3EE2A

Structure of human prostaglandin d-synthase (hgsts1-1) in complex with nocodazole
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAIANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glutathione-requiring prostaglandin D synthase
publication title Identification and characterisation of new inhibitors for the human hematopoietic prostaglandin D(2) synthase
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ee2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ee2A01
1OYJA 1SENA 5ECMB 2VO4A 2F8AA 1PGTA 2UZ8A 4IGJA 4K0NA 2YNXA 3TCOA 5EVOA 4FH8A 1SK2A 1ZOFA 5JCWA 2LJAA 1O85A 2BJXA 3EINA 3UJ1A 2C8UA 9GSSA 1S3DA 1YKCA 5HR3A 4ECCA 4TVEA 5KN1A 3RAZA 1E2YA 3IAS2 4MP4A 1TI1A 4G10A 3UVHA 4PNFA 3I69A 2PWJA 1W89A 3GL3A 4KH7A 4PTSA 5FT3A 3NZNA 4PX1A 5B7CA 3E0UA 2V6OA 4V1Ap 1MTCA 3CSHA 4O32A 1R5AA 1THXA 4XS1A 2I4AA 4KF9A 4I6XA 1M99A 3HJMA 1W4VA 4EUYA 3BCKA 3ZFLA 3GMFA 3D6IA 1AW9A 4K7NA 2H19A 4AJ6A 3IHQA 2WCIA 4XRDA 4OFMA 2C3NA 3GKXA 3QFBC 1TRVA 1KBNA 4DSQA 1SJZA 1K0OA 4ECIA 3C1SA 3IRAA 2L6CA 4KDXA 1A2LA 3ZREA 1WJKA 1AQVA 4GSNA 4X43A 3DEXA 3IK7A 1TP9A 2M80A 3FZ5A 3O6TA 1BG5A 4XS6A 3CSIA 1Z6MA 3H1NA 1K0NA 3NIVA 2KHPA 4TOPA 3MNGA 3WGXA 4P3YB 5D93A 3KM6A 2L5OA 4OWYA 3DKSA 1EZKA 3HZ4A 3PPUA 5C04A 3QAVA 2LRTA 3CRTA 2H30A 2VL3A 1OC9A 4JR6A 5F07A 1TW9A 1UVZA 1Z9HA 3ISOA 3Q18A 4IJ3A 2V32A 4WETA 5J41A 2HSMB 2RUEA 3A2XA 2DSAA 3TDGA 2PMTA 2V6KA 3EE2A 1DBYA 1G6WA 4QL9A 4FIWA 2HQTA 3IK9A 1A8LA 5G1LA 4OO4A 3L0HA 4F9ZA 4PGTA 3F9UA 2YWIA 4XS4B 4OFNA 4TW5A 3P90A 2JU5A 4K7IA 4ULXA 2M46A 2VCQA 4HI7A 3CYNA 3E3EA 2H72A 4HS1A 4KSMA 1GTIA 3SWLA 2VUPA 5J9CA 1XW9A 1T7PB 3CTFA 4ZXGA 4AJ8A 3N5OA 3QR6A 4WR4A 3KCMA 3H8QA 4NMUA 3ZL5A 4PXOA 2FLSA 4V2NA 5ELGA 3GRXA 2FWFA 3HY2A 2B7KA 1GULA 1ZYQB 3LXZA 2GQLA 2MMZA 4MPGA 1F3BA 4G19A 5G5EA 2H1BA 1YEPA 5IIZA 1A24A 1O8XA 2DIZA 3MSZA 3VWUA 2R4VA 3KP8A 2VLVA 1YQ1A 1CQGA 2MMNA 3FR3A 1RQMA 3GFKA 1A8YA 1KEBA 1O8WA 1RW1A 3G7JA 2ALBA 5IOXA 4XRAA 1PKWA 3WD6A 2FWEA 1HNBA 4L5LA 3ZZXA 1EGOA 3TKPA 5IO2A 2JZRA 2P5QA 4ZBDA 1O7UA 1LBKA 3E9JB 2DJ1A 3HYPA 3WGDA 2HSNB 3EURA 4PQ1A 4NXIA 1AUCA 1K0CA 4BVXA 2L4CA 3F0IA 3DXBA 2IMIA 1FW1A 4FQUA 3DVXA 1TRSA 4KE3A 3WGEA 2WDUA 2FNOA 3TJKA 2X8HA 1PN9A 2H66A 1TK5B 1GWCA 5HQPA 4MPFA 1T3BA 1U88A 5J9BA 1GTAA 4BWSA 3FYGA 2C4JA 1X5EA 2YWNA 5BMUA 1WP0A 3P8WA 2XHFA 4FO5A 5IPHA 5JWOB 5CRWA 2GZZA 3J7Yk 4MK3A 1ON4A 3EYTA 1X9SB 3LORA 4ZBBA 3QCPA 3PGTA 2AJQB 2K8VA 1GSQA 2MMAA 3ZYWA 1TK8B 2RUFA 2TIRA 2GZPA 2K18A 3UEMA 2VCZA 1I9DA 1XIYA 3APOA 4PUFC 4IP1A 4DSRA 1B4QA 3FZ4A 2N5FA 1GSYA 1XWGA 2GTUA 2J9HA 5L71A 1FO5A 5CO3A 1NHOA 2R37A 3C73A 2VD0A 2FY6A 2VM1A 1EV4A 4NV5A 4YH2A 1YEXA 3LYPA 2LS5A 5DJLA 2FCHA 1ERVA 2X99A 3ZRDA 4BPYA 1Y6EA 3EWLA 1B4PA 1SK0A 3VLNA 3GTUA 3ME7A 1JHBA 3M9KA 1VRSD 2O8VB 3VPTA 1G6YA 1T1VA 4JE1A 1FOVA 3HVSA 1JLVA 5ABRA 2FGXA 1EEMA 3FW2A 3ERFA 3TKSA 1IYHA 4WR5A 4L5OA 4J57E 5DAKA 3IV4A 5IOWA 4EO3A 4ZB9A 2PPTA 4KX4A 1BQ7A 3DRNA 3IPZA 7GSSA 3F3QA 3IXRA 2H76A 2C1YA 2KP1A 4F03A 2H1GA 5GAND 3EMPA 3GV1A 2REMA 1N8JA 4MLYA 2CAIA 2A2RA 3KMOA 3J7Yb 4G0KA 2TRCP 1UC7A 2H6YA 3KIJA 2QSIA 1YF1A 1VGLA 3C1RA 3FY7A 3GX0A 2YWMA 3R2QA 5GSTA 4IP6A 2YJ7A 1YY7A 3ZTLA 2H1AA 1YDKA 1GLQA 2L5LA 1FB0A 2TRXA 2VM2A 1A23A 1HYUA 1ZGNA 1SD9A 2LNTA 1O73A 2OE1A 4BVXB 2EIQA 1PL2A 3U5RE 4MJBA 1ABAA 1LU4A 4EKZA 1F9MA 3ZMLA 4LL4B 1M2BA 3FK8A 3GYKA 1X0RA 2FA8A 1ERWA 3WT2A 4KB3A 2HRFA 1K0MA 3ZVJD 1J08A 2XPDA 4JZQA 4XS4A 4MMMA 1JZRA 4N0ZA 2OA7A 1XWBA 2LEGA 1T8EB 3LXTA 3L4NA 5JCUA 3CTGA 1U6TA 1OKTA 2DJ2A 3NOFA 2CQ9A 4IHUA 1TU8A 1ZYEA 3UAPA 1THOA 3ZITA 1Q4JA 3VI7A 2QKEA 1TOFA 2WULA 3VWXA 4Q5QA 2VCVA 3FHKA 1DSBA 3IA1A 5HFIA 3CBUA 1TRUA 5CRDA 2B6MA 5IMFA 3JCML 2FA4A 1EP8A 4H86A 1FVJA 3GSTA 4D73B 2NVLA 1QUWA 4KAEA 3KEBA 3C7MA 2CVDA 4ECBA 5DCGA 3HHVA 4F0CA 3PH9A 3ERWA 4ML1A 3IC8A 3G7YA 2IMDA 5AISA 2H0HA 2YANA 18GSA 3TOUA 4WF4A 4LLRA 3TJFA 2LRNA 4JRRA 2GS3A 1WRYA 3I9V2 4AJ7A 2J23A 3DD3A 5D73A 1FVKA 2N5BA 5ECHB 2DMLA 2H8LA 1VF3A 2CX3A 1AQWA 2I9HA 2DJJA 4YQVA 1PX7A 5EY6A 2NDOA 3FZAA 3F4SA 3GKNA 4BA7A 2P5RA 4EE0A 1GUHA 3IR4A 3GTUB 2X8CA 3GNJA 1XOBA 4NPBA 5ELAA 1ZL9A 4NAXA 4QQ7A 6GSSA 3GX8A 3C8EA 2AAWA 3N9JA 3V1WA 4DSSB 1R4WA 2HRAA 3TKSC 1BX9A 4I97A 3IOSA 4ZILA 4HUAA 3VWVA 5ECPB 4OMVA 2V1MA 1VF4A 2E2MA 1A0FA 4KUNA 11GSA 4NHWA 3KP9A 4TRXA 5DAKB 2M72A 3LEFA 5HFGA 5IPGA 2VLUA 1WIKA 3Q6OA 1V98A 2FWHA 1Z3EA 2R5GA 4YQMA 5CNWA 4GWRA 1URMA 2BTOT 5CREA 4HOJA 2MMOA 1SJ6A 4TXOA 2P31A 1A2MA 1ZMAA 3MAKA 5D96A 1QQ2A 1WPIA 4KDYA 4TR0A 3GSSA 4Z7XA 3H93A 1R7HA 2L6DA 2OACA 5FWGA 2WZ9A 19GSA 4LA1A 4CHSA 3ME8A 1SU9A 1A0RP 4EF0A 5DQSA 2YOIA 3O76A 2FWGA 2V41A 4KA0A 1JZOA 5G30A 1SD8A 4N30A 3W8SA 2CX4A 1PSQA 2F3MA 2MYGA 2VCTA 2H0GA 3A5WA 1MD4A 1EOHA 4MZWA 2OKAA 5IMZA 2DC5A 4POLA 4X1UA 4RQXA 5EL8A 4K1FA 2LJRA 4OCFA 4MF7A 5INYA 5IQYA 3UBKA 4WBJA 1F2EA 2YN1A 4LL1B 1XVQA 5LD0A 1MDIA 1V58A 4NV2A 3LQ7A 16GSA 1QXHA 5G2ZA 1GLPA 1PKZA 2CVBA 2O85A 2R2JA 4J56E 1PQNA 4I2UA 1XVWA 5ECSA 5D9XA 1B9XC 1O6JA 4HEA2 4K8MA 3G7IA 2HSHA 3VK9A 4IQAA 4MF6A 5G31A 1AQXA 3TGZA 4K7OA 3KMNA 2GT6A 2GQKA 4FYCA 4MZCA 1M9AA 3KGKA 3VPQA 5JWQB 3IDVA 3D5JA 3GKKA 2G2QA 2WFCA 2KP2A 4MJCA 5C00A 3GH6A 3LJRA 5F0GA 1WOUA 1KNGA 4JU5A 4MJEA 3DMLA 4X0XA 3PR8A 4WBRD 5E4WA 3Q74A 4PUAA 1V2AA 5ECNB 2CZ3A 3KH7A 1TJDA 5FHIA 2A4VA 4IN0A 2CA8A 1SL1B 5GAPD 1S3AA 3VWWA 1DUGA 2XC2A 1FB6A 3HA9A 3CSJA 2BMXA 4MF5A 2GSTA 3HD5A 1XZOA 1M2DA 22GSA 2JADA 4Q5RA 3LYKA 3FZ9A 1V40A 4E8EA 3C71A 5ECRB 5HFKA 1H4OA 4GLTA 5GSSA 4IW9A 1XOAA 2PERA 3FR9A 1TK0B 4L8EA 2R3XA 4V2MA 1ST9A 5A5KA 2YCDA 4MH2A 1V9WA 3EC3A 4HZ4A 5ECLB 1SKWB 2JZTA 3QPMA 4TXOB 5IMAA 4O7HA 2YZHA 1HQOA 1TI3A 2GSRA 2GDRA 4XIHA 2O87A 1T4YA 2PUKC 1XWAA 3ED3A 4D73A 2IJYA 1DE1A 6GSTA 3F4TA 4JR4A 3AY8A 2GT5A 3M1GA 1OVNA 4POKA 4EDYA 1ML6A 1SYXA 2CVKA 1K3LA 3TKSE 2LRCA 1KTEA 4G9HA 2NPBA 2HFDA 2NTOA 2KUCA 3ZIJA 3EMXA 2B1LA 3DWVA 4GF0A 2C3QA 3UOMA 6GSXA 3CXGA 1UA5A 2VOCA 1IYIA 4HU7A 4GQCA 2GGTA 2XBQA 2VCXA 1AIUA 2V2GA 2YZUA 2H0IA 3HCZA 2WGRA 3A2WA 4IELA 1B48A 1M2AA 2VLTA 1S3CA 3HDCA 1SK1A 4DEJA 2VL2A 4JBBA 2F51A 4DSSA 3TB2A 2AHEA 1Z7RA 2LUSA 2HZFA 2VD1A 1GUMA 5AN1A 2PVOC 3D0ZA 4GTUA 2PN8A 3US3A 4ACSA 4O92A 1JZDA 5CRGA 3HVXA 4TR1A 4BL7B 5J3RA 1T00A 4I2TA 2OADA 3TUEA 5HR2A 1O81A 4KNDA 4K6XA 4GQFA 1J9BA 1GTBA 3L9UA 3BOAA 1BJXA 2O7KA 5GZZB 2YPMA 2HE3A 1YF0A 2JACA 4L0UA 1OE7A 1SL0B 3OR5A 3HJOA 3QMXA 5AGYA 2IWTA 2C80A 2HYXA 4MABA 3RHBA 2RM6A 4L0WA 4XTSA 2IN3A 3G9BA 2E2GA 1XBSA 1GUKA 4E8HA 4POMA 4IBPA 2I81A 3GHAA 5JCGA 3BJ5A 3F6FA 3GKMA 5CYYA 4Q5NA 4F82A 1JZWA 5B8AA 4GSSA 4PQHA 3HVVA 2E7PA 1BYEA 2RM5A 1TDIA 2C0DA 4MH3A 3GH9A 2JSZA 1USBA 5CAXA 5AIXA 5EPFA 3FR6A 5DJMA 6GSWA 3F8UA 1GRXA 1YKAA 3A3TA 4MCUA 1K0DA 1EOGA 2FUG2 2JL4A 3UMAA 4POBA 2HRKB 1YJ6A 1SKRB 4OO5A 1Y25A 3TRPA 1TRWA 3H79A 1PA3A 4ZB8A 1EV9A 4KGIA 4TN8A 2VL9A 4HQZA 2NBSA 4OCEA 2GLRA 1PRXA 3M8NA 2XPEA 4PURA 4FYUA 5DDLA 3GURA 4WEYA 3Q19A 3M9JA 1GSEA 5AIVA 2AUVA 4O5RA 5A4UA 2IMFA 1M9BA 5CRHA 2K9FA 4N11A 2HSYA 2GSQA 4EXJA 4GCIA 4NHZA 4GSTA 5CP1A 3HJPA 3VI5A 4K0GA 1ZZYA 2B5YA 4WF5A 4MZBA 2HZEA 3UARA 1Z6NA 1F6MC 3EU4A 4KCEA 6GSYA 4G0LA 1PX6A 1RK4A 2JZSA 5KN2A 1AC1A 3I6AA 17GSA 2C0GA 3L9VA 1Q98A 2VIMA 2O89A 2OBKA 3D4TA 3QD9A 3UL3A 2VL2C 13GSA 20GSA 1YZXA 1HNAA 4GRFA 3EU3A 1GL8A 2IPAA 2F8FA 4XCSA 4BVYA 2FHEA 2VAFA 1SJIA 1X9MB 10GSA 2DJ0A 4JEDA 5DALA 5HR1A 1GSFA 5F06A 3RBTA 2CT6A 3M3MA 3TKQA 4TR1B 2H71A 1F37A 1EGRA 1NSWA 4KSOA 1Z7PA 2IMKA 3GL5A 2ZUPA 2B3SA 2YJHA 2EIRA 2D2ZA 5IO0A 2DBCA 3WT1A 4MA9A 2QGVA 2H6XA 3QAWA 3EVIA 2PBJA 2PU9C 2C0EA 5J4UA 4I8BA 4ZBAA 2P0GA 1BAYA 5DVBA 3RPPA 3TRXA 4RI7A 4IS0A 4EL1A 2OBIA 4KW6A 1GNWA 3F3RA 2WRTA 4IVFA 1U3IA 5B6NA 4ZL9A 5KN0A 4HU9A 1TTZA 3H4KA 5IMDA 2EC4A 5ECIB 2HXKA 1XWCA 3S9FA 3W6GA 1GSUA 3F63A 1G7OA 4TXVA 1FG4A 2DIYA 5ID2B 12GSA 3P7XA 4TKYA 1FHEA 1TXXA 5LNKe 1JFUA 3DYRA 5IMCA 4RQRA 2LKUA 4V2LA 2H75A 3W8JA 3KTLA 4NWYA 1XW5A 2DJ3A 4QL7A 1MDKA 3RDWA 3QOUA 3I43A 4YQUA 5LCZA 2X8GA 2WS2A 2B5XA 1R26A 4IKHA 3DGQA 3ZFBA 5A4VA 1UN2A 4BL7A 5F8BA 4BWQA 3GA4A 4TR3A 2H01A 2KOKA 4KDUA 4HQSA 1NM3A 4YAPA 2VCWA 2R6KA 1SKSB 2MBSA 4Q5FA 3IE3A 2HT9A 1AXDA 4IJIA 1ERUA 2IFQA 6GSUA 1EEJA 2LNSA 2KLXA 3LG6A 3QFAC 1WE0A 1QMVA 2QC7A 1GSSA 1E6BA 2LV3A 5DBQA 2HZEB 1DE2A 1K3YA 2OE0A 3LWAA 2OE3A 3D22A 2GVPA 2YV7A 3GIXA 5G5FA 3APQA 1ACVA 1ERTA 3D21A 2L57A 2H6ZA 5D9TA 4F0BA 2JSYA 1OE8A 2A2SA 4RUVA 2GQMA 2B5EA 2HLSA 1X5DA 3TJBA 8GSSA 4BVYB 3KD0A 4ZL7A 2I3YA 1OC8A 4DVCA 3VFIA 5DALB 2K8SA 1SL2B 1WWJA 3A2VA 3UBLA 3ZVJA 5IM9A 3UIWA 4KCAA 3ZLPA 2GZYA 2HRKA 1A2JA 2ES7A 14GSA 2LSTA 1B9YC 3IAM2 1TKDB 3K8NA 1X5CA 2GSSA 3TOTA 4MJAA 3F4RA 1OKDA 4G0IA 3FKFA 2B1KA 1H75A 1R5PA 3KXOA 3BBYA 1M0UA 3TJJA 1GNEA 2B7JA 3LGCA 5B6MA 2XBIA 5DCHA 5HR0A 1G0TA 4PQIA 2ON7A 1F3AA 5COHA 3HKRA 2DMMA 2E0QA 2HRNA 4I5QA 4AF2A 3ZIVA 2C3TA 3UVTA 1EWXA 5IMVA 1XXUA 4ISDA 3HZ8A 2CZ2A 4ZB6A 3D4MA 2H1DA 2N5AA 1GH2A 4CW9A 4GXZA 2CAQA 4OD7A 1U3AA 1T4ZA 1MDJA 5D9WA 5J5NA 5H5SA 2AYTA 2LQQA 2DJKA 1VF2A 1XFLA 1OC9B 1BEDA 1B8XA 3QDNA 2WJUA 1WMJA 3DIEA 2MBTA 3GN3A 1G7EA 2ZNMA 4EC0A 2ZCTA 5H5QA 3KH9A 3KZQA 3CRUA 2IIYA 1AAZA 1TU7A 1MD3A 5ECKB 2X64A 3BD2A 4ZIJA 4ML6A 2FD3A 5E59A 4ID0A 1K3OA 4EDZA 3R3EA 4OFTA 2L4QA 1PMTA 1C72A 1QFNA 1N2AA 1NHYA 3GUSA 2L59A 3LFLA 2HI7A 3MWHA 2C0FA 5D9VA 6GSVA 3L9SA 4XHMA 5H5RA 4ILFA 3RHCA 1U87A 2PVQA 3TRQA 4PNGA 4J2FA 2EIOA 3O3TA 4HJ2A 2K6VA 3RPNA 4TR4A 5DQYA 1HNCA 1HD2A 1Z5YE 3FRCA 2IFQB 2YWOA 1ILOA 3IC4A 3LSZA 1XWKA 3KTBA 4USSA 4K9ZA 2YV9A 4ECJA 3KJYA 2Z9SA 4CDOA 3TKRA 4WKWA 3SBCA 5JWRB 2IL3A 3F6DA 4FYBA 4RI6A 1QGVA 1FAAA 1QK8A 2LQOA 3FEUA 4MDCA 5KEJA 5B8BA 5ECQB 3IBHA 4V1Ag 1GSDA 1OC3A 5ID2A 1VF1A 4AGSA 2G0FA 4EVMA 4LMWA 1LJRA 5ENUA 5ECOB 5A4WA 2HSMA 3DVWA 4LMVA 3VURA 2RIIA 1M7TA 1GTUA 3QAGA 2OJLA 4YAVA 3MDKA 5F05A 1J0FA 3TJGA 1K0BA 4HZ2A 4F2IA 5KN3A 1ZCPA 4HDEA 1OAZA 1EP7A 3U6VA 2RLIA 2DLXA 3P2AA 4G2EA 1NW2A 1K0AA 4N0VA 2WB9A 2IMEA 3HXSA 3PINA 2CV4A 1XW6A 5D8IA 2AB6A 2AV4A 4HJMA 1PL1A 2ON5A 1JLWA 1XCCA 3WYWA 2MZCA 3CMIA 3M0FA 3APSA 2H73A 1SYRA 1X9WB 2H74A 2LJKA 3BCIA 1CQHA 2LTKA 5G1KA 4IQ1A 4K2DA 2HNLA 4WXTA 1V57A 2F9SA 1XPVA 2I1UA 1GP1A 2YP6A 2H70A 3ZMKA 4N10A 3L78A 1MEKA 2PGTA 1PD21 3ERGA 1I5GA 4ZL8A
chains in the Genus database with same CATH superfamily
1OYJA 1SENA 5BRTA 5ECMB 2VO4A 2F8AA 1PGTA 1BG1A 2UZ8A 4IGJA 4K0NA 2YNXA 3TCOA 5EVOA 4FH8A 2OT3A 1SK2A 4EIPA 1ZOFA 5JCWA 2LJAA 1O85A 1BF5A 2BJXA 3EINA 3UJ1A 2C8UA 9GSSA 1S3DA 1YKCA 5HR3A 4ECCA 4TVEA 5KN1A 3RAZA 1E2YA 3IAS2 4MP4A 1TI1A 2HSNA 4G10A 3UVHA 4PNFA 3I69A 2PWJA 1W89A 3GL3A 4KH7A 4PTSA 5FT3A 3NZNA 4PX1A 5B7CA 3E0UA 4K5SA 2V6OA 4V1Ap 1MTCA 3CSHA 4O32A 1R5AA 1THXA 4XS1A 2I4AA 4KF9A 4BIKA 4I6XA 1M99A 3HJMA 1W4VA 4MNNA 4EUYA 3BCKA 3ZFLA 3GMFA 3D6IA 1AW9A 4Z2UA 4K7NA 2H19A 4AJ6A 3IHQA 2WCIA 4XRDA 4OFMA 2C3NA 3GKXA 3QFBC 1TRVA 1KBNA 4DSQA 1PFOA 1SJZA 1K0OA 4ECIA 3C1SA 3IRAA 2L6CA 4KDXA 1A2LA 3ZREA 1WJKA 1AQVA 4GSNA 4X43A 3DEXA 3IK7A 1TP9A 2M80A 3FZ5A 3O6TA 1BG5A 4XS6A 3CSIA 3CHXC 1Z6MA 3H1NA 1K0NA 3NIVA 2KHPA 4TOPA 3MNGA 3WGXA 4P3YB 4A5PA 5D93A 3KM6A 2L5OA 4OWYA 3DKSA 1EZKA 3HZ4A 3PPUA 5C04A 3QAVA 2LRTA 3CRTA 2H30A 2VL3A 1OC9A 4JR6A 5F07A 1TW9A 1UVZA 1Z9HA 3ISOA 3Q18A 4IJ3A 2V32A 4WETA 5J41A 2HSMB 2RUEA 3A2XA 2DSAA 3TDGA 2PMTA 3EE2A 2V6KA 1DBYA 1G6WA 4QL9A 4FIWA 2HQTA 3IK9A 1A8LA 5G1LA 4OO4A 3L0HA 4F9ZA 4PGTA 3F9UA 2YWIA 4XS4B 4OFNA 4TW5A 3P90A 2JU5A 4K7IA 4ULXA 2M46A 2VCQA 4HI7A 3CYNA 3E3EA 2H72A 5A34A 4HS1A 4KSMA 1GTIA 3SWLA 2VUPA 5J9CA 1XW9A 1T7PB 3CTFA 4ZXGA 4AJ8A 3N5OA 3QR6A 4WR4A 3KCMA 3H8QA 4NMUA 3ZL5A 4PXOA 2FLSA 4V2NA 5ELGA 3GRXA 2FWFA 3HY2A 2B7KA 1GULA 1ZYQB 3LXZA 2GQLA 2MMZA 4MPGA 1F3BA 4G19A 5G5EA 2H1BA 1YEPA 5IIZA 1A24A 1O8XA 5J4YA 2DKHA 2DIZA 3MSZA 3VWUA 2R4VA 3KP8A 2VLVA 1YQ1A 1CQGA 2MMNA 3FR3A 1RQMA 3GFKA 1A8YA 1KEBA 1O8WA 1RW1A 3G7JA 2ALBA 5IOXA 4XRAA 1PKWA 3WD6A 2FWEA 1HNBA 4L5LA 3ZZXA 1EGOA 3TKPA 5IO2A 3CWGA 2JZRA 2P5QA 4ZBDA 1O7UA 1LBKA 3E9JB 2DJ1A 3HYPA 3WGDA 2HSNB 3EURA 4PQ1A 4NXIA 1AUCA 1K0CA 1YVLA 4BVXA 2L4CA 3F0IA 3DXBA 2IMIA 1FW1A 4FQUA 3DVXA 1TRSA 4KE3A 3WGEA 2WDUA 2FNOA 3TJKA 2X8HA 1PN9A 2H66A 1TK5B 1GWCA 2VKZG 5HQPA 4MPFA 1T3BA 1U88A 5J9BA 3A5IA 1GTAA 4BWSA 3FYGA 2C4JA 1X5EA 2YWNA 5BMUA 5J4VA 4QMKA 1WP0A 3P8WA 2XHFA 2WW2A 4FO5A 5IPHA 5JWOB 5CRWA 2GZZA 3J7Yk 4MK3A 1ON4A 3EYTA 1X9SB 3LORA 4ZBBA 3QCPA 3PGTA 2AJQB 4G01A 2K8VA 5A5HA 1GSQA 2MMAA 4ICYA 3ZYWA 1TK8B 2RUFA 2TIRA 2GZPA 2K18A 3UEMA 2VCZA 1I9DA 1XIYA 3APOA 4PUFC 4IP1A 4DSRA 1B4QA 5J47A 3FZ4A 2N5FA 1GSYA 1XWGA 2GTUA 2J9HA 5L71A 1FO5A 5CO3A 1NHOA 2R37A 3C73A 4ZB7A 4CY8A 2VD0A 2FY6A 2VM1A 1EV4A 4NV5A 4YH2A 1YEXA 3LYPA 2LS5A 5DJLA 2FCHA 4PI0C 1ERVA 2X99A 3ZRDA 4BPYA 1Y6EA 3EWLA 1B4PA 1ZYPA 1SK0A 3VLNA 3GTUA 5A34B 3ME7A 1JHBA 3M9KA 1VRSD 2O8VB 3VPTA 1G6YA 1T1VA 4JE1A 1FOVA 4O5UA 3HVSA 2O5VA 1JLVA 5ABRA 2FGXA 1EEMA 3FW2A 3ERFA 3TKSA 1IYHA 4WR5A 4L5OA 4J57E 5DAKA 3IV4A 5IOWA 4EO3A 4ZB9A 1XG8A 2PPTA 4KX4A 1BQ7A 3DRNA 3IPZA 7GSSA 3F3QA 3IXRA 2H76A 2C1YA 2KP1A 4F03A 2H1GA 5GAND 3EMPA 3GV1A 1I1IP 2REMA 1N8JA 4MLYA 2CAIA 2A2RA 3KMOA 3J7Yb 4G0KA 2TRCP 1UC7A 2H6YA 3KIJA 2QSIA 1YF1A 1VGLA 3C1RA 3FY7A 2QA1A 3GX0A 2YWMA 3R2QA 4AI6A 5GSTA 4IP6A 2YJ7A 1YY7A 3ZTLA 2H1AA 1YDKA 1GLQA 2L5LA 1FB0A 2TRXA 2VM2A 1A23A 1HYUA 1ZGNA 1SD9A 2LNTA 1O73A 2OE1A 4BVXB 2EIQA 1PL2A 3U5RE 4MJBA 1ABAA 1LU4A 4EKZA 1F9MA 3ZMLA 4LL4B 1M2BA 3FK8A 3GYKA 1X0RA 2FA8A 1ERWA 3WT2A 3MIXA 2HRFA 4KB3A 1K0MA 3ZVJD 1J08A 2XPDA 4JZQA 4XS4A 4MMMA 1JZRA 4N0ZA 2OA7A 1XWBA 2LEGA 1T8EB 3LXTA 5A1NB 3L4NA 5JCUA 3CTGA 1U6TA 1OKTA 2DJ2A 3NOFA 2CQ9A 4IHUA 1SVMA 1TU8A 1ZYEA 3UAPA 1THOA 3ZITA 1Q4JA 3VI7A 2QKEA 1S3RA 1TOFA 2WULA 3VWXA 4Q5QA 2VCVA 3FHKA 1DSBA 3IA1A 3RFRC 5HFIA 3CBUA 1TRUA 5CRDA 2B6MA 5IMFA 2WVZA 3JCML 2FA4A 1EP8A 4H86A 2A2PA 1FVJA 3GSTA 4D73B 2NVLA 1QUWA 4KAEA 3KEBA 3C7MA 2CVDA 4ECBA 5DCGA 3HHVA 4F0CA 3PH9A 3ERWA 4ML1A 3IC8A 3G7YA 2IMDA 5AISA 2H0HA 4Z2TA 2YANA 18GSA 3TOUA 4WF4A 4LLRA 3TJFA 2LRNA 4JRRA 2GS3A 1WRYA 3I9V2 4AJ7A 2J23A 3DD3A 5D73A 1FVKA 2N5BA 5ECHB 2DMLA 2H8LA 1VF3A 2CX3A 1AQWA 3LW9A 2I9HA 2DJJA 4YQVA 1PX7A 5EY6A 2NDOA 3FZAA 3F4SA 3GKNA 4BA7A 2P5RA 4EE0A 1GUHA 3IR4A 3GTUB 2X8CA 3GNJA 1XOBA 4NPBA 5ELAA 1ZL9A 4NAXA 4QQ7A 6GSSA 3GX8A 3C8EA 2AAWA 3N9JA 3V1WA 4DSSB 1R4WA 2HRAA 3TKSC 1BX9A 4X4JA 4I97A 3IOSA 4ZILA 4HUAA 3HVNA 3VWVA 5ECPB 4OMVA 2V1MA 1VF4A 2E2MA 1A0FA 4KUNA 11GSA 4NHWA 3KP9A 4TRXA 5DAKB 2M72A 3LEFA 5HFGA 5IPGA 2X49A 2VLUA 1WIKA 1V98A 3Q6OA 2FWHA 1Z3EA 2R5GA 4YQMA 5CNWA 4GWRA 1URMA 2BTOT 5CREA 4HOJA 2MMOA 1SJ6A 4TXOA 2P31A 1A2MA 1ZMAA 3MAKA 5D96A 1QQ2A 1WPIA 4KDYA 4TR0A 3GSSA 4Z7XA 3H93A 1R7HA 2L6DA 2OACA 5FWGA 2WZ9A 19GSA 4LA1A 4CHSA 3ME8A 1SU9A 1A0RP 4EF0A 5DQSA 2YOIA 3TU3B 4Z2RA 3O76A 2FWGA 2V41A 4KA0A 1JZOA 5G30A 1SD8A 4N30A 3W8SA 2CX4A 1PSQA 2F3MA 2MYGA 2VCTA 2H0GA 3A5WA 1MD4A 1EOHA 4MZWA 2OKAA 5IMZA 1ZYNA 2DC5A 4POLA 4X1UA 4RQXA 5EL8A 4K1FA 2LJRA 4OCFA 4MF7A 5INYA 5IQYA 3UBKA 4WBJA 1F2EA 2YN1A 4LL1B 1XVQA 5LD0A 1MDIA 5J40A 1V58A 4NV2A 3LQ7A 16GSA 1QXHA 5G2ZA 1GLPA 1PKZA 2CVBA 2O85A 2R2JA 4J56E 1PQNA 4I2UA 1XVWA 5ECSA 5D9XA 1B9XC 1O6JA 4HEA2 4K8MA 3G7IA 2HSHA 3VK9A 4IQAA 4MF6A 5G31A 1AQXA 3TGZA 4K7OA 3KMNA 2GT6A 2GQKA 4FYCA 4MZCA 1M9AA 3KGKA 3VPQA 5JWQB 3IDVA 3D5JA 3GKKA 2G2QA 2WFCA 2KP2A 4MJCA 5C00A 3GH6A 3LJRA 5F0GA 1WOUA 1KNGA 4JU5A 4AKGA 3DMLA 4MJEA 4X0XA 3PR8A 4WBRD 5E4WA 3Q74A 4PUAA 1V2AA 5ECNB 2CZ3A 3KH7A 1TJDA 5FHIA 2A4VA 2CA8A 4IN0A 1SL1B 2EFCA 5GAPD 1S3AA 1M3IA 3VWWA 1DUGA 2XC2A 1FB6A 3HA9A 3CSJA 2BMXA 4MF5A 2GSTA 3HD5A 1XZOA 1M2DA 22GSA 2JADA 4Q5RA 3LYKA 3FZ9A 1V40A 4E8EA 3C71A 5ECRB 5HFKA 4AKHA 1H4OA 4GLTA 4E68A 5GSSA 4IW9A 1XOAA 2PERA 5A1NA 3FR9A 1TK0B 4L8EA 2R3XA 4V2MA 1ST9A 5A5KA 2YCDA 4MH2A 1V9WA 3EC3A 4HZ4A 5ECLB 1SKWB 2JZTA 3QPMA 4TXOB 5IMAA 4O7HA 2YZHA 1HQOA 1TI3A 2GSRA 2GDRA 4XIHA 2O87A 1T4YA 2PUKC 1XWAA 4AKXB 3ED3A 4D73A 2IJYA 1DE1A 6GSTA 3F4TA 1TXUA 4JR4A 3AY8A 2GT5A 3M1GA 1OVNA 4POKA 4EDYA 1ML6A 1SYXA 2CVKA 5KOWA 1K3LA 3TKSE 2LRCA 1KTEA 4G9HA 2NPBA 2HFDA 2NTOA 2KUCA 3ZIJA 1YEWC 3EMXA 4PHZC 4K2XA 2B1LA 3DWVA 1N25A 4GF0A 2C3QA 3UOMA 6GSXA 3CXGA 1UA5A 2VOCA 1IYIA 4HU7A 4GQCA 2GGTA 2XBQA 2VCXA 1AIUA 2V2GA 2YZUA 2H0IA 3HCZA 2WGRA 3A2WA 4IELA 1B48A 1M2AA 2VLTA 1S3CA 1SVOA 3HDCA 1SK1A 4DEJA 4YKFA 2VL2A 4JBBA 2F51A 4DSSA 3TB2A 2AHEA 1Z7RA 2LUSA 2HZFA 2VD1A 1GUMA 5AN1A 2PVOC 3D0ZA 4GTUA 1SVLA 2PN8A 3US3A 4ACSA 4O92A 1JZDA 5CRGA 3HVXA 4TR1A 4BL7B 5J3RA 1T00A 4I2TA 2OADA 3TUEA 5HR2A 1O81A 4KNDA 4K6XA 4GQFA 2O36A 1J9BA 1GTBA 3L9UA 3BOAA 1BJXA 2O7KA 5GZZB 2YPMA 2HE3A 1YF0A 2JACA 4L0UA 1OE7A 4CY6A 1SL0B 3OR5A 1FOHA 3HJOA 4GDFA 3QMXA 5AGYA 2IWTA 2C80A 2HYXA 4MABA 3RHBA 2RM6A 4L0WA 4XTSA 2IN3A 3G9BA 2E2GA 1XBSA 1GUKA 4E8HA 4POMA 4IBPA 2I81A 3GHAA 2WW3A 5JCGA 3BJ5A 3F6FA 3GKMA 5CYYA 4Q5NA 4F82A 1JZWA 5B8AA 1M3JA 4GSSA 4PQHA 3HVVA 2E7PA 1BYEA 2RM5A 1TDIA 2C0DA 4MH3A 3EPTA 3GH9A 2JSZA 1USBA 5CAXA 5AIXA 5EPFA 3FR6A 5DJMA 6GSWA 3F8UA 1GRXA 1YKAA 3A3TA 4MCUA 1K0DA 1EOGA 2FUG2 2JL4A 3UMAA 4POBA 2HRKB 1YJ6A 1SKRB 4OO5A 1Y25A 3TRPA 1TRWA 3H79A 1PA3A 4ZB8A 1EV9A 4KGIA 4TN8A 2VL9A 5KOXA 4HQZA 2NBSA 4OCEA 2GLRA 1PRXA 3M8NA 2XPEA 4PURA 4FYUA 5DDLA 2WW1A 3GURA 4WEYA 3Q19A 3M9JA 1GSEA 5AIVA 2AUVA 4O5RA 5A4UA 2IMFA 1M9BA 5CRHA 2K9FA 4N11A 4EIQA 2HSYA 2GSQA 4EXJA 4GCIA 2EFEA 4NHZA 4GSTA 2DKIA 5CP1A 3HJPA 3VI5A 4K0GA 1ZZYA 2B5YA 4WF5A 4MZBA 2HZEA 3UARA 1Z6NA 1F6MC 3EU4A 4KCEA 6GSYA 4G0LA 1PX6A 1RK4A 2JZSA 5KN2A 1AC1A 3I6AA 17GSA 2C0GA 3L9VA 1Q98A 2VIMA 2O89A 2OBKA 3D4TA 3QD9A 3UL3A 2VL2C 13GSA 20GSA 1YZXA 1HNAA 4GRFA 3EU3A 1GL8A 2IPAA 2F8FA 4XCSA 4BVYA 2FHEA 2VAFA 1SJIA 1X9MB 10GSA 2DJ0A 4JEDA 5DALA 2WVXB 5HR1A 2EFDA 1GSFA 5F06A 3RBTA 2CT6A 3M3MA 3TKQA 4TR1B 2H71A 1F37A 1EGRA 1NSWA 4KSOA 1Z7PA 2IMKA 3GL5A 2ZUPA 2B3SA 2YJHA 2EIRA 2WVYA 2D2ZA 5IO0A 2DBCA 3WT1A 4MA9A 2QGVA 2H6XA 3QAWA 3EVIA 2H1LA 2PBJA 2PU9C 2C0EA 5J4UA 4I8BA 4YKGA 4ZBAA 2P0GA 1BAYA 5DVBA 3RPPA 3TRXA 4RI7A 4IS0A 4EL1A 2OBIA 4KW6A 1GNWA 3F3RA 2WRTA 4IVFA 1U3IA 5B6NA 4ZL9A 5KN0A 4HU9A 1TTZA 3H4KA 5IMDA 2EC4A 5ECIB 2HXKA 1XWCA 3S9FA 3W6GA 2WW0A 1GSUA 3F63A 1G7OA 4TXVA 1FG4A 2DIYA 5ID2B 12GSA 3P7XA 4TKYA 1FHEA 1TXXA 4N3ZA 5LNKe 1JFUA 3DYRA 5IMCA 4RQRA 2LKUA 4V2LA 2H75A 3W8JA 3KTLA 4NWYA 1XW5A 2DJ3A 4QL7A 1MDKA 4PI2C 3RDWA 3QOUA 3I43A 4YQUA 5LCZA 4FXYP 2X8GA 2WS2A 2B5XA 1R26A 4IKHA 3DGQA 3ZFBA 5A4VA 1UN2A 4BL7A 5F8BA 4BWQA 3GA4A 1PN0A 4TR3A 2H01A 2KOKA 4KDUA 2QA2A 4HQSA 1NM3A 4YAPA 2VCWA 2R6KA 1SKSB 2MBSA 4Q5FA 3IE3A 2HT9A 1AXDA 4IJIA 1ERUA 2IFQA 6GSUA 1EEJA 2LNSA 2KLXA 3LG6A 3QFAC 1WE0A 1QMVA 2QC7A 1GSSA 1E6BA 2LV3A 5DBQA 2HZEB 1DE2A 1K3YA 2OE0A 4K5RA 3LWAA 2OE3A 3D22A 2GVPA 2YV7A 3GIXA 5G5FA 3APQA 1ACVA 1ERTA 3D21A 2L57A 2H6ZA 5D9TA 1Y1UA 4F0BA 2JSYA 1OE8A 2A2SA 4RUVA 2GQMA 2B5EA 2HLSA 1X5DA 3TJBA 8GSSA 4BVYB 3KD0A 3FMWA 4ZL7A 2I3YA 1OC8A 4DVCA 4O5QA 3VFIA 5DALB 2K8SA 3CQFA 1SL2B 4W66A 1WWJA 3A2VA 3RGBC 3UBLA 3ZVJA 4AKIA 5IM9A 3UIWA 4KCAA 3ZLPA 2GZYA 2HRKA 1A2JA 2ES7A 14GSA 2LSTA 1B9YC 3IAM2 1TKDB 3K8NA 1X5CA 2EFHA 2R0CA 2GSSA 3TOTA 4MJAA 3F4RA 1OKDA 4G0IA 3FKFA 2B1KA 1H75A 1R5PA 3KXOA 3BBYA 1M0UA 3TJJA 1GNEA 2B7JA 3LGCA 5B6MA 2XBIA 5DCHA 5HR0A 1G0TA 4PQIA 2ON7A 1F3AA 5COHA 3HKRA 2DMMA 2E0QA 2HRNA 4I5QA 4AF2A 3ZIVA 2C3TA 3UVTA 1EWXA 5IMVA 1XXUA 4ISDA 3HZ8A 2CZ2A 4ZB6A 3D4MA 2H1DA 2N5AA 1GH2A 4CW9A 4GXZA 2CAQA 2UV8G 4OD7A 1U3AA 1T4ZA 1MDJA 5D9WA 5J5NA 5H5SA 2AYTA 2LQQA 2DJKA 1VF2A 1XFLA 1OC9B 1BEDA 1B8XA 3QDNA 2WJUA 1WMJA 3DIEA 2MBTA 3GN3A 1G7EA 2ZNMA 4EC0A 2ZCTA 5H5QA 3KH9A 2WZSA 3KZQA 3CRUA 2IIYA 1AAZA 1TU7A 1MD3A 5ECKB 2X64A 3BD2A 4ZIJA 4ML6A 2FD3A 2R0GA 5E59A 2R0PA 4ID0A 1K3OA 2WVXA 4EDZA 3R3EA 4OFTA 2L4QA 1PMTA 1C72A 1QFNA 1N2AA 1NHYA 3GUSA 2L59A 3LFLA 2HI7A 3MWHA 2C0FA 5D9VA 6GSVA 3L9SA 4XHMA 2O3EA 5H5RA 4ILFA 3RHCA 1U87A 2PVQA 3TRQA 4PNGA 2X4AA 4J2FA 2EIOA 3O3TA 4HJ2A 2K6VA 3RPNA 4TR4A 5DQYA 1HNCA 1HD2A 1Z5YE 3FRCA 2IFQB 2YWOA 1ILOA 3IC4A 3LSZA 1XWKA 3KTBA 4USSA 4K9ZA 2YV9A 4ECJA 3KJYA 2Z9SA 4CDOA 3TKRA 4WKWA 3SBCA 5JWRB 2IL3A 3F6DA 4FYBA 4RI6A 1QGVA 1FAAA 1QK8A 2LQOA 3HMJG 3FEUA 4MDCA 5KEJA 5B8BA 5ECQB 3IBHA 4V1Ag 1GSDA 1OC3A 5ID2A 1VF1A 4AGSA 3IHGA 2G0FA 4EVMA 4LMWA 1LJRA 5ENUA 5ECOB 5A4WA 2HSMA 3DVWA 4LMVA 3VURA 2RIIA 3MYDA 1M7TA 1GTUA 3QAGA 2OJLA 4YAVA 3MDKA 5F05A 1J0FA 3TJGA 1K0BA 4HZ2A 4F2IA 5KN3A 1ZCPA 4HDEA 1OAZA 1EP7A 3U6VA 2A4HA 2RLIA 2DLXA 3P2AA 4G2EA 1NW2A 1K0AA 4N0VA 2WB9A 2IMEA 3HXSA 3PINA 2CV4A 5BMUB 1XW6A 5D8IA 2AB6A 2AV4A 4HJMA 1PL1A 2ON5A 1JLWA 1XCCA 3WYWA 2MZCA 3CMIA 3M0FA 3APSA 2H73A 1SYRA 1X9WB 2H74A 2LJKA 3BCIA 1CQHA 2LTKA 5G1KA 4IQ1A 4K2DA 2HNLA 1S4BP 4WXTA 1V57A 2F9SA 1XPVA 2I1UA 1GP1A 2YP6A 5A5HB 4HSCX 2H70A 3ZMKA 4N10A 3L78A 1MEKA 2PGTA 1PD21 3ERGA 1I5GA 4ZL8A
chains in the Genus database with same CATH topology
1OYJA 1SENA 5BRTA 5ECMB 2VO4A 2F8AA 1PGTA 1BG1A 2UZ8A 4IGJA 4K0NA 2YNXA 3TCOA 5EVOA 4FH8A 2OT3A 1SK2A 4EIPA 1ZOFA 5JCWA 2LJAA 1O85A 1BF5A 2BJXA 3EINA 3UJ1A 2C8UA 9GSSA 1S3DA 1YKCA 5HR3A 4ECCA 4TVEA 5KN1A 3RAZA 1E2YA 3IAS2 4MP4A 1TI1A 2HSNA 4G10A 3UVHA 4PNFA 3I69A 2PWJA 1W89A 3GL3A 4KH7A 4PTSA 5FT3A 3NZNA 4PX1A 5B7CA 3E0UA 4K5SA 2V6OA 4V1Ap 1MTCA 3CSHA 4O32A 1R5AA 1THXA 4XS1A 2I4AA 4KF9A 4I6XA 1M99A 3HJMA 1W4VA 4MNNA 4EUYA 3BCKA 3ZFLA 3GMFA 3D6IA 1AW9A 4Z2UA 4K7NA 2H19A 4AJ6A 3IHQA 2WCIA 4XRDA 4OFMA 2C3NA 3GKXA 3QFBC 1TRVA 1KBNA 4DSQA 1SJZA 1K0OA 4ECIA 3C1SA 3IRAA 2L6CA 4KDXA 1A2LA 3ZREA 1WJKA 1AQVA 4GSNA 4X43A 3DEXA 3IK7A 1TP9A 2M80A 3FZ5A 3O6TA 1BG5A 4XS6A 3CSIA 1Z6MA 3H1NA 1K0NA 3NIVA 2KHPA 4TOPA 3MNGA 3WGXA 4P3YB 4A5PA 5D93A 3KM6A 2L5OA 4OWYA 3DKSA 1EZKA 3HZ4A 3PPUA 5C04A 3QAVA 2LRTA 3CRTA 2H30A 2VL3A 1OC9A 4JR6A 5F07A 1TW9A 1UVZA 1Z9HA 3ISOA 3Q18A 4IJ3A 2V32A 4WETA 5J41A 2HSMB 2RUEA 3A2XA 2DSAA 3TDGA 2PMTA 2V6KA 3EE2A 1DBYA 1G6WA 4QL9A 4FIWA 2HQTA 3IK9A 1A8LA 5G1LA 4OO4A 3L0HA 4F9ZA 4PGTA 3F9UA 2YWIA 4XS4B 4OFNA 4TW5A 3P90A 2JU5A 4K7IA 4ULXA 2M46A 2VCQA 4HI7A 3CYNA 3E3EA 2H72A 5A34A 4HS1A 4KSMA 1GTIA 3SWLA 2VUPA 5J9CA 1XW9A 1T7PB 3CTFA 4ZXGA 4AJ8A 3N5OA 3QR6A 4WR4A 3KCMA 3H8QA 4NMUA 3ZL5A 4PXOA 2FLSA 4V2NA 5ELGA 3GRXA 2FWFA 3HY2A 2B7KA 1GULA 1ZYQB 3LXZA 2GQLA 2MMZA 4MPGA 1F3BA 4G19A 5G5EA 2H1BA 1YEPA 5IIZA 1A24A 1O8XA 5J4YA 2DKHA 2DIZA 3MSZA 3VWUA 2R4VA 3KP8A 2VLVA 1YQ1A 1CQGA 2MMNA 3FR3A 1RQMA 3GFKA 1A8YA 1KEBA 1O8WA 1RW1A 3G7JA 2ALBA 5IOXA 4XRAA 1PKWA 3WD6A 2FWEA 1HNBA 4L5LA 3ZZXA 1EGOA 3TKPA 5IO2A 3CWGA 2JZRA 2P5QA 4ZBDA 1O7UA 1LBKA 3E9JB 2DJ1A 3HYPA 3WGDA 2HSNB 3EURA 4PQ1A 4NXIA 1AUCA 1K0CA 1YVLA 4BVXA 2L4CA 3F0IA 3DXBA 2IMIA 1FW1A 4FQUA 3DVXA 1TRSA 4KE3A 3WGEA 2WDUA 2FNOA 3TJKA 2X8HA 1PN9A 2H66A 1TK5B 1GWCA 2VKZG 5HQPA 4MPFA 1T3BA 1U88A 5J9BA 3A5IA 1GTAA 4BWSA 3FYGA 2C4JA 1X5EA 2YWNA 5BMUA 5J4VA 4QMKA 1WP0A 3P8WA 2XHFA 4FO5A 5IPHA 5JWOB 5CRWA 2GZZA 3J7Yk 4MK3A 1ON4A 3EYTA 1X9SB 3LORA 4ZBBA 3QCPA 3PGTA 2AJQB 4G01A 2K8VA 5A5HA 1GSQA 2MMAA 4ICYA 3ZYWA 1TK8B 2RUFA 2TIRA 2GZPA 2K18A 3UEMA 2VCZA 1I9DA 1XIYA 3APOA 4PUFC 4IP1A 4DSRA 1B4QA 5J47A 3FZ4A 2N5FA 1GSYA 1XWGA 2GTUA 2J9HA 5L71A 1FO5A 5CO3A 1NHOA 2R37A 3C73A 4ZB7A 4CY8A 2VD0A 2FY6A 2VM1A 1EV4A 4NV5A 4YH2A 1YEXA 3LYPA 2LS5A 5DJLA 2FCHA 1ERVA 2X99A 3ZRDA 4BPYA 1Y6EA 3EWLA 1B4PA 1ZYPA 1SK0A 3VLNA 3GTUA 5A34B 3ME7A 1JHBA 3M9KA 1VRSD 2O8VB 3VPTA 1G6YA 1T1VA 4JE1A 1FOVA 4O5UA 3HVSA 2O5VA 1JLVA 5ABRA 2FGXA 1EEMA 3FW2A 3ERFA 3TKSA 1IYHA 4WR5A 4L5OA 4J57E 5DAKA 3IV4A 5IOWA 4EO3A 4ZB9A 2PPTA 4KX4A 1BQ7A 3DRNA 3IPZA 7GSSA 3F3QA 3IXRA 2H76A 2C1YA 2KP1A 4F03A 2H1GA 5GAND 3EMPA 3GV1A 2REMA 1N8JA 4MLYA 2CAIA 2A2RA 3KMOA 3J7Yb 4G0KA 2TRCP 1UC7A 2H6YA 3KIJA 2QSIA 1YF1A 1VGLA 3C1RA 3FY7A 2QA1A 3GX0A 2YWMA 3R2QA 4AI6A 5GSTA 4IP6A 2YJ7A 1YY7A 3ZTLA 2H1AA 1YDKA 1GLQA 2L5LA 1FB0A 2TRXA 2VM2A 1A23A 1HYUA 1ZGNA 1SD9A 2LNTA 1O73A 2OE1A 4BVXB 2EIQA 1PL2A 3U5RE 4MJBA 1ABAA 1LU4A 4EKZA 1F9MA 3ZMLA 4LL4B 1M2BA 3FK8A 3GYKA 1X0RA 2FA8A 1ERWA 3WT2A 3MIXA 2HRFA 4KB3A 1K0MA 3ZVJD 1J08A 2XPDA 4JZQA 4XS4A 4MMMA 1JZRA 4N0ZA 2OA7A 1XWBA 2LEGA 1T8EB 3LXTA 5A1NB 3L4NA 5JCUA 3CTGA 1U6TA 1OKTA 2DJ2A 3NOFA 2CQ9A 4IHUA 1SVMA 1TU8A 1ZYEA 3UAPA 1THOA 3ZITA 1Q4JA 3VI7A 2QKEA 1TOFA 2WULA 3VWXA 4Q5QA 2VCVA 3FHKA 1DSBA 3IA1A 5HFIA 3CBUA 1TRUA 5CRDA 2B6MA 5IMFA 3JCML 2FA4A 1EP8A 4H86A 2A2PA 1FVJA 3GSTA 4D73B 2NVLA 1QUWA 4KAEA 3KEBA 3C7MA 2CVDA 4ECBA 5DCGA 3HHVA 4F0CA 3PH9A 3ERWA 4ML1A 3IC8A 3G7YA 2IMDA 5AISA 2H0HA 4Z2TA 2YANA 18GSA 3TOUA 4WF4A 4LLRA 3TJFA 2LRNA 4JRRA 2GS3A 1WRYA 3I9V2 4AJ7A 2J23A 3DD3A 5D73A 1FVKA 2N5BA 5ECHB 2DMLA 2H8LA 1VF3A 2CX3A 1AQWA 3LW9A 2I9HA 2DJJA 4YQVA 1PX7A 5EY6A 2NDOA 3FZAA 3F4SA 3GKNA 4BA7A 2P5RA 4EE0A 1GUHA 3IR4A 3GTUB 2X8CA 3GNJA 1XOBA 4NPBA 5ELAA 1ZL9A 4NAXA 4QQ7A 6GSSA 3GX8A 3C8EA 2AAWA 3N9JA 3V1WA 4DSSB 1R4WA 2HRAA 3TKSC 1BX9A 4X4JA 4I97A 3IOSA 4ZILA 4HUAA 3VWVA 5ECPB 4OMVA 2V1MA 1VF4A 2E2MA 1A0FA 4KUNA 11GSA 4NHWA 3KP9A 4TRXA 5DAKB 2M72A 3LEFA 5HFGA 5IPGA 2X49A 2VLUA 1WIKA 1V98A 3Q6OA 2FWHA 1Z3EA 2R5GA 4YQMA 5CNWA 4GWRA 1URMA 2BTOT 5CREA 4HOJA 2MMOA 1SJ6A 4TXOA 2P31A 1A2MA 1ZMAA 3MAKA 5D96A 1QQ2A 1WPIA 4KDYA 4TR0A 3GSSA 4Z7XA 3H93A 1R7HA 2L6DA 2OACA 5FWGA 2WZ9A 19GSA 4LA1A 4CHSA 3ME8A 1SU9A 1A0RP 4EF0A 5DQSA 2YOIA 3TU3B 4Z2RA 3O76A 2FWGA 2V41A 4KA0A 1JZOA 5G30A 1SD8A 4N30A 3W8SA 2CX4A 1PSQA 2F3MA 2MYGA 2VCTA 2H0GA 3A5WA 1MD4A 1EOHA 4MZWA 2OKAA 5IMZA 1ZYNA 2DC5A 4POLA 4X1UA 4RQXA 5EL8A 4K1FA 2LJRA 4OCFA 4MF7A 5INYA 5IQYA 3UBKA 4WBJA 1F2EA 2YN1A 4LL1B 1XVQA 5LD0A 1MDIA 5J40A 1V58A 4NV2A 3LQ7A 16GSA 1QXHA 5G2ZA 1GLPA 1PKZA 2CVBA 2O85A 2R2JA 4J56E 1PQNA 4I2UA 1XVWA 5ECSA 5D9XA 1B9XC 1O6JA 4HEA2 4K8MA 3G7IA 2HSHA 3VK9A 4IQAA 4MF6A 5G31A 1AQXA 3TGZA 4K7OA 3KMNA 2GT6A 2GQKA 4FYCA 4MZCA 1M9AA 3KGKA 3VPQA 5JWQB 3IDVA 3D5JA 3GKKA 2G2QA 2WFCA 2KP2A 4MJCA 5C00A 3GH6A 3LJRA 5F0GA 1WOUA 1KNGA 4JU5A 4AKGA 3DMLA 4MJEA 4X0XA 3PR8A 4WBRD 5E4WA 3Q74A 4PUAA 1V2AA 5ECNB 2CZ3A 3KH7A 1TJDA 5FHIA 2A4VA 2CA8A 4IN0A 1SL1B 2EFCA 5GAPD 1S3AA 3VWWA 1DUGA 2XC2A 1FB6A 3HA9A 3CSJA 2BMXA 4MF5A 2GSTA 3HD5A 1XZOA 1M2DA 22GSA 2JADA 4Q5RA 3LYKA 3FZ9A 1V40A 4E8EA 3C71A 5ECRB 5HFKA 4AKHA 1H4OA 4GLTA 4E68A 5GSSA 4IW9A 1XOAA 2PERA 5A1NA 3FR9A 1TK0B 4L8EA 2R3XA 4V2MA 1ST9A 5A5KA 2YCDA 4MH2A 1V9WA 3EC3A 4HZ4A 5ECLB 1SKWB 2JZTA 3QPMA 4TXOB 5IMAA 4O7HA 2YZHA 1HQOA 1TI3A 2GSRA 2GDRA 4XIHA 2O87A 1T4YA 2PUKC 1XWAA 4AKXB 3ED3A 4D73A 2IJYA 1DE1A 6GSTA 3F4TA 1TXUA 4JR4A 3AY8A 2GT5A 3M1GA 1OVNA 4POKA 4EDYA 1ML6A 1SYXA 2CVKA 5KOWA 1K3LA 3TKSE 2LRCA 1KTEA 4G9HA 2NPBA 2HFDA 2NTOA 2KUCA 3ZIJA 3EMXA 4K2XA 2B1LA 3DWVA 1N25A 4GF0A 2C3QA 3UOMA 6GSXA 3CXGA 1UA5A 2VOCA 1IYIA 4HU7A 4GQCA 2GGTA 2XBQA 2VCXA 1AIUA 2V2GA 2YZUA 2H0IA 3HCZA 2WGRA 3A2WA 4IELA 1B48A 1M2AA 2VLTA 1S3CA 1SVOA 3HDCA 1SK1A 4DEJA 4YKFA 2VL2A 4JBBA 2F51A 4DSSA 3TB2A 2AHEA 1Z7RA 2LUSA 2HZFA 2VD1A 1GUMA 5AN1A 2PVOC 3D0ZA 4GTUA 1SVLA 2PN8A 3US3A 4ACSA 4O92A 1JZDA 5CRGA 3HVXA 4TR1A 4BL7B 5J3RA 1T00A 4I2TA 2OADA 3TUEA 5HR2A 1O81A 4KNDA 4K6XA 4GQFA 1J9BA 1GTBA 3L9UA 3BOAA 1BJXA 2O7KA 5GZZB 2YPMA 2HE3A 1YF0A 2JACA 4L0UA 1OE7A 4CY6A 1SL0B 3OR5A 1FOHA 3HJOA 4GDFA 3QMXA 5AGYA 2IWTA 2C80A 2HYXA 4MABA 3RHBA 2RM6A 4L0WA 4XTSA 2IN3A 3G9BA 2E2GA 1XBSA 1GUKA 4E8HA 4POMA 4IBPA 2I81A 3GHAA 5JCGA 3BJ5A 3F6FA 3GKMA 5CYYA 4Q5NA 4F82A 1JZWA 5B8AA 4GSSA 4PQHA 3HVVA 2E7PA 1BYEA 2RM5A 1TDIA 2C0DA 4MH3A 3EPTA 3GH9A 2JSZA 1USBA 5CAXA 5AIXA 5EPFA 3FR6A 5DJMA 6GSWA 3F8UA 1GRXA 1YKAA 3A3TA 4MCUA 1K0DA 1EOGA 2FUG2 2JL4A 3UMAA 4POBA 2HRKB 1YJ6A 1SKRB 4OO5A 1Y25A 3TRPA 1TRWA 3H79A 1PA3A 4ZB8A 1EV9A 4KGIA 4TN8A 2VL9A 5KOXA 4HQZA 2NBSA 4OCEA 2GLRA 1PRXA 3M8NA 2XPEA 4PURA 4FYUA 5DDLA 3GURA 4WEYA 3Q19A 3M9JA 1GSEA 5AIVA 2AUVA 4O5RA 5A4UA 2IMFA 1M9BA 5CRHA 2K9FA 4N11A 4EIQA 2HSYA 2GSQA 4EXJA 4GCIA 2EFEA 4NHZA 4GSTA 2DKIA 5CP1A 3HJPA 3VI5A 4K0GA 1ZZYA 2B5YA 4WF5A 4MZBA 2HZEA 3UARA 1Z6NA 1F6MC 3EU4A 4KCEA 6GSYA 4G0LA 1PX6A 1RK4A 2JZSA 5KN2A 1AC1A 3I6AA 17GSA 2C0GA 3L9VA 1Q98A 2VIMA 2O89A 2OBKA 3D4TA 3QD9A 3UL3A 2VL2C 13GSA 20GSA 1YZXA 1HNAA 4GRFA 3EU3A 1GL8A 2IPAA 2F8FA 4XCSA 4BVYA 2FHEA 2VAFA 1SJIA 1X9MB 10GSA 2DJ0A 4JEDA 5DALA 5HR1A 2EFDA 1GSFA 5F06A 3RBTA 2CT6A 3M3MA 3TKQA 4TR1B 2H71A 1F37A 1EGRA 1NSWA 4KSOA 1Z7PA 2IMKA 3GL5A 2ZUPA 2B3SA 2YJHA 2EIRA 2D2ZA 5IO0A 2DBCA 3WT1A 4MA9A 2QGVA 2H6XA 3QAWA 3EVIA 2H1LA 2PBJA 2PU9C 2C0EA 5J4UA 4I8BA 4YKGA 4ZBAA 2P0GA 1BAYA 5DVBA 3RPPA 3TRXA 4RI7A 4IS0A 4EL1A 2OBIA 4KW6A 1GNWA 3F3RA 2WRTA 4IVFA 1U3IA 5B6NA 4ZL9A 5KN0A 4HU9A 1TTZA 3H4KA 5IMDA 2EC4A 5ECIB 2HXKA 1XWCA 3S9FA 3W6GA 1GSUA 3F63A 1G7OA 4TXVA 1FG4A 2DIYA 5ID2B 12GSA 3P7XA 4TKYA 1FHEA 1TXXA 4N3ZA 5LNKe 1JFUA 3DYRA 5IMCA 4RQRA 2LKUA 4V2LA 2H75A 3W8JA 3KTLA 4NWYA 1XW5A 2DJ3A 4QL7A 1MDKA 3RDWA 3QOUA 3I43A 4YQUA 5LCZA 2X8GA 2WS2A 2B5XA 1R26A 4IKHA 3DGQA 3ZFBA 5A4VA 1UN2A 4BL7A 5F8BA 4BWQA 3GA4A 1PN0A 4TR3A 2H01A 2KOKA 4KDUA 2QA2A 4HQSA 1NM3A 4YAPA 2VCWA 2R6KA 1SKSB 2MBSA 4Q5FA 3IE3A 2HT9A 1AXDA 4IJIA 1ERUA 2IFQA 6GSUA 1EEJA 2LNSA 2KLXA 3LG6A 3QFAC 1WE0A 1QMVA 2QC7A 1GSSA 1E6BA 2LV3A 5DBQA 2HZEB 1DE2A 1K3YA 2OE0A 4K5RA 3LWAA 2OE3A 3D22A 2GVPA 2YV7A 3GIXA 5G5FA 3APQA 1ACVA 1ERTA 3D21A 2L57A 2H6ZA 5D9TA 1Y1UA 4F0BA 2JSYA 1OE8A 2A2SA 4RUVA 2GQMA 2B5EA 2HLSA 1X5DA 3TJBA 8GSSA 4BVYB 3KD0A 3FMWA 4ZL7A 2I3YA 1OC8A 4DVCA 4O5QA 3VFIA 5DALB 2K8SA 1SL2B 4W66A 1WWJA 3A2VA 3UBLA 3ZVJA 4AKIA 5IM9A 3UIWA 4KCAA 3ZLPA 2GZYA 2HRKA 1A2JA 2ES7A 14GSA 2LSTA 1B9YC 3IAM2 1TKDB 3K8NA 1X5CA 2EFHA 2R0CA 2GSSA 3TOTA 4MJAA 3F4RA 1OKDA 4G0IA 3FKFA 2B1KA 1H75A 1R5PA 3KXOA 3BBYA 1M0UA 3TJJA 1GNEA 2B7JA 3LGCA 5B6MA 2XBIA 5DCHA 5HR0A 1G0TA 4PQIA 2ON7A 1F3AA 5COHA 3HKRA 2DMMA 2E0QA 2HRNA 4I5QA 4AF2A 3ZIVA 2C3TA 3UVTA 1EWXA 5IMVA 1XXUA 4ISDA 3HZ8A 2CZ2A 4ZB6A 3D4MA 2H1DA 2N5AA 1GH2A 4CW9A 4GXZA 2CAQA 2UV8G 4OD7A 1U3AA 1T4ZA 1MDJA 5D9WA 5J5NA 5H5SA 2AYTA 2LQQA 2DJKA 1VF2A 1XFLA 1OC9B 1BEDA 1B8XA 3QDNA 2WJUA 1WMJA 3DIEA 2MBTA 3GN3A 1G7EA 2ZNMA 4EC0A 2ZCTA 5H5QA 3KH9A 3KZQA 3CRUA 2IIYA 1AAZA 1TU7A 1MD3A 5ECKB 2X64A 3BD2A 4ZIJA 4ML6A 2FD3A 2R0GA 5E59A 2R0PA 4ID0A 1K3OA 4EDZA 3R3EA 4OFTA 2L4QA 1PMTA 1C72A 1QFNA 1N2AA 1NHYA 3GUSA 2L59A 3LFLA 2HI7A 3MWHA 2C0FA 5D9VA 6GSVA 3L9SA 4XHMA 5H5RA 4ILFA 3RHCA 1U87A 2PVQA 3TRQA 4PNGA 2X4AA 4J2FA 2EIOA 3O3TA 4HJ2A 2K6VA 3RPNA 4TR4A 5DQYA 1HNCA 1HD2A 1Z5YE 3FRCA 2IFQB 2YWOA 1ILOA 3IC4A 3LSZA 1XWKA 3KTBA 4USSA 4K9ZA 2YV9A 4ECJA 3KJYA 2Z9SA 4CDOA 3TKRA 4WKWA 3SBCA 5JWRB 2IL3A 3F6DA 4FYBA 4RI6A 1QGVA 1FAAA 1QK8A 2LQOA 3HMJG 3FEUA 4MDCA 5KEJA 5B8BA 5ECQB 3IBHA 4V1Ag 1GSDA 1OC3A 5ID2A 1VF1A 4AGSA 3IHGA 2G0FA 4EVMA 4LMWA 1LJRA 5ENUA 5ECOB 5A4WA 2HSMA 3DVWA 4LMVA 3VURA 2RIIA 3MYDA 1M7TA 1GTUA 3QAGA 2OJLA 4YAVA 3MDKA 5F05A 1J0FA 3TJGA 1K0BA 4HZ2A 4F2IA 5KN3A 1ZCPA 4HDEA 1OAZA 1EP7A 3U6VA 2A4HA 2RLIA 2DLXA 3P2AA 4G2EA 1NW2A 1K0AA 4N0VA 2WB9A 2IMEA 3HXSA 3PINA 2CV4A 5BMUB 1XW6A 5D8IA 2AB6A 2AV4A 4HJMA 1PL1A 2ON5A 1JLWA 1XCCA 3WYWA 2MZCA 3CMIA 3M0FA 3APSA 2H73A 1SYRA 1X9WB 2H74A 2LJKA 3BCIA 1CQHA 2LTKA 5G1KA 4IQ1A 4K2DA 2HNLA 4WXTA 1V57A 2F9SA 1XPVA 2I1UA 1GP1A 2YP6A 5A5HB 2H70A 3ZMKA 4N10A 3L78A 1MEKA 2PGTA 1PD21 3ERGA 1I5GA 4ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYJ A;  1SEN A;  5ECM B;  2VO4 A;  2F8A A;  1PGT A;  2UZ8 A;  4IGJ A;  4K0N A;  2YNX A;  3TCO A;  5EVO A;  4FH8 A;  1SK2 A;  1ZOF A;  5JCW A;  2LJA A;  1O85 A;  2BJX A;  3EIN A;  3UJ1 A;  2C8U A;  9GSS A;  1S3D A;  1YKC A;  5HR3 A;  4ECC A;  4TVE A;  5KN1 A;  3RAZ A;  1E2Y A;  3IAS 2;  4MP4 A;  1TI1 A;  4G10 A;  3UVH A;  4PNF A;  3I69 A;  2PWJ A;  1W89 A;  3GL3 A;  4KH7 A;  4PTS A;  5FT3 A;  3NZN A;  4PX1 A;  5B7C A;  3E0U A;  2V6O A;  4V1A p;  1MTC A;  3CSH A;  4O32 A;  1R5A A;  1THX A;  4XS1 A;  2I4A A;  4KF9 A;  4I6X A;  1M99 A;  3HJM A;  1W4V A;  4EUY A;  3BCK A;  3ZFL A;  3GMF A;  3D6I A;  1AW9 A;  4K7N A;  2H19 A;  4AJ6 A;  3IHQ A;  2WCI A;  4XRD A;  4OFM A;  2C3N A;  3GKX A;  3QFB C;  1TRV A;  1KBN A;  4DSQ A;  1SJZ A;  1K0O A;  4ECI A;  3C1S A;  3IRA A;  2L6C A;  4KDX A;  1A2L A;  3ZRE A;  1WJK A;  1AQV A;  4GSN A;  4X43 A;  3DEX A;  3IK7 A;  1TP9 A;  2M80 A;  3FZ5 A;  3O6T A;  1BG5 A;  4XS6 A;  3CSI A;  1Z6M A;  3H1N A;  1K0N A;  3NIV A;  2KHP A;  4TOP A;  3MNG A;  3WGX A;  4P3Y B;  5D93 A;  3KM6 A;  2L5O A;  4OWY A;  3DKS A;  1EZK A;  3HZ4 A;  3PPU A;  5C04 A;  3QAV A;  2LRT A;  3CRT A;  2H30 A;  2VL3 A;  1OC9 A;  4JR6 A;  5F07 A;  1TW9 A;  1UVZ A;  1Z9H A;  3ISO A;  3Q18 A;  4IJ3 A;  2V32 A;  4WET A;  5J41 A;  2HSM B;  2RUE A;  3A2X A;  2DSA A;  3TDG A;  2PMT A;  2V6K A;  3EE2 A;  1DBY A;  1G6W A;  4QL9 A;  4FIW A;  2HQT A;  3IK9 A;  1A8L A;  5G1L A;  4OO4 A;  3L0H A;  4F9Z A;  4PGT A;  3F9U A;  2YWI A;  4XS4 B;  4OFN A;  4TW5 A;  3P90 A;  2JU5 A;  4K7I A;  4ULX A;  2M46 A;  2VCQ A;  4HI7 A;  3CYN A;  3E3E A;  2H72 A;  4HS1 A;  4KSM A;  1GTI A;  3SWL A;  2VUP A;  5J9C A;  1XW9 A;  1T7P B;  3CTF A;  4ZXG A;  4AJ8 A;  3N5O A;  3QR6 A;  4WR4 A;  3KCM A;  3H8Q A;  4NMU A;  3ZL5 A;  4PXO A;  2FLS A;  4V2N A;  5ELG A;  3GRX A;  2FWF A;  3HY2 A;  2B7K A;  1GUL A;  1ZYQ B;  3LXZ A;  2GQL A;  2MMZ A;  4MPG A;  1F3B A;  4G19 A;  5G5E A;  2H1B A;  1YEP A;  5IIZ A;  1A24 A;  1O8X A;  2DIZ A;  3MSZ A;  3VWU A;  2R4V A;  3KP8 A;  2VLV A;  1YQ1 A;  1CQG A;  2MMN A;  3FR3 A;  1RQM A;  3GFK A;  1A8Y A;  1KEB A;  1O8W A;  1RW1 A;  3G7J A;  2ALB A;  5IOX A;  4XRA A;  1PKW A;  3WD6 A;  2FWE A;  1HNB A;  4L5L A;  3ZZX A;  1EGO A;  3TKP A;  5IO2 A;  2JZR A;  2P5Q A;  4ZBD A;  1O7U A;  1LBK A;  3E9J B;  2DJ1 A;  3HYP A;  3WGD A;  2HSN B;  3EUR A;  4PQ1 A;  4NXI A;  1AUC A;  1K0C A;  4BVX A;  2L4C A;  3F0I A;  3DXB A;  2IMI A;  1FW1 A;  4FQU A;  3DVX A;  1TRS A;  4KE3 A;  3WGE A;  2WDU A;  2FNO A;  3TJK A;  2X8H A;  1PN9 A;  2H66 A;  1TK5 B;  1GWC A;  5HQP A;  4MPF A;  1T3B A;  1U88 A;  5J9B A;  1GTA A;  4BWS A;  3FYG A;  2C4J A;  1X5E A;  2YWN A;  5BMU A;  1WP0 A;  3P8W A;  2XHF A;  4FO5 A;  5IPH A;  5JWO B;  5CRW A;  2GZZ A;  3J7Y k;  4MK3 A;  1ON4 A;  3EYT A;  1X9S B;  3LOR A;  4ZBB A;  3QCP A;  3PGT A;  2AJQ B;  2K8V A;  1GSQ A;  2MMA A;  3ZYW A;  1TK8 B;  2RUF A;  2TIR A;  2GZP A;  2K18 A;  3UEM A;  2VCZ A;  1I9D A;  1XIY A;  3APO A;  4PUF C;  4IP1 A;  4DSR A;  1B4Q A;  3FZ4 A;  2N5F A;  1GSY A;  1XWG A;  2GTU A;  2J9H A;  5L71 A;  1FO5 A;  5CO3 A;  1NHO A;  2R37 A;  3C73 A;  2VD0 A;  2FY6 A;  2VM1 A;  1EV4 A;  4NV5 A;  4YH2 A;  1YEX A;  3LYP A;  2LS5 A;  5DJL A;  2FCH A;  1ERV A;  2X99 A;  3ZRD A;  4BPY A;  1Y6E A;  3EWL A;  1B4P A;  1SK0 A;  3VLN A;  3GTU A;  3ME7 A;  1JHB A;  3M9K A;  1VRS D;  2O8V B;  3VPT A;  1G6Y A;  1T1V A;  4JE1 A;  1FOV A;  3HVS A;  1JLV A;  5ABR A;  2FGX A;  1EEM A;  3FW2 A;  3ERF A;  3TKS A;  1IYH A;  4WR5 A;  4L5O A;  4J57 E;  5DAK A;  3IV4 A;  5IOW A;  4EO3 A;  4ZB9 A;  2PPT A;  4KX4 A;  1BQ7 A;  3DRN A;  3IPZ A;  7GSS A;  3F3Q A;  3IXR A;  2H76 A;  2C1Y A;  2KP1 A;  4F03 A;  2H1G A;  5GAN D;  3EMP A;  3GV1 A;  2REM A;  1N8J A;  4MLY A;  2CAI A;  2A2R A;  3KMO A;  3J7Y b;  4G0K A;  2TRC P;  1UC7 A;  2H6Y A;  3KIJ A;  2QSI A;  1YF1 A;  1VGL A;  3C1R A;  3FY7 A;  3GX0 A;  2YWM A;  3R2Q A;  5GST A;  4IP6 A;  2YJ7 A;  1YY7 A;  3ZTL A;  2H1A A;  1YDK A;  1GLQ A;  2L5L A;  1FB0 A;  2TRX A;  2VM2 A;  1A23 A;  1HYU A;  1ZGN A;  1SD9 A;  2LNT A;  1O73 A;  2OE1 A;  4BVX B;  2EIQ A;  1PL2 A;  3U5R E;  4MJB A;  1ABA A;  1LU4 A;  4EKZ A;  1F9M A;  3ZML A;  4LL4 B;  1M2B A;  3FK8 A;  3GYK A;  1X0R A;  2FA8 A;  1ERW A;  3WT2 A;  4KB3 A;  2HRF A;  1K0M A;  3ZVJ D;  1J08 A;  2XPD A;  4JZQ A;  4XS4 A;  4MMM A;  1JZR A;  4N0Z A;  2OA7 A;  1XWB A;  2LEG A;  1T8E B;  3LXT A;  3L4N A;  5JCU A;  3CTG A;  1U6T A;  1OKT A;  2DJ2 A;  3NOF A;  2CQ9 A;  4IHU A;  1TU8 A;  1ZYE A;  3UAP A;  1THO A;  3ZIT A;  1Q4J A;  3VI7 A;  2QKE A;  1TOF A;  2WUL A;  3VWX A;  4Q5Q A;  2VCV A;  3FHK A;  1DSB A;  3IA1 A;  5HFI A;  3CBU A;  1TRU A;  5CRD A;  2B6M A;  5IMF A;  3JCM L;  2FA4 A;  1EP8 A;  4H86 A;  1FVJ A;  3GST A;  4D73 B;  2NVL A;  1QUW A;  4KAE A;  3KEB A;  3C7M A;  2CVD A;  4ECB A;  5DCG A;  3HHV A;  4F0C A;  3PH9 A;  3ERW A;  4ML1 A;  3IC8 A;  3G7Y A;  2IMD A;  5AIS A;  2H0H A;  2YAN A;  18GS A;  3TOU A;  4WF4 A;  4LLR A;  3TJF A;  2LRN A;  4JRR A;  2GS3 A;  1WRY A;  3I9V 2;  4AJ7 A;  2J23 A;  3DD3 A;  5D73 A;  1FVK A;  2N5B A;  5ECH B;  2DML A;  2H8L A;  1VF3 A;  2CX3 A;  1AQW A;  2I9H A;  2DJJ A;  4YQV A;  1PX7 A;  5EY6 A;  2NDO A;  3FZA A;  3F4S A;  3GKN A;  4BA7 A;  2P5R A;  4EE0 A;  1GUH A;  3IR4 A;  3GTU B;  2X8C A;  3GNJ A;  1XOB A;  4NPB A;  5ELA A;  1ZL9 A;  4NAX A;  4QQ7 A;  6GSS A;  3GX8 A;  3C8E A;  2AAW A;  3N9J A;  3V1W A;  4DSS B;  1R4W A;  2HRA A;  3TKS C;  1BX9 A;  4I97 A;  3IOS A;  4ZIL A;  4HUA A;  3VWV A;  5ECP B;  4OMV A;  2V1M A;  1VF4 A;  2E2M A;  1A0F A;  4KUN A;  11GS A;  4NHW A;  3KP9 A;  4TRX A;  5DAK B;  2M72 A;  3LEF A;  5HFG A;  5IPG A;  2VLU A;  1WIK A;  3Q6O A;  1V98 A;  2FWH A;  1Z3E A;  2R5G A;  4YQM A;  5CNW A;  4GWR A;  1URM A;  2BTO T;  5CRE A;  4HOJ A;  2MMO A;  1SJ6 A;  4TXO A;  2P31 A;  1A2M A;  1ZMA A;  3MAK A;  5D96 A;  1QQ2 A;  1WPI A;  4KDY A;  4TR0 A;  3GSS A;  4Z7X A;  3H93 A;  1R7H A;  2L6D A;  2OAC A;  5FWG A;  2WZ9 A;  19GS A;  4LA1 A;  4CHS A;  3ME8 A;  1SU9 A;  1A0R P;  4EF0 A;  5DQS A;  2YOI A;  3O76 A;  2FWG A;  2V41 A;  4KA0 A;  1JZO A;  5G30 A;  1SD8 A;  4N30 A;  3W8S A;  2CX4 A;  1PSQ A;  2F3M A;  2MYG A;  2VCT A;  2H0G A;  3A5W A;  1MD4 A;  1EOH A;  4MZW A;  2OKA A;  5IMZ A;  2DC5 A;  4POL A;  4X1U A;  4RQX A;  5EL8 A;  4K1F A;  2LJR A;  4OCF A;  4MF7 A;  5INY A;  5IQY A;  3UBK A;  4WBJ A;  1F2E A;  2YN1 A;  4LL1 B;  1XVQ A;  5LD0 A;  1MDI A;  1V58 A;  4NV2 A;  3LQ7 A;  16GS A;  1QXH A;  5G2Z A;  1GLP A;  1PKZ A;  2CVB A;  2O85 A;  2R2J A;  4J56 E;  1PQN A;  4I2U A;  1XVW A;  5ECS A;  5D9X A;  1B9X C;  1O6J A;  4HEA 2;  4K8M A;  3G7I A;  2HSH A;  3VK9 A;  4IQA A;  4MF6 A;  5G31 A;  1AQX A;  3TGZ A;  4K7O A;  3KMN A;  2GT6 A;  2GQK A;  4FYC A;  4MZC A;  1M9A A;  3KGK A;  3VPQ A;  5JWQ B;  3IDV A;  3D5J A;  3GKK A;  2G2Q A;  2WFC A;  2KP2 A;  4MJC A;  5C00 A;  3GH6 A;  3LJR A;  5F0G A;  1WOU A;  1KNG A;  4JU5 A;  4MJE A;  3DML A;  4X0X A;  3PR8 A;  4WBR D;  5E4W A;  3Q74 A;  4PUA A;  1V2A A;  5ECN B;  2CZ3 A;  3KH7 A;  1TJD A;  5FHI A;  2A4V A;  4IN0 A;  2CA8 A;  1SL1 B;  5GAP D;  1S3A A;  3VWW A;  1DUG A;  2XC2 A;  1FB6 A;  3HA9 A;  3CSJ A;  2BMX A;  4MF5 A;  2GST A;  3HD5 A;  1XZO A;  1M2D A;  22GS A;  2JAD A;  4Q5R A;  3LYK A;  3FZ9 A;  1V40 A;  4E8E A;  3C71 A;  5ECR B;  5HFK A;  1H4O A;  4GLT A;  5GSS A;  4IW9 A;  1XOA A;  2PER A;  3FR9 A;  1TK0 B;  4L8E A;  2R3X A;  4V2M A;  1ST9 A;  5A5K A;  2YCD A;  4MH2 A;  1V9W A;  3EC3 A;  4HZ4 A;  5ECL B;  1SKW B;  2JZT A;  3QPM A;  4TXO B;  5IMA A;  4O7H A;  2YZH A;  1HQO A;  1TI3 A;  2GSR A;  2GDR A;  4XIH A;  2O87 A;  1T4Y A;  2PUK C;  1XWA A;  3ED3 A;  4D73 A;  2IJY A;  1DE1 A;  6GST A;  3F4T A;  4JR4 A;  3AY8 A;  2GT5 A;  3M1G A;  1OVN A;  4POK A;  4EDY A;  1ML6 A;  1SYX A;  2CVK A;  1K3L A;  3TKS E;  2LRC A;  1KTE A;  4G9H A;  2NPB A;  2HFD A;  2NTO A;  2KUC A;  3ZIJ A;  3EMX A;  2B1L A;  3DWV A;  4GF0 A;  2C3Q A;  3UOM A;  6GSX A;  3CXG A;  1UA5 A;  2VOC A;  1IYI A;  4HU7 A;  4GQC A;  2GGT A;  2XBQ A;  2VCX A;  1AIU A;  2V2G A;  2YZU A;  2H0I A;  3HCZ A;  2WGR A;  3A2W A;  4IEL A;  1B48 A;  1M2A A;  2VLT A;  1S3C A;  3HDC A;  1SK1 A;  4DEJ A;  2VL2 A;  4JBB A;  2F51 A;  4DSS A;  3TB2 A;  2AHE A;  1Z7R A;  2LUS A;  2HZF A;  2VD1 A;  1GUM A;  5AN1 A;  2PVO C;  3D0Z A;  4GTU A;  2PN8 A;  3US3 A;  4ACS A;  4O92 A;  1JZD A;  5CRG A;  3HVX A;  4TR1 A;  4BL7 B;  5J3R A;  1T00 A;  4I2T A;  2OAD A;  3TUE A;  5HR2 A;  1O81 A;  4KND A;  4K6X A;  4GQF A;  1J9B A;  1GTB A;  3L9U A;  3BOA A;  1BJX A;  2O7K A;  5GZZ B;  2YPM A;  2HE3 A;  1YF0 A;  2JAC A;  4L0U A;  1OE7 A;  1SL0 B;  3OR5 A;  3HJO A;  3QMX A;  5AGY A;  2IWT A;  2C80 A;  2HYX A;  4MAB A;  3RHB A;  2RM6 A;  4L0W A;  4XTS A;  2IN3 A;  3G9B A;  2E2G A;  1XBS A;  1GUK A;  4E8H A;  4POM A;  4IBP A;  2I81 A;  3GHA A;  5JCG A;  3BJ5 A;  3F6F A;  3GKM A;  5CYY A;  4Q5N A;  4F82 A;  1JZW A;  5B8A A;  4GSS A;  4PQH A;  3HVV A;  2E7P A;  1BYE A;  2RM5 A;  1TDI A;  2C0D A;  4MH3 A;  3GH9 A;  2JSZ A;  1USB A;  5CAX A;  5AIX A;  5EPF A;  3FR6 A;  5DJM A;  6GSW A;  3F8U A;  1GRX A;  1YKA A;  3A3T A;  4MCU A;  1K0D A;  1EOG A;  2FUG 2;  2JL4 A;  3UMA A;  4POB A;  2HRK B;  1YJ6 A;  1SKR B;  4OO5 A;  1Y25 A;  3TRP A;  1TRW A;  3H79 A;  1PA3 A;  4ZB8 A;  1EV9 A;  4KGI A;  4TN8 A;  2VL9 A;  4HQZ A;  2NBS A;  4OCE A;  2GLR A;  1PRX A;  3M8N A;  2XPE A;  4PUR A;  4FYU A;  5DDL A;  3GUR A;  4WEY A;  3Q19 A;  3M9J A;  1GSE A;  5AIV A;  2AUV A;  4O5R A;  5A4U A;  2IMF A;  1M9B A;  5CRH A;  2K9F A;  4N11 A;  2HSY A;  2GSQ A;  4EXJ A;  4GCI A;  4NHZ A;  4GST A;  5CP1 A;  3HJP A;  3VI5 A;  4K0G A;  1ZZY A;  2B5Y A;  4WF5 A;  4MZB A;  2HZE A;  3UAR A;  1Z6N A;  1F6M C;  3EU4 A;  4KCE A;  6GSY A;  4G0L A;  1PX6 A;  1RK4 A;  2JZS A;  5KN2 A;  1AC1 A;  3I6A A;  17GS A;  2C0G A;  3L9V A;  1Q98 A;  2VIM A;  2O89 A;  2OBK A;  3D4T A;  3QD9 A;  3UL3 A;  2VL2 C;  13GS A;  20GS A;  1YZX A;  1HNA A;  4GRF A;  3EU3 A;  1GL8 A;  2IPA A;  2F8F A;  4XCS A;  4BVY A;  2FHE A;  2VAF A;  1SJI A;  1X9M B;  10GS A;  2DJ0 A;  4JED A;  5DAL A;  5HR1 A;  1GSF A;  5F06 A;  3RBT A;  2CT6 A;  3M3M A;  3TKQ A;  4TR1 B;  2H71 A;  1F37 A;  1EGR A;  1NSW A;  4KSO A;  1Z7P A;  2IMK A;  3GL5 A;  2ZUP A;  2B3S A;  2YJH A;  2EIR A;  2D2Z A;  5IO0 A;  2DBC A;  3WT1 A;  4MA9 A;  2QGV A;  2H6X A;  3QAW A;  3EVI A;  2PBJ A;  2PU9 C;  2C0E A;  5J4U A;  4I8B A;  4ZBA A;  2P0G A;  1BAY A;  5DVB A;  3RPP A;  3TRX A;  4RI7 A;  4IS0 A;  4EL1 A;  2OBI A;  4KW6 A;  1GNW A;  3F3R A;  2WRT A;  4IVF A;  1U3I A;  5B6N A;  4ZL9 A;  5KN0 A;  4HU9 A;  1TTZ A;  3H4K A;  5IMD A;  2EC4 A;  5ECI B;  2HXK A;  1XWC A;  3S9F A;  3W6G A;  1GSU A;  3F63 A;  1G7O A;  4TXV A;  1FG4 A;  2DIY A;  5ID2 B;  12GS A;  3P7X A;  4TKY A;  1FHE A;  1TXX A;  5LNK e;  1JFU A;  3DYR A;  5IMC A;  4RQR A;  2LKU A;  4V2L A;  2H75 A;  3W8J A;  3KTL A;  4NWY A;  1XW5 A;  2DJ3 A;  4QL7 A;  1MDK A;  3RDW A;  3QOU A;  3I43 A;  4YQU A;  5LCZ A;  2X8G A;  2WS2 A;  2B5X A;  1R26 A;  4IKH A;  3DGQ A;  3ZFB A;  5A4V A;  1UN2 A;  4BL7 A;  5F8B A;  4BWQ A;  3GA4 A;  4TR3 A;  2H01 A;  2KOK A;  4KDU A;  4HQS A;  1NM3 A;  4YAP A;  2VCW A;  2R6K A;  1SKS B;  2MBS A;  4Q5F A;  3IE3 A;  2HT9 A;  1AXD A;  4IJI A;  1ERU A;  2IFQ A;  6GSU A;  1EEJ A;  2LNS A;  2KLX A;  3LG6 A;  3QFA C;  1WE0 A;  1QMV A;  2QC7 A;  1GSS A;  1E6B A;  2LV3 A;  5DBQ A;  2HZE B;  1DE2 A;  1K3Y A;  2OE0 A;  3LWA A;  2OE3 A;  3D22 A;  2GVP A;  2YV7 A;  3GIX A;  5G5F A;  3APQ A;  1ACV A;  1ERT A;  3D21 A;  2L57 A;  2H6Z A;  5D9T A;  4F0B A;  2JSY A;  1OE8 A;  2A2S A;  4RUV A;  2GQM A;  2B5E A;  2HLS A;  1X5D A;  3TJB A;  8GSS A;  4BVY B;  3KD0 A;  4ZL7 A;  2I3Y A;  1OC8 A;  4DVC A;  3VFI A;  5DAL B;  2K8S A;  1SL2 B;  1WWJ A;  3A2V A;  3UBL A;  3ZVJ A;  5IM9 A;  3UIW A;  4KCA A;  3ZLP A;  2GZY A;  2HRK A;  1A2J A;  2ES7 A;  14GS A;  2LST A;  1B9Y C;  3IAM 2;  1TKD B;  3K8N A;  1X5C A;  2GSS A;  3TOT A;  4MJA A;  3F4R A;  1OKD A;  4G0I A;  3FKF A;  2B1K A;  1H75 A;  1R5P A;  3KXO A;  3BBY A;  1M0U A;  3TJJ A;  1GNE A;  2B7J A;  3LGC A;  5B6M A;  2XBI A;  5DCH A;  5HR0 A;  1G0T A;  4PQI A;  2ON7 A;  1F3A A;  5COH A;  3HKR A;  2DMM A;  2E0Q A;  2HRN A;  4I5Q A;  4AF2 A;  3ZIV A;  2C3T A;  3UVT A;  1EWX A;  5IMV A;  1XXU A;  4ISD A;  3HZ8 A;  2CZ2 A;  4ZB6 A;  3D4M A;  2H1D A;  2N5A A;  1GH2 A;  4CW9 A;  4GXZ A;  2CAQ A;  4OD7 A;  1U3A A;  1T4Z A;  1MDJ A;  5D9W A;  5J5N A;  5H5S A;  2AYT A;  2LQQ A;  2DJK A;  1VF2 A;  1XFL A;  1OC9 B;  1BED A;  1B8X A;  3QDN A;  2WJU A;  1WMJ A;  3DIE A;  2MBT A;  3GN3 A;  1G7E A;  2ZNM A;  4EC0 A;  2ZCT A;  5H5Q A;  3KH9 A;  3KZQ A;  3CRU A;  2IIY A;  1AAZ A;  1TU7 A;  1MD3 A;  5ECK B;  2X64 A;  3BD2 A;  4ZIJ A;  4ML6 A;  2FD3 A;  5E59 A;  4ID0 A;  1K3O A;  4EDZ A;  3R3E A;  4OFT A;  2L4Q A;  1PMT A;  1C72 A;  1QFN A;  1N2A A;  1NHY A;  3GUS A;  2L59 A;  3LFL A;  2HI7 A;  3MWH A;  2C0F A;  5D9V A;  6GSV A;  3L9S A;  4XHM A;  5H5R A;  4ILF A;  3RHC A;  1U87 A;  2PVQ A;  3TRQ A;  4PNG A;  4J2F A;  2EIO A;  3O3T A;  4HJ2 A;  2K6V A;  3RPN A;  4TR4 A;  5DQY A;  1HNC A;  1HD2 A;  1Z5Y E;  3FRC A;  2IFQ B;  2YWO A;  1ILO A;  3IC4 A;  3LSZ A;  1XWK A;  3KTB A;  4USS A;  4K9Z A;  2YV9 A;  4ECJ A;  3KJY A;  2Z9S A;  4CDO A;  3TKR A;  4WKW A;  3SBC A;  5JWR B;  2IL3 A;  3F6D A;  4FYB A;  4RI6 A;  1QGV A;  1FAA A;  1QK8 A;  2LQO A;  3FEU A;  4MDC A;  5KEJ A;  5B8B A;  5ECQ B;  3IBH A;  4V1A g;  1GSD A;  1OC3 A;  5ID2 A;  1VF1 A;  4AGS A;  2G0F A;  4EVM A;  4LMW A;  1LJR A;  5ENU A;  5ECO B;  5A4W A;  2HSM A;  3DVW A;  4LMV A;  3VUR A;  2RII A;  1M7T A;  1GTU A;  3QAG A;  2OJL A;  4YAV A;  3MDK A;  5F05 A;  1J0F A;  3TJG A;  1K0B A;  4HZ2 A;  4F2I A;  5KN3 A;  1ZCP A;  4HDE A;  1OAZ A;  1EP7 A;  3U6V A;  2RLI A;  2DLX A;  3P2A A;  4G2E A;  1NW2 A;  1K0A A;  4N0V A;  2WB9 A;  2IME A;  3HXS A;  3PIN A;  2CV4 A;  1XW6 A;  5D8I A;  2AB6 A;  2AV4 A;  4HJM A;  1PL1 A;  2ON5 A;  1JLW A;  1XCC A;  3WYW A;  2MZC A;  3CMI A;  3M0F A;  3APS A;  2H73 A;  1SYR A;  1X9W B;  2H74 A;  2LJK A;  3BCI A;  1CQH A;  2LTK A;  5G1K A;  4IQ1 A;  4K2D A;  2HNL A;  4WXT A;  1V57 A;  2F9S A;  1XPV A;  2I1U A;  1GP1 A;  2YP6 A;  2H70 A;  3ZMK A;  4N10 A;  3L78 A;  1MEK A;  2PGT A;  1PD2 1;  3ERG A;  1I5G A;  4ZL8 A; 
#chains in the Genus database with same CATH topology
 1OYJ A;  1SEN A;  5BRT A;  5ECM B;  2VO4 A;  2F8A A;  1PGT A;  1BG1 A;  2UZ8 A;  4IGJ A;  4K0N A;  2YNX A;  3TCO A;  5EVO A;  4FH8 A;  2OT3 A;  1SK2 A;  4EIP A;  1ZOF A;  5JCW A;  2LJA A;  1O85 A;  1BF5 A;  2BJX A;  3EIN A;  3UJ1 A;  2C8U A;  9GSS A;  1S3D A;  1YKC A;  5HR3 A;  4ECC A;  4TVE A;  5KN1 A;  3RAZ A;  1E2Y A;  3IAS 2;  4MP4 A;  1TI1 A;  2HSN A;  4G10 A;  3UVH A;  4PNF A;  3I69 A;  2PWJ A;  1W89 A;  3GL3 A;  4KH7 A;  4PTS A;  5FT3 A;  3NZN A;  4PX1 A;  5B7C A;  3E0U A;  4K5S A;  2V6O A;  4V1A p;  1MTC A;  3CSH A;  4O32 A;  1R5A A;  1THX A;  4XS1 A;  2I4A A;  4KF9 A;  4BIK A;  4I6X A;  1M99 A;  3HJM A;  1W4V A;  4MNN A;  4EUY A;  3BCK A;  3ZFL A;  3GMF A;  3D6I A;  1AW9 A;  4Z2U A;  4K7N A;  2H19 A;  4AJ6 A;  3IHQ A;  2WCI A;  4XRD A;  4OFM A;  2C3N A;  3GKX A;  3QFB C;  1TRV A;  1KBN A;  4DSQ A;  1PFO A;  1SJZ A;  1K0O A;  4ECI A;  3C1S A;  3IRA A;  2L6C A;  4KDX A;  1A2L A;  3ZRE A;  1WJK A;  1AQV A;  4GSN A;  4X43 A;  3DEX A;  3IK7 A;  1TP9 A;  2M80 A;  3FZ5 A;  3O6T A;  1BG5 A;  4XS6 A;  3CSI A;  3CHX C;  1Z6M A;  3H1N A;  1K0N A;  3NIV A;  2KHP A;  4TOP A;  3MNG A;  3WGX A;  4P3Y B;  4A5P A;  5D93 A;  3KM6 A;  2L5O A;  4OWY A;  3DKS A;  1EZK A;  3HZ4 A;  3PPU A;  5C04 A;  3QAV A;  2LRT A;  3CRT A;  2H30 A;  2VL3 A;  1OC9 A;  4JR6 A;  5F07 A;  1TW9 A;  1UVZ A;  1Z9H A;  3ISO A;  3Q18 A;  4IJ3 A;  2V32 A;  4WET A;  5J41 A;  2HSM B;  2RUE A;  3A2X A;  2DSA A;  3TDG A;  2PMT A;  3EE2 A;  2V6K A;  1DBY A;  1G6W A;  4QL9 A;  4FIW A;  2HQT A;  3IK9 A;  1A8L A;  5G1L A;  4OO4 A;  3L0H A;  4F9Z A;  4PGT A;  3F9U A;  2YWI A;  4XS4 B;  4OFN A;  4TW5 A;  3P90 A;  2JU5 A;  4K7I A;  4ULX A;  2M46 A;  2VCQ A;  4HI7 A;  3CYN A;  3E3E A;  2H72 A;  5A34 A;  4HS1 A;  4KSM A;  1GTI A;  3SWL A;  2VUP A;  5J9C A;  1XW9 A;  1T7P B;  3CTF A;  4ZXG A;  4AJ8 A;  3N5O A;  3QR6 A;  4WR4 A;  3KCM A;  3H8Q A;  4NMU A;  3ZL5 A;  4PXO A;  2FLS A;  4V2N A;  5ELG A;  3GRX A;  2FWF A;  3HY2 A;  2B7K A;  1GUL A;  1ZYQ B;  3LXZ A;  2GQL A;  2MMZ A;  4MPG A;  1F3B A;  4G19 A;  5G5E A;  2H1B A;  1YEP A;  5IIZ A;  1A24 A;  1O8X A;  5J4Y A;  2DKH A;  2DIZ A;  3MSZ A;  3VWU A;  2R4V A;  3KP8 A;  2VLV A;  1YQ1 A;  1CQG A;  2MMN A;  3FR3 A;  1RQM A;  3GFK A;  1A8Y A;  1KEB A;  1O8W A;  1RW1 A;  3G7J A;  2ALB A;  5IOX A;  4XRA A;  1PKW A;  3WD6 A;  2FWE A;  1HNB A;  4L5L A;  3ZZX A;  1EGO A;  3TKP A;  5IO2 A;  3CWG A;  2JZR A;  2P5Q A;  4ZBD A;  1O7U A;  1LBK A;  3E9J B;  2DJ1 A;  3HYP A;  3WGD A;  2HSN B;  3EUR A;  4PQ1 A;  4NXI A;  1AUC A;  1K0C A;  1YVL A;  4BVX A;  2L4C A;  3F0I A;  3DXB A;  2IMI A;  1FW1 A;  4FQU A;  3DVX A;  1TRS A;  4KE3 A;  3WGE A;  2WDU A;  2FNO A;  3TJK A;  2X8H A;  1PN9 A;  2H66 A;  1TK5 B;  1GWC A;  2VKZ G;  5HQP A;  4MPF A;  1T3B A;  1U88 A;  5J9B A;  3A5I A;  1GTA A;  4BWS A;  3FYG A;  2C4J A;  1X5E A;  2YWN A;  5BMU A;  5J4V A;  4QMK A;  1WP0 A;  3P8W A;  2XHF A;  2WW2 A;  4FO5 A;  5IPH A;  5JWO B;  5CRW A;  2GZZ A;  3J7Y k;  4MK3 A;  1ON4 A;  3EYT A;  1X9S B;  3LOR A;  4ZBB A;  3QCP A;  3PGT A;  2AJQ B;  4G01 A;  2K8V A;  5A5H A;  1GSQ A;  2MMA A;  4ICY A;  3ZYW A;  1TK8 B;  2RUF A;  2TIR A;  2GZP A;  2K18 A;  3UEM A;  2VCZ A;  1I9D A;  1XIY A;  3APO A;  4PUF C;  4IP1 A;  4DSR A;  1B4Q A;  5J47 A;  3FZ4 A;  2N5F A;  1GSY A;  1XWG A;  2GTU A;  2J9H A;  5L71 A;  1FO5 A;  5CO3 A;  1NHO A;  2R37 A;  3C73 A;  4ZB7 A;  4CY8 A;  2VD0 A;  2FY6 A;  2VM1 A;  1EV4 A;  4NV5 A;  4YH2 A;  1YEX A;  3LYP A;  2LS5 A;  5DJL A;  2FCH A;  4PI0 C;  1ERV A;  2X99 A;  3ZRD A;  4BPY A;  1Y6E A;  3EWL A;  1B4P A;  1ZYP A;  1SK0 A;  3VLN A;  3GTU A;  5A34 B;  3ME7 A;  1JHB A;  3M9K A;  1VRS D;  2O8V B;  3VPT A;  1G6Y A;  1T1V A;  4JE1 A;  1FOV A;  4O5U A;  3HVS A;  2O5V A;  1JLV A;  5ABR A;  2FGX A;  1EEM A;  3FW2 A;  3ERF A;  3TKS A;  1IYH A;  4WR5 A;  4L5O A;  4J57 E;  5DAK A;  3IV4 A;  5IOW A;  4EO3 A;  4ZB9 A;  1XG8 A;  2PPT A;  4KX4 A;  1BQ7 A;  3DRN A;  3IPZ A;  7GSS A;  3F3Q A;  3IXR A;  2H76 A;  2C1Y A;  2KP1 A;  4F03 A;  2H1G A;  5GAN D;  3EMP A;  3GV1 A;  1I1I P;  2REM A;  1N8J A;  4MLY A;  2CAI A;  2A2R A;  3KMO A;  3J7Y b;  4G0K A;  2TRC P;  1UC7 A;  2H6Y A;  3KIJ A;  2QSI A;  1YF1 A;  1VGL A;  3C1R A;  3FY7 A;  2QA1 A;  3GX0 A;  2YWM A;  3R2Q A;  4AI6 A;  5GST A;  4IP6 A;  2YJ7 A;  1YY7 A;  3ZTL A;  2H1A A;  1YDK A;  1GLQ A;  2L5L A;  1FB0 A;  2TRX A;  2VM2 A;  1A23 A;  1HYU A;  1ZGN A;  1SD9 A;  2LNT A;  1O73 A;  2OE1 A;  4BVX B;  2EIQ A;  1PL2 A;  3U5R E;  4MJB A;  1ABA A;  1LU4 A;  4EKZ A;  1F9M A;  3ZML A;  4LL4 B;  1M2B A;  3FK8 A;  3GYK A;  1X0R A;  2FA8 A;  1ERW A;  3WT2 A;  3MIX A;  2HRF A;  4KB3 A;  1K0M A;  3ZVJ D;  1J08 A;  2XPD A;  4JZQ A;  4XS4 A;  4MMM A;  1JZR A;  4N0Z A;  2OA7 A;  1XWB A;  2LEG A;  1T8E B;  3LXT A;  5A1N B;  3L4N A;  5JCU A;  3CTG A;  1U6T A;  1OKT A;  2DJ2 A;  3NOF A;  2CQ9 A;  4IHU A;  1SVM A;  1TU8 A;  1ZYE A;  3UAP A;  1THO A;  3ZIT A;  1Q4J A;  3VI7 A;  2QKE A;  1S3R A;  1TOF A;  2WUL A;  3VWX A;  4Q5Q A;  2VCV A;  3FHK A;  1DSB A;  3IA1 A;  3RFR C;  5HFI A;  3CBU A;  1TRU A;  5CRD A;  2B6M A;  5IMF A;  2WVZ A;  3JCM L;  2FA4 A;  1EP8 A;  4H86 A;  2A2P A;  1FVJ A;  3GST A;  4D73 B;  2NVL A;  1QUW A;  4KAE A;  3KEB A;  3C7M A;  2CVD A;  4ECB A;  5DCG A;  3HHV A;  4F0C A;  3PH9 A;  3ERW A;  4ML1 A;  3IC8 A;  3G7Y A;  2IMD A;  5AIS A;  2H0H A;  4Z2T A;  2YAN A;  18GS A;  3TOU A;  4WF4 A;  4LLR A;  3TJF A;  2LRN A;  4JRR A;  2GS3 A;  1WRY A;  3I9V 2;  4AJ7 A;  2J23 A;  3DD3 A;  5D73 A;  1FVK A;  2N5B A;  5ECH B;  2DML A;  2H8L A;  1VF3 A;  2CX3 A;  1AQW A;  3LW9 A;  2I9H A;  2DJJ A;  4YQV A;  1PX7 A;  5EY6 A;  2NDO A;  3FZA A;  3F4S A;  3GKN A;  4BA7 A;  2P5R A;  4EE0 A;  1GUH A;  3IR4 A;  3GTU B;  2X8C A;  3GNJ A;  1XOB A;  4NPB A;  5ELA A;  1ZL9 A;  4NAX A;  4QQ7 A;  6GSS A;  3GX8 A;  3C8E A;  2AAW A;  3N9J A;  3V1W A;  4DSS B;  1R4W A;  2HRA A;  3TKS C;  1BX9 A;  4X4J A;  4I97 A;  3IOS A;  4ZIL A;  4HUA A;  3HVN A;  3VWV A;  5ECP B;  4OMV A;  2V1M A;  1VF4 A;  2E2M A;  1A0F A;  4KUN A;  11GS A;  4NHW A;  3KP9 A;  4TRX A;  5DAK B;  2M72 A;  3LEF A;  5HFG A;  5IPG A;  2X49 A;  2VLU A;  1WIK A;  1V98 A;  3Q6O A;  2FWH A;  1Z3E A;  2R5G A;  4YQM A;  5CNW A;  4GWR A;  1URM A;  2BTO T;  5CRE A;  4HOJ A;  2MMO A;  1SJ6 A;  4TXO A;  2P31 A;  1A2M A;  1ZMA A;  3MAK A;  5D96 A;  1QQ2 A;  1WPI A;  4KDY A;  4TR0 A;  3GSS A;  4Z7X A;  3H93 A;  1R7H A;  2L6D A;  2OAC A;  5FWG A;  2WZ9 A;  19GS A;  4LA1 A;  4CHS A;  3ME8 A;  1SU9 A;  1A0R P;  4EF0 A;  5DQS A;  2YOI A;  3TU3 B;  4Z2R A;  3O76 A;  2FWG A;  2V41 A;  4KA0 A;  1JZO A;  5G30 A;  1SD8 A;  4N30 A;  3W8S A;  2CX4 A;  1PSQ A;  2F3M A;  2MYG A;  2VCT A;  2H0G A;  3A5W A;  1MD4 A;  1EOH A;  4MZW A;  2OKA A;  5IMZ A;  1ZYN A;  2DC5 A;  4POL A;  4X1U A;  4RQX A;  5EL8 A;  4K1F A;  2LJR A;  4OCF A;  4MF7 A;  5INY A;  5IQY A;  3UBK A;  4WBJ A;  1F2E A;  2YN1 A;  4LL1 B;  1XVQ A;  5LD0 A;  1MDI A;  5J40 A;  1V58 A;  4NV2 A;  3LQ7 A;  16GS A;  1QXH A;  5G2Z A;  1GLP A;  1PKZ A;  2CVB A;  2O85 A;  2R2J A;  4J56 E;  1PQN A;  4I2U A;  1XVW A;  5ECS A;  5D9X A;  1B9X C;  1O6J A;  4HEA 2;  4K8M A;  3G7I A;  2HSH A;  3VK9 A;  4IQA A;  4MF6 A;  5G31 A;  1AQX A;  3TGZ A;  4K7O A;  3KMN A;  2GT6 A;  2GQK A;  4FYC A;  4MZC A;  1M9A A;  3KGK A;  3VPQ A;  5JWQ B;  3IDV A;  3D5J A;  3GKK A;  2G2Q A;  2WFC A;  2KP2 A;  4MJC A;  5C00 A;  3GH6 A;  3LJR A;  5F0G A;  1WOU A;  1KNG A;  4JU5 A;  4AKG A;  3DML A;  4MJE A;  4X0X A;  3PR8 A;  4WBR D;  5E4W A;  3Q74 A;  4PUA A;  1V2A A;  5ECN B;  2CZ3 A;  3KH7 A;  1TJD A;  5FHI A;  2A4V A;  2CA8 A;  4IN0 A;  1SL1 B;  2EFC A;  5GAP D;  1S3A A;  1M3I A;  3VWW A;  1DUG A;  2XC2 A;  1FB6 A;  3HA9 A;  3CSJ A;  2BMX A;  4MF5 A;  2GST A;  3HD5 A;  1XZO A;  1M2D A;  22GS A;  2JAD A;  4Q5R A;  3LYK A;  3FZ9 A;  1V40 A;  4E8E A;  3C71 A;  5ECR B;  5HFK A;  4AKH A;  1H4O A;  4GLT A;  4E68 A;  5GSS A;  4IW9 A;  1XOA A;  2PER A;  5A1N A;  3FR9 A;  1TK0 B;  4L8E A;  2R3X A;  4V2M A;  1ST9 A;  5A5K A;  2YCD A;  4MH2 A;  1V9W A;  3EC3 A;  4HZ4 A;  5ECL B;  1SKW B;  2JZT A;  3QPM A;  4TXO B;  5IMA A;  4O7H A;  2YZH A;  1HQO A;  1TI3 A;  2GSR A;  2GDR A;  4XIH A;  2O87 A;  1T4Y A;  2PUK C;  1XWA A;  4AKX B;  3ED3 A;  4D73 A;  2IJY A;  1DE1 A;  6GST A;  3F4T A;  1TXU A;  4JR4 A;  3AY8 A;  2GT5 A;  3M1G A;  1OVN A;  4POK A;  4EDY A;  1ML6 A;  1SYX A;  2CVK A;  5KOW A;  1K3L A;  3TKS E;  2LRC A;  1KTE A;  4G9H A;  2NPB A;  2HFD A;  2NTO A;  2KUC A;  3ZIJ A;  1YEW C;  3EMX A;  4PHZ C;  4K2X A;  2B1L A;  3DWV A;  1N25 A;  4GF0 A;  2C3Q A;  3UOM A;  6GSX A;  3CXG A;  1UA5 A;  2VOC A;  1IYI A;  4HU7 A;  4GQC A;  2GGT A;  2XBQ A;  2VCX A;  1AIU A;  2V2G A;  2YZU A;  2H0I A;  3HCZ A;  2WGR A;  3A2W A;  4IEL A;  1B48 A;  1M2A A;  2VLT A;  1S3C A;  1SVO A;  3HDC A;  1SK1 A;  4DEJ A;  4YKF A;  2VL2 A;  4JBB A;  2F51 A;  4DSS A;  3TB2 A;  2AHE A;  1Z7R A;  2LUS A;  2HZF A;  2VD1 A;  1GUM A;  5AN1 A;  2PVO C;  3D0Z A;  4GTU A;  1SVL A;  2PN8 A;  3US3 A;  4ACS A;  4O92 A;  1JZD A;  5CRG A;  3HVX A;  4TR1 A;  4BL7 B;  5J3R A;  1T00 A;  4I2T A;  2OAD A;  3TUE A;  5HR2 A;  1O81 A;  4KND A;  4K6X A;  4GQF A;  2O36 A;  1J9B A;  1GTB A;  3L9U A;  3BOA A;  1BJX A;  2O7K A;  5GZZ B;  2YPM A;  2HE3 A;  1YF0 A;  2JAC A;  4L0U A;  1OE7 A;  4CY6 A;  1SL0 B;  3OR5 A;  1FOH A;  3HJO A;  4GDF A;  3QMX A;  5AGY A;  2IWT A;  2C80 A;  2HYX A;  4MAB A;  3RHB A;  2RM6 A;  4L0W A;  4XTS A;  2IN3 A;  3G9B A;  2E2G A;  1XBS A;  1GUK A;  4E8H A;  4POM A;  4IBP A;  2I81 A;  3GHA A;  2WW3 A;  5JCG A;  3BJ5 A;  3F6F A;  3GKM A;  5CYY A;  4Q5N A;  4F82 A;  1JZW A;  5B8A A;  1M3J A;  4GSS A;  4PQH A;  3HVV A;  2E7P A;  1BYE A;  2RM5 A;  1TDI A;  2C0D A;  4MH3 A;  3EPT A;  3GH9 A;  2JSZ A;  1USB A;  5CAX A;  5AIX A;  5EPF A;  3FR6 A;  5DJM A;  6GSW A;  3F8U A;  1GRX A;  1YKA A;  3A3T A;  4MCU A;  1K0D A;  1EOG A;  2FUG 2;  2JL4 A;  3UMA A;  4POB A;  2HRK B;  1YJ6 A;  1SKR B;  4OO5 A;  1Y25 A;  3TRP A;  1TRW A;  3H79 A;  1PA3 A;  4ZB8 A;  1EV9 A;  4KGI A;  4TN8 A;  2VL9 A;  5KOX A;  4HQZ A;  2NBS A;  4OCE A;  2GLR A;  1PRX A;  3M8N A;  2XPE A;  4PUR A;  4FYU A;  5DDL A;  2WW1 A;  3GUR A;  4WEY A;  3Q19 A;  3M9J A;  1GSE A;  5AIV A;  2AUV A;  4O5R A;  5A4U A;  2IMF A;  1M9B A;  5CRH A;  2K9F A;  4N11 A;  4EIQ A;  2HSY A;  2GSQ A;  4EXJ A;  4GCI A;  2EFE A;  4NHZ A;  4GST A;  2DKI A;  5CP1 A;  3HJP A;  3VI5 A;  4K0G A;  1ZZY A;  2B5Y A;  4WF5 A;  4MZB A;  2HZE A;  3UAR A;  1Z6N A;  1F6M C;  3EU4 A;  4KCE A;  6GSY A;  4G0L A;  1PX6 A;  1RK4 A;  2JZS A;  5KN2 A;  1AC1 A;  3I6A A;  17GS A;  2C0G A;  3L9V A;  1Q98 A;  2VIM A;  2O89 A;  2OBK A;  3D4T A;  3QD9 A;  3UL3 A;  2VL2 C;  13GS A;  20GS A;  1YZX A;  1HNA A;  4GRF A;  3EU3 A;  1GL8 A;  2IPA A;  2F8F A;  4XCS A;  4BVY A;  2FHE A;  2VAF A;  1SJI A;  1X9M B;  10GS A;  2DJ0 A;  4JED A;  5DAL A;  2WVX B;  5HR1 A;  2EFD A;  1GSF A;  5F06 A;  3RBT A;  2CT6 A;  3M3M A;  3TKQ A;  4TR1 B;  2H71 A;  1F37 A;  1EGR A;  1NSW A;  4KSO A;  1Z7P A;  2IMK A;  3GL5 A;  2ZUP A;  2B3S A;  2YJH A;  2EIR A;  2WVY A;  2D2Z A;  5IO0 A;  2DBC A;  3WT1 A;  4MA9 A;  2QGV A;  2H6X A;  3QAW A;  3EVI A;  2H1L A;  2PBJ A;  2PU9 C;  2C0E A;  5J4U A;  4I8B A;  4YKG A;  4ZBA A;  2P0G A;  1BAY A;  5DVB A;  3RPP A;  3TRX A;  4RI7 A;  4IS0 A;  4EL1 A;  2OBI A;  4KW6 A;  1GNW A;  3F3R A;  2WRT A;  4IVF A;  1U3I A;  5B6N A;  4ZL9 A;  5KN0 A;  4HU9 A;  1TTZ A;  3H4K A;  5IMD A;  2EC4 A;  5ECI B;  2HXK A;  1XWC A;  3S9F A;  3W6G A;  2WW0 A;  1GSU A;  3F63 A;  1G7O A;  4TXV A;  1FG4 A;  2DIY A;  5ID2 B;  12GS A;  3P7X A;  4TKY A;  1FHE A;  1TXX A;  4N3Z A;  5LNK e;  1JFU A;  3DYR A;  5IMC A;  4RQR A;  2LKU A;  4V2L A;  2H75 A;  3W8J A;  3KTL A;  4NWY A;  1XW5 A;  2DJ3 A;  4QL7 A;  1MDK A;  4PI2 C;  3RDW A;  3QOU A;  3I43 A;  4YQU A;  5LCZ A;  4FXY P;  2X8G A;  2WS2 A;  2B5X A;  1R26 A;  4IKH A;  3DGQ A;  3ZFB A;  5A4V A;  1UN2 A;  4BL7 A;  5F8B A;  4BWQ A;  3GA4 A;  1PN0 A;  4TR3 A;  2H01 A;  2KOK A;  4KDU A;  2QA2 A;  4HQS A;  1NM3 A;  4YAP A;  2VCW A;  2R6K A;  1SKS B;  2MBS A;  4Q5F A;  3IE3 A;  2HT9 A;  1AXD A;  4IJI A;  1ERU A;  2IFQ A;  6GSU A;  1EEJ A;  2LNS A;  2KLX A;  3LG6 A;  3QFA C;  1WE0 A;  1QMV A;  2QC7 A;  1GSS A;  1E6B A;  2LV3 A;  5DBQ A;  2HZE B;  1DE2 A;  1K3Y A;  2OE0 A;  4K5R A;  3LWA A;  2OE3 A;  3D22 A;  2GVP A;  2YV7 A;  3GIX A;  5G5F A;  3APQ A;  1ACV A;  1ERT A;  3D21 A;  2L57 A;  2H6Z A;  5D9T A;  1Y1U A;  4F0B A;  2JSY A;  1OE8 A;  2A2S A;  4RUV A;  2GQM A;  2B5E A;  2HLS A;  1X5D A;  3TJB A;  8GSS A;  4BVY B;  3KD0 A;  3FMW A;  4ZL7 A;  2I3Y A;  1OC8 A;  4DVC A;  4O5Q A;  3VFI A;  5DAL B;  2K8S A;  3CQF A;  1SL2 B;  4W66 A;  1WWJ A;  3A2V A;  3RGB C;  3UBL A;  3ZVJ A;  4AKI A;  5IM9 A;  3UIW A;  4KCA A;  3ZLP A;  2GZY A;  2HRK A;  1A2J A;  2ES7 A;  14GS A;  2LST A;  1B9Y C;  3IAM 2;  1TKD B;  3K8N A;  1X5C A;  2EFH A;  2R0C A;  2GSS A;  3TOT A;  4MJA A;  3F4R A;  1OKD A;  4G0I A;  3FKF A;  2B1K A;  1H75 A;  1R5P A;  3KXO A;  3BBY A;  1M0U A;  3TJJ A;  1GNE A;  2B7J A;  3LGC A;  5B6M A;  2XBI A;  5DCH A;  5HR0 A;  1G0T A;  4PQI A;  2ON7 A;  1F3A A;  5COH A;  3HKR A;  2DMM A;  2E0Q A;  2HRN A;  4I5Q A;  4AF2 A;  3ZIV A;  2C3T A;  3UVT A;  1EWX A;  5IMV A;  1XXU A;  4ISD A;  3HZ8 A;  2CZ2 A;  4ZB6 A;  3D4M A;  2H1D A;  2N5A A;  1GH2 A;  4CW9 A;  4GXZ A;  2CAQ A;  2UV8 G;  4OD7 A;  1U3A A;  1T4Z A;  1MDJ A;  5D9W A;  5J5N A;  5H5S A;  2AYT A;  2LQQ A;  2DJK A;  1VF2 A;  1XFL A;  1OC9 B;  1BED A;  1B8X A;  3QDN A;  2WJU A;  1WMJ A;  3DIE A;  2MBT A;  3GN3 A;  1G7E A;  2ZNM A;  4EC0 A;  2ZCT A;  5H5Q A;  3KH9 A;  2WZS A;  3KZQ A;  3CRU A;  2IIY A;  1AAZ A;  1TU7 A;  1MD3 A;  5ECK B;  2X64 A;  3BD2 A;  4ZIJ A;  4ML6 A;  2FD3 A;  2R0G A;  5E59 A;  2R0P A;  4ID0 A;  1K3O A;  2WVX A;  4EDZ A;  3R3E A;  4OFT A;  2L4Q A;  1PMT A;  1C72 A;  1QFN A;  1N2A A;  1NHY A;  3GUS A;  2L59 A;  3LFL A;  2HI7 A;  3MWH A;  2C0F A;  5D9V A;  6GSV A;  3L9S A;  4XHM A;  2O3E A;  5H5R A;  4ILF A;  3RHC A;  1U87 A;  2PVQ A;  3TRQ A;  4PNG A;  2X4A A;  4J2F A;  2EIO A;  3O3T A;  4HJ2 A;  2K6V A;  3RPN A;  4TR4 A;  5DQY A;  1HNC A;  1HD2 A;  1Z5Y E;  3FRC A;  2IFQ B;  2YWO A;  1ILO A;  3IC4 A;  3LSZ A;  1XWK A;  3KTB A;  4USS A;  4K9Z A;  2YV9 A;  4ECJ A;  3KJY A;  2Z9S A;  4CDO A;  3TKR A;  4WKW A;  3SBC A;  5JWR B;  2IL3 A;  3F6D A;  4FYB A;  4RI6 A;  1QGV A;  1FAA A;  1QK8 A;  2LQO A;  3HMJ G;  3FEU A;  4MDC A;  5KEJ A;  5B8B A;  5ECQ B;  3IBH A;  4V1A g;  1GSD A;  1OC3 A;  5ID2 A;  1VF1 A;  4AGS A;  3IHG A;  2G0F A;  4EVM A;  4LMW A;  1LJR A;  5ENU A;  5ECO B;  5A4W A;  2HSM A;  3DVW A;  4LMV A;  3VUR A;  2RII A;  3MYD A;  1M7T A;  1GTU A;  3QAG A;  2OJL A;  4YAV A;  3MDK A;  5F05 A;  1J0F A;  3TJG A;  1K0B A;  4HZ2 A;  4F2I A;  5KN3 A;  1ZCP A;  4HDE A;  1OAZ A;  1EP7 A;  3U6V A;  2A4H A;  2RLI A;  2DLX A;  3P2A A;  4G2E A;  1NW2 A;  1K0A A;  4N0V A;  2WB9 A;  2IME A;  3HXS A;  3PIN A;  2CV4 A;  5BMU B;  1XW6 A;  5D8I A;  2AB6 A;  2AV4 A;  4HJM A;  1PL1 A;  2ON5 A;  1JLW A;  1XCC A;  3WYW A;  2MZC A;  3CMI A;  3M0F A;  3APS A;  2H73 A;  1SYR A;  1X9W B;  2H74 A;  2LJK A;  3BCI A;  1CQH A;  2LTK A;  5G1K A;  4IQ1 A;  4K2D A;  2HNL A;  1S4B P;  4WXT A;  1V57 A;  2F9S A;  1XPV A;  2I1U A;  1GP1 A;  2YP6 A;  5A5H B;  4HSC X;  2H70 A;  3ZMK A;  4N10 A;  3L78 A;  1MEK A;  2PGT A;  1PD2 1;  3ERG A;  1I5G A;  4ZL8 A; 
#chains in the Genus database with same CATH homology
 1OYJ A;  1SEN A;  5BRT A;  5ECM B;  2VO4 A;  2F8A A;  1PGT A;  1BG1 A;  2UZ8 A;  4IGJ A;  4K0N A;  2YNX A;  3TCO A;  5EVO A;  4FH8 A;  2OT3 A;  1SK2 A;  4EIP A;  1ZOF A;  5JCW A;  2LJA A;  1O85 A;  1BF5 A;  2BJX A;  3EIN A;  3UJ1 A;  2C8U A;  9GSS A;  1S3D A;  1YKC A;  5HR3 A;  4ECC A;  4TVE A;  5KN1 A;  3RAZ A;  1E2Y A;  3IAS 2;  4MP4 A;  1TI1 A;  2HSN A;  4G10 A;  3UVH A;  4PNF A;  3I69 A;  2PWJ A;  1W89 A;  3GL3 A;  4KH7 A;  4PTS A;  5FT3 A;  3NZN A;  4PX1 A;  5B7C A;  3E0U A;  4K5S A;  2V6O A;  4V1A p;  1MTC A;  3CSH A;  4O32 A;  1R5A A;  1THX A;  4XS1 A;  2I4A A;  4KF9 A;  4I6X A;  1M99 A;  3HJM A;  1W4V A;  4MNN A;  4EUY A;  3BCK A;  3ZFL A;  3GMF A;  3D6I A;  1AW9 A;  4Z2U A;  4K7N A;  2H19 A;  4AJ6 A;  3IHQ A;  2WCI A;  4XRD A;  4OFM A;  2C3N A;  3GKX A;  3QFB C;  1TRV A;  1KBN A;  4DSQ A;  1SJZ A;  1K0O A;  4ECI A;  3C1S A;  3IRA A;  2L6C A;  4KDX A;  1A2L A;  3ZRE A;  1WJK A;  1AQV A;  4GSN A;  4X43 A;  3DEX A;  3IK7 A;  1TP9 A;  2M80 A;  3FZ5 A;  3O6T A;  1BG5 A;  4XS6 A;  3CSI A;  1Z6M A;  3H1N A;  1K0N A;  3NIV A;  2KHP A;  4TOP A;  3MNG A;  3WGX A;  4P3Y B;  4A5P A;  5D93 A;  3KM6 A;  2L5O A;  4OWY A;  3DKS A;  1EZK A;  3HZ4 A;  3PPU A;  5C04 A;  3QAV A;  2LRT A;  3CRT A;  2H30 A;  2VL3 A;  1OC9 A;  4JR6 A;  5F07 A;  1TW9 A;  1UVZ A;  1Z9H A;  3ISO A;  3Q18 A;  4IJ3 A;  2V32 A;  4WET A;  5J41 A;  2HSM B;  2RUE A;  3A2X A;  2DSA A;  3TDG A;  2PMT A;  2V6K A;  3EE2 A;  1DBY A;  1G6W A;  4QL9 A;  4FIW A;  2HQT A;  3IK9 A;  1A8L A;  5G1L A;  4OO4 A;  3L0H A;  4F9Z A;  4PGT A;  3F9U A;  2YWI A;  4XS4 B;  4OFN A;  4TW5 A;  3P90 A;  2JU5 A;  4K7I A;  4ULX A;  2M46 A;  2VCQ A;  4HI7 A;  3CYN A;  3E3E A;  2H72 A;  5A34 A;  4HS1 A;  4KSM A;  1GTI A;  3SWL A;  2VUP A;  5J9C A;  1XW9 A;  1T7P B;  3CTF A;  4ZXG A;  4AJ8 A;  3N5O A;  3QR6 A;  4WR4 A;  3KCM A;  3H8Q A;  4NMU A;  3ZL5 A;  4PXO A;  2FLS A;  4V2N A;  5ELG A;  3GRX A;  2FWF A;  3HY2 A;  2B7K A;  1GUL A;  1ZYQ B;  3LXZ A;  2GQL A;  2MMZ A;  4MPG A;  1F3B A;  4G19 A;  5G5E A;  2H1B A;  1YEP A;  5IIZ A;  1A24 A;  1O8X A;  5J4Y A;  2DKH A;  2DIZ A;  3MSZ A;  3VWU A;  2R4V A;  3KP8 A;  2VLV A;  1YQ1 A;  1CQG A;  2MMN A;  3FR3 A;  1RQM A;  3GFK A;  1A8Y A;  1KEB A;  1O8W A;  1RW1 A;  3G7J A;  2ALB A;  5IOX A;  4XRA A;  1PKW A;  3WD6 A;  2FWE A;  1HNB A;  4L5L A;  3ZZX A;  1EGO A;  3TKP A;  5IO2 A;  3CWG A;  2JZR A;  2P5Q A;  4ZBD A;  1O7U A;  1LBK A;  3E9J B;  2DJ1 A;  3HYP A;  3WGD A;  2HSN B;  3EUR A;  4PQ1 A;  4NXI A;  1AUC A;  1K0C A;  1YVL A;  4BVX A;  2L4C A;  3F0I A;  3DXB A;  2IMI A;  1FW1 A;  4FQU A;  3DVX A;  1TRS A;  4KE3 A;  3WGE A;  2WDU A;  2FNO A;  3TJK A;  2X8H A;  1PN9 A;  2H66 A;  1TK5 B;  1GWC A;  2VKZ G;  5HQP A;  4MPF A;  1T3B A;  1U88 A;  5J9B A;  3A5I A;  1GTA A;  4BWS A;  3FYG A;  2C4J A;  1X5E A;  2YWN A;  5BMU A;  5J4V A;  4QMK A;  1WP0 A;  3P8W A;  2XHF A;  4FO5 A;  5IPH A;  5JWO B;  5CRW A;  2GZZ A;  3J7Y k;  4MK3 A;  1ON4 A;  3EYT A;  1X9S B;  3LOR A;  4ZBB A;  3QCP A;  3PGT A;  2AJQ B;  4G01 A;  2K8V A;  5A5H A;  1GSQ A;  2MMA A;  4ICY A;  3ZYW A;  1TK8 B;  2RUF A;  2TIR A;  2GZP A;  2K18 A;  3UEM A;  2VCZ A;  1I9D A;  1XIY A;  3APO A;  4PUF C;  4IP1 A;  4DSR A;  1B4Q A;  5J47 A;  3FZ4 A;  2N5F A;  1GSY A;  1XWG A;  2GTU A;  2J9H A;  5L71 A;  1FO5 A;  5CO3 A;  1NHO A;  2R37 A;  3C73 A;  4ZB7 A;  4CY8 A;  2VD0 A;  2FY6 A;  2VM1 A;  1EV4 A;  4NV5 A;  4YH2 A;  1YEX A;  3LYP A;  2LS5 A;  5DJL A;  2FCH A;  1ERV A;  2X99 A;  3ZRD A;  4BPY A;  1Y6E A;  3EWL A;  1B4P A;  1ZYP A;  1SK0 A;  3VLN A;  3GTU A;  5A34 B;  3ME7 A;  1JHB A;  3M9K A;  1VRS D;  2O8V B;  3VPT A;  1G6Y A;  1T1V A;  4JE1 A;  1FOV A;  4O5U A;  3HVS A;  2O5V A;  1JLV A;  5ABR A;  2FGX A;  1EEM A;  3FW2 A;  3ERF A;  3TKS A;  1IYH A;  4WR5 A;  4L5O A;  4J57 E;  5DAK A;  3IV4 A;  5IOW A;  4EO3 A;  4ZB9 A;  2PPT A;  4KX4 A;  1BQ7 A;  3DRN A;  3IPZ A;  7GSS A;  3F3Q A;  3IXR A;  2H76 A;  2C1Y A;  2KP1 A;  4F03 A;  2H1G A;  5GAN D;  3EMP A;  3GV1 A;  2REM A;  1N8J A;  4MLY A;  2CAI A;  2A2R A;  3KMO A;  3J7Y b;  4G0K A;  2TRC P;  1UC7 A;  2H6Y A;  3KIJ A;  2QSI A;  1YF1 A;  1VGL A;  3C1R A;  3FY7 A;  2QA1 A;  3GX0 A;  2YWM A;  3R2Q A;  4AI6 A;  5GST A;  4IP6 A;  2YJ7 A;  1YY7 A;  3ZTL A;  2H1A A;  1YDK A;  1GLQ A;  2L5L A;  1FB0 A;  2TRX A;  2VM2 A;  1A23 A;  1HYU A;  1ZGN A;  1SD9 A;  2LNT A;  1O73 A;  2OE1 A;  4BVX B;  2EIQ A;  1PL2 A;  3U5R E;  4MJB A;  1ABA A;  1LU4 A;  4EKZ A;  1F9M A;  3ZML A;  4LL4 B;  1M2B A;  3FK8 A;  3GYK A;  1X0R A;  2FA8 A;  1ERW A;  3WT2 A;  3MIX A;  2HRF A;  4KB3 A;  1K0M A;  3ZVJ D;  1J08 A;  2XPD A;  4JZQ A;  4XS4 A;  4MMM A;  1JZR A;  4N0Z A;  2OA7 A;  1XWB A;  2LEG A;  1T8E B;  3LXT A;  5A1N B;  3L4N A;  5JCU A;  3CTG A;  1U6T A;  1OKT A;  2DJ2 A;  3NOF A;  2CQ9 A;  4IHU A;  1SVM A;  1TU8 A;  1ZYE A;  3UAP A;  1THO A;  3ZIT A;  1Q4J A;  3VI7 A;  2QKE A;  1TOF A;  2WUL A;  3VWX A;  4Q5Q A;  2VCV A;  3FHK A;  1DSB A;  3IA1 A;  5HFI A;  3CBU A;  1TRU A;  5CRD A;  2B6M A;  5IMF A;  3JCM L;  2FA4 A;  1EP8 A;  4H86 A;  2A2P A;  1FVJ A;  3GST A;  4D73 B;  2NVL A;  1QUW A;  4KAE A;  3KEB A;  3C7M A;  2CVD A;  4ECB A;  5DCG A;  3HHV A;  4F0C A;  3PH9 A;  3ERW A;  4ML1 A;  3IC8 A;  3G7Y A;  2IMD A;  5AIS A;  2H0H A;  4Z2T A;  2YAN A;  18GS A;  3TOU A;  4WF4 A;  4LLR A;  3TJF A;  2LRN A;  4JRR A;  2GS3 A;  1WRY A;  3I9V 2;  4AJ7 A;  2J23 A;  3DD3 A;  5D73 A;  1FVK A;  2N5B A;  5ECH B;  2DML A;  2H8L A;  1VF3 A;  2CX3 A;  1AQW A;  3LW9 A;  2I9H A;  2DJJ A;  4YQV A;  1PX7 A;  5EY6 A;  2NDO A;  3FZA A;  3F4S A;  3GKN A;  4BA7 A;  2P5R A;  4EE0 A;  1GUH A;  3IR4 A;  3GTU B;  2X8C A;  3GNJ A;  1XOB A;  4NPB A;  5ELA A;  1ZL9 A;  4NAX A;  4QQ7 A;  6GSS A;  3GX8 A;  3C8E A;  2AAW A;  3N9J A;  3V1W A;  4DSS B;  1R4W A;  2HRA A;  3TKS C;  1BX9 A;  4X4J A;  4I97 A;  3IOS A;  4ZIL A;  4HUA A;  3VWV A;  5ECP B;  4OMV A;  2V1M A;  1VF4 A;  2E2M A;  1A0F A;  4KUN A;  11GS A;  4NHW A;  3KP9 A;  4TRX A;  5DAK B;  2M72 A;  3LEF A;  5HFG A;  5IPG A;  2X49 A;  2VLU A;  1WIK A;  1V98 A;  3Q6O A;  2FWH A;  1Z3E A;  2R5G A;  4YQM A;  5CNW A;  4GWR A;  1URM A;  2BTO T;  5CRE A;  4HOJ A;  2MMO A;  1SJ6 A;  4TXO A;  2P31 A;  1A2M A;  1ZMA A;  3MAK A;  5D96 A;  1QQ2 A;  1WPI A;  4KDY A;  4TR0 A;  3GSS A;  4Z7X A;  3H93 A;  1R7H A;  2L6D A;  2OAC A;  5FWG A;  2WZ9 A;  19GS A;  4LA1 A;  4CHS A;  3ME8 A;  1SU9 A;  1A0R P;  4EF0 A;  5DQS A;  2YOI A;  3TU3 B;  4Z2R A;  3O76 A;  2FWG A;  2V41 A;  4KA0 A;  1JZO A;  5G30 A;  1SD8 A;  4N30 A;  3W8S A;  2CX4 A;  1PSQ A;  2F3M A;  2MYG A;  2VCT A;  2H0G A;  3A5W A;  1MD4 A;  1EOH A;  4MZW A;  2OKA A;  5IMZ A;  1ZYN A;  2DC5 A;  4POL A;  4X1U A;  4RQX A;  5EL8 A;  4K1F A;  2LJR A;  4OCF A;  4MF7 A;  5INY A;  5IQY A;  3UBK A;  4WBJ A;  1F2E A;  2YN1 A;  4LL1 B;  1XVQ A;  5LD0 A;  1MDI A;  5J40 A;  1V58 A;  4NV2 A;  3LQ7 A;  16GS A;  1QXH A;  5G2Z A;  1GLP A;  1PKZ A;  2CVB A;  2O85 A;  2R2J A;  4J56 E;  1PQN A;  4I2U A;  1XVW A;  5ECS A;  5D9X A;  1B9X C;  1O6J A;  4HEA 2;  4K8M A;  3G7I A;  2HSH A;  3VK9 A;  4IQA A;  4MF6 A;  5G31 A;  1AQX A;  3TGZ A;  4K7O A;  3KMN A;  2GT6 A;  2GQK A;  4FYC A;  4MZC A;  1M9A A;  3KGK A;  3VPQ A;  5JWQ B;  3IDV A;  3D5J A;  3GKK A;  2G2Q A;  2WFC A;  2KP2 A;  4MJC A;  5C00 A;  3GH6 A;  3LJR A;  5F0G A;  1WOU A;  1KNG A;  4JU5 A;  4AKG A;  3DML A;  4MJE A;  4X0X A;  3PR8 A;  4WBR D;  5E4W A;  3Q74 A;  4PUA A;  1V2A A;  5ECN B;  2CZ3 A;  3KH7 A;  1TJD A;  5FHI A;  2A4V A;  2CA8 A;  4IN0 A;  1SL1 B;  2EFC A;  5GAP D;  1S3A A;  3VWW A;  1DUG A;  2XC2 A;  1FB6 A;  3HA9 A;  3CSJ A;  2BMX A;  4MF5 A;  2GST A;  3HD5 A;  1XZO A;  1M2D A;  22GS A;  2JAD A;  4Q5R A;  3LYK A;  3FZ9 A;  1V40 A;  4E8E A;  3C71 A;  5ECR B;  5HFK A;  4AKH A;  1H4O A;  4GLT A;  4E68 A;  5GSS A;  4IW9 A;  1XOA A;  2PER A;  5A1N A;  3FR9 A;  1TK0 B;  4L8E A;  2R3X A;  4V2M A;  1ST9 A;  5A5K A;  2YCD A;  4MH2 A;  1V9W A;  3EC3 A;  4HZ4 A;  5ECL B;  1SKW B;  2JZT A;  3QPM A;  4TXO B;  5IMA A;  4O7H A;  2YZH A;  1HQO A;  1TI3 A;  2GSR A;  2GDR A;  4XIH A;  2O87 A;  1T4Y A;  2PUK C;  1XWA A;  4AKX B;  3ED3 A;  4D73 A;  2IJY A;  1DE1 A;  6GST A;  3F4T A;  1TXU A;  4JR4 A;  3AY8 A;  2GT5 A;  3M1G A;  1OVN A;  4POK A;  4EDY A;  1ML6 A;  1SYX A;  2CVK A;  5KOW A;  1K3L A;  3TKS E;  2LRC A;  1KTE A;  4G9H A;  2NPB A;  2HFD A;  2NTO A;  2KUC A;  3ZIJ A;  3EMX A;  4K2X A;  2B1L A;  3DWV A;  1N25 A;  4GF0 A;  2C3Q A;  3UOM A;  6GSX A;  3CXG A;  1UA5 A;  2VOC A;  1IYI A;  4HU7 A;  4GQC A;  2GGT A;  2XBQ A;  2VCX A;  1AIU A;  2V2G A;  2YZU A;  2H0I A;  3HCZ A;  2WGR A;  3A2W A;  4IEL A;  1B48 A;  1M2A A;  2VLT A;  1S3C A;  1SVO A;  3HDC A;  1SK1 A;  4DEJ A;  4YKF A;  2VL2 A;  4JBB A;  2F51 A;  4DSS A;  3TB2 A;  2AHE A;  1Z7R A;  2LUS A;  2HZF A;  2VD1 A;  1GUM A;  5AN1 A;  2PVO C;  3D0Z A;  4GTU A;  1SVL A;  2PN8 A;  3US3 A;  4ACS A;  4O92 A;  1JZD A;  5CRG A;  3HVX A;  4TR1 A;  4BL7 B;  5J3R A;  1T00 A;  4I2T A;  2OAD A;  3TUE A;  5HR2 A;  1O81 A;  4KND A;  4K6X A;  4GQF A;  1J9B A;  1GTB A;  3L9U A;  3BOA A;  1BJX A;  2O7K A;  5GZZ B;  2YPM A;  2HE3 A;  1YF0 A;  2JAC A;  4L0U A;  1OE7 A;  4CY6 A;  1SL0 B;  3OR5 A;  1FOH A;  3HJO A;  4GDF A;  3QMX A;  5AGY A;  2IWT A;  2C80 A;  2HYX A;  4MAB A;  3RHB A;  2RM6 A;  4L0W A;  4XTS A;  2IN3 A;  3G9B A;  2E2G A;  1XBS A;  1GUK A;  4E8H A;  4POM A;  4IBP A;  2I81 A;  3GHA A;  5JCG A;  3BJ5 A;  3F6F A;  3GKM A;  5CYY A;  4Q5N A;  4F82 A;  1JZW A;  5B8A A;  4GSS A;  4PQH A;  3HVV A;  2E7P A;  1BYE A;  2RM5 A;  1TDI A;  2C0D A;  4MH3 A;  3EPT A;  3GH9 A;  2JSZ A;  1USB A;  5CAX A;  5AIX A;  5EPF A;  3FR6 A;  5DJM A;  6GSW A;  3F8U A;  1GRX A;  1YKA A;  3A3T A;  4MCU A;  1K0D A;  1EOG A;  2FUG 2;  2JL4 A;  3UMA A;  4POB A;  2HRK B;  1YJ6 A;  1SKR B;  4OO5 A;  1Y25 A;  3TRP A;  1TRW A;  3H79 A;  1PA3 A;  4ZB8 A;  1EV9 A;  4KGI A;  4TN8 A;  2VL9 A;  5KOX A;  4HQZ A;  2NBS A;  4OCE A;  2GLR A;  1PRX A;  3M8N A;  2XPE A;  4PUR A;  4FYU A;  5DDL A;  3GUR A;  4WEY A;  3Q19 A;  3M9J A;  1GSE A;  5AIV A;  2AUV A;  4O5R A;  5A4U A;  2IMF A;  1M9B A;  5CRH A;  2K9F A;  4N11 A;  4EIQ A;  2HSY A;  2GSQ A;  4EXJ A;  4GCI A;  2EFE A;  4NHZ A;  4GST A;  2DKI A;  5CP1 A;  3HJP A;  3VI5 A;  4K0G A;  1ZZY A;  2B5Y A;  4WF5 A;  4MZB A;  2HZE A;  3UAR A;  1Z6N A;  1F6M C;  3EU4 A;  4KCE A;  6GSY A;  4G0L A;  1PX6 A;  1RK4 A;  2JZS A;  5KN2 A;  1AC1 A;  3I6A A;  17GS A;  2C0G A;  3L9V A;  1Q98 A;  2VIM A;  2O89 A;  2OBK A;  3D4T A;  3QD9 A;  3UL3 A;  2VL2 C;  13GS A;  20GS A;  1YZX A;  1HNA A;  4GRF A;  3EU3 A;  1GL8 A;  2IPA A;  2F8F A;  4XCS A;  4BVY A;  2FHE A;  2VAF A;  1SJI A;  1X9M B;  10GS A;  2DJ0 A;  4JED A;  5DAL A;  5HR1 A;  2EFD A;  1GSF A;  5F06 A;  3RBT A;  2CT6 A;  3M3M A;  3TKQ A;  4TR1 B;  2H71 A;  1F37 A;  1EGR A;  1NSW A;  4KSO A;  1Z7P A;  2IMK A;  3GL5 A;  2ZUP A;  2B3S A;  2YJH A;  2EIR A;  2D2Z A;  5IO0 A;  2DBC A;  3WT1 A;  4MA9 A;  2QGV A;  2H6X A;  3QAW A;  3EVI A;  2H1L A;  2PBJ A;  2PU9 C;  2C0E A;  5J4U A;  4I8B A;  4YKG A;  4ZBA A;  2P0G A;  1BAY A;  5DVB A;  3RPP A;  3TRX A;  4RI7 A;  4IS0 A;  4EL1 A;  2OBI A;  4KW6 A;  1GNW A;  3F3R A;  2WRT A;  4IVF A;  1U3I A;  5B6N A;  4ZL9 A;  5KN0 A;  4HU9 A;  1TTZ A;  3H4K A;  5IMD A;  2EC4 A;  5ECI B;  2HXK A;  1XWC A;  3S9F A;  3W6G A;  1GSU A;  3F63 A;  1G7O A;  4TXV A;  1FG4 A;  2DIY A;  5ID2 B;  12GS A;  3P7X A;  4TKY A;  1FHE A;  1TXX A;  4N3Z A;  5LNK e;  1JFU A;  3DYR A;  5IMC A;  4RQR A;  2LKU A;  4V2L A;  2H75 A;  3W8J A;  3KTL A;  4NWY A;  1XW5 A;  2DJ3 A;  4QL7 A;  1MDK A;  3RDW A;  3QOU A;  3I43 A;  4YQU A;  5LCZ A;  2X8G A;  2WS2 A;  2B5X A;  1R26 A;  4IKH A;  3DGQ A;  3ZFB A;  5A4V A;  1UN2 A;  4BL7 A;  5F8B A;  4BWQ A;  3GA4 A;  1PN0 A;  4TR3 A;  2H01 A;  2KOK A;  4KDU A;  2QA2 A;  4HQS A;  1NM3 A;  4YAP A;  2VCW A;  2R6K A;  1SKS B;  2MBS A;  4Q5F A;  3IE3 A;  2HT9 A;  1AXD A;  4IJI A;  1ERU A;  2IFQ A;  6GSU A;  1EEJ A;  2LNS A;  2KLX A;  3LG6 A;  3QFA C;  1WE0 A;  1QMV A;  2QC7 A;  1GSS A;  1E6B A;  2LV3 A;  5DBQ A;  2HZE B;  1DE2 A;  1K3Y A;  2OE0 A;  4K5R A;  3LWA A;  2OE3 A;  3D22 A;  2GVP A;  2YV7 A;  3GIX A;  5G5F A;  3APQ A;  1ACV A;  1ERT A;  3D21 A;  2L57 A;  2H6Z A;  5D9T A;  1Y1U A;  4F0B A;  2JSY A;  1OE8 A;  2A2S A;  4RUV A;  2GQM A;  2B5E A;  2HLS A;  1X5D A;  3TJB A;  8GSS A;  4BVY B;  3KD0 A;  3FMW A;  4ZL7 A;  2I3Y A;  1OC8 A;  4DVC A;  4O5Q A;  3VFI A;  5DAL B;  2K8S A;  1SL2 B;  4W66 A;  1WWJ A;  3A2V A;  3UBL A;  3ZVJ A;  4AKI A;  5IM9 A;  3UIW A;  4KCA A;  3ZLP A;  2GZY A;  2HRK A;  1A2J A;  2ES7 A;  14GS A;  2LST A;  1B9Y C;  3IAM 2;  1TKD B;  3K8N A;  1X5C A;  2EFH A;  2R0C A;  2GSS A;  3TOT A;  4MJA A;  3F4R A;  1OKD A;  4G0I A;  3FKF A;  2B1K A;  1H75 A;  1R5P A;  3KXO A;  3BBY A;  1M0U A;  3TJJ A;  1GNE A;  2B7J A;  3LGC A;  5B6M A;  2XBI A;  5DCH A;  5HR0 A;  1G0T A;  4PQI A;  2ON7 A;  1F3A A;  5COH A;  3HKR A;  2DMM A;  2E0Q A;  2HRN A;  4I5Q A;  4AF2 A;  3ZIV A;  2C3T A;  3UVT A;  1EWX A;  5IMV A;  1XXU A;  4ISD A;  3HZ8 A;  2CZ2 A;  4ZB6 A;  3D4M A;  2H1D A;  2N5A A;  1GH2 A;  4CW9 A;  4GXZ A;  2CAQ A;  2UV8 G;  4OD7 A;  1U3A A;  1T4Z A;  1MDJ A;  5D9W A;  5J5N A;  5H5S A;  2AYT A;  2LQQ A;  2DJK A;  1VF2 A;  1XFL A;  1OC9 B;  1BED A;  1B8X A;  3QDN A;  2WJU A;  1WMJ A;  3DIE A;  2MBT A;  3GN3 A;  1G7E A;  2ZNM A;  4EC0 A;  2ZCT A;  5H5Q A;  3KH9 A;  3KZQ A;  3CRU A;  2IIY A;  1AAZ A;  1TU7 A;  1MD3 A;  5ECK B;  2X64 A;  3BD2 A;  4ZIJ A;  4ML6 A;  2FD3 A;  2R0G A;  5E59 A;  2R0P A;  4ID0 A;  1K3O A;  4EDZ A;  3R3E A;  4OFT A;  2L4Q A;  1PMT A;  1C72 A;  1QFN A;  1N2A A;  1NHY A;  3GUS A;  2L59 A;  3LFL A;  2HI7 A;  3MWH A;  2C0F A;  5D9V A;  6GSV A;  3L9S A;  4XHM A;  5H5R A;  4ILF A;  3RHC A;  1U87 A;  2PVQ A;  3TRQ A;  4PNG A;  2X4A A;  4J2F A;  2EIO A;  3O3T A;  4HJ2 A;  2K6V A;  3RPN A;  4TR4 A;  5DQY A;  1HNC A;  1HD2 A;  1Z5Y E;  3FRC A;  2IFQ B;  2YWO A;  1ILO A;  3IC4 A;  3LSZ A;  1XWK A;  3KTB A;  4USS A;  4K9Z A;  2YV9 A;  4ECJ A;  3KJY A;  2Z9S A;  4CDO A;  3TKR A;  4WKW A;  3SBC A;  5JWR B;  2IL3 A;  3F6D A;  4FYB A;  4RI6 A;  1QGV A;  1FAA A;  1QK8 A;  2LQO A;  3HMJ G;  3FEU A;  4MDC A;  5KEJ A;  5B8B A;  5ECQ B;  3IBH A;  4V1A g;  1GSD A;  1OC3 A;  5ID2 A;  1VF1 A;  4AGS A;  3IHG A;  2G0F A;  4EVM A;  4LMW A;  1LJR A;  5ENU A;  5ECO B;  5A4W A;  2HSM A;  3DVW A;  4LMV A;  3VUR A;  2RII A;  3MYD A;  1M7T A;  1GTU A;  3QAG A;  2OJL A;  4YAV A;  3MDK A;  5F05 A;  1J0F A;  3TJG A;  1K0B A;  4HZ2 A;  4F2I A;  5KN3 A;  1ZCP A;  4HDE A;  1OAZ A;  1EP7 A;  3U6V A;  2A4H A;  2RLI A;  2DLX A;  3P2A A;  4G2E A;  1NW2 A;  1K0A A;  4N0V A;  2WB9 A;  2IME A;  3HXS A;  3PIN A;  2CV4 A;  5BMU B;  1XW6 A;  5D8I A;  2AB6 A;  2AV4 A;  4HJM A;  1PL1 A;  2ON5 A;  1JLW A;  1XCC A;  3WYW A;  2MZC A;  3CMI A;  3M0F A;  3APS A;  2H73 A;  1SYR A;  1X9W B;  2H74 A;  2LJK A;  3BCI A;  1CQH A;  2LTK A;  5G1K A;  4IQ1 A;  4K2D A;  2HNL A;  4WXT A;  1V57 A;  2F9S A;  1XPV A;  2I1U A;  1GP1 A;  2YP6 A;  5A5H B;  2H70 A;  3ZMK A;  4N10 A;  3L78 A;  1MEK A;  2PGT A;  1PD2 1;  3ERG A;  1I5G A;  4ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...