P2A A;  3GST A;  2H19 A;  4K9Z A;  1EZK A;  4E8E A;  3QOU A;  5ELG A;  1MDK A;  5A34 A;  3E0U A;  5DAK B;  3QAG A;  2CZ2 A;  3TB2 A;  4MZW A;  2ZNM A;  3WD6 A;  4BL7 B;  1TP9 A;  1M9B A;  3H93 A;  4ILF A;  2A4H A;  2OE3 A;  2VOC A;  2H70 A;  3TU3 B;  1OE8 A;  22GS A;  3H8Q A;  3CWG A;  3FZ9 A;  3VK9 A;  3IC8 A;  4HUA A;  1ILO A;  5DCG A;  5A5K A;  4V1A p;  3DGQ A;  2JL4 A;  3C8E A;  4GSS A;  4L0U A;  2YJH A;  2HT9 A;  3UVH A;  3L0H A;  3ED3 A;  1T3B A;  2QA2 A;  2G2Q A;  3FYG A;  3QR6 A;  3TRX A;  5GAN D;  3R2Q A;  3IRA A;  5ECS A;  3HJP A;  5LCZ A;  3E3E A;  1ERU A;  1XW6 A;  2PBJ A;  4WR5 A;  2VIM A;  3QD9 A;  3RBT A;  1RK4 A;  4YH2 A;  1YVL A;  2DC5 A;  3UAR A;  3VWX A;  5KOX A;  1U3I A;  4TVE A;  3K8N A;  5EVO A;  4XS4 B;  5D73 A;  6GSU A;  4TRX A;  5CRW A;  2FA8 A;  5AIV A;  3DWV A;  1F3A A;  3TOU A;  1A2J A;  2QA1 A;  5IM9 A;  3Q18 A;  2H73 A;  3GMF A;  3QFA C;  4RI7 A;  4JED A;  4EDY A;  3GTU A;  2LV3 A;  2WB9 A;  4XS1 A;  3IE3 A;  4KB3 A;  4QL7 A;  3WT2 A;  4D73 A;  2BTO T;  2DJ3 A;  4OWY A;  5JWR B;  2VM2 A;  4PNF A;  5ID2 A;  4IGJ A;  4IQA A;  1TRV A;  3RPP A;  4POL A;  3GHA A;  4X4J A;  3MIX A;  1T1V A;  4K7I A;  1YEX A;  5IMZ A;  2GZY A;  1QMV A;  4N3Z A;  1OAZ A;  4WBJ A;  3HVV A;  1A0R P;  1PQN A;  5A1N A;  3I9V 2;  1J9B A;  2H0G A;  2HZE B;  1XOA A;  3L9V A;  3FK8 A;  4E8H A;  1X5E A;  4J2F A;  3ZTL A;  4V2N A;  1R4W A;  3EMX A;  5F0G A;  2GQK A;  1O85 A;  2EFE A;  4WBR D;  5F06 A;  3LYP A;  4BWS A;  1THX A;  3I43 A;  2K18 A;  1ERT A;  2HXK A;  4L0W A;  2HFD A;  4XTS A;  3ME8 A;  1ABA A;  2GDR A;  6GSW A;  1BG1 A;  1UN2 A;  4H86 A;  4TR0 A;  1AXD A;  5GAP D;  1EP7 A;  2N5F A;  4ISD A;  3GKM A;  3WT1 A;  1QGV A;  3GFK A;  2FNO A;  1MEK A;  1HNC A;  1WE0 A;  2WJU A;  3ZMK A;  3VI7 A;  3IOS A;  3BCI A;  4MZC A;  1MD3 A;  4AJ7 A;  2FWH A;  3IPZ A;  3H1N A;  3KP9 A;  3GX0 A;  2B1K A;  1GSE A;  1B4P A;  1WOU A;  4YAP A;  1U6T A;  3ZVJ D;  1NM3 A;  1XXU A;  4F0B A;  2DIY A;  4G0L A;  1EEM A;  2K8S A;  1YQ1 A;  2GGT A;  1XWA A;  3GH6 A;  3KTB A;  1YF0 A;  2C0E A;  3LOR A;  4TR4 A;  1A23 A;  2BJX A;  4GQF A;  3M8N A;  4GF0 A;  2QC7 A;  1Q98 A;  2VL2 A;  4DSR A;  4ECB A;  2IFQ B;  3N9J A;  2L5L A;  4QMK A;  3ME7 A;  4FYB A;  1GTA A;  2YCD A;  1SK1 A;  2R0P A;  3PH9 A;  2YP6 A;  4ZL8 A;  5D96 A;  1LU4 A;  2HRA A;  1M9A A;  4F03 A;  4F0C A;  1JHB A;  1B9Y C;  1ON4 A;  1PL2 A;  3TRP A;  3VWU A;  3UJ1 A;  3F0I A;  2YWI A;  11GS A;  3ZIJ A;  4ZBA A;  1JZR A;  4MF7 A;  2LKU A;  3CMI A;  3FW2 A;  2L5O A;  2E2M A;  1I9D A;  1A8Y A;  1OVN A;  5E59 A;  1NSW A;  5DQY A;  1YDK A;  3A2X A;  2RM6 A;  2L57 A;  4OFN A;  1JZD A;  1OE7 A;  2C3T A;  2R3X A;  1MTC A;  5IPG A;  1PKW A;  3ZIV A;  1KTE A;  1FVJ A;  2JZS A;  2MBT A;  2V1M A;  3D5J A;  1PRX A;  4V2L A;  4EO3 A;  2I9H A;  3MAK A;  4CW9 A;  2J9H A;  4FYU A;  4NXI A;  18GS A;  1VF4 A;  3J7Y b;  2HSY A;  8GSS A;  4HQZ A;  1HQO A;  1SJZ A;  4JRR A;  4EC0 A;  1YEP A;  1NHY A;  3DKS A;  2A2S A;  3DIE A;  2VCW A;  3IA1 A;  3DYR A;  1WRY A;  1XVQ A;  2OE0 A;  1ST9 A;  4KCE A;  5CRD A;  3WYW A;  3TJJ A;  5ECO B;  1F37 A;  1PSQ A;  4IN0 A;  5A5H B;  1GRX A;  4YAV A;  4GCI A;  1ERV A;  2GZP A;  1XPV A;  2YAN A;  5D8I A;  2NPB A;  2H6Z A;  1SL1 B;  4IQ1 A;  4DSS B;  1GNW A;  4NAX A;  2AUV A;  1HNB A;  1Z7P A;  1Y1U A;  4PTS A;  3MYD A;  5JCG A;  2VUP A;  5DAK A;  2R0C A;  2A2P A;  4MMM A;  3TGZ A;  1AQW A;  3LG6 A;  4IVF A;  4BL7 A;  1EOG A;  5IIZ A;  4BVX B;  1UA5 A;  2CQ9 A;  2F8A A;  2ZUP A;  5ECH B;  5CNW A;  4OCE A;  3C71 A;  1PX7 A;  2GQL A;  5G2Z A;  2PGT A;  4AKG A;  4J56 E;  2JZT A;  2F3M A;  1XWC A;  2H0I A;  1SL0 B;  3KMN A;  3UEM A;  2GT5 A;  2OAC A;  2XC2 A;  2CVD A;  4KCA A;  4ZL9 A;  2HLS A;  3GUR A;  1BF5 A;  2V41 A;  4X0X A;  3VPQ A;  2RUE A;  1EV9 A;  4N11 A;  2DKH A;  2X8G A;  2LQQ A;  3IK9 A;  2DLX A;  3PR8 A;  2KOK A;  1T00 A;  1XW5 A;  6GSS A;  3HYP A;  1SKW B;  1SU9 A;  4JR4 A;  4KND A;  2QSI A;  5G1K A;  4JR6 A;  1SK2 A;  3HCZ A;  1JLV A;  4WF4 A;  5DJM A;  1B8X A;  1H75 A;  3C7M A;  1KEB A;  2PMT A;  2R6K A;  2WDU A;  2X8H A;  3S9F A;  3TUE A;  4XS4 A;  3UAP A;  4EVM A;  3VI5 A;  4MAB A;  4K5R A;  2MMZ A;  2PPT A;  2WZ9 A;  4Z7X A;  1VF3 A;  2JSZ A;  1BED A;  2H1D A;  5IMA A;  2RII A;  1K3Y A;  3QMX A;  3A3T A;  1M2D A;  3ZVJ A;  1FAA A;  3UL3 A;  3UBK A;  5IOW A;  1OKD A;  1O81 A;  3GA4 A;  1AUC A;  3LFL A;  3KMO A;  4POK A;  2CVK A;  4IW9 A;  2YJ7 A;  1FOV A;  2HSN B;  1U3A A;  1JZO A;  2VLV A;  1M0U A;  2HE3 A;  3UIW A;  3GUS A;  5ECI B;  3UBL A;  4OFT A;  2JZR A;  3I69 A;  3EYT A;  4ZXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...