4EDYA

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
b'PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoietic prostaglandin D synthase
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4edyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4edyA01
1XZOA 2H72A 4V1Ap 1TK5B 2IPAA 4NAXA 4POKA 2V1MA 4X1UA 2R37A 4PXOA 2C0GA 2IMIA 1H4OA 2J9HA 3MAKA 3F0IA 2B1KA 1ZGNA 4PGTA 2FA8A 2MMOA 3IDVA 2E0QA 4D73A 3GH9A 2IMEA 1TK8B 1FHEA 3LFLA 5EVOA 1O7UA 4TW5A 2OE0A 2I81A 1TTZA 1M99A 2C0FA 2H75A 4IKHA 3F4RA 4IJIA 2E2GA 4X43A 4ULXA 2VL2A 4WBJA 5IO0A 5ID2A 1TDIA 3KCMA 2H30A 3GX8A 6GSUA 2R4VA 3E0UA 4XS4A 3ZRDA 3CYNA 5IMVA 4GTUA 4TVEA 3GX0A 3APSA 1EV9A 4TXOA 3VWVA 4L5LA 1KNGA 5CRHA 4BWQA 2YJHA 5HR0A 1AW9A 3LYKA 2LV3A 1EGRA 1MDKA 2H0GA 4BVXA 3ZFLA 2OADA 3GKXA 4IP6A 4OD7A 3TOTA 10GSA 1T1VA 1GUMA 1ACVA 2DJ2A 3DYRA 3CTGA 3LORA 3FZAA 4POLA 2PUKC 3O3TA 2Z9SA 2JSYA 5B8AA 12GSA 2C4JA 4OWYA 2PN8A 1S3AA 1F6MC 2EIQA 4JRRA 4WF4A 3UBLA 2AHEA 2HRNA 4DEJA 4PNFA 3IOSA 3AY8A 3WT2A 1V57A 3BJ5A 2QGVA 4K7NA 3GKKA 5B6MA 1A8LA 1TW9A 4USSA 1YQ1A 4L0UA 5IMFA 1AUCA 3LWAA 2LTKA 2VUPA 2DSAA 1Z5YE 2GZZA 4MZCA 4D73B 1FO5A 1F37A 4YAPA 1M2BA 3KGKA 2OE3A 1G7EA 4KF9A 4GLTA 3W6GA 1JLVA 5CRDA 1ZZYA 3HJOA 2F9SA 2FNOA 5DALA 5HR2A 4AGSA 5J4UA 2GLRA 1K0AA 2MYGA 2GSRA 2PBJA 4TR4A 4YH2A 3TJFA 3ISOA 2RLIA 2YWIA 2RM6A 3SBCA 5DDLA 5G5FA 2H6XA 2YZUA 4ACSA 3C7MA 2L5OA 5ECLB 5ID2B 4L5OA 4K9ZA 2H73A 4TRXA 2X8GA 4Q5RA 3GMFA 4ZXGA 3I69A 4MK3A 5FT3A 2BJXA 3FZ4A 4FH8A 2GZPA 4IHUA 4RQRA 2VCQA 1GNEA 1PSQA 4EDZA 1PA3A 3M1GA 2V41A 3H8QA 5D8IA 1Y6EA 4Q5QA 5IOWA 1VF4A 4ECIA 1O8WA 2DIYA 1A2JA 4J56E 2GQKA 4BVXB 2H19A 4TXVA 2IL3A 5CRGA 3VPTA 3DIEA 3O6TA 2X8HA 3Q18A 2YP6A 1GTUA 4LMVA 4PNGA 3A2XA 2CVBA 2ON5A 2DC5A 4FYBA 3EYTA 1ON4A 4QQ7A 2DJ0A 2NBSA 2R6KA 2DJJA 4OO5A 13GSA 1FG4A 4NHZA 2B7KA 1WWJA 2BTOT 5JWQB 1WPIA 2RIIA 2P5RA 4MP4A 1TRUA 2I9HA 4IS0A 4MABA 4ZBDA 1R5PA 2H71A 4WF5A 5H5RA 4NXIA 4H86A 1XW5A 4LMWA 4I2TA 5EY6A 4IGJA 4L8EA 4LA1A 4XRAA 4LL1B 3DRNA 3D4TA 4F2IA 3PPUA 1X5DA 1QGVA 3KH9A 4X0XA 2EIRA 2HYXA 5F07A 2B5EA 1TJDA 2DBCA 4K7OA 3HCZA 4JR4A 1ILOA 2L59A 3JCML 1YF1A 2HZEA 1Q4JA 5JWRB 3US3A 5DQSA 3M3MA 3EMXA 2OA7A 3GHAA 3A3TA 4I2UA 4TN8A 2AUVA 4YQVA 4MMMA 1A23A 3GIXA 1PKZA 2QKEA 3F6DA 1X5EA 2YNXA 1T3BA 2G0FA 2VIMA 4YQUA 2RUEA 3GSTA 3ZVJD 3D6IA 1EOGA 2KHPA 1GWCA 3ME8A 2FWHA 1DSBA 2L57A 5KN0A 2HLSA 3ZREA 2IN3A 2X64A 3FYGA 2HRKB 4LL4B 2WDUA 3GH6A 3FW2A 4NMUA 3I9V2 4ML6A 3CSHA 1AIUA 4OCEA 2J23A 2ON7A 4EF0A 1XOAA 1AXDA 4QL7A 1J9BA 2KUCA 4K6XA 5G30A 2HQTA 1M7TA 5E4WA 3EMPA 5G1LA 2YWMA 5GSTA 3K8NA 3NOFA 4HS1A 3GNJA 3PGTA 2DMLA 2XPEA 4I8BA 2GZYA 2H1DA 1F3BA 3G7JA 2XC2A 1GH2A 4LLRA 4F0CA 2LJRA 3LJRA 5AGYA 1X5CA 1ABAA 1GTBA 1FOVA 3IC8A 3WGEA 4MLYA 2EC4A 4MF6A 1T00A 2GT6A 3BCKA 4DSSA 4DSQA 4MZBA 3HJPA 3ERGA 2HRAA 3TJGA 5ECKB 1EV4A 5HR1A 1JZRA 4POBA 1AAZA 4OFMA 1B48A 4WXTA 4RQXA 3KM6A 3LEFA 4MPGA 4XIHA 4GXZA 4TKYA 4BVYA 4PX1A 4EC0A 5IMAA 2UZ8A 3LXZA 1WJKA 5CRWA 3VI7A 4PQIA 4ZB8A 4FO5A 3F3QA 1QK8A 2HZEB 1YKAA 2CZ3A 1S3DA 2H8LA 1URMA 2TRCP 3KTBA 1USBA 4MF5A 2OBIA 1QUWA 2MBSA 1EEJA 3CMIA 5LNKe 3HA9A 1YKCA 1V98A 1NHOA 1Q98A 3KJYA 2VL9A 2DJ1A 1E2YA 5BMUA 5DCGA 2O8VB 4I5QA 2FWGA 1BJXA 4AJ8A 3GL5A 1BEDA 4IQAA 3VWUA 5HFIA 3TRXA 2LRCA 1V2AA 5D96A 4V2MA 2C3TA 4KGIA 6GSTA 3HKRA 2CX3A 1T8EB 2HI7A 2FHEA 3I43A 2BMXA 3J7Yk 2JZRA 4MJEA 1SD9A 4XHMA 3PR8A 1O8XA 4MH3A 1JHBA 5F8BA 3UARA 3A5WA 2CAQA 5ECSA 2IJYA 1AQXA 1K0DA 3RPNA 4V1Ag 1CQHA 2XBIA 1U87A 2O7KA 3KMNA 3LGCA 2IFQB 4EL1A 5ECOB 5ELGA 2L4QA 5ECQB 1TI3A 3TJJA 2LJKA 1Z7RA 2L6DA 3FR9A 5DQYA 2WFCA 2YV7A 4KW6A 5G1KA 3L9UA 4DSSB 5IO2A 1ERVA 2H74A 3C1SA 1TOFA 2O89A 3IXRA 1XIYA 3RAZA 3HVXA 1B8XA 2GDRA 3FR6A 4EE0A 3QMXA 3ZFBA 3MNGA 2P5QA 3IAS2 1Z6NA 3U6VA 1Z6MA 2IMKA 4GQCA 3C71A 4BVYB 2VCTA 2VD1A 1SJZA 1XOBA 2PMTA 2H0HA 1DUGA 4HEA2 3KP8A 5J41A 3J7Yb 3UOMA 3IBHA 3UAPA 1VF2A 5GAPD 3L4NA 1BQ7A 2FGXA 3KIJA 4POMA 1ERWA 4V2NA 3WD6A 4HU9A 1ZYQB 4TOPA 4PQ1A 1RK4A 3CRTA 2PERA 1I5GA 2B5YA 2LNTA 4DSRA 1AQVA 3FRCA 4TR1A 4IW9A 2V32A 3SWLA 5ECPB 3KP9A 2JACA 1R4WA 4KX4A 1VF3A 1A2MA 5FWGA 4OFNA 3RBTA 3D4MA 1I9DA 4P3YB 1K0OA 2V2GA 1M0UA 2AJQB 5D9WA 2AAWA 3CBUA 2K9FA 1GSDA 4RI6A 3IPZA 4ISDA 3EWLA 5DBQA 2LUSA 5E59A 2M72A 1SL1B 4BL7A 5GZZB 1MTCA 4N0ZA 1J08A 4OCFA 2HT9A 1GSYA 3P90A 4OFTA 3R3EA 3FZ5A 4KCEA 1YEPA 3F9UA 3VURA 3UL3A 2XHFA 3LYPA 2JZSA 3GUSA 3APQA 1SKRB 1EZKA 3UVTA 3QPMA 3CRUA 4AJ7A 2H1AA 2GSSA 1JFUA 2YJ7A 3UVHA 3FZ9A 1V9WA 2M80A 5F06A 5GAND 4CDOA 1PD21 1OC9A 5HFGA 3TRPA 7GSSA 4G2EA 2LRNA 2IMDA 4JBBA 1OC3A 2YV9A 4KH7A 5KN3A 3ZIJA 1JLWA 3M0FA 5LD0A 4KB3A 3DGQA 2E2MA 5JCUA 1PGTA 3ERWA 5FHIA 1XWGA 1TRVA 1F2EA 3U5RE 5HR3A 2IIYA 4EKZA 1MD3A 2B3SA 2QC7A 1V40A 5B8BA 2H6ZA 2O85A 4MJCA 2X99A 2IMFA 5JWOB 3RPPA 3RHBA 5IOXA 5EL8A 3P7XA 2B5XA 3TKSC 2R3XA 4FIWA 2C0EA 4TR1B 4ZL8A 2EIOA 1A8YA 2N5AA 3GSSA 1XWAA 4K1FA 4O7HA 2H0IA 3ZTLA 1J0FA 1W89A 4N10A 4KA0A 5JCGA 2P31A 1T7PB 1XWBA 4DVCA 1A0RP 1LJRA 5IMZA 3M8NA 3TRQA 1WIKA 1VGLA 2FUG2 3I6AA 3GKNA 4KSOA 4ZB6A 14GSA 1XW6A 3MDKA 2RM5A 4ECCA 3PINA 3CSJA 2H70A 4BL7B 4EVMA 1M2DA 2HRKA 6GSVA 4G19A 4HZ4A 1HYUA 5G5EA 3D22A 3TOUA 1KTEA 1A0FA 4KSMA 2WULA 1LU4A 4XS1A 1O81A 16GSA 4YAVA 2AV4A 3UIWA 1UN2A 5G2ZA 1K3LA 5ELAA 3LQ7A 1K0CA 2IWTA 1XVQA 2X8CA 4GCIA 1RQMA 5IMCA 3RHCA 3HJMA 1UC7A 2FWFA 2C3NA 1XBSA 1FB6A 1OC9B 5ECIB 3FEUA 4HJMA 4KCAA 4TR3A 5DJMA 3ZLPA 4AJ6A 2YN1A 3IE3A 6GSYA 5A4UA 3LG6A 3CTFA 4ZL7A 3FK8A 3TDGA 3TKRA 5IPGA 1FVJA 1S3CA 20GSA 4E8HA 3TKPA 4N0VA 2B6MA 4N30A 1TI1A 2H1GA 3KZQA 4G9HA 2LS5A 3TCOA 3TJKA 1GUHA 2C1YA 2CT6A 1O85A 3QFBC 3HXSA 3IR4A 1X9MB 2PWJA 4MCUA 1PL1A 1SU9A 1SL0B 1SK1A 1YZXA 2TRXA 4WETA 4MF7A 2P0GA 1K3YA 2MMZA 3HD5A 2MMNA 1SKSB 3GA4A 3IV4A 2XPDA 1W4VA 2L5LA 5G31A 4I6XA 2F8AA 1A2LA 4GSSA 2H76A 4G0LA 3WGXA 5J9BA 2L6CA 3QR6A 1XXUA 2FLSA 1R7HA 4G0KA 5ECRB 5D93A 3D21A 5D9TA 1GSFA 1OKDA 2LKUA 5AISA 3HVVA 3HDCA 1KBNA 1QFNA 3G9BA 1BX9A 5CYYA 4ZB9A 3EC3A 3PH9A 5HFKA 2VLUA 3KTLA 3UEMA 5IQYA 3ZMLA 2PVQA 3IAM2 3EVIA 4JU5A 1JZWA 1OKTA 3L0HA 3ED3A 3KH7A 4MPFA 1EEMA 3WT1A 3S9FA 1XCCA 4KDUA 1FAAA 2IFQA 2V6KA 5JCWA 4Z7XA 4CW9A 4F0BA 3KEBA 2VOCA 1B9XC 4GWRA 2OACA 2VCVA 3P8WA 2HE3A 3DXBA 5ECHB 3DMLA 3ZVJA 1WOUA 2K6VA 1YF0A 2JL4A 5CREA 3TKSE 3GL3A 2ALBA 1GNWA 2WRTA 4OO4A 3MWHA 4JE1A 2AB6A 3GFKA 4K7IA 2OBKA 4HZ2A 1FB0A 3F4SA 4RUVA 4NPBA 1GLPA 3EE2A 2N5FA 4HQSA 3GTUA 5IIZA 2VO4A 4WBRD 3C73A 3H79A 2WB9A 2PPTA 2V6OA 3DWVA 4NV5A 3Q19A 3DVWA 1SKWB 1QXHA 4L0WA 1DE1A 1B9YC 1B4QA 4Q5NA 2YANA 2CVKA 4GRFA 2WCIA 2HSNB 4KE3A 3F3RA 2I1UA 3TUEA 2CX4A 4NHWA 3L9SA 2C0DA 1K0NA 2TIRA 5LCZA 5AIXA 1FVKA 5AN1A 2LNSA 1Z7PA 4BPYA 2H01A 4HU7A 4F03A 5L71A 2G2QA 3HVSA 1YEXA 1OE7A 4PQHA 4N11A 4HOJA 3E9JB 2JU5A 2H6YA 4PTSA 1OE8A 2DMMA 1H75A 1SK0A 3ZL5A 5DJLA 1UVZA 1YJ6A 4HUAA 3C1RA 4G0IA 3BOAA 4ML1A 2ZUPA 2VCWA 4KDYA 4ZL9A 1HNCA 4HJ2A 1XW9A 1U6TA 1N8JA 1Z3EA 3EURA 2CZ2A 2GS3A 1GLQA 3ZITA 1R5AA 4PUFC 2PGTA 4WR5A 4GF0A 1ZOFA 2KLXA 3GRXA 3UMAA 11GSA 1T4YA 3HZ4A 6GSXA 2YOIA 1M9AA 3CXGA 1ML6A 2D2ZA 1GRXA 1OAZA 4MJBA 3VI5A 3IA1A 2KOKA 3A2VA 2B1LA 2O87A 1MDIA 5A5KA 1HNAA 4OMVA 2I4AA 5J5NA 1PQNA 2FA4A 1THXA 3IC4A 1G7OA 4PURA 4F82A 3GTUB 3G7YA 2VLVA 1DBYA 1G6WA 5COHA 2K8VA 4KDXA 2R5GA 3E3EA 1N2AA 1PX6A 1TRSA 4ECJA 1ERUA 1UA5A 5DAKA 3HYPA 4WR4A 3BD2A 2YWNA 2HSHA 2WGRA 1F9MA 2GTUA 5H5QA 2ES7A 2CV4A 2HSMB 2CQ9A 1Z9HA 3NIVA 2YCDA 1HQOA 2E7PA 2VL3A 17GSA 2A2SA 3UBKA 2YZHA 3WGDA 3WYWA 1TXXA 3MSZA 3QCPA 3C8EA 1U3AA 3VPQA 3TKSA 4ZIJA 5A4WA 3DVXA 3GKMA 4YQMA 3DEXA 3W8SA 2B7JA 5KEJA 1HD2A 4O92A 2HRFA 4JZQA 1QMVA 5IPHA 3APOA 2I3YA 1MDJA 5CAXA 3QAWA 1XVWA 1EOHA 1EWXA 3UJ1A 3RDWA 4RI7A 4IJ3A 3VLNA 3F6FA 1DE2A 1GTAA 2MMAA 1VF1A 5KN1A 4MDCA 4O32A 4J57E 4NV2A 5ABRA 2FD3A 3NZNA 4JEDA 5GSSA 3DD3A 5H5SA 2OE1A 1PN9A 1XWCA 5CO3A 5D9XA 1ERTA 1GUKA 19GSA 3ME7A 3W8JA 4QL9A 4GSNA 3HY2A 2HFDA 3G7IA 4EXJA 2K18A 1ZCPA 5C04A 4ID0A 1SL2B 3D5JA 2ZNMA 2A4VA 1PL2A 3FY7A 3FHKA 1PX7A 1Y25A 2NTOA 3R2QA 3FKFA 4FYUA 5D9VA 5DAKB 1K3OA 4IN0A 1M2AA 1GSQA 5EPFA 2KP1A 2GQMA 2LEGA 1JZDA 3ZZXA 2AYTA 8GSSA 4KAEA 2K8SA 1X0RA 2VCZA 2VL2C 2KP2A 4TR0A 3GURA 2F8FA 1G0TA 1SENA 5CNWA 3ZIVA 1WRYA 4F9ZA 2C8UA 1YDKA 5ECMB 9GSSA 4IP1A 1BYEA 1MD4A 4IELA 3F63A 2NVLA 3QD9A 1O73A 4GQFA 5DCHA 4XS4B 4EUYA 4XRDA 1ZYEA 3Q74A 5IMDA 3KMOA 2FY6A 1PKWA 4K0NA 4TXOB 3TGZA 1THOA 2XBQA 4ZBAA 1AC1A 4E8EA 2DLXA 4J2FA 2LQQA 3ERFA 3H4KA 3IK7A 1ZMAA 1IYHA 1F3AA 2GT5A 4K2DA 5J3RA 2FWEA 1TU8A 3GV1A 2F3MA 3QOUA 2PVOC 2WZ9A 4PUAA 2M46A 4ZBBA 1SJIA 3M9JA 4FQUA 4HDEA 2REMA 2VLTA 3N9JA 3D0ZA 3KD0A 2CAIA 2GSTA 1X9WB 4GSTA 4FYCA 1KEBA 3GN3A 1U88A 3M9KA 1SD8A 1BAYA 1X9SB 1U3IA 3TJBA 2WS2A 3OR5A 5DVBA 3LXTA 3TKQA 5DALB 3P2AA 2HZFA 4ECBA 1C72A 3VWWA 2WJUA 2LSTA 4XS6A 5AIVA 1TP9A 5INYA 5D73A 3H93A 4KUNA 1RW1A 2R2JA 4IVFA 4XCSA 4HQZA 2JSZA 4KNDA 1XPVA 1OYJA 4Q5FA 1MEKA 3V1WA 2CA8A 2YWOA 3QDNA 1PMTA 1GTIA 4WKWA 3QFAC 3TB2A 1K0BA 1NM3A 3H1NA 2DIZA 3HHVA 2OKAA 1NHYA 1GSSA 2ZCTA 2HNLA 1XFLA 2YPMA 3L78A 2F51A 2GVPA 2C80A 3DKSA 2VM1A 5F0GA 4I97A 3IRAA 5B6NA 2MBTA 3EU4A 2VD0A 3GYKA 1NSWA 4MZWA 3QAGA 5B7CA 5ECNB 2GSQA 5HQPA 5F05A 5C00A 1TRWA 1PRXA 4IQ1A 2DJKA 2LQOA 2NPBA 4ZILA 22GSA 1OC8A 1SYXA 4IBPA 1G6YA 3LSZA 1XWKA 1EGOA 4BWSA 1SJ6A 5CP1A 1AQWA 3VFIA 2VCXA 3O76A 2GQLA 2H66A 1NW2A 2HSYA 4ILFA 3KXOA 4G10A 3EU3A 4EO3A 1YY7A 1TU7A 6GSSA 1OVNA 2QSIA 2VM2A 1BG5A 4HI7A 4K0GA 3QAVA 1TK0B 1V58A 6GSWA 18GSA 3F8UA 3L9VA 3VK9A 2RUFA 4NWYA 1WP0A 1SYRA 2MZCA 3N5OA 5A4VA 2GGTA 1M9BA 4BA7A 2A2RA 1GSUA 1FW1A 4O5RA 2HSMA 1IYIA 1JZOA 4V2LA 2LRTA 2L4CA 2LJAA 2N5BA 3HZ8A 4MH2A 3IHQA 1EP8A 1GP1A 1K0MA 2OJLA 2DJ3A 1HNBA 3ZYWA 4CHSA 1TKDB 1WMJA 5IM9A 5ENUA 1CQGA 1LBKA 1VRSD 3IK9A 1ST9A 3BBYA 1E6BA 3BCIA 4XTSA 2FCHA 2C3QA 3A2WA 1EP7A 1WE0A 3FR3A 2VAFA 2HXKA 1O6JA 4K8MA 5KN2A 1SK2A 2JZTA 1T4ZA 2NDOA 2JADA 1A24A 2CVDA 3Q6OA 1B4PA 4MA9A 4EDYA 5J9CA 1ZL9A 1QQ2A 4MJAA 4AF2A 3F4TA 3CSIA 4JR6A 3EINA 1GULA 3ZMKA 4WEYA 1GSEA 1GL8A 2H1BA 1R26A 3VWXA 2PU9C
chains in the Genus database with same CATH superfamily
1XZOA 2H72A 4V1Ap 5A5HA 1TK5B 2IPAA 4NAXA 4POKA 2V1MA 4X1UA 2R37A 2X49A 4PXOA 5J47A 2C0GA 2IMIA 1H4OA 2J9HA 4ICYA 3MAKA 3F0IA 4QMKA 2B1KA 1M3IA 1ZGNA 4PGTA 2FA8A 2MMOA 3IDVA 2E0QA 4D73A 3GH9A 2IMEA 1TK8B 1FHEA 3LFLA 5EVOA 1O7UA 4TW5A 2OE0A 2I81A 1TTZA 1M99A 2C0FA 2H75A 1ZYNA 4IKHA 3F4RA 4IJIA 2E2GA 4X43A 4ULXA 4AKXB 2VL2A 4WBJA 5IO0A 5ID2A 1YVLA 1TDIA 3KCMA 2H30A 2DKHA 3GX8A 6GSUA 2R4VA 3E0UA 4XS4A 3ZRDA 4X4JA 3CYNA 5IMVA 4GTUA 4TVEA 3GX0A 3APSA 1EV9A 4TXOA 3VWVA 4L5LA 1KNGA 5CRHA 4BWQA 2YJHA 5HR0A 1AW9A 3LYKA 2LV3A 1EGRA 1MDKA 2H0GA 4BVXA 3ZFLA 2OADA 2VKZG 3GKXA 4IP6A 4OD7A 3TOTA 10GSA 1T1VA 1GUMA 1ACVA 2DJ2A 5J4VA 1I1IP 3DYRA 3CTGA 3LORA 3FZAA 4POLA 2PUKC 3O3TA 2Z9SA 2JSYA 5B8AA 12GSA 5A5HB 2C4JA 4OWYA 2PN8A 1S3AA 1F6MC 2EIQA 4JRRA 4WF4A 3UBLA 2AHEA 2HRNA 4DEJA 4PNFA 3IOSA 3AY8A 3WT2A 1V57A 3BJ5A 2QGVA 4K7NA 3GKKA 5B6MA 1A8LA 1TW9A 4USSA 1YQ1A 5A34B 5J4YA 4L0UA 5IMFA 1AUCA 3LWAA 2LTKA 2VUPA 2DSAA 1Z5YE 2GZZA 4MZCA 4D73B 1FO5A 1F37A 4YAPA 1M2BA 3KGKA 2OE3A 1G7EA 4KF9A 4GLTA 3W6GA 1JLVA 5CRDA 1ZZYA 3HJOA 2F9SA 2FNOA 5DALA 5HR2A 4AGSA 1S3RA 5J4UA 2GLRA 1K0AA 2MYGA 2GSRA 1PN0A 2PBJA 4TR4A 4YH2A 3TJFA 3ISOA 2RLIA 4PHZC 2YWIA 2RM6A 3SBCA 5DDLA 5G5FA 2H6XA 2YZUA 4ACSA 3C7MA 4Z2TA 2L5OA 5ECLB 5ID2B 4L5OA 4K9ZA 2H73A 1N25A 4TRXA 2X8GA 4Q5RA 3GMFA 4ZXGA 3I69A 4MK3A 5FT3A 2BJXA 3FZ4A 4FH8A 2GZPA 4IHUA 4RQRA 2VCQA 1GNEA 1PSQA 4EDZA 1PA3A 3M1GA 2V41A 3H8QA 5D8IA 1Y6EA 4Q5QA 5IOWA 1VF4A 4ECIA 1O8WA 2DIYA 1A2JA 4J56E 2GQKA 4ZB7A 4BVXB 2H19A 4TXVA 2IL3A 5CRGA 3VPTA 3DIEA 3O6TA 2X8HA 3Q18A 2YP6A 2X4AA 1GTUA 4LMVA 4PNGA 3A2XA 2CVBA 2ON5A 2DC5A 4FYBA 3EYTA 1ON4A 4QQ7A 2DJ0A 2NBSA 2R6KA 2DJJA 4OO5A 13GSA 1FG4A 4NHZA 2B7KA 1WWJA 2BTOT 5JWQB 1WPIA 2RIIA 2P5RA 4MP4A 1TRUA 2I9HA 4IS0A 4MABA 4ZBDA 1R5PA 2H71A 4WF5A 5H5RA 4NXIA 4H86A 1XW5A 4LMWA 4I2TA 5EY6A 4IGJA 4L8EA 4LA1A 4XRAA 4LL1B 2UV8G 3DRNA 3D4TA 4F2IA 3PPUA 1X5DA 1QGVA 3KH9A 1BG1A 4EIQA 4X0XA 2EIRA 2HYXA 5F07A 2B5EA 1TJDA 2DBCA 4K7OA 3HCZA 4JR4A 1ILOA 2L59A 3JCML 1YF1A 2HZEA 1Q4JA 5JWRB 3US3A 5DQSA 3M3MA 4K5RA 3EMXA 2OA7A 2WVYA 3GHAA 3A3TA 4I2UA 4TN8A 2AUVA 4YQVA 4MMMA 1A23A 3GIXA 1PKZA 2QKEA 3F6DA 1X5EA 2YNXA 1T3BA 2G0FA 2VIMA 4YQUA 2RUEA 3GSTA 3ZVJD 3D6IA 1EOGA 2KHPA 1GWCA 3ME8A 2FWHA 1DSBA 2L57A 5KN0A 2HLSA 3ZREA 2IN3A 2X64A 3FYGA 4CY6A 2HRKB 4LL4B 2WDUA 3GH6A 3FW2A 4NMUA 3I9V2 4ML6A 3CSHA 1AIUA 4OCEA 2J23A 2ON7A 4EF0A 1XOAA 1AXDA 4QL7A 1J9BA 2KUCA 4K6XA 5G30A 2HQTA 1M7TA 5E4WA 3EMPA 5G1LA 2YWMA 3FMWA 5GSTA 3K8NA 3NOFA 1FOHA 4HS1A 3GNJA 3PGTA 2DMLA 2XPEA 4I8BA 2GZYA 2H1DA 1F3BA 3G7JA 2XC2A 1GH2A 2O3EA 4LLRA 4F0CA 2LJRA 3LJRA 5AGYA 4E68A 1X5CA 1ABAA 1GTBA 1FOVA 3LW9A 3IC8A 3WGEA 4MLYA 2EC4A 4MF6A 1T00A 2GT6A 3BCKA 4DSSA 4DSQA 4MZBA 3HJPA 3ERGA 2HRAA 3TJGA 5ECKB 1EV4A 5HR1A 1JZRA 4POBA 1AAZA 4OFMA 1B48A 4WXTA 4RQXA 3KM6A 3LEFA 4MPGA 5BRTA 4XIHA 4GXZA 4TKYA 4BVYA 4PX1A 4EC0A 5IMAA 2UZ8A 3LXZA 1WJKA 5CRWA 3VI7A 4PQIA 4ZB8A 4EIPA 4FO5A 5J40A 3F3QA 1QK8A 2HZEB 1YKAA 2CZ3A 1S3DA 2H8LA 1URMA 2TRCP 3KTBA 1USBA 4MF5A 2OBIA 1QUWA 2MBSA 1EEJA 3CMIA 5LNKe 3HA9A 1YKCA 1V98A 1NHOA 1Q98A 3KJYA 2VL9A 2DJ1A 1E2YA 5BMUA 5DCGA 2O8VB 4I5QA 2O36A 2FWGA 4HSCX 1BJXA 4AJ8A 5KOWA 2O5VA 3GL5A 1BEDA 4IQAA 3VWUA 5HFIA 3TRXA 2LRCA 1V2AA 5D96A 4V2MA 2C3TA 4KGIA 6GSTA 3HKRA 2CX3A 1T8EB 4A5PA 2HI7A 2FHEA 3I43A 2BMXA 3J7Yk 2JZRA 4MJEA 1SVMA 1SD9A 4XHMA 3PR8A 1O8XA 4MH3A 1JHBA 5F8BA 3UARA 3A5WA 2CAQA 5ECSA 2IJYA 1AQXA 1K0DA 3RPNA 4V1Ag 1CQHA 2XBIA 1U87A 2O7KA 3KMNA 3LGCA 2IFQB 4YKFA 4CY8A 4EL1A 5ECOB 5ELGA 2L4QA 5ECQB 1TI3A 3MYDA 3TJJA 2LJKA 1Z7RA 2L6DA 3FR9A 5DQYA 2WFCA 2YV7A 4KW6A 5G1KA 3L9UA 4DSSB 5IO2A 1ERVA 2H74A 3C1SA 1TOFA 2O89A 3IXRA 1XIYA 3RAZA 3HVXA 1B8XA 2GDRA 3FR6A 4EE0A 3QMXA 3ZFBA 3MNGA 2P5QA 3IAS2 1Z6NA 3U6VA 1Z6MA 2IMKA 4GQCA 3C71A 4BVYB 2VCTA 5A34A 2VD1A 1SJZA 1XOBA 2PMTA 2H0HA 4YKGA 1DUGA 4HEA2 3KP8A 5J41A 3J7Yb 3UOMA 3IBHA 3UAPA 1VF2A 5GAPD 3L4NA 1BQ7A 2FGXA 3KIJA 4POMA 1ERWA 4V2NA 3WD6A 2A2PA 4HU9A 1ZYQB 4N3ZA 4TOPA 4PQ1A 1RK4A 3CRTA 2PERA 1I5GA 2B5YA 2LNTA 1M3JA 4PI0C 4DSRA 1AQVA 3FRCA 4TR1A 4IW9A 2V32A 3SWLA 5ECPB 3KP9A 2JACA 5BMUB 1R4WA 4KX4A 1VF3A 1A2MA 5FWGA 4OFNA 3RBTA 3D4MA 1I9DA 4P3YB 1K0OA 2V2GA 1M0UA 2AJQB 5D9WA 2AAWA 3CBUA 2K9FA 1GSDA 4RI6A 3IPZA 4ISDA 3EWLA 5DBQA 2LUSA 5E59A 2M72A 1SL1B 4FXYP 4BL7A 5GZZB 1MTCA 4N0ZA 1J08A 1SVOA 2HT9A 4OCFA 1GSYA 3P90A 4OFTA 3R3EA 3FZ5A 4KCEA 1YEPA 3F9UA 3VURA 3UL3A 2XHFA 3LYPA 2JZSA 3GUSA 3APQA 1SKRB 1EZKA 3UVTA 3QPMA 3CRUA 4AJ7A 2H1AA 2GSSA 1JFUA 2YJ7A 1TXUA 3UVHA 3FZ9A 1V9WA 2M80A 5F06A 5GAND 4CDOA 1PD21 1OC9A 5HFGA 3TRPA 7GSSA 4G2EA 2LRNA 2IMDA 4JBBA 1OC3A 2YV9A 4KH7A 5KN3A 3ZIJA 1JLWA 3M0FA 5LD0A 4KB3A 5A1NA 3DGQA 2E2MA 5JCUA 1PGTA 3ERWA 2WW0A 5FHIA 1XWGA 1TRVA 1F2EA 3U5RE 5HR3A 2IIYA 4EKZA 1MD3A 2B3SA 2QC7A 1V40A 5B8BA 2H6ZA 2O85A 4MJCA 2X99A 2IMFA 5JWOB 3RPPA 3RHBA 5IOXA 5EL8A 3P7XA 2B5XA 3TKSC 2R3XA 4FIWA 4AKIA 2C0EA 4TR1B 4ZL8A 2EIOA 1A8YA 3A5IA 2N5AA 3GSSA 1XWAA 4K1FA 4O7HA 2H0IA 3ZTLA 1J0FA 1W89A 4N10A 4KA0A 5JCGA 2P31A 1T7PB 1S4BP 1XWBA 4DVCA 1A0RP 1LJRA 5IMZA 3M8NA 3TRQA 1WIKA 1VGLA 2FUG2 3I6AA 3GKNA 4KSOA 2WW3A 4ZB6A 14GSA 1XW6A 3MDKA 2RM5A 4ECCA 3PINA 3CSJA 2H70A 4BL7B 4EVMA 1M2DA 2HRKA 6GSVA 4G19A 4HZ4A 1HYUA 5G5EA 3D22A 3TOUA 1KTEA 1A0FA 4KSMA 2WULA 1LU4A 4XS1A 1O81A 16GSA 4YAVA 2AV4A 3UIWA 1UN2A 5G2ZA 1K3LA 5ELAA 3LQ7A 1K0CA 2IWTA 1XVQA 2X8CA 4GCIA 1RQMA 5IMCA 4Z2RA 4W66A 3RHCA 3HJMA 1UC7A 2FWFA 2C3NA 3CHXC 1XBSA 1FB6A 1OC9B 5ECIB 3FEUA 4HJMA 4KCAA 4TR3A 5DJMA 3ZLPA 4AJ6A 5A1NB 2YN1A 3IE3A 6GSYA 5A4UA 3LG6A 2EFDA 3CTFA 4ZL7A 3FK8A 3TDGA 3TKRA 5IPGA 1YEWC 1FVJA 1S3CA 20GSA 4E8HA 3TKPA 4N0VA 2B6MA 4N30A 4AI6A 1TI1A 2H1GA 3KZQA 4G9HA 2LS5A 3TCOA 2H1LA 3TJKA 1GUHA 2C1YA 2HSNA 2CT6A 1O85A 3QFBC 3HXSA 3IR4A 1X9MB 2PWJA 4MCUA 1PL1A 1SU9A 1SL0B 3RGBC 1SK1A 1YZXA 2TRXA 4WETA 4MF7A 2P0GA 1K3YA 2MMZA 3HD5A 2MMNA 1SKSB 3GA4A 3IV4A 2XPDA 1W4VA 2L5LA 5G31A 4I6XA 2F8AA 1A2LA 4GSSA 2H76A 4G0LA 3WGXA 5J9BA 2L6CA 3QR6A 4AKHA 1XXUA 2FLSA 1R7HA 4G0KA 5ECRB 3CWGA 5D93A 3D21A 5D9TA 1GSFA 1OKDA 2LKUA 5AISA 3HVVA 3HDCA 1KBNA 1QFNA 3G9BA 1BX9A 5CYYA 4ZB9A 3EC3A 3PH9A 5HFKA 2VLUA 3KTLA 3UEMA 3RFRC 5IQYA 3ZMLA 2PVQA 3IAM2 3EVIA 4JU5A 1JZWA 1OKTA 3L0HA 3ED3A 3KH7A 2EFCA 4MPFA 1EEMA 3WT1A 3S9FA 1XCCA 4KDUA 1FAAA 2IFQA 2V6KA 5JCWA 4Z7XA 4CW9A 4F0BA 3KEBA 2VOCA 1B9XC 4GWRA 2OACA 2VCVA 3P8WA 2HE3A 3DXBA 5ECHB 3DMLA 3ZVJA 1WOUA 2K6VA 1YF0A 2JL4A 5CREA 3TKSE 3GL3A 2ALBA 1GNWA 2WRTA 4OO4A 3MWHA 4JE1A 2AB6A 3GFKA 4K7IA 2OBKA 4HZ2A 1FB0A 3F4SA 4RUVA 4NPBA 1GLPA 3EE2A 2N5FA 3EPTA 4HQSA 3GTUA 5IIZA 2VO4A 4WBRD 3C73A 3H79A 2WB9A 2WZSA 2PPTA 2V6OA 3DWVA 4NV5A 3Q19A 3DVWA 1SKWB 1QXHA 4L0WA 1DE1A 1B9YC 1B4QA 4Q5NA 2YANA 2WVXB 2CVKA 4GRFA 2WCIA 2HSNB 4KE3A 3F3RA 2I1UA 1BF5A 3TUEA 2CX4A 4NHWA 3L9SA 2C0DA 1K0NA 2TIRA 5LCZA 5AIXA 1FVKA 5AN1A 2LNSA 1Z7PA 4BPYA 2H01A 4HU7A 4F03A 5L71A 2G2QA 3HVSA 1YEXA 1OE7A 4PQHA 4N11A 4HOJA 3E9JB 2JU5A 2H6YA 4PTSA 1OE8A 2DMMA 1H75A 1SK0A 3ZL5A 5DJLA 1UVZA 1YJ6A 4HUAA 3C1RA 4G0IA 3BOAA 4ML1A 2ZUPA 2VCWA 4KDYA 4ZL9A 1HNCA 4HJ2A 1XW9A 1U6TA 1N8JA 1Z3EA 3EURA 2CZ2A 2GS3A 1GLQA 3ZITA 1R5AA 4PUFC 2PGTA 4WR5A 4GF0A 1ZOFA 2KLXA 3GRXA 3UMAA 11GSA 1T4YA 3HZ4A 6GSXA 2YOIA 1M9AA 3CXGA 1ML6A 2D2ZA 1GRXA 1OAZA 4MJBA 3VI5A 3IA1A 2KOKA 3A2VA 2B1LA 2O87A 1MDIA 5A5KA 1HNAA 4OMVA 2I4AA 5J5NA 1PQNA 2FA4A 1THXA 3IC4A 1G7OA 4PURA 4F82A 1XG8A 3GTUB 3G7YA 2VLVA 5KOXA 1DBYA 1G6WA 5COHA 2K8VA 4KDXA 2DKIA 2R5GA 3E3EA 1N2AA 1PX6A 1TRSA 4ECJA 1ERUA 1UA5A 5DAKA 3HYPA 4WR4A 3BD2A 2YWNA 2EFEA 2HSHA 2WGRA 1F9MA 3TU3B 2GTUA 5H5QA 2ES7A 2CV4A 2HSMB 2CQ9A 1Z9HA 3NIVA 2YCDA 1HQOA 2E7PA 2VL3A 17GSA 2A2SA 3UBKA 2YZHA 3WGDA 3WYWA 1TXXA 3MSZA 3QCPA 3C8EA 1U3AA 3VPQA 3TKSA 4ZIJA 5A4WA 3DVXA 3GKMA 4YQMA 3DEXA 3W8SA 2B7JA 5KEJA 1HD2A 4O92A 2HRFA 2QA1A 4JZQA 1QMVA 5IPHA 3APOA 2I3YA 3MIXA 1MDJA 5CAXA 3QAWA 1XVWA 1EOHA 1EWXA 3UJ1A 3RDWA 4RI7A 4IJ3A 3VLNA 3F6FA 1DE2A 1GTAA 2MMAA 1VF1A 5KN1A 4MDCA 4O32A 4J57E 4NV2A 5ABRA 2R0CA 2FD3A 3NZNA 4JEDA 5GSSA 3DD3A 5H5SA 2OE1A 1PN9A 1XWCA 5CO3A 5D9XA 1ERTA 1GUKA 19GSA 3ME7A 3W8JA 4QL9A 4GSNA 3HY2A 2HFDA 3G7IA 4EXJA 2K18A 1ZCPA 5C04A 1ZYPA 4ID0A 1SL2B 3D5JA 2ZNMA 2A4VA 1PL2A 3FY7A 3FHKA 1PX7A 1Y25A 2NTOA 3R2QA 3FKFA 2OT3A 4FYUA 5D9VA 5DAKB 1K3OA 4IN0A 1M2AA 1GSQA 5EPFA 2KP1A 2GQMA 2LEGA 1JZDA 3ZZXA 2AYTA 8GSSA 4KAEA 2K8SA 1X0RA 2VCZA 2QA2A 2VL2C 2KP2A 4TR0A 3GURA 2F8FA 1G0TA 1SENA 5CNWA 3ZIVA 1WRYA 4F9ZA 2C8UA 4GDFA 1YDKA 5ECMB 9GSSA 4IP1A 1BYEA 3CQFA 1MD4A 4IELA 3F63A 2NVLA 3QD9A 1O73A 2WW2A 4GQFA 5DCHA 4XS4B 4EUYA 4XRDA 1ZYEA 3Q74A 5IMDA 3KMOA 2FY6A 1PKWA 4K0NA 4TXOB 3TGZA 1THOA 2XBQA 4ZBAA 1AC1A 4E8EA 2DLXA 4J2FA 4PI2C 2LQQA 3ERFA 3H4KA 3IK7A 1ZMAA 1IYHA 1F3AA 2GT5A 4K2DA 5J3RA 4Z2UA 2FWEA 1TU8A 3GV1A 2F3MA 3QOUA 2PVOC 2WZ9A 4PUAA 2M46A 2WW1A 4ZBBA 1SJIA 3M9JA 4FQUA 4HDEA 2REMA 2VLTA 3N9JA 3D0ZA 3KD0A 2CAIA 2GSTA 1X9WB 4K5SA 4GSTA 4FYCA 1KEBA 2WVXA 3GN3A 1U88A 3M9KA 1SD8A 1BAYA 1X9SB 1U3IA 3TJBA 2WS2A 3OR5A 5DVBA 3LXTA 3TKQA 5DALB 3P2AA 1Y1UA 4MNNA 2HZFA 4ECBA 1C72A 3VWWA 2WJUA 2LSTA 4XS6A 5AIVA 1TP9A 5INYA 5D73A 3H93A 4KUNA 1RW1A 2R2JA 4IVFA 4XCSA 4HQZA 2JSZA 4KNDA 1XPVA 1OYJA 4Q5FA 1MEKA 4O5UA 3V1WA 2CA8A 2YWOA 3QDNA 1PMTA 1GTIA 4WKWA 3QFAC 3TB2A 1K0BA 1NM3A 3H1NA 3HMJG 2DIZA 3HHVA 2OKAA 1NHYA 1GSSA 2ZCTA 2HNLA 1XFLA 2YPMA 3L78A 2F51A 2GVPA 2C80A 3DKSA 2VM1A 5F0GA 4I97A 1SVLA 3IRAA 2WVZA 5B6NA 2MBTA 3EU4A 2VD0A 3GYKA 1NSWA 4MZWA 3QAGA 5B7CA 3HVNA 5ECNB 2GSQA 5HQPA 5F05A 5C00A 1TRWA 1PRXA 2R0PA 4IQ1A 2DJKA 2LQOA 2NPBA 4ZILA 22GSA 1OC8A 1SYXA 4IBPA 1G6YA 3LSZA 1XWKA 1EGOA 4BWSA 1SJ6A 5CP1A 1AQWA 3VFIA 2VCXA 3O76A 2GQLA 2H66A 1NW2A 2HSYA 4ILFA 3KXOA 4G10A 3EU3A 4EO3A 1YY7A 1TU7A 6GSSA 4O5QA 1OVNA 2QSIA 2VM2A 1BG5A 4HI7A 4K0GA 3QAVA 4AKGA 1TK0B 1V58A 6GSWA 18GSA 3F8UA 3L9VA 3VK9A 2RUFA 4NWYA 1WP0A 1SYRA 2MZCA 3N5OA 5A4VA 2GGTA 1M9BA 4BA7A 2A2RA 1GSUA 2R0GA 1FW1A 4O5RA 2HSMA 1IYIA 1JZOA 4V2LA 2LRTA 2L4CA 3IHGA 2LJAA 2N5BA 3HZ8A 4MH2A 3IHQA 1EP8A 1GP1A 1K0MA 2OJLA 2DJ3A 1HNBA 3ZYWA 4CHSA 1TKDB 1WMJA 5IM9A 5ENUA 1CQGA 1LBKA 1VRSD 3IK9A 1ST9A 3BBYA 1E6BA 3BCIA 2A4HA 4XTSA 2EFHA 2FCHA 2C3QA 3A2WA 1EP7A 1WE0A 3FR3A 2VAFA 2HXKA 1O6JA 4K8MA 5KN2A 1SK2A 2JZTA 4K2XA 1T4ZA 2NDOA 2JADA 1A24A 2CVDA 3Q6OA 1B4PA 4MA9A 4EDYA 5J9CA 1ZL9A 1QQ2A 4MJAA 4AF2A 3F4TA 3CSIA 4JR6A 3EINA 1GULA 3ZMKA 4WEYA 4BIKA 1GSEA 1GL8A 2H1BA 1PFOA 1R26A 3VWXA 2PU9C 4G01A
chains in the Genus database with same CATH topology
1XZOA 2H72A 4V1Ap 5A5HA 1TK5B 2IPAA 4NAXA 4POKA 2V1MA 4X1UA 2R37A 2X49A 4PXOA 5J47A 2C0GA 2IMIA 1H4OA 2J9HA 4ICYA 3MAKA 3F0IA 4QMKA 2B1KA 1ZGNA 4PGTA 2FA8A 2MMOA 3IDVA 2E0QA 4D73A 3GH9A 2IMEA 1TK8B 1FHEA 3LFLA 5EVOA 1O7UA 4TW5A 2OE0A 2I81A 1TTZA 1M99A 2C0FA 2H75A 1ZYNA 4IKHA 3F4RA 4IJIA 2E2GA 4X43A 4ULXA 4AKXB 2VL2A 4WBJA 5IO0A 5ID2A 1YVLA 1TDIA 3KCMA 2H30A 2DKHA 3GX8A 6GSUA 2R4VA 3E0UA 4XS4A 3ZRDA 4X4JA 3CYNA 5IMVA 4GTUA 4TVEA 3GX0A 3APSA 1EV9A 4TXOA 3VWVA 4L5LA 1KNGA 5CRHA 4BWQA 2YJHA 5HR0A 1AW9A 3LYKA 2LV3A 1EGRA 1MDKA 2H0GA 4BVXA 3ZFLA 2OADA 2VKZG 3GKXA 4IP6A 4OD7A 3TOTA 10GSA 1T1VA 1GUMA 1ACVA 2DJ2A 5J4VA 3DYRA 3CTGA 3LORA 3FZAA 4POLA 2PUKC 3O3TA 2Z9SA 2JSYA 5B8AA 12GSA 5A5HB 2C4JA 4OWYA 2PN8A 1S3AA 1F6MC 2EIQA 4JRRA 4WF4A 3UBLA 2AHEA 2HRNA 4DEJA 4PNFA 3IOSA 3AY8A 3WT2A 1V57A 3BJ5A 2QGVA 4K7NA 3GKKA 5B6MA 1A8LA 1TW9A 4USSA 1YQ1A 5A34B 5J4YA 4L0UA 5IMFA 1AUCA 3LWAA 2LTKA 2VUPA 2DSAA 1Z5YE 2GZZA 4MZCA 4D73B 1FO5A 1F37A 4YAPA 1M2BA 3KGKA 2OE3A 1G7EA 4KF9A 4GLTA 3W6GA 1JLVA 5CRDA 1ZZYA 3HJOA 2F9SA 2FNOA 5DALA 5HR2A 4AGSA 5J4UA 2GLRA 1K0AA 2MYGA 2GSRA 1PN0A 2PBJA 4TR4A 4YH2A 3TJFA 3ISOA 2RLIA 2YWIA 2RM6A 3SBCA 5DDLA 5G5FA 2H6XA 2YZUA 4ACSA 3C7MA 4Z2TA 2L5OA 5ECLB 5ID2B 4L5OA 4K9ZA 2H73A 1N25A 4TRXA 2X8GA 4Q5RA 3GMFA 4ZXGA 3I69A 4MK3A 5FT3A 2BJXA 3FZ4A 4FH8A 2GZPA 4IHUA 4RQRA 2VCQA 1GNEA 1PSQA 4EDZA 1PA3A 3M1GA 2V41A 3H8QA 5D8IA 1Y6EA 4Q5QA 5IOWA 1VF4A 4ECIA 1O8WA 2DIYA 1A2JA 4J56E 2GQKA 4ZB7A 4BVXB 2H19A 4TXVA 2IL3A 5CRGA 3VPTA 3DIEA 3O6TA 2X8HA 3Q18A 2YP6A 2X4AA 1GTUA 4LMVA 4PNGA 3A2XA 2CVBA 2ON5A 2DC5A 4FYBA 3EYTA 1ON4A 4QQ7A 2DJ0A 2NBSA 2R6KA 2DJJA 4OO5A 13GSA 1FG4A 4NHZA 2B7KA 1WWJA 2BTOT 5JWQB 1WPIA 2RIIA 2P5RA 4MP4A 1TRUA 2I9HA 4IS0A 4MABA 4ZBDA 1R5PA 2H71A 4WF5A 5H5RA 4NXIA 4H86A 1XW5A 4LMWA 4I2TA 5EY6A 4IGJA 4L8EA 4LA1A 4XRAA 4LL1B 2UV8G 3DRNA 3D4TA 4F2IA 3PPUA 1X5DA 1QGVA 3KH9A 1BG1A 4EIQA 4X0XA 2EIRA 2HYXA 5F07A 2B5EA 1TJDA 2DBCA 4K7OA 3HCZA 4JR4A 1ILOA 2L59A 3JCML 1YF1A 2HZEA 1Q4JA 5JWRB 3US3A 5DQSA 3M3MA 4K5RA 3EMXA 2OA7A 3GHAA 3A3TA 4I2UA 4TN8A 2AUVA 4YQVA 4MMMA 1A23A 3GIXA 1PKZA 2QKEA 3F6DA 1X5EA 2YNXA 1T3BA 2G0FA 2VIMA 4YQUA 2RUEA 3GSTA 3ZVJD 3D6IA 1EOGA 2KHPA 1GWCA 3ME8A 2FWHA 1DSBA 2L57A 5KN0A 2HLSA 3ZREA 2IN3A 2X64A 3FYGA 4CY6A 2HRKB 4LL4B 2WDUA 3GH6A 3FW2A 4NMUA 3I9V2 4ML6A 3CSHA 1AIUA 4OCEA 2J23A 2ON7A 4EF0A 1XOAA 1AXDA 4QL7A 1J9BA 2KUCA 4K6XA 5G30A 2HQTA 1M7TA 5E4WA 3EMPA 5G1LA 2YWMA 3FMWA 5GSTA 3K8NA 3NOFA 1FOHA 4HS1A 3GNJA 3PGTA 2DMLA 2XPEA 4I8BA 2GZYA 2H1DA 1F3BA 3G7JA 2XC2A 1GH2A 4LLRA 4F0CA 2LJRA 3LJRA 5AGYA 4E68A 1X5CA 1ABAA 1GTBA 1FOVA 3LW9A 3IC8A 3WGEA 4MLYA 2EC4A 4MF6A 1T00A 2GT6A 3BCKA 4DSSA 4DSQA 4MZBA 3HJPA 3ERGA 2HRAA 3TJGA 5ECKB 1EV4A 5HR1A 1JZRA 4POBA 1AAZA 4OFMA 1B48A 4WXTA 4RQXA 3KM6A 3LEFA 4MPGA 5BRTA 4XIHA 4GXZA 4TKYA 4BVYA 4PX1A 4EC0A 5IMAA 2UZ8A 3LXZA 1WJKA 5CRWA 3VI7A 4PQIA 4ZB8A 4EIPA 4FO5A 5J40A 3F3QA 1QK8A 2HZEB 1YKAA 2CZ3A 1S3DA 2H8LA 1URMA 2TRCP 3KTBA 1USBA 4MF5A 2OBIA 1QUWA 2MBSA 1EEJA 3CMIA 5LNKe 3HA9A 1YKCA 1V98A 1NHOA 1Q98A 3KJYA 2VL9A 2DJ1A 1E2YA 5BMUA 5DCGA 2O8VB 4I5QA 2FWGA 1BJXA 4AJ8A 5KOWA 2O5VA 3GL5A 1BEDA 4IQAA 3VWUA 5HFIA 3TRXA 2LRCA 1V2AA 5D96A 4V2MA 2C3TA 4KGIA 6GSTA 3HKRA 2CX3A 1T8EB 4A5PA 2HI7A 2FHEA 3I43A 2BMXA 3J7Yk 2JZRA 4MJEA 1SVMA 1SD9A 4XHMA 3PR8A 1O8XA 4MH3A 1JHBA 5F8BA 3UARA 3A5WA 2CAQA 5ECSA 2IJYA 1AQXA 1K0DA 3RPNA 4V1Ag 1CQHA 2XBIA 1U87A 2O7KA 3KMNA 3LGCA 2IFQB 4YKFA 4CY8A 4EL1A 5ECOB 5ELGA 2L4QA 5ECQB 1TI3A 3MYDA 3TJJA 2LJKA 1Z7RA 2L6DA 3FR9A 5DQYA 2WFCA 2YV7A 4KW6A 5G1KA 3L9UA 4DSSB 5IO2A 1ERVA 2H74A 3C1SA 1TOFA 2O89A 3IXRA 1XIYA 3RAZA 3HVXA 1B8XA 2GDRA 3FR6A 4EE0A 3QMXA 3ZFBA 3MNGA 2P5QA 3IAS2 1Z6NA 3U6VA 1Z6MA 2IMKA 4GQCA 3C71A 4BVYB 2VCTA 5A34A 2VD1A 1SJZA 1XOBA 2PMTA 2H0HA 4YKGA 1DUGA 4HEA2 3KP8A 5J41A 3J7Yb 3UOMA 3IBHA 3UAPA 1VF2A 5GAPD 3L4NA 1BQ7A 2FGXA 3KIJA 4POMA 1ERWA 4V2NA 3WD6A 2A2PA 4HU9A 1ZYQB 4N3ZA 4TOPA 4PQ1A 1RK4A 3CRTA 2PERA 1I5GA 2B5YA 2LNTA 4DSRA 1AQVA 3FRCA 4TR1A 4IW9A 2V32A 3SWLA 5ECPB 3KP9A 2JACA 5BMUB 1R4WA 4KX4A 1VF3A 1A2MA 5FWGA 4OFNA 3RBTA 3D4MA 1I9DA 4P3YB 1K0OA 2V2GA 1M0UA 2AJQB 5D9WA 2AAWA 3CBUA 2K9FA 1GSDA 4RI6A 3IPZA 4ISDA 3EWLA 5DBQA 2LUSA 5E59A 2M72A 1SL1B 4BL7A 5GZZB 1MTCA 4N0ZA 1J08A 1SVOA 2HT9A 4OCFA 1GSYA 3P90A 4OFTA 3R3EA 3FZ5A 4KCEA 1YEPA 3F9UA 3VURA 3UL3A 2XHFA 3LYPA 2JZSA 3GUSA 3APQA 1SKRB 1EZKA 3UVTA 3QPMA 3CRUA 4AJ7A 2H1AA 2GSSA 1JFUA 2YJ7A 1TXUA 3UVHA 3FZ9A 1V9WA 2M80A 5F06A 5GAND 4CDOA 1PD21 1OC9A 5HFGA 3TRPA 7GSSA 4G2EA 2LRNA 2IMDA 4JBBA 1OC3A 2YV9A 4KH7A 5KN3A 3ZIJA 1JLWA 3M0FA 5LD0A 4KB3A 5A1NA 3DGQA 2E2MA 5JCUA 1PGTA 3ERWA 5FHIA 1XWGA 1TRVA 1F2EA 3U5RE 5HR3A 2IIYA 4EKZA 1MD3A 2B3SA 2QC7A 1V40A 5B8BA 2H6ZA 2O85A 4MJCA 2X99A 2IMFA 5JWOB 3RPPA 3RHBA 5IOXA 5EL8A 3P7XA 2B5XA 3TKSC 2R3XA 4FIWA 4AKIA 2C0EA 4TR1B 4ZL8A 2EIOA 1A8YA 3A5IA 2N5AA 3GSSA 1XWAA 4K1FA 4O7HA 2H0IA 3ZTLA 1J0FA 1W89A 4N10A 4KA0A 5JCGA 2P31A 1T7PB 1XWBA 4DVCA 1A0RP 1LJRA 5IMZA 3M8NA 3TRQA 1WIKA 1VGLA 2FUG2 3I6AA 3GKNA 4KSOA 4ZB6A 14GSA 1XW6A 3MDKA 2RM5A 4ECCA 3PINA 3CSJA 2H70A 4BL7B 4EVMA 1M2DA 2HRKA 6GSVA 4G19A 4HZ4A 1HYUA 5G5EA 3D22A 3TOUA 1KTEA 1A0FA 4KSMA 2WULA 1LU4A 4XS1A 1O81A 16GSA 4YAVA 2AV4A 3UIWA 1UN2A 5G2ZA 1K3LA 5ELAA 3LQ7A 1K0CA 2IWTA 1XVQA 2X8CA 4GCIA 1RQMA 5IMCA 4Z2RA 4W66A 3RHCA 3HJMA 1UC7A 2FWFA 2C3NA 1XBSA 1FB6A 1OC9B 5ECIB 3FEUA 4HJMA 4KCAA 4TR3A 5DJMA 3ZLPA 4AJ6A 5A1NB 2YN1A 3IE3A 6GSYA 5A4UA 3LG6A 2EFDA 3CTFA 4ZL7A 3FK8A 3TDGA 3TKRA 5IPGA 1FVJA 1S3CA 20GSA 4E8HA 3TKPA 4N0VA 2B6MA 4N30A 4AI6A 1TI1A 2H1GA 3KZQA 4G9HA 2LS5A 3TCOA 2H1LA 3TJKA 1GUHA 2C1YA 2HSNA 2CT6A 1O85A 3QFBC 3HXSA 3IR4A 1X9MB 2PWJA 4MCUA 1PL1A 1SU9A 1SL0B 1SK1A 1YZXA 2TRXA 4WETA 4MF7A 2P0GA 1K3YA 2MMZA 3HD5A 2MMNA 1SKSB 3GA4A 3IV4A 2XPDA 1W4VA 2L5LA 5G31A 4I6XA 2F8AA 1A2LA 4GSSA 2H76A 4G0LA 3WGXA 5J9BA 2L6CA 3QR6A 4AKHA 1XXUA 2FLSA 1R7HA 4G0KA 5ECRB 3CWGA 5D93A 3D21A 5D9TA 1GSFA 1OKDA 2LKUA 5AISA 3HVVA 3HDCA 1KBNA 1QFNA 3G9BA 1BX9A 5CYYA 4ZB9A 3EC3A 3PH9A 5HFKA 2VLUA 3KTLA 3UEMA 5IQYA 3ZMLA 2PVQA 3IAM2 3EVIA 4JU5A 1JZWA 1OKTA 3L0HA 3ED3A 3KH7A 2EFCA 4MPFA 1EEMA 3WT1A 3S9FA 1XCCA 4KDUA 1FAAA 2IFQA 2V6KA 5JCWA 4Z7XA 4CW9A 4F0BA 3KEBA 2VOCA 1B9XC 4GWRA 2OACA 2VCVA 3P8WA 2HE3A 3DXBA 5ECHB 3DMLA 3ZVJA 1WOUA 2K6VA 1YF0A 2JL4A 5CREA 3TKSE 3GL3A 2ALBA 1GNWA 2WRTA 4OO4A 3MWHA 4JE1A 2AB6A 3GFKA 4K7IA 2OBKA 4HZ2A 1FB0A 3F4SA 4RUVA 4NPBA 1GLPA 3EE2A 2N5FA 3EPTA 4HQSA 3GTUA 5IIZA 2VO4A 4WBRD 3C73A 3H79A 2WB9A 2PPTA 2V6OA 3DWVA 4NV5A 3Q19A 3DVWA 1SKWB 1QXHA 4L0WA 1DE1A 1B9YC 1B4QA 4Q5NA 2YANA 2CVKA 4GRFA 2WCIA 2HSNB 4KE3A 3F3RA 2I1UA 1BF5A 3TUEA 2CX4A 4NHWA 3L9SA 2C0DA 1K0NA 2TIRA 5LCZA 5AIXA 1FVKA 5AN1A 2LNSA 1Z7PA 4BPYA 2H01A 4HU7A 4F03A 5L71A 2G2QA 3HVSA 1YEXA 1OE7A 4PQHA 4N11A 4HOJA 3E9JB 2JU5A 2H6YA 4PTSA 1OE8A 2DMMA 1H75A 1SK0A 3ZL5A 5DJLA 1UVZA 1YJ6A 4HUAA 3C1RA 4G0IA 3BOAA 4ML1A 2ZUPA 2VCWA 4KDYA 4ZL9A 1HNCA 4HJ2A 1XW9A 1U6TA 1N8JA 1Z3EA 3EURA 2CZ2A 2GS3A 1GLQA 3ZITA 1R5AA 4PUFC 2PGTA 4WR5A 4GF0A 1ZOFA 2KLXA 3GRXA 3UMAA 11GSA 1T4YA 3HZ4A 6GSXA 2YOIA 1M9AA 3CXGA 1ML6A 2D2ZA 1GRXA 1OAZA 4MJBA 3VI5A 3IA1A 2KOKA 3A2VA 2B1LA 2O87A 1MDIA 5A5KA 1HNAA 4OMVA 2I4AA 5J5NA 1PQNA 2FA4A 1THXA 3IC4A 1G7OA 4PURA 4F82A 3GTUB 3G7YA 2VLVA 5KOXA 1DBYA 1G6WA 5COHA 2K8VA 4KDXA 2DKIA 2R5GA 3E3EA 1N2AA 1PX6A 1TRSA 4ECJA 1ERUA 1UA5A 5DAKA 3HYPA 4WR4A 3BD2A 2YWNA 2EFEA 2HSHA 2WGRA 1F9MA 3TU3B 2GTUA 5H5QA 2ES7A 2CV4A 2HSMB 2CQ9A 1Z9HA 3NIVA 2YCDA 1HQOA 2E7PA 2VL3A 17GSA 2A2SA 3UBKA 2YZHA 3WGDA 3WYWA 1TXXA 3MSZA 3QCPA 3C8EA 1U3AA 3VPQA 3TKSA 4ZIJA 5A4WA 3DVXA 3GKMA 4YQMA 3DEXA 3W8SA 2B7JA 5KEJA 1HD2A 4O92A 2HRFA 2QA1A 4JZQA 1QMVA 5IPHA 3APOA 2I3YA 3MIXA 1MDJA 5CAXA 3QAWA 1XVWA 1EOHA 1EWXA 3UJ1A 3RDWA 4RI7A 4IJ3A 3VLNA 3F6FA 1DE2A 1GTAA 2MMAA 1VF1A 5KN1A 4MDCA 4O32A 4J57E 4NV2A 5ABRA 2R0CA 2FD3A 3NZNA 4JEDA 5GSSA 3DD3A 5H5SA 2OE1A 1PN9A 1XWCA 5CO3A 5D9XA 1ERTA 1GUKA 19GSA 3ME7A 3W8JA 4QL9A 4GSNA 3HY2A 2HFDA 3G7IA 4EXJA 2K18A 1ZCPA 5C04A 1ZYPA 4ID0A 1SL2B 3D5JA 2ZNMA 2A4VA 1PL2A 3FY7A 3FHKA 1PX7A 1Y25A 2NTOA 3R2QA 3FKFA 2OT3A 4FYUA 5D9VA 5DAKB 1K3OA 4IN0A 1M2AA 1GSQA 5EPFA 2KP1A 2GQMA 2LEGA 1JZDA 3ZZXA 2AYTA 8GSSA 4KAEA 2K8SA 1X0RA 2VCZA 2QA2A 2VL2C 2KP2A 4TR0A 3GURA 2F8FA 1G0TA 1SENA 5CNWA 3ZIVA 1WRYA 4F9ZA 2C8UA 4GDFA 1YDKA 5ECMB 9GSSA 4IP1A 1BYEA 1MD4A 4IELA 3F63A 2NVLA 3QD9A 1O73A 4GQFA 5DCHA 4XS4B 4EUYA 4XRDA 1ZYEA 3Q74A 5IMDA 3KMOA 2FY6A 1PKWA 4K0NA 4TXOB 3TGZA 1THOA 2XBQA 4ZBAA 1AC1A 4E8EA 2DLXA 4J2FA 2LQQA 3ERFA 3H4KA 3IK7A 1ZMAA 1IYHA 1F3AA 2GT5A 4K2DA 5J3RA 4Z2UA 2FWEA 1TU8A 3GV1A 2F3MA 3QOUA 2PVOC 2WZ9A 4PUAA 2M46A 4ZBBA 1SJIA 3M9JA 4FQUA 4HDEA 2REMA 2VLTA 3N9JA 3D0ZA 3KD0A 2CAIA 2GSTA 1X9WB 4K5SA 4GSTA 4FYCA 1KEBA 3GN3A 1U88A 3M9KA 1SD8A 1BAYA 1X9SB 1U3IA 3TJBA 2WS2A 3OR5A 5DVBA 3LXTA 3TKQA 5DALB 3P2AA 1Y1UA 4MNNA 2HZFA 4ECBA 1C72A 3VWWA 2WJUA 2LSTA 4XS6A 5AIVA 1TP9A 5INYA 5D73A 3H93A 4KUNA 1RW1A 2R2JA 4IVFA 4XCSA 4HQZA 2JSZA 4KNDA 1XPVA 1OYJA 4Q5FA 1MEKA 4O5UA 3V1WA 2CA8A 2YWOA 3QDNA 1PMTA 1GTIA 4WKWA 3QFAC 3TB2A 1K0BA 1NM3A 3H1NA 3HMJG 2DIZA 3HHVA 2OKAA 1NHYA 1GSSA 2ZCTA 2HNLA 1XFLA 2YPMA 3L78A 2F51A 2GVPA 2C80A 3DKSA 2VM1A 5F0GA 4I97A 1SVLA 3IRAA 5B6NA 2MBTA 3EU4A 2VD0A 3GYKA 1NSWA 4MZWA 3QAGA 5B7CA 5ECNB 2GSQA 5HQPA 5F05A 5C00A 1TRWA 1PRXA 2R0PA 4IQ1A 2DJKA 2LQOA 2NPBA 4ZILA 22GSA 1OC8A 1SYXA 4IBPA 1G6YA 3LSZA 1XWKA 1EGOA 4BWSA 1SJ6A 5CP1A 1AQWA 3VFIA 2VCXA 3O76A 2GQLA 2H66A 1NW2A 2HSYA 4ILFA 3KXOA 4G10A 3EU3A 4EO3A 1YY7A 1TU7A 6GSSA 4O5QA 1OVNA 2QSIA 2VM2A 1BG5A 4HI7A 4K0GA 3QAVA 4AKGA 1TK0B 1V58A 6GSWA 18GSA 3F8UA 3L9VA 3VK9A 2RUFA 4NWYA 1WP0A 1SYRA 2MZCA 3N5OA 5A4VA 2GGTA 1M9BA 4BA7A 2A2RA 1GSUA 2R0GA 1FW1A 4O5RA 2HSMA 1IYIA 1JZOA 4V2LA 2LRTA 2L4CA 3IHGA 2LJAA 2N5BA 3HZ8A 4MH2A 3IHQA 1EP8A 1GP1A 1K0MA 2OJLA 2DJ3A 1HNBA 3ZYWA 4CHSA 1TKDB 1WMJA 5IM9A 5ENUA 1CQGA 1LBKA 1VRSD 3IK9A 1ST9A 3BBYA 1E6BA 3BCIA 2A4HA 4XTSA 2EFHA 2FCHA 2C3QA 3A2WA 1EP7A 1WE0A 3FR3A 2VAFA 2HXKA 1O6JA 4K8MA 5KN2A 1SK2A 2JZTA 4K2XA 1T4ZA 2NDOA 2JADA 1A24A 2CVDA 3Q6OA 1B4PA 4MA9A 4EDYA 5J9CA 1ZL9A 1QQ2A 4MJAA 4AF2A 3F4TA 3CSIA 4JR6A 3EINA 1GULA 3ZMKA 4WEYA 1GSEA 1GL8A 2H1BA 1R26A 3VWXA 2PU9C 4G01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZO A;  2H72 A;  4V1A p;  1TK5 B;  2IPA A;  4NAX A;  4POK A;  2V1M A;  4X1U A;  2R37 A;  4PXO A;  2C0G A;  2IMI A;  1H4O A;  2J9H A;  3MAK A;  3F0I A;  2B1K A;  1ZGN A;  4PGT A;  2FA8 A;  2MMO A;  3IDV A;  2E0Q A;  4D73 A;  3GH9 A;  2IME A;  1TK8 B;  1FHE A;  3LFL A;  5EVO A;  1O7U A;  4TW5 A;  2OE0 A;  2I81 A;  1TTZ A;  1M99 A;  2C0F A;  2H75 A;  4IKH A;  3F4R A;  4IJI A;  2E2G A;  4X43 A;  4ULX A;  2VL2 A;  4WBJ A;  5IO0 A;  5ID2 A;  1TDI A;  3KCM A;  2H30 A;  3GX8 A;  6GSU A;  2R4V A;  3E0U A;  4XS4 A;  3ZRD A;  3CYN A;  5IMV A;  4GTU A;  4TVE A;  3GX0 A;  3APS A;  1EV9 A;  4TXO A;  3VWV A;  4L5L A;  1KNG A;  5CRH A;  4BWQ A;  2YJH A;  5HR0 A;  1AW9 A;  3LYK A;  2LV3 A;  1EGR A;  1MDK A;  2H0G A;  4BVX A;  3ZFL A;  2OAD A;  3GKX A;  4IP6 A;  4OD7 A;  3TOT A;  10GS A;  1T1V A;  1GUM A;  1ACV A;  2DJ2 A;  3DYR A;  3CTG A;  3LOR A;  3FZA A;  4POL A;  2PUK C;  3O3T A;  2Z9S A;  2JSY A;  5B8A A;  12GS A;  2C4J A;  4OWY A;  2PN8 A;  1S3A A;  1F6M C;  2EIQ A;  4JRR A;  4WF4 A;  3UBL A;  2AHE A;  2HRN A;  4DEJ A;  4PNF A;  3IOS A;  3AY8 A;  3WT2 A;  1V57 A;  3BJ5 A;  2QGV A;  4K7N A;  3GKK A;  5B6M A;  1A8L A;  1TW9 A;  4USS A;  1YQ1 A;  4L0U A;  5IMF A;  1AUC A;  3LWA A;  2LTK A;  2VUP A;  2DSA A;  1Z5Y E;  2GZZ A;  4MZC A;  4D73 B;  1FO5 A;  1F37 A;  4YAP A;  1M2B A;  3KGK A;  2OE3 A;  1G7E A;  4KF9 A;  4GLT A;  3W6G A;  1JLV A;  5CRD A;  1ZZY A;  3HJO A;  2F9S A;  2FNO A;  5DAL A;  5HR2 A;  4AGS A;  5J4U A;  2GLR A;  1K0A A;  2MYG A;  2GSR A;  2PBJ A;  4TR4 A;  4YH2 A;  3TJF A;  3ISO A;  2RLI A;  2YWI A;  2RM6 A;  3SBC A;  5DDL A;  5G5F A;  2H6X A;  2YZU A;  4ACS A;  3C7M A;  2L5O A;  5ECL B;  5ID2 B;  4L5O A;  4K9Z A;  2H73 A;  4TRX A;  2X8G A;  4Q5R A;  3GMF A;  4ZXG A;  3I69 A;  4MK3 A;  5FT3 A;  2BJX A;  3FZ4 A;  4FH8 A;  2GZP A;  4IHU A;  4RQR A;  2VCQ A;  1GNE A;  1PSQ A;  4EDZ A;  1PA3 A;  3M1G A;  2V41 A;  3H8Q A;  5D8I A;  1Y6E A;  4Q5Q A;  5IOW A;  1VF4 A;  4ECI A;  1O8W A;  2DIY A;  1A2J A;  4J56 E;  2GQK A;  4BVX B;  2H19 A;  4TXV A;  2IL3 A;  5CRG A;  3VPT A;  3DIE A;  3O6T A;  2X8H A;  3Q18 A;  2YP6 A;  1GTU A;  4LMV A;  4PNG A;  3A2X A;  2CVB A;  2ON5 A;  2DC5 A;  4FYB A;  3EYT A;  1ON4 A;  4QQ7 A;  2DJ0 A;  2NBS A;  2R6K A;  2DJJ A;  4OO5 A;  13GS A;  1FG4 A;  4NHZ A;  2B7K A;  1WWJ A;  2BTO T;  5JWQ B;  1WPI A;  2RII A;  2P5R A;  4MP4 A;  1TRU A;  2I9H A;  4IS0 A;  4MAB A;  4ZBD A;  1R5P A;  2H71 A;  4WF5 A;  5H5R A;  4NXI A;  4H86 A;  1XW5 A;  4LMW A;  4I2T A;  5EY6 A;  4IGJ A;  4L8E A;  4LA1 A;  4XRA A;  4LL1 B;  3DRN A;  3D4T A;  4F2I A;  3PPU A;  1X5D A;  1QGV A;  3KH9 A;  4X0X A;  2EIR A;  2HYX A;  5F07 A;  2B5E A;  1TJD A;  2DBC A;  4K7O A;  3HCZ A;  4JR4 A;  1ILO A;  2L59 A;  3JCM L;  1YF1 A;  2HZE A;  1Q4J A;  5JWR B;  3US3 A;  5DQS A;  3M3M A;  3EMX A;  2OA7 A;  3GHA A;  3A3T A;  4I2U A;  4TN8 A;  2AUV A;  4YQV A;  4MMM A;  1A23 A;  3GIX A;  1PKZ A;  2QKE A;  3F6D A;  1X5E A;  2YNX A;  1T3B A;  2G0F A;  2VIM A;  4YQU A;  2RUE A;  3GST A;  3ZVJ D;  3D6I A;  1EOG A;  2KHP A;  1GWC A;  3ME8 A;  2FWH A;  1DSB A;  2L57 A;  5KN0 A;  2HLS A;  3ZRE A;  2IN3 A;  2X64 A;  3FYG A;  2HRK B;  4LL4 B;  2WDU A;  3GH6 A;  3FW2 A;  4NMU A;  3I9V 2;  4ML6 A;  3CSH A;  1AIU A;  4OCE A;  2J23 A;  2ON7 A;  4EF0 A;  1XOA A;  1AXD A;  4QL7 A;  1J9B A;  2KUC A;  4K6X A;  5G30 A;  2HQT A;  1M7T A;  5E4W A;  3EMP A;  5G1L A;  2YWM A;  5GST A;  3K8N A;  3NOF A;  4HS1 A;  3GNJ A;  3PGT A;  2DML A;  2XPE A;  4I8B A;  2GZY A;  2H1D A;  1F3B A;  3G7J A;  2XC2 A;  1GH2 A;  4LLR A;  4F0C A;  2LJR A;  3LJR A;  5AGY A;  1X5C A;  1ABA A;  1GTB A;  1FOV A;  3IC8 A;  3WGE A;  4MLY A;  2EC4 A;  4MF6 A;  1T00 A;  2GT6 A;  3BCK A;  4DSS A;  4DSQ A;  4MZB A;  3HJP A;  3ERG A;  2HRA A;  3TJG A;  5ECK B;  1EV4 A;  5HR1 A;  1JZR A;  4POB A;  1AAZ A;  4OFM A;  1B48 A;  4WXT A;  4RQX A;  3KM6 A;  3LEF A;  4MPG A;  4XIH A;  4GXZ A;  4TKY A;  4BVY A;  4PX1 A;  4EC0 A;  5IMA A;  2UZ8 A;  3LXZ A;  1WJK A;  5CRW A;  3VI7 A;  4PQI A;  4ZB8 A;  4FO5 A;  3F3Q A;  1QK8 A;  2HZE B;  1YKA A;  2CZ3 A;  1S3D A;  2H8L A;  1URM A;  2TRC P;  3KTB A;  1USB A;  4MF5 A;  2OBI A;  1QUW A;  2MBS A;  1EEJ A;  3CMI A;  5LNK e;  3HA9 A;  1YKC A;  1V98 A;  1NHO A;  1Q98 A;  3KJY A;  2VL9 A;  2DJ1 A;  1E2Y A;  5BMU A;  5DCG A;  2O8V B;  4I5Q A;  2FWG A;  1BJX A;  4AJ8 A;  3GL5 A;  1BED A;  4IQA A;  3VWU A;  5HFI A;  3TRX A;  2LRC A;  1V2A A;  5D96 A;  4V2M A;  2C3T A;  4KGI A;  6GST A;  3HKR A;  2CX3 A;  1T8E B;  2HI7 A;  2FHE A;  3I43 A;  2BMX A;  3J7Y k;  2JZR A;  4MJE A;  1SD9 A;  4XHM A;  3PR8 A;  1O8X A;  4MH3 A;  1JHB A;  5F8B A;  3UAR A;  3A5W A;  2CAQ A;  5ECS A;  2IJY A;  1AQX A;  1K0D A;  3RPN A;  4V1A g;  1CQH A;  2XBI A;  1U87 A;  2O7K A;  3KMN A;  3LGC A;  2IFQ B;  4EL1 A;  5ECO B;  5ELG A;  2L4Q A;  5ECQ B;  1TI3 A;  3TJJ A;  2LJK A;  1Z7R A;  2L6D A;  3FR9 A;  5DQY A;  2WFC A;  2YV7 A;  4KW6 A;  5G1K A;  3L9U A;  4DSS B;  5IO2 A;  1ERV A;  2H74 A;  3C1S A;  1TOF A;  2O89 A;  3IXR A;  1XIY A;  3RAZ A;  3HVX A;  1B8X A;  2GDR A;  3FR6 A;  4EE0 A;  3QMX A;  3ZFB A;  3MNG A;  2P5Q A;  3IAS 2;  1Z6N A;  3U6V A;  1Z6M A;  2IMK A;  4GQC A;  3C71 A;  4BVY B;  2VCT A;  2VD1 A;  1SJZ A;  1XOB A;  2PMT A;  2H0H A;  1DUG A;  4HEA 2;  3KP8 A;  5J41 A;  3J7Y b;  3UOM A;  3IBH A;  3UAP A;  1VF2 A;  5GAP D;  3L4N A;  1BQ7 A;  2FGX A;  3KIJ A;  4POM A;  1ERW A;  4V2N A;  3WD6 A;  4HU9 A;  1ZYQ B;  4TOP A;  4PQ1 A;  1RK4 A;  3CRT A;  2PER A;  1I5G A;  2B5Y A;  2LNT A;  4DSR A;  1AQV A;  3FRC A;  4TR1 A;  4IW9 A;  2V32 A;  3SWL A;  5ECP B;  3KP9 A;  2JAC A;  1R4W A;  4KX4 A;  1VF3 A;  1A2M A;  5FWG A;  4OFN A;  3RBT A;  3D4M A;  1I9D A;  4P3Y B;  1K0O A;  2V2G A;  1M0U A;  2AJQ B;  5D9W A;  2AAW A;  3CBU A;  2K9F A;  1GSD A;  4RI6 A;  3IPZ A;  4ISD A;  3EWL A;  5DBQ A;  2LUS A;  5E59 A;  2M72 A;  1SL1 B;  4BL7 A;  5GZZ B;  1MTC A;  4N0Z A;  1J08 A;  4OCF A;  2HT9 A;  1GSY A;  3P90 A;  4OFT A;  3R3E A;  3FZ5 A;  4KCE A;  1YEP A;  3F9U A;  3VUR A;  3UL3 A;  2XHF A;  3LYP A;  2JZS A;  3GUS A;  3APQ A;  1SKR B;  1EZK A;  3UVT A;  3QPM A;  3CRU A;  4AJ7 A;  2H1A A;  2GSS A;  1JFU A;  2YJ7 A;  3UVH A;  3FZ9 A;  1V9W A;  2M80 A;  5F06 A;  5GAN D;  4CDO A;  1PD2 1;  1OC9 A;  5HFG A;  3TRP A;  7GSS A;  4G2E A;  2LRN A;  2IMD A;  4JBB A;  1OC3 A;  2YV9 A;  4KH7 A;  5KN3 A;  3ZIJ A;  1JLW A;  3M0F A;  5LD0 A;  4KB3 A;  3DGQ A;  2E2M A;  5JCU A;  1PGT A;  3ERW A;  5FHI A;  1XWG A;  1TRV A;  1F2E A;  3U5R E;  5HR3 A;  2IIY A;  4EKZ A;  1MD3 A;  2B3S A;  2QC7 A;  1V40 A;  5B8B A;  2H6Z A;  2O85 A;  4MJC A;  2X99 A;  2IMF A;  5JWO B;  3RPP A;  3RHB A;  5IOX A;  5EL8 A;  3P7X A;  2B5X A;  3TKS C;  2R3X A;  4FIW A;  2C0E A;  4TR1 B;  4ZL8 A;  2EIO A;  1A8Y A;  2N5A A;  3GSS A;  1XWA A;  4K1F A;  4O7H A;  2H0I A;  3ZTL A;  1J0F A;  1W89 A;  4N10 A;  4KA0 A;  5JCG A;  2P31 A;  1T7P B;  1XWB A;  4DVC A;  1A0R P;  1LJR A;  5IMZ A;  3M8N A;  3TRQ A;  1WIK A;  1VGL A;  2FUG 2;  3I6A A;  3GKN A;  4KSO A;  4ZB6 A;  14GS A;  1XW6 A;  3MDK A;  2RM5 A;  4ECC A;  3PIN A;  3CSJ A;  2H70 A;  4BL7 B;  4EVM A;  1M2D A;  2HRK A;  6GSV A;  4G19 A;  4HZ4 A;  1HYU A;  5G5E A;  3D22 A;  3TOU A;  1KTE A;  1A0F A;  4KSM A;  2WUL A;  1LU4 A;  4XS1 A;  1O81 A;  16GS A;  4YAV A;  2AV4 A;  3UIW A;  1UN2 A;  5G2Z A;  1K3L A;  5ELA A;  3LQ7 A;  1K0C A;  2IWT A;  1XVQ A;  2X8C A;  4GCI A;  1RQM A;  5IMC A;  3RHC A;  3HJM A;  1UC7 A;  2FWF A;  2C3N A;  1XBS A;  1FB6 A;  1OC9 B;  5ECI B;  3FEU A;  4HJM A;  4KCA A;  4TR3 A;  5DJM A;  3ZLP A;  4AJ6 A;  2YN1 A;  3IE3 A;  6GSY A;  5A4U A;  3LG6 A;  3CTF A;  4ZL7 A;  3FK8 A;  3TDG A;  3TKR A;  5IPG A;  1FVJ A;  1S3C A;  20GS A;  4E8H A;  3TKP A;  4N0V A;  2B6M A;  4N30 A;  1TI1 A;  2H1G A;  3KZQ A;  4G9H A;  2LS5 A;  3TCO A;  3TJK A;  1GUH A;  2C1Y A;  2CT6 A;  1O85 A;  3QFB C;  3HXS A;  3IR4 A;  1X9M B;  2PWJ A;  4MCU A;  1PL1 A;  1SU9 A;  1SL0 B;  1SK1 A;  1YZX A;  2TRX A;  4WET A;  4MF7 A;  2P0G A;  1K3Y A;  2MMZ A;  3HD5 A;  2MMN A;  1SKS B;  3GA4 A;  3IV4 A;  2XPD A;  1W4V A;  2L5L A;  5G31 A;  4I6X A;  2F8A A;  1A2L A;  4GSS A;  2H76 A;  4G0L A;  3WGX A;  5J9B A;  2L6C A;  3QR6 A;  1XXU A;  2FLS A;  1R7H A;  4G0K A;  5ECR B;  5D93 A;  3D21 A;  5D9T A;  1GSF A;  1OKD A;  2LKU A;  5AIS A;  3HVV A;  3HDC A;  1KBN A;  1QFN A;  3G9B A;  1BX9 A;  5CYY A;  4ZB9 A;  3EC3 A;  3PH9 A;  5HFK A;  2VLU A;  3KTL A;  3UEM A;  5IQY A;  3ZML A;  2PVQ A;  3IAM 2;  3EVI A;  4JU5 A;  1JZW A;  1OKT A;  3L0H A;  3ED3 A;  3KH7 A;  4MPF A;  1EEM A;  3WT1 A;  3S9F A;  1XCC A;  4KDU A;  1FAA A;  2IFQ A;  2V6K A;  5JCW A;  4Z7X A;  4CW9 A;  4F0B A;  3KEB A;  2VOC A;  1B9X C;  4GWR A;  2OAC A;  2VCV A;  3P8W A;  2HE3 A;  3DXB A;  5ECH B;  3DML A;  3ZVJ A;  1WOU A;  2K6V A;  1YF0 A;  2JL4 A;  5CRE A;  3TKS E;  3GL3 A;  2ALB A;  1GNW A;  2WRT A;  4OO4 A;  3MWH A;  4JE1 A;  2AB6 A;  3GFK A;  4K7I A;  2OBK A;  4HZ2 A;  1FB0 A;  3F4S A;  4RUV A;  4NPB A;  1GLP A;  3EE2 A;  2N5F A;  4HQS A;  3GTU A;  5IIZ A;  2VO4 A;  4WBR D;  3C73 A;  3H79 A;  2WB9 A;  2PPT A;  2V6O A;  3DWV A;  4NV5 A;  3Q19 A;  3DVW A;  1SKW B;  1QXH A;  4L0W A;  1DE1 A;  1B9Y C;  1B4Q A;  4Q5N A;  2YAN A;  2CVK A;  4GRF A;  2WCI A;  2HSN B;  4KE3 A;  3F3R A;  2I1U A;  3TUE A;  2CX4 A;  4NHW A;  3L9S A;  2C0D A;  1K0N A;  2TIR A;  5LCZ A;  5AIX A;  1FVK A;  5AN1 A;  2LNS A;  1Z7P A;  4BPY A;  2H01 A;  4HU7 A;  4F03 A;  5L71 A;  2G2Q A;  3HVS A;  1YEX A;  1OE7 A;  4PQH A;  4N11 A;  4HOJ A;  3E9J B;  2JU5 A;  2H6Y A;  4PTS A;  1OE8 A;  2DMM A;  1H75 A;  1SK0 A;  3ZL5 A;  5DJL A;  1UVZ A;  1YJ6 A;  4HUA A;  3C1R A;  4G0I A;  3BOA A;  4ML1 A;  2ZUP A;  2VCW A;  4KDY A;  4ZL9 A;  1HNC A;  4HJ2 A;  1XW9 A;  1U6T A;  1N8J A;  1Z3E A;  3EUR A;  2CZ2 A;  2GS3 A;  1GLQ A;  3ZIT A;  1R5A A;  4PUF C;  2PGT A;  4WR5 A;  4GF0 A;  1ZOF A;  2KLX A;  3GRX A;  3UMA A;  11GS A;  1T4Y A;  3HZ4 A;  6GSX A;  2YOI A;  1M9A A;  3CXG A;  1ML6 A;  2D2Z A;  1GRX A;  1OAZ A;  4MJB A;  3VI5 A;  3IA1 A;  2KOK A;  3A2V A;  2B1L A;  2O87 A;  1MDI A;  5A5K A;  1HNA A;  4OMV A;  2I4A A;  5J5N A;  1PQN A;  2FA4 A;  1THX A;  3IC4 A;  1G7O A;  4PUR A;  4F82 A;  3GTU B;  3G7Y A;  2VLV A;  1DBY A;  1G6W A;  5COH A;  2K8V A;  4KDX A;  2R5G A;  3E3E A;  1N2A A;  1PX6 A;  1TRS A;  4ECJ A;  1ERU A;  1UA5 A;  5DAK A;  3HYP A;  4WR4 A;  3BD2 A;  2YWN A;  2HSH A;  2WGR A;  1F9M A;  2GTU A;  5H5Q A;  2ES7 A;  2CV4 A;  2HSM B;  2CQ9 A;  1Z9H A;  3NIV A;  2YCD A;  1HQO A;  2E7P A;  2VL3 A;  17GS A;  2A2S A;  3UBK A;  2YZH A;  3WGD A;  3WYW A;  1TXX A;  3MSZ A;  3QCP A;  3C8E A;  1U3A A;  3VPQ A;  3TKS A;  4ZIJ A;  5A4W A;  3DVX A;  3GKM A;  4YQM A;  3DEX A;  3W8S A;  2B7J A;  5KEJ A;  1HD2 A;  4O92 A;  2HRF A;  4JZQ A;  1QMV A;  5IPH A;  3APO A;  2I3Y A;  1MDJ A;  5CAX A;  3QAW A;  1XVW A;  1EOH A;  1EWX A;  3UJ1 A;  3RDW A;  4RI7 A;  4IJ3 A;  3VLN A;  3F6F A;  1DE2 A;  1GTA A;  2MMA A;  1VF1 A;  5KN1 A;  4MDC A;  4O32 A;  4J57 E;  4NV2 A;  5ABR A;  2FD3 A;  3NZN A;  4JED A;  5GSS A;  3DD3 A;  5H5S A;  2OE1 A;  1PN9 A;  1XWC A;  5CO3 A;  5D9X A;  1ERT A;  1GUK A;  19GS A;  3ME7 A;  3W8J A;  4QL9 A;  4GSN A;  3HY2 A;  2HFD A;  3G7I A;  4EXJ A;  2K18 A;  1ZCP A;  5C04 A;  4ID0 A;  1SL2 B;  3D5J A;  2ZNM A;  2A4V A;  1PL2 A;  3FY7 A;  3FHK A;  1PX7 A;  1Y25 A;  2NTO A;  3R2Q A;  3FKF A;  4FYU A;  5D9V A;  5DAK B;  1K3O A;  4IN0 A;  1M2A A;  1GSQ A;  5EPF A;  2KP1 A;  2GQM A;  2LEG A;  1JZD A;  3ZZX A;  2AYT A;  8GSS A;  4KAE A;  2K8S A;  1X0R A;  2VCZ A;  2VL2 C;  2KP2 A;  4TR0 A;  3GUR A;  2F8F A;  1G0T A;  1SEN A;  5CNW A;  3ZIV A;  1WRY A;  4F9Z A;  2C8U A;  1YDK A;  5ECM B;  9GSS A;  4IP1 A;  1BYE A;  1MD4 A;  4IEL A;  3F63 A;  2NVL A;  3QD9 A;  1O73 A;  4GQF A;  5DCH A;  4XS4 B;  4EUY A;  4XRD A;  1ZYE A;  3Q74 A;  5IMD A;  3KMO A;  2FY6 A;  1PKW A;  4K0N A;  4TXO B;  3TGZ A;  1THO A;  2XBQ A;  4ZBA A;  1AC1 A;  4E8E A;  2DLX A;  4J2F A;  2LQQ A;  3ERF A;  3H4K A;  3IK7 A;  1ZMA A;  1IYH A;  1F3A A;  2GT5 A;  4K2D A;  5J3R A;  2FWE A;  1TU8 A;  3GV1 A;  2F3M A;  3QOU A;  2PVO C;  2WZ9 A;  4PUA A;  2M46 A;  4ZBB A;  1SJI A;  3M9J A;  4FQU A;  4HDE A;  2REM A;  2VLT A;  3N9J A;  3D0Z A;  3KD0 A;  2CAI A;  2GST A;  1X9W B;  4GST A;  4FYC A;  1KEB A;  3GN3 A;  1U88 A;  3M9K A;  1SD8 A;  1BAY A;  1X9S B;  1U3I A;  3TJB A;  2WS2 A;  3OR5 A;  5DVB A;  3LXT A;  3TKQ A;  5DAL B;  3P2A A;  2HZF A;  4ECB A;  1C72 A;  3VWW A;  2WJU A;  2LST A;  4XS6 A;  5AIV A;  1TP9 A;  5INY A;  5D73 A;  3H93 A;  4KUN A;  1RW1 A;  2R2J A;  4IVF A;  4XCS A;  4HQZ A;  2JSZ A;  4KND A;  1XPV A;  1OYJ A;  4Q5F A;  1MEK A;  3V1W A;  2CA8 A;  2YWO A;  3QDN A;  1PMT A;  1GTI A;  4WKW A;  3QFA C;  3TB2 A;  1K0B A;  1NM3 A;  3H1N A;  2DIZ A;  3HHV A;  2OKA A;  1NHY A;  1GSS A;  2ZCT A;  2HNL A;  1XFL A;  2YPM A;  3L78 A;  2F51 A;  2GVP A;  2C80 A;  3DKS A;  2VM1 A;  5F0G A;  4I97 A;  3IRA A;  5B6N A;  2MBT A;  3EU4 A;  2VD0 A;  3GYK A;  1NSW A;  4MZW A;  3QAG A;  5B7C A;  5ECN B;  2GSQ A;  5HQP A;  5F05 A;  5C00 A;  1TRW A;  1PRX A;  4IQ1 A;  2DJK A;  2LQO A;  2NPB A;  4ZIL A;  22GS A;  1OC8 A;  1SYX A;  4IBP A;  1G6Y A;  3LSZ A;  1XWK A;  1EGO A;  4BWS A;  1SJ6 A;  5CP1 A;  1AQW A;  3VFI A;  2VCX A;  3O76 A;  2GQL A;  2H66 A;  1NW2 A;  2HSY A;  4ILF A;  3KXO A;  4G10 A;  3EU3 A;  4EO3 A;  1YY7 A;  1TU7 A;  6GSS A;  1OVN A;  2QSI A;  2VM2 A;  1BG5 A;  4HI7 A;  4K0G A;  3QAV A;  1TK0 B;  1V58 A;  6GSW A;  18GS A;  3F8U A;  3L9V A;  3VK9 A;  2RUF A;  4NWY A;  1WP0 A;  1SYR A;  2MZC A;  3N5O A;  5A4V A;  2GGT A;  1M9B A;  4BA7 A;  2A2R A;  1GSU A;  1FW1 A;  4O5R A;  2HSM A;  1IYI A;  1JZO A;  4V2L A;  2LRT A;  2L4C A;  2LJA A;  2N5B A;  3HZ8 A;  4MH2 A;  3IHQ A;  1EP8 A;  1GP1 A;  1K0M A;  2OJL A;  2DJ3 A;  1HNB A;  3ZYW A;  4CHS A;  1TKD B;  1WMJ A;  5IM9 A;  5ENU A;  1CQG A;  1LBK A;  1VRS D;  3IK9 A;  1ST9 A;  3BBY A;  1E6B A;  3BCI A;  4XTS A;  2FCH A;  2C3Q A;  3A2W A;  1EP7 A;  1WE0 A;  3FR3 A;  2VAF A;  2HXK A;  1O6J A;  4K8M A;  5KN2 A;  1SK2 A;  2JZT A;  1T4Z A;  2NDO A;  2JAD A;  1A24 A;  2CVD A;  3Q6O A;  1B4P A;  4MA9 A;  4EDY A;  5J9C A;  1ZL9 A;  1QQ2 A;  4MJA A;  4AF2 A;  3F4T A;  3CSI A;  4JR6 A;  3EIN A;  1GUL A;  3ZMK A;  4WEY A;  1GSE A;  1GL8 A;  2H1B A;  1R26 A;  3VWX A;  2PU9 C; 
#chains in the Genus database with same CATH topology
 1XZO A;  2H72 A;  4V1A p;  5A5H A;  1TK5 B;  2IPA A;  4NAX A;  4POK A;  2V1M A;  4X1U A;  2R37 A;  2X49 A;  4PXO A;  5J47 A;  2C0G A;  2IMI A;  1H4O A;  2J9H A;  4ICY A;  3MAK A;  3F0I A;  4QMK A;  2B1K A;  1M3I A;  1ZGN A;  4PGT A;  2FA8 A;  2MMO A;  3IDV A;  2E0Q A;  4D73 A;  3GH9 A;  2IME A;  1TK8 B;  1FHE A;  3LFL A;  5EVO A;  1O7U A;  4TW5 A;  2OE0 A;  2I81 A;  1TTZ A;  1M99 A;  2C0F A;  2H75 A;  1ZYN A;  4IKH A;  3F4R A;  4IJI A;  2E2G A;  4X43 A;  4ULX A;  4AKX B;  2VL2 A;  4WBJ A;  5IO0 A;  5ID2 A;  1YVL A;  1TDI A;  3KCM A;  2H30 A;  2DKH A;  3GX8 A;  6GSU A;  2R4V A;  3E0U A;  4XS4 A;  3ZRD A;  4X4J A;  3CYN A;  5IMV A;  4GTU A;  4TVE A;  3GX0 A;  3APS A;  1EV9 A;  4TXO A;  3VWV A;  4L5L A;  1KNG A;  5CRH A;  4BWQ A;  2YJH A;  5HR0 A;  1AW9 A;  3LYK A;  2LV3 A;  1EGR A;  1MDK A;  2H0G A;  4BVX A;  3ZFL A;  2OAD A;  2VKZ G;  3GKX A;  4IP6 A;  4OD7 A;  3TOT A;  10GS A;  1T1V A;  1GUM A;  1ACV A;  2DJ2 A;  5J4V A;  1I1I P;  3DYR A;  3CTG A;  3LOR A;  3FZA A;  4POL A;  2PUK C;  3O3T A;  2Z9S A;  2JSY A;  5B8A A;  12GS A;  5A5H B;  2C4J A;  4OWY A;  2PN8 A;  1S3A A;  1F6M C;  2EIQ A;  4JRR A;  4WF4 A;  3UBL A;  2AHE A;  2HRN A;  4DEJ A;  4PNF A;  3IOS A;  3AY8 A;  3WT2 A;  1V57 A;  3BJ5 A;  2QGV A;  4K7N A;  3GKK A;  5B6M A;  1A8L A;  1TW9 A;  4USS A;  1YQ1 A;  5A34 B;  5J4Y A;  4L0U A;  5IMF A;  1AUC A;  3LWA A;  2LTK A;  2VUP A;  2DSA A;  1Z5Y E;  2GZZ A;  4MZC A;  4D73 B;  1FO5 A;  1F37 A;  4YAP A;  1M2B A;  3KGK A;  2OE3 A;  1G7E A;  4KF9 A;  4GLT A;  3W6G A;  1JLV A;  5CRD A;  1ZZY A;  3HJO A;  2F9S A;  2FNO A;  5DAL A;  5HR2 A;  4AGS A;  1S3R A;  5J4U A;  2GLR A;  1K0A A;  2MYG A;  2GSR A;  1PN0 A;  2PBJ A;  4TR4 A;  4YH2 A;  3TJF A;  3ISO A;  2RLI A;  4PHZ C;  2YWI A;  2RM6 A;  3SBC A;  5DDL A;  5G5F A;  2H6X A;  2YZU A;  4ACS A;  3C7M A;  4Z2T A;  2L5O A;  5ECL B;  5ID2 B;  4L5O A;  4K9Z A;  2H73 A;  1N25 A;  4TRX A;  2X8G A;  4Q5R A;  3GMF A;  4ZXG A;  3I69 A;  4MK3 A;  5FT3 A;  2BJX A;  3FZ4 A;  4FH8 A;  2GZP A;  4IHU A;  4RQR A;  2VCQ A;  1GNE A;  1PSQ A;  4EDZ A;  1PA3 A;  3M1G A;  2V41 A;  3H8Q A;  5D8I A;  1Y6E A;  4Q5Q A;  5IOW A;  1VF4 A;  4ECI A;  1O8W A;  2DIY A;  1A2J A;  4J56 E;  2GQK A;  4ZB7 A;  4BVX B;  2H19 A;  4TXV A;  2IL3 A;  5CRG A;  3VPT A;  3DIE A;  3O6T A;  2X8H A;  3Q18 A;  2YP6 A;  2X4A A;  1GTU A;  4LMV A;  4PNG A;  3A2X A;  2CVB A;  2ON5 A;  2DC5 A;  4FYB A;  3EYT A;  1ON4 A;  4QQ7 A;  2DJ0 A;  2NBS A;  2R6K A;  2DJJ A;  4OO5 A;  13GS A;  1FG4 A;  4NHZ A;  2B7K A;  1WWJ A;  2BTO T;  5JWQ B;  1WPI A;  2RII A;  2P5R A;  4MP4 A;  1TRU A;  2I9H A;  4IS0 A;  4MAB A;  4ZBD A;  1R5P A;  2H71 A;  4WF5 A;  5H5R A;  4NXI A;  4H86 A;  1XW5 A;  4LMW A;  4I2T A;  5EY6 A;  4IGJ A;  4L8E A;  4LA1 A;  4XRA A;  4LL1 B;  2UV8 G;  3DRN A;  3D4T A;  4F2I A;  3PPU A;  1X5D A;  1QGV A;  3KH9 A;  1BG1 A;  4EIQ A;  4X0X A;  2EIR A;  2HYX A;  5F07 A;  2B5E A;  1TJD A;  2DBC A;  4K7O A;  3HCZ A;  4JR4 A;  1ILO A;  2L59 A;  3JCM L;  1YF1 A;  2HZE A;  1Q4J A;  5JWR B;  3US3 A;  5DQS A;  3M3M A;  4K5R A;  3EMX A;  2OA7 A;  2WVY A;  3GHA A;  3A3T A;  4I2U A;  4TN8 A;  2AUV A;  4YQV A;  4MMM A;  1A23 A;  3GIX A;  1PKZ A;  2QKE A;  3F6D A;  1X5E A;  2YNX A;  1T3B A;  2G0F A;  2VIM A;  4YQU A;  2RUE A;  3GST A;  3ZVJ D;  3D6I A;  1EOG A;  2KHP A;  1GWC A;  3ME8 A;  2FWH A;  1DSB A;  2L57 A;  5KN0 A;  2HLS A;  3ZRE A;  2IN3 A;  2X64 A;  3FYG A;  4CY6 A;  2HRK B;  4LL4 B;  2WDU A;  3GH6 A;  3FW2 A;  4NMU A;  3I9V 2;  4ML6 A;  3CSH A;  1AIU A;  4OCE A;  2J23 A;  2ON7 A;  4EF0 A;  1XOA A;  1AXD A;  4QL7 A;  1J9B A;  2KUC A;  4K6X A;  5G30 A;  2HQT A;  1M7T A;  5E4W A;  3EMP A;  5G1L A;  2YWM A;  3FMW A;  5GST A;  3K8N A;  3NOF A;  1FOH A;  4HS1 A;  3GNJ A;  3PGT A;  2DML A;  2XPE A;  4I8B A;  2GZY A;  2H1D A;  1F3B A;  3G7J A;  2XC2 A;  1GH2 A;  2O3E A;  4LLR A;  4F0C A;  2LJR A;  3LJR A;  5AGY A;  4E68 A;  1X5C A;  1ABA A;  1GTB A;  1FOV A;  3LW9 A;  3IC8 A;  3WGE A;  4MLY A;  2EC4 A;  4MF6 A;  1T00 A;  2GT6 A;  3BCK A;  4DSS A;  4DSQ A;  4MZB A;  3HJP A;  3ERG A;  2HRA A;  3TJG A;  5ECK B;  1EV4 A;  5HR1 A;  1JZR A;  4POB A;  1AAZ A;  4OFM A;  1B48 A;  4WXT A;  4RQX A;  3KM6 A;  3LEF A;  4MPG A;  5BRT A;  4XIH A;  4GXZ A;  4TKY A;  4BVY A;  4PX1 A;  4EC0 A;  5IMA A;  2UZ8 A;  3LXZ A;  1WJK A;  5CRW A;  3VI7 A;  4PQI A;  4ZB8 A;  4EIP A;  4FO5 A;  5J40 A;  3F3Q A;  1QK8 A;  2HZE B;  1YKA A;  2CZ3 A;  1S3D A;  2H8L A;  1URM A;  2TRC P;  3KTB A;  1USB A;  4MF5 A;  2OBI A;  1QUW A;  2MBS A;  1EEJ A;  3CMI A;  5LNK e;  3HA9 A;  1YKC A;  1V98 A;  1NHO A;  1Q98 A;  3KJY A;  2VL9 A;  2DJ1 A;  1E2Y A;  5BMU A;  5DCG A;  2O8V B;  4I5Q A;  2O36 A;  2FWG A;  4HSC X;  1BJX A;  4AJ8 A;  5KOW A;  2O5V A;  3GL5 A;  1BED A;  4IQA A;  3VWU A;  5HFI A;  3TRX A;  2LRC A;  1V2A A;  5D96 A;  4V2M A;  2C3T A;  4KGI A;  6GST A;  3HKR A;  2CX3 A;  1T8E B;  4A5P A;  2HI7 A;  2FHE A;  3I43 A;  2BMX A;  3J7Y k;  2JZR A;  4MJE A;  1SVM A;  1SD9 A;  4XHM A;  3PR8 A;  1O8X A;  4MH3 A;  1JHB A;  5F8B A;  3UAR A;  3A5W A;  2CAQ A;  5ECS A;  2IJY A;  1AQX A;  1K0D A;  3RPN A;  4V1A g;  1CQH A;  2XBI A;  1U87 A;  2O7K A;  3KMN A;  3LGC A;  2IFQ B;  4YKF A;  4CY8 A;  4EL1 A;  5ECO B;  5ELG A;  2L4Q A;  5ECQ B;  1TI3 A;  3MYD A;  3TJJ A;  2LJK A;  1Z7R A;  2L6D A;  3FR9 A;  5DQY A;  2WFC A;  2YV7 A;  4KW6 A;  5G1K A;  3L9U A;  4DSS B;  5IO2 A;  1ERV A;  2H74 A;  3C1S A;  1TOF A;  2O89 A;  3IXR A;  1XIY A;  3RAZ A;  3HVX A;  1B8X A;  2GDR A;  3FR6 A;  4EE0 A;  3QMX A;  3ZFB A;  3MNG A;  2P5Q A;  3IAS 2;  1Z6N A;  3U6V A;  1Z6M A;  2IMK A;  4GQC A;  3C71 A;  4BVY B;  2VCT A;  5A34 A;  2VD1 A;  1SJZ A;  1XOB A;  2PMT A;  2H0H A;  4YKG A;  1DUG A;  4HEA 2;  3KP8 A;  5J41 A;  3J7Y b;  3UOM A;  3IBH A;  3UAP A;  1VF2 A;  5GAP D;  3L4N A;  1BQ7 A;  2FGX A;  3KIJ A;  4POM A;  1ERW A;  4V2N A;  3WD6 A;  2A2P A;  4HU9 A;  1ZYQ B;  4N3Z A;  4TOP A;  4PQ1 A;  1RK4 A;  3CRT A;  2PER A;  1I5G A;  2B5Y A;  2LNT A;  1M3J A;  4PI0 C;  4DSR A;  1AQV A;  3FRC A;  4TR1 A;  4IW9 A;  2V32 A;  3SWL A;  5ECP B;  3KP9 A;  2JAC A;  5BMU B;  1R4W A;  4KX4 A;  1VF3 A;  1A2M A;  5FWG A;  4OFN A;  3RBT A;  3D4M A;  1I9D A;  4P3Y B;  1K0O A;  2V2G A;  1M0U A;  2AJQ B;  5D9W A;  2AAW A;  3CBU A;  2K9F A;  1GSD A;  4RI6 A;  3IPZ A;  4ISD A;  3EWL A;  5DBQ A;  2LUS A;  5E59 A;  2M72 A;  1SL1 B;  4FXY P;  4BL7 A;  5GZZ B;  1MTC A;  4N0Z A;  1J08 A;  1SVO A;  2HT9 A;  4OCF A;  1GSY A;  3P90 A;  4OFT A;  3R3E A;  3FZ5 A;  4KCE A;  1YEP A;  3F9U A;  3VUR A;  3UL3 A;  2XHF A;  3LYP A;  2JZS A;  3GUS A;  3APQ A;  1SKR B;  1EZK A;  3UVT A;  3QPM A;  3CRU A;  4AJ7 A;  2H1A A;  2GSS A;  1JFU A;  2YJ7 A;  1TXU A;  3UVH A;  3FZ9 A;  1V9W A;  2M80 A;  5F06 A;  5GAN D;  4CDO A;  1PD2 1;  1OC9 A;  5HFG A;  3TRP A;  7GSS A;  4G2E A;  2LRN A;  2IMD A;  4JBB A;  1OC3 A;  2YV9 A;  4KH7 A;  5KN3 A;  3ZIJ A;  1JLW A;  3M0F A;  5LD0 A;  4KB3 A;  5A1N A;  3DGQ A;  2E2M A;  5JCU A;  1PGT A;  3ERW A;  2WW0 A;  5FHI A;  1XWG A;  1TRV A;  1F2E A;  3U5R E;  5HR3 A;  2IIY A;  4EKZ A;  1MD3 A;  2B3S A;  2QC7 A;  1V40 A;  5B8B A;  2H6Z A;  2O85 A;  4MJC A;  2X99 A;  2IMF A;  5JWO B;  3RPP A;  3RHB A;  5IOX A;  5EL8 A;  3P7X A;  2B5X A;  3TKS C;  2R3X A;  4FIW A;  4AKI A;  2C0E A;  4TR1 B;  4ZL8 A;  2EIO A;  1A8Y A;  3A5I A;  2N5A A;  3GSS A;  1XWA A;  4K1F A;  4O7H A;  2H0I A;  3ZTL A;  1J0F A;  1W89 A;  4N10 A;  4KA0 A;  5JCG A;  2P31 A;  1T7P B;  1S4B P;  1XWB A;  4DVC A;  1A0R P;  1LJR A;  5IMZ A;  3M8N A;  3TRQ A;  1WIK A;  1VGL A;  2FUG 2;  3I6A A;  3GKN A;  4KSO A;  2WW3 A;  4ZB6 A;  14GS A;  1XW6 A;  3MDK A;  2RM5 A;  4ECC A;  3PIN A;  3CSJ A;  2H70 A;  4BL7 B;  4EVM A;  1M2D A;  2HRK A;  6GSV A;  4G19 A;  4HZ4 A;  1HYU A;  5G5E A;  3D22 A;  3TOU A;  1KTE A;  1A0F A;  4KSM A;  2WUL A;  1LU4 A;  4XS1 A;  1O81 A;  16GS A;  4YAV A;  2AV4 A;  3UIW A;  1UN2 A;  5G2Z A;  1K3L A;  5ELA A;  3LQ7 A;  1K0C A;  2IWT A;  1XVQ A;  2X8C A;  4GCI A;  1RQM A;  5IMC A;  4Z2R A;  4W66 A;  3RHC A;  3HJM A;  1UC7 A;  2FWF A;  2C3N A;  3CHX C;  1XBS A;  1FB6 A;  1OC9 B;  5ECI B;  3FEU A;  4HJM A;  4KCA A;  4TR3 A;  5DJM A;  3ZLP A;  4AJ6 A;  5A1N B;  2YN1 A;  3IE3 A;  6GSY A;  5A4U A;  3LG6 A;  2EFD A;  3CTF A;  4ZL7 A;  3FK8 A;  3TDG A;  3TKR A;  5IPG A;  1YEW C;  1FVJ A;  1S3C A;  20GS A;  4E8H A;  3TKP A;  4N0V A;  2B6M A;  4N30 A;  4AI6 A;  1TI1 A;  2H1G A;  3KZQ A;  4G9H A;  2LS5 A;  3TCO A;  2H1L A;  3TJK A;  1GUH A;  2C1Y A;  2HSN A;  2CT6 A;  1O85 A;  3QFB C;  3HXS A;  3IR4 A;  1X9M B;  2PWJ A;  4MCU A;  1PL1 A;  1SU9 A;  1SL0 B;  3RGB C;  1SK1 A;  1YZX A;  2TRX A;  4WET A;  4MF7 A;  2P0G A;  1K3Y A;  2MMZ A;  3HD5 A;  2MMN A;  1SKS B;  3GA4 A;  3IV4 A;  2XPD A;  1W4V A;  2L5L A;  5G31 A;  4I6X A;  2F8A A;  1A2L A;  4GSS A;  2H76 A;  4G0L A;  3WGX A;  5J9B A;  2L6C A;  3QR6 A;  4AKH A;  1XXU A;  2FLS A;  1R7H A;  4G0K A;  5ECR B;  3CWG A;  5D93 A;  3D21 A;  5D9T A;  1GSF A;  1OKD A;  2LKU A;  5AIS A;  3HVV A;  3HDC A;  1KBN A;  1QFN A;  3G9B A;  1BX9 A;  5CYY A;  4ZB9 A;  3EC3 A;  3PH9 A;  5HFK A;  2VLU A;  3KTL A;  3UEM A;  3RFR C;  5IQY A;  3ZML A;  2PVQ A;  3IAM 2;  3EVI A;  4JU5 A;  1JZW A;  1OKT A;  3L0H A;  3ED3 A;  3KH7 A;  2EFC A;  4MPF A;  1EEM A;  3WT1 A;  3S9F A;  1XCC A;  4KDU A;  1FAA A;  2IFQ A;  2V6K A;  5JCW A;  4Z7X A;  4CW9 A;  4F0B A;  3KEB A;  2VOC A;  1B9X C;  4GWR A;  2OAC A;  2VCV A;  3P8W A;  2HE3 A;  3DXB A;  5ECH B;  3DML A;  3ZVJ A;  1WOU A;  2K6V A;  1YF0 A;  2JL4 A;  5CRE A;  3TKS E;  3GL3 A;  2ALB A;  1GNW A;  2WRT A;  4OO4 A;  3MWH A;  4JE1 A;  2AB6 A;  3GFK A;  4K7I A;  2OBK A;  4HZ2 A;  1FB0 A;  3F4S A;  4RUV A;  4NPB A;  1GLP A;  3EE2 A;  2N5F A;  3EPT A;  4HQS A;  3GTU A;  5IIZ A;  2VO4 A;  4WBR D;  3C73 A;  3H79 A;  2WB9 A;  2WZS A;  2PPT A;  2V6O A;  3DWV A;  4NV5 A;  3Q19 A;  3DVW A;  1SKW B;  1QXH A;  4L0W A;  1DE1 A;  1B9Y C;  1B4Q A;  4Q5N A;  2YAN A;  2WVX B;  2CVK A;  4GRF A;  2WCI A;  2HSN B;  4KE3 A;  3F3R A;  2I1U A;  1BF5 A;  3TUE A;  2CX4 A;  4NHW A;  3L9S A;  2C0D A;  1K0N A;  2TIR A;  5LCZ A;  5AIX A;  1FVK A;  5AN1 A;  2LNS A;  1Z7P A;  4BPY A;  2H01 A;  4HU7 A;  4F03 A;  5L71 A;  2G2Q A;  3HVS A;  1YEX A;  1OE7 A;  4PQH A;  4N11 A;  4HOJ A;  3E9J B;  2JU5 A;  2H6Y A;  4PTS A;  1OE8 A;  2DMM A;  1H75 A;  1SK0 A;  3ZL5 A;  5DJL A;  1UVZ A;  1YJ6 A;  4HUA A;  3C1R A;  4G0I A;  3BOA A;  4ML1 A;  2ZUP A;  2VCW A;  4KDY A;  4ZL9 A;  1HNC A;  4HJ2 A;  1XW9 A;  1U6T A;  1N8J A;  1Z3E A;  3EUR A;  2CZ2 A;  2GS3 A;  1GLQ A;  3ZIT A;  1R5A A;  4PUF C;  2PGT A;  4WR5 A;  4GF0 A;  1ZOF A;  2KLX A;  3GRX A;  3UMA A;  11GS A;  1T4Y A;  3HZ4 A;  6GSX A;  2YOI A;  1M9A A;  3CXG A;  1ML6 A;  2D2Z A;  1GRX A;  1OAZ A;  4MJB A;  3VI5 A;  3IA1 A;  2KOK A;  3A2V A;  2B1L A;  2O87 A;  1MDI A;  5A5K A;  1HNA A;  4OMV A;  2I4A A;  5J5N A;  1PQN A;  2FA4 A;  1THX A;  3IC4 A;  1G7O A;  4PUR A;  4F82 A;  1XG8 A;  3GTU B;  3G7Y A;  2VLV A;  5KOX A;  1DBY A;  1G6W A;  5COH A;  2K8V A;  4KDX A;  2DKI A;  2R5G A;  3E3E A;  1N2A A;  1PX6 A;  1TRS A;  4ECJ A;  1ERU A;  1UA5 A;  5DAK A;  3HYP A;  4WR4 A;  3BD2 A;  2YWN A;  2EFE A;  2HSH A;  2WGR A;  1F9M A;  3TU3 B;  2GTU A;  5H5Q A;  2ES7 A;  2CV4 A;  2HSM B;  2CQ9 A;  1Z9H A;  3NIV A;  2YCD A;  1HQO A;  2E7P A;  2VL3 A;  17GS A;  2A2S A;  3UBK A;  2YZH A;  3WGD A;  3WYW A;  1TXX A;  3MSZ A;  3QCP A;  3C8E A;  1U3A A;  3VPQ A;  3TKS A;  4ZIJ A;  5A4W A;  3DVX A;  3GKM A;  4YQM A;  3DEX A;  3W8S A;  2B7J A;  5KEJ A;  1HD2 A;  4O92 A;  2HRF A;  2QA1 A;  4JZQ A;  1QMV A;  5IPH A;  3APO A;  2I3Y A;  3MIX A;  1MDJ A;  5CAX A;  3QAW A;  1XVW A;  1EOH A;  1EWX A;  3UJ1 A;  3RDW A;  4RI7 A;  4IJ3 A;  3VLN A;  3F6F A;  1DE2 A;  1GTA A;  2MMA A;  1VF1 A;  5KN1 A;  4MDC A;  4O32 A;  4J57 E;  4NV2 A;  5ABR A;  2R0C A;  2FD3 A;  3NZN A;  4JED A;  5GSS A;  3DD3 A;  5H5S A;  2OE1 A;  1PN9 A;  1XWC A;  5CO3 A;  5D9X A;  1ERT A;  1GUK A;  19GS A;  3ME7 A;  3W8J A;  4QL9 A;  4GSN A;  3HY2 A;  2HFD A;  3G7I A;  4EXJ A;  2K18 A;  1ZCP A;  5C04 A;  1ZYP A;  4ID0 A;  1SL2 B;  3D5J A;  2ZNM A;  2A4V A;  1PL2 A;  3FY7 A;  3FHK A;  1PX7 A;  1Y25 A;  2NTO A;  3R2Q A;  3FKF A;  2OT3 A;  4FYU A;  5D9V A;  5DAK B;  1K3O A;  4IN0 A;  1M2A A;  1GSQ A;  5EPF A;  2KP1 A;  2GQM A;  2LEG A;  1JZD A;  3ZZX A;  2AYT A;  8GSS A;  4KAE A;  2K8S A;  1X0R A;  2VCZ A;  2QA2 A;  2VL2 C;  2KP2 A;  4TR0 A;  3GUR A;  2F8F A;  1G0T A;  1SEN A;  5CNW A;  3ZIV A;  1WRY A;  4F9Z A;  2C8U A;  4GDF A;  1YDK A;  5ECM B;  9GSS A;  4IP1 A;  1BYE A;  3CQF A;  1MD4 A;  4IEL A;  3F63 A;  2NVL A;  3QD9 A;  1O73 A;  2WW2 A;  4GQF A;  5DCH A;  4XS4 B;  4EUY A;  4XRD A;  1ZYE A;  3Q74 A;  5IMD A;  3KMO A;  2FY6 A;  1PKW A;  4K0N A;  4TXO B;  3TGZ A;  1THO A;  2XBQ A;  4ZBA A;  1AC1 A;  4E8E A;  2DLX A;  4J2F A;  4PI2 C;  2LQQ A;  3ERF A;  3H4K A;  3IK7 A;  1ZMA A;  1IYH A;  1F3A A;  2GT5 A;  4K2D A;  5J3R A;  4Z2U A;  2FWE A;  1TU8 A;  3GV1 A;  2F3M A;  3QOU A;  2PVO C;  2WZ9 A;  4PUA A;  2M46 A;  2WW1 A;  4ZBB A;  1SJI A;  3M9J A;  4FQU A;  4HDE A;  2REM A;  2VLT A;  3N9J A;  3D0Z A;  3KD0 A;  2CAI A;  2GST A;  1X9W B;  4K5S A;  4GST A;  4FYC A;  1KEB A;  2WVX A;  3GN3 A;  1U88 A;  3M9K A;  1SD8 A;  1BAY A;  1X9S B;  1U3I A;  3TJB A;  2WS2 A;  3OR5 A;  5DVB A;  3LXT A;  3TKQ A;  5DAL B;  3P2A A;  1Y1U A;  4MNN A;  2HZF A;  4ECB A;  1C72 A;  3VWW A;  2WJU A;  2LST A;  4XS6 A;  5AIV A;  1TP9 A;  5INY A;  5D73 A;  3H93 A;  4KUN A;  1RW1 A;  2R2J A;  4IVF A;  4XCS A;  4HQZ A;  2JSZ A;  4KND A;  1XPV A;  1OYJ A;  4Q5F A;  1MEK A;  4O5U A;  3V1W A;  2CA8 A;  2YWO A;  3QDN A;  1PMT A;  1GTI A;  4WKW A;  3QFA C;  3TB2 A;  1K0B A;  1NM3 A;  3H1N A;  3HMJ G;  2DIZ A;  3HHV A;  2OKA A;  1NHY A;  1GSS A;  2ZCT A;  2HNL A;  1XFL A;  2YPM A;  3L78 A;  2F51 A;  2GVP A;  2C80 A;  3DKS A;  2VM1 A;  5F0G A;  4I97 A;  1SVL A;  3IRA A;  2WVZ A;  5B6N A;  2MBT A;  3EU4 A;  2VD0 A;  3GYK A;  1NSW A;  4MZW A;  3QAG A;  5B7C A;  3HVN A;  5ECN B;  2GSQ A;  5HQP A;  5F05 A;  5C00 A;  1TRW A;  1PRX A;  2R0P A;  4IQ1 A;  2DJK A;  2LQO A;  2NPB A;  4ZIL A;  22GS A;  1OC8 A;  1SYX A;  4IBP A;  1G6Y A;  3LSZ A;  1XWK A;  1EGO A;  4BWS A;  1SJ6 A;  5CP1 A;  1AQW A;  3VFI A;  2VCX A;  3O76 A;  2GQL A;  2H66 A;  1NW2 A;  2HSY A;  4ILF A;  3KXO A;  4G10 A;  3EU3 A;  4EO3 A;  1YY7 A;  1TU7 A;  6GSS A;  4O5Q A;  1OVN A;  2QSI A;  2VM2 A;  1BG5 A;  4HI7 A;  4K0G A;  3QAV A;  4AKG A;  1TK0 B;  1V58 A;  6GSW A;  18GS A;  3F8U A;  3L9V A;  3VK9 A;  2RUF A;  4NWY A;  1WP0 A;  1SYR A;  2MZC A;  3N5O A;  5A4V A;  2GGT A;  1M9B A;  4BA7 A;  2A2R A;  1GSU A;  2R0G A;  1FW1 A;  4O5R A;  2HSM A;  1IYI A;  1JZO A;  4V2L A;  2LRT A;  2L4C A;  3IHG A;  2LJA A;  2N5B A;  3HZ8 A;  4MH2 A;  3IHQ A;  1EP8 A;  1GP1 A;  1K0M A;  2OJL A;  2DJ3 A;  1HNB A;  3ZYW A;  4CHS A;  1TKD B;  1WMJ A;  5IM9 A;  5ENU A;  1CQG A;  1LBK A;  1VRS D;  3IK9 A;  1ST9 A;  3BBY A;  1E6B A;  3BCI A;  2A4H A;  4XTS A;  2EFH A;  2FCH A;  2C3Q A;  3A2W A;  1EP7 A;  1WE0 A;  3FR3 A;  2VAF A;  2HXK A;  1O6J A;  4K8M A;  5KN2 A;  1SK2 A;  2JZT A;  4K2X A;  1T4Z A;  2NDO A;  2JAD A;  1A24 A;  2CVD A;  3Q6O A;  1B4P A;  4MA9 A;  4EDY A;  5J9C A;  1ZL9 A;  1QQ2 A;  4MJA A;  4AF2 A;  3F4T A;  3CSI A;  4JR6 A;  3EIN A;  1GUL A;  3ZMK A;  4WEY A;  4BIK A;  1GSE A;  1GL8 A;  2H1B A;  1PFO A;  1R26 A;  3VWX A;  2PU9 C;  4G01 A; 
#chains in the Genus database with same CATH homology
 1XZO A;  2H72 A;  4V1A p;  5A5H A;  1TK5 B;  2IPA A;  4NAX A;  4POK A;  2V1M A;  4X1U A;  2R37 A;  2X49 A;  4PXO A;  5J47 A;  2C0G A;  2IMI A;  1H4O A;  2J9H A;  4ICY A;  3MAK A;  3F0I A;  4QMK A;  2B1K A;  1ZGN A;  4PGT A;  2FA8 A;  2MMO A;  3IDV A;  2E0Q A;  4D73 A;  3GH9 A;  2IME A;  1TK8 B;  1FHE A;  3LFL A;  5EVO A;  1O7U A;  4TW5 A;  2OE0 A;  2I81 A;  1TTZ A;  1M99 A;  2C0F A;  2H75 A;  1ZYN A;  4IKH A;  3F4R A;  4IJI A;  2E2G A;  4X43 A;  4ULX A;  4AKX B;  2VL2 A;  4WBJ A;  5IO0 A;  5ID2 A;  1YVL A;  1TDI A;  3KCM A;  2H30 A;  2DKH A;  3GX8 A;  6GSU A;  2R4V A;  3E0U A;  4XS4 A;  3ZRD A;  4X4J A;  3CYN A;  5IMV A;  4GTU A;  4TVE A;  3GX0 A;  3APS A;  1EV9 A;  4TXO A;  3VWV A;  4L5L A;  1KNG A;  5CRH A;  4BWQ A;  2YJH A;  5HR0 A;  1AW9 A;  3LYK A;  2LV3 A;  1EGR A;  1MDK A;  2H0G A;  4BVX A;  3ZFL A;  2OAD A;  2VKZ G;  3GKX A;  4IP6 A;  4OD7 A;  3TOT A;  10GS A;  1T1V A;  1GUM A;  1ACV A;  2DJ2 A;  5J4V A;  3DYR A;  3CTG A;  3LOR A;  3FZA A;  4POL A;  2PUK C;  3O3T A;  2Z9S A;  2JSY A;  5B8A A;  12GS A;  5A5H B;  2C4J A;  4OWY A;  2PN8 A;  1S3A A;  1F6M C;  2EIQ A;  4JRR A;  4WF4 A;  3UBL A;  2AHE A;  2HRN A;  4DEJ A;  4PNF A;  3IOS A;  3AY8 A;  3WT2 A;  1V57 A;  3BJ5 A;  2QGV A;  4K7N A;  3GKK A;  5B6M A;  1A8L A;  1TW9 A;  4USS A;  1YQ1 A;  5A34 B;  5J4Y A;  4L0U A;  5IMF A;  1AUC A;  3LWA A;  2LTK A;  2VUP A;  2DSA A;  1Z5Y E;  2GZZ A;  4MZC A;  4D73 B;  1FO5 A;  1F37 A;  4YAP A;  1M2B A;  3KGK A;  2OE3 A;  1G7E A;  4KF9 A;  4GLT A;  3W6G A;  1JLV A;  5CRD A;  1ZZY A;  3HJO A;  2F9S A;  2FNO A;  5DAL A;  5HR2 A;  4AGS A;  5J4U A;  2GLR A;  1K0A A;  2MYG A;  2GSR A;  1PN0 A;  2PBJ A;  4TR4 A;  4YH2 A;  3TJF A;  3ISO A;  2RLI A;  2YWI A;  2RM6 A;  3SBC A;  5DDL A;  5G5F A;  2H6X A;  2YZU A;  4ACS A;  3C7M A;  4Z2T A;  2L5O A;  5ECL B;  5ID2 B;  4L5O A;  4K9Z A;  2H73 A;  1N25 A;  4TRX A;  2X8G A;  4Q5R A;  3GMF A;  4ZXG A;  3I69 A;  4MK3 A;  5FT3 A;  2BJX A;  3FZ4 A;  4FH8 A;  2GZP A;  4IHU A;  4RQR A;  2VCQ A;  1GNE A;  1PSQ A;  4EDZ A;  1PA3 A;  3M1G A;  2V41 A;  3H8Q A;  5D8I A;  1Y6E A;  4Q5Q A;  5IOW A;  1VF4 A;  4ECI A;  1O8W A;  2DIY A;  1A2J A;  4J56 E;  2GQK A;  4ZB7 A;  4BVX B;  2H19 A;  4TXV A;  2IL3 A;  5CRG A;  3VPT A;  3DIE A;  3O6T A;  2X8H A;  3Q18 A;  2YP6 A;  2X4A A;  1GTU A;  4LMV A;  4PNG A;  3A2X A;  2CVB A;  2ON5 A;  2DC5 A;  4FYB A;  3EYT A;  1ON4 A;  4QQ7 A;  2DJ0 A;  2NBS A;  2R6K A;  2DJJ A;  4OO5 A;  13GS A;  1FG4 A;  4NHZ A;  2B7K A;  1WWJ A;  2BTO T;  5JWQ B;  1WPI A;  2RII A;  2P5R A;  4MP4 A;  1TRU A;  2I9H A;  4IS0 A;  4MAB A;  4ZBD A;  1R5P A;  2H71 A;  4WF5 A;  5H5R A;  4NXI A;  4H86 A;  1XW5 A;  4LMW A;  4I2T A;  5EY6 A;  4IGJ A;  4L8E A;  4LA1 A;  4XRA A;  4LL1 B;  2UV8 G;  3DRN A;  3D4T A;  4F2I A;  3PPU A;  1X5D A;  1QGV A;  3KH9 A;  1BG1 A;  4EIQ A;  4X0X A;  2EIR A;  2HYX A;  5F07 A;  2B5E A;  1TJD A;  2DBC A;  4K7O A;  3HCZ A;  4JR4 A;  1ILO A;  2L59 A;  3JCM L;  1YF1 A;  2HZE A;  1Q4J A;  5JWR B;  3US3 A;  5DQS A;  3M3M A;  4K5R A;  3EMX A;  2OA7 A;  3GHA A;  3A3T A;  4I2U A;  4TN8 A;  2AUV A;  4YQV A;  4MMM A;  1A23 A;  3GIX A;  1PKZ A;  2QKE A;  3F6D A;  1X5E A;  2YNX A;  1T3B A;  2G0F A;  2VIM A;  4YQU A;  2RUE A;  3GST A;  3ZVJ D;  3D6I A;  1EOG A;  2KHP A;  1GWC A;  3ME8 A;  2FWH A;  1DSB A;  2L57 A;  5KN0 A;  2HLS A;  3ZRE A;  2IN3 A;  2X64 A;  3FYG A;  4CY6 A;  2HRK B;  4LL4 B;  2WDU A;  3GH6 A;  3FW2 A;  4NMU A;  3I9V 2;  4ML6 A;  3CSH A;  1AIU A;  4OCE A;  2J23 A;  2ON7 A;  4EF0 A;  1XOA A;  1AXD A;  4QL7 A;  1J9B A;  2KUC A;  4K6X A;  5G30 A;  2HQT A;  1M7T A;  5E4W A;  3EMP A;  5G1L A;  2YWM A;  3FMW A;  5GST A;  3K8N A;  3NOF A;  1FOH A;  4HS1 A;  3GNJ A;  3PGT A;  2DML A;  2XPE A;  4I8B A;  2GZY A;  2H1D A;  1F3B A;  3G7J A;  2XC2 A;  1GH2 A;  4LLR A;  4F0C A;  2LJR A;  3LJR A;  5AGY A;  4E68 A;  1X5C A;  1ABA A;  1GTB A;  1FOV A;  3LW9 A;  3IC8 A;  3WGE A;  4MLY A;  2EC4 A;  4MF6 A;  1T00 A;  2GT6 A;  3BCK A;  4DSS A;  4DSQ A;  4MZB A;  3HJP A;  3ERG A;  2HRA A;  3TJG A;  5ECK B;  1EV4 A;  5HR1 A;  1JZR A;  4POB A;  1AAZ A;  4OFM A;  1B48 A;  4WXT A;  4RQX A;  3KM6 A;  3LEF A;  4MPG A;  5BRT A;  4XIH A;  4GXZ A;  4TKY A;  4BVY A;  4PX1 A;  4EC0 A;  5IMA A;  2UZ8 A;  3LXZ A;  1WJK A;  5CRW A;  3VI7 A;  4PQI A;  4ZB8 A;  4EIP A;  4FO5 A;  5J40 A;  3F3Q A;  1QK8 A;  2HZE B;  1YKA A;  2CZ3 A;  1S3D A;  2H8L A;  1URM A;  2TRC P;  3KTB A;  1USB A;  4MF5 A;  2OBI A;  1QUW A;  2MBS A;  1EEJ A;  3CMI A;  5LNK e;  3HA9 A;  1YKC A;  1V98 A;  1NHO A;  1Q98 A;  3KJY A;  2VL9 A;  2DJ1 A;  1E2Y A;  5BMU A;  5DCG A;  2O8V B;  4I5Q A;  2FWG A;  1BJX A;  4AJ8 A;  5KOW A;  2O5V A;  3GL5 A;  1BED A;  4IQA A;  3VWU A;  5HFI A;  3TRX A;  2LRC A;  1V2A A;  5D96 A;  4V2M A;  2C3T A;  4KGI A;  6GST A;  3HKR A;  2CX3 A;  1T8E B;  4A5P A;  2HI7 A;  2FHE A;  3I43 A;  2BMX A;  3J7Y k;  2JZR A;  4MJE A;  1SVM A;  1SD9 A;  4XHM A;  3PR8 A;  1O8X A;  4MH3 A;  1JHB A;  5F8B A;  3UAR A;  3A5W A;  2CAQ A;  5ECS A;  2IJY A;  1AQX A;  1K0D A;  3RPN A;  4V1A g;  1CQH A;  2XBI A;  1U87 A;  2O7K A;  3KMN A;  3LGC A;  2IFQ B;  4YKF A;  4CY8 A;  4EL1 A;  5ECO B;  5ELG A;  2L4Q A;  5ECQ B;  1TI3 A;  3MYD A;  3TJJ A;  2LJK A;  1Z7R A;  2L6D A;  3FR9 A;  5DQY A;  2WFC A;  2YV7 A;  4KW6 A;  5G1K A;  3L9U A;  4DSS B;  5IO2 A;  1ERV A;  2H74 A;  3C1S A;  1TOF A;  2O89 A;  3IXR A;  1XIY A;  3RAZ A;  3HVX A;  1B8X A;  2GDR A;  3FR6 A;  4EE0 A;  3QMX A;  3ZFB A;  3MNG A;  2P5Q A;  3IAS 2;  1Z6N A;  3U6V A;  1Z6M A;  2IMK A;  4GQC A;  3C71 A;  4BVY B;  2VCT A;  5A34 A;  2VD1 A;  1SJZ A;  1XOB A;  2PMT A;  2H0H A;  4YKG A;  1DUG A;  4HEA 2;  3KP8 A;  5J41 A;  3J7Y b;  3UOM A;  3IBH A;  3UAP A;  1VF2 A;  5GAP D;  3L4N A;  1BQ7 A;  2FGX A;  3KIJ A;  4POM A;  1ERW A;  4V2N A;  3WD6 A;  2A2P A;  4HU9 A;  1ZYQ B;  4N3Z A;  4TOP A;  4PQ1 A;  1RK4 A;  3CRT A;  2PER A;  1I5G A;  2B5Y A;  2LNT A;  4DSR A;  1AQV A;  3FRC A;  4TR1 A;  4IW9 A;  2V32 A;  3SWL A;  5ECP B;  3KP9 A;  2JAC A;  5BMU B;  1R4W A;  4KX4 A;  1VF3 A;  1A2M A;  5FWG A;  4OFN A;  3RBT A;  3D4M A;  1I9D A;  4P3Y B;  1K0O A;  2V2G A;  1M0U A;  2AJQ B;  5D9W A;  2AAW A;  3CBU A;  2K9F A;  1GSD A;  4RI6 A;  3IPZ A;  4ISD A;  3EWL A;  5DBQ A;  2LUS A;  5E59 A;  2M72 A;  1SL1 B;  4BL7 A;  5GZZ B;  1MTC A;  4N0Z A;  1J08 A;  1SVO A;  2HT9 A;  4OCF A;  1GSY A;  3P90 A;  4OFT A;  3R3E A;  3FZ5 A;  4KCE A;  1YEP A;  3F9U A;  3VUR A;  3UL3 A;  2XHF A;  3LYP A;  2JZS A;  3GUS A;  3APQ A;  1SKR B;  1EZK A;  3UVT A;  3QPM A;  3CRU A;  4AJ7 A;  2H1A A;  2GSS A;  1JFU A;  2YJ7 A;  1TXU A;  3UVH A;  3FZ9 A;  1V9W A;  2M80 A;  5F06 A;  5GAN D;  4CDO A;  1PD2 1;  1OC9 A;  5HFG A;  3TRP A;  7GSS A;  4G2E A;  2LRN A;  2IMD A;  4JBB A;  1OC3 A;  2YV9 A;  4KH7 A;  5KN3 A;  3ZIJ A;  1JLW A;  3M0F A;  5LD0 A;  4KB3 A;  5A1N A;  3DGQ A;  2E2M A;  5JCU A;  1PGT A;  3ERW A;  5FHI A;  1XWG A;  1TRV A;  1F2E A;  3U5R E;  5HR3 A;  2IIY A;  4EKZ A;  1MD3 A;  2B3S A;  2QC7 A;  1V40 A;  5B8B A;  2H6Z A;  2O85 A;  4MJC A;  2X99 A;  2IMF A;  5JWO B;  3RPP A;  3RHB A;  5IOX A;  5EL8 A;  3P7X A;  2B5X A;  3TKS C;  2R3X A;  4FIW A;  4AKI A;  2C0E A;  4TR1 B;  4ZL8 A;  2EIO A;  1A8Y A;  3A5I A;  2N5A A;  3GSS A;  1XWA A;  4K1F A;  4O7H A;  2H0I A;  3ZTL A;  1J0F A;  1W89 A;  4N10 A;  4KA0 A;  5JCG A;  2P31 A;  1T7P B;  1XWB A;  4DVC A;  1A0R P;  1LJR A;  5IMZ A;  3M8N A;  3TRQ A;  1WIK A;  1VGL A;  2FUG 2;  3I6A A;  3GKN A;  4KSO A;  4ZB6 A;  14GS A;  1XW6 A;  3MDK A;  2RM5 A;  4ECC A;  3PIN A;  3CSJ A;  2H70 A;  4BL7 B;  4EVM A;  1M2D A;  2HRK A;  6GSV A;  4G19 A;  4HZ4 A;  1HYU A;  5G5E A;  3D22 A;  3TOU A;  1KTE A;  1A0F A;  4KSM A;  2WUL A;  1LU4 A;  4XS1 A;  1O81 A;  16GS A;  4YAV A;  2AV4 A;  3UIW A;  1UN2 A;  5G2Z A;  1K3L A;  5ELA A;  3LQ7 A;  1K0C A;  2IWT A;  1XVQ A;  2X8C A;  4GCI A;  1RQM A;  5IMC A;  4Z2R A;  4W66 A;  3RHC A;  3HJM A;  1UC7 A;  2FWF A;  2C3N A;  1XBS A;  1FB6 A;  1OC9 B;  5ECI B;  3FEU A;  4HJM A;  4KCA A;  4TR3 A;  5DJM A;  3ZLP A;  4AJ6 A;  5A1N B;  2YN1 A;  3IE3 A;  6GSY A;  5A4U A;  3LG6 A;  2EFD A;  3CTF A;  4ZL7 A;  3FK8 A;  3TDG A;  3TKR A;  5IPG A;  1FVJ A;  1S3C A;  20GS A;  4E8H A;  3TKP A;  4N0V A;  2B6M A;  4N30 A;  4AI6 A;  1TI1 A;  2H1G A;  3KZQ A;  4G9H A;  2LS5 A;  3TCO A;  2H1L A;  3TJK A;  1GUH A;  2C1Y A;  2HSN A;  2CT6 A;  1O85 A;  3QFB C;  3HXS A;  3IR4 A;  1X9M B;  2PWJ A;  4MCU A;  1PL1 A;  1SU9 A;  1SL0 B;  1SK1 A;  1YZX A;  2TRX A;  4WET A;  4MF7 A;  2P0G A;  1K3Y A;  2MMZ A;  3HD5 A;  2MMN A;  1SKS B;  3GA4 A;  3IV4 A;  2XPD A;  1W4V A;  2L5L A;  5G31 A;  4I6X A;  2F8A A;  1A2L A;  4GSS A;  2H76 A;  4G0L A;  3WGX A;  5J9B A;  2L6C A;  3QR6 A;  4AKH A;  1XXU A;  2FLS A;  1R7H A;  4G0K A;  5ECR B;  3CWG A;  5D93 A;  3D21 A;  5D9T A;  1GSF A;  1OKD A;  2LKU A;  5AIS A;  3HVV A;  3HDC A;  1KBN A;  1QFN A;  3G9B A;  1BX9 A;  5CYY A;  4ZB9 A;  3EC3 A;  3PH9 A;  5HFK A;  2VLU A;  3KTL A;  3UEM A;  5IQY A;  3ZML A;  2PVQ A;  3IAM 2;  3EVI A;  4JU5 A;  1JZW A;  1OKT A;  3L0H A;  3ED3 A;  3KH7 A;  2EFC A;  4MPF A;  1EEM A;  3WT1 A;  3S9F A;  1XCC A;  4KDU A;  1FAA A;  2IFQ A;  2V6K A;  5JCW A;  4Z7X A;  4CW9 A;  4F0B A;  3KEB A;  2VOC A;  1B9X C;  4GWR A;  2OAC A;  2VCV A;  3P8W A;  2HE3 A;  3DXB A;  5ECH B;  3DML A;  3ZVJ A;  1WOU A;  2K6V A;  1YF0 A;  2JL4 A;  5CRE A;  3TKS E;  3GL3 A;  2ALB A;  1GNW A;  2WRT A;  4OO4 A;  3MWH A;  4JE1 A;  2AB6 A;  3GFK A;  4K7I A;  2OBK A;  4HZ2 A;  1FB0 A;  3F4S A;  4RUV A;  4NPB A;  1GLP A;  3EE2 A;  2N5F A;  3EPT A;  4HQS A;  3GTU A;  5IIZ A;  2VO4 A;  4WBR D;  3C73 A;  3H79 A;  2WB9 A;  2PPT A;  2V6O A;  3DWV A;  4NV5 A;  3Q19 A;  3DVW A;  1SKW B;  1QXH A;  4L0W A;  1DE1 A;  1B9Y C;  1B4Q A;  4Q5N A;  2YAN A;  2CVK A;  4GRF A;  2WCI A;  2HSN B;  4KE3 A;  3F3R A;  2I1U A;  1BF5 A;  3TUE A;  2CX4 A;  4NHW A;  3L9S A;  2C0D A;  1K0N A;  2TIR A;  5LCZ A;  5AIX A;  1FVK A;  5AN1 A;  2LNS A;  1Z7P A;  4BPY A;  2H01 A;  4HU7 A;  4F03 A;  5L71 A;  2G2Q A;  3HVS A;  1YEX A;  1OE7 A;  4PQH A;  4N11 A;  4HOJ A;  3E9J B;  2JU5 A;  2H6Y A;  4PTS A;  1OE8 A;  2DMM A;  1H75 A;  1SK0 A;  3ZL5 A;  5DJL A;  1UVZ A;  1YJ6 A;  4HUA A;  3C1R A;  4G0I A;  3BOA A;  4ML1 A;  2ZUP A;  2VCW A;  4KDY A;  4ZL9 A;  1HNC A;  4HJ2 A;  1XW9 A;  1U6T A;  1N8J A;  1Z3E A;  3EUR A;  2CZ2 A;  2GS3 A;  1GLQ A;  3ZIT A;  1R5A A;  4PUF C;  2PGT A;  4WR5 A;  4GF0 A;  1ZOF A;  2KLX A;  3GRX A;  3UMA A;  11GS A;  1T4Y A;  3HZ4 A;  6GSX A;  2YOI A;  1M9A A;  3CXG A;  1ML6 A;  2D2Z A;  1GRX A;  1OAZ A;  4MJB A;  3VI5 A;  3IA1 A;  2KOK A;  3A2V A;  2B1L A;  2O87 A;  1MDI A;  5A5K A;  1HNA A;  4OMV A;  2I4A A;  5J5N A;  1PQN A;  2FA4 A;  1THX A;  3IC4 A;  1G7O A;  4PUR A;  4F82 A;  3GTU B;  3G7Y A;  2VLV A;  5KOX A;  1DBY A;  1G6W A;  5COH A;  2K8V A;  4KDX A;  2DKI A;  2R5G A;  3E3E A;  1N2A A;  1PX6 A;  1TRS A;  4ECJ A;  1ERU A;  1UA5 A;  5DAK A;  3HYP A;  4WR4 A;  3BD2 A;  2YWN A;  2EFE A;  2HSH A;  2WGR A;  1F9M A;  3TU3 B;  2GTU A;  5H5Q A;  2ES7 A;  2CV4 A;  2HSM B;  2CQ9 A;  1Z9H A;  3NIV A;  2YCD A;  1HQO A;  2E7P A;  2VL3 A;  17GS A;  2A2S A;  3UBK A;  2YZH A;  3WGD A;  3WYW A;  1TXX A;  3MSZ A;  3QCP A;  3C8E A;  1U3A A;  3VPQ A;  3TKS A;  4ZIJ A;  5A4W A;  3DVX A;  3GKM A;  4YQM A;  3DEX A;  3W8S A;  2B7J A;  5KEJ A;  1HD2 A;  4O92 A;  2HRF A;  2QA1 A;  4JZQ A;  1QMV A;  5IPH A;  3APO A;  2I3Y A;  3MIX A;  1MDJ A;  5CAX A;  3QAW A;  1XVW A;  1EOH A;  1EWX A;  3UJ1 A;  3RDW A;  4RI7 A;  4IJ3 A;  3VLN A;  3F6F A;  1DE2 A;  1GTA A;  2MMA A;  1VF1 A;  5KN1 A;  4MDC A;  4O32 A;  4J57 E;  4NV2 A;  5ABR A;  2R0C A;  2FD3 A;  3NZN A;  4JED A;  5GSS A;  3DD3 A;  5H5S A;  2OE1 A;  1PN9 A;  1XWC A;  5CO3 A;  5D9X A;  1ERT A;  1GUK A;  19GS A;  3ME7 A;  3W8J A;  4QL9 A;  4GSN A;  3HY2 A;  2HFD A;  3G7I A;  4EXJ A;  2K18 A;  1ZCP A;  5C04 A;  1ZYP A;  4ID0 A;  1SL2 B;  3D5J A;  2ZNM A;  2A4V A;  1PL2 A;  3FY7 A;  3FHK A;  1PX7 A;  1Y25 A;  2NTO A;  3R2Q A;  3FKF A;  2OT3 A;  4FYU A;  5D9V A;  5DAK B;  1K3O A;  4IN0 A;  1M2A A;  1GSQ A;  5EPF A;  2KP1 A;  2GQM A;  2LEG A;  1JZD A;  3ZZX A;  2AYT A;  8GSS A;  4KAE A;  2K8S A;  1X0R A;  2VCZ A;  2QA2 A;  2VL2 C;  2KP2 A;  4TR0 A;  3GUR A;  2F8F A;  1G0T A;  1SEN A;  5CNW A;  3ZIV A;  1WRY A;  4F9Z A;  2C8U A;  4GDF A;  1YDK A;  5ECM B;  9GSS A;  4IP1 A;  1BYE A;  1MD4 A;  4IEL A;  3F63 A;  2NVL A;  3QD9 A;  1O73 A;  4GQF A;  5DCH A;  4XS4 B;  4EUY A;  4XRD A;  1ZYE A;  3Q74 A;  5IMD A;  3KMO A;  2FY6 A;  1PKW A;  4K0N A;  4TXO B;  3TGZ A;  1THO A;  2XBQ A;  4ZBA A;  1AC1 A;  4E8E A;  2DLX A;  4J2F A;  2LQQ A;  3ERF A;  3H4K A;  3IK7 A;  1ZMA A;  1IYH A;  1F3A A;  2GT5 A;  4K2D A;  5J3R A;  4Z2U A;  2FWE A;  1TU8 A;  3GV1 A;  2F3M A;  3QOU A;  2PVO C;  2WZ9 A;  4PUA A;  2M46 A;  4ZBB A;  1SJI A;  3M9J A;  4FQU A;  4HDE A;  2REM A;  2VLT A;  3N9J A;  3D0Z A;  3KD0 A;  2CAI A;  2GST A;  1X9W B;  4K5S A;  4GST A;  4FYC A;  1KEB A;  3GN3 A;  1U88 A;  3M9K A;  1SD8 A;  1BAY A;  1X9S B;  1U3I A;  3TJB A;  2WS2 A;  3OR5 A;  5DVB A;  3LXT A;  3TKQ A;  5DAL B;  3P2A A;  1Y1U A;  4MNN A;  2HZF A;  4ECB A;  1C72 A;  3VWW A;  2WJU A;  2LST A;  4XS6 A;  5AIV A;  1TP9 A;  5INY A;  5D73 A;  3H93 A;  4KUN A;  1RW1 A;  2R2J A;  4IVF A;  4XCS A;  4HQZ A;  2JSZ A;  4KND A;  1XPV A;  1OYJ A;  4Q5F A;  1MEK A;  4O5U A;  3V1W A;  2CA8 A;  2YWO A;  3QDN A;  1PMT A;  1GTI A;  4WKW A;  3QFA C;  3TB2 A;  1K0B A;  1NM3 A;  3H1N A;  3HMJ G;  2DIZ A;  3HHV A;  2OKA A;  1NHY A;  1GSS A;  2ZCT A;  2HNL A;  1XFL A;  2YPM A;  3L78 A;  2F51 A;  2GVP A;  2C80 A;  3DKS A;  2VM1 A;  5F0G A;  4I97 A;  1SVL A;  3IRA A;  5B6N A;  2MBT A;  3EU4 A;  2VD0 A;  3GYK A;  1NSW A;  4MZW A;  3QAG A;  5B7C A;  5ECN B;  2GSQ A;  5HQP A;  5F05 A;  5C00 A;  1TRW A;  1PRX A;  2R0P A;  4IQ1 A;  2DJK A;  2LQO A;  2NPB A;  4ZIL A;  22GS A;  1OC8 A;  1SYX A;  4IBP A;  1G6Y A;  3LSZ A;  1XWK A;  1EGO A;  4BWS A;  1SJ6 A;  5CP1 A;  1AQW A;  3VFI A;  2VCX A;  3O76 A;  2GQL A;  2H66 A;  1NW2 A;  2HSY A;  4ILF A;  3KXO A;  4G10 A;  3EU3 A;  4EO3 A;  1YY7 A;  1TU7 A;  6GSS A;  4O5Q A;  1OVN A;  2QSI A;  2VM2 A;  1BG5 A;  4HI7 A;  4K0G A;  3QAV A;  4AKG A;  1TK0 B;  1V58 A;  6GSW A;  18GS A;  3F8U A;  3L9V A;  3VK9 A;  2RUF A;  4NWY A;  1WP0 A;  1SYR A;  2MZC A;  3N5O A;  5A4V A;  2GGT A;  1M9B A;  4BA7 A;  2A2R A;  1GSU A;  2R0G A;  1FW1 A;  4O5R A;  2HSM A;  1IYI A;  1JZO A;  4V2L A;  2LRT A;  2L4C A;  3IHG A;  2LJA A;  2N5B A;  3HZ8 A;  4MH2 A;  3IHQ A;  1EP8 A;  1GP1 A;  1K0M A;  2OJL A;  2DJ3 A;  1HNB A;  3ZYW A;  4CHS A;  1TKD B;  1WMJ A;  5IM9 A;  5ENU A;  1CQG A;  1LBK A;  1VRS D;  3IK9 A;  1ST9 A;  3BBY A;  1E6B A;  3BCI A;  2A4H A;  4XTS A;  2EFH A;  2FCH A;  2C3Q A;  3A2W A;  1EP7 A;  1WE0 A;  3FR3 A;  2VAF A;  2HXK A;  1O6J A;  4K8M A;  5KN2 A;  1SK2 A;  2JZT A;  4K2X A;  1T4Z A;  2NDO A;  2JAD A;  1A24 A;  2CVD A;  3Q6O A;  1B4P A;  4MA9 A;  4EDY A;  5J9C A;  1ZL9 A;  1QQ2 A;  4MJA A;  4AF2 A;  3F4T A;  3CSI A;  4JR6 A;  3EIN A;  1GUL A;  3ZMK A;  4WEY A;  1GSE A;  1GL8 A;  2H1B A;  1R26 A;  3VWX A;  2PU9 C;  4G01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...