4USSA

Populus trichocarpa glutathione transferase x1-1 (ghr1), complexed with glutathione
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
306
structure length
306
Chain Sequence
TASTFRNFISKEPNSQFPPESGRYHLYVSYACPWASRCLAYLKIKGLEKAIAFTSVKPIWERTKESDEHMGWVFPASETEEAGAEPDTLNGARSIRELYELASTNYAGKYTVPVLWDKKLKTIVNNESSEIIRMFNTEFNDIAENAALDLYPSHLQAQIDETNGWVYDGINNGVYKCGFARKQGPYEEAAIQLYEALDKCEEILGRQRYICGNTLSEADIKLFVTLIRFDEVYAVHFKCNKKLLRDYPNMFNYTKDIFQIPGMSSTVNMQHIKRHYYGSHPTVNPFGIIPLGPDIDYSSPHDRNRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONYL HYDROQUINONE REDUCTASE
publication title Glutathionyl-Hydroquinone Reductases from Poplar are Plastidial Proteins that Deglutathionylate Both Reduced and Oxidized Glutathionylated Quinones.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 99
structure length 306
sequence length 306
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ussA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ussA01
3GTUB 5ECMB 5IQYA 3ERGA 4HZ2A 4IBPA 4Q5QA 1RK4A 5ECPB 1G7OA 3I6AA 1XWGA 4G10A 5G5EA 3CRTA 4WR4A 3FY7A 5EL8A 1K3LA 5D73A 4KDUA 4JBBA 1B4PA 3IBHA 1XWKA 2CAQA 4K0GA 5J5NA 5KEJA 1BX9A 3VPTA 1K3OA 3GSTA 1VF2A 4EDZA 2OACA 3R3EA 3N9JA 4NHZA 2AAWA 1GLPA 5J41A 3I69A 4RI7A 3M8NA 3LJRA 2HSMB 4EE0A 1PMTA 2ON5A 4PQIA 9GSSA 1GUHA 3H1NA 3GTUA 1Q4JA 1ZGNA 4CHSA 3HJMA 2GSSA 3GUSA 4KAEA 3GH6A 1GTUA 1HNAA 1M9AA 5B7CA 4MF6A 3ERFA 1V40A 2VCXA 3KM6A 2HQTA 3FR3A 1FHEA 1V2AA 3LYKA 4E8EA 1E6BA 1VF4A 5F07A 3LXTA 3M1GA 1UA5A 12GSA 1OYJA 4MDCA 3CBUA 1TU7A 3C8EA 3F6FA 5BMUA 2R6KA 18GSA 3CSHA 5LCZA 5DALA 5F06A 3TOTA 2A2SA 4BVYA 4OMVA 1PKWA 1PA3A 1M0UA 2WS2A 5GSSA 4GSSA 3VWXA 2YV7A 1EOHA 1VF3A 2HSMA 3M3MA 1LBKA 2V6KA 3DGQA 1LJRA 1TDIA 1PX6A 2GSQA 4G19A 3UVHA 1JLVA 1U87A 5AISA 4JEDA 1YQ1A 2YV9A 6GSUA 1B48A 1OE8A 3M0FA 3QAGA 3LSZA 4FQUA 2LJRA 3CSIA 17GSA 3R2QA 3W8SA 4IQ1A 1GWCA 1GULA 1K0NA 4RI6A 1GLQA 4LMVA 5EVOA 4F03A 22GSA 3LFLA 5F8BA 3PPUA 1GSDA 4KDXA 4PGTA 2YCDA 5ECQB 1K0CA 2IMKA 1XW6A 3KJYA 5DQSA 4KDYA 3UARA 3FR9A 1TW9A 1YDKA 1K0BA 3LYPA 3UBLA 2VD0A 3QAWA 1NHYA 3D0ZA 1ZL9A 4NHWA 4K0NA 3TGZA 1GSSA 3ZFLA 5HFKA 14GSA 2JL4A 5ELAA 4IGJA 4GLTA 4IQAA 1JZRA 2C3QA 2DSAA 2J9HA 3P8WA 4YQMA 2C80A 1PN9A 1IYHA 6GSSA 3FYGA 4TOPA 2OADA 5DCGA 1PGTA 4BVXA 5D9WA 3VI5A 5D9VA 3KMOA 3KMNA 6GSYA 1DUGA 4L5OA 5DALB 11GSA 2GTUA 4BVYB 1XW5A 1HQOA 4ZB8A 5A4UA 2C3NA 2WRTA 1GTBA 2IMIA 4ZBAA 1B8XA 2GLRA 3LQ7A 2CAIA 4IW9A 2WB9A 19GSA 1GSQA 4NAXA 1EOGA 1GSYA 3U6VA 3F6DA 4HI7A 6GSVA 1YY7A 3PGTA 1K3YA 4IS0A 5LD0A 4GSTA 4ZB9A 2D2ZA 2F3MA 3GSSA 4EXJA 3FRCA 5JCWA 5ECRB 5AN1A 5DJMA 5EY6A 1BG5A 3G7JA 1K0OA 1F3BA 4QQ7A 5AIXA 5D9TA 5ECIB 1C72A 4O92A 1GTAA 2C4JA 7GSSA 2VD1A 2UZ8A 5ECLB 2VO4A 1R5AA 3BBYA 2FHEA 2ON7A 2HSNB 4ISDA 4G0KA 2AB6A 13GSA 1PD21 5JCUA 4ECCA 4ZBDA 5ELGA 3N5OA 2AHEA 1BAYA 3KTLA 1HNCA 1USBA 2NTOA 4F0CA 3ZMLA 2X64A 3IR4A 1A0FA 5AIVA 1ML6A 1FW1A 3ZFBA 2CZ3A 4ECIA 1K0DA 1AQXA 1Z9HA 1F3AA 1EV9A 4BVXB 2GSRA 4OFNA 4ZBBA 2R5GA 2VCZA 1PKZA 2PMTA 1YJ6A 4USSA 4G9HA 2IL3A 4YAVA 4GF0A 1F2EA 6GSXA 4HJ2A 4LMWA 1KBNA 2HNLA 1GSUA 5D9XA 4IJIA 2GDRA 1K0MA 4ID0A 5F05A 8GSSA 3PR8A 1AQWA 4GSNA 1GNWA 4KF9A 4HOJA 4PX1A 3VPQA 1PL1A 4YQUA 1AW9A 3WYWA 4G0LA 4PNFA 5ECHB 4G0IA 4PQHA 4MK3A 2PGTA 4Q5FA 1GTIA 5DAKA 1N2AA 4ACSA 4PUAA 5ECSA 4ECBA 3MAKA 2PBJA 4IVFA 4YAPA 1M99A 5FWGA 4IELA 2CA8A 1PX7A 4YH2A 3O3TA 4KE3A 5FHIA 3VURA 10GSA 3IK7A 4N0VA 2CVDA 4KH7A 2C3TA 2N5FA 2F8FA 1GUKA 4J2FA 4MF7A 2WJUA 5A5KA 3GURA 3RBTA 2R4VA 5GZZB 1YKCA 4I97A 1EEMA 1GSEA 3O76A 4KX4A 4MP4A 3ZMKA 3NIVA 3FR6A 1MTCA 5J4UA 2HRKA 4MPFA 3CSJA 2CZ2A 4KGIA 5ECNB 3WD6A 4ZB6A 4L5LA 1G6WA 1U3IA 3L0HA 5DJLA 1Y6EA 1BYEA 3ISOA 4Q5RA 3EINA 2OA7A 1OKTA 3GX0A 2GSTA 4O7HA 1MD4A 3IK9A 1VF1A 4MZWA 4PURA 1GUMA 5ECOB 2VCTA 1GSFA 2VCQA 3TOUA 2VCVA 4AGSA 3VLNA 3VI7A 1M9BA 6GSTA 1AXDA 3HJOA 1PL2A 3Q18A 4OFMA 5DAKB 4HZ4A 3P90A 3LXZA 3UBKA 4BL7B 1JLWA 4ECJA 3DD3A 4F0BA 3QR6A 5G5FA 5DDLA 4PTSA 3KXOA 4YQVA 3CRUA 3EE2A 4MPGA 3G7IA 4WR5A 4JZQA 2A2RA 5ECKB 20GSA 5AGYA 2HRAA 5F0GA 3Q74A 1K0AA 2VCWA 4GCIA 4DEJA 4OFTA 4GTUA 1MD3A 3AY8A 1IYIA 4PNGA 4MF5A 1U88A 3F63A 3SWLA 1OE7A 3VK9A 1AQVA 2WDUA 3MDKA 1G6YA 2HRKB 1TU8A 4Q5NA 1HNBA 2C8UA 4L8EA 2PVQA 4EC0A 4PXOA 5FT3A 2PERA 3IC8A 4KSMA 3QAVA 5A4WA 2R3XA 16GSA 5A4VA 1GNEA 5GSTA 3LG6A 4ZXGA 3IE3A 2DC5A 3HKRA 4BL7A 2FNOA 3Q19A 1EV4A 4E8HA 6GSWA 4EDYA 4IKHA 3UAPA
chains in the Genus database with same CATH superfamily
2NBSA 1EEJA 3BD2A 4MCUA 1YF0A 4HZ2A 4IBPA 4N11A 4MZCA 5ECPB 3I6AA 1YEPA 2FUG2 3ZREA 3CRTA 3FY7A 2MMNA 3KEBA 1O73A 3EWLA 1XWKA 2CAQA 4K0GA 5B8BA 3ME8A 4MABA 1BX9A 3VPTA 2VAFA 3LEFA 5IMDA 3S9FA 3IHGA 2AAWA 1GLPA 5J40A 2EIRA 1RQMA 4I2TA 3ERWA 2HSMB 2P0GA 4NV5A 5G31A 2X99A 4EIPA 1SL0B 4CHSA 2GSSA 1TKDB 4KAEA 3ZIJA 1HNAA 3FR3A 1FHEA 3LYKA 1XPVA 5F07A 3LXTA 1OVNA 4K7IA 1WPIA 1DE2A 3TDGA 1AIUA 1OYJA 3C8EA 5BMUA 3NOFA 3HA9A 1FOVA 3KD0A 5A1NB 3FW2A 2PUKC 5DALA 3WGEA 5IO2A 4GSSA 1R26A 3KH9A 1VF3A 3DGQA 4XS4B 1LJRA 1V57A 3VFIA 2DJJA 2J23A 2GSQA 2N5BA 3KTBA 5GAND 1SKSB 4JEDA 6GSUA 2RLIA 2H6ZA 3V1WA 2H0GA 1O85A 3M0FA 2M46A 2WGRA 5D93A 2GZZA 3R2QA 2FLSA 2C1YA 2CT6A 1K0NA 2H71A 4FO5A 4I6XA 4F03A 2QA1A 3LFLA 3PPUA 1THOA 1GSDA 3KIJA 3UJ1A 2VUPA 3KH7A 4PGTA 2BMXA 3TJJA 2YCDA 5A34A 5ECQB 1XW6A 3UARA 3FR9A 1Z6NA 1O81A 3HYPA 1ZL9A 1OC8A 1O8WA 4NHWA 2DJ0A 4GQCA 3HVVA 14GSA 2B3SA 4FYCA 2FY6A 3EVIA 3RAZA 2HSYA 4X43A 2HSHA 4BVXA 2K8VA 2WULA 5BMUB 5D9VA 4N3ZA 3L78A 1SL1B 6GSYA 4KA0A 3F0IA 5DALB 2NVLA 2GTUA 1XW5A 2GT6A 3GMFA 4ZB8A 4AKHA 1SENA 2JACA 2WRTA 3A5WA 4ZBAA 2VM2A 2B5EA 5CO3A 3W8JA 4MMMA 19GSA 2X4AA 1GSYA 1R7HA 3GV1A 4HI7A 6GSVA 5H5QA 1H4OA 1YY7A 1K3YA 1RW1A 2H19A 5LD0A 2H0HA 4GSTA 4ZB9A 4EXJA 3GSSA 2L4QA 1AAZA 2ZCTA 1WWJA 5HR3A 2GQKA 5EY6A 4MH2A 2H76A 2R2JA 1XVQA 1K0OA 4J56E 1F3BA 1NW2A 1XXUA 1C72A 4O92A 1O7UA 2YPMA 2YJHA 5A5HA 2UZ8A 5A34B 3CQFA 1U3AA 4AJ6A 2HZEA 2EFEA 2HSNB 2WZ9A 3FK8A 3KTLA 2O7KA 3APSA 3HCZA 3ZMLA 2X64A 2X8GA 3A2VA 1ML6A 2H30A 2CZ3A 1AQXA 4QMKA 3TKPA 3GKMA 1EV9A 3DEXA 1Z3EA 4BVXB 4POKA 5HFIA 1S3DA 2VCZA 2UV8G 4YKGA 4G9HA 2E7PA 2FWEA 1URMA 6GSXA 1F2EA 4LMWA 1SK2A 1SYRA 4EVMA 5CRHA 4RQRA 5CRDA 1PQNA 4EIQA 3TCOA 2IWTA 4GSNA 2ZUPA 4XS6A 1PL1A 4GXZA 3WYWA 4PQHA 2PGTA 2N5AA 1BJXA 2KP1A 3MAKA 1M99A 4YH2A 2AJQB 3O3TA 4WKWA 10GSA 3IK7A 1SJIA 2LQOA 2C3TA 4HQSA 2N5FA 2F8FA 1XW9A 5JWOB 4J2FA 3FMWA 3ZYWA 5A5HB 4TKYA 3GURA 1XWAA 3EURA 3F4TA 5C04A 4MP4A 1Z6MA 2MZCA 3FR6A 2NPBA 2X49A 1V58A 3J7Yb 3I43A 4K2DA 4L0WA 5DJLA 2I1UA 3UMAA 4K5RA 4AJ8A 3IA1A 4CW9A 5JWRB 3EINA 1SU9A 2OA7A 2K6VA 2LRCA 2WW0A 4POBA 1X5DA 1QMVA 4HQZA 1WP0A 2DJ3A 2R0GA 4AKIA 5D96A 2VCVA 4AGSA 4WBJA 1AUCA 1M9BA 2O8VB 3HVNA 3Q18A 3H93A 3LXZA 1JLWA 4J57E 4BIKA 2QA2A 3FEUA 1XFLA 4F0BA 3QR6A 4JE1A 3QPMA 3KXOA 5HFGA 2FWGA 3TJKA 4IHUA 3P2AA 4HEA2 2VCWA 4KSOA 2F8AA 4DEJA 1Y25A 4GTUA 2H1LA 2ES7A 2I9HA 4PI2C 2L5LA 1U88A 1GP1A 3VK9A 3MDKA 4XRAA 1G6YA 2VLUA 3GKXA 3C1SA 3TRPA 4EC0A 3IC8A 5CYYA 5A4VA 2YNXA 2TRCP 2E0QA 2AV4A 3GA4A 3D4MA 3RGBC 4IKHA 2R0CA 3UAPA 1OC3A 3IHQA 4DSQA 4HS1A 4P3YB 5ECMB 2PPTA 5IQYA 2EC4A 3ERGA 1T1VA 1G7OA 1S3CA 1XWGA 3DIEA 4G10A 5G5EA 1MDKA 1TI3A 5EL8A 5D73A 4KDUA 2K8SA 2QGVA 3GHAA 3IBHA 2HZFA 1WOUA 4L0UA 1K3OA 1M7TA 3F9UA 1V9WA 1QQ2A 3FKFA 2MMZA 3I69A 4RI7A 1ZMAA 1TXXA 4F9ZA 4EE0A 2I81A 3TU3B 1GUHA 3TJGA 4TR4A 4MJAA 1XZOA 1JFUA 3GH6A 1JZOA 2GGTA 2BTOT 1GTUA 2DMLA 1M9AA 2HT9A 5B7CA 3DWVA 4EO3A 2VCXA 2FWFA 2HQTA 2PVOC 4E8EA 3HVSA 2B5YA 1T4YA 1UVZA 3M1GA 1FO5A 1UA5A 5INYA 2JU5A 3MWHA 1TU7A 3DRNA 5G30A 3F6FA 3CSHA 4MH3A 2B7KA 4ZL7A 2AYTA 4ZILA 2B6MA 3C1RA 4BVYA 1G0TA 2YWMA 3HVXA 1PA3A 2WZSA 1EOHA 2HSMA 3M3MA 1SJ6A 5KN1A 3APQA 3UEMA 1TDIA 3VWVA 3UL3A 3UVHA 5J3RA 1JLVA 5AISA 1ZYQB 3C7MA 4FYUA 1YQ1A 3HJPA 4OCFA 3LSZA 4FQUA 1GH2A 2H70A 1BG1A 1GWCA 1TRUA 4TVEA 2VM1A 3RPPA 4FYBA 4ICYA 1W89A 1X9MB 2QC7A 3FZAA 3WT2A 4KDXA 3PH9A 1K0CA 2H72A 1WJKA 3EMPA 3D0ZA 1XBSA 1GSSA 4XS4A 5IMAA 5ELAA 4IJ3A 4IQAA 2DIYA 1JZRA 4IP6A 4YQMA 5H5RA 3QFBC 2L4CA 2GS3A 3MIXA 2JADA 2DKHA 2EFDA 3KMOA 2GQLA 3KMNA 2DMMA 3CTFA 4BVYB 2LQQA 1TOFA 5A4UA 4TXVA 1GTBA 1M2AA 2IMIA 2XBQA 3G9BA 2K18A 2CAIA 4BWQA 5IMVA 2WB9A 2IMEA 3U6VA 2F9SA 1EP8A 3PINA 4IP1A 2F3MA 1I1IP 2TRXA 4LL4B 3FRCA 3CMIA 1TK0B 2X8CA 3QMXA 5DJMA 1JZWA 2OE1A 1A23A 4OO5A 4NPBA 2JZTA 2HRNA 5HQPA 1SVMA 2OT3A 7GSSA 3MSZA 2VD1A 5ECLB 1R5AA 2LJKA 2CQ9A 2FHEA 1GL8A 2ON7A 4G0KA 4HUAA 1PD21 3FHKA 5JCUA 1XCCA 4ZBDA 1I5GA 3RDWA 2AHEA 3IPZA 1FG4A 3H79A 2NTOA 3ZLPA 3IR4A 4WF4A 1F3AA 1FB0A 4ZB7A 2H74A 2PMTA 1YJ6A 4TW5A 4USSA 1TTZA 3F4SA 4YAVA 3H8QA 3US3A 1YZXA 1KBNA 3GX8A 4IJIA 2FCHA 3TKRA 1K0MA 5F05A 4F82A 4TR0A 4PHZC 3CYNA 2HSNA 2YJ7A 2NDOA 1KTEA 3VPQA 1XVWA 3HZ8A 5KN3A 5ECHB 1N8JA 2OE0A 5DAKA 2O5VA 1VRSD 5DCHA 5FWGA 4YAPA 4K6XA 2EIQA 4I8BA 2EFHA 5FHIA 3VURA 4DSRA 4N0VA 4X0XA 2CVDA 2YANA 2OBKA 4MF7A 2CV4A 5CRWA 2FD3A 5GZZB 2H1DA 4I97A 5BRTA 1EEMA 1HD2A 2HYXA 2O87A 1ERUA 3NIVA 3ZVJD 4XHMA 2CZ2A 2P5QA 3K8NA 4L5LA 1Y6EA 2V6OA 2OJLA 1BYEA 4POLA 4JR6A 4Q5RA 1F9MA 5DQYA 2KOKA 4H86A 2IMFA 2GSTA 2RUFA 4EF0A 4MZWA 4MJCA 1GUMA 1SVLA 1OC9A 3TKSC 4GRFA 3GH9A 4PUFC 3RFRC 3IDVA 1NSWA 3RHBA 1A24A 2X8HA 6GSTA 2EIOA 2H8LA 5E59A 1AXDA 3FZ4A 2CX3A 1FVKA 1XWBA 2XHFA 2LS5A 5HR1A 1J08A 4OFMA 5DAKB 3P90A 2YWNA 1G7EA 3DD3A 2DJ2A 2H0IA 2VLVA 5DDLA 1AC1A 3EE2A 4MPGA 3G7YA 5KOWA 2A2RA 4BA7A 1ZYNA 2HRAA 1X5EA 5J47A 4ML6A 1K0AA 4NWYA 2WW2A 1S3AA 1ST9A 3L9UA 3KP8A 1WE0A 4MF5A 3SWLA 3ZTLA 1Z5YE 1AQVA 2GZPA 4KCAA 2C8UA 3WGXA 1XOBA 3HHVA 5FT3A 1YKAA 3LGCA 4KSMA 5A4WA 2R3XA 16GSA 1GNEA 2JSYA 5GSTA 2KLXA 4LLRA 4ZXGA 2PWJA 4Z7XA 4OO4A 3F4RA 2DC5A 3HKRA 5JWQB 4E8HA 6GSWA 3GTUB 4FH8A 2E2GA 3ZVJA 2EFCA 2RUEA 1OC9B 1QFNA 4Q5QA 4WR4A 5CP1A 2LEGA 4JBBA 2G0FA 3ZZXA 4TR1A 2LSTA 3TB2A 1ABAA 5IMCA 1KNGA 1VF2A 4EDZA 2OACA 3E0UA 2FGXA 4K2XA 3N9JA 4NHZA 2O36A 2MMAA 3M8NA 4PQIA 9GSSA 1DSBA 3OR5A 3H1NA 2LUSA 1ZGNA 2H1GA 4Z2TA 3HJMA 3D6IA 1FB6A 4XCSA 2C0GA 2RM6A 4D73A 5IO0A 3I9V2 2LTKA 2REMA 3ERFA 2DLXA 4CDOA 1A2JA 1V2AA 1E6BA 1VF4A 3D21A 2JZRA 2LJAA 12GSA 3KGKA 2VKZG 2R6KA 4GQFA 18GSA 3DMLA 3IAS2 4O5QA 5LCZA 5J9CA 5F06A 1J9BA 2G2QA 4OMVA 5EPFA 5KOXA 3IRAA 3CXGA 4MJEA 5GSSA 4POMA 2YV7A 2DJKA 1UN2A 1LBKA 1MEKA 5CAXA 1PX6A 1MDIA 2P31A 5IMZA 3EMXA 4O5UA 4O32A 4DVCA 4EKZA 1ZOFA 4TR1B 2LJRA 3NZNA 4MZBA 2AUVA 17GSA 2QSIA 4IQ1A 3HZ4A 3DVXA 4RI6A 4LMVA 5EVOA 1TRVA 5F8BA 2V1MA 2ALBA 3SBCA 1SD8A 2YN1A 5DQSA 4KDYA 1TW9A 1K0BA 2A2PA 4XS1A 2L6CA 1NHYA 4K0NA 4D73B 3TJFA 1F6MC 3ZFLA 1A8YA 5HFKA 1QGVA 4IGJA 4CY8A 2C3QA 3P8WA 5IOWA 2WFCA 1SK0A 1EP7A 4BPYA 2WCIA 5J4VA 5KN0A 5KN2A 2OADA 4A5PA 1PGTA 1TK8B 5JCGA 1SVOA 2YP6A 4V1Ag 3P7XA 5CNWA 3HMJG 4L5OA 11GSA 2HFDA 1HQOA 2YWOA 1WIKA 2C3NA 1NHOA 3D22A 5IPGA 2IN3A 4Z2UA 1B8XA 2GLRA 2CVKA 4NAXA 1GSQA 3DKSA 1EOGA 5CREA 2PN8A 2D2ZA 1B9YC 2IPAA 3D5JA 5ECRB 4DSSA 3BJ5A 3G7JA 2HLSA 4QQ7A 3QFAC 1PSQA 1BQ7A 5D9TA 2FWHA 3A5IA 1GTAA 3EU3A 3BBYA 5G1KA 1ERTA 2O85A 3IAM2 4XRDA 3C71A 4KW6A 4YKFA 1BEDA 4ZL9A 2WW1A 5ELGA 1FOHA 3BOAA 2O3EA 1BAYA 2OKAA 3KP9A 1HNCA 4F0CA 2IJYA 5AIVA 1FW1A 3ZFBA 1A0RP 3KZQA 4ECIA 4X1UA 1Z9HA 2KUCA 4KCEA 4RQXA 4ZBBA 2R5GA 3EYTA 1PKZA 3IV4A 2ZNMA 4N30A 2V2GA 4GF0A 4HJ2A 4BWSA 1GSUA 4WBRD 1ZCPA 2XC2A 1TK5B 2PU9C 3PR8A 1TP9A 5IM9A 1AQWA 4KF9A 2XPEA 4PX1A 4YQUA 1AW9A 1NM3A 4G0LA 3KCMA 5B6NA 3O6TA 4MK3A 4Q5FA 1GTIA 3UIWA 1N2AA 3GFKA 4PUAA 3HDCA 4DSSB 4GDFA 1CQGA 4AKGA 2CA8A 1PX7A 2B7JA 4KE3A 1T00A 2IFQA 4KH7A 3GKNA 1GUKA 3RBTA 2R4VA 3M9KA 4MA9A 5HR2A 1TXUA 3ZIVA 5ID2B 1MTCA 2HRKA 1YF1A 2H6YA 3CSJA 2P5RA 3TKSA 3EU4A 4KGIA 3WD6A 4ZB6A 3GN3A 4HJMA 1U3IA 4XIHA 4G2EA 2HE3A 3ISOA 2H75A 3APOA 1T8EB 3ZRDA 4I2UA 4O7HA 1MD4A 3IK9A 4KUNA 3IC4A 3GL3A 1VF1A 2I3YA 2H01A 2JZSA 2V32A 2XPDA 2VCTA 3CWGA 2LNTA 4TXOA 5CRGA 1TRSA 2CX4A 1A2MA 1PL2A 2I4AA 5G1LA 1DE1A 1VGLA 3UBKA 4BL7B 3QCPA 1PRXA 4HU7A 3VWUA 5ABRA 2WVXA 3CRUA 3G7IA 4JZQA 5C00A 2IFQB 20GSA 3H4KA 3BCIA 5AGYA 1SYXA 2DBCA 2FA8A 4OFTA 1MD3A 3AY8A 3GKKA 4PNGA 2VL9A 3F63A 2BJXA 2C0EA 1OE7A 2TIRA 1CQHA 2HRKB 1TU8A 1HNBA 4ZIJA 5DVBA 4L8EA 4ULXA 1UC7A 2PVQA 1GRXA 4PXOA 1QK8A 4Z2RA 2PERA 1ZYEA 3QAVA 3GNJA 2OBIA 3FZ5A 4LA1A 1KEBA 1EV4A 3JCML 1T7PB 2H1BA 4AF2A 1B9XC 3F3RA 2B1LA 1E2YA 1SK1A 4MJBA 3F8UA 2WVZA 3F3QA 1RK4A 3HD5A 3L4NA 4TXOB 1SKWB 4GWRA 2K9FA 1SJZA 2Z9SA 1K3LA 2O89A 1TJDA 1EZKA 1B4PA 3TKSE 5J5NA 5KEJA 2A4VA 4FXYP 5E4WA 3GYKA 2HI7A 4FIWA 3GSTA 3IOSA 3R3EA 2WVXB 5B6MA 3QD9A 3CTGA 5J41A 4OD7A 4WETA 1EWXA 2LRNA 3LJRA 1A8LA 1PMTA 2ON5A 5B8AA 3GTUA 1Q4JA 2OE3A 3GUSA 2VL2A 4MF6A 2KP2A 1V40A 3KM6A 3HY2A 3EPTA 3QOUA 3BCKA 4V2NA 2A4HA 4E68A 2MYGA 5LNKe 4JU5A 2YOIA 5J4YA 3TRXA 4MDCA 3CBUA 4KB3A 3TOTA 3LORA 2A2SA 1PKWA 1BF5A 1M2BA 1H75A 1M0UA 2WS2A 2YZUA 3VWXA 4F2IA 2GQMA 1J0FA 2IIYA 2V6KA 2JSZA 4HDEA 1XIYA 4G19A 2M80A 3ED3A 4KNDA 4ILFA 1U87A 2YV9A 4PI0C 4CY6A 2H1AA 1B48A 4O5RA 1OE8A 1XWCA 3QAGA 4WF5A 3ZL5A 4QL7A 3CSIA 3W8SA 3MYDA 1GULA 1U6TA 4AJ7A 4K7OA 1GLQA 22GSA 1DBYA 1ACVA 1T3BA 3KJYA 2IMKA 4RUVA 3U5RE 1YDKA 3LYPA 3UBLA 2VD0A 3QAWA 4IN0A 2V41A 1SD9A 3TGZA 1Z7RA 5D8IA 4I5QA 2JL4A 2C0DA 2B5XA 4GLTA 3LW9A 4G01A 2DSAA 2J9HA 2LRTA 2C80A 3DXBA 1PN9A 1IYHA 6GSSA 3FYGA 4TOPA 4AKXB 5DCGA 1WRYA 5D9WA 3VI5A 1M3JA 2DJ1A 1DUGA 2CVBA 4ZL8A 2WVYA 4OWYA 2HZEB 4TRXA 2MBTA 1X9WB 3RHCA 1QUWA 1ERVA 1EGRA 4IW9A 3LQ7A 4W66A 1X9SB 2F51A 2DIZA 3F6DA 3GL5A 1JHBA 3M9JA 1OAZA 3PGTA 4IS0A 1OKDA 2RIIA 1B4QA 3C73A 5JCWA 2MBSA 4NXIA 3IXRA 5AN1A 4TN8A 1F37A 1BG5A 5AIXA 2VL3A 5ECIB 2C4JA 2WW3A 4PQ1A 2XBIA 2VO4A 3ME7A 2VL2C 1FVJA 3L9SA 4ISDA 5H5SA 2AB6A 5IPHA 4V1Ap 13GSA 4ECCA 4MLYA 4NMUA 5G2ZA 4TR3A 4K8MA 3N5OA 1USBA 3A3TA 1A0FA 1K0DA 4K5SA 1SL2B 1ERWA 3J7Yk 4JR4A 2GSRA 1JZDA 4OFNA 5COHA 2H66A 3DYRA 1Q98A 3VWWA 3E3EA 2IL3A 3CHXC 1X0RA 1TRWA 1T4ZA 4N10A 2HNLA 3E9JB 5D9XA 2M72A 2GDRA 3WT1A 3RPNA 1O8XA 4ID0A 2L57A 2GVPA 2MMOA 3QDNA 1XG8A 8GSSA 1I9DA 5IMFA 1GNWA 4HOJA 1PFOA 3LWAA 5IOXA 4PNFA 3EC3A 4G0IA 3TRQA 4ACSA 1YEXA 1FAAA 4OCEA 5ECSA 4XTSA 2C0FA 3FZ9A 4ECBA 3MNGA 2PBJA 4IVFA 2LKUA 1YEWC 4IELA 3A2XA 4K1FA 1THXA 3GRXA 1YVLA 4N0ZA 2WJUA 5A5KA 3WGDA 1YKCA 3Q6OA 1GSEA 2LNSA 3O76A 4KX4A 2VOCA 3ZMKA 5J4UA 2HRFA 4MPFA 2GZYA 3ZITA 5ECNB 1S4BP 3TJBA 3UVTA 1G6WA 3L0HA 3W6GA 2YZHA 5GAPD 2YWIA 1Z7PA 1R5PA 4QL9A 2E2MA 2IMDA 2VIMA 3UOMA 1M3IA 4K7NA 2LV3A 1ON4A 2L5OA 1HYUA 1SKRB 2H6XA 5DBQA 4V2MA 1PN0A 5J9BA 3L9VA 2KHPA 4HU9A 4K9ZA 3GX0A 1OKTA 2R0PA 3DVWA 4NV2A 2GT5A 4PURA 5ECOB 4MNNA 1GSFA 2L6DA 2VCQA 2B1KA 3TOUA 1M2DA 2L59A 1A2LA 3HXSA 3VLNA 1TI1A 5ENUA 5L71A 3VI7A 2VLTA 2FA4A 4JRRA 4X4JA 2QKEA 5ID2A 3HJOA 4ML1A 1X5CA 3A2WA 4WXTA 3GIXA 1XOAA 4HZ4A 5HR0A 5IIZA 4ECJA 4LL1B 4V2LA 1S3RA 5G5FA 4PTSA 1ZYPA 2H73A 4YQVA 1V98A 4WR5A 5ECKB 3TKQA 1EGOA 2HXKA 2DKIA 5F0GA 3Q74A 4GCIA 4WEYA 2RM5A 1LU4A 1ILOA 2R37A 1IYIA 1QXHA 1W4VA 4EL1A 1MDJA 2WDUA 4Q5NA 3D4TA 1Y1UA 1ZZYA 3TUEA 1O6JA 1N25A 4AI6A 4HSCX 3LG6A 3IE3A 1WMJA 4BL7A 5A1NA 2FNOA 3Q19A 1R4WA 4EUYA 4EDYA
chains in the Genus database with same CATH topology
2NBSA 1EEJA 3BD2A 4MCUA 1YF0A 4HZ2A 4IBPA 4N11A 4MZCA 5ECPB 3I6AA 1YEPA 2FUG2 3ZREA 3CRTA 3FY7A 2MMNA 3KEBA 1O73A 3EWLA 1XWKA 2CAQA 4K0GA 5B8BA 3ME8A 4MABA 1BX9A 3VPTA 2VAFA 3LEFA 5IMDA 3S9FA 3IHGA 2AAWA 1GLPA 5J40A 2EIRA 1RQMA 4I2TA 3ERWA 2HSMB 2P0GA 4NV5A 5G31A 2X99A 4EIPA 1SL0B 4CHSA 2GSSA 1TKDB 4KAEA 3ZIJA 1HNAA 3FR3A 1FHEA 3LYKA 1XPVA 5F07A 3LXTA 1OVNA 4K7IA 1WPIA 1DE2A 3TDGA 1AIUA 1OYJA 3C8EA 5BMUA 3NOFA 3HA9A 1FOVA 3KD0A 5A1NB 3FW2A 2PUKC 5DALA 3WGEA 5IO2A 4GSSA 1R26A 3KH9A 1VF3A 3DGQA 4XS4B 1LJRA 1V57A 3VFIA 2DJJA 2J23A 2GSQA 2N5BA 3KTBA 5GAND 1SKSB 4JEDA 6GSUA 2RLIA 2H6ZA 3V1WA 2H0GA 1O85A 3M0FA 2M46A 2WGRA 5D93A 2GZZA 3R2QA 2FLSA 2C1YA 2CT6A 1K0NA 2H71A 4FO5A 4I6XA 4F03A 2QA1A 3LFLA 3PPUA 1THOA 1GSDA 3KIJA 3UJ1A 2VUPA 3KH7A 4PGTA 2BMXA 3TJJA 2YCDA 5A34A 5ECQB 1XW6A 3UARA 3FR9A 1Z6NA 1O81A 3HYPA 1ZL9A 1OC8A 1O8WA 4NHWA 2DJ0A 4GQCA 3HVVA 14GSA 2B3SA 4FYCA 2FY6A 3EVIA 3RAZA 2HSYA 4X43A 2HSHA 4BVXA 2K8VA 2WULA 5BMUB 5D9VA 4N3ZA 3L78A 1SL1B 6GSYA 4KA0A 3F0IA 5DALB 2NVLA 2GTUA 1XW5A 2GT6A 3GMFA 4ZB8A 4AKHA 1SENA 2JACA 2WRTA 3A5WA 4ZBAA 2VM2A 2B5EA 5CO3A 3W8JA 4MMMA 19GSA 2X4AA 1GSYA 1R7HA 3GV1A 4HI7A 6GSVA 5H5QA 1H4OA 1YY7A 1K3YA 1RW1A 2H19A 5LD0A 2H0HA 4GSTA 4ZB9A 4EXJA 3GSSA 2L4QA 1AAZA 2ZCTA 1WWJA 5HR3A 2GQKA 5EY6A 4MH2A 2H76A 2R2JA 1XVQA 1K0OA 4J56E 1F3BA 1NW2A 1XXUA 1C72A 4O92A 1O7UA 2YPMA 2YJHA 5A5HA 2UZ8A 5A34B 1U3AA 4AJ6A 2HZEA 2EFEA 2HSNB 2WZ9A 3FK8A 3KTLA 2O7KA 3APSA 3HCZA 3ZMLA 2X64A 2X8GA 3A2VA 1ML6A 2H30A 2CZ3A 1AQXA 4QMKA 3TKPA 3GKMA 1EV9A 3DEXA 1Z3EA 4BVXB 4POKA 5HFIA 1S3DA 2VCZA 2UV8G 4YKGA 4G9HA 2E7PA 2FWEA 1URMA 6GSXA 1F2EA 4LMWA 1SK2A 1SYRA 4EVMA 5CRHA 4RQRA 5CRDA 1PQNA 4EIQA 3TCOA 2IWTA 4GSNA 2ZUPA 4XS6A 1PL1A 4GXZA 3WYWA 4PQHA 2PGTA 2N5AA 1BJXA 2KP1A 3MAKA 1M99A 4YH2A 2AJQB 3O3TA 4WKWA 10GSA 3IK7A 1SJIA 2LQOA 2C3TA 4HQSA 2N5FA 2F8FA 1XW9A 5JWOB 4J2FA 3FMWA 3ZYWA 5A5HB 4TKYA 3GURA 1XWAA 3EURA 3F4TA 5C04A 4MP4A 1Z6MA 2MZCA 3FR6A 2NPBA 2X49A 1V58A 3J7Yb 3I43A 4K2DA 4L0WA 5DJLA 2I1UA 3UMAA 4K5RA 4AJ8A 3IA1A 4CW9A 5JWRB 3EINA 1SU9A 2OA7A 2K6VA 2LRCA 4POBA 1X5DA 1QMVA 4HQZA 1WP0A 2DJ3A 2R0GA 4AKIA 5D96A 2VCVA 4AGSA 4WBJA 1AUCA 1M9BA 2O8VB 3Q18A 3H93A 3LXZA 1JLWA 4J57E 2QA2A 3FEUA 1XFLA 4F0BA 3QR6A 4JE1A 3QPMA 3KXOA 5HFGA 2FWGA 3TJKA 4IHUA 3P2AA 4HEA2 2VCWA 4KSOA 2F8AA 4DEJA 1Y25A 4GTUA 2H1LA 2ES7A 2I9HA 2L5LA 1U88A 1GP1A 3VK9A 3MDKA 4XRAA 1G6YA 2VLUA 3GKXA 3C1SA 3TRPA 4EC0A 3IC8A 5CYYA 5A4VA 2YNXA 2TRCP 2E0QA 2AV4A 3GA4A 3D4MA 4IKHA 2R0CA 3UAPA 1OC3A 3IHQA 4DSQA 4HS1A 4P3YB 5ECMB 2PPTA 5IQYA 2EC4A 3ERGA 1T1VA 1G7OA 1S3CA 1XWGA 3DIEA 4G10A 5G5EA 1MDKA 1TI3A 5EL8A 5D73A 4KDUA 2K8SA 2QGVA 3GHAA 3IBHA 2HZFA 1WOUA 4L0UA 1K3OA 1M7TA 3F9UA 1V9WA 1QQ2A 3FKFA 2MMZA 3I69A 4RI7A 1ZMAA 1TXXA 4F9ZA 4EE0A 2I81A 3TU3B 1GUHA 3TJGA 4TR4A 4MJAA 1XZOA 1JFUA 3GH6A 1JZOA 2GGTA 2BTOT 1GTUA 2DMLA 1M9AA 2HT9A 5B7CA 3DWVA 4EO3A 2VCXA 2FWFA 2HQTA 2PVOC 4E8EA 3HVSA 2B5YA 1T4YA 1UVZA 3M1GA 1FO5A 1UA5A 5INYA 2JU5A 3MWHA 1TU7A 3DRNA 5G30A 3F6FA 3CSHA 4MH3A 2B7KA 4ZL7A 2AYTA 4ZILA 2B6MA 3C1RA 4BVYA 1G0TA 2YWMA 3HVXA 1PA3A 1EOHA 2HSMA 3M3MA 1SJ6A 5KN1A 3APQA 3UEMA 1TDIA 3VWVA 3UL3A 3UVHA 5J3RA 1JLVA 5AISA 1ZYQB 3C7MA 4FYUA 1YQ1A 3HJPA 4OCFA 3LSZA 4FQUA 1GH2A 2H70A 1BG1A 1GWCA 1TRUA 4TVEA 2VM1A 3RPPA 4FYBA 4ICYA 1W89A 1X9MB 2QC7A 3FZAA 3WT2A 4KDXA 3PH9A 1K0CA 2H72A 1WJKA 3EMPA 3D0ZA 1XBSA 1GSSA 4XS4A 5IMAA 5ELAA 4IJ3A 4IQAA 2DIYA 1JZRA 4IP6A 4YQMA 5H5RA 3QFBC 2L4CA 2GS3A 3MIXA 2JADA 2DKHA 2EFDA 3KMOA 2GQLA 3KMNA 2DMMA 3CTFA 4BVYB 2LQQA 1TOFA 5A4UA 4TXVA 1GTBA 1M2AA 2IMIA 2XBQA 3G9BA 2K18A 2CAIA 4BWQA 5IMVA 2WB9A 2IMEA 3U6VA 2F9SA 1EP8A 3PINA 4IP1A 2F3MA 2TRXA 4LL4B 3FRCA 3CMIA 1TK0B 2X8CA 3QMXA 5DJMA 1JZWA 2OE1A 1A23A 4OO5A 4NPBA 2JZTA 2HRNA 5HQPA 1SVMA 2OT3A 7GSSA 3MSZA 2VD1A 5ECLB 1R5AA 2LJKA 2CQ9A 2FHEA 1GL8A 2ON7A 4G0KA 4HUAA 1PD21 3FHKA 5JCUA 1XCCA 4ZBDA 1I5GA 3RDWA 2AHEA 3IPZA 1FG4A 3H79A 2NTOA 3ZLPA 3IR4A 4WF4A 1F3AA 1FB0A 4ZB7A 2H74A 2PMTA 1YJ6A 4TW5A 4USSA 1TTZA 3F4SA 4YAVA 3H8QA 3US3A 1YZXA 1KBNA 3GX8A 4IJIA 2FCHA 3TKRA 1K0MA 5F05A 4F82A 4TR0A 3CYNA 2HSNA 2YJ7A 2NDOA 1KTEA 3VPQA 1XVWA 3HZ8A 5KN3A 5ECHB 1N8JA 2OE0A 5DAKA 2O5VA 1VRSD 5DCHA 5FWGA 4YAPA 4K6XA 2EIQA 4I8BA 2EFHA 5FHIA 3VURA 4DSRA 4N0VA 4X0XA 2CVDA 2YANA 2OBKA 4MF7A 2CV4A 5CRWA 2FD3A 5GZZB 2H1DA 4I97A 5BRTA 1EEMA 1HD2A 2HYXA 2O87A 1ERUA 3NIVA 3ZVJD 4XHMA 2CZ2A 2P5QA 3K8NA 4L5LA 1Y6EA 2V6OA 2OJLA 1BYEA 4POLA 4JR6A 4Q5RA 1F9MA 5DQYA 2KOKA 4H86A 2IMFA 2GSTA 2RUFA 4EF0A 4MZWA 4MJCA 1GUMA 1SVLA 1OC9A 3TKSC 4GRFA 3GH9A 4PUFC 3IDVA 1NSWA 3RHBA 1A24A 2X8HA 6GSTA 2EIOA 2H8LA 5E59A 1AXDA 3FZ4A 2CX3A 1FVKA 1XWBA 2XHFA 2LS5A 5HR1A 1J08A 4OFMA 5DAKB 3P90A 2YWNA 1G7EA 3DD3A 2DJ2A 2H0IA 2VLVA 5DDLA 1AC1A 3EE2A 4MPGA 3G7YA 5KOWA 2A2RA 4BA7A 1ZYNA 2HRAA 1X5EA 5J47A 4ML6A 1K0AA 4NWYA 1S3AA 3L9UA 1ST9A 3KP8A 1WE0A 4MF5A 3SWLA 3ZTLA 1Z5YE 1AQVA 2GZPA 4KCAA 2C8UA 3WGXA 1XOBA 3HHVA 5FT3A 1YKAA 3LGCA 4KSMA 5A4WA 2R3XA 16GSA 1GNEA 2JSYA 5GSTA 2KLXA 4LLRA 4ZXGA 2PWJA 4Z7XA 4OO4A 3F4RA 2DC5A 3HKRA 5JWQB 4E8HA 6GSWA 3GTUB 4FH8A 2E2GA 3ZVJA 2EFCA 2RUEA 1OC9B 1QFNA 4Q5QA 4WR4A 5CP1A 2LEGA 4JBBA 2G0FA 3ZZXA 4TR1A 2LSTA 3TB2A 1ABAA 5IMCA 1KNGA 1VF2A 4EDZA 2OACA 3E0UA 2FGXA 4K2XA 3N9JA 4NHZA 2MMAA 3M8NA 4PQIA 9GSSA 1DSBA 3OR5A 3H1NA 2LUSA 1ZGNA 2H1GA 4Z2TA 3HJMA 3D6IA 1FB6A 4XCSA 2C0GA 2RM6A 4D73A 5IO0A 3I9V2 2LTKA 2REMA 3ERFA 2DLXA 4CDOA 1A2JA 1V2AA 1E6BA 1VF4A 3D21A 2JZRA 2LJAA 12GSA 3KGKA 2VKZG 2R6KA 4GQFA 18GSA 3DMLA 3IAS2 4O5QA 5LCZA 5J9CA 5F06A 1J9BA 2G2QA 4OMVA 5EPFA 5KOXA 3IRAA 3CXGA 4MJEA 5GSSA 4POMA 2YV7A 2DJKA 1UN2A 1LBKA 1MEKA 5CAXA 1PX6A 1MDIA 2P31A 5IMZA 3EMXA 4O5UA 4O32A 4DVCA 4EKZA 1ZOFA 4TR1B 2LJRA 3NZNA 4MZBA 2AUVA 17GSA 2QSIA 4IQ1A 3HZ4A 3DVXA 4RI6A 4LMVA 5EVOA 1TRVA 5F8BA 2V1MA 2ALBA 3SBCA 1SD8A 2YN1A 5DQSA 4KDYA 1TW9A 1K0BA 2A2PA 4XS1A 2L6CA 1NHYA 4K0NA 4D73B 3TJFA 1F6MC 3ZFLA 1A8YA 5HFKA 1QGVA 4IGJA 4CY8A 2C3QA 3P8WA 5IOWA 2WFCA 1SK0A 1EP7A 4BPYA 2WCIA 5J4VA 5KN0A 5KN2A 2OADA 4A5PA 1PGTA 1TK8B 5JCGA 1SVOA 2YP6A 4V1Ag 3P7XA 5CNWA 3HMJG 4L5OA 11GSA 2HFDA 1HQOA 2YWOA 1WIKA 2C3NA 1NHOA 3D22A 5IPGA 2IN3A 4Z2UA 1B8XA 2GLRA 2CVKA 4NAXA 1GSQA 3DKSA 1EOGA 5CREA 2PN8A 2D2ZA 1B9YC 2IPAA 3D5JA 5ECRB 4DSSA 3BJ5A 3G7JA 2HLSA 4QQ7A 3QFAC 1PSQA 1BQ7A 5D9TA 2FWHA 3A5IA 1GTAA 3EU3A 3BBYA 5G1KA 1ERTA 2O85A 3IAM2 4XRDA 3C71A 4KW6A 4YKFA 1BEDA 4ZL9A 5ELGA 1FOHA 3BOAA 1BAYA 2OKAA 3KP9A 1HNCA 4F0CA 2IJYA 5AIVA 1FW1A 3ZFBA 1A0RP 3KZQA 4ECIA 4X1UA 1Z9HA 2KUCA 4KCEA 4RQXA 4ZBBA 2R5GA 3EYTA 1PKZA 3IV4A 2ZNMA 4N30A 2V2GA 4GF0A 4HJ2A 4BWSA 1GSUA 4WBRD 1ZCPA 2XC2A 1TK5B 2PU9C 3PR8A 1TP9A 5IM9A 1AQWA 4KF9A 2XPEA 4PX1A 4YQUA 1AW9A 1NM3A 4G0LA 3KCMA 5B6NA 3O6TA 4MK3A 4Q5FA 1GTIA 3UIWA 1N2AA 3GFKA 4PUAA 3HDCA 4DSSB 4GDFA 1CQGA 4AKGA 2CA8A 1PX7A 2B7JA 4KE3A 1T00A 2IFQA 4KH7A 3GKNA 1GUKA 3RBTA 2R4VA 3M9KA 4MA9A 5HR2A 1TXUA 3ZIVA 5ID2B 1MTCA 2HRKA 1YF1A 2H6YA 3CSJA 2P5RA 3TKSA 3EU4A 4KGIA 3WD6A 4ZB6A 3GN3A 4HJMA 1U3IA 4XIHA 4G2EA 2HE3A 3ISOA 2H75A 3APOA 1T8EB 3ZRDA 4I2UA 4O7HA 1MD4A 3IK9A 4KUNA 3IC4A 3GL3A 1VF1A 2I3YA 2H01A 2JZSA 2V32A 2XPDA 2VCTA 3CWGA 2LNTA 4TXOA 5CRGA 1TRSA 2CX4A 1A2MA 1PL2A 2I4AA 5G1LA 1DE1A 1VGLA 3UBKA 4BL7B 3QCPA 1PRXA 4HU7A 3VWUA 5ABRA 3CRUA 3G7IA 4JZQA 5C00A 2IFQB 20GSA 3H4KA 3BCIA 5AGYA 1SYXA 2DBCA 2FA8A 4OFTA 1MD3A 3AY8A 3GKKA 4PNGA 2VL9A 3F63A 2BJXA 2C0EA 1OE7A 2TIRA 1CQHA 2HRKB 1TU8A 1HNBA 4ZIJA 5DVBA 4L8EA 4ULXA 1UC7A 2PVQA 1GRXA 4PXOA 1QK8A 4Z2RA 2PERA 1ZYEA 3QAVA 3GNJA 2OBIA 3FZ5A 4LA1A 1KEBA 1EV4A 3JCML 1T7PB 2H1BA 4AF2A 1B9XC 3F3RA 2B1LA 1E2YA 1SK1A 4MJBA 3F8UA 3F3QA 1RK4A 3HD5A 3L4NA 4TXOB 1SKWB 4GWRA 2K9FA 1SJZA 2Z9SA 1K3LA 2O89A 1TJDA 1EZKA 1B4PA 3TKSE 5J5NA 5KEJA 2A4VA 5E4WA 3GYKA 2HI7A 4FIWA 3GSTA 3IOSA 3R3EA 5B6MA 3QD9A 3CTGA 5J41A 4OD7A 4WETA 1EWXA 2LRNA 3LJRA 1A8LA 1PMTA 2ON5A 5B8AA 3GTUA 1Q4JA 2OE3A 3GUSA 2VL2A 4MF6A 2KP2A 1V40A 3KM6A 3HY2A 3EPTA 3QOUA 3BCKA 4V2NA 2A4HA 4E68A 2MYGA 5LNKe 4JU5A 2YOIA 5J4YA 3TRXA 4MDCA 3CBUA 4KB3A 3TOTA 3LORA 2A2SA 1PKWA 1BF5A 1M2BA 1H75A 1M0UA 2WS2A 2YZUA 3VWXA 4F2IA 2GQMA 1J0FA 2IIYA 2V6KA 2JSZA 4HDEA 1XIYA 4G19A 2M80A 3ED3A 4KNDA 4ILFA 1U87A 2YV9A 4CY6A 2H1AA 1B48A 4O5RA 1OE8A 1XWCA 3QAGA 4WF5A 3ZL5A 4QL7A 3CSIA 3W8SA 3MYDA 1GULA 1U6TA 4AJ7A 4K7OA 1GLQA 22GSA 1DBYA 1ACVA 1T3BA 3KJYA 2IMKA 4RUVA 3U5RE 1YDKA 3LYPA 3UBLA 2VD0A 3QAWA 4IN0A 2V41A 1SD9A 3TGZA 1Z7RA 5D8IA 4I5QA 2JL4A 2C0DA 2B5XA 4GLTA 3LW9A 4G01A 2DSAA 2J9HA 2LRTA 2C80A 3DXBA 1PN9A 1IYHA 6GSSA 3FYGA 4TOPA 4AKXB 5DCGA 1WRYA 5D9WA 3VI5A 2DJ1A 1DUGA 2CVBA 4ZL8A 4OWYA 2HZEB 4TRXA 2MBTA 1X9WB 3RHCA 1QUWA 1ERVA 1EGRA 4IW9A 3LQ7A 4W66A 1X9SB 2F51A 2DIZA 3F6DA 3GL5A 1JHBA 3M9JA 1OAZA 3PGTA 4IS0A 1OKDA 2RIIA 1B4QA 3C73A 5JCWA 2MBSA 4NXIA 3IXRA 5AN1A 4TN8A 1F37A 1BG5A 5AIXA 2VL3A 5ECIB 2C4JA 4PQ1A 2XBIA 2VO4A 3ME7A 2VL2C 1FVJA 3L9SA 4ISDA 5H5SA 2AB6A 5IPHA 4V1Ap 13GSA 4ECCA 4MLYA 4NMUA 5G2ZA 4TR3A 4K8MA 3N5OA 1USBA 3A3TA 1A0FA 1K0DA 4K5SA 1SL2B 1ERWA 3J7Yk 4JR4A 2GSRA 1JZDA 4OFNA 5COHA 2H66A 3DYRA 1Q98A 3VWWA 3E3EA 2IL3A 1X0RA 1TRWA 1T4ZA 4N10A 2HNLA 3E9JB 5D9XA 2M72A 2GDRA 3WT1A 3RPNA 1O8XA 4ID0A 2L57A 2GVPA 2MMOA 3QDNA 8GSSA 1I9DA 5IMFA 1GNWA 4HOJA 3LWAA 5IOXA 4PNFA 3EC3A 4G0IA 3TRQA 4ACSA 1YEXA 1FAAA 4OCEA 5ECSA 4XTSA 2C0FA 3FZ9A 4ECBA 3MNGA 2PBJA 4IVFA 2LKUA 4IELA 3A2XA 4K1FA 1THXA 3GRXA 1YVLA 4N0ZA 2WJUA 5A5KA 3WGDA 1YKCA 3Q6OA 1GSEA 2LNSA 3O76A 4KX4A 2VOCA 3ZMKA 5J4UA 2HRFA 4MPFA 2GZYA 3ZITA 5ECNB 3TJBA 3UVTA 1G6WA 3L0HA 3W6GA 2YZHA 5GAPD 2YWIA 1Z7PA 1R5PA 4QL9A 2E2MA 2IMDA 2VIMA 3UOMA 4K7NA 2LV3A 1ON4A 2L5OA 1HYUA 1SKRB 2H6XA 5DBQA 4V2MA 1PN0A 5J9BA 3L9VA 2KHPA 4HU9A 4K9ZA 3GX0A 1OKTA 2R0PA 3DVWA 4NV2A 2GT5A 4PURA 5ECOB 4MNNA 1GSFA 2L6DA 2VCQA 2B1KA 3TOUA 1M2DA 2L59A 1A2LA 3HXSA 3VLNA 1TI1A 5ENUA 5L71A 3VI7A 2VLTA 2FA4A 4JRRA 4X4JA 2QKEA 5ID2A 3HJOA 4ML1A 1X5CA 3A2WA 4WXTA 3GIXA 1XOAA 4HZ4A 5HR0A 5IIZA 4ECJA 4LL1B 4V2LA 5G5FA 4PTSA 1ZYPA 2H73A 4YQVA 1V98A 4WR5A 5ECKB 3TKQA 1EGOA 2HXKA 2DKIA 5F0GA 3Q74A 4GCIA 4WEYA 2RM5A 1LU4A 1ILOA 2R37A 1IYIA 1QXHA 1W4VA 4EL1A 1MDJA 2WDUA 4Q5NA 3D4TA 1Y1UA 1ZZYA 3TUEA 1O6JA 1N25A 4AI6A 3LG6A 3IE3A 1WMJA 4BL7A 5A1NA 2FNOA 3Q19A 1R4WA 4EUYA 4EDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTU B;  5ECM B;  5IQY A;  3ERG A;  4HZ2 A;  4IBP A;  4Q5Q A;  1RK4 A;  5ECP B;  1G7O A;  3I6A A;  1XWG A;  4G10 A;  5G5E A;  3CRT A;  4WR4 A;  3FY7 A;  5EL8 A;  1K3L A;  5D73 A;  4KDU A;  4JBB A;  1B4P A;  3IBH A;  1XWK A;  2CAQ A;  4K0G A;  5J5N A;  5KEJ A;  1BX9 A;  3VPT A;  1K3O A;  3GST A;  1VF2 A;  4EDZ A;  2OAC A;  3R3E A;  3N9J A;  4NHZ A;  2AAW A;  1GLP A;  5J41 A;  3I69 A;  4RI7 A;  3M8N A;  3LJR A;  2HSM B;  4EE0 A;  1PMT A;  2ON5 A;  4PQI A;  9GSS A;  1GUH A;  3H1N A;  3GTU A;  1Q4J A;  1ZGN A;  4CHS A;  3HJM A;  2GSS A;  3GUS A;  4KAE A;  3GH6 A;  1GTU A;  1HNA A;  1M9A A;  5B7C A;  4MF6 A;  3ERF A;  1V40 A;  2VCX A;  3KM6 A;  2HQT A;  3FR3 A;  1FHE A;  1V2A A;  3LYK A;  4E8E A;  1E6B A;  1VF4 A;  5F07 A;  3LXT A;  3M1G A;  1UA5 A;  12GS A;  1OYJ A;  4MDC A;  3CBU A;  1TU7 A;  3C8E A;  3F6F A;  5BMU A;  2R6K A;  18GS A;  3CSH A;  5LCZ A;  5DAL A;  5F06 A;  3TOT A;  2A2S A;  4BVY A;  4OMV A;  1PKW A;  1PA3 A;  1M0U A;  2WS2 A;  5GSS A;  4GSS A;  3VWX A;  2YV7 A;  1EOH A;  1VF3 A;  2HSM A;  3M3M A;  1LBK A;  2V6K A;  3DGQ A;  1LJR A;  1TDI A;  1PX6 A;  2GSQ A;  4G19 A;  3UVH A;  1JLV A;  1U87 A;  5AIS A;  4JED A;  1YQ1 A;  2YV9 A;  6GSU A;  1B48 A;  1OE8 A;  3M0F A;  3QAG A;  3LSZ A;  4FQU A;  2LJR A;  3CSI A;  17GS A;  3R2Q A;  3W8S A;  4IQ1 A;  1GWC A;  1GUL A;  1K0N A;  4RI6 A;  1GLQ A;  4LMV A;  5EVO A;  4F03 A;  22GS A;  3LFL A;  5F8B A;  3PPU A;  1GSD A;  4KDX A;  4PGT A;  2YCD A;  5ECQ B;  1K0C A;  2IMK A;  1XW6 A;  3KJY A;  5DQS A;  4KDY A;  3UAR A;  3FR9 A;  1TW9 A;  1YDK A;  1K0B A;  3LYP A;  3UBL A;  2VD0 A;  3QAW A;  1NHY A;  3D0Z A;  1ZL9 A;  4NHW A;  4K0N A;  3TGZ A;  1GSS A;  3ZFL A;  5HFK A;  14GS A;  2JL4 A;  5ELA A;  4IGJ A;  4GLT A;  4IQA A;  1JZR A;  2C3Q A;  2DSA A;  2J9H A;  3P8W A;  4YQM A;  2C80 A;  1PN9 A;  1IYH A;  6GSS A;  3FYG A;  4TOP A;  2OAD A;  5DCG A;  1PGT A;  4BVX A;  5D9W A;  3VI5 A;  5D9V A;  3KMO A;  3KMN A;  6GSY A;  1DUG A;  4L5O A;  5DAL B;  11GS A;  2GTU A;  4BVY B;  1XW5 A;  1HQO A;  4ZB8 A;  5A4U A;  2C3N A;  2WRT A;  1GTB A;  2IMI A;  4ZBA A;  1B8X A;  2GLR A;  3LQ7 A;  2CAI A;  4IW9 A;  2WB9 A;  19GS A;  1GSQ A;  4NAX A;  1EOG A;  1GSY A;  3U6V A;  3F6D A;  4HI7 A;  6GSV A;  1YY7 A;  3PGT A;  1K3Y A;  4IS0 A;  5LD0 A;  4GST A;  4ZB9 A;  2D2Z A;  2F3M A;  3GSS A;  4EXJ A;  3FRC A;  5JCW A;  5ECR B;  5AN1 A;  5DJM A;  5EY6 A;  1BG5 A;  3G7J A;  1K0O A;  1F3B A;  4QQ7 A;  5AIX A;  5D9T A;  5ECI B;  1C72 A;  4O92 A;  1GTA A;  2C4J A;  7GSS A;  2VD1 A;  2UZ8 A;  5ECL B;  2VO4 A;  1R5A A;  3BBY A;  2FHE A;  2ON7 A;  2HSN B;  4ISD A;  4G0K A;  2AB6 A;  13GS A;  1PD2 1;  5JCU A;  4ECC A;  4ZBD A;  5ELG A;  3N5O A;  2AHE A;  1BAY A;  3KTL A;  1HNC A;  1USB A;  2NTO A;  4F0C A;  3ZML A;  2X64 A;  3IR4 A;  1A0F A;  5AIV A;  1ML6 A;  1FW1 A;  3ZFB A;  2CZ3 A;  4ECI A;  1K0D A;  1AQX A;  1Z9H A;  1F3A A;  1EV9 A;  4BVX B;  2GSR A;  4OFN A;  4ZBB A;  2R5G A;  2VCZ A;  1PKZ A;  2PMT A;  1YJ6 A;  4USS A;  4G9H A;  2IL3 A;  4YAV A;  4GF0 A;  1F2E A;  6GSX A;  4HJ2 A;  4LMW A;  1KBN A;  2HNL A;  1GSU A;  5D9X A;  4IJI A;  2GDR A;  1K0M A;  4ID0 A;  5F05 A;  8GSS A;  3PR8 A;  1AQW A;  4GSN A;  1GNW A;  4KF9 A;  4HOJ A;  4PX1 A;  3VPQ A;  1PL1 A;  4YQU A;  1AW9 A;  3WYW A;  4G0L A;  4PNF A;  5ECH B;  4G0I A;  4PQH A;  4MK3 A;  2PGT A;  4Q5F A;  1GTI A;  5DAK A;  1N2A A;  4ACS A;  4PUA A;  5ECS A;  4ECB A;  3MAK A;  2PBJ A;  4IVF A;  4YAP A;  1M99 A;  5FWG A;  4IEL A;  2CA8 A;  1PX7 A;  4YH2 A;  3O3T A;  4KE3 A;  5FHI A;  3VUR A;  10GS A;  3IK7 A;  4N0V A;  2CVD A;  4KH7 A;  2C3T A;  2N5F A;  2F8F A;  1GUK A;  4J2F A;  4MF7 A;  2WJU A;  5A5K A;  3GUR A;  3RBT A;  2R4V A;  5GZZ B;  1YKC A;  4I97 A;  1EEM A;  1GSE A;  3O76 A;  4KX4 A;  4MP4 A;  3ZMK A;  3NIV A;  3FR6 A;  1MTC A;  5J4U A;  2HRK A;  4MPF A;  3CSJ A;  2CZ2 A;  4KGI A;  5ECN B;  3WD6 A;  4ZB6 A;  4L5L A;  1G6W A;  1U3I A;  3L0H A;  5DJL A;  1Y6E A;  1BYE A;  3ISO A;  4Q5R A;  3EIN A;  2OA7 A;  1OKT A;  3GX0 A;  2GST A;  4O7H A;  1MD4 A;  3IK9 A;  1VF1 A;  4MZW A;  4PUR A;  1GUM A;  5ECO B;  2VCT A;  1GSF A;  2VCQ A;  3TOU A;  2VCV A;  4AGS A;  3VLN A;  3VI7 A;  1M9B A;  6GST A;  1AXD A;  3HJO A;  1PL2 A;  3Q18 A;  4OFM A;  5DAK B;  4HZ4 A;  3P90 A;  3LXZ A;  3UBK A;  4BL7 B;  1JLW A;  4ECJ A;  3DD3 A;  4F0B A;  3QR6 A;  5G5F A;  5DDL A;  4PTS A;  3KXO A;  4YQV A;  3CRU A;  3EE2 A;  4MPG A;  3G7I A;  4WR5 A;  4JZQ A;  2A2R A;  5ECK B;  20GS A;  5AGY A;  2HRA A;  5F0G A;  3Q74 A;  1K0A A;  2VCW A;  4GCI A;  4DEJ A;  4OFT A;  4GTU A;  1MD3 A;  3AY8 A;  1IYI A;  4PNG A;  4MF5 A;  1U88 A;  3F63 A;  3SWL A;  1OE7 A;  3VK9 A;  1AQV A;  2WDU A;  3MDK A;  1G6Y A;  2HRK B;  1TU8 A;  4Q5N A;  1HNB A;  2C8U A;  4L8E A;  2PVQ A;  4EC0 A;  4PXO A;  5FT3 A;  2PER A;  3IC8 A;  4KSM A;  3QAV A;  5A4W A;  2R3X A;  16GS A;  5A4V A;  1GNE A;  5GST A;  3LG6 A;  4ZXG A;  3IE3 A;  2DC5 A;  3HKR A;  4BL7 A;  2FNO A;  3Q19 A;  1EV4 A;  4E8H A;  6GSW A;  4EDY A;  4IKH A;  3UAP A; 
#chains in the Genus database with same CATH topology
 2NBS A;  1EEJ A;  3BD2 A;  4MCU A;  1YF0 A;  4HZ2 A;  4IBP A;  4N11 A;  4MZC A;  5ECP B;  3I6A A;  1YEP A;  2FUG 2;  3ZRE A;  3CRT A;  3FY7 A;  2MMN A;  3KEB A;  1O73 A;  3EWL A;  1XWK A;  2CAQ A;  4K0G A;  5B8B A;  3ME8 A;  4MAB A;  1BX9 A;  3VPT A;  2VAF A;  3LEF A;  5IMD A;  3S9F A;  3IHG A;  2AAW A;  1GLP A;  5J40 A;  2EIR A;  1RQM A;  4I2T A;  3ERW A;  2HSM B;  2P0G A;  4NV5 A;  5G31 A;  2X99 A;  4EIP A;  1SL0 B;  4CHS A;  2GSS A;  1TKD B;  4KAE A;  3ZIJ A;  1HNA A;  3FR3 A;  1FHE A;  3LYK A;  1XPV A;  5F07 A;  3LXT A;  1OVN A;  4K7I A;  1WPI A;  1DE2 A;  3TDG A;  1AIU A;  1OYJ A;  3C8E A;  5BMU A;  3NOF A;  3HA9 A;  1FOV A;  3KD0 A;  5A1N B;  3FW2 A;  2PUK C;  5DAL A;  3WGE A;  5IO2 A;  4GSS A;  1R26 A;  3KH9 A;  1VF3 A;  3DGQ A;  4XS4 B;  1LJR A;  1V57 A;  3VFI A;  2DJJ A;  2J23 A;  2GSQ A;  2N5B A;  3KTB A;  5GAN D;  1SKS B;  4JED A;  6GSU A;  2RLI A;  2H6Z A;  3V1W A;  2H0G A;  1O85 A;  3M0F A;  2M46 A;  2WGR A;  5D93 A;  2GZZ A;  3R2Q A;  2FLS A;  2C1Y A;  2CT6 A;  1K0N A;  2H71 A;  4FO5 A;  4I6X A;  4F03 A;  2QA1 A;  3LFL A;  3PPU A;  1THO A;  1GSD A;  3KIJ A;  3UJ1 A;  2VUP A;  3KH7 A;  4PGT A;  2BMX A;  3TJJ A;  2YCD A;  5A34 A;  5ECQ B;  1XW6 A;  3UAR A;  3FR9 A;  1Z6N A;  1O81 A;  3HYP A;  1ZL9 A;  1OC8 A;  1O8W A;  4NHW A;  2DJ0 A;  4GQC A;  3HVV A;  14GS A;  2B3S A;  4FYC A;  2FY6 A;  3EVI A;  3RAZ A;  2HSY A;  4X43 A;  2HSH A;  4BVX A;  2K8V A;  2WUL A;  5BMU B;  5D9V A;  4N3Z A;  3L78 A;  1SL1 B;  6GSY A;  4KA0 A;  3F0I A;  5DAL B;  2NVL A;  2GTU A;  1XW5 A;  2GT6 A;  3GMF A;  4ZB8 A;  4AKH A;  1SEN A;  2JAC A;  2WRT A;  3A5W A;  4ZBA A;  2VM2 A;  2B5E A;  5CO3 A;  3W8J A;  4MMM A;  19GS A;  2X4A A;  1GSY A;  1R7H A;  3GV1 A;  4HI7 A;  6GSV A;  5H5Q A;  1H4O A;  1YY7 A;  1K3Y A;  1RW1 A;  2H19 A;  5LD0 A;  2H0H A;  4GST A;  4ZB9 A;  4EXJ A;  3GSS A;  2L4Q A;  1AAZ A;  2ZCT A;  1WWJ A;  5HR3 A;  2GQK A;  5EY6 A;  4MH2 A;  2H76 A;  2R2J A;  1XVQ A;  1K0O A;  4J56 E;  1F3B A;  1NW2 A;  1XXU A;  1C72 A;  4O92 A;  1O7U A;  2YPM A;  2YJH A;  5A5H A;  2UZ8 A;  5A34 B;  3CQF A;  1U3A A;  4AJ6 A;  2HZE A;  2EFE A;  2HSN B;  2WZ9 A;  3FK8 A;  3KTL A;  2O7K A;  3APS A;  3HCZ A;  3ZML A;  2X64 A;  2X8G A;  3A2V A;  1ML6 A;  2H30 A;  2CZ3 A;  1AQX A;  4QMK A;  3TKP A;  3GKM A;  1EV9 A;  3DEX A;  1Z3E A;  4BVX B;  4POK A;  5HFI A;  1S3D A;  2VCZ A;  2UV8 G;  4YKG A;  4G9H A;  2E7P A;  2FWE A;  1URM A;  6GSX A;  1F2E A;  4LMW A;  1SK2 A;  1SYR A;  4EVM A;  5CRH A;  4RQR A;  5CRD A;  1PQN A;  4EIQ A;  3TCO A;  2IWT A;  4GSN A;  2ZUP A;  4XS6 A;  1PL1 A;  4GXZ A;  3WYW A;  4PQH A;  2PGT A;  2N5A A;  1BJX A;  2KP1 A;  3MAK A;  1M99 A;  4YH2 A;  2AJQ B;  3O3T A;  4WKW A;  10GS A;  3IK7 A;  1SJI A;  2LQO A;  2C3T A;  4HQS A;  2N5F A;  2F8F A;  1XW9 A;  5JWO B;  4J2F A;  3FMW A;  3ZYW A;  5A5H B;  4TKY A;  3GUR A;  1XWA A;  3EUR A;  3F4T A;  5C04 A;  4MP4 A;  1Z6M A;  2MZC A;  3FR6 A;  2NPB A;  2X49 A;  1V58 A;  3J7Y b;  3I43 A;  4K2D A;  4L0W A;  5DJL A;  2I1U A;  3UMA A;  4K5R A;  4AJ8 A;  3IA1 A;  4CW9 A;  5JWR B;  3EIN A;  1SU9 A;  2OA7 A;  2K6V A;  2LRC A;  2WW0 A;  4POB A;  1X5D A;  1QMV A;  4HQZ A;  1WP0 A;  2DJ3 A;  2R0G A;  4AKI A;  5D96 A;  2VCV A;  4AGS A;  4WBJ A;  1AUC A;  1M9B A;  2O8V B;  3HVN A;  3Q18 A;  3H93 A;  3LXZ A;  1JLW A;  4J57 E;  4BIK A;  2QA2 A;  3FEU A;  1XFL A;  4F0B A;  3QR6 A;  4JE1 A;  3QPM A;  3KXO A;  5HFG A;  2FWG A;  3TJK A;  4IHU A;  3P2A A;  4HEA 2;  2VCW A;  4KSO A;  2F8A A;  4DEJ A;  1Y25 A;  4GTU A;  2H1L A;  2ES7 A;  2I9H A;  4PI2 C;  2L5L A;  1U88 A;  1GP1 A;  3VK9 A;  3MDK A;  4XRA A;  1G6Y A;  2VLU A;  3GKX A;  3C1S A;  3TRP A;  4EC0 A;  3IC8 A;  5CYY A;  5A4V A;  2YNX A;  2TRC P;  2E0Q A;  2AV4 A;  3GA4 A;  3D4M A;  3RGB C;  4IKH A;  2R0C A;  3UAP A;  1OC3 A;  3IHQ A;  4DSQ A;  4HS1 A;  4P3Y B;  5ECM B;  2PPT A;  5IQY A;  2EC4 A;  3ERG A;  1T1V A;  1G7O A;  1S3C A;  1XWG A;  3DIE A;  4G10 A;  5G5E A;  1MDK A;  1TI3 A;  5EL8 A;  5D73 A;  4KDU A;  2K8S A;  2QGV A;  3GHA A;  3IBH A;  2HZF A;  1WOU A;  4L0U A;  1K3O A;  1M7T A;  3F9U A;  1V9W A;  1QQ2 A;  3FKF A;  2MMZ A;  3I69 A;  4RI7 A;  1ZMA A;  1TXX A;  4F9Z A;  4EE0 A;  2I81 A;  3TU3 B;  1GUH A;  3TJG A;  4TR4 A;  4MJA A;  1XZO A;  1JFU A;  3GH6 A;  1JZO A;  2GGT A;  2BTO T;  1GTU A;  2DML A;  1M9A A;  2HT9 A;  5B7C A;  3DWV A;  4EO3 A;  2VCX A;  2FWF A;  2HQT A;  2PVO C;  4E8E A;  3HVS A;  2B5Y A;  1T4Y A;  1UVZ A;  3M1G A;  1FO5 A;  1UA5 A;  5INY A;  2JU5 A;  3MWH A;  1TU7 A;  3DRN A;  5G30 A;  3F6F A;  3CSH A;  4MH3 A;  2B7K A;  4ZL7 A;  2AYT A;  4ZIL A;  2B6M A;  3C1R A;  4BVY A;  1G0T A;  2YWM A;  3HVX A;  1PA3 A;  2WZS A;  1EOH A;  2HSM A;  3M3M A;  1SJ6 A;  5KN1 A;  3APQ A;  3UEM A;  1TDI A;  3VWV A;  3UL3 A;  3UVH A;  5J3R A;  1JLV A;  5AIS A;  1ZYQ B;  3C7M A;  4FYU A;  1YQ1 A;  3HJP A;  4OCF A;  3LSZ A;  4FQU A;  1GH2 A;  2H70 A;  1BG1 A;  1GWC A;  1TRU A;  4TVE A;  2VM1 A;  3RPP A;  4FYB A;  4ICY A;  1W89 A;  1X9M B;  2QC7 A;  3FZA A;  3WT2 A;  4KDX A;  3PH9 A;  1K0C A;  2H72 A;  1WJK A;  3EMP A;  3D0Z A;  1XBS A;  1GSS A;  4XS4 A;  5IMA A;  5ELA A;  4IJ3 A;  4IQA A;  2DIY A;  1JZR A;  4IP6 A;  4YQM A;  5H5R A;  3QFB C;  2L4C A;  2GS3 A;  3MIX A;  2JAD A;  2DKH A;  2EFD A;  3KMO A;  2GQL A;  3KMN A;  2DMM A;  3CTF A;  4BVY B;  2LQQ A;  1TOF A;  5A4U A;  4TXV A;  1GTB A;  1M2A A;  2IMI A;  2XBQ A;  3G9B A;  2K18 A;  2CAI A;  4BWQ A;  5IMV A;  2WB9 A;  2IME A;  3U6V A;  2F9S A;  1EP8 A;  3PIN A;  4IP1 A;  2F3M A;  1I1I P;  2TRX A;  4LL4 B;  3FRC A;  3CMI A;  1TK0 B;  2X8C A;  3QMX A;  5DJM A;  1JZW A;  2OE1 A;  1A23 A;  4OO5 A;  4NPB A;  2JZT A;  2HRN A;  5HQP A;  1SVM A;  2OT3 A;  7GSS A;  3MSZ A;  2VD1 A;  5ECL B;  1R5A A;  2LJK A;  2CQ9 A;  2FHE A;  1GL8 A;  2ON7 A;  4G0K A;  4HUA A;  1PD2 1;  3FHK A;  5JCU A;  1XCC A;  4ZBD A;  1I5G A;  3RDW A;  2AHE A;  3IPZ A;  1FG4 A;  3H79 A;  2NTO A;  3ZLP A;  3IR4 A;  4WF4 A;  1F3A A;  1FB0 A;  4ZB7 A;  2H74 A;  2PMT A;  1YJ6 A;  4TW5 A;  4USS A;  1TTZ A;  3F4S A;  4YAV A;  3H8Q A;  3US3 A;  1YZX A;  1KBN A;  3GX8 A;  4IJI A;  2FCH A;  3TKR A;  1K0M A;  5F05 A;  4F82 A;  4TR0 A;  4PHZ C;  3CYN A;  2HSN A;  2YJ7 A;  2NDO A;  1KTE A;  3VPQ A;  1XVW A;  3HZ8 A;  5KN3 A;  5ECH B;  1N8J A;  2OE0 A;  5DAK A;  2O5V A;  1VRS D;  5DCH A;  5FWG A;  4YAP A;  4K6X A;  2EIQ A;  4I8B A;  2EFH A;  5FHI A;  3VUR A;  4DSR A;  4N0V A;  4X0X A;  2CVD A;  2YAN A;  2OBK A;  4MF7 A;  2CV4 A;  5CRW A;  2FD3 A;  5GZZ B;  2H1D A;  4I97 A;  5BRT A;  1EEM A;  1HD2 A;  2HYX A;  2O87 A;  1ERU A;  3NIV A;  3ZVJ D;  4XHM A;  2CZ2 A;  2P5Q A;  3K8N A;  4L5L A;  1Y6E A;  2V6O A;  2OJL A;  1BYE A;  4POL A;  4JR6 A;  4Q5R A;  1F9M A;  5DQY A;  2KOK A;  4H86 A;  2IMF A;  2GST A;  2RUF A;  4EF0 A;  4MZW A;  4MJC A;  1GUM A;  1SVL A;  1OC9 A;  3TKS C;  4GRF A;  3GH9 A;  4PUF C;  3RFR C;  3IDV A;  1NSW A;  3RHB A;  1A24 A;  2X8H A;  6GST A;  2EIO A;  2H8L A;  5E59 A;  1AXD A;  3FZ4 A;  2CX3 A;  1FVK A;  1XWB A;  2XHF A;  2LS5 A;  5HR1 A;  1J08 A;  4OFM A;  5DAK B;  3P90 A;  2YWN A;  1G7E A;  3DD3 A;  2DJ2 A;  2H0I A;  2VLV A;  5DDL A;  1AC1 A;  3EE2 A;  4MPG A;  3G7Y A;  5KOW A;  2A2R A;  4BA7 A;  1ZYN A;  2HRA A;  1X5E A;  5J47 A;  4ML6 A;  1K0A A;  4NWY A;  2WW2 A;  1S3A A;  1ST9 A;  3L9U A;  3KP8 A;  1WE0 A;  4MF5 A;  3SWL A;  3ZTL A;  1Z5Y E;  1AQV A;  2GZP A;  4KCA A;  2C8U A;  3WGX A;  1XOB A;  3HHV A;  5FT3 A;  1YKA A;  3LGC A;  4KSM A;  5A4W A;  2R3X A;  16GS A;  1GNE A;  2JSY A;  5GST A;  2KLX A;  4LLR A;  4ZXG A;  2PWJ A;  4Z7X A;  4OO4 A;  3F4R A;  2DC5 A;  3HKR A;  5JWQ B;  4E8H A;  6GSW A;  3GTU B;  4FH8 A;  2E2G A;  3ZVJ A;  2EFC A;  2RUE A;  1OC9 B;  1QFN A;  4Q5Q A;  4WR4 A;  5CP1 A;  2LEG A;  4JBB A;  2G0F A;  3ZZX A;  4TR1 A;  2LST A;  3TB2 A;  1ABA A;  5IMC A;  1KNG A;  1VF2 A;  4EDZ A;  2OAC A;  3E0U A;  2FGX A;  4K2X A;  3N9J A;  4NHZ A;  2O36 A;  2MMA A;  3M8N A;  4PQI A;  9GSS A;  1DSB A;  3OR5 A;  3H1N A;  2LUS A;  1ZGN A;  2H1G A;  4Z2T A;  3HJM A;  3D6I A;  1FB6 A;  4XCS A;  2C0G A;  2RM6 A;  4D73 A;  5IO0 A;  3I9V 2;  2LTK A;  2REM A;  3ERF A;  2DLX A;  4CDO A;  1A2J A;  1V2A A;  1E6B A;  1VF4 A;  3D21 A;  2JZR A;  2LJA A;  12GS A;  3KGK A;  2VKZ G;  2R6K A;  4GQF A;  18GS A;  3DML A;  3IAS 2;  4O5Q A;  5LCZ A;  5J9C A;  5F06 A;  1J9B A;  2G2Q A;  4OMV A;  5EPF A;  5KOX A;  3IRA A;  3CXG A;  4MJE A;  5GSS A;  4POM A;  2YV7 A;  2DJK A;  1UN2 A;  1LBK A;  1MEK A;  5CAX A;  1PX6 A;  1MDI A;  2P31 A;  5IMZ A;  3EMX A;  4O5U A;  4O32 A;  4DVC A;  4EKZ A;  1ZOF A;  4TR1 B;  2LJR A;  3NZN A;  4MZB A;  2AUV A;  17GS A;  2QSI A;  4IQ1 A;  3HZ4 A;  3DVX A;  4RI6 A;  4LMV A;  5EVO A;  1TRV A;  5F8B A;  2V1M A;  2ALB A;  3SBC A;  1SD8 A;  2YN1 A;  5DQS A;  4KDY A;  1TW9 A;  1K0B A;  2A2P A;  4XS1 A;  2L6C A;  1NHY A;  4K0N A;  4D73 B;  3TJF A;  1F6M C;  3ZFL A;  1A8Y A;  5HFK A;  1QGV A;  4IGJ A;  4CY8 A;  2C3Q A;  3P8W A;  5IOW A;  2WFC A;  1SK0 A;  1EP7 A;  4BPY A;  2WCI A;  5J4V A;  5KN0 A;  5KN2 A;  2OAD A;  4A5P A;  1PGT A;  1TK8 B;  5JCG A;  1SVO A;  2YP6 A;  4V1A g;  3P7X A;  5CNW A;  3HMJ G;  4L5O A;  11GS A;  2HFD A;  1HQO A;  2YWO A;  1WIK A;  2C3N A;  1NHO A;  3D22 A;  5IPG A;  2IN3 A;  4Z2U A;  1B8X A;  2GLR A;  2CVK A;  4NAX A;  1GSQ A;  3DKS A;  1EOG A;  5CRE A;  2PN8 A;  2D2Z A;  1B9Y C;  2IPA A;  3D5J A;  5ECR B;  4DSS A;  3BJ5 A;  3G7J A;  2HLS A;  4QQ7 A;  3QFA C;  1PSQ A;  1BQ7 A;  5D9T A;  2FWH A;  3A5I A;  1GTA A;  3EU3 A;  3BBY A;  5G1K A;  1ERT A;  2O85 A;  3IAM 2;  4XRD A;  3C71 A;  4KW6 A;  4YKF A;  1BED A;  4ZL9 A;  2WW1 A;  5ELG A;  1FOH A;  3BOA A;  2O3E A;  1BAY A;  2OKA A;  3KP9 A;  1HNC A;  4F0C A;  2IJY A;  5AIV A;  1FW1 A;  3ZFB A;  1A0R P;  3KZQ A;  4ECI A;  4X1U A;  1Z9H A;  2KUC A;  4KCE A;  4RQX A;  4ZBB A;  2R5G A;  3EYT A;  1PKZ A;  3IV4 A;  2ZNM A;  4N30 A;  2V2G A;  4GF0 A;  4HJ2 A;  4BWS A;  1GSU A;  4WBR D;  1ZCP A;  2XC2 A;  1TK5 B;  2PU9 C;  3PR8 A;  1TP9 A;  5IM9 A;  1AQW A;  4KF9 A;  2XPE A;  4PX1 A;  4YQU A;  1AW9 A;  1NM3 A;  4G0L A;  3KCM A;  5B6N A;  3O6T A;  4MK3 A;  4Q5F A;  1GTI A;  3UIW A;  1N2A A;  3GFK A;  4PUA A;  3HDC A;  4DSS B;  4GDF A;  1CQG A;  4AKG A;  2CA8 A;  1PX7 A;  2B7J A;  4KE3 A;  1T00 A;  2IFQ A;  4KH7 A;  3GKN A;  1GUK A;  3RBT A;  2R4V A;  3M9K A;  4MA9 A;  5HR2 A;  1TXU A;  3ZIV A;  5ID2 B;  1MTC A;  2HRK A;  1YF1 A;  2H6Y A;  3CSJ A;  2P5R A;  3TKS A;  3EU4 A;  4KGI A;  3WD6 A;  4ZB6 A;  3GN3 A;  4HJM A;  1U3I A;  4XIH A;  4G2E A;  2HE3 A;  3ISO A;  2H75 A;  3APO A;  1T8E B;  3ZRD A;  4I2U A;  4O7H A;  1MD4 A;  3IK9 A;  4KUN A;  3IC4 A;  3GL3 A;  1VF1 A;  2I3Y A;  2H01 A;  2JZS A;  2V32 A;  2XPD A;  2VCT A;  3CWG A;  2LNT A;  4TXO A;  5CRG A;  1TRS A;  2CX4 A;  1A2M A;  1PL2 A;  2I4A A;  5G1L A;  1DE1 A;  1VGL A;  3UBK A;  4BL7 B;  3QCP A;  1PRX A;  4HU7 A;  3VWU A;  5ABR A;  2WVX A;  3CRU A;  3G7I A;  4JZQ A;  5C00 A;  2IFQ B;  20GS A;  3H4K A;  3BCI A;  5AGY A;  1SYX A;  2DBC A;  2FA8 A;  4OFT A;  1MD3 A;  3AY8 A;  3GKK A;  4PNG A;  2VL9 A;  3F63 A;  2BJX A;  2C0E A;  1OE7 A;  2TIR A;  1CQH A;  2HRK B;  1TU8 A;  1HNB A;  4ZIJ A;  5DVB A;  4L8E A;  4ULX A;  1UC7 A;  2PVQ A;  1GRX A;  4PXO A;  1QK8 A;  4Z2R A;  2PER A;  1ZYE A;  3QAV A;  3GNJ A;  2OBI A;  3FZ5 A;  4LA1 A;  1KEB A;  1EV4 A;  3JCM L;  1T7P B;  2H1B A;  4AF2 A;  1B9X C;  3F3R A;  2B1L A;  1E2Y A;  1SK1 A;  4MJB A;  3F8U A;  2WVZ A;  3F3Q A;  1RK4 A;  3HD5 A;  3L4N A;  4TXO B;  1SKW B;  4GWR A;  2K9F A;  1SJZ A;  2Z9S A;  1K3L A;  2O89 A;  1TJD A;  1EZK A;  1B4P A;  3TKS E;  5J5N A;  5KEJ A;  2A4V A;  4FXY P;  5E4W A;  3GYK A;  2HI7 A;  4FIW A;  3GST A;  3IOS A;  3R3E A;  2WVX B;  5B6M A;  3QD9 A;  3CTG A;  5J41 A;  4OD7 A;  4WET A;  1EWX A;  2LRN A;  3LJR A;  1A8L A;  1PMT A;  2ON5 A;  5B8A A;  3GTU A;  1Q4J A;  2OE3 A;  3GUS A;  2VL2 A;  4MF6 A;  2KP2 A;  1V40 A;  3KM6 A;  3HY2 A;  3EPT A;  3QOU A;  3BCK A;  4V2N A;  2A4H A;  4E68 A;  2MYG A;  5LNK e;  4JU5 A;  2YOI A;  5J4Y A;  3TRX A;  4MDC A;  3CBU A;  4KB3 A;  3TOT A;  3LOR A;  2A2S A;  1PKW A;  1BF5 A;  1M2B A;  1H75 A;  1M0U A;  2WS2 A;  2YZU A;  3VWX A;  4F2I A;  2GQM A;  1J0F A;  2IIY A;  2V6K A;  2JSZ A;  4HDE A;  1XIY A;  4G19 A;  2M80 A;  3ED3 A;  4KND A;  4ILF A;  1U87 A;  2YV9 A;  4PI0 C;  4CY6 A;  2H1A A;  1B48 A;  4O5R A;  1OE8 A;  1XWC A;  3QAG A;  4WF5 A;  3ZL5 A;  4QL7 A;  3CSI A;  3W8S A;  3MYD A;  1GUL A;  1U6T A;  4AJ7 A;  4K7O A;  1GLQ A;  22GS A;  1DBY A;  1ACV A;  1T3B A;  3KJY A;  2IMK A;  4RUV A;  3U5R E;  1YDK A;  3LYP A;  3UBL A;  2VD0 A;  3QAW A;  4IN0 A;  2V41 A;  1SD9 A;  3TGZ A;  1Z7R A;  5D8I A;  4I5Q A;  2JL4 A;  2C0D A;  2B5X A;  4GLT A;  3LW9 A;  4G01 A;  2DSA A;  2J9H A;  2LRT A;  2C80 A;  3DXB A;  1PN9 A;  1IYH A;  6GSS A;  3FYG A;  4TOP A;  4AKX B;  5DCG A;  1WRY A;  5D9W A;  3VI5 A;  1M3J A;  2DJ1 A;  1DUG A;  2CVB A;  4ZL8 A;  2WVY A;  4OWY A;  2HZE B;  4TRX A;  2MBT A;  1X9W B;  3RHC A;  1QUW A;  1ERV A;  1EGR A;  4IW9 A;  3LQ7 A;  4W66 A;  1X9S B;  2F51 A;  2DIZ A;  3F6D A;  3GL5 A;  1JHB A;  3M9J A;  1OAZ A;  3PGT A;  4IS0 A;  1OKD A;  2RII A;  1B4Q A;  3C73 A;  5JCW A;  2MBS A;  4NXI A;  3IXR A;  5AN1 A;  4TN8 A;  1F37 A;  1BG5 A;  5AIX A;  2VL3 A;  5ECI B;  2C4J A;  2WW3 A;  4PQ1 A;  2XBI A;  2VO4 A;  3ME7 A;  2VL2 C;  1FVJ A;  3L9S A;  4ISD A;  5H5S A;  2AB6 A;  5IPH A;  4V1A p;  13GS A;  4ECC A;  4MLY A;  4NMU A;  5G2Z A;  4TR3 A;  4K8M A;  3N5O A;  1USB A;  3A3T A;  1A0F A;  1K0D A;  4K5S A;  1SL2 B;  1ERW A;  3J7Y k;  4JR4 A;  2GSR A;  1JZD A;  4OFN A;  5COH A;  2H66 A;  3DYR A;  1Q98 A;  3VWW A;  3E3E A;  2IL3 A;  3CHX C;  1X0R A;  1TRW A;  1T4Z A;  4N10 A;  2HNL A;  3E9J B;  5D9X A;  2M72 A;  2GDR A;  3WT1 A;  3RPN A;  1O8X A;  4ID0 A;  2L57 A;  2GVP A;  2MMO A;  3QDN A;  1XG8 A;  8GSS A;  1I9D A;  5IMF A;  1GNW A;  4HOJ A;  1PFO A;  3LWA A;  5IOX A;  4PNF A;  3EC3 A;  4G0I A;  3TRQ A;  4ACS A;  1YEX A;  1FAA A;  4OCE A;  5ECS A;  4XTS A;  2C0F A;  3FZ9 A;  4ECB A;  3MNG A;  2PBJ A;  4IVF A;  2LKU A;  1YEW C;  4IEL A;  3A2X A;  4K1F A;  1THX A;  3GRX A;  1YVL A;  4N0Z A;  2WJU A;  5A5K A;  3WGD A;  1YKC A;  3Q6O A;  1GSE A;  2LNS A;  3O76 A;  4KX4 A;  2VOC A;  3ZMK A;  5J4U A;  2HRF A;  4MPF A;  2GZY A;  3ZIT A;  5ECN B;  1S4B P;  3TJB A;  3UVT A;  1G6W A;  3L0H A;  3W6G A;  2YZH A;  5GAP D;  2YWI A;  1Z7P A;  1R5P A;  4QL9 A;  2E2M A;  2IMD A;  2VIM A;  3UOM A;  1M3I A;  4K7N A;  2LV3 A;  1ON4 A;  2L5O A;  1HYU A;  1SKR B;  2H6X A;  5DBQ A;  4V2M A;  1PN0 A;  5J9B A;  3L9V A;  2KHP A;  4HU9 A;  4K9Z A;  3GX0 A;  1OKT A;  2R0P A;  3DVW A;  4NV2 A;  2GT5 A;  4PUR A;  5ECO B;  4MNN A;  1GSF A;  2L6D A;  2VCQ A;  2B1K A;  3TOU A;  1M2D A;  2L59 A;  1A2L A;  3HXS A;  3VLN A;  1TI1 A;  5ENU A;  5L71 A;  3VI7 A;  2VLT A;  2FA4 A;  4JRR A;  4X4J A;  2QKE A;  5ID2 A;  3HJO A;  4ML1 A;  1X5C A;  3A2W A;  4WXT A;  3GIX A;  1XOA A;  4HZ4 A;  5HR0 A;  5IIZ A;  4ECJ A;  4LL1 B;  4V2L A;  1S3R A;  5G5F A;  4PTS A;  1ZYP A;  2H73 A;  4YQV A;  1V98 A;  4WR5 A;  5ECK B;  3TKQ A;  1EGO A;  2HXK A;  2DKI A;  5F0G A;  3Q74 A;  4GCI A;  4WEY A;  2RM5 A;  1LU4 A;  1ILO A;  2R37 A;  1IYI A;  1QXH A;  1W4V A;  4EL1 A;  1MDJ A;  2WDU A;  4Q5N A;  3D4T A;  1Y1U A;  1ZZY A;  3TUE A;  1O6J A;  1N25 A;  4AI6 A;  4HSC X;  3LG6 A;  3IE3 A;  1WMJ A;  4BL7 A;  5A1N A;  2FNO A;  3Q19 A;  1R4W A;  4EUY A;  4EDY A; 
#chains in the Genus database with same CATH homology
 2NBS A;  1EEJ A;  3BD2 A;  4MCU A;  1YF0 A;  4HZ2 A;  4IBP A;  4N11 A;  4MZC A;  5ECP B;  3I6A A;  1YEP A;  2FUG 2;  3ZRE A;  3CRT A;  3FY7 A;  2MMN A;  3KEB A;  1O73 A;  3EWL A;  1XWK A;  2CAQ A;  4K0G A;  5B8B A;  3ME8 A;  4MAB A;  1BX9 A;  3VPT A;  2VAF A;  3LEF A;  5IMD A;  3S9F A;  3IHG A;  2AAW A;  1GLP A;  5J40 A;  2EIR A;  1RQM A;  4I2T A;  3ERW A;  2HSM B;  2P0G A;  4NV5 A;  5G31 A;  2X99 A;  4EIP A;  1SL0 B;  4CHS A;  2GSS A;  1TKD B;  4KAE A;  3ZIJ A;  1HNA A;  3FR3 A;  1FHE A;  3LYK A;  1XPV A;  5F07 A;  3LXT A;  1OVN A;  4K7I A;  1WPI A;  1DE2 A;  3TDG A;  1AIU A;  1OYJ A;  3C8E A;  5BMU A;  3NOF A;  3HA9 A;  1FOV A;  3KD0 A;  5A1N B;  3FW2 A;  2PUK C;  5DAL A;  3WGE A;  5IO2 A;  4GSS A;  1R26 A;  3KH9 A;  1VF3 A;  3DGQ A;  4XS4 B;  1LJR A;  1V57 A;  3VFI A;  2DJJ A;  2J23 A;  2GSQ A;  2N5B A;  3KTB A;  5GAN D;  1SKS B;  4JED A;  6GSU A;  2RLI A;  2H6Z A;  3V1W A;  2H0G A;  1O85 A;  3M0F A;  2M46 A;  2WGR A;  5D93 A;  2GZZ A;  3R2Q A;  2FLS A;  2C1Y A;  2CT6 A;  1K0N A;  2H71 A;  4FO5 A;  4I6X A;  4F03 A;  2QA1 A;  3LFL A;  3PPU A;  1THO A;  1GSD A;  3KIJ A;  3UJ1 A;  2VUP A;  3KH7 A;  4PGT A;  2BMX A;  3TJJ A;  2YCD A;  5A34 A;  5ECQ B;  1XW6 A;  3UAR A;  3FR9 A;  1Z6N A;  1O81 A;  3HYP A;  1ZL9 A;  1OC8 A;  1O8W A;  4NHW A;  2DJ0 A;  4GQC A;  3HVV A;  14GS A;  2B3S A;  4FYC A;  2FY6 A;  3EVI A;  3RAZ A;  2HSY A;  4X43 A;  2HSH A;  4BVX A;  2K8V A;  2WUL A;  5BMU B;  5D9V A;  4N3Z A;  3L78 A;  1SL1 B;  6GSY A;  4KA0 A;  3F0I A;  5DAL B;  2NVL A;  2GTU A;  1XW5 A;  2GT6 A;  3GMF A;  4ZB8 A;  4AKH A;  1SEN A;  2JAC A;  2WRT A;  3A5W A;  4ZBA A;  2VM2 A;  2B5E A;  5CO3 A;  3W8J A;  4MMM A;  19GS A;  2X4A A;  1GSY A;  1R7H A;  3GV1 A;  4HI7 A;  6GSV A;  5H5Q A;  1H4O A;  1YY7 A;  1K3Y A;  1RW1 A;  2H19 A;  5LD0 A;  2H0H A;  4GST A;  4ZB9 A;  4EXJ A;  3GSS A;  2L4Q A;  1AAZ A;  2ZCT A;  1WWJ A;  5HR3 A;  2GQK A;  5EY6 A;  4MH2 A;  2H76 A;  2R2J A;  1XVQ A;  1K0O A;  4J56 E;  1F3B A;  1NW2 A;  1XXU A;  1C72 A;  4O92 A;  1O7U A;  2YPM A;  2YJH A;  5A5H A;  2UZ8 A;  5A34 B;  1U3A A;  4AJ6 A;  2HZE A;  2EFE A;  2HSN B;  2WZ9 A;  3FK8 A;  3KTL A;  2O7K A;  3APS A;  3HCZ A;  3ZML A;  2X64 A;  2X8G A;  3A2V A;  1ML6 A;  2H30 A;  2CZ3 A;  1AQX A;  4QMK A;  3TKP A;  3GKM A;  1EV9 A;  3DEX A;  1Z3E A;  4BVX B;  4POK A;  5HFI A;  1S3D A;  2VCZ A;  2UV8 G;  4YKG A;  4G9H A;  2E7P A;  2FWE A;  1URM A;  6GSX A;  1F2E A;  4LMW A;  1SK2 A;  1SYR A;  4EVM A;  5CRH A;  4RQR A;  5CRD A;  1PQN A;  4EIQ A;  3TCO A;  2IWT A;  4GSN A;  2ZUP A;  4XS6 A;  1PL1 A;  4GXZ A;  3WYW A;  4PQH A;  2PGT A;  2N5A A;  1BJX A;  2KP1 A;  3MAK A;  1M99 A;  4YH2 A;  2AJQ B;  3O3T A;  4WKW A;  10GS A;  3IK7 A;  1SJI A;  2LQO A;  2C3T A;  4HQS A;  2N5F A;  2F8F A;  1XW9 A;  5JWO B;  4J2F A;  3FMW A;  3ZYW A;  5A5H B;  4TKY A;  3GUR A;  1XWA A;  3EUR A;  3F4T A;  5C04 A;  4MP4 A;  1Z6M A;  2MZC A;  3FR6 A;  2NPB A;  2X49 A;  1V58 A;  3J7Y b;  3I43 A;  4K2D A;  4L0W A;  5DJL A;  2I1U A;  3UMA A;  4K5R A;  4AJ8 A;  3IA1 A;  4CW9 A;  5JWR B;  3EIN A;  1SU9 A;  2OA7 A;  2K6V A;  2LRC A;  4POB A;  1X5D A;  1QMV A;  4HQZ A;  1WP0 A;  2DJ3 A;  2R0G A;  4AKI A;  5D96 A;  2VCV A;  4AGS A;  4WBJ A;  1AUC A;  1M9B A;  2O8V B;  3Q18 A;  3H93 A;  3LXZ A;  1JLW A;  4J57 E;  2QA2 A;  3FEU A;  1XFL A;  4F0B A;  3QR6 A;  4JE1 A;  3QPM A;  3KXO A;  5HFG A;  2FWG A;  3TJK A;  4IHU A;  3P2A A;  4HEA 2;  2VCW A;  4KSO A;  2F8A A;  4DEJ A;  1Y25 A;  4GTU A;  2H1L A;  2ES7 A;  2I9H A;  2L5L A;  1U88 A;  1GP1 A;  3VK9 A;  3MDK A;  4XRA A;  1G6Y A;  2VLU A;  3GKX A;  3C1S A;  3TRP A;  4EC0 A;  3IC8 A;  5CYY A;  5A4V A;  2YNX A;  2TRC P;  2E0Q A;  2AV4 A;  3GA4 A;  3D4M A;  4IKH A;  2R0C A;  3UAP A;  1OC3 A;  3IHQ A;  4DSQ A;  4HS1 A;  4P3Y B;  5ECM B;  2PPT A;  5IQY A;  2EC4 A;  3ERG A;  1T1V A;  1G7O A;  1S3C A;  1XWG A;  3DIE A;  4G10 A;  5G5E A;  1MDK A;  1TI3 A;  5EL8 A;  5D73 A;  4KDU A;  2K8S A;  2QGV A;  3GHA A;  3IBH A;  2HZF A;  1WOU A;  4L0U A;  1K3O A;  1M7T A;  3F9U A;  1V9W A;  1QQ2 A;  3FKF A;  2MMZ A;  3I69 A;  4RI7 A;  1ZMA A;  1TXX A;  4F9Z A;  4EE0 A;  2I81 A;  3TU3 B;  1GUH A;  3TJG A;  4TR4 A;  4MJA A;  1XZO A;  1JFU A;  3GH6 A;  1JZO A;  2GGT A;  2BTO T;  1GTU A;  2DML A;  1M9A A;  2HT9 A;  5B7C A;  3DWV A;  4EO3 A;  2VCX A;  2FWF A;  2HQT A;  2PVO C;  4E8E A;  3HVS A;  2B5Y A;  1T4Y A;  1UVZ A;  3M1G A;  1FO5 A;  1UA5 A;  5INY A;  2JU5 A;  3MWH A;  1TU7 A;  3DRN A;  5G30 A;  3F6F A;  3CSH A;  4MH3 A;  2B7K A;  4ZL7 A;  2AYT A;  4ZIL A;  2B6M A;  3C1R A;  4BVY A;  1G0T A;  2YWM A;  3HVX A;  1PA3 A;  1EOH A;  2HSM A;  3M3M A;  1SJ6 A;  5KN1 A;  3APQ A;  3UEM A;  1TDI A;  3VWV A;  3UL3 A;  3UVH A;  5J3R A;  1JLV A;  5AIS A;  1ZYQ B;  3C7M A;  4FYU A;  1YQ1 A;  3HJP A;  4OCF A;  3LSZ A;  4FQU A;  1GH2 A;  2H70 A;  1BG1 A;  1GWC A;  1TRU A;  4TVE A;  2VM1 A;  3RPP A;  4FYB A;  4ICY A;  1W89 A;  1X9M B;  2QC7 A;  3FZA A;  3WT2 A;  4KDX A;  3PH9 A;  1K0C A;  2H72 A;  1WJK A;  3EMP A;  3D0Z A;  1XBS A;  1GSS A;  4XS4 A;  5IMA A;  5ELA A;  4IJ3 A;  4IQA A;  2DIY A;  1JZR A;  4IP6 A;  4YQM A;  5H5R A;  3QFB C;  2L4C A;  2GS3 A;  3MIX A;  2JAD A;  2DKH A;  2EFD A;  3KMO A;  2GQL A;  3KMN A;  2DMM A;  3CTF A;  4BVY B;  2LQQ A;  1TOF A;  5A4U A;  4TXV A;  1GTB A;  1M2A A;  2IMI A;  2XBQ A;  3G9B A;  2K18 A;  2CAI A;  4BWQ A;  5IMV A;  2WB9 A;  2IME A;  3U6V A;  2F9S A;  1EP8 A;  3PIN A;  4IP1 A;  2F3M A;  2TRX A;  4LL4 B;  3FRC A;  3CMI A;  1TK0 B;  2X8C A;  3QMX A;  5DJM A;  1JZW A;  2OE1 A;  1A23 A;  4OO5 A;  4NPB A;  2JZT A;  2HRN A;  5HQP A;  1SVM A;  2OT3 A;  7GSS A;  3MSZ A;  2VD1 A;  5ECL B;  1R5A A;  2LJK A;  2CQ9 A;  2FHE A;  1GL8 A;  2ON7 A;  4G0K A;  4HUA A;  1PD2 1;  3FHK A;  5JCU A;  1XCC A;  4ZBD A;  1I5G A;  3RDW A;  2AHE A;  3IPZ A;  1FG4 A;  3H79 A;  2NTO A;  3ZLP A;  3IR4 A;  4WF4 A;  1F3A A;  1FB0 A;  4ZB7 A;  2H74 A;  2PMT A;  1YJ6 A;  4TW5 A;  4USS A;  1TTZ A;  3F4S A;  4YAV A;  3H8Q A;  3US3 A;  1YZX A;  1KBN A;  3GX8 A;  4IJI A;  2FCH A;  3TKR A;  1K0M A;  5F05 A;  4F82 A;  4TR0 A;  3CYN A;  2HSN A;  2YJ7 A;  2NDO A;  1KTE A;  3VPQ A;  1XVW A;  3HZ8 A;  5KN3 A;  5ECH B;  1N8J A;  2OE0 A;  5DAK A;  2O5V A;  1VRS D;  5DCH A;  5FWG A;  4YAP A;  4K6X A;  2EIQ A;  4I8B A;  2EFH A;  5FHI A;  3VUR A;  4DSR A;  4N0V A;  4X0X A;  2CVD A;  2YAN A;  2OBK A;  4MF7 A;  2CV4 A;  5CRW A;  2FD3 A;  5GZZ B;  2H1D A;  4I97 A;  5BRT A;  1EEM A;  1HD2 A;  2HYX A;  2O87 A;  1ERU A;  3NIV A;  3ZVJ D;  4XHM A;  2CZ2 A;  2P5Q A;  3K8N A;  4L5L A;  1Y6E A;  2V6O A;  2OJL A;  1BYE A;  4POL A;  4JR6 A;  4Q5R A;  1F9M A;  5DQY A;  2KOK A;  4H86 A;  2IMF A;  2GST A;  2RUF A;  4EF0 A;  4MZW A;  4MJC A;  1GUM A;  1SVL A;  1OC9 A;  3TKS C;  4GRF A;  3GH9 A;  4PUF C;  3IDV A;  1NSW A;  3RHB A;  1A24 A;  2X8H A;  6GST A;  2EIO A;  2H8L A;  5E59 A;  1AXD A;  3FZ4 A;  2CX3 A;  1FVK A;  1XWB A;  2XHF A;  2LS5 A;  5HR1 A;  1J08 A;  4OFM A;  5DAK B;  3P90 A;  2YWN A;  1G7E A;  3DD3 A;  2DJ2 A;  2H0I A;  2VLV A;  5DDL A;  1AC1 A;  3EE2 A;  4MPG A;  3G7Y A;  5KOW A;  2A2R A;  4BA7 A;  1ZYN A;  2HRA A;  1X5E A;  5J47 A;  4ML6 A;  1K0A A;  4NWY A;  1S3A A;  3L9U A;  1ST9 A;  3KP8 A;  1WE0 A;  4MF5 A;  3SWL A;  3ZTL A;  1Z5Y E;  1AQV A;  2GZP A;  4KCA A;  2C8U A;  3WGX A;  1XOB A;  3HHV A;  5FT3 A;  1YKA A;  3LGC A;  4KSM A;  5A4W A;  2R3X A;  16GS A;  1GNE A;  2JSY A;  5GST A;  2KLX A;  4LLR A;  4ZXG A;  2PWJ A;  4Z7X A;  4OO4 A;  3F4R A;  2DC5 A;  3HKR A;  5JWQ B;  4E8H A;  6GSW A;  3GTU B;  4FH8 A;  2E2G A;  3ZVJ A;  2EFC A;  2RUE A;  1OC9 B;  1QFN A;  4Q5Q A;  4WR4 A;  5CP1 A;  2LEG A;  4JBB A;  2G0F A;  3ZZX A;  4TR1 A;  2LST A;  3TB2 A;  1ABA A;  5IMC A;  1KNG A;  1VF2 A;  4EDZ A;  2OAC A;  3E0U A;  2FGX A;  4K2X A;  3N9J A;  4NHZ A;  2MMA A;  3M8N A;  4PQI A;  9GSS A;  1DSB A;  3OR5 A;  3H1N A;  2LUS A;  1ZGN A;  2H1G A;  4Z2T A;  3HJM A;  3D6I A;  1FB6 A;  4XCS A;  2C0G A;  2RM6 A;  4D73 A;  5IO0 A;  3I9V 2;  2LTK A;  2REM A;  3ERF A;  2DLX A;  4CDO A;  1A2J A;  1V2A A;  1E6B A;  1VF4 A;  3D21 A;  2JZR A;  2LJA A;  12GS A;  3KGK A;  2VKZ G;  2R6K A;  4GQF A;  18GS A;  3DML A;  3IAS 2;  4O5Q A;  5LCZ A;  5J9C A;  5F06 A;  1J9B A;  2G2Q A;  4OMV A;  5EPF A;  5KOX A;  3IRA A;  3CXG A;  4MJE A;  5GSS A;  4POM A;  2YV7 A;  2DJK A;  1UN2 A;  1LBK A;  1MEK A;  5CAX A;  1PX6 A;  1MDI A;  2P31 A;  5IMZ A;  3EMX A;  4O5U A;  4O32 A;  4DVC A;  4EKZ A;  1ZOF A;  4TR1 B;  2LJR A;  3NZN A;  4MZB A;  2AUV A;  17GS A;  2QSI A;  4IQ1 A;  3HZ4 A;  3DVX A;  4RI6 A;  4LMV A;  5EVO A;  1TRV A;  5F8B A;  2V1M A;  2ALB A;  3SBC A;  1SD8 A;  2YN1 A;  5DQS A;  4KDY A;  1TW9 A;  1K0B A;  2A2P A;  4XS1 A;  2L6C A;  1NHY A;  4K0N A;  4D73 B;  3TJF A;  1F6M C;  3ZFL A;  1A8Y A;  5HFK A;  1QGV A;  4IGJ A;  4CY8 A;  2C3Q A;  3P8W A;  5IOW A;  2WFC A;  1SK0 A;  1EP7 A;  4BPY A;  2WCI A;  5J4V A;  5KN0 A;  5KN2 A;  2OAD A;  4A5P A;  1PGT A;  1TK8 B;  5JCG A;  1SVO A;  2YP6 A;  4V1A g;  3P7X A;  5CNW A;  3HMJ G;  4L5O A;  11GS A;  2HFD A;  1HQO A;  2YWO A;  1WIK A;  2C3N A;  1NHO A;  3D22 A;  5IPG A;  2IN3 A;  4Z2U A;  1B8X A;  2GLR A;  2CVK A;  4NAX A;  1GSQ A;  3DKS A;  1EOG A;  5CRE A;  2PN8 A;  2D2Z A;  1B9Y C;  2IPA A;  3D5J A;  5ECR B;  4DSS A;  3BJ5 A;  3G7J A;  2HLS A;  4QQ7 A;  3QFA C;  1PSQ A;  1BQ7 A;  5D9T A;  2FWH A;  3A5I A;  1GTA A;  3EU3 A;  3BBY A;  5G1K A;  1ERT A;  2O85 A;  3IAM 2;  4XRD A;  3C71 A;  4KW6 A;  4YKF A;  1BED A;  4ZL9 A;  5ELG A;  1FOH A;  3BOA A;  1BAY A;  2OKA A;  3KP9 A;  1HNC A;  4F0C A;  2IJY A;  5AIV A;  1FW1 A;  3ZFB A;  1A0R P;  3KZQ A;  4ECI A;  4X1U A;  1Z9H A;  2KUC A;  4KCE A;  4RQX A;  4ZBB A;  2R5G A;  3EYT A;  1PKZ A;  3IV4 A;  2ZNM A;  4N30 A;  2V2G A;  4GF0 A;  4HJ2 A;  4BWS A;  1GSU A;  4WBR D;  1ZCP A;  2XC2 A;  1TK5 B;  2PU9 C;  3PR8 A;  1TP9 A;  5IM9 A;  1AQW A;  4KF9 A;  2XPE A;  4PX1 A;  4YQU A;  1AW9 A;  1NM3 A;  4G0L A;  3KCM A;  5B6N A;  3O6T A;  4MK3 A;  4Q5F A;  1GTI A;  3UIW A;  1N2A A;  3GFK A;  4PUA A;  3HDC A;  4DSS B;  4GDF A;  1CQG A;  4AKG A;  2CA8 A;  1PX7 A;  2B7J A;  4KE3 A;  1T00 A;  2IFQ A;  4KH7 A;  3GKN A;  1GUK A;  3RBT A;  2R4V A;  3M9K A;  4MA9 A;  5HR2 A;  1TXU A;  3ZIV A;  5ID2 B;  1MTC A;  2HRK A;  1YF1 A;  2H6Y A;  3CSJ A;  2P5R A;  3TKS A;  3EU4 A;  4KGI A;  3WD6 A;  4ZB6 A;  3GN3 A;  4HJM A;  1U3I A;  4XIH A;  4G2E A;  2HE3 A;  3ISO A;  2H75 A;  3APO A;  1T8E B;  3ZRD A;  4I2U A;  4O7H A;  1MD4 A;  3IK9 A;  4KUN A;  3IC4 A;  3GL3 A;  1VF1 A;  2I3Y A;  2H01 A;  2JZS A;  2V32 A;  2XPD A;  2VCT A;  3CWG A;  2LNT A;  4TXO A;  5CRG A;  1TRS A;  2CX4 A;  1A2M A;  1PL2 A;  2I4A A;  5G1L A;  1DE1 A;  1VGL A;  3UBK A;  4BL7 B;  3QCP A;  1PRX A;  4HU7 A;  3VWU A;  5ABR A;  3CRU A;  3G7I A;  4JZQ A;  5C00 A;  2IFQ B;  20GS A;  3H4K A;  3BCI A;  5AGY A;  1SYX A;  2DBC A;  2FA8 A;  4OFT A;  1MD3 A;  3AY8 A;  3GKK A;  4PNG A;  2VL9 A;  3F63 A;  2BJX A;  2C0E A;  1OE7 A;  2TIR A;  1CQH A;  2HRK B;  1TU8 A;  1HNB A;  4ZIJ A;  5DVB A;  4L8E A;  4ULX A;  1UC7 A;  2PVQ A;  1GRX A;  4PXO A;  1QK8 A;  4Z2R A;  2PER A;  1ZYE A;  3QAV A;  3GNJ A;  2OBI A;  3FZ5 A;  4LA1 A;  1KEB A;  1EV4 A;  3JCM L;  1T7P B;  2H1B A;  4AF2 A;  1B9X C;  3F3R A;  2B1L A;  1E2Y A;  1SK1 A;  4MJB A;  3F8U A;  3F3Q A;  1RK4 A;  3HD5 A;  3L4N A;  4TXO B;  1SKW B;  4GWR A;  2K9F A;  1SJZ A;  2Z9S A;  1K3L A;  2O89 A;  1TJD A;  1EZK A;  1B4P A;  3TKS E;  5J5N A;  5KEJ A;  2A4V A;  5E4W A;  3GYK A;  2HI7 A;  4FIW A;  3GST A;  3IOS A;  3R3E A;  5B6M A;  3QD9 A;  3CTG A;  5J41 A;  4OD7 A;  4WET A;  1EWX A;  2LRN A;  3LJR A;  1A8L A;  1PMT A;  2ON5 A;  5B8A A;  3GTU A;  1Q4J A;  2OE3 A;  3GUS A;  2VL2 A;  4MF6 A;  2KP2 A;  1V40 A;  3KM6 A;  3HY2 A;  3EPT A;  3QOU A;  3BCK A;  4V2N A;  2A4H A;  4E68 A;  2MYG A;  5LNK e;  4JU5 A;  2YOI A;  5J4Y A;  3TRX A;  4MDC A;  3CBU A;  4KB3 A;  3TOT A;  3LOR A;  2A2S A;  1PKW A;  1BF5 A;  1M2B A;  1H75 A;  1M0U A;  2WS2 A;  2YZU A;  3VWX A;  4F2I A;  2GQM A;  1J0F A;  2IIY A;  2V6K A;  2JSZ A;  4HDE A;  1XIY A;  4G19 A;  2M80 A;  3ED3 A;  4KND A;  4ILF A;  1U87 A;  2YV9 A;  4CY6 A;  2H1A A;  1B48 A;  4O5R A;  1OE8 A;  1XWC A;  3QAG A;  4WF5 A;  3ZL5 A;  4QL7 A;  3CSI A;  3W8S A;  3MYD A;  1GUL A;  1U6T A;  4AJ7 A;  4K7O A;  1GLQ A;  22GS A;  1DBY A;  1ACV A;  1T3B A;  3KJY A;  2IMK A;  4RUV A;  3U5R E;  1YDK A;  3LYP A;  3UBL A;  2VD0 A;  3QAW A;  4IN0 A;  2V41 A;  1SD9 A;  3TGZ A;  1Z7R A;  5D8I A;  4I5Q A;  2JL4 A;  2C0D A;  2B5X A;  4GLT A;  3LW9 A;  4G01 A;  2DSA A;  2J9H A;  2LRT A;  2C80 A;  3DXB A;  1PN9 A;  1IYH A;  6GSS A;  3FYG A;  4TOP A;  4AKX B;  5DCG A;  1WRY A;  5D9W A;  3VI5 A;  2DJ1 A;  1DUG A;  2CVB A;  4ZL8 A;  4OWY A;  2HZE B;  4TRX A;  2MBT A;  1X9W B;  3RHC A;  1QUW A;  1ERV A;  1EGR A;  4IW9 A;  3LQ7 A;  4W66 A;  1X9S B;  2F51 A;  2DIZ A;  3F6D A;  3GL5 A;  1JHB A;  3M9J A;  1OAZ A;  3PGT A;  4IS0 A;  1OKD A;  2RII A;  1B4Q A;  3C73 A;  5JCW A;  2MBS A;  4NXI A;  3IXR A;  5AN1 A;  4TN8 A;  1F37 A;  1BG5 A;  5AIX A;  2VL3 A;  5ECI B;  2C4J A;  4PQ1 A;  2XBI A;  2VO4 A;  3ME7 A;  2VL2 C;  1FVJ A;  3L9S A;  4ISD A;  5H5S A;  2AB6 A;  5IPH A;  4V1A p;  13GS A;  4ECC A;  4MLY A;  4NMU A;  5G2Z A;  4TR3 A;  4K8M A;  3N5O A;  1USB A;  3A3T A;  1A0F A;  1K0D A;  4K5S A;  1SL2 B;  1ERW A;  3J7Y k;  4JR4 A;  2GSR A;  1JZD A;  4OFN A;  5COH A;  2H66 A;  3DYR A;  1Q98 A;  3VWW A;  3E3E A;  2IL3 A;  1X0R A;  1TRW A;  1T4Z A;  4N10 A;  2HNL A;  3E9J B;  5D9X A;  2M72 A;  2GDR A;  3WT1 A;  3RPN A;  1O8X A;  4ID0 A;  2L57 A;  2GVP A;  2MMO A;  3QDN A;  8GSS A;  1I9D A;  5IMF A;  1GNW A;  4HOJ A;  3LWA A;  5IOX A;  4PNF A;  3EC3 A;  4G0I A;  3TRQ A;  4ACS A;  1YEX A;  1FAA A;  4OCE A;  5ECS A;  4XTS A;  2C0F A;  3FZ9 A;  4ECB A;  3MNG A;  2PBJ A;  4IVF A;  2LKU A;  4IEL A;  3A2X A;  4K1F A;  1THX A;  3GRX A;  1YVL A;  4N0Z A;  2WJU A;  5A5K A;  3WGD A;  1YKC A;  3Q6O A;  1GSE A;  2LNS A;  3O76 A;  4KX4 A;  2VOC A;  3ZMK A;  5J4U A;  2HRF A;  4MPF A;  2GZY A;  3ZIT A;  5ECN B;  3TJB A;  3UVT A;  1G6W A;  3L0H A;  3W6G A;  2YZH A;  5GAP D;  2YWI A;  1Z7P A;  1R5P A;  4QL9 A;  2E2M A;  2IMD A;  2VIM A;  3UOM A;  4K7N A;  2LV3 A;  1ON4 A;  2L5O A;  1HYU A;  1SKR B;  2H6X A;  5DBQ A;  4V2M A;  1PN0 A;  5J9B A;  3L9V A;  2KHP A;  4HU9 A;  4K9Z A;  3GX0 A;  1OKT A;  2R0P A;  3DVW A;  4NV2 A;  2GT5 A;  4PUR A;  5ECO B;  4MNN A;  1GSF A;  2L6D A;  2VCQ A;  2B1K A;  3TOU A;  1M2D A;  2L59 A;  1A2L A;  3HXS A;  3VLN A;  1TI1 A;  5ENU A;  5L71 A;  3VI7 A;  2VLT A;  2FA4 A;  4JRR A;  4X4J A;  2QKE A;  5ID2 A;  3HJO A;  4ML1 A;  1X5C A;  3A2W A;  4WXT A;  3GIX A;  1XOA A;  4HZ4 A;  5HR0 A;  5IIZ A;  4ECJ A;  4LL1 B;  4V2L A;  5G5F A;  4PTS A;  1ZYP A;  2H73 A;  4YQV A;  1V98 A;  4WR5 A;  5ECK B;  3TKQ A;  1EGO A;  2HXK A;  2DKI A;  5F0G A;  3Q74 A;  4GCI A;  4WEY A;  2RM5 A;  1LU4 A;  1ILO A;  2R37 A;  1IYI A;  1QXH A;  1W4V A;  4EL1 A;  1MDJ A;  2WDU A;  4Q5N A;  3D4T A;  1Y1U A;  1ZZY A;  3TUE A;  1O6J A;  1N25 A;  4AI6 A;  3LG6 A;  3IE3 A;  1WMJ A;  4BL7 A;  5A1N A;  2FNO A;  3Q19 A;  1R4W A;  4EUY A;  4EDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...