4EDYA

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Hematopoietic prostaglandin D synthase
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4edyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4edyA01
2DSAA 2YWMA 1O81A 2R2JA 4GRFA 5DAKA 1UC7A 2YJ7A 1FVJA 4GQFA 2GQLA 2ON5A 1FW1A 3G7IA 4F03A 4MLYA 1MDIA 3CBUA 4IW9A 3VFIA 5H5QA 1Z9HA 2JZTA 3VI7A 1F37A 1MDKA 3HVXA 3TKSC 2B7KA 1IYIA 3TKSA 6GSVA 4HQSA 1A0FA 1EV9A 3RDWA 2C3TA 6GSXA 3CRTA 2L4CA 1HYUA 4EUYA 2V6OA 1LJRA 4PXOA 1I5GA 1T4YA 5AN1A 2B6MA 4MK3A 3L78A 4POBA 2HNLA 6GSUA 1YJ6A 3HA9A 4DSQA 3FEUA 4K9ZA 4POLA 1A23A 1F2EA 2H70A 2X8HA 4MJEA 4V2NA 4G2EA 5EPFA 1WE0A 2WDUA 3V1WA 5G2ZA 3HDCA 4FIWA 3HXSA 2CX3A 5IMFA 1G7EA 4NWYA 3KIJA 4POMA 3TRPA 4CDOA 2B5XA 1CQGA 4IP6A 4N0VA 4K0NA 2F8FA 1M7TA 1XPVA 1DBYA 1N2AA 3H4KA 3D0ZA 3TRXA 4HS1A 2JU5A 5J3RA 5COHA 2WZ9A 2V6KA 5IMDA 1HNAA 5DQYA 5D93A 4KX4A 2E2MA 4E8HA 2FA4A 3BBYA 2OA7A 2GSSA 1R26A 3BJ5A 4KUNA 5G1KA 2NVLA 1FB0A 5AISA 4XIHA 5HFGA 1YF0A 2KOKA 2DLXA 2WGRA 2M80A 3FRCA 4PGTA 2R5GA 5J41A 1OE8A 3C1SA 4EF0A 3UVHA 2CZ3A 1ERUA 5F0GA 4K7NA 2C1YA 4PUAA 3R3EA 2WS2A 3IPZA 4IQ1A 2BTOT 1K0NA 1TOFA 3UEMA 4ZBBA 1ILOA 5KN3A 3ZREA 4IVFA 1GH2A 3C1RA 2FHEA 5ELGA 2J23A 4HDEA 5F06A 5B7CA 4KCEA 3L0HA 1FO5A 4JE1A 4PNFA 4EKZA 1ZYQB 3VWUA 4HZ2A 1YKAA 2DJ0A 2MYGA 4HEA2 3UMAA 2HRAA 3LWAA 3WGXA 3CSHA 2EIQA 3GA4A 5FWGA 5J9BA 4XS4A 2DIYA 3GL3A 4KE3A 1XWBA 3QOUA 4KA0A 3US3A 3O3TA 4DEJA 2IMKA 5B6NA 1MEKA 3UBLA 4ZB6A 3LORA 5DJMA 3BCIA 1FB6A 3ZL5A 4K7IA 3ZRDA 2GTUA 3ZTLA 4HJ2A 19GSA 2DJ2A 4L8EA 3ERGA 1ZGNA 4USSA 4WBRD 3GN3A 5HFKA 5J4UA 3EMPA 2B1KA 3U5RE 4YAPA 2M72A 1SYRA 2V32A 3WD6A 1T8EB 1A24A 1XCCA 1XWCA 4BL7A 2H71A 3C8EA 4PUFC 2WFCA 4XS4B 3Q18A 4N0ZA 1PD21 1GTBA 2IMIA 4HU9A 1ERWA 5A5KA 2P5QA 3LSZA 3HJPA 1E6BA 1F3BA 5ECIB 5CNWA 3K8NA 5ECOB 5E59A 4IBPA 2H76A 2IMEA 1F6MC 2QKEA 3HZ8A 1SK1A 17GSA 2OBKA 2VL3A 2CQ9A 2HRNA 2REMA 2E2GA 4BL7B 3TKRA 2I81A 2TIRA 3Q6OA 3LXTA 5ECSA 2MZCA 4TR1A 2FCHA 3QPMA 2H30A 1TTZA 3CXGA 3ME7A 1X9MB 2A2SA 4I5QA 2YWIA 2HI7A 5KN2A 4N11A 8GSSA 3P2AA 2VOCA 4X0XA 5LD0A 3O6TA 4FYUA 1X5DA 1U87A 1QK8A 3F9UA 5HQPA 3UOMA 1MDJA 1K3YA 2K8SA 4NPBA 5J5NA 1T7PB 1V98A 2H1BA 3HYPA 1UVZA 3KTLA 3GTUA 1Z5YE 2LV3A 1TW9A 1B9YC 4KDUA 2VCTA 1G6WA 3LQ7A 1HNCA 1PX6A 1XWAA 1O8WA 2TRCP 2EC4A 2GZPA 4TR1B 3WYWA 4Q5NA 1V9WA 2I3YA 1YKCA 5CYYA 2GT6A 2DMMA 4FYBA 5HR2A 1SENA 1GUKA 5CP1A 3M1GA 4YQMA 3H1NA 4ID0A 1V2AA 2WB9A 3A5WA 4MJBA 4I2UA 5LNKe 1TK5B 3M3MA 2OE0A 2L4QA 4V2MA 1EWXA 3GTUB 5D9VA 4IN0A 2AYTA 2RM5A 4KDXA 4AGSA 3A2VA 2CAIA 1EGOA 3FKFA 1AC1A 1X9WB 3CSIA 4J57E 4O7HA 1A0RP 5HFIA 2H1DA 2C8UA 1GP1A 3L9VA 4BWSA 2LJKA 2B5EA 4MA9A 5CRHA 2HQTA 4RQRA 1M2AA 5B6MA 1NHOA 2VM1A 4GQCA 3ERFA 3GHAA 1DSBA 1YQ1A 1FG4A 2RUFA 4KCAA 3DGQA 3WT2A 4Q5FA 2DBCA 1PL2A 2H72A 2P5RA 4DVCA 1G6YA 3FR3A 3QD9A 1S3DA 4BPYA 3S9FA 4K7OA 1MTCA 4WETA 2WULA 1EEMA 5D9TA 4MPFA 3EVIA 3F63A 1JZWA 3ZMLA 4OCEA 4Z7XA 3U6VA 4HJMA 1X9SB 3HJMA 3HVVA 3SBCA 4IELA 1U88A 5E4WA 1CQHA 3NIVA 1BAYA 3F6DA 1FVKA 3FR9A 4TXVA 3IAM2 4N10A 4PQ1A 5DVBA 4I6XA 4F9ZA 1DE2A 1PKZA 1ML6A 2PMTA 2C3NA 4TN8A 1LBKA 1H4OA 4KAEA 2P0GA 3IC4A 2YNXA 3WGEA 2FGXA 5LCZA 1XVQA 1GTUA 3RHCA 5ABRA 1OKDA 1THXA 5H5RA 1GSYA 3CSJA 1VF4A 4LA1A 3KH7A 4ZL7A 4QQ7A 1SJIA 2H0GA 1NM3A 1VF3A 2R37A 3GNJA 2TRXA 5L71A 2CVDA 2JSYA 4OO5A 3DIEA 3C73A 2AB6A 4X43A 5D96A 4MP4A 4HZ4A 10GSA 4ZIJA 3VWXA 3M9KA 1KEBA 1WRYA 3IXRA 5GSTA 2CVBA 2HSHA 1TP9A 1XWGA 1YF1A 5IMVA 3FZ9A 4IJ3A 4PQHA 1A2LA 4OD7A 1WJKA 3MAKA 2FWGA 2G0FA 1BX9A 1RQMA 2WCIA 3I69A 4YAVA 3QAGA 3GKXA 2OJLA 4KF9A 3W8JA 1GSFA 3DD3A 2I1UA 1M2DA 4V1Ap 3KTBA 3DKSA 4KW6A 1TDIA 2HRKA 3PH9A 3EURA 13GSA 1SKRB 1WOUA 1GLPA 4K2DA 4NXIA 1C72A 1Z7PA 2PVQA 4YH2A 3E3EA 3N5OA 1PRXA 1XXUA 5IM9A 1Q4JA 3HD5A 4JU5A 3IBHA 5DAKB 5D73A 1OC3A 4D73A 1N8JA 2ES7A 16GSA 1V57A 3CYNA 4ISDA 2ZNMA 2HRFA 1UN2A 3EC3A 3CRUA 3GRXA 3EWLA 3IHQA 5B8AA 4K6XA 1YEXA 9GSSA 2NTOA 2GS3A 3GKMA 2YANA 3Q74A 2O87A 5JCWA 1XOAA 1M2BA 4AJ8A 2JL4A 4EVMA 2NPBA 2HRKB 4WBJA 2YV7A 2N5BA 1GUHA 4TOPA 3UBKA 3MNGA 5GZZB 1TK0B 2JACA 1T1VA 2GDRA 5GSSA 1YZXA 1GRXA 4V2LA 2ZUPA 2VAFA 2ON7A 3NOFA 2X64A 2FUG2 3WT1A 4D73B 3TRQA 2V2GA 1SK0A 2PGTA 4MH2A 2C3QA 1WP0A 4IQAA 4XS1A 3GKKA 22GSA 1TU8A 4O5RA 2NBSA 1TRWA 2J9HA 2LRTA 4KGIA 3DVXA 4EXJA 1R7HA 3RPNA 3I43A 4GXZA 3QMXA 3VK9A 2VL2C 4MF7A 4ZL8A 2DMLA 2VL2A 1SD8A 5JWQB 4GF0A 1EP8A 5IO0A 2H74A 1PGTA 5ENUA 5FHIA 4OWYA 1ZL9A 3O76A 1XWKA 1GLQA 2MBSA 2C0EA 3KH9A 1WWJA 1OC8A 2FWFA 2F51A 1U3AA 2HXKA 4XCSA 2O89A 4ECJA 3DXBA 1ZOFA 4ECCA 3G7JA 2Z9SA 4JR6A 5GAPD 3APQA 4ML6A 2VO4A 3TB2A 1XZOA 4BVYA 1O85A 2LS5A 3KJYA 1R5AA 1XW9A 2B1LA 3KEBA 4TXOA 2XPDA 4NHWA 5CAXA 6GSYA 5KN0A 7GSSA 4YQUA 4NV5A 1M9AA 1MD3A 2JZSA 1MD4A 3TGZA 1H75A 4FQUA 4EE0A 1ZZYA 1KTEA 2L5LA 4JBBA 3FZ4A 2L6CA 4F82A 2L5OA 4KSOA 4AJ6A 4LL1B 2R4VA 3JCML 3F4RA 3A2XA 3G9BA 4BVYB 3KXOA 2GQKA 1S3AA 3D4TA 5G1LA 1SU9A 4WXTA 3QFBC 4JRRA 2GZYA 4TXOB 1GWCA 4POKA 4XS6A 5F05A 1SJ6A 5G5EA 2IN3A 3I6AA 5J9CA 1B9XC 5ECNB 2LKUA 1OAZA 2LQQA 3D6IA 3GIXA 1PQNA 5IMCA 2YJHA 4GWRA 2FWHA 1BQ7A 3LFLA 2PUKC 3N9JA 1WPIA 3GSTA 2RIIA 2H0HA 3KCMA 4F2IA 3ED3A 1Z3EA 1J08A 3HCZA 1QQ2A 5IPGA 5BMUA 2WRTA 2LSTA 4IS0A 5ECHB 4BA7A 6GSWA 3HJOA 4GSNA 1A2JA 4ECBA 2PPTA 3VPTA 1SKSB 3TJKA 3P90A 1G0TA 4X1UA 1GTAA 1GULA 3I9V2 3LXZA 5GAND 1TKDB 1YEPA 2VCWA 1EEJA 2LNTA 4GCIA 3HKRA 2AV4A 1WIKA 2A2RA 3L4NA 4HQZA 5KEJA 4HI7A 1K3OA 4ZB8A 6GSTA 2X8CA 5ECQB 5C00A 1URMA 3ZMKA 5AIVA 1USBA 4MJAA 2L57A 3D5JA 2PERA 4WR5A 2EIOA 2N5AA 5JCGA 1XVWA 1AQWA 1GTIA 5IO2A 3RAZA 3LGCA 1DUGA 3ZITA 1VGLA 1HD2A 3FK8A 2X8GA 2PBJA 4MDCA 5A4WA 4EDYA 1V40A 3VLNA 1VF2A 1NSWA 5CRWA 2YP6A 2QGVA 2FNOA 3MWHA 4GSSA 1R4WA 1I9DA 2FY6A 2C0GA 1WMJA 2IFQA 2VCVA 3GUSA 2YWNA 2X99A 1AQXA 1O73A 1FHEA 4L0WA 4HOJA 3UL3A 4PX1A 1ERTA 3LG6A 3QAWA 5AGYA 3NZNA 1PL1A 3IV4A 3KP9A 4RI7A 4WEYA 5JWRB 2H6XA 1V58A 5G30A 4AJ7A 3FYGA 1EV4A 3DRNA 1OKTA 4FO5A 2CZ2A 3IR4A 2H01A 1X5CA 3LJRA 3TOUA 4ULXA 3CMIA 3PR8A 4I8BA 5IIZA 3ZIVA 5DALA 3ISOA 5IOWA 2AHEA 1W89A 2PWJA 2OE1A 2RUEA 2LQOA 4DSRA 4ZXGA 4MZBA 3F3QA 2IFQB 2YWOA 4EDZA 2O7KA 4MH3A 6GSSA 4EL1A 4Q5RA 3QDNA 2M46A 3EYTA 3TJGA 4PNGA 5F07A 2K6VA 4NV2A 4L5OA 2GZZA 1K0OA 1O8XA 4G19A 1SL1B 5KN1A 3IOSA 1OC9A 3GH9A 2DC5A 1QGVA 1IYHA 4G0KA 3GL5A 2GSQA 5DALB 2VCZA 3LYPA 3ERWA 2VD0A 4EO3A 2XHFA 4L5LA 2XBIA 2H8LA 4XHMA 4XRDA 2NDOA 4KDYA 2FWEA 2H66A 4JZQA 1M99A 2LUSA 1XBSA 2YZUA 2HSMA 2IIYA 2IPAA 2MMZA 1T4ZA 3L9SA 3EMXA 3TKPA 1O6JA 4OFNA 4KNDA 4LMVA 3FW2A 2H6ZA 1TI1A 5HR0A 4EC0A 5D9WA 1B48A 2H73A 2B7JA 2RLIA 1B4PA 3QFAC 5HR1A 1SD9A 2C4JA 1GNEA 4E8EA 4IKHA 1OC9B 1EOHA 5ECPB 4TRXA 1QUWA 3PGTA 3J7Yk 2GGTA 1EOGA 4Q5QA 4ZB9A 1M9BA 5CO3A 3GFKA 1QFNA 4XTSA 3IK9A 4WR4A 2MMOA 4BWQA 3FZ5A 2MMNA 3DYRA 3KMNA 5ECLB 4I2TA 4J2FA 4OMVA 1RK4A 3GYKA 4OO4A 3DVWA 2HSMB 2HZEA 4CW9A 3EINA 2AJQB 4K8MA 4RUVA 5EVOA 4HUAA 1BG5A 1PN9A 4LLRA 3IAS2 3DMLA 3RBTA 1K0MA 2HSYA 1YY7A 1PSQA 1Y6EA 2YCDA 2K18A 1SKWB 3L9UA 1ZCPA 1QXHA 1JZRA 4XRAA 4JR4A 4HU7A 3Q19A 2VLUA 4MJCA 4OFTA 2DJ3A 2JSZA 2G2QA 12GSA 3APOA 1THOA 5F8BA 4RI6A 3F8UA 1UA5A 3TOTA 2C0DA 5CRDA 3IRAA 3TKSE 3ZVJA 3TJJA 2OACA 2O8VB 3FHKA 4IP1A 4WF4A 3MDKA 2HZEB 1EP7A 4MZWA 1JZDA 4MABA 1HQOA 2E0QA 5ECRB 1E2YA 5A4UA 4L0UA 4MCUA 1K0AA 5D9XA 1LU4A 1EGRA 3IDVA 2I4AA 2IMDA 3H93A 2KHPA 3FZAA 3H8QA 1TRSA 1AIUA 5ID2A 2YOIA 4QL9A 3KP8A 3LYKA 5DCGA 2F8AA 2YV9A 2QC7A 3F3RA 1ZYEA 4KB3A 3D22A 2HFDA 2OADA 1KNGA 2H1GA 3E0UA 4MF6A 4PQIA 5JCUA 3KGKA 1U6TA 4TR4A 3ZYWA 3HVSA 2ZCTA 3GMFA 2VIMA 4NHZA 1K0CA 3KMOA 4NMUA 2QSIA 1JHBA 2F9SA 3TJBA 3KM6A 1F9MA 2LEGA 3LEFA 4G10A 3BD2A 4MZCA 5ID2B 1NHYA 4TR0A 18GSA 3UARA 5INYA 3ZFBA 1Y25A 2LRNA 3IC8A 2XPEA 1W4VA 2C80A 4LL4B 3ME8A 5IQYA 4TKYA 2LJAA 4KH7A 2GSTA 1OE7A 2HZFA 2KP2A 5DJLA 3TUEA 3EE2A 2H6YA 3W6GA 2KLXA 4LMWA 4YQVA 2KUCA 2FLSA 1ABAA 3TCOA 4J56E 3ZVJD 1JZOA 2HSNB 4MMMA 4O32A 3GH6A 2BJXA 3GURA 2GSRA 3GX0A 4ECIA 1A2MA 2H0IA 2DJ1A 4FH8A 4RQXA 2K8VA 4P3YB 1U3IA 2H1AA 4NAXA 1Z7RA 3KZQA 1QMVA 1SK2A 5AIXA 1A8YA 3W8SA 3MSZA 5ECMB 3VPQA 2AAWA 2VLVA 2B3SA 3UJ1A 4FYCA 5ELAA 2CAQA 3VWVA 3F0IA 4F0BA 3H79A 3HHVA 3D21A 4K1FA 1GSDA 1SYXA 5CRGA 4AF2A 3G7YA 2GVPA 1GSQA 4TVEA 3M0FA 5IMAA 2C0FA 2BMXA 2AUVA 1T3BA 1K0BA 4IJIA 4PURA 3TKQA 1TU7A 3BOAA 2VLTA 2CT6A 5DDLA 2GLRA 2DJJA 3VURA 4WKWA 1BYEA 4F0CA 3EU3A 5IMZA 2XBQA 2F3MA 2L59A 1GSUA 2KP1A 3C7MA 1X5EA 1F3AA 5IOXA 2L6DA 1A8LA 1GUMA 4ILFA 3HZ4A 1AUCA 3OR5A 4ZBDA 1JLWA 3M9JA 3PINA 2FA8A 4KSMA 1PX7A 2MMAA 1M0UA 1Q98A 3IK7A 4ZBAA 2V1MA 2R3XA 2CV4A 2DIZA 14GSA 3SWLA 1Z6MA 3A2WA 2R6KA 2IMFA 2P31A 3FY7A 4G0LA 3VI5A 1B8XA 3ZIJA 1S3CA 1BJXA 1OVNA 1ZMAA 1J0FA 1GSSA 1G7OA 5ECKB 2YZHA 1EZKA 3J7Yb 3IA1A 3F4TA 4G0IA 1NW2A 1FOVA 1FAAA 2FD3A 4GSTA 5HR3A 2LRCA 2IL3A 3UAPA 5B8BA 3ZFLA 4BVXA 1TK8B 4GTUA 5H5SA 2VCXA 3AY8A 2DJKA 1Z6NA 4TW5A 5DQSA 5JWOB 1K0DA 3BCKA 4JEDA 4QL7A 2CA8A 2WJUA 4K0GA 2ALBA 2K9FA 1ON4A 1XFLA 1K3LA 2OKAA 3QAVA 3RHBA 2O85A 1RW1A 3CTFA 2E7PA 4G9HA 3ZZXA 3GX8A 2H19A 3CTGA 1TXXA 2A4VA 2LNSA 3A3TA 2JZRA 3P8WA 3GSSA 4BVXB 5D8IA 2XC2A 3R2QA 3IE3A 4MF5A 3UVTA 5A4VA 2GQMA 1PKWA 2MBTA 5G5FA 3VWWA 2UZ8A 1BEDA 1R5PA 2H75A 1PMTA 1T00A 2HE3A 1AXDA 2YN1A 2PN8A 2VM2A 3KD0A 1XOBA 5DCHA 1O7UA 1XW5A 3GV1A 1GSEA 1DE1A 3PPUA 4ACSA 4ZL9A 3E9JB 4IHUA 3EU4A 2PVOC 3ZLPA 20GSA 2VUPA 1XW6A 1ACVA 3WGDA 2VCQA 1J9BA 4OCFA 1VF1A 3TJFA 3D4MA 2OE3A 1PA3A 1SL2B 2D2ZA 1OYJA 4MPGA 2VD1A 3HY2A 4DSSA 1B4QA 1AW9A 1JFUA 2V41A 4O92A 1TJDA 4I97A 3F6FA 1KBNA 2LTKA 11GSA 1YDKA 4V1Ag 4GLTA 4H86A 3GKNA 1SL0B 3P7XA 3RPPA 2OBIA 1GL8A 3F4SA 2GT5A 4TR3A 1JLVA 2LJRA 2RM6A 1AQVA 5EL8A 2N5FA 2CVKA 2YPMA 2HLSA 2B5YA 3FR6A 3C71A 1VRSD 3TDGA 1X0RA 1XIYA 1TRVA 4DSSB 3QR6A 4PTSA 1SJZA 2CX4A 1GNWA 1HNBA 4WF5A 5C04A 4CHSA 2JADA 4ML1A 3DWVA 3DEXA 5G31A 3M8NA 1TI3A 2VL9A 2IWTA 4N30A 3UIWA 5EY6A 1TRUA 5FT3A 2HT9A 2IJYA 5IPHA 1ST9A 2HYXA 2I9HA 3QCPA 5DBQA 2EIRA 1ERVA 4OFMA 1AAZA 2PU9C 4IGJA 5CREA 3APSA 4ZILA
chains in the Genus database with same CATH superfamily
2DSAA 2YWMA 1O81A 2R2JA 4GRFA 5DAKA 1UC7A 2YJ7A 1FVJA 4GQFA 2GQLA 2ON5A 1FW1A 3G7IA 4F03A 4MLYA 1MDIA 3CBUA 4IW9A 3VFIA 5H5QA 1Z9HA 2JZTA 4BIKA 3VI7A 1F37A 1MDKA 3HVXA 3TKSC 2B7KA 1IYIA 3TKSA 6GSVA 4HQSA 1A0FA 1EV9A 3RDWA 2C3TA 6GSXA 3CRTA 2L4CA 1HYUA 4EUYA 2V6OA 1LJRA 4PXOA 1FOHA 1I5GA 1T4YA 5AN1A 2B6MA 4MK3A 3L78A 4POBA 2HNLA 6GSUA 1YJ6A 3HA9A 4DSQA 3FEUA 4K9ZA 4POLA 3HMJG 1A23A 1F2EA 2H70A 2X8HA 4MJEA 4V2NA 4G2EA 5EPFA 1WE0A 2WDUA 3V1WA 5G2ZA 3HDCA 4FIWA 3HXSA 2CX3A 5IMFA 1G7EA 4NWYA 3KIJA 4POMA 3TRPA 4CDOA 2B5XA 1CQGA 3HVNA 3CHXC 4IP6A 4N0VA 4K0NA 2F8FA 1M7TA 1XPVA 1DBYA 1N2AA 1S4BP 3H4KA 3A5IA 3D0ZA 3TRXA 4HS1A 2JU5A 5J3RA 5COHA 2WZ9A 2V6KA 5IMDA 1HNAA 5DQYA 5D93A 4KX4A 2E2MA 4E8HA 2FA4A 3BBYA 2OA7A 2GSSA 1R26A 3BJ5A 4KUNA 5G1KA 2NVLA 1FB0A 5AISA 4XIHA 5HFGA 1YF0A 1YEWC 2KOKA 2DLXA 2WGRA 2M80A 3FRCA 4PGTA 2R5GA 5J41A 1OE8A 3C1SA 4EF0A 3UVHA 2CZ3A 1ERUA 5F0GA 4K7NA 2C1YA 4PUAA 3R3EA 2WS2A 3IPZA 4IQ1A 2BTOT 1K0NA 1TOFA 3UEMA 4ZBBA 1ILOA 5KN3A 3ZREA 4IVFA 4N3ZA 1GH2A 3C1RA 2FHEA 5ELGA 2J23A 4HDEA 5F06A 5B7CA 4KCEA 3L0HA 4O5QA 1FO5A 4JE1A 4PNFA 4EKZA 1ZYQB 3VWUA 4HZ2A 1YKAA 2DJ0A 2MYGA 4HEA2 3UMAA 2HRAA 3LWAA 3WGXA 3CSHA 2EIQA 3GA4A 5FWGA 5J9BA 4XS4A 1ZYPA 2DIYA 3GL3A 4KE3A 1XWBA 1S3RA 3QOUA 4Z2RA 4KA0A 3US3A 3O3TA 4DEJA 2IMKA 5B6NA 1MEKA 3UBLA 4ZB6A 5DJMA 3BCIA 3LORA 1FB6A 3ZL5A 4K7IA 3ZRDA 2GTUA 3ZTLA 4HJ2A 19GSA 2DJ2A 2R0PA 4L8EA 3ERGA 1ZGNA 4USSA 4WBRD 3GN3A 5HFKA 5J4UA 3EMPA 2B1KA 4AI6A 4CY6A 3U5RE 4YAPA 2M72A 1SYRA 2V32A 3WD6A 1T8EB 1A24A 1XCCA 1XWCA 4BL7A 2H71A 2QA2A 3C8EA 4PUFC 2WFCA 4XS4B 3Q18A 4N0ZA 1PD21 1GTBA 2IMIA 4HU9A 1ERWA 2O3EA 5A5KA 2P5QA 3LSZA 3HJPA 1E6BA 1F3BA 5ECIB 3LW9A 5CNWA 3K8NA 2EFHA 5ECOB 5E59A 4IBPA 2H76A 2IMEA 2O5VA 1SVOA 1F6MC 2QKEA 3HZ8A 1SK1A 17GSA 2OBKA 4Z2UA 2VL3A 2CQ9A 2HRNA 2REMA 2E2GA 4BL7B 3TKRA 2I81A 2TIRA 3Q6OA 3LXTA 5ECSA 2MZCA 4TR1A 2FCHA 3QPMA 2H30A 1TTZA 3CXGA 3ME7A 1X9MB 2A2SA 4I5QA 2YWIA 2HI7A 5KN2A 4N11A 8GSSA 3P2AA 2VOCA 4X0XA 5LD0A 3O6TA 4FYUA 1X5DA 1U87A 1QK8A 3F9UA 3CQFA 3UOMA 5HQPA 1MDJA 1K3YA 2K8SA 4NPBA 5J5NA 1T7PB 1V98A 2H1BA 3HYPA 1UVZA 3KTLA 3GTUA 1Z5YE 2LV3A 2WVZA 1TW9A 1B9YC 4KDUA 2VCTA 1G6WA 3LQ7A 1HNCA 1PX6A 1XWAA 1O8WA 2TRCP 2H1LA 2EC4A 2GZPA 4TR1B 3WYWA 4Q5NA 1V9WA 2I3YA 1YKCA 5CYYA 2GT6A 2DMMA 4FYBA 5HR2A 1SENA 1GUKA 5CP1A 3M1GA 4YQMA 3H1NA 4ID0A 1V2AA 2WB9A 3A5WA 4MJBA 4I2UA 5LNKe 1TK5B 3M3MA 2OE0A 2L4QA 4V2MA 1EWXA 3GTUB 5D9VA 4IN0A 2AYTA 2RM5A 4KDXA 4AGSA 3A2VA 2CAIA 1EGOA 3FKFA 1AC1A 1X9WB 3CSIA 4J57E 4O7HA 1A0RP 5HFIA 2H1DA 2C8UA 1GP1A 3L9VA 4BWSA 2LJKA 2EFCA 2B5EA 4MA9A 5CRHA 2HQTA 4RQRA 1M2AA 5B6MA 1NHOA 2VM1A 4GQCA 3ERFA 3GHAA 1DSBA 1YQ1A 1FG4A 2RUFA 4KCAA 3DGQA 4AKIA 3WT2A 4Q5FA 2DBCA 1PL2A 2H72A 2P5RA 4DVCA 5A5HA 1G6YA 3FR3A 3QD9A 1S3DA 4BPYA 3S9FA 4K7OA 1MTCA 4WETA 2WULA 1EEMA 5D9TA 4MPFA 3EVIA 3F63A 1JZWA 3ZMLA 4OCEA 4Z7XA 3U6VA 4HJMA 1X9SB 3HJMA 3HVVA 3SBCA 4IELA 1U88A 5E4WA 1CQHA 3MIXA 3NIVA 1BAYA 3F6DA 1FVKA 3FR9A 4TXVA 3IAM2 4EIPA 4N10A 4PQ1A 5DVBA 4I6XA 4F9ZA 1Y1UA 1DE2A 1PKZA 1ML6A 2PMTA 2WVXA 2C3NA 4TN8A 1LBKA 1H4OA 4KAEA 2P0GA 3IC4A 2YNXA 3WGEA 2FGXA 5LCZA 1XVQA 1GTUA 3RHCA 5ABRA 1OKDA 1THXA 5H5RA 1GSYA 2QA1A 3CSJA 4K5RA 1VF4A 4LA1A 3KH7A 4ZL7A 4QQ7A 1SJIA 2H0GA 1NM3A 1VF3A 2R37A 3GNJA 2TRXA 1SVLA 5L71A 2CVDA 1SVMA 2JSYA 4OO5A 3DIEA 3C73A 2AB6A 4X43A 5D96A 4MP4A 4HZ4A 10GSA 4ZIJA 2WVXB 3VWXA 3M9KA 1KEBA 1WRYA 3IXRA 5GSTA 2CVBA 2HSHA 1TP9A 1XWGA 1YF1A 5IMVA 3FZ9A 4IJ3A 4PQHA 1A2LA 4OD7A 1WJKA 3MAKA 2FWGA 2G0FA 1BX9A 1RQMA 2WCIA 3I69A 4YAVA 3QAGA 3GKXA 2OJLA 4KF9A 3W8JA 1GSFA 3DD3A 2I1UA 1M2DA 2WW0A 4V1Ap 3KTBA 3DKSA 4KW6A 1TDIA 2HRKA 2DKIA 4K5SA 3PH9A 3EURA 13GSA 1SKRB 1WOUA 1GLPA 4K2DA 4NXIA 1C72A 1Z7PA 1BG1A 2PVQA 4YH2A 3E3EA 4O5UA 3N5OA 1PRXA 1XXUA 5IM9A 1Q4JA 3HD5A 4JU5A 3IBHA 4HSCX 1M3IA 5DAKB 5D73A 1I1IP 4PI2C 1OC3A 4D73A 1N8JA 2ES7A 16GSA 1V57A 3CYNA 4ISDA 2ZNMA 2HRFA 1UN2A 3EC3A 3CRUA 3GRXA 3EWLA 3IHQA 5B8AA 4K6XA 1YEXA 9GSSA 2NTOA 2GS3A 3GKMA 2YANA 3Q74A 2O87A 5JCWA 1XOAA 1M2BA 4AJ8A 2JL4A 4EVMA 2NPBA 2HRKB 4WBJA 2YV7A 2N5BA 1GUHA 4TOPA 3UBKA 3MNGA 5GZZB 1TK0B 2JACA 1T1VA 2GDRA 5GSSA 1YZXA 1GRXA 4V2LA 2ZUPA 2VAFA 2ON7A 2X64A 2FUG2 3NOFA 3WT1A 4D73B 3TRQA 2V2GA 1SK0A 2PGTA 4MH2A 2C3QA 1WP0A 4IQAA 4XS1A 3GKKA 22GSA 1TU8A 4O5RA 2NBSA 1TRWA 2J9HA 2LRTA 4KGIA 3DVXA 2HSNA 4EXJA 1R7HA 3RPNA 3I43A 4GXZA 3QMXA 3VK9A 2VL2C 4MF7A 4ZL8A 2DMLA 2VL2A 1SD8A 5JWQB 4GF0A 1EP8A 5IO0A 2H74A 1PGTA 5ENUA 5FHIA 4OWYA 1ZL9A 3O76A 1XWKA 1GLQA 2MBSA 2C0EA 3KH9A 4QMKA 2X49A 1WWJA 1OC8A 2FWFA 2F51A 1U3AA 2HXKA 4XCSA 2O89A 4ECJA 3DXBA 1ZOFA 4ECCA 3G7JA 2Z9SA 4JR6A 5GAPD 3APQA 4ML6A 2VO4A 3TB2A 1XZOA 4BVYA 1O85A 2LS5A 3KJYA 4MNNA 1R5AA 1XW9A 2B1LA 3KEBA 4TXOA 2XPDA 4NHWA 5CAXA 4AKGA 6GSYA 5KN0A 7GSSA 4YQUA 4NV5A 1M9AA 4ZB7A 1MD3A 4AKXB 2JZSA 1MD4A 3TGZA 1H75A 4FQUA 4EE0A 4GDFA 1ZZYA 1KTEA 2L5LA 4JBBA 3FZ4A 2L6CA 4F82A 2L5OA 4KSOA 4AJ6A 4LL1B 2R4VA 3JCML 3F4RA 3A2XA 3G9BA 4BVYB 3KXOA 2GQKA 4W66A 2R0CA 1S3AA 3D4TA 5G1LA 1SU9A 4WXTA 3QFBC 4JRRA 2GZYA 4TXOB 1GWCA 2WW2A 4G01A 4POKA 4E68A 4XS6A 5F05A 1SJ6A 5G5EA 2IN3A 3I6AA 5J9CA 1B9XC 5ECNB 2LKUA 1OAZA 2LQQA 3D6IA 3GIXA 1PQNA 5IMCA 2YJHA 4GWRA 2FWHA 1BQ7A 3LFLA 2PUKC 3N9JA 1WPIA 3IHGA 3GSTA 2RIIA 2H0HA 3KCMA 4F2IA 3ED3A 1Z3EA 1J08A 5J47A 3HCZA 1QQ2A 5IPGA 5BMUA 2WRTA 2LSTA 4IS0A 5ECHB 4BA7A 2UV8G 6GSWA 3HJOA 4GSNA 1A2JA 4ECBA 2PPTA 3VPTA 1SKSB 3TJKA 3P90A 1G0TA 4X1UA 1GTAA 1GULA 3I9V2 3LXZA 5GAND 1TKDB 1YEPA 4A5PA 2VCWA 1EEJA 2LNTA 4GCIA 3HKRA 2AV4A 1WIKA 2A2RA 5BRTA 3L4NA 4HQZA 5KEJA 4HI7A 1K3OA 4ZB8A 6GSTA 2X8CA 2EFEA 5ECQB 5C00A 1URMA 3ZMKA 5AIVA 1USBA 4MJAA 2L57A 3D5JA 2PERA 4WR5A 2EIOA 2N5AA 5JCGA 1XVWA 1AQWA 1GTIA 5IO2A 3RAZA 3LGCA 2OT3A 1DUGA 3ZITA 1VGLA 1HD2A 3FK8A 2X8GA 2PBJA 4MDCA 5A4WA 4EDYA 1V40A 3VLNA 1VF2A 1NSWA 5CRWA 2YP6A 2QGVA 2FNOA 3MWHA 4GSSA 1R4WA 1I9DA 2FY6A 2C0GA 1WMJA 2IFQA 2VCVA 3GUSA 2YWNA 2X99A 1AQXA 1O73A 1FHEA 4L0WA 4HOJA 3UL3A 4FXYP 4PX1A 3TU3B 1ERTA 3LG6A 3QAWA 5AGYA 3NZNA 1PL1A 3IV4A 3KP9A 4RI7A 4WEYA 5JWRB 1XG8A 2H6XA 1V58A 5G30A 4AJ7A 3FYGA 1EV4A 3DRNA 4Z2TA 1OKTA 2VKZG 2CZ2A 4FO5A 3IR4A 2H01A 1X5CA 3LJRA 3TOUA 4ULXA 3CMIA 3PR8A 4I8BA 5IIZA 2DKHA 3ZIVA 5DALA 3ISOA 5IOWA 2AHEA 1W89A 2PWJA 2OE1A 2RUEA 2LQOA 4DSRA 4ZXGA 1TXUA 4MZBA 3F3QA 2IFQB 4K2XA 2YWOA 4EDZA 2O7KA 4MH3A 6GSSA 4EL1A 4Q5RA 3QDNA 2M46A 3EYTA 3TJGA 4PNGA 5F07A 2K6VA 4NV2A 4L5OA 2GZZA 1K0OA 1O8XA 4G19A 1SL1B 5KN1A 3IOSA 4AKHA 1OC9A 3GH9A 2DC5A 1QGVA 1IYHA 4G0KA 3GL5A 2GSQA 5DALB 2VCZA 3LYPA 3ERWA 2VD0A 4EO3A 2XHFA 4L5LA 2XBIA 2H8LA 4XHMA 5A5HB 4XRDA 2NDOA 4KDYA 5A1NA 2FWEA 1YVLA 2H66A 4JZQA 1M99A 2LUSA 1XBSA 2YZUA 3MYDA 2HSMA 2IIYA 2IPAA 2MMZA 1T4ZA 3L9SA 3EMXA 3TKPA 1O6JA 4OFNA 4KNDA 4LMVA 3FW2A 2H6ZA 1TI1A 5HR0A 4EC0A 5D9WA 1B48A 2H73A 2B7JA 2RLIA 1B4PA 3QFAC 5HR1A 1SD9A 2C4JA 1GNEA 4E8EA 4IKHA 1OC9B 1EOHA 5ECPB 4TRXA 1QUWA 3PGTA 3J7Yk 2GGTA 1EOGA 4Q5QA 4ZB9A 1M9BA 5CO3A 3GFKA 1QFNA 4XTSA 3IK9A 4WR4A 2MMOA 4BWQA 3FZ5A 2MMNA 3DYRA 3KMNA 5ECLB 5A1NB 4I2TA 4J2FA 4OMVA 1RK4A 3GYKA 4OO4A 1BF5A 3DVWA 2HSMB 2HZEA 4CW9A 3EINA 2AJQB 4K8MA 2A2PA 2WZSA 4RUVA 5EVOA 4HUAA 1BG5A 1PN9A 4LLRA 3IAS2 3RGBC 3DMLA 3RBTA 1K0MA 2HSYA 1YY7A 1PSQA 1Y6EA 3EPTA 2YCDA 2K18A 1SKWB 3L9UA 1ZCPA 1QXHA 1JZRA 4XRAA 4JR4A 4HU7A 3Q19A 2VLUA 4MJCA 4OFTA 2DJ3A 2JSZA 2G2QA 12GSA 3APOA 1THOA 5F8BA 4RI6A 3F8UA 1UA5A 3TOTA 2C0DA 5CRDA 3IRAA 3TKSE 3ZVJA 3TJJA 2OACA 2O8VB 3FHKA 4IP1A 4WF4A 3MDKA 2HZEB 1EP7A 4MZWA 1JZDA 4MABA 1HQOA 2E0QA 5ECRB 1E2YA 5A4UA 4L0UA 4MCUA 1K0AA 5D9XA 1LU4A 1EGRA 3IDVA 2I4AA 2IMDA 3H93A 2KHPA 3FZAA 3H8QA 1TRSA 1AIUA 5ID2A 1N25A 2YOIA 4QL9A 3KP8A 3LYKA 5DCGA 2F8AA 2YV9A 2QC7A 3F3RA 1ZYEA 4KB3A 5KOXA 3D22A 2HFDA 2OADA 1KNGA 2H1GA 3E0UA 4MF6A 4PQIA 5JCUA 3KGKA 1U6TA 3CWGA 4TR4A 3ZYWA 3HVSA 2ZCTA 3GMFA 2VIMA 4NHZA 1K0CA 3KMOA 4NMUA 2QSIA 1JHBA 2F9SA 3TJBA 3KM6A 1ZYNA 1F9MA 2LEGA 3LEFA 4G10A 2R0GA 5KOWA 3BD2A 4MZCA 5ID2B 1NHYA 4TR0A 18GSA 3UARA 5INYA 3ZFBA 1Y25A 2LRNA 3IC8A 2XPEA 1W4VA 2C80A 4LL4B 3ME8A 5IQYA 4TKYA 2LJAA 4KH7A 2GSTA 1OE7A 2HZFA 2KP2A 5DJLA 3TUEA 3EE2A 2H6YA 3W6GA 2KLXA 4LMWA 4YQVA 2KUCA 2FLSA 1ABAA 5J4YA 3TCOA 4J56E 3ZVJD 1JZOA 2HSNB 4MMMA 4O32A 3GH6A 4PI0C 2BJXA 3GURA 2GSRA 3GX0A 4ECIA 1A2MA 2H0IA 2DJ1A 4FH8A 4RQXA 2K8VA 4P3YB 1U3IA 2H1AA 4NAXA 1Z7RA 3KZQA 1QMVA 1SK2A 5AIXA 1A8YA 3W8SA 3MSZA 5ECMB 3VPQA 2AAWA 2VLVA 2B3SA 3UJ1A 4FYCA 5ELAA 2CAQA 3VWVA 3F0IA 4F0BA 3H79A 3HHVA 3D21A 4K1FA 1GSDA 1SYXA 5CRGA 4AF2A 3G7YA 2GVPA 1GSQA 4TVEA 3M0FA 5IMAA 2C0FA 2BMXA 2AUVA 1T3BA 1K0BA 4IJIA 4PURA 3TKQA 1TU7A 3BOAA 1PN0A 2VLTA 2CT6A 2O36A 5DDLA 2GLRA 1PFOA 2DJJA 3VURA 2EFDA 4WKWA 1BYEA 4F0CA 3EU3A 5IMZA 2XBQA 2F3MA 2L59A 1GSUA 2KP1A 3C7MA 4X4JA 1X5EA 1F3AA 5IOXA 2L6DA 1A8LA 2WW3A 1GUMA 4ILFA 3HZ4A 1AUCA 3OR5A 4ZBDA 1JLWA 3M9JA 3PINA 2FA8A 4KSMA 1PX7A 2MMAA 1M0UA 1Q98A 3IK7A 4ZBAA 2V1MA 2R3XA 2CV4A 2DIZA 14GSA 3FMWA 3SWLA 1Z6MA 3A2WA 2R6KA 2IMFA 2P31A 3FY7A 4G0LA 3VI5A 1B8XA 3ZIJA 1S3CA 1BJXA 1OVNA 1ZMAA 1J0FA 1GSSA 1G7OA 5ECKB 2YZHA 1EZKA 3J7Yb 3IA1A 3F4TA 4G0IA 1NW2A 1FOVA 1FAAA 2FD3A 4GSTA 5HR3A 2LRCA 2IL3A 3UAPA 5B8BA 3ZFLA 4BVXA 1TK8B 5BMUB 2A4HA 4GTUA 5H5SA 2VCXA 2WVYA 3AY8A 2DJKA 1Z6NA 4TW5A 5DQSA 3RFRC 5JWOB 1K0DA 3BCKA 4JEDA 4QL7A 2CA8A 2WJUA 4K0GA 2ALBA 2K9FA 1ON4A 1XFLA 1K3LA 4ICYA 2OKAA 3QAVA 3RHBA 2O85A 1RW1A 5J40A 3CTFA 2E7PA 4G9HA 3ZZXA 4YKFA 3GX8A 2H19A 3CTGA 1TXXA 2A4VA 2LNSA 3A3TA 2JZRA 3P8WA 3GSSA 4BVXB 5D8IA 2XC2A 3R2QA 3IE3A 4MF5A 3UVTA 5A4VA 2GQMA 1PKWA 2MBTA 5G5FA 3VWWA 2UZ8A 1BEDA 1R5PA 2H75A 1PMTA 1T00A 2HE3A 1AXDA 2YN1A 2PN8A 2VM2A 3KD0A 1XOBA 5DCHA 1O7UA 3GV1A 1XW5A 2WW1A 1GSEA 1DE1A 3PPUA 4ACSA 1M3JA 4ZL9A 4CY8A 3E9JB 4IHUA 3EU4A 2PVOC 3ZLPA 20GSA 2VUPA 1XW6A 1ACVA 3WGDA 2VCQA 1J9BA 4OCFA 1VF1A 3TJFA 3D4MA 2OE3A 1PA3A 1SL2B 2D2ZA 1OYJA 4MPGA 4YKGA 2VD1A 3HY2A 4DSSA 1B4QA 1AW9A 1JFUA 2V41A 4O92A 1TJDA 4I97A 3F6FA 1KBNA 2LTKA 11GSA 1YDKA 4V1Ag 4GLTA 4H86A 3GKNA 1SL0B 3P7XA 3RPPA 2OBIA 1GL8A 5A34A 2GT5A 3F4SA 4TR3A 1JLVA 2LJRA 2RM6A 1AQVA 5EL8A 2N5FA 2CVKA 2YPMA 4PHZC 2HLSA 2B5YA 3FR6A 3C71A 1VRSD 3TDGA 1X0RA 1XIYA 1TRVA 4DSSB 3QR6A 4PTSA 1SJZA 2CX4A 1GNWA 1HNBA 4WF5A 5C04A 4CHSA 2JADA 4ML1A 3DWVA 3DEXA 5G31A 3M8NA 5A34B 1TI3A 2VL9A 2IWTA 4N30A 3UIWA 5EY6A 1TRUA 5FT3A 5J4VA 2HT9A 2IJYA 4EIQA 5IPHA 1ST9A 2HYXA 2I9HA 3QCPA 5DBQA 2EIRA 1ERVA 4OFMA 1AAZA 2PU9C 2X4AA 4IGJA 5CREA 3APSA 4ZILA
chains in the Genus database with same CATH topology
2DSAA 2YWMA 1O81A 2R2JA 4GRFA 5DAKA 1UC7A 2YJ7A 1FVJA 4GQFA 2GQLA 2ON5A 1FW1A 3G7IA 4F03A 4MLYA 1MDIA 3CBUA 4IW9A 3VFIA 5H5QA 1Z9HA 2JZTA 3VI7A 1F37A 1MDKA 3HVXA 3TKSC 2B7KA 1IYIA 3TKSA 6GSVA 4HQSA 1A0FA 1EV9A 3RDWA 2C3TA 6GSXA 3CRTA 2L4CA 1HYUA 4EUYA 2V6OA 1LJRA 4PXOA 1FOHA 1I5GA 1T4YA 5AN1A 2B6MA 4MK3A 3L78A 4POBA 2HNLA 6GSUA 1YJ6A 3HA9A 4DSQA 3FEUA 4K9ZA 4POLA 3HMJG 1A23A 1F2EA 2H70A 2X8HA 4MJEA 4V2NA 4G2EA 5EPFA 1WE0A 2WDUA 3V1WA 5G2ZA 3HDCA 4FIWA 3HXSA 2CX3A 5IMFA 1G7EA 4NWYA 3KIJA 4POMA 3TRPA 4CDOA 2B5XA 1CQGA 4IP6A 4N0VA 4K0NA 2F8FA 1M7TA 1XPVA 1DBYA 1N2AA 3H4KA 3A5IA 3D0ZA 3TRXA 4HS1A 2JU5A 5J3RA 5COHA 2WZ9A 2V6KA 5IMDA 1HNAA 5DQYA 5D93A 4KX4A 2E2MA 4E8HA 2FA4A 3BBYA 2OA7A 2GSSA 1R26A 3BJ5A 4KUNA 5G1KA 2NVLA 1FB0A 5AISA 4XIHA 5HFGA 1YF0A 2KOKA 2DLXA 2WGRA 2M80A 3FRCA 4PGTA 2R5GA 5J41A 1OE8A 3C1SA 4EF0A 3UVHA 2CZ3A 1ERUA 5F0GA 4K7NA 2C1YA 4PUAA 3R3EA 2WS2A 3IPZA 4IQ1A 2BTOT 1K0NA 1TOFA 3UEMA 4ZBBA 1ILOA 5KN3A 3ZREA 4IVFA 4N3ZA 1GH2A 3C1RA 2FHEA 5ELGA 2J23A 4HDEA 5F06A 5B7CA 4KCEA 3L0HA 4O5QA 1FO5A 4JE1A 4PNFA 4EKZA 1ZYQB 3VWUA 4HZ2A 1YKAA 2DJ0A 2MYGA 4HEA2 3UMAA 2HRAA 3LWAA 3WGXA 3CSHA 2EIQA 3GA4A 5FWGA 5J9BA 4XS4A 1ZYPA 2DIYA 3GL3A 4KE3A 1XWBA 3QOUA 4Z2RA 4KA0A 3US3A 3O3TA 4DEJA 2IMKA 5B6NA 1MEKA 3UBLA 4ZB6A 3LORA 5DJMA 3BCIA 1FB6A 3ZL5A 4K7IA 3ZRDA 2GTUA 3ZTLA 4HJ2A 19GSA 2DJ2A 2R0PA 4L8EA 3ERGA 1ZGNA 4USSA 4WBRD 3GN3A 5HFKA 5J4UA 3EMPA 2B1KA 4AI6A 4CY6A 3U5RE 4YAPA 2M72A 1SYRA 2V32A 3WD6A 1T8EB 1A24A 1XCCA 1XWCA 4BL7A 2H71A 2QA2A 3C8EA 4PUFC 2WFCA 4XS4B 3Q18A 4N0ZA 1PD21 1GTBA 2IMIA 4HU9A 1ERWA 5A5KA 2P5QA 3LSZA 3HJPA 1E6BA 1F3BA 5ECIB 3LW9A 5CNWA 3K8NA 2EFHA 5ECOB 5E59A 4IBPA 2H76A 2IMEA 2O5VA 1SVOA 1F6MC 2QKEA 3HZ8A 1SK1A 17GSA 2OBKA 4Z2UA 2VL3A 2CQ9A 2HRNA 2REMA 2E2GA 4BL7B 3TKRA 2I81A 2TIRA 3Q6OA 3LXTA 5ECSA 2MZCA 4TR1A 2FCHA 3QPMA 2H30A 1TTZA 3CXGA 3ME7A 1X9MB 2A2SA 4I5QA 2YWIA 2HI7A 5KN2A 4N11A 8GSSA 3P2AA 2VOCA 4X0XA 5LD0A 3O6TA 4FYUA 1X5DA 1U87A 1QK8A 3F9UA 5HQPA 3UOMA 1MDJA 1K3YA 2K8SA 4NPBA 5J5NA 1T7PB 1V98A 2H1BA 3HYPA 1UVZA 3KTLA 3GTUA 1Z5YE 2LV3A 1TW9A 1B9YC 4KDUA 2VCTA 1G6WA 3LQ7A 1HNCA 1PX6A 1XWAA 1O8WA 2TRCP 2H1LA 2EC4A 2GZPA 4TR1B 3WYWA 4Q5NA 1V9WA 2I3YA 1YKCA 5CYYA 2GT6A 2DMMA 4FYBA 5HR2A 1SENA 1GUKA 5CP1A 3M1GA 4YQMA 3H1NA 4ID0A 1V2AA 2WB9A 3A5WA 4MJBA 4I2UA 5LNKe 1TK5B 3M3MA 2OE0A 2L4QA 4V2MA 1EWXA 3GTUB 5D9VA 4IN0A 2AYTA 2RM5A 4KDXA 4AGSA 3A2VA 2CAIA 1EGOA 3FKFA 1AC1A 1X9WB 3CSIA 4J57E 4O7HA 1A0RP 5HFIA 2H1DA 2C8UA 1GP1A 3L9VA 4BWSA 2LJKA 2EFCA 2B5EA 4MA9A 5CRHA 2HQTA 4RQRA 1M2AA 5B6MA 1NHOA 2VM1A 4GQCA 3ERFA 3GHAA 1DSBA 1YQ1A 1FG4A 2RUFA 4KCAA 3DGQA 4AKIA 3WT2A 4Q5FA 2DBCA 1PL2A 2H72A 2P5RA 4DVCA 5A5HA 1G6YA 3FR3A 3QD9A 1S3DA 4BPYA 3S9FA 4K7OA 1MTCA 4WETA 2WULA 1EEMA 5D9TA 4MPFA 3EVIA 3F63A 1JZWA 3ZMLA 4OCEA 4Z7XA 3U6VA 4HJMA 1X9SB 3HJMA 3HVVA 3SBCA 4IELA 1U88A 5E4WA 1CQHA 3MIXA 3NIVA 1BAYA 3F6DA 1FVKA 3FR9A 4TXVA 3IAM2 4EIPA 4N10A 4PQ1A 5DVBA 4I6XA 4F9ZA 1Y1UA 1DE2A 1PKZA 1ML6A 2PMTA 2C3NA 4TN8A 1LBKA 1H4OA 4KAEA 2P0GA 3IC4A 2YNXA 3WGEA 2FGXA 5LCZA 1XVQA 1GTUA 3RHCA 5ABRA 1OKDA 1THXA 5H5RA 1GSYA 2QA1A 3CSJA 4K5RA 1VF4A 4LA1A 3KH7A 4ZL7A 4QQ7A 1SJIA 2H0GA 1NM3A 1VF3A 2R37A 3GNJA 2TRXA 1SVLA 5L71A 2CVDA 1SVMA 2JSYA 4OO5A 3DIEA 3C73A 2AB6A 4X43A 5D96A 4MP4A 4HZ4A 10GSA 4ZIJA 3VWXA 3M9KA 1KEBA 1WRYA 3IXRA 5GSTA 2CVBA 2HSHA 1TP9A 1XWGA 1YF1A 5IMVA 3FZ9A 4IJ3A 4PQHA 1A2LA 4OD7A 1WJKA 3MAKA 2FWGA 2G0FA 1BX9A 1RQMA 2WCIA 3I69A 4YAVA 3QAGA 3GKXA 2OJLA 4KF9A 3W8JA 1GSFA 3DD3A 2I1UA 1M2DA 4V1Ap 3KTBA 3DKSA 4KW6A 1TDIA 2HRKA 2DKIA 4K5SA 3PH9A 3EURA 13GSA 1SKRB 1WOUA 1GLPA 4K2DA 4NXIA 1C72A 1Z7PA 1BG1A 2PVQA 4YH2A 3E3EA 4O5UA 3N5OA 1PRXA 1XXUA 5IM9A 1Q4JA 3HD5A 4JU5A 3IBHA 5DAKB 5D73A 1OC3A 4D73A 1N8JA 2ES7A 16GSA 1V57A 3CYNA 4ISDA 2ZNMA 2HRFA 1UN2A 3EC3A 3CRUA 3GRXA 3EWLA 3IHQA 5B8AA 4K6XA 1YEXA 9GSSA 2NTOA 2GS3A 3GKMA 2YANA 3Q74A 2O87A 5JCWA 1XOAA 1M2BA 4AJ8A 2JL4A 4EVMA 2NPBA 2HRKB 4WBJA 2YV7A 2N5BA 1GUHA 4TOPA 3UBKA 3MNGA 5GZZB 1TK0B 2JACA 1T1VA 2GDRA 5GSSA 1YZXA 1GRXA 4V2LA 2ZUPA 2VAFA 2ON7A 3NOFA 2X64A 2FUG2 3WT1A 4D73B 3TRQA 2V2GA 1SK0A 2PGTA 4MH2A 2C3QA 1WP0A 4IQAA 4XS1A 3GKKA 22GSA 1TU8A 4O5RA 2NBSA 1TRWA 2J9HA 2LRTA 4KGIA 3DVXA 2HSNA 4EXJA 1R7HA 3RPNA 3I43A 4GXZA 3QMXA 3VK9A 2VL2C 4MF7A 4ZL8A 2DMLA 2VL2A 1SD8A 5JWQB 4GF0A 1EP8A 5IO0A 2H74A 1PGTA 5ENUA 5FHIA 4OWYA 1ZL9A 3O76A 1XWKA 1GLQA 2MBSA 2C0EA 3KH9A 4QMKA 2X49A 1WWJA 1OC8A 2FWFA 2F51A 1U3AA 2HXKA 4XCSA 2O89A 4ECJA 3DXBA 1ZOFA 4ECCA 3G7JA 2Z9SA 4JR6A 5GAPD 3APQA 4ML6A 2VO4A 3TB2A 1XZOA 4BVYA 1O85A 2LS5A 3KJYA 4MNNA 1R5AA 1XW9A 2B1LA 3KEBA 4TXOA 2XPDA 4NHWA 5CAXA 4AKGA 6GSYA 5KN0A 7GSSA 4YQUA 4NV5A 1M9AA 4ZB7A 1MD3A 4AKXB 2JZSA 1MD4A 3TGZA 1H75A 4FQUA 4EE0A 4GDFA 1ZZYA 1KTEA 2L5LA 4JBBA 3FZ4A 2L6CA 4F82A 2L5OA 4KSOA 4AJ6A 4LL1B 2R4VA 3JCML 3F4RA 3A2XA 3G9BA 4BVYB 3KXOA 2GQKA 4W66A 2R0CA 1S3AA 3D4TA 5G1LA 1SU9A 4WXTA 3QFBC 4JRRA 2GZYA 4TXOB 1GWCA 4G01A 4POKA 4E68A 4XS6A 5F05A 1SJ6A 5G5EA 2IN3A 3I6AA 5J9CA 1B9XC 5ECNB 2LKUA 1OAZA 2LQQA 3D6IA 3GIXA 1PQNA 5IMCA 2YJHA 4GWRA 2FWHA 1BQ7A 3LFLA 2PUKC 3N9JA 1WPIA 3IHGA 3GSTA 2RIIA 2H0HA 3KCMA 4F2IA 3ED3A 1Z3EA 1J08A 5J47A 3HCZA 1QQ2A 5IPGA 5BMUA 2WRTA 2LSTA 4IS0A 5ECHB 4BA7A 2UV8G 6GSWA 3HJOA 4GSNA 1A2JA 4ECBA 2PPTA 3VPTA 1SKSB 3TJKA 3P90A 1G0TA 4X1UA 1GTAA 1GULA 3I9V2 3LXZA 5GAND 1TKDB 1YEPA 4A5PA 2VCWA 1EEJA 2LNTA 4GCIA 3HKRA 2AV4A 1WIKA 2A2RA 5BRTA 3L4NA 4HQZA 5KEJA 4HI7A 1K3OA 4ZB8A 6GSTA 2X8CA 2EFEA 5ECQB 5C00A 1URMA 3ZMKA 5AIVA 1USBA 4MJAA 2L57A 3D5JA 2PERA 4WR5A 2EIOA 2N5AA 5JCGA 1XVWA 1AQWA 1GTIA 5IO2A 3RAZA 3LGCA 2OT3A 1DUGA 3ZITA 1VGLA 1HD2A 3FK8A 2X8GA 2PBJA 4MDCA 5A4WA 4EDYA 1V40A 3VLNA 1VF2A 1NSWA 5CRWA 2YP6A 2QGVA 2FNOA 3MWHA 4GSSA 1R4WA 1I9DA 2FY6A 2C0GA 1WMJA 2IFQA 2VCVA 3GUSA 2YWNA 2X99A 1AQXA 1O73A 1FHEA 4L0WA 4HOJA 3UL3A 4PX1A 3TU3B 1ERTA 3LG6A 3QAWA 5AGYA 3NZNA 1PL1A 3IV4A 3KP9A 4RI7A 4WEYA 5JWRB 2H6XA 1V58A 5G30A 4AJ7A 3FYGA 1EV4A 3DRNA 4Z2TA 1OKTA 2VKZG 2CZ2A 4FO5A 3IR4A 2H01A 1X5CA 3LJRA 3TOUA 4ULXA 3CMIA 3PR8A 4I8BA 5IIZA 2DKHA 3ZIVA 5DALA 3ISOA 5IOWA 2AHEA 1W89A 2PWJA 2OE1A 2RUEA 2LQOA 4DSRA 4ZXGA 1TXUA 4MZBA 3F3QA 2IFQB 4K2XA 2YWOA 4EDZA 2O7KA 4MH3A 6GSSA 4EL1A 4Q5RA 3QDNA 2M46A 3EYTA 3TJGA 4PNGA 5F07A 2K6VA 4NV2A 4L5OA 2GZZA 1K0OA 1O8XA 4G19A 1SL1B 5KN1A 3IOSA 4AKHA 1OC9A 3GH9A 2DC5A 1QGVA 1IYHA 4G0KA 3GL5A 2GSQA 5DALB 2VCZA 3LYPA 3ERWA 2VD0A 4EO3A 2XHFA 4L5LA 2XBIA 2H8LA 4XHMA 5A5HB 4XRDA 2NDOA 4KDYA 5A1NA 2FWEA 1YVLA 2H66A 4JZQA 1M99A 2LUSA 1XBSA 2YZUA 3MYDA 2HSMA 2IIYA 2IPAA 2MMZA 1T4ZA 3L9SA 3EMXA 3TKPA 1O6JA 4OFNA 4KNDA 4LMVA 3FW2A 2H6ZA 1TI1A 5HR0A 4EC0A 5D9WA 1B48A 2H73A 2B7JA 2RLIA 1B4PA 3QFAC 5HR1A 1SD9A 2C4JA 1GNEA 4E8EA 4IKHA 1OC9B 1EOHA 5ECPB 4TRXA 1QUWA 3PGTA 3J7Yk 2GGTA 1EOGA 4Q5QA 4ZB9A 1M9BA 5CO3A 3GFKA 1QFNA 4XTSA 3IK9A 4WR4A 2MMOA 4BWQA 3FZ5A 2MMNA 3DYRA 3KMNA 5ECLB 5A1NB 4I2TA 4J2FA 4OMVA 1RK4A 3GYKA 4OO4A 1BF5A 3DVWA 2HSMB 2HZEA 4CW9A 3EINA 2AJQB 4K8MA 2A2PA 4RUVA 5EVOA 4HUAA 1BG5A 1PN9A 4LLRA 3IAS2 3DMLA 3RBTA 1K0MA 2HSYA 1YY7A 1PSQA 1Y6EA 3EPTA 2YCDA 2K18A 1SKWB 3L9UA 1ZCPA 1QXHA 1JZRA 4XRAA 4JR4A 4HU7A 3Q19A 2VLUA 4MJCA 4OFTA 2DJ3A 2JSZA 2G2QA 12GSA 3APOA 1THOA 5F8BA 4RI6A 3F8UA 1UA5A 3TOTA 2C0DA 5CRDA 3IRAA 3TKSE 3ZVJA 3TJJA 2OACA 2O8VB 3FHKA 4IP1A 4WF4A 3MDKA 2HZEB 1EP7A 4MZWA 1JZDA 4MABA 1HQOA 2E0QA 5ECRB 1E2YA 5A4UA 4L0UA 4MCUA 1K0AA 5D9XA 1LU4A 1EGRA 3IDVA 2I4AA 2IMDA 3H93A 2KHPA 3FZAA 3H8QA 1TRSA 1AIUA 5ID2A 1N25A 2YOIA 4QL9A 3KP8A 3LYKA 5DCGA 2F8AA 2YV9A 2QC7A 3F3RA 1ZYEA 4KB3A 5KOXA 3D22A 2HFDA 2OADA 1KNGA 2H1GA 3E0UA 4MF6A 4PQIA 5JCUA 3KGKA 1U6TA 3CWGA 4TR4A 3ZYWA 3HVSA 2ZCTA 3GMFA 2VIMA 4NHZA 1K0CA 3KMOA 4NMUA 2QSIA 1JHBA 2F9SA 3TJBA 3KM6A 1ZYNA 1F9MA 2LEGA 3LEFA 4G10A 2R0GA 5KOWA 3BD2A 4MZCA 5ID2B 1NHYA 4TR0A 18GSA 3UARA 5INYA 3ZFBA 1Y25A 2LRNA 3IC8A 2XPEA 1W4VA 2C80A 4LL4B 3ME8A 5IQYA 4TKYA 2LJAA 4KH7A 2GSTA 1OE7A 2HZFA 2KP2A 5DJLA 3TUEA 3EE2A 2H6YA 3W6GA 2KLXA 4LMWA 4YQVA 2KUCA 2FLSA 1ABAA 5J4YA 3TCOA 4J56E 3ZVJD 1JZOA 2HSNB 4MMMA 4O32A 3GH6A 2BJXA 3GURA 2GSRA 3GX0A 4ECIA 1A2MA 2H0IA 2DJ1A 4FH8A 4RQXA 2K8VA 4P3YB 1U3IA 2H1AA 4NAXA 1Z7RA 3KZQA 1QMVA 1SK2A 5AIXA 1A8YA 3W8SA 3MSZA 5ECMB 3VPQA 2AAWA 2VLVA 2B3SA 3UJ1A 4FYCA 5ELAA 2CAQA 3VWVA 3F0IA 4F0BA 3H79A 3HHVA 3D21A 4K1FA 1GSDA 1SYXA 5CRGA 4AF2A 3G7YA 2GVPA 1GSQA 4TVEA 3M0FA 5IMAA 2C0FA 2BMXA 2AUVA 1T3BA 1K0BA 4IJIA 4PURA 3TKQA 1TU7A 3BOAA 1PN0A 2VLTA 2CT6A 5DDLA 2GLRA 2DJJA 3VURA 2EFDA 4WKWA 1BYEA 4F0CA 3EU3A 5IMZA 2XBQA 2F3MA 2L59A 1GSUA 2KP1A 3C7MA 4X4JA 1X5EA 1F3AA 5IOXA 2L6DA 1A8LA 1GUMA 4ILFA 3HZ4A 1AUCA 3OR5A 4ZBDA 1JLWA 3M9JA 3PINA 2FA8A 4KSMA 1PX7A 2MMAA 1M0UA 1Q98A 3IK7A 4ZBAA 2V1MA 2R3XA 2CV4A 2DIZA 14GSA 3FMWA 3SWLA 1Z6MA 3A2WA 2R6KA 2IMFA 2P31A 3FY7A 4G0LA 3VI5A 1B8XA 3ZIJA 1S3CA 1BJXA 1OVNA 1ZMAA 1J0FA 1GSSA 1G7OA 5ECKB 2YZHA 1EZKA 3J7Yb 3IA1A 3F4TA 4G0IA 1NW2A 1FOVA 1FAAA 2FD3A 4GSTA 5HR3A 2LRCA 2IL3A 3UAPA 5B8BA 3ZFLA 4BVXA 1TK8B 5BMUB 2A4HA 4GTUA 5H5SA 2VCXA 3AY8A 2DJKA 1Z6NA 4TW5A 5DQSA 5JWOB 1K0DA 3BCKA 4JEDA 4QL7A 2CA8A 2WJUA 4K0GA 2ALBA 2K9FA 1ON4A 1XFLA 1K3LA 4ICYA 2OKAA 3QAVA 3RHBA 2O85A 1RW1A 5J40A 3CTFA 2E7PA 4G9HA 3ZZXA 4YKFA 3GX8A 2H19A 3CTGA 1TXXA 2A4VA 2LNSA 3A3TA 2JZRA 3P8WA 3GSSA 4BVXB 5D8IA 2XC2A 3R2QA 3IE3A 4MF5A 3UVTA 5A4VA 2GQMA 1PKWA 2MBTA 5G5FA 3VWWA 2UZ8A 1BEDA 1R5PA 2H75A 1PMTA 1T00A 2HE3A 1AXDA 2YN1A 2PN8A 2VM2A 3KD0A 1XOBA 5DCHA 1O7UA 3GV1A 1XW5A 1GSEA 1DE1A 3PPUA 4ACSA 4ZL9A 4CY8A 3E9JB 4IHUA 3EU4A 2PVOC 3ZLPA 20GSA 2VUPA 1XW6A 1ACVA 3WGDA 2VCQA 1J9BA 4OCFA 1VF1A 3TJFA 3D4MA 2OE3A 1PA3A 1SL2B 2D2ZA 1OYJA 4MPGA 4YKGA 2VD1A 3HY2A 4DSSA 1B4QA 1AW9A 1JFUA 2V41A 4O92A 1TJDA 4I97A 3F6FA 1KBNA 2LTKA 11GSA 1YDKA 4V1Ag 4GLTA 4H86A 3GKNA 1SL0B 3P7XA 3RPPA 2OBIA 1GL8A 5A34A 2GT5A 3F4SA 4TR3A 1JLVA 2LJRA 2RM6A 1AQVA 5EL8A 2N5FA 2CVKA 2YPMA 2HLSA 2B5YA 3FR6A 3C71A 1VRSD 3TDGA 1X0RA 1XIYA 1TRVA 4DSSB 3QR6A 4PTSA 1SJZA 2CX4A 1GNWA 1HNBA 4WF5A 5C04A 4CHSA 2JADA 4ML1A 3DWVA 3DEXA 5G31A 3M8NA 5A34B 1TI3A 2VL9A 2IWTA 4N30A 3UIWA 5EY6A 1TRUA 5FT3A 5J4VA 2HT9A 2IJYA 4EIQA 5IPHA 1ST9A 2HYXA 2I9HA 3QCPA 5DBQA 2EIRA 1ERVA 4OFMA 1AAZA 2PU9C 2X4AA 4IGJA 5CREA 3APSA 4ZILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSA A;  2YWM A;  1O81 A;  2R2J A;  4GRF A;  5DAK A;  1UC7 A;  2YJ7 A;  1FVJ A;  4GQF A;  2GQL A;  2ON5 A;  1FW1 A;  3G7I A;  4F03 A;  4MLY A;  1MDI A;  3CBU A;  4IW9 A;  3VFI A;  5H5Q A;  1Z9H A;  2JZT A;  3VI7 A;  1F37 A;  1MDK A;  3HVX A;  3TKS C;  2B7K A;  1IYI A;  3TKS A;  6GSV A;  4HQS A;  1A0F A;  1EV9 A;  3RDW A;  2C3T A;  6GSX A;  3CRT A;  2L4C A;  1HYU A;  4EUY A;  2V6O A;  1LJR A;  4PXO A;  1I5G A;  1T4Y A;  5AN1 A;  2B6M A;  4MK3 A;  3L78 A;  4POB A;  2HNL A;  6GSU A;  1YJ6 A;  3HA9 A;  4DSQ A;  3FEU A;  4K9Z A;  4POL A;  1A23 A;  1F2E A;  2H70 A;  2X8H A;  4MJE A;  4V2N A;  4G2E A;  5EPF A;  1WE0 A;  2WDU A;  3V1W A;  5G2Z A;  3HDC A;  4FIW A;  3HXS A;  2CX3 A;  5IMF A;  1G7E A;  4NWY A;  3KIJ A;  4POM A;  3TRP A;  4CDO A;  2B5X A;  1CQG A;  4IP6 A;  4N0V A;  4K0N A;  2F8F A;  1M7T A;  1XPV A;  1DBY A;  1N2A A;  3H4K A;  3D0Z A;  3TRX A;  4HS1 A;  2JU5 A;  5J3R A;  5COH A;  2WZ9 A;  2V6K A;  5IMD A;  1HNA A;  5DQY A;  5D93 A;  4KX4 A;  2E2M A;  4E8H A;  2FA4 A;  3BBY A;  2OA7 A;  2GSS A;  1R26 A;  3BJ5 A;  4KUN A;  5G1K A;  2NVL A;  1FB0 A;  5AIS A;  4XIH A;  5HFG A;  1YF0 A;  2KOK A;  2DLX A;  2WGR A;  2M80 A;  3FRC A;  4PGT A;  2R5G A;  5J41 A;  1OE8 A;  3C1S A;  4EF0 A;  3UVH A;  2CZ3 A;  1ERU A;  5F0G A;  4K7N A;  2C1Y A;  4PUA A;  3R3E A;  2WS2 A;  3IPZ A;  4IQ1 A;  2BTO T;  1K0N A;  1TOF A;  3UEM A;  4ZBB A;  1ILO A;  5KN3 A;  3ZRE A;  4IVF A;  1GH2 A;  3C1R A;  2FHE A;  5ELG A;  2J23 A;  4HDE A;  5F06 A;  5B7C A;  4KCE A;  3L0H A;  1FO5 A;  4JE1 A;  4PNF A;  4EKZ A;  1ZYQ B;  3VWU A;  4HZ2 A;  1YKA A;  2DJ0 A;  2MYG A;  4HEA 2;  3UMA A;  2HRA A;  3LWA A;  3WGX A;  3CSH A;  2EIQ A;  3GA4 A;  5FWG A;  5J9B A;  4XS4 A;  2DIY A;  3GL3 A;  4KE3 A;  1XWB A;  3QOU A;  4KA0 A;  3US3 A;  3O3T A;  4DEJ A;  2IMK A;  5B6N A;  1MEK A;  3UBL A;  4ZB6 A;  3LOR A;  5DJM A;  3BCI A;  1FB6 A;  3ZL5 A;  4K7I A;  3ZRD A;  2GTU A;  3ZTL A;  4HJ2 A;  19GS A;  2DJ2 A;  4L8E A;  3ERG A;  1ZGN A;  4USS A;  4WBR D;  3GN3 A;  5HFK A;  5J4U A;  3EMP A;  2B1K A;  3U5R E;  4YAP A;  2M72 A;  1SYR A;  2V32 A;  3WD6 A;  1T8E B;  1A24 A;  1XCC A;  1XWC A;  4BL7 A;  2H71 A;  3C8E A;  4PUF C;  2WFC A;  4XS4 B;  3Q18 A;  4N0Z A;  1PD2 1;  1GTB A;  2IMI A;  4HU9 A;  1ERW A;  5A5K A;  2P5Q A;  3LSZ A;  3HJP A;  1E6B A;  1F3B A;  5ECI B;  5CNW A;  3K8N A;  5ECO B;  5E59 A;  4IBP A;  2H76 A;  2IME A;  1F6M C;  2QKE A;  3HZ8 A;  1SK1 A;  17GS A;  2OBK A;  2VL3 A;  2CQ9 A;  2HRN A;  2REM A;  2E2G A;  4BL7 B;  3TKR A;  2I81 A;  2TIR A;  3Q6O A;  3LXT A;  5ECS A;  2MZC A;  4TR1 A;  2FCH A;  3QPM A;  2H30 A;  1TTZ A;  3CXG A;  3ME7 A;  1X9M B;  2A2S A;  4I5Q A;  2YWI A;  2HI7 A;  5KN2 A;  4N11 A;  8GSS A;  3P2A A;  2VOC A;  4X0X A;  5LD0 A;  3O6T A;  4FYU A;  1X5D A;  1U87 A;  1QK8 A;  3F9U A;  5HQP A;  3UOM A;  1MDJ A;  1K3Y A;  2K8S A;  4NPB A;  5J5N A;  1T7P B;  1V98 A;  2H1B A;  3HYP A;  1UVZ A;  3KTL A;  3GTU A;  1Z5Y E;  2LV3 A;  1TW9 A;  1B9Y C;  4KDU A;  2VCT A;  1G6W A;  3LQ7 A;  1HNC A;  1PX6 A;  1XWA A;  1O8W A;  2TRC P;  2EC4 A;  2GZP A;  4TR1 B;  3WYW A;  4Q5N A;  1V9W A;  2I3Y A;  1YKC A;  5CYY A;  2GT6 A;  2DMM A;  4FYB A;  5HR2 A;  1SEN A;  1GUK A;  5CP1 A;  3M1G A;  4YQM A;  3H1N A;  4ID0 A;  1V2A A;  2WB9 A;  3A5W A;  4MJB A;  4I2U A;  5LNK e;  1TK5 B;  3M3M A;  2OE0 A;  2L4Q A;  4V2M A;  1EWX A;  3GTU B;  5D9V A;  4IN0 A;  2AYT A;  2RM5 A;  4KDX A;  4AGS A;  3A2V A;  2CAI A;  1EGO A;  3FKF A;  1AC1 A;  1X9W B;  3CSI A;  4J57 E;  4O7H A;  1A0R P;  5HFI A;  2H1D A;  2C8U A;  1GP1 A;  3L9V A;  4BWS A;  2LJK A;  2B5E A;  4MA9 A;  5CRH A;  2HQT A;  4RQR A;  1M2A A;  5B6M A;  1NHO A;  2VM1 A;  4GQC A;  3ERF A;  3GHA A;  1DSB A;  1YQ1 A;  1FG4 A;  2RUF A;  4KCA A;  3DGQ A;  3WT2 A;  4Q5F A;  2DBC A;  1PL2 A;  2H72 A;  2P5R A;  4DVC A;  1G6Y A;  3FR3 A;  3QD9 A;  1S3D A;  4BPY A;  3S9F A;  4K7O A;  1MTC A;  4WET A;  2WUL A;  1EEM A;  5D9T A;  4MPF A;  3EVI A;  3F63 A;  1JZW A;  3ZML A;  4OCE A;  4Z7X A;  3U6V A;  4HJM A;  1X9S B;  3HJM A;  3HVV A;  3SBC A;  4IEL A;  1U88 A;  5E4W A;  1CQH A;  3NIV A;  1BAY A;  3F6D A;  1FVK A;  3FR9 A;  4TXV A;  3IAM 2;  4N10 A;  4PQ1 A;  5DVB A;  4I6X A;  4F9Z A;  1DE2 A;  1PKZ A;  1ML6 A;  2PMT A;  2C3N A;  4TN8 A;  1LBK A;  1H4O A;  4KAE A;  2P0G A;  3IC4 A;  2YNX A;  3WGE A;  2FGX A;  5LCZ A;  1XVQ A;  1GTU A;  3RHC A;  5ABR A;  1OKD A;  1THX A;  5H5R A;  1GSY A;  3CSJ A;  1VF4 A;  4LA1 A;  3KH7 A;  4ZL7 A;  4QQ7 A;  1SJI A;  2H0G A;  1NM3 A;  1VF3 A;  2R37 A;  3GNJ A;  2TRX A;  5L71 A;  2CVD A;  2JSY A;  4OO5 A;  3DIE A;  3C73 A;  2AB6 A;  4X43 A;  5D96 A;  4MP4 A;  4HZ4 A;  10GS A;  4ZIJ A;  3VWX A;  3M9K A;  1KEB A;  1WRY A;  3IXR A;  5GST A;  2CVB A;  2HSH A;  1TP9 A;  1XWG A;  1YF1 A;  5IMV A;  3FZ9 A;  4IJ3 A;  4PQH A;  1A2L A;  4OD7 A;  1WJK A;  3MAK A;  2FWG A;  2G0F A;  1BX9 A;  1RQM A;  2WCI A;  3I69 A;  4YAV A;  3QAG A;  3GKX A;  2OJL A;  4KF9 A;  3W8J A;  1GSF A;  3DD3 A;  2I1U A;  1M2D A;  4V1A p;  3KTB A;  3DKS A;  4KW6 A;  1TDI A;  2HRK A;  3PH9 A;  3EUR A;  13GS A;  1SKR B;  1WOU A;  1GLP A;  4K2D A;  4NXI A;  1C72 A;  1Z7P A;  2PVQ A;  4YH2 A;  3E3E A;  3N5O A;  1PRX A;  1XXU A;  5IM9 A;  1Q4J A;  3HD5 A;  4JU5 A;  3IBH A;  5DAK B;  5D73 A;  1OC3 A;  4D73 A;  1N8J A;  2ES7 A;  16GS A;  1V57 A;  3CYN A;  4ISD A;  2ZNM A;  2HRF A;  1UN2 A;  3EC3 A;  3CRU A;  3GRX A;  3EWL A;  3IHQ A;  5B8A A;  4K6X A;  1YEX A;  9GSS A;  2NTO A;  2GS3 A;  3GKM A;  2YAN A;  3Q74 A;  2O87 A;  5JCW A;  1XOA A;  1M2B A;  4AJ8 A;  2JL4 A;  4EVM A;  2NPB A;  2HRK B;  4WBJ A;  2YV7 A;  2N5B A;  1GUH A;  4TOP A;  3UBK A;  3MNG A;  5GZZ B;  1TK0 B;  2JAC A;  1T1V A;  2GDR A;  5GSS A;  1YZX A;  1GRX A;  4V2L A;  2ZUP A;  2VAF A;  2ON7 A;  3NOF A;  2X64 A;  2FUG 2;  3WT1 A;  4D73 B;  3TRQ A;  2V2G A;  1SK0 A;  2PGT A;  4MH2 A;  2C3Q A;  1WP0 A;  4IQA A;  4XS1 A;  3GKK A;  22GS A;  1TU8 A;  4O5R A;  2NBS A;  1TRW A;  2J9H A;  2LRT A;  4KGI A;  3DVX A;  4EXJ A;  1R7H A;  3RPN A;  3I43 A;  4GXZ A;  3QMX A;  3VK9 A;  2VL2 C;  4MF7 A;  4ZL8 A;  2DML A;  2VL2 A;  1SD8 A;  5JWQ B;  4GF0 A;  1EP8 A;  5IO0 A;  2H74 A;  1PGT A;  5ENU A;  5FHI A;  4OWY A;  1ZL9 A;  3O76 A;  1XWK A;  1GLQ A;  2MBS A;  2C0E A;  3KH9 A;  1WWJ A;  1OC8 A;  2FWF A;  2F51 A;  1U3A A;  2HXK A;  4XCS A;  2O89 A;  4ECJ A;  3DXB A;  1ZOF A;  4ECC A;  3G7J A;  2Z9S A;  4JR6 A;  5GAP D;  3APQ A;  4ML6 A;  2VO4 A;  3TB2 A;  1XZO A;  4BVY A;  1O85 A;  2LS5 A;  3KJY A;  1R5A A;  1XW9 A;  2B1L A;  3KEB A;  4TXO A;  2XPD A;  4NHW A;  5CAX A;  6GSY A;  5KN0 A;  7GSS A;  4YQU A;  4NV5 A;  1M9A A;  1MD3 A;  2JZS A;  1MD4 A;  3TGZ A;  1H75 A;  4FQU A;  4EE0 A;  1ZZY A;  1KTE A;  2L5L A;  4JBB A;  3FZ4 A;  2L6C A;  4F82 A;  2L5O A;  4KSO A;  4AJ6 A;  4LL1 B;  2R4V A;  3JCM L;  3F4R A;  3A2X A;  3G9B A;  4BVY B;  3KXO A;  2GQK A;  1S3A A;  3D4T A;  5G1L A;  1SU9 A;  4WXT A;  3QFB C;  4JRR A;  2GZY A;  4TXO B;  1GWC A;  4POK A;  4XS6 A;  5F05 A;  1SJ6 A;  5G5E A;  2IN3 A;  3I6A A;  5J9C A;  1B9X C;  5ECN B;  2LKU A;  1OAZ A;  2LQQ A;  3D6I A;  3GIX A;  1PQN A;  5IMC A;  2YJH A;  4GWR A;  2FWH A;  1BQ7 A;  3LFL A;  2PUK C;  3N9J A;  1WPI A;  3GST A;  2RII A;  2H0H A;  3KCM A;  4F2I A;  3ED3 A;  1Z3E A;  1J08 A;  3HCZ A;  1QQ2 A;  5IPG A;  5BMU A;  2WRT A;  2LST A;  4IS0 A;  5ECH B;  4BA7 A;  6GSW A;  3HJO A;  4GSN A;  1A2J A;  4ECB A;  2PPT A;  3VPT A;  1SKS B;  3TJK A;  3P90 A;  1G0T A;  4X1U A;  1GTA A;  1GUL A;  3I9V 2;  3LXZ A;  5GAN D;  1TKD B;  1YEP A;  2VCW A;  1EEJ A;  2LNT A;  4GCI A;  3HKR A;  2AV4 A;  1WIK A;  2A2R A;  3L4N A;  4HQZ A;  5KEJ A;  4HI7 A;  1K3O A;  4ZB8 A;  6GST A;  2X8C A;  5ECQ B;  5C00 A;  1URM A;  3ZMK A;  5AIV A;  1USB A;  4MJA A;  2L57 A;  3D5J A;  2PER A;  4WR5 A;  2EIO A;  2N5A A;  5JCG A;  1XVW A;  1AQW A;  1GTI A;  5IO2 A;  3RAZ A;  3LGC A;  1DUG A;  3ZIT A;  1VGL A;  1HD2 A;  3FK8 A;  2X8G A;  2PBJ A;  4MDC A;  5A4W A;  4EDY A;  1V40 A;  3VLN A;  1VF2 A;  1NSW A;  5CRW A;  2YP6 A;  2QGV A;  2FNO A;  3MWH A;  4GSS A;  1R4W A;  1I9D A;  2FY6 A;  2C0G A;  1WMJ A;  2IFQ A;  2VCV A;  3GUS A;  2YWN A;  2X99 A;  1AQX A;  1O73 A;  1FHE A;  4L0W A;  4HOJ A;  3UL3 A;  4PX1 A;  1ERT A;  3LG6 A;  3QAW A;  5AGY A;  3NZN A;  1PL1 A;  3IV4 A;  3KP9 A;  4RI7 A;  4WEY A;  5JWR B;  2H6X A;  1V58 A;  5G30 A;  4AJ7 A;  3FYG A;  1EV4 A;  3DRN A;  1OKT A;  4FO5 A;  2CZ2 A;  3IR4 A;  2H01 A;  1X5C A;  3LJR A;  3TOU A;  4ULX A;  3CMI A;  3PR8 A;  4I8B A;  5IIZ A;  3ZIV A;  5DAL A;  3ISO A;  5IOW A;  2AHE A;  1W89 A;  2PWJ A;  2OE1 A;  2RUE A;  2LQO A;  4DSR A;  4ZXG A;  4MZB A;  3F3Q A;  2IFQ B;  2YWO A;  4EDZ A;  2O7K A;  4MH3 A;  6GSS A;  4EL1 A;  4Q5R A;  3QDN A;  2M46 A;  3EYT A;  3TJG A;  4PNG A;  5F07 A;  2K6V A;  4NV2 A;  4L5O A;  2GZZ A;  1K0O A;  1O8X A;  4G19 A;  1SL1 B;  5KN1 A;  3IOS A;  1OC9 A;  3GH9 A;  2DC5 A;  1QGV A;  1IYH A;  4G0K A;  3GL5 A;  2GSQ A;  5DAL B;  2VCZ A;  3LYP A;  3ERW A;  2VD0 A;  4EO3 A;  2XHF A;  4L5L A;  2XBI A;  2H8L A;  4XHM A;  4XRD A;  2NDO A;  4KDY A;  2FWE A;  2H66 A;  4JZQ A;  1M99 A;  2LUS A;  1XBS A;  2YZU A;  2HSM A;  2IIY A;  2IPA A;  2MMZ A;  1T4Z A;  3L9S A;  3EMX A;  3TKP A;  1O6J A;  4OFN A;  4KND A;  4LMV A;  3FW2 A;  2H6Z A;  1TI1 A;  5HR0 A;  4EC0 A;  5D9W A;  1B48 A;  2H73 A;  2B7J A;  2RLI A;  1B4P A;  3QFA C;  5HR1 A;  1SD9 A;  2C4J A;  1GNE A;  4E8E A;  4IKH A;  1OC9 B;  1EOH A;  5ECP B;  4TRX A;  1QUW A;  3PGT A;  3J7Y k;  2GGT A;  1EOG A;  4Q5Q A;  4ZB9 A;  1M9B A;  5CO3 A;  3GFK A;  1QFN A;  4XTS A;  3IK9 A;  4WR4 A;  2MMO A;  4BWQ A;  3FZ5 A;  2MMN A;  3DYR A;  3KMN A;  5ECL B;  4I2T A;  4J2F A;  4OMV A;  1RK4 A;  3GYK A;  4OO4 A;  3DVW A;  2HSM B;  2HZE A;  4CW9 A;  3EIN A;  2AJQ B;  4K8M A;  4RUV A;  5EVO A;  4HUA A;  1BG5 A;  1PN9 A;  4LLR A;  3IAS 2;  3DML A;  3RBT A;  1K0M A;  2HSY A;  1YY7 A;  1PSQ A;  1Y6E A;  2YCD A;  2K18 A;  1SKW B;  3L9U A;  1ZCP A;  1QXH A;  1JZR A;  4XRA A;  4JR4 A;  4HU7 A;  3Q19 A;  2VLU A;  4MJC A;  4OFT A;  2DJ3 A;  2JSZ A;  2G2Q A;  12GS A;  3APO A;  1THO A;  5F8B A;  4RI6 A;  3F8U A;  1UA5 A;  3TOT A;  2C0D A;  5CRD A;  3IRA A;  3TKS E;  3ZVJ A;  3TJJ A;  2OAC A;  2O8V B;  3FHK A;  4IP1 A;  4WF4 A;  3MDK A;  2HZE B;  1EP7 A;  4MZW A;  1JZD A;  4MAB A;  1HQO A;  2E0Q A;  5ECR B;  1E2Y A;  5A4U A;  4L0U A;  4MCU A;  1K0A A;  5D9X A;  1LU4 A;  1EGR A;  3IDV A;  2I4A A;  2IMD A;  3H93 A;  2KHP A;  3FZA A;  3H8Q A;  1TRS A;  1AIU A;  5ID2 A;  2YOI A;  4QL9 A;  3KP8 A;  3LYK A;  5DCG A;  2F8A A;  2YV9 A;  2QC7 A;  3F3R A;  1ZYE A;  4KB3 A;  3D22 A;  2HFD A;  2OAD A;  1KNG A;  2H1G A;  3E0U A;  4MF6 A;  4PQI A;  5JCU A;  3KGK A;  1U6T A;  4TR4 A;  3ZYW A;  3HVS A;  2ZCT A;  3GMF A;  2VIM A;  4NHZ A;  1K0C A;  3KMO A;  4NMU A;  2QSI A;  1JHB A;  2F9S A;  3TJB A;  3KM6 A;  1F9M A;  2LEG A;  3LEF A;  4G10 A;  3BD2 A;  4MZC A;  5ID2 B;  1NHY A;  4TR0 A;  18GS A;  3UAR A;  5INY A;  3ZFB A;  1Y25 A;  2LRN A;  3IC8 A;  2XPE A;  1W4V A;  2C80 A;  4LL4 B;  3ME8 A;  5IQY A;  4TKY A;  2LJA A;  4KH7 A;  2GST A;  1OE7 A;  2HZF A;  2KP2 A;  5DJL A;  3TUE A;  3EE2 A;  2H6Y A;  3W6G A;  2KLX A;  4LMW A;  4YQV A;  2KUC A;  2FLS A;  1ABA A;  3TCO A;  4J56 E;  3ZVJ D;  1JZO A;  2HSN B;  4MMM A;  4O32 A;  3GH6 A;  2BJX A;  3GUR A;  2GSR A;  3GX0 A;  4ECI A;  1A2M A;  2H0I A;  2DJ1 A;  4FH8 A;  4RQX A;  2K8V A;  4P3Y B;  1U3I A;  2H1A A;  4NAX A;  1Z7R A;  3KZQ A;  1QMV A;  1SK2 A;  5AIX A;  1A8Y A;  3W8S A;  3MSZ A;  5ECM B;  3VPQ A;  2AAW A;  2VLV A;  2B3S A;  3UJ1 A;  4FYC A;  5ELA A;  2CAQ A;  3VWV A;  3F0I A;  4F0B A;  3H79 A;  3HHV A;  3D21 A;  4K1F A;  1GSD A;  1SYX A;  5CRG A;  4AF2 A;  3G7Y A;  2GVP A;  1GSQ A;  4TVE A;  3M0F A;  5IMA A;  2C0F A;  2BMX A;  2AUV A;  1T3B A;  1K0B A;  4IJI A;  4PUR A;  3TKQ A;  1TU7 A;  3BOA A;  2VLT A;  2CT6 A;  5DDL A;  2GLR A;  2DJJ A;  3VUR A;  4WKW A;  1BYE A;  4F0C A;  3EU3 A;  5IMZ A;  2XBQ A;  2F3M A;  2L59 A;  1GSU A;  2KP1 A;  3C7M A;  1X5E A;  1F3A A;  5IOX A;  2L6D A;  1A8L A;  1GUM A;  4ILF A;  3HZ4 A;  1AUC A;  3OR5 A;  4ZBD A;  1JLW A;  3M9J A;  3PIN A;  2FA8 A;  4KSM A;  1PX7 A;  2MMA A;  1M0U A;  1Q98 A;  3IK7 A;  4ZBA A;  2V1M A;  2R3X A;  2CV4 A;  2DIZ A;  14GS A;  3SWL A;  1Z6M A;  3A2W A;  2R6K A;  2IMF A;  2P31 A;  3FY7 A;  4G0L A;  3VI5 A;  1B8X A;  3ZIJ A;  1S3C A;  1BJX A;  1OVN A;  1ZMA A;  1J0F A;  1GSS A;  1G7O A;  5ECK B;  2YZH A;  1EZK A;  3J7Y b;  3IA1 A;  3F4T A;  4G0I A;  1NW2 A;  1FOV A;  1FAA A;  2FD3 A;  4GST A;  5HR3 A;  2LRC A;  2IL3 A;  3UAP A;  5B8B A;  3ZFL A;  4BVX A;  1TK8 B;  4GTU A;  5H5S A;  2VCX A;  3AY8 A;  2DJK A;  1Z6N A;  4TW5 A;  5DQS A;  5JWO B;  1K0D A;  3BCK A;  4JED A;  4QL7 A;  2CA8 A;  2WJU A;  4K0G A;  2ALB A;  2K9F A;  1ON4 A;  1XFL A;  1K3L A;  2OKA A;  3QAV A;  3RHB A;  2O85 A;  1RW1 A;  3CTF A;  2E7P A;  4G9H A;  3ZZX A;  3GX8 A;  2H19 A;  3CTG A;  1TXX A;  2A4V A;  2LNS A;  3A3T A;  2JZR A;  3P8W A;  3GSS A;  4BVX B;  5D8I A;  2XC2 A;  3R2Q A;  3IE3 A;  4MF5 A;  3UVT A;  5A4V A;  2GQM A;  1PKW A;  2MBT A;  5G5F A;  3VWW A;  2UZ8 A;  1BED A;  1R5P A;  2H75 A;  1PMT A;  1T00 A;  2HE3 A;  1AXD A;  2YN1 A;  2PN8 A;  2VM2 A;  3KD0 A;  1XOB A;  5DCH A;  1O7U A;  1XW5 A;  3GV1 A;  1GSE A;  1DE1 A;  3PPU A;  4ACS A;  4ZL9 A;  3E9J B;  4IHU A;  3EU4 A;  2PVO C;  3ZLP A;  20GS A;  2VUP A;  1XW6 A;  1ACV A;  3WGD A;  2VCQ A;  1J9B A;  4OCF A;  1VF1 A;  3TJF A;  3D4M A;  2OE3 A;  1PA3 A;  1SL2 B;  2D2Z A;  1OYJ A;  4MPG A;  2VD1 A;  3HY2 A;  4DSS A;  1B4Q A;  1AW9 A;  1JFU A;  2V41 A;  4O92 A;  1TJD A;  4I97 A;  3F6F A;  1KBN A;  2LTK A;  11GS A;  1YDK A;  4V1A g;  4GLT A;  4H86 A;  3GKN A;  1SL0 B;  3P7X A;  3RPP A;  2OBI A;  1GL8 A;  3F4S A;  2GT5 A;  4TR3 A;  1JLV A;  2LJR A;  2RM6 A;  1AQV A;  5EL8 A;  2N5F A;  2CVK A;  2YPM A;  2HLS A;  2B5Y A;  3FR6 A;  3C71 A;  1VRS D;  3TDG A;  1X0R A;  1XIY A;  1TRV A;  4DSS B;  3QR6 A;  4PTS A;  1SJZ A;  2CX4 A;  1GNW A;  1HNB A;  4WF5 A;  5C04 A;  4CHS A;  2JAD A;  4ML1 A;  3DWV A;  3DEX A;  5G31 A;  3M8N A;  1TI3 A;  2VL9 A;  2IWT A;  4N30 A;  3UIW A;  5EY6 A;  1TRU A;  5FT3 A;  2HT9 A;  2IJY A;  5IPH A;  1ST9 A;  2HYX A;  2I9H A;  3QCP A;  5DBQ A;  2EIR A;  1ERV A;  4OFM A;  1AAZ A;  2PU9 C;  4IGJ A;  5CRE A;  3APS A;  4ZIL A; 
#chains in the Genus database with same CATH topology
 2DSA A;  2YWM A;  1O81 A;  2R2J A;  4GRF A;  5DAK A;  1UC7 A;  2YJ7 A;  1FVJ A;  4GQF A;  2GQL A;  2ON5 A;  1FW1 A;  3G7I A;  4F03 A;  4MLY A;  1MDI A;  3CBU A;  4IW9 A;  3VFI A;  5H5Q A;  1Z9H A;  2JZT A;  4BIK A;  3VI7 A;  1F37 A;  1MDK A;  3HVX A;  3TKS C;  2B7K A;  1IYI A;  3TKS A;  6GSV A;  4HQS A;  1A0F A;  1EV9 A;  3RDW A;  2C3T A;  6GSX A;  3CRT A;  2L4C A;  1HYU A;  4EUY A;  2V6O A;  1LJR A;  4PXO A;  1FOH A;  1I5G A;  1T4Y A;  5AN1 A;  2B6M A;  4MK3 A;  3L78 A;  4POB A;  2HNL A;  6GSU A;  1YJ6 A;  3HA9 A;  4DSQ A;  3FEU A;  4K9Z A;  4POL A;  3HMJ G;  1A23 A;  1F2E A;  2H70 A;  2X8H A;  4MJE A;  4V2N A;  4G2E A;  5EPF A;  1WE0 A;  2WDU A;  3V1W A;  5G2Z A;  3HDC A;  4FIW A;  3HXS A;  2CX3 A;  5IMF A;  1G7E A;  4NWY A;  3KIJ A;  4POM A;  3TRP A;  4CDO A;  2B5X A;  1CQG A;  3HVN A;  3CHX C;  4IP6 A;  4N0V A;  4K0N A;  2F8F A;  1M7T A;  1XPV A;  1DBY A;  1N2A A;  1S4B P;  3H4K A;  3A5I A;  3D0Z A;  3TRX A;  4HS1 A;  2JU5 A;  5J3R A;  5COH A;  2WZ9 A;  2V6K A;  5IMD A;  1HNA A;  5DQY A;  5D93 A;  4KX4 A;  2E2M A;  4E8H A;  2FA4 A;  3BBY A;  2OA7 A;  2GSS A;  1R26 A;  3BJ5 A;  4KUN A;  5G1K A;  2NVL A;  1FB0 A;  5AIS A;  4XIH A;  5HFG A;  1YF0 A;  1YEW C;  2KOK A;  2DLX A;  2WGR A;  2M80 A;  3FRC A;  4PGT A;  2R5G A;  5J41 A;  1OE8 A;  3C1S A;  4EF0 A;  3UVH A;  2CZ3 A;  1ERU A;  5F0G A;  4K7N A;  2C1Y A;  4PUA A;  3R3E A;  2WS2 A;  3IPZ A;  4IQ1 A;  2BTO T;  1K0N A;  1TOF A;  3UEM A;  4ZBB A;  1ILO A;  5KN3 A;  3ZRE A;  4IVF A;  4N3Z A;  1GH2 A;  3C1R A;  2FHE A;  5ELG A;  2J23 A;  4HDE A;  5F06 A;  5B7C A;  4KCE A;  3L0H A;  4O5Q A;  1FO5 A;  4JE1 A;  4PNF A;  4EKZ A;  1ZYQ B;  3VWU A;  4HZ2 A;  1YKA A;  2DJ0 A;  2MYG A;  4HEA 2;  3UMA A;  2HRA A;  3LWA A;  3WGX A;  3CSH A;  2EIQ A;  3GA4 A;  5FWG A;  5J9B A;  4XS4 A;  1ZYP A;  2DIY A;  3GL3 A;  4KE3 A;  1XWB A;  1S3R A;  3QOU A;  4Z2R A;  4KA0 A;  3US3 A;  3O3T A;  4DEJ A;  2IMK A;  5B6N A;  1MEK A;  3UBL A;  4ZB6 A;  5DJM A;  3BCI A;  3LOR A;  1FB6 A;  3ZL5 A;  4K7I A;  3ZRD A;  2GTU A;  3ZTL A;  4HJ2 A;  19GS A;  2DJ2 A;  2R0P A;  4L8E A;  3ERG A;  1ZGN A;  4USS A;  4WBR D;  3GN3 A;  5HFK A;  5J4U A;  3EMP A;  2B1K A;  4AI6 A;  4CY6 A;  3U5R E;  4YAP A;  2M72 A;  1SYR A;  2V32 A;  3WD6 A;  1T8E B;  1A24 A;  1XCC A;  1XWC A;  4BL7 A;  2H71 A;  2QA2 A;  3C8E A;  4PUF C;  2WFC A;  4XS4 B;  3Q18 A;  4N0Z A;  1PD2 1;  1GTB A;  2IMI A;  4HU9 A;  1ERW A;  2O3E A;  5A5K A;  2P5Q A;  3LSZ A;  3HJP A;  1E6B A;  1F3B A;  5ECI B;  3LW9 A;  5CNW A;  3K8N A;  2EFH A;  5ECO B;  5E59 A;  4IBP A;  2H76 A;  2IME A;  2O5V A;  1SVO A;  1F6M C;  2QKE A;  3HZ8 A;  1SK1 A;  17GS A;  2OBK A;  4Z2U A;  2VL3 A;  2CQ9 A;  2HRN A;  2REM A;  2E2G A;  4BL7 B;  3TKR A;  2I81 A;  2TIR A;  3Q6O A;  3LXT A;  5ECS A;  2MZC A;  4TR1 A;  2FCH A;  3QPM A;  2H30 A;  1TTZ A;  3CXG A;  3ME7 A;  1X9M B;  2A2S A;  4I5Q A;  2YWI A;  2HI7 A;  5KN2 A;  4N11 A;  8GSS A;  3P2A A;  2VOC A;  4X0X A;  5LD0 A;  3O6T A;  4FYU A;  1X5D A;  1U87 A;  1QK8 A;  3F9U A;  3CQF A;  3UOM A;  5HQP A;  1MDJ A;  1K3Y A;  2K8S A;  4NPB A;  5J5N A;  1T7P B;  1V98 A;  2H1B A;  3HYP A;  1UVZ A;  3KTL A;  3GTU A;  1Z5Y E;  2LV3 A;  2WVZ A;  1TW9 A;  1B9Y C;  4KDU A;  2VCT A;  1G6W A;  3LQ7 A;  1HNC A;  1PX6 A;  1XWA A;  1O8W A;  2TRC P;  2H1L A;  2EC4 A;  2GZP A;  4TR1 B;  3WYW A;  4Q5N A;  1V9W A;  2I3Y A;  1YKC A;  5CYY A;  2GT6 A;  2DMM A;  4FYB A;  5HR2 A;  1SEN A;  1GUK A;  5CP1 A;  3M1G A;  4YQM A;  3H1N A;  4ID0 A;  1V2A A;  2WB9 A;  3A5W A;  4MJB A;  4I2U A;  5LNK e;  1TK5 B;  3M3M A;  2OE0 A;  2L4Q A;  4V2M A;  1EWX A;  3GTU B;  5D9V A;  4IN0 A;  2AYT A;  2RM5 A;  4KDX A;  4AGS A;  3A2V A;  2CAI A;  1EGO A;  3FKF A;  1AC1 A;  1X9W B;  3CSI A;  4J57 E;  4O7H A;  1A0R P;  5HFI A;  2H1D A;  2C8U A;  1GP1 A;  3L9V A;  4BWS A;  2LJK A;  2EFC A;  2B5E A;  4MA9 A;  5CRH A;  2HQT A;  4RQR A;  1M2A A;  5B6M A;  1NHO A;  2VM1 A;  4GQC A;  3ERF A;  3GHA A;  1DSB A;  1YQ1 A;  1FG4 A;  2RUF A;  4KCA A;  3DGQ A;  4AKI A;  3WT2 A;  4Q5F A;  2DBC A;  1PL2 A;  2H72 A;  2P5R A;  4DVC A;  5A5H A;  1G6Y A;  3FR3 A;  3QD9 A;  1S3D A;  4BPY A;  3S9F A;  4K7O A;  1MTC A;  4WET A;  2WUL A;  1EEM A;  5D9T A;  4MPF A;  3EVI A;  3F63 A;  1JZW A;  3ZML A;  4OCE A;  4Z7X A;  3U6V A;  4HJM A;  1X9S B;  3HJM A;  3HVV A;  3SBC A;  4IEL A;  1U88 A;  5E4W A;  1CQH A;  3MIX A;  3NIV A;  1BAY A;  3F6D A;  1FVK A;  3FR9 A;  4TXV A;  3IAM 2;  4EIP A;  4N10 A;  4PQ1 A;  5DVB A;  4I6X A;  4F9Z A;  1Y1U A;  1DE2 A;  1PKZ A;  1ML6 A;  2PMT A;  2WVX A;  2C3N A;  4TN8 A;  1LBK A;  1H4O A;  4KAE A;  2P0G A;  3IC4 A;  2YNX A;  3WGE A;  2FGX A;  5LCZ A;  1XVQ A;  1GTU A;  3RHC A;  5ABR A;  1OKD A;  1THX A;  5H5R A;  1GSY A;  2QA1 A;  3CSJ A;  4K5R A;  1VF4 A;  4LA1 A;  3KH7 A;  4ZL7 A;  4QQ7 A;  1SJI A;  2H0G A;  1NM3 A;  1VF3 A;  2R37 A;  3GNJ A;  2TRX A;  1SVL A;  5L71 A;  2CVD A;  1SVM A;  2JSY A;  4OO5 A;  3DIE A;  3C73 A;  2AB6 A;  4X43 A;  5D96 A;  4MP4 A;  4HZ4 A;  10GS A;  4ZIJ A;  2WVX B;  3VWX A;  3M9K A;  1KEB A;  1WRY A;  3IXR A;  5GST A;  2CVB A;  2HSH A;  1TP9 A;  1XWG A;  1YF1 A;  5IMV A;  3FZ9 A;  4IJ3 A;  4PQH A;  1A2L A;  4OD7 A;  1WJK A;  3MAK A;  2FWG A;  2G0F A;  1BX9 A;  1RQM A;  2WCI A;  3I69 A;  4YAV A;  3QAG A;  3GKX A;  2OJL A;  4KF9 A;  3W8J A;  1GSF A;  3DD3 A;  2I1U A;  1M2D A;  2WW0 A;  4V1A p;  3KTB A;  3DKS A;  4KW6 A;  1TDI A;  2HRK A;  2DKI A;  4K5S A;  3PH9 A;  3EUR A;  13GS A;  1SKR B;  1WOU A;  1GLP A;  4K2D A;  4NXI A;  1C72 A;  1Z7P A;  1BG1 A;  2PVQ A;  4YH2 A;  3E3E A;  4O5U A;  3N5O A;  1PRX A;  1XXU A;  5IM9 A;  1Q4J A;  3HD5 A;  4JU5 A;  3IBH A;  4HSC X;  1M3I A;  5DAK B;  5D73 A;  1I1I P;  4PI2 C;  1OC3 A;  4D73 A;  1N8J A;  2ES7 A;  16GS A;  1V57 A;  3CYN A;  4ISD A;  2ZNM A;  2HRF A;  1UN2 A;  3EC3 A;  3CRU A;  3GRX A;  3EWL A;  3IHQ A;  5B8A A;  4K6X A;  1YEX A;  9GSS A;  2NTO A;  2GS3 A;  3GKM A;  2YAN A;  3Q74 A;  2O87 A;  5JCW A;  1XOA A;  1M2B A;  4AJ8 A;  2JL4 A;  4EVM A;  2NPB A;  2HRK B;  4WBJ A;  2YV7 A;  2N5B A;  1GUH A;  4TOP A;  3UBK A;  3MNG A;  5GZZ B;  1TK0 B;  2JAC A;  1T1V A;  2GDR A;  5GSS A;  1YZX A;  1GRX A;  4V2L A;  2ZUP A;  2VAF A;  2ON7 A;  2X64 A;  2FUG 2;  3NOF A;  3WT1 A;  4D73 B;  3TRQ A;  2V2G A;  1SK0 A;  2PGT A;  4MH2 A;  2C3Q A;  1WP0 A;  4IQA A;  4XS1 A;  3GKK A;  22GS A;  1TU8 A;  4O5R A;  2NBS A;  1TRW A;  2J9H A;  2LRT A;  4KGI A;  3DVX A;  2HSN A;  4EXJ A;  1R7H A;  3RPN A;  3I43 A;  4GXZ A;  3QMX A;  3VK9 A;  2VL2 C;  4MF7 A;  4ZL8 A;  2DML A;  2VL2 A;  1SD8 A;  5JWQ B;  4GF0 A;  1EP8 A;  5IO0 A;  2H74 A;  1PGT A;  5ENU A;  5FHI A;  4OWY A;  1ZL9 A;  3O76 A;  1XWK A;  1GLQ A;  2MBS A;  2C0E A;  3KH9 A;  4QMK A;  2X49 A;  1WWJ A;  1OC8 A;  2FWF A;  2F51 A;  1U3A A;  2HXK A;  4XCS A;  2O89 A;  4ECJ A;  3DXB A;  1ZOF A;  4ECC A;  3G7J A;  2Z9S A;  4JR6 A;  5GAP D;  3APQ A;  4ML6 A;  2VO4 A;  3TB2 A;  1XZO A;  4BVY A;  1O85 A;  2LS5 A;  3KJY A;  4MNN A;  1R5A A;  1XW9 A;  2B1L A;  3KEB A;  4TXO A;  2XPD A;  4NHW A;  5CAX A;  4AKG A;  6GSY A;  5KN0 A;  7GSS A;  4YQU A;  4NV5 A;  1M9A A;  4ZB7 A;  1MD3 A;  4AKX B;  2JZS A;  1MD4 A;  3TGZ A;  1H75 A;  4FQU A;  4EE0 A;  4GDF A;  1ZZY A;  1KTE A;  2L5L A;  4JBB A;  3FZ4 A;  2L6C A;  4F82 A;  2L5O A;  4KSO A;  4AJ6 A;  4LL1 B;  2R4V A;  3JCM L;  3F4R A;  3A2X A;  3G9B A;  4BVY B;  3KXO A;  2GQK A;  4W66 A;  2R0C A;  1S3A A;  3D4T A;  5G1L A;  1SU9 A;  4WXT A;  3QFB C;  4JRR A;  2GZY A;  4TXO B;  1GWC A;  2WW2 A;  4G01 A;  4POK A;  4E68 A;  4XS6 A;  5F05 A;  1SJ6 A;  5G5E A;  2IN3 A;  3I6A A;  5J9C A;  1B9X C;  5ECN B;  2LKU A;  1OAZ A;  2LQQ A;  3D6I A;  3GIX A;  1PQN A;  5IMC A;  2YJH A;  4GWR A;  2FWH A;  1BQ7 A;  3LFL A;  2PUK C;  3N9J A;  1WPI A;  3IHG A;  3GST A;  2RII A;  2H0H A;  3KCM A;  4F2I A;  3ED3 A;  1Z3E A;  1J08 A;  5J47 A;  3HCZ A;  1QQ2 A;  5IPG A;  5BMU A;  2WRT A;  2LST A;  4IS0 A;  5ECH B;  4BA7 A;  2UV8 G;  6GSW A;  3HJO A;  4GSN A;  1A2J A;  4ECB A;  2PPT A;  3VPT A;  1SKS B;  3TJK A;  3P90 A;  1G0T A;  4X1U A;  1GTA A;  1GUL A;  3I9V 2;  3LXZ A;  5GAN D;  1TKD B;  1YEP A;  4A5P A;  2VCW A;  1EEJ A;  2LNT A;  4GCI A;  3HKR A;  2AV4 A;  1WIK A;  2A2R A;  5BRT A;  3L4N A;  4HQZ A;  5KEJ A;  4HI7 A;  1K3O A;  4ZB8 A;  6GST A;  2X8C A;  2EFE A;  5ECQ B;  5C00 A;  1URM A;  3ZMK A;  5AIV A;  1USB A;  4MJA A;  2L57 A;  3D5J A;  2PER A;  4WR5 A;  2EIO A;  2N5A A;  5JCG A;  1XVW A;  1AQW A;  1GTI A;  5IO2 A;  3RAZ A;  3LGC A;  2OT3 A;  1DUG A;  3ZIT A;  1VGL A;  1HD2 A;  3FK8 A;  2X8G A;  2PBJ A;  4MDC A;  5A4W A;  4EDY A;  1V40 A;  3VLN A;  1VF2 A;  1NSW A;  5CRW A;  2YP6 A;  2QGV A;  2FNO A;  3MWH A;  4GSS A;  1R4W A;  1I9D A;  2FY6 A;  2C0G A;  1WMJ A;  2IFQ A;  2VCV A;  3GUS A;  2YWN A;  2X99 A;  1AQX A;  1O73 A;  1FHE A;  4L0W A;  4HOJ A;  3UL3 A;  4FXY P;  4PX1 A;  3TU3 B;  1ERT A;  3LG6 A;  3QAW A;  5AGY A;  3NZN A;  1PL1 A;  3IV4 A;  3KP9 A;  4RI7 A;  4WEY A;  5JWR B;  1XG8 A;  2H6X A;  1V58 A;  5G30 A;  4AJ7 A;  3FYG A;  1EV4 A;  3DRN A;  4Z2T A;  1OKT A;  2VKZ G;  2CZ2 A;  4FO5 A;  3IR4 A;  2H01 A;  1X5C A;  3LJR A;  3TOU A;  4ULX A;  3CMI A;  3PR8 A;  4I8B A;  5IIZ A;  2DKH A;  3ZIV A;  5DAL A;  3ISO A;  5IOW A;  2AHE A;  1W89 A;  2PWJ A;  2OE1 A;  2RUE A;  2LQO A;  4DSR A;  4ZXG A;  1TXU A;  4MZB A;  3F3Q A;  2IFQ B;  4K2X A;  2YWO A;  4EDZ A;  2O7K A;  4MH3 A;  6GSS A;  4EL1 A;  4Q5R A;  3QDN A;  2M46 A;  3EYT A;  3TJG A;  4PNG A;  5F07 A;  2K6V A;  4NV2 A;  4L5O A;  2GZZ A;  1K0O A;  1O8X A;  4G19 A;  1SL1 B;  5KN1 A;  3IOS A;  4AKH A;  1OC9 A;  3GH9 A;  2DC5 A;  1QGV A;  1IYH A;  4G0K A;  3GL5 A;  2GSQ A;  5DAL B;  2VCZ A;  3LYP A;  3ERW A;  2VD0 A;  4EO3 A;  2XHF A;  4L5L A;  2XBI A;  2H8L A;  4XHM A;  5A5H B;  4XRD A;  2NDO A;  4KDY A;  5A1N A;  2FWE A;  1YVL A;  2H66 A;  4JZQ A;  1M99 A;  2LUS A;  1XBS A;  2YZU A;  3MYD A;  2HSM A;  2IIY A;  2IPA A;  2MMZ A;  1T4Z A;  3L9S A;  3EMX A;  3TKP A;  1O6J A;  4OFN A;  4KND A;  4LMV A;  3FW2 A;  2H6Z A;  1TI1 A;  5HR0 A;  4EC0 A;  5D9W A;  1B48 A;  2H73 A;  2B7J A;  2RLI A;  1B4P A;  3QFA C;  5HR1 A;  1SD9 A;  2C4J A;  1GNE A;  4E8E A;  4IKH A;  1OC9 B;  1EOH A;  5ECP B;  4TRX A;  1QUW A;  3PGT A;  3J7Y k;  2GGT A;  1EOG A;  4Q5Q A;  4ZB9 A;  1M9B A;  5CO3 A;  3GFK A;  1QFN A;  4XTS A;  3IK9 A;  4WR4 A;  2MMO A;  4BWQ A;  3FZ5 A;  2MMN A;  3DYR A;  3KMN A;  5ECL B;  5A1N B;  4I2T A;  4J2F A;  4OMV A;  1RK4 A;  3GYK A;  4OO4 A;  1BF5 A;  3DVW A;  2HSM B;  2HZE A;  4CW9 A;  3EIN A;  2AJQ B;  4K8M A;  2A2P A;  2WZS A;  4RUV A;  5EVO A;  4HUA A;  1BG5 A;  1PN9 A;  4LLR A;  3IAS 2;  3RGB C;  3DML A;  3RBT A;  1K0M A;  2HSY A;  1YY7 A;  1PSQ A;  1Y6E A;  3EPT A;  2YCD A;  2K18 A;  1SKW B;  3L9U A;  1ZCP A;  1QXH A;  1JZR A;  4XRA A;  4JR4 A;  4HU7 A;  3Q19 A;  2VLU A;  4MJC A;  4OFT A;  2DJ3 A;  2JSZ A;  2G2Q A;  12GS A;  3APO A;  1THO A;  5F8B A;  4RI6 A;  3F8U A;  1UA5 A;  3TOT A;  2C0D A;  5CRD A;  3IRA A;  3TKS E;  3ZVJ A;  3TJJ A;  2OAC A;  2O8V B;  3FHK A;  4IP1 A;  4WF4 A;  3MDK A;  2HZE B;  1EP7 A;  4MZW A;  1JZD A;  4MAB A;  1HQO A;  2E0Q A;  5ECR B;  1E2Y A;  5A4U A;  4L0U A;  4MCU A;  1K0A A;  5D9X A;  1LU4 A;  1EGR A;  3IDV A;  2I4A A;  2IMD A;  3H93 A;  2KHP A;  3FZA A;  3H8Q A;  1TRS A;  1AIU A;  5ID2 A;  1N25 A;  2YOI A;  4QL9 A;  3KP8 A;  3LYK A;  5DCG A;  2F8A A;  2YV9 A;  2QC7 A;  3F3R A;  1ZYE A;  4KB3 A;  5KOX A;  3D22 A;  2HFD A;  2OAD A;  1KNG A;  2H1G A;  3E0U A;  4MF6 A;  4PQI A;  5JCU A;  3KGK A;  1U6T A;  3CWG A;  4TR4 A;  3ZYW A;  3HVS A;  2ZCT A;  3GMF A;  2VIM A;  4NHZ A;  1K0C A;  3KMO A;  4NMU A;  2QSI A;  1JHB A;  2F9S A;  3TJB A;  3KM6 A;  1ZYN A;  1F9M A;  2LEG A;  3LEF A;  4G10 A;  2R0G A;  5KOW A;  3BD2 A;  4MZC A;  5ID2 B;  1NHY A;  4TR0 A;  18GS A;  3UAR A;  5INY A;  3ZFB A;  1Y25 A;  2LRN A;  3IC8 A;  2XPE A;  1W4V A;  2C80 A;  4LL4 B;  3ME8 A;  5IQY A;  4TKY A;  2LJA A;  4KH7 A;  2GST A;  1OE7 A;  2HZF A;  2KP2 A;  5DJL A;  3TUE A;  3EE2 A;  2H6Y A;  3W6G A;  2KLX A;  4LMW A;  4YQV A;  2KUC A;  2FLS A;  1ABA A;  5J4Y A;  3TCO A;  4J56 E;  3ZVJ D;  1JZO A;  2HSN B;  4MMM A;  4O32 A;  3GH6 A;  4PI0 C;  2BJX A;  3GUR A;  2GSR A;  3GX0 A;  4ECI A;  1A2M A;  2H0I A;  2DJ1 A;  4FH8 A;  4RQX A;  2K8V A;  4P3Y B;  1U3I A;  2H1A A;  4NAX A;  1Z7R A;  3KZQ A;  1QMV A;  1SK2 A;  5AIX A;  1A8Y A;  3W8S A;  3MSZ A;  5ECM B;  3VPQ A;  2AAW A;  2VLV A;  2B3S A;  3UJ1 A;  4FYC A;  5ELA A;  2CAQ A;  3VWV A;  3F0I A;  4F0B A;  3H79 A;  3HHV A;  3D21 A;  4K1F A;  1GSD A;  1SYX A;  5CRG A;  4AF2 A;  3G7Y A;  2GVP A;  1GSQ A;  4TVE A;  3M0F A;  5IMA A;  2C0F A;  2BMX A;  2AUV A;  1T3B A;  1K0B A;  4IJI A;  4PUR A;  3TKQ A;  1TU7 A;  3BOA A;  1PN0 A;  2VLT A;  2CT6 A;  2O36 A;  5DDL A;  2GLR A;  1PFO A;  2DJJ A;  3VUR A;  2EFD A;  4WKW A;  1BYE A;  4F0C A;  3EU3 A;  5IMZ A;  2XBQ A;  2F3M A;  2L59 A;  1GSU A;  2KP1 A;  3C7M A;  4X4J A;  1X5E A;  1F3A A;  5IOX A;  2L6D A;  1A8L A;  2WW3 A;  1GUM A;  4ILF A;  3HZ4 A;  1AUC A;  3OR5 A;  4ZBD A;  1JLW A;  3M9J A;  3PIN A;  2FA8 A;  4KSM A;  1PX7 A;  2MMA A;  1M0U A;  1Q98 A;  3IK7 A;  4ZBA A;  2V1M A;  2R3X A;  2CV4 A;  2DIZ A;  14GS A;  3FMW A;  3SWL A;  1Z6M A;  3A2W A;  2R6K A;  2IMF A;  2P31 A;  3FY7 A;  4G0L A;  3VI5 A;  1B8X A;  3ZIJ A;  1S3C A;  1BJX A;  1OVN A;  1ZMA A;  1J0F A;  1GSS A;  1G7O A;  5ECK B;  2YZH A;  1EZK A;  3J7Y b;  3IA1 A;  3F4T A;  4G0I A;  1NW2 A;  1FOV A;  1FAA A;  2FD3 A;  4GST A;  5HR3 A;  2LRC A;  2IL3 A;  3UAP A;  5B8B A;  3ZFL A;  4BVX A;  1TK8 B;  5BMU B;  2A4H A;  4GTU A;  5H5S A;  2VCX A;  2WVY A;  3AY8 A;  2DJK A;  1Z6N A;  4TW5 A;  5DQS A;  3RFR C;  5JWO B;  1K0D A;  3BCK A;  4JED A;  4QL7 A;  2CA8 A;  2WJU A;  4K0G A;  2ALB A;  2K9F A;  1ON4 A;  1XFL A;  1K3L A;  4ICY A;  2OKA A;  3QAV A;  3RHB A;  2O85 A;  1RW1 A;  5J40 A;  3CTF A;  2E7P A;  4G9H A;  3ZZX A;  4YKF A;  3GX8 A;  2H19 A;  3CTG A;  1TXX A;  2A4V A;  2LNS A;  3A3T A;  2JZR A;  3P8W A;  3GSS A;  4BVX B;  5D8I A;  2XC2 A;  3R2Q A;  3IE3 A;  4MF5 A;  3UVT A;  5A4V A;  2GQM A;  1PKW A;  2MBT A;  5G5F A;  3VWW A;  2UZ8 A;  1BED A;  1R5P A;  2H75 A;  1PMT A;  1T00 A;  2HE3 A;  1AXD A;  2YN1 A;  2PN8 A;  2VM2 A;  3KD0 A;  1XOB A;  5DCH A;  1O7U A;  3GV1 A;  1XW5 A;  2WW1 A;  1GSE A;  1DE1 A;  3PPU A;  4ACS A;  1M3J A;  4ZL9 A;  4CY8 A;  3E9J B;  4IHU A;  3EU4 A;  2PVO C;  3ZLP A;  20GS A;  2VUP A;  1XW6 A;  1ACV A;  3WGD A;  2VCQ A;  1J9B A;  4OCF A;  1VF1 A;  3TJF A;  3D4M A;  2OE3 A;  1PA3 A;  1SL2 B;  2D2Z A;  1OYJ A;  4MPG A;  4YKG A;  2VD1 A;  3HY2 A;  4DSS A;  1B4Q A;  1AW9 A;  1JFU A;  2V41 A;  4O92 A;  1TJD A;  4I97 A;  3F6F A;  1KBN A;  2LTK A;  11GS A;  1YDK A;  4V1A g;  4GLT A;  4H86 A;  3GKN A;  1SL0 B;  3P7X A;  3RPP A;  2OBI A;  1GL8 A;  5A34 A;  2GT5 A;  3F4S A;  4TR3 A;  1JLV A;  2LJR A;  2RM6 A;  1AQV A;  5EL8 A;  2N5F A;  2CVK A;  2YPM A;  4PHZ C;  2HLS A;  2B5Y A;  3FR6 A;  3C71 A;  1VRS D;  3TDG A;  1X0R A;  1XIY A;  1TRV A;  4DSS B;  3QR6 A;  4PTS A;  1SJZ A;  2CX4 A;  1GNW A;  1HNB A;  4WF5 A;  5C04 A;  4CHS A;  2JAD A;  4ML1 A;  3DWV A;  3DEX A;  5G31 A;  3M8N A;  5A34 B;  1TI3 A;  2VL9 A;  2IWT A;  4N30 A;  3UIW A;  5EY6 A;  1TRU A;  5FT3 A;  5J4V A;  2HT9 A;  2IJY A;  4EIQ A;  5IPH A;  1ST9 A;  2HYX A;  2I9H A;  3QCP A;  5DBQ A;  2EIR A;  1ERV A;  4OFM A;  1AAZ A;  2PU9 C;  2X4A A;  4IGJ A;  5CRE A;  3APS A;  4ZIL A; 
#chains in the Genus database with same CATH homology
 2DSA A;  2YWM A;  1O81 A;  2R2J A;  4GRF A;  5DAK A;  1UC7 A;  2YJ7 A;  1FVJ A;  4GQF A;  2GQL A;  2ON5 A;  1FW1 A;  3G7I A;  4F03 A;  4MLY A;  1MDI A;  3CBU A;  4IW9 A;  3VFI A;  5H5Q A;  1Z9H A;  2JZT A;  3VI7 A;  1F37 A;  1MDK A;  3HVX A;  3TKS C;  2B7K A;  1IYI A;  3TKS A;  6GSV A;  4HQS A;  1A0F A;  1EV9 A;  3RDW A;  2C3T A;  6GSX A;  3CRT A;  2L4C A;  1HYU A;  4EUY A;  2V6O A;  1LJR A;  4PXO A;  1FOH A;  1I5G A;  1T4Y A;  5AN1 A;  2B6M A;  4MK3 A;  3L78 A;  4POB A;  2HNL A;  6GSU A;  1YJ6 A;  3HA9 A;  4DSQ A;  3FEU A;  4K9Z A;  4POL A;  3HMJ G;  1A23 A;  1F2E A;  2H70 A;  2X8H A;  4MJE A;  4V2N A;  4G2E A;  5EPF A;  1WE0 A;  2WDU A;  3V1W A;  5G2Z A;  3HDC A;  4FIW A;  3HXS A;  2CX3 A;  5IMF A;  1G7E A;  4NWY A;  3KIJ A;  4POM A;  3TRP A;  4CDO A;  2B5X A;  1CQG A;  4IP6 A;  4N0V A;  4K0N A;  2F8F A;  1M7T A;  1XPV A;  1DBY A;  1N2A A;  3H4K A;  3A5I A;  3D0Z A;  3TRX A;  4HS1 A;  2JU5 A;  5J3R A;  5COH A;  2WZ9 A;  2V6K A;  5IMD A;  1HNA A;  5DQY A;  5D93 A;  4KX4 A;  2E2M A;  4E8H A;  2FA4 A;  3BBY A;  2OA7 A;  2GSS A;  1R26 A;  3BJ5 A;  4KUN A;  5G1K A;  2NVL A;  1FB0 A;  5AIS A;  4XIH A;  5HFG A;  1YF0 A;  2KOK A;  2DLX A;  2WGR A;  2M80 A;  3FRC A;  4PGT A;  2R5G A;  5J41 A;  1OE8 A;  3C1S A;  4EF0 A;  3UVH A;  2CZ3 A;  1ERU A;  5F0G A;  4K7N A;  2C1Y A;  4PUA A;  3R3E A;  2WS2 A;  3IPZ A;  4IQ1 A;  2BTO T;  1K0N A;  1TOF A;  3UEM A;  4ZBB A;  1ILO A;  5KN3 A;  3ZRE A;  4IVF A;  4N3Z A;  1GH2 A;  3C1R A;  2FHE A;  5ELG A;  2J23 A;  4HDE A;  5F06 A;  5B7C A;  4KCE A;  3L0H A;  4O5Q A;  1FO5 A;  4JE1 A;  4PNF A;  4EKZ A;  1ZYQ B;  3VWU A;  4HZ2 A;  1YKA A;  2DJ0 A;  2MYG A;  4HEA 2;  3UMA A;  2HRA A;  3LWA A;  3WGX A;  3CSH A;  2EIQ A;  3GA4 A;  5FWG A;  5J9B A;  4XS4 A;  1ZYP A;  2DIY A;  3GL3 A;  4KE3 A;  1XWB A;  3QOU A;  4Z2R A;  4KA0 A;  3US3 A;  3O3T A;  4DEJ A;  2IMK A;  5B6N A;  1MEK A;  3UBL A;  4ZB6 A;  3LOR A;  5DJM A;  3BCI A;  1FB6 A;  3ZL5 A;  4K7I A;  3ZRD A;  2GTU A;  3ZTL A;  4HJ2 A;  19GS A;  2DJ2 A;  2R0P A;  4L8E A;  3ERG A;  1ZGN A;  4USS A;  4WBR D;  3GN3 A;  5HFK A;  5J4U A;  3EMP A;  2B1K A;  4AI6 A;  4CY6 A;  3U5R E;  4YAP A;  2M72 A;  1SYR A;  2V32 A;  3WD6 A;  1T8E B;  1A24 A;  1XCC A;  1XWC A;  4BL7 A;  2H71 A;  2QA2 A;  3C8E A;  4PUF C;  2WFC A;  4XS4 B;  3Q18 A;  4N0Z A;  1PD2 1;  1GTB A;  2IMI A;  4HU9 A;  1ERW A;  5A5K A;  2P5Q A;  3LSZ A;  3HJP A;  1E6B A;  1F3B A;  5ECI B;  3LW9 A;  5CNW A;  3K8N A;  2EFH A;  5ECO B;  5E59 A;  4IBP A;  2H76 A;  2IME A;  2O5V A;  1SVO A;  1F6M C;  2QKE A;  3HZ8 A;  1SK1 A;  17GS A;  2OBK A;  4Z2U A;  2VL3 A;  2CQ9 A;  2HRN A;  2REM A;  2E2G A;  4BL7 B;  3TKR A;  2I81 A;  2TIR A;  3Q6O A;  3LXT A;  5ECS A;  2MZC A;  4TR1 A;  2FCH A;  3QPM A;  2H30 A;  1TTZ A;  3CXG A;  3ME7 A;  1X9M B;  2A2S A;  4I5Q A;  2YWI A;  2HI7 A;  5KN2 A;  4N11 A;  8GSS A;  3P2A A;  2VOC A;  4X0X A;  5LD0 A;  3O6T A;  4FYU A;  1X5D A;  1U87 A;  1QK8 A;  3F9U A;  5HQP A;  3UOM A;  1MDJ A;  1K3Y A;  2K8S A;  4NPB A;  5J5N A;  1T7P B;  1V98 A;  2H1B A;  3HYP A;  1UVZ A;  3KTL A;  3GTU A;  1Z5Y E;  2LV3 A;  1TW9 A;  1B9Y C;  4KDU A;  2VCT A;  1G6W A;  3LQ7 A;  1HNC A;  1PX6 A;  1XWA A;  1O8W A;  2TRC P;  2H1L A;  2EC4 A;  2GZP A;  4TR1 B;  3WYW A;  4Q5N A;  1V9W A;  2I3Y A;  1YKC A;  5CYY A;  2GT6 A;  2DMM A;  4FYB A;  5HR2 A;  1SEN A;  1GUK A;  5CP1 A;  3M1G A;  4YQM A;  3H1N A;  4ID0 A;  1V2A A;  2WB9 A;  3A5W A;  4MJB A;  4I2U A;  5LNK e;  1TK5 B;  3M3M A;  2OE0 A;  2L4Q A;  4V2M A;  1EWX A;  3GTU B;  5D9V A;  4IN0 A;  2AYT A;  2RM5 A;  4KDX A;  4AGS A;  3A2V A;  2CAI A;  1EGO A;  3FKF A;  1AC1 A;  1X9W B;  3CSI A;  4J57 E;  4O7H A;  1A0R P;  5HFI A;  2H1D A;  2C8U A;  1GP1 A;  3L9V A;  4BWS A;  2LJK A;  2EFC A;  2B5E A;  4MA9 A;  5CRH A;  2HQT A;  4RQR A;  1M2A A;  5B6M A;  1NHO A;  2VM1 A;  4GQC A;  3ERF A;  3GHA A;  1DSB A;  1YQ1 A;  1FG4 A;  2RUF A;  4KCA A;  3DGQ A;  4AKI A;  3WT2 A;  4Q5F A;  2DBC A;  1PL2 A;  2H72 A;  2P5R A;  4DVC A;  5A5H A;  1G6Y A;  3FR3 A;  3QD9 A;  1S3D A;  4BPY A;  3S9F A;  4K7O A;  1MTC A;  4WET A;  2WUL A;  1EEM A;  5D9T A;  4MPF A;  3EVI A;  3F63 A;  1JZW A;  3ZML A;  4OCE A;  4Z7X A;  3U6V A;  4HJM A;  1X9S B;  3HJM A;  3HVV A;  3SBC A;  4IEL A;  1U88 A;  5E4W A;  1CQH A;  3MIX A;  3NIV A;  1BAY A;  3F6D A;  1FVK A;  3FR9 A;  4TXV A;  3IAM 2;  4EIP A;  4N10 A;  4PQ1 A;  5DVB A;  4I6X A;  4F9Z A;  1Y1U A;  1DE2 A;  1PKZ A;  1ML6 A;  2PMT A;  2C3N A;  4TN8 A;  1LBK A;  1H4O A;  4KAE A;  2P0G A;  3IC4 A;  2YNX A;  3WGE A;  2FGX A;  5LCZ A;  1XVQ A;  1GTU A;  3RHC A;  5ABR A;  1OKD A;  1THX A;  5H5R A;  1GSY A;  2QA1 A;  3CSJ A;  4K5R A;  1VF4 A;  4LA1 A;  3KH7 A;  4ZL7 A;  4QQ7 A;  1SJI A;  2H0G A;  1NM3 A;  1VF3 A;  2R37 A;  3GNJ A;  2TRX A;  1SVL A;  5L71 A;  2CVD A;  1SVM A;  2JSY A;  4OO5 A;  3DIE A;  3C73 A;  2AB6 A;  4X43 A;  5D96 A;  4MP4 A;  4HZ4 A;  10GS A;  4ZIJ A;  3VWX A;  3M9K A;  1KEB A;  1WRY A;  3IXR A;  5GST A;  2CVB A;  2HSH A;  1TP9 A;  1XWG A;  1YF1 A;  5IMV A;  3FZ9 A;  4IJ3 A;  4PQH A;  1A2L A;  4OD7 A;  1WJK A;  3MAK A;  2FWG A;  2G0F A;  1BX9 A;  1RQM A;  2WCI A;  3I69 A;  4YAV A;  3QAG A;  3GKX A;  2OJL A;  4KF9 A;  3W8J A;  1GSF A;  3DD3 A;  2I1U A;  1M2D A;  4V1A p;  3KTB A;  3DKS A;  4KW6 A;  1TDI A;  2HRK A;  2DKI A;  4K5S A;  3PH9 A;  3EUR A;  13GS A;  1SKR B;  1WOU A;  1GLP A;  4K2D A;  4NXI A;  1C72 A;  1Z7P A;  1BG1 A;  2PVQ A;  4YH2 A;  3E3E A;  4O5U A;  3N5O A;  1PRX A;  1XXU A;  5IM9 A;  1Q4J A;  3HD5 A;  4JU5 A;  3IBH A;  5DAK B;  5D73 A;  1OC3 A;  4D73 A;  1N8J A;  2ES7 A;  16GS A;  1V57 A;  3CYN A;  4ISD A;  2ZNM A;  2HRF A;  1UN2 A;  3EC3 A;  3CRU A;  3GRX A;  3EWL A;  3IHQ A;  5B8A A;  4K6X A;  1YEX A;  9GSS A;  2NTO A;  2GS3 A;  3GKM A;  2YAN A;  3Q74 A;  2O87 A;  5JCW A;  1XOA A;  1M2B A;  4AJ8 A;  2JL4 A;  4EVM A;  2NPB A;  2HRK B;  4WBJ A;  2YV7 A;  2N5B A;  1GUH A;  4TOP A;  3UBK A;  3MNG A;  5GZZ B;  1TK0 B;  2JAC A;  1T1V A;  2GDR A;  5GSS A;  1YZX A;  1GRX A;  4V2L A;  2ZUP A;  2VAF A;  2ON7 A;  3NOF A;  2X64 A;  2FUG 2;  3WT1 A;  4D73 B;  3TRQ A;  2V2G A;  1SK0 A;  2PGT A;  4MH2 A;  2C3Q A;  1WP0 A;  4IQA A;  4XS1 A;  3GKK A;  22GS A;  1TU8 A;  4O5R A;  2NBS A;  1TRW A;  2J9H A;  2LRT A;  4KGI A;  3DVX A;  2HSN A;  4EXJ A;  1R7H A;  3RPN A;  3I43 A;  4GXZ A;  3QMX A;  3VK9 A;  2VL2 C;  4MF7 A;  4ZL8 A;  2DML A;  2VL2 A;  1SD8 A;  5JWQ B;  4GF0 A;  1EP8 A;  5IO0 A;  2H74 A;  1PGT A;  5ENU A;  5FHI A;  4OWY A;  1ZL9 A;  3O76 A;  1XWK A;  1GLQ A;  2MBS A;  2C0E A;  3KH9 A;  4QMK A;  2X49 A;  1WWJ A;  1OC8 A;  2FWF A;  2F51 A;  1U3A A;  2HXK A;  4XCS A;  2O89 A;  4ECJ A;  3DXB A;  1ZOF A;  4ECC A;  3G7J A;  2Z9S A;  4JR6 A;  5GAP D;  3APQ A;  4ML6 A;  2VO4 A;  3TB2 A;  1XZO A;  4BVY A;  1O85 A;  2LS5 A;  3KJY A;  4MNN A;  1R5A A;  1XW9 A;  2B1L A;  3KEB A;  4TXO A;  2XPD A;  4NHW A;  5CAX A;  4AKG A;  6GSY A;  5KN0 A;  7GSS A;  4YQU A;  4NV5 A;  1M9A A;  4ZB7 A;  1MD3 A;  4AKX B;  2JZS A;  1MD4 A;  3TGZ A;  1H75 A;  4FQU A;  4EE0 A;  4GDF A;  1ZZY A;  1KTE A;  2L5L A;  4JBB A;  3FZ4 A;  2L6C A;  4F82 A;  2L5O A;  4KSO A;  4AJ6 A;  4LL1 B;  2R4V A;  3JCM L;  3F4R A;  3A2X A;  3G9B A;  4BVY B;  3KXO A;  2GQK A;  4W66 A;  2R0C A;  1S3A A;  3D4T A;  5G1L A;  1SU9 A;  4WXT A;  3QFB C;  4JRR A;  2GZY A;  4TXO B;  1GWC A;  4G01 A;  4POK A;  4E68 A;  4XS6 A;  5F05 A;  1SJ6 A;  5G5E A;  2IN3 A;  3I6A A;  5J9C A;  1B9X C;  5ECN B;  2LKU A;  1OAZ A;  2LQQ A;  3D6I A;  3GIX A;  1PQN A;  5IMC A;  2YJH A;  4GWR A;  2FWH A;  1BQ7 A;  3LFL A;  2PUK C;  3N9J A;  1WPI A;  3IHG A;  3GST A;  2RII A;  2H0H A;  3KCM A;  4F2I A;  3ED3 A;  1Z3E A;  1J08 A;  5J47 A;  3HCZ A;  1QQ2 A;  5IPG A;  5BMU A;  2WRT A;  2LST A;  4IS0 A;  5ECH B;  4BA7 A;  2UV8 G;  6GSW A;  3HJO A;  4GSN A;  1A2J A;  4ECB A;  2PPT A;  3VPT A;  1SKS B;  3TJK A;  3P90 A;  1G0T A;  4X1U A;  1GTA A;  1GUL A;  3I9V 2;  3LXZ A;  5GAN D;  1TKD B;  1YEP A;  4A5P A;  2VCW A;  1EEJ A;  2LNT A;  4GCI A;  3HKR A;  2AV4 A;  1WIK A;  2A2R A;  5BRT A;  3L4N A;  4HQZ A;  5KEJ A;  4HI7 A;  1K3O A;  4ZB8 A;  6GST A;  2X8C A;  2EFE A;  5ECQ B;  5C00 A;  1URM A;  3ZMK A;  5AIV A;  1USB A;  4MJA A;  2L57 A;  3D5J A;  2PER A;  4WR5 A;  2EIO A;  2N5A A;  5JCG A;  1XVW A;  1AQW A;  1GTI A;  5IO2 A;  3RAZ A;  3LGC A;  2OT3 A;  1DUG A;  3ZIT A;  1VGL A;  1HD2 A;  3FK8 A;  2X8G A;  2PBJ A;  4MDC A;  5A4W A;  4EDY A;  1V40 A;  3VLN A;  1VF2 A;  1NSW A;  5CRW A;  2YP6 A;  2QGV A;  2FNO A;  3MWH A;  4GSS A;  1R4W A;  1I9D A;  2FY6 A;  2C0G A;  1WMJ A;  2IFQ A;  2VCV A;  3GUS A;  2YWN A;  2X99 A;  1AQX A;  1O73 A;  1FHE A;  4L0W A;  4HOJ A;  3UL3 A;  4PX1 A;  3TU3 B;  1ERT A;  3LG6 A;  3QAW A;  5AGY A;  3NZN A;  1PL1 A;  3IV4 A;  3KP9 A;  4RI7 A;  4WEY A;  5JWR B;  2H6X A;  1V58 A;  5G30 A;  4AJ7 A;  3FYG A;  1EV4 A;  3DRN A;  4Z2T A;  1OKT A;  2VKZ G;  2CZ2 A;  4FO5 A;  3IR4 A;  2H01 A;  1X5C A;  3LJR A;  3TOU A;  4ULX A;  3CMI A;  3PR8 A;  4I8B A;  5IIZ A;  2DKH A;  3ZIV A;  5DAL A;  3ISO A;  5IOW A;  2AHE A;  1W89 A;  2PWJ A;  2OE1 A;  2RUE A;  2LQO A;  4DSR A;  4ZXG A;  1TXU A;  4MZB A;  3F3Q A;  2IFQ B;  4K2X A;  2YWO A;  4EDZ A;  2O7K A;  4MH3 A;  6GSS A;  4EL1 A;  4Q5R A;  3QDN A;  2M46 A;  3EYT A;  3TJG A;  4PNG A;  5F07 A;  2K6V A;  4NV2 A;  4L5O A;  2GZZ A;  1K0O A;  1O8X A;  4G19 A;  1SL1 B;  5KN1 A;  3IOS A;  4AKH A;  1OC9 A;  3GH9 A;  2DC5 A;  1QGV A;  1IYH A;  4G0K A;  3GL5 A;  2GSQ A;  5DAL B;  2VCZ A;  3LYP A;  3ERW A;  2VD0 A;  4EO3 A;  2XHF A;  4L5L A;  2XBI A;  2H8L A;  4XHM A;  5A5H B;  4XRD A;  2NDO A;  4KDY A;  5A1N A;  2FWE A;  1YVL A;  2H66 A;  4JZQ A;  1M99 A;  2LUS A;  1XBS A;  2YZU A;  3MYD A;  2HSM A;  2IIY A;  2IPA A;  2MMZ A;  1T4Z A;  3L9S A;  3EMX A;  3TKP A;  1O6J A;  4OFN A;  4KND A;  4LMV A;  3FW2 A;  2H6Z A;  1TI1 A;  5HR0 A;  4EC0 A;  5D9W A;  1B48 A;  2H73 A;  2B7J A;  2RLI A;  1B4P A;  3QFA C;  5HR1 A;  1SD9 A;  2C4J A;  1GNE A;  4E8E A;  4IKH A;  1OC9 B;  1EOH A;  5ECP B;  4TRX A;  1QUW A;  3PGT A;  3J7Y k;  2GGT A;  1EOG A;  4Q5Q A;  4ZB9 A;  1M9B A;  5CO3 A;  3GFK A;  1QFN A;  4XTS A;  3IK9 A;  4WR4 A;  2MMO A;  4BWQ A;  3FZ5 A;  2MMN A;  3DYR A;  3KMN A;  5ECL B;  5A1N B;  4I2T A;  4J2F A;  4OMV A;  1RK4 A;  3GYK A;  4OO4 A;  1BF5 A;  3DVW A;  2HSM B;  2HZE A;  4CW9 A;  3EIN A;  2AJQ B;  4K8M A;  2A2P A;  4RUV A;  5EVO A;  4HUA A;  1BG5 A;  1PN9 A;  4LLR A;  3IAS 2;  3DML A;  3RBT A;  1K0M A;  2HSY A;  1YY7 A;  1PSQ A;  1Y6E A;  3EPT A;  2YCD A;  2K18 A;  1SKW B;  3L9U A;  1ZCP A;  1QXH A;  1JZR A;  4XRA A;  4JR4 A;  4HU7 A;  3Q19 A;  2VLU A;  4MJC A;  4OFT A;  2DJ3 A;  2JSZ A;  2G2Q A;  12GS A;  3APO A;  1THO A;  5F8B A;  4RI6 A;  3F8U A;  1UA5 A;  3TOT A;  2C0D A;  5CRD A;  3IRA A;  3TKS E;  3ZVJ A;  3TJJ A;  2OAC A;  2O8V B;  3FHK A;  4IP1 A;  4WF4 A;  3MDK A;  2HZE B;  1EP7 A;  4MZW A;  1JZD A;  4MAB A;  1HQO A;  2E0Q A;  5ECR B;  1E2Y A;  5A4U A;  4L0U A;  4MCU A;  1K0A A;  5D9X A;  1LU4 A;  1EGR A;  3IDV A;  2I4A A;  2IMD A;  3H93 A;  2KHP A;  3FZA A;  3H8Q A;  1TRS A;  1AIU A;  5ID2 A;  1N25 A;  2YOI A;  4QL9 A;  3KP8 A;  3LYK A;  5DCG A;  2F8A A;  2YV9 A;  2QC7 A;  3F3R A;  1ZYE A;  4KB3 A;  5KOX A;  3D22 A;  2HFD A;  2OAD A;  1KNG A;  2H1G A;  3E0U A;  4MF6 A;  4PQI A;  5JCU A;  3KGK A;  1U6T A;  3CWG A;  4TR4 A;  3ZYW A;  3HVS A;  2ZCT A;  3GMF A;  2VIM A;  4NHZ A;  1K0C A;  3KMO A;  4NMU A;  2QSI A;  1JHB A;  2F9S A;  3TJB A;  3KM6 A;  1ZYN A;  1F9M A;  2LEG A;  3LEF A;  4G10 A;  2R0G A;  5KOW A;  3BD2 A;  4MZC A;  5ID2 B;  1NHY A;  4TR0 A;  18GS A;  3UAR A;  5INY A;  3ZFB A;  1Y25 A;  2LRN A;  3IC8 A;  2XPE A;  1W4V A;  2C80 A;  4LL4 B;  3ME8 A;  5IQY A;  4TKY A;  2LJA A;  4KH7 A;  2GST A;  1OE7 A;  2HZF A;  2KP2 A;  5DJL A;  3TUE A;  3EE2 A;  2H6Y A;  3W6G A;  2KLX A;  4LMW A;  4YQV A;  2KUC A;  2FLS A;  1ABA A;  5J4Y A;  3TCO A;  4J56 E;  3ZVJ D;  1JZO A;  2HSN B;  4MMM A;  4O32 A;  3GH6 A;  2BJX A;  3GUR A;  2GSR A;  3GX0 A;  4ECI A;  1A2M A;  2H0I A;  2DJ1 A;  4FH8 A;  4RQX A;  2K8V A;  4P3Y B;  1U3I A;  2H1A A;  4NAX A;  1Z7R A;  3KZQ A;  1QMV A;  1SK2 A;  5AIX A;  1A8Y A;  3W8S A;  3MSZ A;  5ECM B;  3VPQ A;  2AAW A;  2VLV A;  2B3S A;  3UJ1 A;  4FYC A;  5ELA A;  2CAQ A;  3VWV A;  3F0I A;  4F0B A;  3H79 A;  3HHV A;  3D21 A;  4K1F A;  1GSD A;  1SYX A;  5CRG A;  4AF2 A;  3G7Y A;  2GVP A;  1GSQ A;  4TVE A;  3M0F A;  5IMA A;  2C0F A;  2BMX A;  2AUV A;  1T3B A;  1K0B A;  4IJI A;  4PUR A;  3TKQ A;  1TU7 A;  3BOA A;  1PN0 A;  2VLT A;  2CT6 A;  5DDL A;  2GLR A;  2DJJ A;  3VUR A;  2EFD A;  4WKW A;  1BYE A;  4F0C A;  3EU3 A;  5IMZ A;  2XBQ A;  2F3M A;  2L59 A;  1GSU A;  2KP1 A;  3C7M A;  4X4J A;  1X5E A;  1F3A A;  5IOX A;  2L6D A;  1A8L A;  1GUM A;  4ILF A;  3HZ4 A;  1AUC A;  3OR5 A;  4ZBD A;  1JLW A;  3M9J A;  3PIN A;  2FA8 A;  4KSM A;  1PX7 A;  2MMA A;  1M0U A;  1Q98 A;  3IK7 A;  4ZBA A;  2V1M A;  2R3X A;  2CV4 A;  2DIZ A;  14GS A;  3FMW A;  3SWL A;  1Z6M A;  3A2W A;  2R6K A;  2IMF A;  2P31 A;  3FY7 A;  4G0L A;  3VI5 A;  1B8X A;  3ZIJ A;  1S3C A;  1BJX A;  1OVN A;  1ZMA A;  1J0F A;  1GSS A;  1G7O A;  5ECK B;  2YZH A;  1EZK A;  3J7Y b;  3IA1 A;  3F4T A;  4G0I A;  1NW2 A;  1FOV A;  1FAA A;  2FD3 A;  4GST A;  5HR3 A;  2LRC A;  2IL3 A;  3UAP A;  5B8B A;  3ZFL A;  4BVX A;  1TK8 B;  5BMU B;  2A4H A;  4GTU A;  5H5S A;  2VCX A;  3AY8 A;  2DJK A;  1Z6N A;  4TW5 A;  5DQS A;  5JWO B;  1K0D A;  3BCK A;  4JED A;  4QL7 A;  2CA8 A;  2WJU A;  4K0G A;  2ALB A;  2K9F A;  1ON4 A;  1XFL A;  1K3L A;  4ICY A;  2OKA A;  3QAV A;  3RHB A;  2O85 A;  1RW1 A;  5J40 A;  3CTF A;  2E7P A;  4G9H A;  3ZZX A;  4YKF A;  3GX8 A;  2H19 A;  3CTG A;  1TXX A;  2A4V A;  2LNS A;  3A3T A;  2JZR A;  3P8W A;  3GSS A;  4BVX B;  5D8I A;  2XC2 A;  3R2Q A;  3IE3 A;  4MF5 A;  3UVT A;  5A4V A;  2GQM A;  1PKW A;  2MBT A;  5G5F A;  3VWW A;  2UZ8 A;  1BED A;  1R5P A;  2H75 A;  1PMT A;  1T00 A;  2HE3 A;  1AXD A;  2YN1 A;  2PN8 A;  2VM2 A;  3KD0 A;  1XOB A;  5DCH A;  1O7U A;  3GV1 A;  1XW5 A;  1GSE A;  1DE1 A;  3PPU A;  4ACS A;  4ZL9 A;  4CY8 A;  3E9J B;  4IHU A;  3EU4 A;  2PVO C;  3ZLP A;  20GS A;  2VUP A;  1XW6 A;  1ACV A;  3WGD A;  2VCQ A;  1J9B A;  4OCF A;  1VF1 A;  3TJF A;  3D4M A;  2OE3 A;  1PA3 A;  1SL2 B;  2D2Z A;  1OYJ A;  4MPG A;  4YKG A;  2VD1 A;  3HY2 A;  4DSS A;  1B4Q A;  1AW9 A;  1JFU A;  2V41 A;  4O92 A;  1TJD A;  4I97 A;  3F6F A;  1KBN A;  2LTK A;  11GS A;  1YDK A;  4V1A g;  4GLT A;  4H86 A;  3GKN A;  1SL0 B;  3P7X A;  3RPP A;  2OBI A;  1GL8 A;  5A34 A;  2GT5 A;  3F4S A;  4TR3 A;  1JLV A;  2LJR A;  2RM6 A;  1AQV A;  5EL8 A;  2N5F A;  2CVK A;  2YPM A;  2HLS A;  2B5Y A;  3FR6 A;  3C71 A;  1VRS D;  3TDG A;  1X0R A;  1XIY A;  1TRV A;  4DSS B;  3QR6 A;  4PTS A;  1SJZ A;  2CX4 A;  1GNW A;  1HNB A;  4WF5 A;  5C04 A;  4CHS A;  2JAD A;  4ML1 A;  3DWV A;  3DEX A;  5G31 A;  3M8N A;  5A34 B;  1TI3 A;  2VL9 A;  2IWT A;  4N30 A;  3UIW A;  5EY6 A;  1TRU A;  5FT3 A;  5J4V A;  2HT9 A;  2IJY A;  4EIQ A;  5IPH A;  1ST9 A;  2HYX A;  2I9H A;  3QCP A;  5DBQ A;  2EIR A;  1ERV A;  4OFM A;  1AAZ A;  2PU9 C;  2X4A A;  4IGJ A;  5CRE A;  3APS A;  4ZIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...