2FNOA

Crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
239
Chain Sequence
HHHMEDGMNTFDLYYWPVPFRGQLIRGILAHCGCSWDEHDVDAIEGLMDCGAEKQPVAFMGPPVLIDRERNFAISQMPAIAIYLGERLDILPATVEGRTLSAKIVNDANDVLDELTLNGGREMWTPEKWQEFVPRLQKWIRIFADTGARNGLSAASGFMLGTEKIGVADIVTAILWTTVADRFPAIKGIIEDTSPIIWGLSRRVVATAPLAALNSKSFEEYGNAYCGGEIEKSLRKVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AGR_pAT_752p
publication title Comparative structural analysis of a novel glutathioneS-transferase (ATU5508) from Agrobacterium tumefaciens at 2.0 A resolution.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 82
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2fnoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fnoA01
1BYEA 2YZHA 4XS4B 2DJKA 4EC0A 2H66A 1X9WB 1JZOA 5J9CA 2DJ3A 2J23A 4MJEA 3TCOA 4PURA 4I8BA 2L6CA 1QXHA 3GSTA 3VWWA 3HXSA 1PGTA 2L6DA 1PN9A 2LRTA 4H86A 5ID2A 2P31A 2JZRA 2H6ZA 1A0RP 3UOMA 3HYPA 3LXTA 4I2UA 1AIUA 3KCMA 1GSUA 4MZBA 2YOIA 3RAZA 6GSUA 4G0KA 3ZLPA 2H0HA 1SJZA 3A2VA 4DVCA 4O7HA 3HCZA 8GSSA 1K0MA 4DSSA 3GKXA 1H4OA 2C3TA 2RM6A 3LYPA 4F0BA 1EGOA 1XWAA 1GP1A 3NOFA 2I4AA 5EVOA 3ZMLA 2IPAA 5IIZA 5HFKA 3FZ5A 1BAYA 3RPNA 3J7Yk 3HVVA 3FW2A 2FCHA 2HI7A 5COHA 2ZCTA 4JR4A 4KDUA 3LG6A 5B7CA 3FZ9A 3UBLA 1EWXA 2B5EA 2JZTA 1ERTA 5AISA 2KOKA 2OE1A 3U5RE 3UJ1A 2R6KA 2L59A 2GSTA 2FWFA 1N2AA 3UARA 4KUNA 4JU5A 2HXKA 1B9YC 2H8LA 3FYGA 1EEJA 5ABRA 4WF5A 3C7MA 3P8WA 17GSA 3QFBC 3GHAA 5HR2A 3V1WA 4LLRA 2LQOA 2HYXA 1THOA 1WE0A 6GSTA 4V2LA 4MZWA 2YWNA 1YJ6A 1GSQA 3GYKA 2FY6A 3GA4A 3D22A 4OO5A 2B1LA 3C71A 3MNGA 3F9UA 3HY2A 4POBA 1T4ZA 4ECIA 3HZ8A 1O73A 2AYTA 2VCXA 2TRCP 4ID0A 4LMWA 4YAVA 4FO5A 2WS2A 6GSWA 1A8LA 2FA4A 4AJ6A 3GURA 3UVHA 5J4UA 2YANA 3L9VA 4QL7A 2RLIA 4K1FA 4X1UA 1TRUA 2LEGA 4JRRA 3F8UA 2CVKA 3H79A 4ECCA 4ECJA 4IP6A 3R2QA 1QGVA 3VWUA 1SD8A 3GFKA 2IFQB 1GUKA 1GTIA 1M2AA 1TU8A 1TK0B 6GSVA 3DRNA 1VF3A 3VPQA 2A2RA 2L57A 3RHCA 2LUSA 1SKSB 3G7IA 4HJMA 4NWYA 2PBJA 1PQNA 5J9BA 5ELGA 1Q4JA 5IPGA 2LNTA 2YJ7A 4MPFA 5KN3A 1FHEA 4RQRA 1A2MA 3W6GA 3G7JA 4PQHA 2PERA 3IC4A 2YCDA 4FQUA 5DCGA 2IWTA 3F6FA 2C0DA 1NHOA 5ID2B 2O85A 1DE1A 3FEUA 2FD3A 3QAWA 1AXDA 3QDNA 2C0GA 1G6WA 1QK8A 2JU5A 2L4QA 3ERFA 2DLXA 1TTZA 2N5BA 3C73A 1A23A 3TOTA 2R3XA 1GTUA 4HQSA 1O8XA 1FAAA 2HRNA 5D96A 2YPMA 2E7PA 1Y25A 3QMXA 2GQKA 4KCEA 3VI7A 4G19A 3GH6A 1FO5A 2M80A 2MYGA 3UBKA 2NDOA 2VM2A 2AAWA 5ECMB 2CVDA 5HFGA 2C3QA 2ON7A 1I9DA 3DKSA 1F9MA 4KB3A 3FR6A 2GDRA 4ZL7A 3GRXA 3PGTA 1MD4A 5H5SA 1OYJA 4I97A 4PQIA 2HRKA 3IE3A 1C72A 2GLRA 2H72A 4ZL9A 1O81A 4ZBAA 2WDUA 3L4NA 3F4TA 2EC4A 1SL2B 2AUVA 3DVWA 2B1KA 5J5NA 2PPTA 1A8YA 4N11A 1T1VA 1FW1A 2O7KA 2V6OA 1NSWA 2HSHA 4FIWA 3TGZA 3I9V2 1DSBA 4IELA 2Z9SA 1PA3A 3NIVA 2LJAA 4GQCA 2L4CA 4ZBBA 2KUCA 1U88A 3VWVA 1N8JA 3GTUA 1G7EA 3DD3A 4BL7A 5JWOB 3Q18A 5ECIB 4HU7A 4HUAA 3HKRA 5DQSA 2LRCA 4WBRD 3HDCA 1ZYQB 1WP0A 12GSA 5CRHA 2DSAA 5C00A 3W8SA 1A24A 1WWJA 2QGVA 4K0NA 4KNDA 3IHQA 3Q6OA 3KJYA 5B6MA 3O6TA 3IK7A 2WZ9A 3H4KA 1EGRA 2PVQA 2WJUA 5DQYA 3FZAA 4MJAA 3LORA 1W4VA 4EF0A 1QUWA 4KSMA 1ABAA 2I3YA 3A5WA 3WD6A 3BBYA 1KTEA 1TKDB 5FWGA 4IP1A 1ILOA 4OFMA 3ZYWA 5IO0A 3KH9A 4QQ7A 4Q5FA 1JZDA 1LJRA 2JSZA 2XBIA 2UZ8A 1XZOA 2HFDA 5IPHA 1IYHA 3TKPA 2HLSA 1R5PA 5HR0A 3FR9A 3GX8A 1FVJA 2H1AA 1CQGA 4GXZA 1VF2A 2VL9A 4BWQA 4ML1A 5HFIA 4ULXA 4L8EA 3M0FA 4HDEA 5D8IA 3FY7A 2GGTA 3AY8A 13GSA 3VK9A 1ERUA 4AF2A 19GSA 1YEXA 4PNFA 2P5RA 2PVOC 4GQFA 1M2DA 4N0ZA 2DIZA 1XW9A 2YZUA 5GZZB 1NW2A 3L9SA 2RM5A 5D9VA 3GL5A 4TRXA 3EU3A 2B6MA 3HD5A 5CAXA 3PR8A 4F0CA 3IDVA 2O87A 2C0EA 4IHUA 5DJMA 4MH2A 4I5QA 2WULA 3I69A 2VCWA 3WGDA 2BJXA 2C8UA 3UAPA 4NHWA 4GTUA 4Q5NA 1XVQA 4EVMA 5EL8A 4X43A 4AJ8A 1OAZA 1XW5A 4MABA 2R37A 2HRKB 1OKTA 1EZKA 3BD2A 2YJHA 2F51A 1YEPA 1FOVA 3EU4A 2XPDA 1V57A 2OBIA 1AQVA 5IMFA 2VD1A 5F05A 1A0FA 5B8AA 3TJFA 4OMVA 2YWIA 3D4MA 5HR3A 4ILFA 1DBYA 1SJIA 1O7UA 2FWEA 1B8XA 2CA8A 1EOGA 3ZZXA 2GSSA 1Z6NA 2QKEA 1AAZA 4PTSA 3TDGA 3EE2A 1U87A 4K2DA 1GSEA 1B4QA 4KDXA 3K8NA 4MF6A 5IMCA 4L5OA 4NPBA 4EUYA 3J7Yb 5INYA 2FHEA 3KZQA 3I43A 1EOHA 4G9HA 5ECQB 5GSTA 2VOCA 2YV7A 1S3DA 3HZ4A 14GSA 4OFTA 1TK5B 3LJRA 3GX0A 3IV4A 1ZOFA 5LD0A 4KE3A 2VIMA 5IMVA 1XCCA 4USSA 2VCQA 4KCAA 2B7KA 4CDOA 2XBQA 5D73A 4MJCA 2H75A 5G5FA 2YNXA 2L5LA 1JFUA 3VPTA 2L5OA 5GAPD 1ACVA 1FVKA 1GTBA 4NAXA 3LWAA 3D0ZA 2YN1A 3GSSA 3P7XA 3KD0A 3FR3A 10GSA 4RUVA 3ZRDA 1YZXA 2GZPA 4GRFA 1GLPA 3NZNA 3VFIA 1QMVA 4POMA 4IQAA 4RI6A 2OADA 1GRXA 3F6DA 3QR6A 3FK8A 1MTCA 1R7HA 4IJ3A 4F82A 3CTFA 1K0AA 3IPZA 1QQ2A 2JADA 2WRTA 1PRXA 3TJBA 5G5EA 3F0IA 1S3CA 1T8EB 1M99A 4MH3A 2YWMA 4D73A 4BVYA 3F3QA 1HQOA 1FG4A 1M7TA 3G7YA 1G7OA 3IR4A 3Q19A 1GLQA 4N0VA 2CZ3A 1GSSA 4OCEA 1ZZYA 3KM6A 1F37A 2NBSA 1TK8B 3HVSA 5D93A 5G31A 2ZNMA 5HR1A 3HVXA 1X9SB 1ERVA 2IMFA 2V41A 3CYNA 2DBCA 1X5DA 1Z3EA 4TKYA 2C80A 3C1SA 4GSNA 2O8VB 4EXJA 3GKNA 2DMMA 3IA1A 4GWRA 1TDIA 1O8WA 1OC8A 3RDWA 1SKWB 4PUFC 3PH9A 18GSA 3GNJA 2V32A 1JZRA 1KBNA 2HNLA 6GSXA 5G2ZA 3GV1A 5JWQB 3PPUA 1BX9A 3UEMA 1PX6A 1VF1A 4ZB8A 2VLUA 4KSOA 1TI1A 4EKZA 2PN8A 3C8EA 4L0WA 1ZYEA 1M9AA 2IJYA 2DIYA 2R5GA 3LQ7A 4GSSA 3DVXA 2OE3A 5DALA 4L0UA 2LTKA 5ELAA 2GZZA 4EL1A 2LNSA 1LBKA 5BMUA 3KTBA 2VLTA 1ZCPA 2JSYA 1U3IA 4NV2A 2ES7A 1XPVA 2REMA 4ZILA 4PNGA 4GSTA 5J41A 3CSIA 3TB2A 4ACSA 3M9KA 2IIYA 3QAGA 2GS3A 1F6MC 4ZBDA 3ZMKA 1BEDA 3ZFLA 5ECPB 2M72A 5IMZA 4ZIJA 1KNGA 1BQ7A 1BJXA 5JCUA 1K0DA 4DSSB 4POLA 1V2AA 6GSYA 1FB6A 4WXTA 4MCUA 3CTGA 3UMAA 1V98A 4HEA2 2YWOA 1FB0A 1GWCA 2LS5A 4ISDA 3APOA 1SK1A 2LKUA 1XWCA 4CW9A 1Z5YE 2GZYA 2QSIA 3FRCA 2E2GA 3IAS2 3EINA 2H30A 5HQPA 5KN0A 4TR4A 1SYXA 5DBQA 4NXIA 22GSA 1TI3A 4ML6A 4Q5QA 4RI7A 2OJLA 4K0GA 5CNWA 2HZFA 5CRDA 1SKRB 3W8JA 4KW6A 4MZCA 3IBHA 4HU9A 2J9HA 5G30A 4V1Ag 4EDZA 4XS4A 2XC2A 1DE2A 1GSDA 3MDKA 2F8AA 2CV4A 4IN0A 1VF4A 2N5FA 2C3NA 3L78A 20GSA 1U6TA 4MPGA 4V1Ap 2FNOA 2GQLA 2VD0A 1EP8A 3KIJA 4NMUA 4DSQA 1MDJA 2M46A 3ZIVA 2X8HA 1HNBA 4J2FA 1ZGNA 4D73B 1K3OA 1OC3A 5LNKe 4MP4A 4K7IA 2MMNA 2OA7A 1OVNA 3EC3A 2OE0A 4YQVA 2F8FA 4JBBA 1AQWA 4V2MA 3KMOA 1E2YA 3IRAA 3DMLA 3RHBA 3BOAA 16GSA 1RQMA 4WEYA 1W89A 4BPYA 4E8EA 4CHSA 3KMNA 4AJ7A 1SL1B 4KF9A 2H73A 2HT9A 4EE0A 2H74A 4O5RA 2K18A 3DWVA 2H19A 1XIYA 1B4PA 1KEBA 5A4VA 5D9TA 2RIIA 3R3EA 3KGKA 1R26A 3TRQA 2GTUA 2K6VA 1TOFA 1G6YA 2QC7A 3APQA 5JWRB 1NHYA 1RK4A 1USBA 3ME7A 4O92A 2AJQB 5EPFA 1ST9A 4X0XA 5JCWA 3UIWA 2N5AA 5DJLA 1PKZA 1OE8A 3ZL5A 5A4UA 1SK2A 2TRXA 3D6IA 5DALB 1TP9A 11GSA 3KH7A 2MMOA 1PMTA 3QD9A 5CO3A 1ZMAA 4IKHA 5IOXA 1YY7A 3DYRA 5GAND 3EYTA 3CSHA 1DUGA 5DCHA 4F03A 2OACA 1TRSA 4PGTA 4OCFA 1UC7A 3M8NA 1EP7A 4IQ1A 4EDYA 4TW5A 1EV9A 1X9MB 1WJKA 1MDIA 4ZB9A 3HJPA 2H76A 5B6NA 1T00A 4MA9A 5B8BA 4TN8A 1TXXA 2EIRA 2VL2A 1SK0A 4HI7A 1PKWA 5ECOB 3QCPA 3GKKA 4V2NA 1O85A 2LJKA 4POKA 2FLSA 2H1GA 2IFQA 3GIXA 3G9BA 3IOSA 3ZITA 3LSZA 1K0OA 2I9HA 5JCGA 3TJGA 1GL8A 3FHKA 2LRNA 1HNCA 3ZVJD 3KEBA 2MMAA 4WETA 1ERWA 5AIXA 4ZXGA 1GUHA 5CRGA 2LQQA 1GNWA 3CSJA 2HSMA 3WGXA 2DJ2A 3Q74A 1TRWA 2JL4A 4HJ2A 3TKSA 1MD3A 5IM9A 4NHZA 2GVPA 3ZIJA 5ECNB 3QPMA 5IMDA 5G1KA 4K9ZA 3P2AA 2H0GA 4IS0A 2LSTA 2YV9A 5D9XA 3WGEA 4BVXA 2JZSA 3GTUB 5ECSA 5E4WA 4WR5A 3TJKA 4BL7B 3BCKA 2CVBA 4KAEA 2FWGA 1X5EA 1BG5A 1ML6A 2JACA 6GSSA 1TU7A 3HHVA 2H0IA 2CZ2A 4N30A 2G0FA 3BJ5A 4WBJA 5FT3A 1K3YA 4FYBA 5G1LA 4MDCA 2PGTA 3A2WA 5ECRB 1U3AA 5LCZA 1F3AA 1R5AA 1O6JA 2X99A 3M3MA 2IL3A 4I2TA 2DC5A 1WRYA 1WIKA 2IMEA 4FH8A 1NM3A 1SD9A 5DVBA 1M0UA 3CRTA 5ECKB 3GMFA 4OFNA 4LL4B 2P5QA 3DGQA 1XOBA 4TOPA 9GSSA 3DIEA 2CAIA 5C04A 5F07A 2H6XA 3H1NA 2VL3A 1T3BA 1SU9A 1ZL9A 1R4WA 3D4TA 4YQUA 1WOUA 2AHEA 3RBTA 4GF0A 4YAPA 4RQXA 2NTOA 4XRAA 1THXA 1K0CA 2A4VA 3LEFA 4MMMA 3UL3A 3DXBA 4MF5A 1B48A 4MJBA 5GSSA 3A2XA 4G10A 5DAKA 1AUCA 2PUKC 4G0IA 2F3MA 3M1GA 2CX4A 3LGCA 1OE7A 2DJ1A 3BCIA 4ECBA 3EURA 1YKAA 1YF0A 4TXOA 3HJMA 1Y6EA 2H6YA 2DJ0A 1V40A 2GT5A 1S3AA 1GTAA 2F9SA 3GL3A 4BA7A 1MEKA 2C4JA 5CP1A 1JLVA 3SBCA 4KX4A 1VRSD 4HZ4A 2H01A 1PL2A 4MF7A 5CYYA 3MWHA 3ISOA 4E8HA 4TXVA 3ERGA 2VAFA 3H8QA 2EIQA 3TKSE 2CQ9A 4HQZA 2YP6A 1HYUA 3EVIA 4F9ZA 1MDKA 2CX3A 1K3LA 1GSFA 3ZREA 4XS6A 3TRPA 2AB6A 5J3RA 4OO4A 2XPEA 2ON5A 2HZEA 3QOUA 4GCIA 2RUEA 5FHIA 1F2EA 3IK9A 2WFCA 2HSNB 3ED3A 1TJDA 2FUG2 1URMA 1EV4A 2EIOA 4DSRA 3IAM2 3N5OA 5D9WA 1PSQA 3VURA 3EMXA 1RW1A 5IMAA 3F4RA 4IBPA 2LV3A 3ERWA 3EWLA 4DEJA 4WF4A 3LFLA 4PQ1A 1IYIA 1OC9A 2HSMB 5F8BA 3VLNA 2H71A 3D21A 1XOAA 2B3SA 5ENUA 2V2GA 4WKWA 3O3TA 3N9JA 4JR6A 4YQMA 2LJRA 2K9FA 4ZB6A 4ZL8A 3ME8A 2K8VA 4HZ2A 1J08A 2CT6A 4KH7A 3M9JA 3LXZA 4P3YB 2VUPA 2GT6A 5AIVA 1T7PB 4Q5RA 2HRFA 2VM1A 2VO4A 1GH2A 2IMKA 5E59A 2FWHA 1V9WA 1XWGA 1TRVA 2MZCA 4BVXB 1OKDA 4XRDA 5ECHB 5H5QA 2NPBA 4WR4A 3L9UA 2X8CA 3PINA 1GNEA 3CRUA 2PWJA 1PD21 1XXUA 4YH2A 3H93A 3SWLA 2WB9A 4OD7A 1I5GA 4PUAA 1XW6A 3CBUA 3GH9A 4EO3A 5A4WA 4TR1A 3US3A 2MBTA 2VCTA 4JE1A 3VI5A 2TIRA 2CAQA 1XFLA 3I6AA 3TOUA 1ON4A 3KP8A 4JZQA 3F4SA 2MBSA 2WCIA 2X64A 3JCML 1CQHA 2R2JA 3EMPA 1F3BA 2E2MA 3WT1A 5DDLA 4G0LA 2GSRA 3OR5A 2AV4A 3CXGA 3ZTLA 2H1BA 2HSYA 4HS1A 4PX1A 4K6XA 3UVTA 4QL9A 1J0FA 1G0TA 2RUFA 4K7OA 1QFNA 2HRAA 2HQTA 1SYRA 2P0GA 1E6BA 4NV5A 2C1YA 1K0BA 1AW9A 5KEJA 5A5KA 2A2SA 2ALBA 1Z7PA 1Z6MA 2IN3A 3U6VA 1YKCA 5KN2A 5ECLB 3TRXA 3GN3A 5DAKB 5F0GA 1X5CA 4TR3A 4F2IA 1AC1A 3MSZA 3TJJA 1GSYA 1XVWA 1K0NA 1YQ1A 4BVYB 4LMVA 4JEDA 4TXOB 2PMTA 4K7NA 4XHMA 2IMIA 5IQYA 2I81A 3O76A 4IGJA 2BTOT 4FYUA 2FA8A 3QAVA 4I6XA 3MAKA 4K8MA 1V58A 5AN1A 3E9JB 1SENA 2H70A 2R4VA 1Z9HA 3KXOA 3F63A 1SL0B 4MK3A 4LL1B 4J57E 3QFAC 2C0FA 2VCVA 3DEXA 1Z7RA 2O89A 2HZEB 4MLYA 3D5JA 2VCZA 1EEMA 4IW9A 1X0RA 2VL2C 1B9XC 2FGXA 1JHBA 5L71A 1H75A 1XWKA 3IC8A 4G2EA 4TVEA 5F06A 3HJOA 1HNAA 1T4YA 1UVZA 2E0QA 1AQXA 1JZWA 2V1MA 2B7JA 3APSA 3IXRA 5CRWA 1JLWA 1PX7A 2ZUPA 1UN2A 1OC9B 3TKRA 4AGSA 4KGIA 1YF1A 4LA1A 2K8SA 3CMIA 4Z7XA 1TW9A 3A3TA 2IMDA 2NVLA 1LU4A 3TKSC 2BMXA 2MMZA 1UA5A 3F3RA 1XWBA 2DJJA 4J56E 4FYCA 1A2JA 1XBSA 1A2LA 3P90A 1YDKA 5AGYA 5H5RA 4L5LA 3GKMA 4XS1A 2KP1A 4TR0A 1M2BA 3E0UA 2H1DA 2B5XA 1M9BA 3FKFA 3E3EA 1WMJA 2KHPA 3HA9A 4IJIA 2XHFA 3RPPA 1WPIA 2VLVA 4XCSA 4XTSA 2X8GA 2GQMA 5CREA 3ZVJA 3FZ4A 5KN1A 4IVFA 3VWXA 4TR1B 3GUSA 2OKAA 2HE3A 3WYWA 2DMLA 1Q98A 4O32A 2WGRA 2KP2A 4GLTA 3TKQA 3KP9A 2D2ZA 7GSSA 4OWYA 2G2QA 2B5YA 4HOJA 4XIHA 2KLXA 4BWSA 1SJ6A 4KDYA 3KTLA 3LYKA 5EY6A 1PL1A 1HD2A 1VGLA 2PU9C 2GSQA 2V6KA 3ZFBA 5IOWA 1J9BA 1GUMA 2OBKA 3S9FA 3L0HA 4N10A 1GULA 4PXOA 3C1RA 3WT2A 3TUEA 4KA0A 2I1UA 5IO2A
chains in the Genus database with same CATH superfamily
1BYEA 2WVXB 2YZHA 4XS4B 2DJKA 4EC0A 2H66A 1X9WB 1JZOA 5J9CA 2DJ3A 2J23A 4MJEA 3TCOA 4PURA 4I8BA 2L6CA 1QXHA 3GSTA 3VWWA 3HXSA 1PGTA 2L6DA 1PN9A 2LRTA 4H86A 5ID2A 2P31A 2JZRA 2H6ZA 1A0RP 3UOMA 3HYPA 3LXTA 3KCMA 1AIUA 4I2UA 1GSUA 4MZBA 2YOIA 2WW1A 3RAZA 6GSUA 4G0KA 3ZLPA 2H0HA 1SJZA 3A2VA 4DVCA 4O7HA 3HCZA 8GSSA 1K0MA 4DSSA 3GKXA 1H4OA 2C3TA 2RM6A 5A34B 3LYPA 4F0BA 1EGOA 1XWAA 1GP1A 3NOFA 1PFOA 2I4AA 5EVOA 3ZMLA 2IPAA 5IIZA 5HFKA 3FZ5A 1BAYA 3RPNA 3J7Yk 3HVVA 3TU3B 3FW2A 2FCHA 2HI7A 5COHA 2ZCTA 4JR4A 4KDUA 3LG6A 5B7CA 3FZ9A 3UBLA 1EWXA 2B5EA 2JZTA 1ERTA 5AISA 2KOKA 2OE1A 3U5RE 3UJ1A 2R6KA 2L59A 2GSTA 2FWFA 1N2AA 3UARA 4KUNA 4JU5A 2HXKA 1B9YC 2H8LA 3FYGA 1EEJA 5ABRA 4WF5A 4Z2TA 5J47A 3C7MA 3P8WA 17GSA 3QFBC 3GHAA 4X4JA 5HR2A 3V1WA 4LLRA 2LQOA 2HYXA 1THOA 1WE0A 6GSTA 4V2LA 4MZWA 2YWNA 1YJ6A 1GSQA 3GYKA 2FY6A 3GA4A 3D22A 4OO5A 2B1LA 3C71A 3IHGA 3MNGA 1YEWC 3F9UA 3HY2A 4POBA 1T4ZA 4ECIA 3HZ8A 1O73A 2AYTA 2VCXA 2TRCP 4ID0A 4LMWA 4YAVA 4FO5A 2WS2A 6GSWA 1A8LA 2FA4A 2X4AA 4AJ6A 3GURA 3UVHA 5J4UA 2YANA 3L9VA 4QL7A 4FXYP 2RLIA 4K1FA 4X1UA 1TRUA 2LEGA 4JRRA 3F8UA 2CVKA 3H79A 4ECCA 4ECJA 4IP6A 3R2QA 1QGVA 3VWUA 1SD8A 3GFKA 1S3RA 2IFQB 1GUKA 1GTIA 1M2AA 1TU8A 1TK0B 6GSVA 3DRNA 1VF3A 3VPQA 2A2RA 2L57A 3RHCA 2LUSA 1SKSB 3G7IA 4HJMA 4PHZC 4NWYA 2PBJA 1PQNA 5J9BA 5ELGA 3EPTA 1Q4JA 5IPGA 1SVMA 2LNTA 2YJ7A 4MPFA 5KN3A 1FHEA 4RQRA 1A2MA 3W6GA 3G7JA 4PQHA 2PERA 3IC4A 2YCDA 4FQUA 5DCGA 2IWTA 3F6FA 2C0DA 1NHOA 5ID2B 2O85A 1DE1A 3FEUA 2FD3A 3QAWA 5KOXA 1AXDA 3LW9A 3QDNA 2C0GA 1G6WA 1QK8A 2JU5A 2L4QA 3ERFA 2DLXA 1TTZA 2N5BA 3C73A 1A23A 3TOTA 2R3XA 1GTUA 1O8XA 4HQSA 1FAAA 2HRNA 5D96A 2YPMA 2E7PA 1Y25A 3QMXA 2GQKA 4KCEA 3VI7A 4G19A 3GH6A 1FO5A 2M80A 2MYGA 3UBKA 2NDOA 2VM2A 4PI2C 2AAWA 5ECMB 2CVDA 5HFGA 2C3QA 2ON7A 1I9DA 3DKSA 1F9MA 4KB3A 3FR6A 2GDRA 4ZL7A 3GRXA 3PGTA 1MD4A 5H5SA 1OYJA 4I97A 4PQIA 2HRKA 3IE3A 1C72A 2GLRA 2H72A 4ZL9A 1O81A 4ZBAA 2WDUA 3L4NA 3F4TA 2EC4A 1SL2B 2AUVA 3DVWA 2B1KA 5J5NA 2PPTA 1A8YA 4N11A 1T1VA 1FW1A 2O7KA 3FMWA 2V6OA 1NSWA 2HSHA 4FIWA 3TGZA 3I9V2 1DSBA 4IELA 2Z9SA 1PA3A 3NIVA 2LJAA 4GQCA 2L4CA 4ZBBA 2KUCA 1U88A 3VWVA 1N8JA 3GTUA 1G7EA 3DD3A 4BL7A 5JWOB 2WVYA 3Q18A 5ECIB 4HU7A 4HUAA 3HKRA 5DQSA 2LRCA 4WBRD 3HDCA 1ZYQB 1WP0A 12GSA 5CRHA 2DSAA 5C00A 3W8SA 1A24A 1WWJA 2QGVA 2X49A 4K0NA 4KNDA 3IHQA 3Q6OA 3KJYA 5B6MA 3O6TA 3IK7A 2WZ9A 3H4KA 1EGRA 2PVQA 2WJUA 5DQYA 3FZAA 4MJAA 3LORA 1W4VA 4EF0A 1QUWA 4KSMA 1ABAA 2I3YA 3A5WA 3WD6A 3BBYA 1KTEA 1TKDB 5FWGA 4IP1A 1ILOA 4OFMA 3ZYWA 5IO0A 3KH9A 4QQ7A 4Q5FA 1JZDA 1LJRA 2JSZA 2XBIA 2UZ8A 1XZOA 2HFDA 5IPHA 1IYHA 3TKPA 5A1NA 2HLSA 1R5PA 5HR0A 3FR9A 4HSCX 3GX8A 1FVJA 2H1AA 1CQGA 4GXZA 1VF2A 2VL9A 4BWQA 4ML1A 5HFIA 4ULXA 4L8EA 3M0FA 4HDEA 5D8IA 3CQFA 3FY7A 2GGTA 3AY8A 13GSA 3VK9A 1ERUA 4AF2A 19GSA 1YEXA 4PNFA 2P5RA 2PVOC 4GQFA 1M2DA 4N0ZA 2DIZA 1XW9A 2YZUA 2QA2A 5GZZB 1NW2A 3L9SA 2RM5A 5D9VA 3GL5A 4TRXA 3EU3A 2B6MA 3HD5A 5CAXA 3PR8A 4F0CA 3IDVA 2O87A 2C0EA 4IHUA 5DJMA 4MH2A 4I5QA 2WULA 1PN0A 3I69A 2VCWA 3WGDA 2BJXA 2C8UA 3UAPA 4NHWA 4GTUA 4Q5NA 1XVQA 4EVMA 5EL8A 4X43A 4AJ8A 1OAZA 1XW5A 4MABA 4AKGA 2R37A 2HRKB 1OKTA 4CY6A 4W66A 1EZKA 3BD2A 2YJHA 2F51A 1YEPA 1FOVA 3EU4A 2XPDA 1V57A 2OBIA 1AQVA 5IMFA 2VD1A 5F05A 4Z2UA 1A0FA 5B8AA 3TJFA 4OMVA 3RGBC 2YWIA 3D4MA 3MYDA 5HR3A 4ILFA 5A5HB 1DBYA 1SJIA 1O7UA 2FWEA 1B8XA 2CA8A 1EOGA 3ZZXA 2GSSA 1Z6NA 2QKEA 1AAZA 4PTSA 3TDGA 3EE2A 1U87A 4K2DA 1GSEA 1B4QA 4KDXA 3K8NA 4MF6A 5IMCA 4L5OA 2H1LA 4NPBA 4EUYA 3J7Yb 5INYA 2EFCA 2EFHA 2FHEA 3KZQA 3I43A 1EOHA 4G9HA 5ECQB 5GSTA 2VOCA 2YV7A 4ZB7A 1S3DA 3HZ4A 14GSA 4OFTA 1TK5B 3LJRA 3GX0A 3IV4A 1ZOFA 5LD0A 4KE3A 2VIMA 5IMVA 1XCCA 4USSA 2VCQA 4KCAA 2B7KA 4CDOA 2XBQA 5D73A 4MJCA 2H75A 5G5FA 2YNXA 2L5LA 1SVOA 1JFUA 3VPTA 2L5OA 5GAPD 1ACVA 3RFRC 1FVKA 1GTBA 4NAXA 3LWAA 3D0ZA 2YN1A 4ICYA 3GSSA 3P7XA 4O5UA 3KD0A 3FR3A 10GSA 4RUVA 3ZRDA 1YZXA 2GZPA 4GRFA 1GLPA 3NZNA 1I1IP 3VFIA 1QMVA 4POMA 4EIPA 4IQAA 4RI6A 2OADA 1GRXA 3F6DA 5A1NB 3QR6A 3FK8A 1MTCA 1R7HA 4IJ3A 4F82A 3CTFA 1K0AA 3IPZA 1QQ2A 2JADA 2WRTA 1PRXA 3TJBA 4G01A 5G5EA 3F0IA 1S3CA 1T8EB 1M99A 4MH3A 2YWMA 4D73A 4BVYA 3F3QA 1N25A 1HQOA 2WW0A 1FG4A 1M7TA 3G7YA 1G7OA 3IR4A 3Q19A 1GLQA 4N0VA 2CZ3A 1GSSA 4OCEA 1ZZYA 3KM6A 1F37A 2NBSA 1TK8B 3HVSA 5D93A 5G31A 2ZNMA 5HR1A 3HVXA 1X9SB 1ERVA 2IMFA 2V41A 3CYNA 2DBCA 1X5DA 5J4YA 1M3IA 1Z3EA 3HMJG 4TKYA 2C80A 3C1SA 4GSNA 2O8VB 4EXJA 3GKNA 2DMMA 3IA1A 4GWRA 1TDIA 1BG1A 4YKFA 1O8WA 1OC8A 3RDWA 1SKWB 4PUFC 4EIQA 3PH9A 18GSA 3GNJA 2V32A 1JZRA 1KBNA 2HNLA 6GSXA 5G2ZA 3GV1A 5JWQB 3PPUA 1BX9A 3UEMA 1PX6A 1VF1A 4ZB8A 2VLUA 4KSOA 2VKZG 1TI1A 4EKZA 2PN8A 3C8EA 4L0WA 1ZYEA 1M9AA 2IJYA 2DIYA 2R5GA 3LQ7A 4Z2RA 4GSSA 3DVXA 2OE3A 2A2PA 4MNNA 5DALA 4L0UA 2LTKA 5ELAA 2GZZA 4EL1A 2LNSA 2R0PA 1LBKA 2WZSA 5BMUA 3KTBA 2VLTA 1ZCPA 2JSYA 1U3IA 4NV2A 2ES7A 1XPVA 2REMA 4ZILA 4PNGA 2DKHA 4GSTA 5J41A 3CSIA 3TB2A 4ACSA 3M9KA 2IIYA 3QAGA 2GS3A 1F6MC 4ZBDA 1TXUA 3ZMKA 1BEDA 3ZFLA 5ECPB 2M72A 5IMZA 4ZIJA 1KNGA 1BQ7A 1BJXA 5JCUA 1K0DA 4DSSB 4POLA 1V2AA 6GSYA 1FB6A 4WXTA 4MCUA 3CTGA 3UMAA 5KOWA 1V98A 4HEA2 2YWOA 1FB0A 1GWCA 2LS5A 4ISDA 3APOA 1SK1A 2LKUA 1XWCA 4CW9A 1Z5YE 2GZYA 2QSIA 3FRCA 2E2GA 3IAS2 3EINA 2H30A 1SVLA 5HQPA 4N3ZA 5KN0A 4TR4A 1SYXA 5DBQA 4NXIA 22GSA 1TI3A 4ML6A 4Q5QA 4RI7A 2OJLA 4K0GA 5CNWA 2HZFA 5CRDA 1SKRB 3W8JA 4KW6A 4MZCA 3IBHA 2WVZA 4HU9A 2J9HA 5G30A 4V1Ag 5J40A 4EDZA 4XS4A 2XC2A 1DE2A 1GSDA 3MDKA 2F8AA 2CV4A 4IN0A 1VF4A 2N5FA 2C3NA 3L78A 4A5PA 20GSA 1U6TA 4MPGA 4V1Ap 2FNOA 2GQLA 2VD0A 1EP8A 3KIJA 4NMUA 4DSQA 1MDJA 2M46A 3ZIVA 2X8HA 1HNBA 4J2FA 1ZGNA 4D73B 1K3OA 1OC3A 5LNKe 4MP4A 4K7IA 2MMNA 2OA7A 1OVNA 1ZYNA 3EC3A 2OE0A 4YQVA 2F8FA 4JBBA 1AQWA 4V2MA 3KMOA 1E2YA 3IRAA 4CY8A 3DMLA 3RHBA 1ZYPA 3BOAA 16GSA 1RQMA 4WEYA 1W89A 4BPYA 2R0GA 4E8EA 4CHSA 3KMNA 4AJ7A 1SL1B 4KF9A 2H73A 2HT9A 4EE0A 2H74A 4O5RA 2K18A 3DWVA 2H19A 1XIYA 1B4PA 1KEBA 5A4VA 5D9TA 2RIIA 3R3EA 3KGKA 1R26A 3TRQA 2GTUA 2K6VA 1TOFA 1G6YA 2QC7A 3APQA 5JWRB 1NHYA 1RK4A 4AKXB 1USBA 3ME7A 4O92A 2AJQB 5EPFA 1ST9A 4X0XA 5JCWA 3UIWA 2N5AA 5DJLA 1PKZA 1OE8A 3ZL5A 5A4UA 1SK2A 2TRXA 3D6IA 5DALB 1TP9A 11GSA 3KH7A 2MMOA 5BMUB 1PMTA 3QD9A 2EFDA 5CO3A 4PI0C 1ZMAA 4IKHA 5IOXA 1YY7A 3DYRA 5GAND 3EYTA 3CSHA 1DUGA 5DCHA 4F03A 2OACA 1TRSA 3CHXC 4PGTA 4OCFA 1UC7A 3M8NA 1EP7A 4IQ1A 4EDYA 4TW5A 1EV9A 1X9MB 1WJKA 1MDIA 4ZB9A 3HJPA 2H76A 5B6NA 1T00A 4MA9A 5B8BA 4TN8A 1TXXA 2EIRA 2VL2A 1SK0A 4HI7A 1PKWA 5ECOB 3QCPA 3GKKA 4V2NA 1O85A 2HSNA 2LJKA 4POKA 2FLSA 2H1GA 2IFQA 3GIXA 3G9BA 3IOSA 3ZITA 3LSZA 1K0OA 2I9HA 5JCGA 3TJGA 1GL8A 3FHKA 2LRNA 1HNCA 3ZVJD 3KEBA 3HVNA 2MMAA 4WETA 1ERWA 5AIXA 4ZXGA 1GUHA 5CRGA 2LQQA 1GNWA 3CSJA 2HSMA 3WGXA 2DJ2A 3Q74A 1TRWA 2JL4A 4HJ2A 3TKSA 1MD3A 5IM9A 4NHZA 2GVPA 3ZIJA 5ECNB 3QPMA 5IMDA 5G1KA 4K9ZA 3P2AA 2H0GA 4IS0A 2LSTA 2YV9A 5D9XA 3WGEA 4BVXA 2JZSA 3GTUB 5ECSA 5E4WA 4WR5A 3TJKA 4BL7B 3BCKA 2CVBA 4KAEA 2FWGA 1Y1UA 1X5EA 2A4HA 1BG5A 1ML6A 2JACA 6GSSA 1TU7A 3HHVA 2H0IA 2CZ2A 4N30A 2G0FA 3BJ5A 4WBJA 5FT3A 1K3YA 4FYBA 5G1LA 4MDCA 2PGTA 3A2WA 5ECRB 1U3AA 5LCZA 1F3AA 1R5AA 1O6JA 2X99A 3M3MA 2IL3A 4I2TA 2DC5A 1WRYA 1WIKA 2IMEA 4FH8A 4K2XA 1NM3A 2EFEA 1SD9A 5DVBA 1M0UA 3CRTA 5ECKB 4AKHA 3GMFA 4OFNA 4LL4B 2O5VA 2P5QA 3DGQA 1XOBA 4TOPA 9GSSA 3DIEA 2CAIA 5C04A 5F07A 2H6XA 3H1NA 2VL3A 1T3BA 1SU9A 1ZL9A 1R4WA 3D4TA 4YQUA 1WOUA 2AHEA 3RBTA 4GF0A 4YAPA 4RQXA 1S4BP 2NTOA 4XRAA 1THXA 1K0CA 2A4VA 3LEFA 4MMMA 3UL3A 3DXBA 4MF5A 1B48A 4MJBA 5GSSA 3A2XA 4G10A 5DAKA 1AUCA 2PUKC 4G0IA 2WW3A 2F3MA 3M1GA 2CX4A 3LGCA 1OE7A 4QMKA 2DJ1A 3BCIA 4ECBA 4O5QA 3EURA 1YKAA 1YF0A 4TXOA 3HJMA 5BRTA 1Y6EA 2H6YA 2DJ0A 1V40A 2GT5A 1S3AA 1GTAA 2F9SA 3GL3A 4BA7A 1MEKA 2C4JA 5CP1A 1JLVA 3SBCA 4KX4A 1VRSD 4HZ4A 2H01A 1PL2A 4MF7A 4K5SA 5CYYA 3MWHA 3ISOA 4E8HA 4TXVA 1XG8A 3ERGA 2VAFA 3H8QA 2EIQA 3TKSE 2CQ9A 4HQZA 2YP6A 1HYUA 3EVIA 4F9ZA 1MDKA 2CX3A 1K3LA 1GSFA 3ZREA 4BIKA 4XS6A 2WW2A 3TRPA 2AB6A 5J3RA 4OO4A 2XPEA 2ON5A 2HZEA 3QOUA 4GCIA 2RUEA 2DKIA 5FHIA 1F2EA 5J4VA 3IK9A 2WFCA 2HSNB 3ED3A 1TJDA 2FUG2 1URMA 1EV4A 2EIOA 4DSRA 3IAM2 3N5OA 5D9WA 4AI6A 1PSQA 3VURA 3EMXA 1RW1A 5IMAA 3F4RA 4IBPA 2LV3A 3ERWA 3EWLA 4DEJA 4WF4A 3LFLA 4PQ1A 1IYIA 1OC9A 2HSMB 5F8BA 3VLNA 2H71A 3D21A 1XOAA 2B3SA 5ENUA 2V2GA 4WKWA 3O3TA 3N9JA 4JR6A 4YQMA 2LJRA 2K9FA 4ZB6A 4ZL8A 3ME8A 2K8VA 4HZ2A 1J08A 2CT6A 4KH7A 3M9JA 3LXZA 4P3YB 2VUPA 2GT6A 5AIVA 1T7PB 4Q5RA 2HRFA 2VM1A 2VO4A 1GH2A 2OT3A 4K5RA 2IMKA 5E59A 2FWHA 1V9WA 1XWGA 1TRVA 2MZCA 4BVXB 1OKDA 4XRDA 5ECHB 5H5QA 2NPBA 4WR4A 3L9UA 2X8CA 3PINA 2QA1A 1GNEA 3CRUA 2PWJA 2O36A 1PD21 1XXUA 4YH2A 3H93A 3SWLA 2WB9A 4OD7A 1I5GA 4PUAA 1XW6A 3CBUA 3GH9A 4EO3A 5A4WA 4TR1A 3US3A 2MBTA 2VCTA 4JE1A 3VI5A 2TIRA 2CAQA 1XFLA 3I6AA 3TOUA 1ON4A 3KP8A 4JZQA 3MIXA 3F4SA 2MBSA 2WCIA 2X64A 3JCML 1CQHA 2R2JA 3EMPA 1F3BA 2E2MA 3WT1A 5DDLA 4G0LA 2GSRA 3OR5A 2AV4A 3CXGA 3ZTLA 2H1BA 2HSYA 4HS1A 4PX1A 4K6XA 1BF5A 3UVTA 4QL9A 1J0FA 1G0TA 2RUFA 4K7OA 1QFNA 2HRAA 2HQTA 2WVXA 1SYRA 2P0GA 1E6BA 4NV5A 2C1YA 1K0BA 1AW9A 5KEJA 5A5KA 2A2SA 2R0CA 2ALBA 1Z7PA 1Z6MA 2IN3A 3U6VA 1YKCA 5KN2A 5ECLB 3TRXA 2UV8G 3GN3A 5DAKB 5A5HA 5F0GA 1X5CA 4TR3A 4F2IA 1AC1A 3MSZA 3TJJA 1GSYA 1XVWA 1K0NA 1YQ1A 4BVYB 4LMVA 4JEDA 4TXOB 2PMTA 4K7NA 4XHMA 2IMIA 5IQYA 2I81A 3O76A 4IGJA 2BTOT 4FYUA 2FA8A 3QAVA 4I6XA 3MAKA 4YKGA 5A34A 4K8MA 1V58A 5AN1A 3E9JB 1SENA 2H70A 2R4VA 1Z9HA 3KXOA 3F63A 1SL0B 4MK3A 4LL1B 4J57E 3QFAC 2C0FA 2VCVA 3DEXA 1Z7RA 1FOHA 2O89A 2HZEB 4MLYA 3D5JA 2VCZA 1EEMA 2VL2C 4IW9A 1X0RA 1B9XC 3CWGA 2FGXA 1JHBA 5L71A 1H75A 1XWKA 3IC8A 4G2EA 4E68A 4TVEA 5F06A 3HJOA 1HNAA 1T4YA 1UVZA 2E0QA 1AQXA 1JZWA 2V1MA 2B7JA 3APSA 3IXRA 5CRWA 1JLWA 1PX7A 2ZUPA 1UN2A 1OC9B 3TKRA 4AGSA 4KGIA 1YF1A 4LA1A 2K8SA 3CMIA 4Z7XA 1TW9A 3A3TA 2IMDA 2NVLA 1LU4A 3TKSC 2BMXA 2MMZA 1UA5A 3F3RA 1XWBA 2DJJA 4J56E 4FYCA 1A2JA 1XBSA 1A2LA 3P90A 1YDKA 5AGYA 5H5RA 4L5LA 3GKMA 4XS1A 2KP1A 4TR0A 1M2BA 3E0UA 2H1DA 2B5XA 1M9BA 3FKFA 3E3EA 1WMJA 2KHPA 3HA9A 4IJIA 2XHFA 3RPPA 1M3JA 1WPIA 2VLVA 4XCSA 4XTSA 2X8GA 2GQMA 5CREA 3ZVJA 3FZ4A 5KN1A 4IVFA 3VWXA 4TR1B 3A5IA 3GUSA 2OKAA 2HE3A 3WYWA 2DMLA 1Q98A 4O32A 2WGRA 2O3EA 2KP2A 4GLTA 3TKQA 3KP9A 2D2ZA 7GSSA 4OWYA 2G2QA 2B5YA 4HOJA 4XIHA 4GDFA 2KLXA 1YVLA 4BWSA 1SJ6A 4KDYA 3KTLA 3LYKA 5EY6A 1PL1A 1HD2A 1VGLA 2PU9C 2GSQA 2V6KA 3ZFBA 4AKIA 5IOWA 1J9BA 1GUMA 2OBKA 3S9FA 3L0HA 4N10A 1GULA 4PXOA 3C1RA 3WT2A 3TUEA 4KA0A 2I1UA 5IO2A
chains in the Genus database with same CATH topology
1BYEA 2YZHA 4XS4B 2DJKA 4EC0A 2H66A 1X9WB 1JZOA 5J9CA 2DJ3A 2J23A 4MJEA 3TCOA 4PURA 4I8BA 2L6CA 1QXHA 3GSTA 3VWWA 3HXSA 1PGTA 2L6DA 1PN9A 2LRTA 4H86A 5ID2A 2P31A 2JZRA 2H6ZA 1A0RP 3UOMA 3HYPA 3LXTA 3KCMA 1AIUA 4I2UA 1GSUA 4MZBA 2YOIA 3RAZA 6GSUA 4G0KA 3ZLPA 2H0HA 1SJZA 3A2VA 4DVCA 4O7HA 3HCZA 8GSSA 1K0MA 4DSSA 3GKXA 1H4OA 2C3TA 2RM6A 5A34B 3LYPA 4F0BA 1EGOA 1XWAA 1GP1A 3NOFA 2I4AA 5EVOA 3ZMLA 2IPAA 5IIZA 5HFKA 3FZ5A 1BAYA 3RPNA 3J7Yk 3HVVA 3TU3B 3FW2A 2FCHA 2HI7A 5COHA 2ZCTA 4JR4A 4KDUA 3LG6A 5B7CA 3FZ9A 3UBLA 1EWXA 2B5EA 2JZTA 1ERTA 5AISA 2KOKA 2OE1A 3U5RE 3UJ1A 2R6KA 2L59A 2GSTA 2FWFA 1N2AA 3UARA 4KUNA 4JU5A 2HXKA 1B9YC 2H8LA 3FYGA 1EEJA 5ABRA 4WF5A 4Z2TA 5J47A 3C7MA 3P8WA 17GSA 3QFBC 3GHAA 4X4JA 5HR2A 3V1WA 4LLRA 2LQOA 2HYXA 1THOA 1WE0A 6GSTA 4V2LA 4MZWA 2YWNA 1YJ6A 1GSQA 3GYKA 2FY6A 3GA4A 3D22A 4OO5A 2B1LA 3C71A 3IHGA 3MNGA 3F9UA 3HY2A 4POBA 1T4ZA 4ECIA 3HZ8A 1O73A 2AYTA 2VCXA 2TRCP 4ID0A 4LMWA 4YAVA 4FO5A 2WS2A 6GSWA 1A8LA 2FA4A 2X4AA 4AJ6A 3GURA 3UVHA 5J4UA 2YANA 3L9VA 4QL7A 2RLIA 4K1FA 4X1UA 1TRUA 2LEGA 4JRRA 3F8UA 2CVKA 3H79A 4ECCA 4ECJA 4IP6A 3R2QA 1QGVA 3VWUA 1SD8A 3GFKA 2IFQB 1GUKA 1GTIA 1M2AA 1TU8A 1TK0B 6GSVA 3DRNA 1VF3A 3VPQA 2A2RA 2L57A 3RHCA 2LUSA 1SKSB 3G7IA 4HJMA 4NWYA 2PBJA 1PQNA 5J9BA 5ELGA 3EPTA 1Q4JA 5IPGA 1SVMA 2LNTA 2YJ7A 4MPFA 5KN3A 1FHEA 4RQRA 1A2MA 3W6GA 3G7JA 4PQHA 2PERA 3IC4A 2YCDA 4FQUA 5DCGA 2IWTA 3F6FA 2C0DA 1NHOA 5ID2B 2O85A 1DE1A 3FEUA 2FD3A 3QAWA 5KOXA 1AXDA 3LW9A 3QDNA 2C0GA 1G6WA 1QK8A 2JU5A 2L4QA 3ERFA 2DLXA 1TTZA 2N5BA 3C73A 1A23A 3TOTA 2R3XA 1GTUA 1O8XA 4HQSA 1FAAA 2HRNA 5D96A 2YPMA 2E7PA 1Y25A 3QMXA 2GQKA 4KCEA 3VI7A 4G19A 3GH6A 1FO5A 2M80A 2MYGA 3UBKA 2NDOA 2VM2A 2AAWA 5ECMB 2CVDA 5HFGA 2C3QA 2ON7A 1I9DA 3DKSA 1F9MA 4KB3A 3FR6A 2GDRA 4ZL7A 3GRXA 3PGTA 1MD4A 5H5SA 1OYJA 4I97A 4PQIA 2HRKA 3IE3A 1C72A 2GLRA 2H72A 4ZL9A 1O81A 4ZBAA 2WDUA 3L4NA 3F4TA 2EC4A 1SL2B 2AUVA 3DVWA 2B1KA 5J5NA 2PPTA 1A8YA 4N11A 1T1VA 1FW1A 2O7KA 3FMWA 2V6OA 1NSWA 2HSHA 4FIWA 3TGZA 3I9V2 1DSBA 4IELA 2Z9SA 1PA3A 3NIVA 2LJAA 4GQCA 2L4CA 4ZBBA 2KUCA 1U88A 3VWVA 1N8JA 3GTUA 1G7EA 3DD3A 4BL7A 5JWOB 3Q18A 5ECIB 4HU7A 4HUAA 3HKRA 5DQSA 2LRCA 4WBRD 3HDCA 1ZYQB 1WP0A 12GSA 5CRHA 2DSAA 5C00A 3W8SA 1A24A 1WWJA 2QGVA 2X49A 4K0NA 4KNDA 3IHQA 3Q6OA 3KJYA 5B6MA 3O6TA 3IK7A 2WZ9A 3H4KA 1EGRA 2PVQA 2WJUA 5DQYA 3FZAA 4MJAA 3LORA 1W4VA 4EF0A 1QUWA 4KSMA 1ABAA 2I3YA 3A5WA 3WD6A 3BBYA 1KTEA 1TKDB 5FWGA 4IP1A 1ILOA 4OFMA 3ZYWA 5IO0A 3KH9A 4QQ7A 4Q5FA 1JZDA 1LJRA 2JSZA 2XBIA 2UZ8A 1XZOA 2HFDA 5IPHA 1IYHA 3TKPA 5A1NA 2HLSA 1R5PA 5HR0A 3FR9A 3GX8A 1FVJA 2H1AA 1CQGA 4GXZA 1VF2A 2VL9A 4BWQA 4ML1A 5HFIA 4ULXA 4L8EA 3M0FA 4HDEA 5D8IA 3FY7A 2GGTA 3AY8A 13GSA 3VK9A 1ERUA 4AF2A 19GSA 1YEXA 4PNFA 2P5RA 2PVOC 4GQFA 1M2DA 4N0ZA 2DIZA 1XW9A 2YZUA 2QA2A 5GZZB 1NW2A 3L9SA 2RM5A 5D9VA 3GL5A 4TRXA 3EU3A 2B6MA 3HD5A 5CAXA 3PR8A 4F0CA 3IDVA 2O87A 2C0EA 4IHUA 5DJMA 4MH2A 4I5QA 2WULA 1PN0A 3I69A 2VCWA 3WGDA 2BJXA 2C8UA 3UAPA 4NHWA 4GTUA 4Q5NA 1XVQA 4EVMA 5EL8A 4X43A 4AJ8A 1OAZA 1XW5A 4MABA 4AKGA 2R37A 2HRKB 1OKTA 4CY6A 4W66A 1EZKA 3BD2A 2YJHA 2F51A 1YEPA 1FOVA 3EU4A 2XPDA 1V57A 2OBIA 1AQVA 5IMFA 2VD1A 5F05A 4Z2UA 1A0FA 5B8AA 3TJFA 4OMVA 2YWIA 3D4MA 3MYDA 5HR3A 4ILFA 5A5HB 1DBYA 1SJIA 1O7UA 2FWEA 1B8XA 2CA8A 1EOGA 3ZZXA 2GSSA 1Z6NA 2QKEA 1AAZA 4PTSA 3TDGA 3EE2A 1U87A 4K2DA 1GSEA 1B4QA 4KDXA 3K8NA 4MF6A 5IMCA 4L5OA 2H1LA 4NPBA 4EUYA 3J7Yb 5INYA 2EFCA 2EFHA 2FHEA 3KZQA 3I43A 1EOHA 4G9HA 5ECQB 5GSTA 2VOCA 2YV7A 4ZB7A 1S3DA 3HZ4A 14GSA 4OFTA 1TK5B 3LJRA 3GX0A 3IV4A 1ZOFA 5LD0A 4KE3A 2VIMA 5IMVA 1XCCA 4USSA 2VCQA 4KCAA 2B7KA 4CDOA 2XBQA 5D73A 4MJCA 2H75A 5G5FA 2YNXA 2L5LA 1SVOA 1JFUA 3VPTA 2L5OA 5GAPD 1ACVA 1FVKA 1GTBA 4NAXA 3LWAA 3D0ZA 2YN1A 4ICYA 3GSSA 3P7XA 4O5UA 3KD0A 3FR3A 10GSA 4RUVA 3ZRDA 1YZXA 2GZPA 4GRFA 1GLPA 3NZNA 3VFIA 1QMVA 4POMA 4EIPA 4IQAA 4RI6A 2OADA 1GRXA 3F6DA 5A1NB 3QR6A 3FK8A 1MTCA 1R7HA 4IJ3A 4F82A 3CTFA 1K0AA 3IPZA 1QQ2A 2JADA 2WRTA 1PRXA 3TJBA 4G01A 5G5EA 3F0IA 1S3CA 1T8EB 1M99A 4MH3A 2YWMA 4D73A 4BVYA 3F3QA 1N25A 1HQOA 1FG4A 1M7TA 3G7YA 1G7OA 3IR4A 3Q19A 1GLQA 4N0VA 2CZ3A 1GSSA 4OCEA 1ZZYA 3KM6A 1F37A 2NBSA 1TK8B 3HVSA 5D93A 5G31A 2ZNMA 5HR1A 3HVXA 1X9SB 1ERVA 2IMFA 2V41A 3CYNA 2DBCA 1X5DA 5J4YA 1Z3EA 3HMJG 4TKYA 2C80A 3C1SA 4GSNA 2O8VB 4EXJA 3GKNA 2DMMA 3IA1A 4GWRA 1TDIA 1BG1A 4YKFA 1O8WA 1OC8A 3RDWA 1SKWB 4PUFC 4EIQA 3PH9A 18GSA 3GNJA 2V32A 1JZRA 1KBNA 2HNLA 6GSXA 5G2ZA 3GV1A 5JWQB 3PPUA 1BX9A 3UEMA 1PX6A 1VF1A 4ZB8A 2VLUA 4KSOA 2VKZG 1TI1A 4EKZA 2PN8A 3C8EA 4L0WA 1ZYEA 1M9AA 2IJYA 2DIYA 2R5GA 3LQ7A 4Z2RA 4GSSA 3DVXA 2OE3A 2A2PA 4MNNA 5DALA 4L0UA 2LTKA 5ELAA 2GZZA 4EL1A 2LNSA 2R0PA 1LBKA 5BMUA 3KTBA 2VLTA 1ZCPA 2JSYA 1U3IA 4NV2A 2ES7A 1XPVA 2REMA 4ZILA 4PNGA 2DKHA 4GSTA 5J41A 3CSIA 3TB2A 4ACSA 3M9KA 2IIYA 3QAGA 2GS3A 1F6MC 4ZBDA 1TXUA 3ZMKA 1BEDA 3ZFLA 5ECPB 2M72A 5IMZA 4ZIJA 1KNGA 1BQ7A 1BJXA 5JCUA 1K0DA 4DSSB 4POLA 1V2AA 6GSYA 1FB6A 4WXTA 4MCUA 3CTGA 3UMAA 5KOWA 1V98A 4HEA2 2YWOA 1FB0A 1GWCA 2LS5A 4ISDA 3APOA 1SK1A 2LKUA 1XWCA 4CW9A 1Z5YE 2GZYA 2QSIA 3FRCA 2E2GA 3IAS2 3EINA 2H30A 1SVLA 5HQPA 4N3ZA 5KN0A 4TR4A 1SYXA 5DBQA 4NXIA 22GSA 1TI3A 4ML6A 4Q5QA 4RI7A 2OJLA 4K0GA 5CNWA 2HZFA 5CRDA 1SKRB 3W8JA 4KW6A 4MZCA 3IBHA 4HU9A 2J9HA 5G30A 4V1Ag 5J40A 4EDZA 4XS4A 2XC2A 1DE2A 1GSDA 3MDKA 2F8AA 2CV4A 4IN0A 1VF4A 2N5FA 2C3NA 3L78A 4A5PA 20GSA 1U6TA 4MPGA 4V1Ap 2FNOA 2GQLA 2VD0A 1EP8A 3KIJA 4NMUA 4DSQA 1MDJA 2M46A 3ZIVA 2X8HA 1HNBA 4J2FA 1ZGNA 4D73B 1K3OA 1OC3A 5LNKe 4MP4A 4K7IA 2MMNA 2OA7A 1OVNA 1ZYNA 3EC3A 2OE0A 4YQVA 2F8FA 4JBBA 1AQWA 4V2MA 3KMOA 1E2YA 3IRAA 4CY8A 3DMLA 3RHBA 1ZYPA 3BOAA 16GSA 1RQMA 4WEYA 1W89A 4BPYA 2R0GA 4E8EA 4CHSA 3KMNA 4AJ7A 1SL1B 4KF9A 2H73A 2HT9A 4EE0A 2H74A 4O5RA 2K18A 3DWVA 2H19A 1XIYA 1B4PA 1KEBA 5A4VA 5D9TA 2RIIA 3R3EA 3KGKA 1R26A 3TRQA 2GTUA 2K6VA 1TOFA 1G6YA 2QC7A 3APQA 5JWRB 1NHYA 1RK4A 4AKXB 1USBA 3ME7A 4O92A 2AJQB 5EPFA 1ST9A 4X0XA 5JCWA 3UIWA 2N5AA 5DJLA 1PKZA 1OE8A 3ZL5A 5A4UA 1SK2A 2TRXA 3D6IA 5DALB 1TP9A 11GSA 3KH7A 2MMOA 5BMUB 1PMTA 3QD9A 2EFDA 5CO3A 1ZMAA 4IKHA 5IOXA 1YY7A 3DYRA 5GAND 3EYTA 3CSHA 1DUGA 5DCHA 4F03A 2OACA 1TRSA 4PGTA 4OCFA 1UC7A 3M8NA 1EP7A 4IQ1A 4EDYA 4TW5A 1EV9A 1X9MB 1WJKA 1MDIA 4ZB9A 3HJPA 2H76A 5B6NA 1T00A 4MA9A 5B8BA 4TN8A 1TXXA 2EIRA 2VL2A 1SK0A 4HI7A 1PKWA 5ECOB 3QCPA 3GKKA 4V2NA 1O85A 2HSNA 2LJKA 4POKA 2FLSA 2H1GA 2IFQA 3GIXA 3G9BA 3IOSA 3ZITA 3LSZA 1K0OA 2I9HA 5JCGA 3TJGA 1GL8A 3FHKA 2LRNA 1HNCA 3ZVJD 3KEBA 2MMAA 4WETA 1ERWA 5AIXA 4ZXGA 1GUHA 5CRGA 2LQQA 1GNWA 3CSJA 2HSMA 3WGXA 2DJ2A 3Q74A 1TRWA 2JL4A 4HJ2A 3TKSA 1MD3A 5IM9A 4NHZA 2GVPA 3ZIJA 5ECNB 3QPMA 5IMDA 5G1KA 4K9ZA 3P2AA 2H0GA 4IS0A 2LSTA 2YV9A 5D9XA 3WGEA 4BVXA 2JZSA 3GTUB 5ECSA 5E4WA 4WR5A 3TJKA 4BL7B 3BCKA 2CVBA 4KAEA 2FWGA 1Y1UA 1X5EA 2A4HA 1BG5A 1ML6A 2JACA 6GSSA 1TU7A 3HHVA 2H0IA 2CZ2A 4N30A 2G0FA 3BJ5A 4WBJA 5FT3A 1K3YA 4FYBA 5G1LA 4MDCA 2PGTA 3A2WA 5ECRB 1U3AA 5LCZA 1F3AA 1R5AA 1O6JA 2X99A 3M3MA 2IL3A 4I2TA 2DC5A 1WRYA 1WIKA 2IMEA 4FH8A 4K2XA 1NM3A 2EFEA 1SD9A 5DVBA 1M0UA 3CRTA 5ECKB 4AKHA 3GMFA 4OFNA 4LL4B 2O5VA 2P5QA 3DGQA 1XOBA 4TOPA 9GSSA 3DIEA 2CAIA 5C04A 5F07A 2H6XA 3H1NA 2VL3A 1T3BA 1SU9A 1ZL9A 1R4WA 3D4TA 4YQUA 1WOUA 2AHEA 3RBTA 4GF0A 4YAPA 4RQXA 2NTOA 4XRAA 1THXA 1K0CA 2A4VA 3LEFA 4MMMA 3UL3A 3DXBA 4MF5A 1B48A 4MJBA 5GSSA 3A2XA 4G10A 5DAKA 1AUCA 2PUKC 4G0IA 2F3MA 3M1GA 2CX4A 3LGCA 1OE7A 4QMKA 2DJ1A 3BCIA 4ECBA 4O5QA 3EURA 1YKAA 1YF0A 4TXOA 3HJMA 5BRTA 1Y6EA 2H6YA 2DJ0A 1V40A 2GT5A 1S3AA 1GTAA 2F9SA 3GL3A 4BA7A 1MEKA 2C4JA 5CP1A 1JLVA 3SBCA 4KX4A 1VRSD 4HZ4A 2H01A 1PL2A 4MF7A 4K5SA 5CYYA 3MWHA 3ISOA 4E8HA 4TXVA 3ERGA 2VAFA 3H8QA 2EIQA 3TKSE 2CQ9A 4HQZA 2YP6A 1HYUA 3EVIA 4F9ZA 1MDKA 2CX3A 1K3LA 1GSFA 3ZREA 4XS6A 3TRPA 2AB6A 5J3RA 4OO4A 2XPEA 2ON5A 2HZEA 3QOUA 4GCIA 2RUEA 2DKIA 5FHIA 1F2EA 5J4VA 3IK9A 2WFCA 2HSNB 3ED3A 1TJDA 2FUG2 1URMA 1EV4A 2EIOA 4DSRA 3IAM2 3N5OA 5D9WA 4AI6A 1PSQA 3VURA 3EMXA 1RW1A 5IMAA 3F4RA 4IBPA 2LV3A 3ERWA 3EWLA 4DEJA 4WF4A 3LFLA 4PQ1A 1IYIA 1OC9A 2HSMB 5F8BA 3VLNA 2H71A 3D21A 1XOAA 2B3SA 5ENUA 2V2GA 4WKWA 3O3TA 3N9JA 4JR6A 4YQMA 2LJRA 2K9FA 4ZB6A 4ZL8A 3ME8A 2K8VA 4HZ2A 1J08A 2CT6A 4KH7A 3M9JA 3LXZA 4P3YB 2VUPA 2GT6A 5AIVA 1T7PB 4Q5RA 2HRFA 2VM1A 2VO4A 1GH2A 2OT3A 4K5RA 2IMKA 5E59A 2FWHA 1V9WA 1XWGA 1TRVA 2MZCA 4BVXB 1OKDA 4XRDA 5ECHB 5H5QA 2NPBA 4WR4A 3L9UA 2X8CA 3PINA 2QA1A 1GNEA 3CRUA 2PWJA 1PD21 1XXUA 4YH2A 3H93A 3SWLA 2WB9A 4OD7A 1I5GA 4PUAA 1XW6A 3CBUA 3GH9A 4EO3A 5A4WA 4TR1A 3US3A 2MBTA 2VCTA 4JE1A 3VI5A 2TIRA 2CAQA 1XFLA 3I6AA 3TOUA 1ON4A 3KP8A 4JZQA 3MIXA 3F4SA 2MBSA 2WCIA 2X64A 3JCML 1CQHA 2R2JA 3EMPA 1F3BA 2E2MA 3WT1A 5DDLA 4G0LA 2GSRA 3OR5A 2AV4A 3CXGA 3ZTLA 2H1BA 2HSYA 4HS1A 4PX1A 4K6XA 1BF5A 3UVTA 4QL9A 1J0FA 1G0TA 2RUFA 4K7OA 1QFNA 2HRAA 2HQTA 1SYRA 2P0GA 1E6BA 4NV5A 2C1YA 1K0BA 1AW9A 5KEJA 5A5KA 2A2SA 2R0CA 2ALBA 1Z7PA 1Z6MA 2IN3A 3U6VA 1YKCA 5KN2A 5ECLB 3TRXA 2UV8G 3GN3A 5DAKB 5A5HA 5F0GA 1X5CA 4TR3A 4F2IA 1AC1A 3MSZA 3TJJA 1GSYA 1XVWA 1K0NA 1YQ1A 4BVYB 4LMVA 4JEDA 4TXOB 2PMTA 4K7NA 4XHMA 2IMIA 5IQYA 2I81A 3O76A 4IGJA 2BTOT 4FYUA 2FA8A 3QAVA 4I6XA 3MAKA 4YKGA 5A34A 4K8MA 1V58A 5AN1A 3E9JB 1SENA 2H70A 2R4VA 1Z9HA 3KXOA 3F63A 1SL0B 4MK3A 4LL1B 4J57E 3QFAC 2C0FA 2VCVA 3DEXA 1Z7RA 1FOHA 2O89A 2HZEB 4MLYA 3D5JA 2VCZA 1EEMA 4IW9A 1X0RA 2VL2C 1B9XC 3CWGA 2FGXA 1JHBA 5L71A 1H75A 1XWKA 3IC8A 4G2EA 4E68A 4TVEA 5F06A 3HJOA 1HNAA 1T4YA 1UVZA 2E0QA 1AQXA 1JZWA 2V1MA 2B7JA 3APSA 3IXRA 5CRWA 1JLWA 1PX7A 2ZUPA 1UN2A 1OC9B 3TKRA 4AGSA 4KGIA 1YF1A 4LA1A 2K8SA 3CMIA 4Z7XA 1TW9A 3A3TA 2IMDA 2NVLA 1LU4A 3TKSC 2BMXA 2MMZA 1UA5A 3F3RA 1XWBA 2DJJA 4J56E 4FYCA 1A2JA 1XBSA 1A2LA 3P90A 1YDKA 5AGYA 5H5RA 4L5LA 3GKMA 4XS1A 2KP1A 4TR0A 1M2BA 3E0UA 2H1DA 2B5XA 1M9BA 3FKFA 3E3EA 1WMJA 2KHPA 3HA9A 4IJIA 2XHFA 3RPPA 1WPIA 2VLVA 4XCSA 4XTSA 2X8GA 2GQMA 5CREA 3ZVJA 3FZ4A 5KN1A 4IVFA 3VWXA 4TR1B 3A5IA 3GUSA 2OKAA 2HE3A 3WYWA 2DMLA 1Q98A 4O32A 2WGRA 2KP2A 4GLTA 3TKQA 3KP9A 2D2ZA 7GSSA 4OWYA 2G2QA 2B5YA 4HOJA 4XIHA 4GDFA 2KLXA 1YVLA 4BWSA 1SJ6A 4KDYA 3KTLA 3LYKA 5EY6A 1PL1A 1HD2A 1VGLA 2PU9C 2GSQA 2V6KA 3ZFBA 4AKIA 5IOWA 1J9BA 1GUMA 2OBKA 3S9FA 3L0HA 4N10A 1GULA 4PXOA 3C1RA 3WT2A 3TUEA 4KA0A 2I1UA 5IO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BYE A;  2YZH A;  4XS4 B;  2DJK A;  4EC0 A;  2H66 A;  1X9W B;  1JZO A;  5J9C A;  2DJ3 A;  2J23 A;  4MJE A;  3TCO A;  4PUR A;  4I8B A;  2L6C A;  1QXH A;  3GST A;  3VWW A;  3HXS A;  1PGT A;  2L6D A;  1PN9 A;  2LRT A;  4H86 A;  5ID2 A;  2P31 A;  2JZR A;  2H6Z A;  1A0R P;  3UOM A;  3HYP A;  3LXT A;  4I2U A;  1AIU A;  3KCM A;  1GSU A;  4MZB A;  2YOI A;  3RAZ A;  6GSU A;  4G0K A;  3ZLP A;  2H0H A;  1SJZ A;  3A2V A;  4DVC A;  4O7H A;  3HCZ A;  8GSS A;  1K0M A;  4DSS A;  3GKX A;  1H4O A;  2C3T A;  2RM6 A;  3LYP A;  4F0B A;  1EGO A;  1XWA A;  1GP1 A;  3NOF A;  2I4A A;  5EVO A;  3ZML A;  2IPA A;  5IIZ A;  5HFK A;  3FZ5 A;  1BAY A;  3RPN A;  3J7Y k;  3HVV A;  3FW2 A;  2FCH A;  2HI7 A;  5COH A;  2ZCT A;  4JR4 A;  4KDU A;  3LG6 A;  5B7C A;  3FZ9 A;  3UBL A;  1EWX A;  2B5E A;  2JZT A;  1ERT A;  5AIS A;  2KOK A;  2OE1 A;  3U5R E;  3UJ1 A;  2R6K A;  2L59 A;  2GST A;  2FWF A;  1N2A A;  3UAR A;  4KUN A;  4JU5 A;  2HXK A;  1B9Y C;  2H8L A;  3FYG A;  1EEJ A;  5ABR A;  4WF5 A;  3C7M A;  3P8W A;  17GS A;  3QFB C;  3GHA A;  5HR2 A;  3V1W A;  4LLR A;  2LQO A;  2HYX A;  1THO A;  1WE0 A;  6GST A;  4V2L A;  4MZW A;  2YWN A;  1YJ6 A;  1GSQ A;  3GYK A;  2FY6 A;  3GA4 A;  3D22 A;  4OO5 A;  2B1L A;  3C71 A;  3MNG A;  3F9U A;  3HY2 A;  4POB A;  1T4Z A;  4ECI A;  3HZ8 A;  1O73 A;  2AYT A;  2VCX A;  2TRC P;  4ID0 A;  4LMW A;  4YAV A;  4FO5 A;  2WS2 A;  6GSW A;  1A8L A;  2FA4 A;  4AJ6 A;  3GUR A;  3UVH A;  5J4U A;  2YAN A;  3L9V A;  4QL7 A;  2RLI A;  4K1F A;  4X1U A;  1TRU A;  2LEG A;  4JRR A;  3F8U A;  2CVK A;  3H79 A;  4ECC A;  4ECJ A;  4IP6 A;  3R2Q A;  1QGV A;  3VWU A;  1SD8 A;  3GFK A;  2IFQ B;  1GUK A;  1GTI A;  1M2A A;  1TU8 A;  1TK0 B;  6GSV A;  3DRN A;  1VF3 A;  3VPQ A;  2A2R A;  2L57 A;  3RHC A;  2LUS A;  1SKS B;  3G7I A;  4HJM A;  4NWY A;  2PBJ A;  1PQN A;  5J9B A;  5ELG A;  1Q4J A;  5IPG A;  2LNT A;  2YJ7 A;  4MPF A;  5KN3 A;  1FHE A;  4RQR A;  1A2M A;  3W6G A;  3G7J A;  4PQH A;  2PER A;  3IC4 A;  2YCD A;  4FQU A;  5DCG A;  2IWT A;  3F6F A;  2C0D A;  1NHO A;  5ID2 B;  2O85 A;  1DE1 A;  3FEU A;  2FD3 A;  3QAW A;  1AXD A;  3QDN A;  2C0G A;  1G6W A;  1QK8 A;  2JU5 A;  2L4Q A;  3ERF A;  2DLX A;  1TTZ A;  2N5B A;  3C73 A;  1A23 A;  3TOT A;  2R3X A;  1GTU A;  4HQS A;  1O8X A;  1FAA A;  2HRN A;  5D96 A;  2YPM A;  2E7P A;  1Y25 A;  3QMX A;  2GQK A;  4KCE A;  3VI7 A;  4G19 A;  3GH6 A;  1FO5 A;  2M80 A;  2MYG A;  3UBK A;  2NDO A;  2VM2 A;  2AAW A;  5ECM B;  2CVD A;  5HFG A;  2C3Q A;  2ON7 A;  1I9D A;  3DKS A;  1F9M A;  4KB3 A;  3FR6 A;  2GDR A;  4ZL7 A;  3GRX A;  3PGT A;  1MD4 A;  5H5S A;  1OYJ A;  4I97 A;  4PQI A;  2HRK A;  3IE3 A;  1C72 A;  2GLR A;  2H72 A;  4ZL9 A;  1O81 A;  4ZBA A;  2WDU A;  3L4N A;  3F4T A;  2EC4 A;  1SL2 B;  2AUV A;  3DVW A;  2B1K A;  5J5N A;  2PPT A;  1A8Y A;  4N11 A;  1T1V A;  1FW1 A;  2O7K A;  2V6O A;  1NSW A;  2HSH A;  4FIW A;  3TGZ A;  3I9V 2;  1DSB A;  4IEL A;  2Z9S A;  1PA3 A;  3NIV A;  2LJA A;  4GQC A;  2L4C A;  4ZBB A;  2KUC A;  1U88 A;  3VWV A;  1N8J A;  3GTU A;  1G7E A;  3DD3 A;  4BL7 A;  5JWO B;  3Q18 A;  5ECI B;  4HU7 A;  4HUA A;  3HKR A;  5DQS A;  2LRC A;  4WBR D;  3HDC A;  1ZYQ B;  1WP0 A;  12GS A;  5CRH A;  2DSA A;  5C00 A;  3W8S A;  1A24 A;  1WWJ A;  2QGV A;  4K0N A;  4KND A;  3IHQ A;  3Q6O A;  3KJY A;  5B6M A;  3O6T A;  3IK7 A;  2WZ9 A;  3H4K A;  1EGR A;  2PVQ A;  2WJU A;  5DQY A;  3FZA A;  4MJA A;  3LOR A;  1W4V A;  4EF0 A;  1QUW A;  4KSM A;  1ABA A;  2I3Y A;  3A5W A;  3WD6 A;  3BBY A;  1KTE A;  1TKD B;  5FWG A;  4IP1 A;  1ILO A;  4OFM A;  3ZYW A;  5IO0 A;  3KH9 A;  4QQ7 A;  4Q5F A;  1JZD A;  1LJR A;  2JSZ A;  2XBI A;  2UZ8 A;  1XZO A;  2HFD A;  5IPH A;  1IYH A;  3TKP A;  2HLS A;  1R5P A;  5HR0 A;  3FR9 A;  3GX8 A;  1FVJ A;  2H1A A;  1CQG A;  4GXZ A;  1VF2 A;  2VL9 A;  4BWQ A;  4ML1 A;  5HFI A;  4ULX A;  4L8E A;  3M0F A;  4HDE A;  5D8I A;  3FY7 A;  2GGT A;  3AY8 A;  13GS A;  3VK9 A;  1ERU A;  4AF2 A;  19GS A;  1YEX A;  4PNF A;  2P5R A;  2PVO C;  4GQF A;  1M2D A;  4N0Z A;  2DIZ A;  1XW9 A;  2YZU A;  5GZZ B;  1NW2 A;  3L9S A;  2RM5 A;  5D9V A;  3GL5 A;  4TRX A;  3EU3 A;  2B6M A;  3HD5 A;  5CAX A;  3PR8 A;  4F0C A;  3IDV A;  2O87 A;  2C0E A;  4IHU A;  5DJM A;  4MH2 A;  4I5Q A;  2WUL A;  3I69 A;  2VCW A;  3WGD A;  2BJX A;  2C8U A;  3UAP A;  4NHW A;  4GTU A;  4Q5N A;  1XVQ A;  4EVM A;  5EL8 A;  4X43 A;  4AJ8 A;  1OAZ A;  1XW5 A;  4MAB A;  2R37 A;  2HRK B;  1OKT A;  1EZK A;  3BD2 A;  2YJH A;  2F51 A;  1YEP A;  1FOV A;  3EU4 A;  2XPD A;  1V57 A;  2OBI A;  1AQV A;  5IMF A;  2VD1 A;  5F05 A;  1A0F A;  5B8A A;  3TJF A;  4OMV A;  2YWI A;  3D4M A;  5HR3 A;  4ILF A;  1DBY A;  1SJI A;  1O7U A;  2FWE A;  1B8X A;  2CA8 A;  1EOG A;  3ZZX A;  2GSS A;  1Z6N A;  2QKE A;  1AAZ A;  4PTS A;  3TDG A;  3EE2 A;  1U87 A;  4K2D A;  1GSE A;  1B4Q A;  4KDX A;  3K8N A;  4MF6 A;  5IMC A;  4L5O A;  4NPB A;  4EUY A;  3J7Y b;  5INY A;  2FHE A;  3KZQ A;  3I43 A;  1EOH A;  4G9H A;  5ECQ B;  5GST A;  2VOC A;  2YV7 A;  1S3D A;  3HZ4 A;  14GS A;  4OFT A;  1TK5 B;  3LJR A;  3GX0 A;  3IV4 A;  1ZOF A;  5LD0 A;  4KE3 A;  2VIM A;  5IMV A;  1XCC A;  4USS A;  2VCQ A;  4KCA A;  2B7K A;  4CDO A;  2XBQ A;  5D73 A;  4MJC A;  2H75 A;  5G5F A;  2YNX A;  2L5L A;  1JFU A;  3VPT A;  2L5O A;  5GAP D;  1ACV A;  1FVK A;  1GTB A;  4NAX A;  3LWA A;  3D0Z A;  2YN1 A;  3GSS A;  3P7X A;  3KD0 A;  3FR3 A;  10GS A;  4RUV A;  3ZRD A;  1YZX A;  2GZP A;  4GRF A;  1GLP A;  3NZN A;  3VFI A;  1QMV A;  4POM A;  4IQA A;  4RI6 A;  2OAD A;  1GRX A;  3F6D A;  3QR6 A;  3FK8 A;  1MTC A;  1R7H A;  4IJ3 A;  4F82 A;  3CTF A;  1K0A A;  3IPZ A;  1QQ2 A;  2JAD A;  2WRT A;  1PRX A;  3TJB A;  5G5E A;  3F0I A;  1S3C A;  1T8E B;  1M99 A;  4MH3 A;  2YWM A;  4D73 A;  4BVY A;  3F3Q A;  1HQO A;  1FG4 A;  1M7T A;  3G7Y A;  1G7O A;  3IR4 A;  3Q19 A;  1GLQ A;  4N0V A;  2CZ3 A;  1GSS A;  4OCE A;  1ZZY A;  3KM6 A;  1F37 A;  2NBS A;  1TK8 B;  3HVS A;  5D93 A;  5G31 A;  2ZNM A;  5HR1 A;  3HVX A;  1X9S B;  1ERV A;  2IMF A;  2V41 A;  3CYN A;  2DBC A;  1X5D A;  1Z3E A;  4TKY A;  2C80 A;  3C1S A;  4GSN A;  2O8V B;  4EXJ A;  3GKN A;  2DMM A;  3IA1 A;  4GWR A;  1TDI A;  1O8W A;  1OC8 A;  3RDW A;  1SKW B;  4PUF C;  3PH9 A;  18GS A;  3GNJ A;  2V32 A;  1JZR A;  1KBN A;  2HNL A;  6GSX A;  5G2Z A;  3GV1 A;  5JWQ B;  3PPU A;  1BX9 A;  3UEM A;  1PX6 A;  1VF1 A;  4ZB8 A;  2VLU A;  4KSO A;  1TI1 A;  4EKZ A;  2PN8 A;  3C8E A;  4L0W A;  1ZYE A;  1M9A A;  2IJY A;  2DIY A;  2R5G A;  3LQ7 A;  4GSS A;  3DVX A;  2OE3 A;  5DAL A;  4L0U A;  2LTK A;  5ELA A;  2GZZ A;  4EL1 A;  2LNS A;  1LBK A;  5BMU A;  3KTB A;  2VLT A;  1ZCP A;  2JSY A;  1U3I A;  4NV2 A;  2ES7 A;  1XPV A;  2REM A;  4ZIL A;  4PNG A;  4GST A;  5J41 A;  3CSI A;  3TB2 A;  4ACS A;  3M9K A;  2IIY A;  3QAG A;  2GS3 A;  1F6M C;  4ZBD A;  3ZMK A;  1BED A;  3ZFL A;  5ECP B;  2M72 A;  5IMZ A;  4ZIJ A;  1KNG A;  1BQ7 A;  1BJX A;  5JCU A;  1K0D A;  4DSS B;  4POL A;  1V2A A;  6GSY A;  1FB6 A;  4WXT A;  4MCU A;  3CTG A;  3UMA A;  1V98 A;  4HEA 2;  2YWO A;  1FB0 A;  1GWC A;  2LS5 A;  4ISD A;  3APO A;  1SK1 A;  2LKU A;  1XWC A;  4CW9 A;  1Z5Y E;  2GZY A;  2QSI A;  3FRC A;  2E2G A;  3IAS 2;  3EIN A;  2H30 A;  5HQP A;  5KN0 A;  4TR4 A;  1SYX A;  5DBQ A;  4NXI A;  22GS A;  1TI3 A;  4ML6 A;  4Q5Q A;  4RI7 A;  2OJL A;  4K0G A;  5CNW A;  2HZF A;  5CRD A;  1SKR B;  3W8J A;  4KW6 A;  4MZC A;  3IBH A;  4HU9 A;  2J9H A;  5G30 A;  4V1A g;  4EDZ A;  4XS4 A;  2XC2 A;  1DE2 A;  1GSD A;  3MDK A;  2F8A A;  2CV4 A;  4IN0 A;  1VF4 A;  2N5F A;  2C3N A;  3L78 A;  20GS A;  1U6T A;  4MPG A;  4V1A p;  2FNO A;  2GQL A;  2VD0 A;  1EP8 A;  3KIJ A;  4NMU A;  4DSQ A;  1MDJ A;  2M46 A;  3ZIV A;  2X8H A;  1HNB A;  4J2F A;  1ZGN A;  4D73 B;  1K3O A;  1OC3 A;  5LNK e;  4MP4 A;  4K7I A;  2MMN A;  2OA7 A;  1OVN A;  3EC3 A;  2OE0 A;  4YQV A;  2F8F A;  4JBB A;  1AQW A;  4V2M A;  3KMO A;  1E2Y A;  3IRA A;  3DML A;  3RHB A;  3BOA A;  16GS A;  1RQM A;  4WEY A;  1W89 A;  4BPY A;  4E8E A;  4CHS A;  3KMN A;  4AJ7 A;  1SL1 B;  4KF9 A;  2H73 A;  2HT9 A;  4EE0 A;  2H74 A;  4O5R A;  2K18 A;  3DWV A;  2H19 A;  1XIY A;  1B4P A;  1KEB A;  5A4V A;  5D9T A;  2RII A;  3R3E A;  3KGK A;  1R26 A;  3TRQ A;  2GTU A;  2K6V A;  1TOF A;  1G6Y A;  2QC7 A;  3APQ A;  5JWR B;  1NHY A;  1RK4 A;  1USB A;  3ME7 A;  4O92 A;  2AJQ B;  5EPF A;  1ST9 A;  4X0X A;  5JCW A;  3UIW A;  2N5A A;  5DJL A;  1PKZ A;  1OE8 A;  3ZL5 A;  5A4U A;  1SK2 A;  2TRX A;  3D6I A;  5DAL B;  1TP9 A;  11GS A;  3KH7 A;  2MMO A;  1PMT A;  3QD9 A;  5CO3 A;  1ZMA A;  4IKH A;  5IOX A;  1YY7 A;  3DYR A;  5GAN D;  3EYT A;  3CSH A;  1DUG A;  5DCH A;  4F03 A;  2OAC A;  1TRS A;  4PGT A;  4OCF A;  1UC7 A;  3M8N A;  1EP7 A;  4IQ1 A;  4EDY A;  4TW5 A;  1EV9 A;  1X9M B;  1WJK A;  1MDI A;  4ZB9 A;  3HJP A;  2H76 A;  5B6N A;  1T00 A;  4MA9 A;  5B8B A;  4TN8 A;  1TXX A;  2EIR A;  2VL2 A;  1SK0 A;  4HI7 A;  1PKW A;  5ECO B;  3QCP A;  3GKK A;  4V2N A;  1O85 A;  2LJK A;  4POK A;  2FLS A;  2H1G A;  2IFQ A;  3GIX A;  3G9B A;  3IOS A;  3ZIT A;  3LSZ A;  1K0O A;  2I9H A;  5JCG A;  3TJG A;  1GL8 A;  3FHK A;  2LRN A;  1HNC A;  3ZVJ D;  3KEB A;  2MMA A;  4WET A;  1ERW A;  5AIX A;  4ZXG A;  1GUH A;  5CRG A;  2LQQ A;  1GNW A;  3CSJ A;  2HSM A;  3WGX A;  2DJ2 A;  3Q74 A;  1TRW A;  2JL4 A;  4HJ2 A;  3TKS A;  1MD3 A;  5IM9 A;  4NHZ A;  2GVP A;  3ZIJ A;  5ECN B;  3QPM A;  5IMD A;  5G1K A;  4K9Z A;  3P2A A;  2H0G A;  4IS0 A;  2LST A;  2YV9 A;  5D9X A;  3WGE A;  4BVX A;  2JZS A;  3GTU B;  5ECS A;  5E4W A;  4WR5 A;  3TJK A;  4BL7 B;  3BCK A;  2CVB A;  4KAE A;  2FWG A;  1X5E A;  1BG5 A;  1ML6 A;  2JAC A;  6GSS A;  1TU7 A;  3HHV A;  2H0I A;  2CZ2 A;  4N30 A;  2G0F A;  3BJ5 A;  4WBJ A;  5FT3 A;  1K3Y A;  4FYB A;  5G1L A;  4MDC A;  2PGT A;  3A2W A;  5ECR B;  1U3A A;  5LCZ A;  1F3A A;  1R5A A;  1O6J A;  2X99 A;  3M3M A;  2IL3 A;  4I2T A;  2DC5 A;  1WRY A;  1WIK A;  2IME A;  4FH8 A;  1NM3 A;  1SD9 A;  5DVB A;  1M0U A;  3CRT A;  5ECK B;  3GMF A;  4OFN A;  4LL4 B;  2P5Q A;  3DGQ A;  1XOB A;  4TOP A;  9GSS A;  3DIE A;  2CAI A;  5C04 A;  5F07 A;  2H6X A;  3H1N A;  2VL3 A;  1T3B A;  1SU9 A;  1ZL9 A;  1R4W A;  3D4T A;  4YQU A;  1WOU A;  2AHE A;  3RBT A;  4GF0 A;  4YAP A;  4RQX A;  2NTO A;  4XRA A;  1THX A;  1K0C A;  2A4V A;  3LEF A;  4MMM A;  3UL3 A;  3DXB A;  4MF5 A;  1B48 A;  4MJB A;  5GSS A;  3A2X A;  4G10 A;  5DAK A;  1AUC A;  2PUK C;  4G0I A;  2F3M A;  3M1G A;  2CX4 A;  3LGC A;  1OE7 A;  2DJ1 A;  3BCI A;  4ECB A;  3EUR A;  1YKA A;  1YF0 A;  4TXO A;  3HJM A;  1Y6E A;  2H6Y A;  2DJ0 A;  1V40 A;  2GT5 A;  1S3A A;  1GTA A;  2F9S A;  3GL3 A;  4BA7 A;  1MEK A;  2C4J A;  5CP1 A;  1JLV A;  3SBC A;  4KX4 A;  1VRS D;  4HZ4 A;  2H01 A;  1PL2 A;  4MF7 A;  5CYY A;  3MWH A;  3ISO A;  4E8H A;  4TXV A;  3ERG A;  2VAF A;  3H8Q A;  2EIQ A;  3TKS E;  2CQ9 A;  4HQZ A;  2YP6 A;  1HYU A;  3EVI A;  4F9Z A;  1MDK A;  2CX3 A;  1K3L A;  1GSF A;  3ZRE A;  4XS6 A;  3TRP A;  2AB6 A;  5J3R A;  4OO4 A;  2XPE A;  2ON5 A;  2HZE A;  3QOU A;  4GCI A;  2RUE A;  5FHI A;  1F2E A;  3IK9 A;  2WFC A;  2HSN B;  3ED3 A;  1TJD A;  2FUG 2;  1URM A;  1EV4 A;  2EIO A;  4DSR A;  3IAM 2;  3N5O A;  5D9W A;  1PSQ A;  3VUR A;  3EMX A;  1RW1 A;  5IMA A;  3F4R A;  4IBP A;  2LV3 A;  3ERW A;  3EWL A;  4DEJ A;  4WF4 A;  3LFL A;  4PQ1 A;  1IYI A;  1OC9 A;  2HSM B;  5F8B A;  3VLN A;  2H71 A;  3D21 A;  1XOA A;  2B3S A;  5ENU A;  2V2G A;  4WKW A;  3O3T A;  3N9J A;  4JR6 A;  4YQM A;  2LJR A;  2K9F A;  4ZB6 A;  4ZL8 A;  3ME8 A;  2K8V A;  4HZ2 A;  1J08 A;  2CT6 A;  4KH7 A;  3M9J A;  3LXZ A;  4P3Y B;  2VUP A;  2GT6 A;  5AIV A;  1T7P B;  4Q5R A;  2HRF A;  2VM1 A;  2VO4 A;  1GH2 A;  2IMK A;  5E59 A;  2FWH A;  1V9W A;  1XWG A;  1TRV A;  2MZC A;  4BVX B;  1OKD A;  4XRD A;  5ECH B;  5H5Q A;  2NPB A;  4WR4 A;  3L9U A;  2X8C A;  3PIN A;  1GNE A;  3CRU A;  2PWJ A;  1PD2 1;  1XXU A;  4YH2 A;  3H93 A;  3SWL A;  2WB9 A;  4OD7 A;  1I5G A;  4PUA A;  1XW6 A;  3CBU A;  3GH9 A;  4EO3 A;  5A4W A;  4TR1 A;  3US3 A;  2MBT A;  2VCT A;  4JE1 A;  3VI5 A;  2TIR A;  2CAQ A;  1XFL A;  3I6A A;  3TOU A;  1ON4 A;  3KP8 A;  4JZQ A;  3F4S A;  2MBS A;  2WCI A;  2X64 A;  3JCM L;  1CQH A;  2R2J A;  3EMP A;  1F3B A;  2E2M A;  3WT1 A;  5DDL A;  4G0L A;  2GSR A;  3OR5 A;  2AV4 A;  3CXG A;  3ZTL A;  2H1B A;  2HSY A;  4HS1 A;  4PX1 A;  4K6X A;  3UVT A;  4QL9 A;  1J0F A;  1G0T A;  2RUF A;  4K7O A;  1QFN A;  2HRA A;  2HQT A;  1SYR A;  2P0G A;  1E6B A;  4NV5 A;  2C1Y A;  1K0B A;  1AW9 A;  5KEJ A;  5A5K A;  2A2S A;  2ALB A;  1Z7P A;  1Z6M A;  2IN3 A;  3U6V A;  1YKC A;  5KN2 A;  5ECL B;  3TRX A;  3GN3 A;  5DAK B;  5F0G A;  1X5C A;  4TR3 A;  4F2I A;  1AC1 A;  3MSZ A;  3TJJ A;  1GSY A;  1XVW A;  1K0N A;  1YQ1 A;  4BVY B;  4LMV A;  4JED A;  4TXO B;  2PMT A;  4K7N A;  4XHM A;  2IMI A;  5IQY A;  2I81 A;  3O76 A;  4IGJ A;  2BTO T;  4FYU A;  2FA8 A;  3QAV A;  4I6X A;  3MAK A;  4K8M A;  1V58 A;  5AN1 A;  3E9J B;  1SEN A;  2H70 A;  2R4V A;  1Z9H A;  3KXO A;  3F63 A;  1SL0 B;  4MK3 A;  4LL1 B;  4J57 E;  3QFA C;  2C0F A;  2VCV A;  3DEX A;  1Z7R A;  2O89 A;  2HZE B;  4MLY A;  3D5J A;  2VCZ A;  1EEM A;  4IW9 A;  1X0R A;  2VL2 C;  1B9X C;  2FGX A;  1JHB A;  5L71 A;  1H75 A;  1XWK A;  3IC8 A;  4G2E A;  4TVE A;  5F06 A;  3HJO A;  1HNA A;  1T4Y A;  1UVZ A;  2E0Q A;  1AQX A;  1JZW A;  2V1M A;  2B7J A;  3APS A;  3IXR A;  5CRW A;  1JLW A;  1PX7 A;  2ZUP A;  1UN2 A;  1OC9 B;  3TKR A;  4AGS A;  4KGI A;  1YF1 A;  4LA1 A;  2K8S A;  3CMI A;  4Z7X A;  1TW9 A;  3A3T A;  2IMD A;  2NVL A;  1LU4 A;  3TKS C;  2BMX A;  2MMZ A;  1UA5 A;  3F3R A;  1XWB A;  2DJJ A;  4J56 E;  4FYC A;  1A2J A;  1XBS A;  1A2L A;  3P90 A;  1YDK A;  5AGY A;  5H5R A;  4L5L A;  3GKM A;  4XS1 A;  2KP1 A;  4TR0 A;  1M2B A;  3E0U A;  2H1D A;  2B5X A;  1M9B A;  3FKF A;  3E3E A;  1WMJ A;  2KHP A;  3HA9 A;  4IJI A;  2XHF A;  3RPP A;  1WPI A;  2VLV A;  4XCS A;  4XTS A;  2X8G A;  2GQM A;  5CRE A;  3ZVJ A;  3FZ4 A;  5KN1 A;  4IVF A;  3VWX A;  4TR1 B;  3GUS A;  2OKA A;  2HE3 A;  3WYW A;  2DML A;  1Q98 A;  4O32 A;  2WGR A;  2KP2 A;  4GLT A;  3TKQ A;  3KP9 A;  2D2Z A;  7GSS A;  4OWY A;  2G2Q A;  2B5Y A;  4HOJ A;  4XIH A;  2KLX A;  4BWS A;  1SJ6 A;  4KDY A;  3KTL A;  3LYK A;  5EY6 A;  1PL1 A;  1HD2 A;  1VGL A;  2PU9 C;  2GSQ A;  2V6K A;  3ZFB A;  5IOW A;  1J9B A;  1GUM A;  2OBK A;  3S9F A;  3L0H A;  4N10 A;  1GUL A;  4PXO A;  3C1R A;  3WT2 A;  3TUE A;  4KA0 A;  2I1U A;  5IO2 A; 
#chains in the Genus database with same CATH topology
 1BYE A;  2WVX B;  2YZH A;  4XS4 B;  2DJK A;  4EC0 A;  2H66 A;  1X9W B;  1JZO A;  5J9C A;  2DJ3 A;  2J23 A;  4MJE A;  3TCO A;  4PUR A;  4I8B A;  2L6C A;  1QXH A;  3GST A;  3VWW A;  3HXS A;  1PGT A;  2L6D A;  1PN9 A;  2LRT A;  4H86 A;  5ID2 A;  2P31 A;  2JZR A;  2H6Z A;  1A0R P;  3UOM A;  3HYP A;  3LXT A;  3KCM A;  1AIU A;  4I2U A;  1GSU A;  4MZB A;  2YOI A;  2WW1 A;  3RAZ A;  6GSU A;  4G0K A;  3ZLP A;  2H0H A;  1SJZ A;  3A2V A;  4DVC A;  4O7H A;  3HCZ A;  8GSS A;  1K0M A;  4DSS A;  3GKX A;  1H4O A;  2C3T A;  2RM6 A;  5A34 B;  3LYP A;  4F0B A;  1EGO A;  1XWA A;  1GP1 A;  3NOF A;  1PFO A;  2I4A A;  5EVO A;  3ZML A;  2IPA A;  5IIZ A;  5HFK A;  3FZ5 A;  1BAY A;  3RPN A;  3J7Y k;  3HVV A;  3TU3 B;  3FW2 A;  2FCH A;  2HI7 A;  5COH A;  2ZCT A;  4JR4 A;  4KDU A;  3LG6 A;  5B7C A;  3FZ9 A;  3UBL A;  1EWX A;  2B5E A;  2JZT A;  1ERT A;  5AIS A;  2KOK A;  2OE1 A;  3U5R E;  3UJ1 A;  2R6K A;  2L59 A;  2GST A;  2FWF A;  1N2A A;  3UAR A;  4KUN A;  4JU5 A;  2HXK A;  1B9Y C;  2H8L A;  3FYG A;  1EEJ A;  5ABR A;  4WF5 A;  4Z2T A;  5J47 A;  3C7M A;  3P8W A;  17GS A;  3QFB C;  3GHA A;  4X4J A;  5HR2 A;  3V1W A;  4LLR A;  2LQO A;  2HYX A;  1THO A;  1WE0 A;  6GST A;  4V2L A;  4MZW A;  2YWN A;  1YJ6 A;  1GSQ A;  3GYK A;  2FY6 A;  3GA4 A;  3D22 A;  4OO5 A;  2B1L A;  3C71 A;  3IHG A;  3MNG A;  1YEW C;  3F9U A;  3HY2 A;  4POB A;  1T4Z A;  4ECI A;  3HZ8 A;  1O73 A;  2AYT A;  2VCX A;  2TRC P;  4ID0 A;  4LMW A;  4YAV A;  4FO5 A;  2WS2 A;  6GSW A;  1A8L A;  2FA4 A;  2X4A A;  4AJ6 A;  3GUR A;  3UVH A;  5J4U A;  2YAN A;  3L9V A;  4QL7 A;  4FXY P;  2RLI A;  4K1F A;  4X1U A;  1TRU A;  2LEG A;  4JRR A;  3F8U A;  2CVK A;  3H79 A;  4ECC A;  4ECJ A;  4IP6 A;  3R2Q A;  1QGV A;  3VWU A;  1SD8 A;  3GFK A;  1S3R A;  2IFQ B;  1GUK A;  1GTI A;  1M2A A;  1TU8 A;  1TK0 B;  6GSV A;  3DRN A;  1VF3 A;  3VPQ A;  2A2R A;  2L57 A;  3RHC A;  2LUS A;  1SKS B;  3G7I A;  4HJM A;  4PHZ C;  4NWY A;  2PBJ A;  1PQN A;  5J9B A;  5ELG A;  3EPT A;  1Q4J A;  5IPG A;  1SVM A;  2LNT A;  2YJ7 A;  4MPF A;  5KN3 A;  1FHE A;  4RQR A;  1A2M A;  3W6G A;  3G7J A;  4PQH A;  2PER A;  3IC4 A;  2YCD A;  4FQU A;  5DCG A;  2IWT A;  3F6F A;  2C0D A;  1NHO A;  5ID2 B;  2O85 A;  1DE1 A;  3FEU A;  2FD3 A;  3QAW A;  5KOX A;  1AXD A;  3LW9 A;  3QDN A;  2C0G A;  1G6W A;  1QK8 A;  2JU5 A;  2L4Q A;  3ERF A;  2DLX A;  1TTZ A;  2N5B A;  3C73 A;  1A23 A;  3TOT A;  2R3X A;  1GTU A;  1O8X A;  4HQS A;  1FAA A;  2HRN A;  5D96 A;  2YPM A;  2E7P A;  1Y25 A;  3QMX A;  2GQK A;  4KCE A;  3VI7 A;  4G19 A;  3GH6 A;  1FO5 A;  2M80 A;  2MYG A;  3UBK A;  2NDO A;  2VM2 A;  4PI2 C;  2AAW A;  5ECM B;  2CVD A;  5HFG A;  2C3Q A;  2ON7 A;  1I9D A;  3DKS A;  1F9M A;  4KB3 A;  3FR6 A;  2GDR A;  4ZL7 A;  3GRX A;  3PGT A;  1MD4 A;  5H5S A;  1OYJ A;  4I97 A;  4PQI A;  2HRK A;  3IE3 A;  1C72 A;  2GLR A;  2H72 A;  4ZL9 A;  1O81 A;  4ZBA A;  2WDU A;  3L4N A;  3F4T A;  2EC4 A;  1SL2 B;  2AUV A;  3DVW A;  2B1K A;  5J5N A;  2PPT A;  1A8Y A;  4N11 A;  1T1V A;  1FW1 A;  2O7K A;  3FMW A;  2V6O A;  1NSW A;  2HSH A;  4FIW A;  3TGZ A;  3I9V 2;  1DSB A;  4IEL A;  2Z9S A;  1PA3 A;  3NIV A;  2LJA A;  4GQC A;  2L4C A;  4ZBB A;  2KUC A;  1U88 A;  3VWV A;  1N8J A;  3GTU A;  1G7E A;  3DD3 A;  4BL7 A;  5JWO B;  2WVY A;  3Q18 A;  5ECI B;  4HU7 A;  4HUA A;  3HKR A;  5DQS A;  2LRC A;  4WBR D;  3HDC A;  1ZYQ B;  1WP0 A;  12GS A;  5CRH A;  2DSA A;  5C00 A;  3W8S A;  1A24 A;  1WWJ A;  2QGV A;  2X49 A;  4K0N A;  4KND A;  3IHQ A;  3Q6O A;  3KJY A;  5B6M A;  3O6T A;  3IK7 A;  2WZ9 A;  3H4K A;  1EGR A;  2PVQ A;  2WJU A;  5DQY A;  3FZA A;  4MJA A;  3LOR A;  1W4V A;  4EF0 A;  1QUW A;  4KSM A;  1ABA A;  2I3Y A;  3A5W A;  3WD6 A;  3BBY A;  1KTE A;  1TKD B;  5FWG A;  4IP1 A;  1ILO A;  4OFM A;  3ZYW A;  5IO0 A;  3KH9 A;  4QQ7 A;  4Q5F A;  1JZD A;  1LJR A;  2JSZ A;  2XBI A;  2UZ8 A;  1XZO A;  2HFD A;  5IPH A;  1IYH A;  3TKP A;  5A1N A;  2HLS A;  1R5P A;  5HR0 A;  3FR9 A;  4HSC X;  3GX8 A;  1FVJ A;  2H1A A;  1CQG A;  4GXZ A;  1VF2 A;  2VL9 A;  4BWQ A;  4ML1 A;  5HFI A;  4ULX A;  4L8E A;  3M0F A;  4HDE A;  5D8I A;  3CQF A;  3FY7 A;  2GGT A;  3AY8 A;  13GS A;  3VK9 A;  1ERU A;  4AF2 A;  19GS A;  1YEX A;  4PNF A;  2P5R A;  2PVO C;  4GQF A;  1M2D A;  4N0Z A;  2DIZ A;  1XW9 A;  2YZU A;  2QA2 A;  5GZZ B;  1NW2 A;  3L9S A;  2RM5 A;  5D9V A;  3GL5 A;  4TRX A;  3EU3 A;  2B6M A;  3HD5 A;  5CAX A;  3PR8 A;  4F0C A;  3IDV A;  2O87 A;  2C0E A;  4IHU A;  5DJM A;  4MH2 A;  4I5Q A;  2WUL A;  1PN0 A;  3I69 A;  2VCW A;  3WGD A;  2BJX A;  2C8U A;  3UAP A;  4NHW A;  4GTU A;  4Q5N A;  1XVQ A;  4EVM A;  5EL8 A;  4X43 A;  4AJ8 A;  1OAZ A;  1XW5 A;  4MAB A;  4AKG A;  2R37 A;  2HRK B;  1OKT A;  4CY6 A;  4W66 A;  1EZK A;  3BD2 A;  2YJH A;  2F51 A;  1YEP A;  1FOV A;  3EU4 A;  2XPD A;  1V57 A;  2OBI A;  1AQV A;  5IMF A;  2VD1 A;  5F05 A;  4Z2U A;  1A0F A;  5B8A A;  3TJF A;  4OMV A;  3RGB C;  2YWI A;  3D4M A;  3MYD A;  5HR3 A;  4ILF A;  5A5H B;  1DBY A;  1SJI A;  1O7U A;  2FWE A;  1B8X A;  2CA8 A;  1EOG A;  3ZZX A;  2GSS A;  1Z6N A;  2QKE A;  1AAZ A;  4PTS A;  3TDG A;  3EE2 A;  1U87 A;  4K2D A;  1GSE A;  1B4Q A;  4KDX A;  3K8N A;  4MF6 A;  5IMC A;  4L5O A;  2H1L A;  4NPB A;  4EUY A;  3J7Y b;  5INY A;  2EFC A;  2EFH A;  2FHE A;  3KZQ A;  3I43 A;  1EOH A;  4G9H A;  5ECQ B;  5GST A;  2VOC A;  2YV7 A;  4ZB7 A;  1S3D A;  3HZ4 A;  14GS A;  4OFT A;  1TK5 B;  3LJR A;  3GX0 A;  3IV4 A;  1ZOF A;  5LD0 A;  4KE3 A;  2VIM A;  5IMV A;  1XCC A;  4USS A;  2VCQ A;  4KCA A;  2B7K A;  4CDO A;  2XBQ A;  5D73 A;  4MJC A;  2H75 A;  5G5F A;  2YNX A;  2L5L A;  1SVO A;  1JFU A;  3VPT A;  2L5O A;  5GAP D;  1ACV A;  3RFR C;  1FVK A;  1GTB A;  4NAX A;  3LWA A;  3D0Z A;  2YN1 A;  4ICY A;  3GSS A;  3P7X A;  4O5U A;  3KD0 A;  3FR3 A;  10GS A;  4RUV A;  3ZRD A;  1YZX A;  2GZP A;  4GRF A;  1GLP A;  3NZN A;  1I1I P;  3VFI A;  1QMV A;  4POM A;  4EIP A;  4IQA A;  4RI6 A;  2OAD A;  1GRX A;  3F6D A;  5A1N B;  3QR6 A;  3FK8 A;  1MTC A;  1R7H A;  4IJ3 A;  4F82 A;  3CTF A;  1K0A A;  3IPZ A;  1QQ2 A;  2JAD A;  2WRT A;  1PRX A;  3TJB A;  4G01 A;  5G5E A;  3F0I A;  1S3C A;  1T8E B;  1M99 A;  4MH3 A;  2YWM A;  4D73 A;  4BVY A;  3F3Q A;  1N25 A;  1HQO A;  2WW0 A;  1FG4 A;  1M7T A;  3G7Y A;  1G7O A;  3IR4 A;  3Q19 A;  1GLQ A;  4N0V A;  2CZ3 A;  1GSS A;  4OCE A;  1ZZY A;  3KM6 A;  1F37 A;  2NBS A;  1TK8 B;  3HVS A;  5D93 A;  5G31 A;  2ZNM A;  5HR1 A;  3HVX A;  1X9S B;  1ERV A;  2IMF A;  2V41 A;  3CYN A;  2DBC A;  1X5D A;  5J4Y A;  1M3I A;  1Z3E A;  3HMJ G;  4TKY A;  2C80 A;  3C1S A;  4GSN A;  2O8V B;  4EXJ A;  3GKN A;  2DMM A;  3IA1 A;  4GWR A;  1TDI A;  1BG1 A;  4YKF A;  1O8W A;  1OC8 A;  3RDW A;  1SKW B;  4PUF C;  4EIQ A;  3PH9 A;  18GS A;  3GNJ A;  2V32 A;  1JZR A;  1KBN A;  2HNL A;  6GSX A;  5G2Z A;  3GV1 A;  5JWQ B;  3PPU A;  1BX9 A;  3UEM A;  1PX6 A;  1VF1 A;  4ZB8 A;  2VLU A;  4KSO A;  2VKZ G;  1TI1 A;  4EKZ A;  2PN8 A;  3C8E A;  4L0W A;  1ZYE A;  1M9A A;  2IJY A;  2DIY A;  2R5G A;  3LQ7 A;  4Z2R A;  4GSS A;  3DVX A;  2OE3 A;  2A2P A;  4MNN A;  5DAL A;  4L0U A;  2LTK A;  5ELA A;  2GZZ A;  4EL1 A;  2LNS A;  2R0P A;  1LBK A;  2WZS A;  5BMU A;  3KTB A;  2VLT A;  1ZCP A;  2JSY A;  1U3I A;  4NV2 A;  2ES7 A;  1XPV A;  2REM A;  4ZIL A;  4PNG A;  2DKH A;  4GST A;  5J41 A;  3CSI A;  3TB2 A;  4ACS A;  3M9K A;  2IIY A;  3QAG A;  2GS3 A;  1F6M C;  4ZBD A;  1TXU A;  3ZMK A;  1BED A;  3ZFL A;  5ECP B;  2M72 A;  5IMZ A;  4ZIJ A;  1KNG A;  1BQ7 A;  1BJX A;  5JCU A;  1K0D A;  4DSS B;  4POL A;  1V2A A;  6GSY A;  1FB6 A;  4WXT A;  4MCU A;  3CTG A;  3UMA A;  5KOW A;  1V98 A;  4HEA 2;  2YWO A;  1FB0 A;  1GWC A;  2LS5 A;  4ISD A;  3APO A;  1SK1 A;  2LKU A;  1XWC A;  4CW9 A;  1Z5Y E;  2GZY A;  2QSI A;  3FRC A;  2E2G A;  3IAS 2;  3EIN A;  2H30 A;  1SVL A;  5HQP A;  4N3Z A;  5KN0 A;  4TR4 A;  1SYX A;  5DBQ A;  4NXI A;  22GS A;  1TI3 A;  4ML6 A;  4Q5Q A;  4RI7 A;  2OJL A;  4K0G A;  5CNW A;  2HZF A;  5CRD A;  1SKR B;  3W8J A;  4KW6 A;  4MZC A;  3IBH A;  2WVZ A;  4HU9 A;  2J9H A;  5G30 A;  4V1A g;  5J40 A;  4EDZ A;  4XS4 A;  2XC2 A;  1DE2 A;  1GSD A;  3MDK A;  2F8A A;  2CV4 A;  4IN0 A;  1VF4 A;  2N5F A;  2C3N A;  3L78 A;  4A5P A;  20GS A;  1U6T A;  4MPG A;  4V1A p;  2FNO A;  2GQL A;  2VD0 A;  1EP8 A;  3KIJ A;  4NMU A;  4DSQ A;  1MDJ A;  2M46 A;  3ZIV A;  2X8H A;  1HNB A;  4J2F A;  1ZGN A;  4D73 B;  1K3O A;  1OC3 A;  5LNK e;  4MP4 A;  4K7I A;  2MMN A;  2OA7 A;  1OVN A;  1ZYN A;  3EC3 A;  2OE0 A;  4YQV A;  2F8F A;  4JBB A;  1AQW A;  4V2M A;  3KMO A;  1E2Y A;  3IRA A;  4CY8 A;  3DML A;  3RHB A;  1ZYP A;  3BOA A;  16GS A;  1RQM A;  4WEY A;  1W89 A;  4BPY A;  2R0G A;  4E8E A;  4CHS A;  3KMN A;  4AJ7 A;  1SL1 B;  4KF9 A;  2H73 A;  2HT9 A;  4EE0 A;  2H74 A;  4O5R A;  2K18 A;  3DWV A;  2H19 A;  1XIY A;  1B4P A;  1KEB A;  5A4V A;  5D9T A;  2RII A;  3R3E A;  3KGK A;  1R26 A;  3TRQ A;  2GTU A;  2K6V A;  1TOF A;  1G6Y A;  2QC7 A;  3APQ A;  5JWR B;  1NHY A;  1RK4 A;  4AKX B;  1USB A;  3ME7 A;  4O92 A;  2AJQ B;  5EPF A;  1ST9 A;  4X0X A;  5JCW A;  3UIW A;  2N5A A;  5DJL A;  1PKZ A;  1OE8 A;  3ZL5 A;  5A4U A;  1SK2 A;  2TRX A;  3D6I A;  5DAL B;  1TP9 A;  11GS A;  3KH7 A;  2MMO A;  5BMU B;  1PMT A;  3QD9 A;  2EFD A;  5CO3 A;  4PI0 C;  1ZMA A;  4IKH A;  5IOX A;  1YY7 A;  3DYR A;  5GAN D;  3EYT A;  3CSH A;  1DUG A;  5DCH A;  4F03 A;  2OAC A;  1TRS A;  3CHX C;  4PGT A;  4OCF A;  1UC7 A;  3M8N A;  1EP7 A;  4IQ1 A;  4EDY A;  4TW5 A;  1EV9 A;  1X9M B;  1WJK A;  1MDI A;  4ZB9 A;  3HJP A;  2H76 A;  5B6N A;  1T00 A;  4MA9 A;  5B8B A;  4TN8 A;  1TXX A;  2EIR A;  2VL2 A;  1SK0 A;  4HI7 A;  1PKW A;  5ECO B;  3QCP A;  3GKK A;  4V2N A;  1O85 A;  2HSN A;  2LJK A;  4POK A;  2FLS A;  2H1G A;  2IFQ A;  3GIX A;  3G9B A;  3IOS A;  3ZIT A;  3LSZ A;  1K0O A;  2I9H A;  5JCG A;  3TJG A;  1GL8 A;  3FHK A;  2LRN A;  1HNC A;  3ZVJ D;  3KEB A;  3HVN A;  2MMA A;  4WET A;  1ERW A;  5AIX A;  4ZXG A;  1GUH A;  5CRG A;  2LQQ A;  1GNW A;  3CSJ A;  2HSM A;  3WGX A;  2DJ2 A;  3Q74 A;  1TRW A;  2JL4 A;  4HJ2 A;  3TKS A;  1MD3 A;  5IM9 A;  4NHZ A;  2GVP A;  3ZIJ A;  5ECN B;  3QPM A;  5IMD A;  5G1K A;  4K9Z A;  3P2A A;  2H0G A;  4IS0 A;  2LST A;  2YV9 A;  5D9X A;  3WGE A;  4BVX A;  2JZS A;  3GTU B;  5ECS A;  5E4W A;  4WR5 A;  3TJK A;  4BL7 B;  3BCK A;  2CVB A;  4KAE A;  2FWG A;  1Y1U A;  1X5E A;  2A4H A;  1BG5 A;  1ML6 A;  2JAC A;  6GSS A;  1TU7 A;  3HHV A;  2H0I A;  2CZ2 A;  4N30 A;  2G0F A;  3BJ5 A;  4WBJ A;  5FT3 A;  1K3Y A;  4FYB A;  5G1L A;  4MDC A;  2PGT A;  3A2W A;  5ECR B;  1U3A A;  5LCZ A;  1F3A A;  1R5A A;  1O6J A;  2X99 A;  3M3M A;  2IL3 A;  4I2T A;  2DC5 A;  1WRY A;  1WIK A;  2IME A;  4FH8 A;  4K2X A;  1NM3 A;  2EFE A;  1SD9 A;  5DVB A;  1M0U A;  3CRT A;  5ECK B;  4AKH A;  3GMF A;  4OFN A;  4LL4 B;  2O5V A;  2P5Q A;  3DGQ A;  1XOB A;  4TOP A;  9GSS A;  3DIE A;  2CAI A;  5C04 A;  5F07 A;  2H6X A;  3H1N A;  2VL3 A;  1T3B A;  1SU9 A;  1ZL9 A;  1R4W A;  3D4T A;  4YQU A;  1WOU A;  2AHE A;  3RBT A;  4GF0 A;  4YAP A;  4RQX A;  1S4B P;  2NTO A;  4XRA A;  1THX A;  1K0C A;  2A4V A;  3LEF A;  4MMM A;  3UL3 A;  3DXB A;  4MF5 A;  1B48 A;  4MJB A;  5GSS A;  3A2X A;  4G10 A;  5DAK A;  1AUC A;  2PUK C;  4G0I A;  2WW3 A;  2F3M A;  3M1G A;  2CX4 A;  3LGC A;  1OE7 A;  4QMK A;  2DJ1 A;  3BCI A;  4ECB A;  4O5Q A;  3EUR A;  1YKA A;  1YF0 A;  4TXO A;  3HJM A;  5BRT A;  1Y6E A;  2H6Y A;  2DJ0 A;  1V40 A;  2GT5 A;  1S3A A;  1GTA A;  2F9S A;  3GL3 A;  4BA7 A;  1MEK A;  2C4J A;  5CP1 A;  1JLV A;  3SBC A;  4KX4 A;  1VRS D;  4HZ4 A;  2H01 A;  1PL2 A;  4MF7 A;  4K5S A;  5CYY A;  3MWH A;  3ISO A;  4E8H A;  4TXV A;  1XG8 A;  3ERG A;  2VAF A;  3H8Q A;  2EIQ A;  3TKS E;  2CQ9 A;  4HQZ A;  2YP6 A;  1HYU A;  3EVI A;  4F9Z A;  1MDK A;  2CX3 A;  1K3L A;  1GSF A;  3ZRE A;  4BIK A;  4XS6 A;  2WW2 A;  3TRP A;  2AB6 A;  5J3R A;  4OO4 A;  2XPE A;  2ON5 A;  2HZE A;  3QOU A;  4GCI A;  2RUE A;  2DKI A;  5FHI A;  1F2E A;  5J4V A;  3IK9 A;  2WFC A;  2HSN B;  3ED3 A;  1TJD A;  2FUG 2;  1URM A;  1EV4 A;  2EIO A;  4DSR A;  3IAM 2;  3N5O A;  5D9W A;  4AI6 A;  1PSQ A;  3VUR A;  3EMX A;  1RW1 A;  5IMA A;  3F4R A;  4IBP A;  2LV3 A;  3ERW A;  3EWL A;  4DEJ A;  4WF4 A;  3LFL A;  4PQ1 A;  1IYI A;  1OC9 A;  2HSM B;  5F8B A;  3VLN A;  2H71 A;  3D21 A;  1XOA A;  2B3S A;  5ENU A;  2V2G A;  4WKW A;  3O3T A;  3N9J A;  4JR6 A;  4YQM A;  2LJR A;  2K9F A;  4ZB6 A;  4ZL8 A;  3ME8 A;  2K8V A;  4HZ2 A;  1J08 A;  2CT6 A;  4KH7 A;  3M9J A;  3LXZ A;  4P3Y B;  2VUP A;  2GT6 A;  5AIV A;  1T7P B;  4Q5R A;  2HRF A;  2VM1 A;  2VO4 A;  1GH2 A;  2OT3 A;  4K5R A;  2IMK A;  5E59 A;  2FWH A;  1V9W A;  1XWG A;  1TRV A;  2MZC A;  4BVX B;  1OKD A;  4XRD A;  5ECH B;  5H5Q A;  2NPB A;  4WR4 A;  3L9U A;  2X8C A;  3PIN A;  2QA1 A;  1GNE A;  3CRU A;  2PWJ A;  2O36 A;  1PD2 1;  1XXU A;  4YH2 A;  3H93 A;  3SWL A;  2WB9 A;  4OD7 A;  1I5G A;  4PUA A;  1XW6 A;  3CBU A;  3GH9 A;  4EO3 A;  5A4W A;  4TR1 A;  3US3 A;  2MBT A;  2VCT A;  4JE1 A;  3VI5 A;  2TIR A;  2CAQ A;  1XFL A;  3I6A A;  3TOU A;  1ON4 A;  3KP8 A;  4JZQ A;  3MIX A;  3F4S A;  2MBS A;  2WCI A;  2X64 A;  3JCM L;  1CQH A;  2R2J A;  3EMP A;  1F3B A;  2E2M A;  3WT1 A;  5DDL A;  4G0L A;  2GSR A;  3OR5 A;  2AV4 A;  3CXG A;  3ZTL A;  2H1B A;  2HSY A;  4HS1 A;  4PX1 A;  4K6X A;  1BF5 A;  3UVT A;  4QL9 A;  1J0F A;  1G0T A;  2RUF A;  4K7O A;  1QFN A;  2HRA A;  2HQT A;  2WVX A;  1SYR A;  2P0G A;  1E6B A;  4NV5 A;  2C1Y A;  1K0B A;  1AW9 A;  5KEJ A;  5A5K A;  2A2S A;  2R0C A;  2ALB A;  1Z7P A;  1Z6M A;  2IN3 A;  3U6V A;  1YKC A;  5KN2 A;  5ECL B;  3TRX A;  2UV8 G;  3GN3 A;  5DAK B;  5A5H A;  5F0G A;  1X5C A;  4TR3 A;  4F2I A;  1AC1 A;  3MSZ A;  3TJJ A;  1GSY A;  1XVW A;  1K0N A;  1YQ1 A;  4BVY B;  4LMV A;  4JED A;  4TXO B;  2PMT A;  4K7N A;  4XHM A;  2IMI A;  5IQY A;  2I81 A;  3O76 A;  4IGJ A;  2BTO T;  4FYU A;  2FA8 A;  3QAV A;  4I6X A;  3MAK A;  4YKG A;  5A34 A;  4K8M A;  1V58 A;  5AN1 A;  3E9J B;  1SEN A;  2H70 A;  2R4V A;  1Z9H A;  3KXO A;  3F63 A;  1SL0 B;  4MK3 A;  4LL1 B;  4J57 E;  3QFA C;  2C0F A;  2VCV A;  3DEX A;  1Z7R A;  1FOH A;  2O89 A;  2HZE B;  4MLY A;  3D5J A;  2VCZ A;  1EEM A;  2VL2 C;  4IW9 A;  1X0R A;  1B9X C;  3CWG A;  2FGX A;  1JHB A;  5L71 A;  1H75 A;  1XWK A;  3IC8 A;  4G2E A;  4E68 A;  4TVE A;  5F06 A;  3HJO A;  1HNA A;  1T4Y A;  1UVZ A;  2E0Q A;  1AQX A;  1JZW A;  2V1M A;  2B7J A;  3APS A;  3IXR A;  5CRW A;  1JLW A;  1PX7 A;  2ZUP A;  1UN2 A;  1OC9 B;  3TKR A;  4AGS A;  4KGI A;  1YF1 A;  4LA1 A;  2K8S A;  3CMI A;  4Z7X A;  1TW9 A;  3A3T A;  2IMD A;  2NVL A;  1LU4 A;  3TKS C;  2BMX A;  2MMZ A;  1UA5 A;  3F3R A;  1XWB A;  2DJJ A;  4J56 E;  4FYC A;  1A2J A;  1XBS A;  1A2L A;  3P90 A;  1YDK A;  5AGY A;  5H5R A;  4L5L A;  3GKM A;  4XS1 A;  2KP1 A;  4TR0 A;  1M2B A;  3E0U A;  2H1D A;  2B5X A;  1M9B A;  3FKF A;  3E3E A;  1WMJ A;  2KHP A;  3HA9 A;  4IJI A;  2XHF A;  3RPP A;  1M3J A;  1WPI A;  2VLV A;  4XCS A;  4XTS A;  2X8G A;  2GQM A;  5CRE A;  3ZVJ A;  3FZ4 A;  5KN1 A;  4IVF A;  3VWX A;  4TR1 B;  3A5I A;  3GUS A;  2OKA A;  2HE3 A;  3WYW A;  2DML A;  1Q98 A;  4O32 A;  2WGR A;  2O3E A;  2KP2 A;  4GLT A;  3TKQ A;  3KP9 A;  2D2Z A;  7GSS A;  4OWY A;  2G2Q A;  2B5Y A;  4HOJ A;  4XIH A;  4GDF A;  2KLX A;  1YVL A;  4BWS A;  1SJ6 A;  4KDY A;  3KTL A;  3LYK A;  5EY6 A;  1PL1 A;  1HD2 A;  1VGL A;  2PU9 C;  2GSQ A;  2V6K A;  3ZFB A;  4AKI A;  5IOW A;  1J9B A;  1GUM A;  2OBK A;  3S9F A;  3L0H A;  4N10 A;  1GUL A;  4PXO A;  3C1R A;  3WT2 A;  3TUE A;  4KA0 A;  2I1U A;  5IO2 A; 
#chains in the Genus database with same CATH homology
 1BYE A;  2YZH A;  4XS4 B;  2DJK A;  4EC0 A;  2H66 A;  1X9W B;  1JZO A;  5J9C A;  2DJ3 A;  2J23 A;  4MJE A;  3TCO A;  4PUR A;  4I8B A;  2L6C A;  1QXH A;  3GST A;  3VWW A;  3HXS A;  1PGT A;  2L6D A;  1PN9 A;  2LRT A;  4H86 A;  5ID2 A;  2P31 A;  2JZR A;  2H6Z A;  1A0R P;  3UOM A;  3HYP A;  3LXT A;  3KCM A;  1AIU A;  4I2U A;  1GSU A;  4MZB A;  2YOI A;  3RAZ A;  6GSU A;  4G0K A;  3ZLP A;  2H0H A;  1SJZ A;  3A2V A;  4DVC A;  4O7H A;  3HCZ A;  8GSS A;  1K0M A;  4DSS A;  3GKX A;  1H4O A;  2C3T A;  2RM6 A;  5A34 B;  3LYP A;  4F0B A;  1EGO A;  1XWA A;  1GP1 A;  3NOF A;  2I4A A;  5EVO A;  3ZML A;  2IPA A;  5IIZ A;  5HFK A;  3FZ5 A;  1BAY A;  3RPN A;  3J7Y k;  3HVV A;  3TU3 B;  3FW2 A;  2FCH A;  2HI7 A;  5COH A;  2ZCT A;  4JR4 A;  4KDU A;  3LG6 A;  5B7C A;  3FZ9 A;  3UBL A;  1EWX A;  2B5E A;  2JZT A;  1ERT A;  5AIS A;  2KOK A;  2OE1 A;  3U5R E;  3UJ1 A;  2R6K A;  2L59 A;  2GST A;  2FWF A;  1N2A A;  3UAR A;  4KUN A;  4JU5 A;  2HXK A;  1B9Y C;  2H8L A;  3FYG A;  1EEJ A;  5ABR A;  4WF5 A;  4Z2T A;  5J47 A;  3C7M A;  3P8W A;  17GS A;  3QFB C;  3GHA A;  4X4J A;  5HR2 A;  3V1W A;  4LLR A;  2LQO A;  2HYX A;  1THO A;  1WE0 A;  6GST A;  4V2L A;  4MZW A;  2YWN A;  1YJ6 A;  1GSQ A;  3GYK A;  2FY6 A;  3GA4 A;  3D22 A;  4OO5 A;  2B1L A;  3C71 A;  3IHG A;  3MNG A;  3F9U A;  3HY2 A;  4POB A;  1T4Z A;  4ECI A;  3HZ8 A;  1O73 A;  2AYT A;  2VCX A;  2TRC P;  4ID0 A;  4LMW A;  4YAV A;  4FO5 A;  2WS2 A;  6GSW A;  1A8L A;  2FA4 A;  2X4A A;  4AJ6 A;  3GUR A;  3UVH A;  5J4U A;  2YAN A;  3L9V A;  4QL7 A;  2RLI A;  4K1F A;  4X1U A;  1TRU A;  2LEG A;  4JRR A;  3F8U A;  2CVK A;  3H79 A;  4ECC A;  4ECJ A;  4IP6 A;  3R2Q A;  1QGV A;  3VWU A;  1SD8 A;  3GFK A;  2IFQ B;  1GUK A;  1GTI A;  1M2A A;  1TU8 A;  1TK0 B;  6GSV A;  3DRN A;  1VF3 A;  3VPQ A;  2A2R A;  2L57 A;  3RHC A;  2LUS A;  1SKS B;  3G7I A;  4HJM A;  4NWY A;  2PBJ A;  1PQN A;  5J9B A;  5ELG A;  3EPT A;  1Q4J A;  5IPG A;  1SVM A;  2LNT A;  2YJ7 A;  4MPF A;  5KN3 A;  1FHE A;  4RQR A;  1A2M A;  3W6G A;  3G7J A;  4PQH A;  2PER A;  3IC4 A;  2YCD A;  4FQU A;  5DCG A;  2IWT A;  3F6F A;  2C0D A;  1NHO A;  5ID2 B;  2O85 A;  1DE1 A;  3FEU A;  2FD3 A;  3QAW A;  5KOX A;  1AXD A;  3LW9 A;  3QDN A;  2C0G A;  1G6W A;  1QK8 A;  2JU5 A;  2L4Q A;  3ERF A;  2DLX A;  1TTZ A;  2N5B A;  3C73 A;  1A23 A;  3TOT A;  2R3X A;  1GTU A;  1O8X A;  4HQS A;  1FAA A;  2HRN A;  5D96 A;  2YPM A;  2E7P A;  1Y25 A;  3QMX A;  2GQK A;  4KCE A;  3VI7 A;  4G19 A;  3GH6 A;  1FO5 A;  2M80 A;  2MYG A;  3UBK A;  2NDO A;  2VM2 A;  2AAW A;  5ECM B;  2CVD A;  5HFG A;  2C3Q A;  2ON7 A;  1I9D A;  3DKS A;  1F9M A;  4KB3 A;  3FR6 A;  2GDR A;  4ZL7 A;  3GRX A;  3PGT A;  1MD4 A;  5H5S A;  1OYJ A;  4I97 A;  4PQI A;  2HRK A;  3IE3 A;  1C72 A;  2GLR A;  2H72 A;  4ZL9 A;  1O81 A;  4ZBA A;  2WDU A;  3L4N A;  3F4T A;  2EC4 A;  1SL2 B;  2AUV A;  3DVW A;  2B1K A;  5J5N A;  2PPT A;  1A8Y A;  4N11 A;  1T1V A;  1FW1 A;  2O7K A;  3FMW A;  2V6O A;  1NSW A;  2HSH A;  4FIW A;  3TGZ A;  3I9V 2;  1DSB A;  4IEL A;  2Z9S A;  1PA3 A;  3NIV A;  2LJA A;  4GQC A;  2L4C A;  4ZBB A;  2KUC A;  1U88 A;  3VWV A;  1N8J A;  3GTU A;  1G7E A;  3DD3 A;  4BL7 A;  5JWO B;  3Q18 A;  5ECI B;  4HU7 A;  4HUA A;  3HKR A;  5DQS A;  2LRC A;  4WBR D;  3HDC A;  1ZYQ B;  1WP0 A;  12GS A;  5CRH A;  2DSA A;  5C00 A;  3W8S A;  1A24 A;  1WWJ A;  2QGV A;  2X49 A;  4K0N A;  4KND A;  3IHQ A;  3Q6O A;  3KJY A;  5B6M A;  3O6T A;  3IK7 A;  2WZ9 A;  3H4K A;  1EGR A;  2PVQ A;  2WJU A;  5DQY A;  3FZA A;  4MJA A;  3LOR A;  1W4V A;  4EF0 A;  1QUW A;  4KSM A;  1ABA A;  2I3Y A;  3A5W A;  3WD6 A;  3BBY A;  1KTE A;  1TKD B;  5FWG A;  4IP1 A;  1ILO A;  4OFM A;  3ZYW A;  5IO0 A;  3KH9 A;  4QQ7 A;  4Q5F A;  1JZD A;  1LJR A;  2JSZ A;  2XBI A;  2UZ8 A;  1XZO A;  2HFD A;  5IPH A;  1IYH A;  3TKP A;  5A1N A;  2HLS A;  1R5P A;  5HR0 A;  3FR9 A;  3GX8 A;  1FVJ A;  2H1A A;  1CQG A;  4GXZ A;  1VF2 A;  2VL9 A;  4BWQ A;  4ML1 A;  5HFI A;  4ULX A;  4L8E A;  3M0F A;  4HDE A;  5D8I A;  3FY7 A;  2GGT A;  3AY8 A;  13GS A;  3VK9 A;  1ERU A;  4AF2 A;  19GS A;  1YEX A;  4PNF A;  2P5R A;  2PVO C;  4GQF A;  1M2D A;  4N0Z A;  2DIZ A;  1XW9 A;  2YZU A;  2QA2 A;  5GZZ B;  1NW2 A;  3L9S A;  2RM5 A;  5D9V A;  3GL5 A;  4TRX A;  3EU3 A;  2B6M A;  3HD5 A;  5CAX A;  3PR8 A;  4F0C A;  3IDV A;  2O87 A;  2C0E A;  4IHU A;  5DJM A;  4MH2 A;  4I5Q A;  2WUL A;  1PN0 A;  3I69 A;  2VCW A;  3WGD A;  2BJX A;  2C8U A;  3UAP A;  4NHW A;  4GTU A;  4Q5N A;  1XVQ A;  4EVM A;  5EL8 A;  4X43 A;  4AJ8 A;  1OAZ A;  1XW5 A;  4MAB A;  4AKG A;  2R37 A;  2HRK B;  1OKT A;  4CY6 A;  4W66 A;  1EZK A;  3BD2 A;  2YJH A;  2F51 A;  1YEP A;  1FOV A;  3EU4 A;  2XPD A;  1V57 A;  2OBI A;  1AQV A;  5IMF A;  2VD1 A;  5F05 A;  4Z2U A;  1A0F A;  5B8A A;  3TJF A;  4OMV A;  2YWI A;  3D4M A;  3MYD A;  5HR3 A;  4ILF A;  5A5H B;  1DBY A;  1SJI A;  1O7U A;  2FWE A;  1B8X A;  2CA8 A;  1EOG A;  3ZZX A;  2GSS A;  1Z6N A;  2QKE A;  1AAZ A;  4PTS A;  3TDG A;  3EE2 A;  1U87 A;  4K2D A;  1GSE A;  1B4Q A;  4KDX A;  3K8N A;  4MF6 A;  5IMC A;  4L5O A;  2H1L A;  4NPB A;  4EUY A;  3J7Y b;  5INY A;  2EFC A;  2EFH A;  2FHE A;  3KZQ A;  3I43 A;  1EOH A;  4G9H A;  5ECQ B;  5GST A;  2VOC A;  2YV7 A;  4ZB7 A;  1S3D A;  3HZ4 A;  14GS A;  4OFT A;  1TK5 B;  3LJR A;  3GX0 A;  3IV4 A;  1ZOF A;  5LD0 A;  4KE3 A;  2VIM A;  5IMV A;  1XCC A;  4USS A;  2VCQ A;  4KCA A;  2B7K A;  4CDO A;  2XBQ A;  5D73 A;  4MJC A;  2H75 A;  5G5F A;  2YNX A;  2L5L A;  1SVO A;  1JFU A;  3VPT A;  2L5O A;  5GAP D;  1ACV A;  1FVK A;  1GTB A;  4NAX A;  3LWA A;  3D0Z A;  2YN1 A;  4ICY A;  3GSS A;  3P7X A;  4O5U A;  3KD0 A;  3FR3 A;  10GS A;  4RUV A;  3ZRD A;  1YZX A;  2GZP A;  4GRF A;  1GLP A;  3NZN A;  3VFI A;  1QMV A;  4POM A;  4EIP A;  4IQA A;  4RI6 A;  2OAD A;  1GRX A;  3F6D A;  5A1N B;  3QR6 A;  3FK8 A;  1MTC A;  1R7H A;  4IJ3 A;  4F82 A;  3CTF A;  1K0A A;  3IPZ A;  1QQ2 A;  2JAD A;  2WRT A;  1PRX A;  3TJB A;  4G01 A;  5G5E A;  3F0I A;  1S3C A;  1T8E B;  1M99 A;  4MH3 A;  2YWM A;  4D73 A;  4BVY A;  3F3Q A;  1N25 A;  1HQO A;  1FG4 A;  1M7T A;  3G7Y A;  1G7O A;  3IR4 A;  3Q19 A;  1GLQ A;  4N0V A;  2CZ3 A;  1GSS A;  4OCE A;  1ZZY A;  3KM6 A;  1F37 A;  2NBS A;  1TK8 B;  3HVS A;  5D93 A;  5G31 A;  2ZNM A;  5HR1 A;  3HVX A;  1X9S B;  1ERV A;  2IMF A;  2V41 A;  3CYN A;  2DBC A;  1X5D A;  5J4Y A;  1Z3E A;  3HMJ G;  4TKY A;  2C80 A;  3C1S A;  4GSN A;  2O8V B;  4EXJ A;  3GKN A;  2DMM A;  3IA1 A;  4GWR A;  1TDI A;  1BG1 A;  4YKF A;  1O8W A;  1OC8 A;  3RDW A;  1SKW B;  4PUF C;  4EIQ A;  3PH9 A;  18GS A;  3GNJ A;  2V32 A;  1JZR A;  1KBN A;  2HNL A;  6GSX A;  5G2Z A;  3GV1 A;  5JWQ B;  3PPU A;  1BX9 A;  3UEM A;  1PX6 A;  1VF1 A;  4ZB8 A;  2VLU A;  4KSO A;  2VKZ G;  1TI1 A;  4EKZ A;  2PN8 A;  3C8E A;  4L0W A;  1ZYE A;  1M9A A;  2IJY A;  2DIY A;  2R5G A;  3LQ7 A;  4Z2R A;  4GSS A;  3DVX A;  2OE3 A;  2A2P A;  4MNN A;  5DAL A;  4L0U A;  2LTK A;  5ELA A;  2GZZ A;  4EL1 A;  2LNS A;  2R0P A;  1LBK A;  5BMU A;  3KTB A;  2VLT A;  1ZCP A;  2JSY A;  1U3I A;  4NV2 A;  2ES7 A;  1XPV A;  2REM A;  4ZIL A;  4PNG A;  2DKH A;  4GST A;  5J41 A;  3CSI A;  3TB2 A;  4ACS A;  3M9K A;  2IIY A;  3QAG A;  2GS3 A;  1F6M C;  4ZBD A;  1TXU A;  3ZMK A;  1BED A;  3ZFL A;  5ECP B;  2M72 A;  5IMZ A;  4ZIJ A;  1KNG A;  1BQ7 A;  1BJX A;  5JCU A;  1K0D A;  4DSS B;  4POL A;  1V2A A;  6GSY A;  1FB6 A;  4WXT A;  4MCU A;  3CTG A;  3UMA A;  5KOW A;  1V98 A;  4HEA 2;  2YWO A;  1FB0 A;  1GWC A;  2LS5 A;  4ISD A;  3APO A;  1SK1 A;  2LKU A;  1XWC A;  4CW9 A;  1Z5Y E;  2GZY A;  2QSI A;  3FRC A;  2E2G A;  3IAS 2;  3EIN A;  2H30 A;  1SVL A;  5HQP A;  4N3Z A;  5KN0 A;  4TR4 A;  1SYX A;  5DBQ A;  4NXI A;  22GS A;  1TI3 A;  4ML6 A;  4Q5Q A;  4RI7 A;  2OJL A;  4K0G A;  5CNW A;  2HZF A;  5CRD A;  1SKR B;  3W8J A;  4KW6 A;  4MZC A;  3IBH A;  4HU9 A;  2J9H A;  5G30 A;  4V1A g;  5J40 A;  4EDZ A;  4XS4 A;  2XC2 A;  1DE2 A;  1GSD A;  3MDK A;  2F8A A;  2CV4 A;  4IN0 A;  1VF4 A;  2N5F A;  2C3N A;  3L78 A;  4A5P A;  20GS A;  1U6T A;  4MPG A;  4V1A p;  2FNO A;  2GQL A;  2VD0 A;  1EP8 A;  3KIJ A;  4NMU A;  4DSQ A;  1MDJ A;  2M46 A;  3ZIV A;  2X8H A;  1HNB A;  4J2F A;  1ZGN A;  4D73 B;  1K3O A;  1OC3 A;  5LNK e;  4MP4 A;  4K7I A;  2MMN A;  2OA7 A;  1OVN A;  1ZYN A;  3EC3 A;  2OE0 A;  4YQV A;  2F8F A;  4JBB A;  1AQW A;  4V2M A;  3KMO A;  1E2Y A;  3IRA A;  4CY8 A;  3DML A;  3RHB A;  1ZYP A;  3BOA A;  16GS A;  1RQM A;  4WEY A;  1W89 A;  4BPY A;  2R0G A;  4E8E A;  4CHS A;  3KMN A;  4AJ7 A;  1SL1 B;  4KF9 A;  2H73 A;  2HT9 A;  4EE0 A;  2H74 A;  4O5R A;  2K18 A;  3DWV A;  2H19 A;  1XIY A;  1B4P A;  1KEB A;  5A4V A;  5D9T A;  2RII A;  3R3E A;  3KGK A;  1R26 A;  3TRQ A;  2GTU A;  2K6V A;  1TOF A;  1G6Y A;  2QC7 A;  3APQ A;  5JWR B;  1NHY A;  1RK4 A;  4AKX B;  1USB A;  3ME7 A;  4O92 A;  2AJQ B;  5EPF A;  1ST9 A;  4X0X A;  5JCW A;  3UIW A;  2N5A A;  5DJL A;  1PKZ A;  1OE8 A;  3ZL5 A;  5A4U A;  1SK2 A;  2TRX A;  3D6I A;  5DAL B;  1TP9 A;  11GS A;  3KH7 A;  2MMO A;  5BMU B;  1PMT A;  3QD9 A;  2EFD A;  5CO3 A;  1ZMA A;  4IKH A;  5IOX A;  1YY7 A;  3DYR A;  5GAN D;  3EYT A;  3CSH A;  1DUG A;  5DCH A;  4F03 A;  2OAC A;  1TRS A;  4PGT A;  4OCF A;  1UC7 A;  3M8N A;  1EP7 A;  4IQ1 A;  4EDY A;  4TW5 A;  1EV9 A;  1X9M B;  1WJK A;  1MDI A;  4ZB9 A;  3HJP A;  2H76 A;  5B6N A;  1T00 A;  4MA9 A;  5B8B A;  4TN8 A;  1TXX A;  2EIR A;  2VL2 A;  1SK0 A;  4HI7 A;  1PKW A;  5ECO B;  3QCP A;  3GKK A;  4V2N A;  1O85 A;  2HSN A;  2LJK A;  4POK A;  2FLS A;  2H1G A;  2IFQ A;  3GIX A;  3G9B A;  3IOS A;  3ZIT A;  3LSZ A;  1K0O A;  2I9H A;  5JCG A;  3TJG A;  1GL8 A;  3FHK A;  2LRN A;  1HNC A;  3ZVJ D;  3KEB A;  2MMA A;  4WET A;  1ERW A;  5AIX A;  4ZXG A;  1GUH A;  5CRG A;  2LQQ A;  1GNW A;  3CSJ A;  2HSM A;  3WGX A;  2DJ2 A;  3Q74 A;  1TRW A;  2JL4 A;  4HJ2 A;  3TKS A;  1MD3 A;  5IM9 A;  4NHZ A;  2GVP A;  3ZIJ A;  5ECN B;  3QPM A;  5IMD A;  5G1K A;  4K9Z A;  3P2A A;  2H0G A;  4IS0 A;  2LST A;  2YV9 A;  5D9X A;  3WGE A;  4BVX A;  2JZS A;  3GTU B;  5ECS A;  5E4W A;  4WR5 A;  3TJK A;  4BL7 B;  3BCK A;  2CVB A;  4KAE A;  2FWG A;  1Y1U A;  1X5E A;  2A4H A;  1BG5 A;  1ML6 A;  2JAC A;  6GSS A;  1TU7 A;  3HHV A;  2H0I A;  2CZ2 A;  4N30 A;  2G0F A;  3BJ5 A;  4WBJ A;  5FT3 A;  1K3Y A;  4FYB A;  5G1L A;  4MDC A;  2PGT A;  3A2W A;  5ECR B;  1U3A A;  5LCZ A;  1F3A A;  1R5A A;  1O6J A;  2X99 A;  3M3M A;  2IL3 A;  4I2T A;  2DC5 A;  1WRY A;  1WIK A;  2IME A;  4FH8 A;  4K2X A;  1NM3 A;  2EFE A;  1SD9 A;  5DVB A;  1M0U A;  3CRT A;  5ECK B;  4AKH A;  3GMF A;  4OFN A;  4LL4 B;  2O5V A;  2P5Q A;  3DGQ A;  1XOB A;  4TOP A;  9GSS A;  3DIE A;  2CAI A;  5C04 A;  5F07 A;  2H6X A;  3H1N A;  2VL3 A;  1T3B A;  1SU9 A;  1ZL9 A;  1R4W A;  3D4T A;  4YQU A;  1WOU A;  2AHE A;  3RBT A;  4GF0 A;  4YAP A;  4RQX A;  2NTO A;  4XRA A;  1THX A;  1K0C A;  2A4V A;  3LEF A;  4MMM A;  3UL3 A;  3DXB A;  4MF5 A;  1B48 A;  4MJB A;  5GSS A;  3A2X A;  4G10 A;  5DAK A;  1AUC A;  2PUK C;  4G0I A;  2F3M A;  3M1G A;  2CX4 A;  3LGC A;  1OE7 A;  4QMK A;  2DJ1 A;  3BCI A;  4ECB A;  4O5Q A;  3EUR A;  1YKA A;  1YF0 A;  4TXO A;  3HJM A;  5BRT A;  1Y6E A;  2H6Y A;  2DJ0 A;  1V40 A;  2GT5 A;  1S3A A;  1GTA A;  2F9S A;  3GL3 A;  4BA7 A;  1MEK A;  2C4J A;  5CP1 A;  1JLV A;  3SBC A;  4KX4 A;  1VRS D;  4HZ4 A;  2H01 A;  1PL2 A;  4MF7 A;  4K5S A;  5CYY A;  3MWH A;  3ISO A;  4E8H A;  4TXV A;  3ERG A;  2VAF A;  3H8Q A;  2EIQ A;  3TKS E;  2CQ9 A;  4HQZ A;  2YP6 A;  1HYU A;  3EVI A;  4F9Z A;  1MDK A;  2CX3 A;  1K3L A;  1GSF A;  3ZRE A;  4XS6 A;  3TRP A;  2AB6 A;  5J3R A;  4OO4 A;  2XPE A;  2ON5 A;  2HZE A;  3QOU A;  4GCI A;  2RUE A;  2DKI A;  5FHI A;  1F2E A;  5J4V A;  3IK9 A;  2WFC A;  2HSN B;  3ED3 A;  1TJD A;  2FUG 2;  1URM A;  1EV4 A;  2EIO A;  4DSR A;  3IAM 2;  3N5O A;  5D9W A;  4AI6 A;  1PSQ A;  3VUR A;  3EMX A;  1RW1 A;  5IMA A;  3F4R A;  4IBP A;  2LV3 A;  3ERW A;  3EWL A;  4DEJ A;  4WF4 A;  3LFL A;  4PQ1 A;  1IYI A;  1OC9 A;  2HSM B;  5F8B A;  3VLN A;  2H71 A;  3D21 A;  1XOA A;  2B3S A;  5ENU A;  2V2G A;  4WKW A;  3O3T A;  3N9J A;  4JR6 A;  4YQM A;  2LJR A;  2K9F A;  4ZB6 A;  4ZL8 A;  3ME8 A;  2K8V A;  4HZ2 A;  1J08 A;  2CT6 A;  4KH7 A;  3M9J A;  3LXZ A;  4P3Y B;  2VUP A;  2GT6 A;  5AIV A;  1T7P B;  4Q5R A;  2HRF A;  2VM1 A;  2VO4 A;  1GH2 A;  2OT3 A;  4K5R A;  2IMK A;  5E59 A;  2FWH A;  1V9W A;  1XWG A;  1TRV A;  2MZC A;  4BVX B;  1OKD A;  4XRD A;  5ECH B;  5H5Q A;  2NPB A;  4WR4 A;  3L9U A;  2X8C A;  3PIN A;  2QA1 A;  1GNE A;  3CRU A;  2PWJ A;  1PD2 1;  1XXU A;  4YH2 A;  3H93 A;  3SWL A;  2WB9 A;  4OD7 A;  1I5G A;  4PUA A;  1XW6 A;  3CBU A;  3GH9 A;  4EO3 A;  5A4W A;  4TR1 A;  3US3 A;  2MBT A;  2VCT A;  4JE1 A;  3VI5 A;  2TIR A;  2CAQ A;  1XFL A;  3I6A A;  3TOU A;  1ON4 A;  3KP8 A;  4JZQ A;  3MIX A;  3F4S A;  2MBS A;  2WCI A;  2X64 A;  3JCM L;  1CQH A;  2R2J A;  3EMP A;  1F3B A;  2E2M A;  3WT1 A;  5DDL A;  4G0L A;  2GSR A;  3OR5 A;  2AV4 A;  3CXG A;  3ZTL A;  2H1B A;  2HSY A;  4HS1 A;  4PX1 A;  4K6X A;  1BF5 A;  3UVT A;  4QL9 A;  1J0F A;  1G0T A;  2RUF A;  4K7O A;  1QFN A;  2HRA A;  2HQT A;  1SYR A;  2P0G A;  1E6B A;  4NV5 A;  2C1Y A;  1K0B A;  1AW9 A;  5KEJ A;  5A5K A;  2A2S A;  2R0C A;  2ALB A;  1Z7P A;  1Z6M A;  2IN3 A;  3U6V A;  1YKC A;  5KN2 A;  5ECL B;  3TRX A;  2UV8 G;  3GN3 A;  5DAK B;  5A5H A;  5F0G A;  1X5C A;  4TR3 A;  4F2I A;  1AC1 A;  3MSZ A;  3TJJ A;  1GSY A;  1XVW A;  1K0N A;  1YQ1 A;  4BVY B;  4LMV A;  4JED A;  4TXO B;  2PMT A;  4K7N A;  4XHM A;  2IMI A;  5IQY A;  2I81 A;  3O76 A;  4IGJ A;  2BTO T;  4FYU A;  2FA8 A;  3QAV A;  4I6X A;  3MAK A;  4YKG A;  5A34 A;  4K8M A;  1V58 A;  5AN1 A;  3E9J B;  1SEN A;  2H70 A;  2R4V A;  1Z9H A;  3KXO A;  3F63 A;  1SL0 B;  4MK3 A;  4LL1 B;  4J57 E;  3QFA C;  2C0F A;  2VCV A;  3DEX A;  1Z7R A;  1FOH A;  2O89 A;  2HZE B;  4MLY A;  3D5J A;  2VCZ A;  1EEM A;  4IW9 A;  1X0R A;  2VL2 C;  1B9X C;  3CWG A;  2FGX A;  1JHB A;  5L71 A;  1H75 A;  1XWK A;  3IC8 A;  4G2E A;  4E68 A;  4TVE A;  5F06 A;  3HJO A;  1HNA A;  1T4Y A;  1UVZ A;  2E0Q A;  1AQX A;  1JZW A;  2V1M A;  2B7J A;  3APS A;  3IXR A;  5CRW A;  1JLW A;  1PX7 A;  2ZUP A;  1UN2 A;  1OC9 B;  3TKR A;  4AGS A;  4KGI A;  1YF1 A;  4LA1 A;  2K8S A;  3CMI A;  4Z7X A;  1TW9 A;  3A3T A;  2IMD A;  2NVL A;  1LU4 A;  3TKS C;  2BMX A;  2MMZ A;  1UA5 A;  3F3R A;  1XWB A;  2DJJ A;  4J56 E;  4FYC A;  1A2J A;  1XBS A;  1A2L A;  3P90 A;  1YDK A;  5AGY A;  5H5R A;  4L5L A;  3GKM A;  4XS1 A;  2KP1 A;  4TR0 A;  1M2B A;  3E0U A;  2H1D A;  2B5X A;  1M9B A;  3FKF A;  3E3E A;  1WMJ A;  2KHP A;  3HA9 A;  4IJI A;  2XHF A;  3RPP A;  1WPI A;  2VLV A;  4XCS A;  4XTS A;  2X8G A;  2GQM A;  5CRE A;  3ZVJ A;  3FZ4 A;  5KN1 A;  4IVF A;  3VWX A;  4TR1 B;  3A5I A;  3GUS A;  2OKA A;  2HE3 A;  3WYW A;  2DML A;  1Q98 A;  4O32 A;  2WGR A;  2KP2 A;  4GLT A;  3TKQ A;  3KP9 A;  2D2Z A;  7GSS A;  4OWY A;  2G2Q A;  2B5Y A;  4HOJ A;  4XIH A;  4GDF A;  2KLX A;  1YVL A;  4BWS A;  1SJ6 A;  4KDY A;  3KTL A;  3LYK A;  5EY6 A;  1PL1 A;  1HD2 A;  1VGL A;  2PU9 C;  2GSQ A;  2V6K A;  3ZFB A;  4AKI A;  5IOW A;  1J9B A;  1GUM A;  2OBK A;  3S9F A;  3L0H A;  4N10 A;  1GUL A;  4PXO A;  3C1R A;  3WT2 A;  3TUE A;  4KA0 A;  2I1U A;  5IO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...