3DGQA

Crystal structure of the glutathione transferase pi enzyme in complex with the bifunctional inhibitor, etharapta
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Rational design of an organometallic glutathione transferase inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3dgqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dgqA01
1R5AA 4OO5A 3TKQA 2JZSA 1M2BA 1N2AA 3C7MA 2C0DA 2YNXA 4XS4A 3EU3A 1FAAA 2VUPA 5F06A 4JZQA 4EE0A 3GA4A 2WJUA 3LYPA 2LEGA 2H66A 3A3TA 2LRNA 2KHPA 1XWKA 1XWGA 2OBIA 1JZRA 2VCXA 2VM2A 2M46A 2HRAA 1ON4A 1AQWA 1MD4A 5ECNB 4MK3A 1GSEA 3IXRA 3ZFLA 3GH6A 3R3EA 2YOIA 3G7IA 4F0BA 2WGRA 5ECMB 4KCAA 1K0BA 3TJJA 4MH3A 5H5QA 11GSA 4MF7A 5ECQB 2HLSA 4PQHA 4EXJA 1LBKA 1HYUA 3PPUA 4PQIA 4XS1A 3LFLA 4AJ6A 3UEMA 3TOUA 5CAXA 2R37A 3TKSE 1HQOA 3KZQA 4WEYA 4ECJA 1EP7A 2H0IA 2M72A 1O81A 2OE0A 2GQLA 4MJEA 1DSBA 2FA8A 2PWJA 4JBBA 3GSSA 5D93A 2YZUA 2FNOA 2DJ2A 4TXOA 3GSTA 2HT9A 3QMXA 4HEA2 4G19A 1ILOA 2DJ3A 1XOBA 4HS1A 3RHBA 4G2EA 4LMVA 1XVWA 4NPBA 2KP2A 2LJAA 2GVPA 1AQVA 1YF1A 3FEUA 2DMLA 4KSMA 1TOFA 2WFCA 3F4SA 3F4RA 4XCSA 5DQSA 2C3NA 2C0EA 4DEJA 2HE3A 5DDLA 3IHQA 2VCTA 2NPBA 1R26A 5B8AA 2GSQA 4J57E 3APQA 1JZDA 3GTUB 1PN9A 1BAYA 2V1MA 2VCVA 2IL3A 1MDJA 4FIWA 4AF2A 12GSA 5FWGA 1BYEA 5EY6A 2DJKA 4OO4A 3IR4A 7GSSA 5D73A 1UA5A 1WWJA 3K8NA 3GN3A 4MF5A 17GSA 2C0GA 3LXZA 4TOPA 4L5OA 2CAQA 3HJMA 3IV4A 1XWAA 4I97A 4K7IA 3KP9A 2RM6A 5HFIA 3APOA 2L6DA 5KN1A 2H6YA 3CTFA 4ISDA 3IK9A 2OBKA 2O85A 4YQUA 2WDUA 3HVXA 1OC9B 4K7OA 4MPGA 5G2ZA 18GSA 4IP1A 4PNFA 4KDUA 4V2LA 2K8SA 2VM1A 4O5RA 1TTZA 4TR1B 4BWSA 1QQ2A 2JACA 1YKCA 1F6MC 3IC4A 1ERWA 2HNLA 1GSSA 5CRWA 4F0CA 4K6XA 1GSYA 4O32A 2P5RA 4PX1A 2MYGA 4XRAA 1XXUA 3BCIA 2AJQB 4HU9A 2B6MA 2H76A 2F3MA 1M9BA 1SL2B 3WGEA 5F05A 5EPFA 4OFMA 3FR6A 2L4CA 4TR4A 3M1GA 1WP0A 5J3RA 1URMA 5D9TA 1MDKA 6GSVA 5CYYA 3EU4A 1FHEA 3ZFBA 4EO3A 2K8VA 5ECIB 3TRPA 4EDYA 2ALBA 2XBIA 2V2GA 3W8JA 3D0ZA 2LV3A 2TRXA 2FLSA 1WRYA 2QC7A 2X99A 1GTBA 1OVNA 2NDOA 5JCGA 4TW5A 5DCHA 2VL2C 4MPFA 3MDKA 3WYWA 2YJ7A 3ZVJD 3LORA 1DE1A 1N8JA 4BL7B 5IO0A 2VCZA 3TRXA 5G1LA 1X9WB 3ZMKA 3HD5A 1PA3A 2H0HA 4MABA 4ZILA 5DALB 1SJIA 1B9YC 5A5KA 2OJLA 4CHSA 3KGKA 3RHCA 2HSMA 1H4OA 3TKSA 4YQMA 3UBLA 2YP6A 1I5GA 1K0DA 3KJYA 5IMDA 5ENUA 5JWQB 4PUAA 1O73A 3TJGA 4YH2A 1X9SB 3A2VA 1V98A 1H75A 2AUVA 2KP1A 5C04A 3BBYA 4K0GA 4L5LA 4DVCA 2PPTA 3L9UA 1K0AA 2PMTA 3ISOA 1UVZA 1Q98A 3N9JA 4GLTA 2JSZA 2PN8A 2PUKC 3GL5A 2JADA 4ILFA 4IJIA 1GRXA 5DVBA 4CDOA 3ERFA 4MF6A 4QQ7A 5H5SA 3ERWA 2OACA 2EC4A 1U87A 2YJHA 1ZGNA 6GSSA 4MJAA 4EKZA 3O6TA 1PQNA 2Z9SA 1A8YA 4F9ZA 4BA7A 1GUHA 2IFQB 3GKKA 3HY2A 1RW1A 1Z9HA 4OMVA 1M0UA 6GSWA 2GQMA 4WF4A 5DJMA 2X64A 1A2MA 1S3AA 3QOUA 2E2MA 5H5RA 2DMMA 2LRCA 1X5CA 1YEXA 3H4KA 4N30A 2GT5A 3F4TA 3S9FA 3F6FA 1SENA 2KUCA 4OD7A 2BMXA 1IYHA 1G7OA 3C73A 5AGYA 4XHMA 2OKAA 1EWXA 1EOHA 1A8LA 4G0IA 3A2WA 1ACVA 3D21A 3QR6A 3DEXA 3D4TA 3L4NA 5A4WA 1U6TA 3O3TA 4WBRD 3IRAA 5HFKA 1GWCA 5CRGA 1JZWA 2CZ2A 2HSMB 4HZ2A 2HYXA 4LMWA 5IMAA 2R4VA 5JWRB 3FR9A 4YAPA 2LQOA 1E2YA 2H30A 3VI7A 3AY8A 4PQ1A 2H72A 5LD0A 4IJ3A 2XPDA 4QL7A 1BJXA 4BVYB 2B3SA 2H75A 5IOWA 1M2AA 2TRCP 1USBA 1QXHA 1PGTA 2D2ZA 3NOFA 3FW2A 1XW6A 4HQZA 3TJFA 5J5NA 1SK2A 6GSYA 2GZPA 1VF3A 4E8EA 1FB6A 1GUKA 2VAFA 1F37A 3GUSA 5CRHA 1J9BA 1PX6A 1B48A 3QCPA 1HNAA 5ECOB 4GQFA 3FK8A 4RQXA 1XWBA 5F8BA 1EGRA 5IPHA 1TK5B 2CAIA 5JCWA 4I2UA 5G5FA 4DSSB 1PL2A 1W89A 1A0FA 3GTUA 4GXZA 1X5DA 3D6IA 3E9JB 5DJLA 2GZZA 3FKFA 3ZITA 4EDZA 2O87A 1EV9A 1ERVA 2H01A 2MMAA 3KH7A 3NIVA 3GH9A 3WGXA 2GSRA 1BQ7A 5HFGA 1G0TA 4PUFC 1EEJA 4IBPA 5IMVA 4BVXB 1ZYQB 3WGDA 3KM6A 4ML1A 2F51A 1M2DA 2H6XA 4IELA 2OA7A 4H86A 3RPNA 3EYTA 3EVIA 1S3DA 3MNGA 3IC8A 5F0GA 5AN1A 1OKDA 3FZ4A 3GX0A 5B6NA 2GT6A 1MEKA 4NHZA 2LJKA 1OYJA 1O85A 5D9XA 4L0WA 1FG4A 3CYNA 2IMFA 3GX8A 3HVVA 5ID2B 1OC9A 2I1UA 3DIEA 3HZ8A 2MBTA 3D5JA 5AIVA 2L6CA 2HSYA 1MD3A 3HZ4A 3LYKA 1QFNA 4TR1A 2IMIA 3UOMA 1SL1B 4ZB9A 3J7Yb 3DD3A 1NW2A 5IQYA 1K3OA 4PTSA 3LQ7A 2JSYA 3JCML 2YPMA 3BJ5A 1OC3A 1T4YA 3GHAA 2HXKA 3F63A 2FWFA 1JLVA 2B1KA 3VFIA 2HFDA 3CMIA 3CSIA 4IN0A 3EWLA 2VIMA 1U3AA 2CVKA 2L5LA 3EURA 4J2FA 1B4QA 1GUMA 3CBUA 3GYKA 5CO3A 1TJDA 2H19A 2FWHA 1Z7PA 4IHUA 2F9SA 3ZTLA 3H93A 4GQCA 2LQQA 2FHEA 5D9WA 2ES7A 2MZCA 2UZ8A 3OR5A 5KN0A 4LA1A 3Q19A 2H74A 4TRXA 4EVMA 2YV7A 1GULA 1SYRA 3VWUA 4D73B 3UVTA 2HRKB 3M3MA 2DJJA 4TR0A 3EINA 5GAPD 3I9V2 4BL7A 2WB9A 1PD21 1TP9A 2WCIA 5F07A 1THXA 2E7PA 2IIYA 1AQXA 3UARA 4JR6A 1TK8B 3F3QA 3M9JA 3QFAC 1WE0A 5DALA 2P31A 1SJ6A 2R2JA 1ZOFA 2VCQA 4KNDA 5ECKB 2CX3A 1O6JA 3C8EA 4GTUA 1XPVA 1B4PA 1VF1A 2KLXA 3HYPA 1CQGA 1SKSB 2JZTA 3FZAA 3DYRA 4MCUA 3CXGA 2PBJA 1FB0A 2LNSA 3GNJA 4GCIA 5J9CA 3U6VA 4O92A 1NHOA 4RQRA 4N0VA 3UMAA 3WT1A 1B8XA 1EP8A 1O8XA 3TCOA 3I6AA 1AUCA 1BX9A 4JU5A 1YZXA 3UL3A 3HA9A 3RAZA 1GSFA 4PGTA 4I8BA 5B8BA 3KCMA 22GSA 1EGOA 3IK7A 2X8CA 3KMOA 3HCZA 3LG6A 1JFUA 2H1BA 1OKTA 4IVFA 1C72A 3MSZA 3P2AA 4FYUA 2LTKA 1ERTA 3PH9A 1K0NA 2O7KA 5ECHB 4G10A 2VLTA 4ECBA 4KDYA 1K0CA 4GSTA 2M80A 2DC5A 1SYXA 3GL3A 3ZIJA 2IFQA 2WRTA 4ULXA 2YV9A 2C4JA 4XTSA 3KXOA 1ERUA 20GSA 4ML6A 3NZNA 2H0GA 3ZVJA 3HKRA 3VLNA 1Z6NA 2LJRA 4HZ4A 4Q5QA 4KF9A 2HI7A 3TKSC 1M7TA 1TI3A 4FO5A 2O8VB 4WKWA 4N11A 4LLRA 2QKEA 4OFTA 2L59A 3W8SA 2V6KA 5BMUA 5IMCA 1TW9A 5JCUA 3LEFA 2DSAA 4K8MA 4RI6A 4KSOA 3RDWA 1WJKA 4FYBA 2DLXA 2ZCTA 1SU9A 4HJ2A 4TVEA 3CSHA 3DVXA 2H6ZA 1SK0A 3RBTA 5DAKA 6GSUA 1OE7A 3GKXA 4ZBBA 3G9BA 5A4UA 2N5FA 1YDKA 1FVJA 4ZL9A 3WD6A 2B5EA 1YKAA 1WMJA 3HJPA 5ECLB 4MLYA 5IMZA 3CRUA 10GSA 2AHEA 3TGZA 2C80A 4L0UA 4BVYA 2FGXA 2N5BA 4AJ7A 2GS3A 4TKYA 3Q74A 1FVKA 1ML6A 2LNTA 2CV4A 1FW1A 1T4ZA 1GSUA 5C00A 2ON7A 2VD1A 5GSSA 2DJ0A 4MJBA 3MAKA 2DJ1A 1KNGA 2EIOA 3GURA 5HR0A 4RUVA 4ZXGA 14GSA 5COHA 2AYTA 3IA1A 1SL0B 4AGSA 2B7KA 4POKA 3QPMA 1AXDA 1XW5A 1VF2A 4KAEA 3ED3A 1DUGA 3DVWA 3I43A 3L9SA 2I4AA 1Y6EA 5IMFA 3F9UA 1ST9A 3HDCA 2XPEA 4WR5A 3LXTA 2A2SA 2NVLA 2YCDA 1T1VA 1QGVA 3DRNA 4DSSA 3LGCA 4YQVA 4AJ8A 2VL3A 2H70A 4BPYA 1XVQA 1A23A 3Q6OA 4TXVA 4IQAA 2H8LA 2ZNMA 1GSQA 2JZRA 4ECIA 2LS5A 5HR2A 2WULA 3TUEA 3ERGA 3EMPA 3TRQA 3BOAA 3O76A 1HNBA 4PXOA 2RM5A 4BVXA 9GSSA 5DAKB 3PINA 5FT3A 4OCEA 2C3QA 4EL1A 1NM3A 4FH8A 2CQ9A 5IOXA 3KEBA 3ZRDA 5INYA 2AAWA 1GLQA 5KN2A 4WBJA 2R5GA 4ECCA 3GKNA 5JWOB 2TIRA 2XHFA 1QUWA 3F8UA 2C8UA 1M9AA 5ID2A 2B5YA 4N10A 3M8NA 3J7Yk 2CVBA 1A0RP 5DQYA 4ZBAA 1ZCPA 1GTAA 2GLRA 5KEJA 4X43A 2GZYA 4LL4B 4F82A 3KIJA 3FZ9A 4K0NA 4MA9A 4Q5NA 4USSA 4ZBDA 2GQKA 4GF0A 2XC2A 3H8QA 1LU4A 1QMVA 5GSTA 3M0FA 2WZ9A 4Q5RA 4IQ1A 1V57A 2IN3A 2A2RA 3UBKA 3VWWA 4NHWA 3TOTA 2OE1A 4HU7A 2HZEB 3F0IA 3KTBA 3EE2A 4GRFA 3ZYWA 3US3A 5CRDA 2JU5A 1S3CA 2FUG2 1BG5A 2IPAA 4BWQA 4MZCA 2CA8A 1EV4A 2XBQA 3TDGA 4NV2A 4D73A 1DBYA 2HRKA 1U3IA 2ON5A 1GSDA 3VK9A 1M99A 3L9VA 2HRNA 3QAWA 2A4VA 1AAZA 2B5XA 1XW9A 4QL9A 1OC8A 4HUAA 5GAND 2C1YA 4K9ZA 3CSJA 2MMNA 1YF0A 4I2TA 1AIUA 4ACSA 1GH2A 2AV4A 2K6VA 2FY6A 3A2XA 3DMLA 4HQSA 1A2JA 4EC0A 2MMOA 1DE2A 1XZOA 3ZZXA 2FD3A 4K2DA 2VO4A 2E0QA 2K9FA 4F2IA 2CVDA 2PGTA 4YAVA 2F8FA 2IJYA 1F9MA 4DSQA 1G6YA 3UVHA 2LSTA 3TKPA 2FA4A 4ZB8A 4KE3A 2AB6A 1IYIA 4HOJA 1TI1A 5GZZB 1VF4A 1GNWA 5J4UA 1PMTA 2I9HA 2WS2A 3TKRA 2OE3A 3ZL5A 3LSZA 4JEDA 4KCEA 4ID0A 1MDIA 2BTOT 1T00A 5E4WA 5D8IA 1F3AA 4POMA 5IPGA 3Q18A 1TKDB 1A24A 1GNEA 5ELGA 1GLPA 1W4VA 4G0KA 3R2QA 5AISA 4IKHA 1K3YA 1NSWA 3CRTA 2V32A 3ZLPA 1SKRB 5ECPB 1HD2A 4KGIA 4ZIJA 3F6DA 1O7UA 3UJ1A 3HJOA 2IMDA 1JHBA 3L78A 4JE1A 2H71A 3P7XA 3ME7A 1Z6MA 2HSHA 5ABRA 1I9DA 3UIWA 2R3XA 4NV5A 1XCCA 1HNCA 2PERA 3SBCA 1UN2A 1ZYEA 4ZB6A 1TRSA 5B6MA 4TN8A 3IBHA 3C71A 3CTGA 3VWXA 2K18A 13GSA 3DGQA 5IO2A 4KA0A 3H79A 4I5QA 4XS4B 2RIIA 1YEPA 5CNWA 1B9XC 3TB2A 2IMEA 3EC3A 3QAVA 2IWTA 4OFNA 3KD0A 2CT6A 3E0UA 3C1SA 3P90A 2YN1A 3LWAA 3HHVA 1XIYA 4POBA 5G1KA 2G0FA 3P8WA 2V6OA 3FR3A 2CX4A 1K0OA 1J0FA 4FQUA 3GKMA 4V1Ag 1QK8A 1THOA 1RQMA 5EL8A 3GIXA 3LJRA 1XFLA 4MMMA 4MP4A 4J56E 3VPTA 3FY7A 3SWLA 4OWYA 3QDNA 4MZWA 1KBNA 1BEDA 4Z7XA 3MWHA 2BJXA 2DBCA 4NAXA 4TR3A 4E8HA 1SD8A 5A4VA 3VI5A 1Y25A 2NBSA 1R5PA 2L5OA 1FOVA 4NWYA 4XIHA 2LUSA 2X8GA 3V1WA 5L71A 2L57A 2RUFA 4PURA 4GSNA 4JRRA 1V58A 2LRTA 3IAS2 3U5RE 4EF0A 2VL9A 1TRUA 1T8EB 1TU7A 4WF5A 4F03A 1KEBA 3PR8A 3HVSA 3ZMLA 1VGLA 2GDRA 1XWCA 1K0MA 2H1DA 1Z3EA 4I6XA 4TXOB 3KH9A 2YWMA 1Z7RA 5LCZA 3KP8A 2J9HA 2DIYA 2VD0A 3UAPA 2FCHA 3GV1A 1OE8A 2N5AA 5KN3A 4EUYA 4IGJA 1YQ1A 4MZBA 1TDIA 2P0GA 2YZHA 1ZMAA 1YJ6A 5E59A 1TRWA 3GMFA 4G9HA 2VLVA 2FWGA 1Z5YE 3KMNA 2J23A 3TJKA 1OAZA 2GSTA 4LL1B 2B1LA 3VPQA 5ECRB 4IW9A 5D9VA 4NXIA 5G30A 5AIXA 2KOKA 2ZUPA 2JL4A 1UC7A 2EIRA 5D96A 4MDCA 1X5EA 1PSQA 1JZOA 3EMXA 2VLUA 2HSNB 2FWEA 2CZ3A 4KUNA 2E2GA 1R4WA 1XBSA 1G7EA 1V2AA 1YY7A 2X8HA 1GP1A 1T7PB 1GTIA 4V2MA 4NMUA 5HR1A 1F3BA 3E3EA 4OCFA 1SK1A 1J08A 2REMA 1EZKA 4L8EA 1VRSD 4KDXA 3N5OA 1TK0B 1X9MB 2I81A 3G7YA 3RPPA 8GSSA 2F8AA 1LJRA 2VL2A 1FO5A 2C0FA 1ABAA 1WPIA 4KW6A 4JR4A 2VCWA 5EVOA 3A5WA 3QFBC 4X0XA 3C1RA 1U88A 4POLA 2PU9C 4MJCA 1PL1A 2H73A 5G31A 3IPZA 3GRXA 1ZL9A 3L0HA 2H1GA 4N0ZA 2GTUA 1EEMA 2H1AA 4HDEA 5DBQA 2IMKA 2HZEA 3D4MA 6GSXA 2YWIA 3HXSA 4WETA 2R6KA 4FYCA 5CREA 1CQHA 1SJZA 5HR3A 6GSTA 5IM9A 4XRDA 4K7NA 1EOGA 3W6GA 3DKSA 3QD9A 4O7HA 1O8WA 5ELAA 4RI7A 1ZZYA 3IDVA 1PX7A 3QAGA 4CW9A 2PVQA 4KH7A 1SKWB 2MMZA 2HRFA 1WOUA 4IP6A 4GSSA 3BCKA 4GWRA 5DCGA 1TU8A 3VURA 2P5QA 3DXBA 4ZL8A 2LKUA 2VOCA 1JLWA 1V40A 5CP1A 3PGTA 3I69A 4XS6A 19GSA 3IE3A 1RK4A 4V2NA 2OADA 5B7CA 1TXXA 1Q4JA 4WXTA 1R7HA 1K3LA 2O89A 1E6BA 3TJBA 3KTLA 2QSIA 2RUEA 2V41A 2C3TA 3G7JA 2RLIA 1F2EA 1A2LA 1NHYA 3ME8A 3FYGA 4ZL7A 3H1NA 5ECSA 1T3BA 16GSA 1PRXA 4G0LA 3WT2A 4K1FA 4WR4A 2HZFA 3D22A 1V9WA 3GFKA 2DIZA 2EIQA 1WIKA 4P3YB 3FZ5A 3M9KA 1AW9A 3ZIVA 3ZREA 1PKWA 2HQTA 3BD2A 1SD9A 1G6WA 2NTOA 5HQPA 5LNKe 2MBSA 4Q5FA 3FHKA 3IAM2 5J41A 1TRVA 3IOSA 4PNGA 2L4QA 3APSA 1GL8A 4X1UA 3VWVA 2YWOA 4HI7A 4HJMA 2PVOC 1AC1A 4MH2A 3FRCA 1PKZA 3DWVA 2YWNA 2GSSA 4KX4A 2B7JA 1KTEA 5J9BA 3F3RA 2G2QA 2YANA 4KB3A 1MTCA 5FHIA 1GTUA 2GGTA 1XOAA 5IIZA 4V1Ap 2QGVA 2I3YA 4IS0A 4DSRA 5G5EA 1X0RA
chains in the Genus database with same CATH superfamily
1R5AA 4OO5A 3TKQA 2JZSA 1M2BA 1N2AA 3C7MA 2C0DA 2YNXA 4XS4A 2QA1A 3EU3A 1FAAA 2VUPA 5F06A 4JZQA 4EE0A 1SVLA 3GA4A 2WJUA 3LYPA 2LEGA 2H66A 1M3IA 3A3TA 4AKGA 2LRNA 2KHPA 1XWKA 1XWGA 2OBIA 1JZRA 2VCXA 2VM2A 2M46A 2HRAA 1ON4A 1AQWA 1MD4A 5ECNB 4MK3A 1GSEA 3IXRA 3ZFLA 3GH6A 3R3EA 2YOIA 3G7IA 4F0BA 2WGRA 5ECMB 4A5PA 4KCAA 1K0BA 3TJJA 4MH3A 5H5QA 11GSA 4MF7A 5ECQB 2HLSA 4PQHA 4EXJA 1LBKA 1HYUA 3PPUA 2OT3A 2R0GA 4PQIA 4XS1A 3LFLA 4AJ6A 3UEMA 3TOUA 5CAXA 2R37A 3TKSE 1HQOA 3KZQA 4WEYA 4ECJA 1EP7A 2H0IA 2M72A 1SVMA 1O81A 2OE0A 2GQLA 4MJEA 1DSBA 2FA8A 2PWJA 4JBBA 3GSSA 5D93A 2YZUA 2FNOA 2DJ2A 4TXOA 4AKIA 3GSTA 2HT9A 3QMXA 4HEA2 4G19A 1ILOA 2DJ3A 1XOBA 4HS1A 3RHBA 1PN0A 4EIPA 4G2EA 4LMVA 1XVWA 4NPBA 2KP2A 2LJAA 2GVPA 1AQVA 1YF1A 3FEUA 2DMLA 4KSMA 1TOFA 2WFCA 3F4SA 3F4RA 4XCSA 5DQSA 2C3NA 2C0EA 4DEJA 2HE3A 5DDLA 3CQFA 3IHQA 2VCTA 2NPBA 1R26A 5B8AA 2GSQA 4J57E 3APQA 1JZDA 3GTUB 3EPTA 1PN9A 1BAYA 2V1MA 2VCVA 2IL3A 1MDJA 4FIWA 4AF2A 12GSA 5FWGA 1BYEA 5EY6A 2DJKA 4OO4A 4Z2UA 3IR4A 7GSSA 5D73A 1UA5A 1WWJA 3K8NA 2HSNA 3GN3A 4MF5A 17GSA 2C0GA 3LXZA 4TOPA 4L5OA 2CAQA 3HJMA 3IV4A 1XWAA 4I97A 4K7IA 3KP9A 2RM6A 5HFIA 3APOA 2L6DA 5KN1A 2H6YA 3CTFA 4ISDA 3IK9A 2OBKA 2O85A 4YQUA 2WDUA 3HVXA 1OC9B 4K7OA 4MPGA 5G2ZA 18GSA 4IP1A 4PNFA 4KDUA 5A5HA 4V2LA 2K8SA 2VM1A 4O5RA 4EIQA 1TTZA 4TR1B 4BWSA 1QQ2A 2JACA 1YKCA 1F6MC 3IC4A 1ERWA 2HNLA 1GSSA 5CRWA 4F0CA 4K6XA 1GSYA 4O32A 2P5RA 4PX1A 2MYGA 4XRAA 1XXUA 3BCIA 2AJQB 4HU9A 2B6MA 2H76A 2F3MA 1M9BA 1SL2B 3WGEA 5F05A 5EPFA 4OFMA 3FR6A 2L4CA 4TR4A 3M1GA 1WP0A 5J3RA 1URMA 5D9TA 1MDKA 1BF5A 6GSVA 5CYYA 3EU4A 1FHEA 3ZFBA 4EO3A 2K8VA 5ECIB 3TRPA 4EDYA 4N3ZA 2ALBA 2XBIA 2V2GA 3W8JA 3D0ZA 2LV3A 2TRXA 2FLSA 1WRYA 2QC7A 2X99A 1GTBA 1OVNA 2NDOA 5JCGA 4TW5A 5DCHA 2VL2C 4MNNA 4MPFA 3MDKA 3WYWA 2YJ7A 3ZVJD 3LORA 1DE1A 1N8JA 4BL7B 5IO0A 2O3EA 2VCZA 3TRXA 5G1LA 1X9WB 3ZMKA 3HD5A 1PA3A 2H0HA 4MABA 4ZILA 5DALB 1SJIA 1B9YC 5A5KA 2OJLA 2X49A 4CHSA 3KGKA 3CWGA 3RHCA 2HSMA 1H4OA 3TKSA 4YQMA 3UBLA 2YP6A 1I5GA 1K0DA 3KJYA 5IMDA 5ENUA 5JWQB 4GDFA 4PUAA 1O73A 3TJGA 4YH2A 1X9SB 3A2VA 1V98A 1H75A 2AUVA 2KP1A 5C04A 3BBYA 4K0GA 4L5LA 1M3JA 4DVCA 2PPTA 3L9UA 1K0AA 2PMTA 3ISOA 1UVZA 1Q98A 3N9JA 4GLTA 2JSZA 2PN8A 2PUKC 3GL5A 2WVZA 2JADA 4ILFA 4IJIA 1GRXA 5DVBA 4CDOA 3ERFA 4MF6A 4QQ7A 5H5SA 3ERWA 2OACA 4AI6A 2EC4A 1U87A 3RFRC 2YJHA 1ZGNA 6GSSA 4MJAA 4EKZA 3O6TA 1PQNA 2Z9SA 1A8YA 4F9ZA 4BA7A 1GUHA 2IFQB 3GKKA 3HY2A 1RW1A 1Z9HA 4OMVA 1M0UA 6GSWA 2WW3A 2GQMA 1I1IP 4WF4A 5DJMA 2X64A 1A2MA 1S3AA 3QOUA 2E2MA 5H5RA 2DMMA 2LRCA 1X5CA 1YEXA 3H4KA 4N30A 2GT5A 3F4TA 3S9FA 3F6FA 1SENA 2KUCA 5BMUB 4OD7A 2BMXA 1IYHA 1G7OA 3C73A 5AGYA 4XHMA 2OKAA 1EWXA 1EOHA 1A8LA 4G0IA 3A2WA 1ACVA 3D21A 3QR6A 3DEXA 3D4TA 3L4NA 5A4WA 1U6TA 3O3TA 4WBRD 4AKHA 3IRAA 5HFKA 1GWCA 5CRGA 1JZWA 2CZ2A 2HSMB 5A1NB 4HZ2A 2HYXA 4LMWA 5IMAA 2R4VA 5JWRB 3FR9A 4YAPA 2LQOA 1E2YA 2H30A 3VI7A 3AY8A 4PQ1A 2H72A 4Z2TA 5LD0A 4IJ3A 2XPDA 4QL7A 1BJXA 4BVYB 2B3SA 2H75A 5IOWA 2A4HA 1M2AA 2TRCP 1USBA 1QXHA 1PGTA 2D2ZA 3NOFA 3FW2A 4W66A 1XW6A 4HQZA 4CY8A 3TJFA 5J5NA 2WVXB 1SK2A 6GSYA 2GZPA 4PI0C 1VF3A 4E8EA 1FB6A 1GUKA 2VAFA 1F37A 3GUSA 5CRHA 1J9BA 1PX6A 1B48A 3QCPA 1HNAA 5ECOB 4GQFA 3FK8A 4RQXA 4X4JA 1XWBA 5F8BA 1EGRA 5IPHA 1TK5B 2CAIA 5JCWA 4I2UA 5G5FA 4DSSB 1PL2A 1W89A 1A0FA 3GTUA 4GXZA 1X5DA 3D6IA 3E9JB 5DJLA 2GZZA 3FKFA 3ZITA 4G01A 4EDZA 2O87A 1EV9A 1ERVA 2H01A 2MMAA 3KH7A 3NIVA 3GH9A 3WGXA 2GSRA 1BQ7A 5HFGA 2WW1A 1G0TA 4PUFC 2WVYA 1EEJA 4IBPA 4CY6A 5IMVA 4BVXB 1ZYQB 3WGDA 3KM6A 4ML1A 2F51A 1M2DA 2H6XA 4IELA 2OA7A 4H86A 3RPNA 3EYTA 4BIKA 3EVIA 1S3DA 3MNGA 3IC8A 5F0GA 5AN1A 1OKDA 3FZ4A 3GX0A 5B6NA 2GT6A 1MEKA 4NHZA 2LJKA 1OYJA 1O85A 5D9XA 4L0WA 1FG4A 3CYNA 2IMFA 3GX8A 3HVVA 5ID2B 1OC9A 2I1UA 3DIEA 3HZ8A 2MBTA 3D5JA 4PHZC 5AIVA 2L6CA 2HSYA 1MD3A 3HZ4A 3LYKA 1QFNA 4TR1A 2IMIA 3UOMA 1SL1B 4ZB9A 3J7Yb 3DD3A 1NW2A 5IQYA 1K3OA 4PTSA 3LQ7A 2JSYA 3JCML 2YPMA 3BJ5A 1OC3A 1T4YA 3GHAA 2HXKA 3F63A 2FWFA 1JLVA 2B1KA 3VFIA 2HFDA 3CMIA 3CSIA 4IN0A 3EWLA 2VIMA 1U3AA 2CVKA 2L5LA 3EURA 4J2FA 1B4QA 1GUMA 3CBUA 3GYKA 5CO3A 1TJDA 2H19A 2FWHA 1Z7PA 4IHUA 2F9SA 3ZTLA 3H93A 4GQCA 2LQQA 2FHEA 5D9WA 2ES7A 2MZCA 2UZ8A 3OR5A 5KN0A 4LA1A 3Q19A 2H74A 4TRXA 4EVMA 2YV7A 1GULA 1SYRA 3VWUA 4D73B 3UVTA 2HRKB 3M3MA 2DJJA 4TR0A 3EINA 5GAPD 3I9V2 4BL7A 2WB9A 1PD21 1TP9A 2WCIA 5F07A 1THXA 2E7PA 2IIYA 1AQXA 3UARA 4JR6A 1TK8B 3F3QA 3M9JA 3QFAC 1WE0A 5DALA 2P31A 1SJ6A 2R2JA 1ZOFA 2VCQA 4KNDA 5ECKB 2CX3A 1O6JA 3C8EA 4GTUA 1XPVA 1B4PA 1VF1A 4O5UA 2KLXA 3HYPA 1CQGA 1SKSB 2JZTA 3FZAA 3DYRA 4MCUA 3CXGA 2PBJA 1FB0A 2LNSA 3GNJA 4GCIA 5J9CA 1XG8A 3U6VA 4O92A 1NHOA 4RQRA 2R0PA 4N0VA 3UMAA 3WT1A 1B8XA 1EP8A 1O8XA 3TCOA 3I6AA 1AUCA 1BX9A 4JU5A 1YZXA 3UL3A 3HA9A 3RAZA 2EFDA 1GSFA 4PGTA 4I8BA 5B8BA 3KCMA 2EFEA 22GSA 1S4BP 3IK7A 1EGOA 2X8CA 3KMOA 3HCZA 3LG6A 1JFUA 2H1BA 1OKTA 4IVFA 1C72A 3MSZA 3P2AA 4FYUA 2LTKA 1ERTA 3PH9A 1K0NA 2O7KA 5ECHB 4G10A 3FMWA 2VLTA 4ECBA 4KDYA 1K0CA 4GSTA 2M80A 2DC5A 1SYXA 3GL3A 3ZIJA 2IFQA 2WRTA 4ULXA 2YV9A 2C4JA 4XTSA 1SVOA 3KXOA 1ERUA 20GSA 4ML6A 3NZNA 2H0GA 3ZVJA 3HKRA 3VLNA 1Z6NA 2LJRA 4HZ4A 4Q5QA 4KF9A 2HI7A 3TKSC 1M7TA 1TI3A 2X4AA 4FO5A 2O8VB 4WKWA 4N11A 4LLRA 2QKEA 4OFTA 2L59A 3W8SA 2V6KA 5BMUA 5IMCA 1TW9A 5JCUA 2DSAA 3LEFA 4K8MA 5BRTA 4RI6A 4KSOA 3RDWA 1WJKA 4FYBA 2DLXA 2ZCTA 1SU9A 4HJ2A 4TVEA 2QA2A 3IHGA 3CSHA 3DVXA 2H6ZA 1SK0A 3RBTA 5DAKA 6GSUA 1OE7A 3GKXA 4ZBBA 3G9BA 5A4UA 5A1NA 2N5FA 1YDKA 1FVJA 4ZL9A 3WD6A 2B5EA 2O5VA 1YKAA 1WMJA 3HJPA 5ECLB 4MLYA 5IMZA 3CRUA 10GSA 2AHEA 3TGZA 2C80A 4L0UA 4BVYA 2FGXA 2N5BA 4AJ7A 2GS3A 4TKYA 3Q74A 1FVKA 1ML6A 2LNTA 2CV4A 1FW1A 1T4ZA 1GSUA 5C00A 2ON7A 2VD1A 5GSSA 2DJ0A 4MJBA 3MAKA 2DJ1A 1KNGA 2EIOA 3GURA 5HR0A 4RUVA 4ZXGA 14GSA 5COHA 2WVXA 2AYTA 3IA1A 1SL0B 4AGSA 2B7KA 4POKA 3QPMA 1AXDA 1XW5A 1VF2A 4KAEA 3ED3A 1DUGA 1ZYNA 3DVWA 3I43A 3L9SA 2I4AA 1Y6EA 5IMFA 3F9UA 1ST9A 3HDCA 2XPEA 4WR5A 1Y1UA 3LXTA 2A2SA 2NVLA 4E68A 2YCDA 1T1VA 1QGVA 1YEWC 3DRNA 4DSSA 3LGCA 4YQVA 4AJ8A 2VL3A 2H70A 4BPYA 1XVQA 1A23A 3Q6OA 4TXVA 4IQAA 2H8LA 2ZNMA 1GSQA 4YKGA 2JZRA 5KOWA 5A34A 4ECIA 2LS5A 5HR2A 2WULA 3TUEA 3ERGA 3EMPA 3TRQA 3BOAA 3O76A 1HNBA 4PXOA 2RM5A 4BVXA 9GSSA 5DAKB 3PINA 5FT3A 4OCEA 2C3QA 4EL1A 1NM3A 4FH8A 2CQ9A 5IOXA 3KEBA 3ZRDA 5INYA 2AAWA 1GLQA 5KN2A 4WBJA 2R5GA 4ECCA 3GKNA 5JWOB 2TIRA 2XHFA 1QUWA 3F8UA 2C8UA 1M9AA 5ID2A 2B5YA 5J40A 4N10A 3M8NA 3J7Yk 2CVBA 1A0RP 5DQYA 4ZBAA 1ZCPA 1GTAA 2GLRA 5KEJA 4X43A 2GZYA 4LL4B 4F82A 3KIJA 3FZ9A 4K0NA 4MA9A 4Q5NA 4USSA 4ZBDA 2GQKA 4GF0A 2XC2A 3H8QA 1LU4A 1QMVA 4O5QA 5GSTA 3M0FA 2WZ9A 4Q5RA 4IQ1A 1V57A 2IN3A 2A2RA 3UBKA 3VWWA 4FXYP 4NHWA 3TOTA 2OE1A 4HU7A 2HZEB 4YKFA 3F0IA 3KTBA 3EE2A 4GRFA 3ZYWA 3US3A 5CRDA 2JU5A 1S3CA 2FUG2 1BG5A 2IPAA 4BWQA 4MZCA 2CA8A 1EV4A 2XBQA 3TDGA 4NV2A 2H1LA 4D73A 1DBYA 2HRKA 1U3IA 2ON5A 1GSDA 3VK9A 1M99A 5A34B 3L9VA 2HRNA 3QAWA 2A4VA 1AAZA 2B5XA 1XW9A 4QL9A 1OC8A 4HUAA 5GAND 2C1YA 4K9ZA 1BG1A 3CSJA 2MMNA 1YF0A 4I2TA 4ZB7A 1AIUA 4ACSA 1GH2A 2AV4A 2K6VA 2FY6A 3A2XA 3DMLA 4HQSA 1A2JA 4EC0A 2MMOA 5KOXA 1DE2A 1XZOA 3ZZXA 2FD3A 4K2DA 2VO4A 5J4VA 2E0QA 2K9FA 4F2IA 2CVDA 2PGTA 4YAVA 2F8FA 2IJYA 1F9MA 4DSQA 1G6YA 3UVHA 2LSTA 3TKPA 2FA4A 4ZB8A 4KE3A 2AB6A 1IYIA 4HOJA 1TI1A 5GZZB 1VF4A 1GNWA 5J4UA 1PMTA 2I9HA 2WS2A 3TKRA 2A2PA 2OE3A 3ZL5A 3LSZA 4JEDA 4KCEA 4ID0A 1MDIA 2BTOT 1T00A 5E4WA 5D8IA 1F3AA 4POMA 5IPGA 3Q18A 1TKDB 1A24A 1GNEA 5ELGA 1GLPA 1W4VA 4G0KA 3R2QA 5AISA 4IKHA 1K3YA 1NSWA 3CRTA 2V32A 3ZLPA 1SKRB 5ECPB 1HD2A 4KGIA 4ZIJA 3F6DA 1O7UA 3UJ1A 3HJOA 2IMDA 1JHBA 3L78A 4JE1A 2H71A 3P7XA 3ME7A 1Z6MA 4K5SA 2HSHA 5ABRA 1I9DA 3UIWA 2WW0A 2R3XA 4NV5A 1XCCA 1HNCA 2PERA 3SBCA 1UN2A 1ZYEA 4ZB6A 1TRSA 5B6MA 4TN8A 3IBHA 3C71A 3CTGA 3HVNA 4K2XA 3VWXA 2K18A 13GSA 1ZYPA 3DGQA 5IO2A 4KA0A 3H79A 4I5QA 4XS4B 2RIIA 1YEPA 5CNWA 1B9XC 3TB2A 2IMEA 3EC3A 3QAVA 2IWTA 4OFNA 3KD0A 4ICYA 2CT6A 3E0UA 3C1SA 3P90A 2YN1A 3LWAA 3HHVA 1XIYA 4POBA 5G1KA 2G0FA 3P8WA 2V6OA 3FR3A 2CX4A 1K0OA 1J0FA 4FQUA 3GKMA 4V1Ag 1QK8A 3MYDA 1THOA 1RQMA 5EL8A 3GIXA 3LJRA 1XFLA 4MMMA 4MP4A 1N25A 4J56E 2EFCA 1TXUA 3VPTA 3FY7A 3SWLA 4OWYA 3QDNA 4MZWA 1KBNA 1BEDA 4Z7XA 3MWHA 2BJXA 1YVLA 2DBCA 4NAXA 4TR3A 4E8HA 1SD8A 5A4VA 3VI5A 1Y25A 2NBSA 1R5PA 2L5OA 1FOVA 2UV8G 4NWYA 4XIHA 2LUSA 1PFOA 2X8GA 3V1WA 5L71A 2L57A 2RUFA 4PURA 4PI2C 4HSCX 4GSNA 4JRRA 1V58A 2LRTA 3IAS2 3U5RE 4EF0A 2VKZG 2VL9A 1TRUA 1T8EB 1TU7A 4WF5A 4F03A 1KEBA 3PR8A 3HVSA 3ZMLA 1VGLA 3HMJG 2GDRA 1XWCA 1K0MA 2H1DA 1Z3EA 4I6XA 4TXOB 3KH9A 2YWMA 1Z7RA 5LCZA 3KP8A 2J9HA 2DIYA 2VD0A 3UAPA 2FCHA 3GV1A 1OE8A 2N5AA 5KN3A 4EUYA 4IGJA 1YQ1A 4MZBA 2WW2A 2DKIA 1TDIA 2P0GA 2YZHA 1ZMAA 1YJ6A 5E59A 1TRWA 3GMFA 4G9HA 2VLVA 2FWGA 1Z5YE 3KMNA 2J23A 3TJKA 1OAZA 2GSTA 4LL1B 2B1LA 3VPQA 5ECRB 4IW9A 5D9VA 4NXIA 5G30A 5J47A 5AIXA 2KOKA 2ZUPA 2JL4A 1UC7A 2EIRA 5D96A 4MDCA 4AKXB 1X5EA 1PSQA 1JZOA 3EMXA 2VLUA 2HSNB 2FWEA 2CZ3A 4KUNA 2E2GA 1R4WA 1XBSA 1G7EA 1V2AA 1YY7A 2X8HA 1GP1A 1T7PB 1GTIA 3CHXC 4V2MA 4NMUA 5HR1A 1F3BA 3E3EA 4OCFA 1SK1A 1J08A 2REMA 1EZKA 4L8EA 1VRSD 4KDXA 3N5OA 1TK0B 1X9MB 2I81A 3G7YA 3RPPA 8GSSA 2F8AA 1LJRA 2VL2A 1FO5A 2C0FA 1ABAA 1WPIA 4KW6A 4JR4A 2VCWA 5EVOA 3A5WA 3QFBC 4X0XA 3C1RA 1U88A 5A5HB 4POLA 2PU9C 4MJCA 1PL1A 2H73A 3A5IA 5G31A 3TU3B 3IPZA 3GRXA 1ZL9A 3L0HA 2H1GA 4N0ZA 2GTUA 1EEMA 2H1AA 4HDEA 5DBQA 2IMKA 2HZEA 3D4MA 6GSXA 2YWIA 3HXSA 4WETA 2R6KA 4FYCA 5CREA 1CQHA 1SJZA 5HR3A 6GSTA 5IM9A 4XRDA 4K7NA 1EOGA 3W6GA 3DKSA 3QD9A 4O7HA 1O8WA 5ELAA 4RI7A 1ZZYA 3IDVA 1PX7A 3QAGA 4CW9A 2PVQA 4KH7A 1SKWB 2MMZA 2HRFA 2WZSA 1WOUA 4IP6A 4GSSA 3BCKA 4GWRA 5DCGA 1TU8A 2DKHA 3VURA 2P5QA 3DXBA 4ZL8A 2LKUA 2VOCA 1JLWA 1V40A 5CP1A 3PGTA 3I69A 3LW9A 19GSA 4XS6A 3IE3A 1RK4A 4V2NA 2OADA 5B7CA 5J4YA 1TXXA 1Q4JA 4WXTA 1R7HA 1K3LA 2O89A 1E6BA 3TJBA 3KTLA 2QSIA 2RUEA 2V41A 4Z2RA 4QMKA 2C3TA 3G7JA 2RLIA 1F2EA 1A2LA 1NHYA 3ME8A 3FYGA 4ZL7A 3H1NA 5ECSA 1T3BA 16GSA 1PRXA 4G0LA 3WT2A 4K1FA 4WR4A 2HZFA 3D22A 1V9WA 3GFKA 2DIZA 2EIQA 1WIKA 4P3YB 3FZ5A 3M9KA 1AW9A 3MIXA 3ZIVA 3ZREA 1PKWA 1FOHA 2HQTA 1S3RA 3BD2A 2O36A 1SD9A 1G6WA 2NTOA 5HQPA 5LNKe 2MBSA 4Q5FA 3RGBC 3FHKA 3IAM2 5J41A 1TRVA 3IOSA 4PNGA 2L4QA 3APSA 1GL8A 2EFHA 4X1UA 3VWVA 2YWOA 4HI7A 4HJMA 2PVOC 1AC1A 4MH2A 2R0CA 3FRCA 1PKZA 3DWVA 2YWNA 2GSSA 4KX4A 2B7JA 1KTEA 5J9BA 3F3RA 2G2QA 2YANA 4KB3A 1MTCA 5FHIA 1GTUA 2GGTA 1XOAA 5IIZA 4V1Ap 2QGVA 2I3YA 4K5RA 4IS0A 4DSRA 5G5EA 1X0RA
chains in the Genus database with same CATH topology
1R5AA 4OO5A 3TKQA 2JZSA 1M2BA 1N2AA 3C7MA 2C0DA 2YNXA 4XS4A 2QA1A 3EU3A 1FAAA 2VUPA 5F06A 4JZQA 4EE0A 1SVLA 3GA4A 2WJUA 3LYPA 2LEGA 2H66A 3A3TA 4AKGA 2LRNA 2KHPA 1XWKA 1XWGA 2OBIA 1JZRA 2VCXA 2VM2A 2M46A 2HRAA 1ON4A 1AQWA 1MD4A 5ECNB 4MK3A 1GSEA 3IXRA 3ZFLA 3GH6A 3R3EA 2YOIA 3G7IA 4F0BA 2WGRA 5ECMB 4A5PA 4KCAA 1K0BA 3TJJA 4MH3A 5H5QA 11GSA 4MF7A 5ECQB 2HLSA 4PQHA 4EXJA 1LBKA 1HYUA 3PPUA 2OT3A 2R0GA 4PQIA 4XS1A 3LFLA 4AJ6A 3UEMA 3TOUA 5CAXA 2R37A 3TKSE 1HQOA 3KZQA 4WEYA 4ECJA 1EP7A 2H0IA 2M72A 1SVMA 1O81A 2OE0A 2GQLA 4MJEA 1DSBA 2FA8A 2PWJA 4JBBA 3GSSA 5D93A 2YZUA 2FNOA 2DJ2A 4TXOA 4AKIA 3GSTA 2HT9A 3QMXA 4HEA2 4G19A 1ILOA 2DJ3A 1XOBA 4HS1A 3RHBA 1PN0A 4EIPA 4G2EA 4LMVA 1XVWA 4NPBA 2KP2A 2LJAA 2GVPA 1AQVA 1YF1A 3FEUA 2DMLA 4KSMA 1TOFA 2WFCA 3F4SA 3F4RA 4XCSA 5DQSA 2C3NA 2C0EA 4DEJA 2HE3A 5DDLA 3IHQA 2VCTA 2NPBA 1R26A 5B8AA 2GSQA 4J57E 3APQA 1JZDA 3GTUB 3EPTA 1PN9A 1BAYA 2V1MA 2VCVA 2IL3A 1MDJA 4FIWA 4AF2A 12GSA 5FWGA 1BYEA 5EY6A 2DJKA 4OO4A 4Z2UA 3IR4A 7GSSA 5D73A 1UA5A 1WWJA 3K8NA 2HSNA 3GN3A 4MF5A 17GSA 2C0GA 3LXZA 4TOPA 4L5OA 2CAQA 3HJMA 3IV4A 1XWAA 4I97A 4K7IA 3KP9A 2RM6A 5HFIA 3APOA 2L6DA 5KN1A 2H6YA 3CTFA 4ISDA 3IK9A 2OBKA 2O85A 4YQUA 2WDUA 3HVXA 1OC9B 4K7OA 4MPGA 5G2ZA 18GSA 4IP1A 4PNFA 4KDUA 5A5HA 4V2LA 2K8SA 2VM1A 4O5RA 4EIQA 1TTZA 4TR1B 4BWSA 1QQ2A 2JACA 1YKCA 1F6MC 3IC4A 1ERWA 2HNLA 1GSSA 5CRWA 4F0CA 4K6XA 1GSYA 4O32A 2P5RA 4PX1A 2MYGA 4XRAA 1XXUA 3BCIA 2AJQB 4HU9A 2B6MA 2H76A 2F3MA 1M9BA 1SL2B 3WGEA 5F05A 5EPFA 4OFMA 3FR6A 2L4CA 4TR4A 3M1GA 1WP0A 5J3RA 1URMA 5D9TA 1MDKA 1BF5A 6GSVA 5CYYA 3EU4A 1FHEA 3ZFBA 4EO3A 2K8VA 5ECIB 3TRPA 4EDYA 4N3ZA 2ALBA 2XBIA 2V2GA 3W8JA 3D0ZA 2LV3A 2TRXA 2FLSA 1WRYA 2QC7A 2X99A 1GTBA 1OVNA 2NDOA 5JCGA 4TW5A 5DCHA 2VL2C 4MNNA 4MPFA 3MDKA 3WYWA 2YJ7A 3ZVJD 3LORA 1DE1A 1N8JA 4BL7B 5IO0A 2VCZA 3TRXA 5G1LA 1X9WB 3ZMKA 3HD5A 1PA3A 2H0HA 4MABA 4ZILA 5DALB 1SJIA 1B9YC 5A5KA 2OJLA 2X49A 4CHSA 3KGKA 3CWGA 3RHCA 2HSMA 1H4OA 3TKSA 4YQMA 3UBLA 2YP6A 1I5GA 1K0DA 3KJYA 5IMDA 5ENUA 5JWQB 4GDFA 4PUAA 1O73A 3TJGA 4YH2A 1X9SB 3A2VA 1V98A 1H75A 2AUVA 2KP1A 5C04A 3BBYA 4K0GA 4L5LA 4DVCA 2PPTA 3L9UA 1K0AA 2PMTA 3ISOA 1UVZA 1Q98A 3N9JA 4GLTA 2JSZA 2PN8A 2PUKC 3GL5A 2JADA 4ILFA 4IJIA 1GRXA 5DVBA 4CDOA 3ERFA 4MF6A 4QQ7A 5H5SA 3ERWA 2OACA 4AI6A 2EC4A 1U87A 2YJHA 1ZGNA 6GSSA 4MJAA 4EKZA 3O6TA 1PQNA 2Z9SA 1A8YA 4F9ZA 4BA7A 1GUHA 2IFQB 3GKKA 3HY2A 1RW1A 1Z9HA 4OMVA 1M0UA 6GSWA 2GQMA 4WF4A 5DJMA 2X64A 1A2MA 1S3AA 3QOUA 2E2MA 5H5RA 2DMMA 2LRCA 1X5CA 1YEXA 3H4KA 4N30A 2GT5A 3F4TA 3S9FA 3F6FA 1SENA 2KUCA 5BMUB 4OD7A 2BMXA 1IYHA 1G7OA 3C73A 5AGYA 4XHMA 2OKAA 1EWXA 1EOHA 1A8LA 4G0IA 3A2WA 1ACVA 3D21A 3QR6A 3DEXA 3D4TA 3L4NA 5A4WA 1U6TA 3O3TA 4WBRD 4AKHA 3IRAA 5HFKA 1GWCA 5CRGA 1JZWA 2CZ2A 2HSMB 5A1NB 4HZ2A 2HYXA 4LMWA 5IMAA 2R4VA 5JWRB 3FR9A 4YAPA 2LQOA 1E2YA 2H30A 3VI7A 3AY8A 4PQ1A 2H72A 4Z2TA 5LD0A 4IJ3A 2XPDA 4QL7A 1BJXA 4BVYB 2B3SA 2H75A 5IOWA 2A4HA 1M2AA 2TRCP 1USBA 1QXHA 1PGTA 2D2ZA 3NOFA 3FW2A 4W66A 1XW6A 4HQZA 4CY8A 3TJFA 5J5NA 1SK2A 6GSYA 2GZPA 1VF3A 4E8EA 1FB6A 1GUKA 2VAFA 1F37A 3GUSA 5CRHA 1J9BA 1PX6A 1B48A 3QCPA 1HNAA 5ECOB 4GQFA 3FK8A 4RQXA 4X4JA 1XWBA 5F8BA 1EGRA 5IPHA 1TK5B 2CAIA 5JCWA 4I2UA 5G5FA 4DSSB 1PL2A 1W89A 1A0FA 3GTUA 4GXZA 1X5DA 3D6IA 3E9JB 5DJLA 2GZZA 3FKFA 3ZITA 4G01A 4EDZA 2O87A 1EV9A 1ERVA 2H01A 2MMAA 3KH7A 3NIVA 3GH9A 3WGXA 2GSRA 1BQ7A 5HFGA 1G0TA 4PUFC 1EEJA 4CY6A 4IBPA 5IMVA 4BVXB 1ZYQB 3WGDA 3KM6A 4ML1A 2F51A 1M2DA 2H6XA 4IELA 2OA7A 4H86A 3RPNA 3EYTA 3EVIA 1S3DA 3MNGA 3IC8A 5F0GA 5AN1A 1OKDA 3FZ4A 3GX0A 5B6NA 2GT6A 1MEKA 4NHZA 2LJKA 1OYJA 1O85A 5D9XA 4L0WA 1FG4A 3CYNA 2IMFA 3GX8A 3HVVA 5ID2B 1OC9A 2I1UA 3DIEA 3HZ8A 2MBTA 3D5JA 5AIVA 2L6CA 2HSYA 1MD3A 3HZ4A 3LYKA 1QFNA 4TR1A 2IMIA 3UOMA 1SL1B 4ZB9A 3J7Yb 3DD3A 1NW2A 5IQYA 1K3OA 4PTSA 3LQ7A 2JSYA 3JCML 2YPMA 3BJ5A 1OC3A 1T4YA 3GHAA 2HXKA 3F63A 2FWFA 1JLVA 2B1KA 3VFIA 2HFDA 3CMIA 3CSIA 4IN0A 3EWLA 2VIMA 1U3AA 2CVKA 2L5LA 3EURA 4J2FA 1B4QA 1GUMA 3CBUA 3GYKA 5CO3A 1TJDA 2H19A 2FWHA 1Z7PA 4IHUA 2F9SA 3ZTLA 3H93A 4GQCA 2LQQA 2FHEA 5D9WA 2ES7A 2MZCA 2UZ8A 3OR5A 5KN0A 4LA1A 3Q19A 2H74A 4TRXA 4EVMA 2YV7A 1GULA 1SYRA 3VWUA 4D73B 3UVTA 2HRKB 3M3MA 2DJJA 4TR0A 3EINA 5GAPD 3I9V2 4BL7A 2WB9A 1PD21 1TP9A 2WCIA 5F07A 1THXA 2E7PA 2IIYA 1AQXA 3UARA 4JR6A 1TK8B 3F3QA 3M9JA 3QFAC 1WE0A 5DALA 2P31A 1SJ6A 2R2JA 1ZOFA 2VCQA 4KNDA 5ECKB 2CX3A 1O6JA 3C8EA 4GTUA 1XPVA 1B4PA 1VF1A 4O5UA 2KLXA 3HYPA 1CQGA 1SKSB 2JZTA 3FZAA 3DYRA 4MCUA 3CXGA 2PBJA 1FB0A 2LNSA 3GNJA 4GCIA 5J9CA 3U6VA 4O92A 1NHOA 4RQRA 2R0PA 4N0VA 3UMAA 3WT1A 1B8XA 1EP8A 1O8XA 3TCOA 3I6AA 1AUCA 1BX9A 4JU5A 1YZXA 3UL3A 3HA9A 3RAZA 2EFDA 1GSFA 4PGTA 4I8BA 5B8BA 3KCMA 2EFEA 22GSA 1EGOA 3IK7A 2X8CA 3KMOA 3HCZA 3LG6A 1JFUA 2H1BA 1OKTA 4IVFA 1C72A 3MSZA 3P2AA 4FYUA 2LTKA 1ERTA 3PH9A 1K0NA 2O7KA 5ECHB 4G10A 3FMWA 2VLTA 4ECBA 4KDYA 1K0CA 4GSTA 2M80A 2DC5A 1SYXA 3GL3A 3ZIJA 2IFQA 2WRTA 4ULXA 2YV9A 2C4JA 4XTSA 1SVOA 3KXOA 1ERUA 20GSA 4ML6A 3NZNA 2H0GA 3ZVJA 3HKRA 3VLNA 1Z6NA 2LJRA 4HZ4A 4Q5QA 4KF9A 2HI7A 3TKSC 1M7TA 1TI3A 2X4AA 4FO5A 2O8VB 4WKWA 4N11A 4LLRA 2QKEA 4OFTA 2L59A 3W8SA 2V6KA 5BMUA 5IMCA 1TW9A 5JCUA 3LEFA 2DSAA 4K8MA 5BRTA 4RI6A 4KSOA 3RDWA 1WJKA 4FYBA 2DLXA 2ZCTA 1SU9A 4HJ2A 4TVEA 2QA2A 3IHGA 3CSHA 3DVXA 2H6ZA 1SK0A 3RBTA 5DAKA 6GSUA 1OE7A 3GKXA 4ZBBA 3G9BA 5A4UA 5A1NA 2N5FA 1YDKA 1FVJA 4ZL9A 3WD6A 2B5EA 2O5VA 1YKAA 1WMJA 3HJPA 5ECLB 4MLYA 5IMZA 3CRUA 10GSA 2AHEA 3TGZA 2C80A 4L0UA 4BVYA 2FGXA 2N5BA 4AJ7A 2GS3A 4TKYA 3Q74A 1FVKA 1ML6A 2LNTA 2CV4A 1FW1A 1T4ZA 1GSUA 5C00A 2ON7A 2VD1A 5GSSA 2DJ0A 4MJBA 3MAKA 2DJ1A 1KNGA 2EIOA 3GURA 5HR0A 4RUVA 4ZXGA 14GSA 5COHA 2AYTA 3IA1A 1SL0B 4AGSA 2B7KA 4POKA 3QPMA 1AXDA 1XW5A 1VF2A 4KAEA 3ED3A 1DUGA 1ZYNA 3DVWA 3I43A 3L9SA 2I4AA 1Y6EA 5IMFA 3F9UA 1ST9A 3HDCA 2XPEA 4WR5A 1Y1UA 3LXTA 2A2SA 2NVLA 4E68A 2YCDA 1T1VA 1QGVA 3DRNA 4DSSA 3LGCA 4YQVA 4AJ8A 2VL3A 2H70A 4BPYA 1XVQA 1A23A 3Q6OA 4TXVA 4IQAA 2H8LA 2ZNMA 1GSQA 4YKGA 2JZRA 5KOWA 5A34A 4ECIA 2LS5A 5HR2A 2WULA 3TUEA 3ERGA 3EMPA 3TRQA 3BOAA 3O76A 1HNBA 4PXOA 2RM5A 4BVXA 9GSSA 5DAKB 3PINA 5FT3A 4OCEA 2C3QA 4EL1A 1NM3A 4FH8A 2CQ9A 5IOXA 3KEBA 3ZRDA 5INYA 2AAWA 1GLQA 5KN2A 4WBJA 2R5GA 4ECCA 3GKNA 5JWOB 2TIRA 2XHFA 1QUWA 3F8UA 2C8UA 1M9AA 5ID2A 2B5YA 5J40A 4N10A 3M8NA 3J7Yk 2CVBA 1A0RP 5DQYA 4ZBAA 1ZCPA 1GTAA 2GLRA 5KEJA 4X43A 2GZYA 4LL4B 4F82A 3KIJA 3FZ9A 4K0NA 4MA9A 4Q5NA 4USSA 4ZBDA 2GQKA 4GF0A 2XC2A 3H8QA 1LU4A 1QMVA 4O5QA 5GSTA 3M0FA 2WZ9A 4Q5RA 4IQ1A 1V57A 2IN3A 2A2RA 3UBKA 3VWWA 4NHWA 3TOTA 2OE1A 4HU7A 2HZEB 4YKFA 3F0IA 3KTBA 3EE2A 4GRFA 3ZYWA 3US3A 5CRDA 2JU5A 1S3CA 2FUG2 1BG5A 2IPAA 4BWQA 4MZCA 2CA8A 1EV4A 2XBQA 3TDGA 4NV2A 2H1LA 4D73A 1DBYA 2HRKA 1U3IA 2ON5A 1GSDA 3VK9A 1M99A 5A34B 3L9VA 2HRNA 3QAWA 2A4VA 1AAZA 2B5XA 1XW9A 4QL9A 1OC8A 4HUAA 5GAND 2C1YA 4K9ZA 1BG1A 3CSJA 2MMNA 1YF0A 4I2TA 4ZB7A 1AIUA 4ACSA 1GH2A 2AV4A 2K6VA 2FY6A 3A2XA 3DMLA 4HQSA 1A2JA 4EC0A 2MMOA 5KOXA 1DE2A 1XZOA 3ZZXA 2FD3A 4K2DA 2VO4A 5J4VA 2E0QA 2K9FA 4F2IA 2CVDA 2PGTA 4YAVA 2F8FA 2IJYA 1F9MA 4DSQA 1G6YA 3UVHA 2LSTA 3TKPA 2FA4A 4ZB8A 4KE3A 2AB6A 1IYIA 4HOJA 1TI1A 5GZZB 1VF4A 1GNWA 5J4UA 1PMTA 2I9HA 2WS2A 3TKRA 2A2PA 2OE3A 3ZL5A 3LSZA 4JEDA 4KCEA 4ID0A 1MDIA 2BTOT 1T00A 5E4WA 5D8IA 1F3AA 4POMA 5IPGA 3Q18A 1TKDB 1A24A 1GNEA 5ELGA 1GLPA 1W4VA 4G0KA 3R2QA 5AISA 4IKHA 1K3YA 1NSWA 3CRTA 2V32A 3ZLPA 1SKRB 5ECPB 1HD2A 4KGIA 4ZIJA 3F6DA 1O7UA 3UJ1A 3HJOA 2IMDA 1JHBA 3L78A 4JE1A 2H71A 3P7XA 3ME7A 1Z6MA 4K5SA 2HSHA 5ABRA 1I9DA 3UIWA 2R3XA 4NV5A 1XCCA 1HNCA 2PERA 3SBCA 1UN2A 1ZYEA 4ZB6A 1TRSA 5B6MA 4TN8A 3IBHA 3C71A 3CTGA 4K2XA 3VWXA 2K18A 13GSA 1ZYPA 3DGQA 5IO2A 4KA0A 3H79A 4I5QA 4XS4B 2RIIA 1YEPA 5CNWA 1B9XC 3TB2A 2IMEA 3EC3A 3QAVA 2IWTA 4OFNA 3KD0A 4ICYA 2CT6A 3E0UA 3C1SA 3P90A 2YN1A 3LWAA 3HHVA 1XIYA 4POBA 5G1KA 2G0FA 3P8WA 2V6OA 3FR3A 2CX4A 1K0OA 1J0FA 4FQUA 3GKMA 4V1Ag 1QK8A 3MYDA 1THOA 1RQMA 5EL8A 3GIXA 3LJRA 1XFLA 4MMMA 4MP4A 1N25A 4J56E 2EFCA 1TXUA 3VPTA 3FY7A 3SWLA 4OWYA 3QDNA 4MZWA 1KBNA 1BEDA 4Z7XA 3MWHA 2BJXA 1YVLA 2DBCA 4NAXA 4TR3A 4E8HA 1SD8A 5A4VA 3VI5A 1Y25A 2NBSA 1R5PA 2L5OA 1FOVA 2UV8G 4NWYA 4XIHA 2LUSA 2X8GA 3V1WA 5L71A 2L57A 2RUFA 4PURA 4GSNA 4JRRA 1V58A 2LRTA 3IAS2 3U5RE 4EF0A 2VKZG 2VL9A 1TRUA 1T8EB 1TU7A 4WF5A 4F03A 1KEBA 3PR8A 3HVSA 3ZMLA 1VGLA 3HMJG 2GDRA 1XWCA 1K0MA 2H1DA 1Z3EA 4I6XA 4TXOB 3KH9A 2YWMA 1Z7RA 5LCZA 3KP8A 2J9HA 2DIYA 2VD0A 3UAPA 2FCHA 3GV1A 1OE8A 2N5AA 5KN3A 4EUYA 4IGJA 1YQ1A 4MZBA 2DKIA 1TDIA 2P0GA 2YZHA 1ZMAA 1YJ6A 5E59A 1TRWA 3GMFA 4G9HA 2VLVA 2FWGA 1Z5YE 3KMNA 2J23A 3TJKA 1OAZA 2GSTA 4LL1B 2B1LA 3VPQA 5ECRB 4IW9A 5D9VA 4NXIA 5G30A 5J47A 5AIXA 2KOKA 2ZUPA 2JL4A 1UC7A 2EIRA 5D96A 4MDCA 4AKXB 1X5EA 1PSQA 1JZOA 3EMXA 2VLUA 2HSNB 2FWEA 2CZ3A 4KUNA 2E2GA 1R4WA 1XBSA 1G7EA 1V2AA 1YY7A 2X8HA 1GP1A 1T7PB 1GTIA 4V2MA 4NMUA 5HR1A 1F3BA 3E3EA 4OCFA 1SK1A 1J08A 2REMA 1EZKA 4L8EA 1VRSD 4KDXA 3N5OA 1TK0B 1X9MB 2I81A 3G7YA 3RPPA 8GSSA 2F8AA 1LJRA 2VL2A 1FO5A 2C0FA 1ABAA 1WPIA 4KW6A 4JR4A 2VCWA 5EVOA 3A5WA 3QFBC 4X0XA 3C1RA 1U88A 5A5HB 4POLA 2PU9C 4MJCA 1PL1A 2H73A 3A5IA 5G31A 3TU3B 3IPZA 3GRXA 1ZL9A 3L0HA 2H1GA 4N0ZA 2GTUA 1EEMA 2H1AA 4HDEA 5DBQA 2IMKA 2HZEA 3D4MA 6GSXA 2YWIA 3HXSA 4WETA 2R6KA 4FYCA 5CREA 1CQHA 1SJZA 5HR3A 6GSTA 5IM9A 4XRDA 4K7NA 1EOGA 3W6GA 3DKSA 3QD9A 4O7HA 1O8WA 5ELAA 4RI7A 1ZZYA 3IDVA 1PX7A 3QAGA 4CW9A 2PVQA 4KH7A 1SKWB 2MMZA 2HRFA 1WOUA 4IP6A 4GSSA 3BCKA 4GWRA 5DCGA 1TU8A 2DKHA 3VURA 2P5QA 3DXBA 4ZL8A 2LKUA 2VOCA 1JLWA 1V40A 5CP1A 3PGTA 3I69A 3LW9A 19GSA 4XS6A 3IE3A 1RK4A 4V2NA 2OADA 5B7CA 5J4YA 1TXXA 1Q4JA 4WXTA 1R7HA 1K3LA 2O89A 1E6BA 3TJBA 3KTLA 2QSIA 2RUEA 2V41A 4Z2RA 4QMKA 2C3TA 3G7JA 2RLIA 1F2EA 1A2LA 1NHYA 3ME8A 3FYGA 4ZL7A 3H1NA 5ECSA 1T3BA 16GSA 1PRXA 4G0LA 3WT2A 4K1FA 4WR4A 2HZFA 3D22A 1V9WA 3GFKA 2DIZA 2EIQA 1WIKA 4P3YB 3FZ5A 3M9KA 1AW9A 3MIXA 3ZIVA 3ZREA 1PKWA 1FOHA 2HQTA 3BD2A 1SD9A 1G6WA 2NTOA 5HQPA 5LNKe 2MBSA 4Q5FA 3FHKA 3IAM2 5J41A 1TRVA 3IOSA 4PNGA 2L4QA 3APSA 1GL8A 2EFHA 4X1UA 3VWVA 2YWOA 4HI7A 4HJMA 2PVOC 1AC1A 4MH2A 2R0CA 3FRCA 1PKZA 3DWVA 2YWNA 2GSSA 4KX4A 2B7JA 1KTEA 5J9BA 3F3RA 2G2QA 2YANA 4KB3A 1MTCA 5FHIA 1GTUA 2GGTA 1XOAA 5IIZA 4V1Ap 2QGVA 2I3YA 4K5RA 4IS0A 4DSRA 5G5EA 1X0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5A A;  4OO5 A;  3TKQ A;  2JZS A;  1M2B A;  1N2A A;  3C7M A;  2C0D A;  2YNX A;  4XS4 A;  3EU3 A;  1FAA A;  2VUP A;  5F06 A;  4JZQ A;  4EE0 A;  3GA4 A;  2WJU A;  3LYP A;  2LEG A;  2H66 A;  3A3T A;  2LRN A;  2KHP A;  1XWK A;  1XWG A;  2OBI A;  1JZR A;  2VCX A;  2VM2 A;  2M46 A;  2HRA A;  1ON4 A;  1AQW A;  1MD4 A;  5ECN B;  4MK3 A;  1GSE A;  3IXR A;  3ZFL A;  3GH6 A;  3R3E A;  2YOI A;  3G7I A;  4F0B A;  2WGR A;  5ECM B;  4KCA A;  1K0B A;  3TJJ A;  4MH3 A;  5H5Q A;  11GS A;  4MF7 A;  5ECQ B;  2HLS A;  4PQH A;  4EXJ A;  1LBK A;  1HYU A;  3PPU A;  4PQI A;  4XS1 A;  3LFL A;  4AJ6 A;  3UEM A;  3TOU A;  5CAX A;  2R37 A;  3TKS E;  1HQO A;  3KZQ A;  4WEY A;  4ECJ A;  1EP7 A;  2H0I A;  2M72 A;  1O81 A;  2OE0 A;  2GQL A;  4MJE A;  1DSB A;  2FA8 A;  2PWJ A;  4JBB A;  3GSS A;  5D93 A;  2YZU A;  2FNO A;  2DJ2 A;  4TXO A;  3GST A;  2HT9 A;  3QMX A;  4HEA 2;  4G19 A;  1ILO A;  2DJ3 A;  1XOB A;  4HS1 A;  3RHB A;  4G2E A;  4LMV A;  1XVW A;  4NPB A;  2KP2 A;  2LJA A;  2GVP A;  1AQV A;  1YF1 A;  3FEU A;  2DML A;  4KSM A;  1TOF A;  2WFC A;  3F4S A;  3F4R A;  4XCS A;  5DQS A;  2C3N A;  2C0E A;  4DEJ A;  2HE3 A;  5DDL A;  3IHQ A;  2VCT A;  2NPB A;  1R26 A;  5B8A A;  2GSQ A;  4J57 E;  3APQ A;  1JZD A;  3GTU B;  1PN9 A;  1BAY A;  2V1M A;  2VCV A;  2IL3 A;  1MDJ A;  4FIW A;  4AF2 A;  12GS A;  5FWG A;  1BYE A;  5EY6 A;  2DJK A;  4OO4 A;  3IR4 A;  7GSS A;  5D73 A;  1UA5 A;  1WWJ A;  3K8N A;  3GN3 A;  4MF5 A;  17GS A;  2C0G A;  3LXZ A;  4TOP A;  4L5O A;  2CAQ A;  3HJM A;  3IV4 A;  1XWA A;  4I97 A;  4K7I A;  3KP9 A;  2RM6 A;  5HFI A;  3APO A;  2L6D A;  5KN1 A;  2H6Y A;  3CTF A;  4ISD A;  3IK9 A;  2OBK A;  2O85 A;  4YQU A;  2WDU A;  3HVX A;  1OC9 B;  4K7O A;  4MPG A;  5G2Z A;  18GS A;  4IP1 A;  4PNF A;  4KDU A;  4V2L A;  2K8S A;  2VM1 A;  4O5R A;  1TTZ A;  4TR1 B;  4BWS A;  1QQ2 A;  2JAC A;  1YKC A;  1F6M C;  3IC4 A;  1ERW A;  2HNL A;  1GSS A;  5CRW A;  4F0C A;  4K6X A;  1GSY A;  4O32 A;  2P5R A;  4PX1 A;  2MYG A;  4XRA A;  1XXU A;  3BCI A;  2AJQ B;  4HU9 A;  2B6M A;  2H76 A;  2F3M A;  1M9B A;  1SL2 B;  3WGE A;  5F05 A;  5EPF A;  4OFM A;  3FR6 A;  2L4C A;  4TR4 A;  3M1G A;  1WP0 A;  5J3R A;  1URM A;  5D9T A;  1MDK A;  6GSV A;  5CYY A;  3EU4 A;  1FHE A;  3ZFB A;  4EO3 A;  2K8V A;  5ECI B;  3TRP A;  4EDY A;  2ALB A;  2XBI A;  2V2G A;  3W8J A;  3D0Z A;  2LV3 A;  2TRX A;  2FLS A;  1WRY A;  2QC7 A;  2X99 A;  1GTB A;  1OVN A;  2NDO A;  5JCG A;  4TW5 A;  5DCH A;  2VL2 C;  4MPF A;  3MDK A;  3WYW A;  2YJ7 A;  3ZVJ D;  3LOR A;  1DE1 A;  1N8J A;  4BL7 B;  5IO0 A;  2VCZ A;  3TRX A;  5G1L A;  1X9W B;  3ZMK A;  3HD5 A;  1PA3 A;  2H0H A;  4MAB A;  4ZIL A;  5DAL B;  1SJI A;  1B9Y C;  5A5K A;  2OJL A;  4CHS A;  3KGK A;  3RHC A;  2HSM A;  1H4O A;  3TKS A;  4YQM A;  3UBL A;  2YP6 A;  1I5G A;  1K0D A;  3KJY A;  5IMD A;  5ENU A;  5JWQ B;  4PUA A;  1O73 A;  3TJG A;  4YH2 A;  1X9S B;  3A2V A;  1V98 A;  1H75 A;  2AUV A;  2KP1 A;  5C04 A;  3BBY A;  4K0G A;  4L5L A;  4DVC A;  2PPT A;  3L9U A;  1K0A A;  2PMT A;  3ISO A;  1UVZ A;  1Q98 A;  3N9J A;  4GLT A;  2JSZ A;  2PN8 A;  2PUK C;  3GL5 A;  2JAD A;  4ILF A;  4IJI A;  1GRX A;  5DVB A;  4CDO A;  3ERF A;  4MF6 A;  4QQ7 A;  5H5S A;  3ERW A;  2OAC A;  2EC4 A;  1U87 A;  2YJH A;  1ZGN A;  6GSS A;  4MJA A;  4EKZ A;  3O6T A;  1PQN A;  2Z9S A;  1A8Y A;  4F9Z A;  4BA7 A;  1GUH A;  2IFQ B;  3GKK A;  3HY2 A;  1RW1 A;  1Z9H A;  4OMV A;  1M0U A;  6GSW A;  2GQM A;  4WF4 A;  5DJM A;  2X64 A;  1A2M A;  1S3A A;  3QOU A;  2E2M A;  5H5R A;  2DMM A;  2LRC A;  1X5C A;  1YEX A;  3H4K A;  4N30 A;  2GT5 A;  3F4T A;  3S9F A;  3F6F A;  1SEN A;  2KUC A;  4OD7 A;  2BMX A;  1IYH A;  1G7O A;  3C73 A;  5AGY A;  4XHM A;  2OKA A;  1EWX A;  1EOH A;  1A8L A;  4G0I A;  3A2W A;  1ACV A;  3D21 A;  3QR6 A;  3DEX A;  3D4T A;  3L4N A;  5A4W A;  1U6T A;  3O3T A;  4WBR D;  3IRA A;  5HFK A;  1GWC A;  5CRG A;  1JZW A;  2CZ2 A;  2HSM B;  4HZ2 A;  2HYX A;  4LMW A;  5IMA A;  2R4V A;  5JWR B;  3FR9 A;  4YAP A;  2LQO A;  1E2Y A;  2H30 A;  3VI7 A;  3AY8 A;  4PQ1 A;  2H72 A;  5LD0 A;  4IJ3 A;  2XPD A;  4QL7 A;  1BJX A;  4BVY B;  2B3S A;  2H75 A;  5IOW A;  1M2A A;  2TRC P;  1USB A;  1QXH A;  1PGT A;  2D2Z A;  3NOF A;  3FW2 A;  1XW6 A;  4HQZ A;  3TJF A;  5J5N A;  1SK2 A;  6GSY A;  2GZP A;  1VF3 A;  4E8E A;  1FB6 A;  1GUK A;  2VAF A;  1F37 A;  3GUS A;  5CRH A;  1J9B A;  1PX6 A;  1B48 A;  3QCP A;  1HNA A;  5ECO B;  4GQF A;  3FK8 A;  4RQX A;  1XWB A;  5F8B A;  1EGR A;  5IPH A;  1TK5 B;  2CAI A;  5JCW A;  4I2U A;  5G5F A;  4DSS B;  1PL2 A;  1W89 A;  1A0F A;  3GTU A;  4GXZ A;  1X5D A;  3D6I A;  3E9J B;  5DJL A;  2GZZ A;  3FKF A;  3ZIT A;  4EDZ A;  2O87 A;  1EV9 A;  1ERV A;  2H01 A;  2MMA A;  3KH7 A;  3NIV A;  3GH9 A;  3WGX A;  2GSR A;  1BQ7 A;  5HFG A;  1G0T A;  4PUF C;  1EEJ A;  4IBP A;  5IMV A;  4BVX B;  1ZYQ B;  3WGD A;  3KM6 A;  4ML1 A;  2F51 A;  1M2D A;  2H6X A;  4IEL A;  2OA7 A;  4H86 A;  3RPN A;  3EYT A;  3EVI A;  1S3D A;  3MNG A;  3IC8 A;  5F0G A;  5AN1 A;  1OKD A;  3FZ4 A;  3GX0 A;  5B6N A;  2GT6 A;  1MEK A;  4NHZ A;  2LJK A;  1OYJ A;  1O85 A;  5D9X A;  4L0W A;  1FG4 A;  3CYN A;  2IMF A;  3GX8 A;  3HVV A;  5ID2 B;  1OC9 A;  2I1U A;  3DIE A;  3HZ8 A;  2MBT A;  3D5J A;  5AIV A;  2L6C A;  2HSY A;  1MD3 A;  3HZ4 A;  3LYK A;  1QFN A;  4TR1 A;  2IMI A;  3UOM A;  1SL1 B;  4ZB9 A;  3J7Y b;  3DD3 A;  1NW2 A;  5IQY A;  1K3O A;  4PTS A;  3LQ7 A;  2JSY A;  3JCM L;  2YPM A;  3BJ5 A;  1OC3 A;  1T4Y A;  3GHA A;  2HXK A;  3F63 A;  2FWF A;  1JLV A;  2B1K A;  3VFI A;  2HFD A;  3CMI A;  3CSI A;  4IN0 A;  3EWL A;  2VIM A;  1U3A A;  2CVK A;  2L5L A;  3EUR A;  4J2F A;  1B4Q A;  1GUM A;  3CBU A;  3GYK A;  5CO3 A;  1TJD A;  2H19 A;  2FWH A;  1Z7P A;  4IHU A;  2F9S A;  3ZTL A;  3H93 A;  4GQC A;  2LQQ A;  2FHE A;  5D9W A;  2ES7 A;  2MZC A;  2UZ8 A;  3OR5 A;  5KN0 A;  4LA1 A;  3Q19 A;  2H74 A;  4TRX A;  4EVM A;  2YV7 A;  1GUL A;  1SYR A;  3VWU A;  4D73 B;  3UVT A;  2HRK B;  3M3M A;  2DJJ A;  4TR0 A;  3EIN A;  5GAP D;  3I9V 2;  4BL7 A;  2WB9 A;  1PD2 1;  1TP9 A;  2WCI A;  5F07 A;  1THX A;  2E7P A;  2IIY A;  1AQX A;  3UAR A;  4JR6 A;  1TK8 B;  3F3Q A;  3M9J A;  3QFA C;  1WE0 A;  5DAL A;  2P31 A;  1SJ6 A;  2R2J A;  1ZOF A;  2VCQ A;  4KND A;  5ECK B;  2CX3 A;  1O6J A;  3C8E A;  4GTU A;  1XPV A;  1B4P A;  1VF1 A;  2KLX A;  3HYP A;  1CQG A;  1SKS B;  2JZT A;  3FZA A;  3DYR A;  4MCU A;  3CXG A;  2PBJ A;  1FB0 A;  2LNS A;  3GNJ A;  4GCI A;  5J9C A;  3U6V A;  4O92 A;  1NHO A;  4RQR A;  4N0V A;  3UMA A;  3WT1 A;  1B8X A;  1EP8 A;  1O8X A;  3TCO A;  3I6A A;  1AUC A;  1BX9 A;  4JU5 A;  1YZX A;  3UL3 A;  3HA9 A;  3RAZ A;  1GSF A;  4PGT A;  4I8B A;  5B8B A;  3KCM A;  22GS A;  1EGO A;  3IK7 A;  2X8C A;  3KMO A;  3HCZ A;  3LG6 A;  1JFU A;  2H1B A;  1OKT A;  4IVF A;  1C72 A;  3MSZ A;  3P2A A;  4FYU A;  2LTK A;  1ERT A;  3PH9 A;  1K0N A;  2O7K A;  5ECH B;  4G10 A;  2VLT A;  4ECB A;  4KDY A;  1K0C A;  4GST A;  2M80 A;  2DC5 A;  1SYX A;  3GL3 A;  3ZIJ A;  2IFQ A;  2WRT A;  4ULX A;  2YV9 A;  2C4J A;  4XTS A;  3KXO A;  1ERU A;  20GS A;  4ML6 A;  3NZN A;  2H0G A;  3ZVJ A;  3HKR A;  3VLN A;  1Z6N A;  2LJR A;  4HZ4 A;  4Q5Q A;  4KF9 A;  2HI7 A;  3TKS C;  1M7T A;  1TI3 A;  4FO5 A;  2O8V B;  4WKW A;  4N11 A;  4LLR A;  2QKE A;  4OFT A;  2L59 A;  3W8S A;  2V6K A;  5BMU A;  5IMC A;  1TW9 A;  5JCU A;  3LEF A;  2DSA A;  4K8M A;  4RI6 A;  4KSO A;  3RDW A;  1WJK A;  4FYB A;  2DLX A;  2ZCT A;  1SU9 A;  4HJ2 A;  4TVE A;  3CSH A;  3DVX A;  2H6Z A;  1SK0 A;  3RBT A;  5DAK A;  6GSU A;  1OE7 A;  3GKX A;  4ZBB A;  3G9B A;  5A4U A;  2N5F A;  1YDK A;  1FVJ A;  4ZL9 A;  3WD6 A;  2B5E A;  1YKA A;  1WMJ A;  3HJP A;  5ECL B;  4MLY A;  5IMZ A;  3CRU A;  10GS A;  2AHE A;  3TGZ A;  2C80 A;  4L0U A;  4BVY A;  2FGX A;  2N5B A;  4AJ7 A;  2GS3 A;  4TKY A;  3Q74 A;  1FVK A;  1ML6 A;  2LNT A;  2CV4 A;  1FW1 A;  1T4Z A;  1GSU A;  5C00 A;  2ON7 A;  2VD1 A;  5GSS A;  2DJ0 A;  4MJB A;  3MAK A;  2DJ1 A;  1KNG A;  2EIO A;  3GUR A;  5HR0 A;  4RUV A;  4ZXG A;  14GS A;  5COH A;  2AYT A;  3IA1 A;  1SL0 B;  4AGS A;  2B7K A;  4POK A;  3QPM A;  1AXD A;  1XW5 A;  1VF2 A;  4KAE A;  3ED3 A;  1DUG A;  3DVW A;  3I43 A;  3L9S A;  2I4A A;  1Y6E A;  5IMF A;  3F9U A;  1ST9 A;  3HDC A;  2XPE A;  4WR5 A;  3LXT A;  2A2S A;  2NVL A;  2YCD A;  1T1V A;  1QGV A;  3DRN A;  4DSS A;  3LGC A;  4YQV A;  4AJ8 A;  2VL3 A;  2H70 A;  4BPY A;  1XVQ A;  1A23 A;  3Q6O A;  4TXV A;  4IQA A;  2H8L A;  2ZNM A;  1GSQ A;  2JZR A;  4ECI A;  2LS5 A;  5HR2 A;  2WUL A;  3TUE A;  3ERG A;  3EMP A;  3TRQ A;  3BOA A;  3O76 A;  1HNB A;  4PXO A;  2RM5 A;  4BVX A;  9GSS A;  5DAK B;  3PIN A;  5FT3 A;  4OCE A;  2C3Q A;  4EL1 A;  1NM3 A;  4FH8 A;  2CQ9 A;  5IOX A;  3KEB A;  3ZRD A;  5INY A;  2AAW A;  1GLQ A;  5KN2 A;  4WBJ A;  2R5G A;  4ECC A;  3GKN A;  5JWO B;  2TIR A;  2XHF A;  1QUW A;  3F8U A;  2C8U A;  1M9A A;  5ID2 A;  2B5Y A;  4N10 A;  3M8N A;  3J7Y k;  2CVB A;  1A0R P;  5DQY A;  4ZBA A;  1ZCP A;  1GTA A;  2GLR A;  5KEJ A;  4X43 A;  2GZY A;  4LL4 B;  4F82 A;  3KIJ A;  3FZ9 A;  4K0N A;  4MA9 A;  4Q5N A;  4USS A;  4ZBD A;  2GQK A;  4GF0 A;  2XC2 A;  3H8Q A;  1LU4 A;  1QMV A;  5GST A;  3M0F A;  2WZ9 A;  4Q5R A;  4IQ1 A;  1V57 A;  2IN3 A;  2A2R A;  3UBK A;  3VWW A;  4NHW A;  3TOT A;  2OE1 A;  4HU7 A;  2HZE B;  3F0I A;  3KTB A;  3EE2 A;  4GRF A;  3ZYW A;  3US3 A;  5CRD A;  2JU5 A;  1S3C A;  2FUG 2;  1BG5 A;  2IPA A;  4BWQ A;  4MZC A;  2CA8 A;  1EV4 A;  2XBQ A;  3TDG A;  4NV2 A;  4D73 A;  1DBY A;  2HRK A;  1U3I A;  2ON5 A;  1GSD A;  3VK9 A;  1M99 A;  3L9V A;  2HRN A;  3QAW A;  2A4V A;  1AAZ A;  2B5X A;  1XW9 A;  4QL9 A;  1OC8 A;  4HUA A;  5GAN D;  2C1Y A;  4K9Z A;  3CSJ A;  2MMN A;  1YF0 A;  4I2T A;  1AIU A;  4ACS A;  1GH2 A;  2AV4 A;  2K6V A;  2FY6 A;  3A2X A;  3DML A;  4HQS A;  1A2J A;  4EC0 A;  2MMO A;  1DE2 A;  1XZO A;  3ZZX A;  2FD3 A;  4K2D A;  2VO4 A;  2E0Q A;  2K9F A;  4F2I A;  2CVD A;  2PGT A;  4YAV A;  2F8F A;  2IJY A;  1F9M A;  4DSQ A;  1G6Y A;  3UVH A;  2LST A;  3TKP A;  2FA4 A;  4ZB8 A;  4KE3 A;  2AB6 A;  1IYI A;  4HOJ A;  1TI1 A;  5GZZ B;  1VF4 A;  1GNW A;  5J4U A;  1PMT A;  2I9H A;  2WS2 A;  3TKR A;  2OE3 A;  3ZL5 A;  3LSZ A;  4JED A;  4KCE A;  4ID0 A;  1MDI A;  2BTO T;  1T00 A;  5E4W A;  5D8I A;  1F3A A;  4POM A;  5IPG A;  3Q18 A;  1TKD B;  1A24 A;  1GNE A;  5ELG A;  1GLP A;  1W4V A;  4G0K A;  3R2Q A;  5AIS A;  4IKH A;  1K3Y A;  1NSW A;  3CRT A;  2V32 A;  3ZLP A;  1SKR B;  5ECP B;  1HD2 A;  4KGI A;  4ZIJ A;  3F6D A;  1O7U A;  3UJ1 A;  3HJO A;  2IMD A;  1JHB A;  3L78 A;  4JE1 A;  2H71 A;  3P7X A;  3ME7 A;  1Z6M A;  2HSH A;  5ABR A;  1I9D A;  3UIW A;  2R3X A;  4NV5 A;  1XCC A;  1HNC A;  2PER A;  3SBC A;  1UN2 A;  1ZYE A;  4ZB6 A;  1TRS A;  5B6M A;  4TN8 A;  3IBH A;  3C71 A;  3CTG A;  3VWX A;  2K18 A;  13GS A;  3DGQ A;  5IO2 A;  4KA0 A;  3H79 A;  4I5Q A;  4XS4 B;  2RII A;  1YEP A;  5CNW A;  1B9X C;  3TB2 A;  2IME A;  3EC3 A;  3QAV A;  2IWT A;  4OFN A;  3KD0 A;  2CT6 A;  3E0U A;  3C1S A;  3P90 A;  2YN1 A;  3LWA A;  3HHV A;  1XIY A;  4POB A;  5G1K A;  2G0F A;  3P8W A;  2V6O A;  3FR3 A;  2CX4 A;  1K0O A;  1J0F A;  4FQU A;  3GKM A;  4V1A g;  1QK8 A;  1THO A;  1RQM A;  5EL8 A;  3GIX A;  3LJR A;  1XFL A;  4MMM A;  4MP4 A;  4J56 E;  3VPT A;  3FY7 A;  3SWL A;  4OWY A;  3QDN A;  4MZW A;  1KBN A;  1BED A;  4Z7X A;  3MWH A;  2BJX A;  2DBC A;  4NAX A;  4TR3 A;  4E8H A;  1SD8 A;  5A4V A;  3VI5 A;  1Y25 A;  2NBS A;  1R5P A;  2L5O A;  1FOV A;  4NWY A;  4XIH A;  2LUS A;  2X8G A;  3V1W A;  5L71 A;  2L57 A;  2RUF A;  4PUR A;  4GSN A;  4JRR A;  1V58 A;  2LRT A;  3IAS 2;  3U5R E;  4EF0 A;  2VL9 A;  1TRU A;  1T8E B;  1TU7 A;  4WF5 A;  4F03 A;  1KEB A;  3PR8 A;  3HVS A;  3ZML A;  1VGL A;  2GDR A;  1XWC A;  1K0M A;  2H1D A;  1Z3E A;  4I6X A;  4TXO B;  3KH9 A;  2YWM A;  1Z7R A;  5LCZ A;  3KP8 A;  2J9H A;  2DIY A;  2VD0 A;  3UAP A;  2FCH A;  3GV1 A;  1OE8 A;  2N5A A;  5KN3 A;  4EUY A;  4IGJ A;  1YQ1 A;  4MZB A;  1TDI A;  2P0G A;  2YZH A;  1ZMA A;  1YJ6 A;  5E59 A;  1TRW A;  3GMF A;  4G9H A;  2VLV A;  2FWG A;  1Z5Y E;  3KMN A;  2J23 A;  3TJK A;  1OAZ A;  2GST A;  4LL1 B;  2B1L A;  3VPQ A;  5ECR B;  4IW9 A;  5D9V A;  4NXI A;  5G30 A;  5AIX A;  2KOK A;  2ZUP A;  2JL4 A;  1UC7 A;  2EIR A;  5D96 A;  4MDC A;  1X5E A;  1PSQ A;  1JZO A;  3EMX A;  2VLU A;  2HSN B;  2FWE A;  2CZ3 A;  4KUN A;  2E2G A;  1R4W A;  1XBS A;  1G7E A;  1V2A A;  1YY7 A;  2X8H A;  1GP1 A;  1T7P B;  1GTI A;  4V2M A;  4NMU A;  5HR1 A;  1F3B A;  3E3E A;  4OCF A;  1SK1 A;  1J08 A;  2REM A;  1EZK A;  4L8E A;  1VRS D;  4KDX A;  3N5O A;  1TK0 B;  1X9M B;  2I81 A;  3G7Y A;  3RPP A;  8GSS A;  2F8A A;  1LJR A;  2VL2 A;  1FO5 A;  2C0F A;  1ABA A;  1WPI A;  4KW6 A;  4JR4 A;  2VCW A;  5EVO A;  3A5W A;  3QFB C;  4X0X A;  3C1R A;  1U88 A;  4POL A;  2PU9 C;  4MJC A;  1PL1 A;  2H73 A;  5G31 A;  3IPZ A;  3GRX A;  1ZL9 A;  3L0H A;  2H1G A;  4N0Z A;  2GTU A;  1EEM A;  2H1A A;  4HDE A;  5DBQ A;  2IMK A;  2HZE A;  3D4M A;  6GSX A;  2YWI A;  3HXS A;  4WET A;  2R6K A;  4FYC A;  5CRE A;  1CQH A;  1SJZ A;  5HR3 A;  6GST A;  5IM9 A;  4XRD A;  4K7N A;  1EOG A;  3W6G A;  3DKS A;  3QD9 A;  4O7H A;  1O8W A;  5ELA A;  4RI7 A;  1ZZY A;  3IDV A;  1PX7 A;  3QAG A;  4CW9 A;  2PVQ A;  4KH7 A;  1SKW B;  2MMZ A;  2HRF A;  1WOU A;  4IP6 A;  4GSS A;  3BCK A;  4GWR A;  5DCG A;  1TU8 A;  3VUR A;  2P5Q A;  3DXB A;  4ZL8 A;  2LKU A;  2VOC A;  1JLW A;  1V40 A;  5CP1 A;  3PGT A;  3I69 A;  4XS6 A;  19GS A;  3IE3 A;  1RK4 A;  4V2N A;  2OAD A;  5B7C A;  1TXX A;  1Q4J A;  4WXT A;  1R7H A;  1K3L A;  2O89 A;  1E6B A;  3TJB A;  3KTL A;  2QSI A;  2RUE A;  2V41 A;  2C3T A;  3G7J A;  2RLI A;  1F2E A;  1A2L A;  1NHY A;  3ME8 A;  3FYG A;  4ZL7 A;  3H1N A;  5ECS A;  1T3B A;  16GS A;  1PRX A;  4G0L A;  3WT2 A;  4K1F A;  4WR4 A;  2HZF A;  3D22 A;  1V9W A;  3GFK A;  2DIZ A;  2EIQ A;  1WIK A;  4P3Y B;  3FZ5 A;  3M9K A;  1AW9 A;  3ZIV A;  3ZRE A;  1PKW A;  2HQT A;  3BD2 A;  1SD9 A;  1G6W A;  2NTO A;  5HQP A;  5LNK e;  2MBS A;  4Q5F A;  3FHK A;  3IAM 2;  5J41 A;  1TRV A;  3IOS A;  4PNG A;  2L4Q A;  3APS A;  1GL8 A;  4X1U A;  3VWV A;  2YWO A;  4HI7 A;  4HJM A;  2PVO C;  1AC1 A;  4MH2 A;  3FRC A;  1PKZ A;  3DWV A;  2YWN A;  2GSS A;  4KX4 A;  2B7J A;  1KTE A;  5J9B A;  3F3R A;  2G2Q A;  2YAN A;  4KB3 A;  1MTC A;  5FHI A;  1GTU A;  2GGT A;  1XOA A;  5IIZ A;  4V1A p;  2QGV A;  2I3Y A;  4IS0 A;  4DSR A;  5G5E A;  1X0R A; 
#chains in the Genus database with same CATH topology
 1R5A A;  4OO5 A;  3TKQ A;  2JZS A;  1M2B A;  1N2A A;  3C7M A;  2C0D A;  2YNX A;  4XS4 A;  2QA1 A;  3EU3 A;  1FAA A;  2VUP A;  5F06 A;  4JZQ A;  4EE0 A;  1SVL A;  3GA4 A;  2WJU A;  3LYP A;  2LEG A;  2H66 A;  1M3I A;  3A3T A;  4AKG A;  2LRN A;  2KHP A;  1XWK A;  1XWG A;  2OBI A;  1JZR A;  2VCX A;  2VM2 A;  2M46 A;  2HRA A;  1ON4 A;  1AQW A;  1MD4 A;  5ECN B;  4MK3 A;  1GSE A;  3IXR A;  3ZFL A;  3GH6 A;  3R3E A;  2YOI A;  3G7I A;  4F0B A;  2WGR A;  5ECM B;  4A5P A;  4KCA A;  1K0B A;  3TJJ A;  4MH3 A;  5H5Q A;  11GS A;  4MF7 A;  5ECQ B;  2HLS A;  4PQH A;  4EXJ A;  1LBK A;  1HYU A;  3PPU A;  2OT3 A;  2R0G A;  4PQI A;  4XS1 A;  3LFL A;  4AJ6 A;  3UEM A;  3TOU A;  5CAX A;  2R37 A;  3TKS E;  1HQO A;  3KZQ A;  4WEY A;  4ECJ A;  1EP7 A;  2H0I A;  2M72 A;  1SVM A;  1O81 A;  2OE0 A;  2GQL A;  4MJE A;  1DSB A;  2FA8 A;  2PWJ A;  4JBB A;  3GSS A;  5D93 A;  2YZU A;  2FNO A;  2DJ2 A;  4TXO A;  4AKI A;  3GST A;  2HT9 A;  3QMX A;  4HEA 2;  4G19 A;  1ILO A;  2DJ3 A;  1XOB A;  4HS1 A;  3RHB A;  1PN0 A;  4EIP A;  4G2E A;  4LMV A;  1XVW A;  4NPB A;  2KP2 A;  2LJA A;  2GVP A;  1AQV A;  1YF1 A;  3FEU A;  2DML A;  4KSM A;  1TOF A;  2WFC A;  3F4S A;  3F4R A;  4XCS A;  5DQS A;  2C3N A;  2C0E A;  4DEJ A;  2HE3 A;  5DDL A;  3CQF A;  3IHQ A;  2VCT A;  2NPB A;  1R26 A;  5B8A A;  2GSQ A;  4J57 E;  3APQ A;  1JZD A;  3GTU B;  3EPT A;  1PN9 A;  1BAY A;  2V1M A;  2VCV A;  2IL3 A;  1MDJ A;  4FIW A;  4AF2 A;  12GS A;  5FWG A;  1BYE A;  5EY6 A;  2DJK A;  4OO4 A;  4Z2U A;  3IR4 A;  7GSS A;  5D73 A;  1UA5 A;  1WWJ A;  3K8N A;  2HSN A;  3GN3 A;  4MF5 A;  17GS A;  2C0G A;  3LXZ A;  4TOP A;  4L5O A;  2CAQ A;  3HJM A;  3IV4 A;  1XWA A;  4I97 A;  4K7I A;  3KP9 A;  2RM6 A;  5HFI A;  3APO A;  2L6D A;  5KN1 A;  2H6Y A;  3CTF A;  4ISD A;  3IK9 A;  2OBK A;  2O85 A;  4YQU A;  2WDU A;  3HVX A;  1OC9 B;  4K7O A;  4MPG A;  5G2Z A;  18GS A;  4IP1 A;  4PNF A;  4KDU A;  5A5H A;  4V2L A;  2K8S A;  2VM1 A;  4O5R A;  4EIQ A;  1TTZ A;  4TR1 B;  4BWS A;  1QQ2 A;  2JAC A;  1YKC A;  1F6M C;  3IC4 A;  1ERW A;  2HNL A;  1GSS A;  5CRW A;  4F0C A;  4K6X A;  1GSY A;  4O32 A;  2P5R A;  4PX1 A;  2MYG A;  4XRA A;  1XXU A;  3BCI A;  2AJQ B;  4HU9 A;  2B6M A;  2H76 A;  2F3M A;  1M9B A;  1SL2 B;  3WGE A;  5F05 A;  5EPF A;  4OFM A;  3FR6 A;  2L4C A;  4TR4 A;  3M1G A;  1WP0 A;  5J3R A;  1URM A;  5D9T A;  1MDK A;  1BF5 A;  6GSV A;  5CYY A;  3EU4 A;  1FHE A;  3ZFB A;  4EO3 A;  2K8V A;  5ECI B;  3TRP A;  4EDY A;  4N3Z A;  2ALB A;  2XBI A;  2V2G A;  3W8J A;  3D0Z A;  2LV3 A;  2TRX A;  2FLS A;  1WRY A;  2QC7 A;  2X99 A;  1GTB A;  1OVN A;  2NDO A;  5JCG A;  4TW5 A;  5DCH A;  2VL2 C;  4MNN A;  4MPF A;  3MDK A;  3WYW A;  2YJ7 A;  3ZVJ D;  3LOR A;  1DE1 A;  1N8J A;  4BL7 B;  5IO0 A;  2O3E A;  2VCZ A;  3TRX A;  5G1L A;  1X9W B;  3ZMK A;  3HD5 A;  1PA3 A;  2H0H A;  4MAB A;  4ZIL A;  5DAL B;  1SJI A;  1B9Y C;  5A5K A;  2OJL A;  2X49 A;  4CHS A;  3KGK A;  3CWG A;  3RHC A;  2HSM A;  1H4O A;  3TKS A;  4YQM A;  3UBL A;  2YP6 A;  1I5G A;  1K0D A;  3KJY A;  5IMD A;  5ENU A;  5JWQ B;  4GDF A;  4PUA A;  1O73 A;  3TJG A;  4YH2 A;  1X9S B;  3A2V A;  1V98 A;  1H75 A;  2AUV A;  2KP1 A;  5C04 A;  3BBY A;  4K0G A;  4L5L A;  1M3J A;  4DVC A;  2PPT A;  3L9U A;  1K0A A;  2PMT A;  3ISO A;  1UVZ A;  1Q98 A;  3N9J A;  4GLT A;  2JSZ A;  2PN8 A;  2PUK C;  3GL5 A;  2WVZ A;  2JAD A;  4ILF A;  4IJI A;  1GRX A;  5DVB A;  4CDO A;  3ERF A;  4MF6 A;  4QQ7 A;  5H5S A;  3ERW A;  2OAC A;  4AI6 A;  2EC4 A;  1U87 A;  3RFR C;  2YJH A;  1ZGN A;  6GSS A;  4MJA A;  4EKZ A;  3O6T A;  1PQN A;  2Z9S A;  1A8Y A;  4F9Z A;  4BA7 A;  1GUH A;  2IFQ B;  3GKK A;  3HY2 A;  1RW1 A;  1Z9H A;  4OMV A;  1M0U A;  6GSW A;  2WW3 A;  2GQM A;  1I1I P;  4WF4 A;  5DJM A;  2X64 A;  1A2M A;  1S3A A;  3QOU A;  2E2M A;  5H5R A;  2DMM A;  2LRC A;  1X5C A;  1YEX A;  3H4K A;  4N30 A;  2GT5 A;  3F4T A;  3S9F A;  3F6F A;  1SEN A;  2KUC A;  5BMU B;  4OD7 A;  2BMX A;  1IYH A;  1G7O A;  3C73 A;  5AGY A;  4XHM A;  2OKA A;  1EWX A;  1EOH A;  1A8L A;  4G0I A;  3A2W A;  1ACV A;  3D21 A;  3QR6 A;  3DEX A;  3D4T A;  3L4N A;  5A4W A;  1U6T A;  3O3T A;  4WBR D;  4AKH A;  3IRA A;  5HFK A;  1GWC A;  5CRG A;  1JZW A;  2CZ2 A;  2HSM B;  5A1N B;  4HZ2 A;  2HYX A;  4LMW A;  5IMA A;  2R4V A;  5JWR B;  3FR9 A;  4YAP A;  2LQO A;  1E2Y A;  2H30 A;  3VI7 A;  3AY8 A;  4PQ1 A;  2H72 A;  4Z2T A;  5LD0 A;  4IJ3 A;  2XPD A;  4QL7 A;  1BJX A;  4BVY B;  2B3S A;  2H75 A;  5IOW A;  2A4H A;  1M2A A;  2TRC P;  1USB A;  1QXH A;  1PGT A;  2D2Z A;  3NOF A;  3FW2 A;  4W66 A;  1XW6 A;  4HQZ A;  4CY8 A;  3TJF A;  5J5N A;  2WVX B;  1SK2 A;  6GSY A;  2GZP A;  4PI0 C;  1VF3 A;  4E8E A;  1FB6 A;  1GUK A;  2VAF A;  1F37 A;  3GUS A;  5CRH A;  1J9B A;  1PX6 A;  1B48 A;  3QCP A;  1HNA A;  5ECO B;  4GQF A;  3FK8 A;  4RQX A;  4X4J A;  1XWB A;  5F8B A;  1EGR A;  5IPH A;  1TK5 B;  2CAI A;  5JCW A;  4I2U A;  5G5F A;  4DSS B;  1PL2 A;  1W89 A;  1A0F A;  3GTU A;  4GXZ A;  1X5D A;  3D6I A;  3E9J B;  5DJL A;  2GZZ A;  3FKF A;  3ZIT A;  4G01 A;  4EDZ A;  2O87 A;  1EV9 A;  1ERV A;  2H01 A;  2MMA A;  3KH7 A;  3NIV A;  3GH9 A;  3WGX A;  2GSR A;  1BQ7 A;  5HFG A;  2WW1 A;  1G0T A;  4PUF C;  2WVY A;  1EEJ A;  4IBP A;  4CY6 A;  5IMV A;  4BVX B;  1ZYQ B;  3WGD A;  3KM6 A;  4ML1 A;  2F51 A;  1M2D A;  2H6X A;  4IEL A;  2OA7 A;  4H86 A;  3RPN A;  3EYT A;  4BIK A;  3EVI A;  1S3D A;  3MNG A;  3IC8 A;  5F0G A;  5AN1 A;  1OKD A;  3FZ4 A;  3GX0 A;  5B6N A;  2GT6 A;  1MEK A;  4NHZ A;  2LJK A;  1OYJ A;  1O85 A;  5D9X A;  4L0W A;  1FG4 A;  3CYN A;  2IMF A;  3GX8 A;  3HVV A;  5ID2 B;  1OC9 A;  2I1U A;  3DIE A;  3HZ8 A;  2MBT A;  3D5J A;  4PHZ C;  5AIV A;  2L6C A;  2HSY A;  1MD3 A;  3HZ4 A;  3LYK A;  1QFN A;  4TR1 A;  2IMI A;  3UOM A;  1SL1 B;  4ZB9 A;  3J7Y b;  3DD3 A;  1NW2 A;  5IQY A;  1K3O A;  4PTS A;  3LQ7 A;  2JSY A;  3JCM L;  2YPM A;  3BJ5 A;  1OC3 A;  1T4Y A;  3GHA A;  2HXK A;  3F63 A;  2FWF A;  1JLV A;  2B1K A;  3VFI A;  2HFD A;  3CMI A;  3CSI A;  4IN0 A;  3EWL A;  2VIM A;  1U3A A;  2CVK A;  2L5L A;  3EUR A;  4J2F A;  1B4Q A;  1GUM A;  3CBU A;  3GYK A;  5CO3 A;  1TJD A;  2H19 A;  2FWH A;  1Z7P A;  4IHU A;  2F9S A;  3ZTL A;  3H93 A;  4GQC A;  2LQQ A;  2FHE A;  5D9W A;  2ES7 A;  2MZC A;  2UZ8 A;  3OR5 A;  5KN0 A;  4LA1 A;  3Q19 A;  2H74 A;  4TRX A;  4EVM A;  2YV7 A;  1GUL A;  1SYR A;  3VWU A;  4D73 B;  3UVT A;  2HRK B;  3M3M A;  2DJJ A;  4TR0 A;  3EIN A;  5GAP D;  3I9V 2;  4BL7 A;  2WB9 A;  1PD2 1;  1TP9 A;  2WCI A;  5F07 A;  1THX A;  2E7P A;  2IIY A;  1AQX A;  3UAR A;  4JR6 A;  1TK8 B;  3F3Q A;  3M9J A;  3QFA C;  1WE0 A;  5DAL A;  2P31 A;  1SJ6 A;  2R2J A;  1ZOF A;  2VCQ A;  4KND A;  5ECK B;  2CX3 A;  1O6J A;  3C8E A;  4GTU A;  1XPV A;  1B4P A;  1VF1 A;  4O5U A;  2KLX A;  3HYP A;  1CQG A;  1SKS B;  2JZT A;  3FZA A;  3DYR A;  4MCU A;  3CXG A;  2PBJ A;  1FB0 A;  2LNS A;  3GNJ A;  4GCI A;  5J9C A;  1XG8 A;  3U6V A;  4O92 A;  1NHO A;  4RQR A;  2R0P A;  4N0V A;  3UMA A;  3WT1 A;  1B8X A;  1EP8 A;  1O8X A;  3TCO A;  3I6A A;  1AUC A;  1BX9 A;  4JU5 A;  1YZX A;  3UL3 A;  3HA9 A;  3RAZ A;  2EFD A;  1GSF A;  4PGT A;  4I8B A;  5B8B A;  3KCM A;  2EFE A;  22GS A;  1S4B P;  3IK7 A;  1EGO A;  2X8C A;  3KMO A;  3HCZ A;  3LG6 A;  1JFU A;  2H1B A;  1OKT A;  4IVF A;  1C72 A;  3MSZ A;  3P2A A;  4FYU A;  2LTK A;  1ERT A;  3PH9 A;  1K0N A;  2O7K A;  5ECH B;  4G10 A;  3FMW A;  2VLT A;  4ECB A;  4KDY A;  1K0C A;  4GST A;  2M80 A;  2DC5 A;  1SYX A;  3GL3 A;  3ZIJ A;  2IFQ A;  2WRT A;  4ULX A;  2YV9 A;  2C4J A;  4XTS A;  1SVO A;  3KXO A;  1ERU A;  20GS A;  4ML6 A;  3NZN A;  2H0G A;  3ZVJ A;  3HKR A;  3VLN A;  1Z6N A;  2LJR A;  4HZ4 A;  4Q5Q A;  4KF9 A;  2HI7 A;  3TKS C;  1M7T A;  1TI3 A;  2X4A A;  4FO5 A;  2O8V B;  4WKW A;  4N11 A;  4LLR A;  2QKE A;  4OFT A;  2L59 A;  3W8S A;  2V6K A;  5BMU A;  5IMC A;  1TW9 A;  5JCU A;  2DSA A;  3LEF A;  4K8M A;  5BRT A;  4RI6 A;  4KSO A;  3RDW A;  1WJK A;  4FYB A;  2DLX A;  2ZCT A;  1SU9 A;  4HJ2 A;  4TVE A;  2QA2 A;  3IHG A;  3CSH A;  3DVX A;  2H6Z A;  1SK0 A;  3RBT A;  5DAK A;  6GSU A;  1OE7 A;  3GKX A;  4ZBB A;  3G9B A;  5A4U A;  5A1N A;  2N5F A;  1YDK A;  1FVJ A;  4ZL9 A;  3WD6 A;  2B5E A;  2O5V A;  1YKA A;  1WMJ A;  3HJP A;  5ECL B;  4MLY A;  5IMZ A;  3CRU A;  10GS A;  2AHE A;  3TGZ A;  2C80 A;  4L0U A;  4BVY A;  2FGX A;  2N5B A;  4AJ7 A;  2GS3 A;  4TKY A;  3Q74 A;  1FVK A;  1ML6 A;  2LNT A;  2CV4 A;  1FW1 A;  1T4Z A;  1GSU A;  5C00 A;  2ON7 A;  2VD1 A;  5GSS A;  2DJ0 A;  4MJB A;  3MAK A;  2DJ1 A;  1KNG A;  2EIO A;  3GUR A;  5HR0 A;  4RUV A;  4ZXG A;  14GS A;  5COH A;  2WVX A;  2AYT A;  3IA1 A;  1SL0 B;  4AGS A;  2B7K A;  4POK A;  3QPM A;  1AXD A;  1XW5 A;  1VF2 A;  4KAE A;  3ED3 A;  1DUG A;  1ZYN A;  3DVW A;  3I43 A;  3L9S A;  2I4A A;  1Y6E A;  5IMF A;  3F9U A;  1ST9 A;  3HDC A;  2XPE A;  4WR5 A;  1Y1U A;  3LXT A;  2A2S A;  2NVL A;  4E68 A;  2YCD A;  1T1V A;  1QGV A;  1YEW C;  3DRN A;  4DSS A;  3LGC A;  4YQV A;  4AJ8 A;  2VL3 A;  2H70 A;  4BPY A;  1XVQ A;  1A23 A;  3Q6O A;  4TXV A;  4IQA A;  2H8L A;  2ZNM A;  1GSQ A;  4YKG A;  2JZR A;  5KOW A;  5A34 A;  4ECI A;  2LS5 A;  5HR2 A;  2WUL A;  3TUE A;  3ERG A;  3EMP A;  3TRQ A;  3BOA A;  3O76 A;  1HNB A;  4PXO A;  2RM5 A;  4BVX A;  9GSS A;  5DAK B;  3PIN A;  5FT3 A;  4OCE A;  2C3Q A;  4EL1 A;  1NM3 A;  4FH8 A;  2CQ9 A;  5IOX A;  3KEB A;  3ZRD A;  5INY A;  2AAW A;  1GLQ A;  5KN2 A;  4WBJ A;  2R5G A;  4ECC A;  3GKN A;  5JWO B;  2TIR A;  2XHF A;  1QUW A;  3F8U A;  2C8U A;  1M9A A;  5ID2 A;  2B5Y A;  5J40 A;  4N10 A;  3M8N A;  3J7Y k;  2CVB A;  1A0R P;  5DQY A;  4ZBA A;  1ZCP A;  1GTA A;  2GLR A;  5KEJ A;  4X43 A;  2GZY A;  4LL4 B;  4F82 A;  3KIJ A;  3FZ9 A;  4K0N A;  4MA9 A;  4Q5N A;  4USS A;  4ZBD A;  2GQK A;  4GF0 A;  2XC2 A;  3H8Q A;  1LU4 A;  1QMV A;  4O5Q A;  5GST A;  3M0F A;  2WZ9 A;  4Q5R A;  4IQ1 A;  1V57 A;  2IN3 A;  2A2R A;  3UBK A;  3VWW A;  4FXY P;  4NHW A;  3TOT A;  2OE1 A;  4HU7 A;  2HZE B;  4YKF A;  3F0I A;  3KTB A;  3EE2 A;  4GRF A;  3ZYW A;  3US3 A;  5CRD A;  2JU5 A;  1S3C A;  2FUG 2;  1BG5 A;  2IPA A;  4BWQ A;  4MZC A;  2CA8 A;  1EV4 A;  2XBQ A;  3TDG A;  4NV2 A;  2H1L A;  4D73 A;  1DBY A;  2HRK A;  1U3I A;  2ON5 A;  1GSD A;  3VK9 A;  1M99 A;  5A34 B;  3L9V A;  2HRN A;  3QAW A;  2A4V A;  1AAZ A;  2B5X A;  1XW9 A;  4QL9 A;  1OC8 A;  4HUA A;  5GAN D;  2C1Y A;  4K9Z A;  1BG1 A;  3CSJ A;  2MMN A;  1YF0 A;  4I2T A;  4ZB7 A;  1AIU A;  4ACS A;  1GH2 A;  2AV4 A;  2K6V A;  2FY6 A;  3A2X A;  3DML A;  4HQS A;  1A2J A;  4EC0 A;  2MMO A;  5KOX A;  1DE2 A;  1XZO A;  3ZZX A;  2FD3 A;  4K2D A;  2VO4 A;  5J4V A;  2E0Q A;  2K9F A;  4F2I A;  2CVD A;  2PGT A;  4YAV A;  2F8F A;  2IJY A;  1F9M A;  4DSQ A;  1G6Y A;  3UVH A;  2LST A;  3TKP A;  2FA4 A;  4ZB8 A;  4KE3 A;  2AB6 A;  1IYI A;  4HOJ A;  1TI1 A;  5GZZ B;  1VF4 A;  1GNW A;  5J4U A;  1PMT A;  2I9H A;  2WS2 A;  3TKR A;  2A2P A;  2OE3 A;  3ZL5 A;  3LSZ A;  4JED A;  4KCE A;  4ID0 A;  1MDI A;  2BTO T;  1T00 A;  5E4W A;  5D8I A;  1F3A A;  4POM A;  5IPG A;  3Q18 A;  1TKD B;  1A24 A;  1GNE A;  5ELG A;  1GLP A;  1W4V A;  4G0K A;  3R2Q A;  5AIS A;  4IKH A;  1K3Y A;  1NSW A;  3CRT A;  2V32 A;  3ZLP A;  1SKR B;  5ECP B;  1HD2 A;  4KGI A;  4ZIJ A;  3F6D A;  1O7U A;  3UJ1 A;  3HJO A;  2IMD A;  1JHB A;  3L78 A;  4JE1 A;  2H71 A;  3P7X A;  3ME7 A;  1Z6M A;  4K5S A;  2HSH A;  5ABR A;  1I9D A;  3UIW A;  2WW0 A;  2R3X A;  4NV5 A;  1XCC A;  1HNC A;  2PER A;  3SBC A;  1UN2 A;  1ZYE A;  4ZB6 A;  1TRS A;  5B6M A;  4TN8 A;  3IBH A;  3C71 A;  3CTG A;  3HVN A;  4K2X A;  3VWX A;  2K18 A;  13GS A;  1ZYP A;  3DGQ A;  5IO2 A;  4KA0 A;  3H79 A;  4I5Q A;  4XS4 B;  2RII A;  1YEP A;  5CNW A;  1B9X C;  3TB2 A;  2IME A;  3EC3 A;  3QAV A;  2IWT A;  4OFN A;  3KD0 A;  4ICY A;  2CT6 A;  3E0U A;  3C1S A;  3P90 A;  2YN1 A;  3LWA A;  3HHV A;  1XIY A;  4POB A;  5G1K A;  2G0F A;  3P8W A;  2V6O A;  3FR3 A;  2CX4 A;  1K0O A;  1J0F A;  4FQU A;  3GKM A;  4V1A g;  1QK8 A;  3MYD A;  1THO A;  1RQM A;  5EL8 A;  3GIX A;  3LJR A;  1XFL A;  4MMM A;  4MP4 A;  1N25 A;  4J56 E;  2EFC A;  1TXU A;  3VPT A;  3FY7 A;  3SWL A;  4OWY A;  3QDN A;  4MZW A;  1KBN A;  1BED A;  4Z7X A;  3MWH A;  2BJX A;  1YVL A;  2DBC A;  4NAX A;  4TR3 A;  4E8H A;  1SD8 A;  5A4V A;  3VI5 A;  1Y25 A;  2NBS A;  1R5P A;  2L5O A;  1FOV A;  2UV8 G;  4NWY A;  4XIH A;  2LUS A;  1PFO A;  2X8G A;  3V1W A;  5L71 A;  2L57 A;  2RUF A;  4PUR A;  4PI2 C;  4HSC X;  4GSN A;  4JRR A;  1V58 A;  2LRT A;  3IAS 2;  3U5R E;  4EF0 A;  2VKZ G;  2VL9 A;  1TRU A;  1T8E B;  1TU7 A;  4WF5 A;  4F03 A;  1KEB A;  3PR8 A;  3HVS A;  3ZML A;  1VGL A;  3HMJ G;  2GDR A;  1XWC A;  1K0M A;  2H1D A;  1Z3E A;  4I6X A;  4TXO B;  3KH9 A;  2YWM A;  1Z7R A;  5LCZ A;  3KP8 A;  2J9H A;  2DIY A;  2VD0 A;  3UAP A;  2FCH A;  3GV1 A;  1OE8 A;  2N5A A;  5KN3 A;  4EUY A;  4IGJ A;  1YQ1 A;  4MZB A;  2WW2 A;  2DKI A;  1TDI A;  2P0G A;  2YZH A;  1ZMA A;  1YJ6 A;  5E59 A;  1TRW A;  3GMF A;  4G9H A;  2VLV A;  2FWG A;  1Z5Y E;  3KMN A;  2J23 A;  3TJK A;  1OAZ A;  2GST A;  4LL1 B;  2B1L A;  3VPQ A;  5ECR B;  4IW9 A;  5D9V A;  4NXI A;  5G30 A;  5J47 A;  5AIX A;  2KOK A;  2ZUP A;  2JL4 A;  1UC7 A;  2EIR A;  5D96 A;  4MDC A;  4AKX B;  1X5E A;  1PSQ A;  1JZO A;  3EMX A;  2VLU A;  2HSN B;  2FWE A;  2CZ3 A;  4KUN A;  2E2G A;  1R4W A;  1XBS A;  1G7E A;  1V2A A;  1YY7 A;  2X8H A;  1GP1 A;  1T7P B;  1GTI A;  3CHX C;  4V2M A;  4NMU A;  5HR1 A;  1F3B A;  3E3E A;  4OCF A;  1SK1 A;  1J08 A;  2REM A;  1EZK A;  4L8E A;  1VRS D;  4KDX A;  3N5O A;  1TK0 B;  1X9M B;  2I81 A;  3G7Y A;  3RPP A;  8GSS A;  2F8A A;  1LJR A;  2VL2 A;  1FO5 A;  2C0F A;  1ABA A;  1WPI A;  4KW6 A;  4JR4 A;  2VCW A;  5EVO A;  3A5W A;  3QFB C;  4X0X A;  3C1R A;  1U88 A;  5A5H B;  4POL A;  2PU9 C;  4MJC A;  1PL1 A;  2H73 A;  3A5I A;  5G31 A;  3TU3 B;  3IPZ A;  3GRX A;  1ZL9 A;  3L0H A;  2H1G A;  4N0Z A;  2GTU A;  1EEM A;  2H1A A;  4HDE A;  5DBQ A;  2IMK A;  2HZE A;  3D4M A;  6GSX A;  2YWI A;  3HXS A;  4WET A;  2R6K A;  4FYC A;  5CRE A;  1CQH A;  1SJZ A;  5HR3 A;  6GST A;  5IM9 A;  4XRD A;  4K7N A;  1EOG A;  3W6G A;  3DKS A;  3QD9 A;  4O7H A;  1O8W A;  5ELA A;  4RI7 A;  1ZZY A;  3IDV A;  1PX7 A;  3QAG A;  4CW9 A;  2PVQ A;  4KH7 A;  1SKW B;  2MMZ A;  2HRF A;  2WZS A;  1WOU A;  4IP6 A;  4GSS A;  3BCK A;  4GWR A;  5DCG A;  1TU8 A;  2DKH A;  3VUR A;  2P5Q A;  3DXB A;  4ZL8 A;  2LKU A;  2VOC A;  1JLW A;  1V40 A;  5CP1 A;  3PGT A;  3I69 A;  3LW9 A;  19GS A;  4XS6 A;  3IE3 A;  1RK4 A;  4V2N A;  2OAD A;  5B7C A;  5J4Y A;  1TXX A;  1Q4J A;  4WXT A;  1R7H A;  1K3L A;  2O89 A;  1E6B A;  3TJB A;  3KTL A;  2QSI A;  2RUE A;  2V41 A;  4Z2R A;  4QMK A;  2C3T A;  3G7J A;  2RLI A;  1F2E A;  1A2L A;  1NHY A;  3ME8 A;  3FYG A;  4ZL7 A;  3H1N A;  5ECS A;  1T3B A;  16GS A;  1PRX A;  4G0L A;  3WT2 A;  4K1F A;  4WR4 A;  2HZF A;  3D22 A;  1V9W A;  3GFK A;  2DIZ A;  2EIQ A;  1WIK A;  4P3Y B;  3FZ5 A;  3M9K A;  1AW9 A;  3MIX A;  3ZIV A;  3ZRE A;  1PKW A;  1FOH A;  2HQT A;  1S3R A;  3BD2 A;  2O36 A;  1SD9 A;  1G6W A;  2NTO A;  5HQP A;  5LNK e;  2MBS A;  4Q5F A;  3RGB C;  3FHK A;  3IAM 2;  5J41 A;  1TRV A;  3IOS A;  4PNG A;  2L4Q A;  3APS A;  1GL8 A;  2EFH A;  4X1U A;  3VWV A;  2YWO A;  4HI7 A;  4HJM A;  2PVO C;  1AC1 A;  4MH2 A;  2R0C A;  3FRC A;  1PKZ A;  3DWV A;  2YWN A;  2GSS A;  4KX4 A;  2B7J A;  1KTE A;  5J9B A;  3F3R A;  2G2Q A;  2YAN A;  4KB3 A;  1MTC A;  5FHI A;  1GTU A;  2GGT A;  1XOA A;  5IIZ A;  4V1A p;  2QGV A;  2I3Y A;  4K5R A;  4IS0 A;  4DSR A;  5G5E A;  1X0R A; 
#chains in the Genus database with same CATH homology
 1R5A A;  4OO5 A;  3TKQ A;  2JZS A;  1M2B A;  1N2A A;  3C7M A;  2C0D A;  2YNX A;  4XS4 A;  2QA1 A;  3EU3 A;  1FAA A;  2VUP A;  5F06 A;  4JZQ A;  4EE0 A;  1SVL A;  3GA4 A;  2WJU A;  3LYP A;  2LEG A;  2H66 A;  3A3T A;  4AKG A;  2LRN A;  2KHP A;  1XWK A;  1XWG A;  2OBI A;  1JZR A;  2VCX A;  2VM2 A;  2M46 A;  2HRA A;  1ON4 A;  1AQW A;  1MD4 A;  5ECN B;  4MK3 A;  1GSE A;  3IXR A;  3ZFL A;  3GH6 A;  3R3E A;  2YOI A;  3G7I A;  4F0B A;  2WGR A;  5ECM B;  4A5P A;  4KCA A;  1K0B A;  3TJJ A;  4MH3 A;  5H5Q A;  11GS A;  4MF7 A;  5ECQ B;  2HLS A;  4PQH A;  4EXJ A;  1LBK A;  1HYU A;  3PPU A;  2OT3 A;  2R0G A;  4PQI A;  4XS1 A;  3LFL A;  4AJ6 A;  3UEM A;  3TOU A;  5CAX A;  2R37 A;  3TKS E;  1HQO A;  3KZQ A;  4WEY A;  4ECJ A;  1EP7 A;  2H0I A;  2M72 A;  1SVM A;  1O81 A;  2OE0 A;  2GQL A;  4MJE A;  1DSB A;  2FA8 A;  2PWJ A;  4JBB A;  3GSS A;  5D93 A;  2YZU A;  2FNO A;  2DJ2 A;  4TXO A;  4AKI A;  3GST A;  2HT9 A;  3QMX A;  4HEA 2;  4G19 A;  1ILO A;  2DJ3 A;  1XOB A;  4HS1 A;  3RHB A;  1PN0 A;  4EIP A;  4G2E A;  4LMV A;  1XVW A;  4NPB A;  2KP2 A;  2LJA A;  2GVP A;  1AQV A;  1YF1 A;  3FEU A;  2DML A;  4KSM A;  1TOF A;  2WFC A;  3F4S A;  3F4R A;  4XCS A;  5DQS A;  2C3N A;  2C0E A;  4DEJ A;  2HE3 A;  5DDL A;  3IHQ A;  2VCT A;  2NPB A;  1R26 A;  5B8A A;  2GSQ A;  4J57 E;  3APQ A;  1JZD A;  3GTU B;  3EPT A;  1PN9 A;  1BAY A;  2V1M A;  2VCV A;  2IL3 A;  1MDJ A;  4FIW A;  4AF2 A;  12GS A;  5FWG A;  1BYE A;  5EY6 A;  2DJK A;  4OO4 A;  4Z2U A;  3IR4 A;  7GSS A;  5D73 A;  1UA5 A;  1WWJ A;  3K8N A;  2HSN A;  3GN3 A;  4MF5 A;  17GS A;  2C0G A;  3LXZ A;  4TOP A;  4L5O A;  2CAQ A;  3HJM A;  3IV4 A;  1XWA A;  4I97 A;  4K7I A;  3KP9 A;  2RM6 A;  5HFI A;  3APO A;  2L6D A;  5KN1 A;  2H6Y A;  3CTF A;  4ISD A;  3IK9 A;  2OBK A;  2O85 A;  4YQU A;  2WDU A;  3HVX A;  1OC9 B;  4K7O A;  4MPG A;  5G2Z A;  18GS A;  4IP1 A;  4PNF A;  4KDU A;  5A5H A;  4V2L A;  2K8S A;  2VM1 A;  4O5R A;  4EIQ A;  1TTZ A;  4TR1 B;  4BWS A;  1QQ2 A;  2JAC A;  1YKC A;  1F6M C;  3IC4 A;  1ERW A;  2HNL A;  1GSS A;  5CRW A;  4F0C A;  4K6X A;  1GSY A;  4O32 A;  2P5R A;  4PX1 A;  2MYG A;  4XRA A;  1XXU A;  3BCI A;  2AJQ B;  4HU9 A;  2B6M A;  2H76 A;  2F3M A;  1M9B A;  1SL2 B;  3WGE A;  5F05 A;  5EPF A;  4OFM A;  3FR6 A;  2L4C A;  4TR4 A;  3M1G A;  1WP0 A;  5J3R A;  1URM A;  5D9T A;  1MDK A;  1BF5 A;  6GSV A;  5CYY A;  3EU4 A;  1FHE A;  3ZFB A;  4EO3 A;  2K8V A;  5ECI B;  3TRP A;  4EDY A;  4N3Z A;  2ALB A;  2XBI A;  2V2G A;  3W8J A;  3D0Z A;  2LV3 A;  2TRX A;  2FLS A;  1WRY A;  2QC7 A;  2X99 A;  1GTB A;  1OVN A;  2NDO A;  5JCG A;  4TW5 A;  5DCH A;  2VL2 C;  4MNN A;  4MPF A;  3MDK A;  3WYW A;  2YJ7 A;  3ZVJ D;  3LOR A;  1DE1 A;  1N8J A;  4BL7 B;  5IO0 A;  2VCZ A;  3TRX A;  5G1L A;  1X9W B;  3ZMK A;  3HD5 A;  1PA3 A;  2H0H A;  4MAB A;  4ZIL A;  5DAL B;  1SJI A;  1B9Y C;  5A5K A;  2OJL A;  2X49 A;  4CHS A;  3KGK A;  3CWG A;  3RHC A;  2HSM A;  1H4O A;  3TKS A;  4YQM A;  3UBL A;  2YP6 A;  1I5G A;  1K0D A;  3KJY A;  5IMD A;  5ENU A;  5JWQ B;  4GDF A;  4PUA A;  1O73 A;  3TJG A;  4YH2 A;  1X9S B;  3A2V A;  1V98 A;  1H75 A;  2AUV A;  2KP1 A;  5C04 A;  3BBY A;  4K0G A;  4L5L A;  4DVC A;  2PPT A;  3L9U A;  1K0A A;  2PMT A;  3ISO A;  1UVZ A;  1Q98 A;  3N9J A;  4GLT A;  2JSZ A;  2PN8 A;  2PUK C;  3GL5 A;  2JAD A;  4ILF A;  4IJI A;  1GRX A;  5DVB A;  4CDO A;  3ERF A;  4MF6 A;  4QQ7 A;  5H5S A;  3ERW A;  2OAC A;  4AI6 A;  2EC4 A;  1U87 A;  2YJH A;  1ZGN A;  6GSS A;  4MJA A;  4EKZ A;  3O6T A;  1PQN A;  2Z9S A;  1A8Y A;  4F9Z A;  4BA7 A;  1GUH A;  2IFQ B;  3GKK A;  3HY2 A;  1RW1 A;  1Z9H A;  4OMV A;  1M0U A;  6GSW A;  2GQM A;  4WF4 A;  5DJM A;  2X64 A;  1A2M A;  1S3A A;  3QOU A;  2E2M A;  5H5R A;  2DMM A;  2LRC A;  1X5C A;  1YEX A;  3H4K A;  4N30 A;  2GT5 A;  3F4T A;  3S9F A;  3F6F A;  1SEN A;  2KUC A;  5BMU B;  4OD7 A;  2BMX A;  1IYH A;  1G7O A;  3C73 A;  5AGY A;  4XHM A;  2OKA A;  1EWX A;  1EOH A;  1A8L A;  4G0I A;  3A2W A;  1ACV A;  3D21 A;  3QR6 A;  3DEX A;  3D4T A;  3L4N A;  5A4W A;  1U6T A;  3O3T A;  4WBR D;  4AKH A;  3IRA A;  5HFK A;  1GWC A;  5CRG A;  1JZW A;  2CZ2 A;  2HSM B;  5A1N B;  4HZ2 A;  2HYX A;  4LMW A;  5IMA A;  2R4V A;  5JWR B;  3FR9 A;  4YAP A;  2LQO A;  1E2Y A;  2H30 A;  3VI7 A;  3AY8 A;  4PQ1 A;  2H72 A;  4Z2T A;  5LD0 A;  4IJ3 A;  2XPD A;  4QL7 A;  1BJX A;  4BVY B;  2B3S A;  2H75 A;  5IOW A;  2A4H A;  1M2A A;  2TRC P;  1USB A;  1QXH A;  1PGT A;  2D2Z A;  3NOF A;  3FW2 A;  4W66 A;  1XW6 A;  4HQZ A;  4CY8 A;  3TJF A;  5J5N A;  1SK2 A;  6GSY A;  2GZP A;  1VF3 A;  4E8E A;  1FB6 A;  1GUK A;  2VAF A;  1F37 A;  3GUS A;  5CRH A;  1J9B A;  1PX6 A;  1B48 A;  3QCP A;  1HNA A;  5ECO B;  4GQF A;  3FK8 A;  4RQX A;  4X4J A;  1XWB A;  5F8B A;  1EGR A;  5IPH A;  1TK5 B;  2CAI A;  5JCW A;  4I2U A;  5G5F A;  4DSS B;  1PL2 A;  1W89 A;  1A0F A;  3GTU A;  4GXZ A;  1X5D A;  3D6I A;  3E9J B;  5DJL A;  2GZZ A;  3FKF A;  3ZIT A;  4G01 A;  4EDZ A;  2O87 A;  1EV9 A;  1ERV A;  2H01 A;  2MMA A;  3KH7 A;  3NIV A;  3GH9 A;  3WGX A;  2GSR A;  1BQ7 A;  5HFG A;  1G0T A;  4PUF C;  1EEJ A;  4CY6 A;  4IBP A;  5IMV A;  4BVX B;  1ZYQ B;  3WGD A;  3KM6 A;  4ML1 A;  2F51 A;  1M2D A;  2H6X A;  4IEL A;  2OA7 A;  4H86 A;  3RPN A;  3EYT A;  3EVI A;  1S3D A;  3MNG A;  3IC8 A;  5F0G A;  5AN1 A;  1OKD A;  3FZ4 A;  3GX0 A;  5B6N A;  2GT6 A;  1MEK A;  4NHZ A;  2LJK A;  1OYJ A;  1O85 A;  5D9X A;  4L0W A;  1FG4 A;  3CYN A;  2IMF A;  3GX8 A;  3HVV A;  5ID2 B;  1OC9 A;  2I1U A;  3DIE A;  3HZ8 A;  2MBT A;  3D5J A;  5AIV A;  2L6C A;  2HSY A;  1MD3 A;  3HZ4 A;  3LYK A;  1QFN A;  4TR1 A;  2IMI A;  3UOM A;  1SL1 B;  4ZB9 A;  3J7Y b;  3DD3 A;  1NW2 A;  5IQY A;  1K3O A;  4PTS A;  3LQ7 A;  2JSY A;  3JCM L;  2YPM A;  3BJ5 A;  1OC3 A;  1T4Y A;  3GHA A;  2HXK A;  3F63 A;  2FWF A;  1JLV A;  2B1K A;  3VFI A;  2HFD A;  3CMI A;  3CSI A;  4IN0 A;  3EWL A;  2VIM A;  1U3A A;  2CVK A;  2L5L A;  3EUR A;  4J2F A;  1B4Q A;  1GUM A;  3CBU A;  3GYK A;  5CO3 A;  1TJD A;  2H19 A;  2FWH A;  1Z7P A;  4IHU A;  2F9S A;  3ZTL A;  3H93 A;  4GQC A;  2LQQ A;  2FHE A;  5D9W A;  2ES7 A;  2MZC A;  2UZ8 A;  3OR5 A;  5KN0 A;  4LA1 A;  3Q19 A;  2H74 A;  4TRX A;  4EVM A;  2YV7 A;  1GUL A;  1SYR A;  3VWU A;  4D73 B;  3UVT A;  2HRK B;  3M3M A;  2DJJ A;  4TR0 A;  3EIN A;  5GAP D;  3I9V 2;  4BL7 A;  2WB9 A;  1PD2 1;  1TP9 A;  2WCI A;  5F07 A;  1THX A;  2E7P A;  2IIY A;  1AQX A;  3UAR A;  4JR6 A;  1TK8 B;  3F3Q A;  3M9J A;  3QFA C;  1WE0 A;  5DAL A;  2P31 A;  1SJ6 A;  2R2J A;  1ZOF A;  2VCQ A;  4KND A;  5ECK B;  2CX3 A;  1O6J A;  3C8E A;  4GTU A;  1XPV A;  1B4P A;  1VF1 A;  4O5U A;  2KLX A;  3HYP A;  1CQG A;  1SKS B;  2JZT A;  3FZA A;  3DYR A;  4MCU A;  3CXG A;  2PBJ A;  1FB0 A;  2LNS A;  3GNJ A;  4GCI A;  5J9C A;  3U6V A;  4O92 A;  1NHO A;  4RQR A;  2R0P A;  4N0V A;  3UMA A;  3WT1 A;  1B8X A;  1EP8 A;  1O8X A;  3TCO A;  3I6A A;  1AUC A;  1BX9 A;  4JU5 A;  1YZX A;  3UL3 A;  3HA9 A;  3RAZ A;  2EFD A;  1GSF A;  4PGT A;  4I8B A;  5B8B A;  3KCM A;  2EFE A;  22GS A;  1EGO A;  3IK7 A;  2X8C A;  3KMO A;  3HCZ A;  3LG6 A;  1JFU A;  2H1B A;  1OKT A;  4IVF A;  1C72 A;  3MSZ A;  3P2A A;  4FYU A;  2LTK A;  1ERT A;  3PH9 A;  1K0N A;  2O7K A;  5ECH B;  4G10 A;  3FMW A;  2VLT A;  4ECB A;  4KDY A;  1K0C A;  4GST A;  2M80 A;  2DC5 A;  1SYX A;  3GL3 A;  3ZIJ A;  2IFQ A;  2WRT A;  4ULX A;  2YV9 A;  2C4J A;  4XTS A;  1SVO A;  3KXO A;  1ERU A;  20GS A;  4ML6 A;  3NZN A;  2H0G A;  3ZVJ A;  3HKR A;  3VLN A;  1Z6N A;  2LJR A;  4HZ4 A;  4Q5Q A;  4KF9 A;  2HI7 A;  3TKS C;  1M7T A;  1TI3 A;  2X4A A;  4FO5 A;  2O8V B;  4WKW A;  4N11 A;  4LLR A;  2QKE A;  4OFT A;  2L59 A;  3W8S A;  2V6K A;  5BMU A;  5IMC A;  1TW9 A;  5JCU A;  3LEF A;  2DSA A;  4K8M A;  5BRT A;  4RI6 A;  4KSO A;  3RDW A;  1WJK A;  4FYB A;  2DLX A;  2ZCT A;  1SU9 A;  4HJ2 A;  4TVE A;  2QA2 A;  3IHG A;  3CSH A;  3DVX A;  2H6Z A;  1SK0 A;  3RBT A;  5DAK A;  6GSU A;  1OE7 A;  3GKX A;  4ZBB A;  3G9B A;  5A4U A;  5A1N A;  2N5F A;  1YDK A;  1FVJ A;  4ZL9 A;  3WD6 A;  2B5E A;  2O5V A;  1YKA A;  1WMJ A;  3HJP A;  5ECL B;  4MLY A;  5IMZ A;  3CRU A;  10GS A;  2AHE A;  3TGZ A;  2C80 A;  4L0U A;  4BVY A;  2FGX A;  2N5B A;  4AJ7 A;  2GS3 A;  4TKY A;  3Q74 A;  1FVK A;  1ML6 A;  2LNT A;  2CV4 A;  1FW1 A;  1T4Z A;  1GSU A;  5C00 A;  2ON7 A;  2VD1 A;  5GSS A;  2DJ0 A;  4MJB A;  3MAK A;  2DJ1 A;  1KNG A;  2EIO A;  3GUR A;  5HR0 A;  4RUV A;  4ZXG A;  14GS A;  5COH A;  2AYT A;  3IA1 A;  1SL0 B;  4AGS A;  2B7K A;  4POK A;  3QPM A;  1AXD A;  1XW5 A;  1VF2 A;  4KAE A;  3ED3 A;  1DUG A;  1ZYN A;  3DVW A;  3I43 A;  3L9S A;  2I4A A;  1Y6E A;  5IMF A;  3F9U A;  1ST9 A;  3HDC A;  2XPE A;  4WR5 A;  1Y1U A;  3LXT A;  2A2S A;  2NVL A;  4E68 A;  2YCD A;  1T1V A;  1QGV A;  3DRN A;  4DSS A;  3LGC A;  4YQV A;  4AJ8 A;  2VL3 A;  2H70 A;  4BPY A;  1XVQ A;  1A23 A;  3Q6O A;  4TXV A;  4IQA A;  2H8L A;  2ZNM A;  1GSQ A;  4YKG A;  2JZR A;  5KOW A;  5A34 A;  4ECI A;  2LS5 A;  5HR2 A;  2WUL A;  3TUE A;  3ERG A;  3EMP A;  3TRQ A;  3BOA A;  3O76 A;  1HNB A;  4PXO A;  2RM5 A;  4BVX A;  9GSS A;  5DAK B;  3PIN A;  5FT3 A;  4OCE A;  2C3Q A;  4EL1 A;  1NM3 A;  4FH8 A;  2CQ9 A;  5IOX A;  3KEB A;  3ZRD A;  5INY A;  2AAW A;  1GLQ A;  5KN2 A;  4WBJ A;  2R5G A;  4ECC A;  3GKN A;  5JWO B;  2TIR A;  2XHF A;  1QUW A;  3F8U A;  2C8U A;  1M9A A;  5ID2 A;  2B5Y A;  5J40 A;  4N10 A;  3M8N A;  3J7Y k;  2CVB A;  1A0R P;  5DQY A;  4ZBA A;  1ZCP A;  1GTA A;  2GLR A;  5KEJ A;  4X43 A;  2GZY A;  4LL4 B;  4F82 A;  3KIJ A;  3FZ9 A;  4K0N A;  4MA9 A;  4Q5N A;  4USS A;  4ZBD A;  2GQK A;  4GF0 A;  2XC2 A;  3H8Q A;  1LU4 A;  1QMV A;  4O5Q A;  5GST A;  3M0F A;  2WZ9 A;  4Q5R A;  4IQ1 A;  1V57 A;  2IN3 A;  2A2R A;  3UBK A;  3VWW A;  4NHW A;  3TOT A;  2OE1 A;  4HU7 A;  2HZE B;  4YKF A;  3F0I A;  3KTB A;  3EE2 A;  4GRF A;  3ZYW A;  3US3 A;  5CRD A;  2JU5 A;  1S3C A;  2FUG 2;  1BG5 A;  2IPA A;  4BWQ A;  4MZC A;  2CA8 A;  1EV4 A;  2XBQ A;  3TDG A;  4NV2 A;  2H1L A;  4D73 A;  1DBY A;  2HRK A;  1U3I A;  2ON5 A;  1GSD A;  3VK9 A;  1M99 A;  5A34 B;  3L9V A;  2HRN A;  3QAW A;  2A4V A;  1AAZ A;  2B5X A;  1XW9 A;  4QL9 A;  1OC8 A;  4HUA A;  5GAN D;  2C1Y A;  4K9Z A;  1BG1 A;  3CSJ A;  2MMN A;  1YF0 A;  4I2T A;  4ZB7 A;  1AIU A;  4ACS A;  1GH2 A;  2AV4 A;  2K6V A;  2FY6 A;  3A2X A;  3DML A;  4HQS A;  1A2J A;  4EC0 A;  2MMO A;  5KOX A;  1DE2 A;  1XZO A;  3ZZX A;  2FD3 A;  4K2D A;  2VO4 A;  5J4V A;  2E0Q A;  2K9F A;  4F2I A;  2CVD A;  2PGT A;  4YAV A;  2F8F A;  2IJY A;  1F9M A;  4DSQ A;  1G6Y A;  3UVH A;  2LST A;  3TKP A;  2FA4 A;  4ZB8 A;  4KE3 A;  2AB6 A;  1IYI A;  4HOJ A;  1TI1 A;  5GZZ B;  1VF4 A;  1GNW A;  5J4U A;  1PMT A;  2I9H A;  2WS2 A;  3TKR A;  2A2P A;  2OE3 A;  3ZL5 A;  3LSZ A;  4JED A;  4KCE A;  4ID0 A;  1MDI A;  2BTO T;  1T00 A;  5E4W A;  5D8I A;  1F3A A;  4POM A;  5IPG A;  3Q18 A;  1TKD B;  1A24 A;  1GNE A;  5ELG A;  1GLP A;  1W4V A;  4G0K A;  3R2Q A;  5AIS A;  4IKH A;  1K3Y A;  1NSW A;  3CRT A;  2V32 A;  3ZLP A;  1SKR B;  5ECP B;  1HD2 A;  4KGI A;  4ZIJ A;  3F6D A;  1O7U A;  3UJ1 A;  3HJO A;  2IMD A;  1JHB A;  3L78 A;  4JE1 A;  2H71 A;  3P7X A;  3ME7 A;  1Z6M A;  4K5S A;  2HSH A;  5ABR A;  1I9D A;  3UIW A;  2R3X A;  4NV5 A;  1XCC A;  1HNC A;  2PER A;  3SBC A;  1UN2 A;  1ZYE A;  4ZB6 A;  1TRS A;  5B6M A;  4TN8 A;  3IBH A;  3C71 A;  3CTG A;  4K2X A;  3VWX A;  2K18 A;  13GS A;  1ZYP A;  3DGQ A;  5IO2 A;  4KA0 A;  3H79 A;  4I5Q A;  4XS4 B;  2RII A;  1YEP A;  5CNW A;  1B9X C;  3TB2 A;  2IME A;  3EC3 A;  3QAV A;  2IWT A;  4OFN A;  3KD0 A;  4ICY A;  2CT6 A;  3E0U A;  3C1S A;  3P90 A;  2YN1 A;  3LWA A;  3HHV A;  1XIY A;  4POB A;  5G1K A;  2G0F A;  3P8W A;  2V6O A;  3FR3 A;  2CX4 A;  1K0O A;  1J0F A;  4FQU A;  3GKM A;  4V1A g;  1QK8 A;  3MYD A;  1THO A;  1RQM A;  5EL8 A;  3GIX A;  3LJR A;  1XFL A;  4MMM A;  4MP4 A;  1N25 A;  4J56 E;  2EFC A;  1TXU A;  3VPT A;  3FY7 A;  3SWL A;  4OWY A;  3QDN A;  4MZW A;  1KBN A;  1BED A;  4Z7X A;  3MWH A;  2BJX A;  1YVL A;  2DBC A;  4NAX A;  4TR3 A;  4E8H A;  1SD8 A;  5A4V A;  3VI5 A;  1Y25 A;  2NBS A;  1R5P A;  2L5O A;  1FOV A;  2UV8 G;  4NWY A;  4XIH A;  2LUS A;  2X8G A;  3V1W A;  5L71 A;  2L57 A;  2RUF A;  4PUR A;  4GSN A;  4JRR A;  1V58 A;  2LRT A;  3IAS 2;  3U5R E;  4EF0 A;  2VKZ G;  2VL9 A;  1TRU A;  1T8E B;  1TU7 A;  4WF5 A;  4F03 A;  1KEB A;  3PR8 A;  3HVS A;  3ZML A;  1VGL A;  3HMJ G;  2GDR A;  1XWC A;  1K0M A;  2H1D A;  1Z3E A;  4I6X A;  4TXO B;  3KH9 A;  2YWM A;  1Z7R A;  5LCZ A;  3KP8 A;  2J9H A;  2DIY A;  2VD0 A;  3UAP A;  2FCH A;  3GV1 A;  1OE8 A;  2N5A A;  5KN3 A;  4EUY A;  4IGJ A;  1YQ1 A;  4MZB A;  2DKI A;  1TDI A;  2P0G A;  2YZH A;  1ZMA A;  1YJ6 A;  5E59 A;  1TRW A;  3GMF A;  4G9H A;  2VLV A;  2FWG A;  1Z5Y E;  3KMN A;  2J23 A;  3TJK A;  1OAZ A;  2GST A;  4LL1 B;  2B1L A;  3VPQ A;  5ECR B;  4IW9 A;  5D9V A;  4NXI A;  5G30 A;  5J47 A;  5AIX A;  2KOK A;  2ZUP A;  2JL4 A;  1UC7 A;  2EIR A;  5D96 A;  4MDC A;  4AKX B;  1X5E A;  1PSQ A;  1JZO A;  3EMX A;  2VLU A;  2HSN B;  2FWE A;  2CZ3 A;  4KUN A;  2E2G A;  1R4W A;  1XBS A;  1G7E A;  1V2A A;  1YY7 A;  2X8H A;  1GP1 A;  1T7P B;  1GTI A;  4V2M A;  4NMU A;  5HR1 A;  1F3B A;  3E3E A;  4OCF A;  1SK1 A;  1J08 A;  2REM A;  1EZK A;  4L8E A;  1VRS D;  4KDX A;  3N5O A;  1TK0 B;  1X9M B;  2I81 A;  3G7Y A;  3RPP A;  8GSS A;  2F8A A;  1LJR A;  2VL2 A;  1FO5 A;  2C0F A;  1ABA A;  1WPI A;  4KW6 A;  4JR4 A;  2VCW A;  5EVO A;  3A5W A;  3QFB C;  4X0X A;  3C1R A;  1U88 A;  5A5H B;  4POL A;  2PU9 C;  4MJC A;  1PL1 A;  2H73 A;  3A5I A;  5G31 A;  3TU3 B;  3IPZ A;  3GRX A;  1ZL9 A;  3L0H A;  2H1G A;  4N0Z A;  2GTU A;  1EEM A;  2H1A A;  4HDE A;  5DBQ A;  2IMK A;  2HZE A;  3D4M A;  6GSX A;  2YWI A;  3HXS A;  4WET A;  2R6K A;  4FYC A;  5CRE A;  1CQH A;  1SJZ A;  5HR3 A;  6GST A;  5IM9 A;  4XRD A;  4K7N A;  1EOG A;  3W6G A;  3DKS A;  3QD9 A;  4O7H A;  1O8W A;  5ELA A;  4RI7 A;  1ZZY A;  3IDV A;  1PX7 A;  3QAG A;  4CW9 A;  2PVQ A;  4KH7 A;  1SKW B;  2MMZ A;  2HRF A;  1WOU A;  4IP6 A;  4GSS A;  3BCK A;  4GWR A;  5DCG A;  1TU8 A;  2DKH A;  3VUR A;  2P5Q A;  3DXB A;  4ZL8 A;  2LKU A;  2VOC A;  1JLW A;  1V40 A;  5CP1 A;  3PGT A;  3I69 A;  3LW9 A;  19GS A;  4XS6 A;  3IE3 A;  1RK4 A;  4V2N A;  2OAD A;  5B7C A;  5J4Y A;  1TXX A;  1Q4J A;  4WXT A;  1R7H A;  1K3L A;  2O89 A;  1E6B A;  3TJB A;  3KTL A;  2QSI A;  2RUE A;  2V41 A;  4Z2R A;  4QMK A;  2C3T A;  3G7J A;  2RLI A;  1F2E A;  1A2L A;  1NHY A;  3ME8 A;  3FYG A;  4ZL7 A;  3H1N A;  5ECS A;  1T3B A;  16GS A;  1PRX A;  4G0L A;  3WT2 A;  4K1F A;  4WR4 A;  2HZF A;  3D22 A;  1V9W A;  3GFK A;  2DIZ A;  2EIQ A;  1WIK A;  4P3Y B;  3FZ5 A;  3M9K A;  1AW9 A;  3MIX A;  3ZIV A;  3ZRE A;  1PKW A;  1FOH A;  2HQT A;  3BD2 A;  1SD9 A;  1G6W A;  2NTO A;  5HQP A;  5LNK e;  2MBS A;  4Q5F A;  3FHK A;  3IAM 2;  5J41 A;  1TRV A;  3IOS A;  4PNG A;  2L4Q A;  3APS A;  1GL8 A;  2EFH A;  4X1U A;  3VWV A;  2YWO A;  4HI7 A;  4HJM A;  2PVO C;  1AC1 A;  4MH2 A;  2R0C A;  3FRC A;  1PKZ A;  3DWV A;  2YWN A;  2GSS A;  4KX4 A;  2B7J A;  1KTE A;  5J9B A;  3F3R A;  2G2Q A;  2YAN A;  4KB3 A;  1MTC A;  5FHI A;  1GTU A;  2GGT A;  1XOA A;  5IIZ A;  4V1A p;  2QGV A;  2I3Y A;  4K5R A;  4IS0 A;  4DSR A;  5G5E A;  1X0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...