3GTUA

Ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
b'PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gtuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gtuA01
1GRXA 1R26A 4V1Ag 1V58A 5KN0A 6GSVA 3FYGA 3PPUA 3R3EA 1ZYEA 4GCIA 5KN2A 2WB9A 2V41A 2AAWA 4BL7A 2JZSA 5J41A 2OKAA 11GSA 2H1DA 4PQIA 2VL2A 4F0BA 1XIYA 3L0HA 4YAVA 5EVOA 2CVKA 2WRTA 1QQ2A 1R5PA 1BQ7A 2VM1A 4OWYA 2YWMA 2ES7A 2DMLA 3P7XA 3CRTA 5LCZA 4JR6A 1SJZA 2V1MA 2VAFA 1VGLA 1K3YA 1PD21 1JLWA 3FR6A 1K0AA 1PX7A 5B7CA 3QOUA 1KBNA 4K8MA 4ZB9A 3HXSA 4K7OA 2DBCA 3H79A 2TRXA 2GQLA 1JHBA 5D9WA 5GZZB 2ZCTA 2IMKA 1XCCA 2GZPA 4EDYA 4HZ2A 1F6MC 1G0TA 1AC1A 4DSRA 3ZMLA 4PURA 1K0MA 2KLXA 2LEGA 4GXZA 2PUKC 3ZVJD 3HDCA 1EGRA 2DJKA 5IO2A 5D96A 3VLNA 2VCVA 5J9BA 1EP8A 2F9SA 18GSA 4BVYB 1TKDB 1OC9B 5GAND 4KH7A 4J56E 1AAZA 5ENUA 2H1GA 4EE0A 2O7KA 1A8YA 1XBSA 1GTAA 1QMVA 1YF0A 4HI7A 1M7TA 2IL3A 1ON4A 3GYKA 1FB6A 3W8SA 1SK2A 2V6KA 4EKZA 3EINA 4F9ZA 2CAIA 3RBTA 2B6MA 3F3RA 2I9HA 2L5OA 4X1UA 1F3BA 1URMA 5HFIA 2HSYA 2YPMA 2ON5A 4J2FA 1G6YA 5KEJA 3GA4A 4PTSA 2IMFA 1O6JA 1OC8A 1K3OA 1G6WA 4G0LA 5ECOB 2GQKA 1SL0B 3U5RE 2AHEA 1TRUA 1XZOA 1T4ZA 3GL3A 3M0FA 2VL2C 2JL4A 1ZOFA 4TN8A 1EV4A 3BJ5A 4J57E 2AB6A 3MSZA 1MDKA 3D22A 3VWUA 3EE2A 2GSSA 2MYGA 1K0NA 1PKZA 2FA4A 1IYHA 1WWJA 4YAPA 4HU7A 4HEA2 5H5RA 2WGRA 2WS2A 2C1YA 4OD7A 4L5LA 2J23A 5IOXA 3LGCA 1R5AA 2LV3A 1M9BA 4QQ7A 1TOFA 2FWFA 1O81A 4WETA 2DIZA 4GSSA 3UOMA 1SENA 3IHQA 2JZRA 2H6ZA 3D0ZA 3GRXA 4HJMA 3F8UA 4PXOA 3QFBC 4FIWA 4EC0A 2YZUA 4POKA 2FWHA 4KSMA 4L0UA 3LQ7A 3EVIA 3N9JA 1NSWA 1OVNA 5F8BA 1VF2A 2HRAA 4XS4A 4F82A 3TJBA 2DJJA 2L5LA 1TTZA 2A2SA 2XBIA 1TRVA 1TK5B 4MZWA 6GSXA 3E3EA 2H74A 4N11A 5E4WA 4EXJA 2B5YA 2C80A 4Q5QA 2B5EA 2FGXA 1A0FA 1FW1A 3E0UA 3EURA 3GKMA 4WR4A 1LBKA 3I6AA 4NV2A 2JSZA 1Y6EA 4GWRA 2X8CA 5EL8A 5FWGA 3BCIA 1FHEA 3LG6A 1ERWA 1U88A 2H8LA 4TXVA 3KD0A 1Z6MA 3WGXA 4I2UA 3RHBA 1SK1A 4IGJA 3US3A 3UBLA 2B1KA 1GTBA 1X5CA 2CZ2A 1KEBA 2VLTA 4HS1A 2H6YA 1AW9A 1SD8A 2YCDA 5CRGA 2MMNA 5ECPB 4POMA 5IMFA 3TJGA 3G9BA 4BVYA 1Z7PA 1EEMA 3K8NA 2LTKA 5ECRB 2HXKA 1DSBA 1X0RA 3DWVA 1T1VA 4OFMA 3ZYWA 2GZZA 5IM9A 2HSMB 4Z7XA 3QPMA 3HVVA 4MF5A 1FOVA 3FK8A 1XOAA 4L5OA 2RUEA 4K7NA 1M99A 4ID0A 3UEMA 1QXHA 3DRNA 4HQZA 1GNWA 5AIXA 4USSA 2MBTA 2L57A 2AV4A 3KZQA 1X9SB 2CVBA 2IIYA 2VO4A 2EC4A 2FCHA 3VK9A 3D5JA 2BTOT 1V9WA 3TUEA 4NAXA 2R37A 4MLYA 3RHCA 2L4QA 2VCWA 2B7KA 1ERUA 4ZL9A 1XVQA 1M2AA 3IC4A 4MPFA 5AN1A 2BJXA 3C1RA 5CRDA 2FLSA 5ECLB 2JADA 1X5DA 2NBSA 3DMLA 1T00A 3H1NA 3CXGA 1VF1A 2HRKA 4NHWA 1K0BA 2YN1A 2K8SA 2O8VB 3KTLA 2H19A 2PMTA 1J08A 4IQAA 1WOUA 3ME8A 1N8JA 4Q5FA 2RM6A 2K9FA 1SJ6A 1FB0A 4KE3A 4MF7A 3FRCA 1GTIA 5DDLA 5D9XA 2PGTA 3FW2A 4N0ZA 1OAZA 2HYXA 4JRRA 5CRHA 5CAXA 3TOUA 1KNGA 1GSDA 3DGQA 1OC3A 4MH3A 1PL2A 2CQ9A 5JCWA 6GSTA 5LD0A 1R7HA 10GSA 2YV7A 5C00A 4ZBBA 4IS0A 1E2YA 1A0RP 2F51A 2MZCA 1SL2B 5A4VA 4MJEA 1GLQA 5IO0A 1XWCA 2V2GA 4V2LA 5IIZA 5EY6A 5A5KA 3P2AA 2CVDA 3NOFA 4ZIJA 5A4WA 3LJRA 1T7PB 3HHVA 1QUWA 1JZWA 1O7UA 5IMVA 1GSFA 1PA3A 3C71A 2DJ0A 2LRCA 2VIMA 1XOBA 1PMTA 5JCGA 2DIYA 1MD4A 3HYPA 3CSHA 4IQ1A 2QGVA 3CRUA 5D93A 3E9JB 3M9KA 2PN8A 4XIHA 3FY7A 4WR5A 2I1UA 3W6GA 5IQYA 1SU9A 2B1LA 3ZRDA 3IA1A 1CQHA 1U87A 1FAAA 1YEXA 2D2ZA 4YQUA 1RQMA 3CSJA 5DALA 3F4TA 2YANA 4N10A 4TRXA 4XRAA 2YWNA 2G2QA 2HI7A 2HQTA 5DQSA 1RW1A 2F8FA 3G7YA 3PH9A 1G7EA 2IMEA 2R6KA 4ML1A 3TOTA 1FVJA 2DJ3A 3RPNA 4LL1B 4WF4A 17GSA 4TR4A 1F3AA 1B4QA 2L59A 2DC5A 2L6DA 1SL1B 3H93A 2CT6A 1BEDA 2TIRA 3Q74A 3ZZXA 5ID2B 3O76A 1HNAA 4ZBAA 4BVXB 4K9ZA 3EC3A 2CZ3A 1Z3EA 2OE1A 1A2MA 2LNTA 1FG4A 2CV4A 4PQ1A 2L6CA 2J9HA 5COHA 2HLSA 1AUCA 3GUSA 7GSSA 5IMAA 9GSSA 4MMMA 2MMZA 8GSSA 2KP2A 3TRXA 1NW2A 3KM6A 5KN3A 1OYJA 4CHSA 2P31A 4NPBA 4KNDA 5DJMA 4GQCA 4FYCA 4GRFA 4HU9A 2H73A 1BJXA 6GSYA 3ZFLA 1PGTA 3APSA 2V6OA 4MK3A 1MTCA 3MDKA 1O85A 1THOA 1XVWA 1SJIA 3GV1A 1XWKA 3IAS2 1YY7A 5HR1A 1WP0A 5G2ZA 4EF0A 1GH2A 4I2TA 3A2WA 3HJPA 2RIIA 2GS3A 1TK8B 4MZCA 3FEUA 1TU7A 2N5FA 1ZL9A 4IJ3A 1WIKA 2HZFA 2H72A 3G7JA 4GSNA 1O73A 1Z7RA 5G30A 4TR1B 2VLUA 1XW5A 5ECKB 4FQUA 3ERGA 3IAM2 1GLPA 4XRDA 4JU5A 2VD0A 3QAWA 3WGEA 5CNWA 1V98A 2VOCA 1PKWA 2N5BA 1U3IA 3HKRA 3QR6A 2KOKA 2HSNB 1SYRA 4MPGA 2H75A 4FYUA 1ACVA 4IBPA 4AGSA 4IELA 3G7IA 3D6IA 2IPAA 2WFCA 3WYWA 1NM3A 2WZ9A 2AJQB 2LSTA 4OCEA 1V2AA 2A2RA 3FHKA 5IPGA 4POLA 2LQQA 4PX1A 2X8GA 3CTFA 4ZB6A 4I8BA 5J5NA 5G31A 3H4KA 3L78A 1YZXA 4HOJA 5IMCA 5ECNB 5E59A 1ERTA 3ZMKA 5F0GA 1ABAA 1VF3A 2YWOA 5ELGA 3D21A 3BBYA 1VF4A 1SKSB 2F3MA 2OADA 6GSSA 1Z5YE 2X99A 3U6VA 1UVZA 2B3SA 1MDJA 3O3TA 4DSSB 4RQRA 3QAVA 1ST9A 5HFKA 4KB3A 4XTSA 5C04A 2VL9A 5ECHB 3GTUA 2YZHA 1FO5A 3ISOA 2XC2A 2QKEA 3PGTA 1AXDA 5G5FA 2KUCA 2ZUPA 5GSSA 4HZ4A 4IKHA 4I97A 5BMUA 1YEPA 3Q6OA 4GF0A 4GTUA 3GN3A 2PWJA 1GUHA 1YKCA 4ZL8A 4PUAA 1EOHA 2FHEA 2IFQB 3ZLPA 4L8EA 2H0IA 2I3YA 1XWGA 1ZGNA 4BA7A 4V2MA 5ID2A 2R4VA 2HZEB 4BVXA 3GH9A 3EYTA 4MH2A 1MD3A 1DBYA 2NPBA 4K0GA 1XWAA 1GL8A 4GLTA 4ECBA 5IMZA 4HQSA 3RPPA 1I9DA 4F2IA 1TK0B 3S9FA 4ISDA 2FWEA 4D73B 5LNKe 3MNGA 2R2JA 2CX4A 4XCSA 1WJKA 1R4WA 1GTUA 2GLRA 4V1Ap 20GSA 4RUVA 1OE7A 3IOSA 5GSTA 4NV5A 4K2DA 1T4YA 3C73A 4TXOB 5CREA 3CSIA 2GT5A 1S3CA 1OC9A 4P3YB 3V1WA 2LJRA 3HJMA 4CDOA 3GKXA 4I6XA 4K0NA 2H6XA 4H86A 3UBKA 4MA9A 3N5OA 3LYPA 1BYEA 3AY8A 1Q4JA 5GAPD 3DIEA 1B48A 5ECQB 1NHYA 4AJ7A 3IDVA 4K1FA 4EVMA 4IN0A 2E2MA 3Q18A 5JWQB 3P90A 3LYKA 4TR1A 2GZYA 1UC7A 1WMJA 4ACSA 3F0IA 1B4PA 2GSRA 4NXIA 1HNBA 3IXRA 3D4MA 1TDIA 1I5GA 3CYNA 5ECSA 1K0DA 5JWOB 3KTBA 3LSZA 3VURA 2WULA 4JR4A 3KMOA 5G1LA 3SWLA 2WCIA 5DQYA 3M3MA 4FH8A 2LRTA 3F6DA 3HZ8A 2A4VA 1ZCPA 2OBKA 1X9MB 1TRWA 4ZBDA 3IV4A 3HCZA 5B6NA 3GHAA 2KP1A 2H70A 3GURA 3TGZA 4TR3A 1AQWA 5F06A 2VD1A 3LORA 1HD2A 1A23A 1EZKA 4WKWA 3PR8A 3CBUA 3UVTA 4KA0A 4O5RA 1GWCA 1SK0A 3TKRA 2FNOA 3L9UA 4DSSA 2C0DA 2B7JA 3L9VA 1X5EA 1B9XC 3GKKA 3IC8A 4ZILA 4TVEA 4EUYA 2WDUA 4BPYA 3IPZA 5HFGA 2IWTA 2I81A 3UARA 3TJJA 4V2NA 1AQVA 4KDYA 4F03A 3KP9A 4OCFA 1BX9A 2DLXA 5DAKB 5DCHA 4MCUA 2FY6A 1WE0A 4PNFA 3QDNA 3GKNA 3BCKA 3GX0A 2C8UA 3RDWA 2EIOA 1ZZYA 2MMAA 2GVPA 4ECJA 2K18A 3HJOA 2M72A 3KEBA 3KH7A 5DCGA 19GSA 1PRXA 3WT1A 1B9YC 4XS1A 1Z9HA 5DJLA 2HZEA 4ECCA 1F2EA 2C3TA 1GNEA 1EV9A 2HT9A 3J7Yb 3APQA 4MF6A 4RQXA 3KMNA 4KDXA 1AQXA 2H76A 3CTGA 1S3DA 2H01A 5A4UA 4NWYA 2E2GA 3GL5A 5DBQA 2C0FA 2LQOA 2H30A 4DSQA 2PVQA 3MWHA 4G19A 4TXOA 1XWBA 5J3RA 4O92A 4N30A 2YWIA 3GNJA 4IJIA 4TW5A 1EP7A 1T3BA 5J9CA 2XPDA 3PINA 1H4OA 1G7OA 4GQFA 1C72A 2ON7A 4AJ6A 2HSMA 4KGIA 2M46A 1GP1A 2NVLA 2P0GA 2C0GA 3WGDA 1TU8A 1PSQA 3FZ4A 1YQ1A 3QMXA 4PNGA 4XS4B 5CRWA 5HR3A 1LU4A 3KIJA 5AIVA 3TKSA 3ZIJA 5HQPA 3VI7A 1K0CA 2B5XA 3HD5A 1YKAA 4KSOA 2GSQA 3F3QA 2DMMA 5G1KA 3M1GA 2BMXA 2GT6A 1PL1A 4IHUA 3HA9A 5HR2A 2GTUA 3FKFA 3GSTA 3FZAA 5IMDA 2GGTA 1YJ6A 4X43A 2LJKA 5B8BA 3ZVJA 4N0VA 2H0GA 1A2JA 5AGYA 2QSIA 4E8EA 4OO5A 3C8EA 2VCQA 2MBSA 1OKTA 1GSQA 2FWGA 3ZITA 5D9TA 4PUFC 4OO4A 4MJCA 2TRCP 4IW9A 5H5SA 1JZOA 3TKQA 1Q98A 2OA7A 2OBIA 4ZB8A 2YP6A 3A2XA 1XXUA 1ZMAA 3ERFA 3EMPA 1U3AA 1YF1A 1B8XA 2P5QA 2CX3A 3HZ4A 1SKRB 2C4JA 4O7HA 1ZYQB 5ECIB 5HR0A 3ME7A 4XHMA 3FR9A 2NTOA 1BAYA 4MDCA 3BD2A 5ELAA 3GH6A 4L0WA 3LWAA 3L9SA 4ECIA 3A5WA 3EU3A 5DAKA 5G5EA 2HNLA 2HSHA 3A2VA 4FO5A 2LJAA 4QL7A 2LUSA 3HVSA 2VLVA 2YNXA 4WF5A 2O87A 2IJYA 3TKSC 4X0XA 1JZRA 2VUPA 3C1SA 2AYTA 4TKYA 1GUKA 3D4TA 1CQGA 2DJ2A 1KTEA 6GSWA 3IBHA 4XS6A 2OACA 2PVOC 1GSYA 5CO3A 5ABRA 2RUFA 14GSA 3HVXA 5CP1A 4KAEA 4ZL7A 22GSA 4EL1A 1DE2A 4QL9A 2HRFA 4HUAA 4Q5NA 2H71A 4LLRA 3O6TA 16GSA 2H1AA 1TP9A 2HRKB 3C7MA 1M9AA 4FYBA 4KCEA 1E6BA 3H8QA 3DYRA 3RAZA 1ML6A 2L4CA 3FZ5A 5DVBA 1DUGA 3UMAA 1V57A 2R3XA 1A2LA 1SYXA 4K6XA 3J7Yk 2VCZA 3OR5A 1U6TA 2VCTA 3L4NA 2JZTA 1J0FA 3VFIA 3F9UA 1H75A 2YJHA 3ZTLA 2JACA 3DKSA 3TB2A 1VRSD 1QFNA 1O8XA 3F4SA 3I9V2 1YDKA 1OE8A 3JCML 3KXOA 2G0FA 4YQMA 2LKUA 1WRYA 1XW9A 3GSSA 1TRSA 4ULXA 2ALBA 1TJDA 3LXTA 3HY2A 3UL3A 2VCXA 2R5GA 1K0OA 2RM5A 4OFNA 2K8VA 2CAQA 5JWRB 3SBCA 4RI7A 4LMWA 1A8LA 2X8HA 3VWWA 2H66A 2VL3A 4JE1A 4RI6A 2LS5A 3I43A 4POBA 2MMOA 4NMUA 3TCOA 1ERVA 1TI1A 3KJYA 3UJ1A 1T8EB 3NIVA 4K7IA 1OKDA 5FT3A 3ZIVA 1GUMA 3QAGA 4G0KA 2EIQA 4GSTA 3DVWA 5B6MA 4AJ8A 2E0QA 3F63A 2NDOA 2GQMA 1BG5A 4G2EA 3LFLA 4BWSA 1QGVA 4O32A 4TOPA 4KCAA 1MDIA 5L71A 3VI5A 1EOGA 4G9HA 1O8WA 1XFLA 5DALB 5JCUA 5EPFA 2Z9SA 2I4AA 3EU4A 2XBQA 4IP1A 4MABA 1GSUA 2AUVA 2OE0A 2O85A 3DD3A 1M2DA 2YJ7A 3DVXA 2H0HA 1MEKA 4IVFA 4YH2A 1M0UA 2H1BA 2YOIA 1JFUA 1HNCA 4BL7B 2YV9A 4LMVA 2IMDA 2C0EA 4DEJA 5J4UA 3GX8A 1UA5A 1F37A 2M80A 4KW6A 3APOA 1TXXA 1J9BA 3TJKA 1WPIA 3IR4A 2FA8A 4OMVA 3QCPA 2IN3A 2QC7A 3IE3A 4HJ2A 4PQHA 2WJUA 5CYYA 4F0CA 3WT2A 3F4RA 2HFDA 2JSYA 1XW6A 5ECMB 3FZ9A 1M2BA 4JEDA 3TRPA 3M9JA 4I5QA 2K6VA 1PX6A 3BOAA 1TI3A 2PERA 4MJAA 5D73A 5INYA 4KF9A 1W89A 3IK7A 2IMIA 4WBRD 3DXBA 5FHIA 1HQOA 2OE3A 2LNSA 2X64A 3I69A 2N5AA 1IYIA 2C3NA 1W4VA 2JU5A 2P5RA 4IP6A 3EMXA 1GULA 1PQNA 5H5QA 2PPTA 1EGOA 4E8HA 2V32A 1S3AA 2VM2A 4ZXGA 2CA8A 5IOWA 1GSSA 1RK4A 1USBA 4JZQA 2O89A 3VWVA 4MJBA 1F9MA 2UZ8A 2E7PA 5F07A 4YQVA 2XPEA 4OFTA 4ML6A 4WBJA 3DEXA 3CMIA 3UVHA 1JLVA 3P8WA 4ILFA 5F05A 1Z6NA 5B8AA 3VWXA 1HYUA 3TDGA 3UAPA 6GSUA 1Y25A 1N2AA 3Q19A 1X9WB 4DVCA 2KHPA 3MAKA 2RLIA 3KH9A 3TKPA 1EWXA 2GSTA 5IPHA 2IFQA 13GSA 2F8AA 4AF2A 3W8JA 4WXTA 1K3LA 2ZNMA 1QK8A 1EEJA 1NHOA 4EDZA 3TJFA 4BWQA 1FVKA 4NHZA 4TR0A 3ZREA 4MZBA 3UIWA 1THXA 2HRNA 1UN2A 3GMFA 2EIRA 5D8IA 2REMA 3R2QA 4CW9A 2LRNA 3VPQA 1ILOA 4WEYA 4LL4B 5D9VA 3A3TA 1JZDA 12GSA 4D73A 1SKWB 2PU9C 3VPTA 1A24A 1AIUA 3IK9A 4KX4A 3KGKA 1PN9A 3ZL5A 4KUNA 3FR3A 3ED3A 3QFAC 4JBBA 5KN1A 1XPVA 3KCMA 3F6FA 4G10A 3IRAA 4G0IA 3M8NA 4KDUA 2GDRA 3ZFBA 1SD9A 2HE3A 2OJLA 3KP8A 4EO3A 1V40A 3EWLA 2C3QA 4MP4A 3NZNA 2FUG2 1TW9A 3ERWA 3GTUB 2DSAA 3LXZA 3TKSE 2DJ1A 1LJRA 4Q5RA 2FD3A 2PBJA 4LA1A 1GSEA 5AISA 4PGTA 2XHFA 3QD9A 3TRQA 3LEFA 4HDEA 3WD6A 3GFKA 3GIXA 1DE1A
chains in the Genus database with same CATH superfamily
1GRXA 1R26A 4V1Ag 1V58A 5KN0A 6GSVA 3FYGA 3PPUA 3R3EA 1ZYEA 4GCIA 5KN2A 2WB9A 2V41A 2AAWA 4BL7A 2JZSA 5J41A 2OKAA 11GSA 2H1DA 4PQIA 2VL2A 4F0BA 1XIYA 3L0HA 4YAVA 4YKFA 5EVOA 2CVKA 2WRTA 1QQ2A 1R5PA 1BQ7A 2VM1A 4OWYA 2WW3A 2YWMA 2ES7A 2DMLA 3P7XA 3CRTA 5LCZA 4JR6A 1BF5A 1SJZA 2V1MA 2VAFA 1VGLA 1K3YA 1PD21 1JLWA 3FR6A 1K0AA 1PX7A 5B7CA 3QOUA 1KBNA 4K8MA 4ZB9A 3HXSA 4K7OA 2DBCA 3H79A 2TRXA 2GQLA 1JHBA 5D9WA 5GZZB 2ZCTA 2IMKA 1XCCA 2GZPA 4EDYA 4HZ2A 1F6MC 1G0TA 1AC1A 4DSRA 3ZMLA 2EFEA 4HSCX 4PURA 1K0MA 2KLXA 2LEGA 4GXZA 2PUKC 3ZVJD 3HDCA 1EGRA 2DJKA 2EFHA 5IO2A 5D96A 3VLNA 2VCVA 5J9BA 1EP8A 2F9SA 18GSA 4BVYB 1TKDB 4PI2C 1OC9B 5GAND 4KH7A 1BG1A 4J56E 1AAZA 5ENUA 2H1GA 4EE0A 2O7KA 1A8YA 1XBSA 1GTAA 4G01A 1PFOA 1QMVA 1YF0A 4HI7A 1M7TA 2IL3A 4YKGA 1ON4A 3GYKA 1FB6A 3W8SA 1SK2A 2V6KA 4EKZA 3EINA 4F9ZA 2CAIA 3RBTA 2B6MA 3F3RA 2I9HA 2L5OA 4X1UA 1F3BA 1URMA 5HFIA 2HSYA 2YPMA 4O5UA 2ON5A 4J2FA 1G6YA 5KEJA 3GA4A 4PTSA 2IMFA 1O6JA 1OC8A 1K3OA 1G6WA 4G0LA 5ECOB 2GQKA 1SL0B 3U5RE 2AHEA 1TRUA 1XZOA 1T4ZA 3GL3A 3M0FA 2VL2C 1PN0A 2JL4A 1ZOFA 4TN8A 1EV4A 2WW0A 3BJ5A 4J57E 2AB6A 3MSZA 1MDKA 2WVXA 3D22A 3VWUA 3EE2A 2GSSA 2MYGA 1K0NA 1PKZA 2FA4A 1IYHA 1WWJA 4YAPA 4HU7A 4HEA2 5H5RA 2WGRA 2WS2A 2C1YA 4OD7A 4L5LA 2J23A 4CY8A 5IOXA 3LGCA 1R5AA 2LV3A 1M9BA 4QQ7A 1TOFA 2FWFA 1O81A 4WETA 2DIZA 4GSSA 3UOMA 1SENA 3IHQA 2JZRA 2H6ZA 3D0ZA 3GRXA 4HJMA 3F8UA 2EFCA 4PXOA 3QFBC 4FIWA 4EC0A 2YZUA 4POKA 2FWHA 4KSMA 4L0UA 3LQ7A 3EVIA 3N9JA 1NSWA 1OVNA 5F8BA 1VF2A 2HRAA 4XS4A 4F82A 3TJBA 2DJJA 4X4JA 2L5LA 1TTZA 4Z2UA 2A2SA 2XBIA 1TRVA 1TK5B 4MZWA 6GSXA 1SVOA 3E3EA 2H74A 4N11A 5E4WA 4EXJA 2B5YA 2C80A 4Q5QA 2B5EA 2FGXA 1A0FA 1FW1A 3E0UA 3EURA 3GKMA 4WR4A 1LBKA 3I6AA 4NV2A 2JSZA 1Y6EA 4GWRA 2X8CA 5EL8A 5FWGA 3BCIA 1FHEA 3LG6A 1ERWA 1U88A 2H8LA 4TXVA 3KD0A 1Z6MA 3WGXA 4I2UA 3RHBA 1SK1A 4IGJA 3US3A 3UBLA 1YEWC 2B1KA 1GTBA 1X5CA 2CZ2A 1KEBA 2VLTA 4HS1A 2H6YA 1AW9A 1SD8A 2YCDA 5CRGA 2MMNA 5ECPB 4POMA 5IMFA 3TJGA 1Y1UA 4BVYA 3G9BA 1Z7PA 1EEMA 3K8NA 2LTKA 5ECRB 2HXKA 1DSBA 1X0RA 3DWVA 4O5QA 1T1VA 4OFMA 3ZYWA 2GZZA 5IM9A 2HSMB 4Z7XA 3QPMA 3HVVA 4MF5A 1FOVA 3FK8A 1XOAA 4L5OA 2RUEA 4K7NA 1M99A 4ID0A 3UEMA 1QXHA 3DRNA 4HQZA 1GNWA 5AIXA 4USSA 2MBTA 2L57A 2AV4A 5KOWA 3KZQA 1X9SB 5A5HB 2CVBA 2IIYA 2VO4A 2EC4A 2FCHA 3VK9A 3D5JA 2BTOT 1V9WA 3TUEA 4NAXA 2R37A 4MLYA 3RHCA 2L4QA 2VCWA 2B7KA 1ERUA 4ZL9A 1XVQA 1M2AA 3IC4A 4MPFA 5AN1A 2BJXA 3C1RA 5CRDA 2FLSA 5ECLB 2JADA 1X5DA 2NBSA 3DMLA 3A5IA 1T00A 3H1NA 3CXGA 4EIPA 1VF1A 2HRKA 4NHWA 1K0BA 2YN1A 2K8SA 2O8VB 3KTLA 2H19A 4K5SA 3TU3B 2PMTA 1J08A 4IQAA 1WOUA 2DKIA 3ME8A 1N8JA 4QMKA 4Q5FA 2RM6A 2K9FA 1SJ6A 1FB0A 4KE3A 4MF7A 3FRCA 1GTIA 5DDLA 5D9XA 2PGTA 3FW2A 4N0ZA 1OAZA 2HYXA 4JRRA 5CRHA 5CAXA 3TOUA 1KNGA 1GSDA 3DGQA 1OC3A 4MH3A 1PL2A 2CQ9A 5JCWA 6GSTA 5LD0A 1R7HA 10GSA 2YV7A 5C00A 4ZBBA 4IS0A 1E2YA 1A0RP 2F51A 2MZCA 1SVLA 1SL2B 5A4VA 4MJEA 1GLQA 5IO0A 1XWCA 2V2GA 4V2LA 5IIZA 5EY6A 5A5KA 3P2AA 2CVDA 2WVYA 3NOFA 4AKXB 5A4WA 4ZIJA 3LJRA 1T7PB 3HHVA 1QUWA 1JZWA 1O7UA 5IMVA 1GSFA 1PA3A 3C71A 2DJ0A 2LRCA 2VIMA 1XOBA 1PMTA 5JCGA 2DIYA 1MD4A 3HYPA 3CSHA 4IQ1A 2QGVA 3CRUA 5D93A 3E9JB 3M9KA 2PN8A 3RFRC 3FY7A 4XIHA 4WR5A 2I1UA 3W6GA 5IQYA 1SU9A 2B1LA 3ZRDA 3IA1A 1CQHA 1U87A 1FAAA 1YEXA 2D2ZA 4YQUA 1RQMA 1M3JA 2EFDA 4AI6A 3CSJA 5DALA 3F4TA 2YANA 4N10A 4TRXA 4XRAA 2YWNA 2G2QA 2HI7A 2HQTA 5DQSA 1RW1A 2F8FA 5BMUB 3G7YA 3PH9A 1G7EA 2IMEA 2R6KA 4ML1A 3TOTA 1FVJA 2DJ3A 3RPNA 4LL1B 4WF4A 17GSA 4TR4A 1F3AA 1B4QA 2L59A 2DC5A 2L6DA 1SL1B 3H93A 2CT6A 1BEDA 2TIRA 3Q74A 3ZZXA 5ID2B 3O76A 1HNAA 4ZBAA 4BVXB 4K9ZA 3EC3A 2CZ3A 1Z3EA 2OE1A 1A2MA 2LNTA 1FG4A 2CV4A 4PQ1A 2L6CA 2J9HA 5COHA 1FOHA 2HLSA 1AUCA 3GUSA 7GSSA 5IMAA 9GSSA 4MMMA 2MMZA 8GSSA 2KP2A 3TRXA 1NW2A 3KM6A 5KN3A 1OYJA 4CHSA 2P31A 4NPBA 4KNDA 5DJMA 4GQCA 4FYCA 1ZYNA 4GRFA 4HU9A 2A4HA 2H73A 1BJXA 6GSYA 3ZFLA 1PGTA 3APSA 2V6OA 2R0CA 4MK3A 1MTCA 3MDKA 1O85A 1THOA 1XVWA 1SJIA 3GV1A 1XWKA 3IAS2 1YY7A 5HR1A 1WP0A 5G2ZA 4EF0A 1GH2A 4I2TA 3A2WA 3HJPA 2RIIA 2GS3A 1TK8B 4MZCA 3FEUA 1TU7A 2N5FA 1ZL9A 4IJ3A 1WIKA 2HZFA 2H72A 3G7JA 4GSNA 1O73A 1Z7RA 5G30A 4TR1B 2VLUA 1XW5A 4AKGA 5ECKB 4FQUA 3ERGA 3IAM2 1GLPA 4XRDA 4JU5A 2VD0A 3QAWA 3WGEA 5CNWA 1V98A 2VOCA 4W66A 1PKWA 2N5BA 2QA1A 1U3IA 3HKRA 3QR6A 2KOKA 2HSNB 1SYRA 4MPGA 2H75A 4FYUA 1ACVA 4IBPA 4AGSA 4IELA 3G7IA 3D6IA 2IPAA 2WFCA 3WYWA 1NM3A 2WZ9A 2AJQB 2LSTA 4OCEA 1V2AA 2A2RA 3FHKA 5IPGA 4POLA 2LQQA 4PX1A 2X8GA 3CTFA 4ZB6A 4I8BA 5J5NA 5G31A 3H4KA 3L78A 1YZXA 4HOJA 5IMCA 5ECNB 5E59A 1ERTA 3ZMKA 5F0GA 1ABAA 1VF3A 2YWOA 5ELGA 3D21A 3BBYA 1VF4A 1SKSB 2F3MA 2OADA 6GSSA 1Z5YE 2X99A 3U6VA 1UVZA 2B3SA 1MDJA 3O3TA 4DSSB 4RQRA 3QAVA 1ST9A 5HFKA 4KB3A 4XTSA 5C04A 2VL9A 5ECHB 3GTUA 2YZHA 2DKHA 1FO5A 3ISOA 2XC2A 2QKEA 3PGTA 1AXDA 5G5FA 2KUCA 2ZUPA 5GSSA 4HZ4A 4IKHA 4I97A 5BMUA 1YEPA 3MYDA 3Q6OA 4GF0A 1S4BP 4GTUA 3GN3A 2PWJA 2OT3A 1GUHA 1YKCA 4ZL8A 4PUAA 1EOHA 2FHEA 2IFQB 4ICYA 3ZLPA 4L8EA 2WZSA 2H0IA 2I3YA 1XWGA 1ZGNA 4BA7A 4V2MA 5ID2A 2R4VA 2HZEB 4BVXA 3GH9A 3EYTA 4MH2A 1MD3A 1DBYA 3HMJG 2NPBA 4K0GA 1XWAA 1GL8A 4GLTA 2A2PA 4ECBA 2UV8G 5IMZA 4HQSA 3RPPA 1I9DA 4F2IA 1TK0B 3S9FA 4ISDA 2FWEA 4D73B 5LNKe 3MNGA 2R2JA 2CX4A 4XCSA 1WJKA 1R4WA 1GTUA 2GLRA 4V1Ap 20GSA 4RUVA 1OE7A 3IOSA 5GSTA 4NV5A 4K2DA 1T4YA 3C73A 4TXOB 5CREA 3CSIA 2O36A 2GT5A 1S3CA 1OC9A 4P3YB 3V1WA 2LJRA 3HJMA 4CDOA 3GKXA 4I6XA 4K0NA 2H6XA 4H86A 3UBKA 4MA9A 3N5OA 3LYPA 1BYEA 4ZB7A 3AY8A 1Q4JA 5GAPD 3DIEA 1B48A 5ECQB 1NHYA 4AJ7A 3IDVA 4K1FA 4EVMA 4IN0A 2E2MA 3Q18A 5JWQB 3HVNA 3P90A 3LYKA 4TR1A 2GZYA 1UC7A 1WMJA 4ACSA 2WVZA 3F0IA 2R0PA 4K2XA 1B4PA 2GSRA 4NXIA 1HNBA 3IXRA 3D4MA 1TDIA 1I5GA 3CYNA 5ECSA 1K0DA 2HSNA 5JWOB 5BRTA 3KTBA 3LSZA 3VURA 2WULA 4JR4A 3KMOA 5G1LA 3SWLA 2WCIA 5DQYA 5J40A 3M3MA 2VKZG 4FH8A 2LRTA 3F6DA 3HZ8A 2A4VA 1ZCPA 2OBKA 1X9MB 1TRWA 5KOXA 4ZBDA 3IV4A 3HCZA 5B6NA 3GHAA 2KP1A 2H70A 3GURA 3TGZA 4TR3A 1AQWA 5F06A 2VD1A 3LORA 1HD2A 1A23A 1EZKA 4WKWA 3PR8A 1YVLA 3CBUA 3UVTA 4KA0A 4O5RA 1GWCA 1SK0A 3TKRA 2FNOA 3L9UA 4DSSA 2C0DA 2O3EA 2B7JA 4GDFA 3L9VA 1X5EA 1B9XC 3GKKA 3IC8A 4ZILA 4TVEA 4EUYA 2X4AA 2WDUA 4BPYA 3IPZA 5HFGA 2IWTA 2I81A 3UARA 3TJJA 4V2NA 1AQVA 4KDYA 4F03A 3KP9A 4OCFA 1BX9A 2DLXA 5DAKB 5DCHA 4MCUA 2FY6A 1WE0A 4PNFA 3QDNA 4N3ZA 3GKNA 3BCKA 1XG8A 3GX0A 2C8UA 3RDWA 2EIOA 1ZZYA 2MMAA 2GVPA 4ECJA 3RGBC 2K18A 3HJOA 2M72A 3KEBA 3KH7A 5DCGA 19GSA 1PRXA 3WT1A 1B9YC 1TXUA 4XS1A 1Z9HA 5DJLA 2HZEA 4ECCA 1F2EA 2C3TA 1GNEA 5J4VA 1EV9A 1I1IP 2HT9A 3J7Yb 3APQA 4MF6A 4RQXA 3KMNA 4KDXA 1AQXA 2H76A 3CTGA 1S3DA 2H01A 5A4UA 4NWYA 2E2GA 2R0GA 3GL5A 5DBQA 2C0FA 2LQOA 2H30A 4DSQA 2PVQA 1N25A 3MIXA 3MWHA 4G19A 4TXOA 1XWBA 5J3RA 4O92A 4N30A 2YWIA 3GNJA 4IJIA 4TW5A 1EP7A 1T3BA 5J9CA 2XPDA 3PINA 1H4OA 1G7OA 1C72A 2ON7A 4GQFA 4AJ6A 2HSMA 4KGIA 2M46A 1GP1A 2NVLA 2P0GA 4E68A 2C0GA 3WGDA 1TU8A 1PSQA 3FZ4A 1YQ1A 3QMXA 4PNGA 4XS4B 5CRWA 5HR3A 1LU4A 3KIJA 5AIVA 3TKSA 5A5HA 3ZIJA 5HQPA 3VI7A 1K0CA 2B5XA 3HD5A 1YKAA 2QA2A 4KSOA 2GSQA 3F3QA 2DMMA 5G1KA 3M1GA 2BMXA 2GT6A 1PL1A 4IHUA 3HA9A 5HR2A 2GTUA 3FKFA 3GSTA 3FZAA 5IMDA 4Z2RA 1SVMA 2GGTA 1YJ6A 4X43A 2LJKA 5B8BA 3ZVJA 4N0VA 2H0GA 1A2JA 5AGYA 2QSIA 4EIQA 4E8EA 4OO5A 3C8EA 2VCQA 4MNNA 2MBSA 1OKTA 1GSQA 2FWGA 3ZITA 5D9TA 4PUFC 4OO4A 4MJCA 2TRCP 4IW9A 5H5SA 4AKHA 1JZOA 3TKQA 1Q98A 5J4YA 2OA7A 2OBIA 4ZB8A 2YP6A 3A2XA 1XXUA 1ZMAA 3ERFA 3EMPA 1U3AA 1YF1A 1B8XA 2P5QA 2CX3A 3HZ4A 4K5RA 1SKRB 2C4JA 4O7HA 1ZYQB 5ECIB 5HR0A 3ME7A 4XHMA 3FR9A 2NTOA 1BAYA 4MDCA 3BD2A 5ELAA 3GH6A 4L0WA 3LWAA 3L9SA 4ECIA 3A5WA 3EU3A 5DAKA 5G5EA 2HNLA 2HSHA 3A2VA 4FO5A 2LJAA 4QL7A 2LUSA 3HVSA 2VLVA 2YNXA 4WF5A 2O87A 3FMWA 2IJYA 3TKSC 4X0XA 4BIKA 1JZRA 2VUPA 3C1SA 2AYTA 4TKYA 1GUKA 3D4TA 1CQGA 2DJ2A 1KTEA 6GSWA 3IBHA 4XS6A 3EPTA 2OACA 2PVOC 1GSYA 5CO3A 5ABRA 2RUFA 14GSA 3HVXA 5CP1A 4KAEA 4ZL7A 22GSA 4EL1A 1DE2A 4QL9A 2HRFA 4HUAA 4CY6A 4Q5NA 2H71A 4LLRA 3O6TA 16GSA 2H1AA 1TP9A 2HRKB 3C7MA 1M9AA 4FYBA 4KCEA 1E6BA 3H8QA 3DYRA 3RAZA 1ML6A 2L4CA 3FZ5A 5DVBA 1DUGA 4PI0C 3UMAA 1V57A 2R3XA 1A2LA 1SYXA 4K6XA 3J7Yk 2VCZA 3OR5A 1U6TA 2VCTA 5A1NB 3L4NA 2JZTA 1J0FA 3VFIA 3F9UA 1H75A 2YJHA 3ZTLA 2JACA 3DKSA 3TB2A 1VRSD 1QFNA 1O8XA 3F4SA 3I9V2 1YDKA 1OE8A 3JCML 3KXOA 2G0FA 4YQMA 2LKUA 1WRYA 1XW9A 3GSSA 1TRSA 4ULXA 2ALBA 1TJDA 3LXTA 3HY2A 3UL3A 2VCXA 2R5GA 5A34B 1K0OA 2RM5A 4OFNA 2K8VA 2CAQA 5JWRB 3SBCA 4RI7A 4LMWA 1A8LA 2X8HA 3VWWA 2H66A 2VL3A 4JE1A 4RI6A 2LS5A 3I43A 4POBA 2MMOA 4NMUA 3TCOA 1ERVA 1TI1A 3KJYA 3UJ1A 1T8EB 3NIVA 4K7IA 1OKDA 5FT3A 3ZIVA 1GUMA 3QAGA 4G0KA 2EIQA 3CWGA 1ZYPA 4GSTA 3DVWA 5B6MA 4AJ8A 2E0QA 3F63A 2NDOA 2GQMA 1BG5A 4G2EA 3LFLA 4BWSA 1QGVA 4O32A 4TOPA 4KCAA 1MDIA 5L71A 3VI5A 1EOGA 4G9HA 1O8WA 1XFLA 5DALB 5JCUA 5EPFA 2Z9SA 2I4AA 3EU4A 2XBQA 4IP1A 4MABA 1GSUA 2AUVA 2OE0A 2H1LA 2O85A 3DD3A 1M2DA 2YJ7A 3LW9A 3DVXA 2H0HA 1MEKA 4IVFA 4YH2A 1M0UA 2H1BA 2YOIA 1JFUA 1HNCA 4BL7B 2YV9A 4LMVA 2IMDA 2C0EA 4DEJA 5J4UA 3GX8A 1UA5A 1F37A 2M80A 4KW6A 3APOA 1TXXA 1J9BA 3TJKA 1WPIA 3IR4A 2FA8A 4OMVA 3QCPA 2IN3A 2QC7A 3IE3A 4HJ2A 2O5VA 4PQHA 2WJUA 5CYYA 4F0CA 3WT2A 3F4RA 2HFDA 2JSYA 1XW6A 5ECMB 3FZ9A 1M2BA 4JEDA 3TRPA 3M9JA 4I5QA 2K6VA 1PX6A 3BOAA 4AKIA 2PERA 1TI3A 4MJAA 5D73A 5INYA 4KF9A 1W89A 3IK7A 2IMIA 1S3RA 4WBRD 3DXBA 5FHIA 1HQOA 2OE3A 2LNSA 2X64A 3I69A 2N5AA 1IYIA 2C3NA 4Z2TA 1W4VA 2JU5A 2P5RA 4IP6A 2X49A 3EMXA 1GULA 1PQNA 5H5QA 2PPTA 1EGOA 4E8HA 2V32A 1S3AA 2VM2A 4ZXGA 2CA8A 5IOWA 1GSSA 1RK4A 1USBA 4JZQA 2O89A 3VWVA 4MJBA 1F9MA 2UZ8A 2E7PA 5F07A 4YQVA 2XPEA 4OFTA 4ML6A 4WBJA 3DEXA 3CMIA 3UVHA 1JLVA 3P8WA 4ILFA 5F05A 1Z6NA 5B8AA 3VWXA 1HYUA 3TDGA 3UAPA 6GSUA 1Y25A 1N2AA 3Q19A 5A1NA 1X9WB 4FXYP 4DVCA 2KHPA 3MAKA 2RLIA 3KH9A 3TKPA 1EWXA 2GSTA 5IPHA 2IFQA 13GSA 2F8AA 4AF2A 3W8JA 4PHZC 4WXTA 1K3LA 4A5PA 2ZNMA 1QK8A 1EEJA 1NHOA 4EDZA 3TJFA 4BWQA 1FVKA 4NHZA 4TR0A 3ZREA 4MZBA 3UIWA 1THXA 2HRNA 1UN2A 3GMFA 2EIRA 5A34A 5D8IA 2REMA 3R2QA 4CW9A 2LRNA 3VPQA 1ILOA 4WEYA 4LL4B 3A3TA 2WVXB 5D9VA 12GSA 1JZDA 4D73A 1SKWB 2PU9C 3VPTA 1A24A 1AIUA 3IK9A 4KX4A 3KGKA 1PN9A 3ZL5A 4KUNA 3FR3A 3ED3A 3QFAC 4JBBA 5KN1A 1XPVA 3KCMA 3F6FA 4G10A 2WW2A 3CHXC 3IRAA 4G0IA 3M8NA 4KDUA 2GDRA 3ZFBA 1SD9A 2HE3A 2OJLA 3KP8A 4EO3A 1V40A 2WW1A 3CQFA 3IHGA 3EWLA 2C3QA 4MP4A 3NZNA 2FUG2 1TW9A 3ERWA 5J47A 3GTUB 2DSAA 3LXZA 3TKSE 2DJ1A 1LJRA 4Q5RA 2FD3A 2PBJA 4LA1A 1GSEA 5AISA 4PGTA 2XHFA 3QD9A 3TRQA 3LEFA 4HDEA 1M3IA 3WD6A 3GFKA 3GIXA 1DE1A
chains in the Genus database with same CATH topology
1GRXA 1R26A 4V1Ag 1V58A 5KN0A 6GSVA 3FYGA 3PPUA 3R3EA 1ZYEA 4GCIA 5KN2A 2WB9A 2V41A 2AAWA 4BL7A 2JZSA 5J41A 2OKAA 11GSA 2H1DA 4PQIA 2VL2A 4F0BA 1XIYA 3L0HA 4YAVA 4YKFA 5EVOA 2CVKA 2WRTA 1QQ2A 1R5PA 1BQ7A 2VM1A 4OWYA 2YWMA 2ES7A 2DMLA 3P7XA 3CRTA 5LCZA 4JR6A 1BF5A 1SJZA 2V1MA 2VAFA 1VGLA 1K3YA 1PD21 1JLWA 3FR6A 1K0AA 1PX7A 5B7CA 3QOUA 1KBNA 4K8MA 4ZB9A 3HXSA 4K7OA 2DBCA 3H79A 2TRXA 2GQLA 1JHBA 5D9WA 5GZZB 2ZCTA 2IMKA 1XCCA 2GZPA 4EDYA 4HZ2A 1F6MC 1G0TA 1AC1A 4DSRA 3ZMLA 2EFEA 4PURA 1K0MA 2KLXA 2LEGA 4GXZA 2PUKC 3ZVJD 3HDCA 1EGRA 2DJKA 2EFHA 5IO2A 5D96A 3VLNA 2VCVA 5J9BA 1EP8A 2F9SA 18GSA 4BVYB 1TKDB 1OC9B 5GAND 4KH7A 1BG1A 4J56E 1AAZA 5ENUA 2H1GA 4EE0A 2O7KA 1A8YA 1XBSA 1GTAA 4G01A 1QMVA 1YF0A 4HI7A 1M7TA 2IL3A 4YKGA 1ON4A 3GYKA 1FB6A 3W8SA 1SK2A 2V6KA 4EKZA 3EINA 4F9ZA 2CAIA 3RBTA 2B6MA 3F3RA 2I9HA 2L5OA 4X1UA 1F3BA 1URMA 5HFIA 2HSYA 2YPMA 4O5UA 2ON5A 4J2FA 1G6YA 5KEJA 3GA4A 4PTSA 2IMFA 1O6JA 1OC8A 1K3OA 1G6WA 4G0LA 5ECOB 2GQKA 1SL0B 3U5RE 2AHEA 1TRUA 1XZOA 1T4ZA 3GL3A 3M0FA 2VL2C 1PN0A 2JL4A 1ZOFA 4TN8A 1EV4A 3BJ5A 4J57E 2AB6A 3MSZA 1MDKA 3D22A 3VWUA 3EE2A 2GSSA 2MYGA 1K0NA 1PKZA 2FA4A 1IYHA 1WWJA 4YAPA 4HU7A 4HEA2 5H5RA 2WGRA 2WS2A 2C1YA 4OD7A 4L5LA 2J23A 4CY8A 5IOXA 3LGCA 1R5AA 2LV3A 1M9BA 4QQ7A 1TOFA 2FWFA 1O81A 4WETA 2DIZA 4GSSA 3UOMA 1SENA 3IHQA 2JZRA 2H6ZA 3D0ZA 3GRXA 4HJMA 3F8UA 2EFCA 4PXOA 3QFBC 4FIWA 4EC0A 2YZUA 4POKA 2FWHA 4KSMA 4L0UA 3LQ7A 3EVIA 3N9JA 1NSWA 1OVNA 5F8BA 1VF2A 2HRAA 4XS4A 4F82A 3TJBA 2DJJA 4X4JA 2L5LA 1TTZA 4Z2UA 2A2SA 2XBIA 1TRVA 1TK5B 4MZWA 6GSXA 1SVOA 3E3EA 2H74A 4N11A 5E4WA 4EXJA 2B5YA 2C80A 4Q5QA 2B5EA 2FGXA 1A0FA 1FW1A 3E0UA 3EURA 3GKMA 4WR4A 1LBKA 3I6AA 4NV2A 2JSZA 1Y6EA 4GWRA 2X8CA 5EL8A 5FWGA 3BCIA 1FHEA 3LG6A 1ERWA 1U88A 2H8LA 4TXVA 3KD0A 1Z6MA 3WGXA 4I2UA 3RHBA 1SK1A 4IGJA 3US3A 3UBLA 2B1KA 1GTBA 1X5CA 2CZ2A 1KEBA 2VLTA 4HS1A 2H6YA 1AW9A 1SD8A 2YCDA 5CRGA 2MMNA 5ECPB 4POMA 5IMFA 3TJGA 1Y1UA 4BVYA 3G9BA 1Z7PA 1EEMA 3K8NA 2LTKA 5ECRB 2HXKA 1DSBA 1X0RA 3DWVA 4O5QA 1T1VA 4OFMA 3ZYWA 2GZZA 5IM9A 2HSMB 4Z7XA 3QPMA 3HVVA 4MF5A 1FOVA 3FK8A 1XOAA 4L5OA 2RUEA 4K7NA 1M99A 4ID0A 3UEMA 1QXHA 3DRNA 4HQZA 1GNWA 5AIXA 4USSA 2MBTA 2L57A 2AV4A 5KOWA 3KZQA 1X9SB 5A5HB 2CVBA 2IIYA 2VO4A 2EC4A 2FCHA 3VK9A 3D5JA 2BTOT 1V9WA 3TUEA 4NAXA 2R37A 4MLYA 3RHCA 2L4QA 2VCWA 2B7KA 1ERUA 4ZL9A 1XVQA 1M2AA 3IC4A 4MPFA 5AN1A 2BJXA 3C1RA 5CRDA 2FLSA 5ECLB 2JADA 1X5DA 2NBSA 3DMLA 3A5IA 1T00A 3H1NA 3CXGA 4EIPA 1VF1A 2HRKA 4NHWA 1K0BA 2YN1A 2K8SA 2O8VB 3KTLA 2H19A 4K5SA 3TU3B 2PMTA 1J08A 4IQAA 1WOUA 2DKIA 3ME8A 1N8JA 4QMKA 4Q5FA 2RM6A 2K9FA 1SJ6A 1FB0A 4KE3A 4MF7A 3FRCA 1GTIA 5DDLA 5D9XA 2PGTA 3FW2A 4N0ZA 1OAZA 2HYXA 4JRRA 5CRHA 5CAXA 3TOUA 1KNGA 1GSDA 3DGQA 1OC3A 4MH3A 1PL2A 2CQ9A 5JCWA 6GSTA 5LD0A 1R7HA 10GSA 2YV7A 5C00A 4ZBBA 4IS0A 1E2YA 1A0RP 2F51A 2MZCA 1SVLA 1SL2B 5A4VA 4MJEA 1GLQA 5IO0A 1XWCA 2V2GA 4V2LA 5IIZA 5EY6A 5A5KA 3P2AA 2CVDA 3NOFA 4AKXB 5A4WA 4ZIJA 3LJRA 1T7PB 3HHVA 1QUWA 1JZWA 1O7UA 5IMVA 1GSFA 1PA3A 3C71A 2DJ0A 2LRCA 2VIMA 1XOBA 1PMTA 5JCGA 2DIYA 1MD4A 3HYPA 3CSHA 4IQ1A 2QGVA 3CRUA 5D93A 3E9JB 3M9KA 2PN8A 4XIHA 3FY7A 4WR5A 2I1UA 3W6GA 5IQYA 1SU9A 2B1LA 3ZRDA 3IA1A 1CQHA 1U87A 1FAAA 1YEXA 2D2ZA 4YQUA 1RQMA 2EFDA 4AI6A 3CSJA 5DALA 3F4TA 2YANA 4N10A 4TRXA 4XRAA 2YWNA 2G2QA 2HI7A 2HQTA 5DQSA 1RW1A 2F8FA 5BMUB 3G7YA 3PH9A 1G7EA 2IMEA 2R6KA 4ML1A 3TOTA 1FVJA 2DJ3A 3RPNA 4LL1B 4WF4A 17GSA 4TR4A 1F3AA 1B4QA 2L59A 2DC5A 2L6DA 1SL1B 3H93A 2CT6A 1BEDA 2TIRA 3Q74A 3ZZXA 5ID2B 3O76A 1HNAA 4ZBAA 4BVXB 4K9ZA 3EC3A 2CZ3A 1Z3EA 2OE1A 1A2MA 2LNTA 1FG4A 2CV4A 4PQ1A 2L6CA 2J9HA 5COHA 1FOHA 2HLSA 1AUCA 3GUSA 7GSSA 5IMAA 9GSSA 4MMMA 2MMZA 8GSSA 2KP2A 3TRXA 1NW2A 3KM6A 5KN3A 1OYJA 4CHSA 2P31A 4NPBA 4KNDA 5DJMA 4GQCA 4FYCA 1ZYNA 4GRFA 4HU9A 2A4HA 2H73A 1BJXA 6GSYA 3ZFLA 1PGTA 3APSA 2V6OA 2R0CA 4MK3A 1MTCA 3MDKA 1O85A 1THOA 1XVWA 1SJIA 3GV1A 1XWKA 3IAS2 1YY7A 5HR1A 1WP0A 5G2ZA 4EF0A 1GH2A 4I2TA 3A2WA 3HJPA 2RIIA 2GS3A 1TK8B 4MZCA 3FEUA 1TU7A 2N5FA 1ZL9A 4IJ3A 1WIKA 2HZFA 2H72A 3G7JA 4GSNA 1O73A 1Z7RA 5G30A 4TR1B 2VLUA 1XW5A 4AKGA 5ECKB 4FQUA 3ERGA 3IAM2 1GLPA 4XRDA 4JU5A 2VD0A 3QAWA 3WGEA 5CNWA 1V98A 2VOCA 4W66A 1PKWA 2N5BA 2QA1A 1U3IA 3HKRA 3QR6A 2KOKA 2HSNB 1SYRA 4MPGA 2H75A 4FYUA 1ACVA 4IBPA 4AGSA 4IELA 3G7IA 3D6IA 2IPAA 2WFCA 3WYWA 1NM3A 2WZ9A 2AJQB 2LSTA 4OCEA 1V2AA 2A2RA 3FHKA 5IPGA 4POLA 2LQQA 4PX1A 2X8GA 3CTFA 4ZB6A 4I8BA 5J5NA 5G31A 3H4KA 3L78A 1YZXA 4HOJA 5IMCA 5ECNB 5E59A 1ERTA 3ZMKA 5F0GA 1ABAA 1VF3A 2YWOA 5ELGA 3D21A 3BBYA 1VF4A 1SKSB 2F3MA 2OADA 6GSSA 1Z5YE 2X99A 3U6VA 1UVZA 2B3SA 1MDJA 3O3TA 4DSSB 4RQRA 3QAVA 1ST9A 5HFKA 4KB3A 4XTSA 5C04A 2VL9A 5ECHB 3GTUA 2YZHA 2DKHA 1FO5A 3ISOA 2XC2A 2QKEA 3PGTA 1AXDA 5G5FA 2KUCA 2ZUPA 5GSSA 4HZ4A 4IKHA 4I97A 5BMUA 1YEPA 3MYDA 3Q6OA 4GF0A 4GTUA 3GN3A 2PWJA 2OT3A 1GUHA 1YKCA 4ZL8A 4PUAA 1EOHA 2FHEA 2IFQB 4ICYA 3ZLPA 4L8EA 2H0IA 2I3YA 1XWGA 1ZGNA 4BA7A 4V2MA 5ID2A 2R4VA 2HZEB 4BVXA 3GH9A 3EYTA 4MH2A 1MD3A 1DBYA 3HMJG 2NPBA 4K0GA 1XWAA 1GL8A 4GLTA 2A2PA 4ECBA 2UV8G 5IMZA 4HQSA 3RPPA 1I9DA 4F2IA 1TK0B 3S9FA 4ISDA 2FWEA 4D73B 5LNKe 3MNGA 2R2JA 2CX4A 4XCSA 1WJKA 1R4WA 1GTUA 2GLRA 4V1Ap 20GSA 4RUVA 1OE7A 3IOSA 5GSTA 4NV5A 4K2DA 1T4YA 3C73A 4TXOB 5CREA 3CSIA 2GT5A 1S3CA 1OC9A 4P3YB 3V1WA 2LJRA 3HJMA 4CDOA 3GKXA 4I6XA 4K0NA 2H6XA 4H86A 3UBKA 4MA9A 3N5OA 3LYPA 1BYEA 4ZB7A 3AY8A 1Q4JA 5GAPD 3DIEA 1B48A 5ECQB 1NHYA 4AJ7A 3IDVA 4K1FA 4EVMA 4IN0A 2E2MA 3Q18A 5JWQB 3P90A 3LYKA 4TR1A 2GZYA 1UC7A 1WMJA 4ACSA 3F0IA 2R0PA 4K2XA 1B4PA 2GSRA 4NXIA 1HNBA 3IXRA 3D4MA 1TDIA 1I5GA 3CYNA 5ECSA 1K0DA 2HSNA 5JWOB 5BRTA 3KTBA 3LSZA 3VURA 2WULA 4JR4A 3KMOA 5G1LA 3SWLA 2WCIA 5DQYA 5J40A 3M3MA 2VKZG 4FH8A 2LRTA 3F6DA 3HZ8A 2A4VA 1ZCPA 2OBKA 1X9MB 1TRWA 5KOXA 4ZBDA 3IV4A 3HCZA 5B6NA 3GHAA 2KP1A 2H70A 3GURA 3TGZA 4TR3A 1AQWA 5F06A 2VD1A 3LORA 1HD2A 1A23A 1EZKA 4WKWA 3PR8A 1YVLA 3CBUA 3UVTA 4KA0A 4O5RA 1GWCA 1SK0A 3TKRA 2FNOA 3L9UA 4DSSA 2C0DA 2B7JA 4GDFA 3L9VA 1X5EA 1B9XC 3GKKA 3IC8A 4ZILA 4TVEA 4EUYA 2X4AA 2WDUA 4BPYA 3IPZA 5HFGA 2IWTA 2I81A 3UARA 3TJJA 4V2NA 1AQVA 4KDYA 4F03A 3KP9A 4OCFA 1BX9A 2DLXA 5DAKB 5DCHA 4MCUA 2FY6A 1WE0A 4PNFA 3QDNA 4N3ZA 3GKNA 3BCKA 3GX0A 2C8UA 3RDWA 2EIOA 1ZZYA 2MMAA 2GVPA 4ECJA 2K18A 3HJOA 2M72A 3KEBA 3KH7A 5DCGA 19GSA 1PRXA 3WT1A 1B9YC 1TXUA 4XS1A 1Z9HA 5DJLA 2HZEA 4ECCA 1F2EA 2C3TA 1GNEA 5J4VA 1EV9A 2HT9A 3J7Yb 3APQA 4MF6A 4RQXA 3KMNA 4KDXA 1AQXA 2H76A 3CTGA 1S3DA 2H01A 5A4UA 4NWYA 2E2GA 2R0GA 3GL5A 5DBQA 2C0FA 2LQOA 2H30A 4DSQA 2PVQA 1N25A 3MIXA 3MWHA 4G19A 4TXOA 1XWBA 5J3RA 4O92A 4N30A 2YWIA 3GNJA 4IJIA 4TW5A 1EP7A 1T3BA 5J9CA 2XPDA 3PINA 1H4OA 1G7OA 1C72A 2ON7A 4GQFA 4AJ6A 2HSMA 4KGIA 2M46A 1GP1A 2NVLA 2P0GA 4E68A 2C0GA 3WGDA 1TU8A 1PSQA 3FZ4A 1YQ1A 3QMXA 4PNGA 4XS4B 5CRWA 5HR3A 1LU4A 3KIJA 5AIVA 3TKSA 5A5HA 3ZIJA 5HQPA 3VI7A 1K0CA 2B5XA 3HD5A 1YKAA 2QA2A 4KSOA 2GSQA 3F3QA 2DMMA 5G1KA 3M1GA 2BMXA 2GT6A 1PL1A 4IHUA 3HA9A 5HR2A 2GTUA 3FKFA 3GSTA 3FZAA 5IMDA 4Z2RA 1SVMA 2GGTA 1YJ6A 4X43A 2LJKA 5B8BA 3ZVJA 4N0VA 2H0GA 1A2JA 5AGYA 2QSIA 4EIQA 4E8EA 4OO5A 3C8EA 2VCQA 4MNNA 2MBSA 1OKTA 1GSQA 2FWGA 3ZITA 5D9TA 4PUFC 4OO4A 4MJCA 2TRCP 4IW9A 5H5SA 4AKHA 1JZOA 3TKQA 1Q98A 5J4YA 2OA7A 2OBIA 4ZB8A 2YP6A 3A2XA 1XXUA 1ZMAA 3ERFA 3EMPA 1U3AA 1YF1A 1B8XA 2P5QA 2CX3A 3HZ4A 4K5RA 1SKRB 2C4JA 4O7HA 1ZYQB 5ECIB 5HR0A 3ME7A 4XHMA 3FR9A 2NTOA 1BAYA 4MDCA 3BD2A 5ELAA 3GH6A 4L0WA 3LWAA 3L9SA 4ECIA 3A5WA 3EU3A 5DAKA 5G5EA 2HNLA 2HSHA 3A2VA 4FO5A 2LJAA 4QL7A 2LUSA 3HVSA 2VLVA 2YNXA 4WF5A 2O87A 3FMWA 2IJYA 3TKSC 4X0XA 1JZRA 2VUPA 3C1SA 2AYTA 4TKYA 1GUKA 3D4TA 1CQGA 2DJ2A 1KTEA 6GSWA 3IBHA 4XS6A 3EPTA 2OACA 2PVOC 1GSYA 5CO3A 5ABRA 2RUFA 14GSA 3HVXA 5CP1A 4KAEA 4ZL7A 22GSA 4EL1A 1DE2A 4QL9A 2HRFA 4HUAA 4CY6A 4Q5NA 2H71A 4LLRA 3O6TA 16GSA 2H1AA 1TP9A 2HRKB 3C7MA 1M9AA 4FYBA 4KCEA 1E6BA 3H8QA 3DYRA 3RAZA 1ML6A 2L4CA 3FZ5A 5DVBA 1DUGA 3UMAA 1V57A 2R3XA 1A2LA 1SYXA 4K6XA 3J7Yk 2VCZA 3OR5A 1U6TA 2VCTA 5A1NB 3L4NA 2JZTA 1J0FA 3VFIA 3F9UA 1H75A 2YJHA 3ZTLA 2JACA 3DKSA 3TB2A 1VRSD 1QFNA 1O8XA 3F4SA 3I9V2 1YDKA 1OE8A 3JCML 3KXOA 2G0FA 4YQMA 2LKUA 1WRYA 1XW9A 3GSSA 1TRSA 4ULXA 2ALBA 1TJDA 3LXTA 3HY2A 3UL3A 2VCXA 2R5GA 5A34B 1K0OA 2RM5A 4OFNA 2K8VA 2CAQA 5JWRB 3SBCA 4RI7A 4LMWA 1A8LA 2X8HA 3VWWA 2H66A 2VL3A 4JE1A 4RI6A 2LS5A 3I43A 4POBA 2MMOA 4NMUA 3TCOA 1ERVA 1TI1A 3KJYA 3UJ1A 1T8EB 3NIVA 4K7IA 1OKDA 5FT3A 3ZIVA 1GUMA 3QAGA 4G0KA 2EIQA 3CWGA 1ZYPA 4GSTA 3DVWA 5B6MA 4AJ8A 2E0QA 3F63A 2NDOA 2GQMA 1BG5A 4G2EA 3LFLA 4BWSA 1QGVA 4O32A 4TOPA 4KCAA 1MDIA 5L71A 3VI5A 1EOGA 4G9HA 1O8WA 1XFLA 5DALB 5JCUA 5EPFA 2Z9SA 2I4AA 3EU4A 2XBQA 4IP1A 4MABA 1GSUA 2AUVA 2OE0A 2H1LA 2O85A 3DD3A 1M2DA 2YJ7A 3LW9A 3DVXA 2H0HA 1MEKA 4IVFA 4YH2A 1M0UA 2H1BA 2YOIA 1JFUA 1HNCA 4BL7B 2YV9A 4LMVA 2IMDA 2C0EA 4DEJA 5J4UA 3GX8A 1UA5A 1F37A 2M80A 4KW6A 3APOA 1TXXA 1J9BA 3TJKA 1WPIA 3IR4A 2FA8A 4OMVA 3QCPA 2IN3A 2QC7A 3IE3A 4HJ2A 2O5VA 4PQHA 2WJUA 5CYYA 4F0CA 3WT2A 3F4RA 2HFDA 2JSYA 1XW6A 5ECMB 3FZ9A 1M2BA 4JEDA 3TRPA 3M9JA 4I5QA 2K6VA 1PX6A 3BOAA 4AKIA 2PERA 1TI3A 4MJAA 5D73A 5INYA 4KF9A 1W89A 3IK7A 2IMIA 4WBRD 3DXBA 5FHIA 1HQOA 2OE3A 2LNSA 2X64A 3I69A 2N5AA 1IYIA 2C3NA 4Z2TA 1W4VA 2JU5A 2P5RA 4IP6A 2X49A 3EMXA 1GULA 1PQNA 5H5QA 2PPTA 1EGOA 4E8HA 2V32A 1S3AA 2VM2A 4ZXGA 2CA8A 5IOWA 1GSSA 1RK4A 1USBA 4JZQA 2O89A 3VWVA 4MJBA 1F9MA 2UZ8A 2E7PA 5F07A 4YQVA 2XPEA 4OFTA 4ML6A 4WBJA 3DEXA 3CMIA 3UVHA 1JLVA 3P8WA 4ILFA 5F05A 1Z6NA 5B8AA 3VWXA 1HYUA 3TDGA 3UAPA 6GSUA 1Y25A 1N2AA 3Q19A 5A1NA 1X9WB 4DVCA 2KHPA 3MAKA 2RLIA 3KH9A 3TKPA 1EWXA 2GSTA 5IPHA 2IFQA 13GSA 2F8AA 4AF2A 3W8JA 4WXTA 1K3LA 4A5PA 2ZNMA 1QK8A 1EEJA 1NHOA 4EDZA 3TJFA 4BWQA 1FVKA 4NHZA 4TR0A 3ZREA 4MZBA 3UIWA 1THXA 2HRNA 1UN2A 3GMFA 2EIRA 5A34A 5D8IA 2REMA 3R2QA 4CW9A 2LRNA 3VPQA 1ILOA 4WEYA 4LL4B 5D9VA 3A3TA 1JZDA 12GSA 4D73A 1SKWB 2PU9C 3VPTA 1A24A 1AIUA 3IK9A 4KX4A 3KGKA 1PN9A 3ZL5A 4KUNA 3FR3A 3ED3A 3QFAC 4JBBA 5KN1A 1XPVA 3KCMA 3F6FA 4G10A 3IRAA 4G0IA 3M8NA 4KDUA 2GDRA 3ZFBA 1SD9A 2HE3A 2OJLA 3KP8A 4EO3A 1V40A 3IHGA 3EWLA 2C3QA 4MP4A 3NZNA 2FUG2 1TW9A 3ERWA 5J47A 3GTUB 2DSAA 3LXZA 3TKSE 2DJ1A 1LJRA 4Q5RA 2FD3A 2PBJA 4LA1A 1GSEA 5AISA 4PGTA 2XHFA 3QD9A 3TRQA 3LEFA 4HDEA 3WD6A 3GFKA 3GIXA 1DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRX A;  1R26 A;  4V1A g;  1V58 A;  5KN0 A;  6GSV A;  3FYG A;  3PPU A;  3R3E A;  1ZYE A;  4GCI A;  5KN2 A;  2WB9 A;  2V41 A;  2AAW A;  4BL7 A;  2JZS A;  5J41 A;  2OKA A;  11GS A;  2H1D A;  4PQI A;  2VL2 A;  4F0B A;  1XIY A;  3L0H A;  4YAV A;  5EVO A;  2CVK A;  2WRT A;  1QQ2 A;  1R5P A;  1BQ7 A;  2VM1 A;  4OWY A;  2YWM A;  2ES7 A;  2DML A;  3P7X A;  3CRT A;  5LCZ A;  4JR6 A;  1SJZ A;  2V1M A;  2VAF A;  1VGL A;  1K3Y A;  1PD2 1;  1JLW A;  3FR6 A;  1K0A A;  1PX7 A;  5B7C A;  3QOU A;  1KBN A;  4K8M A;  4ZB9 A;  3HXS A;  4K7O A;  2DBC A;  3H79 A;  2TRX A;  2GQL A;  1JHB A;  5D9W A;  5GZZ B;  2ZCT A;  2IMK A;  1XCC A;  2GZP A;  4EDY A;  4HZ2 A;  1F6M C;  1G0T A;  1AC1 A;  4DSR A;  3ZML A;  4PUR A;  1K0M A;  2KLX A;  2LEG A;  4GXZ A;  2PUK C;  3ZVJ D;  3HDC A;  1EGR A;  2DJK A;  5IO2 A;  5D96 A;  3VLN A;  2VCV A;  5J9B A;  1EP8 A;  2F9S A;  18GS A;  4BVY B;  1TKD B;  1OC9 B;  5GAN D;  4KH7 A;  4J56 E;  1AAZ A;  5ENU A;  2H1G A;  4EE0 A;  2O7K A;  1A8Y A;  1XBS A;  1GTA A;  1QMV A;  1YF0 A;  4HI7 A;  1M7T A;  2IL3 A;  1ON4 A;  3GYK A;  1FB6 A;  3W8S A;  1SK2 A;  2V6K A;  4EKZ A;  3EIN A;  4F9Z A;  2CAI A;  3RBT A;  2B6M A;  3F3R A;  2I9H A;  2L5O A;  4X1U A;  1F3B A;  1URM A;  5HFI A;  2HSY A;  2YPM A;  2ON5 A;  4J2F A;  1G6Y A;  5KEJ A;  3GA4 A;  4PTS A;  2IMF A;  1O6J A;  1OC8 A;  1K3O A;  1G6W A;  4G0L A;  5ECO B;  2GQK A;  1SL0 B;  3U5R E;  2AHE A;  1TRU A;  1XZO A;  1T4Z A;  3GL3 A;  3M0F A;  2VL2 C;  2JL4 A;  1ZOF A;  4TN8 A;  1EV4 A;  3BJ5 A;  4J57 E;  2AB6 A;  3MSZ A;  1MDK A;  3D22 A;  3VWU A;  3EE2 A;  2GSS A;  2MYG A;  1K0N A;  1PKZ A;  2FA4 A;  1IYH A;  1WWJ A;  4YAP A;  4HU7 A;  4HEA 2;  5H5R A;  2WGR A;  2WS2 A;  2C1Y A;  4OD7 A;  4L5L A;  2J23 A;  5IOX A;  3LGC A;  1R5A A;  2LV3 A;  1M9B A;  4QQ7 A;  1TOF A;  2FWF A;  1O81 A;  4WET A;  2DIZ A;  4GSS A;  3UOM A;  1SEN A;  3IHQ A;  2JZR A;  2H6Z A;  3D0Z A;  3GRX A;  4HJM A;  3F8U A;  4PXO A;  3QFB C;  4FIW A;  4EC0 A;  2YZU A;  4POK A;  2FWH A;  4KSM A;  4L0U A;  3LQ7 A;  3EVI A;  3N9J A;  1NSW A;  1OVN A;  5F8B A;  1VF2 A;  2HRA A;  4XS4 A;  4F82 A;  3TJB A;  2DJJ A;  2L5L A;  1TTZ A;  2A2S A;  2XBI A;  1TRV A;  1TK5 B;  4MZW A;  6GSX A;  3E3E A;  2H74 A;  4N11 A;  5E4W A;  4EXJ A;  2B5Y A;  2C80 A;  4Q5Q A;  2B5E A;  2FGX A;  1A0F A;  1FW1 A;  3E0U A;  3EUR A;  3GKM A;  4WR4 A;  1LBK A;  3I6A A;  4NV2 A;  2JSZ A;  1Y6E A;  4GWR A;  2X8C A;  5EL8 A;  5FWG A;  3BCI A;  1FHE A;  3LG6 A;  1ERW A;  1U88 A;  2H8L A;  4TXV A;  3KD0 A;  1Z6M A;  3WGX A;  4I2U A;  3RHB A;  1SK1 A;  4IGJ A;  3US3 A;  3UBL A;  2B1K A;  1GTB A;  1X5C A;  2CZ2 A;  1KEB A;  2VLT A;  4HS1 A;  2H6Y A;  1AW9 A;  1SD8 A;  2YCD A;  5CRG A;  2MMN A;  5ECP B;  4POM A;  5IMF A;  3TJG A;  3G9B A;  4BVY A;  1Z7P A;  1EEM A;  3K8N A;  2LTK A;  5ECR B;  2HXK A;  1DSB A;  1X0R A;  3DWV A;  1T1V A;  4OFM A;  3ZYW A;  2GZZ A;  5IM9 A;  2HSM B;  4Z7X A;  3QPM A;  3HVV A;  4MF5 A;  1FOV A;  3FK8 A;  1XOA A;  4L5O A;  2RUE A;  4K7N A;  1M99 A;  4ID0 A;  3UEM A;  1QXH A;  3DRN A;  4HQZ A;  1GNW A;  5AIX A;  4USS A;  2MBT A;  2L57 A;  2AV4 A;  3KZQ A;  1X9S B;  2CVB A;  2IIY A;  2VO4 A;  2EC4 A;  2FCH A;  3VK9 A;  3D5J A;  2BTO T;  1V9W A;  3TUE A;  4NAX A;  2R37 A;  4MLY A;  3RHC A;  2L4Q A;  2VCW A;  2B7K A;  1ERU A;  4ZL9 A;  1XVQ A;  1M2A A;  3IC4 A;  4MPF A;  5AN1 A;  2BJX A;  3C1R A;  5CRD A;  2FLS A;  5ECL B;  2JAD A;  1X5D A;  2NBS A;  3DML A;  1T00 A;  3H1N A;  3CXG A;  1VF1 A;  2HRK A;  4NHW A;  1K0B A;  2YN1 A;  2K8S A;  2O8V B;  3KTL A;  2H19 A;  2PMT A;  1J08 A;  4IQA A;  1WOU A;  3ME8 A;  1N8J A;  4Q5F A;  2RM6 A;  2K9F A;  1SJ6 A;  1FB0 A;  4KE3 A;  4MF7 A;  3FRC A;  1GTI A;  5DDL A;  5D9X A;  2PGT A;  3FW2 A;  4N0Z A;  1OAZ A;  2HYX A;  4JRR A;  5CRH A;  5CAX A;  3TOU A;  1KNG A;  1GSD A;  3DGQ A;  1OC3 A;  4MH3 A;  1PL2 A;  2CQ9 A;  5JCW A;  6GST A;  5LD0 A;  1R7H A;  10GS A;  2YV7 A;  5C00 A;  4ZBB A;  4IS0 A;  1E2Y A;  1A0R P;  2F51 A;  2MZC A;  1SL2 B;  5A4V A;  4MJE A;  1GLQ A;  5IO0 A;  1XWC A;  2V2G A;  4V2L A;  5IIZ A;  5EY6 A;  5A5K A;  3P2A A;  2CVD A;  3NOF A;  4ZIJ A;  5A4W A;  3LJR A;  1T7P B;  3HHV A;  1QUW A;  1JZW A;  1O7U A;  5IMV A;  1GSF A;  1PA3 A;  3C71 A;  2DJ0 A;  2LRC A;  2VIM A;  1XOB A;  1PMT A;  5JCG A;  2DIY A;  1MD4 A;  3HYP A;  3CSH A;  4IQ1 A;  2QGV A;  3CRU A;  5D93 A;  3E9J B;  3M9K A;  2PN8 A;  4XIH A;  3FY7 A;  4WR5 A;  2I1U A;  3W6G A;  5IQY A;  1SU9 A;  2B1L A;  3ZRD A;  3IA1 A;  1CQH A;  1U87 A;  1FAA A;  1YEX A;  2D2Z A;  4YQU A;  1RQM A;  3CSJ A;  5DAL A;  3F4T A;  2YAN A;  4N10 A;  4TRX A;  4XRA A;  2YWN A;  2G2Q A;  2HI7 A;  2HQT A;  5DQS A;  1RW1 A;  2F8F A;  3G7Y A;  3PH9 A;  1G7E A;  2IME A;  2R6K A;  4ML1 A;  3TOT A;  1FVJ A;  2DJ3 A;  3RPN A;  4LL1 B;  4WF4 A;  17GS A;  4TR4 A;  1F3A A;  1B4Q A;  2L59 A;  2DC5 A;  2L6D A;  1SL1 B;  3H93 A;  2CT6 A;  1BED A;  2TIR A;  3Q74 A;  3ZZX A;  5ID2 B;  3O76 A;  1HNA A;  4ZBA A;  4BVX B;  4K9Z A;  3EC3 A;  2CZ3 A;  1Z3E A;  2OE1 A;  1A2M A;  2LNT A;  1FG4 A;  2CV4 A;  4PQ1 A;  2L6C A;  2J9H A;  5COH A;  2HLS A;  1AUC A;  3GUS A;  7GSS A;  5IMA A;  9GSS A;  4MMM A;  2MMZ A;  8GSS A;  2KP2 A;  3TRX A;  1NW2 A;  3KM6 A;  5KN3 A;  1OYJ A;  4CHS A;  2P31 A;  4NPB A;  4KND A;  5DJM A;  4GQC A;  4FYC A;  4GRF A;  4HU9 A;  2H73 A;  1BJX A;  6GSY A;  3ZFL A;  1PGT A;  3APS A;  2V6O A;  4MK3 A;  1MTC A;  3MDK A;  1O85 A;  1THO A;  1XVW A;  1SJI A;  3GV1 A;  1XWK A;  3IAS 2;  1YY7 A;  5HR1 A;  1WP0 A;  5G2Z A;  4EF0 A;  1GH2 A;  4I2T A;  3A2W A;  3HJP A;  2RII A;  2GS3 A;  1TK8 B;  4MZC A;  3FEU A;  1TU7 A;  2N5F A;  1ZL9 A;  4IJ3 A;  1WIK A;  2HZF A;  2H72 A;  3G7J A;  4GSN A;  1O73 A;  1Z7R A;  5G30 A;  4TR1 B;  2VLU A;  1XW5 A;  5ECK B;  4FQU A;  3ERG A;  3IAM 2;  1GLP A;  4XRD A;  4JU5 A;  2VD0 A;  3QAW A;  3WGE A;  5CNW A;  1V98 A;  2VOC A;  1PKW A;  2N5B A;  1U3I A;  3HKR A;  3QR6 A;  2KOK A;  2HSN B;  1SYR A;  4MPG A;  2H75 A;  4FYU A;  1ACV A;  4IBP A;  4AGS A;  4IEL A;  3G7I A;  3D6I A;  2IPA A;  2WFC A;  3WYW A;  1NM3 A;  2WZ9 A;  2AJQ B;  2LST A;  4OCE A;  1V2A A;  2A2R A;  3FHK A;  5IPG A;  4POL A;  2LQQ A;  4PX1 A;  2X8G A;  3CTF A;  4ZB6 A;  4I8B A;  5J5N A;  5G31 A;  3H4K A;  3L78 A;  1YZX A;  4HOJ A;  5IMC A;  5ECN B;  5E59 A;  1ERT A;  3ZMK A;  5F0G A;  1ABA A;  1VF3 A;  2YWO A;  5ELG A;  3D21 A;  3BBY A;  1VF4 A;  1SKS B;  2F3M A;  2OAD A;  6GSS A;  1Z5Y E;  2X99 A;  3U6V A;  1UVZ A;  2B3S A;  1MDJ A;  3O3T A;  4DSS B;  4RQR A;  3QAV A;  1ST9 A;  5HFK A;  4KB3 A;  4XTS A;  5C04 A;  2VL9 A;  5ECH B;  3GTU A;  2YZH A;  1FO5 A;  3ISO A;  2XC2 A;  2QKE A;  3PGT A;  1AXD A;  5G5F A;  2KUC A;  2ZUP A;  5GSS A;  4HZ4 A;  4IKH A;  4I97 A;  5BMU A;  1YEP A;  3Q6O A;  4GF0 A;  4GTU A;  3GN3 A;  2PWJ A;  1GUH A;  1YKC A;  4ZL8 A;  4PUA A;  1EOH A;  2FHE A;  2IFQ B;  3ZLP A;  4L8E A;  2H0I A;  2I3Y A;  1XWG A;  1ZGN A;  4BA7 A;  4V2M A;  5ID2 A;  2R4V A;  2HZE B;  4BVX A;  3GH9 A;  3EYT A;  4MH2 A;  1MD3 A;  1DBY A;  2NPB A;  4K0G A;  1XWA A;  1GL8 A;  4GLT A;  4ECB A;  5IMZ A;  4HQS A;  3RPP A;  1I9D A;  4F2I A;  1TK0 B;  3S9F A;  4ISD A;  2FWE A;  4D73 B;  5LNK e;  3MNG A;  2R2J A;  2CX4 A;  4XCS A;  1WJK A;  1R4W A;  1GTU A;  2GLR A;  4V1A p;  20GS A;  4RUV A;  1OE7 A;  3IOS A;  5GST A;  4NV5 A;  4K2D A;  1T4Y A;  3C73 A;  4TXO B;  5CRE A;  3CSI A;  2GT5 A;  1S3C A;  1OC9 A;  4P3Y B;  3V1W A;  2LJR A;  3HJM A;  4CDO A;  3GKX A;  4I6X A;  4K0N A;  2H6X A;  4H86 A;  3UBK A;  4MA9 A;  3N5O A;  3LYP A;  1BYE A;  3AY8 A;  1Q4J A;  5GAP D;  3DIE A;  1B48 A;  5ECQ B;  1NHY A;  4AJ7 A;  3IDV A;  4K1F A;  4EVM A;  4IN0 A;  2E2M A;  3Q18 A;  5JWQ B;  3P90 A;  3LYK A;  4TR1 A;  2GZY A;  1UC7 A;  1WMJ A;  4ACS A;  3F0I A;  1B4P A;  2GSR A;  4NXI A;  1HNB A;  3IXR A;  3D4M A;  1TDI A;  1I5G A;  3CYN A;  5ECS A;  1K0D A;  5JWO B;  3KTB A;  3LSZ A;  3VUR A;  2WUL A;  4JR4 A;  3KMO A;  5G1L A;  3SWL A;  2WCI A;  5DQY A;  3M3M A;  4FH8 A;  2LRT A;  3F6D A;  3HZ8 A;  2A4V A;  1ZCP A;  2OBK A;  1X9M B;  1TRW A;  4ZBD A;  3IV4 A;  3HCZ A;  5B6N A;  3GHA A;  2KP1 A;  2H70 A;  3GUR A;  3TGZ A;  4TR3 A;  1AQW A;  5F06 A;  2VD1 A;  3LOR A;  1HD2 A;  1A23 A;  1EZK A;  4WKW A;  3PR8 A;  3CBU A;  3UVT A;  4KA0 A;  4O5R A;  1GWC A;  1SK0 A;  3TKR A;  2FNO A;  3L9U A;  4DSS A;  2C0D A;  2B7J A;  3L9V A;  1X5E A;  1B9X C;  3GKK A;  3IC8 A;  4ZIL A;  4TVE A;  4EUY A;  2WDU A;  4BPY A;  3IPZ A;  5HFG A;  2IWT A;  2I81 A;  3UAR A;  3TJJ A;  4V2N A;  1AQV A;  4KDY A;  4F03 A;  3KP9 A;  4OCF A;  1BX9 A;  2DLX A;  5DAK B;  5DCH A;  4MCU A;  2FY6 A;  1WE0 A;  4PNF A;  3QDN A;  3GKN A;  3BCK A;  3GX0 A;  2C8U A;  3RDW A;  2EIO A;  1ZZY A;  2MMA A;  2GVP A;  4ECJ A;  2K18 A;  3HJO A;  2M72 A;  3KEB A;  3KH7 A;  5DCG A;  19GS A;  1PRX A;  3WT1 A;  1B9Y C;  4XS1 A;  1Z9H A;  5DJL A;  2HZE A;  4ECC A;  1F2E A;  2C3T A;  1GNE A;  1EV9 A;  2HT9 A;  3J7Y b;  3APQ A;  4MF6 A;  4RQX A;  3KMN A;  4KDX A;  1AQX A;  2H76 A;  3CTG A;  1S3D A;  2H01 A;  5A4U A;  4NWY A;  2E2G A;  3GL5 A;  5DBQ A;  2C0F A;  2LQO A;  2H30 A;  4DSQ A;  2PVQ A;  3MWH A;  4G19 A;  4TXO A;  1XWB A;  5J3R A;  4O92 A;  4N30 A;  2YWI A;  3GNJ A;  4IJI A;  4TW5 A;  1EP7 A;  1T3B A;  5J9C A;  2XPD A;  3PIN A;  1H4O A;  1G7O A;  4GQF A;  1C72 A;  2ON7 A;  4AJ6 A;  2HSM A;  4KGI A;  2M46 A;  1GP1 A;  2NVL A;  2P0G A;  2C0G A;  3WGD A;  1TU8 A;  1PSQ A;  3FZ4 A;  1YQ1 A;  3QMX A;  4PNG A;  4XS4 B;  5CRW A;  5HR3 A;  1LU4 A;  3KIJ A;  5AIV A;  3TKS A;  3ZIJ A;  5HQP A;  3VI7 A;  1K0C A;  2B5X A;  3HD5 A;  1YKA A;  4KSO A;  2GSQ A;  3F3Q A;  2DMM A;  5G1K A;  3M1G A;  2BMX A;  2GT6 A;  1PL1 A;  4IHU A;  3HA9 A;  5HR2 A;  2GTU A;  3FKF A;  3GST A;  3FZA A;  5IMD A;  2GGT A;  1YJ6 A;  4X43 A;  2LJK A;  5B8B A;  3ZVJ A;  4N0V A;  2H0G A;  1A2J A;  5AGY A;  2QSI A;  4E8E A;  4OO5 A;  3C8E A;  2VCQ A;  2MBS A;  1OKT A;  1GSQ A;  2FWG A;  3ZIT A;  5D9T A;  4PUF C;  4OO4 A;  4MJC A;  2TRC P;  4IW9 A;  5H5S A;  1JZO A;  3TKQ A;  1Q98 A;  2OA7 A;  2OBI A;  4ZB8 A;  2YP6 A;  3A2X A;  1XXU A;  1ZMA A;  3ERF A;  3EMP A;  1U3A A;  1YF1 A;  1B8X A;  2P5Q A;  2CX3 A;  3HZ4 A;  1SKR B;  2C4J A;  4O7H A;  1ZYQ B;  5ECI B;  5HR0 A;  3ME7 A;  4XHM A;  3FR9 A;  2NTO A;  1BAY A;  4MDC A;  3BD2 A;  5ELA A;  3GH6 A;  4L0W A;  3LWA A;  3L9S A;  4ECI A;  3A5W A;  3EU3 A;  5DAK A;  5G5E A;  2HNL A;  2HSH A;  3A2V A;  4FO5 A;  2LJA A;  4QL7 A;  2LUS A;  3HVS A;  2VLV A;  2YNX A;  4WF5 A;  2O87 A;  2IJY A;  3TKS C;  4X0X A;  1JZR A;  2VUP A;  3C1S A;  2AYT A;  4TKY A;  1GUK A;  3D4T A;  1CQG A;  2DJ2 A;  1KTE A;  6GSW A;  3IBH A;  4XS6 A;  2OAC A;  2PVO C;  1GSY A;  5CO3 A;  5ABR A;  2RUF A;  14GS A;  3HVX A;  5CP1 A;  4KAE A;  4ZL7 A;  22GS A;  4EL1 A;  1DE2 A;  4QL9 A;  2HRF A;  4HUA A;  4Q5N A;  2H71 A;  4LLR A;  3O6T A;  16GS A;  2H1A A;  1TP9 A;  2HRK B;  3C7M A;  1M9A A;  4FYB A;  4KCE A;  1E6B A;  3H8Q A;  3DYR A;  3RAZ A;  1ML6 A;  2L4C A;  3FZ5 A;  5DVB A;  1DUG A;  3UMA A;  1V57 A;  2R3X A;  1A2L A;  1SYX A;  4K6X A;  3J7Y k;  2VCZ A;  3OR5 A;  1U6T A;  2VCT A;  3L4N A;  2JZT A;  1J0F A;  3VFI A;  3F9U A;  1H75 A;  2YJH A;  3ZTL A;  2JAC A;  3DKS A;  3TB2 A;  1VRS D;  1QFN A;  1O8X A;  3F4S A;  3I9V 2;  1YDK A;  1OE8 A;  3JCM L;  3KXO A;  2G0F A;  4YQM A;  2LKU A;  1WRY A;  1XW9 A;  3GSS A;  1TRS A;  4ULX A;  2ALB A;  1TJD A;  3LXT A;  3HY2 A;  3UL3 A;  2VCX A;  2R5G A;  1K0O A;  2RM5 A;  4OFN A;  2K8V A;  2CAQ A;  5JWR B;  3SBC A;  4RI7 A;  4LMW A;  1A8L A;  2X8H A;  3VWW A;  2H66 A;  2VL3 A;  4JE1 A;  4RI6 A;  2LS5 A;  3I43 A;  4POB A;  2MMO A;  4NMU A;  3TCO A;  1ERV A;  1TI1 A;  3KJY A;  3UJ1 A;  1T8E B;  3NIV A;  4K7I A;  1OKD A;  5FT3 A;  3ZIV A;  1GUM A;  3QAG A;  4G0K A;  2EIQ A;  4GST A;  3DVW A;  5B6M A;  4AJ8 A;  2E0Q A;  3F63 A;  2NDO A;  2GQM A;  1BG5 A;  4G2E A;  3LFL A;  4BWS A;  1QGV A;  4O32 A;  4TOP A;  4KCA A;  1MDI A;  5L71 A;  3VI5 A;  1EOG A;  4G9H A;  1O8W A;  1XFL A;  5DAL B;  5JCU A;  5EPF A;  2Z9S A;  2I4A A;  3EU4 A;  2XBQ A;  4IP1 A;  4MAB A;  1GSU A;  2AUV A;  2OE0 A;  2O85 A;  3DD3 A;  1M2D A;  2YJ7 A;  3DVX A;  2H0H A;  1MEK A;  4IVF A;  4YH2 A;  1M0U A;  2H1B A;  2YOI A;  1JFU A;  1HNC A;  4BL7 B;  2YV9 A;  4LMV A;  2IMD A;  2C0E A;  4DEJ A;  5J4U A;  3GX8 A;  1UA5 A;  1F37 A;  2M80 A;  4KW6 A;  3APO A;  1TXX A;  1J9B A;  3TJK A;  1WPI A;  3IR4 A;  2FA8 A;  4OMV A;  3QCP A;  2IN3 A;  2QC7 A;  3IE3 A;  4HJ2 A;  4PQH A;  2WJU A;  5CYY A;  4F0C A;  3WT2 A;  3F4R A;  2HFD A;  2JSY A;  1XW6 A;  5ECM B;  3FZ9 A;  1M2B A;  4JED A;  3TRP A;  3M9J A;  4I5Q A;  2K6V A;  1PX6 A;  3BOA A;  1TI3 A;  2PER A;  4MJA A;  5D73 A;  5INY A;  4KF9 A;  1W89 A;  3IK7 A;  2IMI A;  4WBR D;  3DXB A;  5FHI A;  1HQO A;  2OE3 A;  2LNS A;  2X64 A;  3I69 A;  2N5A A;  1IYI A;  2C3N A;  1W4V A;  2JU5 A;  2P5R A;  4IP6 A;  3EMX A;  1GUL A;  1PQN A;  5H5Q A;  2PPT A;  1EGO A;  4E8H A;  2V32 A;  1S3A A;  2VM2 A;  4ZXG A;  2CA8 A;  5IOW A;  1GSS A;  1RK4 A;  1USB A;  4JZQ A;  2O89 A;  3VWV A;  4MJB A;  1F9M A;  2UZ8 A;  2E7P A;  5F07 A;  4YQV A;  2XPE A;  4OFT A;  4ML6 A;  4WBJ A;  3DEX A;  3CMI A;  3UVH A;  1JLV A;  3P8W A;  4ILF A;  5F05 A;  1Z6N A;  5B8A A;  3VWX A;  1HYU A;  3TDG A;  3UAP A;  6GSU A;  1Y25 A;  1N2A A;  3Q19 A;  1X9W B;  4DVC A;  2KHP A;  3MAK A;  2RLI A;  3KH9 A;  3TKP A;  1EWX A;  2GST A;  5IPH A;  2IFQ A;  13GS A;  2F8A A;  4AF2 A;  3W8J A;  4WXT A;  1K3L A;  2ZNM A;  1QK8 A;  1EEJ A;  1NHO A;  4EDZ A;  3TJF A;  4BWQ A;  1FVK A;  4NHZ A;  4TR0 A;  3ZRE A;  4MZB A;  3UIW A;  1THX A;  2HRN A;  1UN2 A;  3GMF A;  2EIR A;  5D8I A;  2REM A;  3R2Q A;  4CW9 A;  2LRN A;  3VPQ A;  1ILO A;  4WEY A;  4LL4 B;  5D9V A;  3A3T A;  1JZD A;  12GS A;  4D73 A;  1SKW B;  2PU9 C;  3VPT A;  1A24 A;  1AIU A;  3IK9 A;  4KX4 A;  3KGK A;  1PN9 A;  3ZL5 A;  4KUN A;  3FR3 A;  3ED3 A;  3QFA C;  4JBB A;  5KN1 A;  1XPV A;  3KCM A;  3F6F A;  4G10 A;  3IRA A;  4G0I A;  3M8N A;  4KDU A;  2GDR A;  3ZFB A;  1SD9 A;  2HE3 A;  2OJL A;  3KP8 A;  4EO3 A;  1V40 A;  3EWL A;  2C3Q A;  4MP4 A;  3NZN A;  2FUG 2;  1TW9 A;  3ERW A;  3GTU B;  2DSA A;  3LXZ A;  3TKS E;  2DJ1 A;  1LJR A;  4Q5R A;  2FD3 A;  2PBJ A;  4LA1 A;  1GSE A;  5AIS A;  4PGT A;  2XHF A;  3QD9 A;  3TRQ A;  3LEF A;  4HDE A;  3WD6 A;  3GFK A;  3GIX A;  1DE1 A; 
#chains in the Genus database with same CATH topology
 1GRX A;  1R26 A;  4V1A g;  1V58 A;  5KN0 A;  6GSV A;  3FYG A;  3PPU A;  3R3E A;  1ZYE A;  4GCI A;  5KN2 A;  2WB9 A;  2V41 A;  2AAW A;  4BL7 A;  2JZS A;  5J41 A;  2OKA A;  11GS A;  2H1D A;  4PQI A;  2VL2 A;  4F0B A;  1XIY A;  3L0H A;  4YAV A;  4YKF A;  5EVO A;  2CVK A;  2WRT A;  1QQ2 A;  1R5P A;  1BQ7 A;  2VM1 A;  4OWY A;  2WW3 A;  2YWM A;  2ES7 A;  2DML A;  3P7X A;  3CRT A;  5LCZ A;  4JR6 A;  1BF5 A;  1SJZ A;  2V1M A;  2VAF A;  1VGL A;  1K3Y A;  1PD2 1;  1JLW A;  3FR6 A;  1K0A A;  1PX7 A;  5B7C A;  3QOU A;  1KBN A;  4K8M A;  4ZB9 A;  3HXS A;  4K7O A;  2DBC A;  3H79 A;  2TRX A;  2GQL A;  1JHB A;  5D9W A;  5GZZ B;  2ZCT A;  2IMK A;  1XCC A;  2GZP A;  4EDY A;  4HZ2 A;  1F6M C;  1G0T A;  1AC1 A;  4DSR A;  3ZML A;  2EFE A;  4HSC X;  4PUR A;  1K0M A;  2KLX A;  2LEG A;  4GXZ A;  2PUK C;  3ZVJ D;  3HDC A;  1EGR A;  2DJK A;  2EFH A;  5IO2 A;  5D96 A;  3VLN A;  2VCV A;  5J9B A;  1EP8 A;  2F9S A;  18GS A;  4BVY B;  1TKD B;  4PI2 C;  1OC9 B;  5GAN D;  4KH7 A;  1BG1 A;  4J56 E;  1AAZ A;  5ENU A;  2H1G A;  4EE0 A;  2O7K A;  1A8Y A;  1XBS A;  1GTA A;  4G01 A;  1PFO A;  1QMV A;  1YF0 A;  4HI7 A;  1M7T A;  2IL3 A;  4YKG A;  1ON4 A;  3GYK A;  1FB6 A;  3W8S A;  1SK2 A;  2V6K A;  4EKZ A;  3EIN A;  4F9Z A;  2CAI A;  3RBT A;  2B6M A;  3F3R A;  2I9H A;  2L5O A;  4X1U A;  1F3B A;  1URM A;  5HFI A;  2HSY A;  2YPM A;  4O5U A;  2ON5 A;  4J2F A;  1G6Y A;  5KEJ A;  3GA4 A;  4PTS A;  2IMF A;  1O6J A;  1OC8 A;  1K3O A;  1G6W A;  4G0L A;  5ECO B;  2GQK A;  1SL0 B;  3U5R E;  2AHE A;  1TRU A;  1XZO A;  1T4Z A;  3GL3 A;  3M0F A;  2VL2 C;  1PN0 A;  2JL4 A;  1ZOF A;  4TN8 A;  1EV4 A;  2WW0 A;  3BJ5 A;  4J57 E;  2AB6 A;  3MSZ A;  1MDK A;  2WVX A;  3D22 A;  3VWU A;  3EE2 A;  2GSS A;  2MYG A;  1K0N A;  1PKZ A;  2FA4 A;  1IYH A;  1WWJ A;  4YAP A;  4HU7 A;  4HEA 2;  5H5R A;  2WGR A;  2WS2 A;  2C1Y A;  4OD7 A;  4L5L A;  2J23 A;  4CY8 A;  5IOX A;  3LGC A;  1R5A A;  2LV3 A;  1M9B A;  4QQ7 A;  1TOF A;  2FWF A;  1O81 A;  4WET A;  2DIZ A;  4GSS A;  3UOM A;  1SEN A;  3IHQ A;  2JZR A;  2H6Z A;  3D0Z A;  3GRX A;  4HJM A;  3F8U A;  2EFC A;  4PXO A;  3QFB C;  4FIW A;  4EC0 A;  2YZU A;  4POK A;  2FWH A;  4KSM A;  4L0U A;  3LQ7 A;  3EVI A;  3N9J A;  1NSW A;  1OVN A;  5F8B A;  1VF2 A;  2HRA A;  4XS4 A;  4F82 A;  3TJB A;  2DJJ A;  4X4J A;  2L5L A;  1TTZ A;  4Z2U A;  2A2S A;  2XBI A;  1TRV A;  1TK5 B;  4MZW A;  6GSX A;  1SVO A;  3E3E A;  2H74 A;  4N11 A;  5E4W A;  4EXJ A;  2B5Y A;  2C80 A;  4Q5Q A;  2B5E A;  2FGX A;  1A0F A;  1FW1 A;  3E0U A;  3EUR A;  3GKM A;  4WR4 A;  1LBK A;  3I6A A;  4NV2 A;  2JSZ A;  1Y6E A;  4GWR A;  2X8C A;  5EL8 A;  5FWG A;  3BCI A;  1FHE A;  3LG6 A;  1ERW A;  1U88 A;  2H8L A;  4TXV A;  3KD0 A;  1Z6M A;  3WGX A;  4I2U A;  3RHB A;  1SK1 A;  4IGJ A;  3US3 A;  3UBL A;  1YEW C;  2B1K A;  1GTB A;  1X5C A;  2CZ2 A;  1KEB A;  2VLT A;  4HS1 A;  2H6Y A;  1AW9 A;  1SD8 A;  2YCD A;  5CRG A;  2MMN A;  5ECP B;  4POM A;  5IMF A;  3TJG A;  1Y1U A;  4BVY A;  3G9B A;  1Z7P A;  1EEM A;  3K8N A;  2LTK A;  5ECR B;  2HXK A;  1DSB A;  1X0R A;  3DWV A;  4O5Q A;  1T1V A;  4OFM A;  3ZYW A;  2GZZ A;  5IM9 A;  2HSM B;  4Z7X A;  3QPM A;  3HVV A;  4MF5 A;  1FOV A;  3FK8 A;  1XOA A;  4L5O A;  2RUE A;  4K7N A;  1M99 A;  4ID0 A;  3UEM A;  1QXH A;  3DRN A;  4HQZ A;  1GNW A;  5AIX A;  4USS A;  2MBT A;  2L57 A;  2AV4 A;  5KOW A;  3KZQ A;  1X9S B;  5A5H B;  2CVB A;  2IIY A;  2VO4 A;  2EC4 A;  2FCH A;  3VK9 A;  3D5J A;  2BTO T;  1V9W A;  3TUE A;  4NAX A;  2R37 A;  4MLY A;  3RHC A;  2L4Q A;  2VCW A;  2B7K A;  1ERU A;  4ZL9 A;  1XVQ A;  1M2A A;  3IC4 A;  4MPF A;  5AN1 A;  2BJX A;  3C1R A;  5CRD A;  2FLS A;  5ECL B;  2JAD A;  1X5D A;  2NBS A;  3DML A;  3A5I A;  1T00 A;  3H1N A;  3CXG A;  4EIP A;  1VF1 A;  2HRK A;  4NHW A;  1K0B A;  2YN1 A;  2K8S A;  2O8V B;  3KTL A;  2H19 A;  4K5S A;  3TU3 B;  2PMT A;  1J08 A;  4IQA A;  1WOU A;  2DKI A;  3ME8 A;  1N8J A;  4QMK A;  4Q5F A;  2RM6 A;  2K9F A;  1SJ6 A;  1FB0 A;  4KE3 A;  4MF7 A;  3FRC A;  1GTI A;  5DDL A;  5D9X A;  2PGT A;  3FW2 A;  4N0Z A;  1OAZ A;  2HYX A;  4JRR A;  5CRH A;  5CAX A;  3TOU A;  1KNG A;  1GSD A;  3DGQ A;  1OC3 A;  4MH3 A;  1PL2 A;  2CQ9 A;  5JCW A;  6GST A;  5LD0 A;  1R7H A;  10GS A;  2YV7 A;  5C00 A;  4ZBB A;  4IS0 A;  1E2Y A;  1A0R P;  2F51 A;  2MZC A;  1SVL A;  1SL2 B;  5A4V A;  4MJE A;  1GLQ A;  5IO0 A;  1XWC A;  2V2G A;  4V2L A;  5IIZ A;  5EY6 A;  5A5K A;  3P2A A;  2CVD A;  2WVY A;  3NOF A;  4AKX B;  5A4W A;  4ZIJ A;  3LJR A;  1T7P B;  3HHV A;  1QUW A;  1JZW A;  1O7U A;  5IMV A;  1GSF A;  1PA3 A;  3C71 A;  2DJ0 A;  2LRC A;  2VIM A;  1XOB A;  1PMT A;  5JCG A;  2DIY A;  1MD4 A;  3HYP A;  3CSH A;  4IQ1 A;  2QGV A;  3CRU A;  5D93 A;  3E9J B;  3M9K A;  2PN8 A;  3RFR C;  3FY7 A;  4XIH A;  4WR5 A;  2I1U A;  3W6G A;  5IQY A;  1SU9 A;  2B1L A;  3ZRD A;  3IA1 A;  1CQH A;  1U87 A;  1FAA A;  1YEX A;  2D2Z A;  4YQU A;  1RQM A;  1M3J A;  2EFD A;  4AI6 A;  3CSJ A;  5DAL A;  3F4T A;  2YAN A;  4N10 A;  4TRX A;  4XRA A;  2YWN A;  2G2Q A;  2HI7 A;  2HQT A;  5DQS A;  1RW1 A;  2F8F A;  5BMU B;  3G7Y A;  3PH9 A;  1G7E A;  2IME A;  2R6K A;  4ML1 A;  3TOT A;  1FVJ A;  2DJ3 A;  3RPN A;  4LL1 B;  4WF4 A;  17GS A;  4TR4 A;  1F3A A;  1B4Q A;  2L59 A;  2DC5 A;  2L6D A;  1SL1 B;  3H93 A;  2CT6 A;  1BED A;  2TIR A;  3Q74 A;  3ZZX A;  5ID2 B;  3O76 A;  1HNA A;  4ZBA A;  4BVX B;  4K9Z A;  3EC3 A;  2CZ3 A;  1Z3E A;  2OE1 A;  1A2M A;  2LNT A;  1FG4 A;  2CV4 A;  4PQ1 A;  2L6C A;  2J9H A;  5COH A;  1FOH A;  2HLS A;  1AUC A;  3GUS A;  7GSS A;  5IMA A;  9GSS A;  4MMM A;  2MMZ A;  8GSS A;  2KP2 A;  3TRX A;  1NW2 A;  3KM6 A;  5KN3 A;  1OYJ A;  4CHS A;  2P31 A;  4NPB A;  4KND A;  5DJM A;  4GQC A;  4FYC A;  1ZYN A;  4GRF A;  4HU9 A;  2A4H A;  2H73 A;  1BJX A;  6GSY A;  3ZFL A;  1PGT A;  3APS A;  2V6O A;  2R0C A;  4MK3 A;  1MTC A;  3MDK A;  1O85 A;  1THO A;  1XVW A;  1SJI A;  3GV1 A;  1XWK A;  3IAS 2;  1YY7 A;  5HR1 A;  1WP0 A;  5G2Z A;  4EF0 A;  1GH2 A;  4I2T A;  3A2W A;  3HJP A;  2RII A;  2GS3 A;  1TK8 B;  4MZC A;  3FEU A;  1TU7 A;  2N5F A;  1ZL9 A;  4IJ3 A;  1WIK A;  2HZF A;  2H72 A;  3G7J A;  4GSN A;  1O73 A;  1Z7R A;  5G30 A;  4TR1 B;  2VLU A;  1XW5 A;  4AKG A;  5ECK B;  4FQU A;  3ERG A;  3IAM 2;  1GLP A;  4XRD A;  4JU5 A;  2VD0 A;  3QAW A;  3WGE A;  5CNW A;  1V98 A;  2VOC A;  4W66 A;  1PKW A;  2N5B A;  2QA1 A;  1U3I A;  3HKR A;  3QR6 A;  2KOK A;  2HSN B;  1SYR A;  4MPG A;  2H75 A;  4FYU A;  1ACV A;  4IBP A;  4AGS A;  4IEL A;  3G7I A;  3D6I A;  2IPA A;  2WFC A;  3WYW A;  1NM3 A;  2WZ9 A;  2AJQ B;  2LST A;  4OCE A;  1V2A A;  2A2R A;  3FHK A;  5IPG A;  4POL A;  2LQQ A;  4PX1 A;  2X8G A;  3CTF A;  4ZB6 A;  4I8B A;  5J5N A;  5G31 A;  3H4K A;  3L78 A;  1YZX A;  4HOJ A;  5IMC A;  5ECN B;  5E59 A;  1ERT A;  3ZMK A;  5F0G A;  1ABA A;  1VF3 A;  2YWO A;  5ELG A;  3D21 A;  3BBY A;  1VF4 A;  1SKS B;  2F3M A;  2OAD A;  6GSS A;  1Z5Y E;  2X99 A;  3U6V A;  1UVZ A;  2B3S A;  1MDJ A;  3O3T A;  4DSS B;  4RQR A;  3QAV A;  1ST9 A;  5HFK A;  4KB3 A;  4XTS A;  5C04 A;  2VL9 A;  5ECH B;  3GTU A;  2YZH A;  2DKH A;  1FO5 A;  3ISO A;  2XC2 A;  2QKE A;  3PGT A;  1AXD A;  5G5F A;  2KUC A;  2ZUP A;  5GSS A;  4HZ4 A;  4IKH A;  4I97 A;  5BMU A;  1YEP A;  3MYD A;  3Q6O A;  4GF0 A;  1S4B P;  4GTU A;  3GN3 A;  2PWJ A;  2OT3 A;  1GUH A;  1YKC A;  4ZL8 A;  4PUA A;  1EOH A;  2FHE A;  2IFQ B;  4ICY A;  3ZLP A;  4L8E A;  2WZS A;  2H0I A;  2I3Y A;  1XWG A;  1ZGN A;  4BA7 A;  4V2M A;  5ID2 A;  2R4V A;  2HZE B;  4BVX A;  3GH9 A;  3EYT A;  4MH2 A;  1MD3 A;  1DBY A;  3HMJ G;  2NPB A;  4K0G A;  1XWA A;  1GL8 A;  4GLT A;  2A2P A;  4ECB A;  2UV8 G;  5IMZ A;  4HQS A;  3RPP A;  1I9D A;  4F2I A;  1TK0 B;  3S9F A;  4ISD A;  2FWE A;  4D73 B;  5LNK e;  3MNG A;  2R2J A;  2CX4 A;  4XCS A;  1WJK A;  1R4W A;  1GTU A;  2GLR A;  4V1A p;  20GS A;  4RUV A;  1OE7 A;  3IOS A;  5GST A;  4NV5 A;  4K2D A;  1T4Y A;  3C73 A;  4TXO B;  5CRE A;  3CSI A;  2O36 A;  2GT5 A;  1S3C A;  1OC9 A;  4P3Y B;  3V1W A;  2LJR A;  3HJM A;  4CDO A;  3GKX A;  4I6X A;  4K0N A;  2H6X A;  4H86 A;  3UBK A;  4MA9 A;  3N5O A;  3LYP A;  1BYE A;  4ZB7 A;  3AY8 A;  1Q4J A;  5GAP D;  3DIE A;  1B48 A;  5ECQ B;  1NHY A;  4AJ7 A;  3IDV A;  4K1F A;  4EVM A;  4IN0 A;  2E2M A;  3Q18 A;  5JWQ B;  3HVN A;  3P90 A;  3LYK A;  4TR1 A;  2GZY A;  1UC7 A;  1WMJ A;  4ACS A;  2WVZ A;  3F0I A;  2R0P A;  4K2X A;  1B4P A;  2GSR A;  4NXI A;  1HNB A;  3IXR A;  3D4M A;  1TDI A;  1I5G A;  3CYN A;  5ECS A;  1K0D A;  2HSN A;  5JWO B;  5BRT A;  3KTB A;  3LSZ A;  3VUR A;  2WUL A;  4JR4 A;  3KMO A;  5G1L A;  3SWL A;  2WCI A;  5DQY A;  5J40 A;  3M3M A;  2VKZ G;  4FH8 A;  2LRT A;  3F6D A;  3HZ8 A;  2A4V A;  1ZCP A;  2OBK A;  1X9M B;  1TRW A;  5KOX A;  4ZBD A;  3IV4 A;  3HCZ A;  5B6N A;  3GHA A;  2KP1 A;  2H70 A;  3GUR A;  3TGZ A;  4TR3 A;  1AQW A;  5F06 A;  2VD1 A;  3LOR A;  1HD2 A;  1A23 A;  1EZK A;  4WKW A;  3PR8 A;  1YVL A;  3CBU A;  3UVT A;  4KA0 A;  4O5R A;  1GWC A;  1SK0 A;  3TKR A;  2FNO A;  3L9U A;  4DSS A;  2C0D A;  2O3E A;  2B7J A;  4GDF A;  3L9V A;  1X5E A;  1B9X C;  3GKK A;  3IC8 A;  4ZIL A;  4TVE A;  4EUY A;  2X4A A;  2WDU A;  4BPY A;  3IPZ A;  5HFG A;  2IWT A;  2I81 A;  3UAR A;  3TJJ A;  4V2N A;  1AQV A;  4KDY A;  4F03 A;  3KP9 A;  4OCF A;  1BX9 A;  2DLX A;  5DAK B;  5DCH A;  4MCU A;  2FY6 A;  1WE0 A;  4PNF A;  3QDN A;  4N3Z A;  3GKN A;  3BCK A;  1XG8 A;  3GX0 A;  2C8U A;  3RDW A;  2EIO A;  1ZZY A;  2MMA A;  2GVP A;  4ECJ A;  3RGB C;  2K18 A;  3HJO A;  2M72 A;  3KEB A;  3KH7 A;  5DCG A;  19GS A;  1PRX A;  3WT1 A;  1B9Y C;  1TXU A;  4XS1 A;  1Z9H A;  5DJL A;  2HZE A;  4ECC A;  1F2E A;  2C3T A;  1GNE A;  5J4V A;  1EV9 A;  1I1I P;  2HT9 A;  3J7Y b;  3APQ A;  4MF6 A;  4RQX A;  3KMN A;  4KDX A;  1AQX A;  2H76 A;  3CTG A;  1S3D A;  2H01 A;  5A4U A;  4NWY A;  2E2G A;  2R0G A;  3GL5 A;  5DBQ A;  2C0F A;  2LQO A;  2H30 A;  4DSQ A;  2PVQ A;  1N25 A;  3MIX A;  3MWH A;  4G19 A;  4TXO A;  1XWB A;  5J3R A;  4O92 A;  4N30 A;  2YWI A;  3GNJ A;  4IJI A;  4TW5 A;  1EP7 A;  1T3B A;  5J9C A;  2XPD A;  3PIN A;  1H4O A;  1G7O A;  1C72 A;  2ON7 A;  4GQF A;  4AJ6 A;  2HSM A;  4KGI A;  2M46 A;  1GP1 A;  2NVL A;  2P0G A;  4E68 A;  2C0G A;  3WGD A;  1TU8 A;  1PSQ A;  3FZ4 A;  1YQ1 A;  3QMX A;  4PNG A;  4XS4 B;  5CRW A;  5HR3 A;  1LU4 A;  3KIJ A;  5AIV A;  3TKS A;  5A5H A;  3ZIJ A;  5HQP A;  3VI7 A;  1K0C A;  2B5X A;  3HD5 A;  1YKA A;  2QA2 A;  4KSO A;  2GSQ A;  3F3Q A;  2DMM A;  5G1K A;  3M1G A;  2BMX A;  2GT6 A;  1PL1 A;  4IHU A;  3HA9 A;  5HR2 A;  2GTU A;  3FKF A;  3GST A;  3FZA A;  5IMD A;  4Z2R A;  1SVM A;  2GGT A;  1YJ6 A;  4X43 A;  2LJK A;  5B8B A;  3ZVJ A;  4N0V A;  2H0G A;  1A2J A;  5AGY A;  2QSI A;  4EIQ A;  4E8E A;  4OO5 A;  3C8E A;  2VCQ A;  4MNN A;  2MBS A;  1OKT A;  1GSQ A;  2FWG A;  3ZIT A;  5D9T A;  4PUF C;  4OO4 A;  4MJC A;  2TRC P;  4IW9 A;  5H5S A;  4AKH A;  1JZO A;  3TKQ A;  1Q98 A;  5J4Y A;  2OA7 A;  2OBI A;  4ZB8 A;  2YP6 A;  3A2X A;  1XXU A;  1ZMA A;  3ERF A;  3EMP A;  1U3A A;  1YF1 A;  1B8X A;  2P5Q A;  2CX3 A;  3HZ4 A;  4K5R A;  1SKR B;  2C4J A;  4O7H A;  1ZYQ B;  5ECI B;  5HR0 A;  3ME7 A;  4XHM A;  3FR9 A;  2NTO A;  1BAY A;  4MDC A;  3BD2 A;  5ELA A;  3GH6 A;  4L0W A;  3LWA A;  3L9S A;  4ECI A;  3A5W A;  3EU3 A;  5DAK A;  5G5E A;  2HNL A;  2HSH A;  3A2V A;  4FO5 A;  2LJA A;  4QL7 A;  2LUS A;  3HVS A;  2VLV A;  2YNX A;  4WF5 A;  2O87 A;  3FMW A;  2IJY A;  3TKS C;  4X0X A;  4BIK A;  1JZR A;  2VUP A;  3C1S A;  2AYT A;  4TKY A;  1GUK A;  3D4T A;  1CQG A;  2DJ2 A;  1KTE A;  6GSW A;  3IBH A;  4XS6 A;  3EPT A;  2OAC A;  2PVO C;  1GSY A;  5CO3 A;  5ABR A;  2RUF A;  14GS A;  3HVX A;  5CP1 A;  4KAE A;  4ZL7 A;  22GS A;  4EL1 A;  1DE2 A;  4QL9 A;  2HRF A;  4HUA A;  4CY6 A;  4Q5N A;  2H71 A;  4LLR A;  3O6T A;  16GS A;  2H1A A;  1TP9 A;  2HRK B;  3C7M A;  1M9A A;  4FYB A;  4KCE A;  1E6B A;  3H8Q A;  3DYR A;  3RAZ A;  1ML6 A;  2L4C A;  3FZ5 A;  5DVB A;  1DUG A;  4PI0 C;  3UMA A;  1V57 A;  2R3X A;  1A2L A;  1SYX A;  4K6X A;  3J7Y k;  2VCZ A;  3OR5 A;  1U6T A;  2VCT A;  5A1N B;  3L4N A;  2JZT A;  1J0F A;  3VFI A;  3F9U A;  1H75 A;  2YJH A;  3ZTL A;  2JAC A;  3DKS A;  3TB2 A;  1VRS D;  1QFN A;  1O8X A;  3F4S A;  3I9V 2;  1YDK A;  1OE8 A;  3JCM L;  3KXO A;  2G0F A;  4YQM A;  2LKU A;  1WRY A;  1XW9 A;  3GSS A;  1TRS A;  4ULX A;  2ALB A;  1TJD A;  3LXT A;  3HY2 A;  3UL3 A;  2VCX A;  2R5G A;  5A34 B;  1K0O A;  2RM5 A;  4OFN A;  2K8V A;  2CAQ A;  5JWR B;  3SBC A;  4RI7 A;  4LMW A;  1A8L A;  2X8H A;  3VWW A;  2H66 A;  2VL3 A;  4JE1 A;  4RI6 A;  2LS5 A;  3I43 A;  4POB A;  2MMO A;  4NMU A;  3TCO A;  1ERV A;  1TI1 A;  3KJY A;  3UJ1 A;  1T8E B;  3NIV A;  4K7I A;  1OKD A;  5FT3 A;  3ZIV A;  1GUM A;  3QAG A;  4G0K A;  2EIQ A;  3CWG A;  1ZYP A;  4GST A;  3DVW A;  5B6M A;  4AJ8 A;  2E0Q A;  3F63 A;  2NDO A;  2GQM A;  1BG5 A;  4G2E A;  3LFL A;  4BWS A;  1QGV A;  4O32 A;  4TOP A;  4KCA A;  1MDI A;  5L71 A;  3VI5 A;  1EOG A;  4G9H A;  1O8W A;  1XFL A;  5DAL B;  5JCU A;  5EPF A;  2Z9S A;  2I4A A;  3EU4 A;  2XBQ A;  4IP1 A;  4MAB A;  1GSU A;  2AUV A;  2OE0 A;  2H1L A;  2O85 A;  3DD3 A;  1M2D A;  2YJ7 A;  3LW9 A;  3DVX A;  2H0H A;  1MEK A;  4IVF A;  4YH2 A;  1M0U A;  2H1B A;  2YOI A;  1JFU A;  1HNC A;  4BL7 B;  2YV9 A;  4LMV A;  2IMD A;  2C0E A;  4DEJ A;  5J4U A;  3GX8 A;  1UA5 A;  1F37 A;  2M80 A;  4KW6 A;  3APO A;  1TXX A;  1J9B A;  3TJK A;  1WPI A;  3IR4 A;  2FA8 A;  4OMV A;  3QCP A;  2IN3 A;  2QC7 A;  3IE3 A;  4HJ2 A;  2O5V A;  4PQH A;  2WJU A;  5CYY A;  4F0C A;  3WT2 A;  3F4R A;  2HFD A;  2JSY A;  1XW6 A;  5ECM B;  3FZ9 A;  1M2B A;  4JED A;  3TRP A;  3M9J A;  4I5Q A;  2K6V A;  1PX6 A;  3BOA A;  4AKI A;  2PER A;  1TI3 A;  4MJA A;  5D73 A;  5INY A;  4KF9 A;  1W89 A;  3IK7 A;  2IMI A;  1S3R A;  4WBR D;  3DXB A;  5FHI A;  1HQO A;  2OE3 A;  2LNS A;  2X64 A;  3I69 A;  2N5A A;  1IYI A;  2C3N A;  4Z2T A;  1W4V A;  2JU5 A;  2P5R A;  4IP6 A;  2X49 A;  3EMX A;  1GUL A;  1PQN A;  5H5Q A;  2PPT A;  1EGO A;  4E8H A;  2V32 A;  1S3A A;  2VM2 A;  4ZXG A;  2CA8 A;  5IOW A;  1GSS A;  1RK4 A;  1USB A;  4JZQ A;  2O89 A;  3VWV A;  4MJB A;  1F9M A;  2UZ8 A;  2E7P A;  5F07 A;  4YQV A;  2XPE A;  4OFT A;  4ML6 A;  4WBJ A;  3DEX A;  3CMI A;  3UVH A;  1JLV A;  3P8W A;  4ILF A;  5F05 A;  1Z6N A;  5B8A A;  3VWX A;  1HYU A;  3TDG A;  3UAP A;  6GSU A;  1Y25 A;  1N2A A;  3Q19 A;  5A1N A;  1X9W B;  4FXY P;  4DVC A;  2KHP A;  3MAK A;  2RLI A;  3KH9 A;  3TKP A;  1EWX A;  2GST A;  5IPH A;  2IFQ A;  13GS A;  2F8A A;  4AF2 A;  3W8J A;  4PHZ C;  4WXT A;  1K3L A;  4A5P A;  2ZNM A;  1QK8 A;  1EEJ A;  1NHO A;  4EDZ A;  3TJF A;  4BWQ A;  1FVK A;  4NHZ A;  4TR0 A;  3ZRE A;  4MZB A;  3UIW A;  1THX A;  2HRN A;  1UN2 A;  3GMF A;  2EIR A;  5A34 A;  5D8I A;  2REM A;  3R2Q A;  4CW9 A;  2LRN A;  3VPQ A;  1ILO A;  4WEY A;  4LL4 B;  3A3T A;  2WVX B;  5D9V A;  12GS A;  1JZD A;  4D73 A;  1SKW B;  2PU9 C;  3VPT A;  1A24 A;  1AIU A;  3IK9 A;  4KX4 A;  3KGK A;  1PN9 A;  3ZL5 A;  4KUN A;  3FR3 A;  3ED3 A;  3QFA C;  4JBB A;  5KN1 A;  1XPV A;  3KCM A;  3F6F A;  4G10 A;  2WW2 A;  3CHX C;  3IRA A;  4G0I A;  3M8N A;  4KDU A;  2GDR A;  3ZFB A;  1SD9 A;  2HE3 A;  2OJL A;  3KP8 A;  4EO3 A;  1V40 A;  2WW1 A;  3CQF A;  3IHG A;  3EWL A;  2C3Q A;  4MP4 A;  3NZN A;  2FUG 2;  1TW9 A;  3ERW A;  5J47 A;  3GTU B;  2DSA A;  3LXZ A;  3TKS E;  2DJ1 A;  1LJR A;  4Q5R A;  2FD3 A;  2PBJ A;  4LA1 A;  1GSE A;  5AIS A;  4PGT A;  2XHF A;  3QD9 A;  3TRQ A;  3LEF A;  4HDE A;  1M3I A;  3WD6 A;  3GFK A;  3GIX A;  1DE1 A; 
#chains in the Genus database with same CATH homology
 1GRX A;  1R26 A;  4V1A g;  1V58 A;  5KN0 A;  6GSV A;  3FYG A;  3PPU A;  3R3E A;  1ZYE A;  4GCI A;  5KN2 A;  2WB9 A;  2V41 A;  2AAW A;  4BL7 A;  2JZS A;  5J41 A;  2OKA A;  11GS A;  2H1D A;  4PQI A;  2VL2 A;  4F0B A;  1XIY A;  3L0H A;  4YAV A;  4YKF A;  5EVO A;  2CVK A;  2WRT A;  1QQ2 A;  1R5P A;  1BQ7 A;  2VM1 A;  4OWY A;  2YWM A;  2ES7 A;  2DML A;  3P7X A;  3CRT A;  5LCZ A;  4JR6 A;  1BF5 A;  1SJZ A;  2V1M A;  2VAF A;  1VGL A;  1K3Y A;  1PD2 1;  1JLW A;  3FR6 A;  1K0A A;  1PX7 A;  5B7C A;  3QOU A;  1KBN A;  4K8M A;  4ZB9 A;  3HXS A;  4K7O A;  2DBC A;  3H79 A;  2TRX A;  2GQL A;  1JHB A;  5D9W A;  5GZZ B;  2ZCT A;  2IMK A;  1XCC A;  2GZP A;  4EDY A;  4HZ2 A;  1F6M C;  1G0T A;  1AC1 A;  4DSR A;  3ZML A;  2EFE A;  4PUR A;  1K0M A;  2KLX A;  2LEG A;  4GXZ A;  2PUK C;  3ZVJ D;  3HDC A;  1EGR A;  2DJK A;  2EFH A;  5IO2 A;  5D96 A;  3VLN A;  2VCV A;  5J9B A;  1EP8 A;  2F9S A;  18GS A;  4BVY B;  1TKD B;  1OC9 B;  5GAN D;  4KH7 A;  1BG1 A;  4J56 E;  1AAZ A;  5ENU A;  2H1G A;  4EE0 A;  2O7K A;  1A8Y A;  1XBS A;  1GTA A;  4G01 A;  1QMV A;  1YF0 A;  4HI7 A;  1M7T A;  2IL3 A;  4YKG A;  1ON4 A;  3GYK A;  1FB6 A;  3W8S A;  1SK2 A;  2V6K A;  4EKZ A;  3EIN A;  4F9Z A;  2CAI A;  3RBT A;  2B6M A;  3F3R A;  2I9H A;  2L5O A;  4X1U A;  1F3B A;  1URM A;  5HFI A;  2HSY A;  2YPM A;  4O5U A;  2ON5 A;  4J2F A;  1G6Y A;  5KEJ A;  3GA4 A;  4PTS A;  2IMF A;  1O6J A;  1OC8 A;  1K3O A;  1G6W A;  4G0L A;  5ECO B;  2GQK A;  1SL0 B;  3U5R E;  2AHE A;  1TRU A;  1XZO A;  1T4Z A;  3GL3 A;  3M0F A;  2VL2 C;  1PN0 A;  2JL4 A;  1ZOF A;  4TN8 A;  1EV4 A;  3BJ5 A;  4J57 E;  2AB6 A;  3MSZ A;  1MDK A;  3D22 A;  3VWU A;  3EE2 A;  2GSS A;  2MYG A;  1K0N A;  1PKZ A;  2FA4 A;  1IYH A;  1WWJ A;  4YAP A;  4HU7 A;  4HEA 2;  5H5R A;  2WGR A;  2WS2 A;  2C1Y A;  4OD7 A;  4L5L A;  2J23 A;  4CY8 A;  5IOX A;  3LGC A;  1R5A A;  2LV3 A;  1M9B A;  4QQ7 A;  1TOF A;  2FWF A;  1O81 A;  4WET A;  2DIZ A;  4GSS A;  3UOM A;  1SEN A;  3IHQ A;  2JZR A;  2H6Z A;  3D0Z A;  3GRX A;  4HJM A;  3F8U A;  2EFC A;  4PXO A;  3QFB C;  4FIW A;  4EC0 A;  2YZU A;  4POK A;  2FWH A;  4KSM A;  4L0U A;  3LQ7 A;  3EVI A;  3N9J A;  1NSW A;  1OVN A;  5F8B A;  1VF2 A;  2HRA A;  4XS4 A;  4F82 A;  3TJB A;  2DJJ A;  4X4J A;  2L5L A;  1TTZ A;  4Z2U A;  2A2S A;  2XBI A;  1TRV A;  1TK5 B;  4MZW A;  6GSX A;  1SVO A;  3E3E A;  2H74 A;  4N11 A;  5E4W A;  4EXJ A;  2B5Y A;  2C80 A;  4Q5Q A;  2B5E A;  2FGX A;  1A0F A;  1FW1 A;  3E0U A;  3EUR A;  3GKM A;  4WR4 A;  1LBK A;  3I6A A;  4NV2 A;  2JSZ A;  1Y6E A;  4GWR A;  2X8C A;  5EL8 A;  5FWG A;  3BCI A;  1FHE A;  3LG6 A;  1ERW A;  1U88 A;  2H8L A;  4TXV A;  3KD0 A;  1Z6M A;  3WGX A;  4I2U A;  3RHB A;  1SK1 A;  4IGJ A;  3US3 A;  3UBL A;  2B1K A;  1GTB A;  1X5C A;  2CZ2 A;  1KEB A;  2VLT A;  4HS1 A;  2H6Y A;  1AW9 A;  1SD8 A;  2YCD A;  5CRG A;  2MMN A;  5ECP B;  4POM A;  5IMF A;  3TJG A;  1Y1U A;  4BVY A;  3G9B A;  1Z7P A;  1EEM A;  3K8N A;  2LTK A;  5ECR B;  2HXK A;  1DSB A;  1X0R A;  3DWV A;  4O5Q A;  1T1V A;  4OFM A;  3ZYW A;  2GZZ A;  5IM9 A;  2HSM B;  4Z7X A;  3QPM A;  3HVV A;  4MF5 A;  1FOV A;  3FK8 A;  1XOA A;  4L5O A;  2RUE A;  4K7N A;  1M99 A;  4ID0 A;  3UEM A;  1QXH A;  3DRN A;  4HQZ A;  1GNW A;  5AIX A;  4USS A;  2MBT A;  2L57 A;  2AV4 A;  5KOW A;  3KZQ A;  1X9S B;  5A5H B;  2CVB A;  2IIY A;  2VO4 A;  2EC4 A;  2FCH A;  3VK9 A;  3D5J A;  2BTO T;  1V9W A;  3TUE A;  4NAX A;  2R37 A;  4MLY A;  3RHC A;  2L4Q A;  2VCW A;  2B7K A;  1ERU A;  4ZL9 A;  1XVQ A;  1M2A A;  3IC4 A;  4MPF A;  5AN1 A;  2BJX A;  3C1R A;  5CRD A;  2FLS A;  5ECL B;  2JAD A;  1X5D A;  2NBS A;  3DML A;  3A5I A;  1T00 A;  3H1N A;  3CXG A;  4EIP A;  1VF1 A;  2HRK A;  4NHW A;  1K0B A;  2YN1 A;  2K8S A;  2O8V B;  3KTL A;  2H19 A;  4K5S A;  3TU3 B;  2PMT A;  1J08 A;  4IQA A;  1WOU A;  2DKI A;  3ME8 A;  1N8J A;  4QMK A;  4Q5F A;  2RM6 A;  2K9F A;  1SJ6 A;  1FB0 A;  4KE3 A;  4MF7 A;  3FRC A;  1GTI A;  5DDL A;  5D9X A;  2PGT A;  3FW2 A;  4N0Z A;  1OAZ A;  2HYX A;  4JRR A;  5CRH A;  5CAX A;  3TOU A;  1KNG A;  1GSD A;  3DGQ A;  1OC3 A;  4MH3 A;  1PL2 A;  2CQ9 A;  5JCW A;  6GST A;  5LD0 A;  1R7H A;  10GS A;  2YV7 A;  5C00 A;  4ZBB A;  4IS0 A;  1E2Y A;  1A0R P;  2F51 A;  2MZC A;  1SVL A;  1SL2 B;  5A4V A;  4MJE A;  1GLQ A;  5IO0 A;  1XWC A;  2V2G A;  4V2L A;  5IIZ A;  5EY6 A;  5A5K A;  3P2A A;  2CVD A;  3NOF A;  4AKX B;  5A4W A;  4ZIJ A;  3LJR A;  1T7P B;  3HHV A;  1QUW A;  1JZW A;  1O7U A;  5IMV A;  1GSF A;  1PA3 A;  3C71 A;  2DJ0 A;  2LRC A;  2VIM A;  1XOB A;  1PMT A;  5JCG A;  2DIY A;  1MD4 A;  3HYP A;  3CSH A;  4IQ1 A;  2QGV A;  3CRU A;  5D93 A;  3E9J B;  3M9K A;  2PN8 A;  4XIH A;  3FY7 A;  4WR5 A;  2I1U A;  3W6G A;  5IQY A;  1SU9 A;  2B1L A;  3ZRD A;  3IA1 A;  1CQH A;  1U87 A;  1FAA A;  1YEX A;  2D2Z A;  4YQU A;  1RQM A;  2EFD A;  4AI6 A;  3CSJ A;  5DAL A;  3F4T A;  2YAN A;  4N10 A;  4TRX A;  4XRA A;  2YWN A;  2G2Q A;  2HI7 A;  2HQT A;  5DQS A;  1RW1 A;  2F8F A;  5BMU B;  3G7Y A;  3PH9 A;  1G7E A;  2IME A;  2R6K A;  4ML1 A;  3TOT A;  1FVJ A;  2DJ3 A;  3RPN A;  4LL1 B;  4WF4 A;  17GS A;  4TR4 A;  1F3A A;  1B4Q A;  2L59 A;  2DC5 A;  2L6D A;  1SL1 B;  3H93 A;  2CT6 A;  1BED A;  2TIR A;  3Q74 A;  3ZZX A;  5ID2 B;  3O76 A;  1HNA A;  4ZBA A;  4BVX B;  4K9Z A;  3EC3 A;  2CZ3 A;  1Z3E A;  2OE1 A;  1A2M A;  2LNT A;  1FG4 A;  2CV4 A;  4PQ1 A;  2L6C A;  2J9H A;  5COH A;  1FOH A;  2HLS A;  1AUC A;  3GUS A;  7GSS A;  5IMA A;  9GSS A;  4MMM A;  2MMZ A;  8GSS A;  2KP2 A;  3TRX A;  1NW2 A;  3KM6 A;  5KN3 A;  1OYJ A;  4CHS A;  2P31 A;  4NPB A;  4KND A;  5DJM A;  4GQC A;  4FYC A;  1ZYN A;  4GRF A;  4HU9 A;  2A4H A;  2H73 A;  1BJX A;  6GSY A;  3ZFL A;  1PGT A;  3APS A;  2V6O A;  2R0C A;  4MK3 A;  1MTC A;  3MDK A;  1O85 A;  1THO A;  1XVW A;  1SJI A;  3GV1 A;  1XWK A;  3IAS 2;  1YY7 A;  5HR1 A;  1WP0 A;  5G2Z A;  4EF0 A;  1GH2 A;  4I2T A;  3A2W A;  3HJP A;  2RII A;  2GS3 A;  1TK8 B;  4MZC A;  3FEU A;  1TU7 A;  2N5F A;  1ZL9 A;  4IJ3 A;  1WIK A;  2HZF A;  2H72 A;  3G7J A;  4GSN A;  1O73 A;  1Z7R A;  5G30 A;  4TR1 B;  2VLU A;  1XW5 A;  4AKG A;  5ECK B;  4FQU A;  3ERG A;  3IAM 2;  1GLP A;  4XRD A;  4JU5 A;  2VD0 A;  3QAW A;  3WGE A;  5CNW A;  1V98 A;  2VOC A;  4W66 A;  1PKW A;  2N5B A;  2QA1 A;  1U3I A;  3HKR A;  3QR6 A;  2KOK A;  2HSN B;  1SYR A;  4MPG A;  2H75 A;  4FYU A;  1ACV A;  4IBP A;  4AGS A;  4IEL A;  3G7I A;  3D6I A;  2IPA A;  2WFC A;  3WYW A;  1NM3 A;  2WZ9 A;  2AJQ B;  2LST A;  4OCE A;  1V2A A;  2A2R A;  3FHK A;  5IPG A;  4POL A;  2LQQ A;  4PX1 A;  2X8G A;  3CTF A;  4ZB6 A;  4I8B A;  5J5N A;  5G31 A;  3H4K A;  3L78 A;  1YZX A;  4HOJ A;  5IMC A;  5ECN B;  5E59 A;  1ERT A;  3ZMK A;  5F0G A;  1ABA A;  1VF3 A;  2YWO A;  5ELG A;  3D21 A;  3BBY A;  1VF4 A;  1SKS B;  2F3M A;  2OAD A;  6GSS A;  1Z5Y E;  2X99 A;  3U6V A;  1UVZ A;  2B3S A;  1MDJ A;  3O3T A;  4DSS B;  4RQR A;  3QAV A;  1ST9 A;  5HFK A;  4KB3 A;  4XTS A;  5C04 A;  2VL9 A;  5ECH B;  3GTU A;  2YZH A;  2DKH A;  1FO5 A;  3ISO A;  2XC2 A;  2QKE A;  3PGT A;  1AXD A;  5G5F A;  2KUC A;  2ZUP A;  5GSS A;  4HZ4 A;  4IKH A;  4I97 A;  5BMU A;  1YEP A;  3MYD A;  3Q6O A;  4GF0 A;  4GTU A;  3GN3 A;  2PWJ A;  2OT3 A;  1GUH A;  1YKC A;  4ZL8 A;  4PUA A;  1EOH A;  2FHE A;  2IFQ B;  4ICY A;  3ZLP A;  4L8E A;  2H0I A;  2I3Y A;  1XWG A;  1ZGN A;  4BA7 A;  4V2M A;  5ID2 A;  2R4V A;  2HZE B;  4BVX A;  3GH9 A;  3EYT A;  4MH2 A;  1MD3 A;  1DBY A;  3HMJ G;  2NPB A;  4K0G A;  1XWA A;  1GL8 A;  4GLT A;  2A2P A;  4ECB A;  2UV8 G;  5IMZ A;  4HQS A;  3RPP A;  1I9D A;  4F2I A;  1TK0 B;  3S9F A;  4ISD A;  2FWE A;  4D73 B;  5LNK e;  3MNG A;  2R2J A;  2CX4 A;  4XCS A;  1WJK A;  1R4W A;  1GTU A;  2GLR A;  4V1A p;  20GS A;  4RUV A;  1OE7 A;  3IOS A;  5GST A;  4NV5 A;  4K2D A;  1T4Y A;  3C73 A;  4TXO B;  5CRE A;  3CSI A;  2GT5 A;  1S3C A;  1OC9 A;  4P3Y B;  3V1W A;  2LJR A;  3HJM A;  4CDO A;  3GKX A;  4I6X A;  4K0N A;  2H6X A;  4H86 A;  3UBK A;  4MA9 A;  3N5O A;  3LYP A;  1BYE A;  4ZB7 A;  3AY8 A;  1Q4J A;  5GAP D;  3DIE A;  1B48 A;  5ECQ B;  1NHY A;  4AJ7 A;  3IDV A;  4K1F A;  4EVM A;  4IN0 A;  2E2M A;  3Q18 A;  5JWQ B;  3P90 A;  3LYK A;  4TR1 A;  2GZY A;  1UC7 A;  1WMJ A;  4ACS A;  3F0I A;  2R0P A;  4K2X A;  1B4P A;  2GSR A;  4NXI A;  1HNB A;  3IXR A;  3D4M A;  1TDI A;  1I5G A;  3CYN A;  5ECS A;  1K0D A;  2HSN A;  5JWO B;  5BRT A;  3KTB A;  3LSZ A;  3VUR A;  2WUL A;  4JR4 A;  3KMO A;  5G1L A;  3SWL A;  2WCI A;  5DQY A;  5J40 A;  3M3M A;  2VKZ G;  4FH8 A;  2LRT A;  3F6D A;  3HZ8 A;  2A4V A;  1ZCP A;  2OBK A;  1X9M B;  1TRW A;  5KOX A;  4ZBD A;  3IV4 A;  3HCZ A;  5B6N A;  3GHA A;  2KP1 A;  2H70 A;  3GUR A;  3TGZ A;  4TR3 A;  1AQW A;  5F06 A;  2VD1 A;  3LOR A;  1HD2 A;  1A23 A;  1EZK A;  4WKW A;  3PR8 A;  1YVL A;  3CBU A;  3UVT A;  4KA0 A;  4O5R A;  1GWC A;  1SK0 A;  3TKR A;  2FNO A;  3L9U A;  4DSS A;  2C0D A;  2B7J A;  4GDF A;  3L9V A;  1X5E A;  1B9X C;  3GKK A;  3IC8 A;  4ZIL A;  4TVE A;  4EUY A;  2X4A A;  2WDU A;  4BPY A;  3IPZ A;  5HFG A;  2IWT A;  2I81 A;  3UAR A;  3TJJ A;  4V2N A;  1AQV A;  4KDY A;  4F03 A;  3KP9 A;  4OCF A;  1BX9 A;  2DLX A;  5DAK B;  5DCH A;  4MCU A;  2FY6 A;  1WE0 A;  4PNF A;  3QDN A;  4N3Z A;  3GKN A;  3BCK A;  3GX0 A;  2C8U A;  3RDW A;  2EIO A;  1ZZY A;  2MMA A;  2GVP A;  4ECJ A;  2K18 A;  3HJO A;  2M72 A;  3KEB A;  3KH7 A;  5DCG A;  19GS A;  1PRX A;  3WT1 A;  1B9Y C;  1TXU A;  4XS1 A;  1Z9H A;  5DJL A;  2HZE A;  4ECC A;  1F2E A;  2C3T A;  1GNE A;  5J4V A;  1EV9 A;  2HT9 A;  3J7Y b;  3APQ A;  4MF6 A;  4RQX A;  3KMN A;  4KDX A;  1AQX A;  2H76 A;  3CTG A;  1S3D A;  2H01 A;  5A4U A;  4NWY A;  2E2G A;  2R0G A;  3GL5 A;  5DBQ A;  2C0F A;  2LQO A;  2H30 A;  4DSQ A;  2PVQ A;  1N25 A;  3MIX A;  3MWH A;  4G19 A;  4TXO A;  1XWB A;  5J3R A;  4O92 A;  4N30 A;  2YWI A;  3GNJ A;  4IJI A;  4TW5 A;  1EP7 A;  1T3B A;  5J9C A;  2XPD A;  3PIN A;  1H4O A;  1G7O A;  1C72 A;  2ON7 A;  4GQF A;  4AJ6 A;  2HSM A;  4KGI A;  2M46 A;  1GP1 A;  2NVL A;  2P0G A;  4E68 A;  2C0G A;  3WGD A;  1TU8 A;  1PSQ A;  3FZ4 A;  1YQ1 A;  3QMX A;  4PNG A;  4XS4 B;  5CRW A;  5HR3 A;  1LU4 A;  3KIJ A;  5AIV A;  3TKS A;  5A5H A;  3ZIJ A;  5HQP A;  3VI7 A;  1K0C A;  2B5X A;  3HD5 A;  1YKA A;  2QA2 A;  4KSO A;  2GSQ A;  3F3Q A;  2DMM A;  5G1K A;  3M1G A;  2BMX A;  2GT6 A;  1PL1 A;  4IHU A;  3HA9 A;  5HR2 A;  2GTU A;  3FKF A;  3GST A;  3FZA A;  5IMD A;  4Z2R A;  1SVM A;  2GGT A;  1YJ6 A;  4X43 A;  2LJK A;  5B8B A;  3ZVJ A;  4N0V A;  2H0G A;  1A2J A;  5AGY A;  2QSI A;  4EIQ A;  4E8E A;  4OO5 A;  3C8E A;  2VCQ A;  4MNN A;  2MBS A;  1OKT A;  1GSQ A;  2FWG A;  3ZIT A;  5D9T A;  4PUF C;  4OO4 A;  4MJC A;  2TRC P;  4IW9 A;  5H5S A;  4AKH A;  1JZO A;  3TKQ A;  1Q98 A;  5J4Y A;  2OA7 A;  2OBI A;  4ZB8 A;  2YP6 A;  3A2X A;  1XXU A;  1ZMA A;  3ERF A;  3EMP A;  1U3A A;  1YF1 A;  1B8X A;  2P5Q A;  2CX3 A;  3HZ4 A;  4K5R A;  1SKR B;  2C4J A;  4O7H A;  1ZYQ B;  5ECI B;  5HR0 A;  3ME7 A;  4XHM A;  3FR9 A;  2NTO A;  1BAY A;  4MDC A;  3BD2 A;  5ELA A;  3GH6 A;  4L0W A;  3LWA A;  3L9S A;  4ECI A;  3A5W A;  3EU3 A;  5DAK A;  5G5E A;  2HNL A;  2HSH A;  3A2V A;  4FO5 A;  2LJA A;  4QL7 A;  2LUS A;  3HVS A;  2VLV A;  2YNX A;  4WF5 A;  2O87 A;  3FMW A;  2IJY A;  3TKS C;  4X0X A;  1JZR A;  2VUP A;  3C1S A;  2AYT A;  4TKY A;  1GUK A;  3D4T A;  1CQG A;  2DJ2 A;  1KTE A;  6GSW A;  3IBH A;  4XS6 A;  3EPT A;  2OAC A;  2PVO C;  1GSY A;  5CO3 A;  5ABR A;  2RUF A;  14GS A;  3HVX A;  5CP1 A;  4KAE A;  4ZL7 A;  22GS A;  4EL1 A;  1DE2 A;  4QL9 A;  2HRF A;  4HUA A;  4CY6 A;  4Q5N A;  2H71 A;  4LLR A;  3O6T A;  16GS A;  2H1A A;  1TP9 A;  2HRK B;  3C7M A;  1M9A A;  4FYB A;  4KCE A;  1E6B A;  3H8Q A;  3DYR A;  3RAZ A;  1ML6 A;  2L4C A;  3FZ5 A;  5DVB A;  1DUG A;  3UMA A;  1V57 A;  2R3X A;  1A2L A;  1SYX A;  4K6X A;  3J7Y k;  2VCZ A;  3OR5 A;  1U6T A;  2VCT A;  5A1N B;  3L4N A;  2JZT A;  1J0F A;  3VFI A;  3F9U A;  1H75 A;  2YJH A;  3ZTL A;  2JAC A;  3DKS A;  3TB2 A;  1VRS D;  1QFN A;  1O8X A;  3F4S A;  3I9V 2;  1YDK A;  1OE8 A;  3JCM L;  3KXO A;  2G0F A;  4YQM A;  2LKU A;  1WRY A;  1XW9 A;  3GSS A;  1TRS A;  4ULX A;  2ALB A;  1TJD A;  3LXT A;  3HY2 A;  3UL3 A;  2VCX A;  2R5G A;  5A34 B;  1K0O A;  2RM5 A;  4OFN A;  2K8V A;  2CAQ A;  5JWR B;  3SBC A;  4RI7 A;  4LMW A;  1A8L A;  2X8H A;  3VWW A;  2H66 A;  2VL3 A;  4JE1 A;  4RI6 A;  2LS5 A;  3I43 A;  4POB A;  2MMO A;  4NMU A;  3TCO A;  1ERV A;  1TI1 A;  3KJY A;  3UJ1 A;  1T8E B;  3NIV A;  4K7I A;  1OKD A;  5FT3 A;  3ZIV A;  1GUM A;  3QAG A;  4G0K A;  2EIQ A;  3CWG A;  1ZYP A;  4GST A;  3DVW A;  5B6M A;  4AJ8 A;  2E0Q A;  3F63 A;  2NDO A;  2GQM A;  1BG5 A;  4G2E A;  3LFL A;  4BWS A;  1QGV A;  4O32 A;  4TOP A;  4KCA A;  1MDI A;  5L71 A;  3VI5 A;  1EOG A;  4G9H A;  1O8W A;  1XFL A;  5DAL B;  5JCU A;  5EPF A;  2Z9S A;  2I4A A;  3EU4 A;  2XBQ A;  4IP1 A;  4MAB A;  1GSU A;  2AUV A;  2OE0 A;  2H1L A;  2O85 A;  3DD3 A;  1M2D A;  2YJ7 A;  3LW9 A;  3DVX A;  2H0H A;  1MEK A;  4IVF A;  4YH2 A;  1M0U A;  2H1B A;  2YOI A;  1JFU A;  1HNC A;  4BL7 B;  2YV9 A;  4LMV A;  2IMD A;  2C0E A;  4DEJ A;  5J4U A;  3GX8 A;  1UA5 A;  1F37 A;  2M80 A;  4KW6 A;  3APO A;  1TXX A;  1J9B A;  3TJK A;  1WPI A;  3IR4 A;  2FA8 A;  4OMV A;  3QCP A;  2IN3 A;  2QC7 A;  3IE3 A;  4HJ2 A;  2O5V A;  4PQH A;  2WJU A;  5CYY A;  4F0C A;  3WT2 A;  3F4R A;  2HFD A;  2JSY A;  1XW6 A;  5ECM B;  3FZ9 A;  1M2B A;  4JED A;  3TRP A;  3M9J A;  4I5Q A;  2K6V A;  1PX6 A;  3BOA A;  4AKI A;  2PER A;  1TI3 A;  4MJA A;  5D73 A;  5INY A;  4KF9 A;  1W89 A;  3IK7 A;  2IMI A;  4WBR D;  3DXB A;  5FHI A;  1HQO A;  2OE3 A;  2LNS A;  2X64 A;  3I69 A;  2N5A A;  1IYI A;  2C3N A;  4Z2T A;  1W4V A;  2JU5 A;  2P5R A;  4IP6 A;  2X49 A;  3EMX A;  1GUL A;  1PQN A;  5H5Q A;  2PPT A;  1EGO A;  4E8H A;  2V32 A;  1S3A A;  2VM2 A;  4ZXG A;  2CA8 A;  5IOW A;  1GSS A;  1RK4 A;  1USB A;  4JZQ A;  2O89 A;  3VWV A;  4MJB A;  1F9M A;  2UZ8 A;  2E7P A;  5F07 A;  4YQV A;  2XPE A;  4OFT A;  4ML6 A;  4WBJ A;  3DEX A;  3CMI A;  3UVH A;  1JLV A;  3P8W A;  4ILF A;  5F05 A;  1Z6N A;  5B8A A;  3VWX A;  1HYU A;  3TDG A;  3UAP A;  6GSU A;  1Y25 A;  1N2A A;  3Q19 A;  5A1N A;  1X9W B;  4DVC A;  2KHP A;  3MAK A;  2RLI A;  3KH9 A;  3TKP A;  1EWX A;  2GST A;  5IPH A;  2IFQ A;  13GS A;  2F8A A;  4AF2 A;  3W8J A;  4WXT A;  1K3L A;  4A5P A;  2ZNM A;  1QK8 A;  1EEJ A;  1NHO A;  4EDZ A;  3TJF A;  4BWQ A;  1FVK A;  4NHZ A;  4TR0 A;  3ZRE A;  4MZB A;  3UIW A;  1THX A;  2HRN A;  1UN2 A;  3GMF A;  2EIR A;  5A34 A;  5D8I A;  2REM A;  3R2Q A;  4CW9 A;  2LRN A;  3VPQ A;  1ILO A;  4WEY A;  4LL4 B;  5D9V A;  3A3T A;  1JZD A;  12GS A;  4D73 A;  1SKW B;  2PU9 C;  3VPT A;  1A24 A;  1AIU A;  3IK9 A;  4KX4 A;  3KGK A;  1PN9 A;  3ZL5 A;  4KUN A;  3FR3 A;  3ED3 A;  3QFA C;  4JBB A;  5KN1 A;  1XPV A;  3KCM A;  3F6F A;  4G10 A;  3IRA A;  4G0I A;  3M8N A;  4KDU A;  2GDR A;  3ZFB A;  1SD9 A;  2HE3 A;  2OJL A;  3KP8 A;  4EO3 A;  1V40 A;  3IHG A;  3EWL A;  2C3Q A;  4MP4 A;  3NZN A;  2FUG 2;  1TW9 A;  3ERW A;  5J47 A;  3GTU B;  2DSA A;  3LXZ A;  3TKS E;  2DJ1 A;  1LJR A;  4Q5R A;  2FD3 A;  2PBJ A;  4LA1 A;  1GSE A;  5AIS A;  4PGT A;  2XHF A;  3QD9 A;  3TRQ A;  3LEF A;  4HDE A;  3WD6 A;  3GFK A;  3GIX A;  1DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...