3CSJA

Human glutathione s-transferase p1-1 in complex with chlorambucil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title The anti-cancer drug chlorambucil as a substrate for the human polymorphic enzyme glutathione transferase P1-1: kinetic properties and crystallographic characterisation of allelic variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3csjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3csjA01
1JLWA 4IELA 3CTGA 5D73A 3ZIJA 5IOWA 5CRWA 5CRHA 2E2MA 3LWAA 3FEUA 2YNXA 2QC7A 4ILFA 2CAQA 2MMNA 3F63A 4IQAA 5ECRB 5DBQA 1XFLA 4CHSA 1VF1A 5AN1A 3H8QA 2JSYA 3M9KA 4PQ1A 3CXGA 2XPDA 5HQPA 2YV9A 2O7KA 1QUWA 3G7IA 2FLSA 2LS5A 3KTBA 3FYGA 2NTOA 5F05A 4QL9A 3O76A 1E2YA 2JU5A 3M9JA 4POBA 4HJMA 1CQHA 5COHA 2NPBA 2VL3A 2P0GA 2WS2A 1DE2A 3GX0A 3EMXA 1GSQA 3FRCA 5DDLA 2VD0A 3IHQA 3VI5A 3WT1A 4ZB6A 3A5WA 2KOKA 1HNCA 2YCDA 14GSA 3DMLA 4RQXA 4HQZA 1F2EA 2CQ9A 5IMZA 3QOUA 2JZSA 1GUKA 1SD8A 2ES7A 3VURA 3F4SA 1XWKA 3L78A 2OKAA 3TOUA 1A8LA 4OFTA 1XIYA 4RUVA 2B3SA 2FD3A 1XW9A 1EV4A 2C8UA 1VF4A 1EWXA 4I5QA 4LL4B 2WRTA 1KTEA 3ISOA 2GT6A 2DJ2A 4TXVA 2B5YA 1OC9B 4MPFA 2VUPA 1G6YA 2C3NA 4IVFA 1GSDA 5HFGA 3GHAA 1XOBA 2GSQA 1WRYA 4MJCA 4WKWA 4ISDA 3ZL5A 1PL2A 2HSMA 6GSWA 3P90A 3L9VA 4ACSA 1MDKA 2CV4A 2JADA 2LQOA 3APOA 2MMOA 2ON7A 2H76A 4JR4A 4IP6A 1AAZA 1AIUA 1AW9A 1K0BA 1BX9A 3BD2A 4TXOA 3R3EA 5KN0A 2G0FA 2EC4A 2QSIA 1K0DA 4BVXB 3GA4A 1T4YA 2HLSA 3Q19A 2DJ3A 2IMIA 1SYXA 3FY7A 1UVZA 2LJKA 1WOUA 3DD3A 2HNLA 3SWLA 1U88A 3IXRA 3I9V2 1TTZA 1U87A 4ECJA 4ML1A 3ZITA 1C72A 3K8NA 3FW2A 4V2NA 2FWEA 2CZ3A 2K18A 3R2QA 3MNGA 4MZWA 5E59A 2DJ0A 1ZGNA 1G0TA 3QAWA 2N5BA 6GSUA 1F3AA 2CVKA 4IBPA 6GSXA 3UMAA 4I2TA 5B8AA 4BA7A 2O8VB 4MH2A 1JHBA 1MEKA 3FZ5A 2HRFA 1A24A 4MF6A 4F0CA 3PGTA 2A4VA 3LXTA 2AAWA 1ST9A 5J41A 3DYRA 4ZL9A 1ACVA 3Q74A 2FA4A 3LSZA 2ZUPA 4EE0A 2FWGA 2VLVA 1FVKA 2VCVA 3CSJA 4XS4B 1M2AA 3HCZA 1Z7PA 4HZ4A 2RLIA 2GSSA 3NZNA 1SKWB 2VL2C 1ERWA 1FHEA 3F3RA 2AUVA 1GSFA 4D73B 1PL1A 1U3AA 5ECKB 4WR5A 1GTUA 3GH6A 3G7JA 1FO5A 1Z6NA 3GV1A 2B5XA 1LU4A 1V9WA 1XW6A 2LEGA 2DC5A 1R4WA 1K3OA 3HZ4A 1EGOA 5CYYA 2XBIA 4TOPA 3GN3A 2VLUA 2I3YA 4F9ZA 3P8WA 4XRDA 2AV4A 3APQA 4K6XA 2OE1A 1PN9A 5IMCA 2L4QA 4OO5A 4KDYA 3LG6A 1S3DA 1F9MA 4X43A 3BBYA 5IO2A 2MMZA 3M8NA 3UAPA 2YJHA 5DAKA 2H72A 4ZIJA 3VLNA 3HYPA 1PX6A 1THOA 1EEJA 2DSAA 2WJUA 1F3BA 5KN3A 3KCMA 1EV9A 1Z9HA 5H5SA 2IPAA 2VCTA 1S3AA 2IN3A 3V1WA 2F3MA 3UVHA 3UEMA 2CAIA 1PQNA 3KTLA 3F8UA 3FR3A 3FR9A 2E7PA 3ZYWA 3CSIA 1EP7A 4V2LA 1V2AA 1PKZA 1X9WB 5FT3A 2YPMA 2WDUA 2JSZA 5IM9A 4IJIA 5HR2A 1PRXA 1A2LA 3WGEA 1FVJA 3H4KA 2I1UA 1BYEA 4FYUA 3KMNA 4ML6A 2YWIA 4I8BA 4WR4A 5F07A 2TRXA 4K2DA 1B48A 2E0QA 3H79A 1OYJA 4HU7A 3TRXA 3QMXA 3ZRDA 3LXZA 4XS1A 2R6KA 1R26A 3M3MA 1FOVA 3GKKA 4GSTA 2YJ7A 4AJ8A 3TKPA 5CNWA 1Z5YE 4MLYA 1V40A 1DUGA 1E6BA 4I97A 3TGZA 1TKDB 2LUSA 1NSWA 2HRNA 1TRWA 5DALB 4FYCA 5ELAA 4GSNA 2H73A 4XS6A 5IMAA 2OBKA 2PUKC 4KDUA 3IR4A 4O92A 4HUAA 4KCAA 3TCOA 2CZ2A 2HT9A 2XBQA 3US3A 2P5QA 1K0MA 1SJZA 2EIOA 4AF2A 1THXA 2GT5A 5DJMA 2B1LA 2X99A 1SK0A 1T3BA 2I4AA 3GH9A 3WGDA 1T7PB 4XHMA 3BOAA 1YF1A 1GRXA 3JCML 2FA8A 5C04A 1B4QA 2H75A 3CRUA 2MBTA 2YV7A 4WF5A 1DSBA 1KNGA 3L9UA 4MABA 2C0DA 2CA8A 4V1Ag 3U5RE 2TRCP 4BVYA 5B6MA 5ID2B 5ECOB 1F37A 1GSSA 2P5RA 1ERUA 2YP6A 4HS1A 5H5RA 4CW9A 2GZYA 3ZMLA 2REMA 1JZRA 1W89A 2PERA 4PNGA 5J3RA 2ALBA 1K0OA 3GURA 1KEBA 3ERFA 1V57A 4OD7A 1GNEA 1J0FA 1O73A 7GSSA 3KD0A 3RAZA 4IKHA 3KMOA 2H71A 3MWHA 12GSA 4ZILA 3N9JA 2V6OA 2LSTA 2DJ1A 4HZ2A 2VM2A 1MDIA 1TW9A 3DXBA 2J9HA 5F06A 3CTFA 3D5JA 3GIXA 5AIVA 2H0GA 3DKSA 4J2FA 4N0ZA 1O81A 4I6XA 1TP9A 3IV4A 1TRUA 2HRAA 2GQMA 4G0IA 2K8VA 2L5LA 5GAPD 3QAGA 3ZVJD 3D6IA 1TRVA 3F9UA 4RI6A 3IPZA 4POKA 3W6GA 4DSSB 2KLXA 4GLTA 3FR6A 3TUEA 1G7EA 4TR1A 2OA7A 2QKEA 2G2QA 5AGYA 2PMTA 1S3CA 1X9MB 3S9FA 3HY2A 4I2UA 4DVCA 4ZL7A 1FB6A 2H6ZA 4NXIA 1A0RP 3LYPA 1M9AA 4N11A 5CREA 3IBHA 3F4TA 3KH7A 1TK0B 2LJAA 4EKZA 3CYNA 5FHIA 3GYKA 1ZYEA 2GZZA 4DSSA 5J9CA 3HD5A 1A0FA 1TDIA 2H0IA 3UBKA 4MA9A 2LRNA 2OBIA 1OE8A 3DWVA 4K7OA 5D9XA 4ZBDA 2MZCA 1QXHA 1O7UA 1I9DA 3P2AA 1PKWA 1XBSA 5E4WA 4YAVA 2UZ8A 3W8SA 4GXZA 2HSMB 2VL2A 1G7OA 3C8EA 2LRTA 5FWGA 2GGTA 1ZL9A 5DQYA 3EU3A 4TXOB 2L59A 5G31A 3HVVA 4FYBA 3QFAC 1HQOA 2R37A 4PXOA 3BCKA 1GWCA 3QPMA 3GRXA 4TKYA 5HR3A 1LBKA 4KE3A 4NV2A 4GRFA 1M99A 6GSYA 2V32A 2PWJA 3F6FA 5D9TA 4N30A 1H75A 2F51A 3D4MA 4QL7A 5EL8A 3E0UA 3APSA 1AQVA 1TK8B 2CX4A 3TKRA 4EF0A 1HYUA 3GSTA 1PX7A 2GZPA 2E2GA 2VCQA 4IP1A 2LRCA 4IN0A 3IC8A 1FAAA 1T8EB 2HSNB 2C3TA 3QAVA 1MD4A 2BJXA 4Q5FA 2K8SA 1HNAA 4K7IA 3IC4A 2YANA 3GX8A 1WMJA 1WWJA 3TJKA 3U6VA 2HYXA 1GTBA 2AB6A 3LORA 3LFLA 4EC0A 2KUCA 4TR0A 1GUHA 1VF2A 1XW5A 4PTSA 4POLA 4YH2A 3ZFLA 2HSYA 5H5QA 4FH8A 2RIIA 5HFKA 1Z6MA 2GVPA 3I69A 2GS3A 2YN1A 5JWRB 5KEJA 4HDEA 4X0XA 2Z9SA 1ML6A 3EYTA 2FWHA 4KH7A 3KP9A 4XTSA 1QGVA 3LGCA 2H74A 2RUFA 1SKRB 1NHYA 3HDCA 3E9JB 3CSHA 2R3XA 9GSSA 2O87A 2B6MA 4TR3A 4LMVA 2LNSA 4JR6A 3KEBA 3VWUA 3E3EA 2HE3A 3TJFA 2B7JA 4K0GA 1ABAA 1XVQA 2IJYA 4OMVA 1VF3A 3VI7A 3PPUA 1TI3A 2V6KA 5D9WA 1VGLA 2IIYA 4DEJA 5GZZB 4E8HA 1LJRA 2F8FA 2LNTA 2H01A 4K7NA 3ERGA 1QQ2A 4YQMA 5B6NA 4HEA2 5DAKB 4DSRA 6GSTA 2DJJA 4O5RA 3TJGA 3HKRA 2F9SA 4H86A 1PGTA 2BTOT 4NV5A 1K0NA 4WXTA 4PQIA 2N5FA 4KF9A 4BL7A 1XZOA 1EOHA 1JZOA 3LEFA 1RK4A 3VK9A 3GTUB 3GNJA 1A2JA 4EVMA 4Z7XA 2C0EA 2L5OA 3WD6A 3W8JA 4JU5A 1UC7A 1R7HA 5G1KA 1XOAA 4IGJA 3DIEA 1TU7A 4FO5A 3RBTA 5HR1A 2P31A 2H1DA 3C71A 4K1FA 3GUSA 2FNOA 4MMMA 4NMUA 5EY6A 1Q98A 2HXKA 3HXSA 3UJ1A 4KW6A 1W4VA 18GSA 1Y6EA 1X5CA 3HHVA 2ZCTA 5LCZA 5ECIB 4MZBA 1OVNA 3A2XA 1X5DA 1SL2B 1ERTA 1H4OA 11GSA 2VCZA 3GTUA 1TI1A 4AJ7A 2IMEA 2PPTA 5A4WA 4V2MA 2FY6A 5J4UA 1JZWA 1EZKA 3TKSE 1PD21 4AGSA 2MMAA 4ZBAA 4L8EA 2PN8A 5ECSA 2GDRA 2H6YA 1GLQA 5C00A 1XWAA 1GP1A 1ILOA 3D0ZA 4ECBA 4G2EA 3VWWA 4ECIA 1IYHA 1SYRA 4KA0A 3ZREA 2V2GA 4K9ZA 1PSQA 3DRNA 1X9SB 1T00A 1U3IA 3D4TA 1A23A 3EMPA 2X64A 1SK1A 2MBSA 2IMFA 1JLVA 2V1MA 1DBYA 5G5EA 1Y25A 2NDOA 5DCHA 5IOXA 1TOFA 2NBSA 2C80A 4ID0A 4BVYB 2VLTA 2VL9A 2FGXA 4MF7A 2PVOC 4KDXA 5ENUA 3ZFBA 2H0HA 3ME8A 1EEMA 5GSSA 4GWRA 4IJ3A 2RM6A 1Q4JA 3TRPA 1R5AA 4G19A 3UBLA 4E8EA 3FZ9A 2B5EA 3GKNA 2B7KA 1QFNA 2L57A 4NWYA 4Q5RA 2VOCA 4N0VA 3CBUA 3EC3A 2HI7A 1J9BA 5CRGA 5DCGA 1M2BA 3M1GA 1XVWA 3P7XA 3QD9A 2XHFA 2HZFA 4GQFA 5EVOA 4HI7A 1PMTA 5JCUA 1OKTA 3L4NA 1ERVA 2JL4A 2DMLA 4GF0A 4AJ6A 5B7CA 2O89A 4EUYA 3LYKA 5ELGA 5A5KA 3KIJA 4O32A 4XRAA 1ZOFA 1UA5A 1AXDA 4OCFA 4ZBBA 4KAEA 2AYTA 4L0WA 3TKSA 4POMA 3LQ7A 2DBCA 2IWTA 5GSTA 3KM6A 4KSMA 3GKMA 1KBNA 4EXJA 3KGKA 3MSZA 3UL3A 1V58A 1DE1A 1ZYQB 3WYWA 4EL1A 5D9VA 4BWSA 4TR1B 4L5OA 2K6VA 3DVXA 2IL3A 5D8IA 1JZDA 1O85A 6GSVA 2YZHA 3ED3A 2VD1A 1BEDA 1M2DA 2X8GA 2KP2A 1ON4A 1Z7RA 2KP1A 1U6TA 2GQKA 2L6DA 3C1RA 3GKXA 1MDJA 4XIHA 3N5OA 3J7Yk 3ZMKA 1GSYA 1UN2A 2OADA 1GH2A 2O85A 5IO0A 2H66A 3SBCA 1B9YC 1A2MA 3WGXA 1ZCPA 1FW1A 3QFBC 5D96A 1SK2A 4O7HA 4PNFA 2HRKB 1B9XC 4MK3A 4BPYA 4BWQA 1N8JA 1EP8A 4MPGA 4YAPA 3TJBA 5LNKe 5IPGA 4N10A 2DJKA 5CO3A 5DVBA 1GULA 4EDYA 1SD9A 2LTKA 4LMWA 3IRAA 2DIYA 1CQGA 2JACA 3MAKA 4F82A 4IS0A 2C4JA 1RW1A 3CRTA 2CX3A 2TIRA 2HFDA 3GMFA 4PURA 1GNWA 1JFUA 2PVQA 2AJQB 1YDKA 3D21A 4ZL8A 4QQ7A 3IE3A 3BJ5A 5BMUA 2HRKA 2C1YA 5JWQB 2WFCA 3QCPA 1X5EA 1BAYA 2YWNA 22GSA 4LA1A 3TJJA 2GSTA 1A8YA 3F0IA 3ERWA 2QGVA 5EPFA 4IW9A 4G10A 5IMVA 3I43A 1XWCA 1J08A 2CT6A 3F3QA 4RI7A 2WCIA 4TW5A 4IQ1A 3G7YA 3KP8A 4PGTA 3EU4A 5ABRA 1WP0A 4CDOA 2R5GA 3HZ8A 1XPVA 2JZTA 2H1AA 3IAS2 4RQRA 2YWOA 1O8WA 4MZCA 3IOSA 5F0GA 3UVTA 1HD2A 1RQMA 3J7Yb 3EINA 4YQUA 3VPQA 3MDKA 3ZVJA 1XWBA 3TKSC 3BCIA 3H93A 2X8CA 2K9FA 4G0LA 5IMDA 4EDZA 3L0HA 2PU9C 3DGQA 1N2AA 3IK7A 1GTAA 3HVXA 3TB2A 4JZQA 5DQSA 2OE3A 1YY7A 5G5FA 3LJRA 3HJOA 1GSUA 4HOJA 2VCXA 4LL1B 5IMFA 4GTUA 4PQHA 4K0NA 4JE1A 1NM3A 4KB3A 1TRSA 2V41A 3IA1A 4ECCA 1YEXA 3FZAA 2ZNMA 3GL3A 3Q6OA 2DLXA 4HQSA 2I9HA 4GSSA 4LLRA 1T4ZA 5IQYA 4MCUA 4KX4A 1XWGA 16GSA 5L71A 4F03A 2XPEA 1TXXA 3KZQA 3ME7A 1YEPA 4ULXA 2M80A 4OCEA 1OC9A 2LJRA 4X1UA 4WETA 4KUNA 1OKDA 3HJMA 4GQCA 3VWVA 1SJIA 1OC3A 13GSA 1XXUA 4MJEA 1M7TA 5KN2A 3UIWA 1T1VA 2DMMA 3HVSA 3DEXA 1WPIA 4FIWA 4KSOA 1YKAA 2LKUA 2RUEA 6GSSA 1QMVA 3ZLPA 2D2ZA 2H6XA 1YQ1A 2VAFA 2IFQB 2A2SA 3FK8A 5G30A 1AC1A 4ZB9A 5J9BA 2XC2A 1I5GA 2B1KA 4K8MA 3A3TA 2FCHA 4BL7B 1XCCA 4MF5A 4TN8A 1OAZA 4BVXA 1WE0A 3EWLA 2YOIA 2R2JA 1NHOA 2VO4A 2OE0A 5IIZA 1K0CA 1ZMAA 1MTCA 4GCIA 4L0UA 5A4UA 3O6TA 5HFIA 3DVWA 3PINA 1K3YA 3EE2A 3KJYA 2PGTA 4HU9A 4WF4A 3NOFA 5AISA 2IFQA 5ECNB 2ON5A 1B4PA 3PH9A 2WB9A 5B8BA 3IAM2 5ECQB 5JWOB 2WULA 4WBRD 4KGIA 4V1Ap 3EVIA 1YZXA 4MJBA 5J5NA 2CVBA 1K0AA 2FUG2 3FKFA 1AUCA 2IMKA 4OFNA 1VRSD 1K3LA 1NW2A 4JEDA 3F6DA 2OJLA 4USSA 4OO4A 1SL0B 4G9HA 2NVLA 1AQWA 1OC8A 4MDCA 3TDGA 4XCSA 4YQVA 2LV3A 1B8XA 1FB0A 3FHKA 1GLPA 3G9BA 2IMDA 1TU8A 3WT2A 1GL8A 4OFMA 5CRDA 3ZTLA 2GTUA 1EOGA 4XS4A 2VCWA 4NAXA 2C3QA 4J57E 3L9SA 5GAND 3D22A 4DSQA 2C0GA 4D73A 4P3YB 3C7MA 2H1BA 2HSHA 4F0BA 3TRQA 1X0RA 3RHCA 3UOMA 2H1GA 1AQXA 5G1LA 2JZRA 3IDVA 4OWYA 2MYGA 1YF0A 20GSA 5CAXA 2FHEA 2OACA 4KCEA 3IK9A 2LQQA 1OE7A 1YJ6A 1M9BA 3H1NA 4Q5QA 4L5LA 2F8AA 2M46A 3C73A 3HJPA 1SJ6A 2PBJA 3VPTA 1PA3A 3F4RA 4G0KA 2GSRA 1BJXA 1V98A 2L6CA 3KXOA 2AHEA 3GFKA 1O8XA 5ECPB 4J56E 2I81A 19GSA 5ECHB 3ZIVA 1Z3EA 2BMXA 4ZXGA 2X8HA 2CVDA 2N5AA 3PR8A 5AIXA 4WEYA 3GSSA 1BQ7A 3RPNA 1TJDA 1R5PA 5LD0A 10GSA 1O6JA 1WJKA 4JRRA 4KNDA 2EIQA 2L4CA 5ECLB 2J23A 4EO3A 1GUMA 2GLRA 5IPHA 2H30A 3OR5A 3QR6A 2EIRA 2GQLA 3VWXA 1SENA 1G6WA 3ZZXA 1SU9A 3EURA 5DJLA 1WIKA 3C1SA 3I6AA 1QK8A 4NPBA 3QDNA 3CMIA 3FZ4A 2WGRA 2RM5A 1HNBA 1GSEA 4PUFC 1EGRA 5KN1A 2HZEB 1TK5B 3KH9A 4HJ2A 5DALA 2VM1A 3M0FA 4WBJA 2HQTA 4F2IA 1GTIA 4Q5NA 5JCWA 4TR4A 4TVEA 2R4VA 5A4VA 4NHZA 5JCGA 3TKQA 5HR0A 2VIMA 1SKSB 3A2VA 4MH3A 5G2ZA 2YWMA 3RHBA 2M72A 1YKCA 3Q18A 4IHUA 4PX1A 2A2RA 3NIVA 1IYIA 1M0UA 5INYA 4PUAA 1USBA 1BG5A 3HA9A 4NHWA 5CP1A 2HZEA 3GL5A 1MD3A 5F8BA 3UARA 1F6MC 1ZZYA 5D93A 4MP4A 2DIZA 2KHPA 1SL1B 17GSA 3RPPA 8GSSA 2WZ9A 3VFIA 2H70A 1FG4A 5ECMB 4ZB8A 3AY8A 5ID2A 2H19A 3A2WA 4MJAA 4FQUA 2FWFA 4TRXA 2H8LA 1URMA 2YZUA 2C0FA 3RDWA 4JBBA 3TOTA 3O3TA
chains in the Genus database with same CATH superfamily
5BMUB 1JLWA 4IELA 3CTGA 5D73A 3ZIJA 5IOWA 5CRWA 5CRHA 2E2MA 3LWAA 3FEUA 2YNXA 2QC7A 4ILFA 2CAQA 2MMNA 3F63A 4IQAA 5ECRB 5DBQA 1XFLA 4CHSA 1VF1A 5AN1A 3H8QA 2JSYA 3M9KA 4PQ1A 3CXGA 2XPDA 5HQPA 2YV9A 2O7KA 1QUWA 3G7IA 2FLSA 2LS5A 3KTBA 3FYGA 2NTOA 5F05A 4QL9A 3O76A 1E2YA 2JU5A 3M9JA 4POBA 4HJMA 1CQHA 5COHA 2NPBA 2VL3A 2P0GA 2WS2A 1DE2A 3GX0A 3EMXA 1GSQA 3FRCA 4O5QA 5DDLA 2VD0A 3IHQA 3VI5A 3WT1A 4ZB6A 3A5WA 2KOKA 1HNCA 2YCDA 14GSA 3DMLA 4RQXA 2EFDA 4HQZA 1F2EA 2CQ9A 5IMZA 3QOUA 2JZSA 1GUKA 1SD8A 2ES7A 3VURA 3F4SA 1XWKA 3L78A 2OKAA 3TOUA 1A8LA 4OFTA 1XIYA 4RUVA 2B3SA 2FD3A 1XW9A 1EV4A 2C8UA 1VF4A 1EWXA 4I5QA 4Z2RA 4LL4B 2WRTA 1KTEA 2R0GA 3ISOA 2GT6A 2DJ2A 4TXVA 2B5YA 3CWGA 1OC9B 4MPFA 2VUPA 1G6YA 2C3NA 4IVFA 5A5HA 1GSDA 5HFGA 3GHAA 1XOBA 2GSQA 1WRYA 4MJCA 4WKWA 4ISDA 3ZL5A 1PL2A 2HSMA 6GSWA 3P90A 3L9VA 4ACSA 1MDKA 2CV4A 2JADA 2LQOA 3APOA 2MMOA 2ON7A 2H76A 4JR4A 4IP6A 1AAZA 1AIUA 1AW9A 1K0BA 1BX9A 3BD2A 4TXOA 3R3EA 5KN0A 2G0FA 3CQFA 2EC4A 2QSIA 1K0DA 4BVXB 3GA4A 1T4YA 2HLSA 3Q19A 2DJ3A 2IMIA 1SYXA 3FY7A 1BG1A 2O36A 1UVZA 2LJKA 1WOUA 3DD3A 2HNLA 3SWLA 1U88A 3IXRA 3I9V2 1TTZA 1U87A 4ECJA 4ML1A 3ZITA 1C72A 3K8NA 3FW2A 4V2NA 2FWEA 2CZ3A 2K18A 2HSNA 3R2QA 3MNGA 4MZWA 5E59A 2DJ0A 2O3EA 1ZGNA 1G0TA 3QAWA 2N5BA 6GSUA 1F3AA 4AKHA 2CVKA 4IBPA 4K2XA 6GSXA 1YEWC 3UMAA 4I2TA 5B8AA 4BA7A 2O8VB 4MH2A 1JHBA 4CY6A 2UV8G 1MEKA 3FZ5A 2HRFA 1A24A 4MF6A 4AI6A 4F0CA 3PGTA 2A4VA 3LXTA 2AAWA 1ST9A 5J41A 3DYRA 4ZL9A 1ACVA 3Q74A 2FA4A 3LSZA 2ZUPA 4EE0A 2FWGA 2VLVA 1FVKA 1SVLA 2VCVA 3CSJA 4XS4B 1M2AA 4EIQA 3HCZA 1Z7PA 4HZ4A 2RLIA 2GSSA 3NZNA 1SKWB 2VL2C 1ERWA 4HSCX 1FHEA 3F3RA 1SVMA 2AUVA 1Y1UA 2WVXA 1GSFA 4D73B 1PL1A 1U3AA 5ECKB 4WR5A 2DKHA 1GTUA 3GH6A 3G7JA 1FO5A 1Z6NA 3GV1A 2B5XA 1LU4A 1V9WA 1XW6A 2LEGA 2DC5A 1R4WA 1K3OA 3HZ4A 1EGOA 5CYYA 2XBIA 4TOPA 3GN3A 2VLUA 2I3YA 4F9ZA 3P8WA 4XRDA 2AV4A 3APQA 4K6XA 2OE1A 1PN9A 5IMCA 2L4QA 4OO5A 4KDYA 4YKGA 3LG6A 1S3DA 1F9MA 4X43A 3BBYA 5IO2A 2MMZA 3M8NA 3UAPA 2YJHA 5DAKA 2H72A 4ZIJA 3VLNA 3HYPA 1PX6A 1THOA 1EEJA 2DSAA 2WJUA 1F3BA 5KN3A 3KCMA 1EV9A 1Z9HA 5H5SA 2IPAA 2VCTA 1S3AA 2IN3A 3V1WA 2F3MA 3UVHA 3UEMA 2CAIA 1PQNA 3KTLA 3F8UA 3FR3A 3FR9A 1XG8A 2E7PA 3ZYWA 3CSIA 1EP7A 4V2LA 1V2AA 1PKZA 1X9WB 5FT3A 2YPMA 2WDUA 2JSZA 5IM9A 4IJIA 5HR2A 1PRXA 1A2LA 1YVLA 4BIKA 3WGEA 1FVJA 4EIPA 3H4KA 2I1UA 1BYEA 4FYUA 3KMNA 4ML6A 2YWIA 4I8BA 4WR4A 5F07A 2TRXA 4K2DA 1B48A 2E0QA 3H79A 1OYJA 4HU7A 3TRXA 3QMXA 3ZRDA 3LXZA 2O5VA 4XS1A 2R6KA 1R26A 3M3MA 2R0PA 4E68A 1FOVA 4K5RA 3GKKA 4GSTA 2YJ7A 4AJ8A 3TKPA 4G01A 5CNWA 1Z5YE 4MLYA 4A5PA 1V40A 1DUGA 1E6BA 4I97A 3TGZA 1TKDB 2LUSA 1NSWA 2HRNA 1TRWA 4MNNA 5DALB 4FYCA 5ELAA 4GSNA 2H73A 4XS6A 2OT3A 5IMAA 2OBKA 2PUKC 4KDUA 3IR4A 4O92A 4HUAA 4KCAA 3TCOA 2CZ2A 2HT9A 2X4AA 2XBQA 3US3A 2P5QA 1K0MA 1SJZA 2EIOA 4AF2A 1THXA 2GT5A 5DJMA 2B1LA 2X99A 4X4JA 1SK0A 1T3BA 2I4AA 3GH9A 3WGDA 1T7PB 4XHMA 3BOAA 1YF1A 2WW0A 1GRXA 3JCML 2FA8A 5C04A 1B4QA 2H75A 3CRUA 2MBTA 2YV7A 4WF5A 1DSBA 1KNGA 3L9UA 3TU3B 4MABA 1I1IP 2C0DA 2CA8A 4V1Ag 3U5RE 2TRCP 4BVYA 5B6MA 5ID2B 5ECOB 1F37A 1GSSA 2P5RA 1ERUA 2YP6A 4HS1A 5H5RA 4CW9A 2GZYA 3ZMLA 2REMA 1JZRA 1W89A 2PERA 4PNGA 5J3RA 2ALBA 1K0OA 3GURA 1KEBA 3ERFA 1V57A 4OD7A 1GNEA 1J0FA 1O73A 7GSSA 3KD0A 3RAZA 4PHZC 4IKHA 3KMOA 2H71A 4PI0C 3MWHA 12GSA 4ZILA 3N9JA 2V6OA 2LSTA 2DJ1A 4HZ2A 2VM2A 1MDIA 1TW9A 3DXBA 3MIXA 2J9HA 5F06A 3CTFA 3D5JA 3GIXA 5J4YA 5AIVA 2H0GA 3DKSA 4J2FA 4N0ZA 1O81A 4I6XA 1TP9A 3IV4A 1TRUA 2HRAA 2GQMA 4G0IA 2H1LA 2K8VA 2L5LA 5GAPD 3QAGA 3ZVJD 3D6IA 1PN0A 1TRVA 3F9UA 4RI6A 3IPZA 4POKA 3W6GA 4DSSB 2KLXA 4GLTA 3FR6A 3TUEA 1G7EA 4TR1A 2OA7A 2QKEA 2G2QA 5AGYA 2PMTA 1S3CA 3A5IA 1X9MB 3S9FA 3HY2A 4I2UA 4DVCA 4ZL7A 1FB6A 2H6ZA 5KOWA 4NXIA 1A0RP 1M9AA 3LYPA 4N11A 5CREA 3IBHA 3F4TA 3KH7A 1TK0B 2LJAA 4EKZA 3CYNA 5FHIA 3IHGA 3GYKA 1ZYEA 2GZZA 4DSSA 2QA2A 5J9CA 3HD5A 1A0FA 1TDIA 2H0IA 3UBKA 4MA9A 2LRNA 2OBIA 1OE8A 3DWVA 4K7OA 5D9XA 4ZBDA 2MZCA 1QXHA 5A5HB 1O7UA 1I9DA 3P2AA 1PKWA 1XBSA 5E4WA 4YAVA 2UZ8A 3W8SA 4GXZA 2HSMB 2VL2A 1G7OA 1S3RA 3C8EA 2LRTA 5FWGA 2GGTA 1ZL9A 5DQYA 3EU3A 4TXOB 2L59A 5G31A 3HVVA 4FYBA 3QFAC 1HQOA 2R37A 4PXOA 3BCKA 1GWCA 3QPMA 3GRXA 4TKYA 5HR3A 1LBKA 4KE3A 4NV2A 4GRFA 1M99A 6GSYA 2V32A 2PWJA 3F6FA 4FXYP 5D9TA 4N30A 1H75A 2F51A 3D4MA 4QL7A 5EL8A 3E0UA 3APSA 1AQVA 1TK8B 2CX4A 3TKRA 4EF0A 4QMKA 1HYUA 1ZYNA 3GSTA 1PX7A 3RGBC 2GZPA 2E2GA 2VCQA 4IP1A 2LRCA 4N3ZA 4IN0A 3IC8A 1FAAA 1T8EB 2HSNB 2C3TA 3QAVA 1MD4A 2BJXA 4Q5FA 2K8SA 1HNAA 4K7IA 3RFRC 3IC4A 2YANA 3GX8A 4GDFA 1WMJA 1WWJA 3TJKA 3U6VA 2HYXA 1GTBA 2AB6A 3LORA 3LFLA 4K5SA 4EC0A 2KUCA 4TR0A 1GUHA 1VF2A 1XW5A 4PTSA 4POLA 4YH2A 3ZFLA 2HSYA 5H5QA 4FH8A 2RIIA 5HFKA 1Z6MA 2GVPA 3I69A 2A4HA 2GS3A 2YN1A 5JWRB 5KEJA 4HDEA 4X0XA 2Z9SA 1ML6A 3EYTA 2FWHA 4KH7A 3KP9A 4XTSA 1QGVA 3LGCA 2H74A 2RUFA 1SKRB 1NHYA 3HDCA 3E9JB 3HVNA 3CSHA 2WVXB 2R3XA 9GSSA 2O87A 2B6MA 4ICYA 4TR3A 4LMVA 2LNSA 4JR6A 3KEBA 3VWUA 3E3EA 2HE3A 3TJFA 2B7JA 4K0GA 1ABAA 1XVQA 2IJYA 4OMVA 1VF3A 1M3JA 3VI7A 3PPUA 1TI3A 2V6KA 5D9WA 1VGLA 2IIYA 4DEJA 5GZZB 4E8HA 1LJRA 2F8FA 2LNTA 2H01A 4K7NA 3ERGA 1QQ2A 4YQMA 5B6NA 5A1NB 4HEA2 4W66A 5DAKB 4DSRA 6GSTA 2DJJA 4O5RA 3TJGA 3HKRA 2F9SA 4H86A 1PGTA 2BTOT 4NV5A 1K0NA 4WXTA 4PQIA 2N5FA 4KF9A 4BL7A 1XZOA 1EOHA 1JZOA 3LEFA 1RK4A 3VK9A 3GTUB 3GNJA 1A2JA 4EVMA 4Z7XA 2C0EA 2L5OA 3WD6A 3W8JA 4JU5A 1UC7A 2WVYA 1R7HA 5G1KA 1XOAA 5A1NA 4IGJA 3DIEA 1TU7A 4FO5A 3RBTA 5HR1A 2P31A 2H1DA 3C71A 3EPTA 4K1FA 3GUSA 2FNOA 4MMMA 4NMUA 5EY6A 1Q98A 2HXKA 3HXSA 3UJ1A 1PFOA 4KW6A 1W4VA 2VKZG 18GSA 1Y6EA 1X5CA 3HHVA 2ZCTA 5LCZA 5ECIB 4MZBA 1OVNA 3A2XA 1X5DA 1SL2B 1ERTA 1H4OA 11GSA 5KOXA 2VCZA 3GTUA 1TI1A 4AJ7A 2IMEA 2PPTA 5A4WA 4V2MA 2FY6A 5J4UA 1JZWA 1EZKA 3TKSE 1PD21 4AGSA 2MMAA 4ZBAA 4L8EA 2PN8A 5ECSA 2GDRA 1SVOA 2H6YA 1GLQA 5C00A 1XWAA 1GP1A 1ILOA 3D0ZA 4ECBA 2QA1A 4G2EA 3VWWA 4ECIA 1IYHA 1SYRA 4KA0A 3ZREA 2V2GA 4K9ZA 1PSQA 3DRNA 1X9SB 1T00A 1U3IA 3D4TA 1TXUA 1A23A 3EMPA 2X64A 1SK1A 2MBSA 2IMFA 1JLVA 2V1MA 1DBYA 5G5EA 1Y25A 2NDOA 5DCHA 5IOXA 2R0CA 1TOFA 2NBSA 2C80A 5J47A 4ID0A 4BVYB 2VLTA 2VL9A 2FGXA 4MF7A 2PVOC 4KDXA 5ENUA 3ZFBA 2EFCA 2H0HA 3ME8A 1EEMA 5GSSA 4GWRA 4IJ3A 2RM6A 1Q4JA 3TRPA 1R5AA 4G19A 3UBLA 4E8EA 3FZ9A 2B5EA 3GKNA 2WW2A 2B7KA 1QFNA 2L57A 4NWYA 2WW3A 4Q5RA 3CHXC 4N0VA 2VOCA 3CBUA 3EC3A 2HI7A 1J9BA 5CRGA 5DCGA 1M2BA 3M1GA 1XVWA 3P7XA 3QD9A 2XHFA 2HZFA 4GQFA 5EVOA 4HI7A 1PMTA 5JCUA 1OKTA 3L4NA 1ERVA 2JL4A 2DMLA 4GF0A 4AJ6A 5B7CA 2O89A 4EUYA 3LYKA 5ELGA 5A5KA 3KIJA 4O32A 4XRAA 3LW9A 1ZOFA 1UA5A 1AXDA 5J40A 4OCFA 4ZBBA 4KAEA 2AYTA 4L0WA 4Z2TA 3TKSA 4POMA 3LQ7A 2DBCA 2IWTA 5GSTA 3KM6A 4KSMA 3GKMA 1KBNA 4EXJA 3KGKA 3MSZA 3UL3A 1V58A 1DE1A 1ZYQB 3WYWA 4EL1A 5D9VA 4BWSA 4TR1B 4L5OA 2K6VA 3DVXA 2IL3A 5D8IA 1JZDA 1O85A 6GSVA 2YZHA 3ED3A 4ZB7A 2VD1A 1BEDA 1M2DA 2X8GA 2KP2A 1ON4A 1Z7RA 2KP1A 1U6TA 2GQKA 2L6DA 3C1RA 3GKXA 1MDJA 3FMWA 4XIHA 3N5OA 3J7Yk 3ZMKA 1GSYA 1UN2A 2OADA 1GH2A 2O85A 4Z2UA 5IO0A 2H66A 3SBCA 1B9YC 1A2MA 3WGXA 1ZCPA 1FW1A 3QFBC 5D96A 1SK2A 4O7HA 4PNFA 2HRKB 1B9XC 1S4BP 4MK3A 4BPYA 4BWQA 1N8JA 1EP8A 4MPGA 4YAPA 3TJBA 5LNKe 5IPGA 4N10A 2DJKA 5CO3A 5DVBA 1GULA 4EDYA 1SD9A 2LTKA 4LMWA 3IRAA 2DIYA 1CQGA 2JACA 3MAKA 4F82A 4IS0A 2C4JA 1RW1A 3CRTA 2CX3A 2TIRA 2HFDA 3GMFA 4PURA 1GNWA 1JFUA 2PVQA 2AJQB 1YDKA 3D21A 4ZL8A 4QQ7A 3IE3A 3BJ5A 5BMUA 2HRKA 2C1YA 5JWQB 2WFCA 3QCPA 1X5EA 1BAYA 2YWNA 22GSA 4LA1A 3TJJA 2GSTA 1A8YA 3F0IA 3ERWA 2QGVA 5EPFA 4IW9A 4G10A 5IMVA 3I43A 1XWCA 1J08A 2CT6A 3F3QA 4RI7A 2WCIA 4TW5A 4IQ1A 3G7YA 3KP8A 4PGTA 3EU4A 5ABRA 1WP0A 4CDOA 2R5GA 3HZ8A 1XPVA 2JZTA 2H1AA 3IAS2 4RQRA 2YWOA 1O8WA 4MZCA 3IOSA 5F0GA 3UVTA 1HD2A 1RQMA 3J7Yb 3EINA 4YQUA 3VPQA 3MDKA 3ZVJA 1XWBA 3TKSC 5A34B 3BCIA 3H93A 2X8CA 2K9FA 4G0LA 2WW1A 5IMDA 4EDZA 3L0HA 2PU9C 3DGQA 1N2AA 3IK7A 1GTAA 1FOHA 3HVXA 3TB2A 4JZQA 5DQSA 2OE3A 1ZYPA 1YY7A 5G5FA 3LJRA 3HJOA 1GSUA 4HOJA 2VCXA 2EFEA 4LL1B 5IMFA 4GTUA 4PQHA 4K0NA 4JE1A 1NM3A 4KB3A 1TRSA 2V41A 3IA1A 4ECCA 1YEXA 3FZAA 2ZNMA 3GL3A 5A34A 3Q6OA 2DLXA 4HQSA 2I9HA 4GSSA 4LLRA 1T4ZA 5IQYA 4MCUA 4KX4A 1XWGA 16GSA 5L71A 4F03A 2XPEA 1TXXA 3KZQA 3ME7A 1YEPA 4ULXA 4AKIA 2M80A 4OCEA 1OC9A 2LJRA 4X1UA 4WETA 4KUNA 1OKDA 3HJMA 4GQCA 3VWVA 1SJIA 1OC3A 13GSA 1XXUA 4MJEA 1M7TA 5KN2A 3UIWA 1T1VA 2DMMA 3HVSA 3DEXA 1WPIA 4FIWA 4KSOA 1YKAA 2LKUA 2RUEA 6GSSA 1QMVA 3ZLPA 2D2ZA 2H6XA 1YQ1A 2VAFA 2IFQB 2A2SA 3FK8A 2WZSA 5G30A 1AC1A 4ZB9A 5J9BA 2XC2A 1I5GA 2B1KA 4K8MA 3A3TA 2FCHA 4BL7B 1XCCA 4MF5A 4TN8A 1OAZA 4BVXA 1WE0A 3EWLA 2YOIA 2R2JA 1NHOA 2VO4A 2OE0A 5IIZA 1K0CA 1ZMAA 4AKGA 1MTCA 4GCIA 4L0UA 5A4UA 3O6TA 4O5UA 5HFIA 3DVWA 3PINA 1K3YA 3EE2A 3KJYA 5J4VA 2PGTA 4HU9A 4WF4A 3NOFA 5AISA 2IFQA 5ECNB 2ON5A 1B4PA 3PH9A 2WB9A 5B8BA 3IAM2 5ECQB 2X49A 5JWOB 2WULA 4WBRD 4KGIA 4V1Ap 3EVIA 1YZXA 4MJBA 5J5NA 2CVBA 1K0AA 2FUG2 3FKFA 1AUCA 2IMKA 4OFNA 1VRSD 4PI2C 1K3LA 1NW2A 4JEDA 3F6DA 2OJLA 4USSA 4OO4A 1SL0B 4G9HA 2NVLA 1AQWA 1OC8A 4MDCA 3MYDA 3TDGA 4XCSA 4YQVA 2LV3A 1B8XA 1FB0A 3FHKA 1GLPA 3G9BA 2IMDA 1TU8A 3WT2A 1GL8A 4OFMA 5CRDA 3ZTLA 2GTUA 1EOGA 4XS4A 2VCWA 4NAXA 2C3QA 4J57E 2A2PA 3L9SA 5GAND 3D22A 4DSQA 2C0GA 4D73A 4P3YB 3C7MA 2H1BA 2HSHA 4F0BA 3TRQA 1X0RA 3RHCA 3UOMA 2H1GA 1AQXA 5G1LA 2JZRA 3IDVA 4OWYA 2MYGA 1YF0A 20GSA 5CAXA 2FHEA 2OACA 4KCEA 3IK9A 2LQQA 1OE7A 1YJ6A 1M9BA 3H1NA 4Q5QA 4L5LA 2F8AA 2M46A 3C73A 3HJPA 1SJ6A 2PBJA 3VPTA 1PA3A 3F4RA 4G0KA 2GSRA 1BJXA 1V98A 2EFHA 2L6CA 3KXOA 2AHEA 3GFKA 1O8XA 5ECPB 1N25A 1M3IA 4J56E 2I81A 19GSA 5ECHB 3ZIVA 1Z3EA 2BMXA 4ZXGA 2X8HA 2CVDA 2N5AA 3PR8A 5AIXA 4WEYA 3GSSA 1BQ7A 3RPNA 1TJDA 1R5PA 5LD0A 10GSA 1O6JA 1WJKA 4JRRA 4KNDA 2EIQA 2L4CA 5ECLB 2J23A 4EO3A 1GUMA 2GLRA 5IPHA 2H30A 3OR5A 2DKIA 3QR6A 2EIRA 2GQLA 3VWXA 4YKFA 1BF5A 1SENA 1G6WA 3ZZXA 1SU9A 3EURA 5DJLA 1WIKA 3C1SA 3I6AA 1QK8A 4NPBA 3QDNA 3CMIA 3FZ4A 2WGRA 2RM5A 1HNBA 1GSEA 4PUFC 1EGRA 5KN1A 2HZEB 1TK5B 4CY8A 3KH9A 4HJ2A 5DALA 4AKXB 2VM1A 3M0FA 4WBJA 2HQTA 4F2IA 1GTIA 4Q5NA 5JCWA 4TR4A 4TVEA 2R4VA 5A4VA 4NHZA 5JCGA 5BRTA 3TKQA 5HR0A 2VIMA 1SKSB 3A2VA 4MH3A 5G2ZA 2WVZA 2YWMA 3RHBA 2M72A 1YKCA 3Q18A 4IHUA 4PX1A 2A2RA 3NIVA 1IYIA 1M0UA 5INYA 4PUAA 1USBA 1BG5A 3HA9A 4NHWA 5CP1A 2HZEA 3GL5A 1MD3A 5F8BA 3UARA 1F6MC 1ZZYA 5D93A 4MP4A 2DIZA 2KHPA 1SL1B 17GSA 3RPPA 8GSSA 2WZ9A 3VFIA 2H70A 1FG4A 5ECMB 4ZB8A 3AY8A 5ID2A 2H19A 3A2WA 4MJAA 4FQUA 2FWFA 4TRXA 2H8LA 3HMJG 1URMA 2YZUA 2C0FA 3RDWA 4JBBA 3TOTA 3O3TA
chains in the Genus database with same CATH topology
5BMUB 1JLWA 4IELA 3CTGA 5D73A 3ZIJA 5IOWA 5CRWA 5CRHA 2E2MA 3LWAA 3FEUA 2YNXA 2QC7A 4ILFA 2CAQA 2MMNA 3F63A 4IQAA 5ECRB 5DBQA 1XFLA 4CHSA 1VF1A 5AN1A 3H8QA 2JSYA 3M9KA 4PQ1A 3CXGA 2XPDA 5HQPA 2YV9A 2O7KA 1QUWA 3G7IA 2FLSA 2LS5A 3KTBA 3FYGA 2NTOA 5F05A 4QL9A 3O76A 1E2YA 2JU5A 3M9JA 4POBA 4HJMA 1CQHA 5COHA 2NPBA 2VL3A 2P0GA 2WS2A 1DE2A 3GX0A 3EMXA 1GSQA 3FRCA 4O5QA 5DDLA 2VD0A 3IHQA 3VI5A 3WT1A 4ZB6A 3A5WA 2KOKA 1HNCA 2YCDA 14GSA 3DMLA 4RQXA 2EFDA 4HQZA 1F2EA 2CQ9A 5IMZA 3QOUA 2JZSA 1GUKA 1SD8A 2ES7A 3VURA 3F4SA 1XWKA 3L78A 2OKAA 3TOUA 1A8LA 4OFTA 1XIYA 4RUVA 2B3SA 2FD3A 1XW9A 1EV4A 2C8UA 1VF4A 1EWXA 4I5QA 4Z2RA 4LL4B 2WRTA 1KTEA 2R0GA 3ISOA 2GT6A 2DJ2A 4TXVA 2B5YA 3CWGA 1OC9B 4MPFA 2VUPA 1G6YA 2C3NA 4IVFA 5A5HA 1GSDA 5HFGA 3GHAA 1XOBA 2GSQA 1WRYA 4MJCA 4WKWA 4ISDA 3ZL5A 1PL2A 2HSMA 6GSWA 3P90A 3L9VA 4ACSA 1MDKA 2CV4A 2JADA 2LQOA 3APOA 2MMOA 2ON7A 2H76A 4JR4A 4IP6A 1AAZA 1AIUA 1AW9A 1K0BA 1BX9A 3BD2A 4TXOA 3R3EA 5KN0A 2G0FA 2EC4A 2QSIA 1K0DA 4BVXB 3GA4A 1T4YA 2HLSA 3Q19A 2DJ3A 2IMIA 1SYXA 3FY7A 1BG1A 1UVZA 2LJKA 1WOUA 3DD3A 2HNLA 3SWLA 1U88A 3IXRA 3I9V2 1TTZA 1U87A 4ECJA 4ML1A 3ZITA 1C72A 3K8NA 3FW2A 4V2NA 2FWEA 2CZ3A 2K18A 2HSNA 3R2QA 3MNGA 4MZWA 5E59A 2DJ0A 1ZGNA 1G0TA 3QAWA 2N5BA 6GSUA 1F3AA 4AKHA 2CVKA 4IBPA 4K2XA 6GSXA 3UMAA 4I2TA 5B8AA 4BA7A 2O8VB 4MH2A 1JHBA 4CY6A 2UV8G 1MEKA 3FZ5A 2HRFA 1A24A 4MF6A 4AI6A 4F0CA 3PGTA 2A4VA 3LXTA 2AAWA 1ST9A 5J41A 3DYRA 4ZL9A 1ACVA 3Q74A 2FA4A 3LSZA 2ZUPA 4EE0A 2FWGA 2VLVA 1FVKA 1SVLA 2VCVA 3CSJA 4XS4B 1M2AA 4EIQA 3HCZA 1Z7PA 4HZ4A 2RLIA 2GSSA 3NZNA 1SKWB 2VL2C 1ERWA 1FHEA 3F3RA 1SVMA 2AUVA 1Y1UA 1GSFA 4D73B 1PL1A 1U3AA 5ECKB 4WR5A 2DKHA 1GTUA 3GH6A 3G7JA 1FO5A 1Z6NA 3GV1A 2B5XA 1LU4A 1V9WA 1XW6A 2LEGA 2DC5A 1R4WA 1K3OA 3HZ4A 1EGOA 5CYYA 2XBIA 4TOPA 3GN3A 2VLUA 2I3YA 4F9ZA 3P8WA 4XRDA 2AV4A 3APQA 4K6XA 2OE1A 1PN9A 5IMCA 2L4QA 4OO5A 4KDYA 4YKGA 3LG6A 1S3DA 1F9MA 4X43A 3BBYA 5IO2A 2MMZA 3M8NA 3UAPA 2YJHA 5DAKA 2H72A 4ZIJA 3VLNA 3HYPA 1PX6A 1THOA 1EEJA 2DSAA 2WJUA 1F3BA 5KN3A 3KCMA 1EV9A 1Z9HA 5H5SA 2IPAA 2VCTA 1S3AA 2IN3A 3V1WA 2F3MA 3UVHA 3UEMA 2CAIA 1PQNA 3KTLA 3F8UA 3FR3A 3FR9A 2E7PA 3ZYWA 3CSIA 1EP7A 4V2LA 1V2AA 1PKZA 1X9WB 5FT3A 2YPMA 2WDUA 2JSZA 5IM9A 4IJIA 5HR2A 1PRXA 1A2LA 1YVLA 3WGEA 1FVJA 4EIPA 3H4KA 2I1UA 1BYEA 4FYUA 3KMNA 4ML6A 2YWIA 4I8BA 4WR4A 5F07A 2TRXA 4K2DA 1B48A 2E0QA 3H79A 1OYJA 4HU7A 3TRXA 3QMXA 3ZRDA 3LXZA 2O5VA 4XS1A 2R6KA 1R26A 3M3MA 2R0PA 4E68A 1FOVA 4K5RA 3GKKA 4GSTA 2YJ7A 4AJ8A 3TKPA 4G01A 5CNWA 1Z5YE 4MLYA 4A5PA 1V40A 1DUGA 1E6BA 4I97A 3TGZA 1TKDB 2LUSA 1NSWA 2HRNA 1TRWA 4MNNA 5DALB 4FYCA 5ELAA 4GSNA 2H73A 4XS6A 2OT3A 5IMAA 2OBKA 2PUKC 4KDUA 3IR4A 4O92A 4HUAA 4KCAA 3TCOA 2CZ2A 2HT9A 2X4AA 2XBQA 3US3A 2P5QA 1K0MA 1SJZA 2EIOA 4AF2A 1THXA 2GT5A 5DJMA 2B1LA 2X99A 4X4JA 1SK0A 1T3BA 2I4AA 3GH9A 3WGDA 1T7PB 4XHMA 3BOAA 1YF1A 1GRXA 3JCML 2FA8A 5C04A 1B4QA 2H75A 3CRUA 2MBTA 2YV7A 4WF5A 1DSBA 1KNGA 3L9UA 3TU3B 4MABA 2C0DA 2CA8A 4V1Ag 3U5RE 2TRCP 4BVYA 5B6MA 5ID2B 5ECOB 1F37A 1GSSA 2P5RA 1ERUA 2YP6A 4HS1A 5H5RA 4CW9A 2GZYA 3ZMLA 2REMA 1JZRA 1W89A 2PERA 4PNGA 5J3RA 2ALBA 1K0OA 3GURA 1KEBA 3ERFA 1V57A 4OD7A 1GNEA 1J0FA 1O73A 7GSSA 3KD0A 3RAZA 4IKHA 3KMOA 2H71A 3MWHA 12GSA 4ZILA 3N9JA 2V6OA 2LSTA 2DJ1A 4HZ2A 2VM2A 1MDIA 1TW9A 3DXBA 3MIXA 2J9HA 5F06A 3CTFA 3D5JA 3GIXA 5J4YA 5AIVA 2H0GA 3DKSA 4J2FA 4N0ZA 1O81A 4I6XA 1TP9A 3IV4A 1TRUA 2HRAA 2GQMA 4G0IA 2H1LA 2K8VA 2L5LA 5GAPD 3QAGA 3ZVJD 3D6IA 1PN0A 1TRVA 3F9UA 4RI6A 3IPZA 4POKA 3W6GA 4DSSB 2KLXA 4GLTA 3FR6A 3TUEA 1G7EA 4TR1A 2OA7A 2QKEA 2G2QA 5AGYA 2PMTA 1S3CA 3A5IA 1X9MB 3S9FA 3HY2A 4I2UA 4DVCA 4ZL7A 1FB6A 2H6ZA 5KOWA 4NXIA 1A0RP 3LYPA 1M9AA 4N11A 5CREA 3IBHA 3F4TA 3KH7A 1TK0B 2LJAA 4EKZA 3CYNA 5FHIA 3IHGA 3GYKA 1ZYEA 2GZZA 4DSSA 2QA2A 5J9CA 3HD5A 1A0FA 1TDIA 2H0IA 3UBKA 4MA9A 2LRNA 2OBIA 1OE8A 3DWVA 4K7OA 5D9XA 4ZBDA 2MZCA 1QXHA 5A5HB 1O7UA 1I9DA 3P2AA 1PKWA 1XBSA 5E4WA 4YAVA 2UZ8A 3W8SA 4GXZA 2HSMB 2VL2A 1G7OA 3C8EA 2LRTA 5FWGA 2GGTA 1ZL9A 5DQYA 3EU3A 4TXOB 2L59A 5G31A 3HVVA 4FYBA 3QFAC 1HQOA 2R37A 4PXOA 3BCKA 1GWCA 3QPMA 3GRXA 4TKYA 5HR3A 1LBKA 4KE3A 4NV2A 4GRFA 1M99A 6GSYA 2V32A 2PWJA 3F6FA 5D9TA 4N30A 1H75A 2F51A 3D4MA 4QL7A 5EL8A 3E0UA 3APSA 1AQVA 1TK8B 2CX4A 3TKRA 4EF0A 4QMKA 1HYUA 1ZYNA 3GSTA 1PX7A 2GZPA 2E2GA 2VCQA 4IP1A 2LRCA 4N3ZA 4IN0A 3IC8A 1FAAA 1T8EB 2HSNB 2C3TA 3QAVA 1MD4A 2BJXA 4Q5FA 2K8SA 1HNAA 4K7IA 3IC4A 2YANA 3GX8A 4GDFA 1WMJA 1WWJA 3TJKA 3U6VA 2HYXA 1GTBA 2AB6A 3LORA 3LFLA 4K5SA 4EC0A 2KUCA 4TR0A 1GUHA 1VF2A 1XW5A 4PTSA 4POLA 4YH2A 3ZFLA 2HSYA 5H5QA 4FH8A 2RIIA 5HFKA 1Z6MA 2GVPA 3I69A 2A4HA 2GS3A 2YN1A 5JWRB 5KEJA 4HDEA 4X0XA 2Z9SA 1ML6A 3EYTA 2FWHA 4KH7A 3KP9A 4XTSA 1QGVA 3LGCA 2H74A 2RUFA 1SKRB 1NHYA 3HDCA 3E9JB 3CSHA 2R3XA 9GSSA 2O87A 2B6MA 4ICYA 4TR3A 4LMVA 2LNSA 4JR6A 3KEBA 3VWUA 3E3EA 2HE3A 3TJFA 2B7JA 4K0GA 1ABAA 1XVQA 2IJYA 4OMVA 1VF3A 3VI7A 3PPUA 1TI3A 2V6KA 5D9WA 1VGLA 2IIYA 4DEJA 5GZZB 4E8HA 1LJRA 2F8FA 2LNTA 2H01A 4K7NA 3ERGA 1QQ2A 4YQMA 5B6NA 5A1NB 4HEA2 4W66A 5DAKB 4DSRA 6GSTA 2DJJA 4O5RA 3TJGA 3HKRA 2F9SA 4H86A 1PGTA 2BTOT 4NV5A 1K0NA 4WXTA 4PQIA 2N5FA 4KF9A 4BL7A 1XZOA 1EOHA 1JZOA 3LEFA 1RK4A 3VK9A 3GTUB 3GNJA 1A2JA 4EVMA 4Z7XA 2C0EA 2L5OA 3WD6A 3W8JA 4JU5A 1UC7A 1R7HA 5G1KA 1XOAA 5A1NA 4IGJA 3DIEA 1TU7A 4FO5A 3RBTA 5HR1A 2P31A 2H1DA 3C71A 3EPTA 4K1FA 3GUSA 2FNOA 4MMMA 4NMUA 5EY6A 1Q98A 2HXKA 3HXSA 3UJ1A 4KW6A 1W4VA 2VKZG 18GSA 1Y6EA 1X5CA 3HHVA 2ZCTA 5LCZA 5ECIB 4MZBA 1OVNA 3A2XA 1X5DA 1SL2B 1ERTA 1H4OA 11GSA 5KOXA 2VCZA 3GTUA 1TI1A 4AJ7A 2IMEA 2PPTA 5A4WA 4V2MA 2FY6A 5J4UA 1JZWA 1EZKA 3TKSE 1PD21 4AGSA 2MMAA 4ZBAA 4L8EA 2PN8A 5ECSA 2GDRA 1SVOA 2H6YA 1GLQA 5C00A 1XWAA 1GP1A 1ILOA 3D0ZA 4ECBA 2QA1A 4G2EA 3VWWA 4ECIA 1IYHA 1SYRA 4KA0A 3ZREA 2V2GA 4K9ZA 1PSQA 3DRNA 1X9SB 1T00A 1U3IA 3D4TA 1TXUA 1A23A 3EMPA 2X64A 1SK1A 2MBSA 2IMFA 1JLVA 2V1MA 1DBYA 5G5EA 1Y25A 2NDOA 5DCHA 5IOXA 2R0CA 1TOFA 2NBSA 2C80A 5J47A 4ID0A 4BVYB 2VLTA 2VL9A 2FGXA 4MF7A 2PVOC 4KDXA 5ENUA 3ZFBA 2EFCA 2H0HA 3ME8A 1EEMA 5GSSA 4GWRA 4IJ3A 2RM6A 1Q4JA 3TRPA 1R5AA 4G19A 3UBLA 4E8EA 3FZ9A 2B5EA 3GKNA 2B7KA 1QFNA 2L57A 4NWYA 4Q5RA 2VOCA 4N0VA 3CBUA 3EC3A 2HI7A 1J9BA 5CRGA 5DCGA 1M2BA 3M1GA 1XVWA 3P7XA 3QD9A 2XHFA 2HZFA 4GQFA 5EVOA 4HI7A 1PMTA 5JCUA 1OKTA 3L4NA 1ERVA 2JL4A 2DMLA 4GF0A 4AJ6A 5B7CA 2O89A 4EUYA 3LYKA 5ELGA 5A5KA 3KIJA 4O32A 4XRAA 3LW9A 1ZOFA 1UA5A 1AXDA 5J40A 4OCFA 4ZBBA 4KAEA 2AYTA 4L0WA 4Z2TA 3TKSA 4POMA 3LQ7A 2DBCA 2IWTA 5GSTA 3KM6A 4KSMA 3GKMA 1KBNA 4EXJA 3KGKA 3MSZA 3UL3A 1V58A 1DE1A 1ZYQB 3WYWA 4EL1A 5D9VA 4BWSA 4TR1B 4L5OA 2K6VA 3DVXA 2IL3A 5D8IA 1JZDA 1O85A 6GSVA 2YZHA 3ED3A 4ZB7A 2VD1A 1BEDA 1M2DA 2X8GA 2KP2A 1ON4A 1Z7RA 2KP1A 1U6TA 2GQKA 2L6DA 3C1RA 3GKXA 1MDJA 3FMWA 4XIHA 3N5OA 3J7Yk 3ZMKA 1GSYA 1UN2A 2OADA 1GH2A 2O85A 4Z2UA 5IO0A 2H66A 3SBCA 1B9YC 1A2MA 3WGXA 1ZCPA 1FW1A 3QFBC 5D96A 1SK2A 4O7HA 4PNFA 2HRKB 1B9XC 4MK3A 4BPYA 4BWQA 1N8JA 1EP8A 4MPGA 4YAPA 3TJBA 5LNKe 5IPGA 4N10A 2DJKA 5CO3A 5DVBA 1GULA 4EDYA 1SD9A 2LTKA 4LMWA 3IRAA 2DIYA 1CQGA 2JACA 3MAKA 4F82A 4IS0A 2C4JA 1RW1A 3CRTA 2CX3A 2TIRA 2HFDA 3GMFA 4PURA 1GNWA 1JFUA 2PVQA 2AJQB 1YDKA 3D21A 4ZL8A 4QQ7A 3IE3A 3BJ5A 5BMUA 2HRKA 2C1YA 5JWQB 2WFCA 3QCPA 1X5EA 1BAYA 2YWNA 22GSA 4LA1A 3TJJA 2GSTA 1A8YA 3F0IA 3ERWA 2QGVA 5EPFA 4IW9A 4G10A 5IMVA 3I43A 1XWCA 1J08A 2CT6A 3F3QA 4RI7A 2WCIA 4TW5A 4IQ1A 3G7YA 3KP8A 4PGTA 3EU4A 5ABRA 1WP0A 4CDOA 2R5GA 3HZ8A 1XPVA 2JZTA 2H1AA 3IAS2 4RQRA 2YWOA 1O8WA 4MZCA 3IOSA 5F0GA 3UVTA 1HD2A 1RQMA 3J7Yb 3EINA 4YQUA 3VPQA 3MDKA 3ZVJA 1XWBA 3TKSC 5A34B 3BCIA 3H93A 2X8CA 2K9FA 4G0LA 5IMDA 4EDZA 3L0HA 2PU9C 3DGQA 1N2AA 3IK7A 1GTAA 1FOHA 3HVXA 3TB2A 4JZQA 5DQSA 2OE3A 1ZYPA 1YY7A 5G5FA 3LJRA 3HJOA 1GSUA 4HOJA 2VCXA 2EFEA 4LL1B 5IMFA 4GTUA 4PQHA 4K0NA 4JE1A 1NM3A 4KB3A 1TRSA 2V41A 3IA1A 4ECCA 1YEXA 3FZAA 2ZNMA 3GL3A 5A34A 3Q6OA 2DLXA 4HQSA 2I9HA 4GSSA 4LLRA 1T4ZA 5IQYA 4MCUA 4KX4A 1XWGA 16GSA 5L71A 4F03A 2XPEA 1TXXA 3KZQA 3ME7A 1YEPA 4ULXA 4AKIA 2M80A 4OCEA 1OC9A 2LJRA 4X1UA 4WETA 4KUNA 1OKDA 3HJMA 4GQCA 3VWVA 1SJIA 1OC3A 13GSA 1XXUA 4MJEA 1M7TA 5KN2A 3UIWA 1T1VA 2DMMA 3HVSA 3DEXA 1WPIA 4FIWA 4KSOA 1YKAA 2LKUA 2RUEA 6GSSA 1QMVA 3ZLPA 2D2ZA 2H6XA 1YQ1A 2VAFA 2IFQB 2A2SA 3FK8A 5G30A 1AC1A 4ZB9A 5J9BA 2XC2A 1I5GA 2B1KA 4K8MA 3A3TA 2FCHA 4BL7B 1XCCA 4MF5A 4TN8A 1OAZA 4BVXA 1WE0A 3EWLA 2YOIA 2R2JA 1NHOA 2VO4A 2OE0A 5IIZA 1K0CA 1ZMAA 4AKGA 1MTCA 4GCIA 4L0UA 5A4UA 3O6TA 4O5UA 5HFIA 3DVWA 3PINA 1K3YA 3EE2A 3KJYA 5J4VA 2PGTA 4HU9A 4WF4A 3NOFA 5AISA 2IFQA 5ECNB 2ON5A 1B4PA 3PH9A 2WB9A 5B8BA 3IAM2 5ECQB 2X49A 5JWOB 2WULA 4WBRD 4KGIA 4V1Ap 3EVIA 1YZXA 4MJBA 5J5NA 2CVBA 1K0AA 2FUG2 3FKFA 1AUCA 2IMKA 4OFNA 1VRSD 1K3LA 1NW2A 4JEDA 3F6DA 2OJLA 4USSA 4OO4A 1SL0B 4G9HA 2NVLA 1AQWA 1OC8A 4MDCA 3MYDA 3TDGA 4XCSA 4YQVA 2LV3A 1B8XA 1FB0A 3FHKA 1GLPA 3G9BA 2IMDA 1TU8A 3WT2A 1GL8A 4OFMA 5CRDA 3ZTLA 2GTUA 1EOGA 4XS4A 2VCWA 4NAXA 2C3QA 4J57E 2A2PA 3L9SA 5GAND 3D22A 4DSQA 2C0GA 4D73A 4P3YB 3C7MA 2H1BA 2HSHA 4F0BA 3TRQA 1X0RA 3RHCA 3UOMA 2H1GA 1AQXA 5G1LA 2JZRA 3IDVA 4OWYA 2MYGA 1YF0A 20GSA 5CAXA 2FHEA 2OACA 4KCEA 3IK9A 2LQQA 1OE7A 1YJ6A 1M9BA 3H1NA 4Q5QA 4L5LA 2F8AA 2M46A 3C73A 3HJPA 1SJ6A 2PBJA 3VPTA 1PA3A 3F4RA 4G0KA 2GSRA 1BJXA 1V98A 2EFHA 2L6CA 3KXOA 2AHEA 3GFKA 1O8XA 5ECPB 1N25A 4J56E 2I81A 19GSA 5ECHB 3ZIVA 1Z3EA 2BMXA 4ZXGA 2X8HA 2CVDA 2N5AA 3PR8A 5AIXA 4WEYA 3GSSA 1BQ7A 3RPNA 1TJDA 1R5PA 5LD0A 10GSA 1O6JA 1WJKA 4JRRA 4KNDA 2EIQA 2L4CA 5ECLB 2J23A 4EO3A 1GUMA 2GLRA 5IPHA 2H30A 3OR5A 2DKIA 3QR6A 2EIRA 2GQLA 3VWXA 4YKFA 1BF5A 1SENA 1G6WA 3ZZXA 1SU9A 3EURA 5DJLA 1WIKA 3C1SA 3I6AA 1QK8A 4NPBA 3QDNA 3CMIA 3FZ4A 2WGRA 2RM5A 1HNBA 1GSEA 4PUFC 1EGRA 5KN1A 2HZEB 1TK5B 4CY8A 3KH9A 4HJ2A 5DALA 4AKXB 2VM1A 3M0FA 4WBJA 2HQTA 4F2IA 1GTIA 4Q5NA 5JCWA 4TR4A 4TVEA 2R4VA 5A4VA 4NHZA 5JCGA 5BRTA 3TKQA 5HR0A 2VIMA 1SKSB 3A2VA 4MH3A 5G2ZA 2YWMA 3RHBA 2M72A 1YKCA 3Q18A 4IHUA 4PX1A 2A2RA 3NIVA 1IYIA 1M0UA 5INYA 4PUAA 1USBA 1BG5A 3HA9A 4NHWA 5CP1A 2HZEA 3GL5A 1MD3A 5F8BA 3UARA 1F6MC 1ZZYA 5D93A 4MP4A 2DIZA 2KHPA 1SL1B 17GSA 3RPPA 8GSSA 2WZ9A 3VFIA 2H70A 1FG4A 5ECMB 4ZB8A 3AY8A 5ID2A 2H19A 3A2WA 4MJAA 4FQUA 2FWFA 4TRXA 2H8LA 3HMJG 1URMA 2YZUA 2C0FA 3RDWA 4JBBA 3TOTA 3O3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLW A;  4IEL A;  3CTG A;  5D73 A;  3ZIJ A;  5IOW A;  5CRW A;  5CRH A;  2E2M A;  3LWA A;  3FEU A;  2YNX A;  2QC7 A;  4ILF A;  2CAQ A;  2MMN A;  3F63 A;  4IQA A;  5ECR B;  5DBQ A;  1XFL A;  4CHS A;  1VF1 A;  5AN1 A;  3H8Q A;  2JSY A;  3M9K A;  4PQ1 A;  3CXG A;  2XPD A;  5HQP A;  2YV9 A;  2O7K A;  1QUW A;  3G7I A;  2FLS A;  2LS5 A;  3KTB A;  3FYG A;  2NTO A;  5F05 A;  4QL9 A;  3O76 A;  1E2Y A;  2JU5 A;  3M9J A;  4POB A;  4HJM A;  1CQH A;  5COH A;  2NPB A;  2VL3 A;  2P0G A;  2WS2 A;  1DE2 A;  3GX0 A;  3EMX A;  1GSQ A;  3FRC A;  5DDL A;  2VD0 A;  3IHQ A;  3VI5 A;  3WT1 A;  4ZB6 A;  3A5W A;  2KOK A;  1HNC A;  2YCD A;  14GS A;  3DML A;  4RQX A;  4HQZ A;  1F2E A;  2CQ9 A;  5IMZ A;  3QOU A;  2JZS A;  1GUK A;  1SD8 A;  2ES7 A;  3VUR A;  3F4S A;  1XWK A;  3L78 A;  2OKA A;  3TOU A;  1A8L A;  4OFT A;  1XIY A;  4RUV A;  2B3S A;  2FD3 A;  1XW9 A;  1EV4 A;  2C8U A;  1VF4 A;  1EWX A;  4I5Q A;  4LL4 B;  2WRT A;  1KTE A;  3ISO A;  2GT6 A;  2DJ2 A;  4TXV A;  2B5Y A;  1OC9 B;  4MPF A;  2VUP A;  1G6Y A;  2C3N A;  4IVF A;  1GSD A;  5HFG A;  3GHA A;  1XOB A;  2GSQ A;  1WRY A;  4MJC A;  4WKW A;  4ISD A;  3ZL5 A;  1PL2 A;  2HSM A;  6GSW A;  3P90 A;  3L9V A;  4ACS A;  1MDK A;  2CV4 A;  2JAD A;  2LQO A;  3APO A;  2MMO A;  2ON7 A;  2H76 A;  4JR4 A;  4IP6 A;  1AAZ A;  1AIU A;  1AW9 A;  1K0B A;  1BX9 A;  3BD2 A;  4TXO A;  3R3E A;  5KN0 A;  2G0F A;  2EC4 A;  2QSI A;  1K0D A;  4BVX B;  3GA4 A;  1T4Y A;  2HLS A;  3Q19 A;  2DJ3 A;  2IMI A;  1SYX A;  3FY7 A;  1UVZ A;  2LJK A;  1WOU A;  3DD3 A;  2HNL A;  3SWL A;  1U88 A;  3IXR A;  3I9V 2;  1TTZ A;  1U87 A;  4ECJ A;  4ML1 A;  3ZIT A;  1C72 A;  3K8N A;  3FW2 A;  4V2N A;  2FWE A;  2CZ3 A;  2K18 A;  3R2Q A;  3MNG A;  4MZW A;  5E59 A;  2DJ0 A;  1ZGN A;  1G0T A;  3QAW A;  2N5B A;  6GSU A;  1F3A A;  2CVK A;  4IBP A;  6GSX A;  3UMA A;  4I2T A;  5B8A A;  4BA7 A;  2O8V B;  4MH2 A;  1JHB A;  1MEK A;  3FZ5 A;  2HRF A;  1A24 A;  4MF6 A;  4F0C A;  3PGT A;  2A4V A;  3LXT A;  2AAW A;  1ST9 A;  5J41 A;  3DYR A;  4ZL9 A;  1ACV A;  3Q74 A;  2FA4 A;  3LSZ A;  2ZUP A;  4EE0 A;  2FWG A;  2VLV A;  1FVK A;  2VCV A;  3CSJ A;  4XS4 B;  1M2A A;  3HCZ A;  1Z7P A;  4HZ4 A;  2RLI A;  2GSS A;  3NZN A;  1SKW B;  2VL2 C;  1ERW A;  1FHE A;  3F3R A;  2AUV A;  1GSF A;  4D73 B;  1PL1 A;  1U3A A;  5ECK B;  4WR5 A;  1GTU A;  3GH6 A;  3G7J A;  1FO5 A;  1Z6N A;  3GV1 A;  2B5X A;  1LU4 A;  1V9W A;  1XW6 A;  2LEG A;  2DC5 A;  1R4W A;  1K3O A;  3HZ4 A;  1EGO A;  5CYY A;  2XBI A;  4TOP A;  3GN3 A;  2VLU A;  2I3Y A;  4F9Z A;  3P8W A;  4XRD A;  2AV4 A;  3APQ A;  4K6X A;  2OE1 A;  1PN9 A;  5IMC A;  2L4Q A;  4OO5 A;  4KDY A;  3LG6 A;  1S3D A;  1F9M A;  4X43 A;  3BBY A;  5IO2 A;  2MMZ A;  3M8N A;  3UAP A;  2YJH A;  5DAK A;  2H72 A;  4ZIJ A;  3VLN A;  3HYP A;  1PX6 A;  1THO A;  1EEJ A;  2DSA A;  2WJU A;  1F3B A;  5KN3 A;  3KCM A;  1EV9 A;  1Z9H A;  5H5S A;  2IPA A;  2VCT A;  1S3A A;  2IN3 A;  3V1W A;  2F3M A;  3UVH A;  3UEM A;  2CAI A;  1PQN A;  3KTL A;  3F8U A;  3FR3 A;  3FR9 A;  2E7P A;  3ZYW A;  3CSI A;  1EP7 A;  4V2L A;  1V2A A;  1PKZ A;  1X9W B;  5FT3 A;  2YPM A;  2WDU A;  2JSZ A;  5IM9 A;  4IJI A;  5HR2 A;  1PRX A;  1A2L A;  3WGE A;  1FVJ A;  3H4K A;  2I1U A;  1BYE A;  4FYU A;  3KMN A;  4ML6 A;  2YWI A;  4I8B A;  4WR4 A;  5F07 A;  2TRX A;  4K2D A;  1B48 A;  2E0Q A;  3H79 A;  1OYJ A;  4HU7 A;  3TRX A;  3QMX A;  3ZRD A;  3LXZ A;  4XS1 A;  2R6K A;  1R26 A;  3M3M A;  1FOV A;  3GKK A;  4GST A;  2YJ7 A;  4AJ8 A;  3TKP A;  5CNW A;  1Z5Y E;  4MLY A;  1V40 A;  1DUG A;  1E6B A;  4I97 A;  3TGZ A;  1TKD B;  2LUS A;  1NSW A;  2HRN A;  1TRW A;  5DAL B;  4FYC A;  5ELA A;  4GSN A;  2H73 A;  4XS6 A;  5IMA A;  2OBK A;  2PUK C;  4KDU A;  3IR4 A;  4O92 A;  4HUA A;  4KCA A;  3TCO A;  2CZ2 A;  2HT9 A;  2XBQ A;  3US3 A;  2P5Q A;  1K0M A;  1SJZ A;  2EIO A;  4AF2 A;  1THX A;  2GT5 A;  5DJM A;  2B1L A;  2X99 A;  1SK0 A;  1T3B A;  2I4A A;  3GH9 A;  3WGD A;  1T7P B;  4XHM A;  3BOA A;  1YF1 A;  1GRX A;  3JCM L;  2FA8 A;  5C04 A;  1B4Q A;  2H75 A;  3CRU A;  2MBT A;  2YV7 A;  4WF5 A;  1DSB A;  1KNG A;  3L9U A;  4MAB A;  2C0D A;  2CA8 A;  4V1A g;  3U5R E;  2TRC P;  4BVY A;  5B6M A;  5ID2 B;  5ECO B;  1F37 A;  1GSS A;  2P5R A;  1ERU A;  2YP6 A;  4HS1 A;  5H5R A;  4CW9 A;  2GZY A;  3ZML A;  2REM A;  1JZR A;  1W89 A;  2PER A;  4PNG A;  5J3R A;  2ALB A;  1K0O A;  3GUR A;  1KEB A;  3ERF A;  1V57 A;  4OD7 A;  1GNE A;  1J0F A;  1O73 A;  7GSS A;  3KD0 A;  3RAZ A;  4IKH A;  3KMO A;  2H71 A;  3MWH A;  12GS A;  4ZIL A;  3N9J A;  2V6O A;  2LST A;  2DJ1 A;  4HZ2 A;  2VM2 A;  1MDI A;  1TW9 A;  3DXB A;  2J9H A;  5F06 A;  3CTF A;  3D5J A;  3GIX A;  5AIV A;  2H0G A;  3DKS A;  4J2F A;  4N0Z A;  1O81 A;  4I6X A;  1TP9 A;  3IV4 A;  1TRU A;  2HRA A;  2GQM A;  4G0I A;  2K8V A;  2L5L A;  5GAP D;  3QAG A;  3ZVJ D;  3D6I A;  1TRV A;  3F9U A;  4RI6 A;  3IPZ A;  4POK A;  3W6G A;  4DSS B;  2KLX A;  4GLT A;  3FR6 A;  3TUE A;  1G7E A;  4TR1 A;  2OA7 A;  2QKE A;  2G2Q A;  5AGY A;  2PMT A;  1S3C A;  1X9M B;  3S9F A;  3HY2 A;  4I2U A;  4DVC A;  4ZL7 A;  1FB6 A;  2H6Z A;  4NXI A;  1A0R P;  3LYP A;  1M9A A;  4N11 A;  5CRE A;  3IBH A;  3F4T A;  3KH7 A;  1TK0 B;  2LJA A;  4EKZ A;  3CYN A;  5FHI A;  3GYK A;  1ZYE A;  2GZZ A;  4DSS A;  5J9C A;  3HD5 A;  1A0F A;  1TDI A;  2H0I A;  3UBK A;  4MA9 A;  2LRN A;  2OBI A;  1OE8 A;  3DWV A;  4K7O A;  5D9X A;  4ZBD A;  2MZC A;  1QXH A;  1O7U A;  1I9D A;  3P2A A;  1PKW A;  1XBS A;  5E4W A;  4YAV A;  2UZ8 A;  3W8S A;  4GXZ A;  2HSM B;  2VL2 A;  1G7O A;  3C8E A;  2LRT A;  5FWG A;  2GGT A;  1ZL9 A;  5DQY A;  3EU3 A;  4TXO B;  2L59 A;  5G31 A;  3HVV A;  4FYB A;  3QFA C;  1HQO A;  2R37 A;  4PXO A;  3BCK A;  1GWC A;  3QPM A;  3GRX A;  4TKY A;  5HR3 A;  1LBK A;  4KE3 A;  4NV2 A;  4GRF A;  1M99 A;  6GSY A;  2V32 A;  2PWJ A;  3F6F A;  5D9T A;  4N30 A;  1H75 A;  2F51 A;  3D4M A;  4QL7 A;  5EL8 A;  3E0U A;  3APS A;  1AQV A;  1TK8 B;  2CX4 A;  3TKR A;  4EF0 A;  1HYU A;  3GST A;  1PX7 A;  2GZP A;  2E2G A;  2VCQ A;  4IP1 A;  2LRC A;  4IN0 A;  3IC8 A;  1FAA A;  1T8E B;  2HSN B;  2C3T A;  3QAV A;  1MD4 A;  2BJX A;  4Q5F A;  2K8S A;  1HNA A;  4K7I A;  3IC4 A;  2YAN A;  3GX8 A;  1WMJ A;  1WWJ A;  3TJK A;  3U6V A;  2HYX A;  1GTB A;  2AB6 A;  3LOR A;  3LFL A;  4EC0 A;  2KUC A;  4TR0 A;  1GUH A;  1VF2 A;  1XW5 A;  4PTS A;  4POL A;  4YH2 A;  3ZFL A;  2HSY A;  5H5Q A;  4FH8 A;  2RII A;  5HFK A;  1Z6M A;  2GVP A;  3I69 A;  2GS3 A;  2YN1 A;  5JWR B;  5KEJ A;  4HDE A;  4X0X A;  2Z9S A;  1ML6 A;  3EYT A;  2FWH A;  4KH7 A;  3KP9 A;  4XTS A;  1QGV A;  3LGC A;  2H74 A;  2RUF A;  1SKR B;  1NHY A;  3HDC A;  3E9J B;  3CSH A;  2R3X A;  9GSS A;  2O87 A;  2B6M A;  4TR3 A;  4LMV A;  2LNS A;  4JR6 A;  3KEB A;  3VWU A;  3E3E A;  2HE3 A;  3TJF A;  2B7J A;  4K0G A;  1ABA A;  1XVQ A;  2IJY A;  4OMV A;  1VF3 A;  3VI7 A;  3PPU A;  1TI3 A;  2V6K A;  5D9W A;  1VGL A;  2IIY A;  4DEJ A;  5GZZ B;  4E8H A;  1LJR A;  2F8F A;  2LNT A;  2H01 A;  4K7N A;  3ERG A;  1QQ2 A;  4YQM A;  5B6N A;  4HEA 2;  5DAK B;  4DSR A;  6GST A;  2DJJ A;  4O5R A;  3TJG A;  3HKR A;  2F9S A;  4H86 A;  1PGT A;  2BTO T;  4NV5 A;  1K0N A;  4WXT A;  4PQI A;  2N5F A;  4KF9 A;  4BL7 A;  1XZO A;  1EOH A;  1JZO A;  3LEF A;  1RK4 A;  3VK9 A;  3GTU B;  3GNJ A;  1A2J A;  4EVM A;  4Z7X A;  2C0E A;  2L5O A;  3WD6 A;  3W8J A;  4JU5 A;  1UC7 A;  1R7H A;  5G1K A;  1XOA A;  4IGJ A;  3DIE A;  1TU7 A;  4FO5 A;  3RBT A;  5HR1 A;  2P31 A;  2H1D A;  3C71 A;  4K1F A;  3GUS A;  2FNO A;  4MMM A;  4NMU A;  5EY6 A;  1Q98 A;  2HXK A;  3HXS A;  3UJ1 A;  4KW6 A;  1W4V A;  18GS A;  1Y6E A;  1X5C A;  3HHV A;  2ZCT A;  5LCZ A;  5ECI B;  4MZB A;  1OVN A;  3A2X A;  1X5D A;  1SL2 B;  1ERT A;  1H4O A;  11GS A;  2VCZ A;  3GTU A;  1TI1 A;  4AJ7 A;  2IME A;  2PPT A;  5A4W A;  4V2M A;  2FY6 A;  5J4U A;  1JZW A;  1EZK A;  3TKS E;  1PD2 1;  4AGS A;  2MMA A;  4ZBA A;  4L8E A;  2PN8 A;  5ECS A;  2GDR A;  2H6Y A;  1GLQ A;  5C00 A;  1XWA A;  1GP1 A;  1ILO A;  3D0Z A;  4ECB A;  4G2E A;  3VWW A;  4ECI A;  1IYH A;  1SYR A;  4KA0 A;  3ZRE A;  2V2G A;  4K9Z A;  1PSQ A;  3DRN A;  1X9S B;  1T00 A;  1U3I A;  3D4T A;  1A23 A;  3EMP A;  2X64 A;  1SK1 A;  2MBS A;  2IMF A;  1JLV A;  2V1M A;  1DBY A;  5G5E A;  1Y25 A;  2NDO A;  5DCH A;  5IOX A;  1TOF A;  2NBS A;  2C80 A;  4ID0 A;  4BVY B;  2VLT A;  2VL9 A;  2FGX A;  4MF7 A;  2PVO C;  4KDX A;  5ENU A;  3ZFB A;  2H0H A;  3ME8 A;  1EEM A;  5GSS A;  4GWR A;  4IJ3 A;  2RM6 A;  1Q4J A;  3TRP A;  1R5A A;  4G19 A;  3UBL A;  4E8E A;  3FZ9 A;  2B5E A;  3GKN A;  2B7K A;  1QFN A;  2L57 A;  4NWY A;  4Q5R A;  2VOC A;  4N0V A;  3CBU A;  3EC3 A;  2HI7 A;  1J9B A;  5CRG A;  5DCG A;  1M2B A;  3M1G A;  1XVW A;  3P7X A;  3QD9 A;  2XHF A;  2HZF A;  4GQF A;  5EVO A;  4HI7 A;  1PMT A;  5JCU A;  1OKT A;  3L4N A;  1ERV A;  2JL4 A;  2DML A;  4GF0 A;  4AJ6 A;  5B7C A;  2O89 A;  4EUY A;  3LYK A;  5ELG A;  5A5K A;  3KIJ A;  4O32 A;  4XRA A;  1ZOF A;  1UA5 A;  1AXD A;  4OCF A;  4ZBB A;  4KAE A;  2AYT A;  4L0W A;  3TKS A;  4POM A;  3LQ7 A;  2DBC A;  2IWT A;  5GST A;  3KM6 A;  4KSM A;  3GKM A;  1KBN A;  4EXJ A;  3KGK A;  3MSZ A;  3UL3 A;  1V58 A;  1DE1 A;  1ZYQ B;  3WYW A;  4EL1 A;  5D9V A;  4BWS A;  4TR1 B;  4L5O A;  2K6V A;  3DVX A;  2IL3 A;  5D8I A;  1JZD A;  1O85 A;  6GSV A;  2YZH A;  3ED3 A;  2VD1 A;  1BED A;  1M2D A;  2X8G A;  2KP2 A;  1ON4 A;  1Z7R A;  2KP1 A;  1U6T A;  2GQK A;  2L6D A;  3C1R A;  3GKX A;  1MDJ A;  4XIH A;  3N5O A;  3J7Y k;  3ZMK A;  1GSY A;  1UN2 A;  2OAD A;  1GH2 A;  2O85 A;  5IO0 A;  2H66 A;  3SBC A;  1B9Y C;  1A2M A;  3WGX A;  1ZCP A;  1FW1 A;  3QFB C;  5D96 A;  1SK2 A;  4O7H A;  4PNF A;  2HRK B;  1B9X C;  4MK3 A;  4BPY A;  4BWQ A;  1N8J A;  1EP8 A;  4MPG A;  4YAP A;  3TJB A;  5LNK e;  5IPG A;  4N10 A;  2DJK A;  5CO3 A;  5DVB A;  1GUL A;  4EDY A;  1SD9 A;  2LTK A;  4LMW A;  3IRA A;  2DIY A;  1CQG A;  2JAC A;  3MAK A;  4F82 A;  4IS0 A;  2C4J A;  1RW1 A;  3CRT A;  2CX3 A;  2TIR A;  2HFD A;  3GMF A;  4PUR A;  1GNW A;  1JFU A;  2PVQ A;  2AJQ B;  1YDK A;  3D21 A;  4ZL8 A;  4QQ7 A;  3IE3 A;  3BJ5 A;  5BMU A;  2HRK A;  2C1Y A;  5JWQ B;  2WFC A;  3QCP A;  1X5E A;  1BAY A;  2YWN A;  22GS A;  4LA1 A;  3TJJ A;  2GST A;  1A8Y A;  3F0I A;  3ERW A;  2QGV A;  5EPF A;  4IW9 A;  4G10 A;  5IMV A;  3I43 A;  1XWC A;  1J08 A;  2CT6 A;  3F3Q A;  4RI7 A;  2WCI A;  4TW5 A;  4IQ1 A;  3G7Y A;  3KP8 A;  4PGT A;  3EU4 A;  5ABR A;  1WP0 A;  4CDO A;  2R5G A;  3HZ8 A;  1XPV A;  2JZT A;  2H1A A;  3IAS 2;  4RQR A;  2YWO A;  1O8W A;  4MZC A;  3IOS A;  5F0G A;  3UVT A;  1HD2 A;  1RQM A;  3J7Y b;  3EIN A;  4YQU A;  3VPQ A;  3MDK A;  3ZVJ A;  1XWB A;  3TKS C;  3BCI A;  3H93 A;  2X8C A;  2K9F A;  4G0L A;  5IMD A;  4EDZ A;  3L0H A;  2PU9 C;  3DGQ A;  1N2A A;  3IK7 A;  1GTA A;  3HVX A;  3TB2 A;  4JZQ A;  5DQS A;  2OE3 A;  1YY7 A;  5G5F A;  3LJR A;  3HJO A;  1GSU A;  4HOJ A;  2VCX A;  4LL1 B;  5IMF A;  4GTU A;  4PQH A;  4K0N A;  4JE1 A;  1NM3 A;  4KB3 A;  1TRS A;  2V41 A;  3IA1 A;  4ECC A;  1YEX A;  3FZA A;  2ZNM A;  3GL3 A;  3Q6O A;  2DLX A;  4HQS A;  2I9H A;  4GSS A;  4LLR A;  1T4Z A;  5IQY A;  4MCU A;  4KX4 A;  1XWG A;  16GS A;  5L71 A;  4F03 A;  2XPE A;  1TXX A;  3KZQ A;  3ME7 A;  1YEP A;  4ULX A;  2M80 A;  4OCE A;  1OC9 A;  2LJR A;  4X1U A;  4WET A;  4KUN A;  1OKD A;  3HJM A;  4GQC A;  3VWV A;  1SJI A;  1OC3 A;  13GS A;  1XXU A;  4MJE A;  1M7T A;  5KN2 A;  3UIW A;  1T1V A;  2DMM A;  3HVS A;  3DEX A;  1WPI A;  4FIW A;  4KSO A;  1YKA A;  2LKU A;  2RUE A;  6GSS A;  1QMV A;  3ZLP A;  2D2Z A;  2H6X A;  1YQ1 A;  2VAF A;  2IFQ B;  2A2S A;  3FK8 A;  5G30 A;  1AC1 A;  4ZB9 A;  5J9B A;  2XC2 A;  1I5G A;  2B1K A;  4K8M A;  3A3T A;  2FCH A;  4BL7 B;  1XCC A;  4MF5 A;  4TN8 A;  1OAZ A;  4BVX A;  1WE0 A;  3EWL A;  2YOI A;  2R2J A;  1NHO A;  2VO4 A;  2OE0 A;  5IIZ A;  1K0C A;  1ZMA A;  1MTC A;  4GCI A;  4L0U A;  5A4U A;  3O6T A;  5HFI A;  3DVW A;  3PIN A;  1K3Y A;  3EE2 A;  3KJY A;  2PGT A;  4HU9 A;  4WF4 A;  3NOF A;  5AIS A;  2IFQ A;  5ECN B;  2ON5 A;  1B4P A;  3PH9 A;  2WB9 A;  5B8B A;  3IAM 2;  5ECQ B;  5JWO B;  2WUL A;  4WBR D;  4KGI A;  4V1A p;  3EVI A;  1YZX A;  4MJB A;  5J5N A;  2CVB A;  1K0A A;  2FUG 2;  3FKF A;  1AUC A;  2IMK A;  4OFN A;  1VRS D;  1K3L A;  1NW2 A;  4JED A;  3F6D A;  2OJL A;  4USS A;  4OO4 A;  1SL0 B;  4G9H A;  2NVL A;  1AQW A;  1OC8 A;  4MDC A;  3TDG A;  4XCS A;  4YQV A;  2LV3 A;  1B8X A;  1FB0 A;  3FHK A;  1GLP A;  3G9B A;  2IMD A;  1TU8 A;  3WT2 A;  1GL8 A;  4OFM A;  5CRD A;  3ZTL A;  2GTU A;  1EOG A;  4XS4 A;  2VCW A;  4NAX A;  2C3Q A;  4J57 E;  3L9S A;  5GAN D;  3D22 A;  4DSQ A;  2C0G A;  4D73 A;  4P3Y B;  3C7M A;  2H1B A;  2HSH A;  4F0B A;  3TRQ A;  1X0R A;  3RHC A;  3UOM A;  2H1G A;  1AQX A;  5G1L A;  2JZR A;  3IDV A;  4OWY A;  2MYG A;  1YF0 A;  20GS A;  5CAX A;  2FHE A;  2OAC A;  4KCE A;  3IK9 A;  2LQQ A;  1OE7 A;  1YJ6 A;  1M9B A;  3H1N A;  4Q5Q A;  4L5L A;  2F8A A;  2M46 A;  3C73 A;  3HJP A;  1SJ6 A;  2PBJ A;  3VPT A;  1PA3 A;  3F4R A;  4G0K A;  2GSR A;  1BJX A;  1V98 A;  2L6C A;  3KXO A;  2AHE A;  3GFK A;  1O8X A;  5ECP B;  4J56 E;  2I81 A;  19GS A;  5ECH B;  3ZIV A;  1Z3E A;  2BMX A;  4ZXG A;  2X8H A;  2CVD A;  2N5A A;  3PR8 A;  5AIX A;  4WEY A;  3GSS A;  1BQ7 A;  3RPN A;  1TJD A;  1R5P A;  5LD0 A;  10GS A;  1O6J A;  1WJK A;  4JRR A;  4KND A;  2EIQ A;  2L4C A;  5ECL B;  2J23 A;  4EO3 A;  1GUM A;  2GLR A;  5IPH A;  2H30 A;  3OR5 A;  3QR6 A;  2EIR A;  2GQL A;  3VWX A;  1SEN A;  1G6W A;  3ZZX A;  1SU9 A;  3EUR A;  5DJL A;  1WIK A;  3C1S A;  3I6A A;  1QK8 A;  4NPB A;  3QDN A;  3CMI A;  3FZ4 A;  2WGR A;  2RM5 A;  1HNB A;  1GSE A;  4PUF C;  1EGR A;  5KN1 A;  2HZE B;  1TK5 B;  3KH9 A;  4HJ2 A;  5DAL A;  2VM1 A;  3M0F A;  4WBJ A;  2HQT A;  4F2I A;  1GTI A;  4Q5N A;  5JCW A;  4TR4 A;  4TVE A;  2R4V A;  5A4V A;  4NHZ A;  5JCG A;  3TKQ A;  5HR0 A;  2VIM A;  1SKS B;  3A2V A;  4MH3 A;  5G2Z A;  2YWM A;  3RHB A;  2M72 A;  1YKC A;  3Q18 A;  4IHU A;  4PX1 A;  2A2R A;  3NIV A;  1IYI A;  1M0U A;  5INY A;  4PUA A;  1USB A;  1BG5 A;  3HA9 A;  4NHW A;  5CP1 A;  2HZE A;  3GL5 A;  1MD3 A;  5F8B A;  3UAR A;  1F6M C;  1ZZY A;  5D93 A;  4MP4 A;  2DIZ A;  2KHP A;  1SL1 B;  17GS A;  3RPP A;  8GSS A;  2WZ9 A;  3VFI A;  2H70 A;  1FG4 A;  5ECM B;  4ZB8 A;  3AY8 A;  5ID2 A;  2H19 A;  3A2W A;  4MJA A;  4FQU A;  2FWF A;  4TRX A;  2H8L A;  1URM A;  2YZU A;  2C0F A;  3RDW A;  4JBB A;  3TOT A;  3O3T A; 
#chains in the Genus database with same CATH topology
 5BMU B;  1JLW A;  4IEL A;  3CTG A;  5D73 A;  3ZIJ A;  5IOW A;  5CRW A;  5CRH A;  2E2M A;  3LWA A;  3FEU A;  2YNX A;  2QC7 A;  4ILF A;  2CAQ A;  2MMN A;  3F63 A;  4IQA A;  5ECR B;  5DBQ A;  1XFL A;  4CHS A;  1VF1 A;  5AN1 A;  3H8Q A;  2JSY A;  3M9K A;  4PQ1 A;  3CXG A;  2XPD A;  5HQP A;  2YV9 A;  2O7K A;  1QUW A;  3G7I A;  2FLS A;  2LS5 A;  3KTB A;  3FYG A;  2NTO A;  5F05 A;  4QL9 A;  3O76 A;  1E2Y A;  2JU5 A;  3M9J A;  4POB A;  4HJM A;  1CQH A;  5COH A;  2NPB A;  2VL3 A;  2P0G A;  2WS2 A;  1DE2 A;  3GX0 A;  3EMX A;  1GSQ A;  3FRC A;  4O5Q A;  5DDL A;  2VD0 A;  3IHQ A;  3VI5 A;  3WT1 A;  4ZB6 A;  3A5W A;  2KOK A;  1HNC A;  2YCD A;  14GS A;  3DML A;  4RQX A;  2EFD A;  4HQZ A;  1F2E A;  2CQ9 A;  5IMZ A;  3QOU A;  2JZS A;  1GUK A;  1SD8 A;  2ES7 A;  3VUR A;  3F4S A;  1XWK A;  3L78 A;  2OKA A;  3TOU A;  1A8L A;  4OFT A;  1XIY A;  4RUV A;  2B3S A;  2FD3 A;  1XW9 A;  1EV4 A;  2C8U A;  1VF4 A;  1EWX A;  4I5Q A;  4Z2R A;  4LL4 B;  2WRT A;  1KTE A;  2R0G A;  3ISO A;  2GT6 A;  2DJ2 A;  4TXV A;  2B5Y A;  3CWG A;  1OC9 B;  4MPF A;  2VUP A;  1G6Y A;  2C3N A;  4IVF A;  5A5H A;  1GSD A;  5HFG A;  3GHA A;  1XOB A;  2GSQ A;  1WRY A;  4MJC A;  4WKW A;  4ISD A;  3ZL5 A;  1PL2 A;  2HSM A;  6GSW A;  3P90 A;  3L9V A;  4ACS A;  1MDK A;  2CV4 A;  2JAD A;  2LQO A;  3APO A;  2MMO A;  2ON7 A;  2H76 A;  4JR4 A;  4IP6 A;  1AAZ A;  1AIU A;  1AW9 A;  1K0B A;  1BX9 A;  3BD2 A;  4TXO A;  3R3E A;  5KN0 A;  2G0F A;  3CQF A;  2EC4 A;  2QSI A;  1K0D A;  4BVX B;  3GA4 A;  1T4Y A;  2HLS A;  3Q19 A;  2DJ3 A;  2IMI A;  1SYX A;  3FY7 A;  1BG1 A;  2O36 A;  1UVZ A;  2LJK A;  1WOU A;  3DD3 A;  2HNL A;  3SWL A;  1U88 A;  3IXR A;  3I9V 2;  1TTZ A;  1U87 A;  4ECJ A;  4ML1 A;  3ZIT A;  1C72 A;  3K8N A;  3FW2 A;  4V2N A;  2FWE A;  2CZ3 A;  2K18 A;  2HSN A;  3R2Q A;  3MNG A;  4MZW A;  5E59 A;  2DJ0 A;  2O3E A;  1ZGN A;  1G0T A;  3QAW A;  2N5B A;  6GSU A;  1F3A A;  4AKH A;  2CVK A;  4IBP A;  4K2X A;  6GSX A;  1YEW C;  3UMA A;  4I2T A;  5B8A A;  4BA7 A;  2O8V B;  4MH2 A;  1JHB A;  4CY6 A;  2UV8 G;  1MEK A;  3FZ5 A;  2HRF A;  1A24 A;  4MF6 A;  4AI6 A;  4F0C A;  3PGT A;  2A4V A;  3LXT A;  2AAW A;  1ST9 A;  5J41 A;  3DYR A;  4ZL9 A;  1ACV A;  3Q74 A;  2FA4 A;  3LSZ A;  2ZUP A;  4EE0 A;  2FWG A;  2VLV A;  1FVK A;  1SVL A;  2VCV A;  3CSJ A;  4XS4 B;  1M2A A;  4EIQ A;  3HCZ A;  1Z7P A;  4HZ4 A;  2RLI A;  2GSS A;  3NZN A;  1SKW B;  2VL2 C;  1ERW A;  4HSC X;  1FHE A;  3F3R A;  1SVM A;  2AUV A;  1Y1U A;  2WVX A;  1GSF A;  4D73 B;  1PL1 A;  1U3A A;  5ECK B;  4WR5 A;  2DKH A;  1GTU A;  3GH6 A;  3G7J A;  1FO5 A;  1Z6N A;  3GV1 A;  2B5X A;  1LU4 A;  1V9W A;  1XW6 A;  2LEG A;  2DC5 A;  1R4W A;  1K3O A;  3HZ4 A;  1EGO A;  5CYY A;  2XBI A;  4TOP A;  3GN3 A;  2VLU A;  2I3Y A;  4F9Z A;  3P8W A;  4XRD A;  2AV4 A;  3APQ A;  4K6X A;  2OE1 A;  1PN9 A;  5IMC A;  2L4Q A;  4OO5 A;  4KDY A;  4YKG A;  3LG6 A;  1S3D A;  1F9M A;  4X43 A;  3BBY A;  5IO2 A;  2MMZ A;  3M8N A;  3UAP A;  2YJH A;  5DAK A;  2H72 A;  4ZIJ A;  3VLN A;  3HYP A;  1PX6 A;  1THO A;  1EEJ A;  2DSA A;  2WJU A;  1F3B A;  5KN3 A;  3KCM A;  1EV9 A;  1Z9H A;  5H5S A;  2IPA A;  2VCT A;  1S3A A;  2IN3 A;  3V1W A;  2F3M A;  3UVH A;  3UEM A;  2CAI A;  1PQN A;  3KTL A;  3F8U A;  3FR3 A;  3FR9 A;  1XG8 A;  2E7P A;  3ZYW A;  3CSI A;  1EP7 A;  4V2L A;  1V2A A;  1PKZ A;  1X9W B;  5FT3 A;  2YPM A;  2WDU A;  2JSZ A;  5IM9 A;  4IJI A;  5HR2 A;  1PRX A;  1A2L A;  1YVL A;  4BIK A;  3WGE A;  1FVJ A;  4EIP A;  3H4K A;  2I1U A;  1BYE A;  4FYU A;  3KMN A;  4ML6 A;  2YWI A;  4I8B A;  4WR4 A;  5F07 A;  2TRX A;  4K2D A;  1B48 A;  2E0Q A;  3H79 A;  1OYJ A;  4HU7 A;  3TRX A;  3QMX A;  3ZRD A;  3LXZ A;  2O5V A;  4XS1 A;  2R6K A;  1R26 A;  3M3M A;  2R0P A;  4E68 A;  1FOV A;  4K5R A;  3GKK A;  4GST A;  2YJ7 A;  4AJ8 A;  3TKP A;  4G01 A;  5CNW A;  1Z5Y E;  4MLY A;  4A5P A;  1V40 A;  1DUG A;  1E6B A;  4I97 A;  3TGZ A;  1TKD B;  2LUS A;  1NSW A;  2HRN A;  1TRW A;  4MNN A;  5DAL B;  4FYC A;  5ELA A;  4GSN A;  2H73 A;  4XS6 A;  2OT3 A;  5IMA A;  2OBK A;  2PUK C;  4KDU A;  3IR4 A;  4O92 A;  4HUA A;  4KCA A;  3TCO A;  2CZ2 A;  2HT9 A;  2X4A A;  2XBQ A;  3US3 A;  2P5Q A;  1K0M A;  1SJZ A;  2EIO A;  4AF2 A;  1THX A;  2GT5 A;  5DJM A;  2B1L A;  2X99 A;  4X4J A;  1SK0 A;  1T3B A;  2I4A A;  3GH9 A;  3WGD A;  1T7P B;  4XHM A;  3BOA A;  1YF1 A;  2WW0 A;  1GRX A;  3JCM L;  2FA8 A;  5C04 A;  1B4Q A;  2H75 A;  3CRU A;  2MBT A;  2YV7 A;  4WF5 A;  1DSB A;  1KNG A;  3L9U A;  3TU3 B;  4MAB A;  1I1I P;  2C0D A;  2CA8 A;  4V1A g;  3U5R E;  2TRC P;  4BVY A;  5B6M A;  5ID2 B;  5ECO B;  1F37 A;  1GSS A;  2P5R A;  1ERU A;  2YP6 A;  4HS1 A;  5H5R A;  4CW9 A;  2GZY A;  3ZML A;  2REM A;  1JZR A;  1W89 A;  2PER A;  4PNG A;  5J3R A;  2ALB A;  1K0O A;  3GUR A;  1KEB A;  3ERF A;  1V57 A;  4OD7 A;  1GNE A;  1J0F A;  1O73 A;  7GSS A;  3KD0 A;  3RAZ A;  4PHZ C;  4IKH A;  3KMO A;  2H71 A;  4PI0 C;  3MWH A;  12GS A;  4ZIL A;  3N9J A;  2V6O A;  2LST A;  2DJ1 A;  4HZ2 A;  2VM2 A;  1MDI A;  1TW9 A;  3DXB A;  3MIX A;  2J9H A;  5F06 A;  3CTF A;  3D5J A;  3GIX A;  5J4Y A;  5AIV A;  2H0G A;  3DKS A;  4J2F A;  4N0Z A;  1O81 A;  4I6X A;  1TP9 A;  3IV4 A;  1TRU A;  2HRA A;  2GQM A;  4G0I A;  2H1L A;  2K8V A;  2L5L A;  5GAP D;  3QAG A;  3ZVJ D;  3D6I A;  1PN0 A;  1TRV A;  3F9U A;  4RI6 A;  3IPZ A;  4POK A;  3W6G A;  4DSS B;  2KLX A;  4GLT A;  3FR6 A;  3TUE A;  1G7E A;  4TR1 A;  2OA7 A;  2QKE A;  2G2Q A;  5AGY A;  2PMT A;  1S3C A;  3A5I A;  1X9M B;  3S9F A;  3HY2 A;  4I2U A;  4DVC A;  4ZL7 A;  1FB6 A;  2H6Z A;  5KOW A;  4NXI A;  1A0R P;  1M9A A;  3LYP A;  4N11 A;  5CRE A;  3IBH A;  3F4T A;  3KH7 A;  1TK0 B;  2LJA A;  4EKZ A;  3CYN A;  5FHI A;  3IHG A;  3GYK A;  1ZYE A;  2GZZ A;  4DSS A;  2QA2 A;  5J9C A;  3HD5 A;  1A0F A;  1TDI A;  2H0I A;  3UBK A;  4MA9 A;  2LRN A;  2OBI A;  1OE8 A;  3DWV A;  4K7O A;  5D9X A;  4ZBD A;  2MZC A;  1QXH A;  5A5H B;  1O7U A;  1I9D A;  3P2A A;  1PKW A;  1XBS A;  5E4W A;  4YAV A;  2UZ8 A;  3W8S A;  4GXZ A;  2HSM B;  2VL2 A;  1G7O A;  1S3R A;  3C8E A;  2LRT A;  5FWG A;  2GGT A;  1ZL9 A;  5DQY A;  3EU3 A;  4TXO B;  2L59 A;  5G31 A;  3HVV A;  4FYB A;  3QFA C;  1HQO A;  2R37 A;  4PXO A;  3BCK A;  1GWC A;  3QPM A;  3GRX A;  4TKY A;  5HR3 A;  1LBK A;  4KE3 A;  4NV2 A;  4GRF A;  1M99 A;  6GSY A;  2V32 A;  2PWJ A;  3F6F A;  4FXY P;  5D9T A;  4N30 A;  1H75 A;  2F51 A;  3D4M A;  4QL7 A;  5EL8 A;  3E0U A;  3APS A;  1AQV A;  1TK8 B;  2CX4 A;  3TKR A;  4EF0 A;  4QMK A;  1HYU A;  1ZYN A;  3GST A;  1PX7 A;  3RGB C;  2GZP A;  2E2G A;  2VCQ A;  4IP1 A;  2LRC A;  4N3Z A;  4IN0 A;  3IC8 A;  1FAA A;  1T8E B;  2HSN B;  2C3T A;  3QAV A;  1MD4 A;  2BJX A;  4Q5F A;  2K8S A;  1HNA A;  4K7I A;  3RFR C;  3IC4 A;  2YAN A;  3GX8 A;  4GDF A;  1WMJ A;  1WWJ A;  3TJK A;  3U6V A;  2HYX A;  1GTB A;  2AB6 A;  3LOR A;  3LFL A;  4K5S A;  4EC0 A;  2KUC A;  4TR0 A;  1GUH A;  1VF2 A;  1XW5 A;  4PTS A;  4POL A;  4YH2 A;  3ZFL A;  2HSY A;  5H5Q A;  4FH8 A;  2RII A;  5HFK A;  1Z6M A;  2GVP A;  3I69 A;  2A4H A;  2GS3 A;  2YN1 A;  5JWR B;  5KEJ A;  4HDE A;  4X0X A;  2Z9S A;  1ML6 A;  3EYT A;  2FWH A;  4KH7 A;  3KP9 A;  4XTS A;  1QGV A;  3LGC A;  2H74 A;  2RUF A;  1SKR B;  1NHY A;  3HDC A;  3E9J B;  3HVN A;  3CSH A;  2WVX B;  2R3X A;  9GSS A;  2O87 A;  2B6M A;  4ICY A;  4TR3 A;  4LMV A;  2LNS A;  4JR6 A;  3KEB A;  3VWU A;  3E3E A;  2HE3 A;  3TJF A;  2B7J A;  4K0G A;  1ABA A;  1XVQ A;  2IJY A;  4OMV A;  1VF3 A;  1M3J A;  3VI7 A;  3PPU A;  1TI3 A;  2V6K A;  5D9W A;  1VGL A;  2IIY A;  4DEJ A;  5GZZ B;  4E8H A;  1LJR A;  2F8F A;  2LNT A;  2H01 A;  4K7N A;  3ERG A;  1QQ2 A;  4YQM A;  5B6N A;  5A1N B;  4HEA 2;  4W66 A;  5DAK B;  4DSR A;  6GST A;  2DJJ A;  4O5R A;  3TJG A;  3HKR A;  2F9S A;  4H86 A;  1PGT A;  2BTO T;  4NV5 A;  1K0N A;  4WXT A;  4PQI A;  2N5F A;  4KF9 A;  4BL7 A;  1XZO A;  1EOH A;  1JZO A;  3LEF A;  1RK4 A;  3VK9 A;  3GTU B;  3GNJ A;  1A2J A;  4EVM A;  4Z7X A;  2C0E A;  2L5O A;  3WD6 A;  3W8J A;  4JU5 A;  1UC7 A;  2WVY A;  1R7H A;  5G1K A;  1XOA A;  5A1N A;  4IGJ A;  3DIE A;  1TU7 A;  4FO5 A;  3RBT A;  5HR1 A;  2P31 A;  2H1D A;  3C71 A;  3EPT A;  4K1F A;  3GUS A;  2FNO A;  4MMM A;  4NMU A;  5EY6 A;  1Q98 A;  2HXK A;  3HXS A;  3UJ1 A;  1PFO A;  4KW6 A;  1W4V A;  2VKZ G;  18GS A;  1Y6E A;  1X5C A;  3HHV A;  2ZCT A;  5LCZ A;  5ECI B;  4MZB A;  1OVN A;  3A2X A;  1X5D A;  1SL2 B;  1ERT A;  1H4O A;  11GS A;  5KOX A;  2VCZ A;  3GTU A;  1TI1 A;  4AJ7 A;  2IME A;  2PPT A;  5A4W A;  4V2M A;  2FY6 A;  5J4U A;  1JZW A;  1EZK A;  3TKS E;  1PD2 1;  4AGS A;  2MMA A;  4ZBA A;  4L8E A;  2PN8 A;  5ECS A;  2GDR A;  1SVO A;  2H6Y A;  1GLQ A;  5C00 A;  1XWA A;  1GP1 A;  1ILO A;  3D0Z A;  4ECB A;  2QA1 A;  4G2E A;  3VWW A;  4ECI A;  1IYH A;  1SYR A;  4KA0 A;  3ZRE A;  2V2G A;  4K9Z A;  1PSQ A;  3DRN A;  1X9S B;  1T00 A;  1U3I A;  3D4T A;  1TXU A;  1A23 A;  3EMP A;  2X64 A;  1SK1 A;  2MBS A;  2IMF A;  1JLV A;  2V1M A;  1DBY A;  5G5E A;  1Y25 A;  2NDO A;  5DCH A;  5IOX A;  2R0C A;  1TOF A;  2NBS A;  2C80 A;  5J47 A;  4ID0 A;  4BVY B;  2VLT A;  2VL9 A;  2FGX A;  4MF7 A;  2PVO C;  4KDX A;  5ENU A;  3ZFB A;  2EFC A;  2H0H A;  3ME8 A;  1EEM A;  5GSS A;  4GWR A;  4IJ3 A;  2RM6 A;  1Q4J A;  3TRP A;  1R5A A;  4G19 A;  3UBL A;  4E8E A;  3FZ9 A;  2B5E A;  3GKN A;  2WW2 A;  2B7K A;  1QFN A;  2L57 A;  4NWY A;  2WW3 A;  4Q5R A;  3CHX C;  4N0V A;  2VOC A;  3CBU A;  3EC3 A;  2HI7 A;  1J9B A;  5CRG A;  5DCG A;  1M2B A;  3M1G A;  1XVW A;  3P7X A;  3QD9 A;  2XHF A;  2HZF A;  4GQF A;  5EVO A;  4HI7 A;  1PMT A;  5JCU A;  1OKT A;  3L4N A;  1ERV A;  2JL4 A;  2DML A;  4GF0 A;  4AJ6 A;  5B7C A;  2O89 A;  4EUY A;  3LYK A;  5ELG A;  5A5K A;  3KIJ A;  4O32 A;  4XRA A;  3LW9 A;  1ZOF A;  1UA5 A;  1AXD A;  5J40 A;  4OCF A;  4ZBB A;  4KAE A;  2AYT A;  4L0W A;  4Z2T A;  3TKS A;  4POM A;  3LQ7 A;  2DBC A;  2IWT A;  5GST A;  3KM6 A;  4KSM A;  3GKM A;  1KBN A;  4EXJ A;  3KGK A;  3MSZ A;  3UL3 A;  1V58 A;  1DE1 A;  1ZYQ B;  3WYW A;  4EL1 A;  5D9V A;  4BWS A;  4TR1 B;  4L5O A;  2K6V A;  3DVX A;  2IL3 A;  5D8I A;  1JZD A;  1O85 A;  6GSV A;  2YZH A;  3ED3 A;  4ZB7 A;  2VD1 A;  1BED A;  1M2D A;  2X8G A;  2KP2 A;  1ON4 A;  1Z7R A;  2KP1 A;  1U6T A;  2GQK A;  2L6D A;  3C1R A;  3GKX A;  1MDJ A;  3FMW A;  4XIH A;  3N5O A;  3J7Y k;  3ZMK A;  1GSY A;  1UN2 A;  2OAD A;  1GH2 A;  2O85 A;  4Z2U A;  5IO0 A;  2H66 A;  3SBC A;  1B9Y C;  1A2M A;  3WGX A;  1ZCP A;  1FW1 A;  3QFB C;  5D96 A;  1SK2 A;  4O7H A;  4PNF A;  2HRK B;  1B9X C;  1S4B P;  4MK3 A;  4BPY A;  4BWQ A;  1N8J A;  1EP8 A;  4MPG A;  4YAP A;  3TJB A;  5LNK e;  5IPG A;  4N10 A;  2DJK A;  5CO3 A;  5DVB A;  1GUL A;  4EDY A;  1SD9 A;  2LTK A;  4LMW A;  3IRA A;  2DIY A;  1CQG A;  2JAC A;  3MAK A;  4F82 A;  4IS0 A;  2C4J A;  1RW1 A;  3CRT A;  2CX3 A;  2TIR A;  2HFD A;  3GMF A;  4PUR A;  1GNW A;  1JFU A;  2PVQ A;  2AJQ B;  1YDK A;  3D21 A;  4ZL8 A;  4QQ7 A;  3IE3 A;  3BJ5 A;  5BMU A;  2HRK A;  2C1Y A;  5JWQ B;  2WFC A;  3QCP A;  1X5E A;  1BAY A;  2YWN A;  22GS A;  4LA1 A;  3TJJ A;  2GST A;  1A8Y A;  3F0I A;  3ERW A;  2QGV A;  5EPF A;  4IW9 A;  4G10 A;  5IMV A;  3I43 A;  1XWC A;  1J08 A;  2CT6 A;  3F3Q A;  4RI7 A;  2WCI A;  4TW5 A;  4IQ1 A;  3G7Y A;  3KP8 A;  4PGT A;  3EU4 A;  5ABR A;  1WP0 A;  4CDO A;  2R5G A;  3HZ8 A;  1XPV A;  2JZT A;  2H1A A;  3IAS 2;  4RQR A;  2YWO A;  1O8W A;  4MZC A;  3IOS A;  5F0G A;  3UVT A;  1HD2 A;  1RQM A;  3J7Y b;  3EIN A;  4YQU A;  3VPQ A;  3MDK A;  3ZVJ A;  1XWB A;  3TKS C;  5A34 B;  3BCI A;  3H93 A;  2X8C A;  2K9F A;  4G0L A;  2WW1 A;  5IMD A;  4EDZ A;  3L0H A;  2PU9 C;  3DGQ A;  1N2A A;  3IK7 A;  1GTA A;  1FOH A;  3HVX A;  3TB2 A;  4JZQ A;  5DQS A;  2OE3 A;  1ZYP A;  1YY7 A;  5G5F A;  3LJR A;  3HJO A;  1GSU A;  4HOJ A;  2VCX A;  2EFE A;  4LL1 B;  5IMF A;  4GTU A;  4PQH A;  4K0N A;  4JE1 A;  1NM3 A;  4KB3 A;  1TRS A;  2V41 A;  3IA1 A;  4ECC A;  1YEX A;  3FZA A;  2ZNM A;  3GL3 A;  5A34 A;  3Q6O A;  2DLX A;  4HQS A;  2I9H A;  4GSS A;  4LLR A;  1T4Z A;  5IQY A;  4MCU A;  4KX4 A;  1XWG A;  16GS A;  5L71 A;  4F03 A;  2XPE A;  1TXX A;  3KZQ A;  3ME7 A;  1YEP A;  4ULX A;  4AKI A;  2M80 A;  4OCE A;  1OC9 A;  2LJR A;  4X1U A;  4WET A;  4KUN A;  1OKD A;  3HJM A;  4GQC A;  3VWV A;  1SJI A;  1OC3 A;  13GS A;  1XXU A;  4MJE A;  1M7T A;  5KN2 A;  3UIW A;  1T1V A;  2DMM A;  3HVS A;  3DEX A;  1WPI A;  4FIW A;  4KSO A;  1YKA A;  2LKU A;  2RUE A;  6GSS A;  1QMV A;  3ZLP A;  2D2Z A;  2H6X A;  1YQ1 A;  2VAF A;  2IFQ B;  2A2S A;  3FK8 A;  2WZS A;  5G30 A;  1AC1 A;  4ZB9 A;  5J9B A;  2XC2 A;  1I5G A;  2B1K A;  4K8M A;  3A3T A;  2FCH A;  4BL7 B;  1XCC A;  4MF5 A;  4TN8 A;  1OAZ A;  4BVX A;  1WE0 A;  3EWL A;  2YOI A;  2R2J A;  1NHO A;  2VO4 A;  2OE0 A;  5IIZ A;  1K0C A;  1ZMA A;  4AKG A;  1MTC A;  4GCI A;  4L0U A;  5A4U A;  3O6T A;  4O5U A;  5HFI A;  3DVW A;  3PIN A;  1K3Y A;  3EE2 A;  3KJY A;  5J4V A;  2PGT A;  4HU9 A;  4WF4 A;  3NOF A;  5AIS A;  2IFQ A;  5ECN B;  2ON5 A;  1B4P A;  3PH9 A;  2WB9 A;  5B8B A;  3IAM 2;  5ECQ B;  2X49 A;  5JWO B;  2WUL A;  4WBR D;  4KGI A;  4V1A p;  3EVI A;  1YZX A;  4MJB A;  5J5N A;  2CVB A;  1K0A A;  2FUG 2;  3FKF A;  1AUC A;  2IMK A;  4OFN A;  1VRS D;  4PI2 C;  1K3L A;  1NW2 A;  4JED A;  3F6D A;  2OJL A;  4USS A;  4OO4 A;  1SL0 B;  4G9H A;  2NVL A;  1AQW A;  1OC8 A;  4MDC A;  3MYD A;  3TDG A;  4XCS A;  4YQV A;  2LV3 A;  1B8X A;  1FB0 A;  3FHK A;  1GLP A;  3G9B A;  2IMD A;  1TU8 A;  3WT2 A;  1GL8 A;  4OFM A;  5CRD A;  3ZTL A;  2GTU A;  1EOG A;  4XS4 A;  2VCW A;  4NAX A;  2C3Q A;  4J57 E;  2A2P A;  3L9S A;  5GAN D;  3D22 A;  4DSQ A;  2C0G A;  4D73 A;  4P3Y B;  3C7M A;  2H1B A;  2HSH A;  4F0B A;  3TRQ A;  1X0R A;  3RHC A;  3UOM A;  2H1G A;  1AQX A;  5G1L A;  2JZR A;  3IDV A;  4OWY A;  2MYG A;  1YF0 A;  20GS A;  5CAX A;  2FHE A;  2OAC A;  4KCE A;  3IK9 A;  2LQQ A;  1OE7 A;  1YJ6 A;  1M9B A;  3H1N A;  4Q5Q A;  4L5L A;  2F8A A;  2M46 A;  3C73 A;  3HJP A;  1SJ6 A;  2PBJ A;  3VPT A;  1PA3 A;  3F4R A;  4G0K A;  2GSR A;  1BJX A;  1V98 A;  2EFH A;  2L6C A;  3KXO A;  2AHE A;  3GFK A;  1O8X A;  5ECP B;  1N25 A;  1M3I A;  4J56 E;  2I81 A;  19GS A;  5ECH B;  3ZIV A;  1Z3E A;  2BMX A;  4ZXG A;  2X8H A;  2CVD A;  2N5A A;  3PR8 A;  5AIX A;  4WEY A;  3GSS A;  1BQ7 A;  3RPN A;  1TJD A;  1R5P A;  5LD0 A;  10GS A;  1O6J A;  1WJK A;  4JRR A;  4KND A;  2EIQ A;  2L4C A;  5ECL B;  2J23 A;  4EO3 A;  1GUM A;  2GLR A;  5IPH A;  2H30 A;  3OR5 A;  2DKI A;  3QR6 A;  2EIR A;  2GQL A;  3VWX A;  4YKF A;  1BF5 A;  1SEN A;  1G6W A;  3ZZX A;  1SU9 A;  3EUR A;  5DJL A;  1WIK A;  3C1S A;  3I6A A;  1QK8 A;  4NPB A;  3QDN A;  3CMI A;  3FZ4 A;  2WGR A;  2RM5 A;  1HNB A;  1GSE A;  4PUF C;  1EGR A;  5KN1 A;  2HZE B;  1TK5 B;  4CY8 A;  3KH9 A;  4HJ2 A;  5DAL A;  4AKX B;  2VM1 A;  3M0F A;  4WBJ A;  2HQT A;  4F2I A;  1GTI A;  4Q5N A;  5JCW A;  4TR4 A;  4TVE A;  2R4V A;  5A4V A;  4NHZ A;  5JCG A;  5BRT A;  3TKQ A;  5HR0 A;  2VIM A;  1SKS B;  3A2V A;  4MH3 A;  5G2Z A;  2WVZ A;  2YWM A;  3RHB A;  2M72 A;  1YKC A;  3Q18 A;  4IHU A;  4PX1 A;  2A2R A;  3NIV A;  1IYI A;  1M0U A;  5INY A;  4PUA A;  1USB A;  1BG5 A;  3HA9 A;  4NHW A;  5CP1 A;  2HZE A;  3GL5 A;  1MD3 A;  5F8B A;  3UAR A;  1F6M C;  1ZZY A;  5D93 A;  4MP4 A;  2DIZ A;  2KHP A;  1SL1 B;  17GS A;  3RPP A;  8GSS A;  2WZ9 A;  3VFI A;  2H70 A;  1FG4 A;  5ECM B;  4ZB8 A;  3AY8 A;  5ID2 A;  2H19 A;  3A2W A;  4MJA A;  4FQU A;  2FWF A;  4TRX A;  2H8L A;  3HMJ G;  1URM A;  2YZU A;  2C0F A;  3RDW A;  4JBB A;  3TOT A;  3O3T A; 
#chains in the Genus database with same CATH homology
 5BMU B;  1JLW A;  4IEL A;  3CTG A;  5D73 A;  3ZIJ A;  5IOW A;  5CRW A;  5CRH A;  2E2M A;  3LWA A;  3FEU A;  2YNX A;  2QC7 A;  4ILF A;  2CAQ A;  2MMN A;  3F63 A;  4IQA A;  5ECR B;  5DBQ A;  1XFL A;  4CHS A;  1VF1 A;  5AN1 A;  3H8Q A;  2JSY A;  3M9K A;  4PQ1 A;  3CXG A;  2XPD A;  5HQP A;  2YV9 A;  2O7K A;  1QUW A;  3G7I A;  2FLS A;  2LS5 A;  3KTB A;  3FYG A;  2NTO A;  5F05 A;  4QL9 A;  3O76 A;  1E2Y A;  2JU5 A;  3M9J A;  4POB A;  4HJM A;  1CQH A;  5COH A;  2NPB A;  2VL3 A;  2P0G A;  2WS2 A;  1DE2 A;  3GX0 A;  3EMX A;  1GSQ A;  3FRC A;  4O5Q A;  5DDL A;  2VD0 A;  3IHQ A;  3VI5 A;  3WT1 A;  4ZB6 A;  3A5W A;  2KOK A;  1HNC A;  2YCD A;  14GS A;  3DML A;  4RQX A;  2EFD A;  4HQZ A;  1F2E A;  2CQ9 A;  5IMZ A;  3QOU A;  2JZS A;  1GUK A;  1SD8 A;  2ES7 A;  3VUR A;  3F4S A;  1XWK A;  3L78 A;  2OKA A;  3TOU A;  1A8L A;  4OFT A;  1XIY A;  4RUV A;  2B3S A;  2FD3 A;  1XW9 A;  1EV4 A;  2C8U A;  1VF4 A;  1EWX A;  4I5Q A;  4Z2R A;  4LL4 B;  2WRT A;  1KTE A;  2R0G A;  3ISO A;  2GT6 A;  2DJ2 A;  4TXV A;  2B5Y A;  3CWG A;  1OC9 B;  4MPF A;  2VUP A;  1G6Y A;  2C3N A;  4IVF A;  5A5H A;  1GSD A;  5HFG A;  3GHA A;  1XOB A;  2GSQ A;  1WRY A;  4MJC A;  4WKW A;  4ISD A;  3ZL5 A;  1PL2 A;  2HSM A;  6GSW A;  3P90 A;  3L9V A;  4ACS A;  1MDK A;  2CV4 A;  2JAD A;  2LQO A;  3APO A;  2MMO A;  2ON7 A;  2H76 A;  4JR4 A;  4IP6 A;  1AAZ A;  1AIU A;  1AW9 A;  1K0B A;  1BX9 A;  3BD2 A;  4TXO A;  3R3E A;  5KN0 A;  2G0F A;  2EC4 A;  2QSI A;  1K0D A;  4BVX B;  3GA4 A;  1T4Y A;  2HLS A;  3Q19 A;  2DJ3 A;  2IMI A;  1SYX A;  3FY7 A;  1BG1 A;  1UVZ A;  2LJK A;  1WOU A;  3DD3 A;  2HNL A;  3SWL A;  1U88 A;  3IXR A;  3I9V 2;  1TTZ A;  1U87 A;  4ECJ A;  4ML1 A;  3ZIT A;  1C72 A;  3K8N A;  3FW2 A;  4V2N A;  2FWE A;  2CZ3 A;  2K18 A;  2HSN A;  3R2Q A;  3MNG A;  4MZW A;  5E59 A;  2DJ0 A;  1ZGN A;  1G0T A;  3QAW A;  2N5B A;  6GSU A;  1F3A A;  4AKH A;  2CVK A;  4IBP A;  4K2X A;  6GSX A;  3UMA A;  4I2T A;  5B8A A;  4BA7 A;  2O8V B;  4MH2 A;  1JHB A;  4CY6 A;  2UV8 G;  1MEK A;  3FZ5 A;  2HRF A;  1A24 A;  4MF6 A;  4AI6 A;  4F0C A;  3PGT A;  2A4V A;  3LXT A;  2AAW A;  1ST9 A;  5J41 A;  3DYR A;  4ZL9 A;  1ACV A;  3Q74 A;  2FA4 A;  3LSZ A;  2ZUP A;  4EE0 A;  2FWG A;  2VLV A;  1FVK A;  1SVL A;  2VCV A;  3CSJ A;  4XS4 B;  1M2A A;  4EIQ A;  3HCZ A;  1Z7P A;  4HZ4 A;  2RLI A;  2GSS A;  3NZN A;  1SKW B;  2VL2 C;  1ERW A;  1FHE A;  3F3R A;  1SVM A;  2AUV A;  1Y1U A;  1GSF A;  4D73 B;  1PL1 A;  1U3A A;  5ECK B;  4WR5 A;  2DKH A;  1GTU A;  3GH6 A;  3G7J A;  1FO5 A;  1Z6N A;  3GV1 A;  2B5X A;  1LU4 A;  1V9W A;  1XW6 A;  2LEG A;  2DC5 A;  1R4W A;  1K3O A;  3HZ4 A;  1EGO A;  5CYY A;  2XBI A;  4TOP A;  3GN3 A;  2VLU A;  2I3Y A;  4F9Z A;  3P8W A;  4XRD A;  2AV4 A;  3APQ A;  4K6X A;  2OE1 A;  1PN9 A;  5IMC A;  2L4Q A;  4OO5 A;  4KDY A;  4YKG A;  3LG6 A;  1S3D A;  1F9M A;  4X43 A;  3BBY A;  5IO2 A;  2MMZ A;  3M8N A;  3UAP A;  2YJH A;  5DAK A;  2H72 A;  4ZIJ A;  3VLN A;  3HYP A;  1PX6 A;  1THO A;  1EEJ A;  2DSA A;  2WJU A;  1F3B A;  5KN3 A;  3KCM A;  1EV9 A;  1Z9H A;  5H5S A;  2IPA A;  2VCT A;  1S3A A;  2IN3 A;  3V1W A;  2F3M A;  3UVH A;  3UEM A;  2CAI A;  1PQN A;  3KTL A;  3F8U A;  3FR3 A;  3FR9 A;  2E7P A;  3ZYW A;  3CSI A;  1EP7 A;  4V2L A;  1V2A A;  1PKZ A;  1X9W B;  5FT3 A;  2YPM A;  2WDU A;  2JSZ A;  5IM9 A;  4IJI A;  5HR2 A;  1PRX A;  1A2L A;  1YVL A;  3WGE A;  1FVJ A;  4EIP A;  3H4K A;  2I1U A;  1BYE A;  4FYU A;  3KMN A;  4ML6 A;  2YWI A;  4I8B A;  4WR4 A;  5F07 A;  2TRX A;  4K2D A;  1B48 A;  2E0Q A;  3H79 A;  1OYJ A;  4HU7 A;  3TRX A;  3QMX A;  3ZRD A;  3LXZ A;  2O5V A;  4XS1 A;  2R6K A;  1R26 A;  3M3M A;  2R0P A;  4E68 A;  1FOV A;  4K5R A;  3GKK A;  4GST A;  2YJ7 A;  4AJ8 A;  3TKP A;  4G01 A;  5CNW A;  1Z5Y E;  4MLY A;  4A5P A;  1V40 A;  1DUG A;  1E6B A;  4I97 A;  3TGZ A;  1TKD B;  2LUS A;  1NSW A;  2HRN A;  1TRW A;  4MNN A;  5DAL B;  4FYC A;  5ELA A;  4GSN A;  2H73 A;  4XS6 A;  2OT3 A;  5IMA A;  2OBK A;  2PUK C;  4KDU A;  3IR4 A;  4O92 A;  4HUA A;  4KCA A;  3TCO A;  2CZ2 A;  2HT9 A;  2X4A A;  2XBQ A;  3US3 A;  2P5Q A;  1K0M A;  1SJZ A;  2EIO A;  4AF2 A;  1THX A;  2GT5 A;  5DJM A;  2B1L A;  2X99 A;  4X4J A;  1SK0 A;  1T3B A;  2I4A A;  3GH9 A;  3WGD A;  1T7P B;  4XHM A;  3BOA A;  1YF1 A;  1GRX A;  3JCM L;  2FA8 A;  5C04 A;  1B4Q A;  2H75 A;  3CRU A;  2MBT A;  2YV7 A;  4WF5 A;  1DSB A;  1KNG A;  3L9U A;  3TU3 B;  4MAB A;  2C0D A;  2CA8 A;  4V1A g;  3U5R E;  2TRC P;  4BVY A;  5B6M A;  5ID2 B;  5ECO B;  1F37 A;  1GSS A;  2P5R A;  1ERU A;  2YP6 A;  4HS1 A;  5H5R A;  4CW9 A;  2GZY A;  3ZML A;  2REM A;  1JZR A;  1W89 A;  2PER A;  4PNG A;  5J3R A;  2ALB A;  1K0O A;  3GUR A;  1KEB A;  3ERF A;  1V57 A;  4OD7 A;  1GNE A;  1J0F A;  1O73 A;  7GSS A;  3KD0 A;  3RAZ A;  4IKH A;  3KMO A;  2H71 A;  3MWH A;  12GS A;  4ZIL A;  3N9J A;  2V6O A;  2LST A;  2DJ1 A;  4HZ2 A;  2VM2 A;  1MDI A;  1TW9 A;  3DXB A;  3MIX A;  2J9H A;  5F06 A;  3CTF A;  3D5J A;  3GIX A;  5J4Y A;  5AIV A;  2H0G A;  3DKS A;  4J2F A;  4N0Z A;  1O81 A;  4I6X A;  1TP9 A;  3IV4 A;  1TRU A;  2HRA A;  2GQM A;  4G0I A;  2H1L A;  2K8V A;  2L5L A;  5GAP D;  3QAG A;  3ZVJ D;  3D6I A;  1PN0 A;  1TRV A;  3F9U A;  4RI6 A;  3IPZ A;  4POK A;  3W6G A;  4DSS B;  2KLX A;  4GLT A;  3FR6 A;  3TUE A;  1G7E A;  4TR1 A;  2OA7 A;  2QKE A;  2G2Q A;  5AGY A;  2PMT A;  1S3C A;  3A5I A;  1X9M B;  3S9F A;  3HY2 A;  4I2U A;  4DVC A;  4ZL7 A;  1FB6 A;  2H6Z A;  5KOW A;  4NXI A;  1A0R P;  3LYP A;  1M9A A;  4N11 A;  5CRE A;  3IBH A;  3F4T A;  3KH7 A;  1TK0 B;  2LJA A;  4EKZ A;  3CYN A;  5FHI A;  3IHG A;  3GYK A;  1ZYE A;  2GZZ A;  4DSS A;  2QA2 A;  5J9C A;  3HD5 A;  1A0F A;  1TDI A;  2H0I A;  3UBK A;  4MA9 A;  2LRN A;  2OBI A;  1OE8 A;  3DWV A;  4K7O A;  5D9X A;  4ZBD A;  2MZC A;  1QXH A;  5A5H B;  1O7U A;  1I9D A;  3P2A A;  1PKW A;  1XBS A;  5E4W A;  4YAV A;  2UZ8 A;  3W8S A;  4GXZ A;  2HSM B;  2VL2 A;  1G7O A;  3C8E A;  2LRT A;  5FWG A;  2GGT A;  1ZL9 A;  5DQY A;  3EU3 A;  4TXO B;  2L59 A;  5G31 A;  3HVV A;  4FYB A;  3QFA C;  1HQO A;  2R37 A;  4PXO A;  3BCK A;  1GWC A;  3QPM A;  3GRX A;  4TKY A;  5HR3 A;  1LBK A;  4KE3 A;  4NV2 A;  4GRF A;  1M99 A;  6GSY A;  2V32 A;  2PWJ A;  3F6F A;  5D9T A;  4N30 A;  1H75 A;  2F51 A;  3D4M A;  4QL7 A;  5EL8 A;  3E0U A;  3APS A;  1AQV A;  1TK8 B;  2CX4 A;  3TKR A;  4EF0 A;  4QMK A;  1HYU A;  1ZYN A;  3GST A;  1PX7 A;  2GZP A;  2E2G A;  2VCQ A;  4IP1 A;  2LRC A;  4N3Z A;  4IN0 A;  3IC8 A;  1FAA A;  1T8E B;  2HSN B;  2C3T A;  3QAV A;  1MD4 A;  2BJX A;  4Q5F A;  2K8S A;  1HNA A;  4K7I A;  3IC4 A;  2YAN A;  3GX8 A;  4GDF A;  1WMJ A;  1WWJ A;  3TJK A;  3U6V A;  2HYX A;  1GTB A;  2AB6 A;  3LOR A;  3LFL A;  4K5S A;  4EC0 A;  2KUC A;  4TR0 A;  1GUH A;  1VF2 A;  1XW5 A;  4PTS A;  4POL A;  4YH2 A;  3ZFL A;  2HSY A;  5H5Q A;  4FH8 A;  2RII A;  5HFK A;  1Z6M A;  2GVP A;  3I69 A;  2A4H A;  2GS3 A;  2YN1 A;  5JWR B;  5KEJ A;  4HDE A;  4X0X A;  2Z9S A;  1ML6 A;  3EYT A;  2FWH A;  4KH7 A;  3KP9 A;  4XTS A;  1QGV A;  3LGC A;  2H74 A;  2RUF A;  1SKR B;  1NHY A;  3HDC A;  3E9J B;  3CSH A;  2R3X A;  9GSS A;  2O87 A;  2B6M A;  4ICY A;  4TR3 A;  4LMV A;  2LNS A;  4JR6 A;  3KEB A;  3VWU A;  3E3E A;  2HE3 A;  3TJF A;  2B7J A;  4K0G A;  1ABA A;  1XVQ A;  2IJY A;  4OMV A;  1VF3 A;  3VI7 A;  3PPU A;  1TI3 A;  2V6K A;  5D9W A;  1VGL A;  2IIY A;  4DEJ A;  5GZZ B;  4E8H A;  1LJR A;  2F8F A;  2LNT A;  2H01 A;  4K7N A;  3ERG A;  1QQ2 A;  4YQM A;  5B6N A;  5A1N B;  4HEA 2;  4W66 A;  5DAK B;  4DSR A;  6GST A;  2DJJ A;  4O5R A;  3TJG A;  3HKR A;  2F9S A;  4H86 A;  1PGT A;  2BTO T;  4NV5 A;  1K0N A;  4WXT A;  4PQI A;  2N5F A;  4KF9 A;  4BL7 A;  1XZO A;  1EOH A;  1JZO A;  3LEF A;  1RK4 A;  3VK9 A;  3GTU B;  3GNJ A;  1A2J A;  4EVM A;  4Z7X A;  2C0E A;  2L5O A;  3WD6 A;  3W8J A;  4JU5 A;  1UC7 A;  1R7H A;  5G1K A;  1XOA A;  5A1N A;  4IGJ A;  3DIE A;  1TU7 A;  4FO5 A;  3RBT A;  5HR1 A;  2P31 A;  2H1D A;  3C71 A;  3EPT A;  4K1F A;  3GUS A;  2FNO A;  4MMM A;  4NMU A;  5EY6 A;  1Q98 A;  2HXK A;  3HXS A;  3UJ1 A;  4KW6 A;  1W4V A;  2VKZ G;  18GS A;  1Y6E A;  1X5C A;  3HHV A;  2ZCT A;  5LCZ A;  5ECI B;  4MZB A;  1OVN A;  3A2X A;  1X5D A;  1SL2 B;  1ERT A;  1H4O A;  11GS A;  5KOX A;  2VCZ A;  3GTU A;  1TI1 A;  4AJ7 A;  2IME A;  2PPT A;  5A4W A;  4V2M A;  2FY6 A;  5J4U A;  1JZW A;  1EZK A;  3TKS E;  1PD2 1;  4AGS A;  2MMA A;  4ZBA A;  4L8E A;  2PN8 A;  5ECS A;  2GDR A;  1SVO A;  2H6Y A;  1GLQ A;  5C00 A;  1XWA A;  1GP1 A;  1ILO A;  3D0Z A;  4ECB A;  2QA1 A;  4G2E A;  3VWW A;  4ECI A;  1IYH A;  1SYR A;  4KA0 A;  3ZRE A;  2V2G A;  4K9Z A;  1PSQ A;  3DRN A;  1X9S B;  1T00 A;  1U3I A;  3D4T A;  1TXU A;  1A23 A;  3EMP A;  2X64 A;  1SK1 A;  2MBS A;  2IMF A;  1JLV A;  2V1M A;  1DBY A;  5G5E A;  1Y25 A;  2NDO A;  5DCH A;  5IOX A;  2R0C A;  1TOF A;  2NBS A;  2C80 A;  5J47 A;  4ID0 A;  4BVY B;  2VLT A;  2VL9 A;  2FGX A;  4MF7 A;  2PVO C;  4KDX A;  5ENU A;  3ZFB A;  2EFC A;  2H0H A;  3ME8 A;  1EEM A;  5GSS A;  4GWR A;  4IJ3 A;  2RM6 A;  1Q4J A;  3TRP A;  1R5A A;  4G19 A;  3UBL A;  4E8E A;  3FZ9 A;  2B5E A;  3GKN A;  2B7K A;  1QFN A;  2L57 A;  4NWY A;  4Q5R A;  2VOC A;  4N0V A;  3CBU A;  3EC3 A;  2HI7 A;  1J9B A;  5CRG A;  5DCG A;  1M2B A;  3M1G A;  1XVW A;  3P7X A;  3QD9 A;  2XHF A;  2HZF A;  4GQF A;  5EVO A;  4HI7 A;  1PMT A;  5JCU A;  1OKT A;  3L4N A;  1ERV A;  2JL4 A;  2DML A;  4GF0 A;  4AJ6 A;  5B7C A;  2O89 A;  4EUY A;  3LYK A;  5ELG A;  5A5K A;  3KIJ A;  4O32 A;  4XRA A;  3LW9 A;  1ZOF A;  1UA5 A;  1AXD A;  5J40 A;  4OCF A;  4ZBB A;  4KAE A;  2AYT A;  4L0W A;  4Z2T A;  3TKS A;  4POM A;  3LQ7 A;  2DBC A;  2IWT A;  5GST A;  3KM6 A;  4KSM A;  3GKM A;  1KBN A;  4EXJ A;  3KGK A;  3MSZ A;  3UL3 A;  1V58 A;  1DE1 A;  1ZYQ B;  3WYW A;  4EL1 A;  5D9V A;  4BWS A;  4TR1 B;  4L5O A;  2K6V A;  3DVX A;  2IL3 A;  5D8I A;  1JZD A;  1O85 A;  6GSV A;  2YZH A;  3ED3 A;  4ZB7 A;  2VD1 A;  1BED A;  1M2D A;  2X8G A;  2KP2 A;  1ON4 A;  1Z7R A;  2KP1 A;  1U6T A;  2GQK A;  2L6D A;  3C1R A;  3GKX A;  1MDJ A;  3FMW A;  4XIH A;  3N5O A;  3J7Y k;  3ZMK A;  1GSY A;  1UN2 A;  2OAD A;  1GH2 A;  2O85 A;  4Z2U A;  5IO0 A;  2H66 A;  3SBC A;  1B9Y C;  1A2M A;  3WGX A;  1ZCP A;  1FW1 A;  3QFB C;  5D96 A;  1SK2 A;  4O7H A;  4PNF A;  2HRK B;  1B9X C;  4MK3 A;  4BPY A;  4BWQ A;  1N8J A;  1EP8 A;  4MPG A;  4YAP A;  3TJB A;  5LNK e;  5IPG A;  4N10 A;  2DJK A;  5CO3 A;  5DVB A;  1GUL A;  4EDY A;  1SD9 A;  2LTK A;  4LMW A;  3IRA A;  2DIY A;  1CQG A;  2JAC A;  3MAK A;  4F82 A;  4IS0 A;  2C4J A;  1RW1 A;  3CRT A;  2CX3 A;  2TIR A;  2HFD A;  3GMF A;  4PUR A;  1GNW A;  1JFU A;  2PVQ A;  2AJQ B;  1YDK A;  3D21 A;  4ZL8 A;  4QQ7 A;  3IE3 A;  3BJ5 A;  5BMU A;  2HRK A;  2C1Y A;  5JWQ B;  2WFC A;  3QCP A;  1X5E A;  1BAY A;  2YWN A;  22GS A;  4LA1 A;  3TJJ A;  2GST A;  1A8Y A;  3F0I A;  3ERW A;  2QGV A;  5EPF A;  4IW9 A;  4G10 A;  5IMV A;  3I43 A;  1XWC A;  1J08 A;  2CT6 A;  3F3Q A;  4RI7 A;  2WCI A;  4TW5 A;  4IQ1 A;  3G7Y A;  3KP8 A;  4PGT A;  3EU4 A;  5ABR A;  1WP0 A;  4CDO A;  2R5G A;  3HZ8 A;  1XPV A;  2JZT A;  2H1A A;  3IAS 2;  4RQR A;  2YWO A;  1O8W A;  4MZC A;  3IOS A;  5F0G A;  3UVT A;  1HD2 A;  1RQM A;  3J7Y b;  3EIN A;  4YQU A;  3VPQ A;  3MDK A;  3ZVJ A;  1XWB A;  3TKS C;  5A34 B;  3BCI A;  3H93 A;  2X8C A;  2K9F A;  4G0L A;  5IMD A;  4EDZ A;  3L0H A;  2PU9 C;  3DGQ A;  1N2A A;  3IK7 A;  1GTA A;  1FOH A;  3HVX A;  3TB2 A;  4JZQ A;  5DQS A;  2OE3 A;  1ZYP A;  1YY7 A;  5G5F A;  3LJR A;  3HJO A;  1GSU A;  4HOJ A;  2VCX A;  2EFE A;  4LL1 B;  5IMF A;  4GTU A;  4PQH A;  4K0N A;  4JE1 A;  1NM3 A;  4KB3 A;  1TRS A;  2V41 A;  3IA1 A;  4ECC A;  1YEX A;  3FZA A;  2ZNM A;  3GL3 A;  5A34 A;  3Q6O A;  2DLX A;  4HQS A;  2I9H A;  4GSS A;  4LLR A;  1T4Z A;  5IQY A;  4MCU A;  4KX4 A;  1XWG A;  16GS A;  5L71 A;  4F03 A;  2XPE A;  1TXX A;  3KZQ A;  3ME7 A;  1YEP A;  4ULX A;  4AKI A;  2M80 A;  4OCE A;  1OC9 A;  2LJR A;  4X1U A;  4WET A;  4KUN A;  1OKD A;  3HJM A;  4GQC A;  3VWV A;  1SJI A;  1OC3 A;  13GS A;  1XXU A;  4MJE A;  1M7T A;  5KN2 A;  3UIW A;  1T1V A;  2DMM A;  3HVS A;  3DEX A;  1WPI A;  4FIW A;  4KSO A;  1YKA A;  2LKU A;  2RUE A;  6GSS A;  1QMV A;  3ZLP A;  2D2Z A;  2H6X A;  1YQ1 A;  2VAF A;  2IFQ B;  2A2S A;  3FK8 A;  5G30 A;  1AC1 A;  4ZB9 A;  5J9B A;  2XC2 A;  1I5G A;  2B1K A;  4K8M A;  3A3T A;  2FCH A;  4BL7 B;  1XCC A;  4MF5 A;  4TN8 A;  1OAZ A;  4BVX A;  1WE0 A;  3EWL A;  2YOI A;  2R2J A;  1NHO A;  2VO4 A;  2OE0 A;  5IIZ A;  1K0C A;  1ZMA A;  4AKG A;  1MTC A;  4GCI A;  4L0U A;  5A4U A;  3O6T A;  4O5U A;  5HFI A;  3DVW A;  3PIN A;  1K3Y A;  3EE2 A;  3KJY A;  5J4V A;  2PGT A;  4HU9 A;  4WF4 A;  3NOF A;  5AIS A;  2IFQ A;  5ECN B;  2ON5 A;  1B4P A;  3PH9 A;  2WB9 A;  5B8B A;  3IAM 2;  5ECQ B;  2X49 A;  5JWO B;  2WUL A;  4WBR D;  4KGI A;  4V1A p;  3EVI A;  1YZX A;  4MJB A;  5J5N A;  2CVB A;  1K0A A;  2FUG 2;  3FKF A;  1AUC A;  2IMK A;  4OFN A;  1VRS D;  1K3L A;  1NW2 A;  4JED A;  3F6D A;  2OJL A;  4USS A;  4OO4 A;  1SL0 B;  4G9H A;  2NVL A;  1AQW A;  1OC8 A;  4MDC A;  3MYD A;  3TDG A;  4XCS A;  4YQV A;  2LV3 A;  1B8X A;  1FB0 A;  3FHK A;  1GLP A;  3G9B A;  2IMD A;  1TU8 A;  3WT2 A;  1GL8 A;  4OFM A;  5CRD A;  3ZTL A;  2GTU A;  1EOG A;  4XS4 A;  2VCW A;  4NAX A;  2C3Q A;  4J57 E;  2A2P A;  3L9S A;  5GAN D;  3D22 A;  4DSQ A;  2C0G A;  4D73 A;  4P3Y B;  3C7M A;  2H1B A;  2HSH A;  4F0B A;  3TRQ A;  1X0R A;  3RHC A;  3UOM A;  2H1G A;  1AQX A;  5G1L A;  2JZR A;  3IDV A;  4OWY A;  2MYG A;  1YF0 A;  20GS A;  5CAX A;  2FHE A;  2OAC A;  4KCE A;  3IK9 A;  2LQQ A;  1OE7 A;  1YJ6 A;  1M9B A;  3H1N A;  4Q5Q A;  4L5L A;  2F8A A;  2M46 A;  3C73 A;  3HJP A;  1SJ6 A;  2PBJ A;  3VPT A;  1PA3 A;  3F4R A;  4G0K A;  2GSR A;  1BJX A;  1V98 A;  2EFH A;  2L6C A;  3KXO A;  2AHE A;  3GFK A;  1O8X A;  5ECP B;  1N25 A;  4J56 E;  2I81 A;  19GS A;  5ECH B;  3ZIV A;  1Z3E A;  2BMX A;  4ZXG A;  2X8H A;  2CVD A;  2N5A A;  3PR8 A;  5AIX A;  4WEY A;  3GSS A;  1BQ7 A;  3RPN A;  1TJD A;  1R5P A;  5LD0 A;  10GS A;  1O6J A;  1WJK A;  4JRR A;  4KND A;  2EIQ A;  2L4C A;  5ECL B;  2J23 A;  4EO3 A;  1GUM A;  2GLR A;  5IPH A;  2H30 A;  3OR5 A;  2DKI A;  3QR6 A;  2EIR A;  2GQL A;  3VWX A;  4YKF A;  1BF5 A;  1SEN A;  1G6W A;  3ZZX A;  1SU9 A;  3EUR A;  5DJL A;  1WIK A;  3C1S A;  3I6A A;  1QK8 A;  4NPB A;  3QDN A;  3CMI A;  3FZ4 A;  2WGR A;  2RM5 A;  1HNB A;  1GSE A;  4PUF C;  1EGR A;  5KN1 A;  2HZE B;  1TK5 B;  4CY8 A;  3KH9 A;  4HJ2 A;  5DAL A;  4AKX B;  2VM1 A;  3M0F A;  4WBJ A;  2HQT A;  4F2I A;  1GTI A;  4Q5N A;  5JCW A;  4TR4 A;  4TVE A;  2R4V A;  5A4V A;  4NHZ A;  5JCG A;  5BRT A;  3TKQ A;  5HR0 A;  2VIM A;  1SKS B;  3A2V A;  4MH3 A;  5G2Z A;  2YWM A;  3RHB A;  2M72 A;  1YKC A;  3Q18 A;  4IHU A;  4PX1 A;  2A2R A;  3NIV A;  1IYI A;  1M0U A;  5INY A;  4PUA A;  1USB A;  1BG5 A;  3HA9 A;  4NHW A;  5CP1 A;  2HZE A;  3GL5 A;  1MD3 A;  5F8B A;  3UAR A;  1F6M C;  1ZZY A;  5D93 A;  4MP4 A;  2DIZ A;  2KHP A;  1SL1 B;  17GS A;  3RPP A;  8GSS A;  2WZ9 A;  3VFI A;  2H70 A;  1FG4 A;  5ECM B;  4ZB8 A;  3AY8 A;  5ID2 A;  2H19 A;  3A2W A;  4MJA A;  4FQU A;  2FWF A;  4TRX A;  2H8L A;  3HMJ G;  1URM A;  2YZU A;  2C0F A;  3RDW A;  4JBB A;  3TOT A;  3O3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...