5GSTA

Reaction coordinate motion in an snar reaction catalyzed by glutathione transferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Snapshots along the reaction coordinate of an SNAr reaction catalyzed by glutathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5gstA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5gstA01
1BG5A 2LTKA 2OJLA 3TKQA 1YJ6A 3P90A 4P3YB 6GSUA 4I2UA 4ECCA 4ML1A 4TN8A 1JLVA 4FO5A 5DCGA 4NWYA 3UJ1A 3ZFBA 3TRQA 3AY8A 2GT6A 3FR9A 3KZQA 1MDJA 4PQ1A 3W6GA 4J2FA 16GSA 2O87A 4DSRA 4KSOA 2K8SA 3FR3A 2JACA 4IQAA 3F9UA 1BJXA 1ZYEA 1XW9A 4PNFA 1YKCA 2FHEA 3O3TA 2IN3A 2HYXA 1V2AA 1YY7A 3CSIA 3IA1A 5G30A 1EV4A 4K7OA 5ABRA 1KTEA 4L0WA 1FB6A 5B6NA 3EWLA 4RQXA 4G19A 3NIVA 3W8SA 2PU9C 2FY6A 5B8BA 4ZBDA 4XS4B 1PKZA 4V2NA 2IIYA 4K2DA 1ML6A 1LBKA 2R6KA 1VF3A 2H72A 2NVLA 3UBKA 4KGIA 2MBTA 1J9BA 1XZOA 1RK4A 1XPVA 1GP1A 2RM5A 4EDZA 3P8WA 5ECKB 3TRXA 2HXKA 4KDXA 1R4WA 1KNGA 2YN1A 4POLA 3LGCA 3QFAC 5D73A 5ECPB 1Z3EA 4N0ZA 5D96A 3BCKA 2DC5A 2HSMA 4KW6A 2C0DA 2I9HA 11GSA 2YP6A 3F4RA 4IQ1A 4AJ7A 3WT1A 4MJEA 1WMJA 1M9BA 5JCGA 3F4TA 4QL9A 2FD3A 3HCZA 1AW9A 3WGXA 1UC7A 4BVYA 2VL9A 4FH8A 1E2YA 1WOUA 2R3XA 3ERGA 1GSSA 1GNWA 19GSA 3UARA 3P2AA 3DKSA 1EZKA 1O73A 3WYWA 5HR3A 3ZRDA 3J7Yk 2JSZA 2CQ9A 1N2AA 5GSTA 3TKSC 3GRXA 5ELAA 1T7PB 4JR6A 3TKSE 4PXOA 4H86A 3HYPA 3ME7A 3GMFA 2RM6A 2PVQA 2HRAA 4IJ3A 1KEBA 5A4UA 1ILOA 3IBHA 3F3RA 4JEDA 3UAPA 4GQCA 1A2MA 5IOWA 3ZL5A 3IRAA 1XWBA 4E8HA 2ZCTA 2FWGA 1FG4A 1TJDA 2VL2A 4IN0A 5H5QA 3LG6A 2LNSA 4PTSA 3ZREA 1FVKA 1V58A 4KAEA 5HFKA 1ZMAA 1F2EA 5J9BA 1FHEA 3DRNA 4N11A 3L78A 1SKWB 1DE1A 2M72A 1UVZA 2B5XA 1MTCA 3N9JA 1M2DA 4ZB9A 2CV4A 5CRGA 2C8UA 3M0FA 3GKXA 5D9WA 5E4WA 1GUKA 3CSHA 2HE3A 4D73B 1C72A 5ELGA 5INYA 4KUNA 5D93A 1A0FA 5HFGA 5DALA 3KCMA 2VCXA 2VCQA 2N5AA 3Q74A 4Q5FA 4HQZA 4K0GA 4OO4A 3MDKA 3Q18A 3CTFA 2YZUA 4ZL9A 3EMXA 3D4MA 4JBBA 4KCAA 2VOCA 3C1RA 3DEXA 3IDVA 1EP7A 5HR2A 3O6TA 2C4JA 2HZFA 2CVKA 3D4TA 1RQMA 1YF0A 3TCOA 3H8QA 1LU4A 4XIHA 2GDRA 4GQFA 5EPFA 4O32A 4BVXB 3D5JA 3QD9A 1SL2B 3DWVA 2FUG2 4CW9A 3GN3A 4XRAA 1TOFA 2LJKA 3DVXA 3IOSA 3UEMA 1OC9A 3L9VA 3ZVJA 2IMKA 3BCIA 3E3EA 3FY7A 5CP1A 4K9ZA 3CXGA 4NAXA 1X5EA 2FA8A 3M1GA 1FOVA 3HA9A 2JSYA 4ZL7A 4N0VA 3C1SA 2L5OA 4JRRA 1F9MA 3QCPA 1YEPA 4WR5A 1SL0B 5D8IA 5JWOB 5ECMB 5JCUA 1HD2A 2HLSA 4N10A 1XVWA 2YWMA 1W4VA 1OE7A 6GSXA 3HDCA 3L0HA 1GTBA 3GYKA 4V2LA 3H4KA 3KD0A 5CREA 4GRFA 4LMVA 2WS2A 4PGTA 3K8NA 3RHBA 4DSSB 3GTUB 4XCSA 2XBQA 2LQQA 3SBCA 2I3YA 3KMOA 14GSA 1BAYA 1TP9A 3A5WA 2QGVA 1V57A 1TXXA 5G2ZA 3GNJA 5IMFA 3TUEA 5IMVA 1SKSB 2H0HA 2DSAA 3GURA 3F0IA 4PQHA 2HRFA 2AB6A 3KH7A 4TR0A 1JZOA 1OKDA 2HRKA 8GSSA 3TGZA 3CRUA 2C3TA 5F0GA 1GUMA 3VI5A 2A4VA 5AISA 1ERVA 2ALBA 3NOFA 1JLWA 3HHVA 3VI7A 2CAIA 1XW6A 1A8YA 4MJBA 1Z5YE 1FO5A 1XOBA 2O7KA 4K7NA 4XHMA 5DAKB 1EEJA 3ZTLA 3FZ5A 3BD2A 5DCHA 2VL3A 2I81A 2GT5A 2GZYA 1GTAA 1OE8A 4ECJA 2E0QA 3FZAA 3QOUA 2E7PA 2VD0A 5FWGA 2VIMA 1U3AA 1R7HA 1XCCA 4GSSA 1K0AA 5A5KA 1FVJA 3UBLA 4PX1A 4OD7A 1GULA 2ES7A 4IP1A 4MPFA 5IMAA 5GSSA 3M9JA 1T4ZA 2GQMA 3U5RE 2R37A 3W8JA 1S3DA 3VPQA 2YWOA 2I1UA 2HT9A 4MPGA 2HZEB 3RAZA 3E9JB 5KEJA 4O92A 1Z7PA 2WB9A 1HQOA 3DIEA 3I9V2 2FGXA 2H74A 1HNCA 4KCEA 4POMA 1ERUA 2L4CA 2H6XA 3EU4A 1TK5B 2CT6A 5HR1A 5A4VA 1XFLA 3CBUA 1J0FA 1M7TA 2C3NA 1K0BA 3DVWA 1U6TA 5F06A 3PPUA 4F0CA 5IO2A 4GTUA 2DIYA 2M80A 4GWRA 2LS5A 4WXTA 3Q6OA 2AYTA 1JZDA 1XWGA 2FA4A 2B1LA 18GSA 1PKWA 2C0EA 4EUYA 1NHYA 3G7JA 3RDWA 5ECOB 2DJKA 1HYUA 2NBSA 1ZGNA 4YQUA 4YH2A 4HUAA 3CRTA 2J9HA 1K0MA 3FEUA 4IVFA 5AN1A 5IMDA 5LCZA 3ZITA 2G2QA 2JADA 2LRNA 4G0LA 1ZOFA 2F8FA 1ON4A 3IAS2 3ERWA 2N5FA 1I5GA 2B7JA 1K0NA 3APOA 4EC0A 4YAVA 1F3AA 4IHUA 2WJUA 3M3MA 3DXBA 2VM2A 3OR5A 4WF4A 2IWTA 6GSWA 1WRYA 2B1KA 4TXVA 2H01A 1OKTA 3KTLA 2OA7A 2GZPA 4ZB8A 1GUHA 2JL4A 3ZMKA 4I6XA 2B3SA 5G1KA 4JE1A 3I69A 5ID2A 5DQSA 3US3A 3LYPA 3A2WA 1WIKA 3HJPA 3JCML 3M9KA 3J7Yb 4HQSA 5G31A 5G5EA 4PUAA 4K8MA 4DEJA 3SWLA 1AAZA 4Z7XA 1X9SB 4PURA 3D22A 1PA3A 4OFTA 1SJ6A 2L6CA 2YV9A 2WGRA 5BMUA 1XVQA 2V6OA 1HNAA 1ACVA 4E8EA 2DJ2A 2R5GA 5KN0A 2IMEA 3UOMA 1FB0A 3P7XA 1AXDA 1MD4A 2HFDA 4MF6A 2GQKA 4MJAA 2BMXA 1U88A 3ZIJA 2NPBA 4WBJA 2VCVA 5H5SA 1TK8B 3TJJA 1TK0B 1T00A 4FIWA 3KEBA 4AF2A 3FK8A 2AUVA 4EXJA 1EP8A 5LNKe 4AJ8A 3R3EA 4RI7A 2H8LA 4F9ZA 4AGSA 1YZXA 3VWUA 4KDYA 2E2MA 4HU7A 1H75A 3DMLA 1WE0A 3HXSA 2YCDA 3HVXA 4LLRA 2YWIA 4L8EA 4IGJA 4Q5NA 4ULXA 4ML6A 1PMTA 3HVSA 4BWQA 4IKHA 1XWCA 5EY6A 2MMAA 3RPPA 4HJMA 2QSIA 2H0GA 1GWCA 4IJIA 1AQXA 3PGTA 1GH2A 4MH2A 3MSZA 4KE3A 3C71A 3KJYA 2FLSA 2IMIA 4BL7A 2N5BA 4G10A 3TRPA 1XIYA 3WGDA 9GSSA 3LWAA 4K0NA 1G0TA 3TDGA 1PGTA 1S3AA 3A2VA 5J9CA 2IMDA 3EYTA 2J23A 1ZYQB 3MWHA 2IPAA 5ECQB 1T3BA 3LSZA 2L6DA 4TXOA 5KN3A 4OFMA 3RHCA 4EVMA 3UL3A 2F3MA 5IPGA 1K3LA 2HRNA 3I6AA 1OAZA 2ON5A 3TJFA 3LEFA 2FNOA 3GSTA 3H93A 1PN9A 1SJZA 5B8AA 1V40A 2V6KA 1H4OA 2PERA 1QXHA 4XTSA 2YOIA 3MNGA 4O5RA 1YQ1A 3KGKA 3L9UA 1T4YA 1DE2A 1WP0A 4TOPA 2PPTA 4I8BA 5J3RA 3VLNA 3PH9A 4OO5A 2H71A 2GQLA 2V1MA 1SK2A 3EU3A 5CYYA 1K0DA 1ABAA 3QAVA 1SK0A 2HSMB 1I9DA 4GLTA 3M8NA 1U87A 2XPDA 2PWJA 1YDKA 1GSQA 3D6IA 3TKSA 4DSQA 2VD1A 1PRXA 1Q98A 5AGYA 2B5YA 4GXZA 4GCIA 5D9VA 5KN1A 1XBSA 4NMUA 1SKRB 4TR1A 4YQVA 4BVYB 3HVVA 5GZZB 1MEKA 2YV7A 1ZZYA 1QK8A 2XHFA 2C3QA 2H6YA 5HFIA 1Z6NA 2AHEA 1BEDA 2FCHA 1SYXA 2H1GA 4G0IA 4MDCA 4J57E 2H76A 4PNGA 3G7YA 4V1Ap 4XS1A 1JHBA 3QMXA 1GSYA 1U3IA 5JCWA 2OBKA 4G2EA 1GSDA 2JZSA 1OYJA 2LEGA 2OACA 2LSTA 2L4QA 3FR6A 2IFQA 1EOGA 2Z9SA 4EDYA 1JFUA 2H70A 2O85A 3CYNA 3GFKA 1THXA 1A2LA 4G9HA 3F6DA 1Y6EA 1XWAA 4Q5QA 4MA9A 4MH3A 2H19A 3TOTA 4J56E 4IS0A 4L0UA 4KDUA 5F05A 1V9WA 2WULA 2GVPA 2DIZA 3GA4A 2K9FA 2ZNMA 2H0IA 4IELA 1Z6MA 4K7IA 4BPYA 3ZLPA 5CO3A 2H6ZA 2VM1A 2LJRA 5DALB 1DBYA 13GSA 4WETA 2MZCA 3UVTA 3HJOA 1K0CA 3KM6A 3KP9A 1EWXA 4MCUA 4OMVA 5ECNB 3IPZA 1FW1A 1TRVA 2X8HA 4KX4A 2JU5A 1TRUA 5DBQA 2KHPA 3FRCA 4KB3A 5DJMA 4IP6A 2K18A 5IMZA 1TTZA 1X5CA 2CVBA 2L59A 1QFNA 2OKAA 1A8LA 1F3BA 1THOA 1XXUA 1F37A 3BBYA 1Q4JA 4F03A 1G7EA 6GSTA 2EC4A 5EVOA 3KXOA 5DJLA 6GSSA 2BJXA 1QQ2A 3GL5A 1OVNA 4HS1A 3HJMA 2DMLA 5F07A 2OE0A 3H1NA 1FAAA 2TRXA 4O7HA 3S9FA 3KIJA 2L57A 2FWEA 4V2MA 2O8VB 4LA1A 4ZB6A 1JZRA 3GKKA 2B5EA 4EO3A 1K3OA 2PN8A 1EGRA 6GSVA 4POBA 5AIXA 1QMVA 4XS4A 4OWYA 4WBRD 1M9AA 3FYGA 3TB2A 4RI6A 3DYRA 2HSYA 3FKFA 1A24A 1R5PA 2EIRA 2P5QA 1M99A 1NHOA 1K0OA 2OE3A 1A23A 2KOKA 4KNDA 1GRXA 3F3QA 1SK1A 2HNLA 3DGQA 2OBIA 4KF9A 1IYHA 5J5NA 2AJQB 4NV5A 2FWHA 1SD9A 2RUFA 3IAM2 4MJCA 2VCWA 1YKAA 3VWXA 2ON7A 1ERTA 3APSA 4V1Ag 4MP4A 1G6WA 2VLTA 5FT3A 3IXRA 5DDLA 1R5AA 2KP1A 3N5OA 2MMOA 5B6MA 1GSFA 4K6XA 5F8BA 1PL1A 4ILFA 2C0GA 3V1WA 3FW2A 4MZWA 3EURA 3GSSA 4HU9A 4OCFA 5IO0A 3IC8A 4PUFC 2HRKB 3HKRA 1GLQA 1G7OA 3RPNA 2A2SA 2B6MA 1SL1B 1RW1A 2B7KA 2R2JA 1GLPA 2BTOT 3A3TA 3WGEA 1AIUA 4ZBBA 1WWJA 1TDIA 5DQYA 4IBPA 2CVDA 2M46A 2WZ9A 1TI1A 3LJRA 2LV3A 1E6BA 1QGVA 2DMMA 1EOHA 2DJ3A 1BQ7A 3O76A 3ME8A 2YJ7A 3QAWA 4WKWA 1PSQA 2OE1A 1T1VA 3CMIA 4ECIA 4MF7A 4RQRA 4POKA 3E0UA 1SD8A 2LRCA 1EEMA 4QQ7A 1B9YC 2IL3A 2P31A 3EE2A 1X5DA 3EINA 1BYEA 2IMFA 1X9MB 1JZWA 4LL1B 1BX9A 3EC3A 3ZIVA 4D73A 1IYIA 2VAFA 1GTUA 5A4WA 3F6FA 4HZ4A 2VL2C 3IHQA 1PD21 3FHKA 4IW9A 2LKUA 4LMWA 4HDEA 5GAND 3TJGA 3UIWA 3GV1A 1VF2A 4ZIJA 17GSA 1ZCPA 1F6MC 2H1AA 2C1YA 2WRTA 4TRXA 2I4AA 1SU9A 2EIOA 2MMZA 3IR4A 3TJKA 1O81A 4MZCA 3BJ5A 2V2GA 1XWKA 3WT2A 5EL8A 7GSSA 5CRWA 2F9SA 2CZ3A 2EIQA 5GAPD 2ZUPA 4BVXA 1XW5A 2WCIA 5IM9A 5DVBA 5CNWA 2FWFA 4TR4A 4HEA2 4K1FA 3ZZXA 1TW9A 2KP2A 4LL4B 3VURA 3LFLA 5JWRB 3HY2A 2KUCA 2CX4A 2PGTA 3ZVJD 4NXIA 4QL7A 1VF1A 4YQMA 3NZNA 3QAGA 3G9BA 3F8UA 4TW5A 5IOXA 3PINA 3KP8A 5ECSA 2GSTA 1O8XA 2H75A 4ID0A 2GSSA 3TJBA 3F4SA 4GSNA 4MMMA 1USBA 3EMPA 3VWVA 5H5RA 4MLYA 2CX3A 3ISOA 5HR0A 1GNEA 4ZILA 1UN2A 2GSQA 1B4PA 3GX0A 4L5OA 1N8JA 2NDOA 1VGLA 1M2AA 1O6JA 5CAXA 2MYGA 5J4UA 5E59A 3G7IA 2HSNB 4OFNA 5ECIB 4WEYA 2GZZA 4FYCA 4CDOA 4OCEA 4DVCA 4XS6A 1TRSA 3LORA 2VUPA 4I5QA 3IK7A 4YAPA 4DSSA 3GTUA 2NTOA 3C73A 5IQYA 5KN2A 4HOJA 3APQA 1G6YA 4NHWA 2H1DA 4MABA 5ECRB 2CA8A 2YNXA 1TU8A 3LXZA 3ZFLA 1NW2A 5CRDA 3WD6A 2IJYA 2YZHA 1QUWA 1MDKA 1DUGA 5ENUA 2MMNA 2LRTA 1X0RA 3LYKA 1MD3A 2L5LA 4BA7A 2CAQA 2JZRA 5ID2B 2MBSA 5IMCA 2GLRA 1NSWA 2XC2A 2VLVA 2WDUA 2GGTA 2QC7A 2OADA 2PVOC 4EE0A 1R26A 4ECBA 2DBCA 3UVHA 20GSA 3IK9A 3FZ4A 3ZMLA 3LQ7A 2YWNA 5DAKA 4NPBA 2QKEA 4I97A 3R2QA 3GHAA 1CQHA 1A0RP 3GH9A 4X43A 6GSYA 2X8CA 1NM3A 1PQNA 1AQVA 1V98A 3GIXA 2HI7A 3D21A 3GUSA 3QPMA 5L71A 1AC1A 2DJ1A 4CHSA 2CZ2A 4F0BA 2H66A 3HZ4A 3A2XA 3ERFA 3IV4A 4XRDA 2VO4A 3C7MA 4TR3A 1CQGA 2O89A 3CSJA 3VPTA 1X9WB 3QDNA 1SJIA 2X8GA 4JR4A 2DJJA 2AAWA 4MK3A 3TKRA 3KTBA 5G1LA 1DSBA 2HSHA 2YANA 2RLIA 5D9TA 3F63A 3BOAA 3KMNA 2V32A 2C80A 1OC8A 2XPEA 4RUVA 1SYRA 1UA5A 2X64A 2HZEA 1PX7A 1VF4A 2H73A 4I2TA 4WF5A 3L4NA 5G5FA 2V41A 1Z7RA 5C04A 4NV2A 4X1UA 2X99A 3RBTA 4HZ2A 2LUSA 4BL7B 4WR4A 5FHIA 12GSA 1XOAA 5IPHA 4ZBAA 3EVIA 3U6VA 3Q19A 3KH9A 2REMA 4MF5A 4EL1A 1TU7A 3QFBC 1ZL9A 5ECLB 4FYBA 3D0ZA 5B7CA 3GKMA 3GL3A 2P5RA 3C8EA 4L5LA 3ZYWA 4TXOB 2P0GA 2VCTA 2DLXA 4GSTA 2UZ8A 4ISDA 2D2ZA 5HQPA 2R4VA 3IC4A 5C00A 2PMTA 2VLUA 4ZL8A 2LQOA 4KA0A 1GTIA 4TVEA 1W89A 3VWWA 1AQWA 2C0FA 1WJKA 3IE3A 2GS3A 1YF1A 2KLXA 5LD0A 4KSMA 1K3YA 2AV4A 3QR6A 2H1BA 1ERWA 3TKPA 1TRWA 1B4QA 4MZBA 4AJ6A 4GF0A 3H79A 2LJAA 5D9XA 4Q5RA 1TKDB 3HD5A 2K8VA 3MAKA 1M2BA 1HNBA 1OC9B 4HJ2A 4FQUA 1PL2A 1O7UA 5IIZA 4TR1B 1URMA 1PX6A 1ST9A 3L9SA 4FYUA 2F51A 1EV9A 3TOUA 3FZ9A 5ECHB 2JZTA 2HQTA 1B8XA 4EF0A 4TKYA 2RIIA 4KH7A 2E2GA 3ED3A 1GL8A 2XBIA 5COHA 1MDIA 2A2RA 1Z9HA 4G0KA 1GSEA 22GSA 5JWQB 1TI3A 2GTUA 3VK9A 3GH6A 4F82A 4PQIA 1J08A 1A2JA 3HZ8A 2IFQB 3GX8A 10GSA 3UMAA 1LJRA 2G0FA 1SENA 1B48A 2PBJA 1KBNA 4HI7A 1YEXA 1B9XC 2WFCA 5AIVA 4X0XA 1OC3A 1AUCA 3PR8A 3DD3A 2H30A 1M0UA 4F2IA 3LXTA 4JU5A 1O8WA 2PUKC 2TRCP 5CRHA 1VRSD 5J41A 1WPIA 4NHZA 4N30A 2GSRA 2DJ0A 1T8EB 1EGOA 1GSUA 4EKZA 2K6VA 1S3CA 2F8AA 4JZQA 4BWSA 3CTGA 4ZXGA 4ACSA 2LNTA 2YPMA 4USSA 2RUEA 2VCZA 2YJHA 1Y25A 3I43A 2TIRA 3VFIA 3GKNA 1O85A
chains in the Genus database with same CATH superfamily
1BG5A 2LTKA 2OJLA 3TKQA 1YJ6A 3P90A 4P3YB 6GSUA 4I2UA 4ECCA 4ML1A 4TN8A 1JLVA 4FO5A 5DCGA 4NWYA 3UJ1A 3ZFBA 3TRQA 3AY8A 2GT6A 3FR9A 3KZQA 1MDJA 4PQ1A 3W6GA 4J2FA 16GSA 2O87A 4DSRA 4KSOA 2K8SA 2WW2A 3FR3A 2JACA 4IQAA 3F9UA 1BJXA 1ZYEA 1XW9A 4PNFA 1YKCA 2FHEA 3O3TA 2IN3A 2HYXA 3TU3B 1V2AA 1YY7A 3CSIA 3IA1A 5G30A 1EV4A 4K7OA 5ABRA 1KTEA 3FMWA 4L0WA 1FB6A 5B6NA 3EWLA 4RQXA 4G19A 2EFHA 3NIVA 3W8SA 2PU9C 2FY6A 5B8BA 4ZBDA 4XS4B 1PKZA 4V2NA 2IIYA 4K2DA 1ML6A 1LBKA 2R6KA 1VF3A 2H72A 2NVLA 3UBKA 4KGIA 2MBTA 1J9BA 1XZOA 1RK4A 1XPVA 3RFRC 1GP1A 1TXUA 2RM5A 4EDZA 3P8WA 5ECKB 3TRXA 2HXKA 4KDXA 1R4WA 1KNGA 2YN1A 4POLA 3LGCA 3QFAC 5D73A 5ECPB 1Z3EA 4N0ZA 5D96A 3BCKA 2DC5A 3A5IA 2HSMA 4KW6A 2C0DA 2I9HA 11GSA 2X4AA 2YP6A 3F4RA 4IQ1A 4AJ7A 3WT1A 4MJEA 1WMJA 1M9BA 5J4VA 5JCGA 3F4TA 4QL9A 2FD3A 3HCZA 1AW9A 3WGXA 1UC7A 4BVYA 2WVXB 2VL9A 5BRTA 4FH8A 1E2YA 1WOUA 2R3XA 3ERGA 1GSSA 1GNWA 19GSA 3UARA 3P2AA 3DKSA 1EZKA 1O73A 3WYWA 5HR3A 3ZRDA 3J7Yk 2JSZA 2CQ9A 1N2AA 5GSTA 3TKSC 3GRXA 5ELAA 1T7PB 4JR6A 3TKSE 4PXOA 4H86A 3HYPA 3ME7A 3GMFA 2RM6A 2PVQA 2HRAA 4IJ3A 1KEBA 5A4UA 1ILOA 3IBHA 3F3RA 4JEDA 3UAPA 4YKGA 4GQCA 1A2MA 5IOWA 3ZL5A 3IRAA 1XWBA 4E8HA 2ZCTA 2FWGA 1FG4A 1TJDA 2VL2A 4IN0A 5H5QA 3LG6A 2LNSA 4PTSA 3ZREA 1FVKA 2VKZG 1V58A 1I1IP 4KAEA 5HFKA 1ZMAA 1F2EA 5J9BA 1FHEA 3DRNA 4N11A 3L78A 1SKWB 1DE1A 2M72A 1UVZA 2B5XA 1MTCA 3N9JA 3RGBC 1M2DA 4ZB9A 2CV4A 5CRGA 2C8UA 3M0FA 3GKXA 5D9WA 5E4WA 1GUKA 3CSHA 2HE3A 4D73B 1C72A 5ELGA 5INYA 4KUNA 5D93A 1A0FA 5HFGA 2WW3A 5DALA 3KCMA 2VCXA 2VCQA 2N5AA 3Q74A 5A5HA 4Q5FA 4HQZA 4K0GA 4OO4A 3MDKA 3Q18A 3CTFA 2YZUA 4ZL9A 3EMXA 3D4MA 4JBBA 4KCAA 2VOCA 3C1RA 3DEXA 3IDVA 1EP7A 5HR2A 3O6TA 2C4JA 2X49A 2HZFA 2CVKA 3D4TA 1RQMA 1YF0A 3TCOA 3H8QA 1LU4A 4XIHA 2GDRA 4GQFA 5EPFA 4O32A 4BVXB 3D5JA 3QD9A 1SL2B 2OT3A 3DWVA 2FUG2 4CW9A 4ICYA 3GN3A 4XRAA 1TOFA 2LJKA 3DVXA 3IOSA 3UEMA 1OC9A 3L9VA 3ZVJA 2IMKA 3BCIA 3E3EA 3FY7A 5CP1A 4K9ZA 3CXGA 3IHGA 4NAXA 1X5EA 2FA8A 3M1GA 1FOVA 3HA9A 1PFOA 2JSYA 4ZL7A 4N0VA 3C1SA 2L5OA 4JRRA 5A1NA 1F9MA 3QCPA 1YEPA 4WR5A 1SL0B 3HMJG 5D8IA 5JWOB 5ECMB 5JCUA 1HD2A 2HLSA 4N10A 1XVWA 2YWMA 1W4VA 1OE7A 6GSXA 3HDCA 3L0HA 1GTBA 3GYKA 4V2LA 3H4KA 3KD0A 5CREA 4GRFA 4LMVA 2WS2A 4PGTA 3K8NA 3RHBA 4DSSB 3GTUB 4XCSA 2XBQA 2LQQA 1SVLA 3SBCA 1M3JA 2I3YA 3KMOA 14GSA 1BAYA 1TP9A 3A5WA 2QGVA 1V57A 1TXXA 5G2ZA 3GNJA 5IMFA 3TUEA 5IMVA 1SKSB 2H0HA 2DSAA 3GURA 3F0IA 1YVLA 4PQHA 2HRFA 2AB6A 3KH7A 4TR0A 1JZOA 1OKDA 2HRKA 4PHZC 3TGZA 3CRUA 8GSSA 2C3TA 2WVYA 5F0GA 1GUMA 3VI5A 2A4VA 5AISA 1ERVA 2ALBA 3NOFA 1JLWA 3HHVA 3VI7A 2CAIA 1XW6A 1A8YA 4MJBA 1N25A 1Z5YE 1FO5A 1XOBA 2O7KA 4K7NA 4XHMA 5DAKB 1EEJA 3ZTLA 3FZ5A 3BD2A 5DCHA 2VL3A 2I81A 2GT5A 2GZYA 4X4JA 1GTAA 1OE8A 4ECJA 2E0QA 3FZAA 3QOUA 2E7PA 2VD0A 5FWGA 2VIMA 1U3AA 1R7HA 1XCCA 4GSSA 1K0AA 5A5KA 1FVJA 3UBLA 4PX1A 4OD7A 1GULA 2ES7A 4IP1A 4MPFA 5IMAA 5GSSA 3M9JA 1T4ZA 2GQMA 3U5RE 2R37A 3W8JA 1S3DA 3VPQA 2YWOA 2I1UA 2HT9A 4MPGA 2HZEB 3RAZA 3E9JB 5KEJA 4O92A 1Z7PA 2WB9A 1HQOA 3DIEA 3I9V2 2FGXA 2H74A 4EIPA 1HNCA 4KCEA 4POMA 1ERUA 2L4CA 2H6XA 3EU4A 1TK5B 2CT6A 5HR1A 5A4VA 1XFLA 3CBUA 1J0FA 1M7TA 2WW1A 2C3NA 1K0BA 3DVWA 1U6TA 4GDFA 5F06A 3PPUA 4F0CA 5IO2A 4GTUA 2DIYA 2M80A 4GWRA 4AKXB 2LS5A 4WXTA 3Q6OA 4Z2TA 2AYTA 1JZDA 1XWGA 2FA4A 2B1LA 18GSA 1PKWA 2C0EA 4EUYA 1NHYA 3G7JA 4O5UA 3RDWA 5ECOB 2DJKA 1HYUA 2NBSA 1ZGNA 4YQUA 4EIQA 4YH2A 4HUAA 3CRTA 2J9HA 1K0MA 1SVMA 3FEUA 4IVFA 5AN1A 2HSNA 5LCZA 5IMDA 3ZITA 2G2QA 2JADA 2LRNA 4G0LA 1ZOFA 2F8FA 1ON4A 3IAS2 3ERWA 2N5FA 1I5GA 2B7JA 1K0NA 3APOA 4EC0A 4YAVA 1F3AA 4IHUA 2WJUA 3M3MA 3DXBA 2VM2A 3OR5A 4WF4A 2IWTA 6GSWA 1WRYA 2B1KA 4TXVA 2H01A 1OKTA 3KTLA 2OA7A 2GZPA 4ZB8A 1GUHA 4A5PA 2JL4A 3ZMKA 4I6XA 2B3SA 5G1KA 4JE1A 3I69A 2R0GA 5ID2A 1BG1A 5DQSA 3US3A 3LYPA 3A2WA 1WIKA 3HJPA 3JCML 3M9KA 1Y1UA 3J7Yb 4HQSA 5G31A 5G5EA 4PUAA 4K8MA 4DEJA 3SWLA 1AAZA 4Z7XA 4FXYP 1X9SB 4PURA 3D22A 1PA3A 4OFTA 1SJ6A 2L6CA 2YV9A 2WGRA 5BMUA 1XVQA 2V6OA 1HNAA 1ACVA 4E8EA 2UV8G 2DJ2A 2R5GA 5KN0A 2IMEA 3UOMA 1FB0A 1S3RA 3P7XA 1AXDA 1MD4A 2HFDA 4MF6A 2GQKA 4MJAA 2BMXA 1U88A 3ZIJA 4K5SA 2NPBA 4WBJA 2VCVA 5H5SA 1TK8B 3TJJA 1TK0B 1T00A 4FIWA 4O5QA 3KEBA 4AF2A 3FK8A 2AUVA 4EXJA 1EP8A 5LNKe 4AJ8A 3R3EA 4RI7A 2H8LA 4F9ZA 4AGSA 1YZXA 3VWUA 4KDYA 2E2MA 4HU7A 1H75A 3DMLA 1WE0A 1XG8A 3HXSA 2YCDA 3HVXA 4LLRA 2YWIA 2A4HA 4L8EA 4IGJA 4Q5NA 4ULXA 4ML6A 1PMTA 3HVSA 2QA1A 4BWQA 4IKHA 1XWCA 5EY6A 2MMAA 3RPPA 4HJMA 2QSIA 2H0GA 1GWCA 4IJIA 1AQXA 3PGTA 1GH2A 4MH2A 3MSZA 4KE3A 3C71A 3KJYA 2FLSA 2IMIA 4BL7A 2N5BA 4G10A 3TRPA 1XIYA 3WGDA 9GSSA 3LWAA 4K0NA 1G0TA 3TDGA 1PGTA 2EFEA 1S3AA 3A2VA 5J9CA 2IMDA 3EYTA 2J23A 1ZYQB 3MWHA 2IPAA 5ECQB 1T3BA 4BIKA 3LSZA 2L6DA 4TXOA 5KN3A 4OFMA 3RHCA 4EVMA 4W66A 3UL3A 3CWGA 3CQFA 2F3MA 5IPGA 1K3LA 2HRNA 3I6AA 1OAZA 2ON5A 3TJFA 3LEFA 2FNOA 3GSTA 3H93A 1PN9A 1SJZA 5B8AA 1V40A 2V6KA 1H4OA 2PERA 1QXHA 4XTSA 2YOIA 3MNGA 4O5RA 1YQ1A 3KGKA 3L9UA 1T4YA 2QA2A 1DE2A 1WP0A 4TOPA 5A34A 2PPTA 4I8BA 5J3RA 3VLNA 2WW0A 3PH9A 4OO5A 4HSCX 2H71A 2GQLA 2V1MA 1SK2A 3EU3A 5CYYA 1K0DA 1ABAA 3QAVA 2WVZA 1SK0A 2HSMB 1I9DA 4GLTA 3M8NA 1U87A 2XPDA 2PWJA 1YDKA 1GSQA 3D6IA 3TKSA 4DSQA 4AKIA 2VD1A 1PRXA 1Q98A 5AGYA 2B5YA 4GXZA 4GCIA 5D9VA 5KN1A 1XBSA 4NMUA 1SKRB 4TR1A 4YQVA 4BVYB 3HVVA 5GZZB 1MEKA 2YV7A 1ZZYA 1QK8A 2XHFA 2C3QA 2H6YA 5HFIA 1Z6NA 2AHEA 1BEDA 5J4YA 2FCHA 1SYXA 2H1GA 4G0IA 4MDCA 5J40A 4J57E 2H76A 4PNGA 3G7YA 4V1Ap 4XS1A 1JHBA 2H1LA 3QMXA 1GSYA 1U3IA 5JCWA 2OBKA 4G2EA 1GSDA 2JZSA 1OYJA 2LEGA 2OACA 2LSTA 2L4QA 3FR6A 2IFQA 1EOGA 2Z9SA 4EDYA 1JFUA 2H70A 4K2XA 2O85A 3CYNA 3GFKA 1THXA 1A2LA 4G9HA 3F6DA 1Y6EA 1XWAA 4Q5QA 4MA9A 4MH3A 2H19A 3TOTA 4J56E 4IS0A 4L0UA 4KDUA 5F05A 1V9WA 2WULA 1BF5A 2GVPA 2DIZA 3GA4A 2K9FA 2ZNMA 2H0IA 2R0PA 4IELA 1Z6MA 4K7IA 4BPYA 3ZLPA 3LW9A 5CO3A 2H6ZA 2VM1A 2LJRA 5DALB 1DBYA 13GSA 4WETA 2MZCA 3UVTA 5A5HB 3HJOA 1K0CA 3KM6A 3KP9A 1EWXA 4MCUA 4OMVA 5ECNB 3IPZA 1FW1A 1TRVA 2X8HA 4KX4A 2JU5A 1TRUA 5DBQA 4ZB7A 2KHPA 3MYDA 3FRCA 4KB3A 5DJMA 4IP6A 2K18A 5IMZA 1TTZA 1X5CA 2CVBA 2L59A 1QFNA 2OKAA 1A8LA 1F3BA 1THOA 1XXUA 1F37A 3BBYA 1Q4JA 4F03A 1G7EA 6GSTA 2EC4A 2A2PA 3CHXC 5EVOA 3KXOA 5DJLA 6GSSA 2BJXA 1QQ2A 3GL5A 1OVNA 4HS1A 3HJMA 2DMLA 5F07A 2OE0A 4PI2C 3H1NA 1FAAA 2TRXA 4O7HA 3S9FA 3KIJA 2L57A 2FWEA 4V2MA 2O8VB 4LA1A 4ZB6A 1FOHA 1JZRA 3GKKA 5KOXA 2B5EA 4EO3A 1K3OA 2PN8A 1EGRA 6GSVA 4POBA 5AIXA 1QMVA 4XS4A 4OWYA 4WBRD 1M9AA 3FYGA 3TB2A 4RI6A 3DYRA 2HSYA 3FKFA 1A24A 1R5PA 2EIRA 2P5QA 1M99A 1NHOA 1K0OA 2OE3A 1A23A 2KOKA 4KNDA 2WZSA 1GRXA 3EPTA 3F3QA 1SK1A 2HNLA 3DGQA 2OBIA 4KF9A 1IYHA 5J5NA 2AJQB 4NV5A 2FWHA 1SD9A 2RUFA 3IAM2 4MJCA 2VCWA 1YKAA 3VWXA 2ON7A 1ERTA 3APSA 4V1Ag 4MP4A 1G6WA 2VLTA 5FT3A 3IXRA 5DDLA 1R5AA 2KP1A 3N5OA 2MMOA 5B6MA 1GSFA 4K6XA 5F8BA 1PL1A 4ILFA 2C0GA 2WVXA 3V1WA 3FW2A 4MZWA 3EURA 3GSSA 4HU9A 4OCFA 5IO0A 3IC8A 4PUFC 2HRKB 3HKRA 1GLQA 1YEWC 1G7OA 3RPNA 2A2SA 2B6MA 1SL1B 1RW1A 2B7KA 2R2JA 1GLPA 2BTOT 3A3TA 3WGEA 1AIUA 3MIXA 4ZBBA 1WWJA 1TDIA 5DQYA 4AKHA 4IBPA 2CVDA 2M46A 2WZ9A 1TI1A 3LJRA 2LV3A 1E6BA 1QGVA 2DMMA 1EOHA 2DJ3A 1BQ7A 3O76A 3ME8A 2YJ7A 3QAWA 4WKWA 1PSQA 2OE1A 1T1VA 3CMIA 4ECIA 4MF7A 4RQRA 4POKA 3E0UA 1SD8A 2LRCA 1EEMA 4QQ7A 1B9YC 2IL3A 2P31A 3EE2A 1X5DA 3EINA 1BYEA 2IMFA 1X9MB 1JZWA 4LL1B 1BX9A 3EC3A 3ZIVA 4D73A 1IYIA 2VAFA 1GTUA 5A4WA 3F6FA 4HZ4A 2VL2C 3IHQA 1PD21 3FHKA 4IW9A 2LKUA 4LMWA 4HDEA 5GAND 3TJGA 3UIWA 3GV1A 1VF2A 4ZIJA 17GSA 1ZCPA 1F6MC 2H1AA 2C1YA 2WRTA 4TRXA 2I4AA 1SU9A 2EIOA 4N3ZA 1PN0A 2MMZA 3IR4A 4YKFA 3TJKA 1O81A 4MZCA 2O3EA 3BJ5A 2V2GA 1XWKA 3WT2A 5EL8A 7GSSA 5CRWA 2F9SA 2CZ3A 2EIQA 5GAPD 2ZUPA 4BVXA 1XW5A 2WCIA 5IM9A 4G01A 5DVBA 5CNWA 2FWFA 4TR4A 4HEA2 4K1FA 3ZZXA 1TW9A 2KP2A 4LL4B 3VURA 3LFLA 5JWRB 3HY2A 2KUCA 2CX4A 2PGTA 3ZVJD 4NXIA 4QL7A 1VF1A 4YQMA 3NZNA 3QAGA 4K5RA 3G9BA 3F8UA 4TW5A 5IOXA 3PINA 3KP8A 5ECSA 2GSTA 1O8XA 2H75A 4ID0A 2GSSA 3TJBA 3F4SA 2O36A 4GSNA 4MMMA 4Z2RA 1USBA 3EMPA 3VWVA 5H5RA 4MLYA 2CX3A 3ISOA 5HR0A 1GNEA 4ZILA 1UN2A 2GSQA 1SVOA 1B4PA 3GX0A 4L5OA 1N8JA 2NDOA 1VGLA 1M2AA 1O6JA 5CAXA 2MYGA 5J4UA 5E59A 3G7IA 2HSNB 4OFNA 5ECIB 4WEYA 2GZZA 4FYCA 4CDOA 4OCEA 4DVCA 4XS6A 1TRSA 3LORA 2DKHA 2VUPA 4I5QA 3IK7A 4YAPA 4DSSA 3GTUA 2NTOA 3C73A 5IQYA 5KN2A 4HOJA 3APQA 1G6YA 4NHWA 2H1DA 4MABA 5ECRB 2CA8A 2YNXA 1TU8A 3LXZA 3ZFLA 1NW2A 5CRDA 4CY6A 3WD6A 2IJYA 2YZHA 1QUWA 1MDKA 1ZYPA 1DUGA 5ENUA 2MMNA 2LRTA 1X0RA 3LYKA 1MD3A 2L5LA 4BA7A 2CAQA 2JZRA 5ID2B 2MBSA 5IMCA 2GLRA 1NSWA 2XC2A 2VLVA 4Z2UA 2WDUA 2GGTA 2QC7A 2OADA 5KOWA 2PVOC 4EE0A 1R26A 4ECBA 2DBCA 3UVHA 20GSA 3IK9A 3FZ4A 3ZMLA 2O5VA 3LQ7A 2YWNA 5DAKA 4NPBA 2QKEA 4I97A 3R2QA 5BMUB 3GHAA 1CQHA 1A0RP 3GH9A 4X43A 6GSYA 2X8CA 1NM3A 1M3IA 1PQNA 1AQVA 1V98A 3GIXA 2HI7A 3D21A 3GUSA 3QPMA 5L71A 1AC1A 2DJ1A 4CHSA 2CZ2A 4F0BA 2H66A 3HZ4A 3A2XA 3ERFA 3IV4A 4XRDA 4E68A 2VO4A 3C7MA 4TR3A 1CQGA 2O89A 3CSJA 3VPTA 1X9WB 3QDNA 1SJIA 2X8GA 4JR4A 2DJJA 2AAWA 4MK3A 3TKRA 3KTBA 5G1LA 1DSBA 2HSHA 2YANA 2RLIA 5D9TA 3F63A 3BOAA 3KMNA 2V32A 2C80A 1OC8A 2XPEA 4RUVA 1SYRA 1UA5A 2X64A 2EFDA 2HZEA 1PX7A 1VF4A 2H73A 4I2TA 4WF5A 3L4NA 5G5FA 2V41A 1Z7RA 5C04A 4NV2A 4X1UA 2X99A 3RBTA 4HZ2A 2LUSA 4BL7B 4WR4A 5FHIA 12GSA 1XOAA 2DKIA 5IPHA 4ZBAA 3EVIA 3U6VA 3Q19A 3KH9A 2REMA 4MF5A 4EL1A 4AKGA 1S4BP 1TU7A 3QFBC 1ZL9A 5ECLB 4FYBA 3D0ZA 5B7CA 3GKMA 4AI6A 3GL3A 2P5RA 3C8EA 4L5LA 3ZYWA 4TXOB 2P0GA 2VCTA 2DLXA 4GSTA 2UZ8A 4ISDA 2D2ZA 5HQPA 2R4VA 3IC4A 5C00A 2PMTA 2VLUA 4CY8A 4ZL8A 2LQOA 4KA0A 1GTIA 4TVEA 1W89A 3VWWA 5A34B 1AQWA 2C0FA 1WJKA 3IE3A 2GS3A 1YF1A 2KLXA 5LD0A 4KSMA 1K3YA 2AV4A 3QR6A 2H1BA 1ERWA 3HVNA 1TRWA 3TKPA 1B4QA 4MZBA 4AJ6A 4GF0A 3H79A 2LJAA 5D9XA 4Q5RA 1TKDB 3HD5A 2K8VA 3MAKA 1M2BA 1HNBA 1OC9B 4HJ2A 4FQUA 1PL2A 1O7UA 5IIZA 4TR1B 1URMA 1PX6A 1ST9A 3L9SA 4FYUA 5J47A 2F51A 1EV9A 3TOUA 3FZ9A 5ECHB 2JZTA 2HQTA 1B8XA 4EF0A 4TKYA 2RIIA 4KH7A 2E2GA 3ED3A 1GL8A 5A1NB 2EFCA 2XBIA 5COHA 1MDIA 2A2RA 1Z9HA 4G0KA 1GSEA 22GSA 5JWQB 4QMKA 1TI3A 2GTUA 3VK9A 3GH6A 4F82A 4PQIA 1J08A 1A2JA 3HZ8A 2IFQB 3GX8A 10GSA 3UMAA 1LJRA 2G0FA 1SENA 1B48A 2PBJA 1KBNA 4HI7A 1YEXA 2WFCA 1B9XC 5AIVA 4X0XA 1OC3A 1AUCA 1ZYNA 3PR8A 3DD3A 2H30A 1M0UA 4F2IA 3LXTA 4JU5A 1O8WA 2PUKC 2TRCP 5CRHA 1VRSD 4MNNA 5J41A 1WPIA 4NHZA 4N30A 2GSRA 2DJ0A 1T8EB 1EGOA 1GSUA 4EKZA 2K6VA 1S3CA 4PI0C 2F8AA 4JZQA 4BWSA 3CTGA 4ZXGA 2R0CA 4ACSA 2LNTA 2YPMA 4USSA 2RUEA 2VCZA 2YJHA 1Y25A 3I43A 2TIRA 3VFIA 3GKNA 1O85A
chains in the Genus database with same CATH topology
1BG5A 2LTKA 2OJLA 3TKQA 1YJ6A 3P90A 4P3YB 6GSUA 4I2UA 4ECCA 4ML1A 4TN8A 1JLVA 4FO5A 5DCGA 4NWYA 3UJ1A 3ZFBA 3TRQA 3AY8A 2GT6A 3FR9A 3KZQA 1MDJA 4PQ1A 3W6GA 4J2FA 16GSA 2O87A 4DSRA 4KSOA 2K8SA 3FR3A 2JACA 4IQAA 3F9UA 1BJXA 1ZYEA 1XW9A 4PNFA 1YKCA 2FHEA 3O3TA 2IN3A 2HYXA 3TU3B 1V2AA 1YY7A 3CSIA 3IA1A 5G30A 1EV4A 4K7OA 5ABRA 1KTEA 3FMWA 4L0WA 1FB6A 5B6NA 3EWLA 4RQXA 4G19A 2EFHA 3NIVA 3W8SA 2PU9C 2FY6A 5B8BA 4ZBDA 4XS4B 1PKZA 4V2NA 2IIYA 4K2DA 1ML6A 1LBKA 2R6KA 1VF3A 2H72A 2NVLA 3UBKA 4KGIA 2MBTA 1J9BA 1XZOA 1RK4A 1XPVA 1GP1A 1TXUA 2RM5A 4EDZA 3P8WA 5ECKB 3TRXA 2HXKA 4KDXA 1R4WA 1KNGA 2YN1A 4POLA 3LGCA 3QFAC 5D73A 5ECPB 1Z3EA 4N0ZA 5D96A 3BCKA 2DC5A 3A5IA 2HSMA 4KW6A 2C0DA 2I9HA 11GSA 2X4AA 2YP6A 3F4RA 4IQ1A 4AJ7A 3WT1A 4MJEA 1WMJA 1M9BA 5J4VA 5JCGA 3F4TA 4QL9A 2FD3A 3HCZA 1AW9A 3WGXA 1UC7A 4BVYA 2VL9A 5BRTA 4FH8A 1E2YA 1WOUA 2R3XA 3ERGA 1GSSA 1GNWA 19GSA 3UARA 3P2AA 3DKSA 1EZKA 1O73A 3WYWA 5HR3A 3ZRDA 3J7Yk 2JSZA 2CQ9A 1N2AA 5GSTA 3TKSC 3GRXA 5ELAA 1T7PB 4JR6A 3TKSE 4PXOA 4H86A 3HYPA 3ME7A 3GMFA 2RM6A 2PVQA 2HRAA 4IJ3A 1KEBA 5A4UA 1ILOA 3IBHA 3F3RA 4JEDA 3UAPA 4YKGA 4GQCA 1A2MA 5IOWA 3ZL5A 3IRAA 1XWBA 4E8HA 2ZCTA 2FWGA 1FG4A 1TJDA 2VL2A 4IN0A 5H5QA 3LG6A 2LNSA 4PTSA 3ZREA 1FVKA 2VKZG 1V58A 4KAEA 5HFKA 1ZMAA 1F2EA 5J9BA 1FHEA 3DRNA 4N11A 3L78A 1SKWB 1DE1A 2M72A 1UVZA 2B5XA 1MTCA 3N9JA 1M2DA 4ZB9A 2CV4A 5CRGA 2C8UA 3M0FA 3GKXA 5D9WA 5E4WA 1GUKA 3CSHA 2HE3A 4D73B 1C72A 5ELGA 5INYA 4KUNA 5D93A 1A0FA 5HFGA 5DALA 3KCMA 2VCXA 2VCQA 2N5AA 3Q74A 5A5HA 4Q5FA 4HQZA 4K0GA 4OO4A 3MDKA 3Q18A 3CTFA 2YZUA 4ZL9A 3EMXA 3D4MA 4JBBA 4KCAA 2VOCA 3C1RA 3DEXA 3IDVA 1EP7A 5HR2A 3O6TA 2C4JA 2X49A 2HZFA 2CVKA 3D4TA 1RQMA 1YF0A 3TCOA 3H8QA 1LU4A 4XIHA 2GDRA 4GQFA 5EPFA 4O32A 4BVXB 3D5JA 3QD9A 1SL2B 2OT3A 3DWVA 2FUG2 4CW9A 4ICYA 3GN3A 4XRAA 1TOFA 2LJKA 3DVXA 3IOSA 3UEMA 1OC9A 3L9VA 3ZVJA 2IMKA 3BCIA 3E3EA 3FY7A 5CP1A 4K9ZA 3CXGA 3IHGA 4NAXA 1X5EA 2FA8A 3M1GA 1FOVA 3HA9A 2JSYA 4ZL7A 4N0VA 3C1SA 2L5OA 4JRRA 5A1NA 1F9MA 3QCPA 1YEPA 4WR5A 1SL0B 3HMJG 5D8IA 5JWOB 5ECMB 5JCUA 1HD2A 2HLSA 4N10A 1XVWA 2YWMA 1W4VA 1OE7A 6GSXA 3HDCA 3L0HA 1GTBA 3GYKA 4V2LA 3H4KA 3KD0A 5CREA 4GRFA 4LMVA 2WS2A 4PGTA 3K8NA 3RHBA 4DSSB 3GTUB 4XCSA 2XBQA 2LQQA 1SVLA 3SBCA 2I3YA 3KMOA 14GSA 1BAYA 1TP9A 3A5WA 2QGVA 1V57A 1TXXA 5G2ZA 3GNJA 5IMFA 3TUEA 5IMVA 1SKSB 2H0HA 2DSAA 3GURA 3F0IA 1YVLA 4PQHA 2HRFA 2AB6A 3KH7A 4TR0A 1JZOA 1OKDA 2HRKA 8GSSA 3TGZA 3CRUA 2C3TA 5F0GA 1GUMA 3VI5A 2A4VA 5AISA 1ERVA 2ALBA 3NOFA 1JLWA 3HHVA 3VI7A 2CAIA 1XW6A 1A8YA 4MJBA 1N25A 1Z5YE 1FO5A 1XOBA 2O7KA 4K7NA 4XHMA 5DAKB 1EEJA 3ZTLA 3FZ5A 3BD2A 5DCHA 2VL3A 2I81A 2GT5A 2GZYA 4X4JA 1GTAA 1OE8A 4ECJA 2E0QA 3FZAA 3QOUA 2E7PA 2VD0A 5FWGA 2VIMA 1U3AA 1R7HA 1XCCA 4GSSA 1K0AA 5A5KA 1FVJA 3UBLA 4PX1A 4OD7A 1GULA 2ES7A 4IP1A 4MPFA 5IMAA 5GSSA 3M9JA 1T4ZA 2GQMA 3U5RE 2R37A 3W8JA 1S3DA 3VPQA 2YWOA 2I1UA 2HT9A 4MPGA 2HZEB 3RAZA 3E9JB 5KEJA 4O92A 1Z7PA 2WB9A 1HQOA 3DIEA 3I9V2 2FGXA 2H74A 4EIPA 1HNCA 4KCEA 4POMA 1ERUA 2L4CA 2H6XA 3EU4A 1TK5B 2CT6A 5HR1A 5A4VA 1XFLA 3CBUA 1J0FA 1M7TA 2C3NA 1K0BA 3DVWA 1U6TA 4GDFA 5F06A 3PPUA 4F0CA 5IO2A 4GTUA 2DIYA 2M80A 4GWRA 4AKXB 2LS5A 4WXTA 3Q6OA 4Z2TA 2AYTA 1JZDA 1XWGA 2FA4A 2B1LA 18GSA 1PKWA 2C0EA 4EUYA 1NHYA 3G7JA 4O5UA 3RDWA 5ECOB 2DJKA 1HYUA 2NBSA 1ZGNA 4YQUA 4EIQA 4YH2A 4HUAA 3CRTA 2J9HA 1K0MA 1SVMA 3FEUA 4IVFA 5AN1A 2HSNA 5LCZA 5IMDA 3ZITA 2G2QA 2JADA 2LRNA 4G0LA 1ZOFA 2F8FA 1ON4A 3IAS2 3ERWA 2N5FA 1I5GA 2B7JA 1K0NA 3APOA 4EC0A 4YAVA 1F3AA 4IHUA 2WJUA 3M3MA 3DXBA 2VM2A 3OR5A 4WF4A 2IWTA 6GSWA 1WRYA 2B1KA 4TXVA 2H01A 1OKTA 3KTLA 2OA7A 2GZPA 4ZB8A 1GUHA 4A5PA 2JL4A 3ZMKA 4I6XA 2B3SA 5G1KA 4JE1A 3I69A 2R0GA 5ID2A 1BG1A 5DQSA 3US3A 3LYPA 3A2WA 1WIKA 3HJPA 3JCML 3M9KA 1Y1UA 3J7Yb 4HQSA 5G31A 5G5EA 4PUAA 4K8MA 4DEJA 3SWLA 1AAZA 4Z7XA 1X9SB 4PURA 3D22A 1PA3A 4OFTA 1SJ6A 2L6CA 2YV9A 2WGRA 5BMUA 1XVQA 2V6OA 1HNAA 1ACVA 4E8EA 2UV8G 2DJ2A 2R5GA 5KN0A 2IMEA 3UOMA 1FB0A 3P7XA 1AXDA 1MD4A 2HFDA 4MF6A 2GQKA 4MJAA 2BMXA 1U88A 3ZIJA 4K5SA 2NPBA 4WBJA 2VCVA 5H5SA 1TK8B 3TJJA 1TK0B 1T00A 4FIWA 4O5QA 3KEBA 4AF2A 3FK8A 2AUVA 4EXJA 1EP8A 5LNKe 4AJ8A 3R3EA 4RI7A 2H8LA 4F9ZA 4AGSA 1YZXA 3VWUA 4KDYA 2E2MA 4HU7A 1H75A 3DMLA 1WE0A 3HXSA 2YCDA 3HVXA 4LLRA 2YWIA 2A4HA 4L8EA 4IGJA 4Q5NA 4ULXA 4ML6A 1PMTA 3HVSA 2QA1A 4BWQA 4IKHA 1XWCA 5EY6A 2MMAA 3RPPA 4HJMA 2QSIA 2H0GA 1GWCA 4IJIA 1AQXA 3PGTA 1GH2A 4MH2A 3MSZA 4KE3A 3C71A 3KJYA 2FLSA 2IMIA 4BL7A 2N5BA 4G10A 3TRPA 1XIYA 3WGDA 9GSSA 3LWAA 4K0NA 1G0TA 3TDGA 1PGTA 2EFEA 1S3AA 3A2VA 5J9CA 2IMDA 3EYTA 2J23A 1ZYQB 3MWHA 2IPAA 5ECQB 1T3BA 3LSZA 2L6DA 4TXOA 5KN3A 4OFMA 3RHCA 4EVMA 4W66A 3UL3A 3CWGA 2F3MA 5IPGA 1K3LA 2HRNA 3I6AA 1OAZA 2ON5A 3TJFA 3LEFA 2FNOA 3GSTA 3H93A 1PN9A 1SJZA 5B8AA 1V40A 2V6KA 1H4OA 2PERA 1QXHA 4XTSA 2YOIA 3MNGA 4O5RA 1YQ1A 3KGKA 3L9UA 1T4YA 2QA2A 1DE2A 1WP0A 4TOPA 5A34A 2PPTA 4I8BA 5J3RA 3VLNA 3PH9A 4OO5A 2H71A 2GQLA 2V1MA 1SK2A 3EU3A 5CYYA 1K0DA 1ABAA 3QAVA 1SK0A 2HSMB 1I9DA 4GLTA 3M8NA 1U87A 2XPDA 2PWJA 1YDKA 1GSQA 3D6IA 3TKSA 4DSQA 4AKIA 2VD1A 1PRXA 1Q98A 5AGYA 2B5YA 4GXZA 4GCIA 5D9VA 5KN1A 1XBSA 4NMUA 1SKRB 4TR1A 4YQVA 4BVYB 3HVVA 5GZZB 1MEKA 2YV7A 1ZZYA 1QK8A 2XHFA 2C3QA 2H6YA 5HFIA 1Z6NA 2AHEA 1BEDA 5J4YA 2FCHA 1SYXA 2H1GA 4G0IA 4MDCA 5J40A 4J57E 2H76A 4PNGA 3G7YA 4V1Ap 4XS1A 1JHBA 2H1LA 3QMXA 1GSYA 1U3IA 5JCWA 2OBKA 4G2EA 1GSDA 2JZSA 1OYJA 2LEGA 2OACA 2LSTA 2L4QA 3FR6A 2IFQA 1EOGA 2Z9SA 4EDYA 1JFUA 2H70A 4K2XA 2O85A 3CYNA 3GFKA 1THXA 1A2LA 4G9HA 3F6DA 1Y6EA 1XWAA 4Q5QA 4MA9A 4MH3A 2H19A 3TOTA 4J56E 4IS0A 4L0UA 4KDUA 5F05A 1V9WA 2WULA 1BF5A 2GVPA 2DIZA 3GA4A 2K9FA 2ZNMA 2H0IA 2R0PA 4IELA 1Z6MA 4K7IA 4BPYA 3ZLPA 3LW9A 5CO3A 2H6ZA 2VM1A 2LJRA 5DALB 1DBYA 13GSA 4WETA 2MZCA 3UVTA 5A5HB 3HJOA 1K0CA 3KM6A 3KP9A 1EWXA 4MCUA 4OMVA 5ECNB 3IPZA 1FW1A 1TRVA 2X8HA 4KX4A 2JU5A 1TRUA 5DBQA 4ZB7A 2KHPA 3MYDA 3FRCA 4KB3A 5DJMA 4IP6A 2K18A 5IMZA 1TTZA 1X5CA 2CVBA 2L59A 1QFNA 2OKAA 1A8LA 1F3BA 1THOA 1XXUA 1F37A 3BBYA 1Q4JA 4F03A 1G7EA 6GSTA 2EC4A 2A2PA 5EVOA 3KXOA 5DJLA 6GSSA 2BJXA 1QQ2A 3GL5A 1OVNA 4HS1A 3HJMA 2DMLA 5F07A 2OE0A 3H1NA 1FAAA 2TRXA 4O7HA 3S9FA 3KIJA 2L57A 2FWEA 4V2MA 2O8VB 4LA1A 4ZB6A 1FOHA 1JZRA 3GKKA 5KOXA 2B5EA 4EO3A 1K3OA 2PN8A 1EGRA 6GSVA 4POBA 5AIXA 1QMVA 4XS4A 4OWYA 4WBRD 1M9AA 3FYGA 3TB2A 4RI6A 3DYRA 2HSYA 3FKFA 1A24A 1R5PA 2EIRA 2P5QA 1M99A 1NHOA 1K0OA 2OE3A 1A23A 2KOKA 4KNDA 1GRXA 3EPTA 3F3QA 1SK1A 2HNLA 3DGQA 2OBIA 4KF9A 1IYHA 5J5NA 2AJQB 4NV5A 2FWHA 1SD9A 2RUFA 3IAM2 4MJCA 2VCWA 1YKAA 3VWXA 2ON7A 1ERTA 3APSA 4V1Ag 4MP4A 1G6WA 2VLTA 5FT3A 3IXRA 5DDLA 1R5AA 2KP1A 3N5OA 2MMOA 5B6MA 1GSFA 4K6XA 5F8BA 1PL1A 4ILFA 2C0GA 3V1WA 3FW2A 4MZWA 3EURA 3GSSA 4HU9A 4OCFA 5IO0A 3IC8A 4PUFC 2HRKB 3HKRA 1GLQA 1G7OA 3RPNA 2A2SA 2B6MA 1SL1B 1RW1A 2B7KA 2R2JA 1GLPA 2BTOT 3A3TA 3WGEA 1AIUA 3MIXA 4ZBBA 1WWJA 1TDIA 5DQYA 4AKHA 4IBPA 2CVDA 2M46A 2WZ9A 1TI1A 3LJRA 2LV3A 1E6BA 1QGVA 2DMMA 1EOHA 2DJ3A 1BQ7A 3O76A 3ME8A 2YJ7A 3QAWA 4WKWA 1PSQA 2OE1A 1T1VA 3CMIA 4ECIA 4MF7A 4RQRA 4POKA 3E0UA 1SD8A 2LRCA 1EEMA 4QQ7A 1B9YC 2IL3A 2P31A 3EE2A 1X5DA 3EINA 1BYEA 2IMFA 1X9MB 1JZWA 4LL1B 1BX9A 3EC3A 3ZIVA 4D73A 1IYIA 2VAFA 1GTUA 5A4WA 3F6FA 4HZ4A 2VL2C 3IHQA 1PD21 3FHKA 4IW9A 2LKUA 4LMWA 4HDEA 5GAND 3TJGA 3UIWA 3GV1A 1VF2A 4ZIJA 17GSA 1ZCPA 1F6MC 2H1AA 2C1YA 2WRTA 4TRXA 2I4AA 1SU9A 2EIOA 4N3ZA 1PN0A 2MMZA 3IR4A 4YKFA 3TJKA 1O81A 4MZCA 3BJ5A 2V2GA 1XWKA 3WT2A 5EL8A 7GSSA 5CRWA 2F9SA 2CZ3A 2EIQA 5GAPD 2ZUPA 4BVXA 1XW5A 2WCIA 5IM9A 4G01A 5DVBA 5CNWA 2FWFA 4TR4A 4HEA2 4K1FA 3ZZXA 1TW9A 2KP2A 4LL4B 3VURA 3LFLA 5JWRB 3HY2A 2KUCA 2CX4A 2PGTA 3ZVJD 4NXIA 4QL7A 1VF1A 4YQMA 3NZNA 3QAGA 4K5RA 3G9BA 3F8UA 4TW5A 5IOXA 3PINA 3KP8A 5ECSA 2GSTA 1O8XA 2H75A 4ID0A 2GSSA 3TJBA 3F4SA 4GSNA 4MMMA 4Z2RA 1USBA 3EMPA 3VWVA 5H5RA 4MLYA 2CX3A 3ISOA 5HR0A 1GNEA 4ZILA 1UN2A 2GSQA 1SVOA 1B4PA 3GX0A 4L5OA 1N8JA 2NDOA 1VGLA 1M2AA 1O6JA 5CAXA 2MYGA 5J4UA 5E59A 3G7IA 2HSNB 4OFNA 5ECIB 4WEYA 2GZZA 4FYCA 4CDOA 4OCEA 4DVCA 4XS6A 1TRSA 3LORA 2DKHA 2VUPA 4I5QA 3IK7A 4YAPA 4DSSA 3GTUA 2NTOA 3C73A 5IQYA 5KN2A 4HOJA 3APQA 1G6YA 4NHWA 2H1DA 4MABA 5ECRB 2CA8A 2YNXA 1TU8A 3LXZA 3ZFLA 1NW2A 5CRDA 4CY6A 3WD6A 2IJYA 2YZHA 1QUWA 1MDKA 1ZYPA 1DUGA 5ENUA 2MMNA 2LRTA 1X0RA 3LYKA 1MD3A 2L5LA 4BA7A 2CAQA 2JZRA 5ID2B 2MBSA 5IMCA 2GLRA 1NSWA 2XC2A 2VLVA 4Z2UA 2WDUA 2GGTA 2QC7A 2OADA 5KOWA 2PVOC 4EE0A 1R26A 4ECBA 2DBCA 3UVHA 20GSA 3IK9A 3FZ4A 3ZMLA 2O5VA 3LQ7A 2YWNA 5DAKA 4NPBA 2QKEA 4I97A 3R2QA 5BMUB 3GHAA 1CQHA 1A0RP 3GH9A 4X43A 6GSYA 2X8CA 1NM3A 1PQNA 1AQVA 1V98A 3GIXA 2HI7A 3D21A 3GUSA 3QPMA 5L71A 1AC1A 2DJ1A 4CHSA 2CZ2A 4F0BA 2H66A 3HZ4A 3A2XA 3ERFA 3IV4A 4XRDA 4E68A 2VO4A 3C7MA 4TR3A 1CQGA 2O89A 3CSJA 3VPTA 1X9WB 3QDNA 1SJIA 2X8GA 4JR4A 2DJJA 2AAWA 4MK3A 3TKRA 3KTBA 5G1LA 1DSBA 2HSHA 2YANA 2RLIA 5D9TA 3F63A 3BOAA 3KMNA 2V32A 2C80A 1OC8A 2XPEA 4RUVA 1SYRA 1UA5A 2X64A 2EFDA 2HZEA 1PX7A 1VF4A 2H73A 4I2TA 4WF5A 3L4NA 5G5FA 2V41A 1Z7RA 5C04A 4NV2A 4X1UA 2X99A 3RBTA 4HZ2A 2LUSA 4BL7B 4WR4A 5FHIA 12GSA 1XOAA 2DKIA 5IPHA 4ZBAA 3EVIA 3U6VA 3Q19A 3KH9A 2REMA 4MF5A 4EL1A 4AKGA 1TU7A 3QFBC 1ZL9A 5ECLB 4FYBA 3D0ZA 5B7CA 3GKMA 4AI6A 3GL3A 2P5RA 3C8EA 4L5LA 3ZYWA 4TXOB 2P0GA 2VCTA 2DLXA 4GSTA 2UZ8A 4ISDA 2D2ZA 5HQPA 2R4VA 3IC4A 5C00A 2PMTA 2VLUA 4CY8A 4ZL8A 2LQOA 4KA0A 1GTIA 4TVEA 1W89A 3VWWA 5A34B 1AQWA 2C0FA 1WJKA 3IE3A 2GS3A 1YF1A 2KLXA 5LD0A 4KSMA 1K3YA 2AV4A 3QR6A 2H1BA 1ERWA 3TKPA 1TRWA 1B4QA 4MZBA 4AJ6A 4GF0A 3H79A 2LJAA 5D9XA 4Q5RA 1TKDB 3HD5A 2K8VA 3MAKA 1M2BA 1HNBA 1OC9B 4HJ2A 4FQUA 1PL2A 1O7UA 5IIZA 4TR1B 1URMA 1PX6A 1ST9A 3L9SA 4FYUA 5J47A 2F51A 1EV9A 3TOUA 3FZ9A 5ECHB 2JZTA 2HQTA 1B8XA 4EF0A 4TKYA 2RIIA 4KH7A 2E2GA 3ED3A 1GL8A 5A1NB 2EFCA 2XBIA 5COHA 1MDIA 2A2RA 1Z9HA 4G0KA 1GSEA 22GSA 5JWQB 4QMKA 1TI3A 2GTUA 3VK9A 3GH6A 4F82A 4PQIA 1J08A 1A2JA 3HZ8A 2IFQB 3GX8A 10GSA 3UMAA 1LJRA 2G0FA 1SENA 1B48A 2PBJA 1KBNA 4HI7A 1YEXA 2WFCA 1B9XC 5AIVA 4X0XA 1OC3A 1AUCA 1ZYNA 3PR8A 3DD3A 2H30A 1M0UA 4F2IA 3LXTA 4JU5A 1O8WA 2PUKC 2TRCP 5CRHA 1VRSD 4MNNA 5J41A 1WPIA 4NHZA 4N30A 2GSRA 2DJ0A 1T8EB 1EGOA 1GSUA 4EKZA 2K6VA 1S3CA 2F8AA 4JZQA 4BWSA 3CTGA 4ZXGA 2R0CA 4ACSA 2LNTA 2YPMA 4USSA 2RUEA 2VCZA 2YJHA 1Y25A 3I43A 2TIRA 3VFIA 3GKNA 1O85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BG5 A;  2LTK A;  2OJL A;  3TKQ A;  1YJ6 A;  3P90 A;  4P3Y B;  6GSU A;  4I2U A;  4ECC A;  4ML1 A;  4TN8 A;  1JLV A;  4FO5 A;  5DCG A;  4NWY A;  3UJ1 A;  3ZFB A;  3TRQ A;  3AY8 A;  2GT6 A;  3FR9 A;  3KZQ A;  1MDJ A;  4PQ1 A;  3W6G A;  4J2F A;  16GS A;  2O87 A;  4DSR A;  4KSO A;  2K8S A;  3FR3 A;  2JAC A;  4IQA A;  3F9U A;  1BJX A;  1ZYE A;  1XW9 A;  4PNF A;  1YKC A;  2FHE A;  3O3T A;  2IN3 A;  2HYX A;  1V2A A;  1YY7 A;  3CSI A;  3IA1 A;  5G30 A;  1EV4 A;  4K7O A;  5ABR A;  1KTE A;  4L0W A;  1FB6 A;  5B6N A;  3EWL A;  4RQX A;  4G19 A;  3NIV A;  3W8S A;  2PU9 C;  2FY6 A;  5B8B A;  4ZBD A;  4XS4 B;  1PKZ A;  4V2N A;  2IIY A;  4K2D A;  1ML6 A;  1LBK A;  2R6K A;  1VF3 A;  2H72 A;  2NVL A;  3UBK A;  4KGI A;  2MBT A;  1J9B A;  1XZO A;  1RK4 A;  1XPV A;  1GP1 A;  2RM5 A;  4EDZ A;  3P8W A;  5ECK B;  3TRX A;  2HXK A;  4KDX A;  1R4W A;  1KNG A;  2YN1 A;  4POL A;  3LGC A;  3QFA C;  5D73 A;  5ECP B;  1Z3E A;  4N0Z A;  5D96 A;  3BCK A;  2DC5 A;  2HSM A;  4KW6 A;  2C0D A;  2I9H A;  11GS A;  2YP6 A;  3F4R A;  4IQ1 A;  4AJ7 A;  3WT1 A;  4MJE A;  1WMJ A;  1M9B A;  5JCG A;  3F4T A;  4QL9 A;  2FD3 A;  3HCZ A;  1AW9 A;  3WGX A;  1UC7 A;  4BVY A;  2VL9 A;  4FH8 A;  1E2Y A;  1WOU A;  2R3X A;  3ERG A;  1GSS A;  1GNW A;  19GS A;  3UAR A;  3P2A A;  3DKS A;  1EZK A;  1O73 A;  3WYW A;  5HR3 A;  3ZRD A;  3J7Y k;  2JSZ A;  2CQ9 A;  1N2A A;  5GST A;  3TKS C;  3GRX A;  5ELA A;  1T7P B;  4JR6 A;  3TKS E;  4PXO A;  4H86 A;  3HYP A;  3ME7 A;  3GMF A;  2RM6 A;  2PVQ A;  2HRA A;  4IJ3 A;  1KEB A;  5A4U A;  1ILO A;  3IBH A;  3F3R A;  4JED A;  3UAP A;  4GQC A;  1A2M A;  5IOW A;  3ZL5 A;  3IRA A;  1XWB A;  4E8H A;  2ZCT A;  2FWG A;  1FG4 A;  1TJD A;  2VL2 A;  4IN0 A;  5H5Q A;  3LG6 A;  2LNS A;  4PTS A;  3ZRE A;  1FVK A;  1V58 A;  4KAE A;  5HFK A;  1ZMA A;  1F2E A;  5J9B A;  1FHE A;  3DRN A;  4N11 A;  3L78 A;  1SKW B;  1DE1 A;  2M72 A;  1UVZ A;  2B5X A;  1MTC A;  3N9J A;  1M2D A;  4ZB9 A;  2CV4 A;  5CRG A;  2C8U A;  3M0F A;  3GKX A;  5D9W A;  5E4W A;  1GUK A;  3CSH A;  2HE3 A;  4D73 B;  1C72 A;  5ELG A;  5INY A;  4KUN A;  5D93 A;  1A0F A;  5HFG A;  5DAL A;  3KCM A;  2VCX A;  2VCQ A;  2N5A A;  3Q74 A;  4Q5F A;  4HQZ A;  4K0G A;  4OO4 A;  3MDK A;  3Q18 A;  3CTF A;  2YZU A;  4ZL9 A;  3EMX A;  3D4M A;  4JBB A;  4KCA A;  2VOC A;  3C1R A;  3DEX A;  3IDV A;  1EP7 A;  5HR2 A;  3O6T A;  2C4J A;  2HZF A;  2CVK A;  3D4T A;  1RQM A;  1YF0 A;  3TCO A;  3H8Q A;  1LU4 A;  4XIH A;  2GDR A;  4GQF A;  5EPF A;  4O32 A;  4BVX B;  3D5J A;  3QD9 A;  1SL2 B;  3DWV A;  2FUG 2;  4CW9 A;  3GN3 A;  4XRA A;  1TOF A;  2LJK A;  3DVX A;  3IOS A;  3UEM A;  1OC9 A;  3L9V A;  3ZVJ A;  2IMK A;  3BCI A;  3E3E A;  3FY7 A;  5CP1 A;  4K9Z A;  3CXG A;  4NAX A;  1X5E A;  2FA8 A;  3M1G A;  1FOV A;  3HA9 A;  2JSY A;  4ZL7 A;  4N0V A;  3C1S A;  2L5O A;  4JRR A;  1F9M A;  3QCP A;  1YEP A;  4WR5 A;  1SL0 B;  5D8I A;  5JWO B;  5ECM B;  5JCU A;  1HD2 A;  2HLS A;  4N10 A;  1XVW A;  2YWM A;  1W4V A;  1OE7 A;  6GSX A;  3HDC A;  3L0H A;  1GTB A;  3GYK A;  4V2L A;  3H4K A;  3KD0 A;  5CRE A;  4GRF A;  4LMV A;  2WS2 A;  4PGT A;  3K8N A;  3RHB A;  4DSS B;  3GTU B;  4XCS A;  2XBQ A;  2LQQ A;  3SBC A;  2I3Y A;  3KMO A;  14GS A;  1BAY A;  1TP9 A;  3A5W A;  2QGV A;  1V57 A;  1TXX A;  5G2Z A;  3GNJ A;  5IMF A;  3TUE A;  5IMV A;  1SKS B;  2H0H A;  2DSA A;  3GUR A;  3F0I A;  4PQH A;  2HRF A;  2AB6 A;  3KH7 A;  4TR0 A;  1JZO A;  1OKD A;  2HRK A;  8GSS A;  3TGZ A;  3CRU A;  2C3T A;  5F0G A;  1GUM A;  3VI5 A;  2A4V A;  5AIS A;  1ERV A;  2ALB A;  3NOF A;  1JLW A;  3HHV A;  3VI7 A;  2CAI A;  1XW6 A;  1A8Y A;  4MJB A;  1Z5Y E;  1FO5 A;  1XOB A;  2O7K A;  4K7N A;  4XHM A;  5DAK B;  1EEJ A;  3ZTL A;  3FZ5 A;  3BD2 A;  5DCH A;  2VL3 A;  2I81 A;  2GT5 A;  2GZY A;  1GTA A;  1OE8 A;  4ECJ A;  2E0Q A;  3FZA A;  3QOU A;  2E7P A;  2VD0 A;  5FWG A;  2VIM A;  1U3A A;  1R7H A;  1XCC A;  4GSS A;  1K0A A;  5A5K A;  1FVJ A;  3UBL A;  4PX1 A;  4OD7 A;  1GUL A;  2ES7 A;  4IP1 A;  4MPF A;  5IMA A;  5GSS A;  3M9J A;  1T4Z A;  2GQM A;  3U5R E;  2R37 A;  3W8J A;  1S3D A;  3VPQ A;  2YWO A;  2I1U A;  2HT9 A;  4MPG A;  2HZE B;  3RAZ A;  3E9J B;  5KEJ A;  4O92 A;  1Z7P A;  2WB9 A;  1HQO A;  3DIE A;  3I9V 2;  2FGX A;  2H74 A;  1HNC A;  4KCE A;  4POM A;  1ERU A;  2L4C A;  2H6X A;  3EU4 A;  1TK5 B;  2CT6 A;  5HR1 A;  5A4V A;  1XFL A;  3CBU A;  1J0F A;  1M7T A;  2C3N A;  1K0B A;  3DVW A;  1U6T A;  5F06 A;  3PPU A;  4F0C A;  5IO2 A;  4GTU A;  2DIY A;  2M80 A;  4GWR A;  2LS5 A;  4WXT A;  3Q6O A;  2AYT A;  1JZD A;  1XWG A;  2FA4 A;  2B1L A;  18GS A;  1PKW A;  2C0E A;  4EUY A;  1NHY A;  3G7J A;  3RDW A;  5ECO B;  2DJK A;  1HYU A;  2NBS A;  1ZGN A;  4YQU A;  4YH2 A;  4HUA A;  3CRT A;  2J9H A;  1K0M A;  3FEU A;  4IVF A;  5AN1 A;  5IMD A;  5LCZ A;  3ZIT A;  2G2Q A;  2JAD A;  2LRN A;  4G0L A;  1ZOF A;  2F8F A;  1ON4 A;  3IAS 2;  3ERW A;  2N5F A;  1I5G A;  2B7J A;  1K0N A;  3APO A;  4EC0 A;  4YAV A;  1F3A A;  4IHU A;  2WJU A;  3M3M A;  3DXB A;  2VM2 A;  3OR5 A;  4WF4 A;  2IWT A;  6GSW A;  1WRY A;  2B1K A;  4TXV A;  2H01 A;  1OKT A;  3KTL A;  2OA7 A;  2GZP A;  4ZB8 A;  1GUH A;  2JL4 A;  3ZMK A;  4I6X A;  2B3S A;  5G1K A;  4JE1 A;  3I69 A;  5ID2 A;  5DQS A;  3US3 A;  3LYP A;  3A2W A;  1WIK A;  3HJP A;  3JCM L;  3M9K A;  3J7Y b;  4HQS A;  5G31 A;  5G5E A;  4PUA A;  4K8M A;  4DEJ A;  3SWL A;  1AAZ A;  4Z7X A;  1X9S B;  4PUR A;  3D22 A;  1PA3 A;  4OFT A;  1SJ6 A;  2L6C A;  2YV9 A;  2WGR A;  5BMU A;  1XVQ A;  2V6O A;  1HNA A;  1ACV A;  4E8E A;  2DJ2 A;  2R5G A;  5KN0 A;  2IME A;  3UOM A;  1FB0 A;  3P7X A;  1AXD A;  1MD4 A;  2HFD A;  4MF6 A;  2GQK A;  4MJA A;  2BMX A;  1U88 A;  3ZIJ A;  2NPB A;  4WBJ A;  2VCV A;  5H5S A;  1TK8 B;  3TJJ A;  1TK0 B;  1T00 A;  4FIW A;  3KEB A;  4AF2 A;  3FK8 A;  2AUV A;  4EXJ A;  1EP8 A;  5LNK e;  4AJ8 A;  3R3E A;  4RI7 A;  2H8L A;  4F9Z A;  4AGS A;  1YZX A;  3VWU A;  4KDY A;  2E2M A;  4HU7 A;  1H75 A;  3DML A;  1WE0 A;  3HXS A;  2YCD A;  3HVX A;  4LLR A;  2YWI A;  4L8E A;  4IGJ A;  4Q5N A;  4ULX A;  4ML6 A;  1PMT A;  3HVS A;  4BWQ A;  4IKH A;  1XWC A;  5EY6 A;  2MMA A;  3RPP A;  4HJM A;  2QSI A;  2H0G A;  1GWC A;  4IJI A;  1AQX A;  3PGT A;  1GH2 A;  4MH2 A;  3MSZ A;  4KE3 A;  3C71 A;  3KJY A;  2FLS A;  2IMI A;  4BL7 A;  2N5B A;  4G10 A;  3TRP A;  1XIY A;  3WGD A;  9GSS A;  3LWA A;  4K0N A;  1G0T A;  3TDG A;  1PGT A;  1S3A A;  3A2V A;  5J9C A;  2IMD A;  3EYT A;  2J23 A;  1ZYQ B;  3MWH A;  2IPA A;  5ECQ B;  1T3B A;  3LSZ A;  2L6D A;  4TXO A;  5KN3 A;  4OFM A;  3RHC A;  4EVM A;  3UL3 A;  2F3M A;  5IPG A;  1K3L A;  2HRN A;  3I6A A;  1OAZ A;  2ON5 A;  3TJF A;  3LEF A;  2FNO A;  3GST A;  3H93 A;  1PN9 A;  1SJZ A;  5B8A A;  1V40 A;  2V6K A;  1H4O A;  2PER A;  1QXH A;  4XTS A;  2YOI A;  3MNG A;  4O5R A;  1YQ1 A;  3KGK A;  3L9U A;  1T4Y A;  1DE2 A;  1WP0 A;  4TOP A;  2PPT A;  4I8B A;  5J3R A;  3VLN A;  3PH9 A;  4OO5 A;  2H71 A;  2GQL A;  2V1M A;  1SK2 A;  3EU3 A;  5CYY A;  1K0D A;  1ABA A;  3QAV A;  1SK0 A;  2HSM B;  1I9D A;  4GLT A;  3M8N A;  1U87 A;  2XPD A;  2PWJ A;  1YDK A;  1GSQ A;  3D6I A;  3TKS A;  4DSQ A;  2VD1 A;  1PRX A;  1Q98 A;  5AGY A;  2B5Y A;  4GXZ A;  4GCI A;  5D9V A;  5KN1 A;  1XBS A;  4NMU A;  1SKR B;  4TR1 A;  4YQV A;  4BVY B;  3HVV A;  5GZZ B;  1MEK A;  2YV7 A;  1ZZY A;  1QK8 A;  2XHF A;  2C3Q A;  2H6Y A;  5HFI A;  1Z6N A;  2AHE A;  1BED A;  2FCH A;  1SYX A;  2H1G A;  4G0I A;  4MDC A;  4J57 E;  2H76 A;  4PNG A;  3G7Y A;  4V1A p;  4XS1 A;  1JHB A;  3QMX A;  1GSY A;  1U3I A;  5JCW A;  2OBK A;  4G2E A;  1GSD A;  2JZS A;  1OYJ A;  2LEG A;  2OAC A;  2LST A;  2L4Q A;  3FR6 A;  2IFQ A;  1EOG A;  2Z9S A;  4EDY A;  1JFU A;  2H70 A;  2O85 A;  3CYN A;  3GFK A;  1THX A;  1A2L A;  4G9H A;  3F6D A;  1Y6E A;  1XWA A;  4Q5Q A;  4MA9 A;  4MH3 A;  2H19 A;  3TOT A;  4J56 E;  4IS0 A;  4L0U A;  4KDU A;  5F05 A;  1V9W A;  2WUL A;  2GVP A;  2DIZ A;  3GA4 A;  2K9F A;  2ZNM A;  2H0I A;  4IEL A;  1Z6M A;  4K7I A;  4BPY A;  3ZLP A;  5CO3 A;  2H6Z A;  2VM1 A;  2LJR A;  5DAL B;  1DBY A;  13GS A;  4WET A;  2MZC A;  3UVT A;  3HJO A;  1K0C A;  3KM6 A;  3KP9 A;  1EWX A;  4MCU A;  4OMV A;  5ECN B;  3IPZ A;  1FW1 A;  1TRV A;  2X8H A;  4KX4 A;  2JU5 A;  1TRU A;  5DBQ A;  2KHP A;  3FRC A;  4KB3 A;  5DJM A;  4IP6 A;  2K18 A;  5IMZ A;  1TTZ A;  1X5C A;  2CVB A;  2L59 A;  1QFN A;  2OKA A;  1A8L A;  1F3B A;  1THO A;  1XXU A;  1F37 A;  3BBY A;  1Q4J A;  4F03 A;  1G7E A;  6GST A;  2EC4 A;  5EVO A;  3KXO A;  5DJL A;  6GSS A;  2BJX A;  1QQ2 A;  3GL5 A;  1OVN A;  4HS1 A;  3HJM A;  2DML A;  5F07 A;  2OE0 A;  3H1N A;  1FAA A;  2TRX A;  4O7H A;  3S9F A;  3KIJ A;  2L57 A;  2FWE A;  4V2M A;  2O8V B;  4LA1 A;  4ZB6 A;  1JZR A;  3GKK A;  2B5E A;  4EO3 A;  1K3O A;  2PN8 A;  1EGR A;  6GSV A;  4POB A;  5AIX A;  1QMV A;  4XS4 A;  4OWY A;  4WBR D;  1M9A A;  3FYG A;  3TB2 A;  4RI6 A;  3DYR A;  2HSY A;  3FKF A;  1A24 A;  1R5P A;  2EIR A;  2P5Q A;  1M99 A;  1NHO A;  1K0O A;  2OE3 A;  1A23 A;  2KOK A;  4KND A;  1GRX A;  3F3Q A;  1SK1 A;  2HNL A;  3DGQ A;  2OBI A;  4KF9 A;  1IYH A;  5J5N A;  2AJQ B;  4NV5 A;  2FWH A;  1SD9 A;  2RUF A;  3IAM 2;  4MJC A;  2VCW A;  1YKA A;  3VWX A;  2ON7 A;  1ERT A;  3APS A;  4V1A g;  4MP4 A;  1G6W A;  2VLT A;  5FT3 A;  3IXR A;  5DDL A;  1R5A A;  2KP1 A;  3N5O A;  2MMO A;  5B6M A;  1GSF A;  4K6X A;  5F8B A;  1PL1 A;  4ILF A;  2C0G A;  3V1W A;  3FW2 A;  4MZW A;  3EUR A;  3GSS A;  4HU9 A;  4OCF A;  5IO0 A;  3IC8 A;  4PUF C;  2HRK B;  3HKR A;  1GLQ A;  1G7O A;  3RPN A;  2A2S A;  2B6M A;  1SL1 B;  1RW1 A;  2B7K A;  2R2J A;  1GLP A;  2BTO T;  3A3T A;  3WGE A;  1AIU A;  4ZBB A;  1WWJ A;  1TDI A;  5DQY A;  4IBP A;  2CVD A;  2M46 A;  2WZ9 A;  1TI1 A;  3LJR A;  2LV3 A;  1E6B A;  1QGV A;  2DMM A;  1EOH A;  2DJ3 A;  1BQ7 A;  3O76 A;  3ME8 A;  2YJ7 A;  3QAW A;  4WKW A;  1PSQ A;  2OE1 A;  1T1V A;  3CMI A;  4ECI A;  4MF7 A;  4RQR A;  4POK A;  3E0U A;  1SD8 A;  2LRC A;  1EEM A;  4QQ7 A;  1B9Y C;  2IL3 A;  2P31 A;  3EE2 A;  1X5D A;  3EIN A;  1BYE A;  2IMF A;  1X9M B;  1JZW A;  4LL1 B;  1BX9 A;  3EC3 A;  3ZIV A;  4D73 A;  1IYI A;  2VAF A;  1GTU A;  5A4W A;  3F6F A;  4HZ4 A;  2VL2 C;  3IHQ A;  1PD2 1;  3FHK A;  4IW9 A;  2LKU A;  4LMW A;  4HDE A;  5GAN D;  3TJG A;  3UIW A;  3GV1 A;  1VF2 A;  4ZIJ A;  17GS A;  1ZCP A;  1F6M C;  2H1A A;  2C1Y A;  2WRT A;  4TRX A;  2I4A A;  1SU9 A;  2EIO A;  2MMZ A;  3IR4 A;  3TJK A;  1O81 A;  4MZC A;  3BJ5 A;  2V2G A;  1XWK A;  3WT2 A;  5EL8 A;  7GSS A;  5CRW A;  2F9S A;  2CZ3 A;  2EIQ A;  5GAP D;  2ZUP A;  4BVX A;  1XW5 A;  2WCI A;  5IM9 A;  5DVB A;  5CNW A;  2FWF A;  4TR4 A;  4HEA 2;  4K1F A;  3ZZX A;  1TW9 A;  2KP2 A;  4LL4 B;  3VUR A;  3LFL A;  5JWR B;  3HY2 A;  2KUC A;  2CX4 A;  2PGT A;  3ZVJ D;  4NXI A;  4QL7 A;  1VF1 A;  4YQM A;  3NZN A;  3QAG A;  3G9B A;  3F8U A;  4TW5 A;  5IOX A;  3PIN A;  3KP8 A;  5ECS A;  2GST A;  1O8X A;  2H75 A;  4ID0 A;  2GSS A;  3TJB A;  3F4S A;  4GSN A;  4MMM A;  1USB A;  3EMP A;  3VWV A;  5H5R A;  4MLY A;  2CX3 A;  3ISO A;  5HR0 A;  1GNE A;  4ZIL A;  1UN2 A;  2GSQ A;  1B4P A;  3GX0 A;  4L5O A;  1N8J A;  2NDO A;  1VGL A;  1M2A A;  1O6J A;  5CAX A;  2MYG A;  5J4U A;  5E59 A;  3G7I A;  2HSN B;  4OFN A;  5ECI B;  4WEY A;  2GZZ A;  4FYC A;  4CDO A;  4OCE A;  4DVC A;  4XS6 A;  1TRS A;  3LOR A;  2VUP A;  4I5Q A;  3IK7 A;  4YAP A;  4DSS A;  3GTU A;  2NTO A;  3C73 A;  5IQY A;  5KN2 A;  4HOJ A;  3APQ A;  1G6Y A;  4NHW A;  2H1D A;  4MAB A;  5ECR B;  2CA8 A;  2YNX A;  1TU8 A;  3LXZ A;  3ZFL A;  1NW2 A;  5CRD A;  3WD6 A;  2IJY A;  2YZH A;  1QUW A;  1MDK A;  1DUG A;  5ENU A;  2MMN A;  2LRT A;  1X0R A;  3LYK A;  1MD3 A;  2L5L A;  4BA7 A;  2CAQ A;  2JZR A;  5ID2 B;  2MBS A;  5IMC A;  2GLR A;  1NSW A;  2XC2 A;  2VLV A;  2WDU A;  2GGT A;  2QC7 A;  2OAD A;  2PVO C;  4EE0 A;  1R26 A;  4ECB A;  2DBC A;  3UVH A;  20GS A;  3IK9 A;  3FZ4 A;  3ZML A;  3LQ7 A;  2YWN A;  5DAK A;  4NPB A;  2QKE A;  4I97 A;  3R2Q A;  3GHA A;  1CQH A;  1A0R P;  3GH9 A;  4X43 A;  6GSY A;  2X8C A;  1NM3 A;  1PQN A;  1AQV A;  1V98 A;  3GIX A;  2HI7 A;  3D21 A;  3GUS A;  3QPM A;  5L71 A;  1AC1 A;  2DJ1 A;  4CHS A;  2CZ2 A;  4F0B A;  2H66 A;  3HZ4 A;  3A2X A;  3ERF A;  3IV4 A;  4XRD A;  2VO4 A;  3C7M A;  4TR3 A;  1CQG A;  2O89 A;  3CSJ A;  3VPT A;  1X9W B;  3QDN A;  1SJI A;  2X8G A;  4JR4 A;  2DJJ A;  2AAW A;  4MK3 A;  3TKR A;  3KTB A;  5G1L A;  1DSB A;  2HSH A;  2YAN A;  2RLI A;  5D9T A;  3F63 A;  3BOA A;  3KMN A;  2V32 A;  2C80 A;  1OC8 A;  2XPE A;  4RUV A;  1SYR A;  1UA5 A;  2X64 A;  2HZE A;  1PX7 A;  1VF4 A;  2H73 A;  4I2T A;  4WF5 A;  3L4N A;  5G5F A;  2V41 A;  1Z7R A;  5C04 A;  4NV2 A;  4X1U A;  2X99 A;  3RBT A;  4HZ2 A;  2LUS A;  4BL7 B;  4WR4 A;  5FHI A;  12GS A;  1XOA A;  5IPH A;  4ZBA A;  3EVI A;  3U6V A;  3Q19 A;  3KH9 A;  2REM A;  4MF5 A;  4EL1 A;  1TU7 A;  3QFB C;  1ZL9 A;  5ECL B;  4FYB A;  3D0Z A;  5B7C A;  3GKM A;  3GL3 A;  2P5R A;  3C8E A;  4L5L A;  3ZYW A;  4TXO B;  2P0G A;  2VCT A;  2DLX A;  4GST A;  2UZ8 A;  4ISD A;  2D2Z A;  5HQP A;  2R4V A;  3IC4 A;  5C00 A;  2PMT A;  2VLU A;  4ZL8 A;  2LQO A;  4KA0 A;  1GTI A;  4TVE A;  1W89 A;  3VWW A;  1AQW A;  2C0F A;  1WJK A;  3IE3 A;  2GS3 A;  1YF1 A;  2KLX A;  5LD0 A;  4KSM A;  1K3Y A;  2AV4 A;  3QR6 A;  2H1B A;  1ERW A;  3TKP A;  1TRW A;  1B4Q A;  4MZB A;  4AJ6 A;  4GF0 A;  3H79 A;  2LJA A;  5D9X A;  4Q5R A;  1TKD B;  3HD5 A;  2K8V A;  3MAK A;  1M2B A;  1HNB A;  1OC9 B;  4HJ2 A;  4FQU A;  1PL2 A;  1O7U A;  5IIZ A;  4TR1 B;  1URM A;  1PX6 A;  1ST9 A;  3L9S A;  4FYU A;  2F51 A;  1EV9 A;  3TOU A;  3FZ9 A;  5ECH B;  2JZT A;  2HQT A;  1B8X A;  4EF0 A;  4TKY A;  2RII A;  4KH7 A;  2E2G A;  3ED3 A;  1GL8 A;  2XBI A;  5COH A;  1MDI A;  2A2R A;  1Z9H A;  4G0K A;  1GSE A;  22GS A;  5JWQ B;  1TI3 A;  2GTU A;  3VK9 A;  3GH6 A;  4F82 A;  4PQI A;  1J08 A;  1A2J A;  3HZ8 A;  2IFQ B;  3GX8 A;  10GS A;  3UMA A;  1LJR A;  2G0F A;  1SEN A;  1B48 A;  2PBJ A;  1KBN A;  4HI7 A;  1YEX A;  1B9X C;  2WFC A;  5AIV A;  4X0X A;  1OC3 A;  1AUC A;  3PR8 A;  3DD3 A;  2H30 A;  1M0U A;  4F2I A;  3LXT A;  4JU5 A;  1O8W A;  2PUK C;  2TRC P;  5CRH A;  1VRS D;  5J41 A;  1WPI A;  4NHZ A;  4N30 A;  2GSR A;  2DJ0 A;  1T8E B;  1EGO A;  1GSU A;  4EKZ A;  2K6V A;  1S3C A;  2F8A A;  4JZQ A;  4BWS A;  3CTG A;  4ZXG A;  4ACS A;  2LNT A;  2YPM A;  4USS A;  2RUE A;  2VCZ A;  2YJH A;  1Y25 A;  3I43 A;  2TIR A;  3VFI A;  3GKN A;  1O85 A; 
#chains in the Genus database with same CATH topology
 1BG5 A;  2LTK A;  2OJL A;  3TKQ A;  1YJ6 A;  3P90 A;  4P3Y B;  6GSU A;  4I2U A;  4ECC A;  4ML1 A;  4TN8 A;  1JLV A;  4FO5 A;  5DCG A;  4NWY A;  3UJ1 A;  3ZFB A;  3TRQ A;  3AY8 A;  2GT6 A;  3FR9 A;  3KZQ A;  1MDJ A;  4PQ1 A;  3W6G A;  4J2F A;  16GS A;  2O87 A;  4DSR A;  4KSO A;  2K8S A;  2WW2 A;  3FR3 A;  2JAC A;  4IQA A;  3F9U A;  1BJX A;  1ZYE A;  1XW9 A;  4PNF A;  1YKC A;  2FHE A;  3O3T A;  2IN3 A;  2HYX A;  3TU3 B;  1V2A A;  1YY7 A;  3CSI A;  3IA1 A;  5G30 A;  1EV4 A;  4K7O A;  5ABR A;  1KTE A;  3FMW A;  4L0W A;  1FB6 A;  5B6N A;  3EWL A;  4RQX A;  4G19 A;  2EFH A;  3NIV A;  3W8S A;  2PU9 C;  2FY6 A;  5B8B A;  4ZBD A;  4XS4 B;  1PKZ A;  4V2N A;  2IIY A;  4K2D A;  1ML6 A;  1LBK A;  2R6K A;  1VF3 A;  2H72 A;  2NVL A;  3UBK A;  4KGI A;  2MBT A;  1J9B A;  1XZO A;  1RK4 A;  1XPV A;  3RFR C;  1GP1 A;  1TXU A;  2RM5 A;  4EDZ A;  3P8W A;  5ECK B;  3TRX A;  2HXK A;  4KDX A;  1R4W A;  1KNG A;  2YN1 A;  4POL A;  3LGC A;  3QFA C;  5D73 A;  5ECP B;  1Z3E A;  4N0Z A;  5D96 A;  3BCK A;  2DC5 A;  3A5I A;  2HSM A;  4KW6 A;  2C0D A;  2I9H A;  11GS A;  2X4A A;  2YP6 A;  3F4R A;  4IQ1 A;  4AJ7 A;  3WT1 A;  4MJE A;  1WMJ A;  1M9B A;  5J4V A;  5JCG A;  3F4T A;  4QL9 A;  2FD3 A;  3HCZ A;  1AW9 A;  3WGX A;  1UC7 A;  4BVY A;  2WVX B;  2VL9 A;  5BRT A;  4FH8 A;  1E2Y A;  1WOU A;  2R3X A;  3ERG A;  1GSS A;  1GNW A;  19GS A;  3UAR A;  3P2A A;  3DKS A;  1EZK A;  1O73 A;  3WYW A;  5HR3 A;  3ZRD A;  3J7Y k;  2JSZ A;  2CQ9 A;  1N2A A;  5GST A;  3TKS C;  3GRX A;  5ELA A;  1T7P B;  4JR6 A;  3TKS E;  4PXO A;  4H86 A;  3HYP A;  3ME7 A;  3GMF A;  2RM6 A;  2PVQ A;  2HRA A;  4IJ3 A;  1KEB A;  5A4U A;  1ILO A;  3IBH A;  3F3R A;  4JED A;  3UAP A;  4YKG A;  4GQC A;  1A2M A;  5IOW A;  3ZL5 A;  3IRA A;  1XWB A;  4E8H A;  2ZCT A;  2FWG A;  1FG4 A;  1TJD A;  2VL2 A;  4IN0 A;  5H5Q A;  3LG6 A;  2LNS A;  4PTS A;  3ZRE A;  1FVK A;  2VKZ G;  1V58 A;  1I1I P;  4KAE A;  5HFK A;  1ZMA A;  1F2E A;  5J9B A;  1FHE A;  3DRN A;  4N11 A;  3L78 A;  1SKW B;  1DE1 A;  2M72 A;  1UVZ A;  2B5X A;  1MTC A;  3N9J A;  3RGB C;  1M2D A;  4ZB9 A;  2CV4 A;  5CRG A;  2C8U A;  3M0F A;  3GKX A;  5D9W A;  5E4W A;  1GUK A;  3CSH A;  2HE3 A;  4D73 B;  1C72 A;  5ELG A;  5INY A;  4KUN A;  5D93 A;  1A0F A;  5HFG A;  2WW3 A;  5DAL A;  3KCM A;  2VCX A;  2VCQ A;  2N5A A;  3Q74 A;  5A5H A;  4Q5F A;  4HQZ A;  4K0G A;  4OO4 A;  3MDK A;  3Q18 A;  3CTF A;  2YZU A;  4ZL9 A;  3EMX A;  3D4M A;  4JBB A;  4KCA A;  2VOC A;  3C1R A;  3DEX A;  3IDV A;  1EP7 A;  5HR2 A;  3O6T A;  2C4J A;  2X49 A;  2HZF A;  2CVK A;  3D4T A;  1RQM A;  1YF0 A;  3TCO A;  3H8Q A;  1LU4 A;  4XIH A;  2GDR A;  4GQF A;  5EPF A;  4O32 A;  4BVX B;  3D5J A;  3QD9 A;  1SL2 B;  2OT3 A;  3DWV A;  2FUG 2;  4CW9 A;  4ICY A;  3GN3 A;  4XRA A;  1TOF A;  2LJK A;  3DVX A;  3IOS A;  3UEM A;  1OC9 A;  3L9V A;  3ZVJ A;  2IMK A;  3BCI A;  3E3E A;  3FY7 A;  5CP1 A;  4K9Z A;  3CXG A;  3IHG A;  4NAX A;  1X5E A;  2FA8 A;  3M1G A;  1FOV A;  3HA9 A;  1PFO A;  2JSY A;  4ZL7 A;  4N0V A;  3C1S A;  2L5O A;  4JRR A;  5A1N A;  1F9M A;  3QCP A;  1YEP A;  4WR5 A;  1SL0 B;  3HMJ G;  5D8I A;  5JWO B;  5ECM B;  5JCU A;  1HD2 A;  2HLS A;  4N10 A;  1XVW A;  2YWM A;  1W4V A;  1OE7 A;  6GSX A;  3HDC A;  3L0H A;  1GTB A;  3GYK A;  4V2L A;  3H4K A;  3KD0 A;  5CRE A;  4GRF A;  4LMV A;  2WS2 A;  4PGT A;  3K8N A;  3RHB A;  4DSS B;  3GTU B;  4XCS A;  2XBQ A;  2LQQ A;  1SVL A;  3SBC A;  1M3J A;  2I3Y A;  3KMO A;  14GS A;  1BAY A;  1TP9 A;  3A5W A;  2QGV A;  1V57 A;  1TXX A;  5G2Z A;  3GNJ A;  5IMF A;  3TUE A;  5IMV A;  1SKS B;  2H0H A;  2DSA A;  3GUR A;  3F0I A;  1YVL A;  4PQH A;  2HRF A;  2AB6 A;  3KH7 A;  4TR0 A;  1JZO A;  1OKD A;  2HRK A;  4PHZ C;  3TGZ A;  3CRU A;  8GSS A;  2C3T A;  2WVY A;  5F0G A;  1GUM A;  3VI5 A;  2A4V A;  5AIS A;  1ERV A;  2ALB A;  3NOF A;  1JLW A;  3HHV A;  3VI7 A;  2CAI A;  1XW6 A;  1A8Y A;  4MJB A;  1N25 A;  1Z5Y E;  1FO5 A;  1XOB A;  2O7K A;  4K7N A;  4XHM A;  5DAK B;  1EEJ A;  3ZTL A;  3FZ5 A;  3BD2 A;  5DCH A;  2VL3 A;  2I81 A;  2GT5 A;  2GZY A;  4X4J A;  1GTA A;  1OE8 A;  4ECJ A;  2E0Q A;  3FZA A;  3QOU A;  2E7P A;  2VD0 A;  5FWG A;  2VIM A;  1U3A A;  1R7H A;  1XCC A;  4GSS A;  1K0A A;  5A5K A;  1FVJ A;  3UBL A;  4PX1 A;  4OD7 A;  1GUL A;  2ES7 A;  4IP1 A;  4MPF A;  5IMA A;  5GSS A;  3M9J A;  1T4Z A;  2GQM A;  3U5R E;  2R37 A;  3W8J A;  1S3D A;  3VPQ A;  2YWO A;  2I1U A;  2HT9 A;  4MPG A;  2HZE B;  3RAZ A;  3E9J B;  5KEJ A;  4O92 A;  1Z7P A;  2WB9 A;  1HQO A;  3DIE A;  3I9V 2;  2FGX A;  2H74 A;  4EIP A;  1HNC A;  4KCE A;  4POM A;  1ERU A;  2L4C A;  2H6X A;  3EU4 A;  1TK5 B;  2CT6 A;  5HR1 A;  5A4V A;  1XFL A;  3CBU A;  1J0F A;  1M7T A;  2WW1 A;  2C3N A;  1K0B A;  3DVW A;  1U6T A;  4GDF A;  5F06 A;  3PPU A;  4F0C A;  5IO2 A;  4GTU A;  2DIY A;  2M80 A;  4GWR A;  4AKX B;  2LS5 A;  4WXT A;  3Q6O A;  4Z2T A;  2AYT A;  1JZD A;  1XWG A;  2FA4 A;  2B1L A;  18GS A;  1PKW A;  2C0E A;  4EUY A;  1NHY A;  3G7J A;  4O5U A;  3RDW A;  5ECO B;  2DJK A;  1HYU A;  2NBS A;  1ZGN A;  4YQU A;  4EIQ A;  4YH2 A;  4HUA A;  3CRT A;  2J9H A;  1K0M A;  1SVM A;  3FEU A;  4IVF A;  5AN1 A;  2HSN A;  5LCZ A;  5IMD A;  3ZIT A;  2G2Q A;  2JAD A;  2LRN A;  4G0L A;  1ZOF A;  2F8F A;  1ON4 A;  3IAS 2;  3ERW A;  2N5F A;  1I5G A;  2B7J A;  1K0N A;  3APO A;  4EC0 A;  4YAV A;  1F3A A;  4IHU A;  2WJU A;  3M3M A;  3DXB A;  2VM2 A;  3OR5 A;  4WF4 A;  2IWT A;  6GSW A;  1WRY A;  2B1K A;  4TXV A;  2H01 A;  1OKT A;  3KTL A;  2OA7 A;  2GZP A;  4ZB8 A;  1GUH A;  4A5P A;  2JL4 A;  3ZMK A;  4I6X A;  2B3S A;  5G1K A;  4JE1 A;  3I69 A;  2R0G A;  5ID2 A;  1BG1 A;  5DQS A;  3US3 A;  3LYP A;  3A2W A;  1WIK A;  3HJP A;  3JCM L;  3M9K A;  1Y1U A;  3J7Y b;  4HQS A;  5G31 A;  5G5E A;  4PUA A;  4K8M A;  4DEJ A;  3SWL A;  1AAZ A;  4Z7X A;  4FXY P;  1X9S B;  4PUR A;  3D22 A;  1PA3 A;  4OFT A;  1SJ6 A;  2L6C A;  2YV9 A;  2WGR A;  5BMU A;  1XVQ A;  2V6O A;  1HNA A;  1ACV A;  4E8E A;  2UV8 G;  2DJ2 A;  2R5G A;  5KN0 A;  2IME A;  3UOM A;  1FB0 A;  1S3R A;  3P7X A;  1AXD A;  1MD4 A;  2HFD A;  4MF6 A;  2GQK A;  4MJA A;  2BMX A;  1U88 A;  3ZIJ A;  4K5S A;  2NPB A;  4WBJ A;  2VCV A;  5H5S A;  1TK8 B;  3TJJ A;  1TK0 B;  1T00 A;  4FIW A;  4O5Q A;  3KEB A;  4AF2 A;  3FK8 A;  2AUV A;  4EXJ A;  1EP8 A;  5LNK e;  4AJ8 A;  3R3E A;  4RI7 A;  2H8L A;  4F9Z A;  4AGS A;  1YZX A;  3VWU A;  4KDY A;  2E2M A;  4HU7 A;  1H75 A;  3DML A;  1WE0 A;  1XG8 A;  3HXS A;  2YCD A;  3HVX A;  4LLR A;  2YWI A;  2A4H A;  4L8E A;  4IGJ A;  4Q5N A;  4ULX A;  4ML6 A;  1PMT A;  3HVS A;  2QA1 A;  4BWQ A;  4IKH A;  1XWC A;  5EY6 A;  2MMA A;  3RPP A;  4HJM A;  2QSI A;  2H0G A;  1GWC A;  4IJI A;  1AQX A;  3PGT A;  1GH2 A;  4MH2 A;  3MSZ A;  4KE3 A;  3C71 A;  3KJY A;  2FLS A;  2IMI A;  4BL7 A;  2N5B A;  4G10 A;  3TRP A;  1XIY A;  3WGD A;  9GSS A;  3LWA A;  4K0N A;  1G0T A;  3TDG A;  1PGT A;  2EFE A;  1S3A A;  3A2V A;  5J9C A;  2IMD A;  3EYT A;  2J23 A;  1ZYQ B;  3MWH A;  2IPA A;  5ECQ B;  1T3B A;  4BIK A;  3LSZ A;  2L6D A;  4TXO A;  5KN3 A;  4OFM A;  3RHC A;  4EVM A;  4W66 A;  3UL3 A;  3CWG A;  3CQF A;  2F3M A;  5IPG A;  1K3L A;  2HRN A;  3I6A A;  1OAZ A;  2ON5 A;  3TJF A;  3LEF A;  2FNO A;  3GST A;  3H93 A;  1PN9 A;  1SJZ A;  5B8A A;  1V40 A;  2V6K A;  1H4O A;  2PER A;  1QXH A;  4XTS A;  2YOI A;  3MNG A;  4O5R A;  1YQ1 A;  3KGK A;  3L9U A;  1T4Y A;  2QA2 A;  1DE2 A;  1WP0 A;  4TOP A;  5A34 A;  2PPT A;  4I8B A;  5J3R A;  3VLN A;  2WW0 A;  3PH9 A;  4OO5 A;  4HSC X;  2H71 A;  2GQL A;  2V1M A;  1SK2 A;  3EU3 A;  5CYY A;  1K0D A;  1ABA A;  3QAV A;  2WVZ A;  1SK0 A;  2HSM B;  1I9D A;  4GLT A;  3M8N A;  1U87 A;  2XPD A;  2PWJ A;  1YDK A;  1GSQ A;  3D6I A;  3TKS A;  4DSQ A;  4AKI A;  2VD1 A;  1PRX A;  1Q98 A;  5AGY A;  2B5Y A;  4GXZ A;  4GCI A;  5D9V A;  5KN1 A;  1XBS A;  4NMU A;  1SKR B;  4TR1 A;  4YQV A;  4BVY B;  3HVV A;  5GZZ B;  1MEK A;  2YV7 A;  1ZZY A;  1QK8 A;  2XHF A;  2C3Q A;  2H6Y A;  5HFI A;  1Z6N A;  2AHE A;  1BED A;  5J4Y A;  2FCH A;  1SYX A;  2H1G A;  4G0I A;  4MDC A;  5J40 A;  4J57 E;  2H76 A;  4PNG A;  3G7Y A;  4V1A p;  4XS1 A;  1JHB A;  2H1L A;  3QMX A;  1GSY A;  1U3I A;  5JCW A;  2OBK A;  4G2E A;  1GSD A;  2JZS A;  1OYJ A;  2LEG A;  2OAC A;  2LST A;  2L4Q A;  3FR6 A;  2IFQ A;  1EOG A;  2Z9S A;  4EDY A;  1JFU A;  2H70 A;  4K2X A;  2O85 A;  3CYN A;  3GFK A;  1THX A;  1A2L A;  4G9H A;  3F6D A;  1Y6E A;  1XWA A;  4Q5Q A;  4MA9 A;  4MH3 A;  2H19 A;  3TOT A;  4J56 E;  4IS0 A;  4L0U A;  4KDU A;  5F05 A;  1V9W A;  2WUL A;  1BF5 A;  2GVP A;  2DIZ A;  3GA4 A;  2K9F A;  2ZNM A;  2H0I A;  2R0P A;  4IEL A;  1Z6M A;  4K7I A;  4BPY A;  3ZLP A;  3LW9 A;  5CO3 A;  2H6Z A;  2VM1 A;  2LJR A;  5DAL B;  1DBY A;  13GS A;  4WET A;  2MZC A;  3UVT A;  5A5H B;  3HJO A;  1K0C A;  3KM6 A;  3KP9 A;  1EWX A;  4MCU A;  4OMV A;  5ECN B;  3IPZ A;  1FW1 A;  1TRV A;  2X8H A;  4KX4 A;  2JU5 A;  1TRU A;  5DBQ A;  4ZB7 A;  2KHP A;  3MYD A;  3FRC A;  4KB3 A;  5DJM A;  4IP6 A;  2K18 A;  5IMZ A;  1TTZ A;  1X5C A;  2CVB A;  2L59 A;  1QFN A;  2OKA A;  1A8L A;  1F3B A;  1THO A;  1XXU A;  1F37 A;  3BBY A;  1Q4J A;  4F03 A;  1G7E A;  6GST A;  2EC4 A;  2A2P A;  3CHX C;  5EVO A;  3KXO A;  5DJL A;  6GSS A;  2BJX A;  1QQ2 A;  3GL5 A;  1OVN A;  4HS1 A;  3HJM A;  2DML A;  5F07 A;  2OE0 A;  4PI2 C;  3H1N A;  1FAA A;  2TRX A;  4O7H A;  3S9F A;  3KIJ A;  2L57 A;  2FWE A;  4V2M A;  2O8V B;  4LA1 A;  4ZB6 A;  1FOH A;  1JZR A;  3GKK A;  5KOX A;  2B5E A;  4EO3 A;  1K3O A;  2PN8 A;  1EGR A;  6GSV A;  4POB A;  5AIX A;  1QMV A;  4XS4 A;  4OWY A;  4WBR D;  1M9A A;  3FYG A;  3TB2 A;  4RI6 A;  3DYR A;  2HSY A;  3FKF A;  1A24 A;  1R5P A;  2EIR A;  2P5Q A;  1M99 A;  1NHO A;  1K0O A;  2OE3 A;  1A23 A;  2KOK A;  4KND A;  2WZS A;  1GRX A;  3EPT A;  3F3Q A;  1SK1 A;  2HNL A;  3DGQ A;  2OBI A;  4KF9 A;  1IYH A;  5J5N A;  2AJQ B;  4NV5 A;  2FWH A;  1SD9 A;  2RUF A;  3IAM 2;  4MJC A;  2VCW A;  1YKA A;  3VWX A;  2ON7 A;  1ERT A;  3APS A;  4V1A g;  4MP4 A;  1G6W A;  2VLT A;  5FT3 A;  3IXR A;  5DDL A;  1R5A A;  2KP1 A;  3N5O A;  2MMO A;  5B6M A;  1GSF A;  4K6X A;  5F8B A;  1PL1 A;  4ILF A;  2C0G A;  2WVX A;  3V1W A;  3FW2 A;  4MZW A;  3EUR A;  3GSS A;  4HU9 A;  4OCF A;  5IO0 A;  3IC8 A;  4PUF C;  2HRK B;  3HKR A;  1GLQ A;  1YEW C;  1G7O A;  3RPN A;  2A2S A;  2B6M A;  1SL1 B;  1RW1 A;  2B7K A;  2R2J A;  1GLP A;  2BTO T;  3A3T A;  3WGE A;  1AIU A;  3MIX A;  4ZBB A;  1WWJ A;  1TDI A;  5DQY A;  4AKH A;  4IBP A;  2CVD A;  2M46 A;  2WZ9 A;  1TI1 A;  3LJR A;  2LV3 A;  1E6B A;  1QGV A;  2DMM A;  1EOH A;  2DJ3 A;  1BQ7 A;  3O76 A;  3ME8 A;  2YJ7 A;  3QAW A;  4WKW A;  1PSQ A;  2OE1 A;  1T1V A;  3CMI A;  4ECI A;  4MF7 A;  4RQR A;  4POK A;  3E0U A;  1SD8 A;  2LRC A;  1EEM A;  4QQ7 A;  1B9Y C;  2IL3 A;  2P31 A;  3EE2 A;  1X5D A;  3EIN A;  1BYE A;  2IMF A;  1X9M B;  1JZW A;  4LL1 B;  1BX9 A;  3EC3 A;  3ZIV A;  4D73 A;  1IYI A;  2VAF A;  1GTU A;  5A4W A;  3F6F A;  4HZ4 A;  2VL2 C;  3IHQ A;  1PD2 1;  3FHK A;  4IW9 A;  2LKU A;  4LMW A;  4HDE A;  5GAN D;  3TJG A;  3UIW A;  3GV1 A;  1VF2 A;  4ZIJ A;  17GS A;  1ZCP A;  1F6M C;  2H1A A;  2C1Y A;  2WRT A;  4TRX A;  2I4A A;  1SU9 A;  2EIO A;  4N3Z A;  1PN0 A;  2MMZ A;  3IR4 A;  4YKF A;  3TJK A;  1O81 A;  4MZC A;  2O3E A;  3BJ5 A;  2V2G A;  1XWK A;  3WT2 A;  5EL8 A;  7GSS A;  5CRW A;  2F9S A;  2CZ3 A;  2EIQ A;  5GAP D;  2ZUP A;  4BVX A;  1XW5 A;  2WCI A;  5IM9 A;  4G01 A;  5DVB A;  5CNW A;  2FWF A;  4TR4 A;  4HEA 2;  4K1F A;  3ZZX A;  1TW9 A;  2KP2 A;  4LL4 B;  3VUR A;  3LFL A;  5JWR B;  3HY2 A;  2KUC A;  2CX4 A;  2PGT A;  3ZVJ D;  4NXI A;  4QL7 A;  1VF1 A;  4YQM A;  3NZN A;  3QAG A;  4K5R A;  3G9B A;  3F8U A;  4TW5 A;  5IOX A;  3PIN A;  3KP8 A;  5ECS A;  2GST A;  1O8X A;  2H75 A;  4ID0 A;  2GSS A;  3TJB A;  3F4S A;  2O36 A;  4GSN A;  4MMM A;  4Z2R A;  1USB A;  3EMP A;  3VWV A;  5H5R A;  4MLY A;  2CX3 A;  3ISO A;  5HR0 A;  1GNE A;  4ZIL A;  1UN2 A;  2GSQ A;  1SVO A;  1B4P A;  3GX0 A;  4L5O A;  1N8J A;  2NDO A;  1VGL A;  1M2A A;  1O6J A;  5CAX A;  2MYG A;  5J4U A;  5E59 A;  3G7I A;  2HSN B;  4OFN A;  5ECI B;  4WEY A;  2GZZ A;  4FYC A;  4CDO A;  4OCE A;  4DVC A;  4XS6 A;  1TRS A;  3LOR A;  2DKH A;  2VUP A;  4I5Q A;  3IK7 A;  4YAP A;  4DSS A;  3GTU A;  2NTO A;  3C73 A;  5IQY A;  5KN2 A;  4HOJ A;  3APQ A;  1G6Y A;  4NHW A;  2H1D A;  4MAB A;  5ECR B;  2CA8 A;  2YNX A;  1TU8 A;  3LXZ A;  3ZFL A;  1NW2 A;  5CRD A;  4CY6 A;  3WD6 A;  2IJY A;  2YZH A;  1QUW A;  1MDK A;  1ZYP A;  1DUG A;  5ENU A;  2MMN A;  2LRT A;  1X0R A;  3LYK A;  1MD3 A;  2L5L A;  4BA7 A;  2CAQ A;  2JZR A;  5ID2 B;  2MBS A;  5IMC A;  2GLR A;  1NSW A;  2XC2 A;  2VLV A;  4Z2U A;  2WDU A;  2GGT A;  2QC7 A;  2OAD A;  5KOW A;  2PVO C;  4EE0 A;  1R26 A;  4ECB A;  2DBC A;  3UVH A;  20GS A;  3IK9 A;  3FZ4 A;  3ZML A;  2O5V A;  3LQ7 A;  2YWN A;  5DAK A;  4NPB A;  2QKE A;  4I97 A;  3R2Q A;  5BMU B;  3GHA A;  1CQH A;  1A0R P;  3GH9 A;  4X43 A;  6GSY A;  2X8C A;  1NM3 A;  1M3I A;  1PQN A;  1AQV A;  1V98 A;  3GIX A;  2HI7 A;  3D21 A;  3GUS A;  3QPM A;  5L71 A;  1AC1 A;  2DJ1 A;  4CHS A;  2CZ2 A;  4F0B A;  2H66 A;  3HZ4 A;  3A2X A;  3ERF A;  3IV4 A;  4XRD A;  4E68 A;  2VO4 A;  3C7M A;  4TR3 A;  1CQG A;  2O89 A;  3CSJ A;  3VPT A;  1X9W B;  3QDN A;  1SJI A;  2X8G A;  4JR4 A;  2DJJ A;  2AAW A;  4MK3 A;  3TKR A;  3KTB A;  5G1L A;  1DSB A;  2HSH A;  2YAN A;  2RLI A;  5D9T A;  3F63 A;  3BOA A;  3KMN A;  2V32 A;  2C80 A;  1OC8 A;  2XPE A;  4RUV A;  1SYR A;  1UA5 A;  2X64 A;  2EFD A;  2HZE A;  1PX7 A;  1VF4 A;  2H73 A;  4I2T A;  4WF5 A;  3L4N A;  5G5F A;  2V41 A;  1Z7R A;  5C04 A;  4NV2 A;  4X1U A;  2X99 A;  3RBT A;  4HZ2 A;  2LUS A;  4BL7 B;  4WR4 A;  5FHI A;  12GS A;  1XOA A;  2DKI A;  5IPH A;  4ZBA A;  3EVI A;  3U6V A;  3Q19 A;  3KH9 A;  2REM A;  4MF5 A;  4EL1 A;  4AKG A;  1S4B P;  1TU7 A;  3QFB C;  1ZL9 A;  5ECL B;  4FYB A;  3D0Z A;  5B7C A;  3GKM A;  4AI6 A;  3GL3 A;  2P5R A;  3C8E A;  4L5L A;  3ZYW A;  4TXO B;  2P0G A;  2VCT A;  2DLX A;  4GST A;  2UZ8 A;  4ISD A;  2D2Z A;  5HQP A;  2R4V A;  3IC4 A;  5C00 A;  2PMT A;  2VLU A;  4CY8 A;  4ZL8 A;  2LQO A;  4KA0 A;  1GTI A;  4TVE A;  1W89 A;  3VWW A;  5A34 B;  1AQW A;  2C0F A;  1WJK A;  3IE3 A;  2GS3 A;  1YF1 A;  2KLX A;  5LD0 A;  4KSM A;  1K3Y A;  2AV4 A;  3QR6 A;  2H1B A;  1ERW A;  3HVN A;  1TRW A;  3TKP A;  1B4Q A;  4MZB A;  4AJ6 A;  4GF0 A;  3H79 A;  2LJA A;  5D9X A;  4Q5R A;  1TKD B;  3HD5 A;  2K8V A;  3MAK A;  1M2B A;  1HNB A;  1OC9 B;  4HJ2 A;  4FQU A;  1PL2 A;  1O7U A;  5IIZ A;  4TR1 B;  1URM A;  1PX6 A;  1ST9 A;  3L9S A;  4FYU A;  5J47 A;  2F51 A;  1EV9 A;  3TOU A;  3FZ9 A;  5ECH B;  2JZT A;  2HQT A;  1B8X A;  4EF0 A;  4TKY A;  2RII A;  4KH7 A;  2E2G A;  3ED3 A;  1GL8 A;  5A1N B;  2EFC A;  2XBI A;  5COH A;  1MDI A;  2A2R A;  1Z9H A;  4G0K A;  1GSE A;  22GS A;  5JWQ B;  4QMK A;  1TI3 A;  2GTU A;  3VK9 A;  3GH6 A;  4F82 A;  4PQI A;  1J08 A;  1A2J A;  3HZ8 A;  2IFQ B;  3GX8 A;  10GS A;  3UMA A;  1LJR A;  2G0F A;  1SEN A;  1B48 A;  2PBJ A;  1KBN A;  4HI7 A;  1YEX A;  2WFC A;  1B9X C;  5AIV A;  4X0X A;  1OC3 A;  1AUC A;  1ZYN A;  3PR8 A;  3DD3 A;  2H30 A;  1M0U A;  4F2I A;  3LXT A;  4JU5 A;  1O8W A;  2PUK C;  2TRC P;  5CRH A;  1VRS D;  4MNN A;  5J41 A;  1WPI A;  4NHZ A;  4N30 A;  2GSR A;  2DJ0 A;  1T8E B;  1EGO A;  1GSU A;  4EKZ A;  2K6V A;  1S3C A;  4PI0 C;  2F8A A;  4JZQ A;  4BWS A;  3CTG A;  4ZXG A;  2R0C A;  4ACS A;  2LNT A;  2YPM A;  4USS A;  2RUE A;  2VCZ A;  2YJH A;  1Y25 A;  3I43 A;  2TIR A;  3VFI A;  3GKN A;  1O85 A; 
#chains in the Genus database with same CATH homology
 1BG5 A;  2LTK A;  2OJL A;  3TKQ A;  1YJ6 A;  3P90 A;  4P3Y B;  6GSU A;  4I2U A;  4ECC A;  4ML1 A;  4TN8 A;  1JLV A;  4FO5 A;  5DCG A;  4NWY A;  3UJ1 A;  3ZFB A;  3TRQ A;  3AY8 A;  2GT6 A;  3FR9 A;  3KZQ A;  1MDJ A;  4PQ1 A;  3W6G A;  4J2F A;  16GS A;  2O87 A;  4DSR A;  4KSO A;  2K8S A;  3FR3 A;  2JAC A;  4IQA A;  3F9U A;  1BJX A;  1ZYE A;  1XW9 A;  4PNF A;  1YKC A;  2FHE A;  3O3T A;  2IN3 A;  2HYX A;  3TU3 B;  1V2A A;  1YY7 A;  3CSI A;  3IA1 A;  5G30 A;  1EV4 A;  4K7O A;  5ABR A;  1KTE A;  3FMW A;  4L0W A;  1FB6 A;  5B6N A;  3EWL A;  4RQX A;  4G19 A;  2EFH A;  3NIV A;  3W8S A;  2PU9 C;  2FY6 A;  5B8B A;  4ZBD A;  4XS4 B;  1PKZ A;  4V2N A;  2IIY A;  4K2D A;  1ML6 A;  1LBK A;  2R6K A;  1VF3 A;  2H72 A;  2NVL A;  3UBK A;  4KGI A;  2MBT A;  1J9B A;  1XZO A;  1RK4 A;  1XPV A;  1GP1 A;  1TXU A;  2RM5 A;  4EDZ A;  3P8W A;  5ECK B;  3TRX A;  2HXK A;  4KDX A;  1R4W A;  1KNG A;  2YN1 A;  4POL A;  3LGC A;  3QFA C;  5D73 A;  5ECP B;  1Z3E A;  4N0Z A;  5D96 A;  3BCK A;  2DC5 A;  3A5I A;  2HSM A;  4KW6 A;  2C0D A;  2I9H A;  11GS A;  2X4A A;  2YP6 A;  3F4R A;  4IQ1 A;  4AJ7 A;  3WT1 A;  4MJE A;  1WMJ A;  1M9B A;  5J4V A;  5JCG A;  3F4T A;  4QL9 A;  2FD3 A;  3HCZ A;  1AW9 A;  3WGX A;  1UC7 A;  4BVY A;  2VL9 A;  5BRT A;  4FH8 A;  1E2Y A;  1WOU A;  2R3X A;  3ERG A;  1GSS A;  1GNW A;  19GS A;  3UAR A;  3P2A A;  3DKS A;  1EZK A;  1O73 A;  3WYW A;  5HR3 A;  3ZRD A;  3J7Y k;  2JSZ A;  2CQ9 A;  1N2A A;  5GST A;  3TKS C;  3GRX A;  5ELA A;  1T7P B;  4JR6 A;  3TKS E;  4PXO A;  4H86 A;  3HYP A;  3ME7 A;  3GMF A;  2RM6 A;  2PVQ A;  2HRA A;  4IJ3 A;  1KEB A;  5A4U A;  1ILO A;  3IBH A;  3F3R A;  4JED A;  3UAP A;  4YKG A;  4GQC A;  1A2M A;  5IOW A;  3ZL5 A;  3IRA A;  1XWB A;  4E8H A;  2ZCT A;  2FWG A;  1FG4 A;  1TJD A;  2VL2 A;  4IN0 A;  5H5Q A;  3LG6 A;  2LNS A;  4PTS A;  3ZRE A;  1FVK A;  2VKZ G;  1V58 A;  4KAE A;  5HFK A;  1ZMA A;  1F2E A;  5J9B A;  1FHE A;  3DRN A;  4N11 A;  3L78 A;  1SKW B;  1DE1 A;  2M72 A;  1UVZ A;  2B5X A;  1MTC A;  3N9J A;  1M2D A;  4ZB9 A;  2CV4 A;  5CRG A;  2C8U A;  3M0F A;  3GKX A;  5D9W A;  5E4W A;  1GUK A;  3CSH A;  2HE3 A;  4D73 B;  1C72 A;  5ELG A;  5INY A;  4KUN A;  5D93 A;  1A0F A;  5HFG A;  5DAL A;  3KCM A;  2VCX A;  2VCQ A;  2N5A A;  3Q74 A;  5A5H A;  4Q5F A;  4HQZ A;  4K0G A;  4OO4 A;  3MDK A;  3Q18 A;  3CTF A;  2YZU A;  4ZL9 A;  3EMX A;  3D4M A;  4JBB A;  4KCA A;  2VOC A;  3C1R A;  3DEX A;  3IDV A;  1EP7 A;  5HR2 A;  3O6T A;  2C4J A;  2X49 A;  2HZF A;  2CVK A;  3D4T A;  1RQM A;  1YF0 A;  3TCO A;  3H8Q A;  1LU4 A;  4XIH A;  2GDR A;  4GQF A;  5EPF A;  4O32 A;  4BVX B;  3D5J A;  3QD9 A;  1SL2 B;  2OT3 A;  3DWV A;  2FUG 2;  4CW9 A;  4ICY A;  3GN3 A;  4XRA A;  1TOF A;  2LJK A;  3DVX A;  3IOS A;  3UEM A;  1OC9 A;  3L9V A;  3ZVJ A;  2IMK A;  3BCI A;  3E3E A;  3FY7 A;  5CP1 A;  4K9Z A;  3CXG A;  3IHG A;  4NAX A;  1X5E A;  2FA8 A;  3M1G A;  1FOV A;  3HA9 A;  2JSY A;  4ZL7 A;  4N0V A;  3C1S A;  2L5O A;  4JRR A;  5A1N A;  1F9M A;  3QCP A;  1YEP A;  4WR5 A;  1SL0 B;  3HMJ G;  5D8I A;  5JWO B;  5ECM B;  5JCU A;  1HD2 A;  2HLS A;  4N10 A;  1XVW A;  2YWM A;  1W4V A;  1OE7 A;  6GSX A;  3HDC A;  3L0H A;  1GTB A;  3GYK A;  4V2L A;  3H4K A;  3KD0 A;  5CRE A;  4GRF A;  4LMV A;  2WS2 A;  4PGT A;  3K8N A;  3RHB A;  4DSS B;  3GTU B;  4XCS A;  2XBQ A;  2LQQ A;  1SVL A;  3SBC A;  2I3Y A;  3KMO A;  14GS A;  1BAY A;  1TP9 A;  3A5W A;  2QGV A;  1V57 A;  1TXX A;  5G2Z A;  3GNJ A;  5IMF A;  3TUE A;  5IMV A;  1SKS B;  2H0H A;  2DSA A;  3GUR A;  3F0I A;  1YVL A;  4PQH A;  2HRF A;  2AB6 A;  3KH7 A;  4TR0 A;  1JZO A;  1OKD A;  2HRK A;  8GSS A;  3TGZ A;  3CRU A;  2C3T A;  5F0G A;  1GUM A;  3VI5 A;  2A4V A;  5AIS A;  1ERV A;  2ALB A;  3NOF A;  1JLW A;  3HHV A;  3VI7 A;  2CAI A;  1XW6 A;  1A8Y A;  4MJB A;  1N25 A;  1Z5Y E;  1FO5 A;  1XOB A;  2O7K A;  4K7N A;  4XHM A;  5DAK B;  1EEJ A;  3ZTL A;  3FZ5 A;  3BD2 A;  5DCH A;  2VL3 A;  2I81 A;  2GT5 A;  2GZY A;  4X4J A;  1GTA A;  1OE8 A;  4ECJ A;  2E0Q A;  3FZA A;  3QOU A;  2E7P A;  2VD0 A;  5FWG A;  2VIM A;  1U3A A;  1R7H A;  1XCC A;  4GSS A;  1K0A A;  5A5K A;  1FVJ A;  3UBL A;  4PX1 A;  4OD7 A;  1GUL A;  2ES7 A;  4IP1 A;  4MPF A;  5IMA A;  5GSS A;  3M9J A;  1T4Z A;  2GQM A;  3U5R E;  2R37 A;  3W8J A;  1S3D A;  3VPQ A;  2YWO A;  2I1U A;  2HT9 A;  4MPG A;  2HZE B;  3RAZ A;  3E9J B;  5KEJ A;  4O92 A;  1Z7P A;  2WB9 A;  1HQO A;  3DIE A;  3I9V 2;  2FGX A;  2H74 A;  4EIP A;  1HNC A;  4KCE A;  4POM A;  1ERU A;  2L4C A;  2H6X A;  3EU4 A;  1TK5 B;  2CT6 A;  5HR1 A;  5A4V A;  1XFL A;  3CBU A;  1J0F A;  1M7T A;  2C3N A;  1K0B A;  3DVW A;  1U6T A;  4GDF A;  5F06 A;  3PPU A;  4F0C A;  5IO2 A;  4GTU A;  2DIY A;  2M80 A;  4GWR A;  4AKX B;  2LS5 A;  4WXT A;  3Q6O A;  4Z2T A;  2AYT A;  1JZD A;  1XWG A;  2FA4 A;  2B1L A;  18GS A;  1PKW A;  2C0E A;  4EUY A;  1NHY A;  3G7J A;  4O5U A;  3RDW A;  5ECO B;  2DJK A;  1HYU A;  2NBS A;  1ZGN A;  4YQU A;  4EIQ A;  4YH2 A;  4HUA A;  3CRT A;  2J9H A;  1K0M A;  1SVM A;  3FEU A;  4IVF A;  5AN1 A;  2HSN A;  5LCZ A;  5IMD A;  3ZIT A;  2G2Q A;  2JAD A;  2LRN A;  4G0L A;  1ZOF A;  2F8F A;  1ON4 A;  3IAS 2;  3ERW A;  2N5F A;  1I5G A;  2B7J A;  1K0N A;  3APO A;  4EC0 A;  4YAV A;  1F3A A;  4IHU A;  2WJU A;  3M3M A;  3DXB A;  2VM2 A;  3OR5 A;  4WF4 A;  2IWT A;  6GSW A;  1WRY A;  2B1K A;  4TXV A;  2H01 A;  1OKT A;  3KTL A;  2OA7 A;  2GZP A;  4ZB8 A;  1GUH A;  4A5P A;  2JL4 A;  3ZMK A;  4I6X A;  2B3S A;  5G1K A;  4JE1 A;  3I69 A;  2R0G A;  5ID2 A;  1BG1 A;  5DQS A;  3US3 A;  3LYP A;  3A2W A;  1WIK A;  3HJP A;  3JCM L;  3M9K A;  1Y1U A;  3J7Y b;  4HQS A;  5G31 A;  5G5E A;  4PUA A;  4K8M A;  4DEJ A;  3SWL A;  1AAZ A;  4Z7X A;  1X9S B;  4PUR A;  3D22 A;  1PA3 A;  4OFT A;  1SJ6 A;  2L6C A;  2YV9 A;  2WGR A;  5BMU A;  1XVQ A;  2V6O A;  1HNA A;  1ACV A;  4E8E A;  2UV8 G;  2DJ2 A;  2R5G A;  5KN0 A;  2IME A;  3UOM A;  1FB0 A;  3P7X A;  1AXD A;  1MD4 A;  2HFD A;  4MF6 A;  2GQK A;  4MJA A;  2BMX A;  1U88 A;  3ZIJ A;  4K5S A;  2NPB A;  4WBJ A;  2VCV A;  5H5S A;  1TK8 B;  3TJJ A;  1TK0 B;  1T00 A;  4FIW A;  4O5Q A;  3KEB A;  4AF2 A;  3FK8 A;  2AUV A;  4EXJ A;  1EP8 A;  5LNK e;  4AJ8 A;  3R3E A;  4RI7 A;  2H8L A;  4F9Z A;  4AGS A;  1YZX A;  3VWU A;  4KDY A;  2E2M A;  4HU7 A;  1H75 A;  3DML A;  1WE0 A;  3HXS A;  2YCD A;  3HVX A;  4LLR A;  2YWI A;  2A4H A;  4L8E A;  4IGJ A;  4Q5N A;  4ULX A;  4ML6 A;  1PMT A;  3HVS A;  2QA1 A;  4BWQ A;  4IKH A;  1XWC A;  5EY6 A;  2MMA A;  3RPP A;  4HJM A;  2QSI A;  2H0G A;  1GWC A;  4IJI A;  1AQX A;  3PGT A;  1GH2 A;  4MH2 A;  3MSZ A;  4KE3 A;  3C71 A;  3KJY A;  2FLS A;  2IMI A;  4BL7 A;  2N5B A;  4G10 A;  3TRP A;  1XIY A;  3WGD A;  9GSS A;  3LWA A;  4K0N A;  1G0T A;  3TDG A;  1PGT A;  2EFE A;  1S3A A;  3A2V A;  5J9C A;  2IMD A;  3EYT A;  2J23 A;  1ZYQ B;  3MWH A;  2IPA A;  5ECQ B;  1T3B A;  3LSZ A;  2L6D A;  4TXO A;  5KN3 A;  4OFM A;  3RHC A;  4EVM A;  4W66 A;  3UL3 A;  3CWG A;  2F3M A;  5IPG A;  1K3L A;  2HRN A;  3I6A A;  1OAZ A;  2ON5 A;  3TJF A;  3LEF A;  2FNO A;  3GST A;  3H93 A;  1PN9 A;  1SJZ A;  5B8A A;  1V40 A;  2V6K A;  1H4O A;  2PER A;  1QXH A;  4XTS A;  2YOI A;  3MNG A;  4O5R A;  1YQ1 A;  3KGK A;  3L9U A;  1T4Y A;  2QA2 A;  1DE2 A;  1WP0 A;  4TOP A;  5A34 A;  2PPT A;  4I8B A;  5J3R A;  3VLN A;  3PH9 A;  4OO5 A;  2H71 A;  2GQL A;  2V1M A;  1SK2 A;  3EU3 A;  5CYY A;  1K0D A;  1ABA A;  3QAV A;  1SK0 A;  2HSM B;  1I9D A;  4GLT A;  3M8N A;  1U87 A;  2XPD A;  2PWJ A;  1YDK A;  1GSQ A;  3D6I A;  3TKS A;  4DSQ A;  4AKI A;  2VD1 A;  1PRX A;  1Q98 A;  5AGY A;  2B5Y A;  4GXZ A;  4GCI A;  5D9V A;  5KN1 A;  1XBS A;  4NMU A;  1SKR B;  4TR1 A;  4YQV A;  4BVY B;  3HVV A;  5GZZ B;  1MEK A;  2YV7 A;  1ZZY A;  1QK8 A;  2XHF A;  2C3Q A;  2H6Y A;  5HFI A;  1Z6N A;  2AHE A;  1BED A;  5J4Y A;  2FCH A;  1SYX A;  2H1G A;  4G0I A;  4MDC A;  5J40 A;  4J57 E;  2H76 A;  4PNG A;  3G7Y A;  4V1A p;  4XS1 A;  1JHB A;  2H1L A;  3QMX A;  1GSY A;  1U3I A;  5JCW A;  2OBK A;  4G2E A;  1GSD A;  2JZS A;  1OYJ A;  2LEG A;  2OAC A;  2LST A;  2L4Q A;  3FR6 A;  2IFQ A;  1EOG A;  2Z9S A;  4EDY A;  1JFU A;  2H70 A;  4K2X A;  2O85 A;  3CYN A;  3GFK A;  1THX A;  1A2L A;  4G9H A;  3F6D A;  1Y6E A;  1XWA A;  4Q5Q A;  4MA9 A;  4MH3 A;  2H19 A;  3TOT A;  4J56 E;  4IS0 A;  4L0U A;  4KDU A;  5F05 A;  1V9W A;  2WUL A;  1BF5 A;  2GVP A;  2DIZ A;  3GA4 A;  2K9F A;  2ZNM A;  2H0I A;  2R0P A;  4IEL A;  1Z6M A;  4K7I A;  4BPY A;  3ZLP A;  3LW9 A;  5CO3 A;  2H6Z A;  2VM1 A;  2LJR A;  5DAL B;  1DBY A;  13GS A;  4WET A;  2MZC A;  3UVT A;  5A5H B;  3HJO A;  1K0C A;  3KM6 A;  3KP9 A;  1EWX A;  4MCU A;  4OMV A;  5ECN B;  3IPZ A;  1FW1 A;  1TRV A;  2X8H A;  4KX4 A;  2JU5 A;  1TRU A;  5DBQ A;  4ZB7 A;  2KHP A;  3MYD A;  3FRC A;  4KB3 A;  5DJM A;  4IP6 A;  2K18 A;  5IMZ A;  1TTZ A;  1X5C A;  2CVB A;  2L59 A;  1QFN A;  2OKA A;  1A8L A;  1F3B A;  1THO A;  1XXU A;  1F37 A;  3BBY A;  1Q4J A;  4F03 A;  1G7E A;  6GST A;  2EC4 A;  2A2P A;  5EVO A;  3KXO A;  5DJL A;  6GSS A;  2BJX A;  1QQ2 A;  3GL5 A;  1OVN A;  4HS1 A;  3HJM A;  2DML A;  5F07 A;  2OE0 A;  3H1N A;  1FAA A;  2TRX A;  4O7H A;  3S9F A;  3KIJ A;  2L57 A;  2FWE A;  4V2M A;  2O8V B;  4LA1 A;  4ZB6 A;  1FOH A;  1JZR A;  3GKK A;  5KOX A;  2B5E A;  4EO3 A;  1K3O A;  2PN8 A;  1EGR A;  6GSV A;  4POB A;  5AIX A;  1QMV A;  4XS4 A;  4OWY A;  4WBR D;  1M9A A;  3FYG A;  3TB2 A;  4RI6 A;  3DYR A;  2HSY A;  3FKF A;  1A24 A;  1R5P A;  2EIR A;  2P5Q A;  1M99 A;  1NHO A;  1K0O A;  2OE3 A;  1A23 A;  2KOK A;  4KND A;  1GRX A;  3EPT A;  3F3Q A;  1SK1 A;  2HNL A;  3DGQ A;  2OBI A;  4KF9 A;  1IYH A;  5J5N A;  2AJQ B;  4NV5 A;  2FWH A;  1SD9 A;  2RUF A;  3IAM 2;  4MJC A;  2VCW A;  1YKA A;  3VWX A;  2ON7 A;  1ERT A;  3APS A;  4V1A g;  4MP4 A;  1G6W A;  2VLT A;  5FT3 A;  3IXR A;  5DDL A;  1R5A A;  2KP1 A;  3N5O A;  2MMO A;  5B6M A;  1GSF A;  4K6X A;  5F8B A;  1PL1 A;  4ILF A;  2C0G A;  3V1W A;  3FW2 A;  4MZW A;  3EUR A;  3GSS A;  4HU9 A;  4OCF A;  5IO0 A;  3IC8 A;  4PUF C;  2HRK B;  3HKR A;  1GLQ A;  1G7O A;  3RPN A;  2A2S A;  2B6M A;  1SL1 B;  1RW1 A;  2B7K A;  2R2J A;  1GLP A;  2BTO T;  3A3T A;  3WGE A;  1AIU A;  3MIX A;  4ZBB A;  1WWJ A;  1TDI A;  5DQY A;  4AKH A;  4IBP A;  2CVD A;  2M46 A;  2WZ9 A;  1TI1 A;  3LJR A;  2LV3 A;  1E6B A;  1QGV A;  2DMM A;  1EOH A;  2DJ3 A;  1BQ7 A;  3O76 A;  3ME8 A;  2YJ7 A;  3QAW A;  4WKW A;  1PSQ A;  2OE1 A;  1T1V A;  3CMI A;  4ECI A;  4MF7 A;  4RQR A;  4POK A;  3E0U A;  1SD8 A;  2LRC A;  1EEM A;  4QQ7 A;  1B9Y C;  2IL3 A;  2P31 A;  3EE2 A;  1X5D A;  3EIN A;  1BYE A;  2IMF A;  1X9M B;  1JZW A;  4LL1 B;  1BX9 A;  3EC3 A;  3ZIV A;  4D73 A;  1IYI A;  2VAF A;  1GTU A;  5A4W A;  3F6F A;  4HZ4 A;  2VL2 C;  3IHQ A;  1PD2 1;  3FHK A;  4IW9 A;  2LKU A;  4LMW A;  4HDE A;  5GAN D;  3TJG A;  3UIW A;  3GV1 A;  1VF2 A;  4ZIJ A;  17GS A;  1ZCP A;  1F6M C;  2H1A A;  2C1Y A;  2WRT A;  4TRX A;  2I4A A;  1SU9 A;  2EIO A;  4N3Z A;  1PN0 A;  2MMZ A;  3IR4 A;  4YKF A;  3TJK A;  1O81 A;  4MZC A;  3BJ5 A;  2V2G A;  1XWK A;  3WT2 A;  5EL8 A;  7GSS A;  5CRW A;  2F9S A;  2CZ3 A;  2EIQ A;  5GAP D;  2ZUP A;  4BVX A;  1XW5 A;  2WCI A;  5IM9 A;  4G01 A;  5DVB A;  5CNW A;  2FWF A;  4TR4 A;  4HEA 2;  4K1F A;  3ZZX A;  1TW9 A;  2KP2 A;  4LL4 B;  3VUR A;  3LFL A;  5JWR B;  3HY2 A;  2KUC A;  2CX4 A;  2PGT A;  3ZVJ D;  4NXI A;  4QL7 A;  1VF1 A;  4YQM A;  3NZN A;  3QAG A;  4K5R A;  3G9B A;  3F8U A;  4TW5 A;  5IOX A;  3PIN A;  3KP8 A;  5ECS A;  2GST A;  1O8X A;  2H75 A;  4ID0 A;  2GSS A;  3TJB A;  3F4S A;  4GSN A;  4MMM A;  4Z2R A;  1USB A;  3EMP A;  3VWV A;  5H5R A;  4MLY A;  2CX3 A;  3ISO A;  5HR0 A;  1GNE A;  4ZIL A;  1UN2 A;  2GSQ A;  1SVO A;  1B4P A;  3GX0 A;  4L5O A;  1N8J A;  2NDO A;  1VGL A;  1M2A A;  1O6J A;  5CAX A;  2MYG A;  5J4U A;  5E59 A;  3G7I A;  2HSN B;  4OFN A;  5ECI B;  4WEY A;  2GZZ A;  4FYC A;  4CDO A;  4OCE A;  4DVC A;  4XS6 A;  1TRS A;  3LOR A;  2DKH A;  2VUP A;  4I5Q A;  3IK7 A;  4YAP A;  4DSS A;  3GTU A;  2NTO A;  3C73 A;  5IQY A;  5KN2 A;  4HOJ A;  3APQ A;  1G6Y A;  4NHW A;  2H1D A;  4MAB A;  5ECR B;  2CA8 A;  2YNX A;  1TU8 A;  3LXZ A;  3ZFL A;  1NW2 A;  5CRD A;  4CY6 A;  3WD6 A;  2IJY A;  2YZH A;  1QUW A;  1MDK A;  1ZYP A;  1DUG A;  5ENU A;  2MMN A;  2LRT A;  1X0R A;  3LYK A;  1MD3 A;  2L5L A;  4BA7 A;  2CAQ A;  2JZR A;  5ID2 B;  2MBS A;  5IMC A;  2GLR A;  1NSW A;  2XC2 A;  2VLV A;  4Z2U A;  2WDU A;  2GGT A;  2QC7 A;  2OAD A;  5KOW A;  2PVO C;  4EE0 A;  1R26 A;  4ECB A;  2DBC A;  3UVH A;  20GS A;  3IK9 A;  3FZ4 A;  3ZML A;  2O5V A;  3LQ7 A;  2YWN A;  5DAK A;  4NPB A;  2QKE A;  4I97 A;  3R2Q A;  5BMU B;  3GHA A;  1CQH A;  1A0R P;  3GH9 A;  4X43 A;  6GSY A;  2X8C A;  1NM3 A;  1PQN A;  1AQV A;  1V98 A;  3GIX A;  2HI7 A;  3D21 A;  3GUS A;  3QPM A;  5L71 A;  1AC1 A;  2DJ1 A;  4CHS A;  2CZ2 A;  4F0B A;  2H66 A;  3HZ4 A;  3A2X A;  3ERF A;  3IV4 A;  4XRD A;  4E68 A;  2VO4 A;  3C7M A;  4TR3 A;  1CQG A;  2O89 A;  3CSJ A;  3VPT A;  1X9W B;  3QDN A;  1SJI A;  2X8G A;  4JR4 A;  2DJJ A;  2AAW A;  4MK3 A;  3TKR A;  3KTB A;  5G1L A;  1DSB A;  2HSH A;  2YAN A;  2RLI A;  5D9T A;  3F63 A;  3BOA A;  3KMN A;  2V32 A;  2C80 A;  1OC8 A;  2XPE A;  4RUV A;  1SYR A;  1UA5 A;  2X64 A;  2EFD A;  2HZE A;  1PX7 A;  1VF4 A;  2H73 A;  4I2T A;  4WF5 A;  3L4N A;  5G5F A;  2V41 A;  1Z7R A;  5C04 A;  4NV2 A;  4X1U A;  2X99 A;  3RBT A;  4HZ2 A;  2LUS A;  4BL7 B;  4WR4 A;  5FHI A;  12GS A;  1XOA A;  2DKI A;  5IPH A;  4ZBA A;  3EVI A;  3U6V A;  3Q19 A;  3KH9 A;  2REM A;  4MF5 A;  4EL1 A;  4AKG A;  1TU7 A;  3QFB C;  1ZL9 A;  5ECL B;  4FYB A;  3D0Z A;  5B7C A;  3GKM A;  4AI6 A;  3GL3 A;  2P5R A;  3C8E A;  4L5L A;  3ZYW A;  4TXO B;  2P0G A;  2VCT A;  2DLX A;  4GST A;  2UZ8 A;  4ISD A;  2D2Z A;  5HQP A;  2R4V A;  3IC4 A;  5C00 A;  2PMT A;  2VLU A;  4CY8 A;  4ZL8 A;  2LQO A;  4KA0 A;  1GTI A;  4TVE A;  1W89 A;  3VWW A;  5A34 B;  1AQW A;  2C0F A;  1WJK A;  3IE3 A;  2GS3 A;  1YF1 A;  2KLX A;  5LD0 A;  4KSM A;  1K3Y A;  2AV4 A;  3QR6 A;  2H1B A;  1ERW A;  3TKP A;  1TRW A;  1B4Q A;  4MZB A;  4AJ6 A;  4GF0 A;  3H79 A;  2LJA A;  5D9X A;  4Q5R A;  1TKD B;  3HD5 A;  2K8V A;  3MAK A;  1M2B A;  1HNB A;  1OC9 B;  4HJ2 A;  4FQU A;  1PL2 A;  1O7U A;  5IIZ A;  4TR1 B;  1URM A;  1PX6 A;  1ST9 A;  3L9S A;  4FYU A;  5J47 A;  2F51 A;  1EV9 A;  3TOU A;  3FZ9 A;  5ECH B;  2JZT A;  2HQT A;  1B8X A;  4EF0 A;  4TKY A;  2RII A;  4KH7 A;  2E2G A;  3ED3 A;  1GL8 A;  5A1N B;  2EFC A;  2XBI A;  5COH A;  1MDI A;  2A2R A;  1Z9H A;  4G0K A;  1GSE A;  22GS A;  5JWQ B;  4QMK A;  1TI3 A;  2GTU A;  3VK9 A;  3GH6 A;  4F82 A;  4PQI A;  1J08 A;  1A2J A;  3HZ8 A;  2IFQ B;  3GX8 A;  10GS A;  3UMA A;  1LJR A;  2G0F A;  1SEN A;  1B48 A;  2PBJ A;  1KBN A;  4HI7 A;  1YEX A;  2WFC A;  1B9X C;  5AIV A;  4X0X A;  1OC3 A;  1AUC A;  1ZYN A;  3PR8 A;  3DD3 A;  2H30 A;  1M0U A;  4F2I A;  3LXT A;  4JU5 A;  1O8W A;  2PUK C;  2TRC P;  5CRH A;  1VRS D;  4MNN A;  5J41 A;  1WPI A;  4NHZ A;  4N30 A;  2GSR A;  2DJ0 A;  1T8E B;  1EGO A;  1GSU A;  4EKZ A;  2K6V A;  1S3C A;  2F8A A;  4JZQ A;  4BWS A;  3CTG A;  4ZXG A;  2R0C A;  4ACS A;  2LNT A;  2YPM A;  4USS A;  2RUE A;  2VCZ A;  2YJH A;  1Y25 A;  3I43 A;  2TIR A;  3VFI A;  3GKN A;  1O85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...