3CSJA

Human glutathione s-transferase p1-1 in complex with chlorambucil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title The anti-cancer drug chlorambucil as a substrate for the human polymorphic enzyme glutathione transferase P1-1: kinetic properties and crystallographic characterisation of allelic variants.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3csjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3csjA01
5ECQB 3UBKA 3FKFA 1GUKA 3I9V2 2HNLA 2GGTA 5CREA 2F9SA 1CQHA 4WF4A 3I69A 1S3AA 1V2AA 3L78A 2GSSA 4LLRA 2E2MA 2X99A 3KCMA 4DSSB 4EO3A 1BEDA 4KSOA 3TKSC 2AUVA 1ZGNA 2H6YA 3GX0A 1ERVA 4L0WA 2O89A 4LMWA 3FZAA 2JU5A 3R3EA 3ERGA 1GL8A 2B3SA 3M9JA 2QSIA 2H0IA 3QAWA 2DSAA 2L6DA 3L0HA 5JWQB 1Z7RA 2BMXA 3Q74A 1XWGA 13GSA 4Z7XA 1Z3EA 1M0UA 4BPYA 5DALB 4V1Ap 3BD2A 4KE3A 1BQ7A 2HRAA 5B6NA 2K8SA 2H76A 3IXRA 4BVYA 2DJKA 1EGOA 1TRUA 1TDIA 1MD4A 4X43A 2HFDA 1OC9A 3EE2A 1ERTA 4AJ6A 4K0NA 5DVBA 1GSEA 4QL9A 2B1KA 16GSA 1JZOA 4MJAA 3FZ9A 1KNGA 5DQSA 1Z5YE 5KEJA 1SL2B 1OKDA 1S3DA 2GZYA 5LD0A 3KTLA 4N11A 1HYUA 3IPZA 5CP1A 4K7IA 1K0NA 4HU9A 3D21A 1B9YC 2MMZA 2IIYA 3QD9A 3IAM2 2VIMA 2VCWA 5FHIA 2LUSA 3VPTA 4HQSA 1SJIA 19GSA 3LWAA 3HJOA 1DUGA 2GLRA 3F8UA 5ECLB 2EIQA 1K3OA 4MABA 2X8HA 5DBQA 1XVWA 4KAEA 3C1RA 1AUCA 3MNGA 1TRVA 1YY7A 2YJHA 2HZEA 2YJ7A 2H6ZA 1SYRA 4MJEA 2KP2A 3CRUA 4OO5A 4MA9A 3L9UA 1YKCA 2ALBA 1GTIA 3C8EA 5EL8A 4I6XA 3U5RE 2FWFA 1SD8A 3H93A 5B6MA 3S9FA 4NPBA 2PMTA 3N5OA 1CQGA 3WT1A 1T7PB 5IPGA 5ID2B 5ECMB 4YAVA 3CYNA 1U87A 3TRPA 2I3YA 1PGTA 3TUEA 4NMUA 2VOCA 3UVHA 1XZOA 1PN9A 4F2IA 1PKWA 1XCCA 3TOTA 5ECKB 4NHWA 4IHUA 1ZOFA 1VF1A 4EKZA 4TRXA 3QMXA 4POBA 2AAWA 1N8JA 1K0OA 3VURA 3KMNA 4HU7A 1GUMA 3AY8A 3CXGA 4DSSA 4MF5A 2HLSA 4J2FA 2ON5A 1O73A 3A5WA 2HSNB 4KSMA 1J9BA 2ES7A 2FY6A 1FG4A 4EE0A 3TKPA 4IELA 4MCUA 4H86A 5EPFA 3IAS2 1DBYA 2BTOT 2C4JA 2YN1A 5DALA 2PUKC 2GSTA 4PX1A 1LU4A 3HYPA 4YH2A 3Q6OA 1FB0A 3KH7A 1AAZA 4PQIA 3ZIJA 4N0ZA 4PUAA 2V41A 3HA9A 2GTUA 3LFLA 4KNDA 2AJQB 1GRXA 1ML6A 1EGRA 4PNFA 1ZYQB 4Q5RA 3PPUA 5DCGA 1XW5A 2VL2A 3GURA 4PUFC 3D0ZA 3F0IA 3M3MA 1WP0A 1XWAA 3IC4A 1X9WB 4OFTA 1TW9A 1ZYEA 1THOA 4EVMA 3GYKA 4K8MA 2R5GA 2PBJA 2J23A 5ECHB 3G9BA 3LEFA 3A2WA 2JSZA 5D73A 1IYIA 2H71A 4NAXA 3SWLA 4AGSA 4ECIA 3TCOA 1EV4A 3HJPA 3M0FA 2ZCTA 3UMAA 3LQ7A 2V6KA 2YPMA 3IOSA 3U6VA 2L4CA 2VL2C 1PKZA 2OJLA 2PU9C 3A3TA 1Q98A 1ACVA 1O8WA 1DE2A 4OD7A 4TR3A 4TR1B 3ZFLA 1V9WA 2DJ3A 3F6DA 3RHCA 1Y25A 3ED3A 3ZL5A 1YJ6A 1AQVA 2LJAA 5ID2A 3CMIA 4NV2A 4DSRA 2R37A 1YZXA 2VAFA 3ZLPA 1SK2A 1ILOA 4L8EA 3TKSE 4ECJA 3QR6A 2C0EA 4Q5FA 4OFNA 3QFBC 5AIVA 3ERWA 4TR4A 1N2AA 2BJXA 5CAXA 1SKSB 2LS5A 1B48A 1X5DA 2G0FA 3EU3A 2M80A 4E8EA 3IE3A 1GULA 1OE8A 2DMMA 1EEJA 4TR0A 1XWKA 3N9JA 4IJIA 2FNOA 1NM3A 1R5AA 2XBQA 1NW2A 3TJBA 2HSYA 5IMZA 1G6YA 3CSJA 3UEMA 3UARA 2NBSA 1EOGA 1F37A 4JBBA 2HRFA 3LXZA 5BMUA 3RPNA 1YF0A 2LQQA 4PGTA 2VL3A 1X5CA 4KH7A 4N30A 1SJ6A 2B6MA 4PQHA 2H73A 4ULXA 2WRTA 3CRTA 3GKXA 4GQFA 1XVQA 3RBTA 5G1LA 4LL1B 1M2AA 1UN2A 1K0CA 5IMVA 4EC0A 1EWXA 1Z7PA 1TJDA 1UC7A 1BX9A 2HQTA 4L5LA 1XIYA 3RPPA 3LG6A 5IO0A 1T1VA 4G19A 1XW6A 3E0UA 5ABRA 3MSZA 4KUNA 4X1UA 1PRXA 3LJRA 2VO4A 1A23A 5J3RA 2OE1A 3ZFBA 5CRGA 3Q19A 1J08A 1GWCA 1SENA 2X8CA 4G9HA 4GXZA 1TRSA 2I4AA 1RK4A 2CVDA 1HNCA 4WF5A 4LA1A 1LBKA 3ZVJA 3EVIA 3MWHA 4J57E 4I5QA 2AYTA 2L57A 2CZ3A 1AC1A 9GSSA 1ERWA 4IQAA 2R3XA 1K0DA 2CQ9A 3IBHA 1EOHA 6GSWA 7GSSA 1X5EA 1C72A 1T8EB 2NTOA 1JZRA 2HYXA 5ECIB 3C73A 3DIEA 4FYCA 4TR1A 3TKSA 3TDGA 1TU7A 4BA7A 3EWLA 4HUAA 1G7OA 4ECCA 2MZCA 3DMLA 2IPAA 2OKAA 2K18A 4G2EA 2PN8A 3Q18A 5IO2A 4GQCA 4XS6A 3VFIA 3KM6A 2XPEA 4TXVA 2QKEA 5HFGA 3FK8A 1K0AA 3FR6A 3US3A 2C0FA 4JR4A 1VF3A 2VCTA 1OC3A 3FHKA 5F07A 3VWWA 4MDCA 1SL0B 3P2AA 2DJ0A 4FQUA 2C3QA 1VGLA 2YZHA 1OE7A 3J7Yb 3DGQA 2O7KA 5JCWA 1JZWA 4J56E 1E6BA 2H66A 4PTSA 3D6IA 3HZ8A 1NHOA 4MH3A 3JCML 2KLXA 2H1GA 5CRHA 3IR4A 1JHBA 3VLNA 1SJZA 3APOA 4KCEA 5B8BA 2K6VA 3CTGA 4FH8A 1WPIA 3HVVA 2DBCA 5C00A 2GSQA 5E59A 2B5YA 2LSTA 2CX3A 3ERFA 1A0RP 2H74A 3DVWA 3KJYA 4PQ1A 2VL9A 4LL4B 2JSYA 4K9ZA 2WZ9A 2CVKA 1A2JA 3F63A 3HCZA 3ZZXA 2MYGA 1EV9A 4GWRA 1PX6A 3VWXA 1F6MC 2L4QA 2YWNA 2A4VA 3H4KA 2HXKA 2V2GA 2O87A 2YWMA 4V2LA 3F3QA 6GSYA 2H19A 2H6XA 1TI1A 5IOWA 1TU8A 4USSA 2B5EA 3C1SA 3DYRA 4MP4A 5HR2A 3NIVA 3UAPA 4RI6A 2HI7A 1A0FA 1GSYA 4V2MA 5ECSA 2GZPA 1DSBA 4L5OA 4ZBBA 2G2QA 2MBTA 2L5OA 4JZQA 1Z9HA 2IMIA 1GLQA 2CX4A 4POLA 4PURA 3F4RA 1GNEA 4IS0A 5INYA 5IPHA 5D93A 4OFMA 5EY6A 3A2VA 3GA4A 4EXJA 5J9BA 2R4VA 4G0KA 1XWCA 4KGIA 3GKNA 4OCEA 1G7EA 2B7JA 3F4SA 2RUEA 2VLUA 2EIRA 2HRNA 4JE1A 1GP1A 4X0XA 1GSQA 1WMJA 1B9XC 1T3BA 3RDWA 5H5SA 2H1BA 4JU5A 1USBA 1B4PA 4IW9A 4P3YB 1AQWA 3W6GA 5IMFA 2O8VB 3I43A 5KN1A 4YQMA 6GSUA 1G6WA 1THXA 4K1FA 1TI3A 5LCZA 4FYUA 2DJ1A 2DJJA 4HS1A 4F9ZA 3VPQA 4XHMA 1R4WA 2RM5A 1GSSA 5A4VA 5GAND 1Y6EA 5ELGA 2KP1A 2O85A 4HZ4A 1EEMA 4TOPA 4ISDA 1MTCA 2X8GA 2X64A 4FYBA 4WETA 3D4TA 1VF2A 3WD6A 1R5PA 2PPTA 2VUPA 5CRWA 4CW9A 3LORA 4KA0A 1OKTA 3BBYA 2HT9A 2AHEA 2TRCP 1OAZA 1TRWA 1XXUA 1FB6A 3IC8A 3CSHA 1QUWA 4K7NA 1PQNA 5IM9A 22GSA 2P0GA 3H8QA 1V98A 2RM6A 3KTBA 2H8LA 2DC5A 3KIJA 2RLIA 3EYTA 5IMCA 3G7YA 4HOJA 4MF6A 2IL3A 4HQZA 2EIOA 3DD3A 4IBPA 2FA8A 1SU9A 3KXOA 3FR9A 3D5JA 1O6JA 4ZXGA 3GRXA 3BCIA 4PXOA 2TRXA 3HXSA 5HR3A 2JADA 4MJCA 4XS1A 1B8XA 4I2TA 2GZZA 5G2ZA 1KBNA 3GL5A 2FWEA 4GRFA 3ZRDA 3UL3A 4BVXB 4BWQA 5E4WA 3L4NA 1I5GA 3TOUA 2PVOC 6GSSA 1U3AA 4CDOA 2HZFA 3EURA 2I1UA 4KDYA 4AF2A 2WCIA 3GKMA 5D9TA 3KP9A 3P90A 4Q5NA 3QCPA 1GLPA 3UVTA 1G0TA 4ECBA 1GSUA 2QGVA 4AJ7A 3OR5A 1R26A 1IYHA 3ME7A 4RQRA 4OO4A 5J9CA 2VCXA 5H5RA 4K7OA 2YWIA 3DVXA 2MMAA 4MMMA 2XHFA 4HJMA 1SYXA 4TW5A 2R2JA 2QC7A 1BG5A 2GT6A 3TJJA 3D4MA 1V58A 3D22A 2OACA 1T00A 1JLWA 4QQ7A 3HHVA 1TOFA 1Z6MA 5ENUA 2C1YA 3UJ1A 3FZ5A 4IKHA 1TXXA 4ZB8A 3ME8A 5G1KA 4QL7A 1VF4A 3GHAA 4F82A 3KP8A 3H79A 2OA7A 1F3AA 4K6XA 3DWVA 3FW2A 4K0GA 1K0MA 2GQMA 4FO5A 2IMDA 3APSA 1FO5A 1KEBA 2EC4A 2HSHA 2L5LA 4ZBDA 2CAQA 2Z9SA 4G0IA 3P7XA 3VWUA 1R7HA 2A2RA 2B5XA 1EP8A 4I97A 5HFKA 1K3LA 3TKQA 5F8BA 2OADA 5KN2A 2FWHA 3TGZA 1AIUA 4I8BA 2L59A 1SKRB 3DEXA 2AV4A 3GKKA 2DIZA 1RQMA 12GSA 2LV3A 4MZWA 4NHZA 4ACSA 1ON4A 2NDOA 3CTFA 1U6TA 1WOUA 3KGKA 3GH6A 2CA8A 1EZKA 5B7CA 5FT3A 1XPVA 2N5FA 2OBIA 4CHSA 1YDKA 2VCVA 2FGXA 1HNAA 3BOAA 1MD3A 4HZ2A 2WGRA 2P31A 1O7UA 3GTUB 2NVLA 1F3BA 3KH9A 1K3YA 2I81A 5AISA 1X0RA 3APQA 2FD3A 3FYGA 1YEPA 1XW9A 3FR3A 2V32A 1PL1A 5ELAA 1UA5A 1TK5B 3C71A 3O76A 1O85A 2VLTA 4GSNA 3QDNA 4KF9A 5DJMA 4GF0A 5EVOA 5A4UA 5CNWA 5G31A 4BWSA 4IVFA 2H70A 2JZSA 4BVXA 2K8VA 4WKWA 11GSA 3M8NA 2JZRA 2A2SA 2KOKA 3GSTA 5IIZA 4WR4A 2H01A 2YZUA 5JCUA 4K2DA 3IV4A 3EC3A 5HR0A 4XIHA 1BYEA 4E8HA 3TRXA 4KW6A 3IDVA 18GSA 2VLVA 4IN0A 3CBUA 3EU4A 2DMLA 2CV4A 5ECNB 2K9FA 2MBSA 1PD21 5DJLA 1QMVA 5DQYA 1T4YA 2CVBA 3SBCA 5DAKB 1XBSA 2GVPA 5HFIA 4ZBAA 2XPDA 4MLYA 4MH2A 4POMA 3L9SA 2WDUA 3F3RA 5F0GA 3IA1A 4ILFA 4DSQA 2B1LA 2KUCA 5IMAA 1YKAA 5IOXA 3LGCA 3RHBA 2C3TA 5GAPD 4N0VA 2H75A 4EF0A 1PX7A 3GL3A 2MMOA 5J41A 4ML1A 3F6FA 1ST9A 1M2BA 2PGTA 3GIXA 2YV7A 4HEA2 2IWTA 4F0CA 1Z6NA 5DDLA 1YF1A 4MJBA 3F9UA 5HR1A 1O81A 3RAZA 2F8AA 2WS2A 5ECPB 1JFUA 1URMA 2LQOA 1QXHA 3QOUA 1ZL9A 4MK3A 10GSA 4ZL9A 1U88A 4RUVA 1X9MB 1GSFA 2CZ2A 2PERA 3J7Yk 2LNTA 5GSTA 2N5AA 3BCKA 1B4QA 2N5BA 3ZTLA 3CSIA 2H0HA 3VK9A 4V1Ag 5G5FA 4O5RA 2HSMB 4G10A 3WGXA 3LSZA 2C80A 1A24A 4MZCA 3LYPA 2R6KA 4DEJA 1A8YA 3EMPA 2VD1A 4EDYA 17GSA 1GSDA 1SD9A 2LRCA 3H1NA 1BAYA 4I2UA 5J5NA 2F51A 3GTUA 3ZMLA 5IQYA 1SL1B 4TXOB 4ID0A 4HI7A 3WT2A 5D9WA 2VM1A 1TTZA 5CYYA 1M2DA 2IMFA 2L6CA 4XRAA 2P5QA 3IRAA 1HQOA 4JR6A 4XCSA 2KHPA 2LRTA 1M99A 2ZNMA 1QK8A 5D9VA 2GQKA 1OYJA 5F06A 2VCQA 2E7PA 6GSVA 4RI7A 5FWGA 2HRKB 2YP6A 3EINA 5A4WA 4EUYA 4WR5A 4O7HA 2JACA 3K8NA 1AXDA 4IGJA 2IFQB 5D96A 4OWYA 5ECRB 1K0BA 2WB9A 4JEDA 3E9JB 3WGDA 2XC2A 2I9HA 1WWJA 5AGYA 3W8SA 5LNKe 3MDKA 1I9DA 3GX8A 4GTUA 4L0UA 5CO3A 5GZZB 4ZL7A 2F8FA 3KZQA 2XBIA 5D8IA 3VI7A 1XOBA 1PSQA 3TJFA 2JL4A 5A5KA 5DAKA 1QQ2A 2YV9A 3HY2A 4MPGA 1W89A 2DLXA 2YNXA 1A2MA 3M9KA 3WYWA 4YQUA 2B7KA 4XS4B 4D73B 4BL7B 3ZVJD 2NPBA 1PL2A 2TIRA 3M1GA 1XOAA 2WULA 4LMVA 5COHA 4MPFA 2PVQA 5G5EA 1UVZA 1H4OA 2AB6A 4TVEA 3HJMA 3TRQA 2JZTA 1XFLA 3HDCA 2LTKA 3MAKA 1T4ZA 4Q5QA 3E3EA 4POKA 4WEYA 2IMEA 1FVKA 1XWBA 2E2GA 3W8JA 2OE0A 3R2QA 2GS3A 1F9MA 1TK0B 2FLSA 2RUFA 4YQVA 1O8XA 2IMKA 2REMA 4PNGA 4XRDA 1E2YA 4O92A 3V1WA 1Q4JA 1QFNA 2HSMA 2WJUA 3IHQA 3GFKA 3TJKA 3KEBA 3UOMA 3KMOA 1M7TA 1WRYA 3QAGA 1FAAA 2GSRA 1RW1A 3PGTA 4TXOA 5J4UA 3O3TA 4GSTA 3ZMKA 4WBJA 4WXTA 5JCGA 5D9XA 5F05A 4IP1A 4HJ2A 4GCIA 1HD2A 2H1DA 1LJRA 3ZITA 1QGVA 2IN3A 3FZ4A 2FHEA 4OMVA 4NWYA 5JWOB 4MF7A 1H75A 2E0QA 2H30A 2C3NA 2H0GA 2V1MA 2V6OA 2HRKA 2GT5A 3FRCA 2MMNA 4TKYA 2VD0A 2LJRA 2FWGA 2C0DA 5DCHA 3WGEA 2IFQA 4N10A 2DIYA 1W4VA 2FUG2 2YWOA 1S3CA 4G0LA 3F4TA 3PR8A 3I6AA 2P5RA 3IK9A 1SKWB 2GQLA 3HZ4A 3GUSA 4JRRA 3A2XA 2ON7A 1KTEA 1JZDA 1TK8B 4AJ8A 3ISOA 1ZMAA 1DE1A 4KCAA 3LXTA 4V2NA 1AQXA 2FA4A 3NOFA 2YCDA 2OE3A 2LEGA 1ZZYA 2F3MA 2J9HA 4XS4A 4D73A 3GH9A 5G30A 4IJ3A 2M46A 3GN3A 4NXIA 1MDJA 4BL7A 1GNWA 1V57A 1PA3A 4ML6A 5H5QA 2ZUPA 2C8UA 3EMXA 1NHYA 3HVXA 3NZNA 4TN8A 1WIKA 3DRNA 2H1AA 1JLVA 5ECOB 5AIXA 2YOIA 4OCFA 3G7JA 5JWRB 4FIWA 1J0FA 4F0BA 2WFCA 3PINA 5IMDA 4YAPA 8GSSA 4F03A 4IQ1A 3BJ5A 2CAIA 5AN1A 1MDKA 1AW9A 3FY7A 4RQXA 3TB2A 1WE0A 4O32A 1TP9A 3KD0A 3G7IA 2OBKA 3QPMA 1ABAA 5HQPA 3O6TA 4ZIJA 1OVNA 4ZL8A 3PH9A 3QFAC 1ZCPA 4EL1A 2PWJA 1MEKA 3DXBA 1M9AA 1YQ1A 1FVJA 3LYKA 5KN3A 3HKRA 3GSSA 1FOVA 1A2LA 5KN0A 2YANA 1GUHA 4NV5A 3C7MA 2LRNA 4KDUA 1FW1A 1NSWA 4BVYB 6GSXA 3QAVA 2RIIA 4ZILA 1V40A 3IK7A 2VM2A 1X9SB 2UZ8A 1OC9B 2LJKA 3VI5A 2M72A 2CT6A 3GNJA 4ZB9A 4MZBA 1FHEA 3GV1A 2D2ZA 4EDZA 1U3IA 3DKSA 1F2EA 20GSA 4DVCA 3VWVA 4KB3A 1EP7A 1SK0A 2LNSA 3UIWA 1GTUA 3ZYWA 3GMFA 5CRDA 3ZREA 4HDEA 3UBLA 1PMTA 5GSSA 1A8LA 1GTBA 4WBRD 2LKUA 2FCHA 1HNBA 2H72A 4ZB6A 1GTAA 6GSTA 3P8WA 2HE3A 1GH2A 5B8AA 3TJGA 2C0GA 1M9BA 3FEUA 2HZEB 1BJXA 2GDRA 1MDIA 1ERUA 4GSSA 3ZIVA 1YEXA 1TKDB 2IJYA 1OC8A 2DJ2A 3HVSA 4IP6A 5L71A 14GSA 1WJKA 1SK1A 4GLTA 4KDXA 4KX4A 3HD5A 3TKRA 5C04A 1VRSD 2VCZA 4XTSA 3L9VA
chains in the Genus database with same CATH superfamily
5ECQB 3UBKA 3FKFA 1GUKA 3I9V2 2WVXA 2HNLA 2GGTA 5CREA 2F9SA 1CQHA 4WF4A 3I69A 1S3AA 1V2AA 3L78A 2GSSA 1TXUA 4LLRA 2E2MA 2X99A 3KCMA 4DSSB 4EO3A 2WW3A 1BEDA 4KSOA 4O5QA 3TKSC 2AUVA 1ZGNA 2H6YA 3GX0A 1ERVA 4L0WA 2O89A 4LMWA 3FZAA 2JU5A 3R3EA 3ERGA 1GL8A 2B3SA 3M9JA 2QSIA 2H0IA 3QAWA 2DSAA 2L6DA 3L0HA 5JWQB 1Z7RA 2BMXA 3Q74A 1XWGA 13GSA 4Z7XA 1Z3EA 1M0UA 4BPYA 5DALB 4V1Ap 3BD2A 4KE3A 1PN0A 1BQ7A 2HRAA 3IHGA 5B6NA 2K8SA 2H76A 3IXRA 4BVYA 2DJKA 1EGOA 1TRUA 1TDIA 1MD4A 4X43A 2HFDA 1OC9A 3EE2A 1ERTA 4AJ6A 4K0NA 5DVBA 1GSEA 4QL9A 2B1KA 16GSA 1JZOA 4MJAA 3CQFA 3FZ9A 1KNGA 5DQSA 1Z5YE 5KEJA 1SL2B 1OKDA 1S3DA 2GZYA 5LD0A 3KTLA 4N11A 1HYUA 3IPZA 5CP1A 4K7IA 1K0NA 3D21A 4HU9A 1B9YC 2MMZA 2IIYA 3QD9A 3IAM2 2VIMA 2VCWA 5FHIA 2EFCA 2LUSA 3VPTA 4HQSA 1SJIA 19GSA 3LWAA 3HJOA 1DUGA 2GLRA 3F8UA 5ECLB 4AI6A 2EIQA 1K3OA 4MABA 4GDFA 2X8HA 5DBQA 1XVWA 4KAEA 3C1RA 1AUCA 3MNGA 1TRVA 1YY7A 2YJHA 2HZEA 2YJ7A 2H6ZA 1SYRA 4MJEA 2KP2A 3CRUA 4OO5A 4MA9A 3L9UA 1YKCA 2ALBA 1GTIA 3C8EA 5EL8A 4I6XA 3U5RE 2FWFA 1SD8A 3H93A 5B6MA 3S9FA 4NPBA 2PMTA 3N5OA 1CQGA 3WT1A 1T7PB 5IPGA 5ID2B 5ECMB 4YAVA 3CYNA 1U87A 3TRPA 2I3YA 1PGTA 3TUEA 4NMUA 2VOCA 3UVHA 1XZOA 1PN9A 4F2IA 1PKWA 1XCCA 3TOTA 5ECKB 4NHWA 4IHUA 1ZOFA 4O5UA 1VF1A 2WZSA 4EKZA 4TRXA 3MIXA 3QMXA 4POBA 2AAWA 1N8JA 1K0OA 5A5HA 3KMNA 3VURA 2WW0A 4HU7A 1GUMA 3AY8A 1S4BP 3CXGA 4DSSA 4MF5A 2HLSA 4J2FA 2ON5A 1O73A 3A5WA 2HSNB 4KSMA 1J9BA 2ES7A 2FY6A 2A4HA 1FG4A 4EE0A 3TKPA 4IELA 5BMUB 4MCUA 4H86A 5EPFA 3IAS2 1DBYA 2BTOT 2C4JA 2YN1A 5DALA 2PUKC 2GSTA 4FXYP 4PX1A 1LU4A 3HYPA 4YH2A 3Q6OA 1FB0A 3KH7A 1AAZA 4PQIA 3ZIJA 4N0ZA 4PUAA 2V41A 3HA9A 2GTUA 3LFLA 4PI0C 4KNDA 4EIQA 2AJQB 1GRXA 1ML6A 1EGRA 4PNFA 1ZYQB 4Q5RA 3PPUA 5DCGA 1XW5A 2VL2A 3GURA 4PUFC 3D0ZA 3F0IA 3M3MA 1WP0A 1XWAA 3IC4A 4X4JA 1X9WB 4OFTA 1TW9A 1ZYEA 1THOA 4EVMA 3GYKA 4K8MA 2R5GA 2PBJA 2J23A 5ECHB 3G9BA 3LEFA 3A2WA 2JSZA 5D73A 1IYIA 2H71A 4NAXA 3SWLA 4AGSA 4ECIA 3CWGA 3TCOA 1EV4A 3HJPA 3M0FA 2ZCTA 3UMAA 3LQ7A 2V6KA 2YPMA 3IOSA 3U6VA 2L4CA 2VL2C 1PKZA 2OJLA 2PU9C 3A3TA 1Q98A 1ACVA 1O8WA 4Z2RA 1DE2A 4OD7A 4TR3A 4TR1B 3ZFLA 1V9WA 2DJ3A 3F6DA 3RHCA 3RGBC 1Y25A 3ED3A 3ZL5A 1YJ6A 1AQVA 2LJAA 5ID2A 3CMIA 4NV2A 4DSRA 2R37A 1YZXA 2VAFA 3ZLPA 1SK2A 1ILOA 4L8EA 3TKSE 4ECJA 3QR6A 2C0EA 4Q5FA 4OFNA 3QFBC 5AIVA 3ERWA 4TR4A 2BJXA 1N2AA 5CAXA 1SKSB 2LS5A 1B48A 1X5DA 2G0FA 3EU3A 2M80A 4E8EA 3IE3A 1GULA 1OE8A 2DMMA 1EEJA 4TR0A 1XWKA 3N9JA 4IJIA 2FNOA 1NM3A 1R5AA 2XBQA 2HSNA 1NW2A 3TJBA 2HSYA 5IMZA 1G6YA 3CSJA 3UEMA 3UARA 2NBSA 1EOGA 1F37A 4JBBA 2HRFA 3LXZA 5BMUA 3RPNA 1YF0A 2LQQA 4PGTA 2VL3A 1X5CA 4KH7A 4N30A 2A2PA 1SJ6A 2B6MA 4PQHA 2H73A 1YEWC 4ULXA 2WRTA 3CRTA 3GKXA 4GQFA 1XVQA 3RBTA 5G1LA 4LL1B 1M2AA 3HMJG 1BG1A 1UN2A 1K0CA 5IMVA 4EC0A 1EWXA 1Z7PA 1TJDA 1UC7A 1BX9A 2HQTA 1YVLA 4L5LA 1XIYA 3RPPA 3LG6A 5IO0A 1ZYNA 1T1VA 4G19A 1XW6A 3E0UA 5ABRA 3MSZA 4KUNA 4X1UA 1PRXA 3LJRA 2VO4A 1A23A 5J3RA 2OE1A 3ZFBA 5CRGA 3Q19A 1J08A 1GWCA 1SENA 2X8CA 4G9HA 4GXZA 1TRSA 2I4AA 1RK4A 2CVDA 1HNCA 4WF5A 1M3JA 4LA1A 1LBKA 5BRTA 3ZVJA 3EVIA 3MWHA 4J57E 4I5QA 2AYTA 2L57A 2CZ3A 1AC1A 9GSSA 1ERWA 4IQAA 2R3XA 1K0DA 2CQ9A 3IBHA 1EOHA 6GSWA 7GSSA 1X5EA 1C72A 1T8EB 2NTOA 1JZRA 2HYXA 5ECIB 3C73A 3DIEA 4FYCA 4TR1A 3TKSA 3TDGA 1TU7A 4BA7A 3EWLA 4HUAA 1G7OA 4ECCA 2MZCA 3DMLA 2IPAA 2OKAA 2K18A 4G2EA 2PN8A 1PFOA 3Q18A 5IO2A 4GQCA 4XS6A 3VFIA 3TU3B 3KM6A 2XPEA 4TXVA 2QKEA 5HFGA 3FK8A 1K0AA 3FR6A 3US3A 2C0FA 4AKIA 4JR4A 1VF3A 2VCTA 1OC3A 3FHKA 5F07A 3VWWA 4MDCA 1SL0B 3LW9A 3P2AA 1ZYPA 2DJ0A 4FQUA 2C3QA 1VGLA 2YZHA 1OE7A 3J7Yb 3DGQA 2O7KA 2WVYA 5JCWA 1JZWA 4J56E 1E6BA 2H66A 5A1NB 4PTSA 3D6IA 3HZ8A 1NHOA 4MH3A 3JCML 2KLXA 2H1GA 5CRHA 4CY6A 3IR4A 1JHBA 3VLNA 1SJZA 3APOA 4KCEA 5B8BA 2K6VA 3CTGA 4FH8A 1WPIA 3HVVA 2DBCA 5C00A 2GSQA 5E59A 2B5YA 2LSTA 2CX3A 3ERFA 1A0RP 2H74A 3DVWA 3KJYA 4AKHA 4K5SA 4PQ1A 2VL9A 4LL4B 2JSYA 4K9ZA 2WZ9A 2CVKA 1A2JA 3F63A 3HCZA 3ZZXA 2MYGA 1EV9A 4GWRA 1PX6A 3VWXA 1F6MC 2L4QA 2YWNA 2A4VA 3H4KA 2HXKA 2V2GA 2O87A 2YWMA 4V2LA 3F3QA 6GSYA 2H19A 3CHXC 2H6XA 1TI1A 5IOWA 1TU8A 4USSA 2B5EA 3C1SA 3DYRA 4MP4A 4PI2C 5HR2A 3NIVA 3UAPA 4RI6A 2HI7A 1A0FA 1GSYA 5J47A 4V2MA 5ECSA 2GZPA 1DSBA 4L5OA 4ZBBA 2G2QA 2MBTA 2L5OA 4JZQA 1Z9HA 2IMIA 1N25A 1GLQA 2CX4A 4POLA 4PURA 3F4RA 1GNEA 4IS0A 5INYA 5IPHA 5D93A 4OFMA 5EY6A 3MYDA 3A2VA 3A5IA 3GA4A 4EXJA 5J9BA 2R4VA 4G0KA 1XWCA 4KGIA 3GKNA 4OCEA 1G7EA 2B7JA 3F4SA 2RUEA 2VLUA 1FOHA 2EIRA 2HRNA 4JE1A 1GP1A 4X0XA 1GSQA 1WMJA 1B9XC 1T3BA 3RDWA 5H5SA 2H1BA 4JU5A 1USBA 1B4PA 4E68A 4IW9A 4P3YB 2WVZA 2DKIA 1AQWA 3W6GA 5IMFA 2O8VB 3I43A 5KN1A 4YQMA 6GSUA 1G6WA 1THXA 4K1FA 1TI3A 5LCZA 4Z2UA 4FYUA 2DJ1A 2DJJA 4HS1A 4F9ZA 3VPQA 4XHMA 1R4WA 2RM5A 1GSSA 5A4VA 5GAND 1Y6EA 5ELGA 2KP1A 2O85A 4HZ4A 1EEMA 4AKXB 4TOPA 4CY8A 4ISDA 1MTCA 2X8GA 2X64A 4FYBA 4WETA 3D4TA 1VF2A 3WD6A 1R5PA 2PPTA 2VUPA 5CRWA 4CW9A 3LORA 4KA0A 1OKTA 3BBYA 2HT9A 2AHEA 1SVOA 2TRCP 1OAZA 1TRWA 1XXUA 1FB6A 3IC8A 3CSHA 1QUWA 4K7NA 1PQNA 5IM9A 22GSA 2P0GA 3H8QA 1V98A 2RM6A 3KTBA 2H8LA 2DC5A 3KIJA 4HSCX 2RLIA 3EYTA 5IMCA 3G7YA 4HOJA 4MF6A 2IL3A 4HQZA 2EIOA 3DD3A 4IBPA 2FA8A 1SU9A 3KXOA 3FR9A 3D5JA 1O6JA 4ZXGA 3GRXA 3BCIA 4PXOA 2TRXA 3HXSA 5HR3A 2JADA 4MJCA 4XS1A 1B8XA 4I2TA 2GZZA 5G2ZA 1KBNA 3GL5A 2FWEA 4QMKA 4GRFA 3ZRDA 3UL3A 4BVXB 4BWQA 5E4WA 3L4NA 1I5GA 3TOUA 2PVOC 6GSSA 1U3AA 3HVNA 4CDOA 2HZFA 3EURA 2I1UA 4KDYA 4AF2A 2WCIA 3GKMA 5D9TA 3KP9A 3P90A 4Q5NA 3QCPA 1GLPA 3UVTA 1G0TA 4PHZC 4ECBA 1GSUA 2QGVA 4AJ7A 3OR5A 1R26A 1IYHA 3ME7A 4RQRA 4OO4A 5J9CA 2VCXA 5H5RA 4K7OA 2YWIA 3DVXA 2MMAA 4MMMA 2XHFA 4HJMA 1SYXA 4TW5A 2R2JA 2QC7A 1BG5A 2GT6A 3TJJA 3D4MA 1V58A 3D22A 2OACA 1T00A 2UV8G 1SVMA 1JLWA 4QQ7A 2EFDA 3HHVA 1TOFA 1Z6MA 5ENUA 2C1YA 3UJ1A 3FZ5A 4IKHA 2R0CA 1TXXA 4ZB8A 3ME8A 5G1KA 4QL7A 1VF4A 3GHAA 4F82A 3KP8A 3H79A 2OA7A 1F3AA 4K6XA 3DWVA 2O5VA 3FW2A 4K0GA 1K0MA 2GQMA 4FO5A 2IMDA 3APSA 1I1IP 1FO5A 1KEBA 2EC4A 2HSHA 2L5LA 4ZBDA 2CAQA 2Z9SA 4G0IA 3P7XA 3VWUA 2X49A 2X4AA 1R7HA 2A2RA 2B5XA 1EP8A 4I97A 5HFKA 1K3LA 3TKQA 5F8BA 2OADA 5KN2A 2FWHA 3TGZA 1AIUA 4I8BA 2L59A 1SKRB 3DEXA 2AV4A 3GKKA 2DIZA 1RQMA 12GSA 2LV3A 4MZWA 4NHZA 4ACSA 1ON4A 2NDOA 3CTFA 1U6TA 1WOUA 3KGKA 3GH6A 2CA8A 1EZKA 5B7CA 5FT3A 1XPVA 2N5FA 2OBIA 4CHSA 1YDKA 2VCVA 2FGXA 1HNAA 3BOAA 1MD3A 4HZ2A 2WGRA 2P31A 1O7UA 3GTUB 2NVLA 1F3BA 2R0PA 3KH9A 1K3YA 2I81A 4N3ZA 5AISA 1X0RA 3APQA 2FD3A 3FYGA 1YEPA 2R0GA 1XW9A 3FR3A 2V32A 1PL1A 5ELAA 1UA5A 1TK5B 3C71A 4K5RA 1SVLA 3O76A 1O85A 2VLTA 4GSNA 3QDNA 4KF9A 5DJMA 4GF0A 5EVOA 5A4UA 5CNWA 5G31A 4BWSA 4IVFA 2H70A 2JZSA 4BVXA 2K8VA 4WKWA 11GSA 3M8NA 2JZRA 2A2SA 2KOKA 3GSTA 5IIZA 4WR4A 2H01A 2YZUA 5JCUA 4K2DA 3IV4A 3EC3A 5HR0A 4XIHA 1BYEA 4W66A 4E8HA 3TRXA 4KW6A 3IDVA 18GSA 2VLVA 4IN0A 3CBUA 3EU4A 2DMLA 2CV4A 5ECNB 3FMWA 2K9FA 2MBSA 1PD21 5DJLA 1QMVA 5DQYA 1T4YA 2CVBA 3SBCA 5DAKB 1XBSA 2GVPA 5HFIA 4ZBAA 2XPDA 5KOWA 4MLYA 4MH2A 4POMA 3L9SA 2WDUA 3F3RA 5F0GA 3IA1A 4ILFA 4DSQA 2B1LA 2KUCA 5IMAA 1YKAA 5IOXA 3LGCA 3RHBA 2C3TA 5GAPD 4N0VA 2H75A 4EF0A 1PX7A 3GL3A 2MMOA 5J41A 4ML1A 3F6FA 5J40A 1ST9A 1M2BA 1Y1UA 2PGTA 3GIXA 2YV7A 4HEA2 2IWTA 2VKZG 4F0CA 1Z6NA 5DDLA 1YF1A 4MJBA 3F9UA 5HR1A 5A5HB 1O81A 3RAZA 2F8AA 2WS2A 5ECPB 1JFUA 1URMA 2LQOA 1QXHA 3QOUA 1ZL9A 4MK3A 10GSA 4ZL9A 4AKGA 1U88A 4RUVA 1X9MB 1GSFA 2CZ2A 2PERA 3J7Yk 4ICYA 2LNTA 5GSTA 2N5AA 3BCKA 1B4QA 2N5BA 3ZTLA 3CSIA 2H0HA 3VK9A 4V1Ag 5G5FA 4O5RA 2HSMB 4G10A 3WGXA 3LSZA 2C80A 1A24A 4MZCA 3LYPA 2R6KA 4DEJA 1A8YA 3EMPA 2VD1A 4EDYA 17GSA 1GSDA 1SD9A 2LRCA 3H1NA 1BAYA 4I2UA 5J5NA 2F51A 3GTUA 3ZMLA 5IQYA 1SL1B 4TXOB 4ID0A 4HI7A 3WT2A 5D9WA 1M3IA 2VM1A 1TTZA 5CYYA 1M2DA 2IMFA 2L6CA 4XRAA 4ZB7A 2P5QA 3IRAA 1HQOA 4JR6A 5KOXA 4XCSA 2WW1A 2KHPA 2LRTA 2GQKA 2ZNMA 1M99A 5D9VA 1QK8A 1OYJA 5F06A 2VCQA 2E7PA 6GSVA 4RI7A 5FWGA 2HRKB 2YP6A 3EINA 5A4WA 4EUYA 4WR5A 4A5PA 4O7HA 2JACA 3K8NA 1AXDA 4IGJA 2IFQB 5D96A 4OWYA 5ECRB 1K0BA 2WB9A 4JEDA 3E9JB 3WGDA 2XC2A 2I9HA 1WWJA 5AGYA 3W8SA 5LNKe 3MDKA 1I9DA 3GX8A 4GTUA 4L0UA 5CO3A 5GZZB 4ZL7A 2F8FA 3KZQA 4Z2TA 2XBIA 5D8IA 3VI7A 1XOBA 1PSQA 3TJFA 2JL4A 5A5KA 5DAKA 1QQ2A 2YV9A 3HY2A 4MPGA 2QA1A 1W89A 2DLXA 2YNXA 1A2MA 3M9KA 3WYWA 4YQUA 2B7KA 4XS4B 4D73B 4BL7B 3ZVJD 2NPBA 1PL2A 2TIRA 3M1GA 1XOAA 2WULA 4LMVA 5COHA 4MPFA 2PVQA 5G5EA 1UVZA 1H4OA 2AB6A 4TVEA 5A1NA 4EIPA 3HJMA 3TRQA 2JZTA 1XFLA 3HDCA 2LTKA 3MAKA 1T4ZA 4Q5QA 3E3EA 4POKA 4WEYA 2IMEA 1FVKA 1XWBA 2E2GA 3W8JA 2OE0A 3R2QA 2GS3A 1F9MA 1TK0B 2FLSA 2RUFA 4YQVA 1O8XA 2IMKA 2REMA 4PNGA 4XRDA 1E2YA 4O92A 3V1WA 1Q4JA 4BIKA 1QFNA 2HSMA 2WJUA 3IHQA 3GFKA 3TJKA 3KEBA 3UOMA 5J4VA 3KMOA 1M7TA 1WRYA 3QAGA 1FAAA 2GSRA 1RW1A 3PGTA 4TXOA 5J4UA 3O3TA 4GSTA 3ZMKA 4WBJA 4WXTA 5JCGA 5D9XA 2O36A 5F05A 4IP1A 4HJ2A 4GCIA 1HD2A 2H1DA 1LJRA 3ZITA 1QGVA 2IN3A 3FZ4A 2FHEA 4OMVA 4NWYA 5JWOB 4MF7A 1H75A 2E0QA 2H30A 2C3NA 2H0GA 2V1MA 2V6OA 2HRKA 2GT5A 3FRCA 2MMNA 4TKYA 4G01A 2VD0A 2LJRA 2FWGA 2C0DA 5DCHA 2QA2A 3WGEA 2IFQA 4N10A 2DIYA 1W4VA 2FUG2 4YKFA 2YWOA 1S3CA 4G0LA 3F4TA 3PR8A 3I6AA 2P5RA 3IK9A 1SKWB 2GQLA 3HZ4A 3GUSA 4JRRA 3A2XA 2ON7A 1KTEA 1JZDA 2H1LA 1TK8B 5A34B 4AJ8A 3ISOA 1ZMAA 1DE1A 4KCAA 3LXTA 4V2NA 1AQXA 2FA4A 3NOFA 2EFHA 2YCDA 2OE3A 2LEGA 1ZZYA 2F3MA 2J9HA 4XS4A 4D73A 3GH9A 5G30A 4IJ3A 4MNNA 2M46A 3GN3A 4NXIA 1MDJA 4BL7A 1GNWA 1V57A 1PA3A 4ML6A 5H5QA 2ZUPA 2C8UA 3EMXA 1NHYA 3HVXA 3NZNA 4TN8A 1WIKA 3DRNA 2H1AA 1JLVA 1XG8A 5ECOB 5AIXA 2YOIA 2WVXB 4OCFA 3G7JA 5JWRB 4FIWA 1J0FA 4F0BA 2WFCA 3PINA 5IMDA 4YAPA 8GSSA 4F03A 4IQ1A 3BJ5A 2CAIA 5AN1A 1MDKA 1AW9A 3FY7A 4RQXA 3TB2A 1WE0A 4O32A 1TP9A 3KD0A 3G7IA 2OBKA 3QPMA 1ABAA 5HQPA 3O6TA 4ZIJA 1OVNA 4ZL8A 3PH9A 3QFAC 1ZCPA 4EL1A 2PWJA 1MEKA 3DXBA 1M9AA 1YQ1A 1FVJA 3LYKA 5KN3A 2EFEA 3HKRA 3RFRC 3GSSA 1BF5A 1FOVA 1A2LA 1S3RA 5KN0A 2YANA 1GUHA 4NV5A 3C7MA 2LRNA 4KDUA 1FW1A 1NSWA 4BVYB 6GSXA 3QAVA 2RIIA 4ZILA 4YKGA 1V40A 3IK7A 2VM2A 1X9SB 2UZ8A 1OC9B 2LJKA 3VI5A 2M72A 2CT6A 3GNJA 4ZB9A 4MZBA 1FHEA 3GV1A 2D2ZA 4EDZA 1U3IA 3DKSA 1F2EA 2O3EA 20GSA 4DVCA 3VWVA 4KB3A 1EP7A 1SK0A 2LNSA 3UIWA 1GTUA 3ZYWA 3GMFA 5CRDA 3ZREA 4HDEA 3UBLA 1PMTA 5GSSA 1A8LA 1GTBA 4WBRD 2LKUA 2FCHA 1HNBA 2H72A 4ZB6A 1GTAA 6GSTA 2WW2A 3P8WA 2HE3A 1GH2A 5B8AA 3TJGA 2OT3A 2C0GA 1M9BA 3FEUA 2HZEB 1BJXA 5J4YA 2GDRA 1MDIA 1ERUA 5A34A 3EPTA 4GSSA 3ZIVA 1YEXA 1TKDB 2IJYA 1OC8A 2DJ2A 3HVSA 4IP6A 5L71A 4K2XA 14GSA 1WJKA 1SK1A 4GLTA 4KDXA 4KX4A 3HD5A 2DKHA 3TKRA 5C04A 1VRSD 2VCZA 4XTSA 3L9VA
chains in the Genus database with same CATH topology
5ECQB 3UBKA 3FKFA 1GUKA 3I9V2 2HNLA 2GGTA 5CREA 2F9SA 1CQHA 4WF4A 3I69A 1S3AA 1V2AA 3L78A 2GSSA 1TXUA 4LLRA 2E2MA 2X99A 3KCMA 4DSSB 4EO3A 1BEDA 4KSOA 4O5QA 3TKSC 2AUVA 1ZGNA 2H6YA 3GX0A 1ERVA 4L0WA 2O89A 4LMWA 3FZAA 2JU5A 3R3EA 3ERGA 1GL8A 2B3SA 3M9JA 2QSIA 2H0IA 3QAWA 2DSAA 2L6DA 3L0HA 5JWQB 1Z7RA 2BMXA 3Q74A 1XWGA 13GSA 4Z7XA 1Z3EA 1M0UA 4BPYA 5DALB 4V1Ap 3BD2A 4KE3A 1PN0A 1BQ7A 2HRAA 3IHGA 5B6NA 2K8SA 2H76A 3IXRA 4BVYA 2DJKA 1EGOA 1TRUA 1TDIA 1MD4A 4X43A 2HFDA 1OC9A 3EE2A 1ERTA 4AJ6A 4K0NA 5DVBA 1GSEA 4QL9A 2B1KA 16GSA 1JZOA 4MJAA 3FZ9A 1KNGA 5DQSA 1Z5YE 5KEJA 1SL2B 1OKDA 1S3DA 2GZYA 5LD0A 3KTLA 4N11A 1HYUA 3IPZA 5CP1A 4K7IA 1K0NA 3D21A 4HU9A 1B9YC 2MMZA 2IIYA 3QD9A 3IAM2 2VIMA 2VCWA 5FHIA 2EFCA 2LUSA 3VPTA 4HQSA 1SJIA 19GSA 3LWAA 3HJOA 1DUGA 2GLRA 3F8UA 5ECLB 4AI6A 2EIQA 1K3OA 4MABA 4GDFA 2X8HA 5DBQA 1XVWA 4KAEA 3C1RA 1AUCA 3MNGA 1TRVA 1YY7A 2YJHA 2HZEA 2YJ7A 2H6ZA 1SYRA 4MJEA 2KP2A 3CRUA 4OO5A 4MA9A 3L9UA 1YKCA 2ALBA 1GTIA 3C8EA 5EL8A 4I6XA 3U5RE 2FWFA 1SD8A 3H93A 5B6MA 3S9FA 4NPBA 2PMTA 3N5OA 1CQGA 3WT1A 1T7PB 5IPGA 5ID2B 5ECMB 4YAVA 3CYNA 1U87A 3TRPA 2I3YA 1PGTA 3TUEA 4NMUA 2VOCA 3UVHA 1XZOA 1PN9A 4F2IA 1PKWA 1XCCA 3TOTA 5ECKB 4NHWA 4IHUA 1ZOFA 4O5UA 1VF1A 4EKZA 4TRXA 3MIXA 3QMXA 4POBA 2AAWA 1N8JA 1K0OA 5A5HA 3KMNA 3VURA 4HU7A 1GUMA 3AY8A 3CXGA 4DSSA 4MF5A 2HLSA 4J2FA 2ON5A 1O73A 3A5WA 2HSNB 4KSMA 1J9BA 2ES7A 2FY6A 2A4HA 1FG4A 4EE0A 3TKPA 4IELA 5BMUB 4MCUA 4H86A 5EPFA 3IAS2 1DBYA 2BTOT 2C4JA 2YN1A 5DALA 2PUKC 2GSTA 4PX1A 1LU4A 3HYPA 4YH2A 3Q6OA 1FB0A 3KH7A 1AAZA 4PQIA 3ZIJA 4N0ZA 4PUAA 2V41A 3HA9A 2GTUA 3LFLA 4KNDA 4EIQA 2AJQB 1GRXA 1ML6A 1EGRA 4PNFA 1ZYQB 4Q5RA 3PPUA 5DCGA 1XW5A 2VL2A 3GURA 4PUFC 3D0ZA 3F0IA 3M3MA 1WP0A 1XWAA 3IC4A 4X4JA 1X9WB 4OFTA 1TW9A 1ZYEA 1THOA 4EVMA 3GYKA 4K8MA 2R5GA 2PBJA 2J23A 5ECHB 3G9BA 3LEFA 3A2WA 2JSZA 5D73A 1IYIA 2H71A 4NAXA 3SWLA 4AGSA 4ECIA 3CWGA 3TCOA 1EV4A 3HJPA 3M0FA 2ZCTA 3UMAA 3LQ7A 2V6KA 2YPMA 3IOSA 3U6VA 2L4CA 2VL2C 1PKZA 2OJLA 2PU9C 3A3TA 1Q98A 1ACVA 1O8WA 4Z2RA 1DE2A 4OD7A 4TR3A 4TR1B 3ZFLA 1V9WA 2DJ3A 3F6DA 3RHCA 1Y25A 3ED3A 3ZL5A 1YJ6A 1AQVA 2LJAA 5ID2A 3CMIA 4NV2A 4DSRA 2R37A 1YZXA 2VAFA 3ZLPA 1SK2A 1ILOA 4L8EA 3TKSE 4ECJA 3QR6A 2C0EA 4Q5FA 4OFNA 3QFBC 5AIVA 3ERWA 4TR4A 2BJXA 1N2AA 5CAXA 1SKSB 2LS5A 1B48A 1X5DA 2G0FA 3EU3A 2M80A 4E8EA 3IE3A 1GULA 1OE8A 2DMMA 1EEJA 4TR0A 1XWKA 3N9JA 4IJIA 2FNOA 1NM3A 1R5AA 2XBQA 2HSNA 1NW2A 3TJBA 2HSYA 5IMZA 1G6YA 3CSJA 3UEMA 3UARA 2NBSA 1EOGA 1F37A 4JBBA 2HRFA 3LXZA 5BMUA 3RPNA 1YF0A 2LQQA 4PGTA 2VL3A 1X5CA 4KH7A 4N30A 2A2PA 1SJ6A 2B6MA 4PQHA 2H73A 4ULXA 2WRTA 3CRTA 3GKXA 4GQFA 1XVQA 3RBTA 5G1LA 4LL1B 1M2AA 3HMJG 1BG1A 1UN2A 1K0CA 5IMVA 4EC0A 1EWXA 1Z7PA 1TJDA 1UC7A 1BX9A 2HQTA 1YVLA 4L5LA 1XIYA 3RPPA 3LG6A 5IO0A 1ZYNA 1T1VA 4G19A 1XW6A 3E0UA 5ABRA 3MSZA 4KUNA 4X1UA 1PRXA 3LJRA 2VO4A 1A23A 5J3RA 2OE1A 3ZFBA 5CRGA 3Q19A 1J08A 1GWCA 1SENA 2X8CA 4G9HA 4GXZA 1TRSA 2I4AA 1RK4A 2CVDA 1HNCA 4WF5A 4LA1A 1LBKA 5BRTA 3ZVJA 3EVIA 3MWHA 4J57E 4I5QA 2AYTA 2L57A 2CZ3A 1AC1A 9GSSA 1ERWA 4IQAA 2R3XA 1K0DA 2CQ9A 3IBHA 1EOHA 6GSWA 7GSSA 1X5EA 1C72A 1T8EB 2NTOA 1JZRA 2HYXA 5ECIB 3C73A 3DIEA 4FYCA 4TR1A 3TKSA 3TDGA 1TU7A 4BA7A 3EWLA 4HUAA 1G7OA 4ECCA 2MZCA 3DMLA 2IPAA 2OKAA 2K18A 4G2EA 2PN8A 3Q18A 5IO2A 4GQCA 4XS6A 3VFIA 3TU3B 3KM6A 2XPEA 4TXVA 2QKEA 5HFGA 3FK8A 1K0AA 3FR6A 3US3A 2C0FA 4AKIA 4JR4A 1VF3A 2VCTA 1OC3A 3FHKA 5F07A 3VWWA 4MDCA 1SL0B 3LW9A 3P2AA 1ZYPA 2DJ0A 4FQUA 2C3QA 1VGLA 2YZHA 1OE7A 3J7Yb 3DGQA 2O7KA 5JCWA 1JZWA 4J56E 1E6BA 2H66A 5A1NB 4PTSA 3D6IA 3HZ8A 1NHOA 4MH3A 3JCML 2KLXA 2H1GA 5CRHA 4CY6A 3IR4A 1JHBA 3VLNA 1SJZA 3APOA 4KCEA 5B8BA 2K6VA 3CTGA 4FH8A 1WPIA 3HVVA 2DBCA 5C00A 2GSQA 5E59A 2B5YA 2LSTA 2CX3A 3ERFA 1A0RP 2H74A 3DVWA 3KJYA 4AKHA 4K5SA 4PQ1A 2VL9A 4LL4B 2JSYA 4K9ZA 2WZ9A 2CVKA 1A2JA 3F63A 3HCZA 3ZZXA 2MYGA 1EV9A 4GWRA 1PX6A 3VWXA 1F6MC 2L4QA 2YWNA 2A4VA 3H4KA 2HXKA 2V2GA 2O87A 2YWMA 4V2LA 3F3QA 6GSYA 2H19A 2H6XA 1TI1A 5IOWA 1TU8A 4USSA 2B5EA 3C1SA 3DYRA 4MP4A 5HR2A 3NIVA 3UAPA 4RI6A 2HI7A 1A0FA 1GSYA 5J47A 4V2MA 5ECSA 2GZPA 1DSBA 4L5OA 4ZBBA 2G2QA 2MBTA 2L5OA 4JZQA 1Z9HA 2IMIA 1N25A 1GLQA 2CX4A 4POLA 4PURA 3F4RA 1GNEA 4IS0A 5INYA 5IPHA 5D93A 4OFMA 5EY6A 3MYDA 3A2VA 3A5IA 3GA4A 4EXJA 5J9BA 2R4VA 4G0KA 1XWCA 4KGIA 3GKNA 4OCEA 1G7EA 2B7JA 3F4SA 2RUEA 2VLUA 1FOHA 2EIRA 2HRNA 4JE1A 1GP1A 4X0XA 1GSQA 1WMJA 1B9XC 1T3BA 3RDWA 5H5SA 2H1BA 4JU5A 1USBA 1B4PA 4E68A 4IW9A 4P3YB 2DKIA 1AQWA 3W6GA 5IMFA 2O8VB 3I43A 5KN1A 4YQMA 6GSUA 1G6WA 1THXA 4K1FA 1TI3A 5LCZA 4Z2UA 4FYUA 2DJ1A 2DJJA 4HS1A 4F9ZA 3VPQA 4XHMA 1R4WA 2RM5A 1GSSA 5A4VA 5GAND 1Y6EA 5ELGA 2KP1A 2O85A 4HZ4A 1EEMA 4AKXB 4TOPA 4CY8A 4ISDA 1MTCA 2X8GA 2X64A 4FYBA 4WETA 3D4TA 1VF2A 3WD6A 1R5PA 2PPTA 2VUPA 5CRWA 4CW9A 3LORA 4KA0A 1OKTA 3BBYA 2HT9A 2AHEA 1SVOA 2TRCP 1OAZA 1TRWA 1XXUA 1FB6A 3IC8A 3CSHA 1QUWA 4K7NA 1PQNA 5IM9A 22GSA 2P0GA 3H8QA 1V98A 2RM6A 3KTBA 2H8LA 2DC5A 3KIJA 2RLIA 3EYTA 5IMCA 3G7YA 4HOJA 4MF6A 2IL3A 4HQZA 2EIOA 3DD3A 4IBPA 2FA8A 1SU9A 3KXOA 3FR9A 3D5JA 1O6JA 4ZXGA 3GRXA 3BCIA 4PXOA 2TRXA 3HXSA 5HR3A 2JADA 4MJCA 4XS1A 1B8XA 4I2TA 2GZZA 5G2ZA 1KBNA 3GL5A 2FWEA 4QMKA 4GRFA 3ZRDA 3UL3A 4BVXB 4BWQA 5E4WA 3L4NA 1I5GA 3TOUA 2PVOC 6GSSA 1U3AA 4CDOA 2HZFA 3EURA 2I1UA 4KDYA 4AF2A 2WCIA 3GKMA 5D9TA 3KP9A 3P90A 4Q5NA 3QCPA 1GLPA 3UVTA 1G0TA 4ECBA 1GSUA 2QGVA 4AJ7A 3OR5A 1R26A 1IYHA 3ME7A 4RQRA 4OO4A 5J9CA 2VCXA 5H5RA 4K7OA 2YWIA 3DVXA 2MMAA 4MMMA 2XHFA 4HJMA 1SYXA 4TW5A 2R2JA 2QC7A 1BG5A 2GT6A 3TJJA 3D4MA 1V58A 3D22A 2OACA 1T00A 2UV8G 1SVMA 1JLWA 4QQ7A 2EFDA 3HHVA 1TOFA 1Z6MA 5ENUA 2C1YA 3UJ1A 3FZ5A 4IKHA 2R0CA 1TXXA 4ZB8A 3ME8A 5G1KA 4QL7A 1VF4A 3GHAA 4F82A 3KP8A 3H79A 2OA7A 1F3AA 4K6XA 3DWVA 2O5VA 3FW2A 4K0GA 1K0MA 2GQMA 4FO5A 2IMDA 3APSA 1FO5A 1KEBA 2EC4A 2HSHA 2L5LA 4ZBDA 2CAQA 2Z9SA 4G0IA 3P7XA 3VWUA 2X49A 2X4AA 1R7HA 2A2RA 2B5XA 1EP8A 4I97A 5HFKA 1K3LA 3TKQA 5F8BA 2OADA 5KN2A 2FWHA 3TGZA 1AIUA 4I8BA 2L59A 1SKRB 3DEXA 2AV4A 3GKKA 2DIZA 1RQMA 12GSA 2LV3A 4MZWA 4NHZA 4ACSA 1ON4A 2NDOA 3CTFA 1U6TA 1WOUA 3KGKA 3GH6A 2CA8A 1EZKA 5B7CA 5FT3A 1XPVA 2N5FA 2OBIA 4CHSA 1YDKA 2VCVA 2FGXA 1HNAA 3BOAA 1MD3A 4HZ2A 2WGRA 2P31A 1O7UA 3GTUB 2NVLA 1F3BA 2R0PA 3KH9A 1K3YA 2I81A 4N3ZA 5AISA 1X0RA 3APQA 2FD3A 3FYGA 1YEPA 2R0GA 1XW9A 3FR3A 2V32A 1PL1A 5ELAA 1UA5A 1TK5B 3C71A 4K5RA 1SVLA 3O76A 1O85A 2VLTA 4GSNA 3QDNA 4KF9A 5DJMA 4GF0A 5EVOA 5A4UA 5CNWA 5G31A 4BWSA 4IVFA 2H70A 2JZSA 4BVXA 2K8VA 4WKWA 11GSA 3M8NA 2JZRA 2A2SA 2KOKA 3GSTA 5IIZA 4WR4A 2H01A 2YZUA 5JCUA 4K2DA 3IV4A 3EC3A 5HR0A 4XIHA 1BYEA 4W66A 4E8HA 3TRXA 4KW6A 3IDVA 18GSA 2VLVA 4IN0A 3CBUA 3EU4A 2DMLA 2CV4A 5ECNB 3FMWA 2K9FA 2MBSA 1PD21 5DJLA 1QMVA 5DQYA 1T4YA 2CVBA 3SBCA 5DAKB 1XBSA 2GVPA 5HFIA 4ZBAA 2XPDA 5KOWA 4MLYA 4MH2A 4POMA 3L9SA 2WDUA 3F3RA 5F0GA 3IA1A 4ILFA 4DSQA 2B1LA 2KUCA 5IMAA 1YKAA 5IOXA 3LGCA 3RHBA 2C3TA 5GAPD 4N0VA 2H75A 4EF0A 1PX7A 3GL3A 2MMOA 5J41A 4ML1A 3F6FA 5J40A 1ST9A 1M2BA 1Y1UA 2PGTA 3GIXA 2YV7A 4HEA2 2IWTA 2VKZG 4F0CA 1Z6NA 5DDLA 1YF1A 4MJBA 3F9UA 5HR1A 5A5HB 1O81A 3RAZA 2F8AA 2WS2A 5ECPB 1JFUA 1URMA 2LQOA 1QXHA 3QOUA 1ZL9A 4MK3A 10GSA 4ZL9A 4AKGA 1U88A 4RUVA 1X9MB 1GSFA 2CZ2A 2PERA 3J7Yk 4ICYA 2LNTA 5GSTA 2N5AA 3BCKA 1B4QA 2N5BA 3ZTLA 3CSIA 2H0HA 3VK9A 4V1Ag 5G5FA 4O5RA 2HSMB 4G10A 3WGXA 3LSZA 2C80A 1A24A 4MZCA 3LYPA 2R6KA 4DEJA 1A8YA 3EMPA 2VD1A 4EDYA 17GSA 1GSDA 1SD9A 2LRCA 3H1NA 1BAYA 4I2UA 5J5NA 2F51A 3GTUA 3ZMLA 5IQYA 1SL1B 4TXOB 4ID0A 4HI7A 3WT2A 5D9WA 2VM1A 1TTZA 5CYYA 1M2DA 2IMFA 2L6CA 4XRAA 4ZB7A 2P5QA 3IRAA 1HQOA 4JR6A 5KOXA 4XCSA 2KHPA 2LRTA 2GQKA 2ZNMA 1M99A 5D9VA 1QK8A 1OYJA 5F06A 2VCQA 2E7PA 6GSVA 4RI7A 5FWGA 2HRKB 2YP6A 3EINA 5A4WA 4EUYA 4WR5A 4A5PA 4O7HA 2JACA 3K8NA 1AXDA 4IGJA 2IFQB 5D96A 4OWYA 5ECRB 1K0BA 2WB9A 4JEDA 3E9JB 3WGDA 2XC2A 2I9HA 1WWJA 5AGYA 3W8SA 5LNKe 3MDKA 1I9DA 3GX8A 4GTUA 4L0UA 5CO3A 5GZZB 4ZL7A 2F8FA 3KZQA 4Z2TA 2XBIA 5D8IA 3VI7A 1XOBA 1PSQA 3TJFA 2JL4A 5A5KA 5DAKA 1QQ2A 2YV9A 3HY2A 4MPGA 2QA1A 1W89A 2DLXA 2YNXA 1A2MA 3M9KA 3WYWA 4YQUA 2B7KA 4XS4B 4D73B 4BL7B 3ZVJD 2NPBA 1PL2A 2TIRA 3M1GA 1XOAA 2WULA 4LMVA 5COHA 4MPFA 2PVQA 5G5EA 1UVZA 1H4OA 2AB6A 4TVEA 5A1NA 4EIPA 3HJMA 3TRQA 2JZTA 1XFLA 3HDCA 2LTKA 3MAKA 1T4ZA 4Q5QA 3E3EA 4POKA 4WEYA 2IMEA 1FVKA 1XWBA 2E2GA 3W8JA 2OE0A 3R2QA 2GS3A 1F9MA 1TK0B 2FLSA 2RUFA 4YQVA 1O8XA 2IMKA 2REMA 4PNGA 4XRDA 1E2YA 4O92A 3V1WA 1Q4JA 1QFNA 2HSMA 2WJUA 3IHQA 3GFKA 3TJKA 3KEBA 3UOMA 5J4VA 3KMOA 1M7TA 1WRYA 3QAGA 1FAAA 2GSRA 1RW1A 3PGTA 4TXOA 5J4UA 3O3TA 4GSTA 3ZMKA 4WBJA 4WXTA 5JCGA 5D9XA 5F05A 4IP1A 4HJ2A 4GCIA 1HD2A 2H1DA 1LJRA 3ZITA 1QGVA 2IN3A 3FZ4A 2FHEA 4OMVA 4NWYA 5JWOB 4MF7A 1H75A 2E0QA 2H30A 2C3NA 2H0GA 2V1MA 2V6OA 2HRKA 2GT5A 3FRCA 2MMNA 4TKYA 4G01A 2VD0A 2LJRA 2FWGA 2C0DA 5DCHA 2QA2A 3WGEA 2IFQA 4N10A 2DIYA 1W4VA 2FUG2 4YKFA 2YWOA 1S3CA 4G0LA 3F4TA 3PR8A 3I6AA 2P5RA 3IK9A 1SKWB 2GQLA 3HZ4A 3GUSA 4JRRA 3A2XA 2ON7A 1KTEA 1JZDA 2H1LA 1TK8B 5A34B 4AJ8A 3ISOA 1ZMAA 1DE1A 4KCAA 3LXTA 4V2NA 1AQXA 2FA4A 3NOFA 2EFHA 2YCDA 2OE3A 2LEGA 1ZZYA 2F3MA 2J9HA 4XS4A 4D73A 3GH9A 5G30A 4IJ3A 4MNNA 2M46A 3GN3A 4NXIA 1MDJA 4BL7A 1GNWA 1V57A 1PA3A 4ML6A 5H5QA 2ZUPA 2C8UA 3EMXA 1NHYA 3HVXA 3NZNA 4TN8A 1WIKA 3DRNA 2H1AA 1JLVA 5ECOB 5AIXA 2YOIA 4OCFA 3G7JA 5JWRB 4FIWA 1J0FA 4F0BA 2WFCA 3PINA 5IMDA 4YAPA 8GSSA 4F03A 4IQ1A 3BJ5A 2CAIA 5AN1A 1MDKA 1AW9A 3FY7A 4RQXA 3TB2A 1WE0A 4O32A 1TP9A 3KD0A 3G7IA 2OBKA 3QPMA 1ABAA 5HQPA 3O6TA 4ZIJA 1OVNA 4ZL8A 3PH9A 3QFAC 1ZCPA 4EL1A 2PWJA 1MEKA 3DXBA 1M9AA 1YQ1A 1FVJA 3LYKA 5KN3A 2EFEA 3HKRA 3GSSA 1BF5A 1FOVA 1A2LA 5KN0A 2YANA 1GUHA 4NV5A 3C7MA 2LRNA 4KDUA 1FW1A 1NSWA 4BVYB 6GSXA 3QAVA 2RIIA 4ZILA 4YKGA 1V40A 3IK7A 2VM2A 1X9SB 2UZ8A 1OC9B 2LJKA 3VI5A 2M72A 2CT6A 3GNJA 4ZB9A 4MZBA 1FHEA 3GV1A 2D2ZA 4EDZA 1U3IA 3DKSA 1F2EA 20GSA 4DVCA 3VWVA 4KB3A 1EP7A 1SK0A 2LNSA 3UIWA 1GTUA 3ZYWA 3GMFA 5CRDA 3ZREA 4HDEA 3UBLA 1PMTA 5GSSA 1A8LA 1GTBA 4WBRD 2LKUA 2FCHA 1HNBA 2H72A 4ZB6A 1GTAA 6GSTA 3P8WA 2HE3A 1GH2A 5B8AA 3TJGA 2OT3A 2C0GA 1M9BA 3FEUA 2HZEB 1BJXA 5J4YA 2GDRA 1MDIA 1ERUA 5A34A 3EPTA 4GSSA 3ZIVA 1YEXA 1TKDB 2IJYA 1OC8A 2DJ2A 3HVSA 4IP6A 5L71A 4K2XA 14GSA 1WJKA 1SK1A 4GLTA 4KDXA 4KX4A 3HD5A 2DKHA 3TKRA 5C04A 1VRSD 2VCZA 4XTSA 3L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECQ B;  3UBK A;  3FKF A;  1GUK A;  3I9V 2;  2HNL A;  2GGT A;  5CRE A;  2F9S A;  1CQH A;  4WF4 A;  3I69 A;  1S3A A;  1V2A A;  3L78 A;  2GSS A;  4LLR A;  2E2M A;  2X99 A;  3KCM A;  4DSS B;  4EO3 A;  1BED A;  4KSO A;  3TKS C;  2AUV A;  1ZGN A;  2H6Y A;  3GX0 A;  1ERV A;  4L0W A;  2O89 A;  4LMW A;  3FZA A;  2JU5 A;  3R3E A;  3ERG A;  1GL8 A;  2B3S A;  3M9J A;  2QSI A;  2H0I A;  3QAW A;  2DSA A;  2L6D A;  3L0H A;  5JWQ B;  1Z7R A;  2BMX A;  3Q74 A;  1XWG A;  13GS A;  4Z7X A;  1Z3E A;  1M0U A;  4BPY A;  5DAL B;  4V1A p;  3BD2 A;  4KE3 A;  1BQ7 A;  2HRA A;  5B6N A;  2K8S A;  2H76 A;  3IXR A;  4BVY A;  2DJK A;  1EGO A;  1TRU A;  1TDI A;  1MD4 A;  4X43 A;  2HFD A;  1OC9 A;  3EE2 A;  1ERT A;  4AJ6 A;  4K0N A;  5DVB A;  1GSE A;  4QL9 A;  2B1K A;  16GS A;  1JZO A;  4MJA A;  3FZ9 A;  1KNG A;  5DQS A;  1Z5Y E;  5KEJ A;  1SL2 B;  1OKD A;  1S3D A;  2GZY A;  5LD0 A;  3KTL A;  4N11 A;  1HYU A;  3IPZ A;  5CP1 A;  4K7I A;  1K0N A;  4HU9 A;  3D21 A;  1B9Y C;  2MMZ A;  2IIY A;  3QD9 A;  3IAM 2;  2VIM A;  2VCW A;  5FHI A;  2LUS A;  3VPT A;  4HQS A;  1SJI A;  19GS A;  3LWA A;  3HJO A;  1DUG A;  2GLR A;  3F8U A;  5ECL B;  2EIQ A;  1K3O A;  4MAB A;  2X8H A;  5DBQ A;  1XVW A;  4KAE A;  3C1R A;  1AUC A;  3MNG A;  1TRV A;  1YY7 A;  2YJH A;  2HZE A;  2YJ7 A;  2H6Z A;  1SYR A;  4MJE A;  2KP2 A;  3CRU A;  4OO5 A;  4MA9 A;  3L9U A;  1YKC A;  2ALB A;  1GTI A;  3C8E A;  5EL8 A;  4I6X A;  3U5R E;  2FWF A;  1SD8 A;  3H93 A;  5B6M A;  3S9F A;  4NPB A;  2PMT A;  3N5O A;  1CQG A;  3WT1 A;  1T7P B;  5IPG A;  5ID2 B;  5ECM B;  4YAV A;  3CYN A;  1U87 A;  3TRP A;  2I3Y A;  1PGT A;  3TUE A;  4NMU A;  2VOC A;  3UVH A;  1XZO A;  1PN9 A;  4F2I A;  1PKW A;  1XCC A;  3TOT A;  5ECK B;  4NHW A;  4IHU A;  1ZOF A;  1VF1 A;  4EKZ A;  4TRX A;  3QMX A;  4POB A;  2AAW A;  1N8J A;  1K0O A;  3VUR A;  3KMN A;  4HU7 A;  1GUM A;  3AY8 A;  3CXG A;  4DSS A;  4MF5 A;  2HLS A;  4J2F A;  2ON5 A;  1O73 A;  3A5W A;  2HSN B;  4KSM A;  1J9B A;  2ES7 A;  2FY6 A;  1FG4 A;  4EE0 A;  3TKP A;  4IEL A;  4MCU A;  4H86 A;  5EPF A;  3IAS 2;  1DBY A;  2BTO T;  2C4J A;  2YN1 A;  5DAL A;  2PUK C;  2GST A;  4PX1 A;  1LU4 A;  3HYP A;  4YH2 A;  3Q6O A;  1FB0 A;  3KH7 A;  1AAZ A;  4PQI A;  3ZIJ A;  4N0Z A;  4PUA A;  2V41 A;  3HA9 A;  2GTU A;  3LFL A;  4KND A;  2AJQ B;  1GRX A;  1ML6 A;  1EGR A;  4PNF A;  1ZYQ B;  4Q5R A;  3PPU A;  5DCG A;  1XW5 A;  2VL2 A;  3GUR A;  4PUF C;  3D0Z A;  3F0I A;  3M3M A;  1WP0 A;  1XWA A;  3IC4 A;  1X9W B;  4OFT A;  1TW9 A;  1ZYE A;  1THO A;  4EVM A;  3GYK A;  4K8M A;  2R5G A;  2PBJ A;  2J23 A;  5ECH B;  3G9B A;  3LEF A;  3A2W A;  2JSZ A;  5D73 A;  1IYI A;  2H71 A;  4NAX A;  3SWL A;  4AGS A;  4ECI A;  3TCO A;  1EV4 A;  3HJP A;  3M0F A;  2ZCT A;  3UMA A;  3LQ7 A;  2V6K A;  2YPM A;  3IOS A;  3U6V A;  2L4C A;  2VL2 C;  1PKZ A;  2OJL A;  2PU9 C;  3A3T A;  1Q98 A;  1ACV A;  1O8W A;  1DE2 A;  4OD7 A;  4TR3 A;  4TR1 B;  3ZFL A;  1V9W A;  2DJ3 A;  3F6D A;  3RHC A;  1Y25 A;  3ED3 A;  3ZL5 A;  1YJ6 A;  1AQV A;  2LJA A;  5ID2 A;  3CMI A;  4NV2 A;  4DSR A;  2R37 A;  1YZX A;  2VAF A;  3ZLP A;  1SK2 A;  1ILO A;  4L8E A;  3TKS E;  4ECJ A;  3QR6 A;  2C0E A;  4Q5F A;  4OFN A;  3QFB C;  5AIV A;  3ERW A;  4TR4 A;  1N2A A;  2BJX A;  5CAX A;  1SKS B;  2LS5 A;  1B48 A;  1X5D A;  2G0F A;  3EU3 A;  2M80 A;  4E8E A;  3IE3 A;  1GUL A;  1OE8 A;  2DMM A;  1EEJ A;  4TR0 A;  1XWK A;  3N9J A;  4IJI A;  2FNO A;  1NM3 A;  1R5A A;  2XBQ A;  1NW2 A;  3TJB A;  2HSY A;  5IMZ A;  1G6Y A;  3CSJ A;  3UEM A;  3UAR A;  2NBS A;  1EOG A;  1F37 A;  4JBB A;  2HRF A;  3LXZ A;  5BMU A;  3RPN A;  1YF0 A;  2LQQ A;  4PGT A;  2VL3 A;  1X5C A;  4KH7 A;  4N30 A;  1SJ6 A;  2B6M A;  4PQH A;  2H73 A;  4ULX A;  2WRT A;  3CRT A;  3GKX A;  4GQF A;  1XVQ A;  3RBT A;  5G1L A;  4LL1 B;  1M2A A;  1UN2 A;  1K0C A;  5IMV A;  4EC0 A;  1EWX A;  1Z7P A;  1TJD A;  1UC7 A;  1BX9 A;  2HQT A;  4L5L A;  1XIY A;  3RPP A;  3LG6 A;  5IO0 A;  1T1V A;  4G19 A;  1XW6 A;  3E0U A;  5ABR A;  3MSZ A;  4KUN A;  4X1U A;  1PRX A;  3LJR A;  2VO4 A;  1A23 A;  5J3R A;  2OE1 A;  3ZFB A;  5CRG A;  3Q19 A;  1J08 A;  1GWC A;  1SEN A;  2X8C A;  4G9H A;  4GXZ A;  1TRS A;  2I4A A;  1RK4 A;  2CVD A;  1HNC A;  4WF5 A;  4LA1 A;  1LBK A;  3ZVJ A;  3EVI A;  3MWH A;  4J57 E;  4I5Q A;  2AYT A;  2L57 A;  2CZ3 A;  1AC1 A;  9GSS A;  1ERW A;  4IQA A;  2R3X A;  1K0D A;  2CQ9 A;  3IBH A;  1EOH A;  6GSW A;  7GSS A;  1X5E A;  1C72 A;  1T8E B;  2NTO A;  1JZR A;  2HYX A;  5ECI B;  3C73 A;  3DIE A;  4FYC A;  4TR1 A;  3TKS A;  3TDG A;  1TU7 A;  4BA7 A;  3EWL A;  4HUA A;  1G7O A;  4ECC A;  2MZC A;  3DML A;  2IPA A;  2OKA A;  2K18 A;  4G2E A;  2PN8 A;  3Q18 A;  5IO2 A;  4GQC A;  4XS6 A;  3VFI A;  3KM6 A;  2XPE A;  4TXV A;  2QKE A;  5HFG A;  3FK8 A;  1K0A A;  3FR6 A;  3US3 A;  2C0F A;  4JR4 A;  1VF3 A;  2VCT A;  1OC3 A;  3FHK A;  5F07 A;  3VWW A;  4MDC A;  1SL0 B;  3P2A A;  2DJ0 A;  4FQU A;  2C3Q A;  1VGL A;  2YZH A;  1OE7 A;  3J7Y b;  3DGQ A;  2O7K A;  5JCW A;  1JZW A;  4J56 E;  1E6B A;  2H66 A;  4PTS A;  3D6I A;  3HZ8 A;  1NHO A;  4MH3 A;  3JCM L;  2KLX A;  2H1G A;  5CRH A;  3IR4 A;  1JHB A;  3VLN A;  1SJZ A;  3APO A;  4KCE A;  5B8B A;  2K6V A;  3CTG A;  4FH8 A;  1WPI A;  3HVV A;  2DBC A;  5C00 A;  2GSQ A;  5E59 A;  2B5Y A;  2LST A;  2CX3 A;  3ERF A;  1A0R P;  2H74 A;  3DVW A;  3KJY A;  4PQ1 A;  2VL9 A;  4LL4 B;  2JSY A;  4K9Z A;  2WZ9 A;  2CVK A;  1A2J A;  3F63 A;  3HCZ A;  3ZZX A;  2MYG A;  1EV9 A;  4GWR A;  1PX6 A;  3VWX A;  1F6M C;  2L4Q A;  2YWN A;  2A4V A;  3H4K A;  2HXK A;  2V2G A;  2O87 A;  2YWM A;  4V2L A;  3F3Q A;  6GSY A;  2H19 A;  2H6X A;  1TI1 A;  5IOW A;  1TU8 A;  4USS A;  2B5E A;  3C1S A;  3DYR A;  4MP4 A;  5HR2 A;  3NIV A;  3UAP A;  4RI6 A;  2HI7 A;  1A0F A;  1GSY A;  4V2M A;  5ECS A;  2GZP A;  1DSB A;  4L5O A;  4ZBB A;  2G2Q A;  2MBT A;  2L5O A;  4JZQ A;  1Z9H A;  2IMI A;  1GLQ A;  2CX4 A;  4POL A;  4PUR A;  3F4R A;  1GNE A;  4IS0 A;  5INY A;  5IPH A;  5D93 A;  4OFM A;  5EY6 A;  3A2V A;  3GA4 A;  4EXJ A;  5J9B A;  2R4V A;  4G0K A;  1XWC A;  4KGI A;  3GKN A;  4OCE A;  1G7E A;  2B7J A;  3F4S A;  2RUE A;  2VLU A;  2EIR A;  2HRN A;  4JE1 A;  1GP1 A;  4X0X A;  1GSQ A;  1WMJ A;  1B9X C;  1T3B A;  3RDW A;  5H5S A;  2H1B A;  4JU5 A;  1USB A;  1B4P A;  4IW9 A;  4P3Y B;  1AQW A;  3W6G A;  5IMF A;  2O8V B;  3I43 A;  5KN1 A;  4YQM A;  6GSU A;  1G6W A;  1THX A;  4K1F A;  1TI3 A;  5LCZ A;  4FYU A;  2DJ1 A;  2DJJ A;  4HS1 A;  4F9Z A;  3VPQ A;  4XHM A;  1R4W A;  2RM5 A;  1GSS A;  5A4V A;  5GAN D;  1Y6E A;  5ELG A;  2KP1 A;  2O85 A;  4HZ4 A;  1EEM A;  4TOP A;  4ISD A;  1MTC A;  2X8G A;  2X64 A;  4FYB A;  4WET A;  3D4T A;  1VF2 A;  3WD6 A;  1R5P A;  2PPT A;  2VUP A;  5CRW A;  4CW9 A;  3LOR A;  4KA0 A;  1OKT A;  3BBY A;  2HT9 A;  2AHE A;  2TRC P;  1OAZ A;  1TRW A;  1XXU A;  1FB6 A;  3IC8 A;  3CSH A;  1QUW A;  4K7N A;  1PQN A;  5IM9 A;  22GS A;  2P0G A;  3H8Q A;  1V98 A;  2RM6 A;  3KTB A;  2H8L A;  2DC5 A;  3KIJ A;  2RLI A;  3EYT A;  5IMC A;  3G7Y A;  4HOJ A;  4MF6 A;  2IL3 A;  4HQZ A;  2EIO A;  3DD3 A;  4IBP A;  2FA8 A;  1SU9 A;  3KXO A;  3FR9 A;  3D5J A;  1O6J A;  4ZXG A;  3GRX A;  3BCI A;  4PXO A;  2TRX A;  3HXS A;  5HR3 A;  2JAD A;  4MJC A;  4XS1 A;  1B8X A;  4I2T A;  2GZZ A;  5G2Z A;  1KBN A;  3GL5 A;  2FWE A;  4GRF A;  3ZRD A;  3UL3 A;  4BVX B;  4BWQ A;  5E4W A;  3L4N A;  1I5G A;  3TOU A;  2PVO C;  6GSS A;  1U3A A;  4CDO A;  2HZF A;  3EUR A;  2I1U A;  4KDY A;  4AF2 A;  2WCI A;  3GKM A;  5D9T A;  3KP9 A;  3P90 A;  4Q5N A;  3QCP A;  1GLP A;  3UVT A;  1G0T A;  4ECB A;  1GSU A;  2QGV A;  4AJ7 A;  3OR5 A;  1R26 A;  1IYH A;  3ME7 A;  4RQR A;  4OO4 A;  5J9C A;  2VCX A;  5H5R A;  4K7O A;  2YWI A;  3DVX A;  2MMA A;  4MMM A;  2XHF A;  4HJM A;  1SYX A;  4TW5 A;  2R2J A;  2QC7 A;  1BG5 A;  2GT6 A;  3TJJ A;  3D4M A;  1V58 A;  3D22 A;  2OAC A;  1T00 A;  1JLW A;  4QQ7 A;  3HHV A;  1TOF A;  1Z6M A;  5ENU A;  2C1Y A;  3UJ1 A;  3FZ5 A;  4IKH A;  1TXX A;  4ZB8 A;  3ME8 A;  5G1K A;  4QL7 A;  1VF4 A;  3GHA A;  4F82 A;  3KP8 A;  3H79 A;  2OA7 A;  1F3A A;  4K6X A;  3DWV A;  3FW2 A;  4K0G A;  1K0M A;  2GQM A;  4FO5 A;  2IMD A;  3APS A;  1FO5 A;  1KEB A;  2EC4 A;  2HSH A;  2L5L A;  4ZBD A;  2CAQ A;  2Z9S A;  4G0I A;  3P7X A;  3VWU A;  1R7H A;  2A2R A;  2B5X A;  1EP8 A;  4I97 A;  5HFK A;  1K3L A;  3TKQ A;  5F8B A;  2OAD A;  5KN2 A;  2FWH A;  3TGZ A;  1AIU A;  4I8B A;  2L59 A;  1SKR B;  3DEX A;  2AV4 A;  3GKK A;  2DIZ A;  1RQM A;  12GS A;  2LV3 A;  4MZW A;  4NHZ A;  4ACS A;  1ON4 A;  2NDO A;  3CTF A;  1U6T A;  1WOU A;  3KGK A;  3GH6 A;  2CA8 A;  1EZK A;  5B7C A;  5FT3 A;  1XPV A;  2N5F A;  2OBI A;  4CHS A;  1YDK A;  2VCV A;  2FGX A;  1HNA A;  3BOA A;  1MD3 A;  4HZ2 A;  2WGR A;  2P31 A;  1O7U A;  3GTU B;  2NVL A;  1F3B A;  3KH9 A;  1K3Y A;  2I81 A;  5AIS A;  1X0R A;  3APQ A;  2FD3 A;  3FYG A;  1YEP A;  1XW9 A;  3FR3 A;  2V32 A;  1PL1 A;  5ELA A;  1UA5 A;  1TK5 B;  3C71 A;  3O76 A;  1O85 A;  2VLT A;  4GSN A;  3QDN A;  4KF9 A;  5DJM A;  4GF0 A;  5EVO A;  5A4U A;  5CNW A;  5G31 A;  4BWS A;  4IVF A;  2H70 A;  2JZS A;  4BVX A;  2K8V A;  4WKW A;  11GS A;  3M8N A;  2JZR A;  2A2S A;  2KOK A;  3GST A;  5IIZ A;  4WR4 A;  2H01 A;  2YZU A;  5JCU A;  4K2D A;  3IV4 A;  3EC3 A;  5HR0 A;  4XIH A;  1BYE A;  4E8H A;  3TRX A;  4KW6 A;  3IDV A;  18GS A;  2VLV A;  4IN0 A;  3CBU A;  3EU4 A;  2DML A;  2CV4 A;  5ECN B;  2K9F A;  2MBS A;  1PD2 1;  5DJL A;  1QMV A;  5DQY A;  1T4Y A;  2CVB A;  3SBC A;  5DAK B;  1XBS A;  2GVP A;  5HFI A;  4ZBA A;  2XPD A;  4MLY A;  4MH2 A;  4POM A;  3L9S A;  2WDU A;  3F3R A;  5F0G A;  3IA1 A;  4ILF A;  4DSQ A;  2B1L A;  2KUC A;  5IMA A;  1YKA A;  5IOX A;  3LGC A;  3RHB A;  2C3T A;  5GAP D;  4N0V A;  2H75 A;  4EF0 A;  1PX7 A;  3GL3 A;  2MMO A;  5J41 A;  4ML1 A;  3F6F A;  1ST9 A;  1M2B A;  2PGT A;  3GIX A;  2YV7 A;  4HEA 2;  2IWT A;  4F0C A;  1Z6N A;  5DDL A;  1YF1 A;  4MJB A;  3F9U A;  5HR1 A;  1O81 A;  3RAZ A;  2F8A A;  2WS2 A;  5ECP B;  1JFU A;  1URM A;  2LQO A;  1QXH A;  3QOU A;  1ZL9 A;  4MK3 A;  10GS A;  4ZL9 A;  1U88 A;  4RUV A;  1X9M B;  1GSF A;  2CZ2 A;  2PER A;  3J7Y k;  2LNT A;  5GST A;  2N5A A;  3BCK A;  1B4Q A;  2N5B A;  3ZTL A;  3CSI A;  2H0H A;  3VK9 A;  4V1A g;  5G5F A;  4O5R A;  2HSM B;  4G10 A;  3WGX A;  3LSZ A;  2C80 A;  1A24 A;  4MZC A;  3LYP A;  2R6K A;  4DEJ A;  1A8Y A;  3EMP A;  2VD1 A;  4EDY A;  17GS A;  1GSD A;  1SD9 A;  2LRC A;  3H1N A;  1BAY A;  4I2U A;  5J5N A;  2F51 A;  3GTU A;  3ZML A;  5IQY A;  1SL1 B;  4TXO B;  4ID0 A;  4HI7 A;  3WT2 A;  5D9W A;  2VM1 A;  1TTZ A;  5CYY A;  1M2D A;  2IMF A;  2L6C A;  4XRA A;  2P5Q A;  3IRA A;  1HQO A;  4JR6 A;  4XCS A;  2KHP A;  2LRT A;  1M99 A;  2ZNM A;  1QK8 A;  5D9V A;  2GQK A;  1OYJ A;  5F06 A;  2VCQ A;  2E7P A;  6GSV A;  4RI7 A;  5FWG A;  2HRK B;  2YP6 A;  3EIN A;  5A4W A;  4EUY A;  4WR5 A;  4O7H A;  2JAC A;  3K8N A;  1AXD A;  4IGJ A;  2IFQ B;  5D96 A;  4OWY A;  5ECR B;  1K0B A;  2WB9 A;  4JED A;  3E9J B;  3WGD A;  2XC2 A;  2I9H A;  1WWJ A;  5AGY A;  3W8S A;  5LNK e;  3MDK A;  1I9D A;  3GX8 A;  4GTU A;  4L0U A;  5CO3 A;  5GZZ B;  4ZL7 A;  2F8F A;  3KZQ A;  2XBI A;  5D8I A;  3VI7 A;  1XOB A;  1PSQ A;  3TJF A;  2JL4 A;  5A5K A;  5DAK A;  1QQ2 A;  2YV9 A;  3HY2 A;  4MPG A;  1W89 A;  2DLX A;  2YNX A;  1A2M A;  3M9K A;  3WYW A;  4YQU A;  2B7K A;  4XS4 B;  4D73 B;  4BL7 B;  3ZVJ D;  2NPB A;  1PL2 A;  2TIR A;  3M1G A;  1XOA A;  2WUL A;  4LMV A;  5COH A;  4MPF A;  2PVQ A;  5G5E A;  1UVZ A;  1H4O A;  2AB6 A;  4TVE A;  3HJM A;  3TRQ A;  2JZT A;  1XFL A;  3HDC A;  2LTK A;  3MAK A;  1T4Z A;  4Q5Q A;  3E3E A;  4POK A;  4WEY A;  2IME A;  1FVK A;  1XWB A;  2E2G A;  3W8J A;  2OE0 A;  3R2Q A;  2GS3 A;  1F9M A;  1TK0 B;  2FLS A;  2RUF A;  4YQV A;  1O8X A;  2IMK A;  2REM A;  4PNG A;  4XRD A;  1E2Y A;  4O92 A;  3V1W A;  1Q4J A;  1QFN A;  2HSM A;  2WJU A;  3IHQ A;  3GFK A;  3TJK A;  3KEB A;  3UOM A;  3KMO A;  1M7T A;  1WRY A;  3QAG A;  1FAA A;  2GSR A;  1RW1 A;  3PGT A;  4TXO A;  5J4U A;  3O3T A;  4GST A;  3ZMK A;  4WBJ A;  4WXT A;  5JCG A;  5D9X A;  5F05 A;  4IP1 A;  4HJ2 A;  4GCI A;  1HD2 A;  2H1D A;  1LJR A;  3ZIT A;  1QGV A;  2IN3 A;  3FZ4 A;  2FHE A;  4OMV A;  4NWY A;  5JWO B;  4MF7 A;  1H75 A;  2E0Q A;  2H30 A;  2C3N A;  2H0G A;  2V1M A;  2V6O A;  2HRK A;  2GT5 A;  3FRC A;  2MMN A;  4TKY A;  2VD0 A;  2LJR A;  2FWG A;  2C0D A;  5DCH A;  3WGE A;  2IFQ A;  4N10 A;  2DIY A;  1W4V A;  2FUG 2;  2YWO A;  1S3C A;  4G0L A;  3F4T A;  3PR8 A;  3I6A A;  2P5R A;  3IK9 A;  1SKW B;  2GQL A;  3HZ4 A;  3GUS A;  4JRR A;  3A2X A;  2ON7 A;  1KTE A;  1JZD A;  1TK8 B;  4AJ8 A;  3ISO A;  1ZMA A;  1DE1 A;  4KCA A;  3LXT A;  4V2N A;  1AQX A;  2FA4 A;  3NOF A;  2YCD A;  2OE3 A;  2LEG A;  1ZZY A;  2F3M A;  2J9H A;  4XS4 A;  4D73 A;  3GH9 A;  5G30 A;  4IJ3 A;  2M46 A;  3GN3 A;  4NXI A;  1MDJ A;  4BL7 A;  1GNW A;  1V57 A;  1PA3 A;  4ML6 A;  5H5Q A;  2ZUP A;  2C8U A;  3EMX A;  1NHY A;  3HVX A;  3NZN A;  4TN8 A;  1WIK A;  3DRN A;  2H1A A;  1JLV A;  5ECO B;  5AIX A;  2YOI A;  4OCF A;  3G7J A;  5JWR B;  4FIW A;  1J0F A;  4F0B A;  2WFC A;  3PIN A;  5IMD A;  4YAP A;  8GSS A;  4F03 A;  4IQ1 A;  3BJ5 A;  2CAI A;  5AN1 A;  1MDK A;  1AW9 A;  3FY7 A;  4RQX A;  3TB2 A;  1WE0 A;  4O32 A;  1TP9 A;  3KD0 A;  3G7I A;  2OBK A;  3QPM A;  1ABA A;  5HQP A;  3O6T A;  4ZIJ A;  1OVN A;  4ZL8 A;  3PH9 A;  3QFA C;  1ZCP A;  4EL1 A;  2PWJ A;  1MEK A;  3DXB A;  1M9A A;  1YQ1 A;  1FVJ A;  3LYK A;  5KN3 A;  3HKR A;  3GSS A;  1FOV A;  1A2L A;  5KN0 A;  2YAN A;  1GUH A;  4NV5 A;  3C7M A;  2LRN A;  4KDU A;  1FW1 A;  1NSW A;  4BVY B;  6GSX A;  3QAV A;  2RII A;  4ZIL A;  1V40 A;  3IK7 A;  2VM2 A;  1X9S B;  2UZ8 A;  1OC9 B;  2LJK A;  3VI5 A;  2M72 A;  2CT6 A;  3GNJ A;  4ZB9 A;  4MZB A;  1FHE A;  3GV1 A;  2D2Z A;  4EDZ A;  1U3I A;  3DKS A;  1F2E A;  20GS A;  4DVC A;  3VWV A;  4KB3 A;  1EP7 A;  1SK0 A;  2LNS A;  3UIW A;  1GTU A;  3ZYW A;  3GMF A;  5CRD A;  3ZRE A;  4HDE A;  3UBL A;  1PMT A;  5GSS A;  1A8L A;  1GTB A;  4WBR D;  2LKU A;  2FCH A;  1HNB A;  2H72 A;  4ZB6 A;  1GTA A;  6GST A;  3P8W A;  2HE3 A;  1GH2 A;  5B8A A;  3TJG A;  2C0G A;  1M9B A;  3FEU A;  2HZE B;  1BJX A;  2GDR A;  1MDI A;  1ERU A;  4GSS A;  3ZIV A;  1YEX A;  1TKD B;  2IJY A;  1OC8 A;  2DJ2 A;  3HVS A;  4IP6 A;  5L71 A;  14GS A;  1WJK A;  1SK1 A;  4GLT A;  4KDX A;  4KX4 A;  3HD5 A;  3TKR A;  5C04 A;  1VRS D;  2VCZ A;  4XTS A;  3L9V A; 
#chains in the Genus database with same CATH topology
 5ECQ B;  3UBK A;  3FKF A;  1GUK A;  3I9V 2;  2WVX A;  2HNL A;  2GGT A;  5CRE A;  2F9S A;  1CQH A;  4WF4 A;  3I69 A;  1S3A A;  1V2A A;  3L78 A;  2GSS A;  1TXU A;  4LLR A;  2E2M A;  2X99 A;  3KCM A;  4DSS B;  4EO3 A;  2WW3 A;  1BED A;  4KSO A;  4O5Q A;  3TKS C;  2AUV A;  1ZGN A;  2H6Y A;  3GX0 A;  1ERV A;  4L0W A;  2O89 A;  4LMW A;  3FZA A;  2JU5 A;  3R3E A;  3ERG A;  1GL8 A;  2B3S A;  3M9J A;  2QSI A;  2H0I A;  3QAW A;  2DSA A;  2L6D A;  3L0H A;  5JWQ B;  1Z7R A;  2BMX A;  3Q74 A;  1XWG A;  13GS A;  4Z7X A;  1Z3E A;  1M0U A;  4BPY A;  5DAL B;  4V1A p;  3BD2 A;  4KE3 A;  1PN0 A;  1BQ7 A;  2HRA A;  3IHG A;  5B6N A;  2K8S A;  2H76 A;  3IXR A;  4BVY A;  2DJK A;  1EGO A;  1TRU A;  1TDI A;  1MD4 A;  4X43 A;  2HFD A;  1OC9 A;  3EE2 A;  1ERT A;  4AJ6 A;  4K0N A;  5DVB A;  1GSE A;  4QL9 A;  2B1K A;  16GS A;  1JZO A;  4MJA A;  3CQF A;  3FZ9 A;  1KNG A;  5DQS A;  1Z5Y E;  5KEJ A;  1SL2 B;  1OKD A;  1S3D A;  2GZY A;  5LD0 A;  3KTL A;  4N11 A;  1HYU A;  3IPZ A;  5CP1 A;  4K7I A;  1K0N A;  3D21 A;  4HU9 A;  1B9Y C;  2MMZ A;  2IIY A;  3QD9 A;  3IAM 2;  2VIM A;  2VCW A;  5FHI A;  2EFC A;  2LUS A;  3VPT A;  4HQS A;  1SJI A;  19GS A;  3LWA A;  3HJO A;  1DUG A;  2GLR A;  3F8U A;  5ECL B;  4AI6 A;  2EIQ A;  1K3O A;  4MAB A;  4GDF A;  2X8H A;  5DBQ A;  1XVW A;  4KAE A;  3C1R A;  1AUC A;  3MNG A;  1TRV A;  1YY7 A;  2YJH A;  2HZE A;  2YJ7 A;  2H6Z A;  1SYR A;  4MJE A;  2KP2 A;  3CRU A;  4OO5 A;  4MA9 A;  3L9U A;  1YKC A;  2ALB A;  1GTI A;  3C8E A;  5EL8 A;  4I6X A;  3U5R E;  2FWF A;  1SD8 A;  3H93 A;  5B6M A;  3S9F A;  4NPB A;  2PMT A;  3N5O A;  1CQG A;  3WT1 A;  1T7P B;  5IPG A;  5ID2 B;  5ECM B;  4YAV A;  3CYN A;  1U87 A;  3TRP A;  2I3Y A;  1PGT A;  3TUE A;  4NMU A;  2VOC A;  3UVH A;  1XZO A;  1PN9 A;  4F2I A;  1PKW A;  1XCC A;  3TOT A;  5ECK B;  4NHW A;  4IHU A;  1ZOF A;  4O5U A;  1VF1 A;  2WZS A;  4EKZ A;  4TRX A;  3MIX A;  3QMX A;  4POB A;  2AAW A;  1N8J A;  1K0O A;  5A5H A;  3KMN A;  3VUR A;  2WW0 A;  4HU7 A;  1GUM A;  3AY8 A;  1S4B P;  3CXG A;  4DSS A;  4MF5 A;  2HLS A;  4J2F A;  2ON5 A;  1O73 A;  3A5W A;  2HSN B;  4KSM A;  1J9B A;  2ES7 A;  2FY6 A;  2A4H A;  1FG4 A;  4EE0 A;  3TKP A;  4IEL A;  5BMU B;  4MCU A;  4H86 A;  5EPF A;  3IAS 2;  1DBY A;  2BTO T;  2C4J A;  2YN1 A;  5DAL A;  2PUK C;  2GST A;  4FXY P;  4PX1 A;  1LU4 A;  3HYP A;  4YH2 A;  3Q6O A;  1FB0 A;  3KH7 A;  1AAZ A;  4PQI A;  3ZIJ A;  4N0Z A;  4PUA A;  2V41 A;  3HA9 A;  2GTU A;  3LFL A;  4PI0 C;  4KND A;  4EIQ A;  2AJQ B;  1GRX A;  1ML6 A;  1EGR A;  4PNF A;  1ZYQ B;  4Q5R A;  3PPU A;  5DCG A;  1XW5 A;  2VL2 A;  3GUR A;  4PUF C;  3D0Z A;  3F0I A;  3M3M A;  1WP0 A;  1XWA A;  3IC4 A;  4X4J A;  1X9W B;  4OFT A;  1TW9 A;  1ZYE A;  1THO A;  4EVM A;  3GYK A;  4K8M A;  2R5G A;  2PBJ A;  2J23 A;  5ECH B;  3G9B A;  3LEF A;  3A2W A;  2JSZ A;  5D73 A;  1IYI A;  2H71 A;  4NAX A;  3SWL A;  4AGS A;  4ECI A;  3CWG A;  3TCO A;  1EV4 A;  3HJP A;  3M0F A;  2ZCT A;  3UMA A;  3LQ7 A;  2V6K A;  2YPM A;  3IOS A;  3U6V A;  2L4C A;  2VL2 C;  1PKZ A;  2OJL A;  2PU9 C;  3A3T A;  1Q98 A;  1ACV A;  1O8W A;  4Z2R A;  1DE2 A;  4OD7 A;  4TR3 A;  4TR1 B;  3ZFL A;  1V9W A;  2DJ3 A;  3F6D A;  3RHC A;  3RGB C;  1Y25 A;  3ED3 A;  3ZL5 A;  1YJ6 A;  1AQV A;  2LJA A;  5ID2 A;  3CMI A;  4NV2 A;  4DSR A;  2R37 A;  1YZX A;  2VAF A;  3ZLP A;  1SK2 A;  1ILO A;  4L8E A;  3TKS E;  4ECJ A;  3QR6 A;  2C0E A;  4Q5F A;  4OFN A;  3QFB C;  5AIV A;  3ERW A;  4TR4 A;  2BJX A;  1N2A A;  5CAX A;  1SKS B;  2LS5 A;  1B48 A;  1X5D A;  2G0F A;  3EU3 A;  2M80 A;  4E8E A;  3IE3 A;  1GUL A;  1OE8 A;  2DMM A;  1EEJ A;  4TR0 A;  1XWK A;  3N9J A;  4IJI A;  2FNO A;  1NM3 A;  1R5A A;  2XBQ A;  2HSN A;  1NW2 A;  3TJB A;  2HSY A;  5IMZ A;  1G6Y A;  3CSJ A;  3UEM A;  3UAR A;  2NBS A;  1EOG A;  1F37 A;  4JBB A;  2HRF A;  3LXZ A;  5BMU A;  3RPN A;  1YF0 A;  2LQQ A;  4PGT A;  2VL3 A;  1X5C A;  4KH7 A;  4N30 A;  2A2P A;  1SJ6 A;  2B6M A;  4PQH A;  2H73 A;  1YEW C;  4ULX A;  2WRT A;  3CRT A;  3GKX A;  4GQF A;  1XVQ A;  3RBT A;  5G1L A;  4LL1 B;  1M2A A;  3HMJ G;  1BG1 A;  1UN2 A;  1K0C A;  5IMV A;  4EC0 A;  1EWX A;  1Z7P A;  1TJD A;  1UC7 A;  1BX9 A;  2HQT A;  1YVL A;  4L5L A;  1XIY A;  3RPP A;  3LG6 A;  5IO0 A;  1ZYN A;  1T1V A;  4G19 A;  1XW6 A;  3E0U A;  5ABR A;  3MSZ A;  4KUN A;  4X1U A;  1PRX A;  3LJR A;  2VO4 A;  1A23 A;  5J3R A;  2OE1 A;  3ZFB A;  5CRG A;  3Q19 A;  1J08 A;  1GWC A;  1SEN A;  2X8C A;  4G9H A;  4GXZ A;  1TRS A;  2I4A A;  1RK4 A;  2CVD A;  1HNC A;  4WF5 A;  1M3J A;  4LA1 A;  1LBK A;  5BRT A;  3ZVJ A;  3EVI A;  3MWH A;  4J57 E;  4I5Q A;  2AYT A;  2L57 A;  2CZ3 A;  1AC1 A;  9GSS A;  1ERW A;  4IQA A;  2R3X A;  1K0D A;  2CQ9 A;  3IBH A;  1EOH A;  6GSW A;  7GSS A;  1X5E A;  1C72 A;  1T8E B;  2NTO A;  1JZR A;  2HYX A;  5ECI B;  3C73 A;  3DIE A;  4FYC A;  4TR1 A;  3TKS A;  3TDG A;  1TU7 A;  4BA7 A;  3EWL A;  4HUA A;  1G7O A;  4ECC A;  2MZC A;  3DML A;  2IPA A;  2OKA A;  2K18 A;  4G2E A;  2PN8 A;  1PFO A;  3Q18 A;  5IO2 A;  4GQC A;  4XS6 A;  3VFI A;  3TU3 B;  3KM6 A;  2XPE A;  4TXV A;  2QKE A;  5HFG A;  3FK8 A;  1K0A A;  3FR6 A;  3US3 A;  2C0F A;  4AKI A;  4JR4 A;  1VF3 A;  2VCT A;  1OC3 A;  3FHK A;  5F07 A;  3VWW A;  4MDC A;  1SL0 B;  3LW9 A;  3P2A A;  1ZYP A;  2DJ0 A;  4FQU A;  2C3Q A;  1VGL A;  2YZH A;  1OE7 A;  3J7Y b;  3DGQ A;  2O7K A;  2WVY A;  5JCW A;  1JZW A;  4J56 E;  1E6B A;  2H66 A;  5A1N B;  4PTS A;  3D6I A;  3HZ8 A;  1NHO A;  4MH3 A;  3JCM L;  2KLX A;  2H1G A;  5CRH A;  4CY6 A;  3IR4 A;  1JHB A;  3VLN A;  1SJZ A;  3APO A;  4KCE A;  5B8B A;  2K6V A;  3CTG A;  4FH8 A;  1WPI A;  3HVV A;  2DBC A;  5C00 A;  2GSQ A;  5E59 A;  2B5Y A;  2LST A;  2CX3 A;  3ERF A;  1A0R P;  2H74 A;  3DVW A;  3KJY A;  4AKH A;  4K5S A;  4PQ1 A;  2VL9 A;  4LL4 B;  2JSY A;  4K9Z A;  2WZ9 A;  2CVK A;  1A2J A;  3F63 A;  3HCZ A;  3ZZX A;  2MYG A;  1EV9 A;  4GWR A;  1PX6 A;  3VWX A;  1F6M C;  2L4Q A;  2YWN A;  2A4V A;  3H4K A;  2HXK A;  2V2G A;  2O87 A;  2YWM A;  4V2L A;  3F3Q A;  6GSY A;  2H19 A;  3CHX C;  2H6X A;  1TI1 A;  5IOW A;  1TU8 A;  4USS A;  2B5E A;  3C1S A;  3DYR A;  4MP4 A;  4PI2 C;  5HR2 A;  3NIV A;  3UAP A;  4RI6 A;  2HI7 A;  1A0F A;  1GSY A;  5J47 A;  4V2M A;  5ECS A;  2GZP A;  1DSB A;  4L5O A;  4ZBB A;  2G2Q A;  2MBT A;  2L5O A;  4JZQ A;  1Z9H A;  2IMI A;  1N25 A;  1GLQ A;  2CX4 A;  4POL A;  4PUR A;  3F4R A;  1GNE A;  4IS0 A;  5INY A;  5IPH A;  5D93 A;  4OFM A;  5EY6 A;  3MYD A;  3A2V A;  3A5I A;  3GA4 A;  4EXJ A;  5J9B A;  2R4V A;  4G0K A;  1XWC A;  4KGI A;  3GKN A;  4OCE A;  1G7E A;  2B7J A;  3F4S A;  2RUE A;  2VLU A;  1FOH A;  2EIR A;  2HRN A;  4JE1 A;  1GP1 A;  4X0X A;  1GSQ A;  1WMJ A;  1B9X C;  1T3B A;  3RDW A;  5H5S A;  2H1B A;  4JU5 A;  1USB A;  1B4P A;  4E68 A;  4IW9 A;  4P3Y B;  2WVZ A;  2DKI A;  1AQW A;  3W6G A;  5IMF A;  2O8V B;  3I43 A;  5KN1 A;  4YQM A;  6GSU A;  1G6W A;  1THX A;  4K1F A;  1TI3 A;  5LCZ A;  4Z2U A;  4FYU A;  2DJ1 A;  2DJJ A;  4HS1 A;  4F9Z A;  3VPQ A;  4XHM A;  1R4W A;  2RM5 A;  1GSS A;  5A4V A;  5GAN D;  1Y6E A;  5ELG A;  2KP1 A;  2O85 A;  4HZ4 A;  1EEM A;  4AKX B;  4TOP A;  4CY8 A;  4ISD A;  1MTC A;  2X8G A;  2X64 A;  4FYB A;  4WET A;  3D4T A;  1VF2 A;  3WD6 A;  1R5P A;  2PPT A;  2VUP A;  5CRW A;  4CW9 A;  3LOR A;  4KA0 A;  1OKT A;  3BBY A;  2HT9 A;  2AHE A;  1SVO A;  2TRC P;  1OAZ A;  1TRW A;  1XXU A;  1FB6 A;  3IC8 A;  3CSH A;  1QUW A;  4K7N A;  1PQN A;  5IM9 A;  22GS A;  2P0G A;  3H8Q A;  1V98 A;  2RM6 A;  3KTB A;  2H8L A;  2DC5 A;  3KIJ A;  4HSC X;  2RLI A;  3EYT A;  5IMC A;  3G7Y A;  4HOJ A;  4MF6 A;  2IL3 A;  4HQZ A;  2EIO A;  3DD3 A;  4IBP A;  2FA8 A;  1SU9 A;  3KXO A;  3FR9 A;  3D5J A;  1O6J A;  4ZXG A;  3GRX A;  3BCI A;  4PXO A;  2TRX A;  3HXS A;  5HR3 A;  2JAD A;  4MJC A;  4XS1 A;  1B8X A;  4I2T A;  2GZZ A;  5G2Z A;  1KBN A;  3GL5 A;  2FWE A;  4QMK A;  4GRF A;  3ZRD A;  3UL3 A;  4BVX B;  4BWQ A;  5E4W A;  3L4N A;  1I5G A;  3TOU A;  2PVO C;  6GSS A;  1U3A A;  3HVN A;  4CDO A;  2HZF A;  3EUR A;  2I1U A;  4KDY A;  4AF2 A;  2WCI A;  3GKM A;  5D9T A;  3KP9 A;  3P90 A;  4Q5N A;  3QCP A;  1GLP A;  3UVT A;  1G0T A;  4PHZ C;  4ECB A;  1GSU A;  2QGV A;  4AJ7 A;  3OR5 A;  1R26 A;  1IYH A;  3ME7 A;  4RQR A;  4OO4 A;  5J9C A;  2VCX A;  5H5R A;  4K7O A;  2YWI A;  3DVX A;  2MMA A;  4MMM A;  2XHF A;  4HJM A;  1SYX A;  4TW5 A;  2R2J A;  2QC7 A;  1BG5 A;  2GT6 A;  3TJJ A;  3D4M A;  1V58 A;  3D22 A;  2OAC A;  1T00 A;  2UV8 G;  1SVM A;  1JLW A;  4QQ7 A;  2EFD A;  3HHV A;  1TOF A;  1Z6M A;  5ENU A;  2C1Y A;  3UJ1 A;  3FZ5 A;  4IKH A;  2R0C A;  1TXX A;  4ZB8 A;  3ME8 A;  5G1K A;  4QL7 A;  1VF4 A;  3GHA A;  4F82 A;  3KP8 A;  3H79 A;  2OA7 A;  1F3A A;  4K6X A;  3DWV A;  2O5V A;  3FW2 A;  4K0G A;  1K0M A;  2GQM A;  4FO5 A;  2IMD A;  3APS A;  1I1I P;  1FO5 A;  1KEB A;  2EC4 A;  2HSH A;  2L5L A;  4ZBD A;  2CAQ A;  2Z9S A;  4G0I A;  3P7X A;  3VWU A;  2X49 A;  2X4A A;  1R7H A;  2A2R A;  2B5X A;  1EP8 A;  4I97 A;  5HFK A;  1K3L A;  3TKQ A;  5F8B A;  2OAD A;  5KN2 A;  2FWH A;  3TGZ A;  1AIU A;  4I8B A;  2L59 A;  1SKR B;  3DEX A;  2AV4 A;  3GKK A;  2DIZ A;  1RQM A;  12GS A;  2LV3 A;  4MZW A;  4NHZ A;  4ACS A;  1ON4 A;  2NDO A;  3CTF A;  1U6T A;  1WOU A;  3KGK A;  3GH6 A;  2CA8 A;  1EZK A;  5B7C A;  5FT3 A;  1XPV A;  2N5F A;  2OBI A;  4CHS A;  1YDK A;  2VCV A;  2FGX A;  1HNA A;  3BOA A;  1MD3 A;  4HZ2 A;  2WGR A;  2P31 A;  1O7U A;  3GTU B;  2NVL A;  1F3B A;  2R0P A;  3KH9 A;  1K3Y A;  2I81 A;  4N3Z A;  5AIS A;  1X0R A;  3APQ A;  2FD3 A;  3FYG A;  1YEP A;  2R0G A;  1XW9 A;  3FR3 A;  2V32 A;  1PL1 A;  5ELA A;  1UA5 A;  1TK5 B;  3C71 A;  4K5R A;  1SVL A;  3O76 A;  1O85 A;  2VLT A;  4GSN A;  3QDN A;  4KF9 A;  5DJM A;  4GF0 A;  5EVO A;  5A4U A;  5CNW A;  5G31 A;  4BWS A;  4IVF A;  2H70 A;  2JZS A;  4BVX A;  2K8V A;  4WKW A;  11GS A;  3M8N A;  2JZR A;  2A2S A;  2KOK A;  3GST A;  5IIZ A;  4WR4 A;  2H01 A;  2YZU A;  5JCU A;  4K2D A;  3IV4 A;  3EC3 A;  5HR0 A;  4XIH A;  1BYE A;  4W66 A;  4E8H A;  3TRX A;  4KW6 A;  3IDV A;  18GS A;  2VLV A;  4IN0 A;  3CBU A;  3EU4 A;  2DML A;  2CV4 A;  5ECN B;  3FMW A;  2K9F A;  2MBS A;  1PD2 1;  5DJL A;  1QMV A;  5DQY A;  1T4Y A;  2CVB A;  3SBC A;  5DAK B;  1XBS A;  2GVP A;  5HFI A;  4ZBA A;  2XPD A;  5KOW A;  4MLY A;  4MH2 A;  4POM A;  3L9S A;  2WDU A;  3F3R A;  5F0G A;  3IA1 A;  4ILF A;  4DSQ A;  2B1L A;  2KUC A;  5IMA A;  1YKA A;  5IOX A;  3LGC A;  3RHB A;  2C3T A;  5GAP D;  4N0V A;  2H75 A;  4EF0 A;  1PX7 A;  3GL3 A;  2MMO A;  5J41 A;  4ML1 A;  3F6F A;  5J40 A;  1ST9 A;  1M2B A;  1Y1U A;  2PGT A;  3GIX A;  2YV7 A;  4HEA 2;  2IWT A;  2VKZ G;  4F0C A;  1Z6N A;  5DDL A;  1YF1 A;  4MJB A;  3F9U A;  5HR1 A;  5A5H B;  1O81 A;  3RAZ A;  2F8A A;  2WS2 A;  5ECP B;  1JFU A;  1URM A;  2LQO A;  1QXH A;  3QOU A;  1ZL9 A;  4MK3 A;  10GS A;  4ZL9 A;  4AKG A;  1U88 A;  4RUV A;  1X9M B;  1GSF A;  2CZ2 A;  2PER A;  3J7Y k;  4ICY A;  2LNT A;  5GST A;  2N5A A;  3BCK A;  1B4Q A;  2N5B A;  3ZTL A;  3CSI A;  2H0H A;  3VK9 A;  4V1A g;  5G5F A;  4O5R A;  2HSM B;  4G10 A;  3WGX A;  3LSZ A;  2C80 A;  1A24 A;  4MZC A;  3LYP A;  2R6K A;  4DEJ A;  1A8Y A;  3EMP A;  2VD1 A;  4EDY A;  17GS A;  1GSD A;  1SD9 A;  2LRC A;  3H1N A;  1BAY A;  4I2U A;  5J5N A;  2F51 A;  3GTU A;  3ZML A;  5IQY A;  1SL1 B;  4TXO B;  4ID0 A;  4HI7 A;  3WT2 A;  5D9W A;  1M3I A;  2VM1 A;  1TTZ A;  5CYY A;  1M2D A;  2IMF A;  2L6C A;  4XRA A;  4ZB7 A;  2P5Q A;  3IRA A;  1HQO A;  4JR6 A;  5KOX A;  4XCS A;  2WW1 A;  2KHP A;  2LRT A;  2GQK A;  2ZNM A;  1M99 A;  5D9V A;  1QK8 A;  1OYJ A;  5F06 A;  2VCQ A;  2E7P A;  6GSV A;  4RI7 A;  5FWG A;  2HRK B;  2YP6 A;  3EIN A;  5A4W A;  4EUY A;  4WR5 A;  4A5P A;  4O7H A;  2JAC A;  3K8N A;  1AXD A;  4IGJ A;  2IFQ B;  5D96 A;  4OWY A;  5ECR B;  1K0B A;  2WB9 A;  4JED A;  3E9J B;  3WGD A;  2XC2 A;  2I9H A;  1WWJ A;  5AGY A;  3W8S A;  5LNK e;  3MDK A;  1I9D A;  3GX8 A;  4GTU A;  4L0U A;  5CO3 A;  5GZZ B;  4ZL7 A;  2F8F A;  3KZQ A;  4Z2T A;  2XBI A;  5D8I A;  3VI7 A;  1XOB A;  1PSQ A;  3TJF A;  2JL4 A;  5A5K A;  5DAK A;  1QQ2 A;  2YV9 A;  3HY2 A;  4MPG A;  2QA1 A;  1W89 A;  2DLX A;  2YNX A;  1A2M A;  3M9K A;  3WYW A;  4YQU A;  2B7K A;  4XS4 B;  4D73 B;  4BL7 B;  3ZVJ D;  2NPB A;  1PL2 A;  2TIR A;  3M1G A;  1XOA A;  2WUL A;  4LMV A;  5COH A;  4MPF A;  2PVQ A;  5G5E A;  1UVZ A;  1H4O A;  2AB6 A;  4TVE A;  5A1N A;  4EIP A;  3HJM A;  3TRQ A;  2JZT A;  1XFL A;  3HDC A;  2LTK A;  3MAK A;  1T4Z A;  4Q5Q A;  3E3E A;  4POK A;  4WEY A;  2IME A;  1FVK A;  1XWB A;  2E2G A;  3W8J A;  2OE0 A;  3R2Q A;  2GS3 A;  1F9M A;  1TK0 B;  2FLS A;  2RUF A;  4YQV A;  1O8X A;  2IMK A;  2REM A;  4PNG A;  4XRD A;  1E2Y A;  4O92 A;  3V1W A;  1Q4J A;  4BIK A;  1QFN A;  2HSM A;  2WJU A;  3IHQ A;  3GFK A;  3TJK A;  3KEB A;  3UOM A;  5J4V A;  3KMO A;  1M7T A;  1WRY A;  3QAG A;  1FAA A;  2GSR A;  1RW1 A;  3PGT A;  4TXO A;  5J4U A;  3O3T A;  4GST A;  3ZMK A;  4WBJ A;  4WXT A;  5JCG A;  5D9X A;  2O36 A;  5F05 A;  4IP1 A;  4HJ2 A;  4GCI A;  1HD2 A;  2H1D A;  1LJR A;  3ZIT A;  1QGV A;  2IN3 A;  3FZ4 A;  2FHE A;  4OMV A;  4NWY A;  5JWO B;  4MF7 A;  1H75 A;  2E0Q A;  2H30 A;  2C3N A;  2H0G A;  2V1M A;  2V6O A;  2HRK A;  2GT5 A;  3FRC A;  2MMN A;  4TKY A;  4G01 A;  2VD0 A;  2LJR A;  2FWG A;  2C0D A;  5DCH A;  2QA2 A;  3WGE A;  2IFQ A;  4N10 A;  2DIY A;  1W4V A;  2FUG 2;  4YKF A;  2YWO A;  1S3C A;  4G0L A;  3F4T A;  3PR8 A;  3I6A A;  2P5R A;  3IK9 A;  1SKW B;  2GQL A;  3HZ4 A;  3GUS A;  4JRR A;  3A2X A;  2ON7 A;  1KTE A;  1JZD A;  2H1L A;  1TK8 B;  5A34 B;  4AJ8 A;  3ISO A;  1ZMA A;  1DE1 A;  4KCA A;  3LXT A;  4V2N A;  1AQX A;  2FA4 A;  3NOF A;  2EFH A;  2YCD A;  2OE3 A;  2LEG A;  1ZZY A;  2F3M A;  2J9H A;  4XS4 A;  4D73 A;  3GH9 A;  5G30 A;  4IJ3 A;  4MNN A;  2M46 A;  3GN3 A;  4NXI A;  1MDJ A;  4BL7 A;  1GNW A;  1V57 A;  1PA3 A;  4ML6 A;  5H5Q A;  2ZUP A;  2C8U A;  3EMX A;  1NHY A;  3HVX A;  3NZN A;  4TN8 A;  1WIK A;  3DRN A;  2H1A A;  1JLV A;  1XG8 A;  5ECO B;  5AIX A;  2YOI A;  2WVX B;  4OCF A;  3G7J A;  5JWR B;  4FIW A;  1J0F A;  4F0B A;  2WFC A;  3PIN A;  5IMD A;  4YAP A;  8GSS A;  4F03 A;  4IQ1 A;  3BJ5 A;  2CAI A;  5AN1 A;  1MDK A;  1AW9 A;  3FY7 A;  4RQX A;  3TB2 A;  1WE0 A;  4O32 A;  1TP9 A;  3KD0 A;  3G7I A;  2OBK A;  3QPM A;  1ABA A;  5HQP A;  3O6T A;  4ZIJ A;  1OVN A;  4ZL8 A;  3PH9 A;  3QFA C;  1ZCP A;  4EL1 A;  2PWJ A;  1MEK A;  3DXB A;  1M9A A;  1YQ1 A;  1FVJ A;  3LYK A;  5KN3 A;  2EFE A;  3HKR A;  3RFR C;  3GSS A;  1BF5 A;  1FOV A;  1A2L A;  1S3R A;  5KN0 A;  2YAN A;  1GUH A;  4NV5 A;  3C7M A;  2LRN A;  4KDU A;  1FW1 A;  1NSW A;  4BVY B;  6GSX A;  3QAV A;  2RII A;  4ZIL A;  4YKG A;  1V40 A;  3IK7 A;  2VM2 A;  1X9S B;  2UZ8 A;  1OC9 B;  2LJK A;  3VI5 A;  2M72 A;  2CT6 A;  3GNJ A;  4ZB9 A;  4MZB A;  1FHE A;  3GV1 A;  2D2Z A;  4EDZ A;  1U3I A;  3DKS A;  1F2E A;  2O3E A;  20GS A;  4DVC A;  3VWV A;  4KB3 A;  1EP7 A;  1SK0 A;  2LNS A;  3UIW A;  1GTU A;  3ZYW A;  3GMF A;  5CRD A;  3ZRE A;  4HDE A;  3UBL A;  1PMT A;  5GSS A;  1A8L A;  1GTB A;  4WBR D;  2LKU A;  2FCH A;  1HNB A;  2H72 A;  4ZB6 A;  1GTA A;  6GST A;  2WW2 A;  3P8W A;  2HE3 A;  1GH2 A;  5B8A A;  3TJG A;  2OT3 A;  2C0G A;  1M9B A;  3FEU A;  2HZE B;  1BJX A;  5J4Y A;  2GDR A;  1MDI A;  1ERU A;  5A34 A;  3EPT A;  4GSS A;  3ZIV A;  1YEX A;  1TKD B;  2IJY A;  1OC8 A;  2DJ2 A;  3HVS A;  4IP6 A;  5L71 A;  4K2X A;  14GS A;  1WJK A;  1SK1 A;  4GLT A;  4KDX A;  4KX4 A;  3HD5 A;  2DKH A;  3TKR A;  5C04 A;  1VRS D;  2VCZ A;  4XTS A;  3L9V A; 
#chains in the Genus database with same CATH homology
 5ECQ B;  3UBK A;  3FKF A;  1GUK A;  3I9V 2;  2HNL A;  2GGT A;  5CRE A;  2F9S A;  1CQH A;  4WF4 A;  3I69 A;  1S3A A;  1V2A A;  3L78 A;  2GSS A;  1TXU A;  4LLR A;  2E2M A;  2X99 A;  3KCM A;  4DSS B;  4EO3 A;  1BED A;  4KSO A;  4O5Q A;  3TKS C;  2AUV A;  1ZGN A;  2H6Y A;  3GX0 A;  1ERV A;  4L0W A;  2O89 A;  4LMW A;  3FZA A;  2JU5 A;  3R3E A;  3ERG A;  1GL8 A;  2B3S A;  3M9J A;  2QSI A;  2H0I A;  3QAW A;  2DSA A;  2L6D A;  3L0H A;  5JWQ B;  1Z7R A;  2BMX A;  3Q74 A;  1XWG A;  13GS A;  4Z7X A;  1Z3E A;  1M0U A;  4BPY A;  5DAL B;  4V1A p;  3BD2 A;  4KE3 A;  1PN0 A;  1BQ7 A;  2HRA A;  3IHG A;  5B6N A;  2K8S A;  2H76 A;  3IXR A;  4BVY A;  2DJK A;  1EGO A;  1TRU A;  1TDI A;  1MD4 A;  4X43 A;  2HFD A;  1OC9 A;  3EE2 A;  1ERT A;  4AJ6 A;  4K0N A;  5DVB A;  1GSE A;  4QL9 A;  2B1K A;  16GS A;  1JZO A;  4MJA A;  3FZ9 A;  1KNG A;  5DQS A;  1Z5Y E;  5KEJ A;  1SL2 B;  1OKD A;  1S3D A;  2GZY A;  5LD0 A;  3KTL A;  4N11 A;  1HYU A;  3IPZ A;  5CP1 A;  4K7I A;  1K0N A;  3D21 A;  4HU9 A;  1B9Y C;  2MMZ A;  2IIY A;  3QD9 A;  3IAM 2;  2VIM A;  2VCW A;  5FHI A;  2EFC A;  2LUS A;  3VPT A;  4HQS A;  1SJI A;  19GS A;  3LWA A;  3HJO A;  1DUG A;  2GLR A;  3F8U A;  5ECL B;  4AI6 A;  2EIQ A;  1K3O A;  4MAB A;  4GDF A;  2X8H A;  5DBQ A;  1XVW A;  4KAE A;  3C1R A;  1AUC A;  3MNG A;  1TRV A;  1YY7 A;  2YJH A;  2HZE A;  2YJ7 A;  2H6Z A;  1SYR A;  4MJE A;  2KP2 A;  3CRU A;  4OO5 A;  4MA9 A;  3L9U A;  1YKC A;  2ALB A;  1GTI A;  3C8E A;  5EL8 A;  4I6X A;  3U5R E;  2FWF A;  1SD8 A;  3H93 A;  5B6M A;  3S9F A;  4NPB A;  2PMT A;  3N5O A;  1CQG A;  3WT1 A;  1T7P B;  5IPG A;  5ID2 B;  5ECM B;  4YAV A;  3CYN A;  1U87 A;  3TRP A;  2I3Y A;  1PGT A;  3TUE A;  4NMU A;  2VOC A;  3UVH A;  1XZO A;  1PN9 A;  4F2I A;  1PKW A;  1XCC A;  3TOT A;  5ECK B;  4NHW A;  4IHU A;  1ZOF A;  4O5U A;  1VF1 A;  4EKZ A;  4TRX A;  3MIX A;  3QMX A;  4POB A;  2AAW A;  1N8J A;  1K0O A;  5A5H A;  3KMN A;  3VUR A;  4HU7 A;  1GUM A;  3AY8 A;  3CXG A;  4DSS A;  4MF5 A;  2HLS A;  4J2F A;  2ON5 A;  1O73 A;  3A5W A;  2HSN B;  4KSM A;  1J9B A;  2ES7 A;  2FY6 A;  2A4H A;  1FG4 A;  4EE0 A;  3TKP A;  4IEL A;  5BMU B;  4MCU A;  4H86 A;  5EPF A;  3IAS 2;  1DBY A;  2BTO T;  2C4J A;  2YN1 A;  5DAL A;  2PUK C;  2GST A;  4PX1 A;  1LU4 A;  3HYP A;  4YH2 A;  3Q6O A;  1FB0 A;  3KH7 A;  1AAZ A;  4PQI A;  3ZIJ A;  4N0Z A;  4PUA A;  2V41 A;  3HA9 A;  2GTU A;  3LFL A;  4KND A;  4EIQ A;  2AJQ B;  1GRX A;  1ML6 A;  1EGR A;  4PNF A;  1ZYQ B;  4Q5R A;  3PPU A;  5DCG A;  1XW5 A;  2VL2 A;  3GUR A;  4PUF C;  3D0Z A;  3F0I A;  3M3M A;  1WP0 A;  1XWA A;  3IC4 A;  4X4J A;  1X9W B;  4OFT A;  1TW9 A;  1ZYE A;  1THO A;  4EVM A;  3GYK A;  4K8M A;  2R5G A;  2PBJ A;  2J23 A;  5ECH B;  3G9B A;  3LEF A;  3A2W A;  2JSZ A;  5D73 A;  1IYI A;  2H71 A;  4NAX A;  3SWL A;  4AGS A;  4ECI A;  3CWG A;  3TCO A;  1EV4 A;  3HJP A;  3M0F A;  2ZCT A;  3UMA A;  3LQ7 A;  2V6K A;  2YPM A;  3IOS A;  3U6V A;  2L4C A;  2VL2 C;  1PKZ A;  2OJL A;  2PU9 C;  3A3T A;  1Q98 A;  1ACV A;  1O8W A;  4Z2R A;  1DE2 A;  4OD7 A;  4TR3 A;  4TR1 B;  3ZFL A;  1V9W A;  2DJ3 A;  3F6D A;  3RHC A;  1Y25 A;  3ED3 A;  3ZL5 A;  1YJ6 A;  1AQV A;  2LJA A;  5ID2 A;  3CMI A;  4NV2 A;  4DSR A;  2R37 A;  1YZX A;  2VAF A;  3ZLP A;  1SK2 A;  1ILO A;  4L8E A;  3TKS E;  4ECJ A;  3QR6 A;  2C0E A;  4Q5F A;  4OFN A;  3QFB C;  5AIV A;  3ERW A;  4TR4 A;  2BJX A;  1N2A A;  5CAX A;  1SKS B;  2LS5 A;  1B48 A;  1X5D A;  2G0F A;  3EU3 A;  2M80 A;  4E8E A;  3IE3 A;  1GUL A;  1OE8 A;  2DMM A;  1EEJ A;  4TR0 A;  1XWK A;  3N9J A;  4IJI A;  2FNO A;  1NM3 A;  1R5A A;  2XBQ A;  2HSN A;  1NW2 A;  3TJB A;  2HSY A;  5IMZ A;  1G6Y A;  3CSJ A;  3UEM A;  3UAR A;  2NBS A;  1EOG A;  1F37 A;  4JBB A;  2HRF A;  3LXZ A;  5BMU A;  3RPN A;  1YF0 A;  2LQQ A;  4PGT A;  2VL3 A;  1X5C A;  4KH7 A;  4N30 A;  2A2P A;  1SJ6 A;  2B6M A;  4PQH A;  2H73 A;  4ULX A;  2WRT A;  3CRT A;  3GKX A;  4GQF A;  1XVQ A;  3RBT A;  5G1L A;  4LL1 B;  1M2A A;  3HMJ G;  1BG1 A;  1UN2 A;  1K0C A;  5IMV A;  4EC0 A;  1EWX A;  1Z7P A;  1TJD A;  1UC7 A;  1BX9 A;  2HQT A;  1YVL A;  4L5L A;  1XIY A;  3RPP A;  3LG6 A;  5IO0 A;  1ZYN A;  1T1V A;  4G19 A;  1XW6 A;  3E0U A;  5ABR A;  3MSZ A;  4KUN A;  4X1U A;  1PRX A;  3LJR A;  2VO4 A;  1A23 A;  5J3R A;  2OE1 A;  3ZFB A;  5CRG A;  3Q19 A;  1J08 A;  1GWC A;  1SEN A;  2X8C A;  4G9H A;  4GXZ A;  1TRS A;  2I4A A;  1RK4 A;  2CVD A;  1HNC A;  4WF5 A;  4LA1 A;  1LBK A;  5BRT A;  3ZVJ A;  3EVI A;  3MWH A;  4J57 E;  4I5Q A;  2AYT A;  2L57 A;  2CZ3 A;  1AC1 A;  9GSS A;  1ERW A;  4IQA A;  2R3X A;  1K0D A;  2CQ9 A;  3IBH A;  1EOH A;  6GSW A;  7GSS A;  1X5E A;  1C72 A;  1T8E B;  2NTO A;  1JZR A;  2HYX A;  5ECI B;  3C73 A;  3DIE A;  4FYC A;  4TR1 A;  3TKS A;  3TDG A;  1TU7 A;  4BA7 A;  3EWL A;  4HUA A;  1G7O A;  4ECC A;  2MZC A;  3DML A;  2IPA A;  2OKA A;  2K18 A;  4G2E A;  2PN8 A;  3Q18 A;  5IO2 A;  4GQC A;  4XS6 A;  3VFI A;  3TU3 B;  3KM6 A;  2XPE A;  4TXV A;  2QKE A;  5HFG A;  3FK8 A;  1K0A A;  3FR6 A;  3US3 A;  2C0F A;  4AKI A;  4JR4 A;  1VF3 A;  2VCT A;  1OC3 A;  3FHK A;  5F07 A;  3VWW A;  4MDC A;  1SL0 B;  3LW9 A;  3P2A A;  1ZYP A;  2DJ0 A;  4FQU A;  2C3Q A;  1VGL A;  2YZH A;  1OE7 A;  3J7Y b;  3DGQ A;  2O7K A;  5JCW A;  1JZW A;  4J56 E;  1E6B A;  2H66 A;  5A1N B;  4PTS A;  3D6I A;  3HZ8 A;  1NHO A;  4MH3 A;  3JCM L;  2KLX A;  2H1G A;  5CRH A;  4CY6 A;  3IR4 A;  1JHB A;  3VLN A;  1SJZ A;  3APO A;  4KCE A;  5B8B A;  2K6V A;  3CTG A;  4FH8 A;  1WPI A;  3HVV A;  2DBC A;  5C00 A;  2GSQ A;  5E59 A;  2B5Y A;  2LST A;  2CX3 A;  3ERF A;  1A0R P;  2H74 A;  3DVW A;  3KJY A;  4AKH A;  4K5S A;  4PQ1 A;  2VL9 A;  4LL4 B;  2JSY A;  4K9Z A;  2WZ9 A;  2CVK A;  1A2J A;  3F63 A;  3HCZ A;  3ZZX A;  2MYG A;  1EV9 A;  4GWR A;  1PX6 A;  3VWX A;  1F6M C;  2L4Q A;  2YWN A;  2A4V A;  3H4K A;  2HXK A;  2V2G A;  2O87 A;  2YWM A;  4V2L A;  3F3Q A;  6GSY A;  2H19 A;  2H6X A;  1TI1 A;  5IOW A;  1TU8 A;  4USS A;  2B5E A;  3C1S A;  3DYR A;  4MP4 A;  5HR2 A;  3NIV A;  3UAP A;  4RI6 A;  2HI7 A;  1A0F A;  1GSY A;  5J47 A;  4V2M A;  5ECS A;  2GZP A;  1DSB A;  4L5O A;  4ZBB A;  2G2Q A;  2MBT A;  2L5O A;  4JZQ A;  1Z9H A;  2IMI A;  1N25 A;  1GLQ A;  2CX4 A;  4POL A;  4PUR A;  3F4R A;  1GNE A;  4IS0 A;  5INY A;  5IPH A;  5D93 A;  4OFM A;  5EY6 A;  3MYD A;  3A2V A;  3A5I A;  3GA4 A;  4EXJ A;  5J9B A;  2R4V A;  4G0K A;  1XWC A;  4KGI A;  3GKN A;  4OCE A;  1G7E A;  2B7J A;  3F4S A;  2RUE A;  2VLU A;  1FOH A;  2EIR A;  2HRN A;  4JE1 A;  1GP1 A;  4X0X A;  1GSQ A;  1WMJ A;  1B9X C;  1T3B A;  3RDW A;  5H5S A;  2H1B A;  4JU5 A;  1USB A;  1B4P A;  4E68 A;  4IW9 A;  4P3Y B;  2DKI A;  1AQW A;  3W6G A;  5IMF A;  2O8V B;  3I43 A;  5KN1 A;  4YQM A;  6GSU A;  1G6W A;  1THX A;  4K1F A;  1TI3 A;  5LCZ A;  4Z2U A;  4FYU A;  2DJ1 A;  2DJJ A;  4HS1 A;  4F9Z A;  3VPQ A;  4XHM A;  1R4W A;  2RM5 A;  1GSS A;  5A4V A;  5GAN D;  1Y6E A;  5ELG A;  2KP1 A;  2O85 A;  4HZ4 A;  1EEM A;  4AKX B;  4TOP A;  4CY8 A;  4ISD A;  1MTC A;  2X8G A;  2X64 A;  4FYB A;  4WET A;  3D4T A;  1VF2 A;  3WD6 A;  1R5P A;  2PPT A;  2VUP A;  5CRW A;  4CW9 A;  3LOR A;  4KA0 A;  1OKT A;  3BBY A;  2HT9 A;  2AHE A;  1SVO A;  2TRC P;  1OAZ A;  1TRW A;  1XXU A;  1FB6 A;  3IC8 A;  3CSH A;  1QUW A;  4K7N A;  1PQN A;  5IM9 A;  22GS A;  2P0G A;  3H8Q A;  1V98 A;  2RM6 A;  3KTB A;  2H8L A;  2DC5 A;  3KIJ A;  2RLI A;  3EYT A;  5IMC A;  3G7Y A;  4HOJ A;  4MF6 A;  2IL3 A;  4HQZ A;  2EIO A;  3DD3 A;  4IBP A;  2FA8 A;  1SU9 A;  3KXO A;  3FR9 A;  3D5J A;  1O6J A;  4ZXG A;  3GRX A;  3BCI A;  4PXO A;  2TRX A;  3HXS A;  5HR3 A;  2JAD A;  4MJC A;  4XS1 A;  1B8X A;  4I2T A;  2GZZ A;  5G2Z A;  1KBN A;  3GL5 A;  2FWE A;  4QMK A;  4GRF A;  3ZRD A;  3UL3 A;  4BVX B;  4BWQ A;  5E4W A;  3L4N A;  1I5G A;  3TOU A;  2PVO C;  6GSS A;  1U3A A;  4CDO A;  2HZF A;  3EUR A;  2I1U A;  4KDY A;  4AF2 A;  2WCI A;  3GKM A;  5D9T A;  3KP9 A;  3P90 A;  4Q5N A;  3QCP A;  1GLP A;  3UVT A;  1G0T A;  4ECB A;  1GSU A;  2QGV A;  4AJ7 A;  3OR5 A;  1R26 A;  1IYH A;  3ME7 A;  4RQR A;  4OO4 A;  5J9C A;  2VCX A;  5H5R A;  4K7O A;  2YWI A;  3DVX A;  2MMA A;  4MMM A;  2XHF A;  4HJM A;  1SYX A;  4TW5 A;  2R2J A;  2QC7 A;  1BG5 A;  2GT6 A;  3TJJ A;  3D4M A;  1V58 A;  3D22 A;  2OAC A;  1T00 A;  2UV8 G;  1SVM A;  1JLW A;  4QQ7 A;  2EFD A;  3HHV A;  1TOF A;  1Z6M A;  5ENU A;  2C1Y A;  3UJ1 A;  3FZ5 A;  4IKH A;  2R0C A;  1TXX A;  4ZB8 A;  3ME8 A;  5G1K A;  4QL7 A;  1VF4 A;  3GHA A;  4F82 A;  3KP8 A;  3H79 A;  2OA7 A;  1F3A A;  4K6X A;  3DWV A;  2O5V A;  3FW2 A;  4K0G A;  1K0M A;  2GQM A;  4FO5 A;  2IMD A;  3APS A;  1FO5 A;  1KEB A;  2EC4 A;  2HSH A;  2L5L A;  4ZBD A;  2CAQ A;  2Z9S A;  4G0I A;  3P7X A;  3VWU A;  2X49 A;  2X4A A;  1R7H A;  2A2R A;  2B5X A;  1EP8 A;  4I97 A;  5HFK A;  1K3L A;  3TKQ A;  5F8B A;  2OAD A;  5KN2 A;  2FWH A;  3TGZ A;  1AIU A;  4I8B A;  2L59 A;  1SKR B;  3DEX A;  2AV4 A;  3GKK A;  2DIZ A;  1RQM A;  12GS A;  2LV3 A;  4MZW A;  4NHZ A;  4ACS A;  1ON4 A;  2NDO A;  3CTF A;  1U6T A;  1WOU A;  3KGK A;  3GH6 A;  2CA8 A;  1EZK A;  5B7C A;  5FT3 A;  1XPV A;  2N5F A;  2OBI A;  4CHS A;  1YDK A;  2VCV A;  2FGX A;  1HNA A;  3BOA A;  1MD3 A;  4HZ2 A;  2WGR A;  2P31 A;  1O7U A;  3GTU B;  2NVL A;  1F3B A;  2R0P A;  3KH9 A;  1K3Y A;  2I81 A;  4N3Z A;  5AIS A;  1X0R A;  3APQ A;  2FD3 A;  3FYG A;  1YEP A;  2R0G A;  1XW9 A;  3FR3 A;  2V32 A;  1PL1 A;  5ELA A;  1UA5 A;  1TK5 B;  3C71 A;  4K5R A;  1SVL A;  3O76 A;  1O85 A;  2VLT A;  4GSN A;  3QDN A;  4KF9 A;  5DJM A;  4GF0 A;  5EVO A;  5A4U A;  5CNW A;  5G31 A;  4BWS A;  4IVF A;  2H70 A;  2JZS A;  4BVX A;  2K8V A;  4WKW A;  11GS A;  3M8N A;  2JZR A;  2A2S A;  2KOK A;  3GST A;  5IIZ A;  4WR4 A;  2H01 A;  2YZU A;  5JCU A;  4K2D A;  3IV4 A;  3EC3 A;  5HR0 A;  4XIH A;  1BYE A;  4W66 A;  4E8H A;  3TRX A;  4KW6 A;  3IDV A;  18GS A;  2VLV A;  4IN0 A;  3CBU A;  3EU4 A;  2DML A;  2CV4 A;  5ECN B;  3FMW A;  2K9F A;  2MBS A;  1PD2 1;  5DJL A;  1QMV A;  5DQY A;  1T4Y A;  2CVB A;  3SBC A;  5DAK B;  1XBS A;  2GVP A;  5HFI A;  4ZBA A;  2XPD A;  5KOW A;  4MLY A;  4MH2 A;  4POM A;  3L9S A;  2WDU A;  3F3R A;  5F0G A;  3IA1 A;  4ILF A;  4DSQ A;  2B1L A;  2KUC A;  5IMA A;  1YKA A;  5IOX A;  3LGC A;  3RHB A;  2C3T A;  5GAP D;  4N0V A;  2H75 A;  4EF0 A;  1PX7 A;  3GL3 A;  2MMO A;  5J41 A;  4ML1 A;  3F6F A;  5J40 A;  1ST9 A;  1M2B A;  1Y1U A;  2PGT A;  3GIX A;  2YV7 A;  4HEA 2;  2IWT A;  2VKZ G;  4F0C A;  1Z6N A;  5DDL A;  1YF1 A;  4MJB A;  3F9U A;  5HR1 A;  5A5H B;  1O81 A;  3RAZ A;  2F8A A;  2WS2 A;  5ECP B;  1JFU A;  1URM A;  2LQO A;  1QXH A;  3QOU A;  1ZL9 A;  4MK3 A;  10GS A;  4ZL9 A;  4AKG A;  1U88 A;  4RUV A;  1X9M B;  1GSF A;  2CZ2 A;  2PER A;  3J7Y k;  4ICY A;  2LNT A;  5GST A;  2N5A A;  3BCK A;  1B4Q A;  2N5B A;  3ZTL A;  3CSI A;  2H0H A;  3VK9 A;  4V1A g;  5G5F A;  4O5R A;  2HSM B;  4G10 A;  3WGX A;  3LSZ A;  2C80 A;  1A24 A;  4MZC A;  3LYP A;  2R6K A;  4DEJ A;  1A8Y A;  3EMP A;  2VD1 A;  4EDY A;  17GS A;  1GSD A;  1SD9 A;  2LRC A;  3H1N A;  1BAY A;  4I2U A;  5J5N A;  2F51 A;  3GTU A;  3ZML A;  5IQY A;  1SL1 B;  4TXO B;  4ID0 A;  4HI7 A;  3WT2 A;  5D9W A;  2VM1 A;  1TTZ A;  5CYY A;  1M2D A;  2IMF A;  2L6C A;  4XRA A;  4ZB7 A;  2P5Q A;  3IRA A;  1HQO A;  4JR6 A;  5KOX A;  4XCS A;  2KHP A;  2LRT A;  2GQK A;  2ZNM A;  1M99 A;  5D9V A;  1QK8 A;  1OYJ A;  5F06 A;  2VCQ A;  2E7P A;  6GSV A;  4RI7 A;  5FWG A;  2HRK B;  2YP6 A;  3EIN A;  5A4W A;  4EUY A;  4WR5 A;  4A5P A;  4O7H A;  2JAC A;  3K8N A;  1AXD A;  4IGJ A;  2IFQ B;  5D96 A;  4OWY A;  5ECR B;  1K0B A;  2WB9 A;  4JED A;  3E9J B;  3WGD A;  2XC2 A;  2I9H A;  1WWJ A;  5AGY A;  3W8S A;  5LNK e;  3MDK A;  1I9D A;  3GX8 A;  4GTU A;  4L0U A;  5CO3 A;  5GZZ B;  4ZL7 A;  2F8F A;  3KZQ A;  4Z2T A;  2XBI A;  5D8I A;  3VI7 A;  1XOB A;  1PSQ A;  3TJF A;  2JL4 A;  5A5K A;  5DAK A;  1QQ2 A;  2YV9 A;  3HY2 A;  4MPG A;  2QA1 A;  1W89 A;  2DLX A;  2YNX A;  1A2M A;  3M9K A;  3WYW A;  4YQU A;  2B7K A;  4XS4 B;  4D73 B;  4BL7 B;  3ZVJ D;  2NPB A;  1PL2 A;  2TIR A;  3M1G A;  1XOA A;  2WUL A;  4LMV A;  5COH A;  4MPF A;  2PVQ A;  5G5E A;  1UVZ A;  1H4O A;  2AB6 A;  4TVE A;  5A1N A;  4EIP A;  3HJM A;  3TRQ A;  2JZT A;  1XFL A;  3HDC A;  2LTK A;  3MAK A;  1T4Z A;  4Q5Q A;  3E3E A;  4POK A;  4WEY A;  2IME A;  1FVK A;  1XWB A;  2E2G A;  3W8J A;  2OE0 A;  3R2Q A;  2GS3 A;  1F9M A;  1TK0 B;  2FLS A;  2RUF A;  4YQV A;  1O8X A;  2IMK A;  2REM A;  4PNG A;  4XRD A;  1E2Y A;  4O92 A;  3V1W A;  1Q4J A;  1QFN A;  2HSM A;  2WJU A;  3IHQ A;  3GFK A;  3TJK A;  3KEB A;  3UOM A;  5J4V A;  3KMO A;  1M7T A;  1WRY A;  3QAG A;  1FAA A;  2GSR A;  1RW1 A;  3PGT A;  4TXO A;  5J4U A;  3O3T A;  4GST A;  3ZMK A;  4WBJ A;  4WXT A;  5JCG A;  5D9X A;  5F05 A;  4IP1 A;  4HJ2 A;  4GCI A;  1HD2 A;  2H1D A;  1LJR A;  3ZIT A;  1QGV A;  2IN3 A;  3FZ4 A;  2FHE A;  4OMV A;  4NWY A;  5JWO B;  4MF7 A;  1H75 A;  2E0Q A;  2H30 A;  2C3N A;  2H0G A;  2V1M A;  2V6O A;  2HRK A;  2GT5 A;  3FRC A;  2MMN A;  4TKY A;  4G01 A;  2VD0 A;  2LJR A;  2FWG A;  2C0D A;  5DCH A;  2QA2 A;  3WGE A;  2IFQ A;  4N10 A;  2DIY A;  1W4V A;  2FUG 2;  4YKF A;  2YWO A;  1S3C A;  4G0L A;  3F4T A;  3PR8 A;  3I6A A;  2P5R A;  3IK9 A;  1SKW B;  2GQL A;  3HZ4 A;  3GUS A;  4JRR A;  3A2X A;  2ON7 A;  1KTE A;  1JZD A;  2H1L A;  1TK8 B;  5A34 B;  4AJ8 A;  3ISO A;  1ZMA A;  1DE1 A;  4KCA A;  3LXT A;  4V2N A;  1AQX A;  2FA4 A;  3NOF A;  2EFH A;  2YCD A;  2OE3 A;  2LEG A;  1ZZY A;  2F3M A;  2J9H A;  4XS4 A;  4D73 A;  3GH9 A;  5G30 A;  4IJ3 A;  4MNN A;  2M46 A;  3GN3 A;  4NXI A;  1MDJ A;  4BL7 A;  1GNW A;  1V57 A;  1PA3 A;  4ML6 A;  5H5Q A;  2ZUP A;  2C8U A;  3EMX A;  1NHY A;  3HVX A;  3NZN A;  4TN8 A;  1WIK A;  3DRN A;  2H1A A;  1JLV A;  5ECO B;  5AIX A;  2YOI A;  4OCF A;  3G7J A;  5JWR B;  4FIW A;  1J0F A;  4F0B A;  2WFC A;  3PIN A;  5IMD A;  4YAP A;  8GSS A;  4F03 A;  4IQ1 A;  3BJ5 A;  2CAI A;  5AN1 A;  1MDK A;  1AW9 A;  3FY7 A;  4RQX A;  3TB2 A;  1WE0 A;  4O32 A;  1TP9 A;  3KD0 A;  3G7I A;  2OBK A;  3QPM A;  1ABA A;  5HQP A;  3O6T A;  4ZIJ A;  1OVN A;  4ZL8 A;  3PH9 A;  3QFA C;  1ZCP A;  4EL1 A;  2PWJ A;  1MEK A;  3DXB A;  1M9A A;  1YQ1 A;  1FVJ A;  3LYK A;  5KN3 A;  2EFE A;  3HKR A;  3GSS A;  1BF5 A;  1FOV A;  1A2L A;  5KN0 A;  2YAN A;  1GUH A;  4NV5 A;  3C7M A;  2LRN A;  4KDU A;  1FW1 A;  1NSW A;  4BVY B;  6GSX A;  3QAV A;  2RII A;  4ZIL A;  4YKG A;  1V40 A;  3IK7 A;  2VM2 A;  1X9S B;  2UZ8 A;  1OC9 B;  2LJK A;  3VI5 A;  2M72 A;  2CT6 A;  3GNJ A;  4ZB9 A;  4MZB A;  1FHE A;  3GV1 A;  2D2Z A;  4EDZ A;  1U3I A;  3DKS A;  1F2E A;  20GS A;  4DVC A;  3VWV A;  4KB3 A;  1EP7 A;  1SK0 A;  2LNS A;  3UIW A;  1GTU A;  3ZYW A;  3GMF A;  5CRD A;  3ZRE A;  4HDE A;  3UBL A;  1PMT A;  5GSS A;  1A8L A;  1GTB A;  4WBR D;  2LKU A;  2FCH A;  1HNB A;  2H72 A;  4ZB6 A;  1GTA A;  6GST A;  3P8W A;  2HE3 A;  1GH2 A;  5B8A A;  3TJG A;  2OT3 A;  2C0G A;  1M9B A;  3FEU A;  2HZE B;  1BJX A;  5J4Y A;  2GDR A;  1MDI A;  1ERU A;  5A34 A;  3EPT A;  4GSS A;  3ZIV A;  1YEX A;  1TKD B;  2IJY A;  1OC8 A;  2DJ2 A;  3HVS A;  4IP6 A;  5L71 A;  4K2X A;  14GS A;  1WJK A;  1SK1 A;  4GLT A;  4KDX A;  4KX4 A;  3HD5 A;  2DKH A;  3TKR A;  5C04 A;  1VRS D;  2VCZ A;  4XTS A;  3L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...