4USSA

Populus trichocarpa glutathione transferase x1-1 (ghr1), complexed with glutathione
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
306
structure length
306
Chain Sequence
b'TASTFRNFISKEPNSQFPPESGRYHLYVSYACPWASRCLAYLKIKGLEKAIAFTSVKPIWERTKESDEHMGWVFPASETEEAGAEPDTLNGARSIRELYELASTNYAGKYTVPVLWDKKLKTIVNNESSEIIRMFNTEFNDIAENAALDLYPSHLQAQIDETNGWVYDGINNGVYKCGFARKQGPYEEAAIQLYEALDKCEEILGRQRYICGNTLSEADIKLFVTLIRFDEVYAVHFKCNKKLLRDYPNMFNYTKDIFQIPGMSSTVNMQHIKRHYYGSHPTVNPFGIIPLGPDIDYSSPHDRNRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONYL HYDROQUINONE REDUCTASE
publication title Glutathionyl-Hydroquinone Reductases from Poplar are Plastidial Proteins that Deglutathionylate Both Reduced and Oxidized Glutathionylated Quinones.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 99
structure length 306
sequence length 306
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ussA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ussA01
1GUMA 3QR6A 4I97A 2WB9A 1K0DA 5F06A 1JLWA 1G6YA 4ZBBA 3MAKA 1F3BA 4GSTA 1FHEA 1MD4A 4NHZA 3R2QA 2HRKB 3MDKA 4EDYA 1PD21 4K0NA 1HNBA 4MF7A 1PKZA 2PMTA 1AXDA 3IK7A 3PPUA 1PL2A 2IMKA 3C8EA 6GSVA 1EOGA 4G10A 4GTUA 3SWLA 2GSRA 3GTUB 2AB6A 5ECLB 16GSA 1YY7A 3KM6A 6GSTA 1GTBA 4IS0A 3FY7A 4MDCA 4ECBA 3F6FA 2AHEA 4ECJA 3M0FA 4BVYA 1TDIA 3I69A 3HJOA 4EC0A 2CA8A 5AIVA 4YQVA 4AGSA 20GSA 5ECPB 3VURA 4IELA 4NHWA 1BX9A 5GSSA 5D9WA 1OYJA 2R3XA 2HNLA 5G5FA 4KH7A 3LG6A 2C3QA 1GTIA 3Q74A 1JLVA 1GTAA 4RI6A 5AISA 4IW9A 4DEJA 1AQWA 4YAVA 2PGTA 3FYGA 5IQYA 1VF3A 5ECSA 3GH6A 18GSA 1TU7A 5ECRB 1XWKA 4L5LA 1B48A 4FQUA 8GSSA 5A5KA 2HSNB 2VCZA 2R5GA 4PNFA 4EXJA 4OFMA 2YCDA 4N0VA 1YDKA 5D9TA 1FW1A 5EY6A 3NIVA 4E8HA 2F3MA 5ECMB 4GSSA 4YQUA 4PURA 4WR4A 4GF0A 1OKTA 4HI7A 5F0GA 1GNEA 5ECKB 6GSYA 1M9BA 2HSMB 3UAPA 5ECQB 2GSTA 2OA7A 3CSJA 3VWXA 1XWGA 4G0IA 1PX6A 3N5OA 1XW6A 4G19A 4BVXA 4OFTA 2FHEA 3D0ZA 3L0HA 1GSQA 1AQVA 3KMOA 1U3IA 3KXOA 1OE7A 1KBNA 5LCZA 1U87A 4IGJA 4IJIA 5F8BA 3GSTA 1PX7A 1GLQA 2WJUA 1GSSA 5AN1A 4E8EA 3W8SA 2X64A 13GSA 1GLPA 4O92A 4KE3A 1MD3A 3IE3A 3ZFBA 2VCWA 3ERGA 3UBLA 1HNCA 2GDRA 2PVQA 12GSA 1BAYA 3EINA 1GWCA 1GSDA 2WS2A 3DD3A 6GSUA 3M3MA 1ML6A 4MF6A 4IBPA 4Q5RA 5A4UA 4ZXGA 3ZMKA 6GSXA 17GSA 3G7JA 22GSA 5FWGA 5ELAA 2A2SA 5ECOB 1EV4A 3Q19A 5F05A 5J41A 4ZB9A 3KTLA 3FR3A 1Q4JA 1EV9A 4KX4A 2DC5A 3H1NA 5DAKA 5DJLA 2GSSA 2D2ZA 2CVDA 3I6AA 1G6WA 3M1GA 1IYIA 4HOJA 3CRTA 3P90A 1EEMA 1M99A 2YV9A 3GURA 3RBTA 4PX1A 2LJRA 2V6KA 3Q18A 5LD0A 1B8XA 5DJMA 1GTUA 1JZRA 5ECIB 3UBKA 3ISOA 5D9VA 4ZBAA 3CBUA 2VCVA 4MK3A 1VF4A 1F2EA 2OACA 2J9HA 2CZ2A 4GSNA 2C4JA 2HQTA 3HJMA 2PERA 3LXZA 2HRKA 1DUGA 4USSA 1BG5A 1G7OA 2VCTA 5EL8A 1XW5A 2DSAA 4ECCA 3TGZA 4PQHA 7GSSA 3CSHA 1K0BA 2JL4A 3GTUA 3WD6A 1Z9HA 4MPFA 2N5FA 4KSMA 3VK9A 4GCIA 4YH2A 2GTUA 3BBYA 3CRUA 1BYEA 3VLNA 1TU8A 2VCQA 3IBHA 2WDUA 5DALB 5A4WA 4J2FA 2VO4A 4KDXA 3TOTA 5B7CA 4LMWA 5FHIA 4JEDA 5GZZB 4F0BA 4PNGA 3IK9A 2NTOA 4OMVA 4HJ2A 3CSIA 3LQ7A 2PBJA 4KAEA 4QQ7A 5HFKA 4MF5A 2YV7A 3HKRA 4ECIA 3KMNA 3FRCA 1C72A 5FT3A 4MPGA 4ISDA 3O76A 3ERFA 3LXTA 3QAGA 2HRAA 4EE0A 4BL7B 3TOUA 4O7HA 4ZBDA 1GSEA 3UVHA 4F0CA 1VF2A 3GUSA 1M0UA 6GSSA 1AQXA 1K3LA 2IL3A 3LYPA 3QAWA 4TOPA 3N9JA 4Q5NA 2GSQA 1K3OA 4CHSA 1RK4A 2HSMA 1F3AA 1PA3A 4LMVA 2CZ3A 4PGTA 6GSWA 4ZB8A 2IMIA 1R5AA 1Y6EA 4PXOA 4Q5FA 5F07A 1K0AA 1OE8A 4Q5QA 3WYWA 4JZQA 4NAXA 5D9XA 4ZB6A 1V2AA 3P8WA 1GSFA 4GLTA 4KDUA 10GSA 5JCUA 5EVOA 2AAWA 2R6KA 4IQ1A 5AIXA 3VI7A 3FR6A 1GSYA 4BVYB 3LSZA 3DGQA 2CAQA 2C3NA 1K0OA 3KJYA 5A4VA 5J5NA 4G9HA 4L8EA 1PKWA 3IC8A 3VPQA 3FR9A 2C80A 5DCGA 5AGYA 5ELGA 1K0NA 1MTCA 3EE2A 1TW9A 1YKCA 3ZMLA 4RI7A 4L5OA 14GSA 19GSA 1ZGNA 4JBBA 1EOHA 4OFNA 1LJRA 4EDZA 1VF1A 1GUHA 1UA5A 2VCXA 3LFLA 3GX0A 4MZWA 4PQIA 2R4VA 4K0GA 1GNWA 3VI5A 4KDYA 9GSSA 4KF9A 1K3YA 1LBKA 4HZ4A 4G0LA 1A0FA 1K0CA 1PMTA 4MP4A 3UARA 1NHYA 4HZ2A 1V40A 4IVFA 4BVXB 2VD1A 3LJRA 4F03A 1M9AA 2CAIA 1U88A 4ID0A 1GSUA 3U6VA 1ZL9A 2ON7A 11GSA 4IQAA 2F8FA 5GSTA 2ON5A 1PL1A 3M8NA 1AW9A 3R3EA 5DDLA 3PGTA 4KGIA 4IKHA 3GSSA 3ZFLA 3G7IA 2A2RA 1N2AA 5DQSA 5J4UA 5BMUA 3IR4A 2FNOA 1YQ1A 4WR5A 4YQMA 4PTSA 5DALA 2C3TA 1HNAA 1B4PA 4ACSA 1YJ6A 3LYKA 1PN9A 1HQOA 5G5EA 5JCWA 3VPTA 3PR8A 1K0MA 5D73A 2GLRA 2UZ8A 4G0KA 1GUKA 2VD0A 1E6BA 4PUAA 5DAKB 2OADA 3QAVA 4YAPA 5ECHB 1GULA 1USBA 2C8UA 2WRTA 3AY8A 3F63A 3F6DA 5ECNB 1IYHA 3O3TA 1PGTA 5KEJA 4BL7A
chains in the Genus database with same CATH superfamily
5IOXA 3ZIVA 3TJFA 1K0DA 1JLWA 4MJEA 1G6YA 2R2JA 4BIKA 3R2QA 3IHQA 3ZZXA 1O7UA 3C7MA 3TJGA 4QL7A 4K0NA 3K8NA 1AXDA 2DJ3A 3PPUA 2QA2A 2WVXB 1EOGA 3E3EA 4DSSA 3UMAA 2H76A 2H70A 2AB6A 2VLVA 16GSA 1YY7A 6GSTA 1XFLA 4IS0A 3F9UA 3FY7A 1EP8A 2H1GA 2LV3A 4ECJA 1SVLA 3D4MA 3KGKA 1TDIA 3C71A 2YWNA 2CA8A 4EVMA 2WULA 4HU9A 4NHWA 1BX9A 2R3XA 2HNLA 2CV4A 2GGTA 3LG6A 2YWOA 5KN0A 3MWHA 5AISA 2JZSA 1ZYQB 1Y1UA 4YAVA 2PGTA 2F8AA 1VF3A 4ZILA 3GA4A 3ZVJD 2PWJA 1TU7A 1XWKA 4DSRA 3J7Yk 2PN8A 4PNFA 5B8AA 5JCGA 1BEDA 5D9TA 2R0CA 2VL2A 3MYDA 4NWYA 5EY6A 2MBSA 3NIVA 2VL3A 3IAM2 1PQNA 1GNEA 5ECKB 2HSMB 3UAPA 1A24A 2FLSA 1EWXA 4POMA 2H66A 1PX6A 2CVKA 2H1AA 4G19A 4OFTA 4AJ7A 2FWEA 4KUNA 2FCHA 3KMOA 1U3IA 4HSCX 3LORA 4DSQA 2QGVA 3FK8A 3ZITA 3FZ5A 1B4QA 1BQ7A 1U87A 3TRQA 2YJ7A 5KN2A 5F8BA 4L0UA 1GLQA 1TXXA 2FA4A 4D73A 3WGXA 3ZREA 1A8YA 1B9YC 4O92A 4KE3A 1MD3A 3IE3A 3G9BA 4BWSA 5E59A 5HR3A 3ZTLA 3BOAA 3TJKA 1GSDA 3D6IA 1G0TA 6GSUA 1V98A 3KTBA 1ML6A 2L6CA 2VOCA 1EZKA 4NMUA 4MMMA 5ECOB 5F05A 5IMCA 2V6OA 2YZUA 3IC4A 2KP1A 1SK2A 4KX4A 2L5OA 3IXRA 5GAPD 3H1NA 2D2ZA 1MDJA 1W4VA 4J56E 1IYIA 3DRNA 4J57E 4QMKA 1EEMA 3RBTA 2YV9A 4BPYA 1TK0B 5J4YA 1EEJA 4KCEA 4OO4A 1V57A 5ECIB 3UBKA 5CRWA 3UIWA 5ID2A 5ABRA 1OC9A 1FOVA 4ZBAA 2B1LA 1S4BP 1VF4A 1F2EA 1EGOA 5J4VA 2WZSA 2PERA 3HMJG 1U3AA 3LXZA 2HRKA 3QCPA 5COHA 1XOAA 3QPMA 1OC3A 1M7TA 2E7PA 7GSSA 3IV4A 4I5QA 2I9HA 1NHOA 1AUCA 1XVQA 4KSMA 1O85A 3BBYA 3M9KA 3VLNA 1FAAA 1MEKA 3FZAA 2VCQA 5IO0A 2WDUA 5DALB 4TXOB 3TOTA 2P5RA 3A3TA 3ERWA 2DMMA 2LJAA 2OJLA 1RW1A 5H5SA 2GZPA 1Q98A 2DKIA 2WCIA 4GDFA 1EGRA 4N0ZA 4CW9A 3ERFA 3LXTA 2HFDA 2EIQA 2YNXA 4O7HA 1GSEA 6GSSA 1K3LA 2IL3A 3LYPA 2RM6A 3GN3A 2H8LA 4WBRD 4Q5NA 1J0FA 2O87A 1RK4A 2WFCA 1PA3A 3KH9A 3TUEA 2IMIA 2H73A 4Q5QA 2HRFA 5B6NA 1VRSD 2FUG2 5D9XA 1V2AA 1DSBA 4Z2RA 1GSFA 4GLTA 3TKSE 2XC2A 4EKZA 4BA7A 2H6XA 2EIOA 1SU9A 1GSYA 3LSZA 1ERTA 4KSOA 2OT3A 1NW2A 1XXUA 2CAQA 2C3NA 5A4VA 3KJYA 4MCUA 3HVVA 4G9HA 3RAZA 2KHPA 4XIHA 4EIPA 1PKWA 2GZYA 4JU5A 2K8SA 2JZTA 1YKCA 3TB2A 1XPVA 3ZMLA 2TRXA 3F4TA 4NXIA 4L5OA 3TDGA 1TI3A 1Z7PA 19GSA 1JHBA 4EIQA 4IN0A 2IFQA 4O5RA 1A23A 1T3BA 2QSIA 3QDNA 1SD8A 4PQIA 2M72A 3QD9A 4K0GA 1DE1A 2H72A 2LNTA 4XS4B 4X43A 2N5BA 4ILFA 4G0LA 1TXUA 2B7JA 1CQGA 3UARA 2C1YA 4KB3A 2JSZA 3ZRDA 4BVXB 4F03A 3KZQA 3LGCA 3UEMA 1M9AA 2LQQA 1ERVA 1GSUA 4ML6A 11GSA 2M46A 2ZCTA 3KH7A 3M8NA 1AW9A 3C1RA 2LTKA 1HD2A 1S3CA 4KGIA 4IKHA 3E0UA 3SBCA 3KP8A 3ZFLA 2PU9C 4FO5A 3G7IA 1XBSA 3HJPA 4JR6A 4POLA 1X9SB 2R0GA 1YQ1A 1FOHA 2XPDA 4V1Ap 3TKRA 4MABA 2YOIA 3HYPA 1FG4A 1XW9A 5G5EA 1K0MA 3BD2A 1XZOA 3WGEA 2B5EA 2VD0A 4PUAA 2MMAA 2C8UA 5J9BA 3CYNA 4RUVA 2CX3A 4AKXB 4KW6A 4WKWA 2YPMA 3QR6A 5A5HA 2IMFA 3H8QA 2WB9A 5F06A 2HE3A 3VWWA 1S3DA 1F3BA 3GHAA 4POBA 1ERWA 3F4RA 1JZWA 1FVJA 4XCSA 2NPBA 1PD21 4ZB7A 1SL0B 4K2XA 1A0RP 4LA1A 4LL4B 1PL2A 2IMKA 1SKSB 4G10A 1T4YA 4AJ8A 3GTUB 2HSHA 5ECLB 1TTZA 4N10A 3KM6A 4MDCA 3MNGA 3F6FA 1LU4A 5A1NA 2DMLA 3M0FA 2C0DA 3I69A 3HJOA 4EO3A 2MMNA 2K18A 5G2ZA 4YQVA 2F9SA 2YWMA 20GSA 3L4NA 5ECPB 3VURA 5CREA 4KH7A 1WMJA 3EVIA 2C3QA 1R5PA 5J3RA 1JLVA 1U6TA 1GTAA 4CY6A 4X0XA 1FO5A 3A2XA 1AQWA 1VGLA 1THOA 1UVZA 2LJKA 5ECSA 1TRUA 3GH6A 5J47A 4HQSA 4KA0A 1SJIA 18GSA 1S3RA 1XOBA 2VKZG 5KN1A 4FQUA 8GSSA 3LEFA 2HSNB 3CXGA 4E68A 4EXJA 4EF0A 4PURA 2OBKA 4WR4A 2HSYA 4GF0A 2MBTA 1F6MC 4HI7A 5F0GA 4KNDA 4MZCA 2OA7A 2LQOA 4G0IA 4G01A 3EYTA 2FHEA 4P3YB 1G7EA 1AQVA 1F9MA 3KXOA 2L4QA 4IJIA 1GH2A 2LRNA 3I43A 1X0RA 3WGDA 2X49A 1PX7A 3U5RE 2WJUA 2C0EA 2K9FA 1GSSA 4E8EA 3W8SA 5DVBA 5GAND 3ERGA 1HNCA 3RHCA 1YZXA 4H86A 1GWCA 4HDEA 2H1LA 2WS2A 2YJHA 1SKRB 4Q5RA 2GQKA 4ZXGA 3ZMKA 2V2GA 3GNJA 2G0FA 6GSXA 3G7JA 2BMXA 1TRWA 4O5QA 3FHKA 1EV4A 3GKMA 2EFDA 3DKSA 3KD0A 3FR3A 1Q4JA 1EV9A 2DC5A 5DAKA 4G2EA 2CVBA 2GSSA 2CVDA 3CRTA 2LKUA 2KP2A 2EFEA 3P90A 2ZUPA 3NZNA 1SJZA 3GURA 1BG1A 4TN8A 2V6KA 1M2DA 3RPPA 5CAXA 5DJMA 1XWCA 1QGVA 3ISOA 5J40A 3EMPA 5C04A 3CBUA 5B8BA 2X4AA 2J9HA 2CZ2A 2C4JA 1QUWA 3HJMA 5E4WA 4QL9A 1DUGA 2RM5A 2AV4A 3EPTA 1G7OA 1DE2A 1Z5YE 4PQHA 3CSHA 2KUCA 3GL5A 2WVXA 1WJKA 4JRRA 2V32A 3VK9A 5H5RA 5IM9A 3PH9A 1OC8A 2GTUA 5BMUB 3HCZA 2JADA 2C0FA 1TU8A 2O36A 2VO4A 4LMWA 1TK5B 4WEYA 3IK9A 2NTOA 1TKDB 4HJ2A 3CSIA 3IA1A 3L9SA 2YWIA 5HFKA 2WW3A 3C1SA 3HZ8A 4MF5A 2YV7A 2WW1A 2H74A 3FRCA 1C72A 5FT3A 1ZYNA 3LWAA 3ME8A 3O6TA 4HU7A 4OWYA 5D96A 2IN3A 2IPAA 4ML1A 4EE0A 3F3RA 2WGRA 3A2WA 4XHMA 4I2TA 3HVXA 3LW9A 3CMIA 1WOUA 2PUKC 3GUSA 3V1WA 1AQXA 1FB0A 4FYCA 2I4AA 3QAWA 3N9JA 3D4TA 5LNKe 2FD3A 2HLSA 2HSMA 1YF1A 4GQCA 4LMVA 2CZ3A 4PGTA 6GSWA 2AUVA 1SL2B 2XBQA 3GX8A 4NAXA 5HR0A 5B6MA 4K7IA 4V2NA 1GP1A 10GSA 4I6XA 2AAWA 3RHBA 4IQ1A 3P7XA 3FR6A 4BVYB 1K0OA 1Y25A 2FWFA 4IP1A 2AJQB 3IC8A 4BWQA 2A4HA 2VUPA 4WXTA 14GSA 2DIYA 3BJ5A 1QXHA 4JBBA 1EOHA 2K8VA 1LJRA 2I81A 1X5EA 5IO2A 1UA5A 2VCXA 3LFLA 3GX0A 4MZWA 1YVLA 5A34B 4GXZA 2CT6A 3UL3A 4KDYA 9GSSA 1K3YA 2VIMA 1K0CA 3ZVJA 4MP4A 3F3QA 4W66A 2B5XA 4MJBA 2VD1A 3LJRA 4K7NA 2X8CA 1QMVA 4K6XA 1U88A 5KOWA 3U6VA 2F8FA 3DXBA 1PL1A 2HT9A 1SD9A 1UN2A 1A2JA 3PGTA 1ON4A 1M3IA 1TOFA 2C0GA 2OE0A 2X8HA 3F8UA 2FWGA 3CTFA 3UOMA 4YQMA 4PUFC 5DALA 4TXOA 1ZYEA 4LL1B 4AKIA 2H6YA 3LYKA 5HFGA 2DKHA 3HHVA 3EMXA 5JCWA 3VPTA 2HZFA 3TKSC 2GLRA 3S9FA 3IRAA 1GUKA 2IMEA 1Z3EA 4O5UA 1E6BA 1SVMA 4FYBA 2OADA 5DQYA 1SL1B 3QAVA 1AC1A 5ECHB 1GULA 4XRAA 3QFAC 3AY8A 3F63A 4GRFA 4PI2C 1IYHA 3KIJA 1ACVA 5KEJA 1PFOA 1GUMA 1ZOFA 3CTGA 4TKYA 4I97A 3IOSA 3US3A 4GSTA 2V1MA 1MD4A 4NHZA 3HVSA 3QOUA 4OCFA 4NPBA 2JACA 1A2MA 3TRPA 2M80A 1PRXA 2DJ0A 1Z7RA 4ZL9A 1HNBA 4MF7A 2PMTA 4IP6A 3IK7A 1YKAA 6GSVA 4ULXA 4GTUA 2WZ9A 2HYXA 4ECBA 2AHEA 5IIZA 2JSYA 4EC0A 5AIVA 4Z7XA 4N11A 4IELA 3WT1A 5D9WA 4CY8A 1OYJA 1XWBA 1ZCPA 3Q74A 2EC4A 4RI6A 2H0IA 2O7KA 5CYYA 4DEJA 2LRCA 4Z2UA 1TRVA 5ECRB 2YANA 3TCOA 3OR5A 4L5LA 2DJJA 3IHGA 1B48A 2VCZA 4OFMA 4N0VA 1FW1A 3IPZA 3TRXA 2F3MA 5ECMB 4GSSA 2H30A 4XS4A 5ECQB 2GSTA 3D22A 3CSJA 3VWXA 4K5SA 3TKSA 3F4SA 4BVXA 2GQMA 3D0ZA 3L0HA 1BF5A 1GSQA 1YEWC 1OE7A 1KBNA 5LCZA 2LEGA 3A5WA 3EU3A 4EUYA 1Z6NA 2FWHA 5AN1A 3L78A 4HEA2 13GSA 2FY6A 2VM2A 1X5CA 3UBLA 1BAYA 2HZEB 3EINA 4YKGA 2QKEA 3M3MA 3APOA 4MF6A 4MNNA 4IBPA 2DIZA 2P31A 2LUSA 1THXA 2OKAA 22GSA 5FWGA 1YEPA 4X1UA 5D93A 2FA8A 1T7PB 5IPHA 4HQZA 1X9MB 3H79A 3KTLA 3KP9A 1ABAA 5DJLA 3I6AA 2HRNA 1PN0A 1TP9A 1G6WA 3M1GA 4HOJA 1SYXA 2NDOA 4K1FA 2LSTA 3GIXA 2UV8G 4HS1A 4POKA 1GTUA 1JZRA 2DJKA 1AIUA 4XRDA 5D9VA 4WF4A 2VCVA 3IDVA 4MK3A 4TR1B 1ILOA 2ALBA 2OE1A 4USSA 2VLTA 5EL8A 1XW5A 4ECCA 5IMDA 1DBYA 1K0BA 4HUAA 3ZIJA 4YKFA 2H71A 3GTUA 3WD6A 4MPFA 4CDOA 2H1BA 4GCIA 4YH2A 1PSQA 3CRUA 1BYEA 1FVKA 4N30A 5G30A 3HD5A 4L0WA 5A4WA 1T00A 2L59A 1SKWB 4KDXA 2R0PA 5FHIA 4MZBA 4JEDA 5JWQB 1GRXA 4OMVA 2GS3A 3M9JA 2PBJA 4KAEA 4QQ7A 1HYUA 3HKRA 3KMNA 2LS5A 1N8JA 5J9CA 2JZRA 2K6VA 2TRCP 4ISDA 5IMZA 1WP0A 2CX4A 3O76A 2O5VA 1SJ6A 1WIKA 2J23A 4BL7B 3TOUA 2A4VA 4ZBDA 5IOWA 2HSNA 2GVPA 2VL2C 3CHXC 1QK8A 1M0UA 2EFCA 3GYKA 3TKPA 3MSZA 4CHSA 2MZCA 4MJCA 1F3AA 2B7KA 4ZB8A 3GH9A 1R5AA 4JE1A 4PXOA 5F07A 3WYWA 4PHZC 4PQ1A 4F9ZA 1JFUA 4ZB6A 4DSSB 5HR1A 5JCUA 2QA1A 5INYA 4AI6A 2O89A 5HQPA 2DJ2A 2VM1A 5J5NA 4AJ6A 4WETA 1KNGA 3BCKA 4ICYA 3MIXA 5EPFA 4TXVA 3GRXA 3FR9A 5D8IA 2C80A 5DCGA 1KEBA 5AGYA 2YZHA 5ELGA 1TRSA 3PINA 4KCAA 3UVTA 2O3EA 3A2VA 4OCEA 2WVZA 4OFNA 1SVOA 4EDZA 3UJ1A 3DMLA 1GL8A 3FW2A 3W6GA 2TIRA 4DVCA 1WRYA 3VWVA 3Q6OA 3VI5A 4K5RA 4KF9A 1XIYA 1XCCA 1A0FA 2RLIA 1PMTA 3I9V2 4PI0C 4HZ2A 4NV5A 2PPTA 3ZLPA 1CQHA 2KOKA 2E2MA 2X99A 1BJXA 1ZL9A 4K7OA 4AKGA 2ON5A 4D73B 2CQ9A 2Z9SA 3FZ9A 4MJAA 3GKKA 1R26A 3ED3A 2XHFA 3H4KA 1O81A 4FXYP 5J4UA 5BMUA 3IR4A 3ZL5A 4PTSA 3DVWA 3EU4A 1W89A 4RQXA 1HNAA 1WWJA 4K8MA 1YJ6A 3TKQA 1PN9A 1HQOA 3J7Yb 1OVNA 3PR8A 1X5DA 3G7YA 5D73A 4F82A 2UZ8A 2REMA 1TK8B 3RGBC 1XWAA 2IWTA 1H75A 5HR2A 1USBA 3DWVA 3HDCA 2GT5A 1QFNA 5JWRB 3F6DA 2KLXA 2IJYA 2AYTA 5ID2B 3APSA 1H4OA 1OC9B 1MDKA 4GWRA 1I5GA 2V41A 5KN3A 4ZBBA 1M3JA 3MAKA 1FHEA 1J08A 1O73A 2HRKB 3MDKA 4EDYA 3FMWA 5JWOB 3RDWA 1PKZA 4TR3A 2B1KA 3C8EA 1I9DA 3SWLA 3FEUA 2GSRA 1RQMA 3KCMA 2WW0A 3TJBA 3BCIA 1GTBA 3RFRC 1A8LA 4V2LA 4FH8A 4BVYA 1YEXA 2HXKA 1URMA 3HY2A 2YN1A 4AGSA 5GSSA 4Z2TA 5G5FA 1GTIA 2ES7A 4ZL7A 2L6DA 2MYGA 2OE3A 1B9XC 1OKDA 4IW9A 4I8BA 3FYGA 5IQYA 3F0IA 4MH3A 2GQLA 4TW5A 5A5KA 1V9WA 5DBQA 2R5GA 3DVXA 2YCDA 1YDKA 5A34A 2F51A 1O8WA 4E8HA 2WW2A 4YQUA 5C00A 2R37A 1OKTA 6GSYA 2RUFA 1M9BA 5L71A 1TI1A 5H5QA 3DYRA 3QMXA 2RIIA 1XWGA 1XG8A 3N5OA 1XW6A 2A2PA 2H19A 2DBCA 3ME7A 2BTOT 1FB6A 1QQ2A 5IMFA 4IGJA 4V2MA 1SENA 4A5PA 3GSTA 5HFIA 3APQA 1T1VA 2X64A 1GLPA 4XS1A 3VWUA 2L4CA 2ZNMA 3ZFBA 2VCWA 2GDRA 2PVQA 12GSA 1T4ZA 2XPEA 3DD3A 2RUEA 4WF5A 3JCML 5A4UA 17GSA 3FZ4A 4MA9A 5ELAA 2A2SA 5ENUA 2IFQB 3Q19A 5J41A 4F2IA 4ZB9A 2FGXA 2GT6A 3VFIA 1T8EB 3GFKA 1M99A 1MDIA 4PX1A 2YP6A 2LJRA 3HA9A 3HVNA 3Q18A 5LD0A 1B8XA 1EP7A 2WVYA 4V1Ag 4N3ZA 3CQFA 1UC7A 4TR0A 3H93A 2OACA 3FKFA 4ZL8A 4GSNA 2HQTA 4AF2A 2X8GA 1BG5A 3L9VA 2VCTA 2DSAA 3TGZA 2H1DA 2L57A 2IIYA 1SK1A 1ZMAA 2B6MA 3EWLA 2JL4A 3GMFA 1O6JA 5IMVA 1SK0A 1NM3A 2B5YA 1Z9HA 2N5FA 2HI7A 2H0HA 4TRXA 1YF0A 5IPGA 3KEBA 3IBHA 1F37A 3DEXA 4K2DA 4J2FA 1M2BA 2H01A 5B7CA 5GZZB 2DJ1A 2E0QA 4F0BA 4PNGA 2O8VB 3TJJA 2BJXA 3E9JB 1V58A 3LQ7A 4RQRA 3P2AA 3GV1A 1NSWA 2LNSA 2I3YA 4ECIA 3HXSA 4WBJA 1TJDA 3RPNA 4TR4A 4MPGA 2NBSA 2I1UA 5IMAA 3QAGA 2HRAA 5CRGA 1N25A 3UVHA 5A5HB 4F0CA 1VF2A 2VLUA 3IAS2 2N5AA 2H6ZA 2G2QA 1R4WA 4TOPA 1X9WB 4IHUA 2GSQA 1M2AA 1K3OA 3C73A 2MMOA 5KOXA 3GL3A 4IJ3A 1Y6EA 4Q5FA 1K0AA 1OE8A 1WE0A 5DCHA 5G31A 4JZQA 3DIEA 3P8WA 4KDUA 3HZ4A 5EVOA 2VL9A 4OD7A 1JZOA 2R6KA 1R7HA 5AIXA 5A1NB 1XVWA 3VI7A 2MMZA 4FIWA 3EC3A 1OAZA 3DGQA 4XS6A 5CRDA 4GQFA 1I1IP 4L8EA 4TVEA 2P5QA 4I2UA 3VPQA 3D21A 2IMDA 1SYRA 2HZEA 1AAZA 1K0NA 1MTCA 3EE2A 1TW9A 3EURA 3QFBC 4RI7A 2GZZA 3A5IA 2VAFA 1ZGNA 3D5JA 4K9ZA 3L9UA 1J9BA 1VF1A 1GUHA 5CO3A 1ZZYA 3GKNA 4XTSA 2R4VA 2O85A 3NOFA 1GNWA 2QC7A 2H0GA 4X4JA 5CNWA 1LBKA 1A2LA 4HZ4A 2H75A 4JR4A 4O32A 2OBIA 1NHYA 1V40A 1O8XA 4IVFA 3W8JA 5BRTA 2CAIA 4ID0A 2LRTA 3CWGA 3TU3B 2EIRA 4MH2A 4TR1A 2ON7A 4IQAA 1S3AA 5GSTA 2DLXA 4ZIJA 2EFHA 3R3EA 5G1LA 5DDLA 5CRHA 4NV2A 5G1KA 3GSSA 4OO5A 4LLRA 4EL1A 2A2RA 1N2AA 5DQSA 1KTEA 1ERUA 1JZDA 5CP1A 2FNOA 4WR5A 3WT2A 2PVOC 1E2YA 2C3TA 1B4PA 4ACSA 2B3SA 2P0GA 4G0KA 2E2GA 2NVLA 4MLYA 5DAKB 4YAPA 2XBIA 2JU5A 1WPIA 4AKHA 3GKXA 2WRTA 2L5LA 3ZYWA 1ZYPA 5ECNB 1ST9A 1Z6MA 4FYUA 1PGTA 3O3TA 4HJMA 4BL7A
chains in the Genus database with same CATH topology
5IOXA 3ZIVA 3TJFA 1K0DA 1JLWA 4MJEA 1G6YA 2R2JA 3R2QA 3IHQA 3ZZXA 1O7UA 3C7MA 3TJGA 4QL7A 4K0NA 3K8NA 1AXDA 2DJ3A 3PPUA 2QA2A 1EOGA 3E3EA 4DSSA 3UMAA 2H76A 2H70A 2AB6A 2VLVA 16GSA 1YY7A 6GSTA 1XFLA 4IS0A 3F9UA 3FY7A 1EP8A 2H1GA 2LV3A 4ECJA 1SVLA 3D4MA 3KGKA 1TDIA 3C71A 2YWNA 2CA8A 4EVMA 2WULA 4HU9A 4NHWA 1BX9A 2R3XA 2HNLA 2CV4A 2GGTA 3LG6A 2YWOA 5KN0A 3MWHA 5AISA 2JZSA 1ZYQB 1Y1UA 4YAVA 2PGTA 2F8AA 1VF3A 4ZILA 3GA4A 3ZVJD 2PWJA 1TU7A 1XWKA 4DSRA 3J7Yk 2PN8A 4PNFA 5B8AA 5JCGA 1BEDA 5D9TA 2R0CA 2VL2A 3MYDA 4NWYA 5EY6A 2MBSA 3NIVA 2VL3A 3IAM2 1PQNA 1GNEA 5ECKB 2HSMB 3UAPA 1A24A 2FLSA 1EWXA 4POMA 2H66A 1PX6A 2CVKA 2H1AA 4G19A 4OFTA 4AJ7A 2FWEA 4KUNA 2FCHA 3KMOA 1U3IA 3LORA 4DSQA 2QGVA 3FK8A 3ZITA 3FZ5A 1B4QA 1BQ7A 1U87A 3TRQA 2YJ7A 5KN2A 5F8BA 4L0UA 1GLQA 1TXXA 2FA4A 4D73A 3WGXA 3ZREA 1A8YA 1B9YC 4O92A 4KE3A 1MD3A 3IE3A 3G9BA 4BWSA 5E59A 5HR3A 3ZTLA 3BOAA 3TJKA 1GSDA 3D6IA 1G0TA 6GSUA 1V98A 3KTBA 1ML6A 2L6CA 2VOCA 1EZKA 4NMUA 4MMMA 5ECOB 5F05A 5IMCA 2V6OA 2YZUA 3IC4A 2KP1A 1SK2A 4KX4A 2L5OA 3IXRA 5GAPD 3H1NA 2D2ZA 1MDJA 1W4VA 4J56E 1IYIA 3DRNA 4J57E 4QMKA 1EEMA 3RBTA 2YV9A 4BPYA 1TK0B 5J4YA 1EEJA 4KCEA 4OO4A 1V57A 5ECIB 3UBKA 5CRWA 3UIWA 5ID2A 5ABRA 1OC9A 1FOVA 4ZBAA 2B1LA 1VF4A 1F2EA 1EGOA 5J4VA 2PERA 3HMJG 1U3AA 3LXZA 2HRKA 3QCPA 5COHA 1XOAA 3QPMA 1OC3A 1M7TA 2E7PA 7GSSA 3IV4A 4I5QA 2I9HA 1NHOA 1AUCA 1XVQA 4KSMA 1O85A 3BBYA 3M9KA 3VLNA 1FAAA 1MEKA 3FZAA 2VCQA 5IO0A 2WDUA 5DALB 4TXOB 3TOTA 2P5RA 3A3TA 3ERWA 2DMMA 2LJAA 2OJLA 1RW1A 5H5SA 2GZPA 1Q98A 2DKIA 2WCIA 4GDFA 1EGRA 4N0ZA 4CW9A 3ERFA 3LXTA 2HFDA 2EIQA 2YNXA 4O7HA 1GSEA 6GSSA 1K3LA 3LYPA 2IL3A 2RM6A 3GN3A 2H8LA 4WBRD 4Q5NA 1J0FA 2O87A 1RK4A 2WFCA 1PA3A 3KH9A 3TUEA 2IMIA 2H73A 4Q5QA 2HRFA 5B6NA 1VRSD 2FUG2 5D9XA 1V2AA 1DSBA 4Z2RA 1GSFA 4GLTA 3TKSE 2XC2A 4EKZA 4BA7A 2H6XA 2EIOA 1SU9A 1GSYA 3LSZA 1ERTA 4KSOA 2OT3A 1NW2A 1XXUA 2CAQA 2C3NA 5A4VA 3KJYA 4MCUA 3HVVA 4G9HA 3RAZA 2KHPA 4XIHA 4EIPA 1PKWA 2GZYA 4JU5A 2K8SA 2JZTA 1YKCA 3TB2A 1XPVA 3ZMLA 2TRXA 3F4TA 4NXIA 4L5OA 3TDGA 1TI3A 1Z7PA 19GSA 1JHBA 4EIQA 4IN0A 2IFQA 4O5RA 1A23A 1T3BA 2QSIA 3QDNA 1SD8A 4PQIA 2M72A 3QD9A 4K0GA 1DE1A 2H72A 2LNTA 4XS4B 4X43A 2N5BA 4ILFA 4G0LA 1TXUA 2B7JA 1CQGA 3UARA 2C1YA 4KB3A 2JSZA 3ZRDA 4BVXB 4F03A 3KZQA 3LGCA 3UEMA 1M9AA 2LQQA 1ERVA 1GSUA 4ML6A 11GSA 2M46A 2ZCTA 3KH7A 3M8NA 1AW9A 3C1RA 2LTKA 1HD2A 1S3CA 4KGIA 4IKHA 3E0UA 3SBCA 3KP8A 3ZFLA 2PU9C 4FO5A 3G7IA 1XBSA 3HJPA 4JR6A 4POLA 1X9SB 2R0GA 1YQ1A 1FOHA 2XPDA 4V1Ap 3TKRA 4MABA 2YOIA 3HYPA 1FG4A 1XW9A 5G5EA 1K0MA 3BD2A 1XZOA 3WGEA 2B5EA 2VD0A 4PUAA 2MMAA 2C8UA 5J9BA 3CYNA 4RUVA 2CX3A 4AKXB 4KW6A 4WKWA 2YPMA 3QR6A 5A5HA 2IMFA 3H8QA 2WB9A 5F06A 2HE3A 3VWWA 1S3DA 1F3BA 3GHAA 4POBA 1ERWA 3F4RA 1JZWA 1FVJA 4XCSA 2NPBA 1PD21 4ZB7A 1SL0B 4K2XA 1A0RP 4LA1A 4LL4B 1PL2A 2IMKA 1SKSB 4G10A 1T4YA 4AJ8A 3GTUB 2HSHA 5ECLB 1TTZA 4N10A 3KM6A 4MDCA 3MNGA 3F6FA 1LU4A 5A1NA 2DMLA 3M0FA 2C0DA 3I69A 3HJOA 4EO3A 2MMNA 2K18A 5G2ZA 4YQVA 2F9SA 2YWMA 20GSA 3L4NA 5ECPB 3VURA 5CREA 4KH7A 1WMJA 3EVIA 2C3QA 1R5PA 5J3RA 1JLVA 1U6TA 1GTAA 4CY6A 4X0XA 1FO5A 3A2XA 1AQWA 1VGLA 1THOA 1UVZA 2LJKA 5ECSA 1TRUA 3GH6A 5J47A 4HQSA 4KA0A 1SJIA 18GSA 1XOBA 2VKZG 5KN1A 4FQUA 8GSSA 3LEFA 2HSNB 3CXGA 4E68A 4EXJA 4EF0A 4PURA 2OBKA 4WR4A 2HSYA 4GF0A 2MBTA 1F6MC 4HI7A 5F0GA 4KNDA 4MZCA 2OA7A 2LQOA 4G0IA 4G01A 3EYTA 2FHEA 4P3YB 1G7EA 1AQVA 1F9MA 3KXOA 2L4QA 4IJIA 1GH2A 2LRNA 3I43A 1X0RA 3WGDA 2X49A 1PX7A 3U5RE 2WJUA 2C0EA 2K9FA 1GSSA 4E8EA 3W8SA 5DVBA 5GAND 3ERGA 1HNCA 3RHCA 1YZXA 4H86A 1GWCA 4HDEA 2H1LA 2WS2A 2YJHA 1SKRB 4Q5RA 2GQKA 4ZXGA 3ZMKA 2V2GA 3GNJA 2G0FA 6GSXA 3G7JA 2BMXA 1TRWA 4O5QA 3FHKA 1EV4A 3GKMA 2EFDA 3DKSA 3KD0A 3FR3A 1Q4JA 1EV9A 2DC5A 5DAKA 4G2EA 2CVBA 2GSSA 2CVDA 3CRTA 2LKUA 2KP2A 2EFEA 3P90A 2ZUPA 3NZNA 1SJZA 3GURA 1BG1A 4TN8A 2V6KA 1M2DA 3RPPA 5CAXA 5DJMA 1XWCA 1QGVA 3ISOA 5J40A 3EMPA 5C04A 3CBUA 5B8BA 2X4AA 2J9HA 2CZ2A 2C4JA 1QUWA 3HJMA 5E4WA 4QL9A 1DUGA 2RM5A 2AV4A 3EPTA 1G7OA 1DE2A 1Z5YE 4PQHA 3CSHA 2KUCA 3GL5A 1WJKA 4JRRA 2V32A 3VK9A 5H5RA 5IM9A 3PH9A 1OC8A 2GTUA 5BMUB 3HCZA 2JADA 2C0FA 1TU8A 2VO4A 4LMWA 1TK5B 4WEYA 3IK9A 2NTOA 1TKDB 4HJ2A 3CSIA 3IA1A 3L9SA 2YWIA 5HFKA 3C1SA 3HZ8A 4MF5A 2YV7A 2H74A 3FRCA 1C72A 5FT3A 1ZYNA 3LWAA 3ME8A 3O6TA 4HU7A 4OWYA 5D96A 2IN3A 2IPAA 4ML1A 4EE0A 3F3RA 2WGRA 3A2WA 4XHMA 4I2TA 3HVXA 3LW9A 3CMIA 1WOUA 2PUKC 3GUSA 3V1WA 1AQXA 1FB0A 4FYCA 2I4AA 3QAWA 3N9JA 3D4TA 5LNKe 2FD3A 2HLSA 2HSMA 1YF1A 4GQCA 4LMVA 2CZ3A 4PGTA 6GSWA 2AUVA 1SL2B 2XBQA 3GX8A 4NAXA 5HR0A 5B6MA 4K7IA 4V2NA 1GP1A 10GSA 4I6XA 2AAWA 3RHBA 4IQ1A 3P7XA 3FR6A 4BVYB 1K0OA 1Y25A 2FWFA 4IP1A 2AJQB 3IC8A 4BWQA 2A4HA 2VUPA 4WXTA 14GSA 2DIYA 3BJ5A 1QXHA 4JBBA 1EOHA 2K8VA 1LJRA 2I81A 1X5EA 5IO2A 1UA5A 2VCXA 3LFLA 3GX0A 4MZWA 1YVLA 5A34B 4GXZA 2CT6A 3UL3A 4KDYA 9GSSA 1K3YA 2VIMA 1K0CA 3ZVJA 4MP4A 3F3QA 4W66A 2B5XA 4MJBA 2VD1A 3LJRA 4K7NA 2X8CA 1QMVA 4K6XA 1U88A 5KOWA 3U6VA 2F8FA 3DXBA 1PL1A 2HT9A 1SD9A 1UN2A 1A2JA 3PGTA 1ON4A 1TOFA 2C0GA 2OE0A 2X8HA 3F8UA 2FWGA 3CTFA 3UOMA 4YQMA 4PUFC 5DALA 4TXOA 1ZYEA 4LL1B 4AKIA 2H6YA 3LYKA 5HFGA 2DKHA 3HHVA 3EMXA 5JCWA 3VPTA 2HZFA 3TKSC 2GLRA 3S9FA 3IRAA 1GUKA 2IMEA 1Z3EA 4O5UA 1E6BA 1SVMA 4FYBA 2OADA 5DQYA 1SL1B 3QAVA 1AC1A 5ECHB 1GULA 4XRAA 3QFAC 3AY8A 3F63A 4GRFA 1IYHA 3KIJA 1ACVA 5KEJA 1GUMA 1ZOFA 3CTGA 4TKYA 4I97A 3IOSA 3US3A 4GSTA 2V1MA 1MD4A 4NHZA 3HVSA 3QOUA 4OCFA 4NPBA 2JACA 1A2MA 3TRPA 2M80A 1PRXA 2DJ0A 1Z7RA 4ZL9A 1HNBA 4MF7A 2PMTA 4IP6A 3IK7A 1YKAA 6GSVA 4ULXA 4GTUA 2WZ9A 2HYXA 4ECBA 2AHEA 5IIZA 2JSYA 4EC0A 5AIVA 4Z7XA 4N11A 4IELA 3WT1A 5D9WA 4CY8A 1OYJA 1XWBA 1ZCPA 3Q74A 2EC4A 4RI6A 2H0IA 2O7KA 5CYYA 4DEJA 2LRCA 4Z2UA 1TRVA 5ECRB 2YANA 3TCOA 3OR5A 4L5LA 2DJJA 3IHGA 1B48A 2VCZA 4OFMA 4N0VA 1FW1A 3IPZA 3TRXA 2F3MA 5ECMB 4GSSA 2H30A 4XS4A 5ECQB 2GSTA 3D22A 3CSJA 3VWXA 4K5SA 3TKSA 3F4SA 4BVXA 2GQMA 3D0ZA 3L0HA 1BF5A 1GSQA 1OE7A 1KBNA 5LCZA 2LEGA 3A5WA 3EU3A 4EUYA 1Z6NA 2FWHA 5AN1A 3L78A 4HEA2 13GSA 2FY6A 2VM2A 1X5CA 3UBLA 1BAYA 2HZEB 3EINA 4YKGA 2QKEA 3M3MA 3APOA 4MF6A 4MNNA 4IBPA 2DIZA 2P31A 2LUSA 1THXA 2OKAA 22GSA 5FWGA 1YEPA 4X1UA 5D93A 2FA8A 1T7PB 5IPHA 4HQZA 1X9MB 3H79A 3KTLA 3KP9A 1ABAA 5DJLA 3I6AA 2HRNA 1PN0A 1TP9A 1G6WA 3M1GA 4HOJA 1SYXA 2NDOA 4K1FA 2LSTA 3GIXA 2UV8G 4HS1A 4POKA 1GTUA 1JZRA 2DJKA 1AIUA 4XRDA 5D9VA 4WF4A 2VCVA 3IDVA 4MK3A 4TR1B 1ILOA 2ALBA 2OE1A 4USSA 2VLTA 5EL8A 1XW5A 4ECCA 5IMDA 1DBYA 1K0BA 4HUAA 3ZIJA 4YKFA 2H71A 3GTUA 3WD6A 4MPFA 4CDOA 2H1BA 4GCIA 4YH2A 1PSQA 3CRUA 1BYEA 1FVKA 4N30A 5G30A 3HD5A 4L0WA 5A4WA 1T00A 2L59A 1SKWB 4KDXA 2R0PA 5FHIA 4MZBA 4JEDA 5JWQB 1GRXA 4OMVA 2GS3A 3M9JA 2PBJA 4KAEA 4QQ7A 1HYUA 3HKRA 3KMNA 2LS5A 1N8JA 5J9CA 2JZRA 2K6VA 2TRCP 4ISDA 5IMZA 1WP0A 2CX4A 3O76A 2O5VA 1SJ6A 1WIKA 2J23A 4BL7B 3TOUA 2A4VA 4ZBDA 5IOWA 2HSNA 2GVPA 2VL2C 1QK8A 1M0UA 2EFCA 3GYKA 3TKPA 3MSZA 4CHSA 2MZCA 4MJCA 1F3AA 2B7KA 4ZB8A 3GH9A 1R5AA 4JE1A 4PXOA 5F07A 3WYWA 4PQ1A 4F9ZA 1JFUA 4ZB6A 4DSSB 5HR1A 5JCUA 2QA1A 5INYA 4AI6A 2O89A 5HQPA 2DJ2A 2VM1A 5J5NA 4AJ6A 4WETA 1KNGA 3BCKA 4ICYA 3MIXA 5EPFA 4TXVA 3GRXA 3FR9A 5D8IA 2C80A 5DCGA 1KEBA 5AGYA 2YZHA 5ELGA 1TRSA 3PINA 4KCAA 3UVTA 3A2VA 4OCEA 4OFNA 1SVOA 4EDZA 3UJ1A 3DMLA 1GL8A 3FW2A 3W6GA 2TIRA 4DVCA 1WRYA 3VWVA 3Q6OA 3VI5A 4K5RA 4KF9A 1XIYA 1XCCA 1A0FA 2RLIA 1PMTA 3I9V2 4HZ2A 4NV5A 2PPTA 3ZLPA 1CQHA 2KOKA 2E2MA 2X99A 1BJXA 1ZL9A 4K7OA 4AKGA 2ON5A 4D73B 2CQ9A 2Z9SA 3FZ9A 4MJAA 3GKKA 1R26A 3ED3A 2XHFA 3H4KA 1O81A 5J4UA 5BMUA 3IR4A 3ZL5A 4PTSA 3DVWA 3EU4A 1W89A 4RQXA 1HNAA 1WWJA 4K8MA 1YJ6A 3TKQA 1PN9A 1HQOA 3J7Yb 1OVNA 3PR8A 1X5DA 3G7YA 5D73A 4F82A 2UZ8A 2REMA 1TK8B 1XWAA 2IWTA 1H75A 5HR2A 1USBA 3DWVA 3HDCA 2GT5A 1QFNA 5JWRB 3F6DA 2KLXA 2IJYA 2AYTA 5ID2B 3APSA 1H4OA 1OC9B 1MDKA 4GWRA 1I5GA 2V41A 5KN3A 4ZBBA 3MAKA 1FHEA 1J08A 1O73A 2HRKB 3MDKA 4EDYA 3FMWA 5JWOB 3RDWA 1PKZA 4TR3A 2B1KA 3C8EA 1I9DA 3SWLA 3FEUA 2GSRA 1RQMA 3KCMA 3TJBA 3BCIA 1GTBA 1A8LA 4V2LA 4FH8A 4BVYA 1YEXA 2HXKA 1URMA 3HY2A 2YN1A 4AGSA 5GSSA 4Z2TA 5G5FA 1GTIA 2ES7A 4ZL7A 2L6DA 2MYGA 2OE3A 1B9XC 1OKDA 4IW9A 4I8BA 3FYGA 5IQYA 3F0IA 4MH3A 2GQLA 4TW5A 5A5KA 1V9WA 5DBQA 2R5GA 3DVXA 2YCDA 1YDKA 5A34A 2F51A 1O8WA 4E8HA 4YQUA 5C00A 2R37A 1OKTA 6GSYA 2RUFA 1M9BA 5L71A 1TI1A 5H5QA 3DYRA 3QMXA 2RIIA 1XWGA 3N5OA 1XW6A 2A2PA 2H19A 2DBCA 3ME7A 2BTOT 1FB6A 1QQ2A 5IMFA 4IGJA 4V2MA 1SENA 4A5PA 3GSTA 5HFIA 3APQA 1T1VA 2X64A 1GLPA 4XS1A 3VWUA 2L4CA 2ZNMA 3ZFBA 2VCWA 2GDRA 2PVQA 12GSA 1T4ZA 2XPEA 3DD3A 2RUEA 4WF5A 3JCML 5A4UA 17GSA 3FZ4A 4MA9A 5ELAA 2A2SA 5ENUA 2IFQB 3Q19A 5J41A 4F2IA 4ZB9A 2FGXA 2GT6A 3VFIA 1T8EB 3GFKA 1M99A 1MDIA 4PX1A 2YP6A 2LJRA 3HA9A 3Q18A 5LD0A 1B8XA 1EP7A 4V1Ag 4N3ZA 1UC7A 4TR0A 3H93A 2OACA 3FKFA 4ZL8A 4GSNA 2HQTA 4AF2A 2X8GA 1BG5A 3L9VA 2VCTA 2DSAA 3TGZA 2H1DA 2L57A 2IIYA 1SK1A 1ZMAA 2B6MA 3EWLA 2JL4A 3GMFA 1O6JA 5IMVA 1SK0A 1NM3A 2B5YA 1Z9HA 2N5FA 2HI7A 2H0HA 4TRXA 1YF0A 5IPGA 3KEBA 3IBHA 1F37A 3DEXA 4K2DA 4J2FA 1M2BA 2H01A 5B7CA 5GZZB 2DJ1A 2E0QA 4F0BA 4PNGA 2O8VB 3TJJA 2BJXA 3E9JB 1V58A 3LQ7A 4RQRA 3P2AA 3GV1A 1NSWA 2LNSA 2I3YA 4ECIA 3HXSA 4WBJA 1TJDA 3RPNA 4TR4A 4MPGA 2NBSA 2I1UA 5IMAA 3QAGA 2HRAA 5CRGA 1N25A 3UVHA 5A5HB 4F0CA 1VF2A 2VLUA 3IAS2 2N5AA 2H6ZA 2G2QA 1R4WA 4TOPA 1X9WB 4IHUA 2GSQA 1M2AA 1K3OA 3C73A 2MMOA 5KOXA 3GL3A 4IJ3A 1Y6EA 4Q5FA 1K0AA 1OE8A 1WE0A 5DCHA 5G31A 4JZQA 3DIEA 3P8WA 4KDUA 3HZ4A 5EVOA 2VL9A 4OD7A 1JZOA 2R6KA 1R7HA 5AIXA 5A1NB 1XVWA 3VI7A 2MMZA 4FIWA 3EC3A 1OAZA 3DGQA 4XS6A 5CRDA 4GQFA 4L8EA 4TVEA 2P5QA 4I2UA 3VPQA 3D21A 2IMDA 1SYRA 2HZEA 1AAZA 1K0NA 1MTCA 3EE2A 1TW9A 3EURA 3QFBC 4RI7A 2GZZA 3A5IA 2VAFA 1ZGNA 3D5JA 4K9ZA 3L9UA 1J9BA 1VF1A 1GUHA 5CO3A 1ZZYA 3GKNA 4XTSA 2R4VA 2O85A 3NOFA 1GNWA 2QC7A 2H0GA 4X4JA 5CNWA 1LBKA 1A2LA 4HZ4A 2H75A 4JR4A 4O32A 2OBIA 1NHYA 1V40A 1O8XA 4IVFA 3W8JA 5BRTA 2CAIA 4ID0A 2LRTA 3CWGA 3TU3B 2EIRA 4MH2A 4TR1A 2ON7A 4IQAA 1S3AA 5GSTA 2DLXA 4ZIJA 2EFHA 3R3EA 5G1LA 5DDLA 5CRHA 4NV2A 5G1KA 3GSSA 4OO5A 4LLRA 4EL1A 2A2RA 1N2AA 5DQSA 1KTEA 1ERUA 1JZDA 5CP1A 2FNOA 4WR5A 3WT2A 2PVOC 1E2YA 2C3TA 1B4PA 4ACSA 2B3SA 2P0GA 4G0KA 2E2GA 2NVLA 4MLYA 5DAKB 4YAPA 2XBIA 2JU5A 1WPIA 4AKHA 3GKXA 2WRTA 2L5LA 3ZYWA 1ZYPA 5ECNB 1ST9A 1Z6MA 4FYUA 1PGTA 3O3TA 4HJMA 4BL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUM A;  3QR6 A;  4I97 A;  2WB9 A;  1K0D A;  5F06 A;  1JLW A;  1G6Y A;  4ZBB A;  3MAK A;  1F3B A;  4GST A;  1FHE A;  1MD4 A;  4NHZ A;  3R2Q A;  2HRK B;  3MDK A;  4EDY A;  1PD2 1;  4K0N A;  1HNB A;  4MF7 A;  1PKZ A;  2PMT A;  1AXD A;  3IK7 A;  3PPU A;  1PL2 A;  2IMK A;  3C8E A;  6GSV A;  1EOG A;  4G10 A;  4GTU A;  3SWL A;  2GSR A;  3GTU B;  2AB6 A;  5ECL B;  16GS A;  1YY7 A;  3KM6 A;  6GST A;  1GTB A;  4IS0 A;  3FY7 A;  4MDC A;  4ECB A;  3F6F A;  2AHE A;  4ECJ A;  3M0F A;  4BVY A;  1TDI A;  3I69 A;  3HJO A;  4EC0 A;  2CA8 A;  5AIV A;  4YQV A;  4AGS A;  20GS A;  5ECP B;  3VUR A;  4IEL A;  4NHW A;  1BX9 A;  5GSS A;  5D9W A;  1OYJ A;  2R3X A;  2HNL A;  5G5F A;  4KH7 A;  3LG6 A;  2C3Q A;  1GTI A;  3Q74 A;  1JLV A;  1GTA A;  4RI6 A;  5AIS A;  4IW9 A;  4DEJ A;  1AQW A;  4YAV A;  2PGT A;  3FYG A;  5IQY A;  1VF3 A;  5ECS A;  3GH6 A;  18GS A;  1TU7 A;  5ECR B;  1XWK A;  4L5L A;  1B48 A;  4FQU A;  8GSS A;  5A5K A;  2HSN B;  2VCZ A;  2R5G A;  4PNF A;  4EXJ A;  4OFM A;  2YCD A;  4N0V A;  1YDK A;  5D9T A;  1FW1 A;  5EY6 A;  3NIV A;  4E8H A;  2F3M A;  5ECM B;  4GSS A;  4YQU A;  4PUR A;  4WR4 A;  4GF0 A;  1OKT A;  4HI7 A;  5F0G A;  1GNE A;  5ECK B;  6GSY A;  1M9B A;  2HSM B;  3UAP A;  5ECQ B;  2GST A;  2OA7 A;  3CSJ A;  3VWX A;  1XWG A;  4G0I A;  1PX6 A;  3N5O A;  1XW6 A;  4G19 A;  4BVX A;  4OFT A;  2FHE A;  3D0Z A;  3L0H A;  1GSQ A;  1AQV A;  3KMO A;  1U3I A;  3KXO A;  1OE7 A;  1KBN A;  5LCZ A;  1U87 A;  4IGJ A;  4IJI A;  5F8B A;  3GST A;  1PX7 A;  1GLQ A;  2WJU A;  1GSS A;  5AN1 A;  4E8E A;  3W8S A;  2X64 A;  13GS A;  1GLP A;  4O92 A;  4KE3 A;  1MD3 A;  3IE3 A;  3ZFB A;  2VCW A;  3ERG A;  3UBL A;  1HNC A;  2GDR A;  2PVQ A;  12GS A;  1BAY A;  3EIN A;  1GWC A;  1GSD A;  2WS2 A;  3DD3 A;  6GSU A;  3M3M A;  1ML6 A;  4MF6 A;  4IBP A;  4Q5R A;  5A4U A;  4ZXG A;  3ZMK A;  6GSX A;  17GS A;  3G7J A;  22GS A;  5FWG A;  5ELA A;  2A2S A;  5ECO B;  1EV4 A;  3Q19 A;  5F05 A;  5J41 A;  4ZB9 A;  3KTL A;  3FR3 A;  1Q4J A;  1EV9 A;  4KX4 A;  2DC5 A;  3H1N A;  5DAK A;  5DJL A;  2GSS A;  2D2Z A;  2CVD A;  3I6A A;  1G6W A;  3M1G A;  1IYI A;  4HOJ A;  3CRT A;  3P90 A;  1EEM A;  1M99 A;  2YV9 A;  3GUR A;  3RBT A;  4PX1 A;  2LJR A;  2V6K A;  3Q18 A;  5LD0 A;  1B8X A;  5DJM A;  1GTU A;  1JZR A;  5ECI B;  3UBK A;  3ISO A;  5D9V A;  4ZBA A;  3CBU A;  2VCV A;  4MK3 A;  1VF4 A;  1F2E A;  2OAC A;  2J9H A;  2CZ2 A;  4GSN A;  2C4J A;  2HQT A;  3HJM A;  2PER A;  3LXZ A;  2HRK A;  1DUG A;  4USS A;  1BG5 A;  1G7O A;  2VCT A;  5EL8 A;  1XW5 A;  2DSA A;  4ECC A;  3TGZ A;  4PQH A;  7GSS A;  3CSH A;  1K0B A;  2JL4 A;  3GTU A;  3WD6 A;  1Z9H A;  4MPF A;  2N5F A;  4KSM A;  3VK9 A;  4GCI A;  4YH2 A;  2GTU A;  3BBY A;  3CRU A;  1BYE A;  3VLN A;  1TU8 A;  2VCQ A;  3IBH A;  2WDU A;  5DAL B;  5A4W A;  4J2F A;  2VO4 A;  4KDX A;  3TOT A;  5B7C A;  4LMW A;  5FHI A;  4JED A;  5GZZ B;  4F0B A;  4PNG A;  3IK9 A;  2NTO A;  4OMV A;  4HJ2 A;  3CSI A;  3LQ7 A;  2PBJ A;  4KAE A;  4QQ7 A;  5HFK A;  4MF5 A;  2YV7 A;  3HKR A;  4ECI A;  3KMN A;  3FRC A;  1C72 A;  5FT3 A;  4MPG A;  4ISD A;  3O76 A;  3ERF A;  3LXT A;  3QAG A;  2HRA A;  4EE0 A;  4BL7 B;  3TOU A;  4O7H A;  4ZBD A;  1GSE A;  3UVH A;  4F0C A;  1VF2 A;  3GUS A;  1M0U A;  6GSS A;  1AQX A;  1K3L A;  2IL3 A;  3LYP A;  3QAW A;  4TOP A;  3N9J A;  4Q5N A;  2GSQ A;  1K3O A;  4CHS A;  1RK4 A;  2HSM A;  1F3A A;  1PA3 A;  4LMV A;  2CZ3 A;  4PGT A;  6GSW A;  4ZB8 A;  2IMI A;  1R5A A;  1Y6E A;  4PXO A;  4Q5F A;  5F07 A;  1K0A A;  1OE8 A;  4Q5Q A;  3WYW A;  4JZQ A;  4NAX A;  5D9X A;  4ZB6 A;  1V2A A;  3P8W A;  1GSF A;  4GLT A;  4KDU A;  10GS A;  5JCU A;  5EVO A;  2AAW A;  2R6K A;  4IQ1 A;  5AIX A;  3VI7 A;  3FR6 A;  1GSY A;  4BVY B;  3LSZ A;  3DGQ A;  2CAQ A;  2C3N A;  1K0O A;  3KJY A;  5A4V A;  5J5N A;  4G9H A;  4L8E A;  1PKW A;  3IC8 A;  3VPQ A;  3FR9 A;  2C80 A;  5DCG A;  5AGY A;  5ELG A;  1K0N A;  1MTC A;  3EE2 A;  1TW9 A;  1YKC A;  3ZML A;  4RI7 A;  4L5O A;  14GS A;  19GS A;  1ZGN A;  4JBB A;  1EOH A;  4OFN A;  1LJR A;  4EDZ A;  1VF1 A;  1GUH A;  1UA5 A;  2VCX A;  3LFL A;  3GX0 A;  4MZW A;  4PQI A;  2R4V A;  4K0G A;  1GNW A;  3VI5 A;  4KDY A;  9GSS A;  4KF9 A;  1K3Y A;  1LBK A;  4HZ4 A;  4G0L A;  1A0F A;  1K0C A;  1PMT A;  4MP4 A;  3UAR A;  1NHY A;  4HZ2 A;  1V40 A;  4IVF A;  4BVX B;  2VD1 A;  3LJR A;  4F03 A;  1M9A A;  2CAI A;  1U88 A;  4ID0 A;  1GSU A;  3U6V A;  1ZL9 A;  2ON7 A;  11GS A;  4IQA A;  2F8F A;  5GST A;  2ON5 A;  1PL1 A;  3M8N A;  1AW9 A;  3R3E A;  5DDL A;  3PGT A;  4KGI A;  4IKH A;  3GSS A;  3ZFL A;  3G7I A;  2A2R A;  1N2A A;  5DQS A;  5J4U A;  5BMU A;  3IR4 A;  2FNO A;  1YQ1 A;  4WR5 A;  4YQM A;  4PTS A;  5DAL A;  2C3T A;  1HNA A;  1B4P A;  4ACS A;  1YJ6 A;  3LYK A;  1PN9 A;  1HQO A;  5G5E A;  5JCW A;  3VPT A;  3PR8 A;  1K0M A;  5D73 A;  2GLR A;  2UZ8 A;  4G0K A;  1GUK A;  2VD0 A;  1E6B A;  4PUA A;  5DAK B;  2OAD A;  3QAV A;  4YAP A;  5ECH B;  1GUL A;  1USB A;  2C8U A;  2WRT A;  3AY8 A;  3F63 A;  3F6D A;  5ECN B;  1IYH A;  3O3T A;  1PGT A;  5KEJ A;  4BL7 A; 
#chains in the Genus database with same CATH topology
 5IOX A;  3ZIV A;  3TJF A;  1K0D A;  1JLW A;  4MJE A;  1G6Y A;  2R2J A;  4BIK A;  3R2Q A;  3IHQ A;  3ZZX A;  1O7U A;  3C7M A;  3TJG A;  4QL7 A;  4K0N A;  3K8N A;  1AXD A;  2DJ3 A;  3PPU A;  2QA2 A;  2WVX B;  1EOG A;  3E3E A;  4DSS A;  3UMA A;  2H76 A;  2H70 A;  2AB6 A;  2VLV A;  16GS A;  1YY7 A;  6GST A;  1XFL A;  4IS0 A;  3F9U A;  3FY7 A;  1EP8 A;  2H1G A;  2LV3 A;  4ECJ A;  1SVL A;  3D4M A;  3KGK A;  1TDI A;  3C71 A;  2YWN A;  2CA8 A;  4EVM A;  2WUL A;  4HU9 A;  4NHW A;  1BX9 A;  2R3X A;  2HNL A;  2CV4 A;  2GGT A;  3LG6 A;  2YWO A;  5KN0 A;  3MWH A;  5AIS A;  2JZS A;  1ZYQ B;  1Y1U A;  4YAV A;  2PGT A;  2F8A A;  1VF3 A;  4ZIL A;  3GA4 A;  3ZVJ D;  2PWJ A;  1TU7 A;  1XWK A;  4DSR A;  3J7Y k;  2PN8 A;  4PNF A;  5B8A A;  5JCG A;  1BED A;  5D9T A;  2R0C A;  2VL2 A;  3MYD A;  4NWY A;  5EY6 A;  2MBS A;  3NIV A;  2VL3 A;  3IAM 2;  1PQN A;  1GNE A;  5ECK B;  2HSM B;  3UAP A;  1A24 A;  2FLS A;  1EWX A;  4POM A;  2H66 A;  1PX6 A;  2CVK A;  2H1A A;  4G19 A;  4OFT A;  4AJ7 A;  2FWE A;  4KUN A;  2FCH A;  3KMO A;  1U3I A;  4HSC X;  3LOR A;  4DSQ A;  2QGV A;  3FK8 A;  3ZIT A;  3FZ5 A;  1B4Q A;  1BQ7 A;  1U87 A;  3TRQ A;  2YJ7 A;  5KN2 A;  5F8B A;  4L0U A;  1GLQ A;  1TXX A;  2FA4 A;  4D73 A;  3WGX A;  3ZRE A;  1A8Y A;  1B9Y C;  4O92 A;  4KE3 A;  1MD3 A;  3IE3 A;  3G9B A;  4BWS A;  5E59 A;  5HR3 A;  3ZTL A;  3BOA A;  3TJK A;  1GSD A;  3D6I A;  1G0T A;  6GSU A;  1V98 A;  3KTB A;  1ML6 A;  2L6C A;  2VOC A;  1EZK A;  4NMU A;  4MMM A;  5ECO B;  5F05 A;  5IMC A;  2V6O A;  2YZU A;  3IC4 A;  2KP1 A;  1SK2 A;  4KX4 A;  2L5O A;  3IXR A;  5GAP D;  3H1N A;  2D2Z A;  1MDJ A;  1W4V A;  4J56 E;  1IYI A;  3DRN A;  4J57 E;  4QMK A;  1EEM A;  3RBT A;  2YV9 A;  4BPY A;  1TK0 B;  5J4Y A;  1EEJ A;  4KCE A;  4OO4 A;  1V57 A;  5ECI B;  3UBK A;  5CRW A;  3UIW A;  5ID2 A;  5ABR A;  1OC9 A;  1FOV A;  4ZBA A;  2B1L A;  1S4B P;  1VF4 A;  1F2E A;  1EGO A;  5J4V A;  2WZS A;  2PER A;  3HMJ G;  1U3A A;  3LXZ A;  2HRK A;  3QCP A;  5COH A;  1XOA A;  3QPM A;  1OC3 A;  1M7T A;  2E7P A;  7GSS A;  3IV4 A;  4I5Q A;  2I9H A;  1NHO A;  1AUC A;  1XVQ A;  4KSM A;  1O85 A;  3BBY A;  3M9K A;  3VLN A;  1FAA A;  1MEK A;  3FZA A;  2VCQ A;  5IO0 A;  2WDU A;  5DAL B;  4TXO B;  3TOT A;  2P5R A;  3A3T A;  3ERW A;  2DMM A;  2LJA A;  2OJL A;  1RW1 A;  5H5S A;  2GZP A;  1Q98 A;  2DKI A;  2WCI A;  4GDF A;  1EGR A;  4N0Z A;  4CW9 A;  3ERF A;  3LXT A;  2HFD A;  2EIQ A;  2YNX A;  4O7H A;  1GSE A;  6GSS A;  1K3L A;  2IL3 A;  3LYP A;  2RM6 A;  3GN3 A;  2H8L A;  4WBR D;  4Q5N A;  1J0F A;  2O87 A;  1RK4 A;  2WFC A;  1PA3 A;  3KH9 A;  3TUE A;  2IMI A;  2H73 A;  4Q5Q A;  2HRF A;  5B6N A;  1VRS D;  2FUG 2;  5D9X A;  1V2A A;  1DSB A;  4Z2R A;  1GSF A;  4GLT A;  3TKS E;  2XC2 A;  4EKZ A;  4BA7 A;  2H6X A;  2EIO A;  1SU9 A;  1GSY A;  3LSZ A;  1ERT A;  4KSO A;  2OT3 A;  1NW2 A;  1XXU A;  2CAQ A;  2C3N A;  5A4V A;  3KJY A;  4MCU A;  3HVV A;  4G9H A;  3RAZ A;  2KHP A;  4XIH A;  4EIP A;  1PKW A;  2GZY A;  4JU5 A;  2K8S A;  2JZT A;  1YKC A;  3TB2 A;  1XPV A;  3ZML A;  2TRX A;  3F4T A;  4NXI A;  4L5O A;  3TDG A;  1TI3 A;  1Z7P A;  19GS A;  1JHB A;  4EIQ A;  4IN0 A;  2IFQ A;  4O5R A;  1A23 A;  1T3B A;  2QSI A;  3QDN A;  1SD8 A;  4PQI A;  2M72 A;  3QD9 A;  4K0G A;  1DE1 A;  2H72 A;  2LNT A;  4XS4 B;  4X43 A;  2N5B A;  4ILF A;  4G0L A;  1TXU A;  2B7J A;  1CQG A;  3UAR A;  2C1Y A;  4KB3 A;  2JSZ A;  3ZRD A;  4BVX B;  4F03 A;  3KZQ A;  3LGC A;  3UEM A;  1M9A A;  2LQQ A;  1ERV A;  1GSU A;  4ML6 A;  11GS A;  2M46 A;  2ZCT A;  3KH7 A;  3M8N A;  1AW9 A;  3C1R A;  2LTK A;  1HD2 A;  1S3C A;  4KGI A;  4IKH A;  3E0U A;  3SBC A;  3KP8 A;  3ZFL A;  2PU9 C;  4FO5 A;  3G7I A;  1XBS A;  3HJP A;  4JR6 A;  4POL A;  1X9S B;  2R0G A;  1YQ1 A;  1FOH A;  2XPD A;  4V1A p;  3TKR A;  4MAB A;  2YOI A;  3HYP A;  1FG4 A;  1XW9 A;  5G5E A;  1K0M A;  3BD2 A;  1XZO A;  3WGE A;  2B5E A;  2VD0 A;  4PUA A;  2MMA A;  2C8U A;  5J9B A;  3CYN A;  4RUV A;  2CX3 A;  4AKX B;  4KW6 A;  4WKW A;  2YPM A;  3QR6 A;  5A5H A;  2IMF A;  3H8Q A;  2WB9 A;  5F06 A;  2HE3 A;  3VWW A;  1S3D A;  1F3B A;  3GHA A;  4POB A;  1ERW A;  3F4R A;  1JZW A;  1FVJ A;  4XCS A;  2NPB A;  1PD2 1;  4ZB7 A;  1SL0 B;  4K2X A;  1A0R P;  4LA1 A;  4LL4 B;  1PL2 A;  2IMK A;  1SKS B;  4G10 A;  1T4Y A;  4AJ8 A;  3GTU B;  2HSH A;  5ECL B;  1TTZ A;  4N10 A;  3KM6 A;  4MDC A;  3MNG A;  3F6F A;  1LU4 A;  5A1N A;  2DML A;  3M0F A;  2C0D A;  3I69 A;  3HJO A;  4EO3 A;  2MMN A;  2K18 A;  5G2Z A;  4YQV A;  2F9S A;  2YWM A;  20GS A;  3L4N A;  5ECP B;  3VUR A;  5CRE A;  4KH7 A;  1WMJ A;  3EVI A;  2C3Q A;  1R5P A;  5J3R A;  1JLV A;  1U6T A;  1GTA A;  4CY6 A;  4X0X A;  1FO5 A;  3A2X A;  1AQW A;  1VGL A;  1THO A;  1UVZ A;  2LJK A;  5ECS A;  1TRU A;  3GH6 A;  5J47 A;  4HQS A;  4KA0 A;  1SJI A;  18GS A;  1S3R A;  1XOB A;  2VKZ G;  5KN1 A;  4FQU A;  8GSS A;  3LEF A;  2HSN B;  3CXG A;  4E68 A;  4EXJ A;  4EF0 A;  4PUR A;  2OBK A;  4WR4 A;  2HSY A;  4GF0 A;  2MBT A;  1F6M C;  4HI7 A;  5F0G A;  4KND A;  4MZC A;  2OA7 A;  2LQO A;  4G0I A;  4G01 A;  3EYT A;  2FHE A;  4P3Y B;  1G7E A;  1AQV A;  1F9M A;  3KXO A;  2L4Q A;  4IJI A;  1GH2 A;  2LRN A;  3I43 A;  1X0R A;  3WGD A;  2X49 A;  1PX7 A;  3U5R E;  2WJU A;  2C0E A;  2K9F A;  1GSS A;  4E8E A;  3W8S A;  5DVB A;  5GAN D;  3ERG A;  1HNC A;  3RHC A;  1YZX A;  4H86 A;  1GWC A;  4HDE A;  2H1L A;  2WS2 A;  2YJH A;  1SKR B;  4Q5R A;  2GQK A;  4ZXG A;  3ZMK A;  2V2G A;  3GNJ A;  2G0F A;  6GSX A;  3G7J A;  2BMX A;  1TRW A;  4O5Q A;  3FHK A;  1EV4 A;  3GKM A;  2EFD A;  3DKS A;  3KD0 A;  3FR3 A;  1Q4J A;  1EV9 A;  2DC5 A;  5DAK A;  4G2E A;  2CVB A;  2GSS A;  2CVD A;  3CRT A;  2LKU A;  2KP2 A;  2EFE A;  3P90 A;  2ZUP A;  3NZN A;  1SJZ A;  3GUR A;  1BG1 A;  4TN8 A;  2V6K A;  1M2D A;  3RPP A;  5CAX A;  5DJM A;  1XWC A;  1QGV A;  3ISO A;  5J40 A;  3EMP A;  5C04 A;  3CBU A;  5B8B A;  2X4A A;  2J9H A;  2CZ2 A;  2C4J A;  1QUW A;  3HJM A;  5E4W A;  4QL9 A;  1DUG A;  2RM5 A;  2AV4 A;  3EPT A;  1G7O A;  1DE2 A;  1Z5Y E;  4PQH A;  3CSH A;  2KUC A;  3GL5 A;  2WVX A;  1WJK A;  4JRR A;  2V32 A;  3VK9 A;  5H5R A;  5IM9 A;  3PH9 A;  1OC8 A;  2GTU A;  5BMU B;  3HCZ A;  2JAD A;  2C0F A;  1TU8 A;  2O36 A;  2VO4 A;  4LMW A;  1TK5 B;  4WEY A;  3IK9 A;  2NTO A;  1TKD B;  4HJ2 A;  3CSI A;  3IA1 A;  3L9S A;  2YWI A;  5HFK A;  2WW3 A;  3C1S A;  3HZ8 A;  4MF5 A;  2YV7 A;  2WW1 A;  2H74 A;  3FRC A;  1C72 A;  5FT3 A;  1ZYN A;  3LWA A;  3ME8 A;  3O6T A;  4HU7 A;  4OWY A;  5D96 A;  2IN3 A;  2IPA A;  4ML1 A;  4EE0 A;  3F3R A;  2WGR A;  3A2W A;  4XHM A;  4I2T A;  3HVX A;  3LW9 A;  3CMI A;  1WOU A;  2PUK C;  3GUS A;  3V1W A;  1AQX A;  1FB0 A;  4FYC A;  2I4A A;  3QAW A;  3N9J A;  3D4T A;  5LNK e;  2FD3 A;  2HLS A;  2HSM A;  1YF1 A;  4GQC A;  4LMV A;  2CZ3 A;  4PGT A;  6GSW A;  2AUV A;  1SL2 B;  2XBQ A;  3GX8 A;  4NAX A;  5HR0 A;  5B6M A;  4K7I A;  4V2N A;  1GP1 A;  10GS A;  4I6X A;  2AAW A;  3RHB A;  4IQ1 A;  3P7X A;  3FR6 A;  4BVY B;  1K0O A;  1Y25 A;  2FWF A;  4IP1 A;  2AJQ B;  3IC8 A;  4BWQ A;  2A4H A;  2VUP A;  4WXT A;  14GS A;  2DIY A;  3BJ5 A;  1QXH A;  4JBB A;  1EOH A;  2K8V A;  1LJR A;  2I81 A;  1X5E A;  5IO2 A;  1UA5 A;  2VCX A;  3LFL A;  3GX0 A;  4MZW A;  1YVL A;  5A34 B;  4GXZ A;  2CT6 A;  3UL3 A;  4KDY A;  9GSS A;  1K3Y A;  2VIM A;  1K0C A;  3ZVJ A;  4MP4 A;  3F3Q A;  4W66 A;  2B5X A;  4MJB A;  2VD1 A;  3LJR A;  4K7N A;  2X8C A;  1QMV A;  4K6X A;  1U88 A;  5KOW A;  3U6V A;  2F8F A;  3DXB A;  1PL1 A;  2HT9 A;  1SD9 A;  1UN2 A;  1A2J A;  3PGT A;  1ON4 A;  1M3I A;  1TOF A;  2C0G A;  2OE0 A;  2X8H A;  3F8U A;  2FWG A;  3CTF A;  3UOM A;  4YQM A;  4PUF C;  5DAL A;  4TXO A;  1ZYE A;  4LL1 B;  4AKI A;  2H6Y A;  3LYK A;  5HFG A;  2DKH A;  3HHV A;  3EMX A;  5JCW A;  3VPT A;  2HZF A;  3TKS C;  2GLR A;  3S9F A;  3IRA A;  1GUK A;  2IME A;  1Z3E A;  4O5U A;  1E6B A;  1SVM A;  4FYB A;  2OAD A;  5DQY A;  1SL1 B;  3QAV A;  1AC1 A;  5ECH B;  1GUL A;  4XRA A;  3QFA C;  3AY8 A;  3F63 A;  4GRF A;  4PI2 C;  1IYH A;  3KIJ A;  1ACV A;  5KEJ A;  1PFO A;  1GUM A;  1ZOF A;  3CTG A;  4TKY A;  4I97 A;  3IOS A;  3US3 A;  4GST A;  2V1M A;  1MD4 A;  4NHZ A;  3HVS A;  3QOU A;  4OCF A;  4NPB A;  2JAC A;  1A2M A;  3TRP A;  2M80 A;  1PRX A;  2DJ0 A;  1Z7R A;  4ZL9 A;  1HNB A;  4MF7 A;  2PMT A;  4IP6 A;  3IK7 A;  1YKA A;  6GSV A;  4ULX A;  4GTU A;  2WZ9 A;  2HYX A;  4ECB A;  2AHE A;  5IIZ A;  2JSY A;  4EC0 A;  5AIV A;  4Z7X A;  4N11 A;  4IEL A;  3WT1 A;  5D9W A;  4CY8 A;  1OYJ A;  1XWB A;  1ZCP A;  3Q74 A;  2EC4 A;  4RI6 A;  2H0I A;  2O7K A;  5CYY A;  4DEJ A;  2LRC A;  4Z2U A;  1TRV A;  5ECR B;  2YAN A;  3TCO A;  3OR5 A;  4L5L A;  2DJJ A;  3IHG A;  1B48 A;  2VCZ A;  4OFM A;  4N0V A;  1FW1 A;  3IPZ A;  3TRX A;  2F3M A;  5ECM B;  4GSS A;  2H30 A;  4XS4 A;  5ECQ B;  2GST A;  3D22 A;  3CSJ A;  3VWX A;  4K5S A;  3TKS A;  3F4S A;  4BVX A;  2GQM A;  3D0Z A;  3L0H A;  1BF5 A;  1GSQ A;  1YEW C;  1OE7 A;  1KBN A;  5LCZ A;  2LEG A;  3A5W A;  3EU3 A;  4EUY A;  1Z6N A;  2FWH A;  5AN1 A;  3L78 A;  4HEA 2;  13GS A;  2FY6 A;  2VM2 A;  1X5C A;  3UBL A;  1BAY A;  2HZE B;  3EIN A;  4YKG A;  2QKE A;  3M3M A;  3APO A;  4MF6 A;  4MNN A;  4IBP A;  2DIZ A;  2P31 A;  2LUS A;  1THX A;  2OKA A;  22GS A;  5FWG A;  1YEP A;  4X1U A;  5D93 A;  2FA8 A;  1T7P B;  5IPH A;  4HQZ A;  1X9M B;  3H79 A;  3KTL A;  3KP9 A;  1ABA A;  5DJL A;  3I6A A;  2HRN A;  1PN0 A;  1TP9 A;  1G6W A;  3M1G A;  4HOJ A;  1SYX A;  2NDO A;  4K1F A;  2LST A;  3GIX A;  2UV8 G;  4HS1 A;  4POK A;  1GTU A;  1JZR A;  2DJK A;  1AIU A;  4XRD A;  5D9V A;  4WF4 A;  2VCV A;  3IDV A;  4MK3 A;  4TR1 B;  1ILO A;  2ALB A;  2OE1 A;  4USS A;  2VLT A;  5EL8 A;  1XW5 A;  4ECC A;  5IMD A;  1DBY A;  1K0B A;  4HUA A;  3ZIJ A;  4YKF A;  2H71 A;  3GTU A;  3WD6 A;  4MPF A;  4CDO A;  2H1B A;  4GCI A;  4YH2 A;  1PSQ A;  3CRU A;  1BYE A;  1FVK A;  4N30 A;  5G30 A;  3HD5 A;  4L0W A;  5A4W A;  1T00 A;  2L59 A;  1SKW B;  4KDX A;  2R0P A;  5FHI A;  4MZB A;  4JED A;  5JWQ B;  1GRX A;  4OMV A;  2GS3 A;  3M9J A;  2PBJ A;  4KAE A;  4QQ7 A;  1HYU A;  3HKR A;  3KMN A;  2LS5 A;  1N8J A;  5J9C A;  2JZR A;  2K6V A;  2TRC P;  4ISD A;  5IMZ A;  1WP0 A;  2CX4 A;  3O76 A;  2O5V A;  1SJ6 A;  1WIK A;  2J23 A;  4BL7 B;  3TOU A;  2A4V A;  4ZBD A;  5IOW A;  2HSN A;  2GVP A;  2VL2 C;  3CHX C;  1QK8 A;  1M0U A;  2EFC A;  3GYK A;  3TKP A;  3MSZ A;  4CHS A;  2MZC A;  4MJC A;  1F3A A;  2B7K A;  4ZB8 A;  3GH9 A;  1R5A A;  4JE1 A;  4PXO A;  5F07 A;  3WYW A;  4PHZ C;  4PQ1 A;  4F9Z A;  1JFU A;  4ZB6 A;  4DSS B;  5HR1 A;  5JCU A;  2QA1 A;  5INY A;  4AI6 A;  2O89 A;  5HQP A;  2DJ2 A;  2VM1 A;  5J5N A;  4AJ6 A;  4WET A;  1KNG A;  3BCK A;  4ICY A;  3MIX A;  5EPF A;  4TXV A;  3GRX A;  3FR9 A;  5D8I A;  2C80 A;  5DCG A;  1KEB A;  5AGY A;  2YZH A;  5ELG A;  1TRS A;  3PIN A;  4KCA A;  3UVT A;  2O3E A;  3A2V A;  4OCE A;  2WVZ A;  4OFN A;  1SVO A;  4EDZ A;  3UJ1 A;  3DML A;  1GL8 A;  3FW2 A;  3W6G A;  2TIR A;  4DVC A;  1WRY A;  3VWV A;  3Q6O A;  3VI5 A;  4K5R A;  4KF9 A;  1XIY A;  1XCC A;  1A0F A;  2RLI A;  1PMT A;  3I9V 2;  4PI0 C;  4HZ2 A;  4NV5 A;  2PPT A;  3ZLP A;  1CQH A;  2KOK A;  2E2M A;  2X99 A;  1BJX A;  1ZL9 A;  4K7O A;  4AKG A;  2ON5 A;  4D73 B;  2CQ9 A;  2Z9S A;  3FZ9 A;  4MJA A;  3GKK A;  1R26 A;  3ED3 A;  2XHF A;  3H4K A;  1O81 A;  4FXY P;  5J4U A;  5BMU A;  3IR4 A;  3ZL5 A;  4PTS A;  3DVW A;  3EU4 A;  1W89 A;  4RQX A;  1HNA A;  1WWJ A;  4K8M A;  1YJ6 A;  3TKQ A;  1PN9 A;  1HQO A;  3J7Y b;  1OVN A;  3PR8 A;  1X5D A;  3G7Y A;  5D73 A;  4F82 A;  2UZ8 A;  2REM A;  1TK8 B;  3RGB C;  1XWA A;  2IWT A;  1H75 A;  5HR2 A;  1USB A;  3DWV A;  3HDC A;  2GT5 A;  1QFN A;  5JWR B;  3F6D A;  2KLX A;  2IJY A;  2AYT A;  5ID2 B;  3APS A;  1H4O A;  1OC9 B;  1MDK A;  4GWR A;  1I5G A;  2V41 A;  5KN3 A;  4ZBB A;  1M3J A;  3MAK A;  1FHE A;  1J08 A;  1O73 A;  2HRK B;  3MDK A;  4EDY A;  3FMW A;  5JWO B;  3RDW A;  1PKZ A;  4TR3 A;  2B1K A;  3C8E A;  1I9D A;  3SWL A;  3FEU A;  2GSR A;  1RQM A;  3KCM A;  2WW0 A;  3TJB A;  3BCI A;  1GTB A;  3RFR C;  1A8L A;  4V2L A;  4FH8 A;  4BVY A;  1YEX A;  2HXK A;  1URM A;  3HY2 A;  2YN1 A;  4AGS A;  5GSS A;  4Z2T A;  5G5F A;  1GTI A;  2ES7 A;  4ZL7 A;  2L6D A;  2MYG A;  2OE3 A;  1B9X C;  1OKD A;  4IW9 A;  4I8B A;  3FYG A;  5IQY A;  3F0I A;  4MH3 A;  2GQL A;  4TW5 A;  5A5K A;  1V9W A;  5DBQ A;  2R5G A;  3DVX A;  2YCD A;  1YDK A;  5A34 A;  2F51 A;  1O8W A;  4E8H A;  2WW2 A;  4YQU A;  5C00 A;  2R37 A;  1OKT A;  6GSY A;  2RUF A;  1M9B A;  5L71 A;  1TI1 A;  5H5Q A;  3DYR A;  3QMX A;  2RII A;  1XWG A;  1XG8 A;  3N5O A;  1XW6 A;  2A2P A;  2H19 A;  2DBC A;  3ME7 A;  2BTO T;  1FB6 A;  1QQ2 A;  5IMF A;  4IGJ A;  4V2M A;  1SEN A;  4A5P A;  3GST A;  5HFI A;  3APQ A;  1T1V A;  2X64 A;  1GLP A;  4XS1 A;  3VWU A;  2L4C A;  2ZNM A;  3ZFB A;  2VCW A;  2GDR A;  2PVQ A;  12GS A;  1T4Z A;  2XPE A;  3DD3 A;  2RUE A;  4WF5 A;  3JCM L;  5A4U A;  17GS A;  3FZ4 A;  4MA9 A;  5ELA A;  2A2S A;  5ENU A;  2IFQ B;  3Q19 A;  5J41 A;  4F2I A;  4ZB9 A;  2FGX A;  2GT6 A;  3VFI A;  1T8E B;  3GFK A;  1M99 A;  1MDI A;  4PX1 A;  2YP6 A;  2LJR A;  3HA9 A;  3HVN A;  3Q18 A;  5LD0 A;  1B8X A;  1EP7 A;  2WVY A;  4V1A g;  4N3Z A;  3CQF A;  1UC7 A;  4TR0 A;  3H93 A;  2OAC A;  3FKF A;  4ZL8 A;  4GSN A;  2HQT A;  4AF2 A;  2X8G A;  1BG5 A;  3L9V A;  2VCT A;  2DSA A;  3TGZ A;  2H1D A;  2L57 A;  2IIY A;  1SK1 A;  1ZMA A;  2B6M A;  3EWL A;  2JL4 A;  3GMF A;  1O6J A;  5IMV A;  1SK0 A;  1NM3 A;  2B5Y A;  1Z9H A;  2N5F A;  2HI7 A;  2H0H A;  4TRX A;  1YF0 A;  5IPG A;  3KEB A;  3IBH A;  1F37 A;  3DEX A;  4K2D A;  4J2F A;  1M2B A;  2H01 A;  5B7C A;  5GZZ B;  2DJ1 A;  2E0Q A;  4F0B A;  4PNG A;  2O8V B;  3TJJ A;  2BJX A;  3E9J B;  1V58 A;  3LQ7 A;  4RQR A;  3P2A A;  3GV1 A;  1NSW A;  2LNS A;  2I3Y A;  4ECI A;  3HXS A;  4WBJ A;  1TJD A;  3RPN A;  4TR4 A;  4MPG A;  2NBS A;  2I1U A;  5IMA A;  3QAG A;  2HRA A;  5CRG A;  1N25 A;  3UVH A;  5A5H B;  4F0C A;  1VF2 A;  2VLU A;  3IAS 2;  2N5A A;  2H6Z A;  2G2Q A;  1R4W A;  4TOP A;  1X9W B;  4IHU A;  2GSQ A;  1M2A A;  1K3O A;  3C73 A;  2MMO A;  5KOX A;  3GL3 A;  4IJ3 A;  1Y6E A;  4Q5F A;  1K0A A;  1OE8 A;  1WE0 A;  5DCH A;  5G31 A;  4JZQ A;  3DIE A;  3P8W A;  4KDU A;  3HZ4 A;  5EVO A;  2VL9 A;  4OD7 A;  1JZO A;  2R6K A;  1R7H A;  5AIX A;  5A1N B;  1XVW A;  3VI7 A;  2MMZ A;  4FIW A;  3EC3 A;  1OAZ A;  3DGQ A;  4XS6 A;  5CRD A;  4GQF A;  1I1I P;  4L8E A;  4TVE A;  2P5Q A;  4I2U A;  3VPQ A;  3D21 A;  2IMD A;  1SYR A;  2HZE A;  1AAZ A;  1K0N A;  1MTC A;  3EE2 A;  1TW9 A;  3EUR A;  3QFB C;  4RI7 A;  2GZZ A;  3A5I A;  2VAF A;  1ZGN A;  3D5J A;  4K9Z A;  3L9U A;  1J9B A;  1VF1 A;  1GUH A;  5CO3 A;  1ZZY A;  3GKN A;  4XTS A;  2R4V A;  2O85 A;  3NOF A;  1GNW A;  2QC7 A;  2H0G A;  4X4J A;  5CNW A;  1LBK A;  1A2L A;  4HZ4 A;  2H75 A;  4JR4 A;  4O32 A;  2OBI A;  1NHY A;  1V40 A;  1O8X A;  4IVF A;  3W8J A;  5BRT A;  2CAI A;  4ID0 A;  2LRT A;  3CWG A;  3TU3 B;  2EIR A;  4MH2 A;  4TR1 A;  2ON7 A;  4IQA A;  1S3A A;  5GST A;  2DLX A;  4ZIJ A;  2EFH A;  3R3E A;  5G1L A;  5DDL A;  5CRH A;  4NV2 A;  5G1K A;  3GSS A;  4OO5 A;  4LLR A;  4EL1 A;  2A2R A;  1N2A A;  5DQS A;  1KTE A;  1ERU A;  1JZD A;  5CP1 A;  2FNO A;  4WR5 A;  3WT2 A;  2PVO C;  1E2Y A;  2C3T A;  1B4P A;  4ACS A;  2B3S A;  2P0G A;  4G0K A;  2E2G A;  2NVL A;  4MLY A;  5DAK B;  4YAP A;  2XBI A;  2JU5 A;  1WPI A;  4AKH A;  3GKX A;  2WRT A;  2L5L A;  3ZYW A;  1ZYP A;  5ECN B;  1ST9 A;  1Z6M A;  4FYU A;  1PGT A;  3O3T A;  4HJM A;  4BL7 A; 
#chains in the Genus database with same CATH homology
 5IOX A;  3ZIV A;  3TJF A;  1K0D A;  1JLW A;  4MJE A;  1G6Y A;  2R2J A;  3R2Q A;  3IHQ A;  3ZZX A;  1O7U A;  3C7M A;  3TJG A;  4QL7 A;  4K0N A;  3K8N A;  1AXD A;  2DJ3 A;  3PPU A;  2QA2 A;  1EOG A;  3E3E A;  4DSS A;  3UMA A;  2H76 A;  2H70 A;  2AB6 A;  2VLV A;  16GS A;  1YY7 A;  6GST A;  1XFL A;  4IS0 A;  3F9U A;  3FY7 A;  1EP8 A;  2H1G A;  2LV3 A;  4ECJ A;  1SVL A;  3D4M A;  3KGK A;  1TDI A;  3C71 A;  2YWN A;  2CA8 A;  4EVM A;  2WUL A;  4HU9 A;  4NHW A;  1BX9 A;  2R3X A;  2HNL A;  2CV4 A;  2GGT A;  3LG6 A;  2YWO A;  5KN0 A;  3MWH A;  5AIS A;  2JZS A;  1ZYQ B;  1Y1U A;  4YAV A;  2PGT A;  2F8A A;  1VF3 A;  4ZIL A;  3GA4 A;  3ZVJ D;  2PWJ A;  1TU7 A;  1XWK A;  4DSR A;  3J7Y k;  2PN8 A;  4PNF A;  5B8A A;  5JCG A;  1BED A;  5D9T A;  2R0C A;  2VL2 A;  3MYD A;  4NWY A;  5EY6 A;  2MBS A;  3NIV A;  2VL3 A;  3IAM 2;  1PQN A;  1GNE A;  5ECK B;  2HSM B;  3UAP A;  1A24 A;  2FLS A;  1EWX A;  4POM A;  2H66 A;  1PX6 A;  2CVK A;  2H1A A;  4G19 A;  4OFT A;  4AJ7 A;  2FWE A;  4KUN A;  2FCH A;  3KMO A;  1U3I A;  3LOR A;  4DSQ A;  2QGV A;  3FK8 A;  3ZIT A;  3FZ5 A;  1B4Q A;  1BQ7 A;  1U87 A;  3TRQ A;  2YJ7 A;  5KN2 A;  5F8B A;  4L0U A;  1GLQ A;  1TXX A;  2FA4 A;  4D73 A;  3WGX A;  3ZRE A;  1A8Y A;  1B9Y C;  4O92 A;  4KE3 A;  1MD3 A;  3IE3 A;  3G9B A;  4BWS A;  5E59 A;  5HR3 A;  3ZTL A;  3BOA A;  3TJK A;  1GSD A;  3D6I A;  1G0T A;  6GSU A;  1V98 A;  3KTB A;  1ML6 A;  2L6C A;  2VOC A;  1EZK A;  4NMU A;  4MMM A;  5ECO B;  5F05 A;  5IMC A;  2V6O A;  2YZU A;  3IC4 A;  2KP1 A;  1SK2 A;  4KX4 A;  2L5O A;  3IXR A;  5GAP D;  3H1N A;  2D2Z A;  1MDJ A;  1W4V A;  4J56 E;  1IYI A;  3DRN A;  4J57 E;  4QMK A;  1EEM A;  3RBT A;  2YV9 A;  4BPY A;  1TK0 B;  5J4Y A;  1EEJ A;  4KCE A;  4OO4 A;  1V57 A;  5ECI B;  3UBK A;  5CRW A;  3UIW A;  5ID2 A;  5ABR A;  1OC9 A;  1FOV A;  4ZBA A;  2B1L A;  1VF4 A;  1F2E A;  1EGO A;  5J4V A;  2PER A;  3HMJ G;  1U3A A;  3LXZ A;  2HRK A;  3QCP A;  5COH A;  1XOA A;  3QPM A;  1OC3 A;  1M7T A;  2E7P A;  7GSS A;  3IV4 A;  4I5Q A;  2I9H A;  1NHO A;  1AUC A;  1XVQ A;  4KSM A;  1O85 A;  3BBY A;  3M9K A;  3VLN A;  1FAA A;  1MEK A;  3FZA A;  2VCQ A;  5IO0 A;  2WDU A;  5DAL B;  4TXO B;  3TOT A;  2P5R A;  3A3T A;  3ERW A;  2DMM A;  2LJA A;  2OJL A;  1RW1 A;  5H5S A;  2GZP A;  1Q98 A;  2DKI A;  2WCI A;  4GDF A;  1EGR A;  4N0Z A;  4CW9 A;  3ERF A;  3LXT A;  2HFD A;  2EIQ A;  2YNX A;  4O7H A;  1GSE A;  6GSS A;  1K3L A;  3LYP A;  2IL3 A;  2RM6 A;  3GN3 A;  2H8L A;  4WBR D;  4Q5N A;  1J0F A;  2O87 A;  1RK4 A;  2WFC A;  1PA3 A;  3KH9 A;  3TUE A;  2IMI A;  2H73 A;  4Q5Q A;  2HRF A;  5B6N A;  1VRS D;  2FUG 2;  5D9X A;  1V2A A;  1DSB A;  4Z2R A;  1GSF A;  4GLT A;  3TKS E;  2XC2 A;  4EKZ A;  4BA7 A;  2H6X A;  2EIO A;  1SU9 A;  1GSY A;  3LSZ A;  1ERT A;  4KSO A;  2OT3 A;  1NW2 A;  1XXU A;  2CAQ A;  2C3N A;  5A4V A;  3KJY A;  4MCU A;  3HVV A;  4G9H A;  3RAZ A;  2KHP A;  4XIH A;  4EIP A;  1PKW A;  2GZY A;  4JU5 A;  2K8S A;  2JZT A;  1YKC A;  3TB2 A;  1XPV A;  3ZML A;  2TRX A;  3F4T A;  4NXI A;  4L5O A;  3TDG A;  1TI3 A;  1Z7P A;  19GS A;  1JHB A;  4EIQ A;  4IN0 A;  2IFQ A;  4O5R A;  1A23 A;  1T3B A;  2QSI A;  3QDN A;  1SD8 A;  4PQI A;  2M72 A;  3QD9 A;  4K0G A;  1DE1 A;  2H72 A;  2LNT A;  4XS4 B;  4X43 A;  2N5B A;  4ILF A;  4G0L A;  1TXU A;  2B7J A;  1CQG A;  3UAR A;  2C1Y A;  4KB3 A;  2JSZ A;  3ZRD A;  4BVX B;  4F03 A;  3KZQ A;  3LGC A;  3UEM A;  1M9A A;  2LQQ A;  1ERV A;  1GSU A;  4ML6 A;  11GS A;  2M46 A;  2ZCT A;  3KH7 A;  3M8N A;  1AW9 A;  3C1R A;  2LTK A;  1HD2 A;  1S3C A;  4KGI A;  4IKH A;  3E0U A;  3SBC A;  3KP8 A;  3ZFL A;  2PU9 C;  4FO5 A;  3G7I A;  1XBS A;  3HJP A;  4JR6 A;  4POL A;  1X9S B;  2R0G A;  1YQ1 A;  1FOH A;  2XPD A;  4V1A p;  3TKR A;  4MAB A;  2YOI A;  3HYP A;  1FG4 A;  1XW9 A;  5G5E A;  1K0M A;  3BD2 A;  1XZO A;  3WGE A;  2B5E A;  2VD0 A;  4PUA A;  2MMA A;  2C8U A;  5J9B A;  3CYN A;  4RUV A;  2CX3 A;  4AKX B;  4KW6 A;  4WKW A;  2YPM A;  3QR6 A;  5A5H A;  2IMF A;  3H8Q A;  2WB9 A;  5F06 A;  2HE3 A;  3VWW A;  1S3D A;  1F3B A;  3GHA A;  4POB A;  1ERW A;  3F4R A;  1JZW A;  1FVJ A;  4XCS A;  2NPB A;  1PD2 1;  4ZB7 A;  1SL0 B;  4K2X A;  1A0R P;  4LA1 A;  4LL4 B;  1PL2 A;  2IMK A;  1SKS B;  4G10 A;  1T4Y A;  4AJ8 A;  3GTU B;  2HSH A;  5ECL B;  1TTZ A;  4N10 A;  3KM6 A;  4MDC A;  3MNG A;  3F6F A;  1LU4 A;  5A1N A;  2DML A;  3M0F A;  2C0D A;  3I69 A;  3HJO A;  4EO3 A;  2MMN A;  2K18 A;  5G2Z A;  4YQV A;  2F9S A;  2YWM A;  20GS A;  3L4N A;  5ECP B;  3VUR A;  5CRE A;  4KH7 A;  1WMJ A;  3EVI A;  2C3Q A;  1R5P A;  5J3R A;  1JLV A;  1U6T A;  1GTA A;  4CY6 A;  4X0X A;  1FO5 A;  3A2X A;  1AQW A;  1VGL A;  1THO A;  1UVZ A;  2LJK A;  5ECS A;  1TRU A;  3GH6 A;  5J47 A;  4HQS A;  4KA0 A;  1SJI A;  18GS A;  1XOB A;  2VKZ G;  5KN1 A;  4FQU A;  8GSS A;  3LEF A;  2HSN B;  3CXG A;  4E68 A;  4EXJ A;  4EF0 A;  4PUR A;  2OBK A;  4WR4 A;  2HSY A;  4GF0 A;  2MBT A;  1F6M C;  4HI7 A;  5F0G A;  4KND A;  4MZC A;  2OA7 A;  2LQO A;  4G0I A;  4G01 A;  3EYT A;  2FHE A;  4P3Y B;  1G7E A;  1AQV A;  1F9M A;  3KXO A;  2L4Q A;  4IJI A;  1GH2 A;  2LRN A;  3I43 A;  1X0R A;  3WGD A;  2X49 A;  1PX7 A;  3U5R E;  2WJU A;  2C0E A;  2K9F A;  1GSS A;  4E8E A;  3W8S A;  5DVB A;  5GAN D;  3ERG A;  1HNC A;  3RHC A;  1YZX A;  4H86 A;  1GWC A;  4HDE A;  2H1L A;  2WS2 A;  2YJH A;  1SKR B;  4Q5R A;  2GQK A;  4ZXG A;  3ZMK A;  2V2G A;  3GNJ A;  2G0F A;  6GSX A;  3G7J A;  2BMX A;  1TRW A;  4O5Q A;  3FHK A;  1EV4 A;  3GKM A;  2EFD A;  3DKS A;  3KD0 A;  3FR3 A;  1Q4J A;  1EV9 A;  2DC5 A;  5DAK A;  4G2E A;  2CVB A;  2GSS A;  2CVD A;  3CRT A;  2LKU A;  2KP2 A;  2EFE A;  3P90 A;  2ZUP A;  3NZN A;  1SJZ A;  3GUR A;  1BG1 A;  4TN8 A;  2V6K A;  1M2D A;  3RPP A;  5CAX A;  5DJM A;  1XWC A;  1QGV A;  3ISO A;  5J40 A;  3EMP A;  5C04 A;  3CBU A;  5B8B A;  2X4A A;  2J9H A;  2CZ2 A;  2C4J A;  1QUW A;  3HJM A;  5E4W A;  4QL9 A;  1DUG A;  2RM5 A;  2AV4 A;  3EPT A;  1G7O A;  1DE2 A;  1Z5Y E;  4PQH A;  3CSH A;  2KUC A;  3GL5 A;  1WJK A;  4JRR A;  2V32 A;  3VK9 A;  5H5R A;  5IM9 A;  3PH9 A;  1OC8 A;  2GTU A;  5BMU B;  3HCZ A;  2JAD A;  2C0F A;  1TU8 A;  2VO4 A;  4LMW A;  1TK5 B;  4WEY A;  3IK9 A;  2NTO A;  1TKD B;  4HJ2 A;  3CSI A;  3IA1 A;  3L9S A;  2YWI A;  5HFK A;  3C1S A;  3HZ8 A;  4MF5 A;  2YV7 A;  2H74 A;  3FRC A;  1C72 A;  5FT3 A;  1ZYN A;  3LWA A;  3ME8 A;  3O6T A;  4HU7 A;  4OWY A;  5D96 A;  2IN3 A;  2IPA A;  4ML1 A;  4EE0 A;  3F3R A;  2WGR A;  3A2W A;  4XHM A;  4I2T A;  3HVX A;  3LW9 A;  3CMI A;  1WOU A;  2PUK C;  3GUS A;  3V1W A;  1AQX A;  1FB0 A;  4FYC A;  2I4A A;  3QAW A;  3N9J A;  3D4T A;  5LNK e;  2FD3 A;  2HLS A;  2HSM A;  1YF1 A;  4GQC A;  4LMV A;  2CZ3 A;  4PGT A;  6GSW A;  2AUV A;  1SL2 B;  2XBQ A;  3GX8 A;  4NAX A;  5HR0 A;  5B6M A;  4K7I A;  4V2N A;  1GP1 A;  10GS A;  4I6X A;  2AAW A;  3RHB A;  4IQ1 A;  3P7X A;  3FR6 A;  4BVY B;  1K0O A;  1Y25 A;  2FWF A;  4IP1 A;  2AJQ B;  3IC8 A;  4BWQ A;  2A4H A;  2VUP A;  4WXT A;  14GS A;  2DIY A;  3BJ5 A;  1QXH A;  4JBB A;  1EOH A;  2K8V A;  1LJR A;  2I81 A;  1X5E A;  5IO2 A;  1UA5 A;  2VCX A;  3LFL A;  3GX0 A;  4MZW A;  1YVL A;  5A34 B;  4GXZ A;  2CT6 A;  3UL3 A;  4KDY A;  9GSS A;  1K3Y A;  2VIM A;  1K0C A;  3ZVJ A;  4MP4 A;  3F3Q A;  4W66 A;  2B5X A;  4MJB A;  2VD1 A;  3LJR A;  4K7N A;  2X8C A;  1QMV A;  4K6X A;  1U88 A;  5KOW A;  3U6V A;  2F8F A;  3DXB A;  1PL1 A;  2HT9 A;  1SD9 A;  1UN2 A;  1A2J A;  3PGT A;  1ON4 A;  1TOF A;  2C0G A;  2OE0 A;  2X8H A;  3F8U A;  2FWG A;  3CTF A;  3UOM A;  4YQM A;  4PUF C;  5DAL A;  4TXO A;  1ZYE A;  4LL1 B;  4AKI A;  2H6Y A;  3LYK A;  5HFG A;  2DKH A;  3HHV A;  3EMX A;  5JCW A;  3VPT A;  2HZF A;  3TKS C;  2GLR A;  3S9F A;  3IRA A;  1GUK A;  2IME A;  1Z3E A;  4O5U A;  1E6B A;  1SVM A;  4FYB A;  2OAD A;  5DQY A;  1SL1 B;  3QAV A;  1AC1 A;  5ECH B;  1GUL A;  4XRA A;  3QFA C;  3AY8 A;  3F63 A;  4GRF A;  1IYH A;  3KIJ A;  1ACV A;  5KEJ A;  1GUM A;  1ZOF A;  3CTG A;  4TKY A;  4I97 A;  3IOS A;  3US3 A;  4GST A;  2V1M A;  1MD4 A;  4NHZ A;  3HVS A;  3QOU A;  4OCF A;  4NPB A;  2JAC A;  1A2M A;  3TRP A;  2M80 A;  1PRX A;  2DJ0 A;  1Z7R A;  4ZL9 A;  1HNB A;  4MF7 A;  2PMT A;  4IP6 A;  3IK7 A;  1YKA A;  6GSV A;  4ULX A;  4GTU A;  2WZ9 A;  2HYX A;  4ECB A;  2AHE A;  5IIZ A;  2JSY A;  4EC0 A;  5AIV A;  4Z7X A;  4N11 A;  4IEL A;  3WT1 A;  5D9W A;  4CY8 A;  1OYJ A;  1XWB A;  1ZCP A;  3Q74 A;  2EC4 A;  4RI6 A;  2H0I A;  2O7K A;  5CYY A;  4DEJ A;  2LRC A;  4Z2U A;  1TRV A;  5ECR B;  2YAN A;  3TCO A;  3OR5 A;  4L5L A;  2DJJ A;  3IHG A;  1B48 A;  2VCZ A;  4OFM A;  4N0V A;  1FW1 A;  3IPZ A;  3TRX A;  2F3M A;  5ECM B;  4GSS A;  2H30 A;  4XS4 A;  5ECQ B;  2GST A;  3D22 A;  3CSJ A;  3VWX A;  4K5S A;  3TKS A;  3F4S A;  4BVX A;  2GQM A;  3D0Z A;  3L0H A;  1BF5 A;  1GSQ A;  1OE7 A;  1KBN A;  5LCZ A;  2LEG A;  3A5W A;  3EU3 A;  4EUY A;  1Z6N A;  2FWH A;  5AN1 A;  3L78 A;  4HEA 2;  13GS A;  2FY6 A;  2VM2 A;  1X5C A;  3UBL A;  1BAY A;  2HZE B;  3EIN A;  4YKG A;  2QKE A;  3M3M A;  3APO A;  4MF6 A;  4MNN A;  4IBP A;  2DIZ A;  2P31 A;  2LUS A;  1THX A;  2OKA A;  22GS A;  5FWG A;  1YEP A;  4X1U A;  5D93 A;  2FA8 A;  1T7P B;  5IPH A;  4HQZ A;  1X9M B;  3H79 A;  3KTL A;  3KP9 A;  1ABA A;  5DJL A;  3I6A A;  2HRN A;  1PN0 A;  1TP9 A;  1G6W A;  3M1G A;  4HOJ A;  1SYX A;  2NDO A;  4K1F A;  2LST A;  3GIX A;  2UV8 G;  4HS1 A;  4POK A;  1GTU A;  1JZR A;  2DJK A;  1AIU A;  4XRD A;  5D9V A;  4WF4 A;  2VCV A;  3IDV A;  4MK3 A;  4TR1 B;  1ILO A;  2ALB A;  2OE1 A;  4USS A;  2VLT A;  5EL8 A;  1XW5 A;  4ECC A;  5IMD A;  1DBY A;  1K0B A;  4HUA A;  3ZIJ A;  4YKF A;  2H71 A;  3GTU A;  3WD6 A;  4MPF A;  4CDO A;  2H1B A;  4GCI A;  4YH2 A;  1PSQ A;  3CRU A;  1BYE A;  1FVK A;  4N30 A;  5G30 A;  3HD5 A;  4L0W A;  5A4W A;  1T00 A;  2L59 A;  1SKW B;  4KDX A;  2R0P A;  5FHI A;  4MZB A;  4JED A;  5JWQ B;  1GRX A;  4OMV A;  2GS3 A;  3M9J A;  2PBJ A;  4KAE A;  4QQ7 A;  1HYU A;  3HKR A;  3KMN A;  2LS5 A;  1N8J A;  5J9C A;  2JZR A;  2K6V A;  2TRC P;  4ISD A;  5IMZ A;  1WP0 A;  2CX4 A;  3O76 A;  2O5V A;  1SJ6 A;  1WIK A;  2J23 A;  4BL7 B;  3TOU A;  2A4V A;  4ZBD A;  5IOW A;  2HSN A;  2GVP A;  2VL2 C;  1QK8 A;  1M0U A;  2EFC A;  3GYK A;  3TKP A;  3MSZ A;  4CHS A;  2MZC A;  4MJC A;  1F3A A;  2B7K A;  4ZB8 A;  3GH9 A;  1R5A A;  4JE1 A;  4PXO A;  5F07 A;  3WYW A;  4PQ1 A;  4F9Z A;  1JFU A;  4ZB6 A;  4DSS B;  5HR1 A;  5JCU A;  2QA1 A;  5INY A;  4AI6 A;  2O89 A;  5HQP A;  2DJ2 A;  2VM1 A;  5J5N A;  4AJ6 A;  4WET A;  1KNG A;  3BCK A;  4ICY A;  3MIX A;  5EPF A;  4TXV A;  3GRX A;  3FR9 A;  5D8I A;  2C80 A;  5DCG A;  1KEB A;  5AGY A;  2YZH A;  5ELG A;  1TRS A;  3PIN A;  4KCA A;  3UVT A;  3A2V A;  4OCE A;  4OFN A;  1SVO A;  4EDZ A;  3UJ1 A;  3DML A;  1GL8 A;  3FW2 A;  3W6G A;  2TIR A;  4DVC A;  1WRY A;  3VWV A;  3Q6O A;  3VI5 A;  4K5R A;  4KF9 A;  1XIY A;  1XCC A;  1A0F A;  2RLI A;  1PMT A;  3I9V 2;  4HZ2 A;  4NV5 A;  2PPT A;  3ZLP A;  1CQH A;  2KOK A;  2E2M A;  2X99 A;  1BJX A;  1ZL9 A;  4K7O A;  4AKG A;  2ON5 A;  4D73 B;  2CQ9 A;  2Z9S A;  3FZ9 A;  4MJA A;  3GKK A;  1R26 A;  3ED3 A;  2XHF A;  3H4K A;  1O81 A;  5J4U A;  5BMU A;  3IR4 A;  3ZL5 A;  4PTS A;  3DVW A;  3EU4 A;  1W89 A;  4RQX A;  1HNA A;  1WWJ A;  4K8M A;  1YJ6 A;  3TKQ A;  1PN9 A;  1HQO A;  3J7Y b;  1OVN A;  3PR8 A;  1X5D A;  3G7Y A;  5D73 A;  4F82 A;  2UZ8 A;  2REM A;  1TK8 B;  1XWA A;  2IWT A;  1H75 A;  5HR2 A;  1USB A;  3DWV A;  3HDC A;  2GT5 A;  1QFN A;  5JWR B;  3F6D A;  2KLX A;  2IJY A;  2AYT A;  5ID2 B;  3APS A;  1H4O A;  1OC9 B;  1MDK A;  4GWR A;  1I5G A;  2V41 A;  5KN3 A;  4ZBB A;  3MAK A;  1FHE A;  1J08 A;  1O73 A;  2HRK B;  3MDK A;  4EDY A;  3FMW A;  5JWO B;  3RDW A;  1PKZ A;  4TR3 A;  2B1K A;  3C8E A;  1I9D A;  3SWL A;  3FEU A;  2GSR A;  1RQM A;  3KCM A;  3TJB A;  3BCI A;  1GTB A;  1A8L A;  4V2L A;  4FH8 A;  4BVY A;  1YEX A;  2HXK A;  1URM A;  3HY2 A;  2YN1 A;  4AGS A;  5GSS A;  4Z2T A;  5G5F A;  1GTI A;  2ES7 A;  4ZL7 A;  2L6D A;  2MYG A;  2OE3 A;  1B9X C;  1OKD A;  4IW9 A;  4I8B A;  3FYG A;  5IQY A;  3F0I A;  4MH3 A;  2GQL A;  4TW5 A;  5A5K A;  1V9W A;  5DBQ A;  2R5G A;  3DVX A;  2YCD A;  1YDK A;  5A34 A;  2F51 A;  1O8W A;  4E8H A;  4YQU A;  5C00 A;  2R37 A;  1OKT A;  6GSY A;  2RUF A;  1M9B A;  5L71 A;  1TI1 A;  5H5Q A;  3DYR A;  3QMX A;  2RII A;  1XWG A;  3N5O A;  1XW6 A;  2A2P A;  2H19 A;  2DBC A;  3ME7 A;  2BTO T;  1FB6 A;  1QQ2 A;  5IMF A;  4IGJ A;  4V2M A;  1SEN A;  4A5P A;  3GST A;  5HFI A;  3APQ A;  1T1V A;  2X64 A;  1GLP A;  4XS1 A;  3VWU A;  2L4C A;  2ZNM A;  3ZFB A;  2VCW A;  2GDR A;  2PVQ A;  12GS A;  1T4Z A;  2XPE A;  3DD3 A;  2RUE A;  4WF5 A;  3JCM L;  5A4U A;  17GS A;  3FZ4 A;  4MA9 A;  5ELA A;  2A2S A;  5ENU A;  2IFQ B;  3Q19 A;  5J41 A;  4F2I A;  4ZB9 A;  2FGX A;  2GT6 A;  3VFI A;  1T8E B;  3GFK A;  1M99 A;  1MDI A;  4PX1 A;  2YP6 A;  2LJR A;  3HA9 A;  3Q18 A;  5LD0 A;  1B8X A;  1EP7 A;  4V1A g;  4N3Z A;  1UC7 A;  4TR0 A;  3H93 A;  2OAC A;  3FKF A;  4ZL8 A;  4GSN A;  2HQT A;  4AF2 A;  2X8G A;  1BG5 A;  3L9V A;  2VCT A;  2DSA A;  3TGZ A;  2H1D A;  2L57 A;  2IIY A;  1SK1 A;  1ZMA A;  2B6M A;  3EWL A;  2JL4 A;  3GMF A;  1O6J A;  5IMV A;  1SK0 A;  1NM3 A;  2B5Y A;  1Z9H A;  2N5F A;  2HI7 A;  2H0H A;  4TRX A;  1YF0 A;  5IPG A;  3KEB A;  3IBH A;  1F37 A;  3DEX A;  4K2D A;  4J2F A;  1M2B A;  2H01 A;  5B7C A;  5GZZ B;  2DJ1 A;  2E0Q A;  4F0B A;  4PNG A;  2O8V B;  3TJJ A;  2BJX A;  3E9J B;  1V58 A;  3LQ7 A;  4RQR A;  3P2A A;  3GV1 A;  1NSW A;  2LNS A;  2I3Y A;  4ECI A;  3HXS A;  4WBJ A;  1TJD A;  3RPN A;  4TR4 A;  4MPG A;  2NBS A;  2I1U A;  5IMA A;  3QAG A;  2HRA A;  5CRG A;  1N25 A;  3UVH A;  5A5H B;  4F0C A;  1VF2 A;  2VLU A;  3IAS 2;  2N5A A;  2H6Z A;  2G2Q A;  1R4W A;  4TOP A;  1X9W B;  4IHU A;  2GSQ A;  1M2A A;  1K3O A;  3C73 A;  2MMO A;  5KOX A;  3GL3 A;  4IJ3 A;  1Y6E A;  4Q5F A;  1K0A A;  1OE8 A;  1WE0 A;  5DCH A;  5G31 A;  4JZQ A;  3DIE A;  3P8W A;  4KDU A;  3HZ4 A;  5EVO A;  2VL9 A;  4OD7 A;  1JZO A;  2R6K A;  1R7H A;  5AIX A;  5A1N B;  1XVW A;  3VI7 A;  2MMZ A;  4FIW A;  3EC3 A;  1OAZ A;  3DGQ A;  4XS6 A;  5CRD A;  4GQF A;  4L8E A;  4TVE A;  2P5Q A;  4I2U A;  3VPQ A;  3D21 A;  2IMD A;  1SYR A;  2HZE A;  1AAZ A;  1K0N A;  1MTC A;  3EE2 A;  1TW9 A;  3EUR A;  3QFB C;  4RI7 A;  2GZZ A;  3A5I A;  2VAF A;  1ZGN A;  3D5J A;  4K9Z A;  3L9U A;  1J9B A;  1VF1 A;  1GUH A;  5CO3 A;  1ZZY A;  3GKN A;  4XTS A;  2R4V A;  2O85 A;  3NOF A;  1GNW A;  2QC7 A;  2H0G A;  4X4J A;  5CNW A;  1LBK A;  1A2L A;  4HZ4 A;  2H75 A;  4JR4 A;  4O32 A;  2OBI A;  1NHY A;  1V40 A;  1O8X A;  4IVF A;  3W8J A;  5BRT A;  2CAI A;  4ID0 A;  2LRT A;  3CWG A;  3TU3 B;  2EIR A;  4MH2 A;  4TR1 A;  2ON7 A;  4IQA A;  1S3A A;  5GST A;  2DLX A;  4ZIJ A;  2EFH A;  3R3E A;  5G1L A;  5DDL A;  5CRH A;  4NV2 A;  5G1K A;  3GSS A;  4OO5 A;  4LLR A;  4EL1 A;  2A2R A;  1N2A A;  5DQS A;  1KTE A;  1ERU A;  1JZD A;  5CP1 A;  2FNO A;  4WR5 A;  3WT2 A;  2PVO C;  1E2Y A;  2C3T A;  1B4P A;  4ACS A;  2B3S A;  2P0G A;  4G0K A;  2E2G A;  2NVL A;  4MLY A;  5DAK B;  4YAP A;  2XBI A;  2JU5 A;  1WPI A;  4AKH A;  3GKX A;  2WRT A;  2L5L A;  3ZYW A;  1ZYP A;  5ECN B;  1ST9 A;  1Z6M A;  4FYU A;  1PGT A;  3O3T A;  4HJM A;  4BL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...