3GTUA

Ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gtuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gtuA01
2FWFA 1Z7RA 1MDIA 2GZPA 3QOUA 4K7IA 2C3QA 1H4OA 2OADA 3DRNA 3I69A 3A2XA 4NHZA 2OE1A 3I43A 4F2IA 3H4KA 2PWJA 4EE0A 1ACVA 4TKYA 1VF4A 4KCAA 3DGQA 3D4MA 2GSTA 2ES7A 1A2LA 4XIHA 1SL0B 4QL7A 2M72A 2GT5A 9GSSA 1VGLA 2WCIA 2C0FA 4G2EA 1GTUA 5IO2A 1GH2A 3TB2A 2PMTA 1B48A 3ZZXA 1XIYA 4ZL8A 4L8EA 4JR6A 2KOKA 3UBLA 3C8EA 3GL5A 3GNJA 1FB6A 3IR4A 4G9HA 4HZ4A 4F03A 3P2AA 4PQIA 3KP8A 1SYRA 1DE1A 5D9WA 4MK3A 5INYA 1DBYA 4IVFA 1Q4JA 1R5PA 4WR5A 4DSRA 12GSA 2GVPA 3QAWA 5IMAA 5DALA 5BMUA 1AUCA 2VD1A 3LEFA 1Z7PA 1M2BA 4AJ7A 1AAZA 4BA7A 1SKSB 1TI3A 1A2MA 1JZWA 4XS6A 2HFDA 2AAWA 2XPDA 3CXGA 1G0TA 2BMXA 5F07A 5H5QA 2WGRA 4PX1A 2UZ8A 2G0FA 5GSSA 5ECQB 3GKMA 3FHKA 4ILFA 4TVEA 4TOPA 3KIJA 4CDOA 1KTEA 3PH9A 17GSA 5ECRB 1ZYQB 1EZKA 2YCDA 3LXZA 4KUNA 3BCKA 5ELGA 1EOHA 4PUFC 4XHMA 3C7MA 5ECIB 4HU7A 2H70A 1TKDB 3ZIVA 4KNDA 1PGTA 4Q5RA 3DYRA 3F63A 1YDKA 3DMLA 2AJQB 3P7XA 2FD3A 2DJ0A 2KP1A 5LD0A 5CRHA 3HDCA 3U5RE 1YEPA 1ZOFA 2FUG2 1BG5A 2L5LA 4KA0A 1USBA 5GAND 1AIUA 2CA8A 2LUSA 5ABRA 1Z6NA 5KN1A 4OO5A 2A2RA 3IPZA 3UVTA 1GP1A 3FZ9A 1EP7A 5CAXA 1ON4A 4GXZA 2LKUA 3LORA 1TK8B 4HOJA 3UVHA 4PUAA 3DXBA 1GWCA 3EURA 3HA9A 1XW9A 3HJMA 4GSNA 3BOAA 1YZXA 5IO0A 3L9SA 1V40A 2N5FA 3TJGA 1SD9A 3M8NA 2VLTA 3EWLA 4IJ3A 1NSWA 1QUWA 2C0DA 5HR0A 1GSQA 4KB3A 5J5NA 2D2ZA 3Q6OA 5AIVA 2MMOA 1FVJA 4MH3A 6GSWA 3M9KA 5LCZA 1XXUA 3UJ1A 3A3TA 3GSTA 4IP6A 1XWAA 1GNEA 4GRFA 2GSSA 1AQXA 2H75A 3EE2A 1LBKA 2RM5A 2PPTA 2MMZA 1ILOA 18GSA 2B5XA 4YQUA 1X9MB 5ECMB 4EL1A 1MDJA 4EDZA 3UOMA 2H30A 1YKAA 3H1NA 1TRSA 1FW1A 4G0LA 3F4SA 1HNAA 1PA3A 4ULXA 4IHUA 3LFLA 22GSA 3DVXA 1GRXA 2DJKA 4YQMA 1GNWA 2I81A 5B8AA 5A4UA 2IFQA 4QQ7A 1O81A 2TRCP 5ENUA 5IOWA 2PVQA 4V2MA 2VL2C 5L71A 3LG6A 1E2YA 1WMJA 5EPFA 4PURA 4Z7XA 3F9UA 4MABA 3LSZA 3HCZA 3G7IA 4EXJA 5AGYA 2VM2A 4MJAA 2YJHA 19GSA 1FHEA 3ERGA 1T3BA 2IMIA 1VRSD 6GSVA 2HRKA 1PSQA 1URMA 4KE3A 2MMAA 4E8EA 2B7JA 4MZWA 2VL2A 4K9ZA 4RQXA 1PX6A 2WFCA 3KGKA 2CZ3A 5C04A 3UAPA 4ZIJA 1IYIA 4P3YB 2EC4A 4KCEA 2DJJA 2RM6A 1O7UA 2JSZA 2XPEA 4I6XA 4V2LA 2HI7A 4WR4A 1A8YA 2QSIA 1F6MC 1GTIA 2KP2A 2HRFA 4Q5NA 2MYGA 2YNXA 3GUSA 2WDUA 5COHA 2TIRA 1EV4A 3WT2A 1ZCPA 2P5RA 1A23A 2ON5A 3ZFLA 4EVMA 1SK1A 1F3AA 4MJCA 2X99A 4DVCA 1KNGA 1M2AA 1TTZA 2H8LA 3IK9A 2WS2A 3U6VA 2OE3A 3K8NA 4I5QA 3FW2A 20GSA 4ZBAA 2AYTA 1TDIA 4OFTA 4RQRA 4TR3A 1TK5B 1XWCA 4ML6A 1CQGA 2WRTA 3R3EA 2PGTA 4JEDA 1E6BA 3RPNA 2BTOT 1GTBA 5GZZB 4MPFA 2YJ7A 4N11A 4EKZA 5CRGA 1XPVA 1MDKA 2E7PA 3ME7A 2JL4A 2WULA 2P0GA 5ID2B 4IKHA 3KP9A 2LJAA 3RHBA 4ZL7A 1XWKA 3ZL5A 3ZVJD 4DSQA 1EV9A 2DBCA 1J0FA 2ZCTA 1JZDA 4AJ8A 4PQ1A 5LNKe 3H79A 4K7OA 1JHBA 3LQ7A 1TRVA 3BCIA 6GSUA 1FG4A 5F0GA 1BAYA 2JZRA 4GSTA 4NHWA 5CRWA 2VCTA 2DIYA 6GSTA 5A4VA 2R5GA 3D4TA 5IPGA 1GSFA 1XOBA 2I9HA 1DE2A 1SK2A 4MPGA 2R6KA 4EO3A 2LNTA 5JCUA 2K18A 2HZFA 1W4VA 3GURA 1EEMA 1M0UA 4WF5A 5JWRB 2MBTA 3PPUA 1YKCA 5HR3A 5D9XA 3ZITA 1K0MA 5E4WA 2P5QA 4DSSB 2GZYA 5DJLA 2V32A 5CO3A 4L5OA 2MZCA 3EMPA 2LEGA 5DAKA 2R2JA 1YF1A 2FGXA 4GCIA 16GSA 3TJBA 4PGTA 1TP9A 4GF0A 4LMWA 3EINA 1OC9B 3L0HA 4HJMA 3RHCA 4G0IA 2OACA 3CRTA 4BVYA 4FYCA 2VCZA 2X64A 3HZ8A 3Q19A 3US3A 3VK9A 1AQWA 4D73A 5G1KA 2DSAA 2HT9A 4BVXA 4TXOB 4I97A 4ML1A 2A2SA 4MJEA 1S3CA 2VM1A 3FK8A 2C80A 5DAKB 4KDYA 2CV4A 1F2EA 4ZILA 1AW9A 4X1UA 2LSTA 3ZLPA 3KCMA 1WE0A 4ZXGA 4ISDA 4YAVA 14GSA 2JSYA 2N5BA 5B6MA 3MAKA 5J9BA 2WZ9A 5EL8A 1X5DA 5AISA 4BVYB 1N8JA 5KN3A 1THXA 2HSYA 4D73B 5IOXA 4FQUA 1GUMA 3HD5A 4BVXB 4KGIA 1F3BA 5B8BA 1QGVA 3M9JA 3DWVA 1ML6A 2L4QA 2CAQA 1T00A 3NOFA 4G19A 1SJ6A 1G6YA 1SJZA 2X8CA 2YOIA 2OBIA 2KUCA 1GLQA 4GTUA 3HZ4A 2LNSA 3IRAA 3TGZA 5FWGA 2PVOC 4N30A 5HR1A 4KF9A 3BBYA 1WRYA 4HQSA 4PNFA 1OKTA 3GL3A 11GSA 1F9MA 2YWOA 1WWJA 3ME8A 1ZMAA 2HE3A 1FO5A 4O92A 2AHEA 2LQOA 5JWQB 1A24A 4OMVA 4NWYA 2YN1A 2H1GA 2ZNMA 1Z3EA 4WBJA 3TKSE 5E59A 1XBSA 1WOUA 3N5OA 5D73A 4POMA 4BPYA 2OBKA 2IPAA 4RI7A 2DJ3A 4Q5QA 2CX3A 2RUEA 2O7KA 1SKWB 2JACA 1WP0A 2FWHA 3DD3A 1THOA 3C1SA 2CT6A 3BJ5A 1K3YA 2L4CA 1ABAA 5JCGA 3TJFA 1ZL9A 3GKXA 2HSNB 4JZQA 2PUKC 1QXHA 2VCVA 4OCEA 1PQNA 4YH2A 2LV3A 2NTOA 1HD2A 2VL9A 1PX7A 2CAIA 1GSEA 2REMA 4HEA2 2XBIA 3APSA 3VWXA 3GTUA 3FY7A 3HVVA 3NIVA 1R7HA 2GZZA 2IJYA 2YZUA 2CVKA 5KN0A 3H8QA 1N2AA 4ZL9A 4HU9A 4GQCA 2HQTA 4OFMA 4LA1A 2WB9A 2GT6A 1LU4A 1TOFA 5B6NA 3HXSA 2ZUPA 4MP4A 3DKSA 2LTKA 2AV4A 2N5AA 1NM3A 3A5WA 4FO5A 3S9FA 4MF5A 5B7CA 3IV4A 4KX4A 2L59A 4ECCA 1AC1A 5CYYA 1T8EB 2VOCA 1MEKA 1BJXA 3CTGA 1XW5A 3D22A 3QFAC 3UIWA 1UA5A 2G2QA 1FAAA 3ED3A 5C00A 2GQKA 3F3RA 1B9XC 1V9WA 3GTUB 3APQA 4IQ1A 3AY8A 3HYPA 2H73A 4ID0A 3W8JA 2WJUA 1EEJA 1VF1A 3KH7A 3IAS2 5D9VA 3FR9A 1RW1A 2H74A 2V6KA 2HSHA 2LRNA 2FY6A 4J56E 3GA4A 2OKAA 5A4WA 3L78A 3PGTA 4JU5A 5H5SA 1TW9A 3WGEA 2GQLA 2C0EA 5G1LA 1XOAA 1K0BA 1G6WA 2YV9A 1GSDA 3GV1A 2DC5A 3GHAA 2GDRA 4YAPA 2F8AA 1GTAA 3ERWA 1SYXA 3WT1A 3ISOA 1YQ1A 3QCPA 4IBPA 1Z9HA 2YV7A 3KEBA 3QMXA 1J08A 2AUVA 1H75A 3WYWA 2IMEA 3L9UA 4K1FA 3F0IA 1CQHA 3CSIA 5IMDA 1O8WA 2O87A 1OAZA 3M0FA 1UVZA 3GKKA 4BWQA 3KMNA 3I6AA 2L5OA 1B4PA 2RIIA 2RUFA 3O6TA 1NW2A 6GSYA 2FWGA 5IPHA 2H66A 1X9SB 2VO4A 3KM6A 1YY7A 1BEDA 4K7NA 3ZMLA 2IMDA 1V98A 3G7YA 2LQQA 5IM9A 1B4QA 3VWVA 1K0OA 2DMLA 3KMOA 4MZCA 3UARA 5D9TA 4OO4A 4WBRD 2CVBA 4I8BA 4IW9A 3BD2A 1V57A 5ID2A 4BWSA 3GMFA 2E2MA 3IA1A 1BQ7A 4X0XA 4IS0A 2VCXA 1PL2A 5D96A 5IMCA 1K0AA 4MF7A 2DMMA 3MNGA 3IOSA 1M9AA 1A0RP 2MBSA 2E2GA 4KSOA 1G7EA 4ECJA 1ERVA 2K8VA 3VPTA 1QQ2A 1ERWA 5HFKA 2CZ2A 1XWGA 4TW5A 4FH8A 2B5YA 4TN8A 3D6IA 3A2VA 4MDCA 3TJJA 2VIMA 3UL3A 2F8FA 3GFKA 4LMVA 5HFGA 2IMKA 2L57A 4USSA 2IIYA 3ZVJA 4EF0A 4PTSA 3PINA 5CRDA 2K9FA 3O76A 4RUVA 1ZZYA 3LXTA 3GRXA 4DSSA 2FLSA 3D5JA 1YF0A 5GSTA 1R4WA 5EVOA 1TK0B 3ERFA 1XVWA 2A4VA 3C73A 1GUHA 1FOVA 2YPMA 5ECLB 1ERTA 3L4NA 5D8IA 1OKDA 4JRRA 1OC9A 4HI7A 4MMMA 2QC7A 2XBQA 4YQVA 1BX9A 2I4AA 3DIEA 2FCHA 1AXDA 1MTCA 2GLRA 3ZREA 1SL2B 3GYKA 1A0FA 2HSMB 1X5CA 4TXVA 4EUYA 4X43A 4TXOA 1GULA 1PN9A 1GL8A 1GLPA 2O85A 1U6TA 1HNCA 1M7TA 4FIWA 3EMXA 2O89A 4MLYA 3W8SA 1SJIA 4MA9A 2GSRA 4WF4A 2B5EA 2H01A 1T4ZA 5IQYA 5D93A 5IMVA 1T4YA 2OJLA 1VF3A 3VWUA 2J23A 2GS3A 3EYTA 2VD0A 2HRNA 3ZIJA 2F51A 3GX8A 3HY2A 3IXRA 2KLXA 2FA8A 2JZSA 2NVLA 4MZBA 1K3LA 1KBNA 3J7Yk 1KEBA 3CRUA 7GSSA 2LRCA 1K0CA 1XFLA 3V1WA 3FZ5A 1WPIA 5G30A 4EDYA 3CTFA 5ECSA 1TI1A 1HNBA 2H6XA 1Z6MA 5A5KA 4PXOA 4N0VA 1NHOA 4O32A 4L0WA 3IK7A 3TKQA 1MD3A 5KEJA 4XRAA 3ZMKA 3EC3A 4NPBA 3GKNA 1GSSA 4J2FA 1U88A 1OC3A 3F6FA 4MJBA 5DDLA 3QD9A 2LRTA 4PQHA 1YEXA 1Y6EA 2NDOA 4I2UA 4KSMA 2J9HA 3TRPA 2CX4A 4OWYA 2H1AA 4NMUA 1U87A 5CP1A 1JLVA 3FR3A 1FB0A 2LS5A 2C0GA 3HHVA 4GLTA 4JR4A 1JZRA 4ZB6A 4K8MA 4F9ZA 1OC8A 1PL1A 2IWTA 5GAPD 3M3MA 2PBJA 2VCWA 4DEJA 6GSSA 3GIXA 4QL9A 3IDVA 3KH9A 1OE7A 1PKWA 4PNGA 2LJKA 4E8HA 3LYKA 2VLVA 3F4RA 4K2DA 2V2GA 1GSUA 4HDEA 4XS1A 4ZBDA 5HFIA 2OE0A 4WKWA 1PRXA 1ST9A 4F0CA 3FZAA 2P31A 5J3RA 1I5GA 2GGTA 1SK0A 1QFNA 5KN2A 1DSBA 1K3OA 3TJKA 5G2ZA 3H93A 3P90A 4IP1A 3HVXA 4F0BA 2ALBA 3W6GA 1UN2A 2VCQA 5DCGA 2NPBA 3VFIA 5DCHA 1XVQA 2AB6A 3TOTA 4F82A 4ZB8A 4CW9A 1X0RA 2H1BA 2YP6A 1JLWA 2IL3A 2CQ9A 2YZHA 2EIRA 2C1YA 2I1UA 4TR4A 1BYEA 1PD21 2M46A 4AJ6A 2O8VB 1EOGA 1SENA 13GSA 2IN3A 2H0HA 3WGXA 3NZNA 2VAFA 2HRAA 2EIOA 2C3NA 3GN3A 5JCWA 4V1Ag 2C4JA 3KTBA 1R26A 1HQOA 3C1RA 3VPQA 3UMAA 1TXXA 2TRXA 3UBKA 3LYPA 5J41A 5DALB 2FA4A 1V2AA 2L6DA 1J9BA 4K6XA 4L0UA 3E9JB 4ACSA 1YJ6A 3QPMA 5DQSA 2HNLA 2LJRA 4V2NA 2JU5A 2DJ2A 1C72A 4HUAA 4TR1A 5F8BA 1UC7A 1O6JA 2X8HA 3WD6A 2MMNA 4NXIA 3VI5A 5G5FA 5ECHB 3TKSC 2K6VA 1PKZA 3L9VA 2H76A 1PMTA 3CBUA 4HZ2A 3TKRA 3IC4A 4HJ2A 3ZYWA 3TDGA 3FZ4A 3Q74A 10GSA 4K0NA 3VURA 3F4TA 3DVWA 1FVKA 1T7PB 3QAVA 5G5EA 2R3XA 1K0DA 2X8GA 5AIXA 3IBHA 3VI7A 4TR1B 3TKSA 4ZB9A 1WIKA 1SU9A 1Z5YE 5DVBA 4Q5FA 2I3YA 1O85A 3VLNA 3P8WA 4NV2A 1K0NA 2H19A 2H0IA 3EU3A 3CMIA 4FYBA 3F6DA 2FNOA 4TR0A 3TCOA 2PN8A 1GUKA 1X5EA 3UEMA 1JZOA 1DUGA 4O7HA 2VUPA 1Y25A 3HJOA 4J57E 4XRDA 5DJMA 5FHIA 5JWOB 4OD7A 3I9V2 4ECIA 5ECPB 2EIQA 3DEXA 1QMVA 4CHSA 4NV5A 3LJRA 1JFUA 3F8UA 4JE1A 4OCFA 4BL7A 3C71A 3FR6A 1ZYEA 3HVSA 5J9CA 2XC2A 3QR6A 3IAM2 1TU7A 1HYUA 2YWNA 4XTSA 4WETA 3Q18A 3KXOA 3MDKA 1I9DA 1B9YC 3ZFBA 4IQAA 1EGOA 4LL1B 2FWEA 4V1Ap 4IGJA 2Z9SA 3A2WA 3APOA 1VF2A 4KW6A 3FKFA 2PERA 2FHEA 4I2TA 1OVNA 3KJYA 1G7OA 2XHFA 4GWRA 3TUEA 1WJKA 3CYNA 5F05A 1TRUA 4FYUA 4HS1A 4KDXA 4BL7B 3EVIA 4WEYA 1RK4A 2B1KA 4MH2A 3EU4A 3J7Yb 2IFQB 3ZRDA 1T1VA 2IMFA 4POKA 5DQYA 4N10A 3MSZA 2V1MA 2VL3A 5IMFA 2H6YA 3LGCA 8GSSA 3G9BA 4RI6A 2B6MA 2L6CA 3IC8A 5ECNB 2B1LA 3TRXA 5CREA 3O3TA 2BJXA 1GSYA 3G7JA 2HRKB 3KZQA 3TOUA 5DBQA 1B8XA 5ECOB 4XS4A 2HXKA 2GSQA 2K8SA 5H5RA 1SL1B 4GQFA 2KHPA 3FRCA 2E0QA 2VLUA 3OR5A 3M1GA 4XCSA 2PU9C 3MWHA 2RLIA 5F06A 3E3EA 1TRWA 3IHQA 2GQMA 4IELA 3E0UA 2F9SA 2YANA 3IE3A 2H71A 2M80A 1ZGNA 2NBSA 2QGVA 3FEUA 1TU8A 2QKEA 2HSMA 3PR8A 2C8UA 4LLRA 1OYJA 5IIZA 5J4UA 5HR2A 1V58A 3RAZA 1F37A 2H1DA 4WXTA 3CSJA 4XS4B 4O5RA 3FYGA 2JZTA 1RQMA 4KH7A 3CSHA 1O73A 1Q98A 2DIZA 3D0ZA 2HYXA 3GX0A 2YWIA 2GTUA 4G10A 3RDWA 1TJDA 1ERUA 3R2QA 4KAEA 4G0KA 4NAXA 5CNWA 3VWWA 3TKPA 2HLSA 2OA7A 1LJRA 3SWLA 2R37A 2ON7A 1XZOA 4POLA 1OE8A 4ZBBA 1EWXA 1M99A 3N9JA 4LL4B 4JBBA 4OFNA 4POBA 1SD8A 1EP8A 3GH9A 1SKRB 4AGSA 2H72A 3HKRA 2HZEA 2CVDA 5AN1A 4EC0A 2V6OA 5HQPA 3RBTA 1A8LA 1NHYA 1W89A 3TRQA 3LWAA 4ECBA 2YWMA 3HJPA 1AQVA 2C3TA 3F3QA 4H86A 2H0GA 5IMZA 4AF2A 4IJIA 1S3DA 3QAGA 5FT3A 6GSXA 3KD0A 1A2JA 1S3AA 4HQZA 1XCCA 1U3IA 2R4VA 4MF6A 1U3AA 1O8XA 3ZTLA 1XWBA 1QK8A 3RPPA 3GH6A 2DLXA 1MD4A 5ECKB 5EY6A 2HZEB 2B3SA 4TRXA 3D21A 2V41A 1M2DA 4K0GA 2H6ZA 3KTLA 4L5LA 3QDNA 4MCUA 4KDUA 3GSSA 4N0ZA 3SBCA 4GSSA 1EGRA 1M9BA 5G31A 2DJ1A 4IN0A 1X9WB 5ELAA 3QFBC 2JADA 1IYHA 2B7KA 3WGDA 2F3MA 3JCML 1XW6A 1R5AA
chains in the Genus database with same CATH superfamily
2FWFA 1Z7RA 1MDIA 2GZPA 2O3EA 3QOUA 4K7IA 2C3QA 1H4OA 2OADA 3DRNA 3I69A 3A2XA 1M3IA 4NHZA 2OE1A 3I43A 4F2IA 3H4KA 2PWJA 4EE0A 1ACVA 4TKYA 2O36A 1VF4A 4KCAA 3DGQA 3D4MA 2GSTA 2ES7A 1A2LA 4XIHA 1SL0B 4QL7A 2M72A 2GT5A 9GSSA 4YKGA 1VGLA 2WCIA 2C0FA 4G2EA 1GTUA 5IO2A 1GH2A 3TB2A 2PMTA 1B48A 3MYDA 3ZZXA 1XIYA 4ZL8A 4L8EA 4JR6A 2KOKA 3UBLA 3C8EA 3GL5A 3GNJA 1FB6A 3IR4A 4G9HA 4HZ4A 4F03A 3P2AA 4PQIA 3KP8A 1SYRA 1DE1A 1SVLA 5D9WA 4MK3A 5INYA 1DBYA 4IVFA 1Q4JA 1R5PA 4WR5A 4DSRA 12GSA 2GVPA 3QAWA 5IMAA 5DALA 5BMUA 1AUCA 2VD1A 3LEFA 1Z7PA 1M2BA 4AJ7A 1AAZA 4BA7A 1SKSB 1TI3A 1A2MA 1JZWA 4XS6A 2HFDA 2AAWA 2XPDA 3CXGA 1G0TA 2BMXA 5F07A 5H5QA 2WGRA 4PX1A 2H1LA 2UZ8A 2G0FA 5GSSA 5ECQB 3GKMA 3FHKA 4ILFA 4TVEA 4TOPA 3KIJA 4CDOA 1KTEA 3PH9A 17GSA 5ECRB 1ZYQB 1EZKA 2YCDA 3LXZA 4KUNA 3BCKA 5ELGA 1EOHA 4PUFC 4XHMA 3C7MA 5ECIB 4HU7A 2H70A 1TKDB 3ZIVA 4KNDA 1PGTA 4Q5RA 3DYRA 3F63A 1YDKA 3DMLA 2AJQB 3P7XA 5BMUB 2FD3A 2DJ0A 2KP1A 2WW2A 5LD0A 5CRHA 3HDCA 3U5RE 1YEPA 1ZOFA 2FUG2 1BG5A 2L5LA 4KA0A 1USBA 5GAND 1AIUA 2CA8A 2LUSA 5ABRA 2OT3A 1Z6NA 5KN1A 4OO5A 2A2RA 3IPZA 3UVTA 1GP1A 3FZ9A 1EP7A 5CAXA 1ON4A 4GXZA 2LKUA 3LORA 1TK8B 4HOJA 3UVHA 4PUAA 3DXBA 1GWCA 3EURA 3HA9A 2R0CA 1XW9A 3HJMA 4GSNA 3BOAA 1YZXA 5IO0A 1V40A 3L9SA 2N5FA 3TJGA 1SD9A 3M8NA 2VLTA 3EWLA 4IJ3A 1NSWA 1QUWA 2C0DA 5HR0A 1GSQA 4KB3A 5J5NA 2D2ZA 3Q6OA 5AIVA 2MMOA 1FVJA 4MH3A 6GSWA 3M9KA 5LCZA 1XXUA 3UJ1A 3A3TA 3GSTA 4IP6A 1XWAA 1GNEA 4GRFA 2GSSA 1AQXA 2H75A 3EE2A 1LBKA 2RM5A 2PPTA 4FXYP 3A5IA 2MMZA 1ILOA 18GSA 2B5XA 4YQUA 1TXUA 1ZYNA 3IHGA 1X9MB 5ECMB 4EL1A 1MDJA 4EDZA 3UOMA 5J4YA 3CHXC 2H30A 1YKAA 3H1NA 1TRSA 1FW1A 4G0LA 3F4SA 1HNAA 1PA3A 3HMJG 4ULXA 4IHUA 3LFLA 22GSA 3DVXA 1GRXA 2DJKA 4YQMA 4Z2RA 1GNWA 2I81A 5B8AA 5A4UA 2IFQA 4QQ7A 1O81A 2TRCP 5ENUA 5IOWA 2PVQA 4V2MA 2VL2C 5L71A 3LG6A 1E2YA 1WMJA 5EPFA 4PURA 2X4AA 4Z7XA 3F9UA 4MABA 4CY8A 3LSZA 3HCZA 3G7IA 4EXJA 5AGYA 2VM2A 4MJAA 2YJHA 19GSA 1FHEA 3ERGA 1T3BA 2IMIA 1VRSD 6GSVA 2HRKA 1PSQA 1URMA 4KE3A 2MMAA 4QMKA 4E8EA 2B7JA 4MZWA 2VL2A 4K9ZA 4RQXA 1PX6A 2WFCA 3KGKA 2CZ3A 5C04A 3UAPA 4ZIJA 1IYIA 4P3YB 3EPTA 2EC4A 5A34A 4KCEA 2DJJA 2RM6A 1O7UA 2JSZA 2XPEA 4I6XA 4V2LA 4AKXB 2HI7A 4WR4A 1A8YA 2QSIA 1F6MC 1GTIA 2KP2A 2HRFA 4Q5NA 2MYGA 2YNXA 3GUSA 2WDUA 5COHA 2TIRA 1EV4A 3WT2A 1ZCPA 2P5RA 1A23A 1BF5A 2ON5A 3ZFLA 4EVMA 1SK1A 1F3AA 4MJCA 4E68A 2X99A 4DVCA 1KNGA 1M2AA 2EFCA 1TTZA 2H8LA 3IK9A 2WS2A 3U6VA 2OE3A 3K8NA 4I5QA 3FW2A 20GSA 4ZBAA 2AYTA 1TDIA 4OFTA 4RQRA 4TR3A 5A34B 1TK5B 1XWCA 1SVMA 4ML6A 1CQGA 2WRTA 3R3EA 2PGTA 4JEDA 1E6BA 3RPNA 2BTOT 1GTBA 5GZZB 4MPFA 2YJ7A 4N11A 4EKZA 5CRGA 1XPVA 1MDKA 2E7PA 3ME7A 2JL4A 2WULA 2P0GA 5ID2B 4IKHA 3KP9A 2UV8G 2LJAA 3RHBA 4ZL7A 1XWKA 3ZL5A 3ZVJD 4DSQA 1EV9A 2DBCA 1J0FA 2ZCTA 1JZDA 4AJ8A 4PQ1A 5LNKe 3H79A 5A5HA 4K7OA 1JHBA 3LQ7A 1TRVA 3BCIA 2R0GA 6GSUA 1FG4A 5F0GA 1BAYA 2JZRA 4GSTA 4NHWA 5CRWA 2VCTA 2DIYA 6GSTA 5A4VA 2R5GA 3D4TA 5IPGA 1GSFA 1XOBA 2I9HA 1DE2A 1SK2A 4MPGA 2R6KA 4EO3A 2LNTA 5JCUA 2K18A 2HZFA 1W4VA 1N25A 3GURA 1EEMA 1M0UA 4WF5A 5JWRB 2MBTA 3PPUA 1YKCA 5HR3A 4CY6A 5D9XA 3ZITA 1K0MA 5E4WA 2P5QA 4DSSB 2GZYA 5DJLA 2V32A 5A5HB 5CO3A 4L5OA 2MZCA 3EMPA 2LEGA 5DAKA 2R2JA 1YF1A 4HSCX 2FGXA 4GCIA 16GSA 3TJBA 4PGTA 1TP9A 4GF0A 4LMWA 3EINA 1OC9B 3L0HA 4HJMA 3RHCA 4G0IA 2OACA 3CRTA 4BVYA 4FYCA 2VCZA 2X64A 3HZ8A 3Q19A 3US3A 3VK9A 1AQWA 4D73A 5G1KA 2DSAA 2HT9A 4N3ZA 4BVXA 4TXOB 4I97A 4ML1A 2A2SA 4MJEA 1S3CA 2VM1A 3FK8A 2C80A 5DAKB 4KDYA 2CV4A 1F2EA 4ZILA 1AW9A 4X1UA 2LSTA 3ZLPA 3KCMA 1WE0A 4ZXGA 4ISDA 4YAVA 14GSA 2JSYA 5BRTA 2N5BA 5B6MA 3MAKA 5J9BA 2WZ9A 5EL8A 1X5DA 5AISA 3RFRC 4BVYB 1N8JA 5KN3A 1THXA 2HSYA 4D73B 5IOXA 4FQUA 1GUMA 3HD5A 4BVXB 4KGIA 1F3BA 5B8BA 1QGVA 3M9JA 3DWVA 1ML6A 2L4QA 1ZYPA 2CAQA 1T00A 3NOFA 4G19A 1SJ6A 1G6YA 1SJZA 2X8CA 2YOIA 2OBIA 2KUCA 1GLQA 4GTUA 3HZ4A 2LNSA 3IRAA 3TGZA 5FWGA 2PVOC 4N30A 5HR1A 4KF9A 3BBYA 1WRYA 4HQSA 4PNFA 1OKTA 3GL3A 11GSA 1F9MA 2YWOA 1WWJA 3ME8A 1ZMAA 2HE3A 1FO5A 4O92A 2AHEA 2LQOA 5JWQB 1A24A 4OMVA 2VKZG 4NWYA 4AKHA 2YN1A 2H1GA 2ZNMA 1Z3EA 4K5SA 4WBJA 3TKSE 4EIQA 5E59A 1XBSA 1WOUA 3N5OA 5D73A 2WVYA 4POMA 4BPYA 2OBKA 5J4VA 2EFDA 2IPAA 4RI7A 2DJ3A 4Q5QA 2CX3A 2RUEA 2O7KA 1SKWB 2JACA 1WP0A 2FWHA 3DD3A 1THOA 3C1SA 2CT6A 3BJ5A 1K3YA 2L4CA 1ABAA 5JCGA 3TJFA 4X4JA 2X49A 1ZL9A 3GKXA 2HSNB 4JZQA 2PUKC 1QXHA 2VCVA 4OCEA 1PQNA 4YH2A 2LV3A 2NTOA 1HD2A 2VL9A 1PX7A 2CAIA 1GSEA 2REMA 4HEA2 2XBIA 3TU3B 3APSA 3VWXA 3GTUA 3FY7A 3HVVA 3NIVA 2DKHA 1R7HA 2GZZA 2IJYA 2YZUA 2WVZA 2CVKA 5KN0A 3H8QA 1N2AA 4ZL9A 4HU9A 4GQCA 2HQTA 4OFMA 4LA1A 2WB9A 1M3JA 2GT6A 1LU4A 1TOFA 5B6NA 3HXSA 2ZUPA 4MP4A 3DKSA 2LTKA 2AV4A 2N5AA 1NM3A 3A5WA 4FO5A 4BIKA 3S9FA 4MF5A 5B7CA 3IV4A 4KX4A 2L59A 4ECCA 1AC1A 5CYYA 1T8EB 2VOCA 1MEKA 1BJXA 3CTGA 1XW5A 3D22A 3QFAC 3UIWA 1UA5A 2G2QA 1FAAA 4K5RA 3ED3A 5C00A 2GQKA 3F3RA 1B9XC 1V9WA 3GTUB 3APQA 4IQ1A 3AY8A 3HYPA 2H73A 4ID0A 3W8JA 2WJUA 1EEJA 1VF1A 3KH7A 3IAS2 5D9VA 3FR9A 5KOWA 1RW1A 2H74A 2V6KA 2HSHA 2LRNA 2FY6A 4J56E 3GA4A 2OKAA 5A4WA 3L78A 3PGTA 4JU5A 5H5SA 1TW9A 3WGEA 2GQLA 2C0EA 5G1LA 1XOAA 1K0BA 1G6WA 2YV9A 1GSDA 3GV1A 2DC5A 3GHAA 2GDRA 4YAPA 2F8AA 1GTAA 3ERWA 1SYXA 3WT1A 3ISOA 1YQ1A 3QCPA 4IBPA 1Z9HA 2YV7A 1BG1A 3KEBA 3QMXA 1J08A 2AUVA 1H75A 3WYWA 2IMEA 3L9UA 4K1FA 3F0IA 1CQHA 3CSIA 5IMDA 1O8WA 2O87A 1OAZA 3M0FA 1UVZA 3GKKA 4BWQA 3KMNA 3I6AA 2L5OA 1B4PA 2RIIA 2RUFA 3O6TA 1NW2A 6GSYA 2FWGA 5IPHA 2H66A 1X9SB 2VO4A 3KM6A 1YY7A 1BEDA 4K7NA 1YEWC 3ZMLA 2IMDA 1V98A 3G7YA 2EFHA 2LQQA 5IM9A 1B4QA 3VWVA 1K0OA 2DMLA 3KMOA 4MZCA 3UARA 5D9TA 4OO4A 4WBRD 2CVBA 4I8BA 4IW9A 3BD2A 1V57A 5ID2A 4BWSA 3GMFA 2E2MA 3HVNA 3IA1A 1BQ7A 4X0XA 4IS0A 1S4BP 2VCXA 1PL2A 5D96A 5IMCA 1K0AA 4MF7A 2DMMA 3MNGA 3IOSA 1M9AA 1A0RP 2MBSA 2E2GA 4KSOA 1G7EA 4ECJA 1ERVA 2K8VA 3VPTA 1QQ2A 1ERWA 5HFKA 2CZ2A 1XWGA 4TW5A 4FH8A 2B5YA 4TN8A 3D6IA 3A2VA 4MDCA 3TJJA 2VIMA 3MIXA 3UL3A 2F8FA 3GFKA 4LMVA 5HFGA 2IMKA 2L57A 4USSA 2IIYA 3ZVJA 4EF0A 4PTSA 3PINA 5CRDA 2K9FA 3O76A 4RUVA 1ZZYA 3LXTA 3GRXA 4DSSA 2FLSA 3D5JA 1YF0A 5GSTA 1R4WA 5EVOA 1TK0B 3ERFA 1I1IP 1XVWA 2A4VA 3C73A 1GUHA 1FOVA 2YPMA 5ECLB 1ERTA 3L4NA 5D8IA 1OKDA 4JRRA 3LW9A 4ICYA 1OC9A 4HI7A 4MMMA 2QC7A 2XBQA 4YQVA 1BX9A 2I4AA 3DIEA 2FCHA 1AXDA 1MTCA 2GLRA 2WW3A 3ZREA 1SL2B 3GYKA 1A0FA 2HSMB 1X5CA 4TXVA 2WVXA 4Z2UA 4EUYA 4X43A 4TXOA 1GULA 1PN9A 1GL8A 1GLPA 2O85A 1U6TA 1HNCA 1M7TA 4FIWA 3EMXA 2O89A 4MLYA 3W8SA 1SJIA 4MA9A 2GSRA 4WF4A 2B5EA 2H01A 1T4ZA 5IQYA 5D93A 5IMVA 1T4YA 2OJLA 1VF3A 3VWUA 2R0PA 2J23A 2GS3A 4PHZC 3EYTA 2VD0A 2HRNA 3ZIJA 2F51A 3GX8A 3HY2A 3IXRA 2KLXA 2FA8A 2JZSA 2NVLA 4MZBA 1K3LA 2WVXB 1KBNA 3J7Yk 1KEBA 3CRUA 7GSSA 2LRCA 1K0CA 1XFLA 3V1WA 3FZ5A 1PN0A 1WPIA 5G30A 4EDYA 3CTFA 4PI2C 5ECSA 1TI1A 1HNBA 2H6XA 1Z6MA 5A5KA 4PXOA 4N0VA 1NHOA 4O32A 4L0WA 3IK7A 3TKQA 1MD3A 5KEJA 4XRAA 3ZMKA 3EC3A 4NPBA 3GKNA 1GSSA 4J2FA 1U88A 1OC3A 3F6FA 4MJBA 5DDLA 3QD9A 2LRTA 4PQHA 1YEXA 1Y6EA 2NDOA 4I2UA 4KSMA 2J9HA 3TRPA 2CX4A 4OWYA 2H1AA 4NMUA 1U87A 5CP1A 5A1NA 1JLVA 3FR3A 1FB0A 2LS5A 2C0GA 3HHVA 4AKGA 4GLTA 4JR4A 1JZRA 4W66A 4ZB6A 4K8MA 4F9ZA 1OC8A 1PL1A 2IWTA 5GAPD 3M3MA 2PBJA 2VCWA 4DEJA 6GSSA 3GIXA 3FMWA 4QL9A 3IDVA 3KH9A 1OE7A 1PKWA 4PNGA 2LJKA 4E8HA 3LYKA 2VLVA 3F4RA 4K2DA 2V2GA 1GSUA 4HDEA 4XS1A 4ZBDA 5HFIA 2OE0A 4WKWA 1PRXA 1ST9A 4F0CA 3FZAA 2P31A 5J3RA 1I5GA 2GGTA 1SK0A 2HSNA 1QFNA 5KN2A 1DSBA 1K3OA 3TJKA 1SVOA 5A1NB 5G2ZA 3H93A 3P90A 4IP1A 3HVXA 4F0BA 2ALBA 3W6GA 1UN2A 2VCQA 5DCGA 2NPBA 3VFIA 5DCHA 1XVQA 2AB6A 3TOTA 4F82A 4ZB8A 4CW9A 1X0RA 2H1BA 2YP6A 1JLWA 2IL3A 2CQ9A 2YZHA 4GDFA 2EIRA 2C1YA 2I1UA 4TR4A 1BYEA 1PD21 2M46A 4O5UA 4AJ6A 2O8VB 1EOGA 1SENA 13GSA 2IN3A 2H0HA 3WGXA 3NZNA 2VAFA 2HRAA 2EIOA 2C3NA 3GN3A 5JCWA 4V1Ag 2C4JA 3KTBA 1R26A 1HQOA 3C1RA 3VPQA 3UMAA 1TXXA 2TRXA 3UBKA 3LYPA 5J41A 5DALB 2FA4A 1V2AA 2L6DA 2A2PA 1J9BA 4K6XA 2QA2A 3E9JB 4L0UA 4ACSA 1YJ6A 3QPMA 5DQSA 2HNLA 2LJRA 4V2NA 2JU5A 2DJ2A 1C72A 4HUAA 4TR1A 5F8BA 1UC7A 1O6JA 2X8HA 3WD6A 2MMNA 4NXIA 3VI5A 4MNNA 5G5FA 5ECHB 3TKSC 2K6VA 2DKIA 1PKZA 3L9VA 2H76A 1PMTA 3CBUA 4HZ2A 3TKRA 3IC4A 4HJ2A 3ZYWA 3TDGA 3FZ4A 3Q74A 10GSA 4K0NA 3VURA 3F4TA 3DVWA 2WW1A 1FVKA 1T7PB 3QAVA 5G5EA 2R3XA 1K0DA 2X8GA 1YVLA 5AIXA 3IBHA 3VI7A 4TR1B 3TKSA 4ZB9A 1WIKA 1SU9A 1Z5YE 5DVBA 4Q5FA 2I3YA 1O85A 3VLNA 3P8WA 4NV2A 1K0NA 2H19A 2H0IA 3EU3A 3CMIA 4FYBA 3F6DA 2FNOA 4TR0A 1Y1UA 3TCOA 5J40A 2PN8A 1GUKA 1X5EA 3UEMA 4PI0C 1JZOA 1DUGA 4O7HA 2VUPA 1Y25A 3HJOA 4J57E 4XRDA 5DJMA 5FHIA 5JWOB 4OD7A 3I9V2 1FOHA 4ECIA 5ECPB 2EIQA 3DEXA 1QMVA 4CHSA 4YKFA 4NV5A 3LJRA 1JFUA 3F8UA 4JE1A 4OCFA 4BL7A 3C71A 3CQFA 3FR6A 1ZYEA 3HVSA 5J9CA 2XC2A 3QR6A 3IAM2 1TU7A 1HYUA 4Z2TA 2YWNA 4XTSA 4WETA 3Q18A 3KXOA 3MDKA 1I9DA 1B9YC 3ZFBA 4IQAA 1EGOA 4LL1B 2FWEA 4V1Ap 4G01A 4IGJA 2Z9SA 3A2WA 3APOA 1VF2A 4KW6A 3FKFA 2PERA 2FHEA 4I2TA 1OVNA 4A5PA 3KJYA 1G7OA 2XHFA 4GWRA 3TUEA 1WJKA 3CYNA 5F05A 1TRUA 4FYUA 4HS1A 4KDXA 4BL7B 3EVIA 4WEYA 1RK4A 2B1KA 4MH2A 3EU4A 3J7Yb 2IFQB 3ZRDA 2EFEA 1T1VA 2IMFA 4POKA 4AKIA 4N10A 5DQYA 3MSZA 2O5VA 2V1MA 2VL3A 5IMFA 1XG8A 3RGBC 2H6YA 3LGCA 4K2XA 1PFOA 8GSSA 3G9BA 4RI6A 4ZB7A 2B6MA 2L6CA 3IC8A 5ECNB 2B1LA 2A4HA 3TRXA 5CREA 3O3TA 2BJXA 1GSYA 3G7JA 2HRKB 3KZQA 3TOUA 5DBQA 1B8XA 4EIPA 5ECOB 4XS4A 2HXKA 2GSQA 2K8SA 5H5RA 1SL1B 4GQFA 2KHPA 3FRCA 2E0QA 2VLUA 3OR5A 3M1GA 4XCSA 2PU9C 3MWHA 2RLIA 5F06A 3E3EA 1TRWA 3IHQA 2GQMA 4IELA 3E0UA 2F9SA 2YANA 3IE3A 2H71A 2M80A 1ZGNA 2NBSA 2QGVA 3FEUA 1TU8A 2QKEA 2HSMA 3PR8A 2C8UA 4LLRA 1OYJA 5IIZA 5J4UA 5HR2A 1V58A 3RAZA 1F37A 2H1DA 2QA1A 4WXTA 3CSJA 4XS4B 4O5RA 3FYGA 2JZTA 1RQMA 4KH7A 3CSHA 1O73A 1Q98A 2DIZA 3D0ZA 2HYXA 3GX0A 2YWIA 2GTUA 4G10A 3RDWA 1TJDA 1ERUA 3R2QA 4KAEA 4G0KA 4NAXA 5CNWA 3VWWA 3TKPA 2HLSA 2OA7A 2WW0A 4AI6A 1LJRA 3SWLA 2R37A 2ON7A 1XZOA 4POLA 1S3RA 1OE8A 4ZBBA 1EWXA 1M99A 3N9JA 4LL4B 4JBBA 4OFNA 4POBA 1SD8A 1EP8A 3GH9A 1SKRB 4AGSA 2H72A 3HKRA 2HZEA 2CVDA 5AN1A 4EC0A 2V6OA 5HQPA 3CWGA 3RBTA 1A8LA 1NHYA 1W89A 3TRQA 3LWAA 4ECBA 2YWMA 3HJPA 1AQVA 2C3TA 3F3QA 4H86A 2H0GA 5IMZA 4AF2A 4IJIA 1S3DA 3QAGA 5FT3A 6GSXA 3KD0A 1A2JA 1S3AA 4HQZA 1XCCA 5KOXA 1U3IA 2R4VA 4MF6A 1U3AA 1O8XA 3ZTLA 5J47A 1XWBA 1QK8A 3RPPA 3GH6A 2DLXA 1MD4A 5ECKB 5EY6A 2HZEB 2B3SA 4TRXA 3D21A 2V41A 1M2DA 4K0GA 2H6ZA 3KTLA 4O5QA 4L5LA 3QDNA 4MCUA 4KDUA 3GSSA 4N0ZA 3SBCA 4GSSA 1EGRA 1M9BA 5G31A 2DJ1A 4IN0A 1X9WB 5ELAA 2WZSA 3QFBC 2JADA 1IYHA 2B7KA 3WGDA 2F3MA 3JCML 1XW6A 1R5AA
chains in the Genus database with same CATH topology
2FWFA 1Z7RA 1MDIA 2GZPA 3QOUA 4K7IA 2C3QA 1H4OA 2OADA 3DRNA 3I69A 3A2XA 4NHZA 2OE1A 3I43A 4F2IA 3H4KA 2PWJA 4EE0A 1ACVA 4TKYA 1VF4A 4KCAA 3DGQA 3D4MA 2GSTA 2ES7A 1A2LA 4XIHA 1SL0B 4QL7A 2M72A 2GT5A 9GSSA 4YKGA 1VGLA 2WCIA 2C0FA 4G2EA 1GTUA 5IO2A 1GH2A 3TB2A 2PMTA 1B48A 3MYDA 3ZZXA 1XIYA 4ZL8A 4L8EA 4JR6A 2KOKA 3UBLA 3C8EA 3GL5A 3GNJA 1FB6A 3IR4A 4G9HA 4HZ4A 4F03A 3P2AA 4PQIA 3KP8A 1SYRA 1DE1A 1SVLA 5D9WA 4MK3A 5INYA 1DBYA 4IVFA 1Q4JA 1R5PA 4WR5A 4DSRA 12GSA 2GVPA 3QAWA 5IMAA 5DALA 5BMUA 1AUCA 2VD1A 3LEFA 1Z7PA 1M2BA 4AJ7A 1AAZA 4BA7A 1SKSB 1TI3A 1A2MA 1JZWA 4XS6A 2HFDA 2AAWA 2XPDA 3CXGA 1G0TA 2BMXA 5F07A 5H5QA 2WGRA 4PX1A 2H1LA 2UZ8A 2G0FA 5GSSA 5ECQB 3GKMA 3FHKA 4ILFA 4TVEA 4TOPA 3KIJA 4CDOA 1KTEA 3PH9A 17GSA 5ECRB 1ZYQB 1EZKA 2YCDA 3LXZA 4KUNA 3BCKA 5ELGA 1EOHA 4PUFC 4XHMA 3C7MA 5ECIB 4HU7A 2H70A 1TKDB 3ZIVA 4KNDA 1PGTA 4Q5RA 3DYRA 3F63A 1YDKA 3DMLA 2AJQB 3P7XA 5BMUB 2FD3A 2DJ0A 2KP1A 5LD0A 5CRHA 3HDCA 3U5RE 1YEPA 1ZOFA 2FUG2 1BG5A 2L5LA 4KA0A 1USBA 5GAND 1AIUA 2CA8A 2LUSA 5ABRA 2OT3A 1Z6NA 5KN1A 4OO5A 2A2RA 3IPZA 3UVTA 1GP1A 3FZ9A 1EP7A 5CAXA 1ON4A 4GXZA 2LKUA 3LORA 1TK8B 4HOJA 3UVHA 4PUAA 3DXBA 1GWCA 3EURA 3HA9A 2R0CA 1XW9A 3HJMA 4GSNA 3BOAA 1YZXA 5IO0A 3L9SA 1V40A 2N5FA 3TJGA 1SD9A 3M8NA 2VLTA 3EWLA 4IJ3A 1NSWA 1QUWA 2C0DA 5HR0A 1GSQA 4KB3A 5J5NA 2D2ZA 3Q6OA 5AIVA 2MMOA 1FVJA 4MH3A 6GSWA 3M9KA 5LCZA 1XXUA 3UJ1A 3A3TA 3GSTA 4IP6A 1XWAA 1GNEA 4GRFA 2GSSA 1AQXA 2H75A 3EE2A 1LBKA 2RM5A 2PPTA 3A5IA 2MMZA 1ILOA 18GSA 2B5XA 4YQUA 1TXUA 1ZYNA 3IHGA 1X9MB 5ECMB 4EL1A 1MDJA 4EDZA 3UOMA 5J4YA 2H30A 1YKAA 3H1NA 1TRSA 1FW1A 4G0LA 3F4SA 1HNAA 1PA3A 3HMJG 4ULXA 4IHUA 3LFLA 22GSA 3DVXA 1GRXA 2DJKA 4YQMA 4Z2RA 1GNWA 2I81A 5B8AA 5A4UA 2IFQA 4QQ7A 1O81A 2TRCP 5ENUA 5IOWA 2PVQA 4V2MA 2VL2C 5L71A 3LG6A 1E2YA 1WMJA 5EPFA 4PURA 2X4AA 4Z7XA 3F9UA 4MABA 4CY8A 3LSZA 3HCZA 3G7IA 4EXJA 5AGYA 2VM2A 4MJAA 2YJHA 19GSA 1FHEA 3ERGA 1T3BA 2IMIA 1VRSD 6GSVA 2HRKA 1PSQA 1URMA 4KE3A 2MMAA 4QMKA 4E8EA 2B7JA 4MZWA 2VL2A 4K9ZA 4RQXA 1PX6A 2WFCA 3KGKA 2CZ3A 5C04A 3UAPA 4ZIJA 1IYIA 4P3YB 3EPTA 2EC4A 5A34A 4KCEA 2DJJA 2RM6A 1O7UA 2JSZA 2XPEA 4I6XA 4V2LA 4AKXB 2HI7A 4WR4A 1A8YA 2QSIA 1F6MC 1GTIA 2KP2A 2HRFA 4Q5NA 2MYGA 2YNXA 3GUSA 2WDUA 5COHA 2TIRA 1EV4A 3WT2A 1ZCPA 2P5RA 1A23A 1BF5A 2ON5A 3ZFLA 4EVMA 1SK1A 1F3AA 4MJCA 4E68A 2X99A 4DVCA 1KNGA 1M2AA 2EFCA 1TTZA 2H8LA 3IK9A 2WS2A 3U6VA 2OE3A 3K8NA 4I5QA 3FW2A 20GSA 4ZBAA 2AYTA 1TDIA 4OFTA 4RQRA 4TR3A 5A34B 1TK5B 1XWCA 1SVMA 4ML6A 1CQGA 2WRTA 3R3EA 2PGTA 4JEDA 1E6BA 3RPNA 2BTOT 1GTBA 5GZZB 4MPFA 2YJ7A 4N11A 4EKZA 5CRGA 1XPVA 1MDKA 2E7PA 3ME7A 2JL4A 2WULA 2P0GA 5ID2B 4IKHA 3KP9A 2UV8G 2LJAA 3RHBA 4ZL7A 1XWKA 3ZL5A 3ZVJD 4DSQA 1EV9A 2DBCA 1J0FA 2ZCTA 1JZDA 4AJ8A 4PQ1A 5LNKe 3H79A 5A5HA 4K7OA 1JHBA 3LQ7A 1TRVA 3BCIA 2R0GA 6GSUA 1FG4A 5F0GA 1BAYA 2JZRA 4GSTA 4NHWA 5CRWA 2VCTA 2DIYA 6GSTA 5A4VA 2R5GA 3D4TA 5IPGA 1GSFA 1XOBA 2I9HA 1DE2A 1SK2A 4MPGA 2R6KA 4EO3A 2LNTA 5JCUA 2K18A 2HZFA 1W4VA 1N25A 3GURA 1EEMA 1M0UA 4WF5A 5JWRB 2MBTA 3PPUA 1YKCA 5HR3A 4CY6A 5D9XA 3ZITA 1K0MA 5E4WA 2P5QA 4DSSB 2GZYA 5DJLA 2V32A 5A5HB 5CO3A 4L5OA 2MZCA 3EMPA 2LEGA 5DAKA 2R2JA 1YF1A 2FGXA 4GCIA 16GSA 3TJBA 4PGTA 1TP9A 4GF0A 4LMWA 3EINA 1OC9B 3L0HA 4HJMA 3RHCA 4G0IA 2OACA 3CRTA 4BVYA 4FYCA 2VCZA 2X64A 3HZ8A 3Q19A 3US3A 3VK9A 1AQWA 4D73A 5G1KA 2DSAA 2HT9A 4N3ZA 4BVXA 4TXOB 4I97A 4ML1A 2A2SA 4MJEA 1S3CA 2VM1A 3FK8A 2C80A 5DAKB 4KDYA 2CV4A 1F2EA 4ZILA 1AW9A 4X1UA 2LSTA 3ZLPA 3KCMA 1WE0A 4ZXGA 4ISDA 4YAVA 14GSA 2JSYA 5BRTA 2N5BA 5B6MA 3MAKA 5J9BA 2WZ9A 5EL8A 1X5DA 5AISA 4BVYB 1N8JA 5KN3A 1THXA 2HSYA 4D73B 5IOXA 4FQUA 1GUMA 3HD5A 4BVXB 4KGIA 1F3BA 5B8BA 1QGVA 3M9JA 3DWVA 1ML6A 2L4QA 1ZYPA 2CAQA 1T00A 3NOFA 4G19A 1SJ6A 1G6YA 1SJZA 2X8CA 2YOIA 2OBIA 2KUCA 1GLQA 4GTUA 3HZ4A 2LNSA 3IRAA 3TGZA 5FWGA 2PVOC 4N30A 5HR1A 4KF9A 3BBYA 1WRYA 4HQSA 4PNFA 1OKTA 3GL3A 11GSA 1F9MA 2YWOA 1WWJA 3ME8A 1ZMAA 2HE3A 1FO5A 4O92A 2AHEA 2LQOA 5JWQB 1A24A 4OMVA 2VKZG 4NWYA 4AKHA 2YN1A 2H1GA 2ZNMA 1Z3EA 4K5SA 4WBJA 3TKSE 4EIQA 5E59A 1XBSA 1WOUA 3N5OA 5D73A 4POMA 4BPYA 2OBKA 5J4VA 2EFDA 2IPAA 4RI7A 2DJ3A 4Q5QA 2CX3A 2RUEA 2O7KA 1SKWB 2JACA 1WP0A 2FWHA 3DD3A 1THOA 3C1SA 2CT6A 3BJ5A 1K3YA 2L4CA 1ABAA 5JCGA 3TJFA 4X4JA 2X49A 1ZL9A 3GKXA 2HSNB 4JZQA 2PUKC 1QXHA 2VCVA 4OCEA 1PQNA 4YH2A 2LV3A 2NTOA 1HD2A 2VL9A 1PX7A 2CAIA 1GSEA 2REMA 4HEA2 2XBIA 3TU3B 3APSA 3VWXA 3GTUA 3FY7A 3HVVA 3NIVA 2DKHA 1R7HA 2GZZA 2IJYA 2YZUA 2CVKA 5KN0A 3H8QA 1N2AA 4ZL9A 4HU9A 4GQCA 2HQTA 4OFMA 4LA1A 2WB9A 2GT6A 1LU4A 1TOFA 5B6NA 3HXSA 2ZUPA 4MP4A 3DKSA 2LTKA 2AV4A 2N5AA 1NM3A 3A5WA 4FO5A 3S9FA 4MF5A 5B7CA 3IV4A 4KX4A 2L59A 4ECCA 1AC1A 5CYYA 1T8EB 2VOCA 1MEKA 1BJXA 3CTGA 1XW5A 3D22A 3QFAC 3UIWA 1UA5A 2G2QA 1FAAA 4K5RA 3ED3A 5C00A 2GQKA 3F3RA 1B9XC 1V9WA 3GTUB 3APQA 4IQ1A 3AY8A 3HYPA 2H73A 4ID0A 3W8JA 2WJUA 1EEJA 1VF1A 3KH7A 3IAS2 5D9VA 3FR9A 5KOWA 1RW1A 2H74A 2V6KA 2HSHA 2LRNA 2FY6A 4J56E 3GA4A 2OKAA 5A4WA 3L78A 3PGTA 4JU5A 5H5SA 1TW9A 3WGEA 2GQLA 2C0EA 5G1LA 1XOAA 1K0BA 1G6WA 2YV9A 1GSDA 3GV1A 2DC5A 3GHAA 2GDRA 4YAPA 2F8AA 1GTAA 3ERWA 1SYXA 3WT1A 3ISOA 1YQ1A 3QCPA 4IBPA 1Z9HA 2YV7A 1BG1A 3KEBA 3QMXA 1J08A 2AUVA 1H75A 3WYWA 2IMEA 3L9UA 4K1FA 3F0IA 1CQHA 3CSIA 5IMDA 1O8WA 2O87A 1OAZA 3M0FA 1UVZA 3GKKA 4BWQA 3KMNA 3I6AA 2L5OA 1B4PA 2RIIA 2RUFA 3O6TA 1NW2A 6GSYA 2FWGA 5IPHA 2H66A 1X9SB 2VO4A 3KM6A 1YY7A 1BEDA 4K7NA 3ZMLA 2IMDA 1V98A 3G7YA 2EFHA 2LQQA 5IM9A 1B4QA 3VWVA 1K0OA 2DMLA 3KMOA 4MZCA 3UARA 5D9TA 4OO4A 4WBRD 2CVBA 4I8BA 4IW9A 3BD2A 1V57A 5ID2A 4BWSA 3GMFA 2E2MA 3IA1A 1BQ7A 4X0XA 4IS0A 2VCXA 1PL2A 5D96A 5IMCA 1K0AA 4MF7A 2DMMA 3MNGA 3IOSA 1M9AA 1A0RP 2MBSA 2E2GA 4KSOA 1G7EA 4ECJA 1ERVA 2K8VA 3VPTA 1QQ2A 1ERWA 5HFKA 2CZ2A 1XWGA 4TW5A 4FH8A 2B5YA 4TN8A 3D6IA 3A2VA 4MDCA 3TJJA 2VIMA 3MIXA 3UL3A 2F8FA 3GFKA 4LMVA 5HFGA 2IMKA 2L57A 4USSA 2IIYA 3ZVJA 4EF0A 4PTSA 3PINA 5CRDA 2K9FA 3O76A 4RUVA 1ZZYA 3LXTA 3GRXA 4DSSA 2FLSA 3D5JA 1YF0A 5GSTA 1R4WA 5EVOA 1TK0B 3ERFA 1XVWA 2A4VA 3C73A 1GUHA 1FOVA 2YPMA 5ECLB 1ERTA 3L4NA 5D8IA 1OKDA 4JRRA 3LW9A 4ICYA 1OC9A 4HI7A 4MMMA 2QC7A 2XBQA 4YQVA 1BX9A 2I4AA 3DIEA 2FCHA 1AXDA 1MTCA 2GLRA 3ZREA 1SL2B 3GYKA 1A0FA 2HSMB 1X5CA 4TXVA 4Z2UA 4EUYA 4X43A 4TXOA 1GULA 1PN9A 1GL8A 1GLPA 2O85A 1U6TA 1HNCA 1M7TA 4FIWA 3EMXA 2O89A 4MLYA 3W8SA 1SJIA 4MA9A 2GSRA 4WF4A 2B5EA 2H01A 1T4ZA 5IQYA 5D93A 5IMVA 1T4YA 2OJLA 1VF3A 3VWUA 2R0PA 2J23A 2GS3A 3EYTA 2VD0A 2HRNA 3ZIJA 2F51A 3GX8A 3HY2A 3IXRA 2KLXA 2FA8A 2JZSA 2NVLA 4MZBA 1K3LA 1KBNA 3J7Yk 1KEBA 3CRUA 7GSSA 2LRCA 1K0CA 1XFLA 3V1WA 3FZ5A 1PN0A 1WPIA 5G30A 4EDYA 3CTFA 5ECSA 1TI1A 1HNBA 2H6XA 1Z6MA 5A5KA 4PXOA 4N0VA 1NHOA 4O32A 4L0WA 3IK7A 3TKQA 1MD3A 5KEJA 4XRAA 3ZMKA 3EC3A 4NPBA 3GKNA 1GSSA 4J2FA 1U88A 1OC3A 3F6FA 4MJBA 5DDLA 3QD9A 2LRTA 4PQHA 1YEXA 1Y6EA 2NDOA 4I2UA 4KSMA 2J9HA 3TRPA 2CX4A 4OWYA 2H1AA 4NMUA 1U87A 5CP1A 5A1NA 1JLVA 3FR3A 1FB0A 2LS5A 2C0GA 3HHVA 4AKGA 4GLTA 4JR4A 1JZRA 4W66A 4ZB6A 4K8MA 4F9ZA 1OC8A 1PL1A 2IWTA 5GAPD 3M3MA 2PBJA 2VCWA 4DEJA 6GSSA 3GIXA 3FMWA 4QL9A 3IDVA 3KH9A 1OE7A 1PKWA 4PNGA 2LJKA 4E8HA 3LYKA 2VLVA 3F4RA 4K2DA 2V2GA 1GSUA 4HDEA 4XS1A 4ZBDA 5HFIA 2OE0A 4WKWA 1PRXA 1ST9A 4F0CA 3FZAA 2P31A 5J3RA 1I5GA 2GGTA 1SK0A 2HSNA 1QFNA 5KN2A 1DSBA 1K3OA 3TJKA 1SVOA 5A1NB 5G2ZA 3H93A 3P90A 4IP1A 3HVXA 4F0BA 2ALBA 3W6GA 1UN2A 2VCQA 5DCGA 2NPBA 3VFIA 5DCHA 1XVQA 2AB6A 3TOTA 4F82A 4ZB8A 4CW9A 1X0RA 2H1BA 2YP6A 1JLWA 2IL3A 2CQ9A 2YZHA 4GDFA 2EIRA 2C1YA 2I1UA 4TR4A 1BYEA 1PD21 2M46A 4O5UA 4AJ6A 2O8VB 1EOGA 1SENA 13GSA 2IN3A 2H0HA 3WGXA 3NZNA 2VAFA 2HRAA 2EIOA 2C3NA 3GN3A 5JCWA 4V1Ag 2C4JA 3KTBA 1R26A 1HQOA 3C1RA 3VPQA 3UMAA 1TXXA 2TRXA 3UBKA 3LYPA 5J41A 5DALB 2FA4A 1V2AA 2L6DA 2A2PA 1J9BA 4K6XA 2QA2A 3E9JB 4L0UA 4ACSA 1YJ6A 3QPMA 5DQSA 2HNLA 2LJRA 4V2NA 2JU5A 2DJ2A 1C72A 4HUAA 4TR1A 5F8BA 1UC7A 1O6JA 2X8HA 3WD6A 2MMNA 4NXIA 3VI5A 4MNNA 5G5FA 5ECHB 3TKSC 2K6VA 2DKIA 1PKZA 3L9VA 2H76A 1PMTA 3CBUA 4HZ2A 3TKRA 3IC4A 4HJ2A 3ZYWA 3TDGA 3FZ4A 3Q74A 10GSA 4K0NA 3VURA 3F4TA 3DVWA 1FVKA 1T7PB 3QAVA 5G5EA 2R3XA 1K0DA 2X8GA 1YVLA 5AIXA 3IBHA 3VI7A 4TR1B 3TKSA 4ZB9A 1WIKA 1SU9A 1Z5YE 5DVBA 4Q5FA 2I3YA 1O85A 3VLNA 3P8WA 4NV2A 1K0NA 2H19A 2H0IA 3EU3A 3CMIA 4FYBA 3F6DA 2FNOA 4TR0A 1Y1UA 3TCOA 5J40A 2PN8A 1GUKA 1X5EA 3UEMA 1JZOA 1DUGA 4O7HA 2VUPA 1Y25A 3HJOA 4J57E 4XRDA 5DJMA 5FHIA 5JWOB 4OD7A 3I9V2 1FOHA 4ECIA 5ECPB 2EIQA 3DEXA 1QMVA 4CHSA 4YKFA 4NV5A 3LJRA 1JFUA 3F8UA 4JE1A 4OCFA 4BL7A 3C71A 3FR6A 1ZYEA 3HVSA 5J9CA 2XC2A 3QR6A 3IAM2 1TU7A 1HYUA 4Z2TA 2YWNA 4XTSA 4WETA 3Q18A 3KXOA 3MDKA 1I9DA 1B9YC 3ZFBA 4IQAA 1EGOA 4LL1B 2FWEA 4V1Ap 4G01A 4IGJA 2Z9SA 3A2WA 3APOA 1VF2A 4KW6A 3FKFA 2PERA 2FHEA 4I2TA 1OVNA 4A5PA 3KJYA 1G7OA 2XHFA 4GWRA 3TUEA 1WJKA 3CYNA 5F05A 1TRUA 4FYUA 4HS1A 4KDXA 4BL7B 3EVIA 4WEYA 1RK4A 2B1KA 4MH2A 3EU4A 3J7Yb 2IFQB 3ZRDA 2EFEA 1T1VA 2IMFA 4POKA 4AKIA 4N10A 5DQYA 3MSZA 2O5VA 2V1MA 2VL3A 5IMFA 2H6YA 3LGCA 4K2XA 8GSSA 3G9BA 4RI6A 4ZB7A 2B6MA 2L6CA 3IC8A 5ECNB 2B1LA 2A4HA 3TRXA 5CREA 3O3TA 2BJXA 1GSYA 3G7JA 2HRKB 3KZQA 3TOUA 5DBQA 1B8XA 4EIPA 5ECOB 4XS4A 2HXKA 2GSQA 2K8SA 5H5RA 1SL1B 4GQFA 2KHPA 3FRCA 2E0QA 2VLUA 3OR5A 3M1GA 4XCSA 2PU9C 3MWHA 2RLIA 5F06A 3E3EA 1TRWA 3IHQA 2GQMA 4IELA 3E0UA 2F9SA 2YANA 3IE3A 2H71A 2M80A 1ZGNA 2NBSA 2QGVA 3FEUA 1TU8A 2QKEA 2HSMA 3PR8A 2C8UA 4LLRA 1OYJA 5IIZA 5J4UA 5HR2A 1V58A 3RAZA 1F37A 2H1DA 2QA1A 4WXTA 3CSJA 4XS4B 4O5RA 3FYGA 2JZTA 1RQMA 4KH7A 3CSHA 1O73A 1Q98A 2DIZA 3D0ZA 2HYXA 3GX0A 2YWIA 2GTUA 4G10A 3RDWA 1TJDA 1ERUA 3R2QA 4KAEA 4G0KA 4NAXA 5CNWA 3VWWA 3TKPA 2HLSA 2OA7A 4AI6A 1LJRA 3SWLA 2R37A 2ON7A 1XZOA 4POLA 1OE8A 4ZBBA 1EWXA 1M99A 3N9JA 4LL4B 4JBBA 4OFNA 4POBA 1SD8A 1EP8A 3GH9A 1SKRB 4AGSA 2H72A 3HKRA 2HZEA 2CVDA 5AN1A 4EC0A 2V6OA 5HQPA 3CWGA 3RBTA 1A8LA 1NHYA 1W89A 3TRQA 3LWAA 4ECBA 2YWMA 3HJPA 1AQVA 2C3TA 3F3QA 4H86A 2H0GA 5IMZA 4AF2A 4IJIA 1S3DA 3QAGA 5FT3A 6GSXA 3KD0A 1A2JA 1S3AA 4HQZA 1XCCA 5KOXA 1U3IA 2R4VA 4MF6A 1U3AA 1O8XA 3ZTLA 5J47A 1XWBA 1QK8A 3RPPA 3GH6A 2DLXA 1MD4A 5ECKB 5EY6A 2HZEB 2B3SA 4TRXA 3D21A 2V41A 1M2DA 4K0GA 2H6ZA 3KTLA 4O5QA 4L5LA 3QDNA 4MCUA 4KDUA 3GSSA 4N0ZA 3SBCA 4GSSA 1EGRA 1M9BA 5G31A 2DJ1A 4IN0A 1X9WB 5ELAA 3QFBC 2JADA 1IYHA 2B7KA 3WGDA 2F3MA 3JCML 1XW6A 1R5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWF A;  1Z7R A;  1MDI A;  2GZP A;  3QOU A;  4K7I A;  2C3Q A;  1H4O A;  2OAD A;  3DRN A;  3I69 A;  3A2X A;  4NHZ A;  2OE1 A;  3I43 A;  4F2I A;  3H4K A;  2PWJ A;  4EE0 A;  1ACV A;  4TKY A;  1VF4 A;  4KCA A;  3DGQ A;  3D4M A;  2GST A;  2ES7 A;  1A2L A;  4XIH A;  1SL0 B;  4QL7 A;  2M72 A;  2GT5 A;  9GSS A;  1VGL A;  2WCI A;  2C0F A;  4G2E A;  1GTU A;  5IO2 A;  1GH2 A;  3TB2 A;  2PMT A;  1B48 A;  3ZZX A;  1XIY A;  4ZL8 A;  4L8E A;  4JR6 A;  2KOK A;  3UBL A;  3C8E A;  3GL5 A;  3GNJ A;  1FB6 A;  3IR4 A;  4G9H A;  4HZ4 A;  4F03 A;  3P2A A;  4PQI A;  3KP8 A;  1SYR A;  1DE1 A;  5D9W A;  4MK3 A;  5INY A;  1DBY A;  4IVF A;  1Q4J A;  1R5P A;  4WR5 A;  4DSR A;  12GS A;  2GVP A;  3QAW A;  5IMA A;  5DAL A;  5BMU A;  1AUC A;  2VD1 A;  3LEF A;  1Z7P A;  1M2B A;  4AJ7 A;  1AAZ A;  4BA7 A;  1SKS B;  1TI3 A;  1A2M A;  1JZW A;  4XS6 A;  2HFD A;  2AAW A;  2XPD A;  3CXG A;  1G0T A;  2BMX A;  5F07 A;  5H5Q A;  2WGR A;  4PX1 A;  2UZ8 A;  2G0F A;  5GSS A;  5ECQ B;  3GKM A;  3FHK A;  4ILF A;  4TVE A;  4TOP A;  3KIJ A;  4CDO A;  1KTE A;  3PH9 A;  17GS A;  5ECR B;  1ZYQ B;  1EZK A;  2YCD A;  3LXZ A;  4KUN A;  3BCK A;  5ELG A;  1EOH A;  4PUF C;  4XHM A;  3C7M A;  5ECI B;  4HU7 A;  2H70 A;  1TKD B;  3ZIV A;  4KND A;  1PGT A;  4Q5R A;  3DYR A;  3F63 A;  1YDK A;  3DML A;  2AJQ B;  3P7X A;  2FD3 A;  2DJ0 A;  2KP1 A;  5LD0 A;  5CRH A;  3HDC A;  3U5R E;  1YEP A;  1ZOF A;  2FUG 2;  1BG5 A;  2L5L A;  4KA0 A;  1USB A;  5GAN D;  1AIU A;  2CA8 A;  2LUS A;  5ABR A;  1Z6N A;  5KN1 A;  4OO5 A;  2A2R A;  3IPZ A;  3UVT A;  1GP1 A;  3FZ9 A;  1EP7 A;  5CAX A;  1ON4 A;  4GXZ A;  2LKU A;  3LOR A;  1TK8 B;  4HOJ A;  3UVH A;  4PUA A;  3DXB A;  1GWC A;  3EUR A;  3HA9 A;  1XW9 A;  3HJM A;  4GSN A;  3BOA A;  1YZX A;  5IO0 A;  3L9S A;  1V40 A;  2N5F A;  3TJG A;  1SD9 A;  3M8N A;  2VLT A;  3EWL A;  4IJ3 A;  1NSW A;  1QUW A;  2C0D A;  5HR0 A;  1GSQ A;  4KB3 A;  5J5N A;  2D2Z A;  3Q6O A;  5AIV A;  2MMO A;  1FVJ A;  4MH3 A;  6GSW A;  3M9K A;  5LCZ A;  1XXU A;  3UJ1 A;  3A3T A;  3GST A;  4IP6 A;  1XWA A;  1GNE A;  4GRF A;  2GSS A;  1AQX A;  2H75 A;  3EE2 A;  1LBK A;  2RM5 A;  2PPT A;  2MMZ A;  1ILO A;  18GS A;  2B5X A;  4YQU A;  1X9M B;  5ECM B;  4EL1 A;  1MDJ A;  4EDZ A;  3UOM A;  2H30 A;  1YKA A;  3H1N A;  1TRS A;  1FW1 A;  4G0L A;  3F4S A;  1HNA A;  1PA3 A;  4ULX A;  4IHU A;  3LFL A;  22GS A;  3DVX A;  1GRX A;  2DJK A;  4YQM A;  1GNW A;  2I81 A;  5B8A A;  5A4U A;  2IFQ A;  4QQ7 A;  1O81 A;  2TRC P;  5ENU A;  5IOW A;  2PVQ A;  4V2M A;  2VL2 C;  5L71 A;  3LG6 A;  1E2Y A;  1WMJ A;  5EPF A;  4PUR A;  4Z7X A;  3F9U A;  4MAB A;  3LSZ A;  3HCZ A;  3G7I A;  4EXJ A;  5AGY A;  2VM2 A;  4MJA A;  2YJH A;  19GS A;  1FHE A;  3ERG A;  1T3B A;  2IMI A;  1VRS D;  6GSV A;  2HRK A;  1PSQ A;  1URM A;  4KE3 A;  2MMA A;  4E8E A;  2B7J A;  4MZW A;  2VL2 A;  4K9Z A;  4RQX A;  1PX6 A;  2WFC A;  3KGK A;  2CZ3 A;  5C04 A;  3UAP A;  4ZIJ A;  1IYI A;  4P3Y B;  2EC4 A;  4KCE A;  2DJJ A;  2RM6 A;  1O7U A;  2JSZ A;  2XPE A;  4I6X A;  4V2L A;  2HI7 A;  4WR4 A;  1A8Y A;  2QSI A;  1F6M C;  1GTI A;  2KP2 A;  2HRF A;  4Q5N A;  2MYG A;  2YNX A;  3GUS A;  2WDU A;  5COH A;  2TIR A;  1EV4 A;  3WT2 A;  1ZCP A;  2P5R A;  1A23 A;  2ON5 A;  3ZFL A;  4EVM A;  1SK1 A;  1F3A A;  4MJC A;  2X99 A;  4DVC A;  1KNG A;  1M2A A;  1TTZ A;  2H8L A;  3IK9 A;  2WS2 A;  3U6V A;  2OE3 A;  3K8N A;  4I5Q A;  3FW2 A;  20GS A;  4ZBA A;  2AYT A;  1TDI A;  4OFT A;  4RQR A;  4TR3 A;  1TK5 B;  1XWC A;  4ML6 A;  1CQG A;  2WRT A;  3R3E A;  2PGT A;  4JED A;  1E6B A;  3RPN A;  2BTO T;  1GTB A;  5GZZ B;  4MPF A;  2YJ7 A;  4N11 A;  4EKZ A;  5CRG A;  1XPV A;  1MDK A;  2E7P A;  3ME7 A;  2JL4 A;  2WUL A;  2P0G A;  5ID2 B;  4IKH A;  3KP9 A;  2LJA A;  3RHB A;  4ZL7 A;  1XWK A;  3ZL5 A;  3ZVJ D;  4DSQ A;  1EV9 A;  2DBC A;  1J0F A;  2ZCT A;  1JZD A;  4AJ8 A;  4PQ1 A;  5LNK e;  3H79 A;  4K7O A;  1JHB A;  3LQ7 A;  1TRV A;  3BCI A;  6GSU A;  1FG4 A;  5F0G A;  1BAY A;  2JZR A;  4GST A;  4NHW A;  5CRW A;  2VCT A;  2DIY A;  6GST A;  5A4V A;  2R5G A;  3D4T A;  5IPG A;  1GSF A;  1XOB A;  2I9H A;  1DE2 A;  1SK2 A;  4MPG A;  2R6K A;  4EO3 A;  2LNT A;  5JCU A;  2K18 A;  2HZF A;  1W4V A;  3GUR A;  1EEM A;  1M0U A;  4WF5 A;  5JWR B;  2MBT A;  3PPU A;  1YKC A;  5HR3 A;  5D9X A;  3ZIT A;  1K0M A;  5E4W A;  2P5Q A;  4DSS B;  2GZY A;  5DJL A;  2V32 A;  5CO3 A;  4L5O A;  2MZC A;  3EMP A;  2LEG A;  5DAK A;  2R2J A;  1YF1 A;  2FGX A;  4GCI A;  16GS A;  3TJB A;  4PGT A;  1TP9 A;  4GF0 A;  4LMW A;  3EIN A;  1OC9 B;  3L0H A;  4HJM A;  3RHC A;  4G0I A;  2OAC A;  3CRT A;  4BVY A;  4FYC A;  2VCZ A;  2X64 A;  3HZ8 A;  3Q19 A;  3US3 A;  3VK9 A;  1AQW A;  4D73 A;  5G1K A;  2DSA A;  2HT9 A;  4BVX A;  4TXO B;  4I97 A;  4ML1 A;  2A2S A;  4MJE A;  1S3C A;  2VM1 A;  3FK8 A;  2C80 A;  5DAK B;  4KDY A;  2CV4 A;  1F2E A;  4ZIL A;  1AW9 A;  4X1U A;  2LST A;  3ZLP A;  3KCM A;  1WE0 A;  4ZXG A;  4ISD A;  4YAV A;  14GS A;  2JSY A;  2N5B A;  5B6M A;  3MAK A;  5J9B A;  2WZ9 A;  5EL8 A;  1X5D A;  5AIS A;  4BVY B;  1N8J A;  5KN3 A;  1THX A;  2HSY A;  4D73 B;  5IOX A;  4FQU A;  1GUM A;  3HD5 A;  4BVX B;  4KGI A;  1F3B A;  5B8B A;  1QGV A;  3M9J A;  3DWV A;  1ML6 A;  2L4Q A;  2CAQ A;  1T00 A;  3NOF A;  4G19 A;  1SJ6 A;  1G6Y A;  1SJZ A;  2X8C A;  2YOI A;  2OBI A;  2KUC A;  1GLQ A;  4GTU A;  3HZ4 A;  2LNS A;  3IRA A;  3TGZ A;  5FWG A;  2PVO C;  4N30 A;  5HR1 A;  4KF9 A;  3BBY A;  1WRY A;  4HQS A;  4PNF A;  1OKT A;  3GL3 A;  11GS A;  1F9M A;  2YWO A;  1WWJ A;  3ME8 A;  1ZMA A;  2HE3 A;  1FO5 A;  4O92 A;  2AHE A;  2LQO A;  5JWQ B;  1A24 A;  4OMV A;  4NWY A;  2YN1 A;  2H1G A;  2ZNM A;  1Z3E A;  4WBJ A;  3TKS E;  5E59 A;  1XBS A;  1WOU A;  3N5O A;  5D73 A;  4POM A;  4BPY A;  2OBK A;  2IPA A;  4RI7 A;  2DJ3 A;  4Q5Q A;  2CX3 A;  2RUE A;  2O7K A;  1SKW B;  2JAC A;  1WP0 A;  2FWH A;  3DD3 A;  1THO A;  3C1S A;  2CT6 A;  3BJ5 A;  1K3Y A;  2L4C A;  1ABA A;  5JCG A;  3TJF A;  1ZL9 A;  3GKX A;  2HSN B;  4JZQ A;  2PUK C;  1QXH A;  2VCV A;  4OCE A;  1PQN A;  4YH2 A;  2LV3 A;  2NTO A;  1HD2 A;  2VL9 A;  1PX7 A;  2CAI A;  1GSE A;  2REM A;  4HEA 2;  2XBI A;  3APS A;  3VWX A;  3GTU A;  3FY7 A;  3HVV A;  3NIV A;  1R7H A;  2GZZ A;  2IJY A;  2YZU A;  2CVK A;  5KN0 A;  3H8Q A;  1N2A A;  4ZL9 A;  4HU9 A;  4GQC A;  2HQT A;  4OFM A;  4LA1 A;  2WB9 A;  2GT6 A;  1LU4 A;  1TOF A;  5B6N A;  3HXS A;  2ZUP A;  4MP4 A;  3DKS A;  2LTK A;  2AV4 A;  2N5A A;  1NM3 A;  3A5W A;  4FO5 A;  3S9F A;  4MF5 A;  5B7C A;  3IV4 A;  4KX4 A;  2L59 A;  4ECC A;  1AC1 A;  5CYY A;  1T8E B;  2VOC A;  1MEK A;  1BJX A;  3CTG A;  1XW5 A;  3D22 A;  3QFA C;  3UIW A;  1UA5 A;  2G2Q A;  1FAA A;  3ED3 A;  5C00 A;  2GQK A;  3F3R A;  1B9X C;  1V9W A;  3GTU B;  3APQ A;  4IQ1 A;  3AY8 A;  3HYP A;  2H73 A;  4ID0 A;  3W8J A;  2WJU A;  1EEJ A;  1VF1 A;  3KH7 A;  3IAS 2;  5D9V A;  3FR9 A;  1RW1 A;  2H74 A;  2V6K A;  2HSH A;  2LRN A;  2FY6 A;  4J56 E;  3GA4 A;  2OKA A;  5A4W A;  3L78 A;  3PGT A;  4JU5 A;  5H5S A;  1TW9 A;  3WGE A;  2GQL A;  2C0E A;  5G1L A;  1XOA A;  1K0B A;  1G6W A;  2YV9 A;  1GSD A;  3GV1 A;  2DC5 A;  3GHA A;  2GDR A;  4YAP A;  2F8A A;  1GTA A;  3ERW A;  1SYX A;  3WT1 A;  3ISO A;  1YQ1 A;  3QCP A;  4IBP A;  1Z9H A;  2YV7 A;  3KEB A;  3QMX A;  1J08 A;  2AUV A;  1H75 A;  3WYW A;  2IME A;  3L9U A;  4K1F A;  3F0I A;  1CQH A;  3CSI A;  5IMD A;  1O8W A;  2O87 A;  1OAZ A;  3M0F A;  1UVZ A;  3GKK A;  4BWQ A;  3KMN A;  3I6A A;  2L5O A;  1B4P A;  2RII A;  2RUF A;  3O6T A;  1NW2 A;  6GSY A;  2FWG A;  5IPH A;  2H66 A;  1X9S B;  2VO4 A;  3KM6 A;  1YY7 A;  1BED A;  4K7N A;  3ZML A;  2IMD A;  1V98 A;  3G7Y A;  2LQQ A;  5IM9 A;  1B4Q A;  3VWV A;  1K0O A;  2DML A;  3KMO A;  4MZC A;  3UAR A;  5D9T A;  4OO4 A;  4WBR D;  2CVB A;  4I8B A;  4IW9 A;  3BD2 A;  1V57 A;  5ID2 A;  4BWS A;  3GMF A;  2E2M A;  3IA1 A;  1BQ7 A;  4X0X A;  4IS0 A;  2VCX A;  1PL2 A;  5D96 A;  5IMC A;  1K0A A;  4MF7 A;  2DMM A;  3MNG A;  3IOS A;  1M9A A;  1A0R P;  2MBS A;  2E2G A;  4KSO A;  1G7E A;  4ECJ A;  1ERV A;  2K8V A;  3VPT A;  1QQ2 A;  1ERW A;  5HFK A;  2CZ2 A;  1XWG A;  4TW5 A;  4FH8 A;  2B5Y A;  4TN8 A;  3D6I A;  3A2V A;  4MDC A;  3TJJ A;  2VIM A;  3UL3 A;  2F8F A;  3GFK A;  4LMV A;  5HFG A;  2IMK A;  2L57 A;  4USS A;  2IIY A;  3ZVJ A;  4EF0 A;  4PTS A;  3PIN A;  5CRD A;  2K9F A;  3O76 A;  4RUV A;  1ZZY A;  3LXT A;  3GRX A;  4DSS A;  2FLS A;  3D5J A;  1YF0 A;  5GST A;  1R4W A;  5EVO A;  1TK0 B;  3ERF A;  1XVW A;  2A4V A;  3C73 A;  1GUH A;  1FOV A;  2YPM A;  5ECL B;  1ERT A;  3L4N A;  5D8I A;  1OKD A;  4JRR A;  1OC9 A;  4HI7 A;  4MMM A;  2QC7 A;  2XBQ A;  4YQV A;  1BX9 A;  2I4A A;  3DIE A;  2FCH A;  1AXD A;  1MTC A;  2GLR A;  3ZRE A;  1SL2 B;  3GYK A;  1A0F A;  2HSM B;  1X5C A;  4TXV A;  4EUY A;  4X43 A;  4TXO A;  1GUL A;  1PN9 A;  1GL8 A;  1GLP A;  2O85 A;  1U6T A;  1HNC A;  1M7T A;  4FIW A;  3EMX A;  2O89 A;  4MLY A;  3W8S A;  1SJI A;  4MA9 A;  2GSR A;  4WF4 A;  2B5E A;  2H01 A;  1T4Z A;  5IQY A;  5D93 A;  5IMV A;  1T4Y A;  2OJL A;  1VF3 A;  3VWU A;  2J23 A;  2GS3 A;  3EYT A;  2VD0 A;  2HRN A;  3ZIJ A;  2F51 A;  3GX8 A;  3HY2 A;  3IXR A;  2KLX A;  2FA8 A;  2JZS A;  2NVL A;  4MZB A;  1K3L A;  1KBN A;  3J7Y k;  1KEB A;  3CRU A;  7GSS A;  2LRC A;  1K0C A;  1XFL A;  3V1W A;  3FZ5 A;  1WPI A;  5G30 A;  4EDY A;  3CTF A;  5ECS A;  1TI1 A;  1HNB A;  2H6X A;  1Z6M A;  5A5K A;  4PXO A;  4N0V A;  1NHO A;  4O32 A;  4L0W A;  3IK7 A;  3TKQ A;  1MD3 A;  5KEJ A;  4XRA A;  3ZMK A;  3EC3 A;  4NPB A;  3GKN A;  1GSS A;  4J2F A;  1U88 A;  1OC3 A;  3F6F A;  4MJB A;  5DDL A;  3QD9 A;  2LRT A;  4PQH A;  1YEX A;  1Y6E A;  2NDO A;  4I2U A;  4KSM A;  2J9H A;  3TRP A;  2CX4 A;  4OWY A;  2H1A A;  4NMU A;  1U87 A;  5CP1 A;  1JLV A;  3FR3 A;  1FB0 A;  2LS5 A;  2C0G A;  3HHV A;  4GLT A;  4JR4 A;  1JZR A;  4ZB6 A;  4K8M A;  4F9Z A;  1OC8 A;  1PL1 A;  2IWT A;  5GAP D;  3M3M A;  2PBJ A;  2VCW A;  4DEJ A;  6GSS A;  3GIX A;  4QL9 A;  3IDV A;  3KH9 A;  1OE7 A;  1PKW A;  4PNG A;  2LJK A;  4E8H A;  3LYK A;  2VLV A;  3F4R A;  4K2D A;  2V2G A;  1GSU A;  4HDE A;  4XS1 A;  4ZBD A;  5HFI A;  2OE0 A;  4WKW A;  1PRX A;  1ST9 A;  4F0C A;  3FZA A;  2P31 A;  5J3R A;  1I5G A;  2GGT A;  1SK0 A;  1QFN A;  5KN2 A;  1DSB A;  1K3O A;  3TJK A;  5G2Z A;  3H93 A;  3P90 A;  4IP1 A;  3HVX A;  4F0B A;  2ALB A;  3W6G A;  1UN2 A;  2VCQ A;  5DCG A;  2NPB A;  3VFI A;  5DCH A;  1XVQ A;  2AB6 A;  3TOT A;  4F82 A;  4ZB8 A;  4CW9 A;  1X0R A;  2H1B A;  2YP6 A;  1JLW A;  2IL3 A;  2CQ9 A;  2YZH A;  2EIR A;  2C1Y A;  2I1U A;  4TR4 A;  1BYE A;  1PD2 1;  2M46 A;  4AJ6 A;  2O8V B;  1EOG A;  1SEN A;  13GS A;  2IN3 A;  2H0H A;  3WGX A;  3NZN A;  2VAF A;  2HRA A;  2EIO A;  2C3N A;  3GN3 A;  5JCW A;  4V1A g;  2C4J A;  3KTB A;  1R26 A;  1HQO A;  3C1R A;  3VPQ A;  3UMA A;  1TXX A;  2TRX A;  3UBK A;  3LYP A;  5J41 A;  5DAL B;  2FA4 A;  1V2A A;  2L6D A;  1J9B A;  4K6X A;  4L0U A;  3E9J B;  4ACS A;  1YJ6 A;  3QPM A;  5DQS A;  2HNL A;  2LJR A;  4V2N A;  2JU5 A;  2DJ2 A;  1C72 A;  4HUA A;  4TR1 A;  5F8B A;  1UC7 A;  1O6J A;  2X8H A;  3WD6 A;  2MMN A;  4NXI A;  3VI5 A;  5G5F A;  5ECH B;  3TKS C;  2K6V A;  1PKZ A;  3L9V A;  2H76 A;  1PMT A;  3CBU A;  4HZ2 A;  3TKR A;  3IC4 A;  4HJ2 A;  3ZYW A;  3TDG A;  3FZ4 A;  3Q74 A;  10GS A;  4K0N A;  3VUR A;  3F4T A;  3DVW A;  1FVK A;  1T7P B;  3QAV A;  5G5E A;  2R3X A;  1K0D A;  2X8G A;  5AIX A;  3IBH A;  3VI7 A;  4TR1 B;  3TKS A;  4ZB9 A;  1WIK A;  1SU9 A;  1Z5Y E;  5DVB A;  4Q5F A;  2I3Y A;  1O85 A;  3VLN A;  3P8W A;  4NV2 A;  1K0N A;  2H19 A;  2H0I A;  3EU3 A;  3CMI A;  4FYB A;  3F6D A;  2FNO A;  4TR0 A;  3TCO A;  2PN8 A;  1GUK A;  1X5E A;  3UEM A;  1JZO A;  1DUG A;  4O7H A;  2VUP A;  1Y25 A;  3HJO A;  4J57 E;  4XRD A;  5DJM A;  5FHI A;  5JWO B;  4OD7 A;  3I9V 2;  4ECI A;  5ECP B;  2EIQ A;  3DEX A;  1QMV A;  4CHS A;  4NV5 A;  3LJR A;  1JFU A;  3F8U A;  4JE1 A;  4OCF A;  4BL7 A;  3C71 A;  3FR6 A;  1ZYE A;  3HVS A;  5J9C A;  2XC2 A;  3QR6 A;  3IAM 2;  1TU7 A;  1HYU A;  2YWN A;  4XTS A;  4WET A;  3Q18 A;  3KXO A;  3MDK A;  1I9D A;  1B9Y C;  3ZFB A;  4IQA A;  1EGO A;  4LL1 B;  2FWE A;  4V1A p;  4IGJ A;  2Z9S A;  3A2W A;  3APO A;  1VF2 A;  4KW6 A;  3FKF A;  2PER A;  2FHE A;  4I2T A;  1OVN A;  3KJY A;  1G7O A;  2XHF A;  4GWR A;  3TUE A;  1WJK A;  3CYN A;  5F05 A;  1TRU A;  4FYU A;  4HS1 A;  4KDX A;  4BL7 B;  3EVI A;  4WEY A;  1RK4 A;  2B1K A;  4MH2 A;  3EU4 A;  3J7Y b;  2IFQ B;  3ZRD A;  1T1V A;  2IMF A;  4POK A;  5DQY A;  4N10 A;  3MSZ A;  2V1M A;  2VL3 A;  5IMF A;  2H6Y A;  3LGC A;  8GSS A;  3G9B A;  4RI6 A;  2B6M A;  2L6C A;  3IC8 A;  5ECN B;  2B1L A;  3TRX A;  5CRE A;  3O3T A;  2BJX A;  1GSY A;  3G7J A;  2HRK B;  3KZQ A;  3TOU A;  5DBQ A;  1B8X A;  5ECO B;  4XS4 A;  2HXK A;  2GSQ A;  2K8S A;  5H5R A;  1SL1 B;  4GQF A;  2KHP A;  3FRC A;  2E0Q A;  2VLU A;  3OR5 A;  3M1G A;  4XCS A;  2PU9 C;  3MWH A;  2RLI A;  5F06 A;  3E3E A;  1TRW A;  3IHQ A;  2GQM A;  4IEL A;  3E0U A;  2F9S A;  2YAN A;  3IE3 A;  2H71 A;  2M80 A;  1ZGN A;  2NBS A;  2QGV A;  3FEU A;  1TU8 A;  2QKE A;  2HSM A;  3PR8 A;  2C8U A;  4LLR A;  1OYJ A;  5IIZ A;  5J4U A;  5HR2 A;  1V58 A;  3RAZ A;  1F37 A;  2H1D A;  4WXT A;  3CSJ A;  4XS4 B;  4O5R A;  3FYG A;  2JZT A;  1RQM A;  4KH7 A;  3CSH A;  1O73 A;  1Q98 A;  2DIZ A;  3D0Z A;  2HYX A;  3GX0 A;  2YWI A;  2GTU A;  4G10 A;  3RDW A;  1TJD A;  1ERU A;  3R2Q A;  4KAE A;  4G0K A;  4NAX A;  5CNW A;  3VWW A;  3TKP A;  2HLS A;  2OA7 A;  1LJR A;  3SWL A;  2R37 A;  2ON7 A;  1XZO A;  4POL A;  1OE8 A;  4ZBB A;  1EWX A;  1M99 A;  3N9J A;  4LL4 B;  4JBB A;  4OFN A;  4POB A;  1SD8 A;  1EP8 A;  3GH9 A;  1SKR B;  4AGS A;  2H72 A;  3HKR A;  2HZE A;  2CVD A;  5AN1 A;  4EC0 A;  2V6O A;  5HQP A;  3RBT A;  1A8L A;  1NHY A;  1W89 A;  3TRQ A;  3LWA A;  4ECB A;  2YWM A;  3HJP A;  1AQV A;  2C3T A;  3F3Q A;  4H86 A;  2H0G A;  5IMZ A;  4AF2 A;  4IJI A;  1S3D A;  3QAG A;  5FT3 A;  6GSX A;  3KD0 A;  1A2J A;  1S3A A;  4HQZ A;  1XCC A;  1U3I A;  2R4V A;  4MF6 A;  1U3A A;  1O8X A;  3ZTL A;  1XWB A;  1QK8 A;  3RPP A;  3GH6 A;  2DLX A;  1MD4 A;  5ECK B;  5EY6 A;  2HZE B;  2B3S A;  4TRX A;  3D21 A;  2V41 A;  1M2D A;  4K0G A;  2H6Z A;  3KTL A;  4L5L A;  3QDN A;  4MCU A;  4KDU A;  3GSS A;  4N0Z A;  3SBC A;  4GSS A;  1EGR A;  1M9B A;  5G31 A;  2DJ1 A;  4IN0 A;  1X9W B;  5ELA A;  3QFB C;  2JAD A;  1IYH A;  2B7K A;  3WGD A;  2F3M A;  3JCM L;  1XW6 A;  1R5A A; 
#chains in the Genus database with same CATH topology
 2FWF A;  1Z7R A;  1MDI A;  2GZP A;  2O3E A;  3QOU A;  4K7I A;  2C3Q A;  1H4O A;  2OAD A;  3DRN A;  3I69 A;  3A2X A;  1M3I A;  4NHZ A;  2OE1 A;  3I43 A;  4F2I A;  3H4K A;  2PWJ A;  4EE0 A;  1ACV A;  4TKY A;  2O36 A;  1VF4 A;  4KCA A;  3DGQ A;  3D4M A;  2GST A;  2ES7 A;  1A2L A;  4XIH A;  1SL0 B;  4QL7 A;  2M72 A;  2GT5 A;  9GSS A;  4YKG A;  1VGL A;  2WCI A;  2C0F A;  4G2E A;  1GTU A;  5IO2 A;  1GH2 A;  3TB2 A;  2PMT A;  1B48 A;  3MYD A;  3ZZX A;  1XIY A;  4ZL8 A;  4L8E A;  4JR6 A;  2KOK A;  3UBL A;  3C8E A;  3GL5 A;  3GNJ A;  1FB6 A;  3IR4 A;  4G9H A;  4HZ4 A;  4F03 A;  3P2A A;  4PQI A;  3KP8 A;  1SYR A;  1DE1 A;  1SVL A;  5D9W A;  4MK3 A;  5INY A;  1DBY A;  4IVF A;  1Q4J A;  1R5P A;  4WR5 A;  4DSR A;  12GS A;  2GVP A;  3QAW A;  5IMA A;  5DAL A;  5BMU A;  1AUC A;  2VD1 A;  3LEF A;  1Z7P A;  1M2B A;  4AJ7 A;  1AAZ A;  4BA7 A;  1SKS B;  1TI3 A;  1A2M A;  1JZW A;  4XS6 A;  2HFD A;  2AAW A;  2XPD A;  3CXG A;  1G0T A;  2BMX A;  5F07 A;  5H5Q A;  2WGR A;  4PX1 A;  2H1L A;  2UZ8 A;  2G0F A;  5GSS A;  5ECQ B;  3GKM A;  3FHK A;  4ILF A;  4TVE A;  4TOP A;  3KIJ A;  4CDO A;  1KTE A;  3PH9 A;  17GS A;  5ECR B;  1ZYQ B;  1EZK A;  2YCD A;  3LXZ A;  4KUN A;  3BCK A;  5ELG A;  1EOH A;  4PUF C;  4XHM A;  3C7M A;  5ECI B;  4HU7 A;  2H70 A;  1TKD B;  3ZIV A;  4KND A;  1PGT A;  4Q5R A;  3DYR A;  3F63 A;  1YDK A;  3DML A;  2AJQ B;  3P7X A;  5BMU B;  2FD3 A;  2DJ0 A;  2KP1 A;  2WW2 A;  5LD0 A;  5CRH A;  3HDC A;  3U5R E;  1YEP A;  1ZOF A;  2FUG 2;  1BG5 A;  2L5L A;  4KA0 A;  1USB A;  5GAN D;  1AIU A;  2CA8 A;  2LUS A;  5ABR A;  2OT3 A;  1Z6N A;  5KN1 A;  4OO5 A;  2A2R A;  3IPZ A;  3UVT A;  1GP1 A;  3FZ9 A;  1EP7 A;  5CAX A;  1ON4 A;  4GXZ A;  2LKU A;  3LOR A;  1TK8 B;  4HOJ A;  3UVH A;  4PUA A;  3DXB A;  1GWC A;  3EUR A;  3HA9 A;  2R0C A;  1XW9 A;  3HJM A;  4GSN A;  3BOA A;  1YZX A;  5IO0 A;  1V40 A;  3L9S A;  2N5F A;  3TJG A;  1SD9 A;  3M8N A;  2VLT A;  3EWL A;  4IJ3 A;  1NSW A;  1QUW A;  2C0D A;  5HR0 A;  1GSQ A;  4KB3 A;  5J5N A;  2D2Z A;  3Q6O A;  5AIV A;  2MMO A;  1FVJ A;  4MH3 A;  6GSW A;  3M9K A;  5LCZ A;  1XXU A;  3UJ1 A;  3A3T A;  3GST A;  4IP6 A;  1XWA A;  1GNE A;  4GRF A;  2GSS A;  1AQX A;  2H75 A;  3EE2 A;  1LBK A;  2RM5 A;  2PPT A;  4FXY P;  3A5I A;  2MMZ A;  1ILO A;  18GS A;  2B5X A;  4YQU A;  1TXU A;  1ZYN A;  3IHG A;  1X9M B;  5ECM B;  4EL1 A;  1MDJ A;  4EDZ A;  3UOM A;  5J4Y A;  3CHX C;  2H30 A;  1YKA A;  3H1N A;  1TRS A;  1FW1 A;  4G0L A;  3F4S A;  1HNA A;  1PA3 A;  3HMJ G;  4ULX A;  4IHU A;  3LFL A;  22GS A;  3DVX A;  1GRX A;  2DJK A;  4YQM A;  4Z2R A;  1GNW A;  2I81 A;  5B8A A;  5A4U A;  2IFQ A;  4QQ7 A;  1O81 A;  2TRC P;  5ENU A;  5IOW A;  2PVQ A;  4V2M A;  2VL2 C;  5L71 A;  3LG6 A;  1E2Y A;  1WMJ A;  5EPF A;  4PUR A;  2X4A A;  4Z7X A;  3F9U A;  4MAB A;  4CY8 A;  3LSZ A;  3HCZ A;  3G7I A;  4EXJ A;  5AGY A;  2VM2 A;  4MJA A;  2YJH A;  19GS A;  1FHE A;  3ERG A;  1T3B A;  2IMI A;  1VRS D;  6GSV A;  2HRK A;  1PSQ A;  1URM A;  4KE3 A;  2MMA A;  4QMK A;  4E8E A;  2B7J A;  4MZW A;  2VL2 A;  4K9Z A;  4RQX A;  1PX6 A;  2WFC A;  3KGK A;  2CZ3 A;  5C04 A;  3UAP A;  4ZIJ A;  1IYI A;  4P3Y B;  3EPT A;  2EC4 A;  5A34 A;  4KCE A;  2DJJ A;  2RM6 A;  1O7U A;  2JSZ A;  2XPE A;  4I6X A;  4V2L A;  4AKX B;  2HI7 A;  4WR4 A;  1A8Y A;  2QSI A;  1F6M C;  1GTI A;  2KP2 A;  2HRF A;  4Q5N A;  2MYG A;  2YNX A;  3GUS A;  2WDU A;  5COH A;  2TIR A;  1EV4 A;  3WT2 A;  1ZCP A;  2P5R A;  1A23 A;  1BF5 A;  2ON5 A;  3ZFL A;  4EVM A;  1SK1 A;  1F3A A;  4MJC A;  4E68 A;  2X99 A;  4DVC A;  1KNG A;  1M2A A;  2EFC A;  1TTZ A;  2H8L A;  3IK9 A;  2WS2 A;  3U6V A;  2OE3 A;  3K8N A;  4I5Q A;  3FW2 A;  20GS A;  4ZBA A;  2AYT A;  1TDI A;  4OFT A;  4RQR A;  4TR3 A;  5A34 B;  1TK5 B;  1XWC A;  1SVM A;  4ML6 A;  1CQG A;  2WRT A;  3R3E A;  2PGT A;  4JED A;  1E6B A;  3RPN A;  2BTO T;  1GTB A;  5GZZ B;  4MPF A;  2YJ7 A;  4N11 A;  4EKZ A;  5CRG A;  1XPV A;  1MDK A;  2E7P A;  3ME7 A;  2JL4 A;  2WUL A;  2P0G A;  5ID2 B;  4IKH A;  3KP9 A;  2UV8 G;  2LJA A;  3RHB A;  4ZL7 A;  1XWK A;  3ZL5 A;  3ZVJ D;  4DSQ A;  1EV9 A;  2DBC A;  1J0F A;  2ZCT A;  1JZD A;  4AJ8 A;  4PQ1 A;  5LNK e;  3H79 A;  5A5H A;  4K7O A;  1JHB A;  3LQ7 A;  1TRV A;  3BCI A;  2R0G A;  6GSU A;  1FG4 A;  5F0G A;  1BAY A;  2JZR A;  4GST A;  4NHW A;  5CRW A;  2VCT A;  2DIY A;  6GST A;  5A4V A;  2R5G A;  3D4T A;  5IPG A;  1GSF A;  1XOB A;  2I9H A;  1DE2 A;  1SK2 A;  4MPG A;  2R6K A;  4EO3 A;  2LNT A;  5JCU A;  2K18 A;  2HZF A;  1W4V A;  1N25 A;  3GUR A;  1EEM A;  1M0U A;  4WF5 A;  5JWR B;  2MBT A;  3PPU A;  1YKC A;  5HR3 A;  4CY6 A;  5D9X A;  3ZIT A;  1K0M A;  5E4W A;  2P5Q A;  4DSS B;  2GZY A;  5DJL A;  2V32 A;  5A5H B;  5CO3 A;  4L5O A;  2MZC A;  3EMP A;  2LEG A;  5DAK A;  2R2J A;  1YF1 A;  4HSC X;  2FGX A;  4GCI A;  16GS A;  3TJB A;  4PGT A;  1TP9 A;  4GF0 A;  4LMW A;  3EIN A;  1OC9 B;  3L0H A;  4HJM A;  3RHC A;  4G0I A;  2OAC A;  3CRT A;  4BVY A;  4FYC A;  2VCZ A;  2X64 A;  3HZ8 A;  3Q19 A;  3US3 A;  3VK9 A;  1AQW A;  4D73 A;  5G1K A;  2DSA A;  2HT9 A;  4N3Z A;  4BVX A;  4TXO B;  4I97 A;  4ML1 A;  2A2S A;  4MJE A;  1S3C A;  2VM1 A;  3FK8 A;  2C80 A;  5DAK B;  4KDY A;  2CV4 A;  1F2E A;  4ZIL A;  1AW9 A;  4X1U A;  2LST A;  3ZLP A;  3KCM A;  1WE0 A;  4ZXG A;  4ISD A;  4YAV A;  14GS A;  2JSY A;  5BRT A;  2N5B A;  5B6M A;  3MAK A;  5J9B A;  2WZ9 A;  5EL8 A;  1X5D A;  5AIS A;  3RFR C;  4BVY B;  1N8J A;  5KN3 A;  1THX A;  2HSY A;  4D73 B;  5IOX A;  4FQU A;  1GUM A;  3HD5 A;  4BVX B;  4KGI A;  1F3B A;  5B8B A;  1QGV A;  3M9J A;  3DWV A;  1ML6 A;  2L4Q A;  1ZYP A;  2CAQ A;  1T00 A;  3NOF A;  4G19 A;  1SJ6 A;  1G6Y A;  1SJZ A;  2X8C A;  2YOI A;  2OBI A;  2KUC A;  1GLQ A;  4GTU A;  3HZ4 A;  2LNS A;  3IRA A;  3TGZ A;  5FWG A;  2PVO C;  4N30 A;  5HR1 A;  4KF9 A;  3BBY A;  1WRY A;  4HQS A;  4PNF A;  1OKT A;  3GL3 A;  11GS A;  1F9M A;  2YWO A;  1WWJ A;  3ME8 A;  1ZMA A;  2HE3 A;  1FO5 A;  4O92 A;  2AHE A;  2LQO A;  5JWQ B;  1A24 A;  4OMV A;  2VKZ G;  4NWY A;  4AKH A;  2YN1 A;  2H1G A;  2ZNM A;  1Z3E A;  4K5S A;  4WBJ A;  3TKS E;  4EIQ A;  5E59 A;  1XBS A;  1WOU A;  3N5O A;  5D73 A;  2WVY A;  4POM A;  4BPY A;  2OBK A;  5J4V A;  2EFD A;  2IPA A;  4RI7 A;  2DJ3 A;  4Q5Q A;  2CX3 A;  2RUE A;  2O7K A;  1SKW B;  2JAC A;  1WP0 A;  2FWH A;  3DD3 A;  1THO A;  3C1S A;  2CT6 A;  3BJ5 A;  1K3Y A;  2L4C A;  1ABA A;  5JCG A;  3TJF A;  4X4J A;  2X49 A;  1ZL9 A;  3GKX A;  2HSN B;  4JZQ A;  2PUK C;  1QXH A;  2VCV A;  4OCE A;  1PQN A;  4YH2 A;  2LV3 A;  2NTO A;  1HD2 A;  2VL9 A;  1PX7 A;  2CAI A;  1GSE A;  2REM A;  4HEA 2;  2XBI A;  3TU3 B;  3APS A;  3VWX A;  3GTU A;  3FY7 A;  3HVV A;  3NIV A;  2DKH A;  1R7H A;  2GZZ A;  2IJY A;  2YZU A;  2WVZ A;  2CVK A;  5KN0 A;  3H8Q A;  1N2A A;  4ZL9 A;  4HU9 A;  4GQC A;  2HQT A;  4OFM A;  4LA1 A;  2WB9 A;  1M3J A;  2GT6 A;  1LU4 A;  1TOF A;  5B6N A;  3HXS A;  2ZUP A;  4MP4 A;  3DKS A;  2LTK A;  2AV4 A;  2N5A A;  1NM3 A;  3A5W A;  4FO5 A;  4BIK A;  3S9F A;  4MF5 A;  5B7C A;  3IV4 A;  4KX4 A;  2L59 A;  4ECC A;  1AC1 A;  5CYY A;  1T8E B;  2VOC A;  1MEK A;  1BJX A;  3CTG A;  1XW5 A;  3D22 A;  3QFA C;  3UIW A;  1UA5 A;  2G2Q A;  1FAA A;  4K5R A;  3ED3 A;  5C00 A;  2GQK A;  3F3R A;  1B9X C;  1V9W A;  3GTU B;  3APQ A;  4IQ1 A;  3AY8 A;  3HYP A;  2H73 A;  4ID0 A;  3W8J A;  2WJU A;  1EEJ A;  1VF1 A;  3KH7 A;  3IAS 2;  5D9V A;  3FR9 A;  5KOW A;  1RW1 A;  2H74 A;  2V6K A;  2HSH A;  2LRN A;  2FY6 A;  4J56 E;  3GA4 A;  2OKA A;  5A4W A;  3L78 A;  3PGT A;  4JU5 A;  5H5S A;  1TW9 A;  3WGE A;  2GQL A;  2C0E A;  5G1L A;  1XOA A;  1K0B A;  1G6W A;  2YV9 A;  1GSD A;  3GV1 A;  2DC5 A;  3GHA A;  2GDR A;  4YAP A;  2F8A A;  1GTA A;  3ERW A;  1SYX A;  3WT1 A;  3ISO A;  1YQ1 A;  3QCP A;  4IBP A;  1Z9H A;  2YV7 A;  1BG1 A;  3KEB A;  3QMX A;  1J08 A;  2AUV A;  1H75 A;  3WYW A;  2IME A;  3L9U A;  4K1F A;  3F0I A;  1CQH A;  3CSI A;  5IMD A;  1O8W A;  2O87 A;  1OAZ A;  3M0F A;  1UVZ A;  3GKK A;  4BWQ A;  3KMN A;  3I6A A;  2L5O A;  1B4P A;  2RII A;  2RUF A;  3O6T A;  1NW2 A;  6GSY A;  2FWG A;  5IPH A;  2H66 A;  1X9S B;  2VO4 A;  3KM6 A;  1YY7 A;  1BED A;  4K7N A;  1YEW C;  3ZML A;  2IMD A;  1V98 A;  3G7Y A;  2EFH A;  2LQQ A;  5IM9 A;  1B4Q A;  3VWV A;  1K0O A;  2DML A;  3KMO A;  4MZC A;  3UAR A;  5D9T A;  4OO4 A;  4WBR D;  2CVB A;  4I8B A;  4IW9 A;  3BD2 A;  1V57 A;  5ID2 A;  4BWS A;  3GMF A;  2E2M A;  3HVN A;  3IA1 A;  1BQ7 A;  4X0X A;  4IS0 A;  1S4B P;  2VCX A;  1PL2 A;  5D96 A;  5IMC A;  1K0A A;  4MF7 A;  2DMM A;  3MNG A;  3IOS A;  1M9A A;  1A0R P;  2MBS A;  2E2G A;  4KSO A;  1G7E A;  4ECJ A;  1ERV A;  2K8V A;  3VPT A;  1QQ2 A;  1ERW A;  5HFK A;  2CZ2 A;  1XWG A;  4TW5 A;  4FH8 A;  2B5Y A;  4TN8 A;  3D6I A;  3A2V A;  4MDC A;  3TJJ A;  2VIM A;  3MIX A;  3UL3 A;  2F8F A;  3GFK A;  4LMV A;  5HFG A;  2IMK A;  2L57 A;  4USS A;  2IIY A;  3ZVJ A;  4EF0 A;  4PTS A;  3PIN A;  5CRD A;  2K9F A;  3O76 A;  4RUV A;  1ZZY A;  3LXT A;  3GRX A;  4DSS A;  2FLS A;  3D5J A;  1YF0 A;  5GST A;  1R4W A;  5EVO A;  1TK0 B;  3ERF A;  1I1I P;  1XVW A;  2A4V A;  3C73 A;  1GUH A;  1FOV A;  2YPM A;  5ECL B;  1ERT A;  3L4N A;  5D8I A;  1OKD A;  4JRR A;  3LW9 A;  4ICY A;  1OC9 A;  4HI7 A;  4MMM A;  2QC7 A;  2XBQ A;  4YQV A;  1BX9 A;  2I4A A;  3DIE A;  2FCH A;  1AXD A;  1MTC A;  2GLR A;  2WW3 A;  3ZRE A;  1SL2 B;  3GYK A;  1A0F A;  2HSM B;  1X5C A;  4TXV A;  2WVX A;  4Z2U A;  4EUY A;  4X43 A;  4TXO A;  1GUL A;  1PN9 A;  1GL8 A;  1GLP A;  2O85 A;  1U6T A;  1HNC A;  1M7T A;  4FIW A;  3EMX A;  2O89 A;  4MLY A;  3W8S A;  1SJI A;  4MA9 A;  2GSR A;  4WF4 A;  2B5E A;  2H01 A;  1T4Z A;  5IQY A;  5D93 A;  5IMV A;  1T4Y A;  2OJL A;  1VF3 A;  3VWU A;  2R0P A;  2J23 A;  2GS3 A;  4PHZ C;  3EYT A;  2VD0 A;  2HRN A;  3ZIJ A;  2F51 A;  3GX8 A;  3HY2 A;  3IXR A;  2KLX A;  2FA8 A;  2JZS A;  2NVL A;  4MZB A;  1K3L A;  2WVX B;  1KBN A;  3J7Y k;  1KEB A;  3CRU A;  7GSS A;  2LRC A;  1K0C A;  1XFL A;  3V1W A;  3FZ5 A;  1PN0 A;  1WPI A;  5G30 A;  4EDY A;  3CTF A;  4PI2 C;  5ECS A;  1TI1 A;  1HNB A;  2H6X A;  1Z6M A;  5A5K A;  4PXO A;  4N0V A;  1NHO A;  4O32 A;  4L0W A;  3IK7 A;  3TKQ A;  1MD3 A;  5KEJ A;  4XRA A;  3ZMK A;  3EC3 A;  4NPB A;  3GKN A;  1GSS A;  4J2F A;  1U88 A;  1OC3 A;  3F6F A;  4MJB A;  5DDL A;  3QD9 A;  2LRT A;  4PQH A;  1YEX A;  1Y6E A;  2NDO A;  4I2U A;  4KSM A;  2J9H A;  3TRP A;  2CX4 A;  4OWY A;  2H1A A;  4NMU A;  1U87 A;  5CP1 A;  5A1N A;  1JLV A;  3FR3 A;  1FB0 A;  2LS5 A;  2C0G A;  3HHV A;  4AKG A;  4GLT A;  4JR4 A;  1JZR A;  4W66 A;  4ZB6 A;  4K8M A;  4F9Z A;  1OC8 A;  1PL1 A;  2IWT A;  5GAP D;  3M3M A;  2PBJ A;  2VCW A;  4DEJ A;  6GSS A;  3GIX A;  3FMW A;  4QL9 A;  3IDV A;  3KH9 A;  1OE7 A;  1PKW A;  4PNG A;  2LJK A;  4E8H A;  3LYK A;  2VLV A;  3F4R A;  4K2D A;  2V2G A;  1GSU A;  4HDE A;  4XS1 A;  4ZBD A;  5HFI A;  2OE0 A;  4WKW A;  1PRX A;  1ST9 A;  4F0C A;  3FZA A;  2P31 A;  5J3R A;  1I5G A;  2GGT A;  1SK0 A;  2HSN A;  1QFN A;  5KN2 A;  1DSB A;  1K3O A;  3TJK A;  1SVO A;  5A1N B;  5G2Z A;  3H93 A;  3P90 A;  4IP1 A;  3HVX A;  4F0B A;  2ALB A;  3W6G A;  1UN2 A;  2VCQ A;  5DCG A;  2NPB A;  3VFI A;  5DCH A;  1XVQ A;  2AB6 A;  3TOT A;  4F82 A;  4ZB8 A;  4CW9 A;  1X0R A;  2H1B A;  2YP6 A;  1JLW A;  2IL3 A;  2CQ9 A;  2YZH A;  4GDF A;  2EIR A;  2C1Y A;  2I1U A;  4TR4 A;  1BYE A;  1PD2 1;  2M46 A;  4O5U A;  4AJ6 A;  2O8V B;  1EOG A;  1SEN A;  13GS A;  2IN3 A;  2H0H A;  3WGX A;  3NZN A;  2VAF A;  2HRA A;  2EIO A;  2C3N A;  3GN3 A;  5JCW A;  4V1A g;  2C4J A;  3KTB A;  1R26 A;  1HQO A;  3C1R A;  3VPQ A;  3UMA A;  1TXX A;  2TRX A;  3UBK A;  3LYP A;  5J41 A;  5DAL B;  2FA4 A;  1V2A A;  2L6D A;  2A2P A;  1J9B A;  4K6X A;  2QA2 A;  3E9J B;  4L0U A;  4ACS A;  1YJ6 A;  3QPM A;  5DQS A;  2HNL A;  2LJR A;  4V2N A;  2JU5 A;  2DJ2 A;  1C72 A;  4HUA A;  4TR1 A;  5F8B A;  1UC7 A;  1O6J A;  2X8H A;  3WD6 A;  2MMN A;  4NXI A;  3VI5 A;  4MNN A;  5G5F A;  5ECH B;  3TKS C;  2K6V A;  2DKI A;  1PKZ A;  3L9V A;  2H76 A;  1PMT A;  3CBU A;  4HZ2 A;  3TKR A;  3IC4 A;  4HJ2 A;  3ZYW A;  3TDG A;  3FZ4 A;  3Q74 A;  10GS A;  4K0N A;  3VUR A;  3F4T A;  3DVW A;  2WW1 A;  1FVK A;  1T7P B;  3QAV A;  5G5E A;  2R3X A;  1K0D A;  2X8G A;  1YVL A;  5AIX A;  3IBH A;  3VI7 A;  4TR1 B;  3TKS A;  4ZB9 A;  1WIK A;  1SU9 A;  1Z5Y E;  5DVB A;  4Q5F A;  2I3Y A;  1O85 A;  3VLN A;  3P8W A;  4NV2 A;  1K0N A;  2H19 A;  2H0I A;  3EU3 A;  3CMI A;  4FYB A;  3F6D A;  2FNO A;  4TR0 A;  1Y1U A;  3TCO A;  5J40 A;  2PN8 A;  1GUK A;  1X5E A;  3UEM A;  4PI0 C;  1JZO A;  1DUG A;  4O7H A;  2VUP A;  1Y25 A;  3HJO A;  4J57 E;  4XRD A;  5DJM A;  5FHI A;  5JWO B;  4OD7 A;  3I9V 2;  1FOH A;  4ECI A;  5ECP B;  2EIQ A;  3DEX A;  1QMV A;  4CHS A;  4YKF A;  4NV5 A;  3LJR A;  1JFU A;  3F8U A;  4JE1 A;  4OCF A;  4BL7 A;  3C71 A;  3CQF A;  3FR6 A;  1ZYE A;  3HVS A;  5J9C A;  2XC2 A;  3QR6 A;  3IAM 2;  1TU7 A;  1HYU A;  4Z2T A;  2YWN A;  4XTS A;  4WET A;  3Q18 A;  3KXO A;  3MDK A;  1I9D A;  1B9Y C;  3ZFB A;  4IQA A;  1EGO A;  4LL1 B;  2FWE A;  4V1A p;  4G01 A;  4IGJ A;  2Z9S A;  3A2W A;  3APO A;  1VF2 A;  4KW6 A;  3FKF A;  2PER A;  2FHE A;  4I2T A;  1OVN A;  4A5P A;  3KJY A;  1G7O A;  2XHF A;  4GWR A;  3TUE A;  1WJK A;  3CYN A;  5F05 A;  1TRU A;  4FYU A;  4HS1 A;  4KDX A;  4BL7 B;  3EVI A;  4WEY A;  1RK4 A;  2B1K A;  4MH2 A;  3EU4 A;  3J7Y b;  2IFQ B;  3ZRD A;  2EFE A;  1T1V A;  2IMF A;  4POK A;  4AKI A;  4N10 A;  5DQY A;  3MSZ A;  2O5V A;  2V1M A;  2VL3 A;  5IMF A;  1XG8 A;  3RGB C;  2H6Y A;  3LGC A;  4K2X A;  1PFO A;  8GSS A;  3G9B A;  4RI6 A;  4ZB7 A;  2B6M A;  2L6C A;  3IC8 A;  5ECN B;  2B1L A;  2A4H A;  3TRX A;  5CRE A;  3O3T A;  2BJX A;  1GSY A;  3G7J A;  2HRK B;  3KZQ A;  3TOU A;  5DBQ A;  1B8X A;  4EIP A;  5ECO B;  4XS4 A;  2HXK A;  2GSQ A;  2K8S A;  5H5R A;  1SL1 B;  4GQF A;  2KHP A;  3FRC A;  2E0Q A;  2VLU A;  3OR5 A;  3M1G A;  4XCS A;  2PU9 C;  3MWH A;  2RLI A;  5F06 A;  3E3E A;  1TRW A;  3IHQ A;  2GQM A;  4IEL A;  3E0U A;  2F9S A;  2YAN A;  3IE3 A;  2H71 A;  2M80 A;  1ZGN A;  2NBS A;  2QGV A;  3FEU A;  1TU8 A;  2QKE A;  2HSM A;  3PR8 A;  2C8U A;  4LLR A;  1OYJ A;  5IIZ A;  5J4U A;  5HR2 A;  1V58 A;  3RAZ A;  1F37 A;  2H1D A;  2QA1 A;  4WXT A;  3CSJ A;  4XS4 B;  4O5R A;  3FYG A;  2JZT A;  1RQM A;  4KH7 A;  3CSH A;  1O73 A;  1Q98 A;  2DIZ A;  3D0Z A;  2HYX A;  3GX0 A;  2YWI A;  2GTU A;  4G10 A;  3RDW A;  1TJD A;  1ERU A;  3R2Q A;  4KAE A;  4G0K A;  4NAX A;  5CNW A;  3VWW A;  3TKP A;  2HLS A;  2OA7 A;  2WW0 A;  4AI6 A;  1LJR A;  3SWL A;  2R37 A;  2ON7 A;  1XZO A;  4POL A;  1S3R A;  1OE8 A;  4ZBB A;  1EWX A;  1M99 A;  3N9J A;  4LL4 B;  4JBB A;  4OFN A;  4POB A;  1SD8 A;  1EP8 A;  3GH9 A;  1SKR B;  4AGS A;  2H72 A;  3HKR A;  2HZE A;  2CVD A;  5AN1 A;  4EC0 A;  2V6O A;  5HQP A;  3CWG A;  3RBT A;  1A8L A;  1NHY A;  1W89 A;  3TRQ A;  3LWA A;  4ECB A;  2YWM A;  3HJP A;  1AQV A;  2C3T A;  3F3Q A;  4H86 A;  2H0G A;  5IMZ A;  4AF2 A;  4IJI A;  1S3D A;  3QAG A;  5FT3 A;  6GSX A;  3KD0 A;  1A2J A;  1S3A A;  4HQZ A;  1XCC A;  5KOX A;  1U3I A;  2R4V A;  4MF6 A;  1U3A A;  1O8X A;  3ZTL A;  5J47 A;  1XWB A;  1QK8 A;  3RPP A;  3GH6 A;  2DLX A;  1MD4 A;  5ECK B;  5EY6 A;  2HZE B;  2B3S A;  4TRX A;  3D21 A;  2V41 A;  1M2D A;  4K0G A;  2H6Z A;  3KTL A;  4O5Q A;  4L5L A;  3QDN A;  4MCU A;  4KDU A;  3GSS A;  4N0Z A;  3SBC A;  4GSS A;  1EGR A;  1M9B A;  5G31 A;  2DJ1 A;  4IN0 A;  1X9W B;  5ELA A;  2WZS A;  3QFB C;  2JAD A;  1IYH A;  2B7K A;  3WGD A;  2F3M A;  3JCM L;  1XW6 A;  1R5A A; 
#chains in the Genus database with same CATH homology
 2FWF A;  1Z7R A;  1MDI A;  2GZP A;  3QOU A;  4K7I A;  2C3Q A;  1H4O A;  2OAD A;  3DRN A;  3I69 A;  3A2X A;  4NHZ A;  2OE1 A;  3I43 A;  4F2I A;  3H4K A;  2PWJ A;  4EE0 A;  1ACV A;  4TKY A;  1VF4 A;  4KCA A;  3DGQ A;  3D4M A;  2GST A;  2ES7 A;  1A2L A;  4XIH A;  1SL0 B;  4QL7 A;  2M72 A;  2GT5 A;  9GSS A;  4YKG A;  1VGL A;  2WCI A;  2C0F A;  4G2E A;  1GTU A;  5IO2 A;  1GH2 A;  3TB2 A;  2PMT A;  1B48 A;  3MYD A;  3ZZX A;  1XIY A;  4ZL8 A;  4L8E A;  4JR6 A;  2KOK A;  3UBL A;  3C8E A;  3GL5 A;  3GNJ A;  1FB6 A;  3IR4 A;  4G9H A;  4HZ4 A;  4F03 A;  3P2A A;  4PQI A;  3KP8 A;  1SYR A;  1DE1 A;  1SVL A;  5D9W A;  4MK3 A;  5INY A;  1DBY A;  4IVF A;  1Q4J A;  1R5P A;  4WR5 A;  4DSR A;  12GS A;  2GVP A;  3QAW A;  5IMA A;  5DAL A;  5BMU A;  1AUC A;  2VD1 A;  3LEF A;  1Z7P A;  1M2B A;  4AJ7 A;  1AAZ A;  4BA7 A;  1SKS B;  1TI3 A;  1A2M A;  1JZW A;  4XS6 A;  2HFD A;  2AAW A;  2XPD A;  3CXG A;  1G0T A;  2BMX A;  5F07 A;  5H5Q A;  2WGR A;  4PX1 A;  2H1L A;  2UZ8 A;  2G0F A;  5GSS A;  5ECQ B;  3GKM A;  3FHK A;  4ILF A;  4TVE A;  4TOP A;  3KIJ A;  4CDO A;  1KTE A;  3PH9 A;  17GS A;  5ECR B;  1ZYQ B;  1EZK A;  2YCD A;  3LXZ A;  4KUN A;  3BCK A;  5ELG A;  1EOH A;  4PUF C;  4XHM A;  3C7M A;  5ECI B;  4HU7 A;  2H70 A;  1TKD B;  3ZIV A;  4KND A;  1PGT A;  4Q5R A;  3DYR A;  3F63 A;  1YDK A;  3DML A;  2AJQ B;  3P7X A;  5BMU B;  2FD3 A;  2DJ0 A;  2KP1 A;  5LD0 A;  5CRH A;  3HDC A;  3U5R E;  1YEP A;  1ZOF A;  2FUG 2;  1BG5 A;  2L5L A;  4KA0 A;  1USB A;  5GAN D;  1AIU A;  2CA8 A;  2LUS A;  5ABR A;  2OT3 A;  1Z6N A;  5KN1 A;  4OO5 A;  2A2R A;  3IPZ A;  3UVT A;  1GP1 A;  3FZ9 A;  1EP7 A;  5CAX A;  1ON4 A;  4GXZ A;  2LKU A;  3LOR A;  1TK8 B;  4HOJ A;  3UVH A;  4PUA A;  3DXB A;  1GWC A;  3EUR A;  3HA9 A;  2R0C A;  1XW9 A;  3HJM A;  4GSN A;  3BOA A;  1YZX A;  5IO0 A;  3L9S A;  1V40 A;  2N5F A;  3TJG A;  1SD9 A;  3M8N A;  2VLT A;  3EWL A;  4IJ3 A;  1NSW A;  1QUW A;  2C0D A;  5HR0 A;  1GSQ A;  4KB3 A;  5J5N A;  2D2Z A;  3Q6O A;  5AIV A;  2MMO A;  1FVJ A;  4MH3 A;  6GSW A;  3M9K A;  5LCZ A;  1XXU A;  3UJ1 A;  3A3T A;  3GST A;  4IP6 A;  1XWA A;  1GNE A;  4GRF A;  2GSS A;  1AQX A;  2H75 A;  3EE2 A;  1LBK A;  2RM5 A;  2PPT A;  3A5I A;  2MMZ A;  1ILO A;  18GS A;  2B5X A;  4YQU A;  1TXU A;  1ZYN A;  3IHG A;  1X9M B;  5ECM B;  4EL1 A;  1MDJ A;  4EDZ A;  3UOM A;  5J4Y A;  2H30 A;  1YKA A;  3H1N A;  1TRS A;  1FW1 A;  4G0L A;  3F4S A;  1HNA A;  1PA3 A;  3HMJ G;  4ULX A;  4IHU A;  3LFL A;  22GS A;  3DVX A;  1GRX A;  2DJK A;  4YQM A;  4Z2R A;  1GNW A;  2I81 A;  5B8A A;  5A4U A;  2IFQ A;  4QQ7 A;  1O81 A;  2TRC P;  5ENU A;  5IOW A;  2PVQ A;  4V2M A;  2VL2 C;  5L71 A;  3LG6 A;  1E2Y A;  1WMJ A;  5EPF A;  4PUR A;  2X4A A;  4Z7X A;  3F9U A;  4MAB A;  4CY8 A;  3LSZ A;  3HCZ A;  3G7I A;  4EXJ A;  5AGY A;  2VM2 A;  4MJA A;  2YJH A;  19GS A;  1FHE A;  3ERG A;  1T3B A;  2IMI A;  1VRS D;  6GSV A;  2HRK A;  1PSQ A;  1URM A;  4KE3 A;  2MMA A;  4QMK A;  4E8E A;  2B7J A;  4MZW A;  2VL2 A;  4K9Z A;  4RQX A;  1PX6 A;  2WFC A;  3KGK A;  2CZ3 A;  5C04 A;  3UAP A;  4ZIJ A;  1IYI A;  4P3Y B;  3EPT A;  2EC4 A;  5A34 A;  4KCE A;  2DJJ A;  2RM6 A;  1O7U A;  2JSZ A;  2XPE A;  4I6X A;  4V2L A;  4AKX B;  2HI7 A;  4WR4 A;  1A8Y A;  2QSI A;  1F6M C;  1GTI A;  2KP2 A;  2HRF A;  4Q5N A;  2MYG A;  2YNX A;  3GUS A;  2WDU A;  5COH A;  2TIR A;  1EV4 A;  3WT2 A;  1ZCP A;  2P5R A;  1A23 A;  1BF5 A;  2ON5 A;  3ZFL A;  4EVM A;  1SK1 A;  1F3A A;  4MJC A;  4E68 A;  2X99 A;  4DVC A;  1KNG A;  1M2A A;  2EFC A;  1TTZ A;  2H8L A;  3IK9 A;  2WS2 A;  3U6V A;  2OE3 A;  3K8N A;  4I5Q A;  3FW2 A;  20GS A;  4ZBA A;  2AYT A;  1TDI A;  4OFT A;  4RQR A;  4TR3 A;  5A34 B;  1TK5 B;  1XWC A;  1SVM A;  4ML6 A;  1CQG A;  2WRT A;  3R3E A;  2PGT A;  4JED A;  1E6B A;  3RPN A;  2BTO T;  1GTB A;  5GZZ B;  4MPF A;  2YJ7 A;  4N11 A;  4EKZ A;  5CRG A;  1XPV A;  1MDK A;  2E7P A;  3ME7 A;  2JL4 A;  2WUL A;  2P0G A;  5ID2 B;  4IKH A;  3KP9 A;  2UV8 G;  2LJA A;  3RHB A;  4ZL7 A;  1XWK A;  3ZL5 A;  3ZVJ D;  4DSQ A;  1EV9 A;  2DBC A;  1J0F A;  2ZCT A;  1JZD A;  4AJ8 A;  4PQ1 A;  5LNK e;  3H79 A;  5A5H A;  4K7O A;  1JHB A;  3LQ7 A;  1TRV A;  3BCI A;  2R0G A;  6GSU A;  1FG4 A;  5F0G A;  1BAY A;  2JZR A;  4GST A;  4NHW A;  5CRW A;  2VCT A;  2DIY A;  6GST A;  5A4V A;  2R5G A;  3D4T A;  5IPG A;  1GSF A;  1XOB A;  2I9H A;  1DE2 A;  1SK2 A;  4MPG A;  2R6K A;  4EO3 A;  2LNT A;  5JCU A;  2K18 A;  2HZF A;  1W4V A;  1N25 A;  3GUR A;  1EEM A;  1M0U A;  4WF5 A;  5JWR B;  2MBT A;  3PPU A;  1YKC A;  5HR3 A;  4CY6 A;  5D9X A;  3ZIT A;  1K0M A;  5E4W A;  2P5Q A;  4DSS B;  2GZY A;  5DJL A;  2V32 A;  5A5H B;  5CO3 A;  4L5O A;  2MZC A;  3EMP A;  2LEG A;  5DAK A;  2R2J A;  1YF1 A;  2FGX A;  4GCI A;  16GS A;  3TJB A;  4PGT A;  1TP9 A;  4GF0 A;  4LMW A;  3EIN A;  1OC9 B;  3L0H A;  4HJM A;  3RHC A;  4G0I A;  2OAC A;  3CRT A;  4BVY A;  4FYC A;  2VCZ A;  2X64 A;  3HZ8 A;  3Q19 A;  3US3 A;  3VK9 A;  1AQW A;  4D73 A;  5G1K A;  2DSA A;  2HT9 A;  4N3Z A;  4BVX A;  4TXO B;  4I97 A;  4ML1 A;  2A2S A;  4MJE A;  1S3C A;  2VM1 A;  3FK8 A;  2C80 A;  5DAK B;  4KDY A;  2CV4 A;  1F2E A;  4ZIL A;  1AW9 A;  4X1U A;  2LST A;  3ZLP A;  3KCM A;  1WE0 A;  4ZXG A;  4ISD A;  4YAV A;  14GS A;  2JSY A;  5BRT A;  2N5B A;  5B6M A;  3MAK A;  5J9B A;  2WZ9 A;  5EL8 A;  1X5D A;  5AIS A;  4BVY B;  1N8J A;  5KN3 A;  1THX A;  2HSY A;  4D73 B;  5IOX A;  4FQU A;  1GUM A;  3HD5 A;  4BVX B;  4KGI A;  1F3B A;  5B8B A;  1QGV A;  3M9J A;  3DWV A;  1ML6 A;  2L4Q A;  1ZYP A;  2CAQ A;  1T00 A;  3NOF A;  4G19 A;  1SJ6 A;  1G6Y A;  1SJZ A;  2X8C A;  2YOI A;  2OBI A;  2KUC A;  1GLQ A;  4GTU A;  3HZ4 A;  2LNS A;  3IRA A;  3TGZ A;  5FWG A;  2PVO C;  4N30 A;  5HR1 A;  4KF9 A;  3BBY A;  1WRY A;  4HQS A;  4PNF A;  1OKT A;  3GL3 A;  11GS A;  1F9M A;  2YWO A;  1WWJ A;  3ME8 A;  1ZMA A;  2HE3 A;  1FO5 A;  4O92 A;  2AHE A;  2LQO A;  5JWQ B;  1A24 A;  4OMV A;  2VKZ G;  4NWY A;  4AKH A;  2YN1 A;  2H1G A;  2ZNM A;  1Z3E A;  4K5S A;  4WBJ A;  3TKS E;  4EIQ A;  5E59 A;  1XBS A;  1WOU A;  3N5O A;  5D73 A;  4POM A;  4BPY A;  2OBK A;  5J4V A;  2EFD A;  2IPA A;  4RI7 A;  2DJ3 A;  4Q5Q A;  2CX3 A;  2RUE A;  2O7K A;  1SKW B;  2JAC A;  1WP0 A;  2FWH A;  3DD3 A;  1THO A;  3C1S A;  2CT6 A;  3BJ5 A;  1K3Y A;  2L4C A;  1ABA A;  5JCG A;  3TJF A;  4X4J A;  2X49 A;  1ZL9 A;  3GKX A;  2HSN B;  4JZQ A;  2PUK C;  1QXH A;  2VCV A;  4OCE A;  1PQN A;  4YH2 A;  2LV3 A;  2NTO A;  1HD2 A;  2VL9 A;  1PX7 A;  2CAI A;  1GSE A;  2REM A;  4HEA 2;  2XBI A;  3TU3 B;  3APS A;  3VWX A;  3GTU A;  3FY7 A;  3HVV A;  3NIV A;  2DKH A;  1R7H A;  2GZZ A;  2IJY A;  2YZU A;  2CVK A;  5KN0 A;  3H8Q A;  1N2A A;  4ZL9 A;  4HU9 A;  4GQC A;  2HQT A;  4OFM A;  4LA1 A;  2WB9 A;  2GT6 A;  1LU4 A;  1TOF A;  5B6N A;  3HXS A;  2ZUP A;  4MP4 A;  3DKS A;  2LTK A;  2AV4 A;  2N5A A;  1NM3 A;  3A5W A;  4FO5 A;  3S9F A;  4MF5 A;  5B7C A;  3IV4 A;  4KX4 A;  2L59 A;  4ECC A;  1AC1 A;  5CYY A;  1T8E B;  2VOC A;  1MEK A;  1BJX A;  3CTG A;  1XW5 A;  3D22 A;  3QFA C;  3UIW A;  1UA5 A;  2G2Q A;  1FAA A;  4K5R A;  3ED3 A;  5C00 A;  2GQK A;  3F3R A;  1B9X C;  1V9W A;  3GTU B;  3APQ A;  4IQ1 A;  3AY8 A;  3HYP A;  2H73 A;  4ID0 A;  3W8J A;  2WJU A;  1EEJ A;  1VF1 A;  3KH7 A;  3IAS 2;  5D9V A;  3FR9 A;  5KOW A;  1RW1 A;  2H74 A;  2V6K A;  2HSH A;  2LRN A;  2FY6 A;  4J56 E;  3GA4 A;  2OKA A;  5A4W A;  3L78 A;  3PGT A;  4JU5 A;  5H5S A;  1TW9 A;  3WGE A;  2GQL A;  2C0E A;  5G1L A;  1XOA A;  1K0B A;  1G6W A;  2YV9 A;  1GSD A;  3GV1 A;  2DC5 A;  3GHA A;  2GDR A;  4YAP A;  2F8A A;  1GTA A;  3ERW A;  1SYX A;  3WT1 A;  3ISO A;  1YQ1 A;  3QCP A;  4IBP A;  1Z9H A;  2YV7 A;  1BG1 A;  3KEB A;  3QMX A;  1J08 A;  2AUV A;  1H75 A;  3WYW A;  2IME A;  3L9U A;  4K1F A;  3F0I A;  1CQH A;  3CSI A;  5IMD A;  1O8W A;  2O87 A;  1OAZ A;  3M0F A;  1UVZ A;  3GKK A;  4BWQ A;  3KMN A;  3I6A A;  2L5O A;  1B4P A;  2RII A;  2RUF A;  3O6T A;  1NW2 A;  6GSY A;  2FWG A;  5IPH A;  2H66 A;  1X9S B;  2VO4 A;  3KM6 A;  1YY7 A;  1BED A;  4K7N A;  3ZML A;  2IMD A;  1V98 A;  3G7Y A;  2EFH A;  2LQQ A;  5IM9 A;  1B4Q A;  3VWV A;  1K0O A;  2DML A;  3KMO A;  4MZC A;  3UAR A;  5D9T A;  4OO4 A;  4WBR D;  2CVB A;  4I8B A;  4IW9 A;  3BD2 A;  1V57 A;  5ID2 A;  4BWS A;  3GMF A;  2E2M A;  3IA1 A;  1BQ7 A;  4X0X A;  4IS0 A;  2VCX A;  1PL2 A;  5D96 A;  5IMC A;  1K0A A;  4MF7 A;  2DMM A;  3MNG A;  3IOS A;  1M9A A;  1A0R P;  2MBS A;  2E2G A;  4KSO A;  1G7E A;  4ECJ A;  1ERV A;  2K8V A;  3VPT A;  1QQ2 A;  1ERW A;  5HFK A;  2CZ2 A;  1XWG A;  4TW5 A;  4FH8 A;  2B5Y A;  4TN8 A;  3D6I A;  3A2V A;  4MDC A;  3TJJ A;  2VIM A;  3MIX A;  3UL3 A;  2F8F A;  3GFK A;  4LMV A;  5HFG A;  2IMK A;  2L57 A;  4USS A;  2IIY A;  3ZVJ A;  4EF0 A;  4PTS A;  3PIN A;  5CRD A;  2K9F A;  3O76 A;  4RUV A;  1ZZY A;  3LXT A;  3GRX A;  4DSS A;  2FLS A;  3D5J A;  1YF0 A;  5GST A;  1R4W A;  5EVO A;  1TK0 B;  3ERF A;  1XVW A;  2A4V A;  3C73 A;  1GUH A;  1FOV A;  2YPM A;  5ECL B;  1ERT A;  3L4N A;  5D8I A;  1OKD A;  4JRR A;  3LW9 A;  4ICY A;  1OC9 A;  4HI7 A;  4MMM A;  2QC7 A;  2XBQ A;  4YQV A;  1BX9 A;  2I4A A;  3DIE A;  2FCH A;  1AXD A;  1MTC A;  2GLR A;  3ZRE A;  1SL2 B;  3GYK A;  1A0F A;  2HSM B;  1X5C A;  4TXV A;  4Z2U A;  4EUY A;  4X43 A;  4TXO A;  1GUL A;  1PN9 A;  1GL8 A;  1GLP A;  2O85 A;  1U6T A;  1HNC A;  1M7T A;  4FIW A;  3EMX A;  2O89 A;  4MLY A;  3W8S A;  1SJI A;  4MA9 A;  2GSR A;  4WF4 A;  2B5E A;  2H01 A;  1T4Z A;  5IQY A;  5D93 A;  5IMV A;  1T4Y A;  2OJL A;  1VF3 A;  3VWU A;  2R0P A;  2J23 A;  2GS3 A;  3EYT A;  2VD0 A;  2HRN A;  3ZIJ A;  2F51 A;  3GX8 A;  3HY2 A;  3IXR A;  2KLX A;  2FA8 A;  2JZS A;  2NVL A;  4MZB A;  1K3L A;  1KBN A;  3J7Y k;  1KEB A;  3CRU A;  7GSS A;  2LRC A;  1K0C A;  1XFL A;  3V1W A;  3FZ5 A;  1PN0 A;  1WPI A;  5G30 A;  4EDY A;  3CTF A;  5ECS A;  1TI1 A;  1HNB A;  2H6X A;  1Z6M A;  5A5K A;  4PXO A;  4N0V A;  1NHO A;  4O32 A;  4L0W A;  3IK7 A;  3TKQ A;  1MD3 A;  5KEJ A;  4XRA A;  3ZMK A;  3EC3 A;  4NPB A;  3GKN A;  1GSS A;  4J2F A;  1U88 A;  1OC3 A;  3F6F A;  4MJB A;  5DDL A;  3QD9 A;  2LRT A;  4PQH A;  1YEX A;  1Y6E A;  2NDO A;  4I2U A;  4KSM A;  2J9H A;  3TRP A;  2CX4 A;  4OWY A;  2H1A A;  4NMU A;  1U87 A;  5CP1 A;  5A1N A;  1JLV A;  3FR3 A;  1FB0 A;  2LS5 A;  2C0G A;  3HHV A;  4AKG A;  4GLT A;  4JR4 A;  1JZR A;  4W66 A;  4ZB6 A;  4K8M A;  4F9Z A;  1OC8 A;  1PL1 A;  2IWT A;  5GAP D;  3M3M A;  2PBJ A;  2VCW A;  4DEJ A;  6GSS A;  3GIX A;  3FMW A;  4QL9 A;  3IDV A;  3KH9 A;  1OE7 A;  1PKW A;  4PNG A;  2LJK A;  4E8H A;  3LYK A;  2VLV A;  3F4R A;  4K2D A;  2V2G A;  1GSU A;  4HDE A;  4XS1 A;  4ZBD A;  5HFI A;  2OE0 A;  4WKW A;  1PRX A;  1ST9 A;  4F0C A;  3FZA A;  2P31 A;  5J3R A;  1I5G A;  2GGT A;  1SK0 A;  2HSN A;  1QFN A;  5KN2 A;  1DSB A;  1K3O A;  3TJK A;  1SVO A;  5A1N B;  5G2Z A;  3H93 A;  3P90 A;  4IP1 A;  3HVX A;  4F0B A;  2ALB A;  3W6G A;  1UN2 A;  2VCQ A;  5DCG A;  2NPB A;  3VFI A;  5DCH A;  1XVQ A;  2AB6 A;  3TOT A;  4F82 A;  4ZB8 A;  4CW9 A;  1X0R A;  2H1B A;  2YP6 A;  1JLW A;  2IL3 A;  2CQ9 A;  2YZH A;  4GDF A;  2EIR A;  2C1Y A;  2I1U A;  4TR4 A;  1BYE A;  1PD2 1;  2M46 A;  4O5U A;  4AJ6 A;  2O8V B;  1EOG A;  1SEN A;  13GS A;  2IN3 A;  2H0H A;  3WGX A;  3NZN A;  2VAF A;  2HRA A;  2EIO A;  2C3N A;  3GN3 A;  5JCW A;  4V1A g;  2C4J A;  3KTB A;  1R26 A;  1HQO A;  3C1R A;  3VPQ A;  3UMA A;  1TXX A;  2TRX A;  3UBK A;  3LYP A;  5J41 A;  5DAL B;  2FA4 A;  1V2A A;  2L6D A;  2A2P A;  1J9B A;  4K6X A;  2QA2 A;  3E9J B;  4L0U A;  4ACS A;  1YJ6 A;  3QPM A;  5DQS A;  2HNL A;  2LJR A;  4V2N A;  2JU5 A;  2DJ2 A;  1C72 A;  4HUA A;  4TR1 A;  5F8B A;  1UC7 A;  1O6J A;  2X8H A;  3WD6 A;  2MMN A;  4NXI A;  3VI5 A;  4MNN A;  5G5F A;  5ECH B;  3TKS C;  2K6V A;  2DKI A;  1PKZ A;  3L9V A;  2H76 A;  1PMT A;  3CBU A;  4HZ2 A;  3TKR A;  3IC4 A;  4HJ2 A;  3ZYW A;  3TDG A;  3FZ4 A;  3Q74 A;  10GS A;  4K0N A;  3VUR A;  3F4T A;  3DVW A;  1FVK A;  1T7P B;  3QAV A;  5G5E A;  2R3X A;  1K0D A;  2X8G A;  1YVL A;  5AIX A;  3IBH A;  3VI7 A;  4TR1 B;  3TKS A;  4ZB9 A;  1WIK A;  1SU9 A;  1Z5Y E;  5DVB A;  4Q5F A;  2I3Y A;  1O85 A;  3VLN A;  3P8W A;  4NV2 A;  1K0N A;  2H19 A;  2H0I A;  3EU3 A;  3CMI A;  4FYB A;  3F6D A;  2FNO A;  4TR0 A;  1Y1U A;  3TCO A;  5J40 A;  2PN8 A;  1GUK A;  1X5E A;  3UEM A;  1JZO A;  1DUG A;  4O7H A;  2VUP A;  1Y25 A;  3HJO A;  4J57 E;  4XRD A;  5DJM A;  5FHI A;  5JWO B;  4OD7 A;  3I9V 2;  1FOH A;  4ECI A;  5ECP B;  2EIQ A;  3DEX A;  1QMV A;  4CHS A;  4YKF A;  4NV5 A;  3LJR A;  1JFU A;  3F8U A;  4JE1 A;  4OCF A;  4BL7 A;  3C71 A;  3FR6 A;  1ZYE A;  3HVS A;  5J9C A;  2XC2 A;  3QR6 A;  3IAM 2;  1TU7 A;  1HYU A;  4Z2T A;  2YWN A;  4XTS A;  4WET A;  3Q18 A;  3KXO A;  3MDK A;  1I9D A;  1B9Y C;  3ZFB A;  4IQA A;  1EGO A;  4LL1 B;  2FWE A;  4V1A p;  4G01 A;  4IGJ A;  2Z9S A;  3A2W A;  3APO A;  1VF2 A;  4KW6 A;  3FKF A;  2PER A;  2FHE A;  4I2T A;  1OVN A;  4A5P A;  3KJY A;  1G7O A;  2XHF A;  4GWR A;  3TUE A;  1WJK A;  3CYN A;  5F05 A;  1TRU A;  4FYU A;  4HS1 A;  4KDX A;  4BL7 B;  3EVI A;  4WEY A;  1RK4 A;  2B1K A;  4MH2 A;  3EU4 A;  3J7Y b;  2IFQ B;  3ZRD A;  2EFE A;  1T1V A;  2IMF A;  4POK A;  4AKI A;  4N10 A;  5DQY A;  3MSZ A;  2O5V A;  2V1M A;  2VL3 A;  5IMF A;  2H6Y A;  3LGC A;  4K2X A;  8GSS A;  3G9B A;  4RI6 A;  4ZB7 A;  2B6M A;  2L6C A;  3IC8 A;  5ECN B;  2B1L A;  2A4H A;  3TRX A;  5CRE A;  3O3T A;  2BJX A;  1GSY A;  3G7J A;  2HRK B;  3KZQ A;  3TOU A;  5DBQ A;  1B8X A;  4EIP A;  5ECO B;  4XS4 A;  2HXK A;  2GSQ A;  2K8S A;  5H5R A;  1SL1 B;  4GQF A;  2KHP A;  3FRC A;  2E0Q A;  2VLU A;  3OR5 A;  3M1G A;  4XCS A;  2PU9 C;  3MWH A;  2RLI A;  5F06 A;  3E3E A;  1TRW A;  3IHQ A;  2GQM A;  4IEL A;  3E0U A;  2F9S A;  2YAN A;  3IE3 A;  2H71 A;  2M80 A;  1ZGN A;  2NBS A;  2QGV A;  3FEU A;  1TU8 A;  2QKE A;  2HSM A;  3PR8 A;  2C8U A;  4LLR A;  1OYJ A;  5IIZ A;  5J4U A;  5HR2 A;  1V58 A;  3RAZ A;  1F37 A;  2H1D A;  2QA1 A;  4WXT A;  3CSJ A;  4XS4 B;  4O5R A;  3FYG A;  2JZT A;  1RQM A;  4KH7 A;  3CSH A;  1O73 A;  1Q98 A;  2DIZ A;  3D0Z A;  2HYX A;  3GX0 A;  2YWI A;  2GTU A;  4G10 A;  3RDW A;  1TJD A;  1ERU A;  3R2Q A;  4KAE A;  4G0K A;  4NAX A;  5CNW A;  3VWW A;  3TKP A;  2HLS A;  2OA7 A;  4AI6 A;  1LJR A;  3SWL A;  2R37 A;  2ON7 A;  1XZO A;  4POL A;  1OE8 A;  4ZBB A;  1EWX A;  1M99 A;  3N9J A;  4LL4 B;  4JBB A;  4OFN A;  4POB A;  1SD8 A;  1EP8 A;  3GH9 A;  1SKR B;  4AGS A;  2H72 A;  3HKR A;  2HZE A;  2CVD A;  5AN1 A;  4EC0 A;  2V6O A;  5HQP A;  3CWG A;  3RBT A;  1A8L A;  1NHY A;  1W89 A;  3TRQ A;  3LWA A;  4ECB A;  2YWM A;  3HJP A;  1AQV A;  2C3T A;  3F3Q A;  4H86 A;  2H0G A;  5IMZ A;  4AF2 A;  4IJI A;  1S3D A;  3QAG A;  5FT3 A;  6GSX A;  3KD0 A;  1A2J A;  1S3A A;  4HQZ A;  1XCC A;  5KOX A;  1U3I A;  2R4V A;  4MF6 A;  1U3A A;  1O8X A;  3ZTL A;  5J47 A;  1XWB A;  1QK8 A;  3RPP A;  3GH6 A;  2DLX A;  1MD4 A;  5ECK B;  5EY6 A;  2HZE B;  2B3S A;  4TRX A;  3D21 A;  2V41 A;  1M2D A;  4K0G A;  2H6Z A;  3KTL A;  4O5Q A;  4L5L A;  3QDN A;  4MCU A;  4KDU A;  3GSS A;  4N0Z A;  3SBC A;  4GSS A;  1EGR A;  1M9B A;  5G31 A;  2DJ1 A;  4IN0 A;  1X9W B;  5ELA A;  3QFB C;  2JAD A;  1IYH A;  2B7K A;  3WGD A;  2F3M A;  3JCM L;  1XW6 A;  1R5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...