5FHIA

Crystallographic structure of psoe without co
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
MVFGTLYTFPGDQCRTIAIKAVAKANGLDLDIRETPRTPDHLSISKLGKVPAFQGADSFKLFECMAIALYITSQNEQTTLLGKDKKEYAEIIKWMSFFNTEIVILMTQQLLPQLGVIPYDRDQVEFFANMTQRSVDVVEEYLQDRTFLVGDQLSLADLFCAGNISLGFQFFYGKAWRQQNPNVSRWYEMVCHQPIYAAVTDKFQLLDEPKLTNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase, putative
publication title Oxidative trans to cis Isomerization of Olefins in Polyketide Biosynthesis.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
total genus 71
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5fhiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5fhiA01
4BL7A 4NMUA 3EMXA 3W8SA 2V1MA 5ECQB 2LEGA 5DALA 1EGRA 1CQGA 3ZREA 5F07A 3GL5A 1GUMA 2LV3A 1PSQA 2B3SA 2PMTA 4EUYA 5CRGA 3TJGA 5D9TA 3KH9A 1SYRA 2IN3A 4TR3A 4O5RA 1ML6A 4O92A 3ZL5A 1NM3A 4PURA 5HQPA 2KOKA 3UVHA 5H5RA 4ECIA 3L78A 1AAZA 1QQ2A 1TDIA 3KMNA 3U6VA 3TUEA 1GL8A 2VLTA 3F63A 12GSA 3KXOA 1OC3A 4WETA 3F6FA 1F9MA 3DRNA 3TKSE 3KTLA 3UOMA 3UVTA 1T4ZA 3D5JA 2HNLA 4IP1A 1V40A 3WGXA 1A2LA 3DD3A 1QMVA 1WP0A 3APQA 2FNOA 1RW1A 2HRFA 2I81A 3GIXA 2RM5A 4K0NA 4MF5A 2FUG2 2C3QA 1VGLA 2RUFA 1QFNA 2OBKA 2YWMA 2VAFA 5D93A 4AF2A 3BCIA 1SKSB 4G0LA 3ED3A 3DVWA 1TTZA 2O7KA 1F3AA 3MAKA 2GTUA 1PMTA 4GLTA 1A2MA 2GT6A 2M80A 1N2AA 2HZEA 4FIWA 2CAIA 4BVYA 1Q98A 2KHPA 1T8EB 5D9VA 1BG5A 5ECMB 3APOA 1X9SB 3P2AA 1FHEA 1GSEA 3KM6A 5EVOA 3D4MA 2E7PA 4JR6A 2DBCA 5IOWA 3GKNA 4ML1A 2MYGA 3IXRA 4L5OA 4PXOA 1XVQA 4MLYA 1ILOA 2VM1A 2OJLA 4K7IA 3PR8A 1PKWA 1SK0A 4EDZA 3P8WA 5F06A 5G5EA 4HDEA 1GNEA 3IK7A 4XRDA 4J2FA 3TKSA 4G9HA 2HSMB 5D9XA 1GSQA 3U5RE 3W8JA 4ACSA 3C73A 4TR1B 1Y6EA 2CVDA 1PL1A 3GFKA 3MDKA 1EWXA 1T4YA 2WRTA 2C0FA 1X9MB 1VF3A 3GYKA 3KD0A 3ME7A 2JL4A 2V6OA 2PERA 2GQLA 2HYXA 4EKZA 5EPFA 5IMZA 3KJYA 2L57A 2N5AA 3UEMA 2HRNA 1WRYA 2LRTA 2LNTA 2LQQA 4GSTA 4K9ZA 2VD1A 3CRUA 5D96A 3ZYWA 4XTSA 2RIIA 1PQNA 3C8EA 2F8FA 4HQZA 1W4VA 2EIQA 4JBBA 1I5GA 1YEPA 4MZWA 2ES7A 4GQCA 3CSHA 3TRPA 4NV5A 2GQMA 4TOPA 1YF0A 1M9BA 1XWGA 3D4TA 1GSDA 3EURA 5CAXA 1TU7A 4WF4A 4NV2A 3ZFLA 5DCGA 2VIMA 1DSBA 4KCAA 4WXTA 4IVFA 2L59A 5AISA 4POLA 2VCTA 1H4OA 2O89A 2K6VA 4HOJA 2JSYA 3VURA 4KGIA 4KB3A 2IPAA 5INYA 1GUKA 3DXBA 3TGZA 5IMDA 1AC1A 3IK9A 1K3YA 4O32A 1JHBA 3GA4A 4FYCA 2JU5A 2MMAA 5L71A 4Q5NA 3VWWA 5GAND 4DSRA 3F0IA 3IC8A 4KDUA 1PRXA 2P5QA 1ABAA 1XPVA 2WB9A 4XS1A 4ULXA 2F51A 2GZPA 1G7EA 1VRSD 1RK4A 2QKEA 1FG4A 3UIWA 3UBKA 2PU9C 3SBCA 1K3OA 1OE8A 22GSA 3ZMLA 2AHEA 2FWFA 4ZL9A 4DSQA 2FWHA 2RUEA 5ECOB 4XCSA 3GKXA 3F6DA 1YDKA 3CYNA 5ENUA 4OWYA 1MDJA 3EU3A 4H86A 4XHMA 2H0HA 5JCWA 5ECHB 2A4VA 2LRCA 3ERGA 2OBIA 1TK0B 3HXSA 4BA7A 3Q18A 1JLVA 1OC8A 1ZYEA 3QFAC 2FLSA 2VO4A 4NHZA 4L0UA 5DALB 1YKAA 2IL3A 1M2BA 3VLNA 2DJJA 1SD9A 1UN2A 3L9SA 3ERFA 3FRCA 2L4CA 2HSMA 4ECCA 1BEDA 4ID0A 2DMLA 1A0RP 2PWJA 4KCEA 4K2DA 2H0GA 4TR1A 2QC7A 3G7JA 1X5DA 2VLUA 5E59A 5DJLA 1B4QA 2IIYA 1O85A 1Q4JA 4GQFA 5CP1A 5IPGA 4ECBA 3EWLA 4EE0A 3QAWA 4K6XA 1YEXA 3GH6A 1FVJA 2C0EA 1TW9A 2EIRA 3A2WA 5ECKB 2YANA 3MNGA 1Z6NA 2B5XA 2GSRA 5D73A 1S3AA 4POMA 2FA8A 5A4UA 5H5SA 3IV4A 5DAKB 4L0WA 1K0MA 1SL2B 4PUAA 3PINA 4KUNA 3G7YA 3GMFA 4TN8A 5BMUA 2V41A 4IELA 4ZL7A 4IKHA 1FAAA 2TIRA 4AJ8A 2D2ZA 1OE7A 2CX4A 3M3MA 3LXZA 5HR2A 5IMCA 1SL0B 3HDCA 1S3DA 3ERWA 16GSA 4CHSA 1U3AA 5FHIA 3H1NA 5KN2A 1W89A 2MMNA 3FR3A 3R2QA 2I9HA 1T7PB 5FWGA 2B7JA 5B7CA 2GT5A 2ZUPA 1XXUA 2C3NA 5EL8A 4BPYA 1N8JA 4BVYB 3BD2A 1THXA 1SJZA 3I69A 3KP8A 5DVBA 4FYBA 4MK3A 5J3RA 3PGTA 3TRXA 4NXIA 3M9JA 2X8GA 4FQUA 1X0RA 2R2JA 3A3TA 1TRWA 1PA3A 1WJKA 1TKDB 2LS5A 3EMPA 3GKKA 2HQTA 4GWRA 1QUWA 1GTBA 2KUCA 5G2ZA 2XBIA 11GSA 1K0OA 2H6YA 5G31A 3HZ4A 1B8XA 2L5OA 3ZRDA 2J9HA 2WZ9A 4AJ6A 2P5RA 3FEUA 4N30A 1XWAA 2QSIA 5GSTA 1O7UA 4K7OA 3K8NA 4QL9A 1TXXA 2LQOA 1B48A 3GKMA 4KSOA 3D22A 3LFLA 3GSSA 4QL7A 1M0UA 1FB0A 1SD8A 1GULA 4MH3A 3L9UA 3CBUA 5F05A 2XPDA 1E6BA 4TR4A 2H1DA 2DLXA 3FR9A 4RI7A 1EEJA 1GUHA 2EC4A 2TRCP 4GF0A 3ZVJD 2LKUA 5CREA 3EINA 2LTKA 1SKWB 5HFKA 4KNDA 1NW2A 4MPGA 3BOAA 4PQ1A 3HHVA 2P0GA 1Z5YE 5ECNB 4MP4A 2N5BA 2ALBA 2V32A 4PGTA 3EVIA 1YJ6A 3L9VA 3H8QA 2YWNA 3LXTA 1TK8B 5ECPB 4JU5A 1ZCPA 5H5QA 3SWLA 2H1AA 1XW9A 2HRKA 4OCFA 4G2EA 1BYEA 5HR1A 3O6TA 1UC7A 4XS4A 1ZOFA 3TJJA 4WEYA 3LYPA 5COHA 6GSYA 1TK5B 2H70A 4LA1A 5DAKA 4KDXA 2PUKC 2VL2A 4MABA 4F9ZA 3I43A 2H30A 5G30A 5HR0A 2OACA 2GS3A 2VCZA 3PPUA 2NBSA 2BJXA 1XWKA 2BTOT 2L4QA 3IAS2 2GSTA 4PTSA 1A8YA 1AW9A 3CMIA 4LMVA 5LCZA 4EL1A 3LGCA 3ZITA 6GSWA 1J08A 2H66A 3IDVA 3FW2A 4EF0A 4YQVA 3CRTA 2HXKA 4JRRA 4IGJA 3HJOA 2H0IA 2MZCA 1MDIA 4LL4B 3WGDA 4NAXA 4I2UA 4G10A 4PQIA 2OKAA 4F82A 4JZQA 1JZOA 3TJKA 1HNAA 2H71A 4KAEA 4RQXA 1U87A 5AN1A 4HI7A 3M9KA 5KN3A 5JCGA 9GSSA 4V1Ag 5E4WA 4Z7XA 1HNBA 3LQ7A 1Z3EA 3TKRA 3L0HA 4Q5RA 2L6DA 2R37A 3IOSA 2IJYA 2HSYA 5IMAA 1WE0A 1JZDA 2DMMA 1G6WA 5JWRB 4N10A 2C3TA 1YF1A 1K0AA 4FH8A 1DUGA 4E8EA 3RHCA 4D73B 3F3QA 2A2SA 2UZ8A 2HSNB 1R26A 3RPPA 2XPEA 3IRAA 2H6XA 2HI7A 1MD3A 2WULA 2ON7A 4TXVA 4HJ2A 2AV4A 19GSA 4YAPA 4NHWA 1XZOA 3DGQA 1M99A 4N0VA 5A4VA 2VCQA 2VL3A 3VWUA 3E3EA 1OYJA 3LSZA 3MWHA 5JCUA 2YWOA 1XW5A 3C1SA 4YQUA 4MJCA 4RQRA 2PN8A 2AYTA 3V1WA 3TOTA 5ECIB 4KH7A 2YZUA 3QOUA 1VF2A 3TCOA 3DEXA 4ML6A 1GP1A 2RLIA 5B8AA 1XVWA 3E9JB 4V2MA 3APSA 1ERUA 4TW5A 4E8HA 1LJRA 1G7OA 1MD4A 3BCKA 2B1LA 1XFLA 3FZ5A 4ILFA 3I9V2 1OAZA 2H6ZA 1ZZYA 6GSXA 5J41A 2X99A 5LD0A 2B7KA 1K0BA 3WGEA 2C80A 2ZNMA 4BVXB 1PD21 1AQWA 3A2VA 1UVZA 3VI7A 3GL3A 4I5QA 2P31A 2C4JA 5CRHA 17GSA 4F03A 4FO5A 4ZB8A 1FB6A 5AIXA 1PX7A 1XBSA 4MJEA 3WT2A 2FY6A 3RBTA 2GGTA 5ELAA 2R3XA 2DJ2A 4KE3A 3KIJA 5IM9A 2IMIA 1PX6A 2VCVA 3VWVA 4Q5FA 3RDWA 3IR4A 3HD5A 1AQVA 2I4AA 2DJKA 3ZTLA 3GX0A 4KX4A 2FA4A 1IYIA 2NTOA 3HVXA 2MBSA 3KEBA 2PVQA 2LJAA 1C72A 1FW1A 2GSSA 4OD7A 2LSTA 1H75A 1EV9A 2E2MA 5JWOB 4AGSA 6GSSA 1RQMA 4WR4A 1JZWA 4IQAA 2H76A 1LBKA 3Q74A 2CVBA 1ACVA 2ZCTA 3P90A 1J0FA 3BJ5A 1BJXA 1JZRA 4F0BA 4MF7A 2JZRA 4ZB6A 1T1VA 4EVMA 5HR3A 3FR6A 2IMEA 1O81A 1YY7A 1QXHA 1B9YC 2GZZA 4EXJA 1NHOA 1ST9A 2AB6A 1Y25A 5F8BA 3OR5A 1M7TA 3TKPA 1EP8A 4HZ4A 3NOFA 2B6MA 5IQYA 4G0KA 2NDOA 3HJMA 1I9DA 2H72A 1R5AA 4PQHA 1MTCA 3HVVA 1QK8A 1UA5A 1EGOA 3H93A 2HRKB 1ERTA 4D73A 3EC3A 1WMJA 3HCZA 4GSNA 3ME8A 3KTBA 2PBJA 2K9FA 2CA8A 4XS4B 1WOUA 5IMFA 2DSAA 5IIZA 2IMKA 5DQSA 4X1UA 1GSYA 3AY8A 3QPMA 4ISDA 1R7HA 4IW9A 3ZZXA 1GLPA 2H19A 1EEMA 1F3BA 2O8VB 2OADA 2O85A 3KCMA 2HSHA 4BWSA 3GURA 4ZB9A 2K8SA 3IE3A 2WCIA 1PKZA 3Q19A 2XBQA 4USSA 5HFGA 1URMA 4I6XA 2VD0A 4MPFA 3TDGA 6GSVA 4JEDA 3A2XA 4WBJA 4HUAA 3FKFA 2GDRA 5J9CA 1ZGNA 2Z9SA 3KH7A 4LLRA 1JFUA 4J57E 3N9JA 1GLQA 2L5LA 3F4TA 1VF4A 4K0GA 2RM6A 1FVKA 3GUSA 1AXDA 1U88A 2CV4A 3ISOA 2CQ9A 1F37A 2HFDA 1X5EA 2X8HA 3D21A 4HZ2A 2V2GA 4BVXA 4L8EA 4EDYA 2HT9A 2KLXA 2DIZA 1X9WB 1V9WA 1B9XC 5D8IA 3TB2A 5J5NA 2H75A 3QR6A 3G9BA 4MMMA 5B8BA 1R5PA 4MA9A 4DSSB 2CZ3A 5KN1A 2WJUA 4GCIA 3DIEA 2VLVA 4HU9A 5CO3A 5DDLA 2CT6A 2X64A 4IP6A 3EYTA 3BBYA 1ZYQB 3FZ9A 1K0CA 2J23A 2F8AA 4K7NA 1F2EA 3F4RA 3WT1A 2IMFA 1HQOA 4IJ3A 3VFIA 3DKSA 2FGXA 1GRXA 1OKTA 1M2DA 4OFMA 1AQXA 5AGYA 1XWBA 3US3A 3N5OA 3ZIVA 1Z9HA 2GVPA 1A8LA 4X0XA 5G1KA 1U6TA 1PGTA 1SJ6A 4X43A 5ABRA 2E2GA 4KF9A 4ZBBA 1NSWA 1A0FA 1KBNA 2YZHA 2MBTA 3LG6A 3RHBA 4ZILA 5IPHA 3MSZA 5C04A 4V2NA 4XRAA 1XW6A 1OVNA 4HU7A 3CTFA 1A23A 6GSTA 4IN0A 4POBA 4MJAA 1ZL9A 4YAVA 2O87A 2YV7A 3E0UA 3FY7A 1SU9A 4I97A 2N5FA 4CDOA 4RUVA 2AJQB 1SL1B 4DEJA 2EIOA 4HEA2 1BAYA 1WPIA 1TOFA 3CSJA 1BQ7A 2LJRA 3R3EA 1FOVA 3GHAA 1T3BA 1GSUA 1GTIA 4EC0A 1SYXA 3GN3A 1Z6MA 5LNKe 4MF6A 5GSSA 3HY2A 4K8MA 1HD2A 3A5WA 1K0DA 1O8XA 2HRAA 1AIUA 4EO3A 3IHQA 2LNSA 1DBYA 3D6IA 4MJBA 3JCML 4ZL8A 1ERWA 3EU4A 1V98A 5HFIA 3C1RA 2PPTA 1DE1A 2REMA 1SK1A 1G0TA 2XC2A 4TVEA 2DC5A 1YQ1A 3F3RA 3O3TA 5CYYA 5DQYA 3KP9A 1EOHA 1TRVA 2CX3A 5IOXA 3UMAA 2YP6A 3FZAA 4IHUA 2IFQB 3WYWA 4N0ZA 3QD9A 2CZ2A 3KZQA 4KDYA 2MMZA 2OE1A 5B6NA 2H74A 4RI6A 5ELGA 4ZBDA 3QAGA 5A5KA 3FHKA 2JZTA 2LUSA 4JR4A 3IA1A 3HZ8A 3M0FA 1IYHA 2K18A 1TJDA 2F3MA 2VCXA 3HYPA 1EV4A 2FCHA 3NIVA 3CTGA 2KP1A 5D9WA 2DJ1A 4F0CA 2B5EA 2YPMA 4TKYA 1GSFA 3PH9A 3GTUB 3GX8A 5IO2A 2VL9A 5IMVA 4DSSA 2M72A 2F9SA 3QAVA 3CSIA 4L5LA 2K8VA 4F2IA 5GZZB 4HQSA 4O7HA 3TOUA 4YH2A 2VCWA 1AUCA 3KGKA 1E2YA 2NPBA 2YJHA 1S3CA 4WF5A 4GTUA 2B1KA 2YNXA 3IAM2 1ERVA 1BX9A 2C1YA 2DJ3A 3ZIJA 2CVKA 3ZFBA 5KN0A 1GTUA 2YJ7A 1TU8A 1OC9A 1SK2A 5ECRB 4ECJA 1KEBA 3GH9A 3TJFA 1MDKA 2WGRA 4WKWA 4Q5QA 4NWYA 4V2LA 5IO0A 3Q6OA 2LRNA 2H73A 4MZBA 4YQMA 4OO4A 1V57A 4MCUA 2L6CA 3GNJA 2A2RA 1QGVA 2YOIA 5FT3A 2M46A 1VF1A 3FYGA 2VL2C 1TI1A 3O76A 1ON4A 1V58A 4OFTA 2XHFA 2YV9A 3UBLA 1Z7PA 4TR0A 2H1GA 5J4UA 4OO5A 1HYUA 3IPZA 1B4PA 2R5GA 3C7MA 3HA9A 4ZBAA 1K3LA 1KNGA 3M8NA 1PL2A 4PNGA 4AJ7A 2MMOA 2OE0A 3VPQA 2I1UA 4CW9A 2C0DA 4HJMA 4QQ7A 1X5CA 1WWJA 4MDCA 1YZXA 3LWAA 4PX1A 4DVCA 4POKA 3H4KA 3F8UA 2IWTA 3P7XA 2X8CA 3TKQA 3KMOA 1GWCA 1EP7A 1GSSA 5GAPD 2H01A 2OA7A 2I3YA 3C71A 1T00A 2R6KA 4LL1B 2FHEA 1XOAA 4GSSA 1O6JA 1HNCA 4IQ1A 1XIYA 3FK8A 3WD6A 1EOGA 3DWVA 1YKCA 1GH2A 2C8UA 3GSTA 4TXOB 4OMVA 2BMXA 3G7IA 2GSQA 5KEJA 3DYRA 2JZSA 3TKSC 3QDNA 1SJIA 3GRXA 2IFQA 2WFCA 10GSA 1R4WA 5AIVA 1SENA 1DE2A 3HVSA 5DCHA 2FWGA 2H1BA 1MEKA 2NVLA 4OFNA 3ZMKA 2JACA 4IJIA 1GNWA 3QFBC 5JWQB 2WDUA 2VUPA 4GXZA 2QGVA 2PVOC 2YCDA 1NHYA 7GSSA 2HE3A 5ID2B 18GSA 1TI3A 5CRWA 3GTUA 4IS0A 3GV1A 4G0IA 1PN9A 2R4VA 2PGTA 4BL7B 2C0GA 4N11A 3LYKA 1F6MC 4XIHA 1U3IA 2AAWA 2JSZA 1ZMAA 4LMWA 4P3YB 1THOA 2DJ0A 3S9FA 3EE2A 3F4SA 4OCEA 4WBRD 3VK9A 2VM2A 2CAQA 3H79A 3F9UA 4ZXGA 3L4NA 1G6YA 1XOBA 4MZCA 5C00A 2G2QA 2KP2A 5A4WA 5EY6A 3VI5A 5DBQA 2YN1A 2FD3A 3UARA 2YWIA 3HKRA 3FZ4A 13GSA 4WR5A 3UJ1A 4KSMA 1TP9A 3UL3A 3IC4A 4K1FA 3VWXA 5J9BA 2H8LA 3NZNA 4JE1A 3D0ZA 3ZLPA 1A24A 3TJBA 4MH2A 4PUFC 3QCPA 1XWCA 2HZFA 1M9AA 2DIYA 1GTAA 2ON5A 2VOCA 3ZVJA 2IMDA 5CNWA 2HLSA 4KA0A 3TRQA 4V1Ap 3VPTA 1O73A 3M1GA 3RAZA 1OKDA 4GRFA 5F0GA 4NPBA 3DVXA 2GQKA 1CQHA 4IBPA 1Z7RA 3HJPA 1V2AA 3IBHA 3LJRA 2V6KA 3CXGA 3QMXA 2B5YA 2TRXA 2E0QA 1JLWA 1TRUA 1M2AA 2G0FA 3J7Yb 3LEFA 5B6MA 4BWQA 1KTEA 1A2JA 6GSUA 3UAPA 4PNFA 5CRDA 4G19A 4ZIJA 3I6AA 2FWEA 4XS6A 2HZEB 4KW6A 1SKRB 4TXOA 2GZYA 2OE3A 4I8BA 3W6GA 1XCCA 5G1LA 4J56E 8GSSA 5ECLB 2WS2A 14GSA 2LJKA 1O8WA 4FYUA 3RPNA 4I2TA 1TRSA 4TRXA 1LU4A 2GLRA 4HS1A 3J7Yk 5G5FA 5DJMA 1USBA 3DMLA 1WIKA 2AUVA 1EZKA 1OC9B 3LORA 1J9BA 1FO5A 5ID2A 5ECSA 20GSA 2JADA 1K0NA
chains in the Genus database with same CATH superfamily
4BL7A 4NMUA 3EMXA 3W8SA 2V1MA 5ECQB 2LEGA 5DALA 1EGRA 1CQGA 3ZREA 4AKIA 5F07A 3GL5A 1GUMA 2LV3A 1PSQA 2B3SA 2PMTA 4EUYA 5CRGA 3TJGA 5D9TA 3KH9A 1SYRA 2IN3A 4TR3A 4O5RA 1ML6A 4O92A 3ZL5A 1NM3A 4PURA 5HQPA 2KOKA 3UVHA 5H5RA 4ECIA 3L78A 1AAZA 1QQ2A 1TDIA 3KMNA 3U6VA 3TUEA 1GL8A 2VLTA 3F63A 12GSA 3KXOA 1OC3A 4WETA 3F6FA 1F9MA 3DRNA 3TKSE 3KTLA 3UOMA 3UVTA 1T4ZA 3D5JA 2HNLA 4IP1A 1V40A 3WGXA 1A2LA 3MIXA 3DD3A 1QMVA 1WP0A 3APQA 2FNOA 1RW1A 2HRFA 3CQFA 2I81A 3GIXA 2RM5A 4K0NA 4MF5A 4Z2UA 2FUG2 2C3QA 1VGLA 2RUFA 1QFNA 2OBKA 2YWMA 2VAFA 5D93A 4AF2A 3BCIA 1SKSB 4G0LA 3ED3A 3DVWA 1TTZA 2O7KA 1F3AA 4FXYP 3MAKA 2GTUA 1PMTA 4GLTA 1A2MA 2GT6A 2M80A 1N2AA 2HZEA 2CAIA 1Q98A 4BVYA 4FIWA 2KHPA 1T8EB 5D9VA 1BG5A 5ECMB 3APOA 1X9SB 3P2AA 1FHEA 1GSEA 3KM6A 5EVOA 3D4MA 2E7PA 4JR6A 1YEWC 2DBCA 5IOWA 3GKNA 4ML1A 2MYGA 3IXRA 4L5OA 4PXOA 1XVQA 4MLYA 1ILOA 2VM1A 2OJLA 4K7IA 3PR8A 1PKWA 1SK0A 4EDZA 5BRTA 3P8WA 5F06A 5G5EA 4HDEA 1GNEA 3IK7A 4XRDA 4J2FA 3TKSA 4G9HA 2HSMB 5D9XA 2O3EA 1GSQA 3U5RE 3W8JA 4ACSA 3C73A 4TR1B 1Y6EA 2CVDA 1PL1A 3GFKA 3MDKA 1EWXA 1T4YA 2WRTA 2C0FA 1X9MB 1VF3A 3GYKA 3KD0A 3ME7A 2JL4A 2V6OA 2PERA 2GQLA 2HYXA 4EKZA 5EPFA 5IMZA 3KJYA 2L57A 2N5AA 3UEMA 2HRNA 1WRYA 2LRTA 2LNTA 5A1NA 2LQQA 4GSTA 4K9ZA 2VD1A 3CRUA 5D96A 3ZYWA 4XTSA 2RIIA 1PQNA 3C8EA 2F8FA 4HQZA 1W4VA 1BG1A 2EIQA 4CY6A 4JBBA 1I5GA 1YEPA 4MZWA 2ES7A 4GQCA 2WW2A 3CSHA 3TRPA 4NV5A 2GQMA 4TOPA 1YF0A 1M9BA 1XWGA 3D4TA 1GSDA 3EURA 5CAXA 1TU7A 4WF4A 4NV2A 3ZFLA 5KOXA 5DCGA 2VIMA 1DSBA 4KCAA 4WXTA 4IVFA 2L59A 5AISA 4POLA 1BF5A 2VCTA 3FMWA 1H4OA 2O89A 2K6VA 4HOJA 2JSYA 3VURA 4KGIA 4KB3A 2IPAA 5INYA 1GUKA 3DXBA 3TGZA 5IMDA 1AC1A 3IK9A 1K3YA 4O32A 1JHBA 3GA4A 4FYCA 2JU5A 2MMAA 5L71A 4Q5NA 3VWWA 5GAND 4DSRA 3F0IA 3IC8A 4KDUA 1PRXA 2P5QA 1ABAA 1XPVA 2WB9A 4XS1A 4ULXA 4O5UA 2F51A 2GZPA 1G7EA 1VRSD 1RK4A 2QKEA 1FG4A 3UIWA 3UBKA 2PU9C 3SBCA 1K3OA 1OE8A 22GSA 3ZMLA 2AHEA 2FWFA 4ZL9A 4DSQA 2FWHA 2RUEA 5ECOB 4XCSA 3GKXA 3F6DA 1YDKA 3CYNA 1S3RA 5ENUA 4OWYA 5KOWA 1MDJA 3EU3A 4H86A 4XHMA 2H0HA 5JCWA 5ECHB 2A4VA 2LRCA 3ERGA 2OBIA 1TK0B 3HXSA 4BA7A 3Q18A 1JLVA 1OC8A 1ZYEA 3QFAC 2FLSA 5J47A 2VO4A 4NHZA 4L0UA 5DALB 1YKAA 2IL3A 1M2BA 3VLNA 2DJJA 1SD9A 1UN2A 3L9SA 3ERFA 3FRCA 2L4CA 2HSMA 4ECCA 1BEDA 4ID0A 2DMLA 1A0RP 2PWJA 4KCEA 4K2DA 2H0GA 4TR1A 2QC7A 3G7JA 1X5DA 2VLUA 5E59A 2DKIA 5DJLA 1B4QA 2IIYA 1O85A 1Q4JA 4GQFA 5CP1A 5IPGA 4ECBA 3EWLA 4EE0A 3QAWA 3RFRC 4K6XA 1YEXA 3HVNA 3GH6A 1FVJA 2X4AA 2C0EA 1TW9A 2EIRA 2A2PA 2H1LA 3A2WA 5ECKB 2YANA 3MNGA 1M3JA 1Z6NA 2B5XA 2GSRA 5D73A 1S3AA 4POMA 2FA8A 5A4UA 5H5SA 3IV4A 5DAKB 4L0WA 1K0MA 1SL2B 4PUAA 3PINA 4KUNA 3G7YA 3GMFA 4TN8A 5BMUA 4E68A 2V41A 4IELA 4X4JA 4ZL7A 4IKHA 1FAAA 2TIRA 4AJ8A 2D2ZA 1OE7A 2CX4A 3M3MA 3LXZA 5HR2A 5IMCA 1SL0B 3HDCA 4BIKA 1S3DA 3ERWA 16GSA 4CHSA 1U3AA 5FHIA 3H1NA 5KN2A 1W89A 2MMNA 3FR3A 3R2QA 2I9HA 1T7PB 5FWGA 2B7JA 5B7CA 2GT5A 2ZUPA 1XXUA 2C3NA 2EFDA 5EL8A 4BPYA 4G01A 1N8JA 4BVYB 3BD2A 1THXA 1SJZA 3I69A 3KP8A 5DVBA 4FYBA 4MK3A 5J3RA 3PGTA 3TRXA 4NXIA 3M9JA 2X8GA 4FQUA 1X0RA 2R2JA 4W66A 3A3TA 2O5VA 1TRWA 1PA3A 1WJKA 1TKDB 2R0CA 2LS5A 3EMPA 3GKKA 2HQTA 4PI0C 4GWRA 1QUWA 1GTBA 2KUCA 5G2ZA 2XBIA 11GSA 1K0OA 2H6YA 5G31A 3HZ4A 1B8XA 2L5OA 3ZRDA 2J9HA 2WZ9A 4AJ6A 2P5RA 3FEUA 4N30A 1XWAA 2QSIA 5GSTA 1O7UA 4K7OA 3K8NA 4QL9A 1TXXA 2LQOA 1B48A 3GKMA 4KSOA 3D22A 3LFLA 3GSSA 4QL7A 1M0UA 1FB0A 1SD8A 1GULA 4MH3A 3L9UA 3CBUA 5F05A 5A1NB 2XPDA 1E6BA 4TR4A 2H1DA 2DLXA 4EIQA 3FR9A 4RI7A 1EEJA 1GUHA 2EC4A 2TRCP 4GF0A 3CWGA 3ZVJD 2LKUA 5CREA 3EINA 2LTKA 1SKWB 2EFCA 5HFKA 4KNDA 1NW2A 4MPGA 3BOAA 4PQ1A 3HHVA 2P0GA 1Z5YE 5ECNB 4MP4A 2N5BA 2ALBA 2V32A 4PGTA 3EVIA 1YJ6A 3L9VA 3H8QA 2YWNA 3LXTA 1TK8B 5ECPB 4JU5A 1ZCPA 5H5QA 3SWLA 2O36A 2H1AA 1XW9A 2HRKA 4OCFA 3TU3B 4G2EA 1BYEA 5HR1A 3O6TA 1UC7A 4N3ZA 4XS4A 1ZOFA 3TJJA 4WEYA 3LYPA 5COHA 6GSYA 1TK5B 2H70A 4LA1A 5DAKA 4KDXA 2PUKC 2VL2A 5J4YA 4MABA 4F9ZA 3I43A 2H30A 2WZSA 5G30A 5HR0A 2OACA 2GS3A 2VCZA 3PPUA 2NBSA 2BJXA 1XWKA 3IAS2 2BTOT 2L4QA 2GSTA 4AKXB 4PTSA 1A8YA 1AW9A 3CMIA 4LMVA 5LCZA 4EL1A 4Z2RA 3LGCA 3ZITA 6GSWA 1J08A 2H66A 3IDVA 3FW2A 4EF0A 2WW1A 4YQVA 3CRTA 2HXKA 4JRRA 4IGJA 4YKFA 3HJOA 2H0IA 2MZCA 1MDIA 4LL4B 3WGDA 4NAXA 2OT3A 4I2UA 4G10A 4PQIA 2OKAA 4F82A 4JZQA 4AKGA 1JZOA 3TJKA 1HNAA 2H71A 4KAEA 4RQXA 1U87A 5AN1A 4HI7A 3M9KA 5KN3A 5JCGA 9GSSA 4V1Ag 5E4WA 4Z7XA 1HNBA 3LQ7A 1Z3EA 3TKRA 3L0HA 4Q5RA 2L6DA 2R37A 3IOSA 2IJYA 2HSYA 5IMAA 1WE0A 1JZDA 2DMMA 1G6WA 5JWRB 4N10A 2C3TA 1YF1A 1K0AA 4FH8A 2WW3A 1DUGA 1SVOA 4E8EA 3RHCA 4D73B 3F3QA 2A2SA 2UZ8A 2HSNB 1R26A 3RPPA 2XPEA 3IRAA 2H6XA 2HI7A 1MD3A 2WULA 2ON7A 4TXVA 4HJ2A 2AV4A 3HMJG 19GSA 4YAPA 4NHWA 1XZOA 3DGQA 1M99A 4N0VA 5A4VA 2VCQA 2VL3A 3VWUA 4A5PA 3E3EA 1OYJA 3LSZA 3MWHA 5JCUA 2YWOA 1XW5A 3C1SA 4YQUA 4MJCA 5BMUB 4RQRA 2PN8A 2AYTA 3V1WA 3TOTA 5ECIB 4KH7A 2YZUA 3QOUA 2X49A 1VF2A 3TCOA 3DEXA 4ML6A 1GP1A 2RLIA 5B8AA 1XVWA 3E9JB 4V2MA 3APSA 1ERUA 4TW5A 4E8HA 1LJRA 1G7OA 1MD4A 3BCKA 2B1LA 1Y1UA 1XFLA 3FZ5A 4ILFA 3I9V2 1OAZA 2H6ZA 1ZZYA 6GSXA 5J41A 2X99A 5LD0A 2B7KA 1K0BA 3WGEA 2C80A 2ZNMA 4BVXB 1PD21 1AQWA 3A2VA 1UVZA 3VI7A 3GL3A 4I5QA 2P31A 2C4JA 5CRHA 17GSA 4F03A 4FO5A 4ZB8A 1FB6A 5AIXA 1PX7A 1XBSA 4MJEA 3WT2A 2FY6A 2QA1A 3RBTA 2GGTA 2R0PA 5ELAA 2R3XA 2DJ2A 4KE3A 3KIJA 5IM9A 2IMIA 1PX6A 2VCVA 3VWVA 4Q5FA 3RDWA 3IR4A 3HD5A 1AQVA 2I4AA 2DJKA 3ZTLA 3GX0A 4KX4A 4PHZC 2FA4A 1IYIA 2NTOA 3HVXA 2MBSA 3KEBA 2PVQA 2LJAA 1C72A 1FW1A 2GSSA 2VKZG 4OD7A 2LSTA 1H75A 1EV9A 2E2MA 5JWOB 4AGSA 6GSSA 1RQMA 4WR4A 1JZWA 4IQAA 2H76A 1LBKA 3Q74A 2CVBA 1ACVA 2ZCTA 3P90A 1J0FA 3BJ5A 1BJXA 1JZRA 4F0BA 4MF7A 2JZRA 4ZB6A 1T1VA 4EVMA 5HR3A 3FR6A 2IMEA 1O81A 1YY7A 1QXHA 1B9YC 2GZZA 4EXJA 1NHOA 1ST9A 2AB6A 1Y25A 5F8BA 3OR5A 1M7TA 3A5IA 3TKPA 1EP8A 4HZ4A 3NOFA 2B6MA 5IQYA 4G0KA 2NDOA 3HJMA 1I9DA 2H72A 1R5AA 4PQHA 1MTCA 3HVVA 1QK8A 1UA5A 2QA2A 1EGOA 3H93A 2HRKB 1ERTA 4D73A 5A34A 3EC3A 1WMJA 3HCZA 4GSNA 2HSNA 3ME8A 3KTBA 2PBJA 2K9FA 2CA8A 4XS4B 1WOUA 5IMFA 2DSAA 5IIZA 2IMKA 5DQSA 4X1UA 1GSYA 3AY8A 3QPMA 4ISDA 1R7HA 4IW9A 3ZZXA 1XG8A 1GLPA 2H19A 1EEMA 1F3BA 2O8VB 2OADA 3KCMA 2O85A 2HSHA 4BWSA 3GURA 4ZB9A 2K8SA 3IE3A 2WCIA 1PKZA 2UV8G 3Q19A 2XBQA 4USSA 5HFGA 1URMA 4I6XA 2VD0A 4MPFA 3TDGA 6GSVA 4JEDA 3A2XA 4WBJA 4HUAA 3FKFA 2GDRA 5J9CA 1ZGNA 2Z9SA 3KH7A 4LLRA 1JFUA 4J57E 3N9JA 1GLQA 2L5LA 3F4TA 4YKGA 1VF4A 4K0GA 2RM6A 1FVKA 3GUSA 1AXDA 1U88A 2CV4A 3ISOA 2CQ9A 1F37A 2HFDA 1X5EA 2X8HA 3D21A 4HZ2A 2V2GA 4BVXA 4L8EA 4EDYA 2HT9A 2KLXA 2DIZA 1X9WB 1V9WA 1B9XC 1I1IP 5D8IA 3TB2A 5J5NA 2H75A 3QR6A 3G9BA 4MMMA 5B8BA 1R5PA 4MA9A 4DSSB 2CZ3A 5KN1A 2WJUA 4GCIA 3DIEA 2VLVA 4HU9A 5CO3A 5DDLA 3CHXC 2CT6A 2X64A 4IP6A 3EYTA 3BBYA 1ZYQB 3FZ9A 1K0CA 2J23A 2F8AA 4K7NA 1F2EA 3F4RA 3WT1A 2IMFA 1HQOA 4IJ3A 3VFIA 3DKSA 2FGXA 1GRXA 1OKTA 1M2DA 4OFMA 1AQXA 5AGYA 1XWBA 3US3A 3N5OA 1SVMA 3ZIVA 1Z9HA 2GVPA 1A8LA 4X0XA 5G1KA 1U6TA 1PGTA 1SJ6A 4X43A 5ABRA 2E2GA 4KF9A 4ZBBA 1NSWA 1A0FA 1KBNA 2YZHA 2MBTA 1YVLA 3LG6A 3RHBA 4ZILA 5IPHA 3MSZA 5C04A 4V2NA 4XRAA 1XW6A 1OVNA 4HU7A 3CTFA 1A23A 6GSTA 4IN0A 4POBA 1ZYNA 4MJAA 1ZL9A 4YAVA 2O87A 2YV7A 3E0UA 3FY7A 1SU9A 4I97A 2N5FA 4CDOA 4RUVA 2AJQB 1SL1B 4DEJA 2EIOA 4HEA2 1BAYA 1WPIA 1TOFA 3CSJA 1BQ7A 3IHGA 2LJRA 3R3EA 1FOVA 3GHAA 1T3BA 1GSUA 1GTIA 4EC0A 1SYXA 3GN3A 1Z6MA 5LNKe 4MF6A 5GSSA 3HY2A 4K8MA 1HD2A 3A5WA 1K0DA 2WW0A 1O8XA 2HRAA 1AIUA 4EO3A 2DKHA 3IHQA 2LNSA 1DBYA 3D6IA 4MJBA 5J40A 3JCML 4ZL8A 1ERWA 3EU4A 1V98A 5HFIA 3C1RA 2PPTA 1DE1A 1FOHA 2REMA 1SK1A 1G0TA 2XC2A 4TVEA 2DC5A 1YQ1A 3F3RA 3O3TA 5CYYA 5DQYA 3KP9A 1EOHA 1TRVA 2CX3A 5IOXA 3UMAA 2YP6A 3FZAA 4IHUA 2IFQB 3WYWA 4N0ZA 3QD9A 2CZ2A 3KZQA 4KDYA 2MMZA 2OE1A 5B6NA 2H74A 4RI6A 5ELGA 4ZBDA 3QAGA 5A5KA 3FHKA 2JZTA 2LUSA 4JR4A 3IA1A 3HZ8A 3M0FA 1N25A 1IYHA 2K18A 1TJDA 3RGBC 2F3MA 2VCXA 3HYPA 1EV4A 2FCHA 3NIVA 3CTGA 2KP1A 5D9WA 2DJ1A 4F0CA 1ZYPA 2B5EA 2YPMA 4TKYA 1GSFA 3PH9A 3GTUB 3GX8A 5IO2A 2VL9A 5IMVA 2WVZA 4QMKA 4DSSA 2M72A 2F9SA 3QAVA 3CSIA 4L5LA 2K8VA 4F2IA 5GZZB 4HQSA 4O7HA 5J4VA 3TOUA 4YH2A 2VCWA 1AUCA 2WVYA 3KGKA 1E2YA 2NPBA 2YJHA 1S3CA 4WF5A 4GTUA 2B1KA 2YNXA 3IAM2 1ERVA 1BX9A 2C1YA 2DJ3A 4ICYA 3ZIJA 2CVKA 3ZFBA 5KN0A 1GTUA 2YJ7A 5A34B 1TU8A 1OC9A 1SK2A 5ECRB 4ECJA 1KEBA 3GH9A 3TJFA 1MDKA 2WGRA 4WKWA 4Q5QA 4NWYA 4V2LA 5IO0A 3Q6OA 2LRNA 2H73A 4MZBA 4YQMA 4OO4A 1V57A 4MCUA 2L6CA 3GNJA 2A2RA 1QGVA 2YOIA 5FT3A 2M46A 1VF1A 3FYGA 1TXUA 2VL2C 5A5HB 1TI1A 3O76A 1ON4A 1V58A 4OFTA 1M3IA 2XHFA 2YV9A 3UBLA 1Z7PA 4TR0A 2H1GA 5J4UA 4OO5A 1HYUA 4K5RA 4MNNA 3IPZA 1B4PA 2R5GA 3C7MA 3HA9A 4ZBAA 1K3LA 1KNGA 4CY8A 3M8NA 1PL2A 4PNGA 4AJ7A 2MMOA 2OE0A 3VPQA 2I1UA 4CW9A 2C0DA 4HJMA 4QQ7A 1X5CA 1PN0A 1WWJA 4MDCA 1YZXA 3LWAA 4PX1A 4DVCA 4POKA 3H4KA 3F8UA 2IWTA 3P7XA 2X8CA 3TKQA 3KMOA 1GWCA 1EP7A 1GSSA 5GAPD 2H01A 2OA7A 2I3YA 3C71A 4Z2TA 1T00A 2R6KA 4LL1B 2FHEA 1XOAA 4AKHA 4GSSA 1O6JA 1HNCA 4IQ1A 1XIYA 3FK8A 3WD6A 1EOGA 3DWVA 1YKCA 1GH2A 2C8UA 3GSTA 4TXOB 4OMVA 2EFHA 2BMXA 3G7IA 2GSQA 4O5QA 5KEJA 1S4BP 3DYRA 2JZSA 3TKSC 3QDNA 1SJIA 3GRXA 2IFQA 2WFCA 10GSA 1PFOA 1R4WA 5AIVA 1SENA 3EPTA 1DE2A 3HVSA 5DCHA 2FWGA 2H1BA 1MEKA 2NVLA 4OFNA 3ZMKA 2JACA 4IJIA 1GNWA 3QFBC 5JWQB 2WDUA 2VUPA 4GXZA 2WVXB 2QGVA 2PVOC 2YCDA 1NHYA 7GSSA 2HE3A 5ID2B 18GSA 1TI3A 5CRWA 3GTUA 4IS0A 3GV1A 4G0IA 1PN9A 2R4VA 2PGTA 4BL7B 2C0GA 4N11A 3LYKA 1F6MC 4XIHA 1U3IA 2AAWA 2JSZA 1ZMAA 4LMWA 4P3YB 1THOA 2DJ0A 3S9FA 3EE2A 3F4SA 4OCEA 4WBRD 3VK9A 2VM2A 2CAQA 3H79A 3F9UA 4ZXGA 3L4NA 1G6YA 1XOBA 4MZCA 5C00A 2G2QA 4EIPA 2KP2A 5A4WA 5EY6A 3VI5A 5DBQA 2YN1A 2FD3A 3UARA 3LW9A 2YWIA 3HKRA 3FZ4A 13GSA 4WR5A 3UJ1A 4KSMA 1TP9A 3UL3A 3IC4A 4K1FA 3VWXA 5J9BA 2H8LA 3NZNA 4JE1A 3D0ZA 3ZLPA 1A24A 3TJBA 4MH2A 4PUFC 3QCPA 1XWCA 4K5SA 2HZFA 1M9AA 5A5HA 2DIYA 1GTAA 2ON5A 2VOCA 3ZVJA 2IMDA 5CNWA 2HLSA 4KA0A 3TRQA 4V1Ap 3VPTA 1O73A 3M1GA 3RAZA 1OKDA 4GRFA 5F0GA 4NPBA 3DVXA 2GQKA 1CQHA 4IBPA 1Z7RA 3HJPA 1V2AA 3IBHA 1SVLA 3LJRA 2V6KA 3CXGA 3QMXA 4PI2C 2B5YA 2TRXA 4K2XA 2E0QA 1JLWA 1TRUA 1M2AA 2G0FA 2EFEA 3J7Yb 3LEFA 5B6MA 3MYDA 4BWQA 1KTEA 1A2JA 6GSUA 3UAPA 4PNFA 5CRDA 4G19A 4ZIJA 3I6AA 2FWEA 4XS6A 2HZEB 4KW6A 1SKRB 4TXOA 2GZYA 2OE3A 4I8BA 3W6GA 1XCCA 5G1LA 4J56E 8GSSA 5ECLB 2R0GA 2WS2A 14GSA 2LJKA 4AI6A 1O8WA 4FYUA 3RPNA 4I2TA 1TRSA 4TRXA 2A4HA 1LU4A 2GLRA 4HS1A 3J7Yk 5G5FA 4HSCX 5DJMA 1USBA 2WVXA 3DMLA 1WIKA 2AUVA 1EZKA 1OC9B 3LORA 1J9BA 1FO5A 4ZB7A 5ID2A 5ECSA 4GDFA 20GSA 2JADA 1K0NA
chains in the Genus database with same CATH topology
4BL7A 4NMUA 3EMXA 3W8SA 2V1MA 5ECQB 2LEGA 5DALA 1EGRA 1CQGA 3ZREA 4AKIA 5F07A 3GL5A 1GUMA 2LV3A 1PSQA 2B3SA 2PMTA 4EUYA 5CRGA 3TJGA 5D9TA 3KH9A 1SYRA 2IN3A 4TR3A 4O5RA 1ML6A 4O92A 3ZL5A 1NM3A 4PURA 5HQPA 2KOKA 3UVHA 5H5RA 4ECIA 3L78A 1AAZA 1QQ2A 1TDIA 3KMNA 3U6VA 3TUEA 1GL8A 2VLTA 3F63A 12GSA 3KXOA 1OC3A 4WETA 3F6FA 1F9MA 3DRNA 3TKSE 3KTLA 3UOMA 3UVTA 1T4ZA 3D5JA 2HNLA 4IP1A 1V40A 3WGXA 1A2LA 3MIXA 3DD3A 1QMVA 1WP0A 3APQA 2FNOA 1RW1A 2HRFA 2I81A 3GIXA 2RM5A 4K0NA 4MF5A 4Z2UA 2FUG2 2C3QA 1VGLA 2RUFA 1QFNA 2OBKA 2YWMA 2VAFA 5D93A 4AF2A 3BCIA 1SKSB 4G0LA 3ED3A 3DVWA 1TTZA 2O7KA 1F3AA 3MAKA 2GTUA 1PMTA 4GLTA 1A2MA 2GT6A 2M80A 1N2AA 2HZEA 2CAIA 1Q98A 4BVYA 4FIWA 2KHPA 1T8EB 5D9VA 1BG5A 5ECMB 3APOA 1X9SB 3P2AA 1FHEA 1GSEA 3KM6A 5EVOA 3D4MA 2E7PA 4JR6A 2DBCA 5IOWA 3GKNA 4ML1A 2MYGA 3IXRA 4L5OA 4PXOA 1XVQA 4MLYA 1ILOA 2VM1A 2OJLA 4K7IA 3PR8A 1PKWA 1SK0A 4EDZA 5BRTA 3P8WA 5F06A 5G5EA 4HDEA 1GNEA 3IK7A 4XRDA 4J2FA 3TKSA 4G9HA 2HSMB 5D9XA 1GSQA 3U5RE 3W8JA 4ACSA 3C73A 4TR1B 1Y6EA 2CVDA 1PL1A 3GFKA 3MDKA 1EWXA 1T4YA 2WRTA 2C0FA 1X9MB 1VF3A 3GYKA 3KD0A 3ME7A 2JL4A 2V6OA 2PERA 2GQLA 2HYXA 4EKZA 5EPFA 5IMZA 3KJYA 2L57A 2N5AA 3UEMA 2HRNA 1WRYA 2LRTA 2LNTA 5A1NA 2LQQA 4GSTA 4K9ZA 2VD1A 3CRUA 5D96A 3ZYWA 4XTSA 2RIIA 1PQNA 3C8EA 2F8FA 4HQZA 1W4VA 1BG1A 2EIQA 4CY6A 4JBBA 1I5GA 1YEPA 4MZWA 2ES7A 4GQCA 3CSHA 3TRPA 4NV5A 2GQMA 4TOPA 1YF0A 1M9BA 1XWGA 3D4TA 1GSDA 3EURA 5CAXA 1TU7A 4WF4A 4NV2A 3ZFLA 5KOXA 5DCGA 2VIMA 1DSBA 4KCAA 4WXTA 4IVFA 2L59A 5AISA 4POLA 1BF5A 2VCTA 3FMWA 1H4OA 2O89A 2K6VA 4HOJA 2JSYA 3VURA 4KGIA 4KB3A 2IPAA 5INYA 1GUKA 3DXBA 3TGZA 5IMDA 1AC1A 3IK9A 1K3YA 4O32A 1JHBA 3GA4A 4FYCA 2JU5A 2MMAA 5L71A 4Q5NA 3VWWA 5GAND 4DSRA 3F0IA 3IC8A 4KDUA 1PRXA 2P5QA 1ABAA 1XPVA 2WB9A 4XS1A 4ULXA 4O5UA 2F51A 2GZPA 1G7EA 1VRSD 1RK4A 2QKEA 1FG4A 3UIWA 3UBKA 2PU9C 3SBCA 1K3OA 1OE8A 22GSA 3ZMLA 2AHEA 2FWFA 4ZL9A 4DSQA 2FWHA 2RUEA 5ECOB 4XCSA 3GKXA 3F6DA 1YDKA 3CYNA 5ENUA 4OWYA 5KOWA 1MDJA 3EU3A 4H86A 4XHMA 2H0HA 5JCWA 5ECHB 2A4VA 2LRCA 3ERGA 2OBIA 1TK0B 3HXSA 4BA7A 3Q18A 1JLVA 1OC8A 1ZYEA 3QFAC 2FLSA 5J47A 2VO4A 4NHZA 4L0UA 5DALB 1YKAA 2IL3A 1M2BA 3VLNA 2DJJA 1SD9A 1UN2A 3L9SA 3ERFA 3FRCA 2L4CA 2HSMA 4ECCA 1BEDA 4ID0A 2DMLA 1A0RP 2PWJA 4KCEA 4K2DA 2H0GA 4TR1A 2QC7A 3G7JA 1X5DA 2VLUA 5E59A 2DKIA 5DJLA 1B4QA 2IIYA 1O85A 1Q4JA 4GQFA 5CP1A 5IPGA 4ECBA 3EWLA 4EE0A 3QAWA 4K6XA 1YEXA 3GH6A 1FVJA 2X4AA 2C0EA 1TW9A 2EIRA 2A2PA 2H1LA 3A2WA 5ECKB 2YANA 3MNGA 1Z6NA 2B5XA 2GSRA 5D73A 1S3AA 4POMA 2FA8A 5A4UA 5H5SA 3IV4A 5DAKB 4L0WA 1K0MA 1SL2B 4PUAA 3PINA 4KUNA 3G7YA 3GMFA 4TN8A 5BMUA 4E68A 2V41A 4IELA 4X4JA 4ZL7A 4IKHA 1FAAA 2TIRA 4AJ8A 2D2ZA 1OE7A 2CX4A 3M3MA 3LXZA 5HR2A 5IMCA 1SL0B 3HDCA 1S3DA 3ERWA 16GSA 4CHSA 1U3AA 5FHIA 3H1NA 5KN2A 1W89A 2MMNA 3FR3A 3R2QA 2I9HA 1T7PB 5FWGA 2B7JA 5B7CA 2GT5A 2ZUPA 1XXUA 2C3NA 2EFDA 5EL8A 4BPYA 4G01A 1N8JA 4BVYB 3BD2A 1THXA 1SJZA 3I69A 3KP8A 5DVBA 4FYBA 4MK3A 5J3RA 3PGTA 3TRXA 4NXIA 3M9JA 2X8GA 4FQUA 1X0RA 2R2JA 4W66A 3A3TA 2O5VA 1TRWA 1PA3A 1WJKA 1TKDB 2R0CA 2LS5A 3EMPA 3GKKA 2HQTA 4GWRA 1QUWA 1GTBA 2KUCA 5G2ZA 2XBIA 11GSA 1K0OA 2H6YA 5G31A 3HZ4A 1B8XA 2L5OA 3ZRDA 2J9HA 2WZ9A 4AJ6A 2P5RA 3FEUA 4N30A 1XWAA 2QSIA 5GSTA 1O7UA 4K7OA 3K8NA 4QL9A 1TXXA 2LQOA 1B48A 3GKMA 4KSOA 3D22A 3LFLA 3GSSA 4QL7A 1M0UA 1FB0A 1SD8A 1GULA 4MH3A 3L9UA 3CBUA 5F05A 5A1NB 2XPDA 1E6BA 4TR4A 2H1DA 2DLXA 4EIQA 3FR9A 4RI7A 1EEJA 1GUHA 2EC4A 2TRCP 4GF0A 3CWGA 3ZVJD 2LKUA 5CREA 3EINA 2LTKA 1SKWB 2EFCA 5HFKA 4KNDA 1NW2A 4MPGA 3BOAA 4PQ1A 3HHVA 2P0GA 1Z5YE 5ECNB 4MP4A 2N5BA 2ALBA 2V32A 4PGTA 3EVIA 1YJ6A 3L9VA 3H8QA 2YWNA 3LXTA 1TK8B 5ECPB 4JU5A 1ZCPA 5H5QA 3SWLA 2H1AA 1XW9A 2HRKA 4OCFA 3TU3B 4G2EA 1BYEA 5HR1A 3O6TA 1UC7A 4N3ZA 4XS4A 1ZOFA 3TJJA 4WEYA 3LYPA 5COHA 6GSYA 1TK5B 2H70A 4LA1A 5DAKA 4KDXA 2PUKC 2VL2A 5J4YA 4MABA 4F9ZA 3I43A 2H30A 5G30A 5HR0A 2OACA 2GS3A 2VCZA 3PPUA 2NBSA 2BJXA 1XWKA 3IAS2 2BTOT 2L4QA 2GSTA 4AKXB 4PTSA 1A8YA 1AW9A 3CMIA 4LMVA 5LCZA 4EL1A 4Z2RA 3LGCA 3ZITA 6GSWA 1J08A 2H66A 3IDVA 3FW2A 4EF0A 4YQVA 3CRTA 2HXKA 4JRRA 4IGJA 4YKFA 3HJOA 2H0IA 2MZCA 1MDIA 4LL4B 3WGDA 4NAXA 2OT3A 4I2UA 4G10A 4PQIA 2OKAA 4F82A 4JZQA 4AKGA 1JZOA 3TJKA 1HNAA 2H71A 4KAEA 4RQXA 1U87A 5AN1A 4HI7A 3M9KA 5KN3A 5JCGA 9GSSA 4V1Ag 5E4WA 4Z7XA 1HNBA 3LQ7A 1Z3EA 3TKRA 3L0HA 4Q5RA 2L6DA 2R37A 3IOSA 2IJYA 2HSYA 5IMAA 1WE0A 1JZDA 2DMMA 1G6WA 5JWRB 4N10A 2C3TA 1YF1A 1K0AA 4FH8A 1DUGA 1SVOA 4E8EA 3RHCA 4D73B 3F3QA 2A2SA 2UZ8A 2HSNB 1R26A 3RPPA 2XPEA 3IRAA 2H6XA 2HI7A 1MD3A 2WULA 2ON7A 4TXVA 4HJ2A 2AV4A 3HMJG 19GSA 4YAPA 4NHWA 1XZOA 3DGQA 1M99A 4N0VA 5A4VA 2VCQA 2VL3A 3VWUA 4A5PA 3E3EA 1OYJA 3LSZA 3MWHA 5JCUA 2YWOA 1XW5A 3C1SA 4YQUA 4MJCA 5BMUB 4RQRA 2PN8A 2AYTA 3V1WA 3TOTA 5ECIB 4KH7A 2YZUA 3QOUA 2X49A 1VF2A 3TCOA 3DEXA 4ML6A 1GP1A 2RLIA 5B8AA 1XVWA 3E9JB 4V2MA 3APSA 1ERUA 4TW5A 4E8HA 1LJRA 1G7OA 1MD4A 3BCKA 2B1LA 1Y1UA 1XFLA 3FZ5A 4ILFA 3I9V2 1OAZA 2H6ZA 1ZZYA 6GSXA 5J41A 2X99A 5LD0A 2B7KA 1K0BA 3WGEA 2C80A 2ZNMA 4BVXB 1PD21 1AQWA 3A2VA 1UVZA 3VI7A 3GL3A 4I5QA 2P31A 2C4JA 5CRHA 17GSA 4F03A 4FO5A 4ZB8A 1FB6A 5AIXA 1PX7A 1XBSA 4MJEA 3WT2A 2FY6A 2QA1A 3RBTA 2GGTA 2R0PA 5ELAA 2R3XA 2DJ2A 4KE3A 3KIJA 5IM9A 2IMIA 1PX6A 2VCVA 3VWVA 4Q5FA 3RDWA 3IR4A 3HD5A 1AQVA 2I4AA 2DJKA 3ZTLA 3GX0A 4KX4A 2FA4A 1IYIA 2NTOA 3HVXA 2MBSA 3KEBA 2PVQA 2LJAA 1C72A 1FW1A 2GSSA 2VKZG 4OD7A 2LSTA 1H75A 1EV9A 2E2MA 5JWOB 4AGSA 6GSSA 1RQMA 4WR4A 1JZWA 4IQAA 2H76A 1LBKA 3Q74A 2CVBA 1ACVA 2ZCTA 3P90A 1J0FA 3BJ5A 1BJXA 1JZRA 4F0BA 4MF7A 2JZRA 4ZB6A 1T1VA 4EVMA 5HR3A 3FR6A 2IMEA 1O81A 1YY7A 1QXHA 1B9YC 2GZZA 4EXJA 1NHOA 1ST9A 2AB6A 1Y25A 5F8BA 3OR5A 1M7TA 3A5IA 3TKPA 1EP8A 4HZ4A 3NOFA 2B6MA 5IQYA 4G0KA 2NDOA 3HJMA 1I9DA 2H72A 1R5AA 4PQHA 1MTCA 3HVVA 1QK8A 1UA5A 2QA2A 1EGOA 3H93A 2HRKB 1ERTA 4D73A 5A34A 3EC3A 1WMJA 3HCZA 4GSNA 2HSNA 3ME8A 3KTBA 2PBJA 2K9FA 2CA8A 4XS4B 1WOUA 5IMFA 2DSAA 5IIZA 2IMKA 5DQSA 4X1UA 1GSYA 3AY8A 3QPMA 4ISDA 1R7HA 4IW9A 3ZZXA 1GLPA 2H19A 1EEMA 1F3BA 2O8VB 2OADA 3KCMA 2O85A 2HSHA 4BWSA 3GURA 4ZB9A 2K8SA 3IE3A 2WCIA 1PKZA 2UV8G 3Q19A 2XBQA 4USSA 5HFGA 1URMA 4I6XA 2VD0A 4MPFA 3TDGA 6GSVA 4JEDA 3A2XA 4WBJA 4HUAA 3FKFA 2GDRA 5J9CA 1ZGNA 2Z9SA 3KH7A 4LLRA 1JFUA 4J57E 3N9JA 1GLQA 2L5LA 3F4TA 4YKGA 1VF4A 4K0GA 2RM6A 1FVKA 3GUSA 1AXDA 1U88A 2CV4A 3ISOA 2CQ9A 1F37A 2HFDA 1X5EA 2X8HA 3D21A 4HZ2A 2V2GA 4BVXA 4L8EA 4EDYA 2HT9A 2KLXA 2DIZA 1X9WB 1V9WA 1B9XC 5D8IA 3TB2A 5J5NA 2H75A 3QR6A 3G9BA 4MMMA 5B8BA 1R5PA 4MA9A 4DSSB 2CZ3A 5KN1A 2WJUA 4GCIA 3DIEA 2VLVA 4HU9A 5CO3A 5DDLA 2CT6A 2X64A 4IP6A 3EYTA 3BBYA 1ZYQB 3FZ9A 1K0CA 2J23A 2F8AA 4K7NA 1F2EA 3F4RA 3WT1A 2IMFA 1HQOA 4IJ3A 3VFIA 3DKSA 2FGXA 1GRXA 1OKTA 1M2DA 4OFMA 1AQXA 5AGYA 1XWBA 3US3A 3N5OA 1SVMA 3ZIVA 1Z9HA 2GVPA 1A8LA 4X0XA 5G1KA 1U6TA 1PGTA 1SJ6A 4X43A 5ABRA 2E2GA 4KF9A 4ZBBA 1NSWA 1A0FA 1KBNA 2YZHA 2MBTA 1YVLA 3LG6A 3RHBA 4ZILA 5IPHA 3MSZA 5C04A 4V2NA 4XRAA 1XW6A 1OVNA 4HU7A 3CTFA 1A23A 6GSTA 4IN0A 4POBA 1ZYNA 4MJAA 1ZL9A 4YAVA 2O87A 2YV7A 3E0UA 3FY7A 1SU9A 4I97A 2N5FA 4CDOA 4RUVA 2AJQB 1SL1B 4DEJA 2EIOA 4HEA2 1BAYA 1WPIA 1TOFA 3CSJA 1BQ7A 3IHGA 2LJRA 3R3EA 1FOVA 3GHAA 1T3BA 1GSUA 1GTIA 4EC0A 1SYXA 3GN3A 1Z6MA 5LNKe 4MF6A 5GSSA 3HY2A 4K8MA 1HD2A 3A5WA 1K0DA 1O8XA 2HRAA 1AIUA 4EO3A 2DKHA 3IHQA 2LNSA 1DBYA 3D6IA 4MJBA 5J40A 3JCML 4ZL8A 1ERWA 3EU4A 1V98A 5HFIA 3C1RA 2PPTA 1DE1A 1FOHA 2REMA 1SK1A 1G0TA 2XC2A 4TVEA 2DC5A 1YQ1A 3F3RA 3O3TA 5CYYA 5DQYA 3KP9A 1EOHA 1TRVA 2CX3A 5IOXA 3UMAA 2YP6A 3FZAA 4IHUA 2IFQB 3WYWA 4N0ZA 3QD9A 2CZ2A 3KZQA 4KDYA 2MMZA 2OE1A 5B6NA 2H74A 4RI6A 5ELGA 4ZBDA 3QAGA 5A5KA 3FHKA 2JZTA 2LUSA 4JR4A 3IA1A 3HZ8A 3M0FA 1N25A 1IYHA 2K18A 1TJDA 2F3MA 2VCXA 3HYPA 1EV4A 2FCHA 3NIVA 3CTGA 2KP1A 5D9WA 2DJ1A 4F0CA 1ZYPA 2B5EA 2YPMA 4TKYA 1GSFA 3PH9A 3GTUB 3GX8A 5IO2A 2VL9A 5IMVA 4QMKA 4DSSA 2M72A 2F9SA 3QAVA 3CSIA 4L5LA 2K8VA 4F2IA 5GZZB 4HQSA 4O7HA 5J4VA 3TOUA 4YH2A 2VCWA 1AUCA 3KGKA 1E2YA 2NPBA 2YJHA 1S3CA 4WF5A 4GTUA 2B1KA 2YNXA 3IAM2 1ERVA 1BX9A 2C1YA 2DJ3A 4ICYA 3ZIJA 2CVKA 3ZFBA 5KN0A 1GTUA 2YJ7A 5A34B 1TU8A 1OC9A 1SK2A 5ECRB 4ECJA 1KEBA 3GH9A 3TJFA 1MDKA 2WGRA 4WKWA 4Q5QA 4NWYA 4V2LA 5IO0A 3Q6OA 2LRNA 2H73A 4MZBA 4YQMA 4OO4A 1V57A 4MCUA 2L6CA 3GNJA 2A2RA 1QGVA 2YOIA 5FT3A 2M46A 1VF1A 3FYGA 1TXUA 2VL2C 5A5HB 1TI1A 3O76A 1ON4A 1V58A 4OFTA 2XHFA 2YV9A 3UBLA 1Z7PA 4TR0A 2H1GA 5J4UA 4OO5A 1HYUA 4K5RA 4MNNA 3IPZA 1B4PA 2R5GA 3C7MA 3HA9A 4ZBAA 1K3LA 1KNGA 4CY8A 3M8NA 1PL2A 4PNGA 4AJ7A 2MMOA 2OE0A 3VPQA 2I1UA 4CW9A 2C0DA 4HJMA 4QQ7A 1X5CA 1PN0A 1WWJA 4MDCA 1YZXA 3LWAA 4PX1A 4DVCA 4POKA 3H4KA 3F8UA 2IWTA 3P7XA 2X8CA 3TKQA 3KMOA 1GWCA 1EP7A 1GSSA 5GAPD 2H01A 2OA7A 2I3YA 3C71A 4Z2TA 1T00A 2R6KA 4LL1B 2FHEA 1XOAA 4AKHA 4GSSA 1O6JA 1HNCA 4IQ1A 1XIYA 3FK8A 3WD6A 1EOGA 3DWVA 1YKCA 1GH2A 2C8UA 3GSTA 4TXOB 4OMVA 2EFHA 2BMXA 3G7IA 2GSQA 4O5QA 5KEJA 3DYRA 2JZSA 3TKSC 3QDNA 1SJIA 3GRXA 2IFQA 2WFCA 10GSA 1R4WA 5AIVA 1SENA 3EPTA 1DE2A 3HVSA 5DCHA 2FWGA 2H1BA 1MEKA 2NVLA 4OFNA 3ZMKA 2JACA 4IJIA 1GNWA 3QFBC 5JWQB 2WDUA 2VUPA 4GXZA 2QGVA 2PVOC 2YCDA 1NHYA 7GSSA 2HE3A 5ID2B 18GSA 1TI3A 5CRWA 3GTUA 4IS0A 3GV1A 4G0IA 1PN9A 2R4VA 2PGTA 4BL7B 2C0GA 4N11A 3LYKA 1F6MC 4XIHA 1U3IA 2AAWA 2JSZA 1ZMAA 4LMWA 4P3YB 1THOA 2DJ0A 3S9FA 3EE2A 3F4SA 4OCEA 4WBRD 3VK9A 2VM2A 2CAQA 3H79A 3F9UA 4ZXGA 3L4NA 1G6YA 1XOBA 4MZCA 5C00A 2G2QA 4EIPA 2KP2A 5A4WA 5EY6A 3VI5A 5DBQA 2YN1A 2FD3A 3UARA 3LW9A 2YWIA 3HKRA 3FZ4A 13GSA 4WR5A 3UJ1A 4KSMA 1TP9A 3UL3A 3IC4A 4K1FA 3VWXA 5J9BA 2H8LA 3NZNA 4JE1A 3D0ZA 3ZLPA 1A24A 3TJBA 4MH2A 4PUFC 3QCPA 1XWCA 4K5SA 2HZFA 1M9AA 5A5HA 2DIYA 1GTAA 2ON5A 2VOCA 3ZVJA 2IMDA 5CNWA 2HLSA 4KA0A 3TRQA 4V1Ap 3VPTA 1O73A 3M1GA 3RAZA 1OKDA 4GRFA 5F0GA 4NPBA 3DVXA 2GQKA 1CQHA 4IBPA 1Z7RA 3HJPA 1V2AA 3IBHA 1SVLA 3LJRA 2V6KA 3CXGA 3QMXA 2B5YA 2TRXA 4K2XA 2E0QA 1JLWA 1TRUA 1M2AA 2G0FA 2EFEA 3J7Yb 3LEFA 5B6MA 3MYDA 4BWQA 1KTEA 1A2JA 6GSUA 3UAPA 4PNFA 5CRDA 4G19A 4ZIJA 3I6AA 2FWEA 4XS6A 2HZEB 4KW6A 1SKRB 4TXOA 2GZYA 2OE3A 4I8BA 3W6GA 1XCCA 5G1LA 4J56E 8GSSA 5ECLB 2R0GA 2WS2A 14GSA 2LJKA 4AI6A 1O8WA 4FYUA 3RPNA 4I2TA 1TRSA 4TRXA 2A4HA 1LU4A 2GLRA 4HS1A 3J7Yk 5G5FA 5DJMA 1USBA 3DMLA 1WIKA 2AUVA 1EZKA 1OC9B 3LORA 1J9BA 1FO5A 4ZB7A 5ID2A 5ECSA 4GDFA 20GSA 2JADA 1K0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL7 A;  4NMU A;  3EMX A;  3W8S A;  2V1M A;  5ECQ B;  2LEG A;  5DAL A;  1EGR A;  1CQG A;  3ZRE A;  5F07 A;  3GL5 A;  1GUM A;  2LV3 A;  1PSQ A;  2B3S A;  2PMT A;  4EUY A;  5CRG A;  3TJG A;  5D9T A;  3KH9 A;  1SYR A;  2IN3 A;  4TR3 A;  4O5R A;  1ML6 A;  4O92 A;  3ZL5 A;  1NM3 A;  4PUR A;  5HQP A;  2KOK A;  3UVH A;  5H5R A;  4ECI A;  3L78 A;  1AAZ A;  1QQ2 A;  1TDI A;  3KMN A;  3U6V A;  3TUE A;  1GL8 A;  2VLT A;  3F63 A;  12GS A;  3KXO A;  1OC3 A;  4WET A;  3F6F A;  1F9M A;  3DRN A;  3TKS E;  3KTL A;  3UOM A;  3UVT A;  1T4Z A;  3D5J A;  2HNL A;  4IP1 A;  1V40 A;  3WGX A;  1A2L A;  3DD3 A;  1QMV A;  1WP0 A;  3APQ A;  2FNO A;  1RW1 A;  2HRF A;  2I81 A;  3GIX A;  2RM5 A;  4K0N A;  4MF5 A;  2FUG 2;  2C3Q A;  1VGL A;  2RUF A;  1QFN A;  2OBK A;  2YWM A;  2VAF A;  5D93 A;  4AF2 A;  3BCI A;  1SKS B;  4G0L A;  3ED3 A;  3DVW A;  1TTZ A;  2O7K A;  1F3A A;  3MAK A;  2GTU A;  1PMT A;  4GLT A;  1A2M A;  2GT6 A;  2M80 A;  1N2A A;  2HZE A;  4FIW A;  2CAI A;  4BVY A;  1Q98 A;  2KHP A;  1T8E B;  5D9V A;  1BG5 A;  5ECM B;  3APO A;  1X9S B;  3P2A A;  1FHE A;  1GSE A;  3KM6 A;  5EVO A;  3D4M A;  2E7P A;  4JR6 A;  2DBC A;  5IOW A;  3GKN A;  4ML1 A;  2MYG A;  3IXR A;  4L5O A;  4PXO A;  1XVQ A;  4MLY A;  1ILO A;  2VM1 A;  2OJL A;  4K7I A;  3PR8 A;  1PKW A;  1SK0 A;  4EDZ A;  3P8W A;  5F06 A;  5G5E A;  4HDE A;  1GNE A;  3IK7 A;  4XRD A;  4J2F A;  3TKS A;  4G9H A;  2HSM B;  5D9X A;  1GSQ A;  3U5R E;  3W8J A;  4ACS A;  3C73 A;  4TR1 B;  1Y6E A;  2CVD A;  1PL1 A;  3GFK A;  3MDK A;  1EWX A;  1T4Y A;  2WRT A;  2C0F A;  1X9M B;  1VF3 A;  3GYK A;  3KD0 A;  3ME7 A;  2JL4 A;  2V6O A;  2PER A;  2GQL A;  2HYX A;  4EKZ A;  5EPF A;  5IMZ A;  3KJY A;  2L57 A;  2N5A A;  3UEM A;  2HRN A;  1WRY A;  2LRT A;  2LNT A;  2LQQ A;  4GST A;  4K9Z A;  2VD1 A;  3CRU A;  5D96 A;  3ZYW A;  4XTS A;  2RII A;  1PQN A;  3C8E A;  2F8F A;  4HQZ A;  1W4V A;  2EIQ A;  4JBB A;  1I5G A;  1YEP A;  4MZW A;  2ES7 A;  4GQC A;  3CSH A;  3TRP A;  4NV5 A;  2GQM A;  4TOP A;  1YF0 A;  1M9B A;  1XWG A;  3D4T A;  1GSD A;  3EUR A;  5CAX A;  1TU7 A;  4WF4 A;  4NV2 A;  3ZFL A;  5DCG A;  2VIM A;  1DSB A;  4KCA A;  4WXT A;  4IVF A;  2L59 A;  5AIS A;  4POL A;  2VCT A;  1H4O A;  2O89 A;  2K6V A;  4HOJ A;  2JSY A;  3VUR A;  4KGI A;  4KB3 A;  2IPA A;  5INY A;  1GUK A;  3DXB A;  3TGZ A;  5IMD A;  1AC1 A;  3IK9 A;  1K3Y A;  4O32 A;  1JHB A;  3GA4 A;  4FYC A;  2JU5 A;  2MMA A;  5L71 A;  4Q5N A;  3VWW A;  5GAN D;  4DSR A;  3F0I A;  3IC8 A;  4KDU A;  1PRX A;  2P5Q A;  1ABA A;  1XPV A;  2WB9 A;  4XS1 A;  4ULX A;  2F51 A;  2GZP A;  1G7E A;  1VRS D;  1RK4 A;  2QKE A;  1FG4 A;  3UIW A;  3UBK A;  2PU9 C;  3SBC A;  1K3O A;  1OE8 A;  22GS A;  3ZML A;  2AHE A;  2FWF A;  4ZL9 A;  4DSQ A;  2FWH A;  2RUE A;  5ECO B;  4XCS A;  3GKX A;  3F6D A;  1YDK A;  3CYN A;  5ENU A;  4OWY A;  1MDJ A;  3EU3 A;  4H86 A;  4XHM A;  2H0H A;  5JCW A;  5ECH B;  2A4V A;  2LRC A;  3ERG A;  2OBI A;  1TK0 B;  3HXS A;  4BA7 A;  3Q18 A;  1JLV A;  1OC8 A;  1ZYE A;  3QFA C;  2FLS A;  2VO4 A;  4NHZ A;  4L0U A;  5DAL B;  1YKA A;  2IL3 A;  1M2B A;  3VLN A;  2DJJ A;  1SD9 A;  1UN2 A;  3L9S A;  3ERF A;  3FRC A;  2L4C A;  2HSM A;  4ECC A;  1BED A;  4ID0 A;  2DML A;  1A0R P;  2PWJ A;  4KCE A;  4K2D A;  2H0G A;  4TR1 A;  2QC7 A;  3G7J A;  1X5D A;  2VLU A;  5E59 A;  5DJL A;  1B4Q A;  2IIY A;  1O85 A;  1Q4J A;  4GQF A;  5CP1 A;  5IPG A;  4ECB A;  3EWL A;  4EE0 A;  3QAW A;  4K6X A;  1YEX A;  3GH6 A;  1FVJ A;  2C0E A;  1TW9 A;  2EIR A;  3A2W A;  5ECK B;  2YAN A;  3MNG A;  1Z6N A;  2B5X A;  2GSR A;  5D73 A;  1S3A A;  4POM A;  2FA8 A;  5A4U A;  5H5S A;  3IV4 A;  5DAK B;  4L0W A;  1K0M A;  1SL2 B;  4PUA A;  3PIN A;  4KUN A;  3G7Y A;  3GMF A;  4TN8 A;  5BMU A;  2V41 A;  4IEL A;  4ZL7 A;  4IKH A;  1FAA A;  2TIR A;  4AJ8 A;  2D2Z A;  1OE7 A;  2CX4 A;  3M3M A;  3LXZ A;  5HR2 A;  5IMC A;  1SL0 B;  3HDC A;  1S3D A;  3ERW A;  16GS A;  4CHS A;  1U3A A;  5FHI A;  3H1N A;  5KN2 A;  1W89 A;  2MMN A;  3FR3 A;  3R2Q A;  2I9H A;  1T7P B;  5FWG A;  2B7J A;  5B7C A;  2GT5 A;  2ZUP A;  1XXU A;  2C3N A;  5EL8 A;  4BPY A;  1N8J A;  4BVY B;  3BD2 A;  1THX A;  1SJZ A;  3I69 A;  3KP8 A;  5DVB A;  4FYB A;  4MK3 A;  5J3R A;  3PGT A;  3TRX A;  4NXI A;  3M9J A;  2X8G A;  4FQU A;  1X0R A;  2R2J A;  3A3T A;  1TRW A;  1PA3 A;  1WJK A;  1TKD B;  2LS5 A;  3EMP A;  3GKK A;  2HQT A;  4GWR A;  1QUW A;  1GTB A;  2KUC A;  5G2Z A;  2XBI A;  11GS A;  1K0O A;  2H6Y A;  5G31 A;  3HZ4 A;  1B8X A;  2L5O A;  3ZRD A;  2J9H A;  2WZ9 A;  4AJ6 A;  2P5R A;  3FEU A;  4N30 A;  1XWA A;  2QSI A;  5GST A;  1O7U A;  4K7O A;  3K8N A;  4QL9 A;  1TXX A;  2LQO A;  1B48 A;  3GKM A;  4KSO A;  3D22 A;  3LFL A;  3GSS A;  4QL7 A;  1M0U A;  1FB0 A;  1SD8 A;  1GUL A;  4MH3 A;  3L9U A;  3CBU A;  5F05 A;  2XPD A;  1E6B A;  4TR4 A;  2H1D A;  2DLX A;  3FR9 A;  4RI7 A;  1EEJ A;  1GUH A;  2EC4 A;  2TRC P;  4GF0 A;  3ZVJ D;  2LKU A;  5CRE A;  3EIN A;  2LTK A;  1SKW B;  5HFK A;  4KND A;  1NW2 A;  4MPG A;  3BOA A;  4PQ1 A;  3HHV A;  2P0G A;  1Z5Y E;  5ECN B;  4MP4 A;  2N5B A;  2ALB A;  2V32 A;  4PGT A;  3EVI A;  1YJ6 A;  3L9V A;  3H8Q A;  2YWN A;  3LXT A;  1TK8 B;  5ECP B;  4JU5 A;  1ZCP A;  5H5Q A;  3SWL A;  2H1A A;  1XW9 A;  2HRK A;  4OCF A;  4G2E A;  1BYE A;  5HR1 A;  3O6T A;  1UC7 A;  4XS4 A;  1ZOF A;  3TJJ A;  4WEY A;  3LYP A;  5COH A;  6GSY A;  1TK5 B;  2H70 A;  4LA1 A;  5DAK A;  4KDX A;  2PUK C;  2VL2 A;  4MAB A;  4F9Z A;  3I43 A;  2H30 A;  5G30 A;  5HR0 A;  2OAC A;  2GS3 A;  2VCZ A;  3PPU A;  2NBS A;  2BJX A;  1XWK A;  2BTO T;  2L4Q A;  3IAS 2;  2GST A;  4PTS A;  1A8Y A;  1AW9 A;  3CMI A;  4LMV A;  5LCZ A;  4EL1 A;  3LGC A;  3ZIT A;  6GSW A;  1J08 A;  2H66 A;  3IDV A;  3FW2 A;  4EF0 A;  4YQV A;  3CRT A;  2HXK A;  4JRR A;  4IGJ A;  3HJO A;  2H0I A;  2MZC A;  1MDI A;  4LL4 B;  3WGD A;  4NAX A;  4I2U A;  4G10 A;  4PQI A;  2OKA A;  4F82 A;  4JZQ A;  1JZO A;  3TJK A;  1HNA A;  2H71 A;  4KAE A;  4RQX A;  1U87 A;  5AN1 A;  4HI7 A;  3M9K A;  5KN3 A;  5JCG A;  9GSS A;  4V1A g;  5E4W A;  4Z7X A;  1HNB A;  3LQ7 A;  1Z3E A;  3TKR A;  3L0H A;  4Q5R A;  2L6D A;  2R37 A;  3IOS A;  2IJY A;  2HSY A;  5IMA A;  1WE0 A;  1JZD A;  2DMM A;  1G6W A;  5JWR B;  4N10 A;  2C3T A;  1YF1 A;  1K0A A;  4FH8 A;  1DUG A;  4E8E A;  3RHC A;  4D73 B;  3F3Q A;  2A2S A;  2UZ8 A;  2HSN B;  1R26 A;  3RPP A;  2XPE A;  3IRA A;  2H6X A;  2HI7 A;  1MD3 A;  2WUL A;  2ON7 A;  4TXV A;  4HJ2 A;  2AV4 A;  19GS A;  4YAP A;  4NHW A;  1XZO A;  3DGQ A;  1M99 A;  4N0V A;  5A4V A;  2VCQ A;  2VL3 A;  3VWU A;  3E3E A;  1OYJ A;  3LSZ A;  3MWH A;  5JCU A;  2YWO A;  1XW5 A;  3C1S A;  4YQU A;  4MJC A;  4RQR A;  2PN8 A;  2AYT A;  3V1W A;  3TOT A;  5ECI B;  4KH7 A;  2YZU A;  3QOU A;  1VF2 A;  3TCO A;  3DEX A;  4ML6 A;  1GP1 A;  2RLI A;  5B8A A;  1XVW A;  3E9J B;  4V2M A;  3APS A;  1ERU A;  4TW5 A;  4E8H A;  1LJR A;  1G7O A;  1MD4 A;  3BCK A;  2B1L A;  1XFL A;  3FZ5 A;  4ILF A;  3I9V 2;  1OAZ A;  2H6Z A;  1ZZY A;  6GSX A;  5J41 A;  2X99 A;  5LD0 A;  2B7K A;  1K0B A;  3WGE A;  2C80 A;  2ZNM A;  4BVX B;  1PD2 1;  1AQW A;  3A2V A;  1UVZ A;  3VI7 A;  3GL3 A;  4I5Q A;  2P31 A;  2C4J A;  5CRH A;  17GS A;  4F03 A;  4FO5 A;  4ZB8 A;  1FB6 A;  5AIX A;  1PX7 A;  1XBS A;  4MJE A;  3WT2 A;  2FY6 A;  3RBT A;  2GGT A;  5ELA A;  2R3X A;  2DJ2 A;  4KE3 A;  3KIJ A;  5IM9 A;  2IMI A;  1PX6 A;  2VCV A;  3VWV A;  4Q5F A;  3RDW A;  3IR4 A;  3HD5 A;  1AQV A;  2I4A A;  2DJK A;  3ZTL A;  3GX0 A;  4KX4 A;  2FA4 A;  1IYI A;  2NTO A;  3HVX A;  2MBS A;  3KEB A;  2PVQ A;  2LJA A;  1C72 A;  1FW1 A;  2GSS A;  4OD7 A;  2LST A;  1H75 A;  1EV9 A;  2E2M A;  5JWO B;  4AGS A;  6GSS A;  1RQM A;  4WR4 A;  1JZW A;  4IQA A;  2H76 A;  1LBK A;  3Q74 A;  2CVB A;  1ACV A;  2ZCT A;  3P90 A;  1J0F A;  3BJ5 A;  1BJX A;  1JZR A;  4F0B A;  4MF7 A;  2JZR A;  4ZB6 A;  1T1V A;  4EVM A;  5HR3 A;  3FR6 A;  2IME A;  1O81 A;  1YY7 A;  1QXH A;  1B9Y C;  2GZZ A;  4EXJ A;  1NHO A;  1ST9 A;  2AB6 A;  1Y25 A;  5F8B A;  3OR5 A;  1M7T A;  3TKP A;  1EP8 A;  4HZ4 A;  3NOF A;  2B6M A;  5IQY A;  4G0K A;  2NDO A;  3HJM A;  1I9D A;  2H72 A;  1R5A A;  4PQH A;  1MTC A;  3HVV A;  1QK8 A;  1UA5 A;  1EGO A;  3H93 A;  2HRK B;  1ERT A;  4D73 A;  3EC3 A;  1WMJ A;  3HCZ A;  4GSN A;  3ME8 A;  3KTB A;  2PBJ A;  2K9F A;  2CA8 A;  4XS4 B;  1WOU A;  5IMF A;  2DSA A;  5IIZ A;  2IMK A;  5DQS A;  4X1U A;  1GSY A;  3AY8 A;  3QPM A;  4ISD A;  1R7H A;  4IW9 A;  3ZZX A;  1GLP A;  2H19 A;  1EEM A;  1F3B A;  2O8V B;  2OAD A;  2O85 A;  3KCM A;  2HSH A;  4BWS A;  3GUR A;  4ZB9 A;  2K8S A;  3IE3 A;  2WCI A;  1PKZ A;  3Q19 A;  2XBQ A;  4USS A;  5HFG A;  1URM A;  4I6X A;  2VD0 A;  4MPF A;  3TDG A;  6GSV A;  4JED A;  3A2X A;  4WBJ A;  4HUA A;  3FKF A;  2GDR A;  5J9C A;  1ZGN A;  2Z9S A;  3KH7 A;  4LLR A;  1JFU A;  4J57 E;  3N9J A;  1GLQ A;  2L5L A;  3F4T A;  1VF4 A;  4K0G A;  2RM6 A;  1FVK A;  3GUS A;  1AXD A;  1U88 A;  2CV4 A;  3ISO A;  2CQ9 A;  1F37 A;  2HFD A;  1X5E A;  2X8H A;  3D21 A;  4HZ2 A;  2V2G A;  4BVX A;  4L8E A;  4EDY A;  2HT9 A;  2KLX A;  2DIZ A;  1X9W B;  1V9W A;  1B9X C;  5D8I A;  3TB2 A;  5J5N A;  2H75 A;  3QR6 A;  3G9B A;  4MMM A;  5B8B A;  1R5P A;  4MA9 A;  4DSS B;  2CZ3 A;  5KN1 A;  2WJU A;  4GCI A;  3DIE A;  2VLV A;  4HU9 A;  5CO3 A;  5DDL A;  2CT6 A;  2X64 A;  4IP6 A;  3EYT A;  3BBY A;  1ZYQ B;  3FZ9 A;  1K0C A;  2J23 A;  2F8A A;  4K7N A;  1F2E A;  3F4R A;  3WT1 A;  2IMF A;  1HQO A;  4IJ3 A;  3VFI A;  3DKS A;  2FGX A;  1GRX A;  1OKT A;  1M2D A;  4OFM A;  1AQX A;  5AGY A;  1XWB A;  3US3 A;  3N5O A;  3ZIV A;  1Z9H A;  2GVP A;  1A8L A;  4X0X A;  5G1K A;  1U6T A;  1PGT A;  1SJ6 A;  4X43 A;  5ABR A;  2E2G A;  4KF9 A;  4ZBB A;  1NSW A;  1A0F A;  1KBN A;  2YZH A;  2MBT A;  3LG6 A;  3RHB A;  4ZIL A;  5IPH A;  3MSZ A;  5C04 A;  4V2N A;  4XRA A;  1XW6 A;  1OVN A;  4HU7 A;  3CTF A;  1A23 A;  6GST A;  4IN0 A;  4POB A;  4MJA A;  1ZL9 A;  4YAV A;  2O87 A;  2YV7 A;  3E0U A;  3FY7 A;  1SU9 A;  4I97 A;  2N5F A;  4CDO A;  4RUV A;  2AJQ B;  1SL1 B;  4DEJ A;  2EIO A;  4HEA 2;  1BAY A;  1WPI A;  1TOF A;  3CSJ A;  1BQ7 A;  2LJR A;  3R3E A;  1FOV A;  3GHA A;  1T3B A;  1GSU A;  1GTI A;  4EC0 A;  1SYX A;  3GN3 A;  1Z6M A;  5LNK e;  4MF6 A;  5GSS A;  3HY2 A;  4K8M A;  1HD2 A;  3A5W A;  1K0D A;  1O8X A;  2HRA A;  1AIU A;  4EO3 A;  3IHQ A;  2LNS A;  1DBY A;  3D6I A;  4MJB A;  3JCM L;  4ZL8 A;  1ERW A;  3EU4 A;  1V98 A;  5HFI A;  3C1R A;  2PPT A;  1DE1 A;  2REM A;  1SK1 A;  1G0T A;  2XC2 A;  4TVE A;  2DC5 A;  1YQ1 A;  3F3R A;  3O3T A;  5CYY A;  5DQY A;  3KP9 A;  1EOH A;  1TRV A;  2CX3 A;  5IOX A;  3UMA A;  2YP6 A;  3FZA A;  4IHU A;  2IFQ B;  3WYW A;  4N0Z A;  3QD9 A;  2CZ2 A;  3KZQ A;  4KDY A;  2MMZ A;  2OE1 A;  5B6N A;  2H74 A;  4RI6 A;  5ELG A;  4ZBD A;  3QAG A;  5A5K A;  3FHK A;  2JZT A;  2LUS A;  4JR4 A;  3IA1 A;  3HZ8 A;  3M0F A;  1IYH A;  2K18 A;  1TJD A;  2F3M A;  2VCX A;  3HYP A;  1EV4 A;  2FCH A;  3NIV A;  3CTG A;  2KP1 A;  5D9W A;  2DJ1 A;  4F0C A;  2B5E A;  2YPM A;  4TKY A;  1GSF A;  3PH9 A;  3GTU B;  3GX8 A;  5IO2 A;  2VL9 A;  5IMV A;  4DSS A;  2M72 A;  2F9S A;  3QAV A;  3CSI A;  4L5L A;  2K8V A;  4F2I A;  5GZZ B;  4HQS A;  4O7H A;  3TOU A;  4YH2 A;  2VCW A;  1AUC A;  3KGK A;  1E2Y A;  2NPB A;  2YJH A;  1S3C A;  4WF5 A;  4GTU A;  2B1K A;  2YNX A;  3IAM 2;  1ERV A;  1BX9 A;  2C1Y A;  2DJ3 A;  3ZIJ A;  2CVK A;  3ZFB A;  5KN0 A;  1GTU A;  2YJ7 A;  1TU8 A;  1OC9 A;  1SK2 A;  5ECR B;  4ECJ A;  1KEB A;  3GH9 A;  3TJF A;  1MDK A;  2WGR A;  4WKW A;  4Q5Q A;  4NWY A;  4V2L A;  5IO0 A;  3Q6O A;  2LRN A;  2H73 A;  4MZB A;  4YQM A;  4OO4 A;  1V57 A;  4MCU A;  2L6C A;  3GNJ A;  2A2R A;  1QGV A;  2YOI A;  5FT3 A;  2M46 A;  1VF1 A;  3FYG A;  2VL2 C;  1TI1 A;  3O76 A;  1ON4 A;  1V58 A;  4OFT A;  2XHF A;  2YV9 A;  3UBL A;  1Z7P A;  4TR0 A;  2H1G A;  5J4U A;  4OO5 A;  1HYU A;  3IPZ A;  1B4P A;  2R5G A;  3C7M A;  3HA9 A;  4ZBA A;  1K3L A;  1KNG A;  3M8N A;  1PL2 A;  4PNG A;  4AJ7 A;  2MMO A;  2OE0 A;  3VPQ A;  2I1U A;  4CW9 A;  2C0D A;  4HJM A;  4QQ7 A;  1X5C A;  1WWJ A;  4MDC A;  1YZX A;  3LWA A;  4PX1 A;  4DVC A;  4POK A;  3H4K A;  3F8U A;  2IWT A;  3P7X A;  2X8C A;  3TKQ A;  3KMO A;  1GWC A;  1EP7 A;  1GSS A;  5GAP D;  2H01 A;  2OA7 A;  2I3Y A;  3C71 A;  1T00 A;  2R6K A;  4LL1 B;  2FHE A;  1XOA A;  4GSS A;  1O6J A;  1HNC A;  4IQ1 A;  1XIY A;  3FK8 A;  3WD6 A;  1EOG A;  3DWV A;  1YKC A;  1GH2 A;  2C8U A;  3GST A;  4TXO B;  4OMV A;  2BMX A;  3G7I A;  2GSQ A;  5KEJ A;  3DYR A;  2JZS A;  3TKS C;  3QDN A;  1SJI A;  3GRX A;  2IFQ A;  2WFC A;  10GS A;  1R4W A;  5AIV A;  1SEN A;  1DE2 A;  3HVS A;  5DCH A;  2FWG A;  2H1B A;  1MEK A;  2NVL A;  4OFN A;  3ZMK A;  2JAC A;  4IJI A;  1GNW A;  3QFB C;  5JWQ B;  2WDU A;  2VUP A;  4GXZ A;  2QGV A;  2PVO C;  2YCD A;  1NHY A;  7GSS A;  2HE3 A;  5ID2 B;  18GS A;  1TI3 A;  5CRW A;  3GTU A;  4IS0 A;  3GV1 A;  4G0I A;  1PN9 A;  2R4V A;  2PGT A;  4BL7 B;  2C0G A;  4N11 A;  3LYK A;  1F6M C;  4XIH A;  1U3I A;  2AAW A;  2JSZ A;  1ZMA A;  4LMW A;  4P3Y B;  1THO A;  2DJ0 A;  3S9F A;  3EE2 A;  3F4S A;  4OCE A;  4WBR D;  3VK9 A;  2VM2 A;  2CAQ A;  3H79 A;  3F9U A;  4ZXG A;  3L4N A;  1G6Y A;  1XOB A;  4MZC A;  5C00 A;  2G2Q A;  2KP2 A;  5A4W A;  5EY6 A;  3VI5 A;  5DBQ A;  2YN1 A;  2FD3 A;  3UAR A;  2YWI A;  3HKR A;  3FZ4 A;  13GS A;  4WR5 A;  3UJ1 A;  4KSM A;  1TP9 A;  3UL3 A;  3IC4 A;  4K1F A;  3VWX A;  5J9B A;  2H8L A;  3NZN A;  4JE1 A;  3D0Z A;  3ZLP A;  1A24 A;  3TJB A;  4MH2 A;  4PUF C;  3QCP A;  1XWC A;  2HZF A;  1M9A A;  2DIY A;  1GTA A;  2ON5 A;  2VOC A;  3ZVJ A;  2IMD A;  5CNW A;  2HLS A;  4KA0 A;  3TRQ A;  4V1A p;  3VPT A;  1O73 A;  3M1G A;  3RAZ A;  1OKD A;  4GRF A;  5F0G A;  4NPB A;  3DVX A;  2GQK A;  1CQH A;  4IBP A;  1Z7R A;  3HJP A;  1V2A A;  3IBH A;  3LJR A;  2V6K A;  3CXG A;  3QMX A;  2B5Y A;  2TRX A;  2E0Q A;  1JLW A;  1TRU A;  1M2A A;  2G0F A;  3J7Y b;  3LEF A;  5B6M A;  4BWQ A;  1KTE A;  1A2J A;  6GSU A;  3UAP A;  4PNF A;  5CRD A;  4G19 A;  4ZIJ A;  3I6A A;  2FWE A;  4XS6 A;  2HZE B;  4KW6 A;  1SKR B;  4TXO A;  2GZY A;  2OE3 A;  4I8B A;  3W6G A;  1XCC A;  5G1L A;  4J56 E;  8GSS A;  5ECL B;  2WS2 A;  14GS A;  2LJK A;  1O8W A;  4FYU A;  3RPN A;  4I2T A;  1TRS A;  4TRX A;  1LU4 A;  2GLR A;  4HS1 A;  3J7Y k;  5G5F A;  5DJM A;  1USB A;  3DML A;  1WIK A;  2AUV A;  1EZK A;  1OC9 B;  3LOR A;  1J9B A;  1FO5 A;  5ID2 A;  5ECS A;  20GS A;  2JAD A;  1K0N A; 
#chains in the Genus database with same CATH topology
 4BL7 A;  4NMU A;  3EMX A;  3W8S A;  2V1M A;  5ECQ B;  2LEG A;  5DAL A;  1EGR A;  1CQG A;  3ZRE A;  4AKI A;  5F07 A;  3GL5 A;  1GUM A;  2LV3 A;  1PSQ A;  2B3S A;  2PMT A;  4EUY A;  5CRG A;  3TJG A;  5D9T A;  3KH9 A;  1SYR A;  2IN3 A;  4TR3 A;  4O5R A;  1ML6 A;  4O92 A;  3ZL5 A;  1NM3 A;  4PUR A;  5HQP A;  2KOK A;  3UVH A;  5H5R A;  4ECI A;  3L78 A;  1AAZ A;  1QQ2 A;  1TDI A;  3KMN A;  3U6V A;  3TUE A;  1GL8 A;  2VLT A;  3F63 A;  12GS A;  3KXO A;  1OC3 A;  4WET A;  3F6F A;  1F9M A;  3DRN A;  3TKS E;  3KTL A;  3UOM A;  3UVT A;  1T4Z A;  3D5J A;  2HNL A;  4IP1 A;  1V40 A;  3WGX A;  1A2L A;  3MIX A;  3DD3 A;  1QMV A;  1WP0 A;  3APQ A;  2FNO A;  1RW1 A;  2HRF A;  3CQF A;  2I81 A;  3GIX A;  2RM5 A;  4K0N A;  4MF5 A;  4Z2U A;  2FUG 2;  2C3Q A;  1VGL A;  2RUF A;  1QFN A;  2OBK A;  2YWM A;  2VAF A;  5D93 A;  4AF2 A;  3BCI A;  1SKS B;  4G0L A;  3ED3 A;  3DVW A;  1TTZ A;  2O7K A;  1F3A A;  4FXY P;  3MAK A;  2GTU A;  1PMT A;  4GLT A;  1A2M A;  2GT6 A;  2M80 A;  1N2A A;  2HZE A;  2CAI A;  1Q98 A;  4BVY A;  4FIW A;  2KHP A;  1T8E B;  5D9V A;  1BG5 A;  5ECM B;  3APO A;  1X9S B;  3P2A A;  1FHE A;  1GSE A;  3KM6 A;  5EVO A;  3D4M A;  2E7P A;  4JR6 A;  1YEW C;  2DBC A;  5IOW A;  3GKN A;  4ML1 A;  2MYG A;  3IXR A;  4L5O A;  4PXO A;  1XVQ A;  4MLY A;  1ILO A;  2VM1 A;  2OJL A;  4K7I A;  3PR8 A;  1PKW A;  1SK0 A;  4EDZ A;  5BRT A;  3P8W A;  5F06 A;  5G5E A;  4HDE A;  1GNE A;  3IK7 A;  4XRD A;  4J2F A;  3TKS A;  4G9H A;  2HSM B;  5D9X A;  2O3E A;  1GSQ A;  3U5R E;  3W8J A;  4ACS A;  3C73 A;  4TR1 B;  1Y6E A;  2CVD A;  1PL1 A;  3GFK A;  3MDK A;  1EWX A;  1T4Y A;  2WRT A;  2C0F A;  1X9M B;  1VF3 A;  3GYK A;  3KD0 A;  3ME7 A;  2JL4 A;  2V6O A;  2PER A;  2GQL A;  2HYX A;  4EKZ A;  5EPF A;  5IMZ A;  3KJY A;  2L57 A;  2N5A A;  3UEM A;  2HRN A;  1WRY A;  2LRT A;  2LNT A;  5A1N A;  2LQQ A;  4GST A;  4K9Z A;  2VD1 A;  3CRU A;  5D96 A;  3ZYW A;  4XTS A;  2RII A;  1PQN A;  3C8E A;  2F8F A;  4HQZ A;  1W4V A;  1BG1 A;  2EIQ A;  4CY6 A;  4JBB A;  1I5G A;  1YEP A;  4MZW A;  2ES7 A;  4GQC A;  2WW2 A;  3CSH A;  3TRP A;  4NV5 A;  2GQM A;  4TOP A;  1YF0 A;  1M9B A;  1XWG A;  3D4T A;  1GSD A;  3EUR A;  5CAX A;  1TU7 A;  4WF4 A;  4NV2 A;  3ZFL A;  5KOX A;  5DCG A;  2VIM A;  1DSB A;  4KCA A;  4WXT A;  4IVF A;  2L59 A;  5AIS A;  4POL A;  1BF5 A;  2VCT A;  3FMW A;  1H4O A;  2O89 A;  2K6V A;  4HOJ A;  2JSY A;  3VUR A;  4KGI A;  4KB3 A;  2IPA A;  5INY A;  1GUK A;  3DXB A;  3TGZ A;  5IMD A;  1AC1 A;  3IK9 A;  1K3Y A;  4O32 A;  1JHB A;  3GA4 A;  4FYC A;  2JU5 A;  2MMA A;  5L71 A;  4Q5N A;  3VWW A;  5GAN D;  4DSR A;  3F0I A;  3IC8 A;  4KDU A;  1PRX A;  2P5Q A;  1ABA A;  1XPV A;  2WB9 A;  4XS1 A;  4ULX A;  4O5U A;  2F51 A;  2GZP A;  1G7E A;  1VRS D;  1RK4 A;  2QKE A;  1FG4 A;  3UIW A;  3UBK A;  2PU9 C;  3SBC A;  1K3O A;  1OE8 A;  22GS A;  3ZML A;  2AHE A;  2FWF A;  4ZL9 A;  4DSQ A;  2FWH A;  2RUE A;  5ECO B;  4XCS A;  3GKX A;  3F6D A;  1YDK A;  3CYN A;  1S3R A;  5ENU A;  4OWY A;  5KOW A;  1MDJ A;  3EU3 A;  4H86 A;  4XHM A;  2H0H A;  5JCW A;  5ECH B;  2A4V A;  2LRC A;  3ERG A;  2OBI A;  1TK0 B;  3HXS A;  4BA7 A;  3Q18 A;  1JLV A;  1OC8 A;  1ZYE A;  3QFA C;  2FLS A;  5J47 A;  2VO4 A;  4NHZ A;  4L0U A;  5DAL B;  1YKA A;  2IL3 A;  1M2B A;  3VLN A;  2DJJ A;  1SD9 A;  1UN2 A;  3L9S A;  3ERF A;  3FRC A;  2L4C A;  2HSM A;  4ECC A;  1BED A;  4ID0 A;  2DML A;  1A0R P;  2PWJ A;  4KCE A;  4K2D A;  2H0G A;  4TR1 A;  2QC7 A;  3G7J A;  1X5D A;  2VLU A;  5E59 A;  2DKI A;  5DJL A;  1B4Q A;  2IIY A;  1O85 A;  1Q4J A;  4GQF A;  5CP1 A;  5IPG A;  4ECB A;  3EWL A;  4EE0 A;  3QAW A;  3RFR C;  4K6X A;  1YEX A;  3HVN A;  3GH6 A;  1FVJ A;  2X4A A;  2C0E A;  1TW9 A;  2EIR A;  2A2P A;  2H1L A;  3A2W A;  5ECK B;  2YAN A;  3MNG A;  1M3J A;  1Z6N A;  2B5X A;  2GSR A;  5D73 A;  1S3A A;  4POM A;  2FA8 A;  5A4U A;  5H5S A;  3IV4 A;  5DAK B;  4L0W A;  1K0M A;  1SL2 B;  4PUA A;  3PIN A;  4KUN A;  3G7Y A;  3GMF A;  4TN8 A;  5BMU A;  4E68 A;  2V41 A;  4IEL A;  4X4J A;  4ZL7 A;  4IKH A;  1FAA A;  2TIR A;  4AJ8 A;  2D2Z A;  1OE7 A;  2CX4 A;  3M3M A;  3LXZ A;  5HR2 A;  5IMC A;  1SL0 B;  3HDC A;  4BIK A;  1S3D A;  3ERW A;  16GS A;  4CHS A;  1U3A A;  5FHI A;  3H1N A;  5KN2 A;  1W89 A;  2MMN A;  3FR3 A;  3R2Q A;  2I9H A;  1T7P B;  5FWG A;  2B7J A;  5B7C A;  2GT5 A;  2ZUP A;  1XXU A;  2C3N A;  2EFD A;  5EL8 A;  4BPY A;  4G01 A;  1N8J A;  4BVY B;  3BD2 A;  1THX A;  1SJZ A;  3I69 A;  3KP8 A;  5DVB A;  4FYB A;  4MK3 A;  5J3R A;  3PGT A;  3TRX A;  4NXI A;  3M9J A;  2X8G A;  4FQU A;  1X0R A;  2R2J A;  4W66 A;  3A3T A;  2O5V A;  1TRW A;  1PA3 A;  1WJK A;  1TKD B;  2R0C A;  2LS5 A;  3EMP A;  3GKK A;  2HQT A;  4PI0 C;  4GWR A;  1QUW A;  1GTB A;  2KUC A;  5G2Z A;  2XBI A;  11GS A;  1K0O A;  2H6Y A;  5G31 A;  3HZ4 A;  1B8X A;  2L5O A;  3ZRD A;  2J9H A;  2WZ9 A;  4AJ6 A;  2P5R A;  3FEU A;  4N30 A;  1XWA A;  2QSI A;  5GST A;  1O7U A;  4K7O A;  3K8N A;  4QL9 A;  1TXX A;  2LQO A;  1B48 A;  3GKM A;  4KSO A;  3D22 A;  3LFL A;  3GSS A;  4QL7 A;  1M0U A;  1FB0 A;  1SD8 A;  1GUL A;  4MH3 A;  3L9U A;  3CBU A;  5F05 A;  5A1N B;  2XPD A;  1E6B A;  4TR4 A;  2H1D A;  2DLX A;  4EIQ A;  3FR9 A;  4RI7 A;  1EEJ A;  1GUH A;  2EC4 A;  2TRC P;  4GF0 A;  3CWG A;  3ZVJ D;  2LKU A;  5CRE A;  3EIN A;  2LTK A;  1SKW B;  2EFC A;  5HFK A;  4KND A;  1NW2 A;  4MPG A;  3BOA A;  4PQ1 A;  3HHV A;  2P0G A;  1Z5Y E;  5ECN B;  4MP4 A;  2N5B A;  2ALB A;  2V32 A;  4PGT A;  3EVI A;  1YJ6 A;  3L9V A;  3H8Q A;  2YWN A;  3LXT A;  1TK8 B;  5ECP B;  4JU5 A;  1ZCP A;  5H5Q A;  3SWL A;  2O36 A;  2H1A A;  1XW9 A;  2HRK A;  4OCF A;  3TU3 B;  4G2E A;  1BYE A;  5HR1 A;  3O6T A;  1UC7 A;  4N3Z A;  4XS4 A;  1ZOF A;  3TJJ A;  4WEY A;  3LYP A;  5COH A;  6GSY A;  1TK5 B;  2H70 A;  4LA1 A;  5DAK A;  4KDX A;  2PUK C;  2VL2 A;  5J4Y A;  4MAB A;  4F9Z A;  3I43 A;  2H30 A;  2WZS A;  5G30 A;  5HR0 A;  2OAC A;  2GS3 A;  2VCZ A;  3PPU A;  2NBS A;  2BJX A;  1XWK A;  3IAS 2;  2BTO T;  2L4Q A;  2GST A;  4AKX B;  4PTS A;  1A8Y A;  1AW9 A;  3CMI A;  4LMV A;  5LCZ A;  4EL1 A;  4Z2R A;  3LGC A;  3ZIT A;  6GSW A;  1J08 A;  2H66 A;  3IDV A;  3FW2 A;  4EF0 A;  2WW1 A;  4YQV A;  3CRT A;  2HXK A;  4JRR A;  4IGJ A;  4YKF A;  3HJO A;  2H0I A;  2MZC A;  1MDI A;  4LL4 B;  3WGD A;  4NAX A;  2OT3 A;  4I2U A;  4G10 A;  4PQI A;  2OKA A;  4F82 A;  4JZQ A;  4AKG A;  1JZO A;  3TJK A;  1HNA A;  2H71 A;  4KAE A;  4RQX A;  1U87 A;  5AN1 A;  4HI7 A;  3M9K A;  5KN3 A;  5JCG A;  9GSS A;  4V1A g;  5E4W A;  4Z7X A;  1HNB A;  3LQ7 A;  1Z3E A;  3TKR A;  3L0H A;  4Q5R A;  2L6D A;  2R37 A;  3IOS A;  2IJY A;  2HSY A;  5IMA A;  1WE0 A;  1JZD A;  2DMM A;  1G6W A;  5JWR B;  4N10 A;  2C3T A;  1YF1 A;  1K0A A;  4FH8 A;  2WW3 A;  1DUG A;  1SVO A;  4E8E A;  3RHC A;  4D73 B;  3F3Q A;  2A2S A;  2UZ8 A;  2HSN B;  1R26 A;  3RPP A;  2XPE A;  3IRA A;  2H6X A;  2HI7 A;  1MD3 A;  2WUL A;  2ON7 A;  4TXV A;  4HJ2 A;  2AV4 A;  3HMJ G;  19GS A;  4YAP A;  4NHW A;  1XZO A;  3DGQ A;  1M99 A;  4N0V A;  5A4V A;  2VCQ A;  2VL3 A;  3VWU A;  4A5P A;  3E3E A;  1OYJ A;  3LSZ A;  3MWH A;  5JCU A;  2YWO A;  1XW5 A;  3C1S A;  4YQU A;  4MJC A;  5BMU B;  4RQR A;  2PN8 A;  2AYT A;  3V1W A;  3TOT A;  5ECI B;  4KH7 A;  2YZU A;  3QOU A;  2X49 A;  1VF2 A;  3TCO A;  3DEX A;  4ML6 A;  1GP1 A;  2RLI A;  5B8A A;  1XVW A;  3E9J B;  4V2M A;  3APS A;  1ERU A;  4TW5 A;  4E8H A;  1LJR A;  1G7O A;  1MD4 A;  3BCK A;  2B1L A;  1Y1U A;  1XFL A;  3FZ5 A;  4ILF A;  3I9V 2;  1OAZ A;  2H6Z A;  1ZZY A;  6GSX A;  5J41 A;  2X99 A;  5LD0 A;  2B7K A;  1K0B A;  3WGE A;  2C80 A;  2ZNM A;  4BVX B;  1PD2 1;  1AQW A;  3A2V A;  1UVZ A;  3VI7 A;  3GL3 A;  4I5Q A;  2P31 A;  2C4J A;  5CRH A;  17GS A;  4F03 A;  4FO5 A;  4ZB8 A;  1FB6 A;  5AIX A;  1PX7 A;  1XBS A;  4MJE A;  3WT2 A;  2FY6 A;  2QA1 A;  3RBT A;  2GGT A;  2R0P A;  5ELA A;  2R3X A;  2DJ2 A;  4KE3 A;  3KIJ A;  5IM9 A;  2IMI A;  1PX6 A;  2VCV A;  3VWV A;  4Q5F A;  3RDW A;  3IR4 A;  3HD5 A;  1AQV A;  2I4A A;  2DJK A;  3ZTL A;  3GX0 A;  4KX4 A;  4PHZ C;  2FA4 A;  1IYI A;  2NTO A;  3HVX A;  2MBS A;  3KEB A;  2PVQ A;  2LJA A;  1C72 A;  1FW1 A;  2GSS A;  2VKZ G;  4OD7 A;  2LST A;  1H75 A;  1EV9 A;  2E2M A;  5JWO B;  4AGS A;  6GSS A;  1RQM A;  4WR4 A;  1JZW A;  4IQA A;  2H76 A;  1LBK A;  3Q74 A;  2CVB A;  1ACV A;  2ZCT A;  3P90 A;  1J0F A;  3BJ5 A;  1BJX A;  1JZR A;  4F0B A;  4MF7 A;  2JZR A;  4ZB6 A;  1T1V A;  4EVM A;  5HR3 A;  3FR6 A;  2IME A;  1O81 A;  1YY7 A;  1QXH A;  1B9Y C;  2GZZ A;  4EXJ A;  1NHO A;  1ST9 A;  2AB6 A;  1Y25 A;  5F8B A;  3OR5 A;  1M7T A;  3A5I A;  3TKP A;  1EP8 A;  4HZ4 A;  3NOF A;  2B6M A;  5IQY A;  4G0K A;  2NDO A;  3HJM A;  1I9D A;  2H72 A;  1R5A A;  4PQH A;  1MTC A;  3HVV A;  1QK8 A;  1UA5 A;  2QA2 A;  1EGO A;  3H93 A;  2HRK B;  1ERT A;  4D73 A;  5A34 A;  3EC3 A;  1WMJ A;  3HCZ A;  4GSN A;  2HSN A;  3ME8 A;  3KTB A;  2PBJ A;  2K9F A;  2CA8 A;  4XS4 B;  1WOU A;  5IMF A;  2DSA A;  5IIZ A;  2IMK A;  5DQS A;  4X1U A;  1GSY A;  3AY8 A;  3QPM A;  4ISD A;  1R7H A;  4IW9 A;  3ZZX A;  1XG8 A;  1GLP A;  2H19 A;  1EEM A;  1F3B A;  2O8V B;  2OAD A;  3KCM A;  2O85 A;  2HSH A;  4BWS A;  3GUR A;  4ZB9 A;  2K8S A;  3IE3 A;  2WCI A;  1PKZ A;  2UV8 G;  3Q19 A;  2XBQ A;  4USS A;  5HFG A;  1URM A;  4I6X A;  2VD0 A;  4MPF A;  3TDG A;  6GSV A;  4JED A;  3A2X A;  4WBJ A;  4HUA A;  3FKF A;  2GDR A;  5J9C A;  1ZGN A;  2Z9S A;  3KH7 A;  4LLR A;  1JFU A;  4J57 E;  3N9J A;  1GLQ A;  2L5L A;  3F4T A;  4YKG A;  1VF4 A;  4K0G A;  2RM6 A;  1FVK A;  3GUS A;  1AXD A;  1U88 A;  2CV4 A;  3ISO A;  2CQ9 A;  1F37 A;  2HFD A;  1X5E A;  2X8H A;  3D21 A;  4HZ2 A;  2V2G A;  4BVX A;  4L8E A;  4EDY A;  2HT9 A;  2KLX A;  2DIZ A;  1X9W B;  1V9W A;  1B9X C;  1I1I P;  5D8I A;  3TB2 A;  5J5N A;  2H75 A;  3QR6 A;  3G9B A;  4MMM A;  5B8B A;  1R5P A;  4MA9 A;  4DSS B;  2CZ3 A;  5KN1 A;  2WJU A;  4GCI A;  3DIE A;  2VLV A;  4HU9 A;  5CO3 A;  5DDL A;  3CHX C;  2CT6 A;  2X64 A;  4IP6 A;  3EYT A;  3BBY A;  1ZYQ B;  3FZ9 A;  1K0C A;  2J23 A;  2F8A A;  4K7N A;  1F2E A;  3F4R A;  3WT1 A;  2IMF A;  1HQO A;  4IJ3 A;  3VFI A;  3DKS A;  2FGX A;  1GRX A;  1OKT A;  1M2D A;  4OFM A;  1AQX A;  5AGY A;  1XWB A;  3US3 A;  3N5O A;  1SVM A;  3ZIV A;  1Z9H A;  2GVP A;  1A8L A;  4X0X A;  5G1K A;  1U6T A;  1PGT A;  1SJ6 A;  4X43 A;  5ABR A;  2E2G A;  4KF9 A;  4ZBB A;  1NSW A;  1A0F A;  1KBN A;  2YZH A;  2MBT A;  1YVL A;  3LG6 A;  3RHB A;  4ZIL A;  5IPH A;  3MSZ A;  5C04 A;  4V2N A;  4XRA A;  1XW6 A;  1OVN A;  4HU7 A;  3CTF A;  1A23 A;  6GST A;  4IN0 A;  4POB A;  1ZYN A;  4MJA A;  1ZL9 A;  4YAV A;  2O87 A;  2YV7 A;  3E0U A;  3FY7 A;  1SU9 A;  4I97 A;  2N5F A;  4CDO A;  4RUV A;  2AJQ B;  1SL1 B;  4DEJ A;  2EIO A;  4HEA 2;  1BAY A;  1WPI A;  1TOF A;  3CSJ A;  1BQ7 A;  3IHG A;  2LJR A;  3R3E A;  1FOV A;  3GHA A;  1T3B A;  1GSU A;  1GTI A;  4EC0 A;  1SYX A;  3GN3 A;  1Z6M A;  5LNK e;  4MF6 A;  5GSS A;  3HY2 A;  4K8M A;  1HD2 A;  3A5W A;  1K0D A;  2WW0 A;  1O8X A;  2HRA A;  1AIU A;  4EO3 A;  2DKH A;  3IHQ A;  2LNS A;  1DBY A;  3D6I A;  4MJB A;  5J40 A;  3JCM L;  4ZL8 A;  1ERW A;  3EU4 A;  1V98 A;  5HFI A;  3C1R A;  2PPT A;  1DE1 A;  1FOH A;  2REM A;  1SK1 A;  1G0T A;  2XC2 A;  4TVE A;  2DC5 A;  1YQ1 A;  3F3R A;  3O3T A;  5CYY A;  5DQY A;  3KP9 A;  1EOH A;  1TRV A;  2CX3 A;  5IOX A;  3UMA A;  2YP6 A;  3FZA A;  4IHU A;  2IFQ B;  3WYW A;  4N0Z A;  3QD9 A;  2CZ2 A;  3KZQ A;  4KDY A;  2MMZ A;  2OE1 A;  5B6N A;  2H74 A;  4RI6 A;  5ELG A;  4ZBD A;  3QAG A;  5A5K A;  3FHK A;  2JZT A;  2LUS A;  4JR4 A;  3IA1 A;  3HZ8 A;  3M0F A;  1N25 A;  1IYH A;  2K18 A;  1TJD A;  3RGB C;  2F3M A;  2VCX A;  3HYP A;  1EV4 A;  2FCH A;  3NIV A;  3CTG A;  2KP1 A;  5D9W A;  2DJ1 A;  4F0C A;  1ZYP A;  2B5E A;  2YPM A;  4TKY A;  1GSF A;  3PH9 A;  3GTU B;  3GX8 A;  5IO2 A;  2VL9 A;  5IMV A;  2WVZ A;  4QMK A;  4DSS A;  2M72 A;  2F9S A;  3QAV A;  3CSI A;  4L5L A;  2K8V A;  4F2I A;  5GZZ B;  4HQS A;  4O7H A;  5J4V A;  3TOU A;  4YH2 A;  2VCW A;  1AUC A;  2WVY A;  3KGK A;  1E2Y A;  2NPB A;  2YJH A;  1S3C A;  4WF5 A;  4GTU A;  2B1K A;  2YNX A;  3IAM 2;  1ERV A;  1BX9 A;  2C1Y A;  2DJ3 A;  4ICY A;  3ZIJ A;  2CVK A;  3ZFB A;  5KN0 A;  1GTU A;  2YJ7 A;  5A34 B;  1TU8 A;  1OC9 A;  1SK2 A;  5ECR B;  4ECJ A;  1KEB A;  3GH9 A;  3TJF A;  1MDK A;  2WGR A;  4WKW A;  4Q5Q A;  4NWY A;  4V2L A;  5IO0 A;  3Q6O A;  2LRN A;  2H73 A;  4MZB A;  4YQM A;  4OO4 A;  1V57 A;  4MCU A;  2L6C A;  3GNJ A;  2A2R A;  1QGV A;  2YOI A;  5FT3 A;  2M46 A;  1VF1 A;  3FYG A;  1TXU A;  2VL2 C;  5A5H B;  1TI1 A;  3O76 A;  1ON4 A;  1V58 A;  4OFT A;  1M3I A;  2XHF A;  2YV9 A;  3UBL A;  1Z7P A;  4TR0 A;  2H1G A;  5J4U A;  4OO5 A;  1HYU A;  4K5R A;  4MNN A;  3IPZ A;  1B4P A;  2R5G A;  3C7M A;  3HA9 A;  4ZBA A;  1K3L A;  1KNG A;  4CY8 A;  3M8N A;  1PL2 A;  4PNG A;  4AJ7 A;  2MMO A;  2OE0 A;  3VPQ A;  2I1U A;  4CW9 A;  2C0D A;  4HJM A;  4QQ7 A;  1X5C A;  1PN0 A;  1WWJ A;  4MDC A;  1YZX A;  3LWA A;  4PX1 A;  4DVC A;  4POK A;  3H4K A;  3F8U A;  2IWT A;  3P7X A;  2X8C A;  3TKQ A;  3KMO A;  1GWC A;  1EP7 A;  1GSS A;  5GAP D;  2H01 A;  2OA7 A;  2I3Y A;  3C71 A;  4Z2T A;  1T00 A;  2R6K A;  4LL1 B;  2FHE A;  1XOA A;  4AKH A;  4GSS A;  1O6J A;  1HNC A;  4IQ1 A;  1XIY A;  3FK8 A;  3WD6 A;  1EOG A;  3DWV A;  1YKC A;  1GH2 A;  2C8U A;  3GST A;  4TXO B;  4OMV A;  2EFH A;  2BMX A;  3G7I A;  2GSQ A;  4O5Q A;  5KEJ A;  1S4B P;  3DYR A;  2JZS A;  3TKS C;  3QDN A;  1SJI A;  3GRX A;  2IFQ A;  2WFC A;  10GS A;  1PFO A;  1R4W A;  5AIV A;  1SEN A;  3EPT A;  1DE2 A;  3HVS A;  5DCH A;  2FWG A;  2H1B A;  1MEK A;  2NVL A;  4OFN A;  3ZMK A;  2JAC A;  4IJI A;  1GNW A;  3QFB C;  5JWQ B;  2WDU A;  2VUP A;  4GXZ A;  2WVX B;  2QGV A;  2PVO C;  2YCD A;  1NHY A;  7GSS A;  2HE3 A;  5ID2 B;  18GS A;  1TI3 A;  5CRW A;  3GTU A;  4IS0 A;  3GV1 A;  4G0I A;  1PN9 A;  2R4V A;  2PGT A;  4BL7 B;  2C0G A;  4N11 A;  3LYK A;  1F6M C;  4XIH A;  1U3I A;  2AAW A;  2JSZ A;  1ZMA A;  4LMW A;  4P3Y B;  1THO A;  2DJ0 A;  3S9F A;  3EE2 A;  3F4S A;  4OCE A;  4WBR D;  3VK9 A;  2VM2 A;  2CAQ A;  3H79 A;  3F9U A;  4ZXG A;  3L4N A;  1G6Y A;  1XOB A;  4MZC A;  5C00 A;  2G2Q A;  4EIP A;  2KP2 A;  5A4W A;  5EY6 A;  3VI5 A;  5DBQ A;  2YN1 A;  2FD3 A;  3UAR A;  3LW9 A;  2YWI A;  3HKR A;  3FZ4 A;  13GS A;  4WR5 A;  3UJ1 A;  4KSM A;  1TP9 A;  3UL3 A;  3IC4 A;  4K1F A;  3VWX A;  5J9B A;  2H8L A;  3NZN A;  4JE1 A;  3D0Z A;  3ZLP A;  1A24 A;  3TJB A;  4MH2 A;  4PUF C;  3QCP A;  1XWC A;  4K5S A;  2HZF A;  1M9A A;  5A5H A;  2DIY A;  1GTA A;  2ON5 A;  2VOC A;  3ZVJ A;  2IMD A;  5CNW A;  2HLS A;  4KA0 A;  3TRQ A;  4V1A p;  3VPT A;  1O73 A;  3M1G A;  3RAZ A;  1OKD A;  4GRF A;  5F0G A;  4NPB A;  3DVX A;  2GQK A;  1CQH A;  4IBP A;  1Z7R A;  3HJP A;  1V2A A;  3IBH A;  1SVL A;  3LJR A;  2V6K A;  3CXG A;  3QMX A;  4PI2 C;  2B5Y A;  2TRX A;  4K2X A;  2E0Q A;  1JLW A;  1TRU A;  1M2A A;  2G0F A;  2EFE A;  3J7Y b;  3LEF A;  5B6M A;  3MYD A;  4BWQ A;  1KTE A;  1A2J A;  6GSU A;  3UAP A;  4PNF A;  5CRD A;  4G19 A;  4ZIJ A;  3I6A A;  2FWE A;  4XS6 A;  2HZE B;  4KW6 A;  1SKR B;  4TXO A;  2GZY A;  2OE3 A;  4I8B A;  3W6G A;  1XCC A;  5G1L A;  4J56 E;  8GSS A;  5ECL B;  2R0G A;  2WS2 A;  14GS A;  2LJK A;  4AI6 A;  1O8W A;  4FYU A;  3RPN A;  4I2T A;  1TRS A;  4TRX A;  2A4H A;  1LU4 A;  2GLR A;  4HS1 A;  3J7Y k;  5G5F A;  4HSC X;  5DJM A;  1USB A;  2WVX A;  3DML A;  1WIK A;  2AUV A;  1EZK A;  1OC9 B;  3LOR A;  1J9B A;  1FO5 A;  4ZB7 A;  5ID2 A;  5ECS A;  4GDF A;  20GS A;  2JAD A;  1K0N A; 
#chains in the Genus database with same CATH homology
 4BL7 A;  4NMU A;  3EMX A;  3W8S A;  2V1M A;  5ECQ B;  2LEG A;  5DAL A;  1EGR A;  1CQG A;  3ZRE A;  4AKI A;  5F07 A;  3GL5 A;  1GUM A;  2LV3 A;  1PSQ A;  2B3S A;  2PMT A;  4EUY A;  5CRG A;  3TJG A;  5D9T A;  3KH9 A;  1SYR A;  2IN3 A;  4TR3 A;  4O5R A;  1ML6 A;  4O92 A;  3ZL5 A;  1NM3 A;  4PUR A;  5HQP A;  2KOK A;  3UVH A;  5H5R A;  4ECI A;  3L78 A;  1AAZ A;  1QQ2 A;  1TDI A;  3KMN A;  3U6V A;  3TUE A;  1GL8 A;  2VLT A;  3F63 A;  12GS A;  3KXO A;  1OC3 A;  4WET A;  3F6F A;  1F9M A;  3DRN A;  3TKS E;  3KTL A;  3UOM A;  3UVT A;  1T4Z A;  3D5J A;  2HNL A;  4IP1 A;  1V40 A;  3WGX A;  1A2L A;  3MIX A;  3DD3 A;  1QMV A;  1WP0 A;  3APQ A;  2FNO A;  1RW1 A;  2HRF A;  2I81 A;  3GIX A;  2RM5 A;  4K0N A;  4MF5 A;  4Z2U A;  2FUG 2;  2C3Q A;  1VGL A;  2RUF A;  1QFN A;  2OBK A;  2YWM A;  2VAF A;  5D93 A;  4AF2 A;  3BCI A;  1SKS B;  4G0L A;  3ED3 A;  3DVW A;  1TTZ A;  2O7K A;  1F3A A;  3MAK A;  2GTU A;  1PMT A;  4GLT A;  1A2M A;  2GT6 A;  2M80 A;  1N2A A;  2HZE A;  2CAI A;  1Q98 A;  4BVY A;  4FIW A;  2KHP A;  1T8E B;  5D9V A;  1BG5 A;  5ECM B;  3APO A;  1X9S B;  3P2A A;  1FHE A;  1GSE A;  3KM6 A;  5EVO A;  3D4M A;  2E7P A;  4JR6 A;  2DBC A;  5IOW A;  3GKN A;  4ML1 A;  2MYG A;  3IXR A;  4L5O A;  4PXO A;  1XVQ A;  4MLY A;  1ILO A;  2VM1 A;  2OJL A;  4K7I A;  3PR8 A;  1PKW A;  1SK0 A;  4EDZ A;  5BRT A;  3P8W A;  5F06 A;  5G5E A;  4HDE A;  1GNE A;  3IK7 A;  4XRD A;  4J2F A;  3TKS A;  4G9H A;  2HSM B;  5D9X A;  1GSQ A;  3U5R E;  3W8J A;  4ACS A;  3C73 A;  4TR1 B;  1Y6E A;  2CVD A;  1PL1 A;  3GFK A;  3MDK A;  1EWX A;  1T4Y A;  2WRT A;  2C0F A;  1X9M B;  1VF3 A;  3GYK A;  3KD0 A;  3ME7 A;  2JL4 A;  2V6O A;  2PER A;  2GQL A;  2HYX A;  4EKZ A;  5EPF A;  5IMZ A;  3KJY A;  2L57 A;  2N5A A;  3UEM A;  2HRN A;  1WRY A;  2LRT A;  2LNT A;  5A1N A;  2LQQ A;  4GST A;  4K9Z A;  2VD1 A;  3CRU A;  5D96 A;  3ZYW A;  4XTS A;  2RII A;  1PQN A;  3C8E A;  2F8F A;  4HQZ A;  1W4V A;  1BG1 A;  2EIQ A;  4CY6 A;  4JBB A;  1I5G A;  1YEP A;  4MZW A;  2ES7 A;  4GQC A;  3CSH A;  3TRP A;  4NV5 A;  2GQM A;  4TOP A;  1YF0 A;  1M9B A;  1XWG A;  3D4T A;  1GSD A;  3EUR A;  5CAX A;  1TU7 A;  4WF4 A;  4NV2 A;  3ZFL A;  5KOX A;  5DCG A;  2VIM A;  1DSB A;  4KCA A;  4WXT A;  4IVF A;  2L59 A;  5AIS A;  4POL A;  1BF5 A;  2VCT A;  3FMW A;  1H4O A;  2O89 A;  2K6V A;  4HOJ A;  2JSY A;  3VUR A;  4KGI A;  4KB3 A;  2IPA A;  5INY A;  1GUK A;  3DXB A;  3TGZ A;  5IMD A;  1AC1 A;  3IK9 A;  1K3Y A;  4O32 A;  1JHB A;  3GA4 A;  4FYC A;  2JU5 A;  2MMA A;  5L71 A;  4Q5N A;  3VWW A;  5GAN D;  4DSR A;  3F0I A;  3IC8 A;  4KDU A;  1PRX A;  2P5Q A;  1ABA A;  1XPV A;  2WB9 A;  4XS1 A;  4ULX A;  4O5U A;  2F51 A;  2GZP A;  1G7E A;  1VRS D;  1RK4 A;  2QKE A;  1FG4 A;  3UIW A;  3UBK A;  2PU9 C;  3SBC A;  1K3O A;  1OE8 A;  22GS A;  3ZML A;  2AHE A;  2FWF A;  4ZL9 A;  4DSQ A;  2FWH A;  2RUE A;  5ECO B;  4XCS A;  3GKX A;  3F6D A;  1YDK A;  3CYN A;  5ENU A;  4OWY A;  5KOW A;  1MDJ A;  3EU3 A;  4H86 A;  4XHM A;  2H0H A;  5JCW A;  5ECH B;  2A4V A;  2LRC A;  3ERG A;  2OBI A;  1TK0 B;  3HXS A;  4BA7 A;  3Q18 A;  1JLV A;  1OC8 A;  1ZYE A;  3QFA C;  2FLS A;  5J47 A;  2VO4 A;  4NHZ A;  4L0U A;  5DAL B;  1YKA A;  2IL3 A;  1M2B A;  3VLN A;  2DJJ A;  1SD9 A;  1UN2 A;  3L9S A;  3ERF A;  3FRC A;  2L4C A;  2HSM A;  4ECC A;  1BED A;  4ID0 A;  2DML A;  1A0R P;  2PWJ A;  4KCE A;  4K2D A;  2H0G A;  4TR1 A;  2QC7 A;  3G7J A;  1X5D A;  2VLU A;  5E59 A;  2DKI A;  5DJL A;  1B4Q A;  2IIY A;  1O85 A;  1Q4J A;  4GQF A;  5CP1 A;  5IPG A;  4ECB A;  3EWL A;  4EE0 A;  3QAW A;  4K6X A;  1YEX A;  3GH6 A;  1FVJ A;  2X4A A;  2C0E A;  1TW9 A;  2EIR A;  2A2P A;  2H1L A;  3A2W A;  5ECK B;  2YAN A;  3MNG A;  1Z6N A;  2B5X A;  2GSR A;  5D73 A;  1S3A A;  4POM A;  2FA8 A;  5A4U A;  5H5S A;  3IV4 A;  5DAK B;  4L0W A;  1K0M A;  1SL2 B;  4PUA A;  3PIN A;  4KUN A;  3G7Y A;  3GMF A;  4TN8 A;  5BMU A;  4E68 A;  2V41 A;  4IEL A;  4X4J A;  4ZL7 A;  4IKH A;  1FAA A;  2TIR A;  4AJ8 A;  2D2Z A;  1OE7 A;  2CX4 A;  3M3M A;  3LXZ A;  5HR2 A;  5IMC A;  1SL0 B;  3HDC A;  1S3D A;  3ERW A;  16GS A;  4CHS A;  1U3A A;  5FHI A;  3H1N A;  5KN2 A;  1W89 A;  2MMN A;  3FR3 A;  3R2Q A;  2I9H A;  1T7P B;  5FWG A;  2B7J A;  5B7C A;  2GT5 A;  2ZUP A;  1XXU A;  2C3N A;  2EFD A;  5EL8 A;  4BPY A;  4G01 A;  1N8J A;  4BVY B;  3BD2 A;  1THX A;  1SJZ A;  3I69 A;  3KP8 A;  5DVB A;  4FYB A;  4MK3 A;  5J3R A;  3PGT A;  3TRX A;  4NXI A;  3M9J A;  2X8G A;  4FQU A;  1X0R A;  2R2J A;  4W66 A;  3A3T A;  2O5V A;  1TRW A;  1PA3 A;  1WJK A;  1TKD B;  2R0C A;  2LS5 A;  3EMP A;  3GKK A;  2HQT A;  4GWR A;  1QUW A;  1GTB A;  2KUC A;  5G2Z A;  2XBI A;  11GS A;  1K0O A;  2H6Y A;  5G31 A;  3HZ4 A;  1B8X A;  2L5O A;  3ZRD A;  2J9H A;  2WZ9 A;  4AJ6 A;  2P5R A;  3FEU A;  4N30 A;  1XWA A;  2QSI A;  5GST A;  1O7U A;  4K7O A;  3K8N A;  4QL9 A;  1TXX A;  2LQO A;  1B48 A;  3GKM A;  4KSO A;  3D22 A;  3LFL A;  3GSS A;  4QL7 A;  1M0U A;  1FB0 A;  1SD8 A;  1GUL A;  4MH3 A;  3L9U A;  3CBU A;  5F05 A;  5A1N B;  2XPD A;  1E6B A;  4TR4 A;  2H1D A;  2DLX A;  4EIQ A;  3FR9 A;  4RI7 A;  1EEJ A;  1GUH A;  2EC4 A;  2TRC P;  4GF0 A;  3CWG A;  3ZVJ D;  2LKU A;  5CRE A;  3EIN A;  2LTK A;  1SKW B;  2EFC A;  5HFK A;  4KND A;  1NW2 A;  4MPG A;  3BOA A;  4PQ1 A;  3HHV A;  2P0G A;  1Z5Y E;  5ECN B;  4MP4 A;  2N5B A;  2ALB A;  2V32 A;  4PGT A;  3EVI A;  1YJ6 A;  3L9V A;  3H8Q A;  2YWN A;  3LXT A;  1TK8 B;  5ECP B;  4JU5 A;  1ZCP A;  5H5Q A;  3SWL A;  2H1A A;  1XW9 A;  2HRK A;  4OCF A;  3TU3 B;  4G2E A;  1BYE A;  5HR1 A;  3O6T A;  1UC7 A;  4N3Z A;  4XS4 A;  1ZOF A;  3TJJ A;  4WEY A;  3LYP A;  5COH A;  6GSY A;  1TK5 B;  2H70 A;  4LA1 A;  5DAK A;  4KDX A;  2PUK C;  2VL2 A;  5J4Y A;  4MAB A;  4F9Z A;  3I43 A;  2H30 A;  5G30 A;  5HR0 A;  2OAC A;  2GS3 A;  2VCZ A;  3PPU A;  2NBS A;  2BJX A;  1XWK A;  3IAS 2;  2BTO T;  2L4Q A;  2GST A;  4AKX B;  4PTS A;  1A8Y A;  1AW9 A;  3CMI A;  4LMV A;  5LCZ A;  4EL1 A;  4Z2R A;  3LGC A;  3ZIT A;  6GSW A;  1J08 A;  2H66 A;  3IDV A;  3FW2 A;  4EF0 A;  4YQV A;  3CRT A;  2HXK A;  4JRR A;  4IGJ A;  4YKF A;  3HJO A;  2H0I A;  2MZC A;  1MDI A;  4LL4 B;  3WGD A;  4NAX A;  2OT3 A;  4I2U A;  4G10 A;  4PQI A;  2OKA A;  4F82 A;  4JZQ A;  4AKG A;  1JZO A;  3TJK A;  1HNA A;  2H71 A;  4KAE A;  4RQX A;  1U87 A;  5AN1 A;  4HI7 A;  3M9K A;  5KN3 A;  5JCG A;  9GSS A;  4V1A g;  5E4W A;  4Z7X A;  1HNB A;  3LQ7 A;  1Z3E A;  3TKR A;  3L0H A;  4Q5R A;  2L6D A;  2R37 A;  3IOS A;  2IJY A;  2HSY A;  5IMA A;  1WE0 A;  1JZD A;  2DMM A;  1G6W A;  5JWR B;  4N10 A;  2C3T A;  1YF1 A;  1K0A A;  4FH8 A;  1DUG A;  1SVO A;  4E8E A;  3RHC A;  4D73 B;  3F3Q A;  2A2S A;  2UZ8 A;  2HSN B;  1R26 A;  3RPP A;  2XPE A;  3IRA A;  2H6X A;  2HI7 A;  1MD3 A;  2WUL A;  2ON7 A;  4TXV A;  4HJ2 A;  2AV4 A;  3HMJ G;  19GS A;  4YAP A;  4NHW A;  1XZO A;  3DGQ A;  1M99 A;  4N0V A;  5A4V A;  2VCQ A;  2VL3 A;  3VWU A;  4A5P A;  3E3E A;  1OYJ A;  3LSZ A;  3MWH A;  5JCU A;  2YWO A;  1XW5 A;  3C1S A;  4YQU A;  4MJC A;  5BMU B;  4RQR A;  2PN8 A;  2AYT A;  3V1W A;  3TOT A;  5ECI B;  4KH7 A;  2YZU A;  3QOU A;  2X49 A;  1VF2 A;  3TCO A;  3DEX A;  4ML6 A;  1GP1 A;  2RLI A;  5B8A A;  1XVW A;  3E9J B;  4V2M A;  3APS A;  1ERU A;  4TW5 A;  4E8H A;  1LJR A;  1G7O A;  1MD4 A;  3BCK A;  2B1L A;  1Y1U A;  1XFL A;  3FZ5 A;  4ILF A;  3I9V 2;  1OAZ A;  2H6Z A;  1ZZY A;  6GSX A;  5J41 A;  2X99 A;  5LD0 A;  2B7K A;  1K0B A;  3WGE A;  2C80 A;  2ZNM A;  4BVX B;  1PD2 1;  1AQW A;  3A2V A;  1UVZ A;  3VI7 A;  3GL3 A;  4I5Q A;  2P31 A;  2C4J A;  5CRH A;  17GS A;  4F03 A;  4FO5 A;  4ZB8 A;  1FB6 A;  5AIX A;  1PX7 A;  1XBS A;  4MJE A;  3WT2 A;  2FY6 A;  2QA1 A;  3RBT A;  2GGT A;  2R0P A;  5ELA A;  2R3X A;  2DJ2 A;  4KE3 A;  3KIJ A;  5IM9 A;  2IMI A;  1PX6 A;  2VCV A;  3VWV A;  4Q5F A;  3RDW A;  3IR4 A;  3HD5 A;  1AQV A;  2I4A A;  2DJK A;  3ZTL A;  3GX0 A;  4KX4 A;  2FA4 A;  1IYI A;  2NTO A;  3HVX A;  2MBS A;  3KEB A;  2PVQ A;  2LJA A;  1C72 A;  1FW1 A;  2GSS A;  2VKZ G;  4OD7 A;  2LST A;  1H75 A;  1EV9 A;  2E2M A;  5JWO B;  4AGS A;  6GSS A;  1RQM A;  4WR4 A;  1JZW A;  4IQA A;  2H76 A;  1LBK A;  3Q74 A;  2CVB A;  1ACV A;  2ZCT A;  3P90 A;  1J0F A;  3BJ5 A;  1BJX A;  1JZR A;  4F0B A;  4MF7 A;  2JZR A;  4ZB6 A;  1T1V A;  4EVM A;  5HR3 A;  3FR6 A;  2IME A;  1O81 A;  1YY7 A;  1QXH A;  1B9Y C;  2GZZ A;  4EXJ A;  1NHO A;  1ST9 A;  2AB6 A;  1Y25 A;  5F8B A;  3OR5 A;  1M7T A;  3A5I A;  3TKP A;  1EP8 A;  4HZ4 A;  3NOF A;  2B6M A;  5IQY A;  4G0K A;  2NDO A;  3HJM A;  1I9D A;  2H72 A;  1R5A A;  4PQH A;  1MTC A;  3HVV A;  1QK8 A;  1UA5 A;  2QA2 A;  1EGO A;  3H93 A;  2HRK B;  1ERT A;  4D73 A;  5A34 A;  3EC3 A;  1WMJ A;  3HCZ A;  4GSN A;  2HSN A;  3ME8 A;  3KTB A;  2PBJ A;  2K9F A;  2CA8 A;  4XS4 B;  1WOU A;  5IMF A;  2DSA A;  5IIZ A;  2IMK A;  5DQS A;  4X1U A;  1GSY A;  3AY8 A;  3QPM A;  4ISD A;  1R7H A;  4IW9 A;  3ZZX A;  1GLP A;  2H19 A;  1EEM A;  1F3B A;  2O8V B;  2OAD A;  3KCM A;  2O85 A;  2HSH A;  4BWS A;  3GUR A;  4ZB9 A;  2K8S A;  3IE3 A;  2WCI A;  1PKZ A;  2UV8 G;  3Q19 A;  2XBQ A;  4USS A;  5HFG A;  1URM A;  4I6X A;  2VD0 A;  4MPF A;  3TDG A;  6GSV A;  4JED A;  3A2X A;  4WBJ A;  4HUA A;  3FKF A;  2GDR A;  5J9C A;  1ZGN A;  2Z9S A;  3KH7 A;  4LLR A;  1JFU A;  4J57 E;  3N9J A;  1GLQ A;  2L5L A;  3F4T A;  4YKG A;  1VF4 A;  4K0G A;  2RM6 A;  1FVK A;  3GUS A;  1AXD A;  1U88 A;  2CV4 A;  3ISO A;  2CQ9 A;  1F37 A;  2HFD A;  1X5E A;  2X8H A;  3D21 A;  4HZ2 A;  2V2G A;  4BVX A;  4L8E A;  4EDY A;  2HT9 A;  2KLX A;  2DIZ A;  1X9W B;  1V9W A;  1B9X C;  5D8I A;  3TB2 A;  5J5N A;  2H75 A;  3QR6 A;  3G9B A;  4MMM A;  5B8B A;  1R5P A;  4MA9 A;  4DSS B;  2CZ3 A;  5KN1 A;  2WJU A;  4GCI A;  3DIE A;  2VLV A;  4HU9 A;  5CO3 A;  5DDL A;  2CT6 A;  2X64 A;  4IP6 A;  3EYT A;  3BBY A;  1ZYQ B;  3FZ9 A;  1K0C A;  2J23 A;  2F8A A;  4K7N A;  1F2E A;  3F4R A;  3WT1 A;  2IMF A;  1HQO A;  4IJ3 A;  3VFI A;  3DKS A;  2FGX A;  1GRX A;  1OKT A;  1M2D A;  4OFM A;  1AQX A;  5AGY A;  1XWB A;  3US3 A;  3N5O A;  1SVM A;  3ZIV A;  1Z9H A;  2GVP A;  1A8L A;  4X0X A;  5G1K A;  1U6T A;  1PGT A;  1SJ6 A;  4X43 A;  5ABR A;  2E2G A;  4KF9 A;  4ZBB A;  1NSW A;  1A0F A;  1KBN A;  2YZH A;  2MBT A;  1YVL A;  3LG6 A;  3RHB A;  4ZIL A;  5IPH A;  3MSZ A;  5C04 A;  4V2N A;  4XRA A;  1XW6 A;  1OVN A;  4HU7 A;  3CTF A;  1A23 A;  6GST A;  4IN0 A;  4POB A;  1ZYN A;  4MJA A;  1ZL9 A;  4YAV A;  2O87 A;  2YV7 A;  3E0U A;  3FY7 A;  1SU9 A;  4I97 A;  2N5F A;  4CDO A;  4RUV A;  2AJQ B;  1SL1 B;  4DEJ A;  2EIO A;  4HEA 2;  1BAY A;  1WPI A;  1TOF A;  3CSJ A;  1BQ7 A;  3IHG A;  2LJR A;  3R3E A;  1FOV A;  3GHA A;  1T3B A;  1GSU A;  1GTI A;  4EC0 A;  1SYX A;  3GN3 A;  1Z6M A;  5LNK e;  4MF6 A;  5GSS A;  3HY2 A;  4K8M A;  1HD2 A;  3A5W A;  1K0D A;  1O8X A;  2HRA A;  1AIU A;  4EO3 A;  2DKH A;  3IHQ A;  2LNS A;  1DBY A;  3D6I A;  4MJB A;  5J40 A;  3JCM L;  4ZL8 A;  1ERW A;  3EU4 A;  1V98 A;  5HFI A;  3C1R A;  2PPT A;  1DE1 A;  1FOH A;  2REM A;  1SK1 A;  1G0T A;  2XC2 A;  4TVE A;  2DC5 A;  1YQ1 A;  3F3R A;  3O3T A;  5CYY A;  5DQY A;  3KP9 A;  1EOH A;  1TRV A;  2CX3 A;  5IOX A;  3UMA A;  2YP6 A;  3FZA A;  4IHU A;  2IFQ B;  3WYW A;  4N0Z A;  3QD9 A;  2CZ2 A;  3KZQ A;  4KDY A;  2MMZ A;  2OE1 A;  5B6N A;  2H74 A;  4RI6 A;  5ELG A;  4ZBD A;  3QAG A;  5A5K A;  3FHK A;  2JZT A;  2LUS A;  4JR4 A;  3IA1 A;  3HZ8 A;  3M0F A;  1N25 A;  1IYH A;  2K18 A;  1TJD A;  2F3M A;  2VCX A;  3HYP A;  1EV4 A;  2FCH A;  3NIV A;  3CTG A;  2KP1 A;  5D9W A;  2DJ1 A;  4F0C A;  1ZYP A;  2B5E A;  2YPM A;  4TKY A;  1GSF A;  3PH9 A;  3GTU B;  3GX8 A;  5IO2 A;  2VL9 A;  5IMV A;  4QMK A;  4DSS A;  2M72 A;  2F9S A;  3QAV A;  3CSI A;  4L5L A;  2K8V A;  4F2I A;  5GZZ B;  4HQS A;  4O7H A;  5J4V A;  3TOU A;  4YH2 A;  2VCW A;  1AUC A;  3KGK A;  1E2Y A;  2NPB A;  2YJH A;  1S3C A;  4WF5 A;  4GTU A;  2B1K A;  2YNX A;  3IAM 2;  1ERV A;  1BX9 A;  2C1Y A;  2DJ3 A;  4ICY A;  3ZIJ A;  2CVK A;  3ZFB A;  5KN0 A;  1GTU A;  2YJ7 A;  5A34 B;  1TU8 A;  1OC9 A;  1SK2 A;  5ECR B;  4ECJ A;  1KEB A;  3GH9 A;  3TJF A;  1MDK A;  2WGR A;  4WKW A;  4Q5Q A;  4NWY A;  4V2L A;  5IO0 A;  3Q6O A;  2LRN A;  2H73 A;  4MZB A;  4YQM A;  4OO4 A;  1V57 A;  4MCU A;  2L6C A;  3GNJ A;  2A2R A;  1QGV A;  2YOI A;  5FT3 A;  2M46 A;  1VF1 A;  3FYG A;  1TXU A;  2VL2 C;  5A5H B;  1TI1 A;  3O76 A;  1ON4 A;  1V58 A;  4OFT A;  2XHF A;  2YV9 A;  3UBL A;  1Z7P A;  4TR0 A;  2H1G A;  5J4U A;  4OO5 A;  1HYU A;  4K5R A;  4MNN A;  3IPZ A;  1B4P A;  2R5G A;  3C7M A;  3HA9 A;  4ZBA A;  1K3L A;  1KNG A;  4CY8 A;  3M8N A;  1PL2 A;  4PNG A;  4AJ7 A;  2MMO A;  2OE0 A;  3VPQ A;  2I1U A;  4CW9 A;  2C0D A;  4HJM A;  4QQ7 A;  1X5C A;  1PN0 A;  1WWJ A;  4MDC A;  1YZX A;  3LWA A;  4PX1 A;  4DVC A;  4POK A;  3H4K A;  3F8U A;  2IWT A;  3P7X A;  2X8C A;  3TKQ A;  3KMO A;  1GWC A;  1EP7 A;  1GSS A;  5GAP D;  2H01 A;  2OA7 A;  2I3Y A;  3C71 A;  4Z2T A;  1T00 A;  2R6K A;  4LL1 B;  2FHE A;  1XOA A;  4AKH A;  4GSS A;  1O6J A;  1HNC A;  4IQ1 A;  1XIY A;  3FK8 A;  3WD6 A;  1EOG A;  3DWV A;  1YKC A;  1GH2 A;  2C8U A;  3GST A;  4TXO B;  4OMV A;  2EFH A;  2BMX A;  3G7I A;  2GSQ A;  4O5Q A;  5KEJ A;  3DYR A;  2JZS A;  3TKS C;  3QDN A;  1SJI A;  3GRX A;  2IFQ A;  2WFC A;  10GS A;  1R4W A;  5AIV A;  1SEN A;  3EPT A;  1DE2 A;  3HVS A;  5DCH A;  2FWG A;  2H1B A;  1MEK A;  2NVL A;  4OFN A;  3ZMK A;  2JAC A;  4IJI A;  1GNW A;  3QFB C;  5JWQ B;  2WDU A;  2VUP A;  4GXZ A;  2QGV A;  2PVO C;  2YCD A;  1NHY A;  7GSS A;  2HE3 A;  5ID2 B;  18GS A;  1TI3 A;  5CRW A;  3GTU A;  4IS0 A;  3GV1 A;  4G0I A;  1PN9 A;  2R4V A;  2PGT A;  4BL7 B;  2C0G A;  4N11 A;  3LYK A;  1F6M C;  4XIH A;  1U3I A;  2AAW A;  2JSZ A;  1ZMA A;  4LMW A;  4P3Y B;  1THO A;  2DJ0 A;  3S9F A;  3EE2 A;  3F4S A;  4OCE A;  4WBR D;  3VK9 A;  2VM2 A;  2CAQ A;  3H79 A;  3F9U A;  4ZXG A;  3L4N A;  1G6Y A;  1XOB A;  4MZC A;  5C00 A;  2G2Q A;  4EIP A;  2KP2 A;  5A4W A;  5EY6 A;  3VI5 A;  5DBQ A;  2YN1 A;  2FD3 A;  3UAR A;  3LW9 A;  2YWI A;  3HKR A;  3FZ4 A;  13GS A;  4WR5 A;  3UJ1 A;  4KSM A;  1TP9 A;  3UL3 A;  3IC4 A;  4K1F A;  3VWX A;  5J9B A;  2H8L A;  3NZN A;  4JE1 A;  3D0Z A;  3ZLP A;  1A24 A;  3TJB A;  4MH2 A;  4PUF C;  3QCP A;  1XWC A;  4K5S A;  2HZF A;  1M9A A;  5A5H A;  2DIY A;  1GTA A;  2ON5 A;  2VOC A;  3ZVJ A;  2IMD A;  5CNW A;  2HLS A;  4KA0 A;  3TRQ A;  4V1A p;  3VPT A;  1O73 A;  3M1G A;  3RAZ A;  1OKD A;  4GRF A;  5F0G A;  4NPB A;  3DVX A;  2GQK A;  1CQH A;  4IBP A;  1Z7R A;  3HJP A;  1V2A A;  3IBH A;  1SVL A;  3LJR A;  2V6K A;  3CXG A;  3QMX A;  2B5Y A;  2TRX A;  4K2X A;  2E0Q A;  1JLW A;  1TRU A;  1M2A A;  2G0F A;  2EFE A;  3J7Y b;  3LEF A;  5B6M A;  3MYD A;  4BWQ A;  1KTE A;  1A2J A;  6GSU A;  3UAP A;  4PNF A;  5CRD A;  4G19 A;  4ZIJ A;  3I6A A;  2FWE A;  4XS6 A;  2HZE B;  4KW6 A;  1SKR B;  4TXO A;  2GZY A;  2OE3 A;  4I8B A;  3W6G A;  1XCC A;  5G1L A;  4J56 E;  8GSS A;  5ECL B;  2R0G A;  2WS2 A;  14GS A;  2LJK A;  4AI6 A;  1O8W A;  4FYU A;  3RPN A;  4I2T A;  1TRS A;  4TRX A;  2A4H A;  1LU4 A;  2GLR A;  4HS1 A;  3J7Y k;  5G5F A;  5DJM A;  1USB A;  3DML A;  1WIK A;  2AUV A;  1EZK A;  1OC9 B;  3LOR A;  1J9B A;  1FO5 A;  4ZB7 A;  5ID2 A;  5ECS A;  4GDF A;  20GS A;  2JAD A;  1K0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...