5G5FA

Crystallographic structure of the tau class glutathione s-transferase migstu in complex with reduced glutathione.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
KSDVKLLGAWPSPYVMRARITLNVKSVDYELLEETLGSKSDLLLKSNPVHKKIPVLIHNDKPICESLIIVHYIDEFWSSGPSILPSDPYDRAIARFWAAYLDEKWYPSLKGIASAQGEEAKKAAVDQVGESLALIEDTYVKLSKGKPFFGGEKIGYLDIAFGCFLGWLRVTEKTSGVKFLNEAKTPHLAKWAVRFCADPAVKDVMPETEKLAEFAKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAU CLASS GLUTATHIONE S-TRANSFERASE
publication title Insights Into Ligand Binding to a Glutathione S-Transferase from Mango: Structure, Thermodynamics and Kinetics
pubmed doi rcsb
source organism Mangifera indica
molecule tags Transferase
total genus 71
structure length 219
sequence length 219
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5g5fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g5fA01
1AQXA 1TK0B 2EIRA 5A4VA 2B1LA 2L5OA 2HI7A 5J41A 2IFQA 2GGTA 2GS3A 3VURA 3IC4A 3GTUB 3H1NA 4K7OA 4KCAA 4GSTA 3PGTA 4IP6A 1MEKA 5A5KA 3M9JA 3HA9A 2C8UA 1GUMA 4GF0A 4G0KA 5H5RA 3LG6A 3M3MA 1SYXA 1O8WA 3CBUA 2GT5A 1B9YC 2BMXA 5ID2A 1GTAA 3S9FA 5ABRA 1Z3EA 1OE8A 1GSQA 3KTLA 1U3AA 4PNGA 3UAPA 5LNKe 2I9HA 5ELAA 1X0RA 3ME7A 1THXA 4D73A 2H1AA 3N5OA 2VOCA 1BJXA 1GTBA 2JL4A 4HEA2 3WT2A 3M0FA 2M46A 4O92A 1QFNA 1Q4JA 3KGKA 4NHWA 1M2BA 2C1YA 3ZFLA 2VLTA 1O8XA 3M1GA 5C00A 5CRWA 2MMAA 1U6TA 1OC3A 2OE1A 1TRWA 3FEUA 1KEBA 3HDCA 3LEFA 4AGSA 3EWLA 1A2LA 1EEJA 4V2NA 2GSTA 4KW6A 5ECSA 2CX4A 5GAPD 4FH8A 4V1Ag 2YV9A 4GCIA 3GHAA 3VI5A 4IJIA 1OE7A 4KUNA 1HYUA 1Z7RA 5DAKB 3DXBA 2P5QA 1WRYA 2XBIA 1GSSA 2JADA 17GSA 1BQ7A 2NDOA 4N11A 4K0GA 1GULA 4F82A 5F0GA 3HD5A 2R6KA 3KM6A 3IOSA 1ERTA 2EIOA 1FB0A 4XS4B 2H76A 1K0OA 5KN2A 1GNEA 5EPFA 4NV2A 2WZ9A 4MZCA 4F2IA 4XHMA 2C3TA 1ON4A 2VCVA 4MZWA 5D9TA 3L9UA 1GSUA 5HR3A 1IYHA 2KP1A 1NHOA 2AHEA 3KP8A 2GQMA 1TKDB 1NM3A 2DJ3A 3U5RE 3IC8A 4LL4B 4GTUA 6GSUA 1F3BA 2YWMA 4TKYA 4ECJA 6GSTA 1I9DA 3WD6A 3UMAA 3TDGA 3F3RA 3GRXA 2DJ1A 5IOWA 3UVHA 3UJ1A 2WDUA 3P7XA 2WGRA 1NSWA 1ACVA 2E2MA 4K8MA 1DE2A 14GSA 2MMOA 1EV4A 3FY7A 4V2LA 4KAEA 5JWQB 3VPTA 3ZREA 1ERVA 5ECNB 2JZTA 1A2MA 5G30A 5GSTA 5DJMA 4JU5A 4IELA 2HSMA 2BJXA 2C0GA 5B6MA 3TKSE 1OKTA 4O32A 2O7KA 2K9FA 4HUAA 4BVXA 3H79A 2C0DA 4I8BA 1R7HA 4MZBA 6GSWA 3ERWA 3QAGA 2VO4A 4DSRA 3IA1A 5G5FA 2HZEA 1G7OA 1U3IA 2HQTA 1RQMA 1K0CA 4XCSA 2H71A 5E59A 1A8LA 4TOPA 2X8GA 1BYEA 4QL7A 2H0GA 3O6TA 5ECHB 5EY6A 3ZZXA 3HVSA 1B4QA 3LSZA 1R5AA 3D0ZA 4TXOB 2F8AA 5JCWA 4DVCA 2GQKA 6GSVA 5ECQB 2H8LA 1K3LA 4BL7A 4OCEA 1V9WA 4WBJA 1XOAA 3VFIA 4KGIA 1FB6A 4F0CA 3CYNA 2JSYA 4KDUA 2YWNA 3TRQA 4X0XA 3UARA 2DIZA 5IMFA 3F3QA 1XOBA 3A2VA 3VWVA 4LMWA 2FA8A 4G19A 4I6XA 2FCHA 2VL3A 3WGDA 4LL1B 2WB9A 3H8QA 3UVTA 1YKAA 3AY8A 5ECIB 3IE3A 3ZLPA 3ZITA 4OCFA 4O7HA 4USSA 2C0EA 2M80A 1U88A 5IMAA 5HR2A 1S3DA 4HQZA 1T3BA 4LLRA 1AQVA 3FZ4A 3PH9A 5AN1A 1ZMAA 2K8VA 2H19A 1T00A 4G9HA 2VIMA 5G2ZA 1AQWA 4Q5NA 2XHFA 5JWOB 5JCUA 2B7JA 5ECPB 2HYXA 5H5SA 4PXOA 5G31A 3QD9A 1WE0A 3P2AA 1FW1A 3GKMA 3Q6OA 4P3YB 1JZWA 5HFGA 2H66A 2YOIA 4JR6A 2JACA 4L8EA 2LNSA 4GXZA 3KIJA 4WBRD 2GDRA 5F8BA 2CAQA 3ED3A 2VM2A 3IRAA 4RI7A 1ZOFA 4BA7A 2OE3A 2F3MA 2HRFA 4L5OA 5H5QA 4YH2A 3DMLA 4IHUA 2VLUA 2X64A 1FVJA 4PQHA 3GL5A 1TW9A 2FD3A 4F9ZA 4NXIA 3P90A 1TTZA 1I5GA 2KP2A 5DVBA 1R5PA 2CT6A 1YKCA 2LKUA 3PINA 20GSA 3QCPA 4MA9A 4TN8A 5LCZA 1OAZA 2AV4A 5DCGA 5IPHA 3GX8A 4EVMA 5D93A 4HQSA 3ERGA 1YEPA 2OADA 1A2JA 4WEYA 2P5RA 3EU3A 2PERA 1PL1A 4IW9A 1EZKA 4F03A 4WETA 1M2DA 1WMJA 2IWTA 2LEGA 2D2ZA 3D4TA 4OFTA 4HJ2A 10GSA 2CVDA 2AUVA 2K8SA 1XW9A 2MBSA 2VCWA 3GH9A 2X8HA 3F0IA 1EP7A 2YV7A 1VF2A 1K3OA 1F6MC 1ZCPA 2H6XA 2CAIA 1XVQA 2N5AA 3A2XA 5HR1A 4IQ1A 1XWCA 1TU8A 2TRCP 3DVWA 1KTEA 2H30A 2OBIA 1WJKA 3ZTLA 3GURA 2OKAA 1K0DA 2V6OA 4ZBAA 1X9MB 4BVYB 1AIUA 2LQQA 1QMVA 2VL2A 1ST9A 1MDKA 2HSNB 2G0FA 4MK3A 4TR3A 4HZ2A 1X5DA 2NTOA 1A0RP 1TU7A 4TR1B 3FZ9A 3DWVA 4HU7A 3LGCA 2XBQA 3LFLA 3H93A 3F4TA 1SKSB 1HNBA 2FWEA 2DMLA 4MJEA 3I6AA 2WJUA 3IK7A 1ILOA 1KNGA 4IJ3A 3OR5A 1Z9HA 5CRHA 1GSDA 2P31A 3TKQA 4IGJA 2LSTA 1SENA 2NPBA 5AIXA 3RHCA 1O6JA 4TR0A 3P8WA 4BVYA 19GSA 3CSIA 2X8CA 2HSHA 1TRUA 1TRSA 1UC7A 3TJFA 4TXVA 5CAXA 3QOUA 2OBKA 3I9V2 4RQXA 1U87A 3QR6A 4EUYA 1WP0A 1WWJA 3FZ5A 2AYTA 4TR1A 1K0AA 4POLA 5HR0A 4IVFA 4ZB9A 2CZ2A 5ECMB 9GSSA 2ZNMA 2HRKB 2GTUA 4PX1A 3E3EA 3ZFBA 18GSA 1ZYQB 1PRXA 5CP1A 2M72A 1GTIA 1K0MA 2B1KA 1TK8B 2Z9SA 5KN0A 2H6ZA 3M8NA 3Q19A 1Z6NA 1M9AA 3BBYA 1J08A 3GKXA 4J2FA 1BAYA 4PNFA 1OVNA 1NHYA 3LORA 1T7PB 4AF2A 4MCUA 3CTGA 4E8EA 3APOA 3GTUA 2O85A 3VWXA 4MPGA 2DJJA 3KH9A 3EU4A 4N0VA 4KX4A 3HYPA 4ZIJA 5DJLA 3QFBC 2C4JA 4GSNA 4JBBA 3FHKA 3M9KA 6GSYA 5ENUA 2MMZA 4POKA 4JE1A 2CVKA 3K8NA 3HHVA 5IMCA 1TOFA 4WR4A 1JZDA 3KJYA 1JLWA 1Y25A 2C0FA 3IHQA 2LJRA 5ECRB 3HZ4A 4ML6A 3UEMA 4IS0A 4Z7XA 4QL9A 1FG4A 3EC3A 2DJ2A 3L78A 5J5NA 2H0IA 3FR9A 3TKSC 3R2QA 2NBSA 1UA5A 2FLSA 2B3SA 1N8JA 3G7YA 4K9ZA 1G6YA 5G5EA 2ON5A 2K18A 1TDIA 1THOA 4JZQA 4K6XA 4EE0A 1PA3A 4OFNA 4OMVA 1Z5YE 3C8EA 1R4WA 1XPVA 4YAVA 3UL3A 1ZYEA 1WPIA 4ISDA 2JZRA 2LS5A 2VAFA 1MD4A 3VI7A 1VF4A 4TR4A 3G9BA 2PMTA 4MJCA 1EOGA 2GSSA 2LQOA 4WKWA 1HNAA 4CHSA 4XTSA 2I1UA 4G10A 3ZMKA 2CX3A 2RUEA 5J9CA 2VLVA 3TCOA 3LXZA 3TJKA 1OC9B 3FZAA 4WF5A 5KN1A 4KB3A 2MYGA 3KMOA 2L5LA 5DAKA 4MJAA 3BOAA 1R26A 2LTKA 5IMDA 1SJIA 2B7KA 4EXJA 3GYKA 3VWWA 1YF0A 1X5CA 4FO5A 1H4OA 4BWQA 1EWXA 2H0HA 2XPEA 5DDLA 4L0UA 4MDCA 2GT6A 1TK5B 4BWSA 4XS4A 2TRXA 3US3A 2B5XA 2LRTA 3DVXA 4OD7A 2IL3A 6GSXA 4GQCA 3FW2A 3GV1A 3Q18A 3GN3A 2V41A 4I2TA 3C7MA 1XXUA 3APQA 3ZMLA 3MWHA 3VLNA 3GUSA 3J7Yk 2DSAA 2DLXA 2LUSA 4G0IA 1XWBA 5IOXA 3LQ7A 4YQUA 3EVIA 3A3TA 2YNXA 3C1RA 2ZCTA 2GZYA 2FA4A 1J0FA 2PVQA 4QQ7A 4DSSB 3MNGA 1K3YA 1SK0A 4ULXA 1TJDA 1B4PA 1YQ1A 4TVEA 4EF0A 2E7PA 3IV4A 3QPMA 1JHBA 4N0ZA 4MMMA 4XS6A 1A8YA 3KP9A 1FAAA 2PUKC 3LXTA 1YDKA 1UVZA 2R5GA 1XCCA 5AISA 2YN1A 4NAXA 4CW9A 3RDWA 3E0UA 1ERWA 1PSQA 2L57A 4ZB8A 4MP4A 3Q74A 1PKWA 4I97A 5IPGA 3GSSA 2C3NA 3KD0A 4IBPA 2VCQA 2AB6A 3JCML 3HXSA 2ALBA 3QDNA 2CVBA 4HS1A 1XBSA 3ME8A 2X99A 4IKHA 4YQMA 5J4UA 2PBJA 4BPYA 1GSFA 1XWKA 2FGXA 3DEXA 4AJ6A 5INYA 1V40A 2V32A 1AUCA 1VGLA 2B5YA 4HI7A 2P0GA 1DUGA 4Q5QA 1NW2A 2GLRA 1O73A 4MJBA 4OO4A 4TXOA 2H1BA 5D9WA 1YEXA 1TRVA 1M7TA 3RBTA 4HDEA 2A2SA 1ZGNA 2UZ8A 4MPFA 2V6KA 5ELGA 1SJ6A 2WULA 2AJQB 3GFKA 2I3YA 1O81A 3GKNA 4NHZA 5FHIA 2IMIA 3PPUA 1EV9A 4LMVA 4K0NA 1GNWA 1QK8A 2E0QA 1VRSD 3F4RA 3IR4A 3GL3A 4PUAA 2ES7A 4ZBBA 3F9UA 1DSBA 1EOHA 2L6DA 1XW5A 1YJ6A 1A0FA 4DSQA 2PWJA 1RW1A 1WIKA 1GUKA 3ZRDA 1FO5A 3HKRA 1FOVA 1QUWA 2VCZA 4EC0A 2NVLA 2VD0A 2WFCA 1EEMA 2OA7A 3D5JA 4G2EA 1SKRB 2E2GA 5CREA 1V2AA 5D96A 1M2AA 3VPQA 3KEBA 3G7IA 4PQIA 1EP8A 5B8AA 2L4QA 4HU9A 3ZYWA 4KSMA 1MTCA 2K6VA 3C71A 3DKSA 5DQSA 1XFLA 2YJ7A 3FR6A 4PGTA 2WS2A 1DE1A 5BMUA 1HQOA 1PQNA 1V57A 4XS1A 2C3QA 4POBA 3D21A 1ERUA 5JCGA 4ACSA 2F8FA 2FWGA 4K1FA 5GSSA 2FWHA 2KLXA 3IK9A 1X5EA 1JZOA 1VF1A 4WXTA 3BCKA 4YAPA 2PN8A 5JWRB 5F05A 4I5QA 4ID0A 3KMNA 2MBTA 4IN0A 1GSEA 2H1GA 3SBCA 3ZIJA 2HE3A 2CQ9A 1GL8A 1XZOA 4FYUA 5AGYA 1JZRA 2YWOA 3KH7A 4NPBA 3DD3A 2GQLA 1N2AA 1SL1B 2L6CA 8GSSA 4JR4A 3IBHA 5DALB 1T4ZA 2HFDA 2OJLA 2VD1A 2IFQB 2GSQA 3GNJA 3FK8A 2IMFA 3CXGA 5EL8A 1YZXA 1PMTA 3TOTA 1FVKA 3HY2A 4ZL7A 2RM5A 3J7Yb 2B6MA 5COHA 2MMNA 3KXOA 2KOKA 1URMA 3ZVJD 3A2WA 1XIYA 1O85A 2H70A 1GUHA 5ID2B 4ZILA 3EE2A 3NIVA 3GKKA 4E8HA 3HZ8A 2VUPA 1HD2A 1X9WB 3TOUA 3RPNA 2VL9A 3RPPA 2DBCA 4HZ4A 2DIYA 4D73B 5CRGA 2QSIA 3V1WA 3CTFA 1BX9A 3D6IA 3EYTA 3QFAC 3D22A 3APSA 4KDXA 4J57E 6GSSA 5DALA 3TKPA 2FHEA 4DEJA 5KEJA 4KH7A 4KDYA 4JRRA 3O76A 7GSSA 4KCEA 1SJZA 3W8SA 5D9VA 4H86A 1Z7PA 3R3EA 5EVOA 5CRDA 2J23A 2KHPA 3MAKA 2N5FA 2F51A 2JU5A 4KF9A 1B9XC 5G1LA 3I69A 1SL2B 1B8XA 3FYGA 1XWAA 5ECKB 3DRNA 4MF6A 2DJ0A 2JZSA 1M99A 2HRNA 5E4WA 13GSA 3TRXA 4V2MA 2HSYA 4RI6A 2J9HA 4ZL8A 3BJ5A 1T8EB 1C72A 1E6BA 1PD21 4ZB6A 5HQPA 2FY6A 3CRTA 3TKRA 1GRXA 1VF3A 3HJPA 5FT3A 1F2EA 2G2QA 3ZIVA 1SL0B 2HRAA 3GH6A 2HRKA 3HJOA 1PL2A 2YANA 5D8IA 1G6WA 2V2GA 5HFIA 5D9XA 3QAWA 2HNLA 3RAZA 1XW6A 2YPMA 4GRFA 5L71A 3F6FA 2R37A 1ML6A 4NWYA 2ON7A 3L0HA 2CV4A 1UN2A 1K0BA 2BTOT 3VWUA 5IIZA 5B6NA 3IDVA 3UIWA 3WYWA 3CRUA 3A5WA 3EINA 4GSSA 1E2YA 2YZHA 1KBNA 2QC7A 4RUVA 1BEDA 1WOUA 1RK4A 1AXDA 3MSZA 3BD2A 2VCTA 3TKSA 2LV3A 2IMDA 4KE3A 4ECBA 1MDIA 1GSYA 2LRCA 3UBLA 1A24A 2R2JA 1W4VA 5FWGA 3TJBA 3CSHA 3PR8A 4EL1A 4POMA 1AAZA 3TJGA 4MF5A 3L9SA 4AJ7A 3G7JA 2RIIA 4GQFA 5IM9A 3GSTA 1EGOA 1SU9A 2PPTA 3GA4A 4FQUA 4KSOA 2B5EA 2HSMB 4PQ1A 3E9JB 3H4KA 2R3XA 4XRDA 1G0TA 4Q5FA 1PN9A 5G1KA 4BVXB 3QAVA 3SWLA 4PUFC 4HJMA 2HLSA 4OFMA 3VK9A 2AAWA 4X1UA 2GVPA 2HZEB 4EDZA 3RHBA 1DBYA 4FYCA 2RLIA 1LBKA 3TGZA 4PTSA 3TJJA 2OE0A 3IAM2 2V1MA 4AJ8A 1S3CA 3IAS2 1GLPA 1PX7A 1F9MA 2H1DA 2FNOA 2GSRA 1SD9A 5A4WA 2YP6A 2O89A 4EO3A 1GWCA 2IMKA 3U6VA 2WCIA 3QMXA 3WT1A 1AC1A 2WRTA 5ECOB 1SYRA 4BL7B 1OC9A 4F0BA 1M0UA 2XPDA 2QKEA 5DCHA 3W8JA 4GWRA 3HVXA 3IXRA 4ZBDA 1H75A 5IMVA 1LU4A 2CA8A 5KN3A 2CZ3A 5DQYA 3HCZA 16GSA 3ISOA 2FWFA 1BG5A 4TW5A 1TXXA 1FHEA 1EGRA 5C04A 3GIXA 1QXHA 4K7NA 1Y6EA 3LYPA 3LYKA 2L4CA 1O7UA 4CDOA 4PURA 5IQYA 4GLTA 2C80A 5J3RA 3LJRA 3DGQA 1W89A 5DBQA 2DC5A 4KNDA 3D4MA 2O8VB 1A23A 5IMZA 3F4SA 12GSA 1OC8A 5GZZB 4ECCA 4RQRA 1XVWA 2H74A 1XWGA 4V1Ap 3WGEA 1ABAA 5A4UA 4XIHA 3MDKA 1USBA 4DSSA 3TUEA 4NV5A 5AIVA 1YY7A 4MH2A 1TP9A 3IPZA 4IP1A 1V98A 5IO0A 3F6DA 3FRCA 2O87A 1T4YA 4ILFA 1K0NA 2HXKA 4N10A 4MH3A 2IMEA 1T1VA 5IO2A 2H01A 4TRXA 2DMMA 1TI3A 5F06A 1S3AA 3HJMA 2PU9C 1HNCA 3WGXA 4L0WA 3KCMA 1QGVA 1TI1A 1SD8A 2RUFA 4N30A 4OWYA 5CO3A 1F3AA 4ECIA 1PKZA 4XRAA 1OKDA 3UBKA 1JFUA 1M9BA 4KA0A 3DIEA 5GAND 22GSA 4OO5A 3DYRA 2H72A 2LNTA 4G0LA 3ERFA 2HZFA 2IN3A 1X9SB 1GLQA 1ZZYA 2H73A 2LJKA 3KZQA 1Z6MA 3CSJA 4WR5A 5LD0A 3O3TA 2VM1A 1ZL9A 1SK1A 2IIYA 3F8UA 2N5BA 3HVVA 3TB2A 1MD3A 4MLYA 1MDJA 3C73A 3F63A 1Q98A 2KUCA 2EC4A 3W6GA 3L9VA 4Q5RA 4O5RA 2QGVA 2I4AA 1V58A 3LWAA 2HT9A 3KTBA 3GMFA 3FKFA 3BCIA 1JLVA 2TIRA 4JEDA 3N9JA 2GZPA 2MZCA 2RM6A 2GZZA 2F9SA 4LA1A 2REMA 2H6YA 4MABA 2OACA 4WF4A 3FR3A 1CQGA 1LJRA 2DJKA 4EDYA 4L5LA 4NMUA 1IYIA 2ZUPA 5ECLB 5HFKA 5CYYA 4I2UA 3GX0A 3EURA 4HOJA 1G7EA 11GSA 2YZUA 3NZNA 3ZVJA 5B8BA 3ZL5A 2VL2C 2JSZA 3CMIA 1OYJA 2PVOC 2LRNA 2H75A 1GH2A 4ZXGA 4IQAA 4ZL9A 1PGTA 5B7CA 2YCDA 4FIWA 5CNWA 2FUG2 3EMXA 3C1SA 4K7IA 2IPAA 3TRPA 2VCXA 2L59A 1QQ2A 2LJAA 3UOMA 1GTUA 1AW9A 1J9BA 2EIQA 3L4NA 4FYBA 1SKWB 1F37A 5F07A 2A4VA 3EMPA 1B48A 2YJHA 4X43A 3NOFA 1YF1A 4K2DA 5D73A 4YQVA 1CQHA 1GP1A 5J9BA 2YWIA 2XC2A 4EKZA 2I81A 1SK2A 2IJYA 4MF7A 3I43A 2R4VA 1PX6A 4ML1A 4J56E 2A2RA 2PGTA
chains in the Genus database with same CATH superfamily
1AQXA 1TK0B 2EIRA 5A4VA 2B1LA 2DKIA 2L5OA 1M3JA 2HI7A 5J41A 2IFQA 2GGTA 2GS3A 3VURA 3IC4A 3GTUB 3H1NA 4K7OA 4G01A 4KCAA 4GSTA 3PGTA 4IP6A 1MEKA 5A5KA 3M9JA 3HA9A 2WVZA 2C8UA 1GUMA 4GF0A 4G0KA 2R0CA 5H5RA 3LG6A 3M3MA 1SYXA 1O8WA 3CBUA 2GT5A 4K2XA 1B9YC 2BMXA 5ID2A 1GTAA 3S9FA 5ABRA 1Z3EA 1OE8A 1GSQA 3KTLA 1U3AA 4PNGA 3UAPA 5LNKe 2I9HA 5ELAA 1X0RA 3ME7A 1THXA 4D73A 2H1AA 4O5UA 4PHZC 3N5OA 2VOCA 1BJXA 1GTBA 2JL4A 4HEA2 3WT2A 3M0FA 2M46A 4O92A 1QFNA 1Q4JA 3KGKA 4NHWA 1M2BA 2C1YA 3ZFLA 5J4VA 2VLTA 1O8XA 3M1GA 5C00A 4A5PA 5CRWA 2MMAA 1U6TA 1OC3A 2OE1A 1TRWA 3FEUA 1KEBA 3HDCA 3LEFA 1BF5A 4AGSA 3EWLA 1A2LA 1EEJA 4V2NA 2GSTA 4KW6A 5ECSA 2CX4A 5GAPD 4FH8A 4V1Ag 2YV9A 4GCIA 3GHAA 3VI5A 4IJIA 1OE7A 4KUNA 1HYUA 1Z7RA 5DAKB 3DXBA 2P5QA 1WRYA 2XBIA 1GSSA 2JADA 17GSA 1BQ7A 2NDOA 4N11A 4K0GA 1GULA 4F82A 5F0GA 3HD5A 2R6KA 3KM6A 3IOSA 1ERTA 2EFCA 2EIOA 1FB0A 4XS4B 2H76A 1K0OA 5KOWA 5KN2A 1GNEA 5EPFA 4NV2A 2WZ9A 4MZCA 4F2IA 4XHMA 2C3TA 5A34A 1ON4A 2VCVA 4MZWA 5D9TA 3L9UA 1GSUA 5HR3A 4X4JA 1IYHA 2KP1A 1NHOA 2AHEA 3KP8A 2GQMA 1TKDB 1NM3A 2DJ3A 3U5RE 3IC8A 4LL4B 1PN0A 4GTUA 2WW1A 6GSUA 1F3BA 2YWMA 4TKYA 4ECJA 6GSTA 1I9DA 3WD6A 3UMAA 3TDGA 3F3RA 3GRXA 2DJ1A 5IOWA 3UVHA 3UJ1A 2WDUA 3P7XA 2WGRA 1NSWA 1ACVA 2E2MA 4K8MA 1DE2A 14GSA 2MMOA 1EV4A 3FY7A 4V2LA 4KAEA 5JWQB 3VPTA 3ZREA 1ERVA 5ECNB 2JZTA 1A2MA 5G30A 5GSTA 5DJMA 4JU5A 4IELA 2HSMA 2BJXA 4HSCX 2C0GA 5B6MA 3TKSE 1OKTA 4O32A 2O7KA 2K9FA 4HUAA 4BVXA 3H79A 2C0DA 4I8BA 1R7HA 4MZBA 6GSWA 3ERWA 3QAGA 2VO4A 4DSRA 3IA1A 5G5FA 2HZEA 1G7OA 1U3IA 2HQTA 1RQMA 1K0CA 4XCSA 2H71A 5E59A 3FMWA 1A8LA 4TOPA 4Z2RA 2X8GA 1BYEA 4QL7A 2H1LA 2H0GA 3O6TA 5ECHB 5EY6A 3ZZXA 3HVSA 1B4QA 4AKHA 3LSZA 1R5AA 3D0ZA 4TXOB 2F8AA 5JCWA 4DVCA 2GQKA 6GSVA 5ECQB 2H8LA 1K3LA 4BL7A 4OCEA 1V9WA 4WBJA 1XOAA 3VFIA 4KGIA 1FB6A 4F0CA 3CYNA 2JSYA 4KDUA 2YWNA 3TRQA 4X0XA 3UARA 2DIZA 5IMFA 3F3QA 1XOBA 3A2VA 3VWVA 4LMWA 2FA8A 4G19A 4I6XA 2FCHA 2VL3A 3WGDA 4LL1B 2WB9A 3H8QA 3UVTA 1YKAA 3AY8A 5ECIB 3IE3A 3ZLPA 3ZITA 4OCFA 4O7HA 4USSA 2C0EA 5J4YA 2M80A 1U88A 5IMAA 5HR2A 1S3DA 4HQZA 1T3BA 4LLRA 1AQVA 3FZ4A 3PH9A 5AN1A 1ZMAA 2K8VA 2H19A 1T00A 4G9HA 2VIMA 5G2ZA 1AQWA 4Q5NA 2XHFA 5JWOB 5JCUA 2B7JA 5ECPB 2HYXA 5H5SA 4PXOA 5G31A 3QD9A 5A5HA 1WE0A 3P2AA 1FW1A 3GKMA 3Q6OA 4P3YB 1JZWA 5HFGA 2H66A 2YOIA 5BMUB 4JR6A 2JACA 4L8EA 2LNSA 4GXZA 3KIJA 4WBRD 2GDRA 5F8BA 2CAQA 3ED3A 2VM2A 3IRAA 4RI7A 1ZOFA 4BA7A 2OE3A 2F3MA 2HRFA 4L5OA 5H5QA 4YH2A 3DMLA 4IHUA 2VLUA 2X64A 1FVJA 4PQHA 3GL5A 1TW9A 2FD3A 2WVYA 4F9ZA 4NXIA 3P90A 1TTZA 1I5GA 2KP2A 5DVBA 1R5PA 2CT6A 1YKCA 2LKUA 3PINA 20GSA 3QCPA 4MA9A 4TN8A 5LCZA 1OAZA 2AV4A 5DCGA 5IPHA 3GX8A 4EVMA 5D93A 4HQSA 3ERGA 1YEPA 1SVLA 2OADA 1A2JA 4WEYA 2P5RA 3EU3A 2PERA 4O5QA 1PL1A 4IW9A 1EZKA 4F03A 4WETA 1M2DA 1WMJA 2IWTA 2LEGA 2D2ZA 3D4TA 4OFTA 4HJ2A 10GSA 4QMKA 2CVDA 2AUVA 2K8SA 1XW9A 2MBSA 2VCWA 3GH9A 2X8HA 3F0IA 1EP7A 2YV7A 1VF2A 1K3OA 1F6MC 1ZCPA 2H6XA 2CAIA 1XVQA 2N5AA 3A2XA 5HR1A 4IQ1A 1XWCA 1TU8A 2TRCP 3DVWA 1KTEA 2H30A 2OBIA 1WJKA 3ZTLA 3GURA 2OKAA 1K0DA 2V6OA 4ZBAA 1X9MB 4BVYB 1AIUA 2LQQA 1QMVA 2VL2A 1ST9A 5A1NB 1MDKA 2HSNB 2EFHA 2G0FA 4MK3A 4TR3A 4YKGA 4HZ2A 1X5DA 2NTOA 1A0RP 1TU7A 4TR1B 3FZ9A 3DWVA 4HU7A 3LGCA 2XBQA 3LFLA 3H93A 3F4TA 1BG1A 1SKSB 5J47A 1HNBA 2FWEA 2DMLA 4MJEA 3I6AA 2WJUA 4K5RA 3IK7A 1ILOA 1KNGA 4IJ3A 3OR5A 1Z9HA 5CRHA 1GSDA 2P31A 3TKQA 4IGJA 2WVXB 2LSTA 1SENA 2NPBA 5AIXA 3RHCA 1O6JA 4TR0A 3P8WA 4BVYA 19GSA 3CSIA 2X8CA 2HSHA 1TRUA 5A1NA 1TRSA 1UC7A 3TJFA 4TXVA 5CAXA 3QOUA 2OBKA 3I9V2 4RQXA 1U87A 3QR6A 4EUYA 1WP0A 1WWJA 3FZ5A 2AYTA 4TR1A 1K0AA 4POLA 5HR0A 4IVFA 4ZB9A 2CZ2A 5ECMB 9GSSA 2ZNMA 2HRKB 2GTUA 4PX1A 3E3EA 3ZFBA 18GSA 1ZYQB 1PRXA 5CP1A 2M72A 1GTIA 1K0MA 2B1KA 1TK8B 4PI0C 2Z9SA 5KN0A 2H6ZA 3M8NA 3Q19A 1Z6NA 1M9AA 3BBYA 1J08A 2O5VA 3GKXA 4J2FA 1BAYA 4PNFA 1OVNA 4AKGA 1NHYA 3LORA 1T7PB 2UV8G 4AF2A 4MCUA 3CTGA 4E8EA 3APOA 3GTUA 2O85A 3VWXA 4MPGA 2DJJA 3KH9A 1S3RA 3EU4A 4N0VA 4KX4A 3HYPA 4ZIJA 5DJLA 1M3IA 3QFBC 2C4JA 4GSNA 4JBBA 3FHKA 4K5SA 3M9KA 6GSYA 5ENUA 2MMZA 4POKA 4JE1A 2CVKA 3K8NA 3HHVA 5IMCA 1TOFA 4WR4A 1JZDA 3KJYA 1JLWA 1Y25A 2C0FA 3IHQA 2LJRA 5ECRB 3HZ4A 4ML6A 3UEMA 4IS0A 4Z7XA 4QL9A 1FG4A 3EC3A 2DJ2A 3L78A 5J5NA 2H0IA 3FR9A 3TKSC 3R2QA 2NBSA 1UA5A 2FLSA 3EPTA 2B3SA 1N8JA 3G7YA 4K9ZA 1G6YA 5G5EA 2ON5A 2K18A 1TDIA 1SVOA 1THOA 1TXUA 4JZQA 4K6XA 4EE0A 1PA3A 4OFNA 4OMVA 1Z5YE 3C8EA 1R4WA 1XPVA 4YAVA 1XG8A 3UL3A 1ZYEA 1WPIA 1YVLA 4ISDA 2JZRA 3MIXA 2LS5A 2VAFA 1MD4A 3VI7A 1VF4A 4TR4A 3G9BA 2PMTA 4MJCA 1EOGA 2EFEA 2GSSA 2LQOA 4WKWA 1HNAA 1N25A 4CHSA 4XTSA 2I1UA 4G10A 3ZMKA 2CX3A 2RUEA 5J9CA 2VLVA 3TCOA 3LXZA 3TJKA 1OC9B 3FZAA 4WF5A 5KN1A 4KB3A 2MYGA 3KMOA 2L5LA 5DAKA 4MJAA 3BOAA 4CY8A 1R26A 2LTKA 5IMDA 1SJIA 2B7KA 4EXJA 3GYKA 3VWWA 1YF0A 1X5CA 4FO5A 1H4OA 4BWQA 1EWXA 2H0HA 2XPEA 5DDLA 4L0UA 4MDCA 4AKXB 2GT6A 1TK5B 4BWSA 4XS4A 2TRXA 4Z2TA 3US3A 3IHGA 2B5XA 2LRTA 3DVXA 4OD7A 2IL3A 6GSXA 4GQCA 3FW2A 3GV1A 3Q18A 4AI6A 4FXYP 2V41A 3GN3A 4I2TA 3C7MA 1XXUA 3APQA 3ZMLA 3MWHA 3VLNA 3GUSA 3J7Yk 2DSAA 2DLXA 2LUSA 4G0IA 1XWBA 3RFRC 5IOXA 3LQ7A 4YQUA 3EVIA 3A3TA 2YNXA 3C1RA 2ZCTA 2GZYA 2FA4A 1J0FA 2PVQA 4QQ7A 4DSSB 3MNGA 1K3YA 1SK0A 4ULXA 1TJDA 1B4PA 1YQ1A 4TVEA 4EF0A 2E7PA 3IV4A 3QPMA 1JHBA 4N0ZA 4MMMA 4XS6A 1A8YA 3KP9A 1FAAA 2PUKC 3LXTA 1YDKA 1UVZA 2R5GA 1XCCA 5AISA 4E68A 2YN1A 4NAXA 4CW9A 3RDWA 3E0UA 1ERWA 1PSQA 2L57A 4ZB8A 4MP4A 3Q74A 1PKWA 4I97A 5IPGA 1PFOA 3RGBC 5BRTA 3GSSA 2C3NA 3KD0A 4IBPA 2VCQA 2AB6A 3JCML 3HXSA 2ALBA 3QDNA 2CVBA 4HS1A 1XBSA 3ME8A 2X99A 4IKHA 4YQMA 5J4UA 2PBJA 4BPYA 3MYDA 1GSFA 1XWKA 2FGXA 3DEXA 4AJ6A 5INYA 1V40A 2V32A 1AUCA 1VGLA 2B5YA 4HI7A 2P0GA 1DUGA 4Q5QA 1NW2A 2GLRA 1O73A 4MJBA 4OO4A 4TXOA 2H1BA 5D9WA 4N3ZA 1YEXA 2WW0A 1TRVA 1M7TA 3RBTA 4HDEA 2A2SA 1ZGNA 2UZ8A 4MPFA 2V6KA 5ELGA 1SJ6A 2WULA 2AJQB 3GFKA 2I3YA 1O81A 3GKNA 4NHZA 5FHIA 2IMIA 3PPUA 1EV9A 4LMVA 4K0NA 1GNWA 1QK8A 2E0QA 1VRSD 3F4RA 3IR4A 3GL3A 4PUAA 2ES7A 4ZBBA 3F9UA 1DSBA 1EOHA 2L6DA 1XW5A 1YJ6A 1A0FA 4DSQA 2PWJA 1RW1A 1WIKA 1GUKA 3ZRDA 1FO5A 3HKRA 1FOVA 1QUWA 2VCZA 4EC0A 2NVLA 2VD0A 2WFCA 1EEMA 2OA7A 3D5JA 4G2EA 1SKRB 2E2GA 5CREA 4ZB7A 1V2AA 5D96A 1M2AA 3VPQA 3KEBA 3G7IA 4PQIA 1EP8A 5B8AA 2L4QA 2A2PA 4HU9A 3ZYWA 2X4AA 4KSMA 1MTCA 2K6VA 3C71A 3DKSA 5DQSA 1XFLA 2YJ7A 3FR6A 4PGTA 1SVMA 2WS2A 1DE1A 5BMUA 1HQOA 1PQNA 1V57A 4XS1A 2C3QA 4POBA 3D21A 1ERUA 5JCGA 4ACSA 2F8FA 2FWGA 4K1FA 5GSSA 2FWHA 2KLXA 3IK9A 1X5EA 1JZOA 1VF1A 4WXTA 3BCKA 4YAPA 2PN8A 5JWRB 5F05A 4I5QA 4ID0A 3KMNA 2MBTA 4IN0A 1GSEA 2H1GA 3SBCA 3ZIJA 2HE3A 2CQ9A 1GL8A 1XZOA 4FYUA 5AGYA 1JZRA 2YWOA 3KH7A 4NPBA 3DD3A 2GQLA 1N2AA 1SL1B 2L6CA 8GSSA 4JR4A 3IBHA 5DALB 1T4ZA 2HFDA 2OJLA 2VD1A 2IFQB 2GSQA 3GNJA 3FK8A 2IMFA 3CXGA 1I1IP 5EL8A 1YZXA 1PMTA 3TOTA 1FVKA 3HY2A 4ZL7A 2RM5A 3J7Yb 2B6MA 5COHA 2MMNA 3KXOA 2KOKA 3TU3B 1URMA 3ZVJD 3A2WA 1XIYA 2R0GA 1O85A 2H70A 1GUHA 5ID2B 4ZILA 3CHXC 3EE2A 3NIVA 3GKKA 4E8HA 3HZ8A 2VUPA 1HD2A 1X9WB 3TOUA 3RPNA 2VL9A 3RPPA 2DBCA 4HZ4A 2DIYA 4D73B 5CRGA 2QSIA 3V1WA 3CTFA 1BX9A 3D6IA 3EYTA 3QFAC 3D22A 2HSNA 4ICYA 3APSA 4KDXA 4J57E 6GSSA 5DALA 3TKPA 2FHEA 4DEJA 5KEJA 4KH7A 4KDYA 4JRRA 3O76A 7GSSA 4KCEA 1SJZA 3W8SA 5D9VA 4H86A 1Z7PA 3A5IA 3R3EA 5EVOA 5CRDA 2J23A 2KHPA 3MAKA 2N5FA 2F51A 2JU5A 4KF9A 1B9XC 5G1LA 3I69A 1SL2B 1B8XA 3FYGA 1XWAA 5ECKB 3DRNA 4MF6A 2DJ0A 2JZSA 1M99A 2HRNA 5E4WA 13GSA 2WVXA 3TRXA 5J40A 4V2MA 2HSYA 4RI6A 2J9HA 4GDFA 4ZL8A 3BJ5A 1T8EB 1C72A 1E6BA 1PD21 4ZB6A 5HQPA 2FY6A 3CRTA 3TKRA 1GRXA 1VF3A 3HJPA 5FT3A 1F2EA 2G2QA 3ZIVA 1SL0B 2HRAA 3GH6A 2HRKA 3HJOA 1PL2A 2YANA 5D8IA 1G6WA 2V2GA 5HFIA 5D9XA 3QAWA 2HNLA 3RAZA 1XW6A 2YPMA 4GRFA 5L71A 3F6FA 2R37A 1ML6A 4NWYA 2ON7A 3L0HA 5A34B 2CV4A 1UN2A 1K0BA 2BTOT 3VWUA 5IIZA 5B6NA 3IDVA 3UIWA 3WYWA 3CRUA 3A5WA 3EINA 4GSSA 1E2YA 2YZHA 1KBNA 2QC7A 4RUVA 1BEDA 1WOUA 1RK4A 1AXDA 3MSZA 2X49A 3BD2A 2VCTA 3TKSA 2LV3A 2IMDA 4KE3A 4ECBA 1MDIA 1GSYA 2LRCA 3UBLA 1A24A 2R2JA 4AKIA 1W4VA 5FWGA 3TJBA 3CSHA 3PR8A 4EL1A 4POMA 1FOHA 1AAZA 3TJGA 4MF5A 3L9SA 4AJ7A 3G7JA 2RIIA 4GQFA 5IM9A 3GSTA 1EGOA 1SU9A 2PPTA 3GA4A 4FQUA 2O3EA 4KSOA 2B5EA 2HSMB 1S4BP 4PQ1A 3E9JB 3H4KA 2R3XA 4XRDA 4PI2C 4Q5FA 1G0TA 1PN9A 5G1KA 4BVXB 3QAVA 3SWLA 4PUFC 4HJMA 2HLSA 4OFMA 3VK9A 2AAWA 4X1UA 2GVPA 2HZEB 4EDZA 3RHBA 1DBYA 4FYCA 2RLIA 1LBKA 4EIQA 3TGZA 4PTSA 3TJJA 2OE0A 3IAM2 2V1MA 4AJ8A 1S3CA 3IAS2 1GLPA 1PX7A 1F9MA 2H1DA 2FNOA 2GSRA 1SD9A 5A4WA 2YP6A 2O89A 4EO3A 1GWCA 2IMKA 3U6VA 2WCIA 3QMXA 3WT1A 1AC1A 2WRTA 5ECOB 1SYRA 4BL7B 1OC9A 4F0BA 1M0UA 4YKFA 2XPDA 2QKEA 5DCHA 3W8JA 4GWRA 3HVXA 3IXRA 4ZBDA 2WW3A 1H75A 5IMVA 1LU4A 2CA8A 3CWGA 2QA2A 5KN3A 2CZ3A 5DQYA 3HCZA 16GSA 3ISOA 2FWFA 1BG5A 2O36A 4TW5A 1TXXA 1FHEA 1EGRA 5C04A 3GIXA 1QXHA 4K7NA 1Y6EA 3LYPA 3LYKA 2L4CA 1O7UA 4CDOA 4PURA 5IQYA 4GLTA 2C80A 5J3RA 3LJRA 3DGQA 1W89A 5DBQA 2DC5A 4KNDA 3D4MA 2O8VB 1A23A 5IMZA 3F4SA 12GSA 1OC8A 5GZZB 4ECCA 4RQRA 1XVWA 2H74A 1XWGA 4V1Ap 3WGEA 1ABAA 5A4UA 4XIHA 3MDKA 5A5HB 1USBA 4DSSA 3HMJG 3TUEA 4NV5A 5AIVA 1YY7A 4MH2A 1TP9A 3IPZA 4IP1A 1V98A 5IO0A 2R0PA 3F6DA 3FRCA 2O87A 1T4YA 4ILFA 1K0NA 2HXKA 4N10A 4MH3A 2IMEA 1T1VA 4EIPA 5IO2A 2H01A 4TRXA 2DMMA 1TI3A 5F06A 1S3AA 3HJMA 2PU9C 1HNCA 3WGXA 4L0WA 3KCMA 1QGVA 1TI1A 1SD8A 2RUFA 4N30A 4OWYA 5CO3A 1F3AA 4ECIA 1PKZA 4XRAA 1OKDA 3UBKA 1JFUA 1M9BA 4KA0A 3DIEA 5GAND 22GSA 4CY6A 4OO5A 3DYRA 2H72A 2LNTA 4G0LA 3ERFA 4Z2UA 2HZFA 2IN3A 1X9SB 1GLQA 1ZZYA 2H73A 2LJKA 3KZQA 1Z6MA 3CSJA 4WR5A 5LD0A 3O3TA 2VM1A 1ZL9A 1SK1A 2IIYA 3F8UA 1ZYNA 2N5BA 3HVVA 3TB2A 1MD3A 4MLYA 1MDJA 3C73A 3F63A 1Q98A 2KUCA 3HVNA 2EC4A 3W6GA 3L9VA 4Q5RA 4O5RA 2QGVA 2I4AA 1V58A 3LWAA 2HT9A 3KTBA 3GMFA 3FKFA 3BCIA 1JLVA 2TIRA 4JEDA 3N9JA 2GZPA 2MZCA 2RM6A 2GZZA 2F9SA 4LA1A 2REMA 2H6YA 4MABA 2OACA 4WF4A 3FR3A 1CQGA 1LJRA 2DJKA 1YEWC 1Y1UA 4EDYA 4L5LA 2EFDA 1IYIA 4NMUA 2ZUPA 5ECLB 5HFKA 5CYYA 5KOXA 4I2UA 3GX0A 3EURA 4HOJA 1G7EA 11GSA 2YZUA 3NZNA 3ZVJA 5B8BA 3ZL5A 2VL2C 2JSZA 3CMIA 3CQFA 1OYJA 2PVOC 2LRNA 4BIKA 2H75A 1GH2A 4ZXGA 4IQAA 4ZL9A 1PGTA 5B7CA 2YCDA 4FIWA 5CNWA 2WW2A 2FUG2 3EMXA 4W66A 3C1SA 4K7IA 2IPAA 3TRPA 2VCXA 2L59A 1QQ2A 2LJAA 3UOMA 1GTUA 1AW9A 1J9BA 2EIQA 2VKZG 3L4NA 4FYBA 1SKWB 1F37A 5F07A 2A4VA 2OT3A 2A4HA 4MNNA 3EMPA 1B48A 1ZYPA 2YJHA 4X43A 3NOFA 1YF1A 4K2DA 5D73A 4YQVA 1CQHA 1GP1A 2QA1A 5J9BA 2WZSA 2YWIA 3LW9A 2XC2A 4EKZA 2I81A 1SK2A 2IJYA 4MF7A 3I43A 2R4VA 1PX6A 4ML1A 2DKHA 4J56E 2A2RA 2PGTA
chains in the Genus database with same CATH topology
1AQXA 1TK0B 2EIRA 5A4VA 2B1LA 2DKIA 2L5OA 2HI7A 5J41A 2IFQA 2GGTA 2GS3A 3VURA 3IC4A 3GTUB 3H1NA 4K7OA 4G01A 4KCAA 4GSTA 3PGTA 4IP6A 1MEKA 5A5KA 3M9JA 3HA9A 2C8UA 1GUMA 4GF0A 4G0KA 2R0CA 5H5RA 3LG6A 3M3MA 1SYXA 1O8WA 3CBUA 2GT5A 4K2XA 1B9YC 2BMXA 5ID2A 1GTAA 3S9FA 5ABRA 1Z3EA 1OE8A 1GSQA 3KTLA 1U3AA 4PNGA 3UAPA 5LNKe 2I9HA 5ELAA 1X0RA 3ME7A 1THXA 4D73A 2H1AA 4O5UA 3N5OA 2VOCA 1BJXA 1GTBA 2JL4A 4HEA2 3WT2A 3M0FA 2M46A 4O92A 1QFNA 1Q4JA 3KGKA 4NHWA 1M2BA 2C1YA 3ZFLA 5J4VA 2VLTA 1O8XA 3M1GA 5C00A 4A5PA 5CRWA 2MMAA 1U6TA 1OC3A 2OE1A 1TRWA 3FEUA 1KEBA 3HDCA 3LEFA 1BF5A 4AGSA 3EWLA 1A2LA 1EEJA 4V2NA 2GSTA 4KW6A 5ECSA 2CX4A 5GAPD 4FH8A 4V1Ag 2YV9A 4GCIA 3GHAA 3VI5A 4IJIA 1OE7A 4KUNA 1HYUA 1Z7RA 5DAKB 3DXBA 2P5QA 1WRYA 2XBIA 1GSSA 2JADA 17GSA 1BQ7A 2NDOA 4N11A 4K0GA 1GULA 4F82A 5F0GA 3HD5A 2R6KA 3KM6A 3IOSA 1ERTA 2EFCA 2EIOA 1FB0A 4XS4B 2H76A 1K0OA 5KOWA 5KN2A 1GNEA 5EPFA 4NV2A 2WZ9A 4MZCA 4F2IA 4XHMA 2C3TA 5A34A 1ON4A 2VCVA 4MZWA 5D9TA 3L9UA 1GSUA 5HR3A 4X4JA 1IYHA 2KP1A 1NHOA 2AHEA 3KP8A 2GQMA 1TKDB 1NM3A 2DJ3A 3U5RE 3IC8A 4LL4B 1PN0A 4GTUA 6GSUA 1F3BA 2YWMA 4TKYA 4ECJA 6GSTA 1I9DA 3WD6A 3UMAA 3TDGA 3F3RA 3GRXA 2DJ1A 5IOWA 3UVHA 3UJ1A 2WDUA 3P7XA 2WGRA 1NSWA 1ACVA 2E2MA 4K8MA 1DE2A 14GSA 2MMOA 1EV4A 3FY7A 4V2LA 4KAEA 5JWQB 3VPTA 3ZREA 1ERVA 5ECNB 2JZTA 1A2MA 5G30A 5GSTA 5DJMA 4JU5A 4IELA 2HSMA 2BJXA 2C0GA 5B6MA 3TKSE 1OKTA 4O32A 2O7KA 2K9FA 4HUAA 4BVXA 3H79A 2C0DA 4I8BA 1R7HA 4MZBA 6GSWA 3ERWA 3QAGA 2VO4A 4DSRA 3IA1A 5G5FA 2HZEA 1G7OA 1U3IA 2HQTA 1RQMA 1K0CA 4XCSA 2H71A 5E59A 3FMWA 1A8LA 4TOPA 4Z2RA 2X8GA 1BYEA 4QL7A 2H1LA 2H0GA 3O6TA 5ECHB 5EY6A 3ZZXA 3HVSA 1B4QA 4AKHA 3LSZA 1R5AA 3D0ZA 4TXOB 2F8AA 5JCWA 4DVCA 2GQKA 6GSVA 5ECQB 2H8LA 1K3LA 4BL7A 4OCEA 1V9WA 4WBJA 1XOAA 3VFIA 4KGIA 1FB6A 4F0CA 3CYNA 2JSYA 4KDUA 2YWNA 3TRQA 4X0XA 3UARA 2DIZA 5IMFA 3F3QA 1XOBA 3A2VA 3VWVA 4LMWA 2FA8A 4G19A 4I6XA 2FCHA 2VL3A 3WGDA 4LL1B 2WB9A 3H8QA 3UVTA 1YKAA 3AY8A 5ECIB 3IE3A 3ZLPA 3ZITA 4OCFA 4O7HA 4USSA 2C0EA 5J4YA 2M80A 1U88A 5IMAA 5HR2A 1S3DA 4HQZA 1T3BA 4LLRA 1AQVA 3FZ4A 3PH9A 5AN1A 1ZMAA 2K8VA 2H19A 1T00A 4G9HA 2VIMA 5G2ZA 1AQWA 4Q5NA 2XHFA 5JWOB 5JCUA 2B7JA 5ECPB 2HYXA 5H5SA 4PXOA 5G31A 3QD9A 5A5HA 1WE0A 3P2AA 1FW1A 3GKMA 3Q6OA 4P3YB 1JZWA 5HFGA 2H66A 2YOIA 5BMUB 4JR6A 2JACA 4L8EA 2LNSA 4GXZA 3KIJA 4WBRD 2GDRA 5F8BA 2CAQA 3ED3A 2VM2A 3IRAA 4RI7A 1ZOFA 4BA7A 2OE3A 2F3MA 2HRFA 4L5OA 5H5QA 4YH2A 3DMLA 4IHUA 2VLUA 2X64A 1FVJA 4PQHA 3GL5A 1TW9A 2FD3A 4F9ZA 4NXIA 3P90A 1TTZA 1I5GA 2KP2A 5DVBA 1R5PA 2CT6A 1YKCA 2LKUA 3PINA 20GSA 3QCPA 4MA9A 4TN8A 5LCZA 1OAZA 2AV4A 5DCGA 5IPHA 3GX8A 4EVMA 5D93A 4HQSA 3ERGA 1YEPA 1SVLA 2OADA 1A2JA 4WEYA 2P5RA 3EU3A 2PERA 4O5QA 1PL1A 4IW9A 1EZKA 4F03A 4WETA 1M2DA 1WMJA 2IWTA 2LEGA 2D2ZA 3D4TA 4OFTA 4HJ2A 10GSA 4QMKA 2CVDA 2AUVA 2K8SA 1XW9A 2MBSA 2VCWA 3GH9A 2X8HA 3F0IA 1EP7A 2YV7A 1VF2A 1K3OA 1F6MC 1ZCPA 2H6XA 2CAIA 1XVQA 2N5AA 3A2XA 5HR1A 4IQ1A 1XWCA 1TU8A 2TRCP 3DVWA 1KTEA 2H30A 2OBIA 1WJKA 3ZTLA 3GURA 2OKAA 1K0DA 2V6OA 4ZBAA 1X9MB 4BVYB 1AIUA 2LQQA 1QMVA 2VL2A 1ST9A 5A1NB 1MDKA 2HSNB 2EFHA 2G0FA 4MK3A 4TR3A 4YKGA 4HZ2A 1X5DA 2NTOA 1A0RP 1TU7A 4TR1B 3FZ9A 3DWVA 4HU7A 3LGCA 2XBQA 3LFLA 3H93A 3F4TA 1BG1A 1SKSB 5J47A 1HNBA 2FWEA 2DMLA 4MJEA 3I6AA 2WJUA 4K5RA 3IK7A 1ILOA 1KNGA 4IJ3A 3OR5A 1Z9HA 5CRHA 1GSDA 2P31A 3TKQA 4IGJA 2LSTA 1SENA 2NPBA 5AIXA 3RHCA 1O6JA 4TR0A 3P8WA 4BVYA 19GSA 3CSIA 2X8CA 2HSHA 1TRUA 5A1NA 1TRSA 1UC7A 3TJFA 4TXVA 5CAXA 3QOUA 2OBKA 3I9V2 4RQXA 1U87A 3QR6A 4EUYA 1WP0A 1WWJA 3FZ5A 2AYTA 4TR1A 1K0AA 4POLA 5HR0A 4IVFA 4ZB9A 2CZ2A 5ECMB 9GSSA 2ZNMA 2HRKB 2GTUA 4PX1A 3E3EA 3ZFBA 18GSA 1ZYQB 1PRXA 5CP1A 2M72A 1GTIA 1K0MA 2B1KA 1TK8B 2Z9SA 5KN0A 2H6ZA 3M8NA 3Q19A 1Z6NA 1M9AA 3BBYA 1J08A 2O5VA 3GKXA 4J2FA 1BAYA 4PNFA 1OVNA 4AKGA 1NHYA 3LORA 1T7PB 2UV8G 4AF2A 4MCUA 3CTGA 4E8EA 3APOA 3GTUA 2O85A 3VWXA 4MPGA 2DJJA 3KH9A 3EU4A 4N0VA 4KX4A 3HYPA 4ZIJA 5DJLA 3QFBC 2C4JA 4GSNA 4JBBA 3FHKA 4K5SA 3M9KA 6GSYA 5ENUA 2MMZA 4POKA 4JE1A 2CVKA 3K8NA 3HHVA 5IMCA 1TOFA 4WR4A 1JZDA 3KJYA 1JLWA 1Y25A 2C0FA 3IHQA 2LJRA 5ECRB 3HZ4A 4ML6A 3UEMA 4IS0A 4Z7XA 4QL9A 1FG4A 3EC3A 2DJ2A 3L78A 5J5NA 2H0IA 3FR9A 3TKSC 3R2QA 2NBSA 1UA5A 2FLSA 3EPTA 2B3SA 1N8JA 3G7YA 4K9ZA 1G6YA 5G5EA 2ON5A 2K18A 1TDIA 1SVOA 1THOA 1TXUA 4JZQA 4K6XA 4EE0A 1PA3A 4OFNA 4OMVA 1Z5YE 3C8EA 1R4WA 1XPVA 4YAVA 3UL3A 1ZYEA 1WPIA 1YVLA 4ISDA 2JZRA 3MIXA 2LS5A 2VAFA 1MD4A 3VI7A 1VF4A 4TR4A 3G9BA 2PMTA 4MJCA 1EOGA 2EFEA 2GSSA 2LQOA 4WKWA 1HNAA 1N25A 4CHSA 4XTSA 2I1UA 4G10A 3ZMKA 2CX3A 2RUEA 5J9CA 2VLVA 3TCOA 3LXZA 3TJKA 1OC9B 3FZAA 4WF5A 5KN1A 4KB3A 2MYGA 3KMOA 2L5LA 5DAKA 4MJAA 3BOAA 4CY8A 1R26A 2LTKA 5IMDA 1SJIA 2B7KA 4EXJA 3GYKA 3VWWA 1YF0A 1X5CA 4FO5A 1H4OA 4BWQA 1EWXA 2H0HA 2XPEA 5DDLA 4L0UA 4MDCA 4AKXB 2GT6A 1TK5B 4BWSA 4XS4A 2TRXA 4Z2TA 3US3A 3IHGA 2B5XA 2LRTA 3DVXA 4OD7A 2IL3A 6GSXA 4GQCA 3FW2A 3GV1A 3Q18A 4AI6A 3GN3A 2V41A 4I2TA 3C7MA 1XXUA 3APQA 3ZMLA 3MWHA 3VLNA 3GUSA 3J7Yk 2DSAA 2DLXA 2LUSA 4G0IA 1XWBA 5IOXA 3LQ7A 4YQUA 3EVIA 3A3TA 2YNXA 3C1RA 2ZCTA 2GZYA 2FA4A 1J0FA 2PVQA 4QQ7A 4DSSB 3MNGA 1K3YA 1SK0A 4ULXA 1TJDA 1B4PA 1YQ1A 4TVEA 4EF0A 2E7PA 3IV4A 3QPMA 1JHBA 4N0ZA 4MMMA 4XS6A 1A8YA 3KP9A 1FAAA 2PUKC 3LXTA 1YDKA 1UVZA 2R5GA 1XCCA 5AISA 4E68A 2YN1A 4NAXA 4CW9A 3RDWA 3E0UA 1ERWA 1PSQA 2L57A 4ZB8A 4MP4A 3Q74A 1PKWA 4I97A 5IPGA 5BRTA 3GSSA 2C3NA 3KD0A 4IBPA 2VCQA 2AB6A 3JCML 3HXSA 2ALBA 3QDNA 2CVBA 4HS1A 1XBSA 3ME8A 2X99A 4IKHA 4YQMA 5J4UA 2PBJA 4BPYA 3MYDA 1GSFA 1XWKA 2FGXA 3DEXA 4AJ6A 5INYA 1V40A 2V32A 1AUCA 1VGLA 2B5YA 4HI7A 2P0GA 1DUGA 4Q5QA 1NW2A 2GLRA 1O73A 4MJBA 4OO4A 4TXOA 2H1BA 5D9WA 4N3ZA 1YEXA 1TRVA 1M7TA 3RBTA 4HDEA 2A2SA 1ZGNA 2UZ8A 4MPFA 2V6KA 5ELGA 1SJ6A 2WULA 2AJQB 3GFKA 2I3YA 1O81A 3GKNA 4NHZA 5FHIA 2IMIA 3PPUA 1EV9A 4LMVA 4K0NA 1GNWA 1QK8A 2E0QA 1VRSD 3F4RA 3IR4A 3GL3A 4PUAA 2ES7A 4ZBBA 3F9UA 1DSBA 1EOHA 2L6DA 1XW5A 1YJ6A 1A0FA 4DSQA 2PWJA 1RW1A 1WIKA 1GUKA 3ZRDA 1FO5A 3HKRA 1FOVA 1QUWA 2VCZA 4EC0A 2NVLA 2VD0A 2WFCA 1EEMA 2OA7A 3D5JA 4G2EA 1SKRB 2E2GA 5CREA 4ZB7A 1V2AA 5D96A 1M2AA 3VPQA 3KEBA 3G7IA 4PQIA 1EP8A 5B8AA 2L4QA 2A2PA 4HU9A 3ZYWA 2X4AA 4KSMA 1MTCA 2K6VA 3C71A 3DKSA 5DQSA 1XFLA 2YJ7A 3FR6A 4PGTA 1SVMA 2WS2A 1DE1A 5BMUA 1HQOA 1PQNA 1V57A 4XS1A 2C3QA 4POBA 3D21A 1ERUA 5JCGA 4ACSA 2F8FA 2FWGA 4K1FA 5GSSA 2FWHA 2KLXA 3IK9A 1X5EA 1JZOA 1VF1A 4WXTA 3BCKA 4YAPA 2PN8A 5JWRB 5F05A 4I5QA 4ID0A 3KMNA 2MBTA 4IN0A 1GSEA 2H1GA 3SBCA 3ZIJA 2HE3A 2CQ9A 1GL8A 1XZOA 4FYUA 5AGYA 1JZRA 2YWOA 3KH7A 4NPBA 3DD3A 2GQLA 1N2AA 1SL1B 2L6CA 8GSSA 4JR4A 3IBHA 5DALB 1T4ZA 2HFDA 2OJLA 2VD1A 2IFQB 2GSQA 3GNJA 3FK8A 2IMFA 3CXGA 5EL8A 1YZXA 1PMTA 3TOTA 1FVKA 3HY2A 4ZL7A 2RM5A 3J7Yb 2B6MA 5COHA 2MMNA 3KXOA 2KOKA 3TU3B 1URMA 3ZVJD 3A2WA 1XIYA 2R0GA 1O85A 2H70A 1GUHA 5ID2B 4ZILA 3EE2A 3NIVA 3GKKA 4E8HA 3HZ8A 2VUPA 1HD2A 1X9WB 3TOUA 3RPNA 2VL9A 3RPPA 2DBCA 4HZ4A 2DIYA 4D73B 5CRGA 2QSIA 3V1WA 3CTFA 1BX9A 3D6IA 3EYTA 3QFAC 3D22A 2HSNA 4ICYA 3APSA 4KDXA 4J57E 6GSSA 5DALA 3TKPA 2FHEA 4DEJA 5KEJA 4KH7A 4KDYA 4JRRA 3O76A 7GSSA 4KCEA 1SJZA 3W8SA 5D9VA 4H86A 1Z7PA 3A5IA 3R3EA 5EVOA 5CRDA 2J23A 2KHPA 3MAKA 2N5FA 2F51A 2JU5A 4KF9A 1B9XC 5G1LA 3I69A 1SL2B 1B8XA 3FYGA 1XWAA 5ECKB 3DRNA 4MF6A 2DJ0A 2JZSA 1M99A 2HRNA 5E4WA 13GSA 3TRXA 5J40A 4V2MA 2HSYA 4RI6A 2J9HA 4GDFA 4ZL8A 3BJ5A 1T8EB 1C72A 1E6BA 1PD21 4ZB6A 5HQPA 2FY6A 3CRTA 3TKRA 1GRXA 1VF3A 3HJPA 5FT3A 1F2EA 2G2QA 3ZIVA 1SL0B 2HRAA 3GH6A 2HRKA 3HJOA 1PL2A 2YANA 5D8IA 1G6WA 2V2GA 5HFIA 5D9XA 3QAWA 2HNLA 3RAZA 1XW6A 2YPMA 4GRFA 5L71A 3F6FA 2R37A 1ML6A 4NWYA 2ON7A 3L0HA 5A34B 2CV4A 1UN2A 1K0BA 2BTOT 3VWUA 5IIZA 5B6NA 3IDVA 3UIWA 3WYWA 3CRUA 3A5WA 3EINA 4GSSA 1E2YA 2YZHA 1KBNA 2QC7A 4RUVA 1BEDA 1WOUA 1RK4A 1AXDA 3MSZA 2X49A 3BD2A 2VCTA 3TKSA 2LV3A 2IMDA 4KE3A 4ECBA 1MDIA 1GSYA 2LRCA 3UBLA 1A24A 2R2JA 4AKIA 1W4VA 5FWGA 3TJBA 3CSHA 3PR8A 4EL1A 4POMA 1FOHA 1AAZA 3TJGA 4MF5A 3L9SA 4AJ7A 3G7JA 2RIIA 4GQFA 5IM9A 3GSTA 1EGOA 1SU9A 2PPTA 3GA4A 4FQUA 4KSOA 2B5EA 2HSMB 4PQ1A 3E9JB 3H4KA 2R3XA 4XRDA 1G0TA 4Q5FA 1PN9A 5G1KA 4BVXB 3QAVA 3SWLA 4PUFC 4HJMA 2HLSA 4OFMA 3VK9A 2AAWA 4X1UA 2GVPA 2HZEB 4EDZA 3RHBA 1DBYA 4FYCA 2RLIA 1LBKA 4EIQA 3TGZA 4PTSA 3TJJA 2OE0A 3IAM2 2V1MA 4AJ8A 1S3CA 3IAS2 1GLPA 1PX7A 1F9MA 2H1DA 2FNOA 2GSRA 1SD9A 5A4WA 2YP6A 2O89A 4EO3A 1GWCA 2IMKA 3U6VA 2WCIA 3QMXA 3WT1A 1AC1A 2WRTA 5ECOB 1SYRA 4BL7B 1OC9A 4F0BA 1M0UA 4YKFA 2XPDA 2QKEA 5DCHA 3W8JA 4GWRA 3HVXA 3IXRA 4ZBDA 1H75A 5IMVA 1LU4A 2CA8A 3CWGA 2QA2A 5KN3A 2CZ3A 5DQYA 3HCZA 16GSA 3ISOA 2FWFA 1BG5A 4TW5A 1TXXA 1FHEA 1EGRA 5C04A 3GIXA 1QXHA 4K7NA 1Y6EA 3LYPA 3LYKA 2L4CA 1O7UA 4CDOA 4PURA 5IQYA 4GLTA 2C80A 5J3RA 3LJRA 3DGQA 1W89A 5DBQA 2DC5A 4KNDA 3D4MA 2O8VB 1A23A 5IMZA 3F4SA 12GSA 1OC8A 5GZZB 4ECCA 4RQRA 1XVWA 2H74A 1XWGA 4V1Ap 3WGEA 1ABAA 5A4UA 4XIHA 3MDKA 5A5HB 1USBA 4DSSA 3HMJG 3TUEA 4NV5A 5AIVA 1YY7A 4MH2A 1TP9A 3IPZA 4IP1A 1V98A 5IO0A 2R0PA 3F6DA 3FRCA 2O87A 1T4YA 4ILFA 1K0NA 2HXKA 4N10A 4MH3A 2IMEA 1T1VA 4EIPA 5IO2A 2H01A 4TRXA 2DMMA 1TI3A 5F06A 1S3AA 3HJMA 2PU9C 1HNCA 3WGXA 4L0WA 3KCMA 1QGVA 1TI1A 1SD8A 2RUFA 4N30A 4OWYA 5CO3A 1F3AA 4ECIA 1PKZA 4XRAA 1OKDA 3UBKA 1JFUA 1M9BA 4KA0A 3DIEA 5GAND 22GSA 4CY6A 4OO5A 3DYRA 2H72A 2LNTA 4G0LA 3ERFA 4Z2UA 2HZFA 2IN3A 1X9SB 1GLQA 1ZZYA 2H73A 2LJKA 3KZQA 1Z6MA 3CSJA 4WR5A 5LD0A 3O3TA 2VM1A 1ZL9A 1SK1A 2IIYA 1ZYNA 3F8UA 2N5BA 3HVVA 3TB2A 1MD3A 4MLYA 1MDJA 3C73A 3F63A 1Q98A 2KUCA 2EC4A 3W6GA 3L9VA 4Q5RA 4O5RA 2QGVA 2I4AA 1V58A 3LWAA 2HT9A 3KTBA 3GMFA 3FKFA 3BCIA 1JLVA 2TIRA 4JEDA 3N9JA 2GZPA 2MZCA 2RM6A 2GZZA 2F9SA 4LA1A 2REMA 2H6YA 4MABA 2OACA 4WF4A 3FR3A 1CQGA 1LJRA 2DJKA 1Y1UA 4EDYA 4L5LA 2EFDA 1IYIA 4NMUA 2ZUPA 5ECLB 5HFKA 5CYYA 5KOXA 4I2UA 3GX0A 3EURA 4HOJA 1G7EA 11GSA 2YZUA 3NZNA 3ZVJA 5B8BA 3ZL5A 2VL2C 2JSZA 3CMIA 1OYJA 2PVOC 2LRNA 2H75A 1GH2A 4ZXGA 4IQAA 4ZL9A 1PGTA 5B7CA 2YCDA 4FIWA 5CNWA 2FUG2 3EMXA 4W66A 3C1SA 4K7IA 2IPAA 3TRPA 2VCXA 2L59A 1QQ2A 2LJAA 3UOMA 1GTUA 1AW9A 1J9BA 2EIQA 2VKZG 3L4NA 4FYBA 1SKWB 1F37A 5F07A 2A4VA 2OT3A 2A4HA 4MNNA 3EMPA 1B48A 1ZYPA 2YJHA 4X43A 3NOFA 1YF1A 4K2DA 5D73A 4YQVA 1CQHA 1GP1A 2QA1A 5J9BA 2YWIA 3LW9A 2XC2A 4EKZA 2I81A 1SK2A 2IJYA 4MF7A 3I43A 2R4VA 1PX6A 4ML1A 2DKHA 4J56E 2A2RA 2PGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQX A;  1TK0 B;  2EIR A;  5A4V A;  2B1L A;  2L5O A;  2HI7 A;  5J41 A;  2IFQ A;  2GGT A;  2GS3 A;  3VUR A;  3IC4 A;  3GTU B;  3H1N A;  4K7O A;  4KCA A;  4GST A;  3PGT A;  4IP6 A;  1MEK A;  5A5K A;  3M9J A;  3HA9 A;  2C8U A;  1GUM A;  4GF0 A;  4G0K A;  5H5R A;  3LG6 A;  3M3M A;  1SYX A;  1O8W A;  3CBU A;  2GT5 A;  1B9Y C;  2BMX A;  5ID2 A;  1GTA A;  3S9F A;  5ABR A;  1Z3E A;  1OE8 A;  1GSQ A;  3KTL A;  1U3A A;  4PNG A;  3UAP A;  5LNK e;  2I9H A;  5ELA A;  1X0R A;  3ME7 A;  1THX A;  4D73 A;  2H1A A;  3N5O A;  2VOC A;  1BJX A;  1GTB A;  2JL4 A;  4HEA 2;  3WT2 A;  3M0F A;  2M46 A;  4O92 A;  1QFN A;  1Q4J A;  3KGK A;  4NHW A;  1M2B A;  2C1Y A;  3ZFL A;  2VLT A;  1O8X A;  3M1G A;  5C00 A;  5CRW A;  2MMA A;  1U6T A;  1OC3 A;  2OE1 A;  1TRW A;  3FEU A;  1KEB A;  3HDC A;  3LEF A;  4AGS A;  3EWL A;  1A2L A;  1EEJ A;  4V2N A;  2GST A;  4KW6 A;  5ECS A;  2CX4 A;  5GAP D;  4FH8 A;  4V1A g;  2YV9 A;  4GCI A;  3GHA A;  3VI5 A;  4IJI A;  1OE7 A;  4KUN A;  1HYU A;  1Z7R A;  5DAK B;  3DXB A;  2P5Q A;  1WRY A;  2XBI A;  1GSS A;  2JAD A;  17GS A;  1BQ7 A;  2NDO A;  4N11 A;  4K0G A;  1GUL A;  4F82 A;  5F0G A;  3HD5 A;  2R6K A;  3KM6 A;  3IOS A;  1ERT A;  2EIO A;  1FB0 A;  4XS4 B;  2H76 A;  1K0O A;  5KN2 A;  1GNE A;  5EPF A;  4NV2 A;  2WZ9 A;  4MZC A;  4F2I A;  4XHM A;  2C3T A;  1ON4 A;  2VCV A;  4MZW A;  5D9T A;  3L9U A;  1GSU A;  5HR3 A;  1IYH A;  2KP1 A;  1NHO A;  2AHE A;  3KP8 A;  2GQM A;  1TKD B;  1NM3 A;  2DJ3 A;  3U5R E;  3IC8 A;  4LL4 B;  4GTU A;  6GSU A;  1F3B A;  2YWM A;  4TKY A;  4ECJ A;  6GST A;  1I9D A;  3WD6 A;  3UMA A;  3TDG A;  3F3R A;  3GRX A;  2DJ1 A;  5IOW A;  3UVH A;  3UJ1 A;  2WDU A;  3P7X A;  2WGR A;  1NSW A;  1ACV A;  2E2M A;  4K8M A;  1DE2 A;  14GS A;  2MMO A;  1EV4 A;  3FY7 A;  4V2L A;  4KAE A;  5JWQ B;  3VPT A;  3ZRE A;  1ERV A;  5ECN B;  2JZT A;  1A2M A;  5G30 A;  5GST A;  5DJM A;  4JU5 A;  4IEL A;  2HSM A;  2BJX A;  2C0G A;  5B6M A;  3TKS E;  1OKT A;  4O32 A;  2O7K A;  2K9F A;  4HUA A;  4BVX A;  3H79 A;  2C0D A;  4I8B A;  1R7H A;  4MZB A;  6GSW A;  3ERW A;  3QAG A;  2VO4 A;  4DSR A;  3IA1 A;  5G5F A;  2HZE A;  1G7O A;  1U3I A;  2HQT A;  1RQM A;  1K0C A;  4XCS A;  2H71 A;  5E59 A;  1A8L A;  4TOP A;  2X8G A;  1BYE A;  4QL7 A;  2H0G A;  3O6T A;  5ECH B;  5EY6 A;  3ZZX A;  3HVS A;  1B4Q A;  3LSZ A;  1R5A A;  3D0Z A;  4TXO B;  2F8A A;  5JCW A;  4DVC A;  2GQK A;  6GSV A;  5ECQ B;  2H8L A;  1K3L A;  4BL7 A;  4OCE A;  1V9W A;  4WBJ A;  1XOA A;  3VFI A;  4KGI A;  1FB6 A;  4F0C A;  3CYN A;  2JSY A;  4KDU A;  2YWN A;  3TRQ A;  4X0X A;  3UAR A;  2DIZ A;  5IMF A;  3F3Q A;  1XOB A;  3A2V A;  3VWV A;  4LMW A;  2FA8 A;  4G19 A;  4I6X A;  2FCH A;  2VL3 A;  3WGD A;  4LL1 B;  2WB9 A;  3H8Q A;  3UVT A;  1YKA A;  3AY8 A;  5ECI B;  3IE3 A;  3ZLP A;  3ZIT A;  4OCF A;  4O7H A;  4USS A;  2C0E A;  2M80 A;  1U88 A;  5IMA A;  5HR2 A;  1S3D A;  4HQZ A;  1T3B A;  4LLR A;  1AQV A;  3FZ4 A;  3PH9 A;  5AN1 A;  1ZMA A;  2K8V A;  2H19 A;  1T00 A;  4G9H A;  2VIM A;  5G2Z A;  1AQW A;  4Q5N A;  2XHF A;  5JWO B;  5JCU A;  2B7J A;  5ECP B;  2HYX A;  5H5S A;  4PXO A;  5G31 A;  3QD9 A;  1WE0 A;  3P2A A;  1FW1 A;  3GKM A;  3Q6O A;  4P3Y B;  1JZW A;  5HFG A;  2H66 A;  2YOI A;  4JR6 A;  2JAC A;  4L8E A;  2LNS A;  4GXZ A;  3KIJ A;  4WBR D;  2GDR A;  5F8B A;  2CAQ A;  3ED3 A;  2VM2 A;  3IRA A;  4RI7 A;  1ZOF A;  4BA7 A;  2OE3 A;  2F3M A;  2HRF A;  4L5O A;  5H5Q A;  4YH2 A;  3DML A;  4IHU A;  2VLU A;  2X64 A;  1FVJ A;  4PQH A;  3GL5 A;  1TW9 A;  2FD3 A;  4F9Z A;  4NXI A;  3P90 A;  1TTZ A;  1I5G A;  2KP2 A;  5DVB A;  1R5P A;  2CT6 A;  1YKC A;  2LKU A;  3PIN A;  20GS A;  3QCP A;  4MA9 A;  4TN8 A;  5LCZ A;  1OAZ A;  2AV4 A;  5DCG A;  5IPH A;  3GX8 A;  4EVM A;  5D93 A;  4HQS A;  3ERG A;  1YEP A;  2OAD A;  1A2J A;  4WEY A;  2P5R A;  3EU3 A;  2PER A;  1PL1 A;  4IW9 A;  1EZK A;  4F03 A;  4WET A;  1M2D A;  1WMJ A;  2IWT A;  2LEG A;  2D2Z A;  3D4T A;  4OFT A;  4HJ2 A;  10GS A;  2CVD A;  2AUV A;  2K8S A;  1XW9 A;  2MBS A;  2VCW A;  3GH9 A;  2X8H A;  3F0I A;  1EP7 A;  2YV7 A;  1VF2 A;  1K3O A;  1F6M C;  1ZCP A;  2H6X A;  2CAI A;  1XVQ A;  2N5A A;  3A2X A;  5HR1 A;  4IQ1 A;  1XWC A;  1TU8 A;  2TRC P;  3DVW A;  1KTE A;  2H30 A;  2OBI A;  1WJK A;  3ZTL A;  3GUR A;  2OKA A;  1K0D A;  2V6O A;  4ZBA A;  1X9M B;  4BVY B;  1AIU A;  2LQQ A;  1QMV A;  2VL2 A;  1ST9 A;  1MDK A;  2HSN B;  2G0F A;  4MK3 A;  4TR3 A;  4HZ2 A;  1X5D A;  2NTO A;  1A0R P;  1TU7 A;  4TR1 B;  3FZ9 A;  3DWV A;  4HU7 A;  3LGC A;  2XBQ A;  3LFL A;  3H93 A;  3F4T A;  1SKS B;  1HNB A;  2FWE A;  2DML A;  4MJE A;  3I6A A;  2WJU A;  3IK7 A;  1ILO A;  1KNG A;  4IJ3 A;  3OR5 A;  1Z9H A;  5CRH A;  1GSD A;  2P31 A;  3TKQ A;  4IGJ A;  2LST A;  1SEN A;  2NPB A;  5AIX A;  3RHC A;  1O6J A;  4TR0 A;  3P8W A;  4BVY A;  19GS A;  3CSI A;  2X8C A;  2HSH A;  1TRU A;  1TRS A;  1UC7 A;  3TJF A;  4TXV A;  5CAX A;  3QOU A;  2OBK A;  3I9V 2;  4RQX A;  1U87 A;  3QR6 A;  4EUY A;  1WP0 A;  1WWJ A;  3FZ5 A;  2AYT A;  4TR1 A;  1K0A A;  4POL A;  5HR0 A;  4IVF A;  4ZB9 A;  2CZ2 A;  5ECM B;  9GSS A;  2ZNM A;  2HRK B;  2GTU A;  4PX1 A;  3E3E A;  3ZFB A;  18GS A;  1ZYQ B;  1PRX A;  5CP1 A;  2M72 A;  1GTI A;  1K0M A;  2B1K A;  1TK8 B;  2Z9S A;  5KN0 A;  2H6Z A;  3M8N A;  3Q19 A;  1Z6N A;  1M9A A;  3BBY A;  1J08 A;  3GKX A;  4J2F A;  1BAY A;  4PNF A;  1OVN A;  1NHY A;  3LOR A;  1T7P B;  4AF2 A;  4MCU A;  3CTG A;  4E8E A;  3APO A;  3GTU A;  2O85 A;  3VWX A;  4MPG A;  2DJJ A;  3KH9 A;  3EU4 A;  4N0V A;  4KX4 A;  3HYP A;  4ZIJ A;  5DJL A;  3QFB C;  2C4J A;  4GSN A;  4JBB A;  3FHK A;  3M9K A;  6GSY A;  5ENU A;  2MMZ A;  4POK A;  4JE1 A;  2CVK A;  3K8N A;  3HHV A;  5IMC A;  1TOF A;  4WR4 A;  1JZD A;  3KJY A;  1JLW A;  1Y25 A;  2C0F A;  3IHQ A;  2LJR A;  5ECR B;  3HZ4 A;  4ML6 A;  3UEM A;  4IS0 A;  4Z7X A;  4QL9 A;  1FG4 A;  3EC3 A;  2DJ2 A;  3L78 A;  5J5N A;  2H0I A;  3FR9 A;  3TKS C;  3R2Q A;  2NBS A;  1UA5 A;  2FLS A;  2B3S A;  1N8J A;  3G7Y A;  4K9Z A;  1G6Y A;  5G5E A;  2ON5 A;  2K18 A;  1TDI A;  1THO A;  4JZQ A;  4K6X A;  4EE0 A;  1PA3 A;  4OFN A;  4OMV A;  1Z5Y E;  3C8E A;  1R4W A;  1XPV A;  4YAV A;  3UL3 A;  1ZYE A;  1WPI A;  4ISD A;  2JZR A;  2LS5 A;  2VAF A;  1MD4 A;  3VI7 A;  1VF4 A;  4TR4 A;  3G9B A;  2PMT A;  4MJC A;  1EOG A;  2GSS A;  2LQO A;  4WKW A;  1HNA A;  4CHS A;  4XTS A;  2I1U A;  4G10 A;  3ZMK A;  2CX3 A;  2RUE A;  5J9C A;  2VLV A;  3TCO A;  3LXZ A;  3TJK A;  1OC9 B;  3FZA A;  4WF5 A;  5KN1 A;  4KB3 A;  2MYG A;  3KMO A;  2L5L A;  5DAK A;  4MJA A;  3BOA A;  1R26 A;  2LTK A;  5IMD A;  1SJI A;  2B7K A;  4EXJ A;  3GYK A;  3VWW A;  1YF0 A;  1X5C A;  4FO5 A;  1H4O A;  4BWQ A;  1EWX A;  2H0H A;  2XPE A;  5DDL A;  4L0U A;  4MDC A;  2GT6 A;  1TK5 B;  4BWS A;  4XS4 A;  2TRX A;  3US3 A;  2B5X A;  2LRT A;  3DVX A;  4OD7 A;  2IL3 A;  6GSX A;  4GQC A;  3FW2 A;  3GV1 A;  3Q18 A;  3GN3 A;  2V41 A;  4I2T A;  3C7M A;  1XXU A;  3APQ A;  3ZML A;  3MWH A;  3VLN A;  3GUS A;  3J7Y k;  2DSA A;  2DLX A;  2LUS A;  4G0I A;  1XWB A;  5IOX A;  3LQ7 A;  4YQU A;  3EVI A;  3A3T A;  2YNX A;  3C1R A;  2ZCT A;  2GZY A;  2FA4 A;  1J0F A;  2PVQ A;  4QQ7 A;  4DSS B;  3MNG A;  1K3Y A;  1SK0 A;  4ULX A;  1TJD A;  1B4P A;  1YQ1 A;  4TVE A;  4EF0 A;  2E7P A;  3IV4 A;  3QPM A;  1JHB A;  4N0Z A;  4MMM A;  4XS6 A;  1A8Y A;  3KP9 A;  1FAA A;  2PUK C;  3LXT A;  1YDK A;  1UVZ A;  2R5G A;  1XCC A;  5AIS A;  2YN1 A;  4NAX A;  4CW9 A;  3RDW A;  3E0U A;  1ERW A;  1PSQ A;  2L57 A;  4ZB8 A;  4MP4 A;  3Q74 A;  1PKW A;  4I97 A;  5IPG A;  3GSS A;  2C3N A;  3KD0 A;  4IBP A;  2VCQ A;  2AB6 A;  3JCM L;  3HXS A;  2ALB A;  3QDN A;  2CVB A;  4HS1 A;  1XBS A;  3ME8 A;  2X99 A;  4IKH A;  4YQM A;  5J4U A;  2PBJ A;  4BPY A;  1GSF A;  1XWK A;  2FGX A;  3DEX A;  4AJ6 A;  5INY A;  1V40 A;  2V32 A;  1AUC A;  1VGL A;  2B5Y A;  4HI7 A;  2P0G A;  1DUG A;  4Q5Q A;  1NW2 A;  2GLR A;  1O73 A;  4MJB A;  4OO4 A;  4TXO A;  2H1B A;  5D9W A;  1YEX A;  1TRV A;  1M7T A;  3RBT A;  4HDE A;  2A2S A;  1ZGN A;  2UZ8 A;  4MPF A;  2V6K A;  5ELG A;  1SJ6 A;  2WUL A;  2AJQ B;  3GFK A;  2I3Y A;  1O81 A;  3GKN A;  4NHZ A;  5FHI A;  2IMI A;  3PPU A;  1EV9 A;  4LMV A;  4K0N A;  1GNW A;  1QK8 A;  2E0Q A;  1VRS D;  3F4R A;  3IR4 A;  3GL3 A;  4PUA A;  2ES7 A;  4ZBB A;  3F9U A;  1DSB A;  1EOH A;  2L6D A;  1XW5 A;  1YJ6 A;  1A0F A;  4DSQ A;  2PWJ A;  1RW1 A;  1WIK A;  1GUK A;  3ZRD A;  1FO5 A;  3HKR A;  1FOV A;  1QUW A;  2VCZ A;  4EC0 A;  2NVL A;  2VD0 A;  2WFC A;  1EEM A;  2OA7 A;  3D5J A;  4G2E A;  1SKR B;  2E2G A;  5CRE A;  1V2A A;  5D96 A;  1M2A A;  3VPQ A;  3KEB A;  3G7I A;  4PQI A;  1EP8 A;  5B8A A;  2L4Q A;  4HU9 A;  3ZYW A;  4KSM A;  1MTC A;  2K6V A;  3C71 A;  3DKS A;  5DQS A;  1XFL A;  2YJ7 A;  3FR6 A;  4PGT A;  2WS2 A;  1DE1 A;  5BMU A;  1HQO A;  1PQN A;  1V57 A;  4XS1 A;  2C3Q A;  4POB A;  3D21 A;  1ERU A;  5JCG A;  4ACS A;  2F8F A;  2FWG A;  4K1F A;  5GSS A;  2FWH A;  2KLX A;  3IK9 A;  1X5E A;  1JZO A;  1VF1 A;  4WXT A;  3BCK A;  4YAP A;  2PN8 A;  5JWR B;  5F05 A;  4I5Q A;  4ID0 A;  3KMN A;  2MBT A;  4IN0 A;  1GSE A;  2H1G A;  3SBC A;  3ZIJ A;  2HE3 A;  2CQ9 A;  1GL8 A;  1XZO A;  4FYU A;  5AGY A;  1JZR A;  2YWO A;  3KH7 A;  4NPB A;  3DD3 A;  2GQL A;  1N2A A;  1SL1 B;  2L6C A;  8GSS A;  4JR4 A;  3IBH A;  5DAL B;  1T4Z A;  2HFD A;  2OJL A;  2VD1 A;  2IFQ B;  2GSQ A;  3GNJ A;  3FK8 A;  2IMF A;  3CXG A;  5EL8 A;  1YZX A;  1PMT A;  3TOT A;  1FVK A;  3HY2 A;  4ZL7 A;  2RM5 A;  3J7Y b;  2B6M A;  5COH A;  2MMN A;  3KXO A;  2KOK A;  1URM A;  3ZVJ D;  3A2W A;  1XIY A;  1O85 A;  2H70 A;  1GUH A;  5ID2 B;  4ZIL A;  3EE2 A;  3NIV A;  3GKK A;  4E8H A;  3HZ8 A;  2VUP A;  1HD2 A;  1X9W B;  3TOU A;  3RPN A;  2VL9 A;  3RPP A;  2DBC A;  4HZ4 A;  2DIY A;  4D73 B;  5CRG A;  2QSI A;  3V1W A;  3CTF A;  1BX9 A;  3D6I A;  3EYT A;  3QFA C;  3D22 A;  3APS A;  4KDX A;  4J57 E;  6GSS A;  5DAL A;  3TKP A;  2FHE A;  4DEJ A;  5KEJ A;  4KH7 A;  4KDY A;  4JRR A;  3O76 A;  7GSS A;  4KCE A;  1SJZ A;  3W8S A;  5D9V A;  4H86 A;  1Z7P A;  3R3E A;  5EVO A;  5CRD A;  2J23 A;  2KHP A;  3MAK A;  2N5F A;  2F51 A;  2JU5 A;  4KF9 A;  1B9X C;  5G1L A;  3I69 A;  1SL2 B;  1B8X A;  3FYG A;  1XWA A;  5ECK B;  3DRN A;  4MF6 A;  2DJ0 A;  2JZS A;  1M99 A;  2HRN A;  5E4W A;  13GS A;  3TRX A;  4V2M A;  2HSY A;  4RI6 A;  2J9H A;  4ZL8 A;  3BJ5 A;  1T8E B;  1C72 A;  1E6B A;  1PD2 1;  4ZB6 A;  5HQP A;  2FY6 A;  3CRT A;  3TKR A;  1GRX A;  1VF3 A;  3HJP A;  5FT3 A;  1F2E A;  2G2Q A;  3ZIV A;  1SL0 B;  2HRA A;  3GH6 A;  2HRK A;  3HJO A;  1PL2 A;  2YAN A;  5D8I A;  1G6W A;  2V2G A;  5HFI A;  5D9X A;  3QAW A;  2HNL A;  3RAZ A;  1XW6 A;  2YPM A;  4GRF A;  5L71 A;  3F6F A;  2R37 A;  1ML6 A;  4NWY A;  2ON7 A;  3L0H A;  2CV4 A;  1UN2 A;  1K0B A;  2BTO T;  3VWU A;  5IIZ A;  5B6N A;  3IDV A;  3UIW A;  3WYW A;  3CRU A;  3A5W A;  3EIN A;  4GSS A;  1E2Y A;  2YZH A;  1KBN A;  2QC7 A;  4RUV A;  1BED A;  1WOU A;  1RK4 A;  1AXD A;  3MSZ A;  3BD2 A;  2VCT A;  3TKS A;  2LV3 A;  2IMD A;  4KE3 A;  4ECB A;  1MDI A;  1GSY A;  2LRC A;  3UBL A;  1A24 A;  2R2J A;  1W4V A;  5FWG A;  3TJB A;  3CSH A;  3PR8 A;  4EL1 A;  4POM A;  1AAZ A;  3TJG A;  4MF5 A;  3L9S A;  4AJ7 A;  3G7J A;  2RII A;  4GQF A;  5IM9 A;  3GST A;  1EGO A;  1SU9 A;  2PPT A;  3GA4 A;  4FQU A;  4KSO A;  2B5E A;  2HSM B;  4PQ1 A;  3E9J B;  3H4K A;  2R3X A;  4XRD A;  1G0T A;  4Q5F A;  1PN9 A;  5G1K A;  4BVX B;  3QAV A;  3SWL A;  4PUF C;  4HJM A;  2HLS A;  4OFM A;  3VK9 A;  2AAW A;  4X1U A;  2GVP A;  2HZE B;  4EDZ A;  3RHB A;  1DBY A;  4FYC A;  2RLI A;  1LBK A;  3TGZ A;  4PTS A;  3TJJ A;  2OE0 A;  3IAM 2;  2V1M A;  4AJ8 A;  1S3C A;  3IAS 2;  1GLP A;  1PX7 A;  1F9M A;  2H1D A;  2FNO A;  2GSR A;  1SD9 A;  5A4W A;  2YP6 A;  2O89 A;  4EO3 A;  1GWC A;  2IMK A;  3U6V A;  2WCI A;  3QMX A;  3WT1 A;  1AC1 A;  2WRT A;  5ECO B;  1SYR A;  4BL7 B;  1OC9 A;  4F0B A;  1M0U A;  2XPD A;  2QKE A;  5DCH A;  3W8J A;  4GWR A;  3HVX A;  3IXR A;  4ZBD A;  1H75 A;  5IMV A;  1LU4 A;  2CA8 A;  5KN3 A;  2CZ3 A;  5DQY A;  3HCZ A;  16GS A;  3ISO A;  2FWF A;  1BG5 A;  4TW5 A;  1TXX A;  1FHE A;  1EGR A;  5C04 A;  3GIX A;  1QXH A;  4K7N A;  1Y6E A;  3LYP A;  3LYK A;  2L4C A;  1O7U A;  4CDO A;  4PUR A;  5IQY A;  4GLT A;  2C80 A;  5J3R A;  3LJR A;  3DGQ A;  1W89 A;  5DBQ A;  2DC5 A;  4KND A;  3D4M A;  2O8V B;  1A23 A;  5IMZ A;  3F4S A;  12GS A;  1OC8 A;  5GZZ B;  4ECC A;  4RQR A;  1XVW A;  2H74 A;  1XWG A;  4V1A p;  3WGE A;  1ABA A;  5A4U A;  4XIH A;  3MDK A;  1USB A;  4DSS A;  3TUE A;  4NV5 A;  5AIV A;  1YY7 A;  4MH2 A;  1TP9 A;  3IPZ A;  4IP1 A;  1V98 A;  5IO0 A;  3F6D A;  3FRC A;  2O87 A;  1T4Y A;  4ILF A;  1K0N A;  2HXK A;  4N10 A;  4MH3 A;  2IME A;  1T1V A;  5IO2 A;  2H01 A;  4TRX A;  2DMM A;  1TI3 A;  5F06 A;  1S3A A;  3HJM A;  2PU9 C;  1HNC A;  3WGX A;  4L0W A;  3KCM A;  1QGV A;  1TI1 A;  1SD8 A;  2RUF A;  4N30 A;  4OWY A;  5CO3 A;  1F3A A;  4ECI A;  1PKZ A;  4XRA A;  1OKD A;  3UBK A;  1JFU A;  1M9B A;  4KA0 A;  3DIE A;  5GAN D;  22GS A;  4OO5 A;  3DYR A;  2H72 A;  2LNT A;  4G0L A;  3ERF A;  2HZF A;  2IN3 A;  1X9S B;  1GLQ A;  1ZZY A;  2H73 A;  2LJK A;  3KZQ A;  1Z6M A;  3CSJ A;  4WR5 A;  5LD0 A;  3O3T A;  2VM1 A;  1ZL9 A;  1SK1 A;  2IIY A;  3F8U A;  2N5B A;  3HVV A;  3TB2 A;  1MD3 A;  4MLY A;  1MDJ A;  3C73 A;  3F63 A;  1Q98 A;  2KUC A;  2EC4 A;  3W6G A;  3L9V A;  4Q5R A;  4O5R A;  2QGV A;  2I4A A;  1V58 A;  3LWA A;  2HT9 A;  3KTB A;  3GMF A;  3FKF A;  3BCI A;  1JLV A;  2TIR A;  4JED A;  3N9J A;  2GZP A;  2MZC A;  2RM6 A;  2GZZ A;  2F9S A;  4LA1 A;  2REM A;  2H6Y A;  4MAB A;  2OAC A;  4WF4 A;  3FR3 A;  1CQG A;  1LJR A;  2DJK A;  4EDY A;  4L5L A;  4NMU A;  1IYI A;  2ZUP A;  5ECL B;  5HFK A;  5CYY A;  4I2U A;  3GX0 A;  3EUR A;  4HOJ A;  1G7E A;  11GS A;  2YZU A;  3NZN A;  3ZVJ A;  5B8B A;  3ZL5 A;  2VL2 C;  2JSZ A;  3CMI A;  1OYJ A;  2PVO C;  2LRN A;  2H75 A;  1GH2 A;  4ZXG A;  4IQA A;  4ZL9 A;  1PGT A;  5B7C A;  2YCD A;  4FIW A;  5CNW A;  2FUG 2;  3EMX A;  3C1S A;  4K7I A;  2IPA A;  3TRP A;  2VCX A;  2L59 A;  1QQ2 A;  2LJA A;  3UOM A;  1GTU A;  1AW9 A;  1J9B A;  2EIQ A;  3L4N A;  4FYB A;  1SKW B;  1F37 A;  5F07 A;  2A4V A;  3EMP A;  1B48 A;  2YJH A;  4X43 A;  3NOF A;  1YF1 A;  4K2D A;  5D73 A;  4YQV A;  1CQH A;  1GP1 A;  5J9B A;  2YWI A;  2XC2 A;  4EKZ A;  2I81 A;  1SK2 A;  2IJY A;  4MF7 A;  3I43 A;  2R4V A;  1PX6 A;  4ML1 A;  4J56 E;  2A2R A;  2PGT A; 
#chains in the Genus database with same CATH topology
 1AQX A;  1TK0 B;  2EIR A;  5A4V A;  2B1L A;  2DKI A;  2L5O A;  1M3J A;  2HI7 A;  5J41 A;  2IFQ A;  2GGT A;  2GS3 A;  3VUR A;  3IC4 A;  3GTU B;  3H1N A;  4K7O A;  4G01 A;  4KCA A;  4GST A;  3PGT A;  4IP6 A;  1MEK A;  5A5K A;  3M9J A;  3HA9 A;  2WVZ A;  2C8U A;  1GUM A;  4GF0 A;  4G0K A;  2R0C A;  5H5R A;  3LG6 A;  3M3M A;  1SYX A;  1O8W A;  3CBU A;  2GT5 A;  4K2X A;  1B9Y C;  2BMX A;  5ID2 A;  1GTA A;  3S9F A;  5ABR A;  1Z3E A;  1OE8 A;  1GSQ A;  3KTL A;  1U3A A;  4PNG A;  3UAP A;  5LNK e;  2I9H A;  5ELA A;  1X0R A;  3ME7 A;  1THX A;  4D73 A;  2H1A A;  4O5U A;  4PHZ C;  3N5O A;  2VOC A;  1BJX A;  1GTB A;  2JL4 A;  4HEA 2;  3WT2 A;  3M0F A;  2M46 A;  4O92 A;  1QFN A;  1Q4J A;  3KGK A;  4NHW A;  1M2B A;  2C1Y A;  3ZFL A;  5J4V A;  2VLT A;  1O8X A;  3M1G A;  5C00 A;  4A5P A;  5CRW A;  2MMA A;  1U6T A;  1OC3 A;  2OE1 A;  1TRW A;  3FEU A;  1KEB A;  3HDC A;  3LEF A;  1BF5 A;  4AGS A;  3EWL A;  1A2L A;  1EEJ A;  4V2N A;  2GST A;  4KW6 A;  5ECS A;  2CX4 A;  5GAP D;  4FH8 A;  4V1A g;  2YV9 A;  4GCI A;  3GHA A;  3VI5 A;  4IJI A;  1OE7 A;  4KUN A;  1HYU A;  1Z7R A;  5DAK B;  3DXB A;  2P5Q A;  1WRY A;  2XBI A;  1GSS A;  2JAD A;  17GS A;  1BQ7 A;  2NDO A;  4N11 A;  4K0G A;  1GUL A;  4F82 A;  5F0G A;  3HD5 A;  2R6K A;  3KM6 A;  3IOS A;  1ERT A;  2EFC A;  2EIO A;  1FB0 A;  4XS4 B;  2H76 A;  1K0O A;  5KOW A;  5KN2 A;  1GNE A;  5EPF A;  4NV2 A;  2WZ9 A;  4MZC A;  4F2I A;  4XHM A;  2C3T A;  5A34 A;  1ON4 A;  2VCV A;  4MZW A;  5D9T A;  3L9U A;  1GSU A;  5HR3 A;  4X4J A;  1IYH A;  2KP1 A;  1NHO A;  2AHE A;  3KP8 A;  2GQM A;  1TKD B;  1NM3 A;  2DJ3 A;  3U5R E;  3IC8 A;  4LL4 B;  1PN0 A;  4GTU A;  2WW1 A;  6GSU A;  1F3B A;  2YWM A;  4TKY A;  4ECJ A;  6GST A;  1I9D A;  3WD6 A;  3UMA A;  3TDG A;  3F3R A;  3GRX A;  2DJ1 A;  5IOW A;  3UVH A;  3UJ1 A;  2WDU A;  3P7X A;  2WGR A;  1NSW A;  1ACV A;  2E2M A;  4K8M A;  1DE2 A;  14GS A;  2MMO A;  1EV4 A;  3FY7 A;  4V2L A;  4KAE A;  5JWQ B;  3VPT A;  3ZRE A;  1ERV A;  5ECN B;  2JZT A;  1A2M A;  5G30 A;  5GST A;  5DJM A;  4JU5 A;  4IEL A;  2HSM A;  2BJX A;  4HSC X;  2C0G A;  5B6M A;  3TKS E;  1OKT A;  4O32 A;  2O7K A;  2K9F A;  4HUA A;  4BVX A;  3H79 A;  2C0D A;  4I8B A;  1R7H A;  4MZB A;  6GSW A;  3ERW A;  3QAG A;  2VO4 A;  4DSR A;  3IA1 A;  5G5F A;  2HZE A;  1G7O A;  1U3I A;  2HQT A;  1RQM A;  1K0C A;  4XCS A;  2H71 A;  5E59 A;  3FMW A;  1A8L A;  4TOP A;  4Z2R A;  2X8G A;  1BYE A;  4QL7 A;  2H1L A;  2H0G A;  3O6T A;  5ECH B;  5EY6 A;  3ZZX A;  3HVS A;  1B4Q A;  4AKH A;  3LSZ A;  1R5A A;  3D0Z A;  4TXO B;  2F8A A;  5JCW A;  4DVC A;  2GQK A;  6GSV A;  5ECQ B;  2H8L A;  1K3L A;  4BL7 A;  4OCE A;  1V9W A;  4WBJ A;  1XOA A;  3VFI A;  4KGI A;  1FB6 A;  4F0C A;  3CYN A;  2JSY A;  4KDU A;  2YWN A;  3TRQ A;  4X0X A;  3UAR A;  2DIZ A;  5IMF A;  3F3Q A;  1XOB A;  3A2V A;  3VWV A;  4LMW A;  2FA8 A;  4G19 A;  4I6X A;  2FCH A;  2VL3 A;  3WGD A;  4LL1 B;  2WB9 A;  3H8Q A;  3UVT A;  1YKA A;  3AY8 A;  5ECI B;  3IE3 A;  3ZLP A;  3ZIT A;  4OCF A;  4O7H A;  4USS A;  2C0E A;  5J4Y A;  2M80 A;  1U88 A;  5IMA A;  5HR2 A;  1S3D A;  4HQZ A;  1T3B A;  4LLR A;  1AQV A;  3FZ4 A;  3PH9 A;  5AN1 A;  1ZMA A;  2K8V A;  2H19 A;  1T00 A;  4G9H A;  2VIM A;  5G2Z A;  1AQW A;  4Q5N A;  2XHF A;  5JWO B;  5JCU A;  2B7J A;  5ECP B;  2HYX A;  5H5S A;  4PXO A;  5G31 A;  3QD9 A;  5A5H A;  1WE0 A;  3P2A A;  1FW1 A;  3GKM A;  3Q6O A;  4P3Y B;  1JZW A;  5HFG A;  2H66 A;  2YOI A;  5BMU B;  4JR6 A;  2JAC A;  4L8E A;  2LNS A;  4GXZ A;  3KIJ A;  4WBR D;  2GDR A;  5F8B A;  2CAQ A;  3ED3 A;  2VM2 A;  3IRA A;  4RI7 A;  1ZOF A;  4BA7 A;  2OE3 A;  2F3M A;  2HRF A;  4L5O A;  5H5Q A;  4YH2 A;  3DML A;  4IHU A;  2VLU A;  2X64 A;  1FVJ A;  4PQH A;  3GL5 A;  1TW9 A;  2FD3 A;  2WVY A;  4F9Z A;  4NXI A;  3P90 A;  1TTZ A;  1I5G A;  2KP2 A;  5DVB A;  1R5P A;  2CT6 A;  1YKC A;  2LKU A;  3PIN A;  20GS A;  3QCP A;  4MA9 A;  4TN8 A;  5LCZ A;  1OAZ A;  2AV4 A;  5DCG A;  5IPH A;  3GX8 A;  4EVM A;  5D93 A;  4HQS A;  3ERG A;  1YEP A;  1SVL A;  2OAD A;  1A2J A;  4WEY A;  2P5R A;  3EU3 A;  2PER A;  4O5Q A;  1PL1 A;  4IW9 A;  1EZK A;  4F03 A;  4WET A;  1M2D A;  1WMJ A;  2IWT A;  2LEG A;  2D2Z A;  3D4T A;  4OFT A;  4HJ2 A;  10GS A;  4QMK A;  2CVD A;  2AUV A;  2K8S A;  1XW9 A;  2MBS A;  2VCW A;  3GH9 A;  2X8H A;  3F0I A;  1EP7 A;  2YV7 A;  1VF2 A;  1K3O A;  1F6M C;  1ZCP A;  2H6X A;  2CAI A;  1XVQ A;  2N5A A;  3A2X A;  5HR1 A;  4IQ1 A;  1XWC A;  1TU8 A;  2TRC P;  3DVW A;  1KTE A;  2H30 A;  2OBI A;  1WJK A;  3ZTL A;  3GUR A;  2OKA A;  1K0D A;  2V6O A;  4ZBA A;  1X9M B;  4BVY B;  1AIU A;  2LQQ A;  1QMV A;  2VL2 A;  1ST9 A;  5A1N B;  1MDK A;  2HSN B;  2EFH A;  2G0F A;  4MK3 A;  4TR3 A;  4YKG A;  4HZ2 A;  1X5D A;  2NTO A;  1A0R P;  1TU7 A;  4TR1 B;  3FZ9 A;  3DWV A;  4HU7 A;  3LGC A;  2XBQ A;  3LFL A;  3H93 A;  3F4T A;  1BG1 A;  1SKS B;  5J47 A;  1HNB A;  2FWE A;  2DML A;  4MJE A;  3I6A A;  2WJU A;  4K5R A;  3IK7 A;  1ILO A;  1KNG A;  4IJ3 A;  3OR5 A;  1Z9H A;  5CRH A;  1GSD A;  2P31 A;  3TKQ A;  4IGJ A;  2WVX B;  2LST A;  1SEN A;  2NPB A;  5AIX A;  3RHC A;  1O6J A;  4TR0 A;  3P8W A;  4BVY A;  19GS A;  3CSI A;  2X8C A;  2HSH A;  1TRU A;  5A1N A;  1TRS A;  1UC7 A;  3TJF A;  4TXV A;  5CAX A;  3QOU A;  2OBK A;  3I9V 2;  4RQX A;  1U87 A;  3QR6 A;  4EUY A;  1WP0 A;  1WWJ A;  3FZ5 A;  2AYT A;  4TR1 A;  1K0A A;  4POL A;  5HR0 A;  4IVF A;  4ZB9 A;  2CZ2 A;  5ECM B;  9GSS A;  2ZNM A;  2HRK B;  2GTU A;  4PX1 A;  3E3E A;  3ZFB A;  18GS A;  1ZYQ B;  1PRX A;  5CP1 A;  2M72 A;  1GTI A;  1K0M A;  2B1K A;  1TK8 B;  4PI0 C;  2Z9S A;  5KN0 A;  2H6Z A;  3M8N A;  3Q19 A;  1Z6N A;  1M9A A;  3BBY A;  1J08 A;  2O5V A;  3GKX A;  4J2F A;  1BAY A;  4PNF A;  1OVN A;  4AKG A;  1NHY A;  3LOR A;  1T7P B;  2UV8 G;  4AF2 A;  4MCU A;  3CTG A;  4E8E A;  3APO A;  3GTU A;  2O85 A;  3VWX A;  4MPG A;  2DJJ A;  3KH9 A;  1S3R A;  3EU4 A;  4N0V A;  4KX4 A;  3HYP A;  4ZIJ A;  5DJL A;  1M3I A;  3QFB C;  2C4J A;  4GSN A;  4JBB A;  3FHK A;  4K5S A;  3M9K A;  6GSY A;  5ENU A;  2MMZ A;  4POK A;  4JE1 A;  2CVK A;  3K8N A;  3HHV A;  5IMC A;  1TOF A;  4WR4 A;  1JZD A;  3KJY A;  1JLW A;  1Y25 A;  2C0F A;  3IHQ A;  2LJR A;  5ECR B;  3HZ4 A;  4ML6 A;  3UEM A;  4IS0 A;  4Z7X A;  4QL9 A;  1FG4 A;  3EC3 A;  2DJ2 A;  3L78 A;  5J5N A;  2H0I A;  3FR9 A;  3TKS C;  3R2Q A;  2NBS A;  1UA5 A;  2FLS A;  3EPT A;  2B3S A;  1N8J A;  3G7Y A;  4K9Z A;  1G6Y A;  5G5E A;  2ON5 A;  2K18 A;  1TDI A;  1SVO A;  1THO A;  1TXU A;  4JZQ A;  4K6X A;  4EE0 A;  1PA3 A;  4OFN A;  4OMV A;  1Z5Y E;  3C8E A;  1R4W A;  1XPV A;  4YAV A;  1XG8 A;  3UL3 A;  1ZYE A;  1WPI A;  1YVL A;  4ISD A;  2JZR A;  3MIX A;  2LS5 A;  2VAF A;  1MD4 A;  3VI7 A;  1VF4 A;  4TR4 A;  3G9B A;  2PMT A;  4MJC A;  1EOG A;  2EFE A;  2GSS A;  2LQO A;  4WKW A;  1HNA A;  1N25 A;  4CHS A;  4XTS A;  2I1U A;  4G10 A;  3ZMK A;  2CX3 A;  2RUE A;  5J9C A;  2VLV A;  3TCO A;  3LXZ A;  3TJK A;  1OC9 B;  3FZA A;  4WF5 A;  5KN1 A;  4KB3 A;  2MYG A;  3KMO A;  2L5L A;  5DAK A;  4MJA A;  3BOA A;  4CY8 A;  1R26 A;  2LTK A;  5IMD A;  1SJI A;  2B7K A;  4EXJ A;  3GYK A;  3VWW A;  1YF0 A;  1X5C A;  4FO5 A;  1H4O A;  4BWQ A;  1EWX A;  2H0H A;  2XPE A;  5DDL A;  4L0U A;  4MDC A;  4AKX B;  2GT6 A;  1TK5 B;  4BWS A;  4XS4 A;  2TRX A;  4Z2T A;  3US3 A;  3IHG A;  2B5X A;  2LRT A;  3DVX A;  4OD7 A;  2IL3 A;  6GSX A;  4GQC A;  3FW2 A;  3GV1 A;  3Q18 A;  4AI6 A;  4FXY P;  2V41 A;  3GN3 A;  4I2T A;  3C7M A;  1XXU A;  3APQ A;  3ZML A;  3MWH A;  3VLN A;  3GUS A;  3J7Y k;  2DSA A;  2DLX A;  2LUS A;  4G0I A;  1XWB A;  3RFR C;  5IOX A;  3LQ7 A;  4YQU A;  3EVI A;  3A3T A;  2YNX A;  3C1R A;  2ZCT A;  2GZY A;  2FA4 A;  1J0F A;  2PVQ A;  4QQ7 A;  4DSS B;  3MNG A;  1K3Y A;  1SK0 A;  4ULX A;  1TJD A;  1B4P A;  1YQ1 A;  4TVE A;  4EF0 A;  2E7P A;  3IV4 A;  3QPM A;  1JHB A;  4N0Z A;  4MMM A;  4XS6 A;  1A8Y A;  3KP9 A;  1FAA A;  2PUK C;  3LXT A;  1YDK A;  1UVZ A;  2R5G A;  1XCC A;  5AIS A;  4E68 A;  2YN1 A;  4NAX A;  4CW9 A;  3RDW A;  3E0U A;  1ERW A;  1PSQ A;  2L57 A;  4ZB8 A;  4MP4 A;  3Q74 A;  1PKW A;  4I97 A;  5IPG A;  1PFO A;  3RGB C;  5BRT A;  3GSS A;  2C3N A;  3KD0 A;  4IBP A;  2VCQ A;  2AB6 A;  3JCM L;  3HXS A;  2ALB A;  3QDN A;  2CVB A;  4HS1 A;  1XBS A;  3ME8 A;  2X99 A;  4IKH A;  4YQM A;  5J4U A;  2PBJ A;  4BPY A;  3MYD A;  1GSF A;  1XWK A;  2FGX A;  3DEX A;  4AJ6 A;  5INY A;  1V40 A;  2V32 A;  1AUC A;  1VGL A;  2B5Y A;  4HI7 A;  2P0G A;  1DUG A;  4Q5Q A;  1NW2 A;  2GLR A;  1O73 A;  4MJB A;  4OO4 A;  4TXO A;  2H1B A;  5D9W A;  4N3Z A;  1YEX A;  2WW0 A;  1TRV A;  1M7T A;  3RBT A;  4HDE A;  2A2S A;  1ZGN A;  2UZ8 A;  4MPF A;  2V6K A;  5ELG A;  1SJ6 A;  2WUL A;  2AJQ B;  3GFK A;  2I3Y A;  1O81 A;  3GKN A;  4NHZ A;  5FHI A;  2IMI A;  3PPU A;  1EV9 A;  4LMV A;  4K0N A;  1GNW A;  1QK8 A;  2E0Q A;  1VRS D;  3F4R A;  3IR4 A;  3GL3 A;  4PUA A;  2ES7 A;  4ZBB A;  3F9U A;  1DSB A;  1EOH A;  2L6D A;  1XW5 A;  1YJ6 A;  1A0F A;  4DSQ A;  2PWJ A;  1RW1 A;  1WIK A;  1GUK A;  3ZRD A;  1FO5 A;  3HKR A;  1FOV A;  1QUW A;  2VCZ A;  4EC0 A;  2NVL A;  2VD0 A;  2WFC A;  1EEM A;  2OA7 A;  3D5J A;  4G2E A;  1SKR B;  2E2G A;  5CRE A;  4ZB7 A;  1V2A A;  5D96 A;  1M2A A;  3VPQ A;  3KEB A;  3G7I A;  4PQI A;  1EP8 A;  5B8A A;  2L4Q A;  2A2P A;  4HU9 A;  3ZYW A;  2X4A A;  4KSM A;  1MTC A;  2K6V A;  3C71 A;  3DKS A;  5DQS A;  1XFL A;  2YJ7 A;  3FR6 A;  4PGT A;  1SVM A;  2WS2 A;  1DE1 A;  5BMU A;  1HQO A;  1PQN A;  1V57 A;  4XS1 A;  2C3Q A;  4POB A;  3D21 A;  1ERU A;  5JCG A;  4ACS A;  2F8F A;  2FWG A;  4K1F A;  5GSS A;  2FWH A;  2KLX A;  3IK9 A;  1X5E A;  1JZO A;  1VF1 A;  4WXT A;  3BCK A;  4YAP A;  2PN8 A;  5JWR B;  5F05 A;  4I5Q A;  4ID0 A;  3KMN A;  2MBT A;  4IN0 A;  1GSE A;  2H1G A;  3SBC A;  3ZIJ A;  2HE3 A;  2CQ9 A;  1GL8 A;  1XZO A;  4FYU A;  5AGY A;  1JZR A;  2YWO A;  3KH7 A;  4NPB A;  3DD3 A;  2GQL A;  1N2A A;  1SL1 B;  2L6C A;  8GSS A;  4JR4 A;  3IBH A;  5DAL B;  1T4Z A;  2HFD A;  2OJL A;  2VD1 A;  2IFQ B;  2GSQ A;  3GNJ A;  3FK8 A;  2IMF A;  3CXG A;  1I1I P;  5EL8 A;  1YZX A;  1PMT A;  3TOT A;  1FVK A;  3HY2 A;  4ZL7 A;  2RM5 A;  3J7Y b;  2B6M A;  5COH A;  2MMN A;  3KXO A;  2KOK A;  3TU3 B;  1URM A;  3ZVJ D;  3A2W A;  1XIY A;  2R0G A;  1O85 A;  2H70 A;  1GUH A;  5ID2 B;  4ZIL A;  3CHX C;  3EE2 A;  3NIV A;  3GKK A;  4E8H A;  3HZ8 A;  2VUP A;  1HD2 A;  1X9W B;  3TOU A;  3RPN A;  2VL9 A;  3RPP A;  2DBC A;  4HZ4 A;  2DIY A;  4D73 B;  5CRG A;  2QSI A;  3V1W A;  3CTF A;  1BX9 A;  3D6I A;  3EYT A;  3QFA C;  3D22 A;  2HSN A;  4ICY A;  3APS A;  4KDX A;  4J57 E;  6GSS A;  5DAL A;  3TKP A;  2FHE A;  4DEJ A;  5KEJ A;  4KH7 A;  4KDY A;  4JRR A;  3O76 A;  7GSS A;  4KCE A;  1SJZ A;  3W8S A;  5D9V A;  4H86 A;  1Z7P A;  3A5I A;  3R3E A;  5EVO A;  5CRD A;  2J23 A;  2KHP A;  3MAK A;  2N5F A;  2F51 A;  2JU5 A;  4KF9 A;  1B9X C;  5G1L A;  3I69 A;  1SL2 B;  1B8X A;  3FYG A;  1XWA A;  5ECK B;  3DRN A;  4MF6 A;  2DJ0 A;  2JZS A;  1M99 A;  2HRN A;  5E4W A;  13GS A;  2WVX A;  3TRX A;  5J40 A;  4V2M A;  2HSY A;  4RI6 A;  2J9H A;  4GDF A;  4ZL8 A;  3BJ5 A;  1T8E B;  1C72 A;  1E6B A;  1PD2 1;  4ZB6 A;  5HQP A;  2FY6 A;  3CRT A;  3TKR A;  1GRX A;  1VF3 A;  3HJP A;  5FT3 A;  1F2E A;  2G2Q A;  3ZIV A;  1SL0 B;  2HRA A;  3GH6 A;  2HRK A;  3HJO A;  1PL2 A;  2YAN A;  5D8I A;  1G6W A;  2V2G A;  5HFI A;  5D9X A;  3QAW A;  2HNL A;  3RAZ A;  1XW6 A;  2YPM A;  4GRF A;  5L71 A;  3F6F A;  2R37 A;  1ML6 A;  4NWY A;  2ON7 A;  3L0H A;  5A34 B;  2CV4 A;  1UN2 A;  1K0B A;  2BTO T;  3VWU A;  5IIZ A;  5B6N A;  3IDV A;  3UIW A;  3WYW A;  3CRU A;  3A5W A;  3EIN A;  4GSS A;  1E2Y A;  2YZH A;  1KBN A;  2QC7 A;  4RUV A;  1BED A;  1WOU A;  1RK4 A;  1AXD A;  3MSZ A;  2X49 A;  3BD2 A;  2VCT A;  3TKS A;  2LV3 A;  2IMD A;  4KE3 A;  4ECB A;  1MDI A;  1GSY A;  2LRC A;  3UBL A;  1A24 A;  2R2J A;  4AKI A;  1W4V A;  5FWG A;  3TJB A;  3CSH A;  3PR8 A;  4EL1 A;  4POM A;  1FOH A;  1AAZ A;  3TJG A;  4MF5 A;  3L9S A;  4AJ7 A;  3G7J A;  2RII A;  4GQF A;  5IM9 A;  3GST A;  1EGO A;  1SU9 A;  2PPT A;  3GA4 A;  4FQU A;  2O3E A;  4KSO A;  2B5E A;  2HSM B;  1S4B P;  4PQ1 A;  3E9J B;  3H4K A;  2R3X A;  4XRD A;  4PI2 C;  4Q5F A;  1G0T A;  1PN9 A;  5G1K A;  4BVX B;  3QAV A;  3SWL A;  4PUF C;  4HJM A;  2HLS A;  4OFM A;  3VK9 A;  2AAW A;  4X1U A;  2GVP A;  2HZE B;  4EDZ A;  3RHB A;  1DBY A;  4FYC A;  2RLI A;  1LBK A;  4EIQ A;  3TGZ A;  4PTS A;  3TJJ A;  2OE0 A;  3IAM 2;  2V1M A;  4AJ8 A;  1S3C A;  3IAS 2;  1GLP A;  1PX7 A;  1F9M A;  2H1D A;  2FNO A;  2GSR A;  1SD9 A;  5A4W A;  2YP6 A;  2O89 A;  4EO3 A;  1GWC A;  2IMK A;  3U6V A;  2WCI A;  3QMX A;  3WT1 A;  1AC1 A;  2WRT A;  5ECO B;  1SYR A;  4BL7 B;  1OC9 A;  4F0B A;  1M0U A;  4YKF A;  2XPD A;  2QKE A;  5DCH A;  3W8J A;  4GWR A;  3HVX A;  3IXR A;  4ZBD A;  2WW3 A;  1H75 A;  5IMV A;  1LU4 A;  2CA8 A;  3CWG A;  2QA2 A;  5KN3 A;  2CZ3 A;  5DQY A;  3HCZ A;  16GS A;  3ISO A;  2FWF A;  1BG5 A;  2O36 A;  4TW5 A;  1TXX A;  1FHE A;  1EGR A;  5C04 A;  3GIX A;  1QXH A;  4K7N A;  1Y6E A;  3LYP A;  3LYK A;  2L4C A;  1O7U A;  4CDO A;  4PUR A;  5IQY A;  4GLT A;  2C80 A;  5J3R A;  3LJR A;  3DGQ A;  1W89 A;  5DBQ A;  2DC5 A;  4KND A;  3D4M A;  2O8V B;  1A23 A;  5IMZ A;  3F4S A;  12GS A;  1OC8 A;  5GZZ B;  4ECC A;  4RQR A;  1XVW A;  2H74 A;  1XWG A;  4V1A p;  3WGE A;  1ABA A;  5A4U A;  4XIH A;  3MDK A;  5A5H B;  1USB A;  4DSS A;  3HMJ G;  3TUE A;  4NV5 A;  5AIV A;  1YY7 A;  4MH2 A;  1TP9 A;  3IPZ A;  4IP1 A;  1V98 A;  5IO0 A;  2R0P A;  3F6D A;  3FRC A;  2O87 A;  1T4Y A;  4ILF A;  1K0N A;  2HXK A;  4N10 A;  4MH3 A;  2IME A;  1T1V A;  4EIP A;  5IO2 A;  2H01 A;  4TRX A;  2DMM A;  1TI3 A;  5F06 A;  1S3A A;  3HJM A;  2PU9 C;  1HNC A;  3WGX A;  4L0W A;  3KCM A;  1QGV A;  1TI1 A;  1SD8 A;  2RUF A;  4N30 A;  4OWY A;  5CO3 A;  1F3A A;  4ECI A;  1PKZ A;  4XRA A;  1OKD A;  3UBK A;  1JFU A;  1M9B A;  4KA0 A;  3DIE A;  5GAN D;  22GS A;  4CY6 A;  4OO5 A;  3DYR A;  2H72 A;  2LNT A;  4G0L A;  3ERF A;  4Z2U A;  2HZF A;  2IN3 A;  1X9S B;  1GLQ A;  1ZZY A;  2H73 A;  2LJK A;  3KZQ A;  1Z6M A;  3CSJ A;  4WR5 A;  5LD0 A;  3O3T A;  2VM1 A;  1ZL9 A;  1SK1 A;  2IIY A;  3F8U A;  1ZYN A;  2N5B A;  3HVV A;  3TB2 A;  1MD3 A;  4MLY A;  1MDJ A;  3C73 A;  3F63 A;  1Q98 A;  2KUC A;  3HVN A;  2EC4 A;  3W6G A;  3L9V A;  4Q5R A;  4O5R A;  2QGV A;  2I4A A;  1V58 A;  3LWA A;  2HT9 A;  3KTB A;  3GMF A;  3FKF A;  3BCI A;  1JLV A;  2TIR A;  4JED A;  3N9J A;  2GZP A;  2MZC A;  2RM6 A;  2GZZ A;  2F9S A;  4LA1 A;  2REM A;  2H6Y A;  4MAB A;  2OAC A;  4WF4 A;  3FR3 A;  1CQG A;  1LJR A;  2DJK A;  1YEW C;  1Y1U A;  4EDY A;  4L5L A;  2EFD A;  1IYI A;  4NMU A;  2ZUP A;  5ECL B;  5HFK A;  5CYY A;  5KOX A;  4I2U A;  3GX0 A;  3EUR A;  4HOJ A;  1G7E A;  11GS A;  2YZU A;  3NZN A;  3ZVJ A;  5B8B A;  3ZL5 A;  2VL2 C;  2JSZ A;  3CMI A;  3CQF A;  1OYJ A;  2PVO C;  2LRN A;  4BIK A;  2H75 A;  1GH2 A;  4ZXG A;  4IQA A;  4ZL9 A;  1PGT A;  5B7C A;  2YCD A;  4FIW A;  5CNW A;  2WW2 A;  2FUG 2;  3EMX A;  4W66 A;  3C1S A;  4K7I A;  2IPA A;  3TRP A;  2VCX A;  2L59 A;  1QQ2 A;  2LJA A;  3UOM A;  1GTU A;  1AW9 A;  1J9B A;  2EIQ A;  2VKZ G;  3L4N A;  4FYB A;  1SKW B;  1F37 A;  5F07 A;  2A4V A;  2OT3 A;  2A4H A;  4MNN A;  3EMP A;  1B48 A;  1ZYP A;  2YJH A;  4X43 A;  3NOF A;  1YF1 A;  4K2D A;  5D73 A;  4YQV A;  1CQH A;  1GP1 A;  2QA1 A;  5J9B A;  2WZS A;  2YWI A;  3LW9 A;  2XC2 A;  4EKZ A;  2I81 A;  1SK2 A;  2IJY A;  4MF7 A;  3I43 A;  2R4V A;  1PX6 A;  4ML1 A;  2DKH A;  4J56 E;  2A2R A;  2PGT A; 
#chains in the Genus database with same CATH homology
 1AQX A;  1TK0 B;  2EIR A;  5A4V A;  2B1L A;  2DKI A;  2L5O A;  2HI7 A;  5J41 A;  2IFQ A;  2GGT A;  2GS3 A;  3VUR A;  3IC4 A;  3GTU B;  3H1N A;  4K7O A;  4G01 A;  4KCA A;  4GST A;  3PGT A;  4IP6 A;  1MEK A;  5A5K A;  3M9J A;  3HA9 A;  2C8U A;  1GUM A;  4GF0 A;  4G0K A;  2R0C A;  5H5R A;  3LG6 A;  3M3M A;  1SYX A;  1O8W A;  3CBU A;  2GT5 A;  4K2X A;  1B9Y C;  2BMX A;  5ID2 A;  1GTA A;  3S9F A;  5ABR A;  1Z3E A;  1OE8 A;  1GSQ A;  3KTL A;  1U3A A;  4PNG A;  3UAP A;  5LNK e;  2I9H A;  5ELA A;  1X0R A;  3ME7 A;  1THX A;  4D73 A;  2H1A A;  4O5U A;  3N5O A;  2VOC A;  1BJX A;  1GTB A;  2JL4 A;  4HEA 2;  3WT2 A;  3M0F A;  2M46 A;  4O92 A;  1QFN A;  1Q4J A;  3KGK A;  4NHW A;  1M2B A;  2C1Y A;  3ZFL A;  5J4V A;  2VLT A;  1O8X A;  3M1G A;  5C00 A;  4A5P A;  5CRW A;  2MMA A;  1U6T A;  1OC3 A;  2OE1 A;  1TRW A;  3FEU A;  1KEB A;  3HDC A;  3LEF A;  1BF5 A;  4AGS A;  3EWL A;  1A2L A;  1EEJ A;  4V2N A;  2GST A;  4KW6 A;  5ECS A;  2CX4 A;  5GAP D;  4FH8 A;  4V1A g;  2YV9 A;  4GCI A;  3GHA A;  3VI5 A;  4IJI A;  1OE7 A;  4KUN A;  1HYU A;  1Z7R A;  5DAK B;  3DXB A;  2P5Q A;  1WRY A;  2XBI A;  1GSS A;  2JAD A;  17GS A;  1BQ7 A;  2NDO A;  4N11 A;  4K0G A;  1GUL A;  4F82 A;  5F0G A;  3HD5 A;  2R6K A;  3KM6 A;  3IOS A;  1ERT A;  2EFC A;  2EIO A;  1FB0 A;  4XS4 B;  2H76 A;  1K0O A;  5KOW A;  5KN2 A;  1GNE A;  5EPF A;  4NV2 A;  2WZ9 A;  4MZC A;  4F2I A;  4XHM A;  2C3T A;  5A34 A;  1ON4 A;  2VCV A;  4MZW A;  5D9T A;  3L9U A;  1GSU A;  5HR3 A;  4X4J A;  1IYH A;  2KP1 A;  1NHO A;  2AHE A;  3KP8 A;  2GQM A;  1TKD B;  1NM3 A;  2DJ3 A;  3U5R E;  3IC8 A;  4LL4 B;  1PN0 A;  4GTU A;  6GSU A;  1F3B A;  2YWM A;  4TKY A;  4ECJ A;  6GST A;  1I9D A;  3WD6 A;  3UMA A;  3TDG A;  3F3R A;  3GRX A;  2DJ1 A;  5IOW A;  3UVH A;  3UJ1 A;  2WDU A;  3P7X A;  2WGR A;  1NSW A;  1ACV A;  2E2M A;  4K8M A;  1DE2 A;  14GS A;  2MMO A;  1EV4 A;  3FY7 A;  4V2L A;  4KAE A;  5JWQ B;  3VPT A;  3ZRE A;  1ERV A;  5ECN B;  2JZT A;  1A2M A;  5G30 A;  5GST A;  5DJM A;  4JU5 A;  4IEL A;  2HSM A;  2BJX A;  2C0G A;  5B6M A;  3TKS E;  1OKT A;  4O32 A;  2O7K A;  2K9F A;  4HUA A;  4BVX A;  3H79 A;  2C0D A;  4I8B A;  1R7H A;  4MZB A;  6GSW A;  3ERW A;  3QAG A;  2VO4 A;  4DSR A;  3IA1 A;  5G5F A;  2HZE A;  1G7O A;  1U3I A;  2HQT A;  1RQM A;  1K0C A;  4XCS A;  2H71 A;  5E59 A;  3FMW A;  1A8L A;  4TOP A;  4Z2R A;  2X8G A;  1BYE A;  4QL7 A;  2H1L A;  2H0G A;  3O6T A;  5ECH B;  5EY6 A;  3ZZX A;  3HVS A;  1B4Q A;  4AKH A;  3LSZ A;  1R5A A;  3D0Z A;  4TXO B;  2F8A A;  5JCW A;  4DVC A;  2GQK A;  6GSV A;  5ECQ B;  2H8L A;  1K3L A;  4BL7 A;  4OCE A;  1V9W A;  4WBJ A;  1XOA A;  3VFI A;  4KGI A;  1FB6 A;  4F0C A;  3CYN A;  2JSY A;  4KDU A;  2YWN A;  3TRQ A;  4X0X A;  3UAR A;  2DIZ A;  5IMF A;  3F3Q A;  1XOB A;  3A2V A;  3VWV A;  4LMW A;  2FA8 A;  4G19 A;  4I6X A;  2FCH A;  2VL3 A;  3WGD A;  4LL1 B;  2WB9 A;  3H8Q A;  3UVT A;  1YKA A;  3AY8 A;  5ECI B;  3IE3 A;  3ZLP A;  3ZIT A;  4OCF A;  4O7H A;  4USS A;  2C0E A;  5J4Y A;  2M80 A;  1U88 A;  5IMA A;  5HR2 A;  1S3D A;  4HQZ A;  1T3B A;  4LLR A;  1AQV A;  3FZ4 A;  3PH9 A;  5AN1 A;  1ZMA A;  2K8V A;  2H19 A;  1T00 A;  4G9H A;  2VIM A;  5G2Z A;  1AQW A;  4Q5N A;  2XHF A;  5JWO B;  5JCU A;  2B7J A;  5ECP B;  2HYX A;  5H5S A;  4PXO A;  5G31 A;  3QD9 A;  5A5H A;  1WE0 A;  3P2A A;  1FW1 A;  3GKM A;  3Q6O A;  4P3Y B;  1JZW A;  5HFG A;  2H66 A;  2YOI A;  5BMU B;  4JR6 A;  2JAC A;  4L8E A;  2LNS A;  4GXZ A;  3KIJ A;  4WBR D;  2GDR A;  5F8B A;  2CAQ A;  3ED3 A;  2VM2 A;  3IRA A;  4RI7 A;  1ZOF A;  4BA7 A;  2OE3 A;  2F3M A;  2HRF A;  4L5O A;  5H5Q A;  4YH2 A;  3DML A;  4IHU A;  2VLU A;  2X64 A;  1FVJ A;  4PQH A;  3GL5 A;  1TW9 A;  2FD3 A;  4F9Z A;  4NXI A;  3P90 A;  1TTZ A;  1I5G A;  2KP2 A;  5DVB A;  1R5P A;  2CT6 A;  1YKC A;  2LKU A;  3PIN A;  20GS A;  3QCP A;  4MA9 A;  4TN8 A;  5LCZ A;  1OAZ A;  2AV4 A;  5DCG A;  5IPH A;  3GX8 A;  4EVM A;  5D93 A;  4HQS A;  3ERG A;  1YEP A;  1SVL A;  2OAD A;  1A2J A;  4WEY A;  2P5R A;  3EU3 A;  2PER A;  4O5Q A;  1PL1 A;  4IW9 A;  1EZK A;  4F03 A;  4WET A;  1M2D A;  1WMJ A;  2IWT A;  2LEG A;  2D2Z A;  3D4T A;  4OFT A;  4HJ2 A;  10GS A;  4QMK A;  2CVD A;  2AUV A;  2K8S A;  1XW9 A;  2MBS A;  2VCW A;  3GH9 A;  2X8H A;  3F0I A;  1EP7 A;  2YV7 A;  1VF2 A;  1K3O A;  1F6M C;  1ZCP A;  2H6X A;  2CAI A;  1XVQ A;  2N5A A;  3A2X A;  5HR1 A;  4IQ1 A;  1XWC A;  1TU8 A;  2TRC P;  3DVW A;  1KTE A;  2H30 A;  2OBI A;  1WJK A;  3ZTL A;  3GUR A;  2OKA A;  1K0D A;  2V6O A;  4ZBA A;  1X9M B;  4BVY B;  1AIU A;  2LQQ A;  1QMV A;  2VL2 A;  1ST9 A;  5A1N B;  1MDK A;  2HSN B;  2EFH A;  2G0F A;  4MK3 A;  4TR3 A;  4YKG A;  4HZ2 A;  1X5D A;  2NTO A;  1A0R P;  1TU7 A;  4TR1 B;  3FZ9 A;  3DWV A;  4HU7 A;  3LGC A;  2XBQ A;  3LFL A;  3H93 A;  3F4T A;  1BG1 A;  1SKS B;  5J47 A;  1HNB A;  2FWE A;  2DML A;  4MJE A;  3I6A A;  2WJU A;  4K5R A;  3IK7 A;  1ILO A;  1KNG A;  4IJ3 A;  3OR5 A;  1Z9H A;  5CRH A;  1GSD A;  2P31 A;  3TKQ A;  4IGJ A;  2LST A;  1SEN A;  2NPB A;  5AIX A;  3RHC A;  1O6J A;  4TR0 A;  3P8W A;  4BVY A;  19GS A;  3CSI A;  2X8C A;  2HSH A;  1TRU A;  5A1N A;  1TRS A;  1UC7 A;  3TJF A;  4TXV A;  5CAX A;  3QOU A;  2OBK A;  3I9V 2;  4RQX A;  1U87 A;  3QR6 A;  4EUY A;  1WP0 A;  1WWJ A;  3FZ5 A;  2AYT A;  4TR1 A;  1K0A A;  4POL A;  5HR0 A;  4IVF A;  4ZB9 A;  2CZ2 A;  5ECM B;  9GSS A;  2ZNM A;  2HRK B;  2GTU A;  4PX1 A;  3E3E A;  3ZFB A;  18GS A;  1ZYQ B;  1PRX A;  5CP1 A;  2M72 A;  1GTI A;  1K0M A;  2B1K A;  1TK8 B;  2Z9S A;  5KN0 A;  2H6Z A;  3M8N A;  3Q19 A;  1Z6N A;  1M9A A;  3BBY A;  1J08 A;  2O5V A;  3GKX A;  4J2F A;  1BAY A;  4PNF A;  1OVN A;  4AKG A;  1NHY A;  3LOR A;  1T7P B;  2UV8 G;  4AF2 A;  4MCU A;  3CTG A;  4E8E A;  3APO A;  3GTU A;  2O85 A;  3VWX A;  4MPG A;  2DJJ A;  3KH9 A;  3EU4 A;  4N0V A;  4KX4 A;  3HYP A;  4ZIJ A;  5DJL A;  3QFB C;  2C4J A;  4GSN A;  4JBB A;  3FHK A;  4K5S A;  3M9K A;  6GSY A;  5ENU A;  2MMZ A;  4POK A;  4JE1 A;  2CVK A;  3K8N A;  3HHV A;  5IMC A;  1TOF A;  4WR4 A;  1JZD A;  3KJY A;  1JLW A;  1Y25 A;  2C0F A;  3IHQ A;  2LJR A;  5ECR B;  3HZ4 A;  4ML6 A;  3UEM A;  4IS0 A;  4Z7X A;  4QL9 A;  1FG4 A;  3EC3 A;  2DJ2 A;  3L78 A;  5J5N A;  2H0I A;  3FR9 A;  3TKS C;  3R2Q A;  2NBS A;  1UA5 A;  2FLS A;  3EPT A;  2B3S A;  1N8J A;  3G7Y A;  4K9Z A;  1G6Y A;  5G5E A;  2ON5 A;  2K18 A;  1TDI A;  1SVO A;  1THO A;  1TXU A;  4JZQ A;  4K6X A;  4EE0 A;  1PA3 A;  4OFN A;  4OMV A;  1Z5Y E;  3C8E A;  1R4W A;  1XPV A;  4YAV A;  3UL3 A;  1ZYE A;  1WPI A;  1YVL A;  4ISD A;  2JZR A;  3MIX A;  2LS5 A;  2VAF A;  1MD4 A;  3VI7 A;  1VF4 A;  4TR4 A;  3G9B A;  2PMT A;  4MJC A;  1EOG A;  2EFE A;  2GSS A;  2LQO A;  4WKW A;  1HNA A;  1N25 A;  4CHS A;  4XTS A;  2I1U A;  4G10 A;  3ZMK A;  2CX3 A;  2RUE A;  5J9C A;  2VLV A;  3TCO A;  3LXZ A;  3TJK A;  1OC9 B;  3FZA A;  4WF5 A;  5KN1 A;  4KB3 A;  2MYG A;  3KMO A;  2L5L A;  5DAK A;  4MJA A;  3BOA A;  4CY8 A;  1R26 A;  2LTK A;  5IMD A;  1SJI A;  2B7K A;  4EXJ A;  3GYK A;  3VWW A;  1YF0 A;  1X5C A;  4FO5 A;  1H4O A;  4BWQ A;  1EWX A;  2H0H A;  2XPE A;  5DDL A;  4L0U A;  4MDC A;  4AKX B;  2GT6 A;  1TK5 B;  4BWS A;  4XS4 A;  2TRX A;  4Z2T A;  3US3 A;  3IHG A;  2B5X A;  2LRT A;  3DVX A;  4OD7 A;  2IL3 A;  6GSX A;  4GQC A;  3FW2 A;  3GV1 A;  3Q18 A;  4AI6 A;  3GN3 A;  2V41 A;  4I2T A;  3C7M A;  1XXU A;  3APQ A;  3ZML A;  3MWH A;  3VLN A;  3GUS A;  3J7Y k;  2DSA A;  2DLX A;  2LUS A;  4G0I A;  1XWB A;  5IOX A;  3LQ7 A;  4YQU A;  3EVI A;  3A3T A;  2YNX A;  3C1R A;  2ZCT A;  2GZY A;  2FA4 A;  1J0F A;  2PVQ A;  4QQ7 A;  4DSS B;  3MNG A;  1K3Y A;  1SK0 A;  4ULX A;  1TJD A;  1B4P A;  1YQ1 A;  4TVE A;  4EF0 A;  2E7P A;  3IV4 A;  3QPM A;  1JHB A;  4N0Z A;  4MMM A;  4XS6 A;  1A8Y A;  3KP9 A;  1FAA A;  2PUK C;  3LXT A;  1YDK A;  1UVZ A;  2R5G A;  1XCC A;  5AIS A;  4E68 A;  2YN1 A;  4NAX A;  4CW9 A;  3RDW A;  3E0U A;  1ERW A;  1PSQ A;  2L57 A;  4ZB8 A;  4MP4 A;  3Q74 A;  1PKW A;  4I97 A;  5IPG A;  5BRT A;  3GSS A;  2C3N A;  3KD0 A;  4IBP A;  2VCQ A;  2AB6 A;  3JCM L;  3HXS A;  2ALB A;  3QDN A;  2CVB A;  4HS1 A;  1XBS A;  3ME8 A;  2X99 A;  4IKH A;  4YQM A;  5J4U A;  2PBJ A;  4BPY A;  3MYD A;  1GSF A;  1XWK A;  2FGX A;  3DEX A;  4AJ6 A;  5INY A;  1V40 A;  2V32 A;  1AUC A;  1VGL A;  2B5Y A;  4HI7 A;  2P0G A;  1DUG A;  4Q5Q A;  1NW2 A;  2GLR A;  1O73 A;  4MJB A;  4OO4 A;  4TXO A;  2H1B A;  5D9W A;  4N3Z A;  1YEX A;  1TRV A;  1M7T A;  3RBT A;  4HDE A;  2A2S A;  1ZGN A;  2UZ8 A;  4MPF A;  2V6K A;  5ELG A;  1SJ6 A;  2WUL A;  2AJQ B;  3GFK A;  2I3Y A;  1O81 A;  3GKN A;  4NHZ A;  5FHI A;  2IMI A;  3PPU A;  1EV9 A;  4LMV A;  4K0N A;  1GNW A;  1QK8 A;  2E0Q A;  1VRS D;  3F4R A;  3IR4 A;  3GL3 A;  4PUA A;  2ES7 A;  4ZBB A;  3F9U A;  1DSB A;  1EOH A;  2L6D A;  1XW5 A;  1YJ6 A;  1A0F A;  4DSQ A;  2PWJ A;  1RW1 A;  1WIK A;  1GUK A;  3ZRD A;  1FO5 A;  3HKR A;  1FOV A;  1QUW A;  2VCZ A;  4EC0 A;  2NVL A;  2VD0 A;  2WFC A;  1EEM A;  2OA7 A;  3D5J A;  4G2E A;  1SKR B;  2E2G A;  5CRE A;  4ZB7 A;  1V2A A;  5D96 A;  1M2A A;  3VPQ A;  3KEB A;  3G7I A;  4PQI A;  1EP8 A;  5B8A A;  2L4Q A;  2A2P A;  4HU9 A;  3ZYW A;  2X4A A;  4KSM A;  1MTC A;  2K6V A;  3C71 A;  3DKS A;  5DQS A;  1XFL A;  2YJ7 A;  3FR6 A;  4PGT A;  1SVM A;  2WS2 A;  1DE1 A;  5BMU A;  1HQO A;  1PQN A;  1V57 A;  4XS1 A;  2C3Q A;  4POB A;  3D21 A;  1ERU A;  5JCG A;  4ACS A;  2F8F A;  2FWG A;  4K1F A;  5GSS A;  2FWH A;  2KLX A;  3IK9 A;  1X5E A;  1JZO A;  1VF1 A;  4WXT A;  3BCK A;  4YAP A;  2PN8 A;  5JWR B;  5F05 A;  4I5Q A;  4ID0 A;  3KMN A;  2MBT A;  4IN0 A;  1GSE A;  2H1G A;  3SBC A;  3ZIJ A;  2HE3 A;  2CQ9 A;  1GL8 A;  1XZO A;  4FYU A;  5AGY A;  1JZR A;  2YWO A;  3KH7 A;  4NPB A;  3DD3 A;  2GQL A;  1N2A A;  1SL1 B;  2L6C A;  8GSS A;  4JR4 A;  3IBH A;  5DAL B;  1T4Z A;  2HFD A;  2OJL A;  2VD1 A;  2IFQ B;  2GSQ A;  3GNJ A;  3FK8 A;  2IMF A;  3CXG A;  5EL8 A;  1YZX A;  1PMT A;  3TOT A;  1FVK A;  3HY2 A;  4ZL7 A;  2RM5 A;  3J7Y b;  2B6M A;  5COH A;  2MMN A;  3KXO A;  2KOK A;  3TU3 B;  1URM A;  3ZVJ D;  3A2W A;  1XIY A;  2R0G A;  1O85 A;  2H70 A;  1GUH A;  5ID2 B;  4ZIL A;  3EE2 A;  3NIV A;  3GKK A;  4E8H A;  3HZ8 A;  2VUP A;  1HD2 A;  1X9W B;  3TOU A;  3RPN A;  2VL9 A;  3RPP A;  2DBC A;  4HZ4 A;  2DIY A;  4D73 B;  5CRG A;  2QSI A;  3V1W A;  3CTF A;  1BX9 A;  3D6I A;  3EYT A;  3QFA C;  3D22 A;  2HSN A;  4ICY A;  3APS A;  4KDX A;  4J57 E;  6GSS A;  5DAL A;  3TKP A;  2FHE A;  4DEJ A;  5KEJ A;  4KH7 A;  4KDY A;  4JRR A;  3O76 A;  7GSS A;  4KCE A;  1SJZ A;  3W8S A;  5D9V A;  4H86 A;  1Z7P A;  3A5I A;  3R3E A;  5EVO A;  5CRD A;  2J23 A;  2KHP A;  3MAK A;  2N5F A;  2F51 A;  2JU5 A;  4KF9 A;  1B9X C;  5G1L A;  3I69 A;  1SL2 B;  1B8X A;  3FYG A;  1XWA A;  5ECK B;  3DRN A;  4MF6 A;  2DJ0 A;  2JZS A;  1M99 A;  2HRN A;  5E4W A;  13GS A;  3TRX A;  5J40 A;  4V2M A;  2HSY A;  4RI6 A;  2J9H A;  4GDF A;  4ZL8 A;  3BJ5 A;  1T8E B;  1C72 A;  1E6B A;  1PD2 1;  4ZB6 A;  5HQP A;  2FY6 A;  3CRT A;  3TKR A;  1GRX A;  1VF3 A;  3HJP A;  5FT3 A;  1F2E A;  2G2Q A;  3ZIV A;  1SL0 B;  2HRA A;  3GH6 A;  2HRK A;  3HJO A;  1PL2 A;  2YAN A;  5D8I A;  1G6W A;  2V2G A;  5HFI A;  5D9X A;  3QAW A;  2HNL A;  3RAZ A;  1XW6 A;  2YPM A;  4GRF A;  5L71 A;  3F6F A;  2R37 A;  1ML6 A;  4NWY A;  2ON7 A;  3L0H A;  5A34 B;  2CV4 A;  1UN2 A;  1K0B A;  2BTO T;  3VWU A;  5IIZ A;  5B6N A;  3IDV A;  3UIW A;  3WYW A;  3CRU A;  3A5W A;  3EIN A;  4GSS A;  1E2Y A;  2YZH A;  1KBN A;  2QC7 A;  4RUV A;  1BED A;  1WOU A;  1RK4 A;  1AXD A;  3MSZ A;  2X49 A;  3BD2 A;  2VCT A;  3TKS A;  2LV3 A;  2IMD A;  4KE3 A;  4ECB A;  1MDI A;  1GSY A;  2LRC A;  3UBL A;  1A24 A;  2R2J A;  4AKI A;  1W4V A;  5FWG A;  3TJB A;  3CSH A;  3PR8 A;  4EL1 A;  4POM A;  1FOH A;  1AAZ A;  3TJG A;  4MF5 A;  3L9S A;  4AJ7 A;  3G7J A;  2RII A;  4GQF A;  5IM9 A;  3GST A;  1EGO A;  1SU9 A;  2PPT A;  3GA4 A;  4FQU A;  4KSO A;  2B5E A;  2HSM B;  4PQ1 A;  3E9J B;  3H4K A;  2R3X A;  4XRD A;  1G0T A;  4Q5F A;  1PN9 A;  5G1K A;  4BVX B;  3QAV A;  3SWL A;  4PUF C;  4HJM A;  2HLS A;  4OFM A;  3VK9 A;  2AAW A;  4X1U A;  2GVP A;  2HZE B;  4EDZ A;  3RHB A;  1DBY A;  4FYC A;  2RLI A;  1LBK A;  4EIQ A;  3TGZ A;  4PTS A;  3TJJ A;  2OE0 A;  3IAM 2;  2V1M A;  4AJ8 A;  1S3C A;  3IAS 2;  1GLP A;  1PX7 A;  1F9M A;  2H1D A;  2FNO A;  2GSR A;  1SD9 A;  5A4W A;  2YP6 A;  2O89 A;  4EO3 A;  1GWC A;  2IMK A;  3U6V A;  2WCI A;  3QMX A;  3WT1 A;  1AC1 A;  2WRT A;  5ECO B;  1SYR A;  4BL7 B;  1OC9 A;  4F0B A;  1M0U A;  4YKF A;  2XPD A;  2QKE A;  5DCH A;  3W8J A;  4GWR A;  3HVX A;  3IXR A;  4ZBD A;  1H75 A;  5IMV A;  1LU4 A;  2CA8 A;  3CWG A;  2QA2 A;  5KN3 A;  2CZ3 A;  5DQY A;  3HCZ A;  16GS A;  3ISO A;  2FWF A;  1BG5 A;  4TW5 A;  1TXX A;  1FHE A;  1EGR A;  5C04 A;  3GIX A;  1QXH A;  4K7N A;  1Y6E A;  3LYP A;  3LYK A;  2L4C A;  1O7U A;  4CDO A;  4PUR A;  5IQY A;  4GLT A;  2C80 A;  5J3R A;  3LJR A;  3DGQ A;  1W89 A;  5DBQ A;  2DC5 A;  4KND A;  3D4M A;  2O8V B;  1A23 A;  5IMZ A;  3F4S A;  12GS A;  1OC8 A;  5GZZ B;  4ECC A;  4RQR A;  1XVW A;  2H74 A;  1XWG A;  4V1A p;  3WGE A;  1ABA A;  5A4U A;  4XIH A;  3MDK A;  5A5H B;  1USB A;  4DSS A;  3HMJ G;  3TUE A;  4NV5 A;  5AIV A;  1YY7 A;  4MH2 A;  1TP9 A;  3IPZ A;  4IP1 A;  1V98 A;  5IO0 A;  2R0P A;  3F6D A;  3FRC A;  2O87 A;  1T4Y A;  4ILF A;  1K0N A;  2HXK A;  4N10 A;  4MH3 A;  2IME A;  1T1V A;  4EIP A;  5IO2 A;  2H01 A;  4TRX A;  2DMM A;  1TI3 A;  5F06 A;  1S3A A;  3HJM A;  2PU9 C;  1HNC A;  3WGX A;  4L0W A;  3KCM A;  1QGV A;  1TI1 A;  1SD8 A;  2RUF A;  4N30 A;  4OWY A;  5CO3 A;  1F3A A;  4ECI A;  1PKZ A;  4XRA A;  1OKD A;  3UBK A;  1JFU A;  1M9B A;  4KA0 A;  3DIE A;  5GAN D;  22GS A;  4CY6 A;  4OO5 A;  3DYR A;  2H72 A;  2LNT A;  4G0L A;  3ERF A;  4Z2U A;  2HZF A;  2IN3 A;  1X9S B;  1GLQ A;  1ZZY A;  2H73 A;  2LJK A;  3KZQ A;  1Z6M A;  3CSJ A;  4WR5 A;  5LD0 A;  3O3T A;  2VM1 A;  1ZL9 A;  1SK1 A;  2IIY A;  1ZYN A;  3F8U A;  2N5B A;  3HVV A;  3TB2 A;  1MD3 A;  4MLY A;  1MDJ A;  3C73 A;  3F63 A;  1Q98 A;  2KUC A;  2EC4 A;  3W6G A;  3L9V A;  4Q5R A;  4O5R A;  2QGV A;  2I4A A;  1V58 A;  3LWA A;  2HT9 A;  3KTB A;  3GMF A;  3FKF A;  3BCI A;  1JLV A;  2TIR A;  4JED A;  3N9J A;  2GZP A;  2MZC A;  2RM6 A;  2GZZ A;  2F9S A;  4LA1 A;  2REM A;  2H6Y A;  4MAB A;  2OAC A;  4WF4 A;  3FR3 A;  1CQG A;  1LJR A;  2DJK A;  1Y1U A;  4EDY A;  4L5L A;  2EFD A;  1IYI A;  4NMU A;  2ZUP A;  5ECL B;  5HFK A;  5CYY A;  5KOX A;  4I2U A;  3GX0 A;  3EUR A;  4HOJ A;  1G7E A;  11GS A;  2YZU A;  3NZN A;  3ZVJ A;  5B8B A;  3ZL5 A;  2VL2 C;  2JSZ A;  3CMI A;  1OYJ A;  2PVO C;  2LRN A;  2H75 A;  1GH2 A;  4ZXG A;  4IQA A;  4ZL9 A;  1PGT A;  5B7C A;  2YCD A;  4FIW A;  5CNW A;  2FUG 2;  3EMX A;  4W66 A;  3C1S A;  4K7I A;  2IPA A;  3TRP A;  2VCX A;  2L59 A;  1QQ2 A;  2LJA A;  3UOM A;  1GTU A;  1AW9 A;  1J9B A;  2EIQ A;  2VKZ G;  3L4N A;  4FYB A;  1SKW B;  1F37 A;  5F07 A;  2A4V A;  2OT3 A;  2A4H A;  4MNN A;  3EMP A;  1B48 A;  1ZYP A;  2YJH A;  4X43 A;  3NOF A;  1YF1 A;  4K2D A;  5D73 A;  4YQV A;  1CQH A;  1GP1 A;  2QA1 A;  5J9B A;  2YWI A;  3LW9 A;  2XC2 A;  4EKZ A;  2I81 A;  1SK2 A;  2IJY A;  4MF7 A;  3I43 A;  2R4V A;  1PX6 A;  4ML1 A;  2DKH A;  4J56 E;  2A2R A;  2PGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...