5A4VA

Atgstf2 from arabidopsis thaliana in complex with quercetin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
b'AGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 84
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a4vA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a4vA01
2X99A 3W8JA 2HZEA 5ELAA 2BTOT 2LJKA 5G2ZA 1Z9HA 1WJKA 1V57A 4K9ZA 1KEBA 2E7PA 3DVXA 3FZ4A 3C8EA 4Q5FA 4WKWA 4QL9A 1GTIA 2CVDA 4ZILA 1BYEA 4G0IA 4RQXA 1GTBA 4ML6A 2YN1A 5IMVA 4KNDA 3LYKA 2CT6A 3HCZA 3IA1A 2HE3A 1VRSD 2HZFA 3GH9A 1U3AA 1GULA 1TOFA 3KD0A 4QQ7A 3CTFA 2H01A 2CVBA 2YWNA 4TXOB 2YWMA 2XPEA 1EOGA 3EU3A 3FRCA 2OADA 5AGYA 5IPGA 3CYNA 2CA8A 5KN0A 1PN9A 4HQZA 1CQGA 4FH8A 4GQCA 1TRVA 5CO3A 3U5RE 3F9UA 4ZXGA 1E6BA 5IMAA 4IGJA 2H75A 3LJRA 2JACA 3GTUB 2O85A 3TKPA 3TKRA 3ZL5A 5IMDA 5ELGA 1T1VA 2IN3A 4V2NA 3I6AA 1AAZA 3QAVA 3SBCA 4V1Ap 2LJAA 5IIZA 2VD0A 4DSQA 3LSZA 2DIZA 4LA1A 3HY2A 1MDJA 3BBYA 4RUVA 4MF6A 3KMOA 3KZQA 3RAZA 3QFAC 2GZPA 5JCUA 2OBKA 2M72A 2LQQA 3G7JA 5ECHB 5CYYA 1HNBA 5GAPD 1GP1A 2IIYA 2L4QA 3G7IA 2F9SA 1TDIA 4XS1A 4DVCA 1J9BA 3MSZA 1GSEA 1Q4JA 2IPAA 2REMA 3GIXA 2VLVA 4KDUA 4F0CA 1SYRA 1K0BA 3IHQA 2DJKA 2IMFA 4IN0A 3G7YA 2NPBA 2I3YA 1PD21 3HXSA 4EKZA 4YAVA 6GSYA 4GF0A 1GSQA 2GT6A 3CXGA 1O85A 3L9VA 3EMPA 4HJMA 2X64A 5DJLA 2KP1A 1JZRA 3VWVA 1VF4A 5KN2A 4OCEA 1NM3A 4I2TA 4PXOA 4AJ6A 2H71A 1GNWA 3DMLA 4JEDA 1RK4A 2O89A 5J5NA 4EF0A 4PX1A 3ZFLA 2C3NA 1XOAA 3CRUA 4IBPA 2PU9C 1AXDA 1PQNA 4MJBA 2KUCA 1TRWA 4XRAA 5KN3A 1GLPA 1PX6A 3J7Yb 1H75A 5JCGA 2X8CA 2VCQA 3EURA 1YJ6A 3LFLA 2H72A 2GSTA 5G5FA 4USSA 4LL1B 2LRTA 3KGKA 4V2LA 2N5FA 3KP9A 2AUVA 5AIXA 4KA0A 2WULA 2FHEA 2YCDA 5GSTA 2OBIA 4BWQA 3TRQA 4I6XA 5INYA 1TK8B 4IELA 4MJAA 1LBKA 1X5DA 1SK2A 4TR1A 2HYXA 1HQOA 2WS2A 4CW9A 2JSZA 3DRNA 1KTEA 5H5RA 4EDYA 2DJ1A 1K0CA 4GQFA 3DIEA 5ID2A 6GSVA 3Q19A 2I9HA 1ILOA 1XZOA 1YEPA 3P2AA 4I2UA 5A4UA 1EWXA 1OC3A 2B7JA 4DEJA 1THOA 4KE3A 1GTAA 1K0DA 2HRFA 1F37A 4KUNA 4ECIA 1SL0B 2GT5A 1T3BA 1UVZA 2KP2A 3FZAA 1G6WA 22GSA 1SK0A 1X9MB 4G0KA 1URMA 1A0FA 5J9CA 2HRNA 4BWSA 1GSUA 3I9V2 2NBSA 5A4WA 5D9XA 5ECLB 5F06A 4AJ8A 4WR5A 4PQHA 3O76A 4F9ZA 4G0LA 1M2AA 3FHKA 3HJPA 1A0RP 3UBLA 4FYBA 2FGXA 3WT2A 2FWFA 2HSHA 3KH9A 3M1GA 2Z9SA 2C0GA 5EY6A 6GSWA 5JWQB 3GNJA 4N10A 4OFTA 5BMUA 4KB3A 4N0VA 3FR9A 5GZZB 1QFNA 1QQ2A 3IOSA 3TJJA 3FZ9A 4ILFA 1RW1A 1WRYA 1EV4A 2F8AA 3VWXA 4ULXA 3MNGA 3DD3A 4DSSA 1XW5A 1XIYA 3K8NA 3VFIA 3APQA 4Q5QA 3CTGA 1JZWA 4F2IA 4BVXA 3EE2A 3C7MA 2VCXA 5F07A 4NXIA 5IM9A 4WBJA 2UZ8A 2GTUA 4POKA 3VPQA 4MZBA 4HOJA 5E59A 5KEJA 5D9TA 3L0HA 3QAWA 4L8EA 4X43A 1SU9A 5A5KA 2CZ2A 3ZFBA 2GSRA 4K0GA 1ERTA 1B9YC 4GTUA 5DBQA 4K7IA 3RPNA 3ZTLA 5ENUA 1T4ZA 3FW2A 3HJMA 2RM5A 4HI7A 1PGTA 2MYGA 2NDOA 3NOFA 4F0BA 1Z6NA 3UJ1A 3GTUA 2H6YA 3ME7A 3C73A 4WETA 2DLXA 6GSUA 2P5RA 2L5LA 3F6DA 2DC5A 3IR4A 1M0UA 3HD5A 2VM1A 1A24A 2K8VA 2XHFA 4PTSA 4MZWA 3ZRDA 1GUMA 1QMVA 1Z3EA 2ZNMA 1U6TA 3HDCA 4JU5A 5FHIA 4KH7A 2C0FA 3KIJA 2MMNA 3TJGA 5HQPA 1XWBA 4KCAA 4OO5A 4LMVA 3VURA 2H73A 1GSFA 4ECBA 1JZDA 3CSIA 4ZIJA 4OWYA 1FVKA 2C0DA 1TW9A 3P90A 2H30A 4K0NA 2WFCA 4HEA2 5F05A 5D96A 5E4WA 2L4CA 2MBSA 4HZ2A 4FYCA 1BX9A 2LKUA 1O6JA 1TRUA 4MDCA 5ECMB 2CZ3A 1EV9A 5HFGA 3KM6A 3IBHA 4XS4A 1C72A 5G1KA 1AW9A 4TR1B 4G19A 3VWWA 4K7OA 2OACA 2YZHA 1AQVA 3WYWA 2WB9A 3C71A 4YQMA 5ID2B 1QGVA 3UARA 2JZRA 2C1YA 3EVIA 3P7XA 5B8BA 3IDVA 2WZ9A 4I8BA 4OO4A 1EGRA 3F0IA 2VLTA 1GSYA 2PWJA 4ZBAA 1XWCA 2ON5A 3V1WA 4EUYA 3PPUA 4QL7A 1E2YA 2H6XA 4MH2A 2CX4A 5D93A 10GSA 3TRXA 2HNLA 1BQ7A 5IO0A 1EP8A 1SL1B 2XPDA 2H74A 2J23A 3RBTA 3GYKA 1BAYA 3F63A 1MEKA 2H0HA 1UC7A 1Z5YE 2F8FA 1UN2A 1B8XA 4BL7B 4E8EA 2QKEA 4GRFA 1O8WA 8GSSA 3FR3A 5A4VA 1SD8A 3MDKA 1A2MA 5D8IA 2E2MA 2YOIA 2DMLA 2ON7A 2EIQA 1FB6A 2DBCA 4NPBA 4DSSB 2JZSA 4PQIA 4MPFA 1WOUA 3WD6A 3QFBC 2GLRA 5IPHA 4XS6A 4TKYA 3H93A 3E9JB 4BVXB 4IHUA 2PERA 4MF7A 5AISA 3WT1A 3R3EA 1PKWA 4K7NA 1F9MA 1Y6EA 1XWAA 3HHVA 1S3AA 2L5OA 4GWRA 2YWIA 2GZZA 2WJUA 4NV2A 4TW5A 3D4MA 3UBKA 3GSSA 3N9JA 4JR4A 3TJKA 3LORA 1WMJA 1QXHA 4IP6A 5JWRB 1QK8A 3D5JA 3US3A 3AY8A 2IMDA 4PNGA 3BD2A 1R4WA 4KX4A 3DYRA 1X9SB 1WE0A 2V32A 1T7PB 2KLXA 1YF0A 3HVVA 3EINA 3PH9A 3CSJA 1AUCA 1O7UA 2VOCA 2B1LA 4FO5A 3DXBA 3TOUA 3BCKA 1J08A 2GQKA 3VI5A 1A2JA 3LEFA 3P8WA 3I69A 4GCIA 1O81A 1PL1A 3QR6A 2HRAA 4GSNA 3QCPA 5CREA 5EL8A 3CSHA 3PR8A 2FA8A 5F8BA 1FW1A 5LD0A 1N2AA 3L78A 2E0QA 4IP1A 4DSRA 5EPFA 2XBQA 3TKSC 2OE1A 4PGTA 2HQTA 3D4TA 1M2DA 2VAFA 1MD3A 1HNAA 2C8UA 4WEYA 3FEUA 4XS4B 1YKCA 4BVYA 1WWJA 4OCFA 4I97A 1PRXA 3UVHA 1TK5B 3HJOA 2LUSA 3GX8A 1ZGNA 4MZCA 12GSA 1TKDB 5EVOA 1K0OA 4LMWA 4YQVA 3VWUA 4KW6A 4WF4A 2RUFA 1X5CA 1GRXA 3QAGA 2H1BA 2LEGA 2CV4A 3IC8A 5DCGA 4G10A 1X5EA 1MDKA 1S3CA 3UL3A 1ZCPA 5CRDA 2IMKA 4JBBA 3ZYWA 4IQ1A 1OKDA 4ZBBA 3A2VA 2YNXA 3GKXA 2VIMA 4TRXA 5G5EA 14GSA 3VLNA 3GL3A 1Z7PA 2TIRA 1YF1A 2H6ZA 3UEMA 4K8MA 4K2DA 4ECCA 2VCVA 5DDLA 4TR4A 4IVFA 4L0UA 3A2XA 3J7Yk 3GKMA 3APSA 2WGRA 5AIVA 4KSMA 5C04A 3JCML 2DJ0A 1PKZA 2A2SA 3DVWA 5IMFA 5FWGA 3CMIA 3ZMKA 5CRHA 2YV7A 3O3TA 4IW9A 3EU4A 3VI7A 3MWHA 4KCEA 4O92A 4J2FA 4NAXA 11GSA 3O6TA 1GWCA 2R2JA 1SJZA 3HKRA 1YZXA 2FWHA 1HNCA 5HR2A 1M7TA 2PBJA 4PUFC 3IV4A 4ISDA 3G9BA 5GAND 4IJ3A 5CRWA 4YAPA 1NW2A 1PX7A 3QOUA 1TK0B 2NVLA 4MA9A 4OFNA 19GSA 2VL3A 1SKRB 1X0RA 4O5RA 4AF2A 3GFKA 3GV1A 5ECSA 4V1Ag 3KTLA 2CVKA 1EOHA 3TKQA 3GL5A 3LXZA 1V2AA 4MPGA 1M2BA 3EMXA 4FIWA 2PGTA 1K3LA 1ZOFA 4KAEA 4ML1A 1I5GA 3HZ8A 4G9HA 1G0TA 1SENA 4HZ4A 2YZUA 5B8AA 2B7KA 1GSDA 4PNFA 4TVEA 1W89A 4TR3A 1DUGA 2AJQB 3TKSA 4MLYA 4BL7A 3I43A 2IFQA 3ED3A 1M9BA 1ST9A 1YKAA 3LG6A 1ML6A 2JU5A 5IO2A 1G6YA 2FNOA 3IE3A 4TN8A 2CX3A 3UMAA 1PSQA 4MF5A 1V9WA 3QMXA 1SJIA 1WP0A 2H19A 1T00A 4HU7A 1SKSB 2DJ3A 2A4VA 1ZYEA 5D73A 4BVYB 3LXTA 4FYUA 1AC1A 4MP4A 1TU8A 1A23A 2M46A 4PQ1A 1BJXA 3KH7A 4LLRA 4XCSA 3UAPA 2L57A 4EL1A 2L6DA 5J4UA 4EE0A 5HFKA 2EIOA 2YPMA 2J9HA 2R3XA 5HR3A 1KNGA 2P5QA 4P3YB 3HYPA 5HFIA 2G0FA 3WGXA 2JL4A 1USBA 2R6KA 2O8VB 3D22A 4POLA 1EP7A 2VL2C 2GZYA 5ECOB 1FHEA 1B4PA 3FY7A 3DEXA 1FOVA 4N0ZA 3U6VA 1TJDA 4PUAA 3GA4A 3C1SA 3TCOA 3GHAA 4JE1A 2DMMA 1RQMA 1VF2A 3F8UA 2MBTA 3NZNA 3IK9A 1JLVA 1EZKA 5HR0A 13GSA 1ZL9A 3BCIA 2CQ9A 2QGVA 3GURA 2PPTA 2I1UA 3APOA 1EGOA 2VCTA 5J9BA 5ECKB 3IXRA 2GGTA 2HSNB 3FZ5A 4HDEA 3WGEA 2PVQA 2M80A 1HD2A 1TTZA 1NHYA 4IQAA 1XW9A 3KP8A 2GVPA 3H4KA 2CAIA 2RIIA 4ZB8A 5KN1A 3EWLA 4YQUA 1TRSA 1T4YA 1R26A 4GSSA 2EC4A 3ZVJD 4D73A 3E3EA 2MMOA 1T8EB 1MD4A 1OC8A 3EC3A 2KOKA 4K1FA 4N11A 2LS5A 3TJFA 3TUEA 2F3MA 1V98A 5CNWA 3ERWA 6GSSA 4N30A 2VL9A 2B3SA 2VD1A 2LQOA 3A2WA 1ERUA 3TDGA 4MABA 4O7HA 3ERGA 4CDOA 3RDWA 2JSYA 4NWYA 3H1NA 2HFDA 2V1MA 1CQHA 4GXZA 3VPTA 2X8GA 5COHA 5B6MA 4FQUA 2FWEA 2C80A 3DGQA 3PGTA 1B4QA 3Q74A 3CBUA 3R2QA 3EYTA 4XHMA 3Q6OA 3ZIVA 2YV9A 3UOMA 4L5LA 2FD3A 3TJBA 2LTKA 1K0NA 2IFQB 3KEBA 2V6KA 2DIYA 1SKWB 1YY7A 3ZREA 1K3OA 2DJ2A 3CRTA 2B5YA 1OE7A 2R5GA 4MMMA 1JFUA 5DAKB 2V2GA 1NHOA 2K8SA 4H86A 3RHCA 2KHPA 1XCCA 3TRPA 18GSA 3HVXA 1F3BA 1U87A 1NSWA 5D9VA 4NMUA 3M8NA 1GL8A 2B5XA 2YP6A 2QSIA 2IMIA 4KF9A 4BPYA 3DWVA 1OVNA 1OC9A 4TR0A 3GSTA 3ZIJA 1B9XC 2VL2A 3W8SA 2TRCP 4WR4A 2FWGA 4JR6A 1G7OA 1TI1A 5ABRA 1F6MC 3UVTA 1OKTA 20GSA 2NTOA 1ERVA 1XBSA 3M9KA 3F3QA 2HT9A 1GSSA 2BJXA 2F51A 1FO5A 1SL2B 3D0ZA 2VLUA 1XWGA 3N5OA 4IS0A 4K6XA 3ZMLA 1KBNA 3BJ5A 1OYJA 5H5QA 2YWOA 2H8LA 1WPIA 1AQWA 4GLTA 4ID0A 3ZITA 2C3TA 1OE8A 5G30A 1XPVA 2ZCTA 4EO3A 4ZB6A 2RUEA 5ECQB 3GKNA 4WF5A 1WIKA 1Q98A 4F03A 2PUKC 5DALA 4NHZA 5ECRB 1UA5A 1I9DA 5F0GA 4L0WA 1YEXA 2ES7A 4POMA 1XW6A 3GKKA 5HR1A 2WRTA 1AIUA 1JHBA 2HRKB 2N5BA 3IPZA 1F2EA 3F6FA 3RPPA 1ZMAA 4D73B 5DQYA 3HVSA 4ZL8A 2LNTA 1R7HA 2OKAA 3DKSA 2MMAA 3GH6A 4HUAA 3LYPA 4ZL9A 17GSA 6GSXA 2AHEA 3A5WA 4PURA 1W4VA 2HSYA 2AV4A 2PMTA 3FKFA 1J0FA 4HS1A 4HU9A 2OE3A 1LU4A 1H4OA 1PA3A 2AB6A 1ERWA 3IC4A 3M3MA 5C00A 2B6MA 5CAXA 1B48A 1S3DA 4IJIA 5IMCA 9GSSA 2WCIA 1JZOA 2V6OA 2H76A 2H0IA 4RI7A 3H79A 4Q5NA 2L59A 5IMZA 1SD9A 5D9WA 1V40A 4EVMA 4MH3A 2RLIA 1XWKA 4G2EA 2H1GA 3PINA 1YQ1A 2WDUA 3FYGA 3ME8A 1PL2A 3S9FA 16GSA 2HI7A 5J41A 3D21A 1ACVA 2GS3A 5ECPB 2QC7A 3GMFA 2MZCA 3A3TA 3KCMA 5DCHA 2FLSA 2YJHA 3IAS2 2HZEB 2HSMA 4E8HA 1N8JA 4YH2A 2R4VA 1XVWA 2GSSA 1F3AA 4J57E 2LRCA 3ISOA 1GUKA 2JZTA 2P0GA 1MTCA 2AAWA 1OC9B 5G31A 1QUWA 1K0AA 3M0FA 1A8LA 3E0UA 1GUHA 5JCWA 3ZLPA 1LJRA 4I5QA 2IWTA 5JWOB 2K9FA 4MCUA 2LRNA 1TI3A 1JLWA 2ZUPA 2VUPA 5J3RA 2K6VA 1V58A 3LQ7A 2GDRA 1X9WB 4XTSA 4MJCA 1U88A 3NIVA 1HYUA 3Q18A 4ECJA 2O7KA 1SK1A 1FG4A 1TP9A 2PVOC 1VF1A 2EIRA 2H1AA 1TXXA 2BMXA 3H8QA 1Z6MA 1VGLA 4TOPA 4NV5A 2VCZA 3GRXA 1ON4A 4ZBDA 3FK8A 3L4NA 1SJ6A 4XIHA 3W6GA 2B5EA 1DBYA 5CP1A 1M99A 2IJYA 2G2QA 3L9UA 2VCWA 2LSTA 4EDZA 1DSBA 3KXOA 2CAQA 1Z7RA 1DE2A 1FB0A 2H0GA 3D6IA 1K0MA 2OA7A 2LJRA 2A2RA 7GSSA 5DJMA 4X1UA 2VM2A 5DAKA 3F4SA 5IOXA 2AYTA 4AGSA 3IAM2 5DALB 3F4TA 3KMNA 1THXA 1BEDA 2C4JA 1AQXA 5ECIB 3RHBA 3QD9A 4JZQA 3LWAA 2FCHA 3ZZXA 5LCZA 4XRDA 2MMZA 1ZYQB 3TOTA 4RI6A 3IRAA 5B7CA 3ZVJA 3KJYA 2DSAA 3MAKA 2OE0A 3UIWA 3FR6A 2OJLA 2PN8A 1MDIA 1XXUA 1VF3A 3HA9A 4ACSA 4TXVA 1BG5A 1TU7A 1GH2A 3L9SA 2JADA 2R37A 3VK9A 1ABAA 3QDNA 4O32A 4TXOA 4ZB9A 2C0EA 4WXTA 4OMVA 1GLQA 4KDYA 2DJJA 5GSSA 5B6NA 3TGZA 3HZ4A 2P31A 1FVJA 2LV3A 2H1DA 4MJEA 5DQSA 2D2ZA 2K18A 5LNKe 1EEJA 4IKHA 4J56E 1SYXA 1PMTA 4OD7A 1Y25A 1U3IA 2N5AA 3ERFA 5CRGA 1EEMA 4MK3A 4OFMA 3TKSE 3GN3A 2HLSA 2H70A 2H66A 1R5PA 2HSMB 2YJ7A 2HRKA 2GSQA 3SWLA 1DE1A 4GSTA 2RM6A 3C1RA 4KDXA 1R5AA 4WBRD 1XOBA 3OR5A 4POBA 4KGIA 5DVBA 3F4RA 2VO4A 1G7EA 2E2GA 1A8YA 4AJ7A 4X0XA 2IL3A 3IK7A 1XFLA 4F82A 4KSOA 2L6CA 2TRXA 2ALBA 5H5SA 5L71A 3TB2A 4BA7A 5IQYA 4JRRA 6GSTA 4CHSA 1K3YA 5G1LA 1XVQA 4L5OA 3BOAA 3LGCA 2FY6A 1IYIA 1O8XA 1YDKA 3M9JA 3KTBA 3GUSA 5AN1A 4Q5RA 3GX0A 1O73A 2FUG2 5IOWA 2GQMA 2YANA 4NHWA 3WGDA 4HQSA 1IYHA 4ZL7A 1GTUA 4V2MA 1GNEA 2GQLA 4RQRA 2IMEA 1M9AA 2XBIA 3QPMA 1OAZA 1FAAA 2I4AA 4EXJA 4EC0A 4HJ2A 4LL4B 3F3RA 5FT3A 4Z7XA 2C3QA 2FA4A 2X8HA 2XC2A 2O87A 2B1KA 2HXKA 2V41A 1ZZYA 2LNSA 2I81A 1A2LA 5ECNB
chains in the Genus database with same CATH superfamily
2X99A 3W8JA 5KOWA 2HZEA 5ELAA 2BTOT 2LJKA 5G2ZA 1Z9HA 5BMUB 1WJKA 1V57A 4K9ZA 1KEBA 2E7PA 4ICYA 3DVXA 3FZ4A 3C8EA 4Q5FA 4WKWA 4QL9A 1GTIA 3RGBC 2CVDA 4ZILA 1BYEA 3LW9A 4G0IA 4RQXA 1GTBA 4ML6A 2YN1A 5IMVA 4KNDA 3LYKA 2CT6A 3HCZA 3IA1A 2HE3A 1VRSD 2HZFA 3GH9A 1U3AA 1GULA 1TOFA 3KD0A 4QQ7A 3CTFA 2H01A 2CVBA 2YWNA 4TXOB 2YWMA 3TU3B 4W66A 2XPEA 1EOGA 3EU3A 3EPTA 3FRCA 2OADA 5AGYA 5IPGA 3CYNA 2CA8A 5KN0A 1PN9A 4HQZA 1CQGA 4AKIA 4FH8A 3HMJG 4GQCA 1TRVA 3MYDA 5CO3A 3U5RE 3F9UA 4ZXGA 1E6BA 5IMAA 4IGJA 2H75A 3LJRA 2JACA 3GTUB 2O85A 3TKPA 3TKRA 3ZL5A 5IMDA 5ELGA 1T1VA 2IN3A 4V2NA 3I6AA 1AAZA 3QAVA 3SBCA 4V1Ap 4Z2RA 2LJAA 5IIZA 2VD0A 4DSQA 3LSZA 2DIZA 4LA1A 3HY2A 1MDJA 5A5HA 3BBYA 4RUVA 2WW0A 4MF6A 3KMOA 5J47A 3KZQA 3RAZA 3QFAC 2GZPA 5JCUA 2OBKA 2M72A 2LQQA 3G7JA 5ECHB 5CYYA 1HNBA 5GAPD 1GP1A 2IIYA 2L4QA 3G7IA 2F9SA 1TDIA 4XS1A 4DVCA 1J9BA 3MSZA 1GSEA 1Q4JA 2IPAA 2REMA 3GIXA 2VLVA 4KDUA 4F0CA 1SYRA 1K0BA 3IHQA 2DJKA 2IMFA 4IN0A 3G7YA 2NPBA 2I3YA 1PD21 3HXSA 4EKZA 4YAVA 6GSYA 4GF0A 1GSQA 2GT6A 3CXGA 1O85A 3L9VA 3EMPA 4HJMA 2X64A 5DJLA 2KP1A 1JZRA 3VWVA 1VF4A 5KN2A 4OCEA 1NM3A 4I2TA 4PXOA 4AJ6A 2DKHA 2H71A 1GNWA 3DMLA 4JEDA 1RK4A 2O89A 2H1LA 5J5NA 4EF0A 4PX1A 3ZFLA 2C3NA 1XOAA 3CRUA 4IBPA 2PU9C 1AXDA 1PQNA 4MJBA 2KUCA 1TRWA 4XRAA 5A1NA 5KN3A 1GLPA 1PX6A 3J7Yb 1H75A 5JCGA 2X8CA 2VCQA 3EURA 1YJ6A 3LFLA 2H72A 2GSTA 5G5FA 4USSA 4LL1B 2LRTA 3KGKA 4V2LA 2N5FA 3KP9A 2AUVA 5AIXA 4KA0A 2WULA 2FHEA 2YCDA 5GSTA 2OBIA 4BWQA 3TRQA 4I6XA 4AKHA 5INYA 1TK8B 4IELA 4MJAA 1LBKA 1X5DA 1SK2A 4TR1A 2HYXA 1HQOA 2WS2A 4CW9A 2JSZA 3DRNA 1KTEA 5H5RA 4EDYA 2DJ1A 1K0CA 4GQFA 3DIEA 5ID2A 6GSVA 3Q19A 2I9HA 1ILOA 1XZOA 1YEPA 3P2AA 4I2UA 5A4UA 1EWXA 1OC3A 2B7JA 4DEJA 1THOA 4KE3A 1GTAA 1K0DA 2HRFA 1F37A 4KUNA 4ECIA 1SL0B 2GT5A 1T3BA 1UVZA 2KP2A 3FZAA 4O5UA 1G6WA 22GSA 1SK0A 1X9MB 1SVLA 4G0KA 1URMA 1YVLA 1A0FA 5J9CA 2HRNA 4BWSA 1GSUA 3I9V2 2NBSA 5A4WA 5D9XA 5ECLB 5F06A 4AJ8A 4WR5A 4PQHA 3O76A 4F9ZA 4G0LA 1M2AA 3FHKA 3HJPA 1A0RP 3UBLA 4E68A 4FYBA 2FGXA 3WT2A 2FWFA 2HSHA 3KH9A 3M1GA 2Z9SA 2C0GA 5EY6A 6GSWA 5JWQB 3GNJA 4FXYP 4N10A 4OFTA 5BMUA 4KB3A 4N0VA 3FR9A 5GZZB 1QFNA 1QQ2A 3IOSA 3TJJA 3FZ9A 4ILFA 1RW1A 1WRYA 1EV4A 2F8AA 3VWXA 4ULXA 3MNGA 3DD3A 4DSSA 1XW5A 1XIYA 3K8NA 4MNNA 3VFIA 3APQA 4Q5QA 3CTGA 1JZWA 4F2IA 4BVXA 3EE2A 3C7MA 2VCXA 5F07A 4NXIA 5IM9A 4WBJA 2UZ8A 2GTUA 4POKA 3VPQA 4MZBA 4HOJA 5E59A 5KEJA 5D9TA 3L0HA 3QAWA 4L8EA 4X43A 1SU9A 5A5KA 2CZ2A 3ZFBA 2GSRA 4K0GA 1ERTA 1B9YC 4GTUA 5DBQA 4K7IA 3RPNA 3ZTLA 5ENUA 1T4ZA 3FW2A 3HJMA 2RM5A 4HI7A 1PGTA 2MYGA 2NDOA 3NOFA 4F0BA 1Z6NA 3UJ1A 3GTUA 2H6YA 3ME7A 3C73A 4WETA 2DLXA 6GSUA 2P5RA 2L5LA 3F6DA 2DC5A 3IR4A 1M0UA 3HD5A 2VM1A 1A24A 2K8VA 2XHFA 4PTSA 4MZWA 3ZRDA 1GUMA 1QMVA 4AKGA 1Z3EA 2ZNMA 1U6TA 3HDCA 4JU5A 5FHIA 4KH7A 2C0FA 3KIJA 4AI6A 2MMNA 3TJGA 5HQPA 1XWBA 4KCAA 4OO5A 4LMVA 3VURA 2H73A 1GSFA 4ECBA 1JZDA 3CSIA 4ZIJA 4OWYA 1FVKA 2C0DA 1TW9A 3P90A 2H30A 4K0NA 2WFCA 4HEA2 5F05A 5D96A 5E4WA 2L4CA 2MBSA 4HZ2A 4FYCA 1BX9A 2LKUA 1O6JA 1TRUA 4MDCA 5ECMB 2CZ3A 1EV9A 5HFGA 2O3EA 3KM6A 3IBHA 4XS4A 1C72A 5G1KA 1AW9A 4TR1B 4CY6A 4G19A 3VWWA 4K7OA 2OACA 2YZHA 1AQVA 3WYWA 2WB9A 3C71A 4YQMA 5ID2B 1QGVA 3UARA 2JZRA 2C1YA 3EVIA 3P7XA 5B8BA 3IDVA 2WZ9A 4I8BA 4OO4A 1EGRA 3F0IA 2VLTA 1GSYA 2PWJA 4ZBAA 1XWCA 2ON5A 3V1WA 4EUYA 3PPUA 4QL7A 1E2YA 2H6XA 4MH2A 2CX4A 5D93A 10GSA 3TRXA 2HNLA 1BQ7A 5IO0A 1EP8A 1SL1B 2XPDA 2H74A 2J23A 3RBTA 3GYKA 1BAYA 3F63A 1MEKA 2H0HA 1UC7A 1Z5YE 2F8FA 1UN2A 1B8XA 4BL7B 4E8EA 2QKEA 4GRFA 1O8WA 8GSSA 3FR3A 4EIPA 5A4VA 1SD8A 3MDKA 1A2MA 5D8IA 2E2MA 2YOIA 2DMLA 2ON7A 2EIQA 1FB6A 2DBCA 4NPBA 4DSSB 2JZSA 4PQIA 4MPFA 1WOUA 3WD6A 3QFBC 2GLRA 5IPHA 4XS6A 4TKYA 3H93A 3E9JB 4BVXB 4IHUA 2PERA 4MF7A 5AISA 3WT1A 3R3EA 1PKWA 1S4BP 4K7NA 1F9MA 1Y6EA 1XWAA 3HHVA 1S3AA 2L5OA 4GWRA 4Z2UA 2YWIA 2GZZA 4YKGA 2WJUA 4NV2A 4TW5A 3D4MA 3UBKA 3GSSA 3N9JA 4JR4A 3TJKA 3LORA 1WMJA 1QXHA 4IP6A 4ZB7A 5JWRB 1QK8A 3D5JA 3US3A 2A2PA 3AY8A 2IMDA 3RFRC 4PNGA 3BD2A 1R4WA 4KX4A 3DYRA 1X9SB 1WE0A 2V32A 1T7PB 2KLXA 1YF0A 3HVVA 3EINA 3PH9A 3CSJA 1AUCA 1O7UA 2VOCA 2B1LA 4FO5A 3DXBA 3TOUA 3BCKA 1J08A 2GQKA 3VI5A 1A2JA 3LEFA 3P8WA 3I69A 4GCIA 1O81A 1PL1A 3QR6A 2HRAA 4GSNA 3QCPA 5CREA 5EL8A 3CSHA 3PR8A 2FA8A 5F8BA 1FW1A 2VKZG 5LD0A 1N2AA 3L78A 2E0QA 4IP1A 4DSRA 5EPFA 2XBQA 3TKSC 2OE1A 4PGTA 2WVZA 2HQTA 3D4TA 1M2DA 2VAFA 1MD3A 4A5PA 1HNAA 2C8UA 4WEYA 3FEUA 4XS4B 1YKCA 4BVYA 1WWJA 4OCFA 4I97A 1PRXA 3UVHA 1TK5B 1SVOA 3HJOA 2LUSA 3GX8A 1ZGNA 4MZCA 12GSA 4G01A 1TKDB 5EVOA 5J40A 1K0OA 4LMWA 4YQVA 3VWUA 4KW6A 4WF4A 2RUFA 1X5CA 1GRXA 3QAGA 4YKFA 2H1BA 2LEGA 2CV4A 3IC8A 5DCGA 2X49A 4G10A 1X5EA 2OT3A 1MDKA 1S3CA 3UL3A 1ZCPA 5CRDA 2IMKA 4JBBA 3ZYWA 4IQ1A 1OKDA 4ZBBA 3A2VA 1FOHA 2YNXA 3GKXA 2VIMA 4TRXA 5G5EA 14GSA 3VLNA 3GL3A 2EFHA 1Z7PA 1TXUA 2TIRA 1YF1A 2H6ZA 4AKXB 4K2DA 4K8MA 5J4VA 4ECCA 3UEMA 2VCVA 5DDLA 4TR4A 4IVFA 4L0UA 3A2XA 3J7Yk 3GKMA 3APSA 2WGRA 5AIVA 4KSMA 5C04A 3JCML 2DJ0A 1PKZA 2A2SA 1BF5A 1M3IA 3DVWA 5IMFA 5FWGA 3CMIA 3ZMKA 5CRHA 2YV7A 3O3TA 4IW9A 3EU4A 3VI7A 3MWHA 4KCEA 4O92A 5J4YA 4J2FA 4NAXA 11GSA 3O6TA 1GWCA 2R2JA 1SJZA 3HKRA 1YEWC 1YZXA 2FWHA 1HNCA 5HR2A 1M7TA 2EFDA 2PBJA 4PUFC 3IV4A 4ISDA 3G9BA 5GAND 4IJ3A 5CRWA 4YAPA 1NW2A 1PX7A 3QOUA 1TK0B 2NVLA 4MA9A 2O36A 4OFNA 19GSA 2VL3A 1SKRB 1X0RA 4O5RA 4AF2A 3GFKA 3GV1A 5ECSA 4V1Ag 3KTLA 2CVKA 1EOHA 3TKQA 3GL5A 3LXZA 1V2AA 4MPGA 1M2BA 3EMXA 4FIWA 4X4JA 2PGTA 1K3LA 1ZOFA 4KAEA 4ML1A 1I5GA 3HZ8A 4G9HA 1G0TA 1SENA 4HZ4A 2YZUA 5B8AA 2B7KA 1GSDA 4PNFA 4TVEA 1W89A 4N3ZA 4TR3A 2WVYA 1DUGA 2DKIA 2AJQB 3TKSA 4MLYA 4BL7A 3I43A 2IFQA 3ED3A 3CHXC 1M9BA 1ST9A 1YKAA 3LG6A 1ML6A 2JU5A 5IO2A 1G6YA 2FNOA 3IE3A 4TN8A 2CX3A 3UMAA 1PSQA 4MF5A 1V9WA 3IHGA 3QMXA 2EFEA 1SJIA 1WP0A 2H19A 1T00A 4HU7A 1SKSB 2DJ3A 2A4VA 4PHZC 1ZYEA 5D73A 4BVYB 3LXTA 4FYUA 1AC1A 4MP4A 1TU8A 1A23A 2M46A 4PQ1A 1BJXA 3KH7A 4LLRA 4XCSA 3UAPA 2L57A 4EL1A 2L6DA 5J4UA 4EE0A 5HFKA 2EIOA 2YPMA 2J9HA 2R3XA 5HR3A 1KNGA 2P5QA 4P3YB 3HYPA 5HFIA 2G0FA 3WGXA 2JL4A 1USBA 2R6KA 2O8VB 3D22A 4POLA 1Y1UA 1EP7A 2VL2C 2GZYA 5ECOB 1FHEA 1B4PA 3FY7A 3DEXA 1FOVA 4N0ZA 3U6VA 1TJDA 4PUAA 3GA4A 3C1SA 3TCOA 3GHAA 4PI0C 4JE1A 2DMMA 1RQMA 1VF2A 3F8UA 2MBTA 2WW1A 3NZNA 3IK9A 1JLVA 1EZKA 5HR0A 13GSA 1ZL9A 3BCIA 2CQ9A 2QGVA 2WW2A 3GURA 2PPTA 2I1UA 3APOA 1EGOA 2VCTA 5J9BA 5ECKB 3IXRA 2GGTA 2HSNB 3FZ5A 4HDEA 3WGEA 2PVQA 2M80A 1HD2A 1TTZA 1NHYA 4IQAA 1XW9A 3KP8A 2GVPA 3H4KA 2CAIA 2RIIA 4ZB8A 5KN1A 3EWLA 4YQUA 1TRSA 1T4YA 1R26A 4K2XA 4GSSA 2EC4A 3ZVJD 4D73A 3E3EA 2MMOA 1T8EB 1MD4A 1OC8A 3EC3A 2KOKA 4K1FA 4N11A 2LS5A 3TJFA 3TUEA 2F3MA 1V98A 5CNWA 3ERWA 6GSSA 1SVMA 4N30A 2VL9A 2B3SA 2VD1A 2LQOA 3A2WA 1ERUA 3TDGA 4MABA 4O7HA 3ERGA 4CDOA 3RDWA 2JSYA 4NWYA 3H1NA 2HFDA 2V1MA 1CQHA 4GXZA 3VPTA 2X8GA 5COHA 5B6MA 4FQUA 2FWEA 2C80A 3DGQA 3PGTA 1B4QA 3Q74A 3CBUA 3R2QA 3EYTA 4XHMA 2X4AA 3Q6OA 3ZIVA 2QA1A 2YV9A 4PI2C 3UOMA 4L5LA 2FD3A 3TJBA 2LTKA 1K0NA 2WW3A 2IFQB 3KEBA 2V6KA 2DIYA 1SKWB 1YY7A 3ZREA 1K3OA 2DJ2A 3CRTA 2B5YA 1OE7A 2R5GA 4MMMA 1JFUA 5DAKB 2V2GA 1NHOA 2K8SA 4H86A 3RHCA 2KHPA 1XCCA 3TRPA 18GSA 3HVXA 3HVNA 1F3BA 1U87A 1NSWA 5D9VA 4NMUA 3M8NA 1GL8A 2B5XA 2YP6A 2QSIA 2IMIA 4KF9A 4BPYA 3DWVA 1OVNA 1OC9A 2WVXA 4TR0A 1M3JA 3GSTA 3ZIJA 1B9XC 2VL2A 3W8SA 2TRCP 4WR4A 2FWGA 4JR6A 1G7OA 1TI1A 5ABRA 1F6MC 3UVTA 1OKTA 1XG8A 20GSA 2NTOA 2QA2A 1ERVA 1XBSA 3M9KA 3F3QA 2HT9A 1GSSA 2BJXA 2F51A 1FO5A 1SL2B 3D0ZA 2VLUA 1XWGA 3N5OA 4IS0A 4K6XA 3ZMLA 1KBNA 3BJ5A 1OYJA 5H5QA 2YWOA 4Z2TA 2H8LA 1WPIA 1AQWA 4GLTA 4ID0A 3ZITA 2C3TA 1OE8A 5G30A 1XPVA 2ZCTA 4EO3A 4ZB6A 4O5QA 2RUEA 5ECQB 3GKNA 4WF5A 1WIKA 1Q98A 4F03A 2PUKC 5DALA 4NHZA 5ECRB 1UA5A 1I9DA 5F0GA 4L0WA 1YEXA 2ES7A 4POMA 1XW6A 3GKKA 5HR1A 2WRTA 1AIUA 1JHBA 2HRKB 2N5BA 3IPZA 3FMWA 1F2EA 3F6FA 3RPPA 1ZMAA 4D73B 5DQYA 3HVSA 4ZL8A 1S3RA 2LNTA 1R7HA 2OKAA 3DKSA 2MMAA 3GH6A 4HUAA 3LYPA 4ZL9A 17GSA 5KOXA 6GSXA 2AHEA 3A5WA 4PURA 1W4VA 2HSYA 2AV4A 2PMTA 3FKFA 1J0FA 4EIQA 4HS1A 4HU9A 2OE3A 1LU4A 1H4OA 1PA3A 2AB6A 1ERWA 3IC4A 3M3MA 5C00A 2B6MA 5CAXA 1B48A 1S3DA 4IJIA 5IMCA 9GSSA 2WCIA 1JZOA 2V6OA 2H76A 2H0IA 4RI7A 3H79A 4Q5NA 2L59A 5IMZA 4K5RA 1SD9A 5D9WA 1V40A 4EVMA 4MH3A 2RLIA 1XWKA 4G2EA 2H1GA 1N25A 3PINA 1YQ1A 2WDUA 3FYGA 3ME8A 2UV8G 1PL2A 3S9FA 2HSNA 16GSA 2HI7A 5J41A 3D21A 1ACVA 2GS3A 5ECPB 2QC7A 3GMFA 4QMKA 2MZCA 3A3TA 3KCMA 5DCHA 2FLSA 2YJHA 4K5SA 3IAS2 2HZEB 2HSMA 4E8HA 1N8JA 4YH2A 2R4VA 1XVWA 2GSSA 1F3AA 1PFOA 4J57E 2LRCA 3ISOA 1GUKA 2JZTA 2P0GA 1MTCA 2AAWA 1OC9B 2WVXB 1BG1A 5G31A 1QUWA 1K0AA 3M0FA 1A8LA 3E0UA 1GUHA 5JCWA 3ZLPA 1LJRA 4I5QA 2IWTA 5JWOB 2K9FA 4MCUA 2LRNA 1TI3A 1JLWA 2ZUPA 2VUPA 5J3RA 2K6VA 1V58A 3LQ7A 3MIXA 2GDRA 1X9WB 4XTSA 4MJCA 1U88A 3NIVA 1HYUA 3Q18A 4ECJA 2O7KA 1SK1A 1FG4A 1TP9A 2PVOC 1VF1A 2EIRA 2H1AA 1TXXA 2BMXA 3H8QA 1Z6MA 1VGLA 4TOPA 4NV5A 2VCZA 3GRXA 1ON4A 4ZBDA 3FK8A 3L4NA 1SJ6A 4XIHA 3W6GA 2B5EA 1DBYA 5CP1A 1M99A 2IJYA 2G2QA 3L9UA 2VCWA 2LSTA 4EDZA 2R0CA 1DSBA 3KXOA 2CAQA 1Z7RA 1DE2A 2EFCA 1FB0A 2H0GA 3D6IA 1K0MA 2OA7A 2LJRA 2A2RA 7GSSA 3CQFA 5DJMA 4X1UA 2VM2A 5DAKA 3F4SA 5IOXA 2AYTA 4AGSA 3IAM2 5DALB 5A34A 3F4TA 3KMNA 1THXA 1BEDA 2C4JA 4HSCX 1AQXA 5ECIB 3RHBA 1PN0A 3QD9A 4BIKA 4JZQA 3LWAA 2FCHA 5A5HB 3ZZXA 5LCZA 4XRDA 2MMZA 1ZYQB 3TOTA 4RI6A 3IRAA 5B7CA 3ZVJA 3KJYA 2DSAA 3MAKA 2OE0A 3UIWA 3FR6A 2OJLA 2PN8A 1MDIA 1XXUA 1VF3A 3HA9A 4ACSA 4TXVA 1BG5A 1TU7A 1GH2A 3L9SA 2JADA 2R37A 3VK9A 1ABAA 3QDNA 2R0PA 4O32A 4TXOA 2R0GA 4ZB9A 2C0EA 4WXTA 4OMVA 1GLQA 4KDYA 2A4HA 2DJJA 5GSSA 5B6NA 3TGZA 3HZ4A 2P31A 1I1IP 1FVJA 2LV3A 2H1DA 4MJEA 5DQSA 4CY8A 2D2ZA 2K18A 5LNKe 1EEJA 4IKHA 4J56E 1SYXA 1PMTA 4OD7A 1Y25A 1U3IA 2N5AA 3ERFA 5CRGA 1EEMA 4MK3A 4OFMA 3TKSE 3GN3A 2HLSA 4GDFA 2H66A 2H70A 1R5PA 2HSMB 5A1NB 2YJ7A 2HRKA 2GSQA 3SWLA 1DE1A 4GSTA 2RM6A 3C1RA 4KDXA 1R5AA 4WBRD 1XOBA 3OR5A 4POBA 2WZSA 4KGIA 5DVBA 3F4RA 2VO4A 1G7EA 2E2GA 1A8YA 4AJ7A 4X0XA 2IL3A 3IK7A 1XFLA 4F82A 4KSOA 2L6CA 2TRXA 3CWGA 2ALBA 5H5SA 5L71A 3TB2A 4BA7A 5IQYA 4JRRA 6GSTA 4CHSA 1K3YA 5G1LA 1XVQA 4L5OA 3BOAA 3LGCA 2FY6A 1IYIA 2O5VA 1O8XA 5BRTA 1YDKA 3M9JA 3KTBA 3GUSA 1ZYPA 5AN1A 4Q5RA 1ZYNA 3GX0A 1O73A 2FUG2 5IOWA 2GQMA 2YANA 4NHWA 3WGDA 4HQSA 1IYHA 3A5IA 4ZL7A 1GTUA 4V2MA 1GNEA 2GQLA 4RQRA 2IMEA 1M9AA 2XBIA 3QPMA 1OAZA 1FAAA 2I4AA 4EXJA 4EC0A 4HJ2A 4LL4B 3F3RA 5FT3A 4Z7XA 2C3QA 2FA4A 2X8HA 2XC2A 2O87A 2B1KA 2HXKA 5A34B 2V41A 1ZZYA 2LNSA 2I81A 1A2LA 5ECNB
chains in the Genus database with same CATH topology
2X99A 3W8JA 5KOWA 2HZEA 5ELAA 2BTOT 2LJKA 5G2ZA 1Z9HA 5BMUB 1WJKA 1V57A 4K9ZA 1KEBA 2E7PA 4ICYA 3DVXA 3FZ4A 3C8EA 4Q5FA 4WKWA 4QL9A 1GTIA 2CVDA 4ZILA 1BYEA 3LW9A 4G0IA 4RQXA 1GTBA 4ML6A 2YN1A 5IMVA 4KNDA 3LYKA 2CT6A 3HCZA 3IA1A 2HE3A 1VRSD 2HZFA 3GH9A 1U3AA 1GULA 1TOFA 3KD0A 4QQ7A 3CTFA 2H01A 2CVBA 2YWNA 4TXOB 2YWMA 3TU3B 4W66A 2XPEA 1EOGA 3EU3A 3EPTA 3FRCA 2OADA 5AGYA 5IPGA 3CYNA 2CA8A 5KN0A 1PN9A 4HQZA 1CQGA 4AKIA 4FH8A 3HMJG 4GQCA 1TRVA 3MYDA 5CO3A 3U5RE 3F9UA 4ZXGA 1E6BA 5IMAA 4IGJA 2H75A 3LJRA 2JACA 3GTUB 2O85A 3TKPA 3TKRA 3ZL5A 5IMDA 5ELGA 1T1VA 2IN3A 4V2NA 3I6AA 1AAZA 3QAVA 3SBCA 4V1Ap 4Z2RA 2LJAA 5IIZA 2VD0A 4DSQA 3LSZA 2DIZA 4LA1A 3HY2A 1MDJA 5A5HA 3BBYA 4RUVA 4MF6A 3KMOA 5J47A 3KZQA 3RAZA 3QFAC 2GZPA 5JCUA 2OBKA 2M72A 2LQQA 3G7JA 5ECHB 5CYYA 1HNBA 5GAPD 1GP1A 2IIYA 2L4QA 3G7IA 2F9SA 1TDIA 4XS1A 4DVCA 1J9BA 3MSZA 1GSEA 1Q4JA 2IPAA 2REMA 3GIXA 2VLVA 4KDUA 4F0CA 1SYRA 1K0BA 3IHQA 2DJKA 2IMFA 4IN0A 3G7YA 2NPBA 2I3YA 1PD21 3HXSA 4EKZA 4YAVA 6GSYA 4GF0A 1GSQA 2GT6A 3CXGA 1O85A 3L9VA 3EMPA 4HJMA 2X64A 5DJLA 2KP1A 1JZRA 3VWVA 1VF4A 5KN2A 4OCEA 1NM3A 4I2TA 4PXOA 4AJ6A 2DKHA 2H71A 1GNWA 3DMLA 4JEDA 1RK4A 2O89A 2H1LA 5J5NA 4EF0A 4PX1A 3ZFLA 2C3NA 1XOAA 3CRUA 4IBPA 2PU9C 1AXDA 1PQNA 4MJBA 2KUCA 1TRWA 4XRAA 5A1NA 5KN3A 1GLPA 1PX6A 3J7Yb 1H75A 5JCGA 2X8CA 2VCQA 3EURA 1YJ6A 3LFLA 2H72A 2GSTA 5G5FA 4USSA 4LL1B 2LRTA 3KGKA 4V2LA 2N5FA 3KP9A 2AUVA 5AIXA 4KA0A 2WULA 2FHEA 2YCDA 5GSTA 2OBIA 4BWQA 3TRQA 4I6XA 4AKHA 5INYA 1TK8B 4IELA 4MJAA 1LBKA 1X5DA 1SK2A 4TR1A 2HYXA 1HQOA 2WS2A 4CW9A 2JSZA 3DRNA 1KTEA 5H5RA 4EDYA 2DJ1A 1K0CA 4GQFA 3DIEA 5ID2A 6GSVA 3Q19A 2I9HA 1ILOA 1XZOA 1YEPA 3P2AA 4I2UA 5A4UA 1EWXA 1OC3A 2B7JA 4DEJA 1THOA 4KE3A 1GTAA 1K0DA 2HRFA 1F37A 4KUNA 4ECIA 1SL0B 2GT5A 1T3BA 1UVZA 2KP2A 3FZAA 4O5UA 1G6WA 22GSA 1SK0A 1X9MB 1SVLA 4G0KA 1URMA 1YVLA 1A0FA 5J9CA 2HRNA 4BWSA 1GSUA 3I9V2 2NBSA 5A4WA 5D9XA 5ECLB 5F06A 4AJ8A 4WR5A 4PQHA 3O76A 4F9ZA 4G0LA 1M2AA 3FHKA 3HJPA 1A0RP 3UBLA 4E68A 4FYBA 2FGXA 3WT2A 2FWFA 2HSHA 3KH9A 3M1GA 2Z9SA 2C0GA 5EY6A 6GSWA 5JWQB 3GNJA 4N10A 4OFTA 5BMUA 4KB3A 4N0VA 3FR9A 5GZZB 1QFNA 1QQ2A 3IOSA 3TJJA 3FZ9A 4ILFA 1RW1A 1WRYA 1EV4A 2F8AA 3VWXA 4ULXA 3MNGA 3DD3A 4DSSA 1XW5A 1XIYA 3K8NA 4MNNA 3VFIA 3APQA 4Q5QA 3CTGA 1JZWA 4F2IA 4BVXA 3EE2A 3C7MA 2VCXA 5F07A 4NXIA 5IM9A 4WBJA 2UZ8A 2GTUA 4POKA 3VPQA 4MZBA 4HOJA 5E59A 5KEJA 5D9TA 3L0HA 3QAWA 4L8EA 4X43A 1SU9A 5A5KA 2CZ2A 3ZFBA 2GSRA 4K0GA 1ERTA 1B9YC 4GTUA 5DBQA 4K7IA 3RPNA 3ZTLA 5ENUA 1T4ZA 3FW2A 3HJMA 2RM5A 4HI7A 1PGTA 2MYGA 2NDOA 3NOFA 4F0BA 1Z6NA 3UJ1A 3GTUA 2H6YA 3ME7A 3C73A 4WETA 2DLXA 6GSUA 2P5RA 2L5LA 3F6DA 2DC5A 3IR4A 1M0UA 3HD5A 2VM1A 1A24A 2K8VA 2XHFA 4PTSA 4MZWA 3ZRDA 1GUMA 1QMVA 4AKGA 1Z3EA 2ZNMA 1U6TA 3HDCA 4JU5A 5FHIA 4KH7A 2C0FA 3KIJA 4AI6A 2MMNA 3TJGA 5HQPA 1XWBA 4KCAA 4OO5A 4LMVA 3VURA 2H73A 1GSFA 4ECBA 1JZDA 3CSIA 4ZIJA 4OWYA 1FVKA 2C0DA 1TW9A 3P90A 2H30A 4K0NA 2WFCA 4HEA2 5F05A 5D96A 5E4WA 2L4CA 2MBSA 4HZ2A 4FYCA 1BX9A 2LKUA 1O6JA 1TRUA 4MDCA 5ECMB 2CZ3A 1EV9A 5HFGA 3KM6A 3IBHA 4XS4A 1C72A 5G1KA 1AW9A 4TR1B 4CY6A 4G19A 3VWWA 4K7OA 2OACA 2YZHA 1AQVA 3WYWA 2WB9A 3C71A 4YQMA 5ID2B 1QGVA 3UARA 2JZRA 2C1YA 3EVIA 3P7XA 5B8BA 3IDVA 2WZ9A 4I8BA 4OO4A 1EGRA 3F0IA 2VLTA 1GSYA 2PWJA 4ZBAA 1XWCA 2ON5A 3V1WA 4EUYA 3PPUA 4QL7A 1E2YA 2H6XA 4MH2A 2CX4A 5D93A 10GSA 3TRXA 2HNLA 1BQ7A 5IO0A 1EP8A 1SL1B 2XPDA 2H74A 2J23A 3RBTA 3GYKA 1BAYA 3F63A 1MEKA 2H0HA 1UC7A 1Z5YE 2F8FA 1UN2A 1B8XA 4BL7B 4E8EA 2QKEA 4GRFA 1O8WA 8GSSA 3FR3A 4EIPA 5A4VA 1SD8A 3MDKA 1A2MA 5D8IA 2E2MA 2YOIA 2DMLA 2ON7A 2EIQA 1FB6A 2DBCA 4NPBA 4DSSB 2JZSA 4PQIA 4MPFA 1WOUA 3WD6A 3QFBC 2GLRA 5IPHA 4XS6A 4TKYA 3H93A 3E9JB 4BVXB 4IHUA 2PERA 4MF7A 5AISA 3WT1A 3R3EA 1PKWA 4K7NA 1F9MA 1Y6EA 1XWAA 3HHVA 1S3AA 2L5OA 4GWRA 4Z2UA 2YWIA 2GZZA 4YKGA 2WJUA 4NV2A 4TW5A 3D4MA 3UBKA 3GSSA 3N9JA 4JR4A 3TJKA 3LORA 1WMJA 1QXHA 4IP6A 4ZB7A 5JWRB 1QK8A 3D5JA 3US3A 2A2PA 3AY8A 2IMDA 4PNGA 3BD2A 1R4WA 4KX4A 3DYRA 1X9SB 1WE0A 2V32A 1T7PB 2KLXA 1YF0A 3HVVA 3EINA 3PH9A 3CSJA 1AUCA 1O7UA 2VOCA 2B1LA 4FO5A 3DXBA 3TOUA 3BCKA 1J08A 2GQKA 3VI5A 1A2JA 3LEFA 3P8WA 3I69A 4GCIA 1O81A 1PL1A 3QR6A 2HRAA 4GSNA 3QCPA 5CREA 5EL8A 3CSHA 3PR8A 2FA8A 5F8BA 1FW1A 2VKZG 5LD0A 1N2AA 3L78A 2E0QA 4IP1A 4DSRA 5EPFA 2XBQA 3TKSC 2OE1A 4PGTA 2HQTA 3D4TA 1M2DA 2VAFA 1MD3A 4A5PA 1HNAA 2C8UA 4WEYA 3FEUA 4XS4B 1YKCA 4BVYA 1WWJA 4OCFA 4I97A 1PRXA 3UVHA 1TK5B 1SVOA 3HJOA 2LUSA 3GX8A 1ZGNA 4MZCA 12GSA 4G01A 1TKDB 5EVOA 5J40A 1K0OA 4LMWA 4YQVA 3VWUA 4KW6A 4WF4A 2RUFA 1X5CA 1GRXA 3QAGA 4YKFA 2H1BA 2LEGA 2CV4A 3IC8A 5DCGA 2X49A 4G10A 1X5EA 2OT3A 1MDKA 1S3CA 3UL3A 1ZCPA 5CRDA 2IMKA 4JBBA 3ZYWA 4IQ1A 1OKDA 4ZBBA 3A2VA 1FOHA 2YNXA 3GKXA 2VIMA 4TRXA 5G5EA 14GSA 3VLNA 3GL3A 2EFHA 1Z7PA 1TXUA 2TIRA 1YF1A 2H6ZA 4AKXB 4K2DA 4K8MA 5J4VA 4ECCA 3UEMA 2VCVA 5DDLA 4TR4A 4IVFA 4L0UA 3A2XA 3J7Yk 3GKMA 3APSA 2WGRA 5AIVA 4KSMA 5C04A 3JCML 2DJ0A 1PKZA 2A2SA 1BF5A 3DVWA 5IMFA 5FWGA 3CMIA 3ZMKA 5CRHA 2YV7A 3O3TA 4IW9A 3EU4A 3VI7A 3MWHA 4KCEA 4O92A 5J4YA 4J2FA 4NAXA 11GSA 3O6TA 1GWCA 2R2JA 1SJZA 3HKRA 1YZXA 2FWHA 1HNCA 5HR2A 1M7TA 2EFDA 2PBJA 4PUFC 3IV4A 4ISDA 3G9BA 5GAND 4IJ3A 5CRWA 4YAPA 1NW2A 1PX7A 3QOUA 1TK0B 2NVLA 4MA9A 4OFNA 19GSA 2VL3A 1SKRB 1X0RA 4O5RA 4AF2A 3GFKA 3GV1A 5ECSA 4V1Ag 3KTLA 2CVKA 1EOHA 3TKQA 3GL5A 3LXZA 1V2AA 4MPGA 1M2BA 3EMXA 4FIWA 4X4JA 2PGTA 1K3LA 1ZOFA 4KAEA 4ML1A 1I5GA 3HZ8A 4G9HA 1G0TA 1SENA 4HZ4A 2YZUA 5B8AA 2B7KA 1GSDA 4PNFA 4TVEA 1W89A 4N3ZA 4TR3A 1DUGA 2DKIA 2AJQB 3TKSA 4MLYA 4BL7A 3I43A 2IFQA 3ED3A 1M9BA 1ST9A 1YKAA 3LG6A 1ML6A 2JU5A 5IO2A 1G6YA 2FNOA 3IE3A 4TN8A 2CX3A 3UMAA 1PSQA 4MF5A 1V9WA 3IHGA 3QMXA 2EFEA 1SJIA 1WP0A 2H19A 1T00A 4HU7A 1SKSB 2DJ3A 2A4VA 1ZYEA 5D73A 4BVYB 3LXTA 4FYUA 1AC1A 4MP4A 1TU8A 1A23A 2M46A 4PQ1A 1BJXA 3KH7A 4LLRA 4XCSA 3UAPA 2L57A 4EL1A 2L6DA 5J4UA 4EE0A 5HFKA 2EIOA 2YPMA 2J9HA 2R3XA 5HR3A 1KNGA 2P5QA 4P3YB 3HYPA 5HFIA 2G0FA 3WGXA 2JL4A 1USBA 2R6KA 2O8VB 3D22A 4POLA 1Y1UA 1EP7A 2VL2C 2GZYA 5ECOB 1FHEA 1B4PA 3FY7A 3DEXA 1FOVA 4N0ZA 3U6VA 1TJDA 4PUAA 3GA4A 3C1SA 3TCOA 3GHAA 4JE1A 2DMMA 1RQMA 1VF2A 3F8UA 2MBTA 3NZNA 3IK9A 1JLVA 1EZKA 5HR0A 13GSA 1ZL9A 3BCIA 2CQ9A 2QGVA 3GURA 2PPTA 2I1UA 3APOA 1EGOA 2VCTA 5J9BA 5ECKB 3IXRA 2GGTA 2HSNB 3FZ5A 4HDEA 3WGEA 2PVQA 2M80A 1HD2A 1TTZA 1NHYA 4IQAA 1XW9A 3KP8A 2GVPA 3H4KA 2CAIA 2RIIA 4ZB8A 5KN1A 3EWLA 4YQUA 1TRSA 1T4YA 1R26A 4K2XA 4GSSA 2EC4A 3ZVJD 4D73A 3E3EA 2MMOA 1T8EB 1MD4A 1OC8A 3EC3A 2KOKA 4K1FA 4N11A 2LS5A 3TJFA 3TUEA 2F3MA 1V98A 5CNWA 3ERWA 6GSSA 1SVMA 4N30A 2VL9A 2B3SA 2VD1A 2LQOA 3A2WA 1ERUA 3TDGA 4MABA 4O7HA 3ERGA 4CDOA 3RDWA 2JSYA 4NWYA 3H1NA 2HFDA 2V1MA 1CQHA 4GXZA 3VPTA 2X8GA 5COHA 5B6MA 4FQUA 2FWEA 2C80A 3DGQA 3PGTA 1B4QA 3Q74A 3CBUA 3R2QA 3EYTA 4XHMA 2X4AA 3Q6OA 3ZIVA 2QA1A 2YV9A 3UOMA 4L5LA 2FD3A 3TJBA 2LTKA 1K0NA 2IFQB 3KEBA 2V6KA 2DIYA 1SKWB 1YY7A 3ZREA 1K3OA 2DJ2A 3CRTA 2B5YA 1OE7A 2R5GA 4MMMA 1JFUA 5DAKB 2V2GA 1NHOA 2K8SA 4H86A 3RHCA 2KHPA 1XCCA 3TRPA 18GSA 3HVXA 1F3BA 1U87A 1NSWA 5D9VA 4NMUA 3M8NA 1GL8A 2B5XA 2YP6A 2QSIA 2IMIA 4KF9A 4BPYA 3DWVA 1OVNA 1OC9A 4TR0A 3GSTA 3ZIJA 1B9XC 2VL2A 3W8SA 2TRCP 4WR4A 2FWGA 4JR6A 1G7OA 1TI1A 5ABRA 1F6MC 3UVTA 1OKTA 20GSA 2NTOA 2QA2A 1ERVA 1XBSA 3M9KA 3F3QA 2HT9A 1GSSA 2BJXA 2F51A 1FO5A 1SL2B 3D0ZA 2VLUA 1XWGA 3N5OA 4IS0A 4K6XA 3ZMLA 1KBNA 3BJ5A 1OYJA 5H5QA 2YWOA 4Z2TA 2H8LA 1WPIA 1AQWA 4GLTA 4ID0A 3ZITA 2C3TA 1OE8A 5G30A 1XPVA 2ZCTA 4EO3A 4ZB6A 4O5QA 2RUEA 5ECQB 3GKNA 4WF5A 1WIKA 1Q98A 4F03A 2PUKC 5DALA 4NHZA 5ECRB 1UA5A 1I9DA 5F0GA 4L0WA 1YEXA 2ES7A 4POMA 1XW6A 3GKKA 5HR1A 2WRTA 1AIUA 1JHBA 2HRKB 2N5BA 3IPZA 3FMWA 1F2EA 3F6FA 3RPPA 1ZMAA 4D73B 5DQYA 3HVSA 4ZL8A 2LNTA 1R7HA 2OKAA 3DKSA 2MMAA 3GH6A 4HUAA 3LYPA 4ZL9A 17GSA 5KOXA 6GSXA 2AHEA 3A5WA 4PURA 1W4VA 2HSYA 2AV4A 2PMTA 3FKFA 1J0FA 4EIQA 4HS1A 4HU9A 2OE3A 1LU4A 1H4OA 1PA3A 2AB6A 1ERWA 3IC4A 3M3MA 5C00A 2B6MA 5CAXA 1B48A 1S3DA 4IJIA 5IMCA 9GSSA 2WCIA 1JZOA 2V6OA 2H76A 2H0IA 4RI7A 3H79A 4Q5NA 2L59A 5IMZA 4K5RA 1SD9A 5D9WA 1V40A 4EVMA 4MH3A 2RLIA 1XWKA 4G2EA 2H1GA 1N25A 3PINA 1YQ1A 2WDUA 3FYGA 3ME8A 2UV8G 1PL2A 3S9FA 2HSNA 16GSA 2HI7A 5J41A 3D21A 1ACVA 2GS3A 5ECPB 2QC7A 3GMFA 4QMKA 2MZCA 3A3TA 3KCMA 5DCHA 2FLSA 2YJHA 4K5SA 3IAS2 2HZEB 2HSMA 4E8HA 1N8JA 4YH2A 2R4VA 1XVWA 2GSSA 1F3AA 4J57E 2LRCA 3ISOA 1GUKA 2JZTA 2P0GA 1MTCA 2AAWA 1OC9B 1BG1A 5G31A 1QUWA 1K0AA 3M0FA 1A8LA 3E0UA 1GUHA 5JCWA 3ZLPA 1LJRA 4I5QA 2IWTA 5JWOB 2K9FA 4MCUA 2LRNA 1TI3A 1JLWA 2ZUPA 2VUPA 5J3RA 2K6VA 1V58A 3LQ7A 3MIXA 2GDRA 1X9WB 4XTSA 4MJCA 1U88A 3NIVA 1HYUA 3Q18A 4ECJA 2O7KA 1SK1A 1FG4A 1TP9A 2PVOC 1VF1A 2EIRA 2H1AA 1TXXA 2BMXA 3H8QA 1Z6MA 1VGLA 4TOPA 4NV5A 2VCZA 3GRXA 1ON4A 4ZBDA 3FK8A 3L4NA 1SJ6A 4XIHA 3W6GA 2B5EA 1DBYA 5CP1A 1M99A 2IJYA 2G2QA 3L9UA 2VCWA 2LSTA 4EDZA 2R0CA 1DSBA 3KXOA 2CAQA 1Z7RA 1DE2A 2EFCA 1FB0A 2H0GA 3D6IA 1K0MA 2OA7A 2LJRA 2A2RA 7GSSA 5DJMA 4X1UA 2VM2A 5DAKA 3F4SA 5IOXA 2AYTA 4AGSA 3IAM2 5DALB 5A34A 3F4TA 3KMNA 1THXA 1BEDA 2C4JA 1AQXA 5ECIB 3RHBA 1PN0A 3QD9A 4JZQA 3LWAA 2FCHA 5A5HB 3ZZXA 5LCZA 4XRDA 2MMZA 1ZYQB 3TOTA 4RI6A 3IRAA 5B7CA 3ZVJA 3KJYA 2DSAA 3MAKA 2OE0A 3UIWA 3FR6A 2OJLA 2PN8A 1MDIA 1XXUA 1VF3A 3HA9A 4ACSA 4TXVA 1BG5A 1TU7A 1GH2A 3L9SA 2JADA 2R37A 3VK9A 1ABAA 3QDNA 2R0PA 4O32A 4TXOA 2R0GA 4ZB9A 2C0EA 4WXTA 4OMVA 1GLQA 4KDYA 2A4HA 2DJJA 5GSSA 5B6NA 3TGZA 3HZ4A 2P31A 1FVJA 2LV3A 2H1DA 4MJEA 5DQSA 4CY8A 2D2ZA 2K18A 5LNKe 1EEJA 4IKHA 4J56E 1SYXA 1PMTA 4OD7A 1Y25A 1U3IA 2N5AA 3ERFA 5CRGA 1EEMA 4MK3A 4OFMA 3TKSE 3GN3A 2HLSA 4GDFA 2H66A 2H70A 1R5PA 2HSMB 5A1NB 2YJ7A 2HRKA 2GSQA 3SWLA 1DE1A 4GSTA 2RM6A 3C1RA 4KDXA 1R5AA 4WBRD 1XOBA 3OR5A 4POBA 4KGIA 5DVBA 3F4RA 2VO4A 1G7EA 2E2GA 1A8YA 4AJ7A 4X0XA 2IL3A 3IK7A 1XFLA 4F82A 4KSOA 2L6CA 2TRXA 3CWGA 2ALBA 5H5SA 5L71A 3TB2A 4BA7A 5IQYA 4JRRA 6GSTA 4CHSA 1K3YA 5G1LA 1XVQA 4L5OA 3BOAA 3LGCA 2FY6A 1IYIA 2O5VA 1O8XA 5BRTA 3M9JA 1YDKA 3KTBA 3GUSA 1ZYPA 5AN1A 4Q5RA 1ZYNA 3GX0A 1O73A 2FUG2 5IOWA 2GQMA 2YANA 4NHWA 3WGDA 4HQSA 1IYHA 3A5IA 4ZL7A 1GTUA 4V2MA 1GNEA 2GQLA 4RQRA 2IMEA 1M9AA 2XBIA 3QPMA 1OAZA 1FAAA 2I4AA 4EXJA 4EC0A 4HJ2A 4LL4B 3F3RA 5FT3A 4Z7XA 2C3QA 2FA4A 2X8HA 2XC2A 2O87A 2B1KA 2HXKA 5A34B 2V41A 1ZZYA 2LNSA 2I81A 1A2LA 5ECNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X99 A;  3W8J A;  2HZE A;  5ELA A;  2BTO T;  2LJK A;  5G2Z A;  1Z9H A;  1WJK A;  1V57 A;  4K9Z A;  1KEB A;  2E7P A;  3DVX A;  3FZ4 A;  3C8E A;  4Q5F A;  4WKW A;  4QL9 A;  1GTI A;  2CVD A;  4ZIL A;  1BYE A;  4G0I A;  4RQX A;  1GTB A;  4ML6 A;  2YN1 A;  5IMV A;  4KND A;  3LYK A;  2CT6 A;  3HCZ A;  3IA1 A;  2HE3 A;  1VRS D;  2HZF A;  3GH9 A;  1U3A A;  1GUL A;  1TOF A;  3KD0 A;  4QQ7 A;  3CTF A;  2H01 A;  2CVB A;  2YWN A;  4TXO B;  2YWM A;  2XPE A;  1EOG A;  3EU3 A;  3FRC A;  2OAD A;  5AGY A;  5IPG A;  3CYN A;  2CA8 A;  5KN0 A;  1PN9 A;  4HQZ A;  1CQG A;  4FH8 A;  4GQC A;  1TRV A;  5CO3 A;  3U5R E;  3F9U A;  4ZXG A;  1E6B A;  5IMA A;  4IGJ A;  2H75 A;  3LJR A;  2JAC A;  3GTU B;  2O85 A;  3TKP A;  3TKR A;  3ZL5 A;  5IMD A;  5ELG A;  1T1V A;  2IN3 A;  4V2N A;  3I6A A;  1AAZ A;  3QAV A;  3SBC A;  4V1A p;  2LJA A;  5IIZ A;  2VD0 A;  4DSQ A;  3LSZ A;  2DIZ A;  4LA1 A;  3HY2 A;  1MDJ A;  3BBY A;  4RUV A;  4MF6 A;  3KMO A;  3KZQ A;  3RAZ A;  3QFA C;  2GZP A;  5JCU A;  2OBK A;  2M72 A;  2LQQ A;  3G7J A;  5ECH B;  5CYY A;  1HNB A;  5GAP D;  1GP1 A;  2IIY A;  2L4Q A;  3G7I A;  2F9S A;  1TDI A;  4XS1 A;  4DVC A;  1J9B A;  3MSZ A;  1GSE A;  1Q4J A;  2IPA A;  2REM A;  3GIX A;  2VLV A;  4KDU A;  4F0C A;  1SYR A;  1K0B A;  3IHQ A;  2DJK A;  2IMF A;  4IN0 A;  3G7Y A;  2NPB A;  2I3Y A;  1PD2 1;  3HXS A;  4EKZ A;  4YAV A;  6GSY A;  4GF0 A;  1GSQ A;  2GT6 A;  3CXG A;  1O85 A;  3L9V A;  3EMP A;  4HJM A;  2X64 A;  5DJL A;  2KP1 A;  1JZR A;  3VWV A;  1VF4 A;  5KN2 A;  4OCE A;  1NM3 A;  4I2T A;  4PXO A;  4AJ6 A;  2H71 A;  1GNW A;  3DML A;  4JED A;  1RK4 A;  2O89 A;  5J5N A;  4EF0 A;  4PX1 A;  3ZFL A;  2C3N A;  1XOA A;  3CRU A;  4IBP A;  2PU9 C;  1AXD A;  1PQN A;  4MJB A;  2KUC A;  1TRW A;  4XRA A;  5KN3 A;  1GLP A;  1PX6 A;  3J7Y b;  1H75 A;  5JCG A;  2X8C A;  2VCQ A;  3EUR A;  1YJ6 A;  3LFL A;  2H72 A;  2GST A;  5G5F A;  4USS A;  4LL1 B;  2LRT A;  3KGK A;  4V2L A;  2N5F A;  3KP9 A;  2AUV A;  5AIX A;  4KA0 A;  2WUL A;  2FHE A;  2YCD A;  5GST A;  2OBI A;  4BWQ A;  3TRQ A;  4I6X A;  5INY A;  1TK8 B;  4IEL A;  4MJA A;  1LBK A;  1X5D A;  1SK2 A;  4TR1 A;  2HYX A;  1HQO A;  2WS2 A;  4CW9 A;  2JSZ A;  3DRN A;  1KTE A;  5H5R A;  4EDY A;  2DJ1 A;  1K0C A;  4GQF A;  3DIE A;  5ID2 A;  6GSV A;  3Q19 A;  2I9H A;  1ILO A;  1XZO A;  1YEP A;  3P2A A;  4I2U A;  5A4U A;  1EWX A;  1OC3 A;  2B7J A;  4DEJ A;  1THO A;  4KE3 A;  1GTA A;  1K0D A;  2HRF A;  1F37 A;  4KUN A;  4ECI A;  1SL0 B;  2GT5 A;  1T3B A;  1UVZ A;  2KP2 A;  3FZA A;  1G6W A;  22GS A;  1SK0 A;  1X9M B;  4G0K A;  1URM A;  1A0F A;  5J9C A;  2HRN A;  4BWS A;  1GSU A;  3I9V 2;  2NBS A;  5A4W A;  5D9X A;  5ECL B;  5F06 A;  4AJ8 A;  4WR5 A;  4PQH A;  3O76 A;  4F9Z A;  4G0L A;  1M2A A;  3FHK A;  3HJP A;  1A0R P;  3UBL A;  4FYB A;  2FGX A;  3WT2 A;  2FWF A;  2HSH A;  3KH9 A;  3M1G A;  2Z9S A;  2C0G A;  5EY6 A;  6GSW A;  5JWQ B;  3GNJ A;  4N10 A;  4OFT A;  5BMU A;  4KB3 A;  4N0V A;  3FR9 A;  5GZZ B;  1QFN A;  1QQ2 A;  3IOS A;  3TJJ A;  3FZ9 A;  4ILF A;  1RW1 A;  1WRY A;  1EV4 A;  2F8A A;  3VWX A;  4ULX A;  3MNG A;  3DD3 A;  4DSS A;  1XW5 A;  1XIY A;  3K8N A;  3VFI A;  3APQ A;  4Q5Q A;  3CTG A;  1JZW A;  4F2I A;  4BVX A;  3EE2 A;  3C7M A;  2VCX A;  5F07 A;  4NXI A;  5IM9 A;  4WBJ A;  2UZ8 A;  2GTU A;  4POK A;  3VPQ A;  4MZB A;  4HOJ A;  5E59 A;  5KEJ A;  5D9T A;  3L0H A;  3QAW A;  4L8E A;  4X43 A;  1SU9 A;  5A5K A;  2CZ2 A;  3ZFB A;  2GSR A;  4K0G A;  1ERT A;  1B9Y C;  4GTU A;  5DBQ A;  4K7I A;  3RPN A;  3ZTL A;  5ENU A;  1T4Z A;  3FW2 A;  3HJM A;  2RM5 A;  4HI7 A;  1PGT A;  2MYG A;  2NDO A;  3NOF A;  4F0B A;  1Z6N A;  3UJ1 A;  3GTU A;  2H6Y A;  3ME7 A;  3C73 A;  4WET A;  2DLX A;  6GSU A;  2P5R A;  2L5L A;  3F6D A;  2DC5 A;  3IR4 A;  1M0U A;  3HD5 A;  2VM1 A;  1A24 A;  2K8V A;  2XHF A;  4PTS A;  4MZW A;  3ZRD A;  1GUM A;  1QMV A;  1Z3E A;  2ZNM A;  1U6T A;  3HDC A;  4JU5 A;  5FHI A;  4KH7 A;  2C0F A;  3KIJ A;  2MMN A;  3TJG A;  5HQP A;  1XWB A;  4KCA A;  4OO5 A;  4LMV A;  3VUR A;  2H73 A;  1GSF A;  4ECB A;  1JZD A;  3CSI A;  4ZIJ A;  4OWY A;  1FVK A;  2C0D A;  1TW9 A;  3P90 A;  2H30 A;  4K0N A;  2WFC A;  4HEA 2;  5F05 A;  5D96 A;  5E4W A;  2L4C A;  2MBS A;  4HZ2 A;  4FYC A;  1BX9 A;  2LKU A;  1O6J A;  1TRU A;  4MDC A;  5ECM B;  2CZ3 A;  1EV9 A;  5HFG A;  3KM6 A;  3IBH A;  4XS4 A;  1C72 A;  5G1K A;  1AW9 A;  4TR1 B;  4G19 A;  3VWW A;  4K7O A;  2OAC A;  2YZH A;  1AQV A;  3WYW A;  2WB9 A;  3C71 A;  4YQM A;  5ID2 B;  1QGV A;  3UAR A;  2JZR A;  2C1Y A;  3EVI A;  3P7X A;  5B8B A;  3IDV A;  2WZ9 A;  4I8B A;  4OO4 A;  1EGR A;  3F0I A;  2VLT A;  1GSY A;  2PWJ A;  4ZBA A;  1XWC A;  2ON5 A;  3V1W A;  4EUY A;  3PPU A;  4QL7 A;  1E2Y A;  2H6X A;  4MH2 A;  2CX4 A;  5D93 A;  10GS A;  3TRX A;  2HNL A;  1BQ7 A;  5IO0 A;  1EP8 A;  1SL1 B;  2XPD A;  2H74 A;  2J23 A;  3RBT A;  3GYK A;  1BAY A;  3F63 A;  1MEK A;  2H0H A;  1UC7 A;  1Z5Y E;  2F8F A;  1UN2 A;  1B8X A;  4BL7 B;  4E8E A;  2QKE A;  4GRF A;  1O8W A;  8GSS A;  3FR3 A;  5A4V A;  1SD8 A;  3MDK A;  1A2M A;  5D8I A;  2E2M A;  2YOI A;  2DML A;  2ON7 A;  2EIQ A;  1FB6 A;  2DBC A;  4NPB A;  4DSS B;  2JZS A;  4PQI A;  4MPF A;  1WOU A;  3WD6 A;  3QFB C;  2GLR A;  5IPH A;  4XS6 A;  4TKY A;  3H93 A;  3E9J B;  4BVX B;  4IHU A;  2PER A;  4MF7 A;  5AIS A;  3WT1 A;  3R3E A;  1PKW A;  4K7N A;  1F9M A;  1Y6E A;  1XWA A;  3HHV A;  1S3A A;  2L5O A;  4GWR A;  2YWI A;  2GZZ A;  2WJU A;  4NV2 A;  4TW5 A;  3D4M A;  3UBK A;  3GSS A;  3N9J A;  4JR4 A;  3TJK A;  3LOR A;  1WMJ A;  1QXH A;  4IP6 A;  5JWR B;  1QK8 A;  3D5J A;  3US3 A;  3AY8 A;  2IMD A;  4PNG A;  3BD2 A;  1R4W A;  4KX4 A;  3DYR A;  1X9S B;  1WE0 A;  2V32 A;  1T7P B;  2KLX A;  1YF0 A;  3HVV A;  3EIN A;  3PH9 A;  3CSJ A;  1AUC A;  1O7U A;  2VOC A;  2B1L A;  4FO5 A;  3DXB A;  3TOU A;  3BCK A;  1J08 A;  2GQK A;  3VI5 A;  1A2J A;  3LEF A;  3P8W A;  3I69 A;  4GCI A;  1O81 A;  1PL1 A;  3QR6 A;  2HRA A;  4GSN A;  3QCP A;  5CRE A;  5EL8 A;  3CSH A;  3PR8 A;  2FA8 A;  5F8B A;  1FW1 A;  5LD0 A;  1N2A A;  3L78 A;  2E0Q A;  4IP1 A;  4DSR A;  5EPF A;  2XBQ A;  3TKS C;  2OE1 A;  4PGT A;  2HQT A;  3D4T A;  1M2D A;  2VAF A;  1MD3 A;  1HNA A;  2C8U A;  4WEY A;  3FEU A;  4XS4 B;  1YKC A;  4BVY A;  1WWJ A;  4OCF A;  4I97 A;  1PRX A;  3UVH A;  1TK5 B;  3HJO A;  2LUS A;  3GX8 A;  1ZGN A;  4MZC A;  12GS A;  1TKD B;  5EVO A;  1K0O A;  4LMW A;  4YQV A;  3VWU A;  4KW6 A;  4WF4 A;  2RUF A;  1X5C A;  1GRX A;  3QAG A;  2H1B A;  2LEG A;  2CV4 A;  3IC8 A;  5DCG A;  4G10 A;  1X5E A;  1MDK A;  1S3C A;  3UL3 A;  1ZCP A;  5CRD A;  2IMK A;  4JBB A;  3ZYW A;  4IQ1 A;  1OKD A;  4ZBB A;  3A2V A;  2YNX A;  3GKX A;  2VIM A;  4TRX A;  5G5E A;  14GS A;  3VLN A;  3GL3 A;  1Z7P A;  2TIR A;  1YF1 A;  2H6Z A;  3UEM A;  4K8M A;  4K2D A;  4ECC A;  2VCV A;  5DDL A;  4TR4 A;  4IVF A;  4L0U A;  3A2X A;  3J7Y k;  3GKM A;  3APS A;  2WGR A;  5AIV A;  4KSM A;  5C04 A;  3JCM L;  2DJ0 A;  1PKZ A;  2A2S A;  3DVW A;  5IMF A;  5FWG A;  3CMI A;  3ZMK A;  5CRH A;  2YV7 A;  3O3T A;  4IW9 A;  3EU4 A;  3VI7 A;  3MWH A;  4KCE A;  4O92 A;  4J2F A;  4NAX A;  11GS A;  3O6T A;  1GWC A;  2R2J A;  1SJZ A;  3HKR A;  1YZX A;  2FWH A;  1HNC A;  5HR2 A;  1M7T A;  2PBJ A;  4PUF C;  3IV4 A;  4ISD A;  3G9B A;  5GAN D;  4IJ3 A;  5CRW A;  4YAP A;  1NW2 A;  1PX7 A;  3QOU A;  1TK0 B;  2NVL A;  4MA9 A;  4OFN A;  19GS A;  2VL3 A;  1SKR B;  1X0R A;  4O5R A;  4AF2 A;  3GFK A;  3GV1 A;  5ECS A;  4V1A g;  3KTL A;  2CVK A;  1EOH A;  3TKQ A;  3GL5 A;  3LXZ A;  1V2A A;  4MPG A;  1M2B A;  3EMX A;  4FIW A;  2PGT A;  1K3L A;  1ZOF A;  4KAE A;  4ML1 A;  1I5G A;  3HZ8 A;  4G9H A;  1G0T A;  1SEN A;  4HZ4 A;  2YZU A;  5B8A A;  2B7K A;  1GSD A;  4PNF A;  4TVE A;  1W89 A;  4TR3 A;  1DUG A;  2AJQ B;  3TKS A;  4MLY A;  4BL7 A;  3I43 A;  2IFQ A;  3ED3 A;  1M9B A;  1ST9 A;  1YKA A;  3LG6 A;  1ML6 A;  2JU5 A;  5IO2 A;  1G6Y A;  2FNO A;  3IE3 A;  4TN8 A;  2CX3 A;  3UMA A;  1PSQ A;  4MF5 A;  1V9W A;  3QMX A;  1SJI A;  1WP0 A;  2H19 A;  1T00 A;  4HU7 A;  1SKS B;  2DJ3 A;  2A4V A;  1ZYE A;  5D73 A;  4BVY B;  3LXT A;  4FYU A;  1AC1 A;  4MP4 A;  1TU8 A;  1A23 A;  2M46 A;  4PQ1 A;  1BJX A;  3KH7 A;  4LLR A;  4XCS A;  3UAP A;  2L57 A;  4EL1 A;  2L6D A;  5J4U A;  4EE0 A;  5HFK A;  2EIO A;  2YPM A;  2J9H A;  2R3X A;  5HR3 A;  1KNG A;  2P5Q A;  4P3Y B;  3HYP A;  5HFI A;  2G0F A;  3WGX A;  2JL4 A;  1USB A;  2R6K A;  2O8V B;  3D22 A;  4POL A;  1EP7 A;  2VL2 C;  2GZY A;  5ECO B;  1FHE A;  1B4P A;  3FY7 A;  3DEX A;  1FOV A;  4N0Z A;  3U6V A;  1TJD A;  4PUA A;  3GA4 A;  3C1S A;  3TCO A;  3GHA A;  4JE1 A;  2DMM A;  1RQM A;  1VF2 A;  3F8U A;  2MBT A;  3NZN A;  3IK9 A;  1JLV A;  1EZK A;  5HR0 A;  13GS A;  1ZL9 A;  3BCI A;  2CQ9 A;  2QGV A;  3GUR A;  2PPT A;  2I1U A;  3APO A;  1EGO A;  2VCT A;  5J9B A;  5ECK B;  3IXR A;  2GGT A;  2HSN B;  3FZ5 A;  4HDE A;  3WGE A;  2PVQ A;  2M80 A;  1HD2 A;  1TTZ A;  1NHY A;  4IQA A;  1XW9 A;  3KP8 A;  2GVP A;  3H4K A;  2CAI A;  2RII A;  4ZB8 A;  5KN1 A;  3EWL A;  4YQU A;  1TRS A;  1T4Y A;  1R26 A;  4GSS A;  2EC4 A;  3ZVJ D;  4D73 A;  3E3E A;  2MMO A;  1T8E B;  1MD4 A;  1OC8 A;  3EC3 A;  2KOK A;  4K1F A;  4N11 A;  2LS5 A;  3TJF A;  3TUE A;  2F3M A;  1V98 A;  5CNW A;  3ERW A;  6GSS A;  4N30 A;  2VL9 A;  2B3S A;  2VD1 A;  2LQO A;  3A2W A;  1ERU A;  3TDG A;  4MAB A;  4O7H A;  3ERG A;  4CDO A;  3RDW A;  2JSY A;  4NWY A;  3H1N A;  2HFD A;  2V1M A;  1CQH A;  4GXZ A;  3VPT A;  2X8G A;  5COH A;  5B6M A;  4FQU A;  2FWE A;  2C80 A;  3DGQ A;  3PGT A;  1B4Q A;  3Q74 A;  3CBU A;  3R2Q A;  3EYT A;  4XHM A;  3Q6O A;  3ZIV A;  2YV9 A;  3UOM A;  4L5L A;  2FD3 A;  3TJB A;  2LTK A;  1K0N A;  2IFQ B;  3KEB A;  2V6K A;  2DIY A;  1SKW B;  1YY7 A;  3ZRE A;  1K3O A;  2DJ2 A;  3CRT A;  2B5Y A;  1OE7 A;  2R5G A;  4MMM A;  1JFU A;  5DAK B;  2V2G A;  1NHO A;  2K8S A;  4H86 A;  3RHC A;  2KHP A;  1XCC A;  3TRP A;  18GS A;  3HVX A;  1F3B A;  1U87 A;  1NSW A;  5D9V A;  4NMU A;  3M8N A;  1GL8 A;  2B5X A;  2YP6 A;  2QSI A;  2IMI A;  4KF9 A;  4BPY A;  3DWV A;  1OVN A;  1OC9 A;  4TR0 A;  3GST A;  3ZIJ A;  1B9X C;  2VL2 A;  3W8S A;  2TRC P;  4WR4 A;  2FWG A;  4JR6 A;  1G7O A;  1TI1 A;  5ABR A;  1F6M C;  3UVT A;  1OKT A;  20GS A;  2NTO A;  1ERV A;  1XBS A;  3M9K A;  3F3Q A;  2HT9 A;  1GSS A;  2BJX A;  2F51 A;  1FO5 A;  1SL2 B;  3D0Z A;  2VLU A;  1XWG A;  3N5O A;  4IS0 A;  4K6X A;  3ZML A;  1KBN A;  3BJ5 A;  1OYJ A;  5H5Q A;  2YWO A;  2H8L A;  1WPI A;  1AQW A;  4GLT A;  4ID0 A;  3ZIT A;  2C3T A;  1OE8 A;  5G30 A;  1XPV A;  2ZCT A;  4EO3 A;  4ZB6 A;  2RUE A;  5ECQ B;  3GKN A;  4WF5 A;  1WIK A;  1Q98 A;  4F03 A;  2PUK C;  5DAL A;  4NHZ A;  5ECR B;  1UA5 A;  1I9D A;  5F0G A;  4L0W A;  1YEX A;  2ES7 A;  4POM A;  1XW6 A;  3GKK A;  5HR1 A;  2WRT A;  1AIU A;  1JHB A;  2HRK B;  2N5B A;  3IPZ A;  1F2E A;  3F6F A;  3RPP A;  1ZMA A;  4D73 B;  5DQY A;  3HVS A;  4ZL8 A;  2LNT A;  1R7H A;  2OKA A;  3DKS A;  2MMA A;  3GH6 A;  4HUA A;  3LYP A;  4ZL9 A;  17GS A;  6GSX A;  2AHE A;  3A5W A;  4PUR A;  1W4V A;  2HSY A;  2AV4 A;  2PMT A;  3FKF A;  1J0F A;  4HS1 A;  4HU9 A;  2OE3 A;  1LU4 A;  1H4O A;  1PA3 A;  2AB6 A;  1ERW A;  3IC4 A;  3M3M A;  5C00 A;  2B6M A;  5CAX A;  1B48 A;  1S3D A;  4IJI A;  5IMC A;  9GSS A;  2WCI A;  1JZO A;  2V6O A;  2H76 A;  2H0I A;  4RI7 A;  3H79 A;  4Q5N A;  2L59 A;  5IMZ A;  1SD9 A;  5D9W A;  1V40 A;  4EVM A;  4MH3 A;  2RLI A;  1XWK A;  4G2E A;  2H1G A;  3PIN A;  1YQ1 A;  2WDU A;  3FYG A;  3ME8 A;  1PL2 A;  3S9F A;  16GS A;  2HI7 A;  5J41 A;  3D21 A;  1ACV A;  2GS3 A;  5ECP B;  2QC7 A;  3GMF A;  2MZC A;  3A3T A;  3KCM A;  5DCH A;  2FLS A;  2YJH A;  3IAS 2;  2HZE B;  2HSM A;  4E8H A;  1N8J A;  4YH2 A;  2R4V A;  1XVW A;  2GSS A;  1F3A A;  4J57 E;  2LRC A;  3ISO A;  1GUK A;  2JZT A;  2P0G A;  1MTC A;  2AAW A;  1OC9 B;  5G31 A;  1QUW A;  1K0A A;  3M0F A;  1A8L A;  3E0U A;  1GUH A;  5JCW A;  3ZLP A;  1LJR A;  4I5Q A;  2IWT A;  5JWO B;  2K9F A;  4MCU A;  2LRN A;  1TI3 A;  1JLW A;  2ZUP A;  2VUP A;  5J3R A;  2K6V A;  1V58 A;  3LQ7 A;  2GDR A;  1X9W B;  4XTS A;  4MJC A;  1U88 A;  3NIV A;  1HYU A;  3Q18 A;  4ECJ A;  2O7K A;  1SK1 A;  1FG4 A;  1TP9 A;  2PVO C;  1VF1 A;  2EIR A;  2H1A A;  1TXX A;  2BMX A;  3H8Q A;  1Z6M A;  1VGL A;  4TOP A;  4NV5 A;  2VCZ A;  3GRX A;  1ON4 A;  4ZBD A;  3FK8 A;  3L4N A;  1SJ6 A;  4XIH A;  3W6G A;  2B5E A;  1DBY A;  5CP1 A;  1M99 A;  2IJY A;  2G2Q A;  3L9U A;  2VCW A;  2LST A;  4EDZ A;  1DSB A;  3KXO A;  2CAQ A;  1Z7R A;  1DE2 A;  1FB0 A;  2H0G A;  3D6I A;  1K0M A;  2OA7 A;  2LJR A;  2A2R A;  7GSS A;  5DJM A;  4X1U A;  2VM2 A;  5DAK A;  3F4S A;  5IOX A;  2AYT A;  4AGS A;  3IAM 2;  5DAL B;  3F4T A;  3KMN A;  1THX A;  1BED A;  2C4J A;  1AQX A;  5ECI B;  3RHB A;  3QD9 A;  4JZQ A;  3LWA A;  2FCH A;  3ZZX A;  5LCZ A;  4XRD A;  2MMZ A;  1ZYQ B;  3TOT A;  4RI6 A;  3IRA A;  5B7C A;  3ZVJ A;  3KJY A;  2DSA A;  3MAK A;  2OE0 A;  3UIW A;  3FR6 A;  2OJL A;  2PN8 A;  1MDI A;  1XXU A;  1VF3 A;  3HA9 A;  4ACS A;  4TXV A;  1BG5 A;  1TU7 A;  1GH2 A;  3L9S A;  2JAD A;  2R37 A;  3VK9 A;  1ABA A;  3QDN A;  4O32 A;  4TXO A;  4ZB9 A;  2C0E A;  4WXT A;  4OMV A;  1GLQ A;  4KDY A;  2DJJ A;  5GSS A;  5B6N A;  3TGZ A;  3HZ4 A;  2P31 A;  1FVJ A;  2LV3 A;  2H1D A;  4MJE A;  5DQS A;  2D2Z A;  2K18 A;  5LNK e;  1EEJ A;  4IKH A;  4J56 E;  1SYX A;  1PMT A;  4OD7 A;  1Y25 A;  1U3I A;  2N5A A;  3ERF A;  5CRG A;  1EEM A;  4MK3 A;  4OFM A;  3TKS E;  3GN3 A;  2HLS A;  2H70 A;  2H66 A;  1R5P A;  2HSM B;  2YJ7 A;  2HRK A;  2GSQ A;  3SWL A;  1DE1 A;  4GST A;  2RM6 A;  3C1R A;  4KDX A;  1R5A A;  4WBR D;  1XOB A;  3OR5 A;  4POB A;  4KGI A;  5DVB A;  3F4R A;  2VO4 A;  1G7E A;  2E2G A;  1A8Y A;  4AJ7 A;  4X0X A;  2IL3 A;  3IK7 A;  1XFL A;  4F82 A;  4KSO A;  2L6C A;  2TRX A;  2ALB A;  5H5S A;  5L71 A;  3TB2 A;  4BA7 A;  5IQY A;  4JRR A;  6GST A;  4CHS A;  1K3Y A;  5G1L A;  1XVQ A;  4L5O A;  3BOA A;  3LGC A;  2FY6 A;  1IYI A;  1O8X A;  1YDK A;  3M9J A;  3KTB A;  3GUS A;  5AN1 A;  4Q5R A;  3GX0 A;  1O73 A;  2FUG 2;  5IOW A;  2GQM A;  2YAN A;  4NHW A;  3WGD A;  4HQS A;  1IYH A;  4ZL7 A;  1GTU A;  4V2M A;  1GNE A;  2GQL A;  4RQR A;  2IME A;  1M9A A;  2XBI A;  3QPM A;  1OAZ A;  1FAA A;  2I4A A;  4EXJ A;  4EC0 A;  4HJ2 A;  4LL4 B;  3F3R A;  5FT3 A;  4Z7X A;  2C3Q A;  2FA4 A;  2X8H A;  2XC2 A;  2O87 A;  2B1K A;  2HXK A;  2V41 A;  1ZZY A;  2LNS A;  2I81 A;  1A2L A;  5ECN B; 
#chains in the Genus database with same CATH topology
 2X99 A;  3W8J A;  5KOW A;  2HZE A;  5ELA A;  2BTO T;  2LJK A;  5G2Z A;  1Z9H A;  5BMU B;  1WJK A;  1V57 A;  4K9Z A;  1KEB A;  2E7P A;  4ICY A;  3DVX A;  3FZ4 A;  3C8E A;  4Q5F A;  4WKW A;  4QL9 A;  1GTI A;  3RGB C;  2CVD A;  4ZIL A;  1BYE A;  3LW9 A;  4G0I A;  4RQX A;  1GTB A;  4ML6 A;  2YN1 A;  5IMV A;  4KND A;  3LYK A;  2CT6 A;  3HCZ A;  3IA1 A;  2HE3 A;  1VRS D;  2HZF A;  3GH9 A;  1U3A A;  1GUL A;  1TOF A;  3KD0 A;  4QQ7 A;  3CTF A;  2H01 A;  2CVB A;  2YWN A;  4TXO B;  2YWM A;  3TU3 B;  4W66 A;  2XPE A;  1EOG A;  3EU3 A;  3EPT A;  3FRC A;  2OAD A;  5AGY A;  5IPG A;  3CYN A;  2CA8 A;  5KN0 A;  1PN9 A;  4HQZ A;  1CQG A;  4AKI A;  4FH8 A;  3HMJ G;  4GQC A;  1TRV A;  3MYD A;  5CO3 A;  3U5R E;  3F9U A;  4ZXG A;  1E6B A;  5IMA A;  4IGJ A;  2H75 A;  3LJR A;  2JAC A;  3GTU B;  2O85 A;  3TKP A;  3TKR A;  3ZL5 A;  5IMD A;  5ELG A;  1T1V A;  2IN3 A;  4V2N A;  3I6A A;  1AAZ A;  3QAV A;  3SBC A;  4V1A p;  4Z2R A;  2LJA A;  5IIZ A;  2VD0 A;  4DSQ A;  3LSZ A;  2DIZ A;  4LA1 A;  3HY2 A;  1MDJ A;  5A5H A;  3BBY A;  4RUV A;  2WW0 A;  4MF6 A;  3KMO A;  5J47 A;  3KZQ A;  3RAZ A;  3QFA C;  2GZP A;  5JCU A;  2OBK A;  2M72 A;  2LQQ A;  3G7J A;  5ECH B;  5CYY A;  1HNB A;  5GAP D;  1GP1 A;  2IIY A;  2L4Q A;  3G7I A;  2F9S A;  1TDI A;  4XS1 A;  4DVC A;  1J9B A;  3MSZ A;  1GSE A;  1Q4J A;  2IPA A;  2REM A;  3GIX A;  2VLV A;  4KDU A;  4F0C A;  1SYR A;  1K0B A;  3IHQ A;  2DJK A;  2IMF A;  4IN0 A;  3G7Y A;  2NPB A;  2I3Y A;  1PD2 1;  3HXS A;  4EKZ A;  4YAV A;  6GSY A;  4GF0 A;  1GSQ A;  2GT6 A;  3CXG A;  1O85 A;  3L9V A;  3EMP A;  4HJM A;  2X64 A;  5DJL A;  2KP1 A;  1JZR A;  3VWV A;  1VF4 A;  5KN2 A;  4OCE A;  1NM3 A;  4I2T A;  4PXO A;  4AJ6 A;  2DKH A;  2H71 A;  1GNW A;  3DML A;  4JED A;  1RK4 A;  2O89 A;  2H1L A;  5J5N A;  4EF0 A;  4PX1 A;  3ZFL A;  2C3N A;  1XOA A;  3CRU A;  4IBP A;  2PU9 C;  1AXD A;  1PQN A;  4MJB A;  2KUC A;  1TRW A;  4XRA A;  5A1N A;  5KN3 A;  1GLP A;  1PX6 A;  3J7Y b;  1H75 A;  5JCG A;  2X8C A;  2VCQ A;  3EUR A;  1YJ6 A;  3LFL A;  2H72 A;  2GST A;  5G5F A;  4USS A;  4LL1 B;  2LRT A;  3KGK A;  4V2L A;  2N5F A;  3KP9 A;  2AUV A;  5AIX A;  4KA0 A;  2WUL A;  2FHE A;  2YCD A;  5GST A;  2OBI A;  4BWQ A;  3TRQ A;  4I6X A;  4AKH A;  5INY A;  1TK8 B;  4IEL A;  4MJA A;  1LBK A;  1X5D A;  1SK2 A;  4TR1 A;  2HYX A;  1HQO A;  2WS2 A;  4CW9 A;  2JSZ A;  3DRN A;  1KTE A;  5H5R A;  4EDY A;  2DJ1 A;  1K0C A;  4GQF A;  3DIE A;  5ID2 A;  6GSV A;  3Q19 A;  2I9H A;  1ILO A;  1XZO A;  1YEP A;  3P2A A;  4I2U A;  5A4U A;  1EWX A;  1OC3 A;  2B7J A;  4DEJ A;  1THO A;  4KE3 A;  1GTA A;  1K0D A;  2HRF A;  1F37 A;  4KUN A;  4ECI A;  1SL0 B;  2GT5 A;  1T3B A;  1UVZ A;  2KP2 A;  3FZA A;  4O5U A;  1G6W A;  22GS A;  1SK0 A;  1X9M B;  1SVL A;  4G0K A;  1URM A;  1YVL A;  1A0F A;  5J9C A;  2HRN A;  4BWS A;  1GSU A;  3I9V 2;  2NBS A;  5A4W A;  5D9X A;  5ECL B;  5F06 A;  4AJ8 A;  4WR5 A;  4PQH A;  3O76 A;  4F9Z A;  4G0L A;  1M2A A;  3FHK A;  3HJP A;  1A0R P;  3UBL A;  4E68 A;  4FYB A;  2FGX A;  3WT2 A;  2FWF A;  2HSH A;  3KH9 A;  3M1G A;  2Z9S A;  2C0G A;  5EY6 A;  6GSW A;  5JWQ B;  3GNJ A;  4FXY P;  4N10 A;  4OFT A;  5BMU A;  4KB3 A;  4N0V A;  3FR9 A;  5GZZ B;  1QFN A;  1QQ2 A;  3IOS A;  3TJJ A;  3FZ9 A;  4ILF A;  1RW1 A;  1WRY A;  1EV4 A;  2F8A A;  3VWX A;  4ULX A;  3MNG A;  3DD3 A;  4DSS A;  1XW5 A;  1XIY A;  3K8N A;  4MNN A;  3VFI A;  3APQ A;  4Q5Q A;  3CTG A;  1JZW A;  4F2I A;  4BVX A;  3EE2 A;  3C7M A;  2VCX A;  5F07 A;  4NXI A;  5IM9 A;  4WBJ A;  2UZ8 A;  2GTU A;  4POK A;  3VPQ A;  4MZB A;  4HOJ A;  5E59 A;  5KEJ A;  5D9T A;  3L0H A;  3QAW A;  4L8E A;  4X43 A;  1SU9 A;  5A5K A;  2CZ2 A;  3ZFB A;  2GSR A;  4K0G A;  1ERT A;  1B9Y C;  4GTU A;  5DBQ A;  4K7I A;  3RPN A;  3ZTL A;  5ENU A;  1T4Z A;  3FW2 A;  3HJM A;  2RM5 A;  4HI7 A;  1PGT A;  2MYG A;  2NDO A;  3NOF A;  4F0B A;  1Z6N A;  3UJ1 A;  3GTU A;  2H6Y A;  3ME7 A;  3C73 A;  4WET A;  2DLX A;  6GSU A;  2P5R A;  2L5L A;  3F6D A;  2DC5 A;  3IR4 A;  1M0U A;  3HD5 A;  2VM1 A;  1A24 A;  2K8V A;  2XHF A;  4PTS A;  4MZW A;  3ZRD A;  1GUM A;  1QMV A;  4AKG A;  1Z3E A;  2ZNM A;  1U6T A;  3HDC A;  4JU5 A;  5FHI A;  4KH7 A;  2C0F A;  3KIJ A;  4AI6 A;  2MMN A;  3TJG A;  5HQP A;  1XWB A;  4KCA A;  4OO5 A;  4LMV A;  3VUR A;  2H73 A;  1GSF A;  4ECB A;  1JZD A;  3CSI A;  4ZIJ A;  4OWY A;  1FVK A;  2C0D A;  1TW9 A;  3P90 A;  2H30 A;  4K0N A;  2WFC A;  4HEA 2;  5F05 A;  5D96 A;  5E4W A;  2L4C A;  2MBS A;  4HZ2 A;  4FYC A;  1BX9 A;  2LKU A;  1O6J A;  1TRU A;  4MDC A;  5ECM B;  2CZ3 A;  1EV9 A;  5HFG A;  2O3E A;  3KM6 A;  3IBH A;  4XS4 A;  1C72 A;  5G1K A;  1AW9 A;  4TR1 B;  4CY6 A;  4G19 A;  3VWW A;  4K7O A;  2OAC A;  2YZH A;  1AQV A;  3WYW A;  2WB9 A;  3C71 A;  4YQM A;  5ID2 B;  1QGV A;  3UAR A;  2JZR A;  2C1Y A;  3EVI A;  3P7X A;  5B8B A;  3IDV A;  2WZ9 A;  4I8B A;  4OO4 A;  1EGR A;  3F0I A;  2VLT A;  1GSY A;  2PWJ A;  4ZBA A;  1XWC A;  2ON5 A;  3V1W A;  4EUY A;  3PPU A;  4QL7 A;  1E2Y A;  2H6X A;  4MH2 A;  2CX4 A;  5D93 A;  10GS A;  3TRX A;  2HNL A;  1BQ7 A;  5IO0 A;  1EP8 A;  1SL1 B;  2XPD A;  2H74 A;  2J23 A;  3RBT A;  3GYK A;  1BAY A;  3F63 A;  1MEK A;  2H0H A;  1UC7 A;  1Z5Y E;  2F8F A;  1UN2 A;  1B8X A;  4BL7 B;  4E8E A;  2QKE A;  4GRF A;  1O8W A;  8GSS A;  3FR3 A;  4EIP A;  5A4V A;  1SD8 A;  3MDK A;  1A2M A;  5D8I A;  2E2M A;  2YOI A;  2DML A;  2ON7 A;  2EIQ A;  1FB6 A;  2DBC A;  4NPB A;  4DSS B;  2JZS A;  4PQI A;  4MPF A;  1WOU A;  3WD6 A;  3QFB C;  2GLR A;  5IPH A;  4XS6 A;  4TKY A;  3H93 A;  3E9J B;  4BVX B;  4IHU A;  2PER A;  4MF7 A;  5AIS A;  3WT1 A;  3R3E A;  1PKW A;  1S4B P;  4K7N A;  1F9M A;  1Y6E A;  1XWA A;  3HHV A;  1S3A A;  2L5O A;  4GWR A;  4Z2U A;  2YWI A;  2GZZ A;  4YKG A;  2WJU A;  4NV2 A;  4TW5 A;  3D4M A;  3UBK A;  3GSS A;  3N9J A;  4JR4 A;  3TJK A;  3LOR A;  1WMJ A;  1QXH A;  4IP6 A;  4ZB7 A;  5JWR B;  1QK8 A;  3D5J A;  3US3 A;  2A2P A;  3AY8 A;  2IMD A;  3RFR C;  4PNG A;  3BD2 A;  1R4W A;  4KX4 A;  3DYR A;  1X9S B;  1WE0 A;  2V32 A;  1T7P B;  2KLX A;  1YF0 A;  3HVV A;  3EIN A;  3PH9 A;  3CSJ A;  1AUC A;  1O7U A;  2VOC A;  2B1L A;  4FO5 A;  3DXB A;  3TOU A;  3BCK A;  1J08 A;  2GQK A;  3VI5 A;  1A2J A;  3LEF A;  3P8W A;  3I69 A;  4GCI A;  1O81 A;  1PL1 A;  3QR6 A;  2HRA A;  4GSN A;  3QCP A;  5CRE A;  5EL8 A;  3CSH A;  3PR8 A;  2FA8 A;  5F8B A;  1FW1 A;  2VKZ G;  5LD0 A;  1N2A A;  3L78 A;  2E0Q A;  4IP1 A;  4DSR A;  5EPF A;  2XBQ A;  3TKS C;  2OE1 A;  4PGT A;  2WVZ A;  2HQT A;  3D4T A;  1M2D A;  2VAF A;  1MD3 A;  4A5P A;  1HNA A;  2C8U A;  4WEY A;  3FEU A;  4XS4 B;  1YKC A;  4BVY A;  1WWJ A;  4OCF A;  4I97 A;  1PRX A;  3UVH A;  1TK5 B;  1SVO A;  3HJO A;  2LUS A;  3GX8 A;  1ZGN A;  4MZC A;  12GS A;  4G01 A;  1TKD B;  5EVO A;  5J40 A;  1K0O A;  4LMW A;  4YQV A;  3VWU A;  4KW6 A;  4WF4 A;  2RUF A;  1X5C A;  1GRX A;  3QAG A;  4YKF A;  2H1B A;  2LEG A;  2CV4 A;  3IC8 A;  5DCG A;  2X49 A;  4G10 A;  1X5E A;  2OT3 A;  1MDK A;  1S3C A;  3UL3 A;  1ZCP A;  5CRD A;  2IMK A;  4JBB A;  3ZYW A;  4IQ1 A;  1OKD A;  4ZBB A;  3A2V A;  1FOH A;  2YNX A;  3GKX A;  2VIM A;  4TRX A;  5G5E A;  14GS A;  3VLN A;  3GL3 A;  2EFH A;  1Z7P A;  1TXU A;  2TIR A;  1YF1 A;  2H6Z A;  4AKX B;  4K2D A;  4K8M A;  5J4V A;  4ECC A;  3UEM A;  2VCV A;  5DDL A;  4TR4 A;  4IVF A;  4L0U A;  3A2X A;  3J7Y k;  3GKM A;  3APS A;  2WGR A;  5AIV A;  4KSM A;  5C04 A;  3JCM L;  2DJ0 A;  1PKZ A;  2A2S A;  1BF5 A;  1M3I A;  3DVW A;  5IMF A;  5FWG A;  3CMI A;  3ZMK A;  5CRH A;  2YV7 A;  3O3T A;  4IW9 A;  3EU4 A;  3VI7 A;  3MWH A;  4KCE A;  4O92 A;  5J4Y A;  4J2F A;  4NAX A;  11GS A;  3O6T A;  1GWC A;  2R2J A;  1SJZ A;  3HKR A;  1YEW C;  1YZX A;  2FWH A;  1HNC A;  5HR2 A;  1M7T A;  2EFD A;  2PBJ A;  4PUF C;  3IV4 A;  4ISD A;  3G9B A;  5GAN D;  4IJ3 A;  5CRW A;  4YAP A;  1NW2 A;  1PX7 A;  3QOU A;  1TK0 B;  2NVL A;  4MA9 A;  2O36 A;  4OFN A;  19GS A;  2VL3 A;  1SKR B;  1X0R A;  4O5R A;  4AF2 A;  3GFK A;  3GV1 A;  5ECS A;  4V1A g;  3KTL A;  2CVK A;  1EOH A;  3TKQ A;  3GL5 A;  3LXZ A;  1V2A A;  4MPG A;  1M2B A;  3EMX A;  4FIW A;  4X4J A;  2PGT A;  1K3L A;  1ZOF A;  4KAE A;  4ML1 A;  1I5G A;  3HZ8 A;  4G9H A;  1G0T A;  1SEN A;  4HZ4 A;  2YZU A;  5B8A A;  2B7K A;  1GSD A;  4PNF A;  4TVE A;  1W89 A;  4N3Z A;  4TR3 A;  2WVY A;  1DUG A;  2DKI A;  2AJQ B;  3TKS A;  4MLY A;  4BL7 A;  3I43 A;  2IFQ A;  3ED3 A;  3CHX C;  1M9B A;  1ST9 A;  1YKA A;  3LG6 A;  1ML6 A;  2JU5 A;  5IO2 A;  1G6Y A;  2FNO A;  3IE3 A;  4TN8 A;  2CX3 A;  3UMA A;  1PSQ A;  4MF5 A;  1V9W A;  3IHG A;  3QMX A;  2EFE A;  1SJI A;  1WP0 A;  2H19 A;  1T00 A;  4HU7 A;  1SKS B;  2DJ3 A;  2A4V A;  4PHZ C;  1ZYE A;  5D73 A;  4BVY B;  3LXT A;  4FYU A;  1AC1 A;  4MP4 A;  1TU8 A;  1A23 A;  2M46 A;  4PQ1 A;  1BJX A;  3KH7 A;  4LLR A;  4XCS A;  3UAP A;  2L57 A;  4EL1 A;  2L6D A;  5J4U A;  4EE0 A;  5HFK A;  2EIO A;  2YPM A;  2J9H A;  2R3X A;  5HR3 A;  1KNG A;  2P5Q A;  4P3Y B;  3HYP A;  5HFI A;  2G0F A;  3WGX A;  2JL4 A;  1USB A;  2R6K A;  2O8V B;  3D22 A;  4POL A;  1Y1U A;  1EP7 A;  2VL2 C;  2GZY A;  5ECO B;  1FHE A;  1B4P A;  3FY7 A;  3DEX A;  1FOV A;  4N0Z A;  3U6V A;  1TJD A;  4PUA A;  3GA4 A;  3C1S A;  3TCO A;  3GHA A;  4PI0 C;  4JE1 A;  2DMM A;  1RQM A;  1VF2 A;  3F8U A;  2MBT A;  2WW1 A;  3NZN A;  3IK9 A;  1JLV A;  1EZK A;  5HR0 A;  13GS A;  1ZL9 A;  3BCI A;  2CQ9 A;  2QGV A;  2WW2 A;  3GUR A;  2PPT A;  2I1U A;  3APO A;  1EGO A;  2VCT A;  5J9B A;  5ECK B;  3IXR A;  2GGT A;  2HSN B;  3FZ5 A;  4HDE A;  3WGE A;  2PVQ A;  2M80 A;  1HD2 A;  1TTZ A;  1NHY A;  4IQA A;  1XW9 A;  3KP8 A;  2GVP A;  3H4K A;  2CAI A;  2RII A;  4ZB8 A;  5KN1 A;  3EWL A;  4YQU A;  1TRS A;  1T4Y A;  1R26 A;  4K2X A;  4GSS A;  2EC4 A;  3ZVJ D;  4D73 A;  3E3E A;  2MMO A;  1T8E B;  1MD4 A;  1OC8 A;  3EC3 A;  2KOK A;  4K1F A;  4N11 A;  2LS5 A;  3TJF A;  3TUE A;  2F3M A;  1V98 A;  5CNW A;  3ERW A;  6GSS A;  1SVM A;  4N30 A;  2VL9 A;  2B3S A;  2VD1 A;  2LQO A;  3A2W A;  1ERU A;  3TDG A;  4MAB A;  4O7H A;  3ERG A;  4CDO A;  3RDW A;  2JSY A;  4NWY A;  3H1N A;  2HFD A;  2V1M A;  1CQH A;  4GXZ A;  3VPT A;  2X8G A;  5COH A;  5B6M A;  4FQU A;  2FWE A;  2C80 A;  3DGQ A;  3PGT A;  1B4Q A;  3Q74 A;  3CBU A;  3R2Q A;  3EYT A;  4XHM A;  2X4A A;  3Q6O A;  3ZIV A;  2QA1 A;  2YV9 A;  4PI2 C;  3UOM A;  4L5L A;  2FD3 A;  3TJB A;  2LTK A;  1K0N A;  2WW3 A;  2IFQ B;  3KEB A;  2V6K A;  2DIY A;  1SKW B;  1YY7 A;  3ZRE A;  1K3O A;  2DJ2 A;  3CRT A;  2B5Y A;  1OE7 A;  2R5G A;  4MMM A;  1JFU A;  5DAK B;  2V2G A;  1NHO A;  2K8S A;  4H86 A;  3RHC A;  2KHP A;  1XCC A;  3TRP A;  18GS A;  3HVX A;  3HVN A;  1F3B A;  1U87 A;  1NSW A;  5D9V A;  4NMU A;  3M8N A;  1GL8 A;  2B5X A;  2YP6 A;  2QSI A;  2IMI A;  4KF9 A;  4BPY A;  3DWV A;  1OVN A;  1OC9 A;  2WVX A;  4TR0 A;  1M3J A;  3GST A;  3ZIJ A;  1B9X C;  2VL2 A;  3W8S A;  2TRC P;  4WR4 A;  2FWG A;  4JR6 A;  1G7O A;  1TI1 A;  5ABR A;  1F6M C;  3UVT A;  1OKT A;  1XG8 A;  20GS A;  2NTO A;  2QA2 A;  1ERV A;  1XBS A;  3M9K A;  3F3Q A;  2HT9 A;  1GSS A;  2BJX A;  2F51 A;  1FO5 A;  1SL2 B;  3D0Z A;  2VLU A;  1XWG A;  3N5O A;  4IS0 A;  4K6X A;  3ZML A;  1KBN A;  3BJ5 A;  1OYJ A;  5H5Q A;  2YWO A;  4Z2T A;  2H8L A;  1WPI A;  1AQW A;  4GLT A;  4ID0 A;  3ZIT A;  2C3T A;  1OE8 A;  5G30 A;  1XPV A;  2ZCT A;  4EO3 A;  4ZB6 A;  4O5Q A;  2RUE A;  5ECQ B;  3GKN A;  4WF5 A;  1WIK A;  1Q98 A;  4F03 A;  2PUK C;  5DAL A;  4NHZ A;  5ECR B;  1UA5 A;  1I9D A;  5F0G A;  4L0W A;  1YEX A;  2ES7 A;  4POM A;  1XW6 A;  3GKK A;  5HR1 A;  2WRT A;  1AIU A;  1JHB A;  2HRK B;  2N5B A;  3IPZ A;  3FMW A;  1F2E A;  3F6F A;  3RPP A;  1ZMA A;  4D73 B;  5DQY A;  3HVS A;  4ZL8 A;  1S3R A;  2LNT A;  1R7H A;  2OKA A;  3DKS A;  2MMA A;  3GH6 A;  4HUA A;  3LYP A;  4ZL9 A;  17GS A;  5KOX A;  6GSX A;  2AHE A;  3A5W A;  4PUR A;  1W4V A;  2HSY A;  2AV4 A;  2PMT A;  3FKF A;  1J0F A;  4EIQ A;  4HS1 A;  4HU9 A;  2OE3 A;  1LU4 A;  1H4O A;  1PA3 A;  2AB6 A;  1ERW A;  3IC4 A;  3M3M A;  5C00 A;  2B6M A;  5CAX A;  1B48 A;  1S3D A;  4IJI A;  5IMC A;  9GSS A;  2WCI A;  1JZO A;  2V6O A;  2H76 A;  2H0I A;  4RI7 A;  3H79 A;  4Q5N A;  2L59 A;  5IMZ A;  4K5R A;  1SD9 A;  5D9W A;  1V40 A;  4EVM A;  4MH3 A;  2RLI A;  1XWK A;  4G2E A;  2H1G A;  1N25 A;  3PIN A;  1YQ1 A;  2WDU A;  3FYG A;  3ME8 A;  2UV8 G;  1PL2 A;  3S9F A;  2HSN A;  16GS A;  2HI7 A;  5J41 A;  3D21 A;  1ACV A;  2GS3 A;  5ECP B;  2QC7 A;  3GMF A;  4QMK A;  2MZC A;  3A3T A;  3KCM A;  5DCH A;  2FLS A;  2YJH A;  4K5S A;  3IAS 2;  2HZE B;  2HSM A;  4E8H A;  1N8J A;  4YH2 A;  2R4V A;  1XVW A;  2GSS A;  1F3A A;  1PFO A;  4J57 E;  2LRC A;  3ISO A;  1GUK A;  2JZT A;  2P0G A;  1MTC A;  2AAW A;  1OC9 B;  2WVX B;  1BG1 A;  5G31 A;  1QUW A;  1K0A A;  3M0F A;  1A8L A;  3E0U A;  1GUH A;  5JCW A;  3ZLP A;  1LJR A;  4I5Q A;  2IWT A;  5JWO B;  2K9F A;  4MCU A;  2LRN A;  1TI3 A;  1JLW A;  2ZUP A;  2VUP A;  5J3R A;  2K6V A;  1V58 A;  3LQ7 A;  3MIX A;  2GDR A;  1X9W B;  4XTS A;  4MJC A;  1U88 A;  3NIV A;  1HYU A;  3Q18 A;  4ECJ A;  2O7K A;  1SK1 A;  1FG4 A;  1TP9 A;  2PVO C;  1VF1 A;  2EIR A;  2H1A A;  1TXX A;  2BMX A;  3H8Q A;  1Z6M A;  1VGL A;  4TOP A;  4NV5 A;  2VCZ A;  3GRX A;  1ON4 A;  4ZBD A;  3FK8 A;  3L4N A;  1SJ6 A;  4XIH A;  3W6G A;  2B5E A;  1DBY A;  5CP1 A;  1M99 A;  2IJY A;  2G2Q A;  3L9U A;  2VCW A;  2LST A;  4EDZ A;  2R0C A;  1DSB A;  3KXO A;  2CAQ A;  1Z7R A;  1DE2 A;  2EFC A;  1FB0 A;  2H0G A;  3D6I A;  1K0M A;  2OA7 A;  2LJR A;  2A2R A;  7GSS A;  3CQF A;  5DJM A;  4X1U A;  2VM2 A;  5DAK A;  3F4S A;  5IOX A;  2AYT A;  4AGS A;  3IAM 2;  5DAL B;  5A34 A;  3F4T A;  3KMN A;  1THX A;  1BED A;  2C4J A;  4HSC X;  1AQX A;  5ECI B;  3RHB A;  1PN0 A;  3QD9 A;  4BIK A;  4JZQ A;  3LWA A;  2FCH A;  5A5H B;  3ZZX A;  5LCZ A;  4XRD A;  2MMZ A;  1ZYQ B;  3TOT A;  4RI6 A;  3IRA A;  5B7C A;  3ZVJ A;  3KJY A;  2DSA A;  3MAK A;  2OE0 A;  3UIW A;  3FR6 A;  2OJL A;  2PN8 A;  1MDI A;  1XXU A;  1VF3 A;  3HA9 A;  4ACS A;  4TXV A;  1BG5 A;  1TU7 A;  1GH2 A;  3L9S A;  2JAD A;  2R37 A;  3VK9 A;  1ABA A;  3QDN A;  2R0P A;  4O32 A;  4TXO A;  2R0G A;  4ZB9 A;  2C0E A;  4WXT A;  4OMV A;  1GLQ A;  4KDY A;  2A4H A;  2DJJ A;  5GSS A;  5B6N A;  3TGZ A;  3HZ4 A;  2P31 A;  1I1I P;  1FVJ A;  2LV3 A;  2H1D A;  4MJE A;  5DQS A;  4CY8 A;  2D2Z A;  2K18 A;  5LNK e;  1EEJ A;  4IKH A;  4J56 E;  1SYX A;  1PMT A;  4OD7 A;  1Y25 A;  1U3I A;  2N5A A;  3ERF A;  5CRG A;  1EEM A;  4MK3 A;  4OFM A;  3TKS E;  3GN3 A;  2HLS A;  4GDF A;  2H66 A;  2H70 A;  1R5P A;  2HSM B;  5A1N B;  2YJ7 A;  2HRK A;  2GSQ A;  3SWL A;  1DE1 A;  4GST A;  2RM6 A;  3C1R A;  4KDX A;  1R5A A;  4WBR D;  1XOB A;  3OR5 A;  4POB A;  2WZS A;  4KGI A;  5DVB A;  3F4R A;  2VO4 A;  1G7E A;  2E2G A;  1A8Y A;  4AJ7 A;  4X0X A;  2IL3 A;  3IK7 A;  1XFL A;  4F82 A;  4KSO A;  2L6C A;  2TRX A;  3CWG A;  2ALB A;  5H5S A;  5L71 A;  3TB2 A;  4BA7 A;  5IQY A;  4JRR A;  6GST A;  4CHS A;  1K3Y A;  5G1L A;  1XVQ A;  4L5O A;  3BOA A;  3LGC A;  2FY6 A;  1IYI A;  2O5V A;  1O8X A;  5BRT A;  1YDK A;  3M9J A;  3KTB A;  3GUS A;  1ZYP A;  5AN1 A;  4Q5R A;  1ZYN A;  3GX0 A;  1O73 A;  2FUG 2;  5IOW A;  2GQM A;  2YAN A;  4NHW A;  3WGD A;  4HQS A;  1IYH A;  3A5I A;  4ZL7 A;  1GTU A;  4V2M A;  1GNE A;  2GQL A;  4RQR A;  2IME A;  1M9A A;  2XBI A;  3QPM A;  1OAZ A;  1FAA A;  2I4A A;  4EXJ A;  4EC0 A;  4HJ2 A;  4LL4 B;  3F3R A;  5FT3 A;  4Z7X A;  2C3Q A;  2FA4 A;  2X8H A;  2XC2 A;  2O87 A;  2B1K A;  2HXK A;  5A34 B;  2V41 A;  1ZZY A;  2LNS A;  2I81 A;  1A2L A;  5ECN B; 
#chains in the Genus database with same CATH homology
 2X99 A;  3W8J A;  5KOW A;  2HZE A;  5ELA A;  2BTO T;  2LJK A;  5G2Z A;  1Z9H A;  5BMU B;  1WJK A;  1V57 A;  4K9Z A;  1KEB A;  2E7P A;  4ICY A;  3DVX A;  3FZ4 A;  3C8E A;  4Q5F A;  4WKW A;  4QL9 A;  1GTI A;  2CVD A;  4ZIL A;  1BYE A;  3LW9 A;  4G0I A;  4RQX A;  1GTB A;  4ML6 A;  2YN1 A;  5IMV A;  4KND A;  3LYK A;  2CT6 A;  3HCZ A;  3IA1 A;  2HE3 A;  1VRS D;  2HZF A;  3GH9 A;  1U3A A;  1GUL A;  1TOF A;  3KD0 A;  4QQ7 A;  3CTF A;  2H01 A;  2CVB A;  2YWN A;  4TXO B;  2YWM A;  3TU3 B;  4W66 A;  2XPE A;  1EOG A;  3EU3 A;  3EPT A;  3FRC A;  2OAD A;  5AGY A;  5IPG A;  3CYN A;  2CA8 A;  5KN0 A;  1PN9 A;  4HQZ A;  1CQG A;  4AKI A;  4FH8 A;  3HMJ G;  4GQC A;  1TRV A;  3MYD A;  5CO3 A;  3U5R E;  3F9U A;  4ZXG A;  1E6B A;  5IMA A;  4IGJ A;  2H75 A;  3LJR A;  2JAC A;  3GTU B;  2O85 A;  3TKP A;  3TKR A;  3ZL5 A;  5IMD A;  5ELG A;  1T1V A;  2IN3 A;  4V2N A;  3I6A A;  1AAZ A;  3QAV A;  3SBC A;  4V1A p;  4Z2R A;  2LJA A;  5IIZ A;  2VD0 A;  4DSQ A;  3LSZ A;  2DIZ A;  4LA1 A;  3HY2 A;  1MDJ A;  5A5H A;  3BBY A;  4RUV A;  4MF6 A;  3KMO A;  5J47 A;  3KZQ A;  3RAZ A;  3QFA C;  2GZP A;  5JCU A;  2OBK A;  2M72 A;  2LQQ A;  3G7J A;  5ECH B;  5CYY A;  1HNB A;  5GAP D;  1GP1 A;  2IIY A;  2L4Q A;  3G7I A;  2F9S A;  1TDI A;  4XS1 A;  4DVC A;  1J9B A;  3MSZ A;  1GSE A;  1Q4J A;  2IPA A;  2REM A;  3GIX A;  2VLV A;  4KDU A;  4F0C A;  1SYR A;  1K0B A;  3IHQ A;  2DJK A;  2IMF A;  4IN0 A;  3G7Y A;  2NPB A;  2I3Y A;  1PD2 1;  3HXS A;  4EKZ A;  4YAV A;  6GSY A;  4GF0 A;  1GSQ A;  2GT6 A;  3CXG A;  1O85 A;  3L9V A;  3EMP A;  4HJM A;  2X64 A;  5DJL A;  2KP1 A;  1JZR A;  3VWV A;  1VF4 A;  5KN2 A;  4OCE A;  1NM3 A;  4I2T A;  4PXO A;  4AJ6 A;  2DKH A;  2H71 A;  1GNW A;  3DML A;  4JED A;  1RK4 A;  2O89 A;  2H1L A;  5J5N A;  4EF0 A;  4PX1 A;  3ZFL A;  2C3N A;  1XOA A;  3CRU A;  4IBP A;  2PU9 C;  1AXD A;  1PQN A;  4MJB A;  2KUC A;  1TRW A;  4XRA A;  5A1N A;  5KN3 A;  1GLP A;  1PX6 A;  3J7Y b;  1H75 A;  5JCG A;  2X8C A;  2VCQ A;  3EUR A;  1YJ6 A;  3LFL A;  2H72 A;  2GST A;  5G5F A;  4USS A;  4LL1 B;  2LRT A;  3KGK A;  4V2L A;  2N5F A;  3KP9 A;  2AUV A;  5AIX A;  4KA0 A;  2WUL A;  2FHE A;  2YCD A;  5GST A;  2OBI A;  4BWQ A;  3TRQ A;  4I6X A;  4AKH A;  5INY A;  1TK8 B;  4IEL A;  4MJA A;  1LBK A;  1X5D A;  1SK2 A;  4TR1 A;  2HYX A;  1HQO A;  2WS2 A;  4CW9 A;  2JSZ A;  3DRN A;  1KTE A;  5H5R A;  4EDY A;  2DJ1 A;  1K0C A;  4GQF A;  3DIE A;  5ID2 A;  6GSV A;  3Q19 A;  2I9H A;  1ILO A;  1XZO A;  1YEP A;  3P2A A;  4I2U A;  5A4U A;  1EWX A;  1OC3 A;  2B7J A;  4DEJ A;  1THO A;  4KE3 A;  1GTA A;  1K0D A;  2HRF A;  1F37 A;  4KUN A;  4ECI A;  1SL0 B;  2GT5 A;  1T3B A;  1UVZ A;  2KP2 A;  3FZA A;  4O5U A;  1G6W A;  22GS A;  1SK0 A;  1X9M B;  1SVL A;  4G0K A;  1URM A;  1YVL A;  1A0F A;  5J9C A;  2HRN A;  4BWS A;  1GSU A;  3I9V 2;  2NBS A;  5A4W A;  5D9X A;  5ECL B;  5F06 A;  4AJ8 A;  4WR5 A;  4PQH A;  3O76 A;  4F9Z A;  4G0L A;  1M2A A;  3FHK A;  3HJP A;  1A0R P;  3UBL A;  4E68 A;  4FYB A;  2FGX A;  3WT2 A;  2FWF A;  2HSH A;  3KH9 A;  3M1G A;  2Z9S A;  2C0G A;  5EY6 A;  6GSW A;  5JWQ B;  3GNJ A;  4N10 A;  4OFT A;  5BMU A;  4KB3 A;  4N0V A;  3FR9 A;  5GZZ B;  1QFN A;  1QQ2 A;  3IOS A;  3TJJ A;  3FZ9 A;  4ILF A;  1RW1 A;  1WRY A;  1EV4 A;  2F8A A;  3VWX A;  4ULX A;  3MNG A;  3DD3 A;  4DSS A;  1XW5 A;  1XIY A;  3K8N A;  4MNN A;  3VFI A;  3APQ A;  4Q5Q A;  3CTG A;  1JZW A;  4F2I A;  4BVX A;  3EE2 A;  3C7M A;  2VCX A;  5F07 A;  4NXI A;  5IM9 A;  4WBJ A;  2UZ8 A;  2GTU A;  4POK A;  3VPQ A;  4MZB A;  4HOJ A;  5E59 A;  5KEJ A;  5D9T A;  3L0H A;  3QAW A;  4L8E A;  4X43 A;  1SU9 A;  5A5K A;  2CZ2 A;  3ZFB A;  2GSR A;  4K0G A;  1ERT A;  1B9Y C;  4GTU A;  5DBQ A;  4K7I A;  3RPN A;  3ZTL A;  5ENU A;  1T4Z A;  3FW2 A;  3HJM A;  2RM5 A;  4HI7 A;  1PGT A;  2MYG A;  2NDO A;  3NOF A;  4F0B A;  1Z6N A;  3UJ1 A;  3GTU A;  2H6Y A;  3ME7 A;  3C73 A;  4WET A;  2DLX A;  6GSU A;  2P5R A;  2L5L A;  3F6D A;  2DC5 A;  3IR4 A;  1M0U A;  3HD5 A;  2VM1 A;  1A24 A;  2K8V A;  2XHF A;  4PTS A;  4MZW A;  3ZRD A;  1GUM A;  1QMV A;  4AKG A;  1Z3E A;  2ZNM A;  1U6T A;  3HDC A;  4JU5 A;  5FHI A;  4KH7 A;  2C0F A;  3KIJ A;  4AI6 A;  2MMN A;  3TJG A;  5HQP A;  1XWB A;  4KCA A;  4OO5 A;  4LMV A;  3VUR A;  2H73 A;  1GSF A;  4ECB A;  1JZD A;  3CSI A;  4ZIJ A;  4OWY A;  1FVK A;  2C0D A;  1TW9 A;  3P90 A;  2H30 A;  4K0N A;  2WFC A;  4HEA 2;  5F05 A;  5D96 A;  5E4W A;  2L4C A;  2MBS A;  4HZ2 A;  4FYC A;  1BX9 A;  2LKU A;  1O6J A;  1TRU A;  4MDC A;  5ECM B;  2CZ3 A;  1EV9 A;  5HFG A;  3KM6 A;  3IBH A;  4XS4 A;  1C72 A;  5G1K A;  1AW9 A;  4TR1 B;  4CY6 A;  4G19 A;  3VWW A;  4K7O A;  2OAC A;  2YZH A;  1AQV A;  3WYW A;  2WB9 A;  3C71 A;  4YQM A;  5ID2 B;  1QGV A;  3UAR A;  2JZR A;  2C1Y A;  3EVI A;  3P7X A;  5B8B A;  3IDV A;  2WZ9 A;  4I8B A;  4OO4 A;  1EGR A;  3F0I A;  2VLT A;  1GSY A;  2PWJ A;  4ZBA A;  1XWC A;  2ON5 A;  3V1W A;  4EUY A;  3PPU A;  4QL7 A;  1E2Y A;  2H6X A;  4MH2 A;  2CX4 A;  5D93 A;  10GS A;  3TRX A;  2HNL A;  1BQ7 A;  5IO0 A;  1EP8 A;  1SL1 B;  2XPD A;  2H74 A;  2J23 A;  3RBT A;  3GYK A;  1BAY A;  3F63 A;  1MEK A;  2H0H A;  1UC7 A;  1Z5Y E;  2F8F A;  1UN2 A;  1B8X A;  4BL7 B;  4E8E A;  2QKE A;  4GRF A;  1O8W A;  8GSS A;  3FR3 A;  4EIP A;  5A4V A;  1SD8 A;  3MDK A;  1A2M A;  5D8I A;  2E2M A;  2YOI A;  2DML A;  2ON7 A;  2EIQ A;  1FB6 A;  2DBC A;  4NPB A;  4DSS B;  2JZS A;  4PQI A;  4MPF A;  1WOU A;  3WD6 A;  3QFB C;  2GLR A;  5IPH A;  4XS6 A;  4TKY A;  3H93 A;  3E9J B;  4BVX B;  4IHU A;  2PER A;  4MF7 A;  5AIS A;  3WT1 A;  3R3E A;  1PKW A;  4K7N A;  1F9M A;  1Y6E A;  1XWA A;  3HHV A;  1S3A A;  2L5O A;  4GWR A;  4Z2U A;  2YWI A;  2GZZ A;  4YKG A;  2WJU A;  4NV2 A;  4TW5 A;  3D4M A;  3UBK A;  3GSS A;  3N9J A;  4JR4 A;  3TJK A;  3LOR A;  1WMJ A;  1QXH A;  4IP6 A;  4ZB7 A;  5JWR B;  1QK8 A;  3D5J A;  3US3 A;  2A2P A;  3AY8 A;  2IMD A;  4PNG A;  3BD2 A;  1R4W A;  4KX4 A;  3DYR A;  1X9S B;  1WE0 A;  2V32 A;  1T7P B;  2KLX A;  1YF0 A;  3HVV A;  3EIN A;  3PH9 A;  3CSJ A;  1AUC A;  1O7U A;  2VOC A;  2B1L A;  4FO5 A;  3DXB A;  3TOU A;  3BCK A;  1J08 A;  2GQK A;  3VI5 A;  1A2J A;  3LEF A;  3P8W A;  3I69 A;  4GCI A;  1O81 A;  1PL1 A;  3QR6 A;  2HRA A;  4GSN A;  3QCP A;  5CRE A;  5EL8 A;  3CSH A;  3PR8 A;  2FA8 A;  5F8B A;  1FW1 A;  2VKZ G;  5LD0 A;  1N2A A;  3L78 A;  2E0Q A;  4IP1 A;  4DSR A;  5EPF A;  2XBQ A;  3TKS C;  2OE1 A;  4PGT A;  2HQT A;  3D4T A;  1M2D A;  2VAF A;  1MD3 A;  4A5P A;  1HNA A;  2C8U A;  4WEY A;  3FEU A;  4XS4 B;  1YKC A;  4BVY A;  1WWJ A;  4OCF A;  4I97 A;  1PRX A;  3UVH A;  1TK5 B;  1SVO A;  3HJO A;  2LUS A;  3GX8 A;  1ZGN A;  4MZC A;  12GS A;  4G01 A;  1TKD B;  5EVO A;  5J40 A;  1K0O A;  4LMW A;  4YQV A;  3VWU A;  4KW6 A;  4WF4 A;  2RUF A;  1X5C A;  1GRX A;  3QAG A;  4YKF A;  2H1B A;  2LEG A;  2CV4 A;  3IC8 A;  5DCG A;  2X49 A;  4G10 A;  1X5E A;  2OT3 A;  1MDK A;  1S3C A;  3UL3 A;  1ZCP A;  5CRD A;  2IMK A;  4JBB A;  3ZYW A;  4IQ1 A;  1OKD A;  4ZBB A;  3A2V A;  1FOH A;  2YNX A;  3GKX A;  2VIM A;  4TRX A;  5G5E A;  14GS A;  3VLN A;  3GL3 A;  2EFH A;  1Z7P A;  1TXU A;  2TIR A;  1YF1 A;  2H6Z A;  4AKX B;  4K2D A;  4K8M A;  5J4V A;  4ECC A;  3UEM A;  2VCV A;  5DDL A;  4TR4 A;  4IVF A;  4L0U A;  3A2X A;  3J7Y k;  3GKM A;  3APS A;  2WGR A;  5AIV A;  4KSM A;  5C04 A;  3JCM L;  2DJ0 A;  1PKZ A;  2A2S A;  1BF5 A;  3DVW A;  5IMF A;  5FWG A;  3CMI A;  3ZMK A;  5CRH A;  2YV7 A;  3O3T A;  4IW9 A;  3EU4 A;  3VI7 A;  3MWH A;  4KCE A;  4O92 A;  5J4Y A;  4J2F A;  4NAX A;  11GS A;  3O6T A;  1GWC A;  2R2J A;  1SJZ A;  3HKR A;  1YZX A;  2FWH A;  1HNC A;  5HR2 A;  1M7T A;  2EFD A;  2PBJ A;  4PUF C;  3IV4 A;  4ISD A;  3G9B A;  5GAN D;  4IJ3 A;  5CRW A;  4YAP A;  1NW2 A;  1PX7 A;  3QOU A;  1TK0 B;  2NVL A;  4MA9 A;  4OFN A;  19GS A;  2VL3 A;  1SKR B;  1X0R A;  4O5R A;  4AF2 A;  3GFK A;  3GV1 A;  5ECS A;  4V1A g;  3KTL A;  2CVK A;  1EOH A;  3TKQ A;  3GL5 A;  3LXZ A;  1V2A A;  4MPG A;  1M2B A;  3EMX A;  4FIW A;  4X4J A;  2PGT A;  1K3L A;  1ZOF A;  4KAE A;  4ML1 A;  1I5G A;  3HZ8 A;  4G9H A;  1G0T A;  1SEN A;  4HZ4 A;  2YZU A;  5B8A A;  2B7K A;  1GSD A;  4PNF A;  4TVE A;  1W89 A;  4N3Z A;  4TR3 A;  1DUG A;  2DKI A;  2AJQ B;  3TKS A;  4MLY A;  4BL7 A;  3I43 A;  2IFQ A;  3ED3 A;  1M9B A;  1ST9 A;  1YKA A;  3LG6 A;  1ML6 A;  2JU5 A;  5IO2 A;  1G6Y A;  2FNO A;  3IE3 A;  4TN8 A;  2CX3 A;  3UMA A;  1PSQ A;  4MF5 A;  1V9W A;  3IHG A;  3QMX A;  2EFE A;  1SJI A;  1WP0 A;  2H19 A;  1T00 A;  4HU7 A;  1SKS B;  2DJ3 A;  2A4V A;  1ZYE A;  5D73 A;  4BVY B;  3LXT A;  4FYU A;  1AC1 A;  4MP4 A;  1TU8 A;  1A23 A;  2M46 A;  4PQ1 A;  1BJX A;  3KH7 A;  4LLR A;  4XCS A;  3UAP A;  2L57 A;  4EL1 A;  2L6D A;  5J4U A;  4EE0 A;  5HFK A;  2EIO A;  2YPM A;  2J9H A;  2R3X A;  5HR3 A;  1KNG A;  2P5Q A;  4P3Y B;  3HYP A;  5HFI A;  2G0F A;  3WGX A;  2JL4 A;  1USB A;  2R6K A;  2O8V B;  3D22 A;  4POL A;  1Y1U A;  1EP7 A;  2VL2 C;  2GZY A;  5ECO B;  1FHE A;  1B4P A;  3FY7 A;  3DEX A;  1FOV A;  4N0Z A;  3U6V A;  1TJD A;  4PUA A;  3GA4 A;  3C1S A;  3TCO A;  3GHA A;  4JE1 A;  2DMM A;  1RQM A;  1VF2 A;  3F8U A;  2MBT A;  3NZN A;  3IK9 A;  1JLV A;  1EZK A;  5HR0 A;  13GS A;  1ZL9 A;  3BCI A;  2CQ9 A;  2QGV A;  3GUR A;  2PPT A;  2I1U A;  3APO A;  1EGO A;  2VCT A;  5J9B A;  5ECK B;  3IXR A;  2GGT A;  2HSN B;  3FZ5 A;  4HDE A;  3WGE A;  2PVQ A;  2M80 A;  1HD2 A;  1TTZ A;  1NHY A;  4IQA A;  1XW9 A;  3KP8 A;  2GVP A;  3H4K A;  2CAI A;  2RII A;  4ZB8 A;  5KN1 A;  3EWL A;  4YQU A;  1TRS A;  1T4Y A;  1R26 A;  4K2X A;  4GSS A;  2EC4 A;  3ZVJ D;  4D73 A;  3E3E A;  2MMO A;  1T8E B;  1MD4 A;  1OC8 A;  3EC3 A;  2KOK A;  4K1F A;  4N11 A;  2LS5 A;  3TJF A;  3TUE A;  2F3M A;  1V98 A;  5CNW A;  3ERW A;  6GSS A;  1SVM A;  4N30 A;  2VL9 A;  2B3S A;  2VD1 A;  2LQO A;  3A2W A;  1ERU A;  3TDG A;  4MAB A;  4O7H A;  3ERG A;  4CDO A;  3RDW A;  2JSY A;  4NWY A;  3H1N A;  2HFD A;  2V1M A;  1CQH A;  4GXZ A;  3VPT A;  2X8G A;  5COH A;  5B6M A;  4FQU A;  2FWE A;  2C80 A;  3DGQ A;  3PGT A;  1B4Q A;  3Q74 A;  3CBU A;  3R2Q A;  3EYT A;  4XHM A;  2X4A A;  3Q6O A;  3ZIV A;  2QA1 A;  2YV9 A;  3UOM A;  4L5L A;  2FD3 A;  3TJB A;  2LTK A;  1K0N A;  2IFQ B;  3KEB A;  2V6K A;  2DIY A;  1SKW B;  1YY7 A;  3ZRE A;  1K3O A;  2DJ2 A;  3CRT A;  2B5Y A;  1OE7 A;  2R5G A;  4MMM A;  1JFU A;  5DAK B;  2V2G A;  1NHO A;  2K8S A;  4H86 A;  3RHC A;  2KHP A;  1XCC A;  3TRP A;  18GS A;  3HVX A;  1F3B A;  1U87 A;  1NSW A;  5D9V A;  4NMU A;  3M8N A;  1GL8 A;  2B5X A;  2YP6 A;  2QSI A;  2IMI A;  4KF9 A;  4BPY A;  3DWV A;  1OVN A;  1OC9 A;  4TR0 A;  3GST A;  3ZIJ A;  1B9X C;  2VL2 A;  3W8S A;  2TRC P;  4WR4 A;  2FWG A;  4JR6 A;  1G7O A;  1TI1 A;  5ABR A;  1F6M C;  3UVT A;  1OKT A;  20GS A;  2NTO A;  2QA2 A;  1ERV A;  1XBS A;  3M9K A;  3F3Q A;  2HT9 A;  1GSS A;  2BJX A;  2F51 A;  1FO5 A;  1SL2 B;  3D0Z A;  2VLU A;  1XWG A;  3N5O A;  4IS0 A;  4K6X A;  3ZML A;  1KBN A;  3BJ5 A;  1OYJ A;  5H5Q A;  2YWO A;  4Z2T A;  2H8L A;  1WPI A;  1AQW A;  4GLT A;  4ID0 A;  3ZIT A;  2C3T A;  1OE8 A;  5G30 A;  1XPV A;  2ZCT A;  4EO3 A;  4ZB6 A;  4O5Q A;  2RUE A;  5ECQ B;  3GKN A;  4WF5 A;  1WIK A;  1Q98 A;  4F03 A;  2PUK C;  5DAL A;  4NHZ A;  5ECR B;  1UA5 A;  1I9D A;  5F0G A;  4L0W A;  1YEX A;  2ES7 A;  4POM A;  1XW6 A;  3GKK A;  5HR1 A;  2WRT A;  1AIU A;  1JHB A;  2HRK B;  2N5B A;  3IPZ A;  3FMW A;  1F2E A;  3F6F A;  3RPP A;  1ZMA A;  4D73 B;  5DQY A;  3HVS A;  4ZL8 A;  2LNT A;  1R7H A;  2OKA A;  3DKS A;  2MMA A;  3GH6 A;  4HUA A;  3LYP A;  4ZL9 A;  17GS A;  5KOX A;  6GSX A;  2AHE A;  3A5W A;  4PUR A;  1W4V A;  2HSY A;  2AV4 A;  2PMT A;  3FKF A;  1J0F A;  4EIQ A;  4HS1 A;  4HU9 A;  2OE3 A;  1LU4 A;  1H4O A;  1PA3 A;  2AB6 A;  1ERW A;  3IC4 A;  3M3M A;  5C00 A;  2B6M A;  5CAX A;  1B48 A;  1S3D A;  4IJI A;  5IMC A;  9GSS A;  2WCI A;  1JZO A;  2V6O A;  2H76 A;  2H0I A;  4RI7 A;  3H79 A;  4Q5N A;  2L59 A;  5IMZ A;  4K5R A;  1SD9 A;  5D9W A;  1V40 A;  4EVM A;  4MH3 A;  2RLI A;  1XWK A;  4G2E A;  2H1G A;  1N25 A;  3PIN A;  1YQ1 A;  2WDU A;  3FYG A;  3ME8 A;  2UV8 G;  1PL2 A;  3S9F A;  2HSN A;  16GS A;  2HI7 A;  5J41 A;  3D21 A;  1ACV A;  2GS3 A;  5ECP B;  2QC7 A;  3GMF A;  4QMK A;  2MZC A;  3A3T A;  3KCM A;  5DCH A;  2FLS A;  2YJH A;  4K5S A;  3IAS 2;  2HZE B;  2HSM A;  4E8H A;  1N8J A;  4YH2 A;  2R4V A;  1XVW A;  2GSS A;  1F3A A;  4J57 E;  2LRC A;  3ISO A;  1GUK A;  2JZT A;  2P0G A;  1MTC A;  2AAW A;  1OC9 B;  1BG1 A;  5G31 A;  1QUW A;  1K0A A;  3M0F A;  1A8L A;  3E0U A;  1GUH A;  5JCW A;  3ZLP A;  1LJR A;  4I5Q A;  2IWT A;  5JWO B;  2K9F A;  4MCU A;  2LRN A;  1TI3 A;  1JLW A;  2ZUP A;  2VUP A;  5J3R A;  2K6V A;  1V58 A;  3LQ7 A;  3MIX A;  2GDR A;  1X9W B;  4XTS A;  4MJC A;  1U88 A;  3NIV A;  1HYU A;  3Q18 A;  4ECJ A;  2O7K A;  1SK1 A;  1FG4 A;  1TP9 A;  2PVO C;  1VF1 A;  2EIR A;  2H1A A;  1TXX A;  2BMX A;  3H8Q A;  1Z6M A;  1VGL A;  4TOP A;  4NV5 A;  2VCZ A;  3GRX A;  1ON4 A;  4ZBD A;  3FK8 A;  3L4N A;  1SJ6 A;  4XIH A;  3W6G A;  2B5E A;  1DBY A;  5CP1 A;  1M99 A;  2IJY A;  2G2Q A;  3L9U A;  2VCW A;  2LST A;  4EDZ A;  2R0C A;  1DSB A;  3KXO A;  2CAQ A;  1Z7R A;  1DE2 A;  2EFC A;  1FB0 A;  2H0G A;  3D6I A;  1K0M A;  2OA7 A;  2LJR A;  2A2R A;  7GSS A;  5DJM A;  4X1U A;  2VM2 A;  5DAK A;  3F4S A;  5IOX A;  2AYT A;  4AGS A;  3IAM 2;  5DAL B;  5A34 A;  3F4T A;  3KMN A;  1THX A;  1BED A;  2C4J A;  1AQX A;  5ECI B;  3RHB A;  1PN0 A;  3QD9 A;  4JZQ A;  3LWA A;  2FCH A;  5A5H B;  3ZZX A;  5LCZ A;  4XRD A;  2MMZ A;  1ZYQ B;  3TOT A;  4RI6 A;  3IRA A;  5B7C A;  3ZVJ A;  3KJY A;  2DSA A;  3MAK A;  2OE0 A;  3UIW A;  3FR6 A;  2OJL A;  2PN8 A;  1MDI A;  1XXU A;  1VF3 A;  3HA9 A;  4ACS A;  4TXV A;  1BG5 A;  1TU7 A;  1GH2 A;  3L9S A;  2JAD A;  2R37 A;  3VK9 A;  1ABA A;  3QDN A;  2R0P A;  4O32 A;  4TXO A;  2R0G A;  4ZB9 A;  2C0E A;  4WXT A;  4OMV A;  1GLQ A;  4KDY A;  2A4H A;  2DJJ A;  5GSS A;  5B6N A;  3TGZ A;  3HZ4 A;  2P31 A;  1FVJ A;  2LV3 A;  2H1D A;  4MJE A;  5DQS A;  4CY8 A;  2D2Z A;  2K18 A;  5LNK e;  1EEJ A;  4IKH A;  4J56 E;  1SYX A;  1PMT A;  4OD7 A;  1Y25 A;  1U3I A;  2N5A A;  3ERF A;  5CRG A;  1EEM A;  4MK3 A;  4OFM A;  3TKS E;  3GN3 A;  2HLS A;  4GDF A;  2H66 A;  2H70 A;  1R5P A;  2HSM B;  5A1N B;  2YJ7 A;  2HRK A;  2GSQ A;  3SWL A;  1DE1 A;  4GST A;  2RM6 A;  3C1R A;  4KDX A;  1R5A A;  4WBR D;  1XOB A;  3OR5 A;  4POB A;  4KGI A;  5DVB A;  3F4R A;  2VO4 A;  1G7E A;  2E2G A;  1A8Y A;  4AJ7 A;  4X0X A;  2IL3 A;  3IK7 A;  1XFL A;  4F82 A;  4KSO A;  2L6C A;  2TRX A;  3CWG A;  2ALB A;  5H5S A;  5L71 A;  3TB2 A;  4BA7 A;  5IQY A;  4JRR A;  6GST A;  4CHS A;  1K3Y A;  5G1L A;  1XVQ A;  4L5O A;  3BOA A;  3LGC A;  2FY6 A;  1IYI A;  2O5V A;  1O8X A;  5BRT A;  3M9J A;  1YDK A;  3KTB A;  3GUS A;  1ZYP A;  5AN1 A;  4Q5R A;  1ZYN A;  3GX0 A;  1O73 A;  2FUG 2;  5IOW A;  2GQM A;  2YAN A;  4NHW A;  3WGD A;  4HQS A;  1IYH A;  3A5I A;  4ZL7 A;  1GTU A;  4V2M A;  1GNE A;  2GQL A;  4RQR A;  2IME A;  1M9A A;  2XBI A;  3QPM A;  1OAZ A;  1FAA A;  2I4A A;  4EXJ A;  4EC0 A;  4HJ2 A;  4LL4 B;  3F3R A;  5FT3 A;  4Z7X A;  2C3Q A;  2FA4 A;  2X8H A;  2XC2 A;  2O87 A;  2B1K A;  2HXK A;  5A34 B;  2V41 A;  1ZZY A;  2LNS A;  2I81 A;  1A2L A;  5ECN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...