1YQ1A

Structural genomics of caenorhabditis elegans: glutathione s-transferase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
205
structure length
201
Chain Sequence
MPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSGEVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-Transferase
publication title Structural Genomics of Caenorhabditis Elegans: glutathione S-Transferase
rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 62
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1yq1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yq1A01
3L0HA 3WGEA 2WRTA 1FOVA 4QL7A 4BL7A 3E0UA 4TXVA 3CMIA 1PA3A 3C7MA 4N10A 1GUHA 2MMAA 5CP1A 1T1VA 1EP7A 12GSA 2QC7A 3UVTA 1EP8A 2CX4A 5AN1A 2H1DA 1TU8A 2HRAA 1HNBA 3S9FA 4BA7A 3JCML 2EIOA 4GSNA 1Z7RA 1YEXA 2R37A 5IIZA 1ERTA 3APQA 1QFNA 2Z9SA 4KNDA 18GSA 3I69A 5IMVA 4K7NA 3ZLPA 2DJ2A 5DALA 1TU7A 5DAKA 1XFLA 2VM1A 2F51A 1AC1A 1YEPA 4N0ZA 1ZOFA 4LL1B 3WGXA 1F37A 2F8AA 1M2DA 2GT5A 2WGRA 4N0VA 3VK9A 2PERA 3M8NA 3RPPA 1XCCA 2C3NA 1SD9A 2YWMA 4GTUA 4EO3A 3HJOA 1EOGA 1QGVA 1SD8A 2O7KA 2H1GA 3W8JA 3IC8A 4BVXB 1JZOA 2FWEA 3UL3A 3UMAA 3D21A 4NMUA 4DSRA 3CRUA 2OBKA 3ED3A 2HRKB 2HFDA 2LKUA 4MA9A 4ILFA 1X9WB 1E6BA 1T3BA 2HRFA 2NPBA 2MZCA 4IN0A 5HR1A 4HU7A 2C8UA 3H4KA 3TOTA 2GT6A 2H30A 3UIWA 2N5FA 5F8BA 2YWNA 5ID2A 1U87A 1GUKA 5JWRB 3F3RA 2WB9A 1PL2A 3HY2A 4ZB8A 1GH2A 1QQ2A 4TN8A 4HI7A 2VCVA 1WMJA 4ID0A 4LL4B 4RI7A 1F3AA 5C04A 2LJRA 2MMZA 5JCWA 1AQVA 1XOBA 2H0HA 4AF2A 2K18A 3GFKA 5G31A 2B5YA 3GURA 2HZFA 5HFKA 3F4SA 5IMZA 5H5RA 2QSIA 4POMA 4HJMA 3HZ4A 3V1WA 5E4WA 3I9V2 4HU9A 3ZTLA 16GSA 3TKSE 3TRQA 2DJ3A 2KP1A 3K8NA 4HQSA 3VPQA 2ES7A 3KMOA 4EUYA 3RDWA 1Z6MA 1MDIA 1MDJA 2H19A 3DYRA 4XS4A 2IL3A 3VWWA 2CAQA 4HJ2A 2VUPA 4OFNA 4XTSA 2FA8A 3GIXA 1GL8A 2FWGA 1USBA 2YNXA 2HRNA 2E2GA 4RQRA 3TJGA 3P2AA 2JZRA 2H0GA 1O81A 3RHBA 1SK2A 4FYBA 5IO2A 5D9WA 1BX9A 5ECSA 2DJKA 2CVKA 1K3OA 4EE0A 5DJLA 3MWHA 5DALB 4TOPA 1OKTA 4ISDA 1H75A 1UVZA 4EDYA 4JU5A 5ABRA 2C4JA 3FR3A 4I2TA 2LJKA 3TUEA 3LG6A 4J2FA 4L5OA 1OKDA 1LJRA 5D8IA 4CDOA 1SK0A 2JZTA 4ZL7A 1SYRA 1IYHA 1QMVA 2GSSA 1T00A 1WE0A 2E2MA 1A8LA 2LRTA 4KDXA 2OADA 3VI7A 1XWBA 1N2AA 1FVJA 5HQPA 3ZVJD 1EOHA 1I5GA 4JR6A 1MDKA 1OVNA 2PVQA 2GQLA 3F8UA 7GSSA 5F07A 1VF3A 4E8EA 2R5GA 4G9HA 2B1LA 4EVMA 2DC5A 4ZB6A 2YPMA 1OC8A 4JRRA 3HJPA 2R2JA 2C1YA 3M9KA 2O89A 1O7UA 4ZBBA 3TJFA 5IMFA 5G1LA 4TVEA 3KH7A 2EIRA 1ZZYA 2LJAA 3G7JA 4HQZA 3VPTA 2YWIA 3DEXA 3QPMA 4K0GA 3GMFA 5CNWA 5ID2B 4TR1B 1F2EA 3KCMA 11GSA 3PGTA 2TIRA 2FY6A 2LNSA 1ERUA 2IFQA 8GSSA 1SK1A 4MABA 3QAVA 3IAS2 1T4YA 4IP6A 2RLIA 5L71A 4MH2A 2MYGA 3TKSA 3HKRA 2B5XA 1V9WA 1RK4A 1PN9A 1GTIA 3OR5A 3ZREA 3LYPA 4G0KA 3LEFA 2O85A 3CSJA 2WS2A 5LD0A 2V6OA 5HR3A 2CZ2A 4JE1A 4L0WA 2VL9A 2CA8A 4ZL9A 1DSBA 4XHMA 2L6DA 2R6KA 3AY8A 2B3SA 3DVWA 2LSTA 3EU3A 2PU9C 5E59A 1AUCA 4G0IA 3HVSA 2NDOA 3UOMA 1YKAA 3H79A 2C3QA 2LS5A 4O5RA 1ERWA 4YAVA 3DRNA 3EE2A 2OE1A 3F9UA 1K0BA 3HD5A 3PR8A 1GSUA 2CV4A 1ML6A 3IBHA 2PWJA 5DCGA 2MBSA 5IO0A 3A2WA 4POBA 2VLVA 4IQ1A 3P90A 2XC2A 4PNGA 4BVXA 3GRXA 2GSRA 4CHSA 5INYA 2GZYA 3FRCA 3HHVA 1K3LA 4MH3A 4DSSB 2HRKA 1ABAA 3IE3A 4OFTA 2ZNMA 3N5OA 1GSYA 2YJHA 5KN2A 3ZITA 5KN3A 4L8EA 2X8HA 3VLNA 4AJ6A 1GNEA 1AXDA 2PN8A 1ON4A 1AIUA 2VL2A 1CQHA 1XBSA 5ECQB 5J5NA 2QGVA 4LA1A 2F3MA 3GKMA 1G0TA 2B5EA 1KEBA 5IMCA 1R26A 4JZQA 2AYTA 1JZRA 1URMA 1Q98A 5GSTA 4HDEA 1GTAA 3TKQA 3FW2A 3FKFA 5AIVA 2XBIA 4J57E 1TRUA 5ECPB 3EVIA 4WBJA 4L0UA 3RBTA 3H93A 4I5QA 2GSQA 3GHAA 2V6KA 4PQIA 2YP6A 2YV7A 2V1MA 4PUFC 3P8WA 2A4VA 1A2MA 4USSA 2WFCA 5ECHB 3F4RA 1M9BA 4OWYA 1VRSD 3I6AA 5FT3A 2BMXA 3MDKA 2JU5A 1G6WA 2LV3A 3M9JA 2IJYA 3ZL5A 3A3TA 4YQMA 3BD2A 3TJJA 5H5SA 1TW9A 3DMLA 4WEYA 2BTOT 4MF6A 3GUSA 4ECCA 2IMIA 3BBYA 2M72A 5ECKB 4V2NA 3ZMKA 3HZ8A 2FHEA 2A2RA 5IOWA 2H1BA 3APSA 3HYPA 2V41A 3HDCA 1EV9A 3W6GA 1PSQA 3KMNA 3FR6A 3G9BA 3KD0A 1A23A 1GNWA 1FAAA 3O6TA 3IV4A 2H66A 2H6ZA 1X5DA 3QOUA 4Q5RA 3RAZA 3ZZXA 4IJ3A 2C0DA 2HLSA 10GSA 3C1SA 3KP8A 1AQXA 1PRXA 2LQQA 3QMXA 1J0FA 2FGXA 3CSIA 3QR6A 3U5RE 4GQFA 1SKSB 1VF1A 2NVLA 3TKRA 2X8GA 1GUMA 4TKYA 2NBSA 1VGLA 5EPFA 5COHA 2CT6A 3IR4A 2GDRA 4MJEA 1THOA 1BJXA 5KN0A 3KTBA 1M0UA 4V2LA 4MDCA 3ME7A 3H8QA 3MNGA 2AHEA 5IM9A 2UZ8A 1MTCA 1B9YC 1XIYA 2L4QA 1DUGA 3KJYA 3QDNA 2GGTA 3TJKA 2E7PA 5F05A 3C1RA 2C3TA 17GSA 2IPAA 4WF5A 5D93A 3ERFA 1J08A 2VLTA 3WT2A 2YCDA 2B1KA 2H75A 4V1Ag 1FVKA 1B4PA 2O8VB 3IK9A 4ZXGA 1OE7A 1K0MA 4GQCA 2LNTA 5HR2A 4FYCA 3GA4A 3ZIVA 1TRVA 2PMTA 4ULXA 1A0FA 1B4QA 4TR1A 5DCHA 1T8EB 3UEMA 3ERWA 4HZ2A 4PQHA 5EL8A 3G7IA 2I81A 5A4VA 2E0QA 1HQOA 4TR4A 5C00A 1J9BA 3PH9A 3J7Yk 3KP9A 4HEA2 5D9TA 4KCEA 4MPFA 3ZYWA 4Q5FA 2JSYA 4F0BA 4YQVA 3A2XA 3EURA 1QXHA 3R3EA 1XWCA 5A5KA 3VWXA 3GSSA 4N11A 4I6XA 4RI6A 1SL1B 1TK8B 3DVXA 2H70A 3NZNA 1B9XC 1MD3A 4K1FA 1KBNA 3FY7A 3GH9A 2FWHA 4KGIA 4KSMA 2DJ0A 1NM3A 2DIYA 2CZ3A 3NOFA 4KE3A 2GZZA 2N5BA 5DVBA 1JZWA 3F6FA 3KM6A 2CQ9A 2F9SA 2H0IA 1NSWA 4TR3A 1K0NA 3UBLA 3IOSA 2HE3A 3FEUA 1EV4A 3CBUA 4OCEA 4G0LA 3SWLA 1HNAA 4NHWA 3MSZA 4RQXA 5D96A 2VCZA 2FCHA 1GRXA 4K0NA 2CVBA 2AV4A 4J56E 2HI7A 1XVWA 2H6YA 1FHEA 3D22A 3PPUA 2N5AA 3VWVA 5LCZA 3LJRA 3HVVA 1R5PA 4EC0A 5CAXA 4BVYA 1GSEA 4P3YB 4PURA 3US3A 3NIVA 2XPDA 4DSSA 3F0IA 1OAZA 1SKRB 1Z5YE 4MF7A 2MMOA 5B7CA 2DBCA 2ZCTA 4EDZA 4K7OA 4DEJA 2IMKA 1HYUA 5J9BA 1ZYQB 2RUEA 6GSSA 5HR0A 2NTOA 1GSFA 2GZPA 2VCWA 1TK0B 4GLTA 3MAKA 3IPZA 2P0GA 4D73B 1V57A 3UBKA 4RUVA 4POLA 3CTFA 4ML6A 3QCPA 1S3DA 1M2AA 1JZDA 3GKNA 2ON5A 3RPNA 1A24A 2IMFA 1PKWA 2D2ZA 4MJBA 4YH2A 3ISOA 5H5QA 4IJIA 1OC9A 2P31A 3TKPA 4MZBA 4MCUA 3C8EA 2OE3A 3GX0A 1TI1A 1LU4A 5LNKe 5DDLA 5ELGA 4IP1A 4K6XA 1Z3EA 4MJCA 1GTBA 4KW6A 1DE2A 4JEDA 3G7YA 2FA4A 4OO5A 4LMWA 2HNLA 5ELAA 4EF0A 1Z9HA 1PMTA 2LQOA 4NAXA 1UN2A 1O8WA 2RM5A 5GSSA 2ON7A 1FW1A 3N9JA 4X1UA 5CREA 2EIQA 3WT1A 2FD3A 2K8VA 2MBTA 1GLPA 2DSAA 4HZ4A 1ZCPA 4XCSA 3LQ7A 1O85A 2LUSA 2HSMB 1X9SB 4I8BA 5KEJA 3ZVJA 1TTZA 4MJAA 1BAYA 3GL3A 1K0CA 4JBBA 2CX3A 3PINA 1XWAA 2V32A 3KEBA 4MPGA 3Q6OA 3HCZA 5B6NA 4IW9A 3TCOA 4FQUA 2RIIA 1QK8A 1TI3A 1M7TA 2G0FA 3KGKA 1U3IA 1WPIA 4K7IA 4L5LA 1ILOA 1ZYEA 4V2MA 1SL2B 5JWOB 2HSYA 5JCGA 3TDGA 3CRTA 4ACSA 4IGJA 5DJMA 2KLXA 1GP1A 3VFIA 3U6VA 1YKCA 3IHQA 4Q5QA 1GSDA 1KNGA 3APOA 1W89A 4H86A 2PGTA 2KUCA 2VL3A 4BVYB 4KF9A 4YAPA 2OA7A 1BQ7A 1UA5A 3KTLA 2IMEA 5EVOA 1M9AA 5ECMB 3D4TA 2MMNA 2V2GA 3D0ZA 5IMAA 3WGDA 3M1GA 3DWVA 4PXOA 1G7EA 2K6VA 1BG5A 1SJZA 2REMA 4WR4A 1R7HA 4HOJA 5F06A 3GYKA 1W4VA 1PGTA 3F6DA 1XOAA 2OKAA 1OC9B 3CYNA 4ZBDA 14GSA 2A2SA 1ZL9A 1YZXA 3EMPA 3LGCA 3ZRDA 3EWLA 4GWRA 1PD21 5GZZB 4DSQA 4NPBA 4NV2A 4KUNA 1F3BA 4MZWA 3HVXA 4TXOA 1YF0A 2VCQA 2ZUPA 2YV9A 1MEKA 4PTSA 4KDUA 5D73A 1HNCA 4PX1A 4WXTA 4XS6A 1XXUA 2FLSA 6GSVA 5G5EA 5IQYA 5CRHA 1X9MB 1SYXA 4YQUA 2J9HA 4KH7A 3ME8A 2VM2A 3A5WA 4NV5A 3LYKA 4TRXA 4O32A 3O3TA 3GSTA 3D4MA 1ST9A 2OACA 1U3AA 2GS3A 1Z7PA 2CVDA 1A0RP 4XIHA 4GSTA 2L57A 2LTKA 4I97A 2FNOA 3E9JB 5D9XA 1RW1A 2WULA 2VD0A 1QUWA 4OMVA 1WIKA 1LBKA 5ECIB 1T7PB 3A2VA 4POKA 1O73A 4BWQA 3ZFBA 1ZGNA 1TK5B 5CRGA 1DBYA 2GQMA 4WR5A 3L9SA 2H74A 2HZEB 2WJUA 5HFGA 1O6JA 1HD2A 3GV1A 1SKWB 3HJMA 3L78A 1SJIA 4NXIA 4ML1A 4K8MA 1V58A 4F82A 1G7OA 1UC7A 2HXKA 2HSHA 4CW9A 3DIEA 2B7KA 4G2EA 2O87A 4WF4A 4QQ7A 3IRAA 2IMDA 3VURA 2JZSA 2VO4A 4N30A 1PX6A 4D73A 5CO3A 3FYGA 3ZMLA 4MP4A 3TKSC 2YOIA 4ECBA 4IVFA 1AAZA 1Y6EA 3UARA 1EZKA 2DJJA 3D5JA 3GTUB 3WD6A 3FZ9A 4KB3A 2GSTA 2OBIA 4GSSA 2H71A 5IPGA 3L4NA 5ECRB 4WKWA 4OCFA 5JCUA 5CRDA 1Y25A 1K0AA 3L9UA 2DMMA 2H1AA 1V98A 1SL0B 3DD3A 1NHYA 4KA0A 3FZAA 1R4WA 4EKZA 4G19A 1GSQA 4EXJA 1B48A 2H73A 3I43A 2GVPA 2LEGA 1TJDA 4WETA 3EYTA 5D9VA 5AISA 4K9ZA 2C0GA 2AAWA 2DIZA 3F4TA 2PBJA 5AGYA 5G1KA 1N8JA 2PUKC 4V1Ap 5B8BA 3WYWA 2R3XA 22GSA 2HSMA 4NWYA 4XS1A 3DGQA 3IC4A 1IYIA 4TW5A 3HXSA 5KN1A 2QKEA 2VAFA 1SENA 1SJ6A 5GAPD 3VI5A 1XWGA 2JADA 3IDVA 4TXOB 4K2DA 3KXOA 2FUG2 1F6MC 1WJKA 1V40A 5AIXA 2J23A 3KH9A 6GSTA 2IWTA 2X64A 5B8AA 20GSA 1A2LA 1NW2A 1XPVA 4BWSA 2YJ7A 3QD9A 1TKDB 2XHFA 1TRSA 2C0EA 4MF5A 1ERVA 5ECNB 4ZL8A 1PKZA 2H8LA 1T4ZA 3KIJA 1BEDA 2VIMA 2HT9A 3ZFLA 3SBCA 1YY7A 3F63A 1F9MA 2L6CA 1TRWA 2VL2C 3GKKA 4KX4A 4PNFA 5J41A 2L4CA 3GL5A 3W8SA 2WDUA 1KTEA 2KOKA 4PGTA 2F8FA 1Q4JA 2AJQB 4X43A 5A4UA 1E2YA 1M99A 1I9DA 5G30A 1C72A 4IBPA 5IMDA 4BL7B 4BPYA 4O92A 3IA1A 5DQYA 4PQ1A 5FHIA 4OD7A 4ZILA 4IQAA 1Z6NA 2WCIA 1X0RA 3FZ5A 1WRYA 4I2UA 9GSSA 3TJBA 2VOCA 3FHKA 6GSUA 4KDYA 3CTGA 1XW5A 5CYYA 2VCXA 4E8HA 4LMVA 2H6XA 2GQKA 1EEJA 3C71A 5ECOB 5DAKB 3GH6A 2IN3A 2BJXA 2G2QA 5BMUA 3ERGA 2X8CA 1FO5A 6GSWA 3Q18A 1FG4A 3UJ1A 3D6IA 1WWJA 2AUVA 3QFAC 3FR9A 4IKHA 2KHPA 1YJ6A 2I4AA 3LXTA 5CRWA 2HYXA 2H01A 1EGOA 2I3YA 2PVOC 1XVQA 1WP0A 4HS1A 1R5AA 6GSYA 2YANA 4AGSA 2I9HA 2YZHA 3QFBC 2L59A 4OO4A 5F0GA 1NHOA 2H72A 2XBQA 2VCTA 3FZ4A 1XZOA 3TOUA 3E3EA 1JHBA 4IELA 1OYJA 2HQTA 3FK8A 4XRAA 5FWGA 2CAIA 4IS0A 3H1NA 4MK3A 3CXGA 4QL9A 4KSOA 2JACA 3L9VA 3TB2A 2YWOA 1GULA 2OE0A 13GSA 1M2BA 3LFLA 5DBQA 1BYEA 2KP2A 1S3CA 4Z7XA 1YQ1A 1PL1A 2HSNB 1GWCA 2YZUA 5DQSA 2B7JA 1K0DA 1ZMAA 1YF1A 2DLXA 1G6YA 3EU4A 4HUAA 2B6MA 1TP9A 2FWFA 3RHCA 3LWAA 1GLQA 4FH8A 3DKSA 2TRCP 4ECJA 4KAEA 1U6TA 3EC3A 5HFIA 1SU9A 5B6MA 1JLWA 2RM6A 4MLYA 2C0FA 2EC4A 3UVHA 1XW6A 2LRCA 3Q19A 1GTUA 3QAGA 3CSHA 4ZBAA 3UAPA 6GSXA 5EY6A 3ZIJA 4KCAA 1EWXA 2HZEA 3EINA 2M46A 1OE8A 1TDIA 3IAM2 1YDKA 3IK7A 4XS4B 4GXZA 4LLRA 2L5LA 5J9CA 4ECIA 1FB0A 5GAND 4GCIA 2VD1A 5A4WA 2R4VA 2DMLA 4MMMA 1VF4A 4F03A 3HA9A 1AW9A 3C73A 1XWKA 3M0FA 3TRPA 3BCKA 3LSZA 5J3RA 1EEMA 4Q5NA 4ZB9A 1H4OA 1OC3A 1V2AA 4DVCA 3EMXA 1S3AA 3GTUA 3BJ5A 4FYUA 2ALBA 2H76A 2M80A 2PPTA 1RQMA 2TRXA 1K3YA 3M3MA 5JWQB 3Q74A 1JFUA 2VLUA 3J7Yb 2OJLA 2I1UA 1B8XA 1DE1A 4AJ7A 2RUFA 4FO5A 5IPHA 1CQGA 4O7HA 1JLVA 4ZIJA 4MZCA 1AQWA 3GX8A 1VF2A 4F9ZA 4FIWA 3LXZA 2K8SA 1FB6A 2X99A 4AJ8A 4F2IA 19GSA 5G5FA 1EGRA 1TXXA 1A2JA 4JR4A 2WZ9A 2YN1A 3LORA 5IOXA 1X5CA 2LRNA 4EL1A 1WOUA 1THXA 3GKXA 5ECLB 1PX7A 2GTUA 2GLRA 1GSSA 1ACVA 3TRXA 4NHZA 3P7XA 2P5RA 3BOAA 4F0CA 4IHUA 2K9FA 2C80A 2DJ1A 2JSZA 1A8YA 3DXBA 5G2ZA 3R2QA 4TR0A 4XRDA 3VWUA 1MD4A 3GN3A 4WBRD 2AB6A 3QAWA 3GNJA 2P5QA 1U88A 3TGZA 1PQNA 2IIYA 4X0XA 5J4UA 4PUAA 2IFQB 2XPEA 4G10A 3BCIA 4GF0A 3O76A 1TOFA 4GRFA 1O8XA 1X5EA 3KZQA 3IXRA 1K0OA 1XW9A 2JL4A 2L5OA 4OFMA 5ENUA 3F3QA
chains in the Genus database with same CATH superfamily
3L0HA 3WGEA 2WRTA 1FOVA 4QL7A 4BL7A 3E0UA 4TXVA 3CMIA 1PA3A 3C7MA 4N10A 1GUHA 2MMAA 5CP1A 1T1VA 1EP7A 12GSA 2QC7A 3UVTA 1EP8A 2CX4A 5AN1A 2H1DA 1TU8A 2HRAA 1HNBA 3S9FA 1M3IA 4BA7A 3JCML 2EIOA 4GSNA 1Z7RA 1YEXA 2R37A 5IIZA 1ERTA 3APQA 1QFNA 2Z9SA 4KNDA 18GSA 3I69A 2R0PA 1YEWC 5IMVA 4K7NA 3ZLPA 2DJ2A 5DALA 1TU7A 5DAKA 1XFLA 2VM1A 1TXUA 2F51A 1AC1A 1YEPA 4N0ZA 5J4VA 1ZOFA 4LL1B 3WGXA 1F37A 2F8AA 1M2DA 2GT5A 2WGRA 4N0VA 3VK9A 2PERA 3CQFA 3M8NA 3RPPA 1XCCA 2C3NA 1SD9A 2YWMA 4GTUA 4EO3A 3HJOA 1EOGA 1QGVA 1SD8A 2O7KA 2H1GA 3W8JA 3IC8A 4BVXB 1JZOA 2FWEA 3UL3A 3UMAA 3D21A 4NMUA 4DSRA 3CRUA 2OBKA 3ED3A 2HRKB 2HFDA 2LKUA 4MA9A 4ILFA 1X9WB 1E6BA 1T3BA 2HRFA 2NPBA 2MZCA 4IN0A 4MNNA 5HR1A 4HU7A 2C8UA 3H4KA 3TOTA 2GT6A 2H30A 3UIWA 2N5FA 5F8BA 2YWNA 2HSNA 5ID2A 1U87A 1GUKA 5JWRB 3F3RA 2WB9A 1PL2A 3HY2A 4ZB8A 1GH2A 1QQ2A 4TN8A 4HI7A 2VCVA 1WMJA 4ID0A 4LL4B 4RI7A 1F3AA 5C04A 2LJRA 3IHGA 2MMZA 5JCWA 1AQVA 1XOBA 2H0HA 4AF2A 2K18A 3GFKA 5G31A 2B5YA 3GURA 2HZFA 5HFKA 3F4SA 5IMZA 5H5RA 2QSIA 4POMA 4HJMA 3HZ4A 3V1WA 5E4WA 3I9V2 4HU9A 3ZTLA 16GSA 3TKSE 3TRQA 2DJ3A 2KP1A 3K8NA 4HQSA 1I1IP 3VPQA 2ES7A 3KMOA 4EUYA 3RDWA 1Z6MA 1MDIA 1MDJA 2H19A 3DYRA 4XS4A 2IL3A 3VWWA 2CAQA 4HJ2A 2VUPA 4OFNA 4XTSA 2FA8A 3GIXA 1GL8A 2WVYA 4Z2TA 2FWGA 1USBA 2YNXA 2HRNA 2E2GA 4RQRA 4G01A 2EFCA 3TJGA 3P2AA 2JZRA 2H0GA 1O81A 3RHBA 1SK2A 4FYBA 5IO2A 5D9WA 1BX9A 5ECSA 2DJKA 2CVKA 1K3OA 4EE0A 5DJLA 3MWHA 5DALB 4TOPA 1OKTA 4ISDA 1H75A 1UVZA 4EDYA 3TU3B 4JU5A 5ABRA 2C4JA 3FR3A 4I2TA 2LJKA 3TUEA 3LG6A 4J2FA 4L5OA 1OKDA 4FXYP 1LJRA 5D8IA 4CDOA 1SK0A 2JZTA 4ZL7A 1SYRA 1IYHA 1QMVA 2GSSA 1T00A 1WE0A 2E2MA 1A8LA 2LRTA 5A34B 4KDXA 2OADA 3VI7A 1XWBA 1N2AA 1FVJA 5HQPA 3ZVJD 1EOHA 1I5GA 4JR6A 1MDKA 1OVNA 2PVQA 2GQLA 3F8UA 7GSSA 5F07A 1VF3A 4E8EA 2R5GA 4G9HA 2B1LA 4W66A 4EVMA 2DC5A 4ZB6A 2YPMA 1OC8A 4JRRA 3HJPA 2R2JA 2C1YA 3M9KA 2O89A 1O7UA 3RGBC 4ZBBA 3TJFA 5IMFA 5G1LA 4TVEA 3KH7A 2EIRA 1ZZYA 2LJAA 3G7JA 4HQZA 4CY6A 3VPTA 2YWIA 3DEXA 3QPMA 4K0GA 3GMFA 5CNWA 5ID2B 4TR1B 1F2EA 3KCMA 11GSA 3PGTA 2TIRA 2FY6A 2LNSA 1ERUA 2IFQA 8GSSA 1SK1A 4MABA 3QAVA 3IAS2 1T4YA 4IP6A 2RLIA 5L71A 4MH2A 2MYGA 3TKSA 3HKRA 2B5XA 1V9WA 1RK4A 1PN9A 1M3JA 1GTIA 3OR5A 3ZREA 3LYPA 4G0KA 3LEFA 2O85A 3CSJA 2WS2A 5LD0A 2V6OA 5HR3A 2WW3A 2CZ2A 4JE1A 4L0WA 2VL9A 2CA8A 4ZL9A 1DSBA 4XHMA 2L6DA 2R6KA 3AY8A 2B3SA 3DVWA 2LSTA 3EU3A 2PU9C 5E59A 2A4HA 1AUCA 4G0IA 3HVSA 2NDOA 3UOMA 1YKAA 3H79A 2C3QA 2LS5A 4O5RA 1ERWA 4YAVA 3DRNA 3EE2A 2OE1A 3F9UA 1K0BA 3HD5A 3PR8A 4PHZC 1GSUA 2CV4A 1ML6A 3IBHA 2PWJA 5DCGA 2MBSA 5IO0A 3A2WA 4POBA 2VLVA 4IQ1A 3P90A 2XC2A 4PNGA 4BVXA 3GRXA 2GSRA 1BF5A 4CHSA 5INYA 2GZYA 3FRCA 1FOHA 3HHVA 1K3LA 4MH3A 4DSSB 2HRKA 1ABAA 3IE3A 4OFTA 2ZNMA 3N5OA 1GSYA 2YJHA 3LW9A 5KN2A 3ZITA 5KN3A 4L8EA 2X8HA 3VLNA 4AJ6A 4QMKA 1GNEA 1AXDA 2PN8A 1ON4A 1AIUA 2VL2A 1CQHA 1XBSA 5ECQB 5J5NA 2QGVA 4LA1A 2F3MA 3A5IA 3GKMA 1G0TA 2B5EA 1KEBA 5IMCA 1R26A 4EIQA 4JZQA 2AYTA 1JZRA 1URMA 1Q98A 5GSTA 4HDEA 1GTAA 3TKQA 3FW2A 3FKFA 2O5VA 5AIVA 2XBIA 4J57E 1TRUA 5ECPB 3EVIA 4WBJA 4L0UA 3RBTA 3H93A 4I5QA 2GSQA 3GHAA 2V6KA 4PQIA 2YP6A 2YV7A 2V1MA 4PUFC 3P8WA 2A4VA 1A2MA 4USSA 2WFCA 5ECHB 3F4RA 1M9BA 4OWYA 1VRSD 3I6AA 5FT3A 3RFRC 2BMXA 3MDKA 2JU5A 3MYDA 4AKXB 1G6WA 2LV3A 3M9JA 2IJYA 3ZL5A 3A3TA 4YQMA 3BD2A 3TJJA 2DKIA 5H5SA 1TW9A 2WW0A 3DMLA 4WEYA 2BTOT 4MF6A 3GUSA 4ECCA 2IMIA 3BBYA 2M72A 5ECKB 4V2NA 3ZMKA 3HZ8A 2FHEA 2A2RA 5IOWA 2H1BA 3APSA 2UV8G 3HYPA 2V41A 3HDCA 1EV9A 3W6GA 2A2PA 1PSQA 3KMNA 3FR6A 3G9BA 3KD0A 1A23A 1GNWA 1FAAA 3O6TA 3IV4A 2H66A 2H6ZA 1X5DA 3QOUA 4Q5RA 3RAZA 3ZZXA 4IJ3A 2C0DA 2HLSA 10GSA 3C1SA 3KP8A 1AQXA 1PRXA 2LQQA 3QMXA 1J0FA 2FGXA 3CSIA 3QR6A 3U5RE 4GQFA 1SKSB 1VF1A 2NVLA 3TKRA 2X8GA 1GUMA 4TKYA 2NBSA 1VGLA 5EPFA 5COHA 2CT6A 3IR4A 2GDRA 4MJEA 1THOA 1BJXA 5KN0A 3KTBA 1M0UA 5A34A 4V2LA 4MDCA 1ZYPA 3ME7A 3H8QA 3MNGA 2AHEA 5IM9A 2UZ8A 1MTCA 1B9YC 1XIYA 2L4QA 1DUGA 3KJYA 3QDNA 5KOWA 2GGTA 3TJKA 2E7PA 5F05A 3C1RA 2C3TA 17GSA 1SVLA 2IPAA 4WF5A 5D93A 3ERFA 1J08A 2R0CA 2VLTA 3WT2A 2YCDA 2B1KA 2H75A 4V1Ag 1FVKA 1B4PA 2O8VB 3IK9A 4ZXGA 1OE7A 1K0MA 4GQCA 2LNTA 5HR2A 4FYCA 3GA4A 3ZIVA 1TRVA 2PMTA 4ULXA 1A0FA 1B4QA 4TR1A 5DCHA 1T8EB 3UEMA 3ERWA 4HZ2A 4PQHA 5EL8A 1PFOA 4N3ZA 3G7IA 2I81A 5A4VA 2E0QA 4Z2UA 1HQOA 4TR4A 5C00A 1J9BA 3PH9A 3J7Yk 3KP9A 4HEA2 5D9TA 4KCEA 4MPFA 3ZYWA 4Q5FA 2JSYA 4F0BA 4YQVA 3A2XA 3EURA 1QXHA 3R3EA 1XWCA 5A5KA 3VWXA 3GSSA 4N11A 4I6XA 4RI6A 1SL1B 1TK8B 3DVXA 2H70A 3NZNA 1B9XC 1MD3A 4K1FA 1KBNA 3FY7A 3GH9A 2FWHA 4KGIA 4KSMA 2DJ0A 1NM3A 2DIYA 2CZ3A 3NOFA 4KE3A 2WVXA 2GZZA 2N5BA 5DVBA 1JZWA 3F6FA 3KM6A 2CQ9A 2F9SA 2H0IA 1NSWA 4TR3A 1K0NA 3UBLA 3IOSA 2HE3A 3FEUA 1EV4A 2H1LA 3CBUA 4OCEA 4G0LA 3SWLA 1HNAA 4AKIA 4NHWA 3MSZA 4RQXA 5D96A 2VCZA 2FCHA 1S4BP 1GRXA 4K0NA 2CVBA 2AV4A 4J56E 2EFHA 2HI7A 1XVWA 2H6YA 1FHEA 3D22A 3PPUA 2N5AA 3VWVA 5LCZA 3LJRA 3HVVA 1R5PA 4EC0A 5CAXA 4BVYA 1GSEA 4P3YB 4PURA 3US3A 3NIVA 2XPDA 4DSSA 3F0IA 1OAZA 1SKRB 1Z5YE 4MF7A 2MMOA 5B7CA 2DBCA 2ZCTA 4EDZA 4K7OA 2WVZA 4DEJA 2IMKA 5A5HB 1HYUA 5J9BA 1ZYQB 2RUEA 6GSSA 5HR0A 2NTOA 1GSFA 2GZPA 2VCWA 1TK0B 4GLTA 3MAKA 3IPZA 2P0GA 4D73B 1V57A 3UBKA 4RUVA 4POLA 3CTFA 4PI0C 3QCPA 4ML6A 1S3DA 3MIXA 1M2AA 1JZDA 3GKNA 2ON5A 3RPNA 1A24A 2IMFA 1PKWA 2D2ZA 4MJBA 4YH2A 3ISOA 5H5QA 4IJIA 1OC9A 2P31A 3TKPA 4MZBA 4MCUA 3C8EA 2OE3A 3GX0A 1TI1A 1LU4A 5LNKe 5DDLA 5ELGA 4IP1A 4K6XA 1Z3EA 4MJCA 1GTBA 4KW6A 1DE2A 4JEDA 3G7YA 2FA4A 4OO5A 4LMWA 2HNLA 5ELAA 4EF0A 1Z9HA 1PMTA 2LQOA 4NAXA 1UN2A 1O8WA 4E68A 2RM5A 5GSSA 3CHXC 2ON7A 1FW1A 3N9JA 4X1UA 5CREA 2EIQA 3WT1A 1S3RA 2FD3A 2K8VA 2QA1A 2MBTA 1GLPA 2DSAA 4HZ4A 1ZCPA 4XCSA 3LQ7A 1O85A 2LUSA 2HSMB 1X9SB 4I8BA 4HSCX 4O5UA 5KEJA 3ZVJA 1TTZA 4MJAA 1BAYA 3GL3A 1K0CA 4JBBA 2CX3A 3PINA 1XWAA 3KEBA 2V32A 4PI2C 4MPGA 3Q6OA 3HCZA 5B6NA 4IW9A 3TCOA 4FQUA 2RIIA 1QK8A 1TI3A 1M7TA 4Z2RA 2WVXB 2G0FA 3KGKA 1U3IA 1WPIA 4K7IA 4L5LA 1ILOA 1ZYEA 4V2MA 1SL2B 5JWOB 2HSYA 5JCGA 3TDGA 3CRTA 4GDFA 4ACSA 4IGJA 1XG8A 5DJMA 2KLXA 1GP1A 3VFIA 3U6VA 1YKCA 3IHQA 4Q5QA 1GSDA 1KNGA 3APOA 4K5RA 1W89A 4H86A 1ZYNA 2PGTA 2KUCA 2VL3A 2EFDA 2DKHA 4BVYB 4KF9A 5A1NA 4YAPA 2OA7A 1BQ7A 1UA5A 3KTLA 2IMEA 5EVOA 1M9AA 5ECMB 3D4TA 2MMNA 2V2GA 3D0ZA 5IMAA 3WGDA 3M1GA 3DWVA 4PXOA 5BMUB 4ICYA 1G7EA 2K6VA 1BG5A 1SJZA 2REMA 4WR4A 1R7HA 4HOJA 5F06A 3HVNA 3GYKA 1W4VA 1PGTA 3F6DA 1XOAA 2OKAA 1OC9B 3CYNA 4ZBDA 14GSA 2A2SA 1ZL9A 1YZXA 1Y1UA 3EMPA 3LGCA 3ZRDA 3EWLA 4GWRA 1PD21 5GZZB 4DSQA 4NPBA 4NV2A 2WZSA 4KUNA 1F3BA 4MZWA 3HVXA 4TXOA 1YF0A 2VCQA 2ZUPA 2YV9A 1MEKA 4PTSA 4KDUA 5D73A 1HNCA 4PX1A 4WXTA 4XS6A 4ZB7A 1XXUA 2FLSA 6GSVA 5G5EA 5IQYA 5CRHA 1X9MB 1SYXA 4YQUA 2J9HA 4KH7A 3ME8A 2VM2A 3A5WA 4NV5A 5J4YA 4O5QA 3LYKA 4TRXA 4O32A 3O3TA 3GSTA 3D4MA 1ST9A 2OACA 1U3AA 2GS3A 1Z7PA 2CVDA 1A0RP 4XIHA 4GSTA 2L57A 2LTKA 4I97A 2FNOA 3E9JB 5D9XA 1RW1A 2WULA 2VD0A 1QUWA 4OMVA 1WIKA 1LBKA 5ECIB 1T7PB 3A2VA 4POKA 1O73A 4BWQA 3ZFBA 1ZGNA 1TK5B 5CRGA 1DBYA 2GQMA 4WR5A 3L9SA 2H74A 2HZEB 2WJUA 5HFGA 1O6JA 1HD2A 3GV1A 1SKWB 3HJMA 3L78A 1SJIA 2VKZG 4EIPA 4NXIA 4ML1A 2O36A 4K8MA 1V58A 4F82A 5A5HA 1G7OA 1UC7A 2HXKA 2HSHA 4CW9A 3DIEA 2B7KA 4G2EA 3EPTA 2O87A 4WF4A 4QQ7A 3IRAA 2IMDA 3VURA 2JZSA 4X4JA 2VO4A 4N30A 1PX6A 4D73A 5CO3A 3FYGA 3ZMLA 4MP4A 3TKSC 5A1NB 2YOIA 4ECBA 4IVFA 1AAZA 1Y6EA 3UARA 1EZKA 2DJJA 3D5JA 3GTUB 3WD6A 3FZ9A 4KB3A 4AKGA 2GSTA 2OBIA 4GSSA 2X4AA 2H71A 5IPGA 3L4NA 5ECRB 4WKWA 4OCFA 5JCUA 5CRDA 1Y25A 1K0AA 3L9UA 2DMMA 2H1AA 1V98A 1SL0B 3DD3A 1NHYA 4KA0A 3FZAA 1R4WA 4EKZA 4G19A 1GSQA 4EXJA 1B48A 2H73A 3I43A 2GVPA 2LEGA 1TJDA 4WETA 3EYTA 5D9VA 5AISA 4K9ZA 2C0GA 2AAWA 2DIZA 2WW2A 3F4TA 2PBJA 5AGYA 5G1KA 1N8JA 2PUKC 4AKHA 4V1Ap 5B8BA 3WYWA 2R3XA 22GSA 2HSMA 4NWYA 4XS1A 3DGQA 3IC4A 1IYIA 4TW5A 3HXSA 5KN1A 2QKEA 2VAFA 1SENA 1SJ6A 5GAPD 3VI5A 1XWGA 2JADA 3IDVA 4TXOB 4K2DA 3KXOA 2FUG2 1F6MC 1WJKA 1V40A 5AIXA 2J23A 3HMJG 3KH9A 6GSTA 2EFEA 2IWTA 2X64A 5B8AA 20GSA 1A2LA 1NW2A 1XPVA 2R0GA 2YJ7A 4BWSA 3QD9A 1SVMA 1TKDB 4CY8A 2XHFA 1TRSA 2C0EA 4MF5A 1ERVA 5ECNB 4A5PA 4ZL8A 1PKZA 2H8LA 1T4ZA 3KIJA 4K5SA 1BEDA 2VIMA 2HT9A 3ZFLA 3SBCA 1YY7A 3F63A 1F9MA 2L6CA 1TRWA 2VL2C 3GKKA 4KX4A 4PNFA 5J41A 2L4CA 3GL5A 3W8SA 2WDUA 1KTEA 2KOKA 4PGTA 2F8FA 1Q4JA 2AJQB 4X43A 5A4UA 1E2YA 1M99A 1I9DA 5G30A 1C72A 4IBPA 5IMDA 4BL7B 4BPYA 4O92A 3IA1A 5DQYA 4PQ1A 5FHIA 4OD7A 4ZILA 4IQAA 1Z6NA 2WCIA 1X0RA 2OT3A 1SVOA 3FZ5A 1YVLA 1WRYA 4I2UA 9GSSA 3TJBA 2VOCA 3FHKA 6GSUA 4KDYA 3CTGA 1XW5A 5CYYA 2VCXA 4E8HA 4LMVA 2H6XA 2GQKA 1PN0A 1EEJA 3C71A 5ECOB 5DAKB 3GH6A 2IN3A 2BJXA 2G2QA 5BMUA 3ERGA 2X8CA 1FO5A 6GSWA 3Q18A 1FG4A 3UJ1A 3D6IA 1WWJA 2AUVA 3QFAC 3FR9A 4IKHA 2KHPA 1YJ6A 2I4AA 3LXTA 5CRWA 5KOXA 2HYXA 2H01A 1EGOA 2I3YA 2PVOC 1XVQA 4YKFA 1WP0A 4HS1A 1R5AA 6GSYA 2YANA 4AGSA 2I9HA 2YZHA 3QFBC 2L59A 1N25A 4OO4A 5F0GA 1NHOA 2H72A 2XBQA 2VCTA 3FZ4A 1XZOA 3TOUA 3E3EA 1JHBA 4IELA 1OYJA 2HQTA 3FK8A 4XRAA 5FWGA 2CAIA 4IS0A 3H1NA 4MK3A 3CXGA 4QL9A 4KSOA 2JACA 3L9VA 3TB2A 2YWOA 1GULA 2OE0A 13GSA 1M2BA 3LFLA 4BIKA 5DBQA 1BYEA 2KP2A 1S3CA 4Z7XA 1YQ1A 1PL1A 2HSNB 5J40A 1GWCA 2YZUA 5DQSA 2B7JA 1K0DA 1ZMAA 1YF1A 2DLXA 1G6YA 3EU4A 4HUAA 2B6MA 1TP9A 2FWFA 3RHCA 3LWAA 1GLQA 4FH8A 3DKSA 2TRCP 4ECJA 4KAEA 1U6TA 3EC3A 5HFIA 1SU9A 5B6MA 1JLWA 2RM6A 4MLYA 2C0FA 2EC4A 3UVHA 1XW6A 2LRCA 3Q19A 1GTUA 3QAGA 3CSHA 4ZBAA 2WW1A 3UAPA 6GSXA 5EY6A 3ZIJA 4KCAA 1EWXA 2HZEA 3EINA 2M46A 1OE8A 1TDIA 3IAM2 1YDKA 3IK7A 4XS4B 4GXZA 4LLRA 2L5LA 5J9CA 4ECIA 1FB0A 5GAND 4GCIA 2VD1A 5A4WA 2R4VA 2DMLA 4MMMA 1VF4A 4F03A 3HA9A 1AW9A 3C73A 5J47A 4YKGA 1XWKA 3M0FA 3TRPA 3BCKA 3LSZA 5J3RA 1EEMA 4Q5NA 4ZB9A 1H4OA 1OC3A 1V2AA 4DVCA 3EMXA 1S3AA 3GTUA 3BJ5A 4FYUA 2ALBA 2X49A 2H76A 2M80A 2PPTA 1RQMA 4K2XA 2TRXA 1K3YA 3M3MA 5JWQB 3Q74A 1JFUA 2VLUA 3J7Yb 2OJLA 2I1UA 1B8XA 1DE1A 4AJ7A 2RUFA 4FO5A 5IPHA 1CQGA 4O7HA 1JLVA 4ZIJA 4MZCA 1AQWA 3GX8A 1VF2A 4F9ZA 4FIWA 3LXZA 2K8SA 1FB6A 2X99A 4AJ8A 4F2IA 3CWGA 19GSA 5G5FA 1EGRA 2O3EA 1TXXA 1A2JA 4JR4A 2WZ9A 2YN1A 3LORA 5IOXA 1X5CA 2LRNA 4EL1A 1WOUA 1THXA 3GKXA 5ECLB 3FMWA 1PX7A 2GTUA 2GLRA 1GSSA 1ACVA 3TRXA 4NHZA 3P7XA 2P5RA 3BOAA 4F0CA 4IHUA 2K9FA 2C80A 2DJ1A 2JSZA 1A8YA 3DXBA 2QA2A 5G2ZA 5BRTA 3R2QA 4TR0A 4XRDA 3VWUA 1MD4A 3GN3A 4WBRD 2AB6A 3QAWA 3GNJA 2P5QA 1U88A 3TGZA 1PQNA 2IIYA 4X0XA 5J4UA 4PUAA 1BG1A 2IFQB 2XPEA 4G10A 3BCIA 4GF0A 3O76A 1TOFA 4AI6A 4GRFA 1O8XA 1X5EA 3KZQA 3IXRA 1K0OA 1XW9A 2JL4A 2L5OA 4OFMA 5ENUA 3F3QA
chains in the Genus database with same CATH topology
3L0HA 3WGEA 2WRTA 1FOVA 4QL7A 4BL7A 3E0UA 4TXVA 3CMIA 1PA3A 3C7MA 4N10A 1GUHA 2MMAA 5CP1A 1T1VA 1EP7A 12GSA 2QC7A 3UVTA 1EP8A 2CX4A 5AN1A 2H1DA 1TU8A 2HRAA 1HNBA 3S9FA 4BA7A 3JCML 2EIOA 4GSNA 1Z7RA 1YEXA 2R37A 5IIZA 1ERTA 3APQA 1QFNA 2Z9SA 4KNDA 18GSA 3I69A 2R0PA 5IMVA 4K7NA 3ZLPA 2DJ2A 5DALA 1TU7A 5DAKA 1XFLA 2VM1A 1TXUA 2F51A 1AC1A 1YEPA 4N0ZA 5J4VA 1ZOFA 4LL1B 3WGXA 1F37A 2F8AA 1M2DA 2GT5A 2WGRA 4N0VA 3VK9A 2PERA 3M8NA 3RPPA 1XCCA 2C3NA 1SD9A 2YWMA 4GTUA 4EO3A 3HJOA 1EOGA 1QGVA 1SD8A 2O7KA 2H1GA 3W8JA 3IC8A 4BVXB 1JZOA 2FWEA 3UL3A 3UMAA 3D21A 4NMUA 4DSRA 3CRUA 2OBKA 3ED3A 2HRKB 2HFDA 2LKUA 4MA9A 4ILFA 1X9WB 1E6BA 1T3BA 2HRFA 2NPBA 2MZCA 4IN0A 4MNNA 5HR1A 4HU7A 2C8UA 3H4KA 3TOTA 2GT6A 2H30A 3UIWA 2N5FA 5F8BA 2YWNA 2HSNA 5ID2A 1U87A 1GUKA 5JWRB 3F3RA 2WB9A 1PL2A 3HY2A 4ZB8A 1GH2A 1QQ2A 4TN8A 4HI7A 2VCVA 1WMJA 4ID0A 4LL4B 4RI7A 1F3AA 5C04A 2LJRA 3IHGA 2MMZA 5JCWA 1AQVA 1XOBA 2H0HA 4AF2A 2K18A 3GFKA 5G31A 2B5YA 3GURA 2HZFA 5HFKA 3F4SA 5IMZA 5H5RA 2QSIA 4POMA 4HJMA 3HZ4A 3V1WA 5E4WA 3I9V2 4HU9A 3ZTLA 16GSA 3TKSE 3TRQA 2DJ3A 2KP1A 3K8NA 4HQSA 3VPQA 2ES7A 3KMOA 4EUYA 3RDWA 1Z6MA 1MDIA 1MDJA 2H19A 3DYRA 4XS4A 2IL3A 3VWWA 2CAQA 4HJ2A 2VUPA 4OFNA 4XTSA 2FA8A 3GIXA 1GL8A 4Z2TA 2FWGA 1USBA 2YNXA 2HRNA 2E2GA 4RQRA 4G01A 2EFCA 3TJGA 3P2AA 2JZRA 2H0GA 1O81A 3RHBA 1SK2A 4FYBA 5IO2A 5D9WA 1BX9A 5ECSA 2DJKA 2CVKA 1K3OA 4EE0A 5DJLA 3MWHA 5DALB 4TOPA 1OKTA 4ISDA 1H75A 1UVZA 4EDYA 3TU3B 4JU5A 5ABRA 2C4JA 3FR3A 4I2TA 2LJKA 3TUEA 3LG6A 4J2FA 4L5OA 1OKDA 1LJRA 5D8IA 4CDOA 1SK0A 2JZTA 4ZL7A 1SYRA 1IYHA 1QMVA 2GSSA 1T00A 1WE0A 2E2MA 1A8LA 2LRTA 5A34B 4KDXA 2OADA 3VI7A 1XWBA 1N2AA 1FVJA 5HQPA 3ZVJD 1EOHA 1I5GA 4JR6A 1MDKA 1OVNA 2PVQA 2GQLA 3F8UA 7GSSA 5F07A 1VF3A 4E8EA 2R5GA 4G9HA 2B1LA 4W66A 4EVMA 2DC5A 4ZB6A 2YPMA 1OC8A 4JRRA 3HJPA 2R2JA 2C1YA 3M9KA 2O89A 1O7UA 4ZBBA 3TJFA 5IMFA 5G1LA 4TVEA 3KH7A 2EIRA 1ZZYA 2LJAA 3G7JA 4HQZA 4CY6A 3VPTA 2YWIA 3DEXA 3QPMA 4K0GA 3GMFA 5CNWA 5ID2B 4TR1B 1F2EA 3KCMA 11GSA 3PGTA 2TIRA 2FY6A 2LNSA 1ERUA 2IFQA 8GSSA 1SK1A 4MABA 3QAVA 3IAS2 1T4YA 4IP6A 2RLIA 5L71A 4MH2A 2MYGA 3TKSA 3HKRA 2B5XA 1V9WA 1RK4A 1PN9A 1GTIA 3OR5A 3ZREA 3LYPA 4G0KA 3LEFA 2O85A 3CSJA 2WS2A 5LD0A 2V6OA 5HR3A 2CZ2A 4JE1A 4L0WA 2VL9A 2CA8A 4ZL9A 1DSBA 4XHMA 2L6DA 2R6KA 3AY8A 2B3SA 3DVWA 2LSTA 3EU3A 2PU9C 5E59A 2A4HA 1AUCA 4G0IA 3HVSA 2NDOA 3UOMA 1YKAA 3H79A 2C3QA 2LS5A 4O5RA 1ERWA 4YAVA 3DRNA 3EE2A 2OE1A 3F9UA 1K0BA 3HD5A 3PR8A 1GSUA 2CV4A 1ML6A 3IBHA 2PWJA 5DCGA 2MBSA 5IO0A 3A2WA 4POBA 2VLVA 4IQ1A 3P90A 2XC2A 4PNGA 4BVXA 3GRXA 2GSRA 1BF5A 4CHSA 5INYA 2GZYA 3FRCA 1FOHA 3HHVA 1K3LA 4MH3A 4DSSB 2HRKA 1ABAA 3IE3A 4OFTA 2ZNMA 3N5OA 1GSYA 2YJHA 3LW9A 5KN2A 3ZITA 5KN3A 4L8EA 2X8HA 3VLNA 4AJ6A 4QMKA 1GNEA 1AXDA 2PN8A 1ON4A 1AIUA 2VL2A 1CQHA 1XBSA 5ECQB 5J5NA 2QGVA 4LA1A 2F3MA 3A5IA 3GKMA 1G0TA 2B5EA 1KEBA 5IMCA 1R26A 4EIQA 4JZQA 2AYTA 1JZRA 1URMA 1Q98A 5GSTA 4HDEA 1GTAA 3TKQA 3FW2A 3FKFA 2O5VA 5AIVA 2XBIA 4J57E 1TRUA 5ECPB 3EVIA 4WBJA 4L0UA 3RBTA 3H93A 4I5QA 2GSQA 3GHAA 2V6KA 4PQIA 2YP6A 2YV7A 2V1MA 4PUFC 3P8WA 2A4VA 1A2MA 4USSA 2WFCA 5ECHB 3F4RA 1M9BA 4OWYA 1VRSD 3I6AA 5FT3A 2BMXA 3MDKA 2JU5A 3MYDA 4AKXB 1G6WA 2LV3A 3M9JA 2IJYA 3ZL5A 3A3TA 4YQMA 3BD2A 3TJJA 2DKIA 5H5SA 1TW9A 3DMLA 4WEYA 2BTOT 4MF6A 3GUSA 4ECCA 2IMIA 3BBYA 2M72A 5ECKB 4V2NA 3ZMKA 3HZ8A 2FHEA 2A2RA 5IOWA 2H1BA 3APSA 2UV8G 3HYPA 2V41A 3HDCA 1EV9A 3W6GA 2A2PA 1PSQA 3KMNA 3FR6A 3G9BA 3KD0A 1A23A 1GNWA 1FAAA 3O6TA 3IV4A 2H66A 2H6ZA 1X5DA 3QOUA 4Q5RA 3RAZA 3ZZXA 4IJ3A 2C0DA 2HLSA 10GSA 3C1SA 3KP8A 1AQXA 1PRXA 2LQQA 3QMXA 1J0FA 2FGXA 3CSIA 3QR6A 3U5RE 4GQFA 1SKSB 1VF1A 2NVLA 3TKRA 2X8GA 1GUMA 4TKYA 2NBSA 1VGLA 5EPFA 5COHA 2CT6A 3IR4A 2GDRA 4MJEA 1THOA 1BJXA 5KN0A 3KTBA 1M0UA 5A34A 4V2LA 4MDCA 1ZYPA 3ME7A 3H8QA 3MNGA 2AHEA 5IM9A 2UZ8A 1MTCA 1B9YC 1XIYA 2L4QA 1DUGA 3KJYA 3QDNA 5KOWA 2GGTA 3TJKA 2E7PA 5F05A 3C1RA 2C3TA 17GSA 1SVLA 2IPAA 4WF5A 5D93A 3ERFA 1J08A 2R0CA 2VLTA 3WT2A 2YCDA 2B1KA 2H75A 4V1Ag 1FVKA 1B4PA 2O8VB 3IK9A 4ZXGA 1OE7A 1K0MA 4GQCA 2LNTA 5HR2A 4FYCA 3GA4A 3ZIVA 1TRVA 2PMTA 4ULXA 1A0FA 1B4QA 4TR1A 5DCHA 1T8EB 3UEMA 3ERWA 4HZ2A 4PQHA 5EL8A 4N3ZA 3G7IA 2I81A 5A4VA 2E0QA 4Z2UA 1HQOA 4TR4A 5C00A 1J9BA 3PH9A 3J7Yk 3KP9A 4HEA2 5D9TA 4KCEA 4MPFA 3ZYWA 4Q5FA 2JSYA 4F0BA 4YQVA 3A2XA 3EURA 1QXHA 3R3EA 1XWCA 5A5KA 3VWXA 3GSSA 4N11A 4I6XA 4RI6A 1SL1B 1TK8B 3DVXA 2H70A 3NZNA 1B9XC 1MD3A 4K1FA 1KBNA 3FY7A 3GH9A 2FWHA 4KGIA 4KSMA 2DJ0A 1NM3A 2DIYA 2CZ3A 3NOFA 4KE3A 2GZZA 2N5BA 5DVBA 1JZWA 3F6FA 3KM6A 2CQ9A 2F9SA 2H0IA 1NSWA 4TR3A 1K0NA 3UBLA 3IOSA 2HE3A 3FEUA 1EV4A 2H1LA 3CBUA 4OCEA 4G0LA 3SWLA 1HNAA 4AKIA 4NHWA 3MSZA 4RQXA 5D96A 2VCZA 2FCHA 1GRXA 4K0NA 2CVBA 2AV4A 4J56E 2EFHA 2HI7A 1XVWA 2H6YA 1FHEA 3D22A 3PPUA 2N5AA 3VWVA 5LCZA 3LJRA 3HVVA 1R5PA 4EC0A 5CAXA 4BVYA 1GSEA 4P3YB 4PURA 3US3A 3NIVA 2XPDA 4DSSA 3F0IA 1OAZA 1SKRB 1Z5YE 4MF7A 2MMOA 5B7CA 2DBCA 2ZCTA 4EDZA 4K7OA 4DEJA 2IMKA 5A5HB 1HYUA 5J9BA 1ZYQB 2RUEA 6GSSA 5HR0A 2NTOA 1GSFA 2GZPA 2VCWA 1TK0B 4GLTA 3MAKA 3IPZA 2P0GA 4D73B 1V57A 3UBKA 4RUVA 4POLA 3CTFA 4ML6A 3QCPA 1S3DA 3MIXA 1M2AA 1JZDA 3GKNA 2ON5A 3RPNA 1A24A 2IMFA 1PKWA 2D2ZA 4MJBA 4YH2A 3ISOA 5H5QA 4IJIA 1OC9A 2P31A 3TKPA 4MZBA 4MCUA 3C8EA 2OE3A 3GX0A 1TI1A 1LU4A 5LNKe 5DDLA 5ELGA 4IP1A 4K6XA 1Z3EA 4MJCA 1GTBA 4KW6A 1DE2A 4JEDA 3G7YA 2FA4A 4OO5A 4LMWA 2HNLA 5ELAA 4EF0A 1Z9HA 1PMTA 2LQOA 4NAXA 1UN2A 1O8WA 4E68A 2RM5A 5GSSA 2ON7A 1FW1A 3N9JA 4X1UA 5CREA 2EIQA 3WT1A 2FD3A 2K8VA 2QA1A 2MBTA 1GLPA 2DSAA 4HZ4A 1ZCPA 4XCSA 3LQ7A 1O85A 2LUSA 2HSMB 1X9SB 4I8BA 4O5UA 5KEJA 3ZVJA 1TTZA 4MJAA 1BAYA 3GL3A 1K0CA 4JBBA 2CX3A 3PINA 1XWAA 2V32A 3KEBA 4MPGA 3Q6OA 3HCZA 5B6NA 4IW9A 3TCOA 4FQUA 2RIIA 1QK8A 1TI3A 1M7TA 4Z2RA 2G0FA 3KGKA 1U3IA 1WPIA 4K7IA 4L5LA 1ILOA 1ZYEA 4V2MA 1SL2B 5JWOB 2HSYA 5JCGA 3TDGA 3CRTA 4GDFA 4ACSA 4IGJA 5DJMA 2KLXA 1GP1A 3VFIA 3U6VA 1YKCA 3IHQA 4Q5QA 1GSDA 1KNGA 3APOA 4K5RA 1W89A 4H86A 1ZYNA 2PGTA 2KUCA 2VL3A 2EFDA 2DKHA 4BVYB 4KF9A 5A1NA 4YAPA 2OA7A 1BQ7A 1UA5A 3KTLA 2IMEA 5EVOA 1M9AA 5ECMB 3D4TA 2MMNA 2V2GA 3D0ZA 5IMAA 3WGDA 3M1GA 3DWVA 4PXOA 5BMUB 4ICYA 1G7EA 2K6VA 1BG5A 1SJZA 2REMA 4WR4A 1R7HA 4HOJA 5F06A 3GYKA 1W4VA 1PGTA 3F6DA 1XOAA 2OKAA 1OC9B 3CYNA 4ZBDA 14GSA 2A2SA 1ZL9A 1YZXA 1Y1UA 3EMPA 3LGCA 3ZRDA 3EWLA 4GWRA 1PD21 5GZZB 4DSQA 4NPBA 4NV2A 4KUNA 1F3BA 4MZWA 3HVXA 4TXOA 1YF0A 2VCQA 2ZUPA 2YV9A 1MEKA 4PTSA 4KDUA 5D73A 1HNCA 4PX1A 4WXTA 4XS6A 4ZB7A 1XXUA 2FLSA 6GSVA 5G5EA 5IQYA 5CRHA 1X9MB 1SYXA 4YQUA 2J9HA 4KH7A 3ME8A 2VM2A 3A5WA 4NV5A 5J4YA 4O5QA 3LYKA 4TRXA 4O32A 3O3TA 3GSTA 3D4MA 1ST9A 2OACA 1U3AA 2GS3A 1Z7PA 2CVDA 1A0RP 4XIHA 4GSTA 2L57A 2LTKA 4I97A 2FNOA 3E9JB 5D9XA 1RW1A 2WULA 2VD0A 1QUWA 4OMVA 1WIKA 1LBKA 5ECIB 1T7PB 3A2VA 4POKA 1O73A 4BWQA 3ZFBA 1ZGNA 1TK5B 5CRGA 1DBYA 2GQMA 4WR5A 3L9SA 2H74A 2HZEB 2WJUA 5HFGA 1O6JA 1HD2A 3GV1A 1SKWB 3HJMA 3L78A 1SJIA 2VKZG 4EIPA 4NXIA 4ML1A 4K8MA 1V58A 4F82A 5A5HA 1G7OA 1UC7A 2HXKA 2HSHA 4CW9A 3DIEA 2B7KA 4G2EA 3EPTA 2O87A 4WF4A 4QQ7A 3IRAA 2IMDA 3VURA 2JZSA 4X4JA 2VO4A 4N30A 1PX6A 4D73A 5CO3A 3FYGA 3ZMLA 4MP4A 3TKSC 5A1NB 2YOIA 4ECBA 4IVFA 1AAZA 1Y6EA 3UARA 1EZKA 2DJJA 3D5JA 3GTUB 3WD6A 3FZ9A 4KB3A 4AKGA 2GSTA 2OBIA 4GSSA 2X4AA 2H71A 5IPGA 3L4NA 5ECRB 4WKWA 4OCFA 5JCUA 5CRDA 1Y25A 1K0AA 3L9UA 2DMMA 2H1AA 1V98A 1SL0B 3DD3A 1NHYA 4KA0A 3FZAA 1R4WA 4EKZA 4G19A 1GSQA 4EXJA 1B48A 2H73A 3I43A 2GVPA 2LEGA 1TJDA 4WETA 3EYTA 5D9VA 5AISA 4K9ZA 2C0GA 2AAWA 2DIZA 3F4TA 2PBJA 5AGYA 5G1KA 1N8JA 2PUKC 4AKHA 4V1Ap 5B8BA 3WYWA 2R3XA 22GSA 2HSMA 4NWYA 4XS1A 3DGQA 3IC4A 1IYIA 4TW5A 3HXSA 5KN1A 2QKEA 2VAFA 1SENA 1SJ6A 5GAPD 3VI5A 1XWGA 2JADA 3IDVA 4TXOB 4K2DA 3KXOA 2FUG2 1F6MC 1WJKA 1V40A 5AIXA 2J23A 3HMJG 3KH9A 6GSTA 2EFEA 2IWTA 2X64A 5B8AA 20GSA 1A2LA 1NW2A 1XPVA 2R0GA 2YJ7A 4BWSA 3QD9A 1SVMA 1TKDB 4CY8A 2XHFA 1TRSA 2C0EA 4MF5A 1ERVA 5ECNB 4A5PA 4ZL8A 1PKZA 2H8LA 1T4ZA 3KIJA 4K5SA 1BEDA 2VIMA 2HT9A 3ZFLA 3SBCA 1YY7A 3F63A 1F9MA 2L6CA 1TRWA 2VL2C 3GKKA 4KX4A 4PNFA 5J41A 2L4CA 3GL5A 3W8SA 2WDUA 1KTEA 2KOKA 4PGTA 2F8FA 1Q4JA 2AJQB 4X43A 5A4UA 1E2YA 1M99A 1I9DA 5G30A 1C72A 4IBPA 5IMDA 4BL7B 4BPYA 4O92A 3IA1A 5DQYA 4PQ1A 5FHIA 4OD7A 4ZILA 4IQAA 1Z6NA 2WCIA 1X0RA 2OT3A 1SVOA 3FZ5A 1YVLA 1WRYA 4I2UA 9GSSA 3TJBA 2VOCA 3FHKA 6GSUA 4KDYA 3CTGA 1XW5A 5CYYA 2VCXA 4E8HA 4LMVA 2H6XA 2GQKA 1PN0A 1EEJA 3C71A 5ECOB 5DAKB 3GH6A 2IN3A 2BJXA 2G2QA 5BMUA 3ERGA 2X8CA 1FO5A 6GSWA 3Q18A 1FG4A 3UJ1A 3D6IA 1WWJA 2AUVA 3QFAC 3FR9A 4IKHA 2KHPA 1YJ6A 2I4AA 3LXTA 5CRWA 5KOXA 2HYXA 2H01A 1EGOA 2I3YA 2PVOC 1XVQA 4YKFA 1WP0A 4HS1A 1R5AA 6GSYA 2YANA 4AGSA 2I9HA 2YZHA 3QFBC 2L59A 1N25A 4OO4A 5F0GA 1NHOA 2H72A 2XBQA 2VCTA 3FZ4A 1XZOA 3TOUA 3E3EA 1JHBA 4IELA 1OYJA 2HQTA 3FK8A 4XRAA 5FWGA 2CAIA 4IS0A 3H1NA 4MK3A 3CXGA 4QL9A 4KSOA 2JACA 3L9VA 3TB2A 2YWOA 1GULA 2OE0A 13GSA 1M2BA 3LFLA 5DBQA 1BYEA 2KP2A 1S3CA 4Z7XA 1YQ1A 1PL1A 2HSNB 5J40A 1GWCA 2YZUA 5DQSA 2B7JA 1K0DA 1ZMAA 1YF1A 2DLXA 1G6YA 3EU4A 4HUAA 2B6MA 1TP9A 2FWFA 3RHCA 3LWAA 1GLQA 4FH8A 3DKSA 2TRCP 4ECJA 4KAEA 1U6TA 3EC3A 5HFIA 1SU9A 5B6MA 1JLWA 2RM6A 4MLYA 2C0FA 2EC4A 3UVHA 1XW6A 2LRCA 3Q19A 1GTUA 3QAGA 3CSHA 4ZBAA 3UAPA 6GSXA 5EY6A 3ZIJA 4KCAA 1EWXA 2HZEA 3EINA 2M46A 1OE8A 1TDIA 3IAM2 1YDKA 3IK7A 4XS4B 4GXZA 4LLRA 2L5LA 5J9CA 4ECIA 1FB0A 5GAND 4GCIA 2VD1A 5A4WA 2R4VA 2DMLA 4MMMA 1VF4A 4F03A 3HA9A 1AW9A 3C73A 5J47A 4YKGA 1XWKA 3M0FA 3TRPA 3BCKA 3LSZA 5J3RA 1EEMA 4Q5NA 4ZB9A 1H4OA 1OC3A 1V2AA 4DVCA 3EMXA 1S3AA 3GTUA 3BJ5A 4FYUA 2ALBA 2X49A 2H76A 2M80A 2PPTA 1RQMA 4K2XA 2TRXA 1K3YA 3M3MA 5JWQB 3Q74A 1JFUA 2VLUA 3J7Yb 2OJLA 2I1UA 1B8XA 1DE1A 4AJ7A 2RUFA 4FO5A 5IPHA 1CQGA 4O7HA 1JLVA 4ZIJA 4MZCA 1AQWA 3GX8A 1VF2A 4F9ZA 4FIWA 3LXZA 2K8SA 1FB6A 2X99A 4AJ8A 4F2IA 3CWGA 19GSA 5G5FA 1EGRA 1TXXA 1A2JA 4JR4A 2WZ9A 2YN1A 3LORA 5IOXA 1X5CA 2LRNA 4EL1A 1WOUA 1THXA 3GKXA 5ECLB 3FMWA 1PX7A 2GTUA 2GLRA 1GSSA 1ACVA 3TRXA 4NHZA 3P7XA 2P5RA 3BOAA 4F0CA 4IHUA 2K9FA 2C80A 2DJ1A 2JSZA 1A8YA 3DXBA 2QA2A 5G2ZA 5BRTA 3R2QA 4TR0A 4XRDA 3VWUA 1MD4A 3GN3A 4WBRD 2AB6A 3QAWA 3GNJA 2P5QA 1U88A 3TGZA 1PQNA 2IIYA 4X0XA 5J4UA 4PUAA 1BG1A 2IFQB 2XPEA 4G10A 3BCIA 4GF0A 3O76A 1TOFA 4AI6A 4GRFA 1O8XA 1X5EA 3KZQA 3IXRA 1K0OA 1XW9A 2JL4A 2L5OA 4OFMA 5ENUA 3F3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0H A;  3WGE A;  2WRT A;  1FOV A;  4QL7 A;  4BL7 A;  3E0U A;  4TXV A;  3CMI A;  1PA3 A;  3C7M A;  4N10 A;  1GUH A;  2MMA A;  5CP1 A;  1T1V A;  1EP7 A;  12GS A;  2QC7 A;  3UVT A;  1EP8 A;  2CX4 A;  5AN1 A;  2H1D A;  1TU8 A;  2HRA A;  1HNB A;  3S9F A;  4BA7 A;  3JCM L;  2EIO A;  4GSN A;  1Z7R A;  1YEX A;  2R37 A;  5IIZ A;  1ERT A;  3APQ A;  1QFN A;  2Z9S A;  4KND A;  18GS A;  3I69 A;  5IMV A;  4K7N A;  3ZLP A;  2DJ2 A;  5DAL A;  1TU7 A;  5DAK A;  1XFL A;  2VM1 A;  2F51 A;  1AC1 A;  1YEP A;  4N0Z A;  1ZOF A;  4LL1 B;  3WGX A;  1F37 A;  2F8A A;  1M2D A;  2GT5 A;  2WGR A;  4N0V A;  3VK9 A;  2PER A;  3M8N A;  3RPP A;  1XCC A;  2C3N A;  1SD9 A;  2YWM A;  4GTU A;  4EO3 A;  3HJO A;  1EOG A;  1QGV A;  1SD8 A;  2O7K A;  2H1G A;  3W8J A;  3IC8 A;  4BVX B;  1JZO A;  2FWE A;  3UL3 A;  3UMA A;  3D21 A;  4NMU A;  4DSR A;  3CRU A;  2OBK A;  3ED3 A;  2HRK B;  2HFD A;  2LKU A;  4MA9 A;  4ILF A;  1X9W B;  1E6B A;  1T3B A;  2HRF A;  2NPB A;  2MZC A;  4IN0 A;  5HR1 A;  4HU7 A;  2C8U A;  3H4K A;  3TOT A;  2GT6 A;  2H30 A;  3UIW A;  2N5F A;  5F8B A;  2YWN A;  5ID2 A;  1U87 A;  1GUK A;  5JWR B;  3F3R A;  2WB9 A;  1PL2 A;  3HY2 A;  4ZB8 A;  1GH2 A;  1QQ2 A;  4TN8 A;  4HI7 A;  2VCV A;  1WMJ A;  4ID0 A;  4LL4 B;  4RI7 A;  1F3A A;  5C04 A;  2LJR A;  2MMZ A;  5JCW A;  1AQV A;  1XOB A;  2H0H A;  4AF2 A;  2K18 A;  3GFK A;  5G31 A;  2B5Y A;  3GUR A;  2HZF A;  5HFK A;  3F4S A;  5IMZ A;  5H5R A;  2QSI A;  4POM A;  4HJM A;  3HZ4 A;  3V1W A;  5E4W A;  3I9V 2;  4HU9 A;  3ZTL A;  16GS A;  3TKS E;  3TRQ A;  2DJ3 A;  2KP1 A;  3K8N A;  4HQS A;  3VPQ A;  2ES7 A;  3KMO A;  4EUY A;  3RDW A;  1Z6M A;  1MDI A;  1MDJ A;  2H19 A;  3DYR A;  4XS4 A;  2IL3 A;  3VWW A;  2CAQ A;  4HJ2 A;  2VUP A;  4OFN A;  4XTS A;  2FA8 A;  3GIX A;  1GL8 A;  2FWG A;  1USB A;  2YNX A;  2HRN A;  2E2G A;  4RQR A;  3TJG A;  3P2A A;  2JZR A;  2H0G A;  1O81 A;  3RHB A;  1SK2 A;  4FYB A;  5IO2 A;  5D9W A;  1BX9 A;  5ECS A;  2DJK A;  2CVK A;  1K3O A;  4EE0 A;  5DJL A;  3MWH A;  5DAL B;  4TOP A;  1OKT A;  4ISD A;  1H75 A;  1UVZ A;  4EDY A;  4JU5 A;  5ABR A;  2C4J A;  3FR3 A;  4I2T A;  2LJK A;  3TUE A;  3LG6 A;  4J2F A;  4L5O A;  1OKD A;  1LJR A;  5D8I A;  4CDO A;  1SK0 A;  2JZT A;  4ZL7 A;  1SYR A;  1IYH A;  1QMV A;  2GSS A;  1T00 A;  1WE0 A;  2E2M A;  1A8L A;  2LRT A;  4KDX A;  2OAD A;  3VI7 A;  1XWB A;  1N2A A;  1FVJ A;  5HQP A;  3ZVJ D;  1EOH A;  1I5G A;  4JR6 A;  1MDK A;  1OVN A;  2PVQ A;  2GQL A;  3F8U A;  7GSS A;  5F07 A;  1VF3 A;  4E8E A;  2R5G A;  4G9H A;  2B1L A;  4EVM A;  2DC5 A;  4ZB6 A;  2YPM A;  1OC8 A;  4JRR A;  3HJP A;  2R2J A;  2C1Y A;  3M9K A;  2O89 A;  1O7U A;  4ZBB A;  3TJF A;  5IMF A;  5G1L A;  4TVE A;  3KH7 A;  2EIR A;  1ZZY A;  2LJA A;  3G7J A;  4HQZ A;  3VPT A;  2YWI A;  3DEX A;  3QPM A;  4K0G A;  3GMF A;  5CNW A;  5ID2 B;  4TR1 B;  1F2E A;  3KCM A;  11GS A;  3PGT A;  2TIR A;  2FY6 A;  2LNS A;  1ERU A;  2IFQ A;  8GSS A;  1SK1 A;  4MAB A;  3QAV A;  3IAS 2;  1T4Y A;  4IP6 A;  2RLI A;  5L71 A;  4MH2 A;  2MYG A;  3TKS A;  3HKR A;  2B5X A;  1V9W A;  1RK4 A;  1PN9 A;  1GTI A;  3OR5 A;  3ZRE A;  3LYP A;  4G0K A;  3LEF A;  2O85 A;  3CSJ A;  2WS2 A;  5LD0 A;  2V6O A;  5HR3 A;  2CZ2 A;  4JE1 A;  4L0W A;  2VL9 A;  2CA8 A;  4ZL9 A;  1DSB A;  4XHM A;  2L6D A;  2R6K A;  3AY8 A;  2B3S A;  3DVW A;  2LST A;  3EU3 A;  2PU9 C;  5E59 A;  1AUC A;  4G0I A;  3HVS A;  2NDO A;  3UOM A;  1YKA A;  3H79 A;  2C3Q A;  2LS5 A;  4O5R A;  1ERW A;  4YAV A;  3DRN A;  3EE2 A;  2OE1 A;  3F9U A;  1K0B A;  3HD5 A;  3PR8 A;  1GSU A;  2CV4 A;  1ML6 A;  3IBH A;  2PWJ A;  5DCG A;  2MBS A;  5IO0 A;  3A2W A;  4POB A;  2VLV A;  4IQ1 A;  3P90 A;  2XC2 A;  4PNG A;  4BVX A;  3GRX A;  2GSR A;  4CHS A;  5INY A;  2GZY A;  3FRC A;  3HHV A;  1K3L A;  4MH3 A;  4DSS B;  2HRK A;  1ABA A;  3IE3 A;  4OFT A;  2ZNM A;  3N5O A;  1GSY A;  2YJH A;  5KN2 A;  3ZIT A;  5KN3 A;  4L8E A;  2X8H A;  3VLN A;  4AJ6 A;  1GNE A;  1AXD A;  2PN8 A;  1ON4 A;  1AIU A;  2VL2 A;  1CQH A;  1XBS A;  5ECQ B;  5J5N A;  2QGV A;  4LA1 A;  2F3M A;  3GKM A;  1G0T A;  2B5E A;  1KEB A;  5IMC A;  1R26 A;  4JZQ A;  2AYT A;  1JZR A;  1URM A;  1Q98 A;  5GST A;  4HDE A;  1GTA A;  3TKQ A;  3FW2 A;  3FKF A;  5AIV A;  2XBI A;  4J57 E;  1TRU A;  5ECP B;  3EVI A;  4WBJ A;  4L0U A;  3RBT A;  3H93 A;  4I5Q A;  2GSQ A;  3GHA A;  2V6K A;  4PQI A;  2YP6 A;  2YV7 A;  2V1M A;  4PUF C;  3P8W A;  2A4V A;  1A2M A;  4USS A;  2WFC A;  5ECH B;  3F4R A;  1M9B A;  4OWY A;  1VRS D;  3I6A A;  5FT3 A;  2BMX A;  3MDK A;  2JU5 A;  1G6W A;  2LV3 A;  3M9J A;  2IJY A;  3ZL5 A;  3A3T A;  4YQM A;  3BD2 A;  3TJJ A;  5H5S A;  1TW9 A;  3DML A;  4WEY A;  2BTO T;  4MF6 A;  3GUS A;  4ECC A;  2IMI A;  3BBY A;  2M72 A;  5ECK B;  4V2N A;  3ZMK A;  3HZ8 A;  2FHE A;  2A2R A;  5IOW A;  2H1B A;  3APS A;  3HYP A;  2V41 A;  3HDC A;  1EV9 A;  3W6G A;  1PSQ A;  3KMN A;  3FR6 A;  3G9B A;  3KD0 A;  1A23 A;  1GNW A;  1FAA A;  3O6T A;  3IV4 A;  2H66 A;  2H6Z A;  1X5D A;  3QOU A;  4Q5R A;  3RAZ A;  3ZZX A;  4IJ3 A;  2C0D A;  2HLS A;  10GS A;  3C1S A;  3KP8 A;  1AQX A;  1PRX A;  2LQQ A;  3QMX A;  1J0F A;  2FGX A;  3CSI A;  3QR6 A;  3U5R E;  4GQF A;  1SKS B;  1VF1 A;  2NVL A;  3TKR A;  2X8G A;  1GUM A;  4TKY A;  2NBS A;  1VGL A;  5EPF A;  5COH A;  2CT6 A;  3IR4 A;  2GDR A;  4MJE A;  1THO A;  1BJX A;  5KN0 A;  3KTB A;  1M0U A;  4V2L A;  4MDC A;  3ME7 A;  3H8Q A;  3MNG A;  2AHE A;  5IM9 A;  2UZ8 A;  1MTC A;  1B9Y C;  1XIY A;  2L4Q A;  1DUG A;  3KJY A;  3QDN A;  2GGT A;  3TJK A;  2E7P A;  5F05 A;  3C1R A;  2C3T A;  17GS A;  2IPA A;  4WF5 A;  5D93 A;  3ERF A;  1J08 A;  2VLT A;  3WT2 A;  2YCD A;  2B1K A;  2H75 A;  4V1A g;  1FVK A;  1B4P A;  2O8V B;  3IK9 A;  4ZXG A;  1OE7 A;  1K0M A;  4GQC A;  2LNT A;  5HR2 A;  4FYC A;  3GA4 A;  3ZIV A;  1TRV A;  2PMT A;  4ULX A;  1A0F A;  1B4Q A;  4TR1 A;  5DCH A;  1T8E B;  3UEM A;  3ERW A;  4HZ2 A;  4PQH A;  5EL8 A;  3G7I A;  2I81 A;  5A4V A;  2E0Q A;  1HQO A;  4TR4 A;  5C00 A;  1J9B A;  3PH9 A;  3J7Y k;  3KP9 A;  4HEA 2;  5D9T A;  4KCE A;  4MPF A;  3ZYW A;  4Q5F A;  2JSY A;  4F0B A;  4YQV A;  3A2X A;  3EUR A;  1QXH A;  3R3E A;  1XWC A;  5A5K A;  3VWX A;  3GSS A;  4N11 A;  4I6X A;  4RI6 A;  1SL1 B;  1TK8 B;  3DVX A;  2H70 A;  3NZN A;  1B9X C;  1MD3 A;  4K1F A;  1KBN A;  3FY7 A;  3GH9 A;  2FWH A;  4KGI A;  4KSM A;  2DJ0 A;  1NM3 A;  2DIY A;  2CZ3 A;  3NOF A;  4KE3 A;  2GZZ A;  2N5B A;  5DVB A;  1JZW A;  3F6F A;  3KM6 A;  2CQ9 A;  2F9S A;  2H0I A;  1NSW A;  4TR3 A;  1K0N A;  3UBL A;  3IOS A;  2HE3 A;  3FEU A;  1EV4 A;  3CBU A;  4OCE A;  4G0L A;  3SWL A;  1HNA A;  4NHW A;  3MSZ A;  4RQX A;  5D96 A;  2VCZ A;  2FCH A;  1GRX A;  4K0N A;  2CVB A;  2AV4 A;  4J56 E;  2HI7 A;  1XVW A;  2H6Y A;  1FHE A;  3D22 A;  3PPU A;  2N5A A;  3VWV A;  5LCZ A;  3LJR A;  3HVV A;  1R5P A;  4EC0 A;  5CAX A;  4BVY A;  1GSE A;  4P3Y B;  4PUR A;  3US3 A;  3NIV A;  2XPD A;  4DSS A;  3F0I A;  1OAZ A;  1SKR B;  1Z5Y E;  4MF7 A;  2MMO A;  5B7C A;  2DBC A;  2ZCT A;  4EDZ A;  4K7O A;  4DEJ A;  2IMK A;  1HYU A;  5J9B A;  1ZYQ B;  2RUE A;  6GSS A;  5HR0 A;  2NTO A;  1GSF A;  2GZP A;  2VCW A;  1TK0 B;  4GLT A;  3MAK A;  3IPZ A;  2P0G A;  4D73 B;  1V57 A;  3UBK A;  4RUV A;  4POL A;  3CTF A;  4ML6 A;  3QCP A;  1S3D A;  1M2A A;  1JZD A;  3GKN A;  2ON5 A;  3RPN A;  1A24 A;  2IMF A;  1PKW A;  2D2Z A;  4MJB A;  4YH2 A;  3ISO A;  5H5Q A;  4IJI A;  1OC9 A;  2P31 A;  3TKP A;  4MZB A;  4MCU A;  3C8E A;  2OE3 A;  3GX0 A;  1TI1 A;  1LU4 A;  5LNK e;  5DDL A;  5ELG A;  4IP1 A;  4K6X A;  1Z3E A;  4MJC A;  1GTB A;  4KW6 A;  1DE2 A;  4JED A;  3G7Y A;  2FA4 A;  4OO5 A;  4LMW A;  2HNL A;  5ELA A;  4EF0 A;  1Z9H A;  1PMT A;  2LQO A;  4NAX A;  1UN2 A;  1O8W A;  2RM5 A;  5GSS A;  2ON7 A;  1FW1 A;  3N9J A;  4X1U A;  5CRE A;  2EIQ A;  3WT1 A;  2FD3 A;  2K8V A;  2MBT A;  1GLP A;  2DSA A;  4HZ4 A;  1ZCP A;  4XCS A;  3LQ7 A;  1O85 A;  2LUS A;  2HSM B;  1X9S B;  4I8B A;  5KEJ A;  3ZVJ A;  1TTZ A;  4MJA A;  1BAY A;  3GL3 A;  1K0C A;  4JBB A;  2CX3 A;  3PIN A;  1XWA A;  2V32 A;  3KEB A;  4MPG A;  3Q6O A;  3HCZ A;  5B6N A;  4IW9 A;  3TCO A;  4FQU A;  2RII A;  1QK8 A;  1TI3 A;  1M7T A;  2G0F A;  3KGK A;  1U3I A;  1WPI A;  4K7I A;  4L5L A;  1ILO A;  1ZYE A;  4V2M A;  1SL2 B;  5JWO B;  2HSY A;  5JCG A;  3TDG A;  3CRT A;  4ACS A;  4IGJ A;  5DJM A;  2KLX A;  1GP1 A;  3VFI A;  3U6V A;  1YKC A;  3IHQ A;  4Q5Q A;  1GSD A;  1KNG A;  3APO A;  1W89 A;  4H86 A;  2PGT A;  2KUC A;  2VL3 A;  4BVY B;  4KF9 A;  4YAP A;  2OA7 A;  1BQ7 A;  1UA5 A;  3KTL A;  2IME A;  5EVO A;  1M9A A;  5ECM B;  3D4T A;  2MMN A;  2V2G A;  3D0Z A;  5IMA A;  3WGD A;  3M1G A;  3DWV A;  4PXO A;  1G7E A;  2K6V A;  1BG5 A;  1SJZ A;  2REM A;  4WR4 A;  1R7H A;  4HOJ A;  5F06 A;  3GYK A;  1W4V A;  1PGT A;  3F6D A;  1XOA A;  2OKA A;  1OC9 B;  3CYN A;  4ZBD A;  14GS A;  2A2S A;  1ZL9 A;  1YZX A;  3EMP A;  3LGC A;  3ZRD A;  3EWL A;  4GWR A;  1PD2 1;  5GZZ B;  4DSQ A;  4NPB A;  4NV2 A;  4KUN A;  1F3B A;  4MZW A;  3HVX A;  4TXO A;  1YF0 A;  2VCQ A;  2ZUP A;  2YV9 A;  1MEK A;  4PTS A;  4KDU A;  5D73 A;  1HNC A;  4PX1 A;  4WXT A;  4XS6 A;  1XXU A;  2FLS A;  6GSV A;  5G5E A;  5IQY A;  5CRH A;  1X9M B;  1SYX A;  4YQU A;  2J9H A;  4KH7 A;  3ME8 A;  2VM2 A;  3A5W A;  4NV5 A;  3LYK A;  4TRX A;  4O32 A;  3O3T A;  3GST A;  3D4M A;  1ST9 A;  2OAC A;  1U3A A;  2GS3 A;  1Z7P A;  2CVD A;  1A0R P;  4XIH A;  4GST A;  2L57 A;  2LTK A;  4I97 A;  2FNO A;  3E9J B;  5D9X A;  1RW1 A;  2WUL A;  2VD0 A;  1QUW A;  4OMV A;  1WIK A;  1LBK A;  5ECI B;  1T7P B;  3A2V A;  4POK A;  1O73 A;  4BWQ A;  3ZFB A;  1ZGN A;  1TK5 B;  5CRG A;  1DBY A;  2GQM A;  4WR5 A;  3L9S A;  2H74 A;  2HZE B;  2WJU A;  5HFG A;  1O6J A;  1HD2 A;  3GV1 A;  1SKW B;  3HJM A;  3L78 A;  1SJI A;  4NXI A;  4ML1 A;  4K8M A;  1V58 A;  4F82 A;  1G7O A;  1UC7 A;  2HXK A;  2HSH A;  4CW9 A;  3DIE A;  2B7K A;  4G2E A;  2O87 A;  4WF4 A;  4QQ7 A;  3IRA A;  2IMD A;  3VUR A;  2JZS A;  2VO4 A;  4N30 A;  1PX6 A;  4D73 A;  5CO3 A;  3FYG A;  3ZML A;  4MP4 A;  3TKS C;  2YOI A;  4ECB A;  4IVF A;  1AAZ A;  1Y6E A;  3UAR A;  1EZK A;  2DJJ A;  3D5J A;  3GTU B;  3WD6 A;  3FZ9 A;  4KB3 A;  2GST A;  2OBI A;  4GSS A;  2H71 A;  5IPG A;  3L4N A;  5ECR B;  4WKW A;  4OCF A;  5JCU A;  5CRD A;  1Y25 A;  1K0A A;  3L9U A;  2DMM A;  2H1A A;  1V98 A;  1SL0 B;  3DD3 A;  1NHY A;  4KA0 A;  3FZA A;  1R4W A;  4EKZ A;  4G19 A;  1GSQ A;  4EXJ A;  1B48 A;  2H73 A;  3I43 A;  2GVP A;  2LEG A;  1TJD A;  4WET A;  3EYT A;  5D9V A;  5AIS A;  4K9Z A;  2C0G A;  2AAW A;  2DIZ A;  3F4T A;  2PBJ A;  5AGY A;  5G1K A;  1N8J A;  2PUK C;  4V1A p;  5B8B A;  3WYW A;  2R3X A;  22GS A;  2HSM A;  4NWY A;  4XS1 A;  3DGQ A;  3IC4 A;  1IYI A;  4TW5 A;  3HXS A;  5KN1 A;  2QKE A;  2VAF A;  1SEN A;  1SJ6 A;  5GAP D;  3VI5 A;  1XWG A;  2JAD A;  3IDV A;  4TXO B;  4K2D A;  3KXO A;  2FUG 2;  1F6M C;  1WJK A;  1V40 A;  5AIX A;  2J23 A;  3KH9 A;  6GST A;  2IWT A;  2X64 A;  5B8A A;  20GS A;  1A2L A;  1NW2 A;  1XPV A;  4BWS A;  2YJ7 A;  3QD9 A;  1TKD B;  2XHF A;  1TRS A;  2C0E A;  4MF5 A;  1ERV A;  5ECN B;  4ZL8 A;  1PKZ A;  2H8L A;  1T4Z A;  3KIJ A;  1BED A;  2VIM A;  2HT9 A;  3ZFL A;  3SBC A;  1YY7 A;  3F63 A;  1F9M A;  2L6C A;  1TRW A;  2VL2 C;  3GKK A;  4KX4 A;  4PNF A;  5J41 A;  2L4C A;  3GL5 A;  3W8S A;  2WDU A;  1KTE A;  2KOK A;  4PGT A;  2F8F A;  1Q4J A;  2AJQ B;  4X43 A;  5A4U A;  1E2Y A;  1M99 A;  1I9D A;  5G30 A;  1C72 A;  4IBP A;  5IMD A;  4BL7 B;  4BPY A;  4O92 A;  3IA1 A;  5DQY A;  4PQ1 A;  5FHI A;  4OD7 A;  4ZIL A;  4IQA A;  1Z6N A;  2WCI A;  1X0R A;  3FZ5 A;  1WRY A;  4I2U A;  9GSS A;  3TJB A;  2VOC A;  3FHK A;  6GSU A;  4KDY A;  3CTG A;  1XW5 A;  5CYY A;  2VCX A;  4E8H A;  4LMV A;  2H6X A;  2GQK A;  1EEJ A;  3C71 A;  5ECO B;  5DAK B;  3GH6 A;  2IN3 A;  2BJX A;  2G2Q A;  5BMU A;  3ERG A;  2X8C A;  1FO5 A;  6GSW A;  3Q18 A;  1FG4 A;  3UJ1 A;  3D6I A;  1WWJ A;  2AUV A;  3QFA C;  3FR9 A;  4IKH A;  2KHP A;  1YJ6 A;  2I4A A;  3LXT A;  5CRW A;  2HYX A;  2H01 A;  1EGO A;  2I3Y A;  2PVO C;  1XVQ A;  1WP0 A;  4HS1 A;  1R5A A;  6GSY A;  2YAN A;  4AGS A;  2I9H A;  2YZH A;  3QFB C;  2L59 A;  4OO4 A;  5F0G A;  1NHO A;  2H72 A;  2XBQ A;  2VCT A;  3FZ4 A;  1XZO A;  3TOU A;  3E3E A;  1JHB A;  4IEL A;  1OYJ A;  2HQT A;  3FK8 A;  4XRA A;  5FWG A;  2CAI A;  4IS0 A;  3H1N A;  4MK3 A;  3CXG A;  4QL9 A;  4KSO A;  2JAC A;  3L9V A;  3TB2 A;  2YWO A;  1GUL A;  2OE0 A;  13GS A;  1M2B A;  3LFL A;  5DBQ A;  1BYE A;  2KP2 A;  1S3C A;  4Z7X A;  1YQ1 A;  1PL1 A;  2HSN B;  1GWC A;  2YZU A;  5DQS A;  2B7J A;  1K0D A;  1ZMA A;  1YF1 A;  2DLX A;  1G6Y A;  3EU4 A;  4HUA A;  2B6M A;  1TP9 A;  2FWF A;  3RHC A;  3LWA A;  1GLQ A;  4FH8 A;  3DKS A;  2TRC P;  4ECJ A;  4KAE A;  1U6T A;  3EC3 A;  5HFI A;  1SU9 A;  5B6M A;  1JLW A;  2RM6 A;  4MLY A;  2C0F A;  2EC4 A;  3UVH A;  1XW6 A;  2LRC A;  3Q19 A;  1GTU A;  3QAG A;  3CSH A;  4ZBA A;  3UAP A;  6GSX A;  5EY6 A;  3ZIJ A;  4KCA A;  1EWX A;  2HZE A;  3EIN A;  2M46 A;  1OE8 A;  1TDI A;  3IAM 2;  1YDK A;  3IK7 A;  4XS4 B;  4GXZ A;  4LLR A;  2L5L A;  5J9C A;  4ECI A;  1FB0 A;  5GAN D;  4GCI A;  2VD1 A;  5A4W A;  2R4V A;  2DML A;  4MMM A;  1VF4 A;  4F03 A;  3HA9 A;  1AW9 A;  3C73 A;  1XWK A;  3M0F A;  3TRP A;  3BCK A;  3LSZ A;  5J3R A;  1EEM A;  4Q5N A;  4ZB9 A;  1H4O A;  1OC3 A;  1V2A A;  4DVC A;  3EMX A;  1S3A A;  3GTU A;  3BJ5 A;  4FYU A;  2ALB A;  2H76 A;  2M80 A;  2PPT A;  1RQM A;  2TRX A;  1K3Y A;  3M3M A;  5JWQ B;  3Q74 A;  1JFU A;  2VLU A;  3J7Y b;  2OJL A;  2I1U A;  1B8X A;  1DE1 A;  4AJ7 A;  2RUF A;  4FO5 A;  5IPH A;  1CQG A;  4O7H A;  1JLV A;  4ZIJ A;  4MZC A;  1AQW A;  3GX8 A;  1VF2 A;  4F9Z A;  4FIW A;  3LXZ A;  2K8S A;  1FB6 A;  2X99 A;  4AJ8 A;  4F2I A;  19GS A;  5G5F A;  1EGR A;  1TXX A;  1A2J A;  4JR4 A;  2WZ9 A;  2YN1 A;  3LOR A;  5IOX A;  1X5C A;  2LRN A;  4EL1 A;  1WOU A;  1THX A;  3GKX A;  5ECL B;  1PX7 A;  2GTU A;  2GLR A;  1GSS A;  1ACV A;  3TRX A;  4NHZ A;  3P7X A;  2P5R A;  3BOA A;  4F0C A;  4IHU A;  2K9F A;  2C80 A;  2DJ1 A;  2JSZ A;  1A8Y A;  3DXB A;  5G2Z A;  3R2Q A;  4TR0 A;  4XRD A;  3VWU A;  1MD4 A;  3GN3 A;  4WBR D;  2AB6 A;  3QAW A;  3GNJ A;  2P5Q A;  1U88 A;  3TGZ A;  1PQN A;  2IIY A;  4X0X A;  5J4U A;  4PUA A;  2IFQ B;  2XPE A;  4G10 A;  3BCI A;  4GF0 A;  3O76 A;  1TOF A;  4GRF A;  1O8X A;  1X5E A;  3KZQ A;  3IXR A;  1K0O A;  1XW9 A;  2JL4 A;  2L5O A;  4OFM A;  5ENU A;  3F3Q A; 
#chains in the Genus database with same CATH topology
 3L0H A;  3WGE A;  2WRT A;  1FOV A;  4QL7 A;  4BL7 A;  3E0U A;  4TXV A;  3CMI A;  1PA3 A;  3C7M A;  4N10 A;  1GUH A;  2MMA A;  5CP1 A;  1T1V A;  1EP7 A;  12GS A;  2QC7 A;  3UVT A;  1EP8 A;  2CX4 A;  5AN1 A;  2H1D A;  1TU8 A;  2HRA A;  1HNB A;  3S9F A;  1M3I A;  4BA7 A;  3JCM L;  2EIO A;  4GSN A;  1Z7R A;  1YEX A;  2R37 A;  5IIZ A;  1ERT A;  3APQ A;  1QFN A;  2Z9S A;  4KND A;  18GS A;  3I69 A;  2R0P A;  1YEW C;  5IMV A;  4K7N A;  3ZLP A;  2DJ2 A;  5DAL A;  1TU7 A;  5DAK A;  1XFL A;  2VM1 A;  1TXU A;  2F51 A;  1AC1 A;  1YEP A;  4N0Z A;  5J4V A;  1ZOF A;  4LL1 B;  3WGX A;  1F37 A;  2F8A A;  1M2D A;  2GT5 A;  2WGR A;  4N0V A;  3VK9 A;  2PER A;  3CQF A;  3M8N A;  3RPP A;  1XCC A;  2C3N A;  1SD9 A;  2YWM A;  4GTU A;  4EO3 A;  3HJO A;  1EOG A;  1QGV A;  1SD8 A;  2O7K A;  2H1G A;  3W8J A;  3IC8 A;  4BVX B;  1JZO A;  2FWE A;  3UL3 A;  3UMA A;  3D21 A;  4NMU A;  4DSR A;  3CRU A;  2OBK A;  3ED3 A;  2HRK B;  2HFD A;  2LKU A;  4MA9 A;  4ILF A;  1X9W B;  1E6B A;  1T3B A;  2HRF A;  2NPB A;  2MZC A;  4IN0 A;  4MNN A;  5HR1 A;  4HU7 A;  2C8U A;  3H4K A;  3TOT A;  2GT6 A;  2H30 A;  3UIW A;  2N5F A;  5F8B A;  2YWN A;  2HSN A;  5ID2 A;  1U87 A;  1GUK A;  5JWR B;  3F3R A;  2WB9 A;  1PL2 A;  3HY2 A;  4ZB8 A;  1GH2 A;  1QQ2 A;  4TN8 A;  4HI7 A;  2VCV A;  1WMJ A;  4ID0 A;  4LL4 B;  4RI7 A;  1F3A A;  5C04 A;  2LJR A;  3IHG A;  2MMZ A;  5JCW A;  1AQV A;  1XOB A;  2H0H A;  4AF2 A;  2K18 A;  3GFK A;  5G31 A;  2B5Y A;  3GUR A;  2HZF A;  5HFK A;  3F4S A;  5IMZ A;  5H5R A;  2QSI A;  4POM A;  4HJM A;  3HZ4 A;  3V1W A;  5E4W A;  3I9V 2;  4HU9 A;  3ZTL A;  16GS A;  3TKS E;  3TRQ A;  2DJ3 A;  2KP1 A;  3K8N A;  4HQS A;  1I1I P;  3VPQ A;  2ES7 A;  3KMO A;  4EUY A;  3RDW A;  1Z6M A;  1MDI A;  1MDJ A;  2H19 A;  3DYR A;  4XS4 A;  2IL3 A;  3VWW A;  2CAQ A;  4HJ2 A;  2VUP A;  4OFN A;  4XTS A;  2FA8 A;  3GIX A;  1GL8 A;  2WVY A;  4Z2T A;  2FWG A;  1USB A;  2YNX A;  2HRN A;  2E2G A;  4RQR A;  4G01 A;  2EFC A;  3TJG A;  3P2A A;  2JZR A;  2H0G A;  1O81 A;  3RHB A;  1SK2 A;  4FYB A;  5IO2 A;  5D9W A;  1BX9 A;  5ECS A;  2DJK A;  2CVK A;  1K3O A;  4EE0 A;  5DJL A;  3MWH A;  5DAL B;  4TOP A;  1OKT A;  4ISD A;  1H75 A;  1UVZ A;  4EDY A;  3TU3 B;  4JU5 A;  5ABR A;  2C4J A;  3FR3 A;  4I2T A;  2LJK A;  3TUE A;  3LG6 A;  4J2F A;  4L5O A;  1OKD A;  4FXY P;  1LJR A;  5D8I A;  4CDO A;  1SK0 A;  2JZT A;  4ZL7 A;  1SYR A;  1IYH A;  1QMV A;  2GSS A;  1T00 A;  1WE0 A;  2E2M A;  1A8L A;  2LRT A;  5A34 B;  4KDX A;  2OAD A;  3VI7 A;  1XWB A;  1N2A A;  1FVJ A;  5HQP A;  3ZVJ D;  1EOH A;  1I5G A;  4JR6 A;  1MDK A;  1OVN A;  2PVQ A;  2GQL A;  3F8U A;  7GSS A;  5F07 A;  1VF3 A;  4E8E A;  2R5G A;  4G9H A;  2B1L A;  4W66 A;  4EVM A;  2DC5 A;  4ZB6 A;  2YPM A;  1OC8 A;  4JRR A;  3HJP A;  2R2J A;  2C1Y A;  3M9K A;  2O89 A;  1O7U A;  3RGB C;  4ZBB A;  3TJF A;  5IMF A;  5G1L A;  4TVE A;  3KH7 A;  2EIR A;  1ZZY A;  2LJA A;  3G7J A;  4HQZ A;  4CY6 A;  3VPT A;  2YWI A;  3DEX A;  3QPM A;  4K0G A;  3GMF A;  5CNW A;  5ID2 B;  4TR1 B;  1F2E A;  3KCM A;  11GS A;  3PGT A;  2TIR A;  2FY6 A;  2LNS A;  1ERU A;  2IFQ A;  8GSS A;  1SK1 A;  4MAB A;  3QAV A;  3IAS 2;  1T4Y A;  4IP6 A;  2RLI A;  5L71 A;  4MH2 A;  2MYG A;  3TKS A;  3HKR A;  2B5X A;  1V9W A;  1RK4 A;  1PN9 A;  1M3J A;  1GTI A;  3OR5 A;  3ZRE A;  3LYP A;  4G0K A;  3LEF A;  2O85 A;  3CSJ A;  2WS2 A;  5LD0 A;  2V6O A;  5HR3 A;  2WW3 A;  2CZ2 A;  4JE1 A;  4L0W A;  2VL9 A;  2CA8 A;  4ZL9 A;  1DSB A;  4XHM A;  2L6D A;  2R6K A;  3AY8 A;  2B3S A;  3DVW A;  2LST A;  3EU3 A;  2PU9 C;  5E59 A;  2A4H A;  1AUC A;  4G0I A;  3HVS A;  2NDO A;  3UOM A;  1YKA A;  3H79 A;  2C3Q A;  2LS5 A;  4O5R A;  1ERW A;  4YAV A;  3DRN A;  3EE2 A;  2OE1 A;  3F9U A;  1K0B A;  3HD5 A;  3PR8 A;  4PHZ C;  1GSU A;  2CV4 A;  1ML6 A;  3IBH A;  2PWJ A;  5DCG A;  2MBS A;  5IO0 A;  3A2W A;  4POB A;  2VLV A;  4IQ1 A;  3P90 A;  2XC2 A;  4PNG A;  4BVX A;  3GRX A;  2GSR A;  1BF5 A;  4CHS A;  5INY A;  2GZY A;  3FRC A;  1FOH A;  3HHV A;  1K3L A;  4MH3 A;  4DSS B;  2HRK A;  1ABA A;  3IE3 A;  4OFT A;  2ZNM A;  3N5O A;  1GSY A;  2YJH A;  3LW9 A;  5KN2 A;  3ZIT A;  5KN3 A;  4L8E A;  2X8H A;  3VLN A;  4AJ6 A;  4QMK A;  1GNE A;  1AXD A;  2PN8 A;  1ON4 A;  1AIU A;  2VL2 A;  1CQH A;  1XBS A;  5ECQ B;  5J5N A;  2QGV A;  4LA1 A;  2F3M A;  3A5I A;  3GKM A;  1G0T A;  2B5E A;  1KEB A;  5IMC A;  1R26 A;  4EIQ A;  4JZQ A;  2AYT A;  1JZR A;  1URM A;  1Q98 A;  5GST A;  4HDE A;  1GTA A;  3TKQ A;  3FW2 A;  3FKF A;  2O5V A;  5AIV A;  2XBI A;  4J57 E;  1TRU A;  5ECP B;  3EVI A;  4WBJ A;  4L0U A;  3RBT A;  3H93 A;  4I5Q A;  2GSQ A;  3GHA A;  2V6K A;  4PQI A;  2YP6 A;  2YV7 A;  2V1M A;  4PUF C;  3P8W A;  2A4V A;  1A2M A;  4USS A;  2WFC A;  5ECH B;  3F4R A;  1M9B A;  4OWY A;  1VRS D;  3I6A A;  5FT3 A;  3RFR C;  2BMX A;  3MDK A;  2JU5 A;  3MYD A;  4AKX B;  1G6W A;  2LV3 A;  3M9J A;  2IJY A;  3ZL5 A;  3A3T A;  4YQM A;  3BD2 A;  3TJJ A;  2DKI A;  5H5S A;  1TW9 A;  2WW0 A;  3DML A;  4WEY A;  2BTO T;  4MF6 A;  3GUS A;  4ECC A;  2IMI A;  3BBY A;  2M72 A;  5ECK B;  4V2N A;  3ZMK A;  3HZ8 A;  2FHE A;  2A2R A;  5IOW A;  2H1B A;  3APS A;  2UV8 G;  3HYP A;  2V41 A;  3HDC A;  1EV9 A;  3W6G A;  2A2P A;  1PSQ A;  3KMN A;  3FR6 A;  3G9B A;  3KD0 A;  1A23 A;  1GNW A;  1FAA A;  3O6T A;  3IV4 A;  2H66 A;  2H6Z A;  1X5D A;  3QOU A;  4Q5R A;  3RAZ A;  3ZZX A;  4IJ3 A;  2C0D A;  2HLS A;  10GS A;  3C1S A;  3KP8 A;  1AQX A;  1PRX A;  2LQQ A;  3QMX A;  1J0F A;  2FGX A;  3CSI A;  3QR6 A;  3U5R E;  4GQF A;  1SKS B;  1VF1 A;  2NVL A;  3TKR A;  2X8G A;  1GUM A;  4TKY A;  2NBS A;  1VGL A;  5EPF A;  5COH A;  2CT6 A;  3IR4 A;  2GDR A;  4MJE A;  1THO A;  1BJX A;  5KN0 A;  3KTB A;  1M0U A;  5A34 A;  4V2L A;  4MDC A;  1ZYP A;  3ME7 A;  3H8Q A;  3MNG A;  2AHE A;  5IM9 A;  2UZ8 A;  1MTC A;  1B9Y C;  1XIY A;  2L4Q A;  1DUG A;  3KJY A;  3QDN A;  5KOW A;  2GGT A;  3TJK A;  2E7P A;  5F05 A;  3C1R A;  2C3T A;  17GS A;  1SVL A;  2IPA A;  4WF5 A;  5D93 A;  3ERF A;  1J08 A;  2R0C A;  2VLT A;  3WT2 A;  2YCD A;  2B1K A;  2H75 A;  4V1A g;  1FVK A;  1B4P A;  2O8V B;  3IK9 A;  4ZXG A;  1OE7 A;  1K0M A;  4GQC A;  2LNT A;  5HR2 A;  4FYC A;  3GA4 A;  3ZIV A;  1TRV A;  2PMT A;  4ULX A;  1A0F A;  1B4Q A;  4TR1 A;  5DCH A;  1T8E B;  3UEM A;  3ERW A;  4HZ2 A;  4PQH A;  5EL8 A;  1PFO A;  4N3Z A;  3G7I A;  2I81 A;  5A4V A;  2E0Q A;  4Z2U A;  1HQO A;  4TR4 A;  5C00 A;  1J9B A;  3PH9 A;  3J7Y k;  3KP9 A;  4HEA 2;  5D9T A;  4KCE A;  4MPF A;  3ZYW A;  4Q5F A;  2JSY A;  4F0B A;  4YQV A;  3A2X A;  3EUR A;  1QXH A;  3R3E A;  1XWC A;  5A5K A;  3VWX A;  3GSS A;  4N11 A;  4I6X A;  4RI6 A;  1SL1 B;  1TK8 B;  3DVX A;  2H70 A;  3NZN A;  1B9X C;  1MD3 A;  4K1F A;  1KBN A;  3FY7 A;  3GH9 A;  2FWH A;  4KGI A;  4KSM A;  2DJ0 A;  1NM3 A;  2DIY A;  2CZ3 A;  3NOF A;  4KE3 A;  2WVX A;  2GZZ A;  2N5B A;  5DVB A;  1JZW A;  3F6F A;  3KM6 A;  2CQ9 A;  2F9S A;  2H0I A;  1NSW A;  4TR3 A;  1K0N A;  3UBL A;  3IOS A;  2HE3 A;  3FEU A;  1EV4 A;  2H1L A;  3CBU A;  4OCE A;  4G0L A;  3SWL A;  1HNA A;  4AKI A;  4NHW A;  3MSZ A;  4RQX A;  5D96 A;  2VCZ A;  2FCH A;  1S4B P;  1GRX A;  4K0N A;  2CVB A;  2AV4 A;  4J56 E;  2EFH A;  2HI7 A;  1XVW A;  2H6Y A;  1FHE A;  3D22 A;  3PPU A;  2N5A A;  3VWV A;  5LCZ A;  3LJR A;  3HVV A;  1R5P A;  4EC0 A;  5CAX A;  4BVY A;  1GSE A;  4P3Y B;  4PUR A;  3US3 A;  3NIV A;  2XPD A;  4DSS A;  3F0I A;  1OAZ A;  1SKR B;  1Z5Y E;  4MF7 A;  2MMO A;  5B7C A;  2DBC A;  2ZCT A;  4EDZ A;  4K7O A;  2WVZ A;  4DEJ A;  2IMK A;  5A5H B;  1HYU A;  5J9B A;  1ZYQ B;  2RUE A;  6GSS A;  5HR0 A;  2NTO A;  1GSF A;  2GZP A;  2VCW A;  1TK0 B;  4GLT A;  3MAK A;  3IPZ A;  2P0G A;  4D73 B;  1V57 A;  3UBK A;  4RUV A;  4POL A;  3CTF A;  4PI0 C;  3QCP A;  4ML6 A;  1S3D A;  3MIX A;  1M2A A;  1JZD A;  3GKN A;  2ON5 A;  3RPN A;  1A24 A;  2IMF A;  1PKW A;  2D2Z A;  4MJB A;  4YH2 A;  3ISO A;  5H5Q A;  4IJI A;  1OC9 A;  2P31 A;  3TKP A;  4MZB A;  4MCU A;  3C8E A;  2OE3 A;  3GX0 A;  1TI1 A;  1LU4 A;  5LNK e;  5DDL A;  5ELG A;  4IP1 A;  4K6X A;  1Z3E A;  4MJC A;  1GTB A;  4KW6 A;  1DE2 A;  4JED A;  3G7Y A;  2FA4 A;  4OO5 A;  4LMW A;  2HNL A;  5ELA A;  4EF0 A;  1Z9H A;  1PMT A;  2LQO A;  4NAX A;  1UN2 A;  1O8W A;  4E68 A;  2RM5 A;  5GSS A;  3CHX C;  2ON7 A;  1FW1 A;  3N9J A;  4X1U A;  5CRE A;  2EIQ A;  3WT1 A;  1S3R A;  2FD3 A;  2K8V A;  2QA1 A;  2MBT A;  1GLP A;  2DSA A;  4HZ4 A;  1ZCP A;  4XCS A;  3LQ7 A;  1O85 A;  2LUS A;  2HSM B;  1X9S B;  4I8B A;  4HSC X;  4O5U A;  5KEJ A;  3ZVJ A;  1TTZ A;  4MJA A;  1BAY A;  3GL3 A;  1K0C A;  4JBB A;  2CX3 A;  3PIN A;  1XWA A;  3KEB A;  2V32 A;  4PI2 C;  4MPG A;  3Q6O A;  3HCZ A;  5B6N A;  4IW9 A;  3TCO A;  4FQU A;  2RII A;  1QK8 A;  1TI3 A;  1M7T A;  4Z2R A;  2WVX B;  2G0F A;  3KGK A;  1U3I A;  1WPI A;  4K7I A;  4L5L A;  1ILO A;  1ZYE A;  4V2M A;  1SL2 B;  5JWO B;  2HSY A;  5JCG A;  3TDG A;  3CRT A;  4GDF A;  4ACS A;  4IGJ A;  1XG8 A;  5DJM A;  2KLX A;  1GP1 A;  3VFI A;  3U6V A;  1YKC A;  3IHQ A;  4Q5Q A;  1GSD A;  1KNG A;  3APO A;  4K5R A;  1W89 A;  4H86 A;  1ZYN A;  2PGT A;  2KUC A;  2VL3 A;  2EFD A;  2DKH A;  4BVY B;  4KF9 A;  5A1N A;  4YAP A;  2OA7 A;  1BQ7 A;  1UA5 A;  3KTL A;  2IME A;  5EVO A;  1M9A A;  5ECM B;  3D4T A;  2MMN A;  2V2G A;  3D0Z A;  5IMA A;  3WGD A;  3M1G A;  3DWV A;  4PXO A;  5BMU B;  4ICY A;  1G7E A;  2K6V A;  1BG5 A;  1SJZ A;  2REM A;  4WR4 A;  1R7H A;  4HOJ A;  5F06 A;  3HVN A;  3GYK A;  1W4V A;  1PGT A;  3F6D A;  1XOA A;  2OKA A;  1OC9 B;  3CYN A;  4ZBD A;  14GS A;  2A2S A;  1ZL9 A;  1YZX A;  1Y1U A;  3EMP A;  3LGC A;  3ZRD A;  3EWL A;  4GWR A;  1PD2 1;  5GZZ B;  4DSQ A;  4NPB A;  4NV2 A;  2WZS A;  4KUN A;  1F3B A;  4MZW A;  3HVX A;  4TXO A;  1YF0 A;  2VCQ A;  2ZUP A;  2YV9 A;  1MEK A;  4PTS A;  4KDU A;  5D73 A;  1HNC A;  4PX1 A;  4WXT A;  4XS6 A;  4ZB7 A;  1XXU A;  2FLS A;  6GSV A;  5G5E A;  5IQY A;  5CRH A;  1X9M B;  1SYX A;  4YQU A;  2J9H A;  4KH7 A;  3ME8 A;  2VM2 A;  3A5W A;  4NV5 A;  5J4Y A;  4O5Q A;  3LYK A;  4TRX A;  4O32 A;  3O3T A;  3GST A;  3D4M A;  1ST9 A;  2OAC A;  1U3A A;  2GS3 A;  1Z7P A;  2CVD A;  1A0R P;  4XIH A;  4GST A;  2L57 A;  2LTK A;  4I97 A;  2FNO A;  3E9J B;  5D9X A;  1RW1 A;  2WUL A;  2VD0 A;  1QUW A;  4OMV A;  1WIK A;  1LBK A;  5ECI B;  1T7P B;  3A2V A;  4POK A;  1O73 A;  4BWQ A;  3ZFB A;  1ZGN A;  1TK5 B;  5CRG A;  1DBY A;  2GQM A;  4WR5 A;  3L9S A;  2H74 A;  2HZE B;  2WJU A;  5HFG A;  1O6J A;  1HD2 A;  3GV1 A;  1SKW B;  3HJM A;  3L78 A;  1SJI A;  2VKZ G;  4EIP A;  4NXI A;  4ML1 A;  2O36 A;  4K8M A;  1V58 A;  4F82 A;  5A5H A;  1G7O A;  1UC7 A;  2HXK A;  2HSH A;  4CW9 A;  3DIE A;  2B7K A;  4G2E A;  3EPT A;  2O87 A;  4WF4 A;  4QQ7 A;  3IRA A;  2IMD A;  3VUR A;  2JZS A;  4X4J A;  2VO4 A;  4N30 A;  1PX6 A;  4D73 A;  5CO3 A;  3FYG A;  3ZML A;  4MP4 A;  3TKS C;  5A1N B;  2YOI A;  4ECB A;  4IVF A;  1AAZ A;  1Y6E A;  3UAR A;  1EZK A;  2DJJ A;  3D5J A;  3GTU B;  3WD6 A;  3FZ9 A;  4KB3 A;  4AKG A;  2GST A;  2OBI A;  4GSS A;  2X4A A;  2H71 A;  5IPG A;  3L4N A;  5ECR B;  4WKW A;  4OCF A;  5JCU A;  5CRD A;  1Y25 A;  1K0A A;  3L9U A;  2DMM A;  2H1A A;  1V98 A;  1SL0 B;  3DD3 A;  1NHY A;  4KA0 A;  3FZA A;  1R4W A;  4EKZ A;  4G19 A;  1GSQ A;  4EXJ A;  1B48 A;  2H73 A;  3I43 A;  2GVP A;  2LEG A;  1TJD A;  4WET A;  3EYT A;  5D9V A;  5AIS A;  4K9Z A;  2C0G A;  2AAW A;  2DIZ A;  2WW2 A;  3F4T A;  2PBJ A;  5AGY A;  5G1K A;  1N8J A;  2PUK C;  4AKH A;  4V1A p;  5B8B A;  3WYW A;  2R3X A;  22GS A;  2HSM A;  4NWY A;  4XS1 A;  3DGQ A;  3IC4 A;  1IYI A;  4TW5 A;  3HXS A;  5KN1 A;  2QKE A;  2VAF A;  1SEN A;  1SJ6 A;  5GAP D;  3VI5 A;  1XWG A;  2JAD A;  3IDV A;  4TXO B;  4K2D A;  3KXO A;  2FUG 2;  1F6M C;  1WJK A;  1V40 A;  5AIX A;  2J23 A;  3HMJ G;  3KH9 A;  6GST A;  2EFE A;  2IWT A;  2X64 A;  5B8A A;  20GS A;  1A2L A;  1NW2 A;  1XPV A;  2R0G A;  2YJ7 A;  4BWS A;  3QD9 A;  1SVM A;  1TKD B;  4CY8 A;  2XHF A;  1TRS A;  2C0E A;  4MF5 A;  1ERV A;  5ECN B;  4A5P A;  4ZL8 A;  1PKZ A;  2H8L A;  1T4Z A;  3KIJ A;  4K5S A;  1BED A;  2VIM A;  2HT9 A;  3ZFL A;  3SBC A;  1YY7 A;  3F63 A;  1F9M A;  2L6C A;  1TRW A;  2VL2 C;  3GKK A;  4KX4 A;  4PNF A;  5J41 A;  2L4C A;  3GL5 A;  3W8S A;  2WDU A;  1KTE A;  2KOK A;  4PGT A;  2F8F A;  1Q4J A;  2AJQ B;  4X43 A;  5A4U A;  1E2Y A;  1M99 A;  1I9D A;  5G30 A;  1C72 A;  4IBP A;  5IMD A;  4BL7 B;  4BPY A;  4O92 A;  3IA1 A;  5DQY A;  4PQ1 A;  5FHI A;  4OD7 A;  4ZIL A;  4IQA A;  1Z6N A;  2WCI A;  1X0R A;  2OT3 A;  1SVO A;  3FZ5 A;  1YVL A;  1WRY A;  4I2U A;  9GSS A;  3TJB A;  2VOC A;  3FHK A;  6GSU A;  4KDY A;  3CTG A;  1XW5 A;  5CYY A;  2VCX A;  4E8H A;  4LMV A;  2H6X A;  2GQK A;  1PN0 A;  1EEJ A;  3C71 A;  5ECO B;  5DAK B;  3GH6 A;  2IN3 A;  2BJX A;  2G2Q A;  5BMU A;  3ERG A;  2X8C A;  1FO5 A;  6GSW A;  3Q18 A;  1FG4 A;  3UJ1 A;  3D6I A;  1WWJ A;  2AUV A;  3QFA C;  3FR9 A;  4IKH A;  2KHP A;  1YJ6 A;  2I4A A;  3LXT A;  5CRW A;  5KOX A;  2HYX A;  2H01 A;  1EGO A;  2I3Y A;  2PVO C;  1XVQ A;  4YKF A;  1WP0 A;  4HS1 A;  1R5A A;  6GSY A;  2YAN A;  4AGS A;  2I9H A;  2YZH A;  3QFB C;  2L59 A;  1N25 A;  4OO4 A;  5F0G A;  1NHO A;  2H72 A;  2XBQ A;  2VCT A;  3FZ4 A;  1XZO A;  3TOU A;  3E3E A;  1JHB A;  4IEL A;  1OYJ A;  2HQT A;  3FK8 A;  4XRA A;  5FWG A;  2CAI A;  4IS0 A;  3H1N A;  4MK3 A;  3CXG A;  4QL9 A;  4KSO A;  2JAC A;  3L9V A;  3TB2 A;  2YWO A;  1GUL A;  2OE0 A;  13GS A;  1M2B A;  3LFL A;  4BIK A;  5DBQ A;  1BYE A;  2KP2 A;  1S3C A;  4Z7X A;  1YQ1 A;  1PL1 A;  2HSN B;  5J40 A;  1GWC A;  2YZU A;  5DQS A;  2B7J A;  1K0D A;  1ZMA A;  1YF1 A;  2DLX A;  1G6Y A;  3EU4 A;  4HUA A;  2B6M A;  1TP9 A;  2FWF A;  3RHC A;  3LWA A;  1GLQ A;  4FH8 A;  3DKS A;  2TRC P;  4ECJ A;  4KAE A;  1U6T A;  3EC3 A;  5HFI A;  1SU9 A;  5B6M A;  1JLW A;  2RM6 A;  4MLY A;  2C0F A;  2EC4 A;  3UVH A;  1XW6 A;  2LRC A;  3Q19 A;  1GTU A;  3QAG A;  3CSH A;  4ZBA A;  2WW1 A;  3UAP A;  6GSX A;  5EY6 A;  3ZIJ A;  4KCA A;  1EWX A;  2HZE A;  3EIN A;  2M46 A;  1OE8 A;  1TDI A;  3IAM 2;  1YDK A;  3IK7 A;  4XS4 B;  4GXZ A;  4LLR A;  2L5L A;  5J9C A;  4ECI A;  1FB0 A;  5GAN D;  4GCI A;  2VD1 A;  5A4W A;  2R4V A;  2DML A;  4MMM A;  1VF4 A;  4F03 A;  3HA9 A;  1AW9 A;  3C73 A;  5J47 A;  4YKG A;  1XWK A;  3M0F A;  3TRP A;  3BCK A;  3LSZ A;  5J3R A;  1EEM A;  4Q5N A;  4ZB9 A;  1H4O A;  1OC3 A;  1V2A A;  4DVC A;  3EMX A;  1S3A A;  3GTU A;  3BJ5 A;  4FYU A;  2ALB A;  2X49 A;  2H76 A;  2M80 A;  2PPT A;  1RQM A;  4K2X A;  2TRX A;  1K3Y A;  3M3M A;  5JWQ B;  3Q74 A;  1JFU A;  2VLU A;  3J7Y b;  2OJL A;  2I1U A;  1B8X A;  1DE1 A;  4AJ7 A;  2RUF A;  4FO5 A;  5IPH A;  1CQG A;  4O7H A;  1JLV A;  4ZIJ A;  4MZC A;  1AQW A;  3GX8 A;  1VF2 A;  4F9Z A;  4FIW A;  3LXZ A;  2K8S A;  1FB6 A;  2X99 A;  4AJ8 A;  4F2I A;  3CWG A;  19GS A;  5G5F A;  1EGR A;  2O3E A;  1TXX A;  1A2J A;  4JR4 A;  2WZ9 A;  2YN1 A;  3LOR A;  5IOX A;  1X5C A;  2LRN A;  4EL1 A;  1WOU A;  1THX A;  3GKX A;  5ECL B;  3FMW A;  1PX7 A;  2GTU A;  2GLR A;  1GSS A;  1ACV A;  3TRX A;  4NHZ A;  3P7X A;  2P5R A;  3BOA A;  4F0C A;  4IHU A;  2K9F A;  2C80 A;  2DJ1 A;  2JSZ A;  1A8Y A;  3DXB A;  2QA2 A;  5G2Z A;  5BRT A;  3R2Q A;  4TR0 A;  4XRD A;  3VWU A;  1MD4 A;  3GN3 A;  4WBR D;  2AB6 A;  3QAW A;  3GNJ A;  2P5Q A;  1U88 A;  3TGZ A;  1PQN A;  2IIY A;  4X0X A;  5J4U A;  4PUA A;  1BG1 A;  2IFQ B;  2XPE A;  4G10 A;  3BCI A;  4GF0 A;  3O76 A;  1TOF A;  4AI6 A;  4GRF A;  1O8X A;  1X5E A;  3KZQ A;  3IXR A;  1K0O A;  1XW9 A;  2JL4 A;  2L5O A;  4OFM A;  5ENU A;  3F3Q A; 
#chains in the Genus database with same CATH homology
 3L0H A;  3WGE A;  2WRT A;  1FOV A;  4QL7 A;  4BL7 A;  3E0U A;  4TXV A;  3CMI A;  1PA3 A;  3C7M A;  4N10 A;  1GUH A;  2MMA A;  5CP1 A;  1T1V A;  1EP7 A;  12GS A;  2QC7 A;  3UVT A;  1EP8 A;  2CX4 A;  5AN1 A;  2H1D A;  1TU8 A;  2HRA A;  1HNB A;  3S9F A;  4BA7 A;  3JCM L;  2EIO A;  4GSN A;  1Z7R A;  1YEX A;  2R37 A;  5IIZ A;  1ERT A;  3APQ A;  1QFN A;  2Z9S A;  4KND A;  18GS A;  3I69 A;  2R0P A;  5IMV A;  4K7N A;  3ZLP A;  2DJ2 A;  5DAL A;  1TU7 A;  5DAK A;  1XFL A;  2VM1 A;  1TXU A;  2F51 A;  1AC1 A;  1YEP A;  4N0Z A;  5J4V A;  1ZOF A;  4LL1 B;  3WGX A;  1F37 A;  2F8A A;  1M2D A;  2GT5 A;  2WGR A;  4N0V A;  3VK9 A;  2PER A;  3M8N A;  3RPP A;  1XCC A;  2C3N A;  1SD9 A;  2YWM A;  4GTU A;  4EO3 A;  3HJO A;  1EOG A;  1QGV A;  1SD8 A;  2O7K A;  2H1G A;  3W8J A;  3IC8 A;  4BVX B;  1JZO A;  2FWE A;  3UL3 A;  3UMA A;  3D21 A;  4NMU A;  4DSR A;  3CRU A;  2OBK A;  3ED3 A;  2HRK B;  2HFD A;  2LKU A;  4MA9 A;  4ILF A;  1X9W B;  1E6B A;  1T3B A;  2HRF A;  2NPB A;  2MZC A;  4IN0 A;  4MNN A;  5HR1 A;  4HU7 A;  2C8U A;  3H4K A;  3TOT A;  2GT6 A;  2H30 A;  3UIW A;  2N5F A;  5F8B A;  2YWN A;  2HSN A;  5ID2 A;  1U87 A;  1GUK A;  5JWR B;  3F3R A;  2WB9 A;  1PL2 A;  3HY2 A;  4ZB8 A;  1GH2 A;  1QQ2 A;  4TN8 A;  4HI7 A;  2VCV A;  1WMJ A;  4ID0 A;  4LL4 B;  4RI7 A;  1F3A A;  5C04 A;  2LJR A;  3IHG A;  2MMZ A;  5JCW A;  1AQV A;  1XOB A;  2H0H A;  4AF2 A;  2K18 A;  3GFK A;  5G31 A;  2B5Y A;  3GUR A;  2HZF A;  5HFK A;  3F4S A;  5IMZ A;  5H5R A;  2QSI A;  4POM A;  4HJM A;  3HZ4 A;  3V1W A;  5E4W A;  3I9V 2;  4HU9 A;  3ZTL A;  16GS A;  3TKS E;  3TRQ A;  2DJ3 A;  2KP1 A;  3K8N A;  4HQS A;  3VPQ A;  2ES7 A;  3KMO A;  4EUY A;  3RDW A;  1Z6M A;  1MDI A;  1MDJ A;  2H19 A;  3DYR A;  4XS4 A;  2IL3 A;  3VWW A;  2CAQ A;  4HJ2 A;  2VUP A;  4OFN A;  4XTS A;  2FA8 A;  3GIX A;  1GL8 A;  4Z2T A;  2FWG A;  1USB A;  2YNX A;  2HRN A;  2E2G A;  4RQR A;  4G01 A;  2EFC A;  3TJG A;  3P2A A;  2JZR A;  2H0G A;  1O81 A;  3RHB A;  1SK2 A;  4FYB A;  5IO2 A;  5D9W A;  1BX9 A;  5ECS A;  2DJK A;  2CVK A;  1K3O A;  4EE0 A;  5DJL A;  3MWH A;  5DAL B;  4TOP A;  1OKT A;  4ISD A;  1H75 A;  1UVZ A;  4EDY A;  3TU3 B;  4JU5 A;  5ABR A;  2C4J A;  3FR3 A;  4I2T A;  2LJK A;  3TUE A;  3LG6 A;  4J2F A;  4L5O A;  1OKD A;  1LJR A;  5D8I A;  4CDO A;  1SK0 A;  2JZT A;  4ZL7 A;  1SYR A;  1IYH A;  1QMV A;  2GSS A;  1T00 A;  1WE0 A;  2E2M A;  1A8L A;  2LRT A;  5A34 B;  4KDX A;  2OAD A;  3VI7 A;  1XWB A;  1N2A A;  1FVJ A;  5HQP A;  3ZVJ D;  1EOH A;  1I5G A;  4JR6 A;  1MDK A;  1OVN A;  2PVQ A;  2GQL A;  3F8U A;  7GSS A;  5F07 A;  1VF3 A;  4E8E A;  2R5G A;  4G9H A;  2B1L A;  4W66 A;  4EVM A;  2DC5 A;  4ZB6 A;  2YPM A;  1OC8 A;  4JRR A;  3HJP A;  2R2J A;  2C1Y A;  3M9K A;  2O89 A;  1O7U A;  4ZBB A;  3TJF A;  5IMF A;  5G1L A;  4TVE A;  3KH7 A;  2EIR A;  1ZZY A;  2LJA A;  3G7J A;  4HQZ A;  4CY6 A;  3VPT A;  2YWI A;  3DEX A;  3QPM A;  4K0G A;  3GMF A;  5CNW A;  5ID2 B;  4TR1 B;  1F2E A;  3KCM A;  11GS A;  3PGT A;  2TIR A;  2FY6 A;  2LNS A;  1ERU A;  2IFQ A;  8GSS A;  1SK1 A;  4MAB A;  3QAV A;  3IAS 2;  1T4Y A;  4IP6 A;  2RLI A;  5L71 A;  4MH2 A;  2MYG A;  3TKS A;  3HKR A;  2B5X A;  1V9W A;  1RK4 A;  1PN9 A;  1GTI A;  3OR5 A;  3ZRE A;  3LYP A;  4G0K A;  3LEF A;  2O85 A;  3CSJ A;  2WS2 A;  5LD0 A;  2V6O A;  5HR3 A;  2CZ2 A;  4JE1 A;  4L0W A;  2VL9 A;  2CA8 A;  4ZL9 A;  1DSB A;  4XHM A;  2L6D A;  2R6K A;  3AY8 A;  2B3S A;  3DVW A;  2LST A;  3EU3 A;  2PU9 C;  5E59 A;  2A4H A;  1AUC A;  4G0I A;  3HVS A;  2NDO A;  3UOM A;  1YKA A;  3H79 A;  2C3Q A;  2LS5 A;  4O5R A;  1ERW A;  4YAV A;  3DRN A;  3EE2 A;  2OE1 A;  3F9U A;  1K0B A;  3HD5 A;  3PR8 A;  1GSU A;  2CV4 A;  1ML6 A;  3IBH A;  2PWJ A;  5DCG A;  2MBS A;  5IO0 A;  3A2W A;  4POB A;  2VLV A;  4IQ1 A;  3P90 A;  2XC2 A;  4PNG A;  4BVX A;  3GRX A;  2GSR A;  1BF5 A;  4CHS A;  5INY A;  2GZY A;  3FRC A;  1FOH A;  3HHV A;  1K3L A;  4MH3 A;  4DSS B;  2HRK A;  1ABA A;  3IE3 A;  4OFT A;  2ZNM A;  3N5O A;  1GSY A;  2YJH A;  3LW9 A;  5KN2 A;  3ZIT A;  5KN3 A;  4L8E A;  2X8H A;  3VLN A;  4AJ6 A;  4QMK A;  1GNE A;  1AXD A;  2PN8 A;  1ON4 A;  1AIU A;  2VL2 A;  1CQH A;  1XBS A;  5ECQ B;  5J5N A;  2QGV A;  4LA1 A;  2F3M A;  3A5I A;  3GKM A;  1G0T A;  2B5E A;  1KEB A;  5IMC A;  1R26 A;  4EIQ A;  4JZQ A;  2AYT A;  1JZR A;  1URM A;  1Q98 A;  5GST A;  4HDE A;  1GTA A;  3TKQ A;  3FW2 A;  3FKF A;  2O5V A;  5AIV A;  2XBI A;  4J57 E;  1TRU A;  5ECP B;  3EVI A;  4WBJ A;  4L0U A;  3RBT A;  3H93 A;  4I5Q A;  2GSQ A;  3GHA A;  2V6K A;  4PQI A;  2YP6 A;  2YV7 A;  2V1M A;  4PUF C;  3P8W A;  2A4V A;  1A2M A;  4USS A;  2WFC A;  5ECH B;  3F4R A;  1M9B A;  4OWY A;  1VRS D;  3I6A A;  5FT3 A;  2BMX A;  3MDK A;  2JU5 A;  3MYD A;  4AKX B;  1G6W A;  2LV3 A;  3M9J A;  2IJY A;  3ZL5 A;  3A3T A;  4YQM A;  3BD2 A;  3TJJ A;  2DKI A;  5H5S A;  1TW9 A;  3DML A;  4WEY A;  2BTO T;  4MF6 A;  3GUS A;  4ECC A;  2IMI A;  3BBY A;  2M72 A;  5ECK B;  4V2N A;  3ZMK A;  3HZ8 A;  2FHE A;  2A2R A;  5IOW A;  2H1B A;  3APS A;  2UV8 G;  3HYP A;  2V41 A;  3HDC A;  1EV9 A;  3W6G A;  2A2P A;  1PSQ A;  3KMN A;  3FR6 A;  3G9B A;  3KD0 A;  1A23 A;  1GNW A;  1FAA A;  3O6T A;  3IV4 A;  2H66 A;  2H6Z A;  1X5D A;  3QOU A;  4Q5R A;  3RAZ A;  3ZZX A;  4IJ3 A;  2C0D A;  2HLS A;  10GS A;  3C1S A;  3KP8 A;  1AQX A;  1PRX A;  2LQQ A;  3QMX A;  1J0F A;  2FGX A;  3CSI A;  3QR6 A;  3U5R E;  4GQF A;  1SKS B;  1VF1 A;  2NVL A;  3TKR A;  2X8G A;  1GUM A;  4TKY A;  2NBS A;  1VGL A;  5EPF A;  5COH A;  2CT6 A;  3IR4 A;  2GDR A;  4MJE A;  1THO A;  1BJX A;  5KN0 A;  3KTB A;  1M0U A;  5A34 A;  4V2L A;  4MDC A;  1ZYP A;  3ME7 A;  3H8Q A;  3MNG A;  2AHE A;  5IM9 A;  2UZ8 A;  1MTC A;  1B9Y C;  1XIY A;  2L4Q A;  1DUG A;  3KJY A;  3QDN A;  5KOW A;  2GGT A;  3TJK A;  2E7P A;  5F05 A;  3C1R A;  2C3T A;  17GS A;  1SVL A;  2IPA A;  4WF5 A;  5D93 A;  3ERF A;  1J08 A;  2R0C A;  2VLT A;  3WT2 A;  2YCD A;  2B1K A;  2H75 A;  4V1A g;  1FVK A;  1B4P A;  2O8V B;  3IK9 A;  4ZXG A;  1OE7 A;  1K0M A;  4GQC A;  2LNT A;  5HR2 A;  4FYC A;  3GA4 A;  3ZIV A;  1TRV A;  2PMT A;  4ULX A;  1A0F A;  1B4Q A;  4TR1 A;  5DCH A;  1T8E B;  3UEM A;  3ERW A;  4HZ2 A;  4PQH A;  5EL8 A;  4N3Z A;  3G7I A;  2I81 A;  5A4V A;  2E0Q A;  4Z2U A;  1HQO A;  4TR4 A;  5C00 A;  1J9B A;  3PH9 A;  3J7Y k;  3KP9 A;  4HEA 2;  5D9T A;  4KCE A;  4MPF A;  3ZYW A;  4Q5F A;  2JSY A;  4F0B A;  4YQV A;  3A2X A;  3EUR A;  1QXH A;  3R3E A;  1XWC A;  5A5K A;  3VWX A;  3GSS A;  4N11 A;  4I6X A;  4RI6 A;  1SL1 B;  1TK8 B;  3DVX A;  2H70 A;  3NZN A;  1B9X C;  1MD3 A;  4K1F A;  1KBN A;  3FY7 A;  3GH9 A;  2FWH A;  4KGI A;  4KSM A;  2DJ0 A;  1NM3 A;  2DIY A;  2CZ3 A;  3NOF A;  4KE3 A;  2GZZ A;  2N5B A;  5DVB A;  1JZW A;  3F6F A;  3KM6 A;  2CQ9 A;  2F9S A;  2H0I A;  1NSW A;  4TR3 A;  1K0N A;  3UBL A;  3IOS A;  2HE3 A;  3FEU A;  1EV4 A;  2H1L A;  3CBU A;  4OCE A;  4G0L A;  3SWL A;  1HNA A;  4AKI A;  4NHW A;  3MSZ A;  4RQX A;  5D96 A;  2VCZ A;  2FCH A;  1GRX A;  4K0N A;  2CVB A;  2AV4 A;  4J56 E;  2EFH A;  2HI7 A;  1XVW A;  2H6Y A;  1FHE A;  3D22 A;  3PPU A;  2N5A A;  3VWV A;  5LCZ A;  3LJR A;  3HVV A;  1R5P A;  4EC0 A;  5CAX A;  4BVY A;  1GSE A;  4P3Y B;  4PUR A;  3US3 A;  3NIV A;  2XPD A;  4DSS A;  3F0I A;  1OAZ A;  1SKR B;  1Z5Y E;  4MF7 A;  2MMO A;  5B7C A;  2DBC A;  2ZCT A;  4EDZ A;  4K7O A;  4DEJ A;  2IMK A;  5A5H B;  1HYU A;  5J9B A;  1ZYQ B;  2RUE A;  6GSS A;  5HR0 A;  2NTO A;  1GSF A;  2GZP A;  2VCW A;  1TK0 B;  4GLT A;  3MAK A;  3IPZ A;  2P0G A;  4D73 B;  1V57 A;  3UBK A;  4RUV A;  4POL A;  3CTF A;  4ML6 A;  3QCP A;  1S3D A;  3MIX A;  1M2A A;  1JZD A;  3GKN A;  2ON5 A;  3RPN A;  1A24 A;  2IMF A;  1PKW A;  2D2Z A;  4MJB A;  4YH2 A;  3ISO A;  5H5Q A;  4IJI A;  1OC9 A;  2P31 A;  3TKP A;  4MZB A;  4MCU A;  3C8E A;  2OE3 A;  3GX0 A;  1TI1 A;  1LU4 A;  5LNK e;  5DDL A;  5ELG A;  4IP1 A;  4K6X A;  1Z3E A;  4MJC A;  1GTB A;  4KW6 A;  1DE2 A;  4JED A;  3G7Y A;  2FA4 A;  4OO5 A;  4LMW A;  2HNL A;  5ELA A;  4EF0 A;  1Z9H A;  1PMT A;  2LQO A;  4NAX A;  1UN2 A;  1O8W A;  4E68 A;  2RM5 A;  5GSS A;  2ON7 A;  1FW1 A;  3N9J A;  4X1U A;  5CRE A;  2EIQ A;  3WT1 A;  2FD3 A;  2K8V A;  2QA1 A;  2MBT A;  1GLP A;  2DSA A;  4HZ4 A;  1ZCP A;  4XCS A;  3LQ7 A;  1O85 A;  2LUS A;  2HSM B;  1X9S B;  4I8B A;  4O5U A;  5KEJ A;  3ZVJ A;  1TTZ A;  4MJA A;  1BAY A;  3GL3 A;  1K0C A;  4JBB A;  2CX3 A;  3PIN A;  1XWA A;  2V32 A;  3KEB A;  4MPG A;  3Q6O A;  3HCZ A;  5B6N A;  4IW9 A;  3TCO A;  4FQU A;  2RII A;  1QK8 A;  1TI3 A;  1M7T A;  4Z2R A;  2G0F A;  3KGK A;  1U3I A;  1WPI A;  4K7I A;  4L5L A;  1ILO A;  1ZYE A;  4V2M A;  1SL2 B;  5JWO B;  2HSY A;  5JCG A;  3TDG A;  3CRT A;  4GDF A;  4ACS A;  4IGJ A;  5DJM A;  2KLX A;  1GP1 A;  3VFI A;  3U6V A;  1YKC A;  3IHQ A;  4Q5Q A;  1GSD A;  1KNG A;  3APO A;  4K5R A;  1W89 A;  4H86 A;  1ZYN A;  2PGT A;  2KUC A;  2VL3 A;  2EFD A;  2DKH A;  4BVY B;  4KF9 A;  5A1N A;  4YAP A;  2OA7 A;  1BQ7 A;  1UA5 A;  3KTL A;  2IME A;  5EVO A;  1M9A A;  5ECM B;  3D4T A;  2MMN A;  2V2G A;  3D0Z A;  5IMA A;  3WGD A;  3M1G A;  3DWV A;  4PXO A;  5BMU B;  4ICY A;  1G7E A;  2K6V A;  1BG5 A;  1SJZ A;  2REM A;  4WR4 A;  1R7H A;  4HOJ A;  5F06 A;  3GYK A;  1W4V A;  1PGT A;  3F6D A;  1XOA A;  2OKA A;  1OC9 B;  3CYN A;  4ZBD A;  14GS A;  2A2S A;  1ZL9 A;  1YZX A;  1Y1U A;  3EMP A;  3LGC A;  3ZRD A;  3EWL A;  4GWR A;  1PD2 1;  5GZZ B;  4DSQ A;  4NPB A;  4NV2 A;  4KUN A;  1F3B A;  4MZW A;  3HVX A;  4TXO A;  1YF0 A;  2VCQ A;  2ZUP A;  2YV9 A;  1MEK A;  4PTS A;  4KDU A;  5D73 A;  1HNC A;  4PX1 A;  4WXT A;  4XS6 A;  4ZB7 A;  1XXU A;  2FLS A;  6GSV A;  5G5E A;  5IQY A;  5CRH A;  1X9M B;  1SYX A;  4YQU A;  2J9H A;  4KH7 A;  3ME8 A;  2VM2 A;  3A5W A;  4NV5 A;  5J4Y A;  4O5Q A;  3LYK A;  4TRX A;  4O32 A;  3O3T A;  3GST A;  3D4M A;  1ST9 A;  2OAC A;  1U3A A;  2GS3 A;  1Z7P A;  2CVD A;  1A0R P;  4XIH A;  4GST A;  2L57 A;  2LTK A;  4I97 A;  2FNO A;  3E9J B;  5D9X A;  1RW1 A;  2WUL A;  2VD0 A;  1QUW A;  4OMV A;  1WIK A;  1LBK A;  5ECI B;  1T7P B;  3A2V A;  4POK A;  1O73 A;  4BWQ A;  3ZFB A;  1ZGN A;  1TK5 B;  5CRG A;  1DBY A;  2GQM A;  4WR5 A;  3L9S A;  2H74 A;  2HZE B;  2WJU A;  5HFG A;  1O6J A;  1HD2 A;  3GV1 A;  1SKW B;  3HJM A;  3L78 A;  1SJI A;  2VKZ G;  4EIP A;  4NXI A;  4ML1 A;  4K8M A;  1V58 A;  4F82 A;  5A5H A;  1G7O A;  1UC7 A;  2HXK A;  2HSH A;  4CW9 A;  3DIE A;  2B7K A;  4G2E A;  3EPT A;  2O87 A;  4WF4 A;  4QQ7 A;  3IRA A;  2IMD A;  3VUR A;  2JZS A;  4X4J A;  2VO4 A;  4N30 A;  1PX6 A;  4D73 A;  5CO3 A;  3FYG A;  3ZML A;  4MP4 A;  3TKS C;  5A1N B;  2YOI A;  4ECB A;  4IVF A;  1AAZ A;  1Y6E A;  3UAR A;  1EZK A;  2DJJ A;  3D5J A;  3GTU B;  3WD6 A;  3FZ9 A;  4KB3 A;  4AKG A;  2GST A;  2OBI A;  4GSS A;  2X4A A;  2H71 A;  5IPG A;  3L4N A;  5ECR B;  4WKW A;  4OCF A;  5JCU A;  5CRD A;  1Y25 A;  1K0A A;  3L9U A;  2DMM A;  2H1A A;  1V98 A;  1SL0 B;  3DD3 A;  1NHY A;  4KA0 A;  3FZA A;  1R4W A;  4EKZ A;  4G19 A;  1GSQ A;  4EXJ A;  1B48 A;  2H73 A;  3I43 A;  2GVP A;  2LEG A;  1TJD A;  4WET A;  3EYT A;  5D9V A;  5AIS A;  4K9Z A;  2C0G A;  2AAW A;  2DIZ A;  3F4T A;  2PBJ A;  5AGY A;  5G1K A;  1N8J A;  2PUK C;  4AKH A;  4V1A p;  5B8B A;  3WYW A;  2R3X A;  22GS A;  2HSM A;  4NWY A;  4XS1 A;  3DGQ A;  3IC4 A;  1IYI A;  4TW5 A;  3HXS A;  5KN1 A;  2QKE A;  2VAF A;  1SEN A;  1SJ6 A;  5GAP D;  3VI5 A;  1XWG A;  2JAD A;  3IDV A;  4TXO B;  4K2D A;  3KXO A;  2FUG 2;  1F6M C;  1WJK A;  1V40 A;  5AIX A;  2J23 A;  3HMJ G;  3KH9 A;  6GST A;  2EFE A;  2IWT A;  2X64 A;  5B8A A;  20GS A;  1A2L A;  1NW2 A;  1XPV A;  2R0G A;  2YJ7 A;  4BWS A;  3QD9 A;  1SVM A;  1TKD B;  4CY8 A;  2XHF A;  1TRS A;  2C0E A;  4MF5 A;  1ERV A;  5ECN B;  4A5P A;  4ZL8 A;  1PKZ A;  2H8L A;  1T4Z A;  3KIJ A;  4K5S A;  1BED A;  2VIM A;  2HT9 A;  3ZFL A;  3SBC A;  1YY7 A;  3F63 A;  1F9M A;  2L6C A;  1TRW A;  2VL2 C;  3GKK A;  4KX4 A;  4PNF A;  5J41 A;  2L4C A;  3GL5 A;  3W8S A;  2WDU A;  1KTE A;  2KOK A;  4PGT A;  2F8F A;  1Q4J A;  2AJQ B;  4X43 A;  5A4U A;  1E2Y A;  1M99 A;  1I9D A;  5G30 A;  1C72 A;  4IBP A;  5IMD A;  4BL7 B;  4BPY A;  4O92 A;  3IA1 A;  5DQY A;  4PQ1 A;  5FHI A;  4OD7 A;  4ZIL A;  4IQA A;  1Z6N A;  2WCI A;  1X0R A;  2OT3 A;  1SVO A;  3FZ5 A;  1YVL A;  1WRY A;  4I2U A;  9GSS A;  3TJB A;  2VOC A;  3FHK A;  6GSU A;  4KDY A;  3CTG A;  1XW5 A;  5CYY A;  2VCX A;  4E8H A;  4LMV A;  2H6X A;  2GQK A;  1PN0 A;  1EEJ A;  3C71 A;  5ECO B;  5DAK B;  3GH6 A;  2IN3 A;  2BJX A;  2G2Q A;  5BMU A;  3ERG A;  2X8C A;  1FO5 A;  6GSW A;  3Q18 A;  1FG4 A;  3UJ1 A;  3D6I A;  1WWJ A;  2AUV A;  3QFA C;  3FR9 A;  4IKH A;  2KHP A;  1YJ6 A;  2I4A A;  3LXT A;  5CRW A;  5KOX A;  2HYX A;  2H01 A;  1EGO A;  2I3Y A;  2PVO C;  1XVQ A;  4YKF A;  1WP0 A;  4HS1 A;  1R5A A;  6GSY A;  2YAN A;  4AGS A;  2I9H A;  2YZH A;  3QFB C;  2L59 A;  1N25 A;  4OO4 A;  5F0G A;  1NHO A;  2H72 A;  2XBQ A;  2VCT A;  3FZ4 A;  1XZO A;  3TOU A;  3E3E A;  1JHB A;  4IEL A;  1OYJ A;  2HQT A;  3FK8 A;  4XRA A;  5FWG A;  2CAI A;  4IS0 A;  3H1N A;  4MK3 A;  3CXG A;  4QL9 A;  4KSO A;  2JAC A;  3L9V A;  3TB2 A;  2YWO A;  1GUL A;  2OE0 A;  13GS A;  1M2B A;  3LFL A;  5DBQ A;  1BYE A;  2KP2 A;  1S3C A;  4Z7X A;  1YQ1 A;  1PL1 A;  2HSN B;  5J40 A;  1GWC A;  2YZU A;  5DQS A;  2B7J A;  1K0D A;  1ZMA A;  1YF1 A;  2DLX A;  1G6Y A;  3EU4 A;  4HUA A;  2B6M A;  1TP9 A;  2FWF A;  3RHC A;  3LWA A;  1GLQ A;  4FH8 A;  3DKS A;  2TRC P;  4ECJ A;  4KAE A;  1U6T A;  3EC3 A;  5HFI A;  1SU9 A;  5B6M A;  1JLW A;  2RM6 A;  4MLY A;  2C0F A;  2EC4 A;  3UVH A;  1XW6 A;  2LRC A;  3Q19 A;  1GTU A;  3QAG A;  3CSH A;  4ZBA A;  3UAP A;  6GSX A;  5EY6 A;  3ZIJ A;  4KCA A;  1EWX A;  2HZE A;  3EIN A;  2M46 A;  1OE8 A;  1TDI A;  3IAM 2;  1YDK A;  3IK7 A;  4XS4 B;  4GXZ A;  4LLR A;  2L5L A;  5J9C A;  4ECI A;  1FB0 A;  5GAN D;  4GCI A;  2VD1 A;  5A4W A;  2R4V A;  2DML A;  4MMM A;  1VF4 A;  4F03 A;  3HA9 A;  1AW9 A;  3C73 A;  5J47 A;  4YKG A;  1XWK A;  3M0F A;  3TRP A;  3BCK A;  3LSZ A;  5J3R A;  1EEM A;  4Q5N A;  4ZB9 A;  1H4O A;  1OC3 A;  1V2A A;  4DVC A;  3EMX A;  1S3A A;  3GTU A;  3BJ5 A;  4FYU A;  2ALB A;  2X49 A;  2H76 A;  2M80 A;  2PPT A;  1RQM A;  4K2X A;  2TRX A;  1K3Y A;  3M3M A;  5JWQ B;  3Q74 A;  1JFU A;  2VLU A;  3J7Y b;  2OJL A;  2I1U A;  1B8X A;  1DE1 A;  4AJ7 A;  2RUF A;  4FO5 A;  5IPH A;  1CQG A;  4O7H A;  1JLV A;  4ZIJ A;  4MZC A;  1AQW A;  3GX8 A;  1VF2 A;  4F9Z A;  4FIW A;  3LXZ A;  2K8S A;  1FB6 A;  2X99 A;  4AJ8 A;  4F2I A;  3CWG A;  19GS A;  5G5F A;  1EGR A;  1TXX A;  1A2J A;  4JR4 A;  2WZ9 A;  2YN1 A;  3LOR A;  5IOX A;  1X5C A;  2LRN A;  4EL1 A;  1WOU A;  1THX A;  3GKX A;  5ECL B;  3FMW A;  1PX7 A;  2GTU A;  2GLR A;  1GSS A;  1ACV A;  3TRX A;  4NHZ A;  3P7X A;  2P5R A;  3BOA A;  4F0C A;  4IHU A;  2K9F A;  2C80 A;  2DJ1 A;  2JSZ A;  1A8Y A;  3DXB A;  2QA2 A;  5G2Z A;  5BRT A;  3R2Q A;  4TR0 A;  4XRD A;  3VWU A;  1MD4 A;  3GN3 A;  4WBR D;  2AB6 A;  3QAW A;  3GNJ A;  2P5Q A;  1U88 A;  3TGZ A;  1PQN A;  2IIY A;  4X0X A;  5J4U A;  4PUA A;  1BG1 A;  2IFQ B;  2XPE A;  4G10 A;  3BCI A;  4GF0 A;  3O76 A;  1TOF A;  4AI6 A;  4GRF A;  1O8X A;  1X5E A;  3KZQ A;  3IXR A;  1K0O A;  1XW9 A;  2JL4 A;  2L5O A;  4OFM A;  5ENU A;  3F3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...