3I6AA

Human gst a1-1 gimf mutant with glutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
219
structure length
219
Chain Sequence
AEKPKLHYFNGRGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMIIMLPFCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPPDEIYVRTVYNIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase A1
publication title Structural analysis of a glutathione transferase A1-1 mutant tailored for high catalytic efficiency with toxic alkenals.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3i6aA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3i6aA01
1BAYA 4QQ7A 5J4UA 2Z9SA 3GTUB 1M7TA 2F51A 5B6MA 1PL1A 3I9V2 2YPMA 2CX4A 3MWHA 5HR2A 2B6MA 1SKWB 3G7IA 4O5RA 4H86A 3VLNA 4HJ2A 2VD0A 3LFLA 1GLQA 1MDKA 1TK5B 2GQMA 2ALBA 2LJRA 3TKSE 3KJYA 3RPPA 3K8NA 4IJ3A 1GRXA 2DJKA 1W89A 2B5YA 1M0UA 3D5JA 1VRSD 1K0MA 3LWAA 2TIRA 5GSTA 2P0GA 1XZOA 2H72A 1YF0A 4XS4B 5D8IA 1PSQA 5BMUA 2OJLA 1K3LA 1F3BA 4K7NA 1A2MA 5ECRB 2JZTA 5JCWA 1F3AA 3FEUA 1MTCA 2I1UA 5D96A 1JFUA 3H93A 4KDXA 2GZPA 1ML6A 16GSA 1A2JA 3Q19A 1SK0A 6GSYA 5AISA 4V2LA 2PMTA 2R5GA 1WE0A 3A5WA 1SJZA 2M46A 1XW6A 1GSYA 1FB0A 4HI7A 2HSHA 2YZHA 2CX3A 2D2ZA 2HSMA 1FHEA 4PX1A 1DBYA 3HJOA 2MMZA 5IO2A 4DSQA 1QK8A 5EY6A 3GN3A 1O8XA 3OR5A 5F07A 1KTEA 1ERVA 1GTUA 4RUVA 4MH2A 3GIXA 2I4AA 4K6XA 4L0WA 2H70A 2H1AA 2PWJA 2F8AA 5CP1A 4OD7A 1EV9A 4GLTA 3GKMA 2J23A 3VWVA 4MZBA 2DJ1A 1PL2A 4KF9A 1Z6NA 3DRNA 2H6XA 1OE7A 4MPGA 3KTBA 2L6DA 4KCAA 1N2AA 1GSSA 1BQ7A 4BVXB 1V9WA 4OFTA 2IMDA 2AUVA 4O32A 2IL3A 4GWRA 5JWOB 1BG5A 4ZBAA 3UJ1A 2YWOA 2HZEB 4AJ6A 3KXOA 5CREA 2DBCA 1EGOA 5DCGA 5DBQA 2F9SA 3U6VA 1M2AA 3QAWA 2YV7A 3RBTA 1WRYA 1URMA 2OBKA 2V6OA 2ES7A 4TR3A 4L0UA 5AN1A 1MDJA 3O6TA 4V1Ag 1EWXA 1ILOA 3GKKA 3Q74A 3BCKA 3PR8A 3HZ4A 4MZCA 2DLXA 1F9MA 5E4WA 2H71A 4BL7A 3M8NA 4KH7A 1UVZA 1PRXA 2GQLA 1ZOFA 5ELAA 4PXOA 4LL4B 4FYUA 1I9DA 3KCMA 3O76A 2HXKA 5HR3A 5HFGA 1EEMA 2P5QA 2H8LA 2OE1A 1OKTA 1ZZYA 4FYBA 1FB6A 6GSTA 1PA3A 4GCIA 1XOAA 5DDLA 4TR4A 2G2QA 3SWLA 3UEMA 1PX6A 1M99A 1YJ6A 4XRAA 2PN8A 5IOWA 3GV1A 4BWQA 3BBYA 3C1SA 1OC3A 4J57E 2YWIA 4X0XA 4TR0A 4MZWA 2LQOA 2FWGA 1AQXA 3QR6A 2F8FA 2B5XA 2QSIA 5CNWA 3TRPA 3IAM2 5CRHA 1GSDA 4PQHA 3HXSA 2VCXA 1XWKA 4KSMA 4EC0A 3HVSA 2HLSA 3WT1A 1EOGA 3HJPA 3ZIJA 1THXA 2FWEA 2HZFA 2TRCP 4KUNA 1A23A 4PTSA 1QUWA 2KHPA 5D93A 3TJKA 3GSSA 4DVCA 1A0RP 1XIYA 5G5FA 1RQMA 1JLWA 2EIOA 2J9HA 2VL3A 4F9ZA 2RM6A 5ECHB 3APQA 3DYRA 5IO0A 4OCFA 3CYNA 3GTUA 2NPBA 5HR1A 3LORA 3E0UA 4JZQA 5H5RA 4Q5RA 3C1RA 4ML1A 5FT3A 3PGTA 3WGEA 4MJBA 1K0OA 3P2AA 3APOA 2HYXA 2WCIA 1PKZA 3H1NA 5G1LA 4EO3A 3LG6A 3G7YA 3F8UA 1YQ1A 1YY7A 1MD4A 1K0CA 1J9BA 2FY6A 2LUSA 1Z5YE 3LJRA 2O89A 2VLTA 3IC4A 2C4JA 5JWQB 1MD3A 4F0CA 3N9JA 1GL8A 1Z7PA 4TVEA 2X8GA 1O85A 2YJHA 1GTIA 5JWRB 3G7JA 1HD2A 3EE2A 1OE8A 2NVLA 2LS5A 2VCVA 4E8EA 2M80A 2H1DA 1Q98A 1H4OA 4EVMA 1FVKA 3TKPA 1VGLA 4F82A 1HNBA 5EPFA 2RUFA 3CBUA 1GUMA 1TDIA 3GUSA 4OO4A 3IXRA 2RM5A 1C72A 4HU9A 4V1Ap 2AB6A 3M0FA 2MBSA 5ABRA 4ISDA 4XHMA 3FY7A 4BA7A 4G2EA 3MAKA 2FGXA 3TRXA 3M3MA 4NV5A 2OE3A 2L4QA 3FZ4A 2VL9A 3A2VA 3KZQA 1WWJA 5HQPA 2F3MA 1JHBA 1XCCA 2LQQA 4HZ4A 3CTFA 1OAZA 4G19A 4HQSA 4RQXA 11GSA 4Q5FA 5ECOB 4I5QA 5JCUA 3VWUA 1GTBA 4F03A 1BYEA 2WDUA 1SK2A 2CT6A 1YZXA 1B9XC 1U3AA 2I3YA 2FWHA 3RDWA 5J3RA 1O81A 3LEFA 5DJMA 2MMAA 2RIIA 2OA7A 4QL7A 1GWCA 2AHEA 4K9ZA 5ECIB 1U88A 1ST9A 3TRQA 2JSZA 4BVXA 3US3A 2JU5A 2DIYA 4ECJA 1M2BA 4F2IA 3ZREA 3L4NA 4FYCA 3IR4A 3GL5A 2AV4A 3TJJA 5J41A 2HZEA 3E9JB 1TXXA 1SL0B 2GSSA 2YANA 3QOUA 1GSFA 2V41A 4WR4A 2LNSA 1T3BA 3EVIA 2DSAA 1H75A 1XWBA 3GFKA 2GTUA 2HSNB 2LV3A 3CMIA 5G2ZA 1V40A 2GSTA 4EXJA 2C0DA 1TP9A 1WPIA 3WYWA 4WETA 2R37A 4ZIJA 3GH9A 1SYXA 3EU3A 2KP1A 2K8SA 4JU5A 2YJ7A 5INYA 2DJ0A 5G30A 5CRDA 3M9KA 1R5PA 2R3XA 2O85A 3ZMLA 5CRGA 1ABAA 4WF4A 3S9FA 2H76A 4IP1A 2QGVA 1V57A 2JZSA 1OKDA 5DVBA 5IMAA 2C80A 1JZRA 2YNXA 1K0DA 1TRWA 3MDKA 4N11A 4G0IA 1XW9A 3CSJA 2X8CA 3IRAA 4BVYB 5B8BA 2PVOC 3P7XA 4MJAA 2X99A 3W8SA 2PU9C 2VCZA 3KMOA 1G0TA 3QCPA 2HFDA 5CO3A 1AXDA 5IPGA 3ZYWA 1G6YA 3VPQA 1PQNA 2LRTA 1BX9A 17GSA 3IPZA 2L4CA 1EEJA 1GSQA 3FR3A 3DEXA 1GNEA 5G1KA 4K7OA 2VCTA 4PGTA 2DJ3A 2C0GA 2DMLA 1DE1A 2L5OA 3ZFLA 2JL4A 2VD1A 4XCSA 1B8XA 3PH9A 1FO5A 5IOXA 4PNGA 4EKZA 3I69A 2O8VB 5HFKA 3KD0A 4K8MA 4ZB6A 1Z9HA 2K8VA 4GF0A 3HZ8A 4HOJA 1X9MB 4L8EA 1AAZA 4OCEA 6GSVA 3IC8A 3F6FA 1WJKA 1WOUA 2ON7A 4PQ1A 4RI7A 2HRNA 4JEDA 3F0IA 2UZ8A 4N30A 2NBSA 4XIHA 1T1VA 3WD6A 3EMXA 5ID2A 4KA0A 5A5KA 1DUGA 1U3IA 3GA4A 3UOMA 2GZZA 3EMPA 1IYHA 3HY2A 1K3YA 2CA8A 4XRDA 4EDYA 2CVKA 3FR9A 3CSHA 1S3CA 4ZB9A 1RW1A 4IVFA 1M2DA 2VM2A 4HS1A 2WZ9A 3ERFA 3KH9A 4O7HA 4CDOA 5DAKA 1Z7RA 2LTKA 6GSSA 3KM6A 1JZOA 2GQKA 3F4SA 2HI7A 5IMZA 5DQSA 1GSUA 1XXUA 2FCHA 4L5OA 4ML6A 1KNGA 3L0HA 4TOPA 4HJMA 5EVOA 2TRXA 1PN9A 5A4WA 1WP0A 3C73A 4EF0A 2HT9A 1DE2A 3C7MA 1B4PA 1AIUA 2H1GA 4MPFA 5ECMB 3VWWA 2YCDA 3KEBA 1SJ6A 2GT5A 3Q18A 3PPUA 2H66A 1UA5A 2B1KA 2VIMA 2YWMA 3D0ZA 1AW9A 5CRWA 4QL9A 2H30A 4JRRA 1G7OA 3W6GA 1GTAA 3HJMA 2KP2A 4WBJA 2VCQA 19GSA 1TRSA 4WF5A 1A8YA 1B9YC 3R3EA 1ERTA 4Q5NA 1YEXA 1ZMAA 2AJQB 3HKRA 3BCIA 4G0LA 2O7KA 1S3AA 2LEGA 2CZ2A 3HD5A 1E6BA 2PBJA 1GP1A 3CSIA 1DSBA 1SJIA 2VM1A 3GHAA 2JZRA 3FR6A 4KSOA 2VUPA 5J9BA 2FNOA 1G6WA 4IP6A 3FZ5A 1A24A 2VCWA 4AGSA 1XBSA 1T7PB 3FW2A 3DD3A 2B3SA 1TJDA 5KN3A 4P3YB 4TKYA 2L6CA 3UIWA 1TK8B 3QAVA 5ECPB 4I8BA 1QXHA 4OMVA 4ZILA 2FA8A 4MF7A 4K7IA 3HVXA 1THOA 3VI5A 1ERWA 4O92A 5ELGA 4JR6A 2XPEA 1V2AA 1XOBA 5KEJA 3BJ5A 2YV9A 3BOAA 4PNFA 3KP8A 1EOHA 3KP9A 4V2NA 2A4VA 3I43A 4XTSA 4KW6A 1R4WA 2C3NA 2CV4A 1TK0B 2M72A 3IHQA 3DVXA 5GSSA 4EE0A 12GSA 4OFMA 2X8HA 3VFIA 1IYIA 3L9SA 4GTUA 2B7KA 3JCML 1LU4A 1HNAA 5ID2B 3GH6A 3GX0A 2ZNMA 3LGCA 1M9BA 3ZTLA 3IK7A 2MBTA 1RK4A 4IQAA 4TXOB 1AC1A 1XVWA 3LQ7A 2XHFA 3UBKA 3F3QA 3DKSA 1AQWA 2LNTA 4BVYA 2GZYA 4YQVA 4HDEA 3SBCA 4NHZA 2B5EA 2V32A 4IHUA 4MK3A 2IMIA 4IS0A 4ID0A 4E8HA 2P5RA 3D4MA 4IELA 5DAKB 3NZNA 2H1BA 5CAXA 2GSQA 2PERA 2N5BA 5D9VA 3CXGA 2HSYA 3TCOA 3QDNA 4MCUA 2NTOA 2CVBA 1WIKA 2KOKA 4V2MA 4MDCA 1EP7A 1F6MC 4I2TA 4YQMA 5IMDA 4WEYA 4NWYA 2LRNA 1TTZA 2VOCA 2CVDA 2YWNA 4HQZA 1F37A 5KN2A 3LXTA 2HRAA 4IKHA 4GSSA 3BD2A 3ERWA 5G5EA 3ZRDA 4WXTA 2A2RA 4NXIA 2X64A 3F63A 3DMLA 4LLRA 5D9TA 3ZFBA 4L5LA 3U5RE 2GT6A 3FHKA 10GSA 4GSNA 5LD0A 2REMA 2C3QA 4YAVA 2H73A 1FG4A 1ACVA 4IJIA 3AY8A 4K0GA 4KX4A 1XW5A 2AAWA 2MMOA 2H0HA 2V1MA 1O73A 2BMXA 4KNDA 4I97A 1TU7A 1SKRB 1CQHA 5H5SA 2G0FA 2PVQA 2IIYA 1A8LA 4MLYA 1YF1A 2FUG2 1A2LA 1T00A 1B48A 4TR1B 1ZL9A 3CRUA 4N0ZA 3QMXA 2GSRA 1VF1A 3ZIVA 3ZZXA 3EU4A 7GSSA 2LSTA 2IPAA 3D21A 1SU9A 2KUCA 2QC7A 2H19A 1O6JA 1K0AA 4IQ1A 3GL3A 2HRKA 1ON4A 3ISOA 3W8JA 4WKWA 2E2MA 5GAPD 2IMFA 1YDKA 2VAFA 3CRTA 2GDRA 1T4YA 4J56E 2DIZA 4DSRA 1FW1A 3GKXA 4NHWA 3LYPA 1N8JA 1AQVA 3DIEA 1WMJA 4HUAA 2VLUA 2DMMA 4BPYA 2P31A 4XS6A 4ZB8A 1ERUA 1J0FA 4F0BA 2PUKC 4KAEA 4ZBBA 4GRFA 5F06A 2PPTA 1OC9A 4HZ2A 3IOSA 1NW2A 4IGJA 2FLSA 3GNJA 3UAPA 4NAXA 1W4VA 1USBA 4BWSA 3FRCA 4FH8A 3C71A 4FQUA 1OC8A 2V2GA 1XVQA 2FHEA 1SD8A 3ED3A 2L59A 4RI6A 2C1YA 5LNKe 3GSTA 1YEPA 5B8AA 1VF4A 3P90A 6GSWA 1F2EA 3QFAC 4TN8A 4MMMA 5G31A 3FK8A 1R7HA 1Z6MA 2GS3A 1VF2A 1K0BA 4TXVA 2L5LA 4X1UA 1QGVA 5D9XA 3DWVA 4K0NA 3UVHA 1XWGA 2E0QA 2K6VA 1NHYA 2OE0A 3TJGA 4ZXGA 5COHA 2KLXA 3D4TA 3EINA 4MF6A 4AF2A 2EC4A 4ZBDA 1JLVA 1SD9A 2VO4A 1HQOA 5KN0A 1R26A 1S3DA 3QPMA 4N0VA 3A2WA 3MSZA 1J08A 1TU8A 3C8EA 1X9WB 2A2SA 3H4KA 4ZL7A 5KN1A 5D9WA 1Z3EA 3GKNA 5ECQB 3F6DA 4JR4A 3ZVJD 3KMNA 3KTLA 5IQYA 2IWTA 3D6IA 4J2FA 1HNCA 4NV2A 3D22A 2C0FA 1YKAA 3H8QA 1Q4JA 5GAND 3IA1A 1G7EA 1SKSB 2OKAA 5B7CA 2WULA 5IIZA 2QKEA 3L9VA 1BJXA 5DALB 3EYTA 4KCEA 4MA9A 4RQRA 1JZDA 1TI1A 4AJ8A 4TRXA 1FVJA 5IMVA 1UC7A 4ZL8A 5DQYA 5DJLA 2RUEA 4HEA2 5DCHA 3IV4A 5J5NA 2XC2A 5J9CA 2OBIA 4TXOA 20GSA 3F9UA 3R2QA 4GQFA 4USSA 5CYYA 1FAAA 5F0GA 1R5AA 4GQCA 4GSTA 2MMNA 5L71A 3V1WA 2HRKB 4PQIA 4MH3A 4ECIA 4K1FA 1OVNA 3RHBA 3J7Yk 3EURA 2YZUA 4I2UA 2LKUA 1XPVA 2YN1A 5C04A 2IJYA 2XBIA 3HHVA 3VK9A 5HFIA 1TOFA 1ZYEA 3TKRA 3P8WA 1U87A 22GSA 3NOFA 3QFBC 2DJJA 3DVWA 1M9AA 1X5CA 2VL2A 2B1LA 2H75A 3J7Yb 4ECBA 3VWXA 4D73A 1MEKA 5ENUA 4Q5QA 1OC9B 2IFQA 3L9UA 4KB3A 1B4QA 2WGRA 4MJEA 3ME7A 5F8BA 4GXZA 4JE1A 4ACSA 2DC5A 3ZVJA 2ON5A 2LRCA 3TOTA 6GSUA 5ECLB 2CAIA 4X43A 3UVTA 1NSWA 4LMVA 5IM9A 3TKSA 4PUAA 3GYKA 2MZCA 4MABA 2E2GA 5H5QA 4KDUA 3ERGA 14GSA 5A4VA 3H79A 5FHIA 3CTGA 4ZL9A 2JSYA 3TKQA 4OFNA 4POBA 4K2DA 3FYGA 3O3TA 4POMA 3WGDA 1V58A 4POLA 2OADA 5EL8A 4G9HA 5ECKB 3TB2A 2YP6A 1EGRA 3N5OA 4TR1A 3WT2A 4POKA 2IMKA 1Y6EA 2GLRA 3G9BA 2C3TA 3UARA 4N10A 2FWFA 2HQTA 4YH2A 3F4RA 2H01A 4WR5A 8GSSA 2E7PA 3M1GA 2PGTA 4CHSA 1X0RA 1SYRA 5B6NA 4MJCA 4KDYA 1MDIA 4G10A 2XBQA 1O7UA 3RPNA 1SL2B 1K0NA 1GULA 1SK1A 1ZCPA 3HYPA 2ZCTA 3RHCA 3L78A 1O8WA 1T8EB 3DXBA 1GH2A 3HCZA 3TJBA 2CZ3A 3NIVA 1YKCA 9GSSA 2HSMB 5E59A 1E2YA 2IN3A 4NMUA 4ILFA 2EIQA 3DGQA 2JADA 1TRUA 3PINA 3GMFA 4YAPA 1XWAA 4Z7XA 1TW9A 4DSSA 2FD3A 1SENA 1ZYQB 3UMAA 4LL1B 3IBHA 3EWLA 3UL3A 2K18A 2BJXA 3QAGA 4PUFC 3A3TA 2VLVA 3KIJA 3LYKA 2O87A 3ZLPA 6GSXA 4WBRD 2R4VA 1PMTA 2V6KA 1AUCA 1ZGNA 1X9SB 3M9JA 2GGTA 2WJUA 3GURA 1GUKA 2VL2C 1TRVA 1XFLA 3FZAA 2WS2A 2ZUPA 3WGXA 2HRFA 1PD21 1X5EA 2B7JA 2FA4A 5C00A 2AYTA 5LCZA 3APSA 2WFCA 3HA9A 4HU7A 5GZZB 2BTOT 2H0GA 1HYUA 3KGKA 3IK9A 1GUHA 5AIXA 2OACA 1GLPA 2H0IA 3ZITA 1EP8A 4XS4A 1T4ZA 2JACA 3TKSC 2CQ9A 3IAS2 4ULXA 3GRXA 1A0FA 1VF3A 3TJFA 1NHOA 4EL1A 1Y25A 5JCGA 2DJ2A 1JZWA 18GSA 4G0KA 4D73B 3HVVA 2I9HA 3LXZA 2IFQB 4PURA 1EV4A 3Q6OA 2NDOA 1TKDB 2R2JA 1OYJA 1PX7A 1KEBA 1QQ2A 2I81A 1PGTA 1QFNA 4CW9A 1CQGA 2CAQA 4MP4A 3FKFA 3KH7A 3HDCA 3FZ9A 3QD9A 13GSA 3ZMKA 1X5DA 4DEJA 2GVPA 5FWGA 5ECNB 3UBLA 1LBKA 2XPDA 3F4TA 4I6XA 4BL7B 4KE3A 1TI3A 5ECSA 5DALA 2K9FA 2LJAA 3VURA 4MF5A 1LJRA 2WRTA 2C0EA 4LMWA 2N5FA 4FO5A 1K3OA 2C8UA 5F05A 4OWYA 1GSEA 3IE3A 5A4UA 4YQUA 1QMVA 2R6KA 1FOVA 2H74A 3LSZA 3A2XA 1BEDA 2EIRA 2YOIA 1UN2A 3EC3A 2HNLA 4IBPA 4TW5A 2IMEA 4FIWA 1KBNA 4EDZA 1SL1B 3VI7A 3F3RA 1U6TA 5IPHA 3VPTA 3MNGA 1XWCA 4LA1A 4KGIA 2H6ZA 3TUEA 1EZKA 3IDVA 3RAZA 4AJ7A 2RLIA 3TOUA 2H6YA 4OO5A 2WB9A 5D73A 1NM3A 3TDGA 4ECCA 2L57A 2N5AA 4IN0A 4IW9A 2LJKA 4XS1A 2MYGA 4JBBA 5IMFA 4NPBA 1I5GA 3E3EA 1PKWA 3ZL5A 4EUYA 5AIVA 3GX8A 3TGZA 4DSSB 3ME8A 1GNWA 5IMCA 5AGYA 1V98A 3I6AA 5HR0A 2HE3A
chains in the Genus database with same CATH superfamily
1BAYA 4QQ7A 5J4UA 2Z9SA 3GTUB 1M7TA 2F51A 5B6MA 2O3EA 1PL1A 3I9V2 2YPMA 2CX4A 3MWHA 5HR2A 2B6MA 1SKWB 3G7IA 4O5RA 4CY6A 4H86A 3VLNA 4HJ2A 2VD0A 3LFLA 1GLQA 1MDKA 4G01A 1TK5B 2GQMA 2ALBA 2LJRA 3TKSE 3KJYA 3RPPA 3K8NA 4IJ3A 1GRXA 2DJKA 1W89A 1S4BP 2B5YA 1M0UA 3D5JA 2WVXB 1VRSD 1K0MA 3LWAA 2TIRA 5GSTA 2P0GA 1XZOA 2H72A 1YF0A 4XS4B 5D8IA 1PSQA 5BMUA 2OJLA 1K3LA 1F3BA 4K7NA 1A2MA 5ECRB 2JZTA 5JCWA 1F3AA 3FEUA 4EIQA 1MTCA 2I1UA 5D96A 1JFUA 3H93A 4KDXA 2GZPA 1ML6A 16GSA 1A2JA 3Q19A 1SK0A 6GSYA 5AISA 4V2LA 2PMTA 2R5GA 1WE0A 3A5WA 1SJZA 2M46A 1XW6A 1GSYA 1FB0A 4HI7A 2HSHA 2YZHA 2CX3A 2D2ZA 2HSMA 1S3RA 1FHEA 4PX1A 1DBYA 3HJOA 2MMZA 5IO2A 4DSQA 1QK8A 5EY6A 3GN3A 5A5HA 1Y1UA 1O8XA 3OR5A 5F07A 1KTEA 4A5PA 1ERVA 1GTUA 4AI6A 4RUVA 2A4HA 4MH2A 2WVYA 3GIXA 2I4AA 4K6XA 4L0WA 2H70A 2H1AA 2PWJA 2F8AA 5CP1A 4OD7A 1EV9A 4GLTA 3GKMA 2J23A 3VWVA 4MZBA 2DJ1A 1PL2A 4KF9A 1Z6NA 3DRNA 2H6XA 1OE7A 4MPGA 3KTBA 2L6DA 4KCAA 1N2AA 1GSSA 1BQ7A 4BVXB 1V9WA 4OFTA 2IMDA 2AUVA 4O32A 2IL3A 4GWRA 5JWOB 1BG5A 4ZBAA 3UJ1A 2YWOA 2HZEB 4AJ6A 3KXOA 5CREA 2DBCA 1EGOA 5DCGA 5DBQA 2F9SA 3U6VA 1M2AA 3QAWA 2YV7A 3RBTA 1WRYA 1URMA 2OBKA 4EIPA 2V6OA 2ES7A 4TR3A 2OT3A 4L0UA 5AN1A 1MDJA 3O6TA 4V1Ag 5KOXA 1EWXA 1ILOA 3GKKA 3Q74A 3BCKA 3PR8A 3HZ4A 4MZCA 2DLXA 1F9MA 5E4WA 2H71A 4BL7A 3M8NA 4KH7A 1UVZA 1PRXA 2GQLA 1ZOFA 5ELAA 4PXOA 4LL4B 4FYUA 1I9DA 3KCMA 3HMJG 3O76A 2HXKA 5HR3A 5HFGA 1EEMA 4O5QA 2P5QA 2H8LA 2OE1A 1OKTA 1ZZYA 4FYBA 1FB6A 6GSTA 1PA3A 4GCIA 1XOAA 5DDLA 4TR4A 2G2QA 3SWLA 3UEMA 4AKHA 1PX6A 1M99A 1YJ6A 4XRAA 2PN8A 5IOWA 3GV1A 4BWQA 2WW3A 3BBYA 3C1SA 1OC3A 4J57E 2YWIA 4X0XA 4TR0A 4MZWA 2LQOA 2EFCA 2FWGA 1AQXA 3QR6A 2F8FA 2B5XA 2QSIA 5CNWA 3TRPA 3IAM2 5CRHA 1GSDA 4PQHA 3HXSA 2VCXA 1XWKA 4KSMA 4EC0A 3HVSA 2HLSA 3WT1A 1EOGA 3HJPA 1N25A 3ZIJA 1THXA 2FWEA 2HZFA 2TRCP 4KUNA 1A23A 4PTSA 1QUWA 2KHPA 5D93A 3TJKA 3GSSA 4DVCA 1A0RP 1XIYA 5G5FA 1RQMA 1JLWA 2EIOA 2J9HA 2VL3A 4F9ZA 2RM6A 5ECHB 2WW0A 3APQA 2HSNA 3DYRA 5IO0A 4OCFA 3CYNA 5J40A 5A1NB 3GTUA 2NPBA 5HR1A 3LORA 3E0UA 4JZQA 5H5RA 4Q5RA 3C1RA 4ML1A 5FT3A 1BF5A 3PGTA 3WGEA 4MJBA 1K0OA 3P2AA 3APOA 2HYXA 2WCIA 1PKZA 3H1NA 5G1LA 4EO3A 2R0PA 3LG6A 3G7YA 3F8UA 1YQ1A 1YY7A 1MD4A 1K0CA 1J9BA 2FY6A 2LUSA 1Z5YE 3LJRA 2O89A 2VLTA 3IC4A 2C4JA 5JWQB 1MD3A 4F0CA 3N9JA 1GL8A 1Z7PA 4TVEA 2X8GA 1O85A 2YJHA 1GTIA 5JWRB 3G7JA 1HD2A 3EE2A 1OE8A 2NVLA 2LS5A 2VCVA 4E8EA 2M80A 2H1DA 1Q98A 1H4OA 1ZYPA 4EVMA 1FVKA 2QA2A 3TKPA 1VGLA 4F82A 1HNBA 5EPFA 2RUFA 3CBUA 1GUMA 1TDIA 3GUSA 4OO4A 3IXRA 1SVLA 2R0GA 2RM5A 1C72A 4HU9A 4V1Ap 2AB6A 3A5IA 3M0FA 2MBSA 5ABRA 4ISDA 4XHMA 3FY7A 4BA7A 4G2EA 3MAKA 2FGXA 3TRXA 3M3MA 4NV5A 2OE3A 2L4QA 3FZ4A 2VL9A 3A2VA 3KZQA 1WWJA 5HQPA 2F3MA 1JHBA 1XCCA 2LQQA 4HZ4A 3CTFA 1OAZA 4G19A 2EFHA 4HQSA 4RQXA 11GSA 4Q5FA 5ECOB 4I5QA 5JCUA 3VWUA 1GTBA 4F03A 1BYEA 4PI2C 2WDUA 2X4AA 1SK2A 2CT6A 1YZXA 1B9XC 1U3AA 2I3YA 2FWHA 3RGBC 3RDWA 5J3RA 1O81A 3LEFA 1SVMA 5DJMA 2MMAA 2RIIA 2OA7A 4QL7A 1GWCA 2AHEA 4K9ZA 5ECIB 1U88A 1ST9A 3TRQA 2JSZA 4BVXA 3US3A 2JU5A 2DIYA 4ECJA 1M2BA 4F2IA 3ZREA 3L4NA 4FYCA 3IR4A 2WZSA 1I1IP 3GL5A 2AV4A 3TJJA 2VKZG 5J41A 3TU3B 2HZEA 3E9JB 1TXXA 1SL0B 2GSSA 2YANA 3QOUA 1GSFA 2V41A 4WR4A 2LNSA 1T3BA 3EVIA 2DSAA 1H75A 1XWBA 3RFRC 3GFKA 2GTUA 2HSNB 2LV3A 3CMIA 5G2ZA 1V40A 2GSTA 2EFEA 4EXJA 2C0DA 1TP9A 1WPIA 3WYWA 4WETA 2R37A 4ZIJA 3GH9A 1SYXA 3EU3A 2KP1A 2K8SA 4JU5A 2YJ7A 5INYA 2DJ0A 5G30A 5CRDA 3M9KA 1R5PA 2R3XA 2O85A 3ZMLA 5CRGA 1ABAA 4WF4A 3S9FA 2H76A 4IP1A 2QGVA 1V57A 2JZSA 1OKDA 5DVBA 5IMAA 2C80A 1JZRA 2YNXA 1K0DA 1TRWA 3MDKA 4N11A 4G0IA 1XW9A 3CSJA 2X8CA 3IRAA 4BVYB 5B8BA 2PVOC 3P7XA 4MJAA 2X99A 3W8SA 2PU9C 2VCZA 3KMOA 1G0TA 3QCPA 2HFDA 5CO3A 1AXDA 5IPGA 3ZYWA 1G6YA 3VPQA 1PQNA 2LRTA 2UV8G 1BX9A 17GSA 3IPZA 2L4CA 1EEJA 1GSQA 3FR3A 3DEXA 1GNEA 5G1KA 4K7OA 2VCTA 4PGTA 2DJ3A 2C0GA 2DMLA 5J4VA 1DE1A 2L5OA 3ZFLA 2JL4A 2VD1A 4XCSA 1B8XA 3PH9A 1FO5A 5IOXA 4PNGA 4EKZA 3I69A 2O8VB 5HFKA 3KD0A 4K8MA 4ZB6A 1Z9HA 2K8VA 4GF0A 3HZ8A 4HOJA 1X9MB 4L8EA 1AAZA 4OCEA 4Z2UA 6GSVA 5KOWA 3IC8A 3F6FA 1WJKA 4PI0C 1WOUA 2ON7A 5A1NA 4PQ1A 4RI7A 2HRNA 4JEDA 3F0IA 2UZ8A 4N30A 2NBSA 4XIHA 1T1VA 3WD6A 3EMXA 5ID2A 4KA0A 5A5KA 1DUGA 1U3IA 3GA4A 3UOMA 2GZZA 3EMPA 1IYHA 3HY2A 1K3YA 2CA8A 4XRDA 4EDYA 4K5SA 2CVKA 3FR9A 2QA1A 3CSHA 1S3CA 4ZB9A 1RW1A 4IVFA 1M2DA 2VM2A 2WZ9A 4HS1A 3ERFA 1M3JA 3KH9A 4O7HA 4CDOA 5DAKA 1Z7RA 2LTKA 6GSSA 3KM6A 1JZOA 2GQKA 3F4SA 2HI7A 5IMZA 5DQSA 1GSUA 1XXUA 2FCHA 4L5OA 4ML6A 1KNGA 3L0HA 4TOPA 4HJMA 5EVOA 2O5VA 2TRXA 1PN9A 5A4WA 1WP0A 3C73A 3MIXA 4EF0A 2HT9A 1DE2A 3C7MA 1B4PA 1AIUA 2H1GA 4MPFA 5ECMB 3VWWA 2YCDA 3KEBA 1SJ6A 2GT5A 3EPTA 3Q18A 3PPUA 2H66A 1UA5A 2B1KA 2VIMA 2YWMA 3D0ZA 1AW9A 5CRWA 4QL9A 2H30A 4JRRA 1G7OA 3W6GA 1GTAA 1PFOA 3HJMA 2KP2A 4WBJA 2VCQA 19GSA 1TRSA 4WF5A 1A8YA 1B9YC 3R3EA 1ERTA 4Q5NA 1YEXA 1ZMAA 2AJQB 3HKRA 3BCIA 4G0LA 2O7KA 1S3AA 2LEGA 2CZ2A 3HD5A 1E6BA 2PBJA 1GP1A 3CSIA 1DSBA 1SJIA 4E68A 2VM1A 3GHAA 2JZRA 3FR6A 4KSOA 2VUPA 5J9BA 2FNOA 1G6WA 4IP6A 3FZ5A 1A24A 2VCWA 4AGSA 1XBSA 1T7PB 3FW2A 3DD3A 2B3SA 1TJDA 5KN3A 4P3YB 4MNNA 4TKYA 2L6CA 1FOHA 3UIWA 1TK8B 3QAVA 5ECPB 4I8BA 1QXHA 4OMVA 4ZILA 2FA8A 4MF7A 4K7IA 3HVXA 1THOA 3VI5A 1ERWA 4O92A 5ELGA 4JR6A 2XPEA 1V2AA 1XOBA 5KEJA 3BJ5A 2YV9A 3BOAA 4PNFA 3KP8A 1EOHA 3KP9A 4V2NA 2A4VA 3I43A 4XTSA 4KW6A 1R4WA 2C3NA 2CV4A 1TK0B 2M72A 3IHQA 3DVXA 5GSSA 4EE0A 12GSA 4OFMA 2X8HA 3VFIA 1IYIA 3L9SA 4GTUA 5J4YA 2B7KA 3IHGA 3JCML 4Z2RA 1LU4A 1HNAA 5ID2B 4AKXB 3GH6A 3GX0A 1TXUA 2ZNMA 3LGCA 1M9BA 3ZTLA 1SVOA 3IK7A 4FXYP 2MBTA 1RK4A 4IQAA 4TXOB 1AC1A 1XVWA 3LQ7A 2XHFA 3UBKA 3MYDA 3F3QA 3DKSA 1AQWA 2LNTA 4BVYA 2GZYA 4YQVA 4HDEA 3SBCA 4NHZA 2B5EA 2V32A 4IHUA 4MK3A 2IMIA 4IS0A 4ID0A 4E8HA 2P5RA 3D4MA 4IELA 5DAKB 3NZNA 2H1BA 5BRTA 5CAXA 2GSQA 2PERA 2N5BA 5D9VA 2H1LA 3CXGA 2HSYA 3TCOA 3QDNA 4MCUA 2NTOA 2CVBA 1WIKA 2KOKA 4V2MA 4MDCA 5A34B 1EP7A 1F6MC 4I2TA 4YQMA 5IMDA 4WEYA 4NWYA 2LRNA 1TTZA 2VOCA 1YVLA 2CVDA 2YWNA 4HQZA 1F37A 5KN2A 3LXTA 2HRAA 4IKHA 4GSSA 3BD2A 5J47A 3ERWA 5G5EA 3ZRDA 4WXTA 2A2RA 4NXIA 2X64A 3F63A 3DMLA 4LLRA 5D9TA 3ZFBA 4L5LA 3U5RE 2GT6A 3FHKA 10GSA 4GSNA 5LD0A 2REMA 2C3QA 4YAVA 2H73A 1FG4A 1ACVA 4IJIA 3AY8A 4K0GA 4KX4A 1XW5A 2AAWA 2MMOA 2H0HA 2V1MA 1O73A 2BMXA 4KNDA 4I97A 4BIKA 4AKIA 4W66A 1TU7A 1SKRB 1CQHA 5H5SA 2G0FA 2PVQA 2IIYA 1A8LA 4MLYA 1YF1A 2FUG2 1A2LA 1T00A 1B48A 4TR1B 1ZL9A 3CRUA 4N0ZA 3QMXA 2GSRA 1VF1A 3ZIVA 3ZZXA 3EU4A 7GSSA 2LSTA 2IPAA 3D21A 1SU9A 2KUCA 2QC7A 2H19A 1O6JA 1K0AA 4IQ1A 3GL3A 2HRKA 1ON4A 3ISOA 3W8JA 4WKWA 2E2MA 5GAPD 2IMFA 1YDKA 2VAFA 3CRTA 2O36A 2GDRA 1T4YA 4J56E 2DIZA 4DSRA 1FW1A 3GKXA 4NHWA 3LYPA 1N8JA 1AQVA 3DIEA 4X4JA 1WMJA 4HUAA 2VLUA 2DMMA 4BPYA 2P31A 4XS6A 4ZB8A 1ERUA 1J0FA 4F0BA 2PUKC 4KAEA 4ZBBA 4GRFA 5F06A 2PPTA 1OC9A 4QMKA 4HZ2A 3IOSA 1NW2A 4IGJA 2FLSA 3GNJA 3UAPA 4NAXA 1W4VA 1USBA 4BWSA 3FRCA 4FH8A 3C71A 4FQUA 1OC8A 2V2GA 1XVQA 2FHEA 1SD8A 3ED3A 2L59A 4RI6A 2C1YA 5LNKe 3GSTA 1YEPA 5B8AA 1VF4A 3P90A 6GSWA 4PHZC 1F2EA 3QFAC 4TN8A 4MMMA 5G31A 3FK8A 1R7HA 1Z6MA 2GS3A 1VF2A 1K0BA 4TXVA 2L5LA 4X1UA 1QGVA 5D9XA 3DWVA 4K0NA 3UVHA 1XWGA 2E0QA 2K6VA 1NHYA 2OE0A 3TJGA 4ZXGA 5COHA 2KLXA 3D4TA 3EINA 4MF6A 4AF2A 2EC4A 4ZBDA 1JLVA 1SD9A 2VO4A 1ZYNA 1HQOA 5KN0A 1R26A 1S3DA 3QPMA 4N0VA 4AKGA 3A2WA 3MSZA 1J08A 1TU8A 3C8EA 3CHXC 1X9WB 2A2SA 3H4KA 4ZL7A 5KN1A 5D9WA 1Z3EA 3GKNA 4YKGA 5ECQB 3F6DA 4JR4A 4K2XA 3ZVJD 3KMNA 3KTLA 5IQYA 2IWTA 3D6IA 4J2FA 1HNCA 4NV2A 3D22A 2C0FA 1YKAA 3H8QA 1Q4JA 5GAND 3IA1A 1G7EA 1SKSB 2OKAA 5B7CA 2WULA 5IIZA 2QKEA 4YKFA 3L9VA 1BJXA 5DALB 1M3IA 3EYTA 4KCEA 4MA9A 4RQRA 1JZDA 1TI1A 2WW1A 4AJ8A 4TRXA 1FVJA 5IMVA 1UC7A 4ZL8A 4Z2TA 5DQYA 5DJLA 4O5UA 2RUEA 4HEA2 5DCHA 3IV4A 5J5NA 2XC2A 5J9CA 3CQFA 2OBIA 4TXOA 20GSA 3F9UA 3R2QA 4GQFA 4USSA 5CYYA 1FAAA 5F0GA 1R5AA 4GQCA 4GSTA 2MMNA 5L71A 2X49A 3V1WA 2HRKB 4PQIA 4MH3A 4ECIA 4K1FA 1OVNA 3RHBA 2EFDA 3J7Yk 3EURA 2YZUA 4I2UA 2LKUA 2R0CA 1XPVA 2YN1A 5C04A 2IJYA 5A34A 2XBIA 3HHVA 3VK9A 5HFIA 1TOFA 1ZYEA 3TKRA 3P8WA 1U87A 22GSA 3NOFA 3QFBC 2DJJA 3DVWA 1M9AA 1X5CA 2VL2A 2B1LA 2H75A 3J7Yb 4ECBA 3VWXA 4D73A 1MEKA 5ENUA 4Q5QA 3CWGA 1OC9B 2IFQA 3L9UA 4KB3A 1B4QA 2WGRA 4MJEA 3ME7A 5F8BA 4GXZA 4JE1A 4ACSA 2DC5A 3ZVJA 2ON5A 2LRCA 3TOTA 6GSUA 5ECLB 2CAIA 4X43A 3UVTA 1NSWA 4LMVA 5IM9A 3TKSA 4PUAA 3GYKA 2MZCA 4MABA 2E2GA 5H5QA 4KDUA 3ERGA 14GSA 5A4VA 4ZB7A 3H79A 5FHIA 3CTGA 4ZL9A 2JSYA 4N3ZA 3TKQA 4OFNA 4POBA 4K2DA 3FYGA 3O3TA 4POMA 3WGDA 1V58A 4POLA 2OADA 5EL8A 4G9HA 5ECKB 3TB2A 2YP6A 1EGRA 3N5OA 4TR1A 3WT2A 4POKA 4HSCX 2IMKA 1Y6EA 2GLRA 3G9BA 2C3TA 3UARA 4N10A 2FWFA 2HQTA 4YH2A 5BMUB 3F4RA 2H01A 4WR5A 8GSSA 2E7PA 3M1GA 2PGTA 4CHSA 1X0RA 1SYRA 5B6NA 4MJCA 4KDYA 1MDIA 4G10A 2XBQA 1O7UA 3RPNA 1SL2B 4CY8A 1K0NA 1GULA 1SK1A 1ZCPA 3HYPA 2ZCTA 3RHCA 3L78A 1O8WA 1T8EB 3DXBA 1GH2A 3HCZA 3TJBA 2CZ3A 3NIVA 1YKCA 9GSSA 2HSMB 5E59A 1E2YA 2IN3A 4NMUA 4ILFA 2EIQA 3DGQA 2JADA 1TRUA 3PINA 3GMFA 5A5HB 4YAPA 1XWAA 4Z7XA 1TW9A 4DSSA 2FD3A 1SENA 1ZYQB 3UMAA 4LL1B 3IBHA 3EWLA 3UL3A 2K18A 2BJXA 3QAGA 4PUFC 3A3TA 2VLVA 3KIJA 3LYKA 2O87A 3ZLPA 6GSXA 4WBRD 2R4VA 1PMTA 2V6KA 1AUCA 1ZGNA 1X9SB 3M9JA 2GGTA 2WJUA 3GURA 1GUKA 2VL2C 1TRVA 1XFLA 3FZAA 2WS2A 2ZUPA 3WGXA 2HRFA 1PD21 1X5EA 2B7JA 2FA4A 5C00A 2AYTA 5LCZA 3APSA 2WFCA 3HA9A 4HU7A 2WVZA 5GZZB 2BTOT 2H0GA 4ICYA 1HYUA 3KGKA 2WVXA 3IK9A 1GUHA 3LW9A 5AIXA 2OACA 1GLPA 2H0IA 3ZITA 1EP8A 4XS4A 1T4ZA 2JACA 3TKSC 2CQ9A 3IAS2 4ULXA 3GRXA 1A0FA 1VF3A 3TJFA 1NHOA 4EL1A 1Y25A 5JCGA 1PN0A 2DJ2A 1JZWA 18GSA 4G0KA 4D73B 3HVVA 2I9HA 3LXZA 2IFQB 2WW2A 4PURA 1EV4A 3Q6OA 2NDOA 1TKDB 2R2JA 1OYJA 1PX7A 1KEBA 1QQ2A 2I81A 1PGTA 1QFNA 4CW9A 1CQGA 2CAQA 4MP4A 3FKFA 3KH7A 3HDCA 3FZ9A 3QD9A 13GSA 3ZMKA 1X5DA 4DEJA 2GVPA 5FWGA 5ECNB 3UBLA 1LBKA 2XPDA 3F4TA 4I6XA 4BL7B 4KE3A 1TI3A 5ECSA 5DALA 2K9FA 2LJAA 3VURA 4MF5A 1LJRA 2WRTA 2C0EA 4LMWA 2N5FA 1YEWC 4FO5A 1K3OA 2C8UA 5F05A 4OWYA 3FMWA 1GSEA 3IE3A 5A4UA 4YQUA 1QMVA 2R6KA 4K5RA 1FOVA 2H74A 3LSZA 3A2XA 3HVNA 1BEDA 2EIRA 4GDFA 1XG8A 2YOIA 1UN2A 3EC3A 2HNLA 4IBPA 4TW5A 2IMEA 4FIWA 1KBNA 4EDZA 1SL1B 3VI7A 3F3RA 1U6TA 5IPHA 3VPTA 3MNGA 1XWCA 4LA1A 4KGIA 2H6ZA 3TUEA 1EZKA 3IDVA 3RAZA 4AJ7A 2A2PA 2RLIA 2DKIA 3TOUA 2H6YA 4OO5A 2WB9A 5D73A 1NM3A 2DKHA 3TDGA 4ECCA 2L57A 2N5AA 4IN0A 4IW9A 1BG1A 2LJKA 4XS1A 2MYGA 4JBBA 5IMFA 4NPBA 1I5GA 3E3EA 1PKWA 3ZL5A 4EUYA 5AIVA 3GX8A 3TGZA 4DSSB 3ME8A 1GNWA 5IMCA 5AGYA 1V98A 3I6AA 5HR0A 2HE3A
chains in the Genus database with same CATH topology
1BAYA 4QQ7A 5J4UA 2Z9SA 3GTUB 1M7TA 2F51A 5B6MA 1PL1A 3I9V2 2YPMA 2CX4A 3MWHA 5HR2A 2B6MA 1SKWB 3G7IA 4O5RA 4CY6A 4H86A 3VLNA 4HJ2A 2VD0A 3LFLA 1GLQA 1MDKA 4G01A 1TK5B 2GQMA 2ALBA 2LJRA 3TKSE 3KJYA 3RPPA 3K8NA 4IJ3A 1GRXA 2DJKA 1W89A 2B5YA 1M0UA 3D5JA 1VRSD 1K0MA 3LWAA 2TIRA 5GSTA 2P0GA 1XZOA 2H72A 1YF0A 4XS4B 5D8IA 1PSQA 5BMUA 2OJLA 1K3LA 1F3BA 4K7NA 1A2MA 5ECRB 2JZTA 5JCWA 1F3AA 3FEUA 4EIQA 1MTCA 2I1UA 5D96A 1JFUA 3H93A 4KDXA 2GZPA 1ML6A 16GSA 1A2JA 3Q19A 1SK0A 6GSYA 5AISA 4V2LA 2PMTA 2R5GA 1WE0A 3A5WA 1SJZA 2M46A 1XW6A 1GSYA 1FB0A 4HI7A 2HSHA 2YZHA 2CX3A 2D2ZA 2HSMA 1FHEA 4PX1A 1DBYA 3HJOA 2MMZA 5IO2A 4DSQA 1QK8A 5EY6A 3GN3A 5A5HA 1Y1UA 1O8XA 3OR5A 5F07A 1KTEA 4A5PA 1ERVA 1GTUA 4AI6A 4RUVA 2A4HA 4MH2A 3GIXA 2I4AA 4K6XA 4L0WA 2H70A 2H1AA 2PWJA 2F8AA 5CP1A 4OD7A 1EV9A 4GLTA 3GKMA 2J23A 3VWVA 4MZBA 2DJ1A 1PL2A 4KF9A 1Z6NA 3DRNA 2H6XA 1OE7A 4MPGA 3KTBA 2L6DA 4KCAA 1N2AA 1GSSA 1BQ7A 4BVXB 1V9WA 4OFTA 2IMDA 2AUVA 4O32A 2IL3A 4GWRA 5JWOB 1BG5A 4ZBAA 3UJ1A 2YWOA 2HZEB 4AJ6A 3KXOA 5CREA 2DBCA 1EGOA 5DCGA 5DBQA 2F9SA 3U6VA 1M2AA 3QAWA 2YV7A 3RBTA 1WRYA 1URMA 2OBKA 4EIPA 2V6OA 2ES7A 4TR3A 2OT3A 4L0UA 5AN1A 1MDJA 3O6TA 4V1Ag 5KOXA 1EWXA 1ILOA 3GKKA 3Q74A 3BCKA 3PR8A 3HZ4A 4MZCA 2DLXA 1F9MA 5E4WA 2H71A 4BL7A 3M8NA 4KH7A 1UVZA 1PRXA 2GQLA 1ZOFA 5ELAA 4PXOA 4LL4B 4FYUA 1I9DA 3KCMA 3HMJG 3O76A 2HXKA 5HR3A 5HFGA 1EEMA 4O5QA 2P5QA 2H8LA 2OE1A 1OKTA 1ZZYA 4FYBA 1FB6A 6GSTA 1PA3A 4GCIA 1XOAA 5DDLA 4TR4A 2G2QA 3SWLA 3UEMA 4AKHA 1PX6A 1M99A 1YJ6A 4XRAA 2PN8A 5IOWA 3GV1A 4BWQA 3BBYA 3C1SA 1OC3A 4J57E 2YWIA 4X0XA 4TR0A 4MZWA 2LQOA 2EFCA 2FWGA 1AQXA 3QR6A 2F8FA 2B5XA 2QSIA 5CNWA 3TRPA 3IAM2 5CRHA 1GSDA 4PQHA 3HXSA 2VCXA 1XWKA 4KSMA 4EC0A 3HVSA 2HLSA 3WT1A 1EOGA 3HJPA 1N25A 3ZIJA 1THXA 2FWEA 2HZFA 2TRCP 4KUNA 1A23A 4PTSA 1QUWA 2KHPA 5D93A 3TJKA 3GSSA 4DVCA 1A0RP 1XIYA 5G5FA 1RQMA 1JLWA 2EIOA 2J9HA 2VL3A 4F9ZA 2RM6A 5ECHB 3APQA 2HSNA 3DYRA 5IO0A 4OCFA 3CYNA 5J40A 5A1NB 3GTUA 2NPBA 5HR1A 3LORA 3E0UA 4JZQA 5H5RA 4Q5RA 3C1RA 4ML1A 5FT3A 1BF5A 3PGTA 3WGEA 4MJBA 1K0OA 3P2AA 3APOA 2HYXA 2WCIA 1PKZA 3H1NA 5G1LA 4EO3A 2R0PA 3LG6A 3G7YA 3F8UA 1YQ1A 1YY7A 1MD4A 1K0CA 1J9BA 2FY6A 2LUSA 1Z5YE 3LJRA 2O89A 2VLTA 3IC4A 2C4JA 5JWQB 1MD3A 4F0CA 3N9JA 1GL8A 1Z7PA 4TVEA 2X8GA 1O85A 2YJHA 1GTIA 5JWRB 3G7JA 1HD2A 3EE2A 1OE8A 2NVLA 2LS5A 2VCVA 4E8EA 2M80A 2H1DA 1Q98A 1H4OA 1ZYPA 4EVMA 1FVKA 2QA2A 3TKPA 1VGLA 4F82A 1HNBA 5EPFA 2RUFA 3CBUA 1GUMA 1TDIA 3GUSA 4OO4A 3IXRA 1SVLA 2R0GA 2RM5A 1C72A 4HU9A 4V1Ap 2AB6A 3A5IA 3M0FA 2MBSA 5ABRA 4ISDA 4XHMA 3FY7A 4BA7A 4G2EA 3MAKA 2FGXA 3TRXA 3M3MA 4NV5A 2OE3A 2L4QA 3FZ4A 2VL9A 3A2VA 3KZQA 1WWJA 5HQPA 2F3MA 1JHBA 1XCCA 2LQQA 4HZ4A 3CTFA 1OAZA 4G19A 2EFHA 4HQSA 4RQXA 11GSA 4Q5FA 5ECOB 4I5QA 5JCUA 3VWUA 1GTBA 4F03A 1BYEA 2WDUA 2X4AA 1SK2A 2CT6A 1YZXA 1B9XC 1U3AA 2I3YA 2FWHA 3RDWA 5J3RA 1O81A 3LEFA 1SVMA 5DJMA 2MMAA 2RIIA 2OA7A 4QL7A 1GWCA 2AHEA 4K9ZA 5ECIB 1U88A 1ST9A 3TRQA 2JSZA 4BVXA 3US3A 2JU5A 2DIYA 4ECJA 1M2BA 4F2IA 3ZREA 3L4NA 4FYCA 3IR4A 3GL5A 2AV4A 3TJJA 2VKZG 5J41A 3TU3B 2HZEA 3E9JB 1TXXA 1SL0B 2GSSA 2YANA 3QOUA 1GSFA 2V41A 4WR4A 2LNSA 1T3BA 3EVIA 2DSAA 1H75A 1XWBA 3GFKA 2GTUA 2HSNB 2LV3A 3CMIA 5G2ZA 1V40A 2GSTA 2EFEA 4EXJA 2C0DA 1TP9A 1WPIA 3WYWA 4WETA 2R37A 4ZIJA 3GH9A 1SYXA 3EU3A 2KP1A 2K8SA 4JU5A 2YJ7A 5INYA 2DJ0A 5G30A 5CRDA 3M9KA 1R5PA 2R3XA 2O85A 3ZMLA 5CRGA 1ABAA 4WF4A 3S9FA 2H76A 4IP1A 2QGVA 1V57A 2JZSA 1OKDA 5DVBA 5IMAA 2C80A 1JZRA 2YNXA 1K0DA 1TRWA 3MDKA 4N11A 4G0IA 1XW9A 3CSJA 2X8CA 3IRAA 4BVYB 5B8BA 2PVOC 3P7XA 4MJAA 2X99A 3W8SA 2PU9C 2VCZA 3KMOA 1G0TA 3QCPA 2HFDA 5CO3A 1AXDA 5IPGA 3ZYWA 1G6YA 3VPQA 1PQNA 2LRTA 2UV8G 1BX9A 17GSA 3IPZA 2L4CA 1EEJA 1GSQA 3FR3A 3DEXA 1GNEA 5G1KA 4K7OA 2VCTA 4PGTA 2DJ3A 2C0GA 2DMLA 5J4VA 1DE1A 2L5OA 3ZFLA 2JL4A 2VD1A 4XCSA 1B8XA 3PH9A 1FO5A 5IOXA 4PNGA 4EKZA 3I69A 2O8VB 5HFKA 3KD0A 4K8MA 4ZB6A 1Z9HA 2K8VA 4GF0A 3HZ8A 4HOJA 1X9MB 4L8EA 1AAZA 4OCEA 4Z2UA 6GSVA 5KOWA 3IC8A 3F6FA 1WJKA 1WOUA 2ON7A 5A1NA 4PQ1A 4RI7A 2HRNA 4JEDA 3F0IA 2UZ8A 4N30A 2NBSA 4XIHA 1T1VA 3WD6A 3EMXA 5ID2A 4KA0A 5A5KA 1DUGA 1U3IA 3GA4A 3UOMA 2GZZA 3EMPA 1IYHA 3HY2A 1K3YA 2CA8A 4XRDA 4EDYA 4K5SA 2CVKA 3FR9A 2QA1A 3CSHA 1S3CA 4ZB9A 1RW1A 4IVFA 1M2DA 2VM2A 2WZ9A 4HS1A 3ERFA 3KH9A 4O7HA 4CDOA 5DAKA 1Z7RA 2LTKA 6GSSA 3KM6A 1JZOA 2GQKA 3F4SA 2HI7A 5IMZA 5DQSA 1GSUA 1XXUA 2FCHA 4L5OA 4ML6A 1KNGA 3L0HA 4TOPA 4HJMA 5EVOA 2O5VA 2TRXA 1PN9A 5A4WA 1WP0A 3C73A 3MIXA 4EF0A 2HT9A 1DE2A 3C7MA 1B4PA 1AIUA 2H1GA 4MPFA 5ECMB 3VWWA 2YCDA 3KEBA 1SJ6A 2GT5A 3EPTA 3Q18A 3PPUA 2H66A 1UA5A 2B1KA 2VIMA 2YWMA 3D0ZA 1AW9A 5CRWA 4QL9A 2H30A 4JRRA 1G7OA 3W6GA 1GTAA 3HJMA 2KP2A 4WBJA 2VCQA 19GSA 1TRSA 4WF5A 1A8YA 1B9YC 3R3EA 1ERTA 4Q5NA 1YEXA 1ZMAA 2AJQB 3HKRA 3BCIA 4G0LA 2O7KA 1S3AA 2LEGA 2CZ2A 3HD5A 1E6BA 2PBJA 1GP1A 3CSIA 1DSBA 1SJIA 4E68A 2VM1A 3GHAA 2JZRA 3FR6A 4KSOA 2VUPA 5J9BA 2FNOA 1G6WA 4IP6A 3FZ5A 1A24A 2VCWA 4AGSA 1XBSA 1T7PB 3FW2A 3DD3A 2B3SA 1TJDA 5KN3A 4P3YB 4MNNA 4TKYA 2L6CA 1FOHA 3UIWA 1TK8B 3QAVA 5ECPB 4I8BA 1QXHA 4OMVA 4ZILA 2FA8A 4MF7A 4K7IA 3HVXA 1THOA 3VI5A 1ERWA 4O92A 5ELGA 4JR6A 2XPEA 1V2AA 1XOBA 5KEJA 3BJ5A 2YV9A 3BOAA 4PNFA 3KP8A 1EOHA 3KP9A 4V2NA 2A4VA 3I43A 4XTSA 4KW6A 1R4WA 2C3NA 2CV4A 1TK0B 2M72A 3IHQA 3DVXA 5GSSA 4EE0A 12GSA 4OFMA 2X8HA 3VFIA 1IYIA 3L9SA 4GTUA 5J4YA 2B7KA 3IHGA 3JCML 4Z2RA 1LU4A 1HNAA 5ID2B 4AKXB 3GH6A 3GX0A 1TXUA 2ZNMA 3LGCA 1M9BA 3ZTLA 1SVOA 3IK7A 2MBTA 1RK4A 4IQAA 4TXOB 1AC1A 1XVWA 3LQ7A 2XHFA 3UBKA 3MYDA 3F3QA 3DKSA 1AQWA 2LNTA 4BVYA 2GZYA 4YQVA 4HDEA 3SBCA 4NHZA 2B5EA 2V32A 4IHUA 4MK3A 2IMIA 4IS0A 4ID0A 4E8HA 2P5RA 3D4MA 4IELA 5DAKB 3NZNA 2H1BA 5BRTA 5CAXA 2GSQA 2PERA 2N5BA 5D9VA 2H1LA 3CXGA 2HSYA 3TCOA 3QDNA 4MCUA 2NTOA 2CVBA 1WIKA 2KOKA 4V2MA 4MDCA 5A34B 1EP7A 1F6MC 4I2TA 4YQMA 5IMDA 4WEYA 4NWYA 2LRNA 1TTZA 2VOCA 1YVLA 2CVDA 2YWNA 4HQZA 1F37A 5KN2A 3LXTA 2HRAA 4IKHA 4GSSA 3BD2A 5J47A 3ERWA 5G5EA 3ZRDA 4WXTA 2A2RA 4NXIA 2X64A 3F63A 3DMLA 4LLRA 5D9TA 3ZFBA 4L5LA 3U5RE 2GT6A 3FHKA 10GSA 4GSNA 5LD0A 2REMA 2C3QA 4YAVA 2H73A 1FG4A 1ACVA 4IJIA 3AY8A 4K0GA 4KX4A 1XW5A 2AAWA 2MMOA 2H0HA 2V1MA 1O73A 2BMXA 4KNDA 4I97A 4AKIA 4W66A 1TU7A 1SKRB 1CQHA 5H5SA 2G0FA 2PVQA 2IIYA 1A8LA 4MLYA 1YF1A 2FUG2 1A2LA 1T00A 1B48A 4TR1B 1ZL9A 3CRUA 4N0ZA 3QMXA 2GSRA 1VF1A 3ZIVA 3ZZXA 3EU4A 7GSSA 2LSTA 2IPAA 3D21A 1SU9A 2KUCA 2QC7A 2H19A 1O6JA 1K0AA 4IQ1A 3GL3A 2HRKA 1ON4A 3ISOA 3W8JA 4WKWA 2E2MA 5GAPD 2IMFA 1YDKA 2VAFA 3CRTA 2GDRA 1T4YA 4J56E 2DIZA 4DSRA 1FW1A 3GKXA 4NHWA 3LYPA 1N8JA 1AQVA 3DIEA 4X4JA 1WMJA 4HUAA 2VLUA 2DMMA 4BPYA 2P31A 4XS6A 4ZB8A 1ERUA 1J0FA 4F0BA 2PUKC 4KAEA 4ZBBA 4GRFA 5F06A 2PPTA 1OC9A 4QMKA 4HZ2A 3IOSA 1NW2A 4IGJA 2FLSA 3GNJA 3UAPA 4NAXA 1W4VA 1USBA 4BWSA 3FRCA 4FH8A 3C71A 4FQUA 1OC8A 2V2GA 1XVQA 2FHEA 1SD8A 3ED3A 2L59A 4RI6A 2C1YA 5LNKe 3GSTA 1YEPA 5B8AA 1VF4A 3P90A 6GSWA 1F2EA 3QFAC 4TN8A 4MMMA 5G31A 3FK8A 1R7HA 1Z6MA 2GS3A 1VF2A 1K0BA 4TXVA 2L5LA 4X1UA 1QGVA 5D9XA 3DWVA 4K0NA 3UVHA 1XWGA 2E0QA 2K6VA 1NHYA 2OE0A 3TJGA 4ZXGA 5COHA 2KLXA 3D4TA 3EINA 4MF6A 4AF2A 2EC4A 4ZBDA 1JLVA 1SD9A 2VO4A 1ZYNA 1HQOA 5KN0A 1R26A 1S3DA 3QPMA 4N0VA 4AKGA 3A2WA 3MSZA 1J08A 1TU8A 3C8EA 1X9WB 2A2SA 3H4KA 4ZL7A 5KN1A 5D9WA 1Z3EA 3GKNA 4YKGA 5ECQB 3F6DA 4JR4A 4K2XA 3ZVJD 3KMNA 3KTLA 5IQYA 2IWTA 3D6IA 4J2FA 1HNCA 4NV2A 3D22A 2C0FA 1YKAA 3H8QA 1Q4JA 5GAND 3IA1A 1G7EA 1SKSB 2OKAA 5B7CA 2WULA 5IIZA 2QKEA 4YKFA 3L9VA 1BJXA 5DALB 3EYTA 4KCEA 4MA9A 4RQRA 1JZDA 1TI1A 4AJ8A 4TRXA 1FVJA 5IMVA 1UC7A 4ZL8A 4Z2TA 5DQYA 5DJLA 4O5UA 2RUEA 4HEA2 5DCHA 3IV4A 5J5NA 2XC2A 5J9CA 2OBIA 4TXOA 20GSA 3F9UA 3R2QA 4GQFA 4USSA 5CYYA 1FAAA 5F0GA 1R5AA 4GQCA 4GSTA 2MMNA 5L71A 2X49A 3V1WA 2HRKB 4PQIA 4MH3A 4ECIA 4K1FA 1OVNA 3RHBA 2EFDA 3J7Yk 3EURA 2YZUA 4I2UA 2LKUA 2R0CA 1XPVA 2YN1A 5C04A 2IJYA 5A34A 2XBIA 3HHVA 3VK9A 5HFIA 1TOFA 1ZYEA 3TKRA 3P8WA 1U87A 22GSA 3NOFA 3QFBC 2DJJA 3DVWA 1M9AA 1X5CA 2VL2A 2B1LA 2H75A 3J7Yb 4ECBA 3VWXA 4D73A 1MEKA 5ENUA 4Q5QA 3CWGA 1OC9B 2IFQA 3L9UA 4KB3A 1B4QA 2WGRA 4MJEA 3ME7A 5F8BA 4GXZA 4JE1A 4ACSA 2DC5A 3ZVJA 2ON5A 2LRCA 3TOTA 6GSUA 5ECLB 2CAIA 4X43A 3UVTA 1NSWA 4LMVA 5IM9A 3TKSA 4PUAA 3GYKA 2MZCA 4MABA 2E2GA 5H5QA 4KDUA 3ERGA 14GSA 5A4VA 4ZB7A 3H79A 5FHIA 3CTGA 4ZL9A 2JSYA 4N3ZA 3TKQA 4OFNA 4POBA 4K2DA 3FYGA 3O3TA 4POMA 3WGDA 1V58A 4POLA 2OADA 5EL8A 4G9HA 5ECKB 3TB2A 2YP6A 1EGRA 3N5OA 4TR1A 3WT2A 4POKA 2IMKA 1Y6EA 2GLRA 3G9BA 2C3TA 3UARA 4N10A 2FWFA 2HQTA 4YH2A 5BMUB 3F4RA 2H01A 4WR5A 8GSSA 2E7PA 3M1GA 2PGTA 4CHSA 1X0RA 1SYRA 5B6NA 4MJCA 4KDYA 1MDIA 4G10A 2XBQA 1O7UA 3RPNA 1SL2B 4CY8A 1K0NA 1GULA 1SK1A 1ZCPA 3HYPA 2ZCTA 3RHCA 3L78A 1O8WA 1T8EB 3DXBA 1GH2A 3HCZA 3TJBA 2CZ3A 3NIVA 1YKCA 9GSSA 2HSMB 5E59A 1E2YA 2IN3A 4NMUA 4ILFA 2EIQA 3DGQA 2JADA 1TRUA 3PINA 3GMFA 5A5HB 4YAPA 1XWAA 4Z7XA 1TW9A 4DSSA 2FD3A 1SENA 1ZYQB 3UMAA 4LL1B 3IBHA 3EWLA 3UL3A 2K18A 2BJXA 3QAGA 4PUFC 3A3TA 2VLVA 3KIJA 3LYKA 2O87A 3ZLPA 6GSXA 4WBRD 2R4VA 1PMTA 2V6KA 1AUCA 1ZGNA 1X9SB 3M9JA 2GGTA 2WJUA 3GURA 1GUKA 2VL2C 1TRVA 1XFLA 3FZAA 2WS2A 2ZUPA 3WGXA 2HRFA 1PD21 1X5EA 2B7JA 2FA4A 5C00A 2AYTA 5LCZA 3APSA 2WFCA 3HA9A 4HU7A 5GZZB 2BTOT 2H0GA 4ICYA 1HYUA 3KGKA 3IK9A 1GUHA 3LW9A 5AIXA 2OACA 1GLPA 2H0IA 3ZITA 1EP8A 4XS4A 1T4ZA 2JACA 3TKSC 2CQ9A 3IAS2 4ULXA 3GRXA 1A0FA 1VF3A 3TJFA 1NHOA 4EL1A 1Y25A 5JCGA 1PN0A 2DJ2A 1JZWA 18GSA 4G0KA 4D73B 3HVVA 2I9HA 3LXZA 2IFQB 4PURA 1EV4A 3Q6OA 2NDOA 1TKDB 2R2JA 1OYJA 1PX7A 1KEBA 1QQ2A 2I81A 1PGTA 1QFNA 4CW9A 1CQGA 2CAQA 4MP4A 3FKFA 3KH7A 3HDCA 3FZ9A 3QD9A 13GSA 3ZMKA 1X5DA 4DEJA 2GVPA 5FWGA 5ECNB 3UBLA 1LBKA 2XPDA 3F4TA 4I6XA 4BL7B 4KE3A 1TI3A 5ECSA 5DALA 2K9FA 2LJAA 3VURA 4MF5A 1LJRA 2WRTA 2C0EA 4LMWA 2N5FA 4FO5A 1K3OA 2C8UA 5F05A 4OWYA 3FMWA 1GSEA 3IE3A 5A4UA 4YQUA 1QMVA 2R6KA 4K5RA 1FOVA 2H74A 3LSZA 3A2XA 1BEDA 2EIRA 4GDFA 2YOIA 1UN2A 3EC3A 2HNLA 4IBPA 4TW5A 2IMEA 4FIWA 1KBNA 4EDZA 1SL1B 3VI7A 3F3RA 1U6TA 5IPHA 3VPTA 3MNGA 1XWCA 4LA1A 4KGIA 2H6ZA 3TUEA 1EZKA 3IDVA 3RAZA 4AJ7A 2A2PA 2RLIA 2DKIA 3TOUA 2H6YA 4OO5A 2WB9A 5D73A 1NM3A 2DKHA 3TDGA 4ECCA 2L57A 2N5AA 4IN0A 4IW9A 1BG1A 2LJKA 4XS1A 2MYGA 4JBBA 5IMFA 4NPBA 1I5GA 3E3EA 1PKWA 3ZL5A 4EUYA 5AIVA 3GX8A 3TGZA 4DSSB 3ME8A 1GNWA 5IMCA 5AGYA 1V98A 3I6AA 5HR0A 2HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAY A;  4QQ7 A;  5J4U A;  2Z9S A;  3GTU B;  1M7T A;  2F51 A;  5B6M A;  1PL1 A;  3I9V 2;  2YPM A;  2CX4 A;  3MWH A;  5HR2 A;  2B6M A;  1SKW B;  3G7I A;  4O5R A;  4H86 A;  3VLN A;  4HJ2 A;  2VD0 A;  3LFL A;  1GLQ A;  1MDK A;  1TK5 B;  2GQM A;  2ALB A;  2LJR A;  3TKS E;  3KJY A;  3RPP A;  3K8N A;  4IJ3 A;  1GRX A;  2DJK A;  1W89 A;  2B5Y A;  1M0U A;  3D5J A;  1VRS D;  1K0M A;  3LWA A;  2TIR A;  5GST A;  2P0G A;  1XZO A;  2H72 A;  1YF0 A;  4XS4 B;  5D8I A;  1PSQ A;  5BMU A;  2OJL A;  1K3L A;  1F3B A;  4K7N A;  1A2M A;  5ECR B;  2JZT A;  5JCW A;  1F3A A;  3FEU A;  1MTC A;  2I1U A;  5D96 A;  1JFU A;  3H93 A;  4KDX A;  2GZP A;  1ML6 A;  16GS A;  1A2J A;  3Q19 A;  1SK0 A;  6GSY A;  5AIS A;  4V2L A;  2PMT A;  2R5G A;  1WE0 A;  3A5W A;  1SJZ A;  2M46 A;  1XW6 A;  1GSY A;  1FB0 A;  4HI7 A;  2HSH A;  2YZH A;  2CX3 A;  2D2Z A;  2HSM A;  1FHE A;  4PX1 A;  1DBY A;  3HJO A;  2MMZ A;  5IO2 A;  4DSQ A;  1QK8 A;  5EY6 A;  3GN3 A;  1O8X A;  3OR5 A;  5F07 A;  1KTE A;  1ERV A;  1GTU A;  4RUV A;  4MH2 A;  3GIX A;  2I4A A;  4K6X A;  4L0W A;  2H70 A;  2H1A A;  2PWJ A;  2F8A A;  5CP1 A;  4OD7 A;  1EV9 A;  4GLT A;  3GKM A;  2J23 A;  3VWV A;  4MZB A;  2DJ1 A;  1PL2 A;  4KF9 A;  1Z6N A;  3DRN A;  2H6X A;  1OE7 A;  4MPG A;  3KTB A;  2L6D A;  4KCA A;  1N2A A;  1GSS A;  1BQ7 A;  4BVX B;  1V9W A;  4OFT A;  2IMD A;  2AUV A;  4O32 A;  2IL3 A;  4GWR A;  5JWO B;  1BG5 A;  4ZBA A;  3UJ1 A;  2YWO A;  2HZE B;  4AJ6 A;  3KXO A;  5CRE A;  2DBC A;  1EGO A;  5DCG A;  5DBQ A;  2F9S A;  3U6V A;  1M2A A;  3QAW A;  2YV7 A;  3RBT A;  1WRY A;  1URM A;  2OBK A;  2V6O A;  2ES7 A;  4TR3 A;  4L0U A;  5AN1 A;  1MDJ A;  3O6T A;  4V1A g;  1EWX A;  1ILO A;  3GKK A;  3Q74 A;  3BCK A;  3PR8 A;  3HZ4 A;  4MZC A;  2DLX A;  1F9M A;  5E4W A;  2H71 A;  4BL7 A;  3M8N A;  4KH7 A;  1UVZ A;  1PRX A;  2GQL A;  1ZOF A;  5ELA A;  4PXO A;  4LL4 B;  4FYU A;  1I9D A;  3KCM A;  3O76 A;  2HXK A;  5HR3 A;  5HFG A;  1EEM A;  2P5Q A;  2H8L A;  2OE1 A;  1OKT A;  1ZZY A;  4FYB A;  1FB6 A;  6GST A;  1PA3 A;  4GCI A;  1XOA A;  5DDL A;  4TR4 A;  2G2Q A;  3SWL A;  3UEM A;  1PX6 A;  1M99 A;  1YJ6 A;  4XRA A;  2PN8 A;  5IOW A;  3GV1 A;  4BWQ A;  3BBY A;  3C1S A;  1OC3 A;  4J57 E;  2YWI A;  4X0X A;  4TR0 A;  4MZW A;  2LQO A;  2FWG A;  1AQX A;  3QR6 A;  2F8F A;  2B5X A;  2QSI A;  5CNW A;  3TRP A;  3IAM 2;  5CRH A;  1GSD A;  4PQH A;  3HXS A;  2VCX A;  1XWK A;  4KSM A;  4EC0 A;  3HVS A;  2HLS A;  3WT1 A;  1EOG A;  3HJP A;  3ZIJ A;  1THX A;  2FWE A;  2HZF A;  2TRC P;  4KUN A;  1A23 A;  4PTS A;  1QUW A;  2KHP A;  5D93 A;  3TJK A;  3GSS A;  4DVC A;  1A0R P;  1XIY A;  5G5F A;  1RQM A;  1JLW A;  2EIO A;  2J9H A;  2VL3 A;  4F9Z A;  2RM6 A;  5ECH B;  3APQ A;  3DYR A;  5IO0 A;  4OCF A;  3CYN A;  3GTU A;  2NPB A;  5HR1 A;  3LOR A;  3E0U A;  4JZQ A;  5H5R A;  4Q5R A;  3C1R A;  4ML1 A;  5FT3 A;  3PGT A;  3WGE A;  4MJB A;  1K0O A;  3P2A A;  3APO A;  2HYX A;  2WCI A;  1PKZ A;  3H1N A;  5G1L A;  4EO3 A;  3LG6 A;  3G7Y A;  3F8U A;  1YQ1 A;  1YY7 A;  1MD4 A;  1K0C A;  1J9B A;  2FY6 A;  2LUS A;  1Z5Y E;  3LJR A;  2O89 A;  2VLT A;  3IC4 A;  2C4J A;  5JWQ B;  1MD3 A;  4F0C A;  3N9J A;  1GL8 A;  1Z7P A;  4TVE A;  2X8G A;  1O85 A;  2YJH A;  1GTI A;  5JWR B;  3G7J A;  1HD2 A;  3EE2 A;  1OE8 A;  2NVL A;  2LS5 A;  2VCV A;  4E8E A;  2M80 A;  2H1D A;  1Q98 A;  1H4O A;  4EVM A;  1FVK A;  3TKP A;  1VGL A;  4F82 A;  1HNB A;  5EPF A;  2RUF A;  3CBU A;  1GUM A;  1TDI A;  3GUS A;  4OO4 A;  3IXR A;  2RM5 A;  1C72 A;  4HU9 A;  4V1A p;  2AB6 A;  3M0F A;  2MBS A;  5ABR A;  4ISD A;  4XHM A;  3FY7 A;  4BA7 A;  4G2E A;  3MAK A;  2FGX A;  3TRX A;  3M3M A;  4NV5 A;  2OE3 A;  2L4Q A;  3FZ4 A;  2VL9 A;  3A2V A;  3KZQ A;  1WWJ A;  5HQP A;  2F3M A;  1JHB A;  1XCC A;  2LQQ A;  4HZ4 A;  3CTF A;  1OAZ A;  4G19 A;  4HQS A;  4RQX A;  11GS A;  4Q5F A;  5ECO B;  4I5Q A;  5JCU A;  3VWU A;  1GTB A;  4F03 A;  1BYE A;  2WDU A;  1SK2 A;  2CT6 A;  1YZX A;  1B9X C;  1U3A A;  2I3Y A;  2FWH A;  3RDW A;  5J3R A;  1O81 A;  3LEF A;  5DJM A;  2MMA A;  2RII A;  2OA7 A;  4QL7 A;  1GWC A;  2AHE A;  4K9Z A;  5ECI B;  1U88 A;  1ST9 A;  3TRQ A;  2JSZ A;  4BVX A;  3US3 A;  2JU5 A;  2DIY A;  4ECJ A;  1M2B A;  4F2I A;  3ZRE A;  3L4N A;  4FYC A;  3IR4 A;  3GL5 A;  2AV4 A;  3TJJ A;  5J41 A;  2HZE A;  3E9J B;  1TXX A;  1SL0 B;  2GSS A;  2YAN A;  3QOU A;  1GSF A;  2V41 A;  4WR4 A;  2LNS A;  1T3B A;  3EVI A;  2DSA A;  1H75 A;  1XWB A;  3GFK A;  2GTU A;  2HSN B;  2LV3 A;  3CMI A;  5G2Z A;  1V40 A;  2GST A;  4EXJ A;  2C0D A;  1TP9 A;  1WPI A;  3WYW A;  4WET A;  2R37 A;  4ZIJ A;  3GH9 A;  1SYX A;  3EU3 A;  2KP1 A;  2K8S A;  4JU5 A;  2YJ7 A;  5INY A;  2DJ0 A;  5G30 A;  5CRD A;  3M9K A;  1R5P A;  2R3X A;  2O85 A;  3ZML A;  5CRG A;  1ABA A;  4WF4 A;  3S9F A;  2H76 A;  4IP1 A;  2QGV A;  1V57 A;  2JZS A;  1OKD A;  5DVB A;  5IMA A;  2C80 A;  1JZR A;  2YNX A;  1K0D A;  1TRW A;  3MDK A;  4N11 A;  4G0I A;  1XW9 A;  3CSJ A;  2X8C A;  3IRA A;  4BVY B;  5B8B A;  2PVO C;  3P7X A;  4MJA A;  2X99 A;  3W8S A;  2PU9 C;  2VCZ A;  3KMO A;  1G0T A;  3QCP A;  2HFD A;  5CO3 A;  1AXD A;  5IPG A;  3ZYW A;  1G6Y A;  3VPQ A;  1PQN A;  2LRT A;  1BX9 A;  17GS A;  3IPZ A;  2L4C A;  1EEJ A;  1GSQ A;  3FR3 A;  3DEX A;  1GNE A;  5G1K A;  4K7O A;  2VCT A;  4PGT A;  2DJ3 A;  2C0G A;  2DML A;  1DE1 A;  2L5O A;  3ZFL A;  2JL4 A;  2VD1 A;  4XCS A;  1B8X A;  3PH9 A;  1FO5 A;  5IOX A;  4PNG A;  4EKZ A;  3I69 A;  2O8V B;  5HFK A;  3KD0 A;  4K8M A;  4ZB6 A;  1Z9H A;  2K8V A;  4GF0 A;  3HZ8 A;  4HOJ A;  1X9M B;  4L8E A;  1AAZ A;  4OCE A;  6GSV A;  3IC8 A;  3F6F A;  1WJK A;  1WOU A;  2ON7 A;  4PQ1 A;  4RI7 A;  2HRN A;  4JED A;  3F0I A;  2UZ8 A;  4N30 A;  2NBS A;  4XIH A;  1T1V A;  3WD6 A;  3EMX A;  5ID2 A;  4KA0 A;  5A5K A;  1DUG A;  1U3I A;  3GA4 A;  3UOM A;  2GZZ A;  3EMP A;  1IYH A;  3HY2 A;  1K3Y A;  2CA8 A;  4XRD A;  4EDY A;  2CVK A;  3FR9 A;  3CSH A;  1S3C A;  4ZB9 A;  1RW1 A;  4IVF A;  1M2D A;  2VM2 A;  4HS1 A;  2WZ9 A;  3ERF A;  3KH9 A;  4O7H A;  4CDO A;  5DAK A;  1Z7R A;  2LTK A;  6GSS A;  3KM6 A;  1JZO A;  2GQK A;  3F4S A;  2HI7 A;  5IMZ A;  5DQS A;  1GSU A;  1XXU A;  2FCH A;  4L5O A;  4ML6 A;  1KNG A;  3L0H A;  4TOP A;  4HJM A;  5EVO A;  2TRX A;  1PN9 A;  5A4W A;  1WP0 A;  3C73 A;  4EF0 A;  2HT9 A;  1DE2 A;  3C7M A;  1B4P A;  1AIU A;  2H1G A;  4MPF A;  5ECM B;  3VWW A;  2YCD A;  3KEB A;  1SJ6 A;  2GT5 A;  3Q18 A;  3PPU A;  2H66 A;  1UA5 A;  2B1K A;  2VIM A;  2YWM A;  3D0Z A;  1AW9 A;  5CRW A;  4QL9 A;  2H30 A;  4JRR A;  1G7O A;  3W6G A;  1GTA A;  3HJM A;  2KP2 A;  4WBJ A;  2VCQ A;  19GS A;  1TRS A;  4WF5 A;  1A8Y A;  1B9Y C;  3R3E A;  1ERT A;  4Q5N A;  1YEX A;  1ZMA A;  2AJQ B;  3HKR A;  3BCI A;  4G0L A;  2O7K A;  1S3A A;  2LEG A;  2CZ2 A;  3HD5 A;  1E6B A;  2PBJ A;  1GP1 A;  3CSI A;  1DSB A;  1SJI A;  2VM1 A;  3GHA A;  2JZR A;  3FR6 A;  4KSO A;  2VUP A;  5J9B A;  2FNO A;  1G6W A;  4IP6 A;  3FZ5 A;  1A24 A;  2VCW A;  4AGS A;  1XBS A;  1T7P B;  3FW2 A;  3DD3 A;  2B3S A;  1TJD A;  5KN3 A;  4P3Y B;  4TKY A;  2L6C A;  3UIW A;  1TK8 B;  3QAV A;  5ECP B;  4I8B A;  1QXH A;  4OMV A;  4ZIL A;  2FA8 A;  4MF7 A;  4K7I A;  3HVX A;  1THO A;  3VI5 A;  1ERW A;  4O92 A;  5ELG A;  4JR6 A;  2XPE A;  1V2A A;  1XOB A;  5KEJ A;  3BJ5 A;  2YV9 A;  3BOA A;  4PNF A;  3KP8 A;  1EOH A;  3KP9 A;  4V2N A;  2A4V A;  3I43 A;  4XTS A;  4KW6 A;  1R4W A;  2C3N A;  2CV4 A;  1TK0 B;  2M72 A;  3IHQ A;  3DVX A;  5GSS A;  4EE0 A;  12GS A;  4OFM A;  2X8H A;  3VFI A;  1IYI A;  3L9S A;  4GTU A;  2B7K A;  3JCM L;  1LU4 A;  1HNA A;  5ID2 B;  3GH6 A;  3GX0 A;  2ZNM A;  3LGC A;  1M9B A;  3ZTL A;  3IK7 A;  2MBT A;  1RK4 A;  4IQA A;  4TXO B;  1AC1 A;  1XVW A;  3LQ7 A;  2XHF A;  3UBK A;  3F3Q A;  3DKS A;  1AQW A;  2LNT A;  4BVY A;  2GZY A;  4YQV A;  4HDE A;  3SBC A;  4NHZ A;  2B5E A;  2V32 A;  4IHU A;  4MK3 A;  2IMI A;  4IS0 A;  4ID0 A;  4E8H A;  2P5R A;  3D4M A;  4IEL A;  5DAK B;  3NZN A;  2H1B A;  5CAX A;  2GSQ A;  2PER A;  2N5B A;  5D9V A;  3CXG A;  2HSY A;  3TCO A;  3QDN A;  4MCU A;  2NTO A;  2CVB A;  1WIK A;  2KOK A;  4V2M A;  4MDC A;  1EP7 A;  1F6M C;  4I2T A;  4YQM A;  5IMD A;  4WEY A;  4NWY A;  2LRN A;  1TTZ A;  2VOC A;  2CVD A;  2YWN A;  4HQZ A;  1F37 A;  5KN2 A;  3LXT A;  2HRA A;  4IKH A;  4GSS A;  3BD2 A;  3ERW A;  5G5E A;  3ZRD A;  4WXT A;  2A2R A;  4NXI A;  2X64 A;  3F63 A;  3DML A;  4LLR A;  5D9T A;  3ZFB A;  4L5L A;  3U5R E;  2GT6 A;  3FHK A;  10GS A;  4GSN A;  5LD0 A;  2REM A;  2C3Q A;  4YAV A;  2H73 A;  1FG4 A;  1ACV A;  4IJI A;  3AY8 A;  4K0G A;  4KX4 A;  1XW5 A;  2AAW A;  2MMO A;  2H0H A;  2V1M A;  1O73 A;  2BMX A;  4KND A;  4I97 A;  1TU7 A;  1SKR B;  1CQH A;  5H5S A;  2G0F A;  2PVQ A;  2IIY A;  1A8L A;  4MLY A;  1YF1 A;  2FUG 2;  1A2L A;  1T00 A;  1B48 A;  4TR1 B;  1ZL9 A;  3CRU A;  4N0Z A;  3QMX A;  2GSR A;  1VF1 A;  3ZIV A;  3ZZX A;  3EU4 A;  7GSS A;  2LST A;  2IPA A;  3D21 A;  1SU9 A;  2KUC A;  2QC7 A;  2H19 A;  1O6J A;  1K0A A;  4IQ1 A;  3GL3 A;  2HRK A;  1ON4 A;  3ISO A;  3W8J A;  4WKW A;  2E2M A;  5GAP D;  2IMF A;  1YDK A;  2VAF A;  3CRT A;  2GDR A;  1T4Y A;  4J56 E;  2DIZ A;  4DSR A;  1FW1 A;  3GKX A;  4NHW A;  3LYP A;  1N8J A;  1AQV A;  3DIE A;  1WMJ A;  4HUA A;  2VLU A;  2DMM A;  4BPY A;  2P31 A;  4XS6 A;  4ZB8 A;  1ERU A;  1J0F A;  4F0B A;  2PUK C;  4KAE A;  4ZBB A;  4GRF A;  5F06 A;  2PPT A;  1OC9 A;  4HZ2 A;  3IOS A;  1NW2 A;  4IGJ A;  2FLS A;  3GNJ A;  3UAP A;  4NAX A;  1W4V A;  1USB A;  4BWS A;  3FRC A;  4FH8 A;  3C71 A;  4FQU A;  1OC8 A;  2V2G A;  1XVQ A;  2FHE A;  1SD8 A;  3ED3 A;  2L59 A;  4RI6 A;  2C1Y A;  5LNK e;  3GST A;  1YEP A;  5B8A A;  1VF4 A;  3P90 A;  6GSW A;  1F2E A;  3QFA C;  4TN8 A;  4MMM A;  5G31 A;  3FK8 A;  1R7H A;  1Z6M A;  2GS3 A;  1VF2 A;  1K0B A;  4TXV A;  2L5L A;  4X1U A;  1QGV A;  5D9X A;  3DWV A;  4K0N A;  3UVH A;  1XWG A;  2E0Q A;  2K6V A;  1NHY A;  2OE0 A;  3TJG A;  4ZXG A;  5COH A;  2KLX A;  3D4T A;  3EIN A;  4MF6 A;  4AF2 A;  2EC4 A;  4ZBD A;  1JLV A;  1SD9 A;  2VO4 A;  1HQO A;  5KN0 A;  1R26 A;  1S3D A;  3QPM A;  4N0V A;  3A2W A;  3MSZ A;  1J08 A;  1TU8 A;  3C8E A;  1X9W B;  2A2S A;  3H4K A;  4ZL7 A;  5KN1 A;  5D9W A;  1Z3E A;  3GKN A;  5ECQ B;  3F6D A;  4JR4 A;  3ZVJ D;  3KMN A;  3KTL A;  5IQY A;  2IWT A;  3D6I A;  4J2F A;  1HNC A;  4NV2 A;  3D22 A;  2C0F A;  1YKA A;  3H8Q A;  1Q4J A;  5GAN D;  3IA1 A;  1G7E A;  1SKS B;  2OKA A;  5B7C A;  2WUL A;  5IIZ A;  2QKE A;  3L9V A;  1BJX A;  5DAL B;  3EYT A;  4KCE A;  4MA9 A;  4RQR A;  1JZD A;  1TI1 A;  4AJ8 A;  4TRX A;  1FVJ A;  5IMV A;  1UC7 A;  4ZL8 A;  5DQY A;  5DJL A;  2RUE A;  4HEA 2;  5DCH A;  3IV4 A;  5J5N A;  2XC2 A;  5J9C A;  2OBI A;  4TXO A;  20GS A;  3F9U A;  3R2Q A;  4GQF A;  4USS A;  5CYY A;  1FAA A;  5F0G A;  1R5A A;  4GQC A;  4GST A;  2MMN A;  5L71 A;  3V1W A;  2HRK B;  4PQI A;  4MH3 A;  4ECI A;  4K1F A;  1OVN A;  3RHB A;  3J7Y k;  3EUR A;  2YZU A;  4I2U A;  2LKU A;  1XPV A;  2YN1 A;  5C04 A;  2IJY A;  2XBI A;  3HHV A;  3VK9 A;  5HFI A;  1TOF A;  1ZYE A;  3TKR A;  3P8W A;  1U87 A;  22GS A;  3NOF A;  3QFB C;  2DJJ A;  3DVW A;  1M9A A;  1X5C A;  2VL2 A;  2B1L A;  2H75 A;  3J7Y b;  4ECB A;  3VWX A;  4D73 A;  1MEK A;  5ENU A;  4Q5Q A;  1OC9 B;  2IFQ A;  3L9U A;  4KB3 A;  1B4Q A;  2WGR A;  4MJE A;  3ME7 A;  5F8B A;  4GXZ A;  4JE1 A;  4ACS A;  2DC5 A;  3ZVJ A;  2ON5 A;  2LRC A;  3TOT A;  6GSU A;  5ECL B;  2CAI A;  4X43 A;  3UVT A;  1NSW A;  4LMV A;  5IM9 A;  3TKS A;  4PUA A;  3GYK A;  2MZC A;  4MAB A;  2E2G A;  5H5Q A;  4KDU A;  3ERG A;  14GS A;  5A4V A;  3H79 A;  5FHI A;  3CTG A;  4ZL9 A;  2JSY A;  3TKQ A;  4OFN A;  4POB A;  4K2D A;  3FYG A;  3O3T A;  4POM A;  3WGD A;  1V58 A;  4POL A;  2OAD A;  5EL8 A;  4G9H A;  5ECK B;  3TB2 A;  2YP6 A;  1EGR A;  3N5O A;  4TR1 A;  3WT2 A;  4POK A;  2IMK A;  1Y6E A;  2GLR A;  3G9B A;  2C3T A;  3UAR A;  4N10 A;  2FWF A;  2HQT A;  4YH2 A;  3F4R A;  2H01 A;  4WR5 A;  8GSS A;  2E7P A;  3M1G A;  2PGT A;  4CHS A;  1X0R A;  1SYR A;  5B6N A;  4MJC A;  4KDY A;  1MDI A;  4G10 A;  2XBQ A;  1O7U A;  3RPN A;  1SL2 B;  1K0N A;  1GUL A;  1SK1 A;  1ZCP A;  3HYP A;  2ZCT A;  3RHC A;  3L78 A;  1O8W A;  1T8E B;  3DXB A;  1GH2 A;  3HCZ A;  3TJB A;  2CZ3 A;  3NIV A;  1YKC A;  9GSS A;  2HSM B;  5E59 A;  1E2Y A;  2IN3 A;  4NMU A;  4ILF A;  2EIQ A;  3DGQ A;  2JAD A;  1TRU A;  3PIN A;  3GMF A;  4YAP A;  1XWA A;  4Z7X A;  1TW9 A;  4DSS A;  2FD3 A;  1SEN A;  1ZYQ B;  3UMA A;  4LL1 B;  3IBH A;  3EWL A;  3UL3 A;  2K18 A;  2BJX A;  3QAG A;  4PUF C;  3A3T A;  2VLV A;  3KIJ A;  3LYK A;  2O87 A;  3ZLP A;  6GSX A;  4WBR D;  2R4V A;  1PMT A;  2V6K A;  1AUC A;  1ZGN A;  1X9S B;  3M9J A;  2GGT A;  2WJU A;  3GUR A;  1GUK A;  2VL2 C;  1TRV A;  1XFL A;  3FZA A;  2WS2 A;  2ZUP A;  3WGX A;  2HRF A;  1PD2 1;  1X5E A;  2B7J A;  2FA4 A;  5C00 A;  2AYT A;  5LCZ A;  3APS A;  2WFC A;  3HA9 A;  4HU7 A;  5GZZ B;  2BTO T;  2H0G A;  1HYU A;  3KGK A;  3IK9 A;  1GUH A;  5AIX A;  2OAC A;  1GLP A;  2H0I A;  3ZIT A;  1EP8 A;  4XS4 A;  1T4Z A;  2JAC A;  3TKS C;  2CQ9 A;  3IAS 2;  4ULX A;  3GRX A;  1A0F A;  1VF3 A;  3TJF A;  1NHO A;  4EL1 A;  1Y25 A;  5JCG A;  2DJ2 A;  1JZW A;  18GS A;  4G0K A;  4D73 B;  3HVV A;  2I9H A;  3LXZ A;  2IFQ B;  4PUR A;  1EV4 A;  3Q6O A;  2NDO A;  1TKD B;  2R2J A;  1OYJ A;  1PX7 A;  1KEB A;  1QQ2 A;  2I81 A;  1PGT A;  1QFN A;  4CW9 A;  1CQG A;  2CAQ A;  4MP4 A;  3FKF A;  3KH7 A;  3HDC A;  3FZ9 A;  3QD9 A;  13GS A;  3ZMK A;  1X5D A;  4DEJ A;  2GVP A;  5FWG A;  5ECN B;  3UBL A;  1LBK A;  2XPD A;  3F4T A;  4I6X A;  4BL7 B;  4KE3 A;  1TI3 A;  5ECS A;  5DAL A;  2K9F A;  2LJA A;  3VUR A;  4MF5 A;  1LJR A;  2WRT A;  2C0E A;  4LMW A;  2N5F A;  4FO5 A;  1K3O A;  2C8U A;  5F05 A;  4OWY A;  1GSE A;  3IE3 A;  5A4U A;  4YQU A;  1QMV A;  2R6K A;  1FOV A;  2H74 A;  3LSZ A;  3A2X A;  1BED A;  2EIR A;  2YOI A;  1UN2 A;  3EC3 A;  2HNL A;  4IBP A;  4TW5 A;  2IME A;  4FIW A;  1KBN A;  4EDZ A;  1SL1 B;  3VI7 A;  3F3R A;  1U6T A;  5IPH A;  3VPT A;  3MNG A;  1XWC A;  4LA1 A;  4KGI A;  2H6Z A;  3TUE A;  1EZK A;  3IDV A;  3RAZ A;  4AJ7 A;  2RLI A;  3TOU A;  2H6Y A;  4OO5 A;  2WB9 A;  5D73 A;  1NM3 A;  3TDG A;  4ECC A;  2L57 A;  2N5A A;  4IN0 A;  4IW9 A;  2LJK A;  4XS1 A;  2MYG A;  4JBB A;  5IMF A;  4NPB A;  1I5G A;  3E3E A;  1PKW A;  3ZL5 A;  4EUY A;  5AIV A;  3GX8 A;  3TGZ A;  4DSS B;  3ME8 A;  1GNW A;  5IMC A;  5AGY A;  1V98 A;  3I6A A;  5HR0 A;  2HE3 A; 
#chains in the Genus database with same CATH topology
 1BAY A;  4QQ7 A;  5J4U A;  2Z9S A;  3GTU B;  1M7T A;  2F51 A;  5B6M A;  2O3E A;  1PL1 A;  3I9V 2;  2YPM A;  2CX4 A;  3MWH A;  5HR2 A;  2B6M A;  1SKW B;  3G7I A;  4O5R A;  4CY6 A;  4H86 A;  3VLN A;  4HJ2 A;  2VD0 A;  3LFL A;  1GLQ A;  1MDK A;  4G01 A;  1TK5 B;  2GQM A;  2ALB A;  2LJR A;  3TKS E;  3KJY A;  3RPP A;  3K8N A;  4IJ3 A;  1GRX A;  2DJK A;  1W89 A;  1S4B P;  2B5Y A;  1M0U A;  3D5J A;  2WVX B;  1VRS D;  1K0M A;  3LWA A;  2TIR A;  5GST A;  2P0G A;  1XZO A;  2H72 A;  1YF0 A;  4XS4 B;  5D8I A;  1PSQ A;  5BMU A;  2OJL A;  1K3L A;  1F3B A;  4K7N A;  1A2M A;  5ECR B;  2JZT A;  5JCW A;  1F3A A;  3FEU A;  4EIQ A;  1MTC A;  2I1U A;  5D96 A;  1JFU A;  3H93 A;  4KDX A;  2GZP A;  1ML6 A;  16GS A;  1A2J A;  3Q19 A;  1SK0 A;  6GSY A;  5AIS A;  4V2L A;  2PMT A;  2R5G A;  1WE0 A;  3A5W A;  1SJZ A;  2M46 A;  1XW6 A;  1GSY A;  1FB0 A;  4HI7 A;  2HSH A;  2YZH A;  2CX3 A;  2D2Z A;  2HSM A;  1S3R A;  1FHE A;  4PX1 A;  1DBY A;  3HJO A;  2MMZ A;  5IO2 A;  4DSQ A;  1QK8 A;  5EY6 A;  3GN3 A;  5A5H A;  1Y1U A;  1O8X A;  3OR5 A;  5F07 A;  1KTE A;  4A5P A;  1ERV A;  1GTU A;  4AI6 A;  4RUV A;  2A4H A;  4MH2 A;  2WVY A;  3GIX A;  2I4A A;  4K6X A;  4L0W A;  2H70 A;  2H1A A;  2PWJ A;  2F8A A;  5CP1 A;  4OD7 A;  1EV9 A;  4GLT A;  3GKM A;  2J23 A;  3VWV A;  4MZB A;  2DJ1 A;  1PL2 A;  4KF9 A;  1Z6N A;  3DRN A;  2H6X A;  1OE7 A;  4MPG A;  3KTB A;  2L6D A;  4KCA A;  1N2A A;  1GSS A;  1BQ7 A;  4BVX B;  1V9W A;  4OFT A;  2IMD A;  2AUV A;  4O32 A;  2IL3 A;  4GWR A;  5JWO B;  1BG5 A;  4ZBA A;  3UJ1 A;  2YWO A;  2HZE B;  4AJ6 A;  3KXO A;  5CRE A;  2DBC A;  1EGO A;  5DCG A;  5DBQ A;  2F9S A;  3U6V A;  1M2A A;  3QAW A;  2YV7 A;  3RBT A;  1WRY A;  1URM A;  2OBK A;  4EIP A;  2V6O A;  2ES7 A;  4TR3 A;  2OT3 A;  4L0U A;  5AN1 A;  1MDJ A;  3O6T A;  4V1A g;  5KOX A;  1EWX A;  1ILO A;  3GKK A;  3Q74 A;  3BCK A;  3PR8 A;  3HZ4 A;  4MZC A;  2DLX A;  1F9M A;  5E4W A;  2H71 A;  4BL7 A;  3M8N A;  4KH7 A;  1UVZ A;  1PRX A;  2GQL A;  1ZOF A;  5ELA A;  4PXO A;  4LL4 B;  4FYU A;  1I9D A;  3KCM A;  3HMJ G;  3O76 A;  2HXK A;  5HR3 A;  5HFG A;  1EEM A;  4O5Q A;  2P5Q A;  2H8L A;  2OE1 A;  1OKT A;  1ZZY A;  4FYB A;  1FB6 A;  6GST A;  1PA3 A;  4GCI A;  1XOA A;  5DDL A;  4TR4 A;  2G2Q A;  3SWL A;  3UEM A;  4AKH A;  1PX6 A;  1M99 A;  1YJ6 A;  4XRA A;  2PN8 A;  5IOW A;  3GV1 A;  4BWQ A;  2WW3 A;  3BBY A;  3C1S A;  1OC3 A;  4J57 E;  2YWI A;  4X0X A;  4TR0 A;  4MZW A;  2LQO A;  2EFC A;  2FWG A;  1AQX A;  3QR6 A;  2F8F A;  2B5X A;  2QSI A;  5CNW A;  3TRP A;  3IAM 2;  5CRH A;  1GSD A;  4PQH A;  3HXS A;  2VCX A;  1XWK A;  4KSM A;  4EC0 A;  3HVS A;  2HLS A;  3WT1 A;  1EOG A;  3HJP A;  1N25 A;  3ZIJ A;  1THX A;  2FWE A;  2HZF A;  2TRC P;  4KUN A;  1A23 A;  4PTS A;  1QUW A;  2KHP A;  5D93 A;  3TJK A;  3GSS A;  4DVC A;  1A0R P;  1XIY A;  5G5F A;  1RQM A;  1JLW A;  2EIO A;  2J9H A;  2VL3 A;  4F9Z A;  2RM6 A;  5ECH B;  2WW0 A;  3APQ A;  2HSN A;  3DYR A;  5IO0 A;  4OCF A;  3CYN A;  5J40 A;  5A1N B;  3GTU A;  2NPB A;  5HR1 A;  3LOR A;  3E0U A;  4JZQ A;  5H5R A;  4Q5R A;  3C1R A;  4ML1 A;  5FT3 A;  1BF5 A;  3PGT A;  3WGE A;  4MJB A;  1K0O A;  3P2A A;  3APO A;  2HYX A;  2WCI A;  1PKZ A;  3H1N A;  5G1L A;  4EO3 A;  2R0P A;  3LG6 A;  3G7Y A;  3F8U A;  1YQ1 A;  1YY7 A;  1MD4 A;  1K0C A;  1J9B A;  2FY6 A;  2LUS A;  1Z5Y E;  3LJR A;  2O89 A;  2VLT A;  3IC4 A;  2C4J A;  5JWQ B;  1MD3 A;  4F0C A;  3N9J A;  1GL8 A;  1Z7P A;  4TVE A;  2X8G A;  1O85 A;  2YJH A;  1GTI A;  5JWR B;  3G7J A;  1HD2 A;  3EE2 A;  1OE8 A;  2NVL A;  2LS5 A;  2VCV A;  4E8E A;  2M80 A;  2H1D A;  1Q98 A;  1H4O A;  1ZYP A;  4EVM A;  1FVK A;  2QA2 A;  3TKP A;  1VGL A;  4F82 A;  1HNB A;  5EPF A;  2RUF A;  3CBU A;  1GUM A;  1TDI A;  3GUS A;  4OO4 A;  3IXR A;  1SVL A;  2R0G A;  2RM5 A;  1C72 A;  4HU9 A;  4V1A p;  2AB6 A;  3A5I A;  3M0F A;  2MBS A;  5ABR A;  4ISD A;  4XHM A;  3FY7 A;  4BA7 A;  4G2E A;  3MAK A;  2FGX A;  3TRX A;  3M3M A;  4NV5 A;  2OE3 A;  2L4Q A;  3FZ4 A;  2VL9 A;  3A2V A;  3KZQ A;  1WWJ A;  5HQP A;  2F3M A;  1JHB A;  1XCC A;  2LQQ A;  4HZ4 A;  3CTF A;  1OAZ A;  4G19 A;  2EFH A;  4HQS A;  4RQX A;  11GS A;  4Q5F A;  5ECO B;  4I5Q A;  5JCU A;  3VWU A;  1GTB A;  4F03 A;  1BYE A;  4PI2 C;  2WDU A;  2X4A A;  1SK2 A;  2CT6 A;  1YZX A;  1B9X C;  1U3A A;  2I3Y A;  2FWH A;  3RGB C;  3RDW A;  5J3R A;  1O81 A;  3LEF A;  1SVM A;  5DJM A;  2MMA A;  2RII A;  2OA7 A;  4QL7 A;  1GWC A;  2AHE A;  4K9Z A;  5ECI B;  1U88 A;  1ST9 A;  3TRQ A;  2JSZ A;  4BVX A;  3US3 A;  2JU5 A;  2DIY A;  4ECJ A;  1M2B A;  4F2I A;  3ZRE A;  3L4N A;  4FYC A;  3IR4 A;  2WZS A;  1I1I P;  3GL5 A;  2AV4 A;  3TJJ A;  2VKZ G;  5J41 A;  3TU3 B;  2HZE A;  3E9J B;  1TXX A;  1SL0 B;  2GSS A;  2YAN A;  3QOU A;  1GSF A;  2V41 A;  4WR4 A;  2LNS A;  1T3B A;  3EVI A;  2DSA A;  1H75 A;  1XWB A;  3RFR C;  3GFK A;  2GTU A;  2HSN B;  2LV3 A;  3CMI A;  5G2Z A;  1V40 A;  2GST A;  2EFE A;  4EXJ A;  2C0D A;  1TP9 A;  1WPI A;  3WYW A;  4WET A;  2R37 A;  4ZIJ A;  3GH9 A;  1SYX A;  3EU3 A;  2KP1 A;  2K8S A;  4JU5 A;  2YJ7 A;  5INY A;  2DJ0 A;  5G30 A;  5CRD A;  3M9K A;  1R5P A;  2R3X A;  2O85 A;  3ZML A;  5CRG A;  1ABA A;  4WF4 A;  3S9F A;  2H76 A;  4IP1 A;  2QGV A;  1V57 A;  2JZS A;  1OKD A;  5DVB A;  5IMA A;  2C80 A;  1JZR A;  2YNX A;  1K0D A;  1TRW A;  3MDK A;  4N11 A;  4G0I A;  1XW9 A;  3CSJ A;  2X8C A;  3IRA A;  4BVY B;  5B8B A;  2PVO C;  3P7X A;  4MJA A;  2X99 A;  3W8S A;  2PU9 C;  2VCZ A;  3KMO A;  1G0T A;  3QCP A;  2HFD A;  5CO3 A;  1AXD A;  5IPG A;  3ZYW A;  1G6Y A;  3VPQ A;  1PQN A;  2LRT A;  2UV8 G;  1BX9 A;  17GS A;  3IPZ A;  2L4C A;  1EEJ A;  1GSQ A;  3FR3 A;  3DEX A;  1GNE A;  5G1K A;  4K7O A;  2VCT A;  4PGT A;  2DJ3 A;  2C0G A;  2DML A;  5J4V A;  1DE1 A;  2L5O A;  3ZFL A;  2JL4 A;  2VD1 A;  4XCS A;  1B8X A;  3PH9 A;  1FO5 A;  5IOX A;  4PNG A;  4EKZ A;  3I69 A;  2O8V B;  5HFK A;  3KD0 A;  4K8M A;  4ZB6 A;  1Z9H A;  2K8V A;  4GF0 A;  3HZ8 A;  4HOJ A;  1X9M B;  4L8E A;  1AAZ A;  4OCE A;  4Z2U A;  6GSV A;  5KOW A;  3IC8 A;  3F6F A;  1WJK A;  4PI0 C;  1WOU A;  2ON7 A;  5A1N A;  4PQ1 A;  4RI7 A;  2HRN A;  4JED A;  3F0I A;  2UZ8 A;  4N30 A;  2NBS A;  4XIH A;  1T1V A;  3WD6 A;  3EMX A;  5ID2 A;  4KA0 A;  5A5K A;  1DUG A;  1U3I A;  3GA4 A;  3UOM A;  2GZZ A;  3EMP A;  1IYH A;  3HY2 A;  1K3Y A;  2CA8 A;  4XRD A;  4EDY A;  4K5S A;  2CVK A;  3FR9 A;  2QA1 A;  3CSH A;  1S3C A;  4ZB9 A;  1RW1 A;  4IVF A;  1M2D A;  2VM2 A;  2WZ9 A;  4HS1 A;  3ERF A;  1M3J A;  3KH9 A;  4O7H A;  4CDO A;  5DAK A;  1Z7R A;  2LTK A;  6GSS A;  3KM6 A;  1JZO A;  2GQK A;  3F4S A;  2HI7 A;  5IMZ A;  5DQS A;  1GSU A;  1XXU A;  2FCH A;  4L5O A;  4ML6 A;  1KNG A;  3L0H A;  4TOP A;  4HJM A;  5EVO A;  2O5V A;  2TRX A;  1PN9 A;  5A4W A;  1WP0 A;  3C73 A;  3MIX A;  4EF0 A;  2HT9 A;  1DE2 A;  3C7M A;  1B4P A;  1AIU A;  2H1G A;  4MPF A;  5ECM B;  3VWW A;  2YCD A;  3KEB A;  1SJ6 A;  2GT5 A;  3EPT A;  3Q18 A;  3PPU A;  2H66 A;  1UA5 A;  2B1K A;  2VIM A;  2YWM A;  3D0Z A;  1AW9 A;  5CRW A;  4QL9 A;  2H30 A;  4JRR A;  1G7O A;  3W6G A;  1GTA A;  1PFO A;  3HJM A;  2KP2 A;  4WBJ A;  2VCQ A;  19GS A;  1TRS A;  4WF5 A;  1A8Y A;  1B9Y C;  3R3E A;  1ERT A;  4Q5N A;  1YEX A;  1ZMA A;  2AJQ B;  3HKR A;  3BCI A;  4G0L A;  2O7K A;  1S3A A;  2LEG A;  2CZ2 A;  3HD5 A;  1E6B A;  2PBJ A;  1GP1 A;  3CSI A;  1DSB A;  1SJI A;  4E68 A;  2VM1 A;  3GHA A;  2JZR A;  3FR6 A;  4KSO A;  2VUP A;  5J9B A;  2FNO A;  1G6W A;  4IP6 A;  3FZ5 A;  1A24 A;  2VCW A;  4AGS A;  1XBS A;  1T7P B;  3FW2 A;  3DD3 A;  2B3S A;  1TJD A;  5KN3 A;  4P3Y B;  4MNN A;  4TKY A;  2L6C A;  1FOH A;  3UIW A;  1TK8 B;  3QAV A;  5ECP B;  4I8B A;  1QXH A;  4OMV A;  4ZIL A;  2FA8 A;  4MF7 A;  4K7I A;  3HVX A;  1THO A;  3VI5 A;  1ERW A;  4O92 A;  5ELG A;  4JR6 A;  2XPE A;  1V2A A;  1XOB A;  5KEJ A;  3BJ5 A;  2YV9 A;  3BOA A;  4PNF A;  3KP8 A;  1EOH A;  3KP9 A;  4V2N A;  2A4V A;  3I43 A;  4XTS A;  4KW6 A;  1R4W A;  2C3N A;  2CV4 A;  1TK0 B;  2M72 A;  3IHQ A;  3DVX A;  5GSS A;  4EE0 A;  12GS A;  4OFM A;  2X8H A;  3VFI A;  1IYI A;  3L9S A;  4GTU A;  5J4Y A;  2B7K A;  3IHG A;  3JCM L;  4Z2R A;  1LU4 A;  1HNA A;  5ID2 B;  4AKX B;  3GH6 A;  3GX0 A;  1TXU A;  2ZNM A;  3LGC A;  1M9B A;  3ZTL A;  1SVO A;  3IK7 A;  4FXY P;  2MBT A;  1RK4 A;  4IQA A;  4TXO B;  1AC1 A;  1XVW A;  3LQ7 A;  2XHF A;  3UBK A;  3MYD A;  3F3Q A;  3DKS A;  1AQW A;  2LNT A;  4BVY A;  2GZY A;  4YQV A;  4HDE A;  3SBC A;  4NHZ A;  2B5E A;  2V32 A;  4IHU A;  4MK3 A;  2IMI A;  4IS0 A;  4ID0 A;  4E8H A;  2P5R A;  3D4M A;  4IEL A;  5DAK B;  3NZN A;  2H1B A;  5BRT A;  5CAX A;  2GSQ A;  2PER A;  2N5B A;  5D9V A;  2H1L A;  3CXG A;  2HSY A;  3TCO A;  3QDN A;  4MCU A;  2NTO A;  2CVB A;  1WIK A;  2KOK A;  4V2M A;  4MDC A;  5A34 B;  1EP7 A;  1F6M C;  4I2T A;  4YQM A;  5IMD A;  4WEY A;  4NWY A;  2LRN A;  1TTZ A;  2VOC A;  1YVL A;  2CVD A;  2YWN A;  4HQZ A;  1F37 A;  5KN2 A;  3LXT A;  2HRA A;  4IKH A;  4GSS A;  3BD2 A;  5J47 A;  3ERW A;  5G5E A;  3ZRD A;  4WXT A;  2A2R A;  4NXI A;  2X64 A;  3F63 A;  3DML A;  4LLR A;  5D9T A;  3ZFB A;  4L5L A;  3U5R E;  2GT6 A;  3FHK A;  10GS A;  4GSN A;  5LD0 A;  2REM A;  2C3Q A;  4YAV A;  2H73 A;  1FG4 A;  1ACV A;  4IJI A;  3AY8 A;  4K0G A;  4KX4 A;  1XW5 A;  2AAW A;  2MMO A;  2H0H A;  2V1M A;  1O73 A;  2BMX A;  4KND A;  4I97 A;  4BIK A;  4AKI A;  4W66 A;  1TU7 A;  1SKR B;  1CQH A;  5H5S A;  2G0F A;  2PVQ A;  2IIY A;  1A8L A;  4MLY A;  1YF1 A;  2FUG 2;  1A2L A;  1T00 A;  1B48 A;  4TR1 B;  1ZL9 A;  3CRU A;  4N0Z A;  3QMX A;  2GSR A;  1VF1 A;  3ZIV A;  3ZZX A;  3EU4 A;  7GSS A;  2LST A;  2IPA A;  3D21 A;  1SU9 A;  2KUC A;  2QC7 A;  2H19 A;  1O6J A;  1K0A A;  4IQ1 A;  3GL3 A;  2HRK A;  1ON4 A;  3ISO A;  3W8J A;  4WKW A;  2E2M A;  5GAP D;  2IMF A;  1YDK A;  2VAF A;  3CRT A;  2O36 A;  2GDR A;  1T4Y A;  4J56 E;  2DIZ A;  4DSR A;  1FW1 A;  3GKX A;  4NHW A;  3LYP A;  1N8J A;  1AQV A;  3DIE A;  4X4J A;  1WMJ A;  4HUA A;  2VLU A;  2DMM A;  4BPY A;  2P31 A;  4XS6 A;  4ZB8 A;  1ERU A;  1J0F A;  4F0B A;  2PUK C;  4KAE A;  4ZBB A;  4GRF A;  5F06 A;  2PPT A;  1OC9 A;  4QMK A;  4HZ2 A;  3IOS A;  1NW2 A;  4IGJ A;  2FLS A;  3GNJ A;  3UAP A;  4NAX A;  1W4V A;  1USB A;  4BWS A;  3FRC A;  4FH8 A;  3C71 A;  4FQU A;  1OC8 A;  2V2G A;  1XVQ A;  2FHE A;  1SD8 A;  3ED3 A;  2L59 A;  4RI6 A;  2C1Y A;  5LNK e;  3GST A;  1YEP A;  5B8A A;  1VF4 A;  3P90 A;  6GSW A;  4PHZ C;  1F2E A;  3QFA C;  4TN8 A;  4MMM A;  5G31 A;  3FK8 A;  1R7H A;  1Z6M A;  2GS3 A;  1VF2 A;  1K0B A;  4TXV A;  2L5L A;  4X1U A;  1QGV A;  5D9X A;  3DWV A;  4K0N A;  3UVH A;  1XWG A;  2E0Q A;  2K6V A;  1NHY A;  2OE0 A;  3TJG A;  4ZXG A;  5COH A;  2KLX A;  3D4T A;  3EIN A;  4MF6 A;  4AF2 A;  2EC4 A;  4ZBD A;  1JLV A;  1SD9 A;  2VO4 A;  1ZYN A;  1HQO A;  5KN0 A;  1R26 A;  1S3D A;  3QPM A;  4N0V A;  4AKG A;  3A2W A;  3MSZ A;  1J08 A;  1TU8 A;  3C8E A;  3CHX C;  1X9W B;  2A2S A;  3H4K A;  4ZL7 A;  5KN1 A;  5D9W A;  1Z3E A;  3GKN A;  4YKG A;  5ECQ B;  3F6D A;  4JR4 A;  4K2X A;  3ZVJ D;  3KMN A;  3KTL A;  5IQY A;  2IWT A;  3D6I A;  4J2F A;  1HNC A;  4NV2 A;  3D22 A;  2C0F A;  1YKA A;  3H8Q A;  1Q4J A;  5GAN D;  3IA1 A;  1G7E A;  1SKS B;  2OKA A;  5B7C A;  2WUL A;  5IIZ A;  2QKE A;  4YKF A;  3L9V A;  1BJX A;  5DAL B;  1M3I A;  3EYT A;  4KCE A;  4MA9 A;  4RQR A;  1JZD A;  1TI1 A;  2WW1 A;  4AJ8 A;  4TRX A;  1FVJ A;  5IMV A;  1UC7 A;  4ZL8 A;  4Z2T A;  5DQY A;  5DJL A;  4O5U A;  2RUE A;  4HEA 2;  5DCH A;  3IV4 A;  5J5N A;  2XC2 A;  5J9C A;  3CQF A;  2OBI A;  4TXO A;  20GS A;  3F9U A;  3R2Q A;  4GQF A;  4USS A;  5CYY A;  1FAA A;  5F0G A;  1R5A A;  4GQC A;  4GST A;  2MMN A;  5L71 A;  2X49 A;  3V1W A;  2HRK B;  4PQI A;  4MH3 A;  4ECI A;  4K1F A;  1OVN A;  3RHB A;  2EFD A;  3J7Y k;  3EUR A;  2YZU A;  4I2U A;  2LKU A;  2R0C A;  1XPV A;  2YN1 A;  5C04 A;  2IJY A;  5A34 A;  2XBI A;  3HHV A;  3VK9 A;  5HFI A;  1TOF A;  1ZYE A;  3TKR A;  3P8W A;  1U87 A;  22GS A;  3NOF A;  3QFB C;  2DJJ A;  3DVW A;  1M9A A;  1X5C A;  2VL2 A;  2B1L A;  2H75 A;  3J7Y b;  4ECB A;  3VWX A;  4D73 A;  1MEK A;  5ENU A;  4Q5Q A;  3CWG A;  1OC9 B;  2IFQ A;  3L9U A;  4KB3 A;  1B4Q A;  2WGR A;  4MJE A;  3ME7 A;  5F8B A;  4GXZ A;  4JE1 A;  4ACS A;  2DC5 A;  3ZVJ A;  2ON5 A;  2LRC A;  3TOT A;  6GSU A;  5ECL B;  2CAI A;  4X43 A;  3UVT A;  1NSW A;  4LMV A;  5IM9 A;  3TKS A;  4PUA A;  3GYK A;  2MZC A;  4MAB A;  2E2G A;  5H5Q A;  4KDU A;  3ERG A;  14GS A;  5A4V A;  4ZB7 A;  3H79 A;  5FHI A;  3CTG A;  4ZL9 A;  2JSY A;  4N3Z A;  3TKQ A;  4OFN A;  4POB A;  4K2D A;  3FYG A;  3O3T A;  4POM A;  3WGD A;  1V58 A;  4POL A;  2OAD A;  5EL8 A;  4G9H A;  5ECK B;  3TB2 A;  2YP6 A;  1EGR A;  3N5O A;  4TR1 A;  3WT2 A;  4POK A;  4HSC X;  2IMK A;  1Y6E A;  2GLR A;  3G9B A;  2C3T A;  3UAR A;  4N10 A;  2FWF A;  2HQT A;  4YH2 A;  5BMU B;  3F4R A;  2H01 A;  4WR5 A;  8GSS A;  2E7P A;  3M1G A;  2PGT A;  4CHS A;  1X0R A;  1SYR A;  5B6N A;  4MJC A;  4KDY A;  1MDI A;  4G10 A;  2XBQ A;  1O7U A;  3RPN A;  1SL2 B;  4CY8 A;  1K0N A;  1GUL A;  1SK1 A;  1ZCP A;  3HYP A;  2ZCT A;  3RHC A;  3L78 A;  1O8W A;  1T8E B;  3DXB A;  1GH2 A;  3HCZ A;  3TJB A;  2CZ3 A;  3NIV A;  1YKC A;  9GSS A;  2HSM B;  5E59 A;  1E2Y A;  2IN3 A;  4NMU A;  4ILF A;  2EIQ A;  3DGQ A;  2JAD A;  1TRU A;  3PIN A;  3GMF A;  5A5H B;  4YAP A;  1XWA A;  4Z7X A;  1TW9 A;  4DSS A;  2FD3 A;  1SEN A;  1ZYQ B;  3UMA A;  4LL1 B;  3IBH A;  3EWL A;  3UL3 A;  2K18 A;  2BJX A;  3QAG A;  4PUF C;  3A3T A;  2VLV A;  3KIJ A;  3LYK A;  2O87 A;  3ZLP A;  6GSX A;  4WBR D;  2R4V A;  1PMT A;  2V6K A;  1AUC A;  1ZGN A;  1X9S B;  3M9J A;  2GGT A;  2WJU A;  3GUR A;  1GUK A;  2VL2 C;  1TRV A;  1XFL A;  3FZA A;  2WS2 A;  2ZUP A;  3WGX A;  2HRF A;  1PD2 1;  1X5E A;  2B7J A;  2FA4 A;  5C00 A;  2AYT A;  5LCZ A;  3APS A;  2WFC A;  3HA9 A;  4HU7 A;  2WVZ A;  5GZZ B;  2BTO T;  2H0G A;  4ICY A;  1HYU A;  3KGK A;  2WVX A;  3IK9 A;  1GUH A;  3LW9 A;  5AIX A;  2OAC A;  1GLP A;  2H0I A;  3ZIT A;  1EP8 A;  4XS4 A;  1T4Z A;  2JAC A;  3TKS C;  2CQ9 A;  3IAS 2;  4ULX A;  3GRX A;  1A0F A;  1VF3 A;  3TJF A;  1NHO A;  4EL1 A;  1Y25 A;  5JCG A;  1PN0 A;  2DJ2 A;  1JZW A;  18GS A;  4G0K A;  4D73 B;  3HVV A;  2I9H A;  3LXZ A;  2IFQ B;  2WW2 A;  4PUR A;  1EV4 A;  3Q6O A;  2NDO A;  1TKD B;  2R2J A;  1OYJ A;  1PX7 A;  1KEB A;  1QQ2 A;  2I81 A;  1PGT A;  1QFN A;  4CW9 A;  1CQG A;  2CAQ A;  4MP4 A;  3FKF A;  3KH7 A;  3HDC A;  3FZ9 A;  3QD9 A;  13GS A;  3ZMK A;  1X5D A;  4DEJ A;  2GVP A;  5FWG A;  5ECN B;  3UBL A;  1LBK A;  2XPD A;  3F4T A;  4I6X A;  4BL7 B;  4KE3 A;  1TI3 A;  5ECS A;  5DAL A;  2K9F A;  2LJA A;  3VUR A;  4MF5 A;  1LJR A;  2WRT A;  2C0E A;  4LMW A;  2N5F A;  1YEW C;  4FO5 A;  1K3O A;  2C8U A;  5F05 A;  4OWY A;  3FMW A;  1GSE A;  3IE3 A;  5A4U A;  4YQU A;  1QMV A;  2R6K A;  4K5R A;  1FOV A;  2H74 A;  3LSZ A;  3A2X A;  3HVN A;  1BED A;  2EIR A;  4GDF A;  1XG8 A;  2YOI A;  1UN2 A;  3EC3 A;  2HNL A;  4IBP A;  4TW5 A;  2IME A;  4FIW A;  1KBN A;  4EDZ A;  1SL1 B;  3VI7 A;  3F3R A;  1U6T A;  5IPH A;  3VPT A;  3MNG A;  1XWC A;  4LA1 A;  4KGI A;  2H6Z A;  3TUE A;  1EZK A;  3IDV A;  3RAZ A;  4AJ7 A;  2A2P A;  2RLI A;  2DKI A;  3TOU A;  2H6Y A;  4OO5 A;  2WB9 A;  5D73 A;  1NM3 A;  2DKH A;  3TDG A;  4ECC A;  2L57 A;  2N5A A;  4IN0 A;  4IW9 A;  1BG1 A;  2LJK A;  4XS1 A;  2MYG A;  4JBB A;  5IMF A;  4NPB A;  1I5G A;  3E3E A;  1PKW A;  3ZL5 A;  4EUY A;  5AIV A;  3GX8 A;  3TGZ A;  4DSS B;  3ME8 A;  1GNW A;  5IMC A;  5AGY A;  1V98 A;  3I6A A;  5HR0 A;  2HE3 A; 
#chains in the Genus database with same CATH homology
 1BAY A;  4QQ7 A;  5J4U A;  2Z9S A;  3GTU B;  1M7T A;  2F51 A;  5B6M A;  1PL1 A;  3I9V 2;  2YPM A;  2CX4 A;  3MWH A;  5HR2 A;  2B6M A;  1SKW B;  3G7I A;  4O5R A;  4CY6 A;  4H86 A;  3VLN A;  4HJ2 A;  2VD0 A;  3LFL A;  1GLQ A;  1MDK A;  4G01 A;  1TK5 B;  2GQM A;  2ALB A;  2LJR A;  3TKS E;  3KJY A;  3RPP A;  3K8N A;  4IJ3 A;  1GRX A;  2DJK A;  1W89 A;  2B5Y A;  1M0U A;  3D5J A;  1VRS D;  1K0M A;  3LWA A;  2TIR A;  5GST A;  2P0G A;  1XZO A;  2H72 A;  1YF0 A;  4XS4 B;  5D8I A;  1PSQ A;  5BMU A;  2OJL A;  1K3L A;  1F3B A;  4K7N A;  1A2M A;  5ECR B;  2JZT A;  5JCW A;  1F3A A;  3FEU A;  4EIQ A;  1MTC A;  2I1U A;  5D96 A;  1JFU A;  3H93 A;  4KDX A;  2GZP A;  1ML6 A;  16GS A;  1A2J A;  3Q19 A;  1SK0 A;  6GSY A;  5AIS A;  4V2L A;  2PMT A;  2R5G A;  1WE0 A;  3A5W A;  1SJZ A;  2M46 A;  1XW6 A;  1GSY A;  1FB0 A;  4HI7 A;  2HSH A;  2YZH A;  2CX3 A;  2D2Z A;  2HSM A;  1FHE A;  4PX1 A;  1DBY A;  3HJO A;  2MMZ A;  5IO2 A;  4DSQ A;  1QK8 A;  5EY6 A;  3GN3 A;  5A5H A;  1Y1U A;  1O8X A;  3OR5 A;  5F07 A;  1KTE A;  4A5P A;  1ERV A;  1GTU A;  4AI6 A;  4RUV A;  2A4H A;  4MH2 A;  3GIX A;  2I4A A;  4K6X A;  4L0W A;  2H70 A;  2H1A A;  2PWJ A;  2F8A A;  5CP1 A;  4OD7 A;  1EV9 A;  4GLT A;  3GKM A;  2J23 A;  3VWV A;  4MZB A;  2DJ1 A;  1PL2 A;  4KF9 A;  1Z6N A;  3DRN A;  2H6X A;  1OE7 A;  4MPG A;  3KTB A;  2L6D A;  4KCA A;  1N2A A;  1GSS A;  1BQ7 A;  4BVX B;  1V9W A;  4OFT A;  2IMD A;  2AUV A;  4O32 A;  2IL3 A;  4GWR A;  5JWO B;  1BG5 A;  4ZBA A;  3UJ1 A;  2YWO A;  2HZE B;  4AJ6 A;  3KXO A;  5CRE A;  2DBC A;  1EGO A;  5DCG A;  5DBQ A;  2F9S A;  3U6V A;  1M2A A;  3QAW A;  2YV7 A;  3RBT A;  1WRY A;  1URM A;  2OBK A;  4EIP A;  2V6O A;  2ES7 A;  4TR3 A;  2OT3 A;  4L0U A;  5AN1 A;  1MDJ A;  3O6T A;  4V1A g;  5KOX A;  1EWX A;  1ILO A;  3GKK A;  3Q74 A;  3BCK A;  3PR8 A;  3HZ4 A;  4MZC A;  2DLX A;  1F9M A;  5E4W A;  2H71 A;  4BL7 A;  3M8N A;  4KH7 A;  1UVZ A;  1PRX A;  2GQL A;  1ZOF A;  5ELA A;  4PXO A;  4LL4 B;  4FYU A;  1I9D A;  3KCM A;  3HMJ G;  3O76 A;  2HXK A;  5HR3 A;  5HFG A;  1EEM A;  4O5Q A;  2P5Q A;  2H8L A;  2OE1 A;  1OKT A;  1ZZY A;  4FYB A;  1FB6 A;  6GST A;  1PA3 A;  4GCI A;  1XOA A;  5DDL A;  4TR4 A;  2G2Q A;  3SWL A;  3UEM A;  4AKH A;  1PX6 A;  1M99 A;  1YJ6 A;  4XRA A;  2PN8 A;  5IOW A;  3GV1 A;  4BWQ A;  3BBY A;  3C1S A;  1OC3 A;  4J57 E;  2YWI A;  4X0X A;  4TR0 A;  4MZW A;  2LQO A;  2EFC A;  2FWG A;  1AQX A;  3QR6 A;  2F8F A;  2B5X A;  2QSI A;  5CNW A;  3TRP A;  3IAM 2;  5CRH A;  1GSD A;  4PQH A;  3HXS A;  2VCX A;  1XWK A;  4KSM A;  4EC0 A;  3HVS A;  2HLS A;  3WT1 A;  1EOG A;  3HJP A;  1N25 A;  3ZIJ A;  1THX A;  2FWE A;  2HZF A;  2TRC P;  4KUN A;  1A23 A;  4PTS A;  1QUW A;  2KHP A;  5D93 A;  3TJK A;  3GSS A;  4DVC A;  1A0R P;  1XIY A;  5G5F A;  1RQM A;  1JLW A;  2EIO A;  2J9H A;  2VL3 A;  4F9Z A;  2RM6 A;  5ECH B;  3APQ A;  2HSN A;  3DYR A;  5IO0 A;  4OCF A;  3CYN A;  5J40 A;  5A1N B;  3GTU A;  2NPB A;  5HR1 A;  3LOR A;  3E0U A;  4JZQ A;  5H5R A;  4Q5R A;  3C1R A;  4ML1 A;  5FT3 A;  1BF5 A;  3PGT A;  3WGE A;  4MJB A;  1K0O A;  3P2A A;  3APO A;  2HYX A;  2WCI A;  1PKZ A;  3H1N A;  5G1L A;  4EO3 A;  2R0P A;  3LG6 A;  3G7Y A;  3F8U A;  1YQ1 A;  1YY7 A;  1MD4 A;  1K0C A;  1J9B A;  2FY6 A;  2LUS A;  1Z5Y E;  3LJR A;  2O89 A;  2VLT A;  3IC4 A;  2C4J A;  5JWQ B;  1MD3 A;  4F0C A;  3N9J A;  1GL8 A;  1Z7P A;  4TVE A;  2X8G A;  1O85 A;  2YJH A;  1GTI A;  5JWR B;  3G7J A;  1HD2 A;  3EE2 A;  1OE8 A;  2NVL A;  2LS5 A;  2VCV A;  4E8E A;  2M80 A;  2H1D A;  1Q98 A;  1H4O A;  1ZYP A;  4EVM A;  1FVK A;  2QA2 A;  3TKP A;  1VGL A;  4F82 A;  1HNB A;  5EPF A;  2RUF A;  3CBU A;  1GUM A;  1TDI A;  3GUS A;  4OO4 A;  3IXR A;  1SVL A;  2R0G A;  2RM5 A;  1C72 A;  4HU9 A;  4V1A p;  2AB6 A;  3A5I A;  3M0F A;  2MBS A;  5ABR A;  4ISD A;  4XHM A;  3FY7 A;  4BA7 A;  4G2E A;  3MAK A;  2FGX A;  3TRX A;  3M3M A;  4NV5 A;  2OE3 A;  2L4Q A;  3FZ4 A;  2VL9 A;  3A2V A;  3KZQ A;  1WWJ A;  5HQP A;  2F3M A;  1JHB A;  1XCC A;  2LQQ A;  4HZ4 A;  3CTF A;  1OAZ A;  4G19 A;  2EFH A;  4HQS A;  4RQX A;  11GS A;  4Q5F A;  5ECO B;  4I5Q A;  5JCU A;  3VWU A;  1GTB A;  4F03 A;  1BYE A;  2WDU A;  2X4A A;  1SK2 A;  2CT6 A;  1YZX A;  1B9X C;  1U3A A;  2I3Y A;  2FWH A;  3RDW A;  5J3R A;  1O81 A;  3LEF A;  1SVM A;  5DJM A;  2MMA A;  2RII A;  2OA7 A;  4QL7 A;  1GWC A;  2AHE A;  4K9Z A;  5ECI B;  1U88 A;  1ST9 A;  3TRQ A;  2JSZ A;  4BVX A;  3US3 A;  2JU5 A;  2DIY A;  4ECJ A;  1M2B A;  4F2I A;  3ZRE A;  3L4N A;  4FYC A;  3IR4 A;  3GL5 A;  2AV4 A;  3TJJ A;  2VKZ G;  5J41 A;  3TU3 B;  2HZE A;  3E9J B;  1TXX A;  1SL0 B;  2GSS A;  2YAN A;  3QOU A;  1GSF A;  2V41 A;  4WR4 A;  2LNS A;  1T3B A;  3EVI A;  2DSA A;  1H75 A;  1XWB A;  3GFK A;  2GTU A;  2HSN B;  2LV3 A;  3CMI A;  5G2Z A;  1V40 A;  2GST A;  2EFE A;  4EXJ A;  2C0D A;  1TP9 A;  1WPI A;  3WYW A;  4WET A;  2R37 A;  4ZIJ A;  3GH9 A;  1SYX A;  3EU3 A;  2KP1 A;  2K8S A;  4JU5 A;  2YJ7 A;  5INY A;  2DJ0 A;  5G30 A;  5CRD A;  3M9K A;  1R5P A;  2R3X A;  2O85 A;  3ZML A;  5CRG A;  1ABA A;  4WF4 A;  3S9F A;  2H76 A;  4IP1 A;  2QGV A;  1V57 A;  2JZS A;  1OKD A;  5DVB A;  5IMA A;  2C80 A;  1JZR A;  2YNX A;  1K0D A;  1TRW A;  3MDK A;  4N11 A;  4G0I A;  1XW9 A;  3CSJ A;  2X8C A;  3IRA A;  4BVY B;  5B8B A;  2PVO C;  3P7X A;  4MJA A;  2X99 A;  3W8S A;  2PU9 C;  2VCZ A;  3KMO A;  1G0T A;  3QCP A;  2HFD A;  5CO3 A;  1AXD A;  5IPG A;  3ZYW A;  1G6Y A;  3VPQ A;  1PQN A;  2LRT A;  2UV8 G;  1BX9 A;  17GS A;  3IPZ A;  2L4C A;  1EEJ A;  1GSQ A;  3FR3 A;  3DEX A;  1GNE A;  5G1K A;  4K7O A;  2VCT A;  4PGT A;  2DJ3 A;  2C0G A;  2DML A;  5J4V A;  1DE1 A;  2L5O A;  3ZFL A;  2JL4 A;  2VD1 A;  4XCS A;  1B8X A;  3PH9 A;  1FO5 A;  5IOX A;  4PNG A;  4EKZ A;  3I69 A;  2O8V B;  5HFK A;  3KD0 A;  4K8M A;  4ZB6 A;  1Z9H A;  2K8V A;  4GF0 A;  3HZ8 A;  4HOJ A;  1X9M B;  4L8E A;  1AAZ A;  4OCE A;  4Z2U A;  6GSV A;  5KOW A;  3IC8 A;  3F6F A;  1WJK A;  1WOU A;  2ON7 A;  5A1N A;  4PQ1 A;  4RI7 A;  2HRN A;  4JED A;  3F0I A;  2UZ8 A;  4N30 A;  2NBS A;  4XIH A;  1T1V A;  3WD6 A;  3EMX A;  5ID2 A;  4KA0 A;  5A5K A;  1DUG A;  1U3I A;  3GA4 A;  3UOM A;  2GZZ A;  3EMP A;  1IYH A;  3HY2 A;  1K3Y A;  2CA8 A;  4XRD A;  4EDY A;  4K5S A;  2CVK A;  3FR9 A;  2QA1 A;  3CSH A;  1S3C A;  4ZB9 A;  1RW1 A;  4IVF A;  1M2D A;  2VM2 A;  2WZ9 A;  4HS1 A;  3ERF A;  3KH9 A;  4O7H A;  4CDO A;  5DAK A;  1Z7R A;  2LTK A;  6GSS A;  3KM6 A;  1JZO A;  2GQK A;  3F4S A;  2HI7 A;  5IMZ A;  5DQS A;  1GSU A;  1XXU A;  2FCH A;  4L5O A;  4ML6 A;  1KNG A;  3L0H A;  4TOP A;  4HJM A;  5EVO A;  2O5V A;  2TRX A;  1PN9 A;  5A4W A;  1WP0 A;  3C73 A;  3MIX A;  4EF0 A;  2HT9 A;  1DE2 A;  3C7M A;  1B4P A;  1AIU A;  2H1G A;  4MPF A;  5ECM B;  3VWW A;  2YCD A;  3KEB A;  1SJ6 A;  2GT5 A;  3EPT A;  3Q18 A;  3PPU A;  2H66 A;  1UA5 A;  2B1K A;  2VIM A;  2YWM A;  3D0Z A;  1AW9 A;  5CRW A;  4QL9 A;  2H30 A;  4JRR A;  1G7O A;  3W6G A;  1GTA A;  3HJM A;  2KP2 A;  4WBJ A;  2VCQ A;  19GS A;  1TRS A;  4WF5 A;  1A8Y A;  1B9Y C;  3R3E A;  1ERT A;  4Q5N A;  1YEX A;  1ZMA A;  2AJQ B;  3HKR A;  3BCI A;  4G0L A;  2O7K A;  1S3A A;  2LEG A;  2CZ2 A;  3HD5 A;  1E6B A;  2PBJ A;  1GP1 A;  3CSI A;  1DSB A;  1SJI A;  4E68 A;  2VM1 A;  3GHA A;  2JZR A;  3FR6 A;  4KSO A;  2VUP A;  5J9B A;  2FNO A;  1G6W A;  4IP6 A;  3FZ5 A;  1A24 A;  2VCW A;  4AGS A;  1XBS A;  1T7P B;  3FW2 A;  3DD3 A;  2B3S A;  1TJD A;  5KN3 A;  4P3Y B;  4MNN A;  4TKY A;  2L6C A;  1FOH A;  3UIW A;  1TK8 B;  3QAV A;  5ECP B;  4I8B A;  1QXH A;  4OMV A;  4ZIL A;  2FA8 A;  4MF7 A;  4K7I A;  3HVX A;  1THO A;  3VI5 A;  1ERW A;  4O92 A;  5ELG A;  4JR6 A;  2XPE A;  1V2A A;  1XOB A;  5KEJ A;  3BJ5 A;  2YV9 A;  3BOA A;  4PNF A;  3KP8 A;  1EOH A;  3KP9 A;  4V2N A;  2A4V A;  3I43 A;  4XTS A;  4KW6 A;  1R4W A;  2C3N A;  2CV4 A;  1TK0 B;  2M72 A;  3IHQ A;  3DVX A;  5GSS A;  4EE0 A;  12GS A;  4OFM A;  2X8H A;  3VFI A;  1IYI A;  3L9S A;  4GTU A;  5J4Y A;  2B7K A;  3IHG A;  3JCM L;  4Z2R A;  1LU4 A;  1HNA A;  5ID2 B;  4AKX B;  3GH6 A;  3GX0 A;  1TXU A;  2ZNM A;  3LGC A;  1M9B A;  3ZTL A;  1SVO A;  3IK7 A;  2MBT A;  1RK4 A;  4IQA A;  4TXO B;  1AC1 A;  1XVW A;  3LQ7 A;  2XHF A;  3UBK A;  3MYD A;  3F3Q A;  3DKS A;  1AQW A;  2LNT A;  4BVY A;  2GZY A;  4YQV A;  4HDE A;  3SBC A;  4NHZ A;  2B5E A;  2V32 A;  4IHU A;  4MK3 A;  2IMI A;  4IS0 A;  4ID0 A;  4E8H A;  2P5R A;  3D4M A;  4IEL A;  5DAK B;  3NZN A;  2H1B A;  5BRT A;  5CAX A;  2GSQ A;  2PER A;  2N5B A;  5D9V A;  2H1L A;  3CXG A;  2HSY A;  3TCO A;  3QDN A;  4MCU A;  2NTO A;  2CVB A;  1WIK A;  2KOK A;  4V2M A;  4MDC A;  5A34 B;  1EP7 A;  1F6M C;  4I2T A;  4YQM A;  5IMD A;  4WEY A;  4NWY A;  2LRN A;  1TTZ A;  2VOC A;  1YVL A;  2CVD A;  2YWN A;  4HQZ A;  1F37 A;  5KN2 A;  3LXT A;  2HRA A;  4IKH A;  4GSS A;  3BD2 A;  5J47 A;  3ERW A;  5G5E A;  3ZRD A;  4WXT A;  2A2R A;  4NXI A;  2X64 A;  3F63 A;  3DML A;  4LLR A;  5D9T A;  3ZFB A;  4L5L A;  3U5R E;  2GT6 A;  3FHK A;  10GS A;  4GSN A;  5LD0 A;  2REM A;  2C3Q A;  4YAV A;  2H73 A;  1FG4 A;  1ACV A;  4IJI A;  3AY8 A;  4K0G A;  4KX4 A;  1XW5 A;  2AAW A;  2MMO A;  2H0H A;  2V1M A;  1O73 A;  2BMX A;  4KND A;  4I97 A;  4AKI A;  4W66 A;  1TU7 A;  1SKR B;  1CQH A;  5H5S A;  2G0F A;  2PVQ A;  2IIY A;  1A8L A;  4MLY A;  1YF1 A;  2FUG 2;  1A2L A;  1T00 A;  1B48 A;  4TR1 B;  1ZL9 A;  3CRU A;  4N0Z A;  3QMX A;  2GSR A;  1VF1 A;  3ZIV A;  3ZZX A;  3EU4 A;  7GSS A;  2LST A;  2IPA A;  3D21 A;  1SU9 A;  2KUC A;  2QC7 A;  2H19 A;  1O6J A;  1K0A A;  4IQ1 A;  3GL3 A;  2HRK A;  1ON4 A;  3ISO A;  3W8J A;  4WKW A;  2E2M A;  5GAP D;  2IMF A;  1YDK A;  2VAF A;  3CRT A;  2GDR A;  1T4Y A;  4J56 E;  2DIZ A;  4DSR A;  1FW1 A;  3GKX A;  4NHW A;  3LYP A;  1N8J A;  1AQV A;  3DIE A;  4X4J A;  1WMJ A;  4HUA A;  2VLU A;  2DMM A;  4BPY A;  2P31 A;  4XS6 A;  4ZB8 A;  1ERU A;  1J0F A;  4F0B A;  2PUK C;  4KAE A;  4ZBB A;  4GRF A;  5F06 A;  2PPT A;  1OC9 A;  4QMK A;  4HZ2 A;  3IOS A;  1NW2 A;  4IGJ A;  2FLS A;  3GNJ A;  3UAP A;  4NAX A;  1W4V A;  1USB A;  4BWS A;  3FRC A;  4FH8 A;  3C71 A;  4FQU A;  1OC8 A;  2V2G A;  1XVQ A;  2FHE A;  1SD8 A;  3ED3 A;  2L59 A;  4RI6 A;  2C1Y A;  5LNK e;  3GST A;  1YEP A;  5B8A A;  1VF4 A;  3P90 A;  6GSW A;  1F2E A;  3QFA C;  4TN8 A;  4MMM A;  5G31 A;  3FK8 A;  1R7H A;  1Z6M A;  2GS3 A;  1VF2 A;  1K0B A;  4TXV A;  2L5L A;  4X1U A;  1QGV A;  5D9X A;  3DWV A;  4K0N A;  3UVH A;  1XWG A;  2E0Q A;  2K6V A;  1NHY A;  2OE0 A;  3TJG A;  4ZXG A;  5COH A;  2KLX A;  3D4T A;  3EIN A;  4MF6 A;  4AF2 A;  2EC4 A;  4ZBD A;  1JLV A;  1SD9 A;  2VO4 A;  1ZYN A;  1HQO A;  5KN0 A;  1R26 A;  1S3D A;  3QPM A;  4N0V A;  4AKG A;  3A2W A;  3MSZ A;  1J08 A;  1TU8 A;  3C8E A;  1X9W B;  2A2S A;  3H4K A;  4ZL7 A;  5KN1 A;  5D9W A;  1Z3E A;  3GKN A;  4YKG A;  5ECQ B;  3F6D A;  4JR4 A;  4K2X A;  3ZVJ D;  3KMN A;  3KTL A;  5IQY A;  2IWT A;  3D6I A;  4J2F A;  1HNC A;  4NV2 A;  3D22 A;  2C0F A;  1YKA A;  3H8Q A;  1Q4J A;  5GAN D;  3IA1 A;  1G7E A;  1SKS B;  2OKA A;  5B7C A;  2WUL A;  5IIZ A;  2QKE A;  4YKF A;  3L9V A;  1BJX A;  5DAL B;  3EYT A;  4KCE A;  4MA9 A;  4RQR A;  1JZD A;  1TI1 A;  4AJ8 A;  4TRX A;  1FVJ A;  5IMV A;  1UC7 A;  4ZL8 A;  4Z2T A;  5DQY A;  5DJL A;  4O5U A;  2RUE A;  4HEA 2;  5DCH A;  3IV4 A;  5J5N A;  2XC2 A;  5J9C A;  2OBI A;  4TXO A;  20GS A;  3F9U A;  3R2Q A;  4GQF A;  4USS A;  5CYY A;  1FAA A;  5F0G A;  1R5A A;  4GQC A;  4GST A;  2MMN A;  5L71 A;  2X49 A;  3V1W A;  2HRK B;  4PQI A;  4MH3 A;  4ECI A;  4K1F A;  1OVN A;  3RHB A;  2EFD A;  3J7Y k;  3EUR A;  2YZU A;  4I2U A;  2LKU A;  2R0C A;  1XPV A;  2YN1 A;  5C04 A;  2IJY A;  5A34 A;  2XBI A;  3HHV A;  3VK9 A;  5HFI A;  1TOF A;  1ZYE A;  3TKR A;  3P8W A;  1U87 A;  22GS A;  3NOF A;  3QFB C;  2DJJ A;  3DVW A;  1M9A A;  1X5C A;  2VL2 A;  2B1L A;  2H75 A;  3J7Y b;  4ECB A;  3VWX A;  4D73 A;  1MEK A;  5ENU A;  4Q5Q A;  3CWG A;  1OC9 B;  2IFQ A;  3L9U A;  4KB3 A;  1B4Q A;  2WGR A;  4MJE A;  3ME7 A;  5F8B A;  4GXZ A;  4JE1 A;  4ACS A;  2DC5 A;  3ZVJ A;  2ON5 A;  2LRC A;  3TOT A;  6GSU A;  5ECL B;  2CAI A;  4X43 A;  3UVT A;  1NSW A;  4LMV A;  5IM9 A;  3TKS A;  4PUA A;  3GYK A;  2MZC A;  4MAB A;  2E2G A;  5H5Q A;  4KDU A;  3ERG A;  14GS A;  5A4V A;  4ZB7 A;  3H79 A;  5FHI A;  3CTG A;  4ZL9 A;  2JSY A;  4N3Z A;  3TKQ A;  4OFN A;  4POB A;  4K2D A;  3FYG A;  3O3T A;  4POM A;  3WGD A;  1V58 A;  4POL A;  2OAD A;  5EL8 A;  4G9H A;  5ECK B;  3TB2 A;  2YP6 A;  1EGR A;  3N5O A;  4TR1 A;  3WT2 A;  4POK A;  2IMK A;  1Y6E A;  2GLR A;  3G9B A;  2C3T A;  3UAR A;  4N10 A;  2FWF A;  2HQT A;  4YH2 A;  5BMU B;  3F4R A;  2H01 A;  4WR5 A;  8GSS A;  2E7P A;  3M1G A;  2PGT A;  4CHS A;  1X0R A;  1SYR A;  5B6N A;  4MJC A;  4KDY A;  1MDI A;  4G10 A;  2XBQ A;  1O7U A;  3RPN A;  1SL2 B;  4CY8 A;  1K0N A;  1GUL A;  1SK1 A;  1ZCP A;  3HYP A;  2ZCT A;  3RHC A;  3L78 A;  1O8W A;  1T8E B;  3DXB A;  1GH2 A;  3HCZ A;  3TJB A;  2CZ3 A;  3NIV A;  1YKC A;  9GSS A;  2HSM B;  5E59 A;  1E2Y A;  2IN3 A;  4NMU A;  4ILF A;  2EIQ A;  3DGQ A;  2JAD A;  1TRU A;  3PIN A;  3GMF A;  5A5H B;  4YAP A;  1XWA A;  4Z7X A;  1TW9 A;  4DSS A;  2FD3 A;  1SEN A;  1ZYQ B;  3UMA A;  4LL1 B;  3IBH A;  3EWL A;  3UL3 A;  2K18 A;  2BJX A;  3QAG A;  4PUF C;  3A3T A;  2VLV A;  3KIJ A;  3LYK A;  2O87 A;  3ZLP A;  6GSX A;  4WBR D;  2R4V A;  1PMT A;  2V6K A;  1AUC A;  1ZGN A;  1X9S B;  3M9J A;  2GGT A;  2WJU A;  3GUR A;  1GUK A;  2VL2 C;  1TRV A;  1XFL A;  3FZA A;  2WS2 A;  2ZUP A;  3WGX A;  2HRF A;  1PD2 1;  1X5E A;  2B7J A;  2FA4 A;  5C00 A;  2AYT A;  5LCZ A;  3APS A;  2WFC A;  3HA9 A;  4HU7 A;  5GZZ B;  2BTO T;  2H0G A;  4ICY A;  1HYU A;  3KGK A;  3IK9 A;  1GUH A;  3LW9 A;  5AIX A;  2OAC A;  1GLP A;  2H0I A;  3ZIT A;  1EP8 A;  4XS4 A;  1T4Z A;  2JAC A;  3TKS C;  2CQ9 A;  3IAS 2;  4ULX A;  3GRX A;  1A0F A;  1VF3 A;  3TJF A;  1NHO A;  4EL1 A;  1Y25 A;  5JCG A;  1PN0 A;  2DJ2 A;  1JZW A;  18GS A;  4G0K A;  4D73 B;  3HVV A;  2I9H A;  3LXZ A;  2IFQ B;  4PUR A;  1EV4 A;  3Q6O A;  2NDO A;  1TKD B;  2R2J A;  1OYJ A;  1PX7 A;  1KEB A;  1QQ2 A;  2I81 A;  1PGT A;  1QFN A;  4CW9 A;  1CQG A;  2CAQ A;  4MP4 A;  3FKF A;  3KH7 A;  3HDC A;  3FZ9 A;  3QD9 A;  13GS A;  3ZMK A;  1X5D A;  4DEJ A;  2GVP A;  5FWG A;  5ECN B;  3UBL A;  1LBK A;  2XPD A;  3F4T A;  4I6X A;  4BL7 B;  4KE3 A;  1TI3 A;  5ECS A;  5DAL A;  2K9F A;  2LJA A;  3VUR A;  4MF5 A;  1LJR A;  2WRT A;  2C0E A;  4LMW A;  2N5F A;  4FO5 A;  1K3O A;  2C8U A;  5F05 A;  4OWY A;  3FMW A;  1GSE A;  3IE3 A;  5A4U A;  4YQU A;  1QMV A;  2R6K A;  4K5R A;  1FOV A;  2H74 A;  3LSZ A;  3A2X A;  1BED A;  2EIR A;  4GDF A;  2YOI A;  1UN2 A;  3EC3 A;  2HNL A;  4IBP A;  4TW5 A;  2IME A;  4FIW A;  1KBN A;  4EDZ A;  1SL1 B;  3VI7 A;  3F3R A;  1U6T A;  5IPH A;  3VPT A;  3MNG A;  1XWC A;  4LA1 A;  4KGI A;  2H6Z A;  3TUE A;  1EZK A;  3IDV A;  3RAZ A;  4AJ7 A;  2A2P A;  2RLI A;  2DKI A;  3TOU A;  2H6Y A;  4OO5 A;  2WB9 A;  5D73 A;  1NM3 A;  2DKH A;  3TDG A;  4ECC A;  2L57 A;  2N5A A;  4IN0 A;  4IW9 A;  1BG1 A;  2LJK A;  4XS1 A;  2MYG A;  4JBB A;  5IMF A;  4NPB A;  1I5G A;  3E3E A;  1PKW A;  3ZL5 A;  4EUY A;  5AIV A;  3GX8 A;  3TGZ A;  4DSS B;  3ME8 A;  1GNW A;  5IMC A;  5AGY A;  1V98 A;  3I6A A;  5HR0 A;  2HE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...