1YQ1A

Structural genomics of caenorhabditis elegans: glutathione s-transferase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
205
structure length
201
Chain Sequence
MPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSGEVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-Transferase
publication title Structural Genomics of Caenorhabditis Elegans: glutathione S-Transferase
rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 62
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1yq1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yq1A01
2VLTA 3ZL5A 3DMLA 1G0TA 2GDRA 2CVKA 1MTCA 3TJFA 2B1KA 2CQ9A 2VUPA 3ZVJD 4HUAA 1OKTA 3GKXA 1SJIA 3HA9A 2YV9A 3KH7A 5HR3A 1GLPA 2L6DA 1XW6A 1RW1A 2C80A 3BJ5A 2HRAA 2OBKA 3QMXA 4N11A 1X9WB 5D9WA 4MCUA 2B7JA 3HJMA 5J5NA 3GYKA 1EEJA 3ERFA 4WEYA 1KNGA 5IOXA 3APOA 4GSSA 1A2JA 5ID2A 7GSSA 3IA1A 1BEDA 4QL9A 3EINA 4DSSB 4RI6A 1T7PB 4KH7A 1K3LA 4WF4A 4G0KA 2B5YA 5EVOA 1OC9B 1HNAA 3IR4A 2HNLA 1VF3A 4HJ2A 3WGDA 5EPFA 4ZL9A 3FK8A 3H79A 1TK5B 3E9JB 5DDLA 3U5RE 3VPTA 4KCAA 2VM1A 5IMVA 2GQKA 4MPGA 4NAXA 2H71A 1YY7A 3CSIA 2DJ3A 2YJ7A 2DC5A 2ON5A 5B6MA 1PD21 4E8EA 3DGQA 4JR6A 3J7Yk 3VWXA 1TKDB 2B1LA 4PNGA 2K6VA 1LU4A 4GXZA 1A23A 1GLQA 3LORA 3HJOA 5DJMA 4MJBA 3ZFBA 2GQMA 4MJEA 1XOAA 1PN9A 3BCIA 1EP7A 3C1RA 2O85A 1H4OA 4NWYA 3MAKA 5KN0A 1HD2A 4RUVA 1V58A 2LKUA 4KE3A 1TJDA 2ON7A 3KIJA 3ME8A 4KUNA 2C0DA 3GSTA 4DSSA 3OR5A 1PKWA 2E7PA 3BBYA 5LNKe 3O3TA 1B48A 3QAVA 4ZBAA 3UVTA 2H72A 2FLSA 1SJZA 1OC9A 3IE3A 3FHKA 3UAPA 4TR4A 2VCWA 4BVXB 4EE0A 4BWQA 4I97A 3QDNA 3GKMA 1ILOA 1JHBA 2AHEA 1Z7PA 1XWBA 1UN2A 1G7EA 1BX9A 1Z9HA 2HRKB 1USBA 6GSYA 4GF0A 4JU5A 2HRFA 3I43A 3PINA 3FKFA 3AY8A 4L0WA 1DE2A 3BCKA 4F0CA 1Z3EA 1GTUA 4IKHA 3A3TA 3IOSA 3GKKA 1GSEA 4KF9A 3LEFA 2MMZA 1J08A 2N5BA 2FY6A 2B7KA 18GSA 2QSIA 5HFGA 2ZUPA 1A2MA 3KTLA 3F8UA 5F07A 3LFLA 3MSZA 3UVHA 1EGOA 5DCGA 1ZL9A 1M9BA 3C1SA 2H1DA 3DKSA 4EUYA 3TJJA 4KX4A 1DUGA 2NBSA 4K8MA 3F63A 5ECSA 4PUFC 3RHCA 4KSOA 1OVNA 1M2DA 4IGJA 2FWGA 5F06A 2GS3A 1DBYA 5GAND 1JFUA 4IJ3A 2RUEA 2HRKA 1FB0A 2FHEA 1M7TA 2MBTA 2VAFA 2JZTA 5ECOB 1WJKA 2HI7A 1JLVA 4HS1A 3HDCA 1UA5A 2GZPA 2DMMA 2E2MA 1Y6EA 5AGYA 4NV2A 3I6AA 1VGLA 12GSA 4O5RA 4YQVA 3EURA 3D4TA 2WCIA 3TKSE 3IK7A 1K0CA 20GSA 4Q5FA 1CQHA 2QC7A 3WGXA 1XFLA 5IMDA 3APSA 3CXGA 2NTOA 4AJ6A 3A5WA 4I6XA 2XPEA 3FZ5A 2X8GA 3L9SA 4QL7A 2REMA 2YWOA 3WT2A 3HYPA 3UJ1A 1T1VA 1XOBA 1ACVA 2O7KA 3IAM2 3NIVA 4JBBA 3R2QA 3CMIA 1K0OA 2YZHA 1GTAA 1XWGA 4FYUA 1EOHA 5DALA 5F05A 3DIEA 4HJMA 4POLA 1ZCPA 1OC3A 4Q5RA 1O85A 5JWQB 1OE8A 2DSAA 2CAQA 1XPVA 3FZ4A 3CYNA 1FVKA 4JZQA 4K9ZA 3VWVA 4ECCA 5HQPA 3S9FA 3KXOA 2F51A 4JRRA 4MLYA 5CAXA 5A4WA 2H75A 4N30A 3QR6A 1M9AA 5KN1A 3F4SA 5AIXA 1T4ZA 2K8SA 3F3QA 1T8EB 2LRTA 6GSWA 4GRFA 4HDEA 1U6TA 5F8BA 1SJ6A 4XTSA 4OCEA 2GSRA 1KBNA 3ZMKA 2HQTA 4F9ZA 2I4AA 4N0ZA 2KP1A 3PR8A 2YZUA 4IBPA 1TK8B 2C3TA 1Z7RA 3LXZA 3HY2A 5D9VA 1Z6NA 4CDOA 2H73A 4PNFA 1EWXA 1QXHA 2WZ9A 1T3BA 2TRXA 5DAKA 3IV4A 4L0UA 4WETA 4GTUA 1MDKA 5GZZB 2GZYA 1ERVA 4O7HA 4PQIA 2VLVA 5HFKA 1VRSD 1O7UA 3UL3A 6GSTA 3TCOA 4GQFA 5INYA 3K8NA 2HLSA 3TRQA 5D8IA 1PSQA 3VURA 2PVQA 4F2IA 1NHYA 4POBA 1EOGA 4K2DA 4GQCA 4L5LA 2H66A 3G9BA 1WRYA 1ERWA 1VF4A 3GKNA 2IN3A 4G10A 3C7MA 14GSA 1QK8A 1X5CA 2TIRA 4TRXA 5ELAA 2VCXA 4USSA 2HYXA 5G30A 4L8EA 3LQ7A 2N5AA 2E0QA 5JCWA 5HFIA 5JCUA 2IMFA 3BOAA 3ZIVA 2DJJA 2YN1A 2AYTA 1SL0B 3GNJA 4LMWA 4MF6A 3EU3A 3WYWA 2B3SA 4V1Ag 5IM9A 1GL8A 2X99A 4YH2A 5G5FA 4TXVA 2L4CA 5FHIA 2CZ2A 5D96A 1JZRA 2LQOA 2A2RA 2M80A 4IS0A 2V6OA 3M8NA 3NZNA 4OO5A 1QUWA 4ML1A 3D22A 2K9FA 3P2AA 3TRPA 5IO0A 1UVZA 1O81A 2WFCA 4FYBA 5CRHA 1S3CA 2HZFA 3TKPA 1DSBA 3GUSA 1T4YA 1TOFA 5IPGA 4WBRD 3D0ZA 5ENUA 1R4WA 4XRDA 10GSA 1G7OA 5CO3A 17GSA 3UARA 2H76A 4HU7A 3TKQA 1AQXA 4FO5A 1ST9A 1EZKA 1OE7A 1K3OA 4F82A 1XZOA 2JSYA 2DBCA 4XS1A 2LQQA 2V32A 1XWKA 1OAZA 2YP6A 2K8VA 2C3NA 3DEXA 1GSYA 4MP4A 1TP9A 3ZYWA 4G19A 1PL2A 5CP1A 4KDXA 3A2XA 2H70A 1B4QA 1JZDA 4MMMA 1AQVA 3FR9A 1SD8A 2JADA 4AJ8A 3FR3A 4EVMA 4K6XA 1GSFA 5E4WA 3PH9A 3ZFLA 1Z6MA 4XRAA 1FW1A 4MABA 1K0BA 3IXRA 4ZB9A 22GSA 4OO4A 4HU9A 2P31A 4EDYA 3FEUA 4HI7A 1U3AA 1MEKA 3IC4A 1N2AA 2LUSA 1GRXA 3M3MA 2YPMA 2FUG2 1NSWA 4MH3A 4V1Ap 4EXJA 5CYYA 4G9HA 3HVXA 4BVYB 5DVBA 3TOTA 5IIZA 2BMXA 3WGEA 1FHEA 2Z9SA 3GH9A 5AIVA 5J9BA 5ECKB 3FW2A 2KLXA 5FWGA 2CX4A 4WR5A 2V2GA 1JLWA 2H1GA 2DIZA 5B6NA 1B9YC 1GSUA 1SYRA 5IPHA 6GSUA 2CA8A 3P8WA 3Q18A 3KMOA 4OFMA 4JEDA 2VM2A 1V2AA 4MPFA 3V1WA 4KSMA 2FNOA 3QAWA 4POKA 1M99A 1XVQA 5D73A 3F4TA 3HKRA 1V9WA 1GUHA 3KTBA 5ECHB 2M46A 2O89A 3CSJA 1W89A 6GSXA 2MZCA 3EMXA 1TTZA 1R7HA 2H74A 1GSQA 1JZWA 2X8HA 2GTUA 2G0FA 1E6BA 1FVJA 3EWLA 4XS6A 4TR0A 1G6YA 2VO4A 5IMFA 4BVYA 2BJXA 2EIQA 4LL4B 4X0XA 3KM6A 4ZXGA 1HYUA 3I9V2 3NOFA 4WXTA 5F0GA 2JZSA 2NDOA 4ULXA 1UC7A 2BTOT 1H75A 3APQA 4IP1A 4MZWA 1SK0A 1XCCA 2WULA 3FYGA 4NMUA 4PQ1A 4V2LA 1OYJA 2K18A 5GSSA 5ELGA 2OJLA 1R26A 2LTKA 2YCDA 3W6GA 4KDYA 2OA7A 3HJPA 4EL1A 1WOUA 1YJ6A 2FWHA 1WE0A 3C71A 3H1NA 1AC1A 4JE1A 1EV9A 4RQXA 4AGSA 5A4VA 1LJRA 5KEJA 3VWUA 2RLIA 1A0RP 5DQSA 4XIHA 1AXDA 3TUEA 2XBIA 1EV4A 13GSA 4K7NA 3UEMA 1PRXA 4MZBA 3GL3A 3MWHA 2C1YA 3EE2A 4ECBA 5DALB 2DJKA 1TRWA 1YKAA 3HXSA 3CTGA 4F0BA 5A4UA 2HT9A 1SK2A 3FR6A 1GUMA 4WBJA 2C4JA 3M0FA 3ZLPA 1WIKA 5J9CA 2FA8A 1KTEA 3CTFA 3E3EA 3D5JA 3TKSC 3TB2A 5HR0A 1ERUA 2FGXA 4Q5NA 2EIRA 4G0LA 3GIXA 3RDWA 5AN1A 4EC0A 2LJAA 3KCMA 4X1UA 4QQ7A 2A4VA 3PPUA 4I8BA 3UIWA 2GZZA 2R5GA 5ECRB 1S3AA 2ZCTA 3TGZA 2CV4A 2H6XA 2X64A 1K0MA 3ZREA 3HZ4A 2LJKA 4PURA 2OE3A 1XXUA 1XVWA 3O6TA 4ZB6A 3L0HA 2KHPA 4I2UA 2WDUA 2IMIA 2QGVA 2F3MA 3QFBC 1GTIA 5DAKB 4LA1A 1YEXA 2HSMB 1THOA 3P90A 1IYIA 1HNBA 2I3YA 1GULA 4KW6A 1GNWA 2FD3A 4EF0A 4ID0A 1GTBA 2NVLA 2N5FA 3D21A 1XBSA 2L5OA 1BQ7A 4EDZA 3ZTLA 1TRUA 1MDJA 1GH2A 4AJ7A 5B8AA 3GRXA 2VCQA 6GSSA 1O73A 2YOIA 4ZIJA 3DRNA 3MNGA 2LV3A 3H93A 1X5DA 2F9SA 2PUKC 1V98A 3WD6A 1M0UA 2MBSA 4MJAA 2B5EA 3KMNA 4MDCA 4I5QA 3U6VA 2PMTA 2UZ8A 4IP6A 5CRDA 3VK9A 5ECIB 5A5KA 4DSRA 2WJUA 2PVOC 3N9JA 1THXA 4ILFA 2LJRA 1PMTA 4ZILA 1XW5A 1K3YA 4NHZA 2LSTA 2VL2A 2R37A 4PUAA 5E59A 3RAZA 4KDUA 2RM5A 4ISDA 2VL9A 2ES7A 1XIYA 2L59A 5ECPB 19GSA 3QAGA 2HSMA 1PL1A 2L57A 3QOUA 3O76A 2IJYA 4IQ1A 3DVXA 4GWRA 4G0IA 3UMAA 2EIOA 1TK0B 1V57A 1YF1A 4KB3A 1XWAA 2PGTA 3GSSA 3DXBA 3E0UA 4TN8A 2H30A 2H19A 3CRTA 2JACA 3GX8A 3A2VA 3QFAC 4WR4A 3KEBA 2KOKA 3GX0A 4GLTA 2RM6A 2HZEB 4MA9A 2LRNA 4XHMA 2FWFA 2WB9A 2YV7A 4MH2A 4XS4B 2V1MA 4TR3A 4YQUA 5G1LA 3L9UA 4HOJA 4MF5A 2IFQB 4NPBA 2P0GA 4KAEA 4YAPA 1SL2B 2C0GA 3PGTA 5BMUA 3M9JA 3KH9A 4IQAA 2GSTA 4AF2A 1X9SB 5DBQA 3RBTA 2OKAA 2CAIA 2PU9C 4J2FA 5GSTA 1F9MA 3P7XA 1A24A 5DJLA 2VOCA 3GL5A 5G2ZA 3L4NA 2PERA 4K7IA 4ZB8A 2O8VB 2HE3A 3F9UA 5ECNB 3IAS2 3GFKA 2L6CA 3M9KA 4MF7A 1WPIA 2C3QA 6GSVA 4TXOB 3GH6A 1W4VA 3ERGA 5IO2A 2C0EA 5EY6A 4RQRA 1OC8A 5CREA 2LEGA 1S3DA 4KNDA 2CX3A 4KA0A 3DWVA 5HR1A 2IPAA 1ZYQB 2L4QA 2YWIA 3H4KA 1QMVA 1AW9A 4LLRA 1T00A 2GVPA 3TKRA 4O32A 3GTUA 2IWTA 3F6FA 4LL1B 2HZEA 3TKSA 1B9XC 1YDKA 4D73A 3QD9A 3I69A 2VCZA 3DVWA 1TI3A 4XS4A 2ZNMA 5ECLB 1EP8A 4DEJA 4EO3A 1KEBA 2VD1A 1X5EA 3BD2A 3QPMA 2HXKA 2IFQA 3H8QA 1ZMAA 1GSDA 2XBQA 4HZ4A 3J7Yb 3ME7A 1O8XA 1WWJA 1ZGNA 4OFNA 3GV1A 1MD3A 1GP1A 3VI5A 2YNXA 4YAVA 1F37A 3KP8A 1M2BA 3WT1A 5D93A 4EKZA 4Z7XA 1J9BA 2KUCA 2J23A 1PKZA 2CVBA 4IVFA 2RIIA 4TXOA 1SKWB 4BA7A 3ZIJA 4ZBBA 2CZ3A 3DYRA 2FA4A 1AUCA 4PXOA 4ECIA 2H0IA 1E2YA 9GSSA 4NXIA 1YKCA 5D9TA 1SKSB 3JCML 1TU8A 4NHWA 1QQ2A 1YF0A 1FB6A 2F8FA 4MJCA 4H86A 2E2GA 3VFIA 4J56E 5IMAA 2I9HA 2LS5A 1GWCA 4YQMA 3ZITA 1XW9A 1SENA 4FYCA 4HQZA 2GQLA 1C72A 3F6DA 4F03A 1VF2A 1TXXA 1F3BA 1NW2A 1M2AA 5IOWA 2YWNA 2EC4A 1EEMA 1O6JA 4OWYA 4ML6A 4L5OA 1SYXA 1TRSA 2IMDA 4CW9A 4GSTA 4TR1B 3N5OA 2VL2C 3SBCA 2DMLA 2AAWA 3HCZA 3HVSA 1N8JA 2ALBA 4BPYA 1DE1A 5ABRA 2OE0A 1SKRB 4DVCA 1MD4A 2TRCP 1ABAA 3ZRDA 1SL1B 3LJRA 3LGCA 1FOVA 3IDVA 2M72A 1Q4JA 2OADA 5LCZA 2GGTA 5H5RA 4ACSA 2OE1A 2VL3A 4ECJA 1FO5A 5B8BA 4FQUA 3ED3A 1J0FA 1B8XA 2CVDA 5J3RA 1HQOA 3IHQA 4IELA 2H1AA 2G2QA 3GA4A 4IW9A 3CSHA 4K7OA 3W8JA 4TKYA 5COHA 4HZ2A 2GT6A 5FT3A 16GSA 2A2SA 1SK1A 1FG4A 1BYEA 4CHSA 2YANA 2HFDA 2HSHA 1F6MC 4HEA2 4IHUA 1IYHA 1I5GA 3TJGA 2C8UA 3EU4A 2IMEA 1Q98A 5J4UA 2J9HA 4K1FA 4MK3A 4TR1A 1R5AA 2VLUA 5C04A 2MMNA 2HRNA 3LSZA 2MYGA 2DJ1A 2JL4A 5CNWA 4E8HA 4WF5A 1ZZYA 3FY7A 4ZL7A 1ZOFA 2P5RA 1B4PA 4K0NA 3ZVJA 3KP9A 2PWJA 1K0AA 3IK9A 1V40A 1FAAA 3EC3A 5AISA 3A2WA 1CQGA 3CBUA 5D9XA 2L5LA 1XWCA 4FH8A 3W8SA 1GUKA 2X8CA 3TOUA 3IPZA 1PGTA 3F4RA 4GSNA 4N10A 4BVXA 1R5PA 3G7JA 1RQMA 3US3A 1Z5YE 2R2JA 2LNSA 1X9MB 1SU9A 3Q6OA 3GURA 4ZBDA 2H0GA 2O87A 3LWAA 2PBJA 3GN3A 5G1KA 4MZCA 1OKDA 2XC2A 1BJXA 3FRCA 3HD5A 2B5XA 3SWLA 4NV5A 3HHVA 3RHBA 2MMAA 1MDIA 3TDGA 2XPDA 2H1BA 4KGIA 1TI1A 1TW9A 5CRGA 1LBKA 2YWMA 4P3YB 5IMCA 1GSSA 2I1UA 2GLRA 2IMKA 2I81A 2VIMA 1F3AA 3UBKA 1TDIA 8GSSA 3C8EA 3ISOA 1RK4A 1U3IA 5C00A 2RUFA 1QFNA 1BG5A 3RPNA 4ZL8A 3VWWA 1NM3A 1F2EA 5EL8A 2V41A 3FZ9A 1WP0A 4J57E 2R6KA 3KJYA 1YQ1A 3LG6A 1O8WA 5IMZA 4GCIA 3EVIA 5DCHA 1A8YA 2V6KA 4IN0A 5GAPD 4OD7A 4OFTA 2H6YA 3D6IA 3G7YA 1A0FA 3D4MA 4PTSA 3IC8A 2H0HA 4I2TA 3KZQA 2OACA 5G31A 5KN3A 4N0VA 1AIUA 1AAZA 4V2NA 3M1GA 1GNEA 4OCFA 5B7CA 5G5EA 5IQYA 3HVVA 3L9VA 3GMFA 3IRAA 2DLXA 4G2EA 3LXTA 3G7IA 1WMJA 4V2MA 3ZZXA 2HSYA 2CT6A 3UOMA 4LMVA 4POMA 4PQHA 3Q19A 5JWOB 1TRVA 3LYKA 2OBIA 2H8LA 1AQWA 1JZOA 2WGRA 3L78A 1QGVA 4DSQA 1ON4A 3VLNA 1HNCA 2XHFA 5ECMB 1PA3A 4TVEA 3FZAA 3F3RA 2KP2A 4BL7B 4JR4A 1ZYEA 2JZRA 1K0NA 2H6ZA 1PX6A 11GSA 1A8LA 4WKWA 1SD9A 2H01A 5J41A 2HSNB 4PX1A 3GTUB 2AJQB 2LRCA 1PQNA 4TOPA 3EMPA 5JWRB 3UBLA 1U88A 4D73B 2C0FA 2NPBA 5H5SA 1G6WA 3DD3A 4Q5QA 1YEPA 5DQYA 4PGTA 5L71A 2JU5A 1K0DA 1I9DA 2WS2A 5H5QA 1U87A 4XCSA 3VPQA 5LD0A 2DJ0A 5KN2A 4KCEA 2FWEA 4OMVA 2R3XA 2DJ2A 4FIWA 2F8AA 2IIYA 3TJBA 3LYPA 4RI7A 3KD0A 3ERWA 3RPPA 4X43A 3EYTA 5CRWA 2WRTA 3VI7A 2AUVA 1ML6A 1BAYA 2VCTA 1A2LA 3MDKA 1EGRA 2GSQA 3ZMLA 2D2ZA 1TU7A 1NHOA 4TW5A 2AV4A 3TJKA 5ID2B 3IBHA 2JSZA 2AB6A 3QCPA 1URMA 1VF1A 3F0IA 5ECQB 3GHAA 2IL3A 3R3EA 2MMOA 4BWSA 4BL7A 3C73A 3KGKA 2VD0A 2FCHA 2PN8A 1Y25A 2P5QA 4IJIA 2VCVA 5JCGA 1PX7A 3HZ8A 1ERTA 2GSSA 1YZXA 4K0GA 4O92A 4HQSA 3CRUA 3Q74A 1X0RA 2R4VA 2PPTA 5HR2A 2GT5A 2DIYA 2LNTA 3TRXA 2YJHA 2B6MA 2QKEA
chains in the Genus database with same CATH superfamily
2VLTA 3ZL5A 4BIKA 3DMLA 1G0TA 2GDRA 2CVKA 2EFCA 1MTCA 3TJFA 2B1KA 2CQ9A 2VUPA 3ZVJD 4HUAA 1OKTA 4K5SA 3GKXA 1SJIA 3HA9A 2YV9A 3KH7A 5HR3A 1GLPA 2L6DA 1XW6A 1RW1A 2C80A 3BJ5A 2HRAA 2OBKA 3QMXA 1PFOA 4N11A 1X9WB 5D9WA 4MCUA 2B7JA 3HJMA 5J5NA 3GYKA 1EEJA 3ERFA 4WEYA 1KNGA 5IOXA 3APOA 4GSSA 1A2JA 5ID2A 7GSSA 3IA1A 1BEDA 4QL9A 3EINA 4DSSB 4RI6A 1T7PB 4KH7A 1K3LA 4WF4A 4G0KA 2B5YA 1Y1UA 5EVOA 1OC9B 1HNAA 3IR4A 2HNLA 1VF3A 4HJ2A 3WGDA 5EPFA 4ZL9A 4GDFA 3FK8A 3H79A 1TK5B 3E9JB 5DDLA 3U5RE 3VPTA 4KCAA 2VM1A 5IMVA 2GQKA 4MPGA 4NAXA 2H71A 1YY7A 3CSIA 2DJ3A 4Z2UA 2YJ7A 2DC5A 2ON5A 5B6MA 1PD21 4N3ZA 4E8EA 3DGQA 4JR6A 3J7Yk 3VWXA 1TKDB 2B1LA 4PNGA 2K6VA 1LU4A 4GXZA 1A23A 1GLQA 3LORA 3HJOA 5DJMA 4MJBA 3ZFBA 2GQMA 4MJEA 1XOAA 1PN9A 3BCIA 1EP7A 3C1RA 2O85A 1H4OA 4NWYA 3MAKA 5KN0A 1HD2A 4RUVA 1V58A 2LKUA 4KE3A 1TJDA 2ON7A 3KIJA 3ME8A 4KUNA 2C0DA 1N25A 3GSTA 4ZB7A 4DSSA 3OR5A 1PKWA 2E7PA 3BBYA 5LNKe 3O3TA 1B48A 3QAVA 4ZBAA 3UVTA 2H72A 2FLSA 1SVOA 1SJZA 1OC9A 2X4AA 3IE3A 3FHKA 3UAPA 4TR4A 2VCWA 4BVXB 4EE0A 4BWQA 4I97A 1SVMA 1XG8A 3QDNA 3GKMA 1ILOA 1JHBA 2AHEA 1Z7PA 1XWBA 1UN2A 1G7EA 1BX9A 3HVNA 1Z9HA 2HRKB 1USBA 6GSYA 4GF0A 4JU5A 2HRFA 2A2PA 3I43A 3EPTA 3FKFA 3AY8A 3PINA 4L0WA 3BCKA 4F0CA 1DE2A 1Z3EA 1GTUA 4IKHA 3A3TA 3IOSA 3GKKA 1GSEA 4KF9A 3LEFA 1M3JA 2MMZA 1J08A 2N5BA 1YEWC 2FY6A 2B7KA 18GSA 2QSIA 4AKGA 5HFGA 2ZUPA 1A2MA 3KTLA 3F8UA 5F07A 3LFLA 3MSZA 3UVHA 1EGOA 5DCGA 1ZL9A 1M9BA 3C1SA 2H1DA 3DKSA 4EUYA 3TJJA 4KX4A 2R0PA 3FMWA 1DUGA 2NBSA 4K8MA 3F63A 5ECSA 4PUFC 3RHCA 4KSOA 1OVNA 1M2DA 4IGJA 2FWGA 5F06A 2GS3A 1DBYA 5GAND 1JFUA 4IJ3A 2RUEA 2HRKA 2WVYA 1FB0A 2FHEA 1M7TA 2MBTA 2VAFA 2JZTA 5ECOB 1WJKA 2HI7A 1JLVA 4HS1A 3HDCA 1UA5A 2GZPA 2DMMA 2E2MA 1Y6EA 5AGYA 4NV2A 3I6AA 1VGLA 12GSA 4O5RA 4YQVA 3EURA 4MNNA 3D4TA 2WCIA 3TKSE 3IK7A 1K0CA 20GSA 4Q5FA 1CQHA 2QC7A 3WGXA 1XFLA 5IMDA 2VKZG 3APSA 3CXGA 2NTOA 4AJ6A 3A5WA 4I6XA 2XPEA 3FZ5A 2X8GA 2WW1A 3L9SA 4QL7A 2REMA 2YWOA 3WT2A 3HYPA 3UJ1A 1T1VA 1XOBA 1ACVA 2O7KA 3IAM2 3NIVA 4JBBA 3R2QA 3CMIA 1K0OA 2YZHA 1GTAA 1XWGA 1EOHA 5F05A 5DALA 3DIEA 4FYUA 4HJMA 2O5VA 4POLA 1ZCPA 1OC3A 4Q5RA 1O85A 5JWQB 1OE8A 2DSAA 2CAQA 1XPVA 3FZ4A 3CYNA 1FVKA 4JZQA 4K9ZA 4ICYA 3VWVA 4ECCA 5HQPA 3S9FA 3KXOA 1YVLA 2F51A 4JRRA 4MLYA 5CAXA 5A4WA 2H75A 4N30A 3QR6A 1M9AA 5KN1A 3F4SA 5AIXA 1T4ZA 2K8SA 3F3QA 1T8EB 2LRTA 4HSCX 6GSWA 4GRFA 4HDEA 1U6TA 5F8BA 1SJ6A 4XTSA 4OCEA 2GSRA 1KBNA 3ZMKA 2HQTA 4F9ZA 2I4AA 4E68A 4N0ZA 2KP1A 4CY6A 3PR8A 2YZUA 4IBPA 1TK8B 2C3TA 1Z7RA 3LXZA 2QA2A 3HY2A 5D9VA 1Z6NA 4CDOA 2H73A 4PNFA 4O5UA 1EWXA 1QXHA 2WZ9A 1T3BA 2TRXA 5DAKA 3IV4A 4L0UA 4WETA 4GTUA 1MDKA 5GZZB 2GZYA 1ERVA 4O7HA 4PQIA 2VLVA 2WW2A 5HFKA 1VRSD 1O7UA 3UL3A 6GSTA 3TCOA 4G01A 4GQFA 5INYA 3K8NA 2HLSA 3TRQA 5D8IA 1PSQA 3VURA 2PVQA 2EFDA 4F2IA 1NHYA 4POBA 1EOGA 4K2DA 4GQCA 4L5LA 2H66A 3G9BA 1WRYA 1ERWA 1VF4A 3GKNA 2IN3A 4G10A 3C7MA 14GSA 1QK8A 1X5CA 2TIRA 3LW9A 4TRXA 5ELAA 2VCXA 3CWGA 4USSA 2HYXA 5G30A 4L8EA 3LQ7A 2N5AA 2E0QA 5JCWA 5HFIA 5JCUA 2IMFA 3BOAA 3ZIVA 2DJJA 2YN1A 2AYTA 1SL0B 3GNJA 4LMWA 4MF6A 1FOHA 3EU3A 3WYWA 2B3SA 4V1Ag 2DKIA 5IM9A 1GL8A 2X99A 4YH2A 5G5FA 4TXVA 2L4CA 5FHIA 2CZ2A 5D96A 1JZRA 2LQOA 2A2RA 2M80A 4IS0A 2V6OA 3M8NA 3NZNA 4OO5A 1QUWA 4ML1A 5KOWA 3D22A 2K9FA 3P2AA 3TRPA 5IO0A 1UVZA 1O81A 2WFCA 4FYBA 5J4VA 5CRHA 1S3CA 4PI2C 2HZFA 3TKPA 1DSBA 3GUSA 1T4YA 1TOFA 5IPGA 4WBRD 3D0ZA 5ENUA 1R4WA 4XRDA 10GSA 1G7OA 5CO3A 17GSA 3UARA 2H76A 4HU7A 3TKQA 1AQXA 4FO5A 1ST9A 1EZKA 1OE7A 1K3OA 4F82A 1XZOA 2JSYA 2DBCA 4XS1A 2LQQA 2V32A 1XWKA 1OAZA 2YP6A 2K8VA 2C3NA 3DEXA 1GSYA 4MP4A 1TP9A 3ZYWA 4G19A 3MIXA 1PL2A 5CP1A 4KDXA 3A2XA 2H70A 1B4QA 1JZDA 4MMMA 1AQVA 3FR9A 1SD8A 2JADA 4AJ8A 3FR3A 4EVMA 4K6XA 1GSFA 5E4WA 3PH9A 3ZFLA 1Z6MA 4XRAA 1FW1A 4MABA 1K0BA 3IXRA 4ZB9A 22GSA 1PN0A 4OO4A 4HU9A 2P31A 4EDYA 3FEUA 4HI7A 1U3AA 1MEKA 3IC4A 1N2AA 2LUSA 1GRXA 3M3MA 2YPMA 2FUG2 1NSWA 3MYDA 4MH3A 4V1Ap 4EXJA 4AKHA 5CYYA 4G9HA 3HVXA 4BVYB 5DVBA 3TOTA 5IIZA 2BMXA 3WGEA 1FHEA 2Z9SA 3GH9A 2X49A 5AIVA 5J9BA 5ECKB 3FW2A 2KLXA 5FWGA 2CX4A 4WR5A 2V2GA 3TU3B 1JLWA 2H1GA 2DIZA 5B6NA 1B9YC 5A5HA 1GSUA 1SYRA 5IPHA 6GSUA 2CA8A 3P8WA 3Q18A 4CY8A 3KMOA 4OFMA 4JEDA 2VM2A 1V2AA 4MPFA 3V1WA 4KSMA 2FNOA 3QAWA 4POKA 1M99A 1XVQA 5D73A 4Z2RA 3F4TA 3HKRA 1V9WA 1GUHA 3KTBA 5ECHB 2M46A 2O89A 3CSJA 1W89A 6GSXA 2MZCA 2O3EA 3EMXA 1TTZA 1R7HA 2H74A 1GSQA 1JZWA 2WW0A 2X8HA 2GTUA 2G0FA 1E6BA 1FVJA 3EWLA 4XS6A 4TR0A 1G6YA 2VO4A 5IMFA 4BVYA 2BJXA 2EIQA 4LL4B 4X0XA 3KM6A 4ZXGA 1HYUA 3I9V2 3NOFA 4WXTA 5F0GA 2JZSA 2NDOA 4ULXA 1UC7A 2BTOT 1H75A 3APQA 4IP1A 4MZWA 1SK0A 1XCCA 2WULA 3FYGA 3RGBC 4NMUA 4PQ1A 4V2LA 1OYJA 2K18A 5GSSA 5ELGA 2OJLA 1R26A 2LTKA 2YCDA 3W6GA 4KDYA 2OA7A 3HJPA 4EL1A 5A34B 1WOUA 4YKGA 1YJ6A 2FWHA 1WE0A 3C71A 3H1NA 1AC1A 4JE1A 1EV9A 4RQXA 4AGSA 5A4VA 1LJRA 3CHXC 5KEJA 3VWUA 2RLIA 1A0RP 5DQSA 4XIHA 1AXDA 3TUEA 2XBIA 1EV4A 13GSA 4K7NA 3UEMA 1PRXA 4MZBA 3GL3A 3MWHA 2C1YA 3EE2A 4ECBA 2DKHA 5DALB 2DJKA 2O36A 1TRWA 1YKAA 3HXSA 3CTGA 4F0BA 5A4UA 2HT9A 1SK2A 4O5QA 3FR6A 1GUMA 4WBJA 2C4JA 3M0FA 3ZLPA 1WIKA 5J9CA 2FA8A 4AKIA 1KTEA 3CTFA 3E3EA 3D5JA 3TKSC 3TB2A 5HR0A 1ERUA 2FGXA 4Q5NA 2EIRA 4G0LA 3GIXA 3RDWA 5AN1A 4EC0A 2LJAA 3KCMA 4X1UA 4QQ7A 2A4VA 3PPUA 4I8BA 3UIWA 2GZZA 2R5GA 5ECRB 1S3AA 2ZCTA 3TGZA 2CV4A 2H6XA 2R0GA 2X64A 1K0MA 3ZREA 3HZ4A 1ZYPA 2LJKA 4PURA 5A34A 2OE3A 1XXUA 1XVWA 3O6TA 4ZB6A 4FXYP 3L0HA 2KHPA 4I2UA 2WDUA 2IMIA 2QGVA 2F3MA 3QFBC 1GTIA 5DAKB 4LA1A 1YEXA 2HSMB 4PI0C 1THOA 3P90A 1IYIA 1HNBA 2I3YA 1GULA 4KW6A 1S4BP 1GNWA 2FD3A 4EF0A 4ID0A 1GTBA 2NVLA 2N5FA 3D21A 1XBSA 2L5OA 1BQ7A 4EDZA 3ZTLA 1TRUA 4K5RA 1MDJA 1GH2A 4AJ7A 5B8AA 3GRXA 2VCQA 6GSSA 1O73A 2YOIA 4ZIJA 3DRNA 3MNGA 2LV3A 3H93A 1X5DA 2F9SA 2PUKC 1V98A 3WD6A 1M0UA 2MBSA 4MJAA 2B5EA 3KMNA 4MDCA 4I5QA 3U6VA 2PMTA 2UZ8A 4IP6A 5CRDA 3VK9A 4A5PA 5ECIB 5A5KA 4DSRA 2WJUA 2PVOC 3N9JA 1THXA 4ILFA 2LJRA 1PMTA 4ZILA 1XW5A 1K3YA 4NHZA 2LSTA 4W66A 2VL2A 2R37A 4PUAA 5E59A 3RAZA 4KDUA 2RM5A 4ISDA 2VL9A 2EFEA 2ES7A 1XIYA 2L59A 5ECPB 2WZSA 19GSA 3QAGA 2HSMA 1PL1A 2L57A 3QOUA 3O76A 2IJYA 4IQ1A 3DVXA 4GWRA 4X4JA 4G0IA 3UMAA 2EIOA 1TK0B 1V57A 1YF1A 4KB3A 1XWAA 2PGTA 5KOXA 3GSSA 1ZYNA 3DXBA 3E0UA 4TN8A 2H30A 2H19A 3CRTA 2JACA 4Z2TA 2R0CA 3GX8A 3RFRC 3A2VA 3QFAC 4WR4A 3KEBA 2KOKA 3GX0A 4GLTA 2RM6A 2HZEB 2WVZA 4MA9A 2LRNA 4XHMA 2FWFA 2WB9A 2YV7A 2UV8G 4MH2A 4XS4B 2V1MA 4TR3A 4YQUA 5G1LA 3L9UA 4HOJA 4MF5A 2IFQB 4NPBA 2P0GA 4KAEA 4YAPA 1SL2B 2C0GA 3PGTA 5BMUA 3M9JA 3KH9A 4IQAA 2GSTA 4AF2A 1X9SB 5DBQA 3RBTA 2OKAA 2CAIA 2PU9C 4J2FA 5GSTA 1F9MA 3P7XA 1A24A 5DJLA 2VOCA 3GL5A 5G2ZA 3L4NA 2PERA 4K7IA 4ZB8A 2O8VB 2HE3A 3F9UA 5ECNB 3IAS2 3GFKA 2L6CA 3M9KA 5J40A 4MF7A 1WPIA 2C3QA 6GSVA 4TXOB 3GH6A 1W4VA 3ERGA 5IO2A 2C0EA 5EY6A 4RQRA 1OC8A 5CREA 2LEGA 1S3DA 4EIQA 4KNDA 2CX3A 4KA0A 3DWVA 5HR1A 3CQFA 2IPAA 1ZYQB 2L4QA 2YWIA 3H4KA 2OT3A 1QMVA 1AW9A 4LLRA 1T00A 2GVPA 3TKRA 4O32A 2HSNA 3GTUA 2IWTA 3F6FA 4LL1B 2HZEA 3TKSA 1B9XC 1YDKA 4D73A 3QD9A 3I69A 2VCZA 3DVWA 1TI3A 4XS4A 2ZNMA 5ECLB 1EP8A 4DEJA 4EO3A 1KEBA 2VD1A 1X5EA 3BD2A 3QPMA 2HXKA 2IFQA 3H8QA 1ZMAA 1GSDA 2XBQA 4HZ4A 5A5HB 3J7Yb 3ME7A 1O8XA 1WWJA 1ZGNA 3IHGA 4OFNA 3GV1A 1MD3A 1GP1A 3VI5A 2YNXA 4YAVA 1F37A 3KP8A 1M2BA 3WT1A 5D93A 4EKZA 4Z7XA 1J9BA 2KUCA 2J23A 1PKZA 2CVBA 4IVFA 2RIIA 4TXOA 1SKWB 4BA7A 3ZIJA 4ZBBA 2CZ3A 3DYRA 2FA4A 1AUCA 4PXOA 4ECIA 2H0IA 1E2YA 9GSSA 2WW3A 4NXIA 1YKCA 5D9TA 1SKSB 3JCML 1TU8A 4NHWA 1QQ2A 4PHZC 1YF0A 1FB6A 2F8FA 4MJCA 4H86A 2E2GA 4EIPA 3VFIA 4J56E 5J4YA 5IMAA 2I9HA 2LS5A 1GWCA 4YQMA 3ZITA 1XW9A 1SENA 5J47A 4FYCA 4HQZA 2GQLA 1C72A 2H1LA 3F6DA 4F03A 1VF2A 1TXXA 1F3BA 2EFHA 1NW2A 1M2AA 5IOWA 2YWNA 2EC4A 1EEMA 1O6JA 4OWYA 4ML6A 4L5OA 1SYXA 4K2XA 1TRSA 2IMDA 4CW9A 4GSTA 4TR1B 3N5OA 2VL2C 3SBCA 2DMLA 2A4HA 2AAWA 3HCZA 3HVSA 1N8JA 2ALBA 4BPYA 1DE1A 5ABRA 2OE0A 1SKRB 4DVCA 1MD4A 2WVXB 2TRCP 1ABAA 3ZRDA 1SL1B 3LJRA 3LGCA 1FOVA 3IDVA 2M72A 1Q4JA 2OADA 5LCZA 2GGTA 5H5RA 4ACSA 2OE1A 2VL3A 4ECJA 1FO5A 4YKFA 5B8BA 4FQUA 3ED3A 1J0FA 1B8XA 2CVDA 5J3RA 1HQOA 3IHQA 4IELA 2H1AA 2G2QA 3GA4A 4IW9A 3CSHA 4K7OA 3W8JA 4TKYA 5COHA 4HZ2A 2GT6A 5FT3A 16GSA 2A2SA 1SK1A 1FG4A 1BYEA 4CHSA 2YANA 2HFDA 2HSHA 1F6MC 4HEA2 4IHUA 1IYHA 1I5GA 3TJGA 2C8UA 3EU4A 2IMEA 1Q98A 5J4UA 2J9HA 4K1FA 4MK3A 4TR1A 1R5AA 2VLUA 5C04A 2MMNA 2HRNA 3LSZA 2MYGA 2DJ1A 2JL4A 5CNWA 4E8HA 1SVLA 4WF5A 1ZZYA 3FY7A 4ZL7A 1ZOFA 2P5RA 1B4PA 4K0NA 3ZVJA 5A1NB 3KP9A 4AI6A 2WVXA 2PWJA 1K0AA 3IK9A 1V40A 1FAAA 3EC3A 5AISA 3A2WA 1CQGA 3CBUA 5D9XA 2L5LA 1XWCA 4FH8A 3W8SA 1GUKA 2X8CA 3TOUA 3IPZA 1PGTA 3F4RA 4GSNA 4N10A 4BVXA 1R5PA 3G7JA 1RQMA 3US3A 1Z5YE 2R2JA 2LNSA 1X9MB 1SU9A 3Q6OA 3GURA 4ZBDA 2H0GA 2O87A 3LWAA 2PBJA 3GN3A 5G1KA 4MZCA 1OKDA 2XC2A 1BJXA 3FRCA 3HD5A 2B5XA 3SWLA 4NV5A 3HHVA 3RHBA 2MMAA 1MDIA 3TDGA 2XPDA 2H1BA 4KGIA 1TI1A 1TW9A 5CRGA 1LBKA 2YWMA 4P3YB 5IMCA 1GSSA 2I1UA 2GLRA 2IMKA 2I81A 2VIMA 1F3AA 3UBKA 1TDIA 1BF5A 8GSSA 3C8EA 3ISOA 1RK4A 1U3IA 5C00A 2RUFA 1QFNA 1BG5A 3RPNA 4ZL8A 3VWWA 1M3IA 1NM3A 1F2EA 5EL8A 5A1NA 2V41A 3FZ9A 1WP0A 4J57E 2R6KA 3KJYA 1YQ1A 3LG6A 1O8WA 5IMZA 4GCIA 3EVIA 5DCHA 1A8YA 2V6KA 4IN0A 5GAPD 4OD7A 4OFTA 2H6YA 3D6IA 3G7YA 1A0FA 3D4MA 4PTSA 3IC8A 1BG1A 2H0HA 4I2TA 3KZQA 2OACA 5G31A 1S3RA 5KN3A 4N0VA 1AIUA 5BRTA 1AAZA 1TXUA 4V2NA 3M1GA 1GNEA 4OCFA 5B7CA 5G5EA 5IQYA 3HVVA 3L9VA 3GMFA 3IRAA 2DLXA 4G2EA 3LXTA 3G7IA 1WMJA 4V2MA 3ZZXA 5BMUB 2HSYA 2CT6A 3UOMA 4LMVA 4POMA 4PQHA 4AKXB 3Q19A 5JWOB 1TRVA 3LYKA 2OBIA 2H8LA 1AQWA 1JZOA 2WGRA 3L78A 1QGVA 4DSQA 1ON4A 3VLNA 1HNCA 2XHFA 5ECMB 1PA3A 4TVEA 3FZAA 3F3RA 2KP2A 4BL7B 4JR4A 1ZYEA 2JZRA 1K0NA 2H6ZA 1PX6A 11GSA 1A8LA 4WKWA 1SD9A 2H01A 5J41A 2HSNB 3HMJG 4PX1A 3GTUB 2AJQB 2LRCA 1PQNA 4TOPA 3EMPA 5JWRB 3UBLA 1U88A 4D73B 2C0FA 2NPBA 5H5SA 1G6WA 3DD3A 4Q5QA 1YEPA 5DQYA 4PGTA 5L71A 2JU5A 1K0DA 1I9DA 2WS2A 5H5QA 1U87A 4XCSA 3VPQA 5LD0A 2DJ0A 5KN2A 4KCEA 2FWEA 4OMVA 2R3XA 2DJ2A 4FIWA 2F8AA 2IIYA 3TJBA 3LYPA 4RI7A 3KD0A 4QMKA 3ERWA 3RPPA 4X43A 3EYTA 5CRWA 2WRTA 2QA1A 3VI7A 2AUVA 1ML6A 1BAYA 2VCTA 1A2LA 3MDKA 1EGRA 2GSQA 3ZMLA 2D2ZA 1TU7A 1NHOA 4TW5A 2AV4A 3TJKA 5ID2B 3IBHA 2JSZA 2AB6A 3QCPA 1URMA 1VF1A 3F0IA 5ECQB 3GHAA 2IL3A 3R3EA 2MMOA 4BWSA 4BL7A 3A5IA 3C73A 3KGKA 2VD0A 2FCHA 2PN8A 1Y25A 2P5QA 4IJIA 2VCVA 5JCGA 1PX7A 3HZ8A 1ERTA 1I1IP 2GSSA 1YZXA 4K0GA 4O92A 4HQSA 3CRUA 3Q74A 1X0RA 2R4VA 2PPTA 5HR2A 2GT5A 2DIYA 2LNTA 3TRXA 2YJHA 2B6MA 2QKEA
chains in the Genus database with same CATH topology
2VLTA 3ZL5A 3DMLA 1G0TA 2GDRA 2CVKA 2EFCA 1MTCA 3TJFA 2B1KA 2CQ9A 2VUPA 3ZVJD 4HUAA 1OKTA 4K5SA 3GKXA 1SJIA 3HA9A 2YV9A 3KH7A 5HR3A 1GLPA 2L6DA 1XW6A 1RW1A 2C80A 3BJ5A 2HRAA 2OBKA 3QMXA 4N11A 1X9WB 5D9WA 4MCUA 2B7JA 3HJMA 5J5NA 3GYKA 1EEJA 3ERFA 4WEYA 1KNGA 5IOXA 3APOA 4GSSA 1A2JA 5ID2A 7GSSA 3IA1A 1BEDA 4QL9A 3EINA 4DSSB 4RI6A 1T7PB 4KH7A 1K3LA 4WF4A 4G0KA 2B5YA 1Y1UA 5EVOA 1OC9B 1HNAA 3IR4A 2HNLA 1VF3A 4HJ2A 3WGDA 5EPFA 4ZL9A 4GDFA 3FK8A 3H79A 1TK5B 3E9JB 5DDLA 3U5RE 3VPTA 4KCAA 2VM1A 5IMVA 2GQKA 4MPGA 4NAXA 2H71A 1YY7A 3CSIA 2DJ3A 4Z2UA 2YJ7A 2DC5A 2ON5A 5B6MA 1PD21 4N3ZA 4E8EA 3DGQA 4JR6A 3J7Yk 3VWXA 1TKDB 2B1LA 4PNGA 2K6VA 1LU4A 4GXZA 1A23A 1GLQA 3LORA 3HJOA 5DJMA 4MJBA 3ZFBA 2GQMA 4MJEA 1XOAA 1PN9A 3BCIA 1EP7A 3C1RA 2O85A 1H4OA 4NWYA 3MAKA 5KN0A 1HD2A 4RUVA 1V58A 2LKUA 4KE3A 1TJDA 2ON7A 3KIJA 3ME8A 4KUNA 2C0DA 1N25A 3GSTA 4ZB7A 4DSSA 3OR5A 1PKWA 2E7PA 3BBYA 5LNKe 3O3TA 1B48A 3QAVA 4ZBAA 3UVTA 2H72A 2FLSA 1SVOA 1SJZA 1OC9A 2X4AA 3IE3A 3FHKA 3UAPA 4TR4A 2VCWA 4BVXB 4EE0A 4BWQA 4I97A 1SVMA 3QDNA 3GKMA 1ILOA 1JHBA 2AHEA 1Z7PA 1XWBA 1UN2A 1G7EA 1BX9A 1Z9HA 2HRKB 1USBA 6GSYA 4GF0A 4JU5A 2HRFA 2A2PA 3I43A 3EPTA 3FKFA 3AY8A 3PINA 4L0WA 3BCKA 4F0CA 1DE2A 1Z3EA 1GTUA 4IKHA 3A3TA 3IOSA 3GKKA 1GSEA 4KF9A 3LEFA 2MMZA 1J08A 2N5BA 2FY6A 2B7KA 18GSA 2QSIA 4AKGA 5HFGA 2ZUPA 1A2MA 3KTLA 3F8UA 5F07A 3LFLA 3MSZA 3UVHA 1EGOA 5DCGA 1ZL9A 1M9BA 3C1SA 2H1DA 3DKSA 4EUYA 3TJJA 4KX4A 2R0PA 3FMWA 1DUGA 2NBSA 4K8MA 3F63A 5ECSA 4PUFC 3RHCA 4KSOA 1OVNA 1M2DA 4IGJA 2FWGA 5F06A 2GS3A 1DBYA 5GAND 1JFUA 4IJ3A 2RUEA 2HRKA 1FB0A 2FHEA 1M7TA 2MBTA 2VAFA 2JZTA 5ECOB 1WJKA 2HI7A 1JLVA 4HS1A 3HDCA 1UA5A 2GZPA 2DMMA 2E2MA 1Y6EA 5AGYA 4NV2A 3I6AA 1VGLA 12GSA 4O5RA 4YQVA 3EURA 4MNNA 3D4TA 2WCIA 3TKSE 3IK7A 1K0CA 20GSA 4Q5FA 1CQHA 2QC7A 3WGXA 1XFLA 5IMDA 2VKZG 3APSA 3CXGA 2NTOA 4AJ6A 3A5WA 4I6XA 2XPEA 3FZ5A 2X8GA 3L9SA 4QL7A 2REMA 2YWOA 3WT2A 3HYPA 3UJ1A 1T1VA 1XOBA 1ACVA 2O7KA 3IAM2 3NIVA 4JBBA 3R2QA 3CMIA 1K0OA 2YZHA 1GTAA 1XWGA 1EOHA 5F05A 5DALA 3DIEA 4FYUA 4HJMA 2O5VA 4POLA 1ZCPA 1OC3A 4Q5RA 1O85A 5JWQB 1OE8A 2DSAA 2CAQA 1XPVA 3FZ4A 3CYNA 1FVKA 4JZQA 4K9ZA 4ICYA 3VWVA 4ECCA 5HQPA 3S9FA 3KXOA 1YVLA 2F51A 4JRRA 4MLYA 5CAXA 5A4WA 2H75A 4N30A 3QR6A 1M9AA 5KN1A 3F4SA 5AIXA 1T4ZA 2K8SA 3F3QA 1T8EB 2LRTA 6GSWA 4GRFA 4HDEA 1U6TA 5F8BA 1SJ6A 4XTSA 4OCEA 2GSRA 1KBNA 3ZMKA 2HQTA 4F9ZA 2I4AA 4E68A 4N0ZA 2KP1A 4CY6A 3PR8A 2YZUA 4IBPA 1TK8B 2C3TA 1Z7RA 3LXZA 2QA2A 3HY2A 5D9VA 1Z6NA 4CDOA 2H73A 4PNFA 4O5UA 1EWXA 1QXHA 2WZ9A 1T3BA 2TRXA 5DAKA 3IV4A 4L0UA 4WETA 4GTUA 1MDKA 5GZZB 2GZYA 1ERVA 4O7HA 4PQIA 2VLVA 5HFKA 1VRSD 1O7UA 3UL3A 6GSTA 3TCOA 4G01A 4GQFA 5INYA 3K8NA 2HLSA 3TRQA 5D8IA 1PSQA 3VURA 2PVQA 2EFDA 4F2IA 1NHYA 4POBA 1EOGA 4K2DA 4GQCA 4L5LA 2H66A 3G9BA 1WRYA 1ERWA 1VF4A 3GKNA 2IN3A 4G10A 3C7MA 14GSA 1QK8A 1X5CA 2TIRA 3LW9A 4TRXA 5ELAA 2VCXA 3CWGA 4USSA 2HYXA 5G30A 4L8EA 3LQ7A 2N5AA 2E0QA 5JCWA 5HFIA 5JCUA 2IMFA 3BOAA 3ZIVA 2DJJA 2YN1A 2AYTA 1SL0B 3GNJA 4LMWA 4MF6A 1FOHA 3EU3A 3WYWA 2B3SA 4V1Ag 2DKIA 5IM9A 1GL8A 2X99A 4YH2A 5G5FA 4TXVA 2L4CA 5FHIA 2CZ2A 5D96A 1JZRA 2LQOA 2A2RA 2M80A 4IS0A 2V6OA 3M8NA 3NZNA 4OO5A 1QUWA 4ML1A 5KOWA 3D22A 2K9FA 3P2AA 3TRPA 5IO0A 1UVZA 1O81A 2WFCA 4FYBA 5J4VA 5CRHA 1S3CA 2HZFA 3TKPA 1DSBA 3GUSA 1T4YA 1TOFA 5IPGA 4WBRD 3D0ZA 5ENUA 1R4WA 4XRDA 10GSA 1G7OA 5CO3A 17GSA 3UARA 2H76A 4HU7A 3TKQA 1AQXA 4FO5A 1ST9A 1EZKA 1OE7A 1K3OA 4F82A 1XZOA 2JSYA 2DBCA 4XS1A 2LQQA 2V32A 1XWKA 1OAZA 2YP6A 2K8VA 2C3NA 3DEXA 1GSYA 4MP4A 1TP9A 3ZYWA 4G19A 3MIXA 1PL2A 5CP1A 4KDXA 3A2XA 2H70A 1B4QA 1JZDA 4MMMA 1AQVA 3FR9A 1SD8A 2JADA 4AJ8A 3FR3A 4EVMA 4K6XA 1GSFA 5E4WA 3PH9A 3ZFLA 1Z6MA 4XRAA 1FW1A 4MABA 1K0BA 3IXRA 4ZB9A 22GSA 1PN0A 4OO4A 4HU9A 2P31A 4EDYA 3FEUA 4HI7A 1U3AA 1MEKA 3IC4A 1N2AA 2LUSA 1GRXA 3M3MA 2YPMA 2FUG2 1NSWA 3MYDA 4MH3A 4V1Ap 4EXJA 4AKHA 5CYYA 4G9HA 3HVXA 4BVYB 5DVBA 3TOTA 5IIZA 2BMXA 3WGEA 1FHEA 2Z9SA 3GH9A 2X49A 5AIVA 5J9BA 5ECKB 3FW2A 2KLXA 5FWGA 2CX4A 4WR5A 2V2GA 3TU3B 1JLWA 2H1GA 2DIZA 5B6NA 1B9YC 5A5HA 1GSUA 1SYRA 5IPHA 6GSUA 2CA8A 3P8WA 3Q18A 4CY8A 3KMOA 4OFMA 4JEDA 2VM2A 1V2AA 4MPFA 3V1WA 4KSMA 2FNOA 3QAWA 4POKA 1M99A 1XVQA 5D73A 4Z2RA 3F4TA 3HKRA 1V9WA 1GUHA 3KTBA 5ECHB 2M46A 2O89A 3CSJA 1W89A 6GSXA 2MZCA 3EMXA 1TTZA 1R7HA 2H74A 1GSQA 1JZWA 2X8HA 2GTUA 2G0FA 1E6BA 1FVJA 3EWLA 4XS6A 4TR0A 1G6YA 2VO4A 5IMFA 4BVYA 2BJXA 2EIQA 4LL4B 4X0XA 3KM6A 4ZXGA 1HYUA 3I9V2 3NOFA 4WXTA 5F0GA 2JZSA 2NDOA 4ULXA 1UC7A 2BTOT 1H75A 3APQA 4IP1A 4MZWA 1SK0A 1XCCA 2WULA 3FYGA 4NMUA 4PQ1A 4V2LA 1OYJA 2K18A 5GSSA 5ELGA 2OJLA 1R26A 2LTKA 2YCDA 3W6GA 4KDYA 2OA7A 3HJPA 4EL1A 5A34B 1WOUA 4YKGA 1YJ6A 2FWHA 1WE0A 3C71A 3H1NA 1AC1A 4JE1A 1EV9A 4RQXA 4AGSA 5A4VA 1LJRA 5KEJA 3VWUA 2RLIA 1A0RP 5DQSA 4XIHA 1AXDA 3TUEA 2XBIA 1EV4A 13GSA 4K7NA 3UEMA 1PRXA 4MZBA 3GL3A 3MWHA 2C1YA 3EE2A 4ECBA 2DKHA 5DALB 2DJKA 1TRWA 1YKAA 3HXSA 3CTGA 4F0BA 5A4UA 2HT9A 1SK2A 4O5QA 3FR6A 1GUMA 4WBJA 2C4JA 3M0FA 3ZLPA 1WIKA 5J9CA 2FA8A 4AKIA 1KTEA 3CTFA 3E3EA 3D5JA 3TKSC 3TB2A 5HR0A 1ERUA 2FGXA 4Q5NA 2EIRA 4G0LA 3GIXA 3RDWA 5AN1A 4EC0A 2LJAA 3KCMA 4X1UA 4QQ7A 2A4VA 3PPUA 4I8BA 3UIWA 2GZZA 2R5GA 5ECRB 1S3AA 2ZCTA 3TGZA 2CV4A 2H6XA 2R0GA 2X64A 1K0MA 3ZREA 3HZ4A 1ZYPA 2LJKA 4PURA 5A34A 2OE3A 1XXUA 1XVWA 3O6TA 4ZB6A 3L0HA 2KHPA 4I2UA 2WDUA 2IMIA 2QGVA 2F3MA 3QFBC 1GTIA 5DAKB 4LA1A 1YEXA 2HSMB 1THOA 3P90A 1IYIA 1HNBA 2I3YA 1GULA 4KW6A 1GNWA 2FD3A 4EF0A 4ID0A 1GTBA 2NVLA 2N5FA 3D21A 1XBSA 2L5OA 1BQ7A 4EDZA 3ZTLA 1TRUA 4K5RA 1MDJA 1GH2A 4AJ7A 5B8AA 3GRXA 2VCQA 6GSSA 1O73A 2YOIA 4ZIJA 3DRNA 3MNGA 2LV3A 3H93A 1X5DA 2F9SA 2PUKC 1V98A 3WD6A 1M0UA 2MBSA 4MJAA 2B5EA 3KMNA 4MDCA 4I5QA 3U6VA 2PMTA 2UZ8A 4IP6A 5CRDA 3VK9A 4A5PA 5ECIB 5A5KA 4DSRA 2WJUA 2PVOC 3N9JA 1THXA 4ILFA 2LJRA 1PMTA 4ZILA 1XW5A 1K3YA 4NHZA 2LSTA 4W66A 2VL2A 2R37A 4PUAA 5E59A 3RAZA 4KDUA 2RM5A 4ISDA 2VL9A 2EFEA 2ES7A 1XIYA 2L59A 5ECPB 19GSA 3QAGA 2HSMA 1PL1A 2L57A 3QOUA 3O76A 2IJYA 4IQ1A 3DVXA 4GWRA 4X4JA 4G0IA 3UMAA 2EIOA 1TK0B 1V57A 1YF1A 4KB3A 1XWAA 2PGTA 5KOXA 3GSSA 1ZYNA 3DXBA 3E0UA 4TN8A 2H30A 2H19A 3CRTA 2JACA 4Z2TA 2R0CA 3GX8A 3A2VA 3QFAC 4WR4A 3KEBA 2KOKA 3GX0A 4GLTA 2RM6A 2HZEB 4MA9A 2LRNA 4XHMA 2FWFA 2WB9A 2YV7A 2UV8G 4MH2A 4XS4B 2V1MA 4TR3A 4YQUA 5G1LA 3L9UA 4HOJA 4MF5A 2IFQB 4NPBA 2P0GA 4KAEA 4YAPA 1SL2B 2C0GA 3PGTA 5BMUA 3M9JA 3KH9A 4IQAA 2GSTA 4AF2A 1X9SB 5DBQA 3RBTA 2OKAA 2CAIA 2PU9C 4J2FA 5GSTA 1F9MA 3P7XA 1A24A 5DJLA 2VOCA 3GL5A 5G2ZA 3L4NA 2PERA 4K7IA 4ZB8A 2O8VB 2HE3A 3F9UA 5ECNB 3IAS2 3GFKA 2L6CA 3M9KA 5J40A 4MF7A 1WPIA 2C3QA 6GSVA 4TXOB 3GH6A 1W4VA 3ERGA 5IO2A 2C0EA 5EY6A 4RQRA 1OC8A 5CREA 2LEGA 1S3DA 4EIQA 4KNDA 2CX3A 4KA0A 3DWVA 5HR1A 2IPAA 1ZYQB 2L4QA 2YWIA 3H4KA 2OT3A 1QMVA 1AW9A 4LLRA 1T00A 2GVPA 3TKRA 4O32A 2HSNA 3GTUA 2IWTA 3F6FA 4LL1B 2HZEA 3TKSA 1B9XC 1YDKA 4D73A 3QD9A 3I69A 2VCZA 3DVWA 1TI3A 4XS4A 2ZNMA 5ECLB 1EP8A 4DEJA 4EO3A 1KEBA 2VD1A 1X5EA 3BD2A 3QPMA 2HXKA 2IFQA 3H8QA 1ZMAA 1GSDA 2XBQA 4HZ4A 5A5HB 3J7Yb 3ME7A 1O8XA 1WWJA 1ZGNA 3IHGA 4OFNA 3GV1A 1MD3A 1GP1A 3VI5A 2YNXA 4YAVA 1F37A 3KP8A 1M2BA 3WT1A 5D93A 4EKZA 4Z7XA 1J9BA 2KUCA 2J23A 1PKZA 2CVBA 4IVFA 2RIIA 4TXOA 1SKWB 4BA7A 3ZIJA 4ZBBA 2CZ3A 3DYRA 2FA4A 1AUCA 4PXOA 4ECIA 2H0IA 1E2YA 9GSSA 4NXIA 1YKCA 5D9TA 1SKSB 3JCML 1TU8A 4NHWA 1QQ2A 1YF0A 1FB6A 2F8FA 4MJCA 4H86A 2E2GA 4EIPA 3VFIA 4J56E 5J4YA 5IMAA 2I9HA 2LS5A 1GWCA 4YQMA 3ZITA 1XW9A 1SENA 5J47A 4FYCA 4HQZA 2GQLA 1C72A 2H1LA 3F6DA 4F03A 1VF2A 1TXXA 1F3BA 2EFHA 1NW2A 1M2AA 5IOWA 2YWNA 2EC4A 1EEMA 1O6JA 4OWYA 4ML6A 4L5OA 1SYXA 4K2XA 1TRSA 2IMDA 4CW9A 4GSTA 4TR1B 3N5OA 2VL2C 3SBCA 2DMLA 2A4HA 2AAWA 3HCZA 3HVSA 1N8JA 2ALBA 4BPYA 1DE1A 5ABRA 2OE0A 1SKRB 4DVCA 1MD4A 2TRCP 1ABAA 3ZRDA 1SL1B 3LJRA 3LGCA 1FOVA 3IDVA 2M72A 1Q4JA 2OADA 5LCZA 2GGTA 5H5RA 4ACSA 2OE1A 2VL3A 4ECJA 1FO5A 4YKFA 5B8BA 4FQUA 3ED3A 1J0FA 1B8XA 2CVDA 5J3RA 1HQOA 3IHQA 4IELA 2H1AA 2G2QA 3GA4A 4IW9A 3CSHA 4K7OA 3W8JA 4TKYA 5COHA 4HZ2A 2GT6A 5FT3A 16GSA 2A2SA 1SK1A 1FG4A 1BYEA 4CHSA 2YANA 2HFDA 2HSHA 1F6MC 4HEA2 4IHUA 1IYHA 1I5GA 3TJGA 2C8UA 3EU4A 2IMEA 1Q98A 5J4UA 2J9HA 4K1FA 4MK3A 4TR1A 1R5AA 2VLUA 5C04A 2MMNA 2HRNA 3LSZA 2MYGA 2DJ1A 2JL4A 5CNWA 4E8HA 1SVLA 4WF5A 1ZZYA 3FY7A 4ZL7A 1ZOFA 2P5RA 1B4PA 4K0NA 3ZVJA 5A1NB 3KP9A 4AI6A 2PWJA 1K0AA 3IK9A 1V40A 1FAAA 3EC3A 5AISA 3A2WA 1CQGA 3CBUA 5D9XA 2L5LA 1XWCA 4FH8A 3W8SA 1GUKA 2X8CA 3TOUA 3IPZA 1PGTA 3F4RA 4GSNA 4N10A 4BVXA 1R5PA 3G7JA 1RQMA 3US3A 1Z5YE 2R2JA 2LNSA 1X9MB 1SU9A 3Q6OA 3GURA 4ZBDA 2H0GA 2O87A 3LWAA 2PBJA 3GN3A 5G1KA 4MZCA 1OKDA 2XC2A 1BJXA 3FRCA 3HD5A 2B5XA 3SWLA 4NV5A 3HHVA 3RHBA 2MMAA 1MDIA 3TDGA 2XPDA 2H1BA 4KGIA 1TI1A 1TW9A 5CRGA 1LBKA 2YWMA 4P3YB 5IMCA 1GSSA 2I1UA 2GLRA 2IMKA 2I81A 2VIMA 1F3AA 3UBKA 1TDIA 1BF5A 8GSSA 3C8EA 3ISOA 1RK4A 1U3IA 5C00A 2RUFA 1QFNA 1BG5A 3RPNA 4ZL8A 3VWWA 1NM3A 1F2EA 5EL8A 5A1NA 2V41A 3FZ9A 1WP0A 4J57E 2R6KA 3KJYA 1YQ1A 3LG6A 1O8WA 5IMZA 4GCIA 3EVIA 5DCHA 1A8YA 2V6KA 4IN0A 5GAPD 4OD7A 4OFTA 2H6YA 3D6IA 3G7YA 1A0FA 3D4MA 4PTSA 3IC8A 1BG1A 2H0HA 4I2TA 3KZQA 2OACA 5G31A 5KN3A 4N0VA 1AIUA 5BRTA 1AAZA 1TXUA 4V2NA 3M1GA 1GNEA 4OCFA 5B7CA 5G5EA 5IQYA 3HVVA 3L9VA 3GMFA 3IRAA 2DLXA 4G2EA 3LXTA 3G7IA 1WMJA 4V2MA 3ZZXA 5BMUB 2HSYA 2CT6A 3UOMA 4LMVA 4POMA 4PQHA 4AKXB 3Q19A 5JWOB 1TRVA 3LYKA 2OBIA 2H8LA 1AQWA 1JZOA 2WGRA 3L78A 1QGVA 4DSQA 1ON4A 3VLNA 1HNCA 2XHFA 5ECMB 1PA3A 4TVEA 3FZAA 3F3RA 2KP2A 4BL7B 4JR4A 1ZYEA 2JZRA 1K0NA 2H6ZA 1PX6A 11GSA 1A8LA 4WKWA 1SD9A 2H01A 5J41A 2HSNB 3HMJG 4PX1A 3GTUB 2AJQB 2LRCA 1PQNA 4TOPA 3EMPA 5JWRB 3UBLA 1U88A 4D73B 2C0FA 2NPBA 5H5SA 1G6WA 3DD3A 4Q5QA 1YEPA 5DQYA 4PGTA 5L71A 2JU5A 1K0DA 1I9DA 2WS2A 5H5QA 1U87A 4XCSA 3VPQA 5LD0A 2DJ0A 5KN2A 4KCEA 2FWEA 4OMVA 2R3XA 2DJ2A 4FIWA 2F8AA 2IIYA 3TJBA 3LYPA 4RI7A 3KD0A 4QMKA 3ERWA 3RPPA 4X43A 3EYTA 5CRWA 2WRTA 2QA1A 3VI7A 2AUVA 1ML6A 1BAYA 2VCTA 1A2LA 3MDKA 1EGRA 2GSQA 3ZMLA 2D2ZA 1TU7A 1NHOA 4TW5A 2AV4A 3TJKA 5ID2B 3IBHA 2JSZA 2AB6A 3QCPA 1URMA 1VF1A 3F0IA 5ECQB 3GHAA 2IL3A 3R3EA 2MMOA 4BWSA 4BL7A 3A5IA 3C73A 3KGKA 2VD0A 2FCHA 2PN8A 1Y25A 2P5QA 4IJIA 2VCVA 5JCGA 1PX7A 3HZ8A 1ERTA 2GSSA 1YZXA 4K0GA 4O92A 4HQSA 3CRUA 3Q74A 1X0RA 2R4VA 2PPTA 5HR2A 2GT5A 2DIYA 2LNTA 3TRXA 2YJHA 2B6MA 2QKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLT A;  3ZL5 A;  3DML A;  1G0T A;  2GDR A;  2CVK A;  1MTC A;  3TJF A;  2B1K A;  2CQ9 A;  2VUP A;  3ZVJ D;  4HUA A;  1OKT A;  3GKX A;  1SJI A;  3HA9 A;  2YV9 A;  3KH7 A;  5HR3 A;  1GLP A;  2L6D A;  1XW6 A;  1RW1 A;  2C80 A;  3BJ5 A;  2HRA A;  2OBK A;  3QMX A;  4N11 A;  1X9W B;  5D9W A;  4MCU A;  2B7J A;  3HJM A;  5J5N A;  3GYK A;  1EEJ A;  3ERF A;  4WEY A;  1KNG A;  5IOX A;  3APO A;  4GSS A;  1A2J A;  5ID2 A;  7GSS A;  3IA1 A;  1BED A;  4QL9 A;  3EIN A;  4DSS B;  4RI6 A;  1T7P B;  4KH7 A;  1K3L A;  4WF4 A;  4G0K A;  2B5Y A;  5EVO A;  1OC9 B;  1HNA A;  3IR4 A;  2HNL A;  1VF3 A;  4HJ2 A;  3WGD A;  5EPF A;  4ZL9 A;  3FK8 A;  3H79 A;  1TK5 B;  3E9J B;  5DDL A;  3U5R E;  3VPT A;  4KCA A;  2VM1 A;  5IMV A;  2GQK A;  4MPG A;  4NAX A;  2H71 A;  1YY7 A;  3CSI A;  2DJ3 A;  2YJ7 A;  2DC5 A;  2ON5 A;  5B6M A;  1PD2 1;  4E8E A;  3DGQ A;  4JR6 A;  3J7Y k;  3VWX A;  1TKD B;  2B1L A;  4PNG A;  2K6V A;  1LU4 A;  4GXZ A;  1A23 A;  1GLQ A;  3LOR A;  3HJO A;  5DJM A;  4MJB A;  3ZFB A;  2GQM A;  4MJE A;  1XOA A;  1PN9 A;  3BCI A;  1EP7 A;  3C1R A;  2O85 A;  1H4O A;  4NWY A;  3MAK A;  5KN0 A;  1HD2 A;  4RUV A;  1V58 A;  2LKU A;  4KE3 A;  1TJD A;  2ON7 A;  3KIJ A;  3ME8 A;  4KUN A;  2C0D A;  3GST A;  4DSS A;  3OR5 A;  1PKW A;  2E7P A;  3BBY A;  5LNK e;  3O3T A;  1B48 A;  3QAV A;  4ZBA A;  3UVT A;  2H72 A;  2FLS A;  1SJZ A;  1OC9 A;  3IE3 A;  3FHK A;  3UAP A;  4TR4 A;  2VCW A;  4BVX B;  4EE0 A;  4BWQ A;  4I97 A;  3QDN A;  3GKM A;  1ILO A;  1JHB A;  2AHE A;  1Z7P A;  1XWB A;  1UN2 A;  1G7E A;  1BX9 A;  1Z9H A;  2HRK B;  1USB A;  6GSY A;  4GF0 A;  4JU5 A;  2HRF A;  3I43 A;  3PIN A;  3FKF A;  3AY8 A;  4L0W A;  1DE2 A;  3BCK A;  4F0C A;  1Z3E A;  1GTU A;  4IKH A;  3A3T A;  3IOS A;  3GKK A;  1GSE A;  4KF9 A;  3LEF A;  2MMZ A;  1J08 A;  2N5B A;  2FY6 A;  2B7K A;  18GS A;  2QSI A;  5HFG A;  2ZUP A;  1A2M A;  3KTL A;  3F8U A;  5F07 A;  3LFL A;  3MSZ A;  3UVH A;  1EGO A;  5DCG A;  1ZL9 A;  1M9B A;  3C1S A;  2H1D A;  3DKS A;  4EUY A;  3TJJ A;  4KX4 A;  1DUG A;  2NBS A;  4K8M A;  3F63 A;  5ECS A;  4PUF C;  3RHC A;  4KSO A;  1OVN A;  1M2D A;  4IGJ A;  2FWG A;  5F06 A;  2GS3 A;  1DBY A;  5GAN D;  1JFU A;  4IJ3 A;  2RUE A;  2HRK A;  1FB0 A;  2FHE A;  1M7T A;  2MBT A;  2VAF A;  2JZT A;  5ECO B;  1WJK A;  2HI7 A;  1JLV A;  4HS1 A;  3HDC A;  1UA5 A;  2GZP A;  2DMM A;  2E2M A;  1Y6E A;  5AGY A;  4NV2 A;  3I6A A;  1VGL A;  12GS A;  4O5R A;  4YQV A;  3EUR A;  3D4T A;  2WCI A;  3TKS E;  3IK7 A;  1K0C A;  20GS A;  4Q5F A;  1CQH A;  2QC7 A;  3WGX A;  1XFL A;  5IMD A;  3APS A;  3CXG A;  2NTO A;  4AJ6 A;  3A5W A;  4I6X A;  2XPE A;  3FZ5 A;  2X8G A;  3L9S A;  4QL7 A;  2REM A;  2YWO A;  3WT2 A;  3HYP A;  3UJ1 A;  1T1V A;  1XOB A;  1ACV A;  2O7K A;  3IAM 2;  3NIV A;  4JBB A;  3R2Q A;  3CMI A;  1K0O A;  2YZH A;  1GTA A;  1XWG A;  4FYU A;  1EOH A;  5DAL A;  5F05 A;  3DIE A;  4HJM A;  4POL A;  1ZCP A;  1OC3 A;  4Q5R A;  1O85 A;  5JWQ B;  1OE8 A;  2DSA A;  2CAQ A;  1XPV A;  3FZ4 A;  3CYN A;  1FVK A;  4JZQ A;  4K9Z A;  3VWV A;  4ECC A;  5HQP A;  3S9F A;  3KXO A;  2F51 A;  4JRR A;  4MLY A;  5CAX A;  5A4W A;  2H75 A;  4N30 A;  3QR6 A;  1M9A A;  5KN1 A;  3F4S A;  5AIX A;  1T4Z A;  2K8S A;  3F3Q A;  1T8E B;  2LRT A;  6GSW A;  4GRF A;  4HDE A;  1U6T A;  5F8B A;  1SJ6 A;  4XTS A;  4OCE A;  2GSR A;  1KBN A;  3ZMK A;  2HQT A;  4F9Z A;  2I4A A;  4N0Z A;  2KP1 A;  3PR8 A;  2YZU A;  4IBP A;  1TK8 B;  2C3T A;  1Z7R A;  3LXZ A;  3HY2 A;  5D9V A;  1Z6N A;  4CDO A;  2H73 A;  4PNF A;  1EWX A;  1QXH A;  2WZ9 A;  1T3B A;  2TRX A;  5DAK A;  3IV4 A;  4L0U A;  4WET A;  4GTU A;  1MDK A;  5GZZ B;  2GZY A;  1ERV A;  4O7H A;  4PQI A;  2VLV A;  5HFK A;  1VRS D;  1O7U A;  3UL3 A;  6GST A;  3TCO A;  4GQF A;  5INY A;  3K8N A;  2HLS A;  3TRQ A;  5D8I A;  1PSQ A;  3VUR A;  2PVQ A;  4F2I A;  1NHY A;  4POB A;  1EOG A;  4K2D A;  4GQC A;  4L5L A;  2H66 A;  3G9B A;  1WRY A;  1ERW A;  1VF4 A;  3GKN A;  2IN3 A;  4G10 A;  3C7M A;  14GS A;  1QK8 A;  1X5C A;  2TIR A;  4TRX A;  5ELA A;  2VCX A;  4USS A;  2HYX A;  5G30 A;  4L8E A;  3LQ7 A;  2N5A A;  2E0Q A;  5JCW A;  5HFI A;  5JCU A;  2IMF A;  3BOA A;  3ZIV A;  2DJJ A;  2YN1 A;  2AYT A;  1SL0 B;  3GNJ A;  4LMW A;  4MF6 A;  3EU3 A;  3WYW A;  2B3S A;  4V1A g;  5IM9 A;  1GL8 A;  2X99 A;  4YH2 A;  5G5F A;  4TXV A;  2L4C A;  5FHI A;  2CZ2 A;  5D96 A;  1JZR A;  2LQO A;  2A2R A;  2M80 A;  4IS0 A;  2V6O A;  3M8N A;  3NZN A;  4OO5 A;  1QUW A;  4ML1 A;  3D22 A;  2K9F A;  3P2A A;  3TRP A;  5IO0 A;  1UVZ A;  1O81 A;  2WFC A;  4FYB A;  5CRH A;  1S3C A;  2HZF A;  3TKP A;  1DSB A;  3GUS A;  1T4Y A;  1TOF A;  5IPG A;  4WBR D;  3D0Z A;  5ENU A;  1R4W A;  4XRD A;  10GS A;  1G7O A;  5CO3 A;  17GS A;  3UAR A;  2H76 A;  4HU7 A;  3TKQ A;  1AQX A;  4FO5 A;  1ST9 A;  1EZK A;  1OE7 A;  1K3O A;  4F82 A;  1XZO A;  2JSY A;  2DBC A;  4XS1 A;  2LQQ A;  2V32 A;  1XWK A;  1OAZ A;  2YP6 A;  2K8V A;  2C3N A;  3DEX A;  1GSY A;  4MP4 A;  1TP9 A;  3ZYW A;  4G19 A;  1PL2 A;  5CP1 A;  4KDX A;  3A2X A;  2H70 A;  1B4Q A;  1JZD A;  4MMM A;  1AQV A;  3FR9 A;  1SD8 A;  2JAD A;  4AJ8 A;  3FR3 A;  4EVM A;  4K6X A;  1GSF A;  5E4W A;  3PH9 A;  3ZFL A;  1Z6M A;  4XRA A;  1FW1 A;  4MAB A;  1K0B A;  3IXR A;  4ZB9 A;  22GS A;  4OO4 A;  4HU9 A;  2P31 A;  4EDY A;  3FEU A;  4HI7 A;  1U3A A;  1MEK A;  3IC4 A;  1N2A A;  2LUS A;  1GRX A;  3M3M A;  2YPM A;  2FUG 2;  1NSW A;  4MH3 A;  4V1A p;  4EXJ A;  5CYY A;  4G9H A;  3HVX A;  4BVY B;  5DVB A;  3TOT A;  5IIZ A;  2BMX A;  3WGE A;  1FHE A;  2Z9S A;  3GH9 A;  5AIV A;  5J9B A;  5ECK B;  3FW2 A;  2KLX A;  5FWG A;  2CX4 A;  4WR5 A;  2V2G A;  1JLW A;  2H1G A;  2DIZ A;  5B6N A;  1B9Y C;  1GSU A;  1SYR A;  5IPH A;  6GSU A;  2CA8 A;  3P8W A;  3Q18 A;  3KMO A;  4OFM A;  4JED A;  2VM2 A;  1V2A A;  4MPF A;  3V1W A;  4KSM A;  2FNO A;  3QAW A;  4POK A;  1M99 A;  1XVQ A;  5D73 A;  3F4T A;  3HKR A;  1V9W A;  1GUH A;  3KTB A;  5ECH B;  2M46 A;  2O89 A;  3CSJ A;  1W89 A;  6GSX A;  2MZC A;  3EMX A;  1TTZ A;  1R7H A;  2H74 A;  1GSQ A;  1JZW A;  2X8H A;  2GTU A;  2G0F A;  1E6B A;  1FVJ A;  3EWL A;  4XS6 A;  4TR0 A;  1G6Y A;  2VO4 A;  5IMF A;  4BVY A;  2BJX A;  2EIQ A;  4LL4 B;  4X0X A;  3KM6 A;  4ZXG A;  1HYU A;  3I9V 2;  3NOF A;  4WXT A;  5F0G A;  2JZS A;  2NDO A;  4ULX A;  1UC7 A;  2BTO T;  1H75 A;  3APQ A;  4IP1 A;  4MZW A;  1SK0 A;  1XCC A;  2WUL A;  3FYG A;  4NMU A;  4PQ1 A;  4V2L A;  1OYJ A;  2K18 A;  5GSS A;  5ELG A;  2OJL A;  1R26 A;  2LTK A;  2YCD A;  3W6G A;  4KDY A;  2OA7 A;  3HJP A;  4EL1 A;  1WOU A;  1YJ6 A;  2FWH A;  1WE0 A;  3C71 A;  3H1N A;  1AC1 A;  4JE1 A;  1EV9 A;  4RQX A;  4AGS A;  5A4V A;  1LJR A;  5KEJ A;  3VWU A;  2RLI A;  1A0R P;  5DQS A;  4XIH A;  1AXD A;  3TUE A;  2XBI A;  1EV4 A;  13GS A;  4K7N A;  3UEM A;  1PRX A;  4MZB A;  3GL3 A;  3MWH A;  2C1Y A;  3EE2 A;  4ECB A;  5DAL B;  2DJK A;  1TRW A;  1YKA A;  3HXS A;  3CTG A;  4F0B A;  5A4U A;  2HT9 A;  1SK2 A;  3FR6 A;  1GUM A;  4WBJ A;  2C4J A;  3M0F A;  3ZLP A;  1WIK A;  5J9C A;  2FA8 A;  1KTE A;  3CTF A;  3E3E A;  3D5J A;  3TKS C;  3TB2 A;  5HR0 A;  1ERU A;  2FGX A;  4Q5N A;  2EIR A;  4G0L A;  3GIX A;  3RDW A;  5AN1 A;  4EC0 A;  2LJA A;  3KCM A;  4X1U A;  4QQ7 A;  2A4V A;  3PPU A;  4I8B A;  3UIW A;  2GZZ A;  2R5G A;  5ECR B;  1S3A A;  2ZCT A;  3TGZ A;  2CV4 A;  2H6X A;  2X64 A;  1K0M A;  3ZRE A;  3HZ4 A;  2LJK A;  4PUR A;  2OE3 A;  1XXU A;  1XVW A;  3O6T A;  4ZB6 A;  3L0H A;  2KHP A;  4I2U A;  2WDU A;  2IMI A;  2QGV A;  2F3M A;  3QFB C;  1GTI A;  5DAK B;  4LA1 A;  1YEX A;  2HSM B;  1THO A;  3P90 A;  1IYI A;  1HNB A;  2I3Y A;  1GUL A;  4KW6 A;  1GNW A;  2FD3 A;  4EF0 A;  4ID0 A;  1GTB A;  2NVL A;  2N5F A;  3D21 A;  1XBS A;  2L5O A;  1BQ7 A;  4EDZ A;  3ZTL A;  1TRU A;  1MDJ A;  1GH2 A;  4AJ7 A;  5B8A A;  3GRX A;  2VCQ A;  6GSS A;  1O73 A;  2YOI A;  4ZIJ A;  3DRN A;  3MNG A;  2LV3 A;  3H93 A;  1X5D A;  2F9S A;  2PUK C;  1V98 A;  3WD6 A;  1M0U A;  2MBS A;  4MJA A;  2B5E A;  3KMN A;  4MDC A;  4I5Q A;  3U6V A;  2PMT A;  2UZ8 A;  4IP6 A;  5CRD A;  3VK9 A;  5ECI B;  5A5K A;  4DSR A;  2WJU A;  2PVO C;  3N9J A;  1THX A;  4ILF A;  2LJR A;  1PMT A;  4ZIL A;  1XW5 A;  1K3Y A;  4NHZ A;  2LST A;  2VL2 A;  2R37 A;  4PUA A;  5E59 A;  3RAZ A;  4KDU A;  2RM5 A;  4ISD A;  2VL9 A;  2ES7 A;  1XIY A;  2L59 A;  5ECP B;  19GS A;  3QAG A;  2HSM A;  1PL1 A;  2L57 A;  3QOU A;  3O76 A;  2IJY A;  4IQ1 A;  3DVX A;  4GWR A;  4G0I A;  3UMA A;  2EIO A;  1TK0 B;  1V57 A;  1YF1 A;  4KB3 A;  1XWA A;  2PGT A;  3GSS A;  3DXB A;  3E0U A;  4TN8 A;  2H30 A;  2H19 A;  3CRT A;  2JAC A;  3GX8 A;  3A2V A;  3QFA C;  4WR4 A;  3KEB A;  2KOK A;  3GX0 A;  4GLT A;  2RM6 A;  2HZE B;  4MA9 A;  2LRN A;  4XHM A;  2FWF A;  2WB9 A;  2YV7 A;  4MH2 A;  4XS4 B;  2V1M A;  4TR3 A;  4YQU A;  5G1L A;  3L9U A;  4HOJ A;  4MF5 A;  2IFQ B;  4NPB A;  2P0G A;  4KAE A;  4YAP A;  1SL2 B;  2C0G A;  3PGT A;  5BMU A;  3M9J A;  3KH9 A;  4IQA A;  2GST A;  4AF2 A;  1X9S B;  5DBQ A;  3RBT A;  2OKA A;  2CAI A;  2PU9 C;  4J2F A;  5GST A;  1F9M A;  3P7X A;  1A24 A;  5DJL A;  2VOC A;  3GL5 A;  5G2Z A;  3L4N A;  2PER A;  4K7I A;  4ZB8 A;  2O8V B;  2HE3 A;  3F9U A;  5ECN B;  3IAS 2;  3GFK A;  2L6C A;  3M9K A;  4MF7 A;  1WPI A;  2C3Q A;  6GSV A;  4TXO B;  3GH6 A;  1W4V A;  3ERG A;  5IO2 A;  2C0E A;  5EY6 A;  4RQR A;  1OC8 A;  5CRE A;  2LEG A;  1S3D A;  4KND A;  2CX3 A;  4KA0 A;  3DWV A;  5HR1 A;  2IPA A;  1ZYQ B;  2L4Q A;  2YWI A;  3H4K A;  1QMV A;  1AW9 A;  4LLR A;  1T00 A;  2GVP A;  3TKR A;  4O32 A;  3GTU A;  2IWT A;  3F6F A;  4LL1 B;  2HZE A;  3TKS A;  1B9X C;  1YDK A;  4D73 A;  3QD9 A;  3I69 A;  2VCZ A;  3DVW A;  1TI3 A;  4XS4 A;  2ZNM A;  5ECL B;  1EP8 A;  4DEJ A;  4EO3 A;  1KEB A;  2VD1 A;  1X5E A;  3BD2 A;  3QPM A;  2HXK A;  2IFQ A;  3H8Q A;  1ZMA A;  1GSD A;  2XBQ A;  4HZ4 A;  3J7Y b;  3ME7 A;  1O8X A;  1WWJ A;  1ZGN A;  4OFN A;  3GV1 A;  1MD3 A;  1GP1 A;  3VI5 A;  2YNX A;  4YAV A;  1F37 A;  3KP8 A;  1M2B A;  3WT1 A;  5D93 A;  4EKZ A;  4Z7X A;  1J9B A;  2KUC A;  2J23 A;  1PKZ A;  2CVB A;  4IVF A;  2RII A;  4TXO A;  1SKW B;  4BA7 A;  3ZIJ A;  4ZBB A;  2CZ3 A;  3DYR A;  2FA4 A;  1AUC A;  4PXO A;  4ECI A;  2H0I A;  1E2Y A;  9GSS A;  4NXI A;  1YKC A;  5D9T A;  1SKS B;  3JCM L;  1TU8 A;  4NHW A;  1QQ2 A;  1YF0 A;  1FB6 A;  2F8F A;  4MJC A;  4H86 A;  2E2G A;  3VFI A;  4J56 E;  5IMA A;  2I9H A;  2LS5 A;  1GWC A;  4YQM A;  3ZIT A;  1XW9 A;  1SEN A;  4FYC A;  4HQZ A;  2GQL A;  1C72 A;  3F6D A;  4F03 A;  1VF2 A;  1TXX A;  1F3B A;  1NW2 A;  1M2A A;  5IOW A;  2YWN A;  2EC4 A;  1EEM A;  1O6J A;  4OWY A;  4ML6 A;  4L5O A;  1SYX A;  1TRS A;  2IMD A;  4CW9 A;  4GST A;  4TR1 B;  3N5O A;  2VL2 C;  3SBC A;  2DML A;  2AAW A;  3HCZ A;  3HVS A;  1N8J A;  2ALB A;  4BPY A;  1DE1 A;  5ABR A;  2OE0 A;  1SKR B;  4DVC A;  1MD4 A;  2TRC P;  1ABA A;  3ZRD A;  1SL1 B;  3LJR A;  3LGC A;  1FOV A;  3IDV A;  2M72 A;  1Q4J A;  2OAD A;  5LCZ A;  2GGT A;  5H5R A;  4ACS A;  2OE1 A;  2VL3 A;  4ECJ A;  1FO5 A;  5B8B A;  4FQU A;  3ED3 A;  1J0F A;  1B8X A;  2CVD A;  5J3R A;  1HQO A;  3IHQ A;  4IEL A;  2H1A A;  2G2Q A;  3GA4 A;  4IW9 A;  3CSH A;  4K7O A;  3W8J A;  4TKY A;  5COH A;  4HZ2 A;  2GT6 A;  5FT3 A;  16GS A;  2A2S A;  1SK1 A;  1FG4 A;  1BYE A;  4CHS A;  2YAN A;  2HFD A;  2HSH A;  1F6M C;  4HEA 2;  4IHU A;  1IYH A;  1I5G A;  3TJG A;  2C8U A;  3EU4 A;  2IME A;  1Q98 A;  5J4U A;  2J9H A;  4K1F A;  4MK3 A;  4TR1 A;  1R5A A;  2VLU A;  5C04 A;  2MMN A;  2HRN A;  3LSZ A;  2MYG A;  2DJ1 A;  2JL4 A;  5CNW A;  4E8H A;  4WF5 A;  1ZZY A;  3FY7 A;  4ZL7 A;  1ZOF A;  2P5R A;  1B4P A;  4K0N A;  3ZVJ A;  3KP9 A;  2PWJ A;  1K0A A;  3IK9 A;  1V40 A;  1FAA A;  3EC3 A;  5AIS A;  3A2W A;  1CQG A;  3CBU A;  5D9X A;  2L5L A;  1XWC A;  4FH8 A;  3W8S A;  1GUK A;  2X8C A;  3TOU A;  3IPZ A;  1PGT A;  3F4R A;  4GSN A;  4N10 A;  4BVX A;  1R5P A;  3G7J A;  1RQM A;  3US3 A;  1Z5Y E;  2R2J A;  2LNS A;  1X9M B;  1SU9 A;  3Q6O A;  3GUR A;  4ZBD A;  2H0G A;  2O87 A;  3LWA A;  2PBJ A;  3GN3 A;  5G1K A;  4MZC A;  1OKD A;  2XC2 A;  1BJX A;  3FRC A;  3HD5 A;  2B5X A;  3SWL A;  4NV5 A;  3HHV A;  3RHB A;  2MMA A;  1MDI A;  3TDG A;  2XPD A;  2H1B A;  4KGI A;  1TI1 A;  1TW9 A;  5CRG A;  1LBK A;  2YWM A;  4P3Y B;  5IMC A;  1GSS A;  2I1U A;  2GLR A;  2IMK A;  2I81 A;  2VIM A;  1F3A A;  3UBK A;  1TDI A;  8GSS A;  3C8E A;  3ISO A;  1RK4 A;  1U3I A;  5C00 A;  2RUF A;  1QFN A;  1BG5 A;  3RPN A;  4ZL8 A;  3VWW A;  1NM3 A;  1F2E A;  5EL8 A;  2V41 A;  3FZ9 A;  1WP0 A;  4J57 E;  2R6K A;  3KJY A;  1YQ1 A;  3LG6 A;  1O8W A;  5IMZ A;  4GCI A;  3EVI A;  5DCH A;  1A8Y A;  2V6K A;  4IN0 A;  5GAP D;  4OD7 A;  4OFT A;  2H6Y A;  3D6I A;  3G7Y A;  1A0F A;  3D4M A;  4PTS A;  3IC8 A;  2H0H A;  4I2T A;  3KZQ A;  2OAC A;  5G31 A;  5KN3 A;  4N0V A;  1AIU A;  1AAZ A;  4V2N A;  3M1G A;  1GNE A;  4OCF A;  5B7C A;  5G5E A;  5IQY A;  3HVV A;  3L9V A;  3GMF A;  3IRA A;  2DLX A;  4G2E A;  3LXT A;  3G7I A;  1WMJ A;  4V2M A;  3ZZX A;  2HSY A;  2CT6 A;  3UOM A;  4LMV A;  4POM A;  4PQH A;  3Q19 A;  5JWO B;  1TRV A;  3LYK A;  2OBI A;  2H8L A;  1AQW A;  1JZO A;  2WGR A;  3L78 A;  1QGV A;  4DSQ A;  1ON4 A;  3VLN A;  1HNC A;  2XHF A;  5ECM B;  1PA3 A;  4TVE A;  3FZA A;  3F3R A;  2KP2 A;  4BL7 B;  4JR4 A;  1ZYE A;  2JZR A;  1K0N A;  2H6Z A;  1PX6 A;  11GS A;  1A8L A;  4WKW A;  1SD9 A;  2H01 A;  5J41 A;  2HSN B;  4PX1 A;  3GTU B;  2AJQ B;  2LRC A;  1PQN A;  4TOP A;  3EMP A;  5JWR B;  3UBL A;  1U88 A;  4D73 B;  2C0F A;  2NPB A;  5H5S A;  1G6W A;  3DD3 A;  4Q5Q A;  1YEP A;  5DQY A;  4PGT A;  5L71 A;  2JU5 A;  1K0D A;  1I9D A;  2WS2 A;  5H5Q A;  1U87 A;  4XCS A;  3VPQ A;  5LD0 A;  2DJ0 A;  5KN2 A;  4KCE A;  2FWE A;  4OMV A;  2R3X A;  2DJ2 A;  4FIW A;  2F8A A;  2IIY A;  3TJB A;  3LYP A;  4RI7 A;  3KD0 A;  3ERW A;  3RPP A;  4X43 A;  3EYT A;  5CRW A;  2WRT A;  3VI7 A;  2AUV A;  1ML6 A;  1BAY A;  2VCT A;  1A2L A;  3MDK A;  1EGR A;  2GSQ A;  3ZML A;  2D2Z A;  1TU7 A;  1NHO A;  4TW5 A;  2AV4 A;  3TJK A;  5ID2 B;  3IBH A;  2JSZ A;  2AB6 A;  3QCP A;  1URM A;  1VF1 A;  3F0I A;  5ECQ B;  3GHA A;  2IL3 A;  3R3E A;  2MMO A;  4BWS A;  4BL7 A;  3C73 A;  3KGK A;  2VD0 A;  2FCH A;  2PN8 A;  1Y25 A;  2P5Q A;  4IJI A;  2VCV A;  5JCG A;  1PX7 A;  3HZ8 A;  1ERT A;  2GSS A;  1YZX A;  4K0G A;  4O92 A;  4HQS A;  3CRU A;  3Q74 A;  1X0R A;  2R4V A;  2PPT A;  5HR2 A;  2GT5 A;  2DIY A;  2LNT A;  3TRX A;  2YJH A;  2B6M A;  2QKE A; 
#chains in the Genus database with same CATH topology
 2VLT A;  3ZL5 A;  4BIK A;  3DML A;  1G0T A;  2GDR A;  2CVK A;  2EFC A;  1MTC A;  3TJF A;  2B1K A;  2CQ9 A;  2VUP A;  3ZVJ D;  4HUA A;  1OKT A;  4K5S A;  3GKX A;  1SJI A;  3HA9 A;  2YV9 A;  3KH7 A;  5HR3 A;  1GLP A;  2L6D A;  1XW6 A;  1RW1 A;  2C80 A;  3BJ5 A;  2HRA A;  2OBK A;  3QMX A;  1PFO A;  4N11 A;  1X9W B;  5D9W A;  4MCU A;  2B7J A;  3HJM A;  5J5N A;  3GYK A;  1EEJ A;  3ERF A;  4WEY A;  1KNG A;  5IOX A;  3APO A;  4GSS A;  1A2J A;  5ID2 A;  7GSS A;  3IA1 A;  1BED A;  4QL9 A;  3EIN A;  4DSS B;  4RI6 A;  1T7P B;  4KH7 A;  1K3L A;  4WF4 A;  4G0K A;  2B5Y A;  1Y1U A;  5EVO A;  1OC9 B;  1HNA A;  3IR4 A;  2HNL A;  1VF3 A;  4HJ2 A;  3WGD A;  5EPF A;  4ZL9 A;  4GDF A;  3FK8 A;  3H79 A;  1TK5 B;  3E9J B;  5DDL A;  3U5R E;  3VPT A;  4KCA A;  2VM1 A;  5IMV A;  2GQK A;  4MPG A;  4NAX A;  2H71 A;  1YY7 A;  3CSI A;  2DJ3 A;  4Z2U A;  2YJ7 A;  2DC5 A;  2ON5 A;  5B6M A;  1PD2 1;  4N3Z A;  4E8E A;  3DGQ A;  4JR6 A;  3J7Y k;  3VWX A;  1TKD B;  2B1L A;  4PNG A;  2K6V A;  1LU4 A;  4GXZ A;  1A23 A;  1GLQ A;  3LOR A;  3HJO A;  5DJM A;  4MJB A;  3ZFB A;  2GQM A;  4MJE A;  1XOA A;  1PN9 A;  3BCI A;  1EP7 A;  3C1R A;  2O85 A;  1H4O A;  4NWY A;  3MAK A;  5KN0 A;  1HD2 A;  4RUV A;  1V58 A;  2LKU A;  4KE3 A;  1TJD A;  2ON7 A;  3KIJ A;  3ME8 A;  4KUN A;  2C0D A;  1N25 A;  3GST A;  4ZB7 A;  4DSS A;  3OR5 A;  1PKW A;  2E7P A;  3BBY A;  5LNK e;  3O3T A;  1B48 A;  3QAV A;  4ZBA A;  3UVT A;  2H72 A;  2FLS A;  1SVO A;  1SJZ A;  1OC9 A;  2X4A A;  3IE3 A;  3FHK A;  3UAP A;  4TR4 A;  2VCW A;  4BVX B;  4EE0 A;  4BWQ A;  4I97 A;  1SVM A;  1XG8 A;  3QDN A;  3GKM A;  1ILO A;  1JHB A;  2AHE A;  1Z7P A;  1XWB A;  1UN2 A;  1G7E A;  1BX9 A;  3HVN A;  1Z9H A;  2HRK B;  1USB A;  6GSY A;  4GF0 A;  4JU5 A;  2HRF A;  2A2P A;  3I43 A;  3EPT A;  3FKF A;  3AY8 A;  3PIN A;  4L0W A;  3BCK A;  4F0C A;  1DE2 A;  1Z3E A;  1GTU A;  4IKH A;  3A3T A;  3IOS A;  3GKK A;  1GSE A;  4KF9 A;  3LEF A;  1M3J A;  2MMZ A;  1J08 A;  2N5B A;  1YEW C;  2FY6 A;  2B7K A;  18GS A;  2QSI A;  4AKG A;  5HFG A;  2ZUP A;  1A2M A;  3KTL A;  3F8U A;  5F07 A;  3LFL A;  3MSZ A;  3UVH A;  1EGO A;  5DCG A;  1ZL9 A;  1M9B A;  3C1S A;  2H1D A;  3DKS A;  4EUY A;  3TJJ A;  4KX4 A;  2R0P A;  3FMW A;  1DUG A;  2NBS A;  4K8M A;  3F63 A;  5ECS A;  4PUF C;  3RHC A;  4KSO A;  1OVN A;  1M2D A;  4IGJ A;  2FWG A;  5F06 A;  2GS3 A;  1DBY A;  5GAN D;  1JFU A;  4IJ3 A;  2RUE A;  2HRK A;  2WVY A;  1FB0 A;  2FHE A;  1M7T A;  2MBT A;  2VAF A;  2JZT A;  5ECO B;  1WJK A;  2HI7 A;  1JLV A;  4HS1 A;  3HDC A;  1UA5 A;  2GZP A;  2DMM A;  2E2M A;  1Y6E A;  5AGY A;  4NV2 A;  3I6A A;  1VGL A;  12GS A;  4O5R A;  4YQV A;  3EUR A;  4MNN A;  3D4T A;  2WCI A;  3TKS E;  3IK7 A;  1K0C A;  20GS A;  4Q5F A;  1CQH A;  2QC7 A;  3WGX A;  1XFL A;  5IMD A;  2VKZ G;  3APS A;  3CXG A;  2NTO A;  4AJ6 A;  3A5W A;  4I6X A;  2XPE A;  3FZ5 A;  2X8G A;  2WW1 A;  3L9S A;  4QL7 A;  2REM A;  2YWO A;  3WT2 A;  3HYP A;  3UJ1 A;  1T1V A;  1XOB A;  1ACV A;  2O7K A;  3IAM 2;  3NIV A;  4JBB A;  3R2Q A;  3CMI A;  1K0O A;  2YZH A;  1GTA A;  1XWG A;  1EOH A;  5F05 A;  5DAL A;  3DIE A;  4FYU A;  4HJM A;  2O5V A;  4POL A;  1ZCP A;  1OC3 A;  4Q5R A;  1O85 A;  5JWQ B;  1OE8 A;  2DSA A;  2CAQ A;  1XPV A;  3FZ4 A;  3CYN A;  1FVK A;  4JZQ A;  4K9Z A;  4ICY A;  3VWV A;  4ECC A;  5HQP A;  3S9F A;  3KXO A;  1YVL A;  2F51 A;  4JRR A;  4MLY A;  5CAX A;  5A4W A;  2H75 A;  4N30 A;  3QR6 A;  1M9A A;  5KN1 A;  3F4S A;  5AIX A;  1T4Z A;  2K8S A;  3F3Q A;  1T8E B;  2LRT A;  4HSC X;  6GSW A;  4GRF A;  4HDE A;  1U6T A;  5F8B A;  1SJ6 A;  4XTS A;  4OCE A;  2GSR A;  1KBN A;  3ZMK A;  2HQT A;  4F9Z A;  2I4A A;  4E68 A;  4N0Z A;  2KP1 A;  4CY6 A;  3PR8 A;  2YZU A;  4IBP A;  1TK8 B;  2C3T A;  1Z7R A;  3LXZ A;  2QA2 A;  3HY2 A;  5D9V A;  1Z6N A;  4CDO A;  2H73 A;  4PNF A;  4O5U A;  1EWX A;  1QXH A;  2WZ9 A;  1T3B A;  2TRX A;  5DAK A;  3IV4 A;  4L0U A;  4WET A;  4GTU A;  1MDK A;  5GZZ B;  2GZY A;  1ERV A;  4O7H A;  4PQI A;  2VLV A;  2WW2 A;  5HFK A;  1VRS D;  1O7U A;  3UL3 A;  6GST A;  3TCO A;  4G01 A;  4GQF A;  5INY A;  3K8N A;  2HLS A;  3TRQ A;  5D8I A;  1PSQ A;  3VUR A;  2PVQ A;  2EFD A;  4F2I A;  1NHY A;  4POB A;  1EOG A;  4K2D A;  4GQC A;  4L5L A;  2H66 A;  3G9B A;  1WRY A;  1ERW A;  1VF4 A;  3GKN A;  2IN3 A;  4G10 A;  3C7M A;  14GS A;  1QK8 A;  1X5C A;  2TIR A;  3LW9 A;  4TRX A;  5ELA A;  2VCX A;  3CWG A;  4USS A;  2HYX A;  5G30 A;  4L8E A;  3LQ7 A;  2N5A A;  2E0Q A;  5JCW A;  5HFI A;  5JCU A;  2IMF A;  3BOA A;  3ZIV A;  2DJJ A;  2YN1 A;  2AYT A;  1SL0 B;  3GNJ A;  4LMW A;  4MF6 A;  1FOH A;  3EU3 A;  3WYW A;  2B3S A;  4V1A g;  2DKI A;  5IM9 A;  1GL8 A;  2X99 A;  4YH2 A;  5G5F A;  4TXV A;  2L4C A;  5FHI A;  2CZ2 A;  5D96 A;  1JZR A;  2LQO A;  2A2R A;  2M80 A;  4IS0 A;  2V6O A;  3M8N A;  3NZN A;  4OO5 A;  1QUW A;  4ML1 A;  5KOW A;  3D22 A;  2K9F A;  3P2A A;  3TRP A;  5IO0 A;  1UVZ A;  1O81 A;  2WFC A;  4FYB A;  5J4V A;  5CRH A;  1S3C A;  4PI2 C;  2HZF A;  3TKP A;  1DSB A;  3GUS A;  1T4Y A;  1TOF A;  5IPG A;  4WBR D;  3D0Z A;  5ENU A;  1R4W A;  4XRD A;  10GS A;  1G7O A;  5CO3 A;  17GS A;  3UAR A;  2H76 A;  4HU7 A;  3TKQ A;  1AQX A;  4FO5 A;  1ST9 A;  1EZK A;  1OE7 A;  1K3O A;  4F82 A;  1XZO A;  2JSY A;  2DBC A;  4XS1 A;  2LQQ A;  2V32 A;  1XWK A;  1OAZ A;  2YP6 A;  2K8V A;  2C3N A;  3DEX A;  1GSY A;  4MP4 A;  1TP9 A;  3ZYW A;  4G19 A;  3MIX A;  1PL2 A;  5CP1 A;  4KDX A;  3A2X A;  2H70 A;  1B4Q A;  1JZD A;  4MMM A;  1AQV A;  3FR9 A;  1SD8 A;  2JAD A;  4AJ8 A;  3FR3 A;  4EVM A;  4K6X A;  1GSF A;  5E4W A;  3PH9 A;  3ZFL A;  1Z6M A;  4XRA A;  1FW1 A;  4MAB A;  1K0B A;  3IXR A;  4ZB9 A;  22GS A;  1PN0 A;  4OO4 A;  4HU9 A;  2P31 A;  4EDY A;  3FEU A;  4HI7 A;  1U3A A;  1MEK A;  3IC4 A;  1N2A A;  2LUS A;  1GRX A;  3M3M A;  2YPM A;  2FUG 2;  1NSW A;  3MYD A;  4MH3 A;  4V1A p;  4EXJ A;  4AKH A;  5CYY A;  4G9H A;  3HVX A;  4BVY B;  5DVB A;  3TOT A;  5IIZ A;  2BMX A;  3WGE A;  1FHE A;  2Z9S A;  3GH9 A;  2X49 A;  5AIV A;  5J9B A;  5ECK B;  3FW2 A;  2KLX A;  5FWG A;  2CX4 A;  4WR5 A;  2V2G A;  3TU3 B;  1JLW A;  2H1G A;  2DIZ A;  5B6N A;  1B9Y C;  5A5H A;  1GSU A;  1SYR A;  5IPH A;  6GSU A;  2CA8 A;  3P8W A;  3Q18 A;  4CY8 A;  3KMO A;  4OFM A;  4JED A;  2VM2 A;  1V2A A;  4MPF A;  3V1W A;  4KSM A;  2FNO A;  3QAW A;  4POK A;  1M99 A;  1XVQ A;  5D73 A;  4Z2R A;  3F4T A;  3HKR A;  1V9W A;  1GUH A;  3KTB A;  5ECH B;  2M46 A;  2O89 A;  3CSJ A;  1W89 A;  6GSX A;  2MZC A;  2O3E A;  3EMX A;  1TTZ A;  1R7H A;  2H74 A;  1GSQ A;  1JZW A;  2WW0 A;  2X8H A;  2GTU A;  2G0F A;  1E6B A;  1FVJ A;  3EWL A;  4XS6 A;  4TR0 A;  1G6Y A;  2VO4 A;  5IMF A;  4BVY A;  2BJX A;  2EIQ A;  4LL4 B;  4X0X A;  3KM6 A;  4ZXG A;  1HYU A;  3I9V 2;  3NOF A;  4WXT A;  5F0G A;  2JZS A;  2NDO A;  4ULX A;  1UC7 A;  2BTO T;  1H75 A;  3APQ A;  4IP1 A;  4MZW A;  1SK0 A;  1XCC A;  2WUL A;  3FYG A;  3RGB C;  4NMU A;  4PQ1 A;  4V2L A;  1OYJ A;  2K18 A;  5GSS A;  5ELG A;  2OJL A;  1R26 A;  2LTK A;  2YCD A;  3W6G A;  4KDY A;  2OA7 A;  3HJP A;  4EL1 A;  5A34 B;  1WOU A;  4YKG A;  1YJ6 A;  2FWH A;  1WE0 A;  3C71 A;  3H1N A;  1AC1 A;  4JE1 A;  1EV9 A;  4RQX A;  4AGS A;  5A4V A;  1LJR A;  3CHX C;  5KEJ A;  3VWU A;  2RLI A;  1A0R P;  5DQS A;  4XIH A;  1AXD A;  3TUE A;  2XBI A;  1EV4 A;  13GS A;  4K7N A;  3UEM A;  1PRX A;  4MZB A;  3GL3 A;  3MWH A;  2C1Y A;  3EE2 A;  4ECB A;  2DKH A;  5DAL B;  2DJK A;  2O36 A;  1TRW A;  1YKA A;  3HXS A;  3CTG A;  4F0B A;  5A4U A;  2HT9 A;  1SK2 A;  4O5Q A;  3FR6 A;  1GUM A;  4WBJ A;  2C4J A;  3M0F A;  3ZLP A;  1WIK A;  5J9C A;  2FA8 A;  4AKI A;  1KTE A;  3CTF A;  3E3E A;  3D5J A;  3TKS C;  3TB2 A;  5HR0 A;  1ERU A;  2FGX A;  4Q5N A;  2EIR A;  4G0L A;  3GIX A;  3RDW A;  5AN1 A;  4EC0 A;  2LJA A;  3KCM A;  4X1U A;  4QQ7 A;  2A4V A;  3PPU A;  4I8B A;  3UIW A;  2GZZ A;  2R5G A;  5ECR B;  1S3A A;  2ZCT A;  3TGZ A;  2CV4 A;  2H6X A;  2R0G A;  2X64 A;  1K0M A;  3ZRE A;  3HZ4 A;  1ZYP A;  2LJK A;  4PUR A;  5A34 A;  2OE3 A;  1XXU A;  1XVW A;  3O6T A;  4ZB6 A;  4FXY P;  3L0H A;  2KHP A;  4I2U A;  2WDU A;  2IMI A;  2QGV A;  2F3M A;  3QFB C;  1GTI A;  5DAK B;  4LA1 A;  1YEX A;  2HSM B;  4PI0 C;  1THO A;  3P90 A;  1IYI A;  1HNB A;  2I3Y A;  1GUL A;  4KW6 A;  1S4B P;  1GNW A;  2FD3 A;  4EF0 A;  4ID0 A;  1GTB A;  2NVL A;  2N5F A;  3D21 A;  1XBS A;  2L5O A;  1BQ7 A;  4EDZ A;  3ZTL A;  1TRU A;  4K5R A;  1MDJ A;  1GH2 A;  4AJ7 A;  5B8A A;  3GRX A;  2VCQ A;  6GSS A;  1O73 A;  2YOI A;  4ZIJ A;  3DRN A;  3MNG A;  2LV3 A;  3H93 A;  1X5D A;  2F9S A;  2PUK C;  1V98 A;  3WD6 A;  1M0U A;  2MBS A;  4MJA A;  2B5E A;  3KMN A;  4MDC A;  4I5Q A;  3U6V A;  2PMT A;  2UZ8 A;  4IP6 A;  5CRD A;  3VK9 A;  4A5P A;  5ECI B;  5A5K A;  4DSR A;  2WJU A;  2PVO C;  3N9J A;  1THX A;  4ILF A;  2LJR A;  1PMT A;  4ZIL A;  1XW5 A;  1K3Y A;  4NHZ A;  2LST A;  4W66 A;  2VL2 A;  2R37 A;  4PUA A;  5E59 A;  3RAZ A;  4KDU A;  2RM5 A;  4ISD A;  2VL9 A;  2EFE A;  2ES7 A;  1XIY A;  2L59 A;  5ECP B;  2WZS A;  19GS A;  3QAG A;  2HSM A;  1PL1 A;  2L57 A;  3QOU A;  3O76 A;  2IJY A;  4IQ1 A;  3DVX A;  4GWR A;  4X4J A;  4G0I A;  3UMA A;  2EIO A;  1TK0 B;  1V57 A;  1YF1 A;  4KB3 A;  1XWA A;  2PGT A;  5KOX A;  3GSS A;  1ZYN A;  3DXB A;  3E0U A;  4TN8 A;  2H30 A;  2H19 A;  3CRT A;  2JAC A;  4Z2T A;  2R0C A;  3GX8 A;  3RFR C;  3A2V A;  3QFA C;  4WR4 A;  3KEB A;  2KOK A;  3GX0 A;  4GLT A;  2RM6 A;  2HZE B;  2WVZ A;  4MA9 A;  2LRN A;  4XHM A;  2FWF A;  2WB9 A;  2YV7 A;  2UV8 G;  4MH2 A;  4XS4 B;  2V1M A;  4TR3 A;  4YQU A;  5G1L A;  3L9U A;  4HOJ A;  4MF5 A;  2IFQ B;  4NPB A;  2P0G A;  4KAE A;  4YAP A;  1SL2 B;  2C0G A;  3PGT A;  5BMU A;  3M9J A;  3KH9 A;  4IQA A;  2GST A;  4AF2 A;  1X9S B;  5DBQ A;  3RBT A;  2OKA A;  2CAI A;  2PU9 C;  4J2F A;  5GST A;  1F9M A;  3P7X A;  1A24 A;  5DJL A;  2VOC A;  3GL5 A;  5G2Z A;  3L4N A;  2PER A;  4K7I A;  4ZB8 A;  2O8V B;  2HE3 A;  3F9U A;  5ECN B;  3IAS 2;  3GFK A;  2L6C A;  3M9K A;  5J40 A;  4MF7 A;  1WPI A;  2C3Q A;  6GSV A;  4TXO B;  3GH6 A;  1W4V A;  3ERG A;  5IO2 A;  2C0E A;  5EY6 A;  4RQR A;  1OC8 A;  5CRE A;  2LEG A;  1S3D A;  4EIQ A;  4KND A;  2CX3 A;  4KA0 A;  3DWV A;  5HR1 A;  3CQF A;  2IPA A;  1ZYQ B;  2L4Q A;  2YWI A;  3H4K A;  2OT3 A;  1QMV A;  1AW9 A;  4LLR A;  1T00 A;  2GVP A;  3TKR A;  4O32 A;  2HSN A;  3GTU A;  2IWT A;  3F6F A;  4LL1 B;  2HZE A;  3TKS A;  1B9X C;  1YDK A;  4D73 A;  3QD9 A;  3I69 A;  2VCZ A;  3DVW A;  1TI3 A;  4XS4 A;  2ZNM A;  5ECL B;  1EP8 A;  4DEJ A;  4EO3 A;  1KEB A;  2VD1 A;  1X5E A;  3BD2 A;  3QPM A;  2HXK A;  2IFQ A;  3H8Q A;  1ZMA A;  1GSD A;  2XBQ A;  4HZ4 A;  5A5H B;  3J7Y b;  3ME7 A;  1O8X A;  1WWJ A;  1ZGN A;  3IHG A;  4OFN A;  3GV1 A;  1MD3 A;  1GP1 A;  3VI5 A;  2YNX A;  4YAV A;  1F37 A;  3KP8 A;  1M2B A;  3WT1 A;  5D93 A;  4EKZ A;  4Z7X A;  1J9B A;  2KUC A;  2J23 A;  1PKZ A;  2CVB A;  4IVF A;  2RII A;  4TXO A;  1SKW B;  4BA7 A;  3ZIJ A;  4ZBB A;  2CZ3 A;  3DYR A;  2FA4 A;  1AUC A;  4PXO A;  4ECI A;  2H0I A;  1E2Y A;  9GSS A;  2WW3 A;  4NXI A;  1YKC A;  5D9T A;  1SKS B;  3JCM L;  1TU8 A;  4NHW A;  1QQ2 A;  4PHZ C;  1YF0 A;  1FB6 A;  2F8F A;  4MJC A;  4H86 A;  2E2G A;  4EIP A;  3VFI A;  4J56 E;  5J4Y A;  5IMA A;  2I9H A;  2LS5 A;  1GWC A;  4YQM A;  3ZIT A;  1XW9 A;  1SEN A;  5J47 A;  4FYC A;  4HQZ A;  2GQL A;  1C72 A;  2H1L A;  3F6D A;  4F03 A;  1VF2 A;  1TXX A;  1F3B A;  2EFH A;  1NW2 A;  1M2A A;  5IOW A;  2YWN A;  2EC4 A;  1EEM A;  1O6J A;  4OWY A;  4ML6 A;  4L5O A;  1SYX A;  4K2X A;  1TRS A;  2IMD A;  4CW9 A;  4GST A;  4TR1 B;  3N5O A;  2VL2 C;  3SBC A;  2DML A;  2A4H A;  2AAW A;  3HCZ A;  3HVS A;  1N8J A;  2ALB A;  4BPY A;  1DE1 A;  5ABR A;  2OE0 A;  1SKR B;  4DVC A;  1MD4 A;  2WVX B;  2TRC P;  1ABA A;  3ZRD A;  1SL1 B;  3LJR A;  3LGC A;  1FOV A;  3IDV A;  2M72 A;  1Q4J A;  2OAD A;  5LCZ A;  2GGT A;  5H5R A;  4ACS A;  2OE1 A;  2VL3 A;  4ECJ A;  1FO5 A;  4YKF A;  5B8B A;  4FQU A;  3ED3 A;  1J0F A;  1B8X A;  2CVD A;  5J3R A;  1HQO A;  3IHQ A;  4IEL A;  2H1A A;  2G2Q A;  3GA4 A;  4IW9 A;  3CSH A;  4K7O A;  3W8J A;  4TKY A;  5COH A;  4HZ2 A;  2GT6 A;  5FT3 A;  16GS A;  2A2S A;  1SK1 A;  1FG4 A;  1BYE A;  4CHS A;  2YAN A;  2HFD A;  2HSH A;  1F6M C;  4HEA 2;  4IHU A;  1IYH A;  1I5G A;  3TJG A;  2C8U A;  3EU4 A;  2IME A;  1Q98 A;  5J4U A;  2J9H A;  4K1F A;  4MK3 A;  4TR1 A;  1R5A A;  2VLU A;  5C04 A;  2MMN A;  2HRN A;  3LSZ A;  2MYG A;  2DJ1 A;  2JL4 A;  5CNW A;  4E8H A;  1SVL A;  4WF5 A;  1ZZY A;  3FY7 A;  4ZL7 A;  1ZOF A;  2P5R A;  1B4P A;  4K0N A;  3ZVJ A;  5A1N B;  3KP9 A;  4AI6 A;  2WVX A;  2PWJ A;  1K0A A;  3IK9 A;  1V40 A;  1FAA A;  3EC3 A;  5AIS A;  3A2W A;  1CQG A;  3CBU A;  5D9X A;  2L5L A;  1XWC A;  4FH8 A;  3W8S A;  1GUK A;  2X8C A;  3TOU A;  3IPZ A;  1PGT A;  3F4R A;  4GSN A;  4N10 A;  4BVX A;  1R5P A;  3G7J A;  1RQM A;  3US3 A;  1Z5Y E;  2R2J A;  2LNS A;  1X9M B;  1SU9 A;  3Q6O A;  3GUR A;  4ZBD A;  2H0G A;  2O87 A;  3LWA A;  2PBJ A;  3GN3 A;  5G1K A;  4MZC A;  1OKD A;  2XC2 A;  1BJX A;  3FRC A;  3HD5 A;  2B5X A;  3SWL A;  4NV5 A;  3HHV A;  3RHB A;  2MMA A;  1MDI A;  3TDG A;  2XPD A;  2H1B A;  4KGI A;  1TI1 A;  1TW9 A;  5CRG A;  1LBK A;  2YWM A;  4P3Y B;  5IMC A;  1GSS A;  2I1U A;  2GLR A;  2IMK A;  2I81 A;  2VIM A;  1F3A A;  3UBK A;  1TDI A;  1BF5 A;  8GSS A;  3C8E A;  3ISO A;  1RK4 A;  1U3I A;  5C00 A;  2RUF A;  1QFN A;  1BG5 A;  3RPN A;  4ZL8 A;  3VWW A;  1M3I A;  1NM3 A;  1F2E A;  5EL8 A;  5A1N A;  2V41 A;  3FZ9 A;  1WP0 A;  4J57 E;  2R6K A;  3KJY A;  1YQ1 A;  3LG6 A;  1O8W A;  5IMZ A;  4GCI A;  3EVI A;  5DCH A;  1A8Y A;  2V6K A;  4IN0 A;  5GAP D;  4OD7 A;  4OFT A;  2H6Y A;  3D6I A;  3G7Y A;  1A0F A;  3D4M A;  4PTS A;  3IC8 A;  1BG1 A;  2H0H A;  4I2T A;  3KZQ A;  2OAC A;  5G31 A;  1S3R A;  5KN3 A;  4N0V A;  1AIU A;  5BRT A;  1AAZ A;  1TXU A;  4V2N A;  3M1G A;  1GNE A;  4OCF A;  5B7C A;  5G5E A;  5IQY A;  3HVV A;  3L9V A;  3GMF A;  3IRA A;  2DLX A;  4G2E A;  3LXT A;  3G7I A;  1WMJ A;  4V2M A;  3ZZX A;  5BMU B;  2HSY A;  2CT6 A;  3UOM A;  4LMV A;  4POM A;  4PQH A;  4AKX B;  3Q19 A;  5JWO B;  1TRV A;  3LYK A;  2OBI A;  2H8L A;  1AQW A;  1JZO A;  2WGR A;  3L78 A;  1QGV A;  4DSQ A;  1ON4 A;  3VLN A;  1HNC A;  2XHF A;  5ECM B;  1PA3 A;  4TVE A;  3FZA A;  3F3R A;  2KP2 A;  4BL7 B;  4JR4 A;  1ZYE A;  2JZR A;  1K0N A;  2H6Z A;  1PX6 A;  11GS A;  1A8L A;  4WKW A;  1SD9 A;  2H01 A;  5J41 A;  2HSN B;  3HMJ G;  4PX1 A;  3GTU B;  2AJQ B;  2LRC A;  1PQN A;  4TOP A;  3EMP A;  5JWR B;  3UBL A;  1U88 A;  4D73 B;  2C0F A;  2NPB A;  5H5S A;  1G6W A;  3DD3 A;  4Q5Q A;  1YEP A;  5DQY A;  4PGT A;  5L71 A;  2JU5 A;  1K0D A;  1I9D A;  2WS2 A;  5H5Q A;  1U87 A;  4XCS A;  3VPQ A;  5LD0 A;  2DJ0 A;  5KN2 A;  4KCE A;  2FWE A;  4OMV A;  2R3X A;  2DJ2 A;  4FIW A;  2F8A A;  2IIY A;  3TJB A;  3LYP A;  4RI7 A;  3KD0 A;  4QMK A;  3ERW A;  3RPP A;  4X43 A;  3EYT A;  5CRW A;  2WRT A;  2QA1 A;  3VI7 A;  2AUV A;  1ML6 A;  1BAY A;  2VCT A;  1A2L A;  3MDK A;  1EGR A;  2GSQ A;  3ZML A;  2D2Z A;  1TU7 A;  1NHO A;  4TW5 A;  2AV4 A;  3TJK A;  5ID2 B;  3IBH A;  2JSZ A;  2AB6 A;  3QCP A;  1URM A;  1VF1 A;  3F0I A;  5ECQ B;  3GHA A;  2IL3 A;  3R3E A;  2MMO A;  4BWS A;  4BL7 A;  3A5I A;  3C73 A;  3KGK A;  2VD0 A;  2FCH A;  2PN8 A;  1Y25 A;  2P5Q A;  4IJI A;  2VCV A;  5JCG A;  1PX7 A;  3HZ8 A;  1ERT A;  1I1I P;  2GSS A;  1YZX A;  4K0G A;  4O92 A;  4HQS A;  3CRU A;  3Q74 A;  1X0R A;  2R4V A;  2PPT A;  5HR2 A;  2GT5 A;  2DIY A;  2LNT A;  3TRX A;  2YJH A;  2B6M A;  2QKE A; 
#chains in the Genus database with same CATH homology
 2VLT A;  3ZL5 A;  3DML A;  1G0T A;  2GDR A;  2CVK A;  2EFC A;  1MTC A;  3TJF A;  2B1K A;  2CQ9 A;  2VUP A;  3ZVJ D;  4HUA A;  1OKT A;  4K5S A;  3GKX A;  1SJI A;  3HA9 A;  2YV9 A;  3KH7 A;  5HR3 A;  1GLP A;  2L6D A;  1XW6 A;  1RW1 A;  2C80 A;  3BJ5 A;  2HRA A;  2OBK A;  3QMX A;  4N11 A;  1X9W B;  5D9W A;  4MCU A;  2B7J A;  3HJM A;  5J5N A;  3GYK A;  1EEJ A;  3ERF A;  4WEY A;  1KNG A;  5IOX A;  3APO A;  4GSS A;  1A2J A;  5ID2 A;  7GSS A;  3IA1 A;  1BED A;  4QL9 A;  3EIN A;  4DSS B;  4RI6 A;  1T7P B;  4KH7 A;  1K3L A;  4WF4 A;  4G0K A;  2B5Y A;  1Y1U A;  5EVO A;  1OC9 B;  1HNA A;  3IR4 A;  2HNL A;  1VF3 A;  4HJ2 A;  3WGD A;  5EPF A;  4ZL9 A;  4GDF A;  3FK8 A;  3H79 A;  1TK5 B;  3E9J B;  5DDL A;  3U5R E;  3VPT A;  4KCA A;  2VM1 A;  5IMV A;  2GQK A;  4MPG A;  4NAX A;  2H71 A;  1YY7 A;  3CSI A;  2DJ3 A;  4Z2U A;  2YJ7 A;  2DC5 A;  2ON5 A;  5B6M A;  1PD2 1;  4N3Z A;  4E8E A;  3DGQ A;  4JR6 A;  3J7Y k;  3VWX A;  1TKD B;  2B1L A;  4PNG A;  2K6V A;  1LU4 A;  4GXZ A;  1A23 A;  1GLQ A;  3LOR A;  3HJO A;  5DJM A;  4MJB A;  3ZFB A;  2GQM A;  4MJE A;  1XOA A;  1PN9 A;  3BCI A;  1EP7 A;  3C1R A;  2O85 A;  1H4O A;  4NWY A;  3MAK A;  5KN0 A;  1HD2 A;  4RUV A;  1V58 A;  2LKU A;  4KE3 A;  1TJD A;  2ON7 A;  3KIJ A;  3ME8 A;  4KUN A;  2C0D A;  1N25 A;  3GST A;  4ZB7 A;  4DSS A;  3OR5 A;  1PKW A;  2E7P A;  3BBY A;  5LNK e;  3O3T A;  1B48 A;  3QAV A;  4ZBA A;  3UVT A;  2H72 A;  2FLS A;  1SVO A;  1SJZ A;  1OC9 A;  2X4A A;  3IE3 A;  3FHK A;  3UAP A;  4TR4 A;  2VCW A;  4BVX B;  4EE0 A;  4BWQ A;  4I97 A;  1SVM A;  3QDN A;  3GKM A;  1ILO A;  1JHB A;  2AHE A;  1Z7P A;  1XWB A;  1UN2 A;  1G7E A;  1BX9 A;  1Z9H A;  2HRK B;  1USB A;  6GSY A;  4GF0 A;  4JU5 A;  2HRF A;  2A2P A;  3I43 A;  3EPT A;  3FKF A;  3AY8 A;  3PIN A;  4L0W A;  3BCK A;  4F0C A;  1DE2 A;  1Z3E A;  1GTU A;  4IKH A;  3A3T A;  3IOS A;  3GKK A;  1GSE A;  4KF9 A;  3LEF A;  2MMZ A;  1J08 A;  2N5B A;  2FY6 A;  2B7K A;  18GS A;  2QSI A;  4AKG A;  5HFG A;  2ZUP A;  1A2M A;  3KTL A;  3F8U A;  5F07 A;  3LFL A;  3MSZ A;  3UVH A;  1EGO A;  5DCG A;  1ZL9 A;  1M9B A;  3C1S A;  2H1D A;  3DKS A;  4EUY A;  3TJJ A;  4KX4 A;  2R0P A;  3FMW A;  1DUG A;  2NBS A;  4K8M A;  3F63 A;  5ECS A;  4PUF C;  3RHC A;  4KSO A;  1OVN A;  1M2D A;  4IGJ A;  2FWG A;  5F06 A;  2GS3 A;  1DBY A;  5GAN D;  1JFU A;  4IJ3 A;  2RUE A;  2HRK A;  1FB0 A;  2FHE A;  1M7T A;  2MBT A;  2VAF A;  2JZT A;  5ECO B;  1WJK A;  2HI7 A;  1JLV A;  4HS1 A;  3HDC A;  1UA5 A;  2GZP A;  2DMM A;  2E2M A;  1Y6E A;  5AGY A;  4NV2 A;  3I6A A;  1VGL A;  12GS A;  4O5R A;  4YQV A;  3EUR A;  4MNN A;  3D4T A;  2WCI A;  3TKS E;  3IK7 A;  1K0C A;  20GS A;  4Q5F A;  1CQH A;  2QC7 A;  3WGX A;  1XFL A;  5IMD A;  2VKZ G;  3APS A;  3CXG A;  2NTO A;  4AJ6 A;  3A5W A;  4I6X A;  2XPE A;  3FZ5 A;  2X8G A;  3L9S A;  4QL7 A;  2REM A;  2YWO A;  3WT2 A;  3HYP A;  3UJ1 A;  1T1V A;  1XOB A;  1ACV A;  2O7K A;  3IAM 2;  3NIV A;  4JBB A;  3R2Q A;  3CMI A;  1K0O A;  2YZH A;  1GTA A;  1XWG A;  1EOH A;  5F05 A;  5DAL A;  3DIE A;  4FYU A;  4HJM A;  2O5V A;  4POL A;  1ZCP A;  1OC3 A;  4Q5R A;  1O85 A;  5JWQ B;  1OE8 A;  2DSA A;  2CAQ A;  1XPV A;  3FZ4 A;  3CYN A;  1FVK A;  4JZQ A;  4K9Z A;  4ICY A;  3VWV A;  4ECC A;  5HQP A;  3S9F A;  3KXO A;  1YVL A;  2F51 A;  4JRR A;  4MLY A;  5CAX A;  5A4W A;  2H75 A;  4N30 A;  3QR6 A;  1M9A A;  5KN1 A;  3F4S A;  5AIX A;  1T4Z A;  2K8S A;  3F3Q A;  1T8E B;  2LRT A;  6GSW A;  4GRF A;  4HDE A;  1U6T A;  5F8B A;  1SJ6 A;  4XTS A;  4OCE A;  2GSR A;  1KBN A;  3ZMK A;  2HQT A;  4F9Z A;  2I4A A;  4E68 A;  4N0Z A;  2KP1 A;  4CY6 A;  3PR8 A;  2YZU A;  4IBP A;  1TK8 B;  2C3T A;  1Z7R A;  3LXZ A;  2QA2 A;  3HY2 A;  5D9V A;  1Z6N A;  4CDO A;  2H73 A;  4PNF A;  4O5U A;  1EWX A;  1QXH A;  2WZ9 A;  1T3B A;  2TRX A;  5DAK A;  3IV4 A;  4L0U A;  4WET A;  4GTU A;  1MDK A;  5GZZ B;  2GZY A;  1ERV A;  4O7H A;  4PQI A;  2VLV A;  5HFK A;  1VRS D;  1O7U A;  3UL3 A;  6GST A;  3TCO A;  4G01 A;  4GQF A;  5INY A;  3K8N A;  2HLS A;  3TRQ A;  5D8I A;  1PSQ A;  3VUR A;  2PVQ A;  2EFD A;  4F2I A;  1NHY A;  4POB A;  1EOG A;  4K2D A;  4GQC A;  4L5L A;  2H66 A;  3G9B A;  1WRY A;  1ERW A;  1VF4 A;  3GKN A;  2IN3 A;  4G10 A;  3C7M A;  14GS A;  1QK8 A;  1X5C A;  2TIR A;  3LW9 A;  4TRX A;  5ELA A;  2VCX A;  3CWG A;  4USS A;  2HYX A;  5G30 A;  4L8E A;  3LQ7 A;  2N5A A;  2E0Q A;  5JCW A;  5HFI A;  5JCU A;  2IMF A;  3BOA A;  3ZIV A;  2DJJ A;  2YN1 A;  2AYT A;  1SL0 B;  3GNJ A;  4LMW A;  4MF6 A;  1FOH A;  3EU3 A;  3WYW A;  2B3S A;  4V1A g;  2DKI A;  5IM9 A;  1GL8 A;  2X99 A;  4YH2 A;  5G5F A;  4TXV A;  2L4C A;  5FHI A;  2CZ2 A;  5D96 A;  1JZR A;  2LQO A;  2A2R A;  2M80 A;  4IS0 A;  2V6O A;  3M8N A;  3NZN A;  4OO5 A;  1QUW A;  4ML1 A;  5KOW A;  3D22 A;  2K9F A;  3P2A A;  3TRP A;  5IO0 A;  1UVZ A;  1O81 A;  2WFC A;  4FYB A;  5J4V A;  5CRH A;  1S3C A;  2HZF A;  3TKP A;  1DSB A;  3GUS A;  1T4Y A;  1TOF A;  5IPG A;  4WBR D;  3D0Z A;  5ENU A;  1R4W A;  4XRD A;  10GS A;  1G7O A;  5CO3 A;  17GS A;  3UAR A;  2H76 A;  4HU7 A;  3TKQ A;  1AQX A;  4FO5 A;  1ST9 A;  1EZK A;  1OE7 A;  1K3O A;  4F82 A;  1XZO A;  2JSY A;  2DBC A;  4XS1 A;  2LQQ A;  2V32 A;  1XWK A;  1OAZ A;  2YP6 A;  2K8V A;  2C3N A;  3DEX A;  1GSY A;  4MP4 A;  1TP9 A;  3ZYW A;  4G19 A;  3MIX A;  1PL2 A;  5CP1 A;  4KDX A;  3A2X A;  2H70 A;  1B4Q A;  1JZD A;  4MMM A;  1AQV A;  3FR9 A;  1SD8 A;  2JAD A;  4AJ8 A;  3FR3 A;  4EVM A;  4K6X A;  1GSF A;  5E4W A;  3PH9 A;  3ZFL A;  1Z6M A;  4XRA A;  1FW1 A;  4MAB A;  1K0B A;  3IXR A;  4ZB9 A;  22GS A;  1PN0 A;  4OO4 A;  4HU9 A;  2P31 A;  4EDY A;  3FEU A;  4HI7 A;  1U3A A;  1MEK A;  3IC4 A;  1N2A A;  2LUS A;  1GRX A;  3M3M A;  2YPM A;  2FUG 2;  1NSW A;  3MYD A;  4MH3 A;  4V1A p;  4EXJ A;  4AKH A;  5CYY A;  4G9H A;  3HVX A;  4BVY B;  5DVB A;  3TOT A;  5IIZ A;  2BMX A;  3WGE A;  1FHE A;  2Z9S A;  3GH9 A;  2X49 A;  5AIV A;  5J9B A;  5ECK B;  3FW2 A;  2KLX A;  5FWG A;  2CX4 A;  4WR5 A;  2V2G A;  3TU3 B;  1JLW A;  2H1G A;  2DIZ A;  5B6N A;  1B9Y C;  5A5H A;  1GSU A;  1SYR A;  5IPH A;  6GSU A;  2CA8 A;  3P8W A;  3Q18 A;  4CY8 A;  3KMO A;  4OFM A;  4JED A;  2VM2 A;  1V2A A;  4MPF A;  3V1W A;  4KSM A;  2FNO A;  3QAW A;  4POK A;  1M99 A;  1XVQ A;  5D73 A;  4Z2R A;  3F4T A;  3HKR A;  1V9W A;  1GUH A;  3KTB A;  5ECH B;  2M46 A;  2O89 A;  3CSJ A;  1W89 A;  6GSX A;  2MZC A;  3EMX A;  1TTZ A;  1R7H A;  2H74 A;  1GSQ A;  1JZW A;  2X8H A;  2GTU A;  2G0F A;  1E6B A;  1FVJ A;  3EWL A;  4XS6 A;  4TR0 A;  1G6Y A;  2VO4 A;  5IMF A;  4BVY A;  2BJX A;  2EIQ A;  4LL4 B;  4X0X A;  3KM6 A;  4ZXG A;  1HYU A;  3I9V 2;  3NOF A;  4WXT A;  5F0G A;  2JZS A;  2NDO A;  4ULX A;  1UC7 A;  2BTO T;  1H75 A;  3APQ A;  4IP1 A;  4MZW A;  1SK0 A;  1XCC A;  2WUL A;  3FYG A;  4NMU A;  4PQ1 A;  4V2L A;  1OYJ A;  2K18 A;  5GSS A;  5ELG A;  2OJL A;  1R26 A;  2LTK A;  2YCD A;  3W6G A;  4KDY A;  2OA7 A;  3HJP A;  4EL1 A;  5A34 B;  1WOU A;  4YKG A;  1YJ6 A;  2FWH A;  1WE0 A;  3C71 A;  3H1N A;  1AC1 A;  4JE1 A;  1EV9 A;  4RQX A;  4AGS A;  5A4V A;  1LJR A;  5KEJ A;  3VWU A;  2RLI A;  1A0R P;  5DQS A;  4XIH A;  1AXD A;  3TUE A;  2XBI A;  1EV4 A;  13GS A;  4K7N A;  3UEM A;  1PRX A;  4MZB A;  3GL3 A;  3MWH A;  2C1Y A;  3EE2 A;  4ECB A;  2DKH A;  5DAL B;  2DJK A;  1TRW A;  1YKA A;  3HXS A;  3CTG A;  4F0B A;  5A4U A;  2HT9 A;  1SK2 A;  4O5Q A;  3FR6 A;  1GUM A;  4WBJ A;  2C4J A;  3M0F A;  3ZLP A;  1WIK A;  5J9C A;  2FA8 A;  4AKI A;  1KTE A;  3CTF A;  3E3E A;  3D5J A;  3TKS C;  3TB2 A;  5HR0 A;  1ERU A;  2FGX A;  4Q5N A;  2EIR A;  4G0L A;  3GIX A;  3RDW A;  5AN1 A;  4EC0 A;  2LJA A;  3KCM A;  4X1U A;  4QQ7 A;  2A4V A;  3PPU A;  4I8B A;  3UIW A;  2GZZ A;  2R5G A;  5ECR B;  1S3A A;  2ZCT A;  3TGZ A;  2CV4 A;  2H6X A;  2R0G A;  2X64 A;  1K0M A;  3ZRE A;  3HZ4 A;  1ZYP A;  2LJK A;  4PUR A;  5A34 A;  2OE3 A;  1XXU A;  1XVW A;  3O6T A;  4ZB6 A;  3L0H A;  2KHP A;  4I2U A;  2WDU A;  2IMI A;  2QGV A;  2F3M A;  3QFB C;  1GTI A;  5DAK B;  4LA1 A;  1YEX A;  2HSM B;  1THO A;  3P90 A;  1IYI A;  1HNB A;  2I3Y A;  1GUL A;  4KW6 A;  1GNW A;  2FD3 A;  4EF0 A;  4ID0 A;  1GTB A;  2NVL A;  2N5F A;  3D21 A;  1XBS A;  2L5O A;  1BQ7 A;  4EDZ A;  3ZTL A;  1TRU A;  4K5R A;  1MDJ A;  1GH2 A;  4AJ7 A;  5B8A A;  3GRX A;  2VCQ A;  6GSS A;  1O73 A;  2YOI A;  4ZIJ A;  3DRN A;  3MNG A;  2LV3 A;  3H93 A;  1X5D A;  2F9S A;  2PUK C;  1V98 A;  3WD6 A;  1M0U A;  2MBS A;  4MJA A;  2B5E A;  3KMN A;  4MDC A;  4I5Q A;  3U6V A;  2PMT A;  2UZ8 A;  4IP6 A;  5CRD A;  3VK9 A;  4A5P A;  5ECI B;  5A5K A;  4DSR A;  2WJU A;  2PVO C;  3N9J A;  1THX A;  4ILF A;  2LJR A;  1PMT A;  4ZIL A;  1XW5 A;  1K3Y A;  4NHZ A;  2LST A;  4W66 A;  2VL2 A;  2R37 A;  4PUA A;  5E59 A;  3RAZ A;  4KDU A;  2RM5 A;  4ISD A;  2VL9 A;  2EFE A;  2ES7 A;  1XIY A;  2L59 A;  5ECP B;  19GS A;  3QAG A;  2HSM A;  1PL1 A;  2L57 A;  3QOU A;  3O76 A;  2IJY A;  4IQ1 A;  3DVX A;  4GWR A;  4X4J A;  4G0I A;  3UMA A;  2EIO A;  1TK0 B;  1V57 A;  1YF1 A;  4KB3 A;  1XWA A;  2PGT A;  5KOX A;  3GSS A;  1ZYN A;  3DXB A;  3E0U A;  4TN8 A;  2H30 A;  2H19 A;  3CRT A;  2JAC A;  4Z2T A;  2R0C A;  3GX8 A;  3A2V A;  3QFA C;  4WR4 A;  3KEB A;  2KOK A;  3GX0 A;  4GLT A;  2RM6 A;  2HZE B;  4MA9 A;  2LRN A;  4XHM A;  2FWF A;  2WB9 A;  2YV7 A;  2UV8 G;  4MH2 A;  4XS4 B;  2V1M A;  4TR3 A;  4YQU A;  5G1L A;  3L9U A;  4HOJ A;  4MF5 A;  2IFQ B;  4NPB A;  2P0G A;  4KAE A;  4YAP A;  1SL2 B;  2C0G A;  3PGT A;  5BMU A;  3M9J A;  3KH9 A;  4IQA A;  2GST A;  4AF2 A;  1X9S B;  5DBQ A;  3RBT A;  2OKA A;  2CAI A;  2PU9 C;  4J2F A;  5GST A;  1F9M A;  3P7X A;  1A24 A;  5DJL A;  2VOC A;  3GL5 A;  5G2Z A;  3L4N A;  2PER A;  4K7I A;  4ZB8 A;  2O8V B;  2HE3 A;  3F9U A;  5ECN B;  3IAS 2;  3GFK A;  2L6C A;  3M9K A;  5J40 A;  4MF7 A;  1WPI A;  2C3Q A;  6GSV A;  4TXO B;  3GH6 A;  1W4V A;  3ERG A;  5IO2 A;  2C0E A;  5EY6 A;  4RQR A;  1OC8 A;  5CRE A;  2LEG A;  1S3D A;  4EIQ A;  4KND A;  2CX3 A;  4KA0 A;  3DWV A;  5HR1 A;  2IPA A;  1ZYQ B;  2L4Q A;  2YWI A;  3H4K A;  2OT3 A;  1QMV A;  1AW9 A;  4LLR A;  1T00 A;  2GVP A;  3TKR A;  4O32 A;  2HSN A;  3GTU A;  2IWT A;  3F6F A;  4LL1 B;  2HZE A;  3TKS A;  1B9X C;  1YDK A;  4D73 A;  3QD9 A;  3I69 A;  2VCZ A;  3DVW A;  1TI3 A;  4XS4 A;  2ZNM A;  5ECL B;  1EP8 A;  4DEJ A;  4EO3 A;  1KEB A;  2VD1 A;  1X5E A;  3BD2 A;  3QPM A;  2HXK A;  2IFQ A;  3H8Q A;  1ZMA A;  1GSD A;  2XBQ A;  4HZ4 A;  5A5H B;  3J7Y b;  3ME7 A;  1O8X A;  1WWJ A;  1ZGN A;  3IHG A;  4OFN A;  3GV1 A;  1MD3 A;  1GP1 A;  3VI5 A;  2YNX A;  4YAV A;  1F37 A;  3KP8 A;  1M2B A;  3WT1 A;  5D93 A;  4EKZ A;  4Z7X A;  1J9B A;  2KUC A;  2J23 A;  1PKZ A;  2CVB A;  4IVF A;  2RII A;  4TXO A;  1SKW B;  4BA7 A;  3ZIJ A;  4ZBB A;  2CZ3 A;  3DYR A;  2FA4 A;  1AUC A;  4PXO A;  4ECI A;  2H0I A;  1E2Y A;  9GSS A;  4NXI A;  1YKC A;  5D9T A;  1SKS B;  3JCM L;  1TU8 A;  4NHW A;  1QQ2 A;  1YF0 A;  1FB6 A;  2F8F A;  4MJC A;  4H86 A;  2E2G A;  4EIP A;  3VFI A;  4J56 E;  5J4Y A;  5IMA A;  2I9H A;  2LS5 A;  1GWC A;  4YQM A;  3ZIT A;  1XW9 A;  1SEN A;  5J47 A;  4FYC A;  4HQZ A;  2GQL A;  1C72 A;  2H1L A;  3F6D A;  4F03 A;  1VF2 A;  1TXX A;  1F3B A;  2EFH A;  1NW2 A;  1M2A A;  5IOW A;  2YWN A;  2EC4 A;  1EEM A;  1O6J A;  4OWY A;  4ML6 A;  4L5O A;  1SYX A;  4K2X A;  1TRS A;  2IMD A;  4CW9 A;  4GST A;  4TR1 B;  3N5O A;  2VL2 C;  3SBC A;  2DML A;  2A4H A;  2AAW A;  3HCZ A;  3HVS A;  1N8J A;  2ALB A;  4BPY A;  1DE1 A;  5ABR A;  2OE0 A;  1SKR B;  4DVC A;  1MD4 A;  2TRC P;  1ABA A;  3ZRD A;  1SL1 B;  3LJR A;  3LGC A;  1FOV A;  3IDV A;  2M72 A;  1Q4J A;  2OAD A;  5LCZ A;  2GGT A;  5H5R A;  4ACS A;  2OE1 A;  2VL3 A;  4ECJ A;  1FO5 A;  4YKF A;  5B8B A;  4FQU A;  3ED3 A;  1J0F A;  1B8X A;  2CVD A;  5J3R A;  1HQO A;  3IHQ A;  4IEL A;  2H1A A;  2G2Q A;  3GA4 A;  4IW9 A;  3CSH A;  4K7O A;  3W8J A;  4TKY A;  5COH A;  4HZ2 A;  2GT6 A;  5FT3 A;  16GS A;  2A2S A;  1SK1 A;  1FG4 A;  1BYE A;  4CHS A;  2YAN A;  2HFD A;  2HSH A;  1F6M C;  4HEA 2;  4IHU A;  1IYH A;  1I5G A;  3TJG A;  2C8U A;  3EU4 A;  2IME A;  1Q98 A;  5J4U A;  2J9H A;  4K1F A;  4MK3 A;  4TR1 A;  1R5A A;  2VLU A;  5C04 A;  2MMN A;  2HRN A;  3LSZ A;  2MYG A;  2DJ1 A;  2JL4 A;  5CNW A;  4E8H A;  1SVL A;  4WF5 A;  1ZZY A;  3FY7 A;  4ZL7 A;  1ZOF A;  2P5R A;  1B4P A;  4K0N A;  3ZVJ A;  5A1N B;  3KP9 A;  4AI6 A;  2PWJ A;  1K0A A;  3IK9 A;  1V40 A;  1FAA A;  3EC3 A;  5AIS A;  3A2W A;  1CQG A;  3CBU A;  5D9X A;  2L5L A;  1XWC A;  4FH8 A;  3W8S A;  1GUK A;  2X8C A;  3TOU A;  3IPZ A;  1PGT A;  3F4R A;  4GSN A;  4N10 A;  4BVX A;  1R5P A;  3G7J A;  1RQM A;  3US3 A;  1Z5Y E;  2R2J A;  2LNS A;  1X9M B;  1SU9 A;  3Q6O A;  3GUR A;  4ZBD A;  2H0G A;  2O87 A;  3LWA A;  2PBJ A;  3GN3 A;  5G1K A;  4MZC A;  1OKD A;  2XC2 A;  1BJX A;  3FRC A;  3HD5 A;  2B5X A;  3SWL A;  4NV5 A;  3HHV A;  3RHB A;  2MMA A;  1MDI A;  3TDG A;  2XPD A;  2H1B A;  4KGI A;  1TI1 A;  1TW9 A;  5CRG A;  1LBK A;  2YWM A;  4P3Y B;  5IMC A;  1GSS A;  2I1U A;  2GLR A;  2IMK A;  2I81 A;  2VIM A;  1F3A A;  3UBK A;  1TDI A;  1BF5 A;  8GSS A;  3C8E A;  3ISO A;  1RK4 A;  1U3I A;  5C00 A;  2RUF A;  1QFN A;  1BG5 A;  3RPN A;  4ZL8 A;  3VWW A;  1NM3 A;  1F2E A;  5EL8 A;  5A1N A;  2V41 A;  3FZ9 A;  1WP0 A;  4J57 E;  2R6K A;  3KJY A;  1YQ1 A;  3LG6 A;  1O8W A;  5IMZ A;  4GCI A;  3EVI A;  5DCH A;  1A8Y A;  2V6K A;  4IN0 A;  5GAP D;  4OD7 A;  4OFT A;  2H6Y A;  3D6I A;  3G7Y A;  1A0F A;  3D4M A;  4PTS A;  3IC8 A;  1BG1 A;  2H0H A;  4I2T A;  3KZQ A;  2OAC A;  5G31 A;  5KN3 A;  4N0V A;  1AIU A;  5BRT A;  1AAZ A;  1TXU A;  4V2N A;  3M1G A;  1GNE A;  4OCF A;  5B7C A;  5G5E A;  5IQY A;  3HVV A;  3L9V A;  3GMF A;  3IRA A;  2DLX A;  4G2E A;  3LXT A;  3G7I A;  1WMJ A;  4V2M A;  3ZZX A;  5BMU B;  2HSY A;  2CT6 A;  3UOM A;  4LMV A;  4POM A;  4PQH A;  4AKX B;  3Q19 A;  5JWO B;  1TRV A;  3LYK A;  2OBI A;  2H8L A;  1AQW A;  1JZO A;  2WGR A;  3L78 A;  1QGV A;  4DSQ A;  1ON4 A;  3VLN A;  1HNC A;  2XHF A;  5ECM B;  1PA3 A;  4TVE A;  3FZA A;  3F3R A;  2KP2 A;  4BL7 B;  4JR4 A;  1ZYE A;  2JZR A;  1K0N A;  2H6Z A;  1PX6 A;  11GS A;  1A8L A;  4WKW A;  1SD9 A;  2H01 A;  5J41 A;  2HSN B;  3HMJ G;  4PX1 A;  3GTU B;  2AJQ B;  2LRC A;  1PQN A;  4TOP A;  3EMP A;  5JWR B;  3UBL A;  1U88 A;  4D73 B;  2C0F A;  2NPB A;  5H5S A;  1G6W A;  3DD3 A;  4Q5Q A;  1YEP A;  5DQY A;  4PGT A;  5L71 A;  2JU5 A;  1K0D A;  1I9D A;  2WS2 A;  5H5Q A;  1U87 A;  4XCS A;  3VPQ A;  5LD0 A;  2DJ0 A;  5KN2 A;  4KCE A;  2FWE A;  4OMV A;  2R3X A;  2DJ2 A;  4FIW A;  2F8A A;  2IIY A;  3TJB A;  3LYP A;  4RI7 A;  3KD0 A;  4QMK A;  3ERW A;  3RPP A;  4X43 A;  3EYT A;  5CRW A;  2WRT A;  2QA1 A;  3VI7 A;  2AUV A;  1ML6 A;  1BAY A;  2VCT A;  1A2L A;  3MDK A;  1EGR A;  2GSQ A;  3ZML A;  2D2Z A;  1TU7 A;  1NHO A;  4TW5 A;  2AV4 A;  3TJK A;  5ID2 B;  3IBH A;  2JSZ A;  2AB6 A;  3QCP A;  1URM A;  1VF1 A;  3F0I A;  5ECQ B;  3GHA A;  2IL3 A;  3R3E A;  2MMO A;  4BWS A;  4BL7 A;  3A5I A;  3C73 A;  3KGK A;  2VD0 A;  2FCH A;  2PN8 A;  1Y25 A;  2P5Q A;  4IJI A;  2VCV A;  5JCG A;  1PX7 A;  3HZ8 A;  1ERT A;  2GSS A;  1YZX A;  4K0G A;  4O92 A;  4HQS A;  3CRU A;  3Q74 A;  1X0R A;  2R4V A;  2PPT A;  5HR2 A;  2GT5 A;  2DIY A;  2LNT A;  3TRX A;  2YJH A;  2B6M A;  2QKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...