5A4VA

Atgstf2 from arabidopsis thaliana in complex with quercetin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
AGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 84
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a4vA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a4vA01
1NSWA 1XOAA 2GZZA 4HU9A 1OKDA 2PN8A 1GTUA 2XPDA 1XOBA 4I2UA 2VL2A 4ECJA 1A0RP 2H70A 3F8UA 4KSOA 2CX4A 3QFAC 2X8GA 4I2TA 3HDCA 3ME7A 2CZ2A 1SJIA 2GT5A 3GTUB 5F06A 5G5EA 1UN2A 1LBKA 4LA1A 1DUGA 3D22A 1SL1B 2OE1A 2O8VB 3G9BA 4ZL7A 5A4VA 3C71A 1R7HA 3IOSA 5HR1A 3TOUA 2HI7A 3A2XA 1X9SB 4TR1A 3F3QA 5F05A 2AYTA 2DIYA 1YJ6A 4IKHA 1X9WB 1OC3A 5JWRB 1EV9A 3DWVA 3IV4A 1PX6A 2HSNB 1PL2A 4EC0A 1MDKA 1M2AA 3GX0A 2DIZA 4HZ2A 4ML1A 1K3YA 4XHMA 5CAXA 3LEFA 1IYHA 4JZQA 5AIVA 3KXOA 2WRTA 2EIRA 3BOAA 2LSTA 2LQOA 2CT6A 4ZBAA 1ACVA 4GQCA 3FZ9A 4NV5A 2GSSA 1BX9A 1EV4A 4IHUA 4WBRD 2FNOA 2AHEA 3P8WA 4MF7A 2VM1A 5CRHA 1XBSA 2VCTA 3QAGA 1X9MB 3QCPA 5HQPA 4TR1B 4BWQA 1M9BA 4X0XA 3VI5A 2V32A 5D96A 3M3MA 1GSYA 4JR6A 2H6YA 2RUFA 3EURA 3GUSA 3CMIA 1PQNA 4EE0A 2VD1A 2JU5A 1AW9A 1AAZA 4ILFA 4HU7A 2JL4A 2R6KA 3M0FA 2VD0A 1HNBA 4X1UA 2GVPA 5EL8A 4G19A 2LJAA 1SYXA 1XW9A 2XC2A 5G1KA 2FHEA 2B1LA 3KMOA 2RM6A 5KN1A 2HRKB 1SKWB 2UZ8A 4POKA 1YQ1A 5ECNB 4MP4A 2HSYA 2HQTA 4NPBA 3IAS2 10GSA 2WB9A 2K8VA 3WYWA 2NDOA 3ERWA 4KA0A 1ZYQB 2R3XA 1OYJA 1PKWA 3GL5A 3TKPA 2YCDA 3BD2A 4EXJA 4HUAA 4HOJA 1T00A 2VLVA 2M80A 1M2BA 3MAKA 1SJ6A 3BJ5A 2LS5A 3V1WA 4XS1A 1URMA 3HJPA 4N11A 4OFTA 2I4AA 3GKKA 4ISDA 1KEBA 5A4WA 3HYPA 1TRSA 2QC7A 3QDNA 2B5EA 2PERA 3J7Yk 1A0FA 4DVCA 4V2MA 3FW2A 2CVBA 1HNCA 2YOIA 4DSRA 2I81A 1SU9A 2FCHA 4KDXA 1SK1A 3HHVA 2N5BA 1VGLA 5HFKA 2VIMA 3ERFA 2CQ9A 3I9V2 2HFDA 4XRAA 3RHBA 1T4YA 1X5CA 2NBSA 3IRAA 5IMFA 1IYIA 1TJDA 4GLTA 1I5GA 1OVNA 4MZWA 3E9JB 3D21A 1I9DA 4XTSA 1TK0B 4HS1A 4KDUA 1GUHA 3KM6A 4ECCA 1A2MA 3GH6A 2E2GA 3IR4A 3GV1A 1BEDA 1A24A 1TKDB 3CSJA 2WCIA 1YDKA 3LGCA 2OA7A 3BCIA 4ZB6A 2CVKA 2JSZA 2XBIA 2OE0A 2P5QA 5IIZA 4WR5A 4ECIA 2H30A 1B9YC 4TXOA 1GSDA 1ML6A 4HDEA 3GSSA 1QUWA 1WP0A 2B5YA 2K18A 5HR2A 3ISOA 2PMTA 1SENA 3C1SA 5CRDA 4IGJA 7GSSA 2H8LA 4POBA 3UMAA 2HSMA 4K7NA 20GSA 2R4VA 1QFNA 2PPTA 4KW6A 2PUKC 5CP1A 1C72A 1Y25A 1V57A 3FHKA 1EOHA 4RQRA 1DE2A 1K0BA 3TCOA 4EF0A 2ZUPA 3TUEA 4WKWA 1TK8B 1K0NA 5EPFA 5IMVA 3L9VA 4GSTA 5GSSA 1A8LA 3FZ4A 3DXBA 2I3YA 1GNWA 3TKQA 4EUYA 5ECIB 6GSUA 2C8UA 4TXOB 1NHYA 3A5WA 1J0FA 4IW9A 1TTZA 3TKRA 1TU8A 1TDIA 1W4VA 4GWRA 1OE7A 2HRNA 1JZWA 2H0GA 1XPVA 1DBYA 3RBTA 4OD7A 3WGDA 1Z9HA 4HQZA 4F0BA 5HFIA 2TRCP 4BL7A 2MMOA 2VCWA 3HVSA 3PR8A 3TKSC 5B6NA 1OE8A 4ZL8A 2HSMB 5IQYA 4ZXGA 2MBTA 1O8WA 5CRGA 3VK9A 5IPHA 3WT1A 4TR3A 1PSQA 5DCHA 1DE1A 4G0IA 1MDJA 5H5QA 2A2SA 5KN0A 1JZOA 1NHOA 4XS6A 1H4OA 5J9BA 3ZREA 1YZXA 3QFBC 2KLXA 1PX7A 2NVLA 3ZIVA 2YV9A 1BYEA 1UA5A 2HE3A 3KD0A 1U88A 2OBKA 4IP1A 3HZ8A 3HKRA 2LRCA 1GUMA 4BVXA 1K0MA 3FEUA 6GSYA 4BL7B 3F63A 1EEMA 3LJRA 5DBQA 3I69A 2H1DA 4N30A 2BJXA 4F0CA 1QK8A 4KCAA 3TRPA 4I6XA 5JWQB 1X5EA 2OKAA 4FO5A 4MA9A 4K8MA 2IMDA 4IS0A 1F3AA 3U6VA 5AGYA 1O85A 1AUCA 2DJ3A 3VWVA 1GSQA 2KHPA 5F8BA 1PMTA 2C0EA 1FVJA 1N2AA 4ZILA 1SL2B 3GX8A 3EE2A 1FAAA 1THOA 4JR4A 1F37A 2FY6A 3E0UA 5DQYA 2OE3A 3H79A 1H75A 4GTUA 3IC4A 4KH7A 5EVOA 1M99A 4IELA 5D8IA 2CZ3A 1ON4A 2H74A 1B48A 4BVXB 2ON7A 2L6DA 1SL0B 4OMVA 2YANA 11GSA 4NXIA 2L6CA 5E59A 5FWGA 13GSA 2CA8A 3ZZXA 3QOUA 4AJ7A 5CNWA 3HD5A 3DRNA 4ZBDA 1V58A 3O76A 2VUPA 4MCUA 4NV2A 3RPPA 1WWJA 2IPAA 1FW1A 2YP6A 3UOMA 3LG6A 2HZFA 4J57E 2HRFA 4KCEA 5DALA 3FYGA 1PKZA 4NWYA 4F9ZA 3GHAA 1JZRA 5G2ZA 2P31A 3DVXA 4YQMA 1OC9B 3N5OA 3DMLA 5IO0A 2IN3A 4Q5RA 4JRRA 4GXZA 1ZOFA 4K9ZA 1K0AA 3ZMLA 1AIUA 3KP9A 2CV4A 4ID0A 3W8SA 2J9HA 3F3RA 3UBLA 1GSUA 3GNJA 4MJBA 4IVFA 4TVEA 4NHZA 2GDRA 4TR0A 5LD0A 2E2MA 3QAVA 3EMXA 2DLXA 4G10A 3F6DA 2KUCA 1B4QA 2HSHA 2WZ9A 3VPQA 2VL2C 3UIWA 4YAVA 5DALB 1RQMA 1XCCA 4MMMA 3US3A 4L0WA 4ZB9A 1TU7A 4AF2A 4HQSA 2O87A 2BTOT 5JWOB 4PGTA 1XFLA 3WGEA 3TRQA 4USSA 3ZFBA 1F9MA 4MLYA 2RLIA 3APQA 3GH9A 4JEDA 5HR0A 3DYRA 1JLVA 5D9XA 4GF0A 2HRKA 2F8FA 2J23A 5D9TA 4YH2A 1EWXA 2WFCA 2EIOA 2GZYA 1YF0A 4KX4A 2YZHA 2H1AA 3Q18A 1YEPA 1SJZA 3MNGA 3S9FA 2HLSA 3IHQA 3DKSA 1ZGNA 1CQGA 3HJMA 2H0HA 3ZL5A 2OBIA 1HQOA 1UC7A 3ZMKA 2YZUA 5E4WA 3EU3A 4MJEA 1SK0A 5JCUA 4L8EA 4TN8A 1R5PA 2XHFA 3PGTA 4ECBA 1O7UA 3R2QA 1TXXA 3ZITA 4F82A 1J9BA 3F9UA 1U6TA 2WGRA 1K0DA 2HXKA 2GSRA 3KH9A 4MF6A 4ULXA 1TP9A 2A4VA 2AAWA 4IBPA 2H66A 2VL3A 4J2FA 3EYTA 1K0CA 2MMNA 2N5AA 3VFIA 6GSXA 3U5RE 1BQ7A 4XCSA 3GKNA 3DGQA 3HCZA 4Q5QA 3SBCA 3LFLA 4G0KA 5ECRB 4OWYA 3KGKA 5JCGA 6GSWA 2VCVA 3L0HA 2WULA 5H5RA 1F2EA 5ELGA 1SD9A 3UJ1A 4WXTA 3F0IA 1GP1A 2P0GA 4XIHA 2AB6A 3FR9A 2V6OA 4Q5NA 5IMDA 4KUNA 1PRXA 4POMA 4PXOA 2IL3A 5AN1A 2EC4A 2AV4A 4K0NA 1WE0A 1A8YA 2V1MA 2R2JA 3A3TA 2EIQA 3KCMA 5DJMA 1QMVA 3M1GA 3ZFLA 2H1GA 4PNGA 4EKZA 3GFKA 4HI7A 4ML6A 3CXGA 2GQMA 3C73A 5H5SA 3KZQA 5GAND 1X5DA 1OAZA 2FA8A 3W8JA 3IPZA 3BBYA 2MMZA 4X43A 1MEKA 4BVYA 2ALBA 1G6YA 2GLRA 1T7PB 5EY6A 3C8EA 3L4NA 2XBQA 3QMXA 3ZYWA 2L4CA 3IA1A 3GMFA 1KNGA 2X8HA 3I6AA 2PWJA 1ILOA 4PX1A 2F3MA 4EDYA 2LQQA 1AC1A 19GSA 2IMKA 1LJRA 3G7YA 5IM9A 3UL3A 2GQLA 1JHBA 3E3EA 1GNEA 3PINA 1EGOA 1G7EA 1Z7RA 4MPFA 1GLQA 3GSTA 1ERWA 1ZCPA 2YNXA 3MSZA 3VWUA 1TRWA 1VRSD 2LTKA 2CX3A 4PURA 6GSTA 3ZIJA 2G0FA 4BVYB 5KEJA 5J5NA 1YKCA 2DMMA 1FOVA 2AUVA 5J41A 3IE3A 1Z6NA 8GSSA 3FRCA 17GSA 2JADA 2JZSA 2YJ7A 1S3DA 2IWTA 5B8BA 4NMUA 2H72A 2V41A 3A2VA 1SD8A 4GSNA 4RUVA 4N10A 4XS4A 3VI7A 1ST9A 3O3TA 2OACA 4LMVA 4AJ6A 3LORA 2WS2A 14GSA 1DSBA 3CRUA 2PU9C 1U3AA 5LNKe 2ES7A 2HYXA 2H01A 4CDOA 2QGVA 3IXRA 2JZTA 2VLTA 1TOFA 1B8XA 1HYUA 3C1RA 4BA7A 1WOUA 4HZ4A 4NAXA 5B7CA 4RI7A 4QL7A 5DVBA 2FWHA 3GKXA 2IIYA 3FR6A 4KB3A 5J4UA 2BMXA 3HVXA 2WJUA 1YEXA 2TIRA 4PTSA 2JZRA 2LUSA 4K7OA 2LV3A 1R4WA 3D6IA 4N0ZA 3CTFA 5G1LA 2B7KA 3WD6A 2HT9A 2LJRA 2O85A 5FHIA 4RI6A 4LLRA 4XS4B 1E6BA 3WGXA 4MPGA 5ECSA 2K8SA 3EWLA 2KOKA 2D2ZA 1TRVA 4TKYA 4AJ8A 3NIVA 5ABRA 3GN3A 2B3SA 1HD2A 4MDCA 2DBCA 2DJ2A 4IJIA 4Q5FA 4POLA 4NHWA 3MWHA 4WETA 1B4PA 4PQHA 3GL3A 3F4SA 2REMA 4OO4A 1TK5B 1GTIA 1M9AA 1EOGA 3LYKA 3M9JA 18GSA 4O92A 4OCFA 1O6JA 3ZVJA 2H75A 5B6MA 4OFNA 2K9FA 4KE3A 4O5RA 3F4TA 4DEJA 5GAPD 4QL9A 1AQXA 1FG4A 5IPGA 1GLPA 5DCGA 1TRUA 3P2AA 3CRTA 1V9WA 12GSA 4HEA2 2DJKA 2H76A 1G6WA 2N5FA 1A2LA 3D0ZA 1M0UA 5F0GA 2VOCA 2B7JA 1B9XC 3EINA 22GSA 4G0LA 4K2DA 4WR4A 3NOFA 2GZPA 3N9JA 2A2RA 3A2WA 5ELAA 1M2DA 4CW9A 2H6ZA 1SKRB 1OC9A 4YQUA 4FYCA 1R26A 4O7HA 2E0QA 1MDIA 3O6TA 4O32A 3TRXA 5ECMB 4V1Ap 1FVKA 3TJKA 5CO3A 2WDUA 3JCML 4HJ2A 1AQWA 1UVZA 2M46A 1K3LA 5DDLA 2YWNA 3TOTA 3UBKA 3QD9A 1XZOA 2G2QA 2C0DA 3GIXA 3F4RA 3KJYA 4EVMA 5CYYA 4AGSA 1RW1A 2DJJA 1V98A 4I8BA 1O73A 3Q19A 5ECHB 3GA4A 3HA9A 3H93A 1Z7PA 5ECPB 4V2NA 3GKMA 1G0TA 1KTEA 1NW2A 3ZVJD 4Z7XA 2FWGA 3DIEA 4L5LA 3TB2A 5AIXA 2VCQA 3L9SA 3ZTLA 1VF1A 4IQAA 3ED3A 3IK7A 2CAQA 2Z9SA 2HZEA 3TGZA 1T3BA 2DJ1A 2H6XA 5CRWA 3HVVA 5HFGA 2K6VA 1FB0A 4TOPA 3KIJA 3L9UA 1JFUA 5ID2B 4ZB8A 6GSSA 3IDVA 5A5KA 1BJXA 5KN2A 4BWSA 2VAFA 1PN9A 1ERVA 1A23A 4V2LA 3P7XA 3TJFA 5J9CA 1GTAA 2MYGA 4PQIA 3W6GA 3ZLPA 2TRXA 5IOWA 2YJHA 2L4QA 1W89A 4J56E 3R3EA 1T1VA 4FQUA 2HZEB 5DJLA 3UVTA 1XWAA 1ZL9A 1QGVA 3IC8A 2KP2A 4KNDA 5IO2A 1YKAA 4K7IA 3FZAA 3LXTA 3ERGA 1O81A 2O7KA 1K0OA 3QR6A 1Z5YE 4TXVA 2LNTA 4FH8A 1PL1A 5IMCA 1THXA 3RAZA 1A2JA 4H86A 1G7OA 4G2EA 3GURA 3GYKA 4WF4A 4LMWA 4EO3A 2F51A 2CVDA 1F6MC 4MH3A 2X99A 3CTGA 2VM2A 3KEBA 3VWWA 2ON5A 3CYNA 3TJBA 4DSSA 6GSVA 1VF2A 2C4JA 2RM5A 3D4MA 3TJGA 4MF5A 3VWXA 1QXHA 2R37A 3NZNA 4MK3A 1GL8A 2YPMA 5HR3A 3FZ5A 1Q4JA 4MH2A 1MD3A 2NPBA 2H73A 4E8EA 3VLNA 2MZCA 2V6KA 4I97A 2OADA 3SWLA 2ZNMA 1Q98A 2ZCTA 3ME8A 4N0VA 4F2IA 4D73A 5BMUA 3APOA 1ABAA 2R5GA 3KH7A 3PH9A 5GZZB 1FHEA 4HJMA 2VL9A 4DSSB 2C0FA 4FIWA 3VURA 4XRDA 2VO4A 1WIKA 5D9WA 5LCZA 1K3OA 1BG5A 4YAPA 3UEMA 1JLWA 1U87A 3IAM2 3Q74A 1R5AA 2IMEA 4PQ1A 1T8EB 4GRFA 2LJKA 4IJ3A 2LRNA 5IOXA 1SK2A 2FGXA 3H8QA 5ECQB 3RPNA 9GSSA 3D4TA 4D73B 1EEJA 1YF1A 2DJ0A 3FY7A 5G30A 4TW5A 5F07A 2PVOC 2NTOA 1XIYA 4EL1A 4P3YB 2F8AA 2QKEA 1N8JA 5DQSA 5ENUA 3LQ7A 5COHA 2H19A 3M9KA 3RHCA 3WT2A 2AJQB 5C00A 1OC8A 3G7IA 1RK4A 3TJJA 1VF3A 1V40A 4CHSA 2X8CA 2JSYA 5INYA 3FK8A 2C0GA 2C3NA 3UVHA 1XWBA 2C80A 1EGRA 3OR5A 3LWAA 2C3TA 2P5RA 2B5XA 2VLUA 1QQ2A 1AXDA 2LEGA 2YWOA 3I43A 2GS3A 4ACSA 1S3CA 3EMPA 4OO5A 4WF5A 1O8XA 3LXZA 2JACA 4KAEA 1GSEA 3KMNA 3EU4A 2IMIA 4G9HA 2FWFA 1GTBA 2OJLA 4L0UA 2DSAA 1M7TA 3P90A 5J3RA 3LYPA 3ZRDA 5KN3A 3CSIA 2C1YA 1X0RA 2L59A 1GRXA 2LRTA 4FYUA 3HXSA 2B1KA 3QAWA 4I5QA 1E2YA 3FR3A 1VF4A 2YN1A 3EC3A 4JE1A 3D5JA 3UAPA 4TRXA 5ECOB 1BAYA 4ZBBA 1TI3A 3EVIA 4MJAA 2FD3A 3QPMA 4KSMA 2KP1A 1MD4A 1XVWA 3TKSA 3M8NA 4ZL9A 5D9VA 3C7MA 4KGIA 1XWCA 2GTUA 3RDWA 5L71A 3BCKA 4FYBA 5FT3A 5GSTA 4MABA 2PBJA 4GSSA 2VCZA 3APSA 1PA3A 1GSFA 2B6MA 3HZ4A 5CREA 1FB6A 1XW5A 1Z3EA 3VPTA 2L57A 2I1UA 2L5LA 1KBNA 1ERUA 2YWIA 3FKFA 4LL1B 1OKTA 3HY2A 2DMLA 3IK9A 2RUEA 4K0GA 4PNFA 1TI1A 2H1BA 4OCEA 5D73A 1AQVA 1GWCA 4PUAA 2LNSA 1USBA 4V1Ag 1NM3A 4BPYA 1GUKA 4K6XA 3KP8A 1WMJA 2CAIA 3PPUA 1GULA 2PVQA 5D93A 2H71A 3Q6OA 3KTBA 2HRAA 5IMZA 4KDYA 2I9HA 2M72A 1YY7A 2FA4A 4GQFA 4LL4B 3CSHA 1FO5A 1EZKA 4DSQA 4F03A 1PD21 4GCIA 3H4KA 2IFQA 2GSQA 5G5FA 3KTLA 3GRXA 5C04A 1SYRA 2FWEA 2YV7A 2LKUA 2QSIA 4IQ1A 5DAKA 1ERTA 1GH2A 1ZMAA 4MZBA 2MBSA 1XXUA 2X64A 4YQVA 2XPEA 4JU5A 3MDKA 5ECKB 2H0IA 1GSSA 2FLSA 4WEYA 4EDZA 1MTCA 4QQ7A 1J08A 4PUFC 1HNAA 2YWMA 4L5OA 2RIIA 16GSA 1LU4A 1JZDA 3J7Yb 4KF9A 5B8AA 2PGTA 1V2AA 1XWKA 4IN0A 1ZZYA 1S3AA 1U3IA 3TKSE 5IMAA 2GGTA 2E7PA 3CBUA 1ZYEA 2C3QA 5G31A 1EP7A 1WJKA 3G7JA 1SKSB 3L78A 2IFQB 4RQXA 4ZIJA 2MMAA 3DEXA 4IP6A 4E8HA 2V2GA 1TW9A 5AISA 1Z6MA 2IMFA 1XW6A 5DAKB 4MJCA 2VCXA 4OFMA 4JBBA 1Y6EA 1F3BA 4MZCA 1EP8A 1T4ZA 3F6FA 3K8NA 3AY8A 3TDGA 2O89A 2GSTA 4WBJA 2FUG2 5ID2A 1XWGA 3GTUA 5A4UA 5ECLB 4TR4A 3H1NA 2DC5A 1PGTA 1WRYA 1CQHA 2GT6A 2GQKA 3IBHA 3DVWA 3DD3A 1XVQA 4K1FA 2L5OA 1WPIA 3HJOA 3UARA 5JCWA 2HNLA 2IJYA 3LSZA 2F9SA
chains in the Genus database with same CATH superfamily
1NSWA 1XOAA 2GZZA 1ZYPA 4HU9A 1OKDA 2PN8A 1GTUA 2HSNA 4Z2TA 2OT3A 2XPDA 1XOBA 4I2UA 2VL2A 4ECJA 1A0RP 2H70A 3F8UA 4KSOA 2CX4A 3QFAC 2X8GA 4I2TA 3HDCA 3ME7A 2CZ2A 1SJIA 2GT5A 3GTUB 5F06A 5G5EA 1UN2A 1LBKA 4LA1A 1DUGA 3D22A 1SL1B 2OE1A 2O8VB 3G9BA 4ZL7A 5A4VA 3C71A 1R7HA 3IOSA 5HR1A 3TOUA 3CQFA 2HI7A 3A2XA 1X9SB 4TR1A 3F3QA 5F05A 2AYTA 2DIYA 1YJ6A 4IKHA 1X9WB 1OC3A 5JWRB 1EV9A 3DWVA 3IV4A 1N25A 1PX6A 2HSNB 1PL2A 4EC0A 1MDKA 1M2AA 3GX0A 2DIZA 4HZ2A 4ML1A 1K3YA 4XHMA 5CAXA 3LEFA 1IYHA 4JZQA 5AIVA 3KXOA 2WRTA 2EIRA 3BOAA 2LSTA 2LQOA 2CT6A 4ZBAA 1ACVA 4GQCA 3FZ9A 4NV5A 2GSSA 1BX9A 1EV4A 4IHUA 4WBRD 2FNOA 2AHEA 3P8WA 3FMWA 4MF7A 2VM1A 5CRHA 1XBSA 2VCTA 3QAGA 1X9MB 4G01A 3QCPA 5HQPA 4TR1B 4BWQA 1M9BA 4X0XA 3VI5A 2V32A 5D96A 3M3MA 2QA2A 1GSYA 4JR6A 2H6YA 2RUFA 3EURA 2WZSA 3GUSA 3CMIA 1PQNA 2EFCA 4EE0A 2VD1A 2JU5A 1AW9A 1AAZA 4ILFA 4HU7A 2JL4A 2R6KA 3M0FA 2VD0A 1HNBA 4X1UA 2GVPA 5EL8A 4G19A 2LJAA 1SYXA 1BF5A 1XW9A 2XC2A 5G1KA 2FHEA 2B1LA 3KMOA 1S3RA 2RM6A 5KN1A 2HRKB 1SKWB 2WVYA 2UZ8A 4POKA 1YQ1A 5ECNB 4MP4A 2HSYA 2HQTA 4NPBA 3IAS2 10GSA 2WB9A 2K8VA 2DKHA 3WYWA 2NDOA 3ERWA 4KA0A 1ZYQB 2R3XA 1OYJA 1PKWA 3GL5A 3TKPA 2YCDA 3BD2A 2A4HA 4EXJA 4HUAA 4HOJA 1T00A 2VLVA 2M80A 1M2BA 3MAKA 1SJ6A 3BJ5A 2LS5A 3V1WA 4XS1A 5J47A 1URMA 3HJPA 4MNNA 4N11A 4OFTA 2I4AA 3GKKA 4ISDA 1KEBA 2O3EA 5A4WA 3HYPA 4A5PA 1TRSA 2QC7A 3QDNA 2B5EA 2PERA 3J7Yk 1A0FA 4DVCA 4V2MA 3FW2A 2CVBA 1HNCA 2YOIA 4DSRA 2I81A 1SU9A 2FCHA 4KDXA 1SK1A 3HHVA 2N5BA 1M3JA 1VGLA 5HFKA 2VIMA 3ERFA 2CQ9A 3I9V2 2HFDA 4XRAA 3RHBA 1T4YA 1X5CA 2NBSA 3IRAA 5IMFA 1IYIA 1TJDA 4GLTA 1I5GA 1OVNA 2WW2A 3EPTA 4MZWA 3E9JB 3D21A 1I9DA 4XTSA 1TK0B 4HS1A 4KDUA 1GUHA 3KM6A 4ECCA 1A2MA 3GH6A 2E2GA 3IR4A 3GV1A 1BEDA 1A24A 1TKDB 3CSJA 2WCIA 1YDKA 3LGCA 2OA7A 3BCIA 4AKXB 4ZB6A 2CVKA 2JSZA 2XBIA 2OE0A 2P5QA 5IIZA 4WR5A 4ECIA 2H30A 1B9YC 4TXOA 1GSDA 1ML6A 4HDEA 3GSSA 1QUWA 1WP0A 2B5YA 2K18A 5HR2A 3ISOA 2PMTA 1SENA 3C1SA 5CRDA 4IGJA 7GSSA 1S4BP 2H8LA 4POBA 3UMAA 2HSMA 4K7NA 20GSA 2R4VA 1QFNA 2PPTA 4KW6A 2PUKC 4K2XA 4O5QA 1C72A 5CP1A 1Y25A 1V57A 3FHKA 1EOHA 4RQRA 1DE2A 1K0BA 3TCOA 4EF0A 4QMKA 2ZUPA 3TUEA 4WKWA 1TK8B 1K0NA 5EPFA 5IMVA 3L9VA 4GSTA 5GSSA 1A8LA 3FZ4A 3DXBA 2I3YA 1GNWA 3TKQA 4EUYA 5ECIB 6GSUA 2C8UA 3RFRC 4TXOB 1NHYA 3A5WA 1J0FA 4IW9A 1TTZA 3TKRA 1TU8A 1TDIA 1W4VA 4GWRA 1OE7A 2HRNA 1JZWA 2H0GA 1XPVA 1DBYA 3RBTA 4OD7A 3WGDA 1Z9HA 4HQZA 4F0BA 5HFIA 2TRCP 4BL7A 2MMOA 2VCWA 3HVSA 3PR8A 3TKSC 5B6NA 3HMJG 1OE8A 4ZL8A 2HSMB 5IQYA 3CWGA 2WVXA 4ZXGA 2MBTA 1O8WA 5CRGA 3VK9A 5IPHA 3WT1A 4TR3A 1PSQA 5DCHA 1DE1A 4G0IA 1MDJA 5H5QA 2A2SA 5KN0A 1JZOA 1NHOA 4XS6A 1H4OA 5J9BA 3ZREA 1YZXA 3QFBC 2KLXA 1PX7A 2NVLA 3ZIVA 2YV9A 1BYEA 1UA5A 2HE3A 3KD0A 1U88A 2OBKA 4IP1A 3HZ8A 3HKRA 2LRCA 1GUMA 4BVXA 1SVOA 1K0MA 3FEUA 6GSYA 4O5UA 4BL7B 3F63A 1EEMA 3LJRA 4ZB7A 5DBQA 3I69A 2H1DA 4N30A 2BJXA 4F0CA 1QK8A 4KCAA 3TRPA 4I6XA 5JWQB 1X5EA 2OKAA 4FO5A 4MA9A 2X4AA 4K8MA 2IMDA 4IS0A 2WVXB 1F3AA 3U6VA 5AGYA 1O85A 1AUCA 1ZYNA 2DJ3A 5A34A 3VWVA 1GSQA 2KHPA 5F8BA 1PMTA 4AKIA 2C0EA 1FVJA 1N2AA 4ZILA 1SL2B 3GX8A 3RGBC 3EE2A 1FAAA 1THOA 4JR4A 1F37A 2FY6A 3E0UA 5DQYA 2OE3A 3H79A 1H75A 4GTUA 3IC4A 4KH7A 3A5IA 5EVOA 1M99A 4IELA 5D8IA 2CZ3A 1ON4A 2H74A 1B48A 4BVXB 2ON7A 2L6DA 1SL0B 4OMVA 2YANA 11GSA 4NXIA 2L6CA 5E59A 5FWGA 2A2PA 13GSA 2CA8A 3ZZXA 3QOUA 4AJ7A 5CNWA 3HD5A 3DRNA 4ZBDA 5KOWA 1V58A 4EIQA 3O76A 2VUPA 4MCUA 4NV2A 3HVNA 5A34B 3RPPA 1WWJA 2IPAA 1FW1A 2YP6A 3UOMA 3LG6A 3IHGA 2HZFA 4J57E 2HRFA 4KCEA 5DALA 3FYGA 1PKZA 4NWYA 4F9ZA 3GHAA 1JZRA 5G2ZA 2P31A 3DVXA 4YQMA 1OC9B 3N5OA 3DMLA 5IO0A 2IN3A 4Q5RA 4JRRA 4GXZA 1ZOFA 4K9ZA 1K0AA 3ZMLA 1AIUA 3KP9A 2CV4A 4ID0A 3W8SA 2J9HA 3F3RA 3UBLA 1GSUA 3GNJA 4MJBA 4IVFA 4TVEA 4NHZA 2GDRA 4TR0A 5LD0A 2E2MA 3QAVA 3EMXA 2DLXA 4G10A 3F6DA 2KUCA 1B4QA 2HSHA 2WZ9A 3VPQA 2VL2C 3UIWA 4YAVA 5DALB 1RQMA 1XCCA 4MMMA 3US3A 4L0WA 4ZB9A 1TU7A 4AF2A 4HQSA 2O87A 2BTOT 5JWOB 4PGTA 1XFLA 3WGEA 4EIPA 3TRQA 4USSA 3ZFBA 1F9MA 4MLYA 2RLIA 3APQA 3GH9A 4JEDA 5HR0A 3DYRA 1JLVA 5D9XA 2O36A 4GF0A 2HRKA 2F8FA 2J23A 5D9TA 4YH2A 1EWXA 2WFCA 2EIOA 2GZYA 1YF0A 4KX4A 2YZHA 2H1AA 3Q18A 1YEPA 1SJZA 3MNGA 3S9FA 2HLSA 3IHQA 3DKSA 1ZGNA 1CQGA 3HJMA 2H0HA 3ZL5A 2OBIA 1HQOA 1UC7A 3ZMKA 2YZUA 5E4WA 3EU3A 4MJEA 1SK0A 5JCUA 4L8EA 4TN8A 1R5PA 2XHFA 3PGTA 4ECBA 1O7UA 3R2QA 1TXXA 3ZITA 4F82A 1J9BA 3F9UA 1U6TA 2WGRA 1K0DA 4GDFA 2HXKA 2GSRA 3KH9A 4MF6A 4ULXA 1TP9A 2A4VA 2AAWA 4IBPA 2H66A 2VL3A 4J2FA 3EYTA 1K0CA 2MMNA 2N5AA 3VFIA 6GSXA 1YVLA 3U5RE 1BQ7A 4XCSA 3GKNA 3DGQA 3HCZA 4Q5QA 3SBCA 3LFLA 4G0KA 5ECRB 4OWYA 3KGKA 5JCGA 6GSWA 3CHXC 2VCVA 3L0HA 2WULA 5H5RA 1F2EA 5ELGA 1SD9A 3UJ1A 4WXTA 1XG8A 3F0IA 2UV8G 1GP1A 2P0GA 4XIHA 2AB6A 3FR9A 2V6OA 4Q5NA 5IMDA 4KUNA 1PRXA 4POMA 4PXOA 2IL3A 5AN1A 2EC4A 2AV4A 4K0NA 1WE0A 1A8YA 2V1MA 2R2JA 3A3TA 2EIQA 3KCMA 5DJMA 1QMVA 3M1GA 3ZFLA 2H1GA 4PNGA 4EKZA 3GFKA 2WW3A 4HI7A 3MIXA 4ML6A 3CXGA 2GQMA 3C73A 5H5SA 3KZQA 5GAND 1X5DA 1OAZA 5J4YA 2FA8A 3W8JA 3IPZA 3BBYA 2MMZA 4X43A 5BRTA 1MEKA 4BVYA 2ALBA 1G6YA 2GLRA 1T7PB 5EY6A 3C8EA 3L4NA 2XBQA 3QMXA 3ZYWA 2L4CA 3IA1A 3GMFA 1SVMA 1KNGA 2X8HA 3I6AA 4YKFA 2PWJA 1ILOA 4PX1A 2F3MA 4EDYA 2LQQA 1AC1A 19GSA 5A1NA 4Z2UA 2IMKA 1LJRA 3G7YA 5IM9A 3UL3A 2GQLA 1JHBA 3E3EA 1GNEA 3PINA 1EGOA 1G7EA 1Z7RA 4MPFA 1GLQA 3GSTA 1ERWA 1ZCPA 2YNXA 3MSZA 3VWUA 4AKHA 1TRWA 1VRSD 2LTKA 2CX3A 4PURA 6GSTA 3ZIJA 2G0FA 4BVYB 5KEJA 5J5NA 1YKCA 2DMMA 1FOVA 2AUVA 5J41A 3IE3A 1Z6NA 8GSSA 3FRCA 17GSA 2JADA 2JZSA 2YJ7A 1S3DA 2IWTA 5B8BA 4NMUA 2H72A 2V41A 3A2VA 1SD8A 4GSNA 4RUVA 4N10A 4XS4A 3VI7A 1ST9A 3O3TA 5A1NB 2OACA 4LMVA 4AJ6A 3LORA 2WS2A 14GSA 1DSBA 3CRUA 2EFHA 5J4VA 4PHZC 2PU9C 1U3AA 5LNKe 1I1IP 2ES7A 2HYXA 2H01A 4W66A 4CDOA 2QGVA 3IXRA 2JZTA 2VLTA 1TOFA 1B8XA 1HYUA 3C1RA 4BA7A 1WOUA 4HZ4A 4NAXA 5B7CA 4RI7A 4QL7A 5DVBA 2FWHA 3GKXA 2IIYA 3FR6A 4KB3A 5J4UA 2BMXA 3HVXA 2WJUA 1YEXA 2TIRA 4PTSA 2JZRA 2LUSA 4K7OA 2LV3A 1R4WA 3D6IA 4N0ZA 3CTFA 5G1LA 2B7KA 3WD6A 2HT9A 2LJRA 2O85A 5FHIA 1Y1UA 4RI6A 4LLRA 4XS4B 1E6BA 3WGXA 4MPGA 5ECSA 2K8SA 3EWLA 5A5HA 2KOKA 2D2ZA 1TRVA 4TKYA 4AJ8A 3NIVA 5ABRA 3GN3A 2B3SA 1HD2A 4MDCA 2DBCA 2DJ2A 4IJIA 4Q5FA 4POLA 4NHWA 3MWHA 4WETA 1B4PA 4PQHA 3GL3A 3F4SA 1SVLA 2REMA 4OO4A 1TK5B 1GTIA 1M9AA 1EOGA 3LYKA 3M9JA 18GSA 4O92A 4OCFA 1O6JA 3MYDA 3ZVJA 2H75A 5B6MA 4OFNA 2K9FA 4KE3A 4O5RA 3F4TA 4DEJA 5GAPD 4QL9A 1AQXA 1YEWC 1FG4A 5IPGA 1GLPA 5DCGA 1TRUA 3P2AA 3CRTA 1V9WA 12GSA 4HEA2 2DJKA 2H76A 1G6WA 2N5FA 1A2LA 3D0ZA 1M0UA 5F0GA 5A5HB 2VOCA 2B7JA 1B9XC 3EINA 22GSA 4G0LA 4K2DA 4WR4A 3NOFA 2GZPA 3N9JA 2A2RA 3A2WA 5ELAA 1M2DA 4CW9A 2H6ZA 1SKRB 1OC9A 4YQUA 4FYCA 1R26A 4O7HA 2E0QA 1MDIA 3O6TA 4O32A 4YKGA 3TRXA 5ECMB 4V1Ap 1FVKA 3TJKA 5CO3A 2WDUA 3JCML 4HJ2A 1AQWA 1UVZA 2M46A 1K3LA 5DDLA 2YWNA 3TOTA 3UBKA 3QD9A 1XZOA 2G2QA 2C0DA 3GIXA 3F4RA 3KJYA 4EVMA 5CYYA 4AGSA 1RW1A 2DJJA 1V98A 4I8BA 1O73A 3Q19A 5ECHB 3GA4A 4AKGA 3HA9A 3H93A 1Z7PA 5ECPB 4V2NA 2DKIA 3GKMA 1G0TA 1KTEA 1NW2A 3ZVJD 4Z7XA 4X4JA 2FWGA 3DIEA 4L5LA 3TB2A 4FXYP 5AIXA 4HSCX 2VCQA 3L9SA 3ZTLA 1VF1A 4IQAA 3ED3A 3IK7A 2CAQA 2Z9SA 2HZEA 3TGZA 1T3BA 2DJ1A 2H6XA 5CRWA 3HVVA 5HFGA 2K6VA 1FB0A 4TOPA 3KIJA 3L9UA 1JFUA 5ID2B 1PFOA 4ZB8A 6GSSA 3IDVA 5A5KA 1BJXA 4BIKA 5KN2A 4BWSA 2VAFA 1PN9A 1ERVA 1A23A 4V2LA 3P7XA 3TJFA 2VKZG 2H1LA 5J9CA 1GTAA 2MYGA 2R0CA 4PQIA 3W6GA 3ZLPA 5J40A 2TRXA 5IOWA 2YJHA 2L4QA 1W89A 4J56E 3R3EA 1T1VA 4FQUA 2HZEB 5DJLA 3UVTA 1XWAA 1ZL9A 1QGVA 3IC8A 2KP2A 4KNDA 5IO2A 1FOHA 1YKAA 4K7IA 3FZAA 3LXTA 3ERGA 1O81A 2O7KA 1K0OA 3QR6A 1Z5YE 4TXVA 2LNTA 4FH8A 1PL1A 5IMCA 1THXA 3RAZA 1A2JA 4H86A 1G7OA 4G2EA 3GURA 3GYKA 4WF4A 4LMWA 4EO3A 2F51A 2CVDA 1F6MC 4MH3A 2X99A 3TU3B 3CTGA 2VM2A 3KEBA 3VWWA 2ON5A 3CYNA 3TJBA 4DSSA 6GSVA 1VF2A 2C4JA 2RM5A 3D4MA 3TJGA 2WW1A 4MF5A 3VWXA 1QXHA 2R37A 3NZNA 4MK3A 1GL8A 2YPMA 2R0GA 5HR3A 3FZ5A 1Q4JA 4MH2A 1MD3A 2NPBA 2H73A 4E8EA 2WW0A 3VLNA 2MZCA 2V6KA 4I97A 2OADA 3SWLA 2ZNMA 1Q98A 2ZCTA 3ME8A 4N0VA 4F2IA 4D73A 5BMUA 3APOA 1ABAA 2R5GA 3KH7A 3PH9A 5GZZB 1FHEA 1TXUA 4HJMA 1BG1A 2VL9A 4DSSB 2C0FA 4FIWA 3VURA 4XRDA 2VO4A 1WIKA 5D9WA 5LCZA 1K3OA 1BG5A 4YAPA 3UEMA 1JLWA 2EFDA 1U87A 3IAM2 3Q74A 1R5AA 2IMEA 4PQ1A 1T8EB 4GRFA 2LJKA 4IJ3A 2LRNA 5IOXA 1SK2A 2FGXA 3H8QA 5ECQB 3RPNA 9GSSA 3D4TA 4D73B 1EEJA 5BMUB 1YF1A 4PI2C 2DJ0A 3FY7A 5G30A 4TW5A 5F07A 2PVOC 2NTOA 1XIYA 4EL1A 4P3YB 2F8AA 2QKEA 1N8JA 5DQSA 5ENUA 3LQ7A 5COHA 2H19A 3M9KA 3RHCA 3WT2A 2AJQB 5C00A 1OC8A 3G7IA 1RK4A 3TJJA 1VF3A 1V40A 4CHSA 2X8CA 2JSYA 5INYA 3FK8A 2C0GA 2C3NA 3UVHA 1XWBA 2C80A 1EGRA 3OR5A 3LWAA 2WVZA 2C3TA 2P5RA 2B5XA 2VLUA 1QQ2A 4CY8A 1AXDA 2LEGA 2YWOA 3I43A 2GS3A 4ACSA 1S3CA 3EMPA 4OO5A 4WF5A 1O8XA 3LXZA 2JACA 4KAEA 1GSEA 3KMNA 1PN0A 3EU4A 2IMIA 4G9HA 2FWFA 1GTBA 2OJLA 4L0UA 2DSAA 1M7TA 3P90A 2R0PA 4PI0C 5J3RA 3LYPA 3ZRDA 5KN3A 3CSIA 2C1YA 1X0RA 2L59A 1GRXA 2LRTA 4FYUA 3HXSA 2B1KA 3QAWA 4I5QA 1E2YA 3FR3A 1VF4A 2YN1A 3EC3A 4JE1A 3D5JA 3UAPA 4TRXA 5ECOB 1BAYA 4ZBBA 1TI3A 3EVIA 4MJAA 2FD3A 3QPMA 4KSMA 2KP1A 1MD4A 1XVWA 3TKSA 3M8NA 4ZL9A 5D9VA 3C7MA 4KGIA 1XWCA 2GTUA 3RDWA 5L71A 3BCKA 4FYBA 5FT3A 5GSTA 4MABA 2PBJA 4GSSA 2VCZA 3APSA 1PA3A 1GSFA 2B6MA 3HZ4A 5CREA 1FB6A 1XW5A 1Z3EA 3VPTA 4K5RA 2L57A 2I1UA 2L5LA 1KBNA 1ERUA 2YWIA 3FKFA 4LL1B 1OKTA 3HY2A 2DMLA 3IK9A 2QA1A 2RUEA 4K0GA 4PNFA 1TI1A 2H1BA 4OCEA 5D73A 1AQVA 1GWCA 4PUAA 2LNSA 1USBA 4V1Ag 4CY6A 1NM3A 4BPYA 1GUKA 4K6XA 3KP8A 1WMJA 2CAIA 3PPUA 1GULA 2PVQA 5D93A 2H71A 3Q6OA 3KTBA 2HRAA 5IMZA 4KDYA 2I9HA 2M72A 1YY7A 2FA4A 4ICYA 4GQFA 4LL4B 3CSHA 4E68A 1FO5A 1EZKA 4DSQA 4F03A 1PD21 4GCIA 3H4KA 2IFQA 2GSQA 5G5FA 3KTLA 3GRXA 5C04A 1SYRA 2FWEA 2YV7A 2LKUA 2QSIA 4IQ1A 5DAKA 1ERTA 1GH2A 1ZMAA 4MZBA 2MBSA 5KOXA 1XXUA 2X64A 4YQVA 3LW9A 2XPEA 4JU5A 3MDKA 5ECKB 2H0IA 1GSSA 2FLSA 4WEYA 4EDZA 1MTCA 4QQ7A 1J08A 4PUFC 1HNAA 2YWMA 4L5OA 2RIIA 16GSA 1LU4A 1JZDA 3J7Yb 4KF9A 5B8AA 2PGTA 1V2AA 1XWKA 4IN0A 1ZZYA 1S3AA 1U3IA 3TKSE 5IMAA 2GGTA 2E7PA 3CBUA 1M3IA 1ZYEA 4N3ZA 2C3QA 5G31A 1EP7A 1WJKA 3G7JA 1SKSB 3L78A 2IFQB 4RQXA 4ZIJA 2MMAA 3DEXA 4IP6A 4E8HA 2V2GA 1TW9A 5AISA 1Z6MA 2IMFA 1XW6A 5DAKB 4MJCA 2VCXA 4OFMA 4JBBA 1Y6EA 1F3BA 4MZCA 1EP8A 1T4ZA 3F6FA 4AI6A 3K8NA 3AY8A 3TDGA 2O89A 2GSTA 4WBJA 2FUG2 5ID2A 1XWGA 3GTUA 2O5VA 5A4UA 5ECLB 4TR4A 3H1NA 2DC5A 1PGTA 1WRYA 1CQHA 2GT6A 2EFEA 3IBHA 2GQKA 3DVWA 3DD3A 1XVQA 2X49A 4K1FA 2L5OA 1WPIA 3HJOA 4Z2RA 3UARA 5JCWA 2HNLA 2IJYA 4K5SA 3LSZA 2F9SA
chains in the Genus database with same CATH topology
1NSWA 1XOAA 2GZZA 1ZYPA 4HU9A 1OKDA 2PN8A 1GTUA 2HSNA 4Z2TA 2OT3A 2XPDA 1XOBA 4I2UA 2VL2A 4ECJA 1A0RP 2H70A 3F8UA 4KSOA 2CX4A 3QFAC 2X8GA 4I2TA 3HDCA 3ME7A 2CZ2A 1SJIA 2GT5A 3GTUB 5F06A 5G5EA 1UN2A 1LBKA 4LA1A 1DUGA 3D22A 1SL1B 2OE1A 2O8VB 3G9BA 4ZL7A 5A4VA 3C71A 1R7HA 3IOSA 5HR1A 3TOUA 2HI7A 3A2XA 1X9SB 4TR1A 3F3QA 5F05A 2AYTA 2DIYA 1YJ6A 4IKHA 1X9WB 1OC3A 5JWRB 1EV9A 3DWVA 3IV4A 1N25A 1PX6A 2HSNB 1PL2A 4EC0A 1MDKA 1M2AA 3GX0A 2DIZA 4HZ2A 4ML1A 1K3YA 4XHMA 5CAXA 3LEFA 1IYHA 4JZQA 5AIVA 3KXOA 2WRTA 2EIRA 3BOAA 2LSTA 2LQOA 2CT6A 4ZBAA 1ACVA 4GQCA 3FZ9A 4NV5A 2GSSA 1BX9A 1EV4A 4IHUA 4WBRD 2FNOA 2AHEA 3P8WA 3FMWA 4MF7A 2VM1A 5CRHA 1XBSA 2VCTA 3QAGA 1X9MB 4G01A 3QCPA 5HQPA 4TR1B 4BWQA 1M9BA 4X0XA 3VI5A 2V32A 5D96A 3M3MA 2QA2A 1GSYA 4JR6A 2H6YA 2RUFA 3EURA 3GUSA 3CMIA 1PQNA 2EFCA 4EE0A 2VD1A 2JU5A 1AW9A 1AAZA 4ILFA 4HU7A 2JL4A 2R6KA 3M0FA 2VD0A 1HNBA 4X1UA 2GVPA 5EL8A 4G19A 2LJAA 1SYXA 1BF5A 1XW9A 2XC2A 5G1KA 2FHEA 2B1LA 3KMOA 2RM6A 5KN1A 2HRKB 1SKWB 2UZ8A 4POKA 1YQ1A 5ECNB 4MP4A 2HSYA 2HQTA 4NPBA 3IAS2 10GSA 2WB9A 2K8VA 2DKHA 3WYWA 2NDOA 3ERWA 4KA0A 1ZYQB 2R3XA 1OYJA 1PKWA 3GL5A 3TKPA 2YCDA 3BD2A 2A4HA 4EXJA 4HUAA 4HOJA 1T00A 2VLVA 2M80A 1M2BA 3MAKA 1SJ6A 3BJ5A 2LS5A 3V1WA 4XS1A 5J47A 1URMA 3HJPA 4MNNA 4N11A 4OFTA 2I4AA 3GKKA 4ISDA 1KEBA 5A4WA 3HYPA 4A5PA 1TRSA 2QC7A 3QDNA 2B5EA 2PERA 3J7Yk 1A0FA 4DVCA 4V2MA 3FW2A 2CVBA 1HNCA 2YOIA 4DSRA 2I81A 1SU9A 2FCHA 4KDXA 1SK1A 3HHVA 2N5BA 1VGLA 5HFKA 2VIMA 3ERFA 2CQ9A 3I9V2 2HFDA 4XRAA 3RHBA 1T4YA 1X5CA 2NBSA 3IRAA 5IMFA 1IYIA 1TJDA 4GLTA 1I5GA 1OVNA 3EPTA 4MZWA 3E9JB 3D21A 1I9DA 4XTSA 1TK0B 4HS1A 4KDUA 1GUHA 3KM6A 4ECCA 1A2MA 3GH6A 2E2GA 3IR4A 3GV1A 1BEDA 1A24A 1TKDB 3CSJA 2WCIA 1YDKA 3LGCA 2OA7A 3BCIA 4AKXB 4ZB6A 2CVKA 2JSZA 2XBIA 2OE0A 2P5QA 5IIZA 4WR5A 4ECIA 2H30A 1B9YC 4TXOA 1GSDA 1ML6A 4HDEA 3GSSA 1QUWA 1WP0A 2B5YA 2K18A 5HR2A 3ISOA 2PMTA 1SENA 3C1SA 5CRDA 4IGJA 7GSSA 2H8LA 4POBA 3UMAA 2HSMA 4K7NA 20GSA 2R4VA 1QFNA 2PPTA 4KW6A 2PUKC 4K2XA 4O5QA 1C72A 5CP1A 1Y25A 1V57A 3FHKA 1EOHA 4RQRA 1DE2A 1K0BA 3TCOA 4EF0A 4QMKA 2ZUPA 3TUEA 4WKWA 1TK8B 1K0NA 5EPFA 5IMVA 3L9VA 4GSTA 5GSSA 1A8LA 3FZ4A 3DXBA 2I3YA 1GNWA 3TKQA 4EUYA 5ECIB 6GSUA 2C8UA 4TXOB 1NHYA 3A5WA 1J0FA 4IW9A 1TTZA 3TKRA 1TU8A 1TDIA 1W4VA 4GWRA 1OE7A 2HRNA 1JZWA 2H0GA 1XPVA 1DBYA 3RBTA 4OD7A 3WGDA 1Z9HA 4HQZA 4F0BA 5HFIA 2TRCP 4BL7A 2MMOA 2VCWA 3HVSA 3PR8A 3TKSC 5B6NA 3HMJG 1OE8A 4ZL8A 2HSMB 5IQYA 3CWGA 4ZXGA 2MBTA 1O8WA 5CRGA 3VK9A 5IPHA 3WT1A 4TR3A 1PSQA 5DCHA 1DE1A 4G0IA 1MDJA 5H5QA 2A2SA 5KN0A 1JZOA 1NHOA 4XS6A 1H4OA 5J9BA 3ZREA 1YZXA 3QFBC 2KLXA 1PX7A 2NVLA 3ZIVA 2YV9A 1BYEA 1UA5A 2HE3A 3KD0A 1U88A 2OBKA 4IP1A 3HZ8A 3HKRA 2LRCA 1GUMA 4BVXA 1SVOA 1K0MA 3FEUA 6GSYA 4O5UA 4BL7B 3F63A 1EEMA 3LJRA 4ZB7A 5DBQA 3I69A 2H1DA 4N30A 2BJXA 4F0CA 1QK8A 4KCAA 3TRPA 4I6XA 5JWQB 1X5EA 2OKAA 4FO5A 4MA9A 2X4AA 4K8MA 2IMDA 4IS0A 1F3AA 3U6VA 5AGYA 1O85A 1AUCA 1ZYNA 2DJ3A 5A34A 3VWVA 1GSQA 2KHPA 5F8BA 1PMTA 4AKIA 2C0EA 1FVJA 1N2AA 4ZILA 1SL2B 3GX8A 3EE2A 1FAAA 1THOA 4JR4A 1F37A 2FY6A 3E0UA 5DQYA 2OE3A 3H79A 1H75A 4GTUA 3IC4A 4KH7A 3A5IA 5EVOA 1M99A 4IELA 5D8IA 2CZ3A 1ON4A 2H74A 1B48A 4BVXB 2ON7A 2L6DA 1SL0B 4OMVA 2YANA 11GSA 4NXIA 2L6CA 5E59A 5FWGA 2A2PA 13GSA 2CA8A 3ZZXA 3QOUA 4AJ7A 5CNWA 3HD5A 3DRNA 4ZBDA 5KOWA 1V58A 4EIQA 3O76A 2VUPA 4MCUA 4NV2A 3RPPA 5A34B 1WWJA 2IPAA 1FW1A 2YP6A 3UOMA 3LG6A 3IHGA 2HZFA 4J57E 2HRFA 4KCEA 5DALA 3FYGA 1PKZA 4NWYA 4F9ZA 3GHAA 1JZRA 5G2ZA 2P31A 3DVXA 4YQMA 1OC9B 3N5OA 3DMLA 5IO0A 2IN3A 4Q5RA 4JRRA 4GXZA 1ZOFA 4K9ZA 1K0AA 3ZMLA 1AIUA 3KP9A 2CV4A 4ID0A 3W8SA 2J9HA 3F3RA 3UBLA 1GSUA 3GNJA 4MJBA 4IVFA 4TVEA 4NHZA 2GDRA 4TR0A 5LD0A 2E2MA 3QAVA 3EMXA 2DLXA 4G10A 3F6DA 2KUCA 1B4QA 2HSHA 2WZ9A 3VPQA 2VL2C 3UIWA 4YAVA 5DALB 1RQMA 1XCCA 4MMMA 3US3A 4L0WA 4ZB9A 1TU7A 4AF2A 4HQSA 2O87A 2BTOT 5JWOB 4PGTA 1XFLA 3WGEA 4EIPA 3TRQA 4USSA 3ZFBA 1F9MA 4MLYA 2RLIA 3APQA 3GH9A 4JEDA 5HR0A 3DYRA 1JLVA 5D9XA 4GF0A 2HRKA 2F8FA 2J23A 5D9TA 4YH2A 1EWXA 2WFCA 2EIOA 2GZYA 1YF0A 4KX4A 2YZHA 2H1AA 3Q18A 1YEPA 1SJZA 3MNGA 3S9FA 2HLSA 3IHQA 3DKSA 1ZGNA 1CQGA 3HJMA 2H0HA 3ZL5A 2OBIA 1HQOA 1UC7A 3ZMKA 2YZUA 5E4WA 3EU3A 4MJEA 1SK0A 5JCUA 4L8EA 4TN8A 1R5PA 2XHFA 3PGTA 4ECBA 1O7UA 3R2QA 1TXXA 3ZITA 4F82A 1J9BA 3F9UA 1U6TA 2WGRA 1K0DA 4GDFA 2HXKA 2GSRA 3KH9A 4MF6A 4ULXA 1TP9A 2A4VA 2AAWA 4IBPA 2H66A 2VL3A 4J2FA 3EYTA 1K0CA 2MMNA 2N5AA 3VFIA 6GSXA 1YVLA 3U5RE 1BQ7A 4XCSA 3GKNA 3DGQA 3HCZA 4Q5QA 3SBCA 3LFLA 4G0KA 5ECRB 4OWYA 3KGKA 5JCGA 6GSWA 2VCVA 3L0HA 2WULA 5H5RA 1F2EA 5ELGA 1SD9A 3UJ1A 4WXTA 3F0IA 2UV8G 1GP1A 2P0GA 4XIHA 2AB6A 3FR9A 2V6OA 4Q5NA 5IMDA 4KUNA 1PRXA 4POMA 4PXOA 2IL3A 5AN1A 2EC4A 2AV4A 4K0NA 1WE0A 1A8YA 2V1MA 2R2JA 3A3TA 2EIQA 3KCMA 5DJMA 1QMVA 3M1GA 3ZFLA 2H1GA 4PNGA 4EKZA 3GFKA 4HI7A 3MIXA 4ML6A 3CXGA 2GQMA 3C73A 5H5SA 3KZQA 5GAND 1X5DA 1OAZA 5J4YA 2FA8A 3W8JA 3IPZA 3BBYA 2MMZA 4X43A 5BRTA 1MEKA 4BVYA 2ALBA 1G6YA 2GLRA 1T7PB 5EY6A 3C8EA 3L4NA 2XBQA 3QMXA 3ZYWA 2L4CA 3IA1A 3GMFA 1SVMA 1KNGA 2X8HA 3I6AA 4YKFA 2PWJA 1ILOA 4PX1A 2F3MA 4EDYA 2LQQA 1AC1A 19GSA 5A1NA 4Z2UA 2IMKA 1LJRA 3G7YA 5IM9A 3UL3A 2GQLA 1JHBA 3E3EA 1GNEA 3PINA 1EGOA 1G7EA 1Z7RA 4MPFA 1GLQA 3GSTA 1ERWA 1ZCPA 2YNXA 3MSZA 3VWUA 4AKHA 1TRWA 1VRSD 2LTKA 2CX3A 4PURA 6GSTA 3ZIJA 2G0FA 4BVYB 5KEJA 5J5NA 1YKCA 2DMMA 1FOVA 2AUVA 5J41A 3IE3A 1Z6NA 8GSSA 3FRCA 17GSA 2JADA 2JZSA 2YJ7A 1S3DA 2IWTA 5B8BA 4NMUA 2H72A 2V41A 3A2VA 1SD8A 4GSNA 4RUVA 4N10A 4XS4A 3VI7A 1ST9A 3O3TA 5A1NB 2OACA 4LMVA 4AJ6A 3LORA 2WS2A 14GSA 1DSBA 3CRUA 2EFHA 5J4VA 2PU9C 1U3AA 5LNKe 2ES7A 2HYXA 2H01A 4W66A 4CDOA 2QGVA 3IXRA 2JZTA 2VLTA 1TOFA 1B8XA 1HYUA 3C1RA 4BA7A 1WOUA 4HZ4A 4NAXA 5B7CA 4RI7A 4QL7A 5DVBA 2FWHA 3GKXA 2IIYA 3FR6A 4KB3A 5J4UA 2BMXA 3HVXA 2WJUA 1YEXA 2TIRA 4PTSA 2JZRA 2LUSA 4K7OA 2LV3A 1R4WA 3D6IA 4N0ZA 3CTFA 5G1LA 2B7KA 3WD6A 2HT9A 2LJRA 2O85A 5FHIA 1Y1UA 4RI6A 4LLRA 4XS4B 1E6BA 3WGXA 4MPGA 5ECSA 2K8SA 3EWLA 5A5HA 2KOKA 2D2ZA 1TRVA 4TKYA 4AJ8A 3NIVA 5ABRA 3GN3A 2B3SA 1HD2A 4MDCA 2DBCA 2DJ2A 4IJIA 4Q5FA 4POLA 4NHWA 3MWHA 4WETA 1B4PA 4PQHA 3GL3A 3F4SA 1SVLA 2REMA 4OO4A 1TK5B 1GTIA 1M9AA 1EOGA 3LYKA 3M9JA 18GSA 4O92A 4OCFA 1O6JA 3MYDA 3ZVJA 2H75A 5B6MA 4OFNA 2K9FA 4KE3A 4O5RA 3F4TA 4DEJA 5GAPD 4QL9A 1AQXA 1FG4A 5IPGA 1GLPA 5DCGA 1TRUA 3P2AA 3CRTA 1V9WA 12GSA 4HEA2 2DJKA 2H76A 1G6WA 2N5FA 1A2LA 3D0ZA 1M0UA 5F0GA 5A5HB 2VOCA 2B7JA 1B9XC 3EINA 22GSA 4G0LA 4K2DA 4WR4A 3NOFA 2GZPA 3N9JA 2A2RA 3A2WA 5ELAA 1M2DA 4CW9A 2H6ZA 1SKRB 1OC9A 4YQUA 4FYCA 1R26A 4O7HA 2E0QA 1MDIA 3O6TA 4O32A 4YKGA 3TRXA 5ECMB 4V1Ap 1FVKA 3TJKA 5CO3A 2WDUA 3JCML 4HJ2A 1AQWA 1UVZA 2M46A 1K3LA 5DDLA 2YWNA 3TOTA 3UBKA 3QD9A 1XZOA 2G2QA 2C0DA 3GIXA 3F4RA 3KJYA 4EVMA 5CYYA 4AGSA 1RW1A 2DJJA 1V98A 4I8BA 1O73A 3Q19A 5ECHB 3GA4A 4AKGA 3HA9A 3H93A 1Z7PA 5ECPB 4V2NA 2DKIA 3GKMA 1G0TA 1KTEA 1NW2A 3ZVJD 4Z7XA 4X4JA 2FWGA 3DIEA 4L5LA 3TB2A 5AIXA 2VCQA 3L9SA 3ZTLA 1VF1A 4IQAA 3ED3A 3IK7A 2CAQA 2Z9SA 2HZEA 3TGZA 1T3BA 2DJ1A 2H6XA 5CRWA 3HVVA 5HFGA 2K6VA 1FB0A 4TOPA 3KIJA 3L9UA 1JFUA 5ID2B 4ZB8A 6GSSA 3IDVA 5A5KA 1BJXA 5KN2A 4BWSA 2VAFA 1PN9A 1ERVA 1A23A 4V2LA 3P7XA 3TJFA 2VKZG 2H1LA 5J9CA 1GTAA 2MYGA 2R0CA 4PQIA 3W6GA 3ZLPA 5J40A 2TRXA 5IOWA 2YJHA 2L4QA 1W89A 4J56E 3R3EA 1T1VA 4FQUA 2HZEB 5DJLA 3UVTA 1XWAA 1ZL9A 1QGVA 3IC8A 2KP2A 4KNDA 5IO2A 1FOHA 1YKAA 4K7IA 3FZAA 3LXTA 3ERGA 1O81A 2O7KA 1K0OA 3QR6A 1Z5YE 4TXVA 2LNTA 4FH8A 1PL1A 5IMCA 1THXA 3RAZA 1A2JA 4H86A 1G7OA 4G2EA 3GURA 3GYKA 4WF4A 4LMWA 4EO3A 2F51A 2CVDA 1F6MC 4MH3A 2X99A 3TU3B 3CTGA 2VM2A 3KEBA 3VWWA 2ON5A 3CYNA 3TJBA 4DSSA 6GSVA 1VF2A 2C4JA 2RM5A 3D4MA 3TJGA 4MF5A 3VWXA 1QXHA 2R37A 3NZNA 4MK3A 1GL8A 2YPMA 2R0GA 5HR3A 3FZ5A 1Q4JA 4MH2A 1MD3A 2NPBA 2H73A 4E8EA 3VLNA 2MZCA 2V6KA 4I97A 2OADA 3SWLA 2ZNMA 1Q98A 2ZCTA 3ME8A 4N0VA 4F2IA 4D73A 5BMUA 3APOA 1ABAA 2R5GA 3KH7A 3PH9A 5GZZB 1FHEA 1TXUA 4HJMA 1BG1A 2VL9A 4DSSB 2C0FA 4FIWA 3VURA 4XRDA 2VO4A 1WIKA 5D9WA 5LCZA 1K3OA 1BG5A 4YAPA 3UEMA 1JLWA 2EFDA 1U87A 3IAM2 3Q74A 1R5AA 2IMEA 4PQ1A 1T8EB 4GRFA 2LJKA 4IJ3A 2LRNA 5IOXA 1SK2A 2FGXA 3H8QA 5ECQB 3RPNA 9GSSA 3D4TA 4D73B 1EEJA 5BMUB 1YF1A 2DJ0A 3FY7A 5G30A 4TW5A 5F07A 2PVOC 2NTOA 1XIYA 4EL1A 4P3YB 2F8AA 2QKEA 1N8JA 5DQSA 5ENUA 3LQ7A 5COHA 2H19A 3M9KA 3RHCA 3WT2A 2AJQB 5C00A 1OC8A 3G7IA 1RK4A 3TJJA 1VF3A 1V40A 4CHSA 2X8CA 2JSYA 5INYA 3FK8A 2C0GA 2C3NA 3UVHA 1XWBA 2C80A 1EGRA 3OR5A 3LWAA 2C3TA 2P5RA 2B5XA 2VLUA 1QQ2A 4CY8A 1AXDA 2LEGA 2YWOA 3I43A 2GS3A 4ACSA 1S3CA 3EMPA 4OO5A 4WF5A 1O8XA 3LXZA 2JACA 4KAEA 1GSEA 3KMNA 1PN0A 3EU4A 2IMIA 4G9HA 2FWFA 1GTBA 2OJLA 4L0UA 2DSAA 1M7TA 3P90A 2R0PA 5J3RA 3LYPA 3ZRDA 5KN3A 3CSIA 2C1YA 1X0RA 2L59A 1GRXA 2LRTA 4FYUA 3HXSA 2B1KA 3QAWA 4I5QA 1E2YA 3FR3A 1VF4A 2YN1A 3EC3A 4JE1A 3D5JA 3UAPA 4TRXA 5ECOB 1BAYA 4ZBBA 1TI3A 3EVIA 4MJAA 2FD3A 3QPMA 4KSMA 2KP1A 1MD4A 1XVWA 3TKSA 3M8NA 4ZL9A 5D9VA 3C7MA 4KGIA 1XWCA 2GTUA 3RDWA 5L71A 3BCKA 4FYBA 5FT3A 5GSTA 4MABA 2PBJA 4GSSA 2VCZA 3APSA 1PA3A 1GSFA 2B6MA 3HZ4A 5CREA 1FB6A 1XW5A 1Z3EA 3VPTA 4K5RA 2L57A 2I1UA 2L5LA 1KBNA 1ERUA 2YWIA 3FKFA 4LL1B 1OKTA 3HY2A 2DMLA 3IK9A 2QA1A 2RUEA 4K0GA 4PNFA 1TI1A 2H1BA 4OCEA 5D73A 1AQVA 1GWCA 4PUAA 2LNSA 1USBA 4V1Ag 4CY6A 1NM3A 4BPYA 1GUKA 4K6XA 3KP8A 1WMJA 2CAIA 3PPUA 1GULA 2PVQA 5D93A 2H71A 3Q6OA 3KTBA 2HRAA 5IMZA 4KDYA 2I9HA 2M72A 1YY7A 2FA4A 4ICYA 4GQFA 4LL4B 3CSHA 4E68A 1FO5A 1EZKA 4DSQA 4F03A 1PD21 4GCIA 3H4KA 2IFQA 2GSQA 5G5FA 3KTLA 3GRXA 5C04A 1SYRA 2FWEA 2YV7A 2LKUA 2QSIA 4IQ1A 5DAKA 1ERTA 1GH2A 1ZMAA 4MZBA 2MBSA 5KOXA 1XXUA 2X64A 4YQVA 3LW9A 2XPEA 4JU5A 3MDKA 5ECKB 2H0IA 1GSSA 2FLSA 4WEYA 4EDZA 1MTCA 4QQ7A 1J08A 4PUFC 1HNAA 2YWMA 4L5OA 2RIIA 16GSA 1LU4A 1JZDA 3J7Yb 4KF9A 5B8AA 2PGTA 1V2AA 1XWKA 4IN0A 1ZZYA 1S3AA 1U3IA 3TKSE 5IMAA 2GGTA 2E7PA 3CBUA 1ZYEA 4N3ZA 2C3QA 5G31A 1EP7A 1WJKA 3G7JA 1SKSB 3L78A 2IFQB 4RQXA 4ZIJA 2MMAA 3DEXA 4IP6A 4E8HA 2V2GA 1TW9A 5AISA 1Z6MA 2IMFA 1XW6A 5DAKB 4MJCA 2VCXA 4OFMA 4JBBA 1Y6EA 1F3BA 4MZCA 1EP8A 1T4ZA 3F6FA 4AI6A 3K8NA 3AY8A 3TDGA 2O89A 2GSTA 4WBJA 2FUG2 5ID2A 1XWGA 3GTUA 2O5VA 5A4UA 5ECLB 4TR4A 3H1NA 2DC5A 1PGTA 1WRYA 1CQHA 2GT6A 2EFEA 3IBHA 2GQKA 3DVWA 3DD3A 1XVQA 2X49A 4K1FA 2L5OA 1WPIA 3HJOA 4Z2RA 3UARA 5JCWA 2HNLA 2IJYA 4K5SA 3LSZA 2F9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSW A;  1XOA A;  2GZZ A;  4HU9 A;  1OKD A;  2PN8 A;  1GTU A;  2XPD A;  1XOB A;  4I2U A;  2VL2 A;  4ECJ A;  1A0R P;  2H70 A;  3F8U A;  4KSO A;  2CX4 A;  3QFA C;  2X8G A;  4I2T A;  3HDC A;  3ME7 A;  2CZ2 A;  1SJI A;  2GT5 A;  3GTU B;  5F06 A;  5G5E A;  1UN2 A;  1LBK A;  4LA1 A;  1DUG A;  3D22 A;  1SL1 B;  2OE1 A;  2O8V B;  3G9B A;  4ZL7 A;  5A4V A;  3C71 A;  1R7H A;  3IOS A;  5HR1 A;  3TOU A;  2HI7 A;  3A2X A;  1X9S B;  4TR1 A;  3F3Q A;  5F05 A;  2AYT A;  2DIY A;  1YJ6 A;  4IKH A;  1X9W B;  1OC3 A;  5JWR B;  1EV9 A;  3DWV A;  3IV4 A;  1PX6 A;  2HSN B;  1PL2 A;  4EC0 A;  1MDK A;  1M2A A;  3GX0 A;  2DIZ A;  4HZ2 A;  4ML1 A;  1K3Y A;  4XHM A;  5CAX A;  3LEF A;  1IYH A;  4JZQ A;  5AIV A;  3KXO A;  2WRT A;  2EIR A;  3BOA A;  2LST A;  2LQO A;  2CT6 A;  4ZBA A;  1ACV A;  4GQC A;  3FZ9 A;  4NV5 A;  2GSS A;  1BX9 A;  1EV4 A;  4IHU A;  4WBR D;  2FNO A;  2AHE A;  3P8W A;  4MF7 A;  2VM1 A;  5CRH A;  1XBS A;  2VCT A;  3QAG A;  1X9M B;  3QCP A;  5HQP A;  4TR1 B;  4BWQ A;  1M9B A;  4X0X A;  3VI5 A;  2V32 A;  5D96 A;  3M3M A;  1GSY A;  4JR6 A;  2H6Y A;  2RUF A;  3EUR A;  3GUS A;  3CMI A;  1PQN A;  4EE0 A;  2VD1 A;  2JU5 A;  1AW9 A;  1AAZ A;  4ILF A;  4HU7 A;  2JL4 A;  2R6K A;  3M0F A;  2VD0 A;  1HNB A;  4X1U A;  2GVP A;  5EL8 A;  4G19 A;  2LJA A;  1SYX A;  1XW9 A;  2XC2 A;  5G1K A;  2FHE A;  2B1L A;  3KMO A;  2RM6 A;  5KN1 A;  2HRK B;  1SKW B;  2UZ8 A;  4POK A;  1YQ1 A;  5ECN B;  4MP4 A;  2HSY A;  2HQT A;  4NPB A;  3IAS 2;  10GS A;  2WB9 A;  2K8V A;  3WYW A;  2NDO A;  3ERW A;  4KA0 A;  1ZYQ B;  2R3X A;  1OYJ A;  1PKW A;  3GL5 A;  3TKP A;  2YCD A;  3BD2 A;  4EXJ A;  4HUA A;  4HOJ A;  1T00 A;  2VLV A;  2M80 A;  1M2B A;  3MAK A;  1SJ6 A;  3BJ5 A;  2LS5 A;  3V1W A;  4XS1 A;  1URM A;  3HJP A;  4N11 A;  4OFT A;  2I4A A;  3GKK A;  4ISD A;  1KEB A;  5A4W A;  3HYP A;  1TRS A;  2QC7 A;  3QDN A;  2B5E A;  2PER A;  3J7Y k;  1A0F A;  4DVC A;  4V2M A;  3FW2 A;  2CVB A;  1HNC A;  2YOI A;  4DSR A;  2I81 A;  1SU9 A;  2FCH A;  4KDX A;  1SK1 A;  3HHV A;  2N5B A;  1VGL A;  5HFK A;  2VIM A;  3ERF A;  2CQ9 A;  3I9V 2;  2HFD A;  4XRA A;  3RHB A;  1T4Y A;  1X5C A;  2NBS A;  3IRA A;  5IMF A;  1IYI A;  1TJD A;  4GLT A;  1I5G A;  1OVN A;  4MZW A;  3E9J B;  3D21 A;  1I9D A;  4XTS A;  1TK0 B;  4HS1 A;  4KDU A;  1GUH A;  3KM6 A;  4ECC A;  1A2M A;  3GH6 A;  2E2G A;  3IR4 A;  3GV1 A;  1BED A;  1A24 A;  1TKD B;  3CSJ A;  2WCI A;  1YDK A;  3LGC A;  2OA7 A;  3BCI A;  4ZB6 A;  2CVK A;  2JSZ A;  2XBI A;  2OE0 A;  2P5Q A;  5IIZ A;  4WR5 A;  4ECI A;  2H30 A;  1B9Y C;  4TXO A;  1GSD A;  1ML6 A;  4HDE A;  3GSS A;  1QUW A;  1WP0 A;  2B5Y A;  2K18 A;  5HR2 A;  3ISO A;  2PMT A;  1SEN A;  3C1S A;  5CRD A;  4IGJ A;  7GSS A;  2H8L A;  4POB A;  3UMA A;  2HSM A;  4K7N A;  20GS A;  2R4V A;  1QFN A;  2PPT A;  4KW6 A;  2PUK C;  5CP1 A;  1C72 A;  1Y25 A;  1V57 A;  3FHK A;  1EOH A;  4RQR A;  1DE2 A;  1K0B A;  3TCO A;  4EF0 A;  2ZUP A;  3TUE A;  4WKW A;  1TK8 B;  1K0N A;  5EPF A;  5IMV A;  3L9V A;  4GST A;  5GSS A;  1A8L A;  3FZ4 A;  3DXB A;  2I3Y A;  1GNW A;  3TKQ A;  4EUY A;  5ECI B;  6GSU A;  2C8U A;  4TXO B;  1NHY A;  3A5W A;  1J0F A;  4IW9 A;  1TTZ A;  3TKR A;  1TU8 A;  1TDI A;  1W4V A;  4GWR A;  1OE7 A;  2HRN A;  1JZW A;  2H0G A;  1XPV A;  1DBY A;  3RBT A;  4OD7 A;  3WGD A;  1Z9H A;  4HQZ A;  4F0B A;  5HFI A;  2TRC P;  4BL7 A;  2MMO A;  2VCW A;  3HVS A;  3PR8 A;  3TKS C;  5B6N A;  1OE8 A;  4ZL8 A;  2HSM B;  5IQY A;  4ZXG A;  2MBT A;  1O8W A;  5CRG A;  3VK9 A;  5IPH A;  3WT1 A;  4TR3 A;  1PSQ A;  5DCH A;  1DE1 A;  4G0I A;  1MDJ A;  5H5Q A;  2A2S A;  5KN0 A;  1JZO A;  1NHO A;  4XS6 A;  1H4O A;  5J9B A;  3ZRE A;  1YZX A;  3QFB C;  2KLX A;  1PX7 A;  2NVL A;  3ZIV A;  2YV9 A;  1BYE A;  1UA5 A;  2HE3 A;  3KD0 A;  1U88 A;  2OBK A;  4IP1 A;  3HZ8 A;  3HKR A;  2LRC A;  1GUM A;  4BVX A;  1K0M A;  3FEU A;  6GSY A;  4BL7 B;  3F63 A;  1EEM A;  3LJR A;  5DBQ A;  3I69 A;  2H1D A;  4N30 A;  2BJX A;  4F0C A;  1QK8 A;  4KCA A;  3TRP A;  4I6X A;  5JWQ B;  1X5E A;  2OKA A;  4FO5 A;  4MA9 A;  4K8M A;  2IMD A;  4IS0 A;  1F3A A;  3U6V A;  5AGY A;  1O85 A;  1AUC A;  2DJ3 A;  3VWV A;  1GSQ A;  2KHP A;  5F8B A;  1PMT A;  2C0E A;  1FVJ A;  1N2A A;  4ZIL A;  1SL2 B;  3GX8 A;  3EE2 A;  1FAA A;  1THO A;  4JR4 A;  1F37 A;  2FY6 A;  3E0U A;  5DQY A;  2OE3 A;  3H79 A;  1H75 A;  4GTU A;  3IC4 A;  4KH7 A;  5EVO A;  1M99 A;  4IEL A;  5D8I A;  2CZ3 A;  1ON4 A;  2H74 A;  1B48 A;  4BVX B;  2ON7 A;  2L6D A;  1SL0 B;  4OMV A;  2YAN A;  11GS A;  4NXI A;  2L6C A;  5E59 A;  5FWG A;  13GS A;  2CA8 A;  3ZZX A;  3QOU A;  4AJ7 A;  5CNW A;  3HD5 A;  3DRN A;  4ZBD A;  1V58 A;  3O76 A;  2VUP A;  4MCU A;  4NV2 A;  3RPP A;  1WWJ A;  2IPA A;  1FW1 A;  2YP6 A;  3UOM A;  3LG6 A;  2HZF A;  4J57 E;  2HRF A;  4KCE A;  5DAL A;  3FYG A;  1PKZ A;  4NWY A;  4F9Z A;  3GHA A;  1JZR A;  5G2Z A;  2P31 A;  3DVX A;  4YQM A;  1OC9 B;  3N5O A;  3DML A;  5IO0 A;  2IN3 A;  4Q5R A;  4JRR A;  4GXZ A;  1ZOF A;  4K9Z A;  1K0A A;  3ZML A;  1AIU A;  3KP9 A;  2CV4 A;  4ID0 A;  3W8S A;  2J9H A;  3F3R A;  3UBL A;  1GSU A;  3GNJ A;  4MJB A;  4IVF A;  4TVE A;  4NHZ A;  2GDR A;  4TR0 A;  5LD0 A;  2E2M A;  3QAV A;  3EMX A;  2DLX A;  4G10 A;  3F6D A;  2KUC A;  1B4Q A;  2HSH A;  2WZ9 A;  3VPQ A;  2VL2 C;  3UIW A;  4YAV A;  5DAL B;  1RQM A;  1XCC A;  4MMM A;  3US3 A;  4L0W A;  4ZB9 A;  1TU7 A;  4AF2 A;  4HQS A;  2O87 A;  2BTO T;  5JWO B;  4PGT A;  1XFL A;  3WGE A;  3TRQ A;  4USS A;  3ZFB A;  1F9M A;  4MLY A;  2RLI A;  3APQ A;  3GH9 A;  4JED A;  5HR0 A;  3DYR A;  1JLV A;  5D9X A;  4GF0 A;  2HRK A;  2F8F A;  2J23 A;  5D9T A;  4YH2 A;  1EWX A;  2WFC A;  2EIO A;  2GZY A;  1YF0 A;  4KX4 A;  2YZH A;  2H1A A;  3Q18 A;  1YEP A;  1SJZ A;  3MNG A;  3S9F A;  2HLS A;  3IHQ A;  3DKS A;  1ZGN A;  1CQG A;  3HJM A;  2H0H A;  3ZL5 A;  2OBI A;  1HQO A;  1UC7 A;  3ZMK A;  2YZU A;  5E4W A;  3EU3 A;  4MJE A;  1SK0 A;  5JCU A;  4L8E A;  4TN8 A;  1R5P A;  2XHF A;  3PGT A;  4ECB A;  1O7U A;  3R2Q A;  1TXX A;  3ZIT A;  4F82 A;  1J9B A;  3F9U A;  1U6T A;  2WGR A;  1K0D A;  2HXK A;  2GSR A;  3KH9 A;  4MF6 A;  4ULX A;  1TP9 A;  2A4V A;  2AAW A;  4IBP A;  2H66 A;  2VL3 A;  4J2F A;  3EYT A;  1K0C A;  2MMN A;  2N5A A;  3VFI A;  6GSX A;  3U5R E;  1BQ7 A;  4XCS A;  3GKN A;  3DGQ A;  3HCZ A;  4Q5Q A;  3SBC A;  3LFL A;  4G0K A;  5ECR B;  4OWY A;  3KGK A;  5JCG A;  6GSW A;  2VCV A;  3L0H A;  2WUL A;  5H5R A;  1F2E A;  5ELG A;  1SD9 A;  3UJ1 A;  4WXT A;  3F0I A;  1GP1 A;  2P0G A;  4XIH A;  2AB6 A;  3FR9 A;  2V6O A;  4Q5N A;  5IMD A;  4KUN A;  1PRX A;  4POM A;  4PXO A;  2IL3 A;  5AN1 A;  2EC4 A;  2AV4 A;  4K0N A;  1WE0 A;  1A8Y A;  2V1M A;  2R2J A;  3A3T A;  2EIQ A;  3KCM A;  5DJM A;  1QMV A;  3M1G A;  3ZFL A;  2H1G A;  4PNG A;  4EKZ A;  3GFK A;  4HI7 A;  4ML6 A;  3CXG A;  2GQM A;  3C73 A;  5H5S A;  3KZQ A;  5GAN D;  1X5D A;  1OAZ A;  2FA8 A;  3W8J A;  3IPZ A;  3BBY A;  2MMZ A;  4X43 A;  1MEK A;  4BVY A;  2ALB A;  1G6Y A;  2GLR A;  1T7P B;  5EY6 A;  3C8E A;  3L4N A;  2XBQ A;  3QMX A;  3ZYW A;  2L4C A;  3IA1 A;  3GMF A;  1KNG A;  2X8H A;  3I6A A;  2PWJ A;  1ILO A;  4PX1 A;  2F3M A;  4EDY A;  2LQQ A;  1AC1 A;  19GS A;  2IMK A;  1LJR A;  3G7Y A;  5IM9 A;  3UL3 A;  2GQL A;  1JHB A;  3E3E A;  1GNE A;  3PIN A;  1EGO A;  1G7E A;  1Z7R A;  4MPF A;  1GLQ A;  3GST A;  1ERW A;  1ZCP A;  2YNX A;  3MSZ A;  3VWU A;  1TRW A;  1VRS D;  2LTK A;  2CX3 A;  4PUR A;  6GST A;  3ZIJ A;  2G0F A;  4BVY B;  5KEJ A;  5J5N A;  1YKC A;  2DMM A;  1FOV A;  2AUV A;  5J41 A;  3IE3 A;  1Z6N A;  8GSS A;  3FRC A;  17GS A;  2JAD A;  2JZS A;  2YJ7 A;  1S3D A;  2IWT A;  5B8B A;  4NMU A;  2H72 A;  2V41 A;  3A2V A;  1SD8 A;  4GSN A;  4RUV A;  4N10 A;  4XS4 A;  3VI7 A;  1ST9 A;  3O3T A;  2OAC A;  4LMV A;  4AJ6 A;  3LOR A;  2WS2 A;  14GS A;  1DSB A;  3CRU A;  2PU9 C;  1U3A A;  5LNK e;  2ES7 A;  2HYX A;  2H01 A;  4CDO A;  2QGV A;  3IXR A;  2JZT A;  2VLT A;  1TOF A;  1B8X A;  1HYU A;  3C1R A;  4BA7 A;  1WOU A;  4HZ4 A;  4NAX A;  5B7C A;  4RI7 A;  4QL7 A;  5DVB A;  2FWH A;  3GKX A;  2IIY A;  3FR6 A;  4KB3 A;  5J4U A;  2BMX A;  3HVX A;  2WJU A;  1YEX A;  2TIR A;  4PTS A;  2JZR A;  2LUS A;  4K7O A;  2LV3 A;  1R4W A;  3D6I A;  4N0Z A;  3CTF A;  5G1L A;  2B7K A;  3WD6 A;  2HT9 A;  2LJR A;  2O85 A;  5FHI A;  4RI6 A;  4LLR A;  4XS4 B;  1E6B A;  3WGX A;  4MPG A;  5ECS A;  2K8S A;  3EWL A;  2KOK A;  2D2Z A;  1TRV A;  4TKY A;  4AJ8 A;  3NIV A;  5ABR A;  3GN3 A;  2B3S A;  1HD2 A;  4MDC A;  2DBC A;  2DJ2 A;  4IJI A;  4Q5F A;  4POL A;  4NHW A;  3MWH A;  4WET A;  1B4P A;  4PQH A;  3GL3 A;  3F4S A;  2REM A;  4OO4 A;  1TK5 B;  1GTI A;  1M9A A;  1EOG A;  3LYK A;  3M9J A;  18GS A;  4O92 A;  4OCF A;  1O6J A;  3ZVJ A;  2H75 A;  5B6M A;  4OFN A;  2K9F A;  4KE3 A;  4O5R A;  3F4T A;  4DEJ A;  5GAP D;  4QL9 A;  1AQX A;  1FG4 A;  5IPG A;  1GLP A;  5DCG A;  1TRU A;  3P2A A;  3CRT A;  1V9W A;  12GS A;  4HEA 2;  2DJK A;  2H76 A;  1G6W A;  2N5F A;  1A2L A;  3D0Z A;  1M0U A;  5F0G A;  2VOC A;  2B7J A;  1B9X C;  3EIN A;  22GS A;  4G0L A;  4K2D A;  4WR4 A;  3NOF A;  2GZP A;  3N9J A;  2A2R A;  3A2W A;  5ELA A;  1M2D A;  4CW9 A;  2H6Z A;  1SKR B;  1OC9 A;  4YQU A;  4FYC A;  1R26 A;  4O7H A;  2E0Q A;  1MDI A;  3O6T A;  4O32 A;  3TRX A;  5ECM B;  4V1A p;  1FVK A;  3TJK A;  5CO3 A;  2WDU A;  3JCM L;  4HJ2 A;  1AQW A;  1UVZ A;  2M46 A;  1K3L A;  5DDL A;  2YWN A;  3TOT A;  3UBK A;  3QD9 A;  1XZO A;  2G2Q A;  2C0D A;  3GIX A;  3F4R A;  3KJY A;  4EVM A;  5CYY A;  4AGS A;  1RW1 A;  2DJJ A;  1V98 A;  4I8B A;  1O73 A;  3Q19 A;  5ECH B;  3GA4 A;  3HA9 A;  3H93 A;  1Z7P A;  5ECP B;  4V2N A;  3GKM A;  1G0T A;  1KTE A;  1NW2 A;  3ZVJ D;  4Z7X A;  2FWG A;  3DIE A;  4L5L A;  3TB2 A;  5AIX A;  2VCQ A;  3L9S A;  3ZTL A;  1VF1 A;  4IQA A;  3ED3 A;  3IK7 A;  2CAQ A;  2Z9S A;  2HZE A;  3TGZ A;  1T3B A;  2DJ1 A;  2H6X A;  5CRW A;  3HVV A;  5HFG A;  2K6V A;  1FB0 A;  4TOP A;  3KIJ A;  3L9U A;  1JFU A;  5ID2 B;  4ZB8 A;  6GSS A;  3IDV A;  5A5K A;  1BJX A;  5KN2 A;  4BWS A;  2VAF A;  1PN9 A;  1ERV A;  1A23 A;  4V2L A;  3P7X A;  3TJF A;  5J9C A;  1GTA A;  2MYG A;  4PQI A;  3W6G A;  3ZLP A;  2TRX A;  5IOW A;  2YJH A;  2L4Q A;  1W89 A;  4J56 E;  3R3E A;  1T1V A;  4FQU A;  2HZE B;  5DJL A;  3UVT A;  1XWA A;  1ZL9 A;  1QGV A;  3IC8 A;  2KP2 A;  4KND A;  5IO2 A;  1YKA A;  4K7I A;  3FZA A;  3LXT A;  3ERG A;  1O81 A;  2O7K A;  1K0O A;  3QR6 A;  1Z5Y E;  4TXV A;  2LNT A;  4FH8 A;  1PL1 A;  5IMC A;  1THX A;  3RAZ A;  1A2J A;  4H86 A;  1G7O A;  4G2E A;  3GUR A;  3GYK A;  4WF4 A;  4LMW A;  4EO3 A;  2F51 A;  2CVD A;  1F6M C;  4MH3 A;  2X99 A;  3CTG A;  2VM2 A;  3KEB A;  3VWW A;  2ON5 A;  3CYN A;  3TJB A;  4DSS A;  6GSV A;  1VF2 A;  2C4J A;  2RM5 A;  3D4M A;  3TJG A;  4MF5 A;  3VWX A;  1QXH A;  2R37 A;  3NZN A;  4MK3 A;  1GL8 A;  2YPM A;  5HR3 A;  3FZ5 A;  1Q4J A;  4MH2 A;  1MD3 A;  2NPB A;  2H73 A;  4E8E A;  3VLN A;  2MZC A;  2V6K A;  4I97 A;  2OAD A;  3SWL A;  2ZNM A;  1Q98 A;  2ZCT A;  3ME8 A;  4N0V A;  4F2I A;  4D73 A;  5BMU A;  3APO A;  1ABA A;  2R5G A;  3KH7 A;  3PH9 A;  5GZZ B;  1FHE A;  4HJM A;  2VL9 A;  4DSS B;  2C0F A;  4FIW A;  3VUR A;  4XRD A;  2VO4 A;  1WIK A;  5D9W A;  5LCZ A;  1K3O A;  1BG5 A;  4YAP A;  3UEM A;  1JLW A;  1U87 A;  3IAM 2;  3Q74 A;  1R5A A;  2IME A;  4PQ1 A;  1T8E B;  4GRF A;  2LJK A;  4IJ3 A;  2LRN A;  5IOX A;  1SK2 A;  2FGX A;  3H8Q A;  5ECQ B;  3RPN A;  9GSS A;  3D4T A;  4D73 B;  1EEJ A;  1YF1 A;  2DJ0 A;  3FY7 A;  5G30 A;  4TW5 A;  5F07 A;  2PVO C;  2NTO A;  1XIY A;  4EL1 A;  4P3Y B;  2F8A A;  2QKE A;  1N8J A;  5DQS A;  5ENU A;  3LQ7 A;  5COH A;  2H19 A;  3M9K A;  3RHC A;  3WT2 A;  2AJQ B;  5C00 A;  1OC8 A;  3G7I A;  1RK4 A;  3TJJ A;  1VF3 A;  1V40 A;  4CHS A;  2X8C A;  2JSY A;  5INY A;  3FK8 A;  2C0G A;  2C3N A;  3UVH A;  1XWB A;  2C80 A;  1EGR A;  3OR5 A;  3LWA A;  2C3T A;  2P5R A;  2B5X A;  2VLU A;  1QQ2 A;  1AXD A;  2LEG A;  2YWO A;  3I43 A;  2GS3 A;  4ACS A;  1S3C A;  3EMP A;  4OO5 A;  4WF5 A;  1O8X A;  3LXZ A;  2JAC A;  4KAE A;  1GSE A;  3KMN A;  3EU4 A;  2IMI A;  4G9H A;  2FWF A;  1GTB A;  2OJL A;  4L0U A;  2DSA A;  1M7T A;  3P90 A;  5J3R A;  3LYP A;  3ZRD A;  5KN3 A;  3CSI A;  2C1Y A;  1X0R A;  2L59 A;  1GRX A;  2LRT A;  4FYU A;  3HXS A;  2B1K A;  3QAW A;  4I5Q A;  1E2Y A;  3FR3 A;  1VF4 A;  2YN1 A;  3EC3 A;  4JE1 A;  3D5J A;  3UAP A;  4TRX A;  5ECO B;  1BAY A;  4ZBB A;  1TI3 A;  3EVI A;  4MJA A;  2FD3 A;  3QPM A;  4KSM A;  2KP1 A;  1MD4 A;  1XVW A;  3TKS A;  3M8N A;  4ZL9 A;  5D9V A;  3C7M A;  4KGI A;  1XWC A;  2GTU A;  3RDW A;  5L71 A;  3BCK A;  4FYB A;  5FT3 A;  5GST A;  4MAB A;  2PBJ A;  4GSS A;  2VCZ A;  3APS A;  1PA3 A;  1GSF A;  2B6M A;  3HZ4 A;  5CRE A;  1FB6 A;  1XW5 A;  1Z3E A;  3VPT A;  2L57 A;  2I1U A;  2L5L A;  1KBN A;  1ERU A;  2YWI A;  3FKF A;  4LL1 B;  1OKT A;  3HY2 A;  2DML A;  3IK9 A;  2RUE A;  4K0G A;  4PNF A;  1TI1 A;  2H1B A;  4OCE A;  5D73 A;  1AQV A;  1GWC A;  4PUA A;  2LNS A;  1USB A;  4V1A g;  1NM3 A;  4BPY A;  1GUK A;  4K6X A;  3KP8 A;  1WMJ A;  2CAI A;  3PPU A;  1GUL A;  2PVQ A;  5D93 A;  2H71 A;  3Q6O A;  3KTB A;  2HRA A;  5IMZ A;  4KDY A;  2I9H A;  2M72 A;  1YY7 A;  2FA4 A;  4GQF A;  4LL4 B;  3CSH A;  1FO5 A;  1EZK A;  4DSQ A;  4F03 A;  1PD2 1;  4GCI A;  3H4K A;  2IFQ A;  2GSQ A;  5G5F A;  3KTL A;  3GRX A;  5C04 A;  1SYR A;  2FWE A;  2YV7 A;  2LKU A;  2QSI A;  4IQ1 A;  5DAK A;  1ERT A;  1GH2 A;  1ZMA A;  4MZB A;  2MBS A;  1XXU A;  2X64 A;  4YQV A;  2XPE A;  4JU5 A;  3MDK A;  5ECK B;  2H0I A;  1GSS A;  2FLS A;  4WEY A;  4EDZ A;  1MTC A;  4QQ7 A;  1J08 A;  4PUF C;  1HNA A;  2YWM A;  4L5O A;  2RII A;  16GS A;  1LU4 A;  1JZD A;  3J7Y b;  4KF9 A;  5B8A A;  2PGT A;  1V2A A;  1XWK A;  4IN0 A;  1ZZY A;  1S3A A;  1U3I A;  3TKS E;  5IMA A;  2GGT A;  2E7P A;  3CBU A;  1ZYE A;  2C3Q A;  5G31 A;  1EP7 A;  1WJK A;  3G7J A;  1SKS B;  3L78 A;  2IFQ B;  4RQX A;  4ZIJ A;  2MMA A;  3DEX A;  4IP6 A;  4E8H A;  2V2G A;  1TW9 A;  5AIS A;  1Z6M A;  2IMF A;  1XW6 A;  5DAK B;  4MJC A;  2VCX A;  4OFM A;  4JBB A;  1Y6E A;  1F3B A;  4MZC A;  1EP8 A;  1T4Z A;  3F6F A;  3K8N A;  3AY8 A;  3TDG A;  2O89 A;  2GST A;  4WBJ A;  2FUG 2;  5ID2 A;  1XWG A;  3GTU A;  5A4U A;  5ECL B;  4TR4 A;  3H1N A;  2DC5 A;  1PGT A;  1WRY A;  1CQH A;  2GT6 A;  2GQK A;  3IBH A;  3DVW A;  3DD3 A;  1XVQ A;  4K1F A;  2L5O A;  1WPI A;  3HJO A;  3UAR A;  5JCW A;  2HNL A;  2IJY A;  3LSZ A;  2F9S A; 
#chains in the Genus database with same CATH topology
 1NSW A;  1XOA A;  2GZZ A;  1ZYP A;  4HU9 A;  1OKD A;  2PN8 A;  1GTU A;  2HSN A;  4Z2T A;  2OT3 A;  2XPD A;  1XOB A;  4I2U A;  2VL2 A;  4ECJ A;  1A0R P;  2H70 A;  3F8U A;  4KSO A;  2CX4 A;  3QFA C;  2X8G A;  4I2T A;  3HDC A;  3ME7 A;  2CZ2 A;  1SJI A;  2GT5 A;  3GTU B;  5F06 A;  5G5E A;  1UN2 A;  1LBK A;  4LA1 A;  1DUG A;  3D22 A;  1SL1 B;  2OE1 A;  2O8V B;  3G9B A;  4ZL7 A;  5A4V A;  3C71 A;  1R7H A;  3IOS A;  5HR1 A;  3TOU A;  3CQF A;  2HI7 A;  3A2X A;  1X9S B;  4TR1 A;  3F3Q A;  5F05 A;  2AYT A;  2DIY A;  1YJ6 A;  4IKH A;  1X9W B;  1OC3 A;  5JWR B;  1EV9 A;  3DWV A;  3IV4 A;  1N25 A;  1PX6 A;  2HSN B;  1PL2 A;  4EC0 A;  1MDK A;  1M2A A;  3GX0 A;  2DIZ A;  4HZ2 A;  4ML1 A;  1K3Y A;  4XHM A;  5CAX A;  3LEF A;  1IYH A;  4JZQ A;  5AIV A;  3KXO A;  2WRT A;  2EIR A;  3BOA A;  2LST A;  2LQO A;  2CT6 A;  4ZBA A;  1ACV A;  4GQC A;  3FZ9 A;  4NV5 A;  2GSS A;  1BX9 A;  1EV4 A;  4IHU A;  4WBR D;  2FNO A;  2AHE A;  3P8W A;  3FMW A;  4MF7 A;  2VM1 A;  5CRH A;  1XBS A;  2VCT A;  3QAG A;  1X9M B;  4G01 A;  3QCP A;  5HQP A;  4TR1 B;  4BWQ A;  1M9B A;  4X0X A;  3VI5 A;  2V32 A;  5D96 A;  3M3M A;  2QA2 A;  1GSY A;  4JR6 A;  2H6Y A;  2RUF A;  3EUR A;  2WZS A;  3GUS A;  3CMI A;  1PQN A;  2EFC A;  4EE0 A;  2VD1 A;  2JU5 A;  1AW9 A;  1AAZ A;  4ILF A;  4HU7 A;  2JL4 A;  2R6K A;  3M0F A;  2VD0 A;  1HNB A;  4X1U A;  2GVP A;  5EL8 A;  4G19 A;  2LJA A;  1SYX A;  1BF5 A;  1XW9 A;  2XC2 A;  5G1K A;  2FHE A;  2B1L A;  3KMO A;  1S3R A;  2RM6 A;  5KN1 A;  2HRK B;  1SKW B;  2WVY A;  2UZ8 A;  4POK A;  1YQ1 A;  5ECN B;  4MP4 A;  2HSY A;  2HQT A;  4NPB A;  3IAS 2;  10GS A;  2WB9 A;  2K8V A;  2DKH A;  3WYW A;  2NDO A;  3ERW A;  4KA0 A;  1ZYQ B;  2R3X A;  1OYJ A;  1PKW A;  3GL5 A;  3TKP A;  2YCD A;  3BD2 A;  2A4H A;  4EXJ A;  4HUA A;  4HOJ A;  1T00 A;  2VLV A;  2M80 A;  1M2B A;  3MAK A;  1SJ6 A;  3BJ5 A;  2LS5 A;  3V1W A;  4XS1 A;  5J47 A;  1URM A;  3HJP A;  4MNN A;  4N11 A;  4OFT A;  2I4A A;  3GKK A;  4ISD A;  1KEB A;  2O3E A;  5A4W A;  3HYP A;  4A5P A;  1TRS A;  2QC7 A;  3QDN A;  2B5E A;  2PER A;  3J7Y k;  1A0F A;  4DVC A;  4V2M A;  3FW2 A;  2CVB A;  1HNC A;  2YOI A;  4DSR A;  2I81 A;  1SU9 A;  2FCH A;  4KDX A;  1SK1 A;  3HHV A;  2N5B A;  1M3J A;  1VGL A;  5HFK A;  2VIM A;  3ERF A;  2CQ9 A;  3I9V 2;  2HFD A;  4XRA A;  3RHB A;  1T4Y A;  1X5C A;  2NBS A;  3IRA A;  5IMF A;  1IYI A;  1TJD A;  4GLT A;  1I5G A;  1OVN A;  2WW2 A;  3EPT A;  4MZW A;  3E9J B;  3D21 A;  1I9D A;  4XTS A;  1TK0 B;  4HS1 A;  4KDU A;  1GUH A;  3KM6 A;  4ECC A;  1A2M A;  3GH6 A;  2E2G A;  3IR4 A;  3GV1 A;  1BED A;  1A24 A;  1TKD B;  3CSJ A;  2WCI A;  1YDK A;  3LGC A;  2OA7 A;  3BCI A;  4AKX B;  4ZB6 A;  2CVK A;  2JSZ A;  2XBI A;  2OE0 A;  2P5Q A;  5IIZ A;  4WR5 A;  4ECI A;  2H30 A;  1B9Y C;  4TXO A;  1GSD A;  1ML6 A;  4HDE A;  3GSS A;  1QUW A;  1WP0 A;  2B5Y A;  2K18 A;  5HR2 A;  3ISO A;  2PMT A;  1SEN A;  3C1S A;  5CRD A;  4IGJ A;  7GSS A;  1S4B P;  2H8L A;  4POB A;  3UMA A;  2HSM A;  4K7N A;  20GS A;  2R4V A;  1QFN A;  2PPT A;  4KW6 A;  2PUK C;  4K2X A;  4O5Q A;  1C72 A;  5CP1 A;  1Y25 A;  1V57 A;  3FHK A;  1EOH A;  4RQR A;  1DE2 A;  1K0B A;  3TCO A;  4EF0 A;  4QMK A;  2ZUP A;  3TUE A;  4WKW A;  1TK8 B;  1K0N A;  5EPF A;  5IMV A;  3L9V A;  4GST A;  5GSS A;  1A8L A;  3FZ4 A;  3DXB A;  2I3Y A;  1GNW A;  3TKQ A;  4EUY A;  5ECI B;  6GSU A;  2C8U A;  3RFR C;  4TXO B;  1NHY A;  3A5W A;  1J0F A;  4IW9 A;  1TTZ A;  3TKR A;  1TU8 A;  1TDI A;  1W4V A;  4GWR A;  1OE7 A;  2HRN A;  1JZW A;  2H0G A;  1XPV A;  1DBY A;  3RBT A;  4OD7 A;  3WGD A;  1Z9H A;  4HQZ A;  4F0B A;  5HFI A;  2TRC P;  4BL7 A;  2MMO A;  2VCW A;  3HVS A;  3PR8 A;  3TKS C;  5B6N A;  3HMJ G;  1OE8 A;  4ZL8 A;  2HSM B;  5IQY A;  3CWG A;  2WVX A;  4ZXG A;  2MBT A;  1O8W A;  5CRG A;  3VK9 A;  5IPH A;  3WT1 A;  4TR3 A;  1PSQ A;  5DCH A;  1DE1 A;  4G0I A;  1MDJ A;  5H5Q A;  2A2S A;  5KN0 A;  1JZO A;  1NHO A;  4XS6 A;  1H4O A;  5J9B A;  3ZRE A;  1YZX A;  3QFB C;  2KLX A;  1PX7 A;  2NVL A;  3ZIV A;  2YV9 A;  1BYE A;  1UA5 A;  2HE3 A;  3KD0 A;  1U88 A;  2OBK A;  4IP1 A;  3HZ8 A;  3HKR A;  2LRC A;  1GUM A;  4BVX A;  1SVO A;  1K0M A;  3FEU A;  6GSY A;  4O5U A;  4BL7 B;  3F63 A;  1EEM A;  3LJR A;  4ZB7 A;  5DBQ A;  3I69 A;  2H1D A;  4N30 A;  2BJX A;  4F0C A;  1QK8 A;  4KCA A;  3TRP A;  4I6X A;  5JWQ B;  1X5E A;  2OKA A;  4FO5 A;  4MA9 A;  2X4A A;  4K8M A;  2IMD A;  4IS0 A;  2WVX B;  1F3A A;  3U6V A;  5AGY A;  1O85 A;  1AUC A;  1ZYN A;  2DJ3 A;  5A34 A;  3VWV A;  1GSQ A;  2KHP A;  5F8B A;  1PMT A;  4AKI A;  2C0E A;  1FVJ A;  1N2A A;  4ZIL A;  1SL2 B;  3GX8 A;  3RGB C;  3EE2 A;  1FAA A;  1THO A;  4JR4 A;  1F37 A;  2FY6 A;  3E0U A;  5DQY A;  2OE3 A;  3H79 A;  1H75 A;  4GTU A;  3IC4 A;  4KH7 A;  3A5I A;  5EVO A;  1M99 A;  4IEL A;  5D8I A;  2CZ3 A;  1ON4 A;  2H74 A;  1B48 A;  4BVX B;  2ON7 A;  2L6D A;  1SL0 B;  4OMV A;  2YAN A;  11GS A;  4NXI A;  2L6C A;  5E59 A;  5FWG A;  2A2P A;  13GS A;  2CA8 A;  3ZZX A;  3QOU A;  4AJ7 A;  5CNW A;  3HD5 A;  3DRN A;  4ZBD A;  5KOW A;  1V58 A;  4EIQ A;  3O76 A;  2VUP A;  4MCU A;  4NV2 A;  3HVN A;  5A34 B;  3RPP A;  1WWJ A;  2IPA A;  1FW1 A;  2YP6 A;  3UOM A;  3LG6 A;  3IHG A;  2HZF A;  4J57 E;  2HRF A;  4KCE A;  5DAL A;  3FYG A;  1PKZ A;  4NWY A;  4F9Z A;  3GHA A;  1JZR A;  5G2Z A;  2P31 A;  3DVX A;  4YQM A;  1OC9 B;  3N5O A;  3DML A;  5IO0 A;  2IN3 A;  4Q5R A;  4JRR A;  4GXZ A;  1ZOF A;  4K9Z A;  1K0A A;  3ZML A;  1AIU A;  3KP9 A;  2CV4 A;  4ID0 A;  3W8S A;  2J9H A;  3F3R A;  3UBL A;  1GSU A;  3GNJ A;  4MJB A;  4IVF A;  4TVE A;  4NHZ A;  2GDR A;  4TR0 A;  5LD0 A;  2E2M A;  3QAV A;  3EMX A;  2DLX A;  4G10 A;  3F6D A;  2KUC A;  1B4Q A;  2HSH A;  2WZ9 A;  3VPQ A;  2VL2 C;  3UIW A;  4YAV A;  5DAL B;  1RQM A;  1XCC A;  4MMM A;  3US3 A;  4L0W A;  4ZB9 A;  1TU7 A;  4AF2 A;  4HQS A;  2O87 A;  2BTO T;  5JWO B;  4PGT A;  1XFL A;  3WGE A;  4EIP A;  3TRQ A;  4USS A;  3ZFB A;  1F9M A;  4MLY A;  2RLI A;  3APQ A;  3GH9 A;  4JED A;  5HR0 A;  3DYR A;  1JLV A;  5D9X A;  2O36 A;  4GF0 A;  2HRK A;  2F8F A;  2J23 A;  5D9T A;  4YH2 A;  1EWX A;  2WFC A;  2EIO A;  2GZY A;  1YF0 A;  4KX4 A;  2YZH A;  2H1A A;  3Q18 A;  1YEP A;  1SJZ A;  3MNG A;  3S9F A;  2HLS A;  3IHQ A;  3DKS A;  1ZGN A;  1CQG A;  3HJM A;  2H0H A;  3ZL5 A;  2OBI A;  1HQO A;  1UC7 A;  3ZMK A;  2YZU A;  5E4W A;  3EU3 A;  4MJE A;  1SK0 A;  5JCU A;  4L8E A;  4TN8 A;  1R5P A;  2XHF A;  3PGT A;  4ECB A;  1O7U A;  3R2Q A;  1TXX A;  3ZIT A;  4F82 A;  1J9B A;  3F9U A;  1U6T A;  2WGR A;  1K0D A;  4GDF A;  2HXK A;  2GSR A;  3KH9 A;  4MF6 A;  4ULX A;  1TP9 A;  2A4V A;  2AAW A;  4IBP A;  2H66 A;  2VL3 A;  4J2F A;  3EYT A;  1K0C A;  2MMN A;  2N5A A;  3VFI A;  6GSX A;  1YVL A;  3U5R E;  1BQ7 A;  4XCS A;  3GKN A;  3DGQ A;  3HCZ A;  4Q5Q A;  3SBC A;  3LFL A;  4G0K A;  5ECR B;  4OWY A;  3KGK A;  5JCG A;  6GSW A;  3CHX C;  2VCV A;  3L0H A;  2WUL A;  5H5R A;  1F2E A;  5ELG A;  1SD9 A;  3UJ1 A;  4WXT A;  1XG8 A;  3F0I A;  2UV8 G;  1GP1 A;  2P0G A;  4XIH A;  2AB6 A;  3FR9 A;  2V6O A;  4Q5N A;  5IMD A;  4KUN A;  1PRX A;  4POM A;  4PXO A;  2IL3 A;  5AN1 A;  2EC4 A;  2AV4 A;  4K0N A;  1WE0 A;  1A8Y A;  2V1M A;  2R2J A;  3A3T A;  2EIQ A;  3KCM A;  5DJM A;  1QMV A;  3M1G A;  3ZFL A;  2H1G A;  4PNG A;  4EKZ A;  3GFK A;  2WW3 A;  4HI7 A;  3MIX A;  4ML6 A;  3CXG A;  2GQM A;  3C73 A;  5H5S A;  3KZQ A;  5GAN D;  1X5D A;  1OAZ A;  5J4Y A;  2FA8 A;  3W8J A;  3IPZ A;  3BBY A;  2MMZ A;  4X43 A;  5BRT A;  1MEK A;  4BVY A;  2ALB A;  1G6Y A;  2GLR A;  1T7P B;  5EY6 A;  3C8E A;  3L4N A;  2XBQ A;  3QMX A;  3ZYW A;  2L4C A;  3IA1 A;  3GMF A;  1SVM A;  1KNG A;  2X8H A;  3I6A A;  4YKF A;  2PWJ A;  1ILO A;  4PX1 A;  2F3M A;  4EDY A;  2LQQ A;  1AC1 A;  19GS A;  5A1N A;  4Z2U A;  2IMK A;  1LJR A;  3G7Y A;  5IM9 A;  3UL3 A;  2GQL A;  1JHB A;  3E3E A;  1GNE A;  3PIN A;  1EGO A;  1G7E A;  1Z7R A;  4MPF A;  1GLQ A;  3GST A;  1ERW A;  1ZCP A;  2YNX A;  3MSZ A;  3VWU A;  4AKH A;  1TRW A;  1VRS D;  2LTK A;  2CX3 A;  4PUR A;  6GST A;  3ZIJ A;  2G0F A;  4BVY B;  5KEJ A;  5J5N A;  1YKC A;  2DMM A;  1FOV A;  2AUV A;  5J41 A;  3IE3 A;  1Z6N A;  8GSS A;  3FRC A;  17GS A;  2JAD A;  2JZS A;  2YJ7 A;  1S3D A;  2IWT A;  5B8B A;  4NMU A;  2H72 A;  2V41 A;  3A2V A;  1SD8 A;  4GSN A;  4RUV A;  4N10 A;  4XS4 A;  3VI7 A;  1ST9 A;  3O3T A;  5A1N B;  2OAC A;  4LMV A;  4AJ6 A;  3LOR A;  2WS2 A;  14GS A;  1DSB A;  3CRU A;  2EFH A;  5J4V A;  4PHZ C;  2PU9 C;  1U3A A;  5LNK e;  1I1I P;  2ES7 A;  2HYX A;  2H01 A;  4W66 A;  4CDO A;  2QGV A;  3IXR A;  2JZT A;  2VLT A;  1TOF A;  1B8X A;  1HYU A;  3C1R A;  4BA7 A;  1WOU A;  4HZ4 A;  4NAX A;  5B7C A;  4RI7 A;  4QL7 A;  5DVB A;  2FWH A;  3GKX A;  2IIY A;  3FR6 A;  4KB3 A;  5J4U A;  2BMX A;  3HVX A;  2WJU A;  1YEX A;  2TIR A;  4PTS A;  2JZR A;  2LUS A;  4K7O A;  2LV3 A;  1R4W A;  3D6I A;  4N0Z A;  3CTF A;  5G1L A;  2B7K A;  3WD6 A;  2HT9 A;  2LJR A;  2O85 A;  5FHI A;  1Y1U A;  4RI6 A;  4LLR A;  4XS4 B;  1E6B A;  3WGX A;  4MPG A;  5ECS A;  2K8S A;  3EWL A;  5A5H A;  2KOK A;  2D2Z A;  1TRV A;  4TKY A;  4AJ8 A;  3NIV A;  5ABR A;  3GN3 A;  2B3S A;  1HD2 A;  4MDC A;  2DBC A;  2DJ2 A;  4IJI A;  4Q5F A;  4POL A;  4NHW A;  3MWH A;  4WET A;  1B4P A;  4PQH A;  3GL3 A;  3F4S A;  1SVL A;  2REM A;  4OO4 A;  1TK5 B;  1GTI A;  1M9A A;  1EOG A;  3LYK A;  3M9J A;  18GS A;  4O92 A;  4OCF A;  1O6J A;  3MYD A;  3ZVJ A;  2H75 A;  5B6M A;  4OFN A;  2K9F A;  4KE3 A;  4O5R A;  3F4T A;  4DEJ A;  5GAP D;  4QL9 A;  1AQX A;  1YEW C;  1FG4 A;  5IPG A;  1GLP A;  5DCG A;  1TRU A;  3P2A A;  3CRT A;  1V9W A;  12GS A;  4HEA 2;  2DJK A;  2H76 A;  1G6W A;  2N5F A;  1A2L A;  3D0Z A;  1M0U A;  5F0G A;  5A5H B;  2VOC A;  2B7J A;  1B9X C;  3EIN A;  22GS A;  4G0L A;  4K2D A;  4WR4 A;  3NOF A;  2GZP A;  3N9J A;  2A2R A;  3A2W A;  5ELA A;  1M2D A;  4CW9 A;  2H6Z A;  1SKR B;  1OC9 A;  4YQU A;  4FYC A;  1R26 A;  4O7H A;  2E0Q A;  1MDI A;  3O6T A;  4O32 A;  4YKG A;  3TRX A;  5ECM B;  4V1A p;  1FVK A;  3TJK A;  5CO3 A;  2WDU A;  3JCM L;  4HJ2 A;  1AQW A;  1UVZ A;  2M46 A;  1K3L A;  5DDL A;  2YWN A;  3TOT A;  3UBK A;  3QD9 A;  1XZO A;  2G2Q A;  2C0D A;  3GIX A;  3F4R A;  3KJY A;  4EVM A;  5CYY A;  4AGS A;  1RW1 A;  2DJJ A;  1V98 A;  4I8B A;  1O73 A;  3Q19 A;  5ECH B;  3GA4 A;  4AKG A;  3HA9 A;  3H93 A;  1Z7P A;  5ECP B;  4V2N A;  2DKI A;  3GKM A;  1G0T A;  1KTE A;  1NW2 A;  3ZVJ D;  4Z7X A;  4X4J A;  2FWG A;  3DIE A;  4L5L A;  3TB2 A;  4FXY P;  5AIX A;  4HSC X;  2VCQ A;  3L9S A;  3ZTL A;  1VF1 A;  4IQA A;  3ED3 A;  3IK7 A;  2CAQ A;  2Z9S A;  2HZE A;  3TGZ A;  1T3B A;  2DJ1 A;  2H6X A;  5CRW A;  3HVV A;  5HFG A;  2K6V A;  1FB0 A;  4TOP A;  3KIJ A;  3L9U A;  1JFU A;  5ID2 B;  1PFO A;  4ZB8 A;  6GSS A;  3IDV A;  5A5K A;  1BJX A;  4BIK A;  5KN2 A;  4BWS A;  2VAF A;  1PN9 A;  1ERV A;  1A23 A;  4V2L A;  3P7X A;  3TJF A;  2VKZ G;  2H1L A;  5J9C A;  1GTA A;  2MYG A;  2R0C A;  4PQI A;  3W6G A;  3ZLP A;  5J40 A;  2TRX A;  5IOW A;  2YJH A;  2L4Q A;  1W89 A;  4J56 E;  3R3E A;  1T1V A;  4FQU A;  2HZE B;  5DJL A;  3UVT A;  1XWA A;  1ZL9 A;  1QGV A;  3IC8 A;  2KP2 A;  4KND A;  5IO2 A;  1FOH A;  1YKA A;  4K7I A;  3FZA A;  3LXT A;  3ERG A;  1O81 A;  2O7K A;  1K0O A;  3QR6 A;  1Z5Y E;  4TXV A;  2LNT A;  4FH8 A;  1PL1 A;  5IMC A;  1THX A;  3RAZ A;  1A2J A;  4H86 A;  1G7O A;  4G2E A;  3GUR A;  3GYK A;  4WF4 A;  4LMW A;  4EO3 A;  2F51 A;  2CVD A;  1F6M C;  4MH3 A;  2X99 A;  3TU3 B;  3CTG A;  2VM2 A;  3KEB A;  3VWW A;  2ON5 A;  3CYN A;  3TJB A;  4DSS A;  6GSV A;  1VF2 A;  2C4J A;  2RM5 A;  3D4M A;  3TJG A;  2WW1 A;  4MF5 A;  3VWX A;  1QXH A;  2R37 A;  3NZN A;  4MK3 A;  1GL8 A;  2YPM A;  2R0G A;  5HR3 A;  3FZ5 A;  1Q4J A;  4MH2 A;  1MD3 A;  2NPB A;  2H73 A;  4E8E A;  2WW0 A;  3VLN A;  2MZC A;  2V6K A;  4I97 A;  2OAD A;  3SWL A;  2ZNM A;  1Q98 A;  2ZCT A;  3ME8 A;  4N0V A;  4F2I A;  4D73 A;  5BMU A;  3APO A;  1ABA A;  2R5G A;  3KH7 A;  3PH9 A;  5GZZ B;  1FHE A;  1TXU A;  4HJM A;  1BG1 A;  2VL9 A;  4DSS B;  2C0F A;  4FIW A;  3VUR A;  4XRD A;  2VO4 A;  1WIK A;  5D9W A;  5LCZ A;  1K3O A;  1BG5 A;  4YAP A;  3UEM A;  1JLW A;  2EFD A;  1U87 A;  3IAM 2;  3Q74 A;  1R5A A;  2IME A;  4PQ1 A;  1T8E B;  4GRF A;  2LJK A;  4IJ3 A;  2LRN A;  5IOX A;  1SK2 A;  2FGX A;  3H8Q A;  5ECQ B;  3RPN A;  9GSS A;  3D4T A;  4D73 B;  1EEJ A;  5BMU B;  1YF1 A;  4PI2 C;  2DJ0 A;  3FY7 A;  5G30 A;  4TW5 A;  5F07 A;  2PVO C;  2NTO A;  1XIY A;  4EL1 A;  4P3Y B;  2F8A A;  2QKE A;  1N8J A;  5DQS A;  5ENU A;  3LQ7 A;  5COH A;  2H19 A;  3M9K A;  3RHC A;  3WT2 A;  2AJQ B;  5C00 A;  1OC8 A;  3G7I A;  1RK4 A;  3TJJ A;  1VF3 A;  1V40 A;  4CHS A;  2X8C A;  2JSY A;  5INY A;  3FK8 A;  2C0G A;  2C3N A;  3UVH A;  1XWB A;  2C80 A;  1EGR A;  3OR5 A;  3LWA A;  2WVZ A;  2C3T A;  2P5R A;  2B5X A;  2VLU A;  1QQ2 A;  4CY8 A;  1AXD A;  2LEG A;  2YWO A;  3I43 A;  2GS3 A;  4ACS A;  1S3C A;  3EMP A;  4OO5 A;  4WF5 A;  1O8X A;  3LXZ A;  2JAC A;  4KAE A;  1GSE A;  3KMN A;  1PN0 A;  3EU4 A;  2IMI A;  4G9H A;  2FWF A;  1GTB A;  2OJL A;  4L0U A;  2DSA A;  1M7T A;  3P90 A;  2R0P A;  4PI0 C;  5J3R A;  3LYP A;  3ZRD A;  5KN3 A;  3CSI A;  2C1Y A;  1X0R A;  2L59 A;  1GRX A;  2LRT A;  4FYU A;  3HXS A;  2B1K A;  3QAW A;  4I5Q A;  1E2Y A;  3FR3 A;  1VF4 A;  2YN1 A;  3EC3 A;  4JE1 A;  3D5J A;  3UAP A;  4TRX A;  5ECO B;  1BAY A;  4ZBB A;  1TI3 A;  3EVI A;  4MJA A;  2FD3 A;  3QPM A;  4KSM A;  2KP1 A;  1MD4 A;  1XVW A;  3TKS A;  3M8N A;  4ZL9 A;  5D9V A;  3C7M A;  4KGI A;  1XWC A;  2GTU A;  3RDW A;  5L71 A;  3BCK A;  4FYB A;  5FT3 A;  5GST A;  4MAB A;  2PBJ A;  4GSS A;  2VCZ A;  3APS A;  1PA3 A;  1GSF A;  2B6M A;  3HZ4 A;  5CRE A;  1FB6 A;  1XW5 A;  1Z3E A;  3VPT A;  4K5R A;  2L57 A;  2I1U A;  2L5L A;  1KBN A;  1ERU A;  2YWI A;  3FKF A;  4LL1 B;  1OKT A;  3HY2 A;  2DML A;  3IK9 A;  2QA1 A;  2RUE A;  4K0G A;  4PNF A;  1TI1 A;  2H1B A;  4OCE A;  5D73 A;  1AQV A;  1GWC A;  4PUA A;  2LNS A;  1USB A;  4V1A g;  4CY6 A;  1NM3 A;  4BPY A;  1GUK A;  4K6X A;  3KP8 A;  1WMJ A;  2CAI A;  3PPU A;  1GUL A;  2PVQ A;  5D93 A;  2H71 A;  3Q6O A;  3KTB A;  2HRA A;  5IMZ A;  4KDY A;  2I9H A;  2M72 A;  1YY7 A;  2FA4 A;  4ICY A;  4GQF A;  4LL4 B;  3CSH A;  4E68 A;  1FO5 A;  1EZK A;  4DSQ A;  4F03 A;  1PD2 1;  4GCI A;  3H4K A;  2IFQ A;  2GSQ A;  5G5F A;  3KTL A;  3GRX A;  5C04 A;  1SYR A;  2FWE A;  2YV7 A;  2LKU A;  2QSI A;  4IQ1 A;  5DAK A;  1ERT A;  1GH2 A;  1ZMA A;  4MZB A;  2MBS A;  5KOX A;  1XXU A;  2X64 A;  4YQV A;  3LW9 A;  2XPE A;  4JU5 A;  3MDK A;  5ECK B;  2H0I A;  1GSS A;  2FLS A;  4WEY A;  4EDZ A;  1MTC A;  4QQ7 A;  1J08 A;  4PUF C;  1HNA A;  2YWM A;  4L5O A;  2RII A;  16GS A;  1LU4 A;  1JZD A;  3J7Y b;  4KF9 A;  5B8A A;  2PGT A;  1V2A A;  1XWK A;  4IN0 A;  1ZZY A;  1S3A A;  1U3I A;  3TKS E;  5IMA A;  2GGT A;  2E7P A;  3CBU A;  1M3I A;  1ZYE A;  4N3Z A;  2C3Q A;  5G31 A;  1EP7 A;  1WJK A;  3G7J A;  1SKS B;  3L78 A;  2IFQ B;  4RQX A;  4ZIJ A;  2MMA A;  3DEX A;  4IP6 A;  4E8H A;  2V2G A;  1TW9 A;  5AIS A;  1Z6M A;  2IMF A;  1XW6 A;  5DAK B;  4MJC A;  2VCX A;  4OFM A;  4JBB A;  1Y6E A;  1F3B A;  4MZC A;  1EP8 A;  1T4Z A;  3F6F A;  4AI6 A;  3K8N A;  3AY8 A;  3TDG A;  2O89 A;  2GST A;  4WBJ A;  2FUG 2;  5ID2 A;  1XWG A;  3GTU A;  2O5V A;  5A4U A;  5ECL B;  4TR4 A;  3H1N A;  2DC5 A;  1PGT A;  1WRY A;  1CQH A;  2GT6 A;  2EFE A;  3IBH A;  2GQK A;  3DVW A;  3DD3 A;  1XVQ A;  2X49 A;  4K1F A;  2L5O A;  1WPI A;  3HJO A;  4Z2R A;  3UAR A;  5JCW A;  2HNL A;  2IJY A;  4K5S A;  3LSZ A;  2F9S A; 
#chains in the Genus database with same CATH homology
 1NSW A;  1XOA A;  2GZZ A;  1ZYP A;  4HU9 A;  1OKD A;  2PN8 A;  1GTU A;  2HSN A;  4Z2T A;  2OT3 A;  2XPD A;  1XOB A;  4I2U A;  2VL2 A;  4ECJ A;  1A0R P;  2H70 A;  3F8U A;  4KSO A;  2CX4 A;  3QFA C;  2X8G A;  4I2T A;  3HDC A;  3ME7 A;  2CZ2 A;  1SJI A;  2GT5 A;  3GTU B;  5F06 A;  5G5E A;  1UN2 A;  1LBK A;  4LA1 A;  1DUG A;  3D22 A;  1SL1 B;  2OE1 A;  2O8V B;  3G9B A;  4ZL7 A;  5A4V A;  3C71 A;  1R7H A;  3IOS A;  5HR1 A;  3TOU A;  2HI7 A;  3A2X A;  1X9S B;  4TR1 A;  3F3Q A;  5F05 A;  2AYT A;  2DIY A;  1YJ6 A;  4IKH A;  1X9W B;  1OC3 A;  5JWR B;  1EV9 A;  3DWV A;  3IV4 A;  1N25 A;  1PX6 A;  2HSN B;  1PL2 A;  4EC0 A;  1MDK A;  1M2A A;  3GX0 A;  2DIZ A;  4HZ2 A;  4ML1 A;  1K3Y A;  4XHM A;  5CAX A;  3LEF A;  1IYH A;  4JZQ A;  5AIV A;  3KXO A;  2WRT A;  2EIR A;  3BOA A;  2LST A;  2LQO A;  2CT6 A;  4ZBA A;  1ACV A;  4GQC A;  3FZ9 A;  4NV5 A;  2GSS A;  1BX9 A;  1EV4 A;  4IHU A;  4WBR D;  2FNO A;  2AHE A;  3P8W A;  3FMW A;  4MF7 A;  2VM1 A;  5CRH A;  1XBS A;  2VCT A;  3QAG A;  1X9M B;  4G01 A;  3QCP A;  5HQP A;  4TR1 B;  4BWQ A;  1M9B A;  4X0X A;  3VI5 A;  2V32 A;  5D96 A;  3M3M A;  2QA2 A;  1GSY A;  4JR6 A;  2H6Y A;  2RUF A;  3EUR A;  3GUS A;  3CMI A;  1PQN A;  2EFC A;  4EE0 A;  2VD1 A;  2JU5 A;  1AW9 A;  1AAZ A;  4ILF A;  4HU7 A;  2JL4 A;  2R6K A;  3M0F A;  2VD0 A;  1HNB A;  4X1U A;  2GVP A;  5EL8 A;  4G19 A;  2LJA A;  1SYX A;  1BF5 A;  1XW9 A;  2XC2 A;  5G1K A;  2FHE A;  2B1L A;  3KMO A;  2RM6 A;  5KN1 A;  2HRK B;  1SKW B;  2UZ8 A;  4POK A;  1YQ1 A;  5ECN B;  4MP4 A;  2HSY A;  2HQT A;  4NPB A;  3IAS 2;  10GS A;  2WB9 A;  2K8V A;  2DKH A;  3WYW A;  2NDO A;  3ERW A;  4KA0 A;  1ZYQ B;  2R3X A;  1OYJ A;  1PKW A;  3GL5 A;  3TKP A;  2YCD A;  3BD2 A;  2A4H A;  4EXJ A;  4HUA A;  4HOJ A;  1T00 A;  2VLV A;  2M80 A;  1M2B A;  3MAK A;  1SJ6 A;  3BJ5 A;  2LS5 A;  3V1W A;  4XS1 A;  5J47 A;  1URM A;  3HJP A;  4MNN A;  4N11 A;  4OFT A;  2I4A A;  3GKK A;  4ISD A;  1KEB A;  5A4W A;  3HYP A;  4A5P A;  1TRS A;  2QC7 A;  3QDN A;  2B5E A;  2PER A;  3J7Y k;  1A0F A;  4DVC A;  4V2M A;  3FW2 A;  2CVB A;  1HNC A;  2YOI A;  4DSR A;  2I81 A;  1SU9 A;  2FCH A;  4KDX A;  1SK1 A;  3HHV A;  2N5B A;  1VGL A;  5HFK A;  2VIM A;  3ERF A;  2CQ9 A;  3I9V 2;  2HFD A;  4XRA A;  3RHB A;  1T4Y A;  1X5C A;  2NBS A;  3IRA A;  5IMF A;  1IYI A;  1TJD A;  4GLT A;  1I5G A;  1OVN A;  3EPT A;  4MZW A;  3E9J B;  3D21 A;  1I9D A;  4XTS A;  1TK0 B;  4HS1 A;  4KDU A;  1GUH A;  3KM6 A;  4ECC A;  1A2M A;  3GH6 A;  2E2G A;  3IR4 A;  3GV1 A;  1BED A;  1A24 A;  1TKD B;  3CSJ A;  2WCI A;  1YDK A;  3LGC A;  2OA7 A;  3BCI A;  4AKX B;  4ZB6 A;  2CVK A;  2JSZ A;  2XBI A;  2OE0 A;  2P5Q A;  5IIZ A;  4WR5 A;  4ECI A;  2H30 A;  1B9Y C;  4TXO A;  1GSD A;  1ML6 A;  4HDE A;  3GSS A;  1QUW A;  1WP0 A;  2B5Y A;  2K18 A;  5HR2 A;  3ISO A;  2PMT A;  1SEN A;  3C1S A;  5CRD A;  4IGJ A;  7GSS A;  2H8L A;  4POB A;  3UMA A;  2HSM A;  4K7N A;  20GS A;  2R4V A;  1QFN A;  2PPT A;  4KW6 A;  2PUK C;  4K2X A;  4O5Q A;  1C72 A;  5CP1 A;  1Y25 A;  1V57 A;  3FHK A;  1EOH A;  4RQR A;  1DE2 A;  1K0B A;  3TCO A;  4EF0 A;  4QMK A;  2ZUP A;  3TUE A;  4WKW A;  1TK8 B;  1K0N A;  5EPF A;  5IMV A;  3L9V A;  4GST A;  5GSS A;  1A8L A;  3FZ4 A;  3DXB A;  2I3Y A;  1GNW A;  3TKQ A;  4EUY A;  5ECI B;  6GSU A;  2C8U A;  4TXO B;  1NHY A;  3A5W A;  1J0F A;  4IW9 A;  1TTZ A;  3TKR A;  1TU8 A;  1TDI A;  1W4V A;  4GWR A;  1OE7 A;  2HRN A;  1JZW A;  2H0G A;  1XPV A;  1DBY A;  3RBT A;  4OD7 A;  3WGD A;  1Z9H A;  4HQZ A;  4F0B A;  5HFI A;  2TRC P;  4BL7 A;  2MMO A;  2VCW A;  3HVS A;  3PR8 A;  3TKS C;  5B6N A;  3HMJ G;  1OE8 A;  4ZL8 A;  2HSM B;  5IQY A;  3CWG A;  4ZXG A;  2MBT A;  1O8W A;  5CRG A;  3VK9 A;  5IPH A;  3WT1 A;  4TR3 A;  1PSQ A;  5DCH A;  1DE1 A;  4G0I A;  1MDJ A;  5H5Q A;  2A2S A;  5KN0 A;  1JZO A;  1NHO A;  4XS6 A;  1H4O A;  5J9B A;  3ZRE A;  1YZX A;  3QFB C;  2KLX A;  1PX7 A;  2NVL A;  3ZIV A;  2YV9 A;  1BYE A;  1UA5 A;  2HE3 A;  3KD0 A;  1U88 A;  2OBK A;  4IP1 A;  3HZ8 A;  3HKR A;  2LRC A;  1GUM A;  4BVX A;  1SVO A;  1K0M A;  3FEU A;  6GSY A;  4O5U A;  4BL7 B;  3F63 A;  1EEM A;  3LJR A;  4ZB7 A;  5DBQ A;  3I69 A;  2H1D A;  4N30 A;  2BJX A;  4F0C A;  1QK8 A;  4KCA A;  3TRP A;  4I6X A;  5JWQ B;  1X5E A;  2OKA A;  4FO5 A;  4MA9 A;  2X4A A;  4K8M A;  2IMD A;  4IS0 A;  1F3A A;  3U6V A;  5AGY A;  1O85 A;  1AUC A;  1ZYN A;  2DJ3 A;  5A34 A;  3VWV A;  1GSQ A;  2KHP A;  5F8B A;  1PMT A;  4AKI A;  2C0E A;  1FVJ A;  1N2A A;  4ZIL A;  1SL2 B;  3GX8 A;  3EE2 A;  1FAA A;  1THO A;  4JR4 A;  1F37 A;  2FY6 A;  3E0U A;  5DQY A;  2OE3 A;  3H79 A;  1H75 A;  4GTU A;  3IC4 A;  4KH7 A;  3A5I A;  5EVO A;  1M99 A;  4IEL A;  5D8I A;  2CZ3 A;  1ON4 A;  2H74 A;  1B48 A;  4BVX B;  2ON7 A;  2L6D A;  1SL0 B;  4OMV A;  2YAN A;  11GS A;  4NXI A;  2L6C A;  5E59 A;  5FWG A;  2A2P A;  13GS A;  2CA8 A;  3ZZX A;  3QOU A;  4AJ7 A;  5CNW A;  3HD5 A;  3DRN A;  4ZBD A;  5KOW A;  1V58 A;  4EIQ A;  3O76 A;  2VUP A;  4MCU A;  4NV2 A;  3RPP A;  5A34 B;  1WWJ A;  2IPA A;  1FW1 A;  2YP6 A;  3UOM A;  3LG6 A;  3IHG A;  2HZF A;  4J57 E;  2HRF A;  4KCE A;  5DAL A;  3FYG A;  1PKZ A;  4NWY A;  4F9Z A;  3GHA A;  1JZR A;  5G2Z A;  2P31 A;  3DVX A;  4YQM A;  1OC9 B;  3N5O A;  3DML A;  5IO0 A;  2IN3 A;  4Q5R A;  4JRR A;  4GXZ A;  1ZOF A;  4K9Z A;  1K0A A;  3ZML A;  1AIU A;  3KP9 A;  2CV4 A;  4ID0 A;  3W8S A;  2J9H A;  3F3R A;  3UBL A;  1GSU A;  3GNJ A;  4MJB A;  4IVF A;  4TVE A;  4NHZ A;  2GDR A;  4TR0 A;  5LD0 A;  2E2M A;  3QAV A;  3EMX A;  2DLX A;  4G10 A;  3F6D A;  2KUC A;  1B4Q A;  2HSH A;  2WZ9 A;  3VPQ A;  2VL2 C;  3UIW A;  4YAV A;  5DAL B;  1RQM A;  1XCC A;  4MMM A;  3US3 A;  4L0W A;  4ZB9 A;  1TU7 A;  4AF2 A;  4HQS A;  2O87 A;  2BTO T;  5JWO B;  4PGT A;  1XFL A;  3WGE A;  4EIP A;  3TRQ A;  4USS A;  3ZFB A;  1F9M A;  4MLY A;  2RLI A;  3APQ A;  3GH9 A;  4JED A;  5HR0 A;  3DYR A;  1JLV A;  5D9X A;  4GF0 A;  2HRK A;  2F8F A;  2J23 A;  5D9T A;  4YH2 A;  1EWX A;  2WFC A;  2EIO A;  2GZY A;  1YF0 A;  4KX4 A;  2YZH A;  2H1A A;  3Q18 A;  1YEP A;  1SJZ A;  3MNG A;  3S9F A;  2HLS A;  3IHQ A;  3DKS A;  1ZGN A;  1CQG A;  3HJM A;  2H0H A;  3ZL5 A;  2OBI A;  1HQO A;  1UC7 A;  3ZMK A;  2YZU A;  5E4W A;  3EU3 A;  4MJE A;  1SK0 A;  5JCU A;  4L8E A;  4TN8 A;  1R5P A;  2XHF A;  3PGT A;  4ECB A;  1O7U A;  3R2Q A;  1TXX A;  3ZIT A;  4F82 A;  1J9B A;  3F9U A;  1U6T A;  2WGR A;  1K0D A;  4GDF A;  2HXK A;  2GSR A;  3KH9 A;  4MF6 A;  4ULX A;  1TP9 A;  2A4V A;  2AAW A;  4IBP A;  2H66 A;  2VL3 A;  4J2F A;  3EYT A;  1K0C A;  2MMN A;  2N5A A;  3VFI A;  6GSX A;  1YVL A;  3U5R E;  1BQ7 A;  4XCS A;  3GKN A;  3DGQ A;  3HCZ A;  4Q5Q A;  3SBC A;  3LFL A;  4G0K A;  5ECR B;  4OWY A;  3KGK A;  5JCG A;  6GSW A;  2VCV A;  3L0H A;  2WUL A;  5H5R A;  1F2E A;  5ELG A;  1SD9 A;  3UJ1 A;  4WXT A;  3F0I A;  2UV8 G;  1GP1 A;  2P0G A;  4XIH A;  2AB6 A;  3FR9 A;  2V6O A;  4Q5N A;  5IMD A;  4KUN A;  1PRX A;  4POM A;  4PXO A;  2IL3 A;  5AN1 A;  2EC4 A;  2AV4 A;  4K0N A;  1WE0 A;  1A8Y A;  2V1M A;  2R2J A;  3A3T A;  2EIQ A;  3KCM A;  5DJM A;  1QMV A;  3M1G A;  3ZFL A;  2H1G A;  4PNG A;  4EKZ A;  3GFK A;  4HI7 A;  3MIX A;  4ML6 A;  3CXG A;  2GQM A;  3C73 A;  5H5S A;  3KZQ A;  5GAN D;  1X5D A;  1OAZ A;  5J4Y A;  2FA8 A;  3W8J A;  3IPZ A;  3BBY A;  2MMZ A;  4X43 A;  5BRT A;  1MEK A;  4BVY A;  2ALB A;  1G6Y A;  2GLR A;  1T7P B;  5EY6 A;  3C8E A;  3L4N A;  2XBQ A;  3QMX A;  3ZYW A;  2L4C A;  3IA1 A;  3GMF A;  1SVM A;  1KNG A;  2X8H A;  3I6A A;  4YKF A;  2PWJ A;  1ILO A;  4PX1 A;  2F3M A;  4EDY A;  2LQQ A;  1AC1 A;  19GS A;  5A1N A;  4Z2U A;  2IMK A;  1LJR A;  3G7Y A;  5IM9 A;  3UL3 A;  2GQL A;  1JHB A;  3E3E A;  1GNE A;  3PIN A;  1EGO A;  1G7E A;  1Z7R A;  4MPF A;  1GLQ A;  3GST A;  1ERW A;  1ZCP A;  2YNX A;  3MSZ A;  3VWU A;  4AKH A;  1TRW A;  1VRS D;  2LTK A;  2CX3 A;  4PUR A;  6GST A;  3ZIJ A;  2G0F A;  4BVY B;  5KEJ A;  5J5N A;  1YKC A;  2DMM A;  1FOV A;  2AUV A;  5J41 A;  3IE3 A;  1Z6N A;  8GSS A;  3FRC A;  17GS A;  2JAD A;  2JZS A;  2YJ7 A;  1S3D A;  2IWT A;  5B8B A;  4NMU A;  2H72 A;  2V41 A;  3A2V A;  1SD8 A;  4GSN A;  4RUV A;  4N10 A;  4XS4 A;  3VI7 A;  1ST9 A;  3O3T A;  5A1N B;  2OAC A;  4LMV A;  4AJ6 A;  3LOR A;  2WS2 A;  14GS A;  1DSB A;  3CRU A;  2EFH A;  5J4V A;  2PU9 C;  1U3A A;  5LNK e;  2ES7 A;  2HYX A;  2H01 A;  4W66 A;  4CDO A;  2QGV A;  3IXR A;  2JZT A;  2VLT A;  1TOF A;  1B8X A;  1HYU A;  3C1R A;  4BA7 A;  1WOU A;  4HZ4 A;  4NAX A;  5B7C A;  4RI7 A;  4QL7 A;  5DVB A;  2FWH A;  3GKX A;  2IIY A;  3FR6 A;  4KB3 A;  5J4U A;  2BMX A;  3HVX A;  2WJU A;  1YEX A;  2TIR A;  4PTS A;  2JZR A;  2LUS A;  4K7O A;  2LV3 A;  1R4W A;  3D6I A;  4N0Z A;  3CTF A;  5G1L A;  2B7K A;  3WD6 A;  2HT9 A;  2LJR A;  2O85 A;  5FHI A;  1Y1U A;  4RI6 A;  4LLR A;  4XS4 B;  1E6B A;  3WGX A;  4MPG A;  5ECS A;  2K8S A;  3EWL A;  5A5H A;  2KOK A;  2D2Z A;  1TRV A;  4TKY A;  4AJ8 A;  3NIV A;  5ABR A;  3GN3 A;  2B3S A;  1HD2 A;  4MDC A;  2DBC A;  2DJ2 A;  4IJI A;  4Q5F A;  4POL A;  4NHW A;  3MWH A;  4WET A;  1B4P A;  4PQH A;  3GL3 A;  3F4S A;  1SVL A;  2REM A;  4OO4 A;  1TK5 B;  1GTI A;  1M9A A;  1EOG A;  3LYK A;  3M9J A;  18GS A;  4O92 A;  4OCF A;  1O6J A;  3MYD A;  3ZVJ A;  2H75 A;  5B6M A;  4OFN A;  2K9F A;  4KE3 A;  4O5R A;  3F4T A;  4DEJ A;  5GAP D;  4QL9 A;  1AQX A;  1FG4 A;  5IPG A;  1GLP A;  5DCG A;  1TRU A;  3P2A A;  3CRT A;  1V9W A;  12GS A;  4HEA 2;  2DJK A;  2H76 A;  1G6W A;  2N5F A;  1A2L A;  3D0Z A;  1M0U A;  5F0G A;  5A5H B;  2VOC A;  2B7J A;  1B9X C;  3EIN A;  22GS A;  4G0L A;  4K2D A;  4WR4 A;  3NOF A;  2GZP A;  3N9J A;  2A2R A;  3A2W A;  5ELA A;  1M2D A;  4CW9 A;  2H6Z A;  1SKR B;  1OC9 A;  4YQU A;  4FYC A;  1R26 A;  4O7H A;  2E0Q A;  1MDI A;  3O6T A;  4O32 A;  4YKG A;  3TRX A;  5ECM B;  4V1A p;  1FVK A;  3TJK A;  5CO3 A;  2WDU A;  3JCM L;  4HJ2 A;  1AQW A;  1UVZ A;  2M46 A;  1K3L A;  5DDL A;  2YWN A;  3TOT A;  3UBK A;  3QD9 A;  1XZO A;  2G2Q A;  2C0D A;  3GIX A;  3F4R A;  3KJY A;  4EVM A;  5CYY A;  4AGS A;  1RW1 A;  2DJJ A;  1V98 A;  4I8B A;  1O73 A;  3Q19 A;  5ECH B;  3GA4 A;  4AKG A;  3HA9 A;  3H93 A;  1Z7P A;  5ECP B;  4V2N A;  2DKI A;  3GKM A;  1G0T A;  1KTE A;  1NW2 A;  3ZVJ D;  4Z7X A;  4X4J A;  2FWG A;  3DIE A;  4L5L A;  3TB2 A;  5AIX A;  2VCQ A;  3L9S A;  3ZTL A;  1VF1 A;  4IQA A;  3ED3 A;  3IK7 A;  2CAQ A;  2Z9S A;  2HZE A;  3TGZ A;  1T3B A;  2DJ1 A;  2H6X A;  5CRW A;  3HVV A;  5HFG A;  2K6V A;  1FB0 A;  4TOP A;  3KIJ A;  3L9U A;  1JFU A;  5ID2 B;  4ZB8 A;  6GSS A;  3IDV A;  5A5K A;  1BJX A;  5KN2 A;  4BWS A;  2VAF A;  1PN9 A;  1ERV A;  1A23 A;  4V2L A;  3P7X A;  3TJF A;  2VKZ G;  2H1L A;  5J9C A;  1GTA A;  2MYG A;  2R0C A;  4PQI A;  3W6G A;  3ZLP A;  5J40 A;  2TRX A;  5IOW A;  2YJH A;  2L4Q A;  1W89 A;  4J56 E;  3R3E A;  1T1V A;  4FQU A;  2HZE B;  5DJL A;  3UVT A;  1XWA A;  1ZL9 A;  1QGV A;  3IC8 A;  2KP2 A;  4KND A;  5IO2 A;  1FOH A;  1YKA A;  4K7I A;  3FZA A;  3LXT A;  3ERG A;  1O81 A;  2O7K A;  1K0O A;  3QR6 A;  1Z5Y E;  4TXV A;  2LNT A;  4FH8 A;  1PL1 A;  5IMC A;  1THX A;  3RAZ A;  1A2J A;  4H86 A;  1G7O A;  4G2E A;  3GUR A;  3GYK A;  4WF4 A;  4LMW A;  4EO3 A;  2F51 A;  2CVD A;  1F6M C;  4MH3 A;  2X99 A;  3TU3 B;  3CTG A;  2VM2 A;  3KEB A;  3VWW A;  2ON5 A;  3CYN A;  3TJB A;  4DSS A;  6GSV A;  1VF2 A;  2C4J A;  2RM5 A;  3D4M A;  3TJG A;  4MF5 A;  3VWX A;  1QXH A;  2R37 A;  3NZN A;  4MK3 A;  1GL8 A;  2YPM A;  2R0G A;  5HR3 A;  3FZ5 A;  1Q4J A;  4MH2 A;  1MD3 A;  2NPB A;  2H73 A;  4E8E A;  3VLN A;  2MZC A;  2V6K A;  4I97 A;  2OAD A;  3SWL A;  2ZNM A;  1Q98 A;  2ZCT A;  3ME8 A;  4N0V A;  4F2I A;  4D73 A;  5BMU A;  3APO A;  1ABA A;  2R5G A;  3KH7 A;  3PH9 A;  5GZZ B;  1FHE A;  1TXU A;  4HJM A;  1BG1 A;  2VL9 A;  4DSS B;  2C0F A;  4FIW A;  3VUR A;  4XRD A;  2VO4 A;  1WIK A;  5D9W A;  5LCZ A;  1K3O A;  1BG5 A;  4YAP A;  3UEM A;  1JLW A;  2EFD A;  1U87 A;  3IAM 2;  3Q74 A;  1R5A A;  2IME A;  4PQ1 A;  1T8E B;  4GRF A;  2LJK A;  4IJ3 A;  2LRN A;  5IOX A;  1SK2 A;  2FGX A;  3H8Q A;  5ECQ B;  3RPN A;  9GSS A;  3D4T A;  4D73 B;  1EEJ A;  5BMU B;  1YF1 A;  2DJ0 A;  3FY7 A;  5G30 A;  4TW5 A;  5F07 A;  2PVO C;  2NTO A;  1XIY A;  4EL1 A;  4P3Y B;  2F8A A;  2QKE A;  1N8J A;  5DQS A;  5ENU A;  3LQ7 A;  5COH A;  2H19 A;  3M9K A;  3RHC A;  3WT2 A;  2AJQ B;  5C00 A;  1OC8 A;  3G7I A;  1RK4 A;  3TJJ A;  1VF3 A;  1V40 A;  4CHS A;  2X8C A;  2JSY A;  5INY A;  3FK8 A;  2C0G A;  2C3N A;  3UVH A;  1XWB A;  2C80 A;  1EGR A;  3OR5 A;  3LWA A;  2C3T A;  2P5R A;  2B5X A;  2VLU A;  1QQ2 A;  4CY8 A;  1AXD A;  2LEG A;  2YWO A;  3I43 A;  2GS3 A;  4ACS A;  1S3C A;  3EMP A;  4OO5 A;  4WF5 A;  1O8X A;  3LXZ A;  2JAC A;  4KAE A;  1GSE A;  3KMN A;  1PN0 A;  3EU4 A;  2IMI A;  4G9H A;  2FWF A;  1GTB A;  2OJL A;  4L0U A;  2DSA A;  1M7T A;  3P90 A;  2R0P A;  5J3R A;  3LYP A;  3ZRD A;  5KN3 A;  3CSI A;  2C1Y A;  1X0R A;  2L59 A;  1GRX A;  2LRT A;  4FYU A;  3HXS A;  2B1K A;  3QAW A;  4I5Q A;  1E2Y A;  3FR3 A;  1VF4 A;  2YN1 A;  3EC3 A;  4JE1 A;  3D5J A;  3UAP A;  4TRX A;  5ECO B;  1BAY A;  4ZBB A;  1TI3 A;  3EVI A;  4MJA A;  2FD3 A;  3QPM A;  4KSM A;  2KP1 A;  1MD4 A;  1XVW A;  3TKS A;  3M8N A;  4ZL9 A;  5D9V A;  3C7M A;  4KGI A;  1XWC A;  2GTU A;  3RDW A;  5L71 A;  3BCK A;  4FYB A;  5FT3 A;  5GST A;  4MAB A;  2PBJ A;  4GSS A;  2VCZ A;  3APS A;  1PA3 A;  1GSF A;  2B6M A;  3HZ4 A;  5CRE A;  1FB6 A;  1XW5 A;  1Z3E A;  3VPT A;  4K5R A;  2L57 A;  2I1U A;  2L5L A;  1KBN A;  1ERU A;  2YWI A;  3FKF A;  4LL1 B;  1OKT A;  3HY2 A;  2DML A;  3IK9 A;  2QA1 A;  2RUE A;  4K0G A;  4PNF A;  1TI1 A;  2H1B A;  4OCE A;  5D73 A;  1AQV A;  1GWC A;  4PUA A;  2LNS A;  1USB A;  4V1A g;  4CY6 A;  1NM3 A;  4BPY A;  1GUK A;  4K6X A;  3KP8 A;  1WMJ A;  2CAI A;  3PPU A;  1GUL A;  2PVQ A;  5D93 A;  2H71 A;  3Q6O A;  3KTB A;  2HRA A;  5IMZ A;  4KDY A;  2I9H A;  2M72 A;  1YY7 A;  2FA4 A;  4ICY A;  4GQF A;  4LL4 B;  3CSH A;  4E68 A;  1FO5 A;  1EZK A;  4DSQ A;  4F03 A;  1PD2 1;  4GCI A;  3H4K A;  2IFQ A;  2GSQ A;  5G5F A;  3KTL A;  3GRX A;  5C04 A;  1SYR A;  2FWE A;  2YV7 A;  2LKU A;  2QSI A;  4IQ1 A;  5DAK A;  1ERT A;  1GH2 A;  1ZMA A;  4MZB A;  2MBS A;  5KOX A;  1XXU A;  2X64 A;  4YQV A;  3LW9 A;  2XPE A;  4JU5 A;  3MDK A;  5ECK B;  2H0I A;  1GSS A;  2FLS A;  4WEY A;  4EDZ A;  1MTC A;  4QQ7 A;  1J08 A;  4PUF C;  1HNA A;  2YWM A;  4L5O A;  2RII A;  16GS A;  1LU4 A;  1JZD A;  3J7Y b;  4KF9 A;  5B8A A;  2PGT A;  1V2A A;  1XWK A;  4IN0 A;  1ZZY A;  1S3A A;  1U3I A;  3TKS E;  5IMA A;  2GGT A;  2E7P A;  3CBU A;  1ZYE A;  4N3Z A;  2C3Q A;  5G31 A;  1EP7 A;  1WJK A;  3G7J A;  1SKS B;  3L78 A;  2IFQ B;  4RQX A;  4ZIJ A;  2MMA A;  3DEX A;  4IP6 A;  4E8H A;  2V2G A;  1TW9 A;  5AIS A;  1Z6M A;  2IMF A;  1XW6 A;  5DAK B;  4MJC A;  2VCX A;  4OFM A;  4JBB A;  1Y6E A;  1F3B A;  4MZC A;  1EP8 A;  1T4Z A;  3F6F A;  4AI6 A;  3K8N A;  3AY8 A;  3TDG A;  2O89 A;  2GST A;  4WBJ A;  2FUG 2;  5ID2 A;  1XWG A;  3GTU A;  2O5V A;  5A4U A;  5ECL B;  4TR4 A;  3H1N A;  2DC5 A;  1PGT A;  1WRY A;  1CQH A;  2GT6 A;  2EFE A;  3IBH A;  2GQK A;  3DVW A;  3DD3 A;  1XVQ A;  2X49 A;  4K1F A;  2L5O A;  1WPI A;  3HJO A;  4Z2R A;  3UAR A;  5JCW A;  2HNL A;  2IJY A;  4K5S A;  3LSZ A;  2F9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...