5A5HA

The crystal structure of the gst-like domains complex of eprs c92sc105sc123s mutant-aimp2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
168
structure length
168
Chain Sequence
b'TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSSDSFTSTINELNHSLSLRTYLVGNSLSLADLSVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs C92Sc105Sc123S Mutant-Aimp2
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 54
structure length 168
sequence length 168
chains with identical sequence C, E, G
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5hA00
5A1NA 5BMUB 4AKHA 5A34B 4AI6A 4W66A 4AKIA 5A34A 5A5HB 4ZB7A 5A5HA 5A1NB 4AKGA
chains in the Genus database with same CATH superfamily
3RFRC 5J5NA 4CHSA 4YQUA 3IK7A 4PGTA 4ZBBA 4IJIA 4MPFA 5D73A 3GTUA 17GSA 4YAVA 4ZB8A 3EINA 2JL4A 1U88A 1YVLA 4IELA 3IC8A 3UBLA 5A4VA 1G7OA 4HJ2A 1LJRA 3R2QA 5EL8A 5ECLB 1XW5A 2WB9A 2WVXB 4E8EA 1EOHA 1OYJA 2HSNA 1TW9A 3L0HA 4E8HA 1GUKA 3LXZA 3TGZA 5ECMB 2WDUA 5DJLA 4L5LA 3VI7A 3AY8A 1GNWA 2C3TA 5F0GA 1DUGA 5F8BA 5A4UA 3P90A 1JLWA 2AB6A 3KMOA 2VKZG 6GSTA 2YCDA 3EE2A 1IYHA 1PGTA 2F3MA 3Q18A 5AN1A 5ECRB 4AGSA 8GSSA 4AKIA 3LSZA 4GSNA 3QAVA 1AW9A 4MPGA 3R3EA 4GF0A 1GLPA 5G5EA 2FHEA 4PNGA 4PURA 2N5FA 4OMVA 2VCWA 4GCIA 1GSYA 5ELAA 1A0FA 2HRKB 2IMKA 3LYPA 4DEJA 4PNFA 5B7CA 6GSWA 3VLNA 3HJMA 4G0KA 4KX4A 4PUAA 1GUMA 2D2ZA 4MF7A 2GSTA 2VCTA 2YV9A 1GLQA 4ZBAA 2HSMB 4IBPA 5ECIB 3MDKA 2EFHA 5J40A 3PPUA 1BAYA 5LD0A 3VPQA 1K3LA 16GSA 4YAPA 2GSRA 3FR6A 1YDKA 3UARA 4K0NA 3GX0A 4F03A 3GURA 4G19A 4QQ7A 1GSFA 3FY7A 3N5OA 4ZBDA 3M8NA 4LMVA 1K0MA 1VF3A 4KDXA 1AQXA 2OACA 5J41A 2DC5A 5ELGA 1XWGA 4USSA 4TOPA 2PERA 3F6FA 4HI7A 2WVXA 3IK9A 3D0ZA 1VF4A 1HQOA 1NHYA 1GSEA 1TXUA 4EDYA 4AI6A 4W66A 2C8UA 5DQSA 2GTUA 5F06A 1HNBA 4MDCA 1KBNA 2AAWA 2C80A 2PMTA 3VWXA 1EEMA 1K0OA 1PKZA 5ECHB 4F0BA 1SVLA 4L8EA 1G6WA 4QMKA 1E6BA 4WR5A 4KAEA 1PD21 1GNEA 3HJOA 2WJUA 4EC0A 4IGJA 4Q5NA 1R5AA 3CBUA 3O76A 4AKHA 4KGIA 1I1IP 2HRKA 3ZMKA 4MK3A 4G01A 2CA8A 1K0BA 5ECNB 2OT3A 1GTAA 3VI5A 5KEJA 1BG5A 5G5FA 2CAIA 4PHZC 2HSMA 1K0AA 3KMNA 5FT3A 4BVXA 1SVOA 5ECKB 3BBYA 5LCZA 4Q5FA 2HQTA 4RI7A 3CRTA 4MF5A 2A2RA 3FR9A 4Q5QA 1GTBA 4GTUA 1YKCA 2WW2A 5AGYA 1Z9HA 1PL1A 1GTIA 1TU7A 3F63A 1G6YA 1M99A 4EDZA 5JCWA 3CRUA 2VD1A 2VCVA 4J2FA 4ID0A 3W8SA 2IL3A 1YEWC 3CSIA 3O3TA 3ERFA 7GSSA 4KDUA 3TOUA 3GUSA 2VCZA 1HNCA 4ISDA 2HNLA 3QAWA 4LMWA 2VCXA 4G0IA 4PI2C 4MP4A 5BMUB 1Q4JA 2UV8G 3ZMLA 1GULA 2VCQA 5J4YA 3TU3B 2GSQA 4IQAA 4ECJA 2WS2A 2LJRA 3WYWA 2WW3A 2R3XA 3LXTA 3GSTA 1BX9A 2GDRA 1B8XA 1ZGNA 3LJRA 2WVYA 3KXOA 1K3OA 1OE7A 1N2AA 1K0CA 4G9HA 3MAKA 5AIXA 2H1LA 3CSHA 3KM6A 1EOGA 5F05A 3N9JA 3UAPA 3ZFBA 1AXDA 2WVZA 4KF9A 2IMIA 3LQ7A 5A1NB 5GSTA 4RI6A 3I69A 2PBJA 1U87A 1RK4A 2YV7A 4K0GA 3UVHA 6GSUA 1YQ1A 4O7HA 1GTUA 4NAXA 1MD4A 5GSSA 5ECSA 5DCGA 3VURA 4PQIA 4ECBA 1AQWA 1K0NA 3ISOA 3QAGA 4IQ1A 4KH7A 2C3QA 5A5KA 1EV4A 3Q74A 3FRCA 4PXOA 2J9HA 5EY6A 3FR3A 4BL7B 5DALB 1M9AA 1YJ6A 3IR4A 3DD3A 4FQUA 20GSA 12GSA 1M0UA 2WW0A 3G7JA 5FWGA 4PTSA 1K0DA 1PMTA 4ECCA 3DGQA 5EVOA 4ZB9A 4BVYB 2O36A 1USBA 4IVFA 4PQHA 1V40A 5BMUA 4HOJA 3LG6A 1GWCA 4G0LA 3QR6A 1BF5A 5A4WA 1M9BA 4E68A 3RGBC 1BG1A 9GSSA 5J4UA 1JLVA 3SWLA 2C4JA 3IE3A 4JBBA 4OFTA 4N3ZA 4ECIA 5F07A 2O3EA 2CAQA 2F8FA 1MD3A 1AQVA 22GSA 4NHWA 2UZ8A 18GSA 2CZ3A 5HFKA 5D9TA 1PX7A 1TU8A 4GSSA 5A5HB 6GSVA 4ZXGA 5ECOB 1PX6A 4OFNA 4JZQA 3LYKA 1XW6A 3HMJG 1PN9A 2CZ2A 2A2SA 5A1NA 3H1NA 1GSDA 1GSUA 2EFEA 2EFCA 1GSQA 1LBKA 5DJMA 2ON5A 1MTCA 1IYIA 1XWKA 4L5OA 1TDIA 1Y1UA 5D9WA 4ACSA 4EXJA 6GSXA 5DDLA 2WRTA 4IKHA 3Q19A 4AKXB 3VK9A 5ECPB 1FW1A 4BL7A 5DALA 1ML6A 3F6DA 3ERGA 2ON7A 3GH6A 2WZSA 4BVYA 1GUHA 2R4VA 4MZWA 5DAKB 2WW1A 3I6AA 1U3IA 2R5GA 3NIVA 4YQMA 5J4VA 3CHXC 3G7IA 4I97A 4WR4A 2CVDA 4PX1A 2C3NA 4ZB6A 1N25A 4KDYA 6GSYA 1VF2A 3C8EA 3TOTA 4MF6A 3CSJA 4GLTA 6GSSA 5D9XA 1HNAA 1BYEA 3VPTA 1Y6EA 2DSAA 14GSA 4HZ2A 5AIVA 3IBHA 5FHIA 2OA7A 4Q5RA 3U6VA 1F3AA 5A34B 3UBKA 2GSSA 3RBTA 4FXYP 5A5HA 2GLRA 4F0CA 1S4BP 3HKRA 5JCUA 4N0VA 1C72A 2O5VA 4IS0A 3GTUB 3M1GA 4IW9A 1YY7A 1F3BA 4EE0A 4KSMA 4NHZA 4BVXB 4AKGA 1PA3A 3PR8A 2NTOA 4G10A 1VF1A 4OFMA 5AISA 2HSNB 3KJYA 5ECQB 1ZL9A 1B4PA 4YH2A 1UA5A 5D9VA 4GDFA 2X64A 4JEDA 1EV9A 4YQVA 4GSTA 2PGTA 1V2AA 1GSSA 4ZB7A 3PGTA 5DAKA 1PL2A 1SVMA 2OADA 4PI0C 3WD6A 4O92A 2R6KA 3GSSA 3ZFLA 5J47A 2HRAA 2AHEA 3FYGA 1K3YA 3P8WA 2VO4A 19GSA 5GZZB 1OE8A 1PKWA 3M3MA 5IQYA 1B48A 2PVQA 11GSA 3M0FA 2FNOA 4HZ4A 3KTLA 3CWGA 2EFDA 1JZRA 1OKTA 1F2EA 4KE3A 10GSA 1FHEA 13GSA 3LFLA 2V6KA 5A34A 2VD0A
chains in the Genus database with same CATH topology
5J5NA 4CHSA 4YQUA 3IK7A 4PGTA 4ZBBA 4IJIA 4MPFA 5D73A 3GTUA 17GSA 4YAVA 4ZB8A 3EINA 2JL4A 1U88A 1YVLA 4IELA 3IC8A 3UBLA 5A4VA 1G7OA 4HJ2A 1LJRA 3R2QA 5EL8A 5ECLB 1XW5A 2WB9A 4E8EA 1EOHA 1OYJA 2HSNA 1TW9A 3L0HA 4E8HA 1GUKA 3LXZA 3TGZA 5ECMB 2WDUA 5DJLA 4L5LA 3VI7A 3AY8A 1GNWA 2C3TA 5F0GA 1DUGA 5F8BA 5A4UA 3P90A 1JLWA 2AB6A 3KMOA 2VKZG 6GSTA 2YCDA 3EE2A 1IYHA 1PGTA 2F3MA 3Q18A 5AN1A 5ECRB 4AGSA 8GSSA 4AKIA 3LSZA 4GSNA 3QAVA 1AW9A 4MPGA 3R3EA 4GF0A 1GLPA 5G5EA 2FHEA 4PNGA 4PURA 2N5FA 4OMVA 2VCWA 4GCIA 1GSYA 5ELAA 1A0FA 2HRKB 2IMKA 3LYPA 4DEJA 4PNFA 5B7CA 6GSWA 3VLNA 3HJMA 4G0KA 4KX4A 4PUAA 1GUMA 2D2ZA 4MF7A 2GSTA 2VCTA 2YV9A 1GLQA 4ZBAA 2HSMB 4IBPA 5ECIB 3MDKA 2EFHA 5J40A 3PPUA 1BAYA 5LD0A 3VPQA 1K3LA 16GSA 4YAPA 2GSRA 3FR6A 1YDKA 3UARA 4K0NA 3GX0A 4F03A 3GURA 4G19A 4QQ7A 1GSFA 3FY7A 3N5OA 4ZBDA 3M8NA 4LMVA 1K0MA 1VF3A 4KDXA 1AQXA 2OACA 5J41A 2DC5A 5ELGA 1XWGA 4USSA 4TOPA 2PERA 3F6FA 4HI7A 3IK9A 3D0ZA 1VF4A 1HQOA 1NHYA 1GSEA 1TXUA 4EDYA 4AI6A 4W66A 2C8UA 5DQSA 2GTUA 5F06A 1HNBA 4MDCA 1KBNA 2AAWA 2C80A 2PMTA 3VWXA 1EEMA 1K0OA 1PKZA 5ECHB 4F0BA 1SVLA 4L8EA 1G6WA 4QMKA 1E6BA 4WR5A 4KAEA 1PD21 1GNEA 3HJOA 2WJUA 4EC0A 4IGJA 4Q5NA 1R5AA 3CBUA 3O76A 4AKHA 4KGIA 2HRKA 3ZMKA 4MK3A 4G01A 2CA8A 1K0BA 5ECNB 2OT3A 1GTAA 3VI5A 5KEJA 1BG5A 5G5FA 2CAIA 2HSMA 1K0AA 3KMNA 5FT3A 4BVXA 1SVOA 5ECKB 3BBYA 5LCZA 4Q5FA 2HQTA 4RI7A 3CRTA 4MF5A 2A2RA 3FR9A 4Q5QA 1GTBA 4GTUA 1YKCA 5AGYA 1Z9HA 1PL1A 1GTIA 1TU7A 3F63A 1G6YA 1M99A 4EDZA 5JCWA 3CRUA 2VD1A 2VCVA 4J2FA 4ID0A 3W8SA 2IL3A 3CSIA 3O3TA 3ERFA 7GSSA 4KDUA 3TOUA 3GUSA 2VCZA 1HNCA 4ISDA 2HNLA 3QAWA 4LMWA 2VCXA 4G0IA 4MP4A 5BMUB 1Q4JA 2UV8G 3ZMLA 1GULA 2VCQA 5J4YA 3TU3B 2GSQA 4IQAA 4ECJA 2WS2A 2LJRA 3WYWA 2R3XA 3LXTA 3GSTA 1BX9A 2GDRA 1B8XA 1ZGNA 3LJRA 3KXOA 1K3OA 1OE7A 1N2AA 1K0CA 4G9HA 3MAKA 5AIXA 2H1LA 3CSHA 3KM6A 1EOGA 5F05A 3N9JA 3UAPA 3ZFBA 1AXDA 4KF9A 2IMIA 3LQ7A 5A1NB 5GSTA 4RI6A 3I69A 2PBJA 1U87A 1RK4A 2YV7A 4K0GA 3UVHA 6GSUA 1YQ1A 4O7HA 1GTUA 4NAXA 1MD4A 5GSSA 5ECSA 5DCGA 3VURA 4PQIA 4ECBA 1AQWA 1K0NA 3ISOA 3QAGA 4IQ1A 4KH7A 2C3QA 5A5KA 1EV4A 3Q74A 3FRCA 4PXOA 2J9HA 5EY6A 3FR3A 4BL7B 5DALB 1M9AA 1YJ6A 3IR4A 3DD3A 4FQUA 20GSA 12GSA 1M0UA 3G7JA 5FWGA 4PTSA 1K0DA 1PMTA 4ECCA 3DGQA 5EVOA 4ZB9A 4BVYB 1USBA 4IVFA 4PQHA 1V40A 5BMUA 4HOJA 3LG6A 1GWCA 4G0LA 3QR6A 1BF5A 5A4WA 1M9BA 4E68A 1BG1A 9GSSA 5J4UA 1JLVA 3SWLA 2C4JA 3IE3A 4JBBA 4OFTA 4N3ZA 4ECIA 5F07A 2CAQA 2F8FA 1MD3A 1AQVA 22GSA 4NHWA 2UZ8A 18GSA 2CZ3A 5HFKA 5D9TA 1PX7A 1TU8A 4GSSA 5A5HB 6GSVA 4ZXGA 5ECOB 1PX6A 4OFNA 4JZQA 3LYKA 1XW6A 3HMJG 1PN9A 2CZ2A 2A2SA 5A1NA 3H1NA 1GSDA 1GSUA 2EFEA 2EFCA 1GSQA 1LBKA 5DJMA 2ON5A 1MTCA 1IYIA 1XWKA 4L5OA 1TDIA 1Y1UA 5D9WA 4ACSA 4EXJA 6GSXA 5DDLA 2WRTA 4IKHA 3Q19A 4AKXB 3VK9A 5ECPB 1FW1A 4BL7A 5DALA 1ML6A 3F6DA 3ERGA 2ON7A 3GH6A 4BVYA 1GUHA 2R4VA 4MZWA 5DAKB 3I6AA 1U3IA 2R5GA 3NIVA 4YQMA 5J4VA 3G7IA 4I97A 4WR4A 2CVDA 4PX1A 2C3NA 4ZB6A 1N25A 4KDYA 6GSYA 1VF2A 3C8EA 3TOTA 4MF6A 3CSJA 4GLTA 6GSSA 5D9XA 1HNAA 1BYEA 3VPTA 1Y6EA 2DSAA 14GSA 4HZ2A 5AIVA 3IBHA 5FHIA 2OA7A 4Q5RA 3U6VA 1F3AA 5A34B 3UBKA 2GSSA 3RBTA 5A5HA 2GLRA 4F0CA 3HKRA 5JCUA 4N0VA 1C72A 2O5VA 4IS0A 3GTUB 3M1GA 4IW9A 1YY7A 1F3BA 4EE0A 4KSMA 4NHZA 4BVXB 4AKGA 1PA3A 3PR8A 2NTOA 4G10A 1VF1A 4OFMA 5AISA 2HSNB 3KJYA 5ECQB 1ZL9A 1B4PA 4YH2A 1UA5A 5D9VA 4GDFA 2X64A 4JEDA 1EV9A 4YQVA 4GSTA 2PGTA 1V2AA 1GSSA 4ZB7A 3PGTA 5DAKA 1PL2A 1SVMA 2OADA 3WD6A 4O92A 2R6KA 3GSSA 3ZFLA 5J47A 2HRAA 2AHEA 3FYGA 1K3YA 3P8WA 2VO4A 19GSA 5GZZB 1OE8A 1PKWA 3M3MA 5IQYA 1B48A 2PVQA 11GSA 3M0FA 2FNOA 4HZ4A 3KTLA 3CWGA 2EFDA 1JZRA 1OKTA 1F2EA 4KE3A 10GSA 1FHEA 13GSA 3LFLA 2V6KA 5A34A 2VD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1N A;  5BMU B;  4AKH A;  5A34 B;  4AI6 A;  4W66 A;  4AKI A;  5A34 A;  5A5H B;  4ZB7 A;  5A5H A;  5A1N B;  4AKG A; 
#chains in the Genus database with same CATH topology
 3RFR C;  5J5N A;  4CHS A;  4YQU A;  3IK7 A;  4PGT A;  4ZBB A;  4IJI A;  4MPF A;  5D73 A;  3GTU A;  17GS A;  4YAV A;  4ZB8 A;  3EIN A;  2JL4 A;  1U88 A;  1YVL A;  4IEL A;  3IC8 A;  3UBL A;  5A4V A;  1G7O A;  4HJ2 A;  1LJR A;  3R2Q A;  5EL8 A;  5ECL B;  1XW5 A;  2WB9 A;  2WVX B;  4E8E A;  1EOH A;  1OYJ A;  2HSN A;  1TW9 A;  3L0H A;  4E8H A;  1GUK A;  3LXZ A;  3TGZ A;  5ECM B;  2WDU A;  5DJL A;  4L5L A;  3VI7 A;  3AY8 A;  1GNW A;  2C3T A;  5F0G A;  1DUG A;  5F8B A;  5A4U A;  3P90 A;  1JLW A;  2AB6 A;  3KMO A;  2VKZ G;  6GST A;  2YCD A;  3EE2 A;  1IYH A;  1PGT A;  2F3M A;  3Q18 A;  5AN1 A;  5ECR B;  4AGS A;  8GSS A;  4AKI A;  3LSZ A;  4GSN A;  3QAV A;  1AW9 A;  4MPG A;  3R3E A;  4GF0 A;  1GLP A;  5G5E A;  2FHE A;  4PNG A;  4PUR A;  2N5F A;  4OMV A;  2VCW A;  4GCI A;  1GSY A;  5ELA A;  1A0F A;  2HRK B;  2IMK A;  3LYP A;  4DEJ A;  4PNF A;  5B7C A;  6GSW A;  3VLN A;  3HJM A;  4G0K A;  4KX4 A;  4PUA A;  1GUM A;  2D2Z A;  4MF7 A;  2GST A;  2VCT A;  2YV9 A;  1GLQ A;  4ZBA A;  2HSM B;  4IBP A;  5ECI B;  3MDK A;  2EFH A;  5J40 A;  3PPU A;  1BAY A;  5LD0 A;  3VPQ A;  1K3L A;  16GS A;  4YAP A;  2GSR A;  3FR6 A;  1YDK A;  3UAR A;  4K0N A;  3GX0 A;  4F03 A;  3GUR A;  4G19 A;  4QQ7 A;  1GSF A;  3FY7 A;  3N5O A;  4ZBD A;  3M8N A;  4LMV A;  1K0M A;  1VF3 A;  4KDX A;  1AQX A;  2OAC A;  5J41 A;  2DC5 A;  5ELG A;  1XWG A;  4USS A;  4TOP A;  2PER A;  3F6F A;  4HI7 A;  2WVX A;  3IK9 A;  3D0Z A;  1VF4 A;  1HQO A;  1NHY A;  1GSE A;  1TXU A;  4EDY A;  4AI6 A;  4W66 A;  2C8U A;  5DQS A;  2GTU A;  5F06 A;  1HNB A;  4MDC A;  1KBN A;  2AAW A;  2C80 A;  2PMT A;  3VWX A;  1EEM A;  1K0O A;  1PKZ A;  5ECH B;  4F0B A;  1SVL A;  4L8E A;  1G6W A;  4QMK A;  1E6B A;  4WR5 A;  4KAE A;  1PD2 1;  1GNE A;  3HJO A;  2WJU A;  4EC0 A;  4IGJ A;  4Q5N A;  1R5A A;  3CBU A;  3O76 A;  4AKH A;  4KGI A;  1I1I P;  2HRK A;  3ZMK A;  4MK3 A;  4G01 A;  2CA8 A;  1K0B A;  5ECN B;  2OT3 A;  1GTA A;  3VI5 A;  5KEJ A;  1BG5 A;  5G5F A;  2CAI A;  4PHZ C;  2HSM A;  1K0A A;  3KMN A;  5FT3 A;  4BVX A;  1SVO A;  5ECK B;  3BBY A;  5LCZ A;  4Q5F A;  2HQT A;  4RI7 A;  3CRT A;  4MF5 A;  2A2R A;  3FR9 A;  4Q5Q A;  1GTB A;  4GTU A;  1YKC A;  2WW2 A;  5AGY A;  1Z9H A;  1PL1 A;  1GTI A;  1TU7 A;  3F63 A;  1G6Y A;  1M99 A;  4EDZ A;  5JCW A;  3CRU A;  2VD1 A;  2VCV A;  4J2F A;  4ID0 A;  3W8S A;  2IL3 A;  1YEW C;  3CSI A;  3O3T A;  3ERF A;  7GSS A;  4KDU A;  3TOU A;  3GUS A;  2VCZ A;  1HNC A;  4ISD A;  2HNL A;  3QAW A;  4LMW A;  2VCX A;  4G0I A;  4PI2 C;  4MP4 A;  5BMU B;  1Q4J A;  2UV8 G;  3ZML A;  1GUL A;  2VCQ A;  5J4Y A;  3TU3 B;  2GSQ A;  4IQA A;  4ECJ A;  2WS2 A;  2LJR A;  3WYW A;  2WW3 A;  2R3X A;  3LXT A;  3GST A;  1BX9 A;  2GDR A;  1B8X A;  1ZGN A;  3LJR A;  2WVY A;  3KXO A;  1K3O A;  1OE7 A;  1N2A A;  1K0C A;  4G9H A;  3MAK A;  5AIX A;  2H1L A;  3CSH A;  3KM6 A;  1EOG A;  5F05 A;  3N9J A;  3UAP A;  3ZFB A;  1AXD A;  2WVZ A;  4KF9 A;  2IMI A;  3LQ7 A;  5A1N B;  5GST A;  4RI6 A;  3I69 A;  2PBJ A;  1U87 A;  1RK4 A;  2YV7 A;  4K0G A;  3UVH A;  6GSU A;  1YQ1 A;  4O7H A;  1GTU A;  4NAX A;  1MD4 A;  5GSS A;  5ECS A;  5DCG A;  3VUR A;  4PQI A;  4ECB A;  1AQW A;  1K0N A;  3ISO A;  3QAG A;  4IQ1 A;  4KH7 A;  2C3Q A;  5A5K A;  1EV4 A;  3Q74 A;  3FRC A;  4PXO A;  2J9H A;  5EY6 A;  3FR3 A;  4BL7 B;  5DAL B;  1M9A A;  1YJ6 A;  3IR4 A;  3DD3 A;  4FQU A;  20GS A;  12GS A;  1M0U A;  2WW0 A;  3G7J A;  5FWG A;  4PTS A;  1K0D A;  1PMT A;  4ECC A;  3DGQ A;  5EVO A;  4ZB9 A;  4BVY B;  2O36 A;  1USB A;  4IVF A;  4PQH A;  1V40 A;  5BMU A;  4HOJ A;  3LG6 A;  1GWC A;  4G0L A;  3QR6 A;  1BF5 A;  5A4W A;  1M9B A;  4E68 A;  3RGB C;  1BG1 A;  9GSS A;  5J4U A;  1JLV A;  3SWL A;  2C4J A;  3IE3 A;  4JBB A;  4OFT A;  4N3Z A;  4ECI A;  5F07 A;  2O3E A;  2CAQ A;  2F8F A;  1MD3 A;  1AQV A;  22GS A;  4NHW A;  2UZ8 A;  18GS A;  2CZ3 A;  5HFK A;  5D9T A;  1PX7 A;  1TU8 A;  4GSS A;  5A5H B;  6GSV A;  4ZXG A;  5ECO B;  1PX6 A;  4OFN A;  4JZQ A;  3LYK A;  1XW6 A;  3HMJ G;  1PN9 A;  2CZ2 A;  2A2S A;  5A1N A;  3H1N A;  1GSD A;  1GSU A;  2EFE A;  2EFC A;  1GSQ A;  1LBK A;  5DJM A;  2ON5 A;  1MTC A;  1IYI A;  1XWK A;  4L5O A;  1TDI A;  1Y1U A;  5D9W A;  4ACS A;  4EXJ A;  6GSX A;  5DDL A;  2WRT A;  4IKH A;  3Q19 A;  4AKX B;  3VK9 A;  5ECP B;  1FW1 A;  4BL7 A;  5DAL A;  1ML6 A;  3F6D A;  3ERG A;  2ON7 A;  3GH6 A;  2WZS A;  4BVY A;  1GUH A;  2R4V A;  4MZW A;  5DAK B;  2WW1 A;  3I6A A;  1U3I A;  2R5G A;  3NIV A;  4YQM A;  5J4V A;  3CHX C;  3G7I A;  4I97 A;  4WR4 A;  2CVD A;  4PX1 A;  2C3N A;  4ZB6 A;  1N25 A;  4KDY A;  6GSY A;  1VF2 A;  3C8E A;  3TOT A;  4MF6 A;  3CSJ A;  4GLT A;  6GSS A;  5D9X A;  1HNA A;  1BYE A;  3VPT A;  1Y6E A;  2DSA A;  14GS A;  4HZ2 A;  5AIV A;  3IBH A;  5FHI A;  2OA7 A;  4Q5R A;  3U6V A;  1F3A A;  5A34 B;  3UBK A;  2GSS A;  3RBT A;  4FXY P;  5A5H A;  2GLR A;  4F0C A;  1S4B P;  3HKR A;  5JCU A;  4N0V A;  1C72 A;  2O5V A;  4IS0 A;  3GTU B;  3M1G A;  4IW9 A;  1YY7 A;  1F3B A;  4EE0 A;  4KSM A;  4NHZ A;  4BVX B;  4AKG A;  1PA3 A;  3PR8 A;  2NTO A;  4G10 A;  1VF1 A;  4OFM A;  5AIS A;  2HSN B;  3KJY A;  5ECQ B;  1ZL9 A;  1B4P A;  4YH2 A;  1UA5 A;  5D9V A;  4GDF A;  2X64 A;  4JED A;  1EV9 A;  4YQV A;  4GST A;  2PGT A;  1V2A A;  1GSS A;  4ZB7 A;  3PGT A;  5DAK A;  1PL2 A;  1SVM A;  2OAD A;  4PI0 C;  3WD6 A;  4O92 A;  2R6K A;  3GSS A;  3ZFL A;  5J47 A;  2HRA A;  2AHE A;  3FYG A;  1K3Y A;  3P8W A;  2VO4 A;  19GS A;  5GZZ B;  1OE8 A;  1PKW A;  3M3M A;  5IQY A;  1B48 A;  2PVQ A;  11GS A;  3M0F A;  2FNO A;  4HZ4 A;  3KTL A;  3CWG A;  2EFD A;  1JZR A;  1OKT A;  1F2E A;  4KE3 A;  10GS A;  1FHE A;  13GS A;  3LFL A;  2V6K A;  5A34 A;  2VD0 A; 
#chains in the Genus database with same CATH homology
 5J5N A;  4CHS A;  4YQU A;  3IK7 A;  4PGT A;  4ZBB A;  4IJI A;  4MPF A;  5D73 A;  3GTU A;  17GS A;  4YAV A;  4ZB8 A;  3EIN A;  2JL4 A;  1U88 A;  1YVL A;  4IEL A;  3IC8 A;  3UBL A;  5A4V A;  1G7O A;  4HJ2 A;  1LJR A;  3R2Q A;  5EL8 A;  5ECL B;  1XW5 A;  2WB9 A;  4E8E A;  1EOH A;  1OYJ A;  2HSN A;  1TW9 A;  3L0H A;  4E8H A;  1GUK A;  3LXZ A;  3TGZ A;  5ECM B;  2WDU A;  5DJL A;  4L5L A;  3VI7 A;  3AY8 A;  1GNW A;  2C3T A;  5F0G A;  1DUG A;  5F8B A;  5A4U A;  3P90 A;  1JLW A;  2AB6 A;  3KMO A;  2VKZ G;  6GST A;  2YCD A;  3EE2 A;  1IYH A;  1PGT A;  2F3M A;  3Q18 A;  5AN1 A;  5ECR B;  4AGS A;  8GSS A;  4AKI A;  3LSZ A;  4GSN A;  3QAV A;  1AW9 A;  4MPG A;  3R3E A;  4GF0 A;  1GLP A;  5G5E A;  2FHE A;  4PNG A;  4PUR A;  2N5F A;  4OMV A;  2VCW A;  4GCI A;  1GSY A;  5ELA A;  1A0F A;  2HRK B;  2IMK A;  3LYP A;  4DEJ A;  4PNF A;  5B7C A;  6GSW A;  3VLN A;  3HJM A;  4G0K A;  4KX4 A;  4PUA A;  1GUM A;  2D2Z A;  4MF7 A;  2GST A;  2VCT A;  2YV9 A;  1GLQ A;  4ZBA A;  2HSM B;  4IBP A;  5ECI B;  3MDK A;  2EFH A;  5J40 A;  3PPU A;  1BAY A;  5LD0 A;  3VPQ A;  1K3L A;  16GS A;  4YAP A;  2GSR A;  3FR6 A;  1YDK A;  3UAR A;  4K0N A;  3GX0 A;  4F03 A;  3GUR A;  4G19 A;  4QQ7 A;  1GSF A;  3FY7 A;  3N5O A;  4ZBD A;  3M8N A;  4LMV A;  1K0M A;  1VF3 A;  4KDX A;  1AQX A;  2OAC A;  5J41 A;  2DC5 A;  5ELG A;  1XWG A;  4USS A;  4TOP A;  2PER A;  3F6F A;  4HI7 A;  3IK9 A;  3D0Z A;  1VF4 A;  1HQO A;  1NHY A;  1GSE A;  1TXU A;  4EDY A;  4AI6 A;  4W66 A;  2C8U A;  5DQS A;  2GTU A;  5F06 A;  1HNB A;  4MDC A;  1KBN A;  2AAW A;  2C80 A;  2PMT A;  3VWX A;  1EEM A;  1K0O A;  1PKZ A;  5ECH B;  4F0B A;  1SVL A;  4L8E A;  1G6W A;  4QMK A;  1E6B A;  4WR5 A;  4KAE A;  1PD2 1;  1GNE A;  3HJO A;  2WJU A;  4EC0 A;  4IGJ A;  4Q5N A;  1R5A A;  3CBU A;  3O76 A;  4AKH A;  4KGI A;  2HRK A;  3ZMK A;  4MK3 A;  4G01 A;  2CA8 A;  1K0B A;  5ECN B;  2OT3 A;  1GTA A;  3VI5 A;  5KEJ A;  1BG5 A;  5G5F A;  2CAI A;  2HSM A;  1K0A A;  3KMN A;  5FT3 A;  4BVX A;  1SVO A;  5ECK B;  3BBY A;  5LCZ A;  4Q5F A;  2HQT A;  4RI7 A;  3CRT A;  4MF5 A;  2A2R A;  3FR9 A;  4Q5Q A;  1GTB A;  4GTU A;  1YKC A;  5AGY A;  1Z9H A;  1PL1 A;  1GTI A;  1TU7 A;  3F63 A;  1G6Y A;  1M99 A;  4EDZ A;  5JCW A;  3CRU A;  2VD1 A;  2VCV A;  4J2F A;  4ID0 A;  3W8S A;  2IL3 A;  3CSI A;  3O3T A;  3ERF A;  7GSS A;  4KDU A;  3TOU A;  3GUS A;  2VCZ A;  1HNC A;  4ISD A;  2HNL A;  3QAW A;  4LMW A;  2VCX A;  4G0I A;  4MP4 A;  5BMU B;  1Q4J A;  2UV8 G;  3ZML A;  1GUL A;  2VCQ A;  5J4Y A;  3TU3 B;  2GSQ A;  4IQA A;  4ECJ A;  2WS2 A;  2LJR A;  3WYW A;  2R3X A;  3LXT A;  3GST A;  1BX9 A;  2GDR A;  1B8X A;  1ZGN A;  3LJR A;  3KXO A;  1K3O A;  1OE7 A;  1N2A A;  1K0C A;  4G9H A;  3MAK A;  5AIX A;  2H1L A;  3CSH A;  3KM6 A;  1EOG A;  5F05 A;  3N9J A;  3UAP A;  3ZFB A;  1AXD A;  4KF9 A;  2IMI A;  3LQ7 A;  5A1N B;  5GST A;  4RI6 A;  3I69 A;  2PBJ A;  1U87 A;  1RK4 A;  2YV7 A;  4K0G A;  3UVH A;  6GSU A;  1YQ1 A;  4O7H A;  1GTU A;  4NAX A;  1MD4 A;  5GSS A;  5ECS A;  5DCG A;  3VUR A;  4PQI A;  4ECB A;  1AQW A;  1K0N A;  3ISO A;  3QAG A;  4IQ1 A;  4KH7 A;  2C3Q A;  5A5K A;  1EV4 A;  3Q74 A;  3FRC A;  4PXO A;  2J9H A;  5EY6 A;  3FR3 A;  4BL7 B;  5DAL B;  1M9A A;  1YJ6 A;  3IR4 A;  3DD3 A;  4FQU A;  20GS A;  12GS A;  1M0U A;  3G7J A;  5FWG A;  4PTS A;  1K0D A;  1PMT A;  4ECC A;  3DGQ A;  5EVO A;  4ZB9 A;  4BVY B;  1USB A;  4IVF A;  4PQH A;  1V40 A;  5BMU A;  4HOJ A;  3LG6 A;  1GWC A;  4G0L A;  3QR6 A;  1BF5 A;  5A4W A;  1M9B A;  4E68 A;  1BG1 A;  9GSS A;  5J4U A;  1JLV A;  3SWL A;  2C4J A;  3IE3 A;  4JBB A;  4OFT A;  4N3Z A;  4ECI A;  5F07 A;  2CAQ A;  2F8F A;  1MD3 A;  1AQV A;  22GS A;  4NHW A;  2UZ8 A;  18GS A;  2CZ3 A;  5HFK A;  5D9T A;  1PX7 A;  1TU8 A;  4GSS A;  5A5H B;  6GSV A;  4ZXG A;  5ECO B;  1PX6 A;  4OFN A;  4JZQ A;  3LYK A;  1XW6 A;  3HMJ G;  1PN9 A;  2CZ2 A;  2A2S A;  5A1N A;  3H1N A;  1GSD A;  1GSU A;  2EFE A;  2EFC A;  1GSQ A;  1LBK A;  5DJM A;  2ON5 A;  1MTC A;  1IYI A;  1XWK A;  4L5O A;  1TDI A;  1Y1U A;  5D9W A;  4ACS A;  4EXJ A;  6GSX A;  5DDL A;  2WRT A;  4IKH A;  3Q19 A;  4AKX B;  3VK9 A;  5ECP B;  1FW1 A;  4BL7 A;  5DAL A;  1ML6 A;  3F6D A;  3ERG A;  2ON7 A;  3GH6 A;  4BVY A;  1GUH A;  2R4V A;  4MZW A;  5DAK B;  3I6A A;  1U3I A;  2R5G A;  3NIV A;  4YQM A;  5J4V A;  3G7I A;  4I97 A;  4WR4 A;  2CVD A;  4PX1 A;  2C3N A;  4ZB6 A;  1N25 A;  4KDY A;  6GSY A;  1VF2 A;  3C8E A;  3TOT A;  4MF6 A;  3CSJ A;  4GLT A;  6GSS A;  5D9X A;  1HNA A;  1BYE A;  3VPT A;  1Y6E A;  2DSA A;  14GS A;  4HZ2 A;  5AIV A;  3IBH A;  5FHI A;  2OA7 A;  4Q5R A;  3U6V A;  1F3A A;  5A34 B;  3UBK A;  2GSS A;  3RBT A;  5A5H A;  2GLR A;  4F0C A;  3HKR A;  5JCU A;  4N0V A;  1C72 A;  2O5V A;  4IS0 A;  3GTU B;  3M1G A;  4IW9 A;  1YY7 A;  1F3B A;  4EE0 A;  4KSM A;  4NHZ A;  4BVX B;  4AKG A;  1PA3 A;  3PR8 A;  2NTO A;  4G10 A;  1VF1 A;  4OFM A;  5AIS A;  2HSN B;  3KJY A;  5ECQ B;  1ZL9 A;  1B4P A;  4YH2 A;  1UA5 A;  5D9V A;  4GDF A;  2X64 A;  4JED A;  1EV9 A;  4YQV A;  4GST A;  2PGT A;  1V2A A;  1GSS A;  4ZB7 A;  3PGT A;  5DAK A;  1PL2 A;  1SVM A;  2OAD A;  3WD6 A;  4O92 A;  2R6K A;  3GSS A;  3ZFL A;  5J47 A;  2HRA A;  2AHE A;  3FYG A;  1K3Y A;  3P8W A;  2VO4 A;  19GS A;  5GZZ B;  1OE8 A;  1PKW A;  3M3M A;  5IQY A;  1B48 A;  2PVQ A;  11GS A;  3M0F A;  2FNO A;  4HZ4 A;  3KTL A;  3CWG A;  2EFD A;  1JZR A;  1OKT A;  1F2E A;  4KE3 A;  10GS A;  1FHE A;  13GS A;  3LFL A;  2V6K A;  5A34 A;  2VD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...