5G5FA

Crystallographic structure of the tau class glutathione s-transferase migstu in complex with reduced glutathione.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
KSDVKLLGAWPSPYVMRARITLNVKSVDYELLEETLGSKSDLLLKSNPVHKKIPVLIHNDKPICESLIIVHYIDEFWSSGPSILPSDPYDRAIARFWAAYLDEKWYPSLKGIASAQGEEAKKAAVDQVGESLALIEDTYVKLSKGKPFFGGEKIGYLDIAFGCFLGWLRVTEKTSGVKFLNEAKTPHLAKWAVRFCADPAVKDVMPETEKLAEFAKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TAU CLASS GLUTATHIONE S-TRANSFERASE
publication title Insights Into Ligand Binding to a Glutathione S-Transferase from Mango: Structure, Thermodynamics and Kinetics
pubmed doi rcsb
source organism Mangifera indica
total genus 71
structure length 219
sequence length 219
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5g5fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g5fA01
1QQ2A 3N9JA 3TGZA 4HZ2A 3TKQA 4NV5A 2M46A 3H4KA 4WKWA 3E9JB 3EINA 2DJ0A 4KDYA 1PSQA 1M99A 4TR1B 4BL7B 4Q5QA 5F0GA 1AXDA 3G7JA 1BAYA 2PPTA 5IPGA 1B4PA 2F51A 4FIWA 2IL3A 1KTEA 1EOGA 3DRNA 3US3A 3H79A 1YEXA 2IWTA 1K0DA 2VCZA 2LKUA 4OO4A 1VGLA 3ERGA 1Z3EA 1IYHA 1MD4A 5DALB 1MDIA 5DJLA 1WIKA 5F8BA 2O87A 3ZIJA 4EC0A 4NAXA 2GSRA 3QAWA 3CSHA 1AIUA 3LWAA 4AJ6A 2HSHA 3VWWA 3UIWA 5IM9A 1GTIA 2YWNA 4HI7A 1GSFA 4F0BA 3WT1A 2FUG2 2IJYA 5ECKB 11GSA 4POLA 1QXHA 2DJ2A 3CMIA 3IK9A 3NIVA 2H1AA 2VD1A 5IPHA 1MEKA 1O85A 1G6YA 3APOA 1FOVA 3EC3A 1EGRA 3VPTA 2R4VA 2X8HA 2CA8A 4G0IA 3IV4A 22GSA 3HVVA 4LMWA 13GSA 3GL5A 3CTFA 1OC3A 1O8XA 1Z9HA 1FAAA 3WGEA 5H5RA 1SU9A 1M0UA 4OCFA 2FWFA 3APSA 3WT2A 2C3NA 1FW1A 4DSSA 1GSUA 1SD9A 2WGRA 4OMVA 2IMIA 5CRGA 3R3EA 3RDWA 3ZTLA 3EURA 3Q19A 2L6DA 4MPFA 2VLVA 1TI1A 1XXUA 4J56E 4MLYA 2JSZA 3EE2A 3LXTA 3LSZA 4WETA 2H74A 3DIEA 4BVXA 1KNGA 5ECIB 4EE0A 1TP9A 5GSSA 2E2GA 3FK8A 5J3RA 3FKFA 1XCCA 1X9SB 1G6WA 1UC7A 1ZOFA 2GQMA 2PBJA 3V1WA 2PGTA 2ZCTA 4KNDA 1HNCA 2ON5A 3GKKA 5D96A 5LCZA 3FZ4A 3K8NA 5AISA 4MJAA 2B5EA 1DUGA 3TKRA 3F0IA 3HA9A 2OACA 2YWMA 1XWCA 5D9WA 3HJMA 1Y25A 5J5NA 1BX9A 2DC5A 2DJ3A 2DBCA 1EV4A 3E3EA 4KCAA 4D73A 1R26A 1DSBA 2YJHA 2N5FA 2B1KA 3G9BA 1HD2A 2A2SA 4DSSB 1B9YC 2F8AA 4Q5NA 5JCUA 1ZYQB 3ISOA 4OFNA 3KIJA 4FO5A 3VI7A 4BA7A 4IBPA 12GSA 3FZ5A 3IAM2 4TOPA 3ZRDA 2ZNMA 3P8WA 2DMMA 1ZGNA 3TB2A 1XWKA 1PKZA 4BVXB 4NV2A 3VI5A 2WCIA 4MF6A 1JFUA 5CRWA 1B48A 5INYA 5A4WA 2HSNB 1WWJA 1FVKA 3RBTA 1KBNA 1PKWA 3HJPA 6GSYA 4WBJA 3OR5A 1PQNA 1JLVA 2MZCA 5B6NA 1XVWA 3GH6A 2AAWA 3GFKA 3ZL5A 1ZCPA 2GT5A 5LD0A 5G1KA 4I2UA 1A8YA 3C7MA 1YF0A 1JZWA 5KN0A 4D73B 2K6VA 2FNOA 2O89A 4ZBDA 1GULA 1WRYA 2EIQA 3GUSA 2CAQA 5ECNB 1BG5A 2VL9A 4TR4A 4XHMA 1M2BA 1EWXA 3LG6A 2HRFA 2AJQB 1T7PB 2X64A 1EP8A 2WDUA 2H8LA 3TUEA 2V1MA 4NWYA 1XWGA 1GTAA 3LJRA 2C8UA 4ZBBA 5JCGA 6GSVA 4J57E 2PUKC 2PWJA 1NW2A 2V6OA 1T4ZA 2CX4A 1K0BA 5B8BA 3BJ5A 1M2DA 5HFGA 1GUHA 1USBA 1BQ7A 1ST9A 1GUMA 4G19A 2J23A 1EV9A 1B9XC 5ELGA 4NPBA 1LJRA 2H0IA 3TOUA 2MMNA 2L6CA 4GWRA 2RUFA 1IYIA 4K7OA 4HUAA 1I9DA 3C8EA 2VCQA 3F4SA 1KEBA 2IMFA 4MH3A 1V98A 4WR4A 2ZUPA 4ZIJA 2KHPA 4JR6A 2LEGA 3F6FA 4IJIA 4MF7A 3I6AA 1GLPA 3KTLA 1XBSA 3M9JA 3I43A 1JZDA 3CYNA 4KB3A 4PUAA 1UA5A 1X9MB 3D22A 2GZYA 2MBSA 1R5PA 2GDRA 2H30A 3L78A 4ZXGA 2IMDA 5COHA 3GIXA 1AQVA 2CT6A 1UVZA 1BYEA 3UEMA 5DJMA 1TXXA 2LNTA 3GV1A 3TKSC 4ZILA 3EYTA 1VF2A 2XPEA 3CXGA 4POKA 1W89A 3TJKA 3HY2A 2H6ZA 3LFLA 3N5OA 1K0OA 1X5EA 2FCHA 1TK5B 1TI3A 2HFDA 1VRSD 1YZXA 4F03A 4IJ3A 2TRXA 1A2MA 2M80A 4GRFA 3H93A 3CTGA 3L9VA 2GGTA 4FH8A 3KMNA 2DIYA 4MPGA 1H4OA 2QKEA 3VWXA 2ES7A 4AJ8A 3KMOA 3BOAA 4TW5A 4Q5FA 5IQYA 3FZ9A 2BTOT 1CQHA 5ECHB 1ZYEA 10GSA 3TRQA 4K0GA 3GKXA 3NZNA 2LRTA 4GXZA 4OO5A 5G1LA 4X1UA 3J7Yb 6GSSA 3GURA 1W4VA 2JZTA 2V32A 1G7EA 4JU5A 2A4VA 3UOMA 1PA3A 1XOBA 3GA4A 4V1Ap 4PQHA 5E59A 2ON7A 4TR0A 1T00A 4QL7A 2R37A 4KSMA 5IMDA 1AW9A 4J2FA 3QPMA 18GSA 3ZMKA 4HZ4A 4IS0A 1V2AA 3D4TA 2H0GA 1THOA 5CAXA 5F06A 2QGVA 3CSIA 3GKNA 4RI7A 4NHWA 3CRUA 3QAGA 1B8XA 1V57A 1XZOA 2NBSA 3GKMA 2DSAA 1OAZA 2CZ2A 5AIXA 1TRVA 1U87A 4HQZA 2LRCA 3IE3A 4L0WA 3PINA 4RUVA 1A2LA 3ZLPA 3TRXA 1EZKA 3DXBA 1GWCA 2NTOA 2JZSA 3KEBA 4LMVA 3P90A 2HI7A 4BWSA 1PMTA 3HJOA 3KD0A 3VFIA 3HVXA 3TDGA 2WULA 1V9WA 1WP0A 3ME7A 4XS4A 3IAS2 4KH7A 2B1LA 2JU5A 2H72A 4IVFA 4MF5A 3FR6A 3PPUA 4OWYA 4FYCA 3QOUA 4XRAA 5GSTA 2X8CA 2FA4A 2EIOA 4POBA 4KDUA 4XS1A 2OKAA 2VL2C 2PVOC 6GSWA 4JEDA 5D73A 3VWUA 4H86A 3ZITA 4MABA 1XVQA 3O3TA 3D21A 2K9FA 1Z7PA 3UARA 2IFQA 4V1Ag 5D9XA 3WD6A 1A0FA 2JL4A 5DCGA 3RHBA 4ID0A 2XC2A 1HQOA 4F2IA 2B5XA 2VUPA 1ACVA 1DE1A 4HU9A 2AHEA 4OFTA 3VURA 2FWGA 3M1GA 2YNXA 2REMA 4CDOA 4K7IA 4YAPA 2L59A 1ZMAA 5DQYA 1U6TA 4K7NA 3WGDA 3ZVJA 4IW9A 4KF9A 2HXKA 1ZZYA 4F9ZA 4QL9A 1B4QA 4XS4B 2C80A 2Z9SA 1GUKA 4LL1B 1FB0A 5IMFA 2GVPA 5G5FA 1GTUA 4G0KA 3LXZA 2E7PA 4ZL9A 5EPFA 4HEA2 3UBLA 1J08A 4E8HA 4PQIA 4EDYA 4RQRA 4YAVA 5D9TA 1OE7A 2IFQB 4L5LA 4HQSA 3RPPA 3GTUA 2HSYA 1I5GA 1WMJA 2B7JA 2H6XA 3GNJA 3IDVA 2H70A 4ECIA 2NDOA 3KTBA 2KUCA 1AC1A 4MJBA 2DJ1A 2P5QA 4MP4A 3WGXA 4K1FA 1A0RP 4FQUA 4I6XA 1WE0A 3QCPA 2H73A 3W6GA 4GSNA 2E0QA 4PNGA 1T3BA 4GSSA 5IMCA 3NOFA 4PXOA 5B7CA 3DVXA 4N11A 5DBQA 1SKSB 2DMLA 3ZMLA 3J7Yk 1OYJA 1MDJA 3GH9A 2GZZA 1XW5A 4K8MA 2H1GA 1S3DA 4JRRA 2HLSA 2YOIA 5IOWA 1NM3A 1XFLA 1YF1A 4BVYA 2OE0A 1O7UA 4N0ZA 5JWRB 5H5QA 1PL2A 2A2RA 2M72A 1TU7A 5JWQB 3EVIA 5ELAA 1QGVA 3GL3A 2HRAA 3GX8A 2R3XA 3APQA 3HYPA 1XPVA 1YDKA 2RLIA 2LJKA 3M9KA 5HR2A 3GTUB 4MJCA 3H8QA 1SJIA 2CX3A 4O7HA 3QR6A 4TXOA 4ZBAA 5IMAA 9GSSA 3ZIVA 1Q4JA 3JCML 2LJAA 5CP1A 1U3AA 5KN2A 2GQLA 3O76A 3ED3A 1ERTA 2JACA 2GSTA 1LBKA 2HSMA 2CVBA 3KH7A 4NMUA 4E8EA 4V2LA 1ERWA 1N2AA 2LNSA 1A23A 5DVBA 2O7KA 4GQFA 3EU4A 4PGTA 3MAKA 3GX0A 4MZBA 1SJZA 2WB9A 2VIMA 1SKWB 3MNGA 3TJBA 4KSOA 4XRDA 4GSTA 4EXJA 4LLRA 3LORA 1M9AA 5B8AA 3FEUA 1TRSA 2YV7A 4BVYB 3EMPA 1K3YA 2CVKA 3GRXA 3R2QA 4PUFC 2K18A 1TJDA 5GZZB 1FB6A 5L71A 2LQQA 2AUVA 3EU3A 4EVMA 4L0UA 3IA1A 1Z6MA 2VLUA 4TXOB 2YZHA 3QFBC 3ME8A 3DVWA 4XTSA 4KE3A 4JE1A 5ECRB 4IN0A 1PX7A 2QC7A 3KZQA 2VLTA 1K3OA 4IP1A 1AUCA 3GN3A 4I2TA 2N5AA 3DD3A 5IO2A 3C71A 1X0RA 2HRNA 8GSSA 4DSRA 1WJKA 4BWQA 2XPDA 3UVHA 1SENA 3C73A 4GCIA 1MD3A 2YN1A 5KN1A 2HSMB 4N10A 1AQWA 3EWLA 2H01A 3RHCA 2CZ3A 1JZRA 1AAZA 2HRKA 3S9FA 3FZAA 5DAKA 2D2ZA 3FR3A 5D93A 1EEMA 3GYKA 1EOHA 1C72A 3F6DA 2MYGA 4KAEA 1WOUA 4YQUA 3F63A 2O8VB 3MWHA 4I97A 1ON4A 1PRXA 2G0FA 3DMLA 4IGJA 3MSZA 5LNKe 5C00A 3UL3A 1FHEA 2CAIA 5EVOA 3FHKA 1V58A 4ILFA 2TIRA 4EL1A 4X0XA 3TCOA 1NHOA 1YEPA 2H76A 2JSYA 4I8BA 1VF4A 3IHQA 6GSTA 4YH2A 3LEFA 1OVNA 4L5OA 2EC4A 5ECOB 1VF1A 5FT3A 3LGCA 4POMA 3FYGA 2KOKA 2XBIA 4MA9A 2L57A 1TKDB 1BJXA 3HD5A 4O32A 3TKPA 6GSUA 2VL3A 2B6MA 3MDKA 3HXSA 2H71A 2HRKB 5DAKB 1EP7A 4EKZA 5B6MA 3QDNA 1XIYA 1SK0A 2VAFA 4ECJA 2HZEA 5GAPD 1SL0B 4WR5A 3VPQA 14GSA 2PN8A 2YCDA 1TK8B 2PMTA 3GSSA 2LV3A 3KGKA 4G10A 2I4AA 1RW1A 4OD7A 2LRNA 1YQ1A 3M0FA 2OE1A 3FRCA 3LYPA 4BL7A 2XHFA 4JR4A 1GSDA 1HNAA 5CRDA 1A2JA 2OJLA 3L9UA 5BMUA 1QK8A 3TOTA 4MZWA 3IK7A 1TDIA 1EGOA 1R4WA 3U5RE 2QSIA 2IPAA 3KP8A 2OBKA 3D0ZA 5FHIA 1A8LA 1N8JA 2BJXA 4PTSA 1TOFA 2F8FA 3D6IA 1QMVA 5KN3A 1F3BA 1QFNA 3A2WA 3FY7A 5D8IA 3DEXA 2NPBA 3TRPA 1NHYA 2LQOA 2MMAA 4Q5RA 2RM6A 1M9BA 3IPZA 5ID2A 5G30A 3ZFBA 1Z5YE 1XOAA 4ZB9A 3RPNA 1H75A 2WFCA 3D5JA 2IIYA 3PGTA 5HR1A 2RM5A 3HZ8A 2HZEB 3L4NA 4YQMA 1K3LA 1WPIA 5KEJA 2NVLA 4MCUA 3TJFA 2C0EA 2FD3A 1CQGA 1T1VA 4HJ2A 1TU8A 2R2JA 2FHEA 4X43A 3W8JA 1BEDA 4TVEA 4USSA 3IC8A 5AGYA 2OA7A 4KA0A 1PD21 3IR4A 2GSSA 5H5SA 3SBCA 2J9HA 3ZZXA 1T4YA 5ECMB 3I9V2 5HFIA 4DSQA 4KUNA 1K0AA 5G31A 3KM6A 4K0NA 2H0HA 1U88A 3A2VA 1M2AA 2YJ7A 2WJUA 5A4VA 2BMXA 1VF3A 1XW6A 4ISDA 1ML6A 2X8GA 1Z7RA 4V2NA 1FVJA 1M7TA 3FW2A 3KXOA 1HYUA 3ZYWA 2FY6A 4MK3A 5DCHA 4RI6A 1GP1A 3KCMA 4TXVA 2B5YA 4PQ1A 2VO4A 3UAPA 1OC9A 5ID2B 19GSA 4N0VA 1EEJA 2WS2A 4N30A 1TK0B 2R6KA 1MTCA 4KX4A 3EMXA 5J4UA 4LA1A 3A2XA 3BCIA 4P3YB 5E4WA 3TJJA 2H1DA 3GSTA 4L8EA 3KJYA 5HR0A 4LL4B 2OADA 5J9BA 2P31A 5D9VA 1V40A 2EIRA 3HZ4A 4CHSA 3UMAA 4K2DA 1Y6EA 2YZUA 2K8VA 1MDKA 3IC4A 2VM2A 5IOXA 5C04A 2VCVA 2CV4A 1Z6NA 2FA8A 1ABAA 2VCTA 2YP6A 1JZOA 2O85A 2WRTA 3D4MA 3IOSA 1THXA 4I5QA 2L5LA 4ECCA 5F07A 1PX6A 2KP1A 1GTBA 3CSJA 2HNLA 1OC9B 2GT6A 3M8NA 3VLNA 2C0DA 1K0MA 2C4JA 3O6TA 1AQXA 4F82A 1R5AA 5G5EA 2I3YA 2WZ9A 5GAND 1XWBA 3PH9A 3TKSE 5DDLA 2IN3A 4AF2A 3GHAA 3F9UA 2DLXA 2V2GA 1GNEA 2VCXA 5JCWA 1F9MA 1SK2A 2P0GA 1K0CA 1FG4A 2RUEA 5J41A 5FWGA 2FWEA 1RQMA 3KH9A 2DJJA 1GLQA 4FYBA 4EDZA 2K8SA 1F37A 1ZL9A 4WF4A 1SYRA 1TW9A 3UJ1A 1ERVA 2JADA 2YANA 5IO0A 3ERFA 2C0GA 3SWLA 2H1BA 3F8UA 3G7YA 1U3IA 4ZL8A 4MJEA 2IMEA 1QUWA 3DWVA 20GSA 2HE3A 1J0FA 1TTZA 1R7HA 4IP6A 3QAVA 5EY6A 4ZB8A 1HNBA 4V2MA 1G7OA 4ULXA 1UN2A 3AY8A 2LTKA 3ZFLA 4IKHA 2F9SA 4ECBA 1T8EB 1E6BA 2XBQA 4GLTA 5G2ZA 2LSTA 1GNWA 2AV4A 1NSWA 4KDXA 2LUSA 1YKCA 1X5CA 1O73A 5ABRA 5ECSA 4QQ7A 1XWAA 3BBYA 2I1UA 4ML6A 2H19A 2E2MA 4AJ7A 3IRAA 1SJ6A 4OCEA 1GH2A 5HFKA 2KP2A 3H1NA 3DKSA 3L9SA 4KCEA 3F4TA 2H75A 1LU4A 2L4QA 1A24A 3I69A 2VD0A 4RQXA 2H6YA 3LQ7A 4ML1A 3Q6OA 2RIIA 1O81A 1DBYA 3DYRA 4ACSA 2FGXA 2LS5A 4F0CA 2JZRA 3ZREA 4G0LA 2B3SA 4YQVA 1OE8A 5F05A 2VOCA 5HR3A 4OFMA 4XCSA 2LJRA 3UVTA 3A5WA 1YKAA 2KLXA 4HJMA 1URMA 4WXTA 3A3TA 1JHBA 4K6XA 4ZL7A 4DVCA 1YJ6A 3G7IA 3ZVJD 1J9BA 2C1YA 2CQ9A 2HZFA 1SYXA 2I81A 2L4CA 4IQ1A 4EUYA 4Z7XA 4XIHA 1X9WB 3TKSA 3P7XA 2L5OA 4KW6A 2OE3A 2IMKA 4EO3A 3IXRA 2HT9A 3F3QA 3LYKA 4IELA 4HDEA 4MH2A 3C1SA 4O5RA 1SL1B 6GSXA 5CYYA 1XW9A 4NHZA 2N5BA 4PURA 1G0TA 1ILOA 2P5RA 2VM1A 3VK9A 1ERUA 1TRUA 3WYWA 4HS1A 3HCZA 2CVDA 3C1RA 2I9HA 2TRCP 3FR9A 4FYUA 4DEJA 5J9CA 1GRXA 4GF0A 3BCKA 4MZCA 2V6KA 5ECPB 4TN8A 4K9ZA 2ALBA 4NXIA 2OBIA 4PNFA 3HVSA 1OKTA 4HU7A 2HYXA 3QD9A 1F2EA 1PGTA 2GTUA 3F4RA 3IBHA 4MDCA 4JZQA 5IMZA 5CREA 4JBBA 2AYTA 2PVQA 5IMVA 2HQTA 1OKDA 1GSQA 2MMOA 4WBRD 1X5DA 2C0FA 3RAZA 4PX1A 2C3TA 3Q74A 7GSSA 3F3RA 3M3MA 2GQKA 3KP9A 3HDCA 1PL1A 5A5KA 2G2QA 1S3CA 4AGSA 1SK1A 3QMXA 2GLRA 3CRTA 5ECQB 3UBKA 3HHVA 2MMZA 4TRXA 3DGQA 5CRHA 16GSA 17GSA 2GS3A 3U6VA 4G9HA 1S3AA 1YY7A 2MBTA 1OC8A 4O92A 5IIZA 1F3AA 4G2EA 1F6MC 1Q98A 1DE2A 1SD8A 4TR3A 2FLSA 2H66A 1E2YA 2F3MA 1GSEA 4KGIA 3PR8A 3CBUA 5CNWA 2YWIA 2X99A 2YWOA 1GSSA 2GSQA 4BPYA 5EL8A 4TR1A 3GMFA 1RK4A 3L0HA 2YV9A 1PN9A 3VWVA 1O8WA 4WF5A 2PERA 2FWHA 5AN1A 5HQPA 1TRWA 3Q18A 5A4UA 4MMMA 4GTUA 2B7KA 1SKRB 2V41A 4TKYA 2DIZA 4CW9A 1SL2B 4HOJA 1GSYA 5CO3A 5ENUA 5DALA 1O6JA 3QFAC 2AB6A 2UZ8A 5DQSA 4ZB6A 4XS6A 3W8SA 3ERWA 4WEYA 3HKRA 3TJGA 5JWOB 4GQCA 2VCWA 4IQAA 2PU9C 1JLWA 5ECLB 3P2AA 4EF0A 1FO5A 2VL2A 1GL8A 2C3QA 2YPMA 3BD2A 2DJKA 2R5GA 2GZPA 4IHUA 5AIVA 1K0NA 3E0UA
chains in the Genus database with same CATH superfamily
2OT3A 1QQ2A 3N9JA 3TGZA 4HZ2A 3TKQA 4NV5A 2M46A 3H4KA 4WKWA 3E9JB 3EINA 2DJ0A 4KDYA 1PSQA 1M99A 4TR1B 4BL7B 4Q5QA 4AKHA 5F0GA 1AXDA 3G7JA 1BAYA 1YEWC 2PPTA 5IPGA 1B4PA 2F51A 4FIWA 2IL3A 1KTEA 1EOGA 3DRNA 3US3A 3H79A 1YEXA 2IWTA 1K0DA 2VCZA 2LKUA 4OO4A 1VGLA 3ERGA 1Z3EA 1IYHA 1MD4A 5DALB 1MDIA 5DJLA 1WIKA 5F8BA 2O87A 3ZIJA 4EC0A 4NAXA 2GSRA 2EFHA 4QMKA 3QAWA 5KOWA 3CSHA 1AIUA 3LWAA 4AJ6A 2HSHA 3VWWA 3UIWA 5J4YA 5IM9A 1GTIA 4E68A 2YWNA 4HI7A 1GSFA 4F0BA 3WT1A 2FUG2 2IJYA 5ECKB 11GSA 4POLA 1QXHA 2DJ2A 3CMIA 3IK9A 3NIVA 2H1AA 2VD1A 5IPHA 1MEKA 1O85A 1G6YA 3APOA 1FOVA 3EC3A 1EGRA 3VPTA 1SVMA 2R4VA 2X8HA 2CA8A 4G0IA 3IV4A 22GSA 3HVVA 4LMWA 13GSA 3GL5A 3CTFA 1OC3A 4GDFA 1O8XA 1Z9HA 1FAAA 3WGEA 5H5RA 1SU9A 1M0UA 4OCFA 2FWFA 3RFRC 3APSA 3WT2A 2C3NA 1FW1A 4DSSA 1GSUA 1SD9A 2WGRA 4OMVA 2IMIA 5CRGA 3R3EA 3RDWA 3ZTLA 3EURA 3Q19A 2L6DA 4MPFA 2VLVA 1TI1A 1XXUA 4J56E 4MLYA 2JSZA 3EE2A 3LXTA 3LSZA 4WETA 2H74A 3DIEA 4BVXA 1KNGA 5ECIB 4A5PA 4Z2UA 4EE0A 1TP9A 5GSSA 2E2GA 3FK8A 5J3RA 4N3ZA 3FKFA 1XCCA 1X9SB 1G6WA 1UC7A 1ZOFA 2GQMA 2PBJA 3V1WA 2PGTA 2ZCTA 4KNDA 1HNCA 2ON5A 3GKKA 5D96A 4FXYP 5LCZA 3FZ4A 3K8NA 5AISA 4MJAA 2B5EA 1DUGA 3TKRA 3F0IA 3HA9A 2OACA 4O5UA 2YWMA 1XWCA 5D9WA 3HJMA 1Y25A 5J5NA 1BX9A 2DC5A 4AKGA 2DJ3A 2DBCA 1BG1A 1EV4A 3E3EA 4KCAA 4D73A 1R26A 1M3JA 1DSBA 3HVNA 3RGBC 2YJHA 2N5FA 2B1KA 3G9BA 1HD2A 2A2SA 4DSSB 1B9YC 2F8AA 4Q5NA 5JCUA 1ZYQB 3ISOA 4OFNA 3KIJA 4FO5A 3VI7A 4BA7A 4X4JA 4IBPA 12GSA 3FZ5A 3IAM2 4TOPA 3ZRDA 2ZNMA 3P8WA 2DMMA 1ZGNA 3TB2A 1XWKA 2O3EA 1PKZA 4BVXB 4NV2A 3VI5A 2WCIA 2R0PA 4MF6A 1JFUA 5CRWA 1B48A 5INYA 5A4WA 2HSNB 1WWJA 1FVKA 3RBTA 1KBNA 1PKWA 3HJPA 6GSYA 4WBJA 3OR5A 1PQNA 1JLVA 2MZCA 2QA1A 5B6NA 1M3IA 1XVWA 3GH6A 2AAWA 3GFKA 3ZL5A 1ZCPA 2GT5A 5LD0A 5G1KA 4I2UA 1A8YA 3C7MA 1YF0A 1JZWA 5KN0A 4D73B 2K6VA 2FNOA 2O89A 4ZBDA 1GULA 4W66A 1WRYA 2EIQA 3GUSA 2CAQA 5ECNB 1BG5A 2VL9A 4TR4A 4XHMA 1M2BA 4Z2TA 1EWXA 3LG6A 2HRFA 2AJQB 1T7PB 2X64A 1EP8A 2WDUA 2H8LA 3TUEA 2V1MA 4NWYA 1XWGA 1GTAA 3LJRA 2C8UA 4ZBBA 5JCGA 6GSVA 4J57E 2PUKC 3A5IA 5A34A 2PWJA 1NW2A 2V6OA 1T4ZA 2CX4A 1K0BA 5B8BA 3BJ5A 1M2DA 5HFGA 1GUHA 1USBA 1BQ7A 1ST9A 1GUMA 4G19A 2J23A 1EV9A 1B9XC 5ELGA 4NPBA 1LJRA 1TXUA 2H0IA 3TOUA 2MMNA 2L6CA 4GWRA 2RUFA 1IYIA 4K7OA 1PFOA 4HUAA 1I9DA 3C8EA 2VCQA 3F4SA 1KEBA 2IMFA 4MH3A 1V98A 4K5SA 4WR4A 2ZUPA 2WZSA 4ZIJA 2KHPA 4JR6A 2LEGA 3F6FA 4IJIA 4MF7A 3I6AA 1GLPA 3KTLA 1XBSA 3M9JA 3I43A 1JZDA 3CYNA 4KB3A 4PUAA 1UA5A 1X9MB 3D22A 2GZYA 2MBSA 1R5PA 2WW2A 2GDRA 2H30A 3L78A 4ZXGA 2IMDA 5COHA 2WW0A 3GIXA 1AQVA 2CT6A 1UVZA 1BYEA 3UEMA 5DJMA 5A34B 1TXXA 2LNTA 3GV1A 3TKSC 4ZILA 3EYTA 1VF2A 2XPEA 3CXGA 4POKA 1W89A 3TJKA 3HY2A 2H6ZA 3LFLA 3N5OA 2EFDA 1K0OA 1X5EA 2FCHA 1TK5B 1TI3A 2HFDA 1VRSD 1YZXA 4F03A 4IJ3A 2TRXA 1A2MA 2M80A 4GRFA 3H93A 3CTGA 2DKIA 3L9VA 2GGTA 4FH8A 3KMNA 2DIYA 4MPGA 1H4OA 2QKEA 3VWXA 2ES7A 4AJ8A 3KMOA 3BOAA 4TW5A 4ICYA 4Q5FA 5IQYA 3FZ9A 2BTOT 1CQHA 5ECHB 1ZYEA 10GSA 3TRQA 4K0GA 3GKXA 3NZNA 2LRTA 4GXZA 4OO5A 5G1LA 4X1UA 5J4VA 3J7Yb 6GSSA 3GURA 1W4VA 2JZTA 2V32A 1G7EA 4JU5A 2A4VA 3UOMA 1PA3A 1XOBA 3GA4A 4V1Ap 4PQHA 5E59A 2ON7A 4TR0A 1T00A 4PI0C 4QL7A 2R37A 4KSMA 5IMDA 1AW9A 4J2FA 3QPMA 18GSA 3ZMKA 4HZ4A 4IS0A 1V2AA 3D4TA 2H0GA 1THOA 5CAXA 5F06A 2QGVA 3CSIA 3GKNA 4RI7A 4NHWA 3CRUA 3QAGA 1B8XA 1V57A 1XZOA 2NBSA 3GKMA 2DSAA 1OAZA 2CZ2A 5AIXA 1TRVA 1U87A 4HQZA 2LRCA 3IE3A 4L0WA 3PINA 4RUVA 1A2LA 3ZLPA 3TRXA 1EZKA 3DXBA 1GWCA 2NTOA 2JZSA 3KEBA 4LMVA 3P90A 2HI7A 4BWSA 1PMTA 3HJOA 3KD0A 3VFIA 2O5VA 2A2PA 3HVXA 3TDGA 2WULA 1V9WA 1WP0A 3ME7A 4XS4A 3IAS2 4KH7A 2B1LA 2O36A 2JU5A 2H72A 4IVFA 4MF5A 3FR6A 3PPUA 4OWYA 4FYCA 3QOUA 4XRAA 5GSTA 2X8CA 2FA4A 2EIOA 4POBA 4KDUA 3FMWA 4XS1A 2OKAA 2VL2C 2PVOC 6GSWA 4JEDA 5D73A 3VWUA 4H86A 3ZITA 4MABA 1XVQA 3O3TA 3D21A 2K9FA 1Z7PA 3UARA 2IFQA 4V1Ag 5D9XA 4ZB7A 3WD6A 1A0FA 2JL4A 5DCGA 3RHBA 4ID0A 2XC2A 1I1IP 1HQOA 4F2IA 2B5XA 4EIPA 2VUPA 1ACVA 1DE1A 4HU9A 2AHEA 4OFTA 3VURA 2FWGA 3M1GA 2YNXA 2REMA 1ZYNA 4CDOA 4K7IA 4YAPA 2L59A 1ZMAA 5DQYA 1U6TA 4K7NA 3WGDA 3ZVJA 4IW9A 4KF9A 2HXKA 1ZZYA 4F9ZA 4QL9A 1B4QA 2X4AA 2C80A 4XS4B 2Z9SA 1GUKA 4LL1B 1FB0A 5IMFA 2GVPA 5G5FA 1GTUA 4G0KA 3LXZA 2E7PA 4ZL9A 5EPFA 4BIKA 4HEA2 3UBLA 1J08A 4E8HA 4PQIA 4YKGA 4EDYA 4RQRA 1ZYPA 4YAVA 5D9TA 1OE7A 2IFQB 4L5LA 4HQSA 3RPPA 3GTUA 2HSYA 1I5GA 3MIXA 1WMJA 2B7JA 2H6XA 3GNJA 3IDVA 2H70A 2WVYA 4ECIA 2NDOA 3KTBA 2KUCA 1AC1A 4MJBA 2DJ1A 2P5QA 4MP4A 3WGXA 4K1FA 1A0RP 4FQUA 4I6XA 1WE0A 3QCPA 4AKXB 2H73A 3W6GA 4GSNA 2E0QA 4PNGA 1T3BA 4GSSA 5IMCA 3NOFA 2UV8G 4PXOA 5B7CA 3DVXA 4N11A 5DBQA 1SKSB 2DMLA 3ZMLA 3J7Yk 1OYJA 1MDJA 4HSCX 3GH9A 2GZZA 1XW5A 4K8MA 2H1GA 3IHGA 1S3DA 4JRRA 2HLSA 2YOIA 3CWGA 5IOWA 3CHXC 1NM3A 1XFLA 1YF1A 4BVYA 2OE0A 1O7UA 4N0ZA 5JWRB 5H5QA 1PL2A 2A2RA 2M72A 1TU7A 5JWQB 3EVIA 5ELAA 1QGVA 3GL3A 2HRAA 3GX8A 2R3XA 3APQA 3HYPA 1XPVA 1YDKA 2RLIA 2LJKA 3M9KA 5HR2A 3GTUB 4MJCA 3H8QA 1SJIA 2CX3A 4O7HA 3QR6A 4TXOA 4ZBAA 4PI2C 5IMAA 9GSSA 3ZIVA 1Q4JA 3JCML 2LJAA 5CP1A 1U3AA 5KN2A 2GQLA 3O76A 3ED3A 1ERTA 3HMJG 2JACA 2GSTA 1LBKA 2HSMA 2CVBA 3KH7A 4NMUA 4E8EA 4V2LA 1ERWA 1N2AA 2LNSA 1A23A 3CQFA 2WVXA 5DVBA 2O7KA 4GQFA 3EU4A 4PGTA 3MAKA 3GX0A 4MZBA 1SJZA 2WB9A 2VIMA 1SKWB 3MNGA 3TJBA 4KSOA 4XRDA 4GSTA 4EXJA 4LLRA 3LORA 1M9AA 5B8AA 3FEUA 1TRSA 2YV7A 4BVYB 3EMPA 1K3YA 2CVKA 3GRXA 1PN0A 3R2QA 4PUFC 2K18A 1TJDA 5GZZB 1FB6A 5L71A 2LQQA 2AUVA 3EU3A 4EVMA 4L0UA 3IA1A 1Z6MA 2VLUA 4TXOB 2YZHA 3QFBC 3ME8A 3DVWA 4XTSA 4KE3A 4JE1A 5ECRB 3MYDA 1S3RA 4IN0A 1PX7A 2QC7A 3KZQA 2VLTA 1K3OA 4IP1A 1AUCA 3GN3A 4I2TA 2N5AA 3DD3A 5IO2A 3C71A 1X0RA 2HRNA 8GSSA 4DSRA 1WJKA 4BWQA 2XPDA 3UVHA 1SENA 3C73A 4GCIA 1MD3A 2YN1A 5KN1A 2HSMB 4N10A 1AQWA 3EWLA 2WVXB 2H01A 3RHCA 2CZ3A 1JZRA 1AAZA 2HRKA 3S9FA 3FZAA 5DAKA 2D2ZA 3FR3A 5D93A 1EEMA 3GYKA 1EOHA 1C72A 3F6DA 2MYGA 4KAEA 1WOUA 4YQUA 4G01A 3F63A 2O8VB 3MWHA 4I97A 1ON4A 1PRXA 2G0FA 3DMLA 4IGJA 3MSZA 5LNKe 5C00A 5A5HA 3UL3A 1FHEA 2CAIA 5EVOA 4K2XA 3FHKA 1V58A 4ILFA 2TIRA 4EL1A 4X0XA 3TCOA 1NHOA 1YEPA 2H76A 2JSYA 4I8BA 1VF4A 3IHQA 6GSTA 4YH2A 3LEFA 1OVNA 4L5OA 2EC4A 5ECOB 1VF1A 5FT3A 3LGCA 4POMA 3FYGA 2KOKA 2XBIA 4MA9A 2L57A 1TKDB 1BJXA 3HD5A 4O32A 3TKPA 6GSUA 2VL3A 2B6MA 3MDKA 3HXSA 2H71A 3TU3B 2HRKB 5DAKB 1EP7A 4EKZA 5B6MA 3QDNA 2VKZG 1XIYA 1SK0A 2VAFA 4ECJA 2HZEA 5GAPD 1SL0B 4WR5A 3VPQA 14GSA 2PN8A 2YCDA 1TK8B 2PMTA 3GSSA 2LV3A 3KGKA 4G10A 2I4AA 1RW1A 4OD7A 2LRNA 1YQ1A 3M0FA 2OE1A 3FRCA 5A5HB 3LYPA 4BL7A 2XHFA 4JR4A 1GSDA 1HNAA 5CRDA 1A2JA 2OJLA 1SVLA 3L9UA 5BMUA 1QK8A 3TOTA 4MZWA 3IK7A 1TDIA 1EGOA 1R4WA 3U5RE 2QSIA 2IPAA 3KP8A 2OBKA 3D0ZA 5FHIA 1A8LA 1N8JA 2BJXA 4PTSA 1TOFA 2F8FA 2WW1A 3D6IA 1QMVA 5KN3A 1F3BA 1QFNA 3A2WA 3FY7A 5D8IA 3DEXA 2NPBA 3TRPA 1NHYA 2LQOA 2MMAA 4Q5RA 2RM6A 1M9BA 3IPZA 5ID2A 5G30A 3ZFBA 1Z5YE 1XOAA 4ZB9A 3RPNA 1H75A 2WFCA 4PHZC 3D5JA 2IIYA 3PGTA 5HR1A 2RM5A 3HZ8A 2HZEB 3L4NA 4YQMA 1K3LA 1WPIA 5KEJA 2NVLA 4MCUA 3TJFA 2C0EA 2FD3A 1CQGA 1T1VA 4HJ2A 1TU8A 2R2JA 2FHEA 4X43A 3W8JA 1BEDA 4TVEA 4USSA 3IC8A 5AGYA 2OA7A 5J47A 3LW9A 4KA0A 1PD21 3IR4A 2GSSA 5BMUB 5H5SA 3SBCA 4Z2RA 2J9HA 3ZZXA 1T4YA 5ECMB 3I9V2 5HFIA 4DSQA 4KUNA 1K0AA 5G31A 3KM6A 4K0NA 2H0HA 1U88A 3A2VA 1M2AA 2YJ7A 2WJUA 5A4VA 2BMXA 1VF3A 1XW6A 4ISDA 1ML6A 2X8GA 2H1LA 1Z7RA 4V2NA 1FVJA 1M7TA 3FW2A 3KXOA 1HYUA 4YKFA 1YVLA 3ZYWA 2FY6A 4MK3A 5DCHA 4RI6A 1GP1A 3KCMA 4TXVA 2B5YA 4PQ1A 2EFCA 2VO4A 3UAPA 1OC9A 5ID2B 19GSA 4N0VA 1EEJA 2WS2A 4N30A 1TK0B 2R6KA 1MTCA 4KX4A 3EMXA 5J4UA 4AKIA 4LA1A 3A2XA 3BCIA 4P3YB 5E4WA 3TJJA 2H1DA 3GSTA 4L8EA 3KJYA 5HR0A 4LL4B 2OADA 5J9BA 2P31A 5D9VA 1V40A 2EIRA 3HZ4A 4CHSA 3UMAA 4K2DA 1Y6EA 2YZUA 2K8VA 1MDKA 3IC4A 2VM2A 5IOXA 5C04A 2VCVA 2CV4A 1Z6NA 2FA8A 1ABAA 2VCTA 2YP6A 1JZOA 2O85A 2WRTA 3D4MA 3IOSA 1THXA 4I5QA 2L5LA 4ECCA 5F07A 1PX6A 2KP1A 1GTBA 3CSJA 2HNLA 5J40A 1OC9B 2GT6A 3M8NA 3VLNA 2C0DA 1K0MA 2C4JA 3O6TA 1AQXA 4F82A 1R5AA 5G5EA 2I3YA 2WZ9A 2HSNA 1XWBA 5GAND 3PH9A 3TKSE 5DDLA 2R0CA 2IN3A 4AF2A 3GHAA 3F9UA 2DLXA 2V2GA 1GNEA 2VCXA 5JCWA 1F9MA 1SK2A 2P0GA 1K0CA 1FG4A 2RUEA 1S4BP 5J41A 5FWGA 2FWEA 1RQMA 3KH9A 2DJJA 1GLQA 4FYBA 4EDZA 2K8SA 1F37A 1ZL9A 4WF4A 1SYRA 5A1NA 1TW9A 3UJ1A 4CY6A 1ERVA 2JADA 2YANA 5IO0A 3EPTA 3ERFA 2C0GA 3SWLA 2H1BA 3F8UA 3G7YA 1U3IA 4ZL8A 4MJEA 2IMEA 1QUWA 3DWVA 20GSA 2HE3A 1J0FA 1TTZA 1R7HA 4IP6A 3QAVA 5EY6A 4ZB8A 1HNBA 4V2MA 1G7OA 4ULXA 1UN2A 3AY8A 2LTKA 3ZFLA 4IKHA 2F9SA 4ECBA 1T8EB 1SVOA 2WW3A 1E6BA 2XBQA 4GLTA 5G2ZA 2LSTA 1GNWA 2AV4A 5BRTA 1NSWA 4KDXA 2LUSA 1YKCA 1X5CA 1O73A 4K5RA 5ABRA 5ECSA 4CY8A 4QQ7A 1XWAA 3BBYA 2I1UA 4ML6A 2H19A 2E2MA 4AJ7A 3IRAA 1SJ6A 4OCEA 1GH2A 5HFKA 2KP2A 3H1NA 3DKSA 3L9SA 4KCEA 3F4TA 2H75A 1LU4A 2L4QA 1A24A 3I69A 5A1NB 2VD0A 4RQXA 2H6YA 3LQ7A 4ML1A 3Q6OA 2RIIA 1O81A 1DBYA 3DYRA 4ACSA 4AI6A 2FGXA 2LS5A 4F0CA 2JZRA 3ZREA 5KOXA 4G0LA 2B3SA 4YQVA 1OE8A 5F05A 2VOCA 5HR3A 4OFMA 4XCSA 2LJRA 3UVTA 3A5WA 1YKAA 2KLXA 4HJMA 1URMA 4WXTA 3A3TA 1JHBA 4K6XA 4ZL7A 4DVCA 1YJ6A 3G7IA 3ZVJD 1J9BA 2C1YA 2CQ9A 2HZFA 1SYXA 2I81A 2L4CA 4IQ1A 4EUYA 4Z7XA 4XIHA 1X9WB 3TKSA 3P7XA 2L5OA 4KW6A 2OE3A 2IMKA 1Y1UA 4EO3A 3IXRA 2HT9A 3F3QA 3LYKA 4IELA 4HDEA 4MH2A 3C1SA 4O5RA 1SL1B 2X49A 6GSXA 5CYYA 1XW9A 4NHZA 2N5BA 4PURA 1G0TA 1ILOA 2P5RA 2VM1A 3VK9A 1ERUA 1TRUA 3WYWA 4HS1A 3HCZA 2CVDA 3C1RA 2I9HA 2TRCP 3FR9A 4FYUA 4DEJA 5J9CA 1GRXA 4GF0A 3BCKA 4MZCA 2V6KA 5ECPB 4TN8A 4K9ZA 2ALBA 4NXIA 2OBIA 4PNFA 3HVSA 1OKTA 4HU7A 2HYXA 3QD9A 1F2EA 1PGTA 2GTUA 3F4RA 3IBHA 4MDCA 4JZQA 5IMZA 5CREA 4JBBA 2AYTA 2PVQA 5IMVA 2HQTA 1OKDA 1GSQA 2MMOA 4WBRD 1X5DA 2C0FA 2QA2A 3RAZA 4PX1A 2C3TA 3Q74A 2WVZA 7GSSA 3F3RA 3M3MA 2GQKA 3KP9A 3HDCA 4O5QA 1PL1A 5A5KA 2G2QA 1S3CA 4AGSA 1SK1A 3QMXA 2GLRA 3CRTA 5ECQB 3UBKA 3HHVA 2MMZA 4TRXA 3DGQA 5CRHA 2DKHA 16GSA 17GSA 2GS3A 3U6VA 4G9HA 1S3AA 1YY7A 2MBTA 1OC8A 4O92A 5IIZA 1F3AA 4G2EA 1F6MC 1Q98A 1BF5A 1DE2A 1SD8A 4TR3A 2FLSA 2H66A 1E2YA 2F3MA 1GSEA 4KGIA 3PR8A 3CBUA 5CNWA 2YWIA 2X99A 1N25A 2YWOA 2A4HA 1GSSA 2GSQA 4BPYA 5EL8A 4TR1A 3GMFA 1RK4A 3L0HA 2YV9A 1PN9A 3VWVA 1O8WA 4WF5A 2PERA 2FWHA 5AN1A 5HQPA 1TRWA 3Q18A 5A4UA 4MMMA 4GTUA 2B7KA 1SKRB 4EIQA 2V41A 4TKYA 2DIZA 4CW9A 1SL2B 4HOJA 1GSYA 5CO3A 5ENUA 5DALA 1O6JA 3QFAC 2AB6A 2UZ8A 5DQSA 4ZB6A 4XS6A 3W8SA 3ERWA 4MNNA 2EFEA 4WEYA 3HKRA 2R0GA 3TJGA 1FOHA 5JWOB 4GQCA 2VCWA 4IQAA 2PU9C 1JLWA 5ECLB 3P2AA 4EF0A 1FO5A 2VL2A 1GL8A 2C3QA 1XG8A 2YPMA 3BD2A 2DJKA 2R5GA 2GZPA 4IHUA 5AIVA 1K0NA 3E0UA
chains in the Genus database with same CATH topology
2OT3A 1QQ2A 3N9JA 3TGZA 4HZ2A 3TKQA 4NV5A 2M46A 3H4KA 4WKWA 3E9JB 3EINA 2DJ0A 4KDYA 1PSQA 1M99A 4TR1B 4BL7B 4Q5QA 4AKHA 5F0GA 1AXDA 3G7JA 1BAYA 2PPTA 5IPGA 1B4PA 2F51A 4FIWA 2IL3A 1KTEA 1EOGA 3DRNA 3US3A 3H79A 1YEXA 2IWTA 1K0DA 2VCZA 2LKUA 4OO4A 1VGLA 3ERGA 1Z3EA 1IYHA 1MD4A 5DALB 1MDIA 5DJLA 1WIKA 5F8BA 2O87A 3ZIJA 4EC0A 4NAXA 2GSRA 2EFHA 4QMKA 3QAWA 5KOWA 3CSHA 1AIUA 3LWAA 4AJ6A 2HSHA 3VWWA 3UIWA 5J4YA 5IM9A 1GTIA 4E68A 2YWNA 4HI7A 1GSFA 4F0BA 3WT1A 2FUG2 2IJYA 5ECKB 11GSA 4POLA 1QXHA 2DJ2A 3CMIA 3IK9A 3NIVA 2H1AA 2VD1A 5IPHA 1MEKA 1O85A 1G6YA 3APOA 1FOVA 3EC3A 1EGRA 3VPTA 1SVMA 2R4VA 2X8HA 2CA8A 4G0IA 3IV4A 22GSA 3HVVA 4LMWA 13GSA 3GL5A 3CTFA 1OC3A 4GDFA 1O8XA 1Z9HA 1FAAA 3WGEA 5H5RA 1SU9A 1M0UA 4OCFA 2FWFA 3APSA 3WT2A 2C3NA 1FW1A 4DSSA 1GSUA 1SD9A 2WGRA 4OMVA 2IMIA 5CRGA 3R3EA 3RDWA 3ZTLA 3EURA 3Q19A 2L6DA 4MPFA 2VLVA 1TI1A 1XXUA 4J56E 4MLYA 2JSZA 3EE2A 3LXTA 3LSZA 4WETA 2H74A 3DIEA 4BVXA 1KNGA 5ECIB 4A5PA 4Z2UA 4EE0A 1TP9A 5GSSA 2E2GA 3FK8A 5J3RA 4N3ZA 3FKFA 1XCCA 1X9SB 1G6WA 1UC7A 1ZOFA 2GQMA 2PBJA 3V1WA 2PGTA 2ZCTA 4KNDA 1HNCA 2ON5A 3GKKA 5D96A 5LCZA 3FZ4A 3K8NA 5AISA 4MJAA 2B5EA 1DUGA 3TKRA 3F0IA 3HA9A 2OACA 4O5UA 2YWMA 1XWCA 5D9WA 3HJMA 1Y25A 5J5NA 1BX9A 2DC5A 4AKGA 2DJ3A 2DBCA 1BG1A 1EV4A 3E3EA 4KCAA 4D73A 1R26A 1DSBA 2YJHA 2N5FA 2B1KA 3G9BA 1HD2A 2A2SA 4DSSB 1B9YC 2F8AA 4Q5NA 5JCUA 1ZYQB 3ISOA 4OFNA 3KIJA 4FO5A 3VI7A 4BA7A 4X4JA 4IBPA 12GSA 3FZ5A 3IAM2 4TOPA 3ZRDA 2ZNMA 3P8WA 2DMMA 1ZGNA 3TB2A 1XWKA 1PKZA 4BVXB 4NV2A 3VI5A 2WCIA 2R0PA 4MF6A 1JFUA 5CRWA 1B48A 5INYA 5A4WA 2HSNB 1WWJA 1FVKA 3RBTA 1KBNA 1PKWA 3HJPA 6GSYA 4WBJA 3OR5A 1PQNA 1JLVA 2MZCA 2QA1A 5B6NA 1XVWA 3GH6A 2AAWA 3GFKA 3ZL5A 1ZCPA 2GT5A 5LD0A 5G1KA 4I2UA 1A8YA 3C7MA 1YF0A 1JZWA 5KN0A 4D73B 2K6VA 2FNOA 2O89A 4ZBDA 1GULA 4W66A 1WRYA 2EIQA 3GUSA 2CAQA 5ECNB 1BG5A 2VL9A 4TR4A 4XHMA 1M2BA 4Z2TA 1EWXA 3LG6A 2HRFA 2AJQB 1T7PB 2X64A 1EP8A 2WDUA 2H8LA 3TUEA 2V1MA 4NWYA 1XWGA 1GTAA 3LJRA 2C8UA 4ZBBA 5JCGA 6GSVA 4J57E 2PUKC 3A5IA 5A34A 2PWJA 1NW2A 2V6OA 1T4ZA 2CX4A 1K0BA 5B8BA 3BJ5A 1M2DA 5HFGA 1GUHA 1USBA 1BQ7A 1ST9A 1GUMA 4G19A 2J23A 1EV9A 1B9XC 5ELGA 4NPBA 1LJRA 1TXUA 2H0IA 3TOUA 2MMNA 2L6CA 4GWRA 2RUFA 1IYIA 4K7OA 4HUAA 1I9DA 3C8EA 2VCQA 3F4SA 1KEBA 2IMFA 4MH3A 1V98A 4K5SA 4WR4A 2ZUPA 4ZIJA 2KHPA 4JR6A 2LEGA 3F6FA 4IJIA 4MF7A 3I6AA 1GLPA 3KTLA 1XBSA 3M9JA 3I43A 1JZDA 3CYNA 4KB3A 4PUAA 1UA5A 1X9MB 3D22A 2GZYA 2MBSA 1R5PA 2GDRA 2H30A 3L78A 4ZXGA 2IMDA 5COHA 3GIXA 1AQVA 2CT6A 1UVZA 1BYEA 3UEMA 5DJMA 5A34B 1TXXA 2LNTA 3GV1A 3TKSC 4ZILA 3EYTA 1VF2A 2XPEA 3CXGA 4POKA 1W89A 3TJKA 3HY2A 2H6ZA 3LFLA 3N5OA 2EFDA 1K0OA 1X5EA 2FCHA 1TK5B 1TI3A 2HFDA 1VRSD 1YZXA 4F03A 4IJ3A 2TRXA 1A2MA 2M80A 4GRFA 3H93A 3CTGA 2DKIA 3L9VA 2GGTA 4FH8A 3KMNA 2DIYA 4MPGA 1H4OA 2QKEA 3VWXA 2ES7A 4AJ8A 3KMOA 3BOAA 4TW5A 4ICYA 4Q5FA 5IQYA 3FZ9A 2BTOT 1CQHA 5ECHB 1ZYEA 10GSA 3TRQA 4K0GA 3GKXA 3NZNA 2LRTA 4GXZA 4OO5A 5G1LA 4X1UA 5J4VA 3J7Yb 6GSSA 3GURA 1W4VA 2JZTA 2V32A 1G7EA 4JU5A 2A4VA 3UOMA 1PA3A 1XOBA 3GA4A 4V1Ap 4PQHA 5E59A 2ON7A 4TR0A 1T00A 4QL7A 2R37A 4KSMA 5IMDA 1AW9A 4J2FA 3QPMA 18GSA 3ZMKA 4HZ4A 4IS0A 1V2AA 3D4TA 2H0GA 1THOA 5CAXA 5F06A 2QGVA 3CSIA 3GKNA 4RI7A 4NHWA 3CRUA 3QAGA 1B8XA 1V57A 1XZOA 2NBSA 3GKMA 2DSAA 1OAZA 2CZ2A 5AIXA 1TRVA 1U87A 4HQZA 2LRCA 3IE3A 4L0WA 3PINA 4RUVA 1A2LA 3ZLPA 3TRXA 1EZKA 3DXBA 1GWCA 2NTOA 2JZSA 3KEBA 4LMVA 3P90A 2HI7A 4BWSA 1PMTA 3HJOA 3KD0A 3VFIA 2O5VA 2A2PA 3HVXA 3TDGA 2WULA 1V9WA 1WP0A 3ME7A 4XS4A 3IAS2 4KH7A 2B1LA 2JU5A 2H72A 4IVFA 4MF5A 3FR6A 3PPUA 4OWYA 4FYCA 3QOUA 4XRAA 5GSTA 2X8CA 2FA4A 2EIOA 4POBA 4KDUA 3FMWA 4XS1A 2OKAA 2VL2C 2PVOC 6GSWA 4JEDA 5D73A 3VWUA 4H86A 3ZITA 4MABA 1XVQA 3O3TA 3D21A 2K9FA 1Z7PA 3UARA 2IFQA 4V1Ag 5D9XA 4ZB7A 3WD6A 1A0FA 2JL4A 5DCGA 3RHBA 4ID0A 2XC2A 1HQOA 4F2IA 2B5XA 4EIPA 2VUPA 1ACVA 1DE1A 4HU9A 2AHEA 4OFTA 3VURA 2FWGA 3M1GA 2YNXA 2REMA 1ZYNA 4CDOA 4K7IA 4YAPA 2L59A 1ZMAA 5DQYA 1U6TA 4K7NA 3WGDA 3ZVJA 4IW9A 4KF9A 2HXKA 1ZZYA 4F9ZA 4QL9A 1B4QA 2X4AA 2C80A 4XS4B 2Z9SA 1GUKA 4LL1B 1FB0A 5IMFA 2GVPA 5G5FA 1GTUA 4G0KA 3LXZA 2E7PA 4ZL9A 5EPFA 4HEA2 3UBLA 1J08A 4E8HA 4PQIA 4YKGA 4EDYA 4RQRA 1ZYPA 4YAVA 5D9TA 1OE7A 2IFQB 4L5LA 4HQSA 3RPPA 3GTUA 2HSYA 1I5GA 3MIXA 1WMJA 2B7JA 2H6XA 3GNJA 3IDVA 2H70A 4ECIA 2NDOA 3KTBA 2KUCA 1AC1A 4MJBA 2DJ1A 2P5QA 4MP4A 3WGXA 4K1FA 1A0RP 4FQUA 4I6XA 1WE0A 3QCPA 4AKXB 2H73A 3W6GA 4GSNA 2E0QA 4PNGA 1T3BA 4GSSA 5IMCA 3NOFA 2UV8G 4PXOA 5B7CA 3DVXA 4N11A 5DBQA 1SKSB 2DMLA 3ZMLA 3J7Yk 1OYJA 1MDJA 3GH9A 2GZZA 1XW5A 4K8MA 2H1GA 3IHGA 1S3DA 4JRRA 2HLSA 2YOIA 3CWGA 5IOWA 1NM3A 1XFLA 1YF1A 4BVYA 2OE0A 1O7UA 4N0ZA 5JWRB 5H5QA 1PL2A 2A2RA 2M72A 1TU7A 5JWQB 3EVIA 5ELAA 1QGVA 3GL3A 2HRAA 3GX8A 2R3XA 3APQA 3HYPA 1XPVA 1YDKA 2RLIA 2LJKA 3M9KA 5HR2A 3GTUB 4MJCA 3H8QA 1SJIA 2CX3A 4O7HA 3QR6A 4TXOA 4ZBAA 5IMAA 9GSSA 3ZIVA 1Q4JA 3JCML 2LJAA 5CP1A 1U3AA 5KN2A 2GQLA 3O76A 3ED3A 1ERTA 3HMJG 2JACA 2GSTA 1LBKA 2HSMA 2CVBA 3KH7A 4NMUA 4E8EA 4V2LA 1ERWA 1N2AA 2LNSA 1A23A 5DVBA 2O7KA 4GQFA 3EU4A 4PGTA 3MAKA 3GX0A 4MZBA 1SJZA 2WB9A 2VIMA 1SKWB 3MNGA 3TJBA 4KSOA 4XRDA 4GSTA 4EXJA 4LLRA 3LORA 1M9AA 5B8AA 3FEUA 1TRSA 2YV7A 4BVYB 3EMPA 1K3YA 2CVKA 3GRXA 1PN0A 3R2QA 4PUFC 2K18A 1TJDA 5GZZB 1FB6A 5L71A 2LQQA 2AUVA 3EU3A 4EVMA 4L0UA 3IA1A 1Z6MA 2VLUA 4TXOB 2YZHA 3QFBC 3ME8A 3DVWA 4XTSA 4KE3A 4JE1A 5ECRB 3MYDA 4IN0A 1PX7A 2QC7A 3KZQA 2VLTA 1K3OA 4IP1A 1AUCA 3GN3A 4I2TA 2N5AA 3DD3A 5IO2A 3C71A 1X0RA 2HRNA 8GSSA 4DSRA 1WJKA 4BWQA 2XPDA 3UVHA 1SENA 3C73A 4GCIA 1MD3A 2YN1A 5KN1A 2HSMB 4N10A 1AQWA 3EWLA 2H01A 3RHCA 2CZ3A 1JZRA 1AAZA 2HRKA 3S9FA 3FZAA 5DAKA 2D2ZA 3FR3A 5D93A 1EEMA 3GYKA 1EOHA 1C72A 3F6DA 2MYGA 4KAEA 1WOUA 4YQUA 4G01A 3F63A 2O8VB 3MWHA 4I97A 1ON4A 1PRXA 2G0FA 3DMLA 4IGJA 3MSZA 5LNKe 5C00A 5A5HA 3UL3A 1FHEA 2CAIA 5EVOA 4K2XA 3FHKA 1V58A 4ILFA 2TIRA 4EL1A 4X0XA 3TCOA 1NHOA 1YEPA 2H76A 2JSYA 4I8BA 1VF4A 3IHQA 6GSTA 4YH2A 3LEFA 1OVNA 4L5OA 2EC4A 5ECOB 1VF1A 5FT3A 3LGCA 4POMA 3FYGA 2KOKA 2XBIA 4MA9A 2L57A 1TKDB 1BJXA 3HD5A 4O32A 3TKPA 6GSUA 2VL3A 2B6MA 3MDKA 3HXSA 2H71A 3TU3B 2HRKB 5DAKB 1EP7A 4EKZA 5B6MA 3QDNA 2VKZG 1XIYA 1SK0A 2VAFA 4ECJA 2HZEA 5GAPD 1SL0B 4WR5A 3VPQA 14GSA 2PN8A 2YCDA 1TK8B 2PMTA 3GSSA 2LV3A 3KGKA 4G10A 2I4AA 1RW1A 4OD7A 2LRNA 1YQ1A 3M0FA 2OE1A 3FRCA 5A5HB 3LYPA 4BL7A 2XHFA 4JR4A 1GSDA 1HNAA 5CRDA 1A2JA 2OJLA 1SVLA 3L9UA 5BMUA 1QK8A 3TOTA 4MZWA 3IK7A 1TDIA 1EGOA 1R4WA 3U5RE 2QSIA 2IPAA 3KP8A 2OBKA 3D0ZA 5FHIA 1A8LA 1N8JA 2BJXA 4PTSA 1TOFA 2F8FA 3D6IA 1QMVA 5KN3A 1F3BA 1QFNA 3A2WA 3FY7A 5D8IA 3DEXA 2NPBA 3TRPA 1NHYA 2LQOA 2MMAA 4Q5RA 2RM6A 1M9BA 3IPZA 5ID2A 5G30A 3ZFBA 1Z5YE 1XOAA 4ZB9A 3RPNA 1H75A 2WFCA 3D5JA 2IIYA 3PGTA 5HR1A 2RM5A 3HZ8A 2HZEB 3L4NA 4YQMA 1K3LA 1WPIA 5KEJA 2NVLA 4MCUA 3TJFA 2C0EA 2FD3A 1CQGA 1T1VA 4HJ2A 1TU8A 2R2JA 2FHEA 4X43A 3W8JA 1BEDA 4TVEA 4USSA 3IC8A 5AGYA 2OA7A 5J47A 3LW9A 4KA0A 1PD21 3IR4A 2GSSA 5BMUB 5H5SA 3SBCA 4Z2RA 2J9HA 3ZZXA 1T4YA 5ECMB 3I9V2 5HFIA 4DSQA 4KUNA 1K0AA 5G31A 3KM6A 4K0NA 2H0HA 1U88A 3A2VA 1M2AA 2YJ7A 2WJUA 5A4VA 2BMXA 1VF3A 1XW6A 4ISDA 1ML6A 2X8GA 2H1LA 1Z7RA 4V2NA 1FVJA 1M7TA 3FW2A 3KXOA 1HYUA 4YKFA 1YVLA 3ZYWA 2FY6A 4MK3A 5DCHA 4RI6A 1GP1A 3KCMA 4TXVA 2B5YA 4PQ1A 2EFCA 2VO4A 3UAPA 1OC9A 5ID2B 19GSA 4N0VA 1EEJA 2WS2A 4N30A 1TK0B 2R6KA 1MTCA 4KX4A 3EMXA 5J4UA 4AKIA 4LA1A 3A2XA 3BCIA 4P3YB 5E4WA 3TJJA 2H1DA 3GSTA 4L8EA 3KJYA 5HR0A 4LL4B 2OADA 5J9BA 2P31A 5D9VA 1V40A 2EIRA 3HZ4A 4CHSA 3UMAA 4K2DA 1Y6EA 2YZUA 2K8VA 1MDKA 3IC4A 2VM2A 5IOXA 5C04A 2VCVA 2CV4A 1Z6NA 2FA8A 1ABAA 2VCTA 2YP6A 1JZOA 2O85A 2WRTA 3D4MA 3IOSA 1THXA 4I5QA 2L5LA 4ECCA 5F07A 1PX6A 2KP1A 1GTBA 3CSJA 2HNLA 5J40A 1OC9B 2GT6A 3M8NA 3VLNA 2C0DA 1K0MA 2C4JA 3O6TA 1AQXA 4F82A 1R5AA 5G5EA 2I3YA 2WZ9A 2HSNA 1XWBA 5GAND 3PH9A 3TKSE 5DDLA 2R0CA 2IN3A 4AF2A 3GHAA 3F9UA 2DLXA 2V2GA 1GNEA 2VCXA 5JCWA 1F9MA 1SK2A 2P0GA 1K0CA 1FG4A 2RUEA 5J41A 5FWGA 2FWEA 1RQMA 3KH9A 2DJJA 1GLQA 4FYBA 4EDZA 2K8SA 1F37A 1ZL9A 4WF4A 1SYRA 5A1NA 1TW9A 3UJ1A 4CY6A 1ERVA 2JADA 2YANA 5IO0A 3EPTA 3ERFA 2C0GA 3SWLA 2H1BA 3F8UA 3G7YA 1U3IA 4ZL8A 4MJEA 2IMEA 1QUWA 3DWVA 20GSA 2HE3A 1J0FA 1TTZA 1R7HA 4IP6A 3QAVA 5EY6A 4ZB8A 1HNBA 4V2MA 1G7OA 4ULXA 1UN2A 3AY8A 2LTKA 3ZFLA 4IKHA 2F9SA 4ECBA 1T8EB 1SVOA 1E6BA 2XBQA 4GLTA 5G2ZA 2LSTA 1GNWA 2AV4A 5BRTA 1NSWA 4KDXA 2LUSA 1YKCA 1X5CA 1O73A 4K5RA 5ABRA 5ECSA 4CY8A 4QQ7A 1XWAA 3BBYA 2I1UA 4ML6A 2H19A 2E2MA 4AJ7A 3IRAA 1SJ6A 4OCEA 1GH2A 5HFKA 2KP2A 3H1NA 3DKSA 3L9SA 4KCEA 3F4TA 2H75A 1LU4A 2L4QA 1A24A 3I69A 5A1NB 2VD0A 4RQXA 2H6YA 3LQ7A 4ML1A 3Q6OA 2RIIA 1O81A 1DBYA 3DYRA 4ACSA 4AI6A 2FGXA 2LS5A 4F0CA 2JZRA 3ZREA 5KOXA 4G0LA 2B3SA 4YQVA 1OE8A 5F05A 2VOCA 5HR3A 4OFMA 4XCSA 2LJRA 3UVTA 3A5WA 1YKAA 2KLXA 4HJMA 1URMA 4WXTA 3A3TA 1JHBA 4K6XA 4ZL7A 4DVCA 1YJ6A 3G7IA 3ZVJD 1J9BA 2C1YA 2CQ9A 2HZFA 1SYXA 2I81A 2L4CA 4IQ1A 4EUYA 4Z7XA 4XIHA 1X9WB 3TKSA 3P7XA 2L5OA 4KW6A 2OE3A 2IMKA 1Y1UA 4EO3A 3IXRA 2HT9A 3F3QA 3LYKA 4IELA 4HDEA 4MH2A 3C1SA 4O5RA 1SL1B 2X49A 6GSXA 5CYYA 1XW9A 4NHZA 2N5BA 4PURA 1G0TA 1ILOA 2P5RA 2VM1A 3VK9A 1ERUA 1TRUA 3WYWA 4HS1A 3HCZA 2CVDA 3C1RA 2I9HA 2TRCP 3FR9A 4FYUA 4DEJA 5J9CA 1GRXA 4GF0A 3BCKA 4MZCA 2V6KA 5ECPB 4TN8A 4K9ZA 2ALBA 4NXIA 2OBIA 4PNFA 3HVSA 1OKTA 4HU7A 2HYXA 3QD9A 1F2EA 1PGTA 2GTUA 3F4RA 3IBHA 4MDCA 4JZQA 5IMZA 5CREA 4JBBA 2AYTA 2PVQA 5IMVA 2HQTA 1OKDA 1GSQA 2MMOA 4WBRD 1X5DA 2C0FA 2QA2A 3RAZA 4PX1A 2C3TA 3Q74A 7GSSA 3F3RA 3M3MA 2GQKA 3KP9A 3HDCA 4O5QA 1PL1A 5A5KA 2G2QA 1S3CA 4AGSA 1SK1A 3QMXA 2GLRA 3CRTA 5ECQB 3UBKA 3HHVA 2MMZA 4TRXA 3DGQA 5CRHA 2DKHA 16GSA 17GSA 2GS3A 3U6VA 4G9HA 1S3AA 1YY7A 2MBTA 1OC8A 4O92A 5IIZA 1F3AA 4G2EA 1F6MC 1Q98A 1BF5A 1DE2A 1SD8A 4TR3A 2FLSA 2H66A 1E2YA 2F3MA 1GSEA 4KGIA 3PR8A 3CBUA 5CNWA 2YWIA 2X99A 1N25A 2YWOA 2A4HA 1GSSA 2GSQA 4BPYA 5EL8A 4TR1A 3GMFA 1RK4A 3L0HA 2YV9A 1PN9A 3VWVA 1O8WA 4WF5A 2PERA 2FWHA 5AN1A 5HQPA 1TRWA 3Q18A 5A4UA 4MMMA 4GTUA 2B7KA 1SKRB 4EIQA 2V41A 4TKYA 2DIZA 4CW9A 1SL2B 4HOJA 1GSYA 5CO3A 5ENUA 5DALA 1O6JA 3QFAC 2AB6A 2UZ8A 5DQSA 4ZB6A 4XS6A 3W8SA 3ERWA 4MNNA 2EFEA 4WEYA 3HKRA 2R0GA 3TJGA 1FOHA 5JWOB 4GQCA 2VCWA 4IQAA 2PU9C 1JLWA 5ECLB 3P2AA 4EF0A 1FO5A 2VL2A 1GL8A 2C3QA 2YPMA 3BD2A 2DJKA 2R5GA 2GZPA 4IHUA 5AIVA 1K0NA 3E0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ2 A;  3N9J A;  3TGZ A;  4HZ2 A;  3TKQ A;  4NV5 A;  2M46 A;  3H4K A;  4WKW A;  3E9J B;  3EIN A;  2DJ0 A;  4KDY A;  1PSQ A;  1M99 A;  4TR1 B;  4BL7 B;  4Q5Q A;  5F0G A;  1AXD A;  3G7J A;  1BAY A;  2PPT A;  5IPG A;  1B4P A;  2F51 A;  4FIW A;  2IL3 A;  1KTE A;  1EOG A;  3DRN A;  3US3 A;  3H79 A;  1YEX A;  2IWT A;  1K0D A;  2VCZ A;  2LKU A;  4OO4 A;  1VGL A;  3ERG A;  1Z3E A;  1IYH A;  1MD4 A;  5DAL B;  1MDI A;  5DJL A;  1WIK A;  5F8B A;  2O87 A;  3ZIJ A;  4EC0 A;  4NAX A;  2GSR A;  3QAW A;  3CSH A;  1AIU A;  3LWA A;  4AJ6 A;  2HSH A;  3VWW A;  3UIW A;  5IM9 A;  1GTI A;  2YWN A;  4HI7 A;  1GSF A;  4F0B A;  3WT1 A;  2FUG 2;  2IJY A;  5ECK B;  11GS A;  4POL A;  1QXH A;  2DJ2 A;  3CMI A;  3IK9 A;  3NIV A;  2H1A A;  2VD1 A;  5IPH A;  1MEK A;  1O85 A;  1G6Y A;  3APO A;  1FOV A;  3EC3 A;  1EGR A;  3VPT A;  2R4V A;  2X8H A;  2CA8 A;  4G0I A;  3IV4 A;  22GS A;  3HVV A;  4LMW A;  13GS A;  3GL5 A;  3CTF A;  1OC3 A;  1O8X A;  1Z9H A;  1FAA A;  3WGE A;  5H5R A;  1SU9 A;  1M0U A;  4OCF A;  2FWF A;  3APS A;  3WT2 A;  2C3N A;  1FW1 A;  4DSS A;  1GSU A;  1SD9 A;  2WGR A;  4OMV A;  2IMI A;  5CRG A;  3R3E A;  3RDW A;  3ZTL A;  3EUR A;  3Q19 A;  2L6D A;  4MPF A;  2VLV A;  1TI1 A;  1XXU A;  4J56 E;  4MLY A;  2JSZ A;  3EE2 A;  3LXT A;  3LSZ A;  4WET A;  2H74 A;  3DIE A;  4BVX A;  1KNG A;  5ECI B;  4EE0 A;  1TP9 A;  5GSS A;  2E2G A;  3FK8 A;  5J3R A;  3FKF A;  1XCC A;  1X9S B;  1G6W A;  1UC7 A;  1ZOF A;  2GQM A;  2PBJ A;  3V1W A;  2PGT A;  2ZCT A;  4KND A;  1HNC A;  2ON5 A;  3GKK A;  5D96 A;  5LCZ A;  3FZ4 A;  3K8N A;  5AIS A;  4MJA A;  2B5E A;  1DUG A;  3TKR A;  3F0I A;  3HA9 A;  2OAC A;  2YWM A;  1XWC A;  5D9W A;  3HJM A;  1Y25 A;  5J5N A;  1BX9 A;  2DC5 A;  2DJ3 A;  2DBC A;  1EV4 A;  3E3E A;  4KCA A;  4D73 A;  1R26 A;  1DSB A;  2YJH A;  2N5F A;  2B1K A;  3G9B A;  1HD2 A;  2A2S A;  4DSS B;  1B9Y C;  2F8A A;  4Q5N A;  5JCU A;  1ZYQ B;  3ISO A;  4OFN A;  3KIJ A;  4FO5 A;  3VI7 A;  4BA7 A;  4IBP A;  12GS A;  3FZ5 A;  3IAM 2;  4TOP A;  3ZRD A;  2ZNM A;  3P8W A;  2DMM A;  1ZGN A;  3TB2 A;  1XWK A;  1PKZ A;  4BVX B;  4NV2 A;  3VI5 A;  2WCI A;  4MF6 A;  1JFU A;  5CRW A;  1B48 A;  5INY A;  5A4W A;  2HSN B;  1WWJ A;  1FVK A;  3RBT A;  1KBN A;  1PKW A;  3HJP A;  6GSY A;  4WBJ A;  3OR5 A;  1PQN A;  1JLV A;  2MZC A;  5B6N A;  1XVW A;  3GH6 A;  2AAW A;  3GFK A;  3ZL5 A;  1ZCP A;  2GT5 A;  5LD0 A;  5G1K A;  4I2U A;  1A8Y A;  3C7M A;  1YF0 A;  1JZW A;  5KN0 A;  4D73 B;  2K6V A;  2FNO A;  2O89 A;  4ZBD A;  1GUL A;  1WRY A;  2EIQ A;  3GUS A;  2CAQ A;  5ECN B;  1BG5 A;  2VL9 A;  4TR4 A;  4XHM A;  1M2B A;  1EWX A;  3LG6 A;  2HRF A;  2AJQ B;  1T7P B;  2X64 A;  1EP8 A;  2WDU A;  2H8L A;  3TUE A;  2V1M A;  4NWY A;  1XWG A;  1GTA A;  3LJR A;  2C8U A;  4ZBB A;  5JCG A;  6GSV A;  4J57 E;  2PUK C;  2PWJ A;  1NW2 A;  2V6O A;  1T4Z A;  2CX4 A;  1K0B A;  5B8B A;  3BJ5 A;  1M2D A;  5HFG A;  1GUH A;  1USB A;  1BQ7 A;  1ST9 A;  1GUM A;  4G19 A;  2J23 A;  1EV9 A;  1B9X C;  5ELG A;  4NPB A;  1LJR A;  2H0I A;  3TOU A;  2MMN A;  2L6C A;  4GWR A;  2RUF A;  1IYI A;  4K7O A;  4HUA A;  1I9D A;  3C8E A;  2VCQ A;  3F4S A;  1KEB A;  2IMF A;  4MH3 A;  1V98 A;  4WR4 A;  2ZUP A;  4ZIJ A;  2KHP A;  4JR6 A;  2LEG A;  3F6F A;  4IJI A;  4MF7 A;  3I6A A;  1GLP A;  3KTL A;  1XBS A;  3M9J A;  3I43 A;  1JZD A;  3CYN A;  4KB3 A;  4PUA A;  1UA5 A;  1X9M B;  3D22 A;  2GZY A;  2MBS A;  1R5P A;  2GDR A;  2H30 A;  3L78 A;  4ZXG A;  2IMD A;  5COH A;  3GIX A;  1AQV A;  2CT6 A;  1UVZ A;  1BYE A;  3UEM A;  5DJM A;  1TXX A;  2LNT A;  3GV1 A;  3TKS C;  4ZIL A;  3EYT A;  1VF2 A;  2XPE A;  3CXG A;  4POK A;  1W89 A;  3TJK A;  3HY2 A;  2H6Z A;  3LFL A;  3N5O A;  1K0O A;  1X5E A;  2FCH A;  1TK5 B;  1TI3 A;  2HFD A;  1VRS D;  1YZX A;  4F03 A;  4IJ3 A;  2TRX A;  1A2M A;  2M80 A;  4GRF A;  3H93 A;  3CTG A;  3L9V A;  2GGT A;  4FH8 A;  3KMN A;  2DIY A;  4MPG A;  1H4O A;  2QKE A;  3VWX A;  2ES7 A;  4AJ8 A;  3KMO A;  3BOA A;  4TW5 A;  4Q5F A;  5IQY A;  3FZ9 A;  2BTO T;  1CQH A;  5ECH B;  1ZYE A;  10GS A;  3TRQ A;  4K0G A;  3GKX A;  3NZN A;  2LRT A;  4GXZ A;  4OO5 A;  5G1L A;  4X1U A;  3J7Y b;  6GSS A;  3GUR A;  1W4V A;  2JZT A;  2V32 A;  1G7E A;  4JU5 A;  2A4V A;  3UOM A;  1PA3 A;  1XOB A;  3GA4 A;  4V1A p;  4PQH A;  5E59 A;  2ON7 A;  4TR0 A;  1T00 A;  4QL7 A;  2R37 A;  4KSM A;  5IMD A;  1AW9 A;  4J2F A;  3QPM A;  18GS A;  3ZMK A;  4HZ4 A;  4IS0 A;  1V2A A;  3D4T A;  2H0G A;  1THO A;  5CAX A;  5F06 A;  2QGV A;  3CSI A;  3GKN A;  4RI7 A;  4NHW A;  3CRU A;  3QAG A;  1B8X A;  1V57 A;  1XZO A;  2NBS A;  3GKM A;  2DSA A;  1OAZ A;  2CZ2 A;  5AIX A;  1TRV A;  1U87 A;  4HQZ A;  2LRC A;  3IE3 A;  4L0W A;  3PIN A;  4RUV A;  1A2L A;  3ZLP A;  3TRX A;  1EZK A;  3DXB A;  1GWC A;  2NTO A;  2JZS A;  3KEB A;  4LMV A;  3P90 A;  2HI7 A;  4BWS A;  1PMT A;  3HJO A;  3KD0 A;  3VFI A;  3HVX A;  3TDG A;  2WUL A;  1V9W A;  1WP0 A;  3ME7 A;  4XS4 A;  3IAS 2;  4KH7 A;  2B1L A;  2JU5 A;  2H72 A;  4IVF A;  4MF5 A;  3FR6 A;  3PPU A;  4OWY A;  4FYC A;  3QOU A;  4XRA A;  5GST A;  2X8C A;  2FA4 A;  2EIO A;  4POB A;  4KDU A;  4XS1 A;  2OKA A;  2VL2 C;  2PVO C;  6GSW A;  4JED A;  5D73 A;  3VWU A;  4H86 A;  3ZIT A;  4MAB A;  1XVQ A;  3O3T A;  3D21 A;  2K9F A;  1Z7P A;  3UAR A;  2IFQ A;  4V1A g;  5D9X A;  3WD6 A;  1A0F A;  2JL4 A;  5DCG A;  3RHB A;  4ID0 A;  2XC2 A;  1HQO A;  4F2I A;  2B5X A;  2VUP A;  1ACV A;  1DE1 A;  4HU9 A;  2AHE A;  4OFT A;  3VUR A;  2FWG A;  3M1G A;  2YNX A;  2REM A;  4CDO A;  4K7I A;  4YAP A;  2L59 A;  1ZMA A;  5DQY A;  1U6T A;  4K7N A;  3WGD A;  3ZVJ A;  4IW9 A;  4KF9 A;  2HXK A;  1ZZY A;  4F9Z A;  4QL9 A;  1B4Q A;  4XS4 B;  2C80 A;  2Z9S A;  1GUK A;  4LL1 B;  1FB0 A;  5IMF A;  2GVP A;  5G5F A;  1GTU A;  4G0K A;  3LXZ A;  2E7P A;  4ZL9 A;  5EPF A;  4HEA 2;  3UBL A;  1J08 A;  4E8H A;  4PQI A;  4EDY A;  4RQR A;  4YAV A;  5D9T A;  1OE7 A;  2IFQ B;  4L5L A;  4HQS A;  3RPP A;  3GTU A;  2HSY A;  1I5G A;  1WMJ A;  2B7J A;  2H6X A;  3GNJ A;  3IDV A;  2H70 A;  4ECI A;  2NDO A;  3KTB A;  2KUC A;  1AC1 A;  4MJB A;  2DJ1 A;  2P5Q A;  4MP4 A;  3WGX A;  4K1F A;  1A0R P;  4FQU A;  4I6X A;  1WE0 A;  3QCP A;  2H73 A;  3W6G A;  4GSN A;  2E0Q A;  4PNG A;  1T3B A;  4GSS A;  5IMC A;  3NOF A;  4PXO A;  5B7C A;  3DVX A;  4N11 A;  5DBQ A;  1SKS B;  2DML A;  3ZML A;  3J7Y k;  1OYJ A;  1MDJ A;  3GH9 A;  2GZZ A;  1XW5 A;  4K8M A;  2H1G A;  1S3D A;  4JRR A;  2HLS A;  2YOI A;  5IOW A;  1NM3 A;  1XFL A;  1YF1 A;  4BVY A;  2OE0 A;  1O7U A;  4N0Z A;  5JWR B;  5H5Q A;  1PL2 A;  2A2R A;  2M72 A;  1TU7 A;  5JWQ B;  3EVI A;  5ELA A;  1QGV A;  3GL3 A;  2HRA A;  3GX8 A;  2R3X A;  3APQ A;  3HYP A;  1XPV A;  1YDK A;  2RLI A;  2LJK A;  3M9K A;  5HR2 A;  3GTU B;  4MJC A;  3H8Q A;  1SJI A;  2CX3 A;  4O7H A;  3QR6 A;  4TXO A;  4ZBA A;  5IMA A;  9GSS A;  3ZIV A;  1Q4J A;  3JCM L;  2LJA A;  5CP1 A;  1U3A A;  5KN2 A;  2GQL A;  3O76 A;  3ED3 A;  1ERT A;  2JAC A;  2GST A;  1LBK A;  2HSM A;  2CVB A;  3KH7 A;  4NMU A;  4E8E A;  4V2L A;  1ERW A;  1N2A A;  2LNS A;  1A23 A;  5DVB A;  2O7K A;  4GQF A;  3EU4 A;  4PGT A;  3MAK A;  3GX0 A;  4MZB A;  1SJZ A;  2WB9 A;  2VIM A;  1SKW B;  3MNG A;  3TJB A;  4KSO A;  4XRD A;  4GST A;  4EXJ A;  4LLR A;  3LOR A;  1M9A A;  5B8A A;  3FEU A;  1TRS A;  2YV7 A;  4BVY B;  3EMP A;  1K3Y A;  2CVK A;  3GRX A;  3R2Q A;  4PUF C;  2K18 A;  1TJD A;  5GZZ B;  1FB6 A;  5L71 A;  2LQQ A;  2AUV A;  3EU3 A;  4EVM A;  4L0U A;  3IA1 A;  1Z6M A;  2VLU A;  4TXO B;  2YZH A;  3QFB C;  3ME8 A;  3DVW A;  4XTS A;  4KE3 A;  4JE1 A;  5ECR B;  4IN0 A;  1PX7 A;  2QC7 A;  3KZQ A;  2VLT A;  1K3O A;  4IP1 A;  1AUC A;  3GN3 A;  4I2T A;  2N5A A;  3DD3 A;  5IO2 A;  3C71 A;  1X0R A;  2HRN A;  8GSS A;  4DSR A;  1WJK A;  4BWQ A;  2XPD A;  3UVH A;  1SEN A;  3C73 A;  4GCI A;  1MD3 A;  2YN1 A;  5KN1 A;  2HSM B;  4N10 A;  1AQW A;  3EWL A;  2H01 A;  3RHC A;  2CZ3 A;  1JZR A;  1AAZ A;  2HRK A;  3S9F A;  3FZA A;  5DAK A;  2D2Z A;  3FR3 A;  5D93 A;  1EEM A;  3GYK A;  1EOH A;  1C72 A;  3F6D A;  2MYG A;  4KAE A;  1WOU A;  4YQU A;  3F63 A;  2O8V B;  3MWH A;  4I97 A;  1ON4 A;  1PRX A;  2G0F A;  3DML A;  4IGJ A;  3MSZ A;  5LNK e;  5C00 A;  3UL3 A;  1FHE A;  2CAI A;  5EVO A;  3FHK A;  1V58 A;  4ILF A;  2TIR A;  4EL1 A;  4X0X A;  3TCO A;  1NHO A;  1YEP A;  2H76 A;  2JSY A;  4I8B A;  1VF4 A;  3IHQ A;  6GST A;  4YH2 A;  3LEF A;  1OVN A;  4L5O A;  2EC4 A;  5ECO B;  1VF1 A;  5FT3 A;  3LGC A;  4POM A;  3FYG A;  2KOK A;  2XBI A;  4MA9 A;  2L57 A;  1TKD B;  1BJX A;  3HD5 A;  4O32 A;  3TKP A;  6GSU A;  2VL3 A;  2B6M A;  3MDK A;  3HXS A;  2H71 A;  2HRK B;  5DAK B;  1EP7 A;  4EKZ A;  5B6M A;  3QDN A;  1XIY A;  1SK0 A;  2VAF A;  4ECJ A;  2HZE A;  5GAP D;  1SL0 B;  4WR5 A;  3VPQ A;  14GS A;  2PN8 A;  2YCD A;  1TK8 B;  2PMT A;  3GSS A;  2LV3 A;  3KGK A;  4G10 A;  2I4A A;  1RW1 A;  4OD7 A;  2LRN A;  1YQ1 A;  3M0F A;  2OE1 A;  3FRC A;  3LYP A;  4BL7 A;  2XHF A;  4JR4 A;  1GSD A;  1HNA A;  5CRD A;  1A2J A;  2OJL A;  3L9U A;  5BMU A;  1QK8 A;  3TOT A;  4MZW A;  3IK7 A;  1TDI A;  1EGO A;  1R4W A;  3U5R E;  2QSI A;  2IPA A;  3KP8 A;  2OBK A;  3D0Z A;  5FHI A;  1A8L A;  1N8J A;  2BJX A;  4PTS A;  1TOF A;  2F8F A;  3D6I A;  1QMV A;  5KN3 A;  1F3B A;  1QFN A;  3A2W A;  3FY7 A;  5D8I A;  3DEX A;  2NPB A;  3TRP A;  1NHY A;  2LQO A;  2MMA A;  4Q5R A;  2RM6 A;  1M9B A;  3IPZ A;  5ID2 A;  5G30 A;  3ZFB A;  1Z5Y E;  1XOA A;  4ZB9 A;  3RPN A;  1H75 A;  2WFC A;  3D5J A;  2IIY A;  3PGT A;  5HR1 A;  2RM5 A;  3HZ8 A;  2HZE B;  3L4N A;  4YQM A;  1K3L A;  1WPI A;  5KEJ A;  2NVL A;  4MCU A;  3TJF A;  2C0E A;  2FD3 A;  1CQG A;  1T1V A;  4HJ2 A;  1TU8 A;  2R2J A;  2FHE A;  4X43 A;  3W8J A;  1BED A;  4TVE A;  4USS A;  3IC8 A;  5AGY A;  2OA7 A;  4KA0 A;  1PD2 1;  3IR4 A;  2GSS A;  5H5S A;  3SBC A;  2J9H A;  3ZZX A;  1T4Y A;  5ECM B;  3I9V 2;  5HFI A;  4DSQ A;  4KUN A;  1K0A A;  5G31 A;  3KM6 A;  4K0N A;  2H0H A;  1U88 A;  3A2V A;  1M2A A;  2YJ7 A;  2WJU A;  5A4V A;  2BMX A;  1VF3 A;  1XW6 A;  4ISD A;  1ML6 A;  2X8G A;  1Z7R A;  4V2N A;  1FVJ A;  1M7T A;  3FW2 A;  3KXO A;  1HYU A;  3ZYW A;  2FY6 A;  4MK3 A;  5DCH A;  4RI6 A;  1GP1 A;  3KCM A;  4TXV A;  2B5Y A;  4PQ1 A;  2VO4 A;  3UAP A;  1OC9 A;  5ID2 B;  19GS A;  4N0V A;  1EEJ A;  2WS2 A;  4N30 A;  1TK0 B;  2R6K A;  1MTC A;  4KX4 A;  3EMX A;  5J4U A;  4LA1 A;  3A2X A;  3BCI A;  4P3Y B;  5E4W A;  3TJJ A;  2H1D A;  3GST A;  4L8E A;  3KJY A;  5HR0 A;  4LL4 B;  2OAD A;  5J9B A;  2P31 A;  5D9V A;  1V40 A;  2EIR A;  3HZ4 A;  4CHS A;  3UMA A;  4K2D A;  1Y6E A;  2YZU A;  2K8V A;  1MDK A;  3IC4 A;  2VM2 A;  5IOX A;  5C04 A;  2VCV A;  2CV4 A;  1Z6N A;  2FA8 A;  1ABA A;  2VCT A;  2YP6 A;  1JZO A;  2O85 A;  2WRT A;  3D4M A;  3IOS A;  1THX A;  4I5Q A;  2L5L A;  4ECC A;  5F07 A;  1PX6 A;  2KP1 A;  1GTB A;  3CSJ A;  2HNL A;  1OC9 B;  2GT6 A;  3M8N A;  3VLN A;  2C0D A;  1K0M A;  2C4J A;  3O6T A;  1AQX A;  4F82 A;  1R5A A;  5G5E A;  2I3Y A;  2WZ9 A;  5GAN D;  1XWB A;  3PH9 A;  3TKS E;  5DDL A;  2IN3 A;  4AF2 A;  3GHA A;  3F9U A;  2DLX A;  2V2G A;  1GNE A;  2VCX A;  5JCW A;  1F9M A;  1SK2 A;  2P0G A;  1K0C A;  1FG4 A;  2RUE A;  5J41 A;  5FWG A;  2FWE A;  1RQM A;  3KH9 A;  2DJJ A;  1GLQ A;  4FYB A;  4EDZ A;  2K8S A;  1F37 A;  1ZL9 A;  4WF4 A;  1SYR A;  1TW9 A;  3UJ1 A;  1ERV A;  2JAD A;  2YAN A;  5IO0 A;  3ERF A;  2C0G A;  3SWL A;  2H1B A;  3F8U A;  3G7Y A;  1U3I A;  4ZL8 A;  4MJE A;  2IME A;  1QUW A;  3DWV A;  20GS A;  2HE3 A;  1J0F A;  1TTZ A;  1R7H A;  4IP6 A;  3QAV A;  5EY6 A;  4ZB8 A;  1HNB A;  4V2M A;  1G7O A;  4ULX A;  1UN2 A;  3AY8 A;  2LTK A;  3ZFL A;  4IKH A;  2F9S A;  4ECB A;  1T8E B;  1E6B A;  2XBQ A;  4GLT A;  5G2Z A;  2LST A;  1GNW A;  2AV4 A;  1NSW A;  4KDX A;  2LUS A;  1YKC A;  1X5C A;  1O73 A;  5ABR A;  5ECS A;  4QQ7 A;  1XWA A;  3BBY A;  2I1U A;  4ML6 A;  2H19 A;  2E2M A;  4AJ7 A;  3IRA A;  1SJ6 A;  4OCE A;  1GH2 A;  5HFK A;  2KP2 A;  3H1N A;  3DKS A;  3L9S A;  4KCE A;  3F4T A;  2H75 A;  1LU4 A;  2L4Q A;  1A24 A;  3I69 A;  2VD0 A;  4RQX A;  2H6Y A;  3LQ7 A;  4ML1 A;  3Q6O A;  2RII A;  1O81 A;  1DBY A;  3DYR A;  4ACS A;  2FGX A;  2LS5 A;  4F0C A;  2JZR A;  3ZRE A;  4G0L A;  2B3S A;  4YQV A;  1OE8 A;  5F05 A;  2VOC A;  5HR3 A;  4OFM A;  4XCS A;  2LJR A;  3UVT A;  3A5W A;  1YKA A;  2KLX A;  4HJM A;  1URM A;  4WXT A;  3A3T A;  1JHB A;  4K6X A;  4ZL7 A;  4DVC A;  1YJ6 A;  3G7I A;  3ZVJ D;  1J9B A;  2C1Y A;  2CQ9 A;  2HZF A;  1SYX A;  2I81 A;  2L4C A;  4IQ1 A;  4EUY A;  4Z7X A;  4XIH A;  1X9W B;  3TKS A;  3P7X A;  2L5O A;  4KW6 A;  2OE3 A;  2IMK A;  4EO3 A;  3IXR A;  2HT9 A;  3F3Q A;  3LYK A;  4IEL A;  4HDE A;  4MH2 A;  3C1S A;  4O5R A;  1SL1 B;  6GSX A;  5CYY A;  1XW9 A;  4NHZ A;  2N5B A;  4PUR A;  1G0T A;  1ILO A;  2P5R A;  2VM1 A;  3VK9 A;  1ERU A;  1TRU A;  3WYW A;  4HS1 A;  3HCZ A;  2CVD A;  3C1R A;  2I9H A;  2TRC P;  3FR9 A;  4FYU A;  4DEJ A;  5J9C A;  1GRX A;  4GF0 A;  3BCK A;  4MZC A;  2V6K A;  5ECP B;  4TN8 A;  4K9Z A;  2ALB A;  4NXI A;  2OBI A;  4PNF A;  3HVS A;  1OKT A;  4HU7 A;  2HYX A;  3QD9 A;  1F2E A;  1PGT A;  2GTU A;  3F4R A;  3IBH A;  4MDC A;  4JZQ A;  5IMZ A;  5CRE A;  4JBB A;  2AYT A;  2PVQ A;  5IMV A;  2HQT A;  1OKD A;  1GSQ A;  2MMO A;  4WBR D;  1X5D A;  2C0F A;  3RAZ A;  4PX1 A;  2C3T A;  3Q74 A;  7GSS A;  3F3R A;  3M3M A;  2GQK A;  3KP9 A;  3HDC A;  1PL1 A;  5A5K A;  2G2Q A;  1S3C A;  4AGS A;  1SK1 A;  3QMX A;  2GLR A;  3CRT A;  5ECQ B;  3UBK A;  3HHV A;  2MMZ A;  4TRX A;  3DGQ A;  5CRH A;  16GS A;  17GS A;  2GS3 A;  3U6V A;  4G9H A;  1S3A A;  1YY7 A;  2MBT A;  1OC8 A;  4O92 A;  5IIZ A;  1F3A A;  4G2E A;  1F6M C;  1Q98 A;  1DE2 A;  1SD8 A;  4TR3 A;  2FLS A;  2H66 A;  1E2Y A;  2F3M A;  1GSE A;  4KGI A;  3PR8 A;  3CBU A;  5CNW A;  2YWI A;  2X99 A;  2YWO A;  1GSS A;  2GSQ A;  4BPY A;  5EL8 A;  4TR1 A;  3GMF A;  1RK4 A;  3L0H A;  2YV9 A;  1PN9 A;  3VWV A;  1O8W A;  4WF5 A;  2PER A;  2FWH A;  5AN1 A;  5HQP A;  1TRW A;  3Q18 A;  5A4U A;  4MMM A;  4GTU A;  2B7K A;  1SKR B;  2V41 A;  4TKY A;  2DIZ A;  4CW9 A;  1SL2 B;  4HOJ A;  1GSY A;  5CO3 A;  5ENU A;  5DAL A;  1O6J A;  3QFA C;  2AB6 A;  2UZ8 A;  5DQS A;  4ZB6 A;  4XS6 A;  3W8S A;  3ERW A;  4WEY A;  3HKR A;  3TJG A;  5JWO B;  4GQC A;  2VCW A;  4IQA A;  2PU9 C;  1JLW A;  5ECL B;  3P2A A;  4EF0 A;  1FO5 A;  2VL2 A;  1GL8 A;  2C3Q A;  2YPM A;  3BD2 A;  2DJK A;  2R5G A;  2GZP A;  4IHU A;  5AIV A;  1K0N A;  3E0U A; 
#chains in the Genus database with same CATH topology
 2OT3 A;  1QQ2 A;  3N9J A;  3TGZ A;  4HZ2 A;  3TKQ A;  4NV5 A;  2M46 A;  3H4K A;  4WKW A;  3E9J B;  3EIN A;  2DJ0 A;  4KDY A;  1PSQ A;  1M99 A;  4TR1 B;  4BL7 B;  4Q5Q A;  4AKH A;  5F0G A;  1AXD A;  3G7J A;  1BAY A;  1YEW C;  2PPT A;  5IPG A;  1B4P A;  2F51 A;  4FIW A;  2IL3 A;  1KTE A;  1EOG A;  3DRN A;  3US3 A;  3H79 A;  1YEX A;  2IWT A;  1K0D A;  2VCZ A;  2LKU A;  4OO4 A;  1VGL A;  3ERG A;  1Z3E A;  1IYH A;  1MD4 A;  5DAL B;  1MDI A;  5DJL A;  1WIK A;  5F8B A;  2O87 A;  3ZIJ A;  4EC0 A;  4NAX A;  2GSR A;  2EFH A;  4QMK A;  3QAW A;  5KOW A;  3CSH A;  1AIU A;  3LWA A;  4AJ6 A;  2HSH A;  3VWW A;  3UIW A;  5J4Y A;  5IM9 A;  1GTI A;  4E68 A;  2YWN A;  4HI7 A;  1GSF A;  4F0B A;  3WT1 A;  2FUG 2;  2IJY A;  5ECK B;  11GS A;  4POL A;  1QXH A;  2DJ2 A;  3CMI A;  3IK9 A;  3NIV A;  2H1A A;  2VD1 A;  5IPH A;  1MEK A;  1O85 A;  1G6Y A;  3APO A;  1FOV A;  3EC3 A;  1EGR A;  3VPT A;  1SVM A;  2R4V A;  2X8H A;  2CA8 A;  4G0I A;  3IV4 A;  22GS A;  3HVV A;  4LMW A;  13GS A;  3GL5 A;  3CTF A;  1OC3 A;  4GDF A;  1O8X A;  1Z9H A;  1FAA A;  3WGE A;  5H5R A;  1SU9 A;  1M0U A;  4OCF A;  2FWF A;  3RFR C;  3APS A;  3WT2 A;  2C3N A;  1FW1 A;  4DSS A;  1GSU A;  1SD9 A;  2WGR A;  4OMV A;  2IMI A;  5CRG A;  3R3E A;  3RDW A;  3ZTL A;  3EUR A;  3Q19 A;  2L6D A;  4MPF A;  2VLV A;  1TI1 A;  1XXU A;  4J56 E;  4MLY A;  2JSZ A;  3EE2 A;  3LXT A;  3LSZ A;  4WET A;  2H74 A;  3DIE A;  4BVX A;  1KNG A;  5ECI B;  4A5P A;  4Z2U A;  4EE0 A;  1TP9 A;  5GSS A;  2E2G A;  3FK8 A;  5J3R A;  4N3Z A;  3FKF A;  1XCC A;  1X9S B;  1G6W A;  1UC7 A;  1ZOF A;  2GQM A;  2PBJ A;  3V1W A;  2PGT A;  2ZCT A;  4KND A;  1HNC A;  2ON5 A;  3GKK A;  5D96 A;  4FXY P;  5LCZ A;  3FZ4 A;  3K8N A;  5AIS A;  4MJA A;  2B5E A;  1DUG A;  3TKR A;  3F0I A;  3HA9 A;  2OAC A;  4O5U A;  2YWM A;  1XWC A;  5D9W A;  3HJM A;  1Y25 A;  5J5N A;  1BX9 A;  2DC5 A;  4AKG A;  2DJ3 A;  2DBC A;  1BG1 A;  1EV4 A;  3E3E A;  4KCA A;  4D73 A;  1R26 A;  1M3J A;  1DSB A;  3HVN A;  3RGB C;  2YJH A;  2N5F A;  2B1K A;  3G9B A;  1HD2 A;  2A2S A;  4DSS B;  1B9Y C;  2F8A A;  4Q5N A;  5JCU A;  1ZYQ B;  3ISO A;  4OFN A;  3KIJ A;  4FO5 A;  3VI7 A;  4BA7 A;  4X4J A;  4IBP A;  12GS A;  3FZ5 A;  3IAM 2;  4TOP A;  3ZRD A;  2ZNM A;  3P8W A;  2DMM A;  1ZGN A;  3TB2 A;  1XWK A;  2O3E A;  1PKZ A;  4BVX B;  4NV2 A;  3VI5 A;  2WCI A;  2R0P A;  4MF6 A;  1JFU A;  5CRW A;  1B48 A;  5INY A;  5A4W A;  2HSN B;  1WWJ A;  1FVK A;  3RBT A;  1KBN A;  1PKW A;  3HJP A;  6GSY A;  4WBJ A;  3OR5 A;  1PQN A;  1JLV A;  2MZC A;  2QA1 A;  5B6N A;  1M3I A;  1XVW A;  3GH6 A;  2AAW A;  3GFK A;  3ZL5 A;  1ZCP A;  2GT5 A;  5LD0 A;  5G1K A;  4I2U A;  1A8Y A;  3C7M A;  1YF0 A;  1JZW A;  5KN0 A;  4D73 B;  2K6V A;  2FNO A;  2O89 A;  4ZBD A;  1GUL A;  4W66 A;  1WRY A;  2EIQ A;  3GUS A;  2CAQ A;  5ECN B;  1BG5 A;  2VL9 A;  4TR4 A;  4XHM A;  1M2B A;  4Z2T A;  1EWX A;  3LG6 A;  2HRF A;  2AJQ B;  1T7P B;  2X64 A;  1EP8 A;  2WDU A;  2H8L A;  3TUE A;  2V1M A;  4NWY A;  1XWG A;  1GTA A;  3LJR A;  2C8U A;  4ZBB A;  5JCG A;  6GSV A;  4J57 E;  2PUK C;  3A5I A;  5A34 A;  2PWJ A;  1NW2 A;  2V6O A;  1T4Z A;  2CX4 A;  1K0B A;  5B8B A;  3BJ5 A;  1M2D A;  5HFG A;  1GUH A;  1USB A;  1BQ7 A;  1ST9 A;  1GUM A;  4G19 A;  2J23 A;  1EV9 A;  1B9X C;  5ELG A;  4NPB A;  1LJR A;  1TXU A;  2H0I A;  3TOU A;  2MMN A;  2L6C A;  4GWR A;  2RUF A;  1IYI A;  4K7O A;  1PFO A;  4HUA A;  1I9D A;  3C8E A;  2VCQ A;  3F4S A;  1KEB A;  2IMF A;  4MH3 A;  1V98 A;  4K5S A;  4WR4 A;  2ZUP A;  2WZS A;  4ZIJ A;  2KHP A;  4JR6 A;  2LEG A;  3F6F A;  4IJI A;  4MF7 A;  3I6A A;  1GLP A;  3KTL A;  1XBS A;  3M9J A;  3I43 A;  1JZD A;  3CYN A;  4KB3 A;  4PUA A;  1UA5 A;  1X9M B;  3D22 A;  2GZY A;  2MBS A;  1R5P A;  2WW2 A;  2GDR A;  2H30 A;  3L78 A;  4ZXG A;  2IMD A;  5COH A;  2WW0 A;  3GIX A;  1AQV A;  2CT6 A;  1UVZ A;  1BYE A;  3UEM A;  5DJM A;  5A34 B;  1TXX A;  2LNT A;  3GV1 A;  3TKS C;  4ZIL A;  3EYT A;  1VF2 A;  2XPE A;  3CXG A;  4POK A;  1W89 A;  3TJK A;  3HY2 A;  2H6Z A;  3LFL A;  3N5O A;  2EFD A;  1K0O A;  1X5E A;  2FCH A;  1TK5 B;  1TI3 A;  2HFD A;  1VRS D;  1YZX A;  4F03 A;  4IJ3 A;  2TRX A;  1A2M A;  2M80 A;  4GRF A;  3H93 A;  3CTG A;  2DKI A;  3L9V A;  2GGT A;  4FH8 A;  3KMN A;  2DIY A;  4MPG A;  1H4O A;  2QKE A;  3VWX A;  2ES7 A;  4AJ8 A;  3KMO A;  3BOA A;  4TW5 A;  4ICY A;  4Q5F A;  5IQY A;  3FZ9 A;  2BTO T;  1CQH A;  5ECH B;  1ZYE A;  10GS A;  3TRQ A;  4K0G A;  3GKX A;  3NZN A;  2LRT A;  4GXZ A;  4OO5 A;  5G1L A;  4X1U A;  5J4V A;  3J7Y b;  6GSS A;  3GUR A;  1W4V A;  2JZT A;  2V32 A;  1G7E A;  4JU5 A;  2A4V A;  3UOM A;  1PA3 A;  1XOB A;  3GA4 A;  4V1A p;  4PQH A;  5E59 A;  2ON7 A;  4TR0 A;  1T00 A;  4PI0 C;  4QL7 A;  2R37 A;  4KSM A;  5IMD A;  1AW9 A;  4J2F A;  3QPM A;  18GS A;  3ZMK A;  4HZ4 A;  4IS0 A;  1V2A A;  3D4T A;  2H0G A;  1THO A;  5CAX A;  5F06 A;  2QGV A;  3CSI A;  3GKN A;  4RI7 A;  4NHW A;  3CRU A;  3QAG A;  1B8X A;  1V57 A;  1XZO A;  2NBS A;  3GKM A;  2DSA A;  1OAZ A;  2CZ2 A;  5AIX A;  1TRV A;  1U87 A;  4HQZ A;  2LRC A;  3IE3 A;  4L0W A;  3PIN A;  4RUV A;  1A2L A;  3ZLP A;  3TRX A;  1EZK A;  3DXB A;  1GWC A;  2NTO A;  2JZS A;  3KEB A;  4LMV A;  3P90 A;  2HI7 A;  4BWS A;  1PMT A;  3HJO A;  3KD0 A;  3VFI A;  2O5V A;  2A2P A;  3HVX A;  3TDG A;  2WUL A;  1V9W A;  1WP0 A;  3ME7 A;  4XS4 A;  3IAS 2;  4KH7 A;  2B1L A;  2O36 A;  2JU5 A;  2H72 A;  4IVF A;  4MF5 A;  3FR6 A;  3PPU A;  4OWY A;  4FYC A;  3QOU A;  4XRA A;  5GST A;  2X8C A;  2FA4 A;  2EIO A;  4POB A;  4KDU A;  3FMW A;  4XS1 A;  2OKA A;  2VL2 C;  2PVO C;  6GSW A;  4JED A;  5D73 A;  3VWU A;  4H86 A;  3ZIT A;  4MAB A;  1XVQ A;  3O3T A;  3D21 A;  2K9F A;  1Z7P A;  3UAR A;  2IFQ A;  4V1A g;  5D9X A;  4ZB7 A;  3WD6 A;  1A0F A;  2JL4 A;  5DCG A;  3RHB A;  4ID0 A;  2XC2 A;  1I1I P;  1HQO A;  4F2I A;  2B5X A;  4EIP A;  2VUP A;  1ACV A;  1DE1 A;  4HU9 A;  2AHE A;  4OFT A;  3VUR A;  2FWG A;  3M1G A;  2YNX A;  2REM A;  1ZYN A;  4CDO A;  4K7I A;  4YAP A;  2L59 A;  1ZMA A;  5DQY A;  1U6T A;  4K7N A;  3WGD A;  3ZVJ A;  4IW9 A;  4KF9 A;  2HXK A;  1ZZY A;  4F9Z A;  4QL9 A;  1B4Q A;  2X4A A;  2C80 A;  4XS4 B;  2Z9S A;  1GUK A;  4LL1 B;  1FB0 A;  5IMF A;  2GVP A;  5G5F A;  1GTU A;  4G0K A;  3LXZ A;  2E7P A;  4ZL9 A;  5EPF A;  4BIK A;  4HEA 2;  3UBL A;  1J08 A;  4E8H A;  4PQI A;  4YKG A;  4EDY A;  4RQR A;  1ZYP A;  4YAV A;  5D9T A;  1OE7 A;  2IFQ B;  4L5L A;  4HQS A;  3RPP A;  3GTU A;  2HSY A;  1I5G A;  3MIX A;  1WMJ A;  2B7J A;  2H6X A;  3GNJ A;  3IDV A;  2H70 A;  2WVY A;  4ECI A;  2NDO A;  3KTB A;  2KUC A;  1AC1 A;  4MJB A;  2DJ1 A;  2P5Q A;  4MP4 A;  3WGX A;  4K1F A;  1A0R P;  4FQU A;  4I6X A;  1WE0 A;  3QCP A;  4AKX B;  2H73 A;  3W6G A;  4GSN A;  2E0Q A;  4PNG A;  1T3B A;  4GSS A;  5IMC A;  3NOF A;  2UV8 G;  4PXO A;  5B7C A;  3DVX A;  4N11 A;  5DBQ A;  1SKS B;  2DML A;  3ZML A;  3J7Y k;  1OYJ A;  1MDJ A;  4HSC X;  3GH9 A;  2GZZ A;  1XW5 A;  4K8M A;  2H1G A;  3IHG A;  1S3D A;  4JRR A;  2HLS A;  2YOI A;  3CWG A;  5IOW A;  3CHX C;  1NM3 A;  1XFL A;  1YF1 A;  4BVY A;  2OE0 A;  1O7U A;  4N0Z A;  5JWR B;  5H5Q A;  1PL2 A;  2A2R A;  2M72 A;  1TU7 A;  5JWQ B;  3EVI A;  5ELA A;  1QGV A;  3GL3 A;  2HRA A;  3GX8 A;  2R3X A;  3APQ A;  3HYP A;  1XPV A;  1YDK A;  2RLI A;  2LJK A;  3M9K A;  5HR2 A;  3GTU B;  4MJC A;  3H8Q A;  1SJI A;  2CX3 A;  4O7H A;  3QR6 A;  4TXO A;  4ZBA A;  4PI2 C;  5IMA A;  9GSS A;  3ZIV A;  1Q4J A;  3JCM L;  2LJA A;  5CP1 A;  1U3A A;  5KN2 A;  2GQL A;  3O76 A;  3ED3 A;  1ERT A;  3HMJ G;  2JAC A;  2GST A;  1LBK A;  2HSM A;  2CVB A;  3KH7 A;  4NMU A;  4E8E A;  4V2L A;  1ERW A;  1N2A A;  2LNS A;  1A23 A;  3CQF A;  2WVX A;  5DVB A;  2O7K A;  4GQF A;  3EU4 A;  4PGT A;  3MAK A;  3GX0 A;  4MZB A;  1SJZ A;  2WB9 A;  2VIM A;  1SKW B;  3MNG A;  3TJB A;  4KSO A;  4XRD A;  4GST A;  4EXJ A;  4LLR A;  3LOR A;  1M9A A;  5B8A A;  3FEU A;  1TRS A;  2YV7 A;  4BVY B;  3EMP A;  1K3Y A;  2CVK A;  3GRX A;  1PN0 A;  3R2Q A;  4PUF C;  2K18 A;  1TJD A;  5GZZ B;  1FB6 A;  5L71 A;  2LQQ A;  2AUV A;  3EU3 A;  4EVM A;  4L0U A;  3IA1 A;  1Z6M A;  2VLU A;  4TXO B;  2YZH A;  3QFB C;  3ME8 A;  3DVW A;  4XTS A;  4KE3 A;  4JE1 A;  5ECR B;  3MYD A;  1S3R A;  4IN0 A;  1PX7 A;  2QC7 A;  3KZQ A;  2VLT A;  1K3O A;  4IP1 A;  1AUC A;  3GN3 A;  4I2T A;  2N5A A;  3DD3 A;  5IO2 A;  3C71 A;  1X0R A;  2HRN A;  8GSS A;  4DSR A;  1WJK A;  4BWQ A;  2XPD A;  3UVH A;  1SEN A;  3C73 A;  4GCI A;  1MD3 A;  2YN1 A;  5KN1 A;  2HSM B;  4N10 A;  1AQW A;  3EWL A;  2WVX B;  2H01 A;  3RHC A;  2CZ3 A;  1JZR A;  1AAZ A;  2HRK A;  3S9F A;  3FZA A;  5DAK A;  2D2Z A;  3FR3 A;  5D93 A;  1EEM A;  3GYK A;  1EOH A;  1C72 A;  3F6D A;  2MYG A;  4KAE A;  1WOU A;  4YQU A;  4G01 A;  3F63 A;  2O8V B;  3MWH A;  4I97 A;  1ON4 A;  1PRX A;  2G0F A;  3DML A;  4IGJ A;  3MSZ A;  5LNK e;  5C00 A;  5A5H A;  3UL3 A;  1FHE A;  2CAI A;  5EVO A;  4K2X A;  3FHK A;  1V58 A;  4ILF A;  2TIR A;  4EL1 A;  4X0X A;  3TCO A;  1NHO A;  1YEP A;  2H76 A;  2JSY A;  4I8B A;  1VF4 A;  3IHQ A;  6GST A;  4YH2 A;  3LEF A;  1OVN A;  4L5O A;  2EC4 A;  5ECO B;  1VF1 A;  5FT3 A;  3LGC A;  4POM A;  3FYG A;  2KOK A;  2XBI A;  4MA9 A;  2L57 A;  1TKD B;  1BJX A;  3HD5 A;  4O32 A;  3TKP A;  6GSU A;  2VL3 A;  2B6M A;  3MDK A;  3HXS A;  2H71 A;  3TU3 B;  2HRK B;  5DAK B;  1EP7 A;  4EKZ A;  5B6M A;  3QDN A;  2VKZ G;  1XIY A;  1SK0 A;  2VAF A;  4ECJ A;  2HZE A;  5GAP D;  1SL0 B;  4WR5 A;  3VPQ A;  14GS A;  2PN8 A;  2YCD A;  1TK8 B;  2PMT A;  3GSS A;  2LV3 A;  3KGK A;  4G10 A;  2I4A A;  1RW1 A;  4OD7 A;  2LRN A;  1YQ1 A;  3M0F A;  2OE1 A;  3FRC A;  5A5H B;  3LYP A;  4BL7 A;  2XHF A;  4JR4 A;  1GSD A;  1HNA A;  5CRD A;  1A2J A;  2OJL A;  1SVL A;  3L9U A;  5BMU A;  1QK8 A;  3TOT A;  4MZW A;  3IK7 A;  1TDI A;  1EGO A;  1R4W A;  3U5R E;  2QSI A;  2IPA A;  3KP8 A;  2OBK A;  3D0Z A;  5FHI A;  1A8L A;  1N8J A;  2BJX A;  4PTS A;  1TOF A;  2F8F A;  2WW1 A;  3D6I A;  1QMV A;  5KN3 A;  1F3B A;  1QFN A;  3A2W A;  3FY7 A;  5D8I A;  3DEX A;  2NPB A;  3TRP A;  1NHY A;  2LQO A;  2MMA A;  4Q5R A;  2RM6 A;  1M9B A;  3IPZ A;  5ID2 A;  5G30 A;  3ZFB A;  1Z5Y E;  1XOA A;  4ZB9 A;  3RPN A;  1H75 A;  2WFC A;  4PHZ C;  3D5J A;  2IIY A;  3PGT A;  5HR1 A;  2RM5 A;  3HZ8 A;  2HZE B;  3L4N A;  4YQM A;  1K3L A;  1WPI A;  5KEJ A;  2NVL A;  4MCU A;  3TJF A;  2C0E A;  2FD3 A;  1CQG A;  1T1V A;  4HJ2 A;  1TU8 A;  2R2J A;  2FHE A;  4X43 A;  3W8J A;  1BED A;  4TVE A;  4USS A;  3IC8 A;  5AGY A;  2OA7 A;  5J47 A;  3LW9 A;  4KA0 A;  1PD2 1;  3IR4 A;  2GSS A;  5BMU B;  5H5S A;  3SBC A;  4Z2R A;  2J9H A;  3ZZX A;  1T4Y A;  5ECM B;  3I9V 2;  5HFI A;  4DSQ A;  4KUN A;  1K0A A;  5G31 A;  3KM6 A;  4K0N A;  2H0H A;  1U88 A;  3A2V A;  1M2A A;  2YJ7 A;  2WJU A;  5A4V A;  2BMX A;  1VF3 A;  1XW6 A;  4ISD A;  1ML6 A;  2X8G A;  2H1L A;  1Z7R A;  4V2N A;  1FVJ A;  1M7T A;  3FW2 A;  3KXO A;  1HYU A;  4YKF A;  1YVL A;  3ZYW A;  2FY6 A;  4MK3 A;  5DCH A;  4RI6 A;  1GP1 A;  3KCM A;  4TXV A;  2B5Y A;  4PQ1 A;  2EFC A;  2VO4 A;  3UAP A;  1OC9 A;  5ID2 B;  19GS A;  4N0V A;  1EEJ A;  2WS2 A;  4N30 A;  1TK0 B;  2R6K A;  1MTC A;  4KX4 A;  3EMX A;  5J4U A;  4AKI A;  4LA1 A;  3A2X A;  3BCI A;  4P3Y B;  5E4W A;  3TJJ A;  2H1D A;  3GST A;  4L8E A;  3KJY A;  5HR0 A;  4LL4 B;  2OAD A;  5J9B A;  2P31 A;  5D9V A;  1V40 A;  2EIR A;  3HZ4 A;  4CHS A;  3UMA A;  4K2D A;  1Y6E A;  2YZU A;  2K8V A;  1MDK A;  3IC4 A;  2VM2 A;  5IOX A;  5C04 A;  2VCV A;  2CV4 A;  1Z6N A;  2FA8 A;  1ABA A;  2VCT A;  2YP6 A;  1JZO A;  2O85 A;  2WRT A;  3D4M A;  3IOS A;  1THX A;  4I5Q A;  2L5L A;  4ECC A;  5F07 A;  1PX6 A;  2KP1 A;  1GTB A;  3CSJ A;  2HNL A;  5J40 A;  1OC9 B;  2GT6 A;  3M8N A;  3VLN A;  2C0D A;  1K0M A;  2C4J A;  3O6T A;  1AQX A;  4F82 A;  1R5A A;  5G5E A;  2I3Y A;  2WZ9 A;  2HSN A;  1XWB A;  5GAN D;  3PH9 A;  3TKS E;  5DDL A;  2R0C A;  2IN3 A;  4AF2 A;  3GHA A;  3F9U A;  2DLX A;  2V2G A;  1GNE A;  2VCX A;  5JCW A;  1F9M A;  1SK2 A;  2P0G A;  1K0C A;  1FG4 A;  2RUE A;  1S4B P;  5J41 A;  5FWG A;  2FWE A;  1RQM A;  3KH9 A;  2DJJ A;  1GLQ A;  4FYB A;  4EDZ A;  2K8S A;  1F37 A;  1ZL9 A;  4WF4 A;  1SYR A;  5A1N A;  1TW9 A;  3UJ1 A;  4CY6 A;  1ERV A;  2JAD A;  2YAN A;  5IO0 A;  3EPT A;  3ERF A;  2C0G A;  3SWL A;  2H1B A;  3F8U A;  3G7Y A;  1U3I A;  4ZL8 A;  4MJE A;  2IME A;  1QUW A;  3DWV A;  20GS A;  2HE3 A;  1J0F A;  1TTZ A;  1R7H A;  4IP6 A;  3QAV A;  5EY6 A;  4ZB8 A;  1HNB A;  4V2M A;  1G7O A;  4ULX A;  1UN2 A;  3AY8 A;  2LTK A;  3ZFL A;  4IKH A;  2F9S A;  4ECB A;  1T8E B;  1SVO A;  2WW3 A;  1E6B A;  2XBQ A;  4GLT A;  5G2Z A;  2LST A;  1GNW A;  2AV4 A;  5BRT A;  1NSW A;  4KDX A;  2LUS A;  1YKC A;  1X5C A;  1O73 A;  4K5R A;  5ABR A;  5ECS A;  4CY8 A;  4QQ7 A;  1XWA A;  3BBY A;  2I1U A;  4ML6 A;  2H19 A;  2E2M A;  4AJ7 A;  3IRA A;  1SJ6 A;  4OCE A;  1GH2 A;  5HFK A;  2KP2 A;  3H1N A;  3DKS A;  3L9S A;  4KCE A;  3F4T A;  2H75 A;  1LU4 A;  2L4Q A;  1A24 A;  3I69 A;  5A1N B;  2VD0 A;  4RQX A;  2H6Y A;  3LQ7 A;  4ML1 A;  3Q6O A;  2RII A;  1O81 A;  1DBY A;  3DYR A;  4ACS A;  4AI6 A;  2FGX A;  2LS5 A;  4F0C A;  2JZR A;  3ZRE A;  5KOX A;  4G0L A;  2B3S A;  4YQV A;  1OE8 A;  5F05 A;  2VOC A;  5HR3 A;  4OFM A;  4XCS A;  2LJR A;  3UVT A;  3A5W A;  1YKA A;  2KLX A;  4HJM A;  1URM A;  4WXT A;  3A3T A;  1JHB A;  4K6X A;  4ZL7 A;  4DVC A;  1YJ6 A;  3G7I A;  3ZVJ D;  1J9B A;  2C1Y A;  2CQ9 A;  2HZF A;  1SYX A;  2I81 A;  2L4C A;  4IQ1 A;  4EUY A;  4Z7X A;  4XIH A;  1X9W B;  3TKS A;  3P7X A;  2L5O A;  4KW6 A;  2OE3 A;  2IMK A;  1Y1U A;  4EO3 A;  3IXR A;  2HT9 A;  3F3Q A;  3LYK A;  4IEL A;  4HDE A;  4MH2 A;  3C1S A;  4O5R A;  1SL1 B;  2X49 A;  6GSX A;  5CYY A;  1XW9 A;  4NHZ A;  2N5B A;  4PUR A;  1G0T A;  1ILO A;  2P5R A;  2VM1 A;  3VK9 A;  1ERU A;  1TRU A;  3WYW A;  4HS1 A;  3HCZ A;  2CVD A;  3C1R A;  2I9H A;  2TRC P;  3FR9 A;  4FYU A;  4DEJ A;  5J9C A;  1GRX A;  4GF0 A;  3BCK A;  4MZC A;  2V6K A;  5ECP B;  4TN8 A;  4K9Z A;  2ALB A;  4NXI A;  2OBI A;  4PNF A;  3HVS A;  1OKT A;  4HU7 A;  2HYX A;  3QD9 A;  1F2E A;  1PGT A;  2GTU A;  3F4R A;  3IBH A;  4MDC A;  4JZQ A;  5IMZ A;  5CRE A;  4JBB A;  2AYT A;  2PVQ A;  5IMV A;  2HQT A;  1OKD A;  1GSQ A;  2MMO A;  4WBR D;  1X5D A;  2C0F A;  2QA2 A;  3RAZ A;  4PX1 A;  2C3T A;  3Q74 A;  2WVZ A;  7GSS A;  3F3R A;  3M3M A;  2GQK A;  3KP9 A;  3HDC A;  4O5Q A;  1PL1 A;  5A5K A;  2G2Q A;  1S3C A;  4AGS A;  1SK1 A;  3QMX A;  2GLR A;  3CRT A;  5ECQ B;  3UBK A;  3HHV A;  2MMZ A;  4TRX A;  3DGQ A;  5CRH A;  2DKH A;  16GS A;  17GS A;  2GS3 A;  3U6V A;  4G9H A;  1S3A A;  1YY7 A;  2MBT A;  1OC8 A;  4O92 A;  5IIZ A;  1F3A A;  4G2E A;  1F6M C;  1Q98 A;  1BF5 A;  1DE2 A;  1SD8 A;  4TR3 A;  2FLS A;  2H66 A;  1E2Y A;  2F3M A;  1GSE A;  4KGI A;  3PR8 A;  3CBU A;  5CNW A;  2YWI A;  2X99 A;  1N25 A;  2YWO A;  2A4H A;  1GSS A;  2GSQ A;  4BPY A;  5EL8 A;  4TR1 A;  3GMF A;  1RK4 A;  3L0H A;  2YV9 A;  1PN9 A;  3VWV A;  1O8W A;  4WF5 A;  2PER A;  2FWH A;  5AN1 A;  5HQP A;  1TRW A;  3Q18 A;  5A4U A;  4MMM A;  4GTU A;  2B7K A;  1SKR B;  4EIQ A;  2V41 A;  4TKY A;  2DIZ A;  4CW9 A;  1SL2 B;  4HOJ A;  1GSY A;  5CO3 A;  5ENU A;  5DAL A;  1O6J A;  3QFA C;  2AB6 A;  2UZ8 A;  5DQS A;  4ZB6 A;  4XS6 A;  3W8S A;  3ERW A;  4MNN A;  2EFE A;  4WEY A;  3HKR A;  2R0G A;  3TJG A;  1FOH A;  5JWO B;  4GQC A;  2VCW A;  4IQA A;  2PU9 C;  1JLW A;  5ECL B;  3P2A A;  4EF0 A;  1FO5 A;  2VL2 A;  1GL8 A;  2C3Q A;  1XG8 A;  2YPM A;  3BD2 A;  2DJK A;  2R5G A;  2GZP A;  4IHU A;  5AIV A;  1K0N A;  3E0U A; 
#chains in the Genus database with same CATH homology
 2OT3 A;  1QQ2 A;  3N9J A;  3TGZ A;  4HZ2 A;  3TKQ A;  4NV5 A;  2M46 A;  3H4K A;  4WKW A;  3E9J B;  3EIN A;  2DJ0 A;  4KDY A;  1PSQ A;  1M99 A;  4TR1 B;  4BL7 B;  4Q5Q A;  4AKH A;  5F0G A;  1AXD A;  3G7J A;  1BAY A;  2PPT A;  5IPG A;  1B4P A;  2F51 A;  4FIW A;  2IL3 A;  1KTE A;  1EOG A;  3DRN A;  3US3 A;  3H79 A;  1YEX A;  2IWT A;  1K0D A;  2VCZ A;  2LKU A;  4OO4 A;  1VGL A;  3ERG A;  1Z3E A;  1IYH A;  1MD4 A;  5DAL B;  1MDI A;  5DJL A;  1WIK A;  5F8B A;  2O87 A;  3ZIJ A;  4EC0 A;  4NAX A;  2GSR A;  2EFH A;  4QMK A;  3QAW A;  5KOW A;  3CSH A;  1AIU A;  3LWA A;  4AJ6 A;  2HSH A;  3VWW A;  3UIW A;  5J4Y A;  5IM9 A;  1GTI A;  4E68 A;  2YWN A;  4HI7 A;  1GSF A;  4F0B A;  3WT1 A;  2FUG 2;  2IJY A;  5ECK B;  11GS A;  4POL A;  1QXH A;  2DJ2 A;  3CMI A;  3IK9 A;  3NIV A;  2H1A A;  2VD1 A;  5IPH A;  1MEK A;  1O85 A;  1G6Y A;  3APO A;  1FOV A;  3EC3 A;  1EGR A;  3VPT A;  1SVM A;  2R4V A;  2X8H A;  2CA8 A;  4G0I A;  3IV4 A;  22GS A;  3HVV A;  4LMW A;  13GS A;  3GL5 A;  3CTF A;  1OC3 A;  4GDF A;  1O8X A;  1Z9H A;  1FAA A;  3WGE A;  5H5R A;  1SU9 A;  1M0U A;  4OCF A;  2FWF A;  3APS A;  3WT2 A;  2C3N A;  1FW1 A;  4DSS A;  1GSU A;  1SD9 A;  2WGR A;  4OMV A;  2IMI A;  5CRG A;  3R3E A;  3RDW A;  3ZTL A;  3EUR A;  3Q19 A;  2L6D A;  4MPF A;  2VLV A;  1TI1 A;  1XXU A;  4J56 E;  4MLY A;  2JSZ A;  3EE2 A;  3LXT A;  3LSZ A;  4WET A;  2H74 A;  3DIE A;  4BVX A;  1KNG A;  5ECI B;  4A5P A;  4Z2U A;  4EE0 A;  1TP9 A;  5GSS A;  2E2G A;  3FK8 A;  5J3R A;  4N3Z A;  3FKF A;  1XCC A;  1X9S B;  1G6W A;  1UC7 A;  1ZOF A;  2GQM A;  2PBJ A;  3V1W A;  2PGT A;  2ZCT A;  4KND A;  1HNC A;  2ON5 A;  3GKK A;  5D96 A;  5LCZ A;  3FZ4 A;  3K8N A;  5AIS A;  4MJA A;  2B5E A;  1DUG A;  3TKR A;  3F0I A;  3HA9 A;  2OAC A;  4O5U A;  2YWM A;  1XWC A;  5D9W A;  3HJM A;  1Y25 A;  5J5N A;  1BX9 A;  2DC5 A;  4AKG A;  2DJ3 A;  2DBC A;  1BG1 A;  1EV4 A;  3E3E A;  4KCA A;  4D73 A;  1R26 A;  1DSB A;  2YJH A;  2N5F A;  2B1K A;  3G9B A;  1HD2 A;  2A2S A;  4DSS B;  1B9Y C;  2F8A A;  4Q5N A;  5JCU A;  1ZYQ B;  3ISO A;  4OFN A;  3KIJ A;  4FO5 A;  3VI7 A;  4BA7 A;  4X4J A;  4IBP A;  12GS A;  3FZ5 A;  3IAM 2;  4TOP A;  3ZRD A;  2ZNM A;  3P8W A;  2DMM A;  1ZGN A;  3TB2 A;  1XWK A;  1PKZ A;  4BVX B;  4NV2 A;  3VI5 A;  2WCI A;  2R0P A;  4MF6 A;  1JFU A;  5CRW A;  1B48 A;  5INY A;  5A4W A;  2HSN B;  1WWJ A;  1FVK A;  3RBT A;  1KBN A;  1PKW A;  3HJP A;  6GSY A;  4WBJ A;  3OR5 A;  1PQN A;  1JLV A;  2MZC A;  2QA1 A;  5B6N A;  1XVW A;  3GH6 A;  2AAW A;  3GFK A;  3ZL5 A;  1ZCP A;  2GT5 A;  5LD0 A;  5G1K A;  4I2U A;  1A8Y A;  3C7M A;  1YF0 A;  1JZW A;  5KN0 A;  4D73 B;  2K6V A;  2FNO A;  2O89 A;  4ZBD A;  1GUL A;  4W66 A;  1WRY A;  2EIQ A;  3GUS A;  2CAQ A;  5ECN B;  1BG5 A;  2VL9 A;  4TR4 A;  4XHM A;  1M2B A;  4Z2T A;  1EWX A;  3LG6 A;  2HRF A;  2AJQ B;  1T7P B;  2X64 A;  1EP8 A;  2WDU A;  2H8L A;  3TUE A;  2V1M A;  4NWY A;  1XWG A;  1GTA A;  3LJR A;  2C8U A;  4ZBB A;  5JCG A;  6GSV A;  4J57 E;  2PUK C;  3A5I A;  5A34 A;  2PWJ A;  1NW2 A;  2V6O A;  1T4Z A;  2CX4 A;  1K0B A;  5B8B A;  3BJ5 A;  1M2D A;  5HFG A;  1GUH A;  1USB A;  1BQ7 A;  1ST9 A;  1GUM A;  4G19 A;  2J23 A;  1EV9 A;  1B9X C;  5ELG A;  4NPB A;  1LJR A;  1TXU A;  2H0I A;  3TOU A;  2MMN A;  2L6C A;  4GWR A;  2RUF A;  1IYI A;  4K7O A;  4HUA A;  1I9D A;  3C8E A;  2VCQ A;  3F4S A;  1KEB A;  2IMF A;  4MH3 A;  1V98 A;  4K5S A;  4WR4 A;  2ZUP A;  4ZIJ A;  2KHP A;  4JR6 A;  2LEG A;  3F6F A;  4IJI A;  4MF7 A;  3I6A A;  1GLP A;  3KTL A;  1XBS A;  3M9J A;  3I43 A;  1JZD A;  3CYN A;  4KB3 A;  4PUA A;  1UA5 A;  1X9M B;  3D22 A;  2GZY A;  2MBS A;  1R5P A;  2GDR A;  2H30 A;  3L78 A;  4ZXG A;  2IMD A;  5COH A;  3GIX A;  1AQV A;  2CT6 A;  1UVZ A;  1BYE A;  3UEM A;  5DJM A;  5A34 B;  1TXX A;  2LNT A;  3GV1 A;  3TKS C;  4ZIL A;  3EYT A;  1VF2 A;  2XPE A;  3CXG A;  4POK A;  1W89 A;  3TJK A;  3HY2 A;  2H6Z A;  3LFL A;  3N5O A;  2EFD A;  1K0O A;  1X5E A;  2FCH A;  1TK5 B;  1TI3 A;  2HFD A;  1VRS D;  1YZX A;  4F03 A;  4IJ3 A;  2TRX A;  1A2M A;  2M80 A;  4GRF A;  3H93 A;  3CTG A;  2DKI A;  3L9V A;  2GGT A;  4FH8 A;  3KMN A;  2DIY A;  4MPG A;  1H4O A;  2QKE A;  3VWX A;  2ES7 A;  4AJ8 A;  3KMO A;  3BOA A;  4TW5 A;  4ICY A;  4Q5F A;  5IQY A;  3FZ9 A;  2BTO T;  1CQH A;  5ECH B;  1ZYE A;  10GS A;  3TRQ A;  4K0G A;  3GKX A;  3NZN A;  2LRT A;  4GXZ A;  4OO5 A;  5G1L A;  4X1U A;  5J4V A;  3J7Y b;  6GSS A;  3GUR A;  1W4V A;  2JZT A;  2V32 A;  1G7E A;  4JU5 A;  2A4V A;  3UOM A;  1PA3 A;  1XOB A;  3GA4 A;  4V1A p;  4PQH A;  5E59 A;  2ON7 A;  4TR0 A;  1T00 A;  4QL7 A;  2R37 A;  4KSM A;  5IMD A;  1AW9 A;  4J2F A;  3QPM A;  18GS A;  3ZMK A;  4HZ4 A;  4IS0 A;  1V2A A;  3D4T A;  2H0G A;  1THO A;  5CAX A;  5F06 A;  2QGV A;  3CSI A;  3GKN A;  4RI7 A;  4NHW A;  3CRU A;  3QAG A;  1B8X A;  1V57 A;  1XZO A;  2NBS A;  3GKM A;  2DSA A;  1OAZ A;  2CZ2 A;  5AIX A;  1TRV A;  1U87 A;  4HQZ A;  2LRC A;  3IE3 A;  4L0W A;  3PIN A;  4RUV A;  1A2L A;  3ZLP A;  3TRX A;  1EZK A;  3DXB A;  1GWC A;  2NTO A;  2JZS A;  3KEB A;  4LMV A;  3P90 A;  2HI7 A;  4BWS A;  1PMT A;  3HJO A;  3KD0 A;  3VFI A;  2O5V A;  2A2P A;  3HVX A;  3TDG A;  2WUL A;  1V9W A;  1WP0 A;  3ME7 A;  4XS4 A;  3IAS 2;  4KH7 A;  2B1L A;  2JU5 A;  2H72 A;  4IVF A;  4MF5 A;  3FR6 A;  3PPU A;  4OWY A;  4FYC A;  3QOU A;  4XRA A;  5GST A;  2X8C A;  2FA4 A;  2EIO A;  4POB A;  4KDU A;  3FMW A;  4XS1 A;  2OKA A;  2VL2 C;  2PVO C;  6GSW A;  4JED A;  5D73 A;  3VWU A;  4H86 A;  3ZIT A;  4MAB A;  1XVQ A;  3O3T A;  3D21 A;  2K9F A;  1Z7P A;  3UAR A;  2IFQ A;  4V1A g;  5D9X A;  4ZB7 A;  3WD6 A;  1A0F A;  2JL4 A;  5DCG A;  3RHB A;  4ID0 A;  2XC2 A;  1HQO A;  4F2I A;  2B5X A;  4EIP A;  2VUP A;  1ACV A;  1DE1 A;  4HU9 A;  2AHE A;  4OFT A;  3VUR A;  2FWG A;  3M1G A;  2YNX A;  2REM A;  1ZYN A;  4CDO A;  4K7I A;  4YAP A;  2L59 A;  1ZMA A;  5DQY A;  1U6T A;  4K7N A;  3WGD A;  3ZVJ A;  4IW9 A;  4KF9 A;  2HXK A;  1ZZY A;  4F9Z A;  4QL9 A;  1B4Q A;  2X4A A;  2C80 A;  4XS4 B;  2Z9S A;  1GUK A;  4LL1 B;  1FB0 A;  5IMF A;  2GVP A;  5G5F A;  1GTU A;  4G0K A;  3LXZ A;  2E7P A;  4ZL9 A;  5EPF A;  4HEA 2;  3UBL A;  1J08 A;  4E8H A;  4PQI A;  4YKG A;  4EDY A;  4RQR A;  1ZYP A;  4YAV A;  5D9T A;  1OE7 A;  2IFQ B;  4L5L A;  4HQS A;  3RPP A;  3GTU A;  2HSY A;  1I5G A;  3MIX A;  1WMJ A;  2B7J A;  2H6X A;  3GNJ A;  3IDV A;  2H70 A;  4ECI A;  2NDO A;  3KTB A;  2KUC A;  1AC1 A;  4MJB A;  2DJ1 A;  2P5Q A;  4MP4 A;  3WGX A;  4K1F A;  1A0R P;  4FQU A;  4I6X A;  1WE0 A;  3QCP A;  4AKX B;  2H73 A;  3W6G A;  4GSN A;  2E0Q A;  4PNG A;  1T3B A;  4GSS A;  5IMC A;  3NOF A;  2UV8 G;  4PXO A;  5B7C A;  3DVX A;  4N11 A;  5DBQ A;  1SKS B;  2DML A;  3ZML A;  3J7Y k;  1OYJ A;  1MDJ A;  3GH9 A;  2GZZ A;  1XW5 A;  4K8M A;  2H1G A;  3IHG A;  1S3D A;  4JRR A;  2HLS A;  2YOI A;  3CWG A;  5IOW A;  1NM3 A;  1XFL A;  1YF1 A;  4BVY A;  2OE0 A;  1O7U A;  4N0Z A;  5JWR B;  5H5Q A;  1PL2 A;  2A2R A;  2M72 A;  1TU7 A;  5JWQ B;  3EVI A;  5ELA A;  1QGV A;  3GL3 A;  2HRA A;  3GX8 A;  2R3X A;  3APQ A;  3HYP A;  1XPV A;  1YDK A;  2RLI A;  2LJK A;  3M9K A;  5HR2 A;  3GTU B;  4MJC A;  3H8Q A;  1SJI A;  2CX3 A;  4O7H A;  3QR6 A;  4TXO A;  4ZBA A;  5IMA A;  9GSS A;  3ZIV A;  1Q4J A;  3JCM L;  2LJA A;  5CP1 A;  1U3A A;  5KN2 A;  2GQL A;  3O76 A;  3ED3 A;  1ERT A;  3HMJ G;  2JAC A;  2GST A;  1LBK A;  2HSM A;  2CVB A;  3KH7 A;  4NMU A;  4E8E A;  4V2L A;  1ERW A;  1N2A A;  2LNS A;  1A23 A;  5DVB A;  2O7K A;  4GQF A;  3EU4 A;  4PGT A;  3MAK A;  3GX0 A;  4MZB A;  1SJZ A;  2WB9 A;  2VIM A;  1SKW B;  3MNG A;  3TJB A;  4KSO A;  4XRD A;  4GST A;  4EXJ A;  4LLR A;  3LOR A;  1M9A A;  5B8A A;  3FEU A;  1TRS A;  2YV7 A;  4BVY B;  3EMP A;  1K3Y A;  2CVK A;  3GRX A;  1PN0 A;  3R2Q A;  4PUF C;  2K18 A;  1TJD A;  5GZZ B;  1FB6 A;  5L71 A;  2LQQ A;  2AUV A;  3EU3 A;  4EVM A;  4L0U A;  3IA1 A;  1Z6M A;  2VLU A;  4TXO B;  2YZH A;  3QFB C;  3ME8 A;  3DVW A;  4XTS A;  4KE3 A;  4JE1 A;  5ECR B;  3MYD A;  4IN0 A;  1PX7 A;  2QC7 A;  3KZQ A;  2VLT A;  1K3O A;  4IP1 A;  1AUC A;  3GN3 A;  4I2T A;  2N5A A;  3DD3 A;  5IO2 A;  3C71 A;  1X0R A;  2HRN A;  8GSS A;  4DSR A;  1WJK A;  4BWQ A;  2XPD A;  3UVH A;  1SEN A;  3C73 A;  4GCI A;  1MD3 A;  2YN1 A;  5KN1 A;  2HSM B;  4N10 A;  1AQW A;  3EWL A;  2H01 A;  3RHC A;  2CZ3 A;  1JZR A;  1AAZ A;  2HRK A;  3S9F A;  3FZA A;  5DAK A;  2D2Z A;  3FR3 A;  5D93 A;  1EEM A;  3GYK A;  1EOH A;  1C72 A;  3F6D A;  2MYG A;  4KAE A;  1WOU A;  4YQU A;  4G01 A;  3F63 A;  2O8V B;  3MWH A;  4I97 A;  1ON4 A;  1PRX A;  2G0F A;  3DML A;  4IGJ A;  3MSZ A;  5LNK e;  5C00 A;  5A5H A;  3UL3 A;  1FHE A;  2CAI A;  5EVO A;  4K2X A;  3FHK A;  1V58 A;  4ILF A;  2TIR A;  4EL1 A;  4X0X A;  3TCO A;  1NHO A;  1YEP A;  2H76 A;  2JSY A;  4I8B A;  1VF4 A;  3IHQ A;  6GST A;  4YH2 A;  3LEF A;  1OVN A;  4L5O A;  2EC4 A;  5ECO B;  1VF1 A;  5FT3 A;  3LGC A;  4POM A;  3FYG A;  2KOK A;  2XBI A;  4MA9 A;  2L57 A;  1TKD B;  1BJX A;  3HD5 A;  4O32 A;  3TKP A;  6GSU A;  2VL3 A;  2B6M A;  3MDK A;  3HXS A;  2H71 A;  3TU3 B;  2HRK B;  5DAK B;  1EP7 A;  4EKZ A;  5B6M A;  3QDN A;  2VKZ G;  1XIY A;  1SK0 A;  2VAF A;  4ECJ A;  2HZE A;  5GAP D;  1SL0 B;  4WR5 A;  3VPQ A;  14GS A;  2PN8 A;  2YCD A;  1TK8 B;  2PMT A;  3GSS A;  2LV3 A;  3KGK A;  4G10 A;  2I4A A;  1RW1 A;  4OD7 A;  2LRN A;  1YQ1 A;  3M0F A;  2OE1 A;  3FRC A;  5A5H B;  3LYP A;  4BL7 A;  2XHF A;  4JR4 A;  1GSD A;  1HNA A;  5CRD A;  1A2J A;  2OJL A;  1SVL A;  3L9U A;  5BMU A;  1QK8 A;  3TOT A;  4MZW A;  3IK7 A;  1TDI A;  1EGO A;  1R4W A;  3U5R E;  2QSI A;  2IPA A;  3KP8 A;  2OBK A;  3D0Z A;  5FHI A;  1A8L A;  1N8J A;  2BJX A;  4PTS A;  1TOF A;  2F8F A;  3D6I A;  1QMV A;  5KN3 A;  1F3B A;  1QFN A;  3A2W A;  3FY7 A;  5D8I A;  3DEX A;  2NPB A;  3TRP A;  1NHY A;  2LQO A;  2MMA A;  4Q5R A;  2RM6 A;  1M9B A;  3IPZ A;  5ID2 A;  5G30 A;  3ZFB A;  1Z5Y E;  1XOA A;  4ZB9 A;  3RPN A;  1H75 A;  2WFC A;  3D5J A;  2IIY A;  3PGT A;  5HR1 A;  2RM5 A;  3HZ8 A;  2HZE B;  3L4N A;  4YQM A;  1K3L A;  1WPI A;  5KEJ A;  2NVL A;  4MCU A;  3TJF A;  2C0E A;  2FD3 A;  1CQG A;  1T1V A;  4HJ2 A;  1TU8 A;  2R2J A;  2FHE A;  4X43 A;  3W8J A;  1BED A;  4TVE A;  4USS A;  3IC8 A;  5AGY A;  2OA7 A;  5J47 A;  3LW9 A;  4KA0 A;  1PD2 1;  3IR4 A;  2GSS A;  5BMU B;  5H5S A;  3SBC A;  4Z2R A;  2J9H A;  3ZZX A;  1T4Y A;  5ECM B;  3I9V 2;  5HFI A;  4DSQ A;  4KUN A;  1K0A A;  5G31 A;  3KM6 A;  4K0N A;  2H0H A;  1U88 A;  3A2V A;  1M2A A;  2YJ7 A;  2WJU A;  5A4V A;  2BMX A;  1VF3 A;  1XW6 A;  4ISD A;  1ML6 A;  2X8G A;  2H1L A;  1Z7R A;  4V2N A;  1FVJ A;  1M7T A;  3FW2 A;  3KXO A;  1HYU A;  4YKF A;  1YVL A;  3ZYW A;  2FY6 A;  4MK3 A;  5DCH A;  4RI6 A;  1GP1 A;  3KCM A;  4TXV A;  2B5Y A;  4PQ1 A;  2EFC A;  2VO4 A;  3UAP A;  1OC9 A;  5ID2 B;  19GS A;  4N0V A;  1EEJ A;  2WS2 A;  4N30 A;  1TK0 B;  2R6K A;  1MTC A;  4KX4 A;  3EMX A;  5J4U A;  4AKI A;  4LA1 A;  3A2X A;  3BCI A;  4P3Y B;  5E4W A;  3TJJ A;  2H1D A;  3GST A;  4L8E A;  3KJY A;  5HR0 A;  4LL4 B;  2OAD A;  5J9B A;  2P31 A;  5D9V A;  1V40 A;  2EIR A;  3HZ4 A;  4CHS A;  3UMA A;  4K2D A;  1Y6E A;  2YZU A;  2K8V A;  1MDK A;  3IC4 A;  2VM2 A;  5IOX A;  5C04 A;  2VCV A;  2CV4 A;  1Z6N A;  2FA8 A;  1ABA A;  2VCT A;  2YP6 A;  1JZO A;  2O85 A;  2WRT A;  3D4M A;  3IOS A;  1THX A;  4I5Q A;  2L5L A;  4ECC A;  5F07 A;  1PX6 A;  2KP1 A;  1GTB A;  3CSJ A;  2HNL A;  5J40 A;  1OC9 B;  2GT6 A;  3M8N A;  3VLN A;  2C0D A;  1K0M A;  2C4J A;  3O6T A;  1AQX A;  4F82 A;  1R5A A;  5G5E A;  2I3Y A;  2WZ9 A;  2HSN A;  1XWB A;  5GAN D;  3PH9 A;  3TKS E;  5DDL A;  2R0C A;  2IN3 A;  4AF2 A;  3GHA A;  3F9U A;  2DLX A;  2V2G A;  1GNE A;  2VCX A;  5JCW A;  1F9M A;  1SK2 A;  2P0G A;  1K0C A;  1FG4 A;  2RUE A;  5J41 A;  5FWG A;  2FWE A;  1RQM A;  3KH9 A;  2DJJ A;  1GLQ A;  4FYB A;  4EDZ A;  2K8S A;  1F37 A;  1ZL9 A;  4WF4 A;  1SYR A;  5A1N A;  1TW9 A;  3UJ1 A;  4CY6 A;  1ERV A;  2JAD A;  2YAN A;  5IO0 A;  3EPT A;  3ERF A;  2C0G A;  3SWL A;  2H1B A;  3F8U A;  3G7Y A;  1U3I A;  4ZL8 A;  4MJE A;  2IME A;  1QUW A;  3DWV A;  20GS A;  2HE3 A;  1J0F A;  1TTZ A;  1R7H A;  4IP6 A;  3QAV A;  5EY6 A;  4ZB8 A;  1HNB A;  4V2M A;  1G7O A;  4ULX A;  1UN2 A;  3AY8 A;  2LTK A;  3ZFL A;  4IKH A;  2F9S A;  4ECB A;  1T8E B;  1SVO A;  1E6B A;  2XBQ A;  4GLT A;  5G2Z A;  2LST A;  1GNW A;  2AV4 A;  5BRT A;  1NSW A;  4KDX A;  2LUS A;  1YKC A;  1X5C A;  1O73 A;  4K5R A;  5ABR A;  5ECS A;  4CY8 A;  4QQ7 A;  1XWA A;  3BBY A;  2I1U A;  4ML6 A;  2H19 A;  2E2M A;  4AJ7 A;  3IRA A;  1SJ6 A;  4OCE A;  1GH2 A;  5HFK A;  2KP2 A;  3H1N A;  3DKS A;  3L9S A;  4KCE A;  3F4T A;  2H75 A;  1LU4 A;  2L4Q A;  1A24 A;  3I69 A;  5A1N B;  2VD0 A;  4RQX A;  2H6Y A;  3LQ7 A;  4ML1 A;  3Q6O A;  2RII A;  1O81 A;  1DBY A;  3DYR A;  4ACS A;  4AI6 A;  2FGX A;  2LS5 A;  4F0C A;  2JZR A;  3ZRE A;  5KOX A;  4G0L A;  2B3S A;  4YQV A;  1OE8 A;  5F05 A;  2VOC A;  5HR3 A;  4OFM A;  4XCS A;  2LJR A;  3UVT A;  3A5W A;  1YKA A;  2KLX A;  4HJM A;  1URM A;  4WXT A;  3A3T A;  1JHB A;  4K6X A;  4ZL7 A;  4DVC A;  1YJ6 A;  3G7I A;  3ZVJ D;  1J9B A;  2C1Y A;  2CQ9 A;  2HZF A;  1SYX A;  2I81 A;  2L4C A;  4IQ1 A;  4EUY A;  4Z7X A;  4XIH A;  1X9W B;  3TKS A;  3P7X A;  2L5O A;  4KW6 A;  2OE3 A;  2IMK A;  1Y1U A;  4EO3 A;  3IXR A;  2HT9 A;  3F3Q A;  3LYK A;  4IEL A;  4HDE A;  4MH2 A;  3C1S A;  4O5R A;  1SL1 B;  2X49 A;  6GSX A;  5CYY A;  1XW9 A;  4NHZ A;  2N5B A;  4PUR A;  1G0T A;  1ILO A;  2P5R A;  2VM1 A;  3VK9 A;  1ERU A;  1TRU A;  3WYW A;  4HS1 A;  3HCZ A;  2CVD A;  3C1R A;  2I9H A;  2TRC P;  3FR9 A;  4FYU A;  4DEJ A;  5J9C A;  1GRX A;  4GF0 A;  3BCK A;  4MZC A;  2V6K A;  5ECP B;  4TN8 A;  4K9Z A;  2ALB A;  4NXI A;  2OBI A;  4PNF A;  3HVS A;  1OKT A;  4HU7 A;  2HYX A;  3QD9 A;  1F2E A;  1PGT A;  2GTU A;  3F4R A;  3IBH A;  4MDC A;  4JZQ A;  5IMZ A;  5CRE A;  4JBB A;  2AYT A;  2PVQ A;  5IMV A;  2HQT A;  1OKD A;  1GSQ A;  2MMO A;  4WBR D;  1X5D A;  2C0F A;  2QA2 A;  3RAZ A;  4PX1 A;  2C3T A;  3Q74 A;  7GSS A;  3F3R A;  3M3M A;  2GQK A;  3KP9 A;  3HDC A;  4O5Q A;  1PL1 A;  5A5K A;  2G2Q A;  1S3C A;  4AGS A;  1SK1 A;  3QMX A;  2GLR A;  3CRT A;  5ECQ B;  3UBK A;  3HHV A;  2MMZ A;  4TRX A;  3DGQ A;  5CRH A;  2DKH A;  16GS A;  17GS A;  2GS3 A;  3U6V A;  4G9H A;  1S3A A;  1YY7 A;  2MBT A;  1OC8 A;  4O92 A;  5IIZ A;  1F3A A;  4G2E A;  1F6M C;  1Q98 A;  1BF5 A;  1DE2 A;  1SD8 A;  4TR3 A;  2FLS A;  2H66 A;  1E2Y A;  2F3M A;  1GSE A;  4KGI A;  3PR8 A;  3CBU A;  5CNW A;  2YWI A;  2X99 A;  1N25 A;  2YWO A;  2A4H A;  1GSS A;  2GSQ A;  4BPY A;  5EL8 A;  4TR1 A;  3GMF A;  1RK4 A;  3L0H A;  2YV9 A;  1PN9 A;  3VWV A;  1O8W A;  4WF5 A;  2PER A;  2FWH A;  5AN1 A;  5HQP A;  1TRW A;  3Q18 A;  5A4U A;  4MMM A;  4GTU A;  2B7K A;  1SKR B;  4EIQ A;  2V41 A;  4TKY A;  2DIZ A;  4CW9 A;  1SL2 B;  4HOJ A;  1GSY A;  5CO3 A;  5ENU A;  5DAL A;  1O6J A;  3QFA C;  2AB6 A;  2UZ8 A;  5DQS A;  4ZB6 A;  4XS6 A;  3W8S A;  3ERW A;  4MNN A;  2EFE A;  4WEY A;  3HKR A;  2R0G A;  3TJG A;  1FOH A;  5JWO B;  4GQC A;  2VCW A;  4IQA A;  2PU9 C;  1JLW A;  5ECL B;  3P2A A;  4EF0 A;  1FO5 A;  2VL2 A;  1GL8 A;  2C3Q A;  2YPM A;  3BD2 A;  2DJK A;  2R5G A;  2GZP A;  4IHU A;  5AIV A;  1K0N A;  3E0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...