5G5FA

Crystallographic structure of the tau class glutathione s-transferase migstu in complex with reduced glutathione.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
b'KSDVKLLGAWPSPYVMRARITLNVKSVDYELLEETLGSKSDLLLKSNPVHKKIPVLIHNDKPICESLIIVHYIDEFWSSGPSILPSDPYDRAIARFWAAYLDEKWYPSLKGIASAQGEEAKKAAVDQVGESLALIEDTYVKLSKGKPFFGGEKIGYLDIAFGCFLGWLRVTEKTSGVKFLNEAKTPHLAKWAVRFCADPAVKDVMPETEKLAEFAKLLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAU CLASS GLUTATHIONE S-TRANSFERASE
publication title Insights Into Ligand Binding to a Glutathione S-Transferase from Mango: Structure, Thermodynamics and Kinetics
pubmed doi rcsb
source organism Mangifera indica
molecule tags Transferase
total genus 71
structure length 219
sequence length 219
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5g5fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g5fA01
4HDEA 5KN1A 3O76A 5HR0A 4ZL8A 1YY7A 1PX6A 1YEXA 2N5BA 4G0KA 2IPAA 1OVNA 4MF6A 4USSA 2HSYA 2KLXA 4K8MA 1AXDA 1SK1A 2YCDA 5D9XA 1TRSA 3WGDA 1VF3A 4G10A 1MDJA 2FY6A 2LUSA 2AJQB 1GULA 2X8CA 4RI7A 2FHEA 2L5LA 3QFBC 3U5RE 4QL9A 4I5QA 1HNCA 4KDUA 3L78A 22GSA 2C0EA 1SL2B 2YWOA 1F2EA 1GTUA 3EINA 3PGTA 4RI6A 2VIMA 1EP7A 3P90A 3EWLA 3HJMA 2GT6A 2GSTA 2DLXA 4TOPA 3RAZA 1SKRB 1GTBA 1WWJA 3Q19A 2EC4A 3GL5A 4J57E 3FHKA 2BJXA 5HFIA 1TI1A 2IMDA 20GSA 4OCFA 4POMA 3WYWA 1V40A 4L0UA 4OFMA 2HFDA 4TR4A 3LJRA 1MD4A 1R7HA 3QCPA 4MZCA 2CV4A 2LNTA 1X9SB 3CTGA 4DVCA 2CZ3A 3TJBA 3C1RA 1OE8A 3L9UA 1AQWA 3UL3A 3QMXA 8GSSA 5H5RA 1M9AA 1KTEA 2QGVA 4Q5QA 1SKSB 1F6MC 4PXOA 1EGRA 3SBCA 2V6OA 5C04A 2LRNA 3IV4A 3ZMLA 2XBIA 3RHBA 3GA4A 1U3IA 2AV4A 2F9SA 3TRXA 5DCHA 3EMXA 6GSSA 3ME8A 4HU9A 3A2WA 1BX9A 2C0GA 2O85A 2M46A 1XOBA 18GSA 1OYJA 3SWLA 3W8JA 5ELAA 3HVXA 4WEYA 2CA8A 2YN1A 1OC8A 3KTBA 1O8WA 1TP9A 2M80A 2CVKA 1V58A 1TK0B 2FLSA 3DD3A 2YNXA 1AQVA 2EIOA 2LJKA 2DJ2A 3VWUA 1TK5B 1FB6A 4XRDA 2GSRA 3EMPA 5CRDA 1XOAA 1SYRA 2G0FA 2HSHA 1V57A 4OD7A 4KF9A 2VLTA 2HSNB 3QD9A 1FG4A 3G7IA 5G1LA 1SYXA 2B1LA 3UVTA 2H1BA 2L4CA 3ZIJA 1U6TA 1G0TA 1SU9A 3IR4A 1K3OA 1F9MA 3I43A 3G7YA 3FYGA 1VF2A 3WD6A 4KUNA 4BVXA 2NBSA 3N9JA 3GTUA 4KSOA 2RM5A 5G5FA 4WBRD 2L6DA 3LXZA 3D21A 4BVXB 2VCXA 4RQRA 3C1SA 2OKAA 4KSMA 3GTUB 1O7UA 3APOA 2IN3A 2NDOA 3UOMA 1ST9A 2IMFA 2MMNA 1DBYA 2YOIA 3GH9A 3H79A 3A2XA 1FVJA 4EO3A 1G7OA 5IPHA 2DMLA 2Z9SA 1NHOA 1QQ2A 3GRXA 4FYBA 3ZRDA 1S3DA 5J9BA 4DEJA 3QR6A 12GSA 1JZOA 4FQUA 1HNAA 4YH2A 1X5DA 4N30A 4O32A 1I9DA 3IC4A 4MPFA 1MTCA 3MDKA 1WE0A 4TXOA 2E7PA 1AQXA 2LQOA 1V2AA 1TU8A 3BOAA 3J7Yb 3HA9A 3ZVJD 5AIXA 2ALBA 4TXOB 5D96A 4YQUA 2I9HA 1TI3A 2F8AA 5E59A 2VAFA 3HYPA 1B9YC 6GSVA 3KTLA 5ECSA 1QFNA 1TRVA 4IP6A 4V2LA 1USBA 4LMWA 5DJMA 3GX0A 1FO5A 2FNOA 2C8UA 2CAIA 3ISOA 2CZ2A 2KP1A 4PUFC 3IE3A 1J08A 2GZYA 1HQOA 4PTSA 4ID0A 3M9JA 1JZWA 1YKAA 3TGZA 2LNSA 1CQGA 4OO4A 4HJ2A 2LRCA 2QKEA 3UAPA 3M3MA 3UMAA 1TKDB 4G2EA 1NSWA 1SKWB 4YAPA 2DSAA 1NW2A 1EP8A 1GLQA 1S3CA 3KIJA 2H1AA 5EL8A 2KUCA 2JACA 5HFKA 2YP6A 2GVPA 3TKPA 2H0HA 1B4PA 2GDRA 3IBHA 4L5LA 3LFLA 1A0FA 3VWVA 1GSEA 4MMMA 3FZ4A 1Z9HA 3C73A 3GX8A 3US3A 2B7KA 5ECKB 4RQXA 2PBJA 1F3BA 5CREA 1YJ6A 2A2RA 3D0ZA 1HNBA 1THOA 1K0DA 2H0GA 2H8LA 3HZ4A 5A5KA 2H30A 2IIYA 1QUWA 3I69A 2GTUA 3M8NA 4EVMA 3FW2A 2PMTA 5D9TA 2HRFA 4ECIA 3CBUA 3FR6A 2HNLA 1GLPA 1XWKA 4N0VA 1XCCA 2GSQA 3GYKA 4BWSA 3VLNA 1M9BA 4CDOA 2H74A 3GKNA 4IHUA 2HLSA 2TRXA 4L0WA 4IP1A 2B5EA 2LS5A 1GH2A 1TU7A 5F0GA 2AB6A 1NM3A 2GZZA 1TW9A 4MH2A 1T4ZA 1Y25A 4OMVA 1T7PB 4GRFA 1OC3A 1Z6NA 2J9HA 1R26A 2NPBA 4MLYA 2V2GA 3VI5A 2I3YA 1GSFA 1JFUA 4I6XA 4IS0A 1M2BA 2PN8A 1Z7PA 3KZQA 2KOKA 4ZL9A 5IIZA 4ZILA 3BCIA 4MZBA 2FA4A 4MDCA 3KD0A 1KNGA 1ZMAA 1PX7A 4IQ1A 4I2TA 3EURA 1PD21 1W89A 1TDIA 3ERGA 1XWGA 1IYIA 1GSUA 1T00A 5J5NA 5B7CA 3F4RA 1SL1B 4TVEA 5ABRA 2YWNA 1N8JA 3IXRA 3JCML 1GTIA 2KHPA 2FWGA 2ZUPA 3HHVA 2M72A 1FB0A 4GQCA 3LGCA 3GURA 2MBTA 5G31A 2D2ZA 5ID2A 3ME7A 3ZIVA 3KM6A 2DJKA 3HXSA 4TW5A 1GWCA 5H5QA 1EEJA 1JLVA 5IMDA 5ID2B 1R5PA 4IN0A 4ZB8A 1PA3A 2VLUA 3F63A 1U87A 4KA0A 5DQSA 2JZSA 2AAWA 5EPFA 1U88A 2DJ0A 4BL7A 3DMLA 5D8IA 3DEXA 2FA8A 1PKWA 3UEMA 3QAVA 2QSIA 1ML6A 4BL7B 3ZTLA 2IFQA 1AAZA 5ECRB 3G9BA 5DBQA 2CT6A 4AJ8A 4KDXA 1JHBA 4ISDA 4FYUA 2IFQB 4K1FA 1K3LA 3F4SA 2K9FA 4I97A 4MH3A 3NZNA 2FWHA 3EVIA 5HFGA 3CMIA 2JSZA 5JCGA 4MABA 2FWEA 1LJRA 4XS1A 3EC3A 4PQ1A 1RQMA 3DVXA 2DIYA 4OCEA 1SD8A 5KN0A 2WB9A 4HS1A 4L5OA 3MSZA 5JCWA 4JU5A 3IK7A 4K7IA 5F07A 2HI7A 3W8SA 5IOWA 2B5XA 1OKTA 5ECIB 1KBNA 2DMMA 2O7KA 6GSTA 3LQ7A 1ZYEA 2DJ1A 2V6KA 1XW9A 2WCIA 1XFLA 4MJBA 3TKSA 3M0FA 4GQFA 3ZVJA 1EEMA 5CYYA 5IO0A 1XPVA 3LORA 1CQHA 2P31A 3L4NA 4F03A 3S9FA 5CP1A 3VK9A 2IMKA 1DUGA 3ZREA 3FR9A 2X8GA 3NOFA 6GSYA 3F3QA 1GSSA 5GZZB 2VM1A 1GTAA 2DJJA 1A2JA 4KE3A 1YF0A 4O7HA 2JU5A 1JZDA 2O8VB 1BJXA 3CSIA 2DBCA 4PNGA 2VCWA 2RLIA 5DAKA 2N5AA 2RM6A 5IM9A 3ZMKA 1URMA 3DGQA 1T1VA 4N11A 2E0QA 3P7XA 1O81A 3KH9A 4TR0A 2R5GA 2AUVA 3TKRA 4LL1B 4EC0A 2XC2A 1RW1A 1OKDA 4MZWA 2YWIA 4GXZA 1AIUA 5JWRB 3ERWA 1Q4JA 4K7OA 2DC5A 3NIVA 1SJ6A 3IA1A 5GAPD 2H6XA 1GUKA 3CRUA 1SJZA 5KN2A 2H66A 3GSTA 7GSSA 1ERWA 3TKSE 1J9BA 4XCSA 1OE7A 3DYRA 1T4YA 3IDVA 1F37A 3V1WA 4OO5A 3IK9A 2ES7A 1H75A 4Q5FA 4HI7A 2CVDA 4G0IA 2LKUA 1DE2A 5A4VA 1TK8B 2JZRA 3L9VA 3TJKA 4IVFA 2HXKA 3TJJA 1ZCPA 4V2MA 2HE3A 2H1GA 3FZAA 2EIQA 2BMXA 2FUG2 4EXJA 5DALA 2MMZA 1O6JA 2VL2A 4DSQA 4DSSA 5JCUA 4NAXA 5DALB 4ZIJA 3M1GA 2CQ9A 4DSSB 3F0IA 1UVZA 4F82A 2B6MA 3WT2A 3APQA 2CX4A 2R4VA 4BVYA 4HEA2 2YZUA 3HJOA 4XS4A 3KEBA 4ZL7A 3D5JA 2FGXA 2C1YA 4BA7A 2H73A 4XIHA 4BVYB 4XS4B 3CSJA 5CRHA 3QDNA 5J9CA 2CX3A 1G7EA 4JE1A 1GUMA 2VCTA 1WPIA 3VURA 4IW9A 1M2AA 4KGIA 5ECPB 2PVQA 2H01A 3GHAA 5FHIA 3LEFA 6GSXA 4XRAA 4LA1A 1A0RP 5D93A 1EWXA 4NWYA 1Y6EA 4K7NA 4GCIA 3DKSA 1MD3A 2XPDA 5G5EA 5COHA 5IMVA 3TCOA 2H6YA 2H72A 2GQMA 4FYCA 2GS3A 3TKSC 3GKMA 4V2NA 5F8BA 2P0GA 3LYKA 2H75A 1B8XA 1TXXA 3ED3A 1THXA 5ECHB 2L4QA 3U6VA 2H71A 1PKZA 4GTUA 1X5CA 4MA9A 1EZKA 1X0RA 4K0GA 3GV1A 4ZB6A 3R3EA 5JWOB 4G19A 5J4UA 3LWAA 4KB3A 9GSSA 1PN9A 1Q98A 1EOGA 4FIWA 2MZCA 1NHYA 1J0FA 2VCQA 1GP1A 4I8BA 5IMFA 1X9MB 3CSHA 4EL1A 4LL4B 3D4MA 1O8XA 1ERVA 3APSA 2ON5A 4HU7A 2GSSA 2R2JA 4EF0A 2F3MA 5HR1A 1Z5YE 2WS2A 2OJLA 1O85A 2B7JA 3A3TA 3O6TA 3QAGA 2KP2A 3EU3A 3IHQA 4MCUA 1GSYA 5HR3A 2OA7A 3L0HA 3AY8A 4IELA 2YZHA 1R5AA 3CYNA 3EE2A 1T8EB 3IAS2 5CRWA 1QXHA 3PINA 5D9WA 2O87A 4HZ4A 1ACVA 3WGXA 2F8FA 2FWFA 2PGTA 1KEBA 3MAKA 4NV5A 4XTSA 1ZOFA 3FEUA 4ZBAA 3D22A 5A4WA 3KJYA 1Z3EA 4KW6A 1EV4A 1HD2A 3IOSA 3E9JB 4E8HA 2P5RA 1BQ7A 2WFCA 3HVVA 3UARA 4KX4A 3IRAA 1GRXA 1K0AA 1JLWA 3HKRA 2C3QA 4HQZA 2VL2C 3DWVA 4NV2A 2GLRA 2YPMA 2C3TA 2UZ8A 3LYPA 2A2SA 3KXOA 4L8EA 2VCZA 1RK4A 5GSSA 3TJGA 1A2LA 3EYTA 3KGKA 5DJLA 2HZEA 4ACSA 1FW1A 5CRGA 4J2FA 2JZTA 4IKHA 4MP4A 2HZEB 5AIVA 2VL9A 1TRWA 1PGTA 3A5WA 3C71A 2VCVA 2HZFA 3GNJA 4P3YB 1GUHA 2VO4A 1TJDA 5IMAA 2PWJA 1SJIA 4TR1A 1TTZA 2L57A 3CRTA 1YF1A 4IQAA 5FWGA 1JZRA 4Z7XA 1F3AA 4BPYA 2MYGA 19GSA 1SENA 2B5YA 4JBBA 2GZPA 2YANA 2WRTA 4TKYA 3GIXA 5LNKe 1UN2A 3UJ1A 3LG6A 2V41A 4FO5A 5G1KA 2IL3A 3C7MA 4F2IA 3H93A 3BJ5A 1SK0A 2DJ3A 2WGRA 2VM2A 4F0BA 2GQKA 3FY7A 3P8WA 2YJHA 2ON7A 4EDYA 4PGTA 1MEKA 3IC8A 3KH7A 4MF7A 4AGSA 1TOFA 2H0IA 3K8NA 2YV7A 5ECOB 4G9HA 2E2MA 3I9V2 5IMCA 4KCAA 1DSBA 4KDYA 3VPQA 1B4QA 5CO3A 3UIWA 5DVBA 2N5FA 2R3XA 2PERA 3R2QA 1H4OA 1K3YA 4N0ZA 4E8EA 2K8SA 1XVWA 3TUEA 1E6BA 4NHZA 2LEGA 2ZCTA 1EGOA 3W6GA 1WJKA 3FKFA 1FAAA 3FZ5A 3J7Yk 1BEDA 4ECJA 1GSDA 4PNFA 3MWHA 3ZLPA 2OACA 4EE0A 4TRXA 2OE3A 2C3NA 2DIZA 1QGVA 3HDCA 1R4WA 3VPTA 3H8QA 3TOUA 4NXIA 3DVWA 1G6WA 4N10A 4OFNA 5J3RA 3A2VA 4WF5A 5IPGA 2OBIA 5GSTA 1LU4A 5A4UA 3RPPA 5ECNB 3GN3A 3Q74A 1YEPA 1VGLA 1XWAA 2TIRA 1AW9A 3F8UA 3TB2A 4GF0A 2B3SA 5LD0A 2L6CA 1OC9A 3F4TA 1ZL9A 4HUAA 4HZ2A 1U3AA 4KH7A 2WULA 4DSRA 1FHEA 1OC9B 4V1Ag 5D9VA 4LLRA 4EKZA 1E2YA 2V1MA 3GH6A 3LXTA 3VWXA 3ZL5A 5INYA 1A24A 2IWTA 4MPGA 2H6ZA 2VLVA 4X0XA 3DIEA 4KAEA 4TR3A 4YQVA 1XW6A 3HCZA 5DAKB 3GKKA 3L9SA 1PMTA 4WR4A 4OFTA 3QFAC 2HYXA 4MF5A 5IO2A 1ZYQB 5L71A 4QL7A 2I1UA 5ECMB 5E4WA 2EIRA 2H70A 5GAND 5DCGA 3HVSA 1M0UA 1V98A 17GSA 5HQPA 3D4TA 4H86A 3FR3A 2P5QA 2K18A 3H4KA 3LSZA 4O92A 2C80A 4JZQA 1BG5A 3UVHA 1XVQA 2RUFA 2F51A 3TDGA 3IPZA 3DRNA 3RPNA 2OE0A 1IYHA 5G2ZA 4Q5NA 1TRUA 3Q18A 3UBLA 5KEJA 1UC7A 3ZITA 4ZB9A 1M2DA 3ZYWA 2TRCP 1B9XC 4GWRA 2IJYA 1B48A 3KMOA 3IAM2 3VFIA 3BBYA 2L5OA 3H1NA 5B6NA 2VUPA 1XWCA 2I81A 2YJ7A 2X99A 2LV3A 2MMAA 3WT1A 3CXGA 5H5SA 1PQNA 4IJIA 2K8VA 1XW5A 4NMUA 3QAWA 3I6AA 14GSA 1MDIA 2L59A 1YZXA 3GMFA 2GT5A 5ECQB 4PQIA 3G7JA 4JR6A 4PQHA 4ECBA 2NVLA 4ML1A 2MMOA 1ERTA 1WIKA 2BTOT 3FK8A 4GSSA 5D73A 4TXVA 5IQYA 1SL0B 1DE1A 4PURA 2LRTA 3E3EA 4ILFA 1XXUA 5BMUA 4KCEA 3F9UA 1X9WB 2OBKA 3UBKA 2MBSA 3DXBA 4TN8A 4OWYA 3VI7A 4ML6A 2JSYA 1XWBA 4IBPA 2AYTA 5B8AA 4CHSA 3N5OA 1K0NA 5IMZA 4GLTA 4FH8A 1WP0A 2I4AA 5F06A 3WGEA 5DDLA 3O3TA 2H76A 2C0DA 3EU4A 1N2AA 2LTKA 2A4VA 3BD2A 3OR5A 2HRAA 5LCZA 1K0CA 2OADA 4EUYA 1PL1A 2LSTA 1SD9A 4WETA 4BWQA 3GFKA 5HR2A 2HQTA 3E0UA 3C8EA 4XS6A 4JR4A 4JRRA 1QK8A 3F3RA 4WKWA 4NPBA 4K0NA 2O89A 2C4JA 2V32A 4V1Ap 3QPMA 3P2AA 4Q5RA 4ZBDA 1GNEA 1YDKA 2VL3A 3ZZXA 4X43A 1S3AA 4GSTA 3VWWA 4IGJA 2B1KA 2GQLA 1YKCA 4K6XA 4ECCA 3TJFA 2K6VA 3ZFBA 2HSMA 1ILOA 1X5EA 3HZ8A 5CAXA 3KCMA 4AJ7A 1K0OA 1BYEA 3GSSA 5AN1A 4LMVA 1PL2A 1VF1A 3D6IA 3HJPA 2HSMB 4XHMA 1Z6MA 1I5GA 2RUEA 1UA5A 2PU9C 4G0LA 1W4VA 2G2QA 3HD5A 4EDZA 3RBTA 4NHWA 2C0FA 3ZFLA 2E2GA 2R6KA 6GSWA 1PRXA 3FZ9A 1GNWA 3M9KA 3CTFA 4K2DA 1VRSD 2IMIA 3ERFA 1LBKA 4ULXA 1XZOA 1XBSA 1AC1A 2NTOA 1SK2A 2CAQA 1YQ1A 2H1DA 1WRYA 3GUSA 4POKA 3RHCA 2YWMA 1ZGNA 3MNGA 3KMNA 4I2UA 4POBA 2HRKA 1A8YA 5AISA 3QOUA 3F6DA 3GKXA 2VD1A 2WJUA 1PSQA 1HYUA 2HRKB 3HY2A 2R37A 5G30A 1ZZYA 1GSQA 4IJ3A 6GSUA 3PR8A 3F6FA 2RIIA 5ENUA 2IMEA 2XPEA 2PPTA 2YV9A 1FVKA 1WOUA 4D73A 5FT3A 4HJMA 2XHFA 5EY6A 1AUCA 1WMJA 2J23A 4AF2A 2PVOC 4MJCA 4D73B 10GSA 13GSA 3KP8A 2JADA 4WXTA 3PPUA 5JWQB 5ECLB 1A23A 2WZ9A 1MDKA 2QC7A 1XIYA 11GSA 2FCHA 4WBJA 1GL8A 4O5RA 4POLA 5KN3A 1G6YA 2LJRA 2ZNMA 2WDUA 2LQQA 4F0CA 2FD3A 3BCKA 1QMVA 3Q6OA 3PH9A 3FRCA 1ON4A 4MJAA 1Z7RA 1A8LA 2H19A 4TR1B 4X1UA 2VD0A 1T3BA 1V9WA 2X64A 1ERUA 1ABAA 1OAZA 2JL4A 1M99A 4HQSA 1FOVA 3GL3A 4YAVA 2GGTA 2VOCA 4ZXGA 5CNWA 16GSA 1EV9A 2LJAA 5C00A 4RUVA 2HRNA 4ZBBA 1O73A 5DQYA 4YQMA 4K9ZA 5F05A 2PUKC 5B8BA 4CW9A 2REMA 3TRPA 4PX1A 4PUAA 1M7TA 5ELGA 4GSNA 4KNDA 4WR5A 3TOTA 3KP9A 4MK3A 4HOJA 5J41A 2X8HA 4WF4A 5B6MA 2AHEA 4F9ZA 3RDWA 5IOXA 1EOHA 1K0BA 5AGYA 1K0MA 4QQ7A 4J56E 4JEDA 5EVOA 2XBQA 2HT9A 4AJ6A 1C72A 4MJEA 3TRQA 2OE1A 3TKQA 2CVBA 1A2MA 1VF4A 1BAYA
chains in the Genus database with same CATH superfamily
4HDEA 5KN1A 4AKGA 3O76A 5HR0A 4ZL8A 1YY7A 1PX6A 1YEXA 2N5BA 4G0KA 2IPAA 1OVNA 4MF6A 3HVNA 4USSA 2HSYA 2KLXA 4K8MA 1AXDA 1SK1A 2YCDA 5D9XA 1TRSA 3WGDA 1VF3A 4G10A 1MDJA 2FY6A 2LUSA 2AJQB 1GULA 2X8CA 4RI7A 2FHEA 2L5LA 3QFBC 3U5RE 4QL9A 4I5QA 1HNCA 4KDUA 3L78A 22GSA 2C0EA 1SL2B 2YWOA 1F2EA 1GTUA 3EINA 3PGTA 4RI6A 4E68A 2VIMA 1EP7A 3P90A 3EWLA 3HJMA 2GT6A 2GSTA 2DLXA 4TOPA 3RAZA 1SKRB 1GTBA 1WWJA 3Q19A 2EC4A 3GL5A 4J57E 3FHKA 2BJXA 5HFIA 1TI1A 2IMDA 20GSA 4OCFA 4POMA 3WYWA 1V40A 4L0UA 4OFMA 2HFDA 4TR4A 3LJRA 2WW3A 1MD4A 1R7HA 3QCPA 4MZCA 2CV4A 2LNTA 1X9SB 3CTGA 4DVCA 2CZ3A 3TJBA 3C1RA 1ZYPA 1OE8A 3L9UA 2UV8G 2A2PA 1AQWA 3UL3A 3QMXA 8GSSA 3IHGA 5H5RA 1M9AA 1KTEA 2QGVA 4Q5QA 1SKSB 1F6MC 4PXOA 1EGRA 3SBCA 2V6OA 5C04A 2LRNA 3IV4A 3ZMLA 2XBIA 3RHBA 3GA4A 1U3IA 2AV4A 2F9SA 3TRXA 5DCHA 3EMXA 6GSSA 3ME8A 4HU9A 3A2WA 1BX9A 2C0GA 2O85A 2M46A 4AKIA 1XOBA 18GSA 1OYJA 3SWLA 1PFOA 3W8JA 3RFRC 5ELAA 3HVXA 4WEYA 2CA8A 2YN1A 1OC8A 3KTBA 1O8WA 1TP9A 2M80A 2CVKA 1V58A 1TK0B 2FLSA 3DD3A 2YNXA 1AQVA 2EIOA 2LJKA 2DJ2A 3HMJG 3VWUA 1TK5B 1FB6A 4XRDA 2GSRA 2HSNA 3EMPA 5CRDA 1XOAA 1SYRA 2G0FA 2HSHA 1V57A 4OD7A 4KF9A 2VLTA 2HSNB 4QMKA 3QD9A 1FG4A 3G7IA 5G1LA 1SYXA 2B1LA 3UVTA 2H1BA 2L4CA 3ZIJA 1U6TA 1G0TA 1SU9A 3IR4A 1K3OA 1F9MA 3I43A 3G7YA 3FYGA 1VF2A 3WD6A 4KUNA 4BVXA 2NBSA 3N9JA 3GTUA 4KSOA 2RM5A 5G5FA 4WBRD 2L6DA 3LXZA 3D21A 4BVXB 2VCXA 4AKXB 4RQRA 4FXYP 4CY8A 3C1SA 2O36A 2OKAA 4KSMA 3GTUB 1O7UA 3APOA 2IN3A 2NDOA 3UOMA 1ST9A 2IMFA 2MMNA 1DBYA 2YOIA 3GH9A 3H79A 3A2XA 1FVJA 4EO3A 1G7OA 5IPHA 2DMLA 2Z9SA 1NHOA 1QQ2A 3GRXA 4FYBA 3ZRDA 1S3DA 2OT3A 5J9BA 4DEJA 3QR6A 12GSA 1JZOA 4FQUA 1HNAA 4YH2A 1X5DA 4N30A 4O32A 1I9DA 3IC4A 4MPFA 1MTCA 3MDKA 1WE0A 4TXOA 2E7PA 1AQXA 2LQOA 1V2AA 1TU8A 3BOAA 3J7Yb 3HA9A 1S3RA 3ZVJD 5AIXA 2ALBA 2WZSA 4TXOB 4O5QA 5D96A 4YQUA 2I9HA 1TI3A 2F8AA 5E59A 2VAFA 3HYPA 1B9YC 6GSVA 3KTLA 5ECSA 1QFNA 1TRVA 4IP6A 4V2LA 1USBA 4LMWA 5DJMA 3GX0A 1FO5A 2FNOA 1YVLA 2C8UA 2CAIA 3ISOA 2CZ2A 2KP1A 4PUFC 3IE3A 1J08A 2GZYA 1HQOA 4PTSA 4ID0A 3M9JA 1JZWA 1YKAA 3TGZA 2LNSA 1CQGA 4OO4A 4HJ2A 2LRCA 2QKEA 1SVOA 4PI2C 3UAPA 3M3MA 3UMAA 1TKDB 4G2EA 1NSWA 1SKWB 4YAPA 5J4VA 2DSAA 1NW2A 1EP8A 1GLQA 1S3CA 3KIJA 2H1AA 5EL8A 2KUCA 2JACA 5HFKA 2YP6A 2GVPA 3TKPA 1PN0A 2H0HA 1B4PA 2GDRA 3IBHA 4L5LA 3LFLA 2EFHA 4G01A 1A0FA 3VWVA 1GSEA 4MMMA 3FZ4A 1Z9HA 3C73A 3GX8A 3US3A 2B7KA 5ECKB 4RQXA 2PBJA 1F3BA 5CREA 1YJ6A 2A2RA 3D0ZA 1HNBA 1THOA 1K0DA 2H0GA 2H8LA 3HZ4A 5A5KA 2H30A 2IIYA 1QUWA 3I69A 2GTUA 3M8NA 4EVMA 3FW2A 2PMTA 5D9TA 2HRFA 4ECIA 3CBUA 3FR6A 2HNLA 1GLPA 1XWKA 4N0VA 1XCCA 2GSQA 3GYKA 4BWSA 3VLNA 1M9BA 4CDOA 2H74A 3GKNA 4IHUA 2HLSA 2TRXA 4L0WA 4IP1A 2B5EA 4ICYA 2LS5A 1GH2A 1TU7A 5F0GA 2AB6A 1NM3A 2GZZA 1TW9A 4MH2A 1T4ZA 1Y25A 4OMVA 1T7PB 4GRFA 1OC3A 1Z6NA 2J9HA 1R26A 2NPBA 4MLYA 2V2GA 3VI5A 2I3YA 1GSFA 1JFUA 4I6XA 4IS0A 1M2BA 1BF5A 1Z7PA 2PN8A 3KZQA 2KOKA 4ZL9A 5IIZA 4ZILA 3BCIA 4MZBA 2FA4A 4MDCA 3KD0A 1KNGA 1ZMAA 1PX7A 4IQ1A 4I2TA 3EURA 1PD21 1W89A 1TDIA 3ERGA 1XWGA 1IYIA 1Y1UA 5BRTA 1GSUA 1T00A 5J5NA 5B7CA 3F4RA 1SL1B 4TVEA 5ABRA 2YWNA 1N8JA 3IXRA 3JCML 1GTIA 2KHPA 2FWGA 4Z2UA 2ZUPA 3HHVA 2M72A 1FB0A 4GQCA 3LGCA 3GURA 2MBTA 5G31A 2D2ZA 5ID2A 3ME7A 3ZIVA 3KM6A 2DJKA 3HXSA 4TW5A 1GWCA 5H5QA 1EEJA 1JLVA 5IMDA 5ID2B 1R5PA 4IN0A 4ZB8A 1PA3A 2VLUA 3F63A 1U87A 4KA0A 5DQSA 2JZSA 2AAWA 5EPFA 1U88A 2DJ0A 4BL7A 3DMLA 5D8IA 3DEXA 2FA8A 1PKWA 3UEMA 3QAVA 2QSIA 1ML6A 4BL7B 3ZTLA 2IFQA 1AAZA 5ECRB 3G9BA 5DBQA 2CT6A 4AJ8A 4KDXA 1JHBA 4ISDA 4FYUA 2IFQB 4K1FA 1K3LA 3F4SA 2K9FA 4I97A 4MH3A 3A5IA 3NZNA 2FWHA 3EVIA 5HFGA 3CMIA 2JSZA 5JCGA 4MABA 2FWEA 1LJRA 4XS1A 3EC3A 4PQ1A 2VKZG 1RQMA 3DVXA 2DIYA 4OCEA 1SD8A 5KN0A 2WB9A 4HS1A 4L5OA 3MSZA 5JCWA 4JU5A 3IK7A 4K7IA 5F07A 2HI7A 3W8SA 5IOWA 2B5XA 1OKTA 5ECIB 1KBNA 2DMMA 2O7KA 6GSTA 3LQ7A 1ZYEA 2DJ1A 2V6KA 1XW9A 4K5SA 2WCIA 1XFLA 4MJBA 3TKSA 3M0FA 4GQFA 3LW9A 3ZVJA 1EEMA 5CYYA 5A34A 5IO0A 1XPVA 3LORA 1CQHA 2P31A 3L4NA 4N3ZA 4F03A 3S9FA 5CP1A 3VK9A 2IMKA 1DUGA 3ZREA 3FR9A 2X8GA 3NOFA 6GSYA 3F3QA 1GSSA 5GZZB 2VM1A 1GTAA 2DJJA 1A2JA 4KE3A 1YF0A 4O7HA 2JU5A 1JZDA 2O8VB 1BJXA 3CSIA 2DBCA 4PNGA 2VCWA 2RLIA 2O5VA 5DAKA 2N5AA 2RM6A 4K5RA 5IM9A 3ZMKA 1URMA 3DGQA 1T1VA 4N11A 2E0QA 3P7XA 1O81A 3KH9A 4TR0A 2R5GA 2AUVA 3TKRA 4LL1B 4EC0A 2XC2A 1RW1A 1OKDA 4MZWA 2YWIA 5KOXA 4GXZA 1AIUA 4BIKA 5JWRB 3ERWA 1Q4JA 4K7OA 2DC5A 3NIVA 1SJ6A 4MNNA 3IA1A 5GAPD 2H6XA 1GUKA 3CRUA 1SJZA 5KN2A 2H66A 3GSTA 7GSSA 1ERWA 3TKSE 1J9BA 4XCSA 1OE7A 3DYRA 1T4YA 3IDVA 1F37A 3V1WA 4OO5A 3IK9A 2ES7A 1H75A 4Q5FA 4HI7A 2CVDA 4G0IA 2LKUA 1DE2A 5A4VA 1TK8B 2JZRA 3L9VA 3TJKA 4IVFA 2HXKA 3TJJA 1ZCPA 2WW1A 4V2MA 2HE3A 4Z2RA 2H1GA 3FZAA 2EIQA 5J40A 2BMXA 2FUG2 4EXJA 5DALA 2MMZA 1O6JA 2VL2A 4DSQA 4DSSA 5JCUA 4NAXA 5DALB 4ZIJA 3M1GA 2CQ9A 4DSSB 4W66A 2DKIA 3F0IA 1UVZA 4F82A 2B6MA 3WT2A 3APQA 2CX4A 2R4VA 4BVYA 4HEA2 2YZUA 3HJOA 4XS4A 2A4HA 3KEBA 4ZL7A 3D5JA 2FGXA 2C1YA 4BA7A 2H73A 2WVYA 4XIHA 4BVYB 4PI0C 4XS4B 3CSJA 5CRHA 3QDNA 5J9CA 2CX3A 1G7EA 4JE1A 1GUMA 2X49A 2VCTA 1WPIA 3VURA 4IW9A 1M2AA 4KGIA 5ECPB 2PVQA 2H01A 3GHAA 5FHIA 4PHZC 3LEFA 6GSXA 4XRAA 4LA1A 1A0RP 5D93A 1EWXA 4NWYA 1Y6EA 4K7NA 4GCIA 3DKSA 1MD3A 2DKHA 2XPDA 5G5EA 5COHA 5IMVA 3TCOA 2H6YA 2H72A 3RGBC 2GQMA 4FYCA 2GS3A 3TKSC 3GKMA 4V2NA 5F8BA 2P0GA 3LYKA 2H75A 1B8XA 1TXXA 2WVXA 3ED3A 4X4JA 1THXA 1SVMA 5ECHB 2L4QA 3U6VA 2H71A 2WVXB 1PKZA 4GTUA 1X5CA 4MA9A 1EZKA 1X0RA 4K0GA 3GV1A 4ZB6A 3R3EA 2R0CA 5JWOB 4G19A 5J4UA 3LWAA 4KB3A 9GSSA 2EFCA 1PN9A 1Q98A 1EOGA 4FIWA 1M3JA 1NHYA 2MZCA 4Z2TA 1J0FA 2VCQA 1GP1A 4I8BA 5IMFA 1X9MB 3CSHA 4EL1A 4LL4B 3D4MA 1O8XA 1ERVA 3APSA 2ON5A 2WW0A 4HU7A 2GSSA 2R2JA 4EF0A 2F3MA 5HR1A 1Z5YE 5KOWA 2WS2A 2OJLA 4A5PA 1O85A 2B7JA 3A3TA 3O6TA 3QAGA 2KP2A 3EU3A 3IHQA 4MCUA 2QA1A 1GSYA 5HR3A 2OA7A 3L0HA 3AY8A 4IELA 2YZHA 1R5AA 3CYNA 3EE2A 1T8EB 3IAS2 5CRWA 1QXHA 3PINA 5D9WA 2O87A 4HZ4A 1ACVA 3WGXA 4CY6A 2F8FA 2FWFA 2PGTA 1KEBA 3MAKA 4NV5A 2H1LA 4XTSA 1ZOFA 3FEUA 4ZBAA 3D22A 5A4WA 3TU3B 3KJYA 1Z3EA 4KW6A 1EV4A 1HD2A 3IOSA 3E9JB 4E8HA 2P5RA 1BQ7A 2WFCA 3HVVA 3UARA 4KX4A 3IRAA 1GRXA 1K0AA 1JLWA 3HKRA 2C3QA 4HQZA 2VL2C 3DWVA 4NV2A 2GLRA 2YPMA 2C3TA 2UZ8A 3LYPA 2A2SA 3KXOA 4L8EA 2VCZA 1RK4A 5GSSA 3TJGA 1A2LA 3EYTA 3KGKA 5DJLA 2HZEA 4ACSA 1FW1A 5CRGA 4J2FA 2JZTA 4IKHA 4MP4A 2HZEB 5AIVA 2VL9A 1TRWA 1PGTA 3A5WA 3C71A 2VCVA 2HZFA 3GNJA 4P3YB 4K2XA 1GUHA 2VO4A 1TJDA 5IMAA 2PWJA 1SJIA 4TR1A 1TTZA 2L57A 3CRTA 1YF1A 4IQAA 5FWGA 1JZRA 4Z7XA 1F3AA 4BPYA 2MYGA 19GSA 1SENA 2B5YA 4JBBA 2GZPA 2YANA 2WRTA 4TKYA 3GIXA 5LNKe 1UN2A 3UJ1A 3LG6A 2V41A 1ZYNA 4FO5A 5G1KA 2IL3A 3C7MA 4F2IA 3H93A 3BJ5A 1SK0A 2DJ3A 2WGRA 2VM2A 4F0BA 2GQKA 3FY7A 3P8WA 2YJHA 2ON7A 4EDYA 4PGTA 1MEKA 3IC8A 3KH7A 4MF7A 4AGSA 1TOFA 2H0IA 3K8NA 2YV7A 5ECOB 4G9HA 2E2MA 3I9V2 5IMCA 1SVLA 4KCAA 4EIPA 1DSBA 4KDYA 3VPQA 1B4QA 5CO3A 3UIWA 3MIXA 5DVBA 2N5FA 2R3XA 2WVZA 1I1IP 2PERA 3R2QA 1H4OA 1K3YA 1YEWC 4N0ZA 4E8EA 2O3EA 2K8SA 1XVWA 3TUEA 1E6BA 4NHZA 2LEGA 2ZCTA 1EGOA 3W6GA 1WJKA 1N25A 3FKFA 1FAAA 3FZ5A 1FOHA 3J7Yk 1BEDA 4ECJA 1GSDA 3CWGA 4PNFA 3MWHA 3ZLPA 2OACA 4EE0A 3EPTA 4TRXA 2OE3A 2C3NA 2DIZA 1QGVA 3HDCA 1R4WA 3VPTA 3H8QA 3TOUA 5J4YA 4NXIA 3DVWA 1G6WA 4N10A 4EIQA 4OFNA 5J3RA 3A2VA 4WF5A 5IPGA 2OBIA 5GSTA 1LU4A 5A4UA 3RPPA 3MYDA 5ECNB 3GN3A 3Q74A 1YEPA 1VGLA 1XWAA 2TIRA 1AW9A 3F8UA 3TB2A 4GF0A 2B3SA 5LD0A 2L6CA 1OC9A 3F4TA 1ZL9A 4HUAA 4HZ2A 5A34B 1U3AA 4KH7A 2WULA 4DSRA 1FHEA 1OC9B 4V1Ag 5D9VA 4LLRA 4EKZA 1E2YA 2V1MA 3GH6A 3CQFA 3LXTA 3VWXA 3ZL5A 5INYA 1A24A 2IWTA 4MPGA 2H6ZA 2VLVA 4X0XA 3DIEA 3FMWA 4KAEA 4TR3A 4YQVA 1XW6A 3HCZA 5DAKB 3GKKA 3L9SA 1PMTA 4WR4A 4OFTA 3QFAC 2HYXA 4MF5A 5IO2A 1ZYQB 5L71A 4QL7A 2I1UA 5ECMB 5E4WA 2EIRA 2H70A 5GAND 5DCGA 3HVSA 1M0UA 1V98A 17GSA 5HQPA 3D4TA 4H86A 3FR3A 2P5QA 2K18A 3H4KA 3LSZA 4O92A 2C80A 4JZQA 1BG5A 3UVHA 1XVQA 2RUFA 2F51A 3TDGA 3IPZA 3DRNA 3RPNA 2OE0A 1IYHA 5G2ZA 4Q5NA 1TRUA 2R0GA 3Q18A 3UBLA 5KEJA 1UC7A 3ZITA 4ZB9A 1M2DA 3ZYWA 2TRCP 1B9XC 4GWRA 2IJYA 1B48A 3KMOA 3IAM2 3VFIA 3BBYA 2L5OA 3H1NA 5B6NA 2VUPA 1XWCA 2I81A 2YJ7A 2X99A 2LV3A 2MMAA 3WT1A 3CXGA 5H5SA 1PQNA 4IJIA 2K8VA 1XW5A 4NMUA 3QAWA 1M3IA 3I6AA 14GSA 1MDIA 2L59A 1YZXA 3GMFA 2GT5A 5ECQB 4PQIA 3G7JA 4JR6A 4PQHA 4ECBA 2NVLA 4ML1A 2MMOA 1ERTA 1WIKA 2BTOT 3FK8A 4GSSA 5D73A 4TXVA 5IQYA 1SL0B 1DE1A 4PURA 2LRTA 3E3EA 4ILFA 1XXUA 5BMUA 4KCEA 3F9UA 1X9WB 2OBKA 3UBKA 2EFDA 2MBSA 1XG8A 5A1NA 3DXBA 4TN8A 4OWYA 3VI7A 4ML6A 5BMUB 2JSYA 1XWBA 4IBPA 2AYTA 1TXUA 5B8AA 4CHSA 3N5OA 5A1NB 1K0NA 5IMZA 4GLTA 4FH8A 1WP0A 2I4AA 5F06A 3WGEA 5DDLA 4O5UA 3O3TA 2H76A 2C0DA 3EU4A 1N2AA 2LTKA 2A4VA 3BD2A 3OR5A 2HRAA 5LCZA 1K0CA 2OADA 4EUYA 1PL1A 2LSTA 1SD9A 4WETA 4BWQA 3GFKA 5HR2A 2HQTA 5A5HA 3E0UA 3C8EA 4XS6A 4JR4A 4JRRA 1QK8A 3F3RA 5A5HB 4WKWA 4NPBA 4K0NA 2O89A 2C4JA 2V32A 4V1Ap 3QPMA 3P2AA 4Q5RA 4ZBDA 1GNEA 1YDKA 2X4AA 2VL3A 3ZZXA 4X43A 1S3AA 4GSTA 3VWWA 4ZB7A 4IGJA 2B1KA 2GQLA 1YKCA 4K6XA 4ECCA 3TJFA 2K6VA 3ZFBA 2HSMA 1ILOA 1X5EA 3HZ8A 5CAXA 4YKFA 3KCMA 4AJ7A 1K0OA 1BYEA 3GSSA 5AN1A 4LMVA 1PL2A 1VF1A 3D6IA 3HJPA 2HSMB 4XHMA 1Z6MA 1I5GA 2RUEA 1UA5A 2PU9C 4G0LA 1W4VA 2G2QA 3HD5A 4EDZA 3RBTA 4NHWA 2C0FA 3ZFLA 2E2GA 2R6KA 6GSWA 1PRXA 3FZ9A 1GNWA 3M9KA 3CTFA 4K2DA 1VRSD 2IMIA 3ERFA 1LBKA 4ULXA 1XZOA 1XBSA 1AC1A 2NTOA 1SK2A 2CAQA 1YQ1A 2H1DA 1WRYA 3GUSA 4POKA 3RHCA 2YWMA 1ZGNA 3MNGA 3KMNA 4I2UA 4POBA 2HRKA 1A8YA 5AISA 3QOUA 3F6DA 3GKXA 2VD1A 2WJUA 1PSQA 1HYUA 2HRKB 3HY2A 2R37A 5G30A 1ZZYA 1GSQA 4IJ3A 6GSUA 3PR8A 3F6FA 2RIIA 5ENUA 2IMEA 2XPEA 2PPTA 2YV9A 1FVKA 1WOUA 4D73A 5FT3A 4HJMA 2XHFA 5EY6A 1AUCA 1WMJA 2J23A 4AF2A 2PVOC 4MJCA 4D73B 10GSA 13GSA 3KP8A 4AI6A 2JADA 4WXTA 1S4BP 3PPUA 5JWQB 5ECLB 1A23A 2WZ9A 1MDKA 2QC7A 2WW2A 1XIYA 11GSA 2FCHA 4WBJA 1GL8A 4O5RA 4POLA 5KN3A 1BG1A 1G6YA 2LJRA 2ZNMA 2WDUA 2QA2A 2LQQA 4F0CA 2FD3A 4AKHA 3BCKA 1QMVA 3Q6OA 3PH9A 3FRCA 1ON4A 4MJAA 1Z7RA 1A8LA 4HSCX 2H19A 4TR1B 4X1UA 2VD0A 1T3BA 1V9WA 3CHXC 2X64A 1ERUA 1ABAA 1OAZA 2JL4A 1M99A 4HQSA 1FOVA 3GL3A 4YAVA 2GGTA 2VOCA 4ZXGA 5CNWA 16GSA 1EV9A 2LJAA 5C00A 4RUVA 2HRNA 2R0PA 4ZBBA 1O73A 5DQYA 4YQMA 4K9ZA 5F05A 2PUKC 5B8BA 4CW9A 2REMA 3TRPA 4PX1A 4PUAA 1M7TA 5ELGA 4GSNA 4KNDA 4WR5A 3TOTA 3KP9A 4YKGA 4MK3A 4HOJA 5J41A 2X8HA 4WF4A 5B6MA 2AHEA 5J47A 4F9ZA 3RDWA 5IOXA 1EOHA 1K0BA 5AGYA 1K0MA 4QQ7A 4J56E 4JEDA 5EVOA 2XBQA 2HT9A 4AJ6A 1C72A 2EFEA 4MJEA 3TRQA 2OE1A 3TKQA 2CVBA 1A2MA 1VF4A 4GDFA 1BAYA
chains in the Genus database with same CATH topology
4HDEA 5KN1A 4AKGA 3O76A 5HR0A 4ZL8A 1YY7A 1PX6A 1YEXA 2N5BA 4G0KA 2IPAA 1OVNA 4MF6A 4USSA 2HSYA 2KLXA 4K8MA 1AXDA 1SK1A 2YCDA 5D9XA 1TRSA 3WGDA 1VF3A 4G10A 1MDJA 2FY6A 2LUSA 2AJQB 1GULA 2X8CA 4RI7A 2FHEA 2L5LA 3QFBC 3U5RE 4QL9A 4I5QA 1HNCA 4KDUA 3L78A 22GSA 2C0EA 1SL2B 2YWOA 1F2EA 1GTUA 3EINA 3PGTA 4RI6A 4E68A 2VIMA 1EP7A 3P90A 3EWLA 3HJMA 2GT6A 2GSTA 2DLXA 4TOPA 3RAZA 1SKRB 1GTBA 1WWJA 3Q19A 2EC4A 3GL5A 4J57E 3FHKA 2BJXA 5HFIA 1TI1A 2IMDA 20GSA 4OCFA 4POMA 3WYWA 1V40A 4L0UA 4OFMA 2HFDA 4TR4A 3LJRA 1MD4A 1R7HA 3QCPA 4MZCA 2CV4A 2LNTA 1X9SB 3CTGA 4DVCA 2CZ3A 3TJBA 3C1RA 1ZYPA 1OE8A 3L9UA 2UV8G 2A2PA 1AQWA 3UL3A 3QMXA 8GSSA 3IHGA 5H5RA 1M9AA 1KTEA 2QGVA 4Q5QA 1SKSB 1F6MC 4PXOA 1EGRA 3SBCA 2V6OA 5C04A 2LRNA 3IV4A 3ZMLA 2XBIA 3RHBA 3GA4A 1U3IA 2AV4A 2F9SA 3TRXA 5DCHA 3EMXA 6GSSA 3ME8A 4HU9A 3A2WA 1BX9A 2C0GA 2O85A 2M46A 4AKIA 1XOBA 18GSA 1OYJA 3SWLA 3W8JA 5ELAA 3HVXA 4WEYA 2CA8A 2YN1A 1OC8A 3KTBA 1O8WA 1TP9A 2M80A 2CVKA 1V58A 1TK0B 2FLSA 3DD3A 2YNXA 1AQVA 2EIOA 2LJKA 2DJ2A 3HMJG 3VWUA 1TK5B 1FB6A 4XRDA 2GSRA 2HSNA 3EMPA 5CRDA 1XOAA 1SYRA 2G0FA 2HSHA 1V57A 4OD7A 4KF9A 2VLTA 2HSNB 4QMKA 3QD9A 1FG4A 3G7IA 5G1LA 1SYXA 2B1LA 3UVTA 2H1BA 2L4CA 3ZIJA 1U6TA 1G0TA 1SU9A 3IR4A 1K3OA 1F9MA 3I43A 3G7YA 3FYGA 1VF2A 3WD6A 4KUNA 4BVXA 2NBSA 3N9JA 3GTUA 4KSOA 2RM5A 5G5FA 4WBRD 2L6DA 3LXZA 3D21A 4BVXB 2VCXA 4AKXB 4RQRA 4CY8A 3C1SA 2OKAA 4KSMA 3GTUB 1O7UA 3APOA 2IN3A 2NDOA 3UOMA 1ST9A 2IMFA 2MMNA 1DBYA 2YOIA 3GH9A 3H79A 3A2XA 1FVJA 4EO3A 1G7OA 5IPHA 2DMLA 2Z9SA 1NHOA 1QQ2A 3GRXA 4FYBA 3ZRDA 1S3DA 2OT3A 5J9BA 4DEJA 3QR6A 12GSA 1JZOA 4FQUA 1HNAA 4YH2A 1X5DA 4N30A 4O32A 1I9DA 3IC4A 4MPFA 1MTCA 3MDKA 1WE0A 4TXOA 2E7PA 1AQXA 2LQOA 1V2AA 1TU8A 3BOAA 3J7Yb 3HA9A 3ZVJD 5AIXA 2ALBA 4TXOB 4O5QA 5D96A 4YQUA 2I9HA 1TI3A 2F8AA 5E59A 2VAFA 3HYPA 1B9YC 6GSVA 3KTLA 5ECSA 1QFNA 1TRVA 4IP6A 4V2LA 1USBA 4LMWA 5DJMA 3GX0A 1FO5A 2FNOA 1YVLA 2C8UA 2CAIA 3ISOA 2CZ2A 2KP1A 4PUFC 3IE3A 1J08A 2GZYA 1HQOA 4PTSA 4ID0A 3M9JA 1JZWA 1YKAA 3TGZA 2LNSA 1CQGA 4OO4A 4HJ2A 2LRCA 2QKEA 1SVOA 3UAPA 3M3MA 3UMAA 1TKDB 4G2EA 1NSWA 1SKWB 4YAPA 5J4VA 2DSAA 1NW2A 1EP8A 1GLQA 1S3CA 3KIJA 2H1AA 5EL8A 2KUCA 2JACA 5HFKA 2YP6A 2GVPA 3TKPA 1PN0A 2H0HA 1B4PA 2GDRA 3IBHA 4L5LA 3LFLA 2EFHA 4G01A 1A0FA 3VWVA 1GSEA 4MMMA 3FZ4A 1Z9HA 3C73A 3GX8A 3US3A 2B7KA 5ECKB 4RQXA 2PBJA 1F3BA 5CREA 1YJ6A 2A2RA 3D0ZA 1HNBA 1THOA 1K0DA 2H0GA 2H8LA 3HZ4A 5A5KA 2H30A 2IIYA 1QUWA 3I69A 2GTUA 3M8NA 4EVMA 3FW2A 2PMTA 5D9TA 2HRFA 4ECIA 3CBUA 3FR6A 2HNLA 1GLPA 1XWKA 4N0VA 1XCCA 2GSQA 3GYKA 4BWSA 3VLNA 1M9BA 4CDOA 2H74A 3GKNA 4IHUA 2HLSA 2TRXA 4L0WA 4IP1A 2B5EA 4ICYA 2LS5A 1GH2A 1TU7A 5F0GA 2AB6A 1NM3A 2GZZA 1TW9A 4MH2A 1T4ZA 1Y25A 4OMVA 1T7PB 4GRFA 1OC3A 1Z6NA 2J9HA 1R26A 2NPBA 4MLYA 2V2GA 3VI5A 2I3YA 1GSFA 1JFUA 4I6XA 4IS0A 1M2BA 1BF5A 1Z7PA 2PN8A 3KZQA 2KOKA 4ZL9A 5IIZA 4ZILA 3BCIA 4MZBA 2FA4A 4MDCA 3KD0A 1KNGA 1ZMAA 1PX7A 4IQ1A 4I2TA 3EURA 1PD21 1W89A 1TDIA 3ERGA 1XWGA 1IYIA 1Y1UA 5BRTA 1GSUA 1T00A 5J5NA 5B7CA 3F4RA 1SL1B 4TVEA 5ABRA 2YWNA 1N8JA 3IXRA 3JCML 1GTIA 2KHPA 2FWGA 4Z2UA 2ZUPA 3HHVA 2M72A 1FB0A 4GQCA 3LGCA 3GURA 2MBTA 5G31A 2D2ZA 5ID2A 3ME7A 3ZIVA 3KM6A 2DJKA 3HXSA 4TW5A 1GWCA 5H5QA 1EEJA 1JLVA 5IMDA 5ID2B 1R5PA 4IN0A 4ZB8A 1PA3A 2VLUA 3F63A 1U87A 4KA0A 5DQSA 2JZSA 2AAWA 5EPFA 1U88A 2DJ0A 4BL7A 3DMLA 5D8IA 3DEXA 2FA8A 1PKWA 3UEMA 3QAVA 2QSIA 1ML6A 4BL7B 3ZTLA 2IFQA 1AAZA 5ECRB 3G9BA 5DBQA 2CT6A 4AJ8A 4KDXA 1JHBA 4ISDA 4FYUA 2IFQB 4K1FA 1K3LA 3F4SA 2K9FA 4I97A 4MH3A 3A5IA 3NZNA 2FWHA 3EVIA 5HFGA 3CMIA 2JSZA 5JCGA 4MABA 2FWEA 1LJRA 4XS1A 3EC3A 4PQ1A 2VKZG 1RQMA 3DVXA 2DIYA 4OCEA 1SD8A 5KN0A 2WB9A 4HS1A 4L5OA 3MSZA 5JCWA 4JU5A 3IK7A 4K7IA 5F07A 2HI7A 3W8SA 5IOWA 2B5XA 1OKTA 5ECIB 1KBNA 2DMMA 2O7KA 6GSTA 3LQ7A 1ZYEA 2DJ1A 2V6KA 1XW9A 4K5SA 2WCIA 1XFLA 4MJBA 3TKSA 3M0FA 4GQFA 3LW9A 3ZVJA 1EEMA 5CYYA 5A34A 5IO0A 1XPVA 3LORA 1CQHA 2P31A 3L4NA 4N3ZA 4F03A 3S9FA 5CP1A 3VK9A 2IMKA 1DUGA 3ZREA 3FR9A 2X8GA 3NOFA 6GSYA 3F3QA 1GSSA 5GZZB 2VM1A 1GTAA 2DJJA 1A2JA 4KE3A 1YF0A 4O7HA 2JU5A 1JZDA 2O8VB 1BJXA 3CSIA 2DBCA 4PNGA 2VCWA 2RLIA 2O5VA 5DAKA 2N5AA 2RM6A 4K5RA 5IM9A 3ZMKA 1URMA 3DGQA 1T1VA 4N11A 2E0QA 3P7XA 1O81A 3KH9A 4TR0A 2R5GA 2AUVA 3TKRA 4LL1B 4EC0A 2XC2A 1RW1A 1OKDA 4MZWA 2YWIA 5KOXA 4GXZA 1AIUA 5JWRB 3ERWA 1Q4JA 4K7OA 2DC5A 3NIVA 1SJ6A 4MNNA 3IA1A 5GAPD 2H6XA 1GUKA 3CRUA 1SJZA 5KN2A 2H66A 3GSTA 7GSSA 1ERWA 3TKSE 1J9BA 4XCSA 1OE7A 3DYRA 1T4YA 3IDVA 1F37A 3V1WA 4OO5A 3IK9A 2ES7A 1H75A 4Q5FA 4HI7A 2CVDA 4G0IA 2LKUA 1DE2A 5A4VA 1TK8B 2JZRA 3L9VA 3TJKA 4IVFA 2HXKA 3TJJA 1ZCPA 4V2MA 2HE3A 4Z2RA 2H1GA 3FZAA 2EIQA 5J40A 2BMXA 2FUG2 4EXJA 5DALA 2MMZA 1O6JA 2VL2A 4DSQA 4DSSA 5JCUA 4NAXA 5DALB 4ZIJA 3M1GA 2CQ9A 4DSSB 4W66A 2DKIA 3F0IA 1UVZA 4F82A 2B6MA 3WT2A 3APQA 2CX4A 2R4VA 4BVYA 4HEA2 2YZUA 3HJOA 4XS4A 2A4HA 3KEBA 4ZL7A 3D5JA 2FGXA 2C1YA 4BA7A 2H73A 4XIHA 4BVYB 4XS4B 3CSJA 5CRHA 3QDNA 5J9CA 2CX3A 1G7EA 4JE1A 1GUMA 2X49A 2VCTA 1WPIA 3VURA 4IW9A 1M2AA 4KGIA 5ECPB 2PVQA 2H01A 3GHAA 5FHIA 3LEFA 6GSXA 4XRAA 4LA1A 1A0RP 5D93A 1EWXA 4NWYA 1Y6EA 4K7NA 4GCIA 3DKSA 1MD3A 2DKHA 2XPDA 5G5EA 5COHA 5IMVA 3TCOA 2H6YA 2H72A 2GQMA 4FYCA 2GS3A 3TKSC 3GKMA 4V2NA 5F8BA 2P0GA 3LYKA 2H75A 1B8XA 1TXXA 3ED3A 4X4JA 1THXA 1SVMA 5ECHB 2L4QA 3U6VA 2H71A 1PKZA 4GTUA 1X5CA 4MA9A 1EZKA 1X0RA 4K0GA 3GV1A 4ZB6A 3R3EA 2R0CA 5JWOB 4G19A 5J4UA 3LWAA 4KB3A 9GSSA 2EFCA 1PN9A 1Q98A 1EOGA 4FIWA 2MZCA 1NHYA 4Z2TA 1J0FA 2VCQA 1GP1A 4I8BA 5IMFA 1X9MB 3CSHA 4EL1A 4LL4B 3D4MA 1O8XA 1ERVA 3APSA 2ON5A 4HU7A 2GSSA 2R2JA 4EF0A 2F3MA 5HR1A 1Z5YE 5KOWA 2WS2A 2OJLA 4A5PA 1O85A 2B7JA 3A3TA 3O6TA 3QAGA 2KP2A 3EU3A 3IHQA 4MCUA 2QA1A 1GSYA 5HR3A 2OA7A 3L0HA 3AY8A 4IELA 2YZHA 1R5AA 3CYNA 3EE2A 1T8EB 3IAS2 5CRWA 1QXHA 3PINA 5D9WA 2O87A 4HZ4A 1ACVA 3WGXA 4CY6A 2F8FA 2FWFA 2PGTA 1KEBA 3MAKA 4NV5A 2H1LA 4XTSA 1ZOFA 3FEUA 4ZBAA 3D22A 5A4WA 3TU3B 3KJYA 1Z3EA 4KW6A 1EV4A 1HD2A 3IOSA 3E9JB 4E8HA 2P5RA 1BQ7A 2WFCA 3HVVA 3UARA 4KX4A 3IRAA 1GRXA 1K0AA 1JLWA 3HKRA 2C3QA 4HQZA 2VL2C 3DWVA 4NV2A 2GLRA 2YPMA 2C3TA 2UZ8A 3LYPA 2A2SA 3KXOA 4L8EA 2VCZA 1RK4A 5GSSA 3TJGA 1A2LA 3EYTA 3KGKA 5DJLA 2HZEA 4ACSA 1FW1A 5CRGA 4J2FA 2JZTA 4IKHA 4MP4A 2HZEB 5AIVA 2VL9A 1TRWA 1PGTA 3A5WA 3C71A 2VCVA 2HZFA 3GNJA 4P3YB 4K2XA 1GUHA 2VO4A 1TJDA 5IMAA 2PWJA 1SJIA 4TR1A 1TTZA 2L57A 3CRTA 1YF1A 4IQAA 5FWGA 1JZRA 4Z7XA 1F3AA 4BPYA 2MYGA 19GSA 1SENA 2B5YA 4JBBA 2GZPA 2YANA 2WRTA 4TKYA 3GIXA 5LNKe 1UN2A 3UJ1A 3LG6A 2V41A 1ZYNA 4FO5A 5G1KA 2IL3A 3C7MA 4F2IA 3H93A 3BJ5A 1SK0A 2DJ3A 2WGRA 2VM2A 4F0BA 2GQKA 3FY7A 3P8WA 2YJHA 2ON7A 4EDYA 4PGTA 1MEKA 3IC8A 3KH7A 4MF7A 4AGSA 1TOFA 2H0IA 3K8NA 2YV7A 5ECOB 4G9HA 2E2MA 3I9V2 5IMCA 1SVLA 4KCAA 4EIPA 1DSBA 4KDYA 3VPQA 1B4QA 5CO3A 3UIWA 3MIXA 5DVBA 2N5FA 2R3XA 2PERA 3R2QA 1H4OA 1K3YA 4N0ZA 4E8EA 2K8SA 1XVWA 3TUEA 1E6BA 4NHZA 2LEGA 2ZCTA 1EGOA 3W6GA 1WJKA 1N25A 3FKFA 1FAAA 3FZ5A 1FOHA 3J7Yk 1BEDA 4ECJA 1GSDA 3CWGA 4PNFA 3MWHA 3ZLPA 2OACA 4EE0A 3EPTA 4TRXA 2OE3A 2C3NA 2DIZA 1QGVA 3HDCA 1R4WA 3VPTA 3H8QA 3TOUA 5J4YA 4NXIA 3DVWA 1G6WA 4N10A 4EIQA 4OFNA 5J3RA 3A2VA 4WF5A 5IPGA 2OBIA 5GSTA 1LU4A 5A4UA 3RPPA 3MYDA 5ECNB 3GN3A 3Q74A 1YEPA 1VGLA 1XWAA 2TIRA 1AW9A 3F8UA 3TB2A 4GF0A 2B3SA 5LD0A 2L6CA 1OC9A 3F4TA 1ZL9A 4HUAA 4HZ2A 5A34B 1U3AA 4KH7A 2WULA 4DSRA 1FHEA 1OC9B 4V1Ag 5D9VA 4LLRA 4EKZA 1E2YA 2V1MA 3GH6A 3LXTA 3VWXA 3ZL5A 5INYA 1A24A 2IWTA 4MPGA 2H6ZA 2VLVA 4X0XA 3DIEA 3FMWA 4KAEA 4TR3A 4YQVA 1XW6A 3HCZA 5DAKB 3GKKA 3L9SA 1PMTA 4WR4A 4OFTA 3QFAC 2HYXA 4MF5A 5IO2A 1ZYQB 5L71A 4QL7A 2I1UA 5ECMB 5E4WA 2EIRA 2H70A 5GAND 5DCGA 3HVSA 1M0UA 1V98A 17GSA 5HQPA 3D4TA 4H86A 3FR3A 2P5QA 2K18A 3H4KA 3LSZA 4O92A 2C80A 4JZQA 1BG5A 3UVHA 1XVQA 2RUFA 2F51A 3TDGA 3IPZA 3DRNA 3RPNA 2OE0A 1IYHA 5G2ZA 4Q5NA 1TRUA 2R0GA 3Q18A 3UBLA 5KEJA 1UC7A 3ZITA 4ZB9A 1M2DA 3ZYWA 2TRCP 1B9XC 4GWRA 2IJYA 1B48A 3KMOA 3IAM2 3VFIA 3BBYA 2L5OA 3H1NA 5B6NA 2VUPA 1XWCA 2I81A 2YJ7A 2X99A 2LV3A 2MMAA 3WT1A 3CXGA 5H5SA 1PQNA 4IJIA 2K8VA 1XW5A 4NMUA 3QAWA 3I6AA 14GSA 1MDIA 2L59A 1YZXA 3GMFA 2GT5A 5ECQB 4PQIA 3G7JA 4JR6A 4PQHA 4ECBA 2NVLA 4ML1A 2MMOA 1ERTA 1WIKA 2BTOT 3FK8A 4GSSA 5D73A 4TXVA 5IQYA 1SL0B 1DE1A 4PURA 2LRTA 3E3EA 4ILFA 1XXUA 5BMUA 4KCEA 3F9UA 1X9WB 2OBKA 3UBKA 2EFDA 2MBSA 5A1NA 3DXBA 4TN8A 4OWYA 3VI7A 4ML6A 5BMUB 2JSYA 1XWBA 4IBPA 2AYTA 1TXUA 5B8AA 4CHSA 3N5OA 5A1NB 1K0NA 5IMZA 4GLTA 4FH8A 1WP0A 2I4AA 5F06A 3WGEA 5DDLA 4O5UA 3O3TA 2H76A 2C0DA 3EU4A 1N2AA 2LTKA 2A4VA 3BD2A 3OR5A 2HRAA 5LCZA 1K0CA 2OADA 4EUYA 1PL1A 2LSTA 1SD9A 4WETA 4BWQA 3GFKA 5HR2A 2HQTA 5A5HA 3E0UA 3C8EA 4XS6A 4JR4A 4JRRA 1QK8A 3F3RA 5A5HB 4WKWA 4NPBA 4K0NA 2O89A 2C4JA 2V32A 4V1Ap 3QPMA 3P2AA 4Q5RA 4ZBDA 1GNEA 1YDKA 2X4AA 2VL3A 3ZZXA 4X43A 1S3AA 4GSTA 3VWWA 4ZB7A 4IGJA 2B1KA 2GQLA 1YKCA 4K6XA 4ECCA 3TJFA 2K6VA 3ZFBA 2HSMA 1ILOA 1X5EA 3HZ8A 5CAXA 4YKFA 3KCMA 4AJ7A 1K0OA 1BYEA 3GSSA 5AN1A 4LMVA 1PL2A 1VF1A 3D6IA 3HJPA 2HSMB 4XHMA 1Z6MA 1I5GA 2RUEA 1UA5A 2PU9C 4G0LA 1W4VA 2G2QA 3HD5A 4EDZA 3RBTA 4NHWA 2C0FA 3ZFLA 2E2GA 2R6KA 6GSWA 1PRXA 3FZ9A 1GNWA 3M9KA 3CTFA 4K2DA 1VRSD 2IMIA 3ERFA 1LBKA 4ULXA 1XZOA 1XBSA 1AC1A 2NTOA 1SK2A 2CAQA 1YQ1A 2H1DA 1WRYA 3GUSA 4POKA 3RHCA 2YWMA 1ZGNA 3MNGA 3KMNA 4I2UA 4POBA 2HRKA 1A8YA 5AISA 3QOUA 3F6DA 3GKXA 2VD1A 2WJUA 1PSQA 1HYUA 2HRKB 3HY2A 2R37A 5G30A 1ZZYA 1GSQA 4IJ3A 6GSUA 3PR8A 3F6FA 2RIIA 5ENUA 2IMEA 2XPEA 2PPTA 2YV9A 1FVKA 1WOUA 4D73A 5FT3A 4HJMA 2XHFA 5EY6A 1AUCA 1WMJA 2J23A 4AF2A 2PVOC 4MJCA 4D73B 10GSA 13GSA 3KP8A 4AI6A 2JADA 4WXTA 3PPUA 5JWQB 5ECLB 1A23A 2WZ9A 1MDKA 2QC7A 1XIYA 11GSA 2FCHA 4WBJA 1GL8A 4O5RA 4POLA 5KN3A 1BG1A 1G6YA 2LJRA 2ZNMA 2WDUA 2QA2A 2LQQA 4F0CA 2FD3A 4AKHA 3BCKA 1QMVA 3Q6OA 3PH9A 3FRCA 1ON4A 4MJAA 1Z7RA 1A8LA 2H19A 4TR1B 4X1UA 2VD0A 1T3BA 1V9WA 2X64A 1ERUA 1ABAA 1OAZA 2JL4A 1M99A 4HQSA 1FOVA 3GL3A 4YAVA 2GGTA 2VOCA 4ZXGA 5CNWA 16GSA 1EV9A 2LJAA 5C00A 4RUVA 2HRNA 2R0PA 4ZBBA 1O73A 5DQYA 4YQMA 4K9ZA 5F05A 2PUKC 5B8BA 4CW9A 2REMA 3TRPA 4PX1A 4PUAA 1M7TA 5ELGA 4GSNA 4KNDA 4WR5A 3TOTA 3KP9A 4YKGA 4MK3A 4HOJA 5J41A 2X8HA 4WF4A 5B6MA 2AHEA 5J47A 4F9ZA 3RDWA 5IOXA 1EOHA 1K0BA 5AGYA 1K0MA 4QQ7A 4J56E 4JEDA 5EVOA 2XBQA 2HT9A 4AJ6A 1C72A 2EFEA 4MJEA 3TRQA 2OE1A 3TKQA 2CVBA 1A2MA 1VF4A 4GDFA 1BAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDE A;  5KN1 A;  3O76 A;  5HR0 A;  4ZL8 A;  1YY7 A;  1PX6 A;  1YEX A;  2N5B A;  4G0K A;  2IPA A;  1OVN A;  4MF6 A;  4USS A;  2HSY A;  2KLX A;  4K8M A;  1AXD A;  1SK1 A;  2YCD A;  5D9X A;  1TRS A;  3WGD A;  1VF3 A;  4G10 A;  1MDJ A;  2FY6 A;  2LUS A;  2AJQ B;  1GUL A;  2X8C A;  4RI7 A;  2FHE A;  2L5L A;  3QFB C;  3U5R E;  4QL9 A;  4I5Q A;  1HNC A;  4KDU A;  3L78 A;  22GS A;  2C0E A;  1SL2 B;  2YWO A;  1F2E A;  1GTU A;  3EIN A;  3PGT A;  4RI6 A;  2VIM A;  1EP7 A;  3P90 A;  3EWL A;  3HJM A;  2GT6 A;  2GST A;  2DLX A;  4TOP A;  3RAZ A;  1SKR B;  1GTB A;  1WWJ A;  3Q19 A;  2EC4 A;  3GL5 A;  4J57 E;  3FHK A;  2BJX A;  5HFI A;  1TI1 A;  2IMD A;  20GS A;  4OCF A;  4POM A;  3WYW A;  1V40 A;  4L0U A;  4OFM A;  2HFD A;  4TR4 A;  3LJR A;  1MD4 A;  1R7H A;  3QCP A;  4MZC A;  2CV4 A;  2LNT A;  1X9S B;  3CTG A;  4DVC A;  2CZ3 A;  3TJB A;  3C1R A;  1OE8 A;  3L9U A;  1AQW A;  3UL3 A;  3QMX A;  8GSS A;  5H5R A;  1M9A A;  1KTE A;  2QGV A;  4Q5Q A;  1SKS B;  1F6M C;  4PXO A;  1EGR A;  3SBC A;  2V6O A;  5C04 A;  2LRN A;  3IV4 A;  3ZML A;  2XBI A;  3RHB A;  3GA4 A;  1U3I A;  2AV4 A;  2F9S A;  3TRX A;  5DCH A;  3EMX A;  6GSS A;  3ME8 A;  4HU9 A;  3A2W A;  1BX9 A;  2C0G A;  2O85 A;  2M46 A;  1XOB A;  18GS A;  1OYJ A;  3SWL A;  3W8J A;  5ELA A;  3HVX A;  4WEY A;  2CA8 A;  2YN1 A;  1OC8 A;  3KTB A;  1O8W A;  1TP9 A;  2M80 A;  2CVK A;  1V58 A;  1TK0 B;  2FLS A;  3DD3 A;  2YNX A;  1AQV A;  2EIO A;  2LJK A;  2DJ2 A;  3VWU A;  1TK5 B;  1FB6 A;  4XRD A;  2GSR A;  3EMP A;  5CRD A;  1XOA A;  1SYR A;  2G0F A;  2HSH A;  1V57 A;  4OD7 A;  4KF9 A;  2VLT A;  2HSN B;  3QD9 A;  1FG4 A;  3G7I A;  5G1L A;  1SYX A;  2B1L A;  3UVT A;  2H1B A;  2L4C A;  3ZIJ A;  1U6T A;  1G0T A;  1SU9 A;  3IR4 A;  1K3O A;  1F9M A;  3I43 A;  3G7Y A;  3FYG A;  1VF2 A;  3WD6 A;  4KUN A;  4BVX A;  2NBS A;  3N9J A;  3GTU A;  4KSO A;  2RM5 A;  5G5F A;  4WBR D;  2L6D A;  3LXZ A;  3D21 A;  4BVX B;  2VCX A;  4RQR A;  3C1S A;  2OKA A;  4KSM A;  3GTU B;  1O7U A;  3APO A;  2IN3 A;  2NDO A;  3UOM A;  1ST9 A;  2IMF A;  2MMN A;  1DBY A;  2YOI A;  3GH9 A;  3H79 A;  3A2X A;  1FVJ A;  4EO3 A;  1G7O A;  5IPH A;  2DML A;  2Z9S A;  1NHO A;  1QQ2 A;  3GRX A;  4FYB A;  3ZRD A;  1S3D A;  5J9B A;  4DEJ A;  3QR6 A;  12GS A;  1JZO A;  4FQU A;  1HNA A;  4YH2 A;  1X5D A;  4N30 A;  4O32 A;  1I9D A;  3IC4 A;  4MPF A;  1MTC A;  3MDK A;  1WE0 A;  4TXO A;  2E7P A;  1AQX A;  2LQO A;  1V2A A;  1TU8 A;  3BOA A;  3J7Y b;  3HA9 A;  3ZVJ D;  5AIX A;  2ALB A;  4TXO B;  5D96 A;  4YQU A;  2I9H A;  1TI3 A;  2F8A A;  5E59 A;  2VAF A;  3HYP A;  1B9Y C;  6GSV A;  3KTL A;  5ECS A;  1QFN A;  1TRV A;  4IP6 A;  4V2L A;  1USB A;  4LMW A;  5DJM A;  3GX0 A;  1FO5 A;  2FNO A;  2C8U A;  2CAI A;  3ISO A;  2CZ2 A;  2KP1 A;  4PUF C;  3IE3 A;  1J08 A;  2GZY A;  1HQO A;  4PTS A;  4ID0 A;  3M9J A;  1JZW A;  1YKA A;  3TGZ A;  2LNS A;  1CQG A;  4OO4 A;  4HJ2 A;  2LRC A;  2QKE A;  3UAP A;  3M3M A;  3UMA A;  1TKD B;  4G2E A;  1NSW A;  1SKW B;  4YAP A;  2DSA A;  1NW2 A;  1EP8 A;  1GLQ A;  1S3C A;  3KIJ A;  2H1A A;  5EL8 A;  2KUC A;  2JAC A;  5HFK A;  2YP6 A;  2GVP A;  3TKP A;  2H0H A;  1B4P A;  2GDR A;  3IBH A;  4L5L A;  3LFL A;  1A0F A;  3VWV A;  1GSE A;  4MMM A;  3FZ4 A;  1Z9H A;  3C73 A;  3GX8 A;  3US3 A;  2B7K A;  5ECK B;  4RQX A;  2PBJ A;  1F3B A;  5CRE A;  1YJ6 A;  2A2R A;  3D0Z A;  1HNB A;  1THO A;  1K0D A;  2H0G A;  2H8L A;  3HZ4 A;  5A5K A;  2H30 A;  2IIY A;  1QUW A;  3I69 A;  2GTU A;  3M8N A;  4EVM A;  3FW2 A;  2PMT A;  5D9T A;  2HRF A;  4ECI A;  3CBU A;  3FR6 A;  2HNL A;  1GLP A;  1XWK A;  4N0V A;  1XCC A;  2GSQ A;  3GYK A;  4BWS A;  3VLN A;  1M9B A;  4CDO A;  2H74 A;  3GKN A;  4IHU A;  2HLS A;  2TRX A;  4L0W A;  4IP1 A;  2B5E A;  2LS5 A;  1GH2 A;  1TU7 A;  5F0G A;  2AB6 A;  1NM3 A;  2GZZ A;  1TW9 A;  4MH2 A;  1T4Z A;  1Y25 A;  4OMV A;  1T7P B;  4GRF A;  1OC3 A;  1Z6N A;  2J9H A;  1R26 A;  2NPB A;  4MLY A;  2V2G A;  3VI5 A;  2I3Y A;  1GSF A;  1JFU A;  4I6X A;  4IS0 A;  1M2B A;  2PN8 A;  1Z7P A;  3KZQ A;  2KOK A;  4ZL9 A;  5IIZ A;  4ZIL A;  3BCI A;  4MZB A;  2FA4 A;  4MDC A;  3KD0 A;  1KNG A;  1ZMA A;  1PX7 A;  4IQ1 A;  4I2T A;  3EUR A;  1PD2 1;  1W89 A;  1TDI A;  3ERG A;  1XWG A;  1IYI A;  1GSU A;  1T00 A;  5J5N A;  5B7C A;  3F4R A;  1SL1 B;  4TVE A;  5ABR A;  2YWN A;  1N8J A;  3IXR A;  3JCM L;  1GTI A;  2KHP A;  2FWG A;  2ZUP A;  3HHV A;  2M72 A;  1FB0 A;  4GQC A;  3LGC A;  3GUR A;  2MBT A;  5G31 A;  2D2Z A;  5ID2 A;  3ME7 A;  3ZIV A;  3KM6 A;  2DJK A;  3HXS A;  4TW5 A;  1GWC A;  5H5Q A;  1EEJ A;  1JLV A;  5IMD A;  5ID2 B;  1R5P A;  4IN0 A;  4ZB8 A;  1PA3 A;  2VLU A;  3F63 A;  1U87 A;  4KA0 A;  5DQS A;  2JZS A;  2AAW A;  5EPF A;  1U88 A;  2DJ0 A;  4BL7 A;  3DML A;  5D8I A;  3DEX A;  2FA8 A;  1PKW A;  3UEM A;  3QAV A;  2QSI A;  1ML6 A;  4BL7 B;  3ZTL A;  2IFQ A;  1AAZ A;  5ECR B;  3G9B A;  5DBQ A;  2CT6 A;  4AJ8 A;  4KDX A;  1JHB A;  4ISD A;  4FYU A;  2IFQ B;  4K1F A;  1K3L A;  3F4S A;  2K9F A;  4I97 A;  4MH3 A;  3NZN A;  2FWH A;  3EVI A;  5HFG A;  3CMI A;  2JSZ A;  5JCG A;  4MAB A;  2FWE A;  1LJR A;  4XS1 A;  3EC3 A;  4PQ1 A;  1RQM A;  3DVX A;  2DIY A;  4OCE A;  1SD8 A;  5KN0 A;  2WB9 A;  4HS1 A;  4L5O A;  3MSZ A;  5JCW A;  4JU5 A;  3IK7 A;  4K7I A;  5F07 A;  2HI7 A;  3W8S A;  5IOW A;  2B5X A;  1OKT A;  5ECI B;  1KBN A;  2DMM A;  2O7K A;  6GST A;  3LQ7 A;  1ZYE A;  2DJ1 A;  2V6K A;  1XW9 A;  2WCI A;  1XFL A;  4MJB A;  3TKS A;  3M0F A;  4GQF A;  3ZVJ A;  1EEM A;  5CYY A;  5IO0 A;  1XPV A;  3LOR A;  1CQH A;  2P31 A;  3L4N A;  4F03 A;  3S9F A;  5CP1 A;  3VK9 A;  2IMK A;  1DUG A;  3ZRE A;  3FR9 A;  2X8G A;  3NOF A;  6GSY A;  3F3Q A;  1GSS A;  5GZZ B;  2VM1 A;  1GTA A;  2DJJ A;  1A2J A;  4KE3 A;  1YF0 A;  4O7H A;  2JU5 A;  1JZD A;  2O8V B;  1BJX A;  3CSI A;  2DBC A;  4PNG A;  2VCW A;  2RLI A;  5DAK A;  2N5A A;  2RM6 A;  5IM9 A;  3ZMK A;  1URM A;  3DGQ A;  1T1V A;  4N11 A;  2E0Q A;  3P7X A;  1O81 A;  3KH9 A;  4TR0 A;  2R5G A;  2AUV A;  3TKR A;  4LL1 B;  4EC0 A;  2XC2 A;  1RW1 A;  1OKD A;  4MZW A;  2YWI A;  4GXZ A;  1AIU A;  5JWR B;  3ERW A;  1Q4J A;  4K7O A;  2DC5 A;  3NIV A;  1SJ6 A;  3IA1 A;  5GAP D;  2H6X A;  1GUK A;  3CRU A;  1SJZ A;  5KN2 A;  2H66 A;  3GST A;  7GSS A;  1ERW A;  3TKS E;  1J9B A;  4XCS A;  1OE7 A;  3DYR A;  1T4Y A;  3IDV A;  1F37 A;  3V1W A;  4OO5 A;  3IK9 A;  2ES7 A;  1H75 A;  4Q5F A;  4HI7 A;  2CVD A;  4G0I A;  2LKU A;  1DE2 A;  5A4V A;  1TK8 B;  2JZR A;  3L9V A;  3TJK A;  4IVF A;  2HXK A;  3TJJ A;  1ZCP A;  4V2M A;  2HE3 A;  2H1G A;  3FZA A;  2EIQ A;  2BMX A;  2FUG 2;  4EXJ A;  5DAL A;  2MMZ A;  1O6J A;  2VL2 A;  4DSQ A;  4DSS A;  5JCU A;  4NAX A;  5DAL B;  4ZIJ A;  3M1G A;  2CQ9 A;  4DSS B;  3F0I A;  1UVZ A;  4F82 A;  2B6M A;  3WT2 A;  3APQ A;  2CX4 A;  2R4V A;  4BVY A;  4HEA 2;  2YZU A;  3HJO A;  4XS4 A;  3KEB A;  4ZL7 A;  3D5J A;  2FGX A;  2C1Y A;  4BA7 A;  2H73 A;  4XIH A;  4BVY B;  4XS4 B;  3CSJ A;  5CRH A;  3QDN A;  5J9C A;  2CX3 A;  1G7E A;  4JE1 A;  1GUM A;  2VCT A;  1WPI A;  3VUR A;  4IW9 A;  1M2A A;  4KGI A;  5ECP B;  2PVQ A;  2H01 A;  3GHA A;  5FHI A;  3LEF A;  6GSX A;  4XRA A;  4LA1 A;  1A0R P;  5D93 A;  1EWX A;  4NWY A;  1Y6E A;  4K7N A;  4GCI A;  3DKS A;  1MD3 A;  2XPD A;  5G5E A;  5COH A;  5IMV A;  3TCO A;  2H6Y A;  2H72 A;  2GQM A;  4FYC A;  2GS3 A;  3TKS C;  3GKM A;  4V2N A;  5F8B A;  2P0G A;  3LYK A;  2H75 A;  1B8X A;  1TXX A;  3ED3 A;  1THX A;  5ECH B;  2L4Q A;  3U6V A;  2H71 A;  1PKZ A;  4GTU A;  1X5C A;  4MA9 A;  1EZK A;  1X0R A;  4K0G A;  3GV1 A;  4ZB6 A;  3R3E A;  5JWO B;  4G19 A;  5J4U A;  3LWA A;  4KB3 A;  9GSS A;  1PN9 A;  1Q98 A;  1EOG A;  4FIW A;  2MZC A;  1NHY A;  1J0F A;  2VCQ A;  1GP1 A;  4I8B A;  5IMF A;  1X9M B;  3CSH A;  4EL1 A;  4LL4 B;  3D4M A;  1O8X A;  1ERV A;  3APS A;  2ON5 A;  4HU7 A;  2GSS A;  2R2J A;  4EF0 A;  2F3M A;  5HR1 A;  1Z5Y E;  2WS2 A;  2OJL A;  1O85 A;  2B7J A;  3A3T A;  3O6T A;  3QAG A;  2KP2 A;  3EU3 A;  3IHQ A;  4MCU A;  1GSY A;  5HR3 A;  2OA7 A;  3L0H A;  3AY8 A;  4IEL A;  2YZH A;  1R5A A;  3CYN A;  3EE2 A;  1T8E B;  3IAS 2;  5CRW A;  1QXH A;  3PIN A;  5D9W A;  2O87 A;  4HZ4 A;  1ACV A;  3WGX A;  2F8F A;  2FWF A;  2PGT A;  1KEB A;  3MAK A;  4NV5 A;  4XTS A;  1ZOF A;  3FEU A;  4ZBA A;  3D22 A;  5A4W A;  3KJY A;  1Z3E A;  4KW6 A;  1EV4 A;  1HD2 A;  3IOS A;  3E9J B;  4E8H A;  2P5R A;  1BQ7 A;  2WFC A;  3HVV A;  3UAR A;  4KX4 A;  3IRA A;  1GRX A;  1K0A A;  1JLW A;  3HKR A;  2C3Q A;  4HQZ A;  2VL2 C;  3DWV A;  4NV2 A;  2GLR A;  2YPM A;  2C3T A;  2UZ8 A;  3LYP A;  2A2S A;  3KXO A;  4L8E A;  2VCZ A;  1RK4 A;  5GSS A;  3TJG A;  1A2L A;  3EYT A;  3KGK A;  5DJL A;  2HZE A;  4ACS A;  1FW1 A;  5CRG A;  4J2F A;  2JZT A;  4IKH A;  4MP4 A;  2HZE B;  5AIV A;  2VL9 A;  1TRW A;  1PGT A;  3A5W A;  3C71 A;  2VCV A;  2HZF A;  3GNJ A;  4P3Y B;  1GUH A;  2VO4 A;  1TJD A;  5IMA A;  2PWJ A;  1SJI A;  4TR1 A;  1TTZ A;  2L57 A;  3CRT A;  1YF1 A;  4IQA A;  5FWG A;  1JZR A;  4Z7X A;  1F3A A;  4BPY A;  2MYG A;  19GS A;  1SEN A;  2B5Y A;  4JBB A;  2GZP A;  2YAN A;  2WRT A;  4TKY A;  3GIX A;  5LNK e;  1UN2 A;  3UJ1 A;  3LG6 A;  2V41 A;  4FO5 A;  5G1K A;  2IL3 A;  3C7M A;  4F2I A;  3H93 A;  3BJ5 A;  1SK0 A;  2DJ3 A;  2WGR A;  2VM2 A;  4F0B A;  2GQK A;  3FY7 A;  3P8W A;  2YJH A;  2ON7 A;  4EDY A;  4PGT A;  1MEK A;  3IC8 A;  3KH7 A;  4MF7 A;  4AGS A;  1TOF A;  2H0I A;  3K8N A;  2YV7 A;  5ECO B;  4G9H A;  2E2M A;  3I9V 2;  5IMC A;  4KCA A;  1DSB A;  4KDY A;  3VPQ A;  1B4Q A;  5CO3 A;  3UIW A;  5DVB A;  2N5F A;  2R3X A;  2PER A;  3R2Q A;  1H4O A;  1K3Y A;  4N0Z A;  4E8E A;  2K8S A;  1XVW A;  3TUE A;  1E6B A;  4NHZ A;  2LEG A;  2ZCT A;  1EGO A;  3W6G A;  1WJK A;  3FKF A;  1FAA A;  3FZ5 A;  3J7Y k;  1BED A;  4ECJ A;  1GSD A;  4PNF A;  3MWH A;  3ZLP A;  2OAC A;  4EE0 A;  4TRX A;  2OE3 A;  2C3N A;  2DIZ A;  1QGV A;  3HDC A;  1R4W A;  3VPT A;  3H8Q A;  3TOU A;  4NXI A;  3DVW A;  1G6W A;  4N10 A;  4OFN A;  5J3R A;  3A2V A;  4WF5 A;  5IPG A;  2OBI A;  5GST A;  1LU4 A;  5A4U A;  3RPP A;  5ECN B;  3GN3 A;  3Q74 A;  1YEP A;  1VGL A;  1XWA A;  2TIR A;  1AW9 A;  3F8U A;  3TB2 A;  4GF0 A;  2B3S A;  5LD0 A;  2L6C A;  1OC9 A;  3F4T A;  1ZL9 A;  4HUA A;  4HZ2 A;  1U3A A;  4KH7 A;  2WUL A;  4DSR A;  1FHE A;  1OC9 B;  4V1A g;  5D9V A;  4LLR A;  4EKZ A;  1E2Y A;  2V1M A;  3GH6 A;  3LXT A;  3VWX A;  3ZL5 A;  5INY A;  1A24 A;  2IWT A;  4MPG A;  2H6Z A;  2VLV A;  4X0X A;  3DIE A;  4KAE A;  4TR3 A;  4YQV A;  1XW6 A;  3HCZ A;  5DAK B;  3GKK A;  3L9S A;  1PMT A;  4WR4 A;  4OFT A;  3QFA C;  2HYX A;  4MF5 A;  5IO2 A;  1ZYQ B;  5L71 A;  4QL7 A;  2I1U A;  5ECM B;  5E4W A;  2EIR A;  2H70 A;  5GAN D;  5DCG A;  3HVS A;  1M0U A;  1V98 A;  17GS A;  5HQP A;  3D4T A;  4H86 A;  3FR3 A;  2P5Q A;  2K18 A;  3H4K A;  3LSZ A;  4O92 A;  2C80 A;  4JZQ A;  1BG5 A;  3UVH A;  1XVQ A;  2RUF A;  2F51 A;  3TDG A;  3IPZ A;  3DRN A;  3RPN A;  2OE0 A;  1IYH A;  5G2Z A;  4Q5N A;  1TRU A;  3Q18 A;  3UBL A;  5KEJ A;  1UC7 A;  3ZIT A;  4ZB9 A;  1M2D A;  3ZYW A;  2TRC P;  1B9X C;  4GWR A;  2IJY A;  1B48 A;  3KMO A;  3IAM 2;  3VFI A;  3BBY A;  2L5O A;  3H1N A;  5B6N A;  2VUP A;  1XWC A;  2I81 A;  2YJ7 A;  2X99 A;  2LV3 A;  2MMA A;  3WT1 A;  3CXG A;  5H5S A;  1PQN A;  4IJI A;  2K8V A;  1XW5 A;  4NMU A;  3QAW A;  3I6A A;  14GS A;  1MDI A;  2L59 A;  1YZX A;  3GMF A;  2GT5 A;  5ECQ B;  4PQI A;  3G7J A;  4JR6 A;  4PQH A;  4ECB A;  2NVL A;  4ML1 A;  2MMO A;  1ERT A;  1WIK A;  2BTO T;  3FK8 A;  4GSS A;  5D73 A;  4TXV A;  5IQY A;  1SL0 B;  1DE1 A;  4PUR A;  2LRT A;  3E3E A;  4ILF A;  1XXU A;  5BMU A;  4KCE A;  3F9U A;  1X9W B;  2OBK A;  3UBK A;  2MBS A;  3DXB A;  4TN8 A;  4OWY A;  3VI7 A;  4ML6 A;  2JSY A;  1XWB A;  4IBP A;  2AYT A;  5B8A A;  4CHS A;  3N5O A;  1K0N A;  5IMZ A;  4GLT A;  4FH8 A;  1WP0 A;  2I4A A;  5F06 A;  3WGE A;  5DDL A;  3O3T A;  2H76 A;  2C0D A;  3EU4 A;  1N2A A;  2LTK A;  2A4V A;  3BD2 A;  3OR5 A;  2HRA A;  5LCZ A;  1K0C A;  2OAD A;  4EUY A;  1PL1 A;  2LST A;  1SD9 A;  4WET A;  4BWQ A;  3GFK A;  5HR2 A;  2HQT A;  3E0U A;  3C8E A;  4XS6 A;  4JR4 A;  4JRR A;  1QK8 A;  3F3R A;  4WKW A;  4NPB A;  4K0N A;  2O89 A;  2C4J A;  2V32 A;  4V1A p;  3QPM A;  3P2A A;  4Q5R A;  4ZBD A;  1GNE A;  1YDK A;  2VL3 A;  3ZZX A;  4X43 A;  1S3A A;  4GST A;  3VWW A;  4IGJ A;  2B1K A;  2GQL A;  1YKC A;  4K6X A;  4ECC A;  3TJF A;  2K6V A;  3ZFB A;  2HSM A;  1ILO A;  1X5E A;  3HZ8 A;  5CAX A;  3KCM A;  4AJ7 A;  1K0O A;  1BYE A;  3GSS A;  5AN1 A;  4LMV A;  1PL2 A;  1VF1 A;  3D6I A;  3HJP A;  2HSM B;  4XHM A;  1Z6M A;  1I5G A;  2RUE A;  1UA5 A;  2PU9 C;  4G0L A;  1W4V A;  2G2Q A;  3HD5 A;  4EDZ A;  3RBT A;  4NHW A;  2C0F A;  3ZFL A;  2E2G A;  2R6K A;  6GSW A;  1PRX A;  3FZ9 A;  1GNW A;  3M9K A;  3CTF A;  4K2D A;  1VRS D;  2IMI A;  3ERF A;  1LBK A;  4ULX A;  1XZO A;  1XBS A;  1AC1 A;  2NTO A;  1SK2 A;  2CAQ A;  1YQ1 A;  2H1D A;  1WRY A;  3GUS A;  4POK A;  3RHC A;  2YWM A;  1ZGN A;  3MNG A;  3KMN A;  4I2U A;  4POB A;  2HRK A;  1A8Y A;  5AIS A;  3QOU A;  3F6D A;  3GKX A;  2VD1 A;  2WJU A;  1PSQ A;  1HYU A;  2HRK B;  3HY2 A;  2R37 A;  5G30 A;  1ZZY A;  1GSQ A;  4IJ3 A;  6GSU A;  3PR8 A;  3F6F A;  2RII A;  5ENU A;  2IME A;  2XPE A;  2PPT A;  2YV9 A;  1FVK A;  1WOU A;  4D73 A;  5FT3 A;  4HJM A;  2XHF A;  5EY6 A;  1AUC A;  1WMJ A;  2J23 A;  4AF2 A;  2PVO C;  4MJC A;  4D73 B;  10GS A;  13GS A;  3KP8 A;  2JAD A;  4WXT A;  3PPU A;  5JWQ B;  5ECL B;  1A23 A;  2WZ9 A;  1MDK A;  2QC7 A;  1XIY A;  11GS A;  2FCH A;  4WBJ A;  1GL8 A;  4O5R A;  4POL A;  5KN3 A;  1G6Y A;  2LJR A;  2ZNM A;  2WDU A;  2LQQ A;  4F0C A;  2FD3 A;  3BCK A;  1QMV A;  3Q6O A;  3PH9 A;  3FRC A;  1ON4 A;  4MJA A;  1Z7R A;  1A8L A;  2H19 A;  4TR1 B;  4X1U A;  2VD0 A;  1T3B A;  1V9W A;  2X64 A;  1ERU A;  1ABA A;  1OAZ A;  2JL4 A;  1M99 A;  4HQS A;  1FOV A;  3GL3 A;  4YAV A;  2GGT A;  2VOC A;  4ZXG A;  5CNW A;  16GS A;  1EV9 A;  2LJA A;  5C00 A;  4RUV A;  2HRN A;  4ZBB A;  1O73 A;  5DQY A;  4YQM A;  4K9Z A;  5F05 A;  2PUK C;  5B8B A;  4CW9 A;  2REM A;  3TRP A;  4PX1 A;  4PUA A;  1M7T A;  5ELG A;  4GSN A;  4KND A;  4WR5 A;  3TOT A;  3KP9 A;  4MK3 A;  4HOJ A;  5J41 A;  2X8H A;  4WF4 A;  5B6M A;  2AHE A;  4F9Z A;  3RDW A;  5IOX A;  1EOH A;  1K0B A;  5AGY A;  1K0M A;  4QQ7 A;  4J56 E;  4JED A;  5EVO A;  2XBQ A;  2HT9 A;  4AJ6 A;  1C72 A;  4MJE A;  3TRQ A;  2OE1 A;  3TKQ A;  2CVB A;  1A2M A;  1VF4 A;  1BAY A; 
#chains in the Genus database with same CATH topology
 4HDE A;  5KN1 A;  4AKG A;  3O76 A;  5HR0 A;  4ZL8 A;  1YY7 A;  1PX6 A;  1YEX A;  2N5B A;  4G0K A;  2IPA A;  1OVN A;  4MF6 A;  3HVN A;  4USS A;  2HSY A;  2KLX A;  4K8M A;  1AXD A;  1SK1 A;  2YCD A;  5D9X A;  1TRS A;  3WGD A;  1VF3 A;  4G10 A;  1MDJ A;  2FY6 A;  2LUS A;  2AJQ B;  1GUL A;  2X8C A;  4RI7 A;  2FHE A;  2L5L A;  3QFB C;  3U5R E;  4QL9 A;  4I5Q A;  1HNC A;  4KDU A;  3L78 A;  22GS A;  2C0E A;  1SL2 B;  2YWO A;  1F2E A;  1GTU A;  3EIN A;  3PGT A;  4RI6 A;  4E68 A;  2VIM A;  1EP7 A;  3P90 A;  3EWL A;  3HJM A;  2GT6 A;  2GST A;  2DLX A;  4TOP A;  3RAZ A;  1SKR B;  1GTB A;  1WWJ A;  3Q19 A;  2EC4 A;  3GL5 A;  4J57 E;  3FHK A;  2BJX A;  5HFI A;  1TI1 A;  2IMD A;  20GS A;  4OCF A;  4POM A;  3WYW A;  1V40 A;  4L0U A;  4OFM A;  2HFD A;  4TR4 A;  3LJR A;  2WW3 A;  1MD4 A;  1R7H A;  3QCP A;  4MZC A;  2CV4 A;  2LNT A;  1X9S B;  3CTG A;  4DVC A;  2CZ3 A;  3TJB A;  3C1R A;  1ZYP A;  1OE8 A;  3L9U A;  2UV8 G;  2A2P A;  1AQW A;  3UL3 A;  3QMX A;  8GSS A;  3IHG A;  5H5R A;  1M9A A;  1KTE A;  2QGV A;  4Q5Q A;  1SKS B;  1F6M C;  4PXO A;  1EGR A;  3SBC A;  2V6O A;  5C04 A;  2LRN A;  3IV4 A;  3ZML A;  2XBI A;  3RHB A;  3GA4 A;  1U3I A;  2AV4 A;  2F9S A;  3TRX A;  5DCH A;  3EMX A;  6GSS A;  3ME8 A;  4HU9 A;  3A2W A;  1BX9 A;  2C0G A;  2O85 A;  2M46 A;  4AKI A;  1XOB A;  18GS A;  1OYJ A;  3SWL A;  1PFO A;  3W8J A;  3RFR C;  5ELA A;  3HVX A;  4WEY A;  2CA8 A;  2YN1 A;  1OC8 A;  3KTB A;  1O8W A;  1TP9 A;  2M80 A;  2CVK A;  1V58 A;  1TK0 B;  2FLS A;  3DD3 A;  2YNX A;  1AQV A;  2EIO A;  2LJK A;  2DJ2 A;  3HMJ G;  3VWU A;  1TK5 B;  1FB6 A;  4XRD A;  2GSR A;  2HSN A;  3EMP A;  5CRD A;  1XOA A;  1SYR A;  2G0F A;  2HSH A;  1V57 A;  4OD7 A;  4KF9 A;  2VLT A;  2HSN B;  4QMK A;  3QD9 A;  1FG4 A;  3G7I A;  5G1L A;  1SYX A;  2B1L A;  3UVT A;  2H1B A;  2L4C A;  3ZIJ A;  1U6T A;  1G0T A;  1SU9 A;  3IR4 A;  1K3O A;  1F9M A;  3I43 A;  3G7Y A;  3FYG A;  1VF2 A;  3WD6 A;  4KUN A;  4BVX A;  2NBS A;  3N9J A;  3GTU A;  4KSO A;  2RM5 A;  5G5F A;  4WBR D;  2L6D A;  3LXZ A;  3D21 A;  4BVX B;  2VCX A;  4AKX B;  4RQR A;  4FXY P;  4CY8 A;  3C1S A;  2O36 A;  2OKA A;  4KSM A;  3GTU B;  1O7U A;  3APO A;  2IN3 A;  2NDO A;  3UOM A;  1ST9 A;  2IMF A;  2MMN A;  1DBY A;  2YOI A;  3GH9 A;  3H79 A;  3A2X A;  1FVJ A;  4EO3 A;  1G7O A;  5IPH A;  2DML A;  2Z9S A;  1NHO A;  1QQ2 A;  3GRX A;  4FYB A;  3ZRD A;  1S3D A;  2OT3 A;  5J9B A;  4DEJ A;  3QR6 A;  12GS A;  1JZO A;  4FQU A;  1HNA A;  4YH2 A;  1X5D A;  4N30 A;  4O32 A;  1I9D A;  3IC4 A;  4MPF A;  1MTC A;  3MDK A;  1WE0 A;  4TXO A;  2E7P A;  1AQX A;  2LQO A;  1V2A A;  1TU8 A;  3BOA A;  3J7Y b;  3HA9 A;  1S3R A;  3ZVJ D;  5AIX A;  2ALB A;  2WZS A;  4TXO B;  4O5Q A;  5D96 A;  4YQU A;  2I9H A;  1TI3 A;  2F8A A;  5E59 A;  2VAF A;  3HYP A;  1B9Y C;  6GSV A;  3KTL A;  5ECS A;  1QFN A;  1TRV A;  4IP6 A;  4V2L A;  1USB A;  4LMW A;  5DJM A;  3GX0 A;  1FO5 A;  2FNO A;  1YVL A;  2C8U A;  2CAI A;  3ISO A;  2CZ2 A;  2KP1 A;  4PUF C;  3IE3 A;  1J08 A;  2GZY A;  1HQO A;  4PTS A;  4ID0 A;  3M9J A;  1JZW A;  1YKA A;  3TGZ A;  2LNS A;  1CQG A;  4OO4 A;  4HJ2 A;  2LRC A;  2QKE A;  1SVO A;  4PI2 C;  3UAP A;  3M3M A;  3UMA A;  1TKD B;  4G2E A;  1NSW A;  1SKW B;  4YAP A;  5J4V A;  2DSA A;  1NW2 A;  1EP8 A;  1GLQ A;  1S3C A;  3KIJ A;  2H1A A;  5EL8 A;  2KUC A;  2JAC A;  5HFK A;  2YP6 A;  2GVP A;  3TKP A;  1PN0 A;  2H0H A;  1B4P A;  2GDR A;  3IBH A;  4L5L A;  3LFL A;  2EFH A;  4G01 A;  1A0F A;  3VWV A;  1GSE A;  4MMM A;  3FZ4 A;  1Z9H A;  3C73 A;  3GX8 A;  3US3 A;  2B7K A;  5ECK B;  4RQX A;  2PBJ A;  1F3B A;  5CRE A;  1YJ6 A;  2A2R A;  3D0Z A;  1HNB A;  1THO A;  1K0D A;  2H0G A;  2H8L A;  3HZ4 A;  5A5K A;  2H30 A;  2IIY A;  1QUW A;  3I69 A;  2GTU A;  3M8N A;  4EVM A;  3FW2 A;  2PMT A;  5D9T A;  2HRF A;  4ECI A;  3CBU A;  3FR6 A;  2HNL A;  1GLP A;  1XWK A;  4N0V A;  1XCC A;  2GSQ A;  3GYK A;  4BWS A;  3VLN A;  1M9B A;  4CDO A;  2H74 A;  3GKN A;  4IHU A;  2HLS A;  2TRX A;  4L0W A;  4IP1 A;  2B5E A;  4ICY A;  2LS5 A;  1GH2 A;  1TU7 A;  5F0G A;  2AB6 A;  1NM3 A;  2GZZ A;  1TW9 A;  4MH2 A;  1T4Z A;  1Y25 A;  4OMV A;  1T7P B;  4GRF A;  1OC3 A;  1Z6N A;  2J9H A;  1R26 A;  2NPB A;  4MLY A;  2V2G A;  3VI5 A;  2I3Y A;  1GSF A;  1JFU A;  4I6X A;  4IS0 A;  1M2B A;  1BF5 A;  1Z7P A;  2PN8 A;  3KZQ A;  2KOK A;  4ZL9 A;  5IIZ A;  4ZIL A;  3BCI A;  4MZB A;  2FA4 A;  4MDC A;  3KD0 A;  1KNG A;  1ZMA A;  1PX7 A;  4IQ1 A;  4I2T A;  3EUR A;  1PD2 1;  1W89 A;  1TDI A;  3ERG A;  1XWG A;  1IYI A;  1Y1U A;  5BRT A;  1GSU A;  1T00 A;  5J5N A;  5B7C A;  3F4R A;  1SL1 B;  4TVE A;  5ABR A;  2YWN A;  1N8J A;  3IXR A;  3JCM L;  1GTI A;  2KHP A;  2FWG A;  4Z2U A;  2ZUP A;  3HHV A;  2M72 A;  1FB0 A;  4GQC A;  3LGC A;  3GUR A;  2MBT A;  5G31 A;  2D2Z A;  5ID2 A;  3ME7 A;  3ZIV A;  3KM6 A;  2DJK A;  3HXS A;  4TW5 A;  1GWC A;  5H5Q A;  1EEJ A;  1JLV A;  5IMD A;  5ID2 B;  1R5P A;  4IN0 A;  4ZB8 A;  1PA3 A;  2VLU A;  3F63 A;  1U87 A;  4KA0 A;  5DQS A;  2JZS A;  2AAW A;  5EPF A;  1U88 A;  2DJ0 A;  4BL7 A;  3DML A;  5D8I A;  3DEX A;  2FA8 A;  1PKW A;  3UEM A;  3QAV A;  2QSI A;  1ML6 A;  4BL7 B;  3ZTL A;  2IFQ A;  1AAZ A;  5ECR B;  3G9B A;  5DBQ A;  2CT6 A;  4AJ8 A;  4KDX A;  1JHB A;  4ISD A;  4FYU A;  2IFQ B;  4K1F A;  1K3L A;  3F4S A;  2K9F A;  4I97 A;  4MH3 A;  3A5I A;  3NZN A;  2FWH A;  3EVI A;  5HFG A;  3CMI A;  2JSZ A;  5JCG A;  4MAB A;  2FWE A;  1LJR A;  4XS1 A;  3EC3 A;  4PQ1 A;  2VKZ G;  1RQM A;  3DVX A;  2DIY A;  4OCE A;  1SD8 A;  5KN0 A;  2WB9 A;  4HS1 A;  4L5O A;  3MSZ A;  5JCW A;  4JU5 A;  3IK7 A;  4K7I A;  5F07 A;  2HI7 A;  3W8S A;  5IOW A;  2B5X A;  1OKT A;  5ECI B;  1KBN A;  2DMM A;  2O7K A;  6GST A;  3LQ7 A;  1ZYE A;  2DJ1 A;  2V6K A;  1XW9 A;  4K5S A;  2WCI A;  1XFL A;  4MJB A;  3TKS A;  3M0F A;  4GQF A;  3LW9 A;  3ZVJ A;  1EEM A;  5CYY A;  5A34 A;  5IO0 A;  1XPV A;  3LOR A;  1CQH A;  2P31 A;  3L4N A;  4N3Z A;  4F03 A;  3S9F A;  5CP1 A;  3VK9 A;  2IMK A;  1DUG A;  3ZRE A;  3FR9 A;  2X8G A;  3NOF A;  6GSY A;  3F3Q A;  1GSS A;  5GZZ B;  2VM1 A;  1GTA A;  2DJJ A;  1A2J A;  4KE3 A;  1YF0 A;  4O7H A;  2JU5 A;  1JZD A;  2O8V B;  1BJX A;  3CSI A;  2DBC A;  4PNG A;  2VCW A;  2RLI A;  2O5V A;  5DAK A;  2N5A A;  2RM6 A;  4K5R A;  5IM9 A;  3ZMK A;  1URM A;  3DGQ A;  1T1V A;  4N11 A;  2E0Q A;  3P7X A;  1O81 A;  3KH9 A;  4TR0 A;  2R5G A;  2AUV A;  3TKR A;  4LL1 B;  4EC0 A;  2XC2 A;  1RW1 A;  1OKD A;  4MZW A;  2YWI A;  5KOX A;  4GXZ A;  1AIU A;  4BIK A;  5JWR B;  3ERW A;  1Q4J A;  4K7O A;  2DC5 A;  3NIV A;  1SJ6 A;  4MNN A;  3IA1 A;  5GAP D;  2H6X A;  1GUK A;  3CRU A;  1SJZ A;  5KN2 A;  2H66 A;  3GST A;  7GSS A;  1ERW A;  3TKS E;  1J9B A;  4XCS A;  1OE7 A;  3DYR A;  1T4Y A;  3IDV A;  1F37 A;  3V1W A;  4OO5 A;  3IK9 A;  2ES7 A;  1H75 A;  4Q5F A;  4HI7 A;  2CVD A;  4G0I A;  2LKU A;  1DE2 A;  5A4V A;  1TK8 B;  2JZR A;  3L9V A;  3TJK A;  4IVF A;  2HXK A;  3TJJ A;  1ZCP A;  2WW1 A;  4V2M A;  2HE3 A;  4Z2R A;  2H1G A;  3FZA A;  2EIQ A;  5J40 A;  2BMX A;  2FUG 2;  4EXJ A;  5DAL A;  2MMZ A;  1O6J A;  2VL2 A;  4DSQ A;  4DSS A;  5JCU A;  4NAX A;  5DAL B;  4ZIJ A;  3M1G A;  2CQ9 A;  4DSS B;  4W66 A;  2DKI A;  3F0I A;  1UVZ A;  4F82 A;  2B6M A;  3WT2 A;  3APQ A;  2CX4 A;  2R4V A;  4BVY A;  4HEA 2;  2YZU A;  3HJO A;  4XS4 A;  2A4H A;  3KEB A;  4ZL7 A;  3D5J A;  2FGX A;  2C1Y A;  4BA7 A;  2H73 A;  2WVY A;  4XIH A;  4BVY B;  4PI0 C;  4XS4 B;  3CSJ A;  5CRH A;  3QDN A;  5J9C A;  2CX3 A;  1G7E A;  4JE1 A;  1GUM A;  2X49 A;  2VCT A;  1WPI A;  3VUR A;  4IW9 A;  1M2A A;  4KGI A;  5ECP B;  2PVQ A;  2H01 A;  3GHA A;  5FHI A;  4PHZ C;  3LEF A;  6GSX A;  4XRA A;  4LA1 A;  1A0R P;  5D93 A;  1EWX A;  4NWY A;  1Y6E A;  4K7N A;  4GCI A;  3DKS A;  1MD3 A;  2DKH A;  2XPD A;  5G5E A;  5COH A;  5IMV A;  3TCO A;  2H6Y A;  2H72 A;  3RGB C;  2GQM A;  4FYC A;  2GS3 A;  3TKS C;  3GKM A;  4V2N A;  5F8B A;  2P0G A;  3LYK A;  2H75 A;  1B8X A;  1TXX A;  2WVX A;  3ED3 A;  4X4J A;  1THX A;  1SVM A;  5ECH B;  2L4Q A;  3U6V A;  2H71 A;  2WVX B;  1PKZ A;  4GTU A;  1X5C A;  4MA9 A;  1EZK A;  1X0R A;  4K0G A;  3GV1 A;  4ZB6 A;  3R3E A;  2R0C A;  5JWO B;  4G19 A;  5J4U A;  3LWA A;  4KB3 A;  9GSS A;  2EFC A;  1PN9 A;  1Q98 A;  1EOG A;  4FIW A;  1M3J A;  1NHY A;  2MZC A;  4Z2T A;  1J0F A;  2VCQ A;  1GP1 A;  4I8B A;  5IMF A;  1X9M B;  3CSH A;  4EL1 A;  4LL4 B;  3D4M A;  1O8X A;  1ERV A;  3APS A;  2ON5 A;  2WW0 A;  4HU7 A;  2GSS A;  2R2J A;  4EF0 A;  2F3M A;  5HR1 A;  1Z5Y E;  5KOW A;  2WS2 A;  2OJL A;  4A5P A;  1O85 A;  2B7J A;  3A3T A;  3O6T A;  3QAG A;  2KP2 A;  3EU3 A;  3IHQ A;  4MCU A;  2QA1 A;  1GSY A;  5HR3 A;  2OA7 A;  3L0H A;  3AY8 A;  4IEL A;  2YZH A;  1R5A A;  3CYN A;  3EE2 A;  1T8E B;  3IAS 2;  5CRW A;  1QXH A;  3PIN A;  5D9W A;  2O87 A;  4HZ4 A;  1ACV A;  3WGX A;  4CY6 A;  2F8F A;  2FWF A;  2PGT A;  1KEB A;  3MAK A;  4NV5 A;  2H1L A;  4XTS A;  1ZOF A;  3FEU A;  4ZBA A;  3D22 A;  5A4W A;  3TU3 B;  3KJY A;  1Z3E A;  4KW6 A;  1EV4 A;  1HD2 A;  3IOS A;  3E9J B;  4E8H A;  2P5R A;  1BQ7 A;  2WFC A;  3HVV A;  3UAR A;  4KX4 A;  3IRA A;  1GRX A;  1K0A A;  1JLW A;  3HKR A;  2C3Q A;  4HQZ A;  2VL2 C;  3DWV A;  4NV2 A;  2GLR A;  2YPM A;  2C3T A;  2UZ8 A;  3LYP A;  2A2S A;  3KXO A;  4L8E A;  2VCZ A;  1RK4 A;  5GSS A;  3TJG A;  1A2L A;  3EYT A;  3KGK A;  5DJL A;  2HZE A;  4ACS A;  1FW1 A;  5CRG A;  4J2F A;  2JZT A;  4IKH A;  4MP4 A;  2HZE B;  5AIV A;  2VL9 A;  1TRW A;  1PGT A;  3A5W A;  3C71 A;  2VCV A;  2HZF A;  3GNJ A;  4P3Y B;  4K2X A;  1GUH A;  2VO4 A;  1TJD A;  5IMA A;  2PWJ A;  1SJI A;  4TR1 A;  1TTZ A;  2L57 A;  3CRT A;  1YF1 A;  4IQA A;  5FWG A;  1JZR A;  4Z7X A;  1F3A A;  4BPY A;  2MYG A;  19GS A;  1SEN A;  2B5Y A;  4JBB A;  2GZP A;  2YAN A;  2WRT A;  4TKY A;  3GIX A;  5LNK e;  1UN2 A;  3UJ1 A;  3LG6 A;  2V41 A;  1ZYN A;  4FO5 A;  5G1K A;  2IL3 A;  3C7M A;  4F2I A;  3H93 A;  3BJ5 A;  1SK0 A;  2DJ3 A;  2WGR A;  2VM2 A;  4F0B A;  2GQK A;  3FY7 A;  3P8W A;  2YJH A;  2ON7 A;  4EDY A;  4PGT A;  1MEK A;  3IC8 A;  3KH7 A;  4MF7 A;  4AGS A;  1TOF A;  2H0I A;  3K8N A;  2YV7 A;  5ECO B;  4G9H A;  2E2M A;  3I9V 2;  5IMC A;  1SVL A;  4KCA A;  4EIP A;  1DSB A;  4KDY A;  3VPQ A;  1B4Q A;  5CO3 A;  3UIW A;  3MIX A;  5DVB A;  2N5F A;  2R3X A;  2WVZ A;  1I1I P;  2PER A;  3R2Q A;  1H4O A;  1K3Y A;  1YEW C;  4N0Z A;  4E8E A;  2O3E A;  2K8S A;  1XVW A;  3TUE A;  1E6B A;  4NHZ A;  2LEG A;  2ZCT A;  1EGO A;  3W6G A;  1WJK A;  1N25 A;  3FKF A;  1FAA A;  3FZ5 A;  1FOH A;  3J7Y k;  1BED A;  4ECJ A;  1GSD A;  3CWG A;  4PNF A;  3MWH A;  3ZLP A;  2OAC A;  4EE0 A;  3EPT A;  4TRX A;  2OE3 A;  2C3N A;  2DIZ A;  1QGV A;  3HDC A;  1R4W A;  3VPT A;  3H8Q A;  3TOU A;  5J4Y A;  4NXI A;  3DVW A;  1G6W A;  4N10 A;  4EIQ A;  4OFN A;  5J3R A;  3A2V A;  4WF5 A;  5IPG A;  2OBI A;  5GST A;  1LU4 A;  5A4U A;  3RPP A;  3MYD A;  5ECN B;  3GN3 A;  3Q74 A;  1YEP A;  1VGL A;  1XWA A;  2TIR A;  1AW9 A;  3F8U A;  3TB2 A;  4GF0 A;  2B3S A;  5LD0 A;  2L6C A;  1OC9 A;  3F4T A;  1ZL9 A;  4HUA A;  4HZ2 A;  5A34 B;  1U3A A;  4KH7 A;  2WUL A;  4DSR A;  1FHE A;  1OC9 B;  4V1A g;  5D9V A;  4LLR A;  4EKZ A;  1E2Y A;  2V1M A;  3GH6 A;  3CQF A;  3LXT A;  3VWX A;  3ZL5 A;  5INY A;  1A24 A;  2IWT A;  4MPG A;  2H6Z A;  2VLV A;  4X0X A;  3DIE A;  3FMW A;  4KAE A;  4TR3 A;  4YQV A;  1XW6 A;  3HCZ A;  5DAK B;  3GKK A;  3L9S A;  1PMT A;  4WR4 A;  4OFT A;  3QFA C;  2HYX A;  4MF5 A;  5IO2 A;  1ZYQ B;  5L71 A;  4QL7 A;  2I1U A;  5ECM B;  5E4W A;  2EIR A;  2H70 A;  5GAN D;  5DCG A;  3HVS A;  1M0U A;  1V98 A;  17GS A;  5HQP A;  3D4T A;  4H86 A;  3FR3 A;  2P5Q A;  2K18 A;  3H4K A;  3LSZ A;  4O92 A;  2C80 A;  4JZQ A;  1BG5 A;  3UVH A;  1XVQ A;  2RUF A;  2F51 A;  3TDG A;  3IPZ A;  3DRN A;  3RPN A;  2OE0 A;  1IYH A;  5G2Z A;  4Q5N A;  1TRU A;  2R0G A;  3Q18 A;  3UBL A;  5KEJ A;  1UC7 A;  3ZIT A;  4ZB9 A;  1M2D A;  3ZYW A;  2TRC P;  1B9X C;  4GWR A;  2IJY A;  1B48 A;  3KMO A;  3IAM 2;  3VFI A;  3BBY A;  2L5O A;  3H1N A;  5B6N A;  2VUP A;  1XWC A;  2I81 A;  2YJ7 A;  2X99 A;  2LV3 A;  2MMA A;  3WT1 A;  3CXG A;  5H5S A;  1PQN A;  4IJI A;  2K8V A;  1XW5 A;  4NMU A;  3QAW A;  1M3I A;  3I6A A;  14GS A;  1MDI A;  2L59 A;  1YZX A;  3GMF A;  2GT5 A;  5ECQ B;  4PQI A;  3G7J A;  4JR6 A;  4PQH A;  4ECB A;  2NVL A;  4ML1 A;  2MMO A;  1ERT A;  1WIK A;  2BTO T;  3FK8 A;  4GSS A;  5D73 A;  4TXV A;  5IQY A;  1SL0 B;  1DE1 A;  4PUR A;  2LRT A;  3E3E A;  4ILF A;  1XXU A;  5BMU A;  4KCE A;  3F9U A;  1X9W B;  2OBK A;  3UBK A;  2EFD A;  2MBS A;  1XG8 A;  5A1N A;  3DXB A;  4TN8 A;  4OWY A;  3VI7 A;  4ML6 A;  5BMU B;  2JSY A;  1XWB A;  4IBP A;  2AYT A;  1TXU A;  5B8A A;  4CHS A;  3N5O A;  5A1N B;  1K0N A;  5IMZ A;  4GLT A;  4FH8 A;  1WP0 A;  2I4A A;  5F06 A;  3WGE A;  5DDL A;  4O5U A;  3O3T A;  2H76 A;  2C0D A;  3EU4 A;  1N2A A;  2LTK A;  2A4V A;  3BD2 A;  3OR5 A;  2HRA A;  5LCZ A;  1K0C A;  2OAD A;  4EUY A;  1PL1 A;  2LST A;  1SD9 A;  4WET A;  4BWQ A;  3GFK A;  5HR2 A;  2HQT A;  5A5H A;  3E0U A;  3C8E A;  4XS6 A;  4JR4 A;  4JRR A;  1QK8 A;  3F3R A;  5A5H B;  4WKW A;  4NPB A;  4K0N A;  2O89 A;  2C4J A;  2V32 A;  4V1A p;  3QPM A;  3P2A A;  4Q5R A;  4ZBD A;  1GNE A;  1YDK A;  2X4A A;  2VL3 A;  3ZZX A;  4X43 A;  1S3A A;  4GST A;  3VWW A;  4ZB7 A;  4IGJ A;  2B1K A;  2GQL A;  1YKC A;  4K6X A;  4ECC A;  3TJF A;  2K6V A;  3ZFB A;  2HSM A;  1ILO A;  1X5E A;  3HZ8 A;  5CAX A;  4YKF A;  3KCM A;  4AJ7 A;  1K0O A;  1BYE A;  3GSS A;  5AN1 A;  4LMV A;  1PL2 A;  1VF1 A;  3D6I A;  3HJP A;  2HSM B;  4XHM A;  1Z6M A;  1I5G A;  2RUE A;  1UA5 A;  2PU9 C;  4G0L A;  1W4V A;  2G2Q A;  3HD5 A;  4EDZ A;  3RBT A;  4NHW A;  2C0F A;  3ZFL A;  2E2G A;  2R6K A;  6GSW A;  1PRX A;  3FZ9 A;  1GNW A;  3M9K A;  3CTF A;  4K2D A;  1VRS D;  2IMI A;  3ERF A;  1LBK A;  4ULX A;  1XZO A;  1XBS A;  1AC1 A;  2NTO A;  1SK2 A;  2CAQ A;  1YQ1 A;  2H1D A;  1WRY A;  3GUS A;  4POK A;  3RHC A;  2YWM A;  1ZGN A;  3MNG A;  3KMN A;  4I2U A;  4POB A;  2HRK A;  1A8Y A;  5AIS A;  3QOU A;  3F6D A;  3GKX A;  2VD1 A;  2WJU A;  1PSQ A;  1HYU A;  2HRK B;  3HY2 A;  2R37 A;  5G30 A;  1ZZY A;  1GSQ A;  4IJ3 A;  6GSU A;  3PR8 A;  3F6F A;  2RII A;  5ENU A;  2IME A;  2XPE A;  2PPT A;  2YV9 A;  1FVK A;  1WOU A;  4D73 A;  5FT3 A;  4HJM A;  2XHF A;  5EY6 A;  1AUC A;  1WMJ A;  2J23 A;  4AF2 A;  2PVO C;  4MJC A;  4D73 B;  10GS A;  13GS A;  3KP8 A;  4AI6 A;  2JAD A;  4WXT A;  1S4B P;  3PPU A;  5JWQ B;  5ECL B;  1A23 A;  2WZ9 A;  1MDK A;  2QC7 A;  2WW2 A;  1XIY A;  11GS A;  2FCH A;  4WBJ A;  1GL8 A;  4O5R A;  4POL A;  5KN3 A;  1BG1 A;  1G6Y A;  2LJR A;  2ZNM A;  2WDU A;  2QA2 A;  2LQQ A;  4F0C A;  2FD3 A;  4AKH A;  3BCK A;  1QMV A;  3Q6O A;  3PH9 A;  3FRC A;  1ON4 A;  4MJA A;  1Z7R A;  1A8L A;  4HSC X;  2H19 A;  4TR1 B;  4X1U A;  2VD0 A;  1T3B A;  1V9W A;  3CHX C;  2X64 A;  1ERU A;  1ABA A;  1OAZ A;  2JL4 A;  1M99 A;  4HQS A;  1FOV A;  3GL3 A;  4YAV A;  2GGT A;  2VOC A;  4ZXG A;  5CNW A;  16GS A;  1EV9 A;  2LJA A;  5C00 A;  4RUV A;  2HRN A;  2R0P A;  4ZBB A;  1O73 A;  5DQY A;  4YQM A;  4K9Z A;  5F05 A;  2PUK C;  5B8B A;  4CW9 A;  2REM A;  3TRP A;  4PX1 A;  4PUA A;  1M7T A;  5ELG A;  4GSN A;  4KND A;  4WR5 A;  3TOT A;  3KP9 A;  4YKG A;  4MK3 A;  4HOJ A;  5J41 A;  2X8H A;  4WF4 A;  5B6M A;  2AHE A;  5J47 A;  4F9Z A;  3RDW A;  5IOX A;  1EOH A;  1K0B A;  5AGY A;  1K0M A;  4QQ7 A;  4J56 E;  4JED A;  5EVO A;  2XBQ A;  2HT9 A;  4AJ6 A;  1C72 A;  2EFE A;  4MJE A;  3TRQ A;  2OE1 A;  3TKQ A;  2CVB A;  1A2M A;  1VF4 A;  4GDF A;  1BAY A; 
#chains in the Genus database with same CATH homology
 4HDE A;  5KN1 A;  4AKG A;  3O76 A;  5HR0 A;  4ZL8 A;  1YY7 A;  1PX6 A;  1YEX A;  2N5B A;  4G0K A;  2IPA A;  1OVN A;  4MF6 A;  4USS A;  2HSY A;  2KLX A;  4K8M A;  1AXD A;  1SK1 A;  2YCD A;  5D9X A;  1TRS A;  3WGD A;  1VF3 A;  4G10 A;  1MDJ A;  2FY6 A;  2LUS A;  2AJQ B;  1GUL A;  2X8C A;  4RI7 A;  2FHE A;  2L5L A;  3QFB C;  3U5R E;  4QL9 A;  4I5Q A;  1HNC A;  4KDU A;  3L78 A;  22GS A;  2C0E A;  1SL2 B;  2YWO A;  1F2E A;  1GTU A;  3EIN A;  3PGT A;  4RI6 A;  4E68 A;  2VIM A;  1EP7 A;  3P90 A;  3EWL A;  3HJM A;  2GT6 A;  2GST A;  2DLX A;  4TOP A;  3RAZ A;  1SKR B;  1GTB A;  1WWJ A;  3Q19 A;  2EC4 A;  3GL5 A;  4J57 E;  3FHK A;  2BJX A;  5HFI A;  1TI1 A;  2IMD A;  20GS A;  4OCF A;  4POM A;  3WYW A;  1V40 A;  4L0U A;  4OFM A;  2HFD A;  4TR4 A;  3LJR A;  1MD4 A;  1R7H A;  3QCP A;  4MZC A;  2CV4 A;  2LNT A;  1X9S B;  3CTG A;  4DVC A;  2CZ3 A;  3TJB A;  3C1R A;  1ZYP A;  1OE8 A;  3L9U A;  2UV8 G;  2A2P A;  1AQW A;  3UL3 A;  3QMX A;  8GSS A;  3IHG A;  5H5R A;  1M9A A;  1KTE A;  2QGV A;  4Q5Q A;  1SKS B;  1F6M C;  4PXO A;  1EGR A;  3SBC A;  2V6O A;  5C04 A;  2LRN A;  3IV4 A;  3ZML A;  2XBI A;  3RHB A;  3GA4 A;  1U3I A;  2AV4 A;  2F9S A;  3TRX A;  5DCH A;  3EMX A;  6GSS A;  3ME8 A;  4HU9 A;  3A2W A;  1BX9 A;  2C0G A;  2O85 A;  2M46 A;  4AKI A;  1XOB A;  18GS A;  1OYJ A;  3SWL A;  3W8J A;  5ELA A;  3HVX A;  4WEY A;  2CA8 A;  2YN1 A;  1OC8 A;  3KTB A;  1O8W A;  1TP9 A;  2M80 A;  2CVK A;  1V58 A;  1TK0 B;  2FLS A;  3DD3 A;  2YNX A;  1AQV A;  2EIO A;  2LJK A;  2DJ2 A;  3HMJ G;  3VWU A;  1TK5 B;  1FB6 A;  4XRD A;  2GSR A;  2HSN A;  3EMP A;  5CRD A;  1XOA A;  1SYR A;  2G0F A;  2HSH A;  1V57 A;  4OD7 A;  4KF9 A;  2VLT A;  2HSN B;  4QMK A;  3QD9 A;  1FG4 A;  3G7I A;  5G1L A;  1SYX A;  2B1L A;  3UVT A;  2H1B A;  2L4C A;  3ZIJ A;  1U6T A;  1G0T A;  1SU9 A;  3IR4 A;  1K3O A;  1F9M A;  3I43 A;  3G7Y A;  3FYG A;  1VF2 A;  3WD6 A;  4KUN A;  4BVX A;  2NBS A;  3N9J A;  3GTU A;  4KSO A;  2RM5 A;  5G5F A;  4WBR D;  2L6D A;  3LXZ A;  3D21 A;  4BVX B;  2VCX A;  4AKX B;  4RQR A;  4CY8 A;  3C1S A;  2OKA A;  4KSM A;  3GTU B;  1O7U A;  3APO A;  2IN3 A;  2NDO A;  3UOM A;  1ST9 A;  2IMF A;  2MMN A;  1DBY A;  2YOI A;  3GH9 A;  3H79 A;  3A2X A;  1FVJ A;  4EO3 A;  1G7O A;  5IPH A;  2DML A;  2Z9S A;  1NHO A;  1QQ2 A;  3GRX A;  4FYB A;  3ZRD A;  1S3D A;  2OT3 A;  5J9B A;  4DEJ A;  3QR6 A;  12GS A;  1JZO A;  4FQU A;  1HNA A;  4YH2 A;  1X5D A;  4N30 A;  4O32 A;  1I9D A;  3IC4 A;  4MPF A;  1MTC A;  3MDK A;  1WE0 A;  4TXO A;  2E7P A;  1AQX A;  2LQO A;  1V2A A;  1TU8 A;  3BOA A;  3J7Y b;  3HA9 A;  3ZVJ D;  5AIX A;  2ALB A;  4TXO B;  4O5Q A;  5D96 A;  4YQU A;  2I9H A;  1TI3 A;  2F8A A;  5E59 A;  2VAF A;  3HYP A;  1B9Y C;  6GSV A;  3KTL A;  5ECS A;  1QFN A;  1TRV A;  4IP6 A;  4V2L A;  1USB A;  4LMW A;  5DJM A;  3GX0 A;  1FO5 A;  2FNO A;  1YVL A;  2C8U A;  2CAI A;  3ISO A;  2CZ2 A;  2KP1 A;  4PUF C;  3IE3 A;  1J08 A;  2GZY A;  1HQO A;  4PTS A;  4ID0 A;  3M9J A;  1JZW A;  1YKA A;  3TGZ A;  2LNS A;  1CQG A;  4OO4 A;  4HJ2 A;  2LRC A;  2QKE A;  1SVO A;  3UAP A;  3M3M A;  3UMA A;  1TKD B;  4G2E A;  1NSW A;  1SKW B;  4YAP A;  5J4V A;  2DSA A;  1NW2 A;  1EP8 A;  1GLQ A;  1S3C A;  3KIJ A;  2H1A A;  5EL8 A;  2KUC A;  2JAC A;  5HFK A;  2YP6 A;  2GVP A;  3TKP A;  1PN0 A;  2H0H A;  1B4P A;  2GDR A;  3IBH A;  4L5L A;  3LFL A;  2EFH A;  4G01 A;  1A0F A;  3VWV A;  1GSE A;  4MMM A;  3FZ4 A;  1Z9H A;  3C73 A;  3GX8 A;  3US3 A;  2B7K A;  5ECK B;  4RQX A;  2PBJ A;  1F3B A;  5CRE A;  1YJ6 A;  2A2R A;  3D0Z A;  1HNB A;  1THO A;  1K0D A;  2H0G A;  2H8L A;  3HZ4 A;  5A5K A;  2H30 A;  2IIY A;  1QUW A;  3I69 A;  2GTU A;  3M8N A;  4EVM A;  3FW2 A;  2PMT A;  5D9T A;  2HRF A;  4ECI A;  3CBU A;  3FR6 A;  2HNL A;  1GLP A;  1XWK A;  4N0V A;  1XCC A;  2GSQ A;  3GYK A;  4BWS A;  3VLN A;  1M9B A;  4CDO A;  2H74 A;  3GKN A;  4IHU A;  2HLS A;  2TRX A;  4L0W A;  4IP1 A;  2B5E A;  4ICY A;  2LS5 A;  1GH2 A;  1TU7 A;  5F0G A;  2AB6 A;  1NM3 A;  2GZZ A;  1TW9 A;  4MH2 A;  1T4Z A;  1Y25 A;  4OMV A;  1T7P B;  4GRF A;  1OC3 A;  1Z6N A;  2J9H A;  1R26 A;  2NPB A;  4MLY A;  2V2G A;  3VI5 A;  2I3Y A;  1GSF A;  1JFU A;  4I6X A;  4IS0 A;  1M2B A;  1BF5 A;  1Z7P A;  2PN8 A;  3KZQ A;  2KOK A;  4ZL9 A;  5IIZ A;  4ZIL A;  3BCI A;  4MZB A;  2FA4 A;  4MDC A;  3KD0 A;  1KNG A;  1ZMA A;  1PX7 A;  4IQ1 A;  4I2T A;  3EUR A;  1PD2 1;  1W89 A;  1TDI A;  3ERG A;  1XWG A;  1IYI A;  1Y1U A;  5BRT A;  1GSU A;  1T00 A;  5J5N A;  5B7C A;  3F4R A;  1SL1 B;  4TVE A;  5ABR A;  2YWN A;  1N8J A;  3IXR A;  3JCM L;  1GTI A;  2KHP A;  2FWG A;  4Z2U A;  2ZUP A;  3HHV A;  2M72 A;  1FB0 A;  4GQC A;  3LGC A;  3GUR A;  2MBT A;  5G31 A;  2D2Z A;  5ID2 A;  3ME7 A;  3ZIV A;  3KM6 A;  2DJK A;  3HXS A;  4TW5 A;  1GWC A;  5H5Q A;  1EEJ A;  1JLV A;  5IMD A;  5ID2 B;  1R5P A;  4IN0 A;  4ZB8 A;  1PA3 A;  2VLU A;  3F63 A;  1U87 A;  4KA0 A;  5DQS A;  2JZS A;  2AAW A;  5EPF A;  1U88 A;  2DJ0 A;  4BL7 A;  3DML A;  5D8I A;  3DEX A;  2FA8 A;  1PKW A;  3UEM A;  3QAV A;  2QSI A;  1ML6 A;  4BL7 B;  3ZTL A;  2IFQ A;  1AAZ A;  5ECR B;  3G9B A;  5DBQ A;  2CT6 A;  4AJ8 A;  4KDX A;  1JHB A;  4ISD A;  4FYU A;  2IFQ B;  4K1F A;  1K3L A;  3F4S A;  2K9F A;  4I97 A;  4MH3 A;  3A5I A;  3NZN A;  2FWH A;  3EVI A;  5HFG A;  3CMI A;  2JSZ A;  5JCG A;  4MAB A;  2FWE A;  1LJR A;  4XS1 A;  3EC3 A;  4PQ1 A;  2VKZ G;  1RQM A;  3DVX A;  2DIY A;  4OCE A;  1SD8 A;  5KN0 A;  2WB9 A;  4HS1 A;  4L5O A;  3MSZ A;  5JCW A;  4JU5 A;  3IK7 A;  4K7I A;  5F07 A;  2HI7 A;  3W8S A;  5IOW A;  2B5X A;  1OKT A;  5ECI B;  1KBN A;  2DMM A;  2O7K A;  6GST A;  3LQ7 A;  1ZYE A;  2DJ1 A;  2V6K A;  1XW9 A;  4K5S A;  2WCI A;  1XFL A;  4MJB A;  3TKS A;  3M0F A;  4GQF A;  3LW9 A;  3ZVJ A;  1EEM A;  5CYY A;  5A34 A;  5IO0 A;  1XPV A;  3LOR A;  1CQH A;  2P31 A;  3L4N A;  4N3Z A;  4F03 A;  3S9F A;  5CP1 A;  3VK9 A;  2IMK A;  1DUG A;  3ZRE A;  3FR9 A;  2X8G A;  3NOF A;  6GSY A;  3F3Q A;  1GSS A;  5GZZ B;  2VM1 A;  1GTA A;  2DJJ A;  1A2J A;  4KE3 A;  1YF0 A;  4O7H A;  2JU5 A;  1JZD A;  2O8V B;  1BJX A;  3CSI A;  2DBC A;  4PNG A;  2VCW A;  2RLI A;  2O5V A;  5DAK A;  2N5A A;  2RM6 A;  4K5R A;  5IM9 A;  3ZMK A;  1URM A;  3DGQ A;  1T1V A;  4N11 A;  2E0Q A;  3P7X A;  1O81 A;  3KH9 A;  4TR0 A;  2R5G A;  2AUV A;  3TKR A;  4LL1 B;  4EC0 A;  2XC2 A;  1RW1 A;  1OKD A;  4MZW A;  2YWI A;  5KOX A;  4GXZ A;  1AIU A;  5JWR B;  3ERW A;  1Q4J A;  4K7O A;  2DC5 A;  3NIV A;  1SJ6 A;  4MNN A;  3IA1 A;  5GAP D;  2H6X A;  1GUK A;  3CRU A;  1SJZ A;  5KN2 A;  2H66 A;  3GST A;  7GSS A;  1ERW A;  3TKS E;  1J9B A;  4XCS A;  1OE7 A;  3DYR A;  1T4Y A;  3IDV A;  1F37 A;  3V1W A;  4OO5 A;  3IK9 A;  2ES7 A;  1H75 A;  4Q5F A;  4HI7 A;  2CVD A;  4G0I A;  2LKU A;  1DE2 A;  5A4V A;  1TK8 B;  2JZR A;  3L9V A;  3TJK A;  4IVF A;  2HXK A;  3TJJ A;  1ZCP A;  4V2M A;  2HE3 A;  4Z2R A;  2H1G A;  3FZA A;  2EIQ A;  5J40 A;  2BMX A;  2FUG 2;  4EXJ A;  5DAL A;  2MMZ A;  1O6J A;  2VL2 A;  4DSQ A;  4DSS A;  5JCU A;  4NAX A;  5DAL B;  4ZIJ A;  3M1G A;  2CQ9 A;  4DSS B;  4W66 A;  2DKI A;  3F0I A;  1UVZ A;  4F82 A;  2B6M A;  3WT2 A;  3APQ A;  2CX4 A;  2R4V A;  4BVY A;  4HEA 2;  2YZU A;  3HJO A;  4XS4 A;  2A4H A;  3KEB A;  4ZL7 A;  3D5J A;  2FGX A;  2C1Y A;  4BA7 A;  2H73 A;  4XIH A;  4BVY B;  4XS4 B;  3CSJ A;  5CRH A;  3QDN A;  5J9C A;  2CX3 A;  1G7E A;  4JE1 A;  1GUM A;  2X49 A;  2VCT A;  1WPI A;  3VUR A;  4IW9 A;  1M2A A;  4KGI A;  5ECP B;  2PVQ A;  2H01 A;  3GHA A;  5FHI A;  3LEF A;  6GSX A;  4XRA A;  4LA1 A;  1A0R P;  5D93 A;  1EWX A;  4NWY A;  1Y6E A;  4K7N A;  4GCI A;  3DKS A;  1MD3 A;  2DKH A;  2XPD A;  5G5E A;  5COH A;  5IMV A;  3TCO A;  2H6Y A;  2H72 A;  2GQM A;  4FYC A;  2GS3 A;  3TKS C;  3GKM A;  4V2N A;  5F8B A;  2P0G A;  3LYK A;  2H75 A;  1B8X A;  1TXX A;  3ED3 A;  4X4J A;  1THX A;  1SVM A;  5ECH B;  2L4Q A;  3U6V A;  2H71 A;  1PKZ A;  4GTU A;  1X5C A;  4MA9 A;  1EZK A;  1X0R A;  4K0G A;  3GV1 A;  4ZB6 A;  3R3E A;  2R0C A;  5JWO B;  4G19 A;  5J4U A;  3LWA A;  4KB3 A;  9GSS A;  2EFC A;  1PN9 A;  1Q98 A;  1EOG A;  4FIW A;  2MZC A;  1NHY A;  4Z2T A;  1J0F A;  2VCQ A;  1GP1 A;  4I8B A;  5IMF A;  1X9M B;  3CSH A;  4EL1 A;  4LL4 B;  3D4M A;  1O8X A;  1ERV A;  3APS A;  2ON5 A;  4HU7 A;  2GSS A;  2R2J A;  4EF0 A;  2F3M A;  5HR1 A;  1Z5Y E;  5KOW A;  2WS2 A;  2OJL A;  4A5P A;  1O85 A;  2B7J A;  3A3T A;  3O6T A;  3QAG A;  2KP2 A;  3EU3 A;  3IHQ A;  4MCU A;  2QA1 A;  1GSY A;  5HR3 A;  2OA7 A;  3L0H A;  3AY8 A;  4IEL A;  2YZH A;  1R5A A;  3CYN A;  3EE2 A;  1T8E B;  3IAS 2;  5CRW A;  1QXH A;  3PIN A;  5D9W A;  2O87 A;  4HZ4 A;  1ACV A;  3WGX A;  4CY6 A;  2F8F A;  2FWF A;  2PGT A;  1KEB A;  3MAK A;  4NV5 A;  2H1L A;  4XTS A;  1ZOF A;  3FEU A;  4ZBA A;  3D22 A;  5A4W A;  3TU3 B;  3KJY A;  1Z3E A;  4KW6 A;  1EV4 A;  1HD2 A;  3IOS A;  3E9J B;  4E8H A;  2P5R A;  1BQ7 A;  2WFC A;  3HVV A;  3UAR A;  4KX4 A;  3IRA A;  1GRX A;  1K0A A;  1JLW A;  3HKR A;  2C3Q A;  4HQZ A;  2VL2 C;  3DWV A;  4NV2 A;  2GLR A;  2YPM A;  2C3T A;  2UZ8 A;  3LYP A;  2A2S A;  3KXO A;  4L8E A;  2VCZ A;  1RK4 A;  5GSS A;  3TJG A;  1A2L A;  3EYT A;  3KGK A;  5DJL A;  2HZE A;  4ACS A;  1FW1 A;  5CRG A;  4J2F A;  2JZT A;  4IKH A;  4MP4 A;  2HZE B;  5AIV A;  2VL9 A;  1TRW A;  1PGT A;  3A5W A;  3C71 A;  2VCV A;  2HZF A;  3GNJ A;  4P3Y B;  4K2X A;  1GUH A;  2VO4 A;  1TJD A;  5IMA A;  2PWJ A;  1SJI A;  4TR1 A;  1TTZ A;  2L57 A;  3CRT A;  1YF1 A;  4IQA A;  5FWG A;  1JZR A;  4Z7X A;  1F3A A;  4BPY A;  2MYG A;  19GS A;  1SEN A;  2B5Y A;  4JBB A;  2GZP A;  2YAN A;  2WRT A;  4TKY A;  3GIX A;  5LNK e;  1UN2 A;  3UJ1 A;  3LG6 A;  2V41 A;  1ZYN A;  4FO5 A;  5G1K A;  2IL3 A;  3C7M A;  4F2I A;  3H93 A;  3BJ5 A;  1SK0 A;  2DJ3 A;  2WGR A;  2VM2 A;  4F0B A;  2GQK A;  3FY7 A;  3P8W A;  2YJH A;  2ON7 A;  4EDY A;  4PGT A;  1MEK A;  3IC8 A;  3KH7 A;  4MF7 A;  4AGS A;  1TOF A;  2H0I A;  3K8N A;  2YV7 A;  5ECO B;  4G9H A;  2E2M A;  3I9V 2;  5IMC A;  1SVL A;  4KCA A;  4EIP A;  1DSB A;  4KDY A;  3VPQ A;  1B4Q A;  5CO3 A;  3UIW A;  3MIX A;  5DVB A;  2N5F A;  2R3X A;  2PER A;  3R2Q A;  1H4O A;  1K3Y A;  4N0Z A;  4E8E A;  2K8S A;  1XVW A;  3TUE A;  1E6B A;  4NHZ A;  2LEG A;  2ZCT A;  1EGO A;  3W6G A;  1WJK A;  1N25 A;  3FKF A;  1FAA A;  3FZ5 A;  1FOH A;  3J7Y k;  1BED A;  4ECJ A;  1GSD A;  3CWG A;  4PNF A;  3MWH A;  3ZLP A;  2OAC A;  4EE0 A;  3EPT A;  4TRX A;  2OE3 A;  2C3N A;  2DIZ A;  1QGV A;  3HDC A;  1R4W A;  3VPT A;  3H8Q A;  3TOU A;  5J4Y A;  4NXI A;  3DVW A;  1G6W A;  4N10 A;  4EIQ A;  4OFN A;  5J3R A;  3A2V A;  4WF5 A;  5IPG A;  2OBI A;  5GST A;  1LU4 A;  5A4U A;  3RPP A;  3MYD A;  5ECN B;  3GN3 A;  3Q74 A;  1YEP A;  1VGL A;  1XWA A;  2TIR A;  1AW9 A;  3F8U A;  3TB2 A;  4GF0 A;  2B3S A;  5LD0 A;  2L6C A;  1OC9 A;  3F4T A;  1ZL9 A;  4HUA A;  4HZ2 A;  5A34 B;  1U3A A;  4KH7 A;  2WUL A;  4DSR A;  1FHE A;  1OC9 B;  4V1A g;  5D9V A;  4LLR A;  4EKZ A;  1E2Y A;  2V1M A;  3GH6 A;  3LXT A;  3VWX A;  3ZL5 A;  5INY A;  1A24 A;  2IWT A;  4MPG A;  2H6Z A;  2VLV A;  4X0X A;  3DIE A;  3FMW A;  4KAE A;  4TR3 A;  4YQV A;  1XW6 A;  3HCZ A;  5DAK B;  3GKK A;  3L9S A;  1PMT A;  4WR4 A;  4OFT A;  3QFA C;  2HYX A;  4MF5 A;  5IO2 A;  1ZYQ B;  5L71 A;  4QL7 A;  2I1U A;  5ECM B;  5E4W A;  2EIR A;  2H70 A;  5GAN D;  5DCG A;  3HVS A;  1M0U A;  1V98 A;  17GS A;  5HQP A;  3D4T A;  4H86 A;  3FR3 A;  2P5Q A;  2K18 A;  3H4K A;  3LSZ A;  4O92 A;  2C80 A;  4JZQ A;  1BG5 A;  3UVH A;  1XVQ A;  2RUF A;  2F51 A;  3TDG A;  3IPZ A;  3DRN A;  3RPN A;  2OE0 A;  1IYH A;  5G2Z A;  4Q5N A;  1TRU A;  2R0G A;  3Q18 A;  3UBL A;  5KEJ A;  1UC7 A;  3ZIT A;  4ZB9 A;  1M2D A;  3ZYW A;  2TRC P;  1B9X C;  4GWR A;  2IJY A;  1B48 A;  3KMO A;  3IAM 2;  3VFI A;  3BBY A;  2L5O A;  3H1N A;  5B6N A;  2VUP A;  1XWC A;  2I81 A;  2YJ7 A;  2X99 A;  2LV3 A;  2MMA A;  3WT1 A;  3CXG A;  5H5S A;  1PQN A;  4IJI A;  2K8V A;  1XW5 A;  4NMU A;  3QAW A;  3I6A A;  14GS A;  1MDI A;  2L59 A;  1YZX A;  3GMF A;  2GT5 A;  5ECQ B;  4PQI A;  3G7J A;  4JR6 A;  4PQH A;  4ECB A;  2NVL A;  4ML1 A;  2MMO A;  1ERT A;  1WIK A;  2BTO T;  3FK8 A;  4GSS A;  5D73 A;  4TXV A;  5IQY A;  1SL0 B;  1DE1 A;  4PUR A;  2LRT A;  3E3E A;  4ILF A;  1XXU A;  5BMU A;  4KCE A;  3F9U A;  1X9W B;  2OBK A;  3UBK A;  2EFD A;  2MBS A;  5A1N A;  3DXB A;  4TN8 A;  4OWY A;  3VI7 A;  4ML6 A;  5BMU B;  2JSY A;  1XWB A;  4IBP A;  2AYT A;  1TXU A;  5B8A A;  4CHS A;  3N5O A;  5A1N B;  1K0N A;  5IMZ A;  4GLT A;  4FH8 A;  1WP0 A;  2I4A A;  5F06 A;  3WGE A;  5DDL A;  4O5U A;  3O3T A;  2H76 A;  2C0D A;  3EU4 A;  1N2A A;  2LTK A;  2A4V A;  3BD2 A;  3OR5 A;  2HRA A;  5LCZ A;  1K0C A;  2OAD A;  4EUY A;  1PL1 A;  2LST A;  1SD9 A;  4WET A;  4BWQ A;  3GFK A;  5HR2 A;  2HQT A;  5A5H A;  3E0U A;  3C8E A;  4XS6 A;  4JR4 A;  4JRR A;  1QK8 A;  3F3R A;  5A5H B;  4WKW A;  4NPB A;  4K0N A;  2O89 A;  2C4J A;  2V32 A;  4V1A p;  3QPM A;  3P2A A;  4Q5R A;  4ZBD A;  1GNE A;  1YDK A;  2X4A A;  2VL3 A;  3ZZX A;  4X43 A;  1S3A A;  4GST A;  3VWW A;  4ZB7 A;  4IGJ A;  2B1K A;  2GQL A;  1YKC A;  4K6X A;  4ECC A;  3TJF A;  2K6V A;  3ZFB A;  2HSM A;  1ILO A;  1X5E A;  3HZ8 A;  5CAX A;  4YKF A;  3KCM A;  4AJ7 A;  1K0O A;  1BYE A;  3GSS A;  5AN1 A;  4LMV A;  1PL2 A;  1VF1 A;  3D6I A;  3HJP A;  2HSM B;  4XHM A;  1Z6M A;  1I5G A;  2RUE A;  1UA5 A;  2PU9 C;  4G0L A;  1W4V A;  2G2Q A;  3HD5 A;  4EDZ A;  3RBT A;  4NHW A;  2C0F A;  3ZFL A;  2E2G A;  2R6K A;  6GSW A;  1PRX A;  3FZ9 A;  1GNW A;  3M9K A;  3CTF A;  4K2D A;  1VRS D;  2IMI A;  3ERF A;  1LBK A;  4ULX A;  1XZO A;  1XBS A;  1AC1 A;  2NTO A;  1SK2 A;  2CAQ A;  1YQ1 A;  2H1D A;  1WRY A;  3GUS A;  4POK A;  3RHC A;  2YWM A;  1ZGN A;  3MNG A;  3KMN A;  4I2U A;  4POB A;  2HRK A;  1A8Y A;  5AIS A;  3QOU A;  3F6D A;  3GKX A;  2VD1 A;  2WJU A;  1PSQ A;  1HYU A;  2HRK B;  3HY2 A;  2R37 A;  5G30 A;  1ZZY A;  1GSQ A;  4IJ3 A;  6GSU A;  3PR8 A;  3F6F A;  2RII A;  5ENU A;  2IME A;  2XPE A;  2PPT A;  2YV9 A;  1FVK A;  1WOU A;  4D73 A;  5FT3 A;  4HJM A;  2XHF A;  5EY6 A;  1AUC A;  1WMJ A;  2J23 A;  4AF2 A;  2PVO C;  4MJC A;  4D73 B;  10GS A;  13GS A;  3KP8 A;  4AI6 A;  2JAD A;  4WXT A;  3PPU A;  5JWQ B;  5ECL B;  1A23 A;  2WZ9 A;  1MDK A;  2QC7 A;  1XIY A;  11GS A;  2FCH A;  4WBJ A;  1GL8 A;  4O5R A;  4POL A;  5KN3 A;  1BG1 A;  1G6Y A;  2LJR A;  2ZNM A;  2WDU A;  2QA2 A;  2LQQ A;  4F0C A;  2FD3 A;  4AKH A;  3BCK A;  1QMV A;  3Q6O A;  3PH9 A;  3FRC A;  1ON4 A;  4MJA A;  1Z7R A;  1A8L A;  2H19 A;  4TR1 B;  4X1U A;  2VD0 A;  1T3B A;  1V9W A;  2X64 A;  1ERU A;  1ABA A;  1OAZ A;  2JL4 A;  1M99 A;  4HQS A;  1FOV A;  3GL3 A;  4YAV A;  2GGT A;  2VOC A;  4ZXG A;  5CNW A;  16GS A;  1EV9 A;  2LJA A;  5C00 A;  4RUV A;  2HRN A;  2R0P A;  4ZBB A;  1O73 A;  5DQY A;  4YQM A;  4K9Z A;  5F05 A;  2PUK C;  5B8B A;  4CW9 A;  2REM A;  3TRP A;  4PX1 A;  4PUA A;  1M7T A;  5ELG A;  4GSN A;  4KND A;  4WR5 A;  3TOT A;  3KP9 A;  4YKG A;  4MK3 A;  4HOJ A;  5J41 A;  2X8H A;  4WF4 A;  5B6M A;  2AHE A;  5J47 A;  4F9Z A;  3RDW A;  5IOX A;  1EOH A;  1K0B A;  5AGY A;  1K0M A;  4QQ7 A;  4J56 E;  4JED A;  5EVO A;  2XBQ A;  2HT9 A;  4AJ6 A;  1C72 A;  2EFE A;  4MJE A;  3TRQ A;  2OE1 A;  3TKQ A;  2CVB A;  1A2M A;  1VF4 A;  4GDF A;  1BAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...