5A5HA

The crystal structure of the gst-like domains complex of eprs c92sc105sc123s mutant-aimp2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
168
structure length
168
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSSDSFTSTINELNHSLSLRTYLVGNSLSLADLSVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs C92Sc105Sc123S Mutant-Aimp2
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 54
structure length 168
sequence length 168
chains with identical sequence C, E, G
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5hA00
4AKHA 4AKGA 4W66A 5A5HB 5A34B 5A1NB 5A5HA 5A34A 5A1NA 4AKIA 5BMUB 4AI6A 4ZB7A
chains in the Genus database with same CATH superfamily
2A2SA 4K0NA 2GLRA 3M1GA 3GTUB 3FY7A 1MD3A 4QQ7A 1AQVA 2CAIA 5F06A 4Q5NA 2FHEA 5ECKB 3ZFLA 4ID0A 1PMTA 3UVHA 4EDYA 5DQSA 4IS0A 14GSA 2WW1A 3N5OA 4G19A 1M99A 5ECPB 3RBTA 2WW2A 1ZL9A 5A5HB 1YY7A 2IMKA 5J40A 3G7IA 2GSSA 2FNOA 1PN9A 3ISOA 2X64A 5DCGA 3HMJG 1N25A 5LCZA 4HZ2A 3VI7A 4BL7A 3GUSA 3GH6A 1U87A 1SVMA 2O3EA 2F3MA 1C72A 2EFDA 1XWKA 4AI6A 2C80A 1XW5A 1V40A 4FQUA 3UBLA 2GSQA 3DD3A 1K3OA 1GSSA 4ECCA 5D9WA 1TXUA 4Q5QA 3LXZA 2PBJA 2EFCA 5DAKA 5J5NA 1USBA 2J9HA 2R5GA 4KX4A 4KAEA 2C8UA 3VLNA 5A34B 2VCZA 4G10A 1G7OA 3RGBC 4NAXA 1K0OA 4ZXGA 5HFKA 3LQ7A 3F6DA 13GSA 3F63A 1AQWA 1M9AA 1PA3A 4PI2C 3PGTA 1KBNA 1M0UA 1S4BP 3CBUA 5ECNB 4MDCA 5J4UA 4Q5FA 3IR4A 4IQAA 2VCVA 3C8EA 4GF0A 3R2QA 1DUGA 2UV8G 6GSWA 1GUKA 1BAYA 4ZB6A 1K3LA 4PQHA 1GSDA 3CSIA 3IBHA 1AW9A 1K0AA 4LMVA 4PUAA 5DJMA 4DEJA 1MD4A 3LFLA 3CWGA 1ML6A 3KM6A 4JZQA 2YV9A 2A2RA 4E8EA 1EV4A 1K0DA 4RI6A 1GULA 5JCWA 1BX9A 1A0FA 3MAKA 1TW9A 5A4VA 3LYKA 4HZ4A 4G0KA 3EE2A 2PVQA 2GDRA 1B4PA 1BG1A 3KXOA 5EVOA 4ECIA 2ON7A 1AXDA 18GSA 4EE0A 4OFMA 3FR6A 1SVLA 3IC8A 4BVXB 1XWGA 2LJRA 4MP4A 2VCXA 3ZFBA 3W8SA 2DSAA 2N5FA 4MK3A 3I69A 4O92A 4YQMA 1PX7A 2PGTA 4WR5A 4MPGA 1GUHA 4AGSA 4PI0C 3QAWA 1MTCA 2PMTA 2IMIA 4MF6A 5ECSA 3Q74A 2UZ8A 3N9JA 1HNAA 1GTAA 3O76A 4LMWA 4KDUA 3QR6A 2HSNA 2EFHA 2HRAA 1GNWA 3M3MA 4NHZA 5G5EA 1VF2A 4IGJA 3DGQA 4IW9A 2CA8A 1VF1A 1TDIA 8GSSA 9GSSA 2WJUA 4GSTA 4MPFA 1PKZA 4ZB9A 2HSMB 4GCIA 3FR3A 1GTUA 5F07A 4QMKA 5A1NB 2OA7A 1K0MA 4EC0A 1I1IP 1FW1A 3LSZA 4GLTA 3M8NA 4PHZC 3GX0A 1ZGNA 4PGTA 4BVYA 1IYIA 4ZBDA 3UARA 5ECMB 5IQYA 3ZMLA 5A5KA 1Z9HA 3GURA 2OADA 3VURA 7GSSA 2CAQA 3FRCA 4KGIA 4YQVA 5JCUA 5F05A 5DALA 19GSA 1F2EA 2WVYA 4HI7A 5GZZB 4GTUA 4IKHA 3TU3B 2WVXB 4YQUA 1GWCA 1PX6A 4G0IA 1YJ6A 1K3YA 1EOGA 2WZSA 4G01A 2CZ2A 5D73A 1GSUA 1B48A 2CVDA 4IELA 4IVFA 5BMUB 4K0GA 3QAVA 1GSQA 3QAGA 3TOTA 2VD0A 4GDFA 1EOHA 5ECIB 5DDLA 3TGZA 2WVZA 2H1LA 4IBPA 3PR8A 2ON5A 3ERFA 1OKTA 4L8EA 3Q18A 1G6WA 1PGTA 3MDKA 4JBBA 2GSTA 1GTIA 1IYHA 1VF4A 2O5VA 4GSNA 3RFRC 4BL7B 5A4UA 3Q19A 3BBYA 3GTUA 5DJLA 4G0LA 1YDKA 4KDYA 1LBKA 4F0CA 2C3QA 3U6VA 4G9HA 2OACA 6GSYA 1UA5A 1YVLA 3NIVA 5ELGA 5F0GA 5A5HA 1GLPA 5DAKB 4MZWA 5KEJA 6GSSA 4KF9A 2YV7A 4ECJA 1SVOA 3IE3A 1YQ1A 2AB6A 1U3IA 2O36A 1JLVA 4IJIA 6GSXA 3G7JA 4HOJA 5LD0A 5AN1A 2CZ3A 5ECLB 4L5LA 4OMVA 5ECHB 2VO4A 5F8BA 4F03A 2C4JA 2R6KA 4PTSA 4KDXA 3I6AA 5EL8A 4CHSA 6GSVA 3P90A 1F3AA 2DC5A 1M9BA 2WRTA 4ZB8A 3GSTA 5ECOB 1R5AA 1GSEA 2WS2A 5J4YA 5A34A 2JL4A 5AIVA 4ZB7A 4AKHA 6GSUA 4J2FA 3HJMA 3KMOA 1GNEA 1GUMA 1FHEA 4E8HA 2GSRA 5BMUA 1JZRA 3VWXA 4F0BA 1EEMA 3CSJA 5GSSA 2EFEA 4RI7A 2VCQA 5FHIA 3L0HA 4EXJA 4KH7A 3HKRA 5AIXA 2C3TA 4GSSA 2AHEA 2NTOA 3WYWA 2HRKB 3KMNA 4WR4A 4AKGA 3IK9A 3CRUA 4O7HA 1NHYA 5ELAA 1TU8A 3LYPA 3UBKA 5AGYA 4KE3A 11GSA 1HNCA 3O3TA 10GSA 4Q5RA 4I97A 2V6KA 4ECBA 1Q4JA 2VCWA 4ZBBA 4EDZA 1V2AA 5J41A 3FR9A 3LJRA 2PERA 4JEDA 3WD6A 4PNFA 1U88A 4USSA 3CRTA 1PD21 20GSA 3ZMKA 3AY8A 1HNBA 3VPQA 2VD1A 2HQTA 1GSFA 2VCTA 5FWGA 1PKWA 3LXTA 1Y6EA 4NHWA 2HSNB 1GTBA 1XW6A 4L5OA 3PPUA 1GLQA 1B8XA 16GSA 4KSMA 4E68A 1GSYA 4BVXA 5FT3A 5G5FA 4PX1A 1E6BA 2GTUA 4AKIA 2R3XA 1YKCA 5B7CA 1OYJA 3VPTA 4PQIA 2R4VA 5D9VA 2YCDA 22GSA 3M0FA 2F8FA 1PL1A 2OT3A 1AQXA 2WB9A 1PL2A 1HQOA 1VF3A 2WW3A 1RK4A 3D0ZA 3EINA 4W66A 4PNGA 2AAWA 3KTLA 4ISDA 3LG6A 1YEWC 1K0CA 4BVYB 5A4WA 4N0VA 1Y1UA 3UAPA 2D2ZA 2WDUA 3GSSA 3SWLA 4AKXB 4HJ2A 3ERGA 5AISA 3CSHA 3TOUA 2HSMA 3KJYA 5DALB 3FYGA 1BF5A 3R3EA 17GSA 4TOPA 3HJOA 5GSTA 5A1NA 1LJRA 1K0NA 3H1NA 1JLWA 4OFNA 5J47A 4MF7A 2HRKA 3F6FA 1K0BA 4ZBAA 4ACSA 5D9TA 12GSA 3P8WA 2WW0A 4FXYP 1OE8A 5ECQB 4YAVA 1EV9A 1TU7A 1OE7A 3CHXC 3VI5A 6GSTA 3IK7A 4YAPA 4YH2A 1N2AA 2C3NA 1F3BA 4MF5A 4PURA 5ECRB 5EY6A 2WVXA 1BYEA 4PXOA 5D9XA 2VKZG 3VK9A 1G6YA 4N3ZA 4OFTA 2HNLA 2IL3A 4IQ1A 5J4VA 1BG5A
chains in the Genus database with same CATH topology
2A2SA 4K0NA 2GLRA 3M1GA 3GTUB 3FY7A 1MD3A 4QQ7A 1AQVA 2CAIA 5F06A 4Q5NA 2FHEA 5ECKB 3ZFLA 4ID0A 1PMTA 3UVHA 4EDYA 5DQSA 4IS0A 14GSA 3N5OA 4G19A 1M99A 5ECPB 3RBTA 1ZL9A 5A5HB 1YY7A 2IMKA 5J40A 3G7IA 2GSSA 2FNOA 1PN9A 3ISOA 2X64A 5DCGA 3HMJG 1N25A 5LCZA 4HZ2A 3VI7A 4BL7A 3GUSA 3GH6A 1U87A 1SVMA 2F3MA 1C72A 2EFDA 1XWKA 4AI6A 2C80A 1XW5A 1V40A 4FQUA 3UBLA 2GSQA 3DD3A 1K3OA 1GSSA 4ECCA 5D9WA 1TXUA 4Q5QA 3LXZA 2PBJA 2EFCA 5DAKA 5J5NA 1USBA 2J9HA 2R5GA 4KX4A 4KAEA 2C8UA 3VLNA 5A34B 2VCZA 4G10A 1G7OA 4NAXA 1K0OA 4ZXGA 5HFKA 3LQ7A 3F6DA 13GSA 3F63A 1AQWA 1M9AA 1PA3A 3PGTA 1KBNA 1M0UA 3CBUA 5ECNB 4MDCA 5J4UA 4Q5FA 3IR4A 4IQAA 2VCVA 3C8EA 4GF0A 3R2QA 1DUGA 2UV8G 6GSWA 1GUKA 1BAYA 4ZB6A 1K3LA 4PQHA 1GSDA 3CSIA 3IBHA 1AW9A 1K0AA 4LMVA 4PUAA 5DJMA 4DEJA 1MD4A 3LFLA 3CWGA 1ML6A 3KM6A 4JZQA 2YV9A 2A2RA 4E8EA 1EV4A 1K0DA 4RI6A 1GULA 5JCWA 1BX9A 1A0FA 3MAKA 1TW9A 5A4VA 3LYKA 4HZ4A 4G0KA 3EE2A 2PVQA 2GDRA 1B4PA 1BG1A 3KXOA 5EVOA 4ECIA 2ON7A 1AXDA 18GSA 4EE0A 4OFMA 3FR6A 1SVLA 3IC8A 4BVXB 1XWGA 2LJRA 4MP4A 2VCXA 3ZFBA 3W8SA 2DSAA 2N5FA 4MK3A 3I69A 4O92A 4YQMA 1PX7A 2PGTA 4WR5A 4MPGA 1GUHA 4AGSA 3QAWA 1MTCA 2PMTA 2IMIA 4MF6A 5ECSA 3Q74A 2UZ8A 3N9JA 1HNAA 1GTAA 3O76A 4LMWA 4KDUA 3QR6A 2HSNA 2EFHA 2HRAA 1GNWA 3M3MA 4NHZA 5G5EA 1VF2A 4IGJA 3DGQA 4IW9A 2CA8A 1VF1A 1TDIA 8GSSA 9GSSA 2WJUA 4GSTA 4MPFA 1PKZA 4ZB9A 2HSMB 4GCIA 3FR3A 1GTUA 5F07A 4QMKA 5A1NB 2OA7A 1K0MA 4EC0A 1FW1A 3LSZA 4GLTA 3M8NA 3GX0A 1ZGNA 4PGTA 4BVYA 1IYIA 4ZBDA 3UARA 5ECMB 5IQYA 3ZMLA 5A5KA 1Z9HA 3GURA 2OADA 3VURA 7GSSA 2CAQA 3FRCA 4KGIA 4YQVA 5JCUA 5F05A 5DALA 19GSA 1F2EA 4HI7A 5GZZB 4GTUA 4IKHA 3TU3B 4YQUA 1GWCA 1PX6A 4G0IA 1YJ6A 1K3YA 1EOGA 4G01A 2CZ2A 5D73A 1GSUA 1B48A 2CVDA 4IELA 4IVFA 5BMUB 4K0GA 3QAVA 1GSQA 3QAGA 3TOTA 2VD0A 4GDFA 1EOHA 5ECIB 5DDLA 3TGZA 2H1LA 4IBPA 3PR8A 2ON5A 3ERFA 1OKTA 4L8EA 3Q18A 1G6WA 1PGTA 3MDKA 4JBBA 2GSTA 1GTIA 1IYHA 1VF4A 2O5VA 4GSNA 4BL7B 5A4UA 3Q19A 3BBYA 3GTUA 5DJLA 4G0LA 1YDKA 4KDYA 1LBKA 4F0CA 2C3QA 3U6VA 4G9HA 2OACA 6GSYA 1UA5A 1YVLA 3NIVA 5ELGA 5F0GA 5A5HA 1GLPA 5DAKB 4MZWA 5KEJA 6GSSA 4KF9A 2YV7A 4ECJA 1SVOA 3IE3A 1YQ1A 2AB6A 1U3IA 1JLVA 4IJIA 6GSXA 3G7JA 4HOJA 5LD0A 5AN1A 2CZ3A 5ECLB 4L5LA 4OMVA 5ECHB 2VO4A 5F8BA 4F03A 2C4JA 2R6KA 4PTSA 4KDXA 3I6AA 5EL8A 4CHSA 6GSVA 3P90A 1F3AA 2DC5A 1M9BA 2WRTA 4ZB8A 3GSTA 5ECOB 1R5AA 1GSEA 2WS2A 5J4YA 5A34A 2JL4A 5AIVA 4ZB7A 4AKHA 6GSUA 4J2FA 3HJMA 3KMOA 1GNEA 1GUMA 1FHEA 4E8HA 2GSRA 5BMUA 1JZRA 3VWXA 4F0BA 1EEMA 3CSJA 5GSSA 2EFEA 4RI7A 2VCQA 5FHIA 3L0HA 4EXJA 4KH7A 3HKRA 5AIXA 2C3TA 4GSSA 2AHEA 2NTOA 3WYWA 2HRKB 3KMNA 4WR4A 4AKGA 3IK9A 3CRUA 4O7HA 1NHYA 5ELAA 1TU8A 3LYPA 3UBKA 5AGYA 4KE3A 11GSA 3O3TA 1HNCA 10GSA 4Q5RA 4I97A 2V6KA 4ECBA 1Q4JA 2VCWA 4ZBBA 4EDZA 1V2AA 5J41A 3FR9A 3LJRA 2PERA 4JEDA 3WD6A 4PNFA 1U88A 4USSA 3CRTA 1PD21 20GSA 3ZMKA 3AY8A 1HNBA 3VPQA 2VD1A 2HQTA 1GSFA 2VCTA 5FWGA 1PKWA 3LXTA 1Y6EA 4NHWA 2HSNB 1GTBA 1XW6A 4L5OA 3PPUA 1GLQA 1B8XA 16GSA 4KSMA 4E68A 1GSYA 4BVXA 5FT3A 5G5FA 4PX1A 1E6BA 2GTUA 4AKIA 2R3XA 1YKCA 5B7CA 1OYJA 3VPTA 4PQIA 2R4VA 5D9VA 2YCDA 22GSA 3M0FA 2F8FA 1PL1A 2OT3A 1AQXA 2WB9A 1PL2A 1HQOA 1VF3A 1RK4A 3D0ZA 3EINA 4W66A 4PNGA 2AAWA 3KTLA 4ISDA 3LG6A 1K0CA 4BVYB 5A4WA 4N0VA 1Y1UA 3UAPA 2D2ZA 2WDUA 3GSSA 3SWLA 4AKXB 4HJ2A 3ERGA 5AISA 3CSHA 3TOUA 2HSMA 3KJYA 5DALB 3FYGA 1BF5A 3R3EA 17GSA 4TOPA 3HJOA 5GSTA 5A1NA 1LJRA 1K0NA 3H1NA 1JLWA 4OFNA 5J47A 4MF7A 2HRKA 3F6FA 1K0BA 4ZBAA 4ACSA 5D9TA 12GSA 3P8WA 1OE8A 5ECQB 4YAVA 1EV9A 1TU7A 1OE7A 3VI5A 6GSTA 3IK7A 4YAPA 4YH2A 1N2AA 2C3NA 1F3BA 4MF5A 4PURA 5ECRB 5EY6A 1BYEA 4PXOA 5D9XA 2VKZG 3VK9A 1G6YA 4N3ZA 4OFTA 2HNLA 2IL3A 4IQ1A 5J4VA 1BG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKH A;  4AKG A;  4W66 A;  5A5H B;  5A34 B;  5A1N B;  5A5H A;  5A34 A;  5A1N A;  4AKI A;  5BMU B;  4AI6 A;  4ZB7 A; 
#chains in the Genus database with same CATH topology
 2A2S A;  4K0N A;  2GLR A;  3M1G A;  3GTU B;  3FY7 A;  1MD3 A;  4QQ7 A;  1AQV A;  2CAI A;  5F06 A;  4Q5N A;  2FHE A;  5ECK B;  3ZFL A;  4ID0 A;  1PMT A;  3UVH A;  4EDY A;  5DQS A;  4IS0 A;  14GS A;  2WW1 A;  3N5O A;  4G19 A;  1M99 A;  5ECP B;  3RBT A;  2WW2 A;  1ZL9 A;  5A5H B;  1YY7 A;  2IMK A;  5J40 A;  3G7I A;  2GSS A;  2FNO A;  1PN9 A;  3ISO A;  2X64 A;  5DCG A;  3HMJ G;  1N25 A;  5LCZ A;  4HZ2 A;  3VI7 A;  4BL7 A;  3GUS A;  3GH6 A;  1U87 A;  1SVM A;  2O3E A;  2F3M A;  1C72 A;  2EFD A;  1XWK A;  4AI6 A;  2C80 A;  1XW5 A;  1V40 A;  4FQU A;  3UBL A;  2GSQ A;  3DD3 A;  1K3O A;  1GSS A;  4ECC A;  5D9W A;  1TXU A;  4Q5Q A;  3LXZ A;  2PBJ A;  2EFC A;  5DAK A;  5J5N A;  1USB A;  2J9H A;  2R5G A;  4KX4 A;  4KAE A;  2C8U A;  3VLN A;  5A34 B;  2VCZ A;  4G10 A;  1G7O A;  3RGB C;  4NAX A;  1K0O A;  4ZXG A;  5HFK A;  3LQ7 A;  3F6D A;  13GS A;  3F63 A;  1AQW A;  1M9A A;  1PA3 A;  4PI2 C;  3PGT A;  1KBN A;  1M0U A;  1S4B P;  3CBU A;  5ECN B;  4MDC A;  5J4U A;  4Q5F A;  3IR4 A;  4IQA A;  2VCV A;  3C8E A;  4GF0 A;  3R2Q A;  1DUG A;  2UV8 G;  6GSW A;  1GUK A;  1BAY A;  4ZB6 A;  1K3L A;  4PQH A;  1GSD A;  3CSI A;  3IBH A;  1AW9 A;  1K0A A;  4LMV A;  4PUA A;  5DJM A;  4DEJ A;  1MD4 A;  3LFL A;  3CWG A;  1ML6 A;  3KM6 A;  4JZQ A;  2YV9 A;  2A2R A;  4E8E A;  1EV4 A;  1K0D A;  4RI6 A;  1GUL A;  5JCW A;  1BX9 A;  1A0F A;  3MAK A;  1TW9 A;  5A4V A;  3LYK A;  4HZ4 A;  4G0K A;  3EE2 A;  2PVQ A;  2GDR A;  1B4P A;  1BG1 A;  3KXO A;  5EVO A;  4ECI A;  2ON7 A;  1AXD A;  18GS A;  4EE0 A;  4OFM A;  3FR6 A;  1SVL A;  3IC8 A;  4BVX B;  1XWG A;  2LJR A;  4MP4 A;  2VCX A;  3ZFB A;  3W8S A;  2DSA A;  2N5F A;  4MK3 A;  3I69 A;  4O92 A;  4YQM A;  1PX7 A;  2PGT A;  4WR5 A;  4MPG A;  1GUH A;  4AGS A;  4PI0 C;  3QAW A;  1MTC A;  2PMT A;  2IMI A;  4MF6 A;  5ECS A;  3Q74 A;  2UZ8 A;  3N9J A;  1HNA A;  1GTA A;  3O76 A;  4LMW A;  4KDU A;  3QR6 A;  2HSN A;  2EFH A;  2HRA A;  1GNW A;  3M3M A;  4NHZ A;  5G5E A;  1VF2 A;  4IGJ A;  3DGQ A;  4IW9 A;  2CA8 A;  1VF1 A;  1TDI A;  8GSS A;  9GSS A;  2WJU A;  4GST A;  4MPF A;  1PKZ A;  4ZB9 A;  2HSM B;  4GCI A;  3FR3 A;  1GTU A;  5F07 A;  4QMK A;  5A1N B;  2OA7 A;  1K0M A;  4EC0 A;  1I1I P;  1FW1 A;  3LSZ A;  4GLT A;  3M8N A;  4PHZ C;  3GX0 A;  1ZGN A;  4PGT A;  4BVY A;  1IYI A;  4ZBD A;  3UAR A;  5ECM B;  5IQY A;  3ZML A;  5A5K A;  1Z9H A;  3GUR A;  2OAD A;  3VUR A;  7GSS A;  2CAQ A;  3FRC A;  4KGI A;  4YQV A;  5JCU A;  5F05 A;  5DAL A;  19GS A;  1F2E A;  2WVY A;  4HI7 A;  5GZZ B;  4GTU A;  4IKH A;  3TU3 B;  2WVX B;  4YQU A;  1GWC A;  1PX6 A;  4G0I A;  1YJ6 A;  1K3Y A;  1EOG A;  2WZS A;  4G01 A;  2CZ2 A;  5D73 A;  1GSU A;  1B48 A;  2CVD A;  4IEL A;  4IVF A;  5BMU B;  4K0G A;  3QAV A;  1GSQ A;  3QAG A;  3TOT A;  2VD0 A;  4GDF A;  1EOH A;  5ECI B;  5DDL A;  3TGZ A;  2WVZ A;  2H1L A;  4IBP A;  3PR8 A;  2ON5 A;  3ERF A;  1OKT A;  4L8E A;  3Q18 A;  1G6W A;  1PGT A;  3MDK A;  4JBB A;  2GST A;  1GTI A;  1IYH A;  1VF4 A;  2O5V A;  4GSN A;  3RFR C;  4BL7 B;  5A4U A;  3Q19 A;  3BBY A;  3GTU A;  5DJL A;  4G0L A;  1YDK A;  4KDY A;  1LBK A;  4F0C A;  2C3Q A;  3U6V A;  4G9H A;  2OAC A;  6GSY A;  1UA5 A;  1YVL A;  3NIV A;  5ELG A;  5F0G A;  5A5H A;  1GLP A;  5DAK B;  4MZW A;  5KEJ A;  6GSS A;  4KF9 A;  2YV7 A;  4ECJ A;  1SVO A;  3IE3 A;  1YQ1 A;  2AB6 A;  1U3I A;  2O36 A;  1JLV A;  4IJI A;  6GSX A;  3G7J A;  4HOJ A;  5LD0 A;  5AN1 A;  2CZ3 A;  5ECL B;  4L5L A;  4OMV A;  5ECH B;  2VO4 A;  5F8B A;  4F03 A;  2C4J A;  2R6K A;  4PTS A;  4KDX A;  3I6A A;  5EL8 A;  4CHS A;  6GSV A;  3P90 A;  1F3A A;  2DC5 A;  1M9B A;  2WRT A;  4ZB8 A;  3GST A;  5ECO B;  1R5A A;  1GSE A;  2WS2 A;  5J4Y A;  5A34 A;  2JL4 A;  5AIV A;  4ZB7 A;  4AKH A;  6GSU A;  4J2F A;  3HJM A;  3KMO A;  1GNE A;  1GUM A;  1FHE A;  4E8H A;  2GSR A;  5BMU A;  1JZR A;  3VWX A;  4F0B A;  1EEM A;  3CSJ A;  5GSS A;  2EFE A;  4RI7 A;  2VCQ A;  5FHI A;  3L0H A;  4EXJ A;  4KH7 A;  3HKR A;  5AIX A;  2C3T A;  4GSS A;  2AHE A;  2NTO A;  3WYW A;  2HRK B;  3KMN A;  4WR4 A;  4AKG A;  3IK9 A;  3CRU A;  4O7H A;  1NHY A;  5ELA A;  1TU8 A;  3LYP A;  3UBK A;  5AGY A;  4KE3 A;  11GS A;  1HNC A;  3O3T A;  10GS A;  4Q5R A;  4I97 A;  2V6K A;  4ECB A;  1Q4J A;  2VCW A;  4ZBB A;  4EDZ A;  1V2A A;  5J41 A;  3FR9 A;  3LJR A;  2PER A;  4JED A;  3WD6 A;  4PNF A;  1U88 A;  4USS A;  3CRT A;  1PD2 1;  20GS A;  3ZMK A;  3AY8 A;  1HNB A;  3VPQ A;  2VD1 A;  2HQT A;  1GSF A;  2VCT A;  5FWG A;  1PKW A;  3LXT A;  1Y6E A;  4NHW A;  2HSN B;  1GTB A;  1XW6 A;  4L5O A;  3PPU A;  1GLQ A;  1B8X A;  16GS A;  4KSM A;  4E68 A;  1GSY A;  4BVX A;  5FT3 A;  5G5F A;  4PX1 A;  1E6B A;  2GTU A;  4AKI A;  2R3X A;  1YKC A;  5B7C A;  1OYJ A;  3VPT A;  4PQI A;  2R4V A;  5D9V A;  2YCD A;  22GS A;  3M0F A;  2F8F A;  1PL1 A;  2OT3 A;  1AQX A;  2WB9 A;  1PL2 A;  1HQO A;  1VF3 A;  2WW3 A;  1RK4 A;  3D0Z A;  3EIN A;  4W66 A;  4PNG A;  2AAW A;  3KTL A;  4ISD A;  3LG6 A;  1YEW C;  1K0C A;  4BVY B;  5A4W A;  4N0V A;  1Y1U A;  3UAP A;  2D2Z A;  2WDU A;  3GSS A;  3SWL A;  4AKX B;  4HJ2 A;  3ERG A;  5AIS A;  3CSH A;  3TOU A;  2HSM A;  3KJY A;  5DAL B;  3FYG A;  1BF5 A;  3R3E A;  17GS A;  4TOP A;  3HJO A;  5GST A;  5A1N A;  1LJR A;  1K0N A;  3H1N A;  1JLW A;  4OFN A;  5J47 A;  4MF7 A;  2HRK A;  3F6F A;  1K0B A;  4ZBA A;  4ACS A;  5D9T A;  12GS A;  3P8W A;  2WW0 A;  4FXY P;  1OE8 A;  5ECQ B;  4YAV A;  1EV9 A;  1TU7 A;  1OE7 A;  3CHX C;  3VI5 A;  6GST A;  3IK7 A;  4YAP A;  4YH2 A;  1N2A A;  2C3N A;  1F3B A;  4MF5 A;  4PUR A;  5ECR B;  5EY6 A;  2WVX A;  1BYE A;  4PXO A;  5D9X A;  2VKZ G;  3VK9 A;  1G6Y A;  4N3Z A;  4OFT A;  2HNL A;  2IL3 A;  4IQ1 A;  5J4V A;  1BG5 A; 
#chains in the Genus database with same CATH homology
 2A2S A;  4K0N A;  2GLR A;  3M1G A;  3GTU B;  3FY7 A;  1MD3 A;  4QQ7 A;  1AQV A;  2CAI A;  5F06 A;  4Q5N A;  2FHE A;  5ECK B;  3ZFL A;  4ID0 A;  1PMT A;  3UVH A;  4EDY A;  5DQS A;  4IS0 A;  14GS A;  3N5O A;  4G19 A;  1M99 A;  5ECP B;  3RBT A;  1ZL9 A;  5A5H B;  1YY7 A;  2IMK A;  5J40 A;  3G7I A;  2GSS A;  2FNO A;  1PN9 A;  3ISO A;  2X64 A;  5DCG A;  3HMJ G;  1N25 A;  5LCZ A;  4HZ2 A;  3VI7 A;  4BL7 A;  3GUS A;  3GH6 A;  1U87 A;  1SVM A;  2F3M A;  1C72 A;  2EFD A;  1XWK A;  4AI6 A;  2C80 A;  1XW5 A;  1V40 A;  4FQU A;  3UBL A;  2GSQ A;  3DD3 A;  1K3O A;  1GSS A;  4ECC A;  5D9W A;  1TXU A;  4Q5Q A;  3LXZ A;  2PBJ A;  2EFC A;  5DAK A;  5J5N A;  1USB A;  2J9H A;  2R5G A;  4KX4 A;  4KAE A;  2C8U A;  3VLN A;  5A34 B;  2VCZ A;  4G10 A;  1G7O A;  4NAX A;  1K0O A;  4ZXG A;  5HFK A;  3LQ7 A;  3F6D A;  13GS A;  3F63 A;  1AQW A;  1M9A A;  1PA3 A;  3PGT A;  1KBN A;  1M0U A;  3CBU A;  5ECN B;  4MDC A;  5J4U A;  4Q5F A;  3IR4 A;  4IQA A;  2VCV A;  3C8E A;  4GF0 A;  3R2Q A;  1DUG A;  2UV8 G;  6GSW A;  1GUK A;  1BAY A;  4ZB6 A;  1K3L A;  4PQH A;  1GSD A;  3CSI A;  3IBH A;  1AW9 A;  1K0A A;  4LMV A;  4PUA A;  5DJM A;  4DEJ A;  1MD4 A;  3LFL A;  3CWG A;  1ML6 A;  3KM6 A;  4JZQ A;  2YV9 A;  2A2R A;  4E8E A;  1EV4 A;  1K0D A;  4RI6 A;  1GUL A;  5JCW A;  1BX9 A;  1A0F A;  3MAK A;  1TW9 A;  5A4V A;  3LYK A;  4HZ4 A;  4G0K A;  3EE2 A;  2PVQ A;  2GDR A;  1B4P A;  1BG1 A;  3KXO A;  5EVO A;  4ECI A;  2ON7 A;  1AXD A;  18GS A;  4EE0 A;  4OFM A;  3FR6 A;  1SVL A;  3IC8 A;  4BVX B;  1XWG A;  2LJR A;  4MP4 A;  2VCX A;  3ZFB A;  3W8S A;  2DSA A;  2N5F A;  4MK3 A;  3I69 A;  4O92 A;  4YQM A;  1PX7 A;  2PGT A;  4WR5 A;  4MPG A;  1GUH A;  4AGS A;  3QAW A;  1MTC A;  2PMT A;  2IMI A;  4MF6 A;  5ECS A;  3Q74 A;  2UZ8 A;  3N9J A;  1HNA A;  1GTA A;  3O76 A;  4LMW A;  4KDU A;  3QR6 A;  2HSN A;  2EFH A;  2HRA A;  1GNW A;  3M3M A;  4NHZ A;  5G5E A;  1VF2 A;  4IGJ A;  3DGQ A;  4IW9 A;  2CA8 A;  1VF1 A;  1TDI A;  8GSS A;  9GSS A;  2WJU A;  4GST A;  4MPF A;  1PKZ A;  4ZB9 A;  2HSM B;  4GCI A;  3FR3 A;  1GTU A;  5F07 A;  4QMK A;  5A1N B;  2OA7 A;  1K0M A;  4EC0 A;  1FW1 A;  3LSZ A;  4GLT A;  3M8N A;  3GX0 A;  1ZGN A;  4PGT A;  4BVY A;  1IYI A;  4ZBD A;  3UAR A;  5ECM B;  5IQY A;  3ZML A;  5A5K A;  1Z9H A;  3GUR A;  2OAD A;  3VUR A;  7GSS A;  2CAQ A;  3FRC A;  4KGI A;  4YQV A;  5JCU A;  5F05 A;  5DAL A;  19GS A;  1F2E A;  4HI7 A;  5GZZ B;  4GTU A;  4IKH A;  3TU3 B;  4YQU A;  1GWC A;  1PX6 A;  4G0I A;  1YJ6 A;  1K3Y A;  1EOG A;  4G01 A;  2CZ2 A;  5D73 A;  1GSU A;  1B48 A;  2CVD A;  4IEL A;  4IVF A;  5BMU B;  4K0G A;  3QAV A;  1GSQ A;  3QAG A;  3TOT A;  2VD0 A;  4GDF A;  1EOH A;  5ECI B;  5DDL A;  3TGZ A;  2H1L A;  4IBP A;  3PR8 A;  2ON5 A;  3ERF A;  1OKT A;  4L8E A;  3Q18 A;  1G6W A;  1PGT A;  3MDK A;  4JBB A;  2GST A;  1GTI A;  1IYH A;  1VF4 A;  2O5V A;  4GSN A;  4BL7 B;  5A4U A;  3Q19 A;  3BBY A;  3GTU A;  5DJL A;  4G0L A;  1YDK A;  4KDY A;  1LBK A;  4F0C A;  2C3Q A;  3U6V A;  4G9H A;  2OAC A;  6GSY A;  1UA5 A;  1YVL A;  3NIV A;  5ELG A;  5F0G A;  5A5H A;  1GLP A;  5DAK B;  4MZW A;  5KEJ A;  6GSS A;  4KF9 A;  2YV7 A;  4ECJ A;  1SVO A;  3IE3 A;  1YQ1 A;  2AB6 A;  1U3I A;  1JLV A;  4IJI A;  6GSX A;  3G7J A;  4HOJ A;  5LD0 A;  5AN1 A;  2CZ3 A;  5ECL B;  4L5L A;  4OMV A;  5ECH B;  2VO4 A;  5F8B A;  4F03 A;  2C4J A;  2R6K A;  4PTS A;  4KDX A;  3I6A A;  5EL8 A;  4CHS A;  6GSV A;  3P90 A;  1F3A A;  2DC5 A;  1M9B A;  2WRT A;  4ZB8 A;  3GST A;  5ECO B;  1R5A A;  1GSE A;  2WS2 A;  5J4Y A;  5A34 A;  2JL4 A;  5AIV A;  4ZB7 A;  4AKH A;  6GSU A;  4J2F A;  3HJM A;  3KMO A;  1GNE A;  1GUM A;  1FHE A;  4E8H A;  2GSR A;  5BMU A;  1JZR A;  3VWX A;  4F0B A;  1EEM A;  3CSJ A;  5GSS A;  2EFE A;  4RI7 A;  2VCQ A;  5FHI A;  3L0H A;  4EXJ A;  4KH7 A;  3HKR A;  5AIX A;  2C3T A;  4GSS A;  2AHE A;  2NTO A;  3WYW A;  2HRK B;  3KMN A;  4WR4 A;  4AKG A;  3IK9 A;  3CRU A;  4O7H A;  1NHY A;  5ELA A;  1TU8 A;  3LYP A;  3UBK A;  5AGY A;  4KE3 A;  11GS A;  3O3T A;  1HNC A;  10GS A;  4Q5R A;  4I97 A;  2V6K A;  4ECB A;  1Q4J A;  2VCW A;  4ZBB A;  4EDZ A;  1V2A A;  5J41 A;  3FR9 A;  3LJR A;  2PER A;  4JED A;  3WD6 A;  4PNF A;  1U88 A;  4USS A;  3CRT A;  1PD2 1;  20GS A;  3ZMK A;  3AY8 A;  1HNB A;  3VPQ A;  2VD1 A;  2HQT A;  1GSF A;  2VCT A;  5FWG A;  1PKW A;  3LXT A;  1Y6E A;  4NHW A;  2HSN B;  1GTB A;  1XW6 A;  4L5O A;  3PPU A;  1GLQ A;  1B8X A;  16GS A;  4KSM A;  4E68 A;  1GSY A;  4BVX A;  5FT3 A;  5G5F A;  4PX1 A;  1E6B A;  2GTU A;  4AKI A;  2R3X A;  1YKC A;  5B7C A;  1OYJ A;  3VPT A;  4PQI A;  2R4V A;  5D9V A;  2YCD A;  22GS A;  3M0F A;  2F8F A;  1PL1 A;  2OT3 A;  1AQX A;  2WB9 A;  1PL2 A;  1HQO A;  1VF3 A;  1RK4 A;  3D0Z A;  3EIN A;  4W66 A;  4PNG A;  2AAW A;  3KTL A;  4ISD A;  3LG6 A;  1K0C A;  4BVY B;  5A4W A;  4N0V A;  1Y1U A;  3UAP A;  2D2Z A;  2WDU A;  3GSS A;  3SWL A;  4AKX B;  4HJ2 A;  3ERG A;  5AIS A;  3CSH A;  3TOU A;  2HSM A;  3KJY A;  5DAL B;  3FYG A;  1BF5 A;  3R3E A;  17GS A;  4TOP A;  3HJO A;  5GST A;  5A1N A;  1LJR A;  1K0N A;  3H1N A;  1JLW A;  4OFN A;  5J47 A;  4MF7 A;  2HRK A;  3F6F A;  1K0B A;  4ZBA A;  4ACS A;  5D9T A;  12GS A;  3P8W A;  1OE8 A;  5ECQ B;  4YAV A;  1EV9 A;  1TU7 A;  1OE7 A;  3VI5 A;  6GST A;  3IK7 A;  4YAP A;  4YH2 A;  1N2A A;  2C3N A;  1F3B A;  4MF5 A;  4PUR A;  5ECR B;  5EY6 A;  1BYE A;  4PXO A;  5D9X A;  2VKZ G;  3VK9 A;  1G6Y A;  4N3Z A;  4OFT A;  2HNL A;  2IL3 A;  4IQ1 A;  5J4V A;  1BG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...