3EE2A

Structure of human prostaglandin d-synthase (hgsts1-1) in complex with nocodazole
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAIANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione-requiring prostaglandin D synthase
publication title Identification and characterisation of new inhibitors for the human hematopoietic prostaglandin D(2) synthase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ee2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ee2A01
2IWTA 3TJJA 3F3QA 1OE7A 1JZOA 2OE0A 2VO4A 2EIRA 4JRRA 1LBKA 1JZDA 1ZGNA 3APSA 1MDJA 4IQAA 6GSUA 2L4QA 3VWXA 2WB9A 2KP1A 5AN1A 4MA9A 1V57A 4AF2A 1SJZA 5IMVA 5ECMB 3CRTA 3L9SA 5EL8A 2H1AA 3IAS2 1E6BA 4BA7A 2YJ7A 1GWCA 1ZZYA 5DQYA 3NZNA 5G1LA 1GSFA 1NM3A 1U3AA 4KH7A 2V41A 4NXIA 2HYXA 2G2QA 4AJ8A 1R26A 1GH2A 2HRNA 2VL2A 2N5BA 1TI3A 1FB6A 4FO5A 3F9UA 3FEUA 4WKWA 4DSQA 3U6VA 2VIMA 1ZCPA 1R4WA 4O32A 3D4TA 2C0EA 4EE0A 2GQKA 2LRNA 3WGXA 8GSSA 4POBA 1G7EA 2OBKA 5D73A 1FOVA 2JZRA 5JCUA 1YKCA 1QGVA 2CAIA 2QGVA 2AAWA 1WP0A 4G0LA 5IPGA 2HI7A 2GT6A 4ZL7A 5F8BA 4ISDA 5F07A 1XW9A 3EMXA 3A2VA 5DJMA 2YNXA 1XBSA 3GKMA 3HY2A 3KXOA 3MAKA 2ON7A 2VLVA 2XBIA 3P2AA 1Q98A 5CYYA 4YH2A 4KSMA 5IMZA 4OFTA 2LNTA 2V32A 5E59A 2JADA 3I69A 4DSSB 2M46A 2QKEA 4RQXA 4GCIA 2VL2C 2A2RA 3CXGA 4L0WA 4ML1A 1I5GA 4HEA2 4TR1B 4DSRA 3FHKA 1H4OA 3SWLA 1MD3A 4I97A 3C8EA 2H0HA 5LNKe 2AUVA 4OO5A 3R3EA 2YZHA 1V58A 3GL3A 5CNWA 1IYIA 2AJQB 1CQGA 3EYTA 2A2SA 4EDZA 5HQPA 3LXZA 1Q4JA 1DSBA 1ZYEA 1VF3A 4CDOA 1KNGA 3IXRA 3HZ8A 1SJ6A 3TKSE 2HSMB 3TRPA 1V2AA 4TOPA 2FY6A 4KA0A 2YPMA 4ML6A 2VUPA 3A2XA 4JR4A 2WULA 2X8HA 4XS4A 1XZOA 2PN8A 3ZITA 3PINA 3FR9A 1G7OA 1WE0A 3IAM2 1MEKA 1IYHA 1M99A 2RLIA 2KLXA 1PD21 2DJ3A 2H6XA 4K7OA 2X8GA 1THXA 1SKRB 4BVYB 1XW6A 2MMZA 4K8MA 5DQSA 1M2AA 2PVOC 5IOXA 4GXZA 2IMFA 4MZCA 3DVXA 3RHBA 4K9ZA 3VWUA 1SJIA 3VPTA 2R4VA 4PURA 4X0XA 2IN3A 3US3A 5FWGA 4GSSA 1FB0A 1T4ZA 1HNBA 3QFBC 2PVQA 1WPIA 1XOAA 3GKXA 5DAKB 4XHMA 4L5OA 2GQMA 4D73A 4K1FA 2H73A 3ZL5A 3GX8A 2H19A 2IIYA 2ZUPA 4HZ4A 2PWJA 1FVKA 4KW6A 2REMA 4FYCA 4IP1A 6GSTA 3IV4A 2CVBA 1JFUA 4KDXA 4QQ7A 2DJJA 3QPMA 4POLA 2H71A 1Z5YE 5F06A 3ZFBA 3TCOA 4V2MA 5CO3A 3CTGA 3HVXA 1GLQA 1GSSA 2FD3A 1CQHA 4HDEA 1WOUA 2Z9SA 2KHPA 2YP6A 3NIVA 4WBRD 4J2FA 1AC1A 1EP8A 2HRKA 1SL1B 1PN9A 1DE1A 3F4TA 1G0TA 1GSYA 4WF4A 4Q5FA 5CP1A 4MP4A 1O8XA 2P31A 4GSNA 2L4CA 4F9ZA 3R2QA 1GULA 4EVMA 1AIUA 3WGEA 4NPBA 3L78A 3G7YA 1GTIA 4BVXA 1H75A 1KEBA 5ECPB 2K6VA 3KCMA 2FWFA 1O73A 3IE3A 3PR8A 2M72A 4ECCA 3I6AA 4TXVA 1BEDA 2X8CA 2O7KA 2VCZA 1XWCA 3UARA 5CAXA 1JZWA 2OACA 5G31A 3CRUA 2JSYA 1SD8A 6GSWA 3IC8A 1FW1A 4ZIJA 2HSYA 3L9VA 1ABAA 2WRTA 5FT3A 1XCCA 2DMMA 4K0NA 1ILOA 4IQ1A 1R7HA 4TKYA 4EDYA 1ERWA 4AJ6A 5FHIA 3CTFA 1RK4A 3GKKA 2PERA 4TW5A 1U6TA 2B6MA 3RHCA 3OR5A 4O92A 2GTUA 2E2GA 1S3CA 3H1NA 2F3MA 1LU4A 4ZB8A 1MDKA 2L59A 2NPBA 1B4QA 3ZYWA 5ECNB 3EU4A 1SD9A 2H1GA 1F3BA 4MDCA 2C4JA 2DC5A 3H79A 1BAYA 3BD2A 3GSSA 2JSZA 3QAVA 5ECLB 3UVTA 4PXOA 1YJ6A 2P0GA 4YAVA 4XRAA 1NHOA 3G7JA 9GSSA 2EIQA 2FUG2 4N10A 4TXOA 4RI7A 3UEMA 1YF0A 3GUSA 3TB2A 4XS1A 2OKAA 2YWMA 3C1SA 1A2MA 1TDIA 2X99A 5D96A 3CSHA 2B3SA 1X5CA 4F0BA 3F0IA 3N9JA 2CZ2A 1ST9A 2LQOA 1JHBA 4LMVA 1FAAA 5D9XA 4AGSA 1GUMA 1HNAA 1XFLA 3EVIA 4GSTA 2WS2A 2C3NA 4ID0A 2WZ9A 3DRNA 3UVHA 4MF7A 1K3YA 3VFIA 3EWLA 3DKSA 3DYRA 1PX7A 3LJRA 1YDKA 2H76A 1XOBA 2B7JA 3O6TA 2FHEA 3TKSC 5G1KA 1SL2B 1MDIA 4FH8A 1EWXA 3LYKA 4OCFA 2H6YA 4MZWA 3VLNA 1LJRA 5DVBA 1DBYA 3CMIA 4ZBAA 4IHUA 3M9KA 1EGOA 1Z6NA 4OCEA 4GWRA 2CAQA 1YKAA 1A23A 2R3XA 3HVSA 3MSZA 1X0RA 4JU5A 3WD6A 1YQ1A 2FA8A 1UN2A 2H01A 5A5KA 4F82A 1RW1A 3C71A 1MD4A 3ZVJD 1K0MA 1QUWA 1VF2A 1Z3EA 2DJKA 2LNSA 3KEBA 2CVKA 1PKZA 2A4VA 2LS5A 3I43A 2IPAA 2N5AA 4PX1A 4KUNA 2RUFA 5HFGA 4PNFA 5DCHA 4POKA 3M0FA 1QMVA 22GSA 2D2ZA 3QMXA 4NHZA 1Y6EA 2GVPA 4FIWA 1AUCA 1ZL9A 2DJ2A 4TR0A 3D0ZA 2I3YA 1X9MB 1ERTA 4XS4B 4ZL9A 2YV9A 3F3RA 1K0CA 2J23A 2M80A 1K0AA 1OKDA 5D93A 3TUEA 3CSJA 4F0CA 2BTOT 1YEPA 4TVEA 3PGTA 3ZVJA 1QK8A 4ULXA 4G2EA 3W8SA 1W89A 4QL9A 2XPEA 2PBJA 2VCTA 5GSTA 1ZMAA 3KIJA 3FW2A 2LKUA 4ECIA 2R5GA 2VM1A 4NV5A 1N2AA 3DVWA 4OMVA 4KNDA 3UMAA 2F8AA 1R5AA 2IMDA 1XIYA 2IFQB 1QQ2A 2HFDA 1TXXA 4LA1A 3JCML 4LMWA 4OWYA 4F03A 3DGQA 2XBQA 3GH6A 3SBCA 5KN0A 3ERWA 2VM2A 5IMAA 1OC3A 2L6CA 3U5RE 3VPQA 4QL7A 3F6FA 2XHFA 1T7PB 5HFIA 2FWHA 3FYGA 2ZNMA 2OA7A 3FR3A 1Y25A 3FK8A 4HUAA 5KN2A 4TR3A 2LJKA 2CQ9A 3VWVA 4Q5NA 2K9FA 1TP9A 1WWJA 3LWAA 5ID2A 5EY6A 1PL2A 2B5EA 3DMLA 2HRKB 4ZB6A 1OAZA 1EV9A 1XVQA 3FKFA 2K8VA 3FY7A 7GSSA 2IMKA 2IMIA 3KM6A 3QD9A 4V2NA 1K0DA 3C1RA 4X1UA 2F8FA 2I81A 2NTOA 3KH7A 4LL1B 3D4MA 1TU7A 1Z7RA 3KTLA 3EU3A 4EKZA 3GH9A 1YZXA 4K0GA 4BVXB 1BQ7A 2BMXA 1WIKA 2GT5A 3RPPA 3QFAC 5INYA 4NHWA 2AV4A 2L57A 5H5QA 17GSA 3TJFA 1HYUA 3C7MA 4MZBA 3UOMA 2C0GA 1XVWA 2ALBA 1OC9A 3BCKA 1ACVA 3IOSA 3D6IA 2L6DA 1J08A 3ERFA 1WMJA 2IL3A 4ZILA 4PNGA 18GSA 1TKDB 5CRGA 2H75A 1XWBA 1PX6A 2WGRA 4KDYA 3M3MA 5D9TA 3O3TA 3TJBA 2C8UA 4KAEA 1X5DA 3ISOA 5IMDA 1F6MC 2IJYA 3G9BA 5H5RA 1A24A 2JACA 1X9SB 3HVVA 1GTBA 3J7Yk 5JWOB 1HD2A 5IIZA 5J41A 2MMNA 3GA4A 4MMMA 1XW5A 2LRTA 1A2LA 4F2IA 3VK9A 3P90A 3BBYA 2MBSA 3EC3A 2VL9A 5HR2A 1E2YA 1B4PA 2LJAA 1TW9A 2C3QA 6GSYA 2CX3A 2GSTA 3IDVA 3W8JA 1RQMA 1J0FA 5D9VA 3GTUA 4OFNA 1EZKA 2LEGA 3GMFA 3RAZA 4L8EA 2B1LA 1OE8A 5J5NA 2VAFA 2TRCP 3GX0A 2LRCA 1TOFA 1UC7A 1GRXA 1T4YA 3HYPA 2LTKA 4V1Ap 2HQTA 4I5QA 3RDWA 4YQMA 2UZ8A 4KCEA 3TRQA 1SYXA 4K7NA 4DSSA 4MF5A 1M2BA 5IMFA 1GNWA 4PUFC 1OKTA 3EE2A 2E0QA 3MWHA 4LL4B 10GSA 1OYJA 2VLUA 3L0HA 3TKRA 2DIZA 4WBJA 5C04A 2H1BA 3VURA 3UAPA 1PQNA 2YZUA 3VI7A 3IK7A 1X5EA 3GHAA 4I6XA 5IM9A 1R5PA 3V1WA 3KGKA 4MJAA 1TRWA 1A0RP 1SKSB 4GTUA 4MPGA 4MH2A 4BL7A 1YY7A 4HZ2A 2HZEA 4I2UA 3LG6A 4HQZA 1AXDA 1GSDA 1GSUA 4KX4A 3ZLPA 4EO3A 1DE2A 5AGYA 3IA1A 2MMAA 3GYKA 2MZCA 2J9HA 2H6ZA 4GF0A 3PPUA 5ECKB 19GSA 2H30A 4K7IA 3DEXA 3A5WA 4OO4A 4HJMA 5G2ZA 5GAPD 1EEJA 3KH9A 2LJRA 3A2WA 1VF4A 3EINA 2WJUA 1K3LA 1I9DA 1K0BA 1TJDA 4ECJA 1THOA 1OC8A 4ZXGA 1SL0B 2GSQA 1U87A 3NOFA 2VLTA 1SU9A 1TTZA 1QXHA 4MK3A 1EGRA 1G6WA 3HJMA 2L5LA 2DMLA 3APOA 5J9CA 4G10A 4I2TA 2H0IA 1URMA 3TKQA 2YN1A 4ECBA 4TRXA 2RM6A 3I9V2 5A4VA 3H4KA 3LSZA 3FZ5A 3Q6OA 3E9JB 1TRSA 2NBSA 4BPYA 4G0IA 3APQA 4J57E 2B5YA 3M8NA 4KF9A 1ERUA 5F0GA 1PMTA 5JCWA 5HR1A 4Q5RA 2V6KA 5HR0A 3LORA 1TK0B 2PMTA 2FLSA 1FVJA 4ZBDA 4ZBBA 4IN0A 4GRFA 3RPNA 4E8HA 4IBPA 2XC2A 3WYWA 4EL1A 5HFKA 1WRYA 3LGCA 4IVFA 1QFNA 2VL3A 2V2GA 2ES7A 3KJYA 3F6DA 2O89A 2H74A 3BCIA 1PL1A 4XIHA 5HR3A 4HJ2A 1YEXA 2NVLA 1T1VA 4O5RA 1M9BA 4NWYA 2R6KA 6GSSA 2VD1A 4USSA 2H1DA 4Q5QA 4X43A 2MYGA 1FHEA 1KBNA 4MCUA 1NW2A 2I4AA 1JLWA 2CVDA 1V9WA 4EXJA 2RM5A 4TN8A 5H5SA 4IKHA 2GDRA 5G5FA 2JL4A 4KGIA 4AJ7A 3EURA 2MMOA 3HCZA 2H66A 1AW9A 1AQWA 1NHYA 3KMOA 2OE1A 3LXTA 4POMA 5E4WA 1O6JA 2PUKC 2RIIA 3ZIVA 1KTEA 5JWRB 4ZL8A 1DUGA 2HE3A 3CSIA 3QCPA 2QC7A 4HU7A 3AY8A 2H70A 5JCGA 3H8QA 3ZIJA 2MBTA 5C00A 2AYTA 3IPZA 4BWQA 4WXTA 5B8AA 2VD0A 3FZ9A 5IOWA 4K6XA 1PA3A 2C80A 5CRDA 5DALA 3F4RA 3IR4A 1B9XC 4GLTA 4H86A 3TGZA 4OFMA 1OC9B 4V2LA 2E7PA 3G7IA 2LUSA 2FA4A 3LEFA 5B6MA 5GZZB 5B7CA 3GV1A 1GUHA 3Q19A 13GSA 2NDOA 2GGTA 2L5OA 2GQLA 4FQUA 5KN1A 2HLSA 3WGDA 4KE3A 3MNGA 5COHA 4EUYA 1GL8A 2E2MA 2GSSA 3C73A 2TIRA 2ZCTA 2OADA 4MPFA 5GSSA 5ECRB 5LCZA 1T3BA 4NMUA 4EC0A 2DJ0A 1FO5A 2HSNB 4N11A 3ZMLA 2HXKA 1T00A 3Q74A 20GSA 2B5XA 1GSQA 4D73B 2B7KA 4DVCA 1GLPA 1VGLA 2KUCA 3DXBA 4IJIA 2P5QA 1W4VA 5L71A 1Z9HA 1EV4A 3L4NA 1XWKA 4WF5A 5A4UA 3S9FA 3GTUB 1AQXA 2VOCA 3QOUA 3HD5A 2HNLA 3IC4A 4J56E 4BWSA 2YCDA 2CZ3A 4NAXA 4JR6A 3ME8A 3Q18A 2EC4A 3UBKA 2KOKA 2F9SA 5F05A 3FRCA 1TRVA 1PKWA 2O87A 2FWEA 2V6OA 5ECOB 1SK0A 1F9MA 3CBUA 6GSVA 2R2JA 2DJ1A 5ECSA 3ZTLA 4MJEA 2G0FA 1ON4A 2LQQA 3BJ5A 1M9AA 3RBTA 4PUAA 2HRAA 1USBA 2VCXA 4YQUA 2PU9C 1GSEA 1N8JA 3IK9A 4OD7A 5B8BA 1F3AA 4XTSA 2FWGA 14GSA 1G6YA 5B6NA 3HJOA 3TDGA 1SYRA 5ECQB 2I1UA 2YWOA 4KCAA 4YQVA 3ZREA 2QSIA 1BJXA 3FZ4A 4PQIA 1C72A 5CRHA 4IJ3A 1A2JA 4HU9A 4BL7B 2HZEB 2DIYA 3GSTA 2O85A 3IBHA 3DD3A 3TJGA 2F51A 5AISA 3TOTA 1SENA 3HA9A 1VRSD 3GRXA 12GSA 1AQVA 3VI5A 1WJKA 3GL5A 4CHSA 4XRDA 1MTCA 2H8LA 3DIEA 2OE3A 1O81A 4G9HA 4E8EA 4HQSA 3O76A 2V1MA 5DJLA 3ZMKA 4MH3A 2IFQA 2TRXA 1PRXA 1EEMA 4G0KA 4HI7A 3J7Yb 1AAZA 2OJLA 2GLRA 5G5EA 3TRXA 3A3TA 3KD0A 4RQRA 3KZQA 2GZZA 4KB3A 2LSTA 1YF1A 1NSWA 4PTSA 1X9WB 5EVOA 3ZRDA 2RUEA 2HZFA 1A8LA 4JZQA 5G30A 5AIVA 1B8XA 4TXOB 2HT9A 2C0FA 4XS6A 4IS0A 16GSA 4G19A 3D5JA 4N0VA 3GIXA 4O7HA 2IMEA 5J9BA 2CX4A 5ELGA 5JWQB 1HQOA 2YWNA 5DBQA 5CREA 3KP8A 4ILFA 2YV7A 3LQ7A 2CA8A 4TR1A 1EOHA 5DCGA 5IO2A 5AIXA 3HKRA 1SKWB 1V40A 5IMCA 3TKPA 2O8VB 5ABRA 4RUVA 3PH9A 3P7XA 2WDUA 1PGTA 3WT1A 1GP1A 2GZYA 1OVNA 3F8UA 1B9YC 4P3YB 5ECHB 2H72A 4WEYA 5CRWA 5ELAA 2K8SA 5IO0A 2BJXA 2GZPA 3E3EA 1TK5B 4N0ZA 4MLYA 1S3AA 2HSMA 5KEJA 3UBLA 1JZRA 4IGJA 3GFKA 5KN3A 2WCIA 2R37A 1V98A 5D9WA 1F2EA 5J4UA 1O8WA 3CYNA 3UL3A 1O85A 1GTAA 4WR4A 4NV2A 4WETA 1TK8B 11GSA 3F4SA 2PGTA 2CV4A 2K18A 5DDLA 3W6GA 2C0DA 1T8EB 4BVYA 4RI6A 4DEJA 4IW9A 1ZOFA 1JLVA 4PQ1A 4L5LA 3HHVA 2ON5A 4IELA 1XXUA 2GSRA 3HXSA 1Z6MA 3TOUA 4HOJA 4LLRA 1U88A 1BYEA 5ECIB 1A0FA 1U3IA 3KTBA 3ERGA 2OBIA 4GQCA 4V1Ag 1XWGA 2VCVA 5IQYA 4HS1A 3FR6A 1ERVA 1J9BA 3ME7A 4K2DA 1SK1A 1TRUA 1UVZA 3P8WA 1F37A 2PPTA 1EP7A 5DALB 3UIWA 2P5RA 4IP6A 1B48A 5DAKA 4YAPA 3QAGA 2LV3A 4MJBA 3HJPA 3GKNA 3ZZXA 2H0GA 2YANA 1XWAA 5GAND 2JZSA 3QR6A 1BX9A 1K3OA 1M7TA 4FYBA 1O7UA 1SK2A 3GURA 2X64A 1S3DA 4MABA 2AB6A 3D21A 3D22A 1BG5A 3QDNA 3TKSA 1TU8A 1XPVA 4PGTA 3IRAA 2EIOA 2FGXA 2CT6A 3TJKA 3ED3A 2GS3A 5ENUA 1GTUA 3HZ4A 2N5FA 2JU5A 1VF1A 3GNJA 4TR4A 2C1YA 2B1KA 1ML6A 2HSHA 3ZFLA 3E0UA 1HNCA 4JE1A 4KDUA 2JZTA 4JEDA 4L0UA 1GUKA 2FNOA 4PQHA 1K0NA 1TI1A 2XPDA 4JBBA 1M2DA 2WFCA 3L9UA 4ACSA 2I9HA 3MDKA 2FCHA 2DLXA 3IHQA 3HDCA 5D8IA 2DSAA 3BOAA 3M9JA 3QAWA 5J3RA 5BMUA 5IPHA 3KMNA 4MJCA 2VCWA 3LYPA 2YOIA 2DBCA 5ID2B 4MF6A 4EF0A 3EMPA 1K0OA 2KP2A 3K8NA 3VWWA 4I8BA 3KP9A 3WT2A 2C3TA 3M1GA 5LD0A 4XCSA 3H93A 4GQFA 1FG4A 3UJ1A 2YWIA 4CW9A 1PSQA 2YJHA 4ZB9A 5A4WA 5EPFA 1UA5A 1A8YA 3LFLA 4Z7XA 1M0UA 4WR5A 2HRFA 2AHEA 3N5OA 3GN3A 1EOGA 2VCQA 3F63A 1Z7PA 1GNEA 6GSXA 4FYUA 4KSOA 4N30A 3DWVA 1ZYQB 3FZAA
chains in the Genus database with same CATH superfamily
2IWTA 3TJJA 3F3QA 1OE7A 1JZOA 2OE0A 2VO4A 2EIRA 4JRRA 1LBKA 1ZYNA 1JZDA 1ZGNA 1TXUA 3APSA 4ICYA 1MDJA 4IQAA 6GSUA 2L4QA 3VWXA 2WB9A 2KP1A 5AN1A 4MA9A 1V57A 4AF2A 1SJZA 5IMVA 5ECMB 3CRTA 3L9SA 5EL8A 2H1AA 3IAS2 1E6BA 4BA7A 2YJ7A 1GWCA 1ZZYA 5DQYA 3NZNA 5G1LA 1GSFA 1NM3A 1U3AA 4KH7A 2V41A 4NXIA 2HYXA 2G2QA 4AJ8A 1R26A 1GH2A 2HRNA 2VL2A 2N5BA 1TI3A 1FB6A 4FO5A 3F9UA 3FEUA 4WKWA 4DSQA 3U6VA 2VIMA 1ZCPA 1R4WA 4O32A 3D4TA 2C0EA 4EE0A 4EIQA 2GQKA 2LRNA 3WGXA 8GSSA 5A34B 4POBA 1G7EA 2OBKA 5D73A 1FOVA 2JZRA 5JCUA 1YKCA 1QGVA 2CAIA 2QGVA 2AAWA 1WP0A 4G0LA 5IPGA 2HI7A 4G01A 2GT6A 4ZL7A 5F8BA 4ISDA 2R0GA 5F07A 1XW9A 3EMXA 3A2VA 4FXYP 5DJMA 2YNXA 1XBSA 3GKMA 3HY2A 3KXOA 3MAKA 2ON7A 2A4HA 2VLVA 2XBIA 3P2AA 1Q98A 5CYYA 4YH2A 4KSMA 5IMZA 4OFTA 2LNTA 2V32A 2WZSA 5E59A 2JADA 3I69A 4DSSB 2M46A 2QKEA 4RQXA 3CQFA 4GCIA 2VL2C 2A2RA 3CXGA 4L0WA 4ML1A 1I5GA 4HEA2 4TR1B 4DSRA 3FHKA 1H4OA 3SWLA 1MD3A 4I97A 3C8EA 2H0HA 5LNKe 2AUVA 4OO5A 3R3EA 4K5SA 2YZHA 1V58A 3GL3A 5CNWA 1IYIA 2WVXA 2AJQB 4Z2UA 1CQGA 3EYTA 2A2SA 4EDZA 5HQPA 3LXZA 1Q4JA 1DSBA 1ZYEA 1VF3A 4CDOA 1KNGA 3IXRA 3HZ8A 1SJ6A 3TKSE 2HSMB 3TRPA 1V2AA 4TOPA 2FY6A 4KA0A 2YPMA 4ML6A 2VUPA 3A2XA 4JR4A 2WULA 2X8HA 4XS4A 1M3IA 1XZOA 2PN8A 3ZITA 3PINA 3FR9A 1G7OA 1WE0A 3IAM2 1MEKA 1IYHA 1M99A 2RLIA 2KLXA 1PD21 2DJ3A 1PN0A 2H6XA 4K7OA 2X8GA 1THXA 1SKRB 4BVYB 1XW6A 2MMZA 4K8MA 5DQSA 1M2AA 2PVOC 5IOXA 4GXZA 2IMFA 4MZCA 3DVXA 3RHBA 2DKHA 4K9ZA 3VWUA 1SJIA 4O5UA 3VPTA 2R4VA 4YKGA 4PURA 4X0XA 2IN3A 3US3A 5FWGA 4GSSA 1FB0A 1T4ZA 2HSNA 1HNBA 5KOXA 3QFBC 2PVQA 1WPIA 1XOAA 3GKXA 5DAKB 4XHMA 4L5OA 2GQMA 4D73A 4K1FA 2H73A 3ZL5A 2X4AA 3GX8A 2H19A 2IIYA 4A5PA 1SVMA 2ZUPA 4HZ4A 2PWJA 1FVKA 4KW6A 4N3ZA 2REMA 4FYCA 4IP1A 6GSTA 3IV4A 2CVBA 1JFUA 4KDXA 4QQ7A 2DJJA 3QPMA 4POLA 2H71A 3CWGA 1Z5YE 5F06A 5BRTA 3ZFBA 3TCOA 4V2MA 5CO3A 3CTGA 3HVXA 1GLQA 1GSSA 2FD3A 1CQHA 4HDEA 1WOUA 2Z9SA 2KHPA 2YP6A 3NIVA 4WBRD 4J2FA 1AC1A 1EP8A 2HRKA 1SL1B 1PN9A 1DE1A 3F4TA 1G0TA 1GSYA 4WF4A 4Q5FA 5CP1A 4MP4A 1O8XA 2P31A 4GSNA 2L4CA 4F9ZA 3R2QA 1GULA 4EVMA 1AIUA 3WGEA 1Y1UA 4NPBA 2QA1A 3L78A 1M3JA 3G7YA 1GTIA 4BVXA 4EIPA 1H75A 1KEBA 2EFEA 3LW9A 5ECPB 2K6VA 3KCMA 2FWFA 1O73A 3IE3A 2M72A 3PR8A 5BMUB 4ECCA 3I6AA 4TXVA 1BEDA 2X8CA 2O7KA 2VCZA 1XWCA 3UARA 5CAXA 1JZWA 2OACA 5G31A 3CRUA 2JSYA 1SD8A 6GSWA 3IC8A 1FW1A 4ZIJA 2HSYA 3L9VA 1ABAA 2WRTA 5A5HA 5FT3A 1XCCA 2DMMA 4K0NA 1ILOA 4IQ1A 1R7HA 4TKYA 4EDYA 1ERWA 4AJ6A 5FHIA 3CTFA 1RK4A 3GKKA 2PERA 4TW5A 1U6TA 2B6MA 3RHCA 3OR5A 4O92A 2GTUA 1FOHA 2E2GA 1S3CA 3H1NA 2F3MA 1LU4A 4ZB8A 1MDKA 2L59A 2NPBA 4Z2RA 1B4QA 3ZYWA 5ECNB 3EU4A 1SD9A 2H1GA 1F3BA 4MDCA 2C4JA 2DC5A 3H79A 1BAYA 5KOWA 3BD2A 3GSSA 2JSZA 3EPTA 4PHZC 3QAVA 5ECLB 3UVTA 4PXOA 3MIXA 1YJ6A 2P0GA 2WW0A 4YAVA 4XRAA 1NHOA 3G7JA 9GSSA 2EIQA 2FUG2 4N10A 4TXOA 4RI7A 3UEMA 1YF0A 3GUSA 3TB2A 4XS1A 2OKAA 2YWMA 3C1SA 1A2MA 1TDIA 2X99A 5D96A 3CSHA 2B3SA 1X5CA 4F0BA 3F0IA 3N9JA 2CZ2A 1ST9A 2LQOA 1JHBA 4LMVA 1FAAA 5D9XA 4QMKA 4AGSA 1GUMA 1HNAA 1XFLA 3EVIA 4GSTA 2WS2A 2C3NA 4ID0A 3RFRC 2WZ9A 3DRNA 4BIKA 3UVHA 4MF7A 1K3YA 2X49A 3VFIA 3EWLA 2VKZG 3DKSA 3DYRA 1PX7A 3LJRA 1YDKA 2H76A 1XOBA 2B7JA 4MNNA 3O6TA 2FHEA 3TKSC 5G1KA 1SL2B 1MDIA 4FH8A 1EWXA 3LYKA 4OCFA 2H6YA 4MZWA 3VLNA 4ZB7A 1LJRA 5DVBA 1DBYA 3CMIA 4ZBAA 4IHUA 3M9KA 1EGOA 1Z6NA 4OCEA 4GWRA 2CAQA 1YKAA 1A23A 2R3XA 3HVSA 3MSZA 1X0RA 4JU5A 3WD6A 1YQ1A 2FA8A 1UN2A 2H01A 5A5KA 4F82A 1RW1A 3C71A 1MD4A 3ZVJD 1K0MA 1QUWA 1VF2A 1Z3EA 2DJKA 2LNSA 2WVXB 3KEBA 2CVKA 1PKZA 2A4VA 2LS5A 3I43A 2IPAA 2N5AA 4PX1A 4KUNA 2RUFA 5HFGA 4PNFA 5DCHA 4POKA 3M0FA 4W66A 1QMVA 22GSA 2D2ZA 3QMXA 4NHZA 1Y6EA 2GVPA 4FIWA 1AUCA 1ZL9A 2DJ2A 4TR0A 3D0ZA 2I3YA 1X9MB 1ERTA 4XS4B 4ZL9A 2YV9A 3F3RA 1K0CA 2J23A 2M80A 1K0AA 1OKDA 5D93A 3TU3B 3HVNA 3TUEA 3CSJA 4F0CA 2BTOT 1YEPA 4TVEA 3PGTA 3ZVJA 1QK8A 4ULXA 4G2EA 3W8SA 1W89A 4QL9A 2XPEA 2PBJA 2O5VA 2VCTA 5GSTA 1ZMAA 5J4VA 3KIJA 3FW2A 2LKUA 4ECIA 2R5GA 2VM1A 4NV5A 1N2AA 3DVWA 4OMVA 4KNDA 3UMAA 2F8AA 4PI2C 2A2PA 1R5AA 2IMDA 1XIYA 2IFQB 1QQ2A 2HFDA 1TXXA 4LA1A 3JCML 4LMWA 4OWYA 4F03A 3DGQA 2XBQA 3GH6A 3SBCA 5KN0A 3ERWA 2VM2A 5IMAA 1OC3A 4AKIA 2L6CA 3U5RE 3VPQA 4QL7A 3F6FA 2XHFA 1T7PB 5HFIA 2FWHA 3FYGA 1S3RA 2ZNMA 2OA7A 3FR3A 1Y25A 3FK8A 4HUAA 5KN2A 4TR3A 2LJKA 2CQ9A 3VWVA 4Q5NA 2K9FA 1TP9A 1WWJA 3LWAA 1N25A 5ID2A 5EY6A 1PL2A 2UV8G 2B5EA 3DMLA 2HRKB 4ZB6A 1OAZA 5A1NA 1EV9A 1XVQA 2EFHA 3FKFA 2K8VA 3FY7A 7GSSA 2QA2A 2IMKA 2IMIA 3KM6A 4HSCX 3QD9A 4V2NA 1K0DA 3C1RA 4X1UA 2F8FA 2I81A 2NTOA 3KH7A 4LL1B 3D4MA 1TU7A 1Z7RA 3KTLA 3EU3A 4EKZA 3GH9A 1YZXA 4K0GA 4BVXB 1BQ7A 2BMXA 1WIKA 2GT5A 3RPPA 1S4BP 3QFAC 5INYA 4NHWA 2AV4A 2L57A 5H5QA 17GSA 3TJFA 1HYUA 3C7MA 4MZBA 3UOMA 1BF5A 2C0GA 1XVWA 2ALBA 1OC9A 3BCKA 1ACVA 3IOSA 3D6IA 2L6DA 1J08A 3ERFA 1WMJA 2IL3A 4ZILA 2O3EA 4PNGA 5A5HB 18GSA 1TKDB 5CRGA 2H75A 4CY8A 1XWBA 1PX6A 2WGRA 4KDYA 3M3MA 5D9TA 3O3TA 3TJBA 2C8UA 4KAEA 1X5DA 3ISOA 3MYDA 4K5RA 5IMDA 1F6MC 2IJYA 3G9BA 5H5RA 1A24A 2JACA 1X9SB 3HVVA 1GTBA 3J7Yk 5JWOB 1HD2A 2O36A 5IIZA 5J41A 2MMNA 3GA4A 4MMMA 1XW5A 2LRTA 1A2LA 4F2IA 3VK9A 3P90A 3BBYA 2MBSA 3EC3A 2VL9A 5HR2A 1E2YA 5J4YA 1B4PA 2LJAA 1TW9A 2C3QA 6GSYA 2CX3A 2GSTA 3IDVA 3W8JA 1RQMA 1J0FA 5D9VA 3GTUA 4OFNA 1EZKA 2LEGA 3GMFA 3RAZA 4L8EA 2B1LA 1OE8A 5J5NA 2VAFA 2TRCP 3GX0A 2LRCA 1TOFA 1UC7A 1GRXA 1T4YA 3HYPA 2LTKA 4V1Ap 2HQTA 4I5QA 3RDWA 4YQMA 2UZ8A 4KCEA 3TRQA 1SYXA 4K7NA 4DSSA 4MF5A 1M2BA 5IMFA 4K2XA 1GNWA 4PUFC 1OKTA 3EE2A 2E0QA 3MWHA 4LL4B 10GSA 1OYJA 2VLUA 3L0HA 3TKRA 2DIZA 4WBJA 5C04A 2H1BA 3VURA 3UAPA 1PQNA 4GDFA 2YZUA 3VI7A 3IK7A 1X5EA 3GHAA 4I6XA 5IM9A 1R5PA 3V1WA 3KGKA 4MJAA 1TRWA 1A0RP 1SKSB 4GTUA 4MPGA 4MH2A 4BL7A 1YY7A 4HZ2A 2HZEA 4I2UA 3LG6A 4HQZA 1AXDA 1GSDA 1GSUA 4KX4A 3ZLPA 4EO3A 1DE2A 5AGYA 3IA1A 2MMAA 3GYKA 2MZCA 2J9HA 2H6ZA 4GF0A 4O5QA 3PPUA 5ECKB 19GSA 2H30A 4K7IA 3DEXA 3A5WA 4OO4A 4HJMA 5G2ZA 5GAPD 1EEJA 3KH9A 2LJRA 3A2WA 1VF4A 3EINA 2WJUA 1K3LA 1I9DA 1K0BA 1TJDA 4ECJA 1THOA 1OC8A 4ZXGA 1SL0B 2GSQA 1U87A 3NOFA 2VLTA 1SU9A 1BG1A 1XG8A 1TTZA 2EFDA 1QXHA 4MK3A 1EGRA 1G6WA 3HJMA 2L5LA 2DMLA 3APOA 5J9CA 4G10A 4I2TA 2H0IA 1URMA 3TKQA 2YN1A 4ECBA 4TRXA 2RM6A 3I9V2 5A4VA 3H4KA 3LSZA 3FZ5A 3Q6OA 3E9JB 1TRSA 2NBSA 4BPYA 4G0IA 3APQA 4J57E 2B5YA 3M8NA 4KF9A 1ERUA 5F0GA 1PMTA 5JCWA 5HR1A 4Q5RA 2V6KA 5HR0A 3LORA 1TK0B 2PMTA 2FLSA 2R0CA 1FVJA 4ZBDA 4ZBBA 4IN0A 4GRFA 3RPNA 4E8HA 4IBPA 2XC2A 3WYWA 4AI6A 4EL1A 5HFKA 1WRYA 3LGCA 4IVFA 1QFNA 2VL3A 2V2GA 2ES7A 3KJYA 3F6DA 2O89A 2H74A 3BCIA 1PL1A 4XIHA 3HMJG 5HR3A 4HJ2A 1YEXA 2NVLA 4PI0C 1T1VA 4O5RA 1M9BA 4NWYA 2R6KA 6GSSA 2VD1A 4USSA 2H1DA 4Q5QA 4X43A 2MYGA 1FHEA 1KBNA 4MCUA 1NW2A 2I4AA 3IHGA 1JLWA 2CVDA 5A1NB 1ZYPA 1V9WA 4EXJA 2RM5A 4TN8A 5H5SA 4IKHA 2GDRA 5G5FA 2JL4A 4KGIA 4AJ7A 3EURA 2MMOA 1YVLA 3HCZA 2H66A 1AW9A 1AQWA 1NHYA 3KMOA 2OE1A 3LXTA 4POMA 5E4WA 1O6JA 2PUKC 2RIIA 3ZIVA 1KTEA 5JWRB 4ZL8A 1DUGA 2HE3A 3CSIA 3QCPA 2QC7A 4HU7A 3AY8A 2H70A 5JCGA 3H8QA 3ZIJA 2MBTA 5C00A 2AYTA 3IPZA 4BWQA 4WXTA 5B8AA 2VD0A 2WVYA 3FZ9A 5IOWA 4K6XA 1PA3A 2C80A 5CRDA 5DALA 3F4RA 3IR4A 1B9XC 4GLTA 4H86A 3TGZA 4OFMA 1OC9B 4V2LA 2E7PA 3RGBC 3G7IA 2LUSA 2FA4A 3LEFA 5B6MA 5GZZB 5B7CA 3GV1A 1GUHA 3Q19A 13GSA 2NDOA 2GGTA 2L5OA 2GQLA 4FQUA 5KN1A 2HLSA 3WGDA 4KE3A 3MNGA 5COHA 4EUYA 1GL8A 2E2MA 2GSSA 3C73A 2TIRA 2ZCTA 2OADA 4MPFA 5GSSA 5ECRB 5LCZA 1T3BA 4NMUA 4EC0A 2DJ0A 1FO5A 2HSNB 4N11A 3ZMLA 2HXKA 2WVZA 1T00A 3Q74A 20GSA 2B5XA 1GSQA 4D73B 2B7KA 5J40A 3FMWA 4DVCA 1GLPA 1VGLA 2R0PA 2KUCA 3DXBA 4IJIA 2P5QA 1W4VA 5L71A 1Z9HA 1EV4A 3L4NA 1XWKA 4WF5A 5A4UA 3S9FA 3GTUB 1AQXA 2VOCA 2H1LA 3QOUA 3HD5A 2HNLA 3IC4A 4J56E 4BWSA 2YCDA 2CZ3A 2WW1A 4NAXA 4JR6A 3ME8A 2OT3A 3Q18A 2EC4A 3UBKA 2KOKA 2F9SA 5F05A 3CHXC 3FRCA 1TRVA 1PKWA 2O87A 2FWEA 2V6OA 4Z2TA 5ECOB 1SK0A 1F9MA 3CBUA 4AKXB 6GSVA 2R2JA 2DJ1A 5ECSA 3ZTLA 4MJEA 2G0FA 1ON4A 2LQQA 3BJ5A 1M9AA 3RBTA 4PUAA 2HRAA 1USBA 2VCXA 4YQUA 2PU9C 1GSEA 1N8JA 3IK9A 4OD7A 5B8BA 1F3AA 4XTSA 2FWGA 14GSA 1G6YA 5B6NA 3HJOA 3TDGA 1SYRA 5ECQB 2I1UA 2YWOA 4KCAA 4YQVA 3ZREA 2QSIA 1BJXA 3FZ4A 4PQIA 1C72A 5CRHA 4IJ3A 1A2JA 4HU9A 4BL7B 2HZEB 2DIYA 1PFOA 3GSTA 2O85A 3IBHA 3DD3A 3TJGA 2F51A 5AISA 3TOTA 1SENA 3HA9A 1VRSD 3GRXA 12GSA 1AQVA 3VI5A 1WJKA 3GL5A 4CHSA 4XRDA 1MTCA 2H8LA 3DIEA 2OE3A 1O81A 4G9HA 4E8EA 4HQSA 3O76A 2V1MA 5DJLA 3ZMKA 4MH3A 2IFQA 5A34A 2TRXA 4E68A 1PRXA 1EEMA 2WW3A 4G0KA 4HI7A 3J7Yb 1AAZA 2OJLA 2GLRA 5G5EA 3TRXA 3A3TA 3KD0A 4RQRA 3KZQA 2GZZA 4KB3A 2LSTA 1YF1A 1NSWA 4PTSA 1X9WB 5EVOA 3ZRDA 2RUEA 2HZFA 1A8LA 4JZQA 5G30A 5AIVA 1B8XA 4TXOB 2HT9A 2C0FA 1I1IP 4XS6A 4IS0A 16GSA 4G19A 4CY6A 3D5JA 4N0VA 3GIXA 4O7HA 2IMEA 5J9BA 2CX4A 5ELGA 5JWQB 1HQOA 2YWNA 5DBQA 5CREA 3KP8A 4ILFA 2YV7A 3LQ7A 2CA8A 4TR1A 1EOHA 5DCGA 5IO2A 5AIXA 3HKRA 1SKWB 1V40A 5IMCA 3TKPA 2O8VB 5ABRA 4RUVA 3PH9A 3P7XA 2WDUA 1PGTA 3WT1A 1GP1A 2GZYA 1OVNA 3F8UA 1B9YC 4P3YB 5ECHB 2H72A 4WEYA 5CRWA 3A5IA 5ELAA 2K8SA 5IO0A 2BJXA 2GZPA 3E3EA 1TK5B 4N0ZA 4MLYA 1S3AA 2EFCA 2HSMA 5KEJA 3UBLA 1JZRA 4IGJA 3GFKA 5KN3A 2WCIA 2R37A 1V98A 5D9WA 1F2EA 5J4UA 1O8WA 3CYNA 3UL3A 1O85A 1GTAA 4WR4A 4NV2A 4WETA 1TK8B 11GSA 3F4SA 2PGTA 2CV4A 2K18A 5DDLA 3W6GA 2C0DA 1T8EB 4BVYA 2WW2A 4RI6A 4DEJA 4IW9A 1ZOFA 1JLVA 4PQ1A 4L5LA 3HHVA 2ON5A 4IELA 1XXUA 2GSRA 2DKIA 3HXSA 1Z6MA 3TOUA 4HOJA 4LLRA 1U88A 1BYEA 5ECIB 1A0FA 1U3IA 3KTBA 3ERGA 2OBIA 4GQCA 4V1Ag 1XWGA 2VCVA 5IQYA 4HS1A 3FR6A 1ERVA 1J9BA 3ME7A 4K2DA 1SK1A 1TRUA 1UVZA 3P8WA 1F37A 2PPTA 1EP7A 5DALB 3UIWA 2P5RA 4IP6A 1B48A 5DAKA 4YAPA 3QAGA 2LV3A 4MJBA 3HJPA 3GKNA 3ZZXA 2H0GA 2YANA 1XWAA 5GAND 2JZSA 3QR6A 1BX9A 1K3OA 1M7TA 4FYBA 5J47A 1O7UA 1SK2A 3GURA 2X64A 1S3DA 4MABA 2AB6A 3D21A 3D22A 1BG5A 3QDNA 3TKSA 1TU8A 1XPVA 4PGTA 3IRAA 2EIOA 2FGXA 2CT6A 3TJKA 3ED3A 2GS3A 5ENUA 1GTUA 3HZ4A 4AKGA 2N5FA 2JU5A 1VF1A 3GNJA 4TR4A 4X4JA 2C1YA 2B1KA 1ML6A 2HSHA 3ZFLA 3E0UA 1HNCA 4JE1A 4KDUA 2JZTA 4JEDA 4L0UA 1GUKA 2FNOA 4PQHA 1K0NA 1TI1A 2XPDA 4JBBA 1M2DA 2WFCA 3L9UA 4ACSA 2I9HA 3MDKA 2FCHA 2DLXA 3IHQA 3HDCA 5D8IA 2DSAA 3BOAA 3M9JA 3QAWA 5J3RA 5BMUA 5IPHA 1SVOA 3KMNA 4MJCA 2VCWA 3LYPA 4YKFA 2YOIA 2DBCA 5ID2B 4MF6A 4EF0A 3EMPA 1K0OA 2KP2A 3K8NA 3VWWA 4I8BA 3KP9A 3WT2A 2C3TA 3M1GA 1SVLA 5LD0A 4AKHA 4XCSA 3H93A 4GQFA 1FG4A 3UJ1A 2YWIA 4CW9A 1PSQA 2YJHA 4ZB9A 5A4WA 5EPFA 1UA5A 1A8YA 3LFLA 4Z7XA 1M0UA 4WR5A 2HRFA 2AHEA 3GN3A 3N5OA 1EOGA 2VCQA 1YEWC 3F63A 1Z7PA 1GNEA 6GSXA 4FYUA 4KSOA 4N30A 3DWVA 1ZYQB 3FZAA
chains in the Genus database with same CATH topology
2IWTA 3TJJA 3F3QA 1OE7A 1JZOA 2OE0A 2VO4A 2EIRA 4JRRA 1LBKA 1ZYNA 1JZDA 1ZGNA 1TXUA 3APSA 4ICYA 1MDJA 4IQAA 6GSUA 2L4QA 3VWXA 2WB9A 2KP1A 5AN1A 4MA9A 1V57A 4AF2A 1SJZA 5IMVA 5ECMB 3CRTA 3L9SA 5EL8A 2H1AA 3IAS2 1E6BA 4BA7A 2YJ7A 1GWCA 1ZZYA 5DQYA 3NZNA 5G1LA 1GSFA 1NM3A 1U3AA 4KH7A 2V41A 4NXIA 2HYXA 2G2QA 4AJ8A 1R26A 1GH2A 2HRNA 2VL2A 2N5BA 1TI3A 1FB6A 4FO5A 3F9UA 3FEUA 4WKWA 4DSQA 3U6VA 2VIMA 1ZCPA 1R4WA 4O32A 3D4TA 2C0EA 4EE0A 4EIQA 2GQKA 2LRNA 3WGXA 8GSSA 5A34B 4POBA 1G7EA 2OBKA 5D73A 1FOVA 2JZRA 5JCUA 1YKCA 1QGVA 2CAIA 2QGVA 2AAWA 1WP0A 4G0LA 5IPGA 2HI7A 4G01A 2GT6A 4ZL7A 5F8BA 4ISDA 2R0GA 5F07A 1XW9A 3EMXA 3A2VA 5DJMA 2YNXA 1XBSA 3GKMA 3HY2A 3KXOA 3MAKA 2ON7A 2A4HA 2VLVA 2XBIA 3P2AA 1Q98A 5CYYA 4YH2A 4KSMA 5IMZA 4OFTA 2LNTA 2V32A 5E59A 2JADA 3I69A 4DSSB 2M46A 2QKEA 4RQXA 4GCIA 2VL2C 2A2RA 3CXGA 4L0WA 4ML1A 1I5GA 4HEA2 4TR1B 4DSRA 3FHKA 1H4OA 3SWLA 1MD3A 4I97A 3C8EA 2H0HA 5LNKe 2AUVA 4OO5A 3R3EA 4K5SA 2YZHA 1V58A 3GL3A 5CNWA 1IYIA 2AJQB 4Z2UA 1CQGA 3EYTA 2A2SA 4EDZA 5HQPA 3LXZA 1Q4JA 1DSBA 1ZYEA 1VF3A 4CDOA 1KNGA 3IXRA 3HZ8A 1SJ6A 3TKSE 2HSMB 3TRPA 1V2AA 4TOPA 2FY6A 4KA0A 2YPMA 4ML6A 2VUPA 3A2XA 4JR4A 2WULA 2X8HA 4XS4A 1XZOA 2PN8A 3ZITA 3PINA 3FR9A 1G7OA 1WE0A 3IAM2 1MEKA 1IYHA 1M99A 2RLIA 2KLXA 1PD21 2DJ3A 1PN0A 2H6XA 4K7OA 2X8GA 1THXA 1SKRB 4BVYB 1XW6A 2MMZA 4K8MA 5DQSA 1M2AA 2PVOC 5IOXA 4GXZA 2IMFA 4MZCA 3DVXA 3RHBA 2DKHA 4K9ZA 3VWUA 1SJIA 4O5UA 3VPTA 2R4VA 4YKGA 4PURA 4X0XA 2IN3A 3US3A 5FWGA 4GSSA 1FB0A 1T4ZA 2HSNA 1HNBA 5KOXA 3QFBC 2PVQA 1WPIA 1XOAA 3GKXA 5DAKB 4XHMA 4L5OA 2GQMA 4D73A 4K1FA 2H73A 3ZL5A 2X4AA 3GX8A 2H19A 2IIYA 4A5PA 1SVMA 2ZUPA 4HZ4A 2PWJA 1FVKA 4KW6A 4N3ZA 2REMA 4FYCA 4IP1A 6GSTA 3IV4A 2CVBA 1JFUA 4KDXA 4QQ7A 2DJJA 3QPMA 4POLA 2H71A 3CWGA 1Z5YE 5F06A 5BRTA 3ZFBA 3TCOA 4V2MA 5CO3A 3CTGA 3HVXA 1GLQA 1GSSA 2FD3A 1CQHA 4HDEA 1WOUA 2Z9SA 2KHPA 2YP6A 3NIVA 4WBRD 4J2FA 1AC1A 1EP8A 2HRKA 1SL1B 1PN9A 1DE1A 3F4TA 1G0TA 1GSYA 4WF4A 4Q5FA 5CP1A 4MP4A 1O8XA 2P31A 4GSNA 2L4CA 4F9ZA 3R2QA 1GULA 4EVMA 1AIUA 3WGEA 1Y1UA 4NPBA 2QA1A 3L78A 3G7YA 1GTIA 4BVXA 4EIPA 1H75A 1KEBA 2EFEA 3LW9A 5ECPB 2K6VA 3KCMA 2FWFA 1O73A 3IE3A 3PR8A 5BMUB 2M72A 4ECCA 3I6AA 4TXVA 1BEDA 2X8CA 2O7KA 2VCZA 1XWCA 3UARA 5CAXA 1JZWA 2OACA 5G31A 3CRUA 2JSYA 1SD8A 6GSWA 3IC8A 1FW1A 4ZIJA 2HSYA 3L9VA 1ABAA 2WRTA 5A5HA 5FT3A 1XCCA 2DMMA 4K0NA 1ILOA 4IQ1A 1R7HA 4TKYA 4EDYA 1ERWA 4AJ6A 5FHIA 3CTFA 1RK4A 3GKKA 2PERA 4TW5A 1U6TA 2B6MA 3RHCA 3OR5A 4O92A 2GTUA 1FOHA 2E2GA 1S3CA 3H1NA 2F3MA 1LU4A 4ZB8A 1MDKA 2L59A 2NPBA 4Z2RA 1B4QA 3ZYWA 5ECNB 3EU4A 1SD9A 2H1GA 1F3BA 4MDCA 2C4JA 2DC5A 3H79A 1BAYA 5KOWA 3BD2A 3GSSA 2JSZA 3EPTA 3QAVA 5ECLB 3UVTA 4PXOA 3MIXA 1YJ6A 2P0GA 4YAVA 4XRAA 1NHOA 3G7JA 9GSSA 2EIQA 2FUG2 4N10A 4TXOA 4RI7A 3UEMA 1YF0A 3GUSA 3TB2A 4XS1A 2OKAA 2YWMA 3C1SA 1A2MA 1TDIA 2X99A 5D96A 3CSHA 2B3SA 1X5CA 4F0BA 3F0IA 3N9JA 2CZ2A 1ST9A 2LQOA 1JHBA 4LMVA 1FAAA 5D9XA 4QMKA 4AGSA 1GUMA 1HNAA 1XFLA 3EVIA 4GSTA 2WS2A 2C3NA 4ID0A 2WZ9A 3DRNA 3UVHA 4MF7A 1K3YA 2X49A 3VFIA 3EWLA 2VKZG 3DKSA 3DYRA 1PX7A 3LJRA 1YDKA 2H76A 1XOBA 2B7JA 4MNNA 3O6TA 2FHEA 3TKSC 5G1KA 1SL2B 1MDIA 4FH8A 1EWXA 3LYKA 4OCFA 2H6YA 4MZWA 3VLNA 4ZB7A 1LJRA 5DVBA 1DBYA 3CMIA 4ZBAA 4IHUA 3M9KA 1EGOA 1Z6NA 4OCEA 4GWRA 2CAQA 1YKAA 1A23A 2R3XA 3HVSA 3MSZA 1X0RA 4JU5A 3WD6A 1YQ1A 2FA8A 1UN2A 2H01A 5A5KA 4F82A 1RW1A 3C71A 1MD4A 3ZVJD 1K0MA 1QUWA 1VF2A 1Z3EA 2DJKA 2LNSA 3KEBA 2CVKA 1PKZA 2A4VA 2LS5A 3I43A 2IPAA 2N5AA 4PX1A 4KUNA 2RUFA 5HFGA 4PNFA 5DCHA 4POKA 3M0FA 4W66A 1QMVA 22GSA 2D2ZA 3QMXA 4NHZA 1Y6EA 2GVPA 4FIWA 1AUCA 1ZL9A 2DJ2A 4TR0A 3D0ZA 2I3YA 1X9MB 1ERTA 4XS4B 4ZL9A 2YV9A 3F3RA 1K0CA 2J23A 2M80A 1K0AA 1OKDA 5D93A 3TU3B 3TUEA 3CSJA 4F0CA 2BTOT 1YEPA 4TVEA 3PGTA 3ZVJA 1QK8A 4ULXA 4G2EA 3W8SA 1W89A 4QL9A 2XPEA 2PBJA 2O5VA 2VCTA 5GSTA 1ZMAA 5J4VA 3KIJA 3FW2A 2LKUA 4ECIA 2R5GA 2VM1A 4NV5A 1N2AA 3DVWA 4OMVA 4KNDA 3UMAA 2F8AA 2A2PA 1R5AA 2IMDA 1XIYA 2IFQB 1QQ2A 2HFDA 1TXXA 4LA1A 3JCML 4LMWA 4OWYA 4F03A 3DGQA 2XBQA 3GH6A 3SBCA 5KN0A 3ERWA 2VM2A 5IMAA 1OC3A 4AKIA 2L6CA 3U5RE 3VPQA 4QL7A 3F6FA 2XHFA 1T7PB 5HFIA 2FWHA 3FYGA 2ZNMA 2OA7A 3FR3A 1Y25A 3FK8A 4HUAA 5KN2A 4TR3A 2LJKA 2CQ9A 3VWVA 4Q5NA 2K9FA 1TP9A 1WWJA 3LWAA 1N25A 5ID2A 5EY6A 1PL2A 2UV8G 2B5EA 3DMLA 2HRKB 4ZB6A 1OAZA 5A1NA 1EV9A 1XVQA 2EFHA 3FKFA 2K8VA 3FY7A 7GSSA 2QA2A 2IMKA 2IMIA 3KM6A 3QD9A 4V2NA 1K0DA 3C1RA 4X1UA 2F8FA 2I81A 2NTOA 3KH7A 4LL1B 3D4MA 1TU7A 1Z7RA 3KTLA 3EU3A 4EKZA 3GH9A 1YZXA 4K0GA 4BVXB 1BQ7A 2BMXA 1WIKA 2GT5A 3RPPA 3QFAC 5INYA 4NHWA 2AV4A 2L57A 5H5QA 17GSA 3TJFA 1HYUA 3C7MA 4MZBA 3UOMA 1BF5A 2C0GA 1XVWA 2ALBA 1OC9A 3BCKA 1ACVA 3IOSA 3D6IA 2L6DA 1J08A 3ERFA 1WMJA 2IL3A 4ZILA 4PNGA 5A5HB 18GSA 1TKDB 5CRGA 2H75A 4CY8A 1XWBA 1PX6A 2WGRA 4KDYA 3M3MA 5D9TA 3O3TA 3TJBA 2C8UA 4KAEA 1X5DA 3ISOA 3MYDA 4K5RA 5IMDA 1F6MC 2IJYA 3G9BA 5H5RA 1A24A 2JACA 1X9SB 3HVVA 1GTBA 3J7Yk 5JWOB 1HD2A 5IIZA 5J41A 2MMNA 3GA4A 4MMMA 1XW5A 2LRTA 1A2LA 4F2IA 3VK9A 3P90A 3BBYA 2MBSA 3EC3A 2VL9A 5HR2A 1E2YA 5J4YA 1B4PA 2LJAA 1TW9A 2C3QA 6GSYA 2CX3A 2GSTA 3IDVA 3W8JA 1RQMA 1J0FA 5D9VA 3GTUA 4OFNA 1EZKA 2LEGA 3GMFA 3RAZA 4L8EA 2B1LA 1OE8A 5J5NA 2VAFA 2TRCP 3GX0A 2LRCA 1TOFA 1UC7A 1GRXA 1T4YA 3HYPA 2LTKA 4V1Ap 2HQTA 4I5QA 3RDWA 4YQMA 2UZ8A 4KCEA 3TRQA 1SYXA 4K7NA 4DSSA 4MF5A 1M2BA 5IMFA 4K2XA 1GNWA 4PUFC 1OKTA 3EE2A 2E0QA 3MWHA 4LL4B 10GSA 1OYJA 2VLUA 3L0HA 3TKRA 2DIZA 4WBJA 5C04A 2H1BA 3VURA 3UAPA 1PQNA 4GDFA 2YZUA 3VI7A 3IK7A 1X5EA 3GHAA 4I6XA 5IM9A 1R5PA 3V1WA 3KGKA 4MJAA 1TRWA 1A0RP 1SKSB 4GTUA 4MPGA 4MH2A 4BL7A 1YY7A 4HZ2A 2HZEA 4I2UA 3LG6A 4HQZA 1AXDA 1GSDA 1GSUA 4KX4A 3ZLPA 4EO3A 1DE2A 5AGYA 3IA1A 2MMAA 3GYKA 2MZCA 2J9HA 2H6ZA 4GF0A 4O5QA 3PPUA 5ECKB 19GSA 2H30A 4K7IA 3DEXA 3A5WA 4OO4A 4HJMA 5G2ZA 5GAPD 1EEJA 3KH9A 2LJRA 3A2WA 1VF4A 3EINA 2WJUA 1K3LA 1I9DA 1K0BA 1TJDA 4ECJA 1THOA 1OC8A 4ZXGA 1SL0B 2GSQA 1U87A 3NOFA 2VLTA 1SU9A 1BG1A 1TTZA 2EFDA 1QXHA 4MK3A 1EGRA 1G6WA 3HJMA 2L5LA 2DMLA 3APOA 5J9CA 4G10A 4I2TA 2H0IA 1URMA 3TKQA 2YN1A 4ECBA 4TRXA 2RM6A 3I9V2 5A4VA 3H4KA 3LSZA 3FZ5A 3Q6OA 3E9JB 1TRSA 2NBSA 4BPYA 4G0IA 3APQA 4J57E 2B5YA 3M8NA 4KF9A 1ERUA 5F0GA 1PMTA 5JCWA 5HR1A 4Q5RA 2V6KA 5HR0A 3LORA 1TK0B 2PMTA 2FLSA 2R0CA 1FVJA 4ZBDA 4ZBBA 4IN0A 4GRFA 3RPNA 4E8HA 4IBPA 2XC2A 3WYWA 4AI6A 4EL1A 5HFKA 1WRYA 3LGCA 4IVFA 1QFNA 2VL3A 2V2GA 2ES7A 3KJYA 3F6DA 2O89A 2H74A 3BCIA 1PL1A 4XIHA 3HMJG 5HR3A 4HJ2A 1YEXA 2NVLA 1T1VA 4O5RA 1M9BA 4NWYA 2R6KA 6GSSA 2VD1A 4USSA 2H1DA 4Q5QA 4X43A 2MYGA 1FHEA 1KBNA 4MCUA 1NW2A 2I4AA 3IHGA 1JLWA 2CVDA 5A1NB 1ZYPA 1V9WA 4EXJA 2RM5A 4TN8A 5H5SA 4IKHA 2GDRA 5G5FA 2JL4A 4KGIA 4AJ7A 3EURA 2MMOA 1YVLA 3HCZA 2H66A 1AW9A 1AQWA 1NHYA 3KMOA 2OE1A 3LXTA 4POMA 5E4WA 1O6JA 2PUKC 2RIIA 3ZIVA 1KTEA 5JWRB 4ZL8A 1DUGA 2HE3A 3CSIA 3QCPA 2QC7A 4HU7A 3AY8A 2H70A 5JCGA 3H8QA 3ZIJA 2MBTA 5C00A 2AYTA 3IPZA 4BWQA 4WXTA 5B8AA 2VD0A 3FZ9A 5IOWA 4K6XA 1PA3A 2C80A 5CRDA 5DALA 3F4RA 3IR4A 1B9XC 4GLTA 4H86A 3TGZA 4OFMA 1OC9B 4V2LA 2E7PA 3G7IA 2LUSA 2FA4A 3LEFA 5B6MA 5GZZB 5B7CA 3GV1A 1GUHA 3Q19A 13GSA 2NDOA 2GGTA 2L5OA 2GQLA 4FQUA 5KN1A 2HLSA 3WGDA 4KE3A 3MNGA 5COHA 4EUYA 1GL8A 2E2MA 2GSSA 3C73A 2TIRA 2ZCTA 2OADA 4MPFA 5GSSA 5ECRB 5LCZA 1T3BA 4NMUA 4EC0A 2DJ0A 1FO5A 2HSNB 4N11A 3ZMLA 2HXKA 1T00A 3Q74A 20GSA 2B5XA 1GSQA 4D73B 2B7KA 5J40A 3FMWA 4DVCA 1GLPA 1VGLA 2R0PA 2KUCA 3DXBA 4IJIA 2P5QA 1W4VA 5L71A 1Z9HA 1EV4A 3L4NA 1XWKA 4WF5A 5A4UA 3S9FA 3GTUB 1AQXA 2VOCA 2H1LA 3QOUA 3HD5A 2HNLA 3IC4A 4J56E 4BWSA 2YCDA 2CZ3A 4NAXA 4JR6A 3ME8A 2OT3A 3Q18A 2EC4A 3UBKA 2KOKA 2F9SA 5F05A 3FRCA 1TRVA 1PKWA 2O87A 2FWEA 2V6OA 4Z2TA 5ECOB 1SK0A 1F9MA 3CBUA 4AKXB 6GSVA 2R2JA 2DJ1A 5ECSA 3ZTLA 4MJEA 2G0FA 1ON4A 2LQQA 3BJ5A 1M9AA 3RBTA 4PUAA 2HRAA 1USBA 2VCXA 4YQUA 2PU9C 1GSEA 1N8JA 3IK9A 4OD7A 5B8BA 1F3AA 4XTSA 2FWGA 14GSA 1G6YA 5B6NA 3HJOA 3TDGA 1SYRA 5ECQB 2I1UA 2YWOA 4KCAA 4YQVA 3ZREA 2QSIA 1BJXA 3FZ4A 4PQIA 1C72A 5CRHA 4IJ3A 1A2JA 4HU9A 4BL7B 2HZEB 2DIYA 3GSTA 2O85A 3IBHA 3DD3A 3TJGA 2F51A 5AISA 3TOTA 1SENA 3HA9A 1VRSD 3GRXA 12GSA 1AQVA 3VI5A 1WJKA 3GL5A 4CHSA 4XRDA 1MTCA 2H8LA 3DIEA 2OE3A 1O81A 4G9HA 4E8EA 4HQSA 3O76A 2V1MA 5DJLA 3ZMKA 4MH3A 2IFQA 5A34A 2TRXA 4E68A 1PRXA 1EEMA 4G0KA 4HI7A 3J7Yb 1AAZA 2OJLA 2GLRA 5G5EA 3TRXA 3A3TA 3KD0A 4RQRA 3KZQA 2GZZA 4KB3A 2LSTA 1YF1A 1NSWA 4PTSA 1X9WB 5EVOA 3ZRDA 2RUEA 2HZFA 1A8LA 4JZQA 5G30A 5AIVA 1B8XA 4TXOB 2HT9A 2C0FA 4XS6A 4IS0A 16GSA 4G19A 4CY6A 3D5JA 4N0VA 3GIXA 4O7HA 2IMEA 5J9BA 2CX4A 5ELGA 5JWQB 1HQOA 2YWNA 5DBQA 5CREA 3KP8A 4ILFA 2YV7A 3LQ7A 2CA8A 4TR1A 1EOHA 5DCGA 5IO2A 5AIXA 3HKRA 1SKWB 1V40A 5IMCA 3TKPA 2O8VB 5ABRA 4RUVA 3PH9A 3P7XA 2WDUA 1PGTA 3WT1A 1GP1A 2GZYA 1OVNA 3F8UA 1B9YC 4P3YB 5ECHB 2H72A 4WEYA 5CRWA 3A5IA 5ELAA 2K8SA 5IO0A 2BJXA 2GZPA 3E3EA 1TK5B 4N0ZA 4MLYA 1S3AA 2EFCA 2HSMA 5KEJA 3UBLA 1JZRA 4IGJA 3GFKA 5KN3A 2WCIA 2R37A 1V98A 5D9WA 1F2EA 5J4UA 1O8WA 3CYNA 3UL3A 1O85A 1GTAA 4WR4A 4NV2A 4WETA 1TK8B 11GSA 3F4SA 2PGTA 2CV4A 2K18A 5DDLA 3W6GA 2C0DA 1T8EB 4BVYA 4RI6A 4DEJA 4IW9A 1ZOFA 1JLVA 4PQ1A 4L5LA 3HHVA 2ON5A 4IELA 1XXUA 2GSRA 2DKIA 3HXSA 1Z6MA 3TOUA 4HOJA 4LLRA 1U88A 1BYEA 5ECIB 1A0FA 1U3IA 3KTBA 3ERGA 2OBIA 4GQCA 4V1Ag 1XWGA 2VCVA 5IQYA 4HS1A 3FR6A 1ERVA 1J9BA 3ME7A 4K2DA 1SK1A 1TRUA 1UVZA 3P8WA 1F37A 2PPTA 1EP7A 5DALB 3UIWA 2P5RA 4IP6A 1B48A 5DAKA 4YAPA 3QAGA 2LV3A 4MJBA 3HJPA 3GKNA 3ZZXA 2H0GA 2YANA 1XWAA 5GAND 2JZSA 3QR6A 1BX9A 1K3OA 1M7TA 4FYBA 5J47A 1O7UA 1SK2A 3GURA 2X64A 1S3DA 4MABA 2AB6A 3D21A 3D22A 1BG5A 3QDNA 3TKSA 1TU8A 1XPVA 4PGTA 3IRAA 2EIOA 2FGXA 2CT6A 3TJKA 3ED3A 2GS3A 5ENUA 1GTUA 3HZ4A 4AKGA 2N5FA 2JU5A 1VF1A 3GNJA 4TR4A 4X4JA 2C1YA 2B1KA 1ML6A 2HSHA 3ZFLA 3E0UA 1HNCA 4JE1A 4KDUA 2JZTA 4JEDA 4L0UA 1GUKA 2FNOA 4PQHA 1K0NA 1TI1A 2XPDA 4JBBA 1M2DA 2WFCA 3L9UA 4ACSA 2I9HA 3MDKA 2FCHA 2DLXA 3IHQA 3HDCA 5D8IA 2DSAA 3BOAA 3M9JA 3QAWA 5J3RA 5BMUA 5IPHA 1SVOA 3KMNA 4MJCA 2VCWA 3LYPA 4YKFA 2YOIA 2DBCA 5ID2B 4MF6A 4EF0A 3EMPA 1K0OA 2KP2A 3K8NA 3VWWA 4I8BA 3KP9A 3WT2A 2C3TA 3M1GA 1SVLA 5LD0A 4AKHA 4XCSA 3H93A 4GQFA 1FG4A 3UJ1A 2YWIA 4CW9A 1PSQA 2YJHA 4ZB9A 5A4WA 5EPFA 1UA5A 1A8YA 3LFLA 4Z7XA 1M0UA 4WR5A 2HRFA 2AHEA 3N5OA 3GN3A 1EOGA 2VCQA 3F63A 1Z7PA 1GNEA 6GSXA 4FYUA 4KSOA 4N30A 3DWVA 1ZYQB 3FZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWT A;  3TJJ A;  3F3Q A;  1OE7 A;  1JZO A;  2OE0 A;  2VO4 A;  2EIR A;  4JRR A;  1LBK A;  1JZD A;  1ZGN A;  3APS A;  1MDJ A;  4IQA A;  6GSU A;  2L4Q A;  3VWX A;  2WB9 A;  2KP1 A;  5AN1 A;  4MA9 A;  1V57 A;  4AF2 A;  1SJZ A;  5IMV A;  5ECM B;  3CRT A;  3L9S A;  5EL8 A;  2H1A A;  3IAS 2;  1E6B A;  4BA7 A;  2YJ7 A;  1GWC A;  1ZZY A;  5DQY A;  3NZN A;  5G1L A;  1GSF A;  1NM3 A;  1U3A A;  4KH7 A;  2V41 A;  4NXI A;  2HYX A;  2G2Q A;  4AJ8 A;  1R26 A;  1GH2 A;  2HRN A;  2VL2 A;  2N5B A;  1TI3 A;  1FB6 A;  4FO5 A;  3F9U A;  3FEU A;  4WKW A;  4DSQ A;  3U6V A;  2VIM A;  1ZCP A;  1R4W A;  4O32 A;  3D4T A;  2C0E A;  4EE0 A;  2GQK A;  2LRN A;  3WGX A;  8GSS A;  4POB A;  1G7E A;  2OBK A;  5D73 A;  1FOV A;  2JZR A;  5JCU A;  1YKC A;  1QGV A;  2CAI A;  2QGV A;  2AAW A;  1WP0 A;  4G0L A;  5IPG A;  2HI7 A;  2GT6 A;  4ZL7 A;  5F8B A;  4ISD A;  5F07 A;  1XW9 A;  3EMX A;  3A2V A;  5DJM A;  2YNX A;  1XBS A;  3GKM A;  3HY2 A;  3KXO A;  3MAK A;  2ON7 A;  2VLV A;  2XBI A;  3P2A A;  1Q98 A;  5CYY A;  4YH2 A;  4KSM A;  5IMZ A;  4OFT A;  2LNT A;  2V32 A;  5E59 A;  2JAD A;  3I69 A;  4DSS B;  2M46 A;  2QKE A;  4RQX A;  4GCI A;  2VL2 C;  2A2R A;  3CXG A;  4L0W A;  4ML1 A;  1I5G A;  4HEA 2;  4TR1 B;  4DSR A;  3FHK A;  1H4O A;  3SWL A;  1MD3 A;  4I97 A;  3C8E A;  2H0H A;  5LNK e;  2AUV A;  4OO5 A;  3R3E A;  2YZH A;  1V58 A;  3GL3 A;  5CNW A;  1IYI A;  2AJQ B;  1CQG A;  3EYT A;  2A2S A;  4EDZ A;  5HQP A;  3LXZ A;  1Q4J A;  1DSB A;  1ZYE A;  1VF3 A;  4CDO A;  1KNG A;  3IXR A;  3HZ8 A;  1SJ6 A;  3TKS E;  2HSM B;  3TRP A;  1V2A A;  4TOP A;  2FY6 A;  4KA0 A;  2YPM A;  4ML6 A;  2VUP A;  3A2X A;  4JR4 A;  2WUL A;  2X8H A;  4XS4 A;  1XZO A;  2PN8 A;  3ZIT A;  3PIN A;  3FR9 A;  1G7O A;  1WE0 A;  3IAM 2;  1MEK A;  1IYH A;  1M99 A;  2RLI A;  2KLX A;  1PD2 1;  2DJ3 A;  2H6X A;  4K7O A;  2X8G A;  1THX A;  1SKR B;  4BVY B;  1XW6 A;  2MMZ A;  4K8M A;  5DQS A;  1M2A A;  2PVO C;  5IOX A;  4GXZ A;  2IMF A;  4MZC A;  3DVX A;  3RHB A;  4K9Z A;  3VWU A;  1SJI A;  3VPT A;  2R4V A;  4PUR A;  4X0X A;  2IN3 A;  3US3 A;  5FWG A;  4GSS A;  1FB0 A;  1T4Z A;  1HNB A;  3QFB C;  2PVQ A;  1WPI A;  1XOA A;  3GKX A;  5DAK B;  4XHM A;  4L5O A;  2GQM A;  4D73 A;  4K1F A;  2H73 A;  3ZL5 A;  3GX8 A;  2H19 A;  2IIY A;  2ZUP A;  4HZ4 A;  2PWJ A;  1FVK A;  4KW6 A;  2REM A;  4FYC A;  4IP1 A;  6GST A;  3IV4 A;  2CVB A;  1JFU A;  4KDX A;  4QQ7 A;  2DJJ A;  3QPM A;  4POL A;  2H71 A;  1Z5Y E;  5F06 A;  3ZFB A;  3TCO A;  4V2M A;  5CO3 A;  3CTG A;  3HVX A;  1GLQ A;  1GSS A;  2FD3 A;  1CQH A;  4HDE A;  1WOU A;  2Z9S A;  2KHP A;  2YP6 A;  3NIV A;  4WBR D;  4J2F A;  1AC1 A;  1EP8 A;  2HRK A;  1SL1 B;  1PN9 A;  1DE1 A;  3F4T A;  1G0T A;  1GSY A;  4WF4 A;  4Q5F A;  5CP1 A;  4MP4 A;  1O8X A;  2P31 A;  4GSN A;  2L4C A;  4F9Z A;  3R2Q A;  1GUL A;  4EVM A;  1AIU A;  3WGE A;  4NPB A;  3L78 A;  3G7Y A;  1GTI A;  4BVX A;  1H75 A;  1KEB A;  5ECP B;  2K6V A;  3KCM A;  2FWF A;  1O73 A;  3IE3 A;  3PR8 A;  2M72 A;  4ECC A;  3I6A A;  4TXV A;  1BED A;  2X8C A;  2O7K A;  2VCZ A;  1XWC A;  3UAR A;  5CAX A;  1JZW A;  2OAC A;  5G31 A;  3CRU A;  2JSY A;  1SD8 A;  6GSW A;  3IC8 A;  1FW1 A;  4ZIJ A;  2HSY A;  3L9V A;  1ABA A;  2WRT A;  5FT3 A;  1XCC A;  2DMM A;  4K0N A;  1ILO A;  4IQ1 A;  1R7H A;  4TKY A;  4EDY A;  1ERW A;  4AJ6 A;  5FHI A;  3CTF A;  1RK4 A;  3GKK A;  2PER A;  4TW5 A;  1U6T A;  2B6M A;  3RHC A;  3OR5 A;  4O92 A;  2GTU A;  2E2G A;  1S3C A;  3H1N A;  2F3M A;  1LU4 A;  4ZB8 A;  1MDK A;  2L59 A;  2NPB A;  1B4Q A;  3ZYW A;  5ECN B;  3EU4 A;  1SD9 A;  2H1G A;  1F3B A;  4MDC A;  2C4J A;  2DC5 A;  3H79 A;  1BAY A;  3BD2 A;  3GSS A;  2JSZ A;  3QAV A;  5ECL B;  3UVT A;  4PXO A;  1YJ6 A;  2P0G A;  4YAV A;  4XRA A;  1NHO A;  3G7J A;  9GSS A;  2EIQ A;  2FUG 2;  4N10 A;  4TXO A;  4RI7 A;  3UEM A;  1YF0 A;  3GUS A;  3TB2 A;  4XS1 A;  2OKA A;  2YWM A;  3C1S A;  1A2M A;  1TDI A;  2X99 A;  5D96 A;  3CSH A;  2B3S A;  1X5C A;  4F0B A;  3F0I A;  3N9J A;  2CZ2 A;  1ST9 A;  2LQO A;  1JHB A;  4LMV A;  1FAA A;  5D9X A;  4AGS A;  1GUM A;  1HNA A;  1XFL A;  3EVI A;  4GST A;  2WS2 A;  2C3N A;  4ID0 A;  2WZ9 A;  3DRN A;  3UVH A;  4MF7 A;  1K3Y A;  3VFI A;  3EWL A;  3DKS A;  3DYR A;  1PX7 A;  3LJR A;  1YDK A;  2H76 A;  1XOB A;  2B7J A;  3O6T A;  2FHE A;  3TKS C;  5G1K A;  1SL2 B;  1MDI A;  4FH8 A;  1EWX A;  3LYK A;  4OCF A;  2H6Y A;  4MZW A;  3VLN A;  1LJR A;  5DVB A;  1DBY A;  3CMI A;  4ZBA A;  4IHU A;  3M9K A;  1EGO A;  1Z6N A;  4OCE A;  4GWR A;  2CAQ A;  1YKA A;  1A23 A;  2R3X A;  3HVS A;  3MSZ A;  1X0R A;  4JU5 A;  3WD6 A;  1YQ1 A;  2FA8 A;  1UN2 A;  2H01 A;  5A5K A;  4F82 A;  1RW1 A;  3C71 A;  1MD4 A;  3ZVJ D;  1K0M A;  1QUW A;  1VF2 A;  1Z3E A;  2DJK A;  2LNS A;  3KEB A;  2CVK A;  1PKZ A;  2A4V A;  2LS5 A;  3I43 A;  2IPA A;  2N5A A;  4PX1 A;  4KUN A;  2RUF A;  5HFG A;  4PNF A;  5DCH A;  4POK A;  3M0F A;  1QMV A;  22GS A;  2D2Z A;  3QMX A;  4NHZ A;  1Y6E A;  2GVP A;  4FIW A;  1AUC A;  1ZL9 A;  2DJ2 A;  4TR0 A;  3D0Z A;  2I3Y A;  1X9M B;  1ERT A;  4XS4 B;  4ZL9 A;  2YV9 A;  3F3R A;  1K0C A;  2J23 A;  2M80 A;  1K0A A;  1OKD A;  5D93 A;  3TUE A;  3CSJ A;  4F0C A;  2BTO T;  1YEP A;  4TVE A;  3PGT A;  3ZVJ A;  1QK8 A;  4ULX A;  4G2E A;  3W8S A;  1W89 A;  4QL9 A;  2XPE A;  2PBJ A;  2VCT A;  5GST A;  1ZMA A;  3KIJ A;  3FW2 A;  2LKU A;  4ECI A;  2R5G A;  2VM1 A;  4NV5 A;  1N2A A;  3DVW A;  4OMV A;  4KND A;  3UMA A;  2F8A A;  1R5A A;  2IMD A;  1XIY A;  2IFQ B;  1QQ2 A;  2HFD A;  1TXX A;  4LA1 A;  3JCM L;  4LMW A;  4OWY A;  4F03 A;  3DGQ A;  2XBQ A;  3GH6 A;  3SBC A;  5KN0 A;  3ERW A;  2VM2 A;  5IMA A;  1OC3 A;  2L6C A;  3U5R E;  3VPQ A;  4QL7 A;  3F6F A;  2XHF A;  1T7P B;  5HFI A;  2FWH A;  3FYG A;  2ZNM A;  2OA7 A;  3FR3 A;  1Y25 A;  3FK8 A;  4HUA A;  5KN2 A;  4TR3 A;  2LJK A;  2CQ9 A;  3VWV A;  4Q5N A;  2K9F A;  1TP9 A;  1WWJ A;  3LWA A;  5ID2 A;  5EY6 A;  1PL2 A;  2B5E A;  3DML A;  2HRK B;  4ZB6 A;  1OAZ A;  1EV9 A;  1XVQ A;  3FKF A;  2K8V A;  3FY7 A;  7GSS A;  2IMK A;  2IMI A;  3KM6 A;  3QD9 A;  4V2N A;  1K0D A;  3C1R A;  4X1U A;  2F8F A;  2I81 A;  2NTO A;  3KH7 A;  4LL1 B;  3D4M A;  1TU7 A;  1Z7R A;  3KTL A;  3EU3 A;  4EKZ A;  3GH9 A;  1YZX A;  4K0G A;  4BVX B;  1BQ7 A;  2BMX A;  1WIK A;  2GT5 A;  3RPP A;  3QFA C;  5INY A;  4NHW A;  2AV4 A;  2L57 A;  5H5Q A;  17GS A;  3TJF A;  1HYU A;  3C7M A;  4MZB A;  3UOM A;  2C0G A;  1XVW A;  2ALB A;  1OC9 A;  3BCK A;  1ACV A;  3IOS A;  3D6I A;  2L6D A;  1J08 A;  3ERF A;  1WMJ A;  2IL3 A;  4ZIL A;  4PNG A;  18GS A;  1TKD B;  5CRG A;  2H75 A;  1XWB A;  1PX6 A;  2WGR A;  4KDY A;  3M3M A;  5D9T A;  3O3T A;  3TJB A;  2C8U A;  4KAE A;  1X5D A;  3ISO A;  5IMD A;  1F6M C;  2IJY A;  3G9B A;  5H5R A;  1A24 A;  2JAC A;  1X9S B;  3HVV A;  1GTB A;  3J7Y k;  5JWO B;  1HD2 A;  5IIZ A;  5J41 A;  2MMN A;  3GA4 A;  4MMM A;  1XW5 A;  2LRT A;  1A2L A;  4F2I A;  3VK9 A;  3P90 A;  3BBY A;  2MBS A;  3EC3 A;  2VL9 A;  5HR2 A;  1E2Y A;  1B4P A;  2LJA A;  1TW9 A;  2C3Q A;  6GSY A;  2CX3 A;  2GST A;  3IDV A;  3W8J A;  1RQM A;  1J0F A;  5D9V A;  3GTU A;  4OFN A;  1EZK A;  2LEG A;  3GMF A;  3RAZ A;  4L8E A;  2B1L A;  1OE8 A;  5J5N A;  2VAF A;  2TRC P;  3GX0 A;  2LRC A;  1TOF A;  1UC7 A;  1GRX A;  1T4Y A;  3HYP A;  2LTK A;  4V1A p;  2HQT A;  4I5Q A;  3RDW A;  4YQM A;  2UZ8 A;  4KCE A;  3TRQ A;  1SYX A;  4K7N A;  4DSS A;  4MF5 A;  1M2B A;  5IMF A;  1GNW A;  4PUF C;  1OKT A;  3EE2 A;  2E0Q A;  3MWH A;  4LL4 B;  10GS A;  1OYJ A;  2VLU A;  3L0H A;  3TKR A;  2DIZ A;  4WBJ A;  5C04 A;  2H1B A;  3VUR A;  3UAP A;  1PQN A;  2YZU A;  3VI7 A;  3IK7 A;  1X5E A;  3GHA A;  4I6X A;  5IM9 A;  1R5P A;  3V1W A;  3KGK A;  4MJA A;  1TRW A;  1A0R P;  1SKS B;  4GTU A;  4MPG A;  4MH2 A;  4BL7 A;  1YY7 A;  4HZ2 A;  2HZE A;  4I2U A;  3LG6 A;  4HQZ A;  1AXD A;  1GSD A;  1GSU A;  4KX4 A;  3ZLP A;  4EO3 A;  1DE2 A;  5AGY A;  3IA1 A;  2MMA A;  3GYK A;  2MZC A;  2J9H A;  2H6Z A;  4GF0 A;  3PPU A;  5ECK B;  19GS A;  2H30 A;  4K7I A;  3DEX A;  3A5W A;  4OO4 A;  4HJM A;  5G2Z A;  5GAP D;  1EEJ A;  3KH9 A;  2LJR A;  3A2W A;  1VF4 A;  3EIN A;  2WJU A;  1K3L A;  1I9D A;  1K0B A;  1TJD A;  4ECJ A;  1THO A;  1OC8 A;  4ZXG A;  1SL0 B;  2GSQ A;  1U87 A;  3NOF A;  2VLT A;  1SU9 A;  1TTZ A;  1QXH A;  4MK3 A;  1EGR A;  1G6W A;  3HJM A;  2L5L A;  2DML A;  3APO A;  5J9C A;  4G10 A;  4I2T A;  2H0I A;  1URM A;  3TKQ A;  2YN1 A;  4ECB A;  4TRX A;  2RM6 A;  3I9V 2;  5A4V A;  3H4K A;  3LSZ A;  3FZ5 A;  3Q6O A;  3E9J B;  1TRS A;  2NBS A;  4BPY A;  4G0I A;  3APQ A;  4J57 E;  2B5Y A;  3M8N A;  4KF9 A;  1ERU A;  5F0G A;  1PMT A;  5JCW A;  5HR1 A;  4Q5R A;  2V6K A;  5HR0 A;  3LOR A;  1TK0 B;  2PMT A;  2FLS A;  1FVJ A;  4ZBD A;  4ZBB A;  4IN0 A;  4GRF A;  3RPN A;  4E8H A;  4IBP A;  2XC2 A;  3WYW A;  4EL1 A;  5HFK A;  1WRY A;  3LGC A;  4IVF A;  1QFN A;  2VL3 A;  2V2G A;  2ES7 A;  3KJY A;  3F6D A;  2O89 A;  2H74 A;  3BCI A;  1PL1 A;  4XIH A;  5HR3 A;  4HJ2 A;  1YEX A;  2NVL A;  1T1V A;  4O5R A;  1M9B A;  4NWY A;  2R6K A;  6GSS A;  2VD1 A;  4USS A;  2H1D A;  4Q5Q A;  4X43 A;  2MYG A;  1FHE A;  1KBN A;  4MCU A;  1NW2 A;  2I4A A;  1JLW A;  2CVD A;  1V9W A;  4EXJ A;  2RM5 A;  4TN8 A;  5H5S A;  4IKH A;  2GDR A;  5G5F A;  2JL4 A;  4KGI A;  4AJ7 A;  3EUR A;  2MMO A;  3HCZ A;  2H66 A;  1AW9 A;  1AQW A;  1NHY A;  3KMO A;  2OE1 A;  3LXT A;  4POM A;  5E4W A;  1O6J A;  2PUK C;  2RII A;  3ZIV A;  1KTE A;  5JWR B;  4ZL8 A;  1DUG A;  2HE3 A;  3CSI A;  3QCP A;  2QC7 A;  4HU7 A;  3AY8 A;  2H70 A;  5JCG A;  3H8Q A;  3ZIJ A;  2MBT A;  5C00 A;  2AYT A;  3IPZ A;  4BWQ A;  4WXT A;  5B8A A;  2VD0 A;  3FZ9 A;  5IOW A;  4K6X A;  1PA3 A;  2C80 A;  5CRD A;  5DAL A;  3F4R A;  3IR4 A;  1B9X C;  4GLT A;  4H86 A;  3TGZ A;  4OFM A;  1OC9 B;  4V2L A;  2E7P A;  3G7I A;  2LUS A;  2FA4 A;  3LEF A;  5B6M A;  5GZZ B;  5B7C A;  3GV1 A;  1GUH A;  3Q19 A;  13GS A;  2NDO A;  2GGT A;  2L5O A;  2GQL A;  4FQU A;  5KN1 A;  2HLS A;  3WGD A;  4KE3 A;  3MNG A;  5COH A;  4EUY A;  1GL8 A;  2E2M A;  2GSS A;  3C73 A;  2TIR A;  2ZCT A;  2OAD A;  4MPF A;  5GSS A;  5ECR B;  5LCZ A;  1T3B A;  4NMU A;  4EC0 A;  2DJ0 A;  1FO5 A;  2HSN B;  4N11 A;  3ZML A;  2HXK A;  1T00 A;  3Q74 A;  20GS A;  2B5X A;  1GSQ A;  4D73 B;  2B7K A;  4DVC A;  1GLP A;  1VGL A;  2KUC A;  3DXB A;  4IJI A;  2P5Q A;  1W4V A;  5L71 A;  1Z9H A;  1EV4 A;  3L4N A;  1XWK A;  4WF5 A;  5A4U A;  3S9F A;  3GTU B;  1AQX A;  2VOC A;  3QOU A;  3HD5 A;  2HNL A;  3IC4 A;  4J56 E;  4BWS A;  2YCD A;  2CZ3 A;  4NAX A;  4JR6 A;  3ME8 A;  3Q18 A;  2EC4 A;  3UBK A;  2KOK A;  2F9S A;  5F05 A;  3FRC A;  1TRV A;  1PKW A;  2O87 A;  2FWE A;  2V6O A;  5ECO B;  1SK0 A;  1F9M A;  3CBU A;  6GSV A;  2R2J A;  2DJ1 A;  5ECS A;  3ZTL A;  4MJE A;  2G0F A;  1ON4 A;  2LQQ A;  3BJ5 A;  1M9A A;  3RBT A;  4PUA A;  2HRA A;  1USB A;  2VCX A;  4YQU A;  2PU9 C;  1GSE A;  1N8J A;  3IK9 A;  4OD7 A;  5B8B A;  1F3A A;  4XTS A;  2FWG A;  14GS A;  1G6Y A;  5B6N A;  3HJO A;  3TDG A;  1SYR A;  5ECQ B;  2I1U A;  2YWO A;  4KCA A;  4YQV A;  3ZRE A;  2QSI A;  1BJX A;  3FZ4 A;  4PQI A;  1C72 A;  5CRH A;  4IJ3 A;  1A2J A;  4HU9 A;  4BL7 B;  2HZE B;  2DIY A;  3GST A;  2O85 A;  3IBH A;  3DD3 A;  3TJG A;  2F51 A;  5AIS A;  3TOT A;  1SEN A;  3HA9 A;  1VRS D;  3GRX A;  12GS A;  1AQV A;  3VI5 A;  1WJK A;  3GL5 A;  4CHS A;  4XRD A;  1MTC A;  2H8L A;  3DIE A;  2OE3 A;  1O81 A;  4G9H A;  4E8E A;  4HQS A;  3O76 A;  2V1M A;  5DJL A;  3ZMK A;  4MH3 A;  2IFQ A;  2TRX A;  1PRX A;  1EEM A;  4G0K A;  4HI7 A;  3J7Y b;  1AAZ A;  2OJL A;  2GLR A;  5G5E A;  3TRX A;  3A3T A;  3KD0 A;  4RQR A;  3KZQ A;  2GZZ A;  4KB3 A;  2LST A;  1YF1 A;  1NSW A;  4PTS A;  1X9W B;  5EVO A;  3ZRD A;  2RUE A;  2HZF A;  1A8L A;  4JZQ A;  5G30 A;  5AIV A;  1B8X A;  4TXO B;  2HT9 A;  2C0F A;  4XS6 A;  4IS0 A;  16GS A;  4G19 A;  3D5J A;  4N0V A;  3GIX A;  4O7H A;  2IME A;  5J9B A;  2CX4 A;  5ELG A;  5JWQ B;  1HQO A;  2YWN A;  5DBQ A;  5CRE A;  3KP8 A;  4ILF A;  2YV7 A;  3LQ7 A;  2CA8 A;  4TR1 A;  1EOH A;  5DCG A;  5IO2 A;  5AIX A;  3HKR A;  1SKW B;  1V40 A;  5IMC A;  3TKP A;  2O8V B;  5ABR A;  4RUV A;  3PH9 A;  3P7X A;  2WDU A;  1PGT A;  3WT1 A;  1GP1 A;  2GZY A;  1OVN A;  3F8U A;  1B9Y C;  4P3Y B;  5ECH B;  2H72 A;  4WEY A;  5CRW A;  5ELA A;  2K8S A;  5IO0 A;  2BJX A;  2GZP A;  3E3E A;  1TK5 B;  4N0Z A;  4MLY A;  1S3A A;  2HSM A;  5KEJ A;  3UBL A;  1JZR A;  4IGJ A;  3GFK A;  5KN3 A;  2WCI A;  2R37 A;  1V98 A;  5D9W A;  1F2E A;  5J4U A;  1O8W A;  3CYN A;  3UL3 A;  1O85 A;  1GTA A;  4WR4 A;  4NV2 A;  4WET A;  1TK8 B;  11GS A;  3F4S A;  2PGT A;  2CV4 A;  2K18 A;  5DDL A;  3W6G A;  2C0D A;  1T8E B;  4BVY A;  4RI6 A;  4DEJ A;  4IW9 A;  1ZOF A;  1JLV A;  4PQ1 A;  4L5L A;  3HHV A;  2ON5 A;  4IEL A;  1XXU A;  2GSR A;  3HXS A;  1Z6M A;  3TOU A;  4HOJ A;  4LLR A;  1U88 A;  1BYE A;  5ECI B;  1A0F A;  1U3I A;  3KTB A;  3ERG A;  2OBI A;  4GQC A;  4V1A g;  1XWG A;  2VCV A;  5IQY A;  4HS1 A;  3FR6 A;  1ERV A;  1J9B A;  3ME7 A;  4K2D A;  1SK1 A;  1TRU A;  1UVZ A;  3P8W A;  1F37 A;  2PPT A;  1EP7 A;  5DAL B;  3UIW A;  2P5R A;  4IP6 A;  1B48 A;  5DAK A;  4YAP A;  3QAG A;  2LV3 A;  4MJB A;  3HJP A;  3GKN A;  3ZZX A;  2H0G A;  2YAN A;  1XWA A;  5GAN D;  2JZS A;  3QR6 A;  1BX9 A;  1K3O A;  1M7T A;  4FYB A;  1O7U A;  1SK2 A;  3GUR A;  2X64 A;  1S3D A;  4MAB A;  2AB6 A;  3D21 A;  3D22 A;  1BG5 A;  3QDN A;  3TKS A;  1TU8 A;  1XPV A;  4PGT A;  3IRA A;  2EIO A;  2FGX A;  2CT6 A;  3TJK A;  3ED3 A;  2GS3 A;  5ENU A;  1GTU A;  3HZ4 A;  2N5F A;  2JU5 A;  1VF1 A;  3GNJ A;  4TR4 A;  2C1Y A;  2B1K A;  1ML6 A;  2HSH A;  3ZFL A;  3E0U A;  1HNC A;  4JE1 A;  4KDU A;  2JZT A;  4JED A;  4L0U A;  1GUK A;  2FNO A;  4PQH A;  1K0N A;  1TI1 A;  2XPD A;  4JBB A;  1M2D A;  2WFC A;  3L9U A;  4ACS A;  2I9H A;  3MDK A;  2FCH A;  2DLX A;  3IHQ A;  3HDC A;  5D8I A;  2DSA A;  3BOA A;  3M9J A;  3QAW A;  5J3R A;  5BMU A;  5IPH A;  3KMN A;  4MJC A;  2VCW A;  3LYP A;  2YOI A;  2DBC A;  5ID2 B;  4MF6 A;  4EF0 A;  3EMP A;  1K0O A;  2KP2 A;  3K8N A;  3VWW A;  4I8B A;  3KP9 A;  3WT2 A;  2C3T A;  3M1G A;  5LD0 A;  4XCS A;  3H93 A;  4GQF A;  1FG4 A;  3UJ1 A;  2YWI A;  4CW9 A;  1PSQ A;  2YJH A;  4ZB9 A;  5A4W A;  5EPF A;  1UA5 A;  1A8Y A;  3LFL A;  4Z7X A;  1M0U A;  4WR5 A;  2HRF A;  2AHE A;  3N5O A;  3GN3 A;  1EOG A;  2VCQ A;  3F63 A;  1Z7P A;  1GNE A;  6GSX A;  4FYU A;  4KSO A;  4N30 A;  3DWV A;  1ZYQ B;  3FZA A; 
#chains in the Genus database with same CATH topology
 2IWT A;  3TJJ A;  3F3Q A;  1OE7 A;  1JZO A;  2OE0 A;  2VO4 A;  2EIR A;  4JRR A;  1LBK A;  1ZYN A;  1JZD A;  1ZGN A;  1TXU A;  3APS A;  4ICY A;  1MDJ A;  4IQA A;  6GSU A;  2L4Q A;  3VWX A;  2WB9 A;  2KP1 A;  5AN1 A;  4MA9 A;  1V57 A;  4AF2 A;  1SJZ A;  5IMV A;  5ECM B;  3CRT A;  3L9S A;  5EL8 A;  2H1A A;  3IAS 2;  1E6B A;  4BA7 A;  2YJ7 A;  1GWC A;  1ZZY A;  5DQY A;  3NZN A;  5G1L A;  1GSF A;  1NM3 A;  1U3A A;  4KH7 A;  2V41 A;  4NXI A;  2HYX A;  2G2Q A;  4AJ8 A;  1R26 A;  1GH2 A;  2HRN A;  2VL2 A;  2N5B A;  1TI3 A;  1FB6 A;  4FO5 A;  3F9U A;  3FEU A;  4WKW A;  4DSQ A;  3U6V A;  2VIM A;  1ZCP A;  1R4W A;  4O32 A;  3D4T A;  2C0E A;  4EE0 A;  4EIQ A;  2GQK A;  2LRN A;  3WGX A;  8GSS A;  5A34 B;  4POB A;  1G7E A;  2OBK A;  5D73 A;  1FOV A;  2JZR A;  5JCU A;  1YKC A;  1QGV A;  2CAI A;  2QGV A;  2AAW A;  1WP0 A;  4G0L A;  5IPG A;  2HI7 A;  4G01 A;  2GT6 A;  4ZL7 A;  5F8B A;  4ISD A;  2R0G A;  5F07 A;  1XW9 A;  3EMX A;  3A2V A;  4FXY P;  5DJM A;  2YNX A;  1XBS A;  3GKM A;  3HY2 A;  3KXO A;  3MAK A;  2ON7 A;  2A4H A;  2VLV A;  2XBI A;  3P2A A;  1Q98 A;  5CYY A;  4YH2 A;  4KSM A;  5IMZ A;  4OFT A;  2LNT A;  2V32 A;  2WZS A;  5E59 A;  2JAD A;  3I69 A;  4DSS B;  2M46 A;  2QKE A;  4RQX A;  3CQF A;  4GCI A;  2VL2 C;  2A2R A;  3CXG A;  4L0W A;  4ML1 A;  1I5G A;  4HEA 2;  4TR1 B;  4DSR A;  3FHK A;  1H4O A;  3SWL A;  1MD3 A;  4I97 A;  3C8E A;  2H0H A;  5LNK e;  2AUV A;  4OO5 A;  3R3E A;  4K5S A;  2YZH A;  1V58 A;  3GL3 A;  5CNW A;  1IYI A;  2WVX A;  2AJQ B;  4Z2U A;  1CQG A;  3EYT A;  2A2S A;  4EDZ A;  5HQP A;  3LXZ A;  1Q4J A;  1DSB A;  1ZYE A;  1VF3 A;  4CDO A;  1KNG A;  3IXR A;  3HZ8 A;  1SJ6 A;  3TKS E;  2HSM B;  3TRP A;  1V2A A;  4TOP A;  2FY6 A;  4KA0 A;  2YPM A;  4ML6 A;  2VUP A;  3A2X A;  4JR4 A;  2WUL A;  2X8H A;  4XS4 A;  1M3I A;  1XZO A;  2PN8 A;  3ZIT A;  3PIN A;  3FR9 A;  1G7O A;  1WE0 A;  3IAM 2;  1MEK A;  1IYH A;  1M99 A;  2RLI A;  2KLX A;  1PD2 1;  2DJ3 A;  1PN0 A;  2H6X A;  4K7O A;  2X8G A;  1THX A;  1SKR B;  4BVY B;  1XW6 A;  2MMZ A;  4K8M A;  5DQS A;  1M2A A;  2PVO C;  5IOX A;  4GXZ A;  2IMF A;  4MZC A;  3DVX A;  3RHB A;  2DKH A;  4K9Z A;  3VWU A;  1SJI A;  4O5U A;  3VPT A;  2R4V A;  4YKG A;  4PUR A;  4X0X A;  2IN3 A;  3US3 A;  5FWG A;  4GSS A;  1FB0 A;  1T4Z A;  2HSN A;  1HNB A;  5KOX A;  3QFB C;  2PVQ A;  1WPI A;  1XOA A;  3GKX A;  5DAK B;  4XHM A;  4L5O A;  2GQM A;  4D73 A;  4K1F A;  2H73 A;  3ZL5 A;  2X4A A;  3GX8 A;  2H19 A;  2IIY A;  4A5P A;  1SVM A;  2ZUP A;  4HZ4 A;  2PWJ A;  1FVK A;  4KW6 A;  4N3Z A;  2REM A;  4FYC A;  4IP1 A;  6GST A;  3IV4 A;  2CVB A;  1JFU A;  4KDX A;  4QQ7 A;  2DJJ A;  3QPM A;  4POL A;  2H71 A;  3CWG A;  1Z5Y E;  5F06 A;  5BRT A;  3ZFB A;  3TCO A;  4V2M A;  5CO3 A;  3CTG A;  3HVX A;  1GLQ A;  1GSS A;  2FD3 A;  1CQH A;  4HDE A;  1WOU A;  2Z9S A;  2KHP A;  2YP6 A;  3NIV A;  4WBR D;  4J2F A;  1AC1 A;  1EP8 A;  2HRK A;  1SL1 B;  1PN9 A;  1DE1 A;  3F4T A;  1G0T A;  1GSY A;  4WF4 A;  4Q5F A;  5CP1 A;  4MP4 A;  1O8X A;  2P31 A;  4GSN A;  2L4C A;  4F9Z A;  3R2Q A;  1GUL A;  4EVM A;  1AIU A;  3WGE A;  1Y1U A;  4NPB A;  2QA1 A;  3L78 A;  1M3J A;  3G7Y A;  1GTI A;  4BVX A;  4EIP A;  1H75 A;  1KEB A;  2EFE A;  3LW9 A;  5ECP B;  2K6V A;  3KCM A;  2FWF A;  1O73 A;  3IE3 A;  2M72 A;  3PR8 A;  5BMU B;  4ECC A;  3I6A A;  4TXV A;  1BED A;  2X8C A;  2O7K A;  2VCZ A;  1XWC A;  3UAR A;  5CAX A;  1JZW A;  2OAC A;  5G31 A;  3CRU A;  2JSY A;  1SD8 A;  6GSW A;  3IC8 A;  1FW1 A;  4ZIJ A;  2HSY A;  3L9V A;  1ABA A;  2WRT A;  5A5H A;  5FT3 A;  1XCC A;  2DMM A;  4K0N A;  1ILO A;  4IQ1 A;  1R7H A;  4TKY A;  4EDY A;  1ERW A;  4AJ6 A;  5FHI A;  3CTF A;  1RK4 A;  3GKK A;  2PER A;  4TW5 A;  1U6T A;  2B6M A;  3RHC A;  3OR5 A;  4O92 A;  2GTU A;  1FOH A;  2E2G A;  1S3C A;  3H1N A;  2F3M A;  1LU4 A;  4ZB8 A;  1MDK A;  2L59 A;  2NPB A;  4Z2R A;  1B4Q A;  3ZYW A;  5ECN B;  3EU4 A;  1SD9 A;  2H1G A;  1F3B A;  4MDC A;  2C4J A;  2DC5 A;  3H79 A;  1BAY A;  5KOW A;  3BD2 A;  3GSS A;  2JSZ A;  3EPT A;  4PHZ C;  3QAV A;  5ECL B;  3UVT A;  4PXO A;  3MIX A;  1YJ6 A;  2P0G A;  2WW0 A;  4YAV A;  4XRA A;  1NHO A;  3G7J A;  9GSS A;  2EIQ A;  2FUG 2;  4N10 A;  4TXO A;  4RI7 A;  3UEM A;  1YF0 A;  3GUS A;  3TB2 A;  4XS1 A;  2OKA A;  2YWM A;  3C1S A;  1A2M A;  1TDI A;  2X99 A;  5D96 A;  3CSH A;  2B3S A;  1X5C A;  4F0B A;  3F0I A;  3N9J A;  2CZ2 A;  1ST9 A;  2LQO A;  1JHB A;  4LMV A;  1FAA A;  5D9X A;  4QMK A;  4AGS A;  1GUM A;  1HNA A;  1XFL A;  3EVI A;  4GST A;  2WS2 A;  2C3N A;  4ID0 A;  3RFR C;  2WZ9 A;  3DRN A;  4BIK A;  3UVH A;  4MF7 A;  1K3Y A;  2X49 A;  3VFI A;  3EWL A;  2VKZ G;  3DKS A;  3DYR A;  1PX7 A;  3LJR A;  1YDK A;  2H76 A;  1XOB A;  2B7J A;  4MNN A;  3O6T A;  2FHE A;  3TKS C;  5G1K A;  1SL2 B;  1MDI A;  4FH8 A;  1EWX A;  3LYK A;  4OCF A;  2H6Y A;  4MZW A;  3VLN A;  4ZB7 A;  1LJR A;  5DVB A;  1DBY A;  3CMI A;  4ZBA A;  4IHU A;  3M9K A;  1EGO A;  1Z6N A;  4OCE A;  4GWR A;  2CAQ A;  1YKA A;  1A23 A;  2R3X A;  3HVS A;  3MSZ A;  1X0R A;  4JU5 A;  3WD6 A;  1YQ1 A;  2FA8 A;  1UN2 A;  2H01 A;  5A5K A;  4F82 A;  1RW1 A;  3C71 A;  1MD4 A;  3ZVJ D;  1K0M A;  1QUW A;  1VF2 A;  1Z3E A;  2DJK A;  2LNS A;  2WVX B;  3KEB A;  2CVK A;  1PKZ A;  2A4V A;  2LS5 A;  3I43 A;  2IPA A;  2N5A A;  4PX1 A;  4KUN A;  2RUF A;  5HFG A;  4PNF A;  5DCH A;  4POK A;  3M0F A;  4W66 A;  1QMV A;  22GS A;  2D2Z A;  3QMX A;  4NHZ A;  1Y6E A;  2GVP A;  4FIW A;  1AUC A;  1ZL9 A;  2DJ2 A;  4TR0 A;  3D0Z A;  2I3Y A;  1X9M B;  1ERT A;  4XS4 B;  4ZL9 A;  2YV9 A;  3F3R A;  1K0C A;  2J23 A;  2M80 A;  1K0A A;  1OKD A;  5D93 A;  3TU3 B;  3HVN A;  3TUE A;  3CSJ A;  4F0C A;  2BTO T;  1YEP A;  4TVE A;  3PGT A;  3ZVJ A;  1QK8 A;  4ULX A;  4G2E A;  3W8S A;  1W89 A;  4QL9 A;  2XPE A;  2PBJ A;  2O5V A;  2VCT A;  5GST A;  1ZMA A;  5J4V A;  3KIJ A;  3FW2 A;  2LKU A;  4ECI A;  2R5G A;  2VM1 A;  4NV5 A;  1N2A A;  3DVW A;  4OMV A;  4KND A;  3UMA A;  2F8A A;  4PI2 C;  2A2P A;  1R5A A;  2IMD A;  1XIY A;  2IFQ B;  1QQ2 A;  2HFD A;  1TXX A;  4LA1 A;  3JCM L;  4LMW A;  4OWY A;  4F03 A;  3DGQ A;  2XBQ A;  3GH6 A;  3SBC A;  5KN0 A;  3ERW A;  2VM2 A;  5IMA A;  1OC3 A;  4AKI A;  2L6C A;  3U5R E;  3VPQ A;  4QL7 A;  3F6F A;  2XHF A;  1T7P B;  5HFI A;  2FWH A;  3FYG A;  1S3R A;  2ZNM A;  2OA7 A;  3FR3 A;  1Y25 A;  3FK8 A;  4HUA A;  5KN2 A;  4TR3 A;  2LJK A;  2CQ9 A;  3VWV A;  4Q5N A;  2K9F A;  1TP9 A;  1WWJ A;  3LWA A;  1N25 A;  5ID2 A;  5EY6 A;  1PL2 A;  2UV8 G;  2B5E A;  3DML A;  2HRK B;  4ZB6 A;  1OAZ A;  5A1N A;  1EV9 A;  1XVQ A;  2EFH A;  3FKF A;  2K8V A;  3FY7 A;  7GSS A;  2QA2 A;  2IMK A;  2IMI A;  3KM6 A;  4HSC X;  3QD9 A;  4V2N A;  1K0D A;  3C1R A;  4X1U A;  2F8F A;  2I81 A;  2NTO A;  3KH7 A;  4LL1 B;  3D4M A;  1TU7 A;  1Z7R A;  3KTL A;  3EU3 A;  4EKZ A;  3GH9 A;  1YZX A;  4K0G A;  4BVX B;  1BQ7 A;  2BMX A;  1WIK A;  2GT5 A;  3RPP A;  1S4B P;  3QFA C;  5INY A;  4NHW A;  2AV4 A;  2L57 A;  5H5Q A;  17GS A;  3TJF A;  1HYU A;  3C7M A;  4MZB A;  3UOM A;  1BF5 A;  2C0G A;  1XVW A;  2ALB A;  1OC9 A;  3BCK A;  1ACV A;  3IOS A;  3D6I A;  2L6D A;  1J08 A;  3ERF A;  1WMJ A;  2IL3 A;  4ZIL A;  2O3E A;  4PNG A;  5A5H B;  18GS A;  1TKD B;  5CRG A;  2H75 A;  4CY8 A;  1XWB A;  1PX6 A;  2WGR A;  4KDY A;  3M3M A;  5D9T A;  3O3T A;  3TJB A;  2C8U A;  4KAE A;  1X5D A;  3ISO A;  3MYD A;  4K5R A;  5IMD A;  1F6M C;  2IJY A;  3G9B A;  5H5R A;  1A24 A;  2JAC A;  1X9S B;  3HVV A;  1GTB A;  3J7Y k;  5JWO B;  1HD2 A;  2O36 A;  5IIZ A;  5J41 A;  2MMN A;  3GA4 A;  4MMM A;  1XW5 A;  2LRT A;  1A2L A;  4F2I A;  3VK9 A;  3P90 A;  3BBY A;  2MBS A;  3EC3 A;  2VL9 A;  5HR2 A;  1E2Y A;  5J4Y A;  1B4P A;  2LJA A;  1TW9 A;  2C3Q A;  6GSY A;  2CX3 A;  2GST A;  3IDV A;  3W8J A;  1RQM A;  1J0F A;  5D9V A;  3GTU A;  4OFN A;  1EZK A;  2LEG A;  3GMF A;  3RAZ A;  4L8E A;  2B1L A;  1OE8 A;  5J5N A;  2VAF A;  2TRC P;  3GX0 A;  2LRC A;  1TOF A;  1UC7 A;  1GRX A;  1T4Y A;  3HYP A;  2LTK A;  4V1A p;  2HQT A;  4I5Q A;  3RDW A;  4YQM A;  2UZ8 A;  4KCE A;  3TRQ A;  1SYX A;  4K7N A;  4DSS A;  4MF5 A;  1M2B A;  5IMF A;  4K2X A;  1GNW A;  4PUF C;  1OKT A;  3EE2 A;  2E0Q A;  3MWH A;  4LL4 B;  10GS A;  1OYJ A;  2VLU A;  3L0H A;  3TKR A;  2DIZ A;  4WBJ A;  5C04 A;  2H1B A;  3VUR A;  3UAP A;  1PQN A;  4GDF A;  2YZU A;  3VI7 A;  3IK7 A;  1X5E A;  3GHA A;  4I6X A;  5IM9 A;  1R5P A;  3V1W A;  3KGK A;  4MJA A;  1TRW A;  1A0R P;  1SKS B;  4GTU A;  4MPG A;  4MH2 A;  4BL7 A;  1YY7 A;  4HZ2 A;  2HZE A;  4I2U A;  3LG6 A;  4HQZ A;  1AXD A;  1GSD A;  1GSU A;  4KX4 A;  3ZLP A;  4EO3 A;  1DE2 A;  5AGY A;  3IA1 A;  2MMA A;  3GYK A;  2MZC A;  2J9H A;  2H6Z A;  4GF0 A;  4O5Q A;  3PPU A;  5ECK B;  19GS A;  2H30 A;  4K7I A;  3DEX A;  3A5W A;  4OO4 A;  4HJM A;  5G2Z A;  5GAP D;  1EEJ A;  3KH9 A;  2LJR A;  3A2W A;  1VF4 A;  3EIN A;  2WJU A;  1K3L A;  1I9D A;  1K0B A;  1TJD A;  4ECJ A;  1THO A;  1OC8 A;  4ZXG A;  1SL0 B;  2GSQ A;  1U87 A;  3NOF A;  2VLT A;  1SU9 A;  1BG1 A;  1XG8 A;  1TTZ A;  2EFD A;  1QXH A;  4MK3 A;  1EGR A;  1G6W A;  3HJM A;  2L5L A;  2DML A;  3APO A;  5J9C A;  4G10 A;  4I2T A;  2H0I A;  1URM A;  3TKQ A;  2YN1 A;  4ECB A;  4TRX A;  2RM6 A;  3I9V 2;  5A4V A;  3H4K A;  3LSZ A;  3FZ5 A;  3Q6O A;  3E9J B;  1TRS A;  2NBS A;  4BPY A;  4G0I A;  3APQ A;  4J57 E;  2B5Y A;  3M8N A;  4KF9 A;  1ERU A;  5F0G A;  1PMT A;  5JCW A;  5HR1 A;  4Q5R A;  2V6K A;  5HR0 A;  3LOR A;  1TK0 B;  2PMT A;  2FLS A;  2R0C A;  1FVJ A;  4ZBD A;  4ZBB A;  4IN0 A;  4GRF A;  3RPN A;  4E8H A;  4IBP A;  2XC2 A;  3WYW A;  4AI6 A;  4EL1 A;  5HFK A;  1WRY A;  3LGC A;  4IVF A;  1QFN A;  2VL3 A;  2V2G A;  2ES7 A;  3KJY A;  3F6D A;  2O89 A;  2H74 A;  3BCI A;  1PL1 A;  4XIH A;  3HMJ G;  5HR3 A;  4HJ2 A;  1YEX A;  2NVL A;  4PI0 C;  1T1V A;  4O5R A;  1M9B A;  4NWY A;  2R6K A;  6GSS A;  2VD1 A;  4USS A;  2H1D A;  4Q5Q A;  4X43 A;  2MYG A;  1FHE A;  1KBN A;  4MCU A;  1NW2 A;  2I4A A;  3IHG A;  1JLW A;  2CVD A;  5A1N B;  1ZYP A;  1V9W A;  4EXJ A;  2RM5 A;  4TN8 A;  5H5S A;  4IKH A;  2GDR A;  5G5F A;  2JL4 A;  4KGI A;  4AJ7 A;  3EUR A;  2MMO A;  1YVL A;  3HCZ A;  2H66 A;  1AW9 A;  1AQW A;  1NHY A;  3KMO A;  2OE1 A;  3LXT A;  4POM A;  5E4W A;  1O6J A;  2PUK C;  2RII A;  3ZIV A;  1KTE A;  5JWR B;  4ZL8 A;  1DUG A;  2HE3 A;  3CSI A;  3QCP A;  2QC7 A;  4HU7 A;  3AY8 A;  2H70 A;  5JCG A;  3H8Q A;  3ZIJ A;  2MBT A;  5C00 A;  2AYT A;  3IPZ A;  4BWQ A;  4WXT A;  5B8A A;  2VD0 A;  2WVY A;  3FZ9 A;  5IOW A;  4K6X A;  1PA3 A;  2C80 A;  5CRD A;  5DAL A;  3F4R A;  3IR4 A;  1B9X C;  4GLT A;  4H86 A;  3TGZ A;  4OFM A;  1OC9 B;  4V2L A;  2E7P A;  3RGB C;  3G7I A;  2LUS A;  2FA4 A;  3LEF A;  5B6M A;  5GZZ B;  5B7C A;  3GV1 A;  1GUH A;  3Q19 A;  13GS A;  2NDO A;  2GGT A;  2L5O A;  2GQL A;  4FQU A;  5KN1 A;  2HLS A;  3WGD A;  4KE3 A;  3MNG A;  5COH A;  4EUY A;  1GL8 A;  2E2M A;  2GSS A;  3C73 A;  2TIR A;  2ZCT A;  2OAD A;  4MPF A;  5GSS A;  5ECR B;  5LCZ A;  1T3B A;  4NMU A;  4EC0 A;  2DJ0 A;  1FO5 A;  2HSN B;  4N11 A;  3ZML A;  2HXK A;  2WVZ A;  1T00 A;  3Q74 A;  20GS A;  2B5X A;  1GSQ A;  4D73 B;  2B7K A;  5J40 A;  3FMW A;  4DVC A;  1GLP A;  1VGL A;  2R0P A;  2KUC A;  3DXB A;  4IJI A;  2P5Q A;  1W4V A;  5L71 A;  1Z9H A;  1EV4 A;  3L4N A;  1XWK A;  4WF5 A;  5A4U A;  3S9F A;  3GTU B;  1AQX A;  2VOC A;  2H1L A;  3QOU A;  3HD5 A;  2HNL A;  3IC4 A;  4J56 E;  4BWS A;  2YCD A;  2CZ3 A;  2WW1 A;  4NAX A;  4JR6 A;  3ME8 A;  2OT3 A;  3Q18 A;  2EC4 A;  3UBK A;  2KOK A;  2F9S A;  5F05 A;  3CHX C;  3FRC A;  1TRV A;  1PKW A;  2O87 A;  2FWE A;  2V6O A;  4Z2T A;  5ECO B;  1SK0 A;  1F9M A;  3CBU A;  4AKX B;  6GSV A;  2R2J A;  2DJ1 A;  5ECS A;  3ZTL A;  4MJE A;  2G0F A;  1ON4 A;  2LQQ A;  3BJ5 A;  1M9A A;  3RBT A;  4PUA A;  2HRA A;  1USB A;  2VCX A;  4YQU A;  2PU9 C;  1GSE A;  1N8J A;  3IK9 A;  4OD7 A;  5B8B A;  1F3A A;  4XTS A;  2FWG A;  14GS A;  1G6Y A;  5B6N A;  3HJO A;  3TDG A;  1SYR A;  5ECQ B;  2I1U A;  2YWO A;  4KCA A;  4YQV A;  3ZRE A;  2QSI A;  1BJX A;  3FZ4 A;  4PQI A;  1C72 A;  5CRH A;  4IJ3 A;  1A2J A;  4HU9 A;  4BL7 B;  2HZE B;  2DIY A;  1PFO A;  3GST A;  2O85 A;  3IBH A;  3DD3 A;  3TJG A;  2F51 A;  5AIS A;  3TOT A;  1SEN A;  3HA9 A;  1VRS D;  3GRX A;  12GS A;  1AQV A;  3VI5 A;  1WJK A;  3GL5 A;  4CHS A;  4XRD A;  1MTC A;  2H8L A;  3DIE A;  2OE3 A;  1O81 A;  4G9H A;  4E8E A;  4HQS A;  3O76 A;  2V1M A;  5DJL A;  3ZMK A;  4MH3 A;  2IFQ A;  5A34 A;  2TRX A;  4E68 A;  1PRX A;  1EEM A;  2WW3 A;  4G0K A;  4HI7 A;  3J7Y b;  1AAZ A;  2OJL A;  2GLR A;  5G5E A;  3TRX A;  3A3T A;  3KD0 A;  4RQR A;  3KZQ A;  2GZZ A;  4KB3 A;  2LST A;  1YF1 A;  1NSW A;  4PTS A;  1X9W B;  5EVO A;  3ZRD A;  2RUE A;  2HZF A;  1A8L A;  4JZQ A;  5G30 A;  5AIV A;  1B8X A;  4TXO B;  2HT9 A;  2C0F A;  1I1I P;  4XS6 A;  4IS0 A;  16GS A;  4G19 A;  4CY6 A;  3D5J A;  4N0V A;  3GIX A;  4O7H A;  2IME A;  5J9B A;  2CX4 A;  5ELG A;  5JWQ B;  1HQO A;  2YWN A;  5DBQ A;  5CRE A;  3KP8 A;  4ILF A;  2YV7 A;  3LQ7 A;  2CA8 A;  4TR1 A;  1EOH A;  5DCG A;  5IO2 A;  5AIX A;  3HKR A;  1SKW B;  1V40 A;  5IMC A;  3TKP A;  2O8V B;  5ABR A;  4RUV A;  3PH9 A;  3P7X A;  2WDU A;  1PGT A;  3WT1 A;  1GP1 A;  2GZY A;  1OVN A;  3F8U A;  1B9Y C;  4P3Y B;  5ECH B;  2H72 A;  4WEY A;  5CRW A;  3A5I A;  5ELA A;  2K8S A;  5IO0 A;  2BJX A;  2GZP A;  3E3E A;  1TK5 B;  4N0Z A;  4MLY A;  1S3A A;  2EFC A;  2HSM A;  5KEJ A;  3UBL A;  1JZR A;  4IGJ A;  3GFK A;  5KN3 A;  2WCI A;  2R37 A;  1V98 A;  5D9W A;  1F2E A;  5J4U A;  1O8W A;  3CYN A;  3UL3 A;  1O85 A;  1GTA A;  4WR4 A;  4NV2 A;  4WET A;  1TK8 B;  11GS A;  3F4S A;  2PGT A;  2CV4 A;  2K18 A;  5DDL A;  3W6G A;  2C0D A;  1T8E B;  4BVY A;  2WW2 A;  4RI6 A;  4DEJ A;  4IW9 A;  1ZOF A;  1JLV A;  4PQ1 A;  4L5L A;  3HHV A;  2ON5 A;  4IEL A;  1XXU A;  2GSR A;  2DKI A;  3HXS A;  1Z6M A;  3TOU A;  4HOJ A;  4LLR A;  1U88 A;  1BYE A;  5ECI B;  1A0F A;  1U3I A;  3KTB A;  3ERG A;  2OBI A;  4GQC A;  4V1A g;  1XWG A;  2VCV A;  5IQY A;  4HS1 A;  3FR6 A;  1ERV A;  1J9B A;  3ME7 A;  4K2D A;  1SK1 A;  1TRU A;  1UVZ A;  3P8W A;  1F37 A;  2PPT A;  1EP7 A;  5DAL B;  3UIW A;  2P5R A;  4IP6 A;  1B48 A;  5DAK A;  4YAP A;  3QAG A;  2LV3 A;  4MJB A;  3HJP A;  3GKN A;  3ZZX A;  2H0G A;  2YAN A;  1XWA A;  5GAN D;  2JZS A;  3QR6 A;  1BX9 A;  1K3O A;  1M7T A;  4FYB A;  5J47 A;  1O7U A;  1SK2 A;  3GUR A;  2X64 A;  1S3D A;  4MAB A;  2AB6 A;  3D21 A;  3D22 A;  1BG5 A;  3QDN A;  3TKS A;  1TU8 A;  1XPV A;  4PGT A;  3IRA A;  2EIO A;  2FGX A;  2CT6 A;  3TJK A;  3ED3 A;  2GS3 A;  5ENU A;  1GTU A;  3HZ4 A;  4AKG A;  2N5F A;  2JU5 A;  1VF1 A;  3GNJ A;  4TR4 A;  4X4J A;  2C1Y A;  2B1K A;  1ML6 A;  2HSH A;  3ZFL A;  3E0U A;  1HNC A;  4JE1 A;  4KDU A;  2JZT A;  4JED A;  4L0U A;  1GUK A;  2FNO A;  4PQH A;  1K0N A;  1TI1 A;  2XPD A;  4JBB A;  1M2D A;  2WFC A;  3L9U A;  4ACS A;  2I9H A;  3MDK A;  2FCH A;  2DLX A;  3IHQ A;  3HDC A;  5D8I A;  2DSA A;  3BOA A;  3M9J A;  3QAW A;  5J3R A;  5BMU A;  5IPH A;  1SVO A;  3KMN A;  4MJC A;  2VCW A;  3LYP A;  4YKF A;  2YOI A;  2DBC A;  5ID2 B;  4MF6 A;  4EF0 A;  3EMP A;  1K0O A;  2KP2 A;  3K8N A;  3VWW A;  4I8B A;  3KP9 A;  3WT2 A;  2C3T A;  3M1G A;  1SVL A;  5LD0 A;  4AKH A;  4XCS A;  3H93 A;  4GQF A;  1FG4 A;  3UJ1 A;  2YWI A;  4CW9 A;  1PSQ A;  2YJH A;  4ZB9 A;  5A4W A;  5EPF A;  1UA5 A;  1A8Y A;  3LFL A;  4Z7X A;  1M0U A;  4WR5 A;  2HRF A;  2AHE A;  3GN3 A;  3N5O A;  1EOG A;  2VCQ A;  1YEW C;  3F63 A;  1Z7P A;  1GNE A;  6GSX A;  4FYU A;  4KSO A;  4N30 A;  3DWV A;  1ZYQ B;  3FZA A; 
#chains in the Genus database with same CATH homology
 2IWT A;  3TJJ A;  3F3Q A;  1OE7 A;  1JZO A;  2OE0 A;  2VO4 A;  2EIR A;  4JRR A;  1LBK A;  1ZYN A;  1JZD A;  1ZGN A;  1TXU A;  3APS A;  4ICY A;  1MDJ A;  4IQA A;  6GSU A;  2L4Q A;  3VWX A;  2WB9 A;  2KP1 A;  5AN1 A;  4MA9 A;  1V57 A;  4AF2 A;  1SJZ A;  5IMV A;  5ECM B;  3CRT A;  3L9S A;  5EL8 A;  2H1A A;  3IAS 2;  1E6B A;  4BA7 A;  2YJ7 A;  1GWC A;  1ZZY A;  5DQY A;  3NZN A;  5G1L A;  1GSF A;  1NM3 A;  1U3A A;  4KH7 A;  2V41 A;  4NXI A;  2HYX A;  2G2Q A;  4AJ8 A;  1R26 A;  1GH2 A;  2HRN A;  2VL2 A;  2N5B A;  1TI3 A;  1FB6 A;  4FO5 A;  3F9U A;  3FEU A;  4WKW A;  4DSQ A;  3U6V A;  2VIM A;  1ZCP A;  1R4W A;  4O32 A;  3D4T A;  2C0E A;  4EE0 A;  4EIQ A;  2GQK A;  2LRN A;  3WGX A;  8GSS A;  5A34 B;  4POB A;  1G7E A;  2OBK A;  5D73 A;  1FOV A;  2JZR A;  5JCU A;  1YKC A;  1QGV A;  2CAI A;  2QGV A;  2AAW A;  1WP0 A;  4G0L A;  5IPG A;  2HI7 A;  4G01 A;  2GT6 A;  4ZL7 A;  5F8B A;  4ISD A;  2R0G A;  5F07 A;  1XW9 A;  3EMX A;  3A2V A;  5DJM A;  2YNX A;  1XBS A;  3GKM A;  3HY2 A;  3KXO A;  3MAK A;  2ON7 A;  2A4H A;  2VLV A;  2XBI A;  3P2A A;  1Q98 A;  5CYY A;  4YH2 A;  4KSM A;  5IMZ A;  4OFT A;  2LNT A;  2V32 A;  5E59 A;  2JAD A;  3I69 A;  4DSS B;  2M46 A;  2QKE A;  4RQX A;  4GCI A;  2VL2 C;  2A2R A;  3CXG A;  4L0W A;  4ML1 A;  1I5G A;  4HEA 2;  4TR1 B;  4DSR A;  3FHK A;  1H4O A;  3SWL A;  1MD3 A;  4I97 A;  3C8E A;  2H0H A;  5LNK e;  2AUV A;  4OO5 A;  3R3E A;  4K5S A;  2YZH A;  1V58 A;  3GL3 A;  5CNW A;  1IYI A;  2AJQ B;  4Z2U A;  1CQG A;  3EYT A;  2A2S A;  4EDZ A;  5HQP A;  3LXZ A;  1Q4J A;  1DSB A;  1ZYE A;  1VF3 A;  4CDO A;  1KNG A;  3IXR A;  3HZ8 A;  1SJ6 A;  3TKS E;  2HSM B;  3TRP A;  1V2A A;  4TOP A;  2FY6 A;  4KA0 A;  2YPM A;  4ML6 A;  2VUP A;  3A2X A;  4JR4 A;  2WUL A;  2X8H A;  4XS4 A;  1XZO A;  2PN8 A;  3ZIT A;  3PIN A;  3FR9 A;  1G7O A;  1WE0 A;  3IAM 2;  1MEK A;  1IYH A;  1M99 A;  2RLI A;  2KLX A;  1PD2 1;  2DJ3 A;  1PN0 A;  2H6X A;  4K7O A;  2X8G A;  1THX A;  1SKR B;  4BVY B;  1XW6 A;  2MMZ A;  4K8M A;  5DQS A;  1M2A A;  2PVO C;  5IOX A;  4GXZ A;  2IMF A;  4MZC A;  3DVX A;  3RHB A;  2DKH A;  4K9Z A;  3VWU A;  1SJI A;  4O5U A;  3VPT A;  2R4V A;  4YKG A;  4PUR A;  4X0X A;  2IN3 A;  3US3 A;  5FWG A;  4GSS A;  1FB0 A;  1T4Z A;  2HSN A;  1HNB A;  5KOX A;  3QFB C;  2PVQ A;  1WPI A;  1XOA A;  3GKX A;  5DAK B;  4XHM A;  4L5O A;  2GQM A;  4D73 A;  4K1F A;  2H73 A;  3ZL5 A;  2X4A A;  3GX8 A;  2H19 A;  2IIY A;  4A5P A;  1SVM A;  2ZUP A;  4HZ4 A;  2PWJ A;  1FVK A;  4KW6 A;  4N3Z A;  2REM A;  4FYC A;  4IP1 A;  6GST A;  3IV4 A;  2CVB A;  1JFU A;  4KDX A;  4QQ7 A;  2DJJ A;  3QPM A;  4POL A;  2H71 A;  3CWG A;  1Z5Y E;  5F06 A;  5BRT A;  3ZFB A;  3TCO A;  4V2M A;  5CO3 A;  3CTG A;  3HVX A;  1GLQ A;  1GSS A;  2FD3 A;  1CQH A;  4HDE A;  1WOU A;  2Z9S A;  2KHP A;  2YP6 A;  3NIV A;  4WBR D;  4J2F A;  1AC1 A;  1EP8 A;  2HRK A;  1SL1 B;  1PN9 A;  1DE1 A;  3F4T A;  1G0T A;  1GSY A;  4WF4 A;  4Q5F A;  5CP1 A;  4MP4 A;  1O8X A;  2P31 A;  4GSN A;  2L4C A;  4F9Z A;  3R2Q A;  1GUL A;  4EVM A;  1AIU A;  3WGE A;  1Y1U A;  4NPB A;  2QA1 A;  3L78 A;  3G7Y A;  1GTI A;  4BVX A;  4EIP A;  1H75 A;  1KEB A;  2EFE A;  3LW9 A;  5ECP B;  2K6V A;  3KCM A;  2FWF A;  1O73 A;  3IE3 A;  3PR8 A;  5BMU B;  2M72 A;  4ECC A;  3I6A A;  4TXV A;  1BED A;  2X8C A;  2O7K A;  2VCZ A;  1XWC A;  3UAR A;  5CAX A;  1JZW A;  2OAC A;  5G31 A;  3CRU A;  2JSY A;  1SD8 A;  6GSW A;  3IC8 A;  1FW1 A;  4ZIJ A;  2HSY A;  3L9V A;  1ABA A;  2WRT A;  5A5H A;  5FT3 A;  1XCC A;  2DMM A;  4K0N A;  1ILO A;  4IQ1 A;  1R7H A;  4TKY A;  4EDY A;  1ERW A;  4AJ6 A;  5FHI A;  3CTF A;  1RK4 A;  3GKK A;  2PER A;  4TW5 A;  1U6T A;  2B6M A;  3RHC A;  3OR5 A;  4O92 A;  2GTU A;  1FOH A;  2E2G A;  1S3C A;  3H1N A;  2F3M A;  1LU4 A;  4ZB8 A;  1MDK A;  2L59 A;  2NPB A;  4Z2R A;  1B4Q A;  3ZYW A;  5ECN B;  3EU4 A;  1SD9 A;  2H1G A;  1F3B A;  4MDC A;  2C4J A;  2DC5 A;  3H79 A;  1BAY A;  5KOW A;  3BD2 A;  3GSS A;  2JSZ A;  3EPT A;  3QAV A;  5ECL B;  3UVT A;  4PXO A;  3MIX A;  1YJ6 A;  2P0G A;  4YAV A;  4XRA A;  1NHO A;  3G7J A;  9GSS A;  2EIQ A;  2FUG 2;  4N10 A;  4TXO A;  4RI7 A;  3UEM A;  1YF0 A;  3GUS A;  3TB2 A;  4XS1 A;  2OKA A;  2YWM A;  3C1S A;  1A2M A;  1TDI A;  2X99 A;  5D96 A;  3CSH A;  2B3S A;  1X5C A;  4F0B A;  3F0I A;  3N9J A;  2CZ2 A;  1ST9 A;  2LQO A;  1JHB A;  4LMV A;  1FAA A;  5D9X A;  4QMK A;  4AGS A;  1GUM A;  1HNA A;  1XFL A;  3EVI A;  4GST A;  2WS2 A;  2C3N A;  4ID0 A;  2WZ9 A;  3DRN A;  3UVH A;  4MF7 A;  1K3Y A;  2X49 A;  3VFI A;  3EWL A;  2VKZ G;  3DKS A;  3DYR A;  1PX7 A;  3LJR A;  1YDK A;  2H76 A;  1XOB A;  2B7J A;  4MNN A;  3O6T A;  2FHE A;  3TKS C;  5G1K A;  1SL2 B;  1MDI A;  4FH8 A;  1EWX A;  3LYK A;  4OCF A;  2H6Y A;  4MZW A;  3VLN A;  4ZB7 A;  1LJR A;  5DVB A;  1DBY A;  3CMI A;  4ZBA A;  4IHU A;  3M9K A;  1EGO A;  1Z6N A;  4OCE A;  4GWR A;  2CAQ A;  1YKA A;  1A23 A;  2R3X A;  3HVS A;  3MSZ A;  1X0R A;  4JU5 A;  3WD6 A;  1YQ1 A;  2FA8 A;  1UN2 A;  2H01 A;  5A5K A;  4F82 A;  1RW1 A;  3C71 A;  1MD4 A;  3ZVJ D;  1K0M A;  1QUW A;  1VF2 A;  1Z3E A;  2DJK A;  2LNS A;  3KEB A;  2CVK A;  1PKZ A;  2A4V A;  2LS5 A;  3I43 A;  2IPA A;  2N5A A;  4PX1 A;  4KUN A;  2RUF A;  5HFG A;  4PNF A;  5DCH A;  4POK A;  3M0F A;  4W66 A;  1QMV A;  22GS A;  2D2Z A;  3QMX A;  4NHZ A;  1Y6E A;  2GVP A;  4FIW A;  1AUC A;  1ZL9 A;  2DJ2 A;  4TR0 A;  3D0Z A;  2I3Y A;  1X9M B;  1ERT A;  4XS4 B;  4ZL9 A;  2YV9 A;  3F3R A;  1K0C A;  2J23 A;  2M80 A;  1K0A A;  1OKD A;  5D93 A;  3TU3 B;  3TUE A;  3CSJ A;  4F0C A;  2BTO T;  1YEP A;  4TVE A;  3PGT A;  3ZVJ A;  1QK8 A;  4ULX A;  4G2E A;  3W8S A;  1W89 A;  4QL9 A;  2XPE A;  2PBJ A;  2O5V A;  2VCT A;  5GST A;  1ZMA A;  5J4V A;  3KIJ A;  3FW2 A;  2LKU A;  4ECI A;  2R5G A;  2VM1 A;  4NV5 A;  1N2A A;  3DVW A;  4OMV A;  4KND A;  3UMA A;  2F8A A;  2A2P A;  1R5A A;  2IMD A;  1XIY A;  2IFQ B;  1QQ2 A;  2HFD A;  1TXX A;  4LA1 A;  3JCM L;  4LMW A;  4OWY A;  4F03 A;  3DGQ A;  2XBQ A;  3GH6 A;  3SBC A;  5KN0 A;  3ERW A;  2VM2 A;  5IMA A;  1OC3 A;  4AKI A;  2L6C A;  3U5R E;  3VPQ A;  4QL7 A;  3F6F A;  2XHF A;  1T7P B;  5HFI A;  2FWH A;  3FYG A;  2ZNM A;  2OA7 A;  3FR3 A;  1Y25 A;  3FK8 A;  4HUA A;  5KN2 A;  4TR3 A;  2LJK A;  2CQ9 A;  3VWV A;  4Q5N A;  2K9F A;  1TP9 A;  1WWJ A;  3LWA A;  1N25 A;  5ID2 A;  5EY6 A;  1PL2 A;  2UV8 G;  2B5E A;  3DML A;  2HRK B;  4ZB6 A;  1OAZ A;  5A1N A;  1EV9 A;  1XVQ A;  2EFH A;  3FKF A;  2K8V A;  3FY7 A;  7GSS A;  2QA2 A;  2IMK A;  2IMI A;  3KM6 A;  3QD9 A;  4V2N A;  1K0D A;  3C1R A;  4X1U A;  2F8F A;  2I81 A;  2NTO A;  3KH7 A;  4LL1 B;  3D4M A;  1TU7 A;  1Z7R A;  3KTL A;  3EU3 A;  4EKZ A;  3GH9 A;  1YZX A;  4K0G A;  4BVX B;  1BQ7 A;  2BMX A;  1WIK A;  2GT5 A;  3RPP A;  3QFA C;  5INY A;  4NHW A;  2AV4 A;  2L57 A;  5H5Q A;  17GS A;  3TJF A;  1HYU A;  3C7M A;  4MZB A;  3UOM A;  1BF5 A;  2C0G A;  1XVW A;  2ALB A;  1OC9 A;  3BCK A;  1ACV A;  3IOS A;  3D6I A;  2L6D A;  1J08 A;  3ERF A;  1WMJ A;  2IL3 A;  4ZIL A;  4PNG A;  5A5H B;  18GS A;  1TKD B;  5CRG A;  2H75 A;  4CY8 A;  1XWB A;  1PX6 A;  2WGR A;  4KDY A;  3M3M A;  5D9T A;  3O3T A;  3TJB A;  2C8U A;  4KAE A;  1X5D A;  3ISO A;  3MYD A;  4K5R A;  5IMD A;  1F6M C;  2IJY A;  3G9B A;  5H5R A;  1A24 A;  2JAC A;  1X9S B;  3HVV A;  1GTB A;  3J7Y k;  5JWO B;  1HD2 A;  5IIZ A;  5J41 A;  2MMN A;  3GA4 A;  4MMM A;  1XW5 A;  2LRT A;  1A2L A;  4F2I A;  3VK9 A;  3P90 A;  3BBY A;  2MBS A;  3EC3 A;  2VL9 A;  5HR2 A;  1E2Y A;  5J4Y A;  1B4P A;  2LJA A;  1TW9 A;  2C3Q A;  6GSY A;  2CX3 A;  2GST A;  3IDV A;  3W8J A;  1RQM A;  1J0F A;  5D9V A;  3GTU A;  4OFN A;  1EZK A;  2LEG A;  3GMF A;  3RAZ A;  4L8E A;  2B1L A;  1OE8 A;  5J5N A;  2VAF A;  2TRC P;  3GX0 A;  2LRC A;  1TOF A;  1UC7 A;  1GRX A;  1T4Y A;  3HYP A;  2LTK A;  4V1A p;  2HQT A;  4I5Q A;  3RDW A;  4YQM A;  2UZ8 A;  4KCE A;  3TRQ A;  1SYX A;  4K7N A;  4DSS A;  4MF5 A;  1M2B A;  5IMF A;  4K2X A;  1GNW A;  4PUF C;  1OKT A;  3EE2 A;  2E0Q A;  3MWH A;  4LL4 B;  10GS A;  1OYJ A;  2VLU A;  3L0H A;  3TKR A;  2DIZ A;  4WBJ A;  5C04 A;  2H1B A;  3VUR A;  3UAP A;  1PQN A;  4GDF A;  2YZU A;  3VI7 A;  3IK7 A;  1X5E A;  3GHA A;  4I6X A;  5IM9 A;  1R5P A;  3V1W A;  3KGK A;  4MJA A;  1TRW A;  1A0R P;  1SKS B;  4GTU A;  4MPG A;  4MH2 A;  4BL7 A;  1YY7 A;  4HZ2 A;  2HZE A;  4I2U A;  3LG6 A;  4HQZ A;  1AXD A;  1GSD A;  1GSU A;  4KX4 A;  3ZLP A;  4EO3 A;  1DE2 A;  5AGY A;  3IA1 A;  2MMA A;  3GYK A;  2MZC A;  2J9H A;  2H6Z A;  4GF0 A;  4O5Q A;  3PPU A;  5ECK B;  19GS A;  2H30 A;  4K7I A;  3DEX A;  3A5W A;  4OO4 A;  4HJM A;  5G2Z A;  5GAP D;  1EEJ A;  3KH9 A;  2LJR A;  3A2W A;  1VF4 A;  3EIN A;  2WJU A;  1K3L A;  1I9D A;  1K0B A;  1TJD A;  4ECJ A;  1THO A;  1OC8 A;  4ZXG A;  1SL0 B;  2GSQ A;  1U87 A;  3NOF A;  2VLT A;  1SU9 A;  1BG1 A;  1TTZ A;  2EFD A;  1QXH A;  4MK3 A;  1EGR A;  1G6W A;  3HJM A;  2L5L A;  2DML A;  3APO A;  5J9C A;  4G10 A;  4I2T A;  2H0I A;  1URM A;  3TKQ A;  2YN1 A;  4ECB A;  4TRX A;  2RM6 A;  3I9V 2;  5A4V A;  3H4K A;  3LSZ A;  3FZ5 A;  3Q6O A;  3E9J B;  1TRS A;  2NBS A;  4BPY A;  4G0I A;  3APQ A;  4J57 E;  2B5Y A;  3M8N A;  4KF9 A;  1ERU A;  5F0G A;  1PMT A;  5JCW A;  5HR1 A;  4Q5R A;  2V6K A;  5HR0 A;  3LOR A;  1TK0 B;  2PMT A;  2FLS A;  2R0C A;  1FVJ A;  4ZBD A;  4ZBB A;  4IN0 A;  4GRF A;  3RPN A;  4E8H A;  4IBP A;  2XC2 A;  3WYW A;  4AI6 A;  4EL1 A;  5HFK A;  1WRY A;  3LGC A;  4IVF A;  1QFN A;  2VL3 A;  2V2G A;  2ES7 A;  3KJY A;  3F6D A;  2O89 A;  2H74 A;  3BCI A;  1PL1 A;  4XIH A;  3HMJ G;  5HR3 A;  4HJ2 A;  1YEX A;  2NVL A;  1T1V A;  4O5R A;  1M9B A;  4NWY A;  2R6K A;  6GSS A;  2VD1 A;  4USS A;  2H1D A;  4Q5Q A;  4X43 A;  2MYG A;  1FHE A;  1KBN A;  4MCU A;  1NW2 A;  2I4A A;  3IHG A;  1JLW A;  2CVD A;  5A1N B;  1ZYP A;  1V9W A;  4EXJ A;  2RM5 A;  4TN8 A;  5H5S A;  4IKH A;  2GDR A;  5G5F A;  2JL4 A;  4KGI A;  4AJ7 A;  3EUR A;  2MMO A;  1YVL A;  3HCZ A;  2H66 A;  1AW9 A;  1AQW A;  1NHY A;  3KMO A;  2OE1 A;  3LXT A;  4POM A;  5E4W A;  1O6J A;  2PUK C;  2RII A;  3ZIV A;  1KTE A;  5JWR B;  4ZL8 A;  1DUG A;  2HE3 A;  3CSI A;  3QCP A;  2QC7 A;  4HU7 A;  3AY8 A;  2H70 A;  5JCG A;  3H8Q A;  3ZIJ A;  2MBT A;  5C00 A;  2AYT A;  3IPZ A;  4BWQ A;  4WXT A;  5B8A A;  2VD0 A;  3FZ9 A;  5IOW A;  4K6X A;  1PA3 A;  2C80 A;  5CRD A;  5DAL A;  3F4R A;  3IR4 A;  1B9X C;  4GLT A;  4H86 A;  3TGZ A;  4OFM A;  1OC9 B;  4V2L A;  2E7P A;  3G7I A;  2LUS A;  2FA4 A;  3LEF A;  5B6M A;  5GZZ B;  5B7C A;  3GV1 A;  1GUH A;  3Q19 A;  13GS A;  2NDO A;  2GGT A;  2L5O A;  2GQL A;  4FQU A;  5KN1 A;  2HLS A;  3WGD A;  4KE3 A;  3MNG A;  5COH A;  4EUY A;  1GL8 A;  2E2M A;  2GSS A;  3C73 A;  2TIR A;  2ZCT A;  2OAD A;  4MPF A;  5GSS A;  5ECR B;  5LCZ A;  1T3B A;  4NMU A;  4EC0 A;  2DJ0 A;  1FO5 A;  2HSN B;  4N11 A;  3ZML A;  2HXK A;  1T00 A;  3Q74 A;  20GS A;  2B5X A;  1GSQ A;  4D73 B;  2B7K A;  5J40 A;  3FMW A;  4DVC A;  1GLP A;  1VGL A;  2R0P A;  2KUC A;  3DXB A;  4IJI A;  2P5Q A;  1W4V A;  5L71 A;  1Z9H A;  1EV4 A;  3L4N A;  1XWK A;  4WF5 A;  5A4U A;  3S9F A;  3GTU B;  1AQX A;  2VOC A;  2H1L A;  3QOU A;  3HD5 A;  2HNL A;  3IC4 A;  4J56 E;  4BWS A;  2YCD A;  2CZ3 A;  4NAX A;  4JR6 A;  3ME8 A;  2OT3 A;  3Q18 A;  2EC4 A;  3UBK A;  2KOK A;  2F9S A;  5F05 A;  3FRC A;  1TRV A;  1PKW A;  2O87 A;  2FWE A;  2V6O A;  4Z2T A;  5ECO B;  1SK0 A;  1F9M A;  3CBU A;  4AKX B;  6GSV A;  2R2J A;  2DJ1 A;  5ECS A;  3ZTL A;  4MJE A;  2G0F A;  1ON4 A;  2LQQ A;  3BJ5 A;  1M9A A;  3RBT A;  4PUA A;  2HRA A;  1USB A;  2VCX A;  4YQU A;  2PU9 C;  1GSE A;  1N8J A;  3IK9 A;  4OD7 A;  5B8B A;  1F3A A;  4XTS A;  2FWG A;  14GS A;  1G6Y A;  5B6N A;  3HJO A;  3TDG A;  1SYR A;  5ECQ B;  2I1U A;  2YWO A;  4KCA A;  4YQV A;  3ZRE A;  2QSI A;  1BJX A;  3FZ4 A;  4PQI A;  1C72 A;  5CRH A;  4IJ3 A;  1A2J A;  4HU9 A;  4BL7 B;  2HZE B;  2DIY A;  3GST A;  2O85 A;  3IBH A;  3DD3 A;  3TJG A;  2F51 A;  5AIS A;  3TOT A;  1SEN A;  3HA9 A;  1VRS D;  3GRX A;  12GS A;  1AQV A;  3VI5 A;  1WJK A;  3GL5 A;  4CHS A;  4XRD A;  1MTC A;  2H8L A;  3DIE A;  2OE3 A;  1O81 A;  4G9H A;  4E8E A;  4HQS A;  3O76 A;  2V1M A;  5DJL A;  3ZMK A;  4MH3 A;  2IFQ A;  5A34 A;  2TRX A;  4E68 A;  1PRX A;  1EEM A;  4G0K A;  4HI7 A;  3J7Y b;  1AAZ A;  2OJL A;  2GLR A;  5G5E A;  3TRX A;  3A3T A;  3KD0 A;  4RQR A;  3KZQ A;  2GZZ A;  4KB3 A;  2LST A;  1YF1 A;  1NSW A;  4PTS A;  1X9W B;  5EVO A;  3ZRD A;  2RUE A;  2HZF A;  1A8L A;  4JZQ A;  5G30 A;  5AIV A;  1B8X A;  4TXO B;  2HT9 A;  2C0F A;  4XS6 A;  4IS0 A;  16GS A;  4G19 A;  4CY6 A;  3D5J A;  4N0V A;  3GIX A;  4O7H A;  2IME A;  5J9B A;  2CX4 A;  5ELG A;  5JWQ B;  1HQO A;  2YWN A;  5DBQ A;  5CRE A;  3KP8 A;  4ILF A;  2YV7 A;  3LQ7 A;  2CA8 A;  4TR1 A;  1EOH A;  5DCG A;  5IO2 A;  5AIX A;  3HKR A;  1SKW B;  1V40 A;  5IMC A;  3TKP A;  2O8V B;  5ABR A;  4RUV A;  3PH9 A;  3P7X A;  2WDU A;  1PGT A;  3WT1 A;  1GP1 A;  2GZY A;  1OVN A;  3F8U A;  1B9Y C;  4P3Y B;  5ECH B;  2H72 A;  4WEY A;  5CRW A;  3A5I A;  5ELA A;  2K8S A;  5IO0 A;  2BJX A;  2GZP A;  3E3E A;  1TK5 B;  4N0Z A;  4MLY A;  1S3A A;  2EFC A;  2HSM A;  5KEJ A;  3UBL A;  1JZR A;  4IGJ A;  3GFK A;  5KN3 A;  2WCI A;  2R37 A;  1V98 A;  5D9W A;  1F2E A;  5J4U A;  1O8W A;  3CYN A;  3UL3 A;  1O85 A;  1GTA A;  4WR4 A;  4NV2 A;  4WET A;  1TK8 B;  11GS A;  3F4S A;  2PGT A;  2CV4 A;  2K18 A;  5DDL A;  3W6G A;  2C0D A;  1T8E B;  4BVY A;  4RI6 A;  4DEJ A;  4IW9 A;  1ZOF A;  1JLV A;  4PQ1 A;  4L5L A;  3HHV A;  2ON5 A;  4IEL A;  1XXU A;  2GSR A;  2DKI A;  3HXS A;  1Z6M A;  3TOU A;  4HOJ A;  4LLR A;  1U88 A;  1BYE A;  5ECI B;  1A0F A;  1U3I A;  3KTB A;  3ERG A;  2OBI A;  4GQC A;  4V1A g;  1XWG A;  2VCV A;  5IQY A;  4HS1 A;  3FR6 A;  1ERV A;  1J9B A;  3ME7 A;  4K2D A;  1SK1 A;  1TRU A;  1UVZ A;  3P8W A;  1F37 A;  2PPT A;  1EP7 A;  5DAL B;  3UIW A;  2P5R A;  4IP6 A;  1B48 A;  5DAK A;  4YAP A;  3QAG A;  2LV3 A;  4MJB A;  3HJP A;  3GKN A;  3ZZX A;  2H0G A;  2YAN A;  1XWA A;  5GAN D;  2JZS A;  3QR6 A;  1BX9 A;  1K3O A;  1M7T A;  4FYB A;  5J47 A;  1O7U A;  1SK2 A;  3GUR A;  2X64 A;  1S3D A;  4MAB A;  2AB6 A;  3D21 A;  3D22 A;  1BG5 A;  3QDN A;  3TKS A;  1TU8 A;  1XPV A;  4PGT A;  3IRA A;  2EIO A;  2FGX A;  2CT6 A;  3TJK A;  3ED3 A;  2GS3 A;  5ENU A;  1GTU A;  3HZ4 A;  4AKG A;  2N5F A;  2JU5 A;  1VF1 A;  3GNJ A;  4TR4 A;  4X4J A;  2C1Y A;  2B1K A;  1ML6 A;  2HSH A;  3ZFL A;  3E0U A;  1HNC A;  4JE1 A;  4KDU A;  2JZT A;  4JED A;  4L0U A;  1GUK A;  2FNO A;  4PQH A;  1K0N A;  1TI1 A;  2XPD A;  4JBB A;  1M2D A;  2WFC A;  3L9U A;  4ACS A;  2I9H A;  3MDK A;  2FCH A;  2DLX A;  3IHQ A;  3HDC A;  5D8I A;  2DSA A;  3BOA A;  3M9J A;  3QAW A;  5J3R A;  5BMU A;  5IPH A;  1SVO A;  3KMN A;  4MJC A;  2VCW A;  3LYP A;  4YKF A;  2YOI A;  2DBC A;  5ID2 B;  4MF6 A;  4EF0 A;  3EMP A;  1K0O A;  2KP2 A;  3K8N A;  3VWW A;  4I8B A;  3KP9 A;  3WT2 A;  2C3T A;  3M1G A;  1SVL A;  5LD0 A;  4AKH A;  4XCS A;  3H93 A;  4GQF A;  1FG4 A;  3UJ1 A;  2YWI A;  4CW9 A;  1PSQ A;  2YJH A;  4ZB9 A;  5A4W A;  5EPF A;  1UA5 A;  1A8Y A;  3LFL A;  4Z7X A;  1M0U A;  4WR5 A;  2HRF A;  2AHE A;  3N5O A;  3GN3 A;  1EOG A;  2VCQ A;  3F63 A;  1Z7P A;  1GNE A;  6GSX A;  4FYU A;  4KSO A;  4N30 A;  3DWV A;  1ZYQ B;  3FZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...