4USSA

Populus trichocarpa glutathione transferase x1-1 (ghr1), complexed with glutathione
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
306
structure length
306
Chain Sequence
TASTFRNFISKEPNSQFPPESGRYHLYVSYACPWASRCLAYLKIKGLEKAIAFTSVKPIWERTKESDEHMGWVFPASETEEAGAEPDTLNGARSIRELYELASTNYAGKYTVPVLWDKKLKTIVNNESSEIIRMFNTEFNDIAENAALDLYPSHLQAQIDETNGWVYDGINNGVYKCGFARKQGPYEEAAIQLYEALDKCEEILGRQRYICGNTLSEADIKLFVTLIRFDEVYAVHFKCNKKLLRDYPNMFNYTKDIFQIPGMSSTVNMQHIKRHYYGSHPTVNPFGIIPLGPDIDYSSPHDRNRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glutathionyl-Hydroquinone Reductases from Poplar are Plastidial Proteins that Deglutathionylate Both Reduced and Oxidized Glutathionylated Quinones.
pubmed doi rcsb
molecule keywords GLUTATHIONYL HYDROQUINONE REDUCTASE
molecule tags Transferase
source organism Populus trichocarpa
total genus 99
structure length 306
sequence length 306
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ussA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ussA01
1XW5A 3VLNA 5A4WA 4PQIA 1HQOA 4ECBA 1MTCA 2V6KA 1K0DA 2C3NA 3F63A 4GLTA 2HSMB 2J9HA 1TDIA 1BG5A 3CSJA 1B48A 4PNFA 1HNBA 2CAQA 4GSTA 1GSUA 3CSIA 1HNAA 4ZBDA 2UZ8A 5D9WA 4RI7A 3LYKA 4IBPA 1VF1A 3D0ZA 4KDUA 1XW6A 1BX9A 4KSMA 1YY7A 4IELA 5JCUA 3QAVA 10GSA 5DQSA 2AB6A 3GTUB 3LFLA 4ZB8A 1M0UA 1ML6A 2GSQA 2CA8A 2DSAA 4KH7A 4ACSA 4KDYA 2HRKB 1EEMA 3BBYA 2C4JA 5J4UA 5J5NA 20GSA 2DC5A 1M9AA 5A4UA 3EE2A 4NHWA 6GSTA 2HRAA 2VO4A 4KX4A 1IYHA 4O7HA 5DDLA 4PX1A 3LQ7A 1DUGA 1A0FA 3IK7A 1U87A 1EOGA 4K0NA 1K3OA 5ECPB 5B7CA 3LJRA 2PERA 1B8XA 3F6DA 5FWGA 1GULA 3MAKA 1VF3A 1PGTA 3P8WA 1K3LA 4F0CA 4EDYA 3W8SA 22GSA 4BVXA 1U88A 4QQ7A 3UARA 1V40A 4IS0A 4E8EA 1USBA 4KDXA 3UVHA 3QAWA 4OFNA 2CZ2A 5BMUA 1F2EA 3VK9A 4CHSA 3HJMA 1FHEA 5HFKA 2PGTA 4YQMA 5AIVA 3KMNA 6GSWA 3ZMKA 2PVQA 3UBLA 4KAEA 1LJRA 2GSRA 1JLVA 3GTUA 3LXTA 1IYIA 4MF7A 3ZFBA 4EXJA 3CRTA 5LD0A 1R5AA 2VCTA 4I97A 2HRKA 3LXZA 3ISOA 4MPGA 3PPUA 5AN1A 4KE3A 2C3QA 3Q18A 2WDUA 3GUSA 11GSA 2R6KA 3FR6A 5ELGA 4KGIA 3U6VA 1B4PA 1U3IA 5F8BA 1TU7A 5ECHB 3HKRA 1ZL9A 5F0GA 1PX6A 2N5FA 4JZQA 5FT3A 3VI5A 2YV9A 4PURA 3LG6A 1EV9A 2VD0A 3N5OA 5EL8A 3LYPA 3M8NA 4ID0A 2OA7A 5D9VA 2FHEA 2HQTA 4NAXA 2JL4A 4PUAA 4GTUA 5FHIA 4TOPA 4Q5FA 4ECCA 3KMOA 6GSVA 4HZ2A 3ZFLA 4NHZA 1M99A 1YQ1A 5ECSA 19GSA 3AY8A 4BVXB 1C72A 2CVDA 3IR4A 1G6YA 4IJIA 3L0HA 1GSSA 4Q5QA 1GNWA 3CSHA 1GWCA 1LBKA 4GCIA 1JLWA 4N0VA 1GTUA 3M0FA 1OKTA 1ZGNA 2YV7A 3M1GA 1AQVA 1AQWA 4FQUA 2VCZA 4YAVA 4IKHA 1K0BA 18GSA 4G9HA 4YH2A 1AW9A 4GSSA 4ZXGA 6GSUA 6GSXA 1YKCA 3KXOA 3EINA 4EDZA 8GSSA 1K3YA 1F3BA 2LJRA 5KEJA 1RK4A 4RI6A 3UAPA 1NHYA 3LSZA 5ELAA 4HI7A 3TGZA 4MDCA 4Q5NA 2C3TA 5AGYA 4ISDA 3GSSA 4OFMA 3GH6A 5G5EA 2YCDA 3I6AA 4WR4A 3VPTA 4MPFA 1XWGA 1PL1A 4JEDA 2NTOA 3TOUA 1GSDA 3IK9A 5AISA 1EOHA 4ZB9A 1PA3A 4BVYB 1G6WA 1PX7A 2CAIA 17GSA 1AXDA 5DALB 3VURA 2D2ZA 2PMTA 4LMVA 4O92A 5ECMB 1K0NA 1GLQA 2AHEA 1GUMA 5D73A 5ECQB 5F07A 1BYEA 1PD21 5IQYA 4WR5A 4K0GA 3N9JA 3RBTA 1GNEA 5ECKB 3O76A 5DJLA 5LCZA 2X64A 3MDKA 2C80A 3DGQA 1MD4A 2WB9A 3M3MA 3KJYA 4L8EA 3WYWA 3G7IA 1K0OA 1GSFA 2IMKA 2VCXA 4YAPA 4HOJA 4G0KA 3ERFA 3HJOA 1OYJA 1PKWA 4YQUA 3O3TA 4AGSA 1OE8A 1VF2A 4PGTA 1GUKA 1GTIA 1E6BA 3QR6A 4KF9A 5AIXA 4BVYA 3KM6A 2GSTA 4EC0A 4MF6A 2OACA 4DEJA 3FYGA 4OFTA 5GSTA 2IL3A 3Q74A 2ON7A 5EY6A 1G7OA 5DALA 2PBJA 1PN9A 4OMVA 5F05A 1JZRA 4LMWA 2F3MA 1Q4JA 9GSSA 1PL2A 5G5FA 2OADA 1XWKA 3NIVA 1GTBA 3FRCA 1AQXA 2F8FA 3GSTA 1YJ6A 2R3XA 6GSSA 4G0LA 5DAKB 1TW9A 2GDRA 4PNGA 5D9TA 2CZ3A 3WD6A 4BL7B 3R3EA 3FY7A 3PR8A 3CRUA 4IW9A 4ZBBA 5J41A 1GSEA 1GSQA 5ECOB 1GSYA 4EE0A 1MD3A 1HNCA 4L5OA 5F06A 3VWXA 4IGJA 3ZMLA 3QAGA 1UA5A 1YDKA 1BAYA 4GSNA 1PKZA 1OE7A 5GZZB 3H1NA 5ECLB 1GLPA 3IBHA 4IQ1A 4GF0A 3SWLA 1TU8A 2WRTA 4YQVA 4HZ4A 1V2AA 4MP4A 12GSA 4Q5RA 5ECRB 4L5LA 5A5KA 4F03A 1Z9HA 4IVFA 1FW1A 1N2AA 7GSSA 14GSA 6GSYA 2VCQA 4MK3A 4IQAA 2HNLA 1KBNA 4MF5A 3R2QA 3VI7A 2GTUA 5DCGA 3GX0A 2HSMA 1M9BA 3Q19A 2GSSA 3G7JA 3KTLA 3DD3A 2AAWA 3GURA 4PXOA 5DJMA 2WS2A 3FR3A 5A4VA 4ZBAA 1EV4A 2IMIA 4F0BA 4J2FA 3VPQA 4ECIA 3FR9A 1Y6EA 5EVOA 5DAKA 2A2SA 4G19A 4JBBA 4BL7A 4HJ2A 3IE3A 3UBKA 2GLRA 3TOTA 4ECJA 1PMTA 1GUHA 2HSNB 3I69A 4G0IA 2VD1A 5ECIB 4E8HA 1F3AA 2R4VA 5ECNB 1VF4A 2FNOA 4G10A 5D9XA 3CBUA 3P90A 1K0AA 2A2RA 16GSA 2VCWA 4ZB6A 4PQHA 2R5GA 3PGTA 4MZWA 5JCWA 3ERGA 13GSA 4USSA 1K0CA 2ON5A 2C8UA 2VCVA 4PTSA 1K0MA 3F6FA 1GTAA 2WJUA 3C8EA 3IC8A 5GSSA
chains in the Genus database with same CATH superfamily
2GGTA 3VLNA 4PQIA 1HQOA 2QA1A 3HCZA 4ZILA 1M2BA 5HR0A 2GZPA 2H1GA 2HSMB 3BCIA 4OO5A 4ICYA 5BMUB 4PNFA 2DLXA 2CAQA 4N11A 3DVXA 4NV2A 1A2MA 4GSTA 1HNAA 2FD3A 3NZNA 2UZ8A 2MBTA 4IBPA 1VF1A 1FVKA 4KDUA 1O6JA 4KSMA 4IELA 5JCUA 3QAVA 4K7OA 2AB6A 3GTUB 1BG1A 3LFLA 3BJ5A 2GQMA 4KH7A 1ERWA 3ME8A 3BBYA 2BMXA 20GSA 2IN3A 2XHFA 4TN8A 5A4UA 2LQOA 1UVZA 4NHWA 2VO4A 4KX4A 1ZMAA 4PX1A 4Z2TA 1DUGA 1A0FA 2DIZA 4A5PA 1XWBA 1EOGA 2L6DA 5B7CA 4PQ1A 3F6DA 5FWGA 4MH2A 2VLTA 1PGTA 3UL3A 1TK8B 1K3LA 3QFAC 4EDYA 2H01A 4BVXA 4MABA 1V40A 3F9UA 5J47A 1F6MC 5CNWA 2C0EA 3RGBC 3QAWA 4TXVA 2CZ2A 5BMUA 1X9SB 4V2LA 2OE0A 3UOMA 5E4WA 2RM5A 2P5RA 4FIWA 4YQMA 3CHXC 2X8GA 6GSWA 3D5JA 3ZMKA 2A4HA 5ENUA 3APOA 4NWYA 3TDGA 2PVQA 3L9UA 4TR3A 4AF2A 2OBIA 2GSRA 1JLVA 3GTUA 3ZFBA 1OKDA 3GFKA 3E9JB 1XWAA 3TKSA 4I97A 1FOHA 2HZFA 5BRTA 3HVVA 1X9MB 3PINA 5C04A 1X5EA 3Q18A 3QCPA 1XIYA 2R6KA 3FR6A 5F8BA 1T8EB 3RFRC 5FT3A 3M8NA 2LUSA 1A8LA 5D9VA 3I9V2 5DCHA 4NAXA 3GHAA 1SENA 1SVMA 1PN0A 1WJKA 4TOPA 3A2XA 3KMOA 5IMAA 1R7HA 4POMA 3ZFLA 4CY6A 4NHZA 2EIOA 4TR4A 2FWFA 3IR4A 2GS3A 5G2ZA 4WF4A 1V58A 3VWUA 1LBKA 4GCIA 3TRXA 4N0VA 2VUPA 3W8JA 1GTUA 4XRDA 2RLIA 4WETA 2EFEA 2R37A 4MJBA 1XFLA 1TJDA 4LL1B 2WW2A 3MWHA 2OKAA 4OD7A 3W6GA 1YEXA 5CYYA 3TRPA 1K0BA 4WXTA 4YH2A 3JCML 6GSXA 4ZXGA 5E59A 2CVKA 3EINA 2KLXA 8GSSA 1S3RA 1MDIA 1F3BA 5KN2A 2K8VA 3LW9A 5KEJA 3UEMA 1A8YA 1JHBA 2AV4A 3UAPA 1FAAA 5ELAA 4HI7A 3FZ5A 4XTSA 4TRXA 4MDCA 4Q5NA 5IMDA 2C3TA 3EC3A 1M3IA 4K6XA 4XIHA 2UV8G 3I6AA 1SU9A 3J7Yb 2O87A 1PL1A 2NTOA 2L59A 1GSDA 1J9BA 4KCAA 4ZB9A 2I9HA 3WGDA 2REMA 2CX4A 1PRXA 1SK1A 1G6WA 2CAIA 17GSA 1AXDA 3A2WA 3A5WA 3HDCA 2D2ZA 4K9ZA 4LLRA 5ECMB 3EYTA 5JCGA 1GLQA 2QKEA 1T00A 5IQYA 3ZIVA 5B6MA 2LTKA 4K0GA 3N9JA 2OJLA 2L57A 1TRWA 3O76A 2B5EA 2M80A 2H71A 1T4ZA 4TXOB 3WGXA 1ERUA 2XBQA 3CTGA 1THOA 1SD8A 2ES7A 4L8EA 3WYWA 4LA1A 3HVXA 2H6ZA 1SKSB 2VAFA 2VCXA 2FWEA 2PU9C 1OYJA 1WRYA 1T1VA 1GUKA 5CRGA 1EP7A 5CRWA 1DE2A 5AIXA 3KM6A 3FYGA 3HY2A 2Z9SA 2IL3A 1XXUA 1FOVA 2VL9A 1NHOA 1RW1A 1VRSD 1Q4JA 2VLVA 4NPBA 3TJBA 1XOAA 1A0RP 9GSSA 5G5FA 3D4MA 1JZWA 2GQLA 1XG8A 1HYUA 1X0RA 4G0LA 2B5YA 1TW9A 1F9MA 4Z2RA 5IOWA 3L9VA 4BL7B 1AUCA 3BD2A 3R3EA 1ACVA 4J57E 4IW9A 4ZBBA 5CRDA 1GSEA 1I5GA 2C0FA 3QOUA 4EE0A 1HNCA 1BAYA 1NW2A 3LEFA 5ECLB 3IBHA 4IQ1A 2WZ9A 5CP1A 1TU8A 3E3EA 4N30A 3U5RE 2RUEA 12GSA 4L5LA 4IVFA 1CQGA 2PN8A 1DBYA 1N2AA 14GSA 5J9BA 3CQFA 2XC2A 1WWJA 4K5SA 4KSOA 2GTUA 5DCGA 2HRFA 5GAPD 4PXOA 5COHA 2WS2A 3FR3A 1O7UA 3VPQA 3FR9A 5KN0A 4RQXA 4X1UA 3P7XA 4BL7A 4HJ2A 3TOTA 4ECJA 3QDNA 1GUHA 1AC1A 3IA1A 1F3AA 5H5QA 3CBUA 3DMLA 3P90A 1K0AA 3ZL5A 2A2RA 5G1LA 2VCWA 2NBSA 4PQHA 2PVOC 3KIJA 3ZVJA 5JCWA 3RHCA 2H0HA 3UJ1A 2P31A 3IHGA 4HQZA 1YF1A 1GTAA 2H72A 4KA0A 1XW9A 5A4WA 1MTCA 1K0DA 2R2JA 2C1YA 2C3NA 1Z5YE 3NOFA 3ZRDA 4F9ZA 1O81A 2EFDA 1KEBA 2J9HA 1QFNA 1BG5A 4JR6A 5ID2B 1TKDB 4MLYA 3GN3A 1THXA 5HQPA 4I5QA 1ZOFA 3D0ZA 1BX9A 1X5DA 2ALBA 10GSA 4ZB8A 1ML6A 3RPNA 2CA8A 3IAS2 1GH2A 2H30A 2EIQA 4MCUA 2DC5A 1M9AA 4POLA 6GSTA 1CQHA 3LQ7A 2H1BA 1K3OA 2PERA 2OE1A 1SJ6A 4TKYA 1QQ2A 4K2DA 3GKMA 2ZUPA 3GH9A 4I6XA 2H8LA 2YNXA 4QQ7A 3UARA 3LORA 5A5HB 4AJ8A 2TRXA 4BWSA 4KDXA 2H6XA 5ID2A 2H1DA 1G0TA 1O85A 4CY8A 1ON4A 4GXZA 5HFKA 2LEGA 5AIVA 4JRRA 1URMA 3RPPA 1LJRA 1PQNA 4MF7A 5LD0A 2WGRA 4ZIJA 3MIXA 5J3RA 3ISOA 2C0DA 3QFBC 3VFIA 2CQ9A 3GA4A 5AN1A 1FG4A 3CXGA 1SL1B 4KE3A 2C3QA 4EO3A 5ELGA 2ZCTA 1TU7A 1ZL9A 1BEDA 1PX6A 4PURA 1EV9A 3N5OA 1W89A 3LYPA 1O8XA 3HHVA 2OA7A 2QGVA 3HZ8A 4HS1A 2E2GA 3TJFA 4PUAA 4GTUA 5A5HA 4MMMA 3C73A 1ERTA 4ECCA 4HZ2A 1YQ1A 3IDVA 19GSA 4BVXB 5A1NB 3QPMA 5JWQB 1G6YA 3GRXA 2O85A 4Q5QA 1GNWA 4HDEA 3L78A 1GWCA 1JLWA 4OO4A 3DXBA 1J08A 2H76A 1YVLA 4V2MA 1Q98A 2YV7A 4HEA2 1TXXA 4BA7A 3I43A 4GRFA 1TRSA 3F4RA 3F4SA 2HLSA 2XPDA 3DYRA 3IOSA 2L4CA 18GSA 2I81A 3M9KA 6GSUA 1YKCA 3TJKA 4EDZA 1K3YA 2JADA 3GKXA 4RI6A 3HZ4A 4AJ7A 4DSQA 1BJXA 2K18A 1NHYA 2WVXB 2LNSA 3TGZA 3L9SA 4TR1B 1J0FA 5A1NA 5AGYA 1OC8A 3GSSA 4OFMA 2V6OA 3GH6A 3ZTLA 4WR4A 1ZYPA 3VWVA 5D96A 4GQCA 2O5VA 2HFDA 1YZXA 3BOAA 1FB0A 2VKZG 1EOHA 1PA3A 4BVYB 5JWRB 4K8MA 1EEJA 2PMTA 3HVNA 1SKRB 4O92A 2N5AA 4HUAA 2M46A 1S4BP 3F0IA 2GZYA 2PPTA 1A2LA 2R0PA 4EIPA 2BTOT 3G7YA 4BPYA 1QK8A 4K5RA 4FH8A 4K7NA 4BIKA 1X5CA 5KN1A 3MDKA 1MD4A 2DJ3A 2WVXA 2O3EA 4G01A 3M3MA 1LU4A 4TR1A 4TR0A 3KJYA 1AAZA 3IAM2 2YZHA 1ZYEA 2V41A 4YAPA 4AKHA 3HJOA 4ULXA 4IP6A 1OE8A 4I2UA 1GTIA 1E6BA 4BVYA 2BJXA 2OACA 4DEJA 4OCEA 2ON7A 5EY6A 3C7MA 2TRCP 5J4YA 4WEYA 1TRVA 1DSBA 3EMXA 4KB3A 1GTBA 2DKIA 5B8BA 3FRCA 1QMVA 3FK8A 1U6TA 2YN1A 2DIYA 2GT5A 3RHBA 4LL4B 2IFQB 3WD6A 4G2EA 4XCSA 1GSQA 5ECOB 4O5QA 1MD3A 3EURA 3VWXA 5F06A 3ZMLA 3QAGA 1UA5A 2QA2A 5GZZB 1T7PB 4GF0A 4YQVA 4TW5A 2YWMA 4HZ4A 1EZKA 1V2AA 4MP4A 2F9SA 3ZLPA 4F03A 1T3BA 3P2AA 3ME7A 1FW1A 6GSYA 3HD5A 4AKGA 3DEXA 3VI7A 2YWNA 3O6TA 4MJAA 2GSSA 2HXKA 2MMNA 3GX8A 3IV4A 4ECIA 4I2TA 1Y6EA 4XS6A 2RIIA 2A2SA 2IFQA 3HA9A 4NV5A 3KH7A 3GV1A 2X8CA 1PMTA 2HSNB 2VD1A 3TJJA 2H1LA 2CVBA 2DJ1A 4G10A 4FYCA 1B9XC 2XPEA 4ZB6A 2IPAA 1WP0A 2H66A 2FCHA 4JE1A 5IIZA 1TK0B 2NPBA 3FZ4A 2C8UA 4IHUA 4MZCA 2VCVA 4XHMA 2WJUA 1TI1A 3MYDA 3C8EA 5KOWA 5GSSA 4PI0C 4F82A 3GMFA 2IJYA 4FYBA 3F63A 5CO3A 1GP1A 2MMZA 3GL3A 2YWOA 4WKWA 2WW3A 3SBCA 2EFCA 2DMLA 2DJKA 3CSIA 2X4AA 2YZUA 4ZBDA 4RI7A 3LYKA 2IMDA 2HSNA 4WBRD 5D8IA 3H4KA 5DQSA 4V1Ag 5LNKe 1U3AA 1M0UA 2GSQA 4ACSA 2B7KA 2HRKB 4P3YB 1EEMA 2TIRA 2LS5A 2C4JA 5J4UA 5J5NA 4QMKA 2MZCA 4CDOA 4K1FA 3ED3A 1UC7A 3TUEA 2HRAA 2H75A 4O7HA 3FMWA 2AUVA 3IK7A 1B4QA 1U87A 2FGXA 1EP8A 4K0NA 3LJRA 5ABRA 2X99A 3P8WA 3W8SA 3F3RA 22GSA 2LJKA 1E2YA 2FWGA 3CTFA 5H5RA 3A2VA 4IS0A 4KCEA 4E8EA 3WT2A 2LRTA 1SJIA 1USBA 3KD0A 3HXSA 3KCMA 5CAXA 4OFNA 5INYA 2FA4A 1PSQA 3GL5A 3HJMA 2G0FA 1FHEA 2EIRA 3EWLA 1FB6A 3UBLA 4YKFA 3VWWA 2H0IA 1R5AA 2VCTA 3MNGA 1KTEA 1GL8A 2YPMA 2HRKA 2VL3A 4MPGA 1FO5A 2WDUA 3GUSA 4E68A 11GSA 2HZEB 2IMEA 2NDOA 4RQRA 3U6VA 5IPHA 1B4PA 1U3IA 1OC9B 3HKRA 4JZQA 4IJ3A 2YV9A 3LG6A 3ZREA 1N8JA 1XVWA 3KZQA 2FHEA 2WW1A 2JL4A 5D93A 4Q5FA 2CT6A 2YOIA 4H86A 1XZOA 1WOUA 2CVDA 4ZL9A 2YJHA 1RQMA 3UMAA 3C71A 1OVNA 3QMXA 4ZL7A 1M7TA 3EU3A 3DRNA 3ZVJD 3M0FA 1OKTA 5A34A 5G30A 3ZYWA 3GIXA 2RM6A 1O8WA 4EIQA 3M1GA 5GAND 1SVOA 1AQVA 2FA8A 1EGRA 2A2PA 4YAVA 2HZEA 3LWAA 3M9JA 2JU5A 1OC9A 1AW9A 1Z7RA 2VM1A 3GKNA 1TOFA 3KH9A 2LJRA 2MBSA 4HJMA 1ST9A 2JZRA 2OBKA 4XS1A 2E0QA 2CV4A 2VL2C 4V2NA 2IIYA 2LQQA 3TKSE 3LSZA 2B1LA 3E0UA 1S3DA 4ISDA 3PH9A 1YF0A 4YKGA 5DVBA 2MMOA 2VIMA 3US3A 1W4VA 3DIEA 3ZIJA 4JEDA 3TCOA 4OWYA 3IK9A 5AISA 4V1Ap 1Z3EA 1SD9A 4O5UA 1EWXA 4AKXB 5DALB 3LGCA 3VURA 4ZL8A 1XVQA 3D21A 3KEBA 1S3AA 1JZOA 1SK0A 3KTBA 2AHEA 1GUMA 5D73A 1XWCA 2LJAA 5IO0A 1BYEA 1PD21 4GQFA 4WR5A 1Y1UA 1V98A 4OCFA 1ABAA 4ML6A 4O32A 2X49A 3RBTA 4F2IA 5G1KA 1GNEA 5ECKB 5LCZA 1PFOA 2HSHA 2WVZA 5JWOB 2DJJA 1UN2A 3DGQA 1WIKA 3HMJG 1HD2A 1XBSA 2YP6A 4FO5A 3V1WA 1MDJA 1K0OA 5J4VA 1GSFA 2IMKA 4HOJA 4G0KA 3ERFA 2GQKA 1TXUA 1PKWA 4YQUA 3O3TA 4AGSA 1VF2A 4PGTA 2V1MA 2CX3A 4X4JA 3QR6A 3F8UA 4KF9A 2QC7A 5DBQA 1XOBA 3KP8A 5IPGA 1G7OA 5DALA 2F8AA 2PBJA 3FEUA 1A24A 1PN9A 3ERWA 5F05A 4EUYA 2F3MA 2JZTA 2OADA 1XWKA 1T4YA 3IC4A 1YJ6A 1R4WA 2R3XA 4GDFA 3IRAA 2X8HA 5DAKB 2GDRA 2O36A 4PNGA 2GVPA 5D9TA 2CZ3A 2C0GA 2EC4A 3EU4A 2MMAA 3FY7A 1ZZYA 3CRUA 2GT6A 4HU9A 4XS4B 5J41A 4AI6A 1GSYA 1NSWA 4L5OA 4IGJA 1WPIA 4I8BA 4GSNA 5G31A 1PKZA 1OE7A 3A5IA 1ERVA 4L0UA 3SWLA 2E2MA 1R5PA 3ZITA 2K6VA 2I1UA 4Q5RA 5ECRB 5A5KA 4ILFA 5C00A 1Z9HA 4DVCA 2J23A 1TTZA 2O89A 2YJ7A 3L4NA 3ZZXA 4JR4A 2VOCA 2F51A 2VCQA 5EPFA 5HFGA 2ZNMA 3F3QA 2MYGA 3GX0A 3H93A 1TP9A 2HSMA 1M9BA 5IMFA 1WE0A 1VGLA 4FYUA 2AAWA 3GURA 5DJMA 5A4VA 4ZBAA 1EV4A 1AIUA 1A2JA 1V57A 5EVOA 5DAKA 1SYRA 3D6IA 1ZYQB 4G19A 3IE3A 2WULA 3GNJA 4EKZA 3TKQA 4W66A 3UBKA 2GLRA 4O5RA 4XS4A 2FLSA 2H70A 2KP2A 1I9DA 4E8HA 4WF5A 4WBJA 1H4OA 2LSTA 5IMVA 2FNOA 1GRXA 3CYNA 4KUNA 1MEKA 16GSA 5J9CA 2V2GA 3ERGA 4PHZC 4DSSB 13GSA 4USSA 1K0CA 4IN0A 1V9WA 5IMCA 3D22A 4N10A 3IC8A 1XW5A 1ZYNA 2WFCA 4EVMA 4JU5A 1SK2A 2RUFA 1BQ7A 4ECBA 4ML1A 2V6KA 3GYKA 4POBA 4GLTA 2DJ2A 2A4VA 3HVSA 1TDIA 3CSJA 4FXYP 4N3ZA 2B3SA 1B48A 3KP9A 1HNBA 3DWVA 5H5SA 1GSUA 1M2AA 5D9WA 1YEWC 1SVLA 1XW6A 3FZ9A 3IXRA 1YY7A 1SL2B 5HFIA 1EGOA 1TI3A 1N25A 3D4TA 3WT1A 2DSAA 3GKKA 4KDYA 5IM9A 2LNTA 4XRAA 4DSSA 3EE2A 1Z6MA 2HT9A 1IYHA 5DDLA 2WZSA 3Q6OA 4Z2UA 5B8AA 1I1IP 3FZAA 5ECPB 4BWQA 1B8XA 1GULA 3MAKA 1VF3A 1SKWB 3DKSA 4F0CA 4PUFC 1SYXA 1U88A 5IOXA 3RDWA 1R26A 3TKSC 5KOXA 3UVHA 2FWHA 2L6CA 2V32A 1YKAA 2N5BA 1F2EA 3VK9A 4CHSA 3UIWA 2LRNA 1SJZA 2PGTA 4HU7A 3KMNA 1OC3A 2JSYA 4KAEA 2O7KA 3LXTA 1WMJA 1IYIA 4EXJA 3CRTA 3LXZA 5J40A 3IPZA 3PPUA 4RUVA 4K7IA 3H8QA 4ZB7A 1F37A 5CRHA 1KNGA 4KGIA 2AJQB 5ECHB 4D73B 3VI5A 5F0GA 2N5FA 2IMFA 5CREA 2VD0A 5EL8A 4ID0A 1S3CA 4CW9A 3RAZA 2HQTA 2B1KA 1JZDA 5FHIA 2WW0A 6GSVA 1M99A 5ECSA 2P0GA 2VM2A 2H73A 3AY8A 1C72A 3UVTA 4IJIA 3L0HA 2GZZA 1GSSA 3CSHA 2NVLA 1DE1A 2HSYA 4MZBA 3G9BA 2M72A 3TKRA 1ZGNA 1MDKA 1JFUA 1YEPA 1AQWA 3TJGA 4FQUA 4AKIA 1NM3A 4Z7XA 3TB2A 4X43A 2VCZA 1X9WB 4IKHA 5IO2A 2DKHA 1XCCA 4MNNA 1Y25A 4G9HA 2H19A 3WGEA 4GSSA 4TXOA 4D73A 3KXOA 4EL1A 2WCIA 1ZCPA 2LKUA 3A3TA 2OE3A 2H1AA 3IHQA 1RK4A 4NXIA 2H0GA 4QL9A 5G5EA 2YCDA 1A23A 3VPTA 2B6MA 4MPFA 3FW2A 1XWGA 2R0GA 3EMPA 2YANA 3TOUA 1Z7PA 5HR1A 2H74A 2K9FA 1Z6NA 2VL2A 1PX7A 1QGVA 3OR5A 5A34B 4LMVA 5B6NA 1K0NA 5F07A 5ECQB 4GWRA 3F4TA 4AJ6A 4MJEA 4L0WA 2LRCA 3MSZA 2KHPA 3QD9A 3FKFA 5DJLA 5HR3A 3EVIA 2X64A 1H75A 1O73A 2KOKA 3APSA 2C80A 2YWIA 2QSIA 2WB9A 2H6YA 4MJCA 3G7IA 2PWJA 2WVYA 5IMZA 2IWTA 4HQSA 4IP1A 4TVEA 2DBCA 2I4AA 2FUG2 3CMIA 2OT3A 4POKA 3APQA 4NMUA 1FVJA 2HI7A 3EPTA 4EF0A 2GSTA 4EC0A 4MF6A 4KNDA 4OFTA 5GSTA 3Q74A 1B9YC 4OMVA 1JZRA 4LMWA 2FY6A 1PL2A 3NIVA 2DMMA 1QUWA 1AQXA 4DSRA 2EFHA 2F8FA 3GSTA 2JZSA 2KP1A 2R0CA 3HJPA 6GSSA 2HRNA 3TU3B 3J7Yk 3PR8A 2PUKC 3S9FA 1XPVA 2O8VB 5HR2A 4N0ZA 1BF5A 3C1RA 1YDKA 2G2QA 3H1NA 1GLPA 2WRTA 2L5OA 1QXHA 2JSZA 2E7PA 2B7JA 2XBIA 7GSSA 4HSCX 2VLUA 4MK3A 4IQAA 2HNLA 1KBNA 4MF5A 1M3JA 2B5XA 3R2QA 2L5LA 2HE3A 4J56E 3Q19A 3G7JA 3KTLA 1TK5B 3DD3A 3FHKA 2I3YA 4MH3A 2IMIA 4F0BA 4J2FA 4PI2C 3KGKA 1TRUA 2KUCA 5DQYA 3HYPA 4QL7A 1M2DA 2HYXA 5L71A 4JBBA 1OAZA 2JACA 5KN3A 2DJ0A 3H79A 3I69A 2L4QA 4G0IA 1ILOA 3K8NA 5ECIB 4K2XA 2R4VA 2LV3A 5ECNB 1VF4A 4X0XA 3CWGA 1SL0B 5D9XA 3TRQA 3DVWA 1G7EA 2R5GA 3PGTA 4MZWA 2AYTA 4KW6A 3C1SA 2ON5A 4PTSA 1K0MA 3F6FA 3TKPA 2K8SA 4MA9A 3BCKA 2P5QA
chains in the Genus database with same CATH topology
2GGTA 3VLNA 4PQIA 1HQOA 2QA1A 3HCZA 4ZILA 1M2BA 5HR0A 2GZPA 2H1GA 2HSMB 3BCIA 4OO5A 4ICYA 5BMUB 4PNFA 2DLXA 2CAQA 4N11A 3DVXA 4NV2A 1A2MA 4GSTA 1HNAA 2FD3A 3NZNA 2UZ8A 2MBTA 4IBPA 1VF1A 1FVKA 4KDUA 1O6JA 4KSMA 4IELA 5JCUA 3QAVA 4K7OA 2AB6A 3GTUB 1BG1A 3LFLA 3BJ5A 2GQMA 4KH7A 1ERWA 3ME8A 3BBYA 2BMXA 20GSA 2IN3A 2XHFA 4TN8A 5A4UA 2LQOA 1UVZA 4NHWA 2VO4A 4KX4A 1ZMAA 4PX1A 4Z2TA 1DUGA 1A0FA 2DIZA 4A5PA 1XWBA 1EOGA 2L6DA 5B7CA 4PQ1A 3F6DA 5FWGA 4MH2A 2VLTA 1PGTA 3UL3A 1TK8B 1K3LA 3QFAC 4EDYA 2H01A 4BVXA 4MABA 1V40A 3F9UA 5J47A 1F6MC 5CNWA 2C0EA 3QAWA 4TXVA 2CZ2A 5BMUA 1X9SB 4V2LA 2OE0A 3UOMA 5E4WA 2RM5A 2P5RA 4FIWA 4YQMA 2X8GA 6GSWA 3D5JA 3ZMKA 2A4HA 5ENUA 3APOA 4NWYA 3TDGA 2PVQA 3L9UA 4TR3A 4AF2A 2OBIA 2GSRA 1JLVA 3GTUA 3ZFBA 1OKDA 3GFKA 3E9JB 1XWAA 3TKSA 4I97A 1FOHA 2HZFA 5BRTA 3HVVA 1X9MB 3PINA 5C04A 1X5EA 3Q18A 3QCPA 1XIYA 2R6KA 3FR6A 5F8BA 1T8EB 5FT3A 3M8NA 2LUSA 1A8LA 5D9VA 3I9V2 5DCHA 4NAXA 3GHAA 1SENA 1SVMA 1PN0A 1WJKA 4TOPA 3A2XA 3KMOA 5IMAA 1R7HA 4POMA 3ZFLA 4CY6A 4NHZA 2EIOA 4TR4A 2FWFA 3IR4A 2GS3A 5G2ZA 4WF4A 1V58A 3VWUA 1LBKA 4GCIA 3TRXA 4N0VA 2VUPA 3W8JA 1GTUA 4XRDA 2RLIA 4WETA 2EFEA 2R37A 4MJBA 1XFLA 1TJDA 4LL1B 3MWHA 2OKAA 4OD7A 3W6GA 1YEXA 5CYYA 3TRPA 1K0BA 4WXTA 4YH2A 3JCML 6GSXA 4ZXGA 5E59A 2CVKA 3EINA 2KLXA 8GSSA 1MDIA 1F3BA 5KN2A 2K8VA 3LW9A 5KEJA 3UEMA 1A8YA 1JHBA 2AV4A 3UAPA 1FAAA 5ELAA 4HI7A 3FZ5A 4XTSA 4TRXA 4MDCA 4Q5NA 5IMDA 2C3TA 3EC3A 4K6XA 4XIHA 2UV8G 3I6AA 1SU9A 3J7Yb 2O87A 1PL1A 2NTOA 2L59A 1GSDA 1J9BA 4KCAA 4ZB9A 2I9HA 3WGDA 2REMA 2CX4A 1PRXA 1SK1A 1G6WA 2CAIA 17GSA 1AXDA 3A2WA 3A5WA 3HDCA 2D2ZA 4K9ZA 4LLRA 5ECMB 3EYTA 5JCGA 1GLQA 2QKEA 1T00A 5IQYA 3ZIVA 5B6MA 2LTKA 4K0GA 3N9JA 2OJLA 2L57A 1TRWA 3O76A 2B5EA 2M80A 2H71A 1T4ZA 4TXOB 3WGXA 1ERUA 2XBQA 3CTGA 1THOA 1SD8A 2ES7A 4L8EA 3WYWA 4LA1A 3HVXA 2H6ZA 1SKSB 2VAFA 2VCXA 2FWEA 2PU9C 1OYJA 1WRYA 1T1VA 1GUKA 5CRGA 1EP7A 5CRWA 1DE2A 5AIXA 3KM6A 3FYGA 3HY2A 2Z9SA 2IL3A 1XXUA 1FOVA 2VL9A 1NHOA 1RW1A 1VRSD 1Q4JA 2VLVA 4NPBA 3TJBA 1XOAA 1A0RP 9GSSA 5G5FA 3D4MA 1JZWA 2GQLA 1HYUA 1X0RA 4G0LA 2B5YA 1TW9A 1F9MA 4Z2RA 5IOWA 3L9VA 4BL7B 1AUCA 3BD2A 3R3EA 1ACVA 4J57E 4IW9A 4ZBBA 5CRDA 1GSEA 1I5GA 2C0FA 3QOUA 4EE0A 1HNCA 1BAYA 1NW2A 3LEFA 5ECLB 3IBHA 4IQ1A 2WZ9A 5CP1A 1TU8A 3E3EA 4N30A 3U5RE 2RUEA 12GSA 4L5LA 4IVFA 1CQGA 2PN8A 1DBYA 1N2AA 14GSA 5J9BA 2XC2A 1WWJA 4K5SA 4KSOA 2GTUA 5DCGA 2HRFA 5GAPD 4PXOA 5COHA 2WS2A 3FR3A 1O7UA 3VPQA 3FR9A 5KN0A 4RQXA 4X1UA 3P7XA 4BL7A 4HJ2A 3TOTA 4ECJA 3QDNA 1GUHA 1AC1A 3IA1A 1F3AA 5H5QA 3CBUA 3DMLA 3P90A 1K0AA 3ZL5A 2A2RA 5G1LA 2VCWA 2NBSA 4PQHA 2PVOC 3KIJA 3ZVJA 5JCWA 3RHCA 2H0HA 3UJ1A 2P31A 3IHGA 4HQZA 1YF1A 1GTAA 2H72A 4KA0A 1XW9A 5A4WA 1MTCA 1K0DA 2R2JA 2C1YA 2C3NA 1Z5YE 3NOFA 3ZRDA 4F9ZA 1O81A 2EFDA 1KEBA 2J9HA 1QFNA 1BG5A 4JR6A 5ID2B 1TKDB 4MLYA 3GN3A 1THXA 5HQPA 4I5QA 1ZOFA 3D0ZA 1BX9A 1X5DA 2ALBA 10GSA 4ZB8A 1ML6A 3RPNA 2CA8A 3IAS2 1GH2A 2H30A 2EIQA 4MCUA 2DC5A 1M9AA 4POLA 6GSTA 1CQHA 3LQ7A 2H1BA 1K3OA 2PERA 2OE1A 1SJ6A 4TKYA 1QQ2A 4K2DA 3GKMA 2ZUPA 3GH9A 4I6XA 2H8LA 2YNXA 4QQ7A 3UARA 3LORA 5A5HB 4AJ8A 2TRXA 4BWSA 4KDXA 2H6XA 5ID2A 2H1DA 1G0TA 1O85A 4CY8A 1ON4A 4GXZA 5HFKA 2LEGA 5AIVA 4JRRA 1URMA 3RPPA 1LJRA 1PQNA 4MF7A 5LD0A 2WGRA 4ZIJA 3MIXA 5J3RA 3ISOA 2C0DA 3QFBC 3VFIA 2CQ9A 3GA4A 5AN1A 1FG4A 3CXGA 1SL1B 4KE3A 2C3QA 4EO3A 5ELGA 2ZCTA 1TU7A 1ZL9A 1BEDA 1PX6A 4PURA 1EV9A 3N5OA 1W89A 3LYPA 1O8XA 3HHVA 2OA7A 2QGVA 3HZ8A 4HS1A 2E2GA 3TJFA 4PUAA 4GTUA 5A5HA 4MMMA 3C73A 1ERTA 4ECCA 4HZ2A 1YQ1A 3IDVA 19GSA 4BVXB 5A1NB 3QPMA 5JWQB 1G6YA 3GRXA 2O85A 4Q5QA 1GNWA 4HDEA 3L78A 1GWCA 1JLWA 4OO4A 3DXBA 1J08A 2H76A 1YVLA 4V2MA 1Q98A 2YV7A 4HEA2 1TXXA 4BA7A 3I43A 4GRFA 1TRSA 3F4RA 3F4SA 2HLSA 2XPDA 3DYRA 3IOSA 2L4CA 18GSA 2I81A 3M9KA 6GSUA 1YKCA 3TJKA 4EDZA 1K3YA 2JADA 3GKXA 4RI6A 3HZ4A 4AJ7A 4DSQA 1BJXA 2K18A 1NHYA 2LNSA 3TGZA 3L9SA 4TR1B 1J0FA 5A1NA 5AGYA 1OC8A 3GSSA 4OFMA 2V6OA 3GH6A 3ZTLA 4WR4A 1ZYPA 3VWVA 5D96A 4GQCA 2O5VA 2HFDA 1YZXA 3BOAA 1FB0A 2VKZG 1EOHA 1PA3A 4BVYB 5JWRB 4K8MA 1EEJA 2PMTA 1SKRB 4O92A 2N5AA 4HUAA 2M46A 3F0IA 2GZYA 2PPTA 1A2LA 2R0PA 4EIPA 2BTOT 3G7YA 4BPYA 1QK8A 4K5RA 4FH8A 4K7NA 1X5CA 5KN1A 3MDKA 1MD4A 2DJ3A 4G01A 3M3MA 1LU4A 4TR1A 4TR0A 3KJYA 1AAZA 3IAM2 2YZHA 1ZYEA 2V41A 4YAPA 4AKHA 3HJOA 4ULXA 4IP6A 1OE8A 4I2UA 1GTIA 1E6BA 4BVYA 2BJXA 2OACA 4DEJA 4OCEA 2ON7A 5EY6A 3C7MA 2TRCP 5J4YA 4WEYA 1TRVA 1DSBA 3EMXA 4KB3A 1GTBA 2DKIA 5B8BA 3FRCA 1QMVA 3FK8A 1U6TA 2YN1A 2DIYA 2GT5A 3RHBA 4LL4B 2IFQB 3WD6A 4G2EA 4XCSA 1GSQA 5ECOB 4O5QA 1MD3A 3EURA 3VWXA 5F06A 3ZMLA 3QAGA 1UA5A 2QA2A 5GZZB 1T7PB 4GF0A 4YQVA 4TW5A 2YWMA 4HZ4A 1EZKA 1V2AA 4MP4A 2F9SA 3ZLPA 4F03A 1T3BA 3P2AA 3ME7A 1FW1A 6GSYA 3HD5A 4AKGA 3DEXA 3VI7A 2YWNA 3O6TA 4MJAA 2GSSA 2HXKA 2MMNA 3GX8A 3IV4A 4ECIA 4I2TA 1Y6EA 4XS6A 2RIIA 2A2SA 2IFQA 3HA9A 4NV5A 3KH7A 3GV1A 2X8CA 1PMTA 2HSNB 2VD1A 3TJJA 2H1LA 2CVBA 2DJ1A 4G10A 4FYCA 1B9XC 2XPEA 4ZB6A 2IPAA 1WP0A 2H66A 2FCHA 4JE1A 5IIZA 1TK0B 2NPBA 3FZ4A 2C8UA 4IHUA 4MZCA 2VCVA 4XHMA 2WJUA 1TI1A 3MYDA 3C8EA 5KOWA 5GSSA 4F82A 3GMFA 2IJYA 4FYBA 3F63A 5CO3A 1GP1A 2MMZA 3GL3A 2YWOA 4WKWA 3SBCA 2EFCA 2DMLA 2DJKA 3CSIA 2X4AA 2YZUA 4ZBDA 4RI7A 3LYKA 2IMDA 2HSNA 4WBRD 5D8IA 3H4KA 5DQSA 4V1Ag 5LNKe 1U3AA 1M0UA 2GSQA 4ACSA 2B7KA 2HRKB 4P3YB 1EEMA 2TIRA 2LS5A 2C4JA 5J4UA 5J5NA 4QMKA 2MZCA 4CDOA 4K1FA 3ED3A 1UC7A 3TUEA 2HRAA 2H75A 4O7HA 3FMWA 2AUVA 3IK7A 1B4QA 1U87A 2FGXA 1EP8A 4K0NA 3LJRA 5ABRA 2X99A 3P8WA 3W8SA 3F3RA 22GSA 2LJKA 1E2YA 2FWGA 3CTFA 5H5RA 3A2VA 4IS0A 4KCEA 4E8EA 3WT2A 2LRTA 1SJIA 1USBA 3KD0A 3HXSA 3KCMA 5CAXA 4OFNA 5INYA 2FA4A 1PSQA 3GL5A 3HJMA 2G0FA 1FHEA 2EIRA 3EWLA 1FB6A 3UBLA 4YKFA 3VWWA 2H0IA 1R5AA 2VCTA 3MNGA 1KTEA 1GL8A 2YPMA 2HRKA 2VL3A 4MPGA 1FO5A 2WDUA 3GUSA 4E68A 11GSA 2HZEB 2IMEA 2NDOA 4RQRA 3U6VA 5IPHA 1B4PA 1U3IA 1OC9B 3HKRA 4JZQA 4IJ3A 2YV9A 3LG6A 3ZREA 1N8JA 1XVWA 3KZQA 2FHEA 2JL4A 5D93A 4Q5FA 2CT6A 2YOIA 4H86A 1XZOA 1WOUA 2CVDA 4ZL9A 2YJHA 1RQMA 3UMAA 3C71A 1OVNA 3QMXA 4ZL7A 1M7TA 3EU3A 3DRNA 3ZVJD 3M0FA 1OKTA 5A34A 5G30A 3ZYWA 3GIXA 2RM6A 1O8WA 4EIQA 3M1GA 5GAND 1SVOA 1AQVA 2FA8A 1EGRA 2A2PA 4YAVA 2HZEA 3LWAA 3M9JA 2JU5A 1OC9A 1AW9A 1Z7RA 2VM1A 3GKNA 1TOFA 3KH9A 2LJRA 2MBSA 4HJMA 1ST9A 2JZRA 2OBKA 4XS1A 2E0QA 2CV4A 2VL2C 4V2NA 2IIYA 2LQQA 3TKSE 3LSZA 2B1LA 3E0UA 1S3DA 4ISDA 3PH9A 1YF0A 4YKGA 5DVBA 2MMOA 2VIMA 3US3A 1W4VA 3DIEA 3ZIJA 4JEDA 3TCOA 4OWYA 3IK9A 5AISA 4V1Ap 1Z3EA 1SD9A 4O5UA 1EWXA 4AKXB 5DALB 3LGCA 3VURA 4ZL8A 1XVQA 3D21A 3KEBA 1S3AA 1JZOA 1SK0A 3KTBA 2AHEA 1GUMA 5D73A 1XWCA 2LJAA 5IO0A 1BYEA 1PD21 4GQFA 4WR5A 1Y1UA 1V98A 4OCFA 1ABAA 4ML6A 4O32A 2X49A 3RBTA 4F2IA 5G1KA 1GNEA 5ECKB 5LCZA 2HSHA 5JWOB 2DJJA 1UN2A 3DGQA 1WIKA 3HMJG 1HD2A 1XBSA 2YP6A 4FO5A 3V1WA 1MDJA 1K0OA 5J4VA 1GSFA 2IMKA 4HOJA 4G0KA 3ERFA 2GQKA 1TXUA 1PKWA 4YQUA 3O3TA 4AGSA 1VF2A 4PGTA 2V1MA 2CX3A 4X4JA 3QR6A 3F8UA 4KF9A 2QC7A 5DBQA 1XOBA 3KP8A 5IPGA 1G7OA 5DALA 2F8AA 2PBJA 3FEUA 1A24A 1PN9A 3ERWA 5F05A 4EUYA 2F3MA 2JZTA 2OADA 1XWKA 1T4YA 3IC4A 1YJ6A 1R4WA 2R3XA 4GDFA 3IRAA 2X8HA 5DAKB 2GDRA 4PNGA 2GVPA 5D9TA 2CZ3A 2C0GA 2EC4A 3EU4A 2MMAA 3FY7A 1ZZYA 3CRUA 2GT6A 4HU9A 4XS4B 5J41A 4AI6A 1GSYA 1NSWA 4L5OA 4IGJA 1WPIA 4I8BA 4GSNA 5G31A 1PKZA 1OE7A 3A5IA 1ERVA 4L0UA 3SWLA 2E2MA 1R5PA 3ZITA 2K6VA 2I1UA 4Q5RA 5ECRB 5A5KA 4ILFA 5C00A 1Z9HA 4DVCA 2J23A 1TTZA 2O89A 2YJ7A 3L4NA 3ZZXA 4JR4A 2VOCA 2F51A 2VCQA 5EPFA 5HFGA 2ZNMA 3F3QA 2MYGA 3GX0A 3H93A 1TP9A 2HSMA 1M9BA 5IMFA 1WE0A 1VGLA 4FYUA 2AAWA 3GURA 5DJMA 5A4VA 4ZBAA 1EV4A 1AIUA 1A2JA 1V57A 5EVOA 5DAKA 1SYRA 3D6IA 1ZYQB 4G19A 3IE3A 2WULA 3GNJA 4EKZA 3TKQA 4W66A 3UBKA 2GLRA 4O5RA 4XS4A 2FLSA 2H70A 2KP2A 1I9DA 4E8HA 4WF5A 4WBJA 1H4OA 2LSTA 5IMVA 2FNOA 1GRXA 3CYNA 4KUNA 1MEKA 16GSA 5J9CA 2V2GA 3ERGA 4DSSB 13GSA 4USSA 1K0CA 4IN0A 1V9WA 5IMCA 3D22A 4N10A 3IC8A 1XW5A 1ZYNA 2WFCA 4EVMA 4JU5A 1SK2A 2RUFA 1BQ7A 4ECBA 4ML1A 2V6KA 3GYKA 4POBA 4GLTA 2DJ2A 2A4VA 3HVSA 1TDIA 3CSJA 4N3ZA 2B3SA 1B48A 3KP9A 1HNBA 3DWVA 5H5SA 1GSUA 1M2AA 5D9WA 1SVLA 1XW6A 3FZ9A 3IXRA 1YY7A 1SL2B 5HFIA 1EGOA 1TI3A 1N25A 3D4TA 3WT1A 2DSAA 3GKKA 4KDYA 5IM9A 2LNTA 4XRAA 4DSSA 3EE2A 1Z6MA 2HT9A 1IYHA 5DDLA 3Q6OA 4Z2UA 5B8AA 3FZAA 5ECPB 4BWQA 1B8XA 1GULA 3MAKA 1VF3A 1SKWB 3DKSA 4F0CA 4PUFC 1SYXA 1U88A 5IOXA 3RDWA 1R26A 3TKSC 5KOXA 3UVHA 2FWHA 2L6CA 2V32A 1YKAA 2N5BA 1F2EA 3VK9A 4CHSA 3UIWA 2LRNA 1SJZA 2PGTA 4HU7A 3KMNA 1OC3A 2JSYA 4KAEA 2O7KA 3LXTA 1WMJA 1IYIA 4EXJA 3CRTA 3LXZA 5J40A 3IPZA 3PPUA 4RUVA 4K7IA 3H8QA 4ZB7A 1F37A 5CRHA 1KNGA 4KGIA 2AJQB 5ECHB 4D73B 3VI5A 5F0GA 2N5FA 2IMFA 5CREA 2VD0A 5EL8A 4ID0A 1S3CA 4CW9A 3RAZA 2HQTA 2B1KA 1JZDA 5FHIA 6GSVA 1M99A 5ECSA 2P0GA 2VM2A 2H73A 3AY8A 1C72A 3UVTA 4IJIA 3L0HA 2GZZA 1GSSA 3CSHA 2NVLA 1DE1A 2HSYA 4MZBA 3G9BA 2M72A 3TKRA 1ZGNA 1MDKA 1JFUA 1YEPA 1AQWA 3TJGA 4FQUA 4AKIA 1NM3A 4Z7XA 3TB2A 4X43A 2VCZA 1X9WB 4IKHA 5IO2A 2DKHA 1XCCA 4MNNA 1Y25A 4G9HA 2H19A 3WGEA 4GSSA 4TXOA 4D73A 3KXOA 4EL1A 2WCIA 1ZCPA 2LKUA 3A3TA 2OE3A 2H1AA 3IHQA 1RK4A 4NXIA 2H0GA 4QL9A 5G5EA 2YCDA 1A23A 3VPTA 2B6MA 4MPFA 3FW2A 1XWGA 2R0GA 3EMPA 2YANA 3TOUA 1Z7PA 5HR1A 2H74A 2K9FA 1Z6NA 2VL2A 1PX7A 1QGVA 3OR5A 5A34B 4LMVA 5B6NA 1K0NA 5F07A 5ECQB 4GWRA 3F4TA 4AJ6A 4MJEA 4L0WA 2LRCA 3MSZA 2KHPA 3QD9A 3FKFA 5DJLA 5HR3A 3EVIA 2X64A 1H75A 1O73A 2KOKA 3APSA 2C80A 2YWIA 2QSIA 2WB9A 2H6YA 4MJCA 3G7IA 2PWJA 5IMZA 2IWTA 4HQSA 4IP1A 4TVEA 2DBCA 2I4AA 2FUG2 3CMIA 2OT3A 4POKA 3APQA 4NMUA 1FVJA 2HI7A 3EPTA 4EF0A 2GSTA 4EC0A 4MF6A 4KNDA 4OFTA 5GSTA 3Q74A 1B9YC 4OMVA 1JZRA 4LMWA 2FY6A 1PL2A 3NIVA 2DMMA 1QUWA 1AQXA 4DSRA 2EFHA 2F8FA 3GSTA 2JZSA 2KP1A 2R0CA 3HJPA 6GSSA 2HRNA 3TU3B 3J7Yk 3PR8A 2PUKC 3S9FA 1XPVA 2O8VB 5HR2A 4N0ZA 1BF5A 3C1RA 1YDKA 2G2QA 3H1NA 1GLPA 2WRTA 2L5OA 1QXHA 2JSZA 2E7PA 2B7JA 2XBIA 7GSSA 2VLUA 4MK3A 4IQAA 2HNLA 1KBNA 4MF5A 2B5XA 3R2QA 2L5LA 2HE3A 4J56E 3Q19A 3G7JA 3KTLA 1TK5B 3DD3A 3FHKA 2I3YA 4MH3A 2IMIA 4F0BA 4J2FA 3KGKA 1TRUA 2KUCA 5DQYA 3HYPA 4QL7A 1M2DA 2HYXA 5L71A 4JBBA 1OAZA 2JACA 5KN3A 2DJ0A 3H79A 3I69A 2L4QA 4G0IA 1ILOA 3K8NA 5ECIB 4K2XA 2R4VA 2LV3A 5ECNB 1VF4A 4X0XA 3CWGA 1SL0B 5D9XA 3TRQA 3DVWA 1G7EA 2R5GA 3PGTA 4MZWA 2AYTA 4KW6A 3C1SA 2ON5A 4PTSA 1K0MA 3F6FA 3TKPA 2K8SA 4MA9A 3BCKA 2P5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XW5 A;  3VLN A;  5A4W A;  4PQI A;  1HQO A;  4ECB A;  1MTC A;  2V6K A;  1K0D A;  2C3N A;  3F63 A;  4GLT A;  2HSM B;  2J9H A;  1TDI A;  1BG5 A;  3CSJ A;  1B48 A;  4PNF A;  1HNB A;  2CAQ A;  4GST A;  1GSU A;  3CSI A;  1HNA A;  4ZBD A;  2UZ8 A;  5D9W A;  4RI7 A;  3LYK A;  4IBP A;  1VF1 A;  3D0Z A;  4KDU A;  1XW6 A;  1BX9 A;  4KSM A;  1YY7 A;  4IEL A;  5JCU A;  3QAV A;  10GS A;  5DQS A;  2AB6 A;  3GTU B;  3LFL A;  4ZB8 A;  1M0U A;  1ML6 A;  2GSQ A;  2CA8 A;  2DSA A;  4KH7 A;  4ACS A;  4KDY A;  2HRK B;  1EEM A;  3BBY A;  2C4J A;  5J4U A;  5J5N A;  20GS A;  2DC5 A;  1M9A A;  5A4U A;  3EE2 A;  4NHW A;  6GST A;  2HRA A;  2VO4 A;  4KX4 A;  1IYH A;  4O7H A;  5DDL A;  4PX1 A;  3LQ7 A;  1DUG A;  1A0F A;  3IK7 A;  1U87 A;  1EOG A;  4K0N A;  1K3O A;  5ECP B;  5B7C A;  3LJR A;  2PER A;  1B8X A;  3F6D A;  5FWG A;  1GUL A;  3MAK A;  1VF3 A;  1PGT A;  3P8W A;  1K3L A;  4F0C A;  4EDY A;  3W8S A;  22GS A;  4BVX A;  1U88 A;  4QQ7 A;  3UAR A;  1V40 A;  4IS0 A;  4E8E A;  1USB A;  4KDX A;  3UVH A;  3QAW A;  4OFN A;  2CZ2 A;  5BMU A;  1F2E A;  3VK9 A;  4CHS A;  3HJM A;  1FHE A;  5HFK A;  2PGT A;  4YQM A;  5AIV A;  3KMN A;  6GSW A;  3ZMK A;  2PVQ A;  3UBL A;  4KAE A;  1LJR A;  2GSR A;  1JLV A;  3GTU A;  3LXT A;  1IYI A;  4MF7 A;  3ZFB A;  4EXJ A;  3CRT A;  5LD0 A;  1R5A A;  2VCT A;  4I97 A;  2HRK A;  3LXZ A;  3ISO A;  4MPG A;  3PPU A;  5AN1 A;  4KE3 A;  2C3Q A;  3Q18 A;  2WDU A;  3GUS A;  11GS A;  2R6K A;  3FR6 A;  5ELG A;  4KGI A;  3U6V A;  1B4P A;  1U3I A;  5F8B A;  1TU7 A;  5ECH B;  3HKR A;  1ZL9 A;  5F0G A;  1PX6 A;  2N5F A;  4JZQ A;  5FT3 A;  3VI5 A;  2YV9 A;  4PUR A;  3LG6 A;  1EV9 A;  2VD0 A;  3N5O A;  5EL8 A;  3LYP A;  3M8N A;  4ID0 A;  2OA7 A;  5D9V A;  2FHE A;  2HQT A;  4NAX A;  2JL4 A;  4PUA A;  4GTU A;  5FHI A;  4TOP A;  4Q5F A;  4ECC A;  3KMO A;  6GSV A;  4HZ2 A;  3ZFL A;  4NHZ A;  1M99 A;  1YQ1 A;  5ECS A;  19GS A;  3AY8 A;  4BVX B;  1C72 A;  2CVD A;  3IR4 A;  1G6Y A;  4IJI A;  3L0H A;  1GSS A;  4Q5Q A;  1GNW A;  3CSH A;  1GWC A;  1LBK A;  4GCI A;  1JLW A;  4N0V A;  1GTU A;  3M0F A;  1OKT A;  1ZGN A;  2YV7 A;  3M1G A;  1AQV A;  1AQW A;  4FQU A;  2VCZ A;  4YAV A;  4IKH A;  1K0B A;  18GS A;  4G9H A;  4YH2 A;  1AW9 A;  4GSS A;  4ZXG A;  6GSU A;  6GSX A;  1YKC A;  3KXO A;  3EIN A;  4EDZ A;  8GSS A;  1K3Y A;  1F3B A;  2LJR A;  5KEJ A;  1RK4 A;  4RI6 A;  3UAP A;  1NHY A;  3LSZ A;  5ELA A;  4HI7 A;  3TGZ A;  4MDC A;  4Q5N A;  2C3T A;  5AGY A;  4ISD A;  3GSS A;  4OFM A;  3GH6 A;  5G5E A;  2YCD A;  3I6A A;  4WR4 A;  3VPT A;  4MPF A;  1XWG A;  1PL1 A;  4JED A;  2NTO A;  3TOU A;  1GSD A;  3IK9 A;  5AIS A;  1EOH A;  4ZB9 A;  1PA3 A;  4BVY B;  1G6W A;  1PX7 A;  2CAI A;  17GS A;  1AXD A;  5DAL B;  3VUR A;  2D2Z A;  2PMT A;  4LMV A;  4O92 A;  5ECM B;  1K0N A;  1GLQ A;  2AHE A;  1GUM A;  5D73 A;  5ECQ B;  5F07 A;  1BYE A;  1PD2 1;  5IQY A;  4WR5 A;  4K0G A;  3N9J A;  3RBT A;  1GNE A;  5ECK B;  3O76 A;  5DJL A;  5LCZ A;  2X64 A;  3MDK A;  2C80 A;  3DGQ A;  1MD4 A;  2WB9 A;  3M3M A;  3KJY A;  4L8E A;  3WYW A;  3G7I A;  1K0O A;  1GSF A;  2IMK A;  2VCX A;  4YAP A;  4HOJ A;  4G0K A;  3ERF A;  3HJO A;  1OYJ A;  1PKW A;  4YQU A;  3O3T A;  4AGS A;  1OE8 A;  1VF2 A;  4PGT A;  1GUK A;  1GTI A;  1E6B A;  3QR6 A;  4KF9 A;  5AIX A;  4BVY A;  3KM6 A;  2GST A;  4EC0 A;  4MF6 A;  2OAC A;  4DEJ A;  3FYG A;  4OFT A;  5GST A;  2IL3 A;  3Q74 A;  2ON7 A;  5EY6 A;  1G7O A;  5DAL A;  2PBJ A;  1PN9 A;  4OMV A;  5F05 A;  1JZR A;  4LMW A;  2F3M A;  1Q4J A;  9GSS A;  1PL2 A;  5G5F A;  2OAD A;  1XWK A;  3NIV A;  1GTB A;  3FRC A;  1AQX A;  2F8F A;  3GST A;  1YJ6 A;  2R3X A;  6GSS A;  4G0L A;  5DAK B;  1TW9 A;  2GDR A;  4PNG A;  5D9T A;  2CZ3 A;  3WD6 A;  4BL7 B;  3R3E A;  3FY7 A;  3PR8 A;  3CRU A;  4IW9 A;  4ZBB A;  5J41 A;  1GSE A;  1GSQ A;  5ECO B;  1GSY A;  4EE0 A;  1MD3 A;  1HNC A;  4L5O A;  5F06 A;  3VWX A;  4IGJ A;  3ZML A;  3QAG A;  1UA5 A;  1YDK A;  1BAY A;  4GSN A;  1PKZ A;  1OE7 A;  5GZZ B;  3H1N A;  5ECL B;  1GLP A;  3IBH A;  4IQ1 A;  4GF0 A;  3SWL A;  1TU8 A;  2WRT A;  4YQV A;  4HZ4 A;  1V2A A;  4MP4 A;  12GS A;  4Q5R A;  5ECR B;  4L5L A;  5A5K A;  4F03 A;  1Z9H A;  4IVF A;  1FW1 A;  1N2A A;  7GSS A;  14GS A;  6GSY A;  2VCQ A;  4MK3 A;  4IQA A;  2HNL A;  1KBN A;  4MF5 A;  3R2Q A;  3VI7 A;  2GTU A;  5DCG A;  3GX0 A;  2HSM A;  1M9B A;  3Q19 A;  2GSS A;  3G7J A;  3KTL A;  3DD3 A;  2AAW A;  3GUR A;  4PXO A;  5DJM A;  2WS2 A;  3FR3 A;  5A4V A;  4ZBA A;  1EV4 A;  2IMI A;  4F0B A;  4J2F A;  3VPQ A;  4ECI A;  3FR9 A;  1Y6E A;  5EVO A;  5DAK A;  2A2S A;  4G19 A;  4JBB A;  4BL7 A;  4HJ2 A;  3IE3 A;  3UBK A;  2GLR A;  3TOT A;  4ECJ A;  1PMT A;  1GUH A;  2HSN B;  3I69 A;  4G0I A;  2VD1 A;  5ECI B;  4E8H A;  1F3A A;  2R4V A;  5ECN B;  1VF4 A;  2FNO A;  4G10 A;  5D9X A;  3CBU A;  3P90 A;  1K0A A;  2A2R A;  16GS A;  2VCW A;  4ZB6 A;  4PQH A;  2R5G A;  3PGT A;  4MZW A;  5JCW A;  3ERG A;  13GS A;  4USS A;  1K0C A;  2ON5 A;  2C8U A;  2VCV A;  4PTS A;  1K0M A;  3F6F A;  1GTA A;  2WJU A;  3C8E A;  3IC8 A;  5GSS A; 
#chains in the Genus database with same CATH topology
 2GGT A;  3VLN A;  4PQI A;  1HQO A;  2QA1 A;  3HCZ A;  4ZIL A;  1M2B A;  5HR0 A;  2GZP A;  2H1G A;  2HSM B;  3BCI A;  4OO5 A;  4ICY A;  5BMU B;  4PNF A;  2DLX A;  2CAQ A;  4N11 A;  3DVX A;  4NV2 A;  1A2M A;  4GST A;  1HNA A;  2FD3 A;  3NZN A;  2UZ8 A;  2MBT A;  4IBP A;  1VF1 A;  1FVK A;  4KDU A;  1O6J A;  4KSM A;  4IEL A;  5JCU A;  3QAV A;  4K7O A;  2AB6 A;  3GTU B;  1BG1 A;  3LFL A;  3BJ5 A;  2GQM A;  4KH7 A;  1ERW A;  3ME8 A;  3BBY A;  2BMX A;  20GS A;  2IN3 A;  2XHF A;  4TN8 A;  5A4U A;  2LQO A;  1UVZ A;  4NHW A;  2VO4 A;  4KX4 A;  1ZMA A;  4PX1 A;  4Z2T A;  1DUG A;  1A0F A;  2DIZ A;  4A5P A;  1XWB A;  1EOG A;  2L6D A;  5B7C A;  4PQ1 A;  3F6D A;  5FWG A;  4MH2 A;  2VLT A;  1PGT A;  3UL3 A;  1TK8 B;  1K3L A;  3QFA C;  4EDY A;  2H01 A;  4BVX A;  4MAB A;  1V40 A;  3F9U A;  5J47 A;  1F6M C;  5CNW A;  2C0E A;  3RGB C;  3QAW A;  4TXV A;  2CZ2 A;  5BMU A;  1X9S B;  4V2L A;  2OE0 A;  3UOM A;  5E4W A;  2RM5 A;  2P5R A;  4FIW A;  4YQM A;  3CHX C;  2X8G A;  6GSW A;  3D5J A;  3ZMK A;  2A4H A;  5ENU A;  3APO A;  4NWY A;  3TDG A;  2PVQ A;  3L9U A;  4TR3 A;  4AF2 A;  2OBI A;  2GSR A;  1JLV A;  3GTU A;  3ZFB A;  1OKD A;  3GFK A;  3E9J B;  1XWA A;  3TKS A;  4I97 A;  1FOH A;  2HZF A;  5BRT A;  3HVV A;  1X9M B;  3PIN A;  5C04 A;  1X5E A;  3Q18 A;  3QCP A;  1XIY A;  2R6K A;  3FR6 A;  5F8B A;  1T8E B;  3RFR C;  5FT3 A;  3M8N A;  2LUS A;  1A8L A;  5D9V A;  3I9V 2;  5DCH A;  4NAX A;  3GHA A;  1SEN A;  1SVM A;  1PN0 A;  1WJK A;  4TOP A;  3A2X A;  3KMO A;  5IMA A;  1R7H A;  4POM A;  3ZFL A;  4CY6 A;  4NHZ A;  2EIO A;  4TR4 A;  2FWF A;  3IR4 A;  2GS3 A;  5G2Z A;  4WF4 A;  1V58 A;  3VWU A;  1LBK A;  4GCI A;  3TRX A;  4N0V A;  2VUP A;  3W8J A;  1GTU A;  4XRD A;  2RLI A;  4WET A;  2EFE A;  2R37 A;  4MJB A;  1XFL A;  1TJD A;  4LL1 B;  2WW2 A;  3MWH A;  2OKA A;  4OD7 A;  3W6G A;  1YEX A;  5CYY A;  3TRP A;  1K0B A;  4WXT A;  4YH2 A;  3JCM L;  6GSX A;  4ZXG A;  5E59 A;  2CVK A;  3EIN A;  2KLX A;  8GSS A;  1S3R A;  1MDI A;  1F3B A;  5KN2 A;  2K8V A;  3LW9 A;  5KEJ A;  3UEM A;  1A8Y A;  1JHB A;  2AV4 A;  3UAP A;  1FAA A;  5ELA A;  4HI7 A;  3FZ5 A;  4XTS A;  4TRX A;  4MDC A;  4Q5N A;  5IMD A;  2C3T A;  3EC3 A;  1M3I A;  4K6X A;  4XIH A;  2UV8 G;  3I6A A;  1SU9 A;  3J7Y b;  2O87 A;  1PL1 A;  2NTO A;  2L59 A;  1GSD A;  1J9B A;  4KCA A;  4ZB9 A;  2I9H A;  3WGD A;  2REM A;  2CX4 A;  1PRX A;  1SK1 A;  1G6W A;  2CAI A;  17GS A;  1AXD A;  3A2W A;  3A5W A;  3HDC A;  2D2Z A;  4K9Z A;  4LLR A;  5ECM B;  3EYT A;  5JCG A;  1GLQ A;  2QKE A;  1T00 A;  5IQY A;  3ZIV A;  5B6M A;  2LTK A;  4K0G A;  3N9J A;  2OJL A;  2L57 A;  1TRW A;  3O76 A;  2B5E A;  2M80 A;  2H71 A;  1T4Z A;  4TXO B;  3WGX A;  1ERU A;  2XBQ A;  3CTG A;  1THO A;  1SD8 A;  2ES7 A;  4L8E A;  3WYW A;  4LA1 A;  3HVX A;  2H6Z A;  1SKS B;  2VAF A;  2VCX A;  2FWE A;  2PU9 C;  1OYJ A;  1WRY A;  1T1V A;  1GUK A;  5CRG A;  1EP7 A;  5CRW A;  1DE2 A;  5AIX A;  3KM6 A;  3FYG A;  3HY2 A;  2Z9S A;  2IL3 A;  1XXU A;  1FOV A;  2VL9 A;  1NHO A;  1RW1 A;  1VRS D;  1Q4J A;  2VLV A;  4NPB A;  3TJB A;  1XOA A;  1A0R P;  9GSS A;  5G5F A;  3D4M A;  1JZW A;  2GQL A;  1XG8 A;  1HYU A;  1X0R A;  4G0L A;  2B5Y A;  1TW9 A;  1F9M A;  4Z2R A;  5IOW A;  3L9V A;  4BL7 B;  1AUC A;  3BD2 A;  3R3E A;  1ACV A;  4J57 E;  4IW9 A;  4ZBB A;  5CRD A;  1GSE A;  1I5G A;  2C0F A;  3QOU A;  4EE0 A;  1HNC A;  1BAY A;  1NW2 A;  3LEF A;  5ECL B;  3IBH A;  4IQ1 A;  2WZ9 A;  5CP1 A;  1TU8 A;  3E3E A;  4N30 A;  3U5R E;  2RUE A;  12GS A;  4L5L A;  4IVF A;  1CQG A;  2PN8 A;  1DBY A;  1N2A A;  14GS A;  5J9B A;  3CQF A;  2XC2 A;  1WWJ A;  4K5S A;  4KSO A;  2GTU A;  5DCG A;  2HRF A;  5GAP D;  4PXO A;  5COH A;  2WS2 A;  3FR3 A;  1O7U A;  3VPQ A;  3FR9 A;  5KN0 A;  4RQX A;  4X1U A;  3P7X A;  4BL7 A;  4HJ2 A;  3TOT A;  4ECJ A;  3QDN A;  1GUH A;  1AC1 A;  3IA1 A;  1F3A A;  5H5Q A;  3CBU A;  3DML A;  3P90 A;  1K0A A;  3ZL5 A;  2A2R A;  5G1L A;  2VCW A;  2NBS A;  4PQH A;  2PVO C;  3KIJ A;  3ZVJ A;  5JCW A;  3RHC A;  2H0H A;  3UJ1 A;  2P31 A;  3IHG A;  4HQZ A;  1YF1 A;  1GTA A;  2H72 A;  4KA0 A;  1XW9 A;  5A4W A;  1MTC A;  1K0D A;  2R2J A;  2C1Y A;  2C3N A;  1Z5Y E;  3NOF A;  3ZRD A;  4F9Z A;  1O81 A;  2EFD A;  1KEB A;  2J9H A;  1QFN A;  1BG5 A;  4JR6 A;  5ID2 B;  1TKD B;  4MLY A;  3GN3 A;  1THX A;  5HQP A;  4I5Q A;  1ZOF A;  3D0Z A;  1BX9 A;  1X5D A;  2ALB A;  10GS A;  4ZB8 A;  1ML6 A;  3RPN A;  2CA8 A;  3IAS 2;  1GH2 A;  2H30 A;  2EIQ A;  4MCU A;  2DC5 A;  1M9A A;  4POL A;  6GST A;  1CQH A;  3LQ7 A;  2H1B A;  1K3O A;  2PER A;  2OE1 A;  1SJ6 A;  4TKY A;  1QQ2 A;  4K2D A;  3GKM A;  2ZUP A;  3GH9 A;  4I6X A;  2H8L A;  2YNX A;  4QQ7 A;  3UAR A;  3LOR A;  5A5H B;  4AJ8 A;  2TRX A;  4BWS A;  4KDX A;  2H6X A;  5ID2 A;  2H1D A;  1G0T A;  1O85 A;  4CY8 A;  1ON4 A;  4GXZ A;  5HFK A;  2LEG A;  5AIV A;  4JRR A;  1URM A;  3RPP A;  1LJR A;  1PQN A;  4MF7 A;  5LD0 A;  2WGR A;  4ZIJ A;  3MIX A;  5J3R A;  3ISO A;  2C0D A;  3QFB C;  3VFI A;  2CQ9 A;  3GA4 A;  5AN1 A;  1FG4 A;  3CXG A;  1SL1 B;  4KE3 A;  2C3Q A;  4EO3 A;  5ELG A;  2ZCT A;  1TU7 A;  1ZL9 A;  1BED A;  1PX6 A;  4PUR A;  1EV9 A;  3N5O A;  1W89 A;  3LYP A;  1O8X A;  3HHV A;  2OA7 A;  2QGV A;  3HZ8 A;  4HS1 A;  2E2G A;  3TJF A;  4PUA A;  4GTU A;  5A5H A;  4MMM A;  3C73 A;  1ERT A;  4ECC A;  4HZ2 A;  1YQ1 A;  3IDV A;  19GS A;  4BVX B;  5A1N B;  3QPM A;  5JWQ B;  1G6Y A;  3GRX A;  2O85 A;  4Q5Q A;  1GNW A;  4HDE A;  3L78 A;  1GWC A;  1JLW A;  4OO4 A;  3DXB A;  1J08 A;  2H76 A;  1YVL A;  4V2M A;  1Q98 A;  2YV7 A;  4HEA 2;  1TXX A;  4BA7 A;  3I43 A;  4GRF A;  1TRS A;  3F4R A;  3F4S A;  2HLS A;  2XPD A;  3DYR A;  3IOS A;  2L4C A;  18GS A;  2I81 A;  3M9K A;  6GSU A;  1YKC A;  3TJK A;  4EDZ A;  1K3Y A;  2JAD A;  3GKX A;  4RI6 A;  3HZ4 A;  4AJ7 A;  4DSQ A;  1BJX A;  2K18 A;  1NHY A;  2WVX B;  2LNS A;  3TGZ A;  3L9S A;  4TR1 B;  1J0F A;  5A1N A;  5AGY A;  1OC8 A;  3GSS A;  4OFM A;  2V6O A;  3GH6 A;  3ZTL A;  4WR4 A;  1ZYP A;  3VWV A;  5D96 A;  4GQC A;  2O5V A;  2HFD A;  1YZX A;  3BOA A;  1FB0 A;  2VKZ G;  1EOH A;  1PA3 A;  4BVY B;  5JWR B;  4K8M A;  1EEJ A;  2PMT A;  3HVN A;  1SKR B;  4O92 A;  2N5A A;  4HUA A;  2M46 A;  1S4B P;  3F0I A;  2GZY A;  2PPT A;  1A2L A;  2R0P A;  4EIP A;  2BTO T;  3G7Y A;  4BPY A;  1QK8 A;  4K5R A;  4FH8 A;  4K7N A;  4BIK A;  1X5C A;  5KN1 A;  3MDK A;  1MD4 A;  2DJ3 A;  2WVX A;  2O3E A;  4G01 A;  3M3M A;  1LU4 A;  4TR1 A;  4TR0 A;  3KJY A;  1AAZ A;  3IAM 2;  2YZH A;  1ZYE A;  2V41 A;  4YAP A;  4AKH A;  3HJO A;  4ULX A;  4IP6 A;  1OE8 A;  4I2U A;  1GTI A;  1E6B A;  4BVY A;  2BJX A;  2OAC A;  4DEJ A;  4OCE A;  2ON7 A;  5EY6 A;  3C7M A;  2TRC P;  5J4Y A;  4WEY A;  1TRV A;  1DSB A;  3EMX A;  4KB3 A;  1GTB A;  2DKI A;  5B8B A;  3FRC A;  1QMV A;  3FK8 A;  1U6T A;  2YN1 A;  2DIY A;  2GT5 A;  3RHB A;  4LL4 B;  2IFQ B;  3WD6 A;  4G2E A;  4XCS A;  1GSQ A;  5ECO B;  4O5Q A;  1MD3 A;  3EUR A;  3VWX A;  5F06 A;  3ZML A;  3QAG A;  1UA5 A;  2QA2 A;  5GZZ B;  1T7P B;  4GF0 A;  4YQV A;  4TW5 A;  2YWM A;  4HZ4 A;  1EZK A;  1V2A A;  4MP4 A;  2F9S A;  3ZLP A;  4F03 A;  1T3B A;  3P2A A;  3ME7 A;  1FW1 A;  6GSY A;  3HD5 A;  4AKG A;  3DEX A;  3VI7 A;  2YWN A;  3O6T A;  4MJA A;  2GSS A;  2HXK A;  2MMN A;  3GX8 A;  3IV4 A;  4ECI A;  4I2T A;  1Y6E A;  4XS6 A;  2RII A;  2A2S A;  2IFQ A;  3HA9 A;  4NV5 A;  3KH7 A;  3GV1 A;  2X8C A;  1PMT A;  2HSN B;  2VD1 A;  3TJJ A;  2H1L A;  2CVB A;  2DJ1 A;  4G10 A;  4FYC A;  1B9X C;  2XPE A;  4ZB6 A;  2IPA A;  1WP0 A;  2H66 A;  2FCH A;  4JE1 A;  5IIZ A;  1TK0 B;  2NPB A;  3FZ4 A;  2C8U A;  4IHU A;  4MZC A;  2VCV A;  4XHM A;  2WJU A;  1TI1 A;  3MYD A;  3C8E A;  5KOW A;  5GSS A;  4PI0 C;  4F82 A;  3GMF A;  2IJY A;  4FYB A;  3F63 A;  5CO3 A;  1GP1 A;  2MMZ A;  3GL3 A;  2YWO A;  4WKW A;  2WW3 A;  3SBC A;  2EFC A;  2DML A;  2DJK A;  3CSI A;  2X4A A;  2YZU A;  4ZBD A;  4RI7 A;  3LYK A;  2IMD A;  2HSN A;  4WBR D;  5D8I A;  3H4K A;  5DQS A;  4V1A g;  5LNK e;  1U3A A;  1M0U A;  2GSQ A;  4ACS A;  2B7K A;  2HRK B;  4P3Y B;  1EEM A;  2TIR A;  2LS5 A;  2C4J A;  5J4U A;  5J5N A;  4QMK A;  2MZC A;  4CDO A;  4K1F A;  3ED3 A;  1UC7 A;  3TUE A;  2HRA A;  2H75 A;  4O7H A;  3FMW A;  2AUV A;  3IK7 A;  1B4Q A;  1U87 A;  2FGX A;  1EP8 A;  4K0N A;  3LJR A;  5ABR A;  2X99 A;  3P8W A;  3W8S A;  3F3R A;  22GS A;  2LJK A;  1E2Y A;  2FWG A;  3CTF A;  5H5R A;  3A2V A;  4IS0 A;  4KCE A;  4E8E A;  3WT2 A;  2LRT A;  1SJI A;  1USB A;  3KD0 A;  3HXS A;  3KCM A;  5CAX A;  4OFN A;  5INY A;  2FA4 A;  1PSQ A;  3GL5 A;  3HJM A;  2G0F A;  1FHE A;  2EIR A;  3EWL A;  1FB6 A;  3UBL A;  4YKF A;  3VWW A;  2H0I A;  1R5A A;  2VCT A;  3MNG A;  1KTE A;  1GL8 A;  2YPM A;  2HRK A;  2VL3 A;  4MPG A;  1FO5 A;  2WDU A;  3GUS A;  4E68 A;  11GS A;  2HZE B;  2IME A;  2NDO A;  4RQR A;  3U6V A;  5IPH A;  1B4P A;  1U3I A;  1OC9 B;  3HKR A;  4JZQ A;  4IJ3 A;  2YV9 A;  3LG6 A;  3ZRE A;  1N8J A;  1XVW A;  3KZQ A;  2FHE A;  2WW1 A;  2JL4 A;  5D93 A;  4Q5F A;  2CT6 A;  2YOI A;  4H86 A;  1XZO A;  1WOU A;  2CVD A;  4ZL9 A;  2YJH A;  1RQM A;  3UMA A;  3C71 A;  1OVN A;  3QMX A;  4ZL7 A;  1M7T A;  3EU3 A;  3DRN A;  3ZVJ D;  3M0F A;  1OKT A;  5A34 A;  5G30 A;  3ZYW A;  3GIX A;  2RM6 A;  1O8W A;  4EIQ A;  3M1G A;  5GAN D;  1SVO A;  1AQV A;  2FA8 A;  1EGR A;  2A2P A;  4YAV A;  2HZE A;  3LWA A;  3M9J A;  2JU5 A;  1OC9 A;  1AW9 A;  1Z7R A;  2VM1 A;  3GKN A;  1TOF A;  3KH9 A;  2LJR A;  2MBS A;  4HJM A;  1ST9 A;  2JZR A;  2OBK A;  4XS1 A;  2E0Q A;  2CV4 A;  2VL2 C;  4V2N A;  2IIY A;  2LQQ A;  3TKS E;  3LSZ A;  2B1L A;  3E0U A;  1S3D A;  4ISD A;  3PH9 A;  1YF0 A;  4YKG A;  5DVB A;  2MMO A;  2VIM A;  3US3 A;  1W4V A;  3DIE A;  3ZIJ A;  4JED A;  3TCO A;  4OWY A;  3IK9 A;  5AIS A;  4V1A p;  1Z3E A;  1SD9 A;  4O5U A;  1EWX A;  4AKX B;  5DAL B;  3LGC A;  3VUR A;  4ZL8 A;  1XVQ A;  3D21 A;  3KEB A;  1S3A A;  1JZO A;  1SK0 A;  3KTB A;  2AHE A;  1GUM A;  5D73 A;  1XWC A;  2LJA A;  5IO0 A;  1BYE A;  1PD2 1;  4GQF A;  4WR5 A;  1Y1U A;  1V98 A;  4OCF A;  1ABA A;  4ML6 A;  4O32 A;  2X49 A;  3RBT A;  4F2I A;  5G1K A;  1GNE A;  5ECK B;  5LCZ A;  1PFO A;  2HSH A;  2WVZ A;  5JWO B;  2DJJ A;  1UN2 A;  3DGQ A;  1WIK A;  3HMJ G;  1HD2 A;  1XBS A;  2YP6 A;  4FO5 A;  3V1W A;  1MDJ A;  1K0O A;  5J4V A;  1GSF A;  2IMK A;  4HOJ A;  4G0K A;  3ERF A;  2GQK A;  1TXU A;  1PKW A;  4YQU A;  3O3T A;  4AGS A;  1VF2 A;  4PGT A;  2V1M A;  2CX3 A;  4X4J A;  3QR6 A;  3F8U A;  4KF9 A;  2QC7 A;  5DBQ A;  1XOB A;  3KP8 A;  5IPG A;  1G7O A;  5DAL A;  2F8A A;  2PBJ A;  3FEU A;  1A24 A;  1PN9 A;  3ERW A;  5F05 A;  4EUY A;  2F3M A;  2JZT A;  2OAD A;  1XWK A;  1T4Y A;  3IC4 A;  1YJ6 A;  1R4W A;  2R3X A;  4GDF A;  3IRA A;  2X8H A;  5DAK B;  2GDR A;  2O36 A;  4PNG A;  2GVP A;  5D9T A;  2CZ3 A;  2C0G A;  2EC4 A;  3EU4 A;  2MMA A;  3FY7 A;  1ZZY A;  3CRU A;  2GT6 A;  4HU9 A;  4XS4 B;  5J41 A;  4AI6 A;  1GSY A;  1NSW A;  4L5O A;  4IGJ A;  1WPI A;  4I8B A;  4GSN A;  5G31 A;  1PKZ A;  1OE7 A;  3A5I A;  1ERV A;  4L0U A;  3SWL A;  2E2M A;  1R5P A;  3ZIT A;  2K6V A;  2I1U A;  4Q5R A;  5ECR B;  5A5K A;  4ILF A;  5C00 A;  1Z9H A;  4DVC A;  2J23 A;  1TTZ A;  2O89 A;  2YJ7 A;  3L4N A;  3ZZX A;  4JR4 A;  2VOC A;  2F51 A;  2VCQ A;  5EPF A;  5HFG A;  2ZNM A;  3F3Q A;  2MYG A;  3GX0 A;  3H93 A;  1TP9 A;  2HSM A;  1M9B A;  5IMF A;  1WE0 A;  1VGL A;  4FYU A;  2AAW A;  3GUR A;  5DJM A;  5A4V A;  4ZBA A;  1EV4 A;  1AIU A;  1A2J A;  1V57 A;  5EVO A;  5DAK A;  1SYR A;  3D6I A;  1ZYQ B;  4G19 A;  3IE3 A;  2WUL A;  3GNJ A;  4EKZ A;  3TKQ A;  4W66 A;  3UBK A;  2GLR A;  4O5R A;  4XS4 A;  2FLS A;  2H70 A;  2KP2 A;  1I9D A;  4E8H A;  4WF5 A;  4WBJ A;  1H4O A;  2LST A;  5IMV A;  2FNO A;  1GRX A;  3CYN A;  4KUN A;  1MEK A;  16GS A;  5J9C A;  2V2G A;  3ERG A;  4PHZ C;  4DSS B;  13GS A;  4USS A;  1K0C A;  4IN0 A;  1V9W A;  5IMC A;  3D22 A;  4N10 A;  3IC8 A;  1XW5 A;  1ZYN A;  2WFC A;  4EVM A;  4JU5 A;  1SK2 A;  2RUF A;  1BQ7 A;  4ECB A;  4ML1 A;  2V6K A;  3GYK A;  4POB A;  4GLT A;  2DJ2 A;  2A4V A;  3HVS A;  1TDI A;  3CSJ A;  4FXY P;  4N3Z A;  2B3S A;  1B48 A;  3KP9 A;  1HNB A;  3DWV A;  5H5S A;  1GSU A;  1M2A A;  5D9W A;  1YEW C;  1SVL A;  1XW6 A;  3FZ9 A;  3IXR A;  1YY7 A;  1SL2 B;  5HFI A;  1EGO A;  1TI3 A;  1N25 A;  3D4T A;  3WT1 A;  2DSA A;  3GKK A;  4KDY A;  5IM9 A;  2LNT A;  4XRA A;  4DSS A;  3EE2 A;  1Z6M A;  2HT9 A;  1IYH A;  5DDL A;  2WZS A;  3Q6O A;  4Z2U A;  5B8A A;  1I1I P;  3FZA A;  5ECP B;  4BWQ A;  1B8X A;  1GUL A;  3MAK A;  1VF3 A;  1SKW B;  3DKS A;  4F0C A;  4PUF C;  1SYX A;  1U88 A;  5IOX A;  3RDW A;  1R26 A;  3TKS C;  5KOX A;  3UVH A;  2FWH A;  2L6C A;  2V32 A;  1YKA A;  2N5B A;  1F2E A;  3VK9 A;  4CHS A;  3UIW A;  2LRN A;  1SJZ A;  2PGT A;  4HU7 A;  3KMN A;  1OC3 A;  2JSY A;  4KAE A;  2O7K A;  3LXT A;  1WMJ A;  1IYI A;  4EXJ A;  3CRT A;  3LXZ A;  5J40 A;  3IPZ A;  3PPU A;  4RUV A;  4K7I A;  3H8Q A;  4ZB7 A;  1F37 A;  5CRH A;  1KNG A;  4KGI A;  2AJQ B;  5ECH B;  4D73 B;  3VI5 A;  5F0G A;  2N5F A;  2IMF A;  5CRE A;  2VD0 A;  5EL8 A;  4ID0 A;  1S3C A;  4CW9 A;  3RAZ A;  2HQT A;  2B1K A;  1JZD A;  5FHI A;  2WW0 A;  6GSV A;  1M99 A;  5ECS A;  2P0G A;  2VM2 A;  2H73 A;  3AY8 A;  1C72 A;  3UVT A;  4IJI A;  3L0H A;  2GZZ A;  1GSS A;  3CSH A;  2NVL A;  1DE1 A;  2HSY A;  4MZB A;  3G9B A;  2M72 A;  3TKR A;  1ZGN A;  1MDK A;  1JFU A;  1YEP A;  1AQW A;  3TJG A;  4FQU A;  4AKI A;  1NM3 A;  4Z7X A;  3TB2 A;  4X43 A;  2VCZ A;  1X9W B;  4IKH A;  5IO2 A;  2DKH A;  1XCC A;  4MNN A;  1Y25 A;  4G9H A;  2H19 A;  3WGE A;  4GSS A;  4TXO A;  4D73 A;  3KXO A;  4EL1 A;  2WCI A;  1ZCP A;  2LKU A;  3A3T A;  2OE3 A;  2H1A A;  3IHQ A;  1RK4 A;  4NXI A;  2H0G A;  4QL9 A;  5G5E A;  2YCD A;  1A23 A;  3VPT A;  2B6M A;  4MPF A;  3FW2 A;  1XWG A;  2R0G A;  3EMP A;  2YAN A;  3TOU A;  1Z7P A;  5HR1 A;  2H74 A;  2K9F A;  1Z6N A;  2VL2 A;  1PX7 A;  1QGV A;  3OR5 A;  5A34 B;  4LMV A;  5B6N A;  1K0N A;  5F07 A;  5ECQ B;  4GWR A;  3F4T A;  4AJ6 A;  4MJE A;  4L0W A;  2LRC A;  3MSZ A;  2KHP A;  3QD9 A;  3FKF A;  5DJL A;  5HR3 A;  3EVI A;  2X64 A;  1H75 A;  1O73 A;  2KOK A;  3APS A;  2C80 A;  2YWI A;  2QSI A;  2WB9 A;  2H6Y A;  4MJC A;  3G7I A;  2PWJ A;  2WVY A;  5IMZ A;  2IWT A;  4HQS A;  4IP1 A;  4TVE A;  2DBC A;  2I4A A;  2FUG 2;  3CMI A;  2OT3 A;  4POK A;  3APQ A;  4NMU A;  1FVJ A;  2HI7 A;  3EPT A;  4EF0 A;  2GST A;  4EC0 A;  4MF6 A;  4KND A;  4OFT A;  5GST A;  3Q74 A;  1B9Y C;  4OMV A;  1JZR A;  4LMW A;  2FY6 A;  1PL2 A;  3NIV A;  2DMM A;  1QUW A;  1AQX A;  4DSR A;  2EFH A;  2F8F A;  3GST A;  2JZS A;  2KP1 A;  2R0C A;  3HJP A;  6GSS A;  2HRN A;  3TU3 B;  3J7Y k;  3PR8 A;  2PUK C;  3S9F A;  1XPV A;  2O8V B;  5HR2 A;  4N0Z A;  1BF5 A;  3C1R A;  1YDK A;  2G2Q A;  3H1N A;  1GLP A;  2WRT A;  2L5O A;  1QXH A;  2JSZ A;  2E7P A;  2B7J A;  2XBI A;  7GSS A;  4HSC X;  2VLU A;  4MK3 A;  4IQA A;  2HNL A;  1KBN A;  4MF5 A;  1M3J A;  2B5X A;  3R2Q A;  2L5L A;  2HE3 A;  4J56 E;  3Q19 A;  3G7J A;  3KTL A;  1TK5 B;  3DD3 A;  3FHK A;  2I3Y A;  4MH3 A;  2IMI A;  4F0B A;  4J2F A;  4PI2 C;  3KGK A;  1TRU A;  2KUC A;  5DQY A;  3HYP A;  4QL7 A;  1M2D A;  2HYX A;  5L71 A;  4JBB A;  1OAZ A;  2JAC A;  5KN3 A;  2DJ0 A;  3H79 A;  3I69 A;  2L4Q A;  4G0I A;  1ILO A;  3K8N A;  5ECI B;  4K2X A;  2R4V A;  2LV3 A;  5ECN B;  1VF4 A;  4X0X A;  3CWG A;  1SL0 B;  5D9X A;  3TRQ A;  3DVW A;  1G7E A;  2R5G A;  3PGT A;  4MZW A;  2AYT A;  4KW6 A;  3C1S A;  2ON5 A;  4PTS A;  1K0M A;  3F6F A;  3TKP A;  2K8S A;  4MA9 A;  3BCK A;  2P5Q A; 
#chains in the Genus database with same CATH homology
 2GGT A;  3VLN A;  4PQI A;  1HQO A;  2QA1 A;  3HCZ A;  4ZIL A;  1M2B A;  5HR0 A;  2GZP A;  2H1G A;  2HSM B;  3BCI A;  4OO5 A;  4ICY A;  5BMU B;  4PNF A;  2DLX A;  2CAQ A;  4N11 A;  3DVX A;  4NV2 A;  1A2M A;  4GST A;  1HNA A;  2FD3 A;  3NZN A;  2UZ8 A;  2MBT A;  4IBP A;  1VF1 A;  1FVK A;  4KDU A;  1O6J A;  4KSM A;  4IEL A;  5JCU A;  3QAV A;  4K7O A;  2AB6 A;  3GTU B;  1BG1 A;  3LFL A;  3BJ5 A;  2GQM A;  4KH7 A;  1ERW A;  3ME8 A;  3BBY A;  2BMX A;  20GS A;  2IN3 A;  2XHF A;  4TN8 A;  5A4U A;  2LQO A;  1UVZ A;  4NHW A;  2VO4 A;  4KX4 A;  1ZMA A;  4PX1 A;  4Z2T A;  1DUG A;  1A0F A;  2DIZ A;  4A5P A;  1XWB A;  1EOG A;  2L6D A;  5B7C A;  4PQ1 A;  3F6D A;  5FWG A;  4MH2 A;  2VLT A;  1PGT A;  3UL3 A;  1TK8 B;  1K3L A;  3QFA C;  4EDY A;  2H01 A;  4BVX A;  4MAB A;  1V40 A;  3F9U A;  5J47 A;  1F6M C;  5CNW A;  2C0E A;  3QAW A;  4TXV A;  2CZ2 A;  5BMU A;  1X9S B;  4V2L A;  2OE0 A;  3UOM A;  5E4W A;  2RM5 A;  2P5R A;  4FIW A;  4YQM A;  2X8G A;  6GSW A;  3D5J A;  3ZMK A;  2A4H A;  5ENU A;  3APO A;  4NWY A;  3TDG A;  2PVQ A;  3L9U A;  4TR3 A;  4AF2 A;  2OBI A;  2GSR A;  1JLV A;  3GTU A;  3ZFB A;  1OKD A;  3GFK A;  3E9J B;  1XWA A;  3TKS A;  4I97 A;  1FOH A;  2HZF A;  5BRT A;  3HVV A;  1X9M B;  3PIN A;  5C04 A;  1X5E A;  3Q18 A;  3QCP A;  1XIY A;  2R6K A;  3FR6 A;  5F8B A;  1T8E B;  5FT3 A;  3M8N A;  2LUS A;  1A8L A;  5D9V A;  3I9V 2;  5DCH A;  4NAX A;  3GHA A;  1SEN A;  1SVM A;  1PN0 A;  1WJK A;  4TOP A;  3A2X A;  3KMO A;  5IMA A;  1R7H A;  4POM A;  3ZFL A;  4CY6 A;  4NHZ A;  2EIO A;  4TR4 A;  2FWF A;  3IR4 A;  2GS3 A;  5G2Z A;  4WF4 A;  1V58 A;  3VWU A;  1LBK A;  4GCI A;  3TRX A;  4N0V A;  2VUP A;  3W8J A;  1GTU A;  4XRD A;  2RLI A;  4WET A;  2EFE A;  2R37 A;  4MJB A;  1XFL A;  1TJD A;  4LL1 B;  3MWH A;  2OKA A;  4OD7 A;  3W6G A;  1YEX A;  5CYY A;  3TRP A;  1K0B A;  4WXT A;  4YH2 A;  3JCM L;  6GSX A;  4ZXG A;  5E59 A;  2CVK A;  3EIN A;  2KLX A;  8GSS A;  1MDI A;  1F3B A;  5KN2 A;  2K8V A;  3LW9 A;  5KEJ A;  3UEM A;  1A8Y A;  1JHB A;  2AV4 A;  3UAP A;  1FAA A;  5ELA A;  4HI7 A;  3FZ5 A;  4XTS A;  4TRX A;  4MDC A;  4Q5N A;  5IMD A;  2C3T A;  3EC3 A;  4K6X A;  4XIH A;  2UV8 G;  3I6A A;  1SU9 A;  3J7Y b;  2O87 A;  1PL1 A;  2NTO A;  2L59 A;  1GSD A;  1J9B A;  4KCA A;  4ZB9 A;  2I9H A;  3WGD A;  2REM A;  2CX4 A;  1PRX A;  1SK1 A;  1G6W A;  2CAI A;  17GS A;  1AXD A;  3A2W A;  3A5W A;  3HDC A;  2D2Z A;  4K9Z A;  4LLR A;  5ECM B;  3EYT A;  5JCG A;  1GLQ A;  2QKE A;  1T00 A;  5IQY A;  3ZIV A;  5B6M A;  2LTK A;  4K0G A;  3N9J A;  2OJL A;  2L57 A;  1TRW A;  3O76 A;  2B5E A;  2M80 A;  2H71 A;  1T4Z A;  4TXO B;  3WGX A;  1ERU A;  2XBQ A;  3CTG A;  1THO A;  1SD8 A;  2ES7 A;  4L8E A;  3WYW A;  4LA1 A;  3HVX A;  2H6Z A;  1SKS B;  2VAF A;  2VCX A;  2FWE A;  2PU9 C;  1OYJ A;  1WRY A;  1T1V A;  1GUK A;  5CRG A;  1EP7 A;  5CRW A;  1DE2 A;  5AIX A;  3KM6 A;  3FYG A;  3HY2 A;  2Z9S A;  2IL3 A;  1XXU A;  1FOV A;  2VL9 A;  1NHO A;  1RW1 A;  1VRS D;  1Q4J A;  2VLV A;  4NPB A;  3TJB A;  1XOA A;  1A0R P;  9GSS A;  5G5F A;  3D4M A;  1JZW A;  2GQL A;  1HYU A;  1X0R A;  4G0L A;  2B5Y A;  1TW9 A;  1F9M A;  4Z2R A;  5IOW A;  3L9V A;  4BL7 B;  1AUC A;  3BD2 A;  3R3E A;  1ACV A;  4J57 E;  4IW9 A;  4ZBB A;  5CRD A;  1GSE A;  1I5G A;  2C0F A;  3QOU A;  4EE0 A;  1HNC A;  1BAY A;  1NW2 A;  3LEF A;  5ECL B;  3IBH A;  4IQ1 A;  2WZ9 A;  5CP1 A;  1TU8 A;  3E3E A;  4N30 A;  3U5R E;  2RUE A;  12GS A;  4L5L A;  4IVF A;  1CQG A;  2PN8 A;  1DBY A;  1N2A A;  14GS A;  5J9B A;  2XC2 A;  1WWJ A;  4K5S A;  4KSO A;  2GTU A;  5DCG A;  2HRF A;  5GAP D;  4PXO A;  5COH A;  2WS2 A;  3FR3 A;  1O7U A;  3VPQ A;  3FR9 A;  5KN0 A;  4RQX A;  4X1U A;  3P7X A;  4BL7 A;  4HJ2 A;  3TOT A;  4ECJ A;  3QDN A;  1GUH A;  1AC1 A;  3IA1 A;  1F3A A;  5H5Q A;  3CBU A;  3DML A;  3P90 A;  1K0A A;  3ZL5 A;  2A2R A;  5G1L A;  2VCW A;  2NBS A;  4PQH A;  2PVO C;  3KIJ A;  3ZVJ A;  5JCW A;  3RHC A;  2H0H A;  3UJ1 A;  2P31 A;  3IHG A;  4HQZ A;  1YF1 A;  1GTA A;  2H72 A;  4KA0 A;  1XW9 A;  5A4W A;  1MTC A;  1K0D A;  2R2J A;  2C1Y A;  2C3N A;  1Z5Y E;  3NOF A;  3ZRD A;  4F9Z A;  1O81 A;  2EFD A;  1KEB A;  2J9H A;  1QFN A;  1BG5 A;  4JR6 A;  5ID2 B;  1TKD B;  4MLY A;  3GN3 A;  1THX A;  5HQP A;  4I5Q A;  1ZOF A;  3D0Z A;  1BX9 A;  1X5D A;  2ALB A;  10GS A;  4ZB8 A;  1ML6 A;  3RPN A;  2CA8 A;  3IAS 2;  1GH2 A;  2H30 A;  2EIQ A;  4MCU A;  2DC5 A;  1M9A A;  4POL A;  6GST A;  1CQH A;  3LQ7 A;  2H1B A;  1K3O A;  2PER A;  2OE1 A;  1SJ6 A;  4TKY A;  1QQ2 A;  4K2D A;  3GKM A;  2ZUP A;  3GH9 A;  4I6X A;  2H8L A;  2YNX A;  4QQ7 A;  3UAR A;  3LOR A;  5A5H B;  4AJ8 A;  2TRX A;  4BWS A;  4KDX A;  2H6X A;  5ID2 A;  2H1D A;  1G0T A;  1O85 A;  4CY8 A;  1ON4 A;  4GXZ A;  5HFK A;  2LEG A;  5AIV A;  4JRR A;  1URM A;  3RPP A;  1LJR A;  1PQN A;  4MF7 A;  5LD0 A;  2WGR A;  4ZIJ A;  3MIX A;  5J3R A;  3ISO A;  2C0D A;  3QFB C;  3VFI A;  2CQ9 A;  3GA4 A;  5AN1 A;  1FG4 A;  3CXG A;  1SL1 B;  4KE3 A;  2C3Q A;  4EO3 A;  5ELG A;  2ZCT A;  1TU7 A;  1ZL9 A;  1BED A;  1PX6 A;  4PUR A;  1EV9 A;  3N5O A;  1W89 A;  3LYP A;  1O8X A;  3HHV A;  2OA7 A;  2QGV A;  3HZ8 A;  4HS1 A;  2E2G A;  3TJF A;  4PUA A;  4GTU A;  5A5H A;  4MMM A;  3C73 A;  1ERT A;  4ECC A;  4HZ2 A;  1YQ1 A;  3IDV A;  19GS A;  4BVX B;  5A1N B;  3QPM A;  5JWQ B;  1G6Y A;  3GRX A;  2O85 A;  4Q5Q A;  1GNW A;  4HDE A;  3L78 A;  1GWC A;  1JLW A;  4OO4 A;  3DXB A;  1J08 A;  2H76 A;  1YVL A;  4V2M A;  1Q98 A;  2YV7 A;  4HEA 2;  1TXX A;  4BA7 A;  3I43 A;  4GRF A;  1TRS A;  3F4R A;  3F4S A;  2HLS A;  2XPD A;  3DYR A;  3IOS A;  2L4C A;  18GS A;  2I81 A;  3M9K A;  6GSU A;  1YKC A;  3TJK A;  4EDZ A;  1K3Y A;  2JAD A;  3GKX A;  4RI6 A;  3HZ4 A;  4AJ7 A;  4DSQ A;  1BJX A;  2K18 A;  1NHY A;  2LNS A;  3TGZ A;  3L9S A;  4TR1 B;  1J0F A;  5A1N A;  5AGY A;  1OC8 A;  3GSS A;  4OFM A;  2V6O A;  3GH6 A;  3ZTL A;  4WR4 A;  1ZYP A;  3VWV A;  5D96 A;  4GQC A;  2O5V A;  2HFD A;  1YZX A;  3BOA A;  1FB0 A;  2VKZ G;  1EOH A;  1PA3 A;  4BVY B;  5JWR B;  4K8M A;  1EEJ A;  2PMT A;  1SKR B;  4O92 A;  2N5A A;  4HUA A;  2M46 A;  3F0I A;  2GZY A;  2PPT A;  1A2L A;  2R0P A;  4EIP A;  2BTO T;  3G7Y A;  4BPY A;  1QK8 A;  4K5R A;  4FH8 A;  4K7N A;  1X5C A;  5KN1 A;  3MDK A;  1MD4 A;  2DJ3 A;  4G01 A;  3M3M A;  1LU4 A;  4TR1 A;  4TR0 A;  3KJY A;  1AAZ A;  3IAM 2;  2YZH A;  1ZYE A;  2V41 A;  4YAP A;  4AKH A;  3HJO A;  4ULX A;  4IP6 A;  1OE8 A;  4I2U A;  1GTI A;  1E6B A;  4BVY A;  2BJX A;  2OAC A;  4DEJ A;  4OCE A;  2ON7 A;  5EY6 A;  3C7M A;  2TRC P;  5J4Y A;  4WEY A;  1TRV A;  1DSB A;  3EMX A;  4KB3 A;  1GTB A;  2DKI A;  5B8B A;  3FRC A;  1QMV A;  3FK8 A;  1U6T A;  2YN1 A;  2DIY A;  2GT5 A;  3RHB A;  4LL4 B;  2IFQ B;  3WD6 A;  4G2E A;  4XCS A;  1GSQ A;  5ECO B;  4O5Q A;  1MD3 A;  3EUR A;  3VWX A;  5F06 A;  3ZML A;  3QAG A;  1UA5 A;  2QA2 A;  5GZZ B;  1T7P B;  4GF0 A;  4YQV A;  4TW5 A;  2YWM A;  4HZ4 A;  1EZK A;  1V2A A;  4MP4 A;  2F9S A;  3ZLP A;  4F03 A;  1T3B A;  3P2A A;  3ME7 A;  1FW1 A;  6GSY A;  3HD5 A;  4AKG A;  3DEX A;  3VI7 A;  2YWN A;  3O6T A;  4MJA A;  2GSS A;  2HXK A;  2MMN A;  3GX8 A;  3IV4 A;  4ECI A;  4I2T A;  1Y6E A;  4XS6 A;  2RII A;  2A2S A;  2IFQ A;  3HA9 A;  4NV5 A;  3KH7 A;  3GV1 A;  2X8C A;  1PMT A;  2HSN B;  2VD1 A;  3TJJ A;  2H1L A;  2CVB A;  2DJ1 A;  4G10 A;  4FYC A;  1B9X C;  2XPE A;  4ZB6 A;  2IPA A;  1WP0 A;  2H66 A;  2FCH A;  4JE1 A;  5IIZ A;  1TK0 B;  2NPB A;  3FZ4 A;  2C8U A;  4IHU A;  4MZC A;  2VCV A;  4XHM A;  2WJU A;  1TI1 A;  3MYD A;  3C8E A;  5KOW A;  5GSS A;  4F82 A;  3GMF A;  2IJY A;  4FYB A;  3F63 A;  5CO3 A;  1GP1 A;  2MMZ A;  3GL3 A;  2YWO A;  4WKW A;  3SBC A;  2EFC A;  2DML A;  2DJK A;  3CSI A;  2X4A A;  2YZU A;  4ZBD A;  4RI7 A;  3LYK A;  2IMD A;  2HSN A;  4WBR D;  5D8I A;  3H4K A;  5DQS A;  4V1A g;  5LNK e;  1U3A A;  1M0U A;  2GSQ A;  4ACS A;  2B7K A;  2HRK B;  4P3Y B;  1EEM A;  2TIR A;  2LS5 A;  2C4J A;  5J4U A;  5J5N A;  4QMK A;  2MZC A;  4CDO A;  4K1F A;  3ED3 A;  1UC7 A;  3TUE A;  2HRA A;  2H75 A;  4O7H A;  3FMW A;  2AUV A;  3IK7 A;  1B4Q A;  1U87 A;  2FGX A;  1EP8 A;  4K0N A;  3LJR A;  5ABR A;  2X99 A;  3P8W A;  3W8S A;  3F3R A;  22GS A;  2LJK A;  1E2Y A;  2FWG A;  3CTF A;  5H5R A;  3A2V A;  4IS0 A;  4KCE A;  4E8E A;  3WT2 A;  2LRT A;  1SJI A;  1USB A;  3KD0 A;  3HXS A;  3KCM A;  5CAX A;  4OFN A;  5INY A;  2FA4 A;  1PSQ A;  3GL5 A;  3HJM A;  2G0F A;  1FHE A;  2EIR A;  3EWL A;  1FB6 A;  3UBL A;  4YKF A;  3VWW A;  2H0I A;  1R5A A;  2VCT A;  3MNG A;  1KTE A;  1GL8 A;  2YPM A;  2HRK A;  2VL3 A;  4MPG A;  1FO5 A;  2WDU A;  3GUS A;  4E68 A;  11GS A;  2HZE B;  2IME A;  2NDO A;  4RQR A;  3U6V A;  5IPH A;  1B4P A;  1U3I A;  1OC9 B;  3HKR A;  4JZQ A;  4IJ3 A;  2YV9 A;  3LG6 A;  3ZRE A;  1N8J A;  1XVW A;  3KZQ A;  2FHE A;  2JL4 A;  5D93 A;  4Q5F A;  2CT6 A;  2YOI A;  4H86 A;  1XZO A;  1WOU A;  2CVD A;  4ZL9 A;  2YJH A;  1RQM A;  3UMA A;  3C71 A;  1OVN A;  3QMX A;  4ZL7 A;  1M7T A;  3EU3 A;  3DRN A;  3ZVJ D;  3M0F A;  1OKT A;  5A34 A;  5G30 A;  3ZYW A;  3GIX A;  2RM6 A;  1O8W A;  4EIQ A;  3M1G A;  5GAN D;  1SVO A;  1AQV A;  2FA8 A;  1EGR A;  2A2P A;  4YAV A;  2HZE A;  3LWA A;  3M9J A;  2JU5 A;  1OC9 A;  1AW9 A;  1Z7R A;  2VM1 A;  3GKN A;  1TOF A;  3KH9 A;  2LJR A;  2MBS A;  4HJM A;  1ST9 A;  2JZR A;  2OBK A;  4XS1 A;  2E0Q A;  2CV4 A;  2VL2 C;  4V2N A;  2IIY A;  2LQQ A;  3TKS E;  3LSZ A;  2B1L A;  3E0U A;  1S3D A;  4ISD A;  3PH9 A;  1YF0 A;  4YKG A;  5DVB A;  2MMO A;  2VIM A;  3US3 A;  1W4V A;  3DIE A;  3ZIJ A;  4JED A;  3TCO A;  4OWY A;  3IK9 A;  5AIS A;  4V1A p;  1Z3E A;  1SD9 A;  4O5U A;  1EWX A;  4AKX B;  5DAL B;  3LGC A;  3VUR A;  4ZL8 A;  1XVQ A;  3D21 A;  3KEB A;  1S3A A;  1JZO A;  1SK0 A;  3KTB A;  2AHE A;  1GUM A;  5D73 A;  1XWC A;  2LJA A;  5IO0 A;  1BYE A;  1PD2 1;  4GQF A;  4WR5 A;  1Y1U A;  1V98 A;  4OCF A;  1ABA A;  4ML6 A;  4O32 A;  2X49 A;  3RBT A;  4F2I A;  5G1K A;  1GNE A;  5ECK B;  5LCZ A;  2HSH A;  5JWO B;  2DJJ A;  1UN2 A;  3DGQ A;  1WIK A;  3HMJ G;  1HD2 A;  1XBS A;  2YP6 A;  4FO5 A;  3V1W A;  1MDJ A;  1K0O A;  5J4V A;  1GSF A;  2IMK A;  4HOJ A;  4G0K A;  3ERF A;  2GQK A;  1TXU A;  1PKW A;  4YQU A;  3O3T A;  4AGS A;  1VF2 A;  4PGT A;  2V1M A;  2CX3 A;  4X4J A;  3QR6 A;  3F8U A;  4KF9 A;  2QC7 A;  5DBQ A;  1XOB A;  3KP8 A;  5IPG A;  1G7O A;  5DAL A;  2F8A A;  2PBJ A;  3FEU A;  1A24 A;  1PN9 A;  3ERW A;  5F05 A;  4EUY A;  2F3M A;  2JZT A;  2OAD A;  1XWK A;  1T4Y A;  3IC4 A;  1YJ6 A;  1R4W A;  2R3X A;  4GDF A;  3IRA A;  2X8H A;  5DAK B;  2GDR A;  4PNG A;  2GVP A;  5D9T A;  2CZ3 A;  2C0G A;  2EC4 A;  3EU4 A;  2MMA A;  3FY7 A;  1ZZY A;  3CRU A;  2GT6 A;  4HU9 A;  4XS4 B;  5J41 A;  4AI6 A;  1GSY A;  1NSW A;  4L5O A;  4IGJ A;  1WPI A;  4I8B A;  4GSN A;  5G31 A;  1PKZ A;  1OE7 A;  3A5I A;  1ERV A;  4L0U A;  3SWL A;  2E2M A;  1R5P A;  3ZIT A;  2K6V A;  2I1U A;  4Q5R A;  5ECR B;  5A5K A;  4ILF A;  5C00 A;  1Z9H A;  4DVC A;  2J23 A;  1TTZ A;  2O89 A;  2YJ7 A;  3L4N A;  3ZZX A;  4JR4 A;  2VOC A;  2F51 A;  2VCQ A;  5EPF A;  5HFG A;  2ZNM A;  3F3Q A;  2MYG A;  3GX0 A;  3H93 A;  1TP9 A;  2HSM A;  1M9B A;  5IMF A;  1WE0 A;  1VGL A;  4FYU A;  2AAW A;  3GUR A;  5DJM A;  5A4V A;  4ZBA A;  1EV4 A;  1AIU A;  1A2J A;  1V57 A;  5EVO A;  5DAK A;  1SYR A;  3D6I A;  1ZYQ B;  4G19 A;  3IE3 A;  2WUL A;  3GNJ A;  4EKZ A;  3TKQ A;  4W66 A;  3UBK A;  2GLR A;  4O5R A;  4XS4 A;  2FLS A;  2H70 A;  2KP2 A;  1I9D A;  4E8H A;  4WF5 A;  4WBJ A;  1H4O A;  2LST A;  5IMV A;  2FNO A;  1GRX A;  3CYN A;  4KUN A;  1MEK A;  16GS A;  5J9C A;  2V2G A;  3ERG A;  4DSS B;  13GS A;  4USS A;  1K0C A;  4IN0 A;  1V9W A;  5IMC A;  3D22 A;  4N10 A;  3IC8 A;  1XW5 A;  1ZYN A;  2WFC A;  4EVM A;  4JU5 A;  1SK2 A;  2RUF A;  1BQ7 A;  4ECB A;  4ML1 A;  2V6K A;  3GYK A;  4POB A;  4GLT A;  2DJ2 A;  2A4V A;  3HVS A;  1TDI A;  3CSJ A;  4N3Z A;  2B3S A;  1B48 A;  3KP9 A;  1HNB A;  3DWV A;  5H5S A;  1GSU A;  1M2A A;  5D9W A;  1SVL A;  1XW6 A;  3FZ9 A;  3IXR A;  1YY7 A;  1SL2 B;  5HFI A;  1EGO A;  1TI3 A;  1N25 A;  3D4T A;  3WT1 A;  2DSA A;  3GKK A;  4KDY A;  5IM9 A;  2LNT A;  4XRA A;  4DSS A;  3EE2 A;  1Z6M A;  2HT9 A;  1IYH A;  5DDL A;  3Q6O A;  4Z2U A;  5B8A A;  3FZA A;  5ECP B;  4BWQ A;  1B8X A;  1GUL A;  3MAK A;  1VF3 A;  1SKW B;  3DKS A;  4F0C A;  4PUF C;  1SYX A;  1U88 A;  5IOX A;  3RDW A;  1R26 A;  3TKS C;  5KOX A;  3UVH A;  2FWH A;  2L6C A;  2V32 A;  1YKA A;  2N5B A;  1F2E A;  3VK9 A;  4CHS A;  3UIW A;  2LRN A;  1SJZ A;  2PGT A;  4HU7 A;  3KMN A;  1OC3 A;  2JSY A;  4KAE A;  2O7K A;  3LXT A;  1WMJ A;  1IYI A;  4EXJ A;  3CRT A;  3LXZ A;  5J40 A;  3IPZ A;  3PPU A;  4RUV A;  4K7I A;  3H8Q A;  4ZB7 A;  1F37 A;  5CRH A;  1KNG A;  4KGI A;  2AJQ B;  5ECH B;  4D73 B;  3VI5 A;  5F0G A;  2N5F A;  2IMF A;  5CRE A;  2VD0 A;  5EL8 A;  4ID0 A;  1S3C A;  4CW9 A;  3RAZ A;  2HQT A;  2B1K A;  1JZD A;  5FHI A;  6GSV A;  1M99 A;  5ECS A;  2P0G A;  2VM2 A;  2H73 A;  3AY8 A;  1C72 A;  3UVT A;  4IJI A;  3L0H A;  2GZZ A;  1GSS A;  3CSH A;  2NVL A;  1DE1 A;  2HSY A;  4MZB A;  3G9B A;  2M72 A;  3TKR A;  1ZGN A;  1MDK A;  1JFU A;  1YEP A;  1AQW A;  3TJG A;  4FQU A;  4AKI A;  1NM3 A;  4Z7X A;  3TB2 A;  4X43 A;  2VCZ A;  1X9W B;  4IKH A;  5IO2 A;  2DKH A;  1XCC A;  4MNN A;  1Y25 A;  4G9H A;  2H19 A;  3WGE A;  4GSS A;  4TXO A;  4D73 A;  3KXO A;  4EL1 A;  2WCI A;  1ZCP A;  2LKU A;  3A3T A;  2OE3 A;  2H1A A;  3IHQ A;  1RK4 A;  4NXI A;  2H0G A;  4QL9 A;  5G5E A;  2YCD A;  1A23 A;  3VPT A;  2B6M A;  4MPF A;  3FW2 A;  1XWG A;  2R0G A;  3EMP A;  2YAN A;  3TOU A;  1Z7P A;  5HR1 A;  2H74 A;  2K9F A;  1Z6N A;  2VL2 A;  1PX7 A;  1QGV A;  3OR5 A;  5A34 B;  4LMV A;  5B6N A;  1K0N A;  5F07 A;  5ECQ B;  4GWR A;  3F4T A;  4AJ6 A;  4MJE A;  4L0W A;  2LRC A;  3MSZ A;  2KHP A;  3QD9 A;  3FKF A;  5DJL A;  5HR3 A;  3EVI A;  2X64 A;  1H75 A;  1O73 A;  2KOK A;  3APS A;  2C80 A;  2YWI A;  2QSI A;  2WB9 A;  2H6Y A;  4MJC A;  3G7I A;  2PWJ A;  5IMZ A;  2IWT A;  4HQS A;  4IP1 A;  4TVE A;  2DBC A;  2I4A A;  2FUG 2;  3CMI A;  2OT3 A;  4POK A;  3APQ A;  4NMU A;  1FVJ A;  2HI7 A;  3EPT A;  4EF0 A;  2GST A;  4EC0 A;  4MF6 A;  4KND A;  4OFT A;  5GST A;  3Q74 A;  1B9Y C;  4OMV A;  1JZR A;  4LMW A;  2FY6 A;  1PL2 A;  3NIV A;  2DMM A;  1QUW A;  1AQX A;  4DSR A;  2EFH A;  2F8F A;  3GST A;  2JZS A;  2KP1 A;  2R0C A;  3HJP A;  6GSS A;  2HRN A;  3TU3 B;  3J7Y k;  3PR8 A;  2PUK C;  3S9F A;  1XPV A;  2O8V B;  5HR2 A;  4N0Z A;  1BF5 A;  3C1R A;  1YDK A;  2G2Q A;  3H1N A;  1GLP A;  2WRT A;  2L5O A;  1QXH A;  2JSZ A;  2E7P A;  2B7J A;  2XBI A;  7GSS A;  2VLU A;  4MK3 A;  4IQA A;  2HNL A;  1KBN A;  4MF5 A;  2B5X A;  3R2Q A;  2L5L A;  2HE3 A;  4J56 E;  3Q19 A;  3G7J A;  3KTL A;  1TK5 B;  3DD3 A;  3FHK A;  2I3Y A;  4MH3 A;  2IMI A;  4F0B A;  4J2F A;  3KGK A;  1TRU A;  2KUC A;  5DQY A;  3HYP A;  4QL7 A;  1M2D A;  2HYX A;  5L71 A;  4JBB A;  1OAZ A;  2JAC A;  5KN3 A;  2DJ0 A;  3H79 A;  3I69 A;  2L4Q A;  4G0I A;  1ILO A;  3K8N A;  5ECI B;  4K2X A;  2R4V A;  2LV3 A;  5ECN B;  1VF4 A;  4X0X A;  3CWG A;  1SL0 B;  5D9X A;  3TRQ A;  3DVW A;  1G7E A;  2R5G A;  3PGT A;  4MZW A;  2AYT A;  4KW6 A;  3C1S A;  2ON5 A;  4PTS A;  1K0M A;  3F6F A;  3TKP A;  2K8S A;  4MA9 A;  3BCK A;  2P5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...