4EDYA

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoietic prostaglandin D synthase
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4edyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4edyA01
5CRWA 2I1UA 4ID0A 1Y25A 5LNKe 4GQFA 12GSA 1Q4JA 2R4VA 1OYJA 5F06A 1PRXA 4KAEA 1VRSD 5FT3A 2I3YA 4WEYA 1X5DA 3MDKA 5KN1A 4EUYA 1EOGA 3WT2A 5A5KA 2JZSA 2OE0A 4CW9A 4NV2A 1XOBA 2VM1A 3ZIJA 5ECQB 3BJ5A 4AF2A 5CRGA 1X9MB 2RUEA 1TW9A 4FQUA 3ZITA 2Z9SA 1NHOA 3RHBA 3QAVA 2MMAA 1BEDA 3UJ1A 3L4NA 2F51A 2AJQB 3KEBA 3LORA 2ON7A 1B4QA 2GS3A 2HRFA 1PMTA 3PINA 5HR0A 3D21A 3L9VA 2L4QA 2YJ7A 2AUVA 3GURA 1FVKA 4MP4A 3DXBA 1N8JA 3BD2A 1GSQA 5D73A 3IBHA 2JADA 2H1AA 1VF2A 4JBBA 5G2ZA 1F6MC 1GLPA 4BVXB 3H4KA 2PN8A 4F0CA 4ZB9A 2CA8A 2MMOA 1XOAA 1M2DA 4N30A 2L4CA 1X9WB 3RAZA 1SD8A 2C0GA 1WE0A 4MDCA 2GGTA 4HUAA 4ZL7A 1UVZA 4MF7A 4OCEA 3HY2A 3NOFA 1PSQA 20GSA 5HFKA 2LRTA 3F9UA 1GUKA 1PKZA 4TW5A 5KN0A 5G1LA 2A2SA 2V6OA 3IRAA 2CAIA 2R2JA 3S9FA 2YWNA 4IS0A 4JEDA 5ID2A 4XS1A 3IOSA 3ED3A 16GSA 2WGRA 1PX7A 2GQKA 2H74A 1EGOA 3CSJA 4AJ6A 3FK8A 3GTUB 2HSMB 1ERUA 3FR9A 1AQVA 1ON4A 2HQTA 1NHYA 4BVYA 1TRWA 1K0MA 3MSZA 1Z6MA 2REMA 4PQ1A 5EPFA 1TK0B 1WIKA 2VL3A 2WB9A 2B1LA 1W89A 4L5LA 3UARA 2LQOA 4N0VA 3TCOA 2YANA 1WOUA 4Q5RA 3A2XA 2DJ3A 2QSIA 2VAFA 3K8NA 1GUMA 1T7PB 3L9UA 5ECNB 5G30A 1K0AA 4I5QA 4TXVA 4F0BA 3GL3A 1TJDA 3FEUA 1LJRA 3WGXA 2H8LA 1M0UA 2OE1A 4KH7A 3IR4A 1V2AA 3ZFBA 5C04A 3TDGA 5ELAA 1ZZYA 2XPEA 2RM5A 4WF5A 4HZ4A 4MH3A 1ERTA 5F0GA 4POMA 5CREA 4G2EA 1K3LA 4DSRA 5GZZB 4AGSA 2H73A 4MZWA 1FG4A 3GL5A 2IJYA 3RHCA 2P0GA 1G7EA 4YH2A 2PMTA 1O7UA 2HE3A 2HRKB 5J41A 3UMAA 5B8BA 22GSA 3NIVA 5A4WA 3O76A 1S3CA 1XVQA 3U6VA 2TRXA 1B8XA 2MBSA 4AJ7A 4WBRD 2X64A 2ALBA 2BMXA 4D73A 3TOUA 2PBJA 1ZGNA 2H70A 2GVPA 1O81A 2MMNA 3WD6A 1V9WA 5B7CA 4KCAA 3QFBC 1NM3A 2XHFA 4FH8A 4EL1A 1M7TA 1SD9A 2H1GA 3HVXA 4PX1A 2GZYA 1O6JA 2J9HA 3KCMA 1ST9A 5JWQB 1M2BA 3SWLA 2FWHA 4K9ZA 2LSTA 3QD9A 3HKRA 4LL1B 1F3AA 4RUVA 3QMXA 4ECIA 4FYCA 2VLTA 1ZOFA 3EMPA 3KH9A 1AC1A 1A0FA 3M3MA 1PA3A 1TRSA 1GULA 1K0NA 4E8EA 2H66A 3ME8A 4KF9A 1YF0A 2X8CA 3IK7A 4MJCA 1R26A 1OC9A 3FZAA 5F8BA 3VK9A 1VF1A 4GSSA 6GSSA 3F4TA 1GSSA 3QR6A 3NZNA 3VI7A 4ECCA 1FB0A 1PX6A 2TIRA 3RDWA 1K0DA 1TI3A 3GSSA 3I9V2 4EE0A 2H0GA 3KH7A 5ABRA 1TU8A 1EWXA 5DVBA 4HQSA 1QXHA 2HZFA 1SENA 2H75A 4V2MA 4MH2A 2VM2A 1G6WA 2OBKA 4OWYA 3APSA 2CV4A 5ID2B 2X8HA 5DQSA 3KTBA 2TRCP 4ISDA 5ENUA 3F3QA 1A8LA 4CDOA 2E2MA 5BMUA 1SKRB 3DRNA 1WRYA 3E3EA 1ERVA 4Q5NA 3TJKA 4BVYB 4XCSA 5G31A 5HFIA 1FO5A 2DMMA 1MDIA 3HYPA 1A2LA 1XVWA 3HDCA 2YV7A 2VLVA 3LWAA 6GSWA 4JU5A 3ZREA 3EC3A 4IJ3A 4POBA 4LMVA 2IPAA 4BWQA 2K8SA 3QDNA 1THOA 3EU4A 3P7XA 1Z9HA 3M1GA 3IAS2 2M80A 1WWJA 2PUKC 1JLWA 1GP1A 2L5LA 5ELGA 3UEMA 2WZ9A 2FWEA 4GXZA 4ZL9A 3VWVA 2HT9A 1BX9A 2E2GA 2C3QA 1U88A 4XHMA 3DYRA 3AY8A 4KDUA 2AV4A 2VCQA 1I9DA 1K0CA 4NAXA 3UBKA 3U5RE 1O73A 2GSQA 3HXSA 3C8EA 1AQWA 1GTBA 3ZMLA 1F2EA 3TUEA 1THXA 2YV9A 3M8NA 4KDXA 1WMJA 3D22A 2IL3A 1GSUA 2EC4A 2YPMA 2GT6A 5D8IA 2B7JA 3QOUA 2JZTA 5HQPA 2A2RA 5IMCA 1QK8A 3M9JA 5ECPB 4GF0A 2C4JA 4WF4A 4D73B 1BJXA 1UC7A 2V2GA 4OO5A 3ZRDA 2GSRA 10GSA 1CQGA 3QAWA 3DGQA 5IMAA 1GNEA 1G6YA 4HEA2 5F07A 4ACSA 1AXDA 2GQMA 1OC3A 2RLIA 3LGCA 8GSSA 4V1Ag 4WKWA 3TKRA 1YJ6A 2H1DA 4FO5A 2OJLA 2V6KA 2L59A 4OD7A 4L8EA 1K0OA 1DSBA 1TOFA 4PUFC 1YY7A 5D9TA 5COHA 1U6TA 5J5NA 1TU7A 4PTSA 2EIRA 1YZXA 1X5CA 6GSYA 3L78A 2FA4A 4RQXA 5CYYA 4TKYA 3HZ8A 1U87A 3IA1A 2O8VB 4I2UA 2O87A 4DSSB 1ZYQB 3W8SA 2GDRA 3ERGA 7GSSA 2PU9C 2WFCA 2AYTA 3LFLA 4KA0A 5H5SA 3GMFA 4EXJA 5C00A 4PQHA 2IMFA 5GSTA 2I81A 1QQ2A 1TKDB 1T4ZA 4OCFA 4JZQA 1OC9B 3VWWA 1G0TA 3PH9A 4MJBA 4OFMA 1F9MA 5KN2A 1T8EB 5JCUA 1YDKA 2QGVA 4OO4A 3FY7A 3UL3A 1SL1B 3A2VA 3P8WA 4KX4A 4O32A 3ZLPA 1XIYA 4ECJA 3IC8A 3APOA 3H1NA 5ECHB 1G7OA 2XBQA 4TR0A 5IMZA 1GLQA 2P31A 2HLSA 18GSA 4EKZA 1USBA 2C1YA 3CTFA 3FHKA 1EZKA 3IHQA 4PURA 2WCIA 3DVWA 2DMLA 3FZ4A 2FHEA 2JU5A 3GH9A 4XS4A 3VWXA 2FCHA 3P2AA 1R4WA 3LXTA 1URMA 2DJKA 2H0HA 5E59A 2IMKA 5DCHA 1XW5A 2NPBA 4MJAA 2LQQA 4ML1A 1F3BA 4HQZA 2M72A 3RPPA 3VPQA 1OKDA 3L9SA 1R7HA 1AUCA 1XWKA 5F05A 3ISOA 1O8XA 6GSXA 3ZFLA 2FWFA 4O92A 3DWVA 3UOMA 1EP7A 4DVCA 4TVEA 4IW9A 4ZXGA 3KMNA 2DSAA 1A0RP 4TOPA 2V32A 2D2ZA 2VL2C 1C72A 4NV5A 2HSYA 4K2DA 3IK9A 4X43A 4MZCA 2G0FA 2F9SA 1PGTA 1JFUA 2AHEA 1TK8B 3GUSA 1WJKA 1U3AA 2VIMA 3C7MA 2QKEA 3GKKA 4PXOA 1GSYA 2XPDA 1GH2A 4KSOA 1GSFA 5D96A 3WGDA 3E0UA 1GTIA 3GKNA 2MYGA 1T3BA 3KMOA 1J9BA 2JSZA 1A8YA 4RI7A 3QFAC 1HQOA 5H5QA 1BG5A 4K6XA 3W6GA 4MJEA 1XWGA 2P5QA 4L0UA 5A4UA 1FVJA 4EO3A 4EVMA 1XWAA 3DEXA 2VD1A 3GFKA 1YQ1A 4IJIA 5D9XA 4MZBA 3LQ7A 5IO0A 5INYA 1VF4A 3GX0A 3FZ5A 3CBUA 3IDVA 2IFQA 5GAND 4MPFA 1SKSB 5EL8A 2LKUA 4XRAA 4MLYA 1LU4A 4IHUA 1VGLA 1J08A 1BYEA 3GIXA 5IOXA 5GSSA 1GTUA 9GSSA 1XPVA 4DEJA 2H6YA 1XW6A 3I6AA 5JCGA 1FB6A 4Z7XA 2B5YA 4K1FA 5FHIA 3DVXA 4TRXA 4KE3A 4IQ1A 2H76A 3ERWA 3EWLA 4NHWA 4J2FA 1A23A 3PPUA 1PN9A 1PQNA 1BAYA 1GSDA 3FRCA 4G0LA 3EVIA 4LLRA 3GV1A 3Q74A 2WJUA 1K3OA 1WP0A 5D9WA 1E2YA 1Z7PA 1DBYA 2FGXA 1WPIA 3WT1A 4BPYA 1HD2A 1GNWA 2G2QA 4X1UA 1HNBA 1XFLA 2LJRA 1UA5A 4GCIA 5IMDA 3BCKA 5AIXA 1TI1A 5AN1A 2I9HA 4YAVA 2LJKA 4YAPA 1FHEA 5JCWA 1HYUA 3QPMA 1V98A 2LEGA 4BWSA 2LNTA 2C80A 1B9XC 1OE7A 1XXUA 4HS1A 3UVHA 2JSYA 1XWCA 3CRUA 3UAPA 4XIHA 1GUHA 5D93A 3GNJA 4NMUA 19GSA 2VCTA 1NSWA 4O7HA 4DSQA 2ZUPA 3ERFA 4Q5FA 3IXRA 5DQYA 1V57A 3FW2A 2CVKA 3APQA 3GA4A 2OACA 3EINA 3ME7A 1MD3A 2PGTA 3EU3A 3KD0A 4XS4B 4HDEA 2HNLA 2FD3A 3DIEA 3EURA 3G7YA 4K7OA 3US3A 2O89A 2ZCTA 2LV3A 5JWRB 2WDUA 2CQ9A 4N0ZA 3GH6A 1PL1A 2KP1A 2HSNB 2IIYA 1N2AA 3BOAA 3GKMA 3L0HA 2OE3A 3F6DA 1U3IA 4BVXA 4ZB8A 1SJIA 2FA8A 2PVOC 3FKFA 1W4VA 5AISA 3IPZA 2H6ZA 2PWJA 4KNDA 1R5AA 4F03A 1EEJA 2HI7A 4MPGA 2M46A 4YQUA 2AB6A 2ON5A 2VLUA 3ZYWA 2C8UA 2FWGA 1RK4A 1QMVA 3O6TA 5A4VA 3TKQA 5ECSA 3CSHA 2ES7A 3KP8A 1M2AA 3VLNA 2GZZA 5B8AA 1KEBA 3UIWA 5HR3A 3KP9A 2JL4A 3LG6A 2OADA 1EV9A 1TRVA 5J9BA 4GQCA 2LUSA 3C1SA 4QQ7A 1QUWA 1X5EA 3MAKA 4ECBA 3WGEA 4K7IA 3LXZA 1S3AA 3BCIA 2VOCA 4ML6A 5ECLB 2CT6A 2KP2A 2CX4A 4F9ZA 2LRCA 2C3NA 1DE1A 4CHSA 2IFQB 3TGZA 4ZBBA 1EOHA 3RBTA 2JZRA 1OVNA 3TRQA 2GTUA 3KXOA 2YNXA 3UBLA 2NBSA 2HRNA 4JR4A 5DBQA 1CQHA 4LMWA 1SYRA 2CAQA 2YOIA 3LYPA 1PKWA 4EDZA 2LJAA 2VCZA 3ZVJD 4G19A 4PUAA 5DAKA 2B7KA 1XWBA 3R2QA 2B3SA 3LSZA 4MF5A 4KDYA 2PPTA 3A5WA 1A2MA 1H75A 2C0FA 1F37A 2A4VA 1ERWA 1Z7RA 3R3EA 1SJZA 4AJ8A 3G7IA 4TN8A 1ZMAA 4NWYA 2YJHA 3I43A 2X99A 2N5FA 2E7PA 4ZIJA 6GSVA 4I6XA 2ZNMA 3HJOA 4ZL8A 4FYBA 1V40A 2IWTA 4I97A 2QC7A 4V2LA 4WR5A 1ZL9A 2L57A 2HRKA 5CO3A 4G10A 4ZB6A 1JHBA 4GRFA 4FYUA 2RIIA 3IV4A 3GN3A 4IP1A 1YEXA 2YZHA 3M9KA 3TOTA 4POKA 1JLVA 2F3MA 2VCXA 2L6DA 5KN3A 1EGRA 4MMMA 2OA7A 2WS2A 1QFNA 2F8AA 4GSTA 3CMIA 4MABA 4IKHA 3MWHA 4BL7A 2XC2A 1H4OA 4G9HA 1SK0A 2CZ2A 4JE1A 1MTCA 2GSTA 2LS5A 1TDIA 5DALA 5ECRB 3PR8A 3D6IA 4POLA 2PERA 3KM6A 3IAM2 3TRPA 4N11A 3HZ4A 5J4UA 3M0FA 2F8FA 1SJ6A 5E4WA 1SKWB 2B5EA 3QAGA 2K18A 5DJMA 4L5OA 2FY6A 2O85A 4KB3A 2FUG2 2LRNA 3F4SA 1PD21 1LBKA 3J7Yk 4QL7A 3RPNA 1BQ7A 3TKPA 2EIOA 3CRTA 3F8UA 3Q18A 4PGTA 1O85A 3KIJA 1GL8A 3LEFA 2GLRA 4WR4A 4TR3A 4I8BA 4JR6A 2V1MA 3GHAA 2DIYA 1EEMA 1V58A 3VPTA 1OAZA 2YN1A 2O7KA 4LA1A 4MA9A 2N5BA 3BBYA 4MF6A 2H01A 5KEJA 5DCGA 3OR5A 4GWRA 2I4AA 1SK2A 2MZCA 4XRDA 3ZIVA 2C3TA 1S3DA 1I5GA 5IOWA 4HU9A 4O5RA 2V41A 4TXOA 3D4MA 5AIVA 4KGIA 3ZVJA 2VL9A 3W8JA 1RQMA 2NDOA 2K8VA 3GKXA 1SL0B 2DJJA 4V1Ap 4QL9A 2XBIA 4PNFA 1VF3A 1SU9A 1X0RA 3DD3A 2OBIA 4WXTA 3ZMKA 1JZDA 3UVTA 3HJMA 4GLTA 3F6FA 3TJFA 3CXGA 1M99A 5IPHA 4V2NA 3GYKA 2H19A 4K7NA 4N10A 2FNOA 5EVOA 5J9CA 4KSMA 2BTOT 1GSEA 2K9FA 4TR4A 2RM6A 2DJ1A 4P3YB 3A2WA 4ULXA 2R3XA 2H1BA 2GQLA 3J7Yb 4XS6A 5G5EA 3LYKA 1YEPA 1ILOA 4HJ2A 3ZZXA 4KCEA 5G1KA 1Q98A 1X9SB 1SYXA 1TRUA 5CP1A 1TP9A 1DUGA 2KOKA 3O3TA 2R5GA 2WULA 1MDJA 2PVQA 3HVSA 4NXIA 2GSSA 4G0IA 4K8MA 2H30A 3KTLA 4ZBDA 2AAWA 2MMZA 5DAKB 4X0XA 1AIUA 3DMLA 1A24A 1EV4A 2N5AA 3CTGA 2LTKA 3TKSC 1KTEA 3VWUA 1GWCA 2HZEA 1TXXA 3LJRA 3EE2A 3GSTA 5H5RA 3FR3A 4J56E 2OKAA 2H72A 2B1KA 5DDLA 3EMXA 2BJXA 4HU7A 3VI5A 3D5JA 2VCWA 2CVDA 2CZ3A 5DJLA 2J23A 2R37A 2RUFA 5EY6A 3N5OA 5CRHA 4BA7A 2H6XA 4Q5QA 1Z3EA 3ZL5A 4WBJA 2HRAA 2KHPA 2R6KA 3H79A 1B9YC 3GRXA 3H93A 3JCML 1ZCPA 4TR1A 4NHZA 4BL7B 1QGVA 1YKCA 1A2JA 5DALB 4K0NA 3MNGA 2B6MA 1YKAA 2K6VA 4EC0A 3HCZA 3C73A 4EDYA 2YWMA 1FOVA 3VFIA 1OE8A 1JZWA 3Q19A 3D0ZA 2JACA 4MCUA 3G7JA 3HVVA 3I69A 4HJMA 1TTZA 4JRRA 5LCZA 14GSA 3TJBA 4IP6A 4PNGA 4OFTA 3HHVA 4OFNA 5IMVA 1GRXA 5ECOB 2DLXA 4J57E 1M9BA 5IMFA 2WRTA 2KUCA 1FAAA 2C0DA 5IPGA 2DJ2A 3H8QA 3TJJA 5J3RA 1T00A 2IMEA 3CYNA 5LD0A 2LNSA 4NPBA 1XCCA 4DSSA 5HR2A 1MDKA 5D9VA 1HNCA 4KUNA 4IN0A 1ML6A 2E0QA 3TRXA 2B5XA 1SL2B 4WETA 1AQXA 3P90A 1T4YA 1AAZA 1K3YA 2L6CA 2NVLA 2NTOA 4USSA 2YWIA 1XBSA 4EF0A 4TXOB 3SBCA 2DIZA 2IMDA 5HR1A 2P5RA 2VD0A 1NW2A 4IQAA 3PGTA 4E8HA 1Z5YE 5GAPD 1RW1A 2VUPA 5B6MA 3WYWA 2HFDA 2YCDA 1FW1A 3IE3A 4KW6A 5L71A 6GSUA 5ECIB 1ACVA 3F4RA 4RI6A 3D4TA 3TB2A 3TJGA 2H71A 3HD5A 6GSTA 4IGJA 3C71A 1B4PA 5G5FA 1EP8A 2FLSA 3Q6OA 1ZYEA 2VO4A 4OMVA 2VCVA 3VURA 1XZOA 5IO2A 3QCPA 5CNWA 4IBPA 1KNGA 2KLXA 4XTSA 1TK5B 4YQVA 4ZILA 5FWGA 2X8GA 2CVBA 3HJPA 1E6BA 2C0EA 3GTUA 3G9BA 2HSMA 4PQIA 3F3RA 4LL4B 5ECMB 4YQMA 3ZTLA 4ZBAA 4F82A 5IM9A 3GX8A 1IYHA 1HNAA 1IYIA 2GT5A 5IIZA 1M9AA 1JZRA 4GTUA 4I2TA 1JZOA 2HYXA 1YF1A 5ECKB 4RQRA 4FIWA 3F0IA 2UZ8A 3KJYA 4MK3A 2VL2A 13GSA 3E9JB 1B48A 3TKSE 4GSNA 1SK1A 5HFGA 4HOJA 2HZEB 2HSHA 2DC5A 4IELA 2CX3A 2HXKA 4L0WA 1Z6NA 17GSA 1AW9A 3V1WA 3HA9A 1O8WA 4H86A 1DE2A 5AGYA 3DKSA 1J0FA 3A3TA 1MD4A 5B6NA 1T1VA 1UN2A 1OC8A 4G0KA 3KGKA 3FZ9A 3FYGA 4HI7A 3CSIA 3N9JA 3F63A 2DJ0A 1KBNA 4F2IA 1Y6EA 5CAXA 3C1RA 2IN3A 2YWOA 2EIQA 3KZQA 11GSA 1R5PA 5CRDA 2YZUA 2YP6A 4HZ2A 1GTAA 3FR6A 2DBCA 2IMIA 3EYTA 1MEKA 2H0IA 1PL2A 2L5OA 2MBTA 3IC4A 2GZPA 1OKTA 4TR1B 4IVFA 1XW9A 3TKSA 5JWOB 4K0GA 1ABAA 5IQYA 1K0BA 4ILFA
chains in the Genus database with same CATH superfamily
5CRWA 2I1UA 4ID0A 1Y25A 5LNKe 1PN0A 4GQFA 12GSA 1Q4JA 2R4VA 1OYJA 5KOWA 5F06A 1PRXA 4KAEA 1VRSD 5FT3A 2I3YA 4WEYA 1X5DA 3MDKA 5KN1A 4EUYA 4CY6A 1EOGA 1XG8A 3WT2A 5A5KA 2JZSA 2OE0A 4EIPA 4CW9A 2WW1A 4NV2A 1XOBA 2VM1A 3ZIJA 5ECQB 3BJ5A 4AF2A 5CRGA 1S3RA 1X9MB 2RUEA 1TW9A 4FQUA 3ZITA 2Z9SA 1NHOA 3RHBA 3QAVA 2MMAA 1BEDA 3UJ1A 3L4NA 5KOXA 4Z2TA 2F51A 2AJQB 3KEBA 3LORA 2ON7A 1B4QA 2GS3A 2HRFA 3CHXC 1PMTA 3PINA 5HR0A 3MYDA 3D21A 3L9VA 2L4QA 2YJ7A 2AUVA 1I1IP 3GURA 3CWGA 1FVKA 4MP4A 4K5SA 3DXBA 1N8JA 2A4HA 3BD2A 1GSQA 5D73A 3IBHA 2JADA 2H1AA 1VF2A 4JBBA 5G2ZA 1F6MC 1GLPA 4E68A 4BVXB 3H4KA 2PN8A 4F0CA 4ZB9A 2CA8A 2MMOA 1XOAA 1M2DA 4N30A 2L4CA 1X9WB 3RAZA 1SD8A 2C0GA 1WE0A 4MDCA 2GGTA 4HUAA 5A5HA 4ZL7A 1UVZA 4MF7A 4OCEA 3HY2A 3NOFA 1PSQA 20GSA 5HFKA 2LRTA 3F9UA 1GUKA 1PKZA 4TW5A 5KN0A 5G1LA 2A2SA 2V6OA 3IRAA 2CAIA 2R2JA 3S9FA 2YWNA 4IS0A 4JEDA 2R0PA 5ID2A 4XS1A 3IOSA 3ED3A 16GSA 2WGRA 1PX7A 2GQKA 2H74A 1EGOA 3CSJA 4AJ6A 3FK8A 3GTUB 2HSMB 1ERUA 3FR9A 1AQVA 1ON4A 2HQTA 1NHYA 4BVYA 1TRWA 5A1NB 1K0MA 3MSZA 1Z6MA 2REMA 4PQ1A 5EPFA 1TK0B 1WIKA 2VL3A 2WB9A 2B1LA 4QMKA 1W89A 4L5LA 3UARA 2LQOA 4N0VA 3TCOA 2YANA 1WOUA 4Q5RA 3A2XA 2DJ3A 2QSIA 2VAFA 3K8NA 2DKHA 1GUMA 1T7PB 3L9UA 5ECNB 5G30A 1K0AA 1SVMA 4I5QA 4TXVA 4F0BA 3GL3A 1TJDA 3FEUA 1LJRA 3RGBC 3WGXA 2H8LA 1M0UA 2OE1A 4KH7A 4GDFA 3IR4A 1V2AA 3ZFBA 5C04A 3TDGA 5ELAA 3RFRC 1ZZYA 2XPEA 2RM5A 4WF5A 4AKXB 4HZ4A 4MH3A 1ERTA 5F0GA 4POMA 5CREA 4G2EA 1K3LA 4DSRA 5GZZB 4AGSA 2H73A 4MZWA 1FG4A 3GL5A 2IJYA 2EFCA 3RHCA 2P0GA 1G7EA 4YH2A 2PMTA 1O7UA 2HE3A 2HRKB 5J41A 3UMAA 5B8BA 22GSA 3NIVA 5A4WA 3O76A 1S3CA 1XVQA 3U6VA 2TRXA 1B8XA 2MBSA 4AJ7A 3IHGA 4WBRD 2X64A 2ALBA 2BMXA 4D73A 3TOUA 2PBJA 1ZGNA 2H70A 2GVPA 1O81A 2MMNA 3CQFA 3WD6A 1V9WA 5B7CA 4KCAA 3QFBC 2WW0A 1NM3A 3EPTA 2XHFA 4FH8A 4EL1A 1M7TA 1SD9A 2H1GA 3HVXA 4PX1A 2GZYA 4Z2UA 1O6JA 2J9HA 3KCMA 1ST9A 5JWQB 1M2BA 3SWLA 2FWHA 4K9ZA 2LSTA 3QD9A 4ZB7A 3HKRA 4LL1B 1F3AA 4RUVA 3QMXA 4ECIA 4FYCA 2VLTA 1ZOFA 3EMPA 3KH9A 1AC1A 1A0FA 3M3MA 1PA3A 1TRSA 1GULA 1K0NA 4E8EA 2H66A 3ME8A 4KF9A 1YF0A 2X8CA 3IK7A 4MJCA 1R26A 1OC9A 3FZAA 5F8BA 3VK9A 1VF1A 4GSSA 6GSSA 3F4TA 1GSSA 3QR6A 3NZNA 3VI7A 4ECCA 1FB0A 1PX6A 2TIRA 3RDWA 1K0DA 1TI3A 3GSSA 3I9V2 4EE0A 2H0GA 3KH7A 5ABRA 1TU8A 1EWXA 5DVBA 4HQSA 1QXHA 2HZFA 1SENA 2H75A 4V2MA 4MH2A 2VM2A 1G6WA 2OBKA 4OWYA 3APSA 2CV4A 2O5VA 5ID2B 2X8HA 5DQSA 3KTBA 2TRCP 4ISDA 5ENUA 3F3QA 1A8LA 4CDOA 2E2MA 4AI6A 5BMUA 1SKRB 3DRNA 1WRYA 4YKFA 2EFEA 1ERVA 3E3EA 3HMJG 4Q5NA 3TJKA 4BVYB 4XCSA 5G31A 5HFIA 1FO5A 2DMMA 1MDIA 3HYPA 1A2LA 1XVWA 3HDCA 2YV7A 2VLVA 3LWAA 6GSWA 4JU5A 3ZREA 3EC3A 4IJ3A 4POBA 4LMVA 2IPAA 4BWQA 2K8SA 3QDNA 1THOA 3EU4A 3P7XA 1Z9HA 3M1GA 3IAS2 5J47A 1WWJA 2M80A 4PI0C 2PUKC 1JLWA 1GP1A 2VKZG 2L5LA 5ELGA 3UEMA 2WZ9A 2FWEA 4GXZA 4ZL9A 2O36A 3VWVA 2HT9A 1BX9A 2E2GA 2C3QA 1U88A 4O5UA 4XHMA 3DYRA 3AY8A 4KDUA 2AV4A 2VCQA 1I9DA 1K0CA 4NAXA 3UBKA 3U5RE 1O73A 2GSQA 3HXSA 3C8EA 1AQWA 1GTBA 3ZMLA 1F2EA 3TUEA 1THXA 2YV9A 3M8NA 4KDXA 1N25A 1WMJA 3D22A 2IL3A 1GSUA 2EC4A 2WW2A 2YPMA 2GT6A 5D8IA 2B7JA 3QOUA 2JZTA 5HQPA 2A2RA 5IMCA 1QK8A 3M9JA 2X49A 5ECPB 4GF0A 2C4JA 4WF4A 4D73B 4Z2RA 1BJXA 1Y1UA 1UC7A 2V2GA 1ZYNA 4OO5A 3ZRDA 2GSRA 10GSA 1CQGA 3QAWA 3DGQA 5IMAA 1GNEA 1G6YA 4HEA2 2R0CA 5F07A 4ACSA 1AXDA 2GQMA 1OC3A 2RLIA 3LGCA 8GSSA 4V1Ag 4WKWA 3TKRA 1YJ6A 2H1DA 4FO5A 5BRTA 2OJLA 2V6KA 2L59A 4OD7A 4L8EA 1K0OA 1DSBA 1TOFA 4PUFC 1YY7A 5D9TA 5COHA 1U6TA 5J5NA 1TU7A 4PTSA 4AKGA 2EIRA 1YZXA 1X5CA 6GSYA 3L78A 2FA4A 4RQXA 5CYYA 4TKYA 3HZ8A 1U87A 3IA1A 2O8VB 4I2UA 2O87A 3FMWA 4DSSB 1ZYQB 3W8SA 2GDRA 3ERGA 7GSSA 2PU9C 2WFCA 2AYTA 3LFLA 4KA0A 5H5SA 3GMFA 4EXJA 5C00A 4PQHA 2IMFA 5GSTA 2I81A 3MIXA 1QQ2A 1TKDB 1T4ZA 4OCFA 4JZQA 1OC9B 3VWWA 1G0TA 3PH9A 4MJBA 4OFMA 1F9MA 5KN2A 1T8EB 5JCUA 1YDKA 2QGVA 4OO4A 3FY7A 3UL3A 1SL1B 3A2VA 3P8WA 4KX4A 4O32A 3ZLPA 1XIYA 4ECJA 3IC8A 3APOA 3H1NA 5ECHB 4O5QA 1G7OA 5A34A 2XBQA 4TR0A 5IMZA 1GLQA 2P31A 2HLSA 18GSA 4EKZA 1USBA 2C1YA 3CTFA 3FHKA 1EZKA 3IHQA 4PURA 2WCIA 3DVWA 2DMLA 3FZ4A 2FHEA 2JU5A 3GH9A 4CY8A 4XS4A 5BMUB 3VWXA 2FCHA 3P2AA 1R4WA 3LXTA 1URMA 2DJKA 2H0HA 5E59A 2IMKA 5DCHA 1XW5A 2NPBA 4MJAA 2LQQA 4ML1A 1F3BA 4HQZA 2M72A 2HSNA 3RPPA 3VPQA 1OKDA 3L9SA 1R7HA 1AUCA 1XWKA 5F05A 3ISOA 1O8XA 6GSXA 3ZFLA 2FWFA 4O92A 3DWVA 3UOMA 1EP7A 4DVCA 4TVEA 4IW9A 4ZXGA 3KMNA 2DSAA 1A0RP 4TOPA 2V32A 2D2ZA 2VL2C 1C72A 4NV5A 2HSYA 4K2DA 3IK9A 4X43A 4MZCA 2G0FA 2F9SA 1PGTA 1JFUA 2AHEA 1TK8B 3GUSA 1WJKA 1U3AA 2VIMA 3C7MA 2QKEA 3GKKA 1S4BP 4PXOA 1GSYA 2XPDA 3LW9A 1GH2A 4KSOA 1GSFA 5D96A 3WGDA 3E0UA 1GTIA 3GKNA 2MYGA 1T3BA 3KMOA 1J9BA 2JSZA 1A8YA 4RI7A 3QFAC 1HQOA 5H5QA 1BG5A 4K6XA 4AKHA 3W6GA 4K5RA 4MJEA 1XWGA 2P5QA 4L0UA 5A4UA 1FVJA 4EO3A 4EVMA 1XWAA 3DEXA 2VD1A 3GFKA 1YQ1A 4IJIA 5D9XA 4MZBA 3LQ7A 5IO0A 5INYA 1VF4A 3GX0A 3FZ5A 3CBUA 3IDVA 2IFQA 5GAND 4MPFA 1SKSB 5EL8A 2LKUA 4XRAA 4MLYA 5J4YA 1LU4A 4IHUA 1VGLA 1J08A 1BYEA 3GIXA 5IOXA 5GSSA 1GTUA 9GSSA 1XPVA 4DEJA 4G01A 2H6YA 1XW6A 3I6AA 5JCGA 1FB6A 4Z7XA 2B5YA 4K1FA 5FHIA 3DVXA 4TRXA 4KE3A 4IQ1A 2H76A 3ERWA 3EWLA 4NHWA 4J2FA 1A23A 3PPUA 1PN9A 1PQNA 1BAYA 1GSDA 3FRCA 4G0LA 3EVIA 4LLRA 3GV1A 3Q74A 2WJUA 2DKIA 1K3OA 1WP0A 5D9WA 1E2YA 1Z7PA 1DBYA 2FGXA 1WPIA 3WT1A 4BPYA 1HD2A 1GNWA 2G2QA 4X1UA 1HNBA 4AKIA 2WVXA 1XFLA 2LJRA 1UA5A 4GCIA 5IMDA 3BCKA 5AIXA 1TI1A 5AN1A 2I9HA 4YAVA 4HSCX 2LJKA 4YAPA 1FHEA 5JCWA 1HYUA 4YKGA 3QPMA 1V98A 2LEGA 4BWSA 2LNTA 2C80A 1B9XC 1OE7A 1XXUA 4HS1A 3UVHA 2JSYA 1XWCA 3CRUA 3UAPA 4XIHA 1GUHA 5D93A 3GNJA 4NMUA 19GSA 5A34B 2VCTA 1YVLA 4O7HA 1NSWA 4DSQA 2ZUPA 3ERFA 4Q5FA 3IXRA 5DQYA 1V57A 4PI2C 3FW2A 2CVKA 3APQA 3GA4A 2OACA 3EINA 5A5HB 3ME7A 1MD3A 2PGTA 3EU3A 3KD0A 4XS4B 4HDEA 2HNLA 2FD3A 3DIEA 3EURA 3G7YA 4K7OA 3US3A 2O89A 2ZCTA 2LV3A 5JWRB 2WDUA 2CQ9A 4N0ZA 3GH6A 1PL1A 2KP1A 2HSNB 2IIYA 1N2AA 3BOAA 3GKMA 3L0HA 2OE3A 3F6DA 1U3IA 4BVXA 4ZB8A 1SJIA 2FA8A 2PVOC 3FKFA 1W4VA 5AISA 3IPZA 2H6ZA 2PWJA 3A5IA 4KNDA 1R5AA 4F03A 1EEJA 2HI7A 4MPGA 2M46A 4YQUA 1M3IA 2AB6A 2ON5A 2VLUA 3ZYWA 2C8UA 2FWGA 1RK4A 1QMVA 3O6TA 5A4VA 3TKQA 5ECSA 3CSHA 2ES7A 2A2PA 3KP8A 1M2AA 2H1LA 3VLNA 2GZZA 5B8AA 1KEBA 3UIWA 5HR3A 3KP9A 2JL4A 3LG6A 2OADA 1EV9A 1TRVA 5J9BA 4GQCA 2LUSA 3C1SA 4QQ7A 1QUWA 1X5EA 3MAKA 4ECBA 3WGEA 4K7IA 3LXZA 1S3AA 3BCIA 2VOCA 4ML6A 2R0GA 5ECLB 2CT6A 2KP2A 2CX4A 4F9ZA 2LRCA 2C3NA 1DE1A 4CHSA 2IFQB 3TGZA 4ZBBA 1EOHA 3RBTA 2WW3A 2JZRA 1OVNA 4X4JA 2GTUA 3KXOA 3TRQA 2YNXA 3UBLA 2NBSA 2HRNA 4JR4A 5DBQA 1CQHA 4LMWA 1SYRA 2CAQA 2YOIA 3LYPA 1PKWA 4EDZA 2LJAA 2VCZA 3ZVJD 4G19A 4PUAA 5DAKA 2B7KA 1XWBA 3R2QA 2B3SA 3LSZA 4MF5A 4KDYA 2PPTA 3A5WA 1A2MA 1H75A 2C0FA 1F37A 2A4VA 1ERWA 1Z7RA 3R3EA 1SJZA 4AJ8A 3G7IA 4TN8A 1ZMAA 4NWYA 2WVYA 2YJHA 3I43A 2X99A 2N5FA 2E7PA 4ZIJA 6GSVA 4I6XA 2ZNMA 3HJOA 4ZL8A 4FYBA 1V40A 2IWTA 4I97A 2QC7A 4V2LA 4WR5A 1ZL9A 2L57A 2HRKA 5CO3A 4G10A 4ZB6A 1JHBA 4GRFA 4FYUA 2WVXB 2RIIA 3IV4A 3GN3A 4IP1A 1YEXA 2YZHA 3M9KA 2EFHA 3TOTA 4POKA 2EFDA 1JLVA 2F3MA 2QA1A 2VCXA 2L6DA 5KN3A 1EGRA 1PFOA 4MMMA 2OA7A 2WS2A 1QFNA 2F8AA 4GSTA 3CMIA 4MABA 4IKHA 1ZYPA 3MWHA 4BL7A 2XC2A 1H4OA 4G9HA 1SK0A 2CZ2A 4JE1A 1MTCA 2GSTA 2LS5A 1TDIA 5DALA 5ECRB 3PR8A 3D6IA 4POLA 2PERA 3KM6A 3IAM2 3TRPA 4N11A 3HZ4A 5J4UA 3M0FA 2F8FA 1SJ6A 5E4WA 1SKWB 2B5EA 3QAGA 2K18A 5DJMA 4L5OA 2FY6A 2O85A 4KB3A 2FUG2 2LRNA 3F4SA 1PD21 1LBKA 3J7Yk 4QL7A 3RPNA 1BQ7A 3TKPA 2EIOA 3CRTA 3F8UA 3Q18A 4PGTA 1O85A 1FOHA 3KIJA 1GL8A 3LEFA 2GLRA 4WR4A 4TR3A 4I8BA 4JR6A 2V1MA 3GHAA 2DIYA 1EEMA 1V58A 3VPTA 1OAZA 2YN1A 2O7KA 4LA1A 4MA9A 2N5BA 3BBYA 4MF6A 2H01A 5KEJA 5DCGA 3OR5A 4GWRA 2I4AA 1SK2A 2MZCA 4XRDA 3ZIVA 2C3TA 1S3DA 1I5GA 5IOWA 4HU9A 4O5RA 2V41A 4TXOA 3D4MA 5AIVA 4KGIA 3ZVJA 2VL9A 3W8JA 1RQMA 2NDOA 2K8VA 3GKXA 1SL0B 2DJJA 4V1Ap 4QL9A 2XBIA 4PNFA 1VF3A 1SU9A 1X0RA 3DD3A 2OBIA 4WXTA 3ZMKA 1JZDA 3UVTA 3HJMA 4GLTA 3F6FA 5J4VA 3TJFA 3CXGA 1M99A 5IPHA 2OT3A 4V2NA 3GYKA 2H19A 4K7NA 4N10A 2FNOA 5EVOA 5J9CA 4KSMA 2BTOT 1GSEA 2K9FA 4TR4A 2RM6A 2DJ1A 4P3YB 3A2WA 4ULXA 2R3XA 2H1BA 2GQLA 3J7Yb 4XS6A 5G5EA 3LYKA 1YEPA 1ILOA 4HJ2A 3ZZXA 4KCEA 5G1KA 1Q98A 1X9SB 1SYXA 1TRUA 5CP1A 1TP9A 1DUGA 2KOKA 1M3JA 3O3TA 2R5GA 2WULA 1MDJA 2PVQA 3HVSA 4NXIA 2GSSA 4G0IA 4K8MA 2H30A 3KTLA 4ZBDA 2AAWA 2MMZA 5DAKB 4X0XA 1AIUA 1YEWC 3DMLA 4MNNA 1A24A 1EV4A 2N5AA 2X4AA 3CTGA 2LTKA 3TKSC 1KTEA 3VWUA 1GWCA 2HZEA 1TXXA 3LJRA 3EE2A 3GSTA 5H5RA 3FR3A 4J56E 2OKAA 2H72A 2B1KA 5DDLA 3EMXA 2BJXA 4HU7A 3VI5A 3D5JA 2VCWA 2CVDA 2CZ3A 5DJLA 2J23A 2R37A 2RUFA 5EY6A 4ICYA 3N5OA 5CRHA 4BA7A 2H6XA 4Q5QA 1Z3EA 3ZL5A 4WBJA 2HRAA 2KHPA 2R6KA 3H79A 1B9YC 3GRXA 3H93A 3JCML 1ZCPA 4TR1A 4NHZA 4BL7B 1QGVA 1YKCA 1A2JA 5DALB 4K0NA 3MNGA 2B6MA 1YKAA 2K6VA 4EC0A 4FXYP 3HCZA 3C73A 4EDYA 2YWMA 1FOVA 3VFIA 1OE8A 1JZWA 3Q19A 3D0ZA 2JACA 4MCUA 3G7JA 3HVVA 3I69A 4HJMA 1TTZA 2O3EA 4JRRA 5LCZA 14GSA 2QA2A 3TJBA 4IP6A 4PNGA 4OFTA 3TU3B 4OFNA 3HHVA 5IMVA 1GRXA 5ECOB 2DLXA 4J57E 1M9BA 5IMFA 2WRTA 2KUCA 1FAAA 2C0DA 5IPGA 2DJ2A 3H8QA 3TJJA 5J3RA 4EIQA 1T00A 2IMEA 3CYNA 5LD0A 2LNSA 4NPBA 1XCCA 4DSSA 5HR2A 1MDKA 5D9VA 1HNCA 4KUNA 4IN0A 1ML6A 2E0QA 3TRXA 2B5XA 1SL2B 4WETA 1AQXA 3P90A 1T4YA 1AAZA 1K3YA 2L6CA 3HVNA 4BIKA 2NVLA 2NTOA 4USSA 2YWIA 1XBSA 4EF0A 1BF5A 4TXOB 3SBCA 2WZSA 2DIZA 2IMDA 5HR1A 2P5RA 1SVOA 2VD0A 1NW2A 4IQAA 3PGTA 4E8HA 1SVLA 1Z5YE 5GAPD 1RW1A 2VUPA 5B6MA 3WYWA 2HFDA 2YCDA 1FW1A 3IE3A 4KW6A 5L71A 6GSUA 5ECIB 1ACVA 3F4RA 4RI6A 4A5PA 3D4TA 3TB2A 3TJGA 2H71A 3HD5A 6GSTA 4IGJA 3C71A 1B4PA 5G5FA 1EP8A 2FLSA 3Q6OA 1ZYEA 2VO4A 4OMVA 2VCVA 3VURA 1XZOA 5IO2A 3QCPA 5CNWA 4IBPA 1KNGA 2KLXA 4XTSA 1TK5B 4YQVA 4ZILA 5FWGA 2X8GA 2CVBA 3HJPA 1E6BA 2C0EA 3GTUA 3G9BA 2HSMA 4PQIA 3F3RA 4LL4B 5ECMB 4YQMA 3ZTLA 4ZBAA 4F82A 5IM9A 3GX8A 1IYHA 1HNAA 1IYIA 5A1NA 2GT5A 5IIZA 1M9AA 1JZRA 4N3ZA 4GTUA 4W66A 4I2TA 1JZOA 2HYXA 1YF1A 5ECKB 4RQRA 2WVZA 4FIWA 3F0IA 2UZ8A 3KJYA 4MK3A 2VL2A 13GSA 3E9JB 1B48A 3TKSE 4GSNA 1SK1A 5HFGA 4HOJA 2HZEB 2HSHA 2DC5A 4IELA 2CX3A 2HXKA 4L0WA 1Z6NA 17GSA 1AW9A 3V1WA 3HA9A 1O8WA 4H86A 1DE2A 5AGYA 3DKSA 1J0FA 3A3TA 1MD4A 5B6NA 1T1VA 1UN2A 1OC8A 4G0KA 1TXUA 3KGKA 3FZ9A 3FYGA 4HI7A 3CSIA 3N9JA 3F63A 2DJ0A 4K2XA 1KBNA 4F2IA 1Y6EA 5CAXA 3C1RA 2IN3A 2YWOA 2EIQA 3KZQA 4PHZC 11GSA 1R5PA 5J40A 5CRDA 2YZUA 2YP6A 4HZ2A 1GTAA 3FR6A 2DBCA 2IMIA 3EYTA 1MEKA 2H0IA 2UV8G 1PL2A 2L5OA 2MBTA 3IC4A 2GZPA 1OKTA 4TR1B 4IVFA 1XW9A 3TKSA 5JWOB 4K0GA 1BG1A 1ABAA 5IQYA 1K0BA 4ILFA
chains in the Genus database with same CATH topology
5CRWA 2I1UA 4ID0A 1Y25A 5LNKe 1PN0A 4GQFA 12GSA 1Q4JA 2R4VA 1OYJA 5KOWA 5F06A 1PRXA 4KAEA 1VRSD 5FT3A 2I3YA 4WEYA 1X5DA 3MDKA 5KN1A 4EUYA 4CY6A 1EOGA 3WT2A 5A5KA 2JZSA 2OE0A 4EIPA 4CW9A 4NV2A 1XOBA 2VM1A 3ZIJA 5ECQB 3BJ5A 4AF2A 5CRGA 1X9MB 2RUEA 1TW9A 4FQUA 3ZITA 2Z9SA 1NHOA 3RHBA 3QAVA 2MMAA 1BEDA 3UJ1A 3L4NA 5KOXA 4Z2TA 2F51A 2AJQB 3KEBA 3LORA 2ON7A 1B4QA 2GS3A 2HRFA 1PMTA 3PINA 5HR0A 3MYDA 3D21A 3L9VA 2L4QA 2YJ7A 2AUVA 3GURA 3CWGA 1FVKA 4MP4A 4K5SA 3DXBA 1N8JA 2A4HA 3BD2A 1GSQA 5D73A 3IBHA 2JADA 2H1AA 1VF2A 4JBBA 5G2ZA 1F6MC 1GLPA 4E68A 4BVXB 3H4KA 2PN8A 4F0CA 4ZB9A 2CA8A 2MMOA 1XOAA 1M2DA 4N30A 2L4CA 1X9WB 3RAZA 1SD8A 2C0GA 1WE0A 4MDCA 2GGTA 4HUAA 5A5HA 4ZL7A 1UVZA 4MF7A 4OCEA 3HY2A 3NOFA 1PSQA 20GSA 5HFKA 2LRTA 3F9UA 1GUKA 1PKZA 4TW5A 5KN0A 5G1LA 2A2SA 2V6OA 3IRAA 2CAIA 2R2JA 3S9FA 2YWNA 4IS0A 4JEDA 2R0PA 5ID2A 4XS1A 3IOSA 3ED3A 16GSA 2WGRA 1PX7A 2GQKA 2H74A 1EGOA 3CSJA 4AJ6A 3FK8A 3GTUB 2HSMB 1ERUA 3FR9A 1AQVA 1ON4A 2HQTA 1NHYA 4BVYA 1TRWA 5A1NB 1K0MA 3MSZA 1Z6MA 2REMA 4PQ1A 5EPFA 1TK0B 1WIKA 2VL3A 2WB9A 2B1LA 4QMKA 1W89A 4L5LA 3UARA 2LQOA 4N0VA 3TCOA 2YANA 1WOUA 4Q5RA 3A2XA 2DJ3A 2QSIA 2VAFA 3K8NA 2DKHA 1GUMA 1T7PB 3L9UA 5ECNB 5G30A 1K0AA 1SVMA 4I5QA 4TXVA 4F0BA 3GL3A 1TJDA 3FEUA 1LJRA 3WGXA 2H8LA 1M0UA 2OE1A 4KH7A 4GDFA 3IR4A 1V2AA 3ZFBA 5C04A 3TDGA 5ELAA 1ZZYA 2XPEA 2RM5A 4WF5A 4AKXB 4HZ4A 4MH3A 1ERTA 5F0GA 4POMA 5CREA 4G2EA 1K3LA 4DSRA 5GZZB 4AGSA 2H73A 4MZWA 1FG4A 3GL5A 2IJYA 2EFCA 3RHCA 2P0GA 1G7EA 4YH2A 2PMTA 1O7UA 2HE3A 2HRKB 5J41A 3UMAA 5B8BA 22GSA 3NIVA 5A4WA 3O76A 1S3CA 1XVQA 3U6VA 2TRXA 1B8XA 2MBSA 4AJ7A 3IHGA 4WBRD 2X64A 2ALBA 2BMXA 4D73A 3TOUA 2PBJA 1ZGNA 2H70A 2GVPA 1O81A 2MMNA 3WD6A 1V9WA 5B7CA 4KCAA 3QFBC 1NM3A 3EPTA 2XHFA 4FH8A 4EL1A 1M7TA 1SD9A 2H1GA 3HVXA 4PX1A 2GZYA 4Z2UA 1O6JA 2J9HA 3KCMA 1ST9A 5JWQB 1M2BA 3SWLA 2FWHA 4K9ZA 2LSTA 3QD9A 4ZB7A 3HKRA 4LL1B 1F3AA 4RUVA 3QMXA 4ECIA 4FYCA 2VLTA 1ZOFA 3EMPA 3KH9A 1AC1A 1A0FA 3M3MA 1PA3A 1TRSA 1GULA 1K0NA 4E8EA 2H66A 3ME8A 4KF9A 1YF0A 2X8CA 3IK7A 4MJCA 1R26A 1OC9A 3FZAA 5F8BA 3VK9A 1VF1A 4GSSA 6GSSA 3F4TA 1GSSA 3QR6A 3NZNA 3VI7A 4ECCA 1FB0A 1PX6A 2TIRA 3RDWA 1K0DA 1TI3A 3GSSA 3I9V2 4EE0A 2H0GA 3KH7A 5ABRA 1TU8A 1EWXA 5DVBA 4HQSA 1QXHA 2HZFA 1SENA 2H75A 4V2MA 4MH2A 2VM2A 1G6WA 2OBKA 4OWYA 3APSA 2CV4A 2O5VA 5ID2B 2X8HA 5DQSA 3KTBA 2TRCP 4ISDA 5ENUA 3F3QA 1A8LA 4CDOA 2E2MA 4AI6A 5BMUA 1SKRB 3DRNA 1WRYA 4YKFA 2EFEA 1ERVA 3E3EA 3HMJG 4Q5NA 3TJKA 4BVYB 4XCSA 5G31A 5HFIA 1FO5A 2DMMA 1MDIA 3HYPA 1A2LA 1XVWA 3HDCA 2YV7A 2VLVA 3LWAA 6GSWA 4JU5A 3ZREA 3EC3A 4IJ3A 4POBA 4LMVA 2IPAA 4BWQA 2K8SA 3QDNA 1THOA 3EU4A 3P7XA 1Z9HA 3M1GA 3IAS2 5J47A 1WWJA 2M80A 2PUKC 1JLWA 1GP1A 2VKZG 2L5LA 5ELGA 3UEMA 2WZ9A 2FWEA 4GXZA 4ZL9A 3VWVA 2HT9A 1BX9A 2E2GA 2C3QA 1U88A 4O5UA 4XHMA 3DYRA 3AY8A 4KDUA 2AV4A 2VCQA 1I9DA 1K0CA 4NAXA 3UBKA 3U5RE 1O73A 2GSQA 3HXSA 3C8EA 1AQWA 1GTBA 3ZMLA 1F2EA 3TUEA 1THXA 2YV9A 3M8NA 4KDXA 1N25A 1WMJA 3D22A 2IL3A 1GSUA 2EC4A 2YPMA 2GT6A 5D8IA 2B7JA 3QOUA 2JZTA 5HQPA 2A2RA 5IMCA 1QK8A 3M9JA 2X49A 5ECPB 4GF0A 2C4JA 4WF4A 4D73B 4Z2RA 1BJXA 1Y1UA 1UC7A 2V2GA 1ZYNA 4OO5A 3ZRDA 2GSRA 10GSA 1CQGA 3QAWA 3DGQA 5IMAA 1GNEA 1G6YA 4HEA2 2R0CA 5F07A 4ACSA 1AXDA 2GQMA 1OC3A 2RLIA 3LGCA 8GSSA 4V1Ag 4WKWA 3TKRA 1YJ6A 2H1DA 4FO5A 5BRTA 2OJLA 2V6KA 2L59A 4OD7A 4L8EA 1K0OA 1DSBA 1TOFA 4PUFC 1YY7A 5D9TA 5COHA 1U6TA 5J5NA 1TU7A 4PTSA 4AKGA 2EIRA 1YZXA 1X5CA 6GSYA 3L78A 2FA4A 4RQXA 5CYYA 4TKYA 3HZ8A 1U87A 3IA1A 2O8VB 4I2UA 2O87A 3FMWA 4DSSB 1ZYQB 3W8SA 2GDRA 3ERGA 7GSSA 2PU9C 2WFCA 2AYTA 3LFLA 4KA0A 5H5SA 3GMFA 4EXJA 5C00A 4PQHA 2IMFA 5GSTA 2I81A 3MIXA 1QQ2A 1TKDB 1T4ZA 4OCFA 4JZQA 1OC9B 3VWWA 1G0TA 3PH9A 4MJBA 4OFMA 1F9MA 5KN2A 1T8EB 5JCUA 1YDKA 2QGVA 4OO4A 3FY7A 3UL3A 1SL1B 3A2VA 3P8WA 4KX4A 4O32A 3ZLPA 1XIYA 4ECJA 3IC8A 3APOA 3H1NA 5ECHB 4O5QA 1G7OA 5A34A 2XBQA 4TR0A 5IMZA 1GLQA 2P31A 2HLSA 18GSA 4EKZA 1USBA 2C1YA 3CTFA 3FHKA 1EZKA 3IHQA 4PURA 2WCIA 3DVWA 2DMLA 3FZ4A 2FHEA 2JU5A 3GH9A 4CY8A 4XS4A 5BMUB 3VWXA 2FCHA 3P2AA 1R4WA 3LXTA 1URMA 2DJKA 2H0HA 5E59A 2IMKA 5DCHA 1XW5A 2NPBA 4MJAA 2LQQA 4ML1A 1F3BA 4HQZA 2M72A 2HSNA 3RPPA 3VPQA 1OKDA 3L9SA 1R7HA 1AUCA 1XWKA 5F05A 3ISOA 1O8XA 6GSXA 3ZFLA 2FWFA 4O92A 3DWVA 3UOMA 1EP7A 4DVCA 4TVEA 4IW9A 4ZXGA 3KMNA 2DSAA 1A0RP 4TOPA 2V32A 2D2ZA 2VL2C 1C72A 4NV5A 2HSYA 4K2DA 3IK9A 4X43A 4MZCA 2G0FA 2F9SA 1PGTA 1JFUA 2AHEA 1TK8B 3GUSA 1WJKA 1U3AA 2VIMA 3C7MA 2QKEA 3GKKA 4PXOA 1GSYA 2XPDA 3LW9A 1GH2A 4KSOA 1GSFA 5D96A 3WGDA 3E0UA 1GTIA 3GKNA 2MYGA 1T3BA 3KMOA 1J9BA 2JSZA 1A8YA 4RI7A 3QFAC 1HQOA 5H5QA 1BG5A 4K6XA 4AKHA 3W6GA 4K5RA 4MJEA 1XWGA 2P5QA 4L0UA 5A4UA 1FVJA 4EO3A 4EVMA 1XWAA 3DEXA 2VD1A 3GFKA 1YQ1A 4IJIA 5D9XA 4MZBA 3LQ7A 5IO0A 5INYA 1VF4A 3GX0A 3FZ5A 3CBUA 3IDVA 2IFQA 5GAND 4MPFA 1SKSB 5EL8A 2LKUA 4XRAA 4MLYA 5J4YA 1LU4A 4IHUA 1VGLA 1J08A 1BYEA 3GIXA 5IOXA 5GSSA 1GTUA 9GSSA 1XPVA 4DEJA 4G01A 2H6YA 1XW6A 3I6AA 5JCGA 1FB6A 4Z7XA 2B5YA 4K1FA 5FHIA 3DVXA 4TRXA 4KE3A 4IQ1A 2H76A 3ERWA 3EWLA 4NHWA 4J2FA 1A23A 3PPUA 1PN9A 1PQNA 1BAYA 1GSDA 3FRCA 4G0LA 3EVIA 4LLRA 3GV1A 3Q74A 2WJUA 2DKIA 1K3OA 1WP0A 5D9WA 1E2YA 1Z7PA 1DBYA 2FGXA 1WPIA 3WT1A 4BPYA 1HD2A 1GNWA 2G2QA 4X1UA 1HNBA 4AKIA 1XFLA 2LJRA 1UA5A 4GCIA 5IMDA 3BCKA 5AIXA 1TI1A 5AN1A 2I9HA 4YAVA 2LJKA 4YAPA 1FHEA 5JCWA 1HYUA 4YKGA 3QPMA 1V98A 2LEGA 4BWSA 2LNTA 2C80A 1B9XC 1OE7A 1XXUA 4HS1A 3UVHA 2JSYA 1XWCA 3CRUA 3UAPA 4XIHA 1GUHA 5D93A 3GNJA 4NMUA 19GSA 5A34B 2VCTA 1YVLA 4O7HA 1NSWA 4DSQA 2ZUPA 3ERFA 4Q5FA 3IXRA 5DQYA 1V57A 3FW2A 2CVKA 3APQA 3GA4A 2OACA 3EINA 5A5HB 3ME7A 1MD3A 2PGTA 3EU3A 3KD0A 4XS4B 4HDEA 2HNLA 2FD3A 3DIEA 3EURA 3G7YA 4K7OA 3US3A 2O89A 2ZCTA 2LV3A 5JWRB 2WDUA 2CQ9A 4N0ZA 3GH6A 1PL1A 2KP1A 2HSNB 2IIYA 1N2AA 3BOAA 3GKMA 3L0HA 2OE3A 3F6DA 1U3IA 4BVXA 4ZB8A 1SJIA 2FA8A 2PVOC 3FKFA 1W4VA 5AISA 3IPZA 2H6ZA 2PWJA 3A5IA 4KNDA 1R5AA 4F03A 1EEJA 2HI7A 4MPGA 2M46A 4YQUA 2AB6A 2ON5A 2VLUA 3ZYWA 2C8UA 2FWGA 1RK4A 1QMVA 3O6TA 5A4VA 3TKQA 5ECSA 3CSHA 2ES7A 2A2PA 3KP8A 1M2AA 2H1LA 3VLNA 2GZZA 5B8AA 1KEBA 3UIWA 5HR3A 3KP9A 2JL4A 3LG6A 2OADA 1EV9A 1TRVA 5J9BA 4GQCA 2LUSA 3C1SA 4QQ7A 1QUWA 1X5EA 3MAKA 4ECBA 3WGEA 4K7IA 3LXZA 1S3AA 3BCIA 2VOCA 4ML6A 2R0GA 5ECLB 2CT6A 2KP2A 2CX4A 4F9ZA 2LRCA 2C3NA 1DE1A 4CHSA 2IFQB 3TGZA 4ZBBA 1EOHA 3RBTA 2JZRA 1OVNA 4X4JA 2GTUA 3KXOA 3TRQA 2YNXA 3UBLA 2NBSA 2HRNA 4JR4A 5DBQA 1CQHA 4LMWA 1SYRA 2CAQA 2YOIA 3LYPA 1PKWA 4EDZA 2LJAA 2VCZA 3ZVJD 4G19A 4PUAA 5DAKA 2B7KA 1XWBA 3R2QA 2B3SA 3LSZA 4MF5A 4KDYA 2PPTA 3A5WA 1A2MA 1H75A 2C0FA 1F37A 2A4VA 1ERWA 1Z7RA 3R3EA 1SJZA 4AJ8A 3G7IA 4TN8A 1ZMAA 4NWYA 2YJHA 3I43A 2X99A 2N5FA 2E7PA 4ZIJA 6GSVA 4I6XA 2ZNMA 3HJOA 4ZL8A 4FYBA 1V40A 2IWTA 4I97A 2QC7A 4V2LA 4WR5A 1ZL9A 2L57A 2HRKA 5CO3A 4G10A 4ZB6A 1JHBA 4GRFA 4FYUA 2RIIA 3IV4A 3GN3A 4IP1A 1YEXA 2YZHA 3M9KA 2EFHA 3TOTA 4POKA 2EFDA 1JLVA 2F3MA 2QA1A 2VCXA 2L6DA 5KN3A 1EGRA 4MMMA 2OA7A 2WS2A 1QFNA 2F8AA 4GSTA 3CMIA 4MABA 4IKHA 1ZYPA 3MWHA 4BL7A 2XC2A 1H4OA 4G9HA 1SK0A 2CZ2A 4JE1A 1MTCA 2GSTA 2LS5A 1TDIA 5DALA 5ECRB 3PR8A 3D6IA 4POLA 2PERA 3KM6A 3IAM2 3TRPA 4N11A 3HZ4A 5J4UA 3M0FA 2F8FA 1SJ6A 5E4WA 1SKWB 2B5EA 3QAGA 2K18A 5DJMA 4L5OA 2FY6A 2O85A 4KB3A 2FUG2 2LRNA 3F4SA 1PD21 1LBKA 3J7Yk 4QL7A 3RPNA 1BQ7A 3TKPA 2EIOA 3CRTA 3F8UA 3Q18A 4PGTA 1O85A 1FOHA 3KIJA 1GL8A 3LEFA 2GLRA 4WR4A 4TR3A 4I8BA 4JR6A 2V1MA 3GHAA 2DIYA 1EEMA 1V58A 3VPTA 1OAZA 2YN1A 2O7KA 4LA1A 4MA9A 2N5BA 3BBYA 4MF6A 2H01A 5KEJA 5DCGA 3OR5A 4GWRA 2I4AA 1SK2A 2MZCA 4XRDA 3ZIVA 2C3TA 1S3DA 1I5GA 5IOWA 4HU9A 4O5RA 2V41A 4TXOA 3D4MA 5AIVA 4KGIA 3ZVJA 2VL9A 3W8JA 1RQMA 2NDOA 2K8VA 3GKXA 1SL0B 2DJJA 4V1Ap 4QL9A 2XBIA 4PNFA 1VF3A 1SU9A 1X0RA 3DD3A 2OBIA 4WXTA 3ZMKA 1JZDA 3UVTA 3HJMA 4GLTA 3F6FA 5J4VA 3TJFA 3CXGA 1M99A 5IPHA 2OT3A 4V2NA 3GYKA 2H19A 4K7NA 4N10A 2FNOA 5EVOA 5J9CA 4KSMA 2BTOT 1GSEA 2K9FA 4TR4A 2RM6A 2DJ1A 4P3YB 3A2WA 4ULXA 2R3XA 2H1BA 2GQLA 3J7Yb 4XS6A 5G5EA 3LYKA 1YEPA 1ILOA 4HJ2A 3ZZXA 4KCEA 5G1KA 1Q98A 1X9SB 1SYXA 1TRUA 5CP1A 1TP9A 1DUGA 2KOKA 3O3TA 2R5GA 2WULA 1MDJA 2PVQA 3HVSA 4NXIA 2GSSA 4G0IA 4K8MA 2H30A 3KTLA 4ZBDA 2AAWA 2MMZA 5DAKB 4X0XA 1AIUA 3DMLA 4MNNA 1A24A 1EV4A 2N5AA 2X4AA 3CTGA 2LTKA 3TKSC 1KTEA 3VWUA 1GWCA 2HZEA 1TXXA 3LJRA 3EE2A 3GSTA 5H5RA 3FR3A 4J56E 2OKAA 2H72A 2B1KA 5DDLA 3EMXA 2BJXA 4HU7A 3VI5A 3D5JA 2VCWA 2CVDA 2CZ3A 5DJLA 2J23A 2R37A 2RUFA 5EY6A 4ICYA 3N5OA 5CRHA 4BA7A 2H6XA 4Q5QA 1Z3EA 3ZL5A 4WBJA 2HRAA 2KHPA 2R6KA 3H79A 1B9YC 3GRXA 3H93A 3JCML 1ZCPA 4TR1A 4NHZA 4BL7B 1QGVA 1YKCA 1A2JA 5DALB 4K0NA 3MNGA 2B6MA 1YKAA 2K6VA 4EC0A 3HCZA 3C73A 4EDYA 2YWMA 1FOVA 3VFIA 1OE8A 1JZWA 3Q19A 3D0ZA 2JACA 4MCUA 3G7JA 3HVVA 3I69A 4HJMA 1TTZA 4JRRA 5LCZA 14GSA 2QA2A 3TJBA 4IP6A 4PNGA 4OFTA 3TU3B 4OFNA 3HHVA 5IMVA 1GRXA 5ECOB 2DLXA 4J57E 1M9BA 5IMFA 2WRTA 2KUCA 1FAAA 2C0DA 5IPGA 2DJ2A 3H8QA 3TJJA 5J3RA 4EIQA 1T00A 2IMEA 3CYNA 5LD0A 2LNSA 4NPBA 1XCCA 4DSSA 5HR2A 1MDKA 5D9VA 1HNCA 4KUNA 4IN0A 1ML6A 2E0QA 3TRXA 2B5XA 1SL2B 4WETA 1AQXA 3P90A 1T4YA 1AAZA 1K3YA 2L6CA 2NVLA 2NTOA 4USSA 2YWIA 1XBSA 4EF0A 1BF5A 4TXOB 3SBCA 2DIZA 2IMDA 5HR1A 2P5RA 1SVOA 2VD0A 1NW2A 4IQAA 3PGTA 4E8HA 1SVLA 1Z5YE 5GAPD 1RW1A 2VUPA 5B6MA 3WYWA 2HFDA 2YCDA 1FW1A 3IE3A 4KW6A 5L71A 6GSUA 5ECIB 1ACVA 3F4RA 4RI6A 4A5PA 3D4TA 3TB2A 3TJGA 2H71A 3HD5A 6GSTA 4IGJA 3C71A 1B4PA 5G5FA 1EP8A 2FLSA 3Q6OA 1ZYEA 2VO4A 4OMVA 2VCVA 3VURA 1XZOA 5IO2A 3QCPA 5CNWA 4IBPA 1KNGA 2KLXA 4XTSA 1TK5B 4YQVA 4ZILA 5FWGA 2X8GA 2CVBA 3HJPA 1E6BA 2C0EA 3GTUA 3G9BA 2HSMA 4PQIA 3F3RA 4LL4B 5ECMB 4YQMA 3ZTLA 4ZBAA 4F82A 5IM9A 3GX8A 1IYHA 1HNAA 1IYIA 5A1NA 2GT5A 5IIZA 1M9AA 1JZRA 4N3ZA 4GTUA 4W66A 4I2TA 1JZOA 2HYXA 1YF1A 5ECKB 4RQRA 4FIWA 3F0IA 2UZ8A 3KJYA 4MK3A 2VL2A 13GSA 3E9JB 1B48A 3TKSE 4GSNA 1SK1A 5HFGA 4HOJA 2HZEB 2HSHA 2DC5A 4IELA 2CX3A 2HXKA 4L0WA 1Z6NA 17GSA 1AW9A 3V1WA 3HA9A 1O8WA 4H86A 1DE2A 5AGYA 3DKSA 1J0FA 3A3TA 1MD4A 5B6NA 1T1VA 1UN2A 1OC8A 4G0KA 1TXUA 3KGKA 3FZ9A 3FYGA 4HI7A 3CSIA 3N9JA 3F63A 2DJ0A 4K2XA 1KBNA 4F2IA 1Y6EA 5CAXA 3C1RA 2IN3A 2YWOA 2EIQA 3KZQA 11GSA 1R5PA 5J40A 5CRDA 2YZUA 2YP6A 4HZ2A 1GTAA 3FR6A 2DBCA 2IMIA 3EYTA 1MEKA 2H0IA 2UV8G 1PL2A 2L5OA 2MBTA 3IC4A 2GZPA 1OKTA 4TR1B 4IVFA 1XW9A 3TKSA 5JWOB 4K0GA 1BG1A 1ABAA 5IQYA 1K0BA 4ILFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CRW A;  2I1U A;  4ID0 A;  1Y25 A;  5LNK e;  4GQF A;  12GS A;  1Q4J A;  2R4V A;  1OYJ A;  5F06 A;  1PRX A;  4KAE A;  1VRS D;  5FT3 A;  2I3Y A;  4WEY A;  1X5D A;  3MDK A;  5KN1 A;  4EUY A;  1EOG A;  3WT2 A;  5A5K A;  2JZS A;  2OE0 A;  4CW9 A;  4NV2 A;  1XOB A;  2VM1 A;  3ZIJ A;  5ECQ B;  3BJ5 A;  4AF2 A;  5CRG A;  1X9M B;  2RUE A;  1TW9 A;  4FQU A;  3ZIT A;  2Z9S A;  1NHO A;  3RHB A;  3QAV A;  2MMA A;  1BED A;  3UJ1 A;  3L4N A;  2F51 A;  2AJQ B;  3KEB A;  3LOR A;  2ON7 A;  1B4Q A;  2GS3 A;  2HRF A;  1PMT A;  3PIN A;  5HR0 A;  3D21 A;  3L9V A;  2L4Q A;  2YJ7 A;  2AUV A;  3GUR A;  1FVK A;  4MP4 A;  3DXB A;  1N8J A;  3BD2 A;  1GSQ A;  5D73 A;  3IBH A;  2JAD A;  2H1A A;  1VF2 A;  4JBB A;  5G2Z A;  1F6M C;  1GLP A;  4BVX B;  3H4K A;  2PN8 A;  4F0C A;  4ZB9 A;  2CA8 A;  2MMO A;  1XOA A;  1M2D A;  4N30 A;  2L4C A;  1X9W B;  3RAZ A;  1SD8 A;  2C0G A;  1WE0 A;  4MDC A;  2GGT A;  4HUA A;  4ZL7 A;  1UVZ A;  4MF7 A;  4OCE A;  3HY2 A;  3NOF A;  1PSQ A;  20GS A;  5HFK A;  2LRT A;  3F9U A;  1GUK A;  1PKZ A;  4TW5 A;  5KN0 A;  5G1L A;  2A2S A;  2V6O A;  3IRA A;  2CAI A;  2R2J A;  3S9F A;  2YWN A;  4IS0 A;  4JED A;  5ID2 A;  4XS1 A;  3IOS A;  3ED3 A;  16GS A;  2WGR A;  1PX7 A;  2GQK A;  2H74 A;  1EGO A;  3CSJ A;  4AJ6 A;  3FK8 A;  3GTU B;  2HSM B;  1ERU A;  3FR9 A;  1AQV A;  1ON4 A;  2HQT A;  1NHY A;  4BVY A;  1TRW A;  1K0M A;  3MSZ A;  1Z6M A;  2REM A;  4PQ1 A;  5EPF A;  1TK0 B;  1WIK A;  2VL3 A;  2WB9 A;  2B1L A;  1W89 A;  4L5L A;  3UAR A;  2LQO A;  4N0V A;  3TCO A;  2YAN A;  1WOU A;  4Q5R A;  3A2X A;  2DJ3 A;  2QSI A;  2VAF A;  3K8N A;  1GUM A;  1T7P B;  3L9U A;  5ECN B;  5G30 A;  1K0A A;  4I5Q A;  4TXV A;  4F0B A;  3GL3 A;  1TJD A;  3FEU A;  1LJR A;  3WGX A;  2H8L A;  1M0U A;  2OE1 A;  4KH7 A;  3IR4 A;  1V2A A;  3ZFB A;  5C04 A;  3TDG A;  5ELA A;  1ZZY A;  2XPE A;  2RM5 A;  4WF5 A;  4HZ4 A;  4MH3 A;  1ERT A;  5F0G A;  4POM A;  5CRE A;  4G2E A;  1K3L A;  4DSR A;  5GZZ B;  4AGS A;  2H73 A;  4MZW A;  1FG4 A;  3GL5 A;  2IJY A;  3RHC A;  2P0G A;  1G7E A;  4YH2 A;  2PMT A;  1O7U A;  2HE3 A;  2HRK B;  5J41 A;  3UMA A;  5B8B A;  22GS A;  3NIV A;  5A4W A;  3O76 A;  1S3C A;  1XVQ A;  3U6V A;  2TRX A;  1B8X A;  2MBS A;  4AJ7 A;  4WBR D;  2X64 A;  2ALB A;  2BMX A;  4D73 A;  3TOU A;  2PBJ A;  1ZGN A;  2H70 A;  2GVP A;  1O81 A;  2MMN A;  3WD6 A;  1V9W A;  5B7C A;  4KCA A;  3QFB C;  1NM3 A;  2XHF A;  4FH8 A;  4EL1 A;  1M7T A;  1SD9 A;  2H1G A;  3HVX A;  4PX1 A;  2GZY A;  1O6J A;  2J9H A;  3KCM A;  1ST9 A;  5JWQ B;  1M2B A;  3SWL A;  2FWH A;  4K9Z A;  2LST A;  3QD9 A;  3HKR A;  4LL1 B;  1F3A A;  4RUV A;  3QMX A;  4ECI A;  4FYC A;  2VLT A;  1ZOF A;  3EMP A;  3KH9 A;  1AC1 A;  1A0F A;  3M3M A;  1PA3 A;  1TRS A;  1GUL A;  1K0N A;  4E8E A;  2H66 A;  3ME8 A;  4KF9 A;  1YF0 A;  2X8C A;  3IK7 A;  4MJC A;  1R26 A;  1OC9 A;  3FZA A;  5F8B A;  3VK9 A;  1VF1 A;  4GSS A;  6GSS A;  3F4T A;  1GSS A;  3QR6 A;  3NZN A;  3VI7 A;  4ECC A;  1FB0 A;  1PX6 A;  2TIR A;  3RDW A;  1K0D A;  1TI3 A;  3GSS A;  3I9V 2;  4EE0 A;  2H0G A;  3KH7 A;  5ABR A;  1TU8 A;  1EWX A;  5DVB A;  4HQS A;  1QXH A;  2HZF A;  1SEN A;  2H75 A;  4V2M A;  4MH2 A;  2VM2 A;  1G6W A;  2OBK A;  4OWY A;  3APS A;  2CV4 A;  5ID2 B;  2X8H A;  5DQS A;  3KTB A;  2TRC P;  4ISD A;  5ENU A;  3F3Q A;  1A8L A;  4CDO A;  2E2M A;  5BMU A;  1SKR B;  3DRN A;  1WRY A;  3E3E A;  1ERV A;  4Q5N A;  3TJK A;  4BVY B;  4XCS A;  5G31 A;  5HFI A;  1FO5 A;  2DMM A;  1MDI A;  3HYP A;  1A2L A;  1XVW A;  3HDC A;  2YV7 A;  2VLV A;  3LWA A;  6GSW A;  4JU5 A;  3ZRE A;  3EC3 A;  4IJ3 A;  4POB A;  4LMV A;  2IPA A;  4BWQ A;  2K8S A;  3QDN A;  1THO A;  3EU4 A;  3P7X A;  1Z9H A;  3M1G A;  3IAS 2;  2M80 A;  1WWJ A;  2PUK C;  1JLW A;  1GP1 A;  2L5L A;  5ELG A;  3UEM A;  2WZ9 A;  2FWE A;  4GXZ A;  4ZL9 A;  3VWV A;  2HT9 A;  1BX9 A;  2E2G A;  2C3Q A;  1U88 A;  4XHM A;  3DYR A;  3AY8 A;  4KDU A;  2AV4 A;  2VCQ A;  1I9D A;  1K0C A;  4NAX A;  3UBK A;  3U5R E;  1O73 A;  2GSQ A;  3HXS A;  3C8E A;  1AQW A;  1GTB A;  3ZML A;  1F2E A;  3TUE A;  1THX A;  2YV9 A;  3M8N A;  4KDX A;  1WMJ A;  3D22 A;  2IL3 A;  1GSU A;  2EC4 A;  2YPM A;  2GT6 A;  5D8I A;  2B7J A;  3QOU A;  2JZT A;  5HQP A;  2A2R A;  5IMC A;  1QK8 A;  3M9J A;  5ECP B;  4GF0 A;  2C4J A;  4WF4 A;  4D73 B;  1BJX A;  1UC7 A;  2V2G A;  4OO5 A;  3ZRD A;  2GSR A;  10GS A;  1CQG A;  3QAW A;  3DGQ A;  5IMA A;  1GNE A;  1G6Y A;  4HEA 2;  5F07 A;  4ACS A;  1AXD A;  2GQM A;  1OC3 A;  2RLI A;  3LGC A;  8GSS A;  4V1A g;  4WKW A;  3TKR A;  1YJ6 A;  2H1D A;  4FO5 A;  2OJL A;  2V6K A;  2L59 A;  4OD7 A;  4L8E A;  1K0O A;  1DSB A;  1TOF A;  4PUF C;  1YY7 A;  5D9T A;  5COH A;  1U6T A;  5J5N A;  1TU7 A;  4PTS A;  2EIR A;  1YZX A;  1X5C A;  6GSY A;  3L78 A;  2FA4 A;  4RQX A;  5CYY A;  4TKY A;  3HZ8 A;  1U87 A;  3IA1 A;  2O8V B;  4I2U A;  2O87 A;  4DSS B;  1ZYQ B;  3W8S A;  2GDR A;  3ERG A;  7GSS A;  2PU9 C;  2WFC A;  2AYT A;  3LFL A;  4KA0 A;  5H5S A;  3GMF A;  4EXJ A;  5C00 A;  4PQH A;  2IMF A;  5GST A;  2I81 A;  1QQ2 A;  1TKD B;  1T4Z A;  4OCF A;  4JZQ A;  1OC9 B;  3VWW A;  1G0T A;  3PH9 A;  4MJB A;  4OFM A;  1F9M A;  5KN2 A;  1T8E B;  5JCU A;  1YDK A;  2QGV A;  4OO4 A;  3FY7 A;  3UL3 A;  1SL1 B;  3A2V A;  3P8W A;  4KX4 A;  4O32 A;  3ZLP A;  1XIY A;  4ECJ A;  3IC8 A;  3APO A;  3H1N A;  5ECH B;  1G7O A;  2XBQ A;  4TR0 A;  5IMZ A;  1GLQ A;  2P31 A;  2HLS A;  18GS A;  4EKZ A;  1USB A;  2C1Y A;  3CTF A;  3FHK A;  1EZK A;  3IHQ A;  4PUR A;  2WCI A;  3DVW A;  2DML A;  3FZ4 A;  2FHE A;  2JU5 A;  3GH9 A;  4XS4 A;  3VWX A;  2FCH A;  3P2A A;  1R4W A;  3LXT A;  1URM A;  2DJK A;  2H0H A;  5E59 A;  2IMK A;  5DCH A;  1XW5 A;  2NPB A;  4MJA A;  2LQQ A;  4ML1 A;  1F3B A;  4HQZ A;  2M72 A;  3RPP A;  3VPQ A;  1OKD A;  3L9S A;  1R7H A;  1AUC A;  1XWK A;  5F05 A;  3ISO A;  1O8X A;  6GSX A;  3ZFL A;  2FWF A;  4O92 A;  3DWV A;  3UOM A;  1EP7 A;  4DVC A;  4TVE A;  4IW9 A;  4ZXG A;  3KMN A;  2DSA A;  1A0R P;  4TOP A;  2V32 A;  2D2Z A;  2VL2 C;  1C72 A;  4NV5 A;  2HSY A;  4K2D A;  3IK9 A;  4X43 A;  4MZC A;  2G0F A;  2F9S A;  1PGT A;  1JFU A;  2AHE A;  1TK8 B;  3GUS A;  1WJK A;  1U3A A;  2VIM A;  3C7M A;  2QKE A;  3GKK A;  4PXO A;  1GSY A;  2XPD A;  1GH2 A;  4KSO A;  1GSF A;  5D96 A;  3WGD A;  3E0U A;  1GTI A;  3GKN A;  2MYG A;  1T3B A;  3KMO A;  1J9B A;  2JSZ A;  1A8Y A;  4RI7 A;  3QFA C;  1HQO A;  5H5Q A;  1BG5 A;  4K6X A;  3W6G A;  4MJE A;  1XWG A;  2P5Q A;  4L0U A;  5A4U A;  1FVJ A;  4EO3 A;  4EVM A;  1XWA A;  3DEX A;  2VD1 A;  3GFK A;  1YQ1 A;  4IJI A;  5D9X A;  4MZB A;  3LQ7 A;  5IO0 A;  5INY A;  1VF4 A;  3GX0 A;  3FZ5 A;  3CBU A;  3IDV A;  2IFQ A;  5GAN D;  4MPF A;  1SKS B;  5EL8 A;  2LKU A;  4XRA A;  4MLY A;  1LU4 A;  4IHU A;  1VGL A;  1J08 A;  1BYE A;  3GIX A;  5IOX A;  5GSS A;  1GTU A;  9GSS A;  1XPV A;  4DEJ A;  2H6Y A;  1XW6 A;  3I6A A;  5JCG A;  1FB6 A;  4Z7X A;  2B5Y A;  4K1F A;  5FHI A;  3DVX A;  4TRX A;  4KE3 A;  4IQ1 A;  2H76 A;  3ERW A;  3EWL A;  4NHW A;  4J2F A;  1A23 A;  3PPU A;  1PN9 A;  1PQN A;  1BAY A;  1GSD A;  3FRC A;  4G0L A;  3EVI A;  4LLR A;  3GV1 A;  3Q74 A;  2WJU A;  1K3O A;  1WP0 A;  5D9W A;  1E2Y A;  1Z7P A;  1DBY A;  2FGX A;  1WPI A;  3WT1 A;  4BPY A;  1HD2 A;  1GNW A;  2G2Q A;  4X1U A;  1HNB A;  1XFL A;  2LJR A;  1UA5 A;  4GCI A;  5IMD A;  3BCK A;  5AIX A;  1TI1 A;  5AN1 A;  2I9H A;  4YAV A;  2LJK A;  4YAP A;  1FHE A;  5JCW A;  1HYU A;  3QPM A;  1V98 A;  2LEG A;  4BWS A;  2LNT A;  2C80 A;  1B9X C;  1OE7 A;  1XXU A;  4HS1 A;  3UVH A;  2JSY A;  1XWC A;  3CRU A;  3UAP A;  4XIH A;  1GUH A;  5D93 A;  3GNJ A;  4NMU A;  19GS A;  2VCT A;  1NSW A;  4O7H A;  4DSQ A;  2ZUP A;  3ERF A;  4Q5F A;  3IXR A;  5DQY A;  1V57 A;  3FW2 A;  2CVK A;  3APQ A;  3GA4 A;  2OAC A;  3EIN A;  3ME7 A;  1MD3 A;  2PGT A;  3EU3 A;  3KD0 A;  4XS4 B;  4HDE A;  2HNL A;  2FD3 A;  3DIE A;  3EUR A;  3G7Y A;  4K7O A;  3US3 A;  2O89 A;  2ZCT A;  2LV3 A;  5JWR B;  2WDU A;  2CQ9 A;  4N0Z A;  3GH6 A;  1PL1 A;  2KP1 A;  2HSN B;  2IIY A;  1N2A A;  3BOA A;  3GKM A;  3L0H A;  2OE3 A;  3F6D A;  1U3I A;  4BVX A;  4ZB8 A;  1SJI A;  2FA8 A;  2PVO C;  3FKF A;  1W4V A;  5AIS A;  3IPZ A;  2H6Z A;  2PWJ A;  4KND A;  1R5A A;  4F03 A;  1EEJ A;  2HI7 A;  4MPG A;  2M46 A;  4YQU A;  2AB6 A;  2ON5 A;  2VLU A;  3ZYW A;  2C8U A;  2FWG A;  1RK4 A;  1QMV A;  3O6T A;  5A4V A;  3TKQ A;  5ECS A;  3CSH A;  2ES7 A;  3KP8 A;  1M2A A;  3VLN A;  2GZZ A;  5B8A A;  1KEB A;  3UIW A;  5HR3 A;  3KP9 A;  2JL4 A;  3LG6 A;  2OAD A;  1EV9 A;  1TRV A;  5J9B A;  4GQC A;  2LUS A;  3C1S A;  4QQ7 A;  1QUW A;  1X5E A;  3MAK A;  4ECB A;  3WGE A;  4K7I A;  3LXZ A;  1S3A A;  3BCI A;  2VOC A;  4ML6 A;  5ECL B;  2CT6 A;  2KP2 A;  2CX4 A;  4F9Z A;  2LRC A;  2C3N A;  1DE1 A;  4CHS A;  2IFQ B;  3TGZ A;  4ZBB A;  1EOH A;  3RBT A;  2JZR A;  1OVN A;  3TRQ A;  2GTU A;  3KXO A;  2YNX A;  3UBL A;  2NBS A;  2HRN A;  4JR4 A;  5DBQ A;  1CQH A;  4LMW A;  1SYR A;  2CAQ A;  2YOI A;  3LYP A;  1PKW A;  4EDZ A;  2LJA A;  2VCZ A;  3ZVJ D;  4G19 A;  4PUA A;  5DAK A;  2B7K A;  1XWB A;  3R2Q A;  2B3S A;  3LSZ A;  4MF5 A;  4KDY A;  2PPT A;  3A5W A;  1A2M A;  1H75 A;  2C0F A;  1F37 A;  2A4V A;  1ERW A;  1Z7R A;  3R3E A;  1SJZ A;  4AJ8 A;  3G7I A;  4TN8 A;  1ZMA A;  4NWY A;  2YJH A;  3I43 A;  2X99 A;  2N5F A;  2E7P A;  4ZIJ A;  6GSV A;  4I6X A;  2ZNM A;  3HJO A;  4ZL8 A;  4FYB A;  1V40 A;  2IWT A;  4I97 A;  2QC7 A;  4V2L A;  4WR5 A;  1ZL9 A;  2L57 A;  2HRK A;  5CO3 A;  4G10 A;  4ZB6 A;  1JHB A;  4GRF A;  4FYU A;  2RII A;  3IV4 A;  3GN3 A;  4IP1 A;  1YEX A;  2YZH A;  3M9K A;  3TOT A;  4POK A;  1JLV A;  2F3M A;  2VCX A;  2L6D A;  5KN3 A;  1EGR A;  4MMM A;  2OA7 A;  2WS2 A;  1QFN A;  2F8A A;  4GST A;  3CMI A;  4MAB A;  4IKH A;  3MWH A;  4BL7 A;  2XC2 A;  1H4O A;  4G9H A;  1SK0 A;  2CZ2 A;  4JE1 A;  1MTC A;  2GST A;  2LS5 A;  1TDI A;  5DAL A;  5ECR B;  3PR8 A;  3D6I A;  4POL A;  2PER A;  3KM6 A;  3IAM 2;  3TRP A;  4N11 A;  3HZ4 A;  5J4U A;  3M0F A;  2F8F A;  1SJ6 A;  5E4W A;  1SKW B;  2B5E A;  3QAG A;  2K18 A;  5DJM A;  4L5O A;  2FY6 A;  2O85 A;  4KB3 A;  2FUG 2;  2LRN A;  3F4S A;  1PD2 1;  1LBK A;  3J7Y k;  4QL7 A;  3RPN A;  1BQ7 A;  3TKP A;  2EIO A;  3CRT A;  3F8U A;  3Q18 A;  4PGT A;  1O85 A;  3KIJ A;  1GL8 A;  3LEF A;  2GLR A;  4WR4 A;  4TR3 A;  4I8B A;  4JR6 A;  2V1M A;  3GHA A;  2DIY A;  1EEM A;  1V58 A;  3VPT A;  1OAZ A;  2YN1 A;  2O7K A;  4LA1 A;  4MA9 A;  2N5B A;  3BBY A;  4MF6 A;  2H01 A;  5KEJ A;  5DCG A;  3OR5 A;  4GWR A;  2I4A A;  1SK2 A;  2MZC A;  4XRD A;  3ZIV A;  2C3T A;  1S3D A;  1I5G A;  5IOW A;  4HU9 A;  4O5R A;  2V41 A;  4TXO A;  3D4M A;  5AIV A;  4KGI A;  3ZVJ A;  2VL9 A;  3W8J A;  1RQM A;  2NDO A;  2K8V A;  3GKX A;  1SL0 B;  2DJJ A;  4V1A p;  4QL9 A;  2XBI A;  4PNF A;  1VF3 A;  1SU9 A;  1X0R A;  3DD3 A;  2OBI A;  4WXT A;  3ZMK A;  1JZD A;  3UVT A;  3HJM A;  4GLT A;  3F6F A;  3TJF A;  3CXG A;  1M99 A;  5IPH A;  4V2N A;  3GYK A;  2H19 A;  4K7N A;  4N10 A;  2FNO A;  5EVO A;  5J9C A;  4KSM A;  2BTO T;  1GSE A;  2K9F A;  4TR4 A;  2RM6 A;  2DJ1 A;  4P3Y B;  3A2W A;  4ULX A;  2R3X A;  2H1B A;  2GQL A;  3J7Y b;  4XS6 A;  5G5E A;  3LYK A;  1YEP A;  1ILO A;  4HJ2 A;  3ZZX A;  4KCE A;  5G1K A;  1Q98 A;  1X9S B;  1SYX A;  1TRU A;  5CP1 A;  1TP9 A;  1DUG A;  2KOK A;  3O3T A;  2R5G A;  2WUL A;  1MDJ A;  2PVQ A;  3HVS A;  4NXI A;  2GSS A;  4G0I A;  4K8M A;  2H30 A;  3KTL A;  4ZBD A;  2AAW A;  2MMZ A;  5DAK B;  4X0X A;  1AIU A;  3DML A;  1A24 A;  1EV4 A;  2N5A A;  3CTG A;  2LTK A;  3TKS C;  1KTE A;  3VWU A;  1GWC A;  2HZE A;  1TXX A;  3LJR A;  3EE2 A;  3GST A;  5H5R A;  3FR3 A;  4J56 E;  2OKA A;  2H72 A;  2B1K A;  5DDL A;  3EMX A;  2BJX A;  4HU7 A;  3VI5 A;  3D5J A;  2VCW A;  2CVD A;  2CZ3 A;  5DJL A;  2J23 A;  2R37 A;  2RUF A;  5EY6 A;  3N5O A;  5CRH A;  4BA7 A;  2H6X A;  4Q5Q A;  1Z3E A;  3ZL5 A;  4WBJ A;  2HRA A;  2KHP A;  2R6K A;  3H79 A;  1B9Y C;  3GRX A;  3H93 A;  3JCM L;  1ZCP A;  4TR1 A;  4NHZ A;  4BL7 B;  1QGV A;  1YKC A;  1A2J A;  5DAL B;  4K0N A;  3MNG A;  2B6M A;  1YKA A;  2K6V A;  4EC0 A;  3HCZ A;  3C73 A;  4EDY A;  2YWM A;  1FOV A;  3VFI A;  1OE8 A;  1JZW A;  3Q19 A;  3D0Z A;  2JAC A;  4MCU A;  3G7J A;  3HVV A;  3I69 A;  4HJM A;  1TTZ A;  4JRR A;  5LCZ A;  14GS A;  3TJB A;  4IP6 A;  4PNG A;  4OFT A;  3HHV A;  4OFN A;  5IMV A;  1GRX A;  5ECO B;  2DLX A;  4J57 E;  1M9B A;  5IMF A;  2WRT A;  2KUC A;  1FAA A;  2C0D A;  5IPG A;  2DJ2 A;  3H8Q A;  3TJJ A;  5J3R A;  1T00 A;  2IME A;  3CYN A;  5LD0 A;  2LNS A;  4NPB A;  1XCC A;  4DSS A;  5HR2 A;  1MDK A;  5D9V A;  1HNC A;  4KUN A;  4IN0 A;  1ML6 A;  2E0Q A;  3TRX A;  2B5X A;  1SL2 B;  4WET A;  1AQX A;  3P90 A;  1T4Y A;  1AAZ A;  1K3Y A;  2L6C A;  2NVL A;  2NTO A;  4USS A;  2YWI A;  1XBS A;  4EF0 A;  4TXO B;  3SBC A;  2DIZ A;  2IMD A;  5HR1 A;  2P5R A;  2VD0 A;  1NW2 A;  4IQA A;  3PGT A;  4E8H A;  1Z5Y E;  5GAP D;  1RW1 A;  2VUP A;  5B6M A;  3WYW A;  2HFD A;  2YCD A;  1FW1 A;  3IE3 A;  4KW6 A;  5L71 A;  6GSU A;  5ECI B;  1ACV A;  3F4R A;  4RI6 A;  3D4T A;  3TB2 A;  3TJG A;  2H71 A;  3HD5 A;  6GST A;  4IGJ A;  3C71 A;  1B4P A;  5G5F A;  1EP8 A;  2FLS A;  3Q6O A;  1ZYE A;  2VO4 A;  4OMV A;  2VCV A;  3VUR A;  1XZO A;  5IO2 A;  3QCP A;  5CNW A;  4IBP A;  1KNG A;  2KLX A;  4XTS A;  1TK5 B;  4YQV A;  4ZIL A;  5FWG A;  2X8G A;  2CVB A;  3HJP A;  1E6B A;  2C0E A;  3GTU A;  3G9B A;  2HSM A;  4PQI A;  3F3R A;  4LL4 B;  5ECM B;  4YQM A;  3ZTL A;  4ZBA A;  4F82 A;  5IM9 A;  3GX8 A;  1IYH A;  1HNA A;  1IYI A;  2GT5 A;  5IIZ A;  1M9A A;  1JZR A;  4GTU A;  4I2T A;  1JZO A;  2HYX A;  1YF1 A;  5ECK B;  4RQR A;  4FIW A;  3F0I A;  2UZ8 A;  3KJY A;  4MK3 A;  2VL2 A;  13GS A;  3E9J B;  1B48 A;  3TKS E;  4GSN A;  1SK1 A;  5HFG A;  4HOJ A;  2HZE B;  2HSH A;  2DC5 A;  4IEL A;  2CX3 A;  2HXK A;  4L0W A;  1Z6N A;  17GS A;  1AW9 A;  3V1W A;  3HA9 A;  1O8W A;  4H86 A;  1DE2 A;  5AGY A;  3DKS A;  1J0F A;  3A3T A;  1MD4 A;  5B6N A;  1T1V A;  1UN2 A;  1OC8 A;  4G0K A;  3KGK A;  3FZ9 A;  3FYG A;  4HI7 A;  3CSI A;  3N9J A;  3F63 A;  2DJ0 A;  1KBN A;  4F2I A;  1Y6E A;  5CAX A;  3C1R A;  2IN3 A;  2YWO A;  2EIQ A;  3KZQ A;  11GS A;  1R5P A;  5CRD A;  2YZU A;  2YP6 A;  4HZ2 A;  1GTA A;  3FR6 A;  2DBC A;  2IMI A;  3EYT A;  1MEK A;  2H0I A;  1PL2 A;  2L5O A;  2MBT A;  3IC4 A;  2GZP A;  1OKT A;  4TR1 B;  4IVF A;  1XW9 A;  3TKS A;  5JWO B;  4K0G A;  1ABA A;  5IQY A;  1K0B A;  4ILF A; 
#chains in the Genus database with same CATH topology
 5CRW A;  2I1U A;  4ID0 A;  1Y25 A;  5LNK e;  1PN0 A;  4GQF A;  12GS A;  1Q4J A;  2R4V A;  1OYJ A;  5KOW A;  5F06 A;  1PRX A;  4KAE A;  1VRS D;  5FT3 A;  2I3Y A;  4WEY A;  1X5D A;  3MDK A;  5KN1 A;  4EUY A;  4CY6 A;  1EOG A;  1XG8 A;  3WT2 A;  5A5K A;  2JZS A;  2OE0 A;  4EIP A;  4CW9 A;  2WW1 A;  4NV2 A;  1XOB A;  2VM1 A;  3ZIJ A;  5ECQ B;  3BJ5 A;  4AF2 A;  5CRG A;  1S3R A;  1X9M B;  2RUE A;  1TW9 A;  4FQU A;  3ZIT A;  2Z9S A;  1NHO A;  3RHB A;  3QAV A;  2MMA A;  1BED A;  3UJ1 A;  3L4N A;  5KOX A;  4Z2T A;  2F51 A;  2AJQ B;  3KEB A;  3LOR A;  2ON7 A;  1B4Q A;  2GS3 A;  2HRF A;  3CHX C;  1PMT A;  3PIN A;  5HR0 A;  3MYD A;  3D21 A;  3L9V A;  2L4Q A;  2YJ7 A;  2AUV A;  1I1I P;  3GUR A;  3CWG A;  1FVK A;  4MP4 A;  4K5S A;  3DXB A;  1N8J A;  2A4H A;  3BD2 A;  1GSQ A;  5D73 A;  3IBH A;  2JAD A;  2H1A A;  1VF2 A;  4JBB A;  5G2Z A;  1F6M C;  1GLP A;  4E68 A;  4BVX B;  3H4K A;  2PN8 A;  4F0C A;  4ZB9 A;  2CA8 A;  2MMO A;  1XOA A;  1M2D A;  4N30 A;  2L4C A;  1X9W B;  3RAZ A;  1SD8 A;  2C0G A;  1WE0 A;  4MDC A;  2GGT A;  4HUA A;  5A5H A;  4ZL7 A;  1UVZ A;  4MF7 A;  4OCE A;  3HY2 A;  3NOF A;  1PSQ A;  20GS A;  5HFK A;  2LRT A;  3F9U A;  1GUK A;  1PKZ A;  4TW5 A;  5KN0 A;  5G1L A;  2A2S A;  2V6O A;  3IRA A;  2CAI A;  2R2J A;  3S9F A;  2YWN A;  4IS0 A;  4JED A;  2R0P A;  5ID2 A;  4XS1 A;  3IOS A;  3ED3 A;  16GS A;  2WGR A;  1PX7 A;  2GQK A;  2H74 A;  1EGO A;  3CSJ A;  4AJ6 A;  3FK8 A;  3GTU B;  2HSM B;  1ERU A;  3FR9 A;  1AQV A;  1ON4 A;  2HQT A;  1NHY A;  4BVY A;  1TRW A;  5A1N B;  1K0M A;  3MSZ A;  1Z6M A;  2REM A;  4PQ1 A;  5EPF A;  1TK0 B;  1WIK A;  2VL3 A;  2WB9 A;  2B1L A;  4QMK A;  1W89 A;  4L5L A;  3UAR A;  2LQO A;  4N0V A;  3TCO A;  2YAN A;  1WOU A;  4Q5R A;  3A2X A;  2DJ3 A;  2QSI A;  2VAF A;  3K8N A;  2DKH A;  1GUM A;  1T7P B;  3L9U A;  5ECN B;  5G30 A;  1K0A A;  1SVM A;  4I5Q A;  4TXV A;  4F0B A;  3GL3 A;  1TJD A;  3FEU A;  1LJR A;  3RGB C;  3WGX A;  2H8L A;  1M0U A;  2OE1 A;  4KH7 A;  4GDF A;  3IR4 A;  1V2A A;  3ZFB A;  5C04 A;  3TDG A;  5ELA A;  3RFR C;  1ZZY A;  2XPE A;  2RM5 A;  4WF5 A;  4AKX B;  4HZ4 A;  4MH3 A;  1ERT A;  5F0G A;  4POM A;  5CRE A;  4G2E A;  1K3L A;  4DSR A;  5GZZ B;  4AGS A;  2H73 A;  4MZW A;  1FG4 A;  3GL5 A;  2IJY A;  2EFC A;  3RHC A;  2P0G A;  1G7E A;  4YH2 A;  2PMT A;  1O7U A;  2HE3 A;  2HRK B;  5J41 A;  3UMA A;  5B8B A;  22GS A;  3NIV A;  5A4W A;  3O76 A;  1S3C A;  1XVQ A;  3U6V A;  2TRX A;  1B8X A;  2MBS A;  4AJ7 A;  3IHG A;  4WBR D;  2X64 A;  2ALB A;  2BMX A;  4D73 A;  3TOU A;  2PBJ A;  1ZGN A;  2H70 A;  2GVP A;  1O81 A;  2MMN A;  3CQF A;  3WD6 A;  1V9W A;  5B7C A;  4KCA A;  3QFB C;  2WW0 A;  1NM3 A;  3EPT A;  2XHF A;  4FH8 A;  4EL1 A;  1M7T A;  1SD9 A;  2H1G A;  3HVX A;  4PX1 A;  2GZY A;  4Z2U A;  1O6J A;  2J9H A;  3KCM A;  1ST9 A;  5JWQ B;  1M2B A;  3SWL A;  2FWH A;  4K9Z A;  2LST A;  3QD9 A;  4ZB7 A;  3HKR A;  4LL1 B;  1F3A A;  4RUV A;  3QMX A;  4ECI A;  4FYC A;  2VLT A;  1ZOF A;  3EMP A;  3KH9 A;  1AC1 A;  1A0F A;  3M3M A;  1PA3 A;  1TRS A;  1GUL A;  1K0N A;  4E8E A;  2H66 A;  3ME8 A;  4KF9 A;  1YF0 A;  2X8C A;  3IK7 A;  4MJC A;  1R26 A;  1OC9 A;  3FZA A;  5F8B A;  3VK9 A;  1VF1 A;  4GSS A;  6GSS A;  3F4T A;  1GSS A;  3QR6 A;  3NZN A;  3VI7 A;  4ECC A;  1FB0 A;  1PX6 A;  2TIR A;  3RDW A;  1K0D A;  1TI3 A;  3GSS A;  3I9V 2;  4EE0 A;  2H0G A;  3KH7 A;  5ABR A;  1TU8 A;  1EWX A;  5DVB A;  4HQS A;  1QXH A;  2HZF A;  1SEN A;  2H75 A;  4V2M A;  4MH2 A;  2VM2 A;  1G6W A;  2OBK A;  4OWY A;  3APS A;  2CV4 A;  2O5V A;  5ID2 B;  2X8H A;  5DQS A;  3KTB A;  2TRC P;  4ISD A;  5ENU A;  3F3Q A;  1A8L A;  4CDO A;  2E2M A;  4AI6 A;  5BMU A;  1SKR B;  3DRN A;  1WRY A;  4YKF A;  2EFE A;  1ERV A;  3E3E A;  3HMJ G;  4Q5N A;  3TJK A;  4BVY B;  4XCS A;  5G31 A;  5HFI A;  1FO5 A;  2DMM A;  1MDI A;  3HYP A;  1A2L A;  1XVW A;  3HDC A;  2YV7 A;  2VLV A;  3LWA A;  6GSW A;  4JU5 A;  3ZRE A;  3EC3 A;  4IJ3 A;  4POB A;  4LMV A;  2IPA A;  4BWQ A;  2K8S A;  3QDN A;  1THO A;  3EU4 A;  3P7X A;  1Z9H A;  3M1G A;  3IAS 2;  5J47 A;  1WWJ A;  2M80 A;  4PI0 C;  2PUK C;  1JLW A;  1GP1 A;  2VKZ G;  2L5L A;  5ELG A;  3UEM A;  2WZ9 A;  2FWE A;  4GXZ A;  4ZL9 A;  2O36 A;  3VWV A;  2HT9 A;  1BX9 A;  2E2G A;  2C3Q A;  1U88 A;  4O5U A;  4XHM A;  3DYR A;  3AY8 A;  4KDU A;  2AV4 A;  2VCQ A;  1I9D A;  1K0C A;  4NAX A;  3UBK A;  3U5R E;  1O73 A;  2GSQ A;  3HXS A;  3C8E A;  1AQW A;  1GTB A;  3ZML A;  1F2E A;  3TUE A;  1THX A;  2YV9 A;  3M8N A;  4KDX A;  1N25 A;  1WMJ A;  3D22 A;  2IL3 A;  1GSU A;  2EC4 A;  2WW2 A;  2YPM A;  2GT6 A;  5D8I A;  2B7J A;  3QOU A;  2JZT A;  5HQP A;  2A2R A;  5IMC A;  1QK8 A;  3M9J A;  2X49 A;  5ECP B;  4GF0 A;  2C4J A;  4WF4 A;  4D73 B;  4Z2R A;  1BJX A;  1Y1U A;  1UC7 A;  2V2G A;  1ZYN A;  4OO5 A;  3ZRD A;  2GSR A;  10GS A;  1CQG A;  3QAW A;  3DGQ A;  5IMA A;  1GNE A;  1G6Y A;  4HEA 2;  2R0C A;  5F07 A;  4ACS A;  1AXD A;  2GQM A;  1OC3 A;  2RLI A;  3LGC A;  8GSS A;  4V1A g;  4WKW A;  3TKR A;  1YJ6 A;  2H1D A;  4FO5 A;  5BRT A;  2OJL A;  2V6K A;  2L59 A;  4OD7 A;  4L8E A;  1K0O A;  1DSB A;  1TOF A;  4PUF C;  1YY7 A;  5D9T A;  5COH A;  1U6T A;  5J5N A;  1TU7 A;  4PTS A;  4AKG A;  2EIR A;  1YZX A;  1X5C A;  6GSY A;  3L78 A;  2FA4 A;  4RQX A;  5CYY A;  4TKY A;  3HZ8 A;  1U87 A;  3IA1 A;  2O8V B;  4I2U A;  2O87 A;  3FMW A;  4DSS B;  1ZYQ B;  3W8S A;  2GDR A;  3ERG A;  7GSS A;  2PU9 C;  2WFC A;  2AYT A;  3LFL A;  4KA0 A;  5H5S A;  3GMF A;  4EXJ A;  5C00 A;  4PQH A;  2IMF A;  5GST A;  2I81 A;  3MIX A;  1QQ2 A;  1TKD B;  1T4Z A;  4OCF A;  4JZQ A;  1OC9 B;  3VWW A;  1G0T A;  3PH9 A;  4MJB A;  4OFM A;  1F9M A;  5KN2 A;  1T8E B;  5JCU A;  1YDK A;  2QGV A;  4OO4 A;  3FY7 A;  3UL3 A;  1SL1 B;  3A2V A;  3P8W A;  4KX4 A;  4O32 A;  3ZLP A;  1XIY A;  4ECJ A;  3IC8 A;  3APO A;  3H1N A;  5ECH B;  4O5Q A;  1G7O A;  5A34 A;  2XBQ A;  4TR0 A;  5IMZ A;  1GLQ A;  2P31 A;  2HLS A;  18GS A;  4EKZ A;  1USB A;  2C1Y A;  3CTF A;  3FHK A;  1EZK A;  3IHQ A;  4PUR A;  2WCI A;  3DVW A;  2DML A;  3FZ4 A;  2FHE A;  2JU5 A;  3GH9 A;  4CY8 A;  4XS4 A;  5BMU B;  3VWX A;  2FCH A;  3P2A A;  1R4W A;  3LXT A;  1URM A;  2DJK A;  2H0H A;  5E59 A;  2IMK A;  5DCH A;  1XW5 A;  2NPB A;  4MJA A;  2LQQ A;  4ML1 A;  1F3B A;  4HQZ A;  2M72 A;  2HSN A;  3RPP A;  3VPQ A;  1OKD A;  3L9S A;  1R7H A;  1AUC A;  1XWK A;  5F05 A;  3ISO A;  1O8X A;  6GSX A;  3ZFL A;  2FWF A;  4O92 A;  3DWV A;  3UOM A;  1EP7 A;  4DVC A;  4TVE A;  4IW9 A;  4ZXG A;  3KMN A;  2DSA A;  1A0R P;  4TOP A;  2V32 A;  2D2Z A;  2VL2 C;  1C72 A;  4NV5 A;  2HSY A;  4K2D A;  3IK9 A;  4X43 A;  4MZC A;  2G0F A;  2F9S A;  1PGT A;  1JFU A;  2AHE A;  1TK8 B;  3GUS A;  1WJK A;  1U3A A;  2VIM A;  3C7M A;  2QKE A;  3GKK A;  1S4B P;  4PXO A;  1GSY A;  2XPD A;  3LW9 A;  1GH2 A;  4KSO A;  1GSF A;  5D96 A;  3WGD A;  3E0U A;  1GTI A;  3GKN A;  2MYG A;  1T3B A;  3KMO A;  1J9B A;  2JSZ A;  1A8Y A;  4RI7 A;  3QFA C;  1HQO A;  5H5Q A;  1BG5 A;  4K6X A;  4AKH A;  3W6G A;  4K5R A;  4MJE A;  1XWG A;  2P5Q A;  4L0U A;  5A4U A;  1FVJ A;  4EO3 A;  4EVM A;  1XWA A;  3DEX A;  2VD1 A;  3GFK A;  1YQ1 A;  4IJI A;  5D9X A;  4MZB A;  3LQ7 A;  5IO0 A;  5INY A;  1VF4 A;  3GX0 A;  3FZ5 A;  3CBU A;  3IDV A;  2IFQ A;  5GAN D;  4MPF A;  1SKS B;  5EL8 A;  2LKU A;  4XRA A;  4MLY A;  5J4Y A;  1LU4 A;  4IHU A;  1VGL A;  1J08 A;  1BYE A;  3GIX A;  5IOX A;  5GSS A;  1GTU A;  9GSS A;  1XPV A;  4DEJ A;  4G01 A;  2H6Y A;  1XW6 A;  3I6A A;  5JCG A;  1FB6 A;  4Z7X A;  2B5Y A;  4K1F A;  5FHI A;  3DVX A;  4TRX A;  4KE3 A;  4IQ1 A;  2H76 A;  3ERW A;  3EWL A;  4NHW A;  4J2F A;  1A23 A;  3PPU A;  1PN9 A;  1PQN A;  1BAY A;  1GSD A;  3FRC A;  4G0L A;  3EVI A;  4LLR A;  3GV1 A;  3Q74 A;  2WJU A;  2DKI A;  1K3O A;  1WP0 A;  5D9W A;  1E2Y A;  1Z7P A;  1DBY A;  2FGX A;  1WPI A;  3WT1 A;  4BPY A;  1HD2 A;  1GNW A;  2G2Q A;  4X1U A;  1HNB A;  4AKI A;  2WVX A;  1XFL A;  2LJR A;  1UA5 A;  4GCI A;  5IMD A;  3BCK A;  5AIX A;  1TI1 A;  5AN1 A;  2I9H A;  4YAV A;  4HSC X;  2LJK A;  4YAP A;  1FHE A;  5JCW A;  1HYU A;  4YKG A;  3QPM A;  1V98 A;  2LEG A;  4BWS A;  2LNT A;  2C80 A;  1B9X C;  1OE7 A;  1XXU A;  4HS1 A;  3UVH A;  2JSY A;  1XWC A;  3CRU A;  3UAP A;  4XIH A;  1GUH A;  5D93 A;  3GNJ A;  4NMU A;  19GS A;  5A34 B;  2VCT A;  1YVL A;  4O7H A;  1NSW A;  4DSQ A;  2ZUP A;  3ERF A;  4Q5F A;  3IXR A;  5DQY A;  1V57 A;  4PI2 C;  3FW2 A;  2CVK A;  3APQ A;  3GA4 A;  2OAC A;  3EIN A;  5A5H B;  3ME7 A;  1MD3 A;  2PGT A;  3EU3 A;  3KD0 A;  4XS4 B;  4HDE A;  2HNL A;  2FD3 A;  3DIE A;  3EUR A;  3G7Y A;  4K7O A;  3US3 A;  2O89 A;  2ZCT A;  2LV3 A;  5JWR B;  2WDU A;  2CQ9 A;  4N0Z A;  3GH6 A;  1PL1 A;  2KP1 A;  2HSN B;  2IIY A;  1N2A A;  3BOA A;  3GKM A;  3L0H A;  2OE3 A;  3F6D A;  1U3I A;  4BVX A;  4ZB8 A;  1SJI A;  2FA8 A;  2PVO C;  3FKF A;  1W4V A;  5AIS A;  3IPZ A;  2H6Z A;  2PWJ A;  3A5I A;  4KND A;  1R5A A;  4F03 A;  1EEJ A;  2HI7 A;  4MPG A;  2M46 A;  4YQU A;  1M3I A;  2AB6 A;  2ON5 A;  2VLU A;  3ZYW A;  2C8U A;  2FWG A;  1RK4 A;  1QMV A;  3O6T A;  5A4V A;  3TKQ A;  5ECS A;  3CSH A;  2ES7 A;  2A2P A;  3KP8 A;  1M2A A;  2H1L A;  3VLN A;  2GZZ A;  5B8A A;  1KEB A;  3UIW A;  5HR3 A;  3KP9 A;  2JL4 A;  3LG6 A;  2OAD A;  1EV9 A;  1TRV A;  5J9B A;  4GQC A;  2LUS A;  3C1S A;  4QQ7 A;  1QUW A;  1X5E A;  3MAK A;  4ECB A;  3WGE A;  4K7I A;  3LXZ A;  1S3A A;  3BCI A;  2VOC A;  4ML6 A;  2R0G A;  5ECL B;  2CT6 A;  2KP2 A;  2CX4 A;  4F9Z A;  2LRC A;  2C3N A;  1DE1 A;  4CHS A;  2IFQ B;  3TGZ A;  4ZBB A;  1EOH A;  3RBT A;  2WW3 A;  2JZR A;  1OVN A;  4X4J A;  2GTU A;  3KXO A;  3TRQ A;  2YNX A;  3UBL A;  2NBS A;  2HRN A;  4JR4 A;  5DBQ A;  1CQH A;  4LMW A;  1SYR A;  2CAQ A;  2YOI A;  3LYP A;  1PKW A;  4EDZ A;  2LJA A;  2VCZ A;  3ZVJ D;  4G19 A;  4PUA A;  5DAK A;  2B7K A;  1XWB A;  3R2Q A;  2B3S A;  3LSZ A;  4MF5 A;  4KDY A;  2PPT A;  3A5W A;  1A2M A;  1H75 A;  2C0F A;  1F37 A;  2A4V A;  1ERW A;  1Z7R A;  3R3E A;  1SJZ A;  4AJ8 A;  3G7I A;  4TN8 A;  1ZMA A;  4NWY A;  2WVY A;  2YJH A;  3I43 A;  2X99 A;  2N5F A;  2E7P A;  4ZIJ A;  6GSV A;  4I6X A;  2ZNM A;  3HJO A;  4ZL8 A;  4FYB A;  1V40 A;  2IWT A;  4I97 A;  2QC7 A;  4V2L A;  4WR5 A;  1ZL9 A;  2L57 A;  2HRK A;  5CO3 A;  4G10 A;  4ZB6 A;  1JHB A;  4GRF A;  4FYU A;  2WVX B;  2RII A;  3IV4 A;  3GN3 A;  4IP1 A;  1YEX A;  2YZH A;  3M9K A;  2EFH A;  3TOT A;  4POK A;  2EFD A;  1JLV A;  2F3M A;  2QA1 A;  2VCX A;  2L6D A;  5KN3 A;  1EGR A;  1PFO A;  4MMM A;  2OA7 A;  2WS2 A;  1QFN A;  2F8A A;  4GST A;  3CMI A;  4MAB A;  4IKH A;  1ZYP A;  3MWH A;  4BL7 A;  2XC2 A;  1H4O A;  4G9H A;  1SK0 A;  2CZ2 A;  4JE1 A;  1MTC A;  2GST A;  2LS5 A;  1TDI A;  5DAL A;  5ECR B;  3PR8 A;  3D6I A;  4POL A;  2PER A;  3KM6 A;  3IAM 2;  3TRP A;  4N11 A;  3HZ4 A;  5J4U A;  3M0F A;  2F8F A;  1SJ6 A;  5E4W A;  1SKW B;  2B5E A;  3QAG A;  2K18 A;  5DJM A;  4L5O A;  2FY6 A;  2O85 A;  4KB3 A;  2FUG 2;  2LRN A;  3F4S A;  1PD2 1;  1LBK A;  3J7Y k;  4QL7 A;  3RPN A;  1BQ7 A;  3TKP A;  2EIO A;  3CRT A;  3F8U A;  3Q18 A;  4PGT A;  1O85 A;  1FOH A;  3KIJ A;  1GL8 A;  3LEF A;  2GLR A;  4WR4 A;  4TR3 A;  4I8B A;  4JR6 A;  2V1M A;  3GHA A;  2DIY A;  1EEM A;  1V58 A;  3VPT A;  1OAZ A;  2YN1 A;  2O7K A;  4LA1 A;  4MA9 A;  2N5B A;  3BBY A;  4MF6 A;  2H01 A;  5KEJ A;  5DCG A;  3OR5 A;  4GWR A;  2I4A A;  1SK2 A;  2MZC A;  4XRD A;  3ZIV A;  2C3T A;  1S3D A;  1I5G A;  5IOW A;  4HU9 A;  4O5R A;  2V41 A;  4TXO A;  3D4M A;  5AIV A;  4KGI A;  3ZVJ A;  2VL9 A;  3W8J A;  1RQM A;  2NDO A;  2K8V A;  3GKX A;  1SL0 B;  2DJJ A;  4V1A p;  4QL9 A;  2XBI A;  4PNF A;  1VF3 A;  1SU9 A;  1X0R A;  3DD3 A;  2OBI A;  4WXT A;  3ZMK A;  1JZD A;  3UVT A;  3HJM A;  4GLT A;  3F6F A;  5J4V A;  3TJF A;  3CXG A;  1M99 A;  5IPH A;  2OT3 A;  4V2N A;  3GYK A;  2H19 A;  4K7N A;  4N10 A;  2FNO A;  5EVO A;  5J9C A;  4KSM A;  2BTO T;  1GSE A;  2K9F A;  4TR4 A;  2RM6 A;  2DJ1 A;  4P3Y B;  3A2W A;  4ULX A;  2R3X A;  2H1B A;  2GQL A;  3J7Y b;  4XS6 A;  5G5E A;  3LYK A;  1YEP A;  1ILO A;  4HJ2 A;  3ZZX A;  4KCE A;  5G1K A;  1Q98 A;  1X9S B;  1SYX A;  1TRU A;  5CP1 A;  1TP9 A;  1DUG A;  2KOK A;  1M3J A;  3O3T A;  2R5G A;  2WUL A;  1MDJ A;  2PVQ A;  3HVS A;  4NXI A;  2GSS A;  4G0I A;  4K8M A;  2H30 A;  3KTL A;  4ZBD A;  2AAW A;  2MMZ A;  5DAK B;  4X0X A;  1AIU A;  1YEW C;  3DML A;  4MNN A;  1A24 A;  1EV4 A;  2N5A A;  2X4A A;  3CTG A;  2LTK A;  3TKS C;  1KTE A;  3VWU A;  1GWC A;  2HZE A;  1TXX A;  3LJR A;  3EE2 A;  3GST A;  5H5R A;  3FR3 A;  4J56 E;  2OKA A;  2H72 A;  2B1K A;  5DDL A;  3EMX A;  2BJX A;  4HU7 A;  3VI5 A;  3D5J A;  2VCW A;  2CVD A;  2CZ3 A;  5DJL A;  2J23 A;  2R37 A;  2RUF A;  5EY6 A;  4ICY A;  3N5O A;  5CRH A;  4BA7 A;  2H6X A;  4Q5Q A;  1Z3E A;  3ZL5 A;  4WBJ A;  2HRA A;  2KHP A;  2R6K A;  3H79 A;  1B9Y C;  3GRX A;  3H93 A;  3JCM L;  1ZCP A;  4TR1 A;  4NHZ A;  4BL7 B;  1QGV A;  1YKC A;  1A2J A;  5DAL B;  4K0N A;  3MNG A;  2B6M A;  1YKA A;  2K6V A;  4EC0 A;  4FXY P;  3HCZ A;  3C73 A;  4EDY A;  2YWM A;  1FOV A;  3VFI A;  1OE8 A;  1JZW A;  3Q19 A;  3D0Z A;  2JAC A;  4MCU A;  3G7J A;  3HVV A;  3I69 A;  4HJM A;  1TTZ A;  2O3E A;  4JRR A;  5LCZ A;  14GS A;  2QA2 A;  3TJB A;  4IP6 A;  4PNG A;  4OFT A;  3TU3 B;  4OFN A;  3HHV A;  5IMV A;  1GRX A;  5ECO B;  2DLX A;  4J57 E;  1M9B A;  5IMF A;  2WRT A;  2KUC A;  1FAA A;  2C0D A;  5IPG A;  2DJ2 A;  3H8Q A;  3TJJ A;  5J3R A;  4EIQ A;  1T00 A;  2IME A;  3CYN A;  5LD0 A;  2LNS A;  4NPB A;  1XCC A;  4DSS A;  5HR2 A;  1MDK A;  5D9V A;  1HNC A;  4KUN A;  4IN0 A;  1ML6 A;  2E0Q A;  3TRX A;  2B5X A;  1SL2 B;  4WET A;  1AQX A;  3P90 A;  1T4Y A;  1AAZ A;  1K3Y A;  2L6C A;  3HVN A;  4BIK A;  2NVL A;  2NTO A;  4USS A;  2YWI A;  1XBS A;  4EF0 A;  1BF5 A;  4TXO B;  3SBC A;  2WZS A;  2DIZ A;  2IMD A;  5HR1 A;  2P5R A;  1SVO A;  2VD0 A;  1NW2 A;  4IQA A;  3PGT A;  4E8H A;  1SVL A;  1Z5Y E;  5GAP D;  1RW1 A;  2VUP A;  5B6M A;  3WYW A;  2HFD A;  2YCD A;  1FW1 A;  3IE3 A;  4KW6 A;  5L71 A;  6GSU A;  5ECI B;  1ACV A;  3F4R A;  4RI6 A;  4A5P A;  3D4T A;  3TB2 A;  3TJG A;  2H71 A;  3HD5 A;  6GST A;  4IGJ A;  3C71 A;  1B4P A;  5G5F A;  1EP8 A;  2FLS A;  3Q6O A;  1ZYE A;  2VO4 A;  4OMV A;  2VCV A;  3VUR A;  1XZO A;  5IO2 A;  3QCP A;  5CNW A;  4IBP A;  1KNG A;  2KLX A;  4XTS A;  1TK5 B;  4YQV A;  4ZIL A;  5FWG A;  2X8G A;  2CVB A;  3HJP A;  1E6B A;  2C0E A;  3GTU A;  3G9B A;  2HSM A;  4PQI A;  3F3R A;  4LL4 B;  5ECM B;  4YQM A;  3ZTL A;  4ZBA A;  4F82 A;  5IM9 A;  3GX8 A;  1IYH A;  1HNA A;  1IYI A;  5A1N A;  2GT5 A;  5IIZ A;  1M9A A;  1JZR A;  4N3Z A;  4GTU A;  4W66 A;  4I2T A;  1JZO A;  2HYX A;  1YF1 A;  5ECK B;  4RQR A;  2WVZ A;  4FIW A;  3F0I A;  2UZ8 A;  3KJY A;  4MK3 A;  2VL2 A;  13GS A;  3E9J B;  1B48 A;  3TKS E;  4GSN A;  1SK1 A;  5HFG A;  4HOJ A;  2HZE B;  2HSH A;  2DC5 A;  4IEL A;  2CX3 A;  2HXK A;  4L0W A;  1Z6N A;  17GS A;  1AW9 A;  3V1W A;  3HA9 A;  1O8W A;  4H86 A;  1DE2 A;  5AGY A;  3DKS A;  1J0F A;  3A3T A;  1MD4 A;  5B6N A;  1T1V A;  1UN2 A;  1OC8 A;  4G0K A;  1TXU A;  3KGK A;  3FZ9 A;  3FYG A;  4HI7 A;  3CSI A;  3N9J A;  3F63 A;  2DJ0 A;  4K2X A;  1KBN A;  4F2I A;  1Y6E A;  5CAX A;  3C1R A;  2IN3 A;  2YWO A;  2EIQ A;  3KZQ A;  4PHZ C;  11GS A;  1R5P A;  5J40 A;  5CRD A;  2YZU A;  2YP6 A;  4HZ2 A;  1GTA A;  3FR6 A;  2DBC A;  2IMI A;  3EYT A;  1MEK A;  2H0I A;  2UV8 G;  1PL2 A;  2L5O A;  2MBT A;  3IC4 A;  2GZP A;  1OKT A;  4TR1 B;  4IVF A;  1XW9 A;  3TKS A;  5JWO B;  4K0G A;  1BG1 A;  1ABA A;  5IQY A;  1K0B A;  4ILF A; 
#chains in the Genus database with same CATH homology
 5CRW A;  2I1U A;  4ID0 A;  1Y25 A;  5LNK e;  1PN0 A;  4GQF A;  12GS A;  1Q4J A;  2R4V A;  1OYJ A;  5KOW A;  5F06 A;  1PRX A;  4KAE A;  1VRS D;  5FT3 A;  2I3Y A;  4WEY A;  1X5D A;  3MDK A;  5KN1 A;  4EUY A;  4CY6 A;  1EOG A;  3WT2 A;  5A5K A;  2JZS A;  2OE0 A;  4EIP A;  4CW9 A;  4NV2 A;  1XOB A;  2VM1 A;  3ZIJ A;  5ECQ B;  3BJ5 A;  4AF2 A;  5CRG A;  1X9M B;  2RUE A;  1TW9 A;  4FQU A;  3ZIT A;  2Z9S A;  1NHO A;  3RHB A;  3QAV A;  2MMA A;  1BED A;  3UJ1 A;  3L4N A;  5KOX A;  4Z2T A;  2F51 A;  2AJQ B;  3KEB A;  3LOR A;  2ON7 A;  1B4Q A;  2GS3 A;  2HRF A;  1PMT A;  3PIN A;  5HR0 A;  3MYD A;  3D21 A;  3L9V A;  2L4Q A;  2YJ7 A;  2AUV A;  3GUR A;  3CWG A;  1FVK A;  4MP4 A;  4K5S A;  3DXB A;  1N8J A;  2A4H A;  3BD2 A;  1GSQ A;  5D73 A;  3IBH A;  2JAD A;  2H1A A;  1VF2 A;  4JBB A;  5G2Z A;  1F6M C;  1GLP A;  4E68 A;  4BVX B;  3H4K A;  2PN8 A;  4F0C A;  4ZB9 A;  2CA8 A;  2MMO A;  1XOA A;  1M2D A;  4N30 A;  2L4C A;  1X9W B;  3RAZ A;  1SD8 A;  2C0G A;  1WE0 A;  4MDC A;  2GGT A;  4HUA A;  5A5H A;  4ZL7 A;  1UVZ A;  4MF7 A;  4OCE A;  3HY2 A;  3NOF A;  1PSQ A;  20GS A;  5HFK A;  2LRT A;  3F9U A;  1GUK A;  1PKZ A;  4TW5 A;  5KN0 A;  5G1L A;  2A2S A;  2V6O A;  3IRA A;  2CAI A;  2R2J A;  3S9F A;  2YWN A;  4IS0 A;  4JED A;  2R0P A;  5ID2 A;  4XS1 A;  3IOS A;  3ED3 A;  16GS A;  2WGR A;  1PX7 A;  2GQK A;  2H74 A;  1EGO A;  3CSJ A;  4AJ6 A;  3FK8 A;  3GTU B;  2HSM B;  1ERU A;  3FR9 A;  1AQV A;  1ON4 A;  2HQT A;  1NHY A;  4BVY A;  1TRW A;  5A1N B;  1K0M A;  3MSZ A;  1Z6M A;  2REM A;  4PQ1 A;  5EPF A;  1TK0 B;  1WIK A;  2VL3 A;  2WB9 A;  2B1L A;  4QMK A;  1W89 A;  4L5L A;  3UAR A;  2LQO A;  4N0V A;  3TCO A;  2YAN A;  1WOU A;  4Q5R A;  3A2X A;  2DJ3 A;  2QSI A;  2VAF A;  3K8N A;  2DKH A;  1GUM A;  1T7P B;  3L9U A;  5ECN B;  5G30 A;  1K0A A;  1SVM A;  4I5Q A;  4TXV A;  4F0B A;  3GL3 A;  1TJD A;  3FEU A;  1LJR A;  3WGX A;  2H8L A;  1M0U A;  2OE1 A;  4KH7 A;  4GDF A;  3IR4 A;  1V2A A;  3ZFB A;  5C04 A;  3TDG A;  5ELA A;  1ZZY A;  2XPE A;  2RM5 A;  4WF5 A;  4AKX B;  4HZ4 A;  4MH3 A;  1ERT A;  5F0G A;  4POM A;  5CRE A;  4G2E A;  1K3L A;  4DSR A;  5GZZ B;  4AGS A;  2H73 A;  4MZW A;  1FG4 A;  3GL5 A;  2IJY A;  2EFC A;  3RHC A;  2P0G A;  1G7E A;  4YH2 A;  2PMT A;  1O7U A;  2HE3 A;  2HRK B;  5J41 A;  3UMA A;  5B8B A;  22GS A;  3NIV A;  5A4W A;  3O76 A;  1S3C A;  1XVQ A;  3U6V A;  2TRX A;  1B8X A;  2MBS A;  4AJ7 A;  3IHG A;  4WBR D;  2X64 A;  2ALB A;  2BMX A;  4D73 A;  3TOU A;  2PBJ A;  1ZGN A;  2H70 A;  2GVP A;  1O81 A;  2MMN A;  3WD6 A;  1V9W A;  5B7C A;  4KCA A;  3QFB C;  1NM3 A;  3EPT A;  2XHF A;  4FH8 A;  4EL1 A;  1M7T A;  1SD9 A;  2H1G A;  3HVX A;  4PX1 A;  2GZY A;  4Z2U A;  1O6J A;  2J9H A;  3KCM A;  1ST9 A;  5JWQ B;  1M2B A;  3SWL A;  2FWH A;  4K9Z A;  2LST A;  3QD9 A;  4ZB7 A;  3HKR A;  4LL1 B;  1F3A A;  4RUV A;  3QMX A;  4ECI A;  4FYC A;  2VLT A;  1ZOF A;  3EMP A;  3KH9 A;  1AC1 A;  1A0F A;  3M3M A;  1PA3 A;  1TRS A;  1GUL A;  1K0N A;  4E8E A;  2H66 A;  3ME8 A;  4KF9 A;  1YF0 A;  2X8C A;  3IK7 A;  4MJC A;  1R26 A;  1OC9 A;  3FZA A;  5F8B A;  3VK9 A;  1VF1 A;  4GSS A;  6GSS A;  3F4T A;  1GSS A;  3QR6 A;  3NZN A;  3VI7 A;  4ECC A;  1FB0 A;  1PX6 A;  2TIR A;  3RDW A;  1K0D A;  1TI3 A;  3GSS A;  3I9V 2;  4EE0 A;  2H0G A;  3KH7 A;  5ABR A;  1TU8 A;  1EWX A;  5DVB A;  4HQS A;  1QXH A;  2HZF A;  1SEN A;  2H75 A;  4V2M A;  4MH2 A;  2VM2 A;  1G6W A;  2OBK A;  4OWY A;  3APS A;  2CV4 A;  2O5V A;  5ID2 B;  2X8H A;  5DQS A;  3KTB A;  2TRC P;  4ISD A;  5ENU A;  3F3Q A;  1A8L A;  4CDO A;  2E2M A;  4AI6 A;  5BMU A;  1SKR B;  3DRN A;  1WRY A;  4YKF A;  2EFE A;  1ERV A;  3E3E A;  3HMJ G;  4Q5N A;  3TJK A;  4BVY B;  4XCS A;  5G31 A;  5HFI A;  1FO5 A;  2DMM A;  1MDI A;  3HYP A;  1A2L A;  1XVW A;  3HDC A;  2YV7 A;  2VLV A;  3LWA A;  6GSW A;  4JU5 A;  3ZRE A;  3EC3 A;  4IJ3 A;  4POB A;  4LMV A;  2IPA A;  4BWQ A;  2K8S A;  3QDN A;  1THO A;  3EU4 A;  3P7X A;  1Z9H A;  3M1G A;  3IAS 2;  5J47 A;  1WWJ A;  2M80 A;  2PUK C;  1JLW A;  1GP1 A;  2VKZ G;  2L5L A;  5ELG A;  3UEM A;  2WZ9 A;  2FWE A;  4GXZ A;  4ZL9 A;  3VWV A;  2HT9 A;  1BX9 A;  2E2G A;  2C3Q A;  1U88 A;  4O5U A;  4XHM A;  3DYR A;  3AY8 A;  4KDU A;  2AV4 A;  2VCQ A;  1I9D A;  1K0C A;  4NAX A;  3UBK A;  3U5R E;  1O73 A;  2GSQ A;  3HXS A;  3C8E A;  1AQW A;  1GTB A;  3ZML A;  1F2E A;  3TUE A;  1THX A;  2YV9 A;  3M8N A;  4KDX A;  1N25 A;  1WMJ A;  3D22 A;  2IL3 A;  1GSU A;  2EC4 A;  2YPM A;  2GT6 A;  5D8I A;  2B7J A;  3QOU A;  2JZT A;  5HQP A;  2A2R A;  5IMC A;  1QK8 A;  3M9J A;  2X49 A;  5ECP B;  4GF0 A;  2C4J A;  4WF4 A;  4D73 B;  4Z2R A;  1BJX A;  1Y1U A;  1UC7 A;  2V2G A;  1ZYN A;  4OO5 A;  3ZRD A;  2GSR A;  10GS A;  1CQG A;  3QAW A;  3DGQ A;  5IMA A;  1GNE A;  1G6Y A;  4HEA 2;  2R0C A;  5F07 A;  4ACS A;  1AXD A;  2GQM A;  1OC3 A;  2RLI A;  3LGC A;  8GSS A;  4V1A g;  4WKW A;  3TKR A;  1YJ6 A;  2H1D A;  4FO5 A;  5BRT A;  2OJL A;  2V6K A;  2L59 A;  4OD7 A;  4L8E A;  1K0O A;  1DSB A;  1TOF A;  4PUF C;  1YY7 A;  5D9T A;  5COH A;  1U6T A;  5J5N A;  1TU7 A;  4PTS A;  4AKG A;  2EIR A;  1YZX A;  1X5C A;  6GSY A;  3L78 A;  2FA4 A;  4RQX A;  5CYY A;  4TKY A;  3HZ8 A;  1U87 A;  3IA1 A;  2O8V B;  4I2U A;  2O87 A;  3FMW A;  4DSS B;  1ZYQ B;  3W8S A;  2GDR A;  3ERG A;  7GSS A;  2PU9 C;  2WFC A;  2AYT A;  3LFL A;  4KA0 A;  5H5S A;  3GMF A;  4EXJ A;  5C00 A;  4PQH A;  2IMF A;  5GST A;  2I81 A;  3MIX A;  1QQ2 A;  1TKD B;  1T4Z A;  4OCF A;  4JZQ A;  1OC9 B;  3VWW A;  1G0T A;  3PH9 A;  4MJB A;  4OFM A;  1F9M A;  5KN2 A;  1T8E B;  5JCU A;  1YDK A;  2QGV A;  4OO4 A;  3FY7 A;  3UL3 A;  1SL1 B;  3A2V A;  3P8W A;  4KX4 A;  4O32 A;  3ZLP A;  1XIY A;  4ECJ A;  3IC8 A;  3APO A;  3H1N A;  5ECH B;  4O5Q A;  1G7O A;  5A34 A;  2XBQ A;  4TR0 A;  5IMZ A;  1GLQ A;  2P31 A;  2HLS A;  18GS A;  4EKZ A;  1USB A;  2C1Y A;  3CTF A;  3FHK A;  1EZK A;  3IHQ A;  4PUR A;  2WCI A;  3DVW A;  2DML A;  3FZ4 A;  2FHE A;  2JU5 A;  3GH9 A;  4CY8 A;  4XS4 A;  5BMU B;  3VWX A;  2FCH A;  3P2A A;  1R4W A;  3LXT A;  1URM A;  2DJK A;  2H0H A;  5E59 A;  2IMK A;  5DCH A;  1XW5 A;  2NPB A;  4MJA A;  2LQQ A;  4ML1 A;  1F3B A;  4HQZ A;  2M72 A;  2HSN A;  3RPP A;  3VPQ A;  1OKD A;  3L9S A;  1R7H A;  1AUC A;  1XWK A;  5F05 A;  3ISO A;  1O8X A;  6GSX A;  3ZFL A;  2FWF A;  4O92 A;  3DWV A;  3UOM A;  1EP7 A;  4DVC A;  4TVE A;  4IW9 A;  4ZXG A;  3KMN A;  2DSA A;  1A0R P;  4TOP A;  2V32 A;  2D2Z A;  2VL2 C;  1C72 A;  4NV5 A;  2HSY A;  4K2D A;  3IK9 A;  4X43 A;  4MZC A;  2G0F A;  2F9S A;  1PGT A;  1JFU A;  2AHE A;  1TK8 B;  3GUS A;  1WJK A;  1U3A A;  2VIM A;  3C7M A;  2QKE A;  3GKK A;  4PXO A;  1GSY A;  2XPD A;  3LW9 A;  1GH2 A;  4KSO A;  1GSF A;  5D96 A;  3WGD A;  3E0U A;  1GTI A;  3GKN A;  2MYG A;  1T3B A;  3KMO A;  1J9B A;  2JSZ A;  1A8Y A;  4RI7 A;  3QFA C;  1HQO A;  5H5Q A;  1BG5 A;  4K6X A;  4AKH A;  3W6G A;  4K5R A;  4MJE A;  1XWG A;  2P5Q A;  4L0U A;  5A4U A;  1FVJ A;  4EO3 A;  4EVM A;  1XWA A;  3DEX A;  2VD1 A;  3GFK A;  1YQ1 A;  4IJI A;  5D9X A;  4MZB A;  3LQ7 A;  5IO0 A;  5INY A;  1VF4 A;  3GX0 A;  3FZ5 A;  3CBU A;  3IDV A;  2IFQ A;  5GAN D;  4MPF A;  1SKS B;  5EL8 A;  2LKU A;  4XRA A;  4MLY A;  5J4Y A;  1LU4 A;  4IHU A;  1VGL A;  1J08 A;  1BYE A;  3GIX A;  5IOX A;  5GSS A;  1GTU A;  9GSS A;  1XPV A;  4DEJ A;  4G01 A;  2H6Y A;  1XW6 A;  3I6A A;  5JCG A;  1FB6 A;  4Z7X A;  2B5Y A;  4K1F A;  5FHI A;  3DVX A;  4TRX A;  4KE3 A;  4IQ1 A;  2H76 A;  3ERW A;  3EWL A;  4NHW A;  4J2F A;  1A23 A;  3PPU A;  1PN9 A;  1PQN A;  1BAY A;  1GSD A;  3FRC A;  4G0L A;  3EVI A;  4LLR A;  3GV1 A;  3Q74 A;  2WJU A;  2DKI A;  1K3O A;  1WP0 A;  5D9W A;  1E2Y A;  1Z7P A;  1DBY A;  2FGX A;  1WPI A;  3WT1 A;  4BPY A;  1HD2 A;  1GNW A;  2G2Q A;  4X1U A;  1HNB A;  4AKI A;  1XFL A;  2LJR A;  1UA5 A;  4GCI A;  5IMD A;  3BCK A;  5AIX A;  1TI1 A;  5AN1 A;  2I9H A;  4YAV A;  2LJK A;  4YAP A;  1FHE A;  5JCW A;  1HYU A;  4YKG A;  3QPM A;  1V98 A;  2LEG A;  4BWS A;  2LNT A;  2C80 A;  1B9X C;  1OE7 A;  1XXU A;  4HS1 A;  3UVH A;  2JSY A;  1XWC A;  3CRU A;  3UAP A;  4XIH A;  1GUH A;  5D93 A;  3GNJ A;  4NMU A;  19GS A;  5A34 B;  2VCT A;  1YVL A;  4O7H A;  1NSW A;  4DSQ A;  2ZUP A;  3ERF A;  4Q5F A;  3IXR A;  5DQY A;  1V57 A;  3FW2 A;  2CVK A;  3APQ A;  3GA4 A;  2OAC A;  3EIN A;  5A5H B;  3ME7 A;  1MD3 A;  2PGT A;  3EU3 A;  3KD0 A;  4XS4 B;  4HDE A;  2HNL A;  2FD3 A;  3DIE A;  3EUR A;  3G7Y A;  4K7O A;  3US3 A;  2O89 A;  2ZCT A;  2LV3 A;  5JWR B;  2WDU A;  2CQ9 A;  4N0Z A;  3GH6 A;  1PL1 A;  2KP1 A;  2HSN B;  2IIY A;  1N2A A;  3BOA A;  3GKM A;  3L0H A;  2OE3 A;  3F6D A;  1U3I A;  4BVX A;  4ZB8 A;  1SJI A;  2FA8 A;  2PVO C;  3FKF A;  1W4V A;  5AIS A;  3IPZ A;  2H6Z A;  2PWJ A;  3A5I A;  4KND A;  1R5A A;  4F03 A;  1EEJ A;  2HI7 A;  4MPG A;  2M46 A;  4YQU A;  2AB6 A;  2ON5 A;  2VLU A;  3ZYW A;  2C8U A;  2FWG A;  1RK4 A;  1QMV A;  3O6T A;  5A4V A;  3TKQ A;  5ECS A;  3CSH A;  2ES7 A;  2A2P A;  3KP8 A;  1M2A A;  2H1L A;  3VLN A;  2GZZ A;  5B8A A;  1KEB A;  3UIW A;  5HR3 A;  3KP9 A;  2JL4 A;  3LG6 A;  2OAD A;  1EV9 A;  1TRV A;  5J9B A;  4GQC A;  2LUS A;  3C1S A;  4QQ7 A;  1QUW A;  1X5E A;  3MAK A;  4ECB A;  3WGE A;  4K7I A;  3LXZ A;  1S3A A;  3BCI A;  2VOC A;  4ML6 A;  2R0G A;  5ECL B;  2CT6 A;  2KP2 A;  2CX4 A;  4F9Z A;  2LRC A;  2C3N A;  1DE1 A;  4CHS A;  2IFQ B;  3TGZ A;  4ZBB A;  1EOH A;  3RBT A;  2JZR A;  1OVN A;  4X4J A;  2GTU A;  3KXO A;  3TRQ A;  2YNX A;  3UBL A;  2NBS A;  2HRN A;  4JR4 A;  5DBQ A;  1CQH A;  4LMW A;  1SYR A;  2CAQ A;  2YOI A;  3LYP A;  1PKW A;  4EDZ A;  2LJA A;  2VCZ A;  3ZVJ D;  4G19 A;  4PUA A;  5DAK A;  2B7K A;  1XWB A;  3R2Q A;  2B3S A;  3LSZ A;  4MF5 A;  4KDY A;  2PPT A;  3A5W A;  1A2M A;  1H75 A;  2C0F A;  1F37 A;  2A4V A;  1ERW A;  1Z7R A;  3R3E A;  1SJZ A;  4AJ8 A;  3G7I A;  4TN8 A;  1ZMA A;  4NWY A;  2YJH A;  3I43 A;  2X99 A;  2N5F A;  2E7P A;  4ZIJ A;  6GSV A;  4I6X A;  2ZNM A;  3HJO A;  4ZL8 A;  4FYB A;  1V40 A;  2IWT A;  4I97 A;  2QC7 A;  4V2L A;  4WR5 A;  1ZL9 A;  2L57 A;  2HRK A;  5CO3 A;  4G10 A;  4ZB6 A;  1JHB A;  4GRF A;  4FYU A;  2RII A;  3IV4 A;  3GN3 A;  4IP1 A;  1YEX A;  2YZH A;  3M9K A;  2EFH A;  3TOT A;  4POK A;  2EFD A;  1JLV A;  2F3M A;  2QA1 A;  2VCX A;  2L6D A;  5KN3 A;  1EGR A;  4MMM A;  2OA7 A;  2WS2 A;  1QFN A;  2F8A A;  4GST A;  3CMI A;  4MAB A;  4IKH A;  1ZYP A;  3MWH A;  4BL7 A;  2XC2 A;  1H4O A;  4G9H A;  1SK0 A;  2CZ2 A;  4JE1 A;  1MTC A;  2GST A;  2LS5 A;  1TDI A;  5DAL A;  5ECR B;  3PR8 A;  3D6I A;  4POL A;  2PER A;  3KM6 A;  3IAM 2;  3TRP A;  4N11 A;  3HZ4 A;  5J4U A;  3M0F A;  2F8F A;  1SJ6 A;  5E4W A;  1SKW B;  2B5E A;  3QAG A;  2K18 A;  5DJM A;  4L5O A;  2FY6 A;  2O85 A;  4KB3 A;  2FUG 2;  2LRN A;  3F4S A;  1PD2 1;  1LBK A;  3J7Y k;  4QL7 A;  3RPN A;  1BQ7 A;  3TKP A;  2EIO A;  3CRT A;  3F8U A;  3Q18 A;  4PGT A;  1O85 A;  1FOH A;  3KIJ A;  1GL8 A;  3LEF A;  2GLR A;  4WR4 A;  4TR3 A;  4I8B A;  4JR6 A;  2V1M A;  3GHA A;  2DIY A;  1EEM A;  1V58 A;  3VPT A;  1OAZ A;  2YN1 A;  2O7K A;  4LA1 A;  4MA9 A;  2N5B A;  3BBY A;  4MF6 A;  2H01 A;  5KEJ A;  5DCG A;  3OR5 A;  4GWR A;  2I4A A;  1SK2 A;  2MZC A;  4XRD A;  3ZIV A;  2C3T A;  1S3D A;  1I5G A;  5IOW A;  4HU9 A;  4O5R A;  2V41 A;  4TXO A;  3D4M A;  5AIV A;  4KGI A;  3ZVJ A;  2VL9 A;  3W8J A;  1RQM A;  2NDO A;  2K8V A;  3GKX A;  1SL0 B;  2DJJ A;  4V1A p;  4QL9 A;  2XBI A;  4PNF A;  1VF3 A;  1SU9 A;  1X0R A;  3DD3 A;  2OBI A;  4WXT A;  3ZMK A;  1JZD A;  3UVT A;  3HJM A;  4GLT A;  3F6F A;  5J4V A;  3TJF A;  3CXG A;  1M99 A;  5IPH A;  2OT3 A;  4V2N A;  3GYK A;  2H19 A;  4K7N A;  4N10 A;  2FNO A;  5EVO A;  5J9C A;  4KSM A;  2BTO T;  1GSE A;  2K9F A;  4TR4 A;  2RM6 A;  2DJ1 A;  4P3Y B;  3A2W A;  4ULX A;  2R3X A;  2H1B A;  2GQL A;  3J7Y b;  4XS6 A;  5G5E A;  3LYK A;  1YEP A;  1ILO A;  4HJ2 A;  3ZZX A;  4KCE A;  5G1K A;  1Q98 A;  1X9S B;  1SYX A;  1TRU A;  5CP1 A;  1TP9 A;  1DUG A;  2KOK A;  3O3T A;  2R5G A;  2WUL A;  1MDJ A;  2PVQ A;  3HVS A;  4NXI A;  2GSS A;  4G0I A;  4K8M A;  2H30 A;  3KTL A;  4ZBD A;  2AAW A;  2MMZ A;  5DAK B;  4X0X A;  1AIU A;  3DML A;  4MNN A;  1A24 A;  1EV4 A;  2N5A A;  2X4A A;  3CTG A;  2LTK A;  3TKS C;  1KTE A;  3VWU A;  1GWC A;  2HZE A;  1TXX A;  3LJR A;  3EE2 A;  3GST A;  5H5R A;  3FR3 A;  4J56 E;  2OKA A;  2H72 A;  2B1K A;  5DDL A;  3EMX A;  2BJX A;  4HU7 A;  3VI5 A;  3D5J A;  2VCW A;  2CVD A;  2CZ3 A;  5DJL A;  2J23 A;  2R37 A;  2RUF A;  5EY6 A;  4ICY A;  3N5O A;  5CRH A;  4BA7 A;  2H6X A;  4Q5Q A;  1Z3E A;  3ZL5 A;  4WBJ A;  2HRA A;  2KHP A;  2R6K A;  3H79 A;  1B9Y C;  3GRX A;  3H93 A;  3JCM L;  1ZCP A;  4TR1 A;  4NHZ A;  4BL7 B;  1QGV A;  1YKC A;  1A2J A;  5DAL B;  4K0N A;  3MNG A;  2B6M A;  1YKA A;  2K6V A;  4EC0 A;  3HCZ A;  3C73 A;  4EDY A;  2YWM A;  1FOV A;  3VFI A;  1OE8 A;  1JZW A;  3Q19 A;  3D0Z A;  2JAC A;  4MCU A;  3G7J A;  3HVV A;  3I69 A;  4HJM A;  1TTZ A;  4JRR A;  5LCZ A;  14GS A;  2QA2 A;  3TJB A;  4IP6 A;  4PNG A;  4OFT A;  3TU3 B;  4OFN A;  3HHV A;  5IMV A;  1GRX A;  5ECO B;  2DLX A;  4J57 E;  1M9B A;  5IMF A;  2WRT A;  2KUC A;  1FAA A;  2C0D A;  5IPG A;  2DJ2 A;  3H8Q A;  3TJJ A;  5J3R A;  4EIQ A;  1T00 A;  2IME A;  3CYN A;  5LD0 A;  2LNS A;  4NPB A;  1XCC A;  4DSS A;  5HR2 A;  1MDK A;  5D9V A;  1HNC A;  4KUN A;  4IN0 A;  1ML6 A;  2E0Q A;  3TRX A;  2B5X A;  1SL2 B;  4WET A;  1AQX A;  3P90 A;  1T4Y A;  1AAZ A;  1K3Y A;  2L6C A;  2NVL A;  2NTO A;  4USS A;  2YWI A;  1XBS A;  4EF0 A;  1BF5 A;  4TXO B;  3SBC A;  2DIZ A;  2IMD A;  5HR1 A;  2P5R A;  1SVO A;  2VD0 A;  1NW2 A;  4IQA A;  3PGT A;  4E8H A;  1SVL A;  1Z5Y E;  5GAP D;  1RW1 A;  2VUP A;  5B6M A;  3WYW A;  2HFD A;  2YCD A;  1FW1 A;  3IE3 A;  4KW6 A;  5L71 A;  6GSU A;  5ECI B;  1ACV A;  3F4R A;  4RI6 A;  4A5P A;  3D4T A;  3TB2 A;  3TJG A;  2H71 A;  3HD5 A;  6GST A;  4IGJ A;  3C71 A;  1B4P A;  5G5F A;  1EP8 A;  2FLS A;  3Q6O A;  1ZYE A;  2VO4 A;  4OMV A;  2VCV A;  3VUR A;  1XZO A;  5IO2 A;  3QCP A;  5CNW A;  4IBP A;  1KNG A;  2KLX A;  4XTS A;  1TK5 B;  4YQV A;  4ZIL A;  5FWG A;  2X8G A;  2CVB A;  3HJP A;  1E6B A;  2C0E A;  3GTU A;  3G9B A;  2HSM A;  4PQI A;  3F3R A;  4LL4 B;  5ECM B;  4YQM A;  3ZTL A;  4ZBA A;  4F82 A;  5IM9 A;  3GX8 A;  1IYH A;  1HNA A;  1IYI A;  5A1N A;  2GT5 A;  5IIZ A;  1M9A A;  1JZR A;  4N3Z A;  4GTU A;  4W66 A;  4I2T A;  1JZO A;  2HYX A;  1YF1 A;  5ECK B;  4RQR A;  4FIW A;  3F0I A;  2UZ8 A;  3KJY A;  4MK3 A;  2VL2 A;  13GS A;  3E9J B;  1B48 A;  3TKS E;  4GSN A;  1SK1 A;  5HFG A;  4HOJ A;  2HZE B;  2HSH A;  2DC5 A;  4IEL A;  2CX3 A;  2HXK A;  4L0W A;  1Z6N A;  17GS A;  1AW9 A;  3V1W A;  3HA9 A;  1O8W A;  4H86 A;  1DE2 A;  5AGY A;  3DKS A;  1J0F A;  3A3T A;  1MD4 A;  5B6N A;  1T1V A;  1UN2 A;  1OC8 A;  4G0K A;  1TXU A;  3KGK A;  3FZ9 A;  3FYG A;  4HI7 A;  3CSI A;  3N9J A;  3F63 A;  2DJ0 A;  4K2X A;  1KBN A;  4F2I A;  1Y6E A;  5CAX A;  3C1R A;  2IN3 A;  2YWO A;  2EIQ A;  3KZQ A;  11GS A;  1R5P A;  5J40 A;  5CRD A;  2YZU A;  2YP6 A;  4HZ2 A;  1GTA A;  3FR6 A;  2DBC A;  2IMI A;  3EYT A;  1MEK A;  2H0I A;  2UV8 G;  1PL2 A;  2L5O A;  2MBT A;  3IC4 A;  2GZP A;  1OKT A;  4TR1 B;  4IVF A;  1XW9 A;  3TKS A;  5JWO B;  4K0G A;  1BG1 A;  1ABA A;  5IQY A;  1K0B A;  4ILF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...