2FNOA

Crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
239
Chain Sequence
b'HHHMEDGMNTFDLYYWPVPFRGQLIRGILAHCGCSWDEHDVDAIEGLMDCGAEKQPVAFMGPPVLIDRERNFAISQMPAIAIYLGERLDILPATVEGRTLSAKIVNDANDVLDELTLNGGREMWTPEKWQEFVPRLQKWIRIFADTGARNGLSAASGFMLGTEKIGVADIVTAILWTTVADRFPAIKGIIEDTSPIIWGLSRRVVATAPLAALNSKSFEEYGNAYCGGEIEKSLRKVAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGR_pAT_752p
publication title Comparative structural analysis of a novel glutathioneS-transferase (ATU5508) from Agrobacterium tumefaciens at 2.0 A resolution.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transferase
total genus 82
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2fnoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fnoA01
3GN3A 4GF0A 6GSYA 1HNBA 1ZYEA 6GSUA 3BD2A 2HRNA 3FEUA 5COHA 3TJJA 3LORA 3MNGA 1U3IA 2GQKA 1OAZA 3IPZA 3APQA 2L5LA 3ZZXA 1XFLA 2HSMB 2B6MA 1EEMA 2L4QA 4EC0A 2BMXA 3TKRA 2K9FA 1OC9A 3IOSA 2C3QA 2YP6A 2TIRA 1SKSB 2WGRA 1TDIA 2MZCA 1FB6A 3NOFA 2KLXA 3A2XA 5L71A 4E8EA 2WJUA 2C8UA 3TRPA 1T4ZA 4WR5A 4QL7A 5DAKB 1DE2A 1FB0A 2GQMA 2CX4A 5D73A 3TRXA 1K0NA 1F3AA 1U88A 4ZL7A 5ECPB 1YF0A 2JZTA 4POKA 3CXGA 5DALB 5B8BA 3F63A 3IAM2 1B48A 2LRCA 2H1AA 2KOKA 1JZWA 6GSTA 2HRKA 3QAVA 4IGJA 5GZZB 3TJBA 2XHFA 1PX6A 3CYNA 4TR1B 5F07A 3KCMA 3N9JA 2X8GA 1AQWA 4IVFA 3GMFA 1M9BA 5ELGA 2CVDA 3ISOA 2IPAA 4KDUA 2DJ1A 3KD0A 5B8AA 4QQ7A 2YV7A 2VD1A 1VF3A 3BOAA 1XPVA 1F2EA 1FVJA 2PERA 3WD6A 3GKNA 3IE3A 3IHQA 1TP9A 2YPMA 2FA4A 4K6XA 5DDLA 1GLQA 5D9WA 2M72A 2AYTA 2IWTA 2KHPA 2H6XA 5HR2A 3FR9A 3L4NA 3C73A 4OFNA 4EDYA 3D0ZA 1JZOA 5KN0A 4Q5FA 4EO3A 5ECQB 4EE0A 1IYHA 2RIIA 1AQVA 3MAKA 3HZ4A 3CSHA 2TRCP 2DMLA 3GRXA 1K0MA 1URMA 1O6JA 2HSYA 2NBSA 1JLWA 4ZL9A 3QOUA 2KUCA 2K18A 4KA0A 3TJFA 5LCZA 2LJAA 3WT1A 5BMUA 5IQYA 4ZB8A 2IMKA 3U5RE 3ZIJA 4PQHA 2E2MA 2H74A 3RBTA 2WFCA 5F0GA 2H70A 3KGKA 1T7PB 2C0FA 1FAAA 2HRFA 1VF2A 4YAPA 3ZIVA 4Q5NA 2HXKA 2C3NA 4GXZA 5G30A 3PH9A 1YJ6A 1A2JA 2C4JA 2R5GA 2O85A 2CVKA 2RUEA 4MLYA 4WF4A 2OBKA 1K0OA 4XS4B 2C0DA 1R5PA 6GSWA 1JZDA 3M0FA 2YN1A 4ISDA 1V9WA 3QFBC 1UN2A 2L6CA 1EV4A 4DVCA 1TOFA 5FHIA 2VLUA 1XVQA 1E2YA 2DJJA 16GSA 3LQ7A 1A0RP 2A2SA 2WB9A 3LEFA 4ID0A 4PNFA 3UBKA 4I97A 4FH8A 1NHYA 2OJLA 1QFNA 3K8NA 2WCIA 3DD3A 1EWXA 4MH2A 1XW9A 1E6BA 4KDXA 3KXOA 2HQTA 1XWGA 4DSSA 5IOXA 2B7JA 2YWIA 2LQOA 1TK5B 1AC1A 2RUFA 5HFIA 3IBHA 4K7NA 5CRDA 5DVBA 1GSYA 4CHSA 4MZCA 3HA9A 4NV2A 3ZRDA 4KAEA 2BJXA 1PX7A 2JL4A 4G0LA 2YZHA 4KF9A 1QQ2A 1S3DA 1M7TA 4K7OA 3EWLA 3U6VA 5HFGA 3KP9A 5B6NA 3CRUA 1WJKA 3TKSA 4XTSA 2GSSA 5F05A 1Z7RA 4PUFC 1GSSA 3DEXA 2DMMA 4JU5A 2C0EA 1Y25A 3UOMA 4G9HA 1U3AA 1ZMAA 1B4PA 2HZEA 2H8LA 3APSA 2QKEA 4MJEA 1V2AA 1HNAA 4N30A 1GTIA 5GAND 2OE3A 4KB3A 4X43A 2GSTA 4K2DA 1O81A 1PMTA 1VF4A 3DWVA 3MSZA 4MP4A 1PRXA 2CA8A 1GSQA 1FW1A 2LEGA 3ERWA 4F82A 2OADA 4PUAA 3GTUB 5B7CA 4NPBA 1G7EA 1TJDA 4L5OA 3HXSA 4G10A 4LL1B 4L5LA 3VWVA 3D4TA 2VCZA 4OCEA 3I69A 1XWAA 3GNJA 1WE0A 3VI7A 3HYPA 1USBA 2VO4A 2CT6A 3LSZA 5DJMA 4NWYA 4WR4A 3EU3A 4Q5QA 3IAS2 1F37A 19GSA 2IMFA 4GLTA 4BVYB 20GSA 4MF5A 1R5AA 4TXVA 4D73B 5IMZA 1SKWB 2V6KA 1Z6NA 3VWUA 2ON5A 3M8NA 1B4QA 3G7YA 1MDKA 5A4UA 2LUSA 1GWCA 4F2IA 1SD9A 4ECCA 3HVVA 1YDKA 4PX1A 3DGQA 3QAGA 4PNGA 1M0UA 2YOIA 3GV1A 1T1VA 1G0TA 4IW9A 2WRTA 4NHZA 4POMA 4ILFA 3TRQA 1WPIA 2V1MA 2MYGA 1R4WA 2I81A 3DIEA 2F3MA 2OA7A 3P90A 5H5QA 3RHBA 1GTBA 3M1GA 3IDVA 4N10A 2JSYA 4KUNA 3L9UA 1F9MA 2OBIA 4OO5A 3KM6A 5ENUA 3EMXA 2IN3A 1XWKA 2TRXA 4L0UA 1W89A 4ZXGA 1BJXA 5DQSA 2MBSA 4MF7A 5D96A 1WOUA 4ML6A 2HRAA 1V57A 4JR6A 5ECMB 2PVOC 1GNWA 3KTLA 3GHAA 2YZUA 4BVXB 2JZRA 4POBA 4MZBA 1MTCA 3UARA 2HNLA 4MCUA 1WIKA 5G31A 2ES7A 2WZ9A 4HZ4A 5B6MA 1THOA 4K0NA 2IMDA 3ED3A 2H1GA 1DUGA 3G7IA 2FNOA 1KEBA 1O73A 3F9UA 4O7HA 3CTGA 5JWOB 1GRXA 2PBJA 3IK7A 5ELAA 2PMTA 1ST9A 1PQNA 2N5FA 1ML6A 3D22A 3CBUA 5G2ZA 3PPUA 2QSIA 3F4SA 2IMEA 2MMOA 1M9AA 2VL3A 5AGYA 1CQGA 3F0IA 2JZSA 1GTAA 5J4UA 4IBPA 4GTUA 3TKSE 3JCML 2PWJA 1XZOA 1X5CA 5ECIB 5CP1A 3H1NA 4MH3A 5HFKA 3GYKA 5A5KA 3F4RA 3WGDA 4V1Ap 2I1UA 3I6AA 2AJQB 5F8BA 3HVSA 5D9XA 3VPQA 4ZBDA 2HSMA 4K9ZA 3ZITA 1BAYA 2B5XA 4XRDA 2R37A 1ZGNA 4TOPA 1SL1B 3F6DA 5AN1A 2GZPA 4L0WA 3FZ5A 4AJ7A 5GAPD 2R3XA 1H4OA 3D5JA 1K0AA 3GKKA 1OC3A 4OCFA 3NIVA 4HU9A 3C1RA 5DAKA 4AF2A 3QR6A 1SYRA 5IIZA 2DJKA 2LJRA 1PA3A 5CRHA 4FO5A 2L6DA 4JE1A 1ZL9A 2C80A 1ZOFA 5ID2B 5DALA 1XWBA 3TJGA 5IOWA 3I43A 3HVXA 1FHEA 1Z3EA 5G1LA 3IC4A 1YF1A 1ZYQB 5J5NA 2H1BA 4TR1A 3RHCA 2H75A 1EOGA 4F03A 4HZ2A 4BPYA 4YQVA 4OMVA 4LA1A 2X8HA 1K3YA 2E0QA 2LS5A 2NDOA 2C3TA 5ECRB 1AXDA 5J9CA 5CO3A 4NV5A 2IL3A 4GCIA 2LRTA 2FD3A 4OD7A 4POLA 3IC8A 2HFDA 3GX0A 3H4KA 3PGTA 4EF0A 2H6YA 4MJBA 4OFMA 2CAQA 1NW2A 1A24A 3UEMA 2HLSA 3IA1A 3C1SA 8GSSA 3O6TA 1M2AA 4MABA 3UAPA 2H1DA 10GSA 4ULXA 2CQ9A 4BL7B 4OO4A 4Q5RA 4CW9A 3EC3A 1Z5YE 1V98A 1HNCA 2HSHA 3VK9A 4ML1A 6GSXA 4OFTA 2ON7A 1Y6EA 4MJCA 1TRVA 1K0DA 5C04A 2HE3A 1YZXA 3E0UA 1I9DA 3J7Yb 2VCTA 1XW5A 1GUKA 3TGZA 2IMIA 3LXTA 3TCOA 5JCWA 5DCHA 2H01A 3HDCA 1WRYA 3F3RA 2A2RA 3IRAA 2GSRA 3TOTA 3QD9A 3VLNA 1SK0A 3EMPA 3UIWA 1SJ6A 4G19A 3DMLA 1U87A 4KCAA 5CYYA 1JZRA 2FA8A 4XS4A 4TR0A 5ECLB 4FQUA 4PQIA 3ZFBA 3L9SA 4I8BA 5IM9A 2XBQA 4LLRA 4G0KA 5ECOB 1A2MA 4O92A 1Q4JA 4HUAA 3GA4A 1DBYA 4KX4A 4V2MA 2RLIA 3LWAA 1EOHA 4GRFA 5EVOA 1FOVA 4N0VA 3TJKA 5G1KA 5DBQA 3I9V2 4MK3A 1SL2B 1AUCA 3FKFA 3MWHA 1AQXA 1QMVA 2HZFA 3DRNA 3EE2A 1XCCA 4FIWA 3FR3A 3CSJA 3GH6A 2GZZA 5C00A 5HR0A 4HU7A 1LU4A 1W4VA 3GL5A 3RPNA 2LKUA 4USSA 3TKPA 1EP8A 4ACSA 2IJYA 1TKDB 2XPDA 2BTOT 1EGRA 1OYJA 2F8FA 3KIJA 4O5RA 2DC5A 4EXJA 4TKYA 3ZYWA 1T00A 1SJZA 2IFQB 1OKTA 4JZQA 4WBRD 3CRTA 1TRSA 1F3BA 1B8XA 3ZLPA 3LGCA 4I6XA 1DE1A 1K3OA 5D9VA 4IN0A 4YAVA 1GULA 7GSSA 3ZVJD 4AGSA 1BQ7A 1GP1A 4ECBA 2XC2A 4ZL8A 2H73A 3F8UA 1XBSA 2VCXA 3VWWA 1AW9A 1O85A 2WULA 2CX3A 3KP8A 2HSNB 4ZB6A 1OC8A 4N0ZA 4FYUA 3APOA 4JRRA 1GUHA 2JADA 3US3A 1PKZA 4HI7A 3BBYA 3GTUA 3ERFA 4G2EA 4RI6A 5D93A 18GSA 3BJ5A 1ERVA 3VURA 2NVLA 2L5OA 1DSBA 4YQMA 1RQMA 5A4VA 4WXTA 3IV4A 2L57A 1UA5A 1A8YA 3ERGA 1GSDA 4PGTA 2EC4A 1PD21 2PUKC 1FO5A 4BVYA 4GSTA 4EDZA 3KMNA 1GUMA 5CRGA 3GIXA 2P5RA 4RQRA 4D73A 4KH7A 2B5YA 1PKWA 1AAZA 4RUVA 2M80A 3HD5A 4IHUA 3WT2A 5AIVA 2PU9C 4N11A 2V32A 1THXA 3PR8A 2H76A 5F06A 3F4TA 1TTZA 11GSA 3VI5A 2P0GA 1SL0B 2DSAA 1X5DA 1XWCA 2FGXA 1VGLA 5ABRA 4IP1A 1O8XA 1LJRA 3ME7A 2V2GA 4XS1A 5DCGA 5A4WA 5CRWA 2MBTA 2P31A 4KW6A 4F0CA 2PGTA 4EUYA 4K8MA 5GSTA 2VOCA 1X0RA 1A0FA 3FZ9A 1U6TA 3FHKA 1BX9A 1S3AA 2DJ2A 4YQUA 1YKCA 1B9XC 3LJRA 4DSRA 5J3RA 4BVXA 4IELA 2J23A 3KTBA 4TXOB 2DBCA 1RK4A 1WP0A 2C1YA 4XCSA 1AIUA 1MD4A 2WS2A 1XOBA 4MPGA 3LG6A 2R4VA 2YWNA 3KH7A 2B5EA 22GSA 4XHMA 1EZKA 4DSQA 4AJ8A 3VPTA 5D9TA 3W8SA 3KJYA 4JEDA 2LV3A 4KCEA 12GSA 2VCQA 4NAXA 2ALBA 1PGTA 2FWGA 3CMIA 3H79A 2VLVA 3VWXA 2R2JA 2F51A 5ECKB 4HEA2 3SWLA 2VL2C 4TW5A 2L4CA 5DQYA 2H0GA 4TR4A 2J9HA 2VUPA 1FG4A 1RW1A 1YQ1A 2I3YA 1X9MB 2DJ0A 3KH9A 3R2QA 1OE8A 2YCDA 4ZIJA 4HJ2A 1A2LA 4MDCA 3TKQA 1FVKA 4XS6A 2H0IA 1VRSD 1EEJA 4YH2A 2H19A 5EPFA 1G6WA 2G0FA 2JU5A 2AUVA 2Z9SA 1N2AA 4GQFA 4NMUA 3HHVA 1TI3A 4P3YB 1O7UA 1TW9A 2H72A 4FYCA 5IO0A 1TK0B 4IQAA 2FWEA 4ZILA 5H5RA 1ERUA 1T3BA 3MDKA 3A3TA 5FT3A 2ZNMA 3L0HA 4MJAA 2VLTA 5HQPA 4KSMA 3WYWA 1ABAA 1SENA 3ZL5A 1TXXA 2QGVA 2VCWA 3GKMA 2HYXA 1N8JA 5ID2A 4X1UA 3UVTA 2YJ7A 2GLRA 2KP2A 2CZ3A 4E8HA 3IR4A 4NXIA 5ECNB 2VM1A 1GH2A 4K0GA 5CAXA 1Z6MA 3HKRA 1M2BA 5IMFA 4LMVA 1F6MC 3G7JA 4K1FA 1UC7A 1ACVA 4OWYA 1OC9B 4GWRA 1J0FA 4WKWA 2GSQA 2R6KA 2I4AA 2LJKA 2X8CA 3GSTA 3EURA 2KP1A 2AB6A 4ZB9A 3IK9A 1MD3A 4I2UA 4PQ1A 4NHWA 2B1LA 6GSVA 2XBIA 4HJMA 1K3LA 3TOUA 4TVEA 3PINA 5ECHB 2CAIA 1GSFA 1XXUA 3UJ1A 1J9BA 3F6FA 4ZBAA 3J7Yk 1OVNA 2EIRA 3GSSA 2FLSA 2HRKB 3ZMLA 1XOAA 2FCHA 2HI7A 3D21A 2GQLA 1R7HA 3QDNA 3FZAA 1A8LA 2X64A 2YANA 4BL7A 3HZ8A 3AY8A 2OACA 2EIOA 4LL4B 1IYIA 2K8VA 1EV9A 1JFUA 2O8VB 2YWMA 3A2WA 3DVXA 1LBKA 2PN8A 1TU8A 4PTSA 3UBLA 2H66A 3D4MA 5H5SA 2PVQA 1M99A 4XRAA 1XVWA 5G5EA 1Q98A 2GT5A 1JLVA 1S3CA 2V6OA 4BWQA 3ZMKA 2B3SA 3SBCA 2GVPA 2ZCTA 3EINA 4RQXA 3WGXA 2DIZA 5E59A 1K0CA 4K7IA 1TI1A 1KNGA 1OE7A 3UVHA 2EIQA 3Q74A 1H75A 4WBJA 3NZNA 3QAWA 1PL1A 1A23A 2AAWA 1XIYA 2GGTA 4BA7A 4O32A 2G2QA 3FK8A 4WETA 2O87A 1EGOA 13GSA 5CREA 4I5QA 3S9FA 4GSNA 3CTFA 5D8IA 3M3MA 3FY7A 2IIYA 3GKXA 5JCUA 4ECJA 3BCKA 4Z7XA 1ERTA 3RPPA 2P5QA 1HQOA 5JWQB 2FHEA 3WGEA 1WMJA 3C7MA 2I9HA 3RAZA 5KEJA 1NHOA 1BEDA 1OKDA 1ILOA 1NSWA 5IMDA 3LXZA 4J2FA 3O76A 3QCPA 2YWOA 3KZQA 1QXHA 2H71A 1I5GA 1B9YC 2CV4A 2FWFA 3A5WA 1SU9A 2LNSA 1V40A 2YJHA 3O3TA 6GSSA 3D6IA 3HCZA 3DXBA 2UZ8A 3FR6A 3QMXA 4IJIA 4HQZA 5G5FA 1GL8A 2K8SA 3EYTA 2DIYA 4DEJA 4MZWA 1V58A 1VF1A 4WF5A 3H8QA 1YEXA 1SK2A 1ZCPA 2IFQA 3GH9A 2FWHA 1YY7A 1PL2A 1TRUA 2YV9A 4BWSA 5J41A 1X5EA 4PXOA 3RDWA 2JACA 5KN2A 1SJIA 4JR4A 4DSSB 1QGVA 3DYRA 1BG5A 2L59A 3W6GA 4J57E 1Z9HA 4IKHA 2K6VA 2AV4A 3TB2A 5GSSA 4F9ZA 3M9KA 3Q18A 3OR5A 4HS1A 4KGIA 4HDEA 5LNKe 1T8EB 3H93A 1MDIA 4J56E 1M2DA 1JHBA 3M9JA 2REMA 3DVWA 5IPHA 2A4VA 3TKSC 3FZ4A 4V1Ag 3ZTLA 2LSTA 4MPFA 3UMAA 2F8AA 3FRCA 2MMNA 3HY2A 3DKSA 1SD8A 2JSZA 1SYXA 2NPBA 4KNDA 4GSSA 5IMCA 3BCIA 1YKAA 1ZZYA 2OKAA 4V2NA 2HZEB 3ME8A 4XIHA 2D2ZA 4L8EA 3E9JB 2GTUA 2GS3A 1HYUA 4F0BA 3A2VA 1Z7PA 1KBNA 5LD0A 3R3EA 3E3EA 3P2AA 2VCVA 2DJ3A 2E2GA 4QL9A 5KN3A 5AISA 17GSA 4GQCA 3IXRA 2B7KA 2N5AA 4JBBA 2WDUA 4IJ3A 1QK8A 2PPTA 1X9WB 1CQHA 3C8EA 3GFKA 1NM3A 2N5BA 3GX8A 1X9SB 3F3QA 4IP6A 4HOJA 4FYBA 5JWRB 1T4YA 3P8WA 3GUSA 3LFLA 4TRXA 1MDJA 4AJ6A 1G6YA 1UVZA 2MMZA 5IMAA 4IS0A 3QFAC 3KMOA 2OE1A 2GT6A 2CZ2A 3HJMA 4X0XA 1R26A 5KN1A 1BYEA 5AIXA 3UL3A 1ERWA 4IQ1A 5ECSA 3W8JA 3N5OA 2GZYA 1G7OA 3GURA 3G9BA 2RM6A 2LQQA 2X99A 1K0BA 5DJLA 5HR1A 5FWGA 5CNWA 2B1KA 2AHEA 4TR3A 2LNTA 4I2TA 4KDYA 2E7PA 3ZREA 2O89A 3ZVJA 4ZBBA 1TU7A 4TXOA 2LTKA 4HQSA 3Q6OA 3L9VA 2XPEA 3Q19A 1TRWA 2VIMA 3HJPA 2VAFA 3VFIA 2QC7A 4EKZA 1PSQA 5IO2A 4MMMA 3LYPA 2VD0A 1GNEA 2ZUPA 1GSEA 5EY6A 2H0HA 4MF6A 1C72A 3EU4A 5INYA 1PN9A 2FUG2 2OE0A 3EVIA 5HR3A 3CSIA 3FW2A 1KTEA 2F9SA 1XW6A 5IMVA 3V1WA 2H6ZA 4EVMA 3HJOA 4H86A 3L78A 2VL2A 2MMAA 1HD2A 2RM5A 1MEKA 4PURA 3GL3A 1SKRB 3QPMA 2CVBA 1GSUA 3KEBA 2C0GA 4CDOA 5IPGA 2VL9A 2GDRA 3P7XA 5E4WA 1GLPA 4MA9A 1J08A 2O7KA 4EL1A 1YEPA 1ON4A 2H30A 5J9BA 1O8WA 1GTUA 1EP7A 2VM2A 4TN8A 4WEYA 3LYKA 9GSSA 3TDGA 3C71A 1SK1A 2HT9A 5EL8A 5JCGA 4KE3A 3TUEA 4RI7A 4G0IA 2FY6A 4LMWA 2M46A 2NTOA 3ZFLA 4V2LA 14GSA 1WWJA 3FYGA 2LRNA 2YNXA 4KSOA 1TK8B 2DLXA 4ECIA 1QUWA 2V41A
chains in the Genus database with same CATH superfamily
3GN3A 4GF0A 6GSYA 1HNBA 1ZYEA 2DKIA 3FMWA 6GSUA 3BD2A 2HRNA 3FEUA 5COHA 3TJJA 3LORA 3MNGA 1U3IA 2GQKA 1OAZA 3IPZA 3APQA 2L5LA 3ZZXA 1XFLA 2HSMB 2B6MA 1EEMA 2L4QA 4EC0A 2BMXA 3TKRA 2K9FA 1OC9A 3IOSA 2C3QA 2YP6A 2TIRA 1SKSB 2WGRA 1TDIA 2MZCA 1FB6A 2A2PA 3NOFA 2KLXA 3A2XA 5L71A 4E8EA 2WJUA 2C8UA 3TRPA 1T4ZA 4WR5A 4QL7A 5DAKB 1DE2A 1FB0A 2GQMA 2CX4A 5D73A 3TRXA 1K0NA 1F3AA 4QMKA 1U88A 4ZL7A 5ECPB 1YF0A 2JZTA 4POKA 3CXGA 5DALB 5B8BA 3F63A 4K2XA 3IAM2 2WVXA 1B48A 2LRCA 2H1AA 2KOKA 1JZWA 1SVLA 6GSTA 2HRKA 3QAVA 4IGJA 5GZZB 3TJBA 2XHFA 1PX6A 3CYNA 4TR1B 5F07A 3KCMA 3N9JA 2X8GA 1AQWA 4IVFA 3GMFA 1M9BA 5ELGA 2CVDA 3ISOA 2IPAA 4KDUA 1TXUA 2DJ1A 3KD0A 5B8AA 4QQ7A 2YV7A 2VD1A 1VF3A 3BOAA 1XPVA 1F2EA 1FVJA 2PERA 3WD6A 3GKNA 3IE3A 3IHQA 1TP9A 2YPMA 2FA4A 4K6XA 5DDLA 1GLQA 5D9WA 2M72A 2AYTA 2IWTA 2KHPA 2H6XA 5HR2A 3FR9A 3L4NA 4N3ZA 3C73A 4OFNA 4EDYA 3D0ZA 2EFDA 1JZOA 5KN0A 4Q5FA 4EO3A 5ECQB 4EE0A 1IYHA 2RIIA 1AQVA 3MAKA 3HZ4A 3CSHA 4AKIA 2TRCP 2DMLA 3GRXA 1K0MA 1URMA 1O6JA 2HSYA 2NBSA 1JLWA 4ZL9A 4G01A 3QOUA 2KUCA 2K18A 4KA0A 3TJFA 5LCZA 2LJAA 3WT1A 5BMUA 5IQYA 4ZB8A 2IMKA 3U5RE 3ZIJA 2WW1A 4PQHA 2E2MA 2H74A 3RBTA 2WFCA 5F0GA 2H70A 3KGKA 1T7PB 2C0FA 1FAAA 2HRFA 1VF2A 4YAPA 3ZIVA 4Q5NA 2HXKA 2C3NA 4GXZA 5G30A 3PH9A 1YJ6A 1A2JA 2C4JA 2R5GA 5A1NB 2O85A 2CVKA 2RUEA 4MLYA 4WF4A 2OBKA 1K0OA 4XS4B 2C0DA 1R5PA 6GSWA 1JZDA 3M0FA 2YN1A 4ISDA 1V9WA 3QFBC 4AKHA 1UN2A 2L6CA 1EV4A 4DVCA 1TOFA 5FHIA 5J4YA 2VLUA 1XVQA 1E2YA 2DJJA 16GSA 3LQ7A 1A0RP 2A2SA 2WB9A 3LEFA 4ID0A 4PNFA 3UBKA 4I97A 4FH8A 1NHYA 2OJLA 1QFNA 3K8NA 2WCIA 3DD3A 1EWXA 4MH2A 1XW9A 1E6BA 4KDXA 3KXOA 2HQTA 1XWGA 4DSSA 5IOXA 2B7JA 2YWIA 2LQOA 1TK5B 1AC1A 2RUFA 5HFIA 3LW9A 3IBHA 4K7NA 5CRDA 5DVBA 1GSYA 4CHSA 4MZCA 3HA9A 4NV2A 3ZRDA 4KAEA 2BJXA 1PX7A 2JL4A 4G0LA 2YZHA 4KF9A 1QQ2A 1S3DA 1M7TA 4K7OA 3EWLA 3U6VA 5HFGA 3KP9A 5B6NA 3CRUA 4Z2TA 1WJKA 3TKSA 4XTSA 2GSSA 5F05A 1Z7RA 4PUFC 1GSSA 3DEXA 2DMMA 4JU5A 2C0EA 1Y25A 3UOMA 4G9HA 1U3AA 2QA2A 1ZMAA 1B4PA 2HZEA 2H8LA 3APSA 2QKEA 4MJEA 1V2AA 1HNAA 4N30A 2WZSA 1GTIA 5GAND 2OE3A 4KB3A 4X43A 2GSTA 4K2DA 1O81A 1PMTA 1VF4A 3DWVA 3MSZA 2H1LA 4MP4A 1PRXA 2CA8A 1GSQA 1FW1A 2LEGA 3ERWA 4F82A 2OADA 4PUAA 3GTUB 5B7CA 4NPBA 1G7EA 1TJDA 4L5OA 3HXSA 1PFOA 4G10A 4LL1B 4L5LA 3VWVA 3D4TA 2VCZA 4OCEA 3I69A 1XWAA 3GNJA 3MYDA 1WE0A 2QA1A 3VI7A 3HYPA 1USBA 2VO4A 2CT6A 3LSZA 5DJMA 4NWYA 4WR4A 3EU3A 4Q5QA 5J40A 1F37A 3IAS2 19GSA 2IMFA 4GLTA 4BVYB 20GSA 4MF5A 1R5AA 4TXVA 4D73B 5IMZA 1SKWB 2V6KA 1Z6NA 3VWUA 2ON5A 3M8NA 1B4QA 3G7YA 1MDKA 5A4UA 2LUSA 1GWCA 4F2IA 1SD9A 4BIKA 4ECCA 3HVVA 1YDKA 4PX1A 2WW3A 3DGQA 3QAGA 4PNGA 1M0UA 2YOIA 3GV1A 1T1VA 1G0TA 4A5PA 4IW9A 2WRTA 4NHZA 4POMA 4ILFA 3TRQA 1WPIA 2V1MA 2MYGA 1R4WA 2I81A 3DIEA 2F3MA 2OA7A 5A5HB 4AKGA 3P90A 5H5QA 3RHBA 1GTBA 3M1GA 3IDVA 4N10A 2JSYA 4KUNA 3L9UA 1F9MA 4CY6A 2OBIA 4OO5A 3KM6A 5ENUA 3EMXA 2IN3A 1XWKA 2TRXA 4L0UA 1W89A 4ZXGA 1BJXA 5DQSA 2MBSA 4MF7A 5D96A 1WOUA 4ML6A 2HRAA 1V57A 4JR6A 5ECMB 2PVOC 1GNWA 3KTLA 1BF5A 3GHAA 2YZUA 4BVXB 2JZRA 4POBA 4MZBA 1MTCA 5A34A 3UARA 2HNLA 4MCUA 1WIKA 1N25A 5G31A 4O5UA 2ES7A 2WZ9A 4HZ4A 5B6MA 1THOA 4K0NA 2IMDA 3ED3A 2H1GA 1DUGA 3G7IA 2FNOA 1KEBA 1O73A 3F9UA 4O7HA 4Z2UA 3CTGA 5JWOB 1GRXA 2PBJA 4FXYP 3IK7A 5ELAA 2PMTA 1ST9A 1PQNA 2N5FA 1ML6A 3D22A 3CBUA 5G2ZA 3PPUA 2QSIA 3F4SA 2IMEA 2MMOA 1M9AA 2VL3A 5AGYA 1CQGA 3F0IA 2JZSA 1GTAA 5J4UA 4IBPA 4GTUA 3TKSE 3JCML 2PWJA 2R0GA 1XZOA 1X5CA 5ECIB 5CP1A 3H1NA 4MH3A 5HFKA 3GYKA 5A5KA 3F4RA 3WGDA 4V1Ap 2I1UA 3I6AA 2O3EA 2AJQB 5F8BA 3HVSA 5D9XA 3VPQA 4ZBDA 2HSMA 2O36A 4K9ZA 3ZITA 1BAYA 2B5XA 4XRDA 2R37A 1I1IP 1ZGNA 4TOPA 1SL1B 3F6DA 5AN1A 2GZPA 4L0WA 3FZ5A 4AJ7A 5GAPD 3CWGA 2R3XA 1H4OA 3D5JA 1K0AA 3GKKA 1OC3A 4OCFA 3NIVA 4HU9A 3C1RA 5DAKA 4AF2A 3QR6A 1SYRA 5IIZA 2DJKA 2LJRA 4Z2RA 1PA3A 2OT3A 5CRHA 4FO5A 2L6DA 4JE1A 1ZL9A 2C80A 1ZOFA 5ID2B 5DALA 1XWBA 3TJGA 5IOWA 3I43A 3HVXA 1FHEA 1Z3EA 5G1LA 2R0CA 3IC4A 1YF1A 1ZYQB 5J5NA 2H1BA 4TR1A 3RHCA 2H75A 1EOGA 4F03A 4HZ2A 4PHZC 4BPYA 4YQVA 4OMVA 4LA1A 2X8HA 1S4BP 1K3YA 2E0QA 2LS5A 2NDOA 2C3TA 5ECRB 1AXDA 5J9CA 5CO3A 4NV5A 2IL3A 4GCIA 2LRTA 2FD3A 4OD7A 4POLA 3IC8A 2HFDA 3GX0A 3H4KA 3PGTA 4K5SA 4EF0A 2H6YA 4MJBA 4OFMA 2CAQA 1NW2A 1A24A 3UEMA 2HLSA 3IA1A 3C1SA 8GSSA 3O6TA 1M2AA 4MABA 3UAPA 2H1DA 10GSA 4ULXA 2CQ9A 4BL7B 4OO4A 4Q5RA 4CW9A 3EC3A 1Z5YE 1V98A 1HNCA 2HSHA 3VK9A 4ML1A 6GSXA 4OFTA 2ON7A 1Y6EA 4MJCA 4O5QA 1TRVA 1K0DA 5C04A 2HE3A 1YZXA 3E0UA 1I9DA 3RFRC 3J7Yb 4EIPA 2VCTA 1XW5A 1GUKA 1YEWC 3TGZA 4ICYA 2IMIA 3LXTA 3TCOA 5JCWA 5DCHA 2H01A 3HDCA 1WRYA 3F3RA 2A2RA 3IRAA 2GSRA 3TOTA 3QD9A 3HMJG 3VLNA 1SK0A 3EMPA 3UIWA 5A1NA 1SJ6A 4G19A 3DMLA 1U87A 4KCAA 5CYYA 1JZRA 2FA8A 4XS4A 4TR0A 5ECLB 4FQUA 4PQIA 3ZFBA 3L9SA 4I8BA 5IM9A 2XBQA 4LLRA 4G0KA 5ECOB 1A2MA 4O92A 1Q4JA 4HUAA 3GA4A 1DBYA 4KX4A 4V2MA 2RLIA 3LWAA 1EOHA 4GRFA 5EVOA 1FOVA 4N0VA 3TJKA 5G1KA 5DBQA 3I9V2 4MK3A 1SL2B 1AUCA 3FKFA 3MWHA 1AQXA 1QMVA 2HZFA 3DRNA 3EE2A 1XCCA 4FIWA 3FR3A 3CSJA 3GH6A 2WVYA 2GZZA 5C00A 5HR0A 4HU7A 1LU4A 1W4VA 3GL5A 3RPNA 2LKUA 4USSA 3TKPA 1EP8A 4ACSA 2IJYA 1TKDB 2XPDA 2BTOT 1EGRA 1OYJA 2F8FA 3KIJA 4O5RA 2DC5A 4EXJA 4TKYA 3ZYWA 1T00A 1SJZA 2IFQB 1OKTA 4JZQA 4WBRD 3CRTA 1TRSA 1F3BA 1B8XA 3A5IA 3ZLPA 3LGCA 4I6XA 1DE1A 5J47A 1K3OA 5D9VA 4IN0A 4YAVA 1GULA 4YKGA 7GSSA 3ZVJD 4X4JA 4AGSA 4GDFA 1BQ7A 1GP1A 4ECBA 2XC2A 4ZL8A 2H73A 3F8UA 1XBSA 2VCXA 3VWWA 1AW9A 1O85A 2VKZG 2WULA 2CX3A 3KP8A 2HSNB 4ZB6A 1OC8A 4N0ZA 4FYUA 3APOA 4JRRA 1GUHA 2JADA 3US3A 1PKZA 4HI7A 3BBYA 3GTUA 3ERFA 4G2EA 4RI6A 5D93A 18GSA 3BJ5A 1ERVA 3VURA 2NVLA 2L5OA 1DSBA 4YQMA 1RQMA 5A4VA 4WXTA 3IV4A 2L57A 1UA5A 1A8YA 3ERGA 1GSDA 4PGTA 2EC4A 1PD21 2PUKC 1FO5A 4BVYA 4GSTA 4EDZA 3KMNA 1GUMA 5CRGA 3GIXA 2P5RA 4RQRA 4D73A 4KH7A 2B5YA 1PKWA 1AAZA 4RUVA 5KOXA 2M80A 3HD5A 4IHUA 3WT2A 5AIVA 2PU9C 4N11A 2V32A 1THXA 3PR8A 2H76A 5F06A 3F4TA 1TTZA 11GSA 3VI5A 2P0GA 1SL0B 2DSAA 1X5DA 1XWCA 2FGXA 1VGLA 5ABRA 4IP1A 1O8XA 1LJRA 3ME7A 2V2GA 4XS1A 5DCGA 5A5HA 5A4WA 5CRWA 2MBTA 2P31A 4KW6A 4F0CA 2PGTA 4EUYA 4K8MA 5GSTA 2VOCA 1X0RA 1A0FA 3FZ9A 1U6TA 3FHKA 1BX9A 1S3AA 2DJ2A 4YQUA 1YKCA 1B9XC 3LJRA 4DSRA 5J3RA 4AI6A 2X49A 4BVXA 1PN0A 5J4VA 4IELA 2J23A 3KTBA 4TXOB 2DBCA 1RK4A 1WP0A 2C1YA 4XCSA 1AIUA 1MD4A 2WS2A 1XOBA 4MPGA 3LG6A 2R4VA 2YWNA 3KH7A 2B5EA 22GSA 4XHMA 1EZKA 4DSQA 4CY8A 4AJ8A 3VPTA 5D9TA 3W8SA 2EFCA 3KJYA 4JEDA 2LV3A 4KCEA 12GSA 2VCQA 4NAXA 2ALBA 1PGTA 2FWGA 3CMIA 3H79A 2VLVA 3VWXA 2R2JA 2F51A 5ECKB 4HEA2 3SWLA 2VL2C 4TW5A 2L4CA 5DQYA 2H0GA 4MNNA 4TR4A 2J9HA 2VUPA 1FG4A 1RW1A 1YQ1A 2I3YA 1X9MB 2DJ0A 3KH9A 3R2QA 1OE8A 2YCDA 4ZIJA 4HJ2A 1A2LA 4MDCA 3TKQA 1FVKA 2DKHA 4XS6A 2H0IA 1VRSD 1EEJA 4YH2A 2H19A 5EPFA 1G6WA 2G0FA 2JU5A 2AUVA 2Z9SA 1N2AA 4GQFA 4NMUA 3HHVA 1TI3A 4P3YB 1O7UA 1TW9A 2H72A 4FYCA 5IO0A 1TK0B 4IQAA 2FWEA 4ZILA 5H5RA 1ERUA 1T3BA 3MDKA 3A3TA 5FT3A 2ZNMA 3L0HA 4MJAA 2WW0A 2VLTA 5HQPA 4KSMA 3WYWA 1ABAA 1SENA 3ZL5A 1TXXA 2QGVA 2VCWA 3GKMA 2HYXA 1N8JA 5ID2A 4X1UA 3UVTA 2YJ7A 2GLRA 2KP2A 2CZ3A 4E8HA 3IR4A 4NXIA 5ECNB 2VM1A 1GH2A 4K0GA 5CAXA 1Z6MA 3HKRA 1M2BA 5IMFA 4LMVA 1F6MC 3G7JA 4K1FA 1UC7A 1ACVA 4OWYA 1OC9B 4GWRA 1J0FA 4WKWA 2GSQA 2R6KA 2I4AA 2LJKA 2X8CA 3GSTA 3EURA 2KP1A 2AB6A 4ZB9A 3IK9A 1MD3A 4I2UA 4PQ1A 2XBIA 4NHWA 6GSVA 2B1LA 1M3IA 4HJMA 1K3LA 2A4HA 3TOUA 4TVEA 3PINA 5ECHB 2CAIA 1GSFA 1XXUA 3UJ1A 1J9BA 3F6FA 4ZBAA 3J7Yk 1OVNA 2WVXB 2EIRA 3GSSA 2FLSA 2HRKB 3ZMLA 1XOAA 2FCHA 2HI7A 3D21A 2GQLA 1R7HA 3QDNA 3FZAA 1A8LA 2X64A 2YANA 4BL7A 3HZ8A 3AY8A 2OACA 2EIOA 4LL4B 3MIXA 1IYIA 2K8VA 1EV9A 1JFUA 2O8VB 2YWMA 3A2WA 3DVXA 1LBKA 2PN8A 1TU8A 4PTSA 3UBLA 2H66A 3D4MA 5H5SA 2PVQA 1M99A 4XRAA 1XVWA 1M3JA 5G5EA 1Q98A 2WVZA 1S3RA 2GT5A 1JLVA 1S3CA 2V6OA 4BWQA 3ZMKA 2B3SA 3SBCA 2GVPA 2ZCTA 3EINA 4RQXA 3WGXA 2DIZA 5E59A 1K0CA 4K7IA 1TI1A 1KNGA 1OE7A 3UVHA 2EIQA 3Q74A 1H75A 4WBJA 3NZNA 3QAWA 1PL1A 5BMUB 1A23A 2AAWA 1XIYA 2GGTA 4BA7A 4O32A 2G2QA 3FK8A 4WETA 2O87A 1EGOA 13GSA 5CREA 4I5QA 3S9FA 4GSNA 3CTFA 5D8IA 3M3MA 3FY7A 2IIYA 3GKXA 5JCUA 4ECJA 3BCKA 4Z7XA 1ERTA 3RPPA 2P5QA 1HQOA 5JWQB 2FHEA 3WGEA 1WMJA 4HSCX 3C7MA 1YVLA 2I9HA 4YKFA 3RAZA 5KEJA 1NHOA 1BEDA 1OKDA 1ILOA 1NSWA 5IMDA 3LXZA 4J2FA 2EFHA 3O76A 3QCPA 2YWOA 3KZQA 1QXHA 2H71A 1I5GA 1B9YC 2CV4A 2FWFA 3A5WA 1SU9A 2LNSA 1V40A 2YJHA 3O3TA 6GSSA 3D6IA 3HCZA 3DXBA 2UZ8A 3FR6A 4AKXB 3QMXA 4IJIA 4HQZA 5G5FA 4EIQA 1GL8A 2K8SA 1ZYNA 3EYTA 2DIYA 4DEJA 4MZWA 1V58A 1VF1A 4WF5A 3H8QA 1YEXA 1SK2A 1ZCPA 2IFQA 3GH9A 2FWHA 1SVMA 1YY7A 1PL2A 1TRUA 2YV9A 4BWSA 5J41A 1X5EA 1Y1UA 4PXOA 3RDWA 2JACA 5KN2A 1SJIA 4JR4A 4DSSB 1QGVA 3DYRA 1BG5A 2L59A 3W6GA 4J57E 1Z9HA 4IKHA 2K6VA 2AV4A 3TB2A 5GSSA 4F9ZA 3M9KA 3Q18A 3OR5A 4HS1A 4KGIA 4HDEA 5LNKe 5BRTA 1T8EB 3H93A 1MDIA 4J56E 1M2DA 2HSNA 3EPTA 1JHBA 3M9JA 2REMA 3DVWA 5IPHA 2UV8G 2A4VA 3TKSC 3FZ4A 4V1Ag 3ZTLA 2LSTA 4MPFA 4ZB7A 3UMAA 2F8AA 3FRCA 2MMNA 3HY2A 3DKSA 1SD8A 2JSZA 1SYXA 2NPBA 4KNDA 4GSSA 5IMCA 3BCIA 1YKAA 1ZZYA 2OKAA 4V2NA 2HZEB 3ME8A 4XIHA 2D2ZA 4L8EA 3E9JB 2GTUA 2GS3A 1HYUA 4F0BA 3A2VA 1Z7PA 1KBNA 5LD0A 3R3EA 1XG8A 3E3EA 3P2AA 2VCVA 2DJ3A 2E2GA 4PI0C 4QL9A 5KN3A 5AISA 17GSA 4GQCA 3IXRA 2B7KA 2N5AA 4JBBA 2WDUA 4IJ3A 1QK8A 2PPTA 1X9WB 1CQHA 3C8EA 3GFKA 4W66A 1NM3A 2N5BA 3GX8A 1X9SB 3F3QA 4IP6A 4HOJA 4FYBA 5JWRB 1T4YA 3P8WA 3GUSA 3LFLA 3TU3B 4TRXA 3RGBC 1MDJA 4AJ6A 1G6YA 1UVZA 2MMZA 5IMAA 4IS0A 2O5VA 3QFAC 2EFEA 3KMOA 3HVNA 2OE1A 2GT6A 2CZ2A 3HJMA 4X0XA 1R26A 5KN1A 1BYEA 5AIXA 3UL3A 1ERWA 4IQ1A 5ECSA 3W8JA 3N5OA 2GZYA 1G7OA 3GURA 3G9BA 2RM6A 2LQQA 2X99A 1K0BA 5DJLA 5HR1A 5FWGA 5CNWA 3CQFA 2B1KA 2AHEA 4TR3A 2LNTA 4I2TA 4KDYA 2E7PA 3ZREA 2O89A 3ZVJA 4ZBBA 1TU7A 4TXOA 2LTKA 4HQSA 3Q6OA 3L9VA 2XPEA 3Q19A 1TRWA 2WW2A 2R0PA 2VIMA 3HJPA 2VAFA 3VFIA 2QC7A 4EKZA 4K5RA 1PSQA 5IO2A 4MMMA 3LYPA 2VD0A 1GNEA 2ZUPA 1GSEA 5EY6A 2H0HA 4MF6A 1C72A 3EU4A 4E68A 5INYA 1PN9A 2FUG2 5KOWA 1ZYPA 2OE0A 3EVIA 1BG1A 5HR3A 3CSIA 3FW2A 2X4AA 1KTEA 2F9SA 1XW6A 5IMVA 3V1WA 2H6ZA 4EVMA 3HJOA 4H86A 3L78A 3CHXC 2VL2A 2MMAA 1HD2A 2RM5A 1MEKA 4PURA 3GL3A 5A34B 1SKRB 3QPMA 2CVBA 1GSUA 3KEBA 4PI2C 2C0GA 4CDOA 1SVOA 5IPGA 2VL9A 2GDRA 3P7XA 3IHGA 5E4WA 1GLPA 4MA9A 1J08A 2O7KA 4EL1A 1YEPA 1ON4A 2H30A 5J9BA 1O8WA 1GTUA 1EP7A 2VM2A 4TN8A 4WEYA 3LYKA 9GSSA 3TDGA 3C71A 1SK1A 2HT9A 5EL8A 5JCGA 4KE3A 3TUEA 4RI7A 4G0IA 2FY6A 4LMWA 2M46A 2NTOA 1FOHA 3ZFLA 4V2LA 14GSA 1WWJA 3FYGA 2LRNA 2YNXA 4KSOA 1TK8B 2DLXA 4ECIA 1QUWA 2V41A
chains in the Genus database with same CATH topology
3GN3A 4GF0A 6GSYA 1HNBA 1ZYEA 2DKIA 3FMWA 6GSUA 3BD2A 2HRNA 3FEUA 5COHA 3TJJA 3LORA 3MNGA 1U3IA 2GQKA 1OAZA 3IPZA 3APQA 2L5LA 3ZZXA 1XFLA 2HSMB 2B6MA 1EEMA 2L4QA 4EC0A 2BMXA 3TKRA 2K9FA 1OC9A 3IOSA 2C3QA 2YP6A 2TIRA 1SKSB 2WGRA 1TDIA 2MZCA 1FB6A 2A2PA 3NOFA 2KLXA 3A2XA 5L71A 4E8EA 2WJUA 2C8UA 3TRPA 1T4ZA 4WR5A 4QL7A 5DAKB 1DE2A 1FB0A 2GQMA 2CX4A 5D73A 3TRXA 1K0NA 1F3AA 4QMKA 1U88A 4ZL7A 5ECPB 1YF0A 2JZTA 4POKA 3CXGA 5DALB 5B8BA 3F63A 4K2XA 3IAM2 1B48A 2LRCA 2H1AA 2KOKA 1JZWA 1SVLA 6GSTA 2HRKA 3QAVA 4IGJA 5GZZB 3TJBA 2XHFA 1PX6A 3CYNA 4TR1B 5F07A 3KCMA 3N9JA 2X8GA 1AQWA 4IVFA 3GMFA 1M9BA 5ELGA 2CVDA 3ISOA 2IPAA 4KDUA 1TXUA 2DJ1A 3KD0A 5B8AA 4QQ7A 2YV7A 2VD1A 1VF3A 3BOAA 1XPVA 1F2EA 1FVJA 2PERA 3WD6A 3GKNA 3IE3A 3IHQA 1TP9A 2YPMA 2FA4A 4K6XA 5DDLA 1GLQA 5D9WA 2M72A 2AYTA 2IWTA 2KHPA 2H6XA 5HR2A 3FR9A 3L4NA 4N3ZA 3C73A 4OFNA 4EDYA 3D0ZA 2EFDA 1JZOA 5KN0A 4Q5FA 4EO3A 5ECQB 4EE0A 1IYHA 2RIIA 1AQVA 3MAKA 3HZ4A 3CSHA 4AKIA 2TRCP 2DMLA 3GRXA 1K0MA 1URMA 1O6JA 2HSYA 2NBSA 1JLWA 4ZL9A 4G01A 3QOUA 2KUCA 2K18A 4KA0A 3TJFA 5LCZA 2LJAA 3WT1A 5BMUA 5IQYA 4ZB8A 2IMKA 3U5RE 3ZIJA 4PQHA 2E2MA 2H74A 3RBTA 2WFCA 5F0GA 2H70A 3KGKA 1T7PB 2C0FA 1FAAA 2HRFA 1VF2A 4YAPA 3ZIVA 4Q5NA 2HXKA 2C3NA 4GXZA 5G30A 3PH9A 1YJ6A 1A2JA 2C4JA 2R5GA 5A1NB 2O85A 2CVKA 2RUEA 4MLYA 4WF4A 2OBKA 1K0OA 4XS4B 2C0DA 1R5PA 6GSWA 1JZDA 3M0FA 2YN1A 4ISDA 1V9WA 3QFBC 4AKHA 1UN2A 2L6CA 1EV4A 4DVCA 1TOFA 5FHIA 5J4YA 2VLUA 1XVQA 1E2YA 2DJJA 16GSA 3LQ7A 1A0RP 2A2SA 2WB9A 3LEFA 4ID0A 4PNFA 3UBKA 4I97A 4FH8A 1NHYA 2OJLA 1QFNA 3K8NA 2WCIA 3DD3A 1EWXA 4MH2A 1XW9A 1E6BA 4KDXA 3KXOA 2HQTA 1XWGA 4DSSA 5IOXA 2B7JA 2YWIA 2LQOA 1TK5B 1AC1A 2RUFA 5HFIA 3LW9A 3IBHA 4K7NA 5CRDA 5DVBA 1GSYA 4CHSA 4MZCA 3HA9A 4NV2A 3ZRDA 4KAEA 2BJXA 1PX7A 2JL4A 4G0LA 2YZHA 4KF9A 1QQ2A 1S3DA 1M7TA 4K7OA 3EWLA 3U6VA 5HFGA 3KP9A 5B6NA 3CRUA 4Z2TA 1WJKA 3TKSA 4XTSA 2GSSA 5F05A 1Z7RA 4PUFC 1GSSA 3DEXA 2DMMA 4JU5A 2C0EA 1Y25A 3UOMA 4G9HA 1U3AA 2QA2A 1ZMAA 1B4PA 2HZEA 2H8LA 3APSA 2QKEA 4MJEA 1V2AA 1HNAA 4N30A 1GTIA 5GAND 2OE3A 4KB3A 4X43A 2GSTA 4K2DA 1O81A 1PMTA 1VF4A 3DWVA 3MSZA 2H1LA 4MP4A 1PRXA 2CA8A 1GSQA 1FW1A 2LEGA 3ERWA 4F82A 2OADA 4PUAA 3GTUB 5B7CA 4NPBA 1G7EA 1TJDA 4L5OA 3HXSA 4G10A 4LL1B 4L5LA 3VWVA 3D4TA 2VCZA 4OCEA 3I69A 1XWAA 3GNJA 3MYDA 1WE0A 2QA1A 3VI7A 3HYPA 1USBA 2VO4A 2CT6A 3LSZA 5DJMA 4NWYA 4WR4A 3EU3A 4Q5QA 5J40A 1F37A 3IAS2 19GSA 2IMFA 4GLTA 4BVYB 20GSA 4MF5A 1R5AA 4TXVA 4D73B 5IMZA 1SKWB 2V6KA 1Z6NA 3VWUA 2ON5A 3M8NA 1B4QA 3G7YA 1MDKA 5A4UA 2LUSA 1GWCA 4F2IA 1SD9A 4ECCA 3HVVA 1YDKA 4PX1A 3DGQA 3QAGA 4PNGA 1M0UA 2YOIA 3GV1A 1T1VA 1G0TA 4A5PA 4IW9A 2WRTA 4NHZA 4POMA 4ILFA 3TRQA 1WPIA 2V1MA 2MYGA 1R4WA 2I81A 3DIEA 2F3MA 2OA7A 5A5HB 4AKGA 3P90A 5H5QA 3RHBA 1GTBA 3M1GA 3IDVA 4N10A 2JSYA 4KUNA 3L9UA 1F9MA 4CY6A 2OBIA 4OO5A 3KM6A 5ENUA 3EMXA 2IN3A 1XWKA 2TRXA 4L0UA 1W89A 4ZXGA 1BJXA 5DQSA 2MBSA 4MF7A 5D96A 1WOUA 4ML6A 2HRAA 1V57A 4JR6A 5ECMB 2PVOC 1GNWA 3KTLA 1BF5A 3GHAA 2YZUA 4BVXB 2JZRA 4POBA 4MZBA 1MTCA 5A34A 3UARA 2HNLA 4MCUA 1WIKA 1N25A 5G31A 4O5UA 2ES7A 2WZ9A 4HZ4A 5B6MA 1THOA 4K0NA 2IMDA 3ED3A 2H1GA 1DUGA 3G7IA 2FNOA 1KEBA 1O73A 3F9UA 4O7HA 4Z2UA 3CTGA 5JWOB 1GRXA 2PBJA 3IK7A 5ELAA 2PMTA 1ST9A 1PQNA 2N5FA 1ML6A 3D22A 3CBUA 5G2ZA 3PPUA 2QSIA 3F4SA 2IMEA 2MMOA 1M9AA 2VL3A 5AGYA 1CQGA 3F0IA 2JZSA 1GTAA 5J4UA 4IBPA 4GTUA 3TKSE 3JCML 2PWJA 2R0GA 1XZOA 1X5CA 5ECIB 5CP1A 3H1NA 4MH3A 5HFKA 3GYKA 5A5KA 3F4RA 3WGDA 4V1Ap 2I1UA 3I6AA 2AJQB 5F8BA 3HVSA 5D9XA 3VPQA 4ZBDA 2HSMA 4K9ZA 3ZITA 1BAYA 2B5XA 4XRDA 2R37A 1ZGNA 4TOPA 1SL1B 3F6DA 5AN1A 2GZPA 4L0WA 3FZ5A 4AJ7A 5GAPD 3CWGA 2R3XA 1H4OA 3D5JA 1K0AA 3GKKA 1OC3A 4OCFA 3NIVA 4HU9A 3C1RA 5DAKA 4AF2A 3QR6A 1SYRA 5IIZA 2DJKA 2LJRA 4Z2RA 1PA3A 2OT3A 5CRHA 4FO5A 2L6DA 4JE1A 1ZL9A 2C80A 1ZOFA 5ID2B 5DALA 1XWBA 3TJGA 5IOWA 3I43A 3HVXA 1FHEA 1Z3EA 5G1LA 2R0CA 3IC4A 1YF1A 1ZYQB 5J5NA 2H1BA 4TR1A 3RHCA 2H75A 1EOGA 4F03A 4HZ2A 4BPYA 4YQVA 4OMVA 4LA1A 2X8HA 1K3YA 2E0QA 2LS5A 2NDOA 2C3TA 5ECRB 1AXDA 5J9CA 5CO3A 4NV5A 2IL3A 4GCIA 2LRTA 2FD3A 4OD7A 4POLA 3IC8A 2HFDA 3GX0A 3H4KA 3PGTA 4K5SA 4EF0A 2H6YA 4MJBA 4OFMA 2CAQA 1NW2A 1A24A 3UEMA 2HLSA 3IA1A 3C1SA 8GSSA 3O6TA 1M2AA 4MABA 3UAPA 2H1DA 10GSA 4ULXA 2CQ9A 4BL7B 4OO4A 4Q5RA 4CW9A 3EC3A 1Z5YE 1V98A 1HNCA 2HSHA 3VK9A 4ML1A 6GSXA 4OFTA 2ON7A 1Y6EA 4MJCA 4O5QA 1TRVA 1K0DA 5C04A 2HE3A 1YZXA 3E0UA 1I9DA 3J7Yb 4EIPA 2VCTA 1XW5A 1GUKA 3TGZA 4ICYA 2IMIA 3LXTA 3TCOA 5JCWA 5DCHA 2H01A 3HDCA 1WRYA 3F3RA 2A2RA 3IRAA 2GSRA 3TOTA 3QD9A 3HMJG 3VLNA 1SK0A 3EMPA 3UIWA 5A1NA 1SJ6A 4G19A 3DMLA 1U87A 4KCAA 5CYYA 1JZRA 2FA8A 4XS4A 4TR0A 5ECLB 4FQUA 4PQIA 3ZFBA 3L9SA 4I8BA 5IM9A 2XBQA 4LLRA 4G0KA 5ECOB 1A2MA 4O92A 1Q4JA 4HUAA 3GA4A 1DBYA 4KX4A 4V2MA 2RLIA 3LWAA 1EOHA 4GRFA 5EVOA 1FOVA 4N0VA 3TJKA 5G1KA 5DBQA 3I9V2 4MK3A 1SL2B 1AUCA 3FKFA 3MWHA 1AQXA 1QMVA 2HZFA 3DRNA 3EE2A 1XCCA 4FIWA 3FR3A 3CSJA 3GH6A 2GZZA 5C00A 5HR0A 4HU7A 1LU4A 1W4VA 3GL5A 3RPNA 2LKUA 4USSA 3TKPA 1EP8A 4ACSA 2IJYA 1TKDB 2XPDA 2BTOT 1EGRA 1OYJA 2F8FA 3KIJA 4O5RA 2DC5A 4EXJA 4TKYA 3ZYWA 1T00A 1SJZA 2IFQB 1OKTA 4JZQA 4WBRD 3CRTA 1TRSA 1F3BA 1B8XA 3A5IA 3ZLPA 3LGCA 4I6XA 1DE1A 5J47A 1K3OA 5D9VA 4IN0A 4YAVA 1GULA 4YKGA 7GSSA 3ZVJD 4X4JA 4AGSA 4GDFA 1BQ7A 1GP1A 4ECBA 2XC2A 4ZL8A 2H73A 3F8UA 1XBSA 2VCXA 3VWWA 1AW9A 1O85A 2VKZG 2WULA 2CX3A 3KP8A 2HSNB 4ZB6A 1OC8A 4N0ZA 4FYUA 3APOA 4JRRA 1GUHA 2JADA 3US3A 1PKZA 4HI7A 3BBYA 3GTUA 3ERFA 4G2EA 4RI6A 5D93A 18GSA 3BJ5A 1ERVA 3VURA 2NVLA 2L5OA 1DSBA 4YQMA 1RQMA 5A4VA 4WXTA 3IV4A 2L57A 1UA5A 1A8YA 3ERGA 1GSDA 4PGTA 2EC4A 1PD21 2PUKC 1FO5A 4BVYA 4GSTA 4EDZA 3KMNA 1GUMA 5CRGA 3GIXA 2P5RA 4RQRA 4D73A 4KH7A 2B5YA 1PKWA 1AAZA 4RUVA 5KOXA 2M80A 3HD5A 4IHUA 3WT2A 5AIVA 2PU9C 4N11A 2V32A 1THXA 3PR8A 2H76A 5F06A 3F4TA 1TTZA 11GSA 3VI5A 2P0GA 1SL0B 2DSAA 1X5DA 1XWCA 2FGXA 1VGLA 5ABRA 4IP1A 1O8XA 1LJRA 3ME7A 2V2GA 4XS1A 5DCGA 5A5HA 5A4WA 5CRWA 2MBTA 2P31A 4KW6A 4F0CA 2PGTA 4EUYA 4K8MA 5GSTA 2VOCA 1X0RA 1A0FA 3FZ9A 1U6TA 3FHKA 1BX9A 1S3AA 2DJ2A 4YQUA 1YKCA 1B9XC 3LJRA 4DSRA 5J3RA 4AI6A 2X49A 4BVXA 1PN0A 5J4VA 4IELA 2J23A 3KTBA 4TXOB 2DBCA 1RK4A 1WP0A 2C1YA 4XCSA 1AIUA 1MD4A 2WS2A 1XOBA 4MPGA 3LG6A 2R4VA 2YWNA 3KH7A 2B5EA 22GSA 4XHMA 1EZKA 4DSQA 4CY8A 4AJ8A 3VPTA 5D9TA 3W8SA 2EFCA 3KJYA 4JEDA 2LV3A 4KCEA 12GSA 2VCQA 4NAXA 2ALBA 1PGTA 2FWGA 3CMIA 3H79A 2VLVA 3VWXA 2R2JA 2F51A 5ECKB 4HEA2 3SWLA 2VL2C 4TW5A 2L4CA 5DQYA 2H0GA 4MNNA 4TR4A 2J9HA 2VUPA 1FG4A 1RW1A 1YQ1A 2I3YA 1X9MB 2DJ0A 3KH9A 3R2QA 1OE8A 2YCDA 4ZIJA 4HJ2A 1A2LA 4MDCA 3TKQA 1FVKA 2DKHA 4XS6A 2H0IA 1VRSD 1EEJA 4YH2A 2H19A 5EPFA 1G6WA 2G0FA 2JU5A 2AUVA 2Z9SA 1N2AA 4GQFA 4NMUA 3HHVA 1TI3A 4P3YB 1O7UA 1TW9A 2H72A 4FYCA 5IO0A 1TK0B 4IQAA 2FWEA 4ZILA 5H5RA 1ERUA 1T3BA 3MDKA 3A3TA 5FT3A 2ZNMA 3L0HA 4MJAA 2VLTA 5HQPA 4KSMA 3WYWA 1ABAA 1SENA 3ZL5A 1TXXA 2QGVA 2VCWA 3GKMA 2HYXA 1N8JA 5ID2A 4X1UA 3UVTA 2YJ7A 2GLRA 2KP2A 2CZ3A 4E8HA 3IR4A 4NXIA 5ECNB 2VM1A 1GH2A 4K0GA 5CAXA 1Z6MA 3HKRA 1M2BA 5IMFA 4LMVA 1F6MC 3G7JA 4K1FA 1UC7A 1ACVA 4OWYA 1OC9B 4GWRA 1J0FA 4WKWA 2GSQA 2R6KA 2I4AA 2LJKA 2X8CA 3GSTA 3EURA 2KP1A 2AB6A 4ZB9A 3IK9A 1MD3A 4I2UA 4PQ1A 4NHWA 2B1LA 6GSVA 2XBIA 4HJMA 1K3LA 2A4HA 3TOUA 4TVEA 3PINA 5ECHB 2CAIA 1GSFA 1XXUA 3UJ1A 1J9BA 3F6FA 4ZBAA 3J7Yk 1OVNA 2EIRA 3GSSA 2FLSA 2HRKB 3ZMLA 1XOAA 2FCHA 2HI7A 3D21A 2GQLA 1R7HA 3QDNA 3FZAA 1A8LA 2X64A 2YANA 4BL7A 3HZ8A 3AY8A 2OACA 2EIOA 4LL4B 3MIXA 1IYIA 2K8VA 1EV9A 1JFUA 2O8VB 2YWMA 3A2WA 3DVXA 1LBKA 2PN8A 1TU8A 4PTSA 3UBLA 2H66A 3D4MA 5H5SA 2PVQA 1M99A 4XRAA 1XVWA 5G5EA 1Q98A 2GT5A 1JLVA 1S3CA 2V6OA 4BWQA 3ZMKA 2B3SA 3SBCA 2GVPA 2ZCTA 3EINA 4RQXA 3WGXA 2DIZA 5E59A 1K0CA 4K7IA 1TI1A 1KNGA 1OE7A 3UVHA 2EIQA 3Q74A 1H75A 4WBJA 3NZNA 3QAWA 1PL1A 5BMUB 1A23A 2AAWA 1XIYA 2GGTA 4BA7A 4O32A 2G2QA 3FK8A 4WETA 2O87A 1EGOA 13GSA 5CREA 4I5QA 3S9FA 4GSNA 3CTFA 5D8IA 3M3MA 3FY7A 2IIYA 3GKXA 5JCUA 4ECJA 3BCKA 4Z7XA 1ERTA 3RPPA 2P5QA 1HQOA 5JWQB 2FHEA 3WGEA 1WMJA 3C7MA 1YVLA 2I9HA 4YKFA 3RAZA 5KEJA 1NHOA 1BEDA 1OKDA 1ILOA 1NSWA 5IMDA 3LXZA 4J2FA 2EFHA 3O76A 3QCPA 2YWOA 3KZQA 1QXHA 2H71A 1I5GA 1B9YC 2CV4A 2FWFA 3A5WA 1SU9A 2LNSA 1V40A 2YJHA 3O3TA 6GSSA 3D6IA 3HCZA 3DXBA 2UZ8A 3FR6A 4AKXB 3QMXA 4IJIA 4HQZA 5G5FA 4EIQA 1GL8A 2K8SA 1ZYNA 3EYTA 2DIYA 4DEJA 4MZWA 1V58A 1VF1A 4WF5A 3H8QA 1YEXA 1SK2A 1ZCPA 2IFQA 3GH9A 2FWHA 1SVMA 1YY7A 1PL2A 1TRUA 2YV9A 4BWSA 5J41A 1X5EA 1Y1UA 4PXOA 3RDWA 2JACA 5KN2A 1SJIA 4JR4A 4DSSB 1QGVA 3DYRA 1BG5A 2L59A 3W6GA 4J57E 1Z9HA 4IKHA 2K6VA 2AV4A 3TB2A 5GSSA 4F9ZA 3M9KA 3Q18A 3OR5A 4HS1A 4KGIA 4HDEA 5LNKe 5BRTA 1T8EB 3H93A 1MDIA 4J56E 1M2DA 2HSNA 3EPTA 1JHBA 3M9JA 2REMA 3DVWA 5IPHA 2UV8G 2A4VA 3TKSC 3FZ4A 4V1Ag 3ZTLA 2LSTA 4MPFA 4ZB7A 3UMAA 2F8AA 3FRCA 2MMNA 3HY2A 3DKSA 1SD8A 2JSZA 1SYXA 2NPBA 4KNDA 4GSSA 5IMCA 3BCIA 1YKAA 1ZZYA 2OKAA 4V2NA 2HZEB 3ME8A 4XIHA 2D2ZA 4L8EA 3E9JB 2GTUA 2GS3A 1HYUA 4F0BA 3A2VA 1Z7PA 1KBNA 5LD0A 3R3EA 3E3EA 3P2AA 2VCVA 2DJ3A 2E2GA 4QL9A 5KN3A 5AISA 17GSA 4GQCA 3IXRA 2B7KA 2N5AA 4JBBA 2WDUA 4IJ3A 1QK8A 2PPTA 1X9WB 1CQHA 3C8EA 3GFKA 4W66A 1NM3A 2N5BA 3GX8A 1X9SB 3F3QA 4IP6A 4HOJA 4FYBA 5JWRB 1T4YA 3P8WA 3GUSA 3LFLA 3TU3B 4TRXA 1MDJA 4AJ6A 1G6YA 1UVZA 2MMZA 5IMAA 4IS0A 2O5VA 3QFAC 2EFEA 3KMOA 2OE1A 2GT6A 2CZ2A 3HJMA 4X0XA 1R26A 5KN1A 1BYEA 5AIXA 3UL3A 1ERWA 4IQ1A 5ECSA 3W8JA 3N5OA 2GZYA 1G7OA 3GURA 3G9BA 2RM6A 2LQQA 2X99A 1K0BA 5DJLA 5HR1A 5FWGA 5CNWA 2B1KA 2AHEA 4TR3A 2LNTA 4I2TA 4KDYA 2E7PA 3ZREA 2O89A 3ZVJA 4ZBBA 1TU7A 4TXOA 2LTKA 4HQSA 3Q6OA 3L9VA 2XPEA 3Q19A 1TRWA 2R0PA 2VIMA 3HJPA 2VAFA 3VFIA 2QC7A 4EKZA 4K5RA 1PSQA 5IO2A 4MMMA 3LYPA 2VD0A 1GNEA 2ZUPA 1GSEA 5EY6A 2H0HA 4MF6A 1C72A 3EU4A 4E68A 5INYA 1PN9A 2FUG2 5KOWA 1ZYPA 2OE0A 3EVIA 1BG1A 5HR3A 3CSIA 3FW2A 2X4AA 1KTEA 2F9SA 1XW6A 5IMVA 3V1WA 2H6ZA 4EVMA 3HJOA 4H86A 3L78A 2VL2A 2MMAA 1HD2A 2RM5A 1MEKA 4PURA 3GL3A 5A34B 1SKRB 3QPMA 2CVBA 1GSUA 3KEBA 2C0GA 4CDOA 1SVOA 5IPGA 2VL9A 2GDRA 3P7XA 3IHGA 5E4WA 1GLPA 4MA9A 1J08A 2O7KA 4EL1A 1YEPA 1ON4A 2H30A 5J9BA 1O8WA 1GTUA 1EP7A 2VM2A 4TN8A 4WEYA 3LYKA 9GSSA 3TDGA 3C71A 1SK1A 2HT9A 5EL8A 5JCGA 4KE3A 3TUEA 4RI7A 4G0IA 2FY6A 4LMWA 2M46A 2NTOA 1FOHA 3ZFLA 4V2LA 14GSA 1WWJA 3FYGA 2LRNA 2YNXA 4KSOA 1TK8B 2DLXA 4ECIA 1QUWA 2V41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN3 A;  4GF0 A;  6GSY A;  1HNB A;  1ZYE A;  6GSU A;  3BD2 A;  2HRN A;  3FEU A;  5COH A;  3TJJ A;  3LOR A;  3MNG A;  1U3I A;  2GQK A;  1OAZ A;  3IPZ A;  3APQ A;  2L5L A;  3ZZX A;  1XFL A;  2HSM B;  2B6M A;  1EEM A;  2L4Q A;  4EC0 A;  2BMX A;  3TKR A;  2K9F A;  1OC9 A;  3IOS A;  2C3Q A;  2YP6 A;  2TIR A;  1SKS B;  2WGR A;  1TDI A;  2MZC A;  1FB6 A;  3NOF A;  2KLX A;  3A2X A;  5L71 A;  4E8E A;  2WJU A;  2C8U A;  3TRP A;  1T4Z A;  4WR5 A;  4QL7 A;  5DAK B;  1DE2 A;  1FB0 A;  2GQM A;  2CX4 A;  5D73 A;  3TRX A;  1K0N A;  1F3A A;  1U88 A;  4ZL7 A;  5ECP B;  1YF0 A;  2JZT A;  4POK A;  3CXG A;  5DAL B;  5B8B A;  3F63 A;  3IAM 2;  1B48 A;  2LRC A;  2H1A A;  2KOK A;  1JZW A;  6GST A;  2HRK A;  3QAV A;  4IGJ A;  5GZZ B;  3TJB A;  2XHF A;  1PX6 A;  3CYN A;  4TR1 B;  5F07 A;  3KCM A;  3N9J A;  2X8G A;  1AQW A;  4IVF A;  3GMF A;  1M9B A;  5ELG A;  2CVD A;  3ISO A;  2IPA A;  4KDU A;  2DJ1 A;  3KD0 A;  5B8A A;  4QQ7 A;  2YV7 A;  2VD1 A;  1VF3 A;  3BOA A;  1XPV A;  1F2E A;  1FVJ A;  2PER A;  3WD6 A;  3GKN A;  3IE3 A;  3IHQ A;  1TP9 A;  2YPM A;  2FA4 A;  4K6X A;  5DDL A;  1GLQ A;  5D9W A;  2M72 A;  2AYT A;  2IWT A;  2KHP A;  2H6X A;  5HR2 A;  3FR9 A;  3L4N A;  3C73 A;  4OFN A;  4EDY A;  3D0Z A;  1JZO A;  5KN0 A;  4Q5F A;  4EO3 A;  5ECQ B;  4EE0 A;  1IYH A;  2RII A;  1AQV A;  3MAK A;  3HZ4 A;  3CSH A;  2TRC P;  2DML A;  3GRX A;  1K0M A;  1URM A;  1O6J A;  2HSY A;  2NBS A;  1JLW A;  4ZL9 A;  3QOU A;  2KUC A;  2K18 A;  4KA0 A;  3TJF A;  5LCZ A;  2LJA A;  3WT1 A;  5BMU A;  5IQY A;  4ZB8 A;  2IMK A;  3U5R E;  3ZIJ A;  4PQH A;  2E2M A;  2H74 A;  3RBT A;  2WFC A;  5F0G A;  2H70 A;  3KGK A;  1T7P B;  2C0F A;  1FAA A;  2HRF A;  1VF2 A;  4YAP A;  3ZIV A;  4Q5N A;  2HXK A;  2C3N A;  4GXZ A;  5G30 A;  3PH9 A;  1YJ6 A;  1A2J A;  2C4J A;  2R5G A;  2O85 A;  2CVK A;  2RUE A;  4MLY A;  4WF4 A;  2OBK A;  1K0O A;  4XS4 B;  2C0D A;  1R5P A;  6GSW A;  1JZD A;  3M0F A;  2YN1 A;  4ISD A;  1V9W A;  3QFB C;  1UN2 A;  2L6C A;  1EV4 A;  4DVC A;  1TOF A;  5FHI A;  2VLU A;  1XVQ A;  1E2Y A;  2DJJ A;  16GS A;  3LQ7 A;  1A0R P;  2A2S A;  2WB9 A;  3LEF A;  4ID0 A;  4PNF A;  3UBK A;  4I97 A;  4FH8 A;  1NHY A;  2OJL A;  1QFN A;  3K8N A;  2WCI A;  3DD3 A;  1EWX A;  4MH2 A;  1XW9 A;  1E6B A;  4KDX A;  3KXO A;  2HQT A;  1XWG A;  4DSS A;  5IOX A;  2B7J A;  2YWI A;  2LQO A;  1TK5 B;  1AC1 A;  2RUF A;  5HFI A;  3IBH A;  4K7N A;  5CRD A;  5DVB A;  1GSY A;  4CHS A;  4MZC A;  3HA9 A;  4NV2 A;  3ZRD A;  4KAE A;  2BJX A;  1PX7 A;  2JL4 A;  4G0L A;  2YZH A;  4KF9 A;  1QQ2 A;  1S3D A;  1M7T A;  4K7O A;  3EWL A;  3U6V A;  5HFG A;  3KP9 A;  5B6N A;  3CRU A;  1WJK A;  3TKS A;  4XTS A;  2GSS A;  5F05 A;  1Z7R A;  4PUF C;  1GSS A;  3DEX A;  2DMM A;  4JU5 A;  2C0E A;  1Y25 A;  3UOM A;  4G9H A;  1U3A A;  1ZMA A;  1B4P A;  2HZE A;  2H8L A;  3APS A;  2QKE A;  4MJE A;  1V2A A;  1HNA A;  4N30 A;  1GTI A;  5GAN D;  2OE3 A;  4KB3 A;  4X43 A;  2GST A;  4K2D A;  1O81 A;  1PMT A;  1VF4 A;  3DWV A;  3MSZ A;  4MP4 A;  1PRX A;  2CA8 A;  1GSQ A;  1FW1 A;  2LEG A;  3ERW A;  4F82 A;  2OAD A;  4PUA A;  3GTU B;  5B7C A;  4NPB A;  1G7E A;  1TJD A;  4L5O A;  3HXS A;  4G10 A;  4LL1 B;  4L5L A;  3VWV A;  3D4T A;  2VCZ A;  4OCE A;  3I69 A;  1XWA A;  3GNJ A;  1WE0 A;  3VI7 A;  3HYP A;  1USB A;  2VO4 A;  2CT6 A;  3LSZ A;  5DJM A;  4NWY A;  4WR4 A;  3EU3 A;  4Q5Q A;  3IAS 2;  1F37 A;  19GS A;  2IMF A;  4GLT A;  4BVY B;  20GS A;  4MF5 A;  1R5A A;  4TXV A;  4D73 B;  5IMZ A;  1SKW B;  2V6K A;  1Z6N A;  3VWU A;  2ON5 A;  3M8N A;  1B4Q A;  3G7Y A;  1MDK A;  5A4U A;  2LUS A;  1GWC A;  4F2I A;  1SD9 A;  4ECC A;  3HVV A;  1YDK A;  4PX1 A;  3DGQ A;  3QAG A;  4PNG A;  1M0U A;  2YOI A;  3GV1 A;  1T1V A;  1G0T A;  4IW9 A;  2WRT A;  4NHZ A;  4POM A;  4ILF A;  3TRQ A;  1WPI A;  2V1M A;  2MYG A;  1R4W A;  2I81 A;  3DIE A;  2F3M A;  2OA7 A;  3P90 A;  5H5Q A;  3RHB A;  1GTB A;  3M1G A;  3IDV A;  4N10 A;  2JSY A;  4KUN A;  3L9U A;  1F9M A;  2OBI A;  4OO5 A;  3KM6 A;  5ENU A;  3EMX A;  2IN3 A;  1XWK A;  2TRX A;  4L0U A;  1W89 A;  4ZXG A;  1BJX A;  5DQS A;  2MBS A;  4MF7 A;  5D96 A;  1WOU A;  4ML6 A;  2HRA A;  1V57 A;  4JR6 A;  5ECM B;  2PVO C;  1GNW A;  3KTL A;  3GHA A;  2YZU A;  4BVX B;  2JZR A;  4POB A;  4MZB A;  1MTC A;  3UAR A;  2HNL A;  4MCU A;  1WIK A;  5G31 A;  2ES7 A;  2WZ9 A;  4HZ4 A;  5B6M A;  1THO A;  4K0N A;  2IMD A;  3ED3 A;  2H1G A;  1DUG A;  3G7I A;  2FNO A;  1KEB A;  1O73 A;  3F9U A;  4O7H A;  3CTG A;  5JWO B;  1GRX A;  2PBJ A;  3IK7 A;  5ELA A;  2PMT A;  1ST9 A;  1PQN A;  2N5F A;  1ML6 A;  3D22 A;  3CBU A;  5G2Z A;  3PPU A;  2QSI A;  3F4S A;  2IME A;  2MMO A;  1M9A A;  2VL3 A;  5AGY A;  1CQG A;  3F0I A;  2JZS A;  1GTA A;  5J4U A;  4IBP A;  4GTU A;  3TKS E;  3JCM L;  2PWJ A;  1XZO A;  1X5C A;  5ECI B;  5CP1 A;  3H1N A;  4MH3 A;  5HFK A;  3GYK A;  5A5K A;  3F4R A;  3WGD A;  4V1A p;  2I1U A;  3I6A A;  2AJQ B;  5F8B A;  3HVS A;  5D9X A;  3VPQ A;  4ZBD A;  2HSM A;  4K9Z A;  3ZIT A;  1BAY A;  2B5X A;  4XRD A;  2R37 A;  1ZGN A;  4TOP A;  1SL1 B;  3F6D A;  5AN1 A;  2GZP A;  4L0W A;  3FZ5 A;  4AJ7 A;  5GAP D;  2R3X A;  1H4O A;  3D5J A;  1K0A A;  3GKK A;  1OC3 A;  4OCF A;  3NIV A;  4HU9 A;  3C1R A;  5DAK A;  4AF2 A;  3QR6 A;  1SYR A;  5IIZ A;  2DJK A;  2LJR A;  1PA3 A;  5CRH A;  4FO5 A;  2L6D A;  4JE1 A;  1ZL9 A;  2C80 A;  1ZOF A;  5ID2 B;  5DAL A;  1XWB A;  3TJG A;  5IOW A;  3I43 A;  3HVX A;  1FHE A;  1Z3E A;  5G1L A;  3IC4 A;  1YF1 A;  1ZYQ B;  5J5N A;  2H1B A;  4TR1 A;  3RHC A;  2H75 A;  1EOG A;  4F03 A;  4HZ2 A;  4BPY A;  4YQV A;  4OMV A;  4LA1 A;  2X8H A;  1K3Y A;  2E0Q A;  2LS5 A;  2NDO A;  2C3T A;  5ECR B;  1AXD A;  5J9C A;  5CO3 A;  4NV5 A;  2IL3 A;  4GCI A;  2LRT A;  2FD3 A;  4OD7 A;  4POL A;  3IC8 A;  2HFD A;  3GX0 A;  3H4K A;  3PGT A;  4EF0 A;  2H6Y A;  4MJB A;  4OFM A;  2CAQ A;  1NW2 A;  1A24 A;  3UEM A;  2HLS A;  3IA1 A;  3C1S A;  8GSS A;  3O6T A;  1M2A A;  4MAB A;  3UAP A;  2H1D A;  10GS A;  4ULX A;  2CQ9 A;  4BL7 B;  4OO4 A;  4Q5R A;  4CW9 A;  3EC3 A;  1Z5Y E;  1V98 A;  1HNC A;  2HSH A;  3VK9 A;  4ML1 A;  6GSX A;  4OFT A;  2ON7 A;  1Y6E A;  4MJC A;  1TRV A;  1K0D A;  5C04 A;  2HE3 A;  1YZX A;  3E0U A;  1I9D A;  3J7Y b;  2VCT A;  1XW5 A;  1GUK A;  3TGZ A;  2IMI A;  3LXT A;  3TCO A;  5JCW A;  5DCH A;  2H01 A;  3HDC A;  1WRY A;  3F3R A;  2A2R A;  3IRA A;  2GSR A;  3TOT A;  3QD9 A;  3VLN A;  1SK0 A;  3EMP A;  3UIW A;  1SJ6 A;  4G19 A;  3DML A;  1U87 A;  4KCA A;  5CYY A;  1JZR A;  2FA8 A;  4XS4 A;  4TR0 A;  5ECL B;  4FQU A;  4PQI A;  3ZFB A;  3L9S A;  4I8B A;  5IM9 A;  2XBQ A;  4LLR A;  4G0K A;  5ECO B;  1A2M A;  4O92 A;  1Q4J A;  4HUA A;  3GA4 A;  1DBY A;  4KX4 A;  4V2M A;  2RLI A;  3LWA A;  1EOH A;  4GRF A;  5EVO A;  1FOV A;  4N0V A;  3TJK A;  5G1K A;  5DBQ A;  3I9V 2;  4MK3 A;  1SL2 B;  1AUC A;  3FKF A;  3MWH A;  1AQX A;  1QMV A;  2HZF A;  3DRN A;  3EE2 A;  1XCC A;  4FIW A;  3FR3 A;  3CSJ A;  3GH6 A;  2GZZ A;  5C00 A;  5HR0 A;  4HU7 A;  1LU4 A;  1W4V A;  3GL5 A;  3RPN A;  2LKU A;  4USS A;  3TKP A;  1EP8 A;  4ACS A;  2IJY A;  1TKD B;  2XPD A;  2BTO T;  1EGR A;  1OYJ A;  2F8F A;  3KIJ A;  4O5R A;  2DC5 A;  4EXJ A;  4TKY A;  3ZYW A;  1T00 A;  1SJZ A;  2IFQ B;  1OKT A;  4JZQ A;  4WBR D;  3CRT A;  1TRS A;  1F3B A;  1B8X A;  3ZLP A;  3LGC A;  4I6X A;  1DE1 A;  1K3O A;  5D9V A;  4IN0 A;  4YAV A;  1GUL A;  7GSS A;  3ZVJ D;  4AGS A;  1BQ7 A;  1GP1 A;  4ECB A;  2XC2 A;  4ZL8 A;  2H73 A;  3F8U A;  1XBS A;  2VCX A;  3VWW A;  1AW9 A;  1O85 A;  2WUL A;  2CX3 A;  3KP8 A;  2HSN B;  4ZB6 A;  1OC8 A;  4N0Z A;  4FYU A;  3APO A;  4JRR A;  1GUH A;  2JAD A;  3US3 A;  1PKZ A;  4HI7 A;  3BBY A;  3GTU A;  3ERF A;  4G2E A;  4RI6 A;  5D93 A;  18GS A;  3BJ5 A;  1ERV A;  3VUR A;  2NVL A;  2L5O A;  1DSB A;  4YQM A;  1RQM A;  5A4V A;  4WXT A;  3IV4 A;  2L57 A;  1UA5 A;  1A8Y A;  3ERG A;  1GSD A;  4PGT A;  2EC4 A;  1PD2 1;  2PUK C;  1FO5 A;  4BVY A;  4GST A;  4EDZ A;  3KMN A;  1GUM A;  5CRG A;  3GIX A;  2P5R A;  4RQR A;  4D73 A;  4KH7 A;  2B5Y A;  1PKW A;  1AAZ A;  4RUV A;  2M80 A;  3HD5 A;  4IHU A;  3WT2 A;  5AIV A;  2PU9 C;  4N11 A;  2V32 A;  1THX A;  3PR8 A;  2H76 A;  5F06 A;  3F4T A;  1TTZ A;  11GS A;  3VI5 A;  2P0G A;  1SL0 B;  2DSA A;  1X5D A;  1XWC A;  2FGX A;  1VGL A;  5ABR A;  4IP1 A;  1O8X A;  1LJR A;  3ME7 A;  2V2G A;  4XS1 A;  5DCG A;  5A4W A;  5CRW A;  2MBT A;  2P31 A;  4KW6 A;  4F0C A;  2PGT A;  4EUY A;  4K8M A;  5GST A;  2VOC A;  1X0R A;  1A0F A;  3FZ9 A;  1U6T A;  3FHK A;  1BX9 A;  1S3A A;  2DJ2 A;  4YQU A;  1YKC A;  1B9X C;  3LJR A;  4DSR A;  5J3R A;  4BVX A;  4IEL A;  2J23 A;  3KTB A;  4TXO B;  2DBC A;  1RK4 A;  1WP0 A;  2C1Y A;  4XCS A;  1AIU A;  1MD4 A;  2WS2 A;  1XOB A;  4MPG A;  3LG6 A;  2R4V A;  2YWN A;  3KH7 A;  2B5E A;  22GS A;  4XHM A;  1EZK A;  4DSQ A;  4AJ8 A;  3VPT A;  5D9T A;  3W8S A;  3KJY A;  4JED A;  2LV3 A;  4KCE A;  12GS A;  2VCQ A;  4NAX A;  2ALB A;  1PGT A;  2FWG A;  3CMI A;  3H79 A;  2VLV A;  3VWX A;  2R2J A;  2F51 A;  5ECK B;  4HEA 2;  3SWL A;  2VL2 C;  4TW5 A;  2L4C A;  5DQY A;  2H0G A;  4TR4 A;  2J9H A;  2VUP A;  1FG4 A;  1RW1 A;  1YQ1 A;  2I3Y A;  1X9M B;  2DJ0 A;  3KH9 A;  3R2Q A;  1OE8 A;  2YCD A;  4ZIJ A;  4HJ2 A;  1A2L A;  4MDC A;  3TKQ A;  1FVK A;  4XS6 A;  2H0I A;  1VRS D;  1EEJ A;  4YH2 A;  2H19 A;  5EPF A;  1G6W A;  2G0F A;  2JU5 A;  2AUV A;  2Z9S A;  1N2A A;  4GQF A;  4NMU A;  3HHV A;  1TI3 A;  4P3Y B;  1O7U A;  1TW9 A;  2H72 A;  4FYC A;  5IO0 A;  1TK0 B;  4IQA A;  2FWE A;  4ZIL A;  5H5R A;  1ERU A;  1T3B A;  3MDK A;  3A3T A;  5FT3 A;  2ZNM A;  3L0H A;  4MJA A;  2VLT A;  5HQP A;  4KSM A;  3WYW A;  1ABA A;  1SEN A;  3ZL5 A;  1TXX A;  2QGV A;  2VCW A;  3GKM A;  2HYX A;  1N8J A;  5ID2 A;  4X1U A;  3UVT A;  2YJ7 A;  2GLR A;  2KP2 A;  2CZ3 A;  4E8H A;  3IR4 A;  4NXI A;  5ECN B;  2VM1 A;  1GH2 A;  4K0G A;  5CAX A;  1Z6M A;  3HKR A;  1M2B A;  5IMF A;  4LMV A;  1F6M C;  3G7J A;  4K1F A;  1UC7 A;  1ACV A;  4OWY A;  1OC9 B;  4GWR A;  1J0F A;  4WKW A;  2GSQ A;  2R6K A;  2I4A A;  2LJK A;  2X8C A;  3GST A;  3EUR A;  2KP1 A;  2AB6 A;  4ZB9 A;  3IK9 A;  1MD3 A;  4I2U A;  4PQ1 A;  4NHW A;  2B1L A;  6GSV A;  2XBI A;  4HJM A;  1K3L A;  3TOU A;  4TVE A;  3PIN A;  5ECH B;  2CAI A;  1GSF A;  1XXU A;  3UJ1 A;  1J9B A;  3F6F A;  4ZBA A;  3J7Y k;  1OVN A;  2EIR A;  3GSS A;  2FLS A;  2HRK B;  3ZML A;  1XOA A;  2FCH A;  2HI7 A;  3D21 A;  2GQL A;  1R7H A;  3QDN A;  3FZA A;  1A8L A;  2X64 A;  2YAN A;  4BL7 A;  3HZ8 A;  3AY8 A;  2OAC A;  2EIO A;  4LL4 B;  1IYI A;  2K8V A;  1EV9 A;  1JFU A;  2O8V B;  2YWM A;  3A2W A;  3DVX A;  1LBK A;  2PN8 A;  1TU8 A;  4PTS A;  3UBL A;  2H66 A;  3D4M A;  5H5S A;  2PVQ A;  1M99 A;  4XRA A;  1XVW A;  5G5E A;  1Q98 A;  2GT5 A;  1JLV A;  1S3C A;  2V6O A;  4BWQ A;  3ZMK A;  2B3S A;  3SBC A;  2GVP A;  2ZCT A;  3EIN A;  4RQX A;  3WGX A;  2DIZ A;  5E59 A;  1K0C A;  4K7I A;  1TI1 A;  1KNG A;  1OE7 A;  3UVH A;  2EIQ A;  3Q74 A;  1H75 A;  4WBJ A;  3NZN A;  3QAW A;  1PL1 A;  1A23 A;  2AAW A;  1XIY A;  2GGT A;  4BA7 A;  4O32 A;  2G2Q A;  3FK8 A;  4WET A;  2O87 A;  1EGO A;  13GS A;  5CRE A;  4I5Q A;  3S9F A;  4GSN A;  3CTF A;  5D8I A;  3M3M A;  3FY7 A;  2IIY A;  3GKX A;  5JCU A;  4ECJ A;  3BCK A;  4Z7X A;  1ERT A;  3RPP A;  2P5Q A;  1HQO A;  5JWQ B;  2FHE A;  3WGE A;  1WMJ A;  3C7M A;  2I9H A;  3RAZ A;  5KEJ A;  1NHO A;  1BED A;  1OKD A;  1ILO A;  1NSW A;  5IMD A;  3LXZ A;  4J2F A;  3O76 A;  3QCP A;  2YWO A;  3KZQ A;  1QXH A;  2H71 A;  1I5G A;  1B9Y C;  2CV4 A;  2FWF A;  3A5W A;  1SU9 A;  2LNS A;  1V40 A;  2YJH A;  3O3T A;  6GSS A;  3D6I A;  3HCZ A;  3DXB A;  2UZ8 A;  3FR6 A;  3QMX A;  4IJI A;  4HQZ A;  5G5F A;  1GL8 A;  2K8S A;  3EYT A;  2DIY A;  4DEJ A;  4MZW A;  1V58 A;  1VF1 A;  4WF5 A;  3H8Q A;  1YEX A;  1SK2 A;  1ZCP A;  2IFQ A;  3GH9 A;  2FWH A;  1YY7 A;  1PL2 A;  1TRU A;  2YV9 A;  4BWS A;  5J41 A;  1X5E A;  4PXO A;  3RDW A;  2JAC A;  5KN2 A;  1SJI A;  4JR4 A;  4DSS B;  1QGV A;  3DYR A;  1BG5 A;  2L59 A;  3W6G A;  4J57 E;  1Z9H A;  4IKH A;  2K6V A;  2AV4 A;  3TB2 A;  5GSS A;  4F9Z A;  3M9K A;  3Q18 A;  3OR5 A;  4HS1 A;  4KGI A;  4HDE A;  5LNK e;  1T8E B;  3H93 A;  1MDI A;  4J56 E;  1M2D A;  1JHB A;  3M9J A;  2REM A;  3DVW A;  5IPH A;  2A4V A;  3TKS C;  3FZ4 A;  4V1A g;  3ZTL A;  2LST A;  4MPF A;  3UMA A;  2F8A A;  3FRC A;  2MMN A;  3HY2 A;  3DKS A;  1SD8 A;  2JSZ A;  1SYX A;  2NPB A;  4KND A;  4GSS A;  5IMC A;  3BCI A;  1YKA A;  1ZZY A;  2OKA A;  4V2N A;  2HZE B;  3ME8 A;  4XIH A;  2D2Z A;  4L8E A;  3E9J B;  2GTU A;  2GS3 A;  1HYU A;  4F0B A;  3A2V A;  1Z7P A;  1KBN A;  5LD0 A;  3R3E A;  3E3E A;  3P2A A;  2VCV A;  2DJ3 A;  2E2G A;  4QL9 A;  5KN3 A;  5AIS A;  17GS A;  4GQC A;  3IXR A;  2B7K A;  2N5A A;  4JBB A;  2WDU A;  4IJ3 A;  1QK8 A;  2PPT A;  1X9W B;  1CQH A;  3C8E A;  3GFK A;  1NM3 A;  2N5B A;  3GX8 A;  1X9S B;  3F3Q A;  4IP6 A;  4HOJ A;  4FYB A;  5JWR B;  1T4Y A;  3P8W A;  3GUS A;  3LFL A;  4TRX A;  1MDJ A;  4AJ6 A;  1G6Y A;  1UVZ A;  2MMZ A;  5IMA A;  4IS0 A;  3QFA C;  3KMO A;  2OE1 A;  2GT6 A;  2CZ2 A;  3HJM A;  4X0X A;  1R26 A;  5KN1 A;  1BYE A;  5AIX A;  3UL3 A;  1ERW A;  4IQ1 A;  5ECS A;  3W8J A;  3N5O A;  2GZY A;  1G7O A;  3GUR A;  3G9B A;  2RM6 A;  2LQQ A;  2X99 A;  1K0B A;  5DJL A;  5HR1 A;  5FWG A;  5CNW A;  2B1K A;  2AHE A;  4TR3 A;  2LNT A;  4I2T A;  4KDY A;  2E7P A;  3ZRE A;  2O89 A;  3ZVJ A;  4ZBB A;  1TU7 A;  4TXO A;  2LTK A;  4HQS A;  3Q6O A;  3L9V A;  2XPE A;  3Q19 A;  1TRW A;  2VIM A;  3HJP A;  2VAF A;  3VFI A;  2QC7 A;  4EKZ A;  1PSQ A;  5IO2 A;  4MMM A;  3LYP A;  2VD0 A;  1GNE A;  2ZUP A;  1GSE A;  5EY6 A;  2H0H A;  4MF6 A;  1C72 A;  3EU4 A;  5INY A;  1PN9 A;  2FUG 2;  2OE0 A;  3EVI A;  5HR3 A;  3CSI A;  3FW2 A;  1KTE A;  2F9S A;  1XW6 A;  5IMV A;  3V1W A;  2H6Z A;  4EVM A;  3HJO A;  4H86 A;  3L78 A;  2VL2 A;  2MMA A;  1HD2 A;  2RM5 A;  1MEK A;  4PUR A;  3GL3 A;  1SKR B;  3QPM A;  2CVB A;  1GSU A;  3KEB A;  2C0G A;  4CDO A;  5IPG A;  2VL9 A;  2GDR A;  3P7X A;  5E4W A;  1GLP A;  4MA9 A;  1J08 A;  2O7K A;  4EL1 A;  1YEP A;  1ON4 A;  2H30 A;  5J9B A;  1O8W A;  1GTU A;  1EP7 A;  2VM2 A;  4TN8 A;  4WEY A;  3LYK A;  9GSS A;  3TDG A;  3C71 A;  1SK1 A;  2HT9 A;  5EL8 A;  5JCG A;  4KE3 A;  3TUE A;  4RI7 A;  4G0I A;  2FY6 A;  4LMW A;  2M46 A;  2NTO A;  3ZFL A;  4V2L A;  14GS A;  1WWJ A;  3FYG A;  2LRN A;  2YNX A;  4KSO A;  1TK8 B;  2DLX A;  4ECI A;  1QUW A;  2V41 A; 
#chains in the Genus database with same CATH topology
 3GN3 A;  4GF0 A;  6GSY A;  1HNB A;  1ZYE A;  2DKI A;  3FMW A;  6GSU A;  3BD2 A;  2HRN A;  3FEU A;  5COH A;  3TJJ A;  3LOR A;  3MNG A;  1U3I A;  2GQK A;  1OAZ A;  3IPZ A;  3APQ A;  2L5L A;  3ZZX A;  1XFL A;  2HSM B;  2B6M A;  1EEM A;  2L4Q A;  4EC0 A;  2BMX A;  3TKR A;  2K9F A;  1OC9 A;  3IOS A;  2C3Q A;  2YP6 A;  2TIR A;  1SKS B;  2WGR A;  1TDI A;  2MZC A;  1FB6 A;  2A2P A;  3NOF A;  2KLX A;  3A2X A;  5L71 A;  4E8E A;  2WJU A;  2C8U A;  3TRP A;  1T4Z A;  4WR5 A;  4QL7 A;  5DAK B;  1DE2 A;  1FB0 A;  2GQM A;  2CX4 A;  5D73 A;  3TRX A;  1K0N A;  1F3A A;  4QMK A;  1U88 A;  4ZL7 A;  5ECP B;  1YF0 A;  2JZT A;  4POK A;  3CXG A;  5DAL B;  5B8B A;  3F63 A;  4K2X A;  3IAM 2;  2WVX A;  1B48 A;  2LRC A;  2H1A A;  2KOK A;  1JZW A;  1SVL A;  6GST A;  2HRK A;  3QAV A;  4IGJ A;  5GZZ B;  3TJB A;  2XHF A;  1PX6 A;  3CYN A;  4TR1 B;  5F07 A;  3KCM A;  3N9J A;  2X8G A;  1AQW A;  4IVF A;  3GMF A;  1M9B A;  5ELG A;  2CVD A;  3ISO A;  2IPA A;  4KDU A;  1TXU A;  2DJ1 A;  3KD0 A;  5B8A A;  4QQ7 A;  2YV7 A;  2VD1 A;  1VF3 A;  3BOA A;  1XPV A;  1F2E A;  1FVJ A;  2PER A;  3WD6 A;  3GKN A;  3IE3 A;  3IHQ A;  1TP9 A;  2YPM A;  2FA4 A;  4K6X A;  5DDL A;  1GLQ A;  5D9W A;  2M72 A;  2AYT A;  2IWT A;  2KHP A;  2H6X A;  5HR2 A;  3FR9 A;  3L4N A;  4N3Z A;  3C73 A;  4OFN A;  4EDY A;  3D0Z A;  2EFD A;  1JZO A;  5KN0 A;  4Q5F A;  4EO3 A;  5ECQ B;  4EE0 A;  1IYH A;  2RII A;  1AQV A;  3MAK A;  3HZ4 A;  3CSH A;  4AKI A;  2TRC P;  2DML A;  3GRX A;  1K0M A;  1URM A;  1O6J A;  2HSY A;  2NBS A;  1JLW A;  4ZL9 A;  4G01 A;  3QOU A;  2KUC A;  2K18 A;  4KA0 A;  3TJF A;  5LCZ A;  2LJA A;  3WT1 A;  5BMU A;  5IQY A;  4ZB8 A;  2IMK A;  3U5R E;  3ZIJ A;  2WW1 A;  4PQH A;  2E2M A;  2H74 A;  3RBT A;  2WFC A;  5F0G A;  2H70 A;  3KGK A;  1T7P B;  2C0F A;  1FAA A;  2HRF A;  1VF2 A;  4YAP A;  3ZIV A;  4Q5N A;  2HXK A;  2C3N A;  4GXZ A;  5G30 A;  3PH9 A;  1YJ6 A;  1A2J A;  2C4J A;  2R5G A;  5A1N B;  2O85 A;  2CVK A;  2RUE A;  4MLY A;  4WF4 A;  2OBK A;  1K0O A;  4XS4 B;  2C0D A;  1R5P A;  6GSW A;  1JZD A;  3M0F A;  2YN1 A;  4ISD A;  1V9W A;  3QFB C;  4AKH A;  1UN2 A;  2L6C A;  1EV4 A;  4DVC A;  1TOF A;  5FHI A;  5J4Y A;  2VLU A;  1XVQ A;  1E2Y A;  2DJJ A;  16GS A;  3LQ7 A;  1A0R P;  2A2S A;  2WB9 A;  3LEF A;  4ID0 A;  4PNF A;  3UBK A;  4I97 A;  4FH8 A;  1NHY A;  2OJL A;  1QFN A;  3K8N A;  2WCI A;  3DD3 A;  1EWX A;  4MH2 A;  1XW9 A;  1E6B A;  4KDX A;  3KXO A;  2HQT A;  1XWG A;  4DSS A;  5IOX A;  2B7J A;  2YWI A;  2LQO A;  1TK5 B;  1AC1 A;  2RUF A;  5HFI A;  3LW9 A;  3IBH A;  4K7N A;  5CRD A;  5DVB A;  1GSY A;  4CHS A;  4MZC A;  3HA9 A;  4NV2 A;  3ZRD A;  4KAE A;  2BJX A;  1PX7 A;  2JL4 A;  4G0L A;  2YZH A;  4KF9 A;  1QQ2 A;  1S3D A;  1M7T A;  4K7O A;  3EWL A;  3U6V A;  5HFG A;  3KP9 A;  5B6N A;  3CRU A;  4Z2T A;  1WJK A;  3TKS A;  4XTS A;  2GSS A;  5F05 A;  1Z7R A;  4PUF C;  1GSS A;  3DEX A;  2DMM A;  4JU5 A;  2C0E A;  1Y25 A;  3UOM A;  4G9H A;  1U3A A;  2QA2 A;  1ZMA A;  1B4P A;  2HZE A;  2H8L A;  3APS A;  2QKE A;  4MJE A;  1V2A A;  1HNA A;  4N30 A;  2WZS A;  1GTI A;  5GAN D;  2OE3 A;  4KB3 A;  4X43 A;  2GST A;  4K2D A;  1O81 A;  1PMT A;  1VF4 A;  3DWV A;  3MSZ A;  2H1L A;  4MP4 A;  1PRX A;  2CA8 A;  1GSQ A;  1FW1 A;  2LEG A;  3ERW A;  4F82 A;  2OAD A;  4PUA A;  3GTU B;  5B7C A;  4NPB A;  1G7E A;  1TJD A;  4L5O A;  3HXS A;  1PFO A;  4G10 A;  4LL1 B;  4L5L A;  3VWV A;  3D4T A;  2VCZ A;  4OCE A;  3I69 A;  1XWA A;  3GNJ A;  3MYD A;  1WE0 A;  2QA1 A;  3VI7 A;  3HYP A;  1USB A;  2VO4 A;  2CT6 A;  3LSZ A;  5DJM A;  4NWY A;  4WR4 A;  3EU3 A;  4Q5Q A;  5J40 A;  1F37 A;  3IAS 2;  19GS A;  2IMF A;  4GLT A;  4BVY B;  20GS A;  4MF5 A;  1R5A A;  4TXV A;  4D73 B;  5IMZ A;  1SKW B;  2V6K A;  1Z6N A;  3VWU A;  2ON5 A;  3M8N A;  1B4Q A;  3G7Y A;  1MDK A;  5A4U A;  2LUS A;  1GWC A;  4F2I A;  1SD9 A;  4BIK A;  4ECC A;  3HVV A;  1YDK A;  4PX1 A;  2WW3 A;  3DGQ A;  3QAG A;  4PNG A;  1M0U A;  2YOI A;  3GV1 A;  1T1V A;  1G0T A;  4A5P A;  4IW9 A;  2WRT A;  4NHZ A;  4POM A;  4ILF A;  3TRQ A;  1WPI A;  2V1M A;  2MYG A;  1R4W A;  2I81 A;  3DIE A;  2F3M A;  2OA7 A;  5A5H B;  4AKG A;  3P90 A;  5H5Q A;  3RHB A;  1GTB A;  3M1G A;  3IDV A;  4N10 A;  2JSY A;  4KUN A;  3L9U A;  1F9M A;  4CY6 A;  2OBI A;  4OO5 A;  3KM6 A;  5ENU A;  3EMX A;  2IN3 A;  1XWK A;  2TRX A;  4L0U A;  1W89 A;  4ZXG A;  1BJX A;  5DQS A;  2MBS A;  4MF7 A;  5D96 A;  1WOU A;  4ML6 A;  2HRA A;  1V57 A;  4JR6 A;  5ECM B;  2PVO C;  1GNW A;  3KTL A;  1BF5 A;  3GHA A;  2YZU A;  4BVX B;  2JZR A;  4POB A;  4MZB A;  1MTC A;  5A34 A;  3UAR A;  2HNL A;  4MCU A;  1WIK A;  1N25 A;  5G31 A;  4O5U A;  2ES7 A;  2WZ9 A;  4HZ4 A;  5B6M A;  1THO A;  4K0N A;  2IMD A;  3ED3 A;  2H1G A;  1DUG A;  3G7I A;  2FNO A;  1KEB A;  1O73 A;  3F9U A;  4O7H A;  4Z2U A;  3CTG A;  5JWO B;  1GRX A;  2PBJ A;  4FXY P;  3IK7 A;  5ELA A;  2PMT A;  1ST9 A;  1PQN A;  2N5F A;  1ML6 A;  3D22 A;  3CBU A;  5G2Z A;  3PPU A;  2QSI A;  3F4S A;  2IME A;  2MMO A;  1M9A A;  2VL3 A;  5AGY A;  1CQG A;  3F0I A;  2JZS A;  1GTA A;  5J4U A;  4IBP A;  4GTU A;  3TKS E;  3JCM L;  2PWJ A;  2R0G A;  1XZO A;  1X5C A;  5ECI B;  5CP1 A;  3H1N A;  4MH3 A;  5HFK A;  3GYK A;  5A5K A;  3F4R A;  3WGD A;  4V1A p;  2I1U A;  3I6A A;  2O3E A;  2AJQ B;  5F8B A;  3HVS A;  5D9X A;  3VPQ A;  4ZBD A;  2HSM A;  2O36 A;  4K9Z A;  3ZIT A;  1BAY A;  2B5X A;  4XRD A;  2R37 A;  1I1I P;  1ZGN A;  4TOP A;  1SL1 B;  3F6D A;  5AN1 A;  2GZP A;  4L0W A;  3FZ5 A;  4AJ7 A;  5GAP D;  3CWG A;  2R3X A;  1H4O A;  3D5J A;  1K0A A;  3GKK A;  1OC3 A;  4OCF A;  3NIV A;  4HU9 A;  3C1R A;  5DAK A;  4AF2 A;  3QR6 A;  1SYR A;  5IIZ A;  2DJK A;  2LJR A;  4Z2R A;  1PA3 A;  2OT3 A;  5CRH A;  4FO5 A;  2L6D A;  4JE1 A;  1ZL9 A;  2C80 A;  1ZOF A;  5ID2 B;  5DAL A;  1XWB A;  3TJG A;  5IOW A;  3I43 A;  3HVX A;  1FHE A;  1Z3E A;  5G1L A;  2R0C A;  3IC4 A;  1YF1 A;  1ZYQ B;  5J5N A;  2H1B A;  4TR1 A;  3RHC A;  2H75 A;  1EOG A;  4F03 A;  4HZ2 A;  4PHZ C;  4BPY A;  4YQV A;  4OMV A;  4LA1 A;  2X8H A;  1S4B P;  1K3Y A;  2E0Q A;  2LS5 A;  2NDO A;  2C3T A;  5ECR B;  1AXD A;  5J9C A;  5CO3 A;  4NV5 A;  2IL3 A;  4GCI A;  2LRT A;  2FD3 A;  4OD7 A;  4POL A;  3IC8 A;  2HFD A;  3GX0 A;  3H4K A;  3PGT A;  4K5S A;  4EF0 A;  2H6Y A;  4MJB A;  4OFM A;  2CAQ A;  1NW2 A;  1A24 A;  3UEM A;  2HLS A;  3IA1 A;  3C1S A;  8GSS A;  3O6T A;  1M2A A;  4MAB A;  3UAP A;  2H1D A;  10GS A;  4ULX A;  2CQ9 A;  4BL7 B;  4OO4 A;  4Q5R A;  4CW9 A;  3EC3 A;  1Z5Y E;  1V98 A;  1HNC A;  2HSH A;  3VK9 A;  4ML1 A;  6GSX A;  4OFT A;  2ON7 A;  1Y6E A;  4MJC A;  4O5Q A;  1TRV A;  1K0D A;  5C04 A;  2HE3 A;  1YZX A;  3E0U A;  1I9D A;  3RFR C;  3J7Y b;  4EIP A;  2VCT A;  1XW5 A;  1GUK A;  1YEW C;  3TGZ A;  4ICY A;  2IMI A;  3LXT A;  3TCO A;  5JCW A;  5DCH A;  2H01 A;  3HDC A;  1WRY A;  3F3R A;  2A2R A;  3IRA A;  2GSR A;  3TOT A;  3QD9 A;  3HMJ G;  3VLN A;  1SK0 A;  3EMP A;  3UIW A;  5A1N A;  1SJ6 A;  4G19 A;  3DML A;  1U87 A;  4KCA A;  5CYY A;  1JZR A;  2FA8 A;  4XS4 A;  4TR0 A;  5ECL B;  4FQU A;  4PQI A;  3ZFB A;  3L9S A;  4I8B A;  5IM9 A;  2XBQ A;  4LLR A;  4G0K A;  5ECO B;  1A2M A;  4O92 A;  1Q4J A;  4HUA A;  3GA4 A;  1DBY A;  4KX4 A;  4V2M A;  2RLI A;  3LWA A;  1EOH A;  4GRF A;  5EVO A;  1FOV A;  4N0V A;  3TJK A;  5G1K A;  5DBQ A;  3I9V 2;  4MK3 A;  1SL2 B;  1AUC A;  3FKF A;  3MWH A;  1AQX A;  1QMV A;  2HZF A;  3DRN A;  3EE2 A;  1XCC A;  4FIW A;  3FR3 A;  3CSJ A;  3GH6 A;  2WVY A;  2GZZ A;  5C00 A;  5HR0 A;  4HU7 A;  1LU4 A;  1W4V A;  3GL5 A;  3RPN A;  2LKU A;  4USS A;  3TKP A;  1EP8 A;  4ACS A;  2IJY A;  1TKD B;  2XPD A;  2BTO T;  1EGR A;  1OYJ A;  2F8F A;  3KIJ A;  4O5R A;  2DC5 A;  4EXJ A;  4TKY A;  3ZYW A;  1T00 A;  1SJZ A;  2IFQ B;  1OKT A;  4JZQ A;  4WBR D;  3CRT A;  1TRS A;  1F3B A;  1B8X A;  3A5I A;  3ZLP A;  3LGC A;  4I6X A;  1DE1 A;  5J47 A;  1K3O A;  5D9V A;  4IN0 A;  4YAV A;  1GUL A;  4YKG A;  7GSS A;  3ZVJ D;  4X4J A;  4AGS A;  4GDF A;  1BQ7 A;  1GP1 A;  4ECB A;  2XC2 A;  4ZL8 A;  2H73 A;  3F8U A;  1XBS A;  2VCX A;  3VWW A;  1AW9 A;  1O85 A;  2VKZ G;  2WUL A;  2CX3 A;  3KP8 A;  2HSN B;  4ZB6 A;  1OC8 A;  4N0Z A;  4FYU A;  3APO A;  4JRR A;  1GUH A;  2JAD A;  3US3 A;  1PKZ A;  4HI7 A;  3BBY A;  3GTU A;  3ERF A;  4G2E A;  4RI6 A;  5D93 A;  18GS A;  3BJ5 A;  1ERV A;  3VUR A;  2NVL A;  2L5O A;  1DSB A;  4YQM A;  1RQM A;  5A4V A;  4WXT A;  3IV4 A;  2L57 A;  1UA5 A;  1A8Y A;  3ERG A;  1GSD A;  4PGT A;  2EC4 A;  1PD2 1;  2PUK C;  1FO5 A;  4BVY A;  4GST A;  4EDZ A;  3KMN A;  1GUM A;  5CRG A;  3GIX A;  2P5R A;  4RQR A;  4D73 A;  4KH7 A;  2B5Y A;  1PKW A;  1AAZ A;  4RUV A;  5KOX A;  2M80 A;  3HD5 A;  4IHU A;  3WT2 A;  5AIV A;  2PU9 C;  4N11 A;  2V32 A;  1THX A;  3PR8 A;  2H76 A;  5F06 A;  3F4T A;  1TTZ A;  11GS A;  3VI5 A;  2P0G A;  1SL0 B;  2DSA A;  1X5D A;  1XWC A;  2FGX A;  1VGL A;  5ABR A;  4IP1 A;  1O8X A;  1LJR A;  3ME7 A;  2V2G A;  4XS1 A;  5DCG A;  5A5H A;  5A4W A;  5CRW A;  2MBT A;  2P31 A;  4KW6 A;  4F0C A;  2PGT A;  4EUY A;  4K8M A;  5GST A;  2VOC A;  1X0R A;  1A0F A;  3FZ9 A;  1U6T A;  3FHK A;  1BX9 A;  1S3A A;  2DJ2 A;  4YQU A;  1YKC A;  1B9X C;  3LJR A;  4DSR A;  5J3R A;  4AI6 A;  2X49 A;  4BVX A;  1PN0 A;  5J4V A;  4IEL A;  2J23 A;  3KTB A;  4TXO B;  2DBC A;  1RK4 A;  1WP0 A;  2C1Y A;  4XCS A;  1AIU A;  1MD4 A;  2WS2 A;  1XOB A;  4MPG A;  3LG6 A;  2R4V A;  2YWN A;  3KH7 A;  2B5E A;  22GS A;  4XHM A;  1EZK A;  4DSQ A;  4CY8 A;  4AJ8 A;  3VPT A;  5D9T A;  3W8S A;  2EFC A;  3KJY A;  4JED A;  2LV3 A;  4KCE A;  12GS A;  2VCQ A;  4NAX A;  2ALB A;  1PGT A;  2FWG A;  3CMI A;  3H79 A;  2VLV A;  3VWX A;  2R2J A;  2F51 A;  5ECK B;  4HEA 2;  3SWL A;  2VL2 C;  4TW5 A;  2L4C A;  5DQY A;  2H0G A;  4MNN A;  4TR4 A;  2J9H A;  2VUP A;  1FG4 A;  1RW1 A;  1YQ1 A;  2I3Y A;  1X9M B;  2DJ0 A;  3KH9 A;  3R2Q A;  1OE8 A;  2YCD A;  4ZIJ A;  4HJ2 A;  1A2L A;  4MDC A;  3TKQ A;  1FVK A;  2DKH A;  4XS6 A;  2H0I A;  1VRS D;  1EEJ A;  4YH2 A;  2H19 A;  5EPF A;  1G6W A;  2G0F A;  2JU5 A;  2AUV A;  2Z9S A;  1N2A A;  4GQF A;  4NMU A;  3HHV A;  1TI3 A;  4P3Y B;  1O7U A;  1TW9 A;  2H72 A;  4FYC A;  5IO0 A;  1TK0 B;  4IQA A;  2FWE A;  4ZIL A;  5H5R A;  1ERU A;  1T3B A;  3MDK A;  3A3T A;  5FT3 A;  2ZNM A;  3L0H A;  4MJA A;  2WW0 A;  2VLT A;  5HQP A;  4KSM A;  3WYW A;  1ABA A;  1SEN A;  3ZL5 A;  1TXX A;  2QGV A;  2VCW A;  3GKM A;  2HYX A;  1N8J A;  5ID2 A;  4X1U A;  3UVT A;  2YJ7 A;  2GLR A;  2KP2 A;  2CZ3 A;  4E8H A;  3IR4 A;  4NXI A;  5ECN B;  2VM1 A;  1GH2 A;  4K0G A;  5CAX A;  1Z6M A;  3HKR A;  1M2B A;  5IMF A;  4LMV A;  1F6M C;  3G7J A;  4K1F A;  1UC7 A;  1ACV A;  4OWY A;  1OC9 B;  4GWR A;  1J0F A;  4WKW A;  2GSQ A;  2R6K A;  2I4A A;  2LJK A;  2X8C A;  3GST A;  3EUR A;  2KP1 A;  2AB6 A;  4ZB9 A;  3IK9 A;  1MD3 A;  4I2U A;  4PQ1 A;  2XBI A;  4NHW A;  6GSV A;  2B1L A;  1M3I A;  4HJM A;  1K3L A;  2A4H A;  3TOU A;  4TVE A;  3PIN A;  5ECH B;  2CAI A;  1GSF A;  1XXU A;  3UJ1 A;  1J9B A;  3F6F A;  4ZBA A;  3J7Y k;  1OVN A;  2WVX B;  2EIR A;  3GSS A;  2FLS A;  2HRK B;  3ZML A;  1XOA A;  2FCH A;  2HI7 A;  3D21 A;  2GQL A;  1R7H A;  3QDN A;  3FZA A;  1A8L A;  2X64 A;  2YAN A;  4BL7 A;  3HZ8 A;  3AY8 A;  2OAC A;  2EIO A;  4LL4 B;  3MIX A;  1IYI A;  2K8V A;  1EV9 A;  1JFU A;  2O8V B;  2YWM A;  3A2W A;  3DVX A;  1LBK A;  2PN8 A;  1TU8 A;  4PTS A;  3UBL A;  2H66 A;  3D4M A;  5H5S A;  2PVQ A;  1M99 A;  4XRA A;  1XVW A;  1M3J A;  5G5E A;  1Q98 A;  2WVZ A;  1S3R A;  2GT5 A;  1JLV A;  1S3C A;  2V6O A;  4BWQ A;  3ZMK A;  2B3S A;  3SBC A;  2GVP A;  2ZCT A;  3EIN A;  4RQX A;  3WGX A;  2DIZ A;  5E59 A;  1K0C A;  4K7I A;  1TI1 A;  1KNG A;  1OE7 A;  3UVH A;  2EIQ A;  3Q74 A;  1H75 A;  4WBJ A;  3NZN A;  3QAW A;  1PL1 A;  5BMU B;  1A23 A;  2AAW A;  1XIY A;  2GGT A;  4BA7 A;  4O32 A;  2G2Q A;  3FK8 A;  4WET A;  2O87 A;  1EGO A;  13GS A;  5CRE A;  4I5Q A;  3S9F A;  4GSN A;  3CTF A;  5D8I A;  3M3M A;  3FY7 A;  2IIY A;  3GKX A;  5JCU A;  4ECJ A;  3BCK A;  4Z7X A;  1ERT A;  3RPP A;  2P5Q A;  1HQO A;  5JWQ B;  2FHE A;  3WGE A;  1WMJ A;  4HSC X;  3C7M A;  1YVL A;  2I9H A;  4YKF A;  3RAZ A;  5KEJ A;  1NHO A;  1BED A;  1OKD A;  1ILO A;  1NSW A;  5IMD A;  3LXZ A;  4J2F A;  2EFH A;  3O76 A;  3QCP A;  2YWO A;  3KZQ A;  1QXH A;  2H71 A;  1I5G A;  1B9Y C;  2CV4 A;  2FWF A;  3A5W A;  1SU9 A;  2LNS A;  1V40 A;  2YJH A;  3O3T A;  6GSS A;  3D6I A;  3HCZ A;  3DXB A;  2UZ8 A;  3FR6 A;  4AKX B;  3QMX A;  4IJI A;  4HQZ A;  5G5F A;  4EIQ A;  1GL8 A;  2K8S A;  1ZYN A;  3EYT A;  2DIY A;  4DEJ A;  4MZW A;  1V58 A;  1VF1 A;  4WF5 A;  3H8Q A;  1YEX A;  1SK2 A;  1ZCP A;  2IFQ A;  3GH9 A;  2FWH A;  1SVM A;  1YY7 A;  1PL2 A;  1TRU A;  2YV9 A;  4BWS A;  5J41 A;  1X5E A;  1Y1U A;  4PXO A;  3RDW A;  2JAC A;  5KN2 A;  1SJI A;  4JR4 A;  4DSS B;  1QGV A;  3DYR A;  1BG5 A;  2L59 A;  3W6G A;  4J57 E;  1Z9H A;  4IKH A;  2K6V A;  2AV4 A;  3TB2 A;  5GSS A;  4F9Z A;  3M9K A;  3Q18 A;  3OR5 A;  4HS1 A;  4KGI A;  4HDE A;  5LNK e;  5BRT A;  1T8E B;  3H93 A;  1MDI A;  4J56 E;  1M2D A;  2HSN A;  3EPT A;  1JHB A;  3M9J A;  2REM A;  3DVW A;  5IPH A;  2UV8 G;  2A4V A;  3TKS C;  3FZ4 A;  4V1A g;  3ZTL A;  2LST A;  4MPF A;  4ZB7 A;  3UMA A;  2F8A A;  3FRC A;  2MMN A;  3HY2 A;  3DKS A;  1SD8 A;  2JSZ A;  1SYX A;  2NPB A;  4KND A;  4GSS A;  5IMC A;  3BCI A;  1YKA A;  1ZZY A;  2OKA A;  4V2N A;  2HZE B;  3ME8 A;  4XIH A;  2D2Z A;  4L8E A;  3E9J B;  2GTU A;  2GS3 A;  1HYU A;  4F0B A;  3A2V A;  1Z7P A;  1KBN A;  5LD0 A;  3R3E A;  1XG8 A;  3E3E A;  3P2A A;  2VCV A;  2DJ3 A;  2E2G A;  4PI0 C;  4QL9 A;  5KN3 A;  5AIS A;  17GS A;  4GQC A;  3IXR A;  2B7K A;  2N5A A;  4JBB A;  2WDU A;  4IJ3 A;  1QK8 A;  2PPT A;  1X9W B;  1CQH A;  3C8E A;  3GFK A;  4W66 A;  1NM3 A;  2N5B A;  3GX8 A;  1X9S B;  3F3Q A;  4IP6 A;  4HOJ A;  4FYB A;  5JWR B;  1T4Y A;  3P8W A;  3GUS A;  3LFL A;  3TU3 B;  4TRX A;  3RGB C;  1MDJ A;  4AJ6 A;  1G6Y A;  1UVZ A;  2MMZ A;  5IMA A;  4IS0 A;  2O5V A;  3QFA C;  2EFE A;  3KMO A;  3HVN A;  2OE1 A;  2GT6 A;  2CZ2 A;  3HJM A;  4X0X A;  1R26 A;  5KN1 A;  1BYE A;  5AIX A;  3UL3 A;  1ERW A;  4IQ1 A;  5ECS A;  3W8J A;  3N5O A;  2GZY A;  1G7O A;  3GUR A;  3G9B A;  2RM6 A;  2LQQ A;  2X99 A;  1K0B A;  5DJL A;  5HR1 A;  5FWG A;  5CNW A;  3CQF A;  2B1K A;  2AHE A;  4TR3 A;  2LNT A;  4I2T A;  4KDY A;  2E7P A;  3ZRE A;  2O89 A;  3ZVJ A;  4ZBB A;  1TU7 A;  4TXO A;  2LTK A;  4HQS A;  3Q6O A;  3L9V A;  2XPE A;  3Q19 A;  1TRW A;  2WW2 A;  2R0P A;  2VIM A;  3HJP A;  2VAF A;  3VFI A;  2QC7 A;  4EKZ A;  4K5R A;  1PSQ A;  5IO2 A;  4MMM A;  3LYP A;  2VD0 A;  1GNE A;  2ZUP A;  1GSE A;  5EY6 A;  2H0H A;  4MF6 A;  1C72 A;  3EU4 A;  4E68 A;  5INY A;  1PN9 A;  2FUG 2;  5KOW A;  1ZYP A;  2OE0 A;  3EVI A;  1BG1 A;  5HR3 A;  3CSI A;  3FW2 A;  2X4A A;  1KTE A;  2F9S A;  1XW6 A;  5IMV A;  3V1W A;  2H6Z A;  4EVM A;  3HJO A;  4H86 A;  3L78 A;  3CHX C;  2VL2 A;  2MMA A;  1HD2 A;  2RM5 A;  1MEK A;  4PUR A;  3GL3 A;  5A34 B;  1SKR B;  3QPM A;  2CVB A;  1GSU A;  3KEB A;  4PI2 C;  2C0G A;  4CDO A;  1SVO A;  5IPG A;  2VL9 A;  2GDR A;  3P7X A;  3IHG A;  5E4W A;  1GLP A;  4MA9 A;  1J08 A;  2O7K A;  4EL1 A;  1YEP A;  1ON4 A;  2H30 A;  5J9B A;  1O8W A;  1GTU A;  1EP7 A;  2VM2 A;  4TN8 A;  4WEY A;  3LYK A;  9GSS A;  3TDG A;  3C71 A;  1SK1 A;  2HT9 A;  5EL8 A;  5JCG A;  4KE3 A;  3TUE A;  4RI7 A;  4G0I A;  2FY6 A;  4LMW A;  2M46 A;  2NTO A;  1FOH A;  3ZFL A;  4V2L A;  14GS A;  1WWJ A;  3FYG A;  2LRN A;  2YNX A;  4KSO A;  1TK8 B;  2DLX A;  4ECI A;  1QUW A;  2V41 A; 
#chains in the Genus database with same CATH homology
 3GN3 A;  4GF0 A;  6GSY A;  1HNB A;  1ZYE A;  2DKI A;  3FMW A;  6GSU A;  3BD2 A;  2HRN A;  3FEU A;  5COH A;  3TJJ A;  3LOR A;  3MNG A;  1U3I A;  2GQK A;  1OAZ A;  3IPZ A;  3APQ A;  2L5L A;  3ZZX A;  1XFL A;  2HSM B;  2B6M A;  1EEM A;  2L4Q A;  4EC0 A;  2BMX A;  3TKR A;  2K9F A;  1OC9 A;  3IOS A;  2C3Q A;  2YP6 A;  2TIR A;  1SKS B;  2WGR A;  1TDI A;  2MZC A;  1FB6 A;  2A2P A;  3NOF A;  2KLX A;  3A2X A;  5L71 A;  4E8E A;  2WJU A;  2C8U A;  3TRP A;  1T4Z A;  4WR5 A;  4QL7 A;  5DAK B;  1DE2 A;  1FB0 A;  2GQM A;  2CX4 A;  5D73 A;  3TRX A;  1K0N A;  1F3A A;  4QMK A;  1U88 A;  4ZL7 A;  5ECP B;  1YF0 A;  2JZT A;  4POK A;  3CXG A;  5DAL B;  5B8B A;  3F63 A;  4K2X A;  3IAM 2;  1B48 A;  2LRC A;  2H1A A;  2KOK A;  1JZW A;  1SVL A;  6GST A;  2HRK A;  3QAV A;  4IGJ A;  5GZZ B;  3TJB A;  2XHF A;  1PX6 A;  3CYN A;  4TR1 B;  5F07 A;  3KCM A;  3N9J A;  2X8G A;  1AQW A;  4IVF A;  3GMF A;  1M9B A;  5ELG A;  2CVD A;  3ISO A;  2IPA A;  4KDU A;  1TXU A;  2DJ1 A;  3KD0 A;  5B8A A;  4QQ7 A;  2YV7 A;  2VD1 A;  1VF3 A;  3BOA A;  1XPV A;  1F2E A;  1FVJ A;  2PER A;  3WD6 A;  3GKN A;  3IE3 A;  3IHQ A;  1TP9 A;  2YPM A;  2FA4 A;  4K6X A;  5DDL A;  1GLQ A;  5D9W A;  2M72 A;  2AYT A;  2IWT A;  2KHP A;  2H6X A;  5HR2 A;  3FR9 A;  3L4N A;  4N3Z A;  3C73 A;  4OFN A;  4EDY A;  3D0Z A;  2EFD A;  1JZO A;  5KN0 A;  4Q5F A;  4EO3 A;  5ECQ B;  4EE0 A;  1IYH A;  2RII A;  1AQV A;  3MAK A;  3HZ4 A;  3CSH A;  4AKI A;  2TRC P;  2DML A;  3GRX A;  1K0M A;  1URM A;  1O6J A;  2HSY A;  2NBS A;  1JLW A;  4ZL9 A;  4G01 A;  3QOU A;  2KUC A;  2K18 A;  4KA0 A;  3TJF A;  5LCZ A;  2LJA A;  3WT1 A;  5BMU A;  5IQY A;  4ZB8 A;  2IMK A;  3U5R E;  3ZIJ A;  4PQH A;  2E2M A;  2H74 A;  3RBT A;  2WFC A;  5F0G A;  2H70 A;  3KGK A;  1T7P B;  2C0F A;  1FAA A;  2HRF A;  1VF2 A;  4YAP A;  3ZIV A;  4Q5N A;  2HXK A;  2C3N A;  4GXZ A;  5G30 A;  3PH9 A;  1YJ6 A;  1A2J A;  2C4J A;  2R5G A;  5A1N B;  2O85 A;  2CVK A;  2RUE A;  4MLY A;  4WF4 A;  2OBK A;  1K0O A;  4XS4 B;  2C0D A;  1R5P A;  6GSW A;  1JZD A;  3M0F A;  2YN1 A;  4ISD A;  1V9W A;  3QFB C;  4AKH A;  1UN2 A;  2L6C A;  1EV4 A;  4DVC A;  1TOF A;  5FHI A;  5J4Y A;  2VLU A;  1XVQ A;  1E2Y A;  2DJJ A;  16GS A;  3LQ7 A;  1A0R P;  2A2S A;  2WB9 A;  3LEF A;  4ID0 A;  4PNF A;  3UBK A;  4I97 A;  4FH8 A;  1NHY A;  2OJL A;  1QFN A;  3K8N A;  2WCI A;  3DD3 A;  1EWX A;  4MH2 A;  1XW9 A;  1E6B A;  4KDX A;  3KXO A;  2HQT A;  1XWG A;  4DSS A;  5IOX A;  2B7J A;  2YWI A;  2LQO A;  1TK5 B;  1AC1 A;  2RUF A;  5HFI A;  3LW9 A;  3IBH A;  4K7N A;  5CRD A;  5DVB A;  1GSY A;  4CHS A;  4MZC A;  3HA9 A;  4NV2 A;  3ZRD A;  4KAE A;  2BJX A;  1PX7 A;  2JL4 A;  4G0L A;  2YZH A;  4KF9 A;  1QQ2 A;  1S3D A;  1M7T A;  4K7O A;  3EWL A;  3U6V A;  5HFG A;  3KP9 A;  5B6N A;  3CRU A;  4Z2T A;  1WJK A;  3TKS A;  4XTS A;  2GSS A;  5F05 A;  1Z7R A;  4PUF C;  1GSS A;  3DEX A;  2DMM A;  4JU5 A;  2C0E A;  1Y25 A;  3UOM A;  4G9H A;  1U3A A;  2QA2 A;  1ZMA A;  1B4P A;  2HZE A;  2H8L A;  3APS A;  2QKE A;  4MJE A;  1V2A A;  1HNA A;  4N30 A;  1GTI A;  5GAN D;  2OE3 A;  4KB3 A;  4X43 A;  2GST A;  4K2D A;  1O81 A;  1PMT A;  1VF4 A;  3DWV A;  3MSZ A;  2H1L A;  4MP4 A;  1PRX A;  2CA8 A;  1GSQ A;  1FW1 A;  2LEG A;  3ERW A;  4F82 A;  2OAD A;  4PUA A;  3GTU B;  5B7C A;  4NPB A;  1G7E A;  1TJD A;  4L5O A;  3HXS A;  4G10 A;  4LL1 B;  4L5L A;  3VWV A;  3D4T A;  2VCZ A;  4OCE A;  3I69 A;  1XWA A;  3GNJ A;  3MYD A;  1WE0 A;  2QA1 A;  3VI7 A;  3HYP A;  1USB A;  2VO4 A;  2CT6 A;  3LSZ A;  5DJM A;  4NWY A;  4WR4 A;  3EU3 A;  4Q5Q A;  5J40 A;  1F37 A;  3IAS 2;  19GS A;  2IMF A;  4GLT A;  4BVY B;  20GS A;  4MF5 A;  1R5A A;  4TXV A;  4D73 B;  5IMZ A;  1SKW B;  2V6K A;  1Z6N A;  3VWU A;  2ON5 A;  3M8N A;  1B4Q A;  3G7Y A;  1MDK A;  5A4U A;  2LUS A;  1GWC A;  4F2I A;  1SD9 A;  4ECC A;  3HVV A;  1YDK A;  4PX1 A;  3DGQ A;  3QAG A;  4PNG A;  1M0U A;  2YOI A;  3GV1 A;  1T1V A;  1G0T A;  4A5P A;  4IW9 A;  2WRT A;  4NHZ A;  4POM A;  4ILF A;  3TRQ A;  1WPI A;  2V1M A;  2MYG A;  1R4W A;  2I81 A;  3DIE A;  2F3M A;  2OA7 A;  5A5H B;  4AKG A;  3P90 A;  5H5Q A;  3RHB A;  1GTB A;  3M1G A;  3IDV A;  4N10 A;  2JSY A;  4KUN A;  3L9U A;  1F9M A;  4CY6 A;  2OBI A;  4OO5 A;  3KM6 A;  5ENU A;  3EMX A;  2IN3 A;  1XWK A;  2TRX A;  4L0U A;  1W89 A;  4ZXG A;  1BJX A;  5DQS A;  2MBS A;  4MF7 A;  5D96 A;  1WOU A;  4ML6 A;  2HRA A;  1V57 A;  4JR6 A;  5ECM B;  2PVO C;  1GNW A;  3KTL A;  1BF5 A;  3GHA A;  2YZU A;  4BVX B;  2JZR A;  4POB A;  4MZB A;  1MTC A;  5A34 A;  3UAR A;  2HNL A;  4MCU A;  1WIK A;  1N25 A;  5G31 A;  4O5U A;  2ES7 A;  2WZ9 A;  4HZ4 A;  5B6M A;  1THO A;  4K0N A;  2IMD A;  3ED3 A;  2H1G A;  1DUG A;  3G7I A;  2FNO A;  1KEB A;  1O73 A;  3F9U A;  4O7H A;  4Z2U A;  3CTG A;  5JWO B;  1GRX A;  2PBJ A;  3IK7 A;  5ELA A;  2PMT A;  1ST9 A;  1PQN A;  2N5F A;  1ML6 A;  3D22 A;  3CBU A;  5G2Z A;  3PPU A;  2QSI A;  3F4S A;  2IME A;  2MMO A;  1M9A A;  2VL3 A;  5AGY A;  1CQG A;  3F0I A;  2JZS A;  1GTA A;  5J4U A;  4IBP A;  4GTU A;  3TKS E;  3JCM L;  2PWJ A;  2R0G A;  1XZO A;  1X5C A;  5ECI B;  5CP1 A;  3H1N A;  4MH3 A;  5HFK A;  3GYK A;  5A5K A;  3F4R A;  3WGD A;  4V1A p;  2I1U A;  3I6A A;  2AJQ B;  5F8B A;  3HVS A;  5D9X A;  3VPQ A;  4ZBD A;  2HSM A;  4K9Z A;  3ZIT A;  1BAY A;  2B5X A;  4XRD A;  2R37 A;  1ZGN A;  4TOP A;  1SL1 B;  3F6D A;  5AN1 A;  2GZP A;  4L0W A;  3FZ5 A;  4AJ7 A;  5GAP D;  3CWG A;  2R3X A;  1H4O A;  3D5J A;  1K0A A;  3GKK A;  1OC3 A;  4OCF A;  3NIV A;  4HU9 A;  3C1R A;  5DAK A;  4AF2 A;  3QR6 A;  1SYR A;  5IIZ A;  2DJK A;  2LJR A;  4Z2R A;  1PA3 A;  2OT3 A;  5CRH A;  4FO5 A;  2L6D A;  4JE1 A;  1ZL9 A;  2C80 A;  1ZOF A;  5ID2 B;  5DAL A;  1XWB A;  3TJG A;  5IOW A;  3I43 A;  3HVX A;  1FHE A;  1Z3E A;  5G1L A;  2R0C A;  3IC4 A;  1YF1 A;  1ZYQ B;  5J5N A;  2H1B A;  4TR1 A;  3RHC A;  2H75 A;  1EOG A;  4F03 A;  4HZ2 A;  4BPY A;  4YQV A;  4OMV A;  4LA1 A;  2X8H A;  1K3Y A;  2E0Q A;  2LS5 A;  2NDO A;  2C3T A;  5ECR B;  1AXD A;  5J9C A;  5CO3 A;  4NV5 A;  2IL3 A;  4GCI A;  2LRT A;  2FD3 A;  4OD7 A;  4POL A;  3IC8 A;  2HFD A;  3GX0 A;  3H4K A;  3PGT A;  4K5S A;  4EF0 A;  2H6Y A;  4MJB A;  4OFM A;  2CAQ A;  1NW2 A;  1A24 A;  3UEM A;  2HLS A;  3IA1 A;  3C1S A;  8GSS A;  3O6T A;  1M2A A;  4MAB A;  3UAP A;  2H1D A;  10GS A;  4ULX A;  2CQ9 A;  4BL7 B;  4OO4 A;  4Q5R A;  4CW9 A;  3EC3 A;  1Z5Y E;  1V98 A;  1HNC A;  2HSH A;  3VK9 A;  4ML1 A;  6GSX A;  4OFT A;  2ON7 A;  1Y6E A;  4MJC A;  4O5Q A;  1TRV A;  1K0D A;  5C04 A;  2HE3 A;  1YZX A;  3E0U A;  1I9D A;  3J7Y b;  4EIP A;  2VCT A;  1XW5 A;  1GUK A;  3TGZ A;  4ICY A;  2IMI A;  3LXT A;  3TCO A;  5JCW A;  5DCH A;  2H01 A;  3HDC A;  1WRY A;  3F3R A;  2A2R A;  3IRA A;  2GSR A;  3TOT A;  3QD9 A;  3HMJ G;  3VLN A;  1SK0 A;  3EMP A;  3UIW A;  5A1N A;  1SJ6 A;  4G19 A;  3DML A;  1U87 A;  4KCA A;  5CYY A;  1JZR A;  2FA8 A;  4XS4 A;  4TR0 A;  5ECL B;  4FQU A;  4PQI A;  3ZFB A;  3L9S A;  4I8B A;  5IM9 A;  2XBQ A;  4LLR A;  4G0K A;  5ECO B;  1A2M A;  4O92 A;  1Q4J A;  4HUA A;  3GA4 A;  1DBY A;  4KX4 A;  4V2M A;  2RLI A;  3LWA A;  1EOH A;  4GRF A;  5EVO A;  1FOV A;  4N0V A;  3TJK A;  5G1K A;  5DBQ A;  3I9V 2;  4MK3 A;  1SL2 B;  1AUC A;  3FKF A;  3MWH A;  1AQX A;  1QMV A;  2HZF A;  3DRN A;  3EE2 A;  1XCC A;  4FIW A;  3FR3 A;  3CSJ A;  3GH6 A;  2GZZ A;  5C00 A;  5HR0 A;  4HU7 A;  1LU4 A;  1W4V A;  3GL5 A;  3RPN A;  2LKU A;  4USS A;  3TKP A;  1EP8 A;  4ACS A;  2IJY A;  1TKD B;  2XPD A;  2BTO T;  1EGR A;  1OYJ A;  2F8F A;  3KIJ A;  4O5R A;  2DC5 A;  4EXJ A;  4TKY A;  3ZYW A;  1T00 A;  1SJZ A;  2IFQ B;  1OKT A;  4JZQ A;  4WBR D;  3CRT A;  1TRS A;  1F3B A;  1B8X A;  3A5I A;  3ZLP A;  3LGC A;  4I6X A;  1DE1 A;  5J47 A;  1K3O A;  5D9V A;  4IN0 A;  4YAV A;  1GUL A;  4YKG A;  7GSS A;  3ZVJ D;  4X4J A;  4AGS A;  4GDF A;  1BQ7 A;  1GP1 A;  4ECB A;  2XC2 A;  4ZL8 A;  2H73 A;  3F8U A;  1XBS A;  2VCX A;  3VWW A;  1AW9 A;  1O85 A;  2VKZ G;  2WUL A;  2CX3 A;  3KP8 A;  2HSN B;  4ZB6 A;  1OC8 A;  4N0Z A;  4FYU A;  3APO A;  4JRR A;  1GUH A;  2JAD A;  3US3 A;  1PKZ A;  4HI7 A;  3BBY A;  3GTU A;  3ERF A;  4G2E A;  4RI6 A;  5D93 A;  18GS A;  3BJ5 A;  1ERV A;  3VUR A;  2NVL A;  2L5O A;  1DSB A;  4YQM A;  1RQM A;  5A4V A;  4WXT A;  3IV4 A;  2L57 A;  1UA5 A;  1A8Y A;  3ERG A;  1GSD A;  4PGT A;  2EC4 A;  1PD2 1;  2PUK C;  1FO5 A;  4BVY A;  4GST A;  4EDZ A;  3KMN A;  1GUM A;  5CRG A;  3GIX A;  2P5R A;  4RQR A;  4D73 A;  4KH7 A;  2B5Y A;  1PKW A;  1AAZ A;  4RUV A;  5KOX A;  2M80 A;  3HD5 A;  4IHU A;  3WT2 A;  5AIV A;  2PU9 C;  4N11 A;  2V32 A;  1THX A;  3PR8 A;  2H76 A;  5F06 A;  3F4T A;  1TTZ A;  11GS A;  3VI5 A;  2P0G A;  1SL0 B;  2DSA A;  1X5D A;  1XWC A;  2FGX A;  1VGL A;  5ABR A;  4IP1 A;  1O8X A;  1LJR A;  3ME7 A;  2V2G A;  4XS1 A;  5DCG A;  5A5H A;  5A4W A;  5CRW A;  2MBT A;  2P31 A;  4KW6 A;  4F0C A;  2PGT A;  4EUY A;  4K8M A;  5GST A;  2VOC A;  1X0R A;  1A0F A;  3FZ9 A;  1U6T A;  3FHK A;  1BX9 A;  1S3A A;  2DJ2 A;  4YQU A;  1YKC A;  1B9X C;  3LJR A;  4DSR A;  5J3R A;  4AI6 A;  2X49 A;  4BVX A;  1PN0 A;  5J4V A;  4IEL A;  2J23 A;  3KTB A;  4TXO B;  2DBC A;  1RK4 A;  1WP0 A;  2C1Y A;  4XCS A;  1AIU A;  1MD4 A;  2WS2 A;  1XOB A;  4MPG A;  3LG6 A;  2R4V A;  2YWN A;  3KH7 A;  2B5E A;  22GS A;  4XHM A;  1EZK A;  4DSQ A;  4CY8 A;  4AJ8 A;  3VPT A;  5D9T A;  3W8S A;  2EFC A;  3KJY A;  4JED A;  2LV3 A;  4KCE A;  12GS A;  2VCQ A;  4NAX A;  2ALB A;  1PGT A;  2FWG A;  3CMI A;  3H79 A;  2VLV A;  3VWX A;  2R2J A;  2F51 A;  5ECK B;  4HEA 2;  3SWL A;  2VL2 C;  4TW5 A;  2L4C A;  5DQY A;  2H0G A;  4MNN A;  4TR4 A;  2J9H A;  2VUP A;  1FG4 A;  1RW1 A;  1YQ1 A;  2I3Y A;  1X9M B;  2DJ0 A;  3KH9 A;  3R2Q A;  1OE8 A;  2YCD A;  4ZIJ A;  4HJ2 A;  1A2L A;  4MDC A;  3TKQ A;  1FVK A;  2DKH A;  4XS6 A;  2H0I A;  1VRS D;  1EEJ A;  4YH2 A;  2H19 A;  5EPF A;  1G6W A;  2G0F A;  2JU5 A;  2AUV A;  2Z9S A;  1N2A A;  4GQF A;  4NMU A;  3HHV A;  1TI3 A;  4P3Y B;  1O7U A;  1TW9 A;  2H72 A;  4FYC A;  5IO0 A;  1TK0 B;  4IQA A;  2FWE A;  4ZIL A;  5H5R A;  1ERU A;  1T3B A;  3MDK A;  3A3T A;  5FT3 A;  2ZNM A;  3L0H A;  4MJA A;  2VLT A;  5HQP A;  4KSM A;  3WYW A;  1ABA A;  1SEN A;  3ZL5 A;  1TXX A;  2QGV A;  2VCW A;  3GKM A;  2HYX A;  1N8J A;  5ID2 A;  4X1U A;  3UVT A;  2YJ7 A;  2GLR A;  2KP2 A;  2CZ3 A;  4E8H A;  3IR4 A;  4NXI A;  5ECN B;  2VM1 A;  1GH2 A;  4K0G A;  5CAX A;  1Z6M A;  3HKR A;  1M2B A;  5IMF A;  4LMV A;  1F6M C;  3G7J A;  4K1F A;  1UC7 A;  1ACV A;  4OWY A;  1OC9 B;  4GWR A;  1J0F A;  4WKW A;  2GSQ A;  2R6K A;  2I4A A;  2LJK A;  2X8C A;  3GST A;  3EUR A;  2KP1 A;  2AB6 A;  4ZB9 A;  3IK9 A;  1MD3 A;  4I2U A;  4PQ1 A;  4NHW A;  2B1L A;  6GSV A;  2XBI A;  4HJM A;  1K3L A;  2A4H A;  3TOU A;  4TVE A;  3PIN A;  5ECH B;  2CAI A;  1GSF A;  1XXU A;  3UJ1 A;  1J9B A;  3F6F A;  4ZBA A;  3J7Y k;  1OVN A;  2EIR A;  3GSS A;  2FLS A;  2HRK B;  3ZML A;  1XOA A;  2FCH A;  2HI7 A;  3D21 A;  2GQL A;  1R7H A;  3QDN A;  3FZA A;  1A8L A;  2X64 A;  2YAN A;  4BL7 A;  3HZ8 A;  3AY8 A;  2OAC A;  2EIO A;  4LL4 B;  3MIX A;  1IYI A;  2K8V A;  1EV9 A;  1JFU A;  2O8V B;  2YWM A;  3A2W A;  3DVX A;  1LBK A;  2PN8 A;  1TU8 A;  4PTS A;  3UBL A;  2H66 A;  3D4M A;  5H5S A;  2PVQ A;  1M99 A;  4XRA A;  1XVW A;  5G5E A;  1Q98 A;  2GT5 A;  1JLV A;  1S3C A;  2V6O A;  4BWQ A;  3ZMK A;  2B3S A;  3SBC A;  2GVP A;  2ZCT A;  3EIN A;  4RQX A;  3WGX A;  2DIZ A;  5E59 A;  1K0C A;  4K7I A;  1TI1 A;  1KNG A;  1OE7 A;  3UVH A;  2EIQ A;  3Q74 A;  1H75 A;  4WBJ A;  3NZN A;  3QAW A;  1PL1 A;  5BMU B;  1A23 A;  2AAW A;  1XIY A;  2GGT A;  4BA7 A;  4O32 A;  2G2Q A;  3FK8 A;  4WET A;  2O87 A;  1EGO A;  13GS A;  5CRE A;  4I5Q A;  3S9F A;  4GSN A;  3CTF A;  5D8I A;  3M3M A;  3FY7 A;  2IIY A;  3GKX A;  5JCU A;  4ECJ A;  3BCK A;  4Z7X A;  1ERT A;  3RPP A;  2P5Q A;  1HQO A;  5JWQ B;  2FHE A;  3WGE A;  1WMJ A;  3C7M A;  1YVL A;  2I9H A;  4YKF A;  3RAZ A;  5KEJ A;  1NHO A;  1BED A;  1OKD A;  1ILO A;  1NSW A;  5IMD A;  3LXZ A;  4J2F A;  2EFH A;  3O76 A;  3QCP A;  2YWO A;  3KZQ A;  1QXH A;  2H71 A;  1I5G A;  1B9Y C;  2CV4 A;  2FWF A;  3A5W A;  1SU9 A;  2LNS A;  1V40 A;  2YJH A;  3O3T A;  6GSS A;  3D6I A;  3HCZ A;  3DXB A;  2UZ8 A;  3FR6 A;  4AKX B;  3QMX A;  4IJI A;  4HQZ A;  5G5F A;  4EIQ A;  1GL8 A;  2K8S A;  1ZYN A;  3EYT A;  2DIY A;  4DEJ A;  4MZW A;  1V58 A;  1VF1 A;  4WF5 A;  3H8Q A;  1YEX A;  1SK2 A;  1ZCP A;  2IFQ A;  3GH9 A;  2FWH A;  1SVM A;  1YY7 A;  1PL2 A;  1TRU A;  2YV9 A;  4BWS A;  5J41 A;  1X5E A;  1Y1U A;  4PXO A;  3RDW A;  2JAC A;  5KN2 A;  1SJI A;  4JR4 A;  4DSS B;  1QGV A;  3DYR A;  1BG5 A;  2L59 A;  3W6G A;  4J57 E;  1Z9H A;  4IKH A;  2K6V A;  2AV4 A;  3TB2 A;  5GSS A;  4F9Z A;  3M9K A;  3Q18 A;  3OR5 A;  4HS1 A;  4KGI A;  4HDE A;  5LNK e;  5BRT A;  1T8E B;  3H93 A;  1MDI A;  4J56 E;  1M2D A;  2HSN A;  3EPT A;  1JHB A;  3M9J A;  2REM A;  3DVW A;  5IPH A;  2UV8 G;  2A4V A;  3TKS C;  3FZ4 A;  4V1A g;  3ZTL A;  2LST A;  4MPF A;  4ZB7 A;  3UMA A;  2F8A A;  3FRC A;  2MMN A;  3HY2 A;  3DKS A;  1SD8 A;  2JSZ A;  1SYX A;  2NPB A;  4KND A;  4GSS A;  5IMC A;  3BCI A;  1YKA A;  1ZZY A;  2OKA A;  4V2N A;  2HZE B;  3ME8 A;  4XIH A;  2D2Z A;  4L8E A;  3E9J B;  2GTU A;  2GS3 A;  1HYU A;  4F0B A;  3A2V A;  1Z7P A;  1KBN A;  5LD0 A;  3R3E A;  3E3E A;  3P2A A;  2VCV A;  2DJ3 A;  2E2G A;  4QL9 A;  5KN3 A;  5AIS A;  17GS A;  4GQC A;  3IXR A;  2B7K A;  2N5A A;  4JBB A;  2WDU A;  4IJ3 A;  1QK8 A;  2PPT A;  1X9W B;  1CQH A;  3C8E A;  3GFK A;  4W66 A;  1NM3 A;  2N5B A;  3GX8 A;  1X9S B;  3F3Q A;  4IP6 A;  4HOJ A;  4FYB A;  5JWR B;  1T4Y A;  3P8W A;  3GUS A;  3LFL A;  3TU3 B;  4TRX A;  1MDJ A;  4AJ6 A;  1G6Y A;  1UVZ A;  2MMZ A;  5IMA A;  4IS0 A;  2O5V A;  3QFA C;  2EFE A;  3KMO A;  2OE1 A;  2GT6 A;  2CZ2 A;  3HJM A;  4X0X A;  1R26 A;  5KN1 A;  1BYE A;  5AIX A;  3UL3 A;  1ERW A;  4IQ1 A;  5ECS A;  3W8J A;  3N5O A;  2GZY A;  1G7O A;  3GUR A;  3G9B A;  2RM6 A;  2LQQ A;  2X99 A;  1K0B A;  5DJL A;  5HR1 A;  5FWG A;  5CNW A;  2B1K A;  2AHE A;  4TR3 A;  2LNT A;  4I2T A;  4KDY A;  2E7P A;  3ZRE A;  2O89 A;  3ZVJ A;  4ZBB A;  1TU7 A;  4TXO A;  2LTK A;  4HQS A;  3Q6O A;  3L9V A;  2XPE A;  3Q19 A;  1TRW A;  2R0P A;  2VIM A;  3HJP A;  2VAF A;  3VFI A;  2QC7 A;  4EKZ A;  4K5R A;  1PSQ A;  5IO2 A;  4MMM A;  3LYP A;  2VD0 A;  1GNE A;  2ZUP A;  1GSE A;  5EY6 A;  2H0H A;  4MF6 A;  1C72 A;  3EU4 A;  4E68 A;  5INY A;  1PN9 A;  2FUG 2;  5KOW A;  1ZYP A;  2OE0 A;  3EVI A;  1BG1 A;  5HR3 A;  3CSI A;  3FW2 A;  2X4A A;  1KTE A;  2F9S A;  1XW6 A;  5IMV A;  3V1W A;  2H6Z A;  4EVM A;  3HJO A;  4H86 A;  3L78 A;  2VL2 A;  2MMA A;  1HD2 A;  2RM5 A;  1MEK A;  4PUR A;  3GL3 A;  5A34 B;  1SKR B;  3QPM A;  2CVB A;  1GSU A;  3KEB A;  2C0G A;  4CDO A;  1SVO A;  5IPG A;  2VL9 A;  2GDR A;  3P7X A;  3IHG A;  5E4W A;  1GLP A;  4MA9 A;  1J08 A;  2O7K A;  4EL1 A;  1YEP A;  1ON4 A;  2H30 A;  5J9B A;  1O8W A;  1GTU A;  1EP7 A;  2VM2 A;  4TN8 A;  4WEY A;  3LYK A;  9GSS A;  3TDG A;  3C71 A;  1SK1 A;  2HT9 A;  5EL8 A;  5JCG A;  4KE3 A;  3TUE A;  4RI7 A;  4G0I A;  2FY6 A;  4LMW A;  2M46 A;  2NTO A;  1FOH A;  3ZFL A;  4V2L A;  14GS A;  1WWJ A;  3FYG A;  2LRN A;  2YNX A;  4KSO A;  1TK8 B;  2DLX A;  4ECI A;  1QUW A;  2V41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...