3EE2A

Structure of human prostaglandin d-synthase (hgsts1-1) in complex with nocodazole
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
b'PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAIANWIKRRPQTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione-requiring prostaglandin D synthase
publication title Identification and characterisation of new inhibitors for the human hematopoietic prostaglandin D(2) synthase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ee2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ee2A01
1JFUA 2REMA 5IOWA 1AW9A 2NVLA 4LMWA 4PQ1A 1PMTA 3FEUA 5FHIA 1LBKA 3GKNA 4L0WA 2RUFA 3ZIVA 2LNSA 3ZREA 1TK8B 3DD3A 1X9WB 3UVTA 3RHCA 5F06A 3IE3A 3FZ5A 4HS1A 4LMVA 4KCEA 4V2MA 2YNXA 1BQ7A 5ELAA 3UJ1A 4BL7B 1MD3A 1T7PB 1ZMAA 2XBIA 2R37A 2X8GA 5CAXA 2FHEA 1YEPA 1PL1A 4KUNA 4EVMA 4DSSA 2EIQA 4I2UA 1H4OA 2WGRA 3HJMA 5LD0A 8GSSA 4WEYA 4ULXA 3VURA 3FKFA 1MTCA 4MJBA 4HJMA 2DSAA 2HRAA 4OFTA 1NHYA 5DBQA 2B1KA 3R3EA 3CSIA 4IBPA 5JWRB 1EOHA 5C04A 5HFGA 1AAZA 1GTBA 2H74A 2OBKA 1TJDA 3TKSA 4WKWA 3PH9A 3EU4A 5B8BA 4NWYA 2GQKA 2F8FA 4XHMA 3UOMA 2YZUA 5HR1A 4EF0A 1BG5A 3Q18A 2H8LA 4XS4A 5HR2A 2NTOA 4BA7A 3L4NA 1QMVA 3CXGA 4G10A 5CYYA 3UEMA 4MZBA 3CTGA 5AIVA 4V1Ag 1T3BA 1Z7PA 5DCHA 1ABAA 2CZ2A 3ME7A 4ZL7A 3A5WA 2I4AA 1A8LA 2HFDA 4FIWA 2IFQA 3S9FA 3O3TA 3HYPA 2YZHA 2HSMA 3H1NA 3KZQA 4IELA 2H0IA 3FZ9A 4IKHA 3OR5A 2R6KA 5D9TA 1DE1A 1AIUA 1GSSA 3IR4A 3UIWA 2GT5A 3MDKA 1QFNA 1GULA 4IN0A 1B9YC 3UVHA 3F9UA 4MMMA 3E0UA 1ERUA 1ON4A 2IIYA 1VF4A 1UVZA 5J5NA 4HU7A 4YAPA 3IDVA 5A5KA 4O92A 3UAPA 2OE0A 4F2IA 4F82A 2DIYA 3ZFLA 3ED3A 1SKRB 4JR6A 2J23A 5IQYA 4NPBA 1G0TA 5D96A 3GMFA 3VFIA 4G0IA 1R7HA 3WT1A 1E2YA 2GZZA 1M0UA 5ECSA 2BTOT 4MF6A 5GSTA 5DCGA 2LJKA 1W89A 5J9BA 5E4WA 3O76A 2VIMA 3WGEA 4MA9A 1FW1A 2KLXA 3FK8A 1U87A 3IC4A 4PQIA 2CVBA 5L71A 2P5QA 3FW2A 2DMMA 4OMVA 2B1LA 2V1MA 1XWCA 4DEJA 3H79A 3C73A 2PVOC 1OAZA 4EKZA 4HDEA 4X1UA 4POLA 2HRFA 4JU5A 2PWJA 5JCUA 3F4SA 17GSA 1GTIA 2C3QA 6GSSA 4AGSA 3ZRDA 4MJAA 3R2QA 2RLIA 1YJ6A 1B4QA 5G2ZA 2F9SA 1VRSD 1Y6EA 3QR6A 3EE2A 4MF7A 5HQPA 1K0AA 3LG6A 5IMZA 2GDRA 1M99A 2HE3A 2VCVA 4GTUA 2ZCTA 5KN3A 4TR4A 2YANA 1WIKA 3QFBC 2VCXA 6GSTA 3RPPA 5IM9A 3E9JB 3I9V2 2RM5A 1DUGA 2H6XA 1FOVA 3L0HA 5D9XA 3ZMLA 5KN2A 1TRVA 3AY8A 1AQXA 2H1AA 3RDWA 5B6MA 2YWNA 4HI7A 3DIEA 2XPEA 1JZRA 3D4MA 2HSHA 3K8NA 1V40A 1B9XC 1THXA 3KH7A 3ZZXA 2VL3A 3DVWA 1O6JA 3EURA 3D5JA 3IOSA 1ZGNA 2JACA 1WP0A 1OC9A 4BVXA 1EWXA 4I97A 5IO2A 2FUG2 3KM6A 4K8MA 1JLWA 1N8JA 3JCML 1Q4JA 3DGQA 4GF0A 2H76A 3HVVA 4K7IA 4PNFA 2RM6A 3APQA 3EMXA 1ZYEA 2JSZA 2GSTA 4Q5FA 1M9BA 5F8BA 2FWGA 1K0BA 2PU9C 4OFNA 4TR0A 3GL5A 1QUWA 3QMXA 1TW9A 4OWYA 1ERWA 3P2AA 4FO5A 3TOUA 2K6VA 2QC7A 4ILFA 4K7NA 2V2GA 5GAPD 1XOBA 2OJLA 1A0RP 4I6XA 2PGTA 2FNOA 1K0OA 1I5GA 2VLUA 1JZWA 3TKRA 5ECOB 2AJQB 4O7HA 2P31A 4L8EA 1JZOA 2DJJA 4F0CA 2I9HA 4RUVA 5CO3A 4PUFC 2F51A 2C4JA 2HRNA 2G0FA 1OYJA 3APOA 5ELGA 4EE0A 2L59A 3W6GA 4WETA 5IMCA 4O5RA 3P90A 5IPHA 1PKZA 3UARA 2FD3A 3A3TA 5DAKA 1MDJA 2HNLA 2P5RA 1OE8A 1LJRA 5A4VA 5G5EA 5G1LA 3TDGA 3E3EA 2A4VA 1XVWA 3L9VA 3Q6OA 5J3RA 4GLTA 1PGTA 1OKDA 2O89A 1XW9A 2YP6A 4KDYA 3DKSA 3I69A 1NM3A 2VCTA 1TP9A 2M80A 5DJMA 2GZPA 2H19A 2DC5A 1GSYA 3WD6A 4OCEA 6GSYA 2DBCA 2L5LA 2F3MA 2YJHA 1WE0A 4HQZA 2FWFA 5CRWA 3GFKA 4WXTA 4OFMA 3ME8A 1PQNA 5F05A 3KJYA 3LJRA 1CQHA 3TJBA 1X9SB 1TI3A 1IYIA 1X5DA 1A0FA 1FVJA 4O32A 1AC1A 2HYXA 1SJZA 3CRTA 1FAAA 3C71A 2GSSA 2GGTA 1PX6A 3IPZA 4BVYA 3D21A 3KGKA 3LXTA 11GSA 2H66A 3G7IA 5ECMB 2YWMA 5ECQB 1G7OA 4K7OA 1U3IA 3KCMA 1XBSA 3GHAA 3IAM2 2LSTA 3F3RA 4CDOA 3D22A 2WRTA 2ES7A 2VM2A 3MWHA 2LNTA 4N0ZA 4ZB6A 2VLVA 3EU3A 3APSA 1A8YA 4WR4A 2HSNB 5COHA 3KMNA 1O8XA 3LFLA 3ISOA 1GWCA 4MPGA 3GTUA 4DSRA 2YWOA 4E8HA 4PX1A 3EYTA 2LV3A 1SYXA 1Z9HA 3NZNA 2MBTA 4DSSB 4KX4A 2I1UA 1F37A 2TRXA 3BD2A 3G9BA 4WBRD 4MH3A 1A2JA 1PL2A 4CHSA 4EXJA 4NV2A 4N30A 1A24A 1FB6A 3VWUA 1TRSA 4RI7A 1GP1A 1O85A 4ZILA 3DYRA 3GN3A 3WGDA 13GSA 1X5EA 1T1VA 2DJ0A 4OD7A 5EPFA 2X64A 4TXOB 1RQMA 3BCIA 4KSOA 1V58A 1OE7A 1EP8A 5GAND 4K9ZA 1FG4A 1WOUA 4L5OA 1UN2A 4V2NA 1THOA 2Z9SA 4POKA 3LQ7A 2LQOA 1EOGA 4LL1B 1TU8A 3TKQA 3GX8A 2LUSA 2FY6A 1A2LA 4USSA 3C8EA 1B4PA 2B5YA 3GYKA 3U5RE 5ECIB 1XXUA 3UBLA 2X8HA 1XWKA 3M8NA 3TOTA 4WR5A 3F63A 5FT3A 4TR1A 1FO5A 4XS6A 2L57A 3SWLA 3RAZA 1HQOA 3IV4A 2HSMB 5LCZA 3N9JA 1SJIA 4XTSA 3TKSE 3A2VA 1PKWA 4FH8A 4PQHA 4ZBDA 6GSWA 3QFAC 4J57E 4JBBA 4GSNA 3BBYA 2V6OA 4PGTA 2JADA 2NPBA 2L6CA 2C1YA 2OACA 1WWJA 1URMA 2IPAA 2GT6A 1G7EA 4OO5A 2GSQA 3MNGA 3HJOA 1YF0A 4I2TA 4ZL9A 3WGXA 1VF2A 1EGRA 4EDZA 1KEBA 5IMVA 2DJ2A 5JCGA 4X0XA 1O8WA 3LEFA 2DJKA 3UMAA 1Z5YE 2HI7A 3FHKA 5JWQB 1EEJA 4G0KA 4MDCA 2NDOA 4ACSA 2VM1A 4GXZA 2FWHA 1G6YA 2LTKA 4K0GA 1YKAA 2IL3A 1F6MC 4IGJA 2MZCA 4QQ7A 5IOXA 3HXSA 2CV4A 2GZYA 1SD8A 2VAFA 1XWGA 4XCSA 4MZWA 1VGLA 2E2MA 3LGCA 1J0FA 2EC4A 1SJ6A 2ON5A 3P8WA 2H70A 3BJ5A 3QAWA 2V32A 4TR3A 1PA3A 5CNWA 3TJJA 1WRYA 5INYA 3PR8A 3C1RA 1O73A 1ST9A 1V9WA 3GNJA 2GVPA 5HFIA 2FLSA 5JWOB 3GKKA 4YH2A 3ERGA 3VI5A 2BMXA 1TU7A 3N5OA 5AN1A 4EDYA 5ECPB 3FZAA 4TRXA 4IS0A 2VO4A 2C8UA 3F6FA 3QCPA 2FCHA 5H5QA 1ML6A 3TRPA 3KH9A 4XRAA 3RHBA 4BPYA 2C0GA 1QQ2A 2FA8A 2OE3A 2A2SA 2WS2A 3F3QA 1ZL9A 3J7Yk 1O81A 4MCUA 1XPVA 3PPUA 2VD1A 3ZIJA 1AUCA 20GSA 1S3DA 3GSTA 3EVIA 2H75A 4QL7A 3GUSA 1OC9B 4BVXB 2MMZA 4XS1A 5DALA 3VWXA 1XOAA 4MABA 5IPGA 1GH2A 4LL4B 2DMLA 2CT6A 5CRGA 2DJ3A 4WF5A 3UL3A 4ECBA 2AUVA 5KN1A 3FR6A 3DRNA 3VK9A 3M9JA 1MEKA 4HOJA 4ZBAA 1FHEA 1EEMA 5KEJA 3DMLA 4RI6A 4ISDA 3D4TA 1C72A 3EWLA 3QOUA 2AYTA 3UBKA 2L5OA 1GUHA 2B7JA 4NXIA 1GL8A 2MMOA 5D9VA 1T4ZA 2JZRA 4WBJA 3DVXA 1XVQA 4IW9A 2HRKA 1SK2A 1GSUA 3G7YA 1F3AA 3GH6A 4FYCA 4HEA2 3MAKA 3HZ4A 4MP4A 2WULA 4KGIA 2N5FA 5G31A 3GX0A 2PVQA 2XPDA 22GSA 3CSJA 4Q5NA 4QL9A 1NHOA 4GWRA 1RW1A 3LYPA 3J7Yb 3HKRA 5AIXA 2IN3A 3TJGA 4Q5QA 4KH7A 5DAKB 1TK0B 1Z6MA 1GSDA 1DBYA 4YAVA 2K9FA 2HQTA 3VWVA 4KB3A 2C0DA 2IMIA 3PINA 12GSA 5EVOA 3F6DA 4ZXGA 1BYEA 1Q98A 2LRCA 3QPMA 1Z7RA 5ID2A 2LRTA 3KMOA 3GURA 5CREA 4TOPA 2N5BA 3CYNA 2YV7A 1G6WA 4JRRA 2M72A 3ZMKA 2FA4A 2LQQA 1GSFA 4MPFA 2B6MA 5HR0A 3LXZA 5ECRB 2GQLA 2OE1A 4GCIA 2YN1A 3M1GA 1XW5A 1EGOA 2R2JA 2JZTA 2X99A 2CX3A 5KN0A 5DJLA 3FR9A 3TKSC 18GSA 4G19A 4K6XA 4F03A 4HJ2A 3TUEA 2CVKA 2I3YA 2VCZA 1KNGA 2LKUA 3HA9A 5G30A 4MK3A 4LLRA 4NV5A 2RIIA 4BVYB 3QD9A 1YY7A 10GSA 4DSQA 2WCIA 2V41A 1SYRA 1ZYQB 2H30A 1HNAA 4G2EA 1GUKA 5D9WA 4KA0A 2AB6A 3US3A 2IMKA 4NHWA 1QGVA 2VLTA 1HD2A 3A2XA 4POMA 2JU5A 3ZVJD 1E6BA 2C3NA 1UC7A 1PD21 14GSA 1HYUA 2H71A 1A2MA 3W8JA 1DSBA 3PGTA 3GA4A 2EIOA 1M7TA 4PNGA 3F4TA 1BAYA 3L78A 5J4UA 1GSEA 3GTUB 1Z3EA 2YJ7A 1OKTA 4RQRA 1X5CA 1AXDA 1WJKA 3LORA 3ZL5A 2PBJA 1ZCPA 1SK0A 4EL1A 4MZCA 1GNEA 3HCZA 4IP6A 19GSA 5D93A 1YZXA 1V2AA 5FWGA 2HSYA 2X8CA 4X43A 5ENUA 1I9DA 1XW6A 2LRNA 4IQAA 2MYGA 4AJ7A 1TOFA 3ZVJA 2PPTA 5IO0A 2HZEA 5H5RA 4TW5A 3IRAA 1OC8A 5IMDA 1N2AA 1XIYA 3ZYWA 4EO3A 4GRFA 1GRXA 4NAXA 1F2EA 3RPNA 1PSQA 4KW6A 1WPIA 4EC0A 2JZSA 4BWQA 2XC2A 1HNBA 5G5FA 2L6DA 2HT9A 4K0NA 5IIZA 3C1SA 3TCOA 3CSHA 2E0QA 1W4VA 5J41A 4IJIA 3GSSA 3DWVA 2YCDA 1GNWA 1MD4A 4D73A 2ZUPA 5H5SA 1CQGA 5A4WA 4DVCA 4KSMA 2LJAA 2VL2C 3D6IA 2CX4A 3NIVA 2BJXA 4NMUA 1XWBA 2H73A 5EY6A 5D8IA 4GQCA 1JLVA 1SKSB 2OKAA 2HXKA 2IMDA 2AAWA 1K0CA 2YV9A 3VLNA 4IJ3A 4CW9A 1R5PA 4TR1B 3IBHA 2KHPA 4XS4B 2KUCA 3HVXA 2QKEA 1R4WA 2GSRA 6GSXA 2C0EA 2GQMA 3WYWA 2IMFA 1S3AA 2WB9A 2VD0A 2O85A 5ECNB 4WF4A 3EINA 3KIJA 2J9HA 5CRDA 4KDXA 3TRQA 2EIRA 3FYGA 2DLXA 4MH2A 3ZLPA 4BL7A 3TJFA 3LYKA 2RUEA 5CP1A 1TXXA 3IXRA 3QDNA 2PUKC 2IFQB 1K0DA 2YPMA 1YQ1A 3TKPA 3LSZA 2O7KA 4JR4A 4TXOA 2HZFA 2FWEA 4JEDA 3CTFA 1JHBA 2PMTA 4ECJA 2GS3A 2JSYA 3H8QA 3HY2A 1TRWA 2ALBA 2TIRA 7GSSA 2FGXA 1V98A 1K3OA 3DXBA 2CA8A 5B7CA 2H1GA 3NOFA 2VUPA 5GSSA 3KEBA 1GTAA 2C0FA 1XFLA 1IYHA 4FQUA 4N11A 2H6ZA 3LWAA 2IWTA 5GZZB 4IHUA 2VL9A 3HDCA 2PN8A 4K1FA 2AHEA 1SD9A 2D2ZA 3DEXA 5BMUA 2MMNA 1F3BA 2OA7A 3GL3A 2NBSA 3SBCA 3QAGA 4AJ8A 1BJXA 2PERA 1JZDA 2H0HA 2YOIA 5B6NA 9GSSA 2WDUA 2K18A 3M0FA 3CMIA 5C00A 3BCKA 4FYBA 1B8XA 4ECIA 3L9UA 3M9KA 2B3SA 2GLRA 3GKXA 1K3LA 1O7UA 3IK9A 1VF1A 4ZB8A 4MLYA 2CVDA 1F9MA 1LU4A 1M2DA 4J2FA 3HZ8A 2IMEA 6GSUA 5HR3A 2ON7A 4JZQA 3I43A 1ILOA 3ERFA 3VI7A 1AQVA 4MF5A 4J56E 1R26A 4YQVA 1FVKA 5G1KA 4BWSA 3GIXA 3H93A 3ZFBA 4NHZA 5EL8A 4ZBBA 3IA1A 3QAVA 4G9HA 3C7MA 2L4QA 2C3TA 3KP9A 4HZ2A 1SK1A 1PN9A 4F0BA 1YKCA 1SU9A 3V1WA 1Y25A 1HNCA 5LNKe 1ZZYA 4OO4A 1B48A 1GSQA 2TRCP 3Q19A 1BEDA 4I8BA 5ECKB 2VL2A 2JL4A 2KOKA 2H6YA 5HFKA 2DIZA 5J9CA 4PURA 2H1BA 2LEGA 4ID0A 4PXOA 5DALB 2ZNMA 1XWAA 5E59A 2CAIA 2N5AA 1U3AA 1DE2A 1GLQA 2B5EA 5ABRA 4GSSA 1SL0B 4GQFA 1ERTA 3GH9A 1K0MA 3BOAA 3H4KA 4KDUA 2E7PA 3U6VA 1KBNA 2WZ9A 3FY7A 3KD0A 3KP8A 4TXVA 2H1DA 4AJ6A 1SENA 1T8EB 3TB2A 4G0LA 1X9MB 1EV4A 4ML6A 2HLSA 2IJYA 4L5LA 4JE1A 4IVFA 4Z7XA 1ERVA 1VF3A 2HRKB 2LS5A 4ML1A 1GLPA 3EC3A 2WFCA 3VWWA 3TGZA 2YWIA 1M2BA 2WJUA 3RBTA 4KCAA 1GTUA 3KTLA 3KXOA 4KE3A 1R5AA 2VCQA 4PUAA 4MJEA 1U88A 3FR3A 2H0GA 2C80A 3IK7A 2K8SA 4RQXA 2QGVA 16GSA 3W8SA 1M2AA 2P0GA 3A2WA 4GSTA 4HQSA 2G2QA 1KTEA 1K0NA 4E8EA 3MSZA 2UZ8A 2GTUA 3IHQA 5ECHB 2M46A 3O6TA 3ZITA 2A2RA 3FRCA 5B8AA 1YDKA 1SL1B 3FZ4A 5ID2B 1QXHA 3CBUA 1TRUA 1OVNA 4H86A 1TI1A 3GV1A 1NW2A 4Q5RA 4HZ4A 2CAQA 3Q74A 1V57A 4MJCA 2CZ3A 1XCCA 1J9BA 2XBQA 2CQ9A 3M3MA 5AGYA 5DQSA 2V6KA 3VPTA 4I5QA 3P7XA 3KTBA 4HU9A 1PX7A 2XHFA 4TVEA 3HHVA 3HD5A 4TKYA 5D73A 4XRDA 2R4VA 6GSVA 4KF9A 5A4UA 1USBA 4KNDA 2L4CA 1TKDB 2H72A 3VPQA 2E2GA 2KP2A 3WT2A 2R3XA 1TTZA 2O8VB 4ZL8A 1YEXA 5IMAA 1UA5A 2F8AA 2O87A 5DQYA 1SL2B 1T00A 4AF2A 3EMPA 5IMFA 2QSIA 1SKWB 3IAS2 1U6TA 5ECLB 4ECCA 3F0IA 1M9AA 1BX9A 1XZOA 1EV9A 1FB0A 1AQWA 2B7KA 3TRXA 4V1Ap 2VOCA 2H01A 1Z6NA 2I81A 1A23A 5F0GA 4HUAA 2MBSA 1NSWA 3I6AA 1OC3A 4OCFA 3HVSA 5DVBA 5CRHA 1RK4A 4P3YB 4POBA 1H75A 5F07A 4PTSA 4F9ZA 2B5XA 2LJRA 2OADA 5DDLA 1ACVA 1J08A 2HZEB 1EP7A 1TDIA 1YF1A 4L0UA 3D0ZA 1TK5B 3CRUA 4LA1A 4TN8A 3GKMA 2DJ1A 3F4RA 1PRXA 1WMJA 1X0RA 5JCWA 3IC8A 3GRXA 3HJPA 4ZIJA 4IP1A 4IQ1A 1EZKA 1MDIA 2K8VA 5AISA 1T4YA 3ZTLA 3ERWA 1ZOFA 4KAEA 2OBIA 4YQMA 4EUYA 1GUMA 4K2DA 4D73B 3G7JA 4YQUA 4FYUA 1MDKA 2VCWA 2AV4A 4N10A 2R5GA 1K3YA 4N0VA 4ZB9A 1S3CA 3L9SA 3TJKA 1QK8A 4XIHA 2KP1A 2MMAA 4V2LA 3F8UA
chains in the Genus database with same CATH superfamily
1JFUA 4QMKA 2REMA 5IOWA 1AW9A 2NVLA 4LMWA 4PQ1A 1PMTA 3FEUA 5FHIA 1LBKA 2HSNA 3GKNA 4L0WA 2RUFA 3ZIVA 2LNSA 3ZREA 1TK8B 3DD3A 1X9WB 3UVTA 3RHCA 5F06A 3IE3A 3FZ5A 4HS1A 4LMVA 4KCEA 4V2MA 2YNXA 1BQ7A 5BRTA 5ELAA 3UJ1A 4BL7B 1MD3A 1T7PB 1ZMAA 2XBIA 2R37A 2X8GA 4K5RA 5CAXA 2FHEA 1YEPA 1PL1A 4KUNA 4EVMA 4DSSA 2EIQA 4I2UA 1H4OA 2WGRA 3HJMA 5LD0A 8GSSA 4WEYA 4ULXA 3VURA 3FKFA 3A5IA 1MTCA 4MJBA 4HJMA 2DSAA 2HRAA 4OFTA 1NHYA 5DBQA 2B1KA 3R3EA 3CSIA 4IBPA 5JWRB 1M3JA 1EOHA 5C04A 4BIKA 5HFGA 1AAZA 1GTBA 2H74A 2OBKA 1TJDA 3TKSA 4WKWA 4O5QA 3PH9A 3EU4A 5B8BA 4NWYA 2GQKA 2F8FA 2WZSA 4XHMA 3UOMA 2H1LA 2YZUA 5HR1A 4EF0A 2WVZA 1BG5A 3Q18A 2H8LA 4XS4A 5HR2A 2NTOA 4BA7A 3L4NA 4EIPA 5A5HB 5BMUB 1QMVA 3CXGA 4G10A 5CYYA 3UEMA 4MZBA 3CTGA 5AIVA 4V1Ag 1T3BA 1Z7PA 5DCHA 1ABAA 2CZ2A 3ME7A 4ZL7A 3A5WA 2I4AA 1A8LA 2HFDA 4FIWA 4AKGA 2IFQA 3S9FA 3O3TA 3HYPA 2YZHA 2HSMA 3H1NA 3KZQA 5J4VA 4IELA 2H0IA 3FZ9A 4IKHA 3OR5A 2R6KA 5D9TA 1DE1A 1AIUA 1GSSA 3IR4A 3UIWA 2GT5A 3MDKA 1QFNA 1GULA 4IN0A 4GDFA 1B9YC 3UVHA 3F9UA 4MMMA 3E0UA 1ERUA 1ON4A 5J40A 5A34A 2IIYA 1VF4A 1UVZA 5J5NA 4HU7A 4YAPA 3IDVA 5A5KA 4O92A 3UAPA 2OE0A 4F2IA 4F82A 2DIYA 3ZFLA 3ED3A 1SKRB 4JR6A 2J23A 5IQYA 4NPBA 1G0TA 5D96A 3GMFA 3VFIA 4G0IA 1R7HA 3WT1A 1E2YA 2GZZA 1M0UA 5ECSA 2BTOT 4MF6A 5GSTA 5DCGA 2LJKA 1W89A 5J9BA 5E4WA 3O76A 2VIMA 2WVXB 3WGEA 4MA9A 1FW1A 2KLXA 3FK8A 1U87A 3IC4A 4PQIA 2CVBA 5L71A 2P5QA 3FW2A 5KOXA 2DMMA 4OMVA 2B1LA 2V1MA 1XWCA 4DEJA 3H79A 3C73A 2PVOC 1OAZA 4EKZA 2QA2A 4HDEA 4X1UA 4POLA 2HRFA 4JU5A 2PWJA 5JCUA 3F4SA 17GSA 1GTIA 2C3QA 6GSSA 4AGSA 4Z2UA 3ZRDA 4MJAA 3R2QA 2RLIA 3CWGA 1YJ6A 1B4QA 5G2ZA 2F9SA 1VRSD 1Y6EA 3QR6A 3EE2A 4MF7A 5HQPA 1K0AA 3LG6A 5IMZA 2GDRA 1M99A 2HE3A 2VCVA 4GTUA 2ZCTA 5KN3A 4TR4A 2YANA 1WIKA 3QFBC 2VCXA 6GSTA 3RPPA 5IM9A 2R0PA 3E9JB 3I9V2 2RM5A 1DUGA 2H6XA 1FOVA 3L0HA 5D9XA 3ZMLA 5KN2A 1TRVA 3AY8A 1AQXA 2H1AA 5A1NA 3RDWA 5B6MA 2YWNA 4HI7A 3DIEA 2XPEA 1JZRA 3D4MA 2HSHA 3K8NA 1V40A 1B9XC 1THXA 3KH7A 3ZZXA 2VL3A 3DVWA 1O6JA 3EURA 3D5JA 3IOSA 1ZGNA 2JACA 1WP0A 1OC9A 4BVXA 4YKGA 1EWXA 4I97A 5IO2A 2FUG2 3KM6A 4K8MA 1JLWA 1N8JA 2EFCA 3JCML 1Q4JA 3DGQA 4GF0A 2H76A 3HVVA 4K7IA 4PNFA 2RM6A 3APQA 3EMXA 1ZYEA 2JSZA 2GSTA 4Q5FA 1M9BA 5F8BA 2FWGA 1K0BA 2PU9C 4OFNA 4TR0A 4E68A 3GL5A 1QUWA 3QMXA 1TW9A 4OWYA 1ERWA 3P2AA 4FO5A 3TOUA 2K6VA 2QC7A 4ILFA 4K7NA 2V2GA 3CHXC 5GAPD 1XOBA 2OJLA 1A0RP 4I6XA 2PGTA 2FNOA 1K0OA 1I5GA 2VLUA 1JZWA 3TKRA 3TU3B 5ECOB 2AJQB 4O7HA 2P31A 4L8EA 1JZOA 1PFOA 2DJJA 4F0CA 2I9HA 4RUVA 5CO3A 4PUFC 2F51A 2C4JA 2HRNA 2G0FA 1OYJA 3APOA 5ELGA 4EE0A 2L59A 3W6GA 4WETA 5IMCA 4O5RA 3P90A 5IPHA 1PKZA 3UARA 2FD3A 3A3TA 5DAKA 2WW1A 1MDJA 2HNLA 2P5RA 1OE8A 1LJRA 5A4VA 5G5EA 1S4BP 5G1LA 3TDGA 3E3EA 2A4VA 1XVWA 3L9VA 3Q6OA 5J3RA 4GLTA 1PGTA 1OKDA 2O89A 1XW9A 2YP6A 4KDYA 3DKSA 3I69A 1NM3A 2A4HA 2VCTA 1TP9A 2M80A 5DJMA 2GZPA 2UV8G 2H19A 2DC5A 1GSYA 3WD6A 4OCEA 4X4JA 6GSYA 2DBCA 2L5LA 2F3MA 2YJHA 1WE0A 4HQZA 2FWFA 5CRWA 3GFKA 4WXTA 4OFMA 3ME8A 1PQNA 5F05A 3KJYA 3LJRA 1CQHA 3TJBA 1X9SB 1TI3A 1IYIA 1X5DA 3HMJG 1A0FA 1FVJA 4O32A 1AC1A 2HYXA 1SJZA 3CRTA 1FAAA 3C71A 2GSSA 2GGTA 1PX6A 3IPZA 4BVYA 3D21A 3KGKA 3LXTA 11GSA 2H66A 3G7IA 5ECMB 2YWMA 1PN0A 5ECQB 1G7OA 4K7OA 4AKIA 1U3IA 2R0GA 3KCMA 2A2PA 4FXYP 1XBSA 3GHAA 3IAM2 2LSTA 3F3RA 4CDOA 3D22A 2WRTA 2ES7A 2VM2A 3MWHA 2LNTA 4AKXB 4N0ZA 4ZB6A 2VLVA 3EU3A 3APSA 1A8YA 4WR4A 2HSNB 5COHA 3KMNA 1O8XA 3RFRC 3LFLA 3ISOA 1GWCA 2O3EA 4MPGA 3GTUA 1YEWC 4DSRA 2YWOA 4E8HA 4PX1A 3EYTA 2O5VA 2LV3A 1SYXA 1Z9HA 3NZNA 2MBTA 4DSSB 4KX4A 4A5PA 2I1UA 1F37A 2TRXA 3BD2A 3G9BA 4WBRD 4MH3A 1A2JA 4ZB7A 1PL2A 4CHSA 4EXJA 4NV2A 4N30A 1A24A 1FB6A 3VWUA 1TRSA 4RI7A 1GP1A 1O85A 4ZILA 3DYRA 3GN3A 3WGDA 13GSA 1X5EA 1T1VA 2DJ0A 4OD7A 5EPFA 2X64A 4TXOB 1RQMA 3BCIA 4KSOA 1V58A 1OE7A 1EP8A 5GAND 4K9ZA 1FG4A 1WOUA 4L5OA 1UN2A 4V2NA 1THOA 2Z9SA 5J47A 4POKA 4K2XA 3LQ7A 2LQOA 1EOGA 4LL1B 1TU8A 3TKQA 3GX8A 3HVNA 2LUSA 2WW0A 2FY6A 1A2LA 4USSA 3C8EA 1B4PA 2B5YA 3GYKA 3U5RE 5ECIB 4Z2RA 1XXUA 3UBLA 2X8HA 1XWKA 3M8NA 3TOTA 4WR5A 4YKFA 3F63A 5FT3A 4TR1A 1FO5A 1Y1UA 4XS6A 2L57A 3SWLA 3RAZA 1HQOA 3IV4A 2HSMB 2EFHA 5LCZA 3N9JA 1SJIA 4XTSA 3TKSE 3A2VA 1PKWA 4FH8A 1S3RA 4PQHA 4ZBDA 6GSWA 3QFAC 4J57E 4JBBA 4GSNA 3BBYA 2V6OA 4PGTA 2JADA 2NPBA 2L6CA 2C1YA 2OACA 1WWJA 1URMA 2IPAA 2GT6A 1G7EA 4OO5A 1SVLA 2GSQA 3MNGA 3HJOA 5A34B 1YF0A 1ZYNA 4I2TA 4ZL9A 3WGXA 1VF2A 3FMWA 1EGRA 4EDZA 1KEBA 5IMVA 4W66A 2DJ2A 5JCGA 4X0XA 1O8WA 3LEFA 2DJKA 3UMAA 1Z5YE 2HI7A 3FHKA 5JWQB 1EEJA 4G0KA 4MDCA 2NDOA 4ACSA 2VM1A 4GXZA 2FWHA 1G6YA 2LTKA 4K0GA 1YKAA 2IL3A 1F6MC 4IGJA 2MZCA 4QQ7A 5IOXA 3HXSA 2CV4A 2GZYA 1SD8A 2VAFA 1XWGA 4XCSA 4MZWA 1VGLA 2E2MA 3LGCA 1J0FA 2EC4A 1SJ6A 2ON5A 5J4YA 1TXUA 3P8WA 2H70A 3BJ5A 3QAWA 2V32A 4TR3A 1PA3A 5CNWA 3TJJA 1WRYA 5INYA 3PR8A 3C1RA 1O73A 1ST9A 1V9WA 3GNJA 2GVPA 5HFIA 2FLSA 5JWOB 3GKKA 4YH2A 3ERGA 2EFEA 3VI5A 2BMXA 1TU7A 3N5OA 5AN1A 4EDYA 5ECPB 3FZAA 4TRXA 4IS0A 2VO4A 2C8UA 3F6FA 3QCPA 2FCHA 5H5QA 1ML6A 3TRPA 1SVMA 3KH9A 3IHGA 4K5SA 4XRAA 3RHBA 4BPYA 2C0GA 1QQ2A 2FA8A 2OE3A 2A2SA 2WS2A 3F3QA 1ZL9A 3J7Yk 1O81A 4MCUA 1XPVA 3PPUA 2VD1A 3ZIJA 1AUCA 20GSA 1S3DA 3GSTA 4G01A 3EVIA 2H75A 2X4AA 4QL7A 3GUSA 1OC9B 4BVXB 2MMZA 4XS1A 5DALA 3VWXA 1XOAA 4MABA 5IPGA 1GH2A 4LL4B 2DMLA 2CT6A 5CRGA 2DJ3A 4WF5A 3UL3A 4ECBA 2AUVA 5KN1A 3FR6A 3DRNA 3VK9A 3M9JA 1MEKA 4HOJA 4ZBAA 1FHEA 1EEMA 5KEJA 3DMLA 4RI6A 4ISDA 3D4TA 1C72A 3EWLA 3QOUA 2AYTA 3UBKA 2L5OA 1GUHA 2B7JA 4NXIA 1GL8A 2MMOA 5D9VA 1T4ZA 2JZRA 4WBJA 3DVXA 1XVQA 4IW9A 2HRKA 1SK2A 1GSUA 3G7YA 1F3AA 3GH6A 4FYCA 4HEA2 3MAKA 3HZ4A 4MP4A 2WULA 4KGIA 2N5FA 5G31A 3GX0A 4AKHA 2PVQA 2XPDA 22GSA 3CSJA 4Q5NA 4QL9A 1NHOA 4GWRA 1RW1A 3LYPA 3J7Yb 3HKRA 5AIXA 2IN3A 3TJGA 4Q5QA 4KH7A 5DAKB 1TK0B 1Z6MA 1GSDA 1DBYA 5KOWA 4YAVA 2K9FA 2HQTA 3VWVA 4KB3A 2C0DA 2IMIA 3PINA 12GSA 2DKIA 5EVOA 3F6DA 4ZXGA 1BYEA 1Q98A 2LRCA 3QPMA 1Z7RA 4HSCX 5ID2A 2LRTA 3KMOA 3GURA 5CREA 4TOPA 2N5BA 3CYNA 2YV7A 1G6WA 4JRRA 2M72A 3ZMKA 2FA4A 2LQQA 1GSFA 4MPFA 2B6MA 5HR0A 3LXZA 5ECRB 2GQLA 2OE1A 4GCIA 2YN1A 3M1GA 1XW5A 1EGOA 2R2JA 2JZTA 4MNNA 2X99A 2CX3A 5KN0A 5DJLA 3FR9A 3TKSC 18GSA 4G19A 4K6XA 4F03A 4HJ2A 3TUEA 2CVKA 2I3YA 2VCZA 1KNGA 2LKUA 3HA9A 5G30A 4MK3A 4LLRA 4NV5A 2RIIA 4BVYB 3QD9A 4Z2TA 1YY7A 10GSA 4DSQA 2WCIA 2V41A 1SYRA 1ZYQB 2H30A 1HNAA 4G2EA 1GUKA 5D9WA 4KA0A 2AB6A 3US3A 1I1IP 2IMKA 4NHWA 1QGVA 2VLTA 1HD2A 3A2XA 4POMA 2JU5A 3ZVJD 1E6BA 2C3NA 1UC7A 1PD21 14GSA 1HYUA 2H71A 1A2MA 3W8JA 1DSBA 3PGTA 3GA4A 2EIOA 1M7TA 4PNGA 3F4TA 1BAYA 3L78A 5J4UA 1GSEA 2OT3A 3GTUB 1Z3EA 2YJ7A 1OKTA 4RQRA 1X5CA 1AXDA 1WJKA 3LORA 3ZL5A 2PBJA 1ZCPA 1SK0A 4EL1A 4MZCA 1GNEA 3HCZA 4IP6A 19GSA 5D93A 1YZXA 1V2AA 5FWGA 2HSYA 2X8CA 4X43A 5ENUA 1I9DA 1XW6A 2LRNA 4IQAA 2WW2A 2MYGA 4AJ7A 1TOFA 3ZVJA 2PPTA 5IO0A 2HZEA 5H5RA 4TW5A 3IRAA 1OC8A 5IMDA 1N2AA 1XIYA 2X49A 3ZYWA 4EO3A 4GRFA 1GRXA 4NAXA 1F2EA 3RPNA 1PSQA 4ICYA 4KW6A 1WPIA 4EC0A 2JZSA 4BWQA 2XC2A 1HNBA 5G5FA 2L6DA 2HT9A 4K0NA 5IIZA 3C1SA 3TCOA 4CY6A 3CSHA 2E0QA 1W4VA 5J41A 4IJIA 3GSSA 3DWVA 2YCDA 1GNWA 1MD4A 4D73A 2ZUPA 4CY8A 5H5SA 1CQGA 5A4WA 4DVCA 4KSMA 2LJAA 3CQFA 2VL2C 3D6IA 2CX4A 3NIVA 2BJXA 4NMUA 1XWBA 2H73A 5EY6A 5D8IA 4GQCA 1JLVA 1BG1A 1SKSB 2OKAA 2HXKA 2IMDA 2AAWA 1K0CA 2YV9A 3VLNA 4IJ3A 4CW9A 1R5PA 4TR1B 3IBHA 2KHPA 1N25A 4XS4B 2KUCA 3HVXA 2QKEA 1R4WA 2GSRA 6GSXA 2C0EA 2GQMA 3WYWA 2IMFA 1S3AA 2WB9A 2VD0A 2O85A 5ECNB 4WF4A 3EINA 3KIJA 2VKZG 2J9HA 5CRDA 4KDXA 3TRQA 2EIRA 3FYGA 2DLXA 4MH2A 3ZLPA 4BL7A 3TJFA 3LYKA 2RUEA 1SVOA 5CP1A 1TXXA 3IXRA 2WW3A 3QDNA 2PUKC 2IFQB 1K0DA 2YPMA 1YQ1A 3TKPA 3LSZA 2O7KA 4JR4A 4TXOA 2HZFA 2FWEA 4JEDA 3CTFA 2QA1A 1JHBA 2PMTA 4ECJA 2GS3A 2JSYA 3H8QA 3HY2A 4N3ZA 1TRWA 2ALBA 2TIRA 7GSSA 2FGXA 1V98A 1K3OA 3DXBA 2CA8A 5B7CA 2H1GA 3NOFA 2VUPA 5GSSA 3KEBA 1GTAA 2C0FA 1XFLA 1IYHA 4FQUA 4N11A 2H6ZA 3LWAA 4O5UA 4PI2C 2IWTA 3MYDA 5GZZB 4IHUA 2VL9A 3HDCA 2PN8A 4K1FA 2AHEA 5A5HA 1SD9A 2D2ZA 3DEXA 5BMUA 2MMNA 1F3BA 2OA7A 3GL3A 2NBSA 3SBCA 3QAGA 4AJ8A 1BJXA 2PERA 1JZDA 2H0HA 2YOIA 5B6NA 9GSSA 2WDUA 2K18A 3M0FA 2R0CA 3CMIA 5C00A 3BCKA 4FYBA 1B8XA 4ECIA 3L9UA 3M9KA 2B3SA 2GLRA 3GKXA 1K3LA 1O7UA 3IK9A 1VF1A 4ZB8A 4MLYA 2CVDA 1F9MA 1LU4A 1M2DA 4J2FA 3HZ8A 2IMEA 6GSUA 5HR3A 2ON7A 4JZQA 3I43A 1ILOA 3ERFA 3VI7A 1AQVA 4MF5A 4J56E 1R26A 3MIXA 4YQVA 1FVKA 5G1KA 4BWSA 3GIXA 3H93A 1YVLA 3ZFBA 4NHZA 5EL8A 4ZBBA 3IA1A 3QAVA 4AI6A 4G9HA 3C7MA 2L4QA 2C3TA 3KP9A 4HZ2A 1SK1A 1PN9A 4F0BA 1YKCA 1SU9A 3V1WA 1Y25A 2WVYA 1HNCA 5LNKe 1ZZYA 4OO4A 1B48A 1GSQA 2TRCP 3Q19A 1BEDA 4I8BA 5ECKB 2VL2A 2JL4A 2KOKA 2H6YA 5HFKA 2DIZA 5J9CA 4PURA 1M3IA 2H1BA 2LEGA 4ID0A 4PXOA 5DALB 2ZNMA 1XWAA 5A1NB 2O36A 5E59A 2CAIA 2N5AA 1U3AA 1DE2A 2WVXA 1GLQA 2B5EA 5ABRA 4GSSA 1SL0B 4GQFA 1ERTA 3GH9A 1K0MA 3BOAA 3H4KA 4KDUA 2E7PA 3U6VA 1KBNA 2WZ9A 3FY7A 3KD0A 3KP8A 4TXVA 2H1DA 4AJ6A 1SENA 1T8EB 3TB2A 4G0LA 1X9MB 1EV4A 4ML6A 1XG8A 2HLSA 2IJYA 4L5LA 4JE1A 4IVFA 4Z7XA 1ERVA 1VF3A 2HRKB 2LS5A 4ML1A 1GLPA 3EC3A 4PHZC 2WFCA 3VWWA 3TGZA 2YWIA 1M2BA 2WJUA 3RBTA 4KCAA 1GTUA 2DKHA 3KTLA 3KXOA 4KE3A 1R5AA 2VCQA 4PUAA 4MJEA 1U88A 3FR3A 2H0GA 2C80A 3IK7A 2K8SA 4RQXA 2QGVA 16GSA 3W8SA 1M2AA 2P0GA 3A2WA 4GSTA 4HQSA 2G2QA 1KTEA 1K0NA 4E8EA 3MSZA 2UZ8A 2GTUA 3IHQA 5ECHB 2M46A 3O6TA 3LW9A 3ZITA 2A2RA 3FRCA 5B8AA 1YDKA 1SL1B 3FZ4A 4EIQA 5ID2B 1QXHA 3CBUA 1TRUA 1OVNA 4H86A 1TI1A 3GV1A 1NW2A 4Q5RA 4HZ4A 2CAQA 3Q74A 1V57A 4MJCA 2CZ3A 1FOHA 1XCCA 1J9BA 2XBQA 2CQ9A 4PI0C 3M3MA 5AGYA 5DQSA 2V6KA 3VPTA 4I5QA 3P7XA 3KTBA 4HU9A 1PX7A 2XHFA 4TVEA 3HHVA 3HD5A 4TKYA 5D73A 4XRDA 2R4VA 6GSVA 4KF9A 5A4UA 1USBA 4KNDA 2L4CA 1TKDB 2H72A 3VPQA 2E2GA 2KP2A 3WT2A 2R3XA 1TTZA 2O8VB 4ZL8A 1YEXA 5IMAA 1UA5A 2F8AA 2O87A 5DQYA 1SL2B 1T00A 4AF2A 3EMPA 3RGBC 5IMFA 1BF5A 2QSIA 1SKWB 3IAS2 1U6TA 5ECLB 4ECCA 3F0IA 1M9AA 1BX9A 1XZOA 1EV9A 1FB0A 1AQWA 2B7KA 3TRXA 4V1Ap 2VOCA 2H01A 2I81A 1Z6NA 1A23A 5F0GA 4HUAA 2MBSA 1NSWA 3I6AA 1OC3A 4OCFA 3HVSA 5DVBA 5CRHA 1RK4A 4P3YB 4POBA 1H75A 5F07A 4PTSA 4F9ZA 2B5XA 2LJRA 2OADA 5DDLA 2EFDA 1ACVA 1J08A 2HZEB 1EP7A 1TDIA 1YF1A 4L0UA 3D0ZA 1TK5B 3CRUA 4LA1A 4TN8A 3GKMA 2DJ1A 3F4RA 1PRXA 1WMJA 1X0RA 5JCWA 3IC8A 3GRXA 3HJPA 4ZIJA 4IP1A 4IQ1A 1EZKA 1MDIA 2K8VA 5AISA 1T4YA 3ZTLA 3ERWA 1ZOFA 3EPTA 4KAEA 2OBIA 4YQMA 4EUYA 1GUMA 4K2DA 4D73B 1ZYPA 3G7JA 4YQUA 4FYUA 1MDKA 2VCWA 2AV4A 4N10A 2R5GA 1K3YA 4N0VA 4ZB9A 1S3CA 3L9SA 3TJKA 1QK8A 4XIHA 2KP1A 2MMAA 4V2LA 3F8UA
chains in the Genus database with same CATH topology
1JFUA 4QMKA 2REMA 5IOWA 1AW9A 2NVLA 4LMWA 4PQ1A 1PMTA 3FEUA 5FHIA 1LBKA 2HSNA 3GKNA 4L0WA 2RUFA 3ZIVA 2LNSA 3ZREA 1TK8B 3DD3A 1X9WB 3UVTA 3RHCA 5F06A 3IE3A 3FZ5A 4HS1A 4LMVA 4KCEA 4V2MA 2YNXA 1BQ7A 5BRTA 5ELAA 3UJ1A 4BL7B 1MD3A 1T7PB 1ZMAA 2XBIA 2R37A 2X8GA 4K5RA 5CAXA 2FHEA 1YEPA 1PL1A 4KUNA 4EVMA 4DSSA 2EIQA 4I2UA 1H4OA 2WGRA 3HJMA 5LD0A 8GSSA 4WEYA 4ULXA 3VURA 3FKFA 3A5IA 1MTCA 4MJBA 4HJMA 2DSAA 2HRAA 4OFTA 1NHYA 5DBQA 2B1KA 3R3EA 3CSIA 4IBPA 5JWRB 1EOHA 5C04A 5HFGA 1AAZA 1GTBA 2H74A 2OBKA 1TJDA 3TKSA 4WKWA 4O5QA 3PH9A 3EU4A 5B8BA 4NWYA 2GQKA 2F8FA 4XHMA 3UOMA 2H1LA 2YZUA 5HR1A 4EF0A 1BG5A 3Q18A 2H8LA 4XS4A 5HR2A 2NTOA 4BA7A 3L4NA 4EIPA 5A5HB 5BMUB 1QMVA 3CXGA 4G10A 5CYYA 3UEMA 4MZBA 3CTGA 5AIVA 4V1Ag 1T3BA 1Z7PA 5DCHA 1ABAA 2CZ2A 3ME7A 4ZL7A 3A5WA 2I4AA 1A8LA 2HFDA 4FIWA 4AKGA 2IFQA 3S9FA 3O3TA 3HYPA 2YZHA 2HSMA 3H1NA 3KZQA 5J4VA 4IELA 2H0IA 3FZ9A 4IKHA 3OR5A 2R6KA 5D9TA 1DE1A 1AIUA 1GSSA 3IR4A 3UIWA 2GT5A 3MDKA 1QFNA 1GULA 4IN0A 4GDFA 1B9YC 3UVHA 3F9UA 4MMMA 3E0UA 1ERUA 1ON4A 5J40A 5A34A 2IIYA 1VF4A 1UVZA 5J5NA 4HU7A 4YAPA 3IDVA 5A5KA 4O92A 3UAPA 2OE0A 4F2IA 4F82A 2DIYA 3ZFLA 3ED3A 1SKRB 4JR6A 2J23A 5IQYA 4NPBA 1G0TA 5D96A 3GMFA 3VFIA 4G0IA 1R7HA 3WT1A 1E2YA 2GZZA 1M0UA 5ECSA 2BTOT 4MF6A 5GSTA 5DCGA 2LJKA 1W89A 5J9BA 5E4WA 3O76A 2VIMA 3WGEA 4MA9A 1FW1A 2KLXA 3FK8A 1U87A 3IC4A 4PQIA 2CVBA 5L71A 2P5QA 3FW2A 5KOXA 2DMMA 4OMVA 2B1LA 2V1MA 1XWCA 4DEJA 3H79A 3C73A 2PVOC 1OAZA 4EKZA 2QA2A 4HDEA 4X1UA 4POLA 2HRFA 4JU5A 2PWJA 5JCUA 3F4SA 17GSA 1GTIA 2C3QA 6GSSA 4AGSA 4Z2UA 3ZRDA 4MJAA 3R2QA 2RLIA 3CWGA 1YJ6A 1B4QA 5G2ZA 2F9SA 1VRSD 1Y6EA 3QR6A 3EE2A 4MF7A 5HQPA 1K0AA 3LG6A 5IMZA 2GDRA 1M99A 2HE3A 2VCVA 4GTUA 2ZCTA 5KN3A 4TR4A 2YANA 1WIKA 3QFBC 2VCXA 6GSTA 3RPPA 5IM9A 2R0PA 3E9JB 3I9V2 2RM5A 1DUGA 2H6XA 1FOVA 3L0HA 5D9XA 3ZMLA 5KN2A 1TRVA 3AY8A 1AQXA 2H1AA 5A1NA 3RDWA 5B6MA 2YWNA 4HI7A 3DIEA 2XPEA 1JZRA 3D4MA 2HSHA 3K8NA 1V40A 1B9XC 1THXA 3KH7A 3ZZXA 2VL3A 3DVWA 1O6JA 3EURA 3D5JA 3IOSA 1ZGNA 2JACA 1WP0A 1OC9A 4BVXA 4YKGA 1EWXA 4I97A 5IO2A 2FUG2 3KM6A 4K8MA 1JLWA 1N8JA 2EFCA 3JCML 1Q4JA 3DGQA 4GF0A 2H76A 3HVVA 4K7IA 4PNFA 2RM6A 3APQA 3EMXA 1ZYEA 2JSZA 2GSTA 4Q5FA 1M9BA 5F8BA 2FWGA 1K0BA 2PU9C 4OFNA 4TR0A 4E68A 3GL5A 1QUWA 3QMXA 1TW9A 4OWYA 1ERWA 3P2AA 4FO5A 3TOUA 2K6VA 2QC7A 4ILFA 4K7NA 2V2GA 5GAPD 1XOBA 2OJLA 1A0RP 4I6XA 2PGTA 2FNOA 1K0OA 1I5GA 2VLUA 1JZWA 3TKRA 3TU3B 5ECOB 2AJQB 4O7HA 2P31A 4L8EA 1JZOA 2DJJA 4F0CA 2I9HA 4RUVA 5CO3A 4PUFC 2F51A 2C4JA 2HRNA 2G0FA 1OYJA 3APOA 5ELGA 4EE0A 2L59A 3W6GA 4WETA 5IMCA 4O5RA 3P90A 5IPHA 1PKZA 3UARA 2FD3A 3A3TA 5DAKA 1MDJA 2HNLA 2P5RA 1OE8A 1LJRA 5A4VA 5G5EA 5G1LA 3TDGA 3E3EA 2A4VA 1XVWA 3L9VA 3Q6OA 5J3RA 4GLTA 1PGTA 1OKDA 2O89A 1XW9A 2YP6A 4KDYA 3DKSA 3I69A 1NM3A 2A4HA 2VCTA 1TP9A 2M80A 5DJMA 2GZPA 2UV8G 2H19A 2DC5A 1GSYA 3WD6A 4OCEA 4X4JA 6GSYA 2DBCA 2L5LA 2F3MA 2YJHA 1WE0A 4HQZA 2FWFA 5CRWA 3GFKA 4WXTA 4OFMA 3ME8A 1PQNA 5F05A 3KJYA 3LJRA 1CQHA 3TJBA 1X9SB 1TI3A 1IYIA 1X5DA 3HMJG 1A0FA 1FVJA 4O32A 1AC1A 2HYXA 1SJZA 3CRTA 1FAAA 3C71A 2GSSA 2GGTA 1PX6A 3IPZA 4BVYA 3D21A 3KGKA 3LXTA 11GSA 2H66A 3G7IA 5ECMB 2YWMA 1PN0A 5ECQB 1G7OA 4K7OA 4AKIA 1U3IA 2R0GA 3KCMA 2A2PA 1XBSA 3GHAA 3IAM2 2LSTA 3F3RA 4CDOA 3D22A 2WRTA 2ES7A 2VM2A 3MWHA 2LNTA 4AKXB 4N0ZA 4ZB6A 2VLVA 3EU3A 3APSA 1A8YA 4WR4A 2HSNB 5COHA 3KMNA 1O8XA 3LFLA 3ISOA 1GWCA 4MPGA 3GTUA 4DSRA 2YWOA 4E8HA 4PX1A 3EYTA 2O5VA 2LV3A 1SYXA 1Z9HA 3NZNA 2MBTA 4DSSB 4KX4A 4A5PA 2I1UA 1F37A 2TRXA 3BD2A 3G9BA 4WBRD 4MH3A 1A2JA 4ZB7A 1PL2A 4CHSA 4EXJA 4NV2A 4N30A 1A24A 1FB6A 3VWUA 1TRSA 4RI7A 1GP1A 1O85A 4ZILA 3DYRA 3GN3A 3WGDA 13GSA 1X5EA 1T1VA 2DJ0A 4OD7A 5EPFA 2X64A 4TXOB 1RQMA 3BCIA 4KSOA 1V58A 1OE7A 1EP8A 5GAND 4K9ZA 1FG4A 1WOUA 4L5OA 1UN2A 4V2NA 1THOA 2Z9SA 5J47A 4POKA 4K2XA 3LQ7A 2LQOA 1EOGA 4LL1B 1TU8A 3TKQA 3GX8A 2LUSA 2FY6A 1A2LA 4USSA 3C8EA 1B4PA 2B5YA 3GYKA 3U5RE 5ECIB 4Z2RA 1XXUA 3UBLA 2X8HA 1XWKA 3M8NA 3TOTA 4WR5A 4YKFA 3F63A 5FT3A 4TR1A 1FO5A 1Y1UA 4XS6A 2L57A 3SWLA 3RAZA 1HQOA 3IV4A 2HSMB 2EFHA 5LCZA 3N9JA 1SJIA 4XTSA 3TKSE 3A2VA 1PKWA 4FH8A 4PQHA 4ZBDA 6GSWA 3QFAC 4J57E 4JBBA 4GSNA 3BBYA 2V6OA 4PGTA 2JADA 2NPBA 2L6CA 2C1YA 2OACA 1WWJA 1URMA 2IPAA 2GT6A 1G7EA 4OO5A 1SVLA 2GSQA 3MNGA 3HJOA 5A34B 1YF0A 1ZYNA 4I2TA 4ZL9A 3WGXA 1VF2A 3FMWA 1EGRA 4EDZA 1KEBA 5IMVA 4W66A 2DJ2A 5JCGA 4X0XA 1O8WA 3LEFA 2DJKA 3UMAA 1Z5YE 2HI7A 3FHKA 5JWQB 1EEJA 4G0KA 4MDCA 2NDOA 4ACSA 2VM1A 4GXZA 2FWHA 1G6YA 2LTKA 4K0GA 1YKAA 2IL3A 1F6MC 4IGJA 2MZCA 4QQ7A 5IOXA 3HXSA 2CV4A 2GZYA 1SD8A 2VAFA 1XWGA 4XCSA 4MZWA 1VGLA 2E2MA 3LGCA 1J0FA 2EC4A 1SJ6A 2ON5A 5J4YA 1TXUA 3P8WA 2H70A 3BJ5A 3QAWA 2V32A 4TR3A 1PA3A 5CNWA 3TJJA 1WRYA 5INYA 3PR8A 3C1RA 1O73A 1ST9A 1V9WA 3GNJA 2GVPA 5HFIA 2FLSA 5JWOB 3GKKA 4YH2A 3ERGA 2EFEA 3VI5A 2BMXA 1TU7A 3N5OA 5AN1A 4EDYA 5ECPB 3FZAA 4TRXA 4IS0A 2VO4A 2C8UA 3F6FA 3QCPA 2FCHA 5H5QA 1ML6A 3TRPA 1SVMA 3KH9A 3IHGA 4K5SA 4XRAA 3RHBA 4BPYA 2C0GA 1QQ2A 2FA8A 2OE3A 2A2SA 2WS2A 3F3QA 1ZL9A 3J7Yk 1O81A 4MCUA 1XPVA 3PPUA 2VD1A 3ZIJA 1AUCA 20GSA 1S3DA 3GSTA 4G01A 3EVIA 2H75A 2X4AA 4QL7A 3GUSA 1OC9B 4BVXB 2MMZA 4XS1A 5DALA 3VWXA 1XOAA 4MABA 5IPGA 1GH2A 4LL4B 2DMLA 2CT6A 5CRGA 2DJ3A 4WF5A 3UL3A 4ECBA 2AUVA 5KN1A 3FR6A 3DRNA 3VK9A 3M9JA 1MEKA 4HOJA 4ZBAA 1FHEA 1EEMA 5KEJA 3DMLA 4RI6A 4ISDA 3D4TA 1C72A 3EWLA 3QOUA 2AYTA 3UBKA 2L5OA 1GUHA 2B7JA 4NXIA 1GL8A 2MMOA 5D9VA 1T4ZA 2JZRA 4WBJA 3DVXA 1XVQA 4IW9A 2HRKA 1SK2A 1GSUA 3G7YA 1F3AA 3GH6A 4FYCA 4HEA2 3MAKA 3HZ4A 4MP4A 2WULA 4KGIA 2N5FA 5G31A 3GX0A 4AKHA 2PVQA 2XPDA 22GSA 3CSJA 4Q5NA 4QL9A 1NHOA 4GWRA 1RW1A 3LYPA 3J7Yb 3HKRA 5AIXA 2IN3A 3TJGA 4Q5QA 4KH7A 5DAKB 1TK0B 1Z6MA 1GSDA 1DBYA 5KOWA 4YAVA 2K9FA 2HQTA 3VWVA 4KB3A 2C0DA 2IMIA 3PINA 12GSA 2DKIA 5EVOA 3F6DA 4ZXGA 1BYEA 1Q98A 2LRCA 3QPMA 1Z7RA 5ID2A 2LRTA 3KMOA 3GURA 5CREA 4TOPA 2N5BA 3CYNA 2YV7A 1G6WA 4JRRA 2M72A 3ZMKA 2FA4A 2LQQA 1GSFA 4MPFA 2B6MA 5HR0A 3LXZA 5ECRB 2GQLA 2OE1A 4GCIA 2YN1A 3M1GA 1XW5A 1EGOA 2R2JA 2JZTA 4MNNA 2X99A 2CX3A 5KN0A 5DJLA 3FR9A 3TKSC 18GSA 4G19A 4K6XA 4F03A 4HJ2A 3TUEA 2CVKA 2I3YA 2VCZA 1KNGA 2LKUA 3HA9A 5G30A 4MK3A 4LLRA 4NV5A 2RIIA 4BVYB 3QD9A 4Z2TA 1YY7A 10GSA 4DSQA 2WCIA 2V41A 1SYRA 1ZYQB 2H30A 1HNAA 4G2EA 1GUKA 5D9WA 4KA0A 2AB6A 3US3A 2IMKA 4NHWA 1QGVA 2VLTA 1HD2A 3A2XA 4POMA 2JU5A 3ZVJD 1E6BA 2C3NA 1UC7A 1PD21 14GSA 1HYUA 2H71A 1A2MA 3W8JA 1DSBA 3PGTA 3GA4A 2EIOA 1M7TA 4PNGA 3F4TA 1BAYA 3L78A 5J4UA 1GSEA 2OT3A 3GTUB 1Z3EA 2YJ7A 1OKTA 4RQRA 1X5CA 1AXDA 1WJKA 3LORA 3ZL5A 2PBJA 1ZCPA 1SK0A 4EL1A 4MZCA 1GNEA 3HCZA 4IP6A 19GSA 5D93A 1YZXA 1V2AA 5FWGA 2HSYA 2X8CA 4X43A 5ENUA 1I9DA 1XW6A 2LRNA 4IQAA 2MYGA 4AJ7A 1TOFA 3ZVJA 2PPTA 5IO0A 2HZEA 5H5RA 4TW5A 3IRAA 1OC8A 5IMDA 1N2AA 1XIYA 2X49A 3ZYWA 4EO3A 4GRFA 1GRXA 4NAXA 1F2EA 3RPNA 1PSQA 4ICYA 4KW6A 1WPIA 4EC0A 2JZSA 4BWQA 2XC2A 1HNBA 5G5FA 2L6DA 2HT9A 4K0NA 5IIZA 3C1SA 3TCOA 4CY6A 3CSHA 2E0QA 1W4VA 5J41A 4IJIA 3GSSA 3DWVA 2YCDA 1GNWA 1MD4A 4D73A 2ZUPA 4CY8A 5H5SA 1CQGA 5A4WA 4DVCA 4KSMA 2LJAA 2VL2C 3D6IA 2CX4A 3NIVA 2BJXA 4NMUA 1XWBA 2H73A 5EY6A 5D8IA 4GQCA 1JLVA 1BG1A 1SKSB 2OKAA 2HXKA 2IMDA 2AAWA 1K0CA 2YV9A 3VLNA 4IJ3A 4CW9A 1R5PA 4TR1B 3IBHA 2KHPA 1N25A 4XS4B 2KUCA 3HVXA 2QKEA 1R4WA 2GSRA 6GSXA 2C0EA 2GQMA 3WYWA 2IMFA 1S3AA 2WB9A 2VD0A 2O85A 5ECNB 4WF4A 3EINA 3KIJA 2VKZG 2J9HA 5CRDA 4KDXA 3TRQA 2EIRA 3FYGA 2DLXA 4MH2A 3ZLPA 4BL7A 3TJFA 3LYKA 2RUEA 1SVOA 5CP1A 1TXXA 3IXRA 3QDNA 2PUKC 2IFQB 1K0DA 2YPMA 1YQ1A 3TKPA 3LSZA 2O7KA 4JR4A 4TXOA 2HZFA 2FWEA 4JEDA 3CTFA 2QA1A 1JHBA 2PMTA 4ECJA 2GS3A 2JSYA 3H8QA 3HY2A 4N3ZA 1TRWA 2ALBA 2TIRA 7GSSA 2FGXA 1V98A 1K3OA 3DXBA 2CA8A 5B7CA 2H1GA 3NOFA 2VUPA 5GSSA 3KEBA 1GTAA 2C0FA 1XFLA 1IYHA 4FQUA 4N11A 2H6ZA 3LWAA 4O5UA 2IWTA 3MYDA 5GZZB 4IHUA 2VL9A 3HDCA 2PN8A 4K1FA 2AHEA 5A5HA 1SD9A 2D2ZA 3DEXA 5BMUA 2MMNA 1F3BA 2OA7A 3GL3A 2NBSA 3SBCA 3QAGA 4AJ8A 1BJXA 2PERA 1JZDA 2H0HA 2YOIA 5B6NA 9GSSA 2WDUA 2K18A 3M0FA 2R0CA 3CMIA 5C00A 3BCKA 4FYBA 1B8XA 4ECIA 3L9UA 3M9KA 2B3SA 2GLRA 3GKXA 1K3LA 1O7UA 3IK9A 1VF1A 4ZB8A 4MLYA 2CVDA 1F9MA 1LU4A 1M2DA 4J2FA 3HZ8A 2IMEA 6GSUA 5HR3A 2ON7A 4JZQA 3I43A 1ILOA 3ERFA 3VI7A 1AQVA 4MF5A 4J56E 1R26A 3MIXA 4YQVA 1FVKA 5G1KA 4BWSA 3GIXA 3H93A 1YVLA 3ZFBA 4NHZA 5EL8A 4ZBBA 3IA1A 3QAVA 4AI6A 4G9HA 3C7MA 2L4QA 2C3TA 3KP9A 4HZ2A 1SK1A 1PN9A 4F0BA 1YKCA 1SU9A 3V1WA 1Y25A 1HNCA 5LNKe 1ZZYA 4OO4A 1B48A 1GSQA 2TRCP 3Q19A 1BEDA 4I8BA 5ECKB 2VL2A 2JL4A 2KOKA 2H6YA 5HFKA 2DIZA 5J9CA 4PURA 2H1BA 2LEGA 4ID0A 4PXOA 5DALB 2ZNMA 1XWAA 5A1NB 5E59A 2CAIA 2N5AA 1U3AA 1DE2A 1GLQA 2B5EA 5ABRA 4GSSA 1SL0B 4GQFA 1ERTA 3GH9A 1K0MA 3BOAA 3H4KA 4KDUA 2E7PA 3U6VA 1KBNA 2WZ9A 3FY7A 3KD0A 3KP8A 4TXVA 2H1DA 4AJ6A 1SENA 1T8EB 3TB2A 4G0LA 1X9MB 1EV4A 4ML6A 2HLSA 2IJYA 4L5LA 4JE1A 4IVFA 4Z7XA 1ERVA 1VF3A 2HRKB 2LS5A 4ML1A 1GLPA 3EC3A 2WFCA 3VWWA 3TGZA 2YWIA 1M2BA 2WJUA 3RBTA 4KCAA 1GTUA 2DKHA 3KTLA 3KXOA 4KE3A 1R5AA 2VCQA 4PUAA 4MJEA 1U88A 3FR3A 2H0GA 2C80A 3IK7A 2K8SA 4RQXA 2QGVA 16GSA 3W8SA 1M2AA 2P0GA 3A2WA 4GSTA 4HQSA 2G2QA 1KTEA 1K0NA 4E8EA 3MSZA 2UZ8A 2GTUA 3IHQA 5ECHB 2M46A 3O6TA 3LW9A 3ZITA 2A2RA 3FRCA 5B8AA 1YDKA 1SL1B 3FZ4A 4EIQA 5ID2B 1QXHA 3CBUA 1TRUA 1OVNA 4H86A 1TI1A 3GV1A 1NW2A 4Q5RA 4HZ4A 2CAQA 3Q74A 1V57A 4MJCA 2CZ3A 1FOHA 1XCCA 1J9BA 2XBQA 2CQ9A 3M3MA 5AGYA 5DQSA 2V6KA 3VPTA 4I5QA 3P7XA 3KTBA 4HU9A 1PX7A 2XHFA 4TVEA 3HHVA 3HD5A 4TKYA 5D73A 4XRDA 2R4VA 6GSVA 4KF9A 5A4UA 1USBA 4KNDA 2L4CA 1TKDB 2H72A 3VPQA 2E2GA 2KP2A 3WT2A 2R3XA 1TTZA 2O8VB 4ZL8A 1YEXA 5IMAA 1UA5A 2F8AA 2O87A 5DQYA 1SL2B 1T00A 4AF2A 3EMPA 5IMFA 1BF5A 2QSIA 1SKWB 3IAS2 1U6TA 5ECLB 4ECCA 3F0IA 1M9AA 1BX9A 1XZOA 1EV9A 1FB0A 1AQWA 2B7KA 3TRXA 4V1Ap 2VOCA 2H01A 2I81A 1Z6NA 1A23A 5F0GA 4HUAA 2MBSA 1NSWA 3I6AA 1OC3A 4OCFA 3HVSA 5DVBA 5CRHA 1RK4A 4P3YB 4POBA 1H75A 5F07A 4PTSA 4F9ZA 2B5XA 2LJRA 2OADA 5DDLA 2EFDA 1ACVA 1J08A 2HZEB 1EP7A 1TDIA 1YF1A 4L0UA 3D0ZA 1TK5B 3CRUA 4LA1A 4TN8A 3GKMA 2DJ1A 3F4RA 1PRXA 1WMJA 1X0RA 5JCWA 3IC8A 3GRXA 3HJPA 4ZIJA 4IP1A 4IQ1A 1EZKA 1MDIA 2K8VA 5AISA 1T4YA 3ZTLA 3ERWA 1ZOFA 3EPTA 4KAEA 2OBIA 4YQMA 4EUYA 1GUMA 4K2DA 4D73B 1ZYPA 3G7JA 4YQUA 4FYUA 1MDKA 2VCWA 2AV4A 4N10A 2R5GA 1K3YA 4N0VA 4ZB9A 1S3CA 3L9SA 3TJKA 1QK8A 4XIHA 2KP1A 2MMAA 4V2LA 3F8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFU A;  2REM A;  5IOW A;  1AW9 A;  2NVL A;  4LMW A;  4PQ1 A;  1PMT A;  3FEU A;  5FHI A;  1LBK A;  3GKN A;  4L0W A;  2RUF A;  3ZIV A;  2LNS A;  3ZRE A;  1TK8 B;  3DD3 A;  1X9W B;  3UVT A;  3RHC A;  5F06 A;  3IE3 A;  3FZ5 A;  4HS1 A;  4LMV A;  4KCE A;  4V2M A;  2YNX A;  1BQ7 A;  5ELA A;  3UJ1 A;  4BL7 B;  1MD3 A;  1T7P B;  1ZMA A;  2XBI A;  2R37 A;  2X8G A;  5CAX A;  2FHE A;  1YEP A;  1PL1 A;  4KUN A;  4EVM A;  4DSS A;  2EIQ A;  4I2U A;  1H4O A;  2WGR A;  3HJM A;  5LD0 A;  8GSS A;  4WEY A;  4ULX A;  3VUR A;  3FKF A;  1MTC A;  4MJB A;  4HJM A;  2DSA A;  2HRA A;  4OFT A;  1NHY A;  5DBQ A;  2B1K A;  3R3E A;  3CSI A;  4IBP A;  5JWR B;  1EOH A;  5C04 A;  5HFG A;  1AAZ A;  1GTB A;  2H74 A;  2OBK A;  1TJD A;  3TKS A;  4WKW A;  3PH9 A;  3EU4 A;  5B8B A;  4NWY A;  2GQK A;  2F8F A;  4XHM A;  3UOM A;  2YZU A;  5HR1 A;  4EF0 A;  1BG5 A;  3Q18 A;  2H8L A;  4XS4 A;  5HR2 A;  2NTO A;  4BA7 A;  3L4N A;  1QMV A;  3CXG A;  4G10 A;  5CYY A;  3UEM A;  4MZB A;  3CTG A;  5AIV A;  4V1A g;  1T3B A;  1Z7P A;  5DCH A;  1ABA A;  2CZ2 A;  3ME7 A;  4ZL7 A;  3A5W A;  2I4A A;  1A8L A;  2HFD A;  4FIW A;  2IFQ A;  3S9F A;  3O3T A;  3HYP A;  2YZH A;  2HSM A;  3H1N A;  3KZQ A;  4IEL A;  2H0I A;  3FZ9 A;  4IKH A;  3OR5 A;  2R6K A;  5D9T A;  1DE1 A;  1AIU A;  1GSS A;  3IR4 A;  3UIW A;  2GT5 A;  3MDK A;  1QFN A;  1GUL A;  4IN0 A;  1B9Y C;  3UVH A;  3F9U A;  4MMM A;  3E0U A;  1ERU A;  1ON4 A;  2IIY A;  1VF4 A;  1UVZ A;  5J5N A;  4HU7 A;  4YAP A;  3IDV A;  5A5K A;  4O92 A;  3UAP A;  2OE0 A;  4F2I A;  4F82 A;  2DIY A;  3ZFL A;  3ED3 A;  1SKR B;  4JR6 A;  2J23 A;  5IQY A;  4NPB A;  1G0T A;  5D96 A;  3GMF A;  3VFI A;  4G0I A;  1R7H A;  3WT1 A;  1E2Y A;  2GZZ A;  1M0U A;  5ECS A;  2BTO T;  4MF6 A;  5GST A;  5DCG A;  2LJK A;  1W89 A;  5J9B A;  5E4W A;  3O76 A;  2VIM A;  3WGE A;  4MA9 A;  1FW1 A;  2KLX A;  3FK8 A;  1U87 A;  3IC4 A;  4PQI A;  2CVB A;  5L71 A;  2P5Q A;  3FW2 A;  2DMM A;  4OMV A;  2B1L A;  2V1M A;  1XWC A;  4DEJ A;  3H79 A;  3C73 A;  2PVO C;  1OAZ A;  4EKZ A;  4HDE A;  4X1U A;  4POL A;  2HRF A;  4JU5 A;  2PWJ A;  5JCU A;  3F4S A;  17GS A;  1GTI A;  2C3Q A;  6GSS A;  4AGS A;  3ZRD A;  4MJA A;  3R2Q A;  2RLI A;  1YJ6 A;  1B4Q A;  5G2Z A;  2F9S A;  1VRS D;  1Y6E A;  3QR6 A;  3EE2 A;  4MF7 A;  5HQP A;  1K0A A;  3LG6 A;  5IMZ A;  2GDR A;  1M99 A;  2HE3 A;  2VCV A;  4GTU A;  2ZCT A;  5KN3 A;  4TR4 A;  2YAN A;  1WIK A;  3QFB C;  2VCX A;  6GST A;  3RPP A;  5IM9 A;  3E9J B;  3I9V 2;  2RM5 A;  1DUG A;  2H6X A;  1FOV A;  3L0H A;  5D9X A;  3ZML A;  5KN2 A;  1TRV A;  3AY8 A;  1AQX A;  2H1A A;  3RDW A;  5B6M A;  2YWN A;  4HI7 A;  3DIE A;  2XPE A;  1JZR A;  3D4M A;  2HSH A;  3K8N A;  1V40 A;  1B9X C;  1THX A;  3KH7 A;  3ZZX A;  2VL3 A;  3DVW A;  1O6J A;  3EUR A;  3D5J A;  3IOS A;  1ZGN A;  2JAC A;  1WP0 A;  1OC9 A;  4BVX A;  1EWX A;  4I97 A;  5IO2 A;  2FUG 2;  3KM6 A;  4K8M A;  1JLW A;  1N8J A;  3JCM L;  1Q4J A;  3DGQ A;  4GF0 A;  2H76 A;  3HVV A;  4K7I A;  4PNF A;  2RM6 A;  3APQ A;  3EMX A;  1ZYE A;  2JSZ A;  2GST A;  4Q5F A;  1M9B A;  5F8B A;  2FWG A;  1K0B A;  2PU9 C;  4OFN A;  4TR0 A;  3GL5 A;  1QUW A;  3QMX A;  1TW9 A;  4OWY A;  1ERW A;  3P2A A;  4FO5 A;  3TOU A;  2K6V A;  2QC7 A;  4ILF A;  4K7N A;  2V2G A;  5GAP D;  1XOB A;  2OJL A;  1A0R P;  4I6X A;  2PGT A;  2FNO A;  1K0O A;  1I5G A;  2VLU A;  1JZW A;  3TKR A;  5ECO B;  2AJQ B;  4O7H A;  2P31 A;  4L8E A;  1JZO A;  2DJJ A;  4F0C A;  2I9H A;  4RUV A;  5CO3 A;  4PUF C;  2F51 A;  2C4J A;  2HRN A;  2G0F A;  1OYJ A;  3APO A;  5ELG A;  4EE0 A;  2L59 A;  3W6G A;  4WET A;  5IMC A;  4O5R A;  3P90 A;  5IPH A;  1PKZ A;  3UAR A;  2FD3 A;  3A3T A;  5DAK A;  1MDJ A;  2HNL A;  2P5R A;  1OE8 A;  1LJR A;  5A4V A;  5G5E A;  5G1L A;  3TDG A;  3E3E A;  2A4V A;  1XVW A;  3L9V A;  3Q6O A;  5J3R A;  4GLT A;  1PGT A;  1OKD A;  2O89 A;  1XW9 A;  2YP6 A;  4KDY A;  3DKS A;  3I69 A;  1NM3 A;  2VCT A;  1TP9 A;  2M80 A;  5DJM A;  2GZP A;  2H19 A;  2DC5 A;  1GSY A;  3WD6 A;  4OCE A;  6GSY A;  2DBC A;  2L5L A;  2F3M A;  2YJH A;  1WE0 A;  4HQZ A;  2FWF A;  5CRW A;  3GFK A;  4WXT A;  4OFM A;  3ME8 A;  1PQN A;  5F05 A;  3KJY A;  3LJR A;  1CQH A;  3TJB A;  1X9S B;  1TI3 A;  1IYI A;  1X5D A;  1A0F A;  1FVJ A;  4O32 A;  1AC1 A;  2HYX A;  1SJZ A;  3CRT A;  1FAA A;  3C71 A;  2GSS A;  2GGT A;  1PX6 A;  3IPZ A;  4BVY A;  3D21 A;  3KGK A;  3LXT A;  11GS A;  2H66 A;  3G7I A;  5ECM B;  2YWM A;  5ECQ B;  1G7O A;  4K7O A;  1U3I A;  3KCM A;  1XBS A;  3GHA A;  3IAM 2;  2LST A;  3F3R A;  4CDO A;  3D22 A;  2WRT A;  2ES7 A;  2VM2 A;  3MWH A;  2LNT A;  4N0Z A;  4ZB6 A;  2VLV A;  3EU3 A;  3APS A;  1A8Y A;  4WR4 A;  2HSN B;  5COH A;  3KMN A;  1O8X A;  3LFL A;  3ISO A;  1GWC A;  4MPG A;  3GTU A;  4DSR A;  2YWO A;  4E8H A;  4PX1 A;  3EYT A;  2LV3 A;  1SYX A;  1Z9H A;  3NZN A;  2MBT A;  4DSS B;  4KX4 A;  2I1U A;  1F37 A;  2TRX A;  3BD2 A;  3G9B A;  4WBR D;  4MH3 A;  1A2J A;  1PL2 A;  4CHS A;  4EXJ A;  4NV2 A;  4N30 A;  1A24 A;  1FB6 A;  3VWU A;  1TRS A;  4RI7 A;  1GP1 A;  1O85 A;  4ZIL A;  3DYR A;  3GN3 A;  3WGD A;  13GS A;  1X5E A;  1T1V A;  2DJ0 A;  4OD7 A;  5EPF A;  2X64 A;  4TXO B;  1RQM A;  3BCI A;  4KSO A;  1V58 A;  1OE7 A;  1EP8 A;  5GAN D;  4K9Z A;  1FG4 A;  1WOU A;  4L5O A;  1UN2 A;  4V2N A;  1THO A;  2Z9S A;  4POK A;  3LQ7 A;  2LQO A;  1EOG A;  4LL1 B;  1TU8 A;  3TKQ A;  3GX8 A;  2LUS A;  2FY6 A;  1A2L A;  4USS A;  3C8E A;  1B4P A;  2B5Y A;  3GYK A;  3U5R E;  5ECI B;  1XXU A;  3UBL A;  2X8H A;  1XWK A;  3M8N A;  3TOT A;  4WR5 A;  3F63 A;  5FT3 A;  4TR1 A;  1FO5 A;  4XS6 A;  2L57 A;  3SWL A;  3RAZ A;  1HQO A;  3IV4 A;  2HSM B;  5LCZ A;  3N9J A;  1SJI A;  4XTS A;  3TKS E;  3A2V A;  1PKW A;  4FH8 A;  4PQH A;  4ZBD A;  6GSW A;  3QFA C;  4J57 E;  4JBB A;  4GSN A;  3BBY A;  2V6O A;  4PGT A;  2JAD A;  2NPB A;  2L6C A;  2C1Y A;  2OAC A;  1WWJ A;  1URM A;  2IPA A;  2GT6 A;  1G7E A;  4OO5 A;  2GSQ A;  3MNG A;  3HJO A;  1YF0 A;  4I2T A;  4ZL9 A;  3WGX A;  1VF2 A;  1EGR A;  4EDZ A;  1KEB A;  5IMV A;  2DJ2 A;  5JCG A;  4X0X A;  1O8W A;  3LEF A;  2DJK A;  3UMA A;  1Z5Y E;  2HI7 A;  3FHK A;  5JWQ B;  1EEJ A;  4G0K A;  4MDC A;  2NDO A;  4ACS A;  2VM1 A;  4GXZ A;  2FWH A;  1G6Y A;  2LTK A;  4K0G A;  1YKA A;  2IL3 A;  1F6M C;  4IGJ A;  2MZC A;  4QQ7 A;  5IOX A;  3HXS A;  2CV4 A;  2GZY A;  1SD8 A;  2VAF A;  1XWG A;  4XCS A;  4MZW A;  1VGL A;  2E2M A;  3LGC A;  1J0F A;  2EC4 A;  1SJ6 A;  2ON5 A;  3P8W A;  2H70 A;  3BJ5 A;  3QAW A;  2V32 A;  4TR3 A;  1PA3 A;  5CNW A;  3TJJ A;  1WRY A;  5INY A;  3PR8 A;  3C1R A;  1O73 A;  1ST9 A;  1V9W A;  3GNJ A;  2GVP A;  5HFI A;  2FLS A;  5JWO B;  3GKK A;  4YH2 A;  3ERG A;  3VI5 A;  2BMX A;  1TU7 A;  3N5O A;  5AN1 A;  4EDY A;  5ECP B;  3FZA A;  4TRX A;  4IS0 A;  2VO4 A;  2C8U A;  3F6F A;  3QCP A;  2FCH A;  5H5Q A;  1ML6 A;  3TRP A;  3KH9 A;  4XRA A;  3RHB A;  4BPY A;  2C0G A;  1QQ2 A;  2FA8 A;  2OE3 A;  2A2S A;  2WS2 A;  3F3Q A;  1ZL9 A;  3J7Y k;  1O81 A;  4MCU A;  1XPV A;  3PPU A;  2VD1 A;  3ZIJ A;  1AUC A;  20GS A;  1S3D A;  3GST A;  3EVI A;  2H75 A;  4QL7 A;  3GUS A;  1OC9 B;  4BVX B;  2MMZ A;  4XS1 A;  5DAL A;  3VWX A;  1XOA A;  4MAB A;  5IPG A;  1GH2 A;  4LL4 B;  2DML A;  2CT6 A;  5CRG A;  2DJ3 A;  4WF5 A;  3UL3 A;  4ECB A;  2AUV A;  5KN1 A;  3FR6 A;  3DRN A;  3VK9 A;  3M9J A;  1MEK A;  4HOJ A;  4ZBA A;  1FHE A;  1EEM A;  5KEJ A;  3DML A;  4RI6 A;  4ISD A;  3D4T A;  1C72 A;  3EWL A;  3QOU A;  2AYT A;  3UBK A;  2L5O A;  1GUH A;  2B7J A;  4NXI A;  1GL8 A;  2MMO A;  5D9V A;  1T4Z A;  2JZR A;  4WBJ A;  3DVX A;  1XVQ A;  4IW9 A;  2HRK A;  1SK2 A;  1GSU A;  3G7Y A;  1F3A A;  3GH6 A;  4FYC A;  4HEA 2;  3MAK A;  3HZ4 A;  4MP4 A;  2WUL A;  4KGI A;  2N5F A;  5G31 A;  3GX0 A;  2PVQ A;  2XPD A;  22GS A;  3CSJ A;  4Q5N A;  4QL9 A;  1NHO A;  4GWR A;  1RW1 A;  3LYP A;  3J7Y b;  3HKR A;  5AIX A;  2IN3 A;  3TJG A;  4Q5Q A;  4KH7 A;  5DAK B;  1TK0 B;  1Z6M A;  1GSD A;  1DBY A;  4YAV A;  2K9F A;  2HQT A;  3VWV A;  4KB3 A;  2C0D A;  2IMI A;  3PIN A;  12GS A;  5EVO A;  3F6D A;  4ZXG A;  1BYE A;  1Q98 A;  2LRC A;  3QPM A;  1Z7R A;  5ID2 A;  2LRT A;  3KMO A;  3GUR A;  5CRE A;  4TOP A;  2N5B A;  3CYN A;  2YV7 A;  1G6W A;  4JRR A;  2M72 A;  3ZMK A;  2FA4 A;  2LQQ A;  1GSF A;  4MPF A;  2B6M A;  5HR0 A;  3LXZ A;  5ECR B;  2GQL A;  2OE1 A;  4GCI A;  2YN1 A;  3M1G A;  1XW5 A;  1EGO A;  2R2J A;  2JZT A;  2X99 A;  2CX3 A;  5KN0 A;  5DJL A;  3FR9 A;  3TKS C;  18GS A;  4G19 A;  4K6X A;  4F03 A;  4HJ2 A;  3TUE A;  2CVK A;  2I3Y A;  2VCZ A;  1KNG A;  2LKU A;  3HA9 A;  5G30 A;  4MK3 A;  4LLR A;  4NV5 A;  2RII A;  4BVY B;  3QD9 A;  1YY7 A;  10GS A;  4DSQ A;  2WCI A;  2V41 A;  1SYR A;  1ZYQ B;  2H30 A;  1HNA A;  4G2E A;  1GUK A;  5D9W A;  4KA0 A;  2AB6 A;  3US3 A;  2IMK A;  4NHW A;  1QGV A;  2VLT A;  1HD2 A;  3A2X A;  4POM A;  2JU5 A;  3ZVJ D;  1E6B A;  2C3N A;  1UC7 A;  1PD2 1;  14GS A;  1HYU A;  2H71 A;  1A2M A;  3W8J A;  1DSB A;  3PGT A;  3GA4 A;  2EIO A;  1M7T A;  4PNG A;  3F4T A;  1BAY A;  3L78 A;  5J4U A;  1GSE A;  3GTU B;  1Z3E A;  2YJ7 A;  1OKT A;  4RQR A;  1X5C A;  1AXD A;  1WJK A;  3LOR A;  3ZL5 A;  2PBJ A;  1ZCP A;  1SK0 A;  4EL1 A;  4MZC A;  1GNE A;  3HCZ A;  4IP6 A;  19GS A;  5D93 A;  1YZX A;  1V2A A;  5FWG A;  2HSY A;  2X8C A;  4X43 A;  5ENU A;  1I9D A;  1XW6 A;  2LRN A;  4IQA A;  2MYG A;  4AJ7 A;  1TOF A;  3ZVJ A;  2PPT A;  5IO0 A;  2HZE A;  5H5R A;  4TW5 A;  3IRA A;  1OC8 A;  5IMD A;  1N2A A;  1XIY A;  3ZYW A;  4EO3 A;  4GRF A;  1GRX A;  4NAX A;  1F2E A;  3RPN A;  1PSQ A;  4KW6 A;  1WPI A;  4EC0 A;  2JZS A;  4BWQ A;  2XC2 A;  1HNB A;  5G5F A;  2L6D A;  2HT9 A;  4K0N A;  5IIZ A;  3C1S A;  3TCO A;  3CSH A;  2E0Q A;  1W4V A;  5J41 A;  4IJI A;  3GSS A;  3DWV A;  2YCD A;  1GNW A;  1MD4 A;  4D73 A;  2ZUP A;  5H5S A;  1CQG A;  5A4W A;  4DVC A;  4KSM A;  2LJA A;  2VL2 C;  3D6I A;  2CX4 A;  3NIV A;  2BJX A;  4NMU A;  1XWB A;  2H73 A;  5EY6 A;  5D8I A;  4GQC A;  1JLV A;  1SKS B;  2OKA A;  2HXK A;  2IMD A;  2AAW A;  1K0C A;  2YV9 A;  3VLN A;  4IJ3 A;  4CW9 A;  1R5P A;  4TR1 B;  3IBH A;  2KHP A;  4XS4 B;  2KUC A;  3HVX A;  2QKE A;  1R4W A;  2GSR A;  6GSX A;  2C0E A;  2GQM A;  3WYW A;  2IMF A;  1S3A A;  2WB9 A;  2VD0 A;  2O85 A;  5ECN B;  4WF4 A;  3EIN A;  3KIJ A;  2J9H A;  5CRD A;  4KDX A;  3TRQ A;  2EIR A;  3FYG A;  2DLX A;  4MH2 A;  3ZLP A;  4BL7 A;  3TJF A;  3LYK A;  2RUE A;  5CP1 A;  1TXX A;  3IXR A;  3QDN A;  2PUK C;  2IFQ B;  1K0D A;  2YPM A;  1YQ1 A;  3TKP A;  3LSZ A;  2O7K A;  4JR4 A;  4TXO A;  2HZF A;  2FWE A;  4JED A;  3CTF A;  1JHB A;  2PMT A;  4ECJ A;  2GS3 A;  2JSY A;  3H8Q A;  3HY2 A;  1TRW A;  2ALB A;  2TIR A;  7GSS A;  2FGX A;  1V98 A;  1K3O A;  3DXB A;  2CA8 A;  5B7C A;  2H1G A;  3NOF A;  2VUP A;  5GSS A;  3KEB A;  1GTA A;  2C0F A;  1XFL A;  1IYH A;  4FQU A;  4N11 A;  2H6Z A;  3LWA A;  2IWT A;  5GZZ B;  4IHU A;  2VL9 A;  3HDC A;  2PN8 A;  4K1F A;  2AHE A;  1SD9 A;  2D2Z A;  3DEX A;  5BMU A;  2MMN A;  1F3B A;  2OA7 A;  3GL3 A;  2NBS A;  3SBC A;  3QAG A;  4AJ8 A;  1BJX A;  2PER A;  1JZD A;  2H0H A;  2YOI A;  5B6N A;  9GSS A;  2WDU A;  2K18 A;  3M0F A;  3CMI A;  5C00 A;  3BCK A;  4FYB A;  1B8X A;  4ECI A;  3L9U A;  3M9K A;  2B3S A;  2GLR A;  3GKX A;  1K3L A;  1O7U A;  3IK9 A;  1VF1 A;  4ZB8 A;  4MLY A;  2CVD A;  1F9M A;  1LU4 A;  1M2D A;  4J2F A;  3HZ8 A;  2IME A;  6GSU A;  5HR3 A;  2ON7 A;  4JZQ A;  3I43 A;  1ILO A;  3ERF A;  3VI7 A;  1AQV A;  4MF5 A;  4J56 E;  1R26 A;  4YQV A;  1FVK A;  5G1K A;  4BWS A;  3GIX A;  3H93 A;  3ZFB A;  4NHZ A;  5EL8 A;  4ZBB A;  3IA1 A;  3QAV A;  4G9H A;  3C7M A;  2L4Q A;  2C3T A;  3KP9 A;  4HZ2 A;  1SK1 A;  1PN9 A;  4F0B A;  1YKC A;  1SU9 A;  3V1W A;  1Y25 A;  1HNC A;  5LNK e;  1ZZY A;  4OO4 A;  1B48 A;  1GSQ A;  2TRC P;  3Q19 A;  1BED A;  4I8B A;  5ECK B;  2VL2 A;  2JL4 A;  2KOK A;  2H6Y A;  5HFK A;  2DIZ A;  5J9C A;  4PUR A;  2H1B A;  2LEG A;  4ID0 A;  4PXO A;  5DAL B;  2ZNM A;  1XWA A;  5E59 A;  2CAI A;  2N5A A;  1U3A A;  1DE2 A;  1GLQ A;  2B5E A;  5ABR A;  4GSS A;  1SL0 B;  4GQF A;  1ERT A;  3GH9 A;  1K0M A;  3BOA A;  3H4K A;  4KDU A;  2E7P A;  3U6V A;  1KBN A;  2WZ9 A;  3FY7 A;  3KD0 A;  3KP8 A;  4TXV A;  2H1D A;  4AJ6 A;  1SEN A;  1T8E B;  3TB2 A;  4G0L A;  1X9M B;  1EV4 A;  4ML6 A;  2HLS A;  2IJY A;  4L5L A;  4JE1 A;  4IVF A;  4Z7X A;  1ERV A;  1VF3 A;  2HRK B;  2LS5 A;  4ML1 A;  1GLP A;  3EC3 A;  2WFC A;  3VWW A;  3TGZ A;  2YWI A;  1M2B A;  2WJU A;  3RBT A;  4KCA A;  1GTU A;  3KTL A;  3KXO A;  4KE3 A;  1R5A A;  2VCQ A;  4PUA A;  4MJE A;  1U88 A;  3FR3 A;  2H0G A;  2C80 A;  3IK7 A;  2K8S A;  4RQX A;  2QGV A;  16GS A;  3W8S A;  1M2A A;  2P0G A;  3A2W A;  4GST A;  4HQS A;  2G2Q A;  1KTE A;  1K0N A;  4E8E A;  3MSZ A;  2UZ8 A;  2GTU A;  3IHQ A;  5ECH B;  2M46 A;  3O6T A;  3ZIT A;  2A2R A;  3FRC A;  5B8A A;  1YDK A;  1SL1 B;  3FZ4 A;  5ID2 B;  1QXH A;  3CBU A;  1TRU A;  1OVN A;  4H86 A;  1TI1 A;  3GV1 A;  1NW2 A;  4Q5R A;  4HZ4 A;  2CAQ A;  3Q74 A;  1V57 A;  4MJC A;  2CZ3 A;  1XCC A;  1J9B A;  2XBQ A;  2CQ9 A;  3M3M A;  5AGY A;  5DQS A;  2V6K A;  3VPT A;  4I5Q A;  3P7X A;  3KTB A;  4HU9 A;  1PX7 A;  2XHF A;  4TVE A;  3HHV A;  3HD5 A;  4TKY A;  5D73 A;  4XRD A;  2R4V A;  6GSV A;  4KF9 A;  5A4U A;  1USB A;  4KND A;  2L4C A;  1TKD B;  2H72 A;  3VPQ A;  2E2G A;  2KP2 A;  3WT2 A;  2R3X A;  1TTZ A;  2O8V B;  4ZL8 A;  1YEX A;  5IMA A;  1UA5 A;  2F8A A;  2O87 A;  5DQY A;  1SL2 B;  1T00 A;  4AF2 A;  3EMP A;  5IMF A;  2QSI A;  1SKW B;  3IAS 2;  1U6T A;  5ECL B;  4ECC A;  3F0I A;  1M9A A;  1BX9 A;  1XZO A;  1EV9 A;  1FB0 A;  1AQW A;  2B7K A;  3TRX A;  4V1A p;  2VOC A;  2H01 A;  1Z6N A;  2I81 A;  1A23 A;  5F0G A;  4HUA A;  2MBS A;  1NSW A;  3I6A A;  1OC3 A;  4OCF A;  3HVS A;  5DVB A;  5CRH A;  1RK4 A;  4P3Y B;  4POB A;  1H75 A;  5F07 A;  4PTS A;  4F9Z A;  2B5X A;  2LJR A;  2OAD A;  5DDL A;  1ACV A;  1J08 A;  2HZE B;  1EP7 A;  1TDI A;  1YF1 A;  4L0U A;  3D0Z A;  1TK5 B;  3CRU A;  4LA1 A;  4TN8 A;  3GKM A;  2DJ1 A;  3F4R A;  1PRX A;  1WMJ A;  1X0R A;  5JCW A;  3IC8 A;  3GRX A;  3HJP A;  4ZIJ A;  4IP1 A;  4IQ1 A;  1EZK A;  1MDI A;  2K8V A;  5AIS A;  1T4Y A;  3ZTL A;  3ERW A;  1ZOF A;  4KAE A;  2OBI A;  4YQM A;  4EUY A;  1GUM A;  4K2D A;  4D73 B;  3G7J A;  4YQU A;  4FYU A;  1MDK A;  2VCW A;  2AV4 A;  4N10 A;  2R5G A;  1K3Y A;  4N0V A;  4ZB9 A;  1S3C A;  3L9S A;  3TJK A;  1QK8 A;  4XIH A;  2KP1 A;  2MMA A;  4V2L A;  3F8U A; 
#chains in the Genus database with same CATH topology
 1JFU A;  4QMK A;  2REM A;  5IOW A;  1AW9 A;  2NVL A;  4LMW A;  4PQ1 A;  1PMT A;  3FEU A;  5FHI A;  1LBK A;  2HSN A;  3GKN A;  4L0W A;  2RUF A;  3ZIV A;  2LNS A;  3ZRE A;  1TK8 B;  3DD3 A;  1X9W B;  3UVT A;  3RHC A;  5F06 A;  3IE3 A;  3FZ5 A;  4HS1 A;  4LMV A;  4KCE A;  4V2M A;  2YNX A;  1BQ7 A;  5BRT A;  5ELA A;  3UJ1 A;  4BL7 B;  1MD3 A;  1T7P B;  1ZMA A;  2XBI A;  2R37 A;  2X8G A;  4K5R A;  5CAX A;  2FHE A;  1YEP A;  1PL1 A;  4KUN A;  4EVM A;  4DSS A;  2EIQ A;  4I2U A;  1H4O A;  2WGR A;  3HJM A;  5LD0 A;  8GSS A;  4WEY A;  4ULX A;  3VUR A;  3FKF A;  3A5I A;  1MTC A;  4MJB A;  4HJM A;  2DSA A;  2HRA A;  4OFT A;  1NHY A;  5DBQ A;  2B1K A;  3R3E A;  3CSI A;  4IBP A;  5JWR B;  1M3J A;  1EOH A;  5C04 A;  4BIK A;  5HFG A;  1AAZ A;  1GTB A;  2H74 A;  2OBK A;  1TJD A;  3TKS A;  4WKW A;  4O5Q A;  3PH9 A;  3EU4 A;  5B8B A;  4NWY A;  2GQK A;  2F8F A;  2WZS A;  4XHM A;  3UOM A;  2H1L A;  2YZU A;  5HR1 A;  4EF0 A;  2WVZ A;  1BG5 A;  3Q18 A;  2H8L A;  4XS4 A;  5HR2 A;  2NTO A;  4BA7 A;  3L4N A;  4EIP A;  5A5H B;  5BMU B;  1QMV A;  3CXG A;  4G10 A;  5CYY A;  3UEM A;  4MZB A;  3CTG A;  5AIV A;  4V1A g;  1T3B A;  1Z7P A;  5DCH A;  1ABA A;  2CZ2 A;  3ME7 A;  4ZL7 A;  3A5W A;  2I4A A;  1A8L A;  2HFD A;  4FIW A;  4AKG A;  2IFQ A;  3S9F A;  3O3T A;  3HYP A;  2YZH A;  2HSM A;  3H1N A;  3KZQ A;  5J4V A;  4IEL A;  2H0I A;  3FZ9 A;  4IKH A;  3OR5 A;  2R6K A;  5D9T A;  1DE1 A;  1AIU A;  1GSS A;  3IR4 A;  3UIW A;  2GT5 A;  3MDK A;  1QFN A;  1GUL A;  4IN0 A;  4GDF A;  1B9Y C;  3UVH A;  3F9U A;  4MMM A;  3E0U A;  1ERU A;  1ON4 A;  5J40 A;  5A34 A;  2IIY A;  1VF4 A;  1UVZ A;  5J5N A;  4HU7 A;  4YAP A;  3IDV A;  5A5K A;  4O92 A;  3UAP A;  2OE0 A;  4F2I A;  4F82 A;  2DIY A;  3ZFL A;  3ED3 A;  1SKR B;  4JR6 A;  2J23 A;  5IQY A;  4NPB A;  1G0T A;  5D96 A;  3GMF A;  3VFI A;  4G0I A;  1R7H A;  3WT1 A;  1E2Y A;  2GZZ A;  1M0U A;  5ECS A;  2BTO T;  4MF6 A;  5GST A;  5DCG A;  2LJK A;  1W89 A;  5J9B A;  5E4W A;  3O76 A;  2VIM A;  2WVX B;  3WGE A;  4MA9 A;  1FW1 A;  2KLX A;  3FK8 A;  1U87 A;  3IC4 A;  4PQI A;  2CVB A;  5L71 A;  2P5Q A;  3FW2 A;  5KOX A;  2DMM A;  4OMV A;  2B1L A;  2V1M A;  1XWC A;  4DEJ A;  3H79 A;  3C73 A;  2PVO C;  1OAZ A;  4EKZ A;  2QA2 A;  4HDE A;  4X1U A;  4POL A;  2HRF A;  4JU5 A;  2PWJ A;  5JCU A;  3F4S A;  17GS A;  1GTI A;  2C3Q A;  6GSS A;  4AGS A;  4Z2U A;  3ZRD A;  4MJA A;  3R2Q A;  2RLI A;  3CWG A;  1YJ6 A;  1B4Q A;  5G2Z A;  2F9S A;  1VRS D;  1Y6E A;  3QR6 A;  3EE2 A;  4MF7 A;  5HQP A;  1K0A A;  3LG6 A;  5IMZ A;  2GDR A;  1M99 A;  2HE3 A;  2VCV A;  4GTU A;  2ZCT A;  5KN3 A;  4TR4 A;  2YAN A;  1WIK A;  3QFB C;  2VCX A;  6GST A;  3RPP A;  5IM9 A;  2R0P A;  3E9J B;  3I9V 2;  2RM5 A;  1DUG A;  2H6X A;  1FOV A;  3L0H A;  5D9X A;  3ZML A;  5KN2 A;  1TRV A;  3AY8 A;  1AQX A;  2H1A A;  5A1N A;  3RDW A;  5B6M A;  2YWN A;  4HI7 A;  3DIE A;  2XPE A;  1JZR A;  3D4M A;  2HSH A;  3K8N A;  1V40 A;  1B9X C;  1THX A;  3KH7 A;  3ZZX A;  2VL3 A;  3DVW A;  1O6J A;  3EUR A;  3D5J A;  3IOS A;  1ZGN A;  2JAC A;  1WP0 A;  1OC9 A;  4BVX A;  4YKG A;  1EWX A;  4I97 A;  5IO2 A;  2FUG 2;  3KM6 A;  4K8M A;  1JLW A;  1N8J A;  2EFC A;  3JCM L;  1Q4J A;  3DGQ A;  4GF0 A;  2H76 A;  3HVV A;  4K7I A;  4PNF A;  2RM6 A;  3APQ A;  3EMX A;  1ZYE A;  2JSZ A;  2GST A;  4Q5F A;  1M9B A;  5F8B A;  2FWG A;  1K0B A;  2PU9 C;  4OFN A;  4TR0 A;  4E68 A;  3GL5 A;  1QUW A;  3QMX A;  1TW9 A;  4OWY A;  1ERW A;  3P2A A;  4FO5 A;  3TOU A;  2K6V A;  2QC7 A;  4ILF A;  4K7N A;  2V2G A;  3CHX C;  5GAP D;  1XOB A;  2OJL A;  1A0R P;  4I6X A;  2PGT A;  2FNO A;  1K0O A;  1I5G A;  2VLU A;  1JZW A;  3TKR A;  3TU3 B;  5ECO B;  2AJQ B;  4O7H A;  2P31 A;  4L8E A;  1JZO A;  1PFO A;  2DJJ A;  4F0C A;  2I9H A;  4RUV A;  5CO3 A;  4PUF C;  2F51 A;  2C4J A;  2HRN A;  2G0F A;  1OYJ A;  3APO A;  5ELG A;  4EE0 A;  2L59 A;  3W6G A;  4WET A;  5IMC A;  4O5R A;  3P90 A;  5IPH A;  1PKZ A;  3UAR A;  2FD3 A;  3A3T A;  5DAK A;  2WW1 A;  1MDJ A;  2HNL A;  2P5R A;  1OE8 A;  1LJR A;  5A4V A;  5G5E A;  1S4B P;  5G1L A;  3TDG A;  3E3E A;  2A4V A;  1XVW A;  3L9V A;  3Q6O A;  5J3R A;  4GLT A;  1PGT A;  1OKD A;  2O89 A;  1XW9 A;  2YP6 A;  4KDY A;  3DKS A;  3I69 A;  1NM3 A;  2A4H A;  2VCT A;  1TP9 A;  2M80 A;  5DJM A;  2GZP A;  2UV8 G;  2H19 A;  2DC5 A;  1GSY A;  3WD6 A;  4OCE A;  4X4J A;  6GSY A;  2DBC A;  2L5L A;  2F3M A;  2YJH A;  1WE0 A;  4HQZ A;  2FWF A;  5CRW A;  3GFK A;  4WXT A;  4OFM A;  3ME8 A;  1PQN A;  5F05 A;  3KJY A;  3LJR A;  1CQH A;  3TJB A;  1X9S B;  1TI3 A;  1IYI A;  1X5D A;  3HMJ G;  1A0F A;  1FVJ A;  4O32 A;  1AC1 A;  2HYX A;  1SJZ A;  3CRT A;  1FAA A;  3C71 A;  2GSS A;  2GGT A;  1PX6 A;  3IPZ A;  4BVY A;  3D21 A;  3KGK A;  3LXT A;  11GS A;  2H66 A;  3G7I A;  5ECM B;  2YWM A;  1PN0 A;  5ECQ B;  1G7O A;  4K7O A;  4AKI A;  1U3I A;  2R0G A;  3KCM A;  2A2P A;  4FXY P;  1XBS A;  3GHA A;  3IAM 2;  2LST A;  3F3R A;  4CDO A;  3D22 A;  2WRT A;  2ES7 A;  2VM2 A;  3MWH A;  2LNT A;  4AKX B;  4N0Z A;  4ZB6 A;  2VLV A;  3EU3 A;  3APS A;  1A8Y A;  4WR4 A;  2HSN B;  5COH A;  3KMN A;  1O8X A;  3RFR C;  3LFL A;  3ISO A;  1GWC A;  2O3E A;  4MPG A;  3GTU A;  1YEW C;  4DSR A;  2YWO A;  4E8H A;  4PX1 A;  3EYT A;  2O5V A;  2LV3 A;  1SYX A;  1Z9H A;  3NZN A;  2MBT A;  4DSS B;  4KX4 A;  4A5P A;  2I1U A;  1F37 A;  2TRX A;  3BD2 A;  3G9B A;  4WBR D;  4MH3 A;  1A2J A;  4ZB7 A;  1PL2 A;  4CHS A;  4EXJ A;  4NV2 A;  4N30 A;  1A24 A;  1FB6 A;  3VWU A;  1TRS A;  4RI7 A;  1GP1 A;  1O85 A;  4ZIL A;  3DYR A;  3GN3 A;  3WGD A;  13GS A;  1X5E A;  1T1V A;  2DJ0 A;  4OD7 A;  5EPF A;  2X64 A;  4TXO B;  1RQM A;  3BCI A;  4KSO A;  1V58 A;  1OE7 A;  1EP8 A;  5GAN D;  4K9Z A;  1FG4 A;  1WOU A;  4L5O A;  1UN2 A;  4V2N A;  1THO A;  2Z9S A;  5J47 A;  4POK A;  4K2X A;  3LQ7 A;  2LQO A;  1EOG A;  4LL1 B;  1TU8 A;  3TKQ A;  3GX8 A;  3HVN A;  2LUS A;  2WW0 A;  2FY6 A;  1A2L A;  4USS A;  3C8E A;  1B4P A;  2B5Y A;  3GYK A;  3U5R E;  5ECI B;  4Z2R A;  1XXU A;  3UBL A;  2X8H A;  1XWK A;  3M8N A;  3TOT A;  4WR5 A;  4YKF A;  3F63 A;  5FT3 A;  4TR1 A;  1FO5 A;  1Y1U A;  4XS6 A;  2L57 A;  3SWL A;  3RAZ A;  1HQO A;  3IV4 A;  2HSM B;  2EFH A;  5LCZ A;  3N9J A;  1SJI A;  4XTS A;  3TKS E;  3A2V A;  1PKW A;  4FH8 A;  1S3R A;  4PQH A;  4ZBD A;  6GSW A;  3QFA C;  4J57 E;  4JBB A;  4GSN A;  3BBY A;  2V6O A;  4PGT A;  2JAD A;  2NPB A;  2L6C A;  2C1Y A;  2OAC A;  1WWJ A;  1URM A;  2IPA A;  2GT6 A;  1G7E A;  4OO5 A;  1SVL A;  2GSQ A;  3MNG A;  3HJO A;  5A34 B;  1YF0 A;  1ZYN A;  4I2T A;  4ZL9 A;  3WGX A;  1VF2 A;  3FMW A;  1EGR A;  4EDZ A;  1KEB A;  5IMV A;  4W66 A;  2DJ2 A;  5JCG A;  4X0X A;  1O8W A;  3LEF A;  2DJK A;  3UMA A;  1Z5Y E;  2HI7 A;  3FHK A;  5JWQ B;  1EEJ A;  4G0K A;  4MDC A;  2NDO A;  4ACS A;  2VM1 A;  4GXZ A;  2FWH A;  1G6Y A;  2LTK A;  4K0G A;  1YKA A;  2IL3 A;  1F6M C;  4IGJ A;  2MZC A;  4QQ7 A;  5IOX A;  3HXS A;  2CV4 A;  2GZY A;  1SD8 A;  2VAF A;  1XWG A;  4XCS A;  4MZW A;  1VGL A;  2E2M A;  3LGC A;  1J0F A;  2EC4 A;  1SJ6 A;  2ON5 A;  5J4Y A;  1TXU A;  3P8W A;  2H70 A;  3BJ5 A;  3QAW A;  2V32 A;  4TR3 A;  1PA3 A;  5CNW A;  3TJJ A;  1WRY A;  5INY A;  3PR8 A;  3C1R A;  1O73 A;  1ST9 A;  1V9W A;  3GNJ A;  2GVP A;  5HFI A;  2FLS A;  5JWO B;  3GKK A;  4YH2 A;  3ERG A;  2EFE A;  3VI5 A;  2BMX A;  1TU7 A;  3N5O A;  5AN1 A;  4EDY A;  5ECP B;  3FZA A;  4TRX A;  4IS0 A;  2VO4 A;  2C8U A;  3F6F A;  3QCP A;  2FCH A;  5H5Q A;  1ML6 A;  3TRP A;  1SVM A;  3KH9 A;  3IHG A;  4K5S A;  4XRA A;  3RHB A;  4BPY A;  2C0G A;  1QQ2 A;  2FA8 A;  2OE3 A;  2A2S A;  2WS2 A;  3F3Q A;  1ZL9 A;  3J7Y k;  1O81 A;  4MCU A;  1XPV A;  3PPU A;  2VD1 A;  3ZIJ A;  1AUC A;  20GS A;  1S3D A;  3GST A;  4G01 A;  3EVI A;  2H75 A;  2X4A A;  4QL7 A;  3GUS A;  1OC9 B;  4BVX B;  2MMZ A;  4XS1 A;  5DAL A;  3VWX A;  1XOA A;  4MAB A;  5IPG A;  1GH2 A;  4LL4 B;  2DML A;  2CT6 A;  5CRG A;  2DJ3 A;  4WF5 A;  3UL3 A;  4ECB A;  2AUV A;  5KN1 A;  3FR6 A;  3DRN A;  3VK9 A;  3M9J A;  1MEK A;  4HOJ A;  4ZBA A;  1FHE A;  1EEM A;  5KEJ A;  3DML A;  4RI6 A;  4ISD A;  3D4T A;  1C72 A;  3EWL A;  3QOU A;  2AYT A;  3UBK A;  2L5O A;  1GUH A;  2B7J A;  4NXI A;  1GL8 A;  2MMO A;  5D9V A;  1T4Z A;  2JZR A;  4WBJ A;  3DVX A;  1XVQ A;  4IW9 A;  2HRK A;  1SK2 A;  1GSU A;  3G7Y A;  1F3A A;  3GH6 A;  4FYC A;  4HEA 2;  3MAK A;  3HZ4 A;  4MP4 A;  2WUL A;  4KGI A;  2N5F A;  5G31 A;  3GX0 A;  4AKH A;  2PVQ A;  2XPD A;  22GS A;  3CSJ A;  4Q5N A;  4QL9 A;  1NHO A;  4GWR A;  1RW1 A;  3LYP A;  3J7Y b;  3HKR A;  5AIX A;  2IN3 A;  3TJG A;  4Q5Q A;  4KH7 A;  5DAK B;  1TK0 B;  1Z6M A;  1GSD A;  1DBY A;  5KOW A;  4YAV A;  2K9F A;  2HQT A;  3VWV A;  4KB3 A;  2C0D A;  2IMI A;  3PIN A;  12GS A;  2DKI A;  5EVO A;  3F6D A;  4ZXG A;  1BYE A;  1Q98 A;  2LRC A;  3QPM A;  1Z7R A;  4HSC X;  5ID2 A;  2LRT A;  3KMO A;  3GUR A;  5CRE A;  4TOP A;  2N5B A;  3CYN A;  2YV7 A;  1G6W A;  4JRR A;  2M72 A;  3ZMK A;  2FA4 A;  2LQQ A;  1GSF A;  4MPF A;  2B6M A;  5HR0 A;  3LXZ A;  5ECR B;  2GQL A;  2OE1 A;  4GCI A;  2YN1 A;  3M1G A;  1XW5 A;  1EGO A;  2R2J A;  2JZT A;  4MNN A;  2X99 A;  2CX3 A;  5KN0 A;  5DJL A;  3FR9 A;  3TKS C;  18GS A;  4G19 A;  4K6X A;  4F03 A;  4HJ2 A;  3TUE A;  2CVK A;  2I3Y A;  2VCZ A;  1KNG A;  2LKU A;  3HA9 A;  5G30 A;  4MK3 A;  4LLR A;  4NV5 A;  2RII A;  4BVY B;  3QD9 A;  4Z2T A;  1YY7 A;  10GS A;  4DSQ A;  2WCI A;  2V41 A;  1SYR A;  1ZYQ B;  2H30 A;  1HNA A;  4G2E A;  1GUK A;  5D9W A;  4KA0 A;  2AB6 A;  3US3 A;  1I1I P;  2IMK A;  4NHW A;  1QGV A;  2VLT A;  1HD2 A;  3A2X A;  4POM A;  2JU5 A;  3ZVJ D;  1E6B A;  2C3N A;  1UC7 A;  1PD2 1;  14GS A;  1HYU A;  2H71 A;  1A2M A;  3W8J A;  1DSB A;  3PGT A;  3GA4 A;  2EIO A;  1M7T A;  4PNG A;  3F4T A;  1BAY A;  3L78 A;  5J4U A;  1GSE A;  2OT3 A;  3GTU B;  1Z3E A;  2YJ7 A;  1OKT A;  4RQR A;  1X5C A;  1AXD A;  1WJK A;  3LOR A;  3ZL5 A;  2PBJ A;  1ZCP A;  1SK0 A;  4EL1 A;  4MZC A;  1GNE A;  3HCZ A;  4IP6 A;  19GS A;  5D93 A;  1YZX A;  1V2A A;  5FWG A;  2HSY A;  2X8C A;  4X43 A;  5ENU A;  1I9D A;  1XW6 A;  2LRN A;  4IQA A;  2WW2 A;  2MYG A;  4AJ7 A;  1TOF A;  3ZVJ A;  2PPT A;  5IO0 A;  2HZE A;  5H5R A;  4TW5 A;  3IRA A;  1OC8 A;  5IMD A;  1N2A A;  1XIY A;  2X49 A;  3ZYW A;  4EO3 A;  4GRF A;  1GRX A;  4NAX A;  1F2E A;  3RPN A;  1PSQ A;  4ICY A;  4KW6 A;  1WPI A;  4EC0 A;  2JZS A;  4BWQ A;  2XC2 A;  1HNB A;  5G5F A;  2L6D A;  2HT9 A;  4K0N A;  5IIZ A;  3C1S A;  3TCO A;  4CY6 A;  3CSH A;  2E0Q A;  1W4V A;  5J41 A;  4IJI A;  3GSS A;  3DWV A;  2YCD A;  1GNW A;  1MD4 A;  4D73 A;  2ZUP A;  4CY8 A;  5H5S A;  1CQG A;  5A4W A;  4DVC A;  4KSM A;  2LJA A;  3CQF A;  2VL2 C;  3D6I A;  2CX4 A;  3NIV A;  2BJX A;  4NMU A;  1XWB A;  2H73 A;  5EY6 A;  5D8I A;  4GQC A;  1JLV A;  1BG1 A;  1SKS B;  2OKA A;  2HXK A;  2IMD A;  2AAW A;  1K0C A;  2YV9 A;  3VLN A;  4IJ3 A;  4CW9 A;  1R5P A;  4TR1 B;  3IBH A;  2KHP A;  1N25 A;  4XS4 B;  2KUC A;  3HVX A;  2QKE A;  1R4W A;  2GSR A;  6GSX A;  2C0E A;  2GQM A;  3WYW A;  2IMF A;  1S3A A;  2WB9 A;  2VD0 A;  2O85 A;  5ECN B;  4WF4 A;  3EIN A;  3KIJ A;  2VKZ G;  2J9H A;  5CRD A;  4KDX A;  3TRQ A;  2EIR A;  3FYG A;  2DLX A;  4MH2 A;  3ZLP A;  4BL7 A;  3TJF A;  3LYK A;  2RUE A;  1SVO A;  5CP1 A;  1TXX A;  3IXR A;  2WW3 A;  3QDN A;  2PUK C;  2IFQ B;  1K0D A;  2YPM A;  1YQ1 A;  3TKP A;  3LSZ A;  2O7K A;  4JR4 A;  4TXO A;  2HZF A;  2FWE A;  4JED A;  3CTF A;  2QA1 A;  1JHB A;  2PMT A;  4ECJ A;  2GS3 A;  2JSY A;  3H8Q A;  3HY2 A;  4N3Z A;  1TRW A;  2ALB A;  2TIR A;  7GSS A;  2FGX A;  1V98 A;  1K3O A;  3DXB A;  2CA8 A;  5B7C A;  2H1G A;  3NOF A;  2VUP A;  5GSS A;  3KEB A;  1GTA A;  2C0F A;  1XFL A;  1IYH A;  4FQU A;  4N11 A;  2H6Z A;  3LWA A;  4O5U A;  4PI2 C;  2IWT A;  3MYD A;  5GZZ B;  4IHU A;  2VL9 A;  3HDC A;  2PN8 A;  4K1F A;  2AHE A;  5A5H A;  1SD9 A;  2D2Z A;  3DEX A;  5BMU A;  2MMN A;  1F3B A;  2OA7 A;  3GL3 A;  2NBS A;  3SBC A;  3QAG A;  4AJ8 A;  1BJX A;  2PER A;  1JZD A;  2H0H A;  2YOI A;  5B6N A;  9GSS A;  2WDU A;  2K18 A;  3M0F A;  2R0C A;  3CMI A;  5C00 A;  3BCK A;  4FYB A;  1B8X A;  4ECI A;  3L9U A;  3M9K A;  2B3S A;  2GLR A;  3GKX A;  1K3L A;  1O7U A;  3IK9 A;  1VF1 A;  4ZB8 A;  4MLY A;  2CVD A;  1F9M A;  1LU4 A;  1M2D A;  4J2F A;  3HZ8 A;  2IME A;  6GSU A;  5HR3 A;  2ON7 A;  4JZQ A;  3I43 A;  1ILO A;  3ERF A;  3VI7 A;  1AQV A;  4MF5 A;  4J56 E;  1R26 A;  3MIX A;  4YQV A;  1FVK A;  5G1K A;  4BWS A;  3GIX A;  3H93 A;  1YVL A;  3ZFB A;  4NHZ A;  5EL8 A;  4ZBB A;  3IA1 A;  3QAV A;  4AI6 A;  4G9H A;  3C7M A;  2L4Q A;  2C3T A;  3KP9 A;  4HZ2 A;  1SK1 A;  1PN9 A;  4F0B A;  1YKC A;  1SU9 A;  3V1W A;  1Y25 A;  2WVY A;  1HNC A;  5LNK e;  1ZZY A;  4OO4 A;  1B48 A;  1GSQ A;  2TRC P;  3Q19 A;  1BED A;  4I8B A;  5ECK B;  2VL2 A;  2JL4 A;  2KOK A;  2H6Y A;  5HFK A;  2DIZ A;  5J9C A;  4PUR A;  1M3I A;  2H1B A;  2LEG A;  4ID0 A;  4PXO A;  5DAL B;  2ZNM A;  1XWA A;  5A1N B;  2O36 A;  5E59 A;  2CAI A;  2N5A A;  1U3A A;  1DE2 A;  2WVX A;  1GLQ A;  2B5E A;  5ABR A;  4GSS A;  1SL0 B;  4GQF A;  1ERT A;  3GH9 A;  1K0M A;  3BOA A;  3H4K A;  4KDU A;  2E7P A;  3U6V A;  1KBN A;  2WZ9 A;  3FY7 A;  3KD0 A;  3KP8 A;  4TXV A;  2H1D A;  4AJ6 A;  1SEN A;  1T8E B;  3TB2 A;  4G0L A;  1X9M B;  1EV4 A;  4ML6 A;  1XG8 A;  2HLS A;  2IJY A;  4L5L A;  4JE1 A;  4IVF A;  4Z7X A;  1ERV A;  1VF3 A;  2HRK B;  2LS5 A;  4ML1 A;  1GLP A;  3EC3 A;  4PHZ C;  2WFC A;  3VWW A;  3TGZ A;  2YWI A;  1M2B A;  2WJU A;  3RBT A;  4KCA A;  1GTU A;  2DKH A;  3KTL A;  3KXO A;  4KE3 A;  1R5A A;  2VCQ A;  4PUA A;  4MJE A;  1U88 A;  3FR3 A;  2H0G A;  2C80 A;  3IK7 A;  2K8S A;  4RQX A;  2QGV A;  16GS A;  3W8S A;  1M2A A;  2P0G A;  3A2W A;  4GST A;  4HQS A;  2G2Q A;  1KTE A;  1K0N A;  4E8E A;  3MSZ A;  2UZ8 A;  2GTU A;  3IHQ A;  5ECH B;  2M46 A;  3O6T A;  3LW9 A;  3ZIT A;  2A2R A;  3FRC A;  5B8A A;  1YDK A;  1SL1 B;  3FZ4 A;  4EIQ A;  5ID2 B;  1QXH A;  3CBU A;  1TRU A;  1OVN A;  4H86 A;  1TI1 A;  3GV1 A;  1NW2 A;  4Q5R A;  4HZ4 A;  2CAQ A;  3Q74 A;  1V57 A;  4MJC A;  2CZ3 A;  1FOH A;  1XCC A;  1J9B A;  2XBQ A;  2CQ9 A;  4PI0 C;  3M3M A;  5AGY A;  5DQS A;  2V6K A;  3VPT A;  4I5Q A;  3P7X A;  3KTB A;  4HU9 A;  1PX7 A;  2XHF A;  4TVE A;  3HHV A;  3HD5 A;  4TKY A;  5D73 A;  4XRD A;  2R4V A;  6GSV A;  4KF9 A;  5A4U A;  1USB A;  4KND A;  2L4C A;  1TKD B;  2H72 A;  3VPQ A;  2E2G A;  2KP2 A;  3WT2 A;  2R3X A;  1TTZ A;  2O8V B;  4ZL8 A;  1YEX A;  5IMA A;  1UA5 A;  2F8A A;  2O87 A;  5DQY A;  1SL2 B;  1T00 A;  4AF2 A;  3EMP A;  3RGB C;  5IMF A;  1BF5 A;  2QSI A;  1SKW B;  3IAS 2;  1U6T A;  5ECL B;  4ECC A;  3F0I A;  1M9A A;  1BX9 A;  1XZO A;  1EV9 A;  1FB0 A;  1AQW A;  2B7K A;  3TRX A;  4V1A p;  2VOC A;  2H01 A;  2I81 A;  1Z6N A;  1A23 A;  5F0G A;  4HUA A;  2MBS A;  1NSW A;  3I6A A;  1OC3 A;  4OCF A;  3HVS A;  5DVB A;  5CRH A;  1RK4 A;  4P3Y B;  4POB A;  1H75 A;  5F07 A;  4PTS A;  4F9Z A;  2B5X A;  2LJR A;  2OAD A;  5DDL A;  2EFD A;  1ACV A;  1J08 A;  2HZE B;  1EP7 A;  1TDI A;  1YF1 A;  4L0U A;  3D0Z A;  1TK5 B;  3CRU A;  4LA1 A;  4TN8 A;  3GKM A;  2DJ1 A;  3F4R A;  1PRX A;  1WMJ A;  1X0R A;  5JCW A;  3IC8 A;  3GRX A;  3HJP A;  4ZIJ A;  4IP1 A;  4IQ1 A;  1EZK A;  1MDI A;  2K8V A;  5AIS A;  1T4Y A;  3ZTL A;  3ERW A;  1ZOF A;  3EPT A;  4KAE A;  2OBI A;  4YQM A;  4EUY A;  1GUM A;  4K2D A;  4D73 B;  1ZYP A;  3G7J A;  4YQU A;  4FYU A;  1MDK A;  2VCW A;  2AV4 A;  4N10 A;  2R5G A;  1K3Y A;  4N0V A;  4ZB9 A;  1S3C A;  3L9S A;  3TJK A;  1QK8 A;  4XIH A;  2KP1 A;  2MMA A;  4V2L A;  3F8U A; 
#chains in the Genus database with same CATH homology
 1JFU A;  4QMK A;  2REM A;  5IOW A;  1AW9 A;  2NVL A;  4LMW A;  4PQ1 A;  1PMT A;  3FEU A;  5FHI A;  1LBK A;  2HSN A;  3GKN A;  4L0W A;  2RUF A;  3ZIV A;  2LNS A;  3ZRE A;  1TK8 B;  3DD3 A;  1X9W B;  3UVT A;  3RHC A;  5F06 A;  3IE3 A;  3FZ5 A;  4HS1 A;  4LMV A;  4KCE A;  4V2M A;  2YNX A;  1BQ7 A;  5BRT A;  5ELA A;  3UJ1 A;  4BL7 B;  1MD3 A;  1T7P B;  1ZMA A;  2XBI A;  2R37 A;  2X8G A;  4K5R A;  5CAX A;  2FHE A;  1YEP A;  1PL1 A;  4KUN A;  4EVM A;  4DSS A;  2EIQ A;  4I2U A;  1H4O A;  2WGR A;  3HJM A;  5LD0 A;  8GSS A;  4WEY A;  4ULX A;  3VUR A;  3FKF A;  3A5I A;  1MTC A;  4MJB A;  4HJM A;  2DSA A;  2HRA A;  4OFT A;  1NHY A;  5DBQ A;  2B1K A;  3R3E A;  3CSI A;  4IBP A;  5JWR B;  1EOH A;  5C04 A;  5HFG A;  1AAZ A;  1GTB A;  2H74 A;  2OBK A;  1TJD A;  3TKS A;  4WKW A;  4O5Q A;  3PH9 A;  3EU4 A;  5B8B A;  4NWY A;  2GQK A;  2F8F A;  4XHM A;  3UOM A;  2H1L A;  2YZU A;  5HR1 A;  4EF0 A;  1BG5 A;  3Q18 A;  2H8L A;  4XS4 A;  5HR2 A;  2NTO A;  4BA7 A;  3L4N A;  4EIP A;  5A5H B;  5BMU B;  1QMV A;  3CXG A;  4G10 A;  5CYY A;  3UEM A;  4MZB A;  3CTG A;  5AIV A;  4V1A g;  1T3B A;  1Z7P A;  5DCH A;  1ABA A;  2CZ2 A;  3ME7 A;  4ZL7 A;  3A5W A;  2I4A A;  1A8L A;  2HFD A;  4FIW A;  4AKG A;  2IFQ A;  3S9F A;  3O3T A;  3HYP A;  2YZH A;  2HSM A;  3H1N A;  3KZQ A;  5J4V A;  4IEL A;  2H0I A;  3FZ9 A;  4IKH A;  3OR5 A;  2R6K A;  5D9T A;  1DE1 A;  1AIU A;  1GSS A;  3IR4 A;  3UIW A;  2GT5 A;  3MDK A;  1QFN A;  1GUL A;  4IN0 A;  4GDF A;  1B9Y C;  3UVH A;  3F9U A;  4MMM A;  3E0U A;  1ERU A;  1ON4 A;  5J40 A;  5A34 A;  2IIY A;  1VF4 A;  1UVZ A;  5J5N A;  4HU7 A;  4YAP A;  3IDV A;  5A5K A;  4O92 A;  3UAP A;  2OE0 A;  4F2I A;  4F82 A;  2DIY A;  3ZFL A;  3ED3 A;  1SKR B;  4JR6 A;  2J23 A;  5IQY A;  4NPB A;  1G0T A;  5D96 A;  3GMF A;  3VFI A;  4G0I A;  1R7H A;  3WT1 A;  1E2Y A;  2GZZ A;  1M0U A;  5ECS A;  2BTO T;  4MF6 A;  5GST A;  5DCG A;  2LJK A;  1W89 A;  5J9B A;  5E4W A;  3O76 A;  2VIM A;  3WGE A;  4MA9 A;  1FW1 A;  2KLX A;  3FK8 A;  1U87 A;  3IC4 A;  4PQI A;  2CVB A;  5L71 A;  2P5Q A;  3FW2 A;  5KOX A;  2DMM A;  4OMV A;  2B1L A;  2V1M A;  1XWC A;  4DEJ A;  3H79 A;  3C73 A;  2PVO C;  1OAZ A;  4EKZ A;  2QA2 A;  4HDE A;  4X1U A;  4POL A;  2HRF A;  4JU5 A;  2PWJ A;  5JCU A;  3F4S A;  17GS A;  1GTI A;  2C3Q A;  6GSS A;  4AGS A;  4Z2U A;  3ZRD A;  4MJA A;  3R2Q A;  2RLI A;  3CWG A;  1YJ6 A;  1B4Q A;  5G2Z A;  2F9S A;  1VRS D;  1Y6E A;  3QR6 A;  3EE2 A;  4MF7 A;  5HQP A;  1K0A A;  3LG6 A;  5IMZ A;  2GDR A;  1M99 A;  2HE3 A;  2VCV A;  4GTU A;  2ZCT A;  5KN3 A;  4TR4 A;  2YAN A;  1WIK A;  3QFB C;  2VCX A;  6GST A;  3RPP A;  5IM9 A;  2R0P A;  3E9J B;  3I9V 2;  2RM5 A;  1DUG A;  2H6X A;  1FOV A;  3L0H A;  5D9X A;  3ZML A;  5KN2 A;  1TRV A;  3AY8 A;  1AQX A;  2H1A A;  5A1N A;  3RDW A;  5B6M A;  2YWN A;  4HI7 A;  3DIE A;  2XPE A;  1JZR A;  3D4M A;  2HSH A;  3K8N A;  1V40 A;  1B9X C;  1THX A;  3KH7 A;  3ZZX A;  2VL3 A;  3DVW A;  1O6J A;  3EUR A;  3D5J A;  3IOS A;  1ZGN A;  2JAC A;  1WP0 A;  1OC9 A;  4BVX A;  4YKG A;  1EWX A;  4I97 A;  5IO2 A;  2FUG 2;  3KM6 A;  4K8M A;  1JLW A;  1N8J A;  2EFC A;  3JCM L;  1Q4J A;  3DGQ A;  4GF0 A;  2H76 A;  3HVV A;  4K7I A;  4PNF A;  2RM6 A;  3APQ A;  3EMX A;  1ZYE A;  2JSZ A;  2GST A;  4Q5F A;  1M9B A;  5F8B A;  2FWG A;  1K0B A;  2PU9 C;  4OFN A;  4TR0 A;  4E68 A;  3GL5 A;  1QUW A;  3QMX A;  1TW9 A;  4OWY A;  1ERW A;  3P2A A;  4FO5 A;  3TOU A;  2K6V A;  2QC7 A;  4ILF A;  4K7N A;  2V2G A;  5GAP D;  1XOB A;  2OJL A;  1A0R P;  4I6X A;  2PGT A;  2FNO A;  1K0O A;  1I5G A;  2VLU A;  1JZW A;  3TKR A;  3TU3 B;  5ECO B;  2AJQ B;  4O7H A;  2P31 A;  4L8E A;  1JZO A;  2DJJ A;  4F0C A;  2I9H A;  4RUV A;  5CO3 A;  4PUF C;  2F51 A;  2C4J A;  2HRN A;  2G0F A;  1OYJ A;  3APO A;  5ELG A;  4EE0 A;  2L59 A;  3W6G A;  4WET A;  5IMC A;  4O5R A;  3P90 A;  5IPH A;  1PKZ A;  3UAR A;  2FD3 A;  3A3T A;  5DAK A;  1MDJ A;  2HNL A;  2P5R A;  1OE8 A;  1LJR A;  5A4V A;  5G5E A;  5G1L A;  3TDG A;  3E3E A;  2A4V A;  1XVW A;  3L9V A;  3Q6O A;  5J3R A;  4GLT A;  1PGT A;  1OKD A;  2O89 A;  1XW9 A;  2YP6 A;  4KDY A;  3DKS A;  3I69 A;  1NM3 A;  2A4H A;  2VCT A;  1TP9 A;  2M80 A;  5DJM A;  2GZP A;  2UV8 G;  2H19 A;  2DC5 A;  1GSY A;  3WD6 A;  4OCE A;  4X4J A;  6GSY A;  2DBC A;  2L5L A;  2F3M A;  2YJH A;  1WE0 A;  4HQZ A;  2FWF A;  5CRW A;  3GFK A;  4WXT A;  4OFM A;  3ME8 A;  1PQN A;  5F05 A;  3KJY A;  3LJR A;  1CQH A;  3TJB A;  1X9S B;  1TI3 A;  1IYI A;  1X5D A;  3HMJ G;  1A0F A;  1FVJ A;  4O32 A;  1AC1 A;  2HYX A;  1SJZ A;  3CRT A;  1FAA A;  3C71 A;  2GSS A;  2GGT A;  1PX6 A;  3IPZ A;  4BVY A;  3D21 A;  3KGK A;  3LXT A;  11GS A;  2H66 A;  3G7I A;  5ECM B;  2YWM A;  1PN0 A;  5ECQ B;  1G7O A;  4K7O A;  4AKI A;  1U3I A;  2R0G A;  3KCM A;  2A2P A;  1XBS A;  3GHA A;  3IAM 2;  2LST A;  3F3R A;  4CDO A;  3D22 A;  2WRT A;  2ES7 A;  2VM2 A;  3MWH A;  2LNT A;  4AKX B;  4N0Z A;  4ZB6 A;  2VLV A;  3EU3 A;  3APS A;  1A8Y A;  4WR4 A;  2HSN B;  5COH A;  3KMN A;  1O8X A;  3LFL A;  3ISO A;  1GWC A;  4MPG A;  3GTU A;  4DSR A;  2YWO A;  4E8H A;  4PX1 A;  3EYT A;  2O5V A;  2LV3 A;  1SYX A;  1Z9H A;  3NZN A;  2MBT A;  4DSS B;  4KX4 A;  4A5P A;  2I1U A;  1F37 A;  2TRX A;  3BD2 A;  3G9B A;  4WBR D;  4MH3 A;  1A2J A;  4ZB7 A;  1PL2 A;  4CHS A;  4EXJ A;  4NV2 A;  4N30 A;  1A24 A;  1FB6 A;  3VWU A;  1TRS A;  4RI7 A;  1GP1 A;  1O85 A;  4ZIL A;  3DYR A;  3GN3 A;  3WGD A;  13GS A;  1X5E A;  1T1V A;  2DJ0 A;  4OD7 A;  5EPF A;  2X64 A;  4TXO B;  1RQM A;  3BCI A;  4KSO A;  1V58 A;  1OE7 A;  1EP8 A;  5GAN D;  4K9Z A;  1FG4 A;  1WOU A;  4L5O A;  1UN2 A;  4V2N A;  1THO A;  2Z9S A;  5J47 A;  4POK A;  4K2X A;  3LQ7 A;  2LQO A;  1EOG A;  4LL1 B;  1TU8 A;  3TKQ A;  3GX8 A;  2LUS A;  2FY6 A;  1A2L A;  4USS A;  3C8E A;  1B4P A;  2B5Y A;  3GYK A;  3U5R E;  5ECI B;  4Z2R A;  1XXU A;  3UBL A;  2X8H A;  1XWK A;  3M8N A;  3TOT A;  4WR5 A;  4YKF A;  3F63 A;  5FT3 A;  4TR1 A;  1FO5 A;  1Y1U A;  4XS6 A;  2L57 A;  3SWL A;  3RAZ A;  1HQO A;  3IV4 A;  2HSM B;  2EFH A;  5LCZ A;  3N9J A;  1SJI A;  4XTS A;  3TKS E;  3A2V A;  1PKW A;  4FH8 A;  4PQH A;  4ZBD A;  6GSW A;  3QFA C;  4J57 E;  4JBB A;  4GSN A;  3BBY A;  2V6O A;  4PGT A;  2JAD A;  2NPB A;  2L6C A;  2C1Y A;  2OAC A;  1WWJ A;  1URM A;  2IPA A;  2GT6 A;  1G7E A;  4OO5 A;  1SVL A;  2GSQ A;  3MNG A;  3HJO A;  5A34 B;  1YF0 A;  1ZYN A;  4I2T A;  4ZL9 A;  3WGX A;  1VF2 A;  3FMW A;  1EGR A;  4EDZ A;  1KEB A;  5IMV A;  4W66 A;  2DJ2 A;  5JCG A;  4X0X A;  1O8W A;  3LEF A;  2DJK A;  3UMA A;  1Z5Y E;  2HI7 A;  3FHK A;  5JWQ B;  1EEJ A;  4G0K A;  4MDC A;  2NDO A;  4ACS A;  2VM1 A;  4GXZ A;  2FWH A;  1G6Y A;  2LTK A;  4K0G A;  1YKA A;  2IL3 A;  1F6M C;  4IGJ A;  2MZC A;  4QQ7 A;  5IOX A;  3HXS A;  2CV4 A;  2GZY A;  1SD8 A;  2VAF A;  1XWG A;  4XCS A;  4MZW A;  1VGL A;  2E2M A;  3LGC A;  1J0F A;  2EC4 A;  1SJ6 A;  2ON5 A;  5J4Y A;  1TXU A;  3P8W A;  2H70 A;  3BJ5 A;  3QAW A;  2V32 A;  4TR3 A;  1PA3 A;  5CNW A;  3TJJ A;  1WRY A;  5INY A;  3PR8 A;  3C1R A;  1O73 A;  1ST9 A;  1V9W A;  3GNJ A;  2GVP A;  5HFI A;  2FLS A;  5JWO B;  3GKK A;  4YH2 A;  3ERG A;  2EFE A;  3VI5 A;  2BMX A;  1TU7 A;  3N5O A;  5AN1 A;  4EDY A;  5ECP B;  3FZA A;  4TRX A;  4IS0 A;  2VO4 A;  2C8U A;  3F6F A;  3QCP A;  2FCH A;  5H5Q A;  1ML6 A;  3TRP A;  1SVM A;  3KH9 A;  3IHG A;  4K5S A;  4XRA A;  3RHB A;  4BPY A;  2C0G A;  1QQ2 A;  2FA8 A;  2OE3 A;  2A2S A;  2WS2 A;  3F3Q A;  1ZL9 A;  3J7Y k;  1O81 A;  4MCU A;  1XPV A;  3PPU A;  2VD1 A;  3ZIJ A;  1AUC A;  20GS A;  1S3D A;  3GST A;  4G01 A;  3EVI A;  2H75 A;  2X4A A;  4QL7 A;  3GUS A;  1OC9 B;  4BVX B;  2MMZ A;  4XS1 A;  5DAL A;  3VWX A;  1XOA A;  4MAB A;  5IPG A;  1GH2 A;  4LL4 B;  2DML A;  2CT6 A;  5CRG A;  2DJ3 A;  4WF5 A;  3UL3 A;  4ECB A;  2AUV A;  5KN1 A;  3FR6 A;  3DRN A;  3VK9 A;  3M9J A;  1MEK A;  4HOJ A;  4ZBA A;  1FHE A;  1EEM A;  5KEJ A;  3DML A;  4RI6 A;  4ISD A;  3D4T A;  1C72 A;  3EWL A;  3QOU A;  2AYT A;  3UBK A;  2L5O A;  1GUH A;  2B7J A;  4NXI A;  1GL8 A;  2MMO A;  5D9V A;  1T4Z A;  2JZR A;  4WBJ A;  3DVX A;  1XVQ A;  4IW9 A;  2HRK A;  1SK2 A;  1GSU A;  3G7Y A;  1F3A A;  3GH6 A;  4FYC A;  4HEA 2;  3MAK A;  3HZ4 A;  4MP4 A;  2WUL A;  4KGI A;  2N5F A;  5G31 A;  3GX0 A;  4AKH A;  2PVQ A;  2XPD A;  22GS A;  3CSJ A;  4Q5N A;  4QL9 A;  1NHO A;  4GWR A;  1RW1 A;  3LYP A;  3J7Y b;  3HKR A;  5AIX A;  2IN3 A;  3TJG A;  4Q5Q A;  4KH7 A;  5DAK B;  1TK0 B;  1Z6M A;  1GSD A;  1DBY A;  5KOW A;  4YAV A;  2K9F A;  2HQT A;  3VWV A;  4KB3 A;  2C0D A;  2IMI A;  3PIN A;  12GS A;  2DKI A;  5EVO A;  3F6D A;  4ZXG A;  1BYE A;  1Q98 A;  2LRC A;  3QPM A;  1Z7R A;  5ID2 A;  2LRT A;  3KMO A;  3GUR A;  5CRE A;  4TOP A;  2N5B A;  3CYN A;  2YV7 A;  1G6W A;  4JRR A;  2M72 A;  3ZMK A;  2FA4 A;  2LQQ A;  1GSF A;  4MPF A;  2B6M A;  5HR0 A;  3LXZ A;  5ECR B;  2GQL A;  2OE1 A;  4GCI A;  2YN1 A;  3M1G A;  1XW5 A;  1EGO A;  2R2J A;  2JZT A;  4MNN A;  2X99 A;  2CX3 A;  5KN0 A;  5DJL A;  3FR9 A;  3TKS C;  18GS A;  4G19 A;  4K6X A;  4F03 A;  4HJ2 A;  3TUE A;  2CVK A;  2I3Y A;  2VCZ A;  1KNG A;  2LKU A;  3HA9 A;  5G30 A;  4MK3 A;  4LLR A;  4NV5 A;  2RII A;  4BVY B;  3QD9 A;  4Z2T A;  1YY7 A;  10GS A;  4DSQ A;  2WCI A;  2V41 A;  1SYR A;  1ZYQ B;  2H30 A;  1HNA A;  4G2E A;  1GUK A;  5D9W A;  4KA0 A;  2AB6 A;  3US3 A;  2IMK A;  4NHW A;  1QGV A;  2VLT A;  1HD2 A;  3A2X A;  4POM A;  2JU5 A;  3ZVJ D;  1E6B A;  2C3N A;  1UC7 A;  1PD2 1;  14GS A;  1HYU A;  2H71 A;  1A2M A;  3W8J A;  1DSB A;  3PGT A;  3GA4 A;  2EIO A;  1M7T A;  4PNG A;  3F4T A;  1BAY A;  3L78 A;  5J4U A;  1GSE A;  2OT3 A;  3GTU B;  1Z3E A;  2YJ7 A;  1OKT A;  4RQR A;  1X5C A;  1AXD A;  1WJK A;  3LOR A;  3ZL5 A;  2PBJ A;  1ZCP A;  1SK0 A;  4EL1 A;  4MZC A;  1GNE A;  3HCZ A;  4IP6 A;  19GS A;  5D93 A;  1YZX A;  1V2A A;  5FWG A;  2HSY A;  2X8C A;  4X43 A;  5ENU A;  1I9D A;  1XW6 A;  2LRN A;  4IQA A;  2MYG A;  4AJ7 A;  1TOF A;  3ZVJ A;  2PPT A;  5IO0 A;  2HZE A;  5H5R A;  4TW5 A;  3IRA A;  1OC8 A;  5IMD A;  1N2A A;  1XIY A;  2X49 A;  3ZYW A;  4EO3 A;  4GRF A;  1GRX A;  4NAX A;  1F2E A;  3RPN A;  1PSQ A;  4ICY A;  4KW6 A;  1WPI A;  4EC0 A;  2JZS A;  4BWQ A;  2XC2 A;  1HNB A;  5G5F A;  2L6D A;  2HT9 A;  4K0N A;  5IIZ A;  3C1S A;  3TCO A;  4CY6 A;  3CSH A;  2E0Q A;  1W4V A;  5J41 A;  4IJI A;  3GSS A;  3DWV A;  2YCD A;  1GNW A;  1MD4 A;  4D73 A;  2ZUP A;  4CY8 A;  5H5S A;  1CQG A;  5A4W A;  4DVC A;  4KSM A;  2LJA A;  2VL2 C;  3D6I A;  2CX4 A;  3NIV A;  2BJX A;  4NMU A;  1XWB A;  2H73 A;  5EY6 A;  5D8I A;  4GQC A;  1JLV A;  1BG1 A;  1SKS B;  2OKA A;  2HXK A;  2IMD A;  2AAW A;  1K0C A;  2YV9 A;  3VLN A;  4IJ3 A;  4CW9 A;  1R5P A;  4TR1 B;  3IBH A;  2KHP A;  1N25 A;  4XS4 B;  2KUC A;  3HVX A;  2QKE A;  1R4W A;  2GSR A;  6GSX A;  2C0E A;  2GQM A;  3WYW A;  2IMF A;  1S3A A;  2WB9 A;  2VD0 A;  2O85 A;  5ECN B;  4WF4 A;  3EIN A;  3KIJ A;  2VKZ G;  2J9H A;  5CRD A;  4KDX A;  3TRQ A;  2EIR A;  3FYG A;  2DLX A;  4MH2 A;  3ZLP A;  4BL7 A;  3TJF A;  3LYK A;  2RUE A;  1SVO A;  5CP1 A;  1TXX A;  3IXR A;  3QDN A;  2PUK C;  2IFQ B;  1K0D A;  2YPM A;  1YQ1 A;  3TKP A;  3LSZ A;  2O7K A;  4JR4 A;  4TXO A;  2HZF A;  2FWE A;  4JED A;  3CTF A;  2QA1 A;  1JHB A;  2PMT A;  4ECJ A;  2GS3 A;  2JSY A;  3H8Q A;  3HY2 A;  4N3Z A;  1TRW A;  2ALB A;  2TIR A;  7GSS A;  2FGX A;  1V98 A;  1K3O A;  3DXB A;  2CA8 A;  5B7C A;  2H1G A;  3NOF A;  2VUP A;  5GSS A;  3KEB A;  1GTA A;  2C0F A;  1XFL A;  1IYH A;  4FQU A;  4N11 A;  2H6Z A;  3LWA A;  4O5U A;  2IWT A;  3MYD A;  5GZZ B;  4IHU A;  2VL9 A;  3HDC A;  2PN8 A;  4K1F A;  2AHE A;  5A5H A;  1SD9 A;  2D2Z A;  3DEX A;  5BMU A;  2MMN A;  1F3B A;  2OA7 A;  3GL3 A;  2NBS A;  3SBC A;  3QAG A;  4AJ8 A;  1BJX A;  2PER A;  1JZD A;  2H0H A;  2YOI A;  5B6N A;  9GSS A;  2WDU A;  2K18 A;  3M0F A;  2R0C A;  3CMI A;  5C00 A;  3BCK A;  4FYB A;  1B8X A;  4ECI A;  3L9U A;  3M9K A;  2B3S A;  2GLR A;  3GKX A;  1K3L A;  1O7U A;  3IK9 A;  1VF1 A;  4ZB8 A;  4MLY A;  2CVD A;  1F9M A;  1LU4 A;  1M2D A;  4J2F A;  3HZ8 A;  2IME A;  6GSU A;  5HR3 A;  2ON7 A;  4JZQ A;  3I43 A;  1ILO A;  3ERF A;  3VI7 A;  1AQV A;  4MF5 A;  4J56 E;  1R26 A;  3MIX A;  4YQV A;  1FVK A;  5G1K A;  4BWS A;  3GIX A;  3H93 A;  1YVL A;  3ZFB A;  4NHZ A;  5EL8 A;  4ZBB A;  3IA1 A;  3QAV A;  4AI6 A;  4G9H A;  3C7M A;  2L4Q A;  2C3T A;  3KP9 A;  4HZ2 A;  1SK1 A;  1PN9 A;  4F0B A;  1YKC A;  1SU9 A;  3V1W A;  1Y25 A;  1HNC A;  5LNK e;  1ZZY A;  4OO4 A;  1B48 A;  1GSQ A;  2TRC P;  3Q19 A;  1BED A;  4I8B A;  5ECK B;  2VL2 A;  2JL4 A;  2KOK A;  2H6Y A;  5HFK A;  2DIZ A;  5J9C A;  4PUR A;  2H1B A;  2LEG A;  4ID0 A;  4PXO A;  5DAL B;  2ZNM A;  1XWA A;  5A1N B;  5E59 A;  2CAI A;  2N5A A;  1U3A A;  1DE2 A;  1GLQ A;  2B5E A;  5ABR A;  4GSS A;  1SL0 B;  4GQF A;  1ERT A;  3GH9 A;  1K0M A;  3BOA A;  3H4K A;  4KDU A;  2E7P A;  3U6V A;  1KBN A;  2WZ9 A;  3FY7 A;  3KD0 A;  3KP8 A;  4TXV A;  2H1D A;  4AJ6 A;  1SEN A;  1T8E B;  3TB2 A;  4G0L A;  1X9M B;  1EV4 A;  4ML6 A;  2HLS A;  2IJY A;  4L5L A;  4JE1 A;  4IVF A;  4Z7X A;  1ERV A;  1VF3 A;  2HRK B;  2LS5 A;  4ML1 A;  1GLP A;  3EC3 A;  2WFC A;  3VWW A;  3TGZ A;  2YWI A;  1M2B A;  2WJU A;  3RBT A;  4KCA A;  1GTU A;  2DKH A;  3KTL A;  3KXO A;  4KE3 A;  1R5A A;  2VCQ A;  4PUA A;  4MJE A;  1U88 A;  3FR3 A;  2H0G A;  2C80 A;  3IK7 A;  2K8S A;  4RQX A;  2QGV A;  16GS A;  3W8S A;  1M2A A;  2P0G A;  3A2W A;  4GST A;  4HQS A;  2G2Q A;  1KTE A;  1K0N A;  4E8E A;  3MSZ A;  2UZ8 A;  2GTU A;  3IHQ A;  5ECH B;  2M46 A;  3O6T A;  3LW9 A;  3ZIT A;  2A2R A;  3FRC A;  5B8A A;  1YDK A;  1SL1 B;  3FZ4 A;  4EIQ A;  5ID2 B;  1QXH A;  3CBU A;  1TRU A;  1OVN A;  4H86 A;  1TI1 A;  3GV1 A;  1NW2 A;  4Q5R A;  4HZ4 A;  2CAQ A;  3Q74 A;  1V57 A;  4MJC A;  2CZ3 A;  1FOH A;  1XCC A;  1J9B A;  2XBQ A;  2CQ9 A;  3M3M A;  5AGY A;  5DQS A;  2V6K A;  3VPT A;  4I5Q A;  3P7X A;  3KTB A;  4HU9 A;  1PX7 A;  2XHF A;  4TVE A;  3HHV A;  3HD5 A;  4TKY A;  5D73 A;  4XRD A;  2R4V A;  6GSV A;  4KF9 A;  5A4U A;  1USB A;  4KND A;  2L4C A;  1TKD B;  2H72 A;  3VPQ A;  2E2G A;  2KP2 A;  3WT2 A;  2R3X A;  1TTZ A;  2O8V B;  4ZL8 A;  1YEX A;  5IMA A;  1UA5 A;  2F8A A;  2O87 A;  5DQY A;  1SL2 B;  1T00 A;  4AF2 A;  3EMP A;  5IMF A;  1BF5 A;  2QSI A;  1SKW B;  3IAS 2;  1U6T A;  5ECL B;  4ECC A;  3F0I A;  1M9A A;  1BX9 A;  1XZO A;  1EV9 A;  1FB0 A;  1AQW A;  2B7K A;  3TRX A;  4V1A p;  2VOC A;  2H01 A;  2I81 A;  1Z6N A;  1A23 A;  5F0G A;  4HUA A;  2MBS A;  1NSW A;  3I6A A;  1OC3 A;  4OCF A;  3HVS A;  5DVB A;  5CRH A;  1RK4 A;  4P3Y B;  4POB A;  1H75 A;  5F07 A;  4PTS A;  4F9Z A;  2B5X A;  2LJR A;  2OAD A;  5DDL A;  2EFD A;  1ACV A;  1J08 A;  2HZE B;  1EP7 A;  1TDI A;  1YF1 A;  4L0U A;  3D0Z A;  1TK5 B;  3CRU A;  4LA1 A;  4TN8 A;  3GKM A;  2DJ1 A;  3F4R A;  1PRX A;  1WMJ A;  1X0R A;  5JCW A;  3IC8 A;  3GRX A;  3HJP A;  4ZIJ A;  4IP1 A;  4IQ1 A;  1EZK A;  1MDI A;  2K8V A;  5AIS A;  1T4Y A;  3ZTL A;  3ERW A;  1ZOF A;  3EPT A;  4KAE A;  2OBI A;  4YQM A;  4EUY A;  1GUM A;  4K2D A;  4D73 B;  1ZYP A;  3G7J A;  4YQU A;  4FYU A;  1MDK A;  2VCW A;  2AV4 A;  4N10 A;  2R5G A;  1K3Y A;  4N0V A;  4ZB9 A;  1S3C A;  3L9S A;  3TJK A;  1QK8 A;  4XIH A;  2KP1 A;  2MMA A;  4V2L A;  3F8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...