1YQ1A

Structural genomics of caenorhabditis elegans: glutathione s-transferase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
205
structure length
201
Chain Sequence
b'MPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSGEVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-Transferase
publication title Structural Genomics of Caenorhabditis Elegans: glutathione S-Transferase
rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 62
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1yq1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yq1A01
4NAXA 1Q4JA 4K0NA 2E2GA 1N2AA 2OE0A 2GT6A 2I3YA 2C0FA 1NM3A 2H8LA 5CRWA 4IP6A 2DMLA 2JACA 5D93A 1K0DA 4J2FA 5DJMA 2GQKA 3ZIVA 1Z3EA 4HU9A 5G30A 2WJUA 3R2QA 1G7OA 3HVSA 4HI7A 1NHOA 3EMXA 4MZWA 3KIJA 3ZLPA 1N8JA 1TI1A 1F3AA 5GSSA 1M0UA 3TKRA 1TW9A 5DAKA 5AISA 3EYTA 5B7CA 3WYWA 2REMA 3CSHA 1O8WA 2PUKC 3O76A 4TR1B 3P8WA 2DJKA 4XIHA 2IL3A 4EO3A 4NPBA 2CVKA 3M1GA 2JZSA 3HJPA 3VK9A 3FY7A 1QXHA 3QPMA 2PERA 4OMVA 1Z7PA 2CX4A 4BVYB 4GF0A 4RQXA 4ZB9A 2FUG2 1PN9A 2GQMA 5J9BA 5F8BA 5E59A 1SKWB 2VL3A 3G7IA 5GAND 1PRXA 2HNLA 1GSSA 1S3AA 3CYNA 2MMOA 5D9XA 1A23A 4OD7A 1GLQA 4V2MA 1CQHA 5F0GA 4BA7A 4DSSB 2GS3A 2CVBA 2IMFA 1GL8A 1XVQA 1NW2A 1WMJA 3A2XA 2RM6A 3EVIA 5ECPB 5DAKB 1XXUA 5KN2A 4POLA 5IM9A 4POKA 5GSTA 1K0AA 4JR6A 5INYA 3KTBA 1FAAA 4MABA 5ECOB 5B6MA 1A8YA 1ERWA 2QSIA 4ZXGA 4TR3A 5L71A 4O32A 4MJBA 3LYKA 2O85A 5F05A 1URMA 1BJXA 2GVPA 4EC0A 5A5KA 7GSSA 4K7IA 1SD9A 1WOUA 5ECQB 3GNJA 2LQQA 1DE2A 5HQPA 1GSYA 1FHEA 4FH8A 3TGZA 4NWYA 1F37A 2CZ2A 5G5EA 4PQ1A 2RUEA 3R3EA 2MBTA 1FOVA 2LTKA 2HSMA 4KW6A 1OC9A 4MF7A 3APQA 5J3RA 1SL1B 2VM2A 5H5SA 3GTUA 1SJZA 3TB2A 3KXOA 3TJJA 1EV9A 4IQ1A 1O81A 3DVWA 2YZHA 4DSQA 2VLVA 4KNDA 3CTGA 4I97A 4GLTA 2YP6A 3GIXA 4WBJA 1UN2A 4Q5RA 2IN3A 4EF0A 4MDCA 2DSAA 1XW9A 2HZFA 1MDIA 3KP9A 3QAWA 4OO5A 4Q5FA 3J7Yb 2YWOA 3VURA 4ZBDA 8GSSA 3P2AA 2FNOA 3W8JA 2C1YA 2R4VA 3A2WA 1TK8B 5J9CA 2CT6A 3ZTLA 3D22A 2XBIA 3I43A 2O87A 5D96A 1X0RA 3ZIJA 3M9KA 1PX7A 2OKAA 1C72A 2HSMB 4G19A 1WP0A 4RUVA 5DQSA 2YANA 3GTUB 4EVMA 3GHAA 2P5QA 4GXZA 3L9UA 3NIVA 2HSYA 3KP8A 2IFQA 5A4VA 4K9ZA 3HZ4A 2C3TA 4IJ3A 1OVNA 2LKUA 3GSSA 5ECIB 4WR5A 3ZVJA 1K3YA 4KGIA 3TKQA 2H72A 3Q18A 2JSYA 2RLIA 1YJ6A 4BVXA 3FW2A 1B48A 3D0ZA 4X1UA 4Z7XA 1WPIA 3D5JA 2AB6A 2HSNB 2IMIA 4KSMA 2GZPA 3D4MA 1BAYA 6GSSA 1ABAA 2GSRA 1CQGA 1G0TA 17GSA 2LV3A 4JBBA 1OC3A 5ECSA 2R3XA 3HZ8A 2DLXA 1TI3A 1TU7A 3CMIA 4CW9A 1XFLA 1QMVA 1UC7A 4K1FA 2IFQB 1OKTA 2FHEA 1A2LA 1TRSA 1U3AA 1T8EB 2FA8A 2LRCA 1V2AA 4LMWA 2K8VA 4BVXB 3CSJA 5JWQB 1YKCA 3PGTA 3PINA 5CYYA 3TKSE 3QR6A 4GWRA 4PXOA 3NOFA 3ZFBA 2NDOA 3UMAA 1TRVA 1SYRA 1VF3A 4GRFA 2L59A 1M7TA 2YPMA 3VWWA 3EINA 2F51A 2HRFA 3V1WA 1XBSA 2FWEA 3IDVA 3QDNA 3IV4A 3LQ7A 1T4YA 1PKZA 3O6TA 3WGEA 3F0IA 4ACSA 4D73B 1LBKA 3C71A 1HD2A 2HFDA 4K6XA 2LNSA 4TXVA 3IPZA 3L4NA 4MH2A 2K8SA 1K0OA 2AUVA 3UARA 1J9BA 22GSA 1SKSB 3IK9A 1EWXA 1M99A 1GRXA 4OCFA 3EE2A 2GSSA 4H86A 3S9FA 4V1Ap 1GP1A 3FR6A 1PQNA 3QOUA 1SD8A 4MH3A 3KJYA 1GSUA 2H73A 5CRHA 3LORA 1MD4A 2CQ9A 1ZCPA 2VLUA 3HHVA 1W4VA 3DKSA 9GSSA 3KCMA 2VM1A 1I5GA 1DUGA 1TRWA 3P7XA 2BTOT 5HR1A 1B8XA 5DVBA 4IN0A 4MZBA 5ID2A 2XHFA 3DD3A 1GTAA 1JZOA 2YN1A 3RBTA 5HFKA 4ULXA 3IHQA 2VO4A 1GTBA 2AYTA 1ZMAA 2VAFA 4I8BA 2E0QA 3HKRA 2ZNMA 3KMNA 3ZZXA 1H4OA 4TOPA 1M2BA 5J41A 1U88A 4MK3A 5CREA 3UIWA 4HQZA 1AQVA 1GSEA 4PTSA 3C7MA 2JADA 5IOWA 3VWVA 3WD6A 1HYUA 2LRNA 4GQFA 2EIOA 3F4TA 3VWXA 1ERUA 1BQ7A 4QQ7A 4MJAA 1XWAA 1TJDA 4KDYA 2E7PA 6GSVA 4EL1A 1PL2A 2WGRA 3PH9A 2PMTA 3AY8A 4K8MA 3TUEA 4HU7A 1JZRA 1R5PA 1U3IA 2WB9A 2VCXA 2QGVA 2Z9SA 2O89A 2IJYA 2VCWA 5KN1A 2FD3A 1XCCA 5H5RA 3BOAA 4WBRD 5HR0A 1EGOA 1USBA 2VOCA 5CRDA 5IPHA 4EXJA 4KCAA 3LG6A 4ML1A 5G31A 3TRXA 4WXTA 4XCSA 2NTOA 1MDKA 2H6YA 2KUCA 5IOXA 2OADA 4FIWA 2FY6A 3HJMA 1VF2A 2PU9C 3IBHA 4GSNA 3LWAA 2M46A 2YV7A 1ZGNA 4V2LA 4F9ZA 3US3A 3UJ1A 1GULA 5ABRA 3TDGA 2VCVA 4JR4A 1S3DA 5EVOA 1WE0A 4HQSA 4CDOA 2EC4A 4J56E 3HVXA 3W8SA 3DEXA 5KEJA 3RAZA 2WDUA 1SENA 5F07A 2PVOC 1SJ6A 5CNWA 1KBNA 1KTEA 2LNTA 4MPFA 4K2DA 3LGCA 4HZ4A 2L6DA 4USSA 3F9UA 1UVZA 1A2MA 11GSA 1TTZA 1LU4A 3TRQA 4V2NA 2RM5A 5GAPD 2YWNA 2H76A 1R7HA 5DBQA 3GH6A 1MDJA 3FK8A 1S3CA 1B9XC 5J4UA 1AQXA 4Q5NA 1OC8A 1JLWA 1J0FA 3ZRDA 3QD9A 1KNGA 3BBYA 1TK5B 5IMCA 4WR4A 3E9JB 2ZCTA 4ML6A 4QL9A 5IMVA 4NV2A 3HJOA 1GLPA 3RHCA 2KLXA 5ENUA 4N0VA 1ZYQB 3RPNA 3PR8A 4ZIJA 3P90A 2HE3A 3DXBA 4KCEA 1X5EA 2V6OA 1Y25A 4ECBA 1MEKA 4ISDA 4FYUA 2M80A 2DJ0A 5C04A 2A4VA 3IOSA 4F0CA 4E8HA 2FGXA 3F6FA 2WFCA 1ZL9A 4L0WA 5JCWA 2P0GA 5G5FA 2N5FA 4RQRA 3MWHA 2P5RA 1A8LA 4MMMA 1PMTA 1TP9A 2OBIA 1XIYA 2B5EA 3EWLA 2H1AA 5EPFA 3GKNA 3LXTA 4POBA 1FB0A 2YCDA 3GYKA 3F6DA 3W6GA 2X8CA 4PUFC 1SK2A 4ZBAA 2YV9A 4P3YB 1RW1A 1YY7A 3N9JA 1KEBA 2I81A 4Q5QA 1TKDB 2X8GA 2C3NA 3Q19A 1EOHA 3QAVA 3HDCA 1EOGA 1F6MC 2GZZA 4MJEA 1WWJA 4RI6A 4YQUA 3L9VA 1G6WA 1JHBA 2C0GA 3H93A 3FR9A 4MJCA 3RHBA 2R2JA 1TU8A 2XPDA 4YAPA 6GSTA 3EURA 3KH7A 1ACVA 3A2VA 4FYCA 2ON5A 4AGSA 2HYXA 4JZQA 4OFMA 1HNAA 4GCIA 1M9AA 4HS1A 1SYXA 1OC9B 2H70A 2MYGA 1TK0B 5BMUA 1BG5A 1NSWA 4DSRA 1B4QA 3GN3A 1T00A 1TOFA 3F3RA 5D8IA 2J9HA 2TIRA 1ZOFA 2ALBA 2VCQA 4BL7A 3APSA 1YKAA 2LJAA 3KD0A 5HR3A 2B7KA 2IMKA 5ELAA 1GUMA 1R4WA 2DIYA 4MA9A 4ZL8A 1XZOA 2H1GA 4EKZA 3WT1A 2M72A 4WF4A 2H1BA 2L4QA 5IIZA 3I6AA 2KOKA 5B8AA 1IYIA 3IA1A 4PUAA 2DMMA 2LEGA 3ZITA 3KMOA 2N5BA 3GX0A 4L8EA 3LSZA 4PURA 4HUAA 1A0FA 4AJ8A 2HRKA 5EL8A 3MSZA 4HEA2 2IMEA 4OCEA 3QFAC 1U87A 2X64A 5FHIA 4HJ2A 2WCIA 2EIRA 4PNGA 2HZEA 3LXZA 3Q6OA 3I9V2 4KSOA 5LNKe 1T4ZA 2PGTA 3ERGA 4JU5A 4KUNA 5ELGA 6GSUA 3U5RE 3LYPA 1PD21 1J08A 3UVTA 1EP7A 3Q74A 2MMNA 2YWIA 5D73A 3FYGA 1EZKA 2WRTA 4TRXA 5CAXA 3TKPA 1GWCA 2VL9A 5DQYA 1GUKA 4GQCA 2VL2A 2YZUA 5D9WA 3CTFA 1VF1A 4PNFA 3BD2A 2V2GA 3F63A 1XVWA 3TKSC 2HSHA 5HFIA 3TJGA 5KN0A 1ST9A 3ME8A 1SK1A 4HZ2A 2H75A 3QMXA 3APOA 3VPQA 3FR3A 2CVDA 4X43A 3ED3A 3E0UA 4XS1A 1TXXA 3H4KA 2B5XA 2H1DA 2B7JA 3LFLA 1THXA 4TKYA 3H1NA 5JWOB 3QAGA 3TJKA 3ME7A 4ZBBA 5GZZB 1GSQA 2XBQA 2F9SA 3IK7A 4KF9A 1ON4A 2L57A 3LJRA 4EE0A 4G9HA 2D2ZA 4IJIA 1M9BA 4TXOA 4EUYA 2DIZA 4K0GA 5IQYA 5IPGA 4NMUA 3VFIA 2DJJA 2HI7A 4MLYA 3HD5A 2H71A 4TN8A 4MF6A 1WIKA 3FRCA 3HYPA 4I2TA 5ECKB 1V57A 1EEJA 3L9SA 1GNEA 2OJLA 1K0MA 2PWJA 2FLSA 4G0KA 3GKKA 4ILFA 4LMVA 4YAVA 3KEBA 5J5NA 2JU5A 1EEMA 4J57E 3IR4A 1Z7RA 2BJXA 4YQVA 5JCUA 2H01A 2C3QA 4JE1A 2LRTA 1YQ1A 4OFNA 4G2EA 2G2QA 5IMAA 4TXOB 1ML6A 1SU9A 3FZ4A 2HXKA 2H0GA 4GTUA 1Z6MA 3E3EA 3FHKA 5FWGA 5IO2A 1K3OA 3QFBC 2B1KA 4AJ7A 1WJKA 4WF5A 13GSA 1AAZA 1FVKA 2HRNA 3I69A 1R26A 2PBJA 3GH9A 4I2UA 2AHEA 3GV1A 2J23A 2L5LA 1PSQA 5G1LA 3WT2A 3ZVJD 3GRXA 3CRUA 4POMA 5ID2B 2TRXA 1HNCA 3DRNA 2QKEA 4XS4A 3J7Yk 2DJ1A 3VWUA 3M0FA 4KAEA 3GMFA 3DMLA 4ZB8A 4N30A 3TJBA 3KGKA 1XW5A 1F9MA 3ERWA 4JEDA 2JZTA 2GGTA 3DGQA 3TOUA 1G7EA 2VCZA 3IXRA 1QK8A 3ZREA 1IYHA 5DJLA 5HFGA 1T1VA 2H74A 3VI5A 2OA7A 2EIQA 1O8XA 4X0XA 4KE3A 1O7UA 4XRDA 4G10A 2FA4A 4KDXA 2GT5A 2CV4A 1SKRB 2DJ3A 1QFNA 4F82A 5IMZA 1PX6A 1RQMA 4FQUA 1TRUA 3A3TA 4KX4A 4WKWA 5IMFA 1YF1A 18GSA 4O5RA 2NVLA 1FG4A 2L5OA 4XS4B 4DSSA 3GL5A 3RDWA 4JRRA 1F2EA 1K3LA 19GSA 4KH7A 5D9TA 1W89A 1V58A 3L78A 2V6KA 3F3QA 1DSBA 4MZCA 1QGVA 1X5CA 1B4PA 3ZFLA 2H66A 4EDZA 1PGTA 5AGYA 1XOAA 5FT3A 3O3TA 2N5AA 1LJRA 2I9HA 6GSYA 1X9SB 2B3SA 4XRAA 1XWKA 1QQ2A 4ZL7A 5IO0A 2GQLA 4ID0A 3KZQA 4YH2A 2R5GA 3IC4A 1EV4A 2I1UA 4IS0A 3ZMLA 2P31A 4NHZA 6GSWA 2F3MA 3TCOA 5ECNB 4MCUA 1QUWA 3IE3A 2VD1A 2ON7A 2MBSA 14GSA 2YJ7A 2FWGA 2LJRA 1AIUA 2WZ9A 4ECJA 1JLVA 1AQWA 3GSTA 5G2ZA 3JCML 2C0DA 5ECRB 4HDEA 2OE1A 1JZWA 2PN8A 1VGLA 2CZ3A 4IGJA 2QC7A 1GSDA 1FO5A 1A0RP 3M8NA 3GKXA 3SBCA 3IAM2 3KTLA 2B6MA 1AW9A 2DC5A 3CXGA 5COHA 4AF2A 4TVEA 3D4TA 3EU3A 1THOA 4NV5A 3BCIA 3GURA 3ISOA 3IAS2 2FCHA 3MDKA 1ZYEA 2YOIA 3MAKA 2LSTA 1VF4A 5CRGA 2KHPA 3BCKA 2C8UA 2VLTA 4AJ6A 3ERFA 4NHWA 1XPVA 2KP1A 4XHMA 4F0BA 5ECHB 4RI7A 1Z5YE 2PPTA 2IPAA 1GSFA 4L5LA 2PVQA 4KB3A 4QL7A 4BWSA 1PKWA 3UVHA 4BWQA 2JSZA 2O8VB 5ECLB 2NPBA 3GX8A 1MD3A 4IVFA 1NHYA 10GSA 4L0UA 3VPTA 1T3BA 1YZXA 3UAPA 5CP1A 3D6IA 4L5OA 1ZZYA 1JZDA 3CRTA 5F06A 1K0BA 5B8BA 2V32A 2JL4A 4K7NA 4DVCA 2H6ZA 4ECCA 1YF0A 3LEFA 1O6JA 1BX9A 2H19A 4I5QA 1K0CA 1OE8A 1PA3A 4LL4B 1XOBA 2H30A 1F3BA 3GKMA 4PQIA 4ZB6A 3GA4A 1DE1A 1FB6A 1HNBA 1VRSD 4N0ZA 5AIXA 2MMZA 2VUPA 3F4RA 4KA0A 5H5QA 4F03A 1O85A 4O7HA 4N10A 3HA9A 16GSA 5C00A 2A2SA 2RUFA 3G9BA 3TOTA 3SWLA 2AAWA 1OYJA 4G0IA 2IIYA 1A2JA 1O73A 1EGRA 3FKFA 1Z9HA 1YDKA 2GTUA 4EDYA 2HT9A 3DIEA 5A4WA 6GSXA 4OFTA 3C1RA 3M9JA 3VI7A 3DVXA 1X5DA 5LD0A 3WGDA 5IMDA 4LA1A 2G0FA 2R37A 3GUSA 2KP2A 3IC8A 2MMAA 3K8NA 3F8UA 1XW6A 2WS2A 3H79A 4TR0A 1GTIA 3GFKA 1WRYA 3TKSA 2MZCA 3CBUA 1JFUA 3EU4A 3FEUA 2GSTA 3D21A 1GTUA 5KN3A 5D9VA 1B9YC 5AIVA 4ECIA 2B5YA 3G7JA 3CSIA 5G1KA 1BYEA 1ERTA 3HY2A 4BL7B 3BJ5A 2GDRA 2H0IA 4FO5A 20GSA 3TJFA 1HQOA 1AUCA 2AV4A 2JZRA 4G0LA 3WGXA 1V9WA 4PQHA 1Y6EA 2VIMA 4CHSA 3A5WA 1SK0A 4D73A 3G7YA 4FYBA 2L6CA 2C4JA 1K0NA 1XWCA 2X8HA 3GL3A 3N5OA 2LS5A 4TR4A 5DALA 3L0HA 3ZL5A 1EP8A 1FW1A 1Z6NA 1OKDA 4F2IA 4HOJA 2WULA 2ZUPA 3HXSA 4ZL9A 2OACA 5B6NA 2HRKB 2LQOA 4PGTA 3EMPA 1V40A 2B1LA 4NXIA 4O92A 2HZEB 4HJMA 4IBPA 3FZAA 2UZ8A 2OBKA 2XPEA 1I9DA 2DBCA 2YJHA 1XWBA 3DWVA 2F8FA 2TRCP 4XTSA 4BPYA 4GSTA 1A24A 3C73A 2LJKA 1X9MB 1H75A 2DJ2A 5A4UA 2O7KA 2LUSA 5JCGA 1G6YA 5DALB 1U6TA 5DCHA 3FZ5A 2V41A 4IP1A 2K18A 2K6VA 2VL2C 3ZYWA 2HQTA 3NZNA 2GZYA 4OWYA 3KM6A 4E8EA 2FWFA 2V1MA 1XWGA 3KH9A 2AJQB 2K9FA 2HLSA 1YEPA 4MP4A 4K7OA 4LL1B 1X9WB 3OR5A 3UL3A 4IKHA 1OAZA 1YEXA 5AN1A 4XS6A 1AXDA 2GLRA 4GSSA 1E6BA 5LCZA 5E4WA 3TRPA 1GUHA 2R6KA 1GH2A 3F4SA 5HR2A 2E2MA 5DCGA 4WETA 2CAIA 2HRAA 4MPGA 4IELA 1GNWA 3MNGA 1TDIA 3H8QA 3U6VA 3UBLA 2YWMA 2CA8A 4IQAA 2GSQA 1DBYA 2I4AA 2F8AA 1PL1A 3M3MA 2ES7A 1MTCA 4MF5A 2OE3A 4PX1A 2RIIA 3UOMA 2L4CA 3HVVA 2H6XA 3UBKA 5EY6A 3DYRA 4KDUA 4TW5A 5DDLA 2IWTA 1R5AA 2CAQA 1SJIA 4V1Ag 2C0EA 2H0HA 4N11A 3RPPA 1RK4A 1ILOA 1SL2B 1BEDA 3ZMKA 1UA5A 4LLRA 4WEYA 1M2AA 1V98A 3HCZA 4YQMA 4ZILA 2BMXA 1FVJA 1Q98A 12GSA 3VLNA 4DEJA 5JWRB 2X99A 2YNXA 4IHUA 3C1SA 5ECMB 1ERVA 2VCTA 3PPUA 2A2RA 4TR1A 4IW9A 1E2YA 2VD0A 4OO4A 3QCPA 1OE7A 3EC3A 1AC1A 2XC2A 1SL0B 3IRAA 4BVYA 3FZ9A 2CX3A 3C8EA 2IMDA 2FWHA 5CO3A 4I6XA 1T7PB 1M2DA 3UEMA 2C80A 2NBSA
chains in the Genus database with same CATH superfamily
4NAXA 1Q4JA 4K0NA 2E2GA 1N2AA 1BG1A 2OE0A 2GT6A 2I3YA 2C0FA 1NM3A 2H8LA 5CRWA 4IP6A 2DMLA 2JACA 5D93A 1K0DA 4J2FA 5DJMA 2GQKA 3ZIVA 2WVXA 1Z3EA 4HU9A 5G30A 2WJUA 3R2QA 1G7OA 3HVSA 1YEWC 4HI7A 1NHOA 3EMXA 4MZWA 3KIJA 3ZLPA 1N8JA 1TI1A 1F3AA 5GSSA 1M0UA 3TKRA 1TW9A 5DAKA 5AISA 3EYTA 5B7CA 3WYWA 2REMA 3CSHA 1O8WA 2PUKC 3O76A 4TR1B 3P8WA 2DJKA 4XIHA 2IL3A 4EO3A 4NPBA 2CVKA 3M1GA 2JZSA 3HJPA 3VK9A 3FY7A 1QXHA 3QPMA 2PERA 4OMVA 1Z7PA 2CX4A 4BVYB 4ZB7A 2WZSA 4GF0A 4RQXA 4ZB9A 2FUG2 1PN9A 2GQMA 5J9BA 5F8BA 5E59A 1SKWB 2VL3A 3G7IA 5GAND 4Z2RA 1PRXA 2HNLA 1GSSA 1S3AA 3CYNA 2MMOA 5D9XA 1A23A 4OD7A 1GLQA 4V2MA 1CQHA 5F0GA 5A34A 4BA7A 4DSSB 2GS3A 2WVXB 2CVBA 2IMFA 1GL8A 1FOHA 1XVQA 1NW2A 1WMJA 3A2XA 2RM6A 3EVIA 5ECPB 1I1IP 4Z2UA 5DAKB 1XXUA 2DKHA 5KN2A 4POLA 5IM9A 4POKA 5GSTA 1K0AA 4JR6A 5INYA 3KTBA 1FAAA 4MABA 5ECOB 5B6MA 1A8YA 1ERWA 2QSIA 4ZXGA 4TR3A 5L71A 4O32A 4MJBA 3LYKA 2O85A 5F05A 1URMA 4K5SA 2O3EA 2O5VA 1BJXA 2GVPA 4EC0A 5A5KA 7GSSA 4K7IA 1SD9A 1WOUA 5ECQB 3GNJA 2LQQA 1DE2A 5HQPA 1GSYA 1FHEA 4FH8A 3TGZA 1ZYPA 4NWYA 1F37A 3RFRC 2CZ2A 5G5EA 4PQ1A 2RUEA 3R3EA 2MBTA 1FOVA 2LTKA 2HSMA 4KW6A 1OC9A 4MF7A 3APQA 5J3RA 1SL1B 2VM2A 5H5SA 3GTUA 1SJZA 3TB2A 3KXOA 3TJJA 1EV9A 4IQ1A 1O81A 3DVWA 2YZHA 4DSQA 2VLVA 4KNDA 3CTGA 4I97A 4GLTA 2WW1A 2YP6A 3GIXA 4WBJA 1UN2A 4Q5RA 2IN3A 4EF0A 4MDCA 4EIQA 2DSAA 1XW9A 2HZFA 1MDIA 3KP9A 3QAWA 4OO5A 4Q5FA 3J7Yb 2YWOA 3VURA 4ZBDA 8GSSA 3P2AA 2FNOA 3W8JA 2C1YA 2R4VA 3A2WA 1TK8B 5J9CA 2CT6A 3ZTLA 3D22A 2XBIA 4AKXB 3I43A 2O87A 5D96A 1X0RA 3ZIJA 3M9KA 1PX7A 2OKAA 1C72A 2HSMB 3HVNA 4G19A 1WP0A 2QA2A 4RUVA 5DQSA 2YANA 3GTUB 4EVMA 3GHAA 2P5QA 4GXZA 3L9UA 3NIVA 2HSYA 3KP8A 1S3RA 2IFQA 1N25A 5A4VA 4K9ZA 5J4VA 3HZ4A 2C3TA 4IJ3A 1OVNA 2LKUA 3GSSA 5ECIB 4WR5A 3ZVJA 1K3YA 4KGIA 3TKQA 2H72A 3Q18A 2JSYA 2RLIA 1YJ6A 4BVXA 3FW2A 1B48A 3D0ZA 4X1UA 4Z7XA 1WPIA 3D5JA 2AB6A 3TU3B 2HSNB 2IMIA 4KSMA 2GZPA 3D4MA 1BAYA 6GSSA 1ABAA 2GSRA 1CQGA 1G0TA 17GSA 2LV3A 4JBBA 1OC3A 4HSCX 5ECSA 2R3XA 3HZ8A 2DLXA 1TI3A 1TU7A 3CMIA 4CW9A 1XFLA 1QMVA 1UC7A 4K1FA 2IFQB 1OKTA 2FHEA 1A2LA 1TRSA 1U3AA 1T8EB 2FA8A 2LRCA 1V2AA 4YKFA 4LMWA 2K8VA 4BVXB 3CSJA 5JWQB 1YKCA 3PGTA 3PINA 5CYYA 3TKSE 3QR6A 4GWRA 4PXOA 3NOFA 3ZFBA 2NDOA 3UMAA 1TRVA 1SYRA 1VF3A 4GRFA 2L59A 1M7TA 2YPMA 3VWWA 3EINA 2F51A 2HRFA 3V1WA 1XBSA 2FWEA 3IDVA 3QDNA 3IV4A 3LQ7A 1T4YA 1PKZA 3O6TA 3WGEA 3F0IA 4ACSA 4D73B 1LBKA 3C71A 1HD2A 2HFDA 4K6XA 2LNSA 4TXVA 3IPZA 3L4NA 4MH2A 2K8SA 1K0OA 2AUVA 3UARA 1J9BA 22GSA 1SKSB 3IK9A 1EWXA 1M99A 1GRXA 4OCFA 4EIPA 3EE2A 2GSSA 4H86A 3S9FA 4V1Ap 1GP1A 3FR6A 1PQNA 3QOUA 1SD8A 4MH3A 3KJYA 1GSUA 2H73A 4PI0C 5CRHA 4AKGA 3LORA 1MD4A 2CQ9A 1ZCPA 2VLUA 3HHVA 1W4VA 3DKSA 9GSSA 3KCMA 2VM1A 1SVMA 1I5GA 1DUGA 1TRWA 2OT3A 3P7XA 2BTOT 5HR1A 1B8XA 5DVBA 4IN0A 4MZBA 5ID2A 2XHFA 3DD3A 1GTAA 1JZOA 2YN1A 3RBTA 5HFKA 4ULXA 3IHQA 2VO4A 1GTBA 4CY6A 2AYTA 1ZMAA 2VAFA 4I8BA 2E0QA 3HKRA 2ZNMA 3KMNA 3ZZXA 1H4OA 4TOPA 1M2BA 5J41A 1U88A 4MK3A 5CREA 3UIWA 4HQZA 1AQVA 1GSEA 4PTSA 3C7MA 2DKIA 2JADA 5IOWA 3VWVA 3WD6A 1HYUA 2LRNA 4GQFA 2EIOA 3F4TA 3VWXA 1ERUA 1BQ7A 4QQ7A 4MJAA 1XWAA 1TJDA 4KDYA 3FMWA 2E7PA 6GSVA 4EL1A 1PL2A 2WGRA 3PH9A 2PMTA 3AY8A 4K8MA 3TUEA 4HU7A 1JZRA 1R5PA 1U3IA 2WB9A 2VCXA 2QGVA 2Z9SA 2O89A 2IJYA 2VCWA 5KN1A 2FD3A 1XCCA 5H5RA 3BOAA 4WBRD 5HR0A 1EGOA 1USBA 2VOCA 5CRDA 4PHZC 5IPHA 4EXJA 4KCAA 3LG6A 4ML1A 5G31A 3TRXA 4WXTA 4XCSA 2NTOA 1MDKA 2H6YA 2KUCA 5IOXA 2OADA 1Y1UA 4FIWA 2FY6A 3HJMA 1VF2A 2PU9C 3IBHA 4GSNA 3LWAA 2M46A 5KOWA 2YV7A 1ZGNA 4V2LA 4F9ZA 3US3A 3UJ1A 1GULA 5ABRA 3TDGA 2VCVA 4JR4A 1S3DA 5EVOA 4O5UA 3CWGA 1WE0A 4HQSA 4CDOA 2EC4A 4J56E 3HVXA 3W8SA 3DEXA 5KEJA 3RAZA 2WVZA 2WDUA 1SENA 5F07A 3MYDA 2PVOC 4MNNA 1SJ6A 5CNWA 1KBNA 1KTEA 2LNTA 4MPFA 4K2DA 3LGCA 4HZ4A 4K2XA 2L6DA 4USSA 3F9UA 1UVZA 1A2MA 3IHGA 11GSA 1TTZA 1LU4A 3TRQA 4FXYP 4V2NA 2RM5A 5GAPD 2YWNA 2H76A 1R7HA 5DBQA 3GH6A 1MDJA 3FK8A 1S3CA 1B9XC 5J4UA 4G01A 1AQXA 4Q5NA 1OC8A 1JLWA 1J0FA 3ZRDA 3QD9A 1KNGA 3BBYA 1TK5B 5IMCA 4WR4A 3E9JB 2ZCTA 4ML6A 4QL9A 5IMVA 4NV2A 3HJOA 1GLPA 3RHCA 2KLXA 5ENUA 4N0VA 1ZYQB 3RPNA 3PR8A 4ZIJA 3P90A 2HE3A 3DXBA 2R0GA 4KCEA 1X5EA 2V6OA 1Y25A 4ECBA 1MEKA 4ISDA 4FYUA 2M80A 2DJ0A 5C04A 1ZYNA 2A4VA 4F0CA 3IOSA 4E8HA 2FGXA 3F6FA 2WFCA 1ZL9A 4L0WA 5JCWA 2VKZG 2P0GA 5G5FA 2N5FA 4RQRA 3MWHA 2P5RA 1A8LA 4MMMA 1PMTA 1TP9A 2OBIA 1XIYA 2B5EA 3EWLA 2H1AA 5EPFA 3GKNA 3LXTA 4POBA 1FB0A 2YCDA 3GYKA 5A34B 3F6DA 3W6GA 2X8CA 4PUFC 1SK2A 4ZBAA 2YV9A 4P3YB 1RW1A 4YKGA 1YY7A 3N9JA 1KEBA 2I81A 4Q5QA 1TKDB 4AKIA 2X8GA 2C3NA 3Q19A 1EOHA 3QAVA 3HDCA 1EOGA 1F6MC 2GZZA 4MJEA 1WWJA 4W66A 4RI6A 2X4AA 4YQUA 3L9VA 1G6WA 1JHBA 2C0GA 3H93A 3FR9A 4MJCA 3RHBA 2R2JA 1TU8A 2XPDA 1BF5A 4YAPA 6GSTA 3EURA 3KH7A 1ACVA 3A2VA 4FYCA 2ON5A 4AGSA 2HYXA 4JZQA 4OFMA 1HNAA 4GCIA 5A5HA 1M9AA 2WW3A 4HS1A 1SYXA 1OC9B 2H70A 2MYGA 3LW9A 1TK0B 5BMUA 1BG5A 1NSWA 4DSRA 1B4QA 3GN3A 1T00A 1TOFA 3F3RA 5D8IA 2J9HA 2TIRA 1ZOFA 2ALBA 2VCQA 4BL7A 3APSA 1YKAA 2LJAA 3KD0A 5HR3A 2B7KA 2IMKA 5ELAA 2R0PA 1GUMA 4BIKA 1R4WA 2DIYA 4MA9A 4ZL8A 1XZOA 2H1GA 4EKZA 3WT1A 2M72A 4WF4A 2H1BA 2L4QA 5IIZA 3I6AA 2KOKA 5B8AA 1IYIA 3IA1A 4PUAA 2DMMA 2LEGA 3ZITA 3KMOA 2N5BA 3GX0A 4L8EA 3LSZA 4PURA 4HUAA 1A0FA 4AJ8A 2HRKA 5EL8A 3MSZA 4HEA2 2IMEA 4OCEA 3QFAC 1U87A 2X64A 5FHIA 4HJ2A 2WCIA 2EIRA 4PNGA 2HZEA 3LXZA 3Q6OA 3I9V2 4KSOA 5LNKe 1T4ZA 2PGTA 3ERGA 4JU5A 4KUNA 5ELGA 6GSUA 3U5RE 3LYPA 1PD21 1J08A 3UVTA 1EP7A 3Q74A 2R0CA 2MMNA 2YWIA 5D73A 3FYGA 1EZKA 2WRTA 4TRXA 5CAXA 3TKPA 1GWCA 2VL9A 5DQYA 1GUKA 4GQCA 2VL2A 2YZUA 5D9WA 3CTFA 1VF1A 4PNFA 3BD2A 2V2GA 3F63A 1XVWA 3TKSC 2HSHA 5HFIA 1SVOA 3TJGA 5KN0A 1ST9A 3ME8A 1SK1A 4HZ2A 2H75A 3QMXA 3APOA 3VPQA 3FR3A 2CVDA 4X43A 5KOXA 3ED3A 3E0UA 4XS1A 1TXXA 3H4KA 2B5XA 2H1DA 2B7JA 3LFLA 1THXA 4TKYA 3H1NA 5JWOB 3QAGA 3TJKA 3ME7A 1XG8A 4ZBBA 3MIXA 5GZZB 1GSQA 2XBQA 2F9SA 3IK7A 4KF9A 1ON4A 2L57A 3A5IA 3LJRA 4EE0A 4G9HA 2D2ZA 4IJIA 1M9BA 4TXOA 4EUYA 2DIZA 4K0GA 5IQYA 5IPGA 4NMUA 3VFIA 4O5QA 2DJJA 2HI7A 4MLYA 3HD5A 2H71A 4TN8A 4MF6A 1WIKA 3FRCA 3HYPA 4I2TA 5ECKB 1V57A 4Z2TA 1EEJA 3L9SA 1GNEA 2OJLA 1K0MA 2PWJA 2FLSA 4G0KA 3GKKA 4ILFA 4ICYA 4LMVA 4YAVA 3KEBA 5J5NA 2O36A 2JU5A 1EEMA 4E68A 4J57E 3IR4A 1Z7RA 2BJXA 4YQVA 5JCUA 2H01A 2C3QA 4JE1A 2LRTA 1YQ1A 4OFNA 4G2EA 2G2QA 5IMAA 4TXOB 1ML6A 1SU9A 3FZ4A 2HXKA 2H0GA 4GTUA 5A1NA 1Z6MA 3E3EA 3FHKA 5FWGA 5IO2A 1K3OA 3QFBC 2B1KA 4AJ7A 1WJKA 4WF5A 13GSA 1AAZA 1FVKA 2HRNA 3I69A 1R26A 2PBJA 3GH9A 4I2UA 2AHEA 3GV1A 2J23A 2L5LA 1PSQA 5G1LA 3WT2A 3ZVJD 3GRXA 3CRUA 4POMA 5ID2B 2TRXA 1HNCA 3DRNA 2QKEA 4XS4A 3J7Yk 2DJ1A 3VWUA 3M0FA 4KAEA 3GMFA 3DMLA 4ZB8A 4N30A 3TJBA 3KGKA 2UV8G 1XW5A 1F9MA 3ERWA 4JEDA 2JZTA 2GGTA 3DGQA 3TOUA 1G7EA 2VCZA 3IXRA 1QK8A 3ZREA 1IYHA 5DJLA 5HFGA 2H1LA 1T1VA 2H74A 3VI5A 5A1NB 2OA7A 2EIQA 1O8XA 4X0XA 4KE3A 2WVYA 1O7UA 4XRDA 4G10A 2FA4A 3CHXC 4KDXA 2GT5A 2CV4A 1SKRB 2DJ3A 5J4YA 4A5PA 1QFNA 4F82A 5IMZA 1PX6A 1RQMA 4FQUA 1TRUA 3A3TA 4KX4A 4WKWA 5IMFA 1YF1A 18GSA 4O5RA 2NVLA 1FG4A 2L5OA 4XS4B 4DSSA 3GL5A 3RDWA 4JRRA 1F2EA 1K3LA 19GSA 4KH7A 5D9TA 1W89A 1V58A 3L78A 2V6KA 3RGBC 3F3QA 1DSBA 4MZCA 1QGVA 1X5CA 1B4PA 3ZFLA 2H66A 4EDZA 1PGTA 5AGYA 1XOAA 5FT3A 3O3TA 2N5AA 1LJRA 2I9HA 6GSYA 1X9SB 2B3SA 4XRAA 1XWKA 1QQ2A 4ZL7A 5IO0A 2GQLA 4ID0A 3KZQA 4YH2A 2R5GA 3IC4A 1EV4A 2I1UA 4IS0A 3ZMLA 2P31A 4NHZA 4K5RA 6GSWA 2F3MA 3TCOA 5ECNB 4MCUA 1QUWA 3IE3A 2VD1A 2ON7A 2MBSA 14GSA 2YJ7A 2FWGA 2LJRA 1AIUA 2WZ9A 4ECJA 1JLVA 1AQWA 3GSTA 5G2ZA 3JCML 2C0DA 2A2PA 5ECRB 4HDEA 2OE1A 1JZWA 2PN8A 1VGLA 2CZ3A 4IGJA 1PN0A 2QC7A 1GSDA 1FO5A 1A0RP 3M8NA 3GKXA 3SBCA 3IAM2 3KTLA 2B6MA 1AW9A 2DC5A 3CXGA 5COHA 4AF2A 4TVEA 3D4TA 3EU3A 1THOA 4NV5A 3BCIA 3GURA 3ISOA 3IAS2 2FCHA 3MDKA 1ZYEA 2YOIA 3MAKA 2LSTA 1VF4A 5CRGA 2KHPA 3BCKA 2C8UA 2VLTA 4AJ6A 1M3IA 3ERFA 4NHWA 1XPVA 2KP1A 4XHMA 4F0BA 5ECHB 4RI7A 1Z5YE 2PPTA 2IPAA 1GSFA 4L5LA 2PVQA 4KB3A 4QL7A 4BWSA 1PKWA 1SVLA 2EFHA 3UVHA 4BWQA 2JSZA 2O8VB 5ECLB 2NPBA 3GX8A 1MD3A 4IVFA 1NHYA 2EFEA 10GSA 4L0UA 3EPTA 3VPTA 1T3BA 1YZXA 3UAPA 5CP1A 3D6IA 4L5OA 1ZZYA 1JZDA 3CRTA 5F06A 1K0BA 5B8BA 2V32A 2JL4A 4K7NA 4DVCA 2H6ZA 4ECCA 1YF0A 3LEFA 1O6JA 1BX9A 2H19A 4I5QA 1K0CA 1OE8A 1PA3A 5BRTA 4LL4B 1XOBA 2H30A 1F3BA 3GKMA 4PQIA 4ZB6A 3GA4A 1DE1A 2HSNA 1FB6A 1HNBA 1VRSD 4N0ZA 5AIXA 2MMZA 2VUPA 3F4RA 4KA0A 5H5QA 2EFDA 4F03A 1O85A 4O7HA 4N10A 4CY8A 3HA9A 16GSA 5C00A 2A2SA 2RUFA 3G9BA 3TOTA 3SWLA 4AKHA 2AAWA 1OYJA 4G0IA 2IIYA 1A2JA 1O73A 1EGRA 3FKFA 1Z9HA 1YDKA 2GTUA 4EDYA 2HT9A 3DIEA 5A4WA 6GSXA 4OFTA 3C1RA 3M9JA 3VI7A 3DVXA 1X5DA 5LD0A 3WGDA 5IMDA 4LA1A 2G0FA 5J40A 2R37A 3GUSA 2KP2A 3IC8A 2MMAA 3K8NA 3F8UA 1XW6A 5A5HB 2WS2A 3H79A 4TR0A 1GTIA 3GFKA 1WRYA 3TKSA 2MZCA 3CBUA 1JFUA 3EU4A 3FEUA 2GSTA 3D21A 1GTUA 5KN3A 5D9VA 1B9YC 5AIVA 1PFOA 5BMUB 4ECIA 2B5YA 3G7JA 4GDFA 3CSIA 5G1KA 1BYEA 1ERTA 3HY2A 4BL7B 3BJ5A 2GDRA 2H0IA 4FO5A 20GSA 3TJFA 1HQOA 1AUCA 2AV4A 2JZRA 4G0LA 3WGXA 1V9WA 4PQHA 1Y6EA 2VIMA 4CHSA 3A5WA 1SK0A 4D73A 3G7YA 4FYBA 2L6CA 2C4JA 1K0NA 1XWCA 2X8HA 3GL3A 3N5OA 2LS5A 4TR4A 5DALA 3L0HA 4N3ZA 3ZL5A 1EP8A 1FW1A 1Z6NA 1OKDA 4F2IA 4HOJA 2WULA 2ZUPA 3HXSA 4ZL9A 2OACA 5B6NA 2HRKB 2LQOA 4PGTA 3EMPA 1V40A 2B1LA 4NXIA 4O92A 2HZEB 4HJMA 4IBPA 3FZAA 2UZ8A 2OBKA 4AI6A 2XPEA 1I9DA 2DBCA 2YJHA 1XWBA 3DWVA 4QMKA 2QA1A 2F8FA 2TRCP 4XTSA 4BPYA 4GSTA 1A24A 3C73A 2LJKA 1X9MB 1H75A 2DJ2A 5A4UA 2O7KA 2LUSA 5JCGA 1G6YA 5DALB 3CQFA 2A4HA 1U6TA 5DCHA 3FZ5A 2V41A 4IP1A 1TXUA 2K18A 2K6VA 2VL2C 3ZYWA 2HQTA 3NZNA 2GZYA 4OWYA 3KM6A 4E8EA 2FWFA 2V1MA 1XWGA 3KH9A 2AJQB 2K9FA 2WW2A 2HLSA 3HMJG 1YEPA 4MP4A 4K7OA 4LL1B 1X9WB 3OR5A 3UL3A 4IKHA 1OAZA 1YEXA 5AN1A 4XS6A 1AXDA 2GLRA 4GSSA 1E6BA 5LCZA 5E4WA 3TRPA 1GUHA 5J47A 2R6KA 1GH2A 3F4SA 5HR2A 2E2MA 5DCGA 4WETA 2CAIA 2HRAA 4MPGA 4IELA 1GNWA 3MNGA 1TDIA 3H8QA 3U6VA 3UBLA 2YWMA 2CA8A 4IQAA 2GSQA 2X49A 1DBYA 2I4AA 2F8AA 1PL1A 3M3MA 2ES7A 1MTCA 4MF5A 2OE3A 4PX1A 2RIIA 3UOMA 2EFCA 2L4CA 3HVVA 2H6XA 3UBKA 5EY6A 3DYRA 4KDUA 4TW5A 4X4JA 5DDLA 2IWTA 1R5AA 2CAQA 1SJIA 4V1Ag 1YVLA 2C0EA 2H0HA 4N11A 3RPPA 1RK4A 1S4BP 1ILOA 1SL2B 1BEDA 3ZMKA 1UA5A 4LLRA 4WEYA 1M2AA 1M3JA 1V98A 3HCZA 4YQMA 4ZILA 2BMXA 1FVJA 1Q98A 12GSA 2WW0A 3VLNA 4DEJA 5JWRB 2X99A 2YNXA 4IHUA 3C1SA 5ECMB 1ERVA 2VCTA 3PPUA 2A2RA 4TR1A 4IW9A 1E2YA 2VD0A 4OO4A 3QCPA 1OE7A 3EC3A 1AC1A 2XC2A 1SL0B 3IRAA 4PI2C 4BVYA 3FZ9A 2CX3A 3C8EA 2IMDA 2FWHA 5CO3A 4I6XA 1T7PB 1M2DA 3UEMA 2C80A 2NBSA
chains in the Genus database with same CATH topology
4NAXA 1Q4JA 4K0NA 2E2GA 1N2AA 1BG1A 2OE0A 2GT6A 2I3YA 2C0FA 1NM3A 2H8LA 5CRWA 4IP6A 2DMLA 2JACA 5D93A 1K0DA 4J2FA 5DJMA 2GQKA 3ZIVA 1Z3EA 4HU9A 5G30A 2WJUA 3R2QA 1G7OA 3HVSA 4HI7A 1NHOA 3EMXA 4MZWA 3KIJA 3ZLPA 1N8JA 1TI1A 1F3AA 5GSSA 1M0UA 3TKRA 1TW9A 5DAKA 5AISA 3EYTA 5B7CA 3WYWA 2REMA 3CSHA 1O8WA 2PUKC 3O76A 4TR1B 3P8WA 2DJKA 4XIHA 2IL3A 4EO3A 4NPBA 2CVKA 3M1GA 2JZSA 3HJPA 3VK9A 3FY7A 1QXHA 3QPMA 2PERA 4OMVA 1Z7PA 2CX4A 4BVYB 4ZB7A 4GF0A 4RQXA 4ZB9A 2FUG2 1PN9A 2GQMA 5J9BA 5F8BA 5E59A 1SKWB 2VL3A 3G7IA 5GAND 4Z2RA 1PRXA 2HNLA 1GSSA 1S3AA 3CYNA 2MMOA 5D9XA 1A23A 4OD7A 1GLQA 4V2MA 1CQHA 5F0GA 5A34A 4BA7A 4DSSB 2GS3A 2CVBA 2IMFA 1GL8A 1FOHA 1XVQA 1NW2A 1WMJA 3A2XA 2RM6A 3EVIA 5ECPB 4Z2UA 5DAKB 1XXUA 2DKHA 5KN2A 4POLA 5IM9A 4POKA 5GSTA 1K0AA 4JR6A 5INYA 3KTBA 1FAAA 4MABA 5ECOB 5B6MA 1A8YA 1ERWA 2QSIA 4ZXGA 4TR3A 5L71A 4O32A 4MJBA 3LYKA 2O85A 5F05A 1URMA 4K5SA 2O5VA 1BJXA 2GVPA 4EC0A 5A5KA 7GSSA 4K7IA 1SD9A 1WOUA 5ECQB 3GNJA 2LQQA 1DE2A 5HQPA 1GSYA 1FHEA 4FH8A 3TGZA 1ZYPA 4NWYA 1F37A 2CZ2A 5G5EA 4PQ1A 2RUEA 3R3EA 2MBTA 1FOVA 2LTKA 2HSMA 4KW6A 1OC9A 4MF7A 3APQA 5J3RA 1SL1B 2VM2A 5H5SA 3GTUA 1SJZA 3TB2A 3KXOA 3TJJA 1EV9A 4IQ1A 1O81A 3DVWA 2YZHA 4DSQA 2VLVA 4KNDA 3CTGA 4I97A 4GLTA 2YP6A 3GIXA 4WBJA 1UN2A 4Q5RA 2IN3A 4EF0A 4MDCA 4EIQA 2DSAA 1XW9A 2HZFA 1MDIA 3KP9A 3QAWA 4OO5A 4Q5FA 3J7Yb 2YWOA 3VURA 4ZBDA 8GSSA 3P2AA 2FNOA 3W8JA 2C1YA 2R4VA 3A2WA 1TK8B 5J9CA 2CT6A 3ZTLA 3D22A 2XBIA 4AKXB 3I43A 2O87A 5D96A 1X0RA 3ZIJA 3M9KA 1PX7A 2OKAA 1C72A 2HSMB 4G19A 1WP0A 2QA2A 4RUVA 5DQSA 2YANA 3GTUB 4EVMA 3GHAA 2P5QA 4GXZA 3L9UA 3NIVA 2HSYA 3KP8A 2IFQA 1N25A 5A4VA 4K9ZA 5J4VA 3HZ4A 2C3TA 4IJ3A 1OVNA 2LKUA 3GSSA 5ECIB 4WR5A 3ZVJA 1K3YA 4KGIA 3TKQA 2H72A 3Q18A 2JSYA 2RLIA 1YJ6A 4BVXA 3FW2A 1B48A 3D0ZA 4X1UA 4Z7XA 1WPIA 3D5JA 2AB6A 3TU3B 2HSNB 2IMIA 4KSMA 2GZPA 3D4MA 1BAYA 6GSSA 1ABAA 2GSRA 1CQGA 1G0TA 17GSA 2LV3A 4JBBA 1OC3A 5ECSA 2R3XA 3HZ8A 2DLXA 1TI3A 1TU7A 3CMIA 4CW9A 1XFLA 1QMVA 1UC7A 4K1FA 2IFQB 1OKTA 2FHEA 1A2LA 1TRSA 1U3AA 1T8EB 2FA8A 2LRCA 1V2AA 4YKFA 4LMWA 2K8VA 4BVXB 3CSJA 5JWQB 1YKCA 3PGTA 3PINA 5CYYA 3TKSE 3QR6A 4GWRA 4PXOA 3NOFA 3ZFBA 2NDOA 3UMAA 1TRVA 1SYRA 1VF3A 4GRFA 2L59A 1M7TA 2YPMA 3VWWA 3EINA 2F51A 2HRFA 3V1WA 1XBSA 2FWEA 3IDVA 3QDNA 3IV4A 3LQ7A 1T4YA 1PKZA 3O6TA 3WGEA 3F0IA 4ACSA 4D73B 1LBKA 3C71A 1HD2A 2HFDA 4K6XA 2LNSA 4TXVA 3IPZA 3L4NA 4MH2A 2K8SA 1K0OA 2AUVA 3UARA 1J9BA 22GSA 1SKSB 3IK9A 1EWXA 1M99A 1GRXA 4OCFA 4EIPA 3EE2A 2GSSA 4H86A 3S9FA 4V1Ap 1GP1A 3FR6A 1PQNA 3QOUA 1SD8A 4MH3A 3KJYA 1GSUA 2H73A 5CRHA 4AKGA 3LORA 1MD4A 2CQ9A 1ZCPA 2VLUA 3HHVA 1W4VA 3DKSA 9GSSA 3KCMA 2VM1A 1SVMA 1I5GA 1DUGA 1TRWA 2OT3A 3P7XA 2BTOT 5HR1A 1B8XA 5DVBA 4IN0A 4MZBA 5ID2A 2XHFA 3DD3A 1GTAA 1JZOA 2YN1A 3RBTA 5HFKA 4ULXA 3IHQA 2VO4A 1GTBA 4CY6A 2AYTA 1ZMAA 2VAFA 4I8BA 2E0QA 3HKRA 2ZNMA 3KMNA 3ZZXA 1H4OA 4TOPA 1M2BA 5J41A 1U88A 4MK3A 5CREA 3UIWA 4HQZA 1AQVA 1GSEA 4PTSA 3C7MA 2DKIA 2JADA 5IOWA 3VWVA 3WD6A 1HYUA 2LRNA 4GQFA 2EIOA 3F4TA 3VWXA 1ERUA 1BQ7A 4QQ7A 4MJAA 1XWAA 1TJDA 4KDYA 3FMWA 2E7PA 6GSVA 4EL1A 1PL2A 2WGRA 3PH9A 2PMTA 3AY8A 4K8MA 3TUEA 4HU7A 1JZRA 1R5PA 1U3IA 2WB9A 2VCXA 2QGVA 2Z9SA 2O89A 2IJYA 2VCWA 5KN1A 2FD3A 1XCCA 5H5RA 3BOAA 4WBRD 5HR0A 1EGOA 1USBA 2VOCA 5CRDA 5IPHA 4EXJA 4KCAA 3LG6A 4ML1A 5G31A 3TRXA 4WXTA 4XCSA 2NTOA 1MDKA 2H6YA 2KUCA 5IOXA 2OADA 1Y1UA 4FIWA 2FY6A 3HJMA 1VF2A 2PU9C 3IBHA 4GSNA 3LWAA 2M46A 5KOWA 2YV7A 1ZGNA 4V2LA 4F9ZA 3US3A 3UJ1A 1GULA 5ABRA 3TDGA 2VCVA 4JR4A 1S3DA 5EVOA 4O5UA 3CWGA 1WE0A 4HQSA 4CDOA 2EC4A 4J56E 3HVXA 3W8SA 3DEXA 5KEJA 3RAZA 2WDUA 1SENA 5F07A 3MYDA 2PVOC 4MNNA 1SJ6A 5CNWA 1KBNA 1KTEA 2LNTA 4MPFA 4K2DA 3LGCA 4HZ4A 4K2XA 2L6DA 4USSA 3F9UA 1UVZA 1A2MA 3IHGA 11GSA 1TTZA 1LU4A 3TRQA 4V2NA 2RM5A 5GAPD 2YWNA 2H76A 1R7HA 5DBQA 3GH6A 1MDJA 3FK8A 1S3CA 1B9XC 5J4UA 4G01A 1AQXA 4Q5NA 1OC8A 1JLWA 1J0FA 3ZRDA 3QD9A 1KNGA 3BBYA 1TK5B 5IMCA 4WR4A 3E9JB 2ZCTA 4ML6A 4QL9A 5IMVA 4NV2A 3HJOA 1GLPA 3RHCA 2KLXA 5ENUA 4N0VA 1ZYQB 3RPNA 3PR8A 4ZIJA 3P90A 2HE3A 3DXBA 2R0GA 4KCEA 1X5EA 2V6OA 1Y25A 4ECBA 1MEKA 4ISDA 4FYUA 2M80A 2DJ0A 5C04A 1ZYNA 2A4VA 4F0CA 3IOSA 4E8HA 2FGXA 3F6FA 2WFCA 1ZL9A 4L0WA 5JCWA 2VKZG 2P0GA 5G5FA 2N5FA 4RQRA 3MWHA 2P5RA 1A8LA 4MMMA 1PMTA 1TP9A 2OBIA 1XIYA 2B5EA 3EWLA 2H1AA 5EPFA 3GKNA 3LXTA 4POBA 1FB0A 2YCDA 3GYKA 5A34B 3F6DA 3W6GA 2X8CA 4PUFC 1SK2A 4ZBAA 2YV9A 4P3YB 1RW1A 4YKGA 1YY7A 3N9JA 1KEBA 2I81A 4Q5QA 1TKDB 4AKIA 2X8GA 2C3NA 3Q19A 1EOHA 3QAVA 3HDCA 1EOGA 1F6MC 2GZZA 4MJEA 1WWJA 4W66A 4RI6A 2X4AA 4YQUA 3L9VA 1G6WA 1JHBA 2C0GA 3H93A 3FR9A 4MJCA 3RHBA 2R2JA 1TU8A 2XPDA 1BF5A 4YAPA 6GSTA 3EURA 3KH7A 1ACVA 3A2VA 4FYCA 2ON5A 4AGSA 2HYXA 4JZQA 4OFMA 1HNAA 4GCIA 5A5HA 1M9AA 4HS1A 1SYXA 1OC9B 2H70A 2MYGA 3LW9A 1TK0B 5BMUA 1BG5A 1NSWA 4DSRA 1B4QA 3GN3A 1T00A 1TOFA 3F3RA 5D8IA 2J9HA 2TIRA 1ZOFA 2ALBA 2VCQA 4BL7A 3APSA 1YKAA 2LJAA 3KD0A 5HR3A 2B7KA 2IMKA 5ELAA 2R0PA 1GUMA 1R4WA 2DIYA 4MA9A 4ZL8A 1XZOA 2H1GA 4EKZA 3WT1A 2M72A 4WF4A 2H1BA 2L4QA 5IIZA 3I6AA 2KOKA 5B8AA 1IYIA 3IA1A 4PUAA 2DMMA 2LEGA 3ZITA 3KMOA 2N5BA 3GX0A 4L8EA 3LSZA 4PURA 4HUAA 1A0FA 4AJ8A 2HRKA 5EL8A 3MSZA 4HEA2 2IMEA 4OCEA 3QFAC 1U87A 2X64A 5FHIA 4HJ2A 2WCIA 2EIRA 4PNGA 2HZEA 3LXZA 3Q6OA 3I9V2 4KSOA 5LNKe 1T4ZA 2PGTA 3ERGA 4JU5A 4KUNA 5ELGA 6GSUA 3U5RE 3LYPA 1PD21 1J08A 3UVTA 1EP7A 3Q74A 2R0CA 2MMNA 2YWIA 5D73A 3FYGA 1EZKA 2WRTA 4TRXA 5CAXA 3TKPA 1GWCA 2VL9A 5DQYA 1GUKA 4GQCA 2VL2A 2YZUA 5D9WA 3CTFA 1VF1A 4PNFA 3BD2A 2V2GA 3F63A 1XVWA 3TKSC 2HSHA 5HFIA 1SVOA 3TJGA 5KN0A 1ST9A 3ME8A 1SK1A 4HZ2A 2H75A 3QMXA 3APOA 3VPQA 3FR3A 2CVDA 4X43A 5KOXA 3ED3A 3E0UA 4XS1A 1TXXA 3H4KA 2B5XA 2H1DA 2B7JA 3LFLA 1THXA 4TKYA 3H1NA 5JWOB 3QAGA 3TJKA 3ME7A 4ZBBA 3MIXA 5GZZB 1GSQA 2XBQA 2F9SA 3IK7A 4KF9A 1ON4A 2L57A 3A5IA 3LJRA 4EE0A 4G9HA 2D2ZA 4IJIA 1M9BA 4TXOA 4EUYA 2DIZA 4K0GA 5IQYA 5IPGA 4NMUA 3VFIA 4O5QA 2DJJA 2HI7A 4MLYA 3HD5A 2H71A 4TN8A 4MF6A 1WIKA 3FRCA 3HYPA 4I2TA 5ECKB 1V57A 4Z2TA 1EEJA 3L9SA 1GNEA 2OJLA 1K0MA 2PWJA 2FLSA 4G0KA 3GKKA 4ILFA 4ICYA 4LMVA 4YAVA 3KEBA 5J5NA 2JU5A 1EEMA 4E68A 4J57E 3IR4A 1Z7RA 2BJXA 4YQVA 5JCUA 2H01A 2C3QA 4JE1A 2LRTA 1YQ1A 4OFNA 4G2EA 2G2QA 5IMAA 4TXOB 1ML6A 1SU9A 3FZ4A 2HXKA 2H0GA 4GTUA 5A1NA 1Z6MA 3E3EA 3FHKA 5FWGA 5IO2A 1K3OA 3QFBC 2B1KA 4AJ7A 1WJKA 4WF5A 13GSA 1AAZA 1FVKA 2HRNA 3I69A 1R26A 2PBJA 3GH9A 4I2UA 2AHEA 3GV1A 2J23A 2L5LA 1PSQA 5G1LA 3WT2A 3ZVJD 3GRXA 3CRUA 4POMA 5ID2B 2TRXA 1HNCA 3DRNA 2QKEA 4XS4A 3J7Yk 2DJ1A 3VWUA 3M0FA 4KAEA 3GMFA 3DMLA 4ZB8A 4N30A 3TJBA 3KGKA 2UV8G 1XW5A 1F9MA 3ERWA 4JEDA 2JZTA 2GGTA 3DGQA 3TOUA 1G7EA 2VCZA 3IXRA 1QK8A 3ZREA 1IYHA 5DJLA 5HFGA 2H1LA 1T1VA 2H74A 3VI5A 5A1NB 2OA7A 2EIQA 1O8XA 4X0XA 4KE3A 1O7UA 4XRDA 4G10A 2FA4A 4KDXA 2GT5A 2CV4A 1SKRB 2DJ3A 5J4YA 4A5PA 1QFNA 4F82A 5IMZA 1PX6A 1RQMA 4FQUA 1TRUA 3A3TA 4KX4A 4WKWA 5IMFA 1YF1A 18GSA 4O5RA 2NVLA 1FG4A 2L5OA 4XS4B 4DSSA 3GL5A 3RDWA 4JRRA 1F2EA 1K3LA 19GSA 4KH7A 5D9TA 1W89A 1V58A 3L78A 2V6KA 3F3QA 1DSBA 4MZCA 1QGVA 1X5CA 1B4PA 3ZFLA 2H66A 4EDZA 1PGTA 5AGYA 1XOAA 5FT3A 3O3TA 2N5AA 1LJRA 2I9HA 6GSYA 1X9SB 2B3SA 4XRAA 1XWKA 1QQ2A 4ZL7A 5IO0A 2GQLA 4ID0A 3KZQA 4YH2A 2R5GA 3IC4A 1EV4A 2I1UA 4IS0A 3ZMLA 2P31A 4NHZA 4K5RA 6GSWA 2F3MA 3TCOA 5ECNB 4MCUA 1QUWA 3IE3A 2VD1A 2ON7A 2MBSA 14GSA 2YJ7A 2FWGA 2LJRA 1AIUA 2WZ9A 4ECJA 1JLVA 1AQWA 3GSTA 5G2ZA 3JCML 2C0DA 2A2PA 5ECRB 4HDEA 2OE1A 1JZWA 2PN8A 1VGLA 2CZ3A 4IGJA 1PN0A 2QC7A 1GSDA 1FO5A 1A0RP 3M8NA 3GKXA 3SBCA 3IAM2 3KTLA 2B6MA 1AW9A 2DC5A 3CXGA 5COHA 4AF2A 4TVEA 3D4TA 3EU3A 1THOA 4NV5A 3BCIA 3GURA 3ISOA 3IAS2 2FCHA 3MDKA 1ZYEA 2YOIA 3MAKA 2LSTA 1VF4A 5CRGA 2KHPA 3BCKA 2C8UA 2VLTA 4AJ6A 3ERFA 4NHWA 1XPVA 2KP1A 4XHMA 4F0BA 5ECHB 4RI7A 1Z5YE 2PPTA 2IPAA 1GSFA 4L5LA 2PVQA 4KB3A 4QL7A 4BWSA 1PKWA 1SVLA 2EFHA 3UVHA 4BWQA 2JSZA 2O8VB 5ECLB 2NPBA 3GX8A 1MD3A 4IVFA 1NHYA 2EFEA 10GSA 4L0UA 3EPTA 3VPTA 1T3BA 1YZXA 3UAPA 5CP1A 3D6IA 4L5OA 1ZZYA 1JZDA 3CRTA 5F06A 1K0BA 5B8BA 2V32A 2JL4A 4K7NA 4DVCA 2H6ZA 4ECCA 1YF0A 3LEFA 1O6JA 1BX9A 2H19A 4I5QA 1K0CA 1OE8A 1PA3A 5BRTA 4LL4B 1XOBA 2H30A 1F3BA 3GKMA 4PQIA 4ZB6A 3GA4A 1DE1A 2HSNA 1FB6A 1HNBA 1VRSD 4N0ZA 5AIXA 2MMZA 2VUPA 3F4RA 4KA0A 5H5QA 2EFDA 4F03A 1O85A 4O7HA 4N10A 4CY8A 3HA9A 16GSA 5C00A 2A2SA 2RUFA 3G9BA 3TOTA 3SWLA 4AKHA 2AAWA 1OYJA 4G0IA 2IIYA 1A2JA 1O73A 1EGRA 3FKFA 1Z9HA 1YDKA 2GTUA 4EDYA 2HT9A 3DIEA 5A4WA 6GSXA 4OFTA 3C1RA 3M9JA 3VI7A 3DVXA 1X5DA 5LD0A 3WGDA 5IMDA 4LA1A 2G0FA 5J40A 2R37A 3GUSA 2KP2A 3IC8A 2MMAA 3K8NA 3F8UA 1XW6A 5A5HB 2WS2A 3H79A 4TR0A 1GTIA 3GFKA 1WRYA 3TKSA 2MZCA 3CBUA 1JFUA 3EU4A 3FEUA 2GSTA 3D21A 1GTUA 5KN3A 5D9VA 1B9YC 5AIVA 5BMUB 4ECIA 2B5YA 3G7JA 4GDFA 3CSIA 5G1KA 1BYEA 1ERTA 3HY2A 4BL7B 3BJ5A 2GDRA 2H0IA 4FO5A 20GSA 3TJFA 1HQOA 1AUCA 2AV4A 2JZRA 4G0LA 3WGXA 1V9WA 4PQHA 1Y6EA 2VIMA 4CHSA 3A5WA 1SK0A 4D73A 3G7YA 4FYBA 2L6CA 2C4JA 1K0NA 1XWCA 2X8HA 3GL3A 3N5OA 2LS5A 4TR4A 5DALA 3L0HA 4N3ZA 3ZL5A 1EP8A 1FW1A 1Z6NA 1OKDA 4F2IA 4HOJA 2WULA 2ZUPA 3HXSA 4ZL9A 2OACA 5B6NA 2HRKB 2LQOA 4PGTA 3EMPA 1V40A 2B1LA 4NXIA 4O92A 2HZEB 4HJMA 4IBPA 3FZAA 2UZ8A 2OBKA 4AI6A 2XPEA 1I9DA 2DBCA 2YJHA 1XWBA 3DWVA 4QMKA 2QA1A 2F8FA 2TRCP 4XTSA 4BPYA 4GSTA 1A24A 3C73A 2LJKA 1X9MB 1H75A 2DJ2A 5A4UA 2O7KA 2LUSA 5JCGA 1G6YA 5DALB 2A4HA 1U6TA 5DCHA 3FZ5A 2V41A 4IP1A 1TXUA 2K18A 2K6VA 2VL2C 3ZYWA 2HQTA 3NZNA 2GZYA 4OWYA 3KM6A 4E8EA 2FWFA 2V1MA 1XWGA 3KH9A 2AJQB 2K9FA 2HLSA 3HMJG 1YEPA 4MP4A 4K7OA 4LL1B 1X9WB 3OR5A 3UL3A 4IKHA 1OAZA 1YEXA 5AN1A 4XS6A 1AXDA 2GLRA 4GSSA 1E6BA 5LCZA 5E4WA 3TRPA 1GUHA 5J47A 2R6KA 1GH2A 3F4SA 5HR2A 2E2MA 5DCGA 4WETA 2CAIA 2HRAA 4MPGA 4IELA 1GNWA 3MNGA 1TDIA 3H8QA 3U6VA 3UBLA 2YWMA 2CA8A 4IQAA 2GSQA 2X49A 1DBYA 2I4AA 2F8AA 1PL1A 3M3MA 2ES7A 1MTCA 4MF5A 2OE3A 4PX1A 2RIIA 3UOMA 2EFCA 2L4CA 3HVVA 2H6XA 3UBKA 5EY6A 3DYRA 4KDUA 4TW5A 4X4JA 5DDLA 2IWTA 1R5AA 2CAQA 1SJIA 4V1Ag 1YVLA 2C0EA 2H0HA 4N11A 3RPPA 1RK4A 1ILOA 1SL2B 1BEDA 3ZMKA 1UA5A 4LLRA 4WEYA 1M2AA 1V98A 3HCZA 4YQMA 4ZILA 2BMXA 1FVJA 1Q98A 12GSA 3VLNA 4DEJA 5JWRB 2X99A 2YNXA 4IHUA 3C1SA 5ECMB 1ERVA 2VCTA 3PPUA 2A2RA 4TR1A 4IW9A 1E2YA 2VD0A 4OO4A 3QCPA 1OE7A 3EC3A 1AC1A 2XC2A 1SL0B 3IRAA 4BVYA 3FZ9A 2CX3A 3C8EA 2IMDA 2FWHA 5CO3A 4I6XA 1T7PB 1M2DA 3UEMA 2C80A 2NBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAX A;  1Q4J A;  4K0N A;  2E2G A;  1N2A A;  2OE0 A;  2GT6 A;  2I3Y A;  2C0F A;  1NM3 A;  2H8L A;  5CRW A;  4IP6 A;  2DML A;  2JAC A;  5D93 A;  1K0D A;  4J2F A;  5DJM A;  2GQK A;  3ZIV A;  1Z3E A;  4HU9 A;  5G30 A;  2WJU A;  3R2Q A;  1G7O A;  3HVS A;  4HI7 A;  1NHO A;  3EMX A;  4MZW A;  3KIJ A;  3ZLP A;  1N8J A;  1TI1 A;  1F3A A;  5GSS A;  1M0U A;  3TKR A;  1TW9 A;  5DAK A;  5AIS A;  3EYT A;  5B7C A;  3WYW A;  2REM A;  3CSH A;  1O8W A;  2PUK C;  3O76 A;  4TR1 B;  3P8W A;  2DJK A;  4XIH A;  2IL3 A;  4EO3 A;  4NPB A;  2CVK A;  3M1G A;  2JZS A;  3HJP A;  3VK9 A;  3FY7 A;  1QXH A;  3QPM A;  2PER A;  4OMV A;  1Z7P A;  2CX4 A;  4BVY B;  4GF0 A;  4RQX A;  4ZB9 A;  2FUG 2;  1PN9 A;  2GQM A;  5J9B A;  5F8B A;  5E59 A;  1SKW B;  2VL3 A;  3G7I A;  5GAN D;  1PRX A;  2HNL A;  1GSS A;  1S3A A;  3CYN A;  2MMO A;  5D9X A;  1A23 A;  4OD7 A;  1GLQ A;  4V2M A;  1CQH A;  5F0G A;  4BA7 A;  4DSS B;  2GS3 A;  2CVB A;  2IMF A;  1GL8 A;  1XVQ A;  1NW2 A;  1WMJ A;  3A2X A;  2RM6 A;  3EVI A;  5ECP B;  5DAK B;  1XXU A;  5KN2 A;  4POL A;  5IM9 A;  4POK A;  5GST A;  1K0A A;  4JR6 A;  5INY A;  3KTB A;  1FAA A;  4MAB A;  5ECO B;  5B6M A;  1A8Y A;  1ERW A;  2QSI A;  4ZXG A;  4TR3 A;  5L71 A;  4O32 A;  4MJB A;  3LYK A;  2O85 A;  5F05 A;  1URM A;  1BJX A;  2GVP A;  4EC0 A;  5A5K A;  7GSS A;  4K7I A;  1SD9 A;  1WOU A;  5ECQ B;  3GNJ A;  2LQQ A;  1DE2 A;  5HQP A;  1GSY A;  1FHE A;  4FH8 A;  3TGZ A;  4NWY A;  1F37 A;  2CZ2 A;  5G5E A;  4PQ1 A;  2RUE A;  3R3E A;  2MBT A;  1FOV A;  2LTK A;  2HSM A;  4KW6 A;  1OC9 A;  4MF7 A;  3APQ A;  5J3R A;  1SL1 B;  2VM2 A;  5H5S A;  3GTU A;  1SJZ A;  3TB2 A;  3KXO A;  3TJJ A;  1EV9 A;  4IQ1 A;  1O81 A;  3DVW A;  2YZH A;  4DSQ A;  2VLV A;  4KND A;  3CTG A;  4I97 A;  4GLT A;  2YP6 A;  3GIX A;  4WBJ A;  1UN2 A;  4Q5R A;  2IN3 A;  4EF0 A;  4MDC A;  2DSA A;  1XW9 A;  2HZF A;  1MDI A;  3KP9 A;  3QAW A;  4OO5 A;  4Q5F A;  3J7Y b;  2YWO A;  3VUR A;  4ZBD A;  8GSS A;  3P2A A;  2FNO A;  3W8J A;  2C1Y A;  2R4V A;  3A2W A;  1TK8 B;  5J9C A;  2CT6 A;  3ZTL A;  3D22 A;  2XBI A;  3I43 A;  2O87 A;  5D96 A;  1X0R A;  3ZIJ A;  3M9K A;  1PX7 A;  2OKA A;  1C72 A;  2HSM B;  4G19 A;  1WP0 A;  4RUV A;  5DQS A;  2YAN A;  3GTU B;  4EVM A;  3GHA A;  2P5Q A;  4GXZ A;  3L9U A;  3NIV A;  2HSY A;  3KP8 A;  2IFQ A;  5A4V A;  4K9Z A;  3HZ4 A;  2C3T A;  4IJ3 A;  1OVN A;  2LKU A;  3GSS A;  5ECI B;  4WR5 A;  3ZVJ A;  1K3Y A;  4KGI A;  3TKQ A;  2H72 A;  3Q18 A;  2JSY A;  2RLI A;  1YJ6 A;  4BVX A;  3FW2 A;  1B48 A;  3D0Z A;  4X1U A;  4Z7X A;  1WPI A;  3D5J A;  2AB6 A;  2HSN B;  2IMI A;  4KSM A;  2GZP A;  3D4M A;  1BAY A;  6GSS A;  1ABA A;  2GSR A;  1CQG A;  1G0T A;  17GS A;  2LV3 A;  4JBB A;  1OC3 A;  5ECS A;  2R3X A;  3HZ8 A;  2DLX A;  1TI3 A;  1TU7 A;  3CMI A;  4CW9 A;  1XFL A;  1QMV A;  1UC7 A;  4K1F A;  2IFQ B;  1OKT A;  2FHE A;  1A2L A;  1TRS A;  1U3A A;  1T8E B;  2FA8 A;  2LRC A;  1V2A A;  4LMW A;  2K8V A;  4BVX B;  3CSJ A;  5JWQ B;  1YKC A;  3PGT A;  3PIN A;  5CYY A;  3TKS E;  3QR6 A;  4GWR A;  4PXO A;  3NOF A;  3ZFB A;  2NDO A;  3UMA A;  1TRV A;  1SYR A;  1VF3 A;  4GRF A;  2L59 A;  1M7T A;  2YPM A;  3VWW A;  3EIN A;  2F51 A;  2HRF A;  3V1W A;  1XBS A;  2FWE A;  3IDV A;  3QDN A;  3IV4 A;  3LQ7 A;  1T4Y A;  1PKZ A;  3O6T A;  3WGE A;  3F0I A;  4ACS A;  4D73 B;  1LBK A;  3C71 A;  1HD2 A;  2HFD A;  4K6X A;  2LNS A;  4TXV A;  3IPZ A;  3L4N A;  4MH2 A;  2K8S A;  1K0O A;  2AUV A;  3UAR A;  1J9B A;  22GS A;  1SKS B;  3IK9 A;  1EWX A;  1M99 A;  1GRX A;  4OCF A;  3EE2 A;  2GSS A;  4H86 A;  3S9F A;  4V1A p;  1GP1 A;  3FR6 A;  1PQN A;  3QOU A;  1SD8 A;  4MH3 A;  3KJY A;  1GSU A;  2H73 A;  5CRH A;  3LOR A;  1MD4 A;  2CQ9 A;  1ZCP A;  2VLU A;  3HHV A;  1W4V A;  3DKS A;  9GSS A;  3KCM A;  2VM1 A;  1I5G A;  1DUG A;  1TRW A;  3P7X A;  2BTO T;  5HR1 A;  1B8X A;  5DVB A;  4IN0 A;  4MZB A;  5ID2 A;  2XHF A;  3DD3 A;  1GTA A;  1JZO A;  2YN1 A;  3RBT A;  5HFK A;  4ULX A;  3IHQ A;  2VO4 A;  1GTB A;  2AYT A;  1ZMA A;  2VAF A;  4I8B A;  2E0Q A;  3HKR A;  2ZNM A;  3KMN A;  3ZZX A;  1H4O A;  4TOP A;  1M2B A;  5J41 A;  1U88 A;  4MK3 A;  5CRE A;  3UIW A;  4HQZ A;  1AQV A;  1GSE A;  4PTS A;  3C7M A;  2JAD A;  5IOW A;  3VWV A;  3WD6 A;  1HYU A;  2LRN A;  4GQF A;  2EIO A;  3F4T A;  3VWX A;  1ERU A;  1BQ7 A;  4QQ7 A;  4MJA A;  1XWA A;  1TJD A;  4KDY A;  2E7P A;  6GSV A;  4EL1 A;  1PL2 A;  2WGR A;  3PH9 A;  2PMT A;  3AY8 A;  4K8M A;  3TUE A;  4HU7 A;  1JZR A;  1R5P A;  1U3I A;  2WB9 A;  2VCX A;  2QGV A;  2Z9S A;  2O89 A;  2IJY A;  2VCW A;  5KN1 A;  2FD3 A;  1XCC A;  5H5R A;  3BOA A;  4WBR D;  5HR0 A;  1EGO A;  1USB A;  2VOC A;  5CRD A;  5IPH A;  4EXJ A;  4KCA A;  3LG6 A;  4ML1 A;  5G31 A;  3TRX A;  4WXT A;  4XCS A;  2NTO A;  1MDK A;  2H6Y A;  2KUC A;  5IOX A;  2OAD A;  4FIW A;  2FY6 A;  3HJM A;  1VF2 A;  2PU9 C;  3IBH A;  4GSN A;  3LWA A;  2M46 A;  2YV7 A;  1ZGN A;  4V2L A;  4F9Z A;  3US3 A;  3UJ1 A;  1GUL A;  5ABR A;  3TDG A;  2VCV A;  4JR4 A;  1S3D A;  5EVO A;  1WE0 A;  4HQS A;  4CDO A;  2EC4 A;  4J56 E;  3HVX A;  3W8S A;  3DEX A;  5KEJ A;  3RAZ A;  2WDU A;  1SEN A;  5F07 A;  2PVO C;  1SJ6 A;  5CNW A;  1KBN A;  1KTE A;  2LNT A;  4MPF A;  4K2D A;  3LGC A;  4HZ4 A;  2L6D A;  4USS A;  3F9U A;  1UVZ A;  1A2M A;  11GS A;  1TTZ A;  1LU4 A;  3TRQ A;  4V2N A;  2RM5 A;  5GAP D;  2YWN A;  2H76 A;  1R7H A;  5DBQ A;  3GH6 A;  1MDJ A;  3FK8 A;  1S3C A;  1B9X C;  5J4U A;  1AQX A;  4Q5N A;  1OC8 A;  1JLW A;  1J0F A;  3ZRD A;  3QD9 A;  1KNG A;  3BBY A;  1TK5 B;  5IMC A;  4WR4 A;  3E9J B;  2ZCT A;  4ML6 A;  4QL9 A;  5IMV A;  4NV2 A;  3HJO A;  1GLP A;  3RHC A;  2KLX A;  5ENU A;  4N0V A;  1ZYQ B;  3RPN A;  3PR8 A;  4ZIJ A;  3P90 A;  2HE3 A;  3DXB A;  4KCE A;  1X5E A;  2V6O A;  1Y25 A;  4ECB A;  1MEK A;  4ISD A;  4FYU A;  2M80 A;  2DJ0 A;  5C04 A;  2A4V A;  3IOS A;  4F0C A;  4E8H A;  2FGX A;  3F6F A;  2WFC A;  1ZL9 A;  4L0W A;  5JCW A;  2P0G A;  5G5F A;  2N5F A;  4RQR A;  3MWH A;  2P5R A;  1A8L A;  4MMM A;  1PMT A;  1TP9 A;  2OBI A;  1XIY A;  2B5E A;  3EWL A;  2H1A A;  5EPF A;  3GKN A;  3LXT A;  4POB A;  1FB0 A;  2YCD A;  3GYK A;  3F6D A;  3W6G A;  2X8C A;  4PUF C;  1SK2 A;  4ZBA A;  2YV9 A;  4P3Y B;  1RW1 A;  1YY7 A;  3N9J A;  1KEB A;  2I81 A;  4Q5Q A;  1TKD B;  2X8G A;  2C3N A;  3Q19 A;  1EOH A;  3QAV A;  3HDC A;  1EOG A;  1F6M C;  2GZZ A;  4MJE A;  1WWJ A;  4RI6 A;  4YQU A;  3L9V A;  1G6W A;  1JHB A;  2C0G A;  3H93 A;  3FR9 A;  4MJC A;  3RHB A;  2R2J A;  1TU8 A;  2XPD A;  4YAP A;  6GST A;  3EUR A;  3KH7 A;  1ACV A;  3A2V A;  4FYC A;  2ON5 A;  4AGS A;  2HYX A;  4JZQ A;  4OFM A;  1HNA A;  4GCI A;  1M9A A;  4HS1 A;  1SYX A;  1OC9 B;  2H70 A;  2MYG A;  1TK0 B;  5BMU A;  1BG5 A;  1NSW A;  4DSR A;  1B4Q A;  3GN3 A;  1T00 A;  1TOF A;  3F3R A;  5D8I A;  2J9H A;  2TIR A;  1ZOF A;  2ALB A;  2VCQ A;  4BL7 A;  3APS A;  1YKA A;  2LJA A;  3KD0 A;  5HR3 A;  2B7K A;  2IMK A;  5ELA A;  1GUM A;  1R4W A;  2DIY A;  4MA9 A;  4ZL8 A;  1XZO A;  2H1G A;  4EKZ A;  3WT1 A;  2M72 A;  4WF4 A;  2H1B A;  2L4Q A;  5IIZ A;  3I6A A;  2KOK A;  5B8A A;  1IYI A;  3IA1 A;  4PUA A;  2DMM A;  2LEG A;  3ZIT A;  3KMO A;  2N5B A;  3GX0 A;  4L8E A;  3LSZ A;  4PUR A;  4HUA A;  1A0F A;  4AJ8 A;  2HRK A;  5EL8 A;  3MSZ A;  4HEA 2;  2IME A;  4OCE A;  3QFA C;  1U87 A;  2X64 A;  5FHI A;  4HJ2 A;  2WCI A;  2EIR A;  4PNG A;  2HZE A;  3LXZ A;  3Q6O A;  3I9V 2;  4KSO A;  5LNK e;  1T4Z A;  2PGT A;  3ERG A;  4JU5 A;  4KUN A;  5ELG A;  6GSU A;  3U5R E;  3LYP A;  1PD2 1;  1J08 A;  3UVT A;  1EP7 A;  3Q74 A;  2MMN A;  2YWI A;  5D73 A;  3FYG A;  1EZK A;  2WRT A;  4TRX A;  5CAX A;  3TKP A;  1GWC A;  2VL9 A;  5DQY A;  1GUK A;  4GQC A;  2VL2 A;  2YZU A;  5D9W A;  3CTF A;  1VF1 A;  4PNF A;  3BD2 A;  2V2G A;  3F63 A;  1XVW A;  3TKS C;  2HSH A;  5HFI A;  3TJG A;  5KN0 A;  1ST9 A;  3ME8 A;  1SK1 A;  4HZ2 A;  2H75 A;  3QMX A;  3APO A;  3VPQ A;  3FR3 A;  2CVD A;  4X43 A;  3ED3 A;  3E0U A;  4XS1 A;  1TXX A;  3H4K A;  2B5X A;  2H1D A;  2B7J A;  3LFL A;  1THX A;  4TKY A;  3H1N A;  5JWO B;  3QAG A;  3TJK A;  3ME7 A;  4ZBB A;  5GZZ B;  1GSQ A;  2XBQ A;  2F9S A;  3IK7 A;  4KF9 A;  1ON4 A;  2L57 A;  3LJR A;  4EE0 A;  4G9H A;  2D2Z A;  4IJI A;  1M9B A;  4TXO A;  4EUY A;  2DIZ A;  4K0G A;  5IQY A;  5IPG A;  4NMU A;  3VFI A;  2DJJ A;  2HI7 A;  4MLY A;  3HD5 A;  2H71 A;  4TN8 A;  4MF6 A;  1WIK A;  3FRC A;  3HYP A;  4I2T A;  5ECK B;  1V57 A;  1EEJ A;  3L9S A;  1GNE A;  2OJL A;  1K0M A;  2PWJ A;  2FLS A;  4G0K A;  3GKK A;  4ILF A;  4LMV A;  4YAV A;  3KEB A;  5J5N A;  2JU5 A;  1EEM A;  4J57 E;  3IR4 A;  1Z7R A;  2BJX A;  4YQV A;  5JCU A;  2H01 A;  2C3Q A;  4JE1 A;  2LRT A;  1YQ1 A;  4OFN A;  4G2E A;  2G2Q A;  5IMA A;  4TXO B;  1ML6 A;  1SU9 A;  3FZ4 A;  2HXK A;  2H0G A;  4GTU A;  1Z6M A;  3E3E A;  3FHK A;  5FWG A;  5IO2 A;  1K3O A;  3QFB C;  2B1K A;  4AJ7 A;  1WJK A;  4WF5 A;  13GS A;  1AAZ A;  1FVK A;  2HRN A;  3I69 A;  1R26 A;  2PBJ A;  3GH9 A;  4I2U A;  2AHE A;  3GV1 A;  2J23 A;  2L5L A;  1PSQ A;  5G1L A;  3WT2 A;  3ZVJ D;  3GRX A;  3CRU A;  4POM A;  5ID2 B;  2TRX A;  1HNC A;  3DRN A;  2QKE A;  4XS4 A;  3J7Y k;  2DJ1 A;  3VWU A;  3M0F A;  4KAE A;  3GMF A;  3DML A;  4ZB8 A;  4N30 A;  3TJB A;  3KGK A;  1XW5 A;  1F9M A;  3ERW A;  4JED A;  2JZT A;  2GGT A;  3DGQ A;  3TOU A;  1G7E A;  2VCZ A;  3IXR A;  1QK8 A;  3ZRE A;  1IYH A;  5DJL A;  5HFG A;  1T1V A;  2H74 A;  3VI5 A;  2OA7 A;  2EIQ A;  1O8X A;  4X0X A;  4KE3 A;  1O7U A;  4XRD A;  4G10 A;  2FA4 A;  4KDX A;  2GT5 A;  2CV4 A;  1SKR B;  2DJ3 A;  1QFN A;  4F82 A;  5IMZ A;  1PX6 A;  1RQM A;  4FQU A;  1TRU A;  3A3T A;  4KX4 A;  4WKW A;  5IMF A;  1YF1 A;  18GS A;  4O5R A;  2NVL A;  1FG4 A;  2L5O A;  4XS4 B;  4DSS A;  3GL5 A;  3RDW A;  4JRR A;  1F2E A;  1K3L A;  19GS A;  4KH7 A;  5D9T A;  1W89 A;  1V58 A;  3L78 A;  2V6K A;  3F3Q A;  1DSB A;  4MZC A;  1QGV A;  1X5C A;  1B4P A;  3ZFL A;  2H66 A;  4EDZ A;  1PGT A;  5AGY A;  1XOA A;  5FT3 A;  3O3T A;  2N5A A;  1LJR A;  2I9H A;  6GSY A;  1X9S B;  2B3S A;  4XRA A;  1XWK A;  1QQ2 A;  4ZL7 A;  5IO0 A;  2GQL A;  4ID0 A;  3KZQ A;  4YH2 A;  2R5G A;  3IC4 A;  1EV4 A;  2I1U A;  4IS0 A;  3ZML A;  2P31 A;  4NHZ A;  6GSW A;  2F3M A;  3TCO A;  5ECN B;  4MCU A;  1QUW A;  3IE3 A;  2VD1 A;  2ON7 A;  2MBS A;  14GS A;  2YJ7 A;  2FWG A;  2LJR A;  1AIU A;  2WZ9 A;  4ECJ A;  1JLV A;  1AQW A;  3GST A;  5G2Z A;  3JCM L;  2C0D A;  5ECR B;  4HDE A;  2OE1 A;  1JZW A;  2PN8 A;  1VGL A;  2CZ3 A;  4IGJ A;  2QC7 A;  1GSD A;  1FO5 A;  1A0R P;  3M8N A;  3GKX A;  3SBC A;  3IAM 2;  3KTL A;  2B6M A;  1AW9 A;  2DC5 A;  3CXG A;  5COH A;  4AF2 A;  4TVE A;  3D4T A;  3EU3 A;  1THO A;  4NV5 A;  3BCI A;  3GUR A;  3ISO A;  3IAS 2;  2FCH A;  3MDK A;  1ZYE A;  2YOI A;  3MAK A;  2LST A;  1VF4 A;  5CRG A;  2KHP A;  3BCK A;  2C8U A;  2VLT A;  4AJ6 A;  3ERF A;  4NHW A;  1XPV A;  2KP1 A;  4XHM A;  4F0B A;  5ECH B;  4RI7 A;  1Z5Y E;  2PPT A;  2IPA A;  1GSF A;  4L5L A;  2PVQ A;  4KB3 A;  4QL7 A;  4BWS A;  1PKW A;  3UVH A;  4BWQ A;  2JSZ A;  2O8V B;  5ECL B;  2NPB A;  3GX8 A;  1MD3 A;  4IVF A;  1NHY A;  10GS A;  4L0U A;  3VPT A;  1T3B A;  1YZX A;  3UAP A;  5CP1 A;  3D6I A;  4L5O A;  1ZZY A;  1JZD A;  3CRT A;  5F06 A;  1K0B A;  5B8B A;  2V32 A;  2JL4 A;  4K7N A;  4DVC A;  2H6Z A;  4ECC A;  1YF0 A;  3LEF A;  1O6J A;  1BX9 A;  2H19 A;  4I5Q A;  1K0C A;  1OE8 A;  1PA3 A;  4LL4 B;  1XOB A;  2H30 A;  1F3B A;  3GKM A;  4PQI A;  4ZB6 A;  3GA4 A;  1DE1 A;  1FB6 A;  1HNB A;  1VRS D;  4N0Z A;  5AIX A;  2MMZ A;  2VUP A;  3F4R A;  4KA0 A;  5H5Q A;  4F03 A;  1O85 A;  4O7H A;  4N10 A;  3HA9 A;  16GS A;  5C00 A;  2A2S A;  2RUF A;  3G9B A;  3TOT A;  3SWL A;  2AAW A;  1OYJ A;  4G0I A;  2IIY A;  1A2J A;  1O73 A;  1EGR A;  3FKF A;  1Z9H A;  1YDK A;  2GTU A;  4EDY A;  2HT9 A;  3DIE A;  5A4W A;  6GSX A;  4OFT A;  3C1R A;  3M9J A;  3VI7 A;  3DVX A;  1X5D A;  5LD0 A;  3WGD A;  5IMD A;  4LA1 A;  2G0F A;  2R37 A;  3GUS A;  2KP2 A;  3IC8 A;  2MMA A;  3K8N A;  3F8U A;  1XW6 A;  2WS2 A;  3H79 A;  4TR0 A;  1GTI A;  3GFK A;  1WRY A;  3TKS A;  2MZC A;  3CBU A;  1JFU A;  3EU4 A;  3FEU A;  2GST A;  3D21 A;  1GTU A;  5KN3 A;  5D9V A;  1B9Y C;  5AIV A;  4ECI A;  2B5Y A;  3G7J A;  3CSI A;  5G1K A;  1BYE A;  1ERT A;  3HY2 A;  4BL7 B;  3BJ5 A;  2GDR A;  2H0I A;  4FO5 A;  20GS A;  3TJF A;  1HQO A;  1AUC A;  2AV4 A;  2JZR A;  4G0L A;  3WGX A;  1V9W A;  4PQH A;  1Y6E A;  2VIM A;  4CHS A;  3A5W A;  1SK0 A;  4D73 A;  3G7Y A;  4FYB A;  2L6C A;  2C4J A;  1K0N A;  1XWC A;  2X8H A;  3GL3 A;  3N5O A;  2LS5 A;  4TR4 A;  5DAL A;  3L0H A;  3ZL5 A;  1EP8 A;  1FW1 A;  1Z6N A;  1OKD A;  4F2I A;  4HOJ A;  2WUL A;  2ZUP A;  3HXS A;  4ZL9 A;  2OAC A;  5B6N A;  2HRK B;  2LQO A;  4PGT A;  3EMP A;  1V40 A;  2B1L A;  4NXI A;  4O92 A;  2HZE B;  4HJM A;  4IBP A;  3FZA A;  2UZ8 A;  2OBK A;  2XPE A;  1I9D A;  2DBC A;  2YJH A;  1XWB A;  3DWV A;  2F8F A;  2TRC P;  4XTS A;  4BPY A;  4GST A;  1A24 A;  3C73 A;  2LJK A;  1X9M B;  1H75 A;  2DJ2 A;  5A4U A;  2O7K A;  2LUS A;  5JCG A;  1G6Y A;  5DAL B;  1U6T A;  5DCH A;  3FZ5 A;  2V41 A;  4IP1 A;  2K18 A;  2K6V A;  2VL2 C;  3ZYW A;  2HQT A;  3NZN A;  2GZY A;  4OWY A;  3KM6 A;  4E8E A;  2FWF A;  2V1M A;  1XWG A;  3KH9 A;  2AJQ B;  2K9F A;  2HLS A;  1YEP A;  4MP4 A;  4K7O A;  4LL1 B;  1X9W B;  3OR5 A;  3UL3 A;  4IKH A;  1OAZ A;  1YEX A;  5AN1 A;  4XS6 A;  1AXD A;  2GLR A;  4GSS A;  1E6B A;  5LCZ A;  5E4W A;  3TRP A;  1GUH A;  2R6K A;  1GH2 A;  3F4S A;  5HR2 A;  2E2M A;  5DCG A;  4WET A;  2CAI A;  2HRA A;  4MPG A;  4IEL A;  1GNW A;  3MNG A;  1TDI A;  3H8Q A;  3U6V A;  3UBL A;  2YWM A;  2CA8 A;  4IQA A;  2GSQ A;  1DBY A;  2I4A A;  2F8A A;  1PL1 A;  3M3M A;  2ES7 A;  1MTC A;  4MF5 A;  2OE3 A;  4PX1 A;  2RII A;  3UOM A;  2L4C A;  3HVV A;  2H6X A;  3UBK A;  5EY6 A;  3DYR A;  4KDU A;  4TW5 A;  5DDL A;  2IWT A;  1R5A A;  2CAQ A;  1SJI A;  4V1A g;  2C0E A;  2H0H A;  4N11 A;  3RPP A;  1RK4 A;  1ILO A;  1SL2 B;  1BED A;  3ZMK A;  1UA5 A;  4LLR A;  4WEY A;  1M2A A;  1V98 A;  3HCZ A;  4YQM A;  4ZIL A;  2BMX A;  1FVJ A;  1Q98 A;  12GS A;  3VLN A;  4DEJ A;  5JWR B;  2X99 A;  2YNX A;  4IHU A;  3C1S A;  5ECM B;  1ERV A;  2VCT A;  3PPU A;  2A2R A;  4TR1 A;  4IW9 A;  1E2Y A;  2VD0 A;  4OO4 A;  3QCP A;  1OE7 A;  3EC3 A;  1AC1 A;  2XC2 A;  1SL0 B;  3IRA A;  4BVY A;  3FZ9 A;  2CX3 A;  3C8E A;  2IMD A;  2FWH A;  5CO3 A;  4I6X A;  1T7P B;  1M2D A;  3UEM A;  2C80 A;  2NBS A; 
#chains in the Genus database with same CATH topology
 4NAX A;  1Q4J A;  4K0N A;  2E2G A;  1N2A A;  1BG1 A;  2OE0 A;  2GT6 A;  2I3Y A;  2C0F A;  1NM3 A;  2H8L A;  5CRW A;  4IP6 A;  2DML A;  2JAC A;  5D93 A;  1K0D A;  4J2F A;  5DJM A;  2GQK A;  3ZIV A;  2WVX A;  1Z3E A;  4HU9 A;  5G30 A;  2WJU A;  3R2Q A;  1G7O A;  3HVS A;  1YEW C;  4HI7 A;  1NHO A;  3EMX A;  4MZW A;  3KIJ A;  3ZLP A;  1N8J A;  1TI1 A;  1F3A A;  5GSS A;  1M0U A;  3TKR A;  1TW9 A;  5DAK A;  5AIS A;  3EYT A;  5B7C A;  3WYW A;  2REM A;  3CSH A;  1O8W A;  2PUK C;  3O76 A;  4TR1 B;  3P8W A;  2DJK A;  4XIH A;  2IL3 A;  4EO3 A;  4NPB A;  2CVK A;  3M1G A;  2JZS A;  3HJP A;  3VK9 A;  3FY7 A;  1QXH A;  3QPM A;  2PER A;  4OMV A;  1Z7P A;  2CX4 A;  4BVY B;  4ZB7 A;  2WZS A;  4GF0 A;  4RQX A;  4ZB9 A;  2FUG 2;  1PN9 A;  2GQM A;  5J9B A;  5F8B A;  5E59 A;  1SKW B;  2VL3 A;  3G7I A;  5GAN D;  4Z2R A;  1PRX A;  2HNL A;  1GSS A;  1S3A A;  3CYN A;  2MMO A;  5D9X A;  1A23 A;  4OD7 A;  1GLQ A;  4V2M A;  1CQH A;  5F0G A;  5A34 A;  4BA7 A;  4DSS B;  2GS3 A;  2WVX B;  2CVB A;  2IMF A;  1GL8 A;  1FOH A;  1XVQ A;  1NW2 A;  1WMJ A;  3A2X A;  2RM6 A;  3EVI A;  5ECP B;  1I1I P;  4Z2U A;  5DAK B;  1XXU A;  2DKH A;  5KN2 A;  4POL A;  5IM9 A;  4POK A;  5GST A;  1K0A A;  4JR6 A;  5INY A;  3KTB A;  1FAA A;  4MAB A;  5ECO B;  5B6M A;  1A8Y A;  1ERW A;  2QSI A;  4ZXG A;  4TR3 A;  5L71 A;  4O32 A;  4MJB A;  3LYK A;  2O85 A;  5F05 A;  1URM A;  4K5S A;  2O3E A;  2O5V A;  1BJX A;  2GVP A;  4EC0 A;  5A5K A;  7GSS A;  4K7I A;  1SD9 A;  1WOU A;  5ECQ B;  3GNJ A;  2LQQ A;  1DE2 A;  5HQP A;  1GSY A;  1FHE A;  4FH8 A;  3TGZ A;  1ZYP A;  4NWY A;  1F37 A;  3RFR C;  2CZ2 A;  5G5E A;  4PQ1 A;  2RUE A;  3R3E A;  2MBT A;  1FOV A;  2LTK A;  2HSM A;  4KW6 A;  1OC9 A;  4MF7 A;  3APQ A;  5J3R A;  1SL1 B;  2VM2 A;  5H5S A;  3GTU A;  1SJZ A;  3TB2 A;  3KXO A;  3TJJ A;  1EV9 A;  4IQ1 A;  1O81 A;  3DVW A;  2YZH A;  4DSQ A;  2VLV A;  4KND A;  3CTG A;  4I97 A;  4GLT A;  2WW1 A;  2YP6 A;  3GIX A;  4WBJ A;  1UN2 A;  4Q5R A;  2IN3 A;  4EF0 A;  4MDC A;  4EIQ A;  2DSA A;  1XW9 A;  2HZF A;  1MDI A;  3KP9 A;  3QAW A;  4OO5 A;  4Q5F A;  3J7Y b;  2YWO A;  3VUR A;  4ZBD A;  8GSS A;  3P2A A;  2FNO A;  3W8J A;  2C1Y A;  2R4V A;  3A2W A;  1TK8 B;  5J9C A;  2CT6 A;  3ZTL A;  3D22 A;  2XBI A;  4AKX B;  3I43 A;  2O87 A;  5D96 A;  1X0R A;  3ZIJ A;  3M9K A;  1PX7 A;  2OKA A;  1C72 A;  2HSM B;  3HVN A;  4G19 A;  1WP0 A;  2QA2 A;  4RUV A;  5DQS A;  2YAN A;  3GTU B;  4EVM A;  3GHA A;  2P5Q A;  4GXZ A;  3L9U A;  3NIV A;  2HSY A;  3KP8 A;  1S3R A;  2IFQ A;  1N25 A;  5A4V A;  4K9Z A;  5J4V A;  3HZ4 A;  2C3T A;  4IJ3 A;  1OVN A;  2LKU A;  3GSS A;  5ECI B;  4WR5 A;  3ZVJ A;  1K3Y A;  4KGI A;  3TKQ A;  2H72 A;  3Q18 A;  2JSY A;  2RLI A;  1YJ6 A;  4BVX A;  3FW2 A;  1B48 A;  3D0Z A;  4X1U A;  4Z7X A;  1WPI A;  3D5J A;  2AB6 A;  3TU3 B;  2HSN B;  2IMI A;  4KSM A;  2GZP A;  3D4M A;  1BAY A;  6GSS A;  1ABA A;  2GSR A;  1CQG A;  1G0T A;  17GS A;  2LV3 A;  4JBB A;  1OC3 A;  4HSC X;  5ECS A;  2R3X A;  3HZ8 A;  2DLX A;  1TI3 A;  1TU7 A;  3CMI A;  4CW9 A;  1XFL A;  1QMV A;  1UC7 A;  4K1F A;  2IFQ B;  1OKT A;  2FHE A;  1A2L A;  1TRS A;  1U3A A;  1T8E B;  2FA8 A;  2LRC A;  1V2A A;  4YKF A;  4LMW A;  2K8V A;  4BVX B;  3CSJ A;  5JWQ B;  1YKC A;  3PGT A;  3PIN A;  5CYY A;  3TKS E;  3QR6 A;  4GWR A;  4PXO A;  3NOF A;  3ZFB A;  2NDO A;  3UMA A;  1TRV A;  1SYR A;  1VF3 A;  4GRF A;  2L59 A;  1M7T A;  2YPM A;  3VWW A;  3EIN A;  2F51 A;  2HRF A;  3V1W A;  1XBS A;  2FWE A;  3IDV A;  3QDN A;  3IV4 A;  3LQ7 A;  1T4Y A;  1PKZ A;  3O6T A;  3WGE A;  3F0I A;  4ACS A;  4D73 B;  1LBK A;  3C71 A;  1HD2 A;  2HFD A;  4K6X A;  2LNS A;  4TXV A;  3IPZ A;  3L4N A;  4MH2 A;  2K8S A;  1K0O A;  2AUV A;  3UAR A;  1J9B A;  22GS A;  1SKS B;  3IK9 A;  1EWX A;  1M99 A;  1GRX A;  4OCF A;  4EIP A;  3EE2 A;  2GSS A;  4H86 A;  3S9F A;  4V1A p;  1GP1 A;  3FR6 A;  1PQN A;  3QOU A;  1SD8 A;  4MH3 A;  3KJY A;  1GSU A;  2H73 A;  4PI0 C;  5CRH A;  4AKG A;  3LOR A;  1MD4 A;  2CQ9 A;  1ZCP A;  2VLU A;  3HHV A;  1W4V A;  3DKS A;  9GSS A;  3KCM A;  2VM1 A;  1SVM A;  1I5G A;  1DUG A;  1TRW A;  2OT3 A;  3P7X A;  2BTO T;  5HR1 A;  1B8X A;  5DVB A;  4IN0 A;  4MZB A;  5ID2 A;  2XHF A;  3DD3 A;  1GTA A;  1JZO A;  2YN1 A;  3RBT A;  5HFK A;  4ULX A;  3IHQ A;  2VO4 A;  1GTB A;  4CY6 A;  2AYT A;  1ZMA A;  2VAF A;  4I8B A;  2E0Q A;  3HKR A;  2ZNM A;  3KMN A;  3ZZX A;  1H4O A;  4TOP A;  1M2B A;  5J41 A;  1U88 A;  4MK3 A;  5CRE A;  3UIW A;  4HQZ A;  1AQV A;  1GSE A;  4PTS A;  3C7M A;  2DKI A;  2JAD A;  5IOW A;  3VWV A;  3WD6 A;  1HYU A;  2LRN A;  4GQF A;  2EIO A;  3F4T A;  3VWX A;  1ERU A;  1BQ7 A;  4QQ7 A;  4MJA A;  1XWA A;  1TJD A;  4KDY A;  3FMW A;  2E7P A;  6GSV A;  4EL1 A;  1PL2 A;  2WGR A;  3PH9 A;  2PMT A;  3AY8 A;  4K8M A;  3TUE A;  4HU7 A;  1JZR A;  1R5P A;  1U3I A;  2WB9 A;  2VCX A;  2QGV A;  2Z9S A;  2O89 A;  2IJY A;  2VCW A;  5KN1 A;  2FD3 A;  1XCC A;  5H5R A;  3BOA A;  4WBR D;  5HR0 A;  1EGO A;  1USB A;  2VOC A;  5CRD A;  4PHZ C;  5IPH A;  4EXJ A;  4KCA A;  3LG6 A;  4ML1 A;  5G31 A;  3TRX A;  4WXT A;  4XCS A;  2NTO A;  1MDK A;  2H6Y A;  2KUC A;  5IOX A;  2OAD A;  1Y1U A;  4FIW A;  2FY6 A;  3HJM A;  1VF2 A;  2PU9 C;  3IBH A;  4GSN A;  3LWA A;  2M46 A;  5KOW A;  2YV7 A;  1ZGN A;  4V2L A;  4F9Z A;  3US3 A;  3UJ1 A;  1GUL A;  5ABR A;  3TDG A;  2VCV A;  4JR4 A;  1S3D A;  5EVO A;  4O5U A;  3CWG A;  1WE0 A;  4HQS A;  4CDO A;  2EC4 A;  4J56 E;  3HVX A;  3W8S A;  3DEX A;  5KEJ A;  3RAZ A;  2WVZ A;  2WDU A;  1SEN A;  5F07 A;  3MYD A;  2PVO C;  4MNN A;  1SJ6 A;  5CNW A;  1KBN A;  1KTE A;  2LNT A;  4MPF A;  4K2D A;  3LGC A;  4HZ4 A;  4K2X A;  2L6D A;  4USS A;  3F9U A;  1UVZ A;  1A2M A;  3IHG A;  11GS A;  1TTZ A;  1LU4 A;  3TRQ A;  4FXY P;  4V2N A;  2RM5 A;  5GAP D;  2YWN A;  2H76 A;  1R7H A;  5DBQ A;  3GH6 A;  1MDJ A;  3FK8 A;  1S3C A;  1B9X C;  5J4U A;  4G01 A;  1AQX A;  4Q5N A;  1OC8 A;  1JLW A;  1J0F A;  3ZRD A;  3QD9 A;  1KNG A;  3BBY A;  1TK5 B;  5IMC A;  4WR4 A;  3E9J B;  2ZCT A;  4ML6 A;  4QL9 A;  5IMV A;  4NV2 A;  3HJO A;  1GLP A;  3RHC A;  2KLX A;  5ENU A;  4N0V A;  1ZYQ B;  3RPN A;  3PR8 A;  4ZIJ A;  3P90 A;  2HE3 A;  3DXB A;  2R0G A;  4KCE A;  1X5E A;  2V6O A;  1Y25 A;  4ECB A;  1MEK A;  4ISD A;  4FYU A;  2M80 A;  2DJ0 A;  5C04 A;  1ZYN A;  2A4V A;  4F0C A;  3IOS A;  4E8H A;  2FGX A;  3F6F A;  2WFC A;  1ZL9 A;  4L0W A;  5JCW A;  2VKZ G;  2P0G A;  5G5F A;  2N5F A;  4RQR A;  3MWH A;  2P5R A;  1A8L A;  4MMM A;  1PMT A;  1TP9 A;  2OBI A;  1XIY A;  2B5E A;  3EWL A;  2H1A A;  5EPF A;  3GKN A;  3LXT A;  4POB A;  1FB0 A;  2YCD A;  3GYK A;  5A34 B;  3F6D A;  3W6G A;  2X8C A;  4PUF C;  1SK2 A;  4ZBA A;  2YV9 A;  4P3Y B;  1RW1 A;  4YKG A;  1YY7 A;  3N9J A;  1KEB A;  2I81 A;  4Q5Q A;  1TKD B;  4AKI A;  2X8G A;  2C3N A;  3Q19 A;  1EOH A;  3QAV A;  3HDC A;  1EOG A;  1F6M C;  2GZZ A;  4MJE A;  1WWJ A;  4W66 A;  4RI6 A;  2X4A A;  4YQU A;  3L9V A;  1G6W A;  1JHB A;  2C0G A;  3H93 A;  3FR9 A;  4MJC A;  3RHB A;  2R2J A;  1TU8 A;  2XPD A;  1BF5 A;  4YAP A;  6GST A;  3EUR A;  3KH7 A;  1ACV A;  3A2V A;  4FYC A;  2ON5 A;  4AGS A;  2HYX A;  4JZQ A;  4OFM A;  1HNA A;  4GCI A;  5A5H A;  1M9A A;  2WW3 A;  4HS1 A;  1SYX A;  1OC9 B;  2H70 A;  2MYG A;  3LW9 A;  1TK0 B;  5BMU A;  1BG5 A;  1NSW A;  4DSR A;  1B4Q A;  3GN3 A;  1T00 A;  1TOF A;  3F3R A;  5D8I A;  2J9H A;  2TIR A;  1ZOF A;  2ALB A;  2VCQ A;  4BL7 A;  3APS A;  1YKA A;  2LJA A;  3KD0 A;  5HR3 A;  2B7K A;  2IMK A;  5ELA A;  2R0P A;  1GUM A;  4BIK A;  1R4W A;  2DIY A;  4MA9 A;  4ZL8 A;  1XZO A;  2H1G A;  4EKZ A;  3WT1 A;  2M72 A;  4WF4 A;  2H1B A;  2L4Q A;  5IIZ A;  3I6A A;  2KOK A;  5B8A A;  1IYI A;  3IA1 A;  4PUA A;  2DMM A;  2LEG A;  3ZIT A;  3KMO A;  2N5B A;  3GX0 A;  4L8E A;  3LSZ A;  4PUR A;  4HUA A;  1A0F A;  4AJ8 A;  2HRK A;  5EL8 A;  3MSZ A;  4HEA 2;  2IME A;  4OCE A;  3QFA C;  1U87 A;  2X64 A;  5FHI A;  4HJ2 A;  2WCI A;  2EIR A;  4PNG A;  2HZE A;  3LXZ A;  3Q6O A;  3I9V 2;  4KSO A;  5LNK e;  1T4Z A;  2PGT A;  3ERG A;  4JU5 A;  4KUN A;  5ELG A;  6GSU A;  3U5R E;  3LYP A;  1PD2 1;  1J08 A;  3UVT A;  1EP7 A;  3Q74 A;  2R0C A;  2MMN A;  2YWI A;  5D73 A;  3FYG A;  1EZK A;  2WRT A;  4TRX A;  5CAX A;  3TKP A;  1GWC A;  2VL9 A;  5DQY A;  1GUK A;  4GQC A;  2VL2 A;  2YZU A;  5D9W A;  3CTF A;  1VF1 A;  4PNF A;  3BD2 A;  2V2G A;  3F63 A;  1XVW A;  3TKS C;  2HSH A;  5HFI A;  1SVO A;  3TJG A;  5KN0 A;  1ST9 A;  3ME8 A;  1SK1 A;  4HZ2 A;  2H75 A;  3QMX A;  3APO A;  3VPQ A;  3FR3 A;  2CVD A;  4X43 A;  5KOX A;  3ED3 A;  3E0U A;  4XS1 A;  1TXX A;  3H4K A;  2B5X A;  2H1D A;  2B7J A;  3LFL A;  1THX A;  4TKY A;  3H1N A;  5JWO B;  3QAG A;  3TJK A;  3ME7 A;  1XG8 A;  4ZBB A;  3MIX A;  5GZZ B;  1GSQ A;  2XBQ A;  2F9S A;  3IK7 A;  4KF9 A;  1ON4 A;  2L57 A;  3A5I A;  3LJR A;  4EE0 A;  4G9H A;  2D2Z A;  4IJI A;  1M9B A;  4TXO A;  4EUY A;  2DIZ A;  4K0G A;  5IQY A;  5IPG A;  4NMU A;  3VFI A;  4O5Q A;  2DJJ A;  2HI7 A;  4MLY A;  3HD5 A;  2H71 A;  4TN8 A;  4MF6 A;  1WIK A;  3FRC A;  3HYP A;  4I2T A;  5ECK B;  1V57 A;  4Z2T A;  1EEJ A;  3L9S A;  1GNE A;  2OJL A;  1K0M A;  2PWJ A;  2FLS A;  4G0K A;  3GKK A;  4ILF A;  4ICY A;  4LMV A;  4YAV A;  3KEB A;  5J5N A;  2O36 A;  2JU5 A;  1EEM A;  4E68 A;  4J57 E;  3IR4 A;  1Z7R A;  2BJX A;  4YQV A;  5JCU A;  2H01 A;  2C3Q A;  4JE1 A;  2LRT A;  1YQ1 A;  4OFN A;  4G2E A;  2G2Q A;  5IMA A;  4TXO B;  1ML6 A;  1SU9 A;  3FZ4 A;  2HXK A;  2H0G A;  4GTU A;  5A1N A;  1Z6M A;  3E3E A;  3FHK A;  5FWG A;  5IO2 A;  1K3O A;  3QFB C;  2B1K A;  4AJ7 A;  1WJK A;  4WF5 A;  13GS A;  1AAZ A;  1FVK A;  2HRN A;  3I69 A;  1R26 A;  2PBJ A;  3GH9 A;  4I2U A;  2AHE A;  3GV1 A;  2J23 A;  2L5L A;  1PSQ A;  5G1L A;  3WT2 A;  3ZVJ D;  3GRX A;  3CRU A;  4POM A;  5ID2 B;  2TRX A;  1HNC A;  3DRN A;  2QKE A;  4XS4 A;  3J7Y k;  2DJ1 A;  3VWU A;  3M0F A;  4KAE A;  3GMF A;  3DML A;  4ZB8 A;  4N30 A;  3TJB A;  3KGK A;  2UV8 G;  1XW5 A;  1F9M A;  3ERW A;  4JED A;  2JZT A;  2GGT A;  3DGQ A;  3TOU A;  1G7E A;  2VCZ A;  3IXR A;  1QK8 A;  3ZRE A;  1IYH A;  5DJL A;  5HFG A;  2H1L A;  1T1V A;  2H74 A;  3VI5 A;  5A1N B;  2OA7 A;  2EIQ A;  1O8X A;  4X0X A;  4KE3 A;  2WVY A;  1O7U A;  4XRD A;  4G10 A;  2FA4 A;  3CHX C;  4KDX A;  2GT5 A;  2CV4 A;  1SKR B;  2DJ3 A;  5J4Y A;  4A5P A;  1QFN A;  4F82 A;  5IMZ A;  1PX6 A;  1RQM A;  4FQU A;  1TRU A;  3A3T A;  4KX4 A;  4WKW A;  5IMF A;  1YF1 A;  18GS A;  4O5R A;  2NVL A;  1FG4 A;  2L5O A;  4XS4 B;  4DSS A;  3GL5 A;  3RDW A;  4JRR A;  1F2E A;  1K3L A;  19GS A;  4KH7 A;  5D9T A;  1W89 A;  1V58 A;  3L78 A;  2V6K A;  3RGB C;  3F3Q A;  1DSB A;  4MZC A;  1QGV A;  1X5C A;  1B4P A;  3ZFL A;  2H66 A;  4EDZ A;  1PGT A;  5AGY A;  1XOA A;  5FT3 A;  3O3T A;  2N5A A;  1LJR A;  2I9H A;  6GSY A;  1X9S B;  2B3S A;  4XRA A;  1XWK A;  1QQ2 A;  4ZL7 A;  5IO0 A;  2GQL A;  4ID0 A;  3KZQ A;  4YH2 A;  2R5G A;  3IC4 A;  1EV4 A;  2I1U A;  4IS0 A;  3ZML A;  2P31 A;  4NHZ A;  4K5R A;  6GSW A;  2F3M A;  3TCO A;  5ECN B;  4MCU A;  1QUW A;  3IE3 A;  2VD1 A;  2ON7 A;  2MBS A;  14GS A;  2YJ7 A;  2FWG A;  2LJR A;  1AIU A;  2WZ9 A;  4ECJ A;  1JLV A;  1AQW A;  3GST A;  5G2Z A;  3JCM L;  2C0D A;  2A2P A;  5ECR B;  4HDE A;  2OE1 A;  1JZW A;  2PN8 A;  1VGL A;  2CZ3 A;  4IGJ A;  1PN0 A;  2QC7 A;  1GSD A;  1FO5 A;  1A0R P;  3M8N A;  3GKX A;  3SBC A;  3IAM 2;  3KTL A;  2B6M A;  1AW9 A;  2DC5 A;  3CXG A;  5COH A;  4AF2 A;  4TVE A;  3D4T A;  3EU3 A;  1THO A;  4NV5 A;  3BCI A;  3GUR A;  3ISO A;  3IAS 2;  2FCH A;  3MDK A;  1ZYE A;  2YOI A;  3MAK A;  2LST A;  1VF4 A;  5CRG A;  2KHP A;  3BCK A;  2C8U A;  2VLT A;  4AJ6 A;  1M3I A;  3ERF A;  4NHW A;  1XPV A;  2KP1 A;  4XHM A;  4F0B A;  5ECH B;  4RI7 A;  1Z5Y E;  2PPT A;  2IPA A;  1GSF A;  4L5L A;  2PVQ A;  4KB3 A;  4QL7 A;  4BWS A;  1PKW A;  1SVL A;  2EFH A;  3UVH A;  4BWQ A;  2JSZ A;  2O8V B;  5ECL B;  2NPB A;  3GX8 A;  1MD3 A;  4IVF A;  1NHY A;  2EFE A;  10GS A;  4L0U A;  3EPT A;  3VPT A;  1T3B A;  1YZX A;  3UAP A;  5CP1 A;  3D6I A;  4L5O A;  1ZZY A;  1JZD A;  3CRT A;  5F06 A;  1K0B A;  5B8B A;  2V32 A;  2JL4 A;  4K7N A;  4DVC A;  2H6Z A;  4ECC A;  1YF0 A;  3LEF A;  1O6J A;  1BX9 A;  2H19 A;  4I5Q A;  1K0C A;  1OE8 A;  1PA3 A;  5BRT A;  4LL4 B;  1XOB A;  2H30 A;  1F3B A;  3GKM A;  4PQI A;  4ZB6 A;  3GA4 A;  1DE1 A;  2HSN A;  1FB6 A;  1HNB A;  1VRS D;  4N0Z A;  5AIX A;  2MMZ A;  2VUP A;  3F4R A;  4KA0 A;  5H5Q A;  2EFD A;  4F03 A;  1O85 A;  4O7H A;  4N10 A;  4CY8 A;  3HA9 A;  16GS A;  5C00 A;  2A2S A;  2RUF A;  3G9B A;  3TOT A;  3SWL A;  4AKH A;  2AAW A;  1OYJ A;  4G0I A;  2IIY A;  1A2J A;  1O73 A;  1EGR A;  3FKF A;  1Z9H A;  1YDK A;  2GTU A;  4EDY A;  2HT9 A;  3DIE A;  5A4W A;  6GSX A;  4OFT A;  3C1R A;  3M9J A;  3VI7 A;  3DVX A;  1X5D A;  5LD0 A;  3WGD A;  5IMD A;  4LA1 A;  2G0F A;  5J40 A;  2R37 A;  3GUS A;  2KP2 A;  3IC8 A;  2MMA A;  3K8N A;  3F8U A;  1XW6 A;  5A5H B;  2WS2 A;  3H79 A;  4TR0 A;  1GTI A;  3GFK A;  1WRY A;  3TKS A;  2MZC A;  3CBU A;  1JFU A;  3EU4 A;  3FEU A;  2GST A;  3D21 A;  1GTU A;  5KN3 A;  5D9V A;  1B9Y C;  5AIV A;  1PFO A;  5BMU B;  4ECI A;  2B5Y A;  3G7J A;  4GDF A;  3CSI A;  5G1K A;  1BYE A;  1ERT A;  3HY2 A;  4BL7 B;  3BJ5 A;  2GDR A;  2H0I A;  4FO5 A;  20GS A;  3TJF A;  1HQO A;  1AUC A;  2AV4 A;  2JZR A;  4G0L A;  3WGX A;  1V9W A;  4PQH A;  1Y6E A;  2VIM A;  4CHS A;  3A5W A;  1SK0 A;  4D73 A;  3G7Y A;  4FYB A;  2L6C A;  2C4J A;  1K0N A;  1XWC A;  2X8H A;  3GL3 A;  3N5O A;  2LS5 A;  4TR4 A;  5DAL A;  3L0H A;  4N3Z A;  3ZL5 A;  1EP8 A;  1FW1 A;  1Z6N A;  1OKD A;  4F2I A;  4HOJ A;  2WUL A;  2ZUP A;  3HXS A;  4ZL9 A;  2OAC A;  5B6N A;  2HRK B;  2LQO A;  4PGT A;  3EMP A;  1V40 A;  2B1L A;  4NXI A;  4O92 A;  2HZE B;  4HJM A;  4IBP A;  3FZA A;  2UZ8 A;  2OBK A;  4AI6 A;  2XPE A;  1I9D A;  2DBC A;  2YJH A;  1XWB A;  3DWV A;  4QMK A;  2QA1 A;  2F8F A;  2TRC P;  4XTS A;  4BPY A;  4GST A;  1A24 A;  3C73 A;  2LJK A;  1X9M B;  1H75 A;  2DJ2 A;  5A4U A;  2O7K A;  2LUS A;  5JCG A;  1G6Y A;  5DAL B;  3CQF A;  2A4H A;  1U6T A;  5DCH A;  3FZ5 A;  2V41 A;  4IP1 A;  1TXU A;  2K18 A;  2K6V A;  2VL2 C;  3ZYW A;  2HQT A;  3NZN A;  2GZY A;  4OWY A;  3KM6 A;  4E8E A;  2FWF A;  2V1M A;  1XWG A;  3KH9 A;  2AJQ B;  2K9F A;  2WW2 A;  2HLS A;  3HMJ G;  1YEP A;  4MP4 A;  4K7O A;  4LL1 B;  1X9W B;  3OR5 A;  3UL3 A;  4IKH A;  1OAZ A;  1YEX A;  5AN1 A;  4XS6 A;  1AXD A;  2GLR A;  4GSS A;  1E6B A;  5LCZ A;  5E4W A;  3TRP A;  1GUH A;  5J47 A;  2R6K A;  1GH2 A;  3F4S A;  5HR2 A;  2E2M A;  5DCG A;  4WET A;  2CAI A;  2HRA A;  4MPG A;  4IEL A;  1GNW A;  3MNG A;  1TDI A;  3H8Q A;  3U6V A;  3UBL A;  2YWM A;  2CA8 A;  4IQA A;  2GSQ A;  2X49 A;  1DBY A;  2I4A A;  2F8A A;  1PL1 A;  3M3M A;  2ES7 A;  1MTC A;  4MF5 A;  2OE3 A;  4PX1 A;  2RII A;  3UOM A;  2EFC A;  2L4C A;  3HVV A;  2H6X A;  3UBK A;  5EY6 A;  3DYR A;  4KDU A;  4TW5 A;  4X4J A;  5DDL A;  2IWT A;  1R5A A;  2CAQ A;  1SJI A;  4V1A g;  1YVL A;  2C0E A;  2H0H A;  4N11 A;  3RPP A;  1RK4 A;  1S4B P;  1ILO A;  1SL2 B;  1BED A;  3ZMK A;  1UA5 A;  4LLR A;  4WEY A;  1M2A A;  1M3J A;  1V98 A;  3HCZ A;  4YQM A;  4ZIL A;  2BMX A;  1FVJ A;  1Q98 A;  12GS A;  2WW0 A;  3VLN A;  4DEJ A;  5JWR B;  2X99 A;  2YNX A;  4IHU A;  3C1S A;  5ECM B;  1ERV A;  2VCT A;  3PPU A;  2A2R A;  4TR1 A;  4IW9 A;  1E2Y A;  2VD0 A;  4OO4 A;  3QCP A;  1OE7 A;  3EC3 A;  1AC1 A;  2XC2 A;  1SL0 B;  3IRA A;  4PI2 C;  4BVY A;  3FZ9 A;  2CX3 A;  3C8E A;  2IMD A;  2FWH A;  5CO3 A;  4I6X A;  1T7P B;  1M2D A;  3UEM A;  2C80 A;  2NBS A; 
#chains in the Genus database with same CATH homology
 4NAX A;  1Q4J A;  4K0N A;  2E2G A;  1N2A A;  1BG1 A;  2OE0 A;  2GT6 A;  2I3Y A;  2C0F A;  1NM3 A;  2H8L A;  5CRW A;  4IP6 A;  2DML A;  2JAC A;  5D93 A;  1K0D A;  4J2F A;  5DJM A;  2GQK A;  3ZIV A;  1Z3E A;  4HU9 A;  5G30 A;  2WJU A;  3R2Q A;  1G7O A;  3HVS A;  4HI7 A;  1NHO A;  3EMX A;  4MZW A;  3KIJ A;  3ZLP A;  1N8J A;  1TI1 A;  1F3A A;  5GSS A;  1M0U A;  3TKR A;  1TW9 A;  5DAK A;  5AIS A;  3EYT A;  5B7C A;  3WYW A;  2REM A;  3CSH A;  1O8W A;  2PUK C;  3O76 A;  4TR1 B;  3P8W A;  2DJK A;  4XIH A;  2IL3 A;  4EO3 A;  4NPB A;  2CVK A;  3M1G A;  2JZS A;  3HJP A;  3VK9 A;  3FY7 A;  1QXH A;  3QPM A;  2PER A;  4OMV A;  1Z7P A;  2CX4 A;  4BVY B;  4ZB7 A;  4GF0 A;  4RQX A;  4ZB9 A;  2FUG 2;  1PN9 A;  2GQM A;  5J9B A;  5F8B A;  5E59 A;  1SKW B;  2VL3 A;  3G7I A;  5GAN D;  4Z2R A;  1PRX A;  2HNL A;  1GSS A;  1S3A A;  3CYN A;  2MMO A;  5D9X A;  1A23 A;  4OD7 A;  1GLQ A;  4V2M A;  1CQH A;  5F0G A;  5A34 A;  4BA7 A;  4DSS B;  2GS3 A;  2CVB A;  2IMF A;  1GL8 A;  1FOH A;  1XVQ A;  1NW2 A;  1WMJ A;  3A2X A;  2RM6 A;  3EVI A;  5ECP B;  4Z2U A;  5DAK B;  1XXU A;  2DKH A;  5KN2 A;  4POL A;  5IM9 A;  4POK A;  5GST A;  1K0A A;  4JR6 A;  5INY A;  3KTB A;  1FAA A;  4MAB A;  5ECO B;  5B6M A;  1A8Y A;  1ERW A;  2QSI A;  4ZXG A;  4TR3 A;  5L71 A;  4O32 A;  4MJB A;  3LYK A;  2O85 A;  5F05 A;  1URM A;  4K5S A;  2O5V A;  1BJX A;  2GVP A;  4EC0 A;  5A5K A;  7GSS A;  4K7I A;  1SD9 A;  1WOU A;  5ECQ B;  3GNJ A;  2LQQ A;  1DE2 A;  5HQP A;  1GSY A;  1FHE A;  4FH8 A;  3TGZ A;  1ZYP A;  4NWY A;  1F37 A;  2CZ2 A;  5G5E A;  4PQ1 A;  2RUE A;  3R3E A;  2MBT A;  1FOV A;  2LTK A;  2HSM A;  4KW6 A;  1OC9 A;  4MF7 A;  3APQ A;  5J3R A;  1SL1 B;  2VM2 A;  5H5S A;  3GTU A;  1SJZ A;  3TB2 A;  3KXO A;  3TJJ A;  1EV9 A;  4IQ1 A;  1O81 A;  3DVW A;  2YZH A;  4DSQ A;  2VLV A;  4KND A;  3CTG A;  4I97 A;  4GLT A;  2YP6 A;  3GIX A;  4WBJ A;  1UN2 A;  4Q5R A;  2IN3 A;  4EF0 A;  4MDC A;  4EIQ A;  2DSA A;  1XW9 A;  2HZF A;  1MDI A;  3KP9 A;  3QAW A;  4OO5 A;  4Q5F A;  3J7Y b;  2YWO A;  3VUR A;  4ZBD A;  8GSS A;  3P2A A;  2FNO A;  3W8J A;  2C1Y A;  2R4V A;  3A2W A;  1TK8 B;  5J9C A;  2CT6 A;  3ZTL A;  3D22 A;  2XBI A;  4AKX B;  3I43 A;  2O87 A;  5D96 A;  1X0R A;  3ZIJ A;  3M9K A;  1PX7 A;  2OKA A;  1C72 A;  2HSM B;  4G19 A;  1WP0 A;  2QA2 A;  4RUV A;  5DQS A;  2YAN A;  3GTU B;  4EVM A;  3GHA A;  2P5Q A;  4GXZ A;  3L9U A;  3NIV A;  2HSY A;  3KP8 A;  2IFQ A;  1N25 A;  5A4V A;  4K9Z A;  5J4V A;  3HZ4 A;  2C3T A;  4IJ3 A;  1OVN A;  2LKU A;  3GSS A;  5ECI B;  4WR5 A;  3ZVJ A;  1K3Y A;  4KGI A;  3TKQ A;  2H72 A;  3Q18 A;  2JSY A;  2RLI A;  1YJ6 A;  4BVX A;  3FW2 A;  1B48 A;  3D0Z A;  4X1U A;  4Z7X A;  1WPI A;  3D5J A;  2AB6 A;  3TU3 B;  2HSN B;  2IMI A;  4KSM A;  2GZP A;  3D4M A;  1BAY A;  6GSS A;  1ABA A;  2GSR A;  1CQG A;  1G0T A;  17GS A;  2LV3 A;  4JBB A;  1OC3 A;  5ECS A;  2R3X A;  3HZ8 A;  2DLX A;  1TI3 A;  1TU7 A;  3CMI A;  4CW9 A;  1XFL A;  1QMV A;  1UC7 A;  4K1F A;  2IFQ B;  1OKT A;  2FHE A;  1A2L A;  1TRS A;  1U3A A;  1T8E B;  2FA8 A;  2LRC A;  1V2A A;  4YKF A;  4LMW A;  2K8V A;  4BVX B;  3CSJ A;  5JWQ B;  1YKC A;  3PGT A;  3PIN A;  5CYY A;  3TKS E;  3QR6 A;  4GWR A;  4PXO A;  3NOF A;  3ZFB A;  2NDO A;  3UMA A;  1TRV A;  1SYR A;  1VF3 A;  4GRF A;  2L59 A;  1M7T A;  2YPM A;  3VWW A;  3EIN A;  2F51 A;  2HRF A;  3V1W A;  1XBS A;  2FWE A;  3IDV A;  3QDN A;  3IV4 A;  3LQ7 A;  1T4Y A;  1PKZ A;  3O6T A;  3WGE A;  3F0I A;  4ACS A;  4D73 B;  1LBK A;  3C71 A;  1HD2 A;  2HFD A;  4K6X A;  2LNS A;  4TXV A;  3IPZ A;  3L4N A;  4MH2 A;  2K8S A;  1K0O A;  2AUV A;  3UAR A;  1J9B A;  22GS A;  1SKS B;  3IK9 A;  1EWX A;  1M99 A;  1GRX A;  4OCF A;  4EIP A;  3EE2 A;  2GSS A;  4H86 A;  3S9F A;  4V1A p;  1GP1 A;  3FR6 A;  1PQN A;  3QOU A;  1SD8 A;  4MH3 A;  3KJY A;  1GSU A;  2H73 A;  5CRH A;  4AKG A;  3LOR A;  1MD4 A;  2CQ9 A;  1ZCP A;  2VLU A;  3HHV A;  1W4V A;  3DKS A;  9GSS A;  3KCM A;  2VM1 A;  1SVM A;  1I5G A;  1DUG A;  1TRW A;  2OT3 A;  3P7X A;  2BTO T;  5HR1 A;  1B8X A;  5DVB A;  4IN0 A;  4MZB A;  5ID2 A;  2XHF A;  3DD3 A;  1GTA A;  1JZO A;  2YN1 A;  3RBT A;  5HFK A;  4ULX A;  3IHQ A;  2VO4 A;  1GTB A;  4CY6 A;  2AYT A;  1ZMA A;  2VAF A;  4I8B A;  2E0Q A;  3HKR A;  2ZNM A;  3KMN A;  3ZZX A;  1H4O A;  4TOP A;  1M2B A;  5J41 A;  1U88 A;  4MK3 A;  5CRE A;  3UIW A;  4HQZ A;  1AQV A;  1GSE A;  4PTS A;  3C7M A;  2DKI A;  2JAD A;  5IOW A;  3VWV A;  3WD6 A;  1HYU A;  2LRN A;  4GQF A;  2EIO A;  3F4T A;  3VWX A;  1ERU A;  1BQ7 A;  4QQ7 A;  4MJA A;  1XWA A;  1TJD A;  4KDY A;  3FMW A;  2E7P A;  6GSV A;  4EL1 A;  1PL2 A;  2WGR A;  3PH9 A;  2PMT A;  3AY8 A;  4K8M A;  3TUE A;  4HU7 A;  1JZR A;  1R5P A;  1U3I A;  2WB9 A;  2VCX A;  2QGV A;  2Z9S A;  2O89 A;  2IJY A;  2VCW A;  5KN1 A;  2FD3 A;  1XCC A;  5H5R A;  3BOA A;  4WBR D;  5HR0 A;  1EGO A;  1USB A;  2VOC A;  5CRD A;  5IPH A;  4EXJ A;  4KCA A;  3LG6 A;  4ML1 A;  5G31 A;  3TRX A;  4WXT A;  4XCS A;  2NTO A;  1MDK A;  2H6Y A;  2KUC A;  5IOX A;  2OAD A;  1Y1U A;  4FIW A;  2FY6 A;  3HJM A;  1VF2 A;  2PU9 C;  3IBH A;  4GSN A;  3LWA A;  2M46 A;  5KOW A;  2YV7 A;  1ZGN A;  4V2L A;  4F9Z A;  3US3 A;  3UJ1 A;  1GUL A;  5ABR A;  3TDG A;  2VCV A;  4JR4 A;  1S3D A;  5EVO A;  4O5U A;  3CWG A;  1WE0 A;  4HQS A;  4CDO A;  2EC4 A;  4J56 E;  3HVX A;  3W8S A;  3DEX A;  5KEJ A;  3RAZ A;  2WDU A;  1SEN A;  5F07 A;  3MYD A;  2PVO C;  4MNN A;  1SJ6 A;  5CNW A;  1KBN A;  1KTE A;  2LNT A;  4MPF A;  4K2D A;  3LGC A;  4HZ4 A;  4K2X A;  2L6D A;  4USS A;  3F9U A;  1UVZ A;  1A2M A;  3IHG A;  11GS A;  1TTZ A;  1LU4 A;  3TRQ A;  4V2N A;  2RM5 A;  5GAP D;  2YWN A;  2H76 A;  1R7H A;  5DBQ A;  3GH6 A;  1MDJ A;  3FK8 A;  1S3C A;  1B9X C;  5J4U A;  4G01 A;  1AQX A;  4Q5N A;  1OC8 A;  1JLW A;  1J0F A;  3ZRD A;  3QD9 A;  1KNG A;  3BBY A;  1TK5 B;  5IMC A;  4WR4 A;  3E9J B;  2ZCT A;  4ML6 A;  4QL9 A;  5IMV A;  4NV2 A;  3HJO A;  1GLP A;  3RHC A;  2KLX A;  5ENU A;  4N0V A;  1ZYQ B;  3RPN A;  3PR8 A;  4ZIJ A;  3P90 A;  2HE3 A;  3DXB A;  2R0G A;  4KCE A;  1X5E A;  2V6O A;  1Y25 A;  4ECB A;  1MEK A;  4ISD A;  4FYU A;  2M80 A;  2DJ0 A;  5C04 A;  1ZYN A;  2A4V A;  4F0C A;  3IOS A;  4E8H A;  2FGX A;  3F6F A;  2WFC A;  1ZL9 A;  4L0W A;  5JCW A;  2VKZ G;  2P0G A;  5G5F A;  2N5F A;  4RQR A;  3MWH A;  2P5R A;  1A8L A;  4MMM A;  1PMT A;  1TP9 A;  2OBI A;  1XIY A;  2B5E A;  3EWL A;  2H1A A;  5EPF A;  3GKN A;  3LXT A;  4POB A;  1FB0 A;  2YCD A;  3GYK A;  5A34 B;  3F6D A;  3W6G A;  2X8C A;  4PUF C;  1SK2 A;  4ZBA A;  2YV9 A;  4P3Y B;  1RW1 A;  4YKG A;  1YY7 A;  3N9J A;  1KEB A;  2I81 A;  4Q5Q A;  1TKD B;  4AKI A;  2X8G A;  2C3N A;  3Q19 A;  1EOH A;  3QAV A;  3HDC A;  1EOG A;  1F6M C;  2GZZ A;  4MJE A;  1WWJ A;  4W66 A;  4RI6 A;  2X4A A;  4YQU A;  3L9V A;  1G6W A;  1JHB A;  2C0G A;  3H93 A;  3FR9 A;  4MJC A;  3RHB A;  2R2J A;  1TU8 A;  2XPD A;  1BF5 A;  4YAP A;  6GST A;  3EUR A;  3KH7 A;  1ACV A;  3A2V A;  4FYC A;  2ON5 A;  4AGS A;  2HYX A;  4JZQ A;  4OFM A;  1HNA A;  4GCI A;  5A5H A;  1M9A A;  4HS1 A;  1SYX A;  1OC9 B;  2H70 A;  2MYG A;  3LW9 A;  1TK0 B;  5BMU A;  1BG5 A;  1NSW A;  4DSR A;  1B4Q A;  3GN3 A;  1T00 A;  1TOF A;  3F3R A;  5D8I A;  2J9H A;  2TIR A;  1ZOF A;  2ALB A;  2VCQ A;  4BL7 A;  3APS A;  1YKA A;  2LJA A;  3KD0 A;  5HR3 A;  2B7K A;  2IMK A;  5ELA A;  2R0P A;  1GUM A;  1R4W A;  2DIY A;  4MA9 A;  4ZL8 A;  1XZO A;  2H1G A;  4EKZ A;  3WT1 A;  2M72 A;  4WF4 A;  2H1B A;  2L4Q A;  5IIZ A;  3I6A A;  2KOK A;  5B8A A;  1IYI A;  3IA1 A;  4PUA A;  2DMM A;  2LEG A;  3ZIT A;  3KMO A;  2N5B A;  3GX0 A;  4L8E A;  3LSZ A;  4PUR A;  4HUA A;  1A0F A;  4AJ8 A;  2HRK A;  5EL8 A;  3MSZ A;  4HEA 2;  2IME A;  4OCE A;  3QFA C;  1U87 A;  2X64 A;  5FHI A;  4HJ2 A;  2WCI A;  2EIR A;  4PNG A;  2HZE A;  3LXZ A;  3Q6O A;  3I9V 2;  4KSO A;  5LNK e;  1T4Z A;  2PGT A;  3ERG A;  4JU5 A;  4KUN A;  5ELG A;  6GSU A;  3U5R E;  3LYP A;  1PD2 1;  1J08 A;  3UVT A;  1EP7 A;  3Q74 A;  2R0C A;  2MMN A;  2YWI A;  5D73 A;  3FYG A;  1EZK A;  2WRT A;  4TRX A;  5CAX A;  3TKP A;  1GWC A;  2VL9 A;  5DQY A;  1GUK A;  4GQC A;  2VL2 A;  2YZU A;  5D9W A;  3CTF A;  1VF1 A;  4PNF A;  3BD2 A;  2V2G A;  3F63 A;  1XVW A;  3TKS C;  2HSH A;  5HFI A;  1SVO A;  3TJG A;  5KN0 A;  1ST9 A;  3ME8 A;  1SK1 A;  4HZ2 A;  2H75 A;  3QMX A;  3APO A;  3VPQ A;  3FR3 A;  2CVD A;  4X43 A;  5KOX A;  3ED3 A;  3E0U A;  4XS1 A;  1TXX A;  3H4K A;  2B5X A;  2H1D A;  2B7J A;  3LFL A;  1THX A;  4TKY A;  3H1N A;  5JWO B;  3QAG A;  3TJK A;  3ME7 A;  4ZBB A;  3MIX A;  5GZZ B;  1GSQ A;  2XBQ A;  2F9S A;  3IK7 A;  4KF9 A;  1ON4 A;  2L57 A;  3A5I A;  3LJR A;  4EE0 A;  4G9H A;  2D2Z A;  4IJI A;  1M9B A;  4TXO A;  4EUY A;  2DIZ A;  4K0G A;  5IQY A;  5IPG A;  4NMU A;  3VFI A;  4O5Q A;  2DJJ A;  2HI7 A;  4MLY A;  3HD5 A;  2H71 A;  4TN8 A;  4MF6 A;  1WIK A;  3FRC A;  3HYP A;  4I2T A;  5ECK B;  1V57 A;  4Z2T A;  1EEJ A;  3L9S A;  1GNE A;  2OJL A;  1K0M A;  2PWJ A;  2FLS A;  4G0K A;  3GKK A;  4ILF A;  4ICY A;  4LMV A;  4YAV A;  3KEB A;  5J5N A;  2JU5 A;  1EEM A;  4E68 A;  4J57 E;  3IR4 A;  1Z7R A;  2BJX A;  4YQV A;  5JCU A;  2H01 A;  2C3Q A;  4JE1 A;  2LRT A;  1YQ1 A;  4OFN A;  4G2E A;  2G2Q A;  5IMA A;  4TXO B;  1ML6 A;  1SU9 A;  3FZ4 A;  2HXK A;  2H0G A;  4GTU A;  5A1N A;  1Z6M A;  3E3E A;  3FHK A;  5FWG A;  5IO2 A;  1K3O A;  3QFB C;  2B1K A;  4AJ7 A;  1WJK A;  4WF5 A;  13GS A;  1AAZ A;  1FVK A;  2HRN A;  3I69 A;  1R26 A;  2PBJ A;  3GH9 A;  4I2U A;  2AHE A;  3GV1 A;  2J23 A;  2L5L A;  1PSQ A;  5G1L A;  3WT2 A;  3ZVJ D;  3GRX A;  3CRU A;  4POM A;  5ID2 B;  2TRX A;  1HNC A;  3DRN A;  2QKE A;  4XS4 A;  3J7Y k;  2DJ1 A;  3VWU A;  3M0F A;  4KAE A;  3GMF A;  3DML A;  4ZB8 A;  4N30 A;  3TJB A;  3KGK A;  2UV8 G;  1XW5 A;  1F9M A;  3ERW A;  4JED A;  2JZT A;  2GGT A;  3DGQ A;  3TOU A;  1G7E A;  2VCZ A;  3IXR A;  1QK8 A;  3ZRE A;  1IYH A;  5DJL A;  5HFG A;  2H1L A;  1T1V A;  2H74 A;  3VI5 A;  5A1N B;  2OA7 A;  2EIQ A;  1O8X A;  4X0X A;  4KE3 A;  1O7U A;  4XRD A;  4G10 A;  2FA4 A;  4KDX A;  2GT5 A;  2CV4 A;  1SKR B;  2DJ3 A;  5J4Y A;  4A5P A;  1QFN A;  4F82 A;  5IMZ A;  1PX6 A;  1RQM A;  4FQU A;  1TRU A;  3A3T A;  4KX4 A;  4WKW A;  5IMF A;  1YF1 A;  18GS A;  4O5R A;  2NVL A;  1FG4 A;  2L5O A;  4XS4 B;  4DSS A;  3GL5 A;  3RDW A;  4JRR A;  1F2E A;  1K3L A;  19GS A;  4KH7 A;  5D9T A;  1W89 A;  1V58 A;  3L78 A;  2V6K A;  3F3Q A;  1DSB A;  4MZC A;  1QGV A;  1X5C A;  1B4P A;  3ZFL A;  2H66 A;  4EDZ A;  1PGT A;  5AGY A;  1XOA A;  5FT3 A;  3O3T A;  2N5A A;  1LJR A;  2I9H A;  6GSY A;  1X9S B;  2B3S A;  4XRA A;  1XWK A;  1QQ2 A;  4ZL7 A;  5IO0 A;  2GQL A;  4ID0 A;  3KZQ A;  4YH2 A;  2R5G A;  3IC4 A;  1EV4 A;  2I1U A;  4IS0 A;  3ZML A;  2P31 A;  4NHZ A;  4K5R A;  6GSW A;  2F3M A;  3TCO A;  5ECN B;  4MCU A;  1QUW A;  3IE3 A;  2VD1 A;  2ON7 A;  2MBS A;  14GS A;  2YJ7 A;  2FWG A;  2LJR A;  1AIU A;  2WZ9 A;  4ECJ A;  1JLV A;  1AQW A;  3GST A;  5G2Z A;  3JCM L;  2C0D A;  2A2P A;  5ECR B;  4HDE A;  2OE1 A;  1JZW A;  2PN8 A;  1VGL A;  2CZ3 A;  4IGJ A;  1PN0 A;  2QC7 A;  1GSD A;  1FO5 A;  1A0R P;  3M8N A;  3GKX A;  3SBC A;  3IAM 2;  3KTL A;  2B6M A;  1AW9 A;  2DC5 A;  3CXG A;  5COH A;  4AF2 A;  4TVE A;  3D4T A;  3EU3 A;  1THO A;  4NV5 A;  3BCI A;  3GUR A;  3ISO A;  3IAS 2;  2FCH A;  3MDK A;  1ZYE A;  2YOI A;  3MAK A;  2LST A;  1VF4 A;  5CRG A;  2KHP A;  3BCK A;  2C8U A;  2VLT A;  4AJ6 A;  3ERF A;  4NHW A;  1XPV A;  2KP1 A;  4XHM A;  4F0B A;  5ECH B;  4RI7 A;  1Z5Y E;  2PPT A;  2IPA A;  1GSF A;  4L5L A;  2PVQ A;  4KB3 A;  4QL7 A;  4BWS A;  1PKW A;  1SVL A;  2EFH A;  3UVH A;  4BWQ A;  2JSZ A;  2O8V B;  5ECL B;  2NPB A;  3GX8 A;  1MD3 A;  4IVF A;  1NHY A;  2EFE A;  10GS A;  4L0U A;  3EPT A;  3VPT A;  1T3B A;  1YZX A;  3UAP A;  5CP1 A;  3D6I A;  4L5O A;  1ZZY A;  1JZD A;  3CRT A;  5F06 A;  1K0B A;  5B8B A;  2V32 A;  2JL4 A;  4K7N A;  4DVC A;  2H6Z A;  4ECC A;  1YF0 A;  3LEF A;  1O6J A;  1BX9 A;  2H19 A;  4I5Q A;  1K0C A;  1OE8 A;  1PA3 A;  5BRT A;  4LL4 B;  1XOB A;  2H30 A;  1F3B A;  3GKM A;  4PQI A;  4ZB6 A;  3GA4 A;  1DE1 A;  2HSN A;  1FB6 A;  1HNB A;  1VRS D;  4N0Z A;  5AIX A;  2MMZ A;  2VUP A;  3F4R A;  4KA0 A;  5H5Q A;  2EFD A;  4F03 A;  1O85 A;  4O7H A;  4N10 A;  4CY8 A;  3HA9 A;  16GS A;  5C00 A;  2A2S A;  2RUF A;  3G9B A;  3TOT A;  3SWL A;  4AKH A;  2AAW A;  1OYJ A;  4G0I A;  2IIY A;  1A2J A;  1O73 A;  1EGR A;  3FKF A;  1Z9H A;  1YDK A;  2GTU A;  4EDY A;  2HT9 A;  3DIE A;  5A4W A;  6GSX A;  4OFT A;  3C1R A;  3M9J A;  3VI7 A;  3DVX A;  1X5D A;  5LD0 A;  3WGD A;  5IMD A;  4LA1 A;  2G0F A;  5J40 A;  2R37 A;  3GUS A;  2KP2 A;  3IC8 A;  2MMA A;  3K8N A;  3F8U A;  1XW6 A;  5A5H B;  2WS2 A;  3H79 A;  4TR0 A;  1GTI A;  3GFK A;  1WRY A;  3TKS A;  2MZC A;  3CBU A;  1JFU A;  3EU4 A;  3FEU A;  2GST A;  3D21 A;  1GTU A;  5KN3 A;  5D9V A;  1B9Y C;  5AIV A;  5BMU B;  4ECI A;  2B5Y A;  3G7J A;  4GDF A;  3CSI A;  5G1K A;  1BYE A;  1ERT A;  3HY2 A;  4BL7 B;  3BJ5 A;  2GDR A;  2H0I A;  4FO5 A;  20GS A;  3TJF A;  1HQO A;  1AUC A;  2AV4 A;  2JZR A;  4G0L A;  3WGX A;  1V9W A;  4PQH A;  1Y6E A;  2VIM A;  4CHS A;  3A5W A;  1SK0 A;  4D73 A;  3G7Y A;  4FYB A;  2L6C A;  2C4J A;  1K0N A;  1XWC A;  2X8H A;  3GL3 A;  3N5O A;  2LS5 A;  4TR4 A;  5DAL A;  3L0H A;  4N3Z A;  3ZL5 A;  1EP8 A;  1FW1 A;  1Z6N A;  1OKD A;  4F2I A;  4HOJ A;  2WUL A;  2ZUP A;  3HXS A;  4ZL9 A;  2OAC A;  5B6N A;  2HRK B;  2LQO A;  4PGT A;  3EMP A;  1V40 A;  2B1L A;  4NXI A;  4O92 A;  2HZE B;  4HJM A;  4IBP A;  3FZA A;  2UZ8 A;  2OBK A;  4AI6 A;  2XPE A;  1I9D A;  2DBC A;  2YJH A;  1XWB A;  3DWV A;  4QMK A;  2QA1 A;  2F8F A;  2TRC P;  4XTS A;  4BPY A;  4GST A;  1A24 A;  3C73 A;  2LJK A;  1X9M B;  1H75 A;  2DJ2 A;  5A4U A;  2O7K A;  2LUS A;  5JCG A;  1G6Y A;  5DAL B;  2A4H A;  1U6T A;  5DCH A;  3FZ5 A;  2V41 A;  4IP1 A;  1TXU A;  2K18 A;  2K6V A;  2VL2 C;  3ZYW A;  2HQT A;  3NZN A;  2GZY A;  4OWY A;  3KM6 A;  4E8E A;  2FWF A;  2V1M A;  1XWG A;  3KH9 A;  2AJQ B;  2K9F A;  2HLS A;  3HMJ G;  1YEP A;  4MP4 A;  4K7O A;  4LL1 B;  1X9W B;  3OR5 A;  3UL3 A;  4IKH A;  1OAZ A;  1YEX A;  5AN1 A;  4XS6 A;  1AXD A;  2GLR A;  4GSS A;  1E6B A;  5LCZ A;  5E4W A;  3TRP A;  1GUH A;  5J47 A;  2R6K A;  1GH2 A;  3F4S A;  5HR2 A;  2E2M A;  5DCG A;  4WET A;  2CAI A;  2HRA A;  4MPG A;  4IEL A;  1GNW A;  3MNG A;  1TDI A;  3H8Q A;  3U6V A;  3UBL A;  2YWM A;  2CA8 A;  4IQA A;  2GSQ A;  2X49 A;  1DBY A;  2I4A A;  2F8A A;  1PL1 A;  3M3M A;  2ES7 A;  1MTC A;  4MF5 A;  2OE3 A;  4PX1 A;  2RII A;  3UOM A;  2EFC A;  2L4C A;  3HVV A;  2H6X A;  3UBK A;  5EY6 A;  3DYR A;  4KDU A;  4TW5 A;  4X4J A;  5DDL A;  2IWT A;  1R5A A;  2CAQ A;  1SJI A;  4V1A g;  1YVL A;  2C0E A;  2H0H A;  4N11 A;  3RPP A;  1RK4 A;  1ILO A;  1SL2 B;  1BED A;  3ZMK A;  1UA5 A;  4LLR A;  4WEY A;  1M2A A;  1V98 A;  3HCZ A;  4YQM A;  4ZIL A;  2BMX A;  1FVJ A;  1Q98 A;  12GS A;  3VLN A;  4DEJ A;  5JWR B;  2X99 A;  2YNX A;  4IHU A;  3C1S A;  5ECM B;  1ERV A;  2VCT A;  3PPU A;  2A2R A;  4TR1 A;  4IW9 A;  1E2Y A;  2VD0 A;  4OO4 A;  3QCP A;  1OE7 A;  3EC3 A;  1AC1 A;  2XC2 A;  1SL0 B;  3IRA A;  4BVY A;  3FZ9 A;  2CX3 A;  3C8E A;  2IMD A;  2FWH A;  5CO3 A;  4I6X A;  1T7P B;  1M2D A;  3UEM A;  2C80 A;  2NBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...