5FHIA

Crystallographic structure of psoe without co
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
MVFGTLYTFPGDQCRTIAIKAVAKANGLDLDIRETPRTPDHLSISKLGKVPAFQGADSFKLFECMAIALYITSQNEQTTLLGKDKKEYAEIIKWMSFFNTEIVILMTQQLLPQLGVIPYDRDQVEFFANMTQRSVDVVEEYLQDRTFLVGDQLSLADLFCAGNISLGFQFFYGKAWRQQNPNVSRWYEMVCHQPIYAAVTDKFQLLDEPKLTNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, putative
publication title Oxidative trans to cis Isomerization of Olefins in Polyketide Biosynthesis.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Transferase
total genus 71
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5fhiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5fhiA01
3CMIA 2K9FA 3TUEA 3RHBA 4DSSB 4PQHA 3GL3A 2AAWA 3D5JA 1GTIA 4EVMA 2FA4A 2JZSA 1EOGA 3DKSA 4V2MA 5FHIA 3GV1A 2O89A 2H0IA 3GTUA 4LMVA 5IPHA 1JLWA 3IXRA 1AQXA 1ERWA 3APQA 1LBKA 1RW1A 1YKCA 2LRCA 3GFKA 2DSAA 3EU3A 2REMA 3A2VA 4OCFA 1HQOA 4NPBA 3JCML 1OKTA 2C0FA 4Q5FA 4KDUA 2VCQA 4KDXA 1ABAA 4D73B 1GSSA 1O7UA 1Q98A 13GSA 5IM9A 5DBQA 1QK8A 1TI1A 1H4OA 3TJKA 2HZEA 4J2FA 2GZYA 3A2XA 4V2LA 5G31A 2R37A 3UBLA 3WGXA 2YWOA 3KM6A 2GT5A 1GRXA 4MJEA 1K3OA 1F37A 4WEYA 3PGTA 1JZDA 1SJIA 1FB6A 1TK8B 4JU5A 5DDLA 3KP9A 1RK4A 2M46A 3IE3A 5B6NA 3TKQA 5H5SA 3VWUA 2BMXA 2WJUA 4HUAA 2IWTA 2PPTA 2LQQA 5INYA 2ON5A 5CRDA 1U6TA 4G10A 2FWEA 3BOAA 1WPIA 1OKDA 4NHZA 3D22A 3FYGA 4CW9A 2K8VA 4K0NA 2HFDA 1DSBA 4ECIA 6GSUA 2OE0A 4GWRA 2G2QA 1A0FA 3TOTA 2IN3A 4EDZA 1JFUA 4OO5A 2LSTA 5KN2A 4G0KA 1WE0A 3RHCA 4KSOA 3WGEA 2IMKA 2C4JA 2X64A 2E2MA 3DYRA 2OBIA 1PRXA 4F2IA 4L5LA 5IPGA 1XBSA 2FWFA 3RDWA 3MDKA 1R5PA 2OACA 4XHMA 4TRXA 2GLRA 5EL8A 2JL4A 5BMUA 4XCSA 1OYJA 4BL7A 3TDGA 2OE1A 3R3EA 1O6JA 2YPMA 4AJ7A 2LNTA 5DJMA 14GSA 3D4TA 2C80A 3PINA 1A2LA 3IBHA 3APSA 2MMNA 5IMCA 4O92A 4ECCA 4PTSA 5IMZA 4I2UA 3CSHA 1M9BA 2FCHA 2L4QA 2C3NA 2OBKA 1A0RP 1WOUA 5A4WA 2G0FA 2I1UA 4AJ6A 1NHYA 1XOBA 5DALA 2LQOA 2CV4A 5AISA 3HJPA 4DSSA 2X8CA 2HXKA 2GQKA 1O81A 4PUFC 5JCWA 5A5KA 1B48A 4PX1A 2MMAA 4GXZA 1THXA 1BYEA 3HCZA 4FYCA 3GIXA 3EMPA 1EEMA 2B7KA 2VD1A 3ZREA 4KUNA 3HJOA 5JCGA 4YQVA 3HHVA 4ZILA 2CX3A 3U5RE 2LJKA 4BPYA 2RM6A 2NBSA 3LG6A 4GQFA 1FOVA 4MF6A 4H86A 2M72A 1V2AA 6GSSA 3CSIA 4XTSA 1OC9B 2A2RA 1T1VA 3D21A 4WBJA 3KXOA 5FWGA 3GH6A 3DD3A 2HSNB 4X0XA 1FB0A 3KTBA 4Q5NA 1YJ6A 3EINA 2DJ2A 1EGRA 4ISDA 3SWLA 4EC0A 3ZRDA 2QKEA 1PMTA 3VFIA 1XXUA 2RIIA 3CSJA 1SL1B 1GLPA 1EP8A 1T00A 4YQUA 5G1LA 1UC7A 3MWHA 5H5QA 3GN3A 4OD7A 2VCWA 3KJYA 2VCZA 4RI6A 2RUFA 4QQ7A 4OO4A 4EUYA 2KP2A 4ZB6A 2CZ2A 3ZYWA 4ML6A 3GUSA 5CNWA 5IMDA 16GSA 5ECQB 1FG4A 3VK9A 4NXIA 3ZVJA 3MAKA 4V1Ag 4Q5QA 5H5RA 3ZMLA 4N10A 2J23A 4GRFA 4XRAA 4I6XA 2EC4A 4L8EA 3DVWA 5GAPD 1NHOA 3ERWA 3KP8A 3AY8A 4MF5A 4KAEA 4K8MA 2OA7A 1K0DA 3CTFA 2YANA 4BWQA 1G7OA 2H1BA 4TR3A 2A2SA 1J9BA 2HSMB 4MMMA 2LV3A 1OAZA 3DGQA 3W6GA 1KEBA 2CZ3A 4GF0A 3TKSE 3F0IA 1BX9A 3IR4A 5KN3A 2DLXA 2V41A 3KMNA 4FYUA 2AB6A 5HFGA 2VL9A 3IOSA 2PBJA 1GSQA 3FY7A 3D6IA 2GSSA 1R26A 4F82A 3GRXA 4K7OA 1KBNA 2H6ZA 5B6MA 2C8UA 1PN9A 1MD4A 2V1MA 1B9XC 2I3YA 4IELA 2KHPA 4HJMA 1TXXA 4IJIA 1EV9A 2F8AA 1XOAA 1WJKA 8GSSA 5HR2A 2OJLA 1ZGNA 2VAFA 1O73A 4GSNA 2HRNA 1TRVA 3F6FA 4HU9A 3TRXA 3ZFBA 5IQYA 2HE3A 2YWMA 2H0HA 2C0DA 2RUEA 2QSIA 2DJ3A 3O3TA 2CVDA 1AQWA 3GNJA 3TB2A 2HQTA 4MDCA 4ZBDA 2FY6A 1ZCPA 2H76A 3EU4A 4PXOA 5F0GA 2IMIA 5HQPA 1A24A 3EVIA 5ECPB 3FZAA 1TJDA 4XS4B 3Q74A 5GZZB 4LL4B 3HZ4A 4IJ3A 2VLVA 2Z9SA 5LNKe 1M0UA 1SKRB 2PERA 3P2AA 3LXTA 4ZXGA 3LJRA 2H6XA 1GUKA 5A4VA 4FH8A 3NZNA 5G2ZA 3UOMA 2XBQA 3LEFA 4WBRD 2O87A 1GUMA 1N2AA 1KTEA 2CVKA 3FW2A 2KOKA 1OC9A 3H8QA 4MH3A 1TRWA 4K2DA 3H1NA 4PNGA 1XPVA 4ACSA 1GL8A 3QPMA 3VURA 1YZXA 4OFMA 5JCUA 4PQ1A 1ERTA 3F8UA 2NDOA 3TJGA 3GSTA 1DUGA 1U3IA 5IOWA 1UA5A 2FNOA 4DSQA 1U87A 1T3BA 1G6WA 1HD2A 4Z7XA 3QR6A 4WR5A 2GZPA 2XHFA 2F51A 3FHKA 5B8BA 2PGTA 3TKSC 4NHWA 3L9VA 1M7TA 5HFIA 2ON7A 22GSA 3I6AA 2DJKA 4O5RA 1AIUA 1K3YA 1BG5A 1F3BA 4TR1B 4WR4A 1NSWA 2P5QA 3K8NA 4TR0A 2LJRA 1GSDA 1EOHA 2CAIA 3C1SA 4X43A 2H6YA 4WXTA 1GTBA 2JSYA 3KH7A 1GSUA 1GSYA 3G7YA 4X1UA 4JR6A 5D73A 3GL5A 3HZ8A 4NMUA 3Q19A 2L6CA 1T7PB 1X9MB 1PD21 5IIZA 1DBYA 2NTOA 2VL2C 3RPNA 2FHEA 4CDOA 2H0GA 5CYYA 2HRAA 3GA4A 5G30A 1VF4A 6GSXA 4ZIJA 2H1DA 3TJBA 1K3LA 1SYXA 2HSHA 4ID0A 4IS0A 1GTUA 4GLTA 3L9SA 4P3YB 3GYKA 2RM5A 2H72A 1F3AA 2O85A 2RLIA 2OE3A 3EYTA 4HU7A 2N5FA 1FVJA 3KCMA 1OE8A 5J9CA 5DJLA 3TJFA 5ECLB 1PL2A 4BVYA 3LORA 2CX4A 1PL1A 3FZ4A 2VUPA 4MCUA 1GSFA 3O76A 3TRPA 5ELAA 4WKWA 1HNAA 3HY2A 1MTCA 2O7KA 1QFNA 2WCIA 4TOPA 5CRWA 1M2DA 1YF0A 4MJBA 1B4QA 4QL9A 4L5OA 3KD0A 1XWKA 1JLVA 5CO3A 4NWYA 1XZOA 3QFAC 4DSRA 2VO4A 3FR6A 4XRDA 2FA8A 1T4YA 4O7HA 1OC8A 3IA1A 2R4VA 2B6MA 4ZBAA 4NV2A 1MEKA 3R2QA 1THOA 4IN0A 4I2TA 6GSVA 1K0CA 4HOJA 3A3TA 5ELGA 3UMAA 4IHUA 4XS4A 3VWVA 2DMLA 1ZYEA 3G9BA 4RQXA 4FO5A 3CXGA 3ZLPA 2AUVA 2B3SA 3EWLA 1VGLA 1IYIA 3I69A 2B1LA 1Z5YE 1Z6MA 1V98A 5IO0A 2CA8A 1X5CA 1DE1A 3EURA 4MZBA 2HRFA 2HRKB 2QC7A 2VCTA 3IHQA 3WD6A 3APOA 4AF2A 3ZIJA 4WF5A 3LFLA 3LYPA 5B8AA 2VCVA 2HLSA 5DAKA 2GSQA 1XWCA 5D9TA 3VWXA 3BJ5A 4IKHA 3S9FA 1ILOA 2J9HA 5HR3A 2GS3A 2YCDA 1NW2A 1U3AA 5F06A 4K0GA 1XIYA 4TR1A 4KE3A 1SJZA 4OFTA 3WT1A 2HYXA 1SENA 3DVXA 1Z7RA 4HQZA 3QAVA 3LWAA 1A8LA 1H75A 2B5XA 3DRNA 1F2EA 2V6KA 5LCZA 3CRUA 2GQMA 4MPGA 2LUSA 4IVFA 6GSTA 4MPFA 3TJJA 1F9MA 3E0UA 4TR4A 5G5EA 3F9UA 2H71A 2B1KA 3G7JA 4KB3A 3GKMA 4J56E 5A4UA 5ENUA 2YOIA 2L57A 3EE2A 1EEJA 4TVEA 2PN8A 3PR8A 1FVKA 5DQYA 2P5RA 3DXBA 1LJRA 1B9YC 5GAND 2WFCA 4TN8A 2X8GA 4POKA 4AGSA 2A4VA 3ZZXA 4E8EA 1XW5A 1O8XA 2B5YA 1SK0A 2H8LA 4ZBBA 1A2JA 1WIKA 2JACA 2WDUA 2I4AA 4D73A 3VLNA 3M3MA 3PH9A 3UARA 5CREA 1VF2A 2IL3A 1SKWB 4EO3A 3P90A 2WZ9A 1GSEA 2HSYA 4JBBA 1CQHA 2PVOC 4ZL9A 5C04A 3V1WA 2YNXA 3TGZA 3E3EA 3GH9A 4TXOB 4MK3A 1GH2A 2JZTA 3M0FA 4N11A 4K7NA 3O6TA 2N5AA 1SD8A 1W89A 3M9JA 4I5QA 4F0CA 7GSSA 1XVQA 3P7XA 2DJ0A 1TOFA 5AN1A 1XWAA 1V57A 3BBYA 4ILFA 1YF1A 1Z9HA 2VM2A 4XIHA 3CBUA 5ECIB 2H70A 4POLA 2GSTA 2YV7A 3M1GA 2AV4A 1JZWA 1YDKA 1K0AA 4OWYA 2VIMA 2C1YA 1E2YA 9GSSA 2HRKA 2DBCA 2GQLA 1C72A 4MH2A 4O32A 4MJAA 4F0BA 2MYGA 2IMFA 1DE2A 1SKSB 1BEDA 2NPBA 4BA7A 4MA9A 2EIQA 1R4WA 3P8WA 3C73A 1M2AA 4EL1A 3QAWA 3L78A 3ED3A 5HFKA 2C3QA 3QFBC 4HS1A 2KP1A 2TRXA 1GNEA 1I9DA 2V32A 1FO5A 1Z6NA 5DCGA 1A23A 4EXJA 2N5BA 3HA9A 1GWCA 3Q6OA 1M2BA 2YZUA 1HNCA 4GSTA 1JZOA 1W4VA 5ECRB 1TTZA 3FR3A 1PX6A 1XWBA 10GSA 2UZ8A 4GQCA 3UIWA 1Y25A 4G0IA 1R5AA 4EDYA 1TRSA 2GT6A 1X5DA 5FT3A 2HZEB 4G2EA 2IMDA 1BJXA 1B4PA 3KTLA 2HI7A 3ZVJD 2I9HA 4IGJA 3A5WA 3GX8A 3FEUA 1GNWA 5D8IA 2LRNA 2AHEA 4J57E 2R6KA 2XPEA 1LU4A 1ACVA 3IV4A 4LA1A 2B7JA 4YAVA 1VRSD 4G9HA 2CT6A 1AC1A 4TXVA 2GZZA 3MNGA 1TRUA 1K0OA 3UVTA 3UBKA 3L0HA 2YWIA 4ZL8A 1ON4A 2WS2A 6GSWA 3GKXA 2C0GA 4FYBA 1PA3A 2H1GA 5DQSA 1PQNA 2H1AA 5EY6A 2R3XA 3LYKA 1TU8A 3EC3A 3FKFA 1X5EA 1K0NA 1OVNA 3RAZA 4V2NA 2PMTA 4POMA 2WRTA 4POBA 1V58A 5B7CA 2H01A 4E8HA 1X9SB 4FIWA 1XWGA 3QOUA 4KNDA 1SL0B 2BTOT 2WB9A 2ZNMA 1TDIA 3L4NA 3I9V2 2MZCA 3VI7A 1TKDB 1AW9A 2TRCP 3W8SA 4LLRA 4LMWA 3KZQA 2YZHA 3ZTLA 5F07A 4HI7A 1S3AA 1MD3A 3HXSA 4N0VA 2VL2A 2WULA 3FRCA 3WGDA 1PX7A 4MZCA 1K0BA 3F4SA 3QCPA 3FR9A 1JZRA 2LRTA 1GLQA 3TOUA 2NVLA 3LQ7A 3WYWA 2F9SA 1QXHA 2DJ1A 2FWHA 4JR4A 2LEGA 20GSA 3VPQA 3I43A 1O8WA 2C0EA 3IAS2 3E9JB 2HSMA 3LXZA 3CYNA 1M9AA 4G19A 4OMVA 4IP6A 5COHA 4JZQA 1X9WB 2L5OA 4ULXA 4MZWA 5AIVA 3OR5A 2H19A 1SU9A 3PPUA 1BQ7A 4G0LA 3MSZA 1Y6EA 1GTAA 4QL7A 2C3TA 1XFLA 4K6XA 1XW9A 5IOXA 2XBIA 1USBA 3EMXA 5IMAA 3GURA 4K1FA 5D9WA 1SK1A 1YKAA 2VLTA 4MABA 1YEPA 3BCIA 3HVSA 3F6DA 3QD9A 5AIXA 5IMVA 1SD9A 4IQ1A 3GX0A 2L4CA 4PNFA 4BVXB 3U6VA 5J3RA 5HR1A 2GSRA 2H74A 3QMXA 2BJXA 2LKUA 1S3CA 12GSA 3G7IA 3ISOA 4KCAA 3RPPA 3VPTA 2I81A 4MLYA 2DC5A 1ZMAA 4F03A 2XPDA 3KIJA 4TKYA 5CRGA 3CTGA 2M80A 2TIRA 2GGTA 2CVBA 4AJ8A 4PGTA 2R2JA 2LTKA 3IRAA 4ZB9A 4DVCA 2JSZA 3GKNA 2PVQA 3FZ9A 3HVXA 4V1Ap 4LL1B 4HEA2 1V40A 3IK7A 3HKRA 5KEJA 2H75A 3J7Yk 1UVZA 1WRYA 4ZL7A 5HR0A 2OKAA 11GSA 3DMLA 4RI7A 4RUVA 4K7IA 2YJHA 2DMMA 1F6MC 3IAM2 2XC2A 1TK0B 4N0ZA 3UAPA 1I5GA 5G5FA 2JZRA 5DCHA 3HVVA 1EZKA 1N8JA 2ZCTA 3ZIVA 1AXDA 2OADA 2ALBA 2HT9A 2MMZA 5D93A 4Q5RA 1EGOA 2YV9A 2GDRA 5ECSA 5CP1A 2QGVA 3HD5A 1SYRA 1NM3A 3L9UA 2V6OA 1GUHA 3Q18A 2MBTA 1KNGA 4KDYA 3GHAA 3KEBA 1XCCA 4I8BA 5ID2B 4FQUA 1WMJA 2B5EA 1PKWA 3NIVA 1HYUA 1BAYA 2YJ7A 3TCOA 3ZL5A 2KUCA 1IYHA 5J4UA 5L71A 1JHBA 2KLXA 2VLUA 2D2ZA 5EPFA 1XW6A 2P0GA 1WWJA 2PUKC 1MDJA 3UVHA 1QQ2A 3C8EA 1PGTA 5LD0A 2VOCA 4MP4A 1O85A 1OC3A 3C1RA 4PQIA 5KN1A 3N9JA 1VF1A 4WETA 3GKKA 5JWRB 3HDCA 1HNBA 3N5OA 1ZZYA 4ZB8A 2EIRA 4K9ZA 2L5LA 2E2GA 2LS5A 5F05A 1ML6A 5E59A 19GSA 1EWXA 2H66A 3LSZA 1QGVA 3ME8A 2E7PA 3IC4A 4HZ4A 3F4RA 2VCXA 1UN2A 1GP1A 1EP7A 1QMVA 1U88A 2FUG2 1WP0A 1QUWA 2WGRA 3ZFLA 1T4ZA 1Z3EA 5D96A 1URMA 4BVXA 4KX4A 2ZUPA 3DWVA 1J0FA 4KF9A 4I97A 1V9WA 5G1KA 2MMOA 2DJJA 4F9ZA 1G0TA 4KA0A 2JU5A 1AQVA 3UJ1A 1OE7A 3D4MA 3TRQA 5CRHA 1ZL9A 2YP6A 2GVPA 4IP1A 3ME7A 2O8VB 3H79A 2IFQB 4NV5A 2R5GA 3GMFA 1XVWA 1SL2B 4XS1A 4L0WA 5D9VA 1ERVA 2FD3A 4EKZA 3SBCA 2FLSA 4HDEA 1ZYQB 2FGXA 3FK8A 4KCEA 3C7MA 3H93A 3H4KA 1GULA 1VF3A 1SK2A 4CHSA 5GSSA 5EVOA 2X8HA 5F8BA 2AYTA 3GTUB 1Z7PA 3DIEA 1SJ6A 4IBPA 5GSTA 3NOFA 4HJ2A 2FWGA 1CQGA 5J41A 1AAZA 5ECHB 1RQMA 4USSA 2YWNA 1EV4A 3RBTA 2V2GA 3BCKA 3UL3A 2ES7A 2DIYA 2K18A 3C71A 3F3QA 2VL3A 4JRRA 2PU9C 5JWQB 4BVYB 2P31A 3TKRA 2HZFA 3QAGA 18GSA 5ID2A 2L59A 1R7HA 4OCEA 3CRTA 3D0ZA 3HYPA 2IJYA 4L0UA 3IDVA 5J9BA 4GSSA 5CAXA 3WT2A 4HZ2A 1A8YA 4GTUA 5ECKB 5ECMB 4ECBA 2IPAA 3W8JA 1E6BA 1YY7A 3ZMKA 3IPZA 4MJCA 4TW5A 4YH2A 5IO2A 1K0MA 2K8SA 5C00A 1B8XA 3M8NA 3IK9A 2IMEA 4EE0A 4KSMA 1J08A 2IIYA 1YQ1A 2PWJA 4ML1A 4RQRA 4KH7A 4KW6A 5KN0A 3LGCA 3F4TA 2CQ9A 3UEMA 3A2WA 3KGKA 4KGIA 3QDNA 1FHEA 1PKZA 3US3A 3KMOA 4GCIA 4JEDA 2AJQB 3J7Yb 1Q4JA 5IMFA 2L6DA 3KH9A 3HJMA 17GSA 2F8FA 4DEJA 1X0RA 5ECOB 5JWOB 3ERGA 3DEXA 4YAPA 4WF4A 1TP9A 4JE1A 2CAQA 3IC8A 2K6VA 3VI5A 1MDIA 1YEXA 3F3RA 5ABRA 1G6YA 1TK5B 6GSYA 4TXOA 4IQAA 3TKSA 3ZITA 3FZ5A 2H73A 2H30A 2MBSA 5E4WA 1PSQA 1ZOFA 4PURA 5DAKB 4HQSA 1TU7A 2GTUA 4BL7B 2VD0A 5ECNB 1T8EB 1MDKA 1TW9A 1S3DA 1TI3A 5D9XA 2E0QA 2LNSA 3F63A 2EIOA 1A2MA 2JADA 1ST9A 3TKPA 3BD2A 2VM1A 1AUCA 5AGYA 4NAXA 4OFNA 4EF0A 4YQMA 1G7EA 4ECJA 1FAAA 3VWWA 4IW9A 4MF7A 3ERFA 3GSSA 2LJAA 2IFQA 1FW1A 1M99A 1ERUA 4PUAA 2YN1A 5DVBA 3M9KA 2DIZA 4BWSA 5J5NA 4XS6A 2F3MA 2HNLA 4N30A 2X99A 5DALB
chains in the Genus database with same CATH superfamily
3CMIA 2K9FA 3TUEA 3RHBA 4DSSB 4PQHA 3GL3A 2AAWA 3D5JA 1GTIA 4EVMA 2FA4A 2JZSA 1EOGA 3DKSA 4V2MA 5FHIA 3GV1A 2O89A 2H0IA 3GTUA 4LMVA 5IPHA 1JLWA 3IXRA 1AQXA 1ERWA 3APQA 1LBKA 1RW1A 1YKCA 2LRCA 3GFKA 2DSAA 3EU3A 2REMA 3A2VA 4OCFA 1HQOA 4NPBA 3JCML 1OKTA 4N3ZA 2C0FA 4Q5FA 4KDUA 2VCQA 4KDXA 1ABAA 4D73B 1GSSA 1O7UA 1Q98A 13GSA 5IM9A 5DBQA 2R0PA 1QK8A 1TI1A 1H4OA 3TJKA 2HZEA 2UV8G 4J2FA 2GZYA 3A2XA 4V2LA 5A34B 5G31A 2R37A 3UBLA 3WGXA 2YWOA 3KM6A 2GT5A 1GRXA 4MJEA 1K3OA 1F37A 4WEYA 3PGTA 1JZDA 1SJIA 1FB6A 1TK8B 4JU5A 5DDLA 3KP9A 1RK4A 2M46A 2EFDA 3IE3A 5B6NA 1SVLA 3TKQA 5H5SA 3VWUA 2BMXA 2WJUA 4HUAA 2IWTA 2PPTA 2LQQA 5INYA 2ON5A 5CRDA 1U6TA 4G10A 2FWEA 1XG8A 3BOAA 2QA1A 1WPIA 1OKDA 4NHZA 3D22A 3FYGA 4CW9A 2K8VA 4K0NA 2HFDA 1DSBA 4EIPA 4ECIA 6GSUA 2OE0A 4GWRA 2G2QA 1A0FA 3TOTA 2IN3A 4EDZA 1JFUA 4OO5A 2LSTA 5KN2A 4G0KA 1WE0A 3RHCA 1SVOA 4KSOA 3WGEA 2IMKA 2C4JA 2X64A 2E2MA 3DYRA 2OBIA 1PRXA 4F2IA 4L5LA 5IPGA 1ZYNA 1XBSA 2FWFA 3RDWA 3MDKA 1R5PA 2OACA 4XHMA 4TRXA 2GLRA 5EL8A 2JL4A 5BMUA 2WZSA 4XCSA 1OYJA 4BL7A 3TDGA 2OE1A 3R3EA 1O6JA 2YPMA 4AJ7A 2LNTA 3FMWA 5DJMA 14GSA 3D4TA 2C80A 3PINA 1A2LA 3RFRC 3IBHA 3APSA 2MMNA 5IMCA 4O92A 5J47A 4ECCA 4PTSA 5IMZA 4I2UA 3CSHA 1M9BA 2FCHA 2L4QA 2C3NA 2OBKA 1A0RP 1WOUA 5A4WA 2G0FA 2I1UA 4AJ6A 4AI6A 1NHYA 1XOBA 5KOXA 5DALA 2LQOA 4O5QA 2CV4A 5AISA 3HJPA 4DSSA 2X8CA 2HXKA 2EFCA 2GQKA 1O81A 4PUFC 5JCWA 5A5KA 1B48A 4PX1A 2MMAA 4GXZA 1THXA 1BYEA 3HCZA 4FYCA 3GIXA 3EMPA 1EEMA 2B7KA 2VD1A 3ZREA 4KUNA 3HJOA 5JCGA 4YQVA 3HHVA 4ZILA 2CX3A 3U5RE 2LJKA 4BPYA 2RM6A 2NBSA 3LG6A 4GQFA 1FOVA 4QMKA 4MF6A 4H86A 2M72A 1V2AA 6GSSA 3CSIA 4XTSA 1OC9B 2A2RA 1T1VA 3D21A 4WBJA 3KXOA 5FWGA 3GH6A 3DD3A 2EFEA 2HSNB 4X0XA 1FB0A 3KTBA 4Q5NA 1YJ6A 3EINA 3RGBC 2DJ2A 1EGRA 4ISDA 3SWLA 4EC0A 3ZRDA 2QKEA 1PMTA 3VFIA 1XXUA 2RIIA 3CSJA 1BG1A 1SL1B 1GLPA 1EP8A 1T00A 4YQUA 5G1LA 1UC7A 3MWHA 5H5QA 3GN3A 4OD7A 2VCWA 3KJYA 2VCZA 4RI6A 2RUFA 4QQ7A 4OO4A 4EUYA 2KP2A 4ZB6A 2CZ2A 3ZYWA 4ML6A 3GUSA 5CNWA 5IMDA 16GSA 5ECQB 1FG4A 3VK9A 4NXIA 3ZVJA 3MAKA 4V1Ag 4Q5QA 5H5RA 3ZMLA 4N10A 2J23A 4GRFA 4XRAA 4K5SA 4I6XA 2EC4A 4L8EA 3DVWA 5GAPD 1NHOA 3ERWA 3KP8A 5KOWA 3AY8A 4MF5A 4KAEA 4K8MA 2OA7A 1K0DA 3CTFA 2YANA 4BWQA 1G7OA 2H1BA 4TR3A 2A2SA 2WW1A 1J9BA 2HSMB 4MMMA 2LV3A 1OAZA 3DGQA 3W6GA 1KEBA 2CZ3A 4GF0A 3TKSE 3F0IA 1BX9A 1M3JA 1BF5A 3IR4A 5KN3A 2DLXA 2V41A 3KMNA 2AB6A 4FYUA 5HFGA 2VL9A 3IOSA 2PBJA 1GSQA 3FY7A 3D6IA 2GSSA 1R26A 4F82A 3GRXA 4K7OA 1KBNA 2H6ZA 5B6MA 2C8UA 1PN9A 1MD4A 2V1MA 1B9XC 2I3YA 4IELA 2KHPA 4HJMA 1TXXA 4IJIA 1EV9A 2F8AA 1XOAA 1WJKA 8GSSA 5HR2A 2OJLA 1ZGNA 2VAFA 1O73A 4GSNA 2HRNA 1TRVA 3F6FA 4HU9A 3TRXA 3ZFBA 5IQYA 2HE3A 2YWMA 2H0HA 2C0DA 2RUEA 2QSIA 2DJ3A 4Z2TA 3O3TA 2CVDA 1AQWA 3GNJA 3TB2A 2HQTA 4MDCA 4ZBDA 2FY6A 1ZCPA 2H76A 3EU4A 4PXOA 5F0GA 2IMIA 5HQPA 1A24A 3EVIA 5ECPB 3FZAA 1TJDA 4XS4B 3Q74A 5GZZB 4LL4B 3HZ4A 4IJ3A 2VLVA 2Z9SA 5LNKe 1M0UA 1SKRB 2PERA 3P2AA 3LXTA 4ZXGA 3LJRA 2H6XA 1GUKA 5A4VA 4FH8A 3NZNA 3CHXC 5G2ZA 3UOMA 2XBQA 3LEFA 4WBRD 2O87A 1GUMA 1N2AA 1KTEA 2CVKA 3FW2A 2KOKA 1OC9A 3H8QA 4MH3A 1TRWA 4O5UA 4K2DA 3H1NA 4PNGA 1XPVA 4ACSA 1GL8A 3QPMA 3VURA 1YZXA 4OFMA 5JCUA 4PQ1A 2HSNA 1ERTA 5A5HB 3F8UA 2NDOA 3TJGA 3GSTA 1DUGA 1U3IA 5IOWA 1UA5A 2FNOA 4DSQA 1U87A 1T3BA 1G6WA 1HD2A 4Z7XA 3QR6A 4WR5A 2GZPA 2XHFA 2WVXA 2F51A 3FHKA 5B8BA 2VKZG 2PGTA 3TKSC 4NHWA 3L9VA 1M7TA 5HFIA 2ON7A 22GSA 2WVYA 3I6AA 2DJKA 4O5RA 1AIUA 1K3YA 1BG5A 1F3BA 4TR1B 4WR4A 1NSWA 2P5QA 3K8NA 4TR0A 2LJRA 1GSDA 1EOHA 2CAIA 3C1SA 4X43A 2H6YA 4WXTA 1GTBA 2JSYA 3KH7A 1GSUA 1GSYA 3G7YA 4X1UA 4JR6A 5D73A 3GL5A 3HZ8A 4NMUA 3Q19A 2L6CA 1T7PB 1X9MB 1PD21 3TU3B 5IIZA 1DBYA 2NTOA 2VL2C 3RPNA 2FHEA 4CDOA 2H0GA 5CYYA 2HRAA 3GA4A 5G30A 1VF4A 6GSXA 1FOHA 4ZIJA 2H1DA 3TJBA 1K3LA 1SYXA 2HSHA 4ID0A 4IS0A 1GTUA 4GLTA 3L9SA 4K5RA 4P3YB 3GYKA 2RM5A 3MYDA 2H72A 1F3AA 2O85A 2RLIA 2OE3A 3EYTA 4HU7A 2N5FA 1FVJA 3KCMA 1OE8A 5J9CA 5DJLA 3TJFA 5ECLB 1PL2A 4G01A 4BVYA 3LORA 2CX4A 1PL1A 3FZ4A 2VUPA 3HMJG 4MCUA 1GSFA 3O76A 3TRPA 5ELAA 4WKWA 1HNAA 3HY2A 1MTCA 2O7KA 1QFNA 2WCIA 4TOPA 5CRWA 1M2DA 1YF0A 4MJBA 1B4QA 4QL9A 4L5OA 3KD0A 1XWKA 1JLVA 5CO3A 4NWYA 1XZOA 3QFAC 4DSRA 2VO4A 3FR6A 4XRDA 2FA8A 1T4YA 4O7HA 1OC8A 3IA1A 2R4VA 2B6MA 4ZBAA 4NV2A 1MEKA 3R2QA 1THOA 4IN0A 4I2TA 6GSVA 1K0CA 4HOJA 3A3TA 5ELGA 3UMAA 4IHUA 4XS4A 3VWVA 2DMLA 4AKIA 1ZYEA 3G9BA 4RQXA 4AKGA 4FO5A 3CXGA 3CWGA 3ZLPA 3EWLA 2AUVA 2B3SA 1VGLA 1IYIA 3I69A 2B1LA 1Z5YE 1Z6MA 1V98A 5IO0A 2CA8A 1X5CA 1DE1A 3EURA 4MZBA 2HRFA 2HRKB 2QC7A 2VCTA 5A1NB 3IHQA 3WD6A 3APOA 4AF2A 3ZIJA 4WF5A 3LFLA 3LYPA 5B8AA 2VCVA 2HLSA 5DAKA 2GSQA 1XWCA 5D9TA 3VWXA 3BJ5A 4IKHA 3S9FA 1ILOA 2J9HA 5HR3A 2GS3A 2YCDA 1NW2A 1U3AA 5F06A 4K0GA 4BIKA 1XIYA 4TR1A 4KE3A 2O5VA 1SJZA 4OFTA 3WT1A 3CQFA 2HYXA 1SENA 3DVXA 1Z7RA 4HQZA 3QAVA 3LWAA 1A8LA 1H75A 2B5XA 3DRNA 1F2EA 2V6KA 5LCZA 3CRUA 2GQMA 4MPGA 2LUSA 4IVFA 6GSTA 4MPFA 3TJJA 1F9MA 3E0UA 4TR4A 4ZB7A 5G5EA 3F9UA 2H71A 2B1KA 3G7JA 4KB3A 3GKMA 4J56E 5A4UA 5ENUA 2YOIA 2L57A 2WW3A 3EE2A 1EEJA 5J4YA 2PN8A 3PR8A 4TVEA 1FVKA 5DQYA 2P5RA 3DXBA 1LJRA 1B9YC 5GAND 2WFCA 4TN8A 2X8GA 4POKA 4AGSA 2A4VA 3ZZXA 4X4JA 4E8EA 1XW5A 1O8XA 2B5YA 1SK0A 2H8LA 4ZBBA 1A2JA 1WIKA 2JACA 2WDUA 2I4AA 4D73A 3VLNA 3M3MA 3PH9A 3UARA 5CREA 1VF2A 2IL3A 1SKWB 4EO3A 3P90A 2WZ9A 1GSEA 4Z2RA 5A34A 2HSYA 4JBBA 1CQHA 2PVOC 4ZL9A 5C04A 3V1WA 2YNXA 3TGZA 3E3EA 2A2PA 3GH9A 4TXOB 4MK3A 1GH2A 2JZTA 2R0GA 3M0FA 4N11A 4K7NA 3O6TA 2N5AA 1SD8A 1W89A 3M9JA 4I5QA 4F0CA 7GSSA 1XVQA 3P7XA 2DJ0A 1TOFA 4MNNA 5AN1A 1XWAA 1V57A 3BBYA 5J40A 4ILFA 1YF1A 1Z9HA 2VM2A 4XIHA 3CBUA 5ECIB 2H70A 4POLA 2GSTA 2YV7A 3M1GA 2AV4A 1JZWA 1YVLA 1YDKA 1K0AA 4OWYA 2VIMA 2C1YA 1E2YA 9GSSA 2HRKA 2DBCA 2GQLA 1C72A 4MH2A 4O32A 4MJAA 4F0BA 4PI2C 2MYGA 2IMFA 1DE2A 1I1IP 1SKSB 1BEDA 2NPBA 4BA7A 4MA9A 2EIQA 1R4WA 3P8WA 3C73A 1M2AA 4EL1A 3QAWA 3L78A 3ED3A 3LW9A 5HFKA 2C3QA 3QFBC 4HS1A 2KP1A 2TRXA 1GNEA 1I9DA 2V32A 1FO5A 1Z6NA 5DCGA 1A23A 4EXJA 2N5BA 3HA9A 1GWCA 3Q6OA 1M2BA 2YZUA 1HNCA 4GSTA 1JZOA 1W4VA 5ECRB 2DKHA 4GDFA 1TTZA 3FR3A 1PX6A 1XWBA 10GSA 2UZ8A 4GQCA 3UIWA 1Y25A 4G0IA 1R5AA 4EDYA 1TRSA 2GT6A 1X5DA 5FT3A 2HZEB 4G2EA 2IMDA 1ZYPA 1BJXA 1B4PA 3MIXA 2QA2A 3KTLA 2HI7A 3ZVJD 2I9HA 4IGJA 3A5WA 3GX8A 3FEUA 1GNWA 5D8IA 2LRNA 2AHEA 4J57E 2R6KA 2XPEA 1LU4A 1ACVA 3IV4A 4LA1A 2B7JA 4YAVA 1VRSD 4G9HA 2CT6A 1AC1A 4TXVA 2GZZA 3MNGA 1TRUA 1K0OA 3UVTA 3UBKA 3L0HA 2YWIA 4ZL8A 1ON4A 2WS2A 6GSWA 3GKXA 2C0GA 4FYBA 1PA3A 2H1GA 1SVMA 5DQSA 1PQNA 2H1AA 5EY6A 2R3XA 3LYKA 1TU8A 3EC3A 3FKFA 1X5EA 1K0NA 1OVNA 3RAZA 4V2NA 2PMTA 4POMA 2WRTA 4POBA 1V58A 5B7CA 4CY6A 2H01A 4E8HA 1X9SB 4FIWA 1XWGA 5BMUB 3QOUA 4KNDA 1SL0B 2BTOT 2WB9A 2ZNMA 1TDIA 3L4NA 3I9V2 2MZCA 3VI7A 1TKDB 1M3IA 1AW9A 4E68A 3W8SA 2TRCP 4LLRA 4LMWA 3KZQA 2YZHA 3ZTLA 5F07A 4ICYA 4HI7A 1S3AA 1MD3A 3HXSA 4N0VA 2VL2A 2WULA 3FRCA 3WGDA 1PX7A 4MZCA 1K0BA 3F4SA 3QCPA 3FR9A 1JZRA 2LRTA 1GLQA 3TOUA 2NVLA 3LQ7A 3WYWA 2F9SA 1QXHA 2DJ1A 2FWHA 4JR4A 2LEGA 20GSA 3VPQA 3I43A 1O8WA 2C0EA 3IAS2 3E9JB 3CYNA 2HSMA 3LXZA 1M9AA 4G19A 4OMVA 4IP6A 5COHA 3EPTA 4JZQA 1X9WB 4YKGA 2L5OA 4ULXA 4MZWA 5AIVA 3OR5A 2H19A 1SU9A 3PPUA 1BQ7A 4G0LA 3MSZA 1Y6EA 1GTAA 4QL7A 2C3TA 1XFLA 4K6XA 1XW9A 2H1LA 2XBIA 1USBA 3EMXA 5IMAA 5IOXA 3GURA 4K1FA 5D9WA 1SK1A 1Y1UA 1YKAA 1PFOA 2VLTA 4MABA 1YEPA 3BCIA 3HVSA 3F6DA 3QD9A 2O3EA 5AIXA 5IMVA 1SD9A 4IQ1A 3GX0A 2L4CA 4PNFA 4BVXB 3U6VA 5J3RA 5HR1A 2GSRA 2H74A 3QMXA 2BJXA 2LKUA 1S3CA 12GSA 3G7IA 3ISOA 4KCAA 3RPPA 2I81A 3VPTA 4MLYA 2DC5A 1ZMAA 4F03A 2XPDA 2WVZA 3KIJA 1PN0A 4TKYA 5CRGA 3CTGA 2M80A 2TIRA 2GGTA 2CVBA 4AJ8A 4K2XA 4PGTA 2R2JA 2LTKA 3IRAA 4ZB9A 4DVCA 2JSZA 3GKNA 2PVQA 3FZ9A 3HVXA 4V1Ap 4LL1B 4HEA2 1V40A 3IK7A 3HKRA 5KEJA 2H75A 3J7Yk 5A5HA 1UVZA 1WRYA 4ZL7A 5HR0A 2OKAA 11GSA 3DMLA 4RI7A 4RUVA 4K7IA 1S3RA 2YJHA 2DMMA 1F6MC 3IAM2 4PI0C 2XC2A 1TK0B 4N0ZA 3UAPA 1I5GA 5G5FA 2JZRA 5DCHA 4AKXB 3HVVA 1EZKA 1N8JA 2ZCTA 3ZIVA 1AXDA 2OADA 2ALBA 2HT9A 2MMZA 5D93A 4Q5RA 1EGOA 2YV9A 2GDRA 5ECSA 5CP1A 2QGVA 2A4HA 3HD5A 1SYRA 1NM3A 3L9UA 2V6OA 1GUHA 3Q18A 2MBTA 1KNGA 4KDYA 3GHAA 3KEBA 1XCCA 4I8BA 5ID2B 4FQUA 1WMJA 2B5EA 1PKWA 3NIVA 1HYUA 1BAYA 2YJ7A 3TCOA 3ZL5A 2KUCA 1IYHA 5J4UA 5L71A 1JHBA 1YEWC 2KLXA 2VLUA 2D2ZA 5EPFA 1XW6A 2P0GA 1WWJA 2PUKC 1MDJA 3UVHA 1QQ2A 3C8EA 1PGTA 5LD0A 2VOCA 4MP4A 1O85A 1OC3A 3C1RA 4PQIA 4AKHA 5KN1A 3N9JA 1VF1A 4WETA 3GKKA 5JWRB 3HDCA 1HNBA 3N5OA 1ZZYA 4ZB8A 2EIRA 4K9ZA 2L5LA 2X49A 2E2GA 2LS5A 5F05A 1ML6A 5J4VA 5E59A 19GSA 1EWXA 2H66A 3LSZA 1QGVA 3ME8A 2E7PA 3IC4A 4HZ4A 3F4RA 2VCXA 1UN2A 1GP1A 1EP7A 1QMVA 1U88A 4HSCX 2FUG2 1WP0A 1QUWA 2WGRA 3ZFLA 1T4ZA 1Z3EA 5D96A 1URMA 4BVXA 4KX4A 2ZUPA 3DWVA 1J0FA 2WVXB 4KF9A 4I97A 4Z2UA 1V9WA 5G1KA 2MMOA 4CY8A 2DJJA 4F9ZA 1G0TA 4YKFA 4KA0A 2JU5A 1AQVA 3UJ1A 1OE7A 3D4MA 3TRQA 3A5IA 5CRHA 4EIQA 1ZL9A 2YP6A 2GVPA 4IP1A 3ME7A 4A5PA 2O8VB 5A1NA 3H79A 2IFQB 4NV5A 2R5GA 3GMFA 2WW2A 1XVWA 1TXUA 1SL2B 4XS1A 4L0WA 5D9VA 1ERVA 4PHZC 2FD3A 4EKZA 3SBCA 2FLSA 4HDEA 1ZYQB 2FGXA 3FK8A 3C7MA 3H93A 4KCEA 3H4KA 1GULA 1VF3A 1SK2A 4CHSA 5GSSA 5EVOA 2X8HA 5F8BA 2AYTA 3GTUB 1Z7PA 3DIEA 1SJ6A 2EFHA 4IBPA 3IHGA 5GSTA 3NOFA 4HJ2A 2FWGA 1CQGA 5J41A 1AAZA 5ECHB 1RQMA 4USSA 4W66A 2YWNA 1EV4A 3RBTA 2V2GA 3BCKA 3UL3A 2R0CA 2ES7A 2DIYA 2K18A 3C71A 3F3QA 2VL3A 4JRRA 2WW0A 2PU9C 5JWQB 4BVYB 2P31A 3HVNA 3TKRA 2HZFA 3QAGA 18GSA 5ID2A 2L59A 1R7HA 4OCEA 3CRTA 3D0ZA 3HYPA 2IJYA 4L0UA 3IDVA 5J9BA 4GSSA 2DKIA 3WT2A 5CAXA 4HZ2A 1A8YA 4GTUA 5ECKB 5ECMB 4ECBA 2IPAA 3W8JA 1E6BA 1YY7A 3ZMKA 3IPZA 4MJCA 4TW5A 4YH2A 5IO2A 1K0MA 2K8SA 5C00A 1B8XA 3M8NA 3IK9A 1N25A 2IMEA 2O36A 4EE0A 4KSMA 1J08A 2IIYA 1YQ1A 2PWJA 1S4BP 4ML1A 4RQRA 4KH7A 4KW6A 5KN0A 3LGCA 3F4TA 2CQ9A 3UEMA 3A2WA 3KGKA 4KGIA 3QDNA 1FHEA 1PKZA 3US3A 3KMOA 4GCIA 4JEDA 2X4AA 2AJQB 3J7Yb 1Q4JA 5IMFA 2L6DA 3KH9A 3HJMA 17GSA 2F8FA 4DEJA 1X0RA 5ECOB 5JWOB 3ERGA 3DEXA 4YAPA 4WF4A 1TP9A 4JE1A 2CAQA 3IC8A 2K6VA 3VI5A 1MDIA 1YEXA 3F3RA 5ABRA 1G6YA 1TK5B 6GSYA 4TXOA 4IQAA 3TKSA 3ZITA 3FZ5A 2H73A 2H30A 2MBSA 5E4WA 1PSQA 1ZOFA 4PURA 5DAKB 5BRTA 4HQSA 1TU7A 2GTUA 4BL7B 2VD0A 5ECNB 1T8EB 1MDKA 1TW9A 1S3DA 2OT3A 1TI3A 5D9XA 2E0QA 2LNSA 3F63A 2EIOA 1A2MA 2JADA 1ST9A 3TKPA 3BD2A 2VM1A 1AUCA 5AGYA 4NAXA 4OFNA 4EF0A 4FXYP 4YQMA 1G7EA 4ECJA 1FAAA 3VWWA 4IW9A 4MF7A 3ERFA 3GSSA 2LJAA 2IFQA 1FW1A 1M99A 1ERUA 4PUAA 2YN1A 5DVBA 3M9KA 2DIZA 4BWSA 5J5NA 4XS6A 2F3MA 2HNLA 4N30A 2X99A 5DALB
chains in the Genus database with same CATH topology
3CMIA 2K9FA 3TUEA 3RHBA 4DSSB 4PQHA 3GL3A 2AAWA 3D5JA 1GTIA 4EVMA 2FA4A 2JZSA 1EOGA 3DKSA 4V2MA 5FHIA 3GV1A 2O89A 2H0IA 3GTUA 4LMVA 5IPHA 1JLWA 3IXRA 1AQXA 1ERWA 3APQA 1LBKA 1RW1A 1YKCA 2LRCA 3GFKA 2DSAA 3EU3A 2REMA 3A2VA 4OCFA 1HQOA 4NPBA 3JCML 1OKTA 4N3ZA 2C0FA 4Q5FA 4KDUA 2VCQA 4KDXA 1ABAA 4D73B 1GSSA 1O7UA 1Q98A 13GSA 5IM9A 5DBQA 2R0PA 1QK8A 1TI1A 1H4OA 3TJKA 2HZEA 2UV8G 4J2FA 2GZYA 3A2XA 4V2LA 5A34B 5G31A 2R37A 3UBLA 3WGXA 2YWOA 3KM6A 2GT5A 1GRXA 4MJEA 1K3OA 1F37A 4WEYA 3PGTA 1JZDA 1SJIA 1FB6A 1TK8B 4JU5A 5DDLA 3KP9A 1RK4A 2M46A 2EFDA 3IE3A 5B6NA 1SVLA 3TKQA 5H5SA 3VWUA 2BMXA 2WJUA 4HUAA 2IWTA 2PPTA 2LQQA 5INYA 2ON5A 5CRDA 1U6TA 4G10A 2FWEA 3BOAA 2QA1A 1WPIA 1OKDA 4NHZA 3D22A 3FYGA 4CW9A 2K8VA 4K0NA 2HFDA 1DSBA 4EIPA 4ECIA 6GSUA 2OE0A 4GWRA 2G2QA 1A0FA 3TOTA 2IN3A 4EDZA 1JFUA 4OO5A 2LSTA 5KN2A 4G0KA 1WE0A 3RHCA 1SVOA 4KSOA 3WGEA 2IMKA 2C4JA 2X64A 2E2MA 3DYRA 2OBIA 1PRXA 4F2IA 4L5LA 5IPGA 1ZYNA 1XBSA 2FWFA 3RDWA 3MDKA 1R5PA 2OACA 4XHMA 4TRXA 2GLRA 5EL8A 2JL4A 5BMUA 4XCSA 1OYJA 4BL7A 3TDGA 2OE1A 3R3EA 1O6JA 2YPMA 4AJ7A 2LNTA 3FMWA 5DJMA 14GSA 3D4TA 2C80A 3PINA 1A2LA 3IBHA 3APSA 2MMNA 5IMCA 4O92A 5J47A 4ECCA 4PTSA 5IMZA 4I2UA 3CSHA 1M9BA 2FCHA 2L4QA 2C3NA 2OBKA 1A0RP 1WOUA 5A4WA 2G0FA 2I1UA 4AJ6A 4AI6A 1NHYA 1XOBA 5KOXA 5DALA 2LQOA 4O5QA 2CV4A 5AISA 3HJPA 4DSSA 2X8CA 2HXKA 2EFCA 2GQKA 1O81A 4PUFC 5JCWA 5A5KA 1B48A 4PX1A 2MMAA 4GXZA 1THXA 1BYEA 3HCZA 4FYCA 3GIXA 3EMPA 1EEMA 2B7KA 2VD1A 3ZREA 4KUNA 3HJOA 5JCGA 4YQVA 3HHVA 4ZILA 2CX3A 3U5RE 2LJKA 4BPYA 2RM6A 2NBSA 3LG6A 4GQFA 1FOVA 4QMKA 4MF6A 4H86A 2M72A 1V2AA 6GSSA 3CSIA 4XTSA 1OC9B 2A2RA 1T1VA 3D21A 4WBJA 3KXOA 5FWGA 3GH6A 3DD3A 2EFEA 2HSNB 4X0XA 1FB0A 3KTBA 4Q5NA 1YJ6A 3EINA 2DJ2A 1EGRA 4ISDA 3SWLA 4EC0A 3ZRDA 2QKEA 1PMTA 3VFIA 1XXUA 2RIIA 3CSJA 1BG1A 1SL1B 1GLPA 1EP8A 1T00A 4YQUA 5G1LA 1UC7A 3MWHA 5H5QA 3GN3A 4OD7A 2VCWA 3KJYA 2VCZA 4RI6A 2RUFA 4QQ7A 4OO4A 4EUYA 2KP2A 4ZB6A 2CZ2A 3ZYWA 4ML6A 3GUSA 5CNWA 5IMDA 16GSA 5ECQB 1FG4A 3VK9A 4NXIA 3ZVJA 3MAKA 4V1Ag 4Q5QA 5H5RA 3ZMLA 4N10A 2J23A 4GRFA 4XRAA 4K5SA 4I6XA 2EC4A 4L8EA 3DVWA 5GAPD 1NHOA 3ERWA 3KP8A 5KOWA 3AY8A 4MF5A 4KAEA 4K8MA 2OA7A 1K0DA 3CTFA 2YANA 4BWQA 1G7OA 2H1BA 4TR3A 2A2SA 1J9BA 2HSMB 4MMMA 2LV3A 1OAZA 3DGQA 3W6GA 1KEBA 2CZ3A 4GF0A 3TKSE 3F0IA 1BX9A 1BF5A 3IR4A 5KN3A 2DLXA 2V41A 3KMNA 2AB6A 4FYUA 5HFGA 2VL9A 3IOSA 2PBJA 1GSQA 3FY7A 3D6IA 2GSSA 1R26A 4F82A 3GRXA 4K7OA 1KBNA 2H6ZA 5B6MA 2C8UA 1PN9A 1MD4A 2V1MA 1B9XC 2I3YA 4IELA 2KHPA 4HJMA 1TXXA 4IJIA 1EV9A 2F8AA 1XOAA 1WJKA 8GSSA 5HR2A 2OJLA 1ZGNA 2VAFA 1O73A 4GSNA 2HRNA 1TRVA 3F6FA 4HU9A 3TRXA 3ZFBA 5IQYA 2HE3A 2YWMA 2H0HA 2C0DA 2RUEA 2QSIA 2DJ3A 4Z2TA 3O3TA 2CVDA 1AQWA 3GNJA 3TB2A 2HQTA 4MDCA 4ZBDA 2FY6A 1ZCPA 2H76A 3EU4A 4PXOA 5F0GA 2IMIA 5HQPA 1A24A 3EVIA 5ECPB 3FZAA 1TJDA 4XS4B 3Q74A 5GZZB 4LL4B 3HZ4A 4IJ3A 2VLVA 2Z9SA 5LNKe 1M0UA 1SKRB 2PERA 3P2AA 3LXTA 4ZXGA 3LJRA 2H6XA 1GUKA 5A4VA 4FH8A 3NZNA 5G2ZA 3UOMA 2XBQA 3LEFA 4WBRD 2O87A 1GUMA 1N2AA 1KTEA 2CVKA 3FW2A 2KOKA 1OC9A 3H8QA 4MH3A 1TRWA 4O5UA 4K2DA 3H1NA 4PNGA 1XPVA 4ACSA 1GL8A 3QPMA 3VURA 1YZXA 4OFMA 5JCUA 4PQ1A 2HSNA 1ERTA 5A5HB 3F8UA 2NDOA 3TJGA 3GSTA 1DUGA 1U3IA 5IOWA 1UA5A 2FNOA 4DSQA 1U87A 1T3BA 1G6WA 1HD2A 4Z7XA 3QR6A 4WR5A 2GZPA 2XHFA 2F51A 3FHKA 5B8BA 2VKZG 2PGTA 3TKSC 4NHWA 3L9VA 1M7TA 5HFIA 2ON7A 22GSA 3I6AA 2DJKA 4O5RA 1AIUA 1K3YA 1BG5A 1F3BA 4TR1B 4WR4A 1NSWA 2P5QA 3K8NA 4TR0A 2LJRA 1GSDA 1EOHA 2CAIA 3C1SA 4X43A 2H6YA 4WXTA 1GTBA 2JSYA 3KH7A 1GSUA 1GSYA 3G7YA 4X1UA 4JR6A 5D73A 3GL5A 3HZ8A 4NMUA 3Q19A 2L6CA 1T7PB 1X9MB 1PD21 3TU3B 5IIZA 1DBYA 2NTOA 2VL2C 3RPNA 2FHEA 4CDOA 2H0GA 5CYYA 2HRAA 3GA4A 5G30A 1VF4A 6GSXA 1FOHA 4ZIJA 2H1DA 3TJBA 1K3LA 1SYXA 2HSHA 4ID0A 4IS0A 1GTUA 4GLTA 3L9SA 4K5RA 4P3YB 3GYKA 2RM5A 3MYDA 2H72A 1F3AA 2O85A 2RLIA 2OE3A 3EYTA 4HU7A 2N5FA 1FVJA 3KCMA 1OE8A 5J9CA 5DJLA 3TJFA 5ECLB 1PL2A 4G01A 4BVYA 3LORA 2CX4A 1PL1A 3FZ4A 2VUPA 3HMJG 4MCUA 1GSFA 3O76A 3TRPA 5ELAA 4WKWA 1HNAA 3HY2A 1MTCA 2O7KA 1QFNA 2WCIA 4TOPA 5CRWA 1M2DA 1YF0A 4MJBA 1B4QA 4QL9A 4L5OA 3KD0A 1XWKA 1JLVA 5CO3A 4NWYA 1XZOA 3QFAC 4DSRA 2VO4A 3FR6A 4XRDA 2FA8A 1T4YA 4O7HA 1OC8A 3IA1A 2R4VA 2B6MA 4ZBAA 4NV2A 1MEKA 3R2QA 1THOA 4IN0A 4I2TA 6GSVA 1K0CA 4HOJA 3A3TA 5ELGA 3UMAA 4IHUA 4XS4A 3VWVA 2DMLA 4AKIA 1ZYEA 3G9BA 4RQXA 4AKGA 4FO5A 3CXGA 3CWGA 3ZLPA 3EWLA 2AUVA 2B3SA 1VGLA 1IYIA 3I69A 2B1LA 1Z5YE 1Z6MA 1V98A 5IO0A 2CA8A 1X5CA 1DE1A 3EURA 4MZBA 2HRFA 2HRKB 2QC7A 2VCTA 5A1NB 3IHQA 3WD6A 3APOA 4AF2A 3ZIJA 4WF5A 3LFLA 3LYPA 5B8AA 2VCVA 2HLSA 5DAKA 2GSQA 1XWCA 5D9TA 3VWXA 3BJ5A 4IKHA 3S9FA 1ILOA 2J9HA 5HR3A 2GS3A 2YCDA 1NW2A 1U3AA 5F06A 4K0GA 1XIYA 4TR1A 4KE3A 2O5VA 1SJZA 4OFTA 3WT1A 2HYXA 1SENA 3DVXA 1Z7RA 4HQZA 3QAVA 3LWAA 1A8LA 1H75A 2B5XA 3DRNA 1F2EA 2V6KA 5LCZA 3CRUA 2GQMA 4MPGA 2LUSA 4IVFA 6GSTA 4MPFA 3TJJA 1F9MA 3E0UA 4TR4A 4ZB7A 5G5EA 3F9UA 2H71A 2B1KA 3G7JA 4KB3A 3GKMA 4J56E 5A4UA 5ENUA 2YOIA 2L57A 3EE2A 1EEJA 5J4YA 2PN8A 3PR8A 4TVEA 1FVKA 5DQYA 2P5RA 3DXBA 1LJRA 1B9YC 5GAND 2WFCA 4TN8A 2X8GA 4POKA 4AGSA 2A4VA 3ZZXA 4X4JA 4E8EA 1XW5A 1O8XA 2B5YA 1SK0A 2H8LA 4ZBBA 1A2JA 1WIKA 2JACA 2WDUA 2I4AA 4D73A 3VLNA 3M3MA 3PH9A 3UARA 5CREA 1VF2A 2IL3A 1SKWB 4EO3A 3P90A 2WZ9A 1GSEA 4Z2RA 5A34A 2HSYA 4JBBA 1CQHA 2PVOC 4ZL9A 5C04A 3V1WA 2YNXA 3TGZA 3E3EA 2A2PA 3GH9A 4TXOB 4MK3A 1GH2A 2JZTA 2R0GA 3M0FA 4N11A 4K7NA 3O6TA 2N5AA 1SD8A 1W89A 3M9JA 4I5QA 4F0CA 7GSSA 1XVQA 3P7XA 2DJ0A 1TOFA 4MNNA 5AN1A 1XWAA 1V57A 3BBYA 5J40A 4ILFA 1YF1A 1Z9HA 2VM2A 4XIHA 3CBUA 5ECIB 2H70A 4POLA 2GSTA 2YV7A 3M1GA 2AV4A 1JZWA 1YVLA 1YDKA 1K0AA 4OWYA 2VIMA 2C1YA 1E2YA 9GSSA 2HRKA 2DBCA 2GQLA 1C72A 4MH2A 4O32A 4MJAA 4F0BA 2MYGA 2IMFA 1DE2A 1SKSB 1BEDA 2NPBA 4BA7A 4MA9A 2EIQA 1R4WA 3P8WA 3C73A 1M2AA 4EL1A 3QAWA 3L78A 3ED3A 3LW9A 5HFKA 2C3QA 3QFBC 4HS1A 2KP1A 2TRXA 1GNEA 1I9DA 2V32A 1FO5A 1Z6NA 5DCGA 1A23A 4EXJA 2N5BA 3HA9A 1GWCA 3Q6OA 1M2BA 2YZUA 1HNCA 4GSTA 1JZOA 1W4VA 5ECRB 2DKHA 4GDFA 1TTZA 3FR3A 1PX6A 1XWBA 10GSA 2UZ8A 4GQCA 3UIWA 1Y25A 4G0IA 1R5AA 4EDYA 1TRSA 2GT6A 1X5DA 5FT3A 2HZEB 4G2EA 2IMDA 1ZYPA 1BJXA 1B4PA 3MIXA 2QA2A 3KTLA 2HI7A 3ZVJD 2I9HA 4IGJA 3A5WA 3GX8A 3FEUA 1GNWA 5D8IA 2LRNA 2AHEA 4J57E 2R6KA 2XPEA 1LU4A 1ACVA 3IV4A 4LA1A 2B7JA 4YAVA 1VRSD 4G9HA 2CT6A 1AC1A 4TXVA 2GZZA 3MNGA 1TRUA 1K0OA 3UVTA 3UBKA 3L0HA 2YWIA 4ZL8A 1ON4A 2WS2A 6GSWA 3GKXA 2C0GA 4FYBA 1PA3A 2H1GA 1SVMA 5DQSA 1PQNA 2H1AA 5EY6A 2R3XA 3LYKA 1TU8A 3EC3A 3FKFA 1X5EA 1K0NA 1OVNA 3RAZA 4V2NA 2PMTA 4POMA 2WRTA 4POBA 1V58A 5B7CA 4CY6A 2H01A 4E8HA 1X9SB 4FIWA 1XWGA 5BMUB 3QOUA 4KNDA 1SL0B 2BTOT 2WB9A 2ZNMA 1TDIA 3L4NA 3I9V2 2MZCA 3VI7A 1TKDB 1AW9A 4E68A 3W8SA 2TRCP 4LLRA 4LMWA 3KZQA 2YZHA 3ZTLA 5F07A 4ICYA 4HI7A 1S3AA 1MD3A 3HXSA 4N0VA 2VL2A 2WULA 3FRCA 3WGDA 1PX7A 4MZCA 1K0BA 3F4SA 3QCPA 3FR9A 1JZRA 2LRTA 1GLQA 3TOUA 2NVLA 3LQ7A 3WYWA 2F9SA 1QXHA 2DJ1A 2FWHA 4JR4A 2LEGA 20GSA 3VPQA 3I43A 1O8WA 2C0EA 3IAS2 3E9JB 3CYNA 2HSMA 3LXZA 1M9AA 4G19A 4OMVA 4IP6A 5COHA 3EPTA 4JZQA 1X9WB 4YKGA 2L5OA 4ULXA 4MZWA 5AIVA 3OR5A 2H19A 1SU9A 3PPUA 1BQ7A 4G0LA 3MSZA 1Y6EA 1GTAA 4QL7A 2C3TA 1XFLA 4K6XA 1XW9A 2H1LA 2XBIA 1USBA 3EMXA 5IMAA 5IOXA 3GURA 4K1FA 5D9WA 1SK1A 1Y1UA 1YKAA 2VLTA 4MABA 1YEPA 3BCIA 3HVSA 3F6DA 3QD9A 5AIXA 5IMVA 1SD9A 4IQ1A 3GX0A 2L4CA 4PNFA 4BVXB 3U6VA 5J3RA 5HR1A 2GSRA 2H74A 3QMXA 2BJXA 2LKUA 1S3CA 12GSA 3G7IA 3ISOA 4KCAA 3RPPA 2I81A 3VPTA 4MLYA 2DC5A 1ZMAA 4F03A 2XPDA 3KIJA 1PN0A 4TKYA 5CRGA 3CTGA 2M80A 2TIRA 2GGTA 2CVBA 4AJ8A 4K2XA 4PGTA 2R2JA 2LTKA 3IRAA 4ZB9A 4DVCA 2JSZA 3GKNA 2PVQA 3FZ9A 3HVXA 4V1Ap 4LL1B 4HEA2 1V40A 3IK7A 3HKRA 5KEJA 2H75A 3J7Yk 5A5HA 1UVZA 1WRYA 4ZL7A 5HR0A 2OKAA 11GSA 3DMLA 4RI7A 4RUVA 4K7IA 2YJHA 2DMMA 1F6MC 3IAM2 2XC2A 1TK0B 4N0ZA 3UAPA 1I5GA 5G5FA 2JZRA 5DCHA 4AKXB 3HVVA 1EZKA 1N8JA 2ZCTA 3ZIVA 1AXDA 2OADA 2ALBA 2HT9A 2MMZA 5D93A 4Q5RA 1EGOA 2YV9A 2GDRA 5ECSA 5CP1A 2QGVA 2A4HA 3HD5A 1SYRA 1NM3A 3L9UA 2V6OA 1GUHA 3Q18A 2MBTA 1KNGA 4KDYA 3GHAA 3KEBA 1XCCA 4I8BA 5ID2B 4FQUA 1WMJA 2B5EA 1PKWA 3NIVA 1HYUA 1BAYA 2YJ7A 3TCOA 3ZL5A 2KUCA 1IYHA 5J4UA 5L71A 1JHBA 2KLXA 2VLUA 2D2ZA 5EPFA 1XW6A 2P0GA 1WWJA 2PUKC 1MDJA 3UVHA 1QQ2A 3C8EA 1PGTA 5LD0A 2VOCA 4MP4A 1O85A 1OC3A 3C1RA 4PQIA 4AKHA 5KN1A 3N9JA 1VF1A 4WETA 3GKKA 5JWRB 3HDCA 1HNBA 3N5OA 1ZZYA 4ZB8A 2EIRA 4K9ZA 2L5LA 2X49A 2E2GA 2LS5A 5F05A 1ML6A 5J4VA 5E59A 19GSA 1EWXA 2H66A 3LSZA 1QGVA 3ME8A 2E7PA 3IC4A 4HZ4A 3F4RA 2VCXA 1UN2A 1GP1A 1EP7A 1QMVA 1U88A 2FUG2 1WP0A 1QUWA 2WGRA 3ZFLA 1T4ZA 1Z3EA 5D96A 1URMA 4BVXA 4KX4A 2ZUPA 3DWVA 1J0FA 4KF9A 4I97A 4Z2UA 1V9WA 5G1KA 2MMOA 4CY8A 2DJJA 4F9ZA 1G0TA 4YKFA 4KA0A 2JU5A 1AQVA 3UJ1A 1OE7A 3D4MA 3TRQA 3A5IA 5CRHA 4EIQA 1ZL9A 2YP6A 2GVPA 4IP1A 3ME7A 4A5PA 2O8VB 5A1NA 3H79A 2IFQB 4NV5A 2R5GA 3GMFA 1XVWA 1TXUA 1SL2B 4XS1A 4L0WA 5D9VA 1ERVA 2FD3A 4EKZA 3SBCA 2FLSA 4HDEA 1ZYQB 2FGXA 3FK8A 3C7MA 3H93A 4KCEA 3H4KA 1GULA 1VF3A 1SK2A 4CHSA 5GSSA 5EVOA 2X8HA 5F8BA 2AYTA 3GTUB 1Z7PA 3DIEA 1SJ6A 2EFHA 4IBPA 3IHGA 5GSTA 3NOFA 4HJ2A 2FWGA 1CQGA 5J41A 1AAZA 5ECHB 1RQMA 4USSA 4W66A 2YWNA 1EV4A 3RBTA 2V2GA 3BCKA 3UL3A 2R0CA 2ES7A 2DIYA 2K18A 3C71A 3F3QA 2VL3A 4JRRA 2PU9C 5JWQB 4BVYB 2P31A 3TKRA 2HZFA 3QAGA 18GSA 5ID2A 2L59A 1R7HA 4OCEA 3CRTA 3D0ZA 3HYPA 2IJYA 4L0UA 3IDVA 5J9BA 4GSSA 2DKIA 3WT2A 5CAXA 4HZ2A 1A8YA 4GTUA 5ECKB 5ECMB 4ECBA 2IPAA 3W8JA 1E6BA 1YY7A 3ZMKA 3IPZA 4MJCA 4TW5A 4YH2A 5IO2A 1K0MA 2K8SA 5C00A 1B8XA 3M8NA 3IK9A 1N25A 2IMEA 4EE0A 4KSMA 1J08A 2IIYA 1YQ1A 2PWJA 4ML1A 4RQRA 4KH7A 4KW6A 5KN0A 3LGCA 3F4TA 2CQ9A 3UEMA 3A2WA 3KGKA 4KGIA 3QDNA 1FHEA 1PKZA 3US3A 3KMOA 4GCIA 4JEDA 2X4AA 2AJQB 3J7Yb 1Q4JA 5IMFA 2L6DA 3KH9A 3HJMA 17GSA 2F8FA 4DEJA 1X0RA 5ECOB 5JWOB 3ERGA 3DEXA 4YAPA 4WF4A 1TP9A 4JE1A 2CAQA 3IC8A 2K6VA 3VI5A 1MDIA 1YEXA 3F3RA 5ABRA 1G6YA 1TK5B 6GSYA 4TXOA 4IQAA 3TKSA 3ZITA 3FZ5A 2H73A 2H30A 2MBSA 5E4WA 1PSQA 1ZOFA 4PURA 5DAKB 5BRTA 4HQSA 1TU7A 2GTUA 4BL7B 2VD0A 5ECNB 1T8EB 1MDKA 1TW9A 1S3DA 2OT3A 1TI3A 5D9XA 2E0QA 2LNSA 3F63A 2EIOA 1A2MA 2JADA 1ST9A 3TKPA 3BD2A 2VM1A 1AUCA 5AGYA 4NAXA 4OFNA 4EF0A 4YQMA 1G7EA 4ECJA 1FAAA 3VWWA 4IW9A 4MF7A 3ERFA 3GSSA 2LJAA 2IFQA 1FW1A 1M99A 1ERUA 4PUAA 2YN1A 5DVBA 3M9KA 2DIZA 4BWSA 5J5NA 4XS6A 2F3MA 2HNLA 4N30A 2X99A 5DALB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMI A;  2K9F A;  3TUE A;  3RHB A;  4DSS B;  4PQH A;  3GL3 A;  2AAW A;  3D5J A;  1GTI A;  4EVM A;  2FA4 A;  2JZS A;  1EOG A;  3DKS A;  4V2M A;  5FHI A;  3GV1 A;  2O89 A;  2H0I A;  3GTU A;  4LMV A;  5IPH A;  1JLW A;  3IXR A;  1AQX A;  1ERW A;  3APQ A;  1LBK A;  1RW1 A;  1YKC A;  2LRC A;  3GFK A;  2DSA A;  3EU3 A;  2REM A;  3A2V A;  4OCF A;  1HQO A;  4NPB A;  3JCM L;  1OKT A;  2C0F A;  4Q5F A;  4KDU A;  2VCQ A;  4KDX A;  1ABA A;  4D73 B;  1GSS A;  1O7U A;  1Q98 A;  13GS A;  5IM9 A;  5DBQ A;  1QK8 A;  1TI1 A;  1H4O A;  3TJK A;  2HZE A;  4J2F A;  2GZY A;  3A2X A;  4V2L A;  5G31 A;  2R37 A;  3UBL A;  3WGX A;  2YWO A;  3KM6 A;  2GT5 A;  1GRX A;  4MJE A;  1K3O A;  1F37 A;  4WEY A;  3PGT A;  1JZD A;  1SJI A;  1FB6 A;  1TK8 B;  4JU5 A;  5DDL A;  3KP9 A;  1RK4 A;  2M46 A;  3IE3 A;  5B6N A;  3TKQ A;  5H5S A;  3VWU A;  2BMX A;  2WJU A;  4HUA A;  2IWT A;  2PPT A;  2LQQ A;  5INY A;  2ON5 A;  5CRD A;  1U6T A;  4G10 A;  2FWE A;  3BOA A;  1WPI A;  1OKD A;  4NHZ A;  3D22 A;  3FYG A;  4CW9 A;  2K8V A;  4K0N A;  2HFD A;  1DSB A;  4ECI A;  6GSU A;  2OE0 A;  4GWR A;  2G2Q A;  1A0F A;  3TOT A;  2IN3 A;  4EDZ A;  1JFU A;  4OO5 A;  2LST A;  5KN2 A;  4G0K A;  1WE0 A;  3RHC A;  4KSO A;  3WGE A;  2IMK A;  2C4J A;  2X64 A;  2E2M A;  3DYR A;  2OBI A;  1PRX A;  4F2I A;  4L5L A;  5IPG A;  1XBS A;  2FWF A;  3RDW A;  3MDK A;  1R5P A;  2OAC A;  4XHM A;  4TRX A;  2GLR A;  5EL8 A;  2JL4 A;  5BMU A;  4XCS A;  1OYJ A;  4BL7 A;  3TDG A;  2OE1 A;  3R3E A;  1O6J A;  2YPM A;  4AJ7 A;  2LNT A;  5DJM A;  14GS A;  3D4T A;  2C80 A;  3PIN A;  1A2L A;  3IBH A;  3APS A;  2MMN A;  5IMC A;  4O92 A;  4ECC A;  4PTS A;  5IMZ A;  4I2U A;  3CSH A;  1M9B A;  2FCH A;  2L4Q A;  2C3N A;  2OBK A;  1A0R P;  1WOU A;  5A4W A;  2G0F A;  2I1U A;  4AJ6 A;  1NHY A;  1XOB A;  5DAL A;  2LQO A;  2CV4 A;  5AIS A;  3HJP A;  4DSS A;  2X8C A;  2HXK A;  2GQK A;  1O81 A;  4PUF C;  5JCW A;  5A5K A;  1B48 A;  4PX1 A;  2MMA A;  4GXZ A;  1THX A;  1BYE A;  3HCZ A;  4FYC A;  3GIX A;  3EMP A;  1EEM A;  2B7K A;  2VD1 A;  3ZRE A;  4KUN A;  3HJO A;  5JCG A;  4YQV A;  3HHV A;  4ZIL A;  2CX3 A;  3U5R E;  2LJK A;  4BPY A;  2RM6 A;  2NBS A;  3LG6 A;  4GQF A;  1FOV A;  4MF6 A;  4H86 A;  2M72 A;  1V2A A;  6GSS A;  3CSI A;  4XTS A;  1OC9 B;  2A2R A;  1T1V A;  3D21 A;  4WBJ A;  3KXO A;  5FWG A;  3GH6 A;  3DD3 A;  2HSN B;  4X0X A;  1FB0 A;  3KTB A;  4Q5N A;  1YJ6 A;  3EIN A;  2DJ2 A;  1EGR A;  4ISD A;  3SWL A;  4EC0 A;  3ZRD A;  2QKE A;  1PMT A;  3VFI A;  1XXU A;  2RII A;  3CSJ A;  1SL1 B;  1GLP A;  1EP8 A;  1T00 A;  4YQU A;  5G1L A;  1UC7 A;  3MWH A;  5H5Q A;  3GN3 A;  4OD7 A;  2VCW A;  3KJY A;  2VCZ A;  4RI6 A;  2RUF A;  4QQ7 A;  4OO4 A;  4EUY A;  2KP2 A;  4ZB6 A;  2CZ2 A;  3ZYW A;  4ML6 A;  3GUS A;  5CNW A;  5IMD A;  16GS A;  5ECQ B;  1FG4 A;  3VK9 A;  4NXI A;  3ZVJ A;  3MAK A;  4V1A g;  4Q5Q A;  5H5R A;  3ZML A;  4N10 A;  2J23 A;  4GRF A;  4XRA A;  4I6X A;  2EC4 A;  4L8E A;  3DVW A;  5GAP D;  1NHO A;  3ERW A;  3KP8 A;  3AY8 A;  4MF5 A;  4KAE A;  4K8M A;  2OA7 A;  1K0D A;  3CTF A;  2YAN A;  4BWQ A;  1G7O A;  2H1B A;  4TR3 A;  2A2S A;  1J9B A;  2HSM B;  4MMM A;  2LV3 A;  1OAZ A;  3DGQ A;  3W6G A;  1KEB A;  2CZ3 A;  4GF0 A;  3TKS E;  3F0I A;  1BX9 A;  3IR4 A;  5KN3 A;  2DLX A;  2V41 A;  3KMN A;  4FYU A;  2AB6 A;  5HFG A;  2VL9 A;  3IOS A;  2PBJ A;  1GSQ A;  3FY7 A;  3D6I A;  2GSS A;  1R26 A;  4F82 A;  3GRX A;  4K7O A;  1KBN A;  2H6Z A;  5B6M A;  2C8U A;  1PN9 A;  1MD4 A;  2V1M A;  1B9X C;  2I3Y A;  4IEL A;  2KHP A;  4HJM A;  1TXX A;  4IJI A;  1EV9 A;  2F8A A;  1XOA A;  1WJK A;  8GSS A;  5HR2 A;  2OJL A;  1ZGN A;  2VAF A;  1O73 A;  4GSN A;  2HRN A;  1TRV A;  3F6F A;  4HU9 A;  3TRX A;  3ZFB A;  5IQY A;  2HE3 A;  2YWM A;  2H0H A;  2C0D A;  2RUE A;  2QSI A;  2DJ3 A;  3O3T A;  2CVD A;  1AQW A;  3GNJ A;  3TB2 A;  2HQT A;  4MDC A;  4ZBD A;  2FY6 A;  1ZCP A;  2H76 A;  3EU4 A;  4PXO A;  5F0G A;  2IMI A;  5HQP A;  1A24 A;  3EVI A;  5ECP B;  3FZA A;  1TJD A;  4XS4 B;  3Q74 A;  5GZZ B;  4LL4 B;  3HZ4 A;  4IJ3 A;  2VLV A;  2Z9S A;  5LNK e;  1M0U A;  1SKR B;  2PER A;  3P2A A;  3LXT A;  4ZXG A;  3LJR A;  2H6X A;  1GUK A;  5A4V A;  4FH8 A;  3NZN A;  5G2Z A;  3UOM A;  2XBQ A;  3LEF A;  4WBR D;  2O87 A;  1GUM A;  1N2A A;  1KTE A;  2CVK A;  3FW2 A;  2KOK A;  1OC9 A;  3H8Q A;  4MH3 A;  1TRW A;  4K2D A;  3H1N A;  4PNG A;  1XPV A;  4ACS A;  1GL8 A;  3QPM A;  3VUR A;  1YZX A;  4OFM A;  5JCU A;  4PQ1 A;  1ERT A;  3F8U A;  2NDO A;  3TJG A;  3GST A;  1DUG A;  1U3I A;  5IOW A;  1UA5 A;  2FNO A;  4DSQ A;  1U87 A;  1T3B A;  1G6W A;  1HD2 A;  4Z7X A;  3QR6 A;  4WR5 A;  2GZP A;  2XHF A;  2F51 A;  3FHK A;  5B8B A;  2PGT A;  3TKS C;  4NHW A;  3L9V A;  1M7T A;  5HFI A;  2ON7 A;  22GS A;  3I6A A;  2DJK A;  4O5R A;  1AIU A;  1K3Y A;  1BG5 A;  1F3B A;  4TR1 B;  4WR4 A;  1NSW A;  2P5Q A;  3K8N A;  4TR0 A;  2LJR A;  1GSD A;  1EOH A;  2CAI A;  3C1S A;  4X43 A;  2H6Y A;  4WXT A;  1GTB A;  2JSY A;  3KH7 A;  1GSU A;  1GSY A;  3G7Y A;  4X1U A;  4JR6 A;  5D73 A;  3GL5 A;  3HZ8 A;  4NMU A;  3Q19 A;  2L6C A;  1T7P B;  1X9M B;  1PD2 1;  5IIZ A;  1DBY A;  2NTO A;  2VL2 C;  3RPN A;  2FHE A;  4CDO A;  2H0G A;  5CYY A;  2HRA A;  3GA4 A;  5G30 A;  1VF4 A;  6GSX A;  4ZIJ A;  2H1D A;  3TJB A;  1K3L A;  1SYX A;  2HSH A;  4ID0 A;  4IS0 A;  1GTU A;  4GLT A;  3L9S A;  4P3Y B;  3GYK A;  2RM5 A;  2H72 A;  1F3A A;  2O85 A;  2RLI A;  2OE3 A;  3EYT A;  4HU7 A;  2N5F A;  1FVJ A;  3KCM A;  1OE8 A;  5J9C A;  5DJL A;  3TJF A;  5ECL B;  1PL2 A;  4BVY A;  3LOR A;  2CX4 A;  1PL1 A;  3FZ4 A;  2VUP A;  4MCU A;  1GSF A;  3O76 A;  3TRP A;  5ELA A;  4WKW A;  1HNA A;  3HY2 A;  1MTC A;  2O7K A;  1QFN A;  2WCI A;  4TOP A;  5CRW A;  1M2D A;  1YF0 A;  4MJB A;  1B4Q A;  4QL9 A;  4L5O A;  3KD0 A;  1XWK A;  1JLV A;  5CO3 A;  4NWY A;  1XZO A;  3QFA C;  4DSR A;  2VO4 A;  3FR6 A;  4XRD A;  2FA8 A;  1T4Y A;  4O7H A;  1OC8 A;  3IA1 A;  2R4V A;  2B6M A;  4ZBA A;  4NV2 A;  1MEK A;  3R2Q A;  1THO A;  4IN0 A;  4I2T A;  6GSV A;  1K0C A;  4HOJ A;  3A3T A;  5ELG A;  3UMA A;  4IHU A;  4XS4 A;  3VWV A;  2DML A;  1ZYE A;  3G9B A;  4RQX A;  4FO5 A;  3CXG A;  3ZLP A;  2AUV A;  2B3S A;  3EWL A;  1VGL A;  1IYI A;  3I69 A;  2B1L A;  1Z5Y E;  1Z6M A;  1V98 A;  5IO0 A;  2CA8 A;  1X5C A;  1DE1 A;  3EUR A;  4MZB A;  2HRF A;  2HRK B;  2QC7 A;  2VCT A;  3IHQ A;  3WD6 A;  3APO A;  4AF2 A;  3ZIJ A;  4WF5 A;  3LFL A;  3LYP A;  5B8A A;  2VCV A;  2HLS A;  5DAK A;  2GSQ A;  1XWC A;  5D9T A;  3VWX A;  3BJ5 A;  4IKH A;  3S9F A;  1ILO A;  2J9H A;  5HR3 A;  2GS3 A;  2YCD A;  1NW2 A;  1U3A A;  5F06 A;  4K0G A;  1XIY A;  4TR1 A;  4KE3 A;  1SJZ A;  4OFT A;  3WT1 A;  2HYX A;  1SEN A;  3DVX A;  1Z7R A;  4HQZ A;  3QAV A;  3LWA A;  1A8L A;  1H75 A;  2B5X A;  3DRN A;  1F2E A;  2V6K A;  5LCZ A;  3CRU A;  2GQM A;  4MPG A;  2LUS A;  4IVF A;  6GST A;  4MPF A;  3TJJ A;  1F9M A;  3E0U A;  4TR4 A;  5G5E A;  3F9U A;  2H71 A;  2B1K A;  3G7J A;  4KB3 A;  3GKM A;  4J56 E;  5A4U A;  5ENU A;  2YOI A;  2L57 A;  3EE2 A;  1EEJ A;  4TVE A;  2PN8 A;  3PR8 A;  1FVK A;  5DQY A;  2P5R A;  3DXB A;  1LJR A;  1B9Y C;  5GAN D;  2WFC A;  4TN8 A;  2X8G A;  4POK A;  4AGS A;  2A4V A;  3ZZX A;  4E8E A;  1XW5 A;  1O8X A;  2B5Y A;  1SK0 A;  2H8L A;  4ZBB A;  1A2J A;  1WIK A;  2JAC A;  2WDU A;  2I4A A;  4D73 A;  3VLN A;  3M3M A;  3PH9 A;  3UAR A;  5CRE A;  1VF2 A;  2IL3 A;  1SKW B;  4EO3 A;  3P90 A;  2WZ9 A;  1GSE A;  2HSY A;  4JBB A;  1CQH A;  2PVO C;  4ZL9 A;  5C04 A;  3V1W A;  2YNX A;  3TGZ A;  3E3E A;  3GH9 A;  4TXO B;  4MK3 A;  1GH2 A;  2JZT A;  3M0F A;  4N11 A;  4K7N A;  3O6T A;  2N5A A;  1SD8 A;  1W89 A;  3M9J A;  4I5Q A;  4F0C A;  7GSS A;  1XVQ A;  3P7X A;  2DJ0 A;  1TOF A;  5AN1 A;  1XWA A;  1V57 A;  3BBY A;  4ILF A;  1YF1 A;  1Z9H A;  2VM2 A;  4XIH A;  3CBU A;  5ECI B;  2H70 A;  4POL A;  2GST A;  2YV7 A;  3M1G A;  2AV4 A;  1JZW A;  1YDK A;  1K0A A;  4OWY A;  2VIM A;  2C1Y A;  1E2Y A;  9GSS A;  2HRK A;  2DBC A;  2GQL A;  1C72 A;  4MH2 A;  4O32 A;  4MJA A;  4F0B A;  2MYG A;  2IMF A;  1DE2 A;  1SKS B;  1BED A;  2NPB A;  4BA7 A;  4MA9 A;  2EIQ A;  1R4W A;  3P8W A;  3C73 A;  1M2A A;  4EL1 A;  3QAW A;  3L78 A;  3ED3 A;  5HFK A;  2C3Q A;  3QFB C;  4HS1 A;  2KP1 A;  2TRX A;  1GNE A;  1I9D A;  2V32 A;  1FO5 A;  1Z6N A;  5DCG A;  1A23 A;  4EXJ A;  2N5B A;  3HA9 A;  1GWC A;  3Q6O A;  1M2B A;  2YZU A;  1HNC A;  4GST A;  1JZO A;  1W4V A;  5ECR B;  1TTZ A;  3FR3 A;  1PX6 A;  1XWB A;  10GS A;  2UZ8 A;  4GQC A;  3UIW A;  1Y25 A;  4G0I A;  1R5A A;  4EDY A;  1TRS A;  2GT6 A;  1X5D A;  5FT3 A;  2HZE B;  4G2E A;  2IMD A;  1BJX A;  1B4P A;  3KTL A;  2HI7 A;  3ZVJ D;  2I9H A;  4IGJ A;  3A5W A;  3GX8 A;  3FEU A;  1GNW A;  5D8I A;  2LRN A;  2AHE A;  4J57 E;  2R6K A;  2XPE A;  1LU4 A;  1ACV A;  3IV4 A;  4LA1 A;  2B7J A;  4YAV A;  1VRS D;  4G9H A;  2CT6 A;  1AC1 A;  4TXV A;  2GZZ A;  3MNG A;  1TRU A;  1K0O A;  3UVT A;  3UBK A;  3L0H A;  2YWI A;  4ZL8 A;  1ON4 A;  2WS2 A;  6GSW A;  3GKX A;  2C0G A;  4FYB A;  1PA3 A;  2H1G A;  5DQS A;  1PQN A;  2H1A A;  5EY6 A;  2R3X A;  3LYK A;  1TU8 A;  3EC3 A;  3FKF A;  1X5E A;  1K0N A;  1OVN A;  3RAZ A;  4V2N A;  2PMT A;  4POM A;  2WRT A;  4POB A;  1V58 A;  5B7C A;  2H01 A;  4E8H A;  1X9S B;  4FIW A;  1XWG A;  3QOU A;  4KND A;  1SL0 B;  2BTO T;  2WB9 A;  2ZNM A;  1TDI A;  3L4N A;  3I9V 2;  2MZC A;  3VI7 A;  1TKD B;  1AW9 A;  2TRC P;  3W8S A;  4LLR A;  4LMW A;  3KZQ A;  2YZH A;  3ZTL A;  5F07 A;  4HI7 A;  1S3A A;  1MD3 A;  3HXS A;  4N0V A;  2VL2 A;  2WUL A;  3FRC A;  3WGD A;  1PX7 A;  4MZC A;  1K0B A;  3F4S A;  3QCP A;  3FR9 A;  1JZR A;  2LRT A;  1GLQ A;  3TOU A;  2NVL A;  3LQ7 A;  3WYW A;  2F9S A;  1QXH A;  2DJ1 A;  2FWH A;  4JR4 A;  2LEG A;  20GS A;  3VPQ A;  3I43 A;  1O8W A;  2C0E A;  3IAS 2;  3E9J B;  2HSM A;  3LXZ A;  3CYN A;  1M9A A;  4G19 A;  4OMV A;  4IP6 A;  5COH A;  4JZQ A;  1X9W B;  2L5O A;  4ULX A;  4MZW A;  5AIV A;  3OR5 A;  2H19 A;  1SU9 A;  3PPU A;  1BQ7 A;  4G0L A;  3MSZ A;  1Y6E A;  1GTA A;  4QL7 A;  2C3T A;  1XFL A;  4K6X A;  1XW9 A;  5IOX A;  2XBI A;  1USB A;  3EMX A;  5IMA A;  3GUR A;  4K1F A;  5D9W A;  1SK1 A;  1YKA A;  2VLT A;  4MAB A;  1YEP A;  3BCI A;  3HVS A;  3F6D A;  3QD9 A;  5AIX A;  5IMV A;  1SD9 A;  4IQ1 A;  3GX0 A;  2L4C A;  4PNF A;  4BVX B;  3U6V A;  5J3R A;  5HR1 A;  2GSR A;  2H74 A;  3QMX A;  2BJX A;  2LKU A;  1S3C A;  12GS A;  3G7I A;  3ISO A;  4KCA A;  3RPP A;  3VPT A;  2I81 A;  4MLY A;  2DC5 A;  1ZMA A;  4F03 A;  2XPD A;  3KIJ A;  4TKY A;  5CRG A;  3CTG A;  2M80 A;  2TIR A;  2GGT A;  2CVB A;  4AJ8 A;  4PGT A;  2R2J A;  2LTK A;  3IRA A;  4ZB9 A;  4DVC A;  2JSZ A;  3GKN A;  2PVQ A;  3FZ9 A;  3HVX A;  4V1A p;  4LL1 B;  4HEA 2;  1V40 A;  3IK7 A;  3HKR A;  5KEJ A;  2H75 A;  3J7Y k;  1UVZ A;  1WRY A;  4ZL7 A;  5HR0 A;  2OKA A;  11GS A;  3DML A;  4RI7 A;  4RUV A;  4K7I A;  2YJH A;  2DMM A;  1F6M C;  3IAM 2;  2XC2 A;  1TK0 B;  4N0Z A;  3UAP A;  1I5G A;  5G5F A;  2JZR A;  5DCH A;  3HVV A;  1EZK A;  1N8J A;  2ZCT A;  3ZIV A;  1AXD A;  2OAD A;  2ALB A;  2HT9 A;  2MMZ A;  5D93 A;  4Q5R A;  1EGO A;  2YV9 A;  2GDR A;  5ECS A;  5CP1 A;  2QGV A;  3HD5 A;  1SYR A;  1NM3 A;  3L9U A;  2V6O A;  1GUH A;  3Q18 A;  2MBT A;  1KNG A;  4KDY A;  3GHA A;  3KEB A;  1XCC A;  4I8B A;  5ID2 B;  4FQU A;  1WMJ A;  2B5E A;  1PKW A;  3NIV A;  1HYU A;  1BAY A;  2YJ7 A;  3TCO A;  3ZL5 A;  2KUC A;  1IYH A;  5J4U A;  5L71 A;  1JHB A;  2KLX A;  2VLU A;  2D2Z A;  5EPF A;  1XW6 A;  2P0G A;  1WWJ A;  2PUK C;  1MDJ A;  3UVH A;  1QQ2 A;  3C8E A;  1PGT A;  5LD0 A;  2VOC A;  4MP4 A;  1O85 A;  1OC3 A;  3C1R A;  4PQI A;  5KN1 A;  3N9J A;  1VF1 A;  4WET A;  3GKK A;  5JWR B;  3HDC A;  1HNB A;  3N5O A;  1ZZY A;  4ZB8 A;  2EIR A;  4K9Z A;  2L5L A;  2E2G A;  2LS5 A;  5F05 A;  1ML6 A;  5E59 A;  19GS A;  1EWX A;  2H66 A;  3LSZ A;  1QGV A;  3ME8 A;  2E7P A;  3IC4 A;  4HZ4 A;  3F4R A;  2VCX A;  1UN2 A;  1GP1 A;  1EP7 A;  1QMV A;  1U88 A;  2FUG 2;  1WP0 A;  1QUW A;  2WGR A;  3ZFL A;  1T4Z A;  1Z3E A;  5D96 A;  1URM A;  4BVX A;  4KX4 A;  2ZUP A;  3DWV A;  1J0F A;  4KF9 A;  4I97 A;  1V9W A;  5G1K A;  2MMO A;  2DJJ A;  4F9Z A;  1G0T A;  4KA0 A;  2JU5 A;  1AQV A;  3UJ1 A;  1OE7 A;  3D4M A;  3TRQ A;  5CRH A;  1ZL9 A;  2YP6 A;  2GVP A;  4IP1 A;  3ME7 A;  2O8V B;  3H79 A;  2IFQ B;  4NV5 A;  2R5G A;  3GMF A;  1XVW A;  1SL2 B;  4XS1 A;  4L0W A;  5D9V A;  1ERV A;  2FD3 A;  4EKZ A;  3SBC A;  2FLS A;  4HDE A;  1ZYQ B;  2FGX A;  3FK8 A;  4KCE A;  3C7M A;  3H93 A;  3H4K A;  1GUL A;  1VF3 A;  1SK2 A;  4CHS A;  5GSS A;  5EVO A;  2X8H A;  5F8B A;  2AYT A;  3GTU B;  1Z7P A;  3DIE A;  1SJ6 A;  4IBP A;  5GST A;  3NOF A;  4HJ2 A;  2FWG A;  1CQG A;  5J41 A;  1AAZ A;  5ECH B;  1RQM A;  4USS A;  2YWN A;  1EV4 A;  3RBT A;  2V2G A;  3BCK A;  3UL3 A;  2ES7 A;  2DIY A;  2K18 A;  3C71 A;  3F3Q A;  2VL3 A;  4JRR A;  2PU9 C;  5JWQ B;  4BVY B;  2P31 A;  3TKR A;  2HZF A;  3QAG A;  18GS A;  5ID2 A;  2L59 A;  1R7H A;  4OCE A;  3CRT A;  3D0Z A;  3HYP A;  2IJY A;  4L0U A;  3IDV A;  5J9B A;  4GSS A;  5CAX A;  3WT2 A;  4HZ2 A;  1A8Y A;  4GTU A;  5ECK B;  5ECM B;  4ECB A;  2IPA A;  3W8J A;  1E6B A;  1YY7 A;  3ZMK A;  3IPZ A;  4MJC A;  4TW5 A;  4YH2 A;  5IO2 A;  1K0M A;  2K8S A;  5C00 A;  1B8X A;  3M8N A;  3IK9 A;  2IME A;  4EE0 A;  4KSM A;  1J08 A;  2IIY A;  1YQ1 A;  2PWJ A;  4ML1 A;  4RQR A;  4KH7 A;  4KW6 A;  5KN0 A;  3LGC A;  3F4T A;  2CQ9 A;  3UEM A;  3A2W A;  3KGK A;  4KGI A;  3QDN A;  1FHE A;  1PKZ A;  3US3 A;  3KMO A;  4GCI A;  4JED A;  2AJQ B;  3J7Y b;  1Q4J A;  5IMF A;  2L6D A;  3KH9 A;  3HJM A;  17GS A;  2F8F A;  4DEJ A;  1X0R A;  5ECO B;  5JWO B;  3ERG A;  3DEX A;  4YAP A;  4WF4 A;  1TP9 A;  4JE1 A;  2CAQ A;  3IC8 A;  2K6V A;  3VI5 A;  1MDI A;  1YEX A;  3F3R A;  5ABR A;  1G6Y A;  1TK5 B;  6GSY A;  4TXO A;  4IQA A;  3TKS A;  3ZIT A;  3FZ5 A;  2H73 A;  2H30 A;  2MBS A;  5E4W A;  1PSQ A;  1ZOF A;  4PUR A;  5DAK B;  4HQS A;  1TU7 A;  2GTU A;  4BL7 B;  2VD0 A;  5ECN B;  1T8E B;  1MDK A;  1TW9 A;  1S3D A;  1TI3 A;  5D9X A;  2E0Q A;  2LNS A;  3F63 A;  2EIO A;  1A2M A;  2JAD A;  1ST9 A;  3TKP A;  3BD2 A;  2VM1 A;  1AUC A;  5AGY A;  4NAX A;  4OFN A;  4EF0 A;  4YQM A;  1G7E A;  4ECJ A;  1FAA A;  3VWW A;  4IW9 A;  4MF7 A;  3ERF A;  3GSS A;  2LJA A;  2IFQ A;  1FW1 A;  1M99 A;  1ERU A;  4PUA A;  2YN1 A;  5DVB A;  3M9K A;  2DIZ A;  4BWS A;  5J5N A;  4XS6 A;  2F3M A;  2HNL A;  4N30 A;  2X99 A;  5DAL B; 
#chains in the Genus database with same CATH topology
 3CMI A;  2K9F A;  3TUE A;  3RHB A;  4DSS B;  4PQH A;  3GL3 A;  2AAW A;  3D5J A;  1GTI A;  4EVM A;  2FA4 A;  2JZS A;  1EOG A;  3DKS A;  4V2M A;  5FHI A;  3GV1 A;  2O89 A;  2H0I A;  3GTU A;  4LMV A;  5IPH A;  1JLW A;  3IXR A;  1AQX A;  1ERW A;  3APQ A;  1LBK A;  1RW1 A;  1YKC A;  2LRC A;  3GFK A;  2DSA A;  3EU3 A;  2REM A;  3A2V A;  4OCF A;  1HQO A;  4NPB A;  3JCM L;  1OKT A;  4N3Z A;  2C0F A;  4Q5F A;  4KDU A;  2VCQ A;  4KDX A;  1ABA A;  4D73 B;  1GSS A;  1O7U A;  1Q98 A;  13GS A;  5IM9 A;  5DBQ A;  2R0P A;  1QK8 A;  1TI1 A;  1H4O A;  3TJK A;  2HZE A;  2UV8 G;  4J2F A;  2GZY A;  3A2X A;  4V2L A;  5A34 B;  5G31 A;  2R37 A;  3UBL A;  3WGX A;  2YWO A;  3KM6 A;  2GT5 A;  1GRX A;  4MJE A;  1K3O A;  1F37 A;  4WEY A;  3PGT A;  1JZD A;  1SJI A;  1FB6 A;  1TK8 B;  4JU5 A;  5DDL A;  3KP9 A;  1RK4 A;  2M46 A;  2EFD A;  3IE3 A;  5B6N A;  1SVL A;  3TKQ A;  5H5S A;  3VWU A;  2BMX A;  2WJU A;  4HUA A;  2IWT A;  2PPT A;  2LQQ A;  5INY A;  2ON5 A;  5CRD A;  1U6T A;  4G10 A;  2FWE A;  1XG8 A;  3BOA A;  2QA1 A;  1WPI A;  1OKD A;  4NHZ A;  3D22 A;  3FYG A;  4CW9 A;  2K8V A;  4K0N A;  2HFD A;  1DSB A;  4EIP A;  4ECI A;  6GSU A;  2OE0 A;  4GWR A;  2G2Q A;  1A0F A;  3TOT A;  2IN3 A;  4EDZ A;  1JFU A;  4OO5 A;  2LST A;  5KN2 A;  4G0K A;  1WE0 A;  3RHC A;  1SVO A;  4KSO A;  3WGE A;  2IMK A;  2C4J A;  2X64 A;  2E2M A;  3DYR A;  2OBI A;  1PRX A;  4F2I A;  4L5L A;  5IPG A;  1ZYN A;  1XBS A;  2FWF A;  3RDW A;  3MDK A;  1R5P A;  2OAC A;  4XHM A;  4TRX A;  2GLR A;  5EL8 A;  2JL4 A;  5BMU A;  2WZS A;  4XCS A;  1OYJ A;  4BL7 A;  3TDG A;  2OE1 A;  3R3E A;  1O6J A;  2YPM A;  4AJ7 A;  2LNT A;  3FMW A;  5DJM A;  14GS A;  3D4T A;  2C80 A;  3PIN A;  1A2L A;  3RFR C;  3IBH A;  3APS A;  2MMN A;  5IMC A;  4O92 A;  5J47 A;  4ECC A;  4PTS A;  5IMZ A;  4I2U A;  3CSH A;  1M9B A;  2FCH A;  2L4Q A;  2C3N A;  2OBK A;  1A0R P;  1WOU A;  5A4W A;  2G0F A;  2I1U A;  4AJ6 A;  4AI6 A;  1NHY A;  1XOB A;  5KOX A;  5DAL A;  2LQO A;  4O5Q A;  2CV4 A;  5AIS A;  3HJP A;  4DSS A;  2X8C A;  2HXK A;  2EFC A;  2GQK A;  1O81 A;  4PUF C;  5JCW A;  5A5K A;  1B48 A;  4PX1 A;  2MMA A;  4GXZ A;  1THX A;  1BYE A;  3HCZ A;  4FYC A;  3GIX A;  3EMP A;  1EEM A;  2B7K A;  2VD1 A;  3ZRE A;  4KUN A;  3HJO A;  5JCG A;  4YQV A;  3HHV A;  4ZIL A;  2CX3 A;  3U5R E;  2LJK A;  4BPY A;  2RM6 A;  2NBS A;  3LG6 A;  4GQF A;  1FOV A;  4QMK A;  4MF6 A;  4H86 A;  2M72 A;  1V2A A;  6GSS A;  3CSI A;  4XTS A;  1OC9 B;  2A2R A;  1T1V A;  3D21 A;  4WBJ A;  3KXO A;  5FWG A;  3GH6 A;  3DD3 A;  2EFE A;  2HSN B;  4X0X A;  1FB0 A;  3KTB A;  4Q5N A;  1YJ6 A;  3EIN A;  3RGB C;  2DJ2 A;  1EGR A;  4ISD A;  3SWL A;  4EC0 A;  3ZRD A;  2QKE A;  1PMT A;  3VFI A;  1XXU A;  2RII A;  3CSJ A;  1BG1 A;  1SL1 B;  1GLP A;  1EP8 A;  1T00 A;  4YQU A;  5G1L A;  1UC7 A;  3MWH A;  5H5Q A;  3GN3 A;  4OD7 A;  2VCW A;  3KJY A;  2VCZ A;  4RI6 A;  2RUF A;  4QQ7 A;  4OO4 A;  4EUY A;  2KP2 A;  4ZB6 A;  2CZ2 A;  3ZYW A;  4ML6 A;  3GUS A;  5CNW A;  5IMD A;  16GS A;  5ECQ B;  1FG4 A;  3VK9 A;  4NXI A;  3ZVJ A;  3MAK A;  4V1A g;  4Q5Q A;  5H5R A;  3ZML A;  4N10 A;  2J23 A;  4GRF A;  4XRA A;  4K5S A;  4I6X A;  2EC4 A;  4L8E A;  3DVW A;  5GAP D;  1NHO A;  3ERW A;  3KP8 A;  5KOW A;  3AY8 A;  4MF5 A;  4KAE A;  4K8M A;  2OA7 A;  1K0D A;  3CTF A;  2YAN A;  4BWQ A;  1G7O A;  2H1B A;  4TR3 A;  2A2S A;  2WW1 A;  1J9B A;  2HSM B;  4MMM A;  2LV3 A;  1OAZ A;  3DGQ A;  3W6G A;  1KEB A;  2CZ3 A;  4GF0 A;  3TKS E;  3F0I A;  1BX9 A;  1M3J A;  1BF5 A;  3IR4 A;  5KN3 A;  2DLX A;  2V41 A;  3KMN A;  2AB6 A;  4FYU A;  5HFG A;  2VL9 A;  3IOS A;  2PBJ A;  1GSQ A;  3FY7 A;  3D6I A;  2GSS A;  1R26 A;  4F82 A;  3GRX A;  4K7O A;  1KBN A;  2H6Z A;  5B6M A;  2C8U A;  1PN9 A;  1MD4 A;  2V1M A;  1B9X C;  2I3Y A;  4IEL A;  2KHP A;  4HJM A;  1TXX A;  4IJI A;  1EV9 A;  2F8A A;  1XOA A;  1WJK A;  8GSS A;  5HR2 A;  2OJL A;  1ZGN A;  2VAF A;  1O73 A;  4GSN A;  2HRN A;  1TRV A;  3F6F A;  4HU9 A;  3TRX A;  3ZFB A;  5IQY A;  2HE3 A;  2YWM A;  2H0H A;  2C0D A;  2RUE A;  2QSI A;  2DJ3 A;  4Z2T A;  3O3T A;  2CVD A;  1AQW A;  3GNJ A;  3TB2 A;  2HQT A;  4MDC A;  4ZBD A;  2FY6 A;  1ZCP A;  2H76 A;  3EU4 A;  4PXO A;  5F0G A;  2IMI A;  5HQP A;  1A24 A;  3EVI A;  5ECP B;  3FZA A;  1TJD A;  4XS4 B;  3Q74 A;  5GZZ B;  4LL4 B;  3HZ4 A;  4IJ3 A;  2VLV A;  2Z9S A;  5LNK e;  1M0U A;  1SKR B;  2PER A;  3P2A A;  3LXT A;  4ZXG A;  3LJR A;  2H6X A;  1GUK A;  5A4V A;  4FH8 A;  3NZN A;  3CHX C;  5G2Z A;  3UOM A;  2XBQ A;  3LEF A;  4WBR D;  2O87 A;  1GUM A;  1N2A A;  1KTE A;  2CVK A;  3FW2 A;  2KOK A;  1OC9 A;  3H8Q A;  4MH3 A;  1TRW A;  4O5U A;  4K2D A;  3H1N A;  4PNG A;  1XPV A;  4ACS A;  1GL8 A;  3QPM A;  3VUR A;  1YZX A;  4OFM A;  5JCU A;  4PQ1 A;  2HSN A;  1ERT A;  5A5H B;  3F8U A;  2NDO A;  3TJG A;  3GST A;  1DUG A;  1U3I A;  5IOW A;  1UA5 A;  2FNO A;  4DSQ A;  1U87 A;  1T3B A;  1G6W A;  1HD2 A;  4Z7X A;  3QR6 A;  4WR5 A;  2GZP A;  2XHF A;  2WVX A;  2F51 A;  3FHK A;  5B8B A;  2VKZ G;  2PGT A;  3TKS C;  4NHW A;  3L9V A;  1M7T A;  5HFI A;  2ON7 A;  22GS A;  2WVY A;  3I6A A;  2DJK A;  4O5R A;  1AIU A;  1K3Y A;  1BG5 A;  1F3B A;  4TR1 B;  4WR4 A;  1NSW A;  2P5Q A;  3K8N A;  4TR0 A;  2LJR A;  1GSD A;  1EOH A;  2CAI A;  3C1S A;  4X43 A;  2H6Y A;  4WXT A;  1GTB A;  2JSY A;  3KH7 A;  1GSU A;  1GSY A;  3G7Y A;  4X1U A;  4JR6 A;  5D73 A;  3GL5 A;  3HZ8 A;  4NMU A;  3Q19 A;  2L6C A;  1T7P B;  1X9M B;  1PD2 1;  3TU3 B;  5IIZ A;  1DBY A;  2NTO A;  2VL2 C;  3RPN A;  2FHE A;  4CDO A;  2H0G A;  5CYY A;  2HRA A;  3GA4 A;  5G30 A;  1VF4 A;  6GSX A;  1FOH A;  4ZIJ A;  2H1D A;  3TJB A;  1K3L A;  1SYX A;  2HSH A;  4ID0 A;  4IS0 A;  1GTU A;  4GLT A;  3L9S A;  4K5R A;  4P3Y B;  3GYK A;  2RM5 A;  3MYD A;  2H72 A;  1F3A A;  2O85 A;  2RLI A;  2OE3 A;  3EYT A;  4HU7 A;  2N5F A;  1FVJ A;  3KCM A;  1OE8 A;  5J9C A;  5DJL A;  3TJF A;  5ECL B;  1PL2 A;  4G01 A;  4BVY A;  3LOR A;  2CX4 A;  1PL1 A;  3FZ4 A;  2VUP A;  3HMJ G;  4MCU A;  1GSF A;  3O76 A;  3TRP A;  5ELA A;  4WKW A;  1HNA A;  3HY2 A;  1MTC A;  2O7K A;  1QFN A;  2WCI A;  4TOP A;  5CRW A;  1M2D A;  1YF0 A;  4MJB A;  1B4Q A;  4QL9 A;  4L5O A;  3KD0 A;  1XWK A;  1JLV A;  5CO3 A;  4NWY A;  1XZO A;  3QFA C;  4DSR A;  2VO4 A;  3FR6 A;  4XRD A;  2FA8 A;  1T4Y A;  4O7H A;  1OC8 A;  3IA1 A;  2R4V A;  2B6M A;  4ZBA A;  4NV2 A;  1MEK A;  3R2Q A;  1THO A;  4IN0 A;  4I2T A;  6GSV A;  1K0C A;  4HOJ A;  3A3T A;  5ELG A;  3UMA A;  4IHU A;  4XS4 A;  3VWV A;  2DML A;  4AKI A;  1ZYE A;  3G9B A;  4RQX A;  4AKG A;  4FO5 A;  3CXG A;  3CWG A;  3ZLP A;  3EWL A;  2AUV A;  2B3S A;  1VGL A;  1IYI A;  3I69 A;  2B1L A;  1Z5Y E;  1Z6M A;  1V98 A;  5IO0 A;  2CA8 A;  1X5C A;  1DE1 A;  3EUR A;  4MZB A;  2HRF A;  2HRK B;  2QC7 A;  2VCT A;  5A1N B;  3IHQ A;  3WD6 A;  3APO A;  4AF2 A;  3ZIJ A;  4WF5 A;  3LFL A;  3LYP A;  5B8A A;  2VCV A;  2HLS A;  5DAK A;  2GSQ A;  1XWC A;  5D9T A;  3VWX A;  3BJ5 A;  4IKH A;  3S9F A;  1ILO A;  2J9H A;  5HR3 A;  2GS3 A;  2YCD A;  1NW2 A;  1U3A A;  5F06 A;  4K0G A;  4BIK A;  1XIY A;  4TR1 A;  4KE3 A;  2O5V A;  1SJZ A;  4OFT A;  3WT1 A;  3CQF A;  2HYX A;  1SEN A;  3DVX A;  1Z7R A;  4HQZ A;  3QAV A;  3LWA A;  1A8L A;  1H75 A;  2B5X A;  3DRN A;  1F2E A;  2V6K A;  5LCZ A;  3CRU A;  2GQM A;  4MPG A;  2LUS A;  4IVF A;  6GST A;  4MPF A;  3TJJ A;  1F9M A;  3E0U A;  4TR4 A;  4ZB7 A;  5G5E A;  3F9U A;  2H71 A;  2B1K A;  3G7J A;  4KB3 A;  3GKM A;  4J56 E;  5A4U A;  5ENU A;  2YOI A;  2L57 A;  2WW3 A;  3EE2 A;  1EEJ A;  5J4Y A;  2PN8 A;  3PR8 A;  4TVE A;  1FVK A;  5DQY A;  2P5R A;  3DXB A;  1LJR A;  1B9Y C;  5GAN D;  2WFC A;  4TN8 A;  2X8G A;  4POK A;  4AGS A;  2A4V A;  3ZZX A;  4X4J A;  4E8E A;  1XW5 A;  1O8X A;  2B5Y A;  1SK0 A;  2H8L A;  4ZBB A;  1A2J A;  1WIK A;  2JAC A;  2WDU A;  2I4A A;  4D73 A;  3VLN A;  3M3M A;  3PH9 A;  3UAR A;  5CRE A;  1VF2 A;  2IL3 A;  1SKW B;  4EO3 A;  3P90 A;  2WZ9 A;  1GSE A;  4Z2R A;  5A34 A;  2HSY A;  4JBB A;  1CQH A;  2PVO C;  4ZL9 A;  5C04 A;  3V1W A;  2YNX A;  3TGZ A;  3E3E A;  2A2P A;  3GH9 A;  4TXO B;  4MK3 A;  1GH2 A;  2JZT A;  2R0G A;  3M0F A;  4N11 A;  4K7N A;  3O6T A;  2N5A A;  1SD8 A;  1W89 A;  3M9J A;  4I5Q A;  4F0C A;  7GSS A;  1XVQ A;  3P7X A;  2DJ0 A;  1TOF A;  4MNN A;  5AN1 A;  1XWA A;  1V57 A;  3BBY A;  5J40 A;  4ILF A;  1YF1 A;  1Z9H A;  2VM2 A;  4XIH A;  3CBU A;  5ECI B;  2H70 A;  4POL A;  2GST A;  2YV7 A;  3M1G A;  2AV4 A;  1JZW A;  1YVL A;  1YDK A;  1K0A A;  4OWY A;  2VIM A;  2C1Y A;  1E2Y A;  9GSS A;  2HRK A;  2DBC A;  2GQL A;  1C72 A;  4MH2 A;  4O32 A;  4MJA A;  4F0B A;  4PI2 C;  2MYG A;  2IMF A;  1DE2 A;  1I1I P;  1SKS B;  1BED A;  2NPB A;  4BA7 A;  4MA9 A;  2EIQ A;  1R4W A;  3P8W A;  3C73 A;  1M2A A;  4EL1 A;  3QAW A;  3L78 A;  3ED3 A;  3LW9 A;  5HFK A;  2C3Q A;  3QFB C;  4HS1 A;  2KP1 A;  2TRX A;  1GNE A;  1I9D A;  2V32 A;  1FO5 A;  1Z6N A;  5DCG A;  1A23 A;  4EXJ A;  2N5B A;  3HA9 A;  1GWC A;  3Q6O A;  1M2B A;  2YZU A;  1HNC A;  4GST A;  1JZO A;  1W4V A;  5ECR B;  2DKH A;  4GDF A;  1TTZ A;  3FR3 A;  1PX6 A;  1XWB A;  10GS A;  2UZ8 A;  4GQC A;  3UIW A;  1Y25 A;  4G0I A;  1R5A A;  4EDY A;  1TRS A;  2GT6 A;  1X5D A;  5FT3 A;  2HZE B;  4G2E A;  2IMD A;  1ZYP A;  1BJX A;  1B4P A;  3MIX A;  2QA2 A;  3KTL A;  2HI7 A;  3ZVJ D;  2I9H A;  4IGJ A;  3A5W A;  3GX8 A;  3FEU A;  1GNW A;  5D8I A;  2LRN A;  2AHE A;  4J57 E;  2R6K A;  2XPE A;  1LU4 A;  1ACV A;  3IV4 A;  4LA1 A;  2B7J A;  4YAV A;  1VRS D;  4G9H A;  2CT6 A;  1AC1 A;  4TXV A;  2GZZ A;  3MNG A;  1TRU A;  1K0O A;  3UVT A;  3UBK A;  3L0H A;  2YWI A;  4ZL8 A;  1ON4 A;  2WS2 A;  6GSW A;  3GKX A;  2C0G A;  4FYB A;  1PA3 A;  2H1G A;  1SVM A;  5DQS A;  1PQN A;  2H1A A;  5EY6 A;  2R3X A;  3LYK A;  1TU8 A;  3EC3 A;  3FKF A;  1X5E A;  1K0N A;  1OVN A;  3RAZ A;  4V2N A;  2PMT A;  4POM A;  2WRT A;  4POB A;  1V58 A;  5B7C A;  4CY6 A;  2H01 A;  4E8H A;  1X9S B;  4FIW A;  1XWG A;  5BMU B;  3QOU A;  4KND A;  1SL0 B;  2BTO T;  2WB9 A;  2ZNM A;  1TDI A;  3L4N A;  3I9V 2;  2MZC A;  3VI7 A;  1TKD B;  1M3I A;  1AW9 A;  4E68 A;  3W8S A;  2TRC P;  4LLR A;  4LMW A;  3KZQ A;  2YZH A;  3ZTL A;  5F07 A;  4ICY A;  4HI7 A;  1S3A A;  1MD3 A;  3HXS A;  4N0V A;  2VL2 A;  2WUL A;  3FRC A;  3WGD A;  1PX7 A;  4MZC A;  1K0B A;  3F4S A;  3QCP A;  3FR9 A;  1JZR A;  2LRT A;  1GLQ A;  3TOU A;  2NVL A;  3LQ7 A;  3WYW A;  2F9S A;  1QXH A;  2DJ1 A;  2FWH A;  4JR4 A;  2LEG A;  20GS A;  3VPQ A;  3I43 A;  1O8W A;  2C0E A;  3IAS 2;  3E9J B;  3CYN A;  2HSM A;  3LXZ A;  1M9A A;  4G19 A;  4OMV A;  4IP6 A;  5COH A;  3EPT A;  4JZQ A;  1X9W B;  4YKG A;  2L5O A;  4ULX A;  4MZW A;  5AIV A;  3OR5 A;  2H19 A;  1SU9 A;  3PPU A;  1BQ7 A;  4G0L A;  3MSZ A;  1Y6E A;  1GTA A;  4QL7 A;  2C3T A;  1XFL A;  4K6X A;  1XW9 A;  2H1L A;  2XBI A;  1USB A;  3EMX A;  5IMA A;  5IOX A;  3GUR A;  4K1F A;  5D9W A;  1SK1 A;  1Y1U A;  1YKA A;  1PFO A;  2VLT A;  4MAB A;  1YEP A;  3BCI A;  3HVS A;  3F6D A;  3QD9 A;  2O3E A;  5AIX A;  5IMV A;  1SD9 A;  4IQ1 A;  3GX0 A;  2L4C A;  4PNF A;  4BVX B;  3U6V A;  5J3R A;  5HR1 A;  2GSR A;  2H74 A;  3QMX A;  2BJX A;  2LKU A;  1S3C A;  12GS A;  3G7I A;  3ISO A;  4KCA A;  3RPP A;  2I81 A;  3VPT A;  4MLY A;  2DC5 A;  1ZMA A;  4F03 A;  2XPD A;  2WVZ A;  3KIJ A;  1PN0 A;  4TKY A;  5CRG A;  3CTG A;  2M80 A;  2TIR A;  2GGT A;  2CVB A;  4AJ8 A;  4K2X A;  4PGT A;  2R2J A;  2LTK A;  3IRA A;  4ZB9 A;  4DVC A;  2JSZ A;  3GKN A;  2PVQ A;  3FZ9 A;  3HVX A;  4V1A p;  4LL1 B;  4HEA 2;  1V40 A;  3IK7 A;  3HKR A;  5KEJ A;  2H75 A;  3J7Y k;  5A5H A;  1UVZ A;  1WRY A;  4ZL7 A;  5HR0 A;  2OKA A;  11GS A;  3DML A;  4RI7 A;  4RUV A;  4K7I A;  1S3R A;  2YJH A;  2DMM A;  1F6M C;  3IAM 2;  4PI0 C;  2XC2 A;  1TK0 B;  4N0Z A;  3UAP A;  1I5G A;  5G5F A;  2JZR A;  5DCH A;  4AKX B;  3HVV A;  1EZK A;  1N8J A;  2ZCT A;  3ZIV A;  1AXD A;  2OAD A;  2ALB A;  2HT9 A;  2MMZ A;  5D93 A;  4Q5R A;  1EGO A;  2YV9 A;  2GDR A;  5ECS A;  5CP1 A;  2QGV A;  2A4H A;  3HD5 A;  1SYR A;  1NM3 A;  3L9U A;  2V6O A;  1GUH A;  3Q18 A;  2MBT A;  1KNG A;  4KDY A;  3GHA A;  3KEB A;  1XCC A;  4I8B A;  5ID2 B;  4FQU A;  1WMJ A;  2B5E A;  1PKW A;  3NIV A;  1HYU A;  1BAY A;  2YJ7 A;  3TCO A;  3ZL5 A;  2KUC A;  1IYH A;  5J4U A;  5L71 A;  1JHB A;  1YEW C;  2KLX A;  2VLU A;  2D2Z A;  5EPF A;  1XW6 A;  2P0G A;  1WWJ A;  2PUK C;  1MDJ A;  3UVH A;  1QQ2 A;  3C8E A;  1PGT A;  5LD0 A;  2VOC A;  4MP4 A;  1O85 A;  1OC3 A;  3C1R A;  4PQI A;  4AKH A;  5KN1 A;  3N9J A;  1VF1 A;  4WET A;  3GKK A;  5JWR B;  3HDC A;  1HNB A;  3N5O A;  1ZZY A;  4ZB8 A;  2EIR A;  4K9Z A;  2L5L A;  2X49 A;  2E2G A;  2LS5 A;  5F05 A;  1ML6 A;  5J4V A;  5E59 A;  19GS A;  1EWX A;  2H66 A;  3LSZ A;  1QGV A;  3ME8 A;  2E7P A;  3IC4 A;  4HZ4 A;  3F4R A;  2VCX A;  1UN2 A;  1GP1 A;  1EP7 A;  1QMV A;  1U88 A;  4HSC X;  2FUG 2;  1WP0 A;  1QUW A;  2WGR A;  3ZFL A;  1T4Z A;  1Z3E A;  5D96 A;  1URM A;  4BVX A;  4KX4 A;  2ZUP A;  3DWV A;  1J0F A;  2WVX B;  4KF9 A;  4I97 A;  4Z2U A;  1V9W A;  5G1K A;  2MMO A;  4CY8 A;  2DJJ A;  4F9Z A;  1G0T A;  4YKF A;  4KA0 A;  2JU5 A;  1AQV A;  3UJ1 A;  1OE7 A;  3D4M A;  3TRQ A;  3A5I A;  5CRH A;  4EIQ A;  1ZL9 A;  2YP6 A;  2GVP A;  4IP1 A;  3ME7 A;  4A5P A;  2O8V B;  5A1N A;  3H79 A;  2IFQ B;  4NV5 A;  2R5G A;  3GMF A;  2WW2 A;  1XVW A;  1TXU A;  1SL2 B;  4XS1 A;  4L0W A;  5D9V A;  1ERV A;  4PHZ C;  2FD3 A;  4EKZ A;  3SBC A;  2FLS A;  4HDE A;  1ZYQ B;  2FGX A;  3FK8 A;  3C7M A;  3H93 A;  4KCE A;  3H4K A;  1GUL A;  1VF3 A;  1SK2 A;  4CHS A;  5GSS A;  5EVO A;  2X8H A;  5F8B A;  2AYT A;  3GTU B;  1Z7P A;  3DIE A;  1SJ6 A;  2EFH A;  4IBP A;  3IHG A;  5GST A;  3NOF A;  4HJ2 A;  2FWG A;  1CQG A;  5J41 A;  1AAZ A;  5ECH B;  1RQM A;  4USS A;  4W66 A;  2YWN A;  1EV4 A;  3RBT A;  2V2G A;  3BCK A;  3UL3 A;  2R0C A;  2ES7 A;  2DIY A;  2K18 A;  3C71 A;  3F3Q A;  2VL3 A;  4JRR A;  2WW0 A;  2PU9 C;  5JWQ B;  4BVY B;  2P31 A;  3HVN A;  3TKR A;  2HZF A;  3QAG A;  18GS A;  5ID2 A;  2L59 A;  1R7H A;  4OCE A;  3CRT A;  3D0Z A;  3HYP A;  2IJY A;  4L0U A;  3IDV A;  5J9B A;  4GSS A;  2DKI A;  3WT2 A;  5CAX A;  4HZ2 A;  1A8Y A;  4GTU A;  5ECK B;  5ECM B;  4ECB A;  2IPA A;  3W8J A;  1E6B A;  1YY7 A;  3ZMK A;  3IPZ A;  4MJC A;  4TW5 A;  4YH2 A;  5IO2 A;  1K0M A;  2K8S A;  5C00 A;  1B8X A;  3M8N A;  3IK9 A;  1N25 A;  2IME A;  2O36 A;  4EE0 A;  4KSM A;  1J08 A;  2IIY A;  1YQ1 A;  2PWJ A;  1S4B P;  4ML1 A;  4RQR A;  4KH7 A;  4KW6 A;  5KN0 A;  3LGC A;  3F4T A;  2CQ9 A;  3UEM A;  3A2W A;  3KGK A;  4KGI A;  3QDN A;  1FHE A;  1PKZ A;  3US3 A;  3KMO A;  4GCI A;  4JED A;  2X4A A;  2AJQ B;  3J7Y b;  1Q4J A;  5IMF A;  2L6D A;  3KH9 A;  3HJM A;  17GS A;  2F8F A;  4DEJ A;  1X0R A;  5ECO B;  5JWO B;  3ERG A;  3DEX A;  4YAP A;  4WF4 A;  1TP9 A;  4JE1 A;  2CAQ A;  3IC8 A;  2K6V A;  3VI5 A;  1MDI A;  1YEX A;  3F3R A;  5ABR A;  1G6Y A;  1TK5 B;  6GSY A;  4TXO A;  4IQA A;  3TKS A;  3ZIT A;  3FZ5 A;  2H73 A;  2H30 A;  2MBS A;  5E4W A;  1PSQ A;  1ZOF A;  4PUR A;  5DAK B;  5BRT A;  4HQS A;  1TU7 A;  2GTU A;  4BL7 B;  2VD0 A;  5ECN B;  1T8E B;  1MDK A;  1TW9 A;  1S3D A;  2OT3 A;  1TI3 A;  5D9X A;  2E0Q A;  2LNS A;  3F63 A;  2EIO A;  1A2M A;  2JAD A;  1ST9 A;  3TKP A;  3BD2 A;  2VM1 A;  1AUC A;  5AGY A;  4NAX A;  4OFN A;  4EF0 A;  4FXY P;  4YQM A;  1G7E A;  4ECJ A;  1FAA A;  3VWW A;  4IW9 A;  4MF7 A;  3ERF A;  3GSS A;  2LJA A;  2IFQ A;  1FW1 A;  1M99 A;  1ERU A;  4PUA A;  2YN1 A;  5DVB A;  3M9K A;  2DIZ A;  4BWS A;  5J5N A;  4XS6 A;  2F3M A;  2HNL A;  4N30 A;  2X99 A;  5DAL B; 
#chains in the Genus database with same CATH homology
 3CMI A;  2K9F A;  3TUE A;  3RHB A;  4DSS B;  4PQH A;  3GL3 A;  2AAW A;  3D5J A;  1GTI A;  4EVM A;  2FA4 A;  2JZS A;  1EOG A;  3DKS A;  4V2M A;  5FHI A;  3GV1 A;  2O89 A;  2H0I A;  3GTU A;  4LMV A;  5IPH A;  1JLW A;  3IXR A;  1AQX A;  1ERW A;  3APQ A;  1LBK A;  1RW1 A;  1YKC A;  2LRC A;  3GFK A;  2DSA A;  3EU3 A;  2REM A;  3A2V A;  4OCF A;  1HQO A;  4NPB A;  3JCM L;  1OKT A;  4N3Z A;  2C0F A;  4Q5F A;  4KDU A;  2VCQ A;  4KDX A;  1ABA A;  4D73 B;  1GSS A;  1O7U A;  1Q98 A;  13GS A;  5IM9 A;  5DBQ A;  2R0P A;  1QK8 A;  1TI1 A;  1H4O A;  3TJK A;  2HZE A;  2UV8 G;  4J2F A;  2GZY A;  3A2X A;  4V2L A;  5A34 B;  5G31 A;  2R37 A;  3UBL A;  3WGX A;  2YWO A;  3KM6 A;  2GT5 A;  1GRX A;  4MJE A;  1K3O A;  1F37 A;  4WEY A;  3PGT A;  1JZD A;  1SJI A;  1FB6 A;  1TK8 B;  4JU5 A;  5DDL A;  3KP9 A;  1RK4 A;  2M46 A;  2EFD A;  3IE3 A;  5B6N A;  1SVL A;  3TKQ A;  5H5S A;  3VWU A;  2BMX A;  2WJU A;  4HUA A;  2IWT A;  2PPT A;  2LQQ A;  5INY A;  2ON5 A;  5CRD A;  1U6T A;  4G10 A;  2FWE A;  3BOA A;  2QA1 A;  1WPI A;  1OKD A;  4NHZ A;  3D22 A;  3FYG A;  4CW9 A;  2K8V A;  4K0N A;  2HFD A;  1DSB A;  4EIP A;  4ECI A;  6GSU A;  2OE0 A;  4GWR A;  2G2Q A;  1A0F A;  3TOT A;  2IN3 A;  4EDZ A;  1JFU A;  4OO5 A;  2LST A;  5KN2 A;  4G0K A;  1WE0 A;  3RHC A;  1SVO A;  4KSO A;  3WGE A;  2IMK A;  2C4J A;  2X64 A;  2E2M A;  3DYR A;  2OBI A;  1PRX A;  4F2I A;  4L5L A;  5IPG A;  1ZYN A;  1XBS A;  2FWF A;  3RDW A;  3MDK A;  1R5P A;  2OAC A;  4XHM A;  4TRX A;  2GLR A;  5EL8 A;  2JL4 A;  5BMU A;  4XCS A;  1OYJ A;  4BL7 A;  3TDG A;  2OE1 A;  3R3E A;  1O6J A;  2YPM A;  4AJ7 A;  2LNT A;  3FMW A;  5DJM A;  14GS A;  3D4T A;  2C80 A;  3PIN A;  1A2L A;  3IBH A;  3APS A;  2MMN A;  5IMC A;  4O92 A;  5J47 A;  4ECC A;  4PTS A;  5IMZ A;  4I2U A;  3CSH A;  1M9B A;  2FCH A;  2L4Q A;  2C3N A;  2OBK A;  1A0R P;  1WOU A;  5A4W A;  2G0F A;  2I1U A;  4AJ6 A;  4AI6 A;  1NHY A;  1XOB A;  5KOX A;  5DAL A;  2LQO A;  4O5Q A;  2CV4 A;  5AIS A;  3HJP A;  4DSS A;  2X8C A;  2HXK A;  2EFC A;  2GQK A;  1O81 A;  4PUF C;  5JCW A;  5A5K A;  1B48 A;  4PX1 A;  2MMA A;  4GXZ A;  1THX A;  1BYE A;  3HCZ A;  4FYC A;  3GIX A;  3EMP A;  1EEM A;  2B7K A;  2VD1 A;  3ZRE A;  4KUN A;  3HJO A;  5JCG A;  4YQV A;  3HHV A;  4ZIL A;  2CX3 A;  3U5R E;  2LJK A;  4BPY A;  2RM6 A;  2NBS A;  3LG6 A;  4GQF A;  1FOV A;  4QMK A;  4MF6 A;  4H86 A;  2M72 A;  1V2A A;  6GSS A;  3CSI A;  4XTS A;  1OC9 B;  2A2R A;  1T1V A;  3D21 A;  4WBJ A;  3KXO A;  5FWG A;  3GH6 A;  3DD3 A;  2EFE A;  2HSN B;  4X0X A;  1FB0 A;  3KTB A;  4Q5N A;  1YJ6 A;  3EIN A;  2DJ2 A;  1EGR A;  4ISD A;  3SWL A;  4EC0 A;  3ZRD A;  2QKE A;  1PMT A;  3VFI A;  1XXU A;  2RII A;  3CSJ A;  1BG1 A;  1SL1 B;  1GLP A;  1EP8 A;  1T00 A;  4YQU A;  5G1L A;  1UC7 A;  3MWH A;  5H5Q A;  3GN3 A;  4OD7 A;  2VCW A;  3KJY A;  2VCZ A;  4RI6 A;  2RUF A;  4QQ7 A;  4OO4 A;  4EUY A;  2KP2 A;  4ZB6 A;  2CZ2 A;  3ZYW A;  4ML6 A;  3GUS A;  5CNW A;  5IMD A;  16GS A;  5ECQ B;  1FG4 A;  3VK9 A;  4NXI A;  3ZVJ A;  3MAK A;  4V1A g;  4Q5Q A;  5H5R A;  3ZML A;  4N10 A;  2J23 A;  4GRF A;  4XRA A;  4K5S A;  4I6X A;  2EC4 A;  4L8E A;  3DVW A;  5GAP D;  1NHO A;  3ERW A;  3KP8 A;  5KOW A;  3AY8 A;  4MF5 A;  4KAE A;  4K8M A;  2OA7 A;  1K0D A;  3CTF A;  2YAN A;  4BWQ A;  1G7O A;  2H1B A;  4TR3 A;  2A2S A;  1J9B A;  2HSM B;  4MMM A;  2LV3 A;  1OAZ A;  3DGQ A;  3W6G A;  1KEB A;  2CZ3 A;  4GF0 A;  3TKS E;  3F0I A;  1BX9 A;  1BF5 A;  3IR4 A;  5KN3 A;  2DLX A;  2V41 A;  3KMN A;  2AB6 A;  4FYU A;  5HFG A;  2VL9 A;  3IOS A;  2PBJ A;  1GSQ A;  3FY7 A;  3D6I A;  2GSS A;  1R26 A;  4F82 A;  3GRX A;  4K7O A;  1KBN A;  2H6Z A;  5B6M A;  2C8U A;  1PN9 A;  1MD4 A;  2V1M A;  1B9X C;  2I3Y A;  4IEL A;  2KHP A;  4HJM A;  1TXX A;  4IJI A;  1EV9 A;  2F8A A;  1XOA A;  1WJK A;  8GSS A;  5HR2 A;  2OJL A;  1ZGN A;  2VAF A;  1O73 A;  4GSN A;  2HRN A;  1TRV A;  3F6F A;  4HU9 A;  3TRX A;  3ZFB A;  5IQY A;  2HE3 A;  2YWM A;  2H0H A;  2C0D A;  2RUE A;  2QSI A;  2DJ3 A;  4Z2T A;  3O3T A;  2CVD A;  1AQW A;  3GNJ A;  3TB2 A;  2HQT A;  4MDC A;  4ZBD A;  2FY6 A;  1ZCP A;  2H76 A;  3EU4 A;  4PXO A;  5F0G A;  2IMI A;  5HQP A;  1A24 A;  3EVI A;  5ECP B;  3FZA A;  1TJD A;  4XS4 B;  3Q74 A;  5GZZ B;  4LL4 B;  3HZ4 A;  4IJ3 A;  2VLV A;  2Z9S A;  5LNK e;  1M0U A;  1SKR B;  2PER A;  3P2A A;  3LXT A;  4ZXG A;  3LJR A;  2H6X A;  1GUK A;  5A4V A;  4FH8 A;  3NZN A;  5G2Z A;  3UOM A;  2XBQ A;  3LEF A;  4WBR D;  2O87 A;  1GUM A;  1N2A A;  1KTE A;  2CVK A;  3FW2 A;  2KOK A;  1OC9 A;  3H8Q A;  4MH3 A;  1TRW A;  4O5U A;  4K2D A;  3H1N A;  4PNG A;  1XPV A;  4ACS A;  1GL8 A;  3QPM A;  3VUR A;  1YZX A;  4OFM A;  5JCU A;  4PQ1 A;  2HSN A;  1ERT A;  5A5H B;  3F8U A;  2NDO A;  3TJG A;  3GST A;  1DUG A;  1U3I A;  5IOW A;  1UA5 A;  2FNO A;  4DSQ A;  1U87 A;  1T3B A;  1G6W A;  1HD2 A;  4Z7X A;  3QR6 A;  4WR5 A;  2GZP A;  2XHF A;  2F51 A;  3FHK A;  5B8B A;  2VKZ G;  2PGT A;  3TKS C;  4NHW A;  3L9V A;  1M7T A;  5HFI A;  2ON7 A;  22GS A;  3I6A A;  2DJK A;  4O5R A;  1AIU A;  1K3Y A;  1BG5 A;  1F3B A;  4TR1 B;  4WR4 A;  1NSW A;  2P5Q A;  3K8N A;  4TR0 A;  2LJR A;  1GSD A;  1EOH A;  2CAI A;  3C1S A;  4X43 A;  2H6Y A;  4WXT A;  1GTB A;  2JSY A;  3KH7 A;  1GSU A;  1GSY A;  3G7Y A;  4X1U A;  4JR6 A;  5D73 A;  3GL5 A;  3HZ8 A;  4NMU A;  3Q19 A;  2L6C A;  1T7P B;  1X9M B;  1PD2 1;  3TU3 B;  5IIZ A;  1DBY A;  2NTO A;  2VL2 C;  3RPN A;  2FHE A;  4CDO A;  2H0G A;  5CYY A;  2HRA A;  3GA4 A;  5G30 A;  1VF4 A;  6GSX A;  1FOH A;  4ZIJ A;  2H1D A;  3TJB A;  1K3L A;  1SYX A;  2HSH A;  4ID0 A;  4IS0 A;  1GTU A;  4GLT A;  3L9S A;  4K5R A;  4P3Y B;  3GYK A;  2RM5 A;  3MYD A;  2H72 A;  1F3A A;  2O85 A;  2RLI A;  2OE3 A;  3EYT A;  4HU7 A;  2N5F A;  1FVJ A;  3KCM A;  1OE8 A;  5J9C A;  5DJL A;  3TJF A;  5ECL B;  1PL2 A;  4G01 A;  4BVY A;  3LOR A;  2CX4 A;  1PL1 A;  3FZ4 A;  2VUP A;  3HMJ G;  4MCU A;  1GSF A;  3O76 A;  3TRP A;  5ELA A;  4WKW A;  1HNA A;  3HY2 A;  1MTC A;  2O7K A;  1QFN A;  2WCI A;  4TOP A;  5CRW A;  1M2D A;  1YF0 A;  4MJB A;  1B4Q A;  4QL9 A;  4L5O A;  3KD0 A;  1XWK A;  1JLV A;  5CO3 A;  4NWY A;  1XZO A;  3QFA C;  4DSR A;  2VO4 A;  3FR6 A;  4XRD A;  2FA8 A;  1T4Y A;  4O7H A;  1OC8 A;  3IA1 A;  2R4V A;  2B6M A;  4ZBA A;  4NV2 A;  1MEK A;  3R2Q A;  1THO A;  4IN0 A;  4I2T A;  6GSV A;  1K0C A;  4HOJ A;  3A3T A;  5ELG A;  3UMA A;  4IHU A;  4XS4 A;  3VWV A;  2DML A;  4AKI A;  1ZYE A;  3G9B A;  4RQX A;  4AKG A;  4FO5 A;  3CXG A;  3CWG A;  3ZLP A;  3EWL A;  2AUV A;  2B3S A;  1VGL A;  1IYI A;  3I69 A;  2B1L A;  1Z5Y E;  1Z6M A;  1V98 A;  5IO0 A;  2CA8 A;  1X5C A;  1DE1 A;  3EUR A;  4MZB A;  2HRF A;  2HRK B;  2QC7 A;  2VCT A;  5A1N B;  3IHQ A;  3WD6 A;  3APO A;  4AF2 A;  3ZIJ A;  4WF5 A;  3LFL A;  3LYP A;  5B8A A;  2VCV A;  2HLS A;  5DAK A;  2GSQ A;  1XWC A;  5D9T A;  3VWX A;  3BJ5 A;  4IKH A;  3S9F A;  1ILO A;  2J9H A;  5HR3 A;  2GS3 A;  2YCD A;  1NW2 A;  1U3A A;  5F06 A;  4K0G A;  1XIY A;  4TR1 A;  4KE3 A;  2O5V A;  1SJZ A;  4OFT A;  3WT1 A;  2HYX A;  1SEN A;  3DVX A;  1Z7R A;  4HQZ A;  3QAV A;  3LWA A;  1A8L A;  1H75 A;  2B5X A;  3DRN A;  1F2E A;  2V6K A;  5LCZ A;  3CRU A;  2GQM A;  4MPG A;  2LUS A;  4IVF A;  6GST A;  4MPF A;  3TJJ A;  1F9M A;  3E0U A;  4TR4 A;  4ZB7 A;  5G5E A;  3F9U A;  2H71 A;  2B1K A;  3G7J A;  4KB3 A;  3GKM A;  4J56 E;  5A4U A;  5ENU A;  2YOI A;  2L57 A;  3EE2 A;  1EEJ A;  5J4Y A;  2PN8 A;  3PR8 A;  4TVE A;  1FVK A;  5DQY A;  2P5R A;  3DXB A;  1LJR A;  1B9Y C;  5GAN D;  2WFC A;  4TN8 A;  2X8G A;  4POK A;  4AGS A;  2A4V A;  3ZZX A;  4X4J A;  4E8E A;  1XW5 A;  1O8X A;  2B5Y A;  1SK0 A;  2H8L A;  4ZBB A;  1A2J A;  1WIK A;  2JAC A;  2WDU A;  2I4A A;  4D73 A;  3VLN A;  3M3M A;  3PH9 A;  3UAR A;  5CRE A;  1VF2 A;  2IL3 A;  1SKW B;  4EO3 A;  3P90 A;  2WZ9 A;  1GSE A;  4Z2R A;  5A34 A;  2HSY A;  4JBB A;  1CQH A;  2PVO C;  4ZL9 A;  5C04 A;  3V1W A;  2YNX A;  3TGZ A;  3E3E A;  2A2P A;  3GH9 A;  4TXO B;  4MK3 A;  1GH2 A;  2JZT A;  2R0G A;  3M0F A;  4N11 A;  4K7N A;  3O6T A;  2N5A A;  1SD8 A;  1W89 A;  3M9J A;  4I5Q A;  4F0C A;  7GSS A;  1XVQ A;  3P7X A;  2DJ0 A;  1TOF A;  4MNN A;  5AN1 A;  1XWA A;  1V57 A;  3BBY A;  5J40 A;  4ILF A;  1YF1 A;  1Z9H A;  2VM2 A;  4XIH A;  3CBU A;  5ECI B;  2H70 A;  4POL A;  2GST A;  2YV7 A;  3M1G A;  2AV4 A;  1JZW A;  1YVL A;  1YDK A;  1K0A A;  4OWY A;  2VIM A;  2C1Y A;  1E2Y A;  9GSS A;  2HRK A;  2DBC A;  2GQL A;  1C72 A;  4MH2 A;  4O32 A;  4MJA A;  4F0B A;  2MYG A;  2IMF A;  1DE2 A;  1SKS B;  1BED A;  2NPB A;  4BA7 A;  4MA9 A;  2EIQ A;  1R4W A;  3P8W A;  3C73 A;  1M2A A;  4EL1 A;  3QAW A;  3L78 A;  3ED3 A;  3LW9 A;  5HFK A;  2C3Q A;  3QFB C;  4HS1 A;  2KP1 A;  2TRX A;  1GNE A;  1I9D A;  2V32 A;  1FO5 A;  1Z6N A;  5DCG A;  1A23 A;  4EXJ A;  2N5B A;  3HA9 A;  1GWC A;  3Q6O A;  1M2B A;  2YZU A;  1HNC A;  4GST A;  1JZO A;  1W4V A;  5ECR B;  2DKH A;  4GDF A;  1TTZ A;  3FR3 A;  1PX6 A;  1XWB A;  10GS A;  2UZ8 A;  4GQC A;  3UIW A;  1Y25 A;  4G0I A;  1R5A A;  4EDY A;  1TRS A;  2GT6 A;  1X5D A;  5FT3 A;  2HZE B;  4G2E A;  2IMD A;  1ZYP A;  1BJX A;  1B4P A;  3MIX A;  2QA2 A;  3KTL A;  2HI7 A;  3ZVJ D;  2I9H A;  4IGJ A;  3A5W A;  3GX8 A;  3FEU A;  1GNW A;  5D8I A;  2LRN A;  2AHE A;  4J57 E;  2R6K A;  2XPE A;  1LU4 A;  1ACV A;  3IV4 A;  4LA1 A;  2B7J A;  4YAV A;  1VRS D;  4G9H A;  2CT6 A;  1AC1 A;  4TXV A;  2GZZ A;  3MNG A;  1TRU A;  1K0O A;  3UVT A;  3UBK A;  3L0H A;  2YWI A;  4ZL8 A;  1ON4 A;  2WS2 A;  6GSW A;  3GKX A;  2C0G A;  4FYB A;  1PA3 A;  2H1G A;  1SVM A;  5DQS A;  1PQN A;  2H1A A;  5EY6 A;  2R3X A;  3LYK A;  1TU8 A;  3EC3 A;  3FKF A;  1X5E A;  1K0N A;  1OVN A;  3RAZ A;  4V2N A;  2PMT A;  4POM A;  2WRT A;  4POB A;  1V58 A;  5B7C A;  4CY6 A;  2H01 A;  4E8H A;  1X9S B;  4FIW A;  1XWG A;  5BMU B;  3QOU A;  4KND A;  1SL0 B;  2BTO T;  2WB9 A;  2ZNM A;  1TDI A;  3L4N A;  3I9V 2;  2MZC A;  3VI7 A;  1TKD B;  1AW9 A;  4E68 A;  3W8S A;  2TRC P;  4LLR A;  4LMW A;  3KZQ A;  2YZH A;  3ZTL A;  5F07 A;  4ICY A;  4HI7 A;  1S3A A;  1MD3 A;  3HXS A;  4N0V A;  2VL2 A;  2WUL A;  3FRC A;  3WGD A;  1PX7 A;  4MZC A;  1K0B A;  3F4S A;  3QCP A;  3FR9 A;  1JZR A;  2LRT A;  1GLQ A;  3TOU A;  2NVL A;  3LQ7 A;  3WYW A;  2F9S A;  1QXH A;  2DJ1 A;  2FWH A;  4JR4 A;  2LEG A;  20GS A;  3VPQ A;  3I43 A;  1O8W A;  2C0E A;  3IAS 2;  3E9J B;  3CYN A;  2HSM A;  3LXZ A;  1M9A A;  4G19 A;  4OMV A;  4IP6 A;  5COH A;  3EPT A;  4JZQ A;  1X9W B;  4YKG A;  2L5O A;  4ULX A;  4MZW A;  5AIV A;  3OR5 A;  2H19 A;  1SU9 A;  3PPU A;  1BQ7 A;  4G0L A;  3MSZ A;  1Y6E A;  1GTA A;  4QL7 A;  2C3T A;  1XFL A;  4K6X A;  1XW9 A;  2H1L A;  2XBI A;  1USB A;  3EMX A;  5IMA A;  5IOX A;  3GUR A;  4K1F A;  5D9W A;  1SK1 A;  1Y1U A;  1YKA A;  2VLT A;  4MAB A;  1YEP A;  3BCI A;  3HVS A;  3F6D A;  3QD9 A;  5AIX A;  5IMV A;  1SD9 A;  4IQ1 A;  3GX0 A;  2L4C A;  4PNF A;  4BVX B;  3U6V A;  5J3R A;  5HR1 A;  2GSR A;  2H74 A;  3QMX A;  2BJX A;  2LKU A;  1S3C A;  12GS A;  3G7I A;  3ISO A;  4KCA A;  3RPP A;  2I81 A;  3VPT A;  4MLY A;  2DC5 A;  1ZMA A;  4F03 A;  2XPD A;  3KIJ A;  1PN0 A;  4TKY A;  5CRG A;  3CTG A;  2M80 A;  2TIR A;  2GGT A;  2CVB A;  4AJ8 A;  4K2X A;  4PGT A;  2R2J A;  2LTK A;  3IRA A;  4ZB9 A;  4DVC A;  2JSZ A;  3GKN A;  2PVQ A;  3FZ9 A;  3HVX A;  4V1A p;  4LL1 B;  4HEA 2;  1V40 A;  3IK7 A;  3HKR A;  5KEJ A;  2H75 A;  3J7Y k;  5A5H A;  1UVZ A;  1WRY A;  4ZL7 A;  5HR0 A;  2OKA A;  11GS A;  3DML A;  4RI7 A;  4RUV A;  4K7I A;  2YJH A;  2DMM A;  1F6M C;  3IAM 2;  2XC2 A;  1TK0 B;  4N0Z A;  3UAP A;  1I5G A;  5G5F A;  2JZR A;  5DCH A;  4AKX B;  3HVV A;  1EZK A;  1N8J A;  2ZCT A;  3ZIV A;  1AXD A;  2OAD A;  2ALB A;  2HT9 A;  2MMZ A;  5D93 A;  4Q5R A;  1EGO A;  2YV9 A;  2GDR A;  5ECS A;  5CP1 A;  2QGV A;  2A4H A;  3HD5 A;  1SYR A;  1NM3 A;  3L9U A;  2V6O A;  1GUH A;  3Q18 A;  2MBT A;  1KNG A;  4KDY A;  3GHA A;  3KEB A;  1XCC A;  4I8B A;  5ID2 B;  4FQU A;  1WMJ A;  2B5E A;  1PKW A;  3NIV A;  1HYU A;  1BAY A;  2YJ7 A;  3TCO A;  3ZL5 A;  2KUC A;  1IYH A;  5J4U A;  5L71 A;  1JHB A;  2KLX A;  2VLU A;  2D2Z A;  5EPF A;  1XW6 A;  2P0G A;  1WWJ A;  2PUK C;  1MDJ A;  3UVH A;  1QQ2 A;  3C8E A;  1PGT A;  5LD0 A;  2VOC A;  4MP4 A;  1O85 A;  1OC3 A;  3C1R A;  4PQI A;  4AKH A;  5KN1 A;  3N9J A;  1VF1 A;  4WET A;  3GKK A;  5JWR B;  3HDC A;  1HNB A;  3N5O A;  1ZZY A;  4ZB8 A;  2EIR A;  4K9Z A;  2L5L A;  2X49 A;  2E2G A;  2LS5 A;  5F05 A;  1ML6 A;  5J4V A;  5E59 A;  19GS A;  1EWX A;  2H66 A;  3LSZ A;  1QGV A;  3ME8 A;  2E7P A;  3IC4 A;  4HZ4 A;  3F4R A;  2VCX A;  1UN2 A;  1GP1 A;  1EP7 A;  1QMV A;  1U88 A;  2FUG 2;  1WP0 A;  1QUW A;  2WGR A;  3ZFL A;  1T4Z A;  1Z3E A;  5D96 A;  1URM A;  4BVX A;  4KX4 A;  2ZUP A;  3DWV A;  1J0F A;  4KF9 A;  4I97 A;  4Z2U A;  1V9W A;  5G1K A;  2MMO A;  4CY8 A;  2DJJ A;  4F9Z A;  1G0T A;  4YKF A;  4KA0 A;  2JU5 A;  1AQV A;  3UJ1 A;  1OE7 A;  3D4M A;  3TRQ A;  3A5I A;  5CRH A;  4EIQ A;  1ZL9 A;  2YP6 A;  2GVP A;  4IP1 A;  3ME7 A;  4A5P A;  2O8V B;  5A1N A;  3H79 A;  2IFQ B;  4NV5 A;  2R5G A;  3GMF A;  1XVW A;  1TXU A;  1SL2 B;  4XS1 A;  4L0W A;  5D9V A;  1ERV A;  2FD3 A;  4EKZ A;  3SBC A;  2FLS A;  4HDE A;  1ZYQ B;  2FGX A;  3FK8 A;  3C7M A;  3H93 A;  4KCE A;  3H4K A;  1GUL A;  1VF3 A;  1SK2 A;  4CHS A;  5GSS A;  5EVO A;  2X8H A;  5F8B A;  2AYT A;  3GTU B;  1Z7P A;  3DIE A;  1SJ6 A;  2EFH A;  4IBP A;  3IHG A;  5GST A;  3NOF A;  4HJ2 A;  2FWG A;  1CQG A;  5J41 A;  1AAZ A;  5ECH B;  1RQM A;  4USS A;  4W66 A;  2YWN A;  1EV4 A;  3RBT A;  2V2G A;  3BCK A;  3UL3 A;  2R0C A;  2ES7 A;  2DIY A;  2K18 A;  3C71 A;  3F3Q A;  2VL3 A;  4JRR A;  2PU9 C;  5JWQ B;  4BVY B;  2P31 A;  3TKR A;  2HZF A;  3QAG A;  18GS A;  5ID2 A;  2L59 A;  1R7H A;  4OCE A;  3CRT A;  3D0Z A;  3HYP A;  2IJY A;  4L0U A;  3IDV A;  5J9B A;  4GSS A;  2DKI A;  3WT2 A;  5CAX A;  4HZ2 A;  1A8Y A;  4GTU A;  5ECK B;  5ECM B;  4ECB A;  2IPA A;  3W8J A;  1E6B A;  1YY7 A;  3ZMK A;  3IPZ A;  4MJC A;  4TW5 A;  4YH2 A;  5IO2 A;  1K0M A;  2K8S A;  5C00 A;  1B8X A;  3M8N A;  3IK9 A;  1N25 A;  2IME A;  4EE0 A;  4KSM A;  1J08 A;  2IIY A;  1YQ1 A;  2PWJ A;  4ML1 A;  4RQR A;  4KH7 A;  4KW6 A;  5KN0 A;  3LGC A;  3F4T A;  2CQ9 A;  3UEM A;  3A2W A;  3KGK A;  4KGI A;  3QDN A;  1FHE A;  1PKZ A;  3US3 A;  3KMO A;  4GCI A;  4JED A;  2X4A A;  2AJQ B;  3J7Y b;  1Q4J A;  5IMF A;  2L6D A;  3KH9 A;  3HJM A;  17GS A;  2F8F A;  4DEJ A;  1X0R A;  5ECO B;  5JWO B;  3ERG A;  3DEX A;  4YAP A;  4WF4 A;  1TP9 A;  4JE1 A;  2CAQ A;  3IC8 A;  2K6V A;  3VI5 A;  1MDI A;  1YEX A;  3F3R A;  5ABR A;  1G6Y A;  1TK5 B;  6GSY A;  4TXO A;  4IQA A;  3TKS A;  3ZIT A;  3FZ5 A;  2H73 A;  2H30 A;  2MBS A;  5E4W A;  1PSQ A;  1ZOF A;  4PUR A;  5DAK B;  5BRT A;  4HQS A;  1TU7 A;  2GTU A;  4BL7 B;  2VD0 A;  5ECN B;  1T8E B;  1MDK A;  1TW9 A;  1S3D A;  2OT3 A;  1TI3 A;  5D9X A;  2E0Q A;  2LNS A;  3F63 A;  2EIO A;  1A2M A;  2JAD A;  1ST9 A;  3TKP A;  3BD2 A;  2VM1 A;  1AUC A;  5AGY A;  4NAX A;  4OFN A;  4EF0 A;  4YQM A;  1G7E A;  4ECJ A;  1FAA A;  3VWW A;  4IW9 A;  4MF7 A;  3ERF A;  3GSS A;  2LJA A;  2IFQ A;  1FW1 A;  1M99 A;  1ERU A;  4PUA A;  2YN1 A;  5DVB A;  3M9K A;  2DIZ A;  4BWS A;  5J5N A;  4XS6 A;  2F3M A;  2HNL A;  4N30 A;  2X99 A;  5DAL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...