2PVQA

Crystal structure of ochrobactrum anthropi glutathione transferase cys10ala mutant with glutathione bound at the h-site
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
201
structure length
201
Chain Sequence
MKLYYKVGAASLAPHIILSEAGLPYELEAVDLKAKKTADGGDYFAVNPRGAVPALEVKPGTVITQNAAILQYIGDHSDVAAFKPAYGSIERARLQEALGFCSDLHAAFSGLFAPNLSEEARAGVIANINRRLGQLEAMLSDKNAYWLGDDFTQPDAYASVIIGWGVGQKLDLSAYPKALKLRERVLARPNVQKAFKEEGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione S-transferase
publication title Cysteine 10 is critical for the activity of Ochrobactrum anthropi glutathione transferase and its mutation to alanine causes the preferential binding of glutathione to the H-site.
pubmed doi rcsb
source organism Ochrobactrum anthropi
total genus 72
structure length 201
sequence length 201
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2pvqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pvqA01
1AQXA 1Z7PA 3E0UA 4ZL9A 3PH9A 4EO3A 5JWOB 2DJ0A 3ZFLA 5CO3A 4GTUA 4IELA 2IL3A 2P5RA 2VCZA 5GAPD 2CAQA 2XBQA 4IKHA 2V6OA 4E8HA 1X5EA 3D4MA 1YKAA 2XPDA 4ECIA 1GSQA 1HQOA 1V40A 2NDOA 2C3TA 2HI7A 2J23A 2Z9SA 3ZYWA 1O81A 3RBTA 1Z7RA 2EC4A 1V58A 2NBSA 2R37A 1J0FA 4XS4A 2GZZA 1NHOA 4MZCA 1SU9A 3GKNA 1YKCA 1M9BA 1F6MC 3TOUA 5ECMB 2LEGA 2ALBA 4OO5A 3KXOA 4GRFA 4X1UA 2X8CA 4MJAA 1TU7A 5CNWA 5IPHA 2L6DA 3O76A 4IS0A 5JCWA 2GSTA 1S3DA 3F3RA 1ZMAA 1T4YA 5EPFA 5D96A 2NPBA 5CAXA 5E4WA 2OE3A 2V1MA 2QGVA 5DAKB 1PL2A 4FO5A 2IMKA 3VWVA 1G0TA 2C3NA 1PGTA 4ZBAA 2HZEA 3Q6OA 1V9WA 1TRVA 2JU5A 2IN3A 3QAGA 2MMOA 1YF0A 4PUFC 3A3TA 3L9VA 4ISDA 5D9TA 2FA8A 3G7IA 1J08A 5B6MA 3DEXA 3GFKA 5HFKA 1GH2A 2O89A 6GSYA 1KEBA 3A2WA 5JCGA 2MMAA 1GSSA 2VD0A 2DIZA 1QQ2A 5F05A 2YJ7A 4HQZA 2LV3A 1Y25A 4PX1A 2VAFA 1Q98A 2HZEB 3LXZA 1ST9A 4IHUA 3CBUA 3AY8A 4HJ2A 2RM6A 3FY7A 4Q5QA 1OKTA 3CYNA 3R2QA 3LFLA 3J7Yk 4IGJA 4ECBA 2O87A 5ELGA 1HNCA 5IMCA 3TRQA 4BVXA 1XW5A 3APQA 3UARA 2V41A 4TW5A 3HVVA 1UVZA 1OC9A 2LJKA 1Q4JA 1MTCA 3M9JA 1MDJA 4HUAA 5IOWA 5A4WA 1GTUA 4KSMA 1O6JA 4IBPA 2FUG2 4BL7A 3GNJA 3U5RE 2H0IA 2E2GA 3EE2A 4I5QA 3C7MA 2C4JA 5AIXA 5DALA 4RI7A 1A0RP 3JCML 3QOUA 4XS1A 2KP1A 3TUEA 4I8BA 2OBKA 3E3EA 4KB3A 3FKFA 4BVXB 1USBA 4LLRA 1OE8A 1O73A 1PQNA 4V1Ag 4RQXA 2IMDA 2M46A 4HI7A 1T3BA 4JEDA 3QAWA 1WIKA 3KMOA 1U3AA 4NAXA 2K8VA 5F07A 4IVFA 1N2AA 2LSTA 1T8EB 1DSBA 5KN3A 2AJQB 5HR3A 4BL7B 2IWTA 2C1YA 2MMZA 3TJGA 1M0UA 4IJIA 4ULXA 1WMJA 1OYJA 1UN2A 1FW1A 4GSNA 4E8EA 1H4OA 4BPYA 3GRXA 3FZ9A 2GLRA 3C1SA 3TKSC 2J9HA 4WKWA 5HFGA 2G0FA 1FHEA 1UC7A 3GL3A 3GKXA 1AIUA 2V6KA 1ACVA 1TTZA 4N10A 2HRAA 2M80A 3FR3A 5ECNB 4OMVA 1TRWA 1X5DA 2IMEA 4GWRA 5EL8A 5G2ZA 1C72A 3KD0A 1O8WA 2FA4A 4MPFA 3TCOA 1SENA 2LRNA 1U3IA 2C0FA 4OO4A 2O7KA 1EEMA 3ZL5A 11GSA 2B5YA 4LMWA 1OC3A 4YAVA 5ABRA 5A4UA 1I5GA 5AGYA 1U88A 3UBLA 1YZXA 5ID2B 4CHSA 1EP8A 5IMZA 1YEXA 3GL5A 2IJYA 3FZAA 1WE0A 2N5FA 4HDEA 5L71A 4HS1A 1EV9A 3VFIA 1BG5A 3BD2A 3F3QA 4KAEA 4TR0A 2RIIA 1XWGA 4G0KA 2MYGA 2OA7A 2L5OA 1XOAA 2WCIA 4WETA 5JCUA 3V1WA 3GMFA 3FEUA 3HHVA 4G2EA 3EYTA 4NV5A 3IOSA 3LWAA 2E2MA 2FLSA 1JFUA 5DDLA 2N5BA 1O7UA 4MF7A 1TKDB 1PX7A 2A4VA 3DRNA 2LJRA 1K0OA 2LNTA 3PPUA 3FRCA 1SD9A 4GQFA 2X8HA 3BJ5A 1TU8A 3HA9A 1JLVA 2H76A 3EWLA 1X5CA 2DMLA 2HQTA 5KN2A 4KDXA 3KH9A 2AAWA 2GQMA 4WEYA 1XFLA 3TRXA 3FR6A 2A2RA 4MF6A 1OAZA 3IAS2 1CQHA 2F51A 2WULA 3WD6A 2PVOC 2GTUA 2DSAA 2B7KA 2H6ZA 5KN0A 3GTUA 5IOXA 1N8JA 4OD7A 3HKRA 3TKSA 2HSHA 1PD21 1BQ7A 4TXVA 2VM1A 4EVMA 5ECPB 2YWNA 4K6XA 4BWQA 5CRWA 4ZL8A 5F06A 2RUEA 5D9WA 4XRDA 5D93A 2HZFA 1I9DA 4BWSA 4MK3A 1LBKA 4N30A 3TKSE 3GYKA 2CX3A 1TI1A 2H72A 5G30A 4ML6A 3H93A 1E2YA 1URMA 2WJUA 2AYTA 3NOFA 3M8NA 3KEBA 4HU9A 1XPVA 3APSA 3O6TA 4K8MA 4AJ7A 5ECHB 1JZWA 3VWXA 3O3TA 3FHKA 1TJDA 5G1KA 3KH7A 3MWHA 1BYEA 4XCSA 2OADA 3ZLPA 3D22A 1WJKA 4GQCA 3SWLA 4FYCA 3US3A 4RUVA 2WFCA 5ECRB 1PKZA 4GF0A 4RQRA 4MJEA 2IIYA 2OE0A 2DC5A 1BJXA 2VLUA 3FYGA 3L9SA 4YH2A 4ZILA 2B6MA 1SK0A 4KW6A 3UBKA 1MD4A 1KTEA 4ZXGA 3HVXA 2CT6A 3KP9A 1SK2A 5DCHA 2H74A 5A4VA 2PMTA 3GURA 2HXKA 3C1RA 2VM2A 3L0HA 2X64A 5F0GA 1AW9A 1AUCA 4TR4A 1FVKA 4RI6A 1ABAA 5CP1A 2MBSA 3ISOA 1T4ZA 4PURA 4LA1A 2HRNA 3P2AA 4I6XA 2WS2A 4L5LA 3IA1A 4YQVA 5D9VA 1GNEA 1GLPA 4JR6A 1GTAA 3FK8A 2GZPA 3IBHA 1A23A 3C73A 2I9HA 9GSSA 1EGRA 3LQ7A 2F9SA 4WR4A 3HJOA 1FG4A 2FWFA 5LCZA 4Q5NA 4WF4A 4PNGA 1QGVA 5DAKA 3VLNA 3GH9A 3K8NA 3F4SA 4DSSB 2CZ3A 4K2DA 4EKZA 2NVLA 1T7PB 4MF5A 2ZCTA 3R3EA 5HR0A 4HJMA 2IPAA 1F9MA 2PPTA 2R3XA 2LNSA 4MLYA 1R7HA 5IMVA 4AGSA 1SJ6A 2JL4A 2DJ1A 5KEJA 1R26A 5COHA 4KNDA 2GSQA 1PL1A 3A2XA 1B9XC 2GZYA 3VPQA 1FB0A 1PKWA 3HCZA 3TJJA 2DBCA 3QPMA 1JHBA 4MJCA 2YNXA 2PU9C 3U6VA 4Q5RA 1ML6A 1F37A 3WGXA 5IPGA 3TJKA 2MBTA 4GXZA 4ZB9A 4N0ZA 1M2AA 3ED3A 4ZBDA 2HE3A 3I6AA 3D4TA 4POMA 2VIMA 4X0XA 2JACA 1ERWA 1TW9A 1NM3A 2GVPA 1XIYA 2R2JA 3LEFA 2DJ2A 3OR5A 3GX0A 4JU5A 2WB9A 3IR4A 1LJRA 2OBIA 4QL9A 2H1BA 5E59A 3RAZA 4KX4A 4K7IA 3HYPA 2K8SA 3G9BA 5J41A 5GSTA 1R5AA 2CZ2A 3TOTA 1EV4A 5CRHA 3QD9A 2KUCA 3LJRA 2QKEA 13GSA 2TIRA 4PQ1A 3HZ8A 1ZL9A 2ES7A 3Q18A 4F0CA 4KCEA 4ZB6A 1WPIA 5DBQA 1EOHA 3ZVJD 1XXUA 5B7CA 3P7XA 5H5RA 3HY2A 5J3RA 4LL4B 2DLXA 4GLTA 4V2MA 1K0CA 3W8SA 1SJIA 3L4NA 3GX8A 1GP1A 4N11A 2NTOA 1YY7A 5EY6A 3MAKA 4MPGA 1GULA 4F0BA 2XHFA 6GSVA 2R6KA 1VF1A 5J9CA 4GSSA 4I2UA 3TDGA 4KUNA 3GV1A 4TXOB 2DJJA 1XCCA 4G19A 4POLA 2AB6A 2IMIA 2C0DA 1F3AA 3GHAA 4KDYA 3IHQA 4O7HA 4MZWA 4GCIA 4I2TA 1ZCPA 4KA0A 2YP6A 8GSSA 2VO4A 3LORA 2L6CA 3HXSA 4V2LA 5ECIB 4V2NA 4KGIA 2V32A 1K0BA 2PVQA 2B5XA 4KCAA 2IMFA 1GLQA 3P8WA 1CQGA 5LD0A 4KSOA 2H71A 1NW2A 5EVOA 20GSA 3LSZA 5IO2A 3QCPA 1TOFA 1VF2A 3FR9A 4PQIA 2M72A 3EVIA 2VLVA 4OWYA 1XWBA 2KHPA 2GQLA 1A8YA 3RDWA 18GSA 3UMAA 4IJ3A 3KZQA 4O92A 4G0IA 2JSZA 1ERVA 5J5NA 1FOVA 1SL1B 2AUVA 5ID2A 2F8FA 2PERA 2L4QA 2L59A 3D21A 5JWQB 3WT2A 2RM5A 2PN8A 5HR2A 5AN1A 1GRXA 4KDUA 2ON5A 1ERUA 3I43A 4ZB8A 2FWGA 4MH3A 3HD5A 3KTLA 4XS6A 1YF1A 1EWXA 2BMXA 1VGLA 4ML1A 5D9XA 3IC8A 1RK4A 1S3AA 4TR1B 3UJ1A 2FWEA 3F9UA 1Z6NA 3HVSA 3RPPA 2YWIA 1GSUA 2I81A 2GQKA 1SKRB 4GSTA 2D2ZA 4IP1A 3S9FA 4N0VA 3BOAA 4G10A 2HSMB 2VOCA 5H5SA 1YDKA 1BX9A 4ECJA 4HZ4A 1AQWA 2YZUA 2ZNMA 1B9YC 2LQQA 3VURA 4F82A 1J9BA 3TGZA 1MD3A 1G6YA 4OCFA 1G7EA 1A0FA 1DUGA 1HNBA 3CSJA 16GSA 5IMAA 4OCEA 3IE3A 2R4VA 1ZYEA 2P5QA 4EXJA 3D6IA 1AQVA 4IQAA 4FYBA 1FO5A 5G31A 2GS3A 3G7YA 3CSIA 2HYXA 2BJXA 4PGTA 4MP4A 3EU4A 4NXIA 1XW9A 1B4QA 2DIYA 2MZCA 4TR3A 4O5RA 2GDRA 3GSSA 3EMPA 4ID0A 2E7PA 2RLIA 2N5AA 2H30A 6GSUA 3GKMA 3GA4A 1F3BA 2YJHA 1GTIA 3DVWA 1DBYA 3QDNA 2GT5A 4EC0A 1EGOA 3IK7A 3IDVA 1TK0B 2YWMA 1SYXA 1M9AA 4QQ7A 2CAIA 2GGTA 1TK8B 2H0HA 5ENUA 3UVHA 5A5KA 3VWUA 2FY6A 2MMNA 1X9MB 1X9WB 1U6TA 2E0QA 3BCIA 1SL2B 5CRGA 2WGRA 6GSSA 3QR6A 4AJ6A 4OFNA 1XWCA 3LG6A 1BEDA 3I9V2 1XVQA 2YOIA 3F6FA 2FWHA 3F8UA 4DSQA 3P90A 4K1FA 2H8LA 5ECLB 3WGDA 2X8GA 3TKRA 3W8JA 1V98A 3IPZA 5BMUA 4PNFA 3LYKA 2JZTA 2L5LA 2C0GA 4MCUA 2DJ3A 1YEPA 4NHWA 2RUFA 2X99A 1SYRA 4FH8A 3F4RA 2HRKA 2TRCP 3W6GA 5GZZB 4EDZA 5J4UA 1QXHA 1ZYQB 2LKUA 1Z3EA 1ERTA 3C8EA 4K9ZA 5DVBA 3UAPA 4NHZA 2KOKA 2F3MA 4HZ2A 3LGCA 2O85A 4PUAA 4OFTA 2I4AA 1OVNA 2R5GA 1SKSB 1MDKA 2LTKA 2YCDA 2B3SA 1V2AA 1Y6EA 3LXTA 2C80A 3WGEA 3EURA 2HNLA 1WRYA 17GSA 2VL2C 1IYIA 1K3OA 4G9HA 4IW9A 4J2FA 5FHIA 1OE7A 5IMFA 2HRKB 4HOJA 5FWGA 4XIHA 4DSSA 4FQUA 2XPEA 2WDUA 5B6NA 4EL1A 3Q19A 2LJAA 3KGKA 4NMUA 2VCQA 4DSRA 3M3MA 4WBRD 3KJYA 2AHEA 4WF5A 4OFMA 2YV9A 4AJ8A 3EINA 1JLWA 5G1LA 1FAAA 3GIXA 1TRUA 5G5EA 2K6VA 3LYPA 2DMMA 2LUSA 4EUYA 2H6YA 10GSA 6GSXA 4TN8A 1VF3A 1QMVA 5HR1A 3VPTA 2K18A 4J57E 3Q74A 5FT3A 1SJZA 2OKAA 3GN3A 3NIVA 1EP7A 4BVYB 5C04A 3KTBA 2HRFA 1A2MA 5KN1A 5B8BA 1LU4A 3NZNA 2LS5A 5H5QA 2JZSA 4L5OA 1NHYA 2P0GA 3DMLA 3WT1A 4PXOA 2PWJA 1ZOFA 4MH2A 1THXA 1SD8A 3IV4A 2G2QA 3IK9A 5ELAA 2LRCA 1B48A 3H4KA 4AF2A 4KE3A 2H66A 3HDCA 2ZUPA 3KMNA 4POBA 2A2SA 12GSA 1U87A 3TB2A 1TRSA 1GUMA 1YJ6A 1ILOA 4YQMA 1XOBA 4P3YB 2P31A 3ME7A 4Z7XA 3M1GA 2LRTA 1Z9HA 1Z5YE 1G6WA 2YWOA 4K0NA 1GSEA 4Q5FA 3QFBC 4POKA 4XS4B 1K0DA 4XHMA 1E6BA 2OE1A 1GNWA 1A8LA 2H1AA 2VL3A 2VCVA 3QAVA 3MNGA 4MDCA 1W89A 1EEJA 1OC8A 5ECSA 1HD2A 2HT9A 3A2VA 2YPMA 2TRXA 1W4VA 2B5EA 5CYYA 1V57A 1XZOA 2H19A 3KM6A 2VL2A 4TXOA 3BBYA 3PGTA 2DJKA 3ZRDA 2GSSA 5AIVA 2L4CA 1O8XA 5DCGA 4I97A 3HZ4A 1WWJA 3FZ5A 1SL0B 4USSA 4DVCA 5DJMA 5CRDA 3G7JA 2CVBA 1PSQA 2C0EA 1TP9A 5DQSA 3ZREA 3H1NA 1ZZYA 1THOA 1JZDA 4DEJA 3CRUA 3RHCA 4L8EA 1O85A 3DD3A 4NPBA 3SBCA 1PX6A 4WR5A 2VUPA 2C8UA 4PTSA 2XBIA 4XRAA 4JE1A 4JRRA 5JWRB 4JBBA 1HYUA 1KNGA 3F4TA 3VK9A 4FIWA 2YV7A 4HQSA 3ZTLA 3D5JA 2EIQA 2H1DA 1X9SB 2CA8A 3J7Yb 1GTBA 1GUKA 2HSNB 4TVEA 2QSIA 3L78A 1UA5A 5D8IA 6GSTA 1XW6A 2VCXA 3EU3A 3APOA 4CW9A 3ZITA 1VF4A 2WRTA 3C71A 1K3LA 3DIEA 4K0GA 2EIOA 4K7NA 3KCMA 2H01A 5ECKB 1MDIA 4MA9A 5ECOB 1DE2A 4D73A 3ZIJA 1R5PA 3CSHA 1PRXA 5IO0A 1R4WA 1G7OA 2I1UA 2ON7A 4NWYA 22GSA 3CMIA 6GSWA 1TI3A 2H0GA 3N5OA 1AAZA 1OC9B 3N9JA 3FZ4A 2HFDA 2REMA 2O8VB 1EOGA 1PMTA 4JR4A 1MEKA 4F2IA 5G5FA 3ERFA 1K0MA 4IP6A 3VI7A 2GT6A 3ZZXA 5D73A 3UEMA 3KP8A 4MMMA 4TR1A 4KH7A 2H75A 2FD3A 3KIJA 5DALB 3EMXA 1DE1A 3TJBA 1OKDA 4D73B 2VCWA 2B1LA 4MZBA 4BA7A 1M99A 4HEA2 3VI5A 3WYWA 2CQ9A 2HSMA 3CXGA 3A5WA 3CTFA 3F0IA 3M9KA 1TDIA 4L0UA 1XWAA 4ILFA 1K3YA 14GSA 3FW2A 1S3CA 4ZL7A 2PUKC 5LNKe 4J56E 1GL8A 1GWCA 1M2BA 2H70A 2JZRA 4IN0A 2OACA 2FHEA 2FNOA 3GUSA 3IAM2 4IQ1A 3E9JB 1FVJA 2H1GA 3UL3A 4HU7A 19GSA 5ECQB 2CVDA 3ME8A 2YN1A 3HJPA 3PINA 2K9FA 2VLTA 2H73A 3D0ZA 3DKSA 2CVKA 4ZBBA 5IM9A 3GSTA 1FB6A 3TKPA 5IQYA 4XTSA 3ZMKA 2L57A 2C3QA 3GKKA 5IIZA 1WP0A 2VCTA 1XVWA 3L9UA 1AC1A 3DGQA 1VRSD 3CRTA 3ZVJA 1F2EA 1XBSA 5J9BA 4JZQA 3DWVA 2HLSA 1A2JA 2F8AA 5HFIA 2XC2A 2PGTA 5GAND 3TJFA 3DXBA 1WOUA 3IC4A 3MDKA 2GSRA 1GSYA 1PA3A 1Z6MA 1T1VA 4F03A 1SK1A 4CDOA 3IRAA 4NV2A 1A24A 1QK8A 4TRXA 1B4PA 4V1Ap 1K0NA 2FCHA 2PBJA 2CV4A 3QMXA 1RW1A 1GSFA 5B8AA 1H75A 3H8QA 3I69A 2LQOA 5DJLA 3RPNA 1HNAA 1JZOA 5C00A 3BCKA 4YQUA 3UIWA 1NSWA 4O32A 5CREA 4QL7A 4G0LA 1M2DA 7GSSA 1ON4A 3HJMA 1TXXA 1GSDA 5INYA 4ZIJA 4WXTA 4LL1B 3CTGA 4LMVA 5AISA 2V2GA 4TKYA 3EC3A 2JSYA 4H86A 4L0WA 2B7JA 3F63A 1YQ1A 3ZFBA 3GH6A 4PQHA 3UOMA 5GSSA 1KBNA 3RHBA 3TKQA 5IMDA 1QUWA 4EE0A 4WBJA 1PN9A 2YZHA 1IYHA 2OJLA 2H6XA 2B1KA 1EZKA 2UZ8A 3PR8A 3H79A 3TRPA 2I3YA 2QC7A 2EIRA 4K7OA 3M0FA 1JZRA 2WZ9A 3GTUB 3ZIVA 3VWWA 1TK5B 4YAPA 2AV4A 3MSZA 4ACSA 2FGXA 1B8XA 2IFQA 5DQYA 2CX4A 2KP2A 4X43A 4ECCA 1RQMA 3ERWA 1A2LA 4TOPA 3ZMLA 3UVTA 5HQPA 1XWKA 1GUHA 2VL9A 1ZGNA 3IXRA 3QFAC 4EF0A 1AXDA 2VD1A 2HSYA 3DYRA 2JADA 1X0RA 4F9ZA 3DVXA 2KLXA 4MABA 3ERGA 1BAYA 4KF9A 1SKWB 3F6DA 4MJBA 4EDYA 1QFNA 2BTOT 1T00A 1K0AA 4BVYA 5F8BA 1M7TA 2IFQB 2YANA 4FYUA
chains in the Genus database with same CATH superfamily
1AQXA 1Z7PA 3E0UA 4ZL9A 3PH9A 4EO3A 5JWOB 2DJ0A 3ZFLA 5CO3A 4GTUA 4IELA 2IL3A 2P5RA 2VCZA 5GAPD 2CAQA 2XBQA 5J4YA 4IKHA 2V6OA 4E8HA 1X5EA 3D4MA 1YKAA 2XPDA 3CQFA 4ECIA 1GSQA 1HQOA 1V40A 2NDOA 2C3TA 2HI7A 2J23A 2Z9SA 3ZYWA 1O81A 4E68A 3RBTA 1Z7RA 2EC4A 1V58A 2NBSA 2R37A 1J0FA 4XS4A 2GZZA 1NHOA 4MZCA 1SU9A 3GKNA 1YEWC 1YKCA 1M9BA 1F6MC 3TOUA 5ECMB 2LEGA 2ALBA 4OO5A 3KXOA 4GRFA 4X1UA 2X8CA 4MJAA 1TU7A 5CNWA 5IPHA 2L6DA 3O76A 4IS0A 5JCWA 2GSTA 1S3DA 3F3RA 1ZMAA 1T4YA 5EPFA 1PN0A 5D96A 2NPBA 5CAXA 5E4WA 2OE3A 2V1MA 2QGVA 5DAKB 1PL2A 4FO5A 2IMKA 3VWVA 1G0TA 2C3NA 1PGTA 4ZBAA 2HZEA 4Z2RA 3Q6OA 1V9WA 1TRVA 2JU5A 2IN3A 3QAGA 2MMOA 1YF0A 4PUFC 3A3TA 3L9VA 4ISDA 5D9TA 2FA8A 3G7IA 1J08A 4Z2TA 5B6MA 3DEXA 3GFKA 5HFKA 1GH2A 2O89A 6GSYA 1KEBA 3A2WA 5JCGA 3RGBC 2MMAA 1GSSA 2VD0A 2DIZA 2EFDA 1QQ2A 5F05A 2YJ7A 4HQZA 2LV3A 1Y25A 2HSNA 4PX1A 2VAFA 1Q98A 2HZEB 3LXZA 1ST9A 4IHUA 3CBUA 3AY8A 4HJ2A 1SVMA 2RM6A 3FY7A 4Q5QA 1OKTA 3CYNA 3R2QA 3LFLA 3J7Yk 4IGJA 4ECBA 2O87A 5ELGA 1HNCA 3EPTA 5IMCA 3TRQA 4BVXA 1XW5A 3APQA 3UARA 2V41A 4TW5A 3HVVA 1UVZA 1OC9A 2LJKA 1Q4JA 1MTCA 3M9JA 1MDJA 4K2XA 4HUAA 5KOWA 5IOWA 5A4WA 1GTUA 4KSMA 1O6JA 4IBPA 2FUG2 4BL7A 3GNJA 3U5RE 2H0IA 2E2GA 3EE2A 4I5QA 3C7MA 2C4JA 5AIXA 5DALA 4RI7A 1A0RP 3JCML 3QOUA 4XS1A 2KP1A 3TUEA 4I8BA 2OBKA 3E3EA 4KB3A 3FKFA 4BVXB 1USBA 4LLRA 1OE8A 1O73A 1PQNA 4V1Ag 4RQXA 2IMDA 2M46A 4HI7A 1T3BA 4JEDA 3QAWA 1WIKA 3KMOA 1U3AA 4NAXA 5KOXA 2K8VA 5F07A 4IVFA 1N2AA 2LSTA 2EFHA 1T8EB 1DSBA 5KN3A 2AJQB 5HR3A 4BL7B 2IWTA 4AKGA 2C1YA 2MMZA 3TJGA 1M0UA 4IJIA 4ULXA 1WMJA 5BRTA 1OYJA 1UN2A 1FW1A 4GSNA 4E8EA 1H4OA 4BPYA 3GRXA 3FZ9A 2GLRA 3C1SA 3TKSC 2J9HA 4WKWA 5HFGA 2G0FA 1FHEA 1UC7A 3GL3A 3GKXA 1AIUA 2V6KA 1ACVA 1TTZA 4N10A 2HRAA 2M80A 3FR3A 5ECNB 4OMVA 1TRWA 1X5DA 2IMEA 4GWRA 5EL8A 5G2ZA 1C72A 3KD0A 1O8WA 2FA4A 4MPFA 3TCOA 1SENA 4O5QA 2LRNA 3LW9A 1U3IA 2C0FA 4OO4A 2O7KA 1EEMA 3ZL5A 11GSA 2B5YA 4LMWA 1OC3A 4YAVA 5ABRA 5A4UA 1I5GA 5AGYA 1U88A 3UBLA 1YZXA 5ID2B 4CHSA 1N25A 1EP8A 5IMZA 3MIXA 1YEXA 3GL5A 2IJYA 3FZAA 4ZB7A 1WE0A 2N5FA 4HDEA 5L71A 4HS1A 1EV9A 3VFIA 1BG5A 3BD2A 3F3QA 4KAEA 4TR0A 2RIIA 1XWGA 4G0KA 2MYGA 2OA7A 2L5OA 1XOAA 2WCIA 1S3RA 4WETA 5JCUA 3V1WA 3GMFA 5A5HA 3FEUA 3HHVA 4G2EA 3EYTA 4NV5A 3IOSA 3LWAA 2E2MA 2FLSA 1JFUA 5DDLA 2N5BA 1O7UA 4MF7A 1TKDB 1PX7A 2A4VA 3DRNA 2LJRA 1K0OA 2LNTA 3PPUA 3FRCA 1SD9A 4GQFA 2X8HA 3BJ5A 1TU8A 3HA9A 1JLVA 2H76A 3EWLA 1X5CA 2DMLA 2HQTA 5KN2A 4KDXA 1Y1UA 3KH9A 2AAWA 2GQMA 4WEYA 1XFLA 3TRXA 3IHGA 3FR6A 2A2RA 4MF6A 1OAZA 3IAS2 1CQHA 2F51A 2WULA 3WD6A 2PVOC 2GTUA 2DSAA 2B7KA 2H6ZA 5KN0A 3GTUA 5IOXA 1N8JA 4OD7A 3HKRA 3TKSA 2HSHA 1PD21 1BQ7A 4TXVA 2VM1A 4EVMA 5ECPB 2YWNA 4K6XA 4BWQA 5CRWA 4ZL8A 5F06A 2RUEA 5D9WA 4XRDA 5D93A 2HZFA 5A34B 2DKHA 1I9DA 4BWSA 4MK3A 1LBKA 4N30A 3TKSE 1SVLA 3GYKA 2O5VA 1TI1A 2CX3A 2H72A 5G30A 2X49A 4ML6A 3H93A 1E2YA 1URMA 2WJUA 2AYTA 3NOFA 3M8NA 3KEBA 4HU9A 1XPVA 3APSA 3O6TA 4K8MA 4AJ7A 5ECHB 1JZWA 3VWXA 3O3TA 3FHKA 1TJDA 5G1KA 3KH7A 3MWHA 1BYEA 4XCSA 2OADA 2H1LA 3ZLPA 3D22A 1WJKA 4GQCA 3SWLA 4FYCA 3US3A 2WVXB 4RUVA 2WFCA 2WZSA 5ECRB 1PKZA 4GF0A 4RQRA 4MJEA 2IIYA 2OE0A 2DC5A 1BJXA 2VLUA 3FYGA 3L9SA 4YH2A 4ZILA 2B6MA 1SK0A 4KW6A 3UBKA 1MD4A 1KTEA 4ZXGA 3HVXA 2CT6A 3KP9A 1SK2A 5DCHA 2H74A 5A4VA 2PMTA 3GURA 2HXKA 3C1RA 2VM2A 3L0HA 2X64A 5F0GA 1AW9A 1AUCA 4TR4A 1FVKA 4RI6A 1ABAA 4PI0C 5CP1A 2MBSA 3ISOA 1T4ZA 4PURA 4LA1A 2HRNA 3P2AA 4I6XA 2WS2A 4L5LA 3IA1A 4YQVA 5D9VA 1GNEA 1GLPA 4JR6A 1GTAA 3FK8A 2GZPA 3IBHA 1A23A 3C73A 2I9HA 4CY8A 9GSSA 1EGRA 3LQ7A 2O3EA 2F9SA 2R0GA 4WR4A 3HJOA 1FG4A 2FWFA 5LCZA 4Q5NA 4WF4A 4PNGA 1QGVA 5DAKA 3VLNA 3GH9A 3K8NA 3F4SA 4DSSB 2CZ3A 4K2DA 4EKZA 2NVLA 1T7PB 4MF5A 2ZCTA 3HVNA 3R3EA 5HR0A 4HJMA 2IPAA 1F9MA 2PPTA 2R3XA 2LNSA 4MLYA 1R7HA 5IMVA 4YKFA 4AGSA 1SJ6A 2JL4A 2DJ1A 5KEJA 1R26A 5COHA 4KNDA 2GSQA 1PL1A 3A2XA 1B9XC 2GZYA 3VPQA 1FB0A 1PKWA 3HCZA 3TJJA 2DBCA 4MNNA 3QPMA 1JHBA 4MJCA 2YNXA 2PU9C 3U6VA 4Q5RA 1ML6A 1F37A 3WGXA 5IPGA 2EFCA 3TJKA 2MBTA 4GXZA 4ZB9A 4N0ZA 1M2AA 3ED3A 4ZBDA 2HE3A 3I6AA 3D4TA 4POMA 2VIMA 4X0XA 2JACA 1ERWA 1TW9A 1NM3A 2GVPA 1XIYA 2R2JA 3LEFA 2DJ2A 3OR5A 3GX0A 4JU5A 2WB9A 3IR4A 1LJRA 2OBIA 4QL9A 2H1BA 5E59A 3RAZA 4KX4A 4K7IA 3HYPA 2K8SA 3G9BA 5J41A 5GSTA 1R5AA 2CZ2A 3TOTA 1EV4A 5CRHA 3QD9A 2KUCA 3LJRA 2QKEA 13GSA 2TIRA 4PQ1A 3HZ8A 1ZL9A 2ES7A 3Q18A 4F0CA 4KCEA 4ZB6A 1WPIA 5DBQA 1EOHA 3ZVJD 1XXUA 2A4HA 5B7CA 3P7XA 5H5RA 3HY2A 5J3RA 4LL4B 2DLXA 4GLTA 4V2MA 1K0CA 3W8SA 1SJIA 3L4NA 4BIKA 3GX8A 1GP1A 4N11A 2NTOA 2R0CA 1YY7A 5EY6A 3MAKA 4MPGA 1GULA 4F0BA 2XHFA 6GSVA 4W66A 2R6KA 1VF1A 5J9CA 4GSSA 4I2UA 3TDGA 4KUNA 3GV1A 4TXOB 2DJJA 1XCCA 4G19A 4POLA 2AB6A 2IMIA 2C0DA 1F3AA 3GHAA 4KDYA 3IHQA 4O7HA 4MZWA 4GCIA 4I2TA 4Z2UA 1ZCPA 4KA0A 2YP6A 8GSSA 2VO4A 2X4AA 2L6CA 3LORA 3HXSA 4V2LA 5ECIB 1BG1A 4KGIA 1M3JA 2V32A 4V2NA 1K0BA 2PVQA 2B5XA 4KCAA 2IMFA 1GLQA 3P8WA 1CQGA 5LD0A 4KSOA 2H71A 1NW2A 5EVOA 20GSA 3LSZA 5IO2A 3QCPA 1TOFA 1VF2A 3FR9A 4PQIA 2M72A 3EVIA 2VLVA 4OWYA 1XWBA 2KHPA 2GQLA 1A8YA 3RDWA 18GSA 3UMAA 4IJ3A 3KZQA 4O92A 4G0IA 2JSZA 1ERVA 5J5NA 1FOVA 1SL1B 2AUVA 5ID2A 3FMWA 2F8FA 2PERA 2L4QA 2L59A 3D21A 5JWQB 4AI6A 3WT2A 2RM5A 2PN8A 5HR2A 5AN1A 1GRXA 4KDUA 2ON5A 1ERUA 3I43A 4ZB8A 2FWGA 4MH3A 3HD5A 3KTLA 4XS6A 1YF1A 1EWXA 2BMXA 1VGLA 4ML1A 5D9XA 3IC8A 1RK4A 1S3AA 4AKXB 4TR1B 3UJ1A 2FWEA 3F9UA 1Z6NA 1M3IA 3HVSA 3RPPA 2YWIA 1GSUA 2I81A 2GQKA 1SKRB 4GSTA 2D2ZA 4IP1A 4FXYP 3S9FA 4N0VA 3BOAA 4G10A 2HSMB 2VOCA 4EIQA 5H5SA 1YDKA 1BX9A 4ECJA 4HZ4A 1AQWA 2YZUA 2ZNMA 1B9YC 2LQQA 3VURA 4F82A 1J9BA 3TGZA 1MD3A 1G6YA 4OCFA 1G7EA 1A0FA 1DUGA 1HNBA 3CSJA 16GSA 5IMAA 4OCEA 3TU3B 3IE3A 2R4VA 1ZYEA 2P5QA 4EXJA 3D6IA 1AQVA 4IQAA 4FYBA 1FO5A 5G31A 2GS3A 2DKIA 3CSIA 2HYXA 3G7YA 2BJXA 4PGTA 4MP4A 3EU4A 4NXIA 1XW9A 5A34A 2DIYA 2MZCA 1B4QA 4TR3A 4O5RA 2GDRA 3GSSA 3EMPA 4ID0A 2E7PA 2RLIA 2N5AA 2H30A 3GKMA 6GSUA 3GA4A 1F3BA 2YJHA 1GTIA 3DVWA 1DBYA 5J40A 3QDNA 2GT5A 4EC0A 1EGOA 3IK7A 3IDVA 1TK0B 2YWMA 1SYXA 1M9AA 2QA1A 4QQ7A 2CAIA 2GGTA 1TK8B 2H0HA 5ENUA 3UVHA 5A5KA 4AKHA 3VWUA 2FY6A 2MMNA 4QMKA 1X9MB 1X9WB 1U6TA 2E0QA 3BCIA 1SL2B 5CRGA 2WGRA 6GSSA 3QR6A 1ZYPA 4AJ6A 4OFNA 1XWCA 3LG6A 1BEDA 2WVXA 3I9V2 1XVQA 2YOIA 4K5RA 3F6FA 2FWHA 3F8UA 4DSQA 3P90A 4K1FA 2H8LA 5ECLB 3CWGA 3WGDA 4K5SA 2X8GA 3TKRA 3W8JA 1V98A 3IPZA 5BMUA 4PNFA 3LYKA 2JZTA 2L5LA 2C0GA 4MCUA 2DJ3A 1YEPA 4NHWA 2RUFA 2X99A 1SYRA 4FH8A 3F4RA 2HRKA 2TRCP 3W6GA 5GZZB 4EDZA 5J4UA 1QXHA 1ZYQB 2LKUA 1Z3EA 1ERTA 3C8EA 1ZYNA 4K9ZA 5DVBA 3UAPA 4NHZA 2KOKA 2F3MA 4HZ2A 3LGCA 2O85A 4PUAA 4OFTA 2I4AA 1OVNA 2R5GA 1SKSB 1MDKA 2LTKA 5BMUB 2YCDA 2B3SA 1V2AA 2WVZA 1Y6EA 3LXTA 2C80A 3WGEA 3EURA 2HNLA 1WRYA 17GSA 2VL2C 1IYIA 1K3OA 4G9HA 4IW9A 4J2FA 5FHIA 1OE7A 5IMFA 2HRKB 4HOJA 5FWGA 4XIHA 4DSSA 4FQUA 2XPEA 2WDUA 5B6NA 1BF5A 3Q19A 4EL1A 2LJAA 3KGKA 4NMUA 4AKIA 2VCQA 4DSRA 3M3MA 3A5IA 4WBRD 3KJYA 2AHEA 4WF5A 4PI2C 4OFMA 2YV9A 2WW0A 4AJ8A 3EINA 1JLWA 5G1LA 1FAAA 3GIXA 1TRUA 4G01A 5G5EA 2K6VA 3LYPA 5J4VA 2DMMA 2LUSA 4EUYA 2H6YA 10GSA 1I1IP 6GSXA 2WW1A 4TN8A 1VF3A 1QMVA 5HR1A 3VPTA 2K18A 4J57E 3Q74A 3CHXC 5FT3A 1SJZA 2OKAA 3GN3A 3NIVA 1EP7A 4BVYB 5C04A 3KTBA 2HRFA 1A2MA 4A5PA 5KN1A 5B8BA 3RFRC 1LU4A 3NZNA 2VKZG 2LS5A 5H5QA 2JZSA 4L5OA 1NHYA 2P0GA 3DMLA 3WT1A 4PXOA 2PWJA 3HMJG 1ZOFA 4MH2A 1THXA 1SD8A 3IV4A 2G2QA 3IK9A 5ELAA 2LRCA 1B48A 2WW3A 3H4KA 4AF2A 4KE3A 2H66A 3HDCA 2ZUPA 3KMNA 4POBA 1SVOA 2A2SA 12GSA 1U87A 3TB2A 1TRSA 1GUMA 1YJ6A 2WW2A 1ILOA 4YQMA 1XOBA 4P3YB 2P31A 3ME7A 4Z7XA 3M1GA 2LRTA 1Z9HA 1Z5YE 1G6WA 2YWOA 4K0NA 1GSEA 4Q5FA 3QFBC 4POKA 4XS4B 1K0DA 4XHMA 1E6BA 2OE1A 4EIPA 1GNWA 1A8LA 2H1AA 2VL3A 2VCVA 3QAVA 3MNGA 4MDCA 1W89A 1EEJA 1OC8A 5ECSA 4YKGA 1HD2A 2HT9A 3A2VA 2YPMA 2TRXA 1W4VA 2B5EA 5CYYA 1V57A 1XZOA 2H19A 3KM6A 2VL2A 4TXOA 3BBYA 3PGTA 2DJKA 3ZRDA 2GSSA 5AIVA 2L4CA 1O8XA 5DCGA 4I97A 3HZ4A 1WWJA 3FZ5A 1SL0B 4USSA 4DVCA 5DJMA 5CRDA 3G7JA 2CVBA 1S4BP 2UV8G 1PSQA 2C0EA 1TP9A 5DQSA 3ZREA 3H1NA 1ZZYA 1THOA 1JZDA 4DEJA 3CRUA 4HSCX 3RHCA 4L8EA 1O85A 3DD3A 4NPBA 3SBCA 1PX6A 4WR5A 2VUPA 2C8UA 4PTSA 2XBIA 4XRAA 4JE1A 1PFOA 4JRRA 5JWRB 4JBBA 1HYUA 1KNGA 3F4TA 2EFEA 3VK9A 4FIWA 2YV7A 2QA2A 4HQSA 3ZTLA 1XG8A 3D5JA 2EIQA 2H1DA 1X9SB 2CA8A 3J7Yb 1GTBA 1GUKA 2O36A 2HSNB 4TVEA 2QSIA 3L78A 1UA5A 5D8IA 6GSTA 2R0PA 1XW6A 2VCXA 3EU3A 3APOA 4CW9A 3ZITA 1VF4A 2WRTA 3C71A 1K3LA 3DIEA 4K0GA 2EIOA 4K7NA 3KCMA 2H01A 5ECKB 1MDIA 4MA9A 5ECOB 1DE2A 4D73A 3ZIJA 1R5PA 3CSHA 1PRXA 5IO0A 1R4WA 1G7OA 2I1UA 2ON7A 4NWYA 22GSA 3CMIA 6GSWA 1TI3A 2H0GA 3N5OA 1AAZA 1OC9B 3N9JA 3FZ4A 2HFDA 2REMA 2O8VB 1EOGA 1PMTA 4JR4A 1MEKA 4F2IA 5G5FA 3ERFA 1K0MA 4IP6A 3VI7A 2GT6A 3ZZXA 5D73A 3UEMA 3KP8A 4MMMA 4TR1A 4KH7A 2H75A 2WVYA 2FD3A 3KIJA 5DALB 3MYDA 3EMXA 1DE1A 3TJBA 1OKDA 4D73B 2VCWA 2B1LA 4MZBA 4BA7A 1M99A 4HEA2 3VI5A 3WYWA 2CQ9A 2HSMA 3CXGA 3A5WA 3CTFA 3F0IA 3M9KA 1TDIA 4L0UA 1XWAA 4ILFA 1K3YA 14GSA 3FW2A 1S3CA 4ZL7A 2PUKC 5LNKe 4J56E 1GL8A 1GWCA 1M2BA 2H70A 2JZRA 4IN0A 2OACA 2FHEA 2FNOA 3GUSA 3IAM2 4IQ1A 3E9JB 1FVJA 2H1GA 3UL3A 4HU7A 19GSA 5ECQB 2CVDA 3ME8A 2YN1A 3HJPA 3PINA 2K9FA 2VLTA 2H73A 3D0ZA 3DKSA 2CVKA 4ZBBA 5IM9A 3GSTA 1FB6A 3TKPA 5IQYA 4XTSA 3ZMKA 2L57A 2C3QA 3GKKA 5IIZA 1WP0A 2VCTA 1XVWA 3L9UA 1AC1A 3DGQA 1VRSD 3CRTA 3ZVJA 1F2EA 1XBSA 5J9BA 4JZQA 5A1NA 3DWVA 2HLSA 1A2JA 4GDFA 2F8AA 5HFIA 2XC2A 2PGTA 5GAND 2A2PA 3TJFA 3DXBA 1WOUA 3IC4A 3MDKA 2GSRA 1GSYA 1PA3A 2OT3A 1Z6MA 1T1VA 4F03A 1SK1A 4CDOA 3IRAA 4NV2A 4PHZC 1A24A 1QK8A 4TRXA 1B4PA 4V1Ap 1K0NA 1TXUA 2FCHA 2PBJA 2CV4A 3QMXA 1RW1A 1GSFA 5B8AA 1H75A 3H8QA 3I69A 2LQOA 5A1NB 5DJLA 3RPNA 4ICYA 1HNAA 1JZOA 5C00A 3BCKA 4YQUA 5A5HB 3UIWA 1NSWA 4O32A 5CREA 4QL7A 4G0LA 1M2DA 7GSSA 1ON4A 3HJMA 1TXXA 1GSDA 5INYA 4N3ZA 4ZIJA 4WXTA 4LL1B 3CTGA 4LMVA 5AISA 2V2GA 4TKYA 3EC3A 2JSYA 4H86A 4L0WA 2B7JA 3F63A 1YQ1A 3ZFBA 3GH6A 4PQHA 3UOMA 5GSSA 1KBNA 3RHBA 3TKQA 5IMDA 1QUWA 4EE0A 4WBJA 1PN9A 2YZHA 1IYHA 2OJLA 2H6XA 2B1KA 1EZKA 2UZ8A 3PR8A 3H79A 3TRPA 2I3YA 2QC7A 2EIRA 4K7OA 3M0FA 1JZRA 2WZ9A 3GTUB 3ZIVA 3VWWA 1TK5B 4YAPA 2AV4A 3MSZA 4ACSA 2FGXA 1B8XA 2IFQA 5DQYA 2CX4A 2KP2A 4X43A 4ECCA 1RQMA 3ERWA 4X4JA 1A2LA 4TOPA 4CY6A 3ZMLA 3UVTA 5HQPA 1XWKA 1GUHA 1FOHA 2VL9A 5J47A 1ZGNA 3IXRA 3QFAC 4EF0A 1AXDA 2VD1A 2HSYA 3DYRA 2JADA 1X0RA 4O5UA 4F9ZA 3DVXA 2KLXA 4MABA 3ERGA 1BAYA 4KF9A 1SKWB 3F6DA 4MJBA 1YVLA 4EDYA 1QFNA 2BTOT 1T00A 1K0AA 4BVYA 5F8BA 1M7TA 2IFQB 2YANA 4FYUA
chains in the Genus database with same CATH topology
1AQXA 1Z7PA 3E0UA 4ZL9A 3PH9A 4EO3A 5JWOB 2DJ0A 3ZFLA 5CO3A 4GTUA 4IELA 2IL3A 2P5RA 2VCZA 5GAPD 2CAQA 2XBQA 5J4YA 4IKHA 2V6OA 4E8HA 1X5EA 3D4MA 1YKAA 2XPDA 4ECIA 1GSQA 1HQOA 1V40A 2NDOA 2C3TA 2HI7A 2J23A 2Z9SA 3ZYWA 1O81A 4E68A 3RBTA 1Z7RA 2EC4A 1V58A 2NBSA 2R37A 1J0FA 4XS4A 2GZZA 1NHOA 4MZCA 1SU9A 3GKNA 1YKCA 1M9BA 1F6MC 3TOUA 5ECMB 2LEGA 2ALBA 4OO5A 3KXOA 4GRFA 4X1UA 2X8CA 4MJAA 1TU7A 5CNWA 5IPHA 2L6DA 3O76A 4IS0A 5JCWA 2GSTA 1S3DA 3F3RA 1ZMAA 1T4YA 5EPFA 1PN0A 5D96A 2NPBA 5CAXA 5E4WA 2OE3A 2V1MA 2QGVA 5DAKB 1PL2A 4FO5A 2IMKA 3VWVA 1G0TA 2C3NA 1PGTA 4ZBAA 2HZEA 4Z2RA 3Q6OA 1V9WA 1TRVA 2JU5A 2IN3A 3QAGA 2MMOA 1YF0A 4PUFC 3A3TA 3L9VA 4ISDA 5D9TA 2FA8A 3G7IA 1J08A 4Z2TA 5B6MA 3DEXA 3GFKA 5HFKA 1GH2A 2O89A 6GSYA 1KEBA 3A2WA 5JCGA 2MMAA 1GSSA 2VD0A 2DIZA 2EFDA 1QQ2A 5F05A 2YJ7A 4HQZA 2LV3A 1Y25A 2HSNA 4PX1A 2VAFA 1Q98A 2HZEB 3LXZA 1ST9A 4IHUA 3CBUA 3AY8A 4HJ2A 1SVMA 2RM6A 3FY7A 4Q5QA 1OKTA 3CYNA 3R2QA 3LFLA 3J7Yk 4IGJA 4ECBA 2O87A 5ELGA 1HNCA 3EPTA 5IMCA 3TRQA 4BVXA 1XW5A 3APQA 3UARA 2V41A 4TW5A 3HVVA 1UVZA 1OC9A 2LJKA 1Q4JA 1MTCA 3M9JA 1MDJA 4K2XA 4HUAA 5KOWA 5IOWA 5A4WA 1GTUA 4KSMA 1O6JA 4IBPA 2FUG2 4BL7A 3GNJA 3U5RE 2H0IA 2E2GA 3EE2A 4I5QA 3C7MA 2C4JA 5AIXA 5DALA 4RI7A 1A0RP 3JCML 3QOUA 4XS1A 2KP1A 3TUEA 4I8BA 2OBKA 3E3EA 4KB3A 3FKFA 4BVXB 1USBA 4LLRA 1OE8A 1O73A 1PQNA 4V1Ag 4RQXA 2IMDA 2M46A 4HI7A 1T3BA 4JEDA 3QAWA 1WIKA 3KMOA 1U3AA 4NAXA 5KOXA 2K8VA 5F07A 4IVFA 1N2AA 2LSTA 2EFHA 1T8EB 1DSBA 5KN3A 2AJQB 5HR3A 4BL7B 2IWTA 4AKGA 2C1YA 2MMZA 3TJGA 1M0UA 4IJIA 4ULXA 1WMJA 5BRTA 1OYJA 1UN2A 1FW1A 4GSNA 4E8EA 1H4OA 4BPYA 3GRXA 3FZ9A 2GLRA 3C1SA 3TKSC 2J9HA 4WKWA 5HFGA 2G0FA 1FHEA 1UC7A 3GL3A 3GKXA 1AIUA 2V6KA 1ACVA 1TTZA 4N10A 2HRAA 2M80A 3FR3A 5ECNB 4OMVA 1TRWA 1X5DA 2IMEA 4GWRA 5EL8A 5G2ZA 1C72A 3KD0A 1O8WA 2FA4A 4MPFA 3TCOA 1SENA 4O5QA 2LRNA 3LW9A 1U3IA 2C0FA 4OO4A 2O7KA 1EEMA 3ZL5A 11GSA 2B5YA 4LMWA 1OC3A 4YAVA 5ABRA 5A4UA 1I5GA 5AGYA 1U88A 3UBLA 1YZXA 5ID2B 4CHSA 1N25A 1EP8A 5IMZA 3MIXA 1YEXA 3GL5A 2IJYA 3FZAA 4ZB7A 1WE0A 2N5FA 4HDEA 5L71A 4HS1A 1EV9A 3VFIA 1BG5A 3BD2A 3F3QA 4KAEA 4TR0A 2RIIA 1XWGA 4G0KA 2MYGA 2OA7A 2L5OA 1XOAA 2WCIA 4WETA 5JCUA 3V1WA 3GMFA 5A5HA 3FEUA 3HHVA 4G2EA 3EYTA 4NV5A 3IOSA 3LWAA 2E2MA 2FLSA 1JFUA 5DDLA 2N5BA 1O7UA 4MF7A 1TKDB 1PX7A 2A4VA 3DRNA 2LJRA 1K0OA 2LNTA 3PPUA 3FRCA 1SD9A 4GQFA 2X8HA 3BJ5A 1TU8A 3HA9A 1JLVA 2H76A 3EWLA 1X5CA 2DMLA 2HQTA 5KN2A 4KDXA 1Y1UA 3KH9A 2AAWA 2GQMA 4WEYA 1XFLA 3TRXA 3IHGA 3FR6A 2A2RA 4MF6A 1OAZA 3IAS2 1CQHA 2F51A 2WULA 3WD6A 2PVOC 2GTUA 2DSAA 2B7KA 2H6ZA 5KN0A 3GTUA 5IOXA 1N8JA 4OD7A 3HKRA 3TKSA 2HSHA 1PD21 1BQ7A 4TXVA 2VM1A 4EVMA 5ECPB 2YWNA 4K6XA 4BWQA 5CRWA 4ZL8A 5F06A 2RUEA 5D9WA 4XRDA 5D93A 2HZFA 5A34B 2DKHA 1I9DA 4BWSA 4MK3A 1LBKA 4N30A 3TKSE 1SVLA 3GYKA 2O5VA 1TI1A 2CX3A 2H72A 5G30A 2X49A 4ML6A 3H93A 1E2YA 1URMA 2WJUA 2AYTA 3NOFA 3M8NA 3KEBA 4HU9A 1XPVA 3APSA 3O6TA 4K8MA 4AJ7A 5ECHB 1JZWA 3VWXA 3O3TA 3FHKA 1TJDA 5G1KA 3KH7A 3MWHA 1BYEA 4XCSA 2OADA 2H1LA 3ZLPA 3D22A 1WJKA 4GQCA 3SWLA 4FYCA 3US3A 4RUVA 2WFCA 5ECRB 1PKZA 4GF0A 4RQRA 4MJEA 2IIYA 2OE0A 2DC5A 1BJXA 2VLUA 3FYGA 3L9SA 4YH2A 4ZILA 2B6MA 1SK0A 4KW6A 3UBKA 1MD4A 1KTEA 4ZXGA 3HVXA 2CT6A 3KP9A 1SK2A 5DCHA 2H74A 5A4VA 2PMTA 3GURA 2HXKA 3C1RA 2VM2A 3L0HA 2X64A 5F0GA 1AW9A 1AUCA 4TR4A 1FVKA 4RI6A 1ABAA 5CP1A 2MBSA 3ISOA 1T4ZA 4PURA 4LA1A 2HRNA 3P2AA 4I6XA 2WS2A 4L5LA 3IA1A 4YQVA 5D9VA 1GNEA 1GLPA 4JR6A 1GTAA 3FK8A 2GZPA 3IBHA 1A23A 3C73A 2I9HA 4CY8A 9GSSA 1EGRA 3LQ7A 2F9SA 2R0GA 4WR4A 3HJOA 1FG4A 2FWFA 5LCZA 4Q5NA 4WF4A 4PNGA 1QGVA 5DAKA 3VLNA 3GH9A 3K8NA 3F4SA 4DSSB 2CZ3A 4K2DA 4EKZA 2NVLA 1T7PB 4MF5A 2ZCTA 3R3EA 5HR0A 4HJMA 2IPAA 1F9MA 2PPTA 2R3XA 2LNSA 4MLYA 1R7HA 5IMVA 4YKFA 4AGSA 1SJ6A 2JL4A 2DJ1A 5KEJA 1R26A 5COHA 4KNDA 2GSQA 1PL1A 3A2XA 1B9XC 2GZYA 3VPQA 1FB0A 1PKWA 3HCZA 3TJJA 2DBCA 4MNNA 3QPMA 1JHBA 4MJCA 2YNXA 2PU9C 3U6VA 4Q5RA 1ML6A 1F37A 3WGXA 5IPGA 2EFCA 3TJKA 2MBTA 4GXZA 4ZB9A 4N0ZA 1M2AA 3ED3A 4ZBDA 2HE3A 3I6AA 3D4TA 4POMA 2VIMA 4X0XA 2JACA 1ERWA 1TW9A 1NM3A 2GVPA 1XIYA 2R2JA 3LEFA 2DJ2A 3OR5A 3GX0A 4JU5A 2WB9A 3IR4A 1LJRA 2OBIA 4QL9A 2H1BA 5E59A 3RAZA 4KX4A 4K7IA 3HYPA 2K8SA 3G9BA 5J41A 5GSTA 1R5AA 2CZ2A 3TOTA 1EV4A 5CRHA 3QD9A 2KUCA 3LJRA 2QKEA 13GSA 2TIRA 4PQ1A 3HZ8A 1ZL9A 2ES7A 3Q18A 4F0CA 4KCEA 4ZB6A 1WPIA 5DBQA 1EOHA 3ZVJD 1XXUA 2A4HA 5B7CA 3P7XA 5H5RA 3HY2A 5J3RA 4LL4B 2DLXA 4GLTA 4V2MA 1K0CA 3W8SA 1SJIA 3L4NA 3GX8A 1GP1A 4N11A 2NTOA 2R0CA 1YY7A 5EY6A 3MAKA 4MPGA 1GULA 4F0BA 2XHFA 6GSVA 4W66A 2R6KA 1VF1A 5J9CA 4GSSA 4I2UA 3TDGA 4KUNA 3GV1A 4TXOB 2DJJA 1XCCA 4G19A 4POLA 2AB6A 2IMIA 2C0DA 1F3AA 3GHAA 4KDYA 3IHQA 4O7HA 4MZWA 4GCIA 4I2TA 4Z2UA 1ZCPA 4KA0A 2YP6A 8GSSA 2VO4A 2X4AA 3LORA 2L6CA 3HXSA 4V2LA 5ECIB 1BG1A 4KGIA 2V32A 4V2NA 1K0BA 2PVQA 2B5XA 4KCAA 2IMFA 1GLQA 3P8WA 1CQGA 5LD0A 4KSOA 2H71A 1NW2A 5EVOA 20GSA 3LSZA 5IO2A 3QCPA 1TOFA 1VF2A 3FR9A 4PQIA 2M72A 3EVIA 2VLVA 4OWYA 1XWBA 2KHPA 2GQLA 1A8YA 3RDWA 18GSA 3UMAA 4IJ3A 3KZQA 4O92A 4G0IA 2JSZA 1ERVA 5J5NA 1FOVA 1SL1B 2AUVA 5ID2A 3FMWA 2F8FA 2PERA 2L4QA 2L59A 3D21A 5JWQB 4AI6A 3WT2A 2RM5A 2PN8A 5HR2A 5AN1A 1GRXA 4KDUA 2ON5A 1ERUA 3I43A 4ZB8A 2FWGA 4MH3A 3HD5A 3KTLA 4XS6A 1YF1A 1EWXA 2BMXA 1VGLA 4ML1A 5D9XA 3IC8A 1RK4A 1S3AA 4AKXB 4TR1B 3UJ1A 2FWEA 3F9UA 1Z6NA 3HVSA 3RPPA 2YWIA 1GSUA 2I81A 2GQKA 1SKRB 4GSTA 2D2ZA 4IP1A 3S9FA 4N0VA 3BOAA 4G10A 2HSMB 2VOCA 4EIQA 5H5SA 1YDKA 1BX9A 4ECJA 4HZ4A 1AQWA 2YZUA 2ZNMA 1B9YC 2LQQA 3VURA 4F82A 1J9BA 3TGZA 1MD3A 1G6YA 4OCFA 1G7EA 1A0FA 1DUGA 1HNBA 3CSJA 16GSA 5IMAA 4OCEA 3TU3B 3IE3A 2R4VA 1ZYEA 2P5QA 4EXJA 3D6IA 1AQVA 4IQAA 4FYBA 1FO5A 5G31A 2GS3A 2DKIA 3CSIA 2HYXA 3G7YA 2BJXA 4PGTA 4MP4A 3EU4A 4NXIA 1XW9A 5A34A 2DIYA 2MZCA 1B4QA 4TR3A 4O5RA 2GDRA 3GSSA 3EMPA 4ID0A 2E7PA 2RLIA 2N5AA 2H30A 6GSUA 3GKMA 3GA4A 1F3BA 2YJHA 1GTIA 3DVWA 1DBYA 5J40A 3QDNA 2GT5A 4EC0A 1EGOA 3IK7A 3IDVA 1TK0B 2YWMA 1SYXA 1M9AA 2QA1A 4QQ7A 2CAIA 2GGTA 1TK8B 2H0HA 5ENUA 3UVHA 5A5KA 4AKHA 3VWUA 2FY6A 2MMNA 4QMKA 1X9MB 1X9WB 1U6TA 2E0QA 3BCIA 1SL2B 5CRGA 2WGRA 6GSSA 3QR6A 1ZYPA 4AJ6A 4OFNA 1XWCA 3LG6A 1BEDA 3I9V2 1XVQA 2YOIA 4K5RA 3F6FA 2FWHA 3F8UA 4DSQA 3P90A 4K1FA 2H8LA 5ECLB 3CWGA 3WGDA 4K5SA 2X8GA 3TKRA 3W8JA 1V98A 3IPZA 5BMUA 4PNFA 3LYKA 2JZTA 2L5LA 2C0GA 4MCUA 2DJ3A 1YEPA 4NHWA 2RUFA 2X99A 1SYRA 4FH8A 3F4RA 2HRKA 2TRCP 3W6GA 5GZZB 4EDZA 5J4UA 1QXHA 1ZYQB 2LKUA 1Z3EA 1ERTA 3C8EA 1ZYNA 4K9ZA 5DVBA 3UAPA 4NHZA 2KOKA 2F3MA 4HZ2A 3LGCA 2O85A 4PUAA 4OFTA 2I4AA 1OVNA 2R5GA 1SKSB 1MDKA 2LTKA 5BMUB 2YCDA 2B3SA 1V2AA 1Y6EA 3LXTA 2C80A 3WGEA 3EURA 2HNLA 1WRYA 17GSA 2VL2C 1IYIA 1K3OA 4G9HA 4IW9A 4J2FA 5FHIA 1OE7A 5IMFA 2HRKB 4HOJA 5FWGA 4XIHA 4DSSA 4FQUA 2XPEA 2WDUA 5B6NA 1BF5A 3Q19A 4EL1A 2LJAA 3KGKA 4NMUA 4AKIA 2VCQA 4DSRA 3M3MA 3A5IA 4WBRD 3KJYA 2AHEA 4WF5A 4OFMA 2YV9A 4AJ8A 3EINA 1JLWA 5G1LA 1FAAA 3GIXA 1TRUA 4G01A 5G5EA 2K6VA 3LYPA 5J4VA 2DMMA 2LUSA 4EUYA 2H6YA 10GSA 6GSXA 4TN8A 1VF3A 1QMVA 5HR1A 3VPTA 2K18A 4J57E 3Q74A 5FT3A 1SJZA 2OKAA 3GN3A 3NIVA 1EP7A 4BVYB 5C04A 3KTBA 2HRFA 1A2MA 4A5PA 5KN1A 5B8BA 1LU4A 3NZNA 2VKZG 2LS5A 5H5QA 2JZSA 4L5OA 1NHYA 2P0GA 3DMLA 3WT1A 4PXOA 2PWJA 3HMJG 1ZOFA 4MH2A 1THXA 1SD8A 3IV4A 2G2QA 3IK9A 5ELAA 2LRCA 1B48A 3H4KA 4AF2A 4KE3A 2H66A 3HDCA 2ZUPA 3KMNA 4POBA 1SVOA 2A2SA 12GSA 1U87A 3TB2A 1TRSA 1GUMA 1YJ6A 1ILOA 4YQMA 1XOBA 4P3YB 2P31A 3ME7A 4Z7XA 3M1GA 2LRTA 1Z9HA 1Z5YE 1G6WA 2YWOA 4K0NA 1GSEA 4Q5FA 3QFBC 4POKA 4XS4B 1K0DA 4XHMA 1E6BA 2OE1A 4EIPA 1GNWA 1A8LA 2H1AA 2VL3A 2VCVA 3QAVA 3MNGA 4MDCA 1W89A 1EEJA 1OC8A 5ECSA 4YKGA 1HD2A 2HT9A 3A2VA 2YPMA 2TRXA 1W4VA 2B5EA 5CYYA 1V57A 1XZOA 2H19A 3KM6A 2VL2A 4TXOA 3BBYA 3PGTA 2DJKA 3ZRDA 2GSSA 5AIVA 2L4CA 1O8XA 5DCGA 4I97A 3HZ4A 1WWJA 3FZ5A 1SL0B 4USSA 4DVCA 5DJMA 5CRDA 3G7JA 2CVBA 2UV8G 1PSQA 2C0EA 1TP9A 5DQSA 3ZREA 3H1NA 1ZZYA 1THOA 1JZDA 4DEJA 3CRUA 3RHCA 4L8EA 1O85A 3DD3A 4NPBA 3SBCA 1PX6A 4WR5A 2VUPA 2C8UA 4PTSA 2XBIA 4XRAA 4JE1A 4JRRA 5JWRB 4JBBA 1HYUA 1KNGA 3F4TA 2EFEA 3VK9A 4FIWA 2YV7A 2QA2A 4HQSA 3ZTLA 3D5JA 2EIQA 2H1DA 1X9SB 2CA8A 3J7Yb 1GTBA 1GUKA 2HSNB 4TVEA 2QSIA 3L78A 1UA5A 5D8IA 6GSTA 2R0PA 1XW6A 2VCXA 3EU3A 3APOA 4CW9A 3ZITA 1VF4A 2WRTA 3C71A 1K3LA 3DIEA 4K0GA 2EIOA 4K7NA 3KCMA 2H01A 5ECKB 1MDIA 4MA9A 5ECOB 1DE2A 4D73A 3ZIJA 1R5PA 3CSHA 1PRXA 5IO0A 1R4WA 1G7OA 2I1UA 2ON7A 4NWYA 22GSA 3CMIA 6GSWA 1TI3A 2H0GA 3N5OA 1AAZA 1OC9B 3N9JA 3FZ4A 2HFDA 2REMA 2O8VB 1EOGA 1PMTA 4JR4A 1MEKA 4F2IA 5G5FA 3ERFA 1K0MA 4IP6A 3VI7A 2GT6A 3ZZXA 5D73A 3UEMA 3KP8A 4MMMA 4TR1A 4KH7A 2H75A 2FD3A 3KIJA 5DALB 3MYDA 3EMXA 1DE1A 3TJBA 1OKDA 4D73B 2VCWA 2B1LA 4MZBA 4BA7A 1M99A 4HEA2 3VI5A 3WYWA 2CQ9A 2HSMA 3CXGA 3A5WA 3CTFA 3F0IA 3M9KA 1TDIA 4L0UA 1XWAA 4ILFA 1K3YA 14GSA 3FW2A 1S3CA 4ZL7A 2PUKC 5LNKe 4J56E 1GL8A 1GWCA 1M2BA 2H70A 2JZRA 4IN0A 2OACA 2FHEA 2FNOA 3GUSA 3IAM2 4IQ1A 3E9JB 1FVJA 2H1GA 3UL3A 4HU7A 19GSA 5ECQB 2CVDA 3ME8A 2YN1A 3HJPA 3PINA 2K9FA 2VLTA 2H73A 3D0ZA 3DKSA 2CVKA 4ZBBA 5IM9A 3GSTA 1FB6A 3TKPA 5IQYA 4XTSA 3ZMKA 2L57A 2C3QA 3GKKA 5IIZA 1WP0A 2VCTA 1XVWA 3L9UA 1AC1A 3DGQA 1VRSD 3CRTA 3ZVJA 1F2EA 1XBSA 5J9BA 4JZQA 5A1NA 3DWVA 2HLSA 1A2JA 4GDFA 2F8AA 5HFIA 2XC2A 2PGTA 5GAND 2A2PA 3TJFA 3DXBA 1WOUA 3IC4A 3MDKA 2GSRA 1GSYA 1PA3A 2OT3A 1Z6MA 1T1VA 4F03A 1SK1A 4CDOA 3IRAA 4NV2A 1A24A 1QK8A 4TRXA 1B4PA 4V1Ap 1K0NA 1TXUA 2FCHA 2PBJA 2CV4A 3QMXA 1RW1A 1GSFA 5B8AA 1H75A 3H8QA 3I69A 2LQOA 5A1NB 5DJLA 3RPNA 4ICYA 1HNAA 1JZOA 5C00A 3BCKA 4YQUA 5A5HB 3UIWA 1NSWA 4O32A 5CREA 4QL7A 4G0LA 1M2DA 7GSSA 1ON4A 3HJMA 1TXXA 1GSDA 5INYA 4N3ZA 4ZIJA 4WXTA 4LL1B 3CTGA 4LMVA 5AISA 2V2GA 4TKYA 3EC3A 2JSYA 4H86A 4L0WA 2B7JA 3F63A 1YQ1A 3ZFBA 3GH6A 4PQHA 3UOMA 5GSSA 1KBNA 3RHBA 3TKQA 5IMDA 1QUWA 4EE0A 4WBJA 1PN9A 2YZHA 1IYHA 2OJLA 2H6XA 2B1KA 1EZKA 2UZ8A 3PR8A 3H79A 3TRPA 2I3YA 2QC7A 2EIRA 4K7OA 3M0FA 1JZRA 2WZ9A 3GTUB 3ZIVA 3VWWA 1TK5B 4YAPA 2AV4A 3MSZA 4ACSA 2FGXA 1B8XA 2IFQA 5DQYA 2CX4A 2KP2A 4X43A 4ECCA 1RQMA 3ERWA 4X4JA 1A2LA 4TOPA 4CY6A 3ZMLA 3UVTA 5HQPA 1XWKA 1GUHA 1FOHA 2VL9A 5J47A 1ZGNA 3IXRA 3QFAC 4EF0A 1AXDA 2VD1A 2HSYA 3DYRA 2JADA 1X0RA 4O5UA 4F9ZA 3DVXA 2KLXA 4MABA 3ERGA 1BAYA 4KF9A 1SKWB 3F6DA 4MJBA 1YVLA 4EDYA 1QFNA 2BTOT 1T00A 1K0AA 4BVYA 5F8BA 1M7TA 2IFQB 2YANA 4FYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQX A;  1Z7P A;  3E0U A;  4ZL9 A;  3PH9 A;  4EO3 A;  5JWO B;  2DJ0 A;  3ZFL A;  5CO3 A;  4GTU A;  4IEL A;  2IL3 A;  2P5R A;  2VCZ A;  5GAP D;  2CAQ A;  2XBQ A;  4IKH A;  2V6O A;  4E8H A;  1X5E A;  3D4M A;  1YKA A;  2XPD A;  4ECI A;  1GSQ A;  1HQO A;  1V40 A;  2NDO A;  2C3T A;  2HI7 A;  2J23 A;  2Z9S A;  3ZYW A;  1O81 A;  3RBT A;  1Z7R A;  2EC4 A;  1V58 A;  2NBS A;  2R37 A;  1J0F A;  4XS4 A;  2GZZ A;  1NHO A;  4MZC A;  1SU9 A;  3GKN A;  1YKC A;  1M9B A;  1F6M C;  3TOU A;  5ECM B;  2LEG A;  2ALB A;  4OO5 A;  3KXO A;  4GRF A;  4X1U A;  2X8C A;  4MJA A;  1TU7 A;  5CNW A;  5IPH A;  2L6D A;  3O76 A;  4IS0 A;  5JCW A;  2GST A;  1S3D A;  3F3R A;  1ZMA A;  1T4Y A;  5EPF A;  5D96 A;  2NPB A;  5CAX A;  5E4W A;  2OE3 A;  2V1M A;  2QGV A;  5DAK B;  1PL2 A;  4FO5 A;  2IMK A;  3VWV A;  1G0T A;  2C3N A;  1PGT A;  4ZBA A;  2HZE A;  3Q6O A;  1V9W A;  1TRV A;  2JU5 A;  2IN3 A;  3QAG A;  2MMO A;  1YF0 A;  4PUF C;  3A3T A;  3L9V A;  4ISD A;  5D9T A;  2FA8 A;  3G7I A;  1J08 A;  5B6M A;  3DEX A;  3GFK A;  5HFK A;  1GH2 A;  2O89 A;  6GSY A;  1KEB A;  3A2W A;  5JCG A;  2MMA A;  1GSS A;  2VD0 A;  2DIZ A;  1QQ2 A;  5F05 A;  2YJ7 A;  4HQZ A;  2LV3 A;  1Y25 A;  4PX1 A;  2VAF A;  1Q98 A;  2HZE B;  3LXZ A;  1ST9 A;  4IHU A;  3CBU A;  3AY8 A;  4HJ2 A;  2RM6 A;  3FY7 A;  4Q5Q A;  1OKT A;  3CYN A;  3R2Q A;  3LFL A;  3J7Y k;  4IGJ A;  4ECB A;  2O87 A;  5ELG A;  1HNC A;  5IMC A;  3TRQ A;  4BVX A;  1XW5 A;  3APQ A;  3UAR A;  2V41 A;  4TW5 A;  3HVV A;  1UVZ A;  1OC9 A;  2LJK A;  1Q4J A;  1MTC A;  3M9J A;  1MDJ A;  4HUA A;  5IOW A;  5A4W A;  1GTU A;  4KSM A;  1O6J A;  4IBP A;  2FUG 2;  4BL7 A;  3GNJ A;  3U5R E;  2H0I A;  2E2G A;  3EE2 A;  4I5Q A;  3C7M A;  2C4J A;  5AIX A;  5DAL A;  4RI7 A;  1A0R P;  3JCM L;  3QOU A;  4XS1 A;  2KP1 A;  3TUE A;  4I8B A;  2OBK A;  3E3E A;  4KB3 A;  3FKF A;  4BVX B;  1USB A;  4LLR A;  1OE8 A;  1O73 A;  1PQN A;  4V1A g;  4RQX A;  2IMD A;  2M46 A;  4HI7 A;  1T3B A;  4JED A;  3QAW A;  1WIK A;  3KMO A;  1U3A A;  4NAX A;  2K8V A;  5F07 A;  4IVF A;  1N2A A;  2LST A;  1T8E B;  1DSB A;  5KN3 A;  2AJQ B;  5HR3 A;  4BL7 B;  2IWT A;  2C1Y A;  2MMZ A;  3TJG A;  1M0U A;  4IJI A;  4ULX A;  1WMJ A;  1OYJ A;  1UN2 A;  1FW1 A;  4GSN A;  4E8E A;  1H4O A;  4BPY A;  3GRX A;  3FZ9 A;  2GLR A;  3C1S A;  3TKS C;  2J9H A;  4WKW A;  5HFG A;  2G0F A;  1FHE A;  1UC7 A;  3GL3 A;  3GKX A;  1AIU A;  2V6K A;  1ACV A;  1TTZ A;  4N10 A;  2HRA A;  2M80 A;  3FR3 A;  5ECN B;  4OMV A;  1TRW A;  1X5D A;  2IME A;  4GWR A;  5EL8 A;  5G2Z A;  1C72 A;  3KD0 A;  1O8W A;  2FA4 A;  4MPF A;  3TCO A;  1SEN A;  2LRN A;  1U3I A;  2C0F A;  4OO4 A;  2O7K A;  1EEM A;  3ZL5 A;  11GS A;  2B5Y A;  4LMW A;  1OC3 A;  4YAV A;  5ABR A;  5A4U A;  1I5G A;  5AGY A;  1U88 A;  3UBL A;  1YZX A;  5ID2 B;  4CHS A;  1EP8 A;  5IMZ A;  1YEX A;  3GL5 A;  2IJY A;  3FZA A;  1WE0 A;  2N5F A;  4HDE A;  5L71 A;  4HS1 A;  1EV9 A;  3VFI A;  1BG5 A;  3BD2 A;  3F3Q A;  4KAE A;  4TR0 A;  2RII A;  1XWG A;  4G0K A;  2MYG A;  2OA7 A;  2L5O A;  1XOA A;  2WCI A;  4WET A;  5JCU A;  3V1W A;  3GMF A;  3FEU A;  3HHV A;  4G2E A;  3EYT A;  4NV5 A;  3IOS A;  3LWA A;  2E2M A;  2FLS A;  1JFU A;  5DDL A;  2N5B A;  1O7U A;  4MF7 A;  1TKD B;  1PX7 A;  2A4V A;  3DRN A;  2LJR A;  1K0O A;  2LNT A;  3PPU A;  3FRC A;  1SD9 A;  4GQF A;  2X8H A;  3BJ5 A;  1TU8 A;  3HA9 A;  1JLV A;  2H76 A;  3EWL A;  1X5C A;  2DML A;  2HQT A;  5KN2 A;  4KDX A;  3KH9 A;  2AAW A;  2GQM A;  4WEY A;  1XFL A;  3TRX A;  3FR6 A;  2A2R A;  4MF6 A;  1OAZ A;  3IAS 2;  1CQH A;  2F51 A;  2WUL A;  3WD6 A;  2PVO C;  2GTU A;  2DSA A;  2B7K A;  2H6Z A;  5KN0 A;  3GTU A;  5IOX A;  1N8J A;  4OD7 A;  3HKR A;  3TKS A;  2HSH A;  1PD2 1;  1BQ7 A;  4TXV A;  2VM1 A;  4EVM A;  5ECP B;  2YWN A;  4K6X A;  4BWQ A;  5CRW A;  4ZL8 A;  5F06 A;  2RUE A;  5D9W A;  4XRD A;  5D93 A;  2HZF A;  1I9D A;  4BWS A;  4MK3 A;  1LBK A;  4N30 A;  3TKS E;  3GYK A;  2CX3 A;  1TI1 A;  2H72 A;  5G30 A;  4ML6 A;  3H93 A;  1E2Y A;  1URM A;  2WJU A;  2AYT A;  3NOF A;  3M8N A;  3KEB A;  4HU9 A;  1XPV A;  3APS A;  3O6T A;  4K8M A;  4AJ7 A;  5ECH B;  1JZW A;  3VWX A;  3O3T A;  3FHK A;  1TJD A;  5G1K A;  3KH7 A;  3MWH A;  1BYE A;  4XCS A;  2OAD A;  3ZLP A;  3D22 A;  1WJK A;  4GQC A;  3SWL A;  4FYC A;  3US3 A;  4RUV A;  2WFC A;  5ECR B;  1PKZ A;  4GF0 A;  4RQR A;  4MJE A;  2IIY A;  2OE0 A;  2DC5 A;  1BJX A;  2VLU A;  3FYG A;  3L9S A;  4YH2 A;  4ZIL A;  2B6M A;  1SK0 A;  4KW6 A;  3UBK A;  1MD4 A;  1KTE A;  4ZXG A;  3HVX A;  2CT6 A;  3KP9 A;  1SK2 A;  5DCH A;  2H74 A;  5A4V A;  2PMT A;  3GUR A;  2HXK A;  3C1R A;  2VM2 A;  3L0H A;  2X64 A;  5F0G A;  1AW9 A;  1AUC A;  4TR4 A;  1FVK A;  4RI6 A;  1ABA A;  5CP1 A;  2MBS A;  3ISO A;  1T4Z A;  4PUR A;  4LA1 A;  2HRN A;  3P2A A;  4I6X A;  2WS2 A;  4L5L A;  3IA1 A;  4YQV A;  5D9V A;  1GNE A;  1GLP A;  4JR6 A;  1GTA A;  3FK8 A;  2GZP A;  3IBH A;  1A23 A;  3C73 A;  2I9H A;  9GSS A;  1EGR A;  3LQ7 A;  2F9S A;  4WR4 A;  3HJO A;  1FG4 A;  2FWF A;  5LCZ A;  4Q5N A;  4WF4 A;  4PNG A;  1QGV A;  5DAK A;  3VLN A;  3GH9 A;  3K8N A;  3F4S A;  4DSS B;  2CZ3 A;  4K2D A;  4EKZ A;  2NVL A;  1T7P B;  4MF5 A;  2ZCT A;  3R3E A;  5HR0 A;  4HJM A;  2IPA A;  1F9M A;  2PPT A;  2R3X A;  2LNS A;  4MLY A;  1R7H A;  5IMV A;  4AGS A;  1SJ6 A;  2JL4 A;  2DJ1 A;  5KEJ A;  1R26 A;  5COH A;  4KND A;  2GSQ A;  1PL1 A;  3A2X A;  1B9X C;  2GZY A;  3VPQ A;  1FB0 A;  1PKW A;  3HCZ A;  3TJJ A;  2DBC A;  3QPM A;  1JHB A;  4MJC A;  2YNX A;  2PU9 C;  3U6V A;  4Q5R A;  1ML6 A;  1F37 A;  3WGX A;  5IPG A;  3TJK A;  2MBT A;  4GXZ A;  4ZB9 A;  4N0Z A;  1M2A A;  3ED3 A;  4ZBD A;  2HE3 A;  3I6A A;  3D4T A;  4POM A;  2VIM A;  4X0X A;  2JAC A;  1ERW A;  1TW9 A;  1NM3 A;  2GVP A;  1XIY A;  2R2J A;  3LEF A;  2DJ2 A;  3OR5 A;  3GX0 A;  4JU5 A;  2WB9 A;  3IR4 A;  1LJR A;  2OBI A;  4QL9 A;  2H1B A;  5E59 A;  3RAZ A;  4KX4 A;  4K7I A;  3HYP A;  2K8S A;  3G9B A;  5J41 A;  5GST A;  1R5A A;  2CZ2 A;  3TOT A;  1EV4 A;  5CRH A;  3QD9 A;  2KUC A;  3LJR A;  2QKE A;  13GS A;  2TIR A;  4PQ1 A;  3HZ8 A;  1ZL9 A;  2ES7 A;  3Q18 A;  4F0C A;  4KCE A;  4ZB6 A;  1WPI A;  5DBQ A;  1EOH A;  3ZVJ D;  1XXU A;  5B7C A;  3P7X A;  5H5R A;  3HY2 A;  5J3R A;  4LL4 B;  2DLX A;  4GLT A;  4V2M A;  1K0C A;  3W8S A;  1SJI A;  3L4N A;  3GX8 A;  1GP1 A;  4N11 A;  2NTO A;  1YY7 A;  5EY6 A;  3MAK A;  4MPG A;  1GUL A;  4F0B A;  2XHF A;  6GSV A;  2R6K A;  1VF1 A;  5J9C A;  4GSS A;  4I2U A;  3TDG A;  4KUN A;  3GV1 A;  4TXO B;  2DJJ A;  1XCC A;  4G19 A;  4POL A;  2AB6 A;  2IMI A;  2C0D A;  1F3A A;  3GHA A;  4KDY A;  3IHQ A;  4O7H A;  4MZW A;  4GCI A;  4I2T A;  1ZCP A;  4KA0 A;  2YP6 A;  8GSS A;  2VO4 A;  3LOR A;  2L6C A;  3HXS A;  4V2L A;  5ECI B;  4V2N A;  4KGI A;  2V32 A;  1K0B A;  2PVQ A;  2B5X A;  4KCA A;  2IMF A;  1GLQ A;  3P8W A;  1CQG A;  5LD0 A;  4KSO A;  2H71 A;  1NW2 A;  5EVO A;  20GS A;  3LSZ A;  5IO2 A;  3QCP A;  1TOF A;  1VF2 A;  3FR9 A;  4PQI A;  2M72 A;  3EVI A;  2VLV A;  4OWY A;  1XWB A;  2KHP A;  2GQL A;  1A8Y A;  3RDW A;  18GS A;  3UMA A;  4IJ3 A;  3KZQ A;  4O92 A;  4G0I A;  2JSZ A;  1ERV A;  5J5N A;  1FOV A;  1SL1 B;  2AUV A;  5ID2 A;  2F8F A;  2PER A;  2L4Q A;  2L59 A;  3D21 A;  5JWQ B;  3WT2 A;  2RM5 A;  2PN8 A;  5HR2 A;  5AN1 A;  1GRX A;  4KDU A;  2ON5 A;  1ERU A;  3I43 A;  4ZB8 A;  2FWG A;  4MH3 A;  3HD5 A;  3KTL A;  4XS6 A;  1YF1 A;  1EWX A;  2BMX A;  1VGL A;  4ML1 A;  5D9X A;  3IC8 A;  1RK4 A;  1S3A A;  4TR1 B;  3UJ1 A;  2FWE A;  3F9U A;  1Z6N A;  3HVS A;  3RPP A;  2YWI A;  1GSU A;  2I81 A;  2GQK A;  1SKR B;  4GST A;  2D2Z A;  4IP1 A;  3S9F A;  4N0V A;  3BOA A;  4G10 A;  2HSM B;  2VOC A;  5H5S A;  1YDK A;  1BX9 A;  4ECJ A;  4HZ4 A;  1AQW A;  2YZU A;  2ZNM A;  1B9Y C;  2LQQ A;  3VUR A;  4F82 A;  1J9B A;  3TGZ A;  1MD3 A;  1G6Y A;  4OCF A;  1G7E A;  1A0F A;  1DUG A;  1HNB A;  3CSJ A;  16GS A;  5IMA A;  4OCE A;  3IE3 A;  2R4V A;  1ZYE A;  2P5Q A;  4EXJ A;  3D6I A;  1AQV A;  4IQA A;  4FYB A;  1FO5 A;  5G31 A;  2GS3 A;  3G7Y A;  3CSI A;  2HYX A;  2BJX A;  4PGT A;  4MP4 A;  3EU4 A;  4NXI A;  1XW9 A;  1B4Q A;  2DIY A;  2MZC A;  4TR3 A;  4O5R A;  2GDR A;  3GSS A;  3EMP A;  4ID0 A;  2E7P A;  2RLI A;  2N5A A;  2H30 A;  6GSU A;  3GKM A;  3GA4 A;  1F3B A;  2YJH A;  1GTI A;  3DVW A;  1DBY A;  3QDN A;  2GT5 A;  4EC0 A;  1EGO A;  3IK7 A;  3IDV A;  1TK0 B;  2YWM A;  1SYX A;  1M9A A;  4QQ7 A;  2CAI A;  2GGT A;  1TK8 B;  2H0H A;  5ENU A;  3UVH A;  5A5K A;  3VWU A;  2FY6 A;  2MMN A;  1X9M B;  1X9W B;  1U6T A;  2E0Q A;  3BCI A;  1SL2 B;  5CRG A;  2WGR A;  6GSS A;  3QR6 A;  4AJ6 A;  4OFN A;  1XWC A;  3LG6 A;  1BED A;  3I9V 2;  1XVQ A;  2YOI A;  3F6F A;  2FWH A;  3F8U A;  4DSQ A;  3P90 A;  4K1F A;  2H8L A;  5ECL B;  3WGD A;  2X8G A;  3TKR A;  3W8J A;  1V98 A;  3IPZ A;  5BMU A;  4PNF A;  3LYK A;  2JZT A;  2L5L A;  2C0G A;  4MCU A;  2DJ3 A;  1YEP A;  4NHW A;  2RUF A;  2X99 A;  1SYR A;  4FH8 A;  3F4R A;  2HRK A;  2TRC P;  3W6G A;  5GZZ B;  4EDZ A;  5J4U A;  1QXH A;  1ZYQ B;  2LKU A;  1Z3E A;  1ERT A;  3C8E A;  4K9Z A;  5DVB A;  3UAP A;  4NHZ A;  2KOK A;  2F3M A;  4HZ2 A;  3LGC A;  2O85 A;  4PUA A;  4OFT A;  2I4A A;  1OVN A;  2R5G A;  1SKS B;  1MDK A;  2LTK A;  2YCD A;  2B3S A;  1V2A A;  1Y6E A;  3LXT A;  2C80 A;  3WGE A;  3EUR A;  2HNL A;  1WRY A;  17GS A;  2VL2 C;  1IYI A;  1K3O A;  4G9H A;  4IW9 A;  4J2F A;  5FHI A;  1OE7 A;  5IMF A;  2HRK B;  4HOJ A;  5FWG A;  4XIH A;  4DSS A;  4FQU A;  2XPE A;  2WDU A;  5B6N A;  4EL1 A;  3Q19 A;  2LJA A;  3KGK A;  4NMU A;  2VCQ A;  4DSR A;  3M3M A;  4WBR D;  3KJY A;  2AHE A;  4WF5 A;  4OFM A;  2YV9 A;  4AJ8 A;  3EIN A;  1JLW A;  5G1L A;  1FAA A;  3GIX A;  1TRU A;  5G5E A;  2K6V A;  3LYP A;  2DMM A;  2LUS A;  4EUY A;  2H6Y A;  10GS A;  6GSX A;  4TN8 A;  1VF3 A;  1QMV A;  5HR1 A;  3VPT A;  2K18 A;  4J57 E;  3Q74 A;  5FT3 A;  1SJZ A;  2OKA A;  3GN3 A;  3NIV A;  1EP7 A;  4BVY B;  5C04 A;  3KTB A;  2HRF A;  1A2M A;  5KN1 A;  5B8B A;  1LU4 A;  3NZN A;  2LS5 A;  5H5Q A;  2JZS A;  4L5O A;  1NHY A;  2P0G A;  3DML A;  3WT1 A;  4PXO A;  2PWJ A;  1ZOF A;  4MH2 A;  1THX A;  1SD8 A;  3IV4 A;  2G2Q A;  3IK9 A;  5ELA A;  2LRC A;  1B48 A;  3H4K A;  4AF2 A;  4KE3 A;  2H66 A;  3HDC A;  2ZUP A;  3KMN A;  4POB A;  2A2S A;  12GS A;  1U87 A;  3TB2 A;  1TRS A;  1GUM A;  1YJ6 A;  1ILO A;  4YQM A;  1XOB A;  4P3Y B;  2P31 A;  3ME7 A;  4Z7X A;  3M1G A;  2LRT A;  1Z9H A;  1Z5Y E;  1G6W A;  2YWO A;  4K0N A;  1GSE A;  4Q5F A;  3QFB C;  4POK A;  4XS4 B;  1K0D A;  4XHM A;  1E6B A;  2OE1 A;  1GNW A;  1A8L A;  2H1A A;  2VL3 A;  2VCV A;  3QAV A;  3MNG A;  4MDC A;  1W89 A;  1EEJ A;  1OC8 A;  5ECS A;  1HD2 A;  2HT9 A;  3A2V A;  2YPM A;  2TRX A;  1W4V A;  2B5E A;  5CYY A;  1V57 A;  1XZO A;  2H19 A;  3KM6 A;  2VL2 A;  4TXO A;  3BBY A;  3PGT A;  2DJK A;  3ZRD A;  2GSS A;  5AIV A;  2L4C A;  1O8X A;  5DCG A;  4I97 A;  3HZ4 A;  1WWJ A;  3FZ5 A;  1SL0 B;  4USS A;  4DVC A;  5DJM A;  5CRD A;  3G7J A;  2CVB A;  1PSQ A;  2C0E A;  1TP9 A;  5DQS A;  3ZRE A;  3H1N A;  1ZZY A;  1THO A;  1JZD A;  4DEJ A;  3CRU A;  3RHC A;  4L8E A;  1O85 A;  3DD3 A;  4NPB A;  3SBC A;  1PX6 A;  4WR5 A;  2VUP A;  2C8U A;  4PTS A;  2XBI A;  4XRA A;  4JE1 A;  4JRR A;  5JWR B;  4JBB A;  1HYU A;  1KNG A;  3F4T A;  3VK9 A;  4FIW A;  2YV7 A;  4HQS A;  3ZTL A;  3D5J A;  2EIQ A;  2H1D A;  1X9S B;  2CA8 A;  3J7Y b;  1GTB A;  1GUK A;  2HSN B;  4TVE A;  2QSI A;  3L78 A;  1UA5 A;  5D8I A;  6GST A;  1XW6 A;  2VCX A;  3EU3 A;  3APO A;  4CW9 A;  3ZIT A;  1VF4 A;  2WRT A;  3C71 A;  1K3L A;  3DIE A;  4K0G A;  2EIO A;  4K7N A;  3KCM A;  2H01 A;  5ECK B;  1MDI A;  4MA9 A;  5ECO B;  1DE2 A;  4D73 A;  3ZIJ A;  1R5P A;  3CSH A;  1PRX A;  5IO0 A;  1R4W A;  1G7O A;  2I1U A;  2ON7 A;  4NWY A;  22GS A;  3CMI A;  6GSW A;  1TI3 A;  2H0G A;  3N5O A;  1AAZ A;  1OC9 B;  3N9J A;  3FZ4 A;  2HFD A;  2REM A;  2O8V B;  1EOG A;  1PMT A;  4JR4 A;  1MEK A;  4F2I A;  5G5F A;  3ERF A;  1K0M A;  4IP6 A;  3VI7 A;  2GT6 A;  3ZZX A;  5D73 A;  3UEM A;  3KP8 A;  4MMM A;  4TR1 A;  4KH7 A;  2H75 A;  2FD3 A;  3KIJ A;  5DAL B;  3EMX A;  1DE1 A;  3TJB A;  1OKD A;  4D73 B;  2VCW A;  2B1L A;  4MZB A;  4BA7 A;  1M99 A;  4HEA 2;  3VI5 A;  3WYW A;  2CQ9 A;  2HSM A;  3CXG A;  3A5W A;  3CTF A;  3F0I A;  3M9K A;  1TDI A;  4L0U A;  1XWA A;  4ILF A;  1K3Y A;  14GS A;  3FW2 A;  1S3C A;  4ZL7 A;  2PUK C;  5LNK e;  4J56 E;  1GL8 A;  1GWC A;  1M2B A;  2H70 A;  2JZR A;  4IN0 A;  2OAC A;  2FHE A;  2FNO A;  3GUS A;  3IAM 2;  4IQ1 A;  3E9J B;  1FVJ A;  2H1G A;  3UL3 A;  4HU7 A;  19GS A;  5ECQ B;  2CVD A;  3ME8 A;  2YN1 A;  3HJP A;  3PIN A;  2K9F A;  2VLT A;  2H73 A;  3D0Z A;  3DKS A;  2CVK A;  4ZBB A;  5IM9 A;  3GST A;  1FB6 A;  3TKP A;  5IQY A;  4XTS A;  3ZMK A;  2L57 A;  2C3Q A;  3GKK A;  5IIZ A;  1WP0 A;  2VCT A;  1XVW A;  3L9U A;  1AC1 A;  3DGQ A;  1VRS D;  3CRT A;  3ZVJ A;  1F2E A;  1XBS A;  5J9B A;  4JZQ A;  3DWV A;  2HLS A;  1A2J A;  2F8A A;  5HFI A;  2XC2 A;  2PGT A;  5GAN D;  3TJF A;  3DXB A;  1WOU A;  3IC4 A;  3MDK A;  2GSR A;  1GSY A;  1PA3 A;  1Z6M A;  1T1V A;  4F03 A;  1SK1 A;  4CDO A;  3IRA A;  4NV2 A;  1A24 A;  1QK8 A;  4TRX A;  1B4P A;  4V1A p;  1K0N A;  2FCH A;  2PBJ A;  2CV4 A;  3QMX A;  1RW1 A;  1GSF A;  5B8A A;  1H75 A;  3H8Q A;  3I69 A;  2LQO A;  5DJL A;  3RPN A;  1HNA A;  1JZO A;  5C00 A;  3BCK A;  4YQU A;  3UIW A;  1NSW A;  4O32 A;  5CRE A;  4QL7 A;  4G0L A;  1M2D A;  7GSS A;  1ON4 A;  3HJM A;  1TXX A;  1GSD A;  5INY A;  4ZIJ A;  4WXT A;  4LL1 B;  3CTG A;  4LMV A;  5AIS A;  2V2G A;  4TKY A;  3EC3 A;  2JSY A;  4H86 A;  4L0W A;  2B7J A;  3F63 A;  1YQ1 A;  3ZFB A;  3GH6 A;  4PQH A;  3UOM A;  5GSS A;  1KBN A;  3RHB A;  3TKQ A;  5IMD A;  1QUW A;  4EE0 A;  4WBJ A;  1PN9 A;  2YZH A;  1IYH A;  2OJL A;  2H6X A;  2B1K A;  1EZK A;  2UZ8 A;  3PR8 A;  3H79 A;  3TRP A;  2I3Y A;  2QC7 A;  2EIR A;  4K7O A;  3M0F A;  1JZR A;  2WZ9 A;  3GTU B;  3ZIV A;  3VWW A;  1TK5 B;  4YAP A;  2AV4 A;  3MSZ A;  4ACS A;  2FGX A;  1B8X A;  2IFQ A;  5DQY A;  2CX4 A;  2KP2 A;  4X43 A;  4ECC A;  1RQM A;  3ERW A;  1A2L A;  4TOP A;  3ZML A;  3UVT A;  5HQP A;  1XWK A;  1GUH A;  2VL9 A;  1ZGN A;  3IXR A;  3QFA C;  4EF0 A;  1AXD A;  2VD1 A;  2HSY A;  3DYR A;  2JAD A;  1X0R A;  4F9Z A;  3DVX A;  2KLX A;  4MAB A;  3ERG A;  1BAY A;  4KF9 A;  1SKW B;  3F6D A;  4MJB A;  4EDY A;  1QFN A;  2BTO T;  1T00 A;  1K0A A;  4BVY A;  5F8B A;  1M7T A;  2IFQ B;  2YAN A;  4FYU A; 
#chains in the Genus database with same CATH topology
 1AQX A;  1Z7P A;  3E0U A;  4ZL9 A;  3PH9 A;  4EO3 A;  5JWO B;  2DJ0 A;  3ZFL A;  5CO3 A;  4GTU A;  4IEL A;  2IL3 A;  2P5R A;  2VCZ A;  5GAP D;  2CAQ A;  2XBQ A;  5J4Y A;  4IKH A;  2V6O A;  4E8H A;  1X5E A;  3D4M A;  1YKA A;  2XPD A;  3CQF A;  4ECI A;  1GSQ A;  1HQO A;  1V40 A;  2NDO A;  2C3T A;  2HI7 A;  2J23 A;  2Z9S A;  3ZYW A;  1O81 A;  4E68 A;  3RBT A;  1Z7R A;  2EC4 A;  1V58 A;  2NBS A;  2R37 A;  1J0F A;  4XS4 A;  2GZZ A;  1NHO A;  4MZC A;  1SU9 A;  3GKN A;  1YEW C;  1YKC A;  1M9B A;  1F6M C;  3TOU A;  5ECM B;  2LEG A;  2ALB A;  4OO5 A;  3KXO A;  4GRF A;  4X1U A;  2X8C A;  4MJA A;  1TU7 A;  5CNW A;  5IPH A;  2L6D A;  3O76 A;  4IS0 A;  5JCW A;  2GST A;  1S3D A;  3F3R A;  1ZMA A;  1T4Y A;  5EPF A;  1PN0 A;  5D96 A;  2NPB A;  5CAX A;  5E4W A;  2OE3 A;  2V1M A;  2QGV A;  5DAK B;  1PL2 A;  4FO5 A;  2IMK A;  3VWV A;  1G0T A;  2C3N A;  1PGT A;  4ZBA A;  2HZE A;  4Z2R A;  3Q6O A;  1V9W A;  1TRV A;  2JU5 A;  2IN3 A;  3QAG A;  2MMO A;  1YF0 A;  4PUF C;  3A3T A;  3L9V A;  4ISD A;  5D9T A;  2FA8 A;  3G7I A;  1J08 A;  4Z2T A;  5B6M A;  3DEX A;  3GFK A;  5HFK A;  1GH2 A;  2O89 A;  6GSY A;  1KEB A;  3A2W A;  5JCG A;  3RGB C;  2MMA A;  1GSS A;  2VD0 A;  2DIZ A;  2EFD A;  1QQ2 A;  5F05 A;  2YJ7 A;  4HQZ A;  2LV3 A;  1Y25 A;  2HSN A;  4PX1 A;  2VAF A;  1Q98 A;  2HZE B;  3LXZ A;  1ST9 A;  4IHU A;  3CBU A;  3AY8 A;  4HJ2 A;  1SVM A;  2RM6 A;  3FY7 A;  4Q5Q A;  1OKT A;  3CYN A;  3R2Q A;  3LFL A;  3J7Y k;  4IGJ A;  4ECB A;  2O87 A;  5ELG A;  1HNC A;  3EPT A;  5IMC A;  3TRQ A;  4BVX A;  1XW5 A;  3APQ A;  3UAR A;  2V41 A;  4TW5 A;  3HVV A;  1UVZ A;  1OC9 A;  2LJK A;  1Q4J A;  1MTC A;  3M9J A;  1MDJ A;  4K2X A;  4HUA A;  5KOW A;  5IOW A;  5A4W A;  1GTU A;  4KSM A;  1O6J A;  4IBP A;  2FUG 2;  4BL7 A;  3GNJ A;  3U5R E;  2H0I A;  2E2G A;  3EE2 A;  4I5Q A;  3C7M A;  2C4J A;  5AIX A;  5DAL A;  4RI7 A;  1A0R P;  3JCM L;  3QOU A;  4XS1 A;  2KP1 A;  3TUE A;  4I8B A;  2OBK A;  3E3E A;  4KB3 A;  3FKF A;  4BVX B;  1USB A;  4LLR A;  1OE8 A;  1O73 A;  1PQN A;  4V1A g;  4RQX A;  2IMD A;  2M46 A;  4HI7 A;  1T3B A;  4JED A;  3QAW A;  1WIK A;  3KMO A;  1U3A A;  4NAX A;  5KOX A;  2K8V A;  5F07 A;  4IVF A;  1N2A A;  2LST A;  2EFH A;  1T8E B;  1DSB A;  5KN3 A;  2AJQ B;  5HR3 A;  4BL7 B;  2IWT A;  4AKG A;  2C1Y A;  2MMZ A;  3TJG A;  1M0U A;  4IJI A;  4ULX A;  1WMJ A;  5BRT A;  1OYJ A;  1UN2 A;  1FW1 A;  4GSN A;  4E8E A;  1H4O A;  4BPY A;  3GRX A;  3FZ9 A;  2GLR A;  3C1S A;  3TKS C;  2J9H A;  4WKW A;  5HFG A;  2G0F A;  1FHE A;  1UC7 A;  3GL3 A;  3GKX A;  1AIU A;  2V6K A;  1ACV A;  1TTZ A;  4N10 A;  2HRA A;  2M80 A;  3FR3 A;  5ECN B;  4OMV A;  1TRW A;  1X5D A;  2IME A;  4GWR A;  5EL8 A;  5G2Z A;  1C72 A;  3KD0 A;  1O8W A;  2FA4 A;  4MPF A;  3TCO A;  1SEN A;  4O5Q A;  2LRN A;  3LW9 A;  1U3I A;  2C0F A;  4OO4 A;  2O7K A;  1EEM A;  3ZL5 A;  11GS A;  2B5Y A;  4LMW A;  1OC3 A;  4YAV A;  5ABR A;  5A4U A;  1I5G A;  5AGY A;  1U88 A;  3UBL A;  1YZX A;  5ID2 B;  4CHS A;  1N25 A;  1EP8 A;  5IMZ A;  3MIX A;  1YEX A;  3GL5 A;  2IJY A;  3FZA A;  4ZB7 A;  1WE0 A;  2N5F A;  4HDE A;  5L71 A;  4HS1 A;  1EV9 A;  3VFI A;  1BG5 A;  3BD2 A;  3F3Q A;  4KAE A;  4TR0 A;  2RII A;  1XWG A;  4G0K A;  2MYG A;  2OA7 A;  2L5O A;  1XOA A;  2WCI A;  1S3R A;  4WET A;  5JCU A;  3V1W A;  3GMF A;  5A5H A;  3FEU A;  3HHV A;  4G2E A;  3EYT A;  4NV5 A;  3IOS A;  3LWA A;  2E2M A;  2FLS A;  1JFU A;  5DDL A;  2N5B A;  1O7U A;  4MF7 A;  1TKD B;  1PX7 A;  2A4V A;  3DRN A;  2LJR A;  1K0O A;  2LNT A;  3PPU A;  3FRC A;  1SD9 A;  4GQF A;  2X8H A;  3BJ5 A;  1TU8 A;  3HA9 A;  1JLV A;  2H76 A;  3EWL A;  1X5C A;  2DML A;  2HQT A;  5KN2 A;  4KDX A;  1Y1U A;  3KH9 A;  2AAW A;  2GQM A;  4WEY A;  1XFL A;  3TRX A;  3IHG A;  3FR6 A;  2A2R A;  4MF6 A;  1OAZ A;  3IAS 2;  1CQH A;  2F51 A;  2WUL A;  3WD6 A;  2PVO C;  2GTU A;  2DSA A;  2B7K A;  2H6Z A;  5KN0 A;  3GTU A;  5IOX A;  1N8J A;  4OD7 A;  3HKR A;  3TKS A;  2HSH A;  1PD2 1;  1BQ7 A;  4TXV A;  2VM1 A;  4EVM A;  5ECP B;  2YWN A;  4K6X A;  4BWQ A;  5CRW A;  4ZL8 A;  5F06 A;  2RUE A;  5D9W A;  4XRD A;  5D93 A;  2HZF A;  5A34 B;  2DKH A;  1I9D A;  4BWS A;  4MK3 A;  1LBK A;  4N30 A;  3TKS E;  1SVL A;  3GYK A;  2O5V A;  1TI1 A;  2CX3 A;  2H72 A;  5G30 A;  2X49 A;  4ML6 A;  3H93 A;  1E2Y A;  1URM A;  2WJU A;  2AYT A;  3NOF A;  3M8N A;  3KEB A;  4HU9 A;  1XPV A;  3APS A;  3O6T A;  4K8M A;  4AJ7 A;  5ECH B;  1JZW A;  3VWX A;  3O3T A;  3FHK A;  1TJD A;  5G1K A;  3KH7 A;  3MWH A;  1BYE A;  4XCS A;  2OAD A;  2H1L A;  3ZLP A;  3D22 A;  1WJK A;  4GQC A;  3SWL A;  4FYC A;  3US3 A;  2WVX B;  4RUV A;  2WFC A;  2WZS A;  5ECR B;  1PKZ A;  4GF0 A;  4RQR A;  4MJE A;  2IIY A;  2OE0 A;  2DC5 A;  1BJX A;  2VLU A;  3FYG A;  3L9S A;  4YH2 A;  4ZIL A;  2B6M A;  1SK0 A;  4KW6 A;  3UBK A;  1MD4 A;  1KTE A;  4ZXG A;  3HVX A;  2CT6 A;  3KP9 A;  1SK2 A;  5DCH A;  2H74 A;  5A4V A;  2PMT A;  3GUR A;  2HXK A;  3C1R A;  2VM2 A;  3L0H A;  2X64 A;  5F0G A;  1AW9 A;  1AUC A;  4TR4 A;  1FVK A;  4RI6 A;  1ABA A;  4PI0 C;  5CP1 A;  2MBS A;  3ISO A;  1T4Z A;  4PUR A;  4LA1 A;  2HRN A;  3P2A A;  4I6X A;  2WS2 A;  4L5L A;  3IA1 A;  4YQV A;  5D9V A;  1GNE A;  1GLP A;  4JR6 A;  1GTA A;  3FK8 A;  2GZP A;  3IBH A;  1A23 A;  3C73 A;  2I9H A;  4CY8 A;  9GSS A;  1EGR A;  3LQ7 A;  2O3E A;  2F9S A;  2R0G A;  4WR4 A;  3HJO A;  1FG4 A;  2FWF A;  5LCZ A;  4Q5N A;  4WF4 A;  4PNG A;  1QGV A;  5DAK A;  3VLN A;  3GH9 A;  3K8N A;  3F4S A;  4DSS B;  2CZ3 A;  4K2D A;  4EKZ A;  2NVL A;  1T7P B;  4MF5 A;  2ZCT A;  3HVN A;  3R3E A;  5HR0 A;  4HJM A;  2IPA A;  1F9M A;  2PPT A;  2R3X A;  2LNS A;  4MLY A;  1R7H A;  5IMV A;  4YKF A;  4AGS A;  1SJ6 A;  2JL4 A;  2DJ1 A;  5KEJ A;  1R26 A;  5COH A;  4KND A;  2GSQ A;  1PL1 A;  3A2X A;  1B9X C;  2GZY A;  3VPQ A;  1FB0 A;  1PKW A;  3HCZ A;  3TJJ A;  2DBC A;  4MNN A;  3QPM A;  1JHB A;  4MJC A;  2YNX A;  2PU9 C;  3U6V A;  4Q5R A;  1ML6 A;  1F37 A;  3WGX A;  5IPG A;  2EFC A;  3TJK A;  2MBT A;  4GXZ A;  4ZB9 A;  4N0Z A;  1M2A A;  3ED3 A;  4ZBD A;  2HE3 A;  3I6A A;  3D4T A;  4POM A;  2VIM A;  4X0X A;  2JAC A;  1ERW A;  1TW9 A;  1NM3 A;  2GVP A;  1XIY A;  2R2J A;  3LEF A;  2DJ2 A;  3OR5 A;  3GX0 A;  4JU5 A;  2WB9 A;  3IR4 A;  1LJR A;  2OBI A;  4QL9 A;  2H1B A;  5E59 A;  3RAZ A;  4KX4 A;  4K7I A;  3HYP A;  2K8S A;  3G9B A;  5J41 A;  5GST A;  1R5A A;  2CZ2 A;  3TOT A;  1EV4 A;  5CRH A;  3QD9 A;  2KUC A;  3LJR A;  2QKE A;  13GS A;  2TIR A;  4PQ1 A;  3HZ8 A;  1ZL9 A;  2ES7 A;  3Q18 A;  4F0C A;  4KCE A;  4ZB6 A;  1WPI A;  5DBQ A;  1EOH A;  3ZVJ D;  1XXU A;  2A4H A;  5B7C A;  3P7X A;  5H5R A;  3HY2 A;  5J3R A;  4LL4 B;  2DLX A;  4GLT A;  4V2M A;  1K0C A;  3W8S A;  1SJI A;  3L4N A;  4BIK A;  3GX8 A;  1GP1 A;  4N11 A;  2NTO A;  2R0C A;  1YY7 A;  5EY6 A;  3MAK A;  4MPG A;  1GUL A;  4F0B A;  2XHF A;  6GSV A;  4W66 A;  2R6K A;  1VF1 A;  5J9C A;  4GSS A;  4I2U A;  3TDG A;  4KUN A;  3GV1 A;  4TXO B;  2DJJ A;  1XCC A;  4G19 A;  4POL A;  2AB6 A;  2IMI A;  2C0D A;  1F3A A;  3GHA A;  4KDY A;  3IHQ A;  4O7H A;  4MZW A;  4GCI A;  4I2T A;  4Z2U A;  1ZCP A;  4KA0 A;  2YP6 A;  8GSS A;  2VO4 A;  2X4A A;  2L6C A;  3LOR A;  3HXS A;  4V2L A;  5ECI B;  1BG1 A;  4KGI A;  1M3J A;  2V32 A;  4V2N A;  1K0B A;  2PVQ A;  2B5X A;  4KCA A;  2IMF A;  1GLQ A;  3P8W A;  1CQG A;  5LD0 A;  4KSO A;  2H71 A;  1NW2 A;  5EVO A;  20GS A;  3LSZ A;  5IO2 A;  3QCP A;  1TOF A;  1VF2 A;  3FR9 A;  4PQI A;  2M72 A;  3EVI A;  2VLV A;  4OWY A;  1XWB A;  2KHP A;  2GQL A;  1A8Y A;  3RDW A;  18GS A;  3UMA A;  4IJ3 A;  3KZQ A;  4O92 A;  4G0I A;  2JSZ A;  1ERV A;  5J5N A;  1FOV A;  1SL1 B;  2AUV A;  5ID2 A;  3FMW A;  2F8F A;  2PER A;  2L4Q A;  2L59 A;  3D21 A;  5JWQ B;  4AI6 A;  3WT2 A;  2RM5 A;  2PN8 A;  5HR2 A;  5AN1 A;  1GRX A;  4KDU A;  2ON5 A;  1ERU A;  3I43 A;  4ZB8 A;  2FWG A;  4MH3 A;  3HD5 A;  3KTL A;  4XS6 A;  1YF1 A;  1EWX A;  2BMX A;  1VGL A;  4ML1 A;  5D9X A;  3IC8 A;  1RK4 A;  1S3A A;  4AKX B;  4TR1 B;  3UJ1 A;  2FWE A;  3F9U A;  1Z6N A;  1M3I A;  3HVS A;  3RPP A;  2YWI A;  1GSU A;  2I81 A;  2GQK A;  1SKR B;  4GST A;  2D2Z A;  4IP1 A;  4FXY P;  3S9F A;  4N0V A;  3BOA A;  4G10 A;  2HSM B;  2VOC A;  4EIQ A;  5H5S A;  1YDK A;  1BX9 A;  4ECJ A;  4HZ4 A;  1AQW A;  2YZU A;  2ZNM A;  1B9Y C;  2LQQ A;  3VUR A;  4F82 A;  1J9B A;  3TGZ A;  1MD3 A;  1G6Y A;  4OCF A;  1G7E A;  1A0F A;  1DUG A;  1HNB A;  3CSJ A;  16GS A;  5IMA A;  4OCE A;  3TU3 B;  3IE3 A;  2R4V A;  1ZYE A;  2P5Q A;  4EXJ A;  3D6I A;  1AQV A;  4IQA A;  4FYB A;  1FO5 A;  5G31 A;  2GS3 A;  2DKI A;  3CSI A;  2HYX A;  3G7Y A;  2BJX A;  4PGT A;  4MP4 A;  3EU4 A;  4NXI A;  1XW9 A;  5A34 A;  2DIY A;  2MZC A;  1B4Q A;  4TR3 A;  4O5R A;  2GDR A;  3GSS A;  3EMP A;  4ID0 A;  2E7P A;  2RLI A;  2N5A A;  2H30 A;  3GKM A;  6GSU A;  3GA4 A;  1F3B A;  2YJH A;  1GTI A;  3DVW A;  1DBY A;  5J40 A;  3QDN A;  2GT5 A;  4EC0 A;  1EGO A;  3IK7 A;  3IDV A;  1TK0 B;  2YWM A;  1SYX A;  1M9A A;  2QA1 A;  4QQ7 A;  2CAI A;  2GGT A;  1TK8 B;  2H0H A;  5ENU A;  3UVH A;  5A5K A;  4AKH A;  3VWU A;  2FY6 A;  2MMN A;  4QMK A;  1X9M B;  1X9W B;  1U6T A;  2E0Q A;  3BCI A;  1SL2 B;  5CRG A;  2WGR A;  6GSS A;  3QR6 A;  1ZYP A;  4AJ6 A;  4OFN A;  1XWC A;  3LG6 A;  1BED A;  2WVX A;  3I9V 2;  1XVQ A;  2YOI A;  4K5R A;  3F6F A;  2FWH A;  3F8U A;  4DSQ A;  3P90 A;  4K1F A;  2H8L A;  5ECL B;  3CWG A;  3WGD A;  4K5S A;  2X8G A;  3TKR A;  3W8J A;  1V98 A;  3IPZ A;  5BMU A;  4PNF A;  3LYK A;  2JZT A;  2L5L A;  2C0G A;  4MCU A;  2DJ3 A;  1YEP A;  4NHW A;  2RUF A;  2X99 A;  1SYR A;  4FH8 A;  3F4R A;  2HRK A;  2TRC P;  3W6G A;  5GZZ B;  4EDZ A;  5J4U A;  1QXH A;  1ZYQ B;  2LKU A;  1Z3E A;  1ERT A;  3C8E A;  1ZYN A;  4K9Z A;  5DVB A;  3UAP A;  4NHZ A;  2KOK A;  2F3M A;  4HZ2 A;  3LGC A;  2O85 A;  4PUA A;  4OFT A;  2I4A A;  1OVN A;  2R5G A;  1SKS B;  1MDK A;  2LTK A;  5BMU B;  2YCD A;  2B3S A;  1V2A A;  2WVZ A;  1Y6E A;  3LXT A;  2C80 A;  3WGE A;  3EUR A;  2HNL A;  1WRY A;  17GS A;  2VL2 C;  1IYI A;  1K3O A;  4G9H A;  4IW9 A;  4J2F A;  5FHI A;  1OE7 A;  5IMF A;  2HRK B;  4HOJ A;  5FWG A;  4XIH A;  4DSS A;  4FQU A;  2XPE A;  2WDU A;  5B6N A;  1BF5 A;  3Q19 A;  4EL1 A;  2LJA A;  3KGK A;  4NMU A;  4AKI A;  2VCQ A;  4DSR A;  3M3M A;  3A5I A;  4WBR D;  3KJY A;  2AHE A;  4WF5 A;  4PI2 C;  4OFM A;  2YV9 A;  2WW0 A;  4AJ8 A;  3EIN A;  1JLW A;  5G1L A;  1FAA A;  3GIX A;  1TRU A;  4G01 A;  5G5E A;  2K6V A;  3LYP A;  5J4V A;  2DMM A;  2LUS A;  4EUY A;  2H6Y A;  10GS A;  1I1I P;  6GSX A;  2WW1 A;  4TN8 A;  1VF3 A;  1QMV A;  5HR1 A;  3VPT A;  2K18 A;  4J57 E;  3Q74 A;  3CHX C;  5FT3 A;  1SJZ A;  2OKA A;  3GN3 A;  3NIV A;  1EP7 A;  4BVY B;  5C04 A;  3KTB A;  2HRF A;  1A2M A;  4A5P A;  5KN1 A;  5B8B A;  3RFR C;  1LU4 A;  3NZN A;  2VKZ G;  2LS5 A;  5H5Q A;  2JZS A;  4L5O A;  1NHY A;  2P0G A;  3DML A;  3WT1 A;  4PXO A;  2PWJ A;  3HMJ G;  1ZOF A;  4MH2 A;  1THX A;  1SD8 A;  3IV4 A;  2G2Q A;  3IK9 A;  5ELA A;  2LRC A;  1B48 A;  2WW3 A;  3H4K A;  4AF2 A;  4KE3 A;  2H66 A;  3HDC A;  2ZUP A;  3KMN A;  4POB A;  1SVO A;  2A2S A;  12GS A;  1U87 A;  3TB2 A;  1TRS A;  1GUM A;  1YJ6 A;  2WW2 A;  1ILO A;  4YQM A;  1XOB A;  4P3Y B;  2P31 A;  3ME7 A;  4Z7X A;  3M1G A;  2LRT A;  1Z9H A;  1Z5Y E;  1G6W A;  2YWO A;  4K0N A;  1GSE A;  4Q5F A;  3QFB C;  4POK A;  4XS4 B;  1K0D A;  4XHM A;  1E6B A;  2OE1 A;  4EIP A;  1GNW A;  1A8L A;  2H1A A;  2VL3 A;  2VCV A;  3QAV A;  3MNG A;  4MDC A;  1W89 A;  1EEJ A;  1OC8 A;  5ECS A;  4YKG A;  1HD2 A;  2HT9 A;  3A2V A;  2YPM A;  2TRX A;  1W4V A;  2B5E A;  5CYY A;  1V57 A;  1XZO A;  2H19 A;  3KM6 A;  2VL2 A;  4TXO A;  3BBY A;  3PGT A;  2DJK A;  3ZRD A;  2GSS A;  5AIV A;  2L4C A;  1O8X A;  5DCG A;  4I97 A;  3HZ4 A;  1WWJ A;  3FZ5 A;  1SL0 B;  4USS A;  4DVC A;  5DJM A;  5CRD A;  3G7J A;  2CVB A;  1S4B P;  2UV8 G;  1PSQ A;  2C0E A;  1TP9 A;  5DQS A;  3ZRE A;  3H1N A;  1ZZY A;  1THO A;  1JZD A;  4DEJ A;  3CRU A;  4HSC X;  3RHC A;  4L8E A;  1O85 A;  3DD3 A;  4NPB A;  3SBC A;  1PX6 A;  4WR5 A;  2VUP A;  2C8U A;  4PTS A;  2XBI A;  4XRA A;  4JE1 A;  1PFO A;  4JRR A;  5JWR B;  4JBB A;  1HYU A;  1KNG A;  3F4T A;  2EFE A;  3VK9 A;  4FIW A;  2YV7 A;  2QA2 A;  4HQS A;  3ZTL A;  1XG8 A;  3D5J A;  2EIQ A;  2H1D A;  1X9S B;  2CA8 A;  3J7Y b;  1GTB A;  1GUK A;  2O36 A;  2HSN B;  4TVE A;  2QSI A;  3L78 A;  1UA5 A;  5D8I A;  6GST A;  2R0P A;  1XW6 A;  2VCX A;  3EU3 A;  3APO A;  4CW9 A;  3ZIT A;  1VF4 A;  2WRT A;  3C71 A;  1K3L A;  3DIE A;  4K0G A;  2EIO A;  4K7N A;  3KCM A;  2H01 A;  5ECK B;  1MDI A;  4MA9 A;  5ECO B;  1DE2 A;  4D73 A;  3ZIJ A;  1R5P A;  3CSH A;  1PRX A;  5IO0 A;  1R4W A;  1G7O A;  2I1U A;  2ON7 A;  4NWY A;  22GS A;  3CMI A;  6GSW A;  1TI3 A;  2H0G A;  3N5O A;  1AAZ A;  1OC9 B;  3N9J A;  3FZ4 A;  2HFD A;  2REM A;  2O8V B;  1EOG A;  1PMT A;  4JR4 A;  1MEK A;  4F2I A;  5G5F A;  3ERF A;  1K0M A;  4IP6 A;  3VI7 A;  2GT6 A;  3ZZX A;  5D73 A;  3UEM A;  3KP8 A;  4MMM A;  4TR1 A;  4KH7 A;  2H75 A;  2WVY A;  2FD3 A;  3KIJ A;  5DAL B;  3MYD A;  3EMX A;  1DE1 A;  3TJB A;  1OKD A;  4D73 B;  2VCW A;  2B1L A;  4MZB A;  4BA7 A;  1M99 A;  4HEA 2;  3VI5 A;  3WYW A;  2CQ9 A;  2HSM A;  3CXG A;  3A5W A;  3CTF A;  3F0I A;  3M9K A;  1TDI A;  4L0U A;  1XWA A;  4ILF A;  1K3Y A;  14GS A;  3FW2 A;  1S3C A;  4ZL7 A;  2PUK C;  5LNK e;  4J56 E;  1GL8 A;  1GWC A;  1M2B A;  2H70 A;  2JZR A;  4IN0 A;  2OAC A;  2FHE A;  2FNO A;  3GUS A;  3IAM 2;  4IQ1 A;  3E9J B;  1FVJ A;  2H1G A;  3UL3 A;  4HU7 A;  19GS A;  5ECQ B;  2CVD A;  3ME8 A;  2YN1 A;  3HJP A;  3PIN A;  2K9F A;  2VLT A;  2H73 A;  3D0Z A;  3DKS A;  2CVK A;  4ZBB A;  5IM9 A;  3GST A;  1FB6 A;  3TKP A;  5IQY A;  4XTS A;  3ZMK A;  2L57 A;  2C3Q A;  3GKK A;  5IIZ A;  1WP0 A;  2VCT A;  1XVW A;  3L9U A;  1AC1 A;  3DGQ A;  1VRS D;  3CRT A;  3ZVJ A;  1F2E A;  1XBS A;  5J9B A;  4JZQ A;  5A1N A;  3DWV A;  2HLS A;  1A2J A;  4GDF A;  2F8A A;  5HFI A;  2XC2 A;  2PGT A;  5GAN D;  2A2P A;  3TJF A;  3DXB A;  1WOU A;  3IC4 A;  3MDK A;  2GSR A;  1GSY A;  1PA3 A;  2OT3 A;  1Z6M A;  1T1V A;  4F03 A;  1SK1 A;  4CDO A;  3IRA A;  4NV2 A;  4PHZ C;  1A24 A;  1QK8 A;  4TRX A;  1B4P A;  4V1A p;  1K0N A;  1TXU A;  2FCH A;  2PBJ A;  2CV4 A;  3QMX A;  1RW1 A;  1GSF A;  5B8A A;  1H75 A;  3H8Q A;  3I69 A;  2LQO A;  5A1N B;  5DJL A;  3RPN A;  4ICY A;  1HNA A;  1JZO A;  5C00 A;  3BCK A;  4YQU A;  5A5H B;  3UIW A;  1NSW A;  4O32 A;  5CRE A;  4QL7 A;  4G0L A;  1M2D A;  7GSS A;  1ON4 A;  3HJM A;  1TXX A;  1GSD A;  5INY A;  4N3Z A;  4ZIJ A;  4WXT A;  4LL1 B;  3CTG A;  4LMV A;  5AIS A;  2V2G A;  4TKY A;  3EC3 A;  2JSY A;  4H86 A;  4L0W A;  2B7J A;  3F63 A;  1YQ1 A;  3ZFB A;  3GH6 A;  4PQH A;  3UOM A;  5GSS A;  1KBN A;  3RHB A;  3TKQ A;  5IMD A;  1QUW A;  4EE0 A;  4WBJ A;  1PN9 A;  2YZH A;  1IYH A;  2OJL A;  2H6X A;  2B1K A;  1EZK A;  2UZ8 A;  3PR8 A;  3H79 A;  3TRP A;  2I3Y A;  2QC7 A;  2EIR A;  4K7O A;  3M0F A;  1JZR A;  2WZ9 A;  3GTU B;  3ZIV A;  3VWW A;  1TK5 B;  4YAP A;  2AV4 A;  3MSZ A;  4ACS A;  2FGX A;  1B8X A;  2IFQ A;  5DQY A;  2CX4 A;  2KP2 A;  4X43 A;  4ECC A;  1RQM A;  3ERW A;  4X4J A;  1A2L A;  4TOP A;  4CY6 A;  3ZML A;  3UVT A;  5HQP A;  1XWK A;  1GUH A;  1FOH A;  2VL9 A;  5J47 A;  1ZGN A;  3IXR A;  3QFA C;  4EF0 A;  1AXD A;  2VD1 A;  2HSY A;  3DYR A;  2JAD A;  1X0R A;  4O5U A;  4F9Z A;  3DVX A;  2KLX A;  4MAB A;  3ERG A;  1BAY A;  4KF9 A;  1SKW B;  3F6D A;  4MJB A;  1YVL A;  4EDY A;  1QFN A;  2BTO T;  1T00 A;  1K0A A;  4BVY A;  5F8B A;  1M7T A;  2IFQ B;  2YAN A;  4FYU A; 
#chains in the Genus database with same CATH homology
 1AQX A;  1Z7P A;  3E0U A;  4ZL9 A;  3PH9 A;  4EO3 A;  5JWO B;  2DJ0 A;  3ZFL A;  5CO3 A;  4GTU A;  4IEL A;  2IL3 A;  2P5R A;  2VCZ A;  5GAP D;  2CAQ A;  2XBQ A;  5J4Y A;  4IKH A;  2V6O A;  4E8H A;  1X5E A;  3D4M A;  1YKA A;  2XPD A;  4ECI A;  1GSQ A;  1HQO A;  1V40 A;  2NDO A;  2C3T A;  2HI7 A;  2J23 A;  2Z9S A;  3ZYW A;  1O81 A;  4E68 A;  3RBT A;  1Z7R A;  2EC4 A;  1V58 A;  2NBS A;  2R37 A;  1J0F A;  4XS4 A;  2GZZ A;  1NHO A;  4MZC A;  1SU9 A;  3GKN A;  1YKC A;  1M9B A;  1F6M C;  3TOU A;  5ECM B;  2LEG A;  2ALB A;  4OO5 A;  3KXO A;  4GRF A;  4X1U A;  2X8C A;  4MJA A;  1TU7 A;  5CNW A;  5IPH A;  2L6D A;  3O76 A;  4IS0 A;  5JCW A;  2GST A;  1S3D A;  3F3R A;  1ZMA A;  1T4Y A;  5EPF A;  1PN0 A;  5D96 A;  2NPB A;  5CAX A;  5E4W A;  2OE3 A;  2V1M A;  2QGV A;  5DAK B;  1PL2 A;  4FO5 A;  2IMK A;  3VWV A;  1G0T A;  2C3N A;  1PGT A;  4ZBA A;  2HZE A;  4Z2R A;  3Q6O A;  1V9W A;  1TRV A;  2JU5 A;  2IN3 A;  3QAG A;  2MMO A;  1YF0 A;  4PUF C;  3A3T A;  3L9V A;  4ISD A;  5D9T A;  2FA8 A;  3G7I A;  1J08 A;  4Z2T A;  5B6M A;  3DEX A;  3GFK A;  5HFK A;  1GH2 A;  2O89 A;  6GSY A;  1KEB A;  3A2W A;  5JCG A;  2MMA A;  1GSS A;  2VD0 A;  2DIZ A;  2EFD A;  1QQ2 A;  5F05 A;  2YJ7 A;  4HQZ A;  2LV3 A;  1Y25 A;  2HSN A;  4PX1 A;  2VAF A;  1Q98 A;  2HZE B;  3LXZ A;  1ST9 A;  4IHU A;  3CBU A;  3AY8 A;  4HJ2 A;  1SVM A;  2RM6 A;  3FY7 A;  4Q5Q A;  1OKT A;  3CYN A;  3R2Q A;  3LFL A;  3J7Y k;  4IGJ A;  4ECB A;  2O87 A;  5ELG A;  1HNC A;  3EPT A;  5IMC A;  3TRQ A;  4BVX A;  1XW5 A;  3APQ A;  3UAR A;  2V41 A;  4TW5 A;  3HVV A;  1UVZ A;  1OC9 A;  2LJK A;  1Q4J A;  1MTC A;  3M9J A;  1MDJ A;  4K2X A;  4HUA A;  5KOW A;  5IOW A;  5A4W A;  1GTU A;  4KSM A;  1O6J A;  4IBP A;  2FUG 2;  4BL7 A;  3GNJ A;  3U5R E;  2H0I A;  2E2G A;  3EE2 A;  4I5Q A;  3C7M A;  2C4J A;  5AIX A;  5DAL A;  4RI7 A;  1A0R P;  3JCM L;  3QOU A;  4XS1 A;  2KP1 A;  3TUE A;  4I8B A;  2OBK A;  3E3E A;  4KB3 A;  3FKF A;  4BVX B;  1USB A;  4LLR A;  1OE8 A;  1O73 A;  1PQN A;  4V1A g;  4RQX A;  2IMD A;  2M46 A;  4HI7 A;  1T3B A;  4JED A;  3QAW A;  1WIK A;  3KMO A;  1U3A A;  4NAX A;  5KOX A;  2K8V A;  5F07 A;  4IVF A;  1N2A A;  2LST A;  2EFH A;  1T8E B;  1DSB A;  5KN3 A;  2AJQ B;  5HR3 A;  4BL7 B;  2IWT A;  4AKG A;  2C1Y A;  2MMZ A;  3TJG A;  1M0U A;  4IJI A;  4ULX A;  1WMJ A;  5BRT A;  1OYJ A;  1UN2 A;  1FW1 A;  4GSN A;  4E8E A;  1H4O A;  4BPY A;  3GRX A;  3FZ9 A;  2GLR A;  3C1S A;  3TKS C;  2J9H A;  4WKW A;  5HFG A;  2G0F A;  1FHE A;  1UC7 A;  3GL3 A;  3GKX A;  1AIU A;  2V6K A;  1ACV A;  1TTZ A;  4N10 A;  2HRA A;  2M80 A;  3FR3 A;  5ECN B;  4OMV A;  1TRW A;  1X5D A;  2IME A;  4GWR A;  5EL8 A;  5G2Z A;  1C72 A;  3KD0 A;  1O8W A;  2FA4 A;  4MPF A;  3TCO A;  1SEN A;  4O5Q A;  2LRN A;  3LW9 A;  1U3I A;  2C0F A;  4OO4 A;  2O7K A;  1EEM A;  3ZL5 A;  11GS A;  2B5Y A;  4LMW A;  1OC3 A;  4YAV A;  5ABR A;  5A4U A;  1I5G A;  5AGY A;  1U88 A;  3UBL A;  1YZX A;  5ID2 B;  4CHS A;  1N25 A;  1EP8 A;  5IMZ A;  3MIX A;  1YEX A;  3GL5 A;  2IJY A;  3FZA A;  4ZB7 A;  1WE0 A;  2N5F A;  4HDE A;  5L71 A;  4HS1 A;  1EV9 A;  3VFI A;  1BG5 A;  3BD2 A;  3F3Q A;  4KAE A;  4TR0 A;  2RII A;  1XWG A;  4G0K A;  2MYG A;  2OA7 A;  2L5O A;  1XOA A;  2WCI A;  4WET A;  5JCU A;  3V1W A;  3GMF A;  5A5H A;  3FEU A;  3HHV A;  4G2E A;  3EYT A;  4NV5 A;  3IOS A;  3LWA A;  2E2M A;  2FLS A;  1JFU A;  5DDL A;  2N5B A;  1O7U A;  4MF7 A;  1TKD B;  1PX7 A;  2A4V A;  3DRN A;  2LJR A;  1K0O A;  2LNT A;  3PPU A;  3FRC A;  1SD9 A;  4GQF A;  2X8H A;  3BJ5 A;  1TU8 A;  3HA9 A;  1JLV A;  2H76 A;  3EWL A;  1X5C A;  2DML A;  2HQT A;  5KN2 A;  4KDX A;  1Y1U A;  3KH9 A;  2AAW A;  2GQM A;  4WEY A;  1XFL A;  3TRX A;  3IHG A;  3FR6 A;  2A2R A;  4MF6 A;  1OAZ A;  3IAS 2;  1CQH A;  2F51 A;  2WUL A;  3WD6 A;  2PVO C;  2GTU A;  2DSA A;  2B7K A;  2H6Z A;  5KN0 A;  3GTU A;  5IOX A;  1N8J A;  4OD7 A;  3HKR A;  3TKS A;  2HSH A;  1PD2 1;  1BQ7 A;  4TXV A;  2VM1 A;  4EVM A;  5ECP B;  2YWN A;  4K6X A;  4BWQ A;  5CRW A;  4ZL8 A;  5F06 A;  2RUE A;  5D9W A;  4XRD A;  5D93 A;  2HZF A;  5A34 B;  2DKH A;  1I9D A;  4BWS A;  4MK3 A;  1LBK A;  4N30 A;  3TKS E;  1SVL A;  3GYK A;  2O5V A;  1TI1 A;  2CX3 A;  2H72 A;  5G30 A;  2X49 A;  4ML6 A;  3H93 A;  1E2Y A;  1URM A;  2WJU A;  2AYT A;  3NOF A;  3M8N A;  3KEB A;  4HU9 A;  1XPV A;  3APS A;  3O6T A;  4K8M A;  4AJ7 A;  5ECH B;  1JZW A;  3VWX A;  3O3T A;  3FHK A;  1TJD A;  5G1K A;  3KH7 A;  3MWH A;  1BYE A;  4XCS A;  2OAD A;  2H1L A;  3ZLP A;  3D22 A;  1WJK A;  4GQC A;  3SWL A;  4FYC A;  3US3 A;  4RUV A;  2WFC A;  5ECR B;  1PKZ A;  4GF0 A;  4RQR A;  4MJE A;  2IIY A;  2OE0 A;  2DC5 A;  1BJX A;  2VLU A;  3FYG A;  3L9S A;  4YH2 A;  4ZIL A;  2B6M A;  1SK0 A;  4KW6 A;  3UBK A;  1MD4 A;  1KTE A;  4ZXG A;  3HVX A;  2CT6 A;  3KP9 A;  1SK2 A;  5DCH A;  2H74 A;  5A4V A;  2PMT A;  3GUR A;  2HXK A;  3C1R A;  2VM2 A;  3L0H A;  2X64 A;  5F0G A;  1AW9 A;  1AUC A;  4TR4 A;  1FVK A;  4RI6 A;  1ABA A;  5CP1 A;  2MBS A;  3ISO A;  1T4Z A;  4PUR A;  4LA1 A;  2HRN A;  3P2A A;  4I6X A;  2WS2 A;  4L5L A;  3IA1 A;  4YQV A;  5D9V A;  1GNE A;  1GLP A;  4JR6 A;  1GTA A;  3FK8 A;  2GZP A;  3IBH A;  1A23 A;  3C73 A;  2I9H A;  4CY8 A;  9GSS A;  1EGR A;  3LQ7 A;  2F9S A;  2R0G A;  4WR4 A;  3HJO A;  1FG4 A;  2FWF A;  5LCZ A;  4Q5N A;  4WF4 A;  4PNG A;  1QGV A;  5DAK A;  3VLN A;  3GH9 A;  3K8N A;  3F4S A;  4DSS B;  2CZ3 A;  4K2D A;  4EKZ A;  2NVL A;  1T7P B;  4MF5 A;  2ZCT A;  3R3E A;  5HR0 A;  4HJM A;  2IPA A;  1F9M A;  2PPT A;  2R3X A;  2LNS A;  4MLY A;  1R7H A;  5IMV A;  4YKF A;  4AGS A;  1SJ6 A;  2JL4 A;  2DJ1 A;  5KEJ A;  1R26 A;  5COH A;  4KND A;  2GSQ A;  1PL1 A;  3A2X A;  1B9X C;  2GZY A;  3VPQ A;  1FB0 A;  1PKW A;  3HCZ A;  3TJJ A;  2DBC A;  4MNN A;  3QPM A;  1JHB A;  4MJC A;  2YNX A;  2PU9 C;  3U6V A;  4Q5R A;  1ML6 A;  1F37 A;  3WGX A;  5IPG A;  2EFC A;  3TJK A;  2MBT A;  4GXZ A;  4ZB9 A;  4N0Z A;  1M2A A;  3ED3 A;  4ZBD A;  2HE3 A;  3I6A A;  3D4T A;  4POM A;  2VIM A;  4X0X A;  2JAC A;  1ERW A;  1TW9 A;  1NM3 A;  2GVP A;  1XIY A;  2R2J A;  3LEF A;  2DJ2 A;  3OR5 A;  3GX0 A;  4JU5 A;  2WB9 A;  3IR4 A;  1LJR A;  2OBI A;  4QL9 A;  2H1B A;  5E59 A;  3RAZ A;  4KX4 A;  4K7I A;  3HYP A;  2K8S A;  3G9B A;  5J41 A;  5GST A;  1R5A A;  2CZ2 A;  3TOT A;  1EV4 A;  5CRH A;  3QD9 A;  2KUC A;  3LJR A;  2QKE A;  13GS A;  2TIR A;  4PQ1 A;  3HZ8 A;  1ZL9 A;  2ES7 A;  3Q18 A;  4F0C A;  4KCE A;  4ZB6 A;  1WPI A;  5DBQ A;  1EOH A;  3ZVJ D;  1XXU A;  2A4H A;  5B7C A;  3P7X A;  5H5R A;  3HY2 A;  5J3R A;  4LL4 B;  2DLX A;  4GLT A;  4V2M A;  1K0C A;  3W8S A;  1SJI A;  3L4N A;  3GX8 A;  1GP1 A;  4N11 A;  2NTO A;  2R0C A;  1YY7 A;  5EY6 A;  3MAK A;  4MPG A;  1GUL A;  4F0B A;  2XHF A;  6GSV A;  4W66 A;  2R6K A;  1VF1 A;  5J9C A;  4GSS A;  4I2U A;  3TDG A;  4KUN A;  3GV1 A;  4TXO B;  2DJJ A;  1XCC A;  4G19 A;  4POL A;  2AB6 A;  2IMI A;  2C0D A;  1F3A A;  3GHA A;  4KDY A;  3IHQ A;  4O7H A;  4MZW A;  4GCI A;  4I2T A;  4Z2U A;  1ZCP A;  4KA0 A;  2YP6 A;  8GSS A;  2VO4 A;  2X4A A;  3LOR A;  2L6C A;  3HXS A;  4V2L A;  5ECI B;  1BG1 A;  4KGI A;  2V32 A;  4V2N A;  1K0B A;  2PVQ A;  2B5X A;  4KCA A;  2IMF A;  1GLQ A;  3P8W A;  1CQG A;  5LD0 A;  4KSO A;  2H71 A;  1NW2 A;  5EVO A;  20GS A;  3LSZ A;  5IO2 A;  3QCP A;  1TOF A;  1VF2 A;  3FR9 A;  4PQI A;  2M72 A;  3EVI A;  2VLV A;  4OWY A;  1XWB A;  2KHP A;  2GQL A;  1A8Y A;  3RDW A;  18GS A;  3UMA A;  4IJ3 A;  3KZQ A;  4O92 A;  4G0I A;  2JSZ A;  1ERV A;  5J5N A;  1FOV A;  1SL1 B;  2AUV A;  5ID2 A;  3FMW A;  2F8F A;  2PER A;  2L4Q A;  2L59 A;  3D21 A;  5JWQ B;  4AI6 A;  3WT2 A;  2RM5 A;  2PN8 A;  5HR2 A;  5AN1 A;  1GRX A;  4KDU A;  2ON5 A;  1ERU A;  3I43 A;  4ZB8 A;  2FWG A;  4MH3 A;  3HD5 A;  3KTL A;  4XS6 A;  1YF1 A;  1EWX A;  2BMX A;  1VGL A;  4ML1 A;  5D9X A;  3IC8 A;  1RK4 A;  1S3A A;  4AKX B;  4TR1 B;  3UJ1 A;  2FWE A;  3F9U A;  1Z6N A;  3HVS A;  3RPP A;  2YWI A;  1GSU A;  2I81 A;  2GQK A;  1SKR B;  4GST A;  2D2Z A;  4IP1 A;  3S9F A;  4N0V A;  3BOA A;  4G10 A;  2HSM B;  2VOC A;  4EIQ A;  5H5S A;  1YDK A;  1BX9 A;  4ECJ A;  4HZ4 A;  1AQW A;  2YZU A;  2ZNM A;  1B9Y C;  2LQQ A;  3VUR A;  4F82 A;  1J9B A;  3TGZ A;  1MD3 A;  1G6Y A;  4OCF A;  1G7E A;  1A0F A;  1DUG A;  1HNB A;  3CSJ A;  16GS A;  5IMA A;  4OCE A;  3TU3 B;  3IE3 A;  2R4V A;  1ZYE A;  2P5Q A;  4EXJ A;  3D6I A;  1AQV A;  4IQA A;  4FYB A;  1FO5 A;  5G31 A;  2GS3 A;  2DKI A;  3CSI A;  2HYX A;  3G7Y A;  2BJX A;  4PGT A;  4MP4 A;  3EU4 A;  4NXI A;  1XW9 A;  5A34 A;  2DIY A;  2MZC A;  1B4Q A;  4TR3 A;  4O5R A;  2GDR A;  3GSS A;  3EMP A;  4ID0 A;  2E7P A;  2RLI A;  2N5A A;  2H30 A;  6GSU A;  3GKM A;  3GA4 A;  1F3B A;  2YJH A;  1GTI A;  3DVW A;  1DBY A;  5J40 A;  3QDN A;  2GT5 A;  4EC0 A;  1EGO A;  3IK7 A;  3IDV A;  1TK0 B;  2YWM A;  1SYX A;  1M9A A;  2QA1 A;  4QQ7 A;  2CAI A;  2GGT A;  1TK8 B;  2H0H A;  5ENU A;  3UVH A;  5A5K A;  4AKH A;  3VWU A;  2FY6 A;  2MMN A;  4QMK A;  1X9M B;  1X9W B;  1U6T A;  2E0Q A;  3BCI A;  1SL2 B;  5CRG A;  2WGR A;  6GSS A;  3QR6 A;  1ZYP A;  4AJ6 A;  4OFN A;  1XWC A;  3LG6 A;  1BED A;  3I9V 2;  1XVQ A;  2YOI A;  4K5R A;  3F6F A;  2FWH A;  3F8U A;  4DSQ A;  3P90 A;  4K1F A;  2H8L A;  5ECL B;  3CWG A;  3WGD A;  4K5S A;  2X8G A;  3TKR A;  3W8J A;  1V98 A;  3IPZ A;  5BMU A;  4PNF A;  3LYK A;  2JZT A;  2L5L A;  2C0G A;  4MCU A;  2DJ3 A;  1YEP A;  4NHW A;  2RUF A;  2X99 A;  1SYR A;  4FH8 A;  3F4R A;  2HRK A;  2TRC P;  3W6G A;  5GZZ B;  4EDZ A;  5J4U A;  1QXH A;  1ZYQ B;  2LKU A;  1Z3E A;  1ERT A;  3C8E A;  1ZYN A;  4K9Z A;  5DVB A;  3UAP A;  4NHZ A;  2KOK A;  2F3M A;  4HZ2 A;  3LGC A;  2O85 A;  4PUA A;  4OFT A;  2I4A A;  1OVN A;  2R5G A;  1SKS B;  1MDK A;  2LTK A;  5BMU B;  2YCD A;  2B3S A;  1V2A A;  1Y6E A;  3LXT A;  2C80 A;  3WGE A;  3EUR A;  2HNL A;  1WRY A;  17GS A;  2VL2 C;  1IYI A;  1K3O A;  4G9H A;  4IW9 A;  4J2F A;  5FHI A;  1OE7 A;  5IMF A;  2HRK B;  4HOJ A;  5FWG A;  4XIH A;  4DSS A;  4FQU A;  2XPE A;  2WDU A;  5B6N A;  1BF5 A;  3Q19 A;  4EL1 A;  2LJA A;  3KGK A;  4NMU A;  4AKI A;  2VCQ A;  4DSR A;  3M3M A;  3A5I A;  4WBR D;  3KJY A;  2AHE A;  4WF5 A;  4OFM A;  2YV9 A;  4AJ8 A;  3EIN A;  1JLW A;  5G1L A;  1FAA A;  3GIX A;  1TRU A;  4G01 A;  5G5E A;  2K6V A;  3LYP A;  5J4V A;  2DMM A;  2LUS A;  4EUY A;  2H6Y A;  10GS A;  6GSX A;  4TN8 A;  1VF3 A;  1QMV A;  5HR1 A;  3VPT A;  2K18 A;  4J57 E;  3Q74 A;  5FT3 A;  1SJZ A;  2OKA A;  3GN3 A;  3NIV A;  1EP7 A;  4BVY B;  5C04 A;  3KTB A;  2HRF A;  1A2M A;  4A5P A;  5KN1 A;  5B8B A;  1LU4 A;  3NZN A;  2VKZ G;  2LS5 A;  5H5Q A;  2JZS A;  4L5O A;  1NHY A;  2P0G A;  3DML A;  3WT1 A;  4PXO A;  2PWJ A;  3HMJ G;  1ZOF A;  4MH2 A;  1THX A;  1SD8 A;  3IV4 A;  2G2Q A;  3IK9 A;  5ELA A;  2LRC A;  1B48 A;  3H4K A;  4AF2 A;  4KE3 A;  2H66 A;  3HDC A;  2ZUP A;  3KMN A;  4POB A;  1SVO A;  2A2S A;  12GS A;  1U87 A;  3TB2 A;  1TRS A;  1GUM A;  1YJ6 A;  1ILO A;  4YQM A;  1XOB A;  4P3Y B;  2P31 A;  3ME7 A;  4Z7X A;  3M1G A;  2LRT A;  1Z9H A;  1Z5Y E;  1G6W A;  2YWO A;  4K0N A;  1GSE A;  4Q5F A;  3QFB C;  4POK A;  4XS4 B;  1K0D A;  4XHM A;  1E6B A;  2OE1 A;  4EIP A;  1GNW A;  1A8L A;  2H1A A;  2VL3 A;  2VCV A;  3QAV A;  3MNG A;  4MDC A;  1W89 A;  1EEJ A;  1OC8 A;  5ECS A;  4YKG A;  1HD2 A;  2HT9 A;  3A2V A;  2YPM A;  2TRX A;  1W4V A;  2B5E A;  5CYY A;  1V57 A;  1XZO A;  2H19 A;  3KM6 A;  2VL2 A;  4TXO A;  3BBY A;  3PGT A;  2DJK A;  3ZRD A;  2GSS A;  5AIV A;  2L4C A;  1O8X A;  5DCG A;  4I97 A;  3HZ4 A;  1WWJ A;  3FZ5 A;  1SL0 B;  4USS A;  4DVC A;  5DJM A;  5CRD A;  3G7J A;  2CVB A;  2UV8 G;  1PSQ A;  2C0E A;  1TP9 A;  5DQS A;  3ZRE A;  3H1N A;  1ZZY A;  1THO A;  1JZD A;  4DEJ A;  3CRU A;  3RHC A;  4L8E A;  1O85 A;  3DD3 A;  4NPB A;  3SBC A;  1PX6 A;  4WR5 A;  2VUP A;  2C8U A;  4PTS A;  2XBI A;  4XRA A;  4JE1 A;  4JRR A;  5JWR B;  4JBB A;  1HYU A;  1KNG A;  3F4T A;  2EFE A;  3VK9 A;  4FIW A;  2YV7 A;  2QA2 A;  4HQS A;  3ZTL A;  3D5J A;  2EIQ A;  2H1D A;  1X9S B;  2CA8 A;  3J7Y b;  1GTB A;  1GUK A;  2HSN B;  4TVE A;  2QSI A;  3L78 A;  1UA5 A;  5D8I A;  6GST A;  2R0P A;  1XW6 A;  2VCX A;  3EU3 A;  3APO A;  4CW9 A;  3ZIT A;  1VF4 A;  2WRT A;  3C71 A;  1K3L A;  3DIE A;  4K0G A;  2EIO A;  4K7N A;  3KCM A;  2H01 A;  5ECK B;  1MDI A;  4MA9 A;  5ECO B;  1DE2 A;  4D73 A;  3ZIJ A;  1R5P A;  3CSH A;  1PRX A;  5IO0 A;  1R4W A;  1G7O A;  2I1U A;  2ON7 A;  4NWY A;  22GS A;  3CMI A;  6GSW A;  1TI3 A;  2H0G A;  3N5O A;  1AAZ A;  1OC9 B;  3N9J A;  3FZ4 A;  2HFD A;  2REM A;  2O8V B;  1EOG A;  1PMT A;  4JR4 A;  1MEK A;  4F2I A;  5G5F A;  3ERF A;  1K0M A;  4IP6 A;  3VI7 A;  2GT6 A;  3ZZX A;  5D73 A;  3UEM A;  3KP8 A;  4MMM A;  4TR1 A;  4KH7 A;  2H75 A;  2FD3 A;  3KIJ A;  5DAL B;  3MYD A;  3EMX A;  1DE1 A;  3TJB A;  1OKD A;  4D73 B;  2VCW A;  2B1L A;  4MZB A;  4BA7 A;  1M99 A;  4HEA 2;  3VI5 A;  3WYW A;  2CQ9 A;  2HSM A;  3CXG A;  3A5W A;  3CTF A;  3F0I A;  3M9K A;  1TDI A;  4L0U A;  1XWA A;  4ILF A;  1K3Y A;  14GS A;  3FW2 A;  1S3C A;  4ZL7 A;  2PUK C;  5LNK e;  4J56 E;  1GL8 A;  1GWC A;  1M2B A;  2H70 A;  2JZR A;  4IN0 A;  2OAC A;  2FHE A;  2FNO A;  3GUS A;  3IAM 2;  4IQ1 A;  3E9J B;  1FVJ A;  2H1G A;  3UL3 A;  4HU7 A;  19GS A;  5ECQ B;  2CVD A;  3ME8 A;  2YN1 A;  3HJP A;  3PIN A;  2K9F A;  2VLT A;  2H73 A;  3D0Z A;  3DKS A;  2CVK A;  4ZBB A;  5IM9 A;  3GST A;  1FB6 A;  3TKP A;  5IQY A;  4XTS A;  3ZMK A;  2L57 A;  2C3Q A;  3GKK A;  5IIZ A;  1WP0 A;  2VCT A;  1XVW A;  3L9U A;  1AC1 A;  3DGQ A;  1VRS D;  3CRT A;  3ZVJ A;  1F2E A;  1XBS A;  5J9B A;  4JZQ A;  5A1N A;  3DWV A;  2HLS A;  1A2J A;  4GDF A;  2F8A A;  5HFI A;  2XC2 A;  2PGT A;  5GAN D;  2A2P A;  3TJF A;  3DXB A;  1WOU A;  3IC4 A;  3MDK A;  2GSR A;  1GSY A;  1PA3 A;  2OT3 A;  1Z6M A;  1T1V A;  4F03 A;  1SK1 A;  4CDO A;  3IRA A;  4NV2 A;  1A24 A;  1QK8 A;  4TRX A;  1B4P A;  4V1A p;  1K0N A;  1TXU A;  2FCH A;  2PBJ A;  2CV4 A;  3QMX A;  1RW1 A;  1GSF A;  5B8A A;  1H75 A;  3H8Q A;  3I69 A;  2LQO A;  5A1N B;  5DJL A;  3RPN A;  4ICY A;  1HNA A;  1JZO A;  5C00 A;  3BCK A;  4YQU A;  5A5H B;  3UIW A;  1NSW A;  4O32 A;  5CRE A;  4QL7 A;  4G0L A;  1M2D A;  7GSS A;  1ON4 A;  3HJM A;  1TXX A;  1GSD A;  5INY A;  4N3Z A;  4ZIJ A;  4WXT A;  4LL1 B;  3CTG A;  4LMV A;  5AIS A;  2V2G A;  4TKY A;  3EC3 A;  2JSY A;  4H86 A;  4L0W A;  2B7J A;  3F63 A;  1YQ1 A;  3ZFB A;  3GH6 A;  4PQH A;  3UOM A;  5GSS A;  1KBN A;  3RHB A;  3TKQ A;  5IMD A;  1QUW A;  4EE0 A;  4WBJ A;  1PN9 A;  2YZH A;  1IYH A;  2OJL A;  2H6X A;  2B1K A;  1EZK A;  2UZ8 A;  3PR8 A;  3H79 A;  3TRP A;  2I3Y A;  2QC7 A;  2EIR A;  4K7O A;  3M0F A;  1JZR A;  2WZ9 A;  3GTU B;  3ZIV A;  3VWW A;  1TK5 B;  4YAP A;  2AV4 A;  3MSZ A;  4ACS A;  2FGX A;  1B8X A;  2IFQ A;  5DQY A;  2CX4 A;  2KP2 A;  4X43 A;  4ECC A;  1RQM A;  3ERW A;  4X4J A;  1A2L A;  4TOP A;  4CY6 A;  3ZML A;  3UVT A;  5HQP A;  1XWK A;  1GUH A;  1FOH A;  2VL9 A;  5J47 A;  1ZGN A;  3IXR A;  3QFA C;  4EF0 A;  1AXD A;  2VD1 A;  2HSY A;  3DYR A;  2JAD A;  1X0R A;  4O5U A;  4F9Z A;  3DVX A;  2KLX A;  4MAB A;  3ERG A;  1BAY A;  4KF9 A;  1SKW B;  3F6D A;  4MJB A;  1YVL A;  4EDY A;  1QFN A;  2BTO T;  1T00 A;  1K0A A;  4BVY A;  5F8B A;  1M7T A;  2IFQ B;  2YAN A;  4FYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...