5GSTA

Reaction coordinate motion in an snar reaction catalyzed by glutathione transferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Snapshots along the reaction coordinate of an SNAr reaction catalyzed by glutathione transferase.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Transferase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5gstA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5gstA01
2CX3A 3KTLA 3VWUA 1VF3A 2B5EA 1R26A 2E2GA 2JZRA 1OYJA 3TDGA 4HJMA 16GSA 3HHVA 2YCDA 1RQMA 2E7PA 1O7UA 3GMFA 2LQQA 1T1VA 2TRCP 5J5NA 1ERTA 4PGTA 3LEFA 3CBUA 5G30A 3LYPA 3KH9A 3TUEA 4G0KA 4TR4A 1DUGA 1ZMAA 3TKSA 2QGVA 3H1NA 2NVLA 2F8AA 2MZCA 1THXA 2H0IA 4FO5A 3A5WA 4N0VA 5HR2A 2WRTA 2O7KA 2I3YA 3EINA 2GQMA 1TK5B 5J3RA 3IRAA 1W89A 2CVDA 2I9HA 1ZYQB 3L9VA 2DJ0A 3DGQA 4GSTA 4WBJA 1BQ7A 3PINA 3DEXA 2DC5A 4YQUA 1QGVA 1O73A 4DEJA 3HJOA 2ON7A 4L5OA 4MPGA 5DJMA 1NW2A 2GZYA 4FQUA 1YF1A 4D73A 1B4QA 3BOAA 3UMAA 1YY7A 3OR5A 1MD4A 4WETA 4G0LA 2J23A 4D73B 5ID2B 5G5FA 5HFGA 4F82A 2MYGA 1HYUA 1XBSA 1QK8A 3KM6A 3GH9A 3KGKA 1T00A 1Q98A 1M99A 3Q19A 1PD21 2LS5A 1I5GA 5BMUA 4ZIJA 4GQFA 4Q5RA 4XCSA 5KEJA 3DXBA 1EEMA 3M9JA 3KD0A 1KTEA 1GTUA 4HQSA 5ECIB 3L4NA 3BCIA 2AHEA 5EPFA 1BX9A 2G2QA 3GV1A 3LQ7A 1EP8A 5CREA 1U6TA 2VLUA 2IN3A 4ACSA 2DIYA 2F8FA 1O81A 1X5EA 1WMJA 4NWYA 4LL1B 1TK8B 4PQIA 2LJKA 2KHPA 2GSQA 1U3AA 5J41A 4V1Ap 2XHFA 1TP9A 5HR3A 2VL2C 1GSDA 1J08A 5DDLA 3LGCA 2LRCA 1B4PA 3GN3A 1YQ1A 3DVXA 5D8IA 4POMA 3IHQA 2H71A 1KNGA 1Z7PA 1BAYA 1K0OA 3TJGA 4MCUA 1XIYA 1SL2B 2JSYA 5FHIA 1F6MC 2AUVA 1MDKA 1W4VA 2RUFA 5IMFA 2H6XA 1EV9A 4MF5A 4JR4A 4NV5A 4BA7A 2GQKA 4K0NA 5J4UA 1EV4A 3FHKA 4WR5A 4TXOA 1OC9A 5DBQA 1GSQA 1AUCA 5ECNB 3M0FA 2K9FA 2HXKA 2L57A 3MDKA 2XBIA 3GL3A 4PQ1A 3D6IA 1OC9B 2CAQA 4P3YB 3JCML 1JZWA 2C80A 4ZBBA 3CXGA 3V1WA 2GSRA 3DVWA 5ECLB 3WD6A 1R4WA 1SL1B 2RUEA 4IHUA 4MA9A 2QSIA 1OE7A 2F51A 2H73A 1Z9HA 3FY7A 1BG5A 1LU4A 4ML6A 4TR1B 4PNGA 2PVOC 2CZ3A 4MZWA 4IW9A 2IFQA 4IGJA 3F3RA 2ZCTA 2IFQB 2OE1A 1SENA 4KB3A 3RPPA 1RW1A 1PMTA 4DSSA 20GSA 2HRAA 1NSWA 3ZTLA 1Z3EA 4LMWA 2B3SA 2HZFA 1X5DA 5A4WA 2C8UA 2H6ZA 3AY8A 4DSSB 4RQRA 2VO4A 2ALBA 2P5QA 4RUVA 5DQYA 2VCTA 3VWXA 4ZL9A 2IMKA 2FHEA 5JWOB 4MMMA 2R37A 4LA1A 2FNOA 4KDUA 4XS1A 3ERGA 1FAAA 3ZIVA 3GYKA 4IQAA 1TW9A 3EURA 1DE1A 2C0DA 4I5QA 1IYIA 2BMXA 4MABA 4KE3A 5GAND 3IC4A 4EXJA 5C04A 4K7OA 3GL5A 3VWWA 1ABAA 1VGLA 2K8VA 2ZUPA 5FWGA 3PGTA 4JBBA 3M9KA 4NHZA 1AQXA 13GSA 2X8CA 17GSA 1QFNA 2L59A 2CQ9A 3P7XA 5HR1A 4KGIA 2RM5A 3BD2A 1M2BA 2HRFA 2AYTA 1ZGNA 2OJLA 1OAZA 3QDNA 4J2FA 3GKMA 4YQVA 4MLYA 11GSA 4WXTA 3VPTA 1EEJA 1YDKA 4TN8A 1I9DA 4G19A 3IOSA 5GAPD 3W6GA 4IJ3A 1TKDB 1HNBA 4USSA 4ZB9A 2MMOA 2VD1A 1TOFA 3RPNA 1K3LA 2VCZA 3P90A 5ECRB 3F6DA 4BPYA 4KDXA 1PQNA 2FLSA 3CTFA 1ON4A 1SL0B 3QMXA 3A2XA 1G6YA 3FK8A 1AXDA 4OO5A 2YJHA 4ZB6A 4BVYA 3FZ4A 1E6BA 3DD3A 6GSUA 2FWEA 2M72A 3IXRA 4V2NA 2YZUA 4BVYB 1Z7RA 1PA3A 2X8HA 1E2YA 5LD0A 1GLQA 2UZ8A 3U6VA 3K8NA 1GL8A 1GP1A 4TKYA 3FRCA 3NZNA 1WRYA 3IDVA 1A2JA 3CYNA 1JZDA 4JU5A 3LG6A 2XC2A 1X9WB 3M1GA 5EL8A 4HJ2A 1YKCA 2YPMA 4IELA 4MJBA 4PTSA 2A2RA 1XZOA 4X0XA 2B5YA 2RIIA 4GSNA 1ERVA 1K0BA 4MF6A 4O7HA 2HRKB 4NV2A 3QCPA 1GLPA 2OBKA 2C1YA 1V2AA 3VURA 3UBLA 1ZL9A 2H01A 5HQPA 4HUAA 3RAZA 3G7JA 4EO3A 1Q4JA 5DALA 4O92A 3C73A 1LBKA 5LCZA 5DALB 1UA5A 1WIKA 3TRQA 4MK3A 2A2SA 1EP7A 3KH7A 4J56E 4MZCA 2IIYA 1WP0A 4QQ7A 5IQYA 4XRDA 3ZREA 3BJ5A 2IMFA 2J9HA 3DMLA 3TOUA 4WF4A 5B6NA 5B7CA 4IP6A 2QKEA 3FZ5A 2JSZA 5GZZB 1B9YC 3US3A 5E59A 2WS2A 1TRUA 4HDEA 2R3XA 1U88A 2H19A 4WBRD 3ED3A 1YEPA 2C0FA 4TRXA 3QFAC 3IBHA 1R5PA 1VF2A 1SJ6A 1F37A 4XS4A 4CHSA 4ECJA 4ECCA 3IAS2 2X8GA 2FWHA 1GNWA 2M80A 3U5RE 1SYXA 4KA0A 1TK0B 4XIHA 3TKRA 1EGOA 4XS4B 1Z5YE 3UARA 2PWJA 3EE2A 1TXXA 2KP1A 3KEBA 1C72A 1XOAA 4I8BA 4FYUA 2GZZA 1XVWA 5IMCA 1U87A 3TJBA 4PUAA 2PPTA 3M8NA 2XPEA 4NMUA 4YAPA 4X43A 3TKSE 1A24A 3F4RA 2P0GA 2QC7A 5IMDA 4OWYA 1TRSA 3HVVA 3MWHA 3TKQA 5AN1A 2C3NA 3HCZA 4N11A 1K0MA 2RM6A 3WGXA 3D21A 2L5OA 4I2TA 3CRUA 1SD9A 4KW6A 1MDJA 2GZPA 3SBCA 2H6YA 5JWQB 4OD7A 2B6MA 1PX6A 3UIWA 3KJYA 1K3YA 4EDZA 3E9JB 5ID2A 4KSMA 4JRRA 3EWLA 4BVXA 2H70A 3HA9A 1N8JA 5IPGA 1JFUA 3A3TA 3VI5A 4BVXB 2LQOA 1GUMA 3A2WA 4MPFA 2VM2A 3KMOA 2B7KA 4G0IA 4ILFA 5CO3A 2DLXA 1PRXA 1J0FA 1AIUA 5ECSA 1OC8A 1V98A 1XXUA 1IYHA 3BCKA 1R7HA 3ERWA 4O5RA 3R3EA 1XW6A 4GLTA 1F3AA 1XPVA 4OCFA 5KN3A 1O8WA 3L78A 3RBTA 1YF0A 2RLIA 2H1BA 2YV7A 2H75A 2VD0A 4BWSA 3TJFA 22GSA 5J9BA 3FZ9A 2LV3A 1HD2A 2B7JA 3ZLPA 4AJ7A 2C3TA 2EIRA 3CRTA 3FEUA 3UEMA 1SK2A 4DSQA 1EZKA 3GIXA 3ISOA 5DCHA 1YEXA 1TRWA 4HU7A 1TJDA 2H66A 2P31A 4IQ1A 3UAPA 5ECQB 4H86A 1WE0A 3KTBA 5B8AA 4MDCA 2TRXA 4OO4A 4YQMA 5A4UA 4MH2A 1U3IA 3GKKA 5HFIA 3CSJA 4F9ZA 4L5LA 4HU9A 1K0CA 2LTKA 2GVPA 3GX8A 4L0UA 4IP1A 2PMTA 3QR6A 4KCAA 1M7TA 3HJMA 1NHYA 4ISDA 3DKSA 5IMVA 2PBJA 4EKZA 2OE3A 2XBQA 2MMAA 2VCQA 1ZZYA 4HI7A 3Q6OA 1XCCA 3ZVJA 1SYRA 1X0RA 5D9XA 2IMEA 3HKRA 3N5OA 3RDWA 4TR1A 3WT1A 4Q5QA 2EC4A 3GSTA 1OE8A 2I81A 2LJAA 2MBSA 1FO5A 4KDYA 2TIRA 4HZ4A 2IWTA 3G7IA 4G10A 4DVCA 2HSHA 2FD3A 14GSA 2EIQA 4X1UA 2FCHA 4KSOA 3H8QA 3W8JA 3KMNA 1FB6A 4WF5A 4N0ZA 2AJQB 3DRNA 5ABRA 2V41A 3LSZA 2O8VB 5IPHA 1B48A 3H93A 2MBTA 3O6TA 2AAWA 4MJCA 4XS6A 2ON5A 4RQXA 2YZHA 2CZ2A 5CRWA 1TDIA 3TJJA 2YANA 5D73A 4POBA 2P5RA 1RK4A 1AC1A 1EOHA 3G7YA 1B8XA 2X64A 2KUCA 3KP8A 3HYPA 1LJRA 3QAVA 2JZSA 3LWAA 2X99A 3TGZA 3HZ4A 5L71A 4MJEA 3P2AA 1WOUA 2C3QA 1BJXA 2HSMA 2V1MA 3KP9A 3UVHA 5KN1A 2N5BA 1JZRA 3UBKA 3IPZA 3VLNA 3EU4A 2HSMB 2PN8A 5CAXA 2NBSA 3F6FA 1ZOFA 5IO0A 4HEA2 1J9BA 1M2DA 3HD5A 3F0IA 4IN0A 2HT9A 3D22A 4AF2A 1TRVA 3I69A 4YAVA 2VL2A 3D4TA 3J7Yb 9GSSA 1BEDA 1X9MB 4PXOA 1GTBA 1S3AA 1GSSA 1S3DA 1WPIA 1EOGA 4XRAA 3LFLA 3EYTA 4NXIA 1WWJA 3C71A 4IJIA 1V58A 3C1SA 2F9SA 4DSRA 2GLRA 4LLRA 4TR3A 2HFDA 5G2ZA 2C0EA 2YWIA 4OMVA 2VCVA 2YV9A 4J57E 2FWGA 3N9JA 4KNDA 3APQA 4EF0A 3J7Yk 3F4TA 5ENUA 3MAKA 6GSYA 2LEGA 1SJIA 5DVBA 1TI1A 1DBYA 3VFIA 1K3OA 1GWCA 1TI3A 1G6WA 2FUG2 3RHCA 4G9HA 5IOWA 2FA4A 2FY6A 4ZBDA 4F0BA 1XOBA 1QXHA 3KCMA 3GRXA 3ZIJA 1PSQA 5AISA 3QAWA 3CSHA 1THOA 2FA8A 4N10A 5G31A 4NPBA 4FIWA 1A8YA 3IA1A 1H75A 2VLTA 1GSUA 2VL9A 4K7NA 5DCGA 4RI7A 2HZEA 1HNCA 2HRKA 1XWKA 1A8LA 2I4AA 2L4CA 3F4SA 3PH9A 3ME7A 1DSBA 1V40A 2LJRA 4WR4A 2HZEB 3D5JA 3TCOA 5D9WA 5FT3A 5AIVA 3P8WA 4EE0A 4FYCA 4PNFA 4LMVA 5G5EA 3ZFBA 2FGXA 4E8HA 3GHAA 5D9VA 1PN9A 1JLWA 3O76A 3VWVA 4K9ZA 3EMXA 1XWGA 3NIVA 1DE2A 2DJ3A 1K0DA 2JACA 4FYBA 2B1KA 2HNLA 3LXTA 4K7IA 2WB9A 5KN2A 3F63A 5JCUA 5ELGA 1K0AA 2N5AA 2XPDA 3GA4A 3RHBA 2O89A 3M3MA 2CX4A 1XVQA 2JZTA 1T4ZA 2YWNA 3GUSA 1CQHA 3FYGA 2WJUA 3D4MA 4V1Ag 2C0GA 4EL1A 2YJ7A 1A0FA 1URMA 2YN1A 1UVZA 2NPBA 3I43A 2WZ9A 2IPAA 2OE0A 4QL7A 3FKFA 5F8BA 4Q5FA 2DJJA 2N5FA 2VOCA 2R4VA 2WDUA 3L0HA 2MMNA 2V6KA 4JZQA 3UOMA 4NHWA 2Z9SA 2YOIA 3H79A 4PQHA 3LORA 4HS1A 1V9WA 2GQLA 2I1UA 1G7EA 3EVIA 3UL3A 3TRPA 2K6VA 2YWOA 2AV4A 3QD9A 12GSA 2HI7A 3L9SA 4WEYA 2ES7A 1VRSD 1Y25A 1V57A 4BL7A 3GSSA 4JR6A 1PL2A 2OBIA 2HYXA 5D96A 1PL1A 2PVQA 2H1GA 3C7MA 1OC3A 4KX4A 5H5QA 3WT2A 4K2DA 4BL7B 1F9MA 3KIJA 1EGRA 1XW5A 3LYKA 1OKDA 2EIOA 3R2QA 4JEDA 1GSYA 1YZXA 4TOPA 3DWVA 3ZFLA 2ZNMA 2V6OA 3GX0A 3WYWA 2R6KA 4N30A 4ZL7A 5ELAA 1Z6NA 1FVJA 2PU9C 2VL3A 5H5SA 1H4OA 1A2LA 1ERUA 3EMPA 1TU7A 3NOFA 3VI7A 3LXZA 5ECOB 5J9CA 1GRXA 3W8SA 1F3BA 4TW5A 2HSYA 2L6DA 2DMLA 4IS0A 4AJ8A 5CRGA 3KZQA 2GSTA 2L6CA 2HE3A 1FG4A 3TOTA 3I9V2 1X9SB 2CVBA 1GSEA 4OCEA 5A5KA 6GSSA 3GFKA 2DJKA 2VUPA 3IK9A 1G7OA 1XWCA 1O8XA 3ZVJD 2JADA 5COHA 1CQGA 2CT6A 1MTCA 1B9XC 2YP6A 2IJYA 3BBYA 2H0HA 5GSTA 4F2IA 5ECMB 4KCEA 3HY2A 5INYA 3IAM2 1ILOA 4ID0A 4IKHA 1JLVA 1UN2A 1ST9A 4QL9A 3FR9A 1A2MA 3FR3A 5CNWA 4E8EA 1FW1A 4PUFC 5AIXA 4XTSA 3CTGA 1GNEA 3F8UA 3UJ1A 3FZAA 2LKUA 3PR8A 2VCXA 1O6JA 5KN0A 4RI6A 2LRTA 4AGSA 2DSAA 10GSA 3EU3A 3KXOA 2D2ZA 2B5XA 1PX7A 1XFLA 4JE1A 1T4YA 1MD3A 4KH7A 2VAFA 4L8EA 2R2JA 4IVFA 4I6XA 2H1AA 3DYRA 4ULXA 2AB6A 4KF9A 2BTOT 4LL4B 1VF4A 5E4WA 2OA7A 2H0GA 2L5LA 4TVEA 4MH3A 3H4KA 5F07A 5HR0A 1JZOA 3IC8A 5ECHB 4FH8A 3L9UA 5AGYA 2IMDA 4EUYA 3EC3A 1K0NA 1SKSB 2YNXA 4K8MA 1T8EB 1FHEA 2DMMA 3WGDA 3PPUA 4CW9A 1X5CA 1AQVA 4MJAA 3TKPA 2WFCA 3QOUA 3Q18A 2O87A 2V32A 2C4JA 5B8BA 4ZBAA 4MF7A 8GSSA 3ZMKA 1YKAA 4PX1A 2PGTA 3WGEA 2GT6A 3GNJA 1GULA 4TXOB 3IV4A 2KP2A 3DIEA 19GSA 2CA8A 1N2AA 4K1FA 2H76A 1FOVA 3C8EA 1FVKA 4ECBA 2H30A 2GGTA 3GH6A 4F0CA 2DBCA 3O3TA 1AQWA 2FWFA 5IO2A 1TU8A 2K18A 2KLXA 2CV4A 4GTUA 5CYYA 1PKWA 3ME8A 3HJPA 2G0FA 2O85A 5DJLA 2MMZA 2PUKC 1GH2A 4G2EA 3GKNA 2IMIA 1OVNA 2OKAA 2H8LA 4EC0A 4GF0A 4I2UA 5B6MA 1SD8A 4I97A 3FW2A 2HSNB 3ERFA 1EWXA 4TXVA 3QAGA 3ZZXA 2H74A 4PURA 1XWBA 1A23A 4ZILA 3ZRDA 4WKWA 1M9BA 1SKRB 3HXSA 5JCGA 3HVSA 1GSFA 2NTOA 2YWMA 3APOA 4TR0A 1UC7A 1Y6EA 5GSSA 1PGTA 1O85A 1HQOA 5D93A 4BWQA 4ZB8A 4EDYA 3TJKA 3MNGA 2HQTA 1G0TA 1MEKA 4OFTA 4OFMA 1VF1A 1A0RP 5G1LA 3ZITA 3A2VA 2VM1A 2DJ1A 3S9FA 6GSVA 5LNKe 5IIZA 2M46A 3SWLA 1F2EA 4Q5NA 4AJ6A 2B1LA 1OKTA 2OACA 1YJ6A 4KUNA 1R5AA 1SU9A 3QPMA 2LNSA 1KEBA 4V2MA 4K6XA 1USBA 1M2AA 3FR6A 2K8SA 4MZBA 1MDIA 2KOKA 5F05A 2HRNA 4ECIA 5G1KA 5ECKB 3E0UA 1QUWA 5EY6A 4HOJA 6GSWA 3GURA 3HVXA 3D0ZA 5CRDA 5JWRB 3GTUA 4GXZA 4POLA 2DJ2A 4ML1A 5CP1A 5H5RA 1XW9A 4XHMA 3GTUB 3TKSC 1GTAA 4GWRA 1GUHA 2F3MA 5HFKA 3IR4A 3E3EA 1SK0A 1SKWB 2REMA 2GSSA 3QFBC 2WULA 2VIMA 1SK1A 4ZL8A 1NM3A 4CDOA 3Q74A 2H1DA 3LJRA 3HZ8A 5C00A 4NAXA 4F03A 2V2GA 1T3BA 2LNTA 5F06A 3APSA 2JL4A 4POKA 3UVTA 3CSIA 4L0WA 18GSA 4Z7XA 2LUSA 1SJZA 2JU5A 3GKXA 1QQ2A 4HQZA 4GSSA 1TTZA 5IMZA 1XWAA 5ECPB 3ZMLA 1AW9A 1BYEA 1KBNA 4GCIA 3MSZA 3HDCA 2H72A 1JHBA 4YH2A 1AAZA 1ERWA 2LRNA 2VLVA 5CRHA 2LSTA 5EVOA 2BJXA 2WGRA 3IE3A 2E2MA 2HLSA 1ML6A 2CAIA 5D9TA 4OFNA 1T7PB 2GS3A 2R5GA 4ZXGA 4EVMA 3ZYWA 5IM9A 1FB0A 1QMVA 4HZ2A 5JCWA 2A4VA 5F0GA 1PKZA 4GQCA 1S3CA 3TRXA 1M0UA 5DQSA 5IMAA 1GTIA 4K0GA 2IL3A 2E0QA 5A4VA 3I6AA 4KAEA 2L4QA 4MP4A 3IK7A 1ACVA 3TB2A 4O32A 2OADA 1HNAA 4V2LA 5DAKA 3ZL5A 1WJKA 3C1RA 2VCWA 4IBPA 6GSXA 6GSTA 1M9AA 5DAKB 2GDRA 1GUKA 2GTUA 3VPQA 5IOXA 1Z6MA 4GRFA 3G9BA 7GSSA 2PERA 2CVKA 3VK9A 2NDOA 2WCIA 2DIZA 1NHOA 1ZCPA 3CMIA 3F9UA 2GT5A 1ZYEA 3F3QA
chains in the Genus database with same CATH superfamily
2CX3A 3KTLA 3VWUA 1VF3A 2B5EA 1R26A 2E2GA 2JZRA 1OYJA 3TDGA 4HJMA 16GSA 3HHVA 2YCDA 1RQMA 2E7PA 4N3ZA 1O7UA 3CQFA 3GMFA 2LQQA 1T1VA 2TRCP 5J5NA 1ERTA 4PGTA 3LEFA 3CBUA 5G30A 2WVZA 3LYPA 3KH9A 3TUEA 4G0KA 4TR4A 1DUGA 1ZMAA 3TKSA 2QGVA 3H1NA 2NVLA 2F8AA 2MZCA 1THXA 2H0IA 4FO5A 5A1NA 3A5WA 4N0VA 5HR2A 2WRTA 2O7KA 2I3YA 3EINA 5A1NB 2GQMA 1TK5B 5J3RA 3IRAA 1W89A 2CVDA 2I9HA 1ZYQB 3L9VA 2DJ0A 3DGQA 4GSTA 2WW0A 4WBJA 1BQ7A 3PINA 3DEXA 2DC5A 4YQUA 1QGVA 1O73A 4DEJA 3HJOA 2ON7A 4L5OA 4MPGA 5DJMA 1NW2A 3RFRC 2GZYA 4FQUA 1YF1A 4D73A 1B4QA 3BOAA 3UMAA 1YY7A 3OR5A 1MD4A 4WETA 4G0LA 2J23A 4D73B 5ID2B 5G5FA 5HFGA 4F82A 2MYGA 4MNNA 1HYUA 1XBSA 1QK8A 3KM6A 3GH9A 3KGKA 2WVYA 1T00A 1Q98A 1M99A 3Q19A 1PD21 2LS5A 1I5GA 5BMUA 4ZIJA 4GQFA 4Q5RA 2X4AA 4XCSA 5KEJA 3DXBA 1EEMA 3M9JA 3KD0A 1KTEA 1GTUA 5BMUB 4HQSA 5ECIB 3L4NA 3BCIA 2AHEA 5EPFA 1BX9A 2G2QA 3GV1A 3LQ7A 1EP8A 5CREA 1U6TA 2VLUA 2IN3A 4ACSA 2DIYA 2F8FA 1O81A 1X5EA 1WMJA 4NWYA 4LL1B 1TK8B 4PQIA 2LJKA 2KHPA 3HVNA 2GSQA 1U3AA 5J41A 4V1Ap 2XHFA 1TP9A 5HR3A 2VL2C 1GSDA 1J08A 5DDLA 3LGCA 2LRCA 1B4PA 3GN3A 1YQ1A 3DVXA 5D8IA 4POMA 3IHQA 2H71A 1KNGA 1Z7PA 1BAYA 1K0OA 3TJGA 4MCUA 1XIYA 1SL2B 2JSYA 5FHIA 1F6MC 2AUVA 1MDKA 1W4VA 2RUFA 4K5SA 5IMFA 2H6XA 1EV9A 4MF5A 4JR4A 4NV5A 4BA7A 2GQKA 4K0NA 5J4UA 1EV4A 3FHKA 4WR5A 4TXOA 1OC9A 5DBQA 1GSQA 1AUCA 5ECNB 3M0FA 2K9FA 2HXKA 2L57A 3MDKA 2XBIA 3GL3A 4PQ1A 3D6IA 1OC9B 2CAQA 4P3YB 3JCML 2R0GA 1JZWA 2C80A 4ZBBA 3CXGA 3V1WA 2GSRA 3DVWA 5ECLB 3WD6A 1R4WA 1SL1B 2RUEA 4IHUA 4MA9A 2QSIA 1OE7A 2F51A 2H73A 1Z9HA 3FY7A 5J40A 1BG5A 1LU4A 4YKGA 4ML6A 4TR1B 4PNGA 2WW1A 2PVOC 2CZ3A 4MZWA 4IW9A 2IFQA 4IGJA 3F3RA 2ZCTA 4PI0C 2HSNA 2IFQB 2OE1A 1SENA 4KB3A 3RPPA 1RW1A 1PMTA 4DSSA 20GSA 2HRAA 1NSWA 3ZTLA 1Z3EA 4LMWA 2B3SA 2HZFA 1X5DA 2WVXA 5A4WA 2C8UA 2H6ZA 3AY8A 4DSSB 4RQRA 2VO4A 2ALBA 2P5QA 4RUVA 5DQYA 2WVXB 2VCTA 3VWXA 4ZL9A 2IMKA 2FHEA 5JWOB 4MMMA 2R37A 1ZYNA 4LA1A 2FNOA 4KDUA 4XS1A 3ERGA 1FAAA 3ZIVA 3GYKA 4IQAA 1TW9A 3EURA 2H1LA 1DE1A 2C0DA 4I5QA 1IYIA 2BMXA 4MABA 4KE3A 5GAND 3IC4A 4EXJA 5C04A 4K7OA 3GL5A 3VWWA 1ABAA 1VGLA 2K8VA 2ZUPA 5FWGA 3PGTA 4JBBA 3M9KA 4NHZA 1AQXA 13GSA 2X8CA 17GSA 1QFNA 2L59A 2CQ9A 5KOWA 3P7XA 1S4BP 5HR1A 4KGIA 2RM5A 3BD2A 1ZYPA 1M2BA 2HRFA 2AYTA 1ZGNA 2OJLA 1OAZA 3QDNA 4J2FA 3GKMA 4YQVA 4MLYA 11GSA 4AKHA 4WXTA 3VPTA 1EEJA 1YDKA 4TN8A 1I9DA 4G19A 3IOSA 5GAPD 3W6GA 4IJ3A 1TKDB 1HNBA 4USSA 4ZB9A 2MMOA 2VD1A 1TOFA 3A5IA 5J4YA 3RPNA 1K3LA 2VCZA 3P90A 5ECRB 4E68A 3F6DA 4BPYA 4KDXA 1PQNA 2FLSA 3CTFA 1ON4A 1SL0B 3QMXA 3A2XA 1G6YA 3FK8A 1AXDA 4OO5A 2YJHA 4ZB6A 4BVYA 3FZ4A 1E6BA 3DD3A 6GSUA 2FWEA 2M72A 3IXRA 4V2NA 2YZUA 4BVYB 1Z7RA 1PA3A 2X8HA 1E2YA 5LD0A 1GLQA 2UZ8A 3U6VA 3K8NA 1GL8A 1GP1A 4AKIA 4TKYA 3FRCA 3NZNA 1WRYA 3IDVA 1A2JA 3CYNA 4Z2TA 1JZDA 4AKGA 4JU5A 3LG6A 2XC2A 1X9WB 4Z2UA 3M1GA 1Y1UA 5EL8A 4HJ2A 1YKCA 2YPMA 4IELA 4MJBA 4PTSA 2A2RA 1XZOA 4X0XA 2B5YA 2RIIA 4GSNA 1ERVA 1K0BA 4MF6A 4O7HA 2HRKB 4NV2A 3QCPA 1GLPA 1SVLA 2OBKA 2C1YA 1V2AA 3VURA 4EIPA 3UBLA 1ZL9A 2H01A 5HQPA 4HUAA 2QA1A 3RAZA 3G7JA 4EO3A 1Q4JA 5DALA 4O92A 3C73A 1LBKA 5LCZA 4CY6A 5DALB 1UA5A 1WIKA 3TRQA 4MK3A 2A2SA 1EP7A 3KH7A 4J56E 4MZCA 2IIYA 1WP0A 4QQ7A 5IQYA 1M3IA 4XRDA 3ZREA 4K2XA 3BJ5A 2IMFA 2J9HA 3DMLA 4HSCX 3TOUA 4WF4A 5B6NA 5B7CA 4IP6A 2QKEA 3FZ5A 2JSZA 4Z2RA 5GZZB 1B9YC 3US3A 3RGBC 5E59A 2WS2A 1TRUA 4HDEA 2R3XA 1U88A 2H19A 4WBRD 3ED3A 1YEPA 2C0FA 4TRXA 3QFAC 3IBHA 1R5PA 1VF2A 1SJ6A 1F37A 4XS4A 4CHSA 4ECJA 4ECCA 3IAS2 2X8GA 2FWHA 1GNWA 2M80A 3U5RE 1SYXA 4KA0A 1TK0B 4XIHA 3TKRA 1EGOA 4XS4B 1Z5YE 1SVMA 3UARA 2PWJA 3EE2A 4W66A 1TXXA 2KP1A 3KEBA 1C72A 1XOAA 4I8BA 4FYUA 2GZZA 1XVWA 5IMCA 1U87A 3TJBA 4PUAA 2PPTA 3M8NA 2O36A 2XPEA 4NMUA 4YAPA 4X43A 3TKSE 1A24A 1TXUA 3F4RA 2P0GA 2QC7A 5IMDA 4OWYA 1TRSA 3HVVA 3MWHA 3TKQA 5AN1A 2C3NA 3HCZA 4N11A 1K0MA 2RM6A 3WGXA 2R0PA 3D21A 2L5OA 4I2TA 3CRUA 1SD9A 4KW6A 1MDJA 2GZPA 3SBCA 2H6YA 5JWQB 4OD7A 2B6MA 1PX6A 3UIWA 3KJYA 1K3YA 4EDZA 3E9JB 5ID2A 4KSMA 4JRRA 3EWLA 4BVXA 2H70A 3HA9A 1N8JA 5IPGA 1JFUA 3A3TA 3VI5A 4BVXB 2LQOA 1GUMA 2UV8G 1I1IP 3A2WA 4MPFA 2VM2A 3KMOA 2B7KA 4G0IA 4ILFA 5CO3A 2DLXA 1PRXA 2VKZG 1J0FA 1AIUA 5ECSA 1OC8A 1V98A 1XXUA 1IYHA 3BCKA 1R7HA 3ERWA 4O5RA 3R3EA 1XW6A 4GLTA 1F3AA 1XPVA 4OCFA 5KN3A 1O8WA 3L78A 3RBTA 1YF0A 2RLIA 2H1BA 2YV7A 2H75A 2VD0A 4BWSA 3TJFA 22GSA 5J9BA 3FZ9A 2LV3A 1HD2A 2B7JA 3ZLPA 4AJ7A 2C3TA 2EIRA 3CRTA 3FEUA 3UEMA 1SK2A 4DSQA 1EZKA 3GIXA 3ISOA 5DCHA 1YEXA 1TRWA 4HU7A 1TJDA 2H66A 2P31A 4IQ1A 3UAPA 5ECQB 4H86A 1WE0A 3KTBA 5B8AA 4MDCA 2TRXA 4OO4A 4YQMA 5A4UA 5J47A 4MH2A 1U3IA 3GKKA 3CWGA 5HFIA 3CSJA 4F9ZA 4L5LA 4HU9A 3FMWA 1K0CA 2LTKA 2GVPA 3GX8A 4L0UA 4IP1A 2PMTA 3QR6A 4KCAA 1M7TA 3HJMA 1NHYA 4ISDA 3DKSA 1YEWC 5IMVA 2PBJA 4EKZA 2OE3A 2XBQA 2MMAA 2VCQA 1ZZYA 4HI7A 3Q6OA 2DKIA 1XCCA 5BRTA 3ZVJA 1SYRA 1X0RA 5D9XA 2IMEA 3HKRA 3N5OA 3RDWA 4TR1A 3WT1A 5A34A 4Q5QA 2EC4A 3GSTA 1OE8A 2I81A 2LJAA 2MBSA 1FO5A 4KDYA 2TIRA 4HZ4A 5A34B 4PHZC 1FOHA 2IWTA 3G7IA 4G10A 4DVCA 2HSHA 2FD3A 14GSA 2EIQA 4X1UA 2FCHA 4KSOA 3H8QA 3W8JA 3KMNA 3LW9A 1FB6A 4WF5A 4N0ZA 2AJQB 3DRNA 5ABRA 2V41A 3LSZA 2O8VB 5IPHA 1B48A 3H93A 2MBTA 3O6TA 2AAWA 4MJCA 4XS6A 2ON5A 4RQXA 2YZHA 2CZ2A 5CRWA 1TDIA 3TJJA 2YANA 5D73A 4POBA 2P5RA 1RK4A 1AC1A 5KOXA 1EOHA 3G7YA 1B8XA 2X64A 2KUCA 3KP8A 3HYPA 1LJRA 3QAVA 2JZSA 3LWAA 2X99A 3TGZA 4FXYP 3HZ4A 5L71A 3IHGA 4MJEA 3P2AA 1WOUA 2C3QA 1BJXA 2HSMA 2V1MA 3KP9A 4X4JA 3UVHA 3EPTA 5KN1A 2N5BA 1JZRA 3UBKA 3IPZA 3VLNA 3EU4A 2HSMB 2PN8A 5CAXA 2NBSA 3F6FA 1ZOFA 5IO0A 4HEA2 1J9BA 1M2DA 3HD5A 3F0IA 4IN0A 2HT9A 3D22A 4AF2A 1TRVA 3I69A 4YAVA 2VL2A 3D4TA 3J7Yb 9GSSA 1BEDA 1X9MB 4PXOA 1GTBA 1S3AA 1GSSA 1S3DA 1WPIA 1EOGA 4XRAA 3LFLA 4EIQA 3EYTA 4NXIA 1WWJA 3C71A 5J4VA 4IJIA 1V58A 3C1SA 2F9SA 4DSRA 2GLRA 2EFDA 4LLRA 4TR3A 2HFDA 5G2ZA 4BIKA 2C0EA 2YWIA 4OMVA 2VCVA 1XG8A 2YV9A 4J57E 2FWGA 1N25A 3N9JA 4KNDA 3APQA 4EF0A 3J7Yk 3F4TA 5ENUA 3MAKA 6GSYA 2LEGA 1SJIA 5DVBA 1TI1A 1DBYA 3VFIA 1K3OA 1GWCA 1TI3A 1G6WA 2WW3A 2FUG2 3RHCA 4G9HA 5IOWA 1YVLA 2FA4A 2FY6A 4ZBDA 4F0BA 1XOBA 1QXHA 3KCMA 3GRXA 3ZIJA 1PSQA 5AISA 3QAWA 3CSHA 1THOA 2FA8A 4N10A 5G31A 4NPBA 4FIWA 1A8YA 4O5QA 2A4HA 3IA1A 1H75A 2VLTA 4ZB7A 1GSUA 2VL9A 4K7NA 5DCGA 4RI7A 2HZEA 1HNCA 2HRKA 1XWKA 1A8LA 2I4AA 2L4CA 3F4SA 3PH9A 3ME7A 1DSBA 1V40A 2LJRA 4WR4A 2HZEB 3D5JA 3TCOA 5D9WA 5FT3A 5AIVA 3P8WA 4EE0A 4FYCA 4PNFA 4LMVA 5G5EA 3ZFBA 2FGXA 4E8HA 3GHAA 5D9VA 1PN9A 1JLWA 3O76A 3VWVA 4K9ZA 3EMXA 1XWGA 3NIVA 1DE2A 4A5PA 2DJ3A 1K0DA 2JACA 4FYBA 2B1KA 2HNLA 3LXTA 4K7IA 2WB9A 5KN2A 3F63A 5JCUA 5ELGA 1K0AA 2N5AA 2XPDA 3GA4A 3RHBA 2O89A 3M3MA 2CX4A 1XVQA 2JZTA 2EFHA 1T4ZA 2YWNA 3GUSA 1CQHA 3FYGA 2WJUA 3D4MA 2WZSA 4V1Ag 2C0GA 4EL1A 1M3JA 2YJ7A 1A0FA 1URMA 2YN1A 1UVZA 2NPBA 3I43A 2WZ9A 2IPAA 2OE0A 4QL7A 3FKFA 5F8BA 4Q5FA 2DJJA 2N5FA 2VOCA 2R4VA 2WDUA 3L0HA 2MMNA 2V6KA 4JZQA 3UOMA 4NHWA 2Z9SA 2YOIA 3H79A 4PQHA 3LORA 1BF5A 4HS1A 1V9WA 2GQLA 2I1UA 2DKHA 1G7EA 3EVIA 2OT3A 3UL3A 3TRPA 2K6VA 2YWOA 2AV4A 3QD9A 12GSA 4PI2C 2HI7A 3L9SA 4WEYA 2ES7A 1VRSD 1Y25A 1V57A 2EFEA 4BL7A 3GSSA 4JR6A 1PL2A 2OBIA 2HYXA 5D96A 1PL1A 2PVQA 2H1GA 3C7MA 1OC3A 4YKFA 4KX4A 2O3EA 5H5QA 3WT2A 4K2DA 4BL7B 2X49A 1F9MA 3KIJA 1EGRA 1XW5A 3LYKA 1OKDA 2EIOA 3R2QA 4JEDA 1GSYA 1YZXA 4TOPA 3DWVA 3ZFLA 2ZNMA 2V6OA 3GX0A 1SVOA 2R6KA 3WYWA 4N30A 4ZL7A 5ELAA 1Z6NA 1FVJA 2PU9C 2VL3A 5H5SA 1H4OA 1A2LA 1ERUA 3EMPA 1TU7A 3NOFA 3VI7A 3LXZA 5ECOB 5J9CA 1GRXA 3W8SA 1F3BA 4TW5A 2HSYA 2L6DA 2DMLA 4IS0A 4AJ8A 3HMJG 5CRGA 3KZQA 2GSTA 2L6CA 2HE3A 1FG4A 3TOTA 3I9V2 1X9SB 2CVBA 1GSEA 4OCEA 5A5KA 6GSSA 3GFKA 2DJKA 2VUPA 5A5HA 3IK9A 1G7OA 1XWCA 1O8XA 3ZVJD 2JADA 5A5HB 5COHA 1CQGA 2CT6A 1MTCA 1B9XC 2YP6A 2IJYA 3BBYA 2H0HA 5GSTA 4F2IA 5ECMB 4KCEA 3HY2A 5INYA 3IAM2 1ILOA 4ID0A 4IKHA 1JLVA 1UN2A 1ST9A 4QL9A 3FR9A 1A2MA 3FR3A 5CNWA 4E8EA 1FW1A 4PUFC 5AIXA 4XTSA 3CTGA 1GNEA 3F8UA 3UJ1A 3FZAA 2LKUA 3PR8A 2VCXA 1O6JA 5KN0A 4RI6A 2LRTA 4AGSA 2DSAA 10GSA 3EU3A 3KXOA 2D2ZA 2B5XA 1PX7A 1XFLA 4JE1A 1T4YA 4O5UA 1MD3A 4KH7A 2VAFA 4L8EA 2R2JA 4IVFA 4I6XA 2H1AA 3DYRA 4ULXA 2AB6A 4KF9A 2BTOT 4LL4B 1VF4A 5E4WA 2OA7A 2H0GA 2L5LA 4TVEA 4ICYA 4MH3A 3H4KA 5F07A 3CHXC 5HR0A 1JZOA 4CY8A 3IC8A 5ECHB 4FH8A 3L9UA 1PN0A 5AGYA 2IMDA 4EUYA 3EC3A 1K0NA 1SKSB 2YNXA 4K8MA 1T8EB 1FHEA 2DMMA 3WGDA 3PPUA 4CW9A 1X5CA 1AQVA 4MJAA 3TKPA 2WFCA 3QOUA 2R0CA 3Q18A 2O87A 2V32A 2C4JA 5B8BA 4ZBAA 4MF7A 8GSSA 3ZMKA 1YKAA 2EFCA 4PX1A 2QA2A 2PGTA 3WGEA 2GT6A 3GNJA 1GULA 4TXOB 3IV4A 2KP2A 3DIEA 19GSA 2CA8A 1N2AA 4K1FA 2H76A 1FOVA 3C8EA 1FVKA 4ECBA 2H30A 2GGTA 3GH6A 4F0CA 2DBCA 3O3TA 1AQWA 2FWFA 5IO2A 1TU8A 2K18A 2KLXA 2CV4A 4GTUA 5CYYA 1PKWA 3ME8A 3HJPA 2G0FA 2O85A 5DJLA 2MMZA 2PUKC 1GH2A 4G2EA 3GKNA 2IMIA 1OVNA 2OKAA 2H8LA 4EC0A 4GF0A 4I2UA 5B6MA 1SD8A 4I97A 4AKXB 3FW2A 2HSNB 3ERFA 1EWXA 4TXVA 3QAGA 3ZZXA 2H74A 3TU3B 4PURA 1XWBA 1A23A 4ZILA 3ZRDA 4WKWA 1M9BA 1SKRB 3HXSA 5JCGA 3HVSA 1GSFA 2NTOA 2YWMA 3APOA 4TR0A 1UC7A 3MYDA 1Y6EA 5GSSA 1PGTA 1O85A 1HQOA 5D93A 4BWQA 4ZB8A 4EDYA 3TJKA 3MNGA 2HQTA 1G0TA 1MEKA 4OFTA 2O5VA 4OFMA 1VF1A 1A0RP 5G1LA 3ZITA 3A2VA 2VM1A 2DJ1A 3S9FA 6GSVA 5LNKe 5IIZA 4AI6A 2M46A 3SWLA 1F2EA 4Q5NA 4AJ6A 2WW2A 2B1LA 1OKTA 2OACA 1YJ6A 4KUNA 1R5AA 1SU9A 3QPMA 2LNSA 1KEBA 4V2MA 4K6XA 1USBA 1M2AA 3FR6A 2K8SA 4MZBA 1MDIA 2KOKA 5F05A 2HRNA 4ECIA 5G1KA 4GDFA 5ECKB 3E0UA 1QUWA 5EY6A 4HOJA 6GSWA 3GURA 3HVXA 3D0ZA 5CRDA 5JWRB 3GTUA 4GXZA 4POLA 2DJ2A 4ML1A 5CP1A 5H5RA 1XW9A 4XHMA 3GTUB 3TKSC 1PFOA 1GTAA 4GWRA 1GUHA 2F3MA 5HFKA 3IR4A 3E3EA 2A2PA 4G01A 1SK0A 1SKWB 2REMA 2GSSA 3QFBC 2WULA 2VIMA 1SK1A 4ZL8A 1NM3A 4CDOA 3Q74A 2H1DA 4QMKA 3LJRA 3HZ8A 5C00A 4NAXA 4F03A 2V2GA 1T3BA 2LNTA 3MIXA 4K5RA 5F06A 3APSA 2JL4A 4POKA 1BG1A 3UVTA 3CSIA 1S3RA 4L0WA 18GSA 4Z7XA 2LUSA 1SJZA 2JU5A 3GKXA 1QQ2A 4HQZA 4GSSA 1TTZA 5IMZA 1XWAA 5ECPB 3ZMLA 1AW9A 1BYEA 1KBNA 4GCIA 3MSZA 3HDCA 2H72A 1JHBA 4YH2A 1AAZA 1ERWA 2LRNA 2VLVA 5CRHA 2LSTA 5EVOA 2BJXA 2WGRA 3IE3A 2E2MA 2HLSA 1ML6A 2CAIA 5D9TA 4OFNA 1T7PB 2GS3A 2R5GA 4ZXGA 4EVMA 3ZYWA 5IM9A 1FB0A 1QMVA 4HZ2A 5JCWA 2A4VA 5F0GA 1PKZA 4GQCA 1S3CA 3TRXA 1M0UA 5DQSA 5IMAA 1GTIA 4K0GA 2IL3A 2E0QA 5A4VA 3I6AA 4KAEA 2L4QA 4MP4A 3IK7A 1ACVA 3TB2A 4O32A 2OADA 1HNAA 4V2LA 5DAKA 3ZL5A 1WJKA 3C1RA 2VCWA 4IBPA 6GSXA 6GSTA 1M9AA 5DAKB 2GDRA 1GUKA 2GTUA 3VPQA 5IOXA 1Z6MA 4GRFA 3G9BA 7GSSA 2PERA 2CVKA 3VK9A 2NDOA 2WCIA 2DIZA 1NHOA 1ZCPA 3CMIA 3F9UA 2GT5A 1ZYEA 3F3QA
chains in the Genus database with same CATH topology
2CX3A 3KTLA 3VWUA 1VF3A 2B5EA 1R26A 2E2GA 2JZRA 1OYJA 3TDGA 4HJMA 16GSA 3HHVA 2YCDA 1RQMA 2E7PA 4N3ZA 1O7UA 3GMFA 2LQQA 1T1VA 2TRCP 5J5NA 1ERTA 4PGTA 3LEFA 3CBUA 5G30A 3LYPA 3KH9A 3TUEA 4G0KA 4TR4A 1DUGA 1ZMAA 3TKSA 2QGVA 3H1NA 2NVLA 2F8AA 2MZCA 1THXA 2H0IA 4FO5A 5A1NA 3A5WA 4N0VA 5HR2A 2WRTA 2O7KA 2I3YA 3EINA 5A1NB 2GQMA 1TK5B 5J3RA 3IRAA 1W89A 2CVDA 2I9HA 1ZYQB 3L9VA 2DJ0A 3DGQA 4GSTA 4WBJA 1BQ7A 3PINA 3DEXA 2DC5A 4YQUA 1QGVA 1O73A 4DEJA 3HJOA 2ON7A 4L5OA 4MPGA 5DJMA 1NW2A 2GZYA 4FQUA 1YF1A 4D73A 1B4QA 3BOAA 3UMAA 1YY7A 3OR5A 1MD4A 4WETA 4G0LA 2J23A 4D73B 5ID2B 5G5FA 5HFGA 4F82A 2MYGA 4MNNA 1HYUA 1XBSA 1QK8A 3KM6A 3GH9A 3KGKA 1T00A 1Q98A 1M99A 3Q19A 1PD21 2LS5A 1I5GA 5BMUA 4ZIJA 4GQFA 4Q5RA 2X4AA 4XCSA 5KEJA 3DXBA 1EEMA 3M9JA 3KD0A 1KTEA 1GTUA 5BMUB 4HQSA 5ECIB 3L4NA 3BCIA 2AHEA 5EPFA 1BX9A 2G2QA 3GV1A 3LQ7A 1EP8A 5CREA 1U6TA 2VLUA 2IN3A 4ACSA 2DIYA 2F8FA 1O81A 1X5EA 1WMJA 4NWYA 4LL1B 1TK8B 4PQIA 2LJKA 2KHPA 2GSQA 1U3AA 5J41A 4V1Ap 2XHFA 1TP9A 5HR3A 2VL2C 1GSDA 1J08A 5DDLA 3LGCA 2LRCA 1B4PA 3GN3A 1YQ1A 3DVXA 5D8IA 4POMA 3IHQA 2H71A 1KNGA 1Z7PA 1BAYA 1K0OA 3TJGA 4MCUA 1XIYA 1SL2B 2JSYA 5FHIA 1F6MC 2AUVA 1MDKA 1W4VA 2RUFA 4K5SA 5IMFA 2H6XA 1EV9A 4MF5A 4JR4A 4NV5A 4BA7A 2GQKA 4K0NA 5J4UA 1EV4A 3FHKA 4WR5A 4TXOA 1OC9A 5DBQA 1GSQA 1AUCA 5ECNB 3M0FA 2K9FA 2HXKA 2L57A 3MDKA 2XBIA 3GL3A 4PQ1A 3D6IA 1OC9B 2CAQA 4P3YB 3JCML 2R0GA 1JZWA 2C80A 4ZBBA 3CXGA 3V1WA 2GSRA 3DVWA 5ECLB 3WD6A 1R4WA 1SL1B 2RUEA 4IHUA 4MA9A 2QSIA 1OE7A 2F51A 2H73A 1Z9HA 3FY7A 5J40A 1BG5A 1LU4A 4YKGA 4ML6A 4TR1B 4PNGA 2PVOC 2CZ3A 4MZWA 4IW9A 2IFQA 4IGJA 3F3RA 2ZCTA 2HSNA 2IFQB 2OE1A 1SENA 4KB3A 3RPPA 1RW1A 1PMTA 4DSSA 20GSA 2HRAA 1NSWA 3ZTLA 1Z3EA 4LMWA 2B3SA 2HZFA 1X5DA 5A4WA 2C8UA 2H6ZA 3AY8A 4DSSB 4RQRA 2VO4A 2ALBA 2P5QA 4RUVA 5DQYA 2VCTA 3VWXA 4ZL9A 2IMKA 2FHEA 5JWOB 4MMMA 2R37A 1ZYNA 4LA1A 2FNOA 4KDUA 4XS1A 3ERGA 1FAAA 3ZIVA 3GYKA 4IQAA 1TW9A 3EURA 2H1LA 1DE1A 2C0DA 4I5QA 1IYIA 2BMXA 4MABA 4KE3A 5GAND 3IC4A 4EXJA 5C04A 4K7OA 3GL5A 3VWWA 1ABAA 1VGLA 2K8VA 2ZUPA 5FWGA 3PGTA 4JBBA 3M9KA 4NHZA 1AQXA 13GSA 2X8CA 17GSA 1QFNA 2L59A 2CQ9A 5KOWA 3P7XA 5HR1A 4KGIA 2RM5A 3BD2A 1ZYPA 1M2BA 2HRFA 2AYTA 1ZGNA 2OJLA 1OAZA 3QDNA 4J2FA 3GKMA 4YQVA 4MLYA 11GSA 4AKHA 4WXTA 3VPTA 1EEJA 1YDKA 4TN8A 1I9DA 4G19A 3IOSA 5GAPD 3W6GA 4IJ3A 1TKDB 1HNBA 4USSA 4ZB9A 2MMOA 2VD1A 1TOFA 3A5IA 5J4YA 3RPNA 1K3LA 2VCZA 3P90A 5ECRB 4E68A 3F6DA 4BPYA 4KDXA 1PQNA 2FLSA 3CTFA 1ON4A 1SL0B 3QMXA 3A2XA 1G6YA 3FK8A 1AXDA 4OO5A 2YJHA 4ZB6A 4BVYA 3FZ4A 1E6BA 3DD3A 6GSUA 2FWEA 2M72A 3IXRA 4V2NA 2YZUA 4BVYB 1Z7RA 1PA3A 2X8HA 1E2YA 5LD0A 1GLQA 2UZ8A 3U6VA 3K8NA 1GL8A 1GP1A 4AKIA 4TKYA 3FRCA 3NZNA 1WRYA 3IDVA 1A2JA 3CYNA 4Z2TA 1JZDA 4AKGA 4JU5A 3LG6A 2XC2A 1X9WB 4Z2UA 3M1GA 1Y1UA 5EL8A 4HJ2A 1YKCA 2YPMA 4IELA 4MJBA 4PTSA 2A2RA 1XZOA 4X0XA 2B5YA 2RIIA 4GSNA 1ERVA 1K0BA 4MF6A 4O7HA 2HRKB 4NV2A 3QCPA 1GLPA 1SVLA 2OBKA 2C1YA 1V2AA 3VURA 4EIPA 3UBLA 1ZL9A 2H01A 5HQPA 4HUAA 2QA1A 3RAZA 3G7JA 4EO3A 1Q4JA 5DALA 4O92A 3C73A 1LBKA 5LCZA 4CY6A 5DALB 1UA5A 1WIKA 3TRQA 4MK3A 2A2SA 1EP7A 3KH7A 4J56E 4MZCA 2IIYA 1WP0A 4QQ7A 5IQYA 4XRDA 3ZREA 4K2XA 3BJ5A 2IMFA 2J9HA 3DMLA 3TOUA 4WF4A 5B6NA 5B7CA 4IP6A 2QKEA 3FZ5A 2JSZA 4Z2RA 5GZZB 1B9YC 3US3A 5E59A 2WS2A 1TRUA 4HDEA 2R3XA 1U88A 2H19A 4WBRD 3ED3A 1YEPA 2C0FA 4TRXA 3QFAC 3IBHA 1R5PA 1VF2A 1SJ6A 1F37A 4XS4A 4CHSA 4ECJA 4ECCA 3IAS2 2X8GA 2FWHA 1GNWA 2M80A 3U5RE 1SYXA 4KA0A 1TK0B 4XIHA 3TKRA 1EGOA 4XS4B 1Z5YE 1SVMA 3UARA 2PWJA 3EE2A 4W66A 1TXXA 2KP1A 3KEBA 1C72A 1XOAA 4I8BA 4FYUA 2GZZA 1XVWA 5IMCA 1U87A 3TJBA 4PUAA 2PPTA 3M8NA 2XPEA 4NMUA 4YAPA 4X43A 3TKSE 1A24A 1TXUA 3F4RA 2P0GA 2QC7A 5IMDA 4OWYA 1TRSA 3HVVA 3MWHA 3TKQA 5AN1A 2C3NA 3HCZA 4N11A 1K0MA 2RM6A 3WGXA 2R0PA 3D21A 2L5OA 4I2TA 3CRUA 1SD9A 4KW6A 1MDJA 2GZPA 3SBCA 2H6YA 5JWQB 4OD7A 2B6MA 1PX6A 3UIWA 3KJYA 1K3YA 4EDZA 3E9JB 5ID2A 4KSMA 4JRRA 3EWLA 4BVXA 2H70A 3HA9A 1N8JA 5IPGA 1JFUA 3A3TA 3VI5A 4BVXB 2LQOA 1GUMA 2UV8G 3A2WA 4MPFA 2VM2A 3KMOA 2B7KA 4G0IA 4ILFA 5CO3A 2DLXA 1PRXA 2VKZG 1J0FA 1AIUA 5ECSA 1OC8A 1V98A 1XXUA 1IYHA 3BCKA 1R7HA 3ERWA 4O5RA 3R3EA 1XW6A 4GLTA 1F3AA 1XPVA 4OCFA 5KN3A 1O8WA 3L78A 3RBTA 1YF0A 2RLIA 2H1BA 2YV7A 2H75A 2VD0A 4BWSA 3TJFA 22GSA 5J9BA 3FZ9A 2LV3A 1HD2A 2B7JA 3ZLPA 4AJ7A 2C3TA 2EIRA 3CRTA 3FEUA 3UEMA 1SK2A 4DSQA 1EZKA 3GIXA 3ISOA 5DCHA 1YEXA 1TRWA 4HU7A 1TJDA 2H66A 2P31A 4IQ1A 3UAPA 5ECQB 4H86A 1WE0A 3KTBA 5B8AA 4MDCA 2TRXA 4OO4A 4YQMA 5A4UA 5J47A 4MH2A 1U3IA 3GKKA 3CWGA 5HFIA 3CSJA 4F9ZA 4L5LA 4HU9A 3FMWA 1K0CA 2LTKA 2GVPA 3GX8A 4L0UA 4IP1A 2PMTA 3QR6A 4KCAA 1M7TA 3HJMA 1NHYA 4ISDA 3DKSA 5IMVA 2PBJA 4EKZA 2OE3A 2XBQA 2MMAA 2VCQA 1ZZYA 4HI7A 3Q6OA 2DKIA 1XCCA 5BRTA 3ZVJA 1SYRA 1X0RA 5D9XA 2IMEA 3HKRA 3N5OA 3RDWA 4TR1A 3WT1A 5A34A 4Q5QA 2EC4A 3GSTA 1OE8A 2I81A 2LJAA 2MBSA 1FO5A 4KDYA 2TIRA 4HZ4A 5A34B 1FOHA 2IWTA 3G7IA 4G10A 4DVCA 2HSHA 2FD3A 14GSA 2EIQA 4X1UA 2FCHA 4KSOA 3H8QA 3W8JA 3KMNA 3LW9A 1FB6A 4WF5A 4N0ZA 2AJQB 3DRNA 5ABRA 2V41A 3LSZA 2O8VB 5IPHA 1B48A 3H93A 2MBTA 3O6TA 2AAWA 4MJCA 4XS6A 2ON5A 4RQXA 2YZHA 2CZ2A 5CRWA 1TDIA 3TJJA 2YANA 5D73A 4POBA 2P5RA 1RK4A 1AC1A 5KOXA 1EOHA 3G7YA 1B8XA 2X64A 2KUCA 3KP8A 3HYPA 1LJRA 3QAVA 2JZSA 3LWAA 2X99A 3TGZA 3HZ4A 5L71A 3IHGA 4MJEA 3P2AA 1WOUA 2C3QA 1BJXA 2HSMA 2V1MA 3KP9A 4X4JA 3UVHA 3EPTA 5KN1A 2N5BA 1JZRA 3UBKA 3IPZA 3VLNA 3EU4A 2HSMB 2PN8A 5CAXA 2NBSA 3F6FA 1ZOFA 5IO0A 4HEA2 1J9BA 1M2DA 3HD5A 3F0IA 4IN0A 2HT9A 3D22A 4AF2A 1TRVA 3I69A 4YAVA 2VL2A 3D4TA 3J7Yb 9GSSA 1BEDA 1X9MB 4PXOA 1GTBA 1S3AA 1GSSA 1S3DA 1WPIA 1EOGA 4XRAA 3LFLA 4EIQA 3EYTA 4NXIA 1WWJA 3C71A 5J4VA 4IJIA 1V58A 3C1SA 2F9SA 4DSRA 2GLRA 2EFDA 4LLRA 4TR3A 2HFDA 5G2ZA 2C0EA 2YWIA 4OMVA 2VCVA 2YV9A 4J57E 2FWGA 1N25A 3N9JA 4KNDA 3APQA 4EF0A 3J7Yk 3F4TA 5ENUA 3MAKA 6GSYA 2LEGA 1SJIA 5DVBA 1TI1A 1DBYA 3VFIA 1K3OA 1GWCA 1TI3A 1G6WA 2FUG2 3RHCA 4G9HA 5IOWA 1YVLA 2FA4A 2FY6A 4ZBDA 4F0BA 1XOBA 1QXHA 3KCMA 3GRXA 3ZIJA 1PSQA 5AISA 3QAWA 3CSHA 1THOA 2FA8A 4N10A 5G31A 4NPBA 4FIWA 1A8YA 4O5QA 2A4HA 3IA1A 1H75A 2VLTA 4ZB7A 1GSUA 2VL9A 4K7NA 5DCGA 4RI7A 2HZEA 1HNCA 2HRKA 1XWKA 1A8LA 2I4AA 2L4CA 3F4SA 3PH9A 3ME7A 1DSBA 1V40A 2LJRA 4WR4A 2HZEB 3D5JA 3TCOA 5D9WA 5FT3A 5AIVA 3P8WA 4EE0A 4FYCA 4PNFA 4LMVA 5G5EA 3ZFBA 2FGXA 4E8HA 3GHAA 5D9VA 1PN9A 1JLWA 3O76A 3VWVA 4K9ZA 3EMXA 1XWGA 3NIVA 1DE2A 4A5PA 2DJ3A 1K0DA 2JACA 4FYBA 2B1KA 2HNLA 3LXTA 4K7IA 2WB9A 5KN2A 3F63A 5JCUA 5ELGA 1K0AA 2N5AA 2XPDA 3GA4A 3RHBA 2O89A 3M3MA 2CX4A 1XVQA 2JZTA 2EFHA 1T4ZA 2YWNA 3GUSA 1CQHA 3FYGA 2WJUA 3D4MA 4V1Ag 2C0GA 4EL1A 2YJ7A 1A0FA 1URMA 2YN1A 1UVZA 2NPBA 3I43A 2WZ9A 2IPAA 2OE0A 4QL7A 3FKFA 5F8BA 4Q5FA 2DJJA 2N5FA 2VOCA 2R4VA 2WDUA 3L0HA 2MMNA 2V6KA 4JZQA 3UOMA 4NHWA 2Z9SA 2YOIA 3H79A 4PQHA 3LORA 1BF5A 4HS1A 1V9WA 2GQLA 2I1UA 2DKHA 1G7EA 3EVIA 2OT3A 3UL3A 3TRPA 2K6VA 2YWOA 2AV4A 3QD9A 12GSA 2HI7A 3L9SA 4WEYA 2ES7A 1VRSD 1Y25A 1V57A 2EFEA 4BL7A 3GSSA 4JR6A 1PL2A 2OBIA 2HYXA 5D96A 1PL1A 2PVQA 2H1GA 3C7MA 1OC3A 4YKFA 4KX4A 5H5QA 3WT2A 4K2DA 4BL7B 2X49A 1F9MA 3KIJA 1EGRA 1XW5A 3LYKA 1OKDA 2EIOA 3R2QA 4JEDA 1GSYA 1YZXA 4TOPA 3DWVA 3ZFLA 2ZNMA 2V6OA 3GX0A 1SVOA 2R6KA 3WYWA 4N30A 4ZL7A 5ELAA 1Z6NA 1FVJA 2PU9C 2VL3A 5H5SA 1H4OA 1A2LA 1ERUA 3EMPA 1TU7A 3NOFA 3VI7A 3LXZA 5ECOB 5J9CA 1GRXA 3W8SA 1F3BA 4TW5A 2HSYA 2L6DA 2DMLA 4IS0A 4AJ8A 3HMJG 5CRGA 3KZQA 2GSTA 2L6CA 2HE3A 1FG4A 3TOTA 3I9V2 1X9SB 2CVBA 1GSEA 4OCEA 5A5KA 6GSSA 3GFKA 2DJKA 2VUPA 5A5HA 3IK9A 1G7OA 1XWCA 1O8XA 3ZVJD 2JADA 5A5HB 5COHA 1CQGA 2CT6A 1MTCA 1B9XC 2YP6A 2IJYA 3BBYA 2H0HA 5GSTA 4F2IA 5ECMB 4KCEA 3HY2A 5INYA 3IAM2 1ILOA 4ID0A 4IKHA 1JLVA 1UN2A 1ST9A 4QL9A 3FR9A 1A2MA 3FR3A 5CNWA 4E8EA 1FW1A 4PUFC 5AIXA 4XTSA 3CTGA 1GNEA 3F8UA 3UJ1A 3FZAA 2LKUA 3PR8A 2VCXA 1O6JA 5KN0A 4RI6A 2LRTA 4AGSA 2DSAA 10GSA 3EU3A 3KXOA 2D2ZA 2B5XA 1PX7A 1XFLA 4JE1A 1T4YA 4O5UA 1MD3A 4KH7A 2VAFA 4L8EA 2R2JA 4IVFA 4I6XA 2H1AA 3DYRA 4ULXA 2AB6A 4KF9A 2BTOT 4LL4B 1VF4A 5E4WA 2OA7A 2H0GA 2L5LA 4TVEA 4ICYA 4MH3A 3H4KA 5F07A 5HR0A 1JZOA 4CY8A 3IC8A 5ECHB 4FH8A 3L9UA 1PN0A 5AGYA 2IMDA 4EUYA 3EC3A 1K0NA 1SKSB 2YNXA 4K8MA 1T8EB 1FHEA 2DMMA 3WGDA 3PPUA 4CW9A 1X5CA 1AQVA 4MJAA 3TKPA 2WFCA 3QOUA 2R0CA 3Q18A 2O87A 2V32A 2C4JA 5B8BA 4ZBAA 4MF7A 8GSSA 3ZMKA 1YKAA 2EFCA 4PX1A 2QA2A 2PGTA 3WGEA 2GT6A 3GNJA 1GULA 4TXOB 3IV4A 2KP2A 3DIEA 19GSA 2CA8A 1N2AA 4K1FA 2H76A 1FOVA 3C8EA 1FVKA 4ECBA 2H30A 2GGTA 3GH6A 4F0CA 2DBCA 3O3TA 1AQWA 2FWFA 5IO2A 1TU8A 2K18A 2KLXA 2CV4A 4GTUA 5CYYA 1PKWA 3ME8A 3HJPA 2G0FA 2O85A 5DJLA 2MMZA 2PUKC 1GH2A 4G2EA 3GKNA 2IMIA 1OVNA 2OKAA 2H8LA 4EC0A 4GF0A 4I2UA 5B6MA 1SD8A 4I97A 4AKXB 3FW2A 2HSNB 3ERFA 1EWXA 4TXVA 3QAGA 3ZZXA 2H74A 3TU3B 4PURA 1XWBA 1A23A 4ZILA 3ZRDA 4WKWA 1M9BA 1SKRB 3HXSA 5JCGA 3HVSA 1GSFA 2NTOA 2YWMA 3APOA 4TR0A 1UC7A 3MYDA 1Y6EA 5GSSA 1PGTA 1O85A 1HQOA 5D93A 4BWQA 4ZB8A 4EDYA 3TJKA 3MNGA 2HQTA 1G0TA 1MEKA 4OFTA 2O5VA 4OFMA 1VF1A 1A0RP 5G1LA 3ZITA 3A2VA 2VM1A 2DJ1A 3S9FA 6GSVA 5LNKe 5IIZA 4AI6A 2M46A 3SWLA 1F2EA 4Q5NA 4AJ6A 2B1LA 1OKTA 2OACA 1YJ6A 4KUNA 1R5AA 1SU9A 3QPMA 2LNSA 1KEBA 4V2MA 4K6XA 1USBA 1M2AA 3FR6A 2K8SA 4MZBA 1MDIA 2KOKA 5F05A 2HRNA 4ECIA 5G1KA 4GDFA 5ECKB 3E0UA 1QUWA 5EY6A 4HOJA 6GSWA 3GURA 3HVXA 3D0ZA 5CRDA 5JWRB 3GTUA 4GXZA 4POLA 2DJ2A 4ML1A 5CP1A 5H5RA 1XW9A 4XHMA 3GTUB 3TKSC 1GTAA 4GWRA 1GUHA 2F3MA 5HFKA 3IR4A 3E3EA 2A2PA 4G01A 1SK0A 1SKWB 2REMA 2GSSA 3QFBC 2WULA 2VIMA 1SK1A 4ZL8A 1NM3A 4CDOA 3Q74A 2H1DA 4QMKA 3LJRA 3HZ8A 5C00A 4NAXA 4F03A 2V2GA 1T3BA 2LNTA 3MIXA 4K5RA 5F06A 3APSA 2JL4A 4POKA 1BG1A 3UVTA 3CSIA 4L0WA 18GSA 4Z7XA 2LUSA 1SJZA 2JU5A 3GKXA 1QQ2A 4HQZA 4GSSA 1TTZA 5IMZA 1XWAA 5ECPB 3ZMLA 1AW9A 1BYEA 1KBNA 4GCIA 3MSZA 3HDCA 2H72A 1JHBA 4YH2A 1AAZA 1ERWA 2LRNA 2VLVA 5CRHA 2LSTA 5EVOA 2BJXA 2WGRA 3IE3A 2E2MA 2HLSA 1ML6A 2CAIA 5D9TA 4OFNA 1T7PB 2GS3A 2R5GA 4ZXGA 4EVMA 3ZYWA 5IM9A 1FB0A 1QMVA 4HZ2A 5JCWA 2A4VA 5F0GA 1PKZA 4GQCA 1S3CA 3TRXA 1M0UA 5DQSA 5IMAA 1GTIA 4K0GA 2IL3A 2E0QA 5A4VA 3I6AA 4KAEA 2L4QA 4MP4A 3IK7A 1ACVA 3TB2A 4O32A 2OADA 1HNAA 4V2LA 5DAKA 3ZL5A 1WJKA 3C1RA 2VCWA 4IBPA 6GSXA 6GSTA 1M9AA 5DAKB 2GDRA 1GUKA 2GTUA 3VPQA 5IOXA 1Z6MA 4GRFA 3G9BA 7GSSA 2PERA 2CVKA 3VK9A 2NDOA 2WCIA 2DIZA 1NHOA 1ZCPA 3CMIA 3F9UA 2GT5A 1ZYEA 3F3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX3 A;  3KTL A;  3VWU A;  1VF3 A;  2B5E A;  1R26 A;  2E2G A;  2JZR A;  1OYJ A;  3TDG A;  4HJM A;  16GS A;  3HHV A;  2YCD A;  1RQM A;  2E7P A;  1O7U A;  3GMF A;  2LQQ A;  1T1V A;  2TRC P;  5J5N A;  1ERT A;  4PGT A;  3LEF A;  3CBU A;  5G30 A;  3LYP A;  3KH9 A;  3TUE A;  4G0K A;  4TR4 A;  1DUG A;  1ZMA A;  3TKS A;  2QGV A;  3H1N A;  2NVL A;  2F8A A;  2MZC A;  1THX A;  2H0I A;  4FO5 A;  3A5W A;  4N0V A;  5HR2 A;  2WRT A;  2O7K A;  2I3Y A;  3EIN A;  2GQM A;  1TK5 B;  5J3R A;  3IRA A;  1W89 A;  2CVD A;  2I9H A;  1ZYQ B;  3L9V A;  2DJ0 A;  3DGQ A;  4GST A;  4WBJ A;  1BQ7 A;  3PIN A;  3DEX A;  2DC5 A;  4YQU A;  1QGV A;  1O73 A;  4DEJ A;  3HJO A;  2ON7 A;  4L5O A;  4MPG A;  5DJM A;  1NW2 A;  2GZY A;  4FQU A;  1YF1 A;  4D73 A;  1B4Q A;  3BOA A;  3UMA A;  1YY7 A;  3OR5 A;  1MD4 A;  4WET A;  4G0L A;  2J23 A;  4D73 B;  5ID2 B;  5G5F A;  5HFG A;  4F82 A;  2MYG A;  1HYU A;  1XBS A;  1QK8 A;  3KM6 A;  3GH9 A;  3KGK A;  1T00 A;  1Q98 A;  1M99 A;  3Q19 A;  1PD2 1;  2LS5 A;  1I5G A;  5BMU A;  4ZIJ A;  4GQF A;  4Q5R A;  4XCS A;  5KEJ A;  3DXB A;  1EEM A;  3M9J A;  3KD0 A;  1KTE A;  1GTU A;  4HQS A;  5ECI B;  3L4N A;  3BCI A;  2AHE A;  5EPF A;  1BX9 A;  2G2Q A;  3GV1 A;  3LQ7 A;  1EP8 A;  5CRE A;  1U6T A;  2VLU A;  2IN3 A;  4ACS A;  2DIY A;  2F8F A;  1O81 A;  1X5E A;  1WMJ A;  4NWY A;  4LL1 B;  1TK8 B;  4PQI A;  2LJK A;  2KHP A;  2GSQ A;  1U3A A;  5J41 A;  4V1A p;  2XHF A;  1TP9 A;  5HR3 A;  2VL2 C;  1GSD A;  1J08 A;  5DDL A;  3LGC A;  2LRC A;  1B4P A;  3GN3 A;  1YQ1 A;  3DVX A;  5D8I A;  4POM A;  3IHQ A;  2H71 A;  1KNG A;  1Z7P A;  1BAY A;  1K0O A;  3TJG A;  4MCU A;  1XIY A;  1SL2 B;  2JSY A;  5FHI A;  1F6M C;  2AUV A;  1MDK A;  1W4V A;  2RUF A;  5IMF A;  2H6X A;  1EV9 A;  4MF5 A;  4JR4 A;  4NV5 A;  4BA7 A;  2GQK A;  4K0N A;  5J4U A;  1EV4 A;  3FHK A;  4WR5 A;  4TXO A;  1OC9 A;  5DBQ A;  1GSQ A;  1AUC A;  5ECN B;  3M0F A;  2K9F A;  2HXK A;  2L57 A;  3MDK A;  2XBI A;  3GL3 A;  4PQ1 A;  3D6I A;  1OC9 B;  2CAQ A;  4P3Y B;  3JCM L;  1JZW A;  2C80 A;  4ZBB A;  3CXG A;  3V1W A;  2GSR A;  3DVW A;  5ECL B;  3WD6 A;  1R4W A;  1SL1 B;  2RUE A;  4IHU A;  4MA9 A;  2QSI A;  1OE7 A;  2F51 A;  2H73 A;  1Z9H A;  3FY7 A;  1BG5 A;  1LU4 A;  4ML6 A;  4TR1 B;  4PNG A;  2PVO C;  2CZ3 A;  4MZW A;  4IW9 A;  2IFQ A;  4IGJ A;  3F3R A;  2ZCT A;  2IFQ B;  2OE1 A;  1SEN A;  4KB3 A;  3RPP A;  1RW1 A;  1PMT A;  4DSS A;  20GS A;  2HRA A;  1NSW A;  3ZTL A;  1Z3E A;  4LMW A;  2B3S A;  2HZF A;  1X5D A;  5A4W A;  2C8U A;  2H6Z A;  3AY8 A;  4DSS B;  4RQR A;  2VO4 A;  2ALB A;  2P5Q A;  4RUV A;  5DQY A;  2VCT A;  3VWX A;  4ZL9 A;  2IMK A;  2FHE A;  5JWO B;  4MMM A;  2R37 A;  4LA1 A;  2FNO A;  4KDU A;  4XS1 A;  3ERG A;  1FAA A;  3ZIV A;  3GYK A;  4IQA A;  1TW9 A;  3EUR A;  1DE1 A;  2C0D A;  4I5Q A;  1IYI A;  2BMX A;  4MAB A;  4KE3 A;  5GAN D;  3IC4 A;  4EXJ A;  5C04 A;  4K7O A;  3GL5 A;  3VWW A;  1ABA A;  1VGL A;  2K8V A;  2ZUP A;  5FWG A;  3PGT A;  4JBB A;  3M9K A;  4NHZ A;  1AQX A;  13GS A;  2X8C A;  17GS A;  1QFN A;  2L59 A;  2CQ9 A;  3P7X A;  5HR1 A;  4KGI A;  2RM5 A;  3BD2 A;  1M2B A;  2HRF A;  2AYT A;  1ZGN A;  2OJL A;  1OAZ A;  3QDN A;  4J2F A;  3GKM A;  4YQV A;  4MLY A;  11GS A;  4WXT A;  3VPT A;  1EEJ A;  1YDK A;  4TN8 A;  1I9D A;  4G19 A;  3IOS A;  5GAP D;  3W6G A;  4IJ3 A;  1TKD B;  1HNB A;  4USS A;  4ZB9 A;  2MMO A;  2VD1 A;  1TOF A;  3RPN A;  1K3L A;  2VCZ A;  3P90 A;  5ECR B;  3F6D A;  4BPY A;  4KDX A;  1PQN A;  2FLS A;  3CTF A;  1ON4 A;  1SL0 B;  3QMX A;  3A2X A;  1G6Y A;  3FK8 A;  1AXD A;  4OO5 A;  2YJH A;  4ZB6 A;  4BVY A;  3FZ4 A;  1E6B A;  3DD3 A;  6GSU A;  2FWE A;  2M72 A;  3IXR A;  4V2N A;  2YZU A;  4BVY B;  1Z7R A;  1PA3 A;  2X8H A;  1E2Y A;  5LD0 A;  1GLQ A;  2UZ8 A;  3U6V A;  3K8N A;  1GL8 A;  1GP1 A;  4TKY A;  3FRC A;  3NZN A;  1WRY A;  3IDV A;  1A2J A;  3CYN A;  1JZD A;  4JU5 A;  3LG6 A;  2XC2 A;  1X9W B;  3M1G A;  5EL8 A;  4HJ2 A;  1YKC A;  2YPM A;  4IEL A;  4MJB A;  4PTS A;  2A2R A;  1XZO A;  4X0X A;  2B5Y A;  2RII A;  4GSN A;  1ERV A;  1K0B A;  4MF6 A;  4O7H A;  2HRK B;  4NV2 A;  3QCP A;  1GLP A;  2OBK A;  2C1Y A;  1V2A A;  3VUR A;  3UBL A;  1ZL9 A;  2H01 A;  5HQP A;  4HUA A;  3RAZ A;  3G7J A;  4EO3 A;  1Q4J A;  5DAL A;  4O92 A;  3C73 A;  1LBK A;  5LCZ A;  5DAL B;  1UA5 A;  1WIK A;  3TRQ A;  4MK3 A;  2A2S A;  1EP7 A;  3KH7 A;  4J56 E;  4MZC A;  2IIY A;  1WP0 A;  4QQ7 A;  5IQY A;  4XRD A;  3ZRE A;  3BJ5 A;  2IMF A;  2J9H A;  3DML A;  3TOU A;  4WF4 A;  5B6N A;  5B7C A;  4IP6 A;  2QKE A;  3FZ5 A;  2JSZ A;  5GZZ B;  1B9Y C;  3US3 A;  5E59 A;  2WS2 A;  1TRU A;  4HDE A;  2R3X A;  1U88 A;  2H19 A;  4WBR D;  3ED3 A;  1YEP A;  2C0F A;  4TRX A;  3QFA C;  3IBH A;  1R5P A;  1VF2 A;  1SJ6 A;  1F37 A;  4XS4 A;  4CHS A;  4ECJ A;  4ECC A;  3IAS 2;  2X8G A;  2FWH A;  1GNW A;  2M80 A;  3U5R E;  1SYX A;  4KA0 A;  1TK0 B;  4XIH A;  3TKR A;  1EGO A;  4XS4 B;  1Z5Y E;  3UAR A;  2PWJ A;  3EE2 A;  1TXX A;  2KP1 A;  3KEB A;  1C72 A;  1XOA A;  4I8B A;  4FYU A;  2GZZ A;  1XVW A;  5IMC A;  1U87 A;  3TJB A;  4PUA A;  2PPT A;  3M8N A;  2XPE A;  4NMU A;  4YAP A;  4X43 A;  3TKS E;  1A24 A;  3F4R A;  2P0G A;  2QC7 A;  5IMD A;  4OWY A;  1TRS A;  3HVV A;  3MWH A;  3TKQ A;  5AN1 A;  2C3N A;  3HCZ A;  4N11 A;  1K0M A;  2RM6 A;  3WGX A;  3D21 A;  2L5O A;  4I2T A;  3CRU A;  1SD9 A;  4KW6 A;  1MDJ A;  2GZP A;  3SBC A;  2H6Y A;  5JWQ B;  4OD7 A;  2B6M A;  1PX6 A;  3UIW A;  3KJY A;  1K3Y A;  4EDZ A;  3E9J B;  5ID2 A;  4KSM A;  4JRR A;  3EWL A;  4BVX A;  2H70 A;  3HA9 A;  1N8J A;  5IPG A;  1JFU A;  3A3T A;  3VI5 A;  4BVX B;  2LQO A;  1GUM A;  3A2W A;  4MPF A;  2VM2 A;  3KMO A;  2B7K A;  4G0I A;  4ILF A;  5CO3 A;  2DLX A;  1PRX A;  1J0F A;  1AIU A;  5ECS A;  1OC8 A;  1V98 A;  1XXU A;  1IYH A;  3BCK A;  1R7H A;  3ERW A;  4O5R A;  3R3E A;  1XW6 A;  4GLT A;  1F3A A;  1XPV A;  4OCF A;  5KN3 A;  1O8W A;  3L78 A;  3RBT A;  1YF0 A;  2RLI A;  2H1B A;  2YV7 A;  2H75 A;  2VD0 A;  4BWS A;  3TJF A;  22GS A;  5J9B A;  3FZ9 A;  2LV3 A;  1HD2 A;  2B7J A;  3ZLP A;  4AJ7 A;  2C3T A;  2EIR A;  3CRT A;  3FEU A;  3UEM A;  1SK2 A;  4DSQ A;  1EZK A;  3GIX A;  3ISO A;  5DCH A;  1YEX A;  1TRW A;  4HU7 A;  1TJD A;  2H66 A;  2P31 A;  4IQ1 A;  3UAP A;  5ECQ B;  4H86 A;  1WE0 A;  3KTB A;  5B8A A;  4MDC A;  2TRX A;  4OO4 A;  4YQM A;  5A4U A;  4MH2 A;  1U3I A;  3GKK A;  5HFI A;  3CSJ A;  4F9Z A;  4L5L A;  4HU9 A;  1K0C A;  2LTK A;  2GVP A;  3GX8 A;  4L0U A;  4IP1 A;  2PMT A;  3QR6 A;  4KCA A;  1M7T A;  3HJM A;  1NHY A;  4ISD A;  3DKS A;  5IMV A;  2PBJ A;  4EKZ A;  2OE3 A;  2XBQ A;  2MMA A;  2VCQ A;  1ZZY A;  4HI7 A;  3Q6O A;  1XCC A;  3ZVJ A;  1SYR A;  1X0R A;  5D9X A;  2IME A;  3HKR A;  3N5O A;  3RDW A;  4TR1 A;  3WT1 A;  4Q5Q A;  2EC4 A;  3GST A;  1OE8 A;  2I81 A;  2LJA A;  2MBS A;  1FO5 A;  4KDY A;  2TIR A;  4HZ4 A;  2IWT A;  3G7I A;  4G10 A;  4DVC A;  2HSH A;  2FD3 A;  14GS A;  2EIQ A;  4X1U A;  2FCH A;  4KSO A;  3H8Q A;  3W8J A;  3KMN A;  1FB6 A;  4WF5 A;  4N0Z A;  2AJQ B;  3DRN A;  5ABR A;  2V41 A;  3LSZ A;  2O8V B;  5IPH A;  1B48 A;  3H93 A;  2MBT A;  3O6T A;  2AAW A;  4MJC A;  4XS6 A;  2ON5 A;  4RQX A;  2YZH A;  2CZ2 A;  5CRW A;  1TDI A;  3TJJ A;  2YAN A;  5D73 A;  4POB A;  2P5R A;  1RK4 A;  1AC1 A;  1EOH A;  3G7Y A;  1B8X A;  2X64 A;  2KUC A;  3KP8 A;  3HYP A;  1LJR A;  3QAV A;  2JZS A;  3LWA A;  2X99 A;  3TGZ A;  3HZ4 A;  5L71 A;  4MJE A;  3P2A A;  1WOU A;  2C3Q A;  1BJX A;  2HSM A;  2V1M A;  3KP9 A;  3UVH A;  5KN1 A;  2N5B A;  1JZR A;  3UBK A;  3IPZ A;  3VLN A;  3EU4 A;  2HSM B;  2PN8 A;  5CAX A;  2NBS A;  3F6F A;  1ZOF A;  5IO0 A;  4HEA 2;  1J9B A;  1M2D A;  3HD5 A;  3F0I A;  4IN0 A;  2HT9 A;  3D22 A;  4AF2 A;  1TRV A;  3I69 A;  4YAV A;  2VL2 A;  3D4T A;  3J7Y b;  9GSS A;  1BED A;  1X9M B;  4PXO A;  1GTB A;  1S3A A;  1GSS A;  1S3D A;  1WPI A;  1EOG A;  4XRA A;  3LFL A;  3EYT A;  4NXI A;  1WWJ A;  3C71 A;  4IJI A;  1V58 A;  3C1S A;  2F9S A;  4DSR A;  2GLR A;  4LLR A;  4TR3 A;  2HFD A;  5G2Z A;  2C0E A;  2YWI A;  4OMV A;  2VCV A;  2YV9 A;  4J57 E;  2FWG A;  3N9J A;  4KND A;  3APQ A;  4EF0 A;  3J7Y k;  3F4T A;  5ENU A;  3MAK A;  6GSY A;  2LEG A;  1SJI A;  5DVB A;  1TI1 A;  1DBY A;  3VFI A;  1K3O A;  1GWC A;  1TI3 A;  1G6W A;  2FUG 2;  3RHC A;  4G9H A;  5IOW A;  2FA4 A;  2FY6 A;  4ZBD A;  4F0B A;  1XOB A;  1QXH A;  3KCM A;  3GRX A;  3ZIJ A;  1PSQ A;  5AIS A;  3QAW A;  3CSH A;  1THO A;  2FA8 A;  4N10 A;  5G31 A;  4NPB A;  4FIW A;  1A8Y A;  3IA1 A;  1H75 A;  2VLT A;  1GSU A;  2VL9 A;  4K7N A;  5DCG A;  4RI7 A;  2HZE A;  1HNC A;  2HRK A;  1XWK A;  1A8L A;  2I4A A;  2L4C A;  3F4S A;  3PH9 A;  3ME7 A;  1DSB A;  1V40 A;  2LJR A;  4WR4 A;  2HZE B;  3D5J A;  3TCO A;  5D9W A;  5FT3 A;  5AIV A;  3P8W A;  4EE0 A;  4FYC A;  4PNF A;  4LMV A;  5G5E A;  3ZFB A;  2FGX A;  4E8H A;  3GHA A;  5D9V A;  1PN9 A;  1JLW A;  3O76 A;  3VWV A;  4K9Z A;  3EMX A;  1XWG A;  3NIV A;  1DE2 A;  2DJ3 A;  1K0D A;  2JAC A;  4FYB A;  2B1K A;  2HNL A;  3LXT A;  4K7I A;  2WB9 A;  5KN2 A;  3F63 A;  5JCU A;  5ELG A;  1K0A A;  2N5A A;  2XPD A;  3GA4 A;  3RHB A;  2O89 A;  3M3M A;  2CX4 A;  1XVQ A;  2JZT A;  1T4Z A;  2YWN A;  3GUS A;  1CQH A;  3FYG A;  2WJU A;  3D4M A;  4V1A g;  2C0G A;  4EL1 A;  2YJ7 A;  1A0F A;  1URM A;  2YN1 A;  1UVZ A;  2NPB A;  3I43 A;  2WZ9 A;  2IPA A;  2OE0 A;  4QL7 A;  3FKF A;  5F8B A;  4Q5F A;  2DJJ A;  2N5F A;  2VOC A;  2R4V A;  2WDU A;  3L0H A;  2MMN A;  2V6K A;  4JZQ A;  3UOM A;  4NHW A;  2Z9S A;  2YOI A;  3H79 A;  4PQH A;  3LOR A;  4HS1 A;  1V9W A;  2GQL A;  2I1U A;  1G7E A;  3EVI A;  3UL3 A;  3TRP A;  2K6V A;  2YWO A;  2AV4 A;  3QD9 A;  12GS A;  2HI7 A;  3L9S A;  4WEY A;  2ES7 A;  1VRS D;  1Y25 A;  1V57 A;  4BL7 A;  3GSS A;  4JR6 A;  1PL2 A;  2OBI A;  2HYX A;  5D96 A;  1PL1 A;  2PVQ A;  2H1G A;  3C7M A;  1OC3 A;  4KX4 A;  5H5Q A;  3WT2 A;  4K2D A;  4BL7 B;  1F9M A;  3KIJ A;  1EGR A;  1XW5 A;  3LYK A;  1OKD A;  2EIO A;  3R2Q A;  4JED A;  1GSY A;  1YZX A;  4TOP A;  3DWV A;  3ZFL A;  2ZNM A;  2V6O A;  3GX0 A;  3WYW A;  2R6K A;  4N30 A;  4ZL7 A;  5ELA A;  1Z6N A;  1FVJ A;  2PU9 C;  2VL3 A;  5H5S A;  1H4O A;  1A2L A;  1ERU A;  3EMP A;  1TU7 A;  3NOF A;  3VI7 A;  3LXZ A;  5ECO B;  5J9C A;  1GRX A;  3W8S A;  1F3B A;  4TW5 A;  2HSY A;  2L6D A;  2DML A;  4IS0 A;  4AJ8 A;  5CRG A;  3KZQ A;  2GST A;  2L6C A;  2HE3 A;  1FG4 A;  3TOT A;  3I9V 2;  1X9S B;  2CVB A;  1GSE A;  4OCE A;  5A5K A;  6GSS A;  3GFK A;  2DJK A;  2VUP A;  3IK9 A;  1G7O A;  1XWC A;  1O8X A;  3ZVJ D;  2JAD A;  5COH A;  1CQG A;  2CT6 A;  1MTC A;  1B9X C;  2YP6 A;  2IJY A;  3BBY A;  2H0H A;  5GST A;  4F2I A;  5ECM B;  4KCE A;  3HY2 A;  5INY A;  3IAM 2;  1ILO A;  4ID0 A;  4IKH A;  1JLV A;  1UN2 A;  1ST9 A;  4QL9 A;  3FR9 A;  1A2M A;  3FR3 A;  5CNW A;  4E8E A;  1FW1 A;  4PUF C;  5AIX A;  4XTS A;  3CTG A;  1GNE A;  3F8U A;  3UJ1 A;  3FZA A;  2LKU A;  3PR8 A;  2VCX A;  1O6J A;  5KN0 A;  4RI6 A;  2LRT A;  4AGS A;  2DSA A;  10GS A;  3EU3 A;  3KXO A;  2D2Z A;  2B5X A;  1PX7 A;  1XFL A;  4JE1 A;  1T4Y A;  1MD3 A;  4KH7 A;  2VAF A;  4L8E A;  2R2J A;  4IVF A;  4I6X A;  2H1A A;  3DYR A;  4ULX A;  2AB6 A;  4KF9 A;  2BTO T;  4LL4 B;  1VF4 A;  5E4W A;  2OA7 A;  2H0G A;  2L5L A;  4TVE A;  4MH3 A;  3H4K A;  5F07 A;  5HR0 A;  1JZO A;  3IC8 A;  5ECH B;  4FH8 A;  3L9U A;  5AGY A;  2IMD A;  4EUY A;  3EC3 A;  1K0N A;  1SKS B;  2YNX A;  4K8M A;  1T8E B;  1FHE A;  2DMM A;  3WGD A;  3PPU A;  4CW9 A;  1X5C A;  1AQV A;  4MJA A;  3TKP A;  2WFC A;  3QOU A;  3Q18 A;  2O87 A;  2V32 A;  2C4J A;  5B8B A;  4ZBA A;  4MF7 A;  8GSS A;  3ZMK A;  1YKA A;  4PX1 A;  2PGT A;  3WGE A;  2GT6 A;  3GNJ A;  1GUL A;  4TXO B;  3IV4 A;  2KP2 A;  3DIE A;  19GS A;  2CA8 A;  1N2A A;  4K1F A;  2H76 A;  1FOV A;  3C8E A;  1FVK A;  4ECB A;  2H30 A;  2GGT A;  3GH6 A;  4F0C A;  2DBC A;  3O3T A;  1AQW A;  2FWF A;  5IO2 A;  1TU8 A;  2K18 A;  2KLX A;  2CV4 A;  4GTU A;  5CYY A;  1PKW A;  3ME8 A;  3HJP A;  2G0F A;  2O85 A;  5DJL A;  2MMZ A;  2PUK C;  1GH2 A;  4G2E A;  3GKN A;  2IMI A;  1OVN A;  2OKA A;  2H8L A;  4EC0 A;  4GF0 A;  4I2U A;  5B6M A;  1SD8 A;  4I97 A;  3FW2 A;  2HSN B;  3ERF A;  1EWX A;  4TXV A;  3QAG A;  3ZZX A;  2H74 A;  4PUR A;  1XWB A;  1A23 A;  4ZIL A;  3ZRD A;  4WKW A;  1M9B A;  1SKR B;  3HXS A;  5JCG A;  3HVS A;  1GSF A;  2NTO A;  2YWM A;  3APO A;  4TR0 A;  1UC7 A;  1Y6E A;  5GSS A;  1PGT A;  1O85 A;  1HQO A;  5D93 A;  4BWQ A;  4ZB8 A;  4EDY A;  3TJK A;  3MNG A;  2HQT A;  1G0T A;  1MEK A;  4OFT A;  4OFM A;  1VF1 A;  1A0R P;  5G1L A;  3ZIT A;  3A2V A;  2VM1 A;  2DJ1 A;  3S9F A;  6GSV A;  5LNK e;  5IIZ A;  2M46 A;  3SWL A;  1F2E A;  4Q5N A;  4AJ6 A;  2B1L A;  1OKT A;  2OAC A;  1YJ6 A;  4KUN A;  1R5A A;  1SU9 A;  3QPM A;  2LNS A;  1KEB A;  4V2M A;  4K6X A;  1USB A;  1M2A A;  3FR6 A;  2K8S A;  4MZB A;  1MDI A;  2KOK A;  5F05 A;  2HRN A;  4ECI A;  5G1K A;  5ECK B;  3E0U A;  1QUW A;  5EY6 A;  4HOJ A;  6GSW A;  3GUR A;  3HVX A;  3D0Z A;  5CRD A;  5JWR B;  3GTU A;  4GXZ A;  4POL A;  2DJ2 A;  4ML1 A;  5CP1 A;  5H5R A;  1XW9 A;  4XHM A;  3GTU B;  3TKS C;  1GTA A;  4GWR A;  1GUH A;  2F3M A;  5HFK A;  3IR4 A;  3E3E A;  1SK0 A;  1SKW B;  2REM A;  2GSS A;  3QFB C;  2WUL A;  2VIM A;  1SK1 A;  4ZL8 A;  1NM3 A;  4CDO A;  3Q74 A;  2H1D A;  3LJR A;  3HZ8 A;  5C00 A;  4NAX A;  4F03 A;  2V2G A;  1T3B A;  2LNT A;  5F06 A;  3APS A;  2JL4 A;  4POK A;  3UVT A;  3CSI A;  4L0W A;  18GS A;  4Z7X A;  2LUS A;  1SJZ A;  2JU5 A;  3GKX A;  1QQ2 A;  4HQZ A;  4GSS A;  1TTZ A;  5IMZ A;  1XWA A;  5ECP B;  3ZML A;  1AW9 A;  1BYE A;  1KBN A;  4GCI A;  3MSZ A;  3HDC A;  2H72 A;  1JHB A;  4YH2 A;  1AAZ A;  1ERW A;  2LRN A;  2VLV A;  5CRH A;  2LST A;  5EVO A;  2BJX A;  2WGR A;  3IE3 A;  2E2M A;  2HLS A;  1ML6 A;  2CAI A;  5D9T A;  4OFN A;  1T7P B;  2GS3 A;  2R5G A;  4ZXG A;  4EVM A;  3ZYW A;  5IM9 A;  1FB0 A;  1QMV A;  4HZ2 A;  5JCW A;  2A4V A;  5F0G A;  1PKZ A;  4GQC A;  1S3C A;  3TRX A;  1M0U A;  5DQS A;  5IMA A;  1GTI A;  4K0G A;  2IL3 A;  2E0Q A;  5A4V A;  3I6A A;  4KAE A;  2L4Q A;  4MP4 A;  3IK7 A;  1ACV A;  3TB2 A;  4O32 A;  2OAD A;  1HNA A;  4V2L A;  5DAK A;  3ZL5 A;  1WJK A;  3C1R A;  2VCW A;  4IBP A;  6GSX A;  6GST A;  1M9A A;  5DAK B;  2GDR A;  1GUK A;  2GTU A;  3VPQ A;  5IOX A;  1Z6M A;  4GRF A;  3G9B A;  7GSS A;  2PER A;  2CVK A;  3VK9 A;  2NDO A;  2WCI A;  2DIZ A;  1NHO A;  1ZCP A;  3CMI A;  3F9U A;  2GT5 A;  1ZYE A;  3F3Q A; 
#chains in the Genus database with same CATH topology
 2CX3 A;  3KTL A;  3VWU A;  1VF3 A;  2B5E A;  1R26 A;  2E2G A;  2JZR A;  1OYJ A;  3TDG A;  4HJM A;  16GS A;  3HHV A;  2YCD A;  1RQM A;  2E7P A;  4N3Z A;  1O7U A;  3CQF A;  3GMF A;  2LQQ A;  1T1V A;  2TRC P;  5J5N A;  1ERT A;  4PGT A;  3LEF A;  3CBU A;  5G30 A;  2WVZ A;  3LYP A;  3KH9 A;  3TUE A;  4G0K A;  4TR4 A;  1DUG A;  1ZMA A;  3TKS A;  2QGV A;  3H1N A;  2NVL A;  2F8A A;  2MZC A;  1THX A;  2H0I A;  4FO5 A;  5A1N A;  3A5W A;  4N0V A;  5HR2 A;  2WRT A;  2O7K A;  2I3Y A;  3EIN A;  5A1N B;  2GQM A;  1TK5 B;  5J3R A;  3IRA A;  1W89 A;  2CVD A;  2I9H A;  1ZYQ B;  3L9V A;  2DJ0 A;  3DGQ A;  4GST A;  2WW0 A;  4WBJ A;  1BQ7 A;  3PIN A;  3DEX A;  2DC5 A;  4YQU A;  1QGV A;  1O73 A;  4DEJ A;  3HJO A;  2ON7 A;  4L5O A;  4MPG A;  5DJM A;  1NW2 A;  3RFR C;  2GZY A;  4FQU A;  1YF1 A;  4D73 A;  1B4Q A;  3BOA A;  3UMA A;  1YY7 A;  3OR5 A;  1MD4 A;  4WET A;  4G0L A;  2J23 A;  4D73 B;  5ID2 B;  5G5F A;  5HFG A;  4F82 A;  2MYG A;  4MNN A;  1HYU A;  1XBS A;  1QK8 A;  3KM6 A;  3GH9 A;  3KGK A;  2WVY A;  1T00 A;  1Q98 A;  1M99 A;  3Q19 A;  1PD2 1;  2LS5 A;  1I5G A;  5BMU A;  4ZIJ A;  4GQF A;  4Q5R A;  2X4A A;  4XCS A;  5KEJ A;  3DXB A;  1EEM A;  3M9J A;  3KD0 A;  1KTE A;  1GTU A;  5BMU B;  4HQS A;  5ECI B;  3L4N A;  3BCI A;  2AHE A;  5EPF A;  1BX9 A;  2G2Q A;  3GV1 A;  3LQ7 A;  1EP8 A;  5CRE A;  1U6T A;  2VLU A;  2IN3 A;  4ACS A;  2DIY A;  2F8F A;  1O81 A;  1X5E A;  1WMJ A;  4NWY A;  4LL1 B;  1TK8 B;  4PQI A;  2LJK A;  2KHP A;  3HVN A;  2GSQ A;  1U3A A;  5J41 A;  4V1A p;  2XHF A;  1TP9 A;  5HR3 A;  2VL2 C;  1GSD A;  1J08 A;  5DDL A;  3LGC A;  2LRC A;  1B4P A;  3GN3 A;  1YQ1 A;  3DVX A;  5D8I A;  4POM A;  3IHQ A;  2H71 A;  1KNG A;  1Z7P A;  1BAY A;  1K0O A;  3TJG A;  4MCU A;  1XIY A;  1SL2 B;  2JSY A;  5FHI A;  1F6M C;  2AUV A;  1MDK A;  1W4V A;  2RUF A;  4K5S A;  5IMF A;  2H6X A;  1EV9 A;  4MF5 A;  4JR4 A;  4NV5 A;  4BA7 A;  2GQK A;  4K0N A;  5J4U A;  1EV4 A;  3FHK A;  4WR5 A;  4TXO A;  1OC9 A;  5DBQ A;  1GSQ A;  1AUC A;  5ECN B;  3M0F A;  2K9F A;  2HXK A;  2L57 A;  3MDK A;  2XBI A;  3GL3 A;  4PQ1 A;  3D6I A;  1OC9 B;  2CAQ A;  4P3Y B;  3JCM L;  2R0G A;  1JZW A;  2C80 A;  4ZBB A;  3CXG A;  3V1W A;  2GSR A;  3DVW A;  5ECL B;  3WD6 A;  1R4W A;  1SL1 B;  2RUE A;  4IHU A;  4MA9 A;  2QSI A;  1OE7 A;  2F51 A;  2H73 A;  1Z9H A;  3FY7 A;  5J40 A;  1BG5 A;  1LU4 A;  4YKG A;  4ML6 A;  4TR1 B;  4PNG A;  2WW1 A;  2PVO C;  2CZ3 A;  4MZW A;  4IW9 A;  2IFQ A;  4IGJ A;  3F3R A;  2ZCT A;  4PI0 C;  2HSN A;  2IFQ B;  2OE1 A;  1SEN A;  4KB3 A;  3RPP A;  1RW1 A;  1PMT A;  4DSS A;  20GS A;  2HRA A;  1NSW A;  3ZTL A;  1Z3E A;  4LMW A;  2B3S A;  2HZF A;  1X5D A;  2WVX A;  5A4W A;  2C8U A;  2H6Z A;  3AY8 A;  4DSS B;  4RQR A;  2VO4 A;  2ALB A;  2P5Q A;  4RUV A;  5DQY A;  2WVX B;  2VCT A;  3VWX A;  4ZL9 A;  2IMK A;  2FHE A;  5JWO B;  4MMM A;  2R37 A;  1ZYN A;  4LA1 A;  2FNO A;  4KDU A;  4XS1 A;  3ERG A;  1FAA A;  3ZIV A;  3GYK A;  4IQA A;  1TW9 A;  3EUR A;  2H1L A;  1DE1 A;  2C0D A;  4I5Q A;  1IYI A;  2BMX A;  4MAB A;  4KE3 A;  5GAN D;  3IC4 A;  4EXJ A;  5C04 A;  4K7O A;  3GL5 A;  3VWW A;  1ABA A;  1VGL A;  2K8V A;  2ZUP A;  5FWG A;  3PGT A;  4JBB A;  3M9K A;  4NHZ A;  1AQX A;  13GS A;  2X8C A;  17GS A;  1QFN A;  2L59 A;  2CQ9 A;  5KOW A;  3P7X A;  1S4B P;  5HR1 A;  4KGI A;  2RM5 A;  3BD2 A;  1ZYP A;  1M2B A;  2HRF A;  2AYT A;  1ZGN A;  2OJL A;  1OAZ A;  3QDN A;  4J2F A;  3GKM A;  4YQV A;  4MLY A;  11GS A;  4AKH A;  4WXT A;  3VPT A;  1EEJ A;  1YDK A;  4TN8 A;  1I9D A;  4G19 A;  3IOS A;  5GAP D;  3W6G A;  4IJ3 A;  1TKD B;  1HNB A;  4USS A;  4ZB9 A;  2MMO A;  2VD1 A;  1TOF A;  3A5I A;  5J4Y A;  3RPN A;  1K3L A;  2VCZ A;  3P90 A;  5ECR B;  4E68 A;  3F6D A;  4BPY A;  4KDX A;  1PQN A;  2FLS A;  3CTF A;  1ON4 A;  1SL0 B;  3QMX A;  3A2X A;  1G6Y A;  3FK8 A;  1AXD A;  4OO5 A;  2YJH A;  4ZB6 A;  4BVY A;  3FZ4 A;  1E6B A;  3DD3 A;  6GSU A;  2FWE A;  2M72 A;  3IXR A;  4V2N A;  2YZU A;  4BVY B;  1Z7R A;  1PA3 A;  2X8H A;  1E2Y A;  5LD0 A;  1GLQ A;  2UZ8 A;  3U6V A;  3K8N A;  1GL8 A;  1GP1 A;  4AKI A;  4TKY A;  3FRC A;  3NZN A;  1WRY A;  3IDV A;  1A2J A;  3CYN A;  4Z2T A;  1JZD A;  4AKG A;  4JU5 A;  3LG6 A;  2XC2 A;  1X9W B;  4Z2U A;  3M1G A;  1Y1U A;  5EL8 A;  4HJ2 A;  1YKC A;  2YPM A;  4IEL A;  4MJB A;  4PTS A;  2A2R A;  1XZO A;  4X0X A;  2B5Y A;  2RII A;  4GSN A;  1ERV A;  1K0B A;  4MF6 A;  4O7H A;  2HRK B;  4NV2 A;  3QCP A;  1GLP A;  1SVL A;  2OBK A;  2C1Y A;  1V2A A;  3VUR A;  4EIP A;  3UBL A;  1ZL9 A;  2H01 A;  5HQP A;  4HUA A;  2QA1 A;  3RAZ A;  3G7J A;  4EO3 A;  1Q4J A;  5DAL A;  4O92 A;  3C73 A;  1LBK A;  5LCZ A;  4CY6 A;  5DAL B;  1UA5 A;  1WIK A;  3TRQ A;  4MK3 A;  2A2S A;  1EP7 A;  3KH7 A;  4J56 E;  4MZC A;  2IIY A;  1WP0 A;  4QQ7 A;  5IQY A;  1M3I A;  4XRD A;  3ZRE A;  4K2X A;  3BJ5 A;  2IMF A;  2J9H A;  3DML A;  4HSC X;  3TOU A;  4WF4 A;  5B6N A;  5B7C A;  4IP6 A;  2QKE A;  3FZ5 A;  2JSZ A;  4Z2R A;  5GZZ B;  1B9Y C;  3US3 A;  3RGB C;  5E59 A;  2WS2 A;  1TRU A;  4HDE A;  2R3X A;  1U88 A;  2H19 A;  4WBR D;  3ED3 A;  1YEP A;  2C0F A;  4TRX A;  3QFA C;  3IBH A;  1R5P A;  1VF2 A;  1SJ6 A;  1F37 A;  4XS4 A;  4CHS A;  4ECJ A;  4ECC A;  3IAS 2;  2X8G A;  2FWH A;  1GNW A;  2M80 A;  3U5R E;  1SYX A;  4KA0 A;  1TK0 B;  4XIH A;  3TKR A;  1EGO A;  4XS4 B;  1Z5Y E;  1SVM A;  3UAR A;  2PWJ A;  3EE2 A;  4W66 A;  1TXX A;  2KP1 A;  3KEB A;  1C72 A;  1XOA A;  4I8B A;  4FYU A;  2GZZ A;  1XVW A;  5IMC A;  1U87 A;  3TJB A;  4PUA A;  2PPT A;  3M8N A;  2O36 A;  2XPE A;  4NMU A;  4YAP A;  4X43 A;  3TKS E;  1A24 A;  1TXU A;  3F4R A;  2P0G A;  2QC7 A;  5IMD A;  4OWY A;  1TRS A;  3HVV A;  3MWH A;  3TKQ A;  5AN1 A;  2C3N A;  3HCZ A;  4N11 A;  1K0M A;  2RM6 A;  3WGX A;  2R0P A;  3D21 A;  2L5O A;  4I2T A;  3CRU A;  1SD9 A;  4KW6 A;  1MDJ A;  2GZP A;  3SBC A;  2H6Y A;  5JWQ B;  4OD7 A;  2B6M A;  1PX6 A;  3UIW A;  3KJY A;  1K3Y A;  4EDZ A;  3E9J B;  5ID2 A;  4KSM A;  4JRR A;  3EWL A;  4BVX A;  2H70 A;  3HA9 A;  1N8J A;  5IPG A;  1JFU A;  3A3T A;  3VI5 A;  4BVX B;  2LQO A;  1GUM A;  2UV8 G;  1I1I P;  3A2W A;  4MPF A;  2VM2 A;  3KMO A;  2B7K A;  4G0I A;  4ILF A;  5CO3 A;  2DLX A;  1PRX A;  2VKZ G;  1J0F A;  1AIU A;  5ECS A;  1OC8 A;  1V98 A;  1XXU A;  1IYH A;  3BCK A;  1R7H A;  3ERW A;  4O5R A;  3R3E A;  1XW6 A;  4GLT A;  1F3A A;  1XPV A;  4OCF A;  5KN3 A;  1O8W A;  3L78 A;  3RBT A;  1YF0 A;  2RLI A;  2H1B A;  2YV7 A;  2H75 A;  2VD0 A;  4BWS A;  3TJF A;  22GS A;  5J9B A;  3FZ9 A;  2LV3 A;  1HD2 A;  2B7J A;  3ZLP A;  4AJ7 A;  2C3T A;  2EIR A;  3CRT A;  3FEU A;  3UEM A;  1SK2 A;  4DSQ A;  1EZK A;  3GIX A;  3ISO A;  5DCH A;  1YEX A;  1TRW A;  4HU7 A;  1TJD A;  2H66 A;  2P31 A;  4IQ1 A;  3UAP A;  5ECQ B;  4H86 A;  1WE0 A;  3KTB A;  5B8A A;  4MDC A;  2TRX A;  4OO4 A;  4YQM A;  5A4U A;  5J47 A;  4MH2 A;  1U3I A;  3GKK A;  3CWG A;  5HFI A;  3CSJ A;  4F9Z A;  4L5L A;  4HU9 A;  3FMW A;  1K0C A;  2LTK A;  2GVP A;  3GX8 A;  4L0U A;  4IP1 A;  2PMT A;  3QR6 A;  4KCA A;  1M7T A;  3HJM A;  1NHY A;  4ISD A;  3DKS A;  1YEW C;  5IMV A;  2PBJ A;  4EKZ A;  2OE3 A;  2XBQ A;  2MMA A;  2VCQ A;  1ZZY A;  4HI7 A;  3Q6O A;  2DKI A;  1XCC A;  5BRT A;  3ZVJ A;  1SYR A;  1X0R A;  5D9X A;  2IME A;  3HKR A;  3N5O A;  3RDW A;  4TR1 A;  3WT1 A;  5A34 A;  4Q5Q A;  2EC4 A;  3GST A;  1OE8 A;  2I81 A;  2LJA A;  2MBS A;  1FO5 A;  4KDY A;  2TIR A;  4HZ4 A;  5A34 B;  4PHZ C;  1FOH A;  2IWT A;  3G7I A;  4G10 A;  4DVC A;  2HSH A;  2FD3 A;  14GS A;  2EIQ A;  4X1U A;  2FCH A;  4KSO A;  3H8Q A;  3W8J A;  3KMN A;  3LW9 A;  1FB6 A;  4WF5 A;  4N0Z A;  2AJQ B;  3DRN A;  5ABR A;  2V41 A;  3LSZ A;  2O8V B;  5IPH A;  1B48 A;  3H93 A;  2MBT A;  3O6T A;  2AAW A;  4MJC A;  4XS6 A;  2ON5 A;  4RQX A;  2YZH A;  2CZ2 A;  5CRW A;  1TDI A;  3TJJ A;  2YAN A;  5D73 A;  4POB A;  2P5R A;  1RK4 A;  1AC1 A;  5KOX A;  1EOH A;  3G7Y A;  1B8X A;  2X64 A;  2KUC A;  3KP8 A;  3HYP A;  1LJR A;  3QAV A;  2JZS A;  3LWA A;  2X99 A;  3TGZ A;  4FXY P;  3HZ4 A;  5L71 A;  3IHG A;  4MJE A;  3P2A A;  1WOU A;  2C3Q A;  1BJX A;  2HSM A;  2V1M A;  3KP9 A;  4X4J A;  3UVH A;  3EPT A;  5KN1 A;  2N5B A;  1JZR A;  3UBK A;  3IPZ A;  3VLN A;  3EU4 A;  2HSM B;  2PN8 A;  5CAX A;  2NBS A;  3F6F A;  1ZOF A;  5IO0 A;  4HEA 2;  1J9B A;  1M2D A;  3HD5 A;  3F0I A;  4IN0 A;  2HT9 A;  3D22 A;  4AF2 A;  1TRV A;  3I69 A;  4YAV A;  2VL2 A;  3D4T A;  3J7Y b;  9GSS A;  1BED A;  1X9M B;  4PXO A;  1GTB A;  1S3A A;  1GSS A;  1S3D A;  1WPI A;  1EOG A;  4XRA A;  3LFL A;  4EIQ A;  3EYT A;  4NXI A;  1WWJ A;  3C71 A;  5J4V A;  4IJI A;  1V58 A;  3C1S A;  2F9S A;  4DSR A;  2GLR A;  2EFD A;  4LLR A;  4TR3 A;  2HFD A;  5G2Z A;  4BIK A;  2C0E A;  2YWI A;  4OMV A;  2VCV A;  1XG8 A;  2YV9 A;  4J57 E;  2FWG A;  1N25 A;  3N9J A;  4KND A;  3APQ A;  4EF0 A;  3J7Y k;  3F4T A;  5ENU A;  3MAK A;  6GSY A;  2LEG A;  1SJI A;  5DVB A;  1TI1 A;  1DBY A;  3VFI A;  1K3O A;  1GWC A;  1TI3 A;  1G6W A;  2WW3 A;  2FUG 2;  3RHC A;  4G9H A;  5IOW A;  1YVL A;  2FA4 A;  2FY6 A;  4ZBD A;  4F0B A;  1XOB A;  1QXH A;  3KCM A;  3GRX A;  3ZIJ A;  1PSQ A;  5AIS A;  3QAW A;  3CSH A;  1THO A;  2FA8 A;  4N10 A;  5G31 A;  4NPB A;  4FIW A;  1A8Y A;  4O5Q A;  2A4H A;  3IA1 A;  1H75 A;  2VLT A;  4ZB7 A;  1GSU A;  2VL9 A;  4K7N A;  5DCG A;  4RI7 A;  2HZE A;  1HNC A;  2HRK A;  1XWK A;  1A8L A;  2I4A A;  2L4C A;  3F4S A;  3PH9 A;  3ME7 A;  1DSB A;  1V40 A;  2LJR A;  4WR4 A;  2HZE B;  3D5J A;  3TCO A;  5D9W A;  5FT3 A;  5AIV A;  3P8W A;  4EE0 A;  4FYC A;  4PNF A;  4LMV A;  5G5E A;  3ZFB A;  2FGX A;  4E8H A;  3GHA A;  5D9V A;  1PN9 A;  1JLW A;  3O76 A;  3VWV A;  4K9Z A;  3EMX A;  1XWG A;  3NIV A;  1DE2 A;  4A5P A;  2DJ3 A;  1K0D A;  2JAC A;  4FYB A;  2B1K A;  2HNL A;  3LXT A;  4K7I A;  2WB9 A;  5KN2 A;  3F63 A;  5JCU A;  5ELG A;  1K0A A;  2N5A A;  2XPD A;  3GA4 A;  3RHB A;  2O89 A;  3M3M A;  2CX4 A;  1XVQ A;  2JZT A;  2EFH A;  1T4Z A;  2YWN A;  3GUS A;  1CQH A;  3FYG A;  2WJU A;  3D4M A;  2WZS A;  4V1A g;  2C0G A;  4EL1 A;  1M3J A;  2YJ7 A;  1A0F A;  1URM A;  2YN1 A;  1UVZ A;  2NPB A;  3I43 A;  2WZ9 A;  2IPA A;  2OE0 A;  4QL7 A;  3FKF A;  5F8B A;  4Q5F A;  2DJJ A;  2N5F A;  2VOC A;  2R4V A;  2WDU A;  3L0H A;  2MMN A;  2V6K A;  4JZQ A;  3UOM A;  4NHW A;  2Z9S A;  2YOI A;  3H79 A;  4PQH A;  3LOR A;  1BF5 A;  4HS1 A;  1V9W A;  2GQL A;  2I1U A;  2DKH A;  1G7E A;  3EVI A;  2OT3 A;  3UL3 A;  3TRP A;  2K6V A;  2YWO A;  2AV4 A;  3QD9 A;  12GS A;  4PI2 C;  2HI7 A;  3L9S A;  4WEY A;  2ES7 A;  1VRS D;  1Y25 A;  1V57 A;  2EFE A;  4BL7 A;  3GSS A;  4JR6 A;  1PL2 A;  2OBI A;  2HYX A;  5D96 A;  1PL1 A;  2PVQ A;  2H1G A;  3C7M A;  1OC3 A;  4YKF A;  4KX4 A;  2O3E A;  5H5Q A;  3WT2 A;  4K2D A;  4BL7 B;  2X49 A;  1F9M A;  3KIJ A;  1EGR A;  1XW5 A;  3LYK A;  1OKD A;  2EIO A;  3R2Q A;  4JED A;  1GSY A;  1YZX A;  4TOP A;  3DWV A;  3ZFL A;  2ZNM A;  2V6O A;  3GX0 A;  1SVO A;  2R6K A;  3WYW A;  4N30 A;  4ZL7 A;  5ELA A;  1Z6N A;  1FVJ A;  2PU9 C;  2VL3 A;  5H5S A;  1H4O A;  1A2L A;  1ERU A;  3EMP A;  1TU7 A;  3NOF A;  3VI7 A;  3LXZ A;  5ECO B;  5J9C A;  1GRX A;  3W8S A;  1F3B A;  4TW5 A;  2HSY A;  2L6D A;  2DML A;  4IS0 A;  4AJ8 A;  3HMJ G;  5CRG A;  3KZQ A;  2GST A;  2L6C A;  2HE3 A;  1FG4 A;  3TOT A;  3I9V 2;  1X9S B;  2CVB A;  1GSE A;  4OCE A;  5A5K A;  6GSS A;  3GFK A;  2DJK A;  2VUP A;  5A5H A;  3IK9 A;  1G7O A;  1XWC A;  1O8X A;  3ZVJ D;  2JAD A;  5A5H B;  5COH A;  1CQG A;  2CT6 A;  1MTC A;  1B9X C;  2YP6 A;  2IJY A;  3BBY A;  2H0H A;  5GST A;  4F2I A;  5ECM B;  4KCE A;  3HY2 A;  5INY A;  3IAM 2;  1ILO A;  4ID0 A;  4IKH A;  1JLV A;  1UN2 A;  1ST9 A;  4QL9 A;  3FR9 A;  1A2M A;  3FR3 A;  5CNW A;  4E8E A;  1FW1 A;  4PUF C;  5AIX A;  4XTS A;  3CTG A;  1GNE A;  3F8U A;  3UJ1 A;  3FZA A;  2LKU A;  3PR8 A;  2VCX A;  1O6J A;  5KN0 A;  4RI6 A;  2LRT A;  4AGS A;  2DSA A;  10GS A;  3EU3 A;  3KXO A;  2D2Z A;  2B5X A;  1PX7 A;  1XFL A;  4JE1 A;  1T4Y A;  4O5U A;  1MD3 A;  4KH7 A;  2VAF A;  4L8E A;  2R2J A;  4IVF A;  4I6X A;  2H1A A;  3DYR A;  4ULX A;  2AB6 A;  4KF9 A;  2BTO T;  4LL4 B;  1VF4 A;  5E4W A;  2OA7 A;  2H0G A;  2L5L A;  4TVE A;  4ICY A;  4MH3 A;  3H4K A;  5F07 A;  3CHX C;  5HR0 A;  1JZO A;  4CY8 A;  3IC8 A;  5ECH B;  4FH8 A;  3L9U A;  1PN0 A;  5AGY A;  2IMD A;  4EUY A;  3EC3 A;  1K0N A;  1SKS B;  2YNX A;  4K8M A;  1T8E B;  1FHE A;  2DMM A;  3WGD A;  3PPU A;  4CW9 A;  1X5C A;  1AQV A;  4MJA A;  3TKP A;  2WFC A;  3QOU A;  2R0C A;  3Q18 A;  2O87 A;  2V32 A;  2C4J A;  5B8B A;  4ZBA A;  4MF7 A;  8GSS A;  3ZMK A;  1YKA A;  2EFC A;  4PX1 A;  2QA2 A;  2PGT A;  3WGE A;  2GT6 A;  3GNJ A;  1GUL A;  4TXO B;  3IV4 A;  2KP2 A;  3DIE A;  19GS A;  2CA8 A;  1N2A A;  4K1F A;  2H76 A;  1FOV A;  3C8E A;  1FVK A;  4ECB A;  2H30 A;  2GGT A;  3GH6 A;  4F0C A;  2DBC A;  3O3T A;  1AQW A;  2FWF A;  5IO2 A;  1TU8 A;  2K18 A;  2KLX A;  2CV4 A;  4GTU A;  5CYY A;  1PKW A;  3ME8 A;  3HJP A;  2G0F A;  2O85 A;  5DJL A;  2MMZ A;  2PUK C;  1GH2 A;  4G2E A;  3GKN A;  2IMI A;  1OVN A;  2OKA A;  2H8L A;  4EC0 A;  4GF0 A;  4I2U A;  5B6M A;  1SD8 A;  4I97 A;  4AKX B;  3FW2 A;  2HSN B;  3ERF A;  1EWX A;  4TXV A;  3QAG A;  3ZZX A;  2H74 A;  3TU3 B;  4PUR A;  1XWB A;  1A23 A;  4ZIL A;  3ZRD A;  4WKW A;  1M9B A;  1SKR B;  3HXS A;  5JCG A;  3HVS A;  1GSF A;  2NTO A;  2YWM A;  3APO A;  4TR0 A;  1UC7 A;  3MYD A;  1Y6E A;  5GSS A;  1PGT A;  1O85 A;  1HQO A;  5D93 A;  4BWQ A;  4ZB8 A;  4EDY A;  3TJK A;  3MNG A;  2HQT A;  1G0T A;  1MEK A;  4OFT A;  2O5V A;  4OFM A;  1VF1 A;  1A0R P;  5G1L A;  3ZIT A;  3A2V A;  2VM1 A;  2DJ1 A;  3S9F A;  6GSV A;  5LNK e;  5IIZ A;  4AI6 A;  2M46 A;  3SWL A;  1F2E A;  4Q5N A;  4AJ6 A;  2WW2 A;  2B1L A;  1OKT A;  2OAC A;  1YJ6 A;  4KUN A;  1R5A A;  1SU9 A;  3QPM A;  2LNS A;  1KEB A;  4V2M A;  4K6X A;  1USB A;  1M2A A;  3FR6 A;  2K8S A;  4MZB A;  1MDI A;  2KOK A;  5F05 A;  2HRN A;  4ECI A;  5G1K A;  4GDF A;  5ECK B;  3E0U A;  1QUW A;  5EY6 A;  4HOJ A;  6GSW A;  3GUR A;  3HVX A;  3D0Z A;  5CRD A;  5JWR B;  3GTU A;  4GXZ A;  4POL A;  2DJ2 A;  4ML1 A;  5CP1 A;  5H5R A;  1XW9 A;  4XHM A;  3GTU B;  3TKS C;  1PFO A;  1GTA A;  4GWR A;  1GUH A;  2F3M A;  5HFK A;  3IR4 A;  3E3E A;  2A2P A;  4G01 A;  1SK0 A;  1SKW B;  2REM A;  2GSS A;  3QFB C;  2WUL A;  2VIM A;  1SK1 A;  4ZL8 A;  1NM3 A;  4CDO A;  3Q74 A;  2H1D A;  4QMK A;  3LJR A;  3HZ8 A;  5C00 A;  4NAX A;  4F03 A;  2V2G A;  1T3B A;  2LNT A;  3MIX A;  4K5R A;  5F06 A;  3APS A;  2JL4 A;  4POK A;  1BG1 A;  3UVT A;  3CSI A;  1S3R A;  4L0W A;  18GS A;  4Z7X A;  2LUS A;  1SJZ A;  2JU5 A;  3GKX A;  1QQ2 A;  4HQZ A;  4GSS A;  1TTZ A;  5IMZ A;  1XWA A;  5ECP B;  3ZML A;  1AW9 A;  1BYE A;  1KBN A;  4GCI A;  3MSZ A;  3HDC A;  2H72 A;  1JHB A;  4YH2 A;  1AAZ A;  1ERW A;  2LRN A;  2VLV A;  5CRH A;  2LST A;  5EVO A;  2BJX A;  2WGR A;  3IE3 A;  2E2M A;  2HLS A;  1ML6 A;  2CAI A;  5D9T A;  4OFN A;  1T7P B;  2GS3 A;  2R5G A;  4ZXG A;  4EVM A;  3ZYW A;  5IM9 A;  1FB0 A;  1QMV A;  4HZ2 A;  5JCW A;  2A4V A;  5F0G A;  1PKZ A;  4GQC A;  1S3C A;  3TRX A;  1M0U A;  5DQS A;  5IMA A;  1GTI A;  4K0G A;  2IL3 A;  2E0Q A;  5A4V A;  3I6A A;  4KAE A;  2L4Q A;  4MP4 A;  3IK7 A;  1ACV A;  3TB2 A;  4O32 A;  2OAD A;  1HNA A;  4V2L A;  5DAK A;  3ZL5 A;  1WJK A;  3C1R A;  2VCW A;  4IBP A;  6GSX A;  6GST A;  1M9A A;  5DAK B;  2GDR A;  1GUK A;  2GTU A;  3VPQ A;  5IOX A;  1Z6M A;  4GRF A;  3G9B A;  7GSS A;  2PER A;  2CVK A;  3VK9 A;  2NDO A;  2WCI A;  2DIZ A;  1NHO A;  1ZCP A;  3CMI A;  3F9U A;  2GT5 A;  1ZYE A;  3F3Q A; 
#chains in the Genus database with same CATH homology
 2CX3 A;  3KTL A;  3VWU A;  1VF3 A;  2B5E A;  1R26 A;  2E2G A;  2JZR A;  1OYJ A;  3TDG A;  4HJM A;  16GS A;  3HHV A;  2YCD A;  1RQM A;  2E7P A;  4N3Z A;  1O7U A;  3GMF A;  2LQQ A;  1T1V A;  2TRC P;  5J5N A;  1ERT A;  4PGT A;  3LEF A;  3CBU A;  5G30 A;  3LYP A;  3KH9 A;  3TUE A;  4G0K A;  4TR4 A;  1DUG A;  1ZMA A;  3TKS A;  2QGV A;  3H1N A;  2NVL A;  2F8A A;  2MZC A;  1THX A;  2H0I A;  4FO5 A;  5A1N A;  3A5W A;  4N0V A;  5HR2 A;  2WRT A;  2O7K A;  2I3Y A;  3EIN A;  5A1N B;  2GQM A;  1TK5 B;  5J3R A;  3IRA A;  1W89 A;  2CVD A;  2I9H A;  1ZYQ B;  3L9V A;  2DJ0 A;  3DGQ A;  4GST A;  4WBJ A;  1BQ7 A;  3PIN A;  3DEX A;  2DC5 A;  4YQU A;  1QGV A;  1O73 A;  4DEJ A;  3HJO A;  2ON7 A;  4L5O A;  4MPG A;  5DJM A;  1NW2 A;  2GZY A;  4FQU A;  1YF1 A;  4D73 A;  1B4Q A;  3BOA A;  3UMA A;  1YY7 A;  3OR5 A;  1MD4 A;  4WET A;  4G0L A;  2J23 A;  4D73 B;  5ID2 B;  5G5F A;  5HFG A;  4F82 A;  2MYG A;  4MNN A;  1HYU A;  1XBS A;  1QK8 A;  3KM6 A;  3GH9 A;  3KGK A;  1T00 A;  1Q98 A;  1M99 A;  3Q19 A;  1PD2 1;  2LS5 A;  1I5G A;  5BMU A;  4ZIJ A;  4GQF A;  4Q5R A;  2X4A A;  4XCS A;  5KEJ A;  3DXB A;  1EEM A;  3M9J A;  3KD0 A;  1KTE A;  1GTU A;  5BMU B;  4HQS A;  5ECI B;  3L4N A;  3BCI A;  2AHE A;  5EPF A;  1BX9 A;  2G2Q A;  3GV1 A;  3LQ7 A;  1EP8 A;  5CRE A;  1U6T A;  2VLU A;  2IN3 A;  4ACS A;  2DIY A;  2F8F A;  1O81 A;  1X5E A;  1WMJ A;  4NWY A;  4LL1 B;  1TK8 B;  4PQI A;  2LJK A;  2KHP A;  2GSQ A;  1U3A A;  5J41 A;  4V1A p;  2XHF A;  1TP9 A;  5HR3 A;  2VL2 C;  1GSD A;  1J08 A;  5DDL A;  3LGC A;  2LRC A;  1B4P A;  3GN3 A;  1YQ1 A;  3DVX A;  5D8I A;  4POM A;  3IHQ A;  2H71 A;  1KNG A;  1Z7P A;  1BAY A;  1K0O A;  3TJG A;  4MCU A;  1XIY A;  1SL2 B;  2JSY A;  5FHI A;  1F6M C;  2AUV A;  1MDK A;  1W4V A;  2RUF A;  4K5S A;  5IMF A;  2H6X A;  1EV9 A;  4MF5 A;  4JR4 A;  4NV5 A;  4BA7 A;  2GQK A;  4K0N A;  5J4U A;  1EV4 A;  3FHK A;  4WR5 A;  4TXO A;  1OC9 A;  5DBQ A;  1GSQ A;  1AUC A;  5ECN B;  3M0F A;  2K9F A;  2HXK A;  2L57 A;  3MDK A;  2XBI A;  3GL3 A;  4PQ1 A;  3D6I A;  1OC9 B;  2CAQ A;  4P3Y B;  3JCM L;  2R0G A;  1JZW A;  2C80 A;  4ZBB A;  3CXG A;  3V1W A;  2GSR A;  3DVW A;  5ECL B;  3WD6 A;  1R4W A;  1SL1 B;  2RUE A;  4IHU A;  4MA9 A;  2QSI A;  1OE7 A;  2F51 A;  2H73 A;  1Z9H A;  3FY7 A;  5J40 A;  1BG5 A;  1LU4 A;  4YKG A;  4ML6 A;  4TR1 B;  4PNG A;  2PVO C;  2CZ3 A;  4MZW A;  4IW9 A;  2IFQ A;  4IGJ A;  3F3R A;  2ZCT A;  2HSN A;  2IFQ B;  2OE1 A;  1SEN A;  4KB3 A;  3RPP A;  1RW1 A;  1PMT A;  4DSS A;  20GS A;  2HRA A;  1NSW A;  3ZTL A;  1Z3E A;  4LMW A;  2B3S A;  2HZF A;  1X5D A;  5A4W A;  2C8U A;  2H6Z A;  3AY8 A;  4DSS B;  4RQR A;  2VO4 A;  2ALB A;  2P5Q A;  4RUV A;  5DQY A;  2VCT A;  3VWX A;  4ZL9 A;  2IMK A;  2FHE A;  5JWO B;  4MMM A;  2R37 A;  1ZYN A;  4LA1 A;  2FNO A;  4KDU A;  4XS1 A;  3ERG A;  1FAA A;  3ZIV A;  3GYK A;  4IQA A;  1TW9 A;  3EUR A;  2H1L A;  1DE1 A;  2C0D A;  4I5Q A;  1IYI A;  2BMX A;  4MAB A;  4KE3 A;  5GAN D;  3IC4 A;  4EXJ A;  5C04 A;  4K7O A;  3GL5 A;  3VWW A;  1ABA A;  1VGL A;  2K8V A;  2ZUP A;  5FWG A;  3PGT A;  4JBB A;  3M9K A;  4NHZ A;  1AQX A;  13GS A;  2X8C A;  17GS A;  1QFN A;  2L59 A;  2CQ9 A;  5KOW A;  3P7X A;  5HR1 A;  4KGI A;  2RM5 A;  3BD2 A;  1ZYP A;  1M2B A;  2HRF A;  2AYT A;  1ZGN A;  2OJL A;  1OAZ A;  3QDN A;  4J2F A;  3GKM A;  4YQV A;  4MLY A;  11GS A;  4AKH A;  4WXT A;  3VPT A;  1EEJ A;  1YDK A;  4TN8 A;  1I9D A;  4G19 A;  3IOS A;  5GAP D;  3W6G A;  4IJ3 A;  1TKD B;  1HNB A;  4USS A;  4ZB9 A;  2MMO A;  2VD1 A;  1TOF A;  3A5I A;  5J4Y A;  3RPN A;  1K3L A;  2VCZ A;  3P90 A;  5ECR B;  4E68 A;  3F6D A;  4BPY A;  4KDX A;  1PQN A;  2FLS A;  3CTF A;  1ON4 A;  1SL0 B;  3QMX A;  3A2X A;  1G6Y A;  3FK8 A;  1AXD A;  4OO5 A;  2YJH A;  4ZB6 A;  4BVY A;  3FZ4 A;  1E6B A;  3DD3 A;  6GSU A;  2FWE A;  2M72 A;  3IXR A;  4V2N A;  2YZU A;  4BVY B;  1Z7R A;  1PA3 A;  2X8H A;  1E2Y A;  5LD0 A;  1GLQ A;  2UZ8 A;  3U6V A;  3K8N A;  1GL8 A;  1GP1 A;  4AKI A;  4TKY A;  3FRC A;  3NZN A;  1WRY A;  3IDV A;  1A2J A;  3CYN A;  4Z2T A;  1JZD A;  4AKG A;  4JU5 A;  3LG6 A;  2XC2 A;  1X9W B;  4Z2U A;  3M1G A;  1Y1U A;  5EL8 A;  4HJ2 A;  1YKC A;  2YPM A;  4IEL A;  4MJB A;  4PTS A;  2A2R A;  1XZO A;  4X0X A;  2B5Y A;  2RII A;  4GSN A;  1ERV A;  1K0B A;  4MF6 A;  4O7H A;  2HRK B;  4NV2 A;  3QCP A;  1GLP A;  1SVL A;  2OBK A;  2C1Y A;  1V2A A;  3VUR A;  4EIP A;  3UBL A;  1ZL9 A;  2H01 A;  5HQP A;  4HUA A;  2QA1 A;  3RAZ A;  3G7J A;  4EO3 A;  1Q4J A;  5DAL A;  4O92 A;  3C73 A;  1LBK A;  5LCZ A;  4CY6 A;  5DAL B;  1UA5 A;  1WIK A;  3TRQ A;  4MK3 A;  2A2S A;  1EP7 A;  3KH7 A;  4J56 E;  4MZC A;  2IIY A;  1WP0 A;  4QQ7 A;  5IQY A;  4XRD A;  3ZRE A;  4K2X A;  3BJ5 A;  2IMF A;  2J9H A;  3DML A;  3TOU A;  4WF4 A;  5B6N A;  5B7C A;  4IP6 A;  2QKE A;  3FZ5 A;  2JSZ A;  4Z2R A;  5GZZ B;  1B9Y C;  3US3 A;  5E59 A;  2WS2 A;  1TRU A;  4HDE A;  2R3X A;  1U88 A;  2H19 A;  4WBR D;  3ED3 A;  1YEP A;  2C0F A;  4TRX A;  3QFA C;  3IBH A;  1R5P A;  1VF2 A;  1SJ6 A;  1F37 A;  4XS4 A;  4CHS A;  4ECJ A;  4ECC A;  3IAS 2;  2X8G A;  2FWH A;  1GNW A;  2M80 A;  3U5R E;  1SYX A;  4KA0 A;  1TK0 B;  4XIH A;  3TKR A;  1EGO A;  4XS4 B;  1Z5Y E;  1SVM A;  3UAR A;  2PWJ A;  3EE2 A;  4W66 A;  1TXX A;  2KP1 A;  3KEB A;  1C72 A;  1XOA A;  4I8B A;  4FYU A;  2GZZ A;  1XVW A;  5IMC A;  1U87 A;  3TJB A;  4PUA A;  2PPT A;  3M8N A;  2XPE A;  4NMU A;  4YAP A;  4X43 A;  3TKS E;  1A24 A;  1TXU A;  3F4R A;  2P0G A;  2QC7 A;  5IMD A;  4OWY A;  1TRS A;  3HVV A;  3MWH A;  3TKQ A;  5AN1 A;  2C3N A;  3HCZ A;  4N11 A;  1K0M A;  2RM6 A;  3WGX A;  2R0P A;  3D21 A;  2L5O A;  4I2T A;  3CRU A;  1SD9 A;  4KW6 A;  1MDJ A;  2GZP A;  3SBC A;  2H6Y A;  5JWQ B;  4OD7 A;  2B6M A;  1PX6 A;  3UIW A;  3KJY A;  1K3Y A;  4EDZ A;  3E9J B;  5ID2 A;  4KSM A;  4JRR A;  3EWL A;  4BVX A;  2H70 A;  3HA9 A;  1N8J A;  5IPG A;  1JFU A;  3A3T A;  3VI5 A;  4BVX B;  2LQO A;  1GUM A;  2UV8 G;  3A2W A;  4MPF A;  2VM2 A;  3KMO A;  2B7K A;  4G0I A;  4ILF A;  5CO3 A;  2DLX A;  1PRX A;  2VKZ G;  1J0F A;  1AIU A;  5ECS A;  1OC8 A;  1V98 A;  1XXU A;  1IYH A;  3BCK A;  1R7H A;  3ERW A;  4O5R A;  3R3E A;  1XW6 A;  4GLT A;  1F3A A;  1XPV A;  4OCF A;  5KN3 A;  1O8W A;  3L78 A;  3RBT A;  1YF0 A;  2RLI A;  2H1B A;  2YV7 A;  2H75 A;  2VD0 A;  4BWS A;  3TJF A;  22GS A;  5J9B A;  3FZ9 A;  2LV3 A;  1HD2 A;  2B7J A;  3ZLP A;  4AJ7 A;  2C3T A;  2EIR A;  3CRT A;  3FEU A;  3UEM A;  1SK2 A;  4DSQ A;  1EZK A;  3GIX A;  3ISO A;  5DCH A;  1YEX A;  1TRW A;  4HU7 A;  1TJD A;  2H66 A;  2P31 A;  4IQ1 A;  3UAP A;  5ECQ B;  4H86 A;  1WE0 A;  3KTB A;  5B8A A;  4MDC A;  2TRX A;  4OO4 A;  4YQM A;  5A4U A;  5J47 A;  4MH2 A;  1U3I A;  3GKK A;  3CWG A;  5HFI A;  3CSJ A;  4F9Z A;  4L5L A;  4HU9 A;  3FMW A;  1K0C A;  2LTK A;  2GVP A;  3GX8 A;  4L0U A;  4IP1 A;  2PMT A;  3QR6 A;  4KCA A;  1M7T A;  3HJM A;  1NHY A;  4ISD A;  3DKS A;  5IMV A;  2PBJ A;  4EKZ A;  2OE3 A;  2XBQ A;  2MMA A;  2VCQ A;  1ZZY A;  4HI7 A;  3Q6O A;  2DKI A;  1XCC A;  5BRT A;  3ZVJ A;  1SYR A;  1X0R A;  5D9X A;  2IME A;  3HKR A;  3N5O A;  3RDW A;  4TR1 A;  3WT1 A;  5A34 A;  4Q5Q A;  2EC4 A;  3GST A;  1OE8 A;  2I81 A;  2LJA A;  2MBS A;  1FO5 A;  4KDY A;  2TIR A;  4HZ4 A;  5A34 B;  1FOH A;  2IWT A;  3G7I A;  4G10 A;  4DVC A;  2HSH A;  2FD3 A;  14GS A;  2EIQ A;  4X1U A;  2FCH A;  4KSO A;  3H8Q A;  3W8J A;  3KMN A;  3LW9 A;  1FB6 A;  4WF5 A;  4N0Z A;  2AJQ B;  3DRN A;  5ABR A;  2V41 A;  3LSZ A;  2O8V B;  5IPH A;  1B48 A;  3H93 A;  2MBT A;  3O6T A;  2AAW A;  4MJC A;  4XS6 A;  2ON5 A;  4RQX A;  2YZH A;  2CZ2 A;  5CRW A;  1TDI A;  3TJJ A;  2YAN A;  5D73 A;  4POB A;  2P5R A;  1RK4 A;  1AC1 A;  5KOX A;  1EOH A;  3G7Y A;  1B8X A;  2X64 A;  2KUC A;  3KP8 A;  3HYP A;  1LJR A;  3QAV A;  2JZS A;  3LWA A;  2X99 A;  3TGZ A;  3HZ4 A;  5L71 A;  3IHG A;  4MJE A;  3P2A A;  1WOU A;  2C3Q A;  1BJX A;  2HSM A;  2V1M A;  3KP9 A;  4X4J A;  3UVH A;  3EPT A;  5KN1 A;  2N5B A;  1JZR A;  3UBK A;  3IPZ A;  3VLN A;  3EU4 A;  2HSM B;  2PN8 A;  5CAX A;  2NBS A;  3F6F A;  1ZOF A;  5IO0 A;  4HEA 2;  1J9B A;  1M2D A;  3HD5 A;  3F0I A;  4IN0 A;  2HT9 A;  3D22 A;  4AF2 A;  1TRV A;  3I69 A;  4YAV A;  2VL2 A;  3D4T A;  3J7Y b;  9GSS A;  1BED A;  1X9M B;  4PXO A;  1GTB A;  1S3A A;  1GSS A;  1S3D A;  1WPI A;  1EOG A;  4XRA A;  3LFL A;  4EIQ A;  3EYT A;  4NXI A;  1WWJ A;  3C71 A;  5J4V A;  4IJI A;  1V58 A;  3C1S A;  2F9S A;  4DSR A;  2GLR A;  2EFD A;  4LLR A;  4TR3 A;  2HFD A;  5G2Z A;  2C0E A;  2YWI A;  4OMV A;  2VCV A;  2YV9 A;  4J57 E;  2FWG A;  1N25 A;  3N9J A;  4KND A;  3APQ A;  4EF0 A;  3J7Y k;  3F4T A;  5ENU A;  3MAK A;  6GSY A;  2LEG A;  1SJI A;  5DVB A;  1TI1 A;  1DBY A;  3VFI A;  1K3O A;  1GWC A;  1TI3 A;  1G6W A;  2FUG 2;  3RHC A;  4G9H A;  5IOW A;  1YVL A;  2FA4 A;  2FY6 A;  4ZBD A;  4F0B A;  1XOB A;  1QXH A;  3KCM A;  3GRX A;  3ZIJ A;  1PSQ A;  5AIS A;  3QAW A;  3CSH A;  1THO A;  2FA8 A;  4N10 A;  5G31 A;  4NPB A;  4FIW A;  1A8Y A;  4O5Q A;  2A4H A;  3IA1 A;  1H75 A;  2VLT A;  4ZB7 A;  1GSU A;  2VL9 A;  4K7N A;  5DCG A;  4RI7 A;  2HZE A;  1HNC A;  2HRK A;  1XWK A;  1A8L A;  2I4A A;  2L4C A;  3F4S A;  3PH9 A;  3ME7 A;  1DSB A;  1V40 A;  2LJR A;  4WR4 A;  2HZE B;  3D5J A;  3TCO A;  5D9W A;  5FT3 A;  5AIV A;  3P8W A;  4EE0 A;  4FYC A;  4PNF A;  4LMV A;  5G5E A;  3ZFB A;  2FGX A;  4E8H A;  3GHA A;  5D9V A;  1PN9 A;  1JLW A;  3O76 A;  3VWV A;  4K9Z A;  3EMX A;  1XWG A;  3NIV A;  1DE2 A;  4A5P A;  2DJ3 A;  1K0D A;  2JAC A;  4FYB A;  2B1K A;  2HNL A;  3LXT A;  4K7I A;  2WB9 A;  5KN2 A;  3F63 A;  5JCU A;  5ELG A;  1K0A A;  2N5A A;  2XPD A;  3GA4 A;  3RHB A;  2O89 A;  3M3M A;  2CX4 A;  1XVQ A;  2JZT A;  2EFH A;  1T4Z A;  2YWN A;  3GUS A;  1CQH A;  3FYG A;  2WJU A;  3D4M A;  4V1A g;  2C0G A;  4EL1 A;  2YJ7 A;  1A0F A;  1URM A;  2YN1 A;  1UVZ A;  2NPB A;  3I43 A;  2WZ9 A;  2IPA A;  2OE0 A;  4QL7 A;  3FKF A;  5F8B A;  4Q5F A;  2DJJ A;  2N5F A;  2VOC A;  2R4V A;  2WDU A;  3L0H A;  2MMN A;  2V6K A;  4JZQ A;  3UOM A;  4NHW A;  2Z9S A;  2YOI A;  3H79 A;  4PQH A;  3LOR A;  1BF5 A;  4HS1 A;  1V9W A;  2GQL A;  2I1U A;  2DKH A;  1G7E A;  3EVI A;  2OT3 A;  3UL3 A;  3TRP A;  2K6V A;  2YWO A;  2AV4 A;  3QD9 A;  12GS A;  2HI7 A;  3L9S A;  4WEY A;  2ES7 A;  1VRS D;  1Y25 A;  1V57 A;  2EFE A;  4BL7 A;  3GSS A;  4JR6 A;  1PL2 A;  2OBI A;  2HYX A;  5D96 A;  1PL1 A;  2PVQ A;  2H1G A;  3C7M A;  1OC3 A;  4YKF A;  4KX4 A;  5H5Q A;  3WT2 A;  4K2D A;  4BL7 B;  2X49 A;  1F9M A;  3KIJ A;  1EGR A;  1XW5 A;  3LYK A;  1OKD A;  2EIO A;  3R2Q A;  4JED A;  1GSY A;  1YZX A;  4TOP A;  3DWV A;  3ZFL A;  2ZNM A;  2V6O A;  3GX0 A;  1SVO A;  2R6K A;  3WYW A;  4N30 A;  4ZL7 A;  5ELA A;  1Z6N A;  1FVJ A;  2PU9 C;  2VL3 A;  5H5S A;  1H4O A;  1A2L A;  1ERU A;  3EMP A;  1TU7 A;  3NOF A;  3VI7 A;  3LXZ A;  5ECO B;  5J9C A;  1GRX A;  3W8S A;  1F3B A;  4TW5 A;  2HSY A;  2L6D A;  2DML A;  4IS0 A;  4AJ8 A;  3HMJ G;  5CRG A;  3KZQ A;  2GST A;  2L6C A;  2HE3 A;  1FG4 A;  3TOT A;  3I9V 2;  1X9S B;  2CVB A;  1GSE A;  4OCE A;  5A5K A;  6GSS A;  3GFK A;  2DJK A;  2VUP A;  5A5H A;  3IK9 A;  1G7O A;  1XWC A;  1O8X A;  3ZVJ D;  2JAD A;  5A5H B;  5COH A;  1CQG A;  2CT6 A;  1MTC A;  1B9X C;  2YP6 A;  2IJY A;  3BBY A;  2H0H A;  5GST A;  4F2I A;  5ECM B;  4KCE A;  3HY2 A;  5INY A;  3IAM 2;  1ILO A;  4ID0 A;  4IKH A;  1JLV A;  1UN2 A;  1ST9 A;  4QL9 A;  3FR9 A;  1A2M A;  3FR3 A;  5CNW A;  4E8E A;  1FW1 A;  4PUF C;  5AIX A;  4XTS A;  3CTG A;  1GNE A;  3F8U A;  3UJ1 A;  3FZA A;  2LKU A;  3PR8 A;  2VCX A;  1O6J A;  5KN0 A;  4RI6 A;  2LRT A;  4AGS A;  2DSA A;  10GS A;  3EU3 A;  3KXO A;  2D2Z A;  2B5X A;  1PX7 A;  1XFL A;  4JE1 A;  1T4Y A;  4O5U A;  1MD3 A;  4KH7 A;  2VAF A;  4L8E A;  2R2J A;  4IVF A;  4I6X A;  2H1A A;  3DYR A;  4ULX A;  2AB6 A;  4KF9 A;  2BTO T;  4LL4 B;  1VF4 A;  5E4W A;  2OA7 A;  2H0G A;  2L5L A;  4TVE A;  4ICY A;  4MH3 A;  3H4K A;  5F07 A;  5HR0 A;  1JZO A;  4CY8 A;  3IC8 A;  5ECH B;  4FH8 A;  3L9U A;  1PN0 A;  5AGY A;  2IMD A;  4EUY A;  3EC3 A;  1K0N A;  1SKS B;  2YNX A;  4K8M A;  1T8E B;  1FHE A;  2DMM A;  3WGD A;  3PPU A;  4CW9 A;  1X5C A;  1AQV A;  4MJA A;  3TKP A;  2WFC A;  3QOU A;  2R0C A;  3Q18 A;  2O87 A;  2V32 A;  2C4J A;  5B8B A;  4ZBA A;  4MF7 A;  8GSS A;  3ZMK A;  1YKA A;  2EFC A;  4PX1 A;  2QA2 A;  2PGT A;  3WGE A;  2GT6 A;  3GNJ A;  1GUL A;  4TXO B;  3IV4 A;  2KP2 A;  3DIE A;  19GS A;  2CA8 A;  1N2A A;  4K1F A;  2H76 A;  1FOV A;  3C8E A;  1FVK A;  4ECB A;  2H30 A;  2GGT A;  3GH6 A;  4F0C A;  2DBC A;  3O3T A;  1AQW A;  2FWF A;  5IO2 A;  1TU8 A;  2K18 A;  2KLX A;  2CV4 A;  4GTU A;  5CYY A;  1PKW A;  3ME8 A;  3HJP A;  2G0F A;  2O85 A;  5DJL A;  2MMZ A;  2PUK C;  1GH2 A;  4G2E A;  3GKN A;  2IMI A;  1OVN A;  2OKA A;  2H8L A;  4EC0 A;  4GF0 A;  4I2U A;  5B6M A;  1SD8 A;  4I97 A;  4AKX B;  3FW2 A;  2HSN B;  3ERF A;  1EWX A;  4TXV A;  3QAG A;  3ZZX A;  2H74 A;  3TU3 B;  4PUR A;  1XWB A;  1A23 A;  4ZIL A;  3ZRD A;  4WKW A;  1M9B A;  1SKR B;  3HXS A;  5JCG A;  3HVS A;  1GSF A;  2NTO A;  2YWM A;  3APO A;  4TR0 A;  1UC7 A;  3MYD A;  1Y6E A;  5GSS A;  1PGT A;  1O85 A;  1HQO A;  5D93 A;  4BWQ A;  4ZB8 A;  4EDY A;  3TJK A;  3MNG A;  2HQT A;  1G0T A;  1MEK A;  4OFT A;  2O5V A;  4OFM A;  1VF1 A;  1A0R P;  5G1L A;  3ZIT A;  3A2V A;  2VM1 A;  2DJ1 A;  3S9F A;  6GSV A;  5LNK e;  5IIZ A;  4AI6 A;  2M46 A;  3SWL A;  1F2E A;  4Q5N A;  4AJ6 A;  2B1L A;  1OKT A;  2OAC A;  1YJ6 A;  4KUN A;  1R5A A;  1SU9 A;  3QPM A;  2LNS A;  1KEB A;  4V2M A;  4K6X A;  1USB A;  1M2A A;  3FR6 A;  2K8S A;  4MZB A;  1MDI A;  2KOK A;  5F05 A;  2HRN A;  4ECI A;  5G1K A;  4GDF A;  5ECK B;  3E0U A;  1QUW A;  5EY6 A;  4HOJ A;  6GSW A;  3GUR A;  3HVX A;  3D0Z A;  5CRD A;  5JWR B;  3GTU A;  4GXZ A;  4POL A;  2DJ2 A;  4ML1 A;  5CP1 A;  5H5R A;  1XW9 A;  4XHM A;  3GTU B;  3TKS C;  1GTA A;  4GWR A;  1GUH A;  2F3M A;  5HFK A;  3IR4 A;  3E3E A;  2A2P A;  4G01 A;  1SK0 A;  1SKW B;  2REM A;  2GSS A;  3QFB C;  2WUL A;  2VIM A;  1SK1 A;  4ZL8 A;  1NM3 A;  4CDO A;  3Q74 A;  2H1D A;  4QMK A;  3LJR A;  3HZ8 A;  5C00 A;  4NAX A;  4F03 A;  2V2G A;  1T3B A;  2LNT A;  3MIX A;  4K5R A;  5F06 A;  3APS A;  2JL4 A;  4POK A;  1BG1 A;  3UVT A;  3CSI A;  4L0W A;  18GS A;  4Z7X A;  2LUS A;  1SJZ A;  2JU5 A;  3GKX A;  1QQ2 A;  4HQZ A;  4GSS A;  1TTZ A;  5IMZ A;  1XWA A;  5ECP B;  3ZML A;  1AW9 A;  1BYE A;  1KBN A;  4GCI A;  3MSZ A;  3HDC A;  2H72 A;  1JHB A;  4YH2 A;  1AAZ A;  1ERW A;  2LRN A;  2VLV A;  5CRH A;  2LST A;  5EVO A;  2BJX A;  2WGR A;  3IE3 A;  2E2M A;  2HLS A;  1ML6 A;  2CAI A;  5D9T A;  4OFN A;  1T7P B;  2GS3 A;  2R5G A;  4ZXG A;  4EVM A;  3ZYW A;  5IM9 A;  1FB0 A;  1QMV A;  4HZ2 A;  5JCW A;  2A4V A;  5F0G A;  1PKZ A;  4GQC A;  1S3C A;  3TRX A;  1M0U A;  5DQS A;  5IMA A;  1GTI A;  4K0G A;  2IL3 A;  2E0Q A;  5A4V A;  3I6A A;  4KAE A;  2L4Q A;  4MP4 A;  3IK7 A;  1ACV A;  3TB2 A;  4O32 A;  2OAD A;  1HNA A;  4V2L A;  5DAK A;  3ZL5 A;  1WJK A;  3C1R A;  2VCW A;  4IBP A;  6GSX A;  6GST A;  1M9A A;  5DAK B;  2GDR A;  1GUK A;  2GTU A;  3VPQ A;  5IOX A;  1Z6M A;  4GRF A;  3G9B A;  7GSS A;  2PER A;  2CVK A;  3VK9 A;  2NDO A;  2WCI A;  2DIZ A;  1NHO A;  1ZCP A;  3CMI A;  3F9U A;  2GT5 A;  1ZYE A;  3F3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...