1YQ1A

Structural genomics of caenorhabditis elegans: glutathione s-transferase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
205
structure length
201
Chain Sequence
MPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSGEVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione S-Transferase
publication title Structural Genomics of Caenorhabditis Elegans: glutathione S-Transferase
rcsb
source organism Caenorhabditis elegans
total genus 62
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1yq1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yq1A01
2O89A 2JADA 1A24A 2YCDA 1R5PA 1XPVA 1K0MA 4ZILA 5FT3A 4L5OA 3QFBC 5DALA 3ZLPA 1IYIA 3MAKA 2H1AA 2LTKA 1HNCA 1ERUA 1T7PB 4I97A 5ECKB 1NSWA 1YF0A 2LNSA 4RUVA 2YV7A 4ECJA 3LWAA 2GQKA 2R3XA 5DAKA 3ZRDA 5D73A 2DMMA 2E7PA 1M7TA 2YWIA 1AC1A 3MDKA 2WB9A 4ZIJA 1VF4A 4NV2A 1OVNA 2B6MA 5EPFA 3QR6A 3GL5A 2VLTA 2G0FA 1EWXA 1M2DA 5ELAA 1S3AA 1ZL9A 5G5FA 4MJEA 1TRVA 5ECOB 5ECIB 3APQA 3P90A 2X8CA 4RQXA 4N30A 4BVYB 3UVTA 5CRGA 4ML6A 5F07A 1HQOA 3ZVJA 4GLTA 2H1GA 2L5OA 4TR1A 4MZBA 1QUWA 3GKMA 3FR3A 4ECBA 1U88A 4WR5A 2I1UA 4HZ4A 1B48A 2DJ0A 4LL1B 2TRCP 2E2MA 4GSTA 4LMVA 2Z9SA 1VF2A 4K7IA 1WRYA 3D5JA 1GH2A 3JCML 3UIWA 2KP1A 1VRSD 2FA4A 4BVXA 5G30A 3FZ5A 10GSA 3DEXA 2HNLA 1T1VA 5DALB 1FO5A 1ON4A 3H93A 3IBHA 2MMZA 1XWKA 1USBA 3CYNA 4E8HA 2RLIA 3ZMKA 1SK0A 3KEBA 5KN1A 1AUCA 3PPUA 2CA8A 4KE3A 3HYPA 4ID0A 3VK9A 4IELA 4OFMA 1M2AA 1JZRA 4ZL7A 2HI7A 3P7XA 2HSMA 1JLVA 2HYXA 3VURA 2ALBA 4HJMA 2I4AA 3F8UA 2L6DA 4FYBA 3VI5A 3RBTA 3GTUA 2VD1A 3F4SA 4NV5A 4JR4A 2H19A 3AY8A 4GSSA 4KSOA 3Q6OA 1HD2A 3N5OA 1VF1A 4RI6A 1EOGA 4POMA 2YV9A 4EXJA 1AQVA 4K1FA 1XVQA 2JSYA 1FB6A 1GTAA 2VL2C 2NDOA 2JZTA 5GZZB 2QKEA 2ZCTA 4KW6A 4XS4A 3K8NA 1HNBA 4MA9A 4IJIA 2J23A 3TCOA 2BTOT 2O7KA 5KN0A 5IPHA 1BAYA 2H6XA 4KAEA 1T4YA 1SL1B 5GAPD 4BVXB 1ERVA 3A2WA 4DSRA 3UVHA 4HQSA 2AUVA 1ZGNA 1J0FA 1GUKA 3GNJA 2IMEA 2LEGA 3GRXA 6GSTA 4FIWA 5IMZA 1X9WB 1Z6MA 1FVKA 1B9XC 3TJJA 1ZZYA 2PWJA 5F06A 1DUGA 4MDCA 1XXUA 5IOWA 4N11A 1G7EA 2F9SA 3D4MA 1B8XA 3EE2A 4HJ2A 2H74A 1YQ1A 2VO4A 2HSMB 1XOAA 2R2JA 2WGRA 3HD5A 4KNDA 3F3RA 1GLPA 2L4QA 2P5RA 3GL3A 4KDUA 4IJ3A 5IQYA 1G6WA 3GTUB 6GSXA 1TRUA 5ECLB 5DCHA 2XC2A 3TOTA 4Z7XA 3Q74A 2BMXA 1Q4JA 4YQMA 3HXSA 1TOFA 3C8EA 2R37A 2VM1A 2VL9A 1GTBA 4IP6A 4XS4B 3H8QA 4ACSA 4QL7A 3TJGA 3CMIA 5HR0A 3ZZXA 22GSA 5A4WA 3W8JA 1V98A 2H0IA 3D21A 3RHCA 2CVKA 5CAXA 3ZIJA 17GSA 3QDNA 4JR6A 1I9DA 1OKDA 2NVLA 4FYUA 3HA9A 1RQMA 1XW5A 5E59A 3NIVA 4L8EA 4HU9A 4PQHA 2ON7A 3GKNA 1A2MA 4YQVA 2PVOC 4PURA 9GSSA 1XBSA 1F3AA 4KH7A 1GSFA 4G9HA 2YN1A 1JZDA 3W8SA 2CAQA 1QGVA 3KIJA 5E4WA 1X5CA 4HEA2 2P31A 2QC7A 5COHA 4IKHA 2ES7A 1OE8A 1G0TA 4NAXA 4V2NA 4KCAA 2YJHA 4ML1A 1HYUA 1U3AA 4LL4B 2CZ2A 3GFKA 1Z9HA 1EZKA 1K3OA 3FHKA 3P2AA 4DSSA 2FD3A 4I2TA 2CV4A 3KJYA 1THXA 1PA3A 1SKRB 4ECIA 1XCCA 4AJ8A 4AJ7A 1JLWA 6GSSA 2C80A 3CRUA 4JU5A 5A5KA 1Z7PA 4NPBA 1V2AA 3HZ8A 2V6KA 2HRKA 5CREA 2LS5A 3F6FA 5AISA 3VI7A 3APOA 5DVBA 3MNGA 1JFUA 2H1BA 2VCQA 3DD3A 5F0GA 2C0DA 2E2GA 1THOA 3KTLA 3HY2A 1XWBA 4FH8A 5EL8A 1EP8A 3IOSA 3IPZA 3KMOA 4OO4A 1H4OA 2RIIA 1GULA 4OCEA 5HFIA 2PGTA 1TK0B 3VLNA 2LRCA 2WRTA 1BQ7A 2HRNA 5IM9A 4OCFA 2KOKA 1KBNA 3FZAA 3GSTA 2EIRA 1PQNA 4KB3A 1ABAA 2M80A 5GSSA 3IR4A 5DJMA 2A4VA 2H75A 1XVWA 2DJ1A 2V2GA 3C73A 3ZIVA 5B7CA 1B4PA 4I2UA 2LRNA 2WDUA 1ZYQB 1SJZA 3M1GA 3UBLA 1R5AA 3I9V2 3RAZA 3OR5A 2MMNA 6GSWA 5B6NA 4PQ1A 2H30A 3U6VA 5IO2A 3FRCA 5CO3A 3GMFA 2LSTA 2OADA 5CRWA 3L9SA 2F51A 4GQCA 3EVIA 2VCVA 1K0CA 2NBSA 2PVQA 4IS0A 4IHUA 3IK9A 4IBPA 5J3RA 3VWUA 4G2EA 2L4CA 2RM6A 3QMXA 5B6MA 3QAGA 2HRKB 3IXRA 1WE0A 2FA8A 4HI7A 1PGTA 2YP6A 5B8AA 3LJRA 3F0IA 1SJIA 1S3DA 1A8YA 2LV3A 3LYKA 4BWSA 3DIEA 4XCSA 2FUG2 1LJRA 3KMNA 2XBQA 1SYRA 1A0RP 3UJ1A 2H72A 1XW6A 4ILFA 1FAAA 1PX7A 4AJ6A 3O76A 5ELGA 2RM5A 1WJKA 18GSA 3UEMA 5BMUA 4GCIA 1PN9A 3ZMLA 2C0EA 4MF5A 2FY6A 1G7OA 1B4QA 4YQUA 2I9HA 3CSJA 4IW9A 3IRAA 2O87A 3CTFA 5ECMB 2B5XA 4KF9A 2HXKA 3Q19A 1QQ2A 5HR3A 1TI3A 4JZQA 4HUAA 2GTUA 5D9TA 2YOIA 3EWLA 3DMLA 3GX8A 1V40A 2N5AA 2HZEA 1V58A 3QPMA 1ZMAA 2LQQA 2ZUPA 4WKWA 4QL9A 3KH7A 1TK8B 3HJMA 3MWHA 2F8FA 3KXOA 2PU9C 2PERA 3ME8A 3GYKA 3DKSA 1OC8A 2KHPA 1QMVA 3J7Yk 2GSRA 2GVPA 4MABA 1A0FA 4NWYA 2GZZA 2REMA 1YKCA 2EIQA 2EC4A 2VUPA 3KH9A 4OO5A 4O92A 5IMAA 5ECSA 4ZL8A 1F2EA 4BWQA 1TK5B 4HZ2A 4CW9A 4K2DA 1M99A 1DE1A 4NXIA 3FEUA 4GWRA 5JWRB 4ZBBA 3CTGA 3EC3A 3P8WA 1XIYA 1SENA 3WD6A 3GV1A 1SU9A 2A2RA 2X8GA 2JZSA 2B7JA 2IFQA 3HHVA 1SK2A 3DYRA 2MZCA 5G1LA 1PMTA 2K9FA 3TKSC 1YEPA 2J9HA 3E9JB 1GNEA 2GSTA 4Q5NA 3DXBA 4X0XA 3FR9A 3N9JA 2DMLA 2HSHA 1YF1A 1DSBA 3GUSA 3D4TA 2CX4A 4ZXGA 2PPTA 2M72A 3GKKA 5FWGA 3TJBA 1V57A 4MMMA 3KGKA 3R3EA 1SK1A 3ZITA 1DE2A 1TDIA 1F37A 2GLRA 3DVWA 4L0UA 2HZEB 5A4UA 3C7MA 3M9KA 2NTOA 4L0WA 4G0IA 4G0KA 5DQSA 1A8LA 3HJOA 4G10A 4FYCA 3HJPA 2QSIA 1M9AA 13GSA 6GSVA 5AGYA 3F6DA 3H4KA 4JBBA 5D93A 1UN2A 4EE0A 1QK8A 4GXZA 3KP8A 1GSUA 3GKXA 5IIZA 4E8EA 1N2AA 2C3TA 4KGIA 4LLRA 4TXVA 5D9WA 5GAND 2JL4A 1PKWA 2OBKA 4PNFA 5J41A 4K7OA 4F0BA 4P3YB 1XZOA 3EYTA 2JSZA 3ZTLA 2GSSA 3RPNA 4TR3A 4MF7A 1TP9A 4HS1A 2IFQB 1IYHA 3FK8A 3DGQA 3FY7A 2OACA 2XBIA 3KD0A 3TJFA 4MJCA 2I3YA 4OMVA 2K6VA 2IN3A 4DVCA 4WETA 1MDIA 5GSTA 1XWAA 2XPEA 3TRPA 3TKSA 4POBA 4NMUA 4MZCA 4WXTA 4XS1A 5AIVA 2LRTA 5ENUA 2DIZA 4BPYA 2B3SA 2CAIA 1CQGA 12GSA 4KCEA 3TKQA 5AIXA 4IQ1A 1S3CA 2DIYA 5DCGA 3IA1A 4EF0A 2CX3A 5G2ZA 4PGTA 1Q98A 3L4NA 4TRXA 3A2VA 2GDRA 3HVVA 8GSSA 1RW1A 2QGVA 1FHEA 3G7JA 5B8BA 2WCIA 2VL2A 4V1Ag 2IPAA 3PGTA 2F8AA 3PR8A 4X1UA 2TRXA 1NHOA 5G1KA 19GSA 4TR0A 2FNOA 2B1KA 1O73A 1YDKA 3TOUA 2N5BA 2K18A 4OD7A 1ZCPA 2L59A 2V41A 4MH3A 3QD9A 2LUSA 1GTUA 1O8WA 5KEJA 3LFLA 1T3BA 2HFDA 5ID2A 2X64A 11GSA 4D73A 1AQXA 4Q5FA 2H66A 2YANA 3GX0A 4OWYA 5ECHB 1EEMA 1SD9A 2KLXA 2GZPA 5CRHA 2VL3A 1SYXA 1JHBA 3UOMA 4N10A 4F82A 1MD3A 2IWTA 4PXOA 3R2QA 4IP1A 1X0RA 2KP2A 2M46A 5IO0A 1MDKA 4GF0A 3H1NA 3ZREA 2PUKC 2RUFA 6GSUA 3IDVA 3VFIA 1TU7A 3ED3A 4EKZA 3TGZA 1SL0B 4J57E 3LXTA 5JCWA 2DJJA 1SKWB 4ISDA 1GNWA 1TRWA 2AAWA 3CSHA 5LCZA 3D6IA 2O85A 3G9BA 5HQPA 4ZL9A 4WBRD 2KUCA 3EMXA 3TUEA 1E2YA 4K7NA 5HFGA 1QXHA 3BD2A 2IIYA 4H86A 4YAPA 2HSNB 3L78A 1GSEA 3GA4A 3LQ7A 3FW2A 1EEJA 2AV4A 5J4UA 4ZB8A 1MD4A 4EDZA 4BL7A 1H75A 4TXOB 5IMDA 5CRDA 3U5RE 3CXGA 3IV4A 3EMPA 3KM6A 5D96A 5J9BA 4KX4A 5INYA 2FHEA 2G2QA 2VIMA 7GSSA 3F4RA 1R7HA 2IMFA 3BOAA 1WIKA 1O85A 2LQOA 3LORA 3TKSE 2FWGA 5ECQB 1O7UA 5IMCA 1TTZA 1EV4A 5ID2B 3UARA 4Q5QA 1T8EB 4DEJA 3BCIA 3M3MA 4D73B 3FZ4A 5IMFA 1BJXA 1SJ6A 1X9SB 4MLYA 4ZBAA 3F63A 2GT5A 4RI7A 4JRRA 2VD0A 4IN0A 2YPMA 2B5YA 1WP0A 2LJAA 1LBKA 3US3A 1OYJA 1ST9A 1DBYA 4CHSA 1LU4A 2LJRA 1F9MA 3LEFA 2H6YA 1WPIA 4K6XA 2H71A 2MMAA 3NOFA 5JWOB 2YNXA 1AXDA 1KNGA 3J7Yb 4I6XA 4ULXA 4Q5RA 2K8VA 4WEYA 3ME7A 5A4VA 1TRSA 2D2ZA 3FZ9A 3C71A 3WT2A 4MP4A 5H5RA 2VOCA 5CYYA 3TKRA 3UBKA 3W6GA 1OC3A 4XRDA 4EL1A 1XWCA 4K0NA 4MCUA 2YWOA 5ABRA 1AAZA 4BL7B 5D8IA 5JCGA 1MEKA 2WJUA 4XHMA 2FWEA 1ILOA 5HR2A 5F05A 3GIXA 4J56E 3D22A 2C4JA 3M8NA 3UMAA 1BX9A 3S9FA 3ERGA 1TU8A 4LA1A 4KDYA 5ECNB 3L9UA 3I6AA 2FWFA 2OE0A 4MPFA 1OAZA 4LMWA 1GLQA 1PD21 2C0FA 3E3EA 1CQHA 3EU3A 1YJ6A 4V2MA 4F2IA 4GSNA 3IC8A 2MMOA 3PH9A 3TDGA 3QOUA 1BEDA 1F3BA 1TXXA 5G5EA 4AF2A 3IK7A 3O6TA 1EGRA 3WYWA 2HT9A 6GSYA 1KTEA 3HDCA 1R26A 2AHEA 4TKYA 1EGOA 1AQWA 3M9JA 4MK3A 3EU4A 1GTIA 3IHQA 1KEBA 4MPGA 2H01A 5DQYA 1R4WA 3I43A 5AN1A 5HR1A 1OE7A 3IAS2 4YH2A 3A3TA 2C3QA 3GH9A 4I5QA 2TIRA 2IMDA 2DJKA 3PINA 2GSQA 4QQ7A 2XPDA 2LKUA 4TVEA 2A2SA 2JZRA 3CRTA 3VWWA 1TI1A 1EV9A 3L0HA 5DDLA 1ERWA 2X8HA 1PL2A 3UL3A 4N0VA 1E6BA 4MZWA 1YEXA 4WF5A 2L57A 2E0QA 4JE1A 2AB6A 4EC0A 3DVXA 2CZ3A 2HQTA 1GUMA 1EP7A 3QCPA 1XOBA 1Z7RA 2OBIA 3EINA 1GL8A 4EDYA 2B7KA 1GSDA 4HU7A 2B5EA 1EOHA 1YY7A 2R4VA 3ZFLA 1JZOA 1T00A 4AGSA 3KTBA 4ZB9A 5G31A 1A23A 1U3IA 3RDWA 4WR4A 1G6YA 4O5RA 4F9ZA 5CNWA 3VPQA 4V1Ap 4G19A 20GSA 1QFNA 1OKTA 2PN8A 4XTSA 1X5EA 1PRXA 3G7YA 5D9XA 1WOUA 4V2LA 5IMVA 1FB0A 3KZQA 3DRNA 3GN3A 3HZ4A 4USSA 3KP9A 4IVFA 2ON5A 1HNAA 4ZB6A 5DAKB 1TJDA 4GRFA 1AIUA 4NHZA 3O3TA 1V9WA 2GZYA 2RUEA 2YWNA 4WBJA 5HFKA 3GSSA 3SBCA 5D9VA 3SWLA 2WZ9A 2YWMA 2OJLA 1ACVA 2C3NA 1RK4A 1J08A 4BA7A 3ERFA 1O6JA 4I8BA 1PL1A 2IMKA 2LNTA 3RHBA 5LNKe 4IQAA 2BJXA 16GSA 2IL3A 2CVBA 4KUNA 4TR1B 4X43A 1Z6NA 3E0UA 4MF6A 2B1LA 4YAVA 4ZBDA 2H76A 3HVXA 2JU5A 2O8VB 4L5LA 1K3LA 1T4ZA 3H79A 1VF3A 4NHWA 5JWQB 2MYGA 1TW9A 1NM3A 3APSA 4MJAA 3GHAA 2HSYA 2ZNMA 1Y25A 1NW2A 4HQZA 3ZL5A 2IMIA 2VCWA 2R5GA 3HKRA 1TKDB 2H8LA 5C04A 3LXZA 1XFLA 1A2JA 3ZVJD 2C1YA 3BCKA 3LG6A 2NPBA 4F03A 2GS3A 1U87A 4K0GA 1SD8A 1J9BA 5J9CA 3ISOA 5F8BA 4O32A 2C0GA 4POLA 4PUFC 1B9YC 3TJKA 3DWVA 5CP1A 2OKAA 4K9ZA 3LGCA 2FWHA 1GWCA 2YJ7A 1BYEA 1N8JA 2XHFA 3WGEA 4GTUA 2MBSA 3BJ5A 2CVDA 5IOXA 1GUHA 2PBJA 3TRQA 1X5DA 2DC5A 5IPGA 3F9UA 1I5GA 4HDEA 1FVJA 2UZ8A 2DBCA 2VCTA 1PKZA 5H5QA 3C1RA 4MJBA 1C72A 1W4VA 2V32A 3VWXA 3Q18A 2GGTA 1K0DA 2PMTA 2LJKA 5KN2A 2CQ9A 2L5LA 2DJ2A 4XRAA 5KN3A 2AJQB 4XS6A 4TXOA 1UVZA 3GURA 3MSZA 2GQLA 3IE3A 5EVOA 1SKSB 3KCMA 3TB2A 4EVMA 3TKPA 3QAVA 2N5FA 4O7HA 2CT6A 1JZWA 2IJYA 5ECRB 5C00A 3CSIA 3L9VA 2OA7A 2HZFA 3A5WA 3A2XA 1OC9A 1K0OA 1FG4A 3M0FA 1F6MC 2H0GA 4POKA 1K0AA 4CDOA 3GH6A 4EO3A 3HVSA 3UAPA 4KA0A 4KSMA 1GRXA 3WGDA 3QFAC 2H73A 2HE3A 3I69A 1MTCA 2VLVA 2FCHA 2K8SA 3F4TA 1U6TA 4K8MA 2YZHA 3RPPA 1FW1A 2H0HA 5FHIA 2HLSA 2DLXA 3ZYWA 1NHYA 1WWJA 1K0NA 1SL2B 2FLSA 4HOJA 4KDXA 3F3QA 3TRXA 1ML6A 2VCZA 1WMJA 4J2FA 1GSQA 3VWVA 2VAFA 1MDJA 1URMA 2H70A 3ZFBA 3G7IA 3FR6A 4GQFA 1VGLA 3HCZA 2VLUA 3BBYA 2H6ZA 1Z5YE 4PNGA 1K0BA 4G0LA 4JEDA 1XWGA 1Y6EA 1X9MB 3D0ZA 14GSA 2V6OA 4TR4A 2X99A 2JACA 1ERTA 5L71A 1PSQA 3FYGA 1ZOFA 1OC9B 2P5QA 4MH2A 1M0UA 3IAM2 1GSSA 5H5SA 3NZNA 4WF4A 2DSAA 3EURA 4OFTA 2L6CA 2DJ3A 2AYTA 4XIHA 3IC4A 2GQMA 4F0CA 2WS2A 2H1DA 5EY6A 2GT6A 4DSQA 4TN8A 3ERWA 1YKAA 3C1SA 1ZYEA 1UA5A 1AW9A 4TW5A 1O81A 1XW9A 1BG5A 1K3YA 2V1MA 5DJLA 1M2BA 2YZUA 2I81A 3LSZA 3LYPA 4PX1A 4ECCA 4EUYA 1GP1A 3V1WA 4PUAA 1PX6A 1YZXA 2HRFA 5ECPB 5JCUA 1UC7A 3WT1A 4FQUA 2R6KA 2P0GA 2HRAA 3QAWA 1GSYA 2OE1A 2VM2A 4TOPA 4BVYA 3CBUA 3FKFA 4DSSB 4PQIA 4N0ZA 2C8UA 5J5NA 4PTSA 4IGJA 1A2LA 1M9BA 4RQRA 3VPTA 2MBTA 5DBQA 2EIOA 1W89A 2F3MA 4OFNA 4FO5A 2WFCA 2OE3A 2FGXA 1O8XA 2WULA 1Z3EA 5LD0A 3WGXA 1FOVA 2VCXA
chains in the Genus database with same CATH superfamily
2O89A 2JADA 1A24A 2YCDA 3LW9A 1SVMA 1R5PA 1XPVA 1K0MA 4ZILA 5FT3A 4L5OA 3QFBC 5DALA 3ZLPA 1IYIA 3MAKA 2H1AA 2LTKA 1HNCA 1ERUA 1T7PB 4I97A 5ECKB 1NSWA 1YF0A 2LNSA 4RUVA 2YV7A 4ECJA 3LWAA 2GQKA 2R3XA 5DAKA 3ZRDA 5D73A 2DMMA 2E7PA 1M7TA 2YWIA 1AC1A 3MDKA 2WB9A 4ZIJA 1VF4A 4NV2A 1OVNA 2B6MA 5J4VA 5EPFA 3QR6A 3GL5A 2VLTA 2G0FA 1EWXA 1M2DA 5ELAA 1S3AA 1ZL9A 5G5FA 4MJEA 1TRVA 5ECOB 5ECIB 3APQA 3P90A 2X8CA 4RQXA 4N30A 4BVYB 3UVTA 5CRGA 4ML6A 5F07A 1HQOA 2A4HA 3ZVJA 4GLTA 2H1GA 2L5OA 4TR1A 4MZBA 1QUWA 3GKMA 3FR3A 4ECBA 1U88A 4WR5A 2I1UA 4O5UA 4HZ4A 1B48A 2DJ0A 4LL1B 2TRCP 2E2MA 4GSTA 4LMVA 2Z9SA 1VF2A 4K7IA 1WRYA 3D5JA 1GH2A 3JCML 3UIWA 2KP1A 1VRSD 2FA4A 4BVXA 5G30A 3FZ5A 10GSA 3DEXA 2HNLA 1T1VA 5DALB 1FO5A 1ON4A 3H93A 3IBHA 2MMZA 1XWKA 1USBA 3CYNA 4E8HA 2RLIA 3ZMKA 1SK0A 4K5SA 3KEBA 5KN1A 1AUCA 3PPUA 2CA8A 4KE3A 3HYPA 5A34A 4ID0A 3VK9A 4IELA 4OFMA 1M2AA 1JZRA 4ZL7A 2HI7A 3P7XA 2HSMA 1JLVA 2HYXA 3VURA 2ALBA 4HJMA 2I4AA 3F8UA 2L6DA 4FYBA 3VI5A 3RBTA 3GTUA 2VD1A 3F4SA 4NV5A 4JR4A 2H19A 3AY8A 4GSSA 4KSOA 3Q6OA 1HD2A 3N5OA 1VF1A 4RI6A 1EOGA 4POMA 2YV9A 4EXJA 1AQVA 4K1FA 1XVQA 2JSYA 1FB6A 1GTAA 2VL2C 1ZYPA 2A2PA 2NDOA 2JZTA 5GZZB 2QKEA 2ZCTA 4KW6A 4XS4A 3K8NA 1HNBA 4MA9A 4IJIA 2J23A 3TCOA 2BTOT 5A1NA 2O7KA 5KN0A 5IPHA 1BAYA 2H6XA 4KAEA 1T4YA 1SL1B 5GAPD 3RGBC 4BVXB 1ERVA 3A2WA 4DSRA 3UVHA 4HQSA 2AUVA 1ZGNA 1J0FA 1GUKA 4AKHA 3GNJA 2IMEA 2LEGA 3GRXA 6GSTA 4FIWA 5IMZA 1X9WB 1Z6MA 1FVKA 1B9XC 3TJJA 1ZZYA 2PWJA 5F06A 1DUGA 4MDCA 1XXUA 5IOWA 4N11A 1G7EA 2F9SA 3D4MA 4AKXB 1B8XA 3EE2A 4HJ2A 2H74A 1YQ1A 2VO4A 2HSMB 1XOAA 2R2JA 2WGRA 3HD5A 4KNDA 3F3RA 1GLPA 2L4QA 2P5RA 3GL3A 4KDUA 4IJ3A 5IQYA 1G6WA 3GTUB 6GSXA 1TRUA 5ECLB 5DCHA 2XC2A 3TOTA 4Z7XA 3Q74A 1M3JA 2BMXA 1Q4JA 4YQMA 3HXSA 1TOFA 1S4BP 3C8EA 2R37A 2VM1A 2VL9A 2QA1A 1GTBA 4IP6A 4XS4B 3H8QA 4ACSA 4QL7A 3TJGA 4PI2C 3CMIA 5HR0A 5A1NB 3ZZXA 22GSA 5A4WA 3W8JA 1M3IA 1V98A 2H0IA 3D21A 3RHCA 2CVKA 5CAXA 3ZIJA 17GSA 3HVNA 3QDNA 4JR6A 1I9DA 1OKDA 4HSCX 2NVLA 4FYUA 3HA9A 1RQMA 1XW5A 5E59A 3NIVA 4L8EA 4HU9A 4PQHA 2ON7A 3GKNA 1A2MA 4YQVA 2PVOC 4PURA 9GSSA 1XBSA 1F3AA 4KH7A 1GSFA 4G9HA 2YN1A 1JZDA 3W8SA 2CAQA 1QGVA 3KIJA 2WW2A 5E4WA 1X5CA 4HEA2 2P31A 2QC7A 5COHA 4IKHA 2ES7A 1OE8A 1G0TA 4NAXA 4AKIA 4V2NA 2R0CA 4KCAA 2YJHA 4ML1A 1HYUA 1U3AA 4LL4B 2CZ2A 3GFKA 1Z9HA 1EZKA 1K3OA 3FHKA 3P2AA 3CHXC 4DSSA 2FD3A 4I2TA 2CV4A 3KJYA 1THXA 1PA3A 1SKRB 4ECIA 1XCCA 4AJ8A 4AJ7A 1JLWA 6GSSA 5A5HA 2C80A 3CRUA 4JU5A 5A5KA 1Z7PA 4NPBA 4CY8A 1V2AA 3HZ8A 2V6KA 2HRKA 5CREA 2LS5A 3F6FA 5AISA 3VI7A 3APOA 5DVBA 3MNGA 1JFUA 2H1BA 2VCQA 3DD3A 5F0GA 2C0DA 2EFHA 2E2GA 1THOA 3KTLA 3HY2A 1XWBA 4FH8A 4PI0C 5EL8A 1EP8A 3IOSA 3IPZA 3KMOA 4OO4A 1H4OA 2RIIA 1GULA 4OCEA 5HFIA 2PGTA 1TK0B 3VLNA 2LRCA 2WRTA 1BQ7A 2HRNA 5IM9A 4OCFA 2KOKA 1KBNA 3FZAA 3TU3B 3GSTA 2EIRA 1PQNA 4KB3A 1ABAA 2M80A 5GSSA 3IR4A 5DJMA 2A4VA 2H75A 1XVWA 2DJ1A 2V2GA 3C73A 3ZIVA 5B7CA 1B4PA 4I2UA 2LRNA 2WDUA 1ZYQB 1SJZA 3M1GA 3UBLA 1R5AA 3I9V2 3RAZA 3OR5A 2MMNA 6GSWA 1SVLA 5B6NA 4PQ1A 2H30A 3U6VA 5IO2A 3FRCA 5CO3A 3GMFA 2LSTA 2OADA 5CRWA 3L9SA 2F51A 4GQCA 3EVIA 2VCVA 1K0CA 2NBSA 2PVQA 4IS0A 4IHUA 3IK9A 4IBPA 5J3RA 3VWUA 4G2EA 2L4CA 2RM6A 5A5HB 3QMXA 5B6MA 3QAGA 2HRKB 3IXRA 1WE0A 2FA8A 4HI7A 1PGTA 2YP6A 5B8AA 3LJRA 3F0IA 2O36A 1SJIA 1S3DA 1A8YA 2LV3A 3LYKA 4BWSA 3DIEA 4XCSA 2FUG2 1LJRA 3KMNA 2XBQA 1SYRA 1A0RP 3UJ1A 2H72A 1XW6A 4ILFA 1FAAA 1PX7A 4AJ6A 4PHZC 3O76A 4ZB7A 5ELGA 2RM5A 1WJKA 18GSA 3UEMA 5BMUA 4GCIA 1PN9A 3ZMLA 2C0EA 4MF5A 2FY6A 1G7OA 1B4QA 4YQUA 2I9HA 3CSJA 4IW9A 3IRAA 2O87A 3CTFA 5ECMB 2B5XA 4KF9A 2HXKA 2EFCA 5KOXA 3Q19A 1QQ2A 5HR3A 1TI3A 4JZQA 4HUAA 2GTUA 5D9TA 2YOIA 3EWLA 3DMLA 3GX8A 1V40A 1PFOA 2N5AA 2HZEA 1V58A 3QPMA 1ZMAA 2LQQA 2ZUPA 4WKWA 4QL9A 3KH7A 1TK8B 3HJMA 3MWHA 2F8FA 4YKFA 3KXOA 2PU9C 2PERA 3ME8A 3GYKA 3DKSA 1OC8A 2KHPA 1QMVA 3J7Yk 2GSRA 2GVPA 4MABA 1A0FA 4K5RA 4NWYA 2GZZA 2REMA 1YKCA 2EIQA 2EC4A 2VUPA 3KH9A 4OO5A 4O92A 5J40A 5IMAA 4ICYA 5ECSA 4ZL8A 1F2EA 4BWQA 1TK5B 3MIXA 4HZ2A 4CW9A 4K2DA 1M99A 1DE1A 4NXIA 3FEUA 4GWRA 4Z2RA 5JWRB 4ZBBA 3CTGA 1XG8A 3EC3A 3P8WA 1XIYA 1SENA 3WD6A 3GV1A 1SU9A 2A2RA 2X8GA 2JZSA 2B7JA 2IFQA 3HHVA 1SK2A 5BMUB 3DYRA 2MZCA 5G1LA 1PMTA 2K9FA 3TKSC 1YEPA 2J9HA 3E9JB 1GNEA 2GSTA 4Q5NA 3DXBA 4X0XA 3FR9A 3N9JA 2DMLA 2HSHA 1YF1A 1DSBA 3GUSA 3D4TA 2CX4A 4ZXGA 2PPTA 2M72A 3GKKA 5FWGA 3TJBA 1V57A 4MMMA 3KGKA 3R3EA 1SK1A 3ZITA 1DE2A 1TDIA 1F37A 2GLRA 3DVWA 4L0UA 2HZEB 5A4UA 3C7MA 3M9KA 2NTOA 4L0WA 4G0IA 4G0KA 5DQSA 1A8LA 3HJOA 4G10A 4FYCA 3HJPA 2QSIA 1M9AA 13GSA 6GSVA 5AGYA 3F6DA 3H4KA 1TXUA 4JBBA 5D93A 1UN2A 4EE0A 1QK8A 4GXZA 3KP8A 1GSUA 3GKXA 5IIZA 4E8EA 1N2AA 2C3TA 4EIPA 4KGIA 4LLRA 4TXVA 5D9WA 5GAND 2JL4A 1PKWA 2OBKA 4PNFA 5J41A 4K7OA 4F0BA 4P3YB 1XZOA 3EYTA 2JSZA 3ZTLA 2GSSA 3RPNA 4TR3A 4MF7A 1TP9A 4HS1A 2OT3A 2IFQB 1IYHA 2WVYA 3FK8A 3DGQA 3FY7A 2OACA 2XBIA 3KD0A 3TJFA 4MJCA 2I3YA 4OMVA 2K6VA 2IN3A 4Z2UA 4DVCA 4K2XA 4WETA 1MDIA 5GSTA 1XWAA 2XPEA 3TRPA 3TKSA 4POBA 4NMUA 4MZCA 4WXTA 4XS1A 5AIVA 2LRTA 5ENUA 2DIZA 4BPYA 2B3SA 2CAIA 1CQGA 12GSA 4KCEA 3TKQA 5AIXA 4IQ1A 1S3CA 2DIYA 5DCGA 3IA1A 1YEWC 4EF0A 2CX3A 5G2ZA 4PGTA 1Q98A 3L4NA 4TRXA 3A2VA 2GDRA 3HVVA 4G01A 8GSSA 1RW1A 2QGVA 1FHEA 3G7JA 2UV8G 5B8BA 2WCIA 2VL2A 4V1Ag 2IPAA 3PGTA 2F8AA 3PR8A 4X1UA 2TRXA 1NHOA 5G1KA 1SVOA 19GSA 4TR0A 2O3EA 2FNOA 2B1KA 1O73A 1YDKA 3TOUA 2N5BA 2K18A 4OD7A 1ZCPA 2L59A 2V41A 4MH3A 3QD9A 2LUSA 1GTUA 1O8WA 5KEJA 3LFLA 1T3BA 2HFDA 4AKGA 5ID2A 2X64A 11GSA 4D73A 1AQXA 4Q5FA 2H66A 2YANA 3GX0A 4OWYA 5ECHB 1EEMA 1SD9A 2KLXA 2GZPA 5CRHA 2VL3A 1SYXA 1JHBA 3UOMA 4N10A 4F82A 1MD3A 2IWTA 4PXOA 3R2QA 4IP1A 1X0RA 2KP2A 2M46A 5IO0A 1MDKA 4GF0A 3H1NA 3ZREA 2PUKC 1FOHA 2RUFA 6GSUA 3IDVA 3VFIA 1TU7A 3ED3A 4EKZA 3TGZA 1SL0B 4J57E 3LXTA 5JCWA 2DJJA 1SKWB 4ISDA 1GNWA 1TRWA 2QA2A 2AAWA 3CSHA 5LCZA 3D6IA 2O85A 3G9BA 5HQPA 4ZL9A 4WBRD 2KUCA 3EMXA 3TUEA 1E2YA 4K7NA 5HFGA 1QXHA 3BD2A 2IIYA 4H86A 2H1LA 4YAPA 2HSNB 3L78A 1GSEA 3GA4A 3LQ7A 3FW2A 1EEJA 2AV4A 5J4UA 4ZB8A 1MD4A 4EDZA 4BL7A 1H75A 4TXOB 5IMDA 5CRDA 3U5RE 4QMKA 3CXGA 3IV4A 3CWGA 3EMPA 3KM6A 5D96A 5J9BA 4KX4A 4YKGA 5INYA 2FHEA 2G2QA 2VIMA 7GSSA 1YVLA 3F4RA 1R7HA 2IMFA 3BOAA 1WIKA 2R0PA 1O85A 2LQOA 3LORA 3TKSE 2FWGA 5ECQB 1O7UA 5IMCA 1TTZA 1EV4A 2R0GA 5ID2B 3UARA 4Q5QA 1T8EB 4DEJA 3BCIA 3M3MA 4A5PA 4D73B 3FZ4A 5IMFA 1BJXA 1SJ6A 1X9SB 4MLYA 4ZBAA 3F63A 2GT5A 4RI7A 4JRRA 2VD0A 4IN0A 2YPMA 2B5YA 1WP0A 3RFRC 2LJAA 1LBKA 3US3A 1OYJA 1ST9A 1DBYA 4CHSA 1LU4A 4E68A 2LJRA 1F9MA 3LEFA 2H6YA 1WPIA 4K6XA 2H71A 2MMAA 4GDFA 3NOFA 5JWOB 2YNXA 1AXDA 1KNGA 3J7Yb 4I6XA 4ULXA 4Q5RA 2K8VA 4WEYA 3ME7A 5A4VA 1TRSA 2D2ZA 2VKZG 3FZ9A 3C71A 3WT2A 4MP4A 5H5RA 2VOCA 5CYYA 3TKRA 2WVZA 3UBKA 3W6GA 1OC3A 2X4AA 4XRDA 4EL1A 1XWCA 4K0NA 4MCUA 2YWOA 5ABRA 1AAZA 4BL7B 5D8IA 5JCGA 1MEKA 2WJUA 4XHMA 2FWEA 1ILOA 5HR2A 5F05A 3GIXA 4J56E 3D22A 1Y1UA 2C4JA 3M8NA 3UMAA 1BX9A 3S9FA 3ERGA 1TU8A 4LA1A 4KDYA 5ECNB 3L9UA 3I6AA 2FWFA 2OE0A 2X49A 4MPFA 1OAZA 4LMWA 1GLQA 1PD21 2C0FA 3E3EA 4AI6A 1CQHA 3EU3A 1YJ6A 4V2MA 4F2IA 4GSNA 3IC8A 2MMOA 3PH9A 3TDGA 1BEDA 3QOUA 1F3BA 1TXXA 5G5EA 4AF2A 3IK7A 3O6TA 1EGRA 3WYWA 2HT9A 6GSYA 1KTEA 3HDCA 1R26A 2AHEA 4TKYA 1EGOA 1AQWA 1I1IP 3M9JA 4MK3A 3EU4A 1GTIA 3IHQA 1KEBA 4MPGA 2H01A 5DQYA 1R4WA 3I43A 5AN1A 5HR1A 1OE7A 4X4JA 3IAS2 4YH2A 3A3TA 2C3QA 3GH9A 4I5QA 2TIRA 2IMDA 2DJKA 3PINA 2GSQA 4QQ7A 2XPDA 2LKUA 4TVEA 2A2SA 2JZRA 3CRTA 3VWWA 1TI1A 1EV9A 3L0HA 5DDLA 1ERWA 2X8HA 1PL2A 3UL3A 4N0VA 1E6BA 4MZWA 1YEXA 4WF5A 2L57A 2E0QA 4JE1A 2AB6A 4EC0A 3DVXA 2DKIA 2CZ3A 2HQTA 1GUMA 1EP7A 3QCPA 1XOBA 1Z7RA 2OBIA 3EINA 1GL8A 4EDYA 2B7KA 1GSDA 4HU7A 2B5EA 1EOHA 1YY7A 2R4VA 3ZFLA 1JZOA 1BF5A 4AGSA 1T00A 3KTBA 4ZB9A 5G31A 1A23A 3HMJG 1U3IA 4W66A 3RDWA 4WR4A 1G6YA 4O5RA 4F9ZA 4BIKA 5CNWA 3VPQA 4V1Ap 4G19A 20GSA 1QFNA 1OKTA 2PN8A 3EPTA 1N25A 4XTSA 1X5EA 1PRXA 2WW1A 3G7YA 1S3RA 5D9XA 1WOUA 4V2LA 5IMVA 1FB0A 3KZQA 3DRNA 3GN3A 3HZ4A 4USSA 3KP9A 4IVFA 2ON5A 1HNAA 4ZB6A 5DAKB 1TJDA 4GRFA 1AIUA 4CY6A 4MNNA 3CQFA 4NHZA 3O3TA 1V9WA 2GZYA 2RUEA 2YWNA 4WBJA 5HFKA 3GSSA 3SBCA 5D9VA 3SWLA 2WZ9A 2YWMA 2OJLA 1ACVA 2C3NA 1RK4A 1J08A 4BA7A 3ERFA 1O6JA 4I8BA 1PL1A 2IMKA 2LNTA 3RHBA 5LNKe 4IQAA 2BJXA 2EFDA 16GSA 2IL3A 2CVBA 4KUNA 4TR1B 4X43A 1Z6NA 3E0UA 4MF6A 2B1LA 4YAVA 4ZBDA 2H76A 3HVXA 2JU5A 2O8VB 4L5LA 1K3LA 1BG1A 1T4ZA 3H79A 1VF3A 4NHWA 5JWQB 2MYGA 1TW9A 1NM3A 3APSA 4MJAA 3GHAA 2HSYA 2ZNMA 1Y25A 1NW2A 1ZYNA 4HQZA 3ZL5A 2IMIA 2VCWA 2R5GA 3HKRA 2O5VA 2WW3A 1TKDB 2H8LA 5C04A 3LXZA 1XFLA 1A2JA 3ZVJD 3IHGA 2C1YA 3BCKA 3LG6A 2NPBA 4F03A 2GS3A 1U87A 4K0GA 1SD8A 1J9BA 5BRTA 5J9CA 3ISOA 5F8BA 4O32A 2C0GA 4POLA 4PUFC 1B9YC 3TJKA 3DWVA 5CP1A 2OKAA 4K9ZA 5A34B 3LGCA 2FWHA 1GWCA 2YJ7A 1BYEA 1N8JA 2XHFA 3WGEA 4GTUA 2MBSA 3BJ5A 2CVDA 5IOXA 1GUHA 2PBJA 3TRQA 1X5DA 2DC5A 5IPGA 3F9UA 1I5GA 4HDEA 1FVJA 2UZ8A 2DBCA 2VCTA 1PKZA 5H5QA 3C1RA 4MJBA 2WW0A 1C72A 1W4VA 2V32A 3VWXA 3Q18A 2HSNA 2GGTA 1K0DA 2PMTA 2LJKA 4O5QA 5KN2A 2CQ9A 2L5LA 2DJ2A 4XRAA 5KN3A 2AJQB 4XS6A 4TXOA 1UVZA 3GURA 3MSZA 2GQLA 3IE3A 5EVOA 1SKSB 3KCMA 3TB2A 4EVMA 3TKPA 5J4YA 3QAVA 2N5FA 4O7HA 2CT6A 1JZWA 2IJYA 3A5IA 5ECRB 5C00A 3CSIA 2OA7A 3L9VA 2HZFA 3A5WA 3A2XA 1OC9A 1K0OA 1FG4A 3FMWA 3M0FA 1F6MC 5KOWA 2H0GA 4POKA 1K0AA 4CDOA 3GH6A 4EO3A 3HVSA 3UAPA 4KA0A 4KSMA 1GRXA 3WGDA 3QFAC 2H73A 2HE3A 3I69A 1MTCA 2VLVA 2FCHA 2K8SA 3F4TA 1U6TA 2WVXA 4Z2TA 4K8MA 2YZHA 3RPPA 1FW1A 2H0HA 5FHIA 2HLSA 4EIQA 2DLXA 3ZYWA 1NHYA 1WWJA 1K0NA 1SL2B 2FLSA 4HOJA 4KDXA 3F3QA 3TRXA 1ML6A 2VCZA 1WMJA 4J2FA 1GSQA 3VWVA 2WZSA 2VAFA 1MDJA 1URMA 2H70A 3ZFBA 3G7IA 3FR6A 4GQFA 1VGLA 3HCZA 2VLUA 3BBYA 2H6ZA 1Z5YE 4PNGA 1K0BA 4G0LA 4JEDA 1XWGA 1Y6EA 1X9MB 4N3ZA 3D0ZA 14GSA 2V6OA 4TR4A 2X99A 2JACA 1ERTA 2DKHA 5L71A 1PSQA 3FYGA 1ZOFA 1OC9B 2P5QA 4MH2A 1M0UA 3IAM2 1GSSA 5H5SA 3NZNA 4WF4A 2DSAA 3EURA 4OFTA 2L6CA 2DJ3A 2AYTA 4XIHA 3IC4A 2GQMA 3MYDA 4F0CA 2WS2A 2H1DA 5EY6A 2GT6A 4DSQA 4TN8A 3ERWA 1YKAA 4FXYP 3C1SA 1ZYEA 1UA5A 1AW9A 4TW5A 1O81A 1XW9A 1BG5A 1K3YA 2V1MA 2WVXB 5DJLA 1M2BA 2YZUA 2I81A 3LSZA 3LYPA 4PX1A 4ECCA 4EUYA 1GP1A 3V1WA 4PUAA 1PX6A 1YZXA 2HRFA 5ECPB 5JCUA 1UC7A 3WT1A 4FQUA 2R6KA 2P0GA 2HRAA 3QAWA 1GSYA 2OE1A 2VM2A 4TOPA 4BVYA 3CBUA 3FKFA 4DSSB 4PQIA 4N0ZA 2C8UA 1PN0A 5J5NA 4PTSA 4IGJA 1A2LA 1M9BA 4RQRA 3VPTA 2MBTA 5DBQA 2EIOA 1W89A 2F3MA 4OFNA 4FO5A 2EFEA 2WFCA 2OE3A 2FGXA 1O8XA 2WULA 1Z3EA 5LD0A 5J47A 3WGXA 1FOVA 2VCXA
chains in the Genus database with same CATH topology
2O89A 2JADA 1A24A 2YCDA 3LW9A 1SVMA 1R5PA 1XPVA 1K0MA 4ZILA 5FT3A 4L5OA 3QFBC 5DALA 3ZLPA 1IYIA 3MAKA 2H1AA 2LTKA 1HNCA 1ERUA 1T7PB 4I97A 5ECKB 1NSWA 1YF0A 2LNSA 4RUVA 2YV7A 4ECJA 3LWAA 2GQKA 2R3XA 5DAKA 3ZRDA 5D73A 2DMMA 2E7PA 1M7TA 2YWIA 1AC1A 3MDKA 2WB9A 4ZIJA 1VF4A 4NV2A 1OVNA 2B6MA 5J4VA 5EPFA 3QR6A 3GL5A 2VLTA 2G0FA 1EWXA 1M2DA 5ELAA 1S3AA 1ZL9A 5G5FA 4MJEA 1TRVA 5ECOB 5ECIB 3APQA 3P90A 2X8CA 4RQXA 4N30A 4BVYB 3UVTA 5CRGA 4ML6A 5F07A 1HQOA 2A4HA 3ZVJA 4GLTA 2H1GA 2L5OA 4TR1A 4MZBA 1QUWA 3GKMA 3FR3A 4ECBA 1U88A 4WR5A 2I1UA 4O5UA 4HZ4A 1B48A 2DJ0A 4LL1B 2TRCP 2E2MA 4GSTA 4LMVA 2Z9SA 1VF2A 4K7IA 1WRYA 3D5JA 1GH2A 3JCML 3UIWA 2KP1A 1VRSD 2FA4A 4BVXA 5G30A 3FZ5A 10GSA 3DEXA 2HNLA 1T1VA 5DALB 1FO5A 1ON4A 3H93A 3IBHA 2MMZA 1XWKA 1USBA 3CYNA 4E8HA 2RLIA 3ZMKA 1SK0A 4K5SA 3KEBA 5KN1A 1AUCA 3PPUA 2CA8A 4KE3A 3HYPA 5A34A 4ID0A 3VK9A 4IELA 4OFMA 1M2AA 1JZRA 4ZL7A 2HI7A 3P7XA 2HSMA 1JLVA 2HYXA 3VURA 2ALBA 4HJMA 2I4AA 3F8UA 2L6DA 4FYBA 3VI5A 3RBTA 3GTUA 2VD1A 3F4SA 4NV5A 4JR4A 2H19A 3AY8A 4GSSA 4KSOA 3Q6OA 1HD2A 3N5OA 1VF1A 4RI6A 1EOGA 4POMA 2YV9A 4EXJA 1AQVA 4K1FA 1XVQA 2JSYA 1FB6A 1GTAA 2VL2C 1ZYPA 2A2PA 2NDOA 2JZTA 5GZZB 2QKEA 2ZCTA 4KW6A 4XS4A 3K8NA 1HNBA 4MA9A 4IJIA 2J23A 3TCOA 2BTOT 5A1NA 2O7KA 5KN0A 5IPHA 1BAYA 2H6XA 4KAEA 1T4YA 1SL1B 5GAPD 4BVXB 1ERVA 3A2WA 4DSRA 3UVHA 4HQSA 2AUVA 1ZGNA 1J0FA 1GUKA 4AKHA 3GNJA 2IMEA 2LEGA 3GRXA 6GSTA 4FIWA 5IMZA 1X9WB 1Z6MA 1FVKA 1B9XC 3TJJA 1ZZYA 2PWJA 5F06A 1DUGA 4MDCA 1XXUA 5IOWA 4N11A 1G7EA 2F9SA 3D4MA 4AKXB 1B8XA 3EE2A 4HJ2A 2H74A 1YQ1A 2VO4A 2HSMB 1XOAA 2R2JA 2WGRA 3HD5A 4KNDA 3F3RA 1GLPA 2L4QA 2P5RA 3GL3A 4KDUA 4IJ3A 5IQYA 1G6WA 3GTUB 6GSXA 1TRUA 5ECLB 5DCHA 2XC2A 3TOTA 4Z7XA 3Q74A 2BMXA 1Q4JA 4YQMA 3HXSA 1TOFA 3C8EA 2R37A 2VM1A 2VL9A 2QA1A 1GTBA 4IP6A 4XS4B 3H8QA 4ACSA 4QL7A 3TJGA 3CMIA 5HR0A 5A1NB 3ZZXA 22GSA 5A4WA 3W8JA 1V98A 2H0IA 3D21A 3RHCA 2CVKA 5CAXA 3ZIJA 17GSA 3QDNA 4JR6A 1I9DA 1OKDA 2NVLA 4FYUA 3HA9A 1RQMA 1XW5A 5E59A 3NIVA 4L8EA 4HU9A 4PQHA 2ON7A 3GKNA 1A2MA 4YQVA 2PVOC 4PURA 9GSSA 1XBSA 1F3AA 4KH7A 1GSFA 4G9HA 2YN1A 1JZDA 3W8SA 2CAQA 1QGVA 3KIJA 5E4WA 1X5CA 4HEA2 2P31A 2QC7A 5COHA 4IKHA 2ES7A 1OE8A 1G0TA 4NAXA 4AKIA 4V2NA 2R0CA 4KCAA 2YJHA 4ML1A 1HYUA 1U3AA 4LL4B 2CZ2A 3GFKA 1Z9HA 1EZKA 1K3OA 3FHKA 3P2AA 4DSSA 2FD3A 4I2TA 2CV4A 3KJYA 1THXA 1PA3A 1SKRB 4ECIA 1XCCA 4AJ8A 4AJ7A 1JLWA 6GSSA 5A5HA 2C80A 3CRUA 4JU5A 5A5KA 1Z7PA 4NPBA 4CY8A 1V2AA 3HZ8A 2V6KA 2HRKA 5CREA 2LS5A 3F6FA 5AISA 3VI7A 3APOA 5DVBA 3MNGA 1JFUA 2H1BA 2VCQA 3DD3A 5F0GA 2C0DA 2EFHA 2E2GA 1THOA 3KTLA 3HY2A 1XWBA 4FH8A 5EL8A 1EP8A 3IOSA 3IPZA 3KMOA 4OO4A 1H4OA 2RIIA 1GULA 4OCEA 5HFIA 2PGTA 1TK0B 3VLNA 2LRCA 2WRTA 1BQ7A 2HRNA 5IM9A 4OCFA 2KOKA 1KBNA 3FZAA 3TU3B 3GSTA 2EIRA 1PQNA 4KB3A 1ABAA 2M80A 5GSSA 3IR4A 5DJMA 2A4VA 2H75A 1XVWA 2DJ1A 2V2GA 3C73A 3ZIVA 5B7CA 1B4PA 4I2UA 2LRNA 2WDUA 1ZYQB 1SJZA 3M1GA 3UBLA 1R5AA 3I9V2 3RAZA 3OR5A 2MMNA 6GSWA 1SVLA 5B6NA 4PQ1A 2H30A 3U6VA 5IO2A 3FRCA 5CO3A 3GMFA 2LSTA 2OADA 5CRWA 3L9SA 2F51A 4GQCA 3EVIA 2VCVA 1K0CA 2NBSA 2PVQA 4IS0A 4IHUA 3IK9A 4IBPA 5J3RA 3VWUA 4G2EA 2L4CA 2RM6A 5A5HB 3QMXA 5B6MA 3QAGA 2HRKB 3IXRA 1WE0A 2FA8A 4HI7A 1PGTA 2YP6A 5B8AA 3LJRA 3F0IA 1SJIA 1S3DA 1A8YA 2LV3A 3LYKA 4BWSA 3DIEA 4XCSA 2FUG2 1LJRA 3KMNA 2XBQA 1SYRA 1A0RP 3UJ1A 2H72A 1XW6A 4ILFA 1FAAA 1PX7A 4AJ6A 3O76A 4ZB7A 5ELGA 2RM5A 1WJKA 18GSA 3UEMA 5BMUA 4GCIA 1PN9A 3ZMLA 2C0EA 4MF5A 2FY6A 1G7OA 1B4QA 4YQUA 2I9HA 3CSJA 4IW9A 3IRAA 2O87A 3CTFA 5ECMB 2B5XA 4KF9A 2HXKA 2EFCA 5KOXA 3Q19A 1QQ2A 5HR3A 1TI3A 4JZQA 4HUAA 2GTUA 5D9TA 2YOIA 3EWLA 3DMLA 3GX8A 1V40A 2N5AA 2HZEA 1V58A 3QPMA 1ZMAA 2LQQA 2ZUPA 4WKWA 4QL9A 3KH7A 1TK8B 3HJMA 3MWHA 2F8FA 4YKFA 3KXOA 2PU9C 2PERA 3ME8A 3GYKA 3DKSA 1OC8A 2KHPA 1QMVA 3J7Yk 2GSRA 2GVPA 4MABA 1A0FA 4K5RA 4NWYA 2GZZA 2REMA 1YKCA 2EIQA 2EC4A 2VUPA 3KH9A 4OO5A 4O92A 5J40A 5IMAA 4ICYA 5ECSA 4ZL8A 1F2EA 4BWQA 1TK5B 3MIXA 4HZ2A 4CW9A 4K2DA 1M99A 1DE1A 4NXIA 3FEUA 4GWRA 4Z2RA 5JWRB 4ZBBA 3CTGA 3EC3A 3P8WA 1XIYA 1SENA 3WD6A 3GV1A 1SU9A 2A2RA 2X8GA 2JZSA 2B7JA 2IFQA 3HHVA 1SK2A 5BMUB 3DYRA 2MZCA 5G1LA 1PMTA 2K9FA 3TKSC 1YEPA 2J9HA 3E9JB 1GNEA 2GSTA 4Q5NA 3DXBA 4X0XA 3FR9A 3N9JA 2DMLA 2HSHA 1YF1A 1DSBA 3GUSA 3D4TA 2CX4A 4ZXGA 2PPTA 2M72A 3GKKA 5FWGA 3TJBA 1V57A 4MMMA 3KGKA 3R3EA 1SK1A 3ZITA 1DE2A 1TDIA 1F37A 2GLRA 3DVWA 4L0UA 2HZEB 5A4UA 3C7MA 3M9KA 2NTOA 4L0WA 4G0IA 4G0KA 5DQSA 1A8LA 3HJOA 4G10A 4FYCA 3HJPA 2QSIA 1M9AA 13GSA 6GSVA 5AGYA 3F6DA 3H4KA 1TXUA 4JBBA 5D93A 1UN2A 4EE0A 1QK8A 4GXZA 3KP8A 1GSUA 3GKXA 5IIZA 4E8EA 1N2AA 2C3TA 4EIPA 4KGIA 4LLRA 4TXVA 5D9WA 5GAND 2JL4A 1PKWA 2OBKA 4PNFA 5J41A 4K7OA 4F0BA 4P3YB 1XZOA 3EYTA 2JSZA 3ZTLA 2GSSA 3RPNA 4TR3A 4MF7A 1TP9A 4HS1A 2OT3A 2IFQB 1IYHA 3FK8A 3DGQA 3FY7A 2OACA 2XBIA 3KD0A 3TJFA 4MJCA 2I3YA 4OMVA 2K6VA 2IN3A 4Z2UA 4DVCA 4K2XA 4WETA 1MDIA 5GSTA 1XWAA 2XPEA 3TRPA 3TKSA 4POBA 4NMUA 4MZCA 4WXTA 4XS1A 5AIVA 2LRTA 5ENUA 2DIZA 4BPYA 2B3SA 2CAIA 1CQGA 12GSA 4KCEA 3TKQA 5AIXA 4IQ1A 1S3CA 2DIYA 5DCGA 3IA1A 4EF0A 2CX3A 5G2ZA 4PGTA 1Q98A 3L4NA 4TRXA 3A2VA 2GDRA 3HVVA 4G01A 8GSSA 1RW1A 2QGVA 1FHEA 3G7JA 2UV8G 5B8BA 2WCIA 2VL2A 4V1Ag 2IPAA 3PGTA 2F8AA 3PR8A 4X1UA 2TRXA 1NHOA 5G1KA 1SVOA 19GSA 4TR0A 2FNOA 2B1KA 1O73A 1YDKA 3TOUA 2N5BA 2K18A 4OD7A 1ZCPA 2L59A 2V41A 4MH3A 3QD9A 2LUSA 1GTUA 1O8WA 5KEJA 3LFLA 1T3BA 2HFDA 4AKGA 5ID2A 2X64A 11GSA 4D73A 1AQXA 4Q5FA 2H66A 2YANA 3GX0A 4OWYA 5ECHB 1EEMA 1SD9A 2KLXA 2GZPA 5CRHA 2VL3A 1SYXA 1JHBA 3UOMA 4N10A 4F82A 1MD3A 2IWTA 4PXOA 3R2QA 4IP1A 1X0RA 2KP2A 2M46A 5IO0A 1MDKA 4GF0A 3H1NA 3ZREA 2PUKC 1FOHA 2RUFA 6GSUA 3IDVA 3VFIA 1TU7A 3ED3A 4EKZA 3TGZA 1SL0B 4J57E 3LXTA 5JCWA 2DJJA 1SKWB 4ISDA 1GNWA 1TRWA 2QA2A 2AAWA 3CSHA 5LCZA 3D6IA 2O85A 3G9BA 5HQPA 4ZL9A 4WBRD 2KUCA 3EMXA 3TUEA 1E2YA 4K7NA 5HFGA 1QXHA 3BD2A 2IIYA 4H86A 2H1LA 4YAPA 2HSNB 3L78A 1GSEA 3GA4A 3LQ7A 3FW2A 1EEJA 2AV4A 5J4UA 4ZB8A 1MD4A 4EDZA 4BL7A 1H75A 4TXOB 5IMDA 5CRDA 3U5RE 4QMKA 3CXGA 3IV4A 3CWGA 3EMPA 3KM6A 5D96A 5J9BA 4KX4A 4YKGA 5INYA 2FHEA 2G2QA 2VIMA 7GSSA 1YVLA 3F4RA 1R7HA 2IMFA 3BOAA 1WIKA 2R0PA 1O85A 2LQOA 3LORA 3TKSE 2FWGA 5ECQB 1O7UA 5IMCA 1TTZA 1EV4A 2R0GA 5ID2B 3UARA 4Q5QA 1T8EB 4DEJA 3BCIA 3M3MA 4A5PA 4D73B 3FZ4A 5IMFA 1BJXA 1SJ6A 1X9SB 4MLYA 4ZBAA 3F63A 2GT5A 4RI7A 4JRRA 2VD0A 4IN0A 2YPMA 2B5YA 1WP0A 2LJAA 1LBKA 3US3A 1OYJA 1ST9A 1DBYA 4CHSA 1LU4A 4E68A 2LJRA 1F9MA 3LEFA 2H6YA 1WPIA 4K6XA 2H71A 2MMAA 4GDFA 3NOFA 5JWOB 2YNXA 1AXDA 1KNGA 3J7Yb 4I6XA 4ULXA 4Q5RA 2K8VA 4WEYA 3ME7A 5A4VA 1TRSA 2D2ZA 2VKZG 3FZ9A 3C71A 3WT2A 4MP4A 5H5RA 2VOCA 5CYYA 3TKRA 3UBKA 3W6GA 1OC3A 2X4AA 4XRDA 4EL1A 1XWCA 4K0NA 4MCUA 2YWOA 5ABRA 1AAZA 4BL7B 5D8IA 5JCGA 1MEKA 2WJUA 4XHMA 2FWEA 1ILOA 5HR2A 5F05A 3GIXA 4J56E 3D22A 1Y1UA 2C4JA 3M8NA 3UMAA 1BX9A 3S9FA 3ERGA 1TU8A 4LA1A 4KDYA 5ECNB 3L9UA 3I6AA 2FWFA 2OE0A 2X49A 4MPFA 1OAZA 4LMWA 1GLQA 1PD21 2C0FA 3E3EA 4AI6A 1CQHA 3EU3A 1YJ6A 4V2MA 4F2IA 4GSNA 3IC8A 2MMOA 3PH9A 3TDGA 1BEDA 3QOUA 1F3BA 1TXXA 5G5EA 4AF2A 3IK7A 3O6TA 1EGRA 3WYWA 2HT9A 6GSYA 1KTEA 3HDCA 1R26A 2AHEA 4TKYA 1EGOA 1AQWA 3M9JA 4MK3A 3EU4A 1GTIA 3IHQA 1KEBA 4MPGA 2H01A 5DQYA 1R4WA 3I43A 5AN1A 5HR1A 1OE7A 4X4JA 3IAS2 4YH2A 3A3TA 2C3QA 3GH9A 4I5QA 2TIRA 2IMDA 2DJKA 3PINA 2GSQA 4QQ7A 2XPDA 2LKUA 4TVEA 2A2SA 2JZRA 3CRTA 3VWWA 1TI1A 1EV9A 3L0HA 5DDLA 1ERWA 2X8HA 1PL2A 3UL3A 4N0VA 1E6BA 4MZWA 1YEXA 4WF5A 2L57A 2E0QA 4JE1A 2AB6A 4EC0A 3DVXA 2DKIA 2CZ3A 2HQTA 1GUMA 1EP7A 3QCPA 1XOBA 1Z7RA 2OBIA 3EINA 1GL8A 4EDYA 2B7KA 1GSDA 4HU7A 2B5EA 1EOHA 1YY7A 2R4VA 3ZFLA 1JZOA 1BF5A 4AGSA 1T00A 3KTBA 4ZB9A 5G31A 1A23A 3HMJG 1U3IA 4W66A 3RDWA 4WR4A 1G6YA 4O5RA 4F9ZA 5CNWA 3VPQA 4V1Ap 4G19A 20GSA 1QFNA 1OKTA 2PN8A 3EPTA 1N25A 4XTSA 1X5EA 1PRXA 3G7YA 5D9XA 1WOUA 4V2LA 5IMVA 1FB0A 3KZQA 3DRNA 3GN3A 3HZ4A 4USSA 3KP9A 4IVFA 2ON5A 1HNAA 4ZB6A 5DAKB 1TJDA 4GRFA 1AIUA 4CY6A 4MNNA 4NHZA 3O3TA 1V9WA 2GZYA 2RUEA 2YWNA 4WBJA 5HFKA 3GSSA 3SBCA 5D9VA 3SWLA 2WZ9A 2YWMA 2OJLA 1ACVA 2C3NA 1RK4A 1J08A 4BA7A 3ERFA 1O6JA 4I8BA 1PL1A 2IMKA 2LNTA 3RHBA 5LNKe 4IQAA 2BJXA 2EFDA 16GSA 2IL3A 2CVBA 4KUNA 4TR1B 4X43A 1Z6NA 3E0UA 4MF6A 2B1LA 4YAVA 4ZBDA 2H76A 3HVXA 2JU5A 2O8VB 4L5LA 1K3LA 1BG1A 1T4ZA 3H79A 1VF3A 4NHWA 5JWQB 2MYGA 1TW9A 1NM3A 3APSA 4MJAA 3GHAA 2HSYA 2ZNMA 1Y25A 1NW2A 1ZYNA 4HQZA 3ZL5A 2IMIA 2VCWA 2R5GA 3HKRA 2O5VA 1TKDB 2H8LA 5C04A 3LXZA 1XFLA 1A2JA 3ZVJD 3IHGA 2C1YA 3BCKA 3LG6A 2NPBA 4F03A 2GS3A 1U87A 4K0GA 1SD8A 1J9BA 5BRTA 5J9CA 3ISOA 5F8BA 4O32A 2C0GA 4POLA 4PUFC 1B9YC 3TJKA 3DWVA 5CP1A 2OKAA 4K9ZA 5A34B 3LGCA 2FWHA 1GWCA 2YJ7A 1BYEA 1N8JA 2XHFA 3WGEA 4GTUA 2MBSA 3BJ5A 2CVDA 5IOXA 1GUHA 2PBJA 3TRQA 1X5DA 2DC5A 5IPGA 3F9UA 1I5GA 4HDEA 1FVJA 2UZ8A 2DBCA 2VCTA 1PKZA 5H5QA 3C1RA 4MJBA 1C72A 1W4VA 2V32A 3VWXA 3Q18A 2HSNA 2GGTA 1K0DA 2PMTA 2LJKA 4O5QA 5KN2A 2CQ9A 2L5LA 2DJ2A 4XRAA 5KN3A 2AJQB 4XS6A 4TXOA 1UVZA 3GURA 3MSZA 2GQLA 3IE3A 5EVOA 1SKSB 3KCMA 3TB2A 4EVMA 3TKPA 5J4YA 3QAVA 2N5FA 4O7HA 2CT6A 1JZWA 2IJYA 3A5IA 5ECRB 5C00A 3CSIA 3L9VA 2OA7A 2HZFA 3A5WA 3A2XA 1OC9A 1K0OA 1FG4A 3FMWA 3M0FA 1F6MC 5KOWA 2H0GA 4POKA 1K0AA 4CDOA 3GH6A 4EO3A 3HVSA 3UAPA 4KA0A 4KSMA 1GRXA 3WGDA 3QFAC 2H73A 2HE3A 3I69A 1MTCA 2VLVA 2FCHA 2K8SA 3F4TA 1U6TA 4Z2TA 4K8MA 2YZHA 3RPPA 1FW1A 2H0HA 5FHIA 2HLSA 4EIQA 2DLXA 3ZYWA 1NHYA 1WWJA 1K0NA 1SL2B 2FLSA 4HOJA 4KDXA 3F3QA 3TRXA 1ML6A 2VCZA 1WMJA 4J2FA 1GSQA 3VWVA 2VAFA 1MDJA 1URMA 2H70A 3ZFBA 3G7IA 3FR6A 4GQFA 1VGLA 3HCZA 2VLUA 3BBYA 2H6ZA 1Z5YE 4PNGA 1K0BA 4G0LA 4JEDA 1XWGA 1Y6EA 1X9MB 4N3ZA 3D0ZA 14GSA 2V6OA 4TR4A 2X99A 2JACA 1ERTA 2DKHA 5L71A 1PSQA 3FYGA 1ZOFA 1OC9B 2P5QA 4MH2A 1M0UA 3IAM2 1GSSA 5H5SA 3NZNA 4WF4A 2DSAA 3EURA 4OFTA 2L6CA 2DJ3A 2AYTA 4XIHA 3IC4A 2GQMA 3MYDA 4F0CA 2WS2A 2H1DA 5EY6A 2GT6A 4DSQA 4TN8A 3ERWA 1YKAA 3C1SA 1ZYEA 1UA5A 1AW9A 4TW5A 1O81A 1XW9A 1BG5A 1K3YA 2V1MA 5DJLA 1M2BA 2YZUA 2I81A 3LSZA 3LYPA 4PX1A 4ECCA 4EUYA 1GP1A 3V1WA 4PUAA 1PX6A 1YZXA 2HRFA 5ECPB 5JCUA 1UC7A 3WT1A 4FQUA 2R6KA 2P0GA 2HRAA 3QAWA 1GSYA 2OE1A 2VM2A 4TOPA 4BVYA 3CBUA 3FKFA 4DSSB 4PQIA 4N0ZA 2C8UA 1PN0A 5J5NA 4PTSA 4IGJA 1A2LA 1M9BA 4RQRA 3VPTA 2MBTA 5DBQA 2EIOA 1W89A 2F3MA 4OFNA 4FO5A 2EFEA 2WFCA 2OE3A 2FGXA 1O8XA 2WULA 1Z3EA 5LD0A 5J47A 3WGXA 1FOVA 2VCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O89 A;  2JAD A;  1A24 A;  2YCD A;  1R5P A;  1XPV A;  1K0M A;  4ZIL A;  5FT3 A;  4L5O A;  3QFB C;  5DAL A;  3ZLP A;  1IYI A;  3MAK A;  2H1A A;  2LTK A;  1HNC A;  1ERU A;  1T7P B;  4I97 A;  5ECK B;  1NSW A;  1YF0 A;  2LNS A;  4RUV A;  2YV7 A;  4ECJ A;  3LWA A;  2GQK A;  2R3X A;  5DAK A;  3ZRD A;  5D73 A;  2DMM A;  2E7P A;  1M7T A;  2YWI A;  1AC1 A;  3MDK A;  2WB9 A;  4ZIJ A;  1VF4 A;  4NV2 A;  1OVN A;  2B6M A;  5EPF A;  3QR6 A;  3GL5 A;  2VLT A;  2G0F A;  1EWX A;  1M2D A;  5ELA A;  1S3A A;  1ZL9 A;  5G5F A;  4MJE A;  1TRV A;  5ECO B;  5ECI B;  3APQ A;  3P90 A;  2X8C A;  4RQX A;  4N30 A;  4BVY B;  3UVT A;  5CRG A;  4ML6 A;  5F07 A;  1HQO A;  3ZVJ A;  4GLT A;  2H1G A;  2L5O A;  4TR1 A;  4MZB A;  1QUW A;  3GKM A;  3FR3 A;  4ECB A;  1U88 A;  4WR5 A;  2I1U A;  4HZ4 A;  1B48 A;  2DJ0 A;  4LL1 B;  2TRC P;  2E2M A;  4GST A;  4LMV A;  2Z9S A;  1VF2 A;  4K7I A;  1WRY A;  3D5J A;  1GH2 A;  3JCM L;  3UIW A;  2KP1 A;  1VRS D;  2FA4 A;  4BVX A;  5G30 A;  3FZ5 A;  10GS A;  3DEX A;  2HNL A;  1T1V A;  5DAL B;  1FO5 A;  1ON4 A;  3H93 A;  3IBH A;  2MMZ A;  1XWK A;  1USB A;  3CYN A;  4E8H A;  2RLI A;  3ZMK A;  1SK0 A;  3KEB A;  5KN1 A;  1AUC A;  3PPU A;  2CA8 A;  4KE3 A;  3HYP A;  4ID0 A;  3VK9 A;  4IEL A;  4OFM A;  1M2A A;  1JZR A;  4ZL7 A;  2HI7 A;  3P7X A;  2HSM A;  1JLV A;  2HYX A;  3VUR A;  2ALB A;  4HJM A;  2I4A A;  3F8U A;  2L6D A;  4FYB A;  3VI5 A;  3RBT A;  3GTU A;  2VD1 A;  3F4S A;  4NV5 A;  4JR4 A;  2H19 A;  3AY8 A;  4GSS A;  4KSO A;  3Q6O A;  1HD2 A;  3N5O A;  1VF1 A;  4RI6 A;  1EOG A;  4POM A;  2YV9 A;  4EXJ A;  1AQV A;  4K1F A;  1XVQ A;  2JSY A;  1FB6 A;  1GTA A;  2VL2 C;  2NDO A;  2JZT A;  5GZZ B;  2QKE A;  2ZCT A;  4KW6 A;  4XS4 A;  3K8N A;  1HNB A;  4MA9 A;  4IJI A;  2J23 A;  3TCO A;  2BTO T;  2O7K A;  5KN0 A;  5IPH A;  1BAY A;  2H6X A;  4KAE A;  1T4Y A;  1SL1 B;  5GAP D;  4BVX B;  1ERV A;  3A2W A;  4DSR A;  3UVH A;  4HQS A;  2AUV A;  1ZGN A;  1J0F A;  1GUK A;  3GNJ A;  2IME A;  2LEG A;  3GRX A;  6GST A;  4FIW A;  5IMZ A;  1X9W B;  1Z6M A;  1FVK A;  1B9X C;  3TJJ A;  1ZZY A;  2PWJ A;  5F06 A;  1DUG A;  4MDC A;  1XXU A;  5IOW A;  4N11 A;  1G7E A;  2F9S A;  3D4M A;  1B8X A;  3EE2 A;  4HJ2 A;  2H74 A;  1YQ1 A;  2VO4 A;  2HSM B;  1XOA A;  2R2J A;  2WGR A;  3HD5 A;  4KND A;  3F3R A;  1GLP A;  2L4Q A;  2P5R A;  3GL3 A;  4KDU A;  4IJ3 A;  5IQY A;  1G6W A;  3GTU B;  6GSX A;  1TRU A;  5ECL B;  5DCH A;  2XC2 A;  3TOT A;  4Z7X A;  3Q74 A;  2BMX A;  1Q4J A;  4YQM A;  3HXS A;  1TOF A;  3C8E A;  2R37 A;  2VM1 A;  2VL9 A;  1GTB A;  4IP6 A;  4XS4 B;  3H8Q A;  4ACS A;  4QL7 A;  3TJG A;  3CMI A;  5HR0 A;  3ZZX A;  22GS A;  5A4W A;  3W8J A;  1V98 A;  2H0I A;  3D21 A;  3RHC A;  2CVK A;  5CAX A;  3ZIJ A;  17GS A;  3QDN A;  4JR6 A;  1I9D A;  1OKD A;  2NVL A;  4FYU A;  3HA9 A;  1RQM A;  1XW5 A;  5E59 A;  3NIV A;  4L8E A;  4HU9 A;  4PQH A;  2ON7 A;  3GKN A;  1A2M A;  4YQV A;  2PVO C;  4PUR A;  9GSS A;  1XBS A;  1F3A A;  4KH7 A;  1GSF A;  4G9H A;  2YN1 A;  1JZD A;  3W8S A;  2CAQ A;  1QGV A;  3KIJ A;  5E4W A;  1X5C A;  4HEA 2;  2P31 A;  2QC7 A;  5COH A;  4IKH A;  2ES7 A;  1OE8 A;  1G0T A;  4NAX A;  4V2N A;  4KCA A;  2YJH A;  4ML1 A;  1HYU A;  1U3A A;  4LL4 B;  2CZ2 A;  3GFK A;  1Z9H A;  1EZK A;  1K3O A;  3FHK A;  3P2A A;  4DSS A;  2FD3 A;  4I2T A;  2CV4 A;  3KJY A;  1THX A;  1PA3 A;  1SKR B;  4ECI A;  1XCC A;  4AJ8 A;  4AJ7 A;  1JLW A;  6GSS A;  2C80 A;  3CRU A;  4JU5 A;  5A5K A;  1Z7P A;  4NPB A;  1V2A A;  3HZ8 A;  2V6K A;  2HRK A;  5CRE A;  2LS5 A;  3F6F A;  5AIS A;  3VI7 A;  3APO A;  5DVB A;  3MNG A;  1JFU A;  2H1B A;  2VCQ A;  3DD3 A;  5F0G A;  2C0D A;  2E2G A;  1THO A;  3KTL A;  3HY2 A;  1XWB A;  4FH8 A;  5EL8 A;  1EP8 A;  3IOS A;  3IPZ A;  3KMO A;  4OO4 A;  1H4O A;  2RII A;  1GUL A;  4OCE A;  5HFI A;  2PGT A;  1TK0 B;  3VLN A;  2LRC A;  2WRT A;  1BQ7 A;  2HRN A;  5IM9 A;  4OCF A;  2KOK A;  1KBN A;  3FZA A;  3GST A;  2EIR A;  1PQN A;  4KB3 A;  1ABA A;  2M80 A;  5GSS A;  3IR4 A;  5DJM A;  2A4V A;  2H75 A;  1XVW A;  2DJ1 A;  2V2G A;  3C73 A;  3ZIV A;  5B7C A;  1B4P A;  4I2U A;  2LRN A;  2WDU A;  1ZYQ B;  1SJZ A;  3M1G A;  3UBL A;  1R5A A;  3I9V 2;  3RAZ A;  3OR5 A;  2MMN A;  6GSW A;  5B6N A;  4PQ1 A;  2H30 A;  3U6V A;  5IO2 A;  3FRC A;  5CO3 A;  3GMF A;  2LST A;  2OAD A;  5CRW A;  3L9S A;  2F51 A;  4GQC A;  3EVI A;  2VCV A;  1K0C A;  2NBS A;  2PVQ A;  4IS0 A;  4IHU A;  3IK9 A;  4IBP A;  5J3R A;  3VWU A;  4G2E A;  2L4C A;  2RM6 A;  3QMX A;  5B6M A;  3QAG A;  2HRK B;  3IXR A;  1WE0 A;  2FA8 A;  4HI7 A;  1PGT A;  2YP6 A;  5B8A A;  3LJR A;  3F0I A;  1SJI A;  1S3D A;  1A8Y A;  2LV3 A;  3LYK A;  4BWS A;  3DIE A;  4XCS A;  2FUG 2;  1LJR A;  3KMN A;  2XBQ A;  1SYR A;  1A0R P;  3UJ1 A;  2H72 A;  1XW6 A;  4ILF A;  1FAA A;  1PX7 A;  4AJ6 A;  3O76 A;  5ELG A;  2RM5 A;  1WJK A;  18GS A;  3UEM A;  5BMU A;  4GCI A;  1PN9 A;  3ZML A;  2C0E A;  4MF5 A;  2FY6 A;  1G7O A;  1B4Q A;  4YQU A;  2I9H A;  3CSJ A;  4IW9 A;  3IRA A;  2O87 A;  3CTF A;  5ECM B;  2B5X A;  4KF9 A;  2HXK A;  3Q19 A;  1QQ2 A;  5HR3 A;  1TI3 A;  4JZQ A;  4HUA A;  2GTU A;  5D9T A;  2YOI A;  3EWL A;  3DML A;  3GX8 A;  1V40 A;  2N5A A;  2HZE A;  1V58 A;  3QPM A;  1ZMA A;  2LQQ A;  2ZUP A;  4WKW A;  4QL9 A;  3KH7 A;  1TK8 B;  3HJM A;  3MWH A;  2F8F A;  3KXO A;  2PU9 C;  2PER A;  3ME8 A;  3GYK A;  3DKS A;  1OC8 A;  2KHP A;  1QMV A;  3J7Y k;  2GSR A;  2GVP A;  4MAB A;  1A0F A;  4NWY A;  2GZZ A;  2REM A;  1YKC A;  2EIQ A;  2EC4 A;  2VUP A;  3KH9 A;  4OO5 A;  4O92 A;  5IMA A;  5ECS A;  4ZL8 A;  1F2E A;  4BWQ A;  1TK5 B;  4HZ2 A;  4CW9 A;  4K2D A;  1M99 A;  1DE1 A;  4NXI A;  3FEU A;  4GWR A;  5JWR B;  4ZBB A;  3CTG A;  3EC3 A;  3P8W A;  1XIY A;  1SEN A;  3WD6 A;  3GV1 A;  1SU9 A;  2A2R A;  2X8G A;  2JZS A;  2B7J A;  2IFQ A;  3HHV A;  1SK2 A;  3DYR A;  2MZC A;  5G1L A;  1PMT A;  2K9F A;  3TKS C;  1YEP A;  2J9H A;  3E9J B;  1GNE A;  2GST A;  4Q5N A;  3DXB A;  4X0X A;  3FR9 A;  3N9J A;  2DML A;  2HSH A;  1YF1 A;  1DSB A;  3GUS A;  3D4T A;  2CX4 A;  4ZXG A;  2PPT A;  2M72 A;  3GKK A;  5FWG A;  3TJB A;  1V57 A;  4MMM A;  3KGK A;  3R3E A;  1SK1 A;  3ZIT A;  1DE2 A;  1TDI A;  1F37 A;  2GLR A;  3DVW A;  4L0U A;  2HZE B;  5A4U A;  3C7M A;  3M9K A;  2NTO A;  4L0W A;  4G0I A;  4G0K A;  5DQS A;  1A8L A;  3HJO A;  4G10 A;  4FYC A;  3HJP A;  2QSI A;  1M9A A;  13GS A;  6GSV A;  5AGY A;  3F6D A;  3H4K A;  4JBB A;  5D93 A;  1UN2 A;  4EE0 A;  1QK8 A;  4GXZ A;  3KP8 A;  1GSU A;  3GKX A;  5IIZ A;  4E8E A;  1N2A A;  2C3T A;  4KGI A;  4LLR A;  4TXV A;  5D9W A;  5GAN D;  2JL4 A;  1PKW A;  2OBK A;  4PNF A;  5J41 A;  4K7O A;  4F0B A;  4P3Y B;  1XZO A;  3EYT A;  2JSZ A;  3ZTL A;  2GSS A;  3RPN A;  4TR3 A;  4MF7 A;  1TP9 A;  4HS1 A;  2IFQ B;  1IYH A;  3FK8 A;  3DGQ A;  3FY7 A;  2OAC A;  2XBI A;  3KD0 A;  3TJF A;  4MJC A;  2I3Y A;  4OMV A;  2K6V A;  2IN3 A;  4DVC A;  4WET A;  1MDI A;  5GST A;  1XWA A;  2XPE A;  3TRP A;  3TKS A;  4POB A;  4NMU A;  4MZC A;  4WXT A;  4XS1 A;  5AIV A;  2LRT A;  5ENU A;  2DIZ A;  4BPY A;  2B3S A;  2CAI A;  1CQG A;  12GS A;  4KCE A;  3TKQ A;  5AIX A;  4IQ1 A;  1S3C A;  2DIY A;  5DCG A;  3IA1 A;  4EF0 A;  2CX3 A;  5G2Z A;  4PGT A;  1Q98 A;  3L4N A;  4TRX A;  3A2V A;  2GDR A;  3HVV A;  8GSS A;  1RW1 A;  2QGV A;  1FHE A;  3G7J A;  5B8B A;  2WCI A;  2VL2 A;  4V1A g;  2IPA A;  3PGT A;  2F8A A;  3PR8 A;  4X1U A;  2TRX A;  1NHO A;  5G1K A;  19GS A;  4TR0 A;  2FNO A;  2B1K A;  1O73 A;  1YDK A;  3TOU A;  2N5B A;  2K18 A;  4OD7 A;  1ZCP A;  2L59 A;  2V41 A;  4MH3 A;  3QD9 A;  2LUS A;  1GTU A;  1O8W A;  5KEJ A;  3LFL A;  1T3B A;  2HFD A;  5ID2 A;  2X64 A;  11GS A;  4D73 A;  1AQX A;  4Q5F A;  2H66 A;  2YAN A;  3GX0 A;  4OWY A;  5ECH B;  1EEM A;  1SD9 A;  2KLX A;  2GZP A;  5CRH A;  2VL3 A;  1SYX A;  1JHB A;  3UOM A;  4N10 A;  4F82 A;  1MD3 A;  2IWT A;  4PXO A;  3R2Q A;  4IP1 A;  1X0R A;  2KP2 A;  2M46 A;  5IO0 A;  1MDK A;  4GF0 A;  3H1N A;  3ZRE A;  2PUK C;  2RUF A;  6GSU A;  3IDV A;  3VFI A;  1TU7 A;  3ED3 A;  4EKZ A;  3TGZ A;  1SL0 B;  4J57 E;  3LXT A;  5JCW A;  2DJJ A;  1SKW B;  4ISD A;  1GNW A;  1TRW A;  2AAW A;  3CSH A;  5LCZ A;  3D6I A;  2O85 A;  3G9B A;  5HQP A;  4ZL9 A;  4WBR D;  2KUC A;  3EMX A;  3TUE A;  1E2Y A;  4K7N A;  5HFG A;  1QXH A;  3BD2 A;  2IIY A;  4H86 A;  4YAP A;  2HSN B;  3L78 A;  1GSE A;  3GA4 A;  3LQ7 A;  3FW2 A;  1EEJ A;  2AV4 A;  5J4U A;  4ZB8 A;  1MD4 A;  4EDZ A;  4BL7 A;  1H75 A;  4TXO B;  5IMD A;  5CRD A;  3U5R E;  3CXG A;  3IV4 A;  3EMP A;  3KM6 A;  5D96 A;  5J9B A;  4KX4 A;  5INY A;  2FHE A;  2G2Q A;  2VIM A;  7GSS A;  3F4R A;  1R7H A;  2IMF A;  3BOA A;  1WIK A;  1O85 A;  2LQO A;  3LOR A;  3TKS E;  2FWG A;  5ECQ B;  1O7U A;  5IMC A;  1TTZ A;  1EV4 A;  5ID2 B;  3UAR A;  4Q5Q A;  1T8E B;  4DEJ A;  3BCI A;  3M3M A;  4D73 B;  3FZ4 A;  5IMF A;  1BJX A;  1SJ6 A;  1X9S B;  4MLY A;  4ZBA A;  3F63 A;  2GT5 A;  4RI7 A;  4JRR A;  2VD0 A;  4IN0 A;  2YPM A;  2B5Y A;  1WP0 A;  2LJA A;  1LBK A;  3US3 A;  1OYJ A;  1ST9 A;  1DBY A;  4CHS A;  1LU4 A;  2LJR A;  1F9M A;  3LEF A;  2H6Y A;  1WPI A;  4K6X A;  2H71 A;  2MMA A;  3NOF A;  5JWO B;  2YNX A;  1AXD A;  1KNG A;  3J7Y b;  4I6X A;  4ULX A;  4Q5R A;  2K8V A;  4WEY A;  3ME7 A;  5A4V A;  1TRS A;  2D2Z A;  3FZ9 A;  3C71 A;  3WT2 A;  4MP4 A;  5H5R A;  2VOC A;  5CYY A;  3TKR A;  3UBK A;  3W6G A;  1OC3 A;  4XRD A;  4EL1 A;  1XWC A;  4K0N A;  4MCU A;  2YWO A;  5ABR A;  1AAZ A;  4BL7 B;  5D8I A;  5JCG A;  1MEK A;  2WJU A;  4XHM A;  2FWE A;  1ILO A;  5HR2 A;  5F05 A;  3GIX A;  4J56 E;  3D22 A;  2C4J A;  3M8N A;  3UMA A;  1BX9 A;  3S9F A;  3ERG A;  1TU8 A;  4LA1 A;  4KDY A;  5ECN B;  3L9U A;  3I6A A;  2FWF A;  2OE0 A;  4MPF A;  1OAZ A;  4LMW A;  1GLQ A;  1PD2 1;  2C0F A;  3E3E A;  1CQH A;  3EU3 A;  1YJ6 A;  4V2M A;  4F2I A;  4GSN A;  3IC8 A;  2MMO A;  3PH9 A;  3TDG A;  3QOU A;  1BED A;  1F3B A;  1TXX A;  5G5E A;  4AF2 A;  3IK7 A;  3O6T A;  1EGR A;  3WYW A;  2HT9 A;  6GSY A;  1KTE A;  3HDC A;  1R26 A;  2AHE A;  4TKY A;  1EGO A;  1AQW A;  3M9J A;  4MK3 A;  3EU4 A;  1GTI A;  3IHQ A;  1KEB A;  4MPG A;  2H01 A;  5DQY A;  1R4W A;  3I43 A;  5AN1 A;  5HR1 A;  1OE7 A;  3IAS 2;  4YH2 A;  3A3T A;  2C3Q A;  3GH9 A;  4I5Q A;  2TIR A;  2IMD A;  2DJK A;  3PIN A;  2GSQ A;  4QQ7 A;  2XPD A;  2LKU A;  4TVE A;  2A2S A;  2JZR A;  3CRT A;  3VWW A;  1TI1 A;  1EV9 A;  3L0H A;  5DDL A;  1ERW A;  2X8H A;  1PL2 A;  3UL3 A;  4N0V A;  1E6B A;  4MZW A;  1YEX A;  4WF5 A;  2L57 A;  2E0Q A;  4JE1 A;  2AB6 A;  4EC0 A;  3DVX A;  2CZ3 A;  2HQT A;  1GUM A;  1EP7 A;  3QCP A;  1XOB A;  1Z7R A;  2OBI A;  3EIN A;  1GL8 A;  4EDY A;  2B7K A;  1GSD A;  4HU7 A;  2B5E A;  1EOH A;  1YY7 A;  2R4V A;  3ZFL A;  1JZO A;  1T00 A;  4AGS A;  3KTB A;  4ZB9 A;  5G31 A;  1A23 A;  1U3I A;  3RDW A;  4WR4 A;  1G6Y A;  4O5R A;  4F9Z A;  5CNW A;  3VPQ A;  4V1A p;  4G19 A;  20GS A;  1QFN A;  1OKT A;  2PN8 A;  4XTS A;  1X5E A;  1PRX A;  3G7Y A;  5D9X A;  1WOU A;  4V2L A;  5IMV A;  1FB0 A;  3KZQ A;  3DRN A;  3GN3 A;  3HZ4 A;  4USS A;  3KP9 A;  4IVF A;  2ON5 A;  1HNA A;  4ZB6 A;  5DAK B;  1TJD A;  4GRF A;  1AIU A;  4NHZ A;  3O3T A;  1V9W A;  2GZY A;  2RUE A;  2YWN A;  4WBJ A;  5HFK A;  3GSS A;  3SBC A;  5D9V A;  3SWL A;  2WZ9 A;  2YWM A;  2OJL A;  1ACV A;  2C3N A;  1RK4 A;  1J08 A;  4BA7 A;  3ERF A;  1O6J A;  4I8B A;  1PL1 A;  2IMK A;  2LNT A;  3RHB A;  5LNK e;  4IQA A;  2BJX A;  16GS A;  2IL3 A;  2CVB A;  4KUN A;  4TR1 B;  4X43 A;  1Z6N A;  3E0U A;  4MF6 A;  2B1L A;  4YAV A;  4ZBD A;  2H76 A;  3HVX A;  2JU5 A;  2O8V B;  4L5L A;  1K3L A;  1T4Z A;  3H79 A;  1VF3 A;  4NHW A;  5JWQ B;  2MYG A;  1TW9 A;  1NM3 A;  3APS A;  4MJA A;  3GHA A;  2HSY A;  2ZNM A;  1Y25 A;  1NW2 A;  4HQZ A;  3ZL5 A;  2IMI A;  2VCW A;  2R5G A;  3HKR A;  1TKD B;  2H8L A;  5C04 A;  3LXZ A;  1XFL A;  1A2J A;  3ZVJ D;  2C1Y A;  3BCK A;  3LG6 A;  2NPB A;  4F03 A;  2GS3 A;  1U87 A;  4K0G A;  1SD8 A;  1J9B A;  5J9C A;  3ISO A;  5F8B A;  4O32 A;  2C0G A;  4POL A;  4PUF C;  1B9Y C;  3TJK A;  3DWV A;  5CP1 A;  2OKA A;  4K9Z A;  3LGC A;  2FWH A;  1GWC A;  2YJ7 A;  1BYE A;  1N8J A;  2XHF A;  3WGE A;  4GTU A;  2MBS A;  3BJ5 A;  2CVD A;  5IOX A;  1GUH A;  2PBJ A;  3TRQ A;  1X5D A;  2DC5 A;  5IPG A;  3F9U A;  1I5G A;  4HDE A;  1FVJ A;  2UZ8 A;  2DBC A;  2VCT A;  1PKZ A;  5H5Q A;  3C1R A;  4MJB A;  1C72 A;  1W4V A;  2V32 A;  3VWX A;  3Q18 A;  2GGT A;  1K0D A;  2PMT A;  2LJK A;  5KN2 A;  2CQ9 A;  2L5L A;  2DJ2 A;  4XRA A;  5KN3 A;  2AJQ B;  4XS6 A;  4TXO A;  1UVZ A;  3GUR A;  3MSZ A;  2GQL A;  3IE3 A;  5EVO A;  1SKS B;  3KCM A;  3TB2 A;  4EVM A;  3TKP A;  3QAV A;  2N5F A;  4O7H A;  2CT6 A;  1JZW A;  2IJY A;  5ECR B;  5C00 A;  3CSI A;  3L9V A;  2OA7 A;  2HZF A;  3A5W A;  3A2X A;  1OC9 A;  1K0O A;  1FG4 A;  3M0F A;  1F6M C;  2H0G A;  4POK A;  1K0A A;  4CDO A;  3GH6 A;  4EO3 A;  3HVS A;  3UAP A;  4KA0 A;  4KSM A;  1GRX A;  3WGD A;  3QFA C;  2H73 A;  2HE3 A;  3I69 A;  1MTC A;  2VLV A;  2FCH A;  2K8S A;  3F4T A;  1U6T A;  4K8M A;  2YZH A;  3RPP A;  1FW1 A;  2H0H A;  5FHI A;  2HLS A;  2DLX A;  3ZYW A;  1NHY A;  1WWJ A;  1K0N A;  1SL2 B;  2FLS A;  4HOJ A;  4KDX A;  3F3Q A;  3TRX A;  1ML6 A;  2VCZ A;  1WMJ A;  4J2F A;  1GSQ A;  3VWV A;  2VAF A;  1MDJ A;  1URM A;  2H70 A;  3ZFB A;  3G7I A;  3FR6 A;  4GQF A;  1VGL A;  3HCZ A;  2VLU A;  3BBY A;  2H6Z A;  1Z5Y E;  4PNG A;  1K0B A;  4G0L A;  4JED A;  1XWG A;  1Y6E A;  1X9M B;  3D0Z A;  14GS A;  2V6O A;  4TR4 A;  2X99 A;  2JAC A;  1ERT A;  5L71 A;  1PSQ A;  3FYG A;  1ZOF A;  1OC9 B;  2P5Q A;  4MH2 A;  1M0U A;  3IAM 2;  1GSS A;  5H5S A;  3NZN A;  4WF4 A;  2DSA A;  3EUR A;  4OFT A;  2L6C A;  2DJ3 A;  2AYT A;  4XIH A;  3IC4 A;  2GQM A;  4F0C A;  2WS2 A;  2H1D A;  5EY6 A;  2GT6 A;  4DSQ A;  4TN8 A;  3ERW A;  1YKA A;  3C1S A;  1ZYE A;  1UA5 A;  1AW9 A;  4TW5 A;  1O81 A;  1XW9 A;  1BG5 A;  1K3Y A;  2V1M A;  5DJL A;  1M2B A;  2YZU A;  2I81 A;  3LSZ A;  3LYP A;  4PX1 A;  4ECC A;  4EUY A;  1GP1 A;  3V1W A;  4PUA A;  1PX6 A;  1YZX A;  2HRF A;  5ECP B;  5JCU A;  1UC7 A;  3WT1 A;  4FQU A;  2R6K A;  2P0G A;  2HRA A;  3QAW A;  1GSY A;  2OE1 A;  2VM2 A;  4TOP A;  4BVY A;  3CBU A;  3FKF A;  4DSS B;  4PQI A;  4N0Z A;  2C8U A;  5J5N A;  4PTS A;  4IGJ A;  1A2L A;  1M9B A;  4RQR A;  3VPT A;  2MBT A;  5DBQ A;  2EIO A;  1W89 A;  2F3M A;  4OFN A;  4FO5 A;  2WFC A;  2OE3 A;  2FGX A;  1O8X A;  2WUL A;  1Z3E A;  5LD0 A;  3WGX A;  1FOV A;  2VCX A; 
#chains in the Genus database with same CATH topology
 2O89 A;  2JAD A;  1A24 A;  2YCD A;  3LW9 A;  1SVM A;  1R5P A;  1XPV A;  1K0M A;  4ZIL A;  5FT3 A;  4L5O A;  3QFB C;  5DAL A;  3ZLP A;  1IYI A;  3MAK A;  2H1A A;  2LTK A;  1HNC A;  1ERU A;  1T7P B;  4I97 A;  5ECK B;  1NSW A;  1YF0 A;  2LNS A;  4RUV A;  2YV7 A;  4ECJ A;  3LWA A;  2GQK A;  2R3X A;  5DAK A;  3ZRD A;  5D73 A;  2DMM A;  2E7P A;  1M7T A;  2YWI A;  1AC1 A;  3MDK A;  2WB9 A;  4ZIJ A;  1VF4 A;  4NV2 A;  1OVN A;  2B6M A;  5J4V A;  5EPF A;  3QR6 A;  3GL5 A;  2VLT A;  2G0F A;  1EWX A;  1M2D A;  5ELA A;  1S3A A;  1ZL9 A;  5G5F A;  4MJE A;  1TRV A;  5ECO B;  5ECI B;  3APQ A;  3P90 A;  2X8C A;  4RQX A;  4N30 A;  4BVY B;  3UVT A;  5CRG A;  4ML6 A;  5F07 A;  1HQO A;  2A4H A;  3ZVJ A;  4GLT A;  2H1G A;  2L5O A;  4TR1 A;  4MZB A;  1QUW A;  3GKM A;  3FR3 A;  4ECB A;  1U88 A;  4WR5 A;  2I1U A;  4O5U A;  4HZ4 A;  1B48 A;  2DJ0 A;  4LL1 B;  2TRC P;  2E2M A;  4GST A;  4LMV A;  2Z9S A;  1VF2 A;  4K7I A;  1WRY A;  3D5J A;  1GH2 A;  3JCM L;  3UIW A;  2KP1 A;  1VRS D;  2FA4 A;  4BVX A;  5G30 A;  3FZ5 A;  10GS A;  3DEX A;  2HNL A;  1T1V A;  5DAL B;  1FO5 A;  1ON4 A;  3H93 A;  3IBH A;  2MMZ A;  1XWK A;  1USB A;  3CYN A;  4E8H A;  2RLI A;  3ZMK A;  1SK0 A;  4K5S A;  3KEB A;  5KN1 A;  1AUC A;  3PPU A;  2CA8 A;  4KE3 A;  3HYP A;  5A34 A;  4ID0 A;  3VK9 A;  4IEL A;  4OFM A;  1M2A A;  1JZR A;  4ZL7 A;  2HI7 A;  3P7X A;  2HSM A;  1JLV A;  2HYX A;  3VUR A;  2ALB A;  4HJM A;  2I4A A;  3F8U A;  2L6D A;  4FYB A;  3VI5 A;  3RBT A;  3GTU A;  2VD1 A;  3F4S A;  4NV5 A;  4JR4 A;  2H19 A;  3AY8 A;  4GSS A;  4KSO A;  3Q6O A;  1HD2 A;  3N5O A;  1VF1 A;  4RI6 A;  1EOG A;  4POM A;  2YV9 A;  4EXJ A;  1AQV A;  4K1F A;  1XVQ A;  2JSY A;  1FB6 A;  1GTA A;  2VL2 C;  1ZYP A;  2A2P A;  2NDO A;  2JZT A;  5GZZ B;  2QKE A;  2ZCT A;  4KW6 A;  4XS4 A;  3K8N A;  1HNB A;  4MA9 A;  4IJI A;  2J23 A;  3TCO A;  2BTO T;  5A1N A;  2O7K A;  5KN0 A;  5IPH A;  1BAY A;  2H6X A;  4KAE A;  1T4Y A;  1SL1 B;  5GAP D;  3RGB C;  4BVX B;  1ERV A;  3A2W A;  4DSR A;  3UVH A;  4HQS A;  2AUV A;  1ZGN A;  1J0F A;  1GUK A;  4AKH A;  3GNJ A;  2IME A;  2LEG A;  3GRX A;  6GST A;  4FIW A;  5IMZ A;  1X9W B;  1Z6M A;  1FVK A;  1B9X C;  3TJJ A;  1ZZY A;  2PWJ A;  5F06 A;  1DUG A;  4MDC A;  1XXU A;  5IOW A;  4N11 A;  1G7E A;  2F9S A;  3D4M A;  4AKX B;  1B8X A;  3EE2 A;  4HJ2 A;  2H74 A;  1YQ1 A;  2VO4 A;  2HSM B;  1XOA A;  2R2J A;  2WGR A;  3HD5 A;  4KND A;  3F3R A;  1GLP A;  2L4Q A;  2P5R A;  3GL3 A;  4KDU A;  4IJ3 A;  5IQY A;  1G6W A;  3GTU B;  6GSX A;  1TRU A;  5ECL B;  5DCH A;  2XC2 A;  3TOT A;  4Z7X A;  3Q74 A;  1M3J A;  2BMX A;  1Q4J A;  4YQM A;  3HXS A;  1TOF A;  1S4B P;  3C8E A;  2R37 A;  2VM1 A;  2VL9 A;  2QA1 A;  1GTB A;  4IP6 A;  4XS4 B;  3H8Q A;  4ACS A;  4QL7 A;  3TJG A;  4PI2 C;  3CMI A;  5HR0 A;  5A1N B;  3ZZX A;  22GS A;  5A4W A;  3W8J A;  1M3I A;  1V98 A;  2H0I A;  3D21 A;  3RHC A;  2CVK A;  5CAX A;  3ZIJ A;  17GS A;  3HVN A;  3QDN A;  4JR6 A;  1I9D A;  1OKD A;  4HSC X;  2NVL A;  4FYU A;  3HA9 A;  1RQM A;  1XW5 A;  5E59 A;  3NIV A;  4L8E A;  4HU9 A;  4PQH A;  2ON7 A;  3GKN A;  1A2M A;  4YQV A;  2PVO C;  4PUR A;  9GSS A;  1XBS A;  1F3A A;  4KH7 A;  1GSF A;  4G9H A;  2YN1 A;  1JZD A;  3W8S A;  2CAQ A;  1QGV A;  3KIJ A;  2WW2 A;  5E4W A;  1X5C A;  4HEA 2;  2P31 A;  2QC7 A;  5COH A;  4IKH A;  2ES7 A;  1OE8 A;  1G0T A;  4NAX A;  4AKI A;  4V2N A;  2R0C A;  4KCA A;  2YJH A;  4ML1 A;  1HYU A;  1U3A A;  4LL4 B;  2CZ2 A;  3GFK A;  1Z9H A;  1EZK A;  1K3O A;  3FHK A;  3P2A A;  3CHX C;  4DSS A;  2FD3 A;  4I2T A;  2CV4 A;  3KJY A;  1THX A;  1PA3 A;  1SKR B;  4ECI A;  1XCC A;  4AJ8 A;  4AJ7 A;  1JLW A;  6GSS A;  5A5H A;  2C80 A;  3CRU A;  4JU5 A;  5A5K A;  1Z7P A;  4NPB A;  4CY8 A;  1V2A A;  3HZ8 A;  2V6K A;  2HRK A;  5CRE A;  2LS5 A;  3F6F A;  5AIS A;  3VI7 A;  3APO A;  5DVB A;  3MNG A;  1JFU A;  2H1B A;  2VCQ A;  3DD3 A;  5F0G A;  2C0D A;  2EFH A;  2E2G A;  1THO A;  3KTL A;  3HY2 A;  1XWB A;  4FH8 A;  4PI0 C;  5EL8 A;  1EP8 A;  3IOS A;  3IPZ A;  3KMO A;  4OO4 A;  1H4O A;  2RII A;  1GUL A;  4OCE A;  5HFI A;  2PGT A;  1TK0 B;  3VLN A;  2LRC A;  2WRT A;  1BQ7 A;  2HRN A;  5IM9 A;  4OCF A;  2KOK A;  1KBN A;  3FZA A;  3TU3 B;  3GST A;  2EIR A;  1PQN A;  4KB3 A;  1ABA A;  2M80 A;  5GSS A;  3IR4 A;  5DJM A;  2A4V A;  2H75 A;  1XVW A;  2DJ1 A;  2V2G A;  3C73 A;  3ZIV A;  5B7C A;  1B4P A;  4I2U A;  2LRN A;  2WDU A;  1ZYQ B;  1SJZ A;  3M1G A;  3UBL A;  1R5A A;  3I9V 2;  3RAZ A;  3OR5 A;  2MMN A;  6GSW A;  1SVL A;  5B6N A;  4PQ1 A;  2H30 A;  3U6V A;  5IO2 A;  3FRC A;  5CO3 A;  3GMF A;  2LST A;  2OAD A;  5CRW A;  3L9S A;  2F51 A;  4GQC A;  3EVI A;  2VCV A;  1K0C A;  2NBS A;  2PVQ A;  4IS0 A;  4IHU A;  3IK9 A;  4IBP A;  5J3R A;  3VWU A;  4G2E A;  2L4C A;  2RM6 A;  5A5H B;  3QMX A;  5B6M A;  3QAG A;  2HRK B;  3IXR A;  1WE0 A;  2FA8 A;  4HI7 A;  1PGT A;  2YP6 A;  5B8A A;  3LJR A;  3F0I A;  2O36 A;  1SJI A;  1S3D A;  1A8Y A;  2LV3 A;  3LYK A;  4BWS A;  3DIE A;  4XCS A;  2FUG 2;  1LJR A;  3KMN A;  2XBQ A;  1SYR A;  1A0R P;  3UJ1 A;  2H72 A;  1XW6 A;  4ILF A;  1FAA A;  1PX7 A;  4AJ6 A;  4PHZ C;  3O76 A;  4ZB7 A;  5ELG A;  2RM5 A;  1WJK A;  18GS A;  3UEM A;  5BMU A;  4GCI A;  1PN9 A;  3ZML A;  2C0E A;  4MF5 A;  2FY6 A;  1G7O A;  1B4Q A;  4YQU A;  2I9H A;  3CSJ A;  4IW9 A;  3IRA A;  2O87 A;  3CTF A;  5ECM B;  2B5X A;  4KF9 A;  2HXK A;  2EFC A;  5KOX A;  3Q19 A;  1QQ2 A;  5HR3 A;  1TI3 A;  4JZQ A;  4HUA A;  2GTU A;  5D9T A;  2YOI A;  3EWL A;  3DML A;  3GX8 A;  1V40 A;  1PFO A;  2N5A A;  2HZE A;  1V58 A;  3QPM A;  1ZMA A;  2LQQ A;  2ZUP A;  4WKW A;  4QL9 A;  3KH7 A;  1TK8 B;  3HJM A;  3MWH A;  2F8F A;  4YKF A;  3KXO A;  2PU9 C;  2PER A;  3ME8 A;  3GYK A;  3DKS A;  1OC8 A;  2KHP A;  1QMV A;  3J7Y k;  2GSR A;  2GVP A;  4MAB A;  1A0F A;  4K5R A;  4NWY A;  2GZZ A;  2REM A;  1YKC A;  2EIQ A;  2EC4 A;  2VUP A;  3KH9 A;  4OO5 A;  4O92 A;  5J40 A;  5IMA A;  4ICY A;  5ECS A;  4ZL8 A;  1F2E A;  4BWQ A;  1TK5 B;  3MIX A;  4HZ2 A;  4CW9 A;  4K2D A;  1M99 A;  1DE1 A;  4NXI A;  3FEU A;  4GWR A;  4Z2R A;  5JWR B;  4ZBB A;  3CTG A;  1XG8 A;  3EC3 A;  3P8W A;  1XIY A;  1SEN A;  3WD6 A;  3GV1 A;  1SU9 A;  2A2R A;  2X8G A;  2JZS A;  2B7J A;  2IFQ A;  3HHV A;  1SK2 A;  5BMU B;  3DYR A;  2MZC A;  5G1L A;  1PMT A;  2K9F A;  3TKS C;  1YEP A;  2J9H A;  3E9J B;  1GNE A;  2GST A;  4Q5N A;  3DXB A;  4X0X A;  3FR9 A;  3N9J A;  2DML A;  2HSH A;  1YF1 A;  1DSB A;  3GUS A;  3D4T A;  2CX4 A;  4ZXG A;  2PPT A;  2M72 A;  3GKK A;  5FWG A;  3TJB A;  1V57 A;  4MMM A;  3KGK A;  3R3E A;  1SK1 A;  3ZIT A;  1DE2 A;  1TDI A;  1F37 A;  2GLR A;  3DVW A;  4L0U A;  2HZE B;  5A4U A;  3C7M A;  3M9K A;  2NTO A;  4L0W A;  4G0I A;  4G0K A;  5DQS A;  1A8L A;  3HJO A;  4G10 A;  4FYC A;  3HJP A;  2QSI A;  1M9A A;  13GS A;  6GSV A;  5AGY A;  3F6D A;  3H4K A;  1TXU A;  4JBB A;  5D93 A;  1UN2 A;  4EE0 A;  1QK8 A;  4GXZ A;  3KP8 A;  1GSU A;  3GKX A;  5IIZ A;  4E8E A;  1N2A A;  2C3T A;  4EIP A;  4KGI A;  4LLR A;  4TXV A;  5D9W A;  5GAN D;  2JL4 A;  1PKW A;  2OBK A;  4PNF A;  5J41 A;  4K7O A;  4F0B A;  4P3Y B;  1XZO A;  3EYT A;  2JSZ A;  3ZTL A;  2GSS A;  3RPN A;  4TR3 A;  4MF7 A;  1TP9 A;  4HS1 A;  2OT3 A;  2IFQ B;  1IYH A;  2WVY A;  3FK8 A;  3DGQ A;  3FY7 A;  2OAC A;  2XBI A;  3KD0 A;  3TJF A;  4MJC A;  2I3Y A;  4OMV A;  2K6V A;  2IN3 A;  4Z2U A;  4DVC A;  4K2X A;  4WET A;  1MDI A;  5GST A;  1XWA A;  2XPE A;  3TRP A;  3TKS A;  4POB A;  4NMU A;  4MZC A;  4WXT A;  4XS1 A;  5AIV A;  2LRT A;  5ENU A;  2DIZ A;  4BPY A;  2B3S A;  2CAI A;  1CQG A;  12GS A;  4KCE A;  3TKQ A;  5AIX A;  4IQ1 A;  1S3C A;  2DIY A;  5DCG A;  3IA1 A;  1YEW C;  4EF0 A;  2CX3 A;  5G2Z A;  4PGT A;  1Q98 A;  3L4N A;  4TRX A;  3A2V A;  2GDR A;  3HVV A;  4G01 A;  8GSS A;  1RW1 A;  2QGV A;  1FHE A;  3G7J A;  2UV8 G;  5B8B A;  2WCI A;  2VL2 A;  4V1A g;  2IPA A;  3PGT A;  2F8A A;  3PR8 A;  4X1U A;  2TRX A;  1NHO A;  5G1K A;  1SVO A;  19GS A;  4TR0 A;  2O3E A;  2FNO A;  2B1K A;  1O73 A;  1YDK A;  3TOU A;  2N5B A;  2K18 A;  4OD7 A;  1ZCP A;  2L59 A;  2V41 A;  4MH3 A;  3QD9 A;  2LUS A;  1GTU A;  1O8W A;  5KEJ A;  3LFL A;  1T3B A;  2HFD A;  4AKG A;  5ID2 A;  2X64 A;  11GS A;  4D73 A;  1AQX A;  4Q5F A;  2H66 A;  2YAN A;  3GX0 A;  4OWY A;  5ECH B;  1EEM A;  1SD9 A;  2KLX A;  2GZP A;  5CRH A;  2VL3 A;  1SYX A;  1JHB A;  3UOM A;  4N10 A;  4F82 A;  1MD3 A;  2IWT A;  4PXO A;  3R2Q A;  4IP1 A;  1X0R A;  2KP2 A;  2M46 A;  5IO0 A;  1MDK A;  4GF0 A;  3H1N A;  3ZRE A;  2PUK C;  1FOH A;  2RUF A;  6GSU A;  3IDV A;  3VFI A;  1TU7 A;  3ED3 A;  4EKZ A;  3TGZ A;  1SL0 B;  4J57 E;  3LXT A;  5JCW A;  2DJJ A;  1SKW B;  4ISD A;  1GNW A;  1TRW A;  2QA2 A;  2AAW A;  3CSH A;  5LCZ A;  3D6I A;  2O85 A;  3G9B A;  5HQP A;  4ZL9 A;  4WBR D;  2KUC A;  3EMX A;  3TUE A;  1E2Y A;  4K7N A;  5HFG A;  1QXH A;  3BD2 A;  2IIY A;  4H86 A;  2H1L A;  4YAP A;  2HSN B;  3L78 A;  1GSE A;  3GA4 A;  3LQ7 A;  3FW2 A;  1EEJ A;  2AV4 A;  5J4U A;  4ZB8 A;  1MD4 A;  4EDZ A;  4BL7 A;  1H75 A;  4TXO B;  5IMD A;  5CRD A;  3U5R E;  4QMK A;  3CXG A;  3IV4 A;  3CWG A;  3EMP A;  3KM6 A;  5D96 A;  5J9B A;  4KX4 A;  4YKG A;  5INY A;  2FHE A;  2G2Q A;  2VIM A;  7GSS A;  1YVL A;  3F4R A;  1R7H A;  2IMF A;  3BOA A;  1WIK A;  2R0P A;  1O85 A;  2LQO A;  3LOR A;  3TKS E;  2FWG A;  5ECQ B;  1O7U A;  5IMC A;  1TTZ A;  1EV4 A;  2R0G A;  5ID2 B;  3UAR A;  4Q5Q A;  1T8E B;  4DEJ A;  3BCI A;  3M3M A;  4A5P A;  4D73 B;  3FZ4 A;  5IMF A;  1BJX A;  1SJ6 A;  1X9S B;  4MLY A;  4ZBA A;  3F63 A;  2GT5 A;  4RI7 A;  4JRR A;  2VD0 A;  4IN0 A;  2YPM A;  2B5Y A;  1WP0 A;  3RFR C;  2LJA A;  1LBK A;  3US3 A;  1OYJ A;  1ST9 A;  1DBY A;  4CHS A;  1LU4 A;  4E68 A;  2LJR A;  1F9M A;  3LEF A;  2H6Y A;  1WPI A;  4K6X A;  2H71 A;  2MMA A;  4GDF A;  3NOF A;  5JWO B;  2YNX A;  1AXD A;  1KNG A;  3J7Y b;  4I6X A;  4ULX A;  4Q5R A;  2K8V A;  4WEY A;  3ME7 A;  5A4V A;  1TRS A;  2D2Z A;  2VKZ G;  3FZ9 A;  3C71 A;  3WT2 A;  4MP4 A;  5H5R A;  2VOC A;  5CYY A;  3TKR A;  2WVZ A;  3UBK A;  3W6G A;  1OC3 A;  2X4A A;  4XRD A;  4EL1 A;  1XWC A;  4K0N A;  4MCU A;  2YWO A;  5ABR A;  1AAZ A;  4BL7 B;  5D8I A;  5JCG A;  1MEK A;  2WJU A;  4XHM A;  2FWE A;  1ILO A;  5HR2 A;  5F05 A;  3GIX A;  4J56 E;  3D22 A;  1Y1U A;  2C4J A;  3M8N A;  3UMA A;  1BX9 A;  3S9F A;  3ERG A;  1TU8 A;  4LA1 A;  4KDY A;  5ECN B;  3L9U A;  3I6A A;  2FWF A;  2OE0 A;  2X49 A;  4MPF A;  1OAZ A;  4LMW A;  1GLQ A;  1PD2 1;  2C0F A;  3E3E A;  4AI6 A;  1CQH A;  3EU3 A;  1YJ6 A;  4V2M A;  4F2I A;  4GSN A;  3IC8 A;  2MMO A;  3PH9 A;  3TDG A;  1BED A;  3QOU A;  1F3B A;  1TXX A;  5G5E A;  4AF2 A;  3IK7 A;  3O6T A;  1EGR A;  3WYW A;  2HT9 A;  6GSY A;  1KTE A;  3HDC A;  1R26 A;  2AHE A;  4TKY A;  1EGO A;  1AQW A;  1I1I P;  3M9J A;  4MK3 A;  3EU4 A;  1GTI A;  3IHQ A;  1KEB A;  4MPG A;  2H01 A;  5DQY A;  1R4W A;  3I43 A;  5AN1 A;  5HR1 A;  1OE7 A;  4X4J A;  3IAS 2;  4YH2 A;  3A3T A;  2C3Q A;  3GH9 A;  4I5Q A;  2TIR A;  2IMD A;  2DJK A;  3PIN A;  2GSQ A;  4QQ7 A;  2XPD A;  2LKU A;  4TVE A;  2A2S A;  2JZR A;  3CRT A;  3VWW A;  1TI1 A;  1EV9 A;  3L0H A;  5DDL A;  1ERW A;  2X8H A;  1PL2 A;  3UL3 A;  4N0V A;  1E6B A;  4MZW A;  1YEX A;  4WF5 A;  2L57 A;  2E0Q A;  4JE1 A;  2AB6 A;  4EC0 A;  3DVX A;  2DKI A;  2CZ3 A;  2HQT A;  1GUM A;  1EP7 A;  3QCP A;  1XOB A;  1Z7R A;  2OBI A;  3EIN A;  1GL8 A;  4EDY A;  2B7K A;  1GSD A;  4HU7 A;  2B5E A;  1EOH A;  1YY7 A;  2R4V A;  3ZFL A;  1JZO A;  1BF5 A;  4AGS A;  1T00 A;  3KTB A;  4ZB9 A;  5G31 A;  1A23 A;  3HMJ G;  1U3I A;  4W66 A;  3RDW A;  4WR4 A;  1G6Y A;  4O5R A;  4F9Z A;  4BIK A;  5CNW A;  3VPQ A;  4V1A p;  4G19 A;  20GS A;  1QFN A;  1OKT A;  2PN8 A;  3EPT A;  1N25 A;  4XTS A;  1X5E A;  1PRX A;  2WW1 A;  3G7Y A;  1S3R A;  5D9X A;  1WOU A;  4V2L A;  5IMV A;  1FB0 A;  3KZQ A;  3DRN A;  3GN3 A;  3HZ4 A;  4USS A;  3KP9 A;  4IVF A;  2ON5 A;  1HNA A;  4ZB6 A;  5DAK B;  1TJD A;  4GRF A;  1AIU A;  4CY6 A;  4MNN A;  3CQF A;  4NHZ A;  3O3T A;  1V9W A;  2GZY A;  2RUE A;  2YWN A;  4WBJ A;  5HFK A;  3GSS A;  3SBC A;  5D9V A;  3SWL A;  2WZ9 A;  2YWM A;  2OJL A;  1ACV A;  2C3N A;  1RK4 A;  1J08 A;  4BA7 A;  3ERF A;  1O6J A;  4I8B A;  1PL1 A;  2IMK A;  2LNT A;  3RHB A;  5LNK e;  4IQA A;  2BJX A;  2EFD A;  16GS A;  2IL3 A;  2CVB A;  4KUN A;  4TR1 B;  4X43 A;  1Z6N A;  3E0U A;  4MF6 A;  2B1L A;  4YAV A;  4ZBD A;  2H76 A;  3HVX A;  2JU5 A;  2O8V B;  4L5L A;  1K3L A;  1BG1 A;  1T4Z A;  3H79 A;  1VF3 A;  4NHW A;  5JWQ B;  2MYG A;  1TW9 A;  1NM3 A;  3APS A;  4MJA A;  3GHA A;  2HSY A;  2ZNM A;  1Y25 A;  1NW2 A;  1ZYN A;  4HQZ A;  3ZL5 A;  2IMI A;  2VCW A;  2R5G A;  3HKR A;  2O5V A;  2WW3 A;  1TKD B;  2H8L A;  5C04 A;  3LXZ A;  1XFL A;  1A2J A;  3ZVJ D;  3IHG A;  2C1Y A;  3BCK A;  3LG6 A;  2NPB A;  4F03 A;  2GS3 A;  1U87 A;  4K0G A;  1SD8 A;  1J9B A;  5BRT A;  5J9C A;  3ISO A;  5F8B A;  4O32 A;  2C0G A;  4POL A;  4PUF C;  1B9Y C;  3TJK A;  3DWV A;  5CP1 A;  2OKA A;  4K9Z A;  5A34 B;  3LGC A;  2FWH A;  1GWC A;  2YJ7 A;  1BYE A;  1N8J A;  2XHF A;  3WGE A;  4GTU A;  2MBS A;  3BJ5 A;  2CVD A;  5IOX A;  1GUH A;  2PBJ A;  3TRQ A;  1X5D A;  2DC5 A;  5IPG A;  3F9U A;  1I5G A;  4HDE A;  1FVJ A;  2UZ8 A;  2DBC A;  2VCT A;  1PKZ A;  5H5Q A;  3C1R A;  4MJB A;  2WW0 A;  1C72 A;  1W4V A;  2V32 A;  3VWX A;  3Q18 A;  2HSN A;  2GGT A;  1K0D A;  2PMT A;  2LJK A;  4O5Q A;  5KN2 A;  2CQ9 A;  2L5L A;  2DJ2 A;  4XRA A;  5KN3 A;  2AJQ B;  4XS6 A;  4TXO A;  1UVZ A;  3GUR A;  3MSZ A;  2GQL A;  3IE3 A;  5EVO A;  1SKS B;  3KCM A;  3TB2 A;  4EVM A;  3TKP A;  5J4Y A;  3QAV A;  2N5F A;  4O7H A;  2CT6 A;  1JZW A;  2IJY A;  3A5I A;  5ECR B;  5C00 A;  3CSI A;  2OA7 A;  3L9V A;  2HZF A;  3A5W A;  3A2X A;  1OC9 A;  1K0O A;  1FG4 A;  3FMW A;  3M0F A;  1F6M C;  5KOW A;  2H0G A;  4POK A;  1K0A A;  4CDO A;  3GH6 A;  4EO3 A;  3HVS A;  3UAP A;  4KA0 A;  4KSM A;  1GRX A;  3WGD A;  3QFA C;  2H73 A;  2HE3 A;  3I69 A;  1MTC A;  2VLV A;  2FCH A;  2K8S A;  3F4T A;  1U6T A;  2WVX A;  4Z2T A;  4K8M A;  2YZH A;  3RPP A;  1FW1 A;  2H0H A;  5FHI A;  2HLS A;  4EIQ A;  2DLX A;  3ZYW A;  1NHY A;  1WWJ A;  1K0N A;  1SL2 B;  2FLS A;  4HOJ A;  4KDX A;  3F3Q A;  3TRX A;  1ML6 A;  2VCZ A;  1WMJ A;  4J2F A;  1GSQ A;  3VWV A;  2WZS A;  2VAF A;  1MDJ A;  1URM A;  2H70 A;  3ZFB A;  3G7I A;  3FR6 A;  4GQF A;  1VGL A;  3HCZ A;  2VLU A;  3BBY A;  2H6Z A;  1Z5Y E;  4PNG A;  1K0B A;  4G0L A;  4JED A;  1XWG A;  1Y6E A;  1X9M B;  4N3Z A;  3D0Z A;  14GS A;  2V6O A;  4TR4 A;  2X99 A;  2JAC A;  1ERT A;  2DKH A;  5L71 A;  1PSQ A;  3FYG A;  1ZOF A;  1OC9 B;  2P5Q A;  4MH2 A;  1M0U A;  3IAM 2;  1GSS A;  5H5S A;  3NZN A;  4WF4 A;  2DSA A;  3EUR A;  4OFT A;  2L6C A;  2DJ3 A;  2AYT A;  4XIH A;  3IC4 A;  2GQM A;  3MYD A;  4F0C A;  2WS2 A;  2H1D A;  5EY6 A;  2GT6 A;  4DSQ A;  4TN8 A;  3ERW A;  1YKA A;  4FXY P;  3C1S A;  1ZYE A;  1UA5 A;  1AW9 A;  4TW5 A;  1O81 A;  1XW9 A;  1BG5 A;  1K3Y A;  2V1M A;  2WVX B;  5DJL A;  1M2B A;  2YZU A;  2I81 A;  3LSZ A;  3LYP A;  4PX1 A;  4ECC A;  4EUY A;  1GP1 A;  3V1W A;  4PUA A;  1PX6 A;  1YZX A;  2HRF A;  5ECP B;  5JCU A;  1UC7 A;  3WT1 A;  4FQU A;  2R6K A;  2P0G A;  2HRA A;  3QAW A;  1GSY A;  2OE1 A;  2VM2 A;  4TOP A;  4BVY A;  3CBU A;  3FKF A;  4DSS B;  4PQI A;  4N0Z A;  2C8U A;  1PN0 A;  5J5N A;  4PTS A;  4IGJ A;  1A2L A;  1M9B A;  4RQR A;  3VPT A;  2MBT A;  5DBQ A;  2EIO A;  1W89 A;  2F3M A;  4OFN A;  4FO5 A;  2EFE A;  2WFC A;  2OE3 A;  2FGX A;  1O8X A;  2WUL A;  1Z3E A;  5LD0 A;  5J47 A;  3WGX A;  1FOV A;  2VCX A; 
#chains in the Genus database with same CATH homology
 2O89 A;  2JAD A;  1A24 A;  2YCD A;  3LW9 A;  1SVM A;  1R5P A;  1XPV A;  1K0M A;  4ZIL A;  5FT3 A;  4L5O A;  3QFB C;  5DAL A;  3ZLP A;  1IYI A;  3MAK A;  2H1A A;  2LTK A;  1HNC A;  1ERU A;  1T7P B;  4I97 A;  5ECK B;  1NSW A;  1YF0 A;  2LNS A;  4RUV A;  2YV7 A;  4ECJ A;  3LWA A;  2GQK A;  2R3X A;  5DAK A;  3ZRD A;  5D73 A;  2DMM A;  2E7P A;  1M7T A;  2YWI A;  1AC1 A;  3MDK A;  2WB9 A;  4ZIJ A;  1VF4 A;  4NV2 A;  1OVN A;  2B6M A;  5J4V A;  5EPF A;  3QR6 A;  3GL5 A;  2VLT A;  2G0F A;  1EWX A;  1M2D A;  5ELA A;  1S3A A;  1ZL9 A;  5G5F A;  4MJE A;  1TRV A;  5ECO B;  5ECI B;  3APQ A;  3P90 A;  2X8C A;  4RQX A;  4N30 A;  4BVY B;  3UVT A;  5CRG A;  4ML6 A;  5F07 A;  1HQO A;  2A4H A;  3ZVJ A;  4GLT A;  2H1G A;  2L5O A;  4TR1 A;  4MZB A;  1QUW A;  3GKM A;  3FR3 A;  4ECB A;  1U88 A;  4WR5 A;  2I1U A;  4O5U A;  4HZ4 A;  1B48 A;  2DJ0 A;  4LL1 B;  2TRC P;  2E2M A;  4GST A;  4LMV A;  2Z9S A;  1VF2 A;  4K7I A;  1WRY A;  3D5J A;  1GH2 A;  3JCM L;  3UIW A;  2KP1 A;  1VRS D;  2FA4 A;  4BVX A;  5G30 A;  3FZ5 A;  10GS A;  3DEX A;  2HNL A;  1T1V A;  5DAL B;  1FO5 A;  1ON4 A;  3H93 A;  3IBH A;  2MMZ A;  1XWK A;  1USB A;  3CYN A;  4E8H A;  2RLI A;  3ZMK A;  1SK0 A;  4K5S A;  3KEB A;  5KN1 A;  1AUC A;  3PPU A;  2CA8 A;  4KE3 A;  3HYP A;  5A34 A;  4ID0 A;  3VK9 A;  4IEL A;  4OFM A;  1M2A A;  1JZR A;  4ZL7 A;  2HI7 A;  3P7X A;  2HSM A;  1JLV A;  2HYX A;  3VUR A;  2ALB A;  4HJM A;  2I4A A;  3F8U A;  2L6D A;  4FYB A;  3VI5 A;  3RBT A;  3GTU A;  2VD1 A;  3F4S A;  4NV5 A;  4JR4 A;  2H19 A;  3AY8 A;  4GSS A;  4KSO A;  3Q6O A;  1HD2 A;  3N5O A;  1VF1 A;  4RI6 A;  1EOG A;  4POM A;  2YV9 A;  4EXJ A;  1AQV A;  4K1F A;  1XVQ A;  2JSY A;  1FB6 A;  1GTA A;  2VL2 C;  1ZYP A;  2A2P A;  2NDO A;  2JZT A;  5GZZ B;  2QKE A;  2ZCT A;  4KW6 A;  4XS4 A;  3K8N A;  1HNB A;  4MA9 A;  4IJI A;  2J23 A;  3TCO A;  2BTO T;  5A1N A;  2O7K A;  5KN0 A;  5IPH A;  1BAY A;  2H6X A;  4KAE A;  1T4Y A;  1SL1 B;  5GAP D;  4BVX B;  1ERV A;  3A2W A;  4DSR A;  3UVH A;  4HQS A;  2AUV A;  1ZGN A;  1J0F A;  1GUK A;  4AKH A;  3GNJ A;  2IME A;  2LEG A;  3GRX A;  6GST A;  4FIW A;  5IMZ A;  1X9W B;  1Z6M A;  1FVK A;  1B9X C;  3TJJ A;  1ZZY A;  2PWJ A;  5F06 A;  1DUG A;  4MDC A;  1XXU A;  5IOW A;  4N11 A;  1G7E A;  2F9S A;  3D4M A;  4AKX B;  1B8X A;  3EE2 A;  4HJ2 A;  2H74 A;  1YQ1 A;  2VO4 A;  2HSM B;  1XOA A;  2R2J A;  2WGR A;  3HD5 A;  4KND A;  3F3R A;  1GLP A;  2L4Q A;  2P5R A;  3GL3 A;  4KDU A;  4IJ3 A;  5IQY A;  1G6W A;  3GTU B;  6GSX A;  1TRU A;  5ECL B;  5DCH A;  2XC2 A;  3TOT A;  4Z7X A;  3Q74 A;  2BMX A;  1Q4J A;  4YQM A;  3HXS A;  1TOF A;  3C8E A;  2R37 A;  2VM1 A;  2VL9 A;  2QA1 A;  1GTB A;  4IP6 A;  4XS4 B;  3H8Q A;  4ACS A;  4QL7 A;  3TJG A;  3CMI A;  5HR0 A;  5A1N B;  3ZZX A;  22GS A;  5A4W A;  3W8J A;  1V98 A;  2H0I A;  3D21 A;  3RHC A;  2CVK A;  5CAX A;  3ZIJ A;  17GS A;  3QDN A;  4JR6 A;  1I9D A;  1OKD A;  2NVL A;  4FYU A;  3HA9 A;  1RQM A;  1XW5 A;  5E59 A;  3NIV A;  4L8E A;  4HU9 A;  4PQH A;  2ON7 A;  3GKN A;  1A2M A;  4YQV A;  2PVO C;  4PUR A;  9GSS A;  1XBS A;  1F3A A;  4KH7 A;  1GSF A;  4G9H A;  2YN1 A;  1JZD A;  3W8S A;  2CAQ A;  1QGV A;  3KIJ A;  5E4W A;  1X5C A;  4HEA 2;  2P31 A;  2QC7 A;  5COH A;  4IKH A;  2ES7 A;  1OE8 A;  1G0T A;  4NAX A;  4AKI A;  4V2N A;  2R0C A;  4KCA A;  2YJH A;  4ML1 A;  1HYU A;  1U3A A;  4LL4 B;  2CZ2 A;  3GFK A;  1Z9H A;  1EZK A;  1K3O A;  3FHK A;  3P2A A;  4DSS A;  2FD3 A;  4I2T A;  2CV4 A;  3KJY A;  1THX A;  1PA3 A;  1SKR B;  4ECI A;  1XCC A;  4AJ8 A;  4AJ7 A;  1JLW A;  6GSS A;  5A5H A;  2C80 A;  3CRU A;  4JU5 A;  5A5K A;  1Z7P A;  4NPB A;  4CY8 A;  1V2A A;  3HZ8 A;  2V6K A;  2HRK A;  5CRE A;  2LS5 A;  3F6F A;  5AIS A;  3VI7 A;  3APO A;  5DVB A;  3MNG A;  1JFU A;  2H1B A;  2VCQ A;  3DD3 A;  5F0G A;  2C0D A;  2EFH A;  2E2G A;  1THO A;  3KTL A;  3HY2 A;  1XWB A;  4FH8 A;  5EL8 A;  1EP8 A;  3IOS A;  3IPZ A;  3KMO A;  4OO4 A;  1H4O A;  2RII A;  1GUL A;  4OCE A;  5HFI A;  2PGT A;  1TK0 B;  3VLN A;  2LRC A;  2WRT A;  1BQ7 A;  2HRN A;  5IM9 A;  4OCF A;  2KOK A;  1KBN A;  3FZA A;  3TU3 B;  3GST A;  2EIR A;  1PQN A;  4KB3 A;  1ABA A;  2M80 A;  5GSS A;  3IR4 A;  5DJM A;  2A4V A;  2H75 A;  1XVW A;  2DJ1 A;  2V2G A;  3C73 A;  3ZIV A;  5B7C A;  1B4P A;  4I2U A;  2LRN A;  2WDU A;  1ZYQ B;  1SJZ A;  3M1G A;  3UBL A;  1R5A A;  3I9V 2;  3RAZ A;  3OR5 A;  2MMN A;  6GSW A;  1SVL A;  5B6N A;  4PQ1 A;  2H30 A;  3U6V A;  5IO2 A;  3FRC A;  5CO3 A;  3GMF A;  2LST A;  2OAD A;  5CRW A;  3L9S A;  2F51 A;  4GQC A;  3EVI A;  2VCV A;  1K0C A;  2NBS A;  2PVQ A;  4IS0 A;  4IHU A;  3IK9 A;  4IBP A;  5J3R A;  3VWU A;  4G2E A;  2L4C A;  2RM6 A;  5A5H B;  3QMX A;  5B6M A;  3QAG A;  2HRK B;  3IXR A;  1WE0 A;  2FA8 A;  4HI7 A;  1PGT A;  2YP6 A;  5B8A A;  3LJR A;  3F0I A;  1SJI A;  1S3D A;  1A8Y A;  2LV3 A;  3LYK A;  4BWS A;  3DIE A;  4XCS A;  2FUG 2;  1LJR A;  3KMN A;  2XBQ A;  1SYR A;  1A0R P;  3UJ1 A;  2H72 A;  1XW6 A;  4ILF A;  1FAA A;  1PX7 A;  4AJ6 A;  3O76 A;  4ZB7 A;  5ELG A;  2RM5 A;  1WJK A;  18GS A;  3UEM A;  5BMU A;  4GCI A;  1PN9 A;  3ZML A;  2C0E A;  4MF5 A;  2FY6 A;  1G7O A;  1B4Q A;  4YQU A;  2I9H A;  3CSJ A;  4IW9 A;  3IRA A;  2O87 A;  3CTF A;  5ECM B;  2B5X A;  4KF9 A;  2HXK A;  2EFC A;  5KOX A;  3Q19 A;  1QQ2 A;  5HR3 A;  1TI3 A;  4JZQ A;  4HUA A;  2GTU A;  5D9T A;  2YOI A;  3EWL A;  3DML A;  3GX8 A;  1V40 A;  2N5A A;  2HZE A;  1V58 A;  3QPM A;  1ZMA A;  2LQQ A;  2ZUP A;  4WKW A;  4QL9 A;  3KH7 A;  1TK8 B;  3HJM A;  3MWH A;  2F8F A;  4YKF A;  3KXO A;  2PU9 C;  2PER A;  3ME8 A;  3GYK A;  3DKS A;  1OC8 A;  2KHP A;  1QMV A;  3J7Y k;  2GSR A;  2GVP A;  4MAB A;  1A0F A;  4K5R A;  4NWY A;  2GZZ A;  2REM A;  1YKC A;  2EIQ A;  2EC4 A;  2VUP A;  3KH9 A;  4OO5 A;  4O92 A;  5J40 A;  5IMA A;  4ICY A;  5ECS A;  4ZL8 A;  1F2E A;  4BWQ A;  1TK5 B;  3MIX A;  4HZ2 A;  4CW9 A;  4K2D A;  1M99 A;  1DE1 A;  4NXI A;  3FEU A;  4GWR A;  4Z2R A;  5JWR B;  4ZBB A;  3CTG A;  3EC3 A;  3P8W A;  1XIY A;  1SEN A;  3WD6 A;  3GV1 A;  1SU9 A;  2A2R A;  2X8G A;  2JZS A;  2B7J A;  2IFQ A;  3HHV A;  1SK2 A;  5BMU B;  3DYR A;  2MZC A;  5G1L A;  1PMT A;  2K9F A;  3TKS C;  1YEP A;  2J9H A;  3E9J B;  1GNE A;  2GST A;  4Q5N A;  3DXB A;  4X0X A;  3FR9 A;  3N9J A;  2DML A;  2HSH A;  1YF1 A;  1DSB A;  3GUS A;  3D4T A;  2CX4 A;  4ZXG A;  2PPT A;  2M72 A;  3GKK A;  5FWG A;  3TJB A;  1V57 A;  4MMM A;  3KGK A;  3R3E A;  1SK1 A;  3ZIT A;  1DE2 A;  1TDI A;  1F37 A;  2GLR A;  3DVW A;  4L0U A;  2HZE B;  5A4U A;  3C7M A;  3M9K A;  2NTO A;  4L0W A;  4G0I A;  4G0K A;  5DQS A;  1A8L A;  3HJO A;  4G10 A;  4FYC A;  3HJP A;  2QSI A;  1M9A A;  13GS A;  6GSV A;  5AGY A;  3F6D A;  3H4K A;  1TXU A;  4JBB A;  5D93 A;  1UN2 A;  4EE0 A;  1QK8 A;  4GXZ A;  3KP8 A;  1GSU A;  3GKX A;  5IIZ A;  4E8E A;  1N2A A;  2C3T A;  4EIP A;  4KGI A;  4LLR A;  4TXV A;  5D9W A;  5GAN D;  2JL4 A;  1PKW A;  2OBK A;  4PNF A;  5J41 A;  4K7O A;  4F0B A;  4P3Y B;  1XZO A;  3EYT A;  2JSZ A;  3ZTL A;  2GSS A;  3RPN A;  4TR3 A;  4MF7 A;  1TP9 A;  4HS1 A;  2OT3 A;  2IFQ B;  1IYH A;  3FK8 A;  3DGQ A;  3FY7 A;  2OAC A;  2XBI A;  3KD0 A;  3TJF A;  4MJC A;  2I3Y A;  4OMV A;  2K6V A;  2IN3 A;  4Z2U A;  4DVC A;  4K2X A;  4WET A;  1MDI A;  5GST A;  1XWA A;  2XPE A;  3TRP A;  3TKS A;  4POB A;  4NMU A;  4MZC A;  4WXT A;  4XS1 A;  5AIV A;  2LRT A;  5ENU A;  2DIZ A;  4BPY A;  2B3S A;  2CAI A;  1CQG A;  12GS A;  4KCE A;  3TKQ A;  5AIX A;  4IQ1 A;  1S3C A;  2DIY A;  5DCG A;  3IA1 A;  4EF0 A;  2CX3 A;  5G2Z A;  4PGT A;  1Q98 A;  3L4N A;  4TRX A;  3A2V A;  2GDR A;  3HVV A;  4G01 A;  8GSS A;  1RW1 A;  2QGV A;  1FHE A;  3G7J A;  2UV8 G;  5B8B A;  2WCI A;  2VL2 A;  4V1A g;  2IPA A;  3PGT A;  2F8A A;  3PR8 A;  4X1U A;  2TRX A;  1NHO A;  5G1K A;  1SVO A;  19GS A;  4TR0 A;  2FNO A;  2B1K A;  1O73 A;  1YDK A;  3TOU A;  2N5B A;  2K18 A;  4OD7 A;  1ZCP A;  2L59 A;  2V41 A;  4MH3 A;  3QD9 A;  2LUS A;  1GTU A;  1O8W A;  5KEJ A;  3LFL A;  1T3B A;  2HFD A;  4AKG A;  5ID2 A;  2X64 A;  11GS A;  4D73 A;  1AQX A;  4Q5F A;  2H66 A;  2YAN A;  3GX0 A;  4OWY A;  5ECH B;  1EEM A;  1SD9 A;  2KLX A;  2GZP A;  5CRH A;  2VL3 A;  1SYX A;  1JHB A;  3UOM A;  4N10 A;  4F82 A;  1MD3 A;  2IWT A;  4PXO A;  3R2Q A;  4IP1 A;  1X0R A;  2KP2 A;  2M46 A;  5IO0 A;  1MDK A;  4GF0 A;  3H1N A;  3ZRE A;  2PUK C;  1FOH A;  2RUF A;  6GSU A;  3IDV A;  3VFI A;  1TU7 A;  3ED3 A;  4EKZ A;  3TGZ A;  1SL0 B;  4J57 E;  3LXT A;  5JCW A;  2DJJ A;  1SKW B;  4ISD A;  1GNW A;  1TRW A;  2QA2 A;  2AAW A;  3CSH A;  5LCZ A;  3D6I A;  2O85 A;  3G9B A;  5HQP A;  4ZL9 A;  4WBR D;  2KUC A;  3EMX A;  3TUE A;  1E2Y A;  4K7N A;  5HFG A;  1QXH A;  3BD2 A;  2IIY A;  4H86 A;  2H1L A;  4YAP A;  2HSN B;  3L78 A;  1GSE A;  3GA4 A;  3LQ7 A;  3FW2 A;  1EEJ A;  2AV4 A;  5J4U A;  4ZB8 A;  1MD4 A;  4EDZ A;  4BL7 A;  1H75 A;  4TXO B;  5IMD A;  5CRD A;  3U5R E;  4QMK A;  3CXG A;  3IV4 A;  3CWG A;  3EMP A;  3KM6 A;  5D96 A;  5J9B A;  4KX4 A;  4YKG A;  5INY A;  2FHE A;  2G2Q A;  2VIM A;  7GSS A;  1YVL A;  3F4R A;  1R7H A;  2IMF A;  3BOA A;  1WIK A;  2R0P A;  1O85 A;  2LQO A;  3LOR A;  3TKS E;  2FWG A;  5ECQ B;  1O7U A;  5IMC A;  1TTZ A;  1EV4 A;  2R0G A;  5ID2 B;  3UAR A;  4Q5Q A;  1T8E B;  4DEJ A;  3BCI A;  3M3M A;  4A5P A;  4D73 B;  3FZ4 A;  5IMF A;  1BJX A;  1SJ6 A;  1X9S B;  4MLY A;  4ZBA A;  3F63 A;  2GT5 A;  4RI7 A;  4JRR A;  2VD0 A;  4IN0 A;  2YPM A;  2B5Y A;  1WP0 A;  2LJA A;  1LBK A;  3US3 A;  1OYJ A;  1ST9 A;  1DBY A;  4CHS A;  1LU4 A;  4E68 A;  2LJR A;  1F9M A;  3LEF A;  2H6Y A;  1WPI A;  4K6X A;  2H71 A;  2MMA A;  4GDF A;  3NOF A;  5JWO B;  2YNX A;  1AXD A;  1KNG A;  3J7Y b;  4I6X A;  4ULX A;  4Q5R A;  2K8V A;  4WEY A;  3ME7 A;  5A4V A;  1TRS A;  2D2Z A;  2VKZ G;  3FZ9 A;  3C71 A;  3WT2 A;  4MP4 A;  5H5R A;  2VOC A;  5CYY A;  3TKR A;  3UBK A;  3W6G A;  1OC3 A;  2X4A A;  4XRD A;  4EL1 A;  1XWC A;  4K0N A;  4MCU A;  2YWO A;  5ABR A;  1AAZ A;  4BL7 B;  5D8I A;  5JCG A;  1MEK A;  2WJU A;  4XHM A;  2FWE A;  1ILO A;  5HR2 A;  5F05 A;  3GIX A;  4J56 E;  3D22 A;  1Y1U A;  2C4J A;  3M8N A;  3UMA A;  1BX9 A;  3S9F A;  3ERG A;  1TU8 A;  4LA1 A;  4KDY A;  5ECN B;  3L9U A;  3I6A A;  2FWF A;  2OE0 A;  2X49 A;  4MPF A;  1OAZ A;  4LMW A;  1GLQ A;  1PD2 1;  2C0F A;  3E3E A;  4AI6 A;  1CQH A;  3EU3 A;  1YJ6 A;  4V2M A;  4F2I A;  4GSN A;  3IC8 A;  2MMO A;  3PH9 A;  3TDG A;  1BED A;  3QOU A;  1F3B A;  1TXX A;  5G5E A;  4AF2 A;  3IK7 A;  3O6T A;  1EGR A;  3WYW A;  2HT9 A;  6GSY A;  1KTE A;  3HDC A;  1R26 A;  2AHE A;  4TKY A;  1EGO A;  1AQW A;  3M9J A;  4MK3 A;  3EU4 A;  1GTI A;  3IHQ A;  1KEB A;  4MPG A;  2H01 A;  5DQY A;  1R4W A;  3I43 A;  5AN1 A;  5HR1 A;  1OE7 A;  4X4J A;  3IAS 2;  4YH2 A;  3A3T A;  2C3Q A;  3GH9 A;  4I5Q A;  2TIR A;  2IMD A;  2DJK A;  3PIN A;  2GSQ A;  4QQ7 A;  2XPD A;  2LKU A;  4TVE A;  2A2S A;  2JZR A;  3CRT A;  3VWW A;  1TI1 A;  1EV9 A;  3L0H A;  5DDL A;  1ERW A;  2X8H A;  1PL2 A;  3UL3 A;  4N0V A;  1E6B A;  4MZW A;  1YEX A;  4WF5 A;  2L57 A;  2E0Q A;  4JE1 A;  2AB6 A;  4EC0 A;  3DVX A;  2DKI A;  2CZ3 A;  2HQT A;  1GUM A;  1EP7 A;  3QCP A;  1XOB A;  1Z7R A;  2OBI A;  3EIN A;  1GL8 A;  4EDY A;  2B7K A;  1GSD A;  4HU7 A;  2B5E A;  1EOH A;  1YY7 A;  2R4V A;  3ZFL A;  1JZO A;  1BF5 A;  4AGS A;  1T00 A;  3KTB A;  4ZB9 A;  5G31 A;  1A23 A;  3HMJ G;  1U3I A;  4W66 A;  3RDW A;  4WR4 A;  1G6Y A;  4O5R A;  4F9Z A;  5CNW A;  3VPQ A;  4V1A p;  4G19 A;  20GS A;  1QFN A;  1OKT A;  2PN8 A;  3EPT A;  1N25 A;  4XTS A;  1X5E A;  1PRX A;  3G7Y A;  5D9X A;  1WOU A;  4V2L A;  5IMV A;  1FB0 A;  3KZQ A;  3DRN A;  3GN3 A;  3HZ4 A;  4USS A;  3KP9 A;  4IVF A;  2ON5 A;  1HNA A;  4ZB6 A;  5DAK B;  1TJD A;  4GRF A;  1AIU A;  4CY6 A;  4MNN A;  4NHZ A;  3O3T A;  1V9W A;  2GZY A;  2RUE A;  2YWN A;  4WBJ A;  5HFK A;  3GSS A;  3SBC A;  5D9V A;  3SWL A;  2WZ9 A;  2YWM A;  2OJL A;  1ACV A;  2C3N A;  1RK4 A;  1J08 A;  4BA7 A;  3ERF A;  1O6J A;  4I8B A;  1PL1 A;  2IMK A;  2LNT A;  3RHB A;  5LNK e;  4IQA A;  2BJX A;  2EFD A;  16GS A;  2IL3 A;  2CVB A;  4KUN A;  4TR1 B;  4X43 A;  1Z6N A;  3E0U A;  4MF6 A;  2B1L A;  4YAV A;  4ZBD A;  2H76 A;  3HVX A;  2JU5 A;  2O8V B;  4L5L A;  1K3L A;  1BG1 A;  1T4Z A;  3H79 A;  1VF3 A;  4NHW A;  5JWQ B;  2MYG A;  1TW9 A;  1NM3 A;  3APS A;  4MJA A;  3GHA A;  2HSY A;  2ZNM A;  1Y25 A;  1NW2 A;  1ZYN A;  4HQZ A;  3ZL5 A;  2IMI A;  2VCW A;  2R5G A;  3HKR A;  2O5V A;  1TKD B;  2H8L A;  5C04 A;  3LXZ A;  1XFL A;  1A2J A;  3ZVJ D;  3IHG A;  2C1Y A;  3BCK A;  3LG6 A;  2NPB A;  4F03 A;  2GS3 A;  1U87 A;  4K0G A;  1SD8 A;  1J9B A;  5BRT A;  5J9C A;  3ISO A;  5F8B A;  4O32 A;  2C0G A;  4POL A;  4PUF C;  1B9Y C;  3TJK A;  3DWV A;  5CP1 A;  2OKA A;  4K9Z A;  5A34 B;  3LGC A;  2FWH A;  1GWC A;  2YJ7 A;  1BYE A;  1N8J A;  2XHF A;  3WGE A;  4GTU A;  2MBS A;  3BJ5 A;  2CVD A;  5IOX A;  1GUH A;  2PBJ A;  3TRQ A;  1X5D A;  2DC5 A;  5IPG A;  3F9U A;  1I5G A;  4HDE A;  1FVJ A;  2UZ8 A;  2DBC A;  2VCT A;  1PKZ A;  5H5Q A;  3C1R A;  4MJB A;  1C72 A;  1W4V A;  2V32 A;  3VWX A;  3Q18 A;  2HSN A;  2GGT A;  1K0D A;  2PMT A;  2LJK A;  4O5Q A;  5KN2 A;  2CQ9 A;  2L5L A;  2DJ2 A;  4XRA A;  5KN3 A;  2AJQ B;  4XS6 A;  4TXO A;  1UVZ A;  3GUR A;  3MSZ A;  2GQL A;  3IE3 A;  5EVO A;  1SKS B;  3KCM A;  3TB2 A;  4EVM A;  3TKP A;  5J4Y A;  3QAV A;  2N5F A;  4O7H A;  2CT6 A;  1JZW A;  2IJY A;  3A5I A;  5ECR B;  5C00 A;  3CSI A;  3L9V A;  2OA7 A;  2HZF A;  3A5W A;  3A2X A;  1OC9 A;  1K0O A;  1FG4 A;  3FMW A;  3M0F A;  1F6M C;  5KOW A;  2H0G A;  4POK A;  1K0A A;  4CDO A;  3GH6 A;  4EO3 A;  3HVS A;  3UAP A;  4KA0 A;  4KSM A;  1GRX A;  3WGD A;  3QFA C;  2H73 A;  2HE3 A;  3I69 A;  1MTC A;  2VLV A;  2FCH A;  2K8S A;  3F4T A;  1U6T A;  4Z2T A;  4K8M A;  2YZH A;  3RPP A;  1FW1 A;  2H0H A;  5FHI A;  2HLS A;  4EIQ A;  2DLX A;  3ZYW A;  1NHY A;  1WWJ A;  1K0N A;  1SL2 B;  2FLS A;  4HOJ A;  4KDX A;  3F3Q A;  3TRX A;  1ML6 A;  2VCZ A;  1WMJ A;  4J2F A;  1GSQ A;  3VWV A;  2VAF A;  1MDJ A;  1URM A;  2H70 A;  3ZFB A;  3G7I A;  3FR6 A;  4GQF A;  1VGL A;  3HCZ A;  2VLU A;  3BBY A;  2H6Z A;  1Z5Y E;  4PNG A;  1K0B A;  4G0L A;  4JED A;  1XWG A;  1Y6E A;  1X9M B;  4N3Z A;  3D0Z A;  14GS A;  2V6O A;  4TR4 A;  2X99 A;  2JAC A;  1ERT A;  2DKH A;  5L71 A;  1PSQ A;  3FYG A;  1ZOF A;  1OC9 B;  2P5Q A;  4MH2 A;  1M0U A;  3IAM 2;  1GSS A;  5H5S A;  3NZN A;  4WF4 A;  2DSA A;  3EUR A;  4OFT A;  2L6C A;  2DJ3 A;  2AYT A;  4XIH A;  3IC4 A;  2GQM A;  3MYD A;  4F0C A;  2WS2 A;  2H1D A;  5EY6 A;  2GT6 A;  4DSQ A;  4TN8 A;  3ERW A;  1YKA A;  3C1S A;  1ZYE A;  1UA5 A;  1AW9 A;  4TW5 A;  1O81 A;  1XW9 A;  1BG5 A;  1K3Y A;  2V1M A;  5DJL A;  1M2B A;  2YZU A;  2I81 A;  3LSZ A;  3LYP A;  4PX1 A;  4ECC A;  4EUY A;  1GP1 A;  3V1W A;  4PUA A;  1PX6 A;  1YZX A;  2HRF A;  5ECP B;  5JCU A;  1UC7 A;  3WT1 A;  4FQU A;  2R6K A;  2P0G A;  2HRA A;  3QAW A;  1GSY A;  2OE1 A;  2VM2 A;  4TOP A;  4BVY A;  3CBU A;  3FKF A;  4DSS B;  4PQI A;  4N0Z A;  2C8U A;  1PN0 A;  5J5N A;  4PTS A;  4IGJ A;  1A2L A;  1M9B A;  4RQR A;  3VPT A;  2MBT A;  5DBQ A;  2EIO A;  1W89 A;  2F3M A;  4OFN A;  4FO5 A;  2EFE A;  2WFC A;  2OE3 A;  2FGX A;  1O8X A;  2WUL A;  1Z3E A;  5LD0 A;  5J47 A;  3WGX A;  1FOV A;  2VCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...