1GTBA

Crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glutathione transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structures of a schistosomal drug and vaccine target: glutathione S-transferase from Schistosoma japonica and its complex with the leading antischistosomal drug praziquantel.
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 65
structure length 218
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1994-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gtbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gtbA01
2TIRA 6GSXA 2HNLA 4MZBA 4PXOA 2IMKA 4OWYA 5DVBA 2LKUA 1AUCA 3KXOA 3EU3A 5A4VA 1QQ2A 2HYXA 1EV4A 5CYYA 1UA5A 5ECLB 3KH9A 4BVYB 4GRFA 3VURA 2XPEA 1GSSA 1PQNA 2GQLA 1XCCA 2H6ZA 5H5RA 4TKYA 3IPZA 1EP8A 4IHUA 4MJAA 5G31A 1ZZYA 4GSSA 2V1MA 5GAND 4RI7A 2DSAA 2LTKA 1DSBA 4TN8A 2GT5A 1SJ6A 1GSFA 4EKZA 1KBNA 5ABRA 2CA8A 3HYPA 1SKSB 2MBSA 4X43A 4F2IA 3FR9A 4F9ZA 3N5OA 4Q5FA 3FZ5A 3UIWA 2B7JA 1QK8A 4HZ4A 2IMIA 5IM9A 3NZNA 4O7HA 2H1BA 4TXOA 2IPAA 3UJ1A 5IOXA 4HJ2A 4PQ1A 4K7OA 3P2AA 3FY7A 22GSA 3LXTA 4WETA 3WGEA 4K2DA 4YQUA 2VM2A 3TRXA 1KEBA 2DIZA 2FWHA 2DJKA 3CXGA 3HY2A 5KEJA 1TXXA 3EC3A 2I81A 2AUVA 2HFDA 4KGIA 1PD21 4JU5A 1AQXA 3A2WA 1RK4A 1O73A 1R7HA 3A3TA 5F8BA 2VLTA 2WZ9A 1XWCA 3TKQA 2LNTA 3LGCA 4KSOA 3HVSA 3IHQA 1K0DA 2BJXA 1IYHA 1F3BA 3R3EA 2H1DA 2HRKA 3KZQA 4K6XA 2WULA 2YJHA 1Z3EA 3I6AA 2I1UA 2KOKA 3KTBA 4L0UA 2H72A 2N5AA 5ECHB 2HI7A 2JZRA 4KF9A 4EF0A 2FD3A 3GX8A 1U88A 2REMA 3IC4A 1U3AA 1OAZA 5HFIA 3G7YA 4IQAA 4HS1A 5B6MA 1QUWA 3RPPA 3EWLA 5HR3A 3TKPA 4D73A 4G0KA 2JACA 4LA1A 3IK7A 4GTUA 2VLVA 1A23A 4V1Ap 4HZ2A 2PVQA 4WXTA 3TRQA 2WRTA 3F0IA 1YDKA 1X9MB 2C1YA 3UOMA 4HEA2 1R5AA 2AV4A 1SD8A 3VK9A 4F03A 5D9TA 2PUKC 4F0CA 2DMLA 4XS4B 2VL2C 3L9UA 1T7PB 5GAPD 2YANA 1X0RA 3WD6A 1K3LA 4WKWA 1DE2A 1LU4A 1UVZA 1ERVA 4P3YB 2VLUA 5GZZB 2H75A 2X99A 2EC4A 1XVQA 3GH9A 2M80A 2YOIA 2C3NA 3TKSE 3F4RA 5JWQB 2IMEA 2LEGA 1M2DA 5G30A 1U87A 2YWOA 3D22A 1X5DA 3D6IA 1FB6A 1GUMA 2A4VA 2VM1A 2IFQA 1GTUA 4BWSA 2DIYA 3DKSA 2GQKA 4MA9A 1AQVA 1YF1A 2ZUPA 2CVKA 1GSYA 1ACVA 5IMVA 5ECNB 3GH6A 2EIQA 4OD7A 4IELA 2VL2A 5HR1A 1U6TA 2IN3A 4ZL9A 1Z7RA 3NOFA 5ECKB 1WRYA 1MD3A 2D2ZA 1ZYEA 4NPBA 3C1RA 1TRUA 3KGKA 3TOTA 1SL1B 6GSYA 2E2GA 4GQCA 4AJ6A 3M8NA 3LFLA 3PH9A 4RQRA 3UEMA 2HSMA 1NW2A 2YWMA 1FVJA 1WMJA 4MK3A 2CX3A 2LQOA 3J7Yb 1YY7A 1XIYA 1M2BA 2FWGA 2DJJA 2FCHA 3A2VA 3TJKA 1S3DA 4IP6A 1HNBA 2PU9C 3DD3A 4NWYA 4MZWA 2HLSA 2CQ9A 2E7PA 4PX1A 1PRXA 4G2EA 3QOUA 4TR3A 1PN9A 1V2AA 3UL3A 3HKRA 4EDYA 5CRHA 1F2EA 4LMVA 1GUKA 2WJUA 1GNWA 1B4QA 1OC9A 5ECRB 3VI5A 2J9HA 5AGYA 4TR4A 4E8EA 4YQMA 1PGTA 5INYA 1XW9A 3DWVA 4XIHA 2MMZA 3F4SA 5IMZA 3F6DA 3UVHA 3WYWA 1LJRA 3LSZA 2H30A 4NV2A 3WGXA 1PL1A 2L57A 3ZVJD 1JZRA 2FNOA 4HJMA 5D73A 3VPQA 1WOUA 1ZOFA 1J9BA 2PGTA 1WJKA 1A8YA 3M9KA 1X9SB 9GSSA 1FAAA 1T1VA 3SWLA 4EDZA 1VF2A 5IPGA 3D5JA 3LJRA 3DMLA 1VF1A 1AIUA 4BVYA 2JADA 2IFQB 2C4JA 1K0NA 6GSUA 1YKCA 3W8JA 2G0FA 4NXIA 2MMNA 1BG5A 3FW2A 1Z6MA 3HCZA 3UARA 3US3A 2C80A 1S3CA 5CP1A 2GSSA 3S9FA 4V2NA 4QQ7A 1KNGA 4EL1A 4ZL7A 3BBYA 3KJYA 4O5RA 2P31A 2GZPA 3CRTA 3SBCA 5DQSA 1FO5A 3GSTA 1XOAA 2LS5A 4AJ7A 2V6OA 2PN8A 1O8XA 2FWEA 1FB0A 5IMAA 2XHFA 3W8SA 4WF5A 2KUCA 5ID2B 1TK8B 2WB9A 3LQ7A 2HXKA 1FHEA 2F8AA 14GSA 4MDCA 3EU4A 3EE2A 2H01A 3MAKA 4RQXA 5G1LA 4XCSA 4PNGA 2GGTA 3LYKA 3FZ9A 2RM6A 2XBQA 2H0GA 1TRSA 2H19A 5ENUA 3Q74A 1MEKA 2QC7A 1ABAA 3A5WA 4NHZA 2H71A 1PX7A 2M72A 5C04A 4H86A 4G0LA 4HI7A 1X5EA 4PTSA 2CX4A 6GSWA 1SYXA 3CSHA 3FEUA 4OCFA 1G0TA 2HZFA 4PQHA 2CV4A 4NV5A 5DALB 3C71A 4L0WA 2LRCA 1SL0B 2YZUA 20GSA 2L5LA 3P7XA 3D0ZA 3GTUA 2GZZA 2JZTA 3IAS2 2PMTA 3A2XA 1B4PA 3IXRA 4IBPA 4OFMA 1GLPA 2HRAA 4ZBAA 3C73A 3VWWA 2OE0A 4TVEA 3PPUA 5E4WA 18GSA 5ECIB 2H6XA 2UZ8A 4TXVA 3N9JA 3GUSA 1VF4A 5JCUA 1QGVA 2GS3A 2L59A 3GURA 2CAQA 5IQYA 2QKEA 1EP7A 4MLYA 5CNWA 3H4KA 3IAM2 3CTGA 1X5CA 1EV9A 4FQUA 3PR8A 2C3QA 2K6VA 2V41A 2YP6A 4XS4A 1K0BA 5HQPA 3VI7A 1Y6EA 3CSIA 2DJ3A 2DMMA 3QFBC 4KDYA 4HOJA 1VF3A 1GTAA 2H70A 3E9JB 1SYRA 3LG6A 4ACSA 3O76A 3QAVA 3BCIA 2GSTA 4ZB9A 3UMAA 4Z7XA 2JU5A 1JLVA 4MPFA 4X1UA 5EVOA 2CT6A 2HT9A 4HQZA 3O3TA 1FG4A 4ISDA 4ULXA 1Z7PA 3JCML 2L6DA 3AY8A 1I5GA 1O8WA 1A2MA 1Z5YE 2L4QA 1M99A 4MABA 3QAGA 5B8BA 3C7MA 4CDOA 3ZLPA 3KM6A 1XZOA 3ED3A 4DSQA 2H8LA 3ZIJA 4KB3A 3U5RE 5CAXA 2VCXA 4PUAA 1Z9HA 3EINA 4JRRA 3W6GA 1SKWB 1LBKA 3Q19A 4POMA 5HR0A 4YH2A 1PKWA 4KE3A 4V2MA 1H4OA 2B5YA 5CO3A 3D4MA 1ERTA 2IIYA 1TTZA 3GTUB 2A2RA 4OFTA 5KN1A 1HNCA 1M7TA 4TRXA 5FT3A 1WPIA 4BVXA 1WE0A 1TU7A 5EY6A 4L5LA 1VRSD 1W89A 1ERUA 1JZOA 1YF0A 2H0HA 3ZRDA 4K7NA 2AYTA 2WDUA 1JZWA 2H0IA 1XW6A 2DC5A 3ZFLA 3IV4A 4G9HA 3GMFA 3KH7A 4K1FA 4MH3A 3QDNA 1WP0A 2JSYA 3TJJA 2HRNA 3ZITA 1MTCA 3KTLA 1B48A 3GN3A 4O92A 4WBJA 2X8GA 5F07A 3KEBA 6GSTA 1XWBA 3DIEA 2DJ0A 3QPMA 4N11A 1B8XA 4JR6A 4LL4B 1ML6A 2E2MA 4NMUA 5IOWA 5J4UA 3TJFA 5EL8A 3GKKA 3IA1A 2B5EA 3TB2A 3P90A 5D9WA 2C0DA 3FK8A 5AN1A 5ELGA 4LL1B 3J7Yk 2G2QA 5HFKA 2K9FA 4IKHA 5BMUA 4KCEA 5EPFA 4I6XA 2V2GA 2FA8A 4NHWA 4KH7A 4L5OA 1X9WB 4Q5NA 3TOUA 5AIVA 1UC7A 2GTUA 2XPDA 2LJKA 2VL9A 1A0FA 1VGLA 2HZEA 1YEXA 2MMAA 1K3YA 4XHMA 4FYBA 1OKDA 3D4TA 5GSTA 4PNFA 5KN3A 4YQVA 5CRDA 1YEPA 3UBLA 3HA9A 4OO4A 3WT1A 2V32A 1F37A 1O6JA 5G5FA 1DUGA 1GWCA 1R4WA 4TOPA 2VD0A 4PQIA 4MF5A 2C8UA 2CZ2A 2RIIA 3F6FA 3L0HA 3TKSA 5ID2A 5HFGA 4ZL8A 2XC2A 4ZILA 5G1KA 4ZBDA 2YCDA 4BVXB 5A5KA 3HJMA 2ON5A 1JHBA 3EVIA 1GH2A 4DVCA 3EYTA 1TP9A 4G0IA 2GQMA 4MPGA 3DVXA 1EOHA 2CVBA 4XS1A 4TR1A 2LV3A 1CQGA 2DLXA 2ON7A 2MMOA 1THXA 4ML6A 4KDXA 4TW5A 3IDVA 3L4NA 4J56E 1ZMAA 1GSDA 3BCKA 3VWXA 4FYUA 5H5SA 2L6CA 2TRXA 1GTBA 1NM3A 2FGXA 2K8SA 5ECMB 1XXUA 5C00A 6GSVA 1V57A 5DALA 3H93A 5G5EA 1M2AA 1MDKA 3Q18A 4OCEA 3KCMA 5A4UA 3L9SA 4GLTA 2VO4A 1YZXA 1RW1A 5A4WA 4KDUA 4KA0A 3BJ5A 4USSA 2Z9SA 4F0BA 11GSA 2IMDA 3Q6OA 3GV1A 4N0ZA 4DSSA 3RHCA 4IQ1A 5LNKe 1EOGA 3I69A 4KAEA 3G7JA 2BTOT 2RM5A 3BOAA 1M0UA 3IR4A 1SD9A 4HDEA 3DYRA 4WR5A 2C0FA 3KIJA 5H5QA 3R2QA 2OBIA 3DVWA 2HZEB 2R3XA 4F82A 2B6MA 1G7EA 1F6MC 1AXDA 5B7CA 3K8NA 1ZGNA 3ME8A 4KCAA 4J57E 3ZTLA 5IO2A 1EGOA 1SU9A 2YN1A 1JLWA 2VAFA 1S3AA 3GNJA 1TKDB 3GFKA 2MBTA 3CMIA 2KHPA 3RAZA 3MNGA 2DJ2A 5DDLA 1XWAA 3ERGA 2WCIA 4MJBA 1O85A 3ERWA 2CAIA 2B3SA 2B5XA 1J08A 1WIKA 1TW9A 3F63A 2YV9A 1XFLA 3HZ8A 1OE7A 1O81A 2YV7A 5E59A 1AQWA 4IW9A 3UBKA 3CYNA 3NIVA 1K3OA 2NPBA 1SENA 3GSSA 2ZCTA 2PERA 1O7UA 3L78A 2R4VA 3ZMKA 1GLQA 4BL7A 4EUYA 4ECJA 4TR1B 4O32A 1ZL9A 1UN2A 3TKRA 4ECBA 3HDCA 2AHEA 4AJ8A 2J23A 2HSYA 1C72A 2F8FA 3M9JA 5DJMA 3BD2A 4HU9A 1T4ZA 3G7IA 1EWXA 3GX0A 2I9HA 5ECOB 4I2TA 1V9WA 2HSNB 4RUVA 2QSIA 2OJLA 17GSA 3GYKA 2NTOA 2YNXA 1MDIA 4HU7A 5DBQA 2E0QA 2AB6A 2GVPA 2C0EA 3I43A 4HQSA 1T4YA 4EC0A 4N10A 2OE3A 1TRVA 4LLRA 3IC8A 2GSQA 4MF6A 5HR2A 4DSSB 4I8BA 5JCGA 1WWJA 1FOVA 2JZSA 3HJOA 5D93A 1M9BA 5IO0A 3DEXA 5FWGA 2YJ7A 2OA7A 4X0XA 1JZDA 2ES7A 4WF4A 3ZVJA 3FKFA 4N30A 3I9V2 5IPHA 1B9YC 2H1GA 1PMTA 3VWVA 4K7IA 2OADA 3ZZXA 5IMFA 5JWOB 1JFUA 2WFCA 2A2SA 2VD1A 2L5OA 2O7KA 1ST9A 3FZAA 3TGZA 3GKNA 4Q5QA 2LUSA 3FHKA 5AIXA 2DBCA 2VCZA 2X8CA 2FA4A 1OC8A 5ECSA 1TU8A 3APQA 1SJZA 2I3YA 4EE0A 1NHOA 1HD2A 1XVWA 3GRXA 1T8EB 3UVTA 3CBUA 4EO3A 13GSA 4K0NA 4POBA 2AJQB 4K8MA 1QXHA 1ZYQB 1E2YA 4RI6A 3EURA 2OACA 4FO5A 1V58A 2ALBA 3GKMA 1MDJA 3LWAA 5JWRB 2YWIA 2EIOA 1M9AA 1TDIA 1BQ7A 1GP1A 1F3AA 5F0GA 4BL7B 8GSSA 2FHEA 3ME7A 5ECPB 1TI3A 3EMXA 4DSRA 4QL7A 3QAWA 1SJIA 2R2JA 2N5BA 3GL5A 4QL9A 4PGTA 4GSTA 1RQMA 2H6YA 2BMXA 2PBJA 3F8UA 3IRAA 3DRNA 4JEDA 1PL2A 4ZXGA 4ECIA 3ZYWA 3LEFA 4E8HA 1QMVA 3RBTA 4K0GA 2HRFA 5D9VA 3E3EA 1R26A 1GULA 5JCWA 1GSQA 3MSZA 5CRWA 2M46A 1A8LA 1OKTA 5G2ZA 3ZMLA 2LRNA 3E0UA 3V1WA 1PA3A 4IP1A 3LYPA 2LJRA 3MDKA 4AGSA 5F06A 1EZKA 3HXSA 2VL3A 3F3QA 2O87A 4FIWA 3TUEA 3H1NA 2OKAA 5D96A 2K8VA 3DGQA 3TCOA 2B7KA 4NAXA 4JE1A 4ZB6A 3GA4A 1AAZA 1SL2B 1H75A 1K0OA 3CRUA 1BYEA 4MH2A 3ERFA 1DBYA 3P8WA 2NVLA 4MZCA 4ZIJA 2GT6A 4EXJA 1K0MA 3TRPA 2YWNA 1GSUA 1Y25A 2HE3A 4IVFA 4JBBA 2LSTA 2P5QA 3L9VA 2OBKA 3HVXA 3QMXA 2O8VB 1TK5B 3ZREA 3APSA 3FRCA 2EIRA 4POKA 1OE8A 4MF7A 5J9BA 4L8EA 3U6VA 1FVKA 3TJGA 4ZB8A 5CRGA 1G6YA 2X8HA 3M1GA 2KLXA 3C1SA 3GL3A 5KN0A 3TKSC 1XWKA 4AF2A 2LRTA 2AAWA 2H1AA 2LQQA 4TR0A 1QFNA 1GRXA 19GSA 5ECQB 3HJPA 4MJCA 1BAYA 4OFNA 4ILFA 2ZNMA 4KSMA 2H73A 3IBHA 4KW6A 1NSWA 4FYCA 4KUNA 3VFIA 7GSSA 2LNSA 3LXZA 5L71A 4GF0A 2O85A 4BPYA 1AW9A 1XPVA 3ZFBA 4TXOB 2P0GA 4IGJA 6GSSA 3KMNA 1HQOA 2V6KA 5DAKA 2GZYA 4N0VA 1URMA 3H79A 1A0RP 1A2LA 1ERWA 2JL4A 1B9XC 2VIMA 4I2UA 1K0CA 4IS0A 4XS6A 3HHVA 4ECCA 2PPTA 2KP2A 1N2AA 5D9XA 2HSHA 4OO5A 3FYGA 4HUAA 3KMOA 4PURA 5IMDA 5IIZA 3UAPA 4V1Ag 1GUHA 4WR4A 3QD9A 1R5PA 4EVMA 2HRKB 4YAVA 4XTSA 3FZ4A 5LD0A 1PSQA 1U3IA 5J9CA 3M3MA 3TDGA 4XRDA 5J3RA 2GDRA 4Q5RA 3C8EA 1BJXA 1EEMA 1Q98A 1SKRB 3HD5A 3RPNA 1T00A 1J0FA 2F9SA 12GSA 2GSRA 1XWGA 2QGVA 3QR6A 4XRAA 3QFAC 3TJBA 1A2JA 2VOCA 5GSSA 1ILOA 5ELAA 2IMFA 3EMPA 3HZ4A 1SK1A 1W4VA 2MZCA 1V98A 4ML1A 3F9UA 2FWFA 1SK2A 2R37A 2XBIA 4GQFA 4WEYA 1PKZA 10GSA 3M0FA 1G7OA 1YKAA 5FHIA 1YQ1A 2RLIA 1USBA 4D73B 5DJLA 5KN2A 2B1KA 5J41A 1YJ6A 2P5RA 3VLNA 2NDOA 1XBSA 3PINA 4DEJA 4JR4A 4GSNA 1IYIA 2F3MA 1GTIA 2YPMA 3F3RA 5IMCA 3ZIVA 2C3TA 1GL8A 2PWJA 1HNAA 2IWTA 2RUEA 2X64A 1HYUA 1SK0A 4I5QA 1CQHA 1THOA 1TOFA 4KX4A 2OE1A 3F4TA 3GIXA 1PX6A 2YZHA 2H66A 2H74A 2VCQA 4G19A 3GKXA 1XOBA 2K18A 4OMVA 2FLSA 4WBRD 4YAPA 5DCGA 3RHBA 1Z6NA 5DAKB 5AISA 5B8AA 1TJDA 3ZL5A 4ID0A 4MJEA 1GSEA 2GLRA 3ISOA 1V40A 2LJAA 4KNDA 1T3BA 1NHYA 2R5GA 1FW1A 1KTEA 1GNEA 4ZBBA 3LORA 16GSA 4IJIA 3VWUA 1G6WA 1K0AA 2VCVA 1TI1A 1OYJA 4K9ZA 1TRWA 1BEDA 5DCHA 3KD0A 3QCPA 4MMMA 2B1LA 3OR5A 4MCUA 4V2LA 2FY6A 2VUPA 2WS2A 3CSJA 2DJ1A 3VPTA 1AC1A 4J2FA 5D8IA 1BX9A 3IE3A 3APOA 5DQYA 2C0GA 1EGRA 3DXBA 3MWHA 4G10A 1A24A 2HSMB 1XW5A 3IK9A 4BWQA 1F9MA 2FUG2 2CVDA 3HVVA 3IOSA 3WT2A 2R6KA 4GWRA 2IL3A 3FR6A 5J5NA 2F51A 5CREA 1Q4JA 2HQTA 3CTFA 4GXZA 3KP9A 2IJYA 1OC3A 1OVNA 3GHAA 2NBSA 1N8JA 4I97A 3RDWA 2VCWA 2H76A 5COHA 1ON4A 3PGTA 5F05A 2KP1A 3D21A 5LCZA 4IN0A 1ZCPA 5B6NA 2CZ3A 1I9DA 3WGDA 1MD4A 4PUFC 4LMWA 2VCTA 2L4CA 4GCIA 3O6TA 4POLA 4FH8A 1DE1A 2TRCP 1E6BA 1OC9B 4BA7A 4JZQA 1EEJA 3KP8A 4CHSA 2WGRA 4MP4A 2O89A 1TK0B 3H8QA 2MYGA 3FR3A 2I4AA 3G9BA 2JSZA 4IJ3A 2N5FA 4CW9A 2RUFA 2PVOC
chains in the Genus database with same CATH superfamily
2TIRA 6GSXA 2HNLA 4MZBA 4PXOA 2IMKA 4OWYA 5DVBA 2LKUA 1AUCA 3KXOA 3EU3A 5A4VA 1QQ2A 2HYXA 1EV4A 5CYYA 1UA5A 5ECLB 3KH9A 4BVYB 4GRFA 3VURA 2XPEA 1GSSA 1PQNA 2GQLA 1XCCA 2H6ZA 5H5RA 4TKYA 3IPZA 1EP8A 4IHUA 4MJAA 5G31A 1ZZYA 4GSSA 2V1MA 5GAND 4RI7A 2DSAA 2LTKA 1DSBA 4TN8A 2GT5A 1SJ6A 1GSFA 4EKZA 1KBNA 5ABRA 2CA8A 3CWGA 3HYPA 1SKSB 2MBSA 4X43A 5J4VA 4F2IA 3FR9A 4F9ZA 3N5OA 4Q5FA 4E68A 3FZ5A 3UIWA 2B7JA 2QA1A 1QK8A 4HZ4A 2IMIA 5IM9A 3NZNA 4O7HA 2H1BA 4TXOA 2IPAA 3UJ1A 5IOXA 1S4BP 4HJ2A 4PQ1A 4K7OA 3P2AA 3FY7A 22GSA 3LXTA 4WETA 3WGEA 4GDFA 4K2DA 4YQUA 2VM2A 3TRXA 1KEBA 2DIZA 2FWHA 2DJKA 3CXGA 3HY2A 5KEJA 1TXXA 3EC3A 2I81A 2AUVA 2X4AA 2HFDA 4KGIA 1PD21 4JU5A 1AQXA 3A2WA 1RK4A 1O73A 1R7HA 3A3TA 5F8BA 2VLTA 3MYDA 2WZ9A 1XWCA 3TKQA 2LNTA 3LGCA 4KSOA 3HVSA 3IHQA 1K0DA 2BJXA 1IYHA 1F3BA 3R3EA 2H1DA 4BIKA 2HRKA 3KZQA 4K6XA 2WULA 2YJHA 1Z3EA 3I6AA 2I1UA 2KOKA 3KTBA 4L0UA 2H72A 2N5AA 5ECHB 2HI7A 2JZRA 4KF9A 4EF0A 2FD3A 3GX8A 1U88A 2REMA 3IC4A 1U3AA 1OAZA 5HFIA 3G7YA 4IQAA 4HS1A 5B6MA 1QUWA 3RPPA 3EWLA 5HR3A 3TKPA 4D73A 4G0KA 2JACA 4LA1A 2EFDA 3IK7A 4GTUA 2VLVA 1A23A 4V1Ap 4HZ2A 2PVQA 2UV8G 4WXTA 3TRQA 2WRTA 3F0IA 1YDKA 1X9MB 2C1YA 4ICYA 3UOMA 4HEA2 1R5AA 2AV4A 1SD8A 3VK9A 4F03A 1YVLA 5D9TA 2PUKC 4F0CA 2DMLA 4XS4B 2VL2C 3L9UA 1T7PB 5GAPD 2YANA 1X0RA 3WD6A 1K3LA 4WKWA 1DE2A 1LU4A 1UVZA 1ERVA 4P3YB 2VLUA 5GZZB 2H75A 2X99A 2A4HA 2EC4A 1XVQA 2X49A 3GH9A 2M80A 2YOIA 2C3NA 3TKSE 3F4RA 5JWQB 2IMEA 2LEGA 1M2DA 5G30A 1U87A 2YWOA 1I1IP 3D22A 1X5DA 3D6IA 1FB6A 1GUMA 2A4VA 2VM1A 2IFQA 1GTUA 4BWSA 2DIYA 3DKSA 2GQKA 4MA9A 2EFCA 1AQVA 1YF1A 2ZUPA 2CVKA 1GSYA 1ACVA 3CHXC 5IMVA 5ECNB 3GH6A 4MNNA 2EIQA 4OD7A 4IELA 2VL2A 5HR1A 5J40A 1U6TA 2IN3A 4ZL9A 1Z7RA 3NOFA 4W66A 5ECKB 1WRYA 1MD3A 2D2ZA 1ZYEA 4NPBA 3C1RA 1TRUA 3KGKA 3TOTA 1SL1B 6GSYA 2E2GA 4HSCX 4GQCA 4AJ6A 3M8NA 3LFLA 3PH9A 4RQRA 3UEMA 2HSMA 1NW2A 2YWMA 1FVJA 1WMJA 4MK3A 2CX3A 2LQOA 3J7Yb 1YY7A 5A1NA 1XIYA 1M2BA 2FWGA 2DJJA 2FCHA 3A2VA 3TJKA 1S3DA 4IP6A 1HNBA 2PU9C 3DD3A 4YKFA 4NWYA 4MZWA 2HLSA 2CQ9A 2E7PA 4PX1A 1PRXA 4G2EA 3QOUA 4TR3A 1PN9A 1V2AA 3UL3A 3HKRA 5A34B 4EDYA 5CRHA 1F2EA 4LMVA 1GUKA 2WJUA 1GNWA 1B4QA 1OC9A 5ECRB 3VI5A 2J9HA 5AGYA 1PFOA 4TR4A 4E8EA 4YQMA 1PGTA 5INYA 1XW9A 3DWVA 4XIHA 2MMZA 3F4SA 5IMZA 3F6DA 5BMUB 3UVHA 3WYWA 1LJRA 3LSZA 2H30A 4NV2A 3WGXA 1PL1A 2L57A 3ZVJD 1JZRA 1N25A 2FNOA 4HJMA 5D73A 3VPQA 1WOUA 1ZOFA 1J9BA 2PGTA 1WJKA 1A8YA 3M9KA 1X9SB 9GSSA 1FAAA 1T1VA 3SWLA 4N3ZA 4EDZA 1VF2A 5IPGA 3D5JA 3LJRA 3DMLA 1VF1A 1AIUA 4BVYA 2O36A 2JADA 2IFQB 2C4JA 1K0NA 6GSUA 1YKCA 3W8JA 2G0FA 4NXIA 2MMNA 1BG5A 3FW2A 1Z6MA 3HCZA 3UARA 3US3A 2C80A 1S3CA 5CP1A 2GSSA 3S9FA 4V2NA 4QQ7A 1KNGA 4EL1A 4ZL7A 3BBYA 3KJYA 4O5RA 2P31A 2GZPA 3CRTA 3SBCA 5DQSA 1FO5A 3GSTA 3HMJG 1XOAA 2LS5A 4AJ7A 2V6OA 1FOHA 2PN8A 1O8XA 2FWEA 1FB0A 5IMAA 2XHFA 3W8SA 4WF5A 2KUCA 5ID2B 1TK8B 2WB9A 3LQ7A 3CQFA 2HXKA 1FHEA 2F8AA 14GSA 4MDCA 3EU4A 3EE2A 2H01A 3MAKA 4RQXA 5G1LA 4XCSA 5A1NB 4PNGA 2GGTA 3LYKA 1S3RA 3FZ9A 2RM6A 2XBQA 2H0GA 1TRSA 2H19A 5ENUA 3Q74A 1MEKA 2QC7A 1ABAA 3A5WA 4NHZA 2H71A 1TXUA 1PX7A 2M72A 5C04A 4H86A 4CY6A 4G0LA 4HI7A 1X5EA 4PTSA 2CX4A 6GSWA 1SYXA 3CSHA 3FEUA 4OCFA 1G0TA 2HZFA 4PQHA 2CV4A 4NV5A 5DALB 3C71A 2WW3A 4L0WA 2LRCA 1SL0B 2YZUA 20GSA 2L5LA 3P7XA 3D0ZA 3GTUA 2GZZA 2JZTA 3IAS2 2PMTA 3A2XA 1B4PA 3IXRA 4IBPA 4OFMA 1GLPA 2HRAA 4ZBAA 3C73A 3MIXA 3VWWA 2OE0A 4TVEA 4PI0C 3PPUA 4A5PA 5E4WA 18GSA 5ECIB 2H6XA 2UZ8A 4TXVA 3N9JA 3GUSA 1VF4A 5JCUA 1QGVA 2GS3A 2L59A 2O5VA 3GURA 2CAQA 5IQYA 2QKEA 1EP7A 4MLYA 5CNWA 3H4KA 3IAM2 3CTGA 1X5CA 1EV9A 4FQUA 3PR8A 2C3QA 2K6VA 2V41A 2YP6A 4XS4A 1K0BA 5HQPA 3VI7A 1Y6EA 3CSIA 2DJ3A 2DMMA 4G01A 3QFBC 4KDYA 4HOJA 3RGBC 3LW9A 4YKGA 1VF3A 1GTAA 2H70A 3E9JB 1SYRA 3LG6A 4ACSA 3O76A 3QAVA 3BCIA 2GSTA 4ZB9A 3UMAA 4Z7XA 2JU5A 1JLVA 4MPFA 4X1UA 5EVOA 2CT6A 2HT9A 4HQZA 3O3TA 1FG4A 4ISDA 4ULXA 1Z7PA 3JCML 2L6DA 3AY8A 1I5GA 1O8WA 1ZYNA 1A2MA 1Z5YE 2L4QA 1M99A 4MABA 3QAGA 5B8BA 3C7MA 4CDOA 3ZLPA 3KM6A 1XZOA 3ED3A 4K5SA 4O5UA 4DSQA 2H8LA 3ZIJA 4KB3A 3U5RE 5CAXA 2VCXA 4PUAA 1Z9HA 3EINA 4JRRA 3W6GA 1SKWB 1LBKA 3Q19A 4POMA 5HR0A 4YH2A 1PKWA 4KE3A 4FXYP 4V2MA 1H4OA 2B5YA 5CO3A 3D4MA 1ERTA 2IIYA 1TTZA 1BF5A 3GTUB 2A2RA 4OFTA 5KN1A 1HNCA 1M7TA 4TRXA 5FT3A 1WPIA 4BVXA 1WE0A 1TU7A 5EY6A 4L5LA 1VRSD 1W89A 1ERUA 1JZOA 1YF0A 2H0HA 3ZRDA 4K7NA 2AYTA 2WDUA 1JZWA 2H0IA 1XW6A 2DC5A 3ZFLA 3IV4A 4G9HA 3GMFA 3KH7A 4K1FA 4MH3A 3QDNA 1WP0A 2JSYA 3TJJA 4AKXB 2HRNA 3ZITA 1MTCA 3KTLA 1B48A 3GN3A 4O92A 4WBJA 2VKZG 2X8GA 5F07A 3KEBA 6GSTA 5A34A 1XWBA 3DIEA 2DJ0A 3QPMA 4N11A 1B8XA 4JR6A 4LL4B 1ML6A 2E2MA 4NMUA 5IOWA 5J4UA 3TJFA 5EL8A 3GKKA 3IA1A 2B5EA 3TB2A 3P90A 4X4JA 5D9WA 2C0DA 3FK8A 5AN1A 5ELGA 4LL1B 3J7Yk 2G2QA 5HFKA 2K9FA 4IKHA 5BMUA 4KCEA 5EPFA 4I6XA 2V2GA 4O5QA 2FA8A 4NHWA 4KH7A 4L5OA 1X9WB 4Q5NA 3TOUA 5AIVA 1UC7A 2GTUA 2XPDA 2LJKA 2VL9A 1A0FA 1VGLA 2HZEA 1YEXA 2MMAA 1K3YA 4XHMA 1XG8A 4FYBA 1OKDA 3D4TA 5KOXA 5GSTA 4PNFA 5KN3A 4YQVA 5CRDA 1YEPA 3UBLA 3HA9A 4OO4A 3WT1A 4AKHA 2V32A 1BG1A 1F37A 1O6JA 5G5FA 4AI6A 1DUGA 1GWCA 1R4WA 2R0CA 4TOPA 2VD0A 2H1LA 4PQIA 4MF5A 2C8UA 2CZ2A 2WZSA 2RIIA 3F6FA 3L0HA 3TKSA 5ID2A 5HFGA 4ZL8A 2XC2A 4ZILA 5G1KA 4ZBDA 2YCDA 4BVXB 5A5KA 3HJMA 2ON5A 1JHBA 3EVIA 1GH2A 4DVCA 3EYTA 1TP9A 4G0IA 2GQMA 4MPGA 3DVXA 1EOHA 2CVBA 4XS1A 4TR1A 2LV3A 2WVYA 1CQGA 2DLXA 2ON7A 3IHGA 2MMOA 1THXA 4ML6A 4KDXA 4TW5A 3IDVA 3RFRC 3L4NA 4J56E 1ZMAA 1GSDA 3BCKA 3VWXA 4FYUA 1YEWC 5H5SA 2L6CA 2TRXA 4AKIA 1GTBA 1NM3A 2FGXA 2K8SA 5ECMB 1XXUA 5C00A 6GSVA 1V57A 5DALA 3H93A 2OT3A 5G5EA 1M2AA 4ZB7A 1MDKA 3Q18A 4OCEA 3KCMA 5A4UA 3L9SA 4GLTA 4K5RA 2VO4A 1YZXA 1RW1A 5A4WA 4KDUA 4KA0A 3BJ5A 4USSA 2Z9SA 4F0BA 2EFEA 11GSA 2IMDA 3Q6OA 3GV1A 4N0ZA 4DSSA 3RHCA 4IQ1A 5LNKe 3EPTA 1EOGA 3I69A 4KAEA 3G7JA 2BTOT 2RM5A 3BOAA 1M0UA 2EFHA 3IR4A 1SD9A 4HDEA 3DYRA 4WR5A 2C0FA 3KIJA 1SVLA 5H5QA 3R2QA 2OBIA 3DVWA 2HZEB 2R3XA 4F82A 2B6MA 1G7EA 1F6MC 1AXDA 5B7CA 3K8NA 1ZGNA 3ME8A 4KCAA 4J57E 3ZTLA 5IO2A 1EGOA 1SU9A 2YN1A 1JLWA 2VAFA 1S3AA 3GNJA 1TKDB 3GFKA 2MBTA 3CMIA 2KHPA 2DKHA 3RAZA 3MNGA 2DJ2A 5DDLA 1XWAA 3ERGA 2WCIA 4MJBA 1O85A 3ERWA 2CAIA 2B3SA 2B5XA 1J08A 1WIKA 1TW9A 3F63A 2YV9A 5BRTA 1XFLA 3HZ8A 1OE7A 1O81A 2YV7A 5E59A 1AQWA 3CYNA 4IW9A 3UBKA 3NIVA 2WVXB 1K3OA 2NPBA 3HVNA 1SENA 3GSSA 2ZCTA 2PERA 1O7UA 3TU3B 3L78A 2R4VA 3ZMKA 1GLQA 4BL7A 4EUYA 4ECJA 4TR1B 4O32A 1ZL9A 1UN2A 3TKRA 4ECBA 3HDCA 2AHEA 4AJ8A 2J23A 2HSYA 1C72A 2F8FA 3M9JA 5DJMA 3BD2A 4HU9A 1T4ZA 3G7IA 1EWXA 3GX0A 2I9HA 5ECOB 4I2TA 1V9WA 2HSNB 4RUVA 2QSIA 2OJLA 17GSA 3GYKA 2NTOA 4PI2C 2YNXA 1MDIA 4HU7A 5DBQA 2E0QA 2AB6A 2GVPA 2C0EA 3I43A 4HQSA 1T4YA 4EC0A 4N10A 2OE3A 1TRVA 4LLRA 3IC8A 2GSQA 4MF6A 5HR2A 4DSSB 4I8BA 5JCGA 1WWJA 1FOVA 2JZSA 3HJOA 5D93A 1M9BA 5IO0A 1M3JA 3DEXA 5FWGA 2YJ7A 2OA7A 4X0XA 1JZDA 2ES7A 4WF4A 3ZVJA 3FKFA 4N30A 3I9V2 3A5IA 5IPHA 1B9YC 2H1GA 1PMTA 3VWVA 4K7IA 2OADA 3ZZXA 5IMFA 5JWOB 1JFUA 2WFCA 2A2SA 2VD1A 2L5OA 2O7KA 1ST9A 3FZAA 3TGZA 1M3IA 3GKNA 4Q5QA 2LUSA 3FHKA 5AIXA 2DBCA 4QMKA 2VCZA 2X8CA 2FA4A 1OC8A 5ECSA 1TU8A 3APQA 1SJZA 2I3YA 4EE0A 1NHOA 1HD2A 1XVWA 3GRXA 1T8EB 3UVTA 3CBUA 4EO3A 13GSA 4K0NA 4POBA 2AJQB 4K8MA 1QXHA 1ZYQB 1E2YA 1PN0A 4RI6A 3EURA 5A5HA 2OACA 4FO5A 1V58A 2ALBA 3GKMA 1MDJA 3LWAA 5JWRB 2YWIA 2EIOA 1M9AA 1TDIA 1BQ7A 1GP1A 1F3AA 5F0GA 4BL7B 8GSSA 2FHEA 3ME7A 5ECPB 1TI3A 3EMXA 4DSRA 4QL7A 3QAWA 1SJIA 2R2JA 2N5BA 3GL5A 4QL9A 4PGTA 4GSTA 1RQMA 2H6YA 2BMXA 2PBJA 3F8UA 3IRAA 3DRNA 4JEDA 1PL2A 4ZXGA 4ECIA 3ZYWA 3LEFA 4E8HA 1QMVA 3RBTA 4K0GA 2HRFA 5D9VA 3E3EA 1R26A 1GULA 5JCWA 1GSQA 3MSZA 5CRWA 2M46A 4EIPA 3FMWA 1A8LA 1OKTA 5G2ZA 3ZMLA 2LRNA 3E0UA 3V1WA 1PA3A 4IP1A 3LYPA 4Z2UA 2LJRA 3MDKA 2A2PA 4AGSA 5F06A 1EZKA 3HXSA 2VL3A 3F3QA 2O87A 4FIWA 3TUEA 3H1NA 2OKAA 5D96A 2K8VA 3DGQA 3TCOA 2B7KA 4NAXA 4JE1A 4ZB6A 3GA4A 1AAZA 1SL2B 1H75A 1K0OA 3CRUA 1BYEA 4MH2A 3ERFA 1DBYA 3P8WA 2NVLA 4MZCA 4ZIJA 2GT6A 4EXJA 1K0MA 3TRPA 2YWNA 1GSUA 1Y25A 2HE3A 4IVFA 4JBBA 2LSTA 2P5QA 3L9VA 2OBKA 1ZYPA 3HVXA 1SVMA 3QMXA 2O8VB 1TK5B 3ZREA 3APSA 3FRCA 2WW2A 2EIRA 4POKA 1OE8A 4MF7A 5J9BA 4L8EA 3U6VA 1FVKA 2QA2A 3TJGA 4ZB8A 5CRGA 1G6YA 2X8HA 3M1GA 2KLXA 3C1SA 3GL3A 5KN0A 3TKSC 1XWKA 4AF2A 2LRTA 2AAWA 2H1AA 2LQQA 4TR0A 1QFNA 1GRXA 2O3EA 19GSA 5ECQB 3HJPA 4MJCA 1BAYA 4OFNA 4ILFA 2ZNMA 4KSMA 2H73A 3IBHA 5A5HB 4KW6A 1NSWA 4FYCA 4KUNA 3VFIA 7GSSA 2LNSA 3LXZA 5L71A 4GF0A 2O85A 4BPYA 1AW9A 1XPVA 3ZFBA 4TXOB 5J4YA 2P0GA 4IGJA 6GSSA 3KMNA 1HQOA 2V6KA 5DAKA 2GZYA 4N0VA 1URMA 3H79A 1A0RP 1A2LA 1ERWA 2JL4A 1B9XC 2VIMA 4I2UA 1K0CA 2R0GA 4IS0A 4XS6A 3HHVA 4ECCA 2PPTA 2KP2A 1Y1UA 1N2AA 5D9XA 2HSHA 4EIQA 4OO5A 3FYGA 4HUAA 3KMOA 4PURA 5IMDA 5IIZA 3UAPA 4V1Ag 1GUHA 4WR4A 3QD9A 1R5PA 4EVMA 2HRKB 4YAVA 4XTSA 3FZ4A 2R0PA 5LD0A 1PSQA 1U3IA 5J9CA 3M3MA 3TDGA 4XRDA 5J3RA 2GDRA 4Q5RA 3C8EA 2WVXA 1BJXA 1EEMA 1Q98A 1SKRB 3HD5A 3RPNA 1T00A 1J0FA 2F9SA 12GSA 2GSRA 1XWGA 2QGVA 3QR6A 4XRAA 3QFAC 3TJBA 1A2JA 2VOCA 5GSSA 1ILOA 5ELAA 2IMFA 3EMPA 3HZ4A 1SK1A 1W4VA 2MZCA 1V98A 4ML1A 3F9UA 2FWFA 1SK2A 2R37A 2XBIA 4GQFA 4WEYA 1PKZA 10GSA 3M0FA 1G7OA 1YKAA 4K2XA 5FHIA 1YQ1A 2RLIA 1USBA 2WVZA 4D73B 5DJLA 5KN2A 2B1KA 5J41A 4Z2TA 2HSNA 1YJ6A 2P5RA 3VLNA 2NDOA 1XBSA 3PINA 4DEJA 4JR4A 4GSNA 1IYIA 2F3MA 1GTIA 2YPMA 3F3RA 5IMCA 3ZIVA 2C3TA 1GL8A 2PWJA 1HNAA 2IWTA 2RUEA 2X64A 1HYUA 1SK0A 4I5QA 1CQHA 1THOA 1TOFA 4KX4A 2OE1A 3F4TA 3GIXA 1PX6A 2YZHA 2H66A 2H74A 1SVOA 2VCQA 4G19A 2WW1A 3GKXA 1XOBA 2K18A 4OMVA 2FLSA 4WBRD 4YAPA 5DCGA 3RHBA 5J47A 1Z6NA 5DAKB 5AISA 5B8AA 1TJDA 3ZL5A 4ID0A 4MJEA 1GSEA 2GLRA 3ISOA 1V40A 2LJAA 4KNDA 1T3BA 1NHYA 2R5GA 1FW1A 1KTEA 1GNEA 4ZBBA 4AKGA 3LORA 16GSA 4IJIA 3VWUA 1G6WA 1K0AA 2VCVA 1TI1A 1OYJA 4PHZC 4K9ZA 1TRWA 1BEDA 5DCHA 3KD0A 3QCPA 4MMMA 2B1LA 3OR5A 4MCUA 4V2LA 2FY6A 2VUPA 2WS2A 3CSJA 2DJ1A 2DKIA 3VPTA 1AC1A 4J2FA 5D8IA 1BX9A 3IE3A 3APOA 5DQYA 2C0GA 1EGRA 3DXBA 3MWHA 4G10A 1A24A 2HSMB 1XW5A 3IK9A 4BWQA 1F9MA 2FUG2 2CVDA 3HVVA 3IOSA 3WT2A 2R6KA 4CY8A 4GWRA 2IL3A 3FR6A 5J5NA 2F51A 5CREA 1Q4JA 2HQTA 3CTFA 4GXZA 3KP9A 2IJYA 1OC3A 1OVNA 3GHAA 2NBSA 1N8JA 4I97A 5KOWA 2WW0A 3RDWA 2VCWA 2H76A 5COHA 1ON4A 3PGTA 5F05A 2KP1A 3D21A 5LCZA 4IN0A 1ZCPA 5B6NA 2CZ3A 1I9DA 3WGDA 1MD4A 4PUFC 4LMWA 2VCTA 2L4CA 4GCIA 3O6TA 4POLA 4FH8A 1DE1A 2TRCP 1E6BA 1OC9B 4BA7A 4JZQA 1EEJA 3KP8A 4CHSA 4Z2RA 2WGRA 4MP4A 2O89A 1TK0B 3H8QA 2MYGA 3FR3A 2I4AA 3G9BA 2JSZA 4IJ3A 2N5FA 4CW9A 2RUFA 2PVOC
chains in the Genus database with same CATH topology
2TIRA 6GSXA 2HNLA 4MZBA 4PXOA 2IMKA 4OWYA 5DVBA 2LKUA 1AUCA 3KXOA 3EU3A 5A4VA 1QQ2A 2HYXA 1EV4A 5CYYA 1UA5A 5ECLB 3KH9A 4BVYB 4GRFA 3VURA 2XPEA 1GSSA 1PQNA 2GQLA 1XCCA 2H6ZA 5H5RA 4TKYA 3IPZA 1EP8A 4IHUA 4MJAA 5G31A 1ZZYA 4GSSA 2V1MA 5GAND 4RI7A 2DSAA 2LTKA 1DSBA 4TN8A 2GT5A 1SJ6A 1GSFA 4EKZA 1KBNA 5ABRA 2CA8A 3CWGA 3HYPA 1SKSB 2MBSA 4X43A 5J4VA 4F2IA 3FR9A 4F9ZA 3N5OA 4Q5FA 4E68A 3FZ5A 3UIWA 2B7JA 2QA1A 1QK8A 4HZ4A 2IMIA 5IM9A 3NZNA 4O7HA 2H1BA 4TXOA 2IPAA 3UJ1A 5IOXA 4HJ2A 4PQ1A 4K7OA 3P2AA 3FY7A 22GSA 3LXTA 4WETA 3WGEA 4GDFA 4K2DA 4YQUA 2VM2A 3TRXA 1KEBA 2DIZA 2FWHA 2DJKA 3CXGA 3HY2A 5KEJA 1TXXA 3EC3A 2I81A 2AUVA 2X4AA 2HFDA 4KGIA 1PD21 4JU5A 1AQXA 3A2WA 1RK4A 1O73A 1R7HA 3A3TA 5F8BA 2VLTA 3MYDA 2WZ9A 1XWCA 3TKQA 2LNTA 3LGCA 4KSOA 3HVSA 3IHQA 1K0DA 2BJXA 1IYHA 1F3BA 3R3EA 2H1DA 2HRKA 3KZQA 4K6XA 2WULA 2YJHA 1Z3EA 3I6AA 2I1UA 2KOKA 3KTBA 4L0UA 2H72A 2N5AA 5ECHB 2HI7A 2JZRA 4KF9A 4EF0A 2FD3A 3GX8A 1U88A 2REMA 3IC4A 1U3AA 1OAZA 5HFIA 3G7YA 4IQAA 4HS1A 5B6MA 1QUWA 3RPPA 3EWLA 5HR3A 3TKPA 4D73A 4G0KA 2JACA 4LA1A 2EFDA 3IK7A 4GTUA 2VLVA 1A23A 4V1Ap 4HZ2A 2PVQA 2UV8G 4WXTA 3TRQA 2WRTA 3F0IA 1YDKA 1X9MB 2C1YA 4ICYA 3UOMA 4HEA2 1R5AA 2AV4A 1SD8A 3VK9A 4F03A 1YVLA 5D9TA 2PUKC 4F0CA 2DMLA 4XS4B 2VL2C 3L9UA 1T7PB 5GAPD 2YANA 1X0RA 3WD6A 1K3LA 4WKWA 1DE2A 1LU4A 1UVZA 1ERVA 4P3YB 2VLUA 5GZZB 2H75A 2X99A 2A4HA 2EC4A 1XVQA 2X49A 3GH9A 2M80A 2YOIA 2C3NA 3TKSE 3F4RA 5JWQB 2IMEA 2LEGA 1M2DA 5G30A 1U87A 2YWOA 3D22A 1X5DA 3D6IA 1FB6A 1GUMA 2A4VA 2VM1A 2IFQA 1GTUA 4BWSA 2DIYA 3DKSA 2GQKA 4MA9A 2EFCA 1AQVA 1YF1A 2ZUPA 2CVKA 1GSYA 1ACVA 5IMVA 5ECNB 3GH6A 4MNNA 2EIQA 4OD7A 4IELA 2VL2A 5HR1A 5J40A 1U6TA 2IN3A 4ZL9A 1Z7RA 3NOFA 4W66A 5ECKB 1WRYA 1MD3A 2D2ZA 1ZYEA 4NPBA 3C1RA 1TRUA 3KGKA 3TOTA 1SL1B 6GSYA 2E2GA 4GQCA 4AJ6A 3M8NA 3LFLA 3PH9A 4RQRA 3UEMA 2HSMA 1NW2A 2YWMA 1FVJA 1WMJA 4MK3A 2CX3A 2LQOA 3J7Yb 1YY7A 5A1NA 1XIYA 1M2BA 2FWGA 2DJJA 2FCHA 3A2VA 3TJKA 1S3DA 4IP6A 1HNBA 2PU9C 3DD3A 4YKFA 4NWYA 4MZWA 2HLSA 2CQ9A 2E7PA 4PX1A 1PRXA 4G2EA 3QOUA 4TR3A 1PN9A 1V2AA 3UL3A 3HKRA 5A34B 4EDYA 5CRHA 1F2EA 4LMVA 1GUKA 2WJUA 1GNWA 1B4QA 1OC9A 5ECRB 3VI5A 2J9HA 5AGYA 4TR4A 4E8EA 4YQMA 1PGTA 5INYA 1XW9A 3DWVA 4XIHA 2MMZA 3F4SA 5IMZA 3F6DA 5BMUB 3UVHA 3WYWA 1LJRA 3LSZA 2H30A 4NV2A 3WGXA 1PL1A 2L57A 3ZVJD 1JZRA 1N25A 2FNOA 4HJMA 5D73A 3VPQA 1WOUA 1ZOFA 1J9BA 2PGTA 1WJKA 1A8YA 3M9KA 1X9SB 9GSSA 1FAAA 1T1VA 3SWLA 4N3ZA 4EDZA 1VF2A 5IPGA 3D5JA 3LJRA 3DMLA 1VF1A 1AIUA 4BVYA 2JADA 2IFQB 2C4JA 1K0NA 6GSUA 1YKCA 3W8JA 2G0FA 4NXIA 2MMNA 1BG5A 3FW2A 1Z6MA 3HCZA 3UARA 3US3A 2C80A 1S3CA 5CP1A 2GSSA 3S9FA 4V2NA 4QQ7A 1KNGA 4EL1A 4ZL7A 3BBYA 3KJYA 4O5RA 2P31A 2GZPA 3CRTA 3SBCA 5DQSA 1FO5A 3GSTA 3HMJG 1XOAA 2LS5A 4AJ7A 2V6OA 1FOHA 2PN8A 1O8XA 2FWEA 1FB0A 5IMAA 2XHFA 3W8SA 4WF5A 2KUCA 5ID2B 1TK8B 2WB9A 3LQ7A 2HXKA 1FHEA 2F8AA 14GSA 4MDCA 3EU4A 3EE2A 2H01A 3MAKA 4RQXA 5G1LA 4XCSA 5A1NB 4PNGA 2GGTA 3LYKA 3FZ9A 2RM6A 2XBQA 2H0GA 1TRSA 2H19A 5ENUA 3Q74A 1MEKA 2QC7A 1ABAA 3A5WA 4NHZA 2H71A 1TXUA 1PX7A 2M72A 5C04A 4H86A 4CY6A 4G0LA 4HI7A 1X5EA 4PTSA 2CX4A 6GSWA 1SYXA 3CSHA 3FEUA 4OCFA 1G0TA 2HZFA 4PQHA 2CV4A 4NV5A 5DALB 3C71A 4L0WA 2LRCA 1SL0B 2YZUA 20GSA 2L5LA 3P7XA 3D0ZA 3GTUA 2GZZA 2JZTA 3IAS2 2PMTA 3A2XA 1B4PA 3IXRA 4IBPA 4OFMA 1GLPA 2HRAA 4ZBAA 3C73A 3MIXA 3VWWA 2OE0A 4TVEA 3PPUA 4A5PA 5E4WA 18GSA 5ECIB 2H6XA 2UZ8A 4TXVA 3N9JA 3GUSA 1VF4A 5JCUA 1QGVA 2GS3A 2L59A 2O5VA 3GURA 2CAQA 5IQYA 2QKEA 1EP7A 4MLYA 5CNWA 3H4KA 3IAM2 3CTGA 1X5CA 1EV9A 4FQUA 3PR8A 2C3QA 2K6VA 2V41A 2YP6A 4XS4A 1K0BA 5HQPA 3VI7A 1Y6EA 3CSIA 2DJ3A 2DMMA 4G01A 3QFBC 4KDYA 4HOJA 3LW9A 4YKGA 1VF3A 1GTAA 2H70A 3E9JB 1SYRA 3LG6A 4ACSA 3O76A 3QAVA 3BCIA 2GSTA 4ZB9A 3UMAA 4Z7XA 2JU5A 1JLVA 4MPFA 4X1UA 5EVOA 2CT6A 2HT9A 4HQZA 3O3TA 1FG4A 4ISDA 4ULXA 1Z7PA 3JCML 2L6DA 3AY8A 1I5GA 1O8WA 1ZYNA 1A2MA 1Z5YE 2L4QA 1M99A 4MABA 3QAGA 5B8BA 3C7MA 4CDOA 3ZLPA 3KM6A 1XZOA 3ED3A 4K5SA 4O5UA 4DSQA 2H8LA 3ZIJA 4KB3A 3U5RE 5CAXA 2VCXA 4PUAA 1Z9HA 3EINA 4JRRA 3W6GA 1SKWB 1LBKA 3Q19A 4POMA 5HR0A 4YH2A 1PKWA 4KE3A 4V2MA 1H4OA 2B5YA 5CO3A 3D4MA 1ERTA 2IIYA 1TTZA 1BF5A 3GTUB 2A2RA 4OFTA 5KN1A 1HNCA 1M7TA 4TRXA 5FT3A 1WPIA 4BVXA 1WE0A 1TU7A 5EY6A 4L5LA 1VRSD 1W89A 1ERUA 1JZOA 1YF0A 2H0HA 3ZRDA 4K7NA 2AYTA 2WDUA 1JZWA 2H0IA 1XW6A 2DC5A 3ZFLA 3IV4A 4G9HA 3GMFA 3KH7A 4K1FA 4MH3A 3QDNA 1WP0A 2JSYA 3TJJA 4AKXB 2HRNA 3ZITA 1MTCA 3KTLA 1B48A 3GN3A 4O92A 4WBJA 2VKZG 2X8GA 5F07A 3KEBA 6GSTA 5A34A 1XWBA 3DIEA 2DJ0A 3QPMA 4N11A 1B8XA 4JR6A 4LL4B 1ML6A 2E2MA 4NMUA 5IOWA 5J4UA 3TJFA 5EL8A 3GKKA 3IA1A 2B5EA 3TB2A 3P90A 4X4JA 5D9WA 2C0DA 3FK8A 5AN1A 5ELGA 4LL1B 3J7Yk 2G2QA 5HFKA 2K9FA 4IKHA 5BMUA 4KCEA 5EPFA 4I6XA 2V2GA 4O5QA 2FA8A 4NHWA 4KH7A 4L5OA 1X9WB 4Q5NA 3TOUA 5AIVA 1UC7A 2GTUA 2XPDA 2LJKA 2VL9A 1A0FA 1VGLA 2HZEA 1YEXA 2MMAA 1K3YA 4XHMA 4FYBA 1OKDA 3D4TA 5KOXA 5GSTA 4PNFA 5KN3A 4YQVA 5CRDA 1YEPA 3UBLA 3HA9A 4OO4A 3WT1A 4AKHA 2V32A 1BG1A 1F37A 1O6JA 5G5FA 4AI6A 1DUGA 1GWCA 1R4WA 2R0CA 4TOPA 2VD0A 2H1LA 4PQIA 4MF5A 2C8UA 2CZ2A 2RIIA 3F6FA 3L0HA 3TKSA 5ID2A 5HFGA 4ZL8A 2XC2A 4ZILA 5G1KA 4ZBDA 2YCDA 4BVXB 5A5KA 3HJMA 2ON5A 1JHBA 3EVIA 1GH2A 4DVCA 3EYTA 1TP9A 4G0IA 2GQMA 4MPGA 3DVXA 1EOHA 2CVBA 4XS1A 4TR1A 2LV3A 1CQGA 2DLXA 2ON7A 3IHGA 2MMOA 1THXA 4ML6A 4KDXA 4TW5A 3IDVA 3L4NA 4J56E 1ZMAA 1GSDA 3BCKA 3VWXA 4FYUA 5H5SA 2L6CA 2TRXA 4AKIA 1GTBA 1NM3A 2FGXA 2K8SA 5ECMB 1XXUA 5C00A 6GSVA 1V57A 5DALA 3H93A 2OT3A 5G5EA 1M2AA 4ZB7A 1MDKA 3Q18A 4OCEA 3KCMA 5A4UA 3L9SA 4GLTA 4K5RA 2VO4A 1YZXA 1RW1A 5A4WA 4KDUA 4KA0A 3BJ5A 4USSA 2Z9SA 4F0BA 2EFEA 11GSA 2IMDA 3Q6OA 3GV1A 4N0ZA 4DSSA 3RHCA 4IQ1A 5LNKe 3EPTA 1EOGA 3I69A 4KAEA 3G7JA 2BTOT 2RM5A 3BOAA 1M0UA 2EFHA 3IR4A 1SD9A 4HDEA 3DYRA 4WR5A 2C0FA 3KIJA 1SVLA 5H5QA 3R2QA 2OBIA 3DVWA 2HZEB 2R3XA 4F82A 2B6MA 1G7EA 1F6MC 1AXDA 5B7CA 3K8NA 1ZGNA 3ME8A 4KCAA 4J57E 3ZTLA 5IO2A 1EGOA 1SU9A 2YN1A 1JLWA 2VAFA 1S3AA 3GNJA 1TKDB 3GFKA 2MBTA 3CMIA 2KHPA 2DKHA 3RAZA 3MNGA 2DJ2A 5DDLA 1XWAA 3ERGA 2WCIA 4MJBA 1O85A 3ERWA 2CAIA 2B3SA 2B5XA 1J08A 1WIKA 1TW9A 3F63A 2YV9A 5BRTA 1XFLA 3HZ8A 1OE7A 1O81A 2YV7A 5E59A 1AQWA 4IW9A 3UBKA 3CYNA 3NIVA 1K3OA 2NPBA 1SENA 3GSSA 2ZCTA 2PERA 1O7UA 3TU3B 3L78A 2R4VA 3ZMKA 1GLQA 4BL7A 4EUYA 4ECJA 4TR1B 4O32A 1ZL9A 1UN2A 3TKRA 4ECBA 3HDCA 2AHEA 4AJ8A 2J23A 2HSYA 1C72A 2F8FA 3M9JA 5DJMA 3BD2A 4HU9A 1T4ZA 3G7IA 1EWXA 3GX0A 2I9HA 5ECOB 4I2TA 1V9WA 2HSNB 4RUVA 2QSIA 2OJLA 17GSA 3GYKA 2NTOA 2YNXA 1MDIA 4HU7A 5DBQA 2E0QA 2AB6A 2GVPA 2C0EA 3I43A 4HQSA 1T4YA 4EC0A 4N10A 2OE3A 1TRVA 4LLRA 3IC8A 2GSQA 4MF6A 5HR2A 4DSSB 4I8BA 5JCGA 1WWJA 1FOVA 2JZSA 3HJOA 5D93A 1M9BA 5IO0A 3DEXA 5FWGA 2YJ7A 2OA7A 4X0XA 1JZDA 2ES7A 4WF4A 3ZVJA 3FKFA 4N30A 3I9V2 3A5IA 5IPHA 1B9YC 2H1GA 1PMTA 3VWVA 4K7IA 2OADA 3ZZXA 5IMFA 5JWOB 1JFUA 2WFCA 2A2SA 2VD1A 2L5OA 2O7KA 1ST9A 3FZAA 3TGZA 3GKNA 4Q5QA 2LUSA 3FHKA 5AIXA 2DBCA 4QMKA 2VCZA 2X8CA 2FA4A 1OC8A 5ECSA 1TU8A 3APQA 1SJZA 2I3YA 4EE0A 1NHOA 1HD2A 1XVWA 3GRXA 1T8EB 3UVTA 3CBUA 4EO3A 13GSA 4K0NA 4POBA 2AJQB 4K8MA 1QXHA 1ZYQB 1E2YA 1PN0A 4RI6A 3EURA 5A5HA 2OACA 4FO5A 1V58A 2ALBA 3GKMA 1MDJA 3LWAA 5JWRB 2YWIA 2EIOA 1M9AA 1TDIA 1BQ7A 1GP1A 1F3AA 5F0GA 4BL7B 8GSSA 2FHEA 3ME7A 5ECPB 1TI3A 3EMXA 4DSRA 4QL7A 3QAWA 1SJIA 2R2JA 2N5BA 3GL5A 4QL9A 4PGTA 4GSTA 1RQMA 2H6YA 2BMXA 2PBJA 3F8UA 3IRAA 3DRNA 4JEDA 1PL2A 4ZXGA 4ECIA 3ZYWA 3LEFA 4E8HA 1QMVA 3RBTA 4K0GA 2HRFA 5D9VA 3E3EA 1R26A 1GULA 5JCWA 1GSQA 3MSZA 5CRWA 2M46A 4EIPA 3FMWA 1A8LA 1OKTA 5G2ZA 3ZMLA 2LRNA 3E0UA 3V1WA 1PA3A 4IP1A 3LYPA 4Z2UA 2LJRA 3MDKA 2A2PA 4AGSA 5F06A 1EZKA 3HXSA 2VL3A 3F3QA 2O87A 4FIWA 3TUEA 3H1NA 2OKAA 5D96A 2K8VA 3DGQA 3TCOA 2B7KA 4NAXA 4JE1A 4ZB6A 3GA4A 1AAZA 1SL2B 1H75A 1K0OA 3CRUA 1BYEA 4MH2A 3ERFA 1DBYA 3P8WA 2NVLA 4MZCA 4ZIJA 2GT6A 4EXJA 1K0MA 3TRPA 2YWNA 1GSUA 1Y25A 2HE3A 4IVFA 4JBBA 2LSTA 2P5QA 3L9VA 2OBKA 1ZYPA 3HVXA 1SVMA 3QMXA 2O8VB 1TK5B 3ZREA 3APSA 3FRCA 2EIRA 4POKA 1OE8A 4MF7A 5J9BA 4L8EA 3U6VA 1FVKA 2QA2A 3TJGA 4ZB8A 5CRGA 1G6YA 2X8HA 3M1GA 2KLXA 3C1SA 3GL3A 5KN0A 3TKSC 1XWKA 4AF2A 2LRTA 2AAWA 2H1AA 2LQQA 4TR0A 1QFNA 1GRXA 19GSA 5ECQB 3HJPA 4MJCA 1BAYA 4OFNA 4ILFA 2ZNMA 4KSMA 2H73A 3IBHA 5A5HB 4KW6A 1NSWA 4FYCA 4KUNA 3VFIA 7GSSA 2LNSA 3LXZA 5L71A 4GF0A 2O85A 4BPYA 1AW9A 1XPVA 3ZFBA 4TXOB 5J4YA 2P0GA 4IGJA 6GSSA 3KMNA 1HQOA 2V6KA 5DAKA 2GZYA 4N0VA 1URMA 3H79A 1A0RP 1A2LA 1ERWA 2JL4A 1B9XC 2VIMA 4I2UA 1K0CA 2R0GA 4IS0A 4XS6A 3HHVA 4ECCA 2PPTA 2KP2A 1Y1UA 1N2AA 5D9XA 2HSHA 4EIQA 4OO5A 3FYGA 4HUAA 3KMOA 4PURA 5IMDA 5IIZA 3UAPA 4V1Ag 1GUHA 4WR4A 3QD9A 1R5PA 4EVMA 2HRKB 4YAVA 4XTSA 3FZ4A 2R0PA 5LD0A 1PSQA 1U3IA 5J9CA 3M3MA 3TDGA 4XRDA 5J3RA 2GDRA 4Q5RA 3C8EA 1BJXA 1EEMA 1Q98A 1SKRB 3HD5A 3RPNA 1T00A 1J0FA 2F9SA 12GSA 2GSRA 1XWGA 2QGVA 3QR6A 4XRAA 3QFAC 3TJBA 1A2JA 2VOCA 5GSSA 1ILOA 5ELAA 2IMFA 3EMPA 3HZ4A 1SK1A 1W4VA 2MZCA 1V98A 4ML1A 3F9UA 2FWFA 1SK2A 2R37A 2XBIA 4GQFA 4WEYA 1PKZA 10GSA 3M0FA 1G7OA 1YKAA 4K2XA 5FHIA 1YQ1A 2RLIA 1USBA 4D73B 5DJLA 5KN2A 2B1KA 5J41A 4Z2TA 2HSNA 1YJ6A 2P5RA 3VLNA 2NDOA 1XBSA 3PINA 4DEJA 4JR4A 4GSNA 1IYIA 2F3MA 1GTIA 2YPMA 3F3RA 5IMCA 3ZIVA 2C3TA 1GL8A 2PWJA 1HNAA 2IWTA 2RUEA 2X64A 1HYUA 1SK0A 4I5QA 1CQHA 1THOA 1TOFA 4KX4A 2OE1A 3F4TA 3GIXA 1PX6A 2YZHA 2H66A 2H74A 1SVOA 2VCQA 4G19A 3GKXA 1XOBA 2K18A 4OMVA 2FLSA 4WBRD 4YAPA 5DCGA 3RHBA 5J47A 1Z6NA 5DAKB 5AISA 5B8AA 1TJDA 3ZL5A 4ID0A 4MJEA 1GSEA 2GLRA 3ISOA 1V40A 2LJAA 4KNDA 1T3BA 1NHYA 2R5GA 1FW1A 1KTEA 1GNEA 4ZBBA 4AKGA 3LORA 16GSA 4IJIA 3VWUA 1G6WA 1K0AA 2VCVA 1TI1A 1OYJA 4K9ZA 1TRWA 1BEDA 5DCHA 3KD0A 3QCPA 4MMMA 2B1LA 3OR5A 4MCUA 4V2LA 2FY6A 2VUPA 2WS2A 3CSJA 2DJ1A 2DKIA 3VPTA 1AC1A 4J2FA 5D8IA 1BX9A 3IE3A 3APOA 5DQYA 2C0GA 1EGRA 3DXBA 3MWHA 4G10A 1A24A 2HSMB 1XW5A 3IK9A 4BWQA 1F9MA 2FUG2 2CVDA 3HVVA 3IOSA 3WT2A 2R6KA 4CY8A 4GWRA 2IL3A 3FR6A 5J5NA 2F51A 5CREA 1Q4JA 2HQTA 3CTFA 4GXZA 3KP9A 2IJYA 1OC3A 1OVNA 3GHAA 2NBSA 1N8JA 4I97A 5KOWA 3RDWA 2VCWA 2H76A 5COHA 1ON4A 3PGTA 5F05A 2KP1A 3D21A 5LCZA 4IN0A 1ZCPA 5B6NA 2CZ3A 1I9DA 3WGDA 1MD4A 4PUFC 4LMWA 2VCTA 2L4CA 4GCIA 3O6TA 4POLA 4FH8A 1DE1A 2TRCP 1E6BA 1OC9B 4BA7A 4JZQA 1EEJA 3KP8A 4CHSA 4Z2RA 2WGRA 4MP4A 2O89A 1TK0B 3H8QA 2MYGA 3FR3A 2I4AA 3G9BA 2JSZA 4IJ3A 2N5FA 4CW9A 2RUFA 2PVOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TIR A;  6GSX A;  2HNL A;  4MZB A;  4PXO A;  2IMK A;  4OWY A;  5DVB A;  2LKU A;  1AUC A;  3KXO A;  3EU3 A;  5A4V A;  1QQ2 A;  2HYX A;  1EV4 A;  5CYY A;  1UA5 A;  5ECL B;  3KH9 A;  4BVY B;  4GRF A;  3VUR A;  2XPE A;  1GSS A;  1PQN A;  2GQL A;  1XCC A;  2H6Z A;  5H5R A;  4TKY A;  3IPZ A;  1EP8 A;  4IHU A;  4MJA A;  5G31 A;  1ZZY A;  4GSS A;  2V1M A;  5GAN D;  4RI7 A;  2DSA A;  2LTK A;  1DSB A;  4TN8 A;  2GT5 A;  1SJ6 A;  1GSF A;  4EKZ A;  1KBN A;  5ABR A;  2CA8 A;  3HYP A;  1SKS B;  2MBS A;  4X43 A;  4F2I A;  3FR9 A;  4F9Z A;  3N5O A;  4Q5F A;  3FZ5 A;  3UIW A;  2B7J A;  1QK8 A;  4HZ4 A;  2IMI A;  5IM9 A;  3NZN A;  4O7H A;  2H1B A;  4TXO A;  2IPA A;  3UJ1 A;  5IOX A;  4HJ2 A;  4PQ1 A;  4K7O A;  3P2A A;  3FY7 A;  22GS A;  3LXT A;  4WET A;  3WGE A;  4K2D A;  4YQU A;  2VM2 A;  3TRX A;  1KEB A;  2DIZ A;  2FWH A;  2DJK A;  3CXG A;  3HY2 A;  5KEJ A;  1TXX A;  3EC3 A;  2I81 A;  2AUV A;  2HFD A;  4KGI A;  1PD2 1;  4JU5 A;  1AQX A;  3A2W A;  1RK4 A;  1O73 A;  1R7H A;  3A3T A;  5F8B A;  2VLT A;  2WZ9 A;  1XWC A;  3TKQ A;  2LNT A;  3LGC A;  4KSO A;  3HVS A;  3IHQ A;  1K0D A;  2BJX A;  1IYH A;  1F3B A;  3R3E A;  2H1D A;  2HRK A;  3KZQ A;  4K6X A;  2WUL A;  2YJH A;  1Z3E A;  3I6A A;  2I1U A;  2KOK A;  3KTB A;  4L0U A;  2H72 A;  2N5A A;  5ECH B;  2HI7 A;  2JZR A;  4KF9 A;  4EF0 A;  2FD3 A;  3GX8 A;  1U88 A;  2REM A;  3IC4 A;  1U3A A;  1OAZ A;  5HFI A;  3G7Y A;  4IQA A;  4HS1 A;  5B6M A;  1QUW A;  3RPP A;  3EWL A;  5HR3 A;  3TKP A;  4D73 A;  4G0K A;  2JAC A;  4LA1 A;  3IK7 A;  4GTU A;  2VLV A;  1A23 A;  4V1A p;  4HZ2 A;  2PVQ A;  4WXT A;  3TRQ A;  2WRT A;  3F0I A;  1YDK A;  1X9M B;  2C1Y A;  3UOM A;  4HEA 2;  1R5A A;  2AV4 A;  1SD8 A;  3VK9 A;  4F03 A;  5D9T A;  2PUK C;  4F0C A;  2DML A;  4XS4 B;  2VL2 C;  3L9U A;  1T7P B;  5GAP D;  2YAN A;  1X0R A;  3WD6 A;  1K3L A;  4WKW A;  1DE2 A;  1LU4 A;  1UVZ A;  1ERV A;  4P3Y B;  2VLU A;  5GZZ B;  2H75 A;  2X99 A;  2EC4 A;  1XVQ A;  3GH9 A;  2M80 A;  2YOI A;  2C3N A;  3TKS E;  3F4R A;  5JWQ B;  2IME A;  2LEG A;  1M2D A;  5G30 A;  1U87 A;  2YWO A;  3D22 A;  1X5D A;  3D6I A;  1FB6 A;  1GUM A;  2A4V A;  2VM1 A;  2IFQ A;  1GTU A;  4BWS A;  2DIY A;  3DKS A;  2GQK A;  4MA9 A;  1AQV A;  1YF1 A;  2ZUP A;  2CVK A;  1GSY A;  1ACV A;  5IMV A;  5ECN B;  3GH6 A;  2EIQ A;  4OD7 A;  4IEL A;  2VL2 A;  5HR1 A;  1U6T A;  2IN3 A;  4ZL9 A;  1Z7R A;  3NOF A;  5ECK B;  1WRY A;  1MD3 A;  2D2Z A;  1ZYE A;  4NPB A;  3C1R A;  1TRU A;  3KGK A;  3TOT A;  1SL1 B;  6GSY A;  2E2G A;  4GQC A;  4AJ6 A;  3M8N A;  3LFL A;  3PH9 A;  4RQR A;  3UEM A;  2HSM A;  1NW2 A;  2YWM A;  1FVJ A;  1WMJ A;  4MK3 A;  2CX3 A;  2LQO A;  3J7Y b;  1YY7 A;  1XIY A;  1M2B A;  2FWG A;  2DJJ A;  2FCH A;  3A2V A;  3TJK A;  1S3D A;  4IP6 A;  1HNB A;  2PU9 C;  3DD3 A;  4NWY A;  4MZW A;  2HLS A;  2CQ9 A;  2E7P A;  4PX1 A;  1PRX A;  4G2E A;  3QOU A;  4TR3 A;  1PN9 A;  1V2A A;  3UL3 A;  3HKR A;  4EDY A;  5CRH A;  1F2E A;  4LMV A;  1GUK A;  2WJU A;  1GNW A;  1B4Q A;  1OC9 A;  5ECR B;  3VI5 A;  2J9H A;  5AGY A;  4TR4 A;  4E8E A;  4YQM A;  1PGT A;  5INY A;  1XW9 A;  3DWV A;  4XIH A;  2MMZ A;  3F4S A;  5IMZ A;  3F6D A;  3UVH A;  3WYW A;  1LJR A;  3LSZ A;  2H30 A;  4NV2 A;  3WGX A;  1PL1 A;  2L57 A;  3ZVJ D;  1JZR A;  2FNO A;  4HJM A;  5D73 A;  3VPQ A;  1WOU A;  1ZOF A;  1J9B A;  2PGT A;  1WJK A;  1A8Y A;  3M9K A;  1X9S B;  9GSS A;  1FAA A;  1T1V A;  3SWL A;  4EDZ A;  1VF2 A;  5IPG A;  3D5J A;  3LJR A;  3DML A;  1VF1 A;  1AIU A;  4BVY A;  2JAD A;  2IFQ B;  2C4J A;  1K0N A;  6GSU A;  1YKC A;  3W8J A;  2G0F A;  4NXI A;  2MMN A;  1BG5 A;  3FW2 A;  1Z6M A;  3HCZ A;  3UAR A;  3US3 A;  2C80 A;  1S3C A;  5CP1 A;  2GSS A;  3S9F A;  4V2N A;  4QQ7 A;  1KNG A;  4EL1 A;  4ZL7 A;  3BBY A;  3KJY A;  4O5R A;  2P31 A;  2GZP A;  3CRT A;  3SBC A;  5DQS A;  1FO5 A;  3GST A;  1XOA A;  2LS5 A;  4AJ7 A;  2V6O A;  2PN8 A;  1O8X A;  2FWE A;  1FB0 A;  5IMA A;  2XHF A;  3W8S A;  4WF5 A;  2KUC A;  5ID2 B;  1TK8 B;  2WB9 A;  3LQ7 A;  2HXK A;  1FHE A;  2F8A A;  14GS A;  4MDC A;  3EU4 A;  3EE2 A;  2H01 A;  3MAK A;  4RQX A;  5G1L A;  4XCS A;  4PNG A;  2GGT A;  3LYK A;  3FZ9 A;  2RM6 A;  2XBQ A;  2H0G A;  1TRS A;  2H19 A;  5ENU A;  3Q74 A;  1MEK A;  2QC7 A;  1ABA A;  3A5W A;  4NHZ A;  2H71 A;  1PX7 A;  2M72 A;  5C04 A;  4H86 A;  4G0L A;  4HI7 A;  1X5E A;  4PTS A;  2CX4 A;  6GSW A;  1SYX A;  3CSH A;  3FEU A;  4OCF A;  1G0T A;  2HZF A;  4PQH A;  2CV4 A;  4NV5 A;  5DAL B;  3C71 A;  4L0W A;  2LRC A;  1SL0 B;  2YZU A;  20GS A;  2L5L A;  3P7X A;  3D0Z A;  3GTU A;  2GZZ A;  2JZT A;  3IAS 2;  2PMT A;  3A2X A;  1B4P A;  3IXR A;  4IBP A;  4OFM A;  1GLP A;  2HRA A;  4ZBA A;  3C73 A;  3VWW A;  2OE0 A;  4TVE A;  3PPU A;  5E4W A;  18GS A;  5ECI B;  2H6X A;  2UZ8 A;  4TXV A;  3N9J A;  3GUS A;  1VF4 A;  5JCU A;  1QGV A;  2GS3 A;  2L59 A;  3GUR A;  2CAQ A;  5IQY A;  2QKE A;  1EP7 A;  4MLY A;  5CNW A;  3H4K A;  3IAM 2;  3CTG A;  1X5C A;  1EV9 A;  4FQU A;  3PR8 A;  2C3Q A;  2K6V A;  2V41 A;  2YP6 A;  4XS4 A;  1K0B A;  5HQP A;  3VI7 A;  1Y6E A;  3CSI A;  2DJ3 A;  2DMM A;  3QFB C;  4KDY A;  4HOJ A;  1VF3 A;  1GTA A;  2H70 A;  3E9J B;  1SYR A;  3LG6 A;  4ACS A;  3O76 A;  3QAV A;  3BCI A;  2GST A;  4ZB9 A;  3UMA A;  4Z7X A;  2JU5 A;  1JLV A;  4MPF A;  4X1U A;  5EVO A;  2CT6 A;  2HT9 A;  4HQZ A;  3O3T A;  1FG4 A;  4ISD A;  4ULX A;  1Z7P A;  3JCM L;  2L6D A;  3AY8 A;  1I5G A;  1O8W A;  1A2M A;  1Z5Y E;  2L4Q A;  1M99 A;  4MAB A;  3QAG A;  5B8B A;  3C7M A;  4CDO A;  3ZLP A;  3KM6 A;  1XZO A;  3ED3 A;  4DSQ A;  2H8L A;  3ZIJ A;  4KB3 A;  3U5R E;  5CAX A;  2VCX A;  4PUA A;  1Z9H A;  3EIN A;  4JRR A;  3W6G A;  1SKW B;  1LBK A;  3Q19 A;  4POM A;  5HR0 A;  4YH2 A;  1PKW A;  4KE3 A;  4V2M A;  1H4O A;  2B5Y A;  5CO3 A;  3D4M A;  1ERT A;  2IIY A;  1TTZ A;  3GTU B;  2A2R A;  4OFT A;  5KN1 A;  1HNC A;  1M7T A;  4TRX A;  5FT3 A;  1WPI A;  4BVX A;  1WE0 A;  1TU7 A;  5EY6 A;  4L5L A;  1VRS D;  1W89 A;  1ERU A;  1JZO A;  1YF0 A;  2H0H A;  3ZRD A;  4K7N A;  2AYT A;  2WDU A;  1JZW A;  2H0I A;  1XW6 A;  2DC5 A;  3ZFL A;  3IV4 A;  4G9H A;  3GMF A;  3KH7 A;  4K1F A;  4MH3 A;  3QDN A;  1WP0 A;  2JSY A;  3TJJ A;  2HRN A;  3ZIT A;  1MTC A;  3KTL A;  1B48 A;  3GN3 A;  4O92 A;  4WBJ A;  2X8G A;  5F07 A;  3KEB A;  6GST A;  1XWB A;  3DIE A;  2DJ0 A;  3QPM A;  4N11 A;  1B8X A;  4JR6 A;  4LL4 B;  1ML6 A;  2E2M A;  4NMU A;  5IOW A;  5J4U A;  3TJF A;  5EL8 A;  3GKK A;  3IA1 A;  2B5E A;  3TB2 A;  3P90 A;  5D9W A;  2C0D A;  3FK8 A;  5AN1 A;  5ELG A;  4LL1 B;  3J7Y k;  2G2Q A;  5HFK A;  2K9F A;  4IKH A;  5BMU A;  4KCE A;  5EPF A;  4I6X A;  2V2G A;  2FA8 A;  4NHW A;  4KH7 A;  4L5O A;  1X9W B;  4Q5N A;  3TOU A;  5AIV A;  1UC7 A;  2GTU A;  2XPD A;  2LJK A;  2VL9 A;  1A0F A;  1VGL A;  2HZE A;  1YEX A;  2MMA A;  1K3Y A;  4XHM A;  4FYB A;  1OKD A;  3D4T A;  5GST A;  4PNF A;  5KN3 A;  4YQV A;  5CRD A;  1YEP A;  3UBL A;  3HA9 A;  4OO4 A;  3WT1 A;  2V32 A;  1F37 A;  1O6J A;  5G5F A;  1DUG A;  1GWC A;  1R4W A;  4TOP A;  2VD0 A;  4PQI A;  4MF5 A;  2C8U A;  2CZ2 A;  2RII A;  3F6F A;  3L0H A;  3TKS A;  5ID2 A;  5HFG A;  4ZL8 A;  2XC2 A;  4ZIL A;  5G1K A;  4ZBD A;  2YCD A;  4BVX B;  5A5K A;  3HJM A;  2ON5 A;  1JHB A;  3EVI A;  1GH2 A;  4DVC A;  3EYT A;  1TP9 A;  4G0I A;  2GQM A;  4MPG A;  3DVX A;  1EOH A;  2CVB A;  4XS1 A;  4TR1 A;  2LV3 A;  1CQG A;  2DLX A;  2ON7 A;  2MMO A;  1THX A;  4ML6 A;  4KDX A;  4TW5 A;  3IDV A;  3L4N A;  4J56 E;  1ZMA A;  1GSD A;  3BCK A;  3VWX A;  4FYU A;  5H5S A;  2L6C A;  2TRX A;  1GTB A;  1NM3 A;  2FGX A;  2K8S A;  5ECM B;  1XXU A;  5C00 A;  6GSV A;  1V57 A;  5DAL A;  3H93 A;  5G5E A;  1M2A A;  1MDK A;  3Q18 A;  4OCE A;  3KCM A;  5A4U A;  3L9S A;  4GLT A;  2VO4 A;  1YZX A;  1RW1 A;  5A4W A;  4KDU A;  4KA0 A;  3BJ5 A;  4USS A;  2Z9S A;  4F0B A;  11GS A;  2IMD A;  3Q6O A;  3GV1 A;  4N0Z A;  4DSS A;  3RHC A;  4IQ1 A;  5LNK e;  1EOG A;  3I69 A;  4KAE A;  3G7J A;  2BTO T;  2RM5 A;  3BOA A;  1M0U A;  3IR4 A;  1SD9 A;  4HDE A;  3DYR A;  4WR5 A;  2C0F A;  3KIJ A;  5H5Q A;  3R2Q A;  2OBI A;  3DVW A;  2HZE B;  2R3X A;  4F82 A;  2B6M A;  1G7E A;  1F6M C;  1AXD A;  5B7C A;  3K8N A;  1ZGN A;  3ME8 A;  4KCA A;  4J57 E;  3ZTL A;  5IO2 A;  1EGO A;  1SU9 A;  2YN1 A;  1JLW A;  2VAF A;  1S3A A;  3GNJ A;  1TKD B;  3GFK A;  2MBT A;  3CMI A;  2KHP A;  3RAZ A;  3MNG A;  2DJ2 A;  5DDL A;  1XWA A;  3ERG A;  2WCI A;  4MJB A;  1O85 A;  3ERW A;  2CAI A;  2B3S A;  2B5X A;  1J08 A;  1WIK A;  1TW9 A;  3F63 A;  2YV9 A;  1XFL A;  3HZ8 A;  1OE7 A;  1O81 A;  2YV7 A;  5E59 A;  1AQW A;  4IW9 A;  3UBK A;  3CYN A;  3NIV A;  1K3O A;  2NPB A;  1SEN A;  3GSS A;  2ZCT A;  2PER A;  1O7U A;  3L78 A;  2R4V A;  3ZMK A;  1GLQ A;  4BL7 A;  4EUY A;  4ECJ A;  4TR1 B;  4O32 A;  1ZL9 A;  1UN2 A;  3TKR A;  4ECB A;  3HDC A;  2AHE A;  4AJ8 A;  2J23 A;  2HSY A;  1C72 A;  2F8F A;  3M9J A;  5DJM A;  3BD2 A;  4HU9 A;  1T4Z A;  3G7I A;  1EWX A;  3GX0 A;  2I9H A;  5ECO B;  4I2T A;  1V9W A;  2HSN B;  4RUV A;  2QSI A;  2OJL A;  17GS A;  3GYK A;  2NTO A;  2YNX A;  1MDI A;  4HU7 A;  5DBQ A;  2E0Q A;  2AB6 A;  2GVP A;  2C0E A;  3I43 A;  4HQS A;  1T4Y A;  4EC0 A;  4N10 A;  2OE3 A;  1TRV A;  4LLR A;  3IC8 A;  2GSQ A;  4MF6 A;  5HR2 A;  4DSS B;  4I8B A;  5JCG A;  1WWJ A;  1FOV A;  2JZS A;  3HJO A;  5D93 A;  1M9B A;  5IO0 A;  3DEX A;  5FWG A;  2YJ7 A;  2OA7 A;  4X0X A;  1JZD A;  2ES7 A;  4WF4 A;  3ZVJ A;  3FKF A;  4N30 A;  3I9V 2;  5IPH A;  1B9Y C;  2H1G A;  1PMT A;  3VWV A;  4K7I A;  2OAD A;  3ZZX A;  5IMF A;  5JWO B;  1JFU A;  2WFC A;  2A2S A;  2VD1 A;  2L5O A;  2O7K A;  1ST9 A;  3FZA A;  3TGZ A;  3GKN A;  4Q5Q A;  2LUS A;  3FHK A;  5AIX A;  2DBC A;  2VCZ A;  2X8C A;  2FA4 A;  1OC8 A;  5ECS A;  1TU8 A;  3APQ A;  1SJZ A;  2I3Y A;  4EE0 A;  1NHO A;  1HD2 A;  1XVW A;  3GRX A;  1T8E B;  3UVT A;  3CBU A;  4EO3 A;  13GS A;  4K0N A;  4POB A;  2AJQ B;  4K8M A;  1QXH A;  1ZYQ B;  1E2Y A;  4RI6 A;  3EUR A;  2OAC A;  4FO5 A;  1V58 A;  2ALB A;  3GKM A;  1MDJ A;  3LWA A;  5JWR B;  2YWI A;  2EIO A;  1M9A A;  1TDI A;  1BQ7 A;  1GP1 A;  1F3A A;  5F0G A;  4BL7 B;  8GSS A;  2FHE A;  3ME7 A;  5ECP B;  1TI3 A;  3EMX A;  4DSR A;  4QL7 A;  3QAW A;  1SJI A;  2R2J A;  2N5B A;  3GL5 A;  4QL9 A;  4PGT A;  4GST A;  1RQM A;  2H6Y A;  2BMX A;  2PBJ A;  3F8U A;  3IRA A;  3DRN A;  4JED A;  1PL2 A;  4ZXG A;  4ECI A;  3ZYW A;  3LEF A;  4E8H A;  1QMV A;  3RBT A;  4K0G A;  2HRF A;  5D9V A;  3E3E A;  1R26 A;  1GUL A;  5JCW A;  1GSQ A;  3MSZ A;  5CRW A;  2M46 A;  1A8L A;  1OKT A;  5G2Z A;  3ZML A;  2LRN A;  3E0U A;  3V1W A;  1PA3 A;  4IP1 A;  3LYP A;  2LJR A;  3MDK A;  4AGS A;  5F06 A;  1EZK A;  3HXS A;  2VL3 A;  3F3Q A;  2O87 A;  4FIW A;  3TUE A;  3H1N A;  2OKA A;  5D96 A;  2K8V A;  3DGQ A;  3TCO A;  2B7K A;  4NAX A;  4JE1 A;  4ZB6 A;  3GA4 A;  1AAZ A;  1SL2 B;  1H75 A;  1K0O A;  3CRU A;  1BYE A;  4MH2 A;  3ERF A;  1DBY A;  3P8W A;  2NVL A;  4MZC A;  4ZIJ A;  2GT6 A;  4EXJ A;  1K0M A;  3TRP A;  2YWN A;  1GSU A;  1Y25 A;  2HE3 A;  4IVF A;  4JBB A;  2LST A;  2P5Q A;  3L9V A;  2OBK A;  3HVX A;  3QMX A;  2O8V B;  1TK5 B;  3ZRE A;  3APS A;  3FRC A;  2EIR A;  4POK A;  1OE8 A;  4MF7 A;  5J9B A;  4L8E A;  3U6V A;  1FVK A;  3TJG A;  4ZB8 A;  5CRG A;  1G6Y A;  2X8H A;  3M1G A;  2KLX A;  3C1S A;  3GL3 A;  5KN0 A;  3TKS C;  1XWK A;  4AF2 A;  2LRT A;  2AAW A;  2H1A A;  2LQQ A;  4TR0 A;  1QFN A;  1GRX A;  19GS A;  5ECQ B;  3HJP A;  4MJC A;  1BAY A;  4OFN A;  4ILF A;  2ZNM A;  4KSM A;  2H73 A;  3IBH A;  4KW6 A;  1NSW A;  4FYC A;  4KUN A;  3VFI A;  7GSS A;  2LNS A;  3LXZ A;  5L71 A;  4GF0 A;  2O85 A;  4BPY A;  1AW9 A;  1XPV A;  3ZFB A;  4TXO B;  2P0G A;  4IGJ A;  6GSS A;  3KMN A;  1HQO A;  2V6K A;  5DAK A;  2GZY A;  4N0V A;  1URM A;  3H79 A;  1A0R P;  1A2L A;  1ERW A;  2JL4 A;  1B9X C;  2VIM A;  4I2U A;  1K0C A;  4IS0 A;  4XS6 A;  3HHV A;  4ECC A;  2PPT A;  2KP2 A;  1N2A A;  5D9X A;  2HSH A;  4OO5 A;  3FYG A;  4HUA A;  3KMO A;  4PUR A;  5IMD A;  5IIZ A;  3UAP A;  4V1A g;  1GUH A;  4WR4 A;  3QD9 A;  1R5P A;  4EVM A;  2HRK B;  4YAV A;  4XTS A;  3FZ4 A;  5LD0 A;  1PSQ A;  1U3I A;  5J9C A;  3M3M A;  3TDG A;  4XRD A;  5J3R A;  2GDR A;  4Q5R A;  3C8E A;  1BJX A;  1EEM A;  1Q98 A;  1SKR B;  3HD5 A;  3RPN A;  1T00 A;  1J0F A;  2F9S A;  12GS A;  2GSR A;  1XWG A;  2QGV A;  3QR6 A;  4XRA A;  3QFA C;  3TJB A;  1A2J A;  2VOC A;  5GSS A;  1ILO A;  5ELA A;  2IMF A;  3EMP A;  3HZ4 A;  1SK1 A;  1W4V A;  2MZC A;  1V98 A;  4ML1 A;  3F9U A;  2FWF A;  1SK2 A;  2R37 A;  2XBI A;  4GQF A;  4WEY A;  1PKZ A;  10GS A;  3M0F A;  1G7O A;  1YKA A;  5FHI A;  1YQ1 A;  2RLI A;  1USB A;  4D73 B;  5DJL A;  5KN2 A;  2B1K A;  5J41 A;  1YJ6 A;  2P5R A;  3VLN A;  2NDO A;  1XBS A;  3PIN A;  4DEJ A;  4JR4 A;  4GSN A;  1IYI A;  2F3M A;  1GTI A;  2YPM A;  3F3R A;  5IMC A;  3ZIV A;  2C3T A;  1GL8 A;  2PWJ A;  1HNA A;  2IWT A;  2RUE A;  2X64 A;  1HYU A;  1SK0 A;  4I5Q A;  1CQH A;  1THO A;  1TOF A;  4KX4 A;  2OE1 A;  3F4T A;  3GIX A;  1PX6 A;  2YZH A;  2H66 A;  2H74 A;  2VCQ A;  4G19 A;  3GKX A;  1XOB A;  2K18 A;  4OMV A;  2FLS A;  4WBR D;  4YAP A;  5DCG A;  3RHB A;  1Z6N A;  5DAK B;  5AIS A;  5B8A A;  1TJD A;  3ZL5 A;  4ID0 A;  4MJE A;  1GSE A;  2GLR A;  3ISO A;  1V40 A;  2LJA A;  4KND A;  1T3B A;  1NHY A;  2R5G A;  1FW1 A;  1KTE A;  1GNE A;  4ZBB A;  3LOR A;  16GS A;  4IJI A;  3VWU A;  1G6W A;  1K0A A;  2VCV A;  1TI1 A;  1OYJ A;  4K9Z A;  1TRW A;  1BED A;  5DCH A;  3KD0 A;  3QCP A;  4MMM A;  2B1L A;  3OR5 A;  4MCU A;  4V2L A;  2FY6 A;  2VUP A;  2WS2 A;  3CSJ A;  2DJ1 A;  3VPT A;  1AC1 A;  4J2F A;  5D8I A;  1BX9 A;  3IE3 A;  3APO A;  5DQY A;  2C0G A;  1EGR A;  3DXB A;  3MWH A;  4G10 A;  1A24 A;  2HSM B;  1XW5 A;  3IK9 A;  4BWQ A;  1F9M A;  2FUG 2;  2CVD A;  3HVV A;  3IOS A;  3WT2 A;  2R6K A;  4GWR A;  2IL3 A;  3FR6 A;  5J5N A;  2F51 A;  5CRE A;  1Q4J A;  2HQT A;  3CTF A;  4GXZ A;  3KP9 A;  2IJY A;  1OC3 A;  1OVN A;  3GHA A;  2NBS A;  1N8J A;  4I97 A;  3RDW A;  2VCW A;  2H76 A;  5COH A;  1ON4 A;  3PGT A;  5F05 A;  2KP1 A;  3D21 A;  5LCZ A;  4IN0 A;  1ZCP A;  5B6N A;  2CZ3 A;  1I9D A;  3WGD A;  1MD4 A;  4PUF C;  4LMW A;  2VCT A;  2L4C A;  4GCI A;  3O6T A;  4POL A;  4FH8 A;  1DE1 A;  2TRC P;  1E6B A;  1OC9 B;  4BA7 A;  4JZQ A;  1EEJ A;  3KP8 A;  4CHS A;  2WGR A;  4MP4 A;  2O89 A;  1TK0 B;  3H8Q A;  2MYG A;  3FR3 A;  2I4A A;  3G9B A;  2JSZ A;  4IJ3 A;  2N5F A;  4CW9 A;  2RUF A;  2PVO C; 
#chains in the Genus database with same CATH topology
 2TIR A;  6GSX A;  2HNL A;  4MZB A;  4PXO A;  2IMK A;  4OWY A;  5DVB A;  2LKU A;  1AUC A;  3KXO A;  3EU3 A;  5A4V A;  1QQ2 A;  2HYX A;  1EV4 A;  5CYY A;  1UA5 A;  5ECL B;  3KH9 A;  4BVY B;  4GRF A;  3VUR A;  2XPE A;  1GSS A;  1PQN A;  2GQL A;  1XCC A;  2H6Z A;  5H5R A;  4TKY A;  3IPZ A;  1EP8 A;  4IHU A;  4MJA A;  5G31 A;  1ZZY A;  4GSS A;  2V1M A;  5GAN D;  4RI7 A;  2DSA A;  2LTK A;  1DSB A;  4TN8 A;  2GT5 A;  1SJ6 A;  1GSF A;  4EKZ A;  1KBN A;  5ABR A;  2CA8 A;  3CWG A;  3HYP A;  1SKS B;  2MBS A;  4X43 A;  5J4V A;  4F2I A;  3FR9 A;  4F9Z A;  3N5O A;  4Q5F A;  4E68 A;  3FZ5 A;  3UIW A;  2B7J A;  2QA1 A;  1QK8 A;  4HZ4 A;  2IMI A;  5IM9 A;  3NZN A;  4O7H A;  2H1B A;  4TXO A;  2IPA A;  3UJ1 A;  5IOX A;  1S4B P;  4HJ2 A;  4PQ1 A;  4K7O A;  3P2A A;  3FY7 A;  22GS A;  3LXT A;  4WET A;  3WGE A;  4GDF A;  4K2D A;  4YQU A;  2VM2 A;  3TRX A;  1KEB A;  2DIZ A;  2FWH A;  2DJK A;  3CXG A;  3HY2 A;  5KEJ A;  1TXX A;  3EC3 A;  2I81 A;  2AUV A;  2X4A A;  2HFD A;  4KGI A;  1PD2 1;  4JU5 A;  1AQX A;  3A2W A;  1RK4 A;  1O73 A;  1R7H A;  3A3T A;  5F8B A;  2VLT A;  3MYD A;  2WZ9 A;  1XWC A;  3TKQ A;  2LNT A;  3LGC A;  4KSO A;  3HVS A;  3IHQ A;  1K0D A;  2BJX A;  1IYH A;  1F3B A;  3R3E A;  2H1D A;  4BIK A;  2HRK A;  3KZQ A;  4K6X A;  2WUL A;  2YJH A;  1Z3E A;  3I6A A;  2I1U A;  2KOK A;  3KTB A;  4L0U A;  2H72 A;  2N5A A;  5ECH B;  2HI7 A;  2JZR A;  4KF9 A;  4EF0 A;  2FD3 A;  3GX8 A;  1U88 A;  2REM A;  3IC4 A;  1U3A A;  1OAZ A;  5HFI A;  3G7Y A;  4IQA A;  4HS1 A;  5B6M A;  1QUW A;  3RPP A;  3EWL A;  5HR3 A;  3TKP A;  4D73 A;  4G0K A;  2JAC A;  4LA1 A;  2EFD A;  3IK7 A;  4GTU A;  2VLV A;  1A23 A;  4V1A p;  4HZ2 A;  2PVQ A;  2UV8 G;  4WXT A;  3TRQ A;  2WRT A;  3F0I A;  1YDK A;  1X9M B;  2C1Y A;  4ICY A;  3UOM A;  4HEA 2;  1R5A A;  2AV4 A;  1SD8 A;  3VK9 A;  4F03 A;  1YVL A;  5D9T A;  2PUK C;  4F0C A;  2DML A;  4XS4 B;  2VL2 C;  3L9U A;  1T7P B;  5GAP D;  2YAN A;  1X0R A;  3WD6 A;  1K3L A;  4WKW A;  1DE2 A;  1LU4 A;  1UVZ A;  1ERV A;  4P3Y B;  2VLU A;  5GZZ B;  2H75 A;  2X99 A;  2A4H A;  2EC4 A;  1XVQ A;  2X49 A;  3GH9 A;  2M80 A;  2YOI A;  2C3N A;  3TKS E;  3F4R A;  5JWQ B;  2IME A;  2LEG A;  1M2D A;  5G30 A;  1U87 A;  2YWO A;  1I1I P;  3D22 A;  1X5D A;  3D6I A;  1FB6 A;  1GUM A;  2A4V A;  2VM1 A;  2IFQ A;  1GTU A;  4BWS A;  2DIY A;  3DKS A;  2GQK A;  4MA9 A;  2EFC A;  1AQV A;  1YF1 A;  2ZUP A;  2CVK A;  1GSY A;  1ACV A;  3CHX C;  5IMV A;  5ECN B;  3GH6 A;  4MNN A;  2EIQ A;  4OD7 A;  4IEL A;  2VL2 A;  5HR1 A;  5J40 A;  1U6T A;  2IN3 A;  4ZL9 A;  1Z7R A;  3NOF A;  4W66 A;  5ECK B;  1WRY A;  1MD3 A;  2D2Z A;  1ZYE A;  4NPB A;  3C1R A;  1TRU A;  3KGK A;  3TOT A;  1SL1 B;  6GSY A;  2E2G A;  4HSC X;  4GQC A;  4AJ6 A;  3M8N A;  3LFL A;  3PH9 A;  4RQR A;  3UEM A;  2HSM A;  1NW2 A;  2YWM A;  1FVJ A;  1WMJ A;  4MK3 A;  2CX3 A;  2LQO A;  3J7Y b;  1YY7 A;  5A1N A;  1XIY A;  1M2B A;  2FWG A;  2DJJ A;  2FCH A;  3A2V A;  3TJK A;  1S3D A;  4IP6 A;  1HNB A;  2PU9 C;  3DD3 A;  4YKF A;  4NWY A;  4MZW A;  2HLS A;  2CQ9 A;  2E7P A;  4PX1 A;  1PRX A;  4G2E A;  3QOU A;  4TR3 A;  1PN9 A;  1V2A A;  3UL3 A;  3HKR A;  5A34 B;  4EDY A;  5CRH A;  1F2E A;  4LMV A;  1GUK A;  2WJU A;  1GNW A;  1B4Q A;  1OC9 A;  5ECR B;  3VI5 A;  2J9H A;  5AGY A;  1PFO A;  4TR4 A;  4E8E A;  4YQM A;  1PGT A;  5INY A;  1XW9 A;  3DWV A;  4XIH A;  2MMZ A;  3F4S A;  5IMZ A;  3F6D A;  5BMU B;  3UVH A;  3WYW A;  1LJR A;  3LSZ A;  2H30 A;  4NV2 A;  3WGX A;  1PL1 A;  2L57 A;  3ZVJ D;  1JZR A;  1N25 A;  2FNO A;  4HJM A;  5D73 A;  3VPQ A;  1WOU A;  1ZOF A;  1J9B A;  2PGT A;  1WJK A;  1A8Y A;  3M9K A;  1X9S B;  9GSS A;  1FAA A;  1T1V A;  3SWL A;  4N3Z A;  4EDZ A;  1VF2 A;  5IPG A;  3D5J A;  3LJR A;  3DML A;  1VF1 A;  1AIU A;  4BVY A;  2O36 A;  2JAD A;  2IFQ B;  2C4J A;  1K0N A;  6GSU A;  1YKC A;  3W8J A;  2G0F A;  4NXI A;  2MMN A;  1BG5 A;  3FW2 A;  1Z6M A;  3HCZ A;  3UAR A;  3US3 A;  2C80 A;  1S3C A;  5CP1 A;  2GSS A;  3S9F A;  4V2N A;  4QQ7 A;  1KNG A;  4EL1 A;  4ZL7 A;  3BBY A;  3KJY A;  4O5R A;  2P31 A;  2GZP A;  3CRT A;  3SBC A;  5DQS A;  1FO5 A;  3GST A;  3HMJ G;  1XOA A;  2LS5 A;  4AJ7 A;  2V6O A;  1FOH A;  2PN8 A;  1O8X A;  2FWE A;  1FB0 A;  5IMA A;  2XHF A;  3W8S A;  4WF5 A;  2KUC A;  5ID2 B;  1TK8 B;  2WB9 A;  3LQ7 A;  3CQF A;  2HXK A;  1FHE A;  2F8A A;  14GS A;  4MDC A;  3EU4 A;  3EE2 A;  2H01 A;  3MAK A;  4RQX A;  5G1L A;  4XCS A;  5A1N B;  4PNG A;  2GGT A;  3LYK A;  1S3R A;  3FZ9 A;  2RM6 A;  2XBQ A;  2H0G A;  1TRS A;  2H19 A;  5ENU A;  3Q74 A;  1MEK A;  2QC7 A;  1ABA A;  3A5W A;  4NHZ A;  2H71 A;  1TXU A;  1PX7 A;  2M72 A;  5C04 A;  4H86 A;  4CY6 A;  4G0L A;  4HI7 A;  1X5E A;  4PTS A;  2CX4 A;  6GSW A;  1SYX A;  3CSH A;  3FEU A;  4OCF A;  1G0T A;  2HZF A;  4PQH A;  2CV4 A;  4NV5 A;  5DAL B;  3C71 A;  2WW3 A;  4L0W A;  2LRC A;  1SL0 B;  2YZU A;  20GS A;  2L5L A;  3P7X A;  3D0Z A;  3GTU A;  2GZZ A;  2JZT A;  3IAS 2;  2PMT A;  3A2X A;  1B4P A;  3IXR A;  4IBP A;  4OFM A;  1GLP A;  2HRA A;  4ZBA A;  3C73 A;  3MIX A;  3VWW A;  2OE0 A;  4TVE A;  4PI0 C;  3PPU A;  4A5P A;  5E4W A;  18GS A;  5ECI B;  2H6X A;  2UZ8 A;  4TXV A;  3N9J A;  3GUS A;  1VF4 A;  5JCU A;  1QGV A;  2GS3 A;  2L59 A;  2O5V A;  3GUR A;  2CAQ A;  5IQY A;  2QKE A;  1EP7 A;  4MLY A;  5CNW A;  3H4K A;  3IAM 2;  3CTG A;  1X5C A;  1EV9 A;  4FQU A;  3PR8 A;  2C3Q A;  2K6V A;  2V41 A;  2YP6 A;  4XS4 A;  1K0B A;  5HQP A;  3VI7 A;  1Y6E A;  3CSI A;  2DJ3 A;  2DMM A;  4G01 A;  3QFB C;  4KDY A;  4HOJ A;  3RGB C;  3LW9 A;  4YKG A;  1VF3 A;  1GTA A;  2H70 A;  3E9J B;  1SYR A;  3LG6 A;  4ACS A;  3O76 A;  3QAV A;  3BCI A;  2GST A;  4ZB9 A;  3UMA A;  4Z7X A;  2JU5 A;  1JLV A;  4MPF A;  4X1U A;  5EVO A;  2CT6 A;  2HT9 A;  4HQZ A;  3O3T A;  1FG4 A;  4ISD A;  4ULX A;  1Z7P A;  3JCM L;  2L6D A;  3AY8 A;  1I5G A;  1O8W A;  1ZYN A;  1A2M A;  1Z5Y E;  2L4Q A;  1M99 A;  4MAB A;  3QAG A;  5B8B A;  3C7M A;  4CDO A;  3ZLP A;  3KM6 A;  1XZO A;  3ED3 A;  4K5S A;  4O5U A;  4DSQ A;  2H8L A;  3ZIJ A;  4KB3 A;  3U5R E;  5CAX A;  2VCX A;  4PUA A;  1Z9H A;  3EIN A;  4JRR A;  3W6G A;  1SKW B;  1LBK A;  3Q19 A;  4POM A;  5HR0 A;  4YH2 A;  1PKW A;  4KE3 A;  4FXY P;  4V2M A;  1H4O A;  2B5Y A;  5CO3 A;  3D4M A;  1ERT A;  2IIY A;  1TTZ A;  1BF5 A;  3GTU B;  2A2R A;  4OFT A;  5KN1 A;  1HNC A;  1M7T A;  4TRX A;  5FT3 A;  1WPI A;  4BVX A;  1WE0 A;  1TU7 A;  5EY6 A;  4L5L A;  1VRS D;  1W89 A;  1ERU A;  1JZO A;  1YF0 A;  2H0H A;  3ZRD A;  4K7N A;  2AYT A;  2WDU A;  1JZW A;  2H0I A;  1XW6 A;  2DC5 A;  3ZFL A;  3IV4 A;  4G9H A;  3GMF A;  3KH7 A;  4K1F A;  4MH3 A;  3QDN A;  1WP0 A;  2JSY A;  3TJJ A;  4AKX B;  2HRN A;  3ZIT A;  1MTC A;  3KTL A;  1B48 A;  3GN3 A;  4O92 A;  4WBJ A;  2VKZ G;  2X8G A;  5F07 A;  3KEB A;  6GST A;  5A34 A;  1XWB A;  3DIE A;  2DJ0 A;  3QPM A;  4N11 A;  1B8X A;  4JR6 A;  4LL4 B;  1ML6 A;  2E2M A;  4NMU A;  5IOW A;  5J4U A;  3TJF A;  5EL8 A;  3GKK A;  3IA1 A;  2B5E A;  3TB2 A;  3P90 A;  4X4J A;  5D9W A;  2C0D A;  3FK8 A;  5AN1 A;  5ELG A;  4LL1 B;  3J7Y k;  2G2Q A;  5HFK A;  2K9F A;  4IKH A;  5BMU A;  4KCE A;  5EPF A;  4I6X A;  2V2G A;  4O5Q A;  2FA8 A;  4NHW A;  4KH7 A;  4L5O A;  1X9W B;  4Q5N A;  3TOU A;  5AIV A;  1UC7 A;  2GTU A;  2XPD A;  2LJK A;  2VL9 A;  1A0F A;  1VGL A;  2HZE A;  1YEX A;  2MMA A;  1K3Y A;  4XHM A;  1XG8 A;  4FYB A;  1OKD A;  3D4T A;  5KOX A;  5GST A;  4PNF A;  5KN3 A;  4YQV A;  5CRD A;  1YEP A;  3UBL A;  3HA9 A;  4OO4 A;  3WT1 A;  4AKH A;  2V32 A;  1BG1 A;  1F37 A;  1O6J A;  5G5F A;  4AI6 A;  1DUG A;  1GWC A;  1R4W A;  2R0C A;  4TOP A;  2VD0 A;  2H1L A;  4PQI A;  4MF5 A;  2C8U A;  2CZ2 A;  2WZS A;  2RII A;  3F6F A;  3L0H A;  3TKS A;  5ID2 A;  5HFG A;  4ZL8 A;  2XC2 A;  4ZIL A;  5G1K A;  4ZBD A;  2YCD A;  4BVX B;  5A5K A;  3HJM A;  2ON5 A;  1JHB A;  3EVI A;  1GH2 A;  4DVC A;  3EYT A;  1TP9 A;  4G0I A;  2GQM A;  4MPG A;  3DVX A;  1EOH A;  2CVB A;  4XS1 A;  4TR1 A;  2LV3 A;  2WVY A;  1CQG A;  2DLX A;  2ON7 A;  3IHG A;  2MMO A;  1THX A;  4ML6 A;  4KDX A;  4TW5 A;  3IDV A;  3RFR C;  3L4N A;  4J56 E;  1ZMA A;  1GSD A;  3BCK A;  3VWX A;  4FYU A;  1YEW C;  5H5S A;  2L6C A;  2TRX A;  4AKI A;  1GTB A;  1NM3 A;  2FGX A;  2K8S A;  5ECM B;  1XXU A;  5C00 A;  6GSV A;  1V57 A;  5DAL A;  3H93 A;  2OT3 A;  5G5E A;  1M2A A;  4ZB7 A;  1MDK A;  3Q18 A;  4OCE A;  3KCM A;  5A4U A;  3L9S A;  4GLT A;  4K5R A;  2VO4 A;  1YZX A;  1RW1 A;  5A4W A;  4KDU A;  4KA0 A;  3BJ5 A;  4USS A;  2Z9S A;  4F0B A;  2EFE A;  11GS A;  2IMD A;  3Q6O A;  3GV1 A;  4N0Z A;  4DSS A;  3RHC A;  4IQ1 A;  5LNK e;  3EPT A;  1EOG A;  3I69 A;  4KAE A;  3G7J A;  2BTO T;  2RM5 A;  3BOA A;  1M0U A;  2EFH A;  3IR4 A;  1SD9 A;  4HDE A;  3DYR A;  4WR5 A;  2C0F A;  3KIJ A;  1SVL A;  5H5Q A;  3R2Q A;  2OBI A;  3DVW A;  2HZE B;  2R3X A;  4F82 A;  2B6M A;  1G7E A;  1F6M C;  1AXD A;  5B7C A;  3K8N A;  1ZGN A;  3ME8 A;  4KCA A;  4J57 E;  3ZTL A;  5IO2 A;  1EGO A;  1SU9 A;  2YN1 A;  1JLW A;  2VAF A;  1S3A A;  3GNJ A;  1TKD B;  3GFK A;  2MBT A;  3CMI A;  2KHP A;  2DKH A;  3RAZ A;  3MNG A;  2DJ2 A;  5DDL A;  1XWA A;  3ERG A;  2WCI A;  4MJB A;  1O85 A;  3ERW A;  2CAI A;  2B3S A;  2B5X A;  1J08 A;  1WIK A;  1TW9 A;  3F63 A;  2YV9 A;  5BRT A;  1XFL A;  3HZ8 A;  1OE7 A;  1O81 A;  2YV7 A;  5E59 A;  1AQW A;  3CYN A;  4IW9 A;  3UBK A;  3NIV A;  2WVX B;  1K3O A;  2NPB A;  3HVN A;  1SEN A;  3GSS A;  2ZCT A;  2PER A;  1O7U A;  3TU3 B;  3L78 A;  2R4V A;  3ZMK A;  1GLQ A;  4BL7 A;  4EUY A;  4ECJ A;  4TR1 B;  4O32 A;  1ZL9 A;  1UN2 A;  3TKR A;  4ECB A;  3HDC A;  2AHE A;  4AJ8 A;  2J23 A;  2HSY A;  1C72 A;  2F8F A;  3M9J A;  5DJM A;  3BD2 A;  4HU9 A;  1T4Z A;  3G7I A;  1EWX A;  3GX0 A;  2I9H A;  5ECO B;  4I2T A;  1V9W A;  2HSN B;  4RUV A;  2QSI A;  2OJL A;  17GS A;  3GYK A;  2NTO A;  4PI2 C;  2YNX A;  1MDI A;  4HU7 A;  5DBQ A;  2E0Q A;  2AB6 A;  2GVP A;  2C0E A;  3I43 A;  4HQS A;  1T4Y A;  4EC0 A;  4N10 A;  2OE3 A;  1TRV A;  4LLR A;  3IC8 A;  2GSQ A;  4MF6 A;  5HR2 A;  4DSS B;  4I8B A;  5JCG A;  1WWJ A;  1FOV A;  2JZS A;  3HJO A;  5D93 A;  1M9B A;  5IO0 A;  1M3J A;  3DEX A;  5FWG A;  2YJ7 A;  2OA7 A;  4X0X A;  1JZD A;  2ES7 A;  4WF4 A;  3ZVJ A;  3FKF A;  4N30 A;  3I9V 2;  3A5I A;  5IPH A;  1B9Y C;  2H1G A;  1PMT A;  3VWV A;  4K7I A;  2OAD A;  3ZZX A;  5IMF A;  5JWO B;  1JFU A;  2WFC A;  2A2S A;  2VD1 A;  2L5O A;  2O7K A;  1ST9 A;  3FZA A;  3TGZ A;  1M3I A;  3GKN A;  4Q5Q A;  2LUS A;  3FHK A;  5AIX A;  2DBC A;  4QMK A;  2VCZ A;  2X8C A;  2FA4 A;  1OC8 A;  5ECS A;  1TU8 A;  3APQ A;  1SJZ A;  2I3Y A;  4EE0 A;  1NHO A;  1HD2 A;  1XVW A;  3GRX A;  1T8E B;  3UVT A;  3CBU A;  4EO3 A;  13GS A;  4K0N A;  4POB A;  2AJQ B;  4K8M A;  1QXH A;  1ZYQ B;  1E2Y A;  1PN0 A;  4RI6 A;  3EUR A;  5A5H A;  2OAC A;  4FO5 A;  1V58 A;  2ALB A;  3GKM A;  1MDJ A;  3LWA A;  5JWR B;  2YWI A;  2EIO A;  1M9A A;  1TDI A;  1BQ7 A;  1GP1 A;  1F3A A;  5F0G A;  4BL7 B;  8GSS A;  2FHE A;  3ME7 A;  5ECP B;  1TI3 A;  3EMX A;  4DSR A;  4QL7 A;  3QAW A;  1SJI A;  2R2J A;  2N5B A;  3GL5 A;  4QL9 A;  4PGT A;  4GST A;  1RQM A;  2H6Y A;  2BMX A;  2PBJ A;  3F8U A;  3IRA A;  3DRN A;  4JED A;  1PL2 A;  4ZXG A;  4ECI A;  3ZYW A;  3LEF A;  4E8H A;  1QMV A;  3RBT A;  4K0G A;  2HRF A;  5D9V A;  3E3E A;  1R26 A;  1GUL A;  5JCW A;  1GSQ A;  3MSZ A;  5CRW A;  2M46 A;  4EIP A;  3FMW A;  1A8L A;  1OKT A;  5G2Z A;  3ZML A;  2LRN A;  3E0U A;  3V1W A;  1PA3 A;  4IP1 A;  3LYP A;  4Z2U A;  2LJR A;  3MDK A;  2A2P A;  4AGS A;  5F06 A;  1EZK A;  3HXS A;  2VL3 A;  3F3Q A;  2O87 A;  4FIW A;  3TUE A;  3H1N A;  2OKA A;  5D96 A;  2K8V A;  3DGQ A;  3TCO A;  2B7K A;  4NAX A;  4JE1 A;  4ZB6 A;  3GA4 A;  1AAZ A;  1SL2 B;  1H75 A;  1K0O A;  3CRU A;  1BYE A;  4MH2 A;  3ERF A;  1DBY A;  3P8W A;  2NVL A;  4MZC A;  4ZIJ A;  2GT6 A;  4EXJ A;  1K0M A;  3TRP A;  2YWN A;  1GSU A;  1Y25 A;  2HE3 A;  4IVF A;  4JBB A;  2LST A;  2P5Q A;  3L9V A;  2OBK A;  1ZYP A;  3HVX A;  1SVM A;  3QMX A;  2O8V B;  1TK5 B;  3ZRE A;  3APS A;  3FRC A;  2WW2 A;  2EIR A;  4POK A;  1OE8 A;  4MF7 A;  5J9B A;  4L8E A;  3U6V A;  1FVK A;  2QA2 A;  3TJG A;  4ZB8 A;  5CRG A;  1G6Y A;  2X8H A;  3M1G A;  2KLX A;  3C1S A;  3GL3 A;  5KN0 A;  3TKS C;  1XWK A;  4AF2 A;  2LRT A;  2AAW A;  2H1A A;  2LQQ A;  4TR0 A;  1QFN A;  1GRX A;  2O3E A;  19GS A;  5ECQ B;  3HJP A;  4MJC A;  1BAY A;  4OFN A;  4ILF A;  2ZNM A;  4KSM A;  2H73 A;  3IBH A;  5A5H B;  4KW6 A;  1NSW A;  4FYC A;  4KUN A;  3VFI A;  7GSS A;  2LNS A;  3LXZ A;  5L71 A;  4GF0 A;  2O85 A;  4BPY A;  1AW9 A;  1XPV A;  3ZFB A;  4TXO B;  5J4Y A;  2P0G A;  4IGJ A;  6GSS A;  3KMN A;  1HQO A;  2V6K A;  5DAK A;  2GZY A;  4N0V A;  1URM A;  3H79 A;  1A0R P;  1A2L A;  1ERW A;  2JL4 A;  1B9X C;  2VIM A;  4I2U A;  1K0C A;  2R0G A;  4IS0 A;  4XS6 A;  3HHV A;  4ECC A;  2PPT A;  2KP2 A;  1Y1U A;  1N2A A;  5D9X A;  2HSH A;  4EIQ A;  4OO5 A;  3FYG A;  4HUA A;  3KMO A;  4PUR A;  5IMD A;  5IIZ A;  3UAP A;  4V1A g;  1GUH A;  4WR4 A;  3QD9 A;  1R5P A;  4EVM A;  2HRK B;  4YAV A;  4XTS A;  3FZ4 A;  2R0P A;  5LD0 A;  1PSQ A;  1U3I A;  5J9C A;  3M3M A;  3TDG A;  4XRD A;  5J3R A;  2GDR A;  4Q5R A;  3C8E A;  2WVX A;  1BJX A;  1EEM A;  1Q98 A;  1SKR B;  3HD5 A;  3RPN A;  1T00 A;  1J0F A;  2F9S A;  12GS A;  2GSR A;  1XWG A;  2QGV A;  3QR6 A;  4XRA A;  3QFA C;  3TJB A;  1A2J A;  2VOC A;  5GSS A;  1ILO A;  5ELA A;  2IMF A;  3EMP A;  3HZ4 A;  1SK1 A;  1W4V A;  2MZC A;  1V98 A;  4ML1 A;  3F9U A;  2FWF A;  1SK2 A;  2R37 A;  2XBI A;  4GQF A;  4WEY A;  1PKZ A;  10GS A;  3M0F A;  1G7O A;  1YKA A;  4K2X A;  5FHI A;  1YQ1 A;  2RLI A;  1USB A;  2WVZ A;  4D73 B;  5DJL A;  5KN2 A;  2B1K A;  5J41 A;  4Z2T A;  2HSN A;  1YJ6 A;  2P5R A;  3VLN A;  2NDO A;  1XBS A;  3PIN A;  4DEJ A;  4JR4 A;  4GSN A;  1IYI A;  2F3M A;  1GTI A;  2YPM A;  3F3R A;  5IMC A;  3ZIV A;  2C3T A;  1GL8 A;  2PWJ A;  1HNA A;  2IWT A;  2RUE A;  2X64 A;  1HYU A;  1SK0 A;  4I5Q A;  1CQH A;  1THO A;  1TOF A;  4KX4 A;  2OE1 A;  3F4T A;  3GIX A;  1PX6 A;  2YZH A;  2H66 A;  2H74 A;  1SVO A;  2VCQ A;  4G19 A;  2WW1 A;  3GKX A;  1XOB A;  2K18 A;  4OMV A;  2FLS A;  4WBR D;  4YAP A;  5DCG A;  3RHB A;  5J47 A;  1Z6N A;  5DAK B;  5AIS A;  5B8A A;  1TJD A;  3ZL5 A;  4ID0 A;  4MJE A;  1GSE A;  2GLR A;  3ISO A;  1V40 A;  2LJA A;  4KND A;  1T3B A;  1NHY A;  2R5G A;  1FW1 A;  1KTE A;  1GNE A;  4ZBB A;  4AKG A;  3LOR A;  16GS A;  4IJI A;  3VWU A;  1G6W A;  1K0A A;  2VCV A;  1TI1 A;  1OYJ A;  4PHZ C;  4K9Z A;  1TRW A;  1BED A;  5DCH A;  3KD0 A;  3QCP A;  4MMM A;  2B1L A;  3OR5 A;  4MCU A;  4V2L A;  2FY6 A;  2VUP A;  2WS2 A;  3CSJ A;  2DJ1 A;  2DKI A;  3VPT A;  1AC1 A;  4J2F A;  5D8I A;  1BX9 A;  3IE3 A;  3APO A;  5DQY A;  2C0G A;  1EGR A;  3DXB A;  3MWH A;  4G10 A;  1A24 A;  2HSM B;  1XW5 A;  3IK9 A;  4BWQ A;  1F9M A;  2FUG 2;  2CVD A;  3HVV A;  3IOS A;  3WT2 A;  2R6K A;  4CY8 A;  4GWR A;  2IL3 A;  3FR6 A;  5J5N A;  2F51 A;  5CRE A;  1Q4J A;  2HQT A;  3CTF A;  4GXZ A;  3KP9 A;  2IJY A;  1OC3 A;  1OVN A;  3GHA A;  2NBS A;  1N8J A;  4I97 A;  5KOW A;  2WW0 A;  3RDW A;  2VCW A;  2H76 A;  5COH A;  1ON4 A;  3PGT A;  5F05 A;  2KP1 A;  3D21 A;  5LCZ A;  4IN0 A;  1ZCP A;  5B6N A;  2CZ3 A;  1I9D A;  3WGD A;  1MD4 A;  4PUF C;  4LMW A;  2VCT A;  2L4C A;  4GCI A;  3O6T A;  4POL A;  4FH8 A;  1DE1 A;  2TRC P;  1E6B A;  1OC9 B;  4BA7 A;  4JZQ A;  1EEJ A;  3KP8 A;  4CHS A;  4Z2R A;  2WGR A;  4MP4 A;  2O89 A;  1TK0 B;  3H8Q A;  2MYG A;  3FR3 A;  2I4A A;  3G9B A;  2JSZ A;  4IJ3 A;  2N5F A;  4CW9 A;  2RUF A;  2PVO C; 
#chains in the Genus database with same CATH homology
 2TIR A;  6GSX A;  2HNL A;  4MZB A;  4PXO A;  2IMK A;  4OWY A;  5DVB A;  2LKU A;  1AUC A;  3KXO A;  3EU3 A;  5A4V A;  1QQ2 A;  2HYX A;  1EV4 A;  5CYY A;  1UA5 A;  5ECL B;  3KH9 A;  4BVY B;  4GRF A;  3VUR A;  2XPE A;  1GSS A;  1PQN A;  2GQL A;  1XCC A;  2H6Z A;  5H5R A;  4TKY A;  3IPZ A;  1EP8 A;  4IHU A;  4MJA A;  5G31 A;  1ZZY A;  4GSS A;  2V1M A;  5GAN D;  4RI7 A;  2DSA A;  2LTK A;  1DSB A;  4TN8 A;  2GT5 A;  1SJ6 A;  1GSF A;  4EKZ A;  1KBN A;  5ABR A;  2CA8 A;  3CWG A;  3HYP A;  1SKS B;  2MBS A;  4X43 A;  5J4V A;  4F2I A;  3FR9 A;  4F9Z A;  3N5O A;  4Q5F A;  4E68 A;  3FZ5 A;  3UIW A;  2B7J A;  2QA1 A;  1QK8 A;  4HZ4 A;  2IMI A;  5IM9 A;  3NZN A;  4O7H A;  2H1B A;  4TXO A;  2IPA A;  3UJ1 A;  5IOX A;  4HJ2 A;  4PQ1 A;  4K7O A;  3P2A A;  3FY7 A;  22GS A;  3LXT A;  4WET A;  3WGE A;  4GDF A;  4K2D A;  4YQU A;  2VM2 A;  3TRX A;  1KEB A;  2DIZ A;  2FWH A;  2DJK A;  3CXG A;  3HY2 A;  5KEJ A;  1TXX A;  3EC3 A;  2I81 A;  2AUV A;  2X4A A;  2HFD A;  4KGI A;  1PD2 1;  4JU5 A;  1AQX A;  3A2W A;  1RK4 A;  1O73 A;  1R7H A;  3A3T A;  5F8B A;  2VLT A;  3MYD A;  2WZ9 A;  1XWC A;  3TKQ A;  2LNT A;  3LGC A;  4KSO A;  3HVS A;  3IHQ A;  1K0D A;  2BJX A;  1IYH A;  1F3B A;  3R3E A;  2H1D A;  2HRK A;  3KZQ A;  4K6X A;  2WUL A;  2YJH A;  1Z3E A;  3I6A A;  2I1U A;  2KOK A;  3KTB A;  4L0U A;  2H72 A;  2N5A A;  5ECH B;  2HI7 A;  2JZR A;  4KF9 A;  4EF0 A;  2FD3 A;  3GX8 A;  1U88 A;  2REM A;  3IC4 A;  1U3A A;  1OAZ A;  5HFI A;  3G7Y A;  4IQA A;  4HS1 A;  5B6M A;  1QUW A;  3RPP A;  3EWL A;  5HR3 A;  3TKP A;  4D73 A;  4G0K A;  2JAC A;  4LA1 A;  2EFD A;  3IK7 A;  4GTU A;  2VLV A;  1A23 A;  4V1A p;  4HZ2 A;  2PVQ A;  2UV8 G;  4WXT A;  3TRQ A;  2WRT A;  3F0I A;  1YDK A;  1X9M B;  2C1Y A;  4ICY A;  3UOM A;  4HEA 2;  1R5A A;  2AV4 A;  1SD8 A;  3VK9 A;  4F03 A;  1YVL A;  5D9T A;  2PUK C;  4F0C A;  2DML A;  4XS4 B;  2VL2 C;  3L9U A;  1T7P B;  5GAP D;  2YAN A;  1X0R A;  3WD6 A;  1K3L A;  4WKW A;  1DE2 A;  1LU4 A;  1UVZ A;  1ERV A;  4P3Y B;  2VLU A;  5GZZ B;  2H75 A;  2X99 A;  2A4H A;  2EC4 A;  1XVQ A;  2X49 A;  3GH9 A;  2M80 A;  2YOI A;  2C3N A;  3TKS E;  3F4R A;  5JWQ B;  2IME A;  2LEG A;  1M2D A;  5G30 A;  1U87 A;  2YWO A;  3D22 A;  1X5D A;  3D6I A;  1FB6 A;  1GUM A;  2A4V A;  2VM1 A;  2IFQ A;  1GTU A;  4BWS A;  2DIY A;  3DKS A;  2GQK A;  4MA9 A;  2EFC A;  1AQV A;  1YF1 A;  2ZUP A;  2CVK A;  1GSY A;  1ACV A;  5IMV A;  5ECN B;  3GH6 A;  4MNN A;  2EIQ A;  4OD7 A;  4IEL A;  2VL2 A;  5HR1 A;  5J40 A;  1U6T A;  2IN3 A;  4ZL9 A;  1Z7R A;  3NOF A;  4W66 A;  5ECK B;  1WRY A;  1MD3 A;  2D2Z A;  1ZYE A;  4NPB A;  3C1R A;  1TRU A;  3KGK A;  3TOT A;  1SL1 B;  6GSY A;  2E2G A;  4GQC A;  4AJ6 A;  3M8N A;  3LFL A;  3PH9 A;  4RQR A;  3UEM A;  2HSM A;  1NW2 A;  2YWM A;  1FVJ A;  1WMJ A;  4MK3 A;  2CX3 A;  2LQO A;  3J7Y b;  1YY7 A;  5A1N A;  1XIY A;  1M2B A;  2FWG A;  2DJJ A;  2FCH A;  3A2V A;  3TJK A;  1S3D A;  4IP6 A;  1HNB A;  2PU9 C;  3DD3 A;  4YKF A;  4NWY A;  4MZW A;  2HLS A;  2CQ9 A;  2E7P A;  4PX1 A;  1PRX A;  4G2E A;  3QOU A;  4TR3 A;  1PN9 A;  1V2A A;  3UL3 A;  3HKR A;  5A34 B;  4EDY A;  5CRH A;  1F2E A;  4LMV A;  1GUK A;  2WJU A;  1GNW A;  1B4Q A;  1OC9 A;  5ECR B;  3VI5 A;  2J9H A;  5AGY A;  4TR4 A;  4E8E A;  4YQM A;  1PGT A;  5INY A;  1XW9 A;  3DWV A;  4XIH A;  2MMZ A;  3F4S A;  5IMZ A;  3F6D A;  5BMU B;  3UVH A;  3WYW A;  1LJR A;  3LSZ A;  2H30 A;  4NV2 A;  3WGX A;  1PL1 A;  2L57 A;  3ZVJ D;  1JZR A;  1N25 A;  2FNO A;  4HJM A;  5D73 A;  3VPQ A;  1WOU A;  1ZOF A;  1J9B A;  2PGT A;  1WJK A;  1A8Y A;  3M9K A;  1X9S B;  9GSS A;  1FAA A;  1T1V A;  3SWL A;  4N3Z A;  4EDZ A;  1VF2 A;  5IPG A;  3D5J A;  3LJR A;  3DML A;  1VF1 A;  1AIU A;  4BVY A;  2JAD A;  2IFQ B;  2C4J A;  1K0N A;  6GSU A;  1YKC A;  3W8J A;  2G0F A;  4NXI A;  2MMN A;  1BG5 A;  3FW2 A;  1Z6M A;  3HCZ A;  3UAR A;  3US3 A;  2C80 A;  1S3C A;  5CP1 A;  2GSS A;  3S9F A;  4V2N A;  4QQ7 A;  1KNG A;  4EL1 A;  4ZL7 A;  3BBY A;  3KJY A;  4O5R A;  2P31 A;  2GZP A;  3CRT A;  3SBC A;  5DQS A;  1FO5 A;  3GST A;  3HMJ G;  1XOA A;  2LS5 A;  4AJ7 A;  2V6O A;  1FOH A;  2PN8 A;  1O8X A;  2FWE A;  1FB0 A;  5IMA A;  2XHF A;  3W8S A;  4WF5 A;  2KUC A;  5ID2 B;  1TK8 B;  2WB9 A;  3LQ7 A;  2HXK A;  1FHE A;  2F8A A;  14GS A;  4MDC A;  3EU4 A;  3EE2 A;  2H01 A;  3MAK A;  4RQX A;  5G1L A;  4XCS A;  5A1N B;  4PNG A;  2GGT A;  3LYK A;  3FZ9 A;  2RM6 A;  2XBQ A;  2H0G A;  1TRS A;  2H19 A;  5ENU A;  3Q74 A;  1MEK A;  2QC7 A;  1ABA A;  3A5W A;  4NHZ A;  2H71 A;  1TXU A;  1PX7 A;  2M72 A;  5C04 A;  4H86 A;  4CY6 A;  4G0L A;  4HI7 A;  1X5E A;  4PTS A;  2CX4 A;  6GSW A;  1SYX A;  3CSH A;  3FEU A;  4OCF A;  1G0T A;  2HZF A;  4PQH A;  2CV4 A;  4NV5 A;  5DAL B;  3C71 A;  4L0W A;  2LRC A;  1SL0 B;  2YZU A;  20GS A;  2L5L A;  3P7X A;  3D0Z A;  3GTU A;  2GZZ A;  2JZT A;  3IAS 2;  2PMT A;  3A2X A;  1B4P A;  3IXR A;  4IBP A;  4OFM A;  1GLP A;  2HRA A;  4ZBA A;  3C73 A;  3MIX A;  3VWW A;  2OE0 A;  4TVE A;  3PPU A;  4A5P A;  5E4W A;  18GS A;  5ECI B;  2H6X A;  2UZ8 A;  4TXV A;  3N9J A;  3GUS A;  1VF4 A;  5JCU A;  1QGV A;  2GS3 A;  2L59 A;  2O5V A;  3GUR A;  2CAQ A;  5IQY A;  2QKE A;  1EP7 A;  4MLY A;  5CNW A;  3H4K A;  3IAM 2;  3CTG A;  1X5C A;  1EV9 A;  4FQU A;  3PR8 A;  2C3Q A;  2K6V A;  2V41 A;  2YP6 A;  4XS4 A;  1K0B A;  5HQP A;  3VI7 A;  1Y6E A;  3CSI A;  2DJ3 A;  2DMM A;  4G01 A;  3QFB C;  4KDY A;  4HOJ A;  3LW9 A;  4YKG A;  1VF3 A;  1GTA A;  2H70 A;  3E9J B;  1SYR A;  3LG6 A;  4ACS A;  3O76 A;  3QAV A;  3BCI A;  2GST A;  4ZB9 A;  3UMA A;  4Z7X A;  2JU5 A;  1JLV A;  4MPF A;  4X1U A;  5EVO A;  2CT6 A;  2HT9 A;  4HQZ A;  3O3T A;  1FG4 A;  4ISD A;  4ULX A;  1Z7P A;  3JCM L;  2L6D A;  3AY8 A;  1I5G A;  1O8W A;  1ZYN A;  1A2M A;  1Z5Y E;  2L4Q A;  1M99 A;  4MAB A;  3QAG A;  5B8B A;  3C7M A;  4CDO A;  3ZLP A;  3KM6 A;  1XZO A;  3ED3 A;  4K5S A;  4O5U A;  4DSQ A;  2H8L A;  3ZIJ A;  4KB3 A;  3U5R E;  5CAX A;  2VCX A;  4PUA A;  1Z9H A;  3EIN A;  4JRR A;  3W6G A;  1SKW B;  1LBK A;  3Q19 A;  4POM A;  5HR0 A;  4YH2 A;  1PKW A;  4KE3 A;  4V2M A;  1H4O A;  2B5Y A;  5CO3 A;  3D4M A;  1ERT A;  2IIY A;  1TTZ A;  1BF5 A;  3GTU B;  2A2R A;  4OFT A;  5KN1 A;  1HNC A;  1M7T A;  4TRX A;  5FT3 A;  1WPI A;  4BVX A;  1WE0 A;  1TU7 A;  5EY6 A;  4L5L A;  1VRS D;  1W89 A;  1ERU A;  1JZO A;  1YF0 A;  2H0H A;  3ZRD A;  4K7N A;  2AYT A;  2WDU A;  1JZW A;  2H0I A;  1XW6 A;  2DC5 A;  3ZFL A;  3IV4 A;  4G9H A;  3GMF A;  3KH7 A;  4K1F A;  4MH3 A;  3QDN A;  1WP0 A;  2JSY A;  3TJJ A;  4AKX B;  2HRN A;  3ZIT A;  1MTC A;  3KTL A;  1B48 A;  3GN3 A;  4O92 A;  4WBJ A;  2VKZ G;  2X8G A;  5F07 A;  3KEB A;  6GST A;  5A34 A;  1XWB A;  3DIE A;  2DJ0 A;  3QPM A;  4N11 A;  1B8X A;  4JR6 A;  4LL4 B;  1ML6 A;  2E2M A;  4NMU A;  5IOW A;  5J4U A;  3TJF A;  5EL8 A;  3GKK A;  3IA1 A;  2B5E A;  3TB2 A;  3P90 A;  4X4J A;  5D9W A;  2C0D A;  3FK8 A;  5AN1 A;  5ELG A;  4LL1 B;  3J7Y k;  2G2Q A;  5HFK A;  2K9F A;  4IKH A;  5BMU A;  4KCE A;  5EPF A;  4I6X A;  2V2G A;  4O5Q A;  2FA8 A;  4NHW A;  4KH7 A;  4L5O A;  1X9W B;  4Q5N A;  3TOU A;  5AIV A;  1UC7 A;  2GTU A;  2XPD A;  2LJK A;  2VL9 A;  1A0F A;  1VGL A;  2HZE A;  1YEX A;  2MMA A;  1K3Y A;  4XHM A;  4FYB A;  1OKD A;  3D4T A;  5KOX A;  5GST A;  4PNF A;  5KN3 A;  4YQV A;  5CRD A;  1YEP A;  3UBL A;  3HA9 A;  4OO4 A;  3WT1 A;  4AKH A;  2V32 A;  1BG1 A;  1F37 A;  1O6J A;  5G5F A;  4AI6 A;  1DUG A;  1GWC A;  1R4W A;  2R0C A;  4TOP A;  2VD0 A;  2H1L A;  4PQI A;  4MF5 A;  2C8U A;  2CZ2 A;  2RII A;  3F6F A;  3L0H A;  3TKS A;  5ID2 A;  5HFG A;  4ZL8 A;  2XC2 A;  4ZIL A;  5G1K A;  4ZBD A;  2YCD A;  4BVX B;  5A5K A;  3HJM A;  2ON5 A;  1JHB A;  3EVI A;  1GH2 A;  4DVC A;  3EYT A;  1TP9 A;  4G0I A;  2GQM A;  4MPG A;  3DVX A;  1EOH A;  2CVB A;  4XS1 A;  4TR1 A;  2LV3 A;  1CQG A;  2DLX A;  2ON7 A;  3IHG A;  2MMO A;  1THX A;  4ML6 A;  4KDX A;  4TW5 A;  3IDV A;  3L4N A;  4J56 E;  1ZMA A;  1GSD A;  3BCK A;  3VWX A;  4FYU A;  5H5S A;  2L6C A;  2TRX A;  4AKI A;  1GTB A;  1NM3 A;  2FGX A;  2K8S A;  5ECM B;  1XXU A;  5C00 A;  6GSV A;  1V57 A;  5DAL A;  3H93 A;  2OT3 A;  5G5E A;  1M2A A;  4ZB7 A;  1MDK A;  3Q18 A;  4OCE A;  3KCM A;  5A4U A;  3L9S A;  4GLT A;  4K5R A;  2VO4 A;  1YZX A;  1RW1 A;  5A4W A;  4KDU A;  4KA0 A;  3BJ5 A;  4USS A;  2Z9S A;  4F0B A;  2EFE A;  11GS A;  2IMD A;  3Q6O A;  3GV1 A;  4N0Z A;  4DSS A;  3RHC A;  4IQ1 A;  5LNK e;  3EPT A;  1EOG A;  3I69 A;  4KAE A;  3G7J A;  2BTO T;  2RM5 A;  3BOA A;  1M0U A;  2EFH A;  3IR4 A;  1SD9 A;  4HDE A;  3DYR A;  4WR5 A;  2C0F A;  3KIJ A;  1SVL A;  5H5Q A;  3R2Q A;  2OBI A;  3DVW A;  2HZE B;  2R3X A;  4F82 A;  2B6M A;  1G7E A;  1F6M C;  1AXD A;  5B7C A;  3K8N A;  1ZGN A;  3ME8 A;  4KCA A;  4J57 E;  3ZTL A;  5IO2 A;  1EGO A;  1SU9 A;  2YN1 A;  1JLW A;  2VAF A;  1S3A A;  3GNJ A;  1TKD B;  3GFK A;  2MBT A;  3CMI A;  2KHP A;  2DKH A;  3RAZ A;  3MNG A;  2DJ2 A;  5DDL A;  1XWA A;  3ERG A;  2WCI A;  4MJB A;  1O85 A;  3ERW A;  2CAI A;  2B3S A;  2B5X A;  1J08 A;  1WIK A;  1TW9 A;  3F63 A;  2YV9 A;  5BRT A;  1XFL A;  3HZ8 A;  1OE7 A;  1O81 A;  2YV7 A;  5E59 A;  1AQW A;  4IW9 A;  3UBK A;  3CYN A;  3NIV A;  1K3O A;  2NPB A;  1SEN A;  3GSS A;  2ZCT A;  2PER A;  1O7U A;  3TU3 B;  3L78 A;  2R4V A;  3ZMK A;  1GLQ A;  4BL7 A;  4EUY A;  4ECJ A;  4TR1 B;  4O32 A;  1ZL9 A;  1UN2 A;  3TKR A;  4ECB A;  3HDC A;  2AHE A;  4AJ8 A;  2J23 A;  2HSY A;  1C72 A;  2F8F A;  3M9J A;  5DJM A;  3BD2 A;  4HU9 A;  1T4Z A;  3G7I A;  1EWX A;  3GX0 A;  2I9H A;  5ECO B;  4I2T A;  1V9W A;  2HSN B;  4RUV A;  2QSI A;  2OJL A;  17GS A;  3GYK A;  2NTO A;  2YNX A;  1MDI A;  4HU7 A;  5DBQ A;  2E0Q A;  2AB6 A;  2GVP A;  2C0E A;  3I43 A;  4HQS A;  1T4Y A;  4EC0 A;  4N10 A;  2OE3 A;  1TRV A;  4LLR A;  3IC8 A;  2GSQ A;  4MF6 A;  5HR2 A;  4DSS B;  4I8B A;  5JCG A;  1WWJ A;  1FOV A;  2JZS A;  3HJO A;  5D93 A;  1M9B A;  5IO0 A;  3DEX A;  5FWG A;  2YJ7 A;  2OA7 A;  4X0X A;  1JZD A;  2ES7 A;  4WF4 A;  3ZVJ A;  3FKF A;  4N30 A;  3I9V 2;  3A5I A;  5IPH A;  1B9Y C;  2H1G A;  1PMT A;  3VWV A;  4K7I A;  2OAD A;  3ZZX A;  5IMF A;  5JWO B;  1JFU A;  2WFC A;  2A2S A;  2VD1 A;  2L5O A;  2O7K A;  1ST9 A;  3FZA A;  3TGZ A;  3GKN A;  4Q5Q A;  2LUS A;  3FHK A;  5AIX A;  2DBC A;  4QMK A;  2VCZ A;  2X8C A;  2FA4 A;  1OC8 A;  5ECS A;  1TU8 A;  3APQ A;  1SJZ A;  2I3Y A;  4EE0 A;  1NHO A;  1HD2 A;  1XVW A;  3GRX A;  1T8E B;  3UVT A;  3CBU A;  4EO3 A;  13GS A;  4K0N A;  4POB A;  2AJQ B;  4K8M A;  1QXH A;  1ZYQ B;  1E2Y A;  1PN0 A;  4RI6 A;  3EUR A;  5A5H A;  2OAC A;  4FO5 A;  1V58 A;  2ALB A;  3GKM A;  1MDJ A;  3LWA A;  5JWR B;  2YWI A;  2EIO A;  1M9A A;  1TDI A;  1BQ7 A;  1GP1 A;  1F3A A;  5F0G A;  4BL7 B;  8GSS A;  2FHE A;  3ME7 A;  5ECP B;  1TI3 A;  3EMX A;  4DSR A;  4QL7 A;  3QAW A;  1SJI A;  2R2J A;  2N5B A;  3GL5 A;  4QL9 A;  4PGT A;  4GST A;  1RQM A;  2H6Y A;  2BMX A;  2PBJ A;  3F8U A;  3IRA A;  3DRN A;  4JED A;  1PL2 A;  4ZXG A;  4ECI A;  3ZYW A;  3LEF A;  4E8H A;  1QMV A;  3RBT A;  4K0G A;  2HRF A;  5D9V A;  3E3E A;  1R26 A;  1GUL A;  5JCW A;  1GSQ A;  3MSZ A;  5CRW A;  2M46 A;  4EIP A;  3FMW A;  1A8L A;  1OKT A;  5G2Z A;  3ZML A;  2LRN A;  3E0U A;  3V1W A;  1PA3 A;  4IP1 A;  3LYP A;  4Z2U A;  2LJR A;  3MDK A;  2A2P A;  4AGS A;  5F06 A;  1EZK A;  3HXS A;  2VL3 A;  3F3Q A;  2O87 A;  4FIW A;  3TUE A;  3H1N A;  2OKA A;  5D96 A;  2K8V A;  3DGQ A;  3TCO A;  2B7K A;  4NAX A;  4JE1 A;  4ZB6 A;  3GA4 A;  1AAZ A;  1SL2 B;  1H75 A;  1K0O A;  3CRU A;  1BYE A;  4MH2 A;  3ERF A;  1DBY A;  3P8W A;  2NVL A;  4MZC A;  4ZIJ A;  2GT6 A;  4EXJ A;  1K0M A;  3TRP A;  2YWN A;  1GSU A;  1Y25 A;  2HE3 A;  4IVF A;  4JBB A;  2LST A;  2P5Q A;  3L9V A;  2OBK A;  1ZYP A;  3HVX A;  1SVM A;  3QMX A;  2O8V B;  1TK5 B;  3ZRE A;  3APS A;  3FRC A;  2EIR A;  4POK A;  1OE8 A;  4MF7 A;  5J9B A;  4L8E A;  3U6V A;  1FVK A;  2QA2 A;  3TJG A;  4ZB8 A;  5CRG A;  1G6Y A;  2X8H A;  3M1G A;  2KLX A;  3C1S A;  3GL3 A;  5KN0 A;  3TKS C;  1XWK A;  4AF2 A;  2LRT A;  2AAW A;  2H1A A;  2LQQ A;  4TR0 A;  1QFN A;  1GRX A;  19GS A;  5ECQ B;  3HJP A;  4MJC A;  1BAY A;  4OFN A;  4ILF A;  2ZNM A;  4KSM A;  2H73 A;  3IBH A;  5A5H B;  4KW6 A;  1NSW A;  4FYC A;  4KUN A;  3VFI A;  7GSS A;  2LNS A;  3LXZ A;  5L71 A;  4GF0 A;  2O85 A;  4BPY A;  1AW9 A;  1XPV A;  3ZFB A;  4TXO B;  5J4Y A;  2P0G A;  4IGJ A;  6GSS A;  3KMN A;  1HQO A;  2V6K A;  5DAK A;  2GZY A;  4N0V A;  1URM A;  3H79 A;  1A0R P;  1A2L A;  1ERW A;  2JL4 A;  1B9X C;  2VIM A;  4I2U A;  1K0C A;  2R0G A;  4IS0 A;  4XS6 A;  3HHV A;  4ECC A;  2PPT A;  2KP2 A;  1Y1U A;  1N2A A;  5D9X A;  2HSH A;  4EIQ A;  4OO5 A;  3FYG A;  4HUA A;  3KMO A;  4PUR A;  5IMD A;  5IIZ A;  3UAP A;  4V1A g;  1GUH A;  4WR4 A;  3QD9 A;  1R5P A;  4EVM A;  2HRK B;  4YAV A;  4XTS A;  3FZ4 A;  2R0P A;  5LD0 A;  1PSQ A;  1U3I A;  5J9C A;  3M3M A;  3TDG A;  4XRD A;  5J3R A;  2GDR A;  4Q5R A;  3C8E A;  1BJX A;  1EEM A;  1Q98 A;  1SKR B;  3HD5 A;  3RPN A;  1T00 A;  1J0F A;  2F9S A;  12GS A;  2GSR A;  1XWG A;  2QGV A;  3QR6 A;  4XRA A;  3QFA C;  3TJB A;  1A2J A;  2VOC A;  5GSS A;  1ILO A;  5ELA A;  2IMF A;  3EMP A;  3HZ4 A;  1SK1 A;  1W4V A;  2MZC A;  1V98 A;  4ML1 A;  3F9U A;  2FWF A;  1SK2 A;  2R37 A;  2XBI A;  4GQF A;  4WEY A;  1PKZ A;  10GS A;  3M0F A;  1G7O A;  1YKA A;  4K2X A;  5FHI A;  1YQ1 A;  2RLI A;  1USB A;  4D73 B;  5DJL A;  5KN2 A;  2B1K A;  5J41 A;  4Z2T A;  2HSN A;  1YJ6 A;  2P5R A;  3VLN A;  2NDO A;  1XBS A;  3PIN A;  4DEJ A;  4JR4 A;  4GSN A;  1IYI A;  2F3M A;  1GTI A;  2YPM A;  3F3R A;  5IMC A;  3ZIV A;  2C3T A;  1GL8 A;  2PWJ A;  1HNA A;  2IWT A;  2RUE A;  2X64 A;  1HYU A;  1SK0 A;  4I5Q A;  1CQH A;  1THO A;  1TOF A;  4KX4 A;  2OE1 A;  3F4T A;  3GIX A;  1PX6 A;  2YZH A;  2H66 A;  2H74 A;  1SVO A;  2VCQ A;  4G19 A;  3GKX A;  1XOB A;  2K18 A;  4OMV A;  2FLS A;  4WBR D;  4YAP A;  5DCG A;  3RHB A;  5J47 A;  1Z6N A;  5DAK B;  5AIS A;  5B8A A;  1TJD A;  3ZL5 A;  4ID0 A;  4MJE A;  1GSE A;  2GLR A;  3ISO A;  1V40 A;  2LJA A;  4KND A;  1T3B A;  1NHY A;  2R5G A;  1FW1 A;  1KTE A;  1GNE A;  4ZBB A;  4AKG A;  3LOR A;  16GS A;  4IJI A;  3VWU A;  1G6W A;  1K0A A;  2VCV A;  1TI1 A;  1OYJ A;  4K9Z A;  1TRW A;  1BED A;  5DCH A;  3KD0 A;  3QCP A;  4MMM A;  2B1L A;  3OR5 A;  4MCU A;  4V2L A;  2FY6 A;  2VUP A;  2WS2 A;  3CSJ A;  2DJ1 A;  2DKI A;  3VPT A;  1AC1 A;  4J2F A;  5D8I A;  1BX9 A;  3IE3 A;  3APO A;  5DQY A;  2C0G A;  1EGR A;  3DXB A;  3MWH A;  4G10 A;  1A24 A;  2HSM B;  1XW5 A;  3IK9 A;  4BWQ A;  1F9M A;  2FUG 2;  2CVD A;  3HVV A;  3IOS A;  3WT2 A;  2R6K A;  4CY8 A;  4GWR A;  2IL3 A;  3FR6 A;  5J5N A;  2F51 A;  5CRE A;  1Q4J A;  2HQT A;  3CTF A;  4GXZ A;  3KP9 A;  2IJY A;  1OC3 A;  1OVN A;  3GHA A;  2NBS A;  1N8J A;  4I97 A;  5KOW A;  3RDW A;  2VCW A;  2H76 A;  5COH A;  1ON4 A;  3PGT A;  5F05 A;  2KP1 A;  3D21 A;  5LCZ A;  4IN0 A;  1ZCP A;  5B6N A;  2CZ3 A;  1I9D A;  3WGD A;  1MD4 A;  4PUF C;  4LMW A;  2VCT A;  2L4C A;  4GCI A;  3O6T A;  4POL A;  4FH8 A;  1DE1 A;  2TRC P;  1E6B A;  1OC9 B;  4BA7 A;  4JZQ A;  1EEJ A;  3KP8 A;  4CHS A;  4Z2R A;  2WGR A;  4MP4 A;  2O89 A;  1TK0 B;  3H8Q A;  2MYG A;  3FR3 A;  2I4A A;  3G9B A;  2JSZ A;  4IJ3 A;  2N5F A;  4CW9 A;  2RUF A;  2PVO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...