5FHIA

Crystallographic structure of psoe without co
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
MVFGTLYTFPGDQCRTIAIKAVAKANGLDLDIRETPRTPDHLSISKLGKVPAFQGADSFKLFECMAIALYITSQNEQTTLLGKDKKEYAEIIKWMSFFNTEIVILMTQQLLPQLGVIPYDRDQVEFFANMTQRSVDVVEEYLQDRTFLVGDQLSLADLFCAGNISLGFQFFYGKAWRQQNPNVSRWYEMVCHQPIYAAVTDKFQLLDEPKLTNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidative trans to cis Isomerization of Olefins in Polyketide Biosynthesis.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Transferase
molecule keywords Glutathione S-transferase, putative
total genus 71
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5fhiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5fhiA01
2PVOC 3DWVA 2ON7A 1TJDA 2PGTA 2HSHA 2B1LA 3EMXA 3TJBA 2WJUA 3M8NA 4K7IA 3MDKA 4KB3A 4Q5QA 5KN0A 4IN0A 5J5NA 3DYRA 1YF1A 4GSSA 5HFGA 2BJXA 5GAND 1FO5A 2O8VB 3G7YA 3RAZA 2OACA 3FR3A 1DBYA 1YF0A 3D4TA 3J7Yb 3QMXA 5G2ZA 1K0NA 2C0GA 3IK9A 5AIXA 1XW6A 1YEPA 2YP6A 2QC7A 3TKQA 3VLNA 3VWUA 1X9MB 4HJMA 2PU9C 1CQGA 1GL8A 4KDXA 4WKWA 20GSA 3GL5A 1PL1A 2IMEA 2HSMA 2LJRA 1U3AA 1G7OA 1TDIA 2DIYA 4G2EA 2C3QA 1ABAA 3P7XA 4K8MA 2H76A 4WXTA 3GSTA 3QR6A 4J56E 2JADA 1PA3A 4K2DA 3LYKA 1T8EB 2HRFA 1V9WA 1V57A 1Z6NA 1A0RP 1QK8A 1WJKA 3I43A 3QAVA 3ME7A 4BVYB 2R4VA 3LSZA 2GZYA 3UVTA 4GWRA 5DALB 3J7Yk 3VWWA 2OBKA 2EIQA 4GF0A 3N5OA 2V6KA 13GSA 2H73A 1GRXA 1GSQA 3HVXA 3EYTA 4POKA 2LQOA 3FEUA 1KEBA 5CO3A 3LEFA 2MMOA 2DJKA 4TRXA 2HNLA 4ZL8A 2YANA 3F3RA 3KEBA 4XS6A 5IIZA 2YWMA 3DRNA 3GIXA 3F9UA 3KTBA 3LJRA 2HQTA 3TJGA 2HFDA 4KA0A 4NPBA 4ZBAA 3BCIA 1GSUA 2VCZA 2PERA 5ELAA 2VLVA 3US3A 3G9BA 4QQ7A 1XW9A 4HU9A 1ZZYA 3F3QA 2GGTA 4F0BA 1BX9A 1WOUA 2LQQA 4PXOA 2NDOA 5AISA 2FY6A 1SL0B 2C0FA 5GSSA 1YQ1A 1XWBA 3MSZA 3D6IA 4EKZA 2IFQB 3M1GA 3GV1A 4I5QA 11GSA 4RI6A 5D9TA 2JZSA 1R4WA 3Q74A 2OE0A 5CRDA 4ZB8A 1SK1A 1O8XA 3DVWA 1JZRA 1M2DA 1RK4A 4XTSA 4IP6A 1KTEA 2G0FA 3NOFA 14GSA 5D8IA 2HRKB 4LL1B 5ECQB 4HEA2 4BPYA 1S3DA 2NVLA 3I69A 4KCEA 2GSQA 2PUKC 2GT5A 1U88A 1XVQA 1PQNA 1OC3A 2ZUPA 4XS4A 4KCAA 5CREA 1PMTA 2YWNA 3QOUA 2B5EA 2CA8A 2A4VA 3L9UA 3EE2A 5B8BA 3PGTA 2MYGA 1R26A 3LXTA 2GZZA 3TGZA 4EE0A 3ZVJD 2H6YA 4BL7B 1EP7A 5KN1A 1M2AA 1M2BA 1VGLA 3IDVA 3TJKA 1YZXA 2YV9A 1A24A 4ILFA 4TXOB 4D73B 3D0ZA 4FYBA 1FOVA 3QAWA 1AUCA 2TRCP 3GN3A 3QFBC 3IAM2 1TK5B 1XWGA 4IP1A 2ON5A 2GSSA 1XW5A 3GH9A 1SK2A 4E8HA 4DSSA 1X9WB 4ECBA 2H30A 3KD0A 2VD1A 5JWQB 1UN2A 3QCPA 3N9JA 1I5GA 4AGSA 2YPMA 1TRSA 5DDLA 4N30A 3ZREA 3ZIJA 1TRWA 4OO4A 1F9MA 2HE3A 6GSTA 1O85A 3M0FA 2VIMA 3TOUA 2YCDA 1WMJA 1TOFA 4OMVA 4YQUA 2OJLA 3F63A 3IXRA 2H0IA 2F51A 1OKDA 1MDJA 2TRXA 3FK8A 4OCFA 1XWKA 2B7KA 4G19A 4GSNA 5E59A 1JHBA 3UVHA 2GQMA 3VFIA 1URMA 2X64A 2CV4A 2LNSA 2B7JA 2ALBA 3DXBA 1G6WA 2PN8A 2VL3A 4OFTA 1B48A 2WULA 5COHA 4N0ZA 1PX6A 1GSEA 4BVYA 5GSTA 4V2LA 5J9BA 1B9XC 5ABRA 2GS3A 2EIOA 4I6XA 5HR0A 5H5RA 5IMFA 4LA1A 2V2GA 1W4VA 4NAXA 2DC5A 1WWJA 4PQHA 1XWAA 2H19A 2LV3A 5IMVA 4PQIA 1GNWA 5LD0A 4L5OA 4XS4B 3ZVJA 3KMOA 2PWJA 4ZL9A 2H72A 3GKXA 3LORA 2AJQB 3WD6A 4K1FA 4XS1A 2H66A 6GSSA 1FAAA 1ILOA 2L5OA 1MDIA 4WEYA 2MZCA 3WT2A 5C04A 3ED3A 4IJIA 4BL7A 2R5GA 1HNBA 5ECNB 3HJMA 3KM6A 3H79A 2IJYA 4AJ7A 5INYA 3R3EA 4E8EA 1M9AA 1I9DA 4MPFA 1EEJA 4DSQA 3GSSA 2C3TA 1TXXA 2H8LA 5KN2A 3A3TA 3A2WA 2IPAA 3EC3A 3ZLPA 5EY6A 2GTUA 1PN9A 5CRHA 2V32A 3FRCA 1Z3EA 1U3IA 2J9HA 4HQSA 3TRQA 2MMNA 1K0AA 2YN1A 3APOA 5J41A 1CQHA 2IMIA 4NXIA 3W8SA 1G7EA 3H4KA 4ISDA 2JU5A 3M9KA 5IOXA 4OWYA 5IPHA 4BWSA 4O92A 3GX0A 3GUSA 1USBA 2FWHA 4LL4B 4AJ8A 4MLYA 5HFKA 3JCML 3HXSA 4YAVA 2VLUA 4EDYA 3BOAA 3ISOA 5H5SA 1A2JA 3TRPA 2FUG2 3IC8A 3ZRDA 4POBA 3NIVA 4ID0A 2LSTA 4EVMA 4ACSA 3LYPA 5DAKA 2HZEB 3IAS2 1A2LA 4KSMA 3F0IA 2HRNA 1VF2A 3WGXA 3A5WA 4MPGA 2H1BA 3KH7A 4JE1A 2HLSA 1YKAA 5JWOB 4G9HA 2NBSA 2RIIA 3KCMA 3ZFBA 4XCSA 4XIHA 2L57A 3TCOA 2DSAA 3FZ4A 4Q5RA 4MJBA 2F3MA 2DMLA 4YQMA 2FWGA 5ECIB 1EP8A 2KOKA 2RUEA 1HD2A 4V1Ap 1SENA 5HR3A 1XFLA 3KH9A 2IN3A 2EIRA 4IQ1A 2HT9A 4NV5A 5DJMA 3LWAA 3UL3A 4MJCA 4ML1A 4CW9A 3TKSA 5DCHA 3VI5A 1K0MA 5IPGA 3TKRA 4F03A 2QSIA 1UC7A 4O7HA 4MDCA 1IYHA 2WS2A 2H70A 1T4YA 3IRAA 4CDOA 4EF0A 4USSA 2HI7A 2CVBA 2LEGA 2IMDA 5IM9A 2OA7A 2B6MA 1WIKA 3IPZA 4EO3A 4JU5A 4MF7A 3QD9A 3SWLA 1BG5A 2O7KA 2C80A 4MZWA 3CYNA 1TP9A 4X43A 2JSZA 2C1YA 3Q6OA 4KX4A 4MH3A 3WGDA 4I8BA 4PGTA 5IMZA 2FNOA 5ECRB 1T1VA 2FLSA 1NM3A 5B6MA 3IV4A 5ENUA 3L78A 2B5XA 3FKFA 3I6AA 2L6CA 3TDGA 2RM6A 1X5EA 2XBQA 1OC9A 1SJZA 2M72A 2B5YA 4WF4A 4GCIA 5ECHB 1FW1A 3IBHA 2R2JA 1GLPA 5D9XA 1SU9A 5HFIA 1PGTA 4DVCA 5ECKB 4ECIA 2AV4A 2OKAA 3UIWA 1F2EA 2VCVA 4ZBBA 2C0EA 3TJFA 2P5QA 1Z6MA 5KN3A 1QGVA 2GSRA 3D5JA 1M99A 4TVEA 4I2UA 2OBIA 1X0RA 5F06A 4KNDA 1LU4A 5DAKB 1GUHA 1M9BA 3H8QA 3GURA 3LQ7A 1JFUA 1EOGA 5F8BA 4Q5FA 3O3TA 4G0IA 3MNGA 2QGVA 4FO5A 2CAQA 3CBUA 1WPIA 3KP9A 5L71A 5G1LA 5A4VA 1WE0A 5AN1A 5DJLA 1YDKA 3AY8A 4L0WA 2I3YA 5D93A 5GAPD 4IBPA 1GP1A 4IJ3A 4TW5A 4G0KA 1XBSA 2E2GA 4I2TA 3GTUA 2AAWA 4JR4A 2H1GA 3UBLA 2J23A 3ZITA 3L0HA 4ZB9A 2AB6A 1BEDA 5IMDA 2I1UA 4HS1A 2DBCA 3ZFLA 2L4QA 1X5CA 2K18A 3PR8A 2DJ2A 2I9HA 1SD9A 2PPTA 3HZ8A 2L59A 1XXUA 2GSTA 1EZKA 1ON4A 2DJ1A 4IELA 6GSUA 4KE3A 3Q18A 3QDNA 3TOTA 4OCEA 3GH6A 4YH2A 2P5RA 4KDUA 1TTZA 2CQ9A 1E6BA 2IL3A 1NHOA 4TN8A 1GSSA 3F8UA 3HY2A 4KDYA 4IQAA 3LGCA 3F4RA 1R5AA 2IIYA 4F9ZA 1PRXA 3CTGA 1SKSB 2RLIA 1XZOA 2GZPA 1ML6A 3CSIA 2B1KA 4EDZA 3LFLA 3GMFA 3HVVA 4JR6A 1HNAA 1YKCA 1SKWB 2FCHA 4BVXB 2MMAA 3U5RE 4F82A 4EUYA 4MJEA 1OYJA 4QL7A 2D2ZA 1TKDB 1OE8A 4JEDA 2K8VA 1T00A 4NHZA 6GSWA 2LS5A 1OVNA 4HJ2A 2WFCA 2B3SA 2O85A 4K0NA 1GTUA 2GDRA 4IGJA 1S3AA 1GTBA 1JZWA 4K6XA 5DBQA 3S9FA 5CRGA 2LTKA 5J9CA 3ZMLA 2L6DA 1PL2A 5DALA 2YZHA 2VOCA 1TRUA 4TOPA 2Z9SA 2LJAA 3ERWA 2I81A 3RHBA 2VM1A 5DQYA 5JCWA 1Z7PA 2H71A 2HXKA 4MF5A 1UVZA 5D9VA 3H93A 2GLRA 2IMKA 4DSRA 2F8FA 4FIWA 4LMVA 3L4NA 2CZ2A 2CAIA 2R6KA 1XIYA 4MK3A 4HUAA 2A2RA 4WR4A 1AIUA 1FB0A 1PD21 4KGIA 2VCTA 1GWCA 5B7CA 5G31A 1TU7A 2HSYA 3IHQA 1FVJA 2DJ0A 2BTOT 1THOA 2KLXA 2L5LA 4LMWA 1M7TA 2C4JA 4POLA 3GTUB 4FQUA 1XWCA 4HDEA 1XVWA 2XBIA 1AQVA 4PTSA 3ERFA 4PUAA 3FW2A 3UOMA 4PX1A 4F0CA 5G5EA 3C73A 5D9WA 2NPBA 4KF9A 5CRWA 1SD8A 1QXHA 1SL2B 1HNCA 3F6DA 5IMAA 3TKPA 4J57E 2FWFA 1SJ6A 3ZZXA 2CVKA 4ZL7A 1B4PA 1KBNA 1UA5A 1B9YC 1JZDA 1WP0A 1DSBA 2V1MA 2LNTA 19GSA 1H75A 3RBTA 2OADA 5HR1A 2OE3A 1VF3A 4TKYA 2VD0A 4X1UA 1GNEA 4GSTA 4JZQA 3HKRA 4CHSA 1GUKA 2P31A 2DJ3A 5ECPB 4N10A 3A2XA 2H1DA 1ERTA 2VM2A 3WGEA 3DEXA 2H6XA 4RI7A 3CSJA 3D21A 3EURA 1SJIA 1EEMA 5IQYA 3P8WA 3HHVA 4PUFC 4K9ZA 2AHEA 3C8EA 2HYXA 1HYUA 4GQCA 2YOIA 4DEJA 2JL4A 3WT1A 4ZBDA 2LKUA 3IE3A 1TRVA 2FD3A 4X0XA 2YNXA 1VRSD 3HD5A 3PH9A 4TR4A 2H01A 5G5FA 2RUFA 5C00A 4TR0A 1THXA 2ZNMA 3TKSC 2YWIA 3GKNA 2KHPA 1TK0B 3ZIVA 3E3EA 3U6VA 1ZYEA 4NMUA 3FY7A 2V6OA 3TUEA 3GHAA 2GVPA 3Q19A 1B8XA 3HJOA 3HCZA 5IO0A 4AF2A 2OE1A 4I97A 2VL2A 4TR1B 4MH2A 2DJJA 1R5PA 4MA9A 12GSA 2LUSA 2VCWA 2WB9A 2MBSA 1GSFA 1J08A 1ZOFA 4WF5A 1K0DA 2PBJA 1TW9A 5ELGA 5J3RA 2IWTA 5JWRB 3DVXA 3C1RA 3GL3A 1QFNA 1SK0A 1SYRA 4WBRD 2FA8A 1DE2A 4ZILA 1AQXA 3ME8A 4K7OA 4HI7A 17GSA 5EVOA 3CMIA 3DKSA 4KH7A 1SL1B 4IW9A 3GX8A 1VF4A 2VUPA 3ZMKA 1O73A 2HSMB 1ZGNA 4F2IA 2DIZA 4PNGA 2YJ7A 1JLVA 3FYGA 2H74A 1YJ6A 4N0VA 2HZFA 3W6GA 5LCZA 2H0GA 3P90A 4XHMA 5G1KA 2JZRA 4OD7A 1ZCPA 1GUMA 1ERWA 4OFNA 1TU8A 2E2MA 4V1Ag 2C3NA 1GSYA 1AQWA 2A2SA 1OKTA 4TR1A 2X99A 1B4QA 3GYKA 2CZ3A 2VO4A 4BWQA 4HU7A 4GQFA 2HRAA 3APSA 1K3OA 1A8LA 3F4TA 3W8JA 2VL9A 3EINA 2VL2C 1C72A 2WZ9A 1ZYQB 4IKHA 1KNGA 3ZL5A 2L4CA 3ZYWA 1NW2A 4ECJA 1BQ7A 2ES7A 3P2AA 4P3YB 5CP1A 2DLXA 5D73A 2WCIA 2JSYA 5JCUA 1FG4A 1SKRB 5E4WA 4NV2A 2QKEA 3G7JA 4HZ2A 2CX3A 4POMA 1U87A 3F6FA 3TKSE 4MABA 2MBTA 1T4ZA 2P0GA 3WYWA 1X9SB 3QFAC 1O7UA 3BBYA 2IMFA 2H0HA 4Z7XA 1IYIA 4G0LA 4MP4A 2F8AA 2XPEA 3HVSA 2R3XA 5ECMB 22GSA 2E7PA 4MF6A 2VCQA 2LJKA 1GSDA 1QUWA 1EGRA 4KAEA 3R2QA 1O81A 1EOHA 3IA1A 1YY7A 5A4WA 4FH8A 4RQXA 3EVIA 1HQOA 2GQLA 1GULA 2O89A 4MZBA 6GSYA 4MCUA 4AJ6A 1MTCA 3DD3A 2ZCTA 2TIRA 3A2VA 3FZAA 3IR4A 4YQVA 4HOJA 5EPFA 3CSHA 1Q4JA 1G6YA 2HRKA 4XRAA 2CT6A 1J0FA 3TRXA 2YZUA 2N5AA 2CVDA 5B8AA 1EV4A 4PURA 1PSQA 3C1SA 4L5LA 1ST9A 4WETA 1A8YA 2WDUA 3KP8A 5IOWA 2M80A 1TI1A 4O5RA 3CTFA 1Q98A 3APQA 4KSOA 5AGYA 6GSXA 1SYXA 1OE7A 5J4UA 4K0GA 5LNKe 3I9V2 3RDWA 1VF1A 2PVQA 3K8NA 3UMAA 2C0DA 1Z5YE 1K0CA 1R7HA 3VK9A 5ID2A 5ID2B 3VWXA 5ECOB 2IFQA 3TJJA 1JLWA 3HYPA 1EGOA 4DSSB 3E0UA 2XC2A 2H6ZA 3GA4A 2NTOA 18GSA 3DGQA 3HZ4A 2X8HA 3VURA 1F3BA 5ECSA 3KZQA 2KP1A 2I4AA 1XOBA 4N11A 1K0BA 2AYTA 1T3BA 2R37A 4XRDA 3D22A 2FHEA 1AC1A 4V2MA 2HZEA 4JRRA 2LRTA 1BYEA 1X5DA 3L9SA 1GTIA 5F0GA 1GLQA 1NSWA 2VLTA 3UBKA 3HDCA 4TXOA 1Y6EA 4D73A 2YJHA 2C8UA 3HJPA 4RQRA 1FVKA 3PPUA 4MMMA 2X8CA 5DCGA 4O32A 5G30A 1LBKA 1ERUA 4LLRA 3L9VA 2JZTA 2REMA 1XCCA 1ERVA 3GFKA 5HQPA 4OFMA 4ULXA 3EWLA 5CNWA 4ZB6A 3H1NA 2K6VA 5F07A 1A0FA 3VPTA 3KGKA 5A4UA 4MJAA 3ERGA 3QAGA 1N8JA 4OO5A 3DIEA 4GLTA 2XPDA 4EXJA 5A5KA 4EC0A 2PMTA 2CX4A 1N2AA 1V2AA 1GTAA 5FWGA 2DMMA 4NHWA 3OR5A 1K3YA 5IO2A 3FHKA 3IK7A 2UZ8A 2LRCA 5B6NA 4WR5A 4J2FA 2MMZA 3BJ5A 4EL1A 3C71A 3KIJA 3EU4A 4FYUA 2M46A 5GZZB 3QPMA 3GNJA 3MWHA 1BAYA 5HR2A 2FGXA 3ZTLA 1Y25A 3V1WA 3CRTA 3EU3A 8GSSA 3FZ5A 4IHUA 2F9SA 5KEJA 4TXVA 1ZL9A 1U6TA 3RHCA 10GSA 4GXZA 4FYCA 1F37A 4GRFA 1DUGA 4IVFA 1A2MA 1MEKA 2LRNA 3UJ1A 2KUCA 3NZNA 1E2YA 3BD2A 1FB6A 2GT6A 1A23A 5H5QA 3G7IA 3UAPA 5DVBA 3BCKA 5JCGA 1K3LA 4ZIJA 3CXGA 1EV9A 3UARA 5CYYA 3FR6A 5FHIA 1MDKA 2AUVA 1RW1A 4BA7A 3LG6A 2K8SA 9GSSA 5F05A 5AIVA 2RM5A 1AXDA 3GKKA 1Z7RA 3F4SA 4L0UA 1V40A 4K7NA 16GSA 4H86A 1V58A 1M0UA 1JZOA 3FZ9A 3M9JA 3VI7A 4GTUA 2WGRA 5D96A 3UEMA 3M3MA 3O6TA 1BJXA 1TI3A 1O8WA 4ECCA 4BVXA 2VCXA 1S3CA 1J9BA 2EC4A 3KXOA 1DE1A 3HA9A 1XPVA 3IC4A 1Z9HA 1AW9A 4MZCA 3PINA 1F6MC 2VAFA 1ACVA 1F3AA 2HSNB 5FT3A 4HZ4A 4KW6A 2V41A 4L8EA 2X8GA 4ZXGA 1TK8B 2XHFA 2K9FA 5BMUA 4WBJA 2H1AA 4ML6A 1YEXA 3FR9A 1GH2A 4V2NA 4HQZA 2N5FA 3LXZA 2H75A 1PKWA 3GKMA 1WRYA 3IOSA 4NWYA 1K0OA 3KJYA 1MD3A 1O6JA 4JBBA 3C7MA 2YWOA 3MAKA 5EL8A 5CAXA 1LJRA 3KMNA 3SBCA 5IMCA 3O76A 1OAZA 3EMPA 1H4OA 4RUVA 3E9JB 5ECLB 2YV7A 4QL9A 1XOAA 4PQ1A 1QMVA 1QQ2A 1NHYA 2O87A 1MD4A 1V98A 1ZMAA 3GRXA 1G0TA 2BMXA 3CRUA 4IS0A 2G2QA 1PX7A 4PNFA 4G10A 2FWEA 2KP2A 4Q5NA 3DMLA 3RPNA 2WRTA 1RQMA 1AAZA 3D4MA 3VPQA 1EWXA 1OC8A 2GQKA 4YAPA 6GSVA 2N5BA 4TR3A 4KUNA 2E0QA 7GSSA 2FA4A 1OC9B 1W89A 2JACA 3TB2A 3RPPA 1PKZA 1FHEA 3VWVA 3KTLA 1T7PB 5DQSA
chains in the Genus database with same CATH superfamily
2PVOC 3DWVA 2ON7A 1TJDA 2PGTA 2HSHA 2B1LA 3EMXA 3TJBA 2WJUA 3M8NA 4K7IA 3MDKA 4KB3A 4Q5QA 5KN0A 4IN0A 5J5NA 3DYRA 1YF1A 4GSSA 5HFGA 2BJXA 5GAND 1FO5A 2O8VB 3G7YA 3RAZA 2OACA 3FR3A 1DBYA 1YF0A 3D4TA 3J7Yb 3QMXA 5G2ZA 1K0NA 2C0GA 3IK9A 5AIXA 1XW6A 1YEPA 2YP6A 2H1LA 2QC7A 3TKQA 3VLNA 3VWUA 1X9MB 4HJMA 2PU9C 1CQGA 1GL8A 4KDXA 4WKWA 20GSA 3GL5A 1PL1A 2IMEA 2HSMA 2LJRA 1U3AA 1G7OA 1TDIA 2DIYA 4G2EA 2C3QA 1ABAA 3P7XA 4K8MA 2H76A 4WXTA 3GSTA 3QR6A 4J56E 2JADA 1PA3A 4K2DA 3LYKA 1T8EB 2HRFA 2OT3A 1V9WA 1V57A 1Z6NA 4PI0C 2WVXA 1A0RP 1QK8A 1WJKA 3I43A 2X49A 3QAVA 3ME7A 4BVYB 2R4VA 3LSZA 2GZYA 3UVTA 2WW3A 4GWRA 5DALB 3J7Yk 3VWWA 2OBKA 2EIQA 4GF0A 3N5OA 2V6KA 13GSA 2H73A 1GRXA 1GSQA 3HVXA 3EYTA 4POKA 2LQOA 3FEUA 1KEBA 5CO3A 3LEFA 2MMOA 2DJKA 4TRXA 2HNLA 4ZL8A 2YANA 3F3RA 3KEBA 4XS6A 5IIZA 2YWMA 3DRNA 3GIXA 3F9UA 3KTBA 3LJRA 3CQFA 2HQTA 3TJGA 4N3ZA 2HFDA 4NPBA 4ZBAA 3BCIA 1GSUA 4KA0A 2VCZA 2PERA 5ELAA 2VLVA 3US3A 3G9BA 4QQ7A 1XW9A 4HU9A 1ZZYA 3F3QA 2GGTA 4F0BA 1BX9A 1WOUA 2LQQA 4PXOA 2NDOA 5AISA 2FY6A 1SL0B 4GDFA 2A2PA 2C0FA 5GSSA 1YQ1A 1XWBA 3MSZA 3D6IA 4EKZA 2IFQB 3M1GA 3GV1A 4I5QA 11GSA 4RI6A 5D9TA 2JZSA 1R4WA 3Q74A 2OE0A 5CRDA 4ZB8A 1SK1A 1O8XA 3DVWA 1JZRA 1M2DA 1RK4A 4XTSA 4IP6A 1KTEA 2G0FA 3NOFA 14GSA 5D8IA 2HRKB 4LL1B 5ECQB 5J47A 4HEA2 4BPYA 1S3DA 2NVLA 3I69A 4KCEA 2GSQA 2PUKC 2GT5A 1U88A 1XVQA 1PQNA 1OC3A 2ZUPA 4XS4A 4KCAA 5CREA 1PMTA 4W66A 2YWNA 3QOUA 2B5EA 2CA8A 2A4VA 3L9UA 3EE2A 5B8BA 3PGTA 2MYGA 1R26A 3LXTA 2GZZA 3TGZA 4EE0A 3ZVJD 2H6YA 4BL7B 1EP7A 5KN1A 2WW0A 1M2AA 1M2BA 1VGLA 3IDVA 3TJKA 1YZXA 2YV9A 1A24A 4ILFA 4TXOB 4D73B 4MNNA 3D0ZA 4FYBA 1FOVA 3QAWA 1AUCA 2TRCP 3GN3A 3QFBC 3IAM2 1TK5B 1XWGA 4IP1A 2ON5A 2GSSA 1XW5A 4K5SA 3GH9A 1SK2A 4E8HA 4DSSA 1X9WB 4ECBA 2H30A 3KD0A 2VD1A 5JWQB 1UN2A 3QCPA 3N9JA 1I5GA 4AGSA 2YPMA 1TRSA 5DDLA 4N30A 3ZREA 3ZIJA 1N25A 1TRWA 4OO4A 1F9MA 2HE3A 6GSTA 1O85A 3M0FA 2VIMA 3TOUA 2YCDA 1WMJA 1TOFA 4OMVA 4YQUA 2OJLA 3F63A 3IXRA 2H0IA 2F51A 1OKDA 1MDJA 2TRXA 3FK8A 4OCFA 1XWKA 2B7KA 4G19A 4GSNA 5E59A 1JHBA 3UVHA 2GQMA 3VFIA 4Z2UA 1URMA 2X64A 2CV4A 2LNSA 2B7JA 2ALBA 3DXBA 1G6WA 2PN8A 2VL3A 4OFTA 1B48A 2WULA 5COHA 4N0ZA 1PX6A 1GSEA 4BVYA 5GSTA 4V2LA 5J9BA 1B9XC 5ABRA 2GS3A 2EIOA 4I6XA 5HR0A 5H5RA 5IMFA 4LA1A 2V2GA 1W4VA 4NAXA 2DC5A 1WWJA 4PQHA 1XWAA 2H19A 2LV3A 5IMVA 4PQIA 1GNWA 5LD0A 4L5OA 4XS4B 3ZVJA 3KMOA 2PWJA 4ZL9A 2H72A 3GKXA 3LORA 2AJQB 3WD6A 4K1FA 4XS1A 2H66A 6GSSA 4AKXB 1FAAA 1ILOA 2L5OA 1MDIA 4WEYA 5KOWA 2MZCA 3WT2A 5C04A 3ED3A 4IJIA 4BL7A 2R5GA 1HNBA 5ECNB 3HJMA 3EPTA 3KM6A 3H79A 2IJYA 4AJ7A 5INYA 3R3EA 4E8EA 1M9AA 1I9DA 2QA2A 1ZYPA 4MPFA 1EEJA 4DSQA 3GSSA 2C3TA 1TXXA 2R0CA 2H8LA 5KN2A 3A3TA 3A2WA 2IPAA 3EC3A 3ZLPA 5EY6A 2GTUA 1PN9A 5CRHA 2V32A 3FRCA 1Z3EA 1U3IA 2J9HA 4HQSA 3TRQA 2MMNA 1K0AA 2YN1A 3APOA 5J41A 1CQHA 2IMIA 4NXIA 3W8SA 1G7EA 3H4KA 4ISDA 2JU5A 3M9KA 5IOXA 4OWYA 5IPHA 4BWSA 4O92A 3GX0A 3GUSA 1USBA 2FWHA 4LL4B 4AJ8A 4MLYA 5HFKA 3JCML 3HXSA 4YAVA 2VLUA 4FXYP 4EDYA 3BOAA 4AI6A 3ISOA 5H5SA 1A2JA 3HVNA 3TRPA 2FUG2 3IC8A 3ZRDA 4POBA 3NIVA 4ID0A 2LSTA 4EVMA 4ACSA 3LYPA 5DAKA 2HZEB 3IAS2 1A2LA 4KSMA 3F0IA 2HRNA 1VF2A 5J40A 2QA1A 3A5WA 3WGXA 4MPGA 2H1BA 3KH7A 4JE1A 2HLSA 1YKAA 5JWOB 4G9HA 2NBSA 2RIIA 3KCMA 3ZFBA 4XCSA 4XIHA 2L57A 3TCOA 2DSAA 3FZ4A 4Q5RA 4MJBA 5A5HA 2F3MA 2HSNA 2DMLA 4YQMA 2FWGA 5ECIB 1EP8A 2KOKA 2RUEA 1HD2A 4V1Ap 1SENA 5HR3A 1XFLA 3KH9A 2IN3A 2EIRA 4IQ1A 2HT9A 4AKGA 4NV5A 5DJMA 3LWAA 3UL3A 4MJCA 4ML1A 4CW9A 3TKSA 5DCHA 3VI5A 1K0MA 5IPGA 3TKRA 4F03A 2QSIA 1UC7A 5J4YA 4O7HA 4MDCA 1IYHA 2WS2A 2H70A 1T4YA 4ICYA 3IRAA 4CDOA 4EF0A 4USSA 2HI7A 2CVBA 2LEGA 2IMDA 5IM9A 2OA7A 2B6MA 1WIKA 3IPZA 4EO3A 2EFCA 3MYDA 4JU5A 1XG8A 4MF7A 3QD9A 3SWLA 1BG5A 2O7KA 2C80A 4MZWA 3CYNA 1TP9A 4X43A 2JSZA 2C1YA 3Q6OA 4BIKA 4KX4A 4MH3A 3WGDA 4QMKA 4I8BA 4PGTA 5IMZA 2FNOA 5ECRB 1T1VA 2FLSA 1NM3A 5B6MA 3IV4A 5ENUA 4HSCX 3L78A 2B5XA 3FKFA 3I6AA 2L6CA 3TDGA 2RM6A 1X5EA 2XBQA 1OC9A 1SJZA 2M72A 2B5YA 4WF4A 2DKHA 3IHGA 5A5HB 4GCIA 5ECHB 1FW1A 3IBHA 2R2JA 1GLPA 5D9XA 1SU9A 5HFIA 1PGTA 4DVCA 5ECKB 4ECIA 2AV4A 2OKAA 3UIWA 1F2EA 2VCVA 4ZBBA 2C0EA 3TJFA 2P5QA 1Z6MA 5KN3A 1QGVA 2GSRA 3D5JA 1M99A 4TVEA 4I2UA 2OBIA 1X0RA 5F06A 4KNDA 1LU4A 5DAKB 1GUHA 1M9BA 3H8QA 3GURA 3LQ7A 1JFUA 1EOGA 5F8BA 4Q5FA 4Z2TA 3O3TA 4G0IA 3MNGA 2QGVA 4FO5A 2CAQA 1BG1A 3CBUA 1WPIA 3KP9A 5L71A 5G1LA 5A4VA 1WE0A 5AN1A 5DJLA 1YDKA 3AY8A 1I1IP 4L0WA 5KOXA 2I3YA 5D93A 5GAPD 4IBPA 1GP1A 4IJ3A 4TW5A 4G0KA 1XBSA 2EFHA 2E2GA 4I2TA 3GTUA 2AAWA 4JR4A 2H1GA 3UBLA 2J23A 3ZITA 3L0HA 4ZB9A 2AB6A 1BEDA 5IMDA 1M3JA 2I1UA 4HS1A 2DBCA 3ZFLA 2L4QA 1X5CA 2K18A 3PR8A 2DJ2A 2I9HA 1SD9A 3HZ8A 2PPTA 2L59A 1XXUA 2GSTA 1EZKA 1ON4A 2DJ1A 4IELA 6GSUA 4KE3A 3Q18A 3QDNA 3TOTA 4OCEA 3GH6A 4YH2A 2P5RA 4KDUA 1TTZA 2CQ9A 4AKIA 1E6BA 2IL3A 1NHOA 4TN8A 1GSSA 3F8UA 3HY2A 4KDYA 4IQAA 3LGCA 3F4RA 1R5AA 2IIYA 4F9ZA 1PRXA 3CTGA 1SKSB 2RLIA 1XZOA 2GZPA 1ML6A 3CSIA 2B1KA 4EDZA 3LFLA 3GMFA 3HVVA 4JR6A 1HNAA 3CHXC 1YKCA 1SKWB 2FCHA 4BVXB 2MMAA 3U5RE 3RFRC 4F82A 4EUYA 4MJEA 1OYJA 2A4HA 4K5RA 4QL7A 2D2ZA 1TKDB 1OE8A 4JEDA 2K8VA 1T00A 4NHZA 6GSWA 2LS5A 1OVNA 4HJ2A 2WFCA 2B3SA 2O85A 4K0NA 1GTUA 2GDRA 4IGJA 1S3AA 1GTBA 1JZWA 4K6XA 5DBQA 3S9FA 5CRGA 2LTKA 4PI2C 5J9CA 3ZMLA 2L6DA 1PL2A 5DALA 2YZHA 1PFOA 2VOCA 1TRUA 4TOPA 2Z9SA 2LJAA 3ERWA 2I81A 3RHBA 2VM1A 5DQYA 5JCWA 4G01A 1Z7PA 2H71A 2HXKA 4MF5A 1UVZA 5D9VA 3H93A 2GLRA 2IMKA 4DSRA 2F8FA 4FIWA 4LMVA 3L4NA 2CZ2A 2CAIA 2R6KA 1XIYA 4MK3A 4HUAA 2A2RA 4WR4A 1AIUA 1FB0A 1PD21 4KGIA 2VCTA 1GWCA 5B7CA 5G31A 1TU7A 2HSYA 3IHQA 2O3EA 1FVJA 5J4VA 2DJ0A 2BTOT 1THOA 2KLXA 2WVYA 2L5LA 4LMWA 1M7TA 2C4JA 4POLA 3GTUB 4FQUA 1XWCA 4HDEA 1XVWA 1M3IA 2XBIA 1AQVA 4PTSA 3ERFA 3A5IA 4PUAA 3FW2A 3UOMA 2WW2A 4PX1A 5G5EA 4F0CA 3C73A 5D9WA 1Y1UA 3LW9A 2NPBA 4KF9A 5CRWA 1SD8A 1QXHA 1SL2B 1HNCA 3F6DA 5IMAA 3TKPA 4J57E 2FWFA 1SJ6A 3ZZXA 2CVKA 4ZL7A 1B4PA 1KBNA 1UA5A 1B9YC 1JZDA 3CWGA 1WP0A 1DSBA 2V1MA 2LNTA 19GSA 2WZSA 1H75A 3RBTA 2R0PA 2OADA 4ZB7A 5HR1A 2OE3A 1ZYNA 1VF3A 2EFDA 4TKYA 2VD0A 2R0GA 1S4BP 4X1UA 5A34B 1GNEA 4GSTA 4JZQA 3HKRA 4CHSA 1GUKA 2P31A 2DJ3A 5ECPB 4N10A 3A2XA 2H1DA 1ERTA 2VM2A 3WGEA 3DEXA 2H6XA 4RI7A 3CSJA 3D21A 3EURA 1SJIA 1EEMA 5IQYA 3P8WA 3HHVA 4PUFC 4K9ZA 4CY8A 2AHEA 3C8EA 2HYXA 1HYUA 4GQCA 2YOIA 4DEJA 2JL4A 3WT1A 4ZBDA 2LKUA 3IE3A 1TRVA 2FD3A 4X0XA 1FOHA 2YNXA 1VRSD 3HD5A 3PH9A 4TR4A 2H01A 5G5FA 4E68A 2RUFA 5C00A 4TR0A 1THXA 2ZNMA 3TKSC 2YWIA 3GKNA 2KHPA 1TK0B 1PN0A 3MIXA 3ZIVA 3E3EA 3U6VA 1ZYEA 4NMUA 3FY7A 2V6OA 3TUEA 3GHAA 2GVPA 3Q19A 1B8XA 3HJOA 5A1NA 3HCZA 5IO0A 4AF2A 2OE1A 4I97A 2VL2A 5A1NB 4TR1B 4MH2A 2DJJA 1R5PA 4MA9A 12GSA 2LUSA 2VCWA 2WB9A 2MBSA 1GSFA 1J08A 1ZOFA 4WF5A 1K0DA 2PBJA 1TW9A 5ELGA 5J3RA 2IWTA 5JWRB 3DVXA 3C1RA 3GL3A 1QFNA 1SK0A 1SYRA 4WBRD 1YVLA 2WW1A 2FA8A 1DE2A 4ZILA 1AQXA 3ME8A 4K7OA 4HI7A 17GSA 5EVOA 3CMIA 3DKSA 4KH7A 1SL1B 4IW9A 3GX8A 1VF4A 2VUPA 3ZMKA 1O73A 2HSMB 1ZGNA 4F2IA 2DIZA 4PNGA 2YJ7A 1JLVA 3FYGA 2H74A 1YJ6A 4N0VA 2HZFA 3W6GA 5LCZA 2H0GA 3P90A 4XHMA 4EIPA 5G1KA 2JZRA 4OD7A 1ZCPA 1GUMA 1ERWA 4OFNA 1TU8A 2E2MA 4V1Ag 2C3NA 1GSYA 1AQWA 2A2SA 1SVLA 1OKTA 4TR1A 2X99A 1B4QA 3GYKA 2CZ3A 2VO4A 4BWQA 4HU7A 4GQFA 2HRAA 3APSA 1K3OA 1A8LA 3F4TA 3W8JA 2VL9A 3EINA 2VL2C 1C72A 2WZ9A 1ZYQB 4IKHA 1KNGA 3ZL5A 2L4CA 3ZYWA 1NW2A 4ECJA 1BQ7A 2ES7A 3P2AA 4P3YB 5CP1A 3FMWA 2DLXA 5D73A 2WCIA 2JSYA 5JCUA 1FG4A 1SKRB 5E4WA 4NV2A 2QKEA 3G7JA 4HZ2A 2CX3A 4POMA 1U87A 3F6FA 4K2XA 3TKSE 4MABA 2MBTA 1T4ZA 2P0GA 3WYWA 1X9SB 3QFAC 1O7UA 3BBYA 2IMFA 2H0HA 4Z7XA 1IYIA 4G0LA 4MP4A 2F8AA 2XPEA 3HVSA 2R3XA 5ECMB 22GSA 2E7PA 4MF6A 2VCQA 2LJKA 1GSDA 2WVZA 1QUWA 1EGRA 4KAEA 3R2QA 1O81A 1EOHA 3IA1A 1YY7A 5A4WA 4FH8A 4RQXA 3EVIA 1HQOA 2GQLA 1GULA 2O89A 4MZBA 6GSYA 4MCUA 4AJ6A 1MTCA 3DD3A 2ZCTA 2TIRA 3A2VA 3FZAA 3IR4A 4YQVA 4HOJA 5EPFA 3CSHA 1Q4JA 1G6YA 2HRKA 4XRAA 2WVXB 2CT6A 1J0FA 3TRXA 2YZUA 2N5AA 2CVDA 2UV8G 5B8AA 1EV4A 4EIQA 4PURA 1PSQA 3C1SA 1YEWC 4L5LA 1ST9A 4WETA 1A8YA 2O5VA 2WDUA 3RGBC 3KP8A 5IOWA 2M80A 1TI1A 4O5RA 3CTFA 1Q98A 3APQA 4KSOA 5AGYA 6GSXA 1SYXA 1OE7A 5J4UA 4K0GA 5LNKe 3I9V2 3RDWA 1VF1A 2PVQA 3K8NA 3UMAA 4Z2RA 2C0DA 1Z5YE 1K0CA 1R7HA 3VK9A 5ID2A 1BF5A 5ID2B 3VWXA 5ECOB 2IFQA 3TJJA 4O5UA 1JLWA 3HYPA 1EGOA 4DSSB 3E0UA 2XC2A 2H6ZA 3GA4A 2NTOA 18GSA 3DGQA 3HZ4A 2X8HA 3VURA 1F3BA 5ECSA 3KZQA 2KP1A 2I4AA 1XOBA 4N11A 1K0BA 3TU3B 2AYTA 1T3BA 5BMUB 2R37A 4XRDA 3D22A 2FHEA 1AC1A 4V2MA 2HZEA 4JRRA 2LRTA 1BYEA 1X5DA 3L9SA 1GTIA 5F0GA 1GLQA 1NSWA 2VLTA 2X4AA 3UBKA 3HDCA 4TXOA 1Y6EA 4D73A 2YJHA 2C8UA 3HJPA 4RQRA 1FVKA 3PPUA 4MMMA 2X8CA 2VKZG 5DCGA 4O32A 5G30A 1LBKA 1ERUA 4LLRA 3L9VA 2JZTA 2EFEA 2REMA 1XCCA 1ERVA 3GFKA 5HQPA 4OFMA 4ULXA 3EWLA 5CNWA 4ZB6A 3H1NA 2K6VA 5F07A 1A0FA 3VPTA 3KGKA 5A4UA 4MJAA 3ERGA 3QAGA 1N8JA 4OO5A 3DIEA 4GLTA 2XPDA 4YKGA 4EXJA 5A5KA 4EC0A 2PMTA 2CX4A 1N2AA 1V2AA 4AKHA 1GTAA 5FWGA 5A34A 2DMMA 4NHWA 3OR5A 1K3YA 5IO2A 3FHKA 3IK7A 2UZ8A 2LRCA 5B6NA 4WR5A 2DKIA 4J2FA 2MMZA 3BJ5A 4EL1A 3C71A 1S3RA 3KIJA 3EU4A 4FYUA 2M46A 5GZZB 3QPMA 3GNJA 3MWHA 1BAYA 5HR2A 2FGXA 3ZTLA 1Y25A 3V1WA 3CRTA 3EU3A 8GSSA 3FZ5A 4IHUA 2F9SA 4YKFA 5KEJA 4TXVA 1ZL9A 1U6TA 3RHCA 10GSA 4GXZA 4FYCA 1F37A 4GRFA 1DUGA 4IVFA 1A2MA 1MEKA 2LRNA 3UJ1A 3NZNA 3HMJG 2KUCA 1E2YA 3BD2A 4O5QA 1FB6A 2GT6A 1A23A 5H5QA 3G7IA 3UAPA 5DVBA 3BCKA 5JCGA 1K3LA 4ZIJA 3CXGA 1EV9A 3UARA 5CYYA 3FR6A 5FHIA 1MDKA 2AUVA 1RW1A 4BA7A 3LG6A 2K8SA 9GSSA 5F05A 5AIVA 2RM5A 1AXDA 3GKKA 1Z7RA 3F4SA 4L0UA 1V40A 4K7NA 16GSA 4H86A 1V58A 1M0UA 1JZOA 3FZ9A 3M9JA 3VI7A 4GTUA 2WGRA 5D96A 3UEMA 3M3MA 3O6TA 1BJXA 1TI3A 1O8WA 4ECCA 4BVXA 2VCXA 1S3CA 1J9BA 2EC4A 3KXOA 1DE1A 3HA9A 1XPVA 3IC4A 1TXUA 1Z9HA 1AW9A 4MZCA 3PINA 4X4JA 1F6MC 2VAFA 1ACVA 1F3AA 2HSNB 5FT3A 4HZ4A 4KW6A 2V41A 4L8EA 2X8GA 4ZXGA 1TK8B 2XHFA 2K9FA 5BMUA 4WBJA 2H1AA 4ML6A 1YEXA 3FR9A 1GH2A 4V2NA 4HQZA 2N5FA 3LXZA 2H75A 1PKWA 3GKMA 1WRYA 3IOSA 4NWYA 1K0OA 3KJYA 1MD3A 1O6JA 4JBBA 3C7MA 2YWOA 3MAKA 5EL8A 5CAXA 1LJRA 3KMNA 3SBCA 2O36A 5IMCA 3O76A 1SVOA 4PHZC 1OAZA 3EMPA 1H4OA 4RUVA 1SVMA 3E9JB 5ECLB 2YV7A 4QL9A 5BRTA 1XOAA 4PQ1A 1QMVA 1QQ2A 4A5PA 1NHYA 2O87A 1MD4A 1V98A 1ZMAA 3GRXA 1G0TA 2BMXA 3CRUA 4CY6A 4IS0A 2G2QA 1PX7A 4PNFA 4G10A 2FWEA 2KP2A 4Q5NA 3DMLA 3RPNA 2WRTA 1RQMA 1AAZA 3D4MA 3VPQA 1EWXA 1OC8A 2GQKA 4YAPA 6GSVA 2N5BA 4TR3A 4KUNA 2E0QA 7GSSA 2FA4A 1OC9B 1W89A 2JACA 3TB2A 3RPPA 1PKZA 1FHEA 3VWVA 3KTLA 1T7PB 5DQSA
chains in the Genus database with same CATH topology
2PVOC 3DWVA 2ON7A 1TJDA 2PGTA 2HSHA 2B1LA 3EMXA 3TJBA 2WJUA 3M8NA 4K7IA 3MDKA 4KB3A 4Q5QA 5KN0A 4IN0A 5J5NA 3DYRA 1YF1A 4GSSA 5HFGA 2BJXA 5GAND 1FO5A 2O8VB 3G7YA 3RAZA 2OACA 3FR3A 1DBYA 1YF0A 3D4TA 3J7Yb 3QMXA 5G2ZA 1K0NA 2C0GA 3IK9A 5AIXA 1XW6A 1YEPA 2YP6A 2H1LA 2QC7A 3TKQA 3VLNA 3VWUA 1X9MB 4HJMA 2PU9C 1CQGA 1GL8A 4KDXA 4WKWA 20GSA 3GL5A 1PL1A 2IMEA 2HSMA 2LJRA 1U3AA 1G7OA 1TDIA 2DIYA 4G2EA 2C3QA 1ABAA 3P7XA 4K8MA 2H76A 4WXTA 3GSTA 3QR6A 4J56E 2JADA 1PA3A 4K2DA 3LYKA 1T8EB 2HRFA 2OT3A 1V9WA 1V57A 1Z6NA 1A0RP 1QK8A 1WJKA 3I43A 2X49A 3QAVA 3ME7A 4BVYB 2R4VA 3LSZA 2GZYA 3UVTA 4GWRA 5DALB 3J7Yk 3VWWA 2OBKA 2EIQA 4GF0A 3N5OA 2V6KA 13GSA 2H73A 1GRXA 1GSQA 3HVXA 3EYTA 4POKA 2LQOA 3FEUA 1KEBA 5CO3A 3LEFA 2MMOA 2DJKA 4TRXA 2HNLA 4ZL8A 2YANA 3F3RA 3KEBA 4XS6A 5IIZA 2YWMA 3DRNA 3GIXA 3F9UA 3KTBA 3LJRA 2HQTA 3TJGA 4N3ZA 2HFDA 4NPBA 4ZBAA 3BCIA 1GSUA 4KA0A 2VCZA 2PERA 5ELAA 2VLVA 3US3A 3G9BA 4QQ7A 1XW9A 4HU9A 1ZZYA 3F3QA 2GGTA 4F0BA 1BX9A 1WOUA 2LQQA 4PXOA 2NDOA 5AISA 2FY6A 1SL0B 4GDFA 2A2PA 2C0FA 5GSSA 1YQ1A 1XWBA 3MSZA 3D6IA 4EKZA 2IFQB 3M1GA 3GV1A 4I5QA 11GSA 4RI6A 5D9TA 2JZSA 1R4WA 3Q74A 2OE0A 5CRDA 4ZB8A 1SK1A 1O8XA 3DVWA 1JZRA 1M2DA 1RK4A 4XTSA 4IP6A 1KTEA 2G0FA 3NOFA 14GSA 5D8IA 2HRKB 4LL1B 5ECQB 5J47A 4HEA2 4BPYA 1S3DA 2NVLA 3I69A 4KCEA 2GSQA 2PUKC 2GT5A 1U88A 1XVQA 1PQNA 1OC3A 2ZUPA 4XS4A 4KCAA 5CREA 1PMTA 4W66A 2YWNA 3QOUA 2B5EA 2CA8A 2A4VA 3L9UA 3EE2A 5B8BA 3PGTA 2MYGA 1R26A 3LXTA 2GZZA 3TGZA 4EE0A 3ZVJD 2H6YA 4BL7B 1EP7A 5KN1A 1M2AA 1M2BA 1VGLA 3IDVA 3TJKA 1YZXA 2YV9A 1A24A 4ILFA 4TXOB 4D73B 4MNNA 3D0ZA 4FYBA 1FOVA 3QAWA 1AUCA 2TRCP 3GN3A 3QFBC 3IAM2 1TK5B 1XWGA 4IP1A 2ON5A 2GSSA 1XW5A 4K5SA 3GH9A 1SK2A 4E8HA 4DSSA 1X9WB 4ECBA 2H30A 3KD0A 2VD1A 5JWQB 1UN2A 3QCPA 3N9JA 1I5GA 4AGSA 2YPMA 1TRSA 5DDLA 4N30A 3ZREA 3ZIJA 1N25A 1TRWA 4OO4A 1F9MA 2HE3A 6GSTA 1O85A 3M0FA 2VIMA 3TOUA 2YCDA 1WMJA 1TOFA 4OMVA 4YQUA 2OJLA 3F63A 3IXRA 2H0IA 2F51A 1OKDA 1MDJA 2TRXA 3FK8A 4OCFA 1XWKA 2B7KA 4G19A 4GSNA 5E59A 1JHBA 3UVHA 2GQMA 3VFIA 4Z2UA 1URMA 2X64A 2CV4A 2LNSA 2B7JA 2ALBA 3DXBA 1G6WA 2PN8A 2VL3A 4OFTA 1B48A 2WULA 5COHA 4N0ZA 1PX6A 1GSEA 4BVYA 5GSTA 4V2LA 5J9BA 1B9XC 5ABRA 2GS3A 2EIOA 4I6XA 5HR0A 5H5RA 5IMFA 4LA1A 2V2GA 1W4VA 4NAXA 2DC5A 1WWJA 4PQHA 1XWAA 2H19A 2LV3A 5IMVA 4PQIA 1GNWA 5LD0A 4L5OA 4XS4B 3ZVJA 3KMOA 2PWJA 4ZL9A 2H72A 3GKXA 3LORA 2AJQB 3WD6A 4K1FA 4XS1A 2H66A 6GSSA 4AKXB 1FAAA 1ILOA 2L5OA 1MDIA 4WEYA 5KOWA 2MZCA 3WT2A 5C04A 3ED3A 4IJIA 4BL7A 2R5GA 1HNBA 5ECNB 3HJMA 3EPTA 3KM6A 3H79A 2IJYA 4AJ7A 5INYA 3R3EA 4E8EA 1M9AA 1I9DA 2QA2A 1ZYPA 4MPFA 1EEJA 4DSQA 3GSSA 2C3TA 1TXXA 2R0CA 2H8LA 5KN2A 3A3TA 3A2WA 2IPAA 3EC3A 3ZLPA 5EY6A 2GTUA 1PN9A 5CRHA 2V32A 3FRCA 1Z3EA 1U3IA 2J9HA 4HQSA 3TRQA 2MMNA 1K0AA 2YN1A 3APOA 5J41A 1CQHA 2IMIA 4NXIA 3W8SA 1G7EA 3H4KA 4ISDA 2JU5A 3M9KA 5IOXA 4OWYA 5IPHA 4BWSA 4O92A 3GX0A 3GUSA 1USBA 2FWHA 4LL4B 4AJ8A 4MLYA 5HFKA 3JCML 3HXSA 4YAVA 2VLUA 4EDYA 3BOAA 4AI6A 3ISOA 5H5SA 1A2JA 3TRPA 2FUG2 3IC8A 3ZRDA 4POBA 3NIVA 4ID0A 2LSTA 4EVMA 4ACSA 3LYPA 5DAKA 2HZEB 3IAS2 1A2LA 4KSMA 3F0IA 2HRNA 1VF2A 5J40A 2QA1A 3A5WA 3WGXA 4MPGA 2H1BA 3KH7A 4JE1A 2HLSA 1YKAA 5JWOB 4G9HA 2NBSA 2RIIA 3KCMA 3ZFBA 4XCSA 4XIHA 2L57A 3TCOA 2DSAA 3FZ4A 4Q5RA 4MJBA 5A5HA 2F3MA 2HSNA 2DMLA 4YQMA 2FWGA 5ECIB 1EP8A 2KOKA 2RUEA 1HD2A 4V1Ap 1SENA 5HR3A 1XFLA 3KH9A 2IN3A 2EIRA 4IQ1A 2HT9A 4AKGA 4NV5A 5DJMA 3LWAA 3UL3A 4MJCA 4ML1A 4CW9A 3TKSA 5DCHA 3VI5A 1K0MA 5IPGA 3TKRA 4F03A 2QSIA 1UC7A 5J4YA 4O7HA 4MDCA 1IYHA 2WS2A 2H70A 1T4YA 4ICYA 3IRAA 4CDOA 4EF0A 4USSA 2HI7A 2CVBA 2LEGA 2IMDA 5IM9A 2OA7A 2B6MA 1WIKA 3IPZA 4EO3A 2EFCA 3MYDA 4JU5A 4MF7A 3QD9A 3SWLA 1BG5A 2O7KA 2C80A 4MZWA 3CYNA 1TP9A 4X43A 2JSZA 2C1YA 3Q6OA 4KX4A 4MH3A 3WGDA 4QMKA 4I8BA 4PGTA 5IMZA 2FNOA 5ECRB 1T1VA 2FLSA 1NM3A 5B6MA 3IV4A 5ENUA 3L78A 2B5XA 3FKFA 3I6AA 2L6CA 3TDGA 2RM6A 1X5EA 2XBQA 1OC9A 1SJZA 2M72A 2B5YA 4WF4A 2DKHA 3IHGA 5A5HB 4GCIA 5ECHB 1FW1A 3IBHA 2R2JA 1GLPA 5D9XA 1SU9A 5HFIA 1PGTA 4DVCA 5ECKB 4ECIA 2AV4A 2OKAA 3UIWA 1F2EA 2VCVA 4ZBBA 2C0EA 3TJFA 2P5QA 1Z6MA 5KN3A 1QGVA 2GSRA 3D5JA 1M99A 4TVEA 4I2UA 2OBIA 1X0RA 5F06A 4KNDA 1LU4A 5DAKB 1GUHA 1M9BA 3H8QA 3GURA 3LQ7A 1JFUA 1EOGA 5F8BA 4Q5FA 4Z2TA 3O3TA 4G0IA 3MNGA 2QGVA 4FO5A 2CAQA 1BG1A 3CBUA 1WPIA 3KP9A 5L71A 5G1LA 5A4VA 1WE0A 5AN1A 5DJLA 1YDKA 3AY8A 4L0WA 5KOXA 2I3YA 5D93A 5GAPD 4IBPA 1GP1A 4IJ3A 4TW5A 4G0KA 1XBSA 2EFHA 2E2GA 4I2TA 3GTUA 2AAWA 4JR4A 2H1GA 3UBLA 2J23A 3ZITA 3L0HA 4ZB9A 2AB6A 1BEDA 5IMDA 2I1UA 4HS1A 2DBCA 3ZFLA 2L4QA 1X5CA 2K18A 3PR8A 2DJ2A 2I9HA 1SD9A 2PPTA 3HZ8A 2L59A 1XXUA 2GSTA 1EZKA 1ON4A 2DJ1A 4IELA 6GSUA 4KE3A 3Q18A 3QDNA 3TOTA 4OCEA 3GH6A 4YH2A 2P5RA 4KDUA 1TTZA 2CQ9A 4AKIA 1E6BA 2IL3A 1NHOA 4TN8A 1GSSA 3F8UA 3HY2A 4KDYA 4IQAA 3LGCA 3F4RA 1R5AA 2IIYA 4F9ZA 1PRXA 3CTGA 1SKSB 2RLIA 1XZOA 2GZPA 1ML6A 3CSIA 2B1KA 4EDZA 3LFLA 3GMFA 3HVVA 4JR6A 1HNAA 1YKCA 1SKWB 2FCHA 4BVXB 2MMAA 3U5RE 4F82A 4EUYA 4MJEA 1OYJA 2A4HA 4K5RA 4QL7A 2D2ZA 1TKDB 1OE8A 4JEDA 2K8VA 1T00A 4NHZA 6GSWA 2LS5A 1OVNA 4HJ2A 2WFCA 2B3SA 2O85A 4K0NA 1GTUA 2GDRA 4IGJA 1S3AA 1GTBA 1JZWA 4K6XA 5DBQA 3S9FA 5CRGA 2LTKA 5J9CA 3ZMLA 2L6DA 1PL2A 5DALA 2YZHA 2VOCA 1TRUA 4TOPA 2Z9SA 2LJAA 3ERWA 2I81A 3RHBA 2VM1A 5DQYA 5JCWA 4G01A 1Z7PA 2H71A 2HXKA 4MF5A 1UVZA 5D9VA 3H93A 2GLRA 2IMKA 4DSRA 2F8FA 4FIWA 4LMVA 3L4NA 2CZ2A 2CAIA 2R6KA 1XIYA 4MK3A 4HUAA 2A2RA 4WR4A 1AIUA 1FB0A 1PD21 4KGIA 2VCTA 1GWCA 5B7CA 5G31A 1TU7A 2HSYA 3IHQA 1FVJA 5J4VA 2DJ0A 2BTOT 1THOA 2KLXA 2L5LA 4LMWA 1M7TA 2C4JA 4POLA 3GTUB 4FQUA 1XWCA 4HDEA 1XVWA 2XBIA 1AQVA 4PTSA 3ERFA 3A5IA 4PUAA 3FW2A 3UOMA 4PX1A 4F0CA 5G5EA 3C73A 5D9WA 1Y1UA 3LW9A 2NPBA 4KF9A 5CRWA 1SD8A 1QXHA 1SL2B 1HNCA 3F6DA 5IMAA 3TKPA 4J57E 2FWFA 1SJ6A 3ZZXA 2CVKA 4ZL7A 1B4PA 1KBNA 1UA5A 1B9YC 1JZDA 3CWGA 1WP0A 1DSBA 2V1MA 2LNTA 19GSA 1H75A 3RBTA 2R0PA 2OADA 4ZB7A 5HR1A 2OE3A 1ZYNA 1VF3A 2EFDA 4TKYA 2VD0A 2R0GA 4X1UA 5A34B 1GNEA 4GSTA 4JZQA 3HKRA 4CHSA 1GUKA 2P31A 2DJ3A 5ECPB 4N10A 3A2XA 2H1DA 1ERTA 2VM2A 3WGEA 3DEXA 2H6XA 4RI7A 3CSJA 3D21A 3EURA 1SJIA 1EEMA 5IQYA 3P8WA 3HHVA 4PUFC 4K9ZA 4CY8A 2AHEA 3C8EA 2HYXA 1HYUA 4GQCA 2YOIA 4DEJA 2JL4A 3WT1A 4ZBDA 2LKUA 3IE3A 1TRVA 2FD3A 4X0XA 1FOHA 2YNXA 1VRSD 3HD5A 3PH9A 4TR4A 2H01A 5G5FA 4E68A 2RUFA 5C00A 4TR0A 1THXA 2ZNMA 3TKSC 2YWIA 3GKNA 2KHPA 1TK0B 1PN0A 3MIXA 3ZIVA 3E3EA 3U6VA 1ZYEA 4NMUA 3FY7A 2V6OA 3TUEA 3GHAA 2GVPA 3Q19A 1B8XA 3HJOA 5A1NA 3HCZA 5IO0A 4AF2A 2OE1A 4I97A 2VL2A 5A1NB 4TR1B 4MH2A 2DJJA 1R5PA 4MA9A 12GSA 2LUSA 2VCWA 2WB9A 2MBSA 1GSFA 1J08A 1ZOFA 4WF5A 1K0DA 2PBJA 1TW9A 5ELGA 5J3RA 2IWTA 5JWRB 3DVXA 3C1RA 3GL3A 1QFNA 1SK0A 1SYRA 4WBRD 1YVLA 2FA8A 1DE2A 4ZILA 1AQXA 3ME8A 4K7OA 4HI7A 17GSA 5EVOA 3CMIA 3DKSA 4KH7A 1SL1B 4IW9A 3GX8A 1VF4A 2VUPA 3ZMKA 1O73A 2HSMB 1ZGNA 4F2IA 2DIZA 4PNGA 2YJ7A 1JLVA 3FYGA 2H74A 1YJ6A 4N0VA 2HZFA 3W6GA 5LCZA 2H0GA 3P90A 4XHMA 4EIPA 5G1KA 2JZRA 4OD7A 1ZCPA 1GUMA 1ERWA 4OFNA 1TU8A 2E2MA 4V1Ag 2C3NA 1GSYA 1AQWA 2A2SA 1SVLA 1OKTA 4TR1A 2X99A 1B4QA 3GYKA 2CZ3A 2VO4A 4BWQA 4HU7A 4GQFA 2HRAA 3APSA 1K3OA 1A8LA 3F4TA 3W8JA 2VL9A 3EINA 2VL2C 1C72A 2WZ9A 1ZYQB 4IKHA 1KNGA 3ZL5A 2L4CA 3ZYWA 1NW2A 4ECJA 1BQ7A 2ES7A 3P2AA 4P3YB 5CP1A 3FMWA 2DLXA 5D73A 2WCIA 2JSYA 5JCUA 1FG4A 1SKRB 5E4WA 4NV2A 2QKEA 3G7JA 4HZ2A 2CX3A 4POMA 1U87A 3F6FA 4K2XA 3TKSE 4MABA 2MBTA 1T4ZA 2P0GA 3WYWA 1X9SB 3QFAC 1O7UA 3BBYA 2IMFA 2H0HA 4Z7XA 1IYIA 4G0LA 4MP4A 2F8AA 2XPEA 3HVSA 2R3XA 5ECMB 22GSA 2E7PA 4MF6A 2VCQA 2LJKA 1GSDA 1QUWA 1EGRA 4KAEA 3R2QA 1O81A 1EOHA 3IA1A 1YY7A 5A4WA 4FH8A 4RQXA 3EVIA 1HQOA 2GQLA 1GULA 2O89A 4MZBA 6GSYA 4MCUA 4AJ6A 1MTCA 3DD3A 2ZCTA 2TIRA 3A2VA 3FZAA 3IR4A 4YQVA 4HOJA 5EPFA 3CSHA 1Q4JA 1G6YA 2HRKA 4XRAA 2CT6A 1J0FA 3TRXA 2YZUA 2N5AA 2CVDA 2UV8G 5B8AA 1EV4A 4EIQA 4PURA 1PSQA 3C1SA 4L5LA 1ST9A 4WETA 1A8YA 2O5VA 2WDUA 3KP8A 5IOWA 2M80A 1TI1A 4O5RA 3CTFA 1Q98A 3APQA 4KSOA 5AGYA 6GSXA 1SYXA 1OE7A 5J4UA 4K0GA 5LNKe 3I9V2 3RDWA 1VF1A 2PVQA 3K8NA 3UMAA 4Z2RA 2C0DA 1Z5YE 1K0CA 1R7HA 3VK9A 5ID2A 1BF5A 5ID2B 3VWXA 5ECOB 2IFQA 3TJJA 4O5UA 1JLWA 3HYPA 1EGOA 4DSSB 3E0UA 2XC2A 2H6ZA 3GA4A 2NTOA 18GSA 3DGQA 3HZ4A 2X8HA 3VURA 1F3BA 5ECSA 3KZQA 2KP1A 2I4AA 1XOBA 4N11A 1K0BA 3TU3B 2AYTA 1T3BA 5BMUB 2R37A 4XRDA 3D22A 2FHEA 1AC1A 4V2MA 2HZEA 4JRRA 2LRTA 1BYEA 1X5DA 3L9SA 1GTIA 5F0GA 1GLQA 1NSWA 2VLTA 2X4AA 3UBKA 3HDCA 4TXOA 1Y6EA 4D73A 2YJHA 2C8UA 3HJPA 4RQRA 1FVKA 3PPUA 4MMMA 2X8CA 2VKZG 5DCGA 4O32A 5G30A 1LBKA 1ERUA 4LLRA 3L9VA 2JZTA 2EFEA 2REMA 1XCCA 1ERVA 3GFKA 5HQPA 4OFMA 4ULXA 3EWLA 5CNWA 4ZB6A 3H1NA 2K6VA 5F07A 1A0FA 3VPTA 3KGKA 5A4UA 4MJAA 3ERGA 3QAGA 1N8JA 4OO5A 3DIEA 4GLTA 2XPDA 4YKGA 4EXJA 5A5KA 4EC0A 2PMTA 2CX4A 1N2AA 1V2AA 4AKHA 1GTAA 5FWGA 5A34A 2DMMA 4NHWA 3OR5A 1K3YA 5IO2A 3FHKA 3IK7A 2UZ8A 2LRCA 5B6NA 4WR5A 2DKIA 4J2FA 2MMZA 3BJ5A 4EL1A 3C71A 3KIJA 3EU4A 4FYUA 2M46A 5GZZB 3QPMA 3GNJA 3MWHA 1BAYA 5HR2A 2FGXA 3ZTLA 1Y25A 3V1WA 3CRTA 3EU3A 8GSSA 3FZ5A 4IHUA 2F9SA 4YKFA 5KEJA 4TXVA 1ZL9A 1U6TA 3RHCA 10GSA 4GXZA 4FYCA 1F37A 4GRFA 1DUGA 4IVFA 1A2MA 1MEKA 2LRNA 3UJ1A 3NZNA 3HMJG 2KUCA 1E2YA 3BD2A 4O5QA 1FB6A 2GT6A 1A23A 5H5QA 3G7IA 3UAPA 5DVBA 3BCKA 5JCGA 1K3LA 4ZIJA 3CXGA 1EV9A 3UARA 5CYYA 3FR6A 5FHIA 1MDKA 2AUVA 1RW1A 4BA7A 3LG6A 2K8SA 9GSSA 5F05A 5AIVA 2RM5A 1AXDA 3GKKA 1Z7RA 3F4SA 4L0UA 1V40A 4K7NA 16GSA 4H86A 1V58A 1M0UA 1JZOA 3FZ9A 3M9JA 3VI7A 4GTUA 2WGRA 5D96A 3UEMA 3M3MA 3O6TA 1BJXA 1TI3A 1O8WA 4ECCA 4BVXA 2VCXA 1S3CA 1J9BA 2EC4A 3KXOA 1DE1A 3HA9A 1XPVA 3IC4A 1TXUA 1Z9HA 1AW9A 4MZCA 3PINA 4X4JA 1F6MC 2VAFA 1ACVA 1F3AA 2HSNB 5FT3A 4HZ4A 4KW6A 2V41A 4L8EA 2X8GA 4ZXGA 1TK8B 2XHFA 2K9FA 5BMUA 4WBJA 2H1AA 4ML6A 1YEXA 3FR9A 1GH2A 4V2NA 4HQZA 2N5FA 3LXZA 2H75A 1PKWA 3GKMA 1WRYA 3IOSA 4NWYA 1K0OA 3KJYA 1MD3A 1O6JA 4JBBA 3C7MA 2YWOA 3MAKA 5EL8A 5CAXA 1LJRA 3KMNA 3SBCA 5IMCA 3O76A 1SVOA 1OAZA 3EMPA 1H4OA 4RUVA 1SVMA 3E9JB 5ECLB 2YV7A 4QL9A 5BRTA 1XOAA 4PQ1A 1QMVA 1QQ2A 4A5PA 1NHYA 2O87A 1MD4A 1V98A 1ZMAA 3GRXA 1G0TA 2BMXA 3CRUA 4CY6A 4IS0A 2G2QA 1PX7A 4PNFA 4G10A 2FWEA 2KP2A 4Q5NA 3DMLA 3RPNA 2WRTA 1RQMA 1AAZA 3D4MA 3VPQA 1EWXA 1OC8A 2GQKA 4YAPA 6GSVA 2N5BA 4TR3A 4KUNA 2E0QA 7GSSA 2FA4A 1OC9B 1W89A 2JACA 3TB2A 3RPPA 1PKZA 1FHEA 3VWVA 3KTLA 1T7PB 5DQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVO C;  3DWV A;  2ON7 A;  1TJD A;  2PGT A;  2HSH A;  2B1L A;  3EMX A;  3TJB A;  2WJU A;  3M8N A;  4K7I A;  3MDK A;  4KB3 A;  4Q5Q A;  5KN0 A;  4IN0 A;  5J5N A;  3DYR A;  1YF1 A;  4GSS A;  5HFG A;  2BJX A;  5GAN D;  1FO5 A;  2O8V B;  3G7Y A;  3RAZ A;  2OAC A;  3FR3 A;  1DBY A;  1YF0 A;  3D4T A;  3J7Y b;  3QMX A;  5G2Z A;  1K0N A;  2C0G A;  3IK9 A;  5AIX A;  1XW6 A;  1YEP A;  2YP6 A;  2QC7 A;  3TKQ A;  3VLN A;  3VWU A;  1X9M B;  4HJM A;  2PU9 C;  1CQG A;  1GL8 A;  4KDX A;  4WKW A;  20GS A;  3GL5 A;  1PL1 A;  2IME A;  2HSM A;  2LJR A;  1U3A A;  1G7O A;  1TDI A;  2DIY A;  4G2E A;  2C3Q A;  1ABA A;  3P7X A;  4K8M A;  2H76 A;  4WXT A;  3GST A;  3QR6 A;  4J56 E;  2JAD A;  1PA3 A;  4K2D A;  3LYK A;  1T8E B;  2HRF A;  1V9W A;  1V57 A;  1Z6N A;  1A0R P;  1QK8 A;  1WJK A;  3I43 A;  3QAV A;  3ME7 A;  4BVY B;  2R4V A;  3LSZ A;  2GZY A;  3UVT A;  4GWR A;  5DAL B;  3J7Y k;  3VWW A;  2OBK A;  2EIQ A;  4GF0 A;  3N5O A;  2V6K A;  13GS A;  2H73 A;  1GRX A;  1GSQ A;  3HVX A;  3EYT A;  4POK A;  2LQO A;  3FEU A;  1KEB A;  5CO3 A;  3LEF A;  2MMO A;  2DJK A;  4TRX A;  2HNL A;  4ZL8 A;  2YAN A;  3F3R A;  3KEB A;  4XS6 A;  5IIZ A;  2YWM A;  3DRN A;  3GIX A;  3F9U A;  3KTB A;  3LJR A;  2HQT A;  3TJG A;  2HFD A;  4KA0 A;  4NPB A;  4ZBA A;  3BCI A;  1GSU A;  2VCZ A;  2PER A;  5ELA A;  2VLV A;  3US3 A;  3G9B A;  4QQ7 A;  1XW9 A;  4HU9 A;  1ZZY A;  3F3Q A;  2GGT A;  4F0B A;  1BX9 A;  1WOU A;  2LQQ A;  4PXO A;  2NDO A;  5AIS A;  2FY6 A;  1SL0 B;  2C0F A;  5GSS A;  1YQ1 A;  1XWB A;  3MSZ A;  3D6I A;  4EKZ A;  2IFQ B;  3M1G A;  3GV1 A;  4I5Q A;  11GS A;  4RI6 A;  5D9T A;  2JZS A;  1R4W A;  3Q74 A;  2OE0 A;  5CRD A;  4ZB8 A;  1SK1 A;  1O8X A;  3DVW A;  1JZR A;  1M2D A;  1RK4 A;  4XTS A;  4IP6 A;  1KTE A;  2G0F A;  3NOF A;  14GS A;  5D8I A;  2HRK B;  4LL1 B;  5ECQ B;  4HEA 2;  4BPY A;  1S3D A;  2NVL A;  3I69 A;  4KCE A;  2GSQ A;  2PUK C;  2GT5 A;  1U88 A;  1XVQ A;  1PQN A;  1OC3 A;  2ZUP A;  4XS4 A;  4KCA A;  5CRE A;  1PMT A;  2YWN A;  3QOU A;  2B5E A;  2CA8 A;  2A4V A;  3L9U A;  3EE2 A;  5B8B A;  3PGT A;  2MYG A;  1R26 A;  3LXT A;  2GZZ A;  3TGZ A;  4EE0 A;  3ZVJ D;  2H6Y A;  4BL7 B;  1EP7 A;  5KN1 A;  1M2A A;  1M2B A;  1VGL A;  3IDV A;  3TJK A;  1YZX A;  2YV9 A;  1A24 A;  4ILF A;  4TXO B;  4D73 B;  3D0Z A;  4FYB A;  1FOV A;  3QAW A;  1AUC A;  2TRC P;  3GN3 A;  3QFB C;  3IAM 2;  1TK5 B;  1XWG A;  4IP1 A;  2ON5 A;  2GSS A;  1XW5 A;  3GH9 A;  1SK2 A;  4E8H A;  4DSS A;  1X9W B;  4ECB A;  2H30 A;  3KD0 A;  2VD1 A;  5JWQ B;  1UN2 A;  3QCP A;  3N9J A;  1I5G A;  4AGS A;  2YPM A;  1TRS A;  5DDL A;  4N30 A;  3ZRE A;  3ZIJ A;  1TRW A;  4OO4 A;  1F9M A;  2HE3 A;  6GST A;  1O85 A;  3M0F A;  2VIM A;  3TOU A;  2YCD A;  1WMJ A;  1TOF A;  4OMV A;  4YQU A;  2OJL A;  3F63 A;  3IXR A;  2H0I A;  2F51 A;  1OKD A;  1MDJ A;  2TRX A;  3FK8 A;  4OCF A;  1XWK A;  2B7K A;  4G19 A;  4GSN A;  5E59 A;  1JHB A;  3UVH A;  2GQM A;  3VFI A;  1URM A;  2X64 A;  2CV4 A;  2LNS A;  2B7J A;  2ALB A;  3DXB A;  1G6W A;  2PN8 A;  2VL3 A;  4OFT A;  1B48 A;  2WUL A;  5COH A;  4N0Z A;  1PX6 A;  1GSE A;  4BVY A;  5GST A;  4V2L A;  5J9B A;  1B9X C;  5ABR A;  2GS3 A;  2EIO A;  4I6X A;  5HR0 A;  5H5R A;  5IMF A;  4LA1 A;  2V2G A;  1W4V A;  4NAX A;  2DC5 A;  1WWJ A;  4PQH A;  1XWA A;  2H19 A;  2LV3 A;  5IMV A;  4PQI A;  1GNW A;  5LD0 A;  4L5O A;  4XS4 B;  3ZVJ A;  3KMO A;  2PWJ A;  4ZL9 A;  2H72 A;  3GKX A;  3LOR A;  2AJQ B;  3WD6 A;  4K1F A;  4XS1 A;  2H66 A;  6GSS A;  1FAA A;  1ILO A;  2L5O A;  1MDI A;  4WEY A;  2MZC A;  3WT2 A;  5C04 A;  3ED3 A;  4IJI A;  4BL7 A;  2R5G A;  1HNB A;  5ECN B;  3HJM A;  3KM6 A;  3H79 A;  2IJY A;  4AJ7 A;  5INY A;  3R3E A;  4E8E A;  1M9A A;  1I9D A;  4MPF A;  1EEJ A;  4DSQ A;  3GSS A;  2C3T A;  1TXX A;  2H8L A;  5KN2 A;  3A3T A;  3A2W A;  2IPA A;  3EC3 A;  3ZLP A;  5EY6 A;  2GTU A;  1PN9 A;  5CRH A;  2V32 A;  3FRC A;  1Z3E A;  1U3I A;  2J9H A;  4HQS A;  3TRQ A;  2MMN A;  1K0A A;  2YN1 A;  3APO A;  5J41 A;  1CQH A;  2IMI A;  4NXI A;  3W8S A;  1G7E A;  3H4K A;  4ISD A;  2JU5 A;  3M9K A;  5IOX A;  4OWY A;  5IPH A;  4BWS A;  4O92 A;  3GX0 A;  3GUS A;  1USB A;  2FWH A;  4LL4 B;  4AJ8 A;  4MLY A;  5HFK A;  3JCM L;  3HXS A;  4YAV A;  2VLU A;  4EDY A;  3BOA A;  3ISO A;  5H5S A;  1A2J A;  3TRP A;  2FUG 2;  3IC8 A;  3ZRD A;  4POB A;  3NIV A;  4ID0 A;  2LST A;  4EVM A;  4ACS A;  3LYP A;  5DAK A;  2HZE B;  3IAS 2;  1A2L A;  4KSM A;  3F0I A;  2HRN A;  1VF2 A;  3WGX A;  3A5W A;  4MPG A;  2H1B A;  3KH7 A;  4JE1 A;  2HLS A;  1YKA A;  5JWO B;  4G9H A;  2NBS A;  2RII A;  3KCM A;  3ZFB A;  4XCS A;  4XIH A;  2L57 A;  3TCO A;  2DSA A;  3FZ4 A;  4Q5R A;  4MJB A;  2F3M A;  2DML A;  4YQM A;  2FWG A;  5ECI B;  1EP8 A;  2KOK A;  2RUE A;  1HD2 A;  4V1A p;  1SEN A;  5HR3 A;  1XFL A;  3KH9 A;  2IN3 A;  2EIR A;  4IQ1 A;  2HT9 A;  4NV5 A;  5DJM A;  3LWA A;  3UL3 A;  4MJC A;  4ML1 A;  4CW9 A;  3TKS A;  5DCH A;  3VI5 A;  1K0M A;  5IPG A;  3TKR A;  4F03 A;  2QSI A;  1UC7 A;  4O7H A;  4MDC A;  1IYH A;  2WS2 A;  2H70 A;  1T4Y A;  3IRA A;  4CDO A;  4EF0 A;  4USS A;  2HI7 A;  2CVB A;  2LEG A;  2IMD A;  5IM9 A;  2OA7 A;  2B6M A;  1WIK A;  3IPZ A;  4EO3 A;  4JU5 A;  4MF7 A;  3QD9 A;  3SWL A;  1BG5 A;  2O7K A;  2C80 A;  4MZW A;  3CYN A;  1TP9 A;  4X43 A;  2JSZ A;  2C1Y A;  3Q6O A;  4KX4 A;  4MH3 A;  3WGD A;  4I8B A;  4PGT A;  5IMZ A;  2FNO A;  5ECR B;  1T1V A;  2FLS A;  1NM3 A;  5B6M A;  3IV4 A;  5ENU A;  3L78 A;  2B5X A;  3FKF A;  3I6A A;  2L6C A;  3TDG A;  2RM6 A;  1X5E A;  2XBQ A;  1OC9 A;  1SJZ A;  2M72 A;  2B5Y A;  4WF4 A;  4GCI A;  5ECH B;  1FW1 A;  3IBH A;  2R2J A;  1GLP A;  5D9X A;  1SU9 A;  5HFI A;  1PGT A;  4DVC A;  5ECK B;  4ECI A;  2AV4 A;  2OKA A;  3UIW A;  1F2E A;  2VCV A;  4ZBB A;  2C0E A;  3TJF A;  2P5Q A;  1Z6M A;  5KN3 A;  1QGV A;  2GSR A;  3D5J A;  1M99 A;  4TVE A;  4I2U A;  2OBI A;  1X0R A;  5F06 A;  4KND A;  1LU4 A;  5DAK B;  1GUH A;  1M9B A;  3H8Q A;  3GUR A;  3LQ7 A;  1JFU A;  1EOG A;  5F8B A;  4Q5F A;  3O3T A;  4G0I A;  3MNG A;  2QGV A;  4FO5 A;  2CAQ A;  3CBU A;  1WPI A;  3KP9 A;  5L71 A;  5G1L A;  5A4V A;  1WE0 A;  5AN1 A;  5DJL A;  1YDK A;  3AY8 A;  4L0W A;  2I3Y A;  5D93 A;  5GAP D;  4IBP A;  1GP1 A;  4IJ3 A;  4TW5 A;  4G0K A;  1XBS A;  2E2G A;  4I2T A;  3GTU A;  2AAW A;  4JR4 A;  2H1G A;  3UBL A;  2J23 A;  3ZIT A;  3L0H A;  4ZB9 A;  2AB6 A;  1BED A;  5IMD A;  2I1U A;  4HS1 A;  2DBC A;  3ZFL A;  2L4Q A;  1X5C A;  2K18 A;  3PR8 A;  2DJ2 A;  2I9H A;  1SD9 A;  2PPT A;  3HZ8 A;  2L59 A;  1XXU A;  2GST A;  1EZK A;  1ON4 A;  2DJ1 A;  4IEL A;  6GSU A;  4KE3 A;  3Q18 A;  3QDN A;  3TOT A;  4OCE A;  3GH6 A;  4YH2 A;  2P5R A;  4KDU A;  1TTZ A;  2CQ9 A;  1E6B A;  2IL3 A;  1NHO A;  4TN8 A;  1GSS A;  3F8U A;  3HY2 A;  4KDY A;  4IQA A;  3LGC A;  3F4R A;  1R5A A;  2IIY A;  4F9Z A;  1PRX A;  3CTG A;  1SKS B;  2RLI A;  1XZO A;  2GZP A;  1ML6 A;  3CSI A;  2B1K A;  4EDZ A;  3LFL A;  3GMF A;  3HVV A;  4JR6 A;  1HNA A;  1YKC A;  1SKW B;  2FCH A;  4BVX B;  2MMA A;  3U5R E;  4F82 A;  4EUY A;  4MJE A;  1OYJ A;  4QL7 A;  2D2Z A;  1TKD B;  1OE8 A;  4JED A;  2K8V A;  1T00 A;  4NHZ A;  6GSW A;  2LS5 A;  1OVN A;  4HJ2 A;  2WFC A;  2B3S A;  2O85 A;  4K0N A;  1GTU A;  2GDR A;  4IGJ A;  1S3A A;  1GTB A;  1JZW A;  4K6X A;  5DBQ A;  3S9F A;  5CRG A;  2LTK A;  5J9C A;  3ZML A;  2L6D A;  1PL2 A;  5DAL A;  2YZH A;  2VOC A;  1TRU A;  4TOP A;  2Z9S A;  2LJA A;  3ERW A;  2I81 A;  3RHB A;  2VM1 A;  5DQY A;  5JCW A;  1Z7P A;  2H71 A;  2HXK A;  4MF5 A;  1UVZ A;  5D9V A;  3H93 A;  2GLR A;  2IMK A;  4DSR A;  2F8F A;  4FIW A;  4LMV A;  3L4N A;  2CZ2 A;  2CAI A;  2R6K A;  1XIY A;  4MK3 A;  4HUA A;  2A2R A;  4WR4 A;  1AIU A;  1FB0 A;  1PD2 1;  4KGI A;  2VCT A;  1GWC A;  5B7C A;  5G31 A;  1TU7 A;  2HSY A;  3IHQ A;  1FVJ A;  2DJ0 A;  2BTO T;  1THO A;  2KLX A;  2L5L A;  4LMW A;  1M7T A;  2C4J A;  4POL A;  3GTU B;  4FQU A;  1XWC A;  4HDE A;  1XVW A;  2XBI A;  1AQV A;  4PTS A;  3ERF A;  4PUA A;  3FW2 A;  3UOM A;  4PX1 A;  4F0C A;  5G5E A;  3C73 A;  5D9W A;  2NPB A;  4KF9 A;  5CRW A;  1SD8 A;  1QXH A;  1SL2 B;  1HNC A;  3F6D A;  5IMA A;  3TKP A;  4J57 E;  2FWF A;  1SJ6 A;  3ZZX A;  2CVK A;  4ZL7 A;  1B4P A;  1KBN A;  1UA5 A;  1B9Y C;  1JZD A;  1WP0 A;  1DSB A;  2V1M A;  2LNT A;  19GS A;  1H75 A;  3RBT A;  2OAD A;  5HR1 A;  2OE3 A;  1VF3 A;  4TKY A;  2VD0 A;  4X1U A;  1GNE A;  4GST A;  4JZQ A;  3HKR A;  4CHS A;  1GUK A;  2P31 A;  2DJ3 A;  5ECP B;  4N10 A;  3A2X A;  2H1D A;  1ERT A;  2VM2 A;  3WGE A;  3DEX A;  2H6X A;  4RI7 A;  3CSJ A;  3D21 A;  3EUR A;  1SJI A;  1EEM A;  5IQY A;  3P8W A;  3HHV A;  4PUF C;  4K9Z A;  2AHE A;  3C8E A;  2HYX A;  1HYU A;  4GQC A;  2YOI A;  4DEJ A;  2JL4 A;  3WT1 A;  4ZBD A;  2LKU A;  3IE3 A;  1TRV A;  2FD3 A;  4X0X A;  2YNX A;  1VRS D;  3HD5 A;  3PH9 A;  4TR4 A;  2H01 A;  5G5F A;  2RUF A;  5C00 A;  4TR0 A;  1THX A;  2ZNM A;  3TKS C;  2YWI A;  3GKN A;  2KHP A;  1TK0 B;  3ZIV A;  3E3E A;  3U6V A;  1ZYE A;  4NMU A;  3FY7 A;  2V6O A;  3TUE A;  3GHA A;  2GVP A;  3Q19 A;  1B8X A;  3HJO A;  3HCZ A;  5IO0 A;  4AF2 A;  2OE1 A;  4I97 A;  2VL2 A;  4TR1 B;  4MH2 A;  2DJJ A;  1R5P A;  4MA9 A;  12GS A;  2LUS A;  2VCW A;  2WB9 A;  2MBS A;  1GSF A;  1J08 A;  1ZOF A;  4WF5 A;  1K0D A;  2PBJ A;  1TW9 A;  5ELG A;  5J3R A;  2IWT A;  5JWR B;  3DVX A;  3C1R A;  3GL3 A;  1QFN A;  1SK0 A;  1SYR A;  4WBR D;  2FA8 A;  1DE2 A;  4ZIL A;  1AQX A;  3ME8 A;  4K7O A;  4HI7 A;  17GS A;  5EVO A;  3CMI A;  3DKS A;  4KH7 A;  1SL1 B;  4IW9 A;  3GX8 A;  1VF4 A;  2VUP A;  3ZMK A;  1O73 A;  2HSM B;  1ZGN A;  4F2I A;  2DIZ A;  4PNG A;  2YJ7 A;  1JLV A;  3FYG A;  2H74 A;  1YJ6 A;  4N0V A;  2HZF A;  3W6G A;  5LCZ A;  2H0G A;  3P90 A;  4XHM A;  5G1K A;  2JZR A;  4OD7 A;  1ZCP A;  1GUM A;  1ERW A;  4OFN A;  1TU8 A;  2E2M A;  4V1A g;  2C3N A;  1GSY A;  1AQW A;  2A2S A;  1OKT A;  4TR1 A;  2X99 A;  1B4Q A;  3GYK A;  2CZ3 A;  2VO4 A;  4BWQ A;  4HU7 A;  4GQF A;  2HRA A;  3APS A;  1K3O A;  1A8L A;  3F4T A;  3W8J A;  2VL9 A;  3EIN A;  2VL2 C;  1C72 A;  2WZ9 A;  1ZYQ B;  4IKH A;  1KNG A;  3ZL5 A;  2L4C A;  3ZYW A;  1NW2 A;  4ECJ A;  1BQ7 A;  2ES7 A;  3P2A A;  4P3Y B;  5CP1 A;  2DLX A;  5D73 A;  2WCI A;  2JSY A;  5JCU A;  1FG4 A;  1SKR B;  5E4W A;  4NV2 A;  2QKE A;  3G7J A;  4HZ2 A;  2CX3 A;  4POM A;  1U87 A;  3F6F A;  3TKS E;  4MAB A;  2MBT A;  1T4Z A;  2P0G A;  3WYW A;  1X9S B;  3QFA C;  1O7U A;  3BBY A;  2IMF A;  2H0H A;  4Z7X A;  1IYI A;  4G0L A;  4MP4 A;  2F8A A;  2XPE A;  3HVS A;  2R3X A;  5ECM B;  22GS A;  2E7P A;  4MF6 A;  2VCQ A;  2LJK A;  1GSD A;  1QUW A;  1EGR A;  4KAE A;  3R2Q A;  1O81 A;  1EOH A;  3IA1 A;  1YY7 A;  5A4W A;  4FH8 A;  4RQX A;  3EVI A;  1HQO A;  2GQL A;  1GUL A;  2O89 A;  4MZB A;  6GSY A;  4MCU A;  4AJ6 A;  1MTC A;  3DD3 A;  2ZCT A;  2TIR A;  3A2V A;  3FZA A;  3IR4 A;  4YQV A;  4HOJ A;  5EPF A;  3CSH A;  1Q4J A;  1G6Y A;  2HRK A;  4XRA A;  2CT6 A;  1J0F A;  3TRX A;  2YZU A;  2N5A A;  2CVD A;  5B8A A;  1EV4 A;  4PUR A;  1PSQ A;  3C1S A;  4L5L A;  1ST9 A;  4WET A;  1A8Y A;  2WDU A;  3KP8 A;  5IOW A;  2M80 A;  1TI1 A;  4O5R A;  3CTF A;  1Q98 A;  3APQ A;  4KSO A;  5AGY A;  6GSX A;  1SYX A;  1OE7 A;  5J4U A;  4K0G A;  5LNK e;  3I9V 2;  3RDW A;  1VF1 A;  2PVQ A;  3K8N A;  3UMA A;  2C0D A;  1Z5Y E;  1K0C A;  1R7H A;  3VK9 A;  5ID2 A;  5ID2 B;  3VWX A;  5ECO B;  2IFQ A;  3TJJ A;  1JLW A;  3HYP A;  1EGO A;  4DSS B;  3E0U A;  2XC2 A;  2H6Z A;  3GA4 A;  2NTO A;  18GS A;  3DGQ A;  3HZ4 A;  2X8H A;  3VUR A;  1F3B A;  5ECS A;  3KZQ A;  2KP1 A;  2I4A A;  1XOB A;  4N11 A;  1K0B A;  2AYT A;  1T3B A;  2R37 A;  4XRD A;  3D22 A;  2FHE A;  1AC1 A;  4V2M A;  2HZE A;  4JRR A;  2LRT A;  1BYE A;  1X5D A;  3L9S A;  1GTI A;  5F0G A;  1GLQ A;  1NSW A;  2VLT A;  3UBK A;  3HDC A;  4TXO A;  1Y6E A;  4D73 A;  2YJH A;  2C8U A;  3HJP A;  4RQR A;  1FVK A;  3PPU A;  4MMM A;  2X8C A;  5DCG A;  4O32 A;  5G30 A;  1LBK A;  1ERU A;  4LLR A;  3L9V A;  2JZT A;  2REM A;  1XCC A;  1ERV A;  3GFK A;  5HQP A;  4OFM A;  4ULX A;  3EWL A;  5CNW A;  4ZB6 A;  3H1N A;  2K6V A;  5F07 A;  1A0F A;  3VPT A;  3KGK A;  5A4U A;  4MJA A;  3ERG A;  3QAG A;  1N8J A;  4OO5 A;  3DIE A;  4GLT A;  2XPD A;  4EXJ A;  5A5K A;  4EC0 A;  2PMT A;  2CX4 A;  1N2A A;  1V2A A;  1GTA A;  5FWG A;  2DMM A;  4NHW A;  3OR5 A;  1K3Y A;  5IO2 A;  3FHK A;  3IK7 A;  2UZ8 A;  2LRC A;  5B6N A;  4WR5 A;  4J2F A;  2MMZ A;  3BJ5 A;  4EL1 A;  3C71 A;  3KIJ A;  3EU4 A;  4FYU A;  2M46 A;  5GZZ B;  3QPM A;  3GNJ A;  3MWH A;  1BAY A;  5HR2 A;  2FGX A;  3ZTL A;  1Y25 A;  3V1W A;  3CRT A;  3EU3 A;  8GSS A;  3FZ5 A;  4IHU A;  2F9S A;  5KEJ A;  4TXV A;  1ZL9 A;  1U6T A;  3RHC A;  10GS A;  4GXZ A;  4FYC A;  1F37 A;  4GRF A;  1DUG A;  4IVF A;  1A2M A;  1MEK A;  2LRN A;  3UJ1 A;  2KUC A;  3NZN A;  1E2Y A;  3BD2 A;  1FB6 A;  2GT6 A;  1A23 A;  5H5Q A;  3G7I A;  3UAP A;  5DVB A;  3BCK A;  5JCG A;  1K3L A;  4ZIJ A;  3CXG A;  1EV9 A;  3UAR A;  5CYY A;  3FR6 A;  5FHI A;  1MDK A;  2AUV A;  1RW1 A;  4BA7 A;  3LG6 A;  2K8S A;  9GSS A;  5F05 A;  5AIV A;  2RM5 A;  1AXD A;  3GKK A;  1Z7R A;  3F4S A;  4L0U A;  1V40 A;  4K7N A;  16GS A;  4H86 A;  1V58 A;  1M0U A;  1JZO A;  3FZ9 A;  3M9J A;  3VI7 A;  4GTU A;  2WGR A;  5D96 A;  3UEM A;  3M3M A;  3O6T A;  1BJX A;  1TI3 A;  1O8W A;  4ECC A;  4BVX A;  2VCX A;  1S3C A;  1J9B A;  2EC4 A;  3KXO A;  1DE1 A;  3HA9 A;  1XPV A;  3IC4 A;  1Z9H A;  1AW9 A;  4MZC A;  3PIN A;  1F6M C;  2VAF A;  1ACV A;  1F3A A;  2HSN B;  5FT3 A;  4HZ4 A;  4KW6 A;  2V41 A;  4L8E A;  2X8G A;  4ZXG A;  1TK8 B;  2XHF A;  2K9F A;  5BMU A;  4WBJ A;  2H1A A;  4ML6 A;  1YEX A;  3FR9 A;  1GH2 A;  4V2N A;  4HQZ A;  2N5F A;  3LXZ A;  2H75 A;  1PKW A;  3GKM A;  1WRY A;  3IOS A;  4NWY A;  1K0O A;  3KJY A;  1MD3 A;  1O6J A;  4JBB A;  3C7M A;  2YWO A;  3MAK A;  5EL8 A;  5CAX A;  1LJR A;  3KMN A;  3SBC A;  5IMC A;  3O76 A;  1OAZ A;  3EMP A;  1H4O A;  4RUV A;  3E9J B;  5ECL B;  2YV7 A;  4QL9 A;  1XOA A;  4PQ1 A;  1QMV A;  1QQ2 A;  1NHY A;  2O87 A;  1MD4 A;  1V98 A;  1ZMA A;  3GRX A;  1G0T A;  2BMX A;  3CRU A;  4IS0 A;  2G2Q A;  1PX7 A;  4PNF A;  4G10 A;  2FWE A;  2KP2 A;  4Q5N A;  3DML A;  3RPN A;  2WRT A;  1RQM A;  1AAZ A;  3D4M A;  3VPQ A;  1EWX A;  1OC8 A;  2GQK A;  4YAP A;  6GSV A;  2N5B A;  4TR3 A;  4KUN A;  2E0Q A;  7GSS A;  2FA4 A;  1OC9 B;  1W89 A;  2JAC A;  3TB2 A;  3RPP A;  1PKZ A;  1FHE A;  3VWV A;  3KTL A;  1T7P B;  5DQS A; 
#chains in the Genus database with same CATH topology
 2PVO C;  3DWV A;  2ON7 A;  1TJD A;  2PGT A;  2HSH A;  2B1L A;  3EMX A;  3TJB A;  2WJU A;  3M8N A;  4K7I A;  3MDK A;  4KB3 A;  4Q5Q A;  5KN0 A;  4IN0 A;  5J5N A;  3DYR A;  1YF1 A;  4GSS A;  5HFG A;  2BJX A;  5GAN D;  1FO5 A;  2O8V B;  3G7Y A;  3RAZ A;  2OAC A;  3FR3 A;  1DBY A;  1YF0 A;  3D4T A;  3J7Y b;  3QMX A;  5G2Z A;  1K0N A;  2C0G A;  3IK9 A;  5AIX A;  1XW6 A;  1YEP A;  2YP6 A;  2H1L A;  2QC7 A;  3TKQ A;  3VLN A;  3VWU A;  1X9M B;  4HJM A;  2PU9 C;  1CQG A;  1GL8 A;  4KDX A;  4WKW A;  20GS A;  3GL5 A;  1PL1 A;  2IME A;  2HSM A;  2LJR A;  1U3A A;  1G7O A;  1TDI A;  2DIY A;  4G2E A;  2C3Q A;  1ABA A;  3P7X A;  4K8M A;  2H76 A;  4WXT A;  3GST A;  3QR6 A;  4J56 E;  2JAD A;  1PA3 A;  4K2D A;  3LYK A;  1T8E B;  2HRF A;  2OT3 A;  1V9W A;  1V57 A;  1Z6N A;  4PI0 C;  2WVX A;  1A0R P;  1QK8 A;  1WJK A;  3I43 A;  2X49 A;  3QAV A;  3ME7 A;  4BVY B;  2R4V A;  3LSZ A;  2GZY A;  3UVT A;  2WW3 A;  4GWR A;  5DAL B;  3J7Y k;  3VWW A;  2OBK A;  2EIQ A;  4GF0 A;  3N5O A;  2V6K A;  13GS A;  2H73 A;  1GRX A;  1GSQ A;  3HVX A;  3EYT A;  4POK A;  2LQO A;  3FEU A;  1KEB A;  5CO3 A;  3LEF A;  2MMO A;  2DJK A;  4TRX A;  2HNL A;  4ZL8 A;  2YAN A;  3F3R A;  3KEB A;  4XS6 A;  5IIZ A;  2YWM A;  3DRN A;  3GIX A;  3F9U A;  3KTB A;  3LJR A;  3CQF A;  2HQT A;  3TJG A;  4N3Z A;  2HFD A;  4NPB A;  4ZBA A;  3BCI A;  1GSU A;  4KA0 A;  2VCZ A;  2PER A;  5ELA A;  2VLV A;  3US3 A;  3G9B A;  4QQ7 A;  1XW9 A;  4HU9 A;  1ZZY A;  3F3Q A;  2GGT A;  4F0B A;  1BX9 A;  1WOU A;  2LQQ A;  4PXO A;  2NDO A;  5AIS A;  2FY6 A;  1SL0 B;  4GDF A;  2A2P A;  2C0F A;  5GSS A;  1YQ1 A;  1XWB A;  3MSZ A;  3D6I A;  4EKZ A;  2IFQ B;  3M1G A;  3GV1 A;  4I5Q A;  11GS A;  4RI6 A;  5D9T A;  2JZS A;  1R4W A;  3Q74 A;  2OE0 A;  5CRD A;  4ZB8 A;  1SK1 A;  1O8X A;  3DVW A;  1JZR A;  1M2D A;  1RK4 A;  4XTS A;  4IP6 A;  1KTE A;  2G0F A;  3NOF A;  14GS A;  5D8I A;  2HRK B;  4LL1 B;  5ECQ B;  5J47 A;  4HEA 2;  4BPY A;  1S3D A;  2NVL A;  3I69 A;  4KCE A;  2GSQ A;  2PUK C;  2GT5 A;  1U88 A;  1XVQ A;  1PQN A;  1OC3 A;  2ZUP A;  4XS4 A;  4KCA A;  5CRE A;  1PMT A;  4W66 A;  2YWN A;  3QOU A;  2B5E A;  2CA8 A;  2A4V A;  3L9U A;  3EE2 A;  5B8B A;  3PGT A;  2MYG A;  1R26 A;  3LXT A;  2GZZ A;  3TGZ A;  4EE0 A;  3ZVJ D;  2H6Y A;  4BL7 B;  1EP7 A;  5KN1 A;  2WW0 A;  1M2A A;  1M2B A;  1VGL A;  3IDV A;  3TJK A;  1YZX A;  2YV9 A;  1A24 A;  4ILF A;  4TXO B;  4D73 B;  4MNN A;  3D0Z A;  4FYB A;  1FOV A;  3QAW A;  1AUC A;  2TRC P;  3GN3 A;  3QFB C;  3IAM 2;  1TK5 B;  1XWG A;  4IP1 A;  2ON5 A;  2GSS A;  1XW5 A;  4K5S A;  3GH9 A;  1SK2 A;  4E8H A;  4DSS A;  1X9W B;  4ECB A;  2H30 A;  3KD0 A;  2VD1 A;  5JWQ B;  1UN2 A;  3QCP A;  3N9J A;  1I5G A;  4AGS A;  2YPM A;  1TRS A;  5DDL A;  4N30 A;  3ZRE A;  3ZIJ A;  1N25 A;  1TRW A;  4OO4 A;  1F9M A;  2HE3 A;  6GST A;  1O85 A;  3M0F A;  2VIM A;  3TOU A;  2YCD A;  1WMJ A;  1TOF A;  4OMV A;  4YQU A;  2OJL A;  3F63 A;  3IXR A;  2H0I A;  2F51 A;  1OKD A;  1MDJ A;  2TRX A;  3FK8 A;  4OCF A;  1XWK A;  2B7K A;  4G19 A;  4GSN A;  5E59 A;  1JHB A;  3UVH A;  2GQM A;  3VFI A;  4Z2U A;  1URM A;  2X64 A;  2CV4 A;  2LNS A;  2B7J A;  2ALB A;  3DXB A;  1G6W A;  2PN8 A;  2VL3 A;  4OFT A;  1B48 A;  2WUL A;  5COH A;  4N0Z A;  1PX6 A;  1GSE A;  4BVY A;  5GST A;  4V2L A;  5J9B A;  1B9X C;  5ABR A;  2GS3 A;  2EIO A;  4I6X A;  5HR0 A;  5H5R A;  5IMF A;  4LA1 A;  2V2G A;  1W4V A;  4NAX A;  2DC5 A;  1WWJ A;  4PQH A;  1XWA A;  2H19 A;  2LV3 A;  5IMV A;  4PQI A;  1GNW A;  5LD0 A;  4L5O A;  4XS4 B;  3ZVJ A;  3KMO A;  2PWJ A;  4ZL9 A;  2H72 A;  3GKX A;  3LOR A;  2AJQ B;  3WD6 A;  4K1F A;  4XS1 A;  2H66 A;  6GSS A;  4AKX B;  1FAA A;  1ILO A;  2L5O A;  1MDI A;  4WEY A;  5KOW A;  2MZC A;  3WT2 A;  5C04 A;  3ED3 A;  4IJI A;  4BL7 A;  2R5G A;  1HNB A;  5ECN B;  3HJM A;  3EPT A;  3KM6 A;  3H79 A;  2IJY A;  4AJ7 A;  5INY A;  3R3E A;  4E8E A;  1M9A A;  1I9D A;  2QA2 A;  1ZYP A;  4MPF A;  1EEJ A;  4DSQ A;  3GSS A;  2C3T A;  1TXX A;  2R0C A;  2H8L A;  5KN2 A;  3A3T A;  3A2W A;  2IPA A;  3EC3 A;  3ZLP A;  5EY6 A;  2GTU A;  1PN9 A;  5CRH A;  2V32 A;  3FRC A;  1Z3E A;  1U3I A;  2J9H A;  4HQS A;  3TRQ A;  2MMN A;  1K0A A;  2YN1 A;  3APO A;  5J41 A;  1CQH A;  2IMI A;  4NXI A;  3W8S A;  1G7E A;  3H4K A;  4ISD A;  2JU5 A;  3M9K A;  5IOX A;  4OWY A;  5IPH A;  4BWS A;  4O92 A;  3GX0 A;  3GUS A;  1USB A;  2FWH A;  4LL4 B;  4AJ8 A;  4MLY A;  5HFK A;  3JCM L;  3HXS A;  4YAV A;  2VLU A;  4FXY P;  4EDY A;  3BOA A;  4AI6 A;  3ISO A;  5H5S A;  1A2J A;  3HVN A;  3TRP A;  2FUG 2;  3IC8 A;  3ZRD A;  4POB A;  3NIV A;  4ID0 A;  2LST A;  4EVM A;  4ACS A;  3LYP A;  5DAK A;  2HZE B;  3IAS 2;  1A2L A;  4KSM A;  3F0I A;  2HRN A;  1VF2 A;  5J40 A;  2QA1 A;  3A5W A;  3WGX A;  4MPG A;  2H1B A;  3KH7 A;  4JE1 A;  2HLS A;  1YKA A;  5JWO B;  4G9H A;  2NBS A;  2RII A;  3KCM A;  3ZFB A;  4XCS A;  4XIH A;  2L57 A;  3TCO A;  2DSA A;  3FZ4 A;  4Q5R A;  4MJB A;  5A5H A;  2F3M A;  2HSN A;  2DML A;  4YQM A;  2FWG A;  5ECI B;  1EP8 A;  2KOK A;  2RUE A;  1HD2 A;  4V1A p;  1SEN A;  5HR3 A;  1XFL A;  3KH9 A;  2IN3 A;  2EIR A;  4IQ1 A;  2HT9 A;  4AKG A;  4NV5 A;  5DJM A;  3LWA A;  3UL3 A;  4MJC A;  4ML1 A;  4CW9 A;  3TKS A;  5DCH A;  3VI5 A;  1K0M A;  5IPG A;  3TKR A;  4F03 A;  2QSI A;  1UC7 A;  5J4Y A;  4O7H A;  4MDC A;  1IYH A;  2WS2 A;  2H70 A;  1T4Y A;  4ICY A;  3IRA A;  4CDO A;  4EF0 A;  4USS A;  2HI7 A;  2CVB A;  2LEG A;  2IMD A;  5IM9 A;  2OA7 A;  2B6M A;  1WIK A;  3IPZ A;  4EO3 A;  2EFC A;  3MYD A;  4JU5 A;  1XG8 A;  4MF7 A;  3QD9 A;  3SWL A;  1BG5 A;  2O7K A;  2C80 A;  4MZW A;  3CYN A;  1TP9 A;  4X43 A;  2JSZ A;  2C1Y A;  3Q6O A;  4BIK A;  4KX4 A;  4MH3 A;  3WGD A;  4QMK A;  4I8B A;  4PGT A;  5IMZ A;  2FNO A;  5ECR B;  1T1V A;  2FLS A;  1NM3 A;  5B6M A;  3IV4 A;  5ENU A;  4HSC X;  3L78 A;  2B5X A;  3FKF A;  3I6A A;  2L6C A;  3TDG A;  2RM6 A;  1X5E A;  2XBQ A;  1OC9 A;  1SJZ A;  2M72 A;  2B5Y A;  4WF4 A;  2DKH A;  3IHG A;  5A5H B;  4GCI A;  5ECH B;  1FW1 A;  3IBH A;  2R2J A;  1GLP A;  5D9X A;  1SU9 A;  5HFI A;  1PGT A;  4DVC A;  5ECK B;  4ECI A;  2AV4 A;  2OKA A;  3UIW A;  1F2E A;  2VCV A;  4ZBB A;  2C0E A;  3TJF A;  2P5Q A;  1Z6M A;  5KN3 A;  1QGV A;  2GSR A;  3D5J A;  1M99 A;  4TVE A;  4I2U A;  2OBI A;  1X0R A;  5F06 A;  4KND A;  1LU4 A;  5DAK B;  1GUH A;  1M9B A;  3H8Q A;  3GUR A;  3LQ7 A;  1JFU A;  1EOG A;  5F8B A;  4Q5F A;  4Z2T A;  3O3T A;  4G0I A;  3MNG A;  2QGV A;  4FO5 A;  2CAQ A;  1BG1 A;  3CBU A;  1WPI A;  3KP9 A;  5L71 A;  5G1L A;  5A4V A;  1WE0 A;  5AN1 A;  5DJL A;  1YDK A;  3AY8 A;  1I1I P;  4L0W A;  5KOX A;  2I3Y A;  5D93 A;  5GAP D;  4IBP A;  1GP1 A;  4IJ3 A;  4TW5 A;  4G0K A;  1XBS A;  2EFH A;  2E2G A;  4I2T A;  3GTU A;  2AAW A;  4JR4 A;  2H1G A;  3UBL A;  2J23 A;  3ZIT A;  3L0H A;  4ZB9 A;  2AB6 A;  1BED A;  5IMD A;  1M3J A;  2I1U A;  4HS1 A;  2DBC A;  3ZFL A;  2L4Q A;  1X5C A;  2K18 A;  3PR8 A;  2DJ2 A;  2I9H A;  1SD9 A;  3HZ8 A;  2PPT A;  2L59 A;  1XXU A;  2GST A;  1EZK A;  1ON4 A;  2DJ1 A;  4IEL A;  6GSU A;  4KE3 A;  3Q18 A;  3QDN A;  3TOT A;  4OCE A;  3GH6 A;  4YH2 A;  2P5R A;  4KDU A;  1TTZ A;  2CQ9 A;  4AKI A;  1E6B A;  2IL3 A;  1NHO A;  4TN8 A;  1GSS A;  3F8U A;  3HY2 A;  4KDY A;  4IQA A;  3LGC A;  3F4R A;  1R5A A;  2IIY A;  4F9Z A;  1PRX A;  3CTG A;  1SKS B;  2RLI A;  1XZO A;  2GZP A;  1ML6 A;  3CSI A;  2B1K A;  4EDZ A;  3LFL A;  3GMF A;  3HVV A;  4JR6 A;  1HNA A;  3CHX C;  1YKC A;  1SKW B;  2FCH A;  4BVX B;  2MMA A;  3U5R E;  3RFR C;  4F82 A;  4EUY A;  4MJE A;  1OYJ A;  2A4H A;  4K5R A;  4QL7 A;  2D2Z A;  1TKD B;  1OE8 A;  4JED A;  2K8V A;  1T00 A;  4NHZ A;  6GSW A;  2LS5 A;  1OVN A;  4HJ2 A;  2WFC A;  2B3S A;  2O85 A;  4K0N A;  1GTU A;  2GDR A;  4IGJ A;  1S3A A;  1GTB A;  1JZW A;  4K6X A;  5DBQ A;  3S9F A;  5CRG A;  2LTK A;  4PI2 C;  5J9C A;  3ZML A;  2L6D A;  1PL2 A;  5DAL A;  2YZH A;  1PFO A;  2VOC A;  1TRU A;  4TOP A;  2Z9S A;  2LJA A;  3ERW A;  2I81 A;  3RHB A;  2VM1 A;  5DQY A;  5JCW A;  4G01 A;  1Z7P A;  2H71 A;  2HXK A;  4MF5 A;  1UVZ A;  5D9V A;  3H93 A;  2GLR A;  2IMK A;  4DSR A;  2F8F A;  4FIW A;  4LMV A;  3L4N A;  2CZ2 A;  2CAI A;  2R6K A;  1XIY A;  4MK3 A;  4HUA A;  2A2R A;  4WR4 A;  1AIU A;  1FB0 A;  1PD2 1;  4KGI A;  2VCT A;  1GWC A;  5B7C A;  5G31 A;  1TU7 A;  2HSY A;  3IHQ A;  2O3E A;  1FVJ A;  5J4V A;  2DJ0 A;  2BTO T;  1THO A;  2KLX A;  2WVY A;  2L5L A;  4LMW A;  1M7T A;  2C4J A;  4POL A;  3GTU B;  4FQU A;  1XWC A;  4HDE A;  1XVW A;  1M3I A;  2XBI A;  1AQV A;  4PTS A;  3ERF A;  3A5I A;  4PUA A;  3FW2 A;  3UOM A;  2WW2 A;  4PX1 A;  5G5E A;  4F0C A;  3C73 A;  5D9W A;  1Y1U A;  3LW9 A;  2NPB A;  4KF9 A;  5CRW A;  1SD8 A;  1QXH A;  1SL2 B;  1HNC A;  3F6D A;  5IMA A;  3TKP A;  4J57 E;  2FWF A;  1SJ6 A;  3ZZX A;  2CVK A;  4ZL7 A;  1B4P A;  1KBN A;  1UA5 A;  1B9Y C;  1JZD A;  3CWG A;  1WP0 A;  1DSB A;  2V1M A;  2LNT A;  19GS A;  2WZS A;  1H75 A;  3RBT A;  2R0P A;  2OAD A;  4ZB7 A;  5HR1 A;  2OE3 A;  1ZYN A;  1VF3 A;  2EFD A;  4TKY A;  2VD0 A;  2R0G A;  1S4B P;  4X1U A;  5A34 B;  1GNE A;  4GST A;  4JZQ A;  3HKR A;  4CHS A;  1GUK A;  2P31 A;  2DJ3 A;  5ECP B;  4N10 A;  3A2X A;  2H1D A;  1ERT A;  2VM2 A;  3WGE A;  3DEX A;  2H6X A;  4RI7 A;  3CSJ A;  3D21 A;  3EUR A;  1SJI A;  1EEM A;  5IQY A;  3P8W A;  3HHV A;  4PUF C;  4K9Z A;  4CY8 A;  2AHE A;  3C8E A;  2HYX A;  1HYU A;  4GQC A;  2YOI A;  4DEJ A;  2JL4 A;  3WT1 A;  4ZBD A;  2LKU A;  3IE3 A;  1TRV A;  2FD3 A;  4X0X A;  1FOH A;  2YNX A;  1VRS D;  3HD5 A;  3PH9 A;  4TR4 A;  2H01 A;  5G5F A;  4E68 A;  2RUF A;  5C00 A;  4TR0 A;  1THX A;  2ZNM A;  3TKS C;  2YWI A;  3GKN A;  2KHP A;  1TK0 B;  1PN0 A;  3MIX A;  3ZIV A;  3E3E A;  3U6V A;  1ZYE A;  4NMU A;  3FY7 A;  2V6O A;  3TUE A;  3GHA A;  2GVP A;  3Q19 A;  1B8X A;  3HJO A;  5A1N A;  3HCZ A;  5IO0 A;  4AF2 A;  2OE1 A;  4I97 A;  2VL2 A;  5A1N B;  4TR1 B;  4MH2 A;  2DJJ A;  1R5P A;  4MA9 A;  12GS A;  2LUS A;  2VCW A;  2WB9 A;  2MBS A;  1GSF A;  1J08 A;  1ZOF A;  4WF5 A;  1K0D A;  2PBJ A;  1TW9 A;  5ELG A;  5J3R A;  2IWT A;  5JWR B;  3DVX A;  3C1R A;  3GL3 A;  1QFN A;  1SK0 A;  1SYR A;  4WBR D;  1YVL A;  2WW1 A;  2FA8 A;  1DE2 A;  4ZIL A;  1AQX A;  3ME8 A;  4K7O A;  4HI7 A;  17GS A;  5EVO A;  3CMI A;  3DKS A;  4KH7 A;  1SL1 B;  4IW9 A;  3GX8 A;  1VF4 A;  2VUP A;  3ZMK A;  1O73 A;  2HSM B;  1ZGN A;  4F2I A;  2DIZ A;  4PNG A;  2YJ7 A;  1JLV A;  3FYG A;  2H74 A;  1YJ6 A;  4N0V A;  2HZF A;  3W6G A;  5LCZ A;  2H0G A;  3P90 A;  4XHM A;  4EIP A;  5G1K A;  2JZR A;  4OD7 A;  1ZCP A;  1GUM A;  1ERW A;  4OFN A;  1TU8 A;  2E2M A;  4V1A g;  2C3N A;  1GSY A;  1AQW A;  2A2S A;  1SVL A;  1OKT A;  4TR1 A;  2X99 A;  1B4Q A;  3GYK A;  2CZ3 A;  2VO4 A;  4BWQ A;  4HU7 A;  4GQF A;  2HRA A;  3APS A;  1K3O A;  1A8L A;  3F4T A;  3W8J A;  2VL9 A;  3EIN A;  2VL2 C;  1C72 A;  2WZ9 A;  1ZYQ B;  4IKH A;  1KNG A;  3ZL5 A;  2L4C A;  3ZYW A;  1NW2 A;  4ECJ A;  1BQ7 A;  2ES7 A;  3P2A A;  4P3Y B;  5CP1 A;  3FMW A;  2DLX A;  5D73 A;  2WCI A;  2JSY A;  5JCU A;  1FG4 A;  1SKR B;  5E4W A;  4NV2 A;  2QKE A;  3G7J A;  4HZ2 A;  2CX3 A;  4POM A;  1U87 A;  3F6F A;  4K2X A;  3TKS E;  4MAB A;  2MBT A;  1T4Z A;  2P0G A;  3WYW A;  1X9S B;  3QFA C;  1O7U A;  3BBY A;  2IMF A;  2H0H A;  4Z7X A;  1IYI A;  4G0L A;  4MP4 A;  2F8A A;  2XPE A;  3HVS A;  2R3X A;  5ECM B;  22GS A;  2E7P A;  4MF6 A;  2VCQ A;  2LJK A;  1GSD A;  2WVZ A;  1QUW A;  1EGR A;  4KAE A;  3R2Q A;  1O81 A;  1EOH A;  3IA1 A;  1YY7 A;  5A4W A;  4FH8 A;  4RQX A;  3EVI A;  1HQO A;  2GQL A;  1GUL A;  2O89 A;  4MZB A;  6GSY A;  4MCU A;  4AJ6 A;  1MTC A;  3DD3 A;  2ZCT A;  2TIR A;  3A2V A;  3FZA A;  3IR4 A;  4YQV A;  4HOJ A;  5EPF A;  3CSH A;  1Q4J A;  1G6Y A;  2HRK A;  4XRA A;  2WVX B;  2CT6 A;  1J0F A;  3TRX A;  2YZU A;  2N5A A;  2CVD A;  2UV8 G;  5B8A A;  1EV4 A;  4EIQ A;  4PUR A;  1PSQ A;  3C1S A;  1YEW C;  4L5L A;  1ST9 A;  4WET A;  1A8Y A;  2O5V A;  2WDU A;  3RGB C;  3KP8 A;  5IOW A;  2M80 A;  1TI1 A;  4O5R A;  3CTF A;  1Q98 A;  3APQ A;  4KSO A;  5AGY A;  6GSX A;  1SYX A;  1OE7 A;  5J4U A;  4K0G A;  5LNK e;  3I9V 2;  3RDW A;  1VF1 A;  2PVQ A;  3K8N A;  3UMA A;  4Z2R A;  2C0D A;  1Z5Y E;  1K0C A;  1R7H A;  3VK9 A;  5ID2 A;  1BF5 A;  5ID2 B;  3VWX A;  5ECO B;  2IFQ A;  3TJJ A;  4O5U A;  1JLW A;  3HYP A;  1EGO A;  4DSS B;  3E0U A;  2XC2 A;  2H6Z A;  3GA4 A;  2NTO A;  18GS A;  3DGQ A;  3HZ4 A;  2X8H A;  3VUR A;  1F3B A;  5ECS A;  3KZQ A;  2KP1 A;  2I4A A;  1XOB A;  4N11 A;  1K0B A;  3TU3 B;  2AYT A;  1T3B A;  5BMU B;  2R37 A;  4XRD A;  3D22 A;  2FHE A;  1AC1 A;  4V2M A;  2HZE A;  4JRR A;  2LRT A;  1BYE A;  1X5D A;  3L9S A;  1GTI A;  5F0G A;  1GLQ A;  1NSW A;  2VLT A;  2X4A A;  3UBK A;  3HDC A;  4TXO A;  1Y6E A;  4D73 A;  2YJH A;  2C8U A;  3HJP A;  4RQR A;  1FVK A;  3PPU A;  4MMM A;  2X8C A;  2VKZ G;  5DCG A;  4O32 A;  5G30 A;  1LBK A;  1ERU A;  4LLR A;  3L9V A;  2JZT A;  2EFE A;  2REM A;  1XCC A;  1ERV A;  3GFK A;  5HQP A;  4OFM A;  4ULX A;  3EWL A;  5CNW A;  4ZB6 A;  3H1N A;  2K6V A;  5F07 A;  1A0F A;  3VPT A;  3KGK A;  5A4U A;  4MJA A;  3ERG A;  3QAG A;  1N8J A;  4OO5 A;  3DIE A;  4GLT A;  2XPD A;  4YKG A;  4EXJ A;  5A5K A;  4EC0 A;  2PMT A;  2CX4 A;  1N2A A;  1V2A A;  4AKH A;  1GTA A;  5FWG A;  5A34 A;  2DMM A;  4NHW A;  3OR5 A;  1K3Y A;  5IO2 A;  3FHK A;  3IK7 A;  2UZ8 A;  2LRC A;  5B6N A;  4WR5 A;  2DKI A;  4J2F A;  2MMZ A;  3BJ5 A;  4EL1 A;  3C71 A;  1S3R A;  3KIJ A;  3EU4 A;  4FYU A;  2M46 A;  5GZZ B;  3QPM A;  3GNJ A;  3MWH A;  1BAY A;  5HR2 A;  2FGX A;  3ZTL A;  1Y25 A;  3V1W A;  3CRT A;  3EU3 A;  8GSS A;  3FZ5 A;  4IHU A;  2F9S A;  4YKF A;  5KEJ A;  4TXV A;  1ZL9 A;  1U6T A;  3RHC A;  10GS A;  4GXZ A;  4FYC A;  1F37 A;  4GRF A;  1DUG A;  4IVF A;  1A2M A;  1MEK A;  2LRN A;  3UJ1 A;  3NZN A;  3HMJ G;  2KUC A;  1E2Y A;  3BD2 A;  4O5Q A;  1FB6 A;  2GT6 A;  1A23 A;  5H5Q A;  3G7I A;  3UAP A;  5DVB A;  3BCK A;  5JCG A;  1K3L A;  4ZIJ A;  3CXG A;  1EV9 A;  3UAR A;  5CYY A;  3FR6 A;  5FHI A;  1MDK A;  2AUV A;  1RW1 A;  4BA7 A;  3LG6 A;  2K8S A;  9GSS A;  5F05 A;  5AIV A;  2RM5 A;  1AXD A;  3GKK A;  1Z7R A;  3F4S A;  4L0U A;  1V40 A;  4K7N A;  16GS A;  4H86 A;  1V58 A;  1M0U A;  1JZO A;  3FZ9 A;  3M9J A;  3VI7 A;  4GTU A;  2WGR A;  5D96 A;  3UEM A;  3M3M A;  3O6T A;  1BJX A;  1TI3 A;  1O8W A;  4ECC A;  4BVX A;  2VCX A;  1S3C A;  1J9B A;  2EC4 A;  3KXO A;  1DE1 A;  3HA9 A;  1XPV A;  3IC4 A;  1TXU A;  1Z9H A;  1AW9 A;  4MZC A;  3PIN A;  4X4J A;  1F6M C;  2VAF A;  1ACV A;  1F3A A;  2HSN B;  5FT3 A;  4HZ4 A;  4KW6 A;  2V41 A;  4L8E A;  2X8G A;  4ZXG A;  1TK8 B;  2XHF A;  2K9F A;  5BMU A;  4WBJ A;  2H1A A;  4ML6 A;  1YEX A;  3FR9 A;  1GH2 A;  4V2N A;  4HQZ A;  2N5F A;  3LXZ A;  2H75 A;  1PKW A;  3GKM A;  1WRY A;  3IOS A;  4NWY A;  1K0O A;  3KJY A;  1MD3 A;  1O6J A;  4JBB A;  3C7M A;  2YWO A;  3MAK A;  5EL8 A;  5CAX A;  1LJR A;  3KMN A;  3SBC A;  2O36 A;  5IMC A;  3O76 A;  1SVO A;  4PHZ C;  1OAZ A;  3EMP A;  1H4O A;  4RUV A;  1SVM A;  3E9J B;  5ECL B;  2YV7 A;  4QL9 A;  5BRT A;  1XOA A;  4PQ1 A;  1QMV A;  1QQ2 A;  4A5P A;  1NHY A;  2O87 A;  1MD4 A;  1V98 A;  1ZMA A;  3GRX A;  1G0T A;  2BMX A;  3CRU A;  4CY6 A;  4IS0 A;  2G2Q A;  1PX7 A;  4PNF A;  4G10 A;  2FWE A;  2KP2 A;  4Q5N A;  3DML A;  3RPN A;  2WRT A;  1RQM A;  1AAZ A;  3D4M A;  3VPQ A;  1EWX A;  1OC8 A;  2GQK A;  4YAP A;  6GSV A;  2N5B A;  4TR3 A;  4KUN A;  2E0Q A;  7GSS A;  2FA4 A;  1OC9 B;  1W89 A;  2JAC A;  3TB2 A;  3RPP A;  1PKZ A;  1FHE A;  3VWV A;  3KTL A;  1T7P B;  5DQS A; 
#chains in the Genus database with same CATH homology
 2PVO C;  3DWV A;  2ON7 A;  1TJD A;  2PGT A;  2HSH A;  2B1L A;  3EMX A;  3TJB A;  2WJU A;  3M8N A;  4K7I A;  3MDK A;  4KB3 A;  4Q5Q A;  5KN0 A;  4IN0 A;  5J5N A;  3DYR A;  1YF1 A;  4GSS A;  5HFG A;  2BJX A;  5GAN D;  1FO5 A;  2O8V B;  3G7Y A;  3RAZ A;  2OAC A;  3FR3 A;  1DBY A;  1YF0 A;  3D4T A;  3J7Y b;  3QMX A;  5G2Z A;  1K0N A;  2C0G A;  3IK9 A;  5AIX A;  1XW6 A;  1YEP A;  2YP6 A;  2H1L A;  2QC7 A;  3TKQ A;  3VLN A;  3VWU A;  1X9M B;  4HJM A;  2PU9 C;  1CQG A;  1GL8 A;  4KDX A;  4WKW A;  20GS A;  3GL5 A;  1PL1 A;  2IME A;  2HSM A;  2LJR A;  1U3A A;  1G7O A;  1TDI A;  2DIY A;  4G2E A;  2C3Q A;  1ABA A;  3P7X A;  4K8M A;  2H76 A;  4WXT A;  3GST A;  3QR6 A;  4J56 E;  2JAD A;  1PA3 A;  4K2D A;  3LYK A;  1T8E B;  2HRF A;  2OT3 A;  1V9W A;  1V57 A;  1Z6N A;  1A0R P;  1QK8 A;  1WJK A;  3I43 A;  2X49 A;  3QAV A;  3ME7 A;  4BVY B;  2R4V A;  3LSZ A;  2GZY A;  3UVT A;  4GWR A;  5DAL B;  3J7Y k;  3VWW A;  2OBK A;  2EIQ A;  4GF0 A;  3N5O A;  2V6K A;  13GS A;  2H73 A;  1GRX A;  1GSQ A;  3HVX A;  3EYT A;  4POK A;  2LQO A;  3FEU A;  1KEB A;  5CO3 A;  3LEF A;  2MMO A;  2DJK A;  4TRX A;  2HNL A;  4ZL8 A;  2YAN A;  3F3R A;  3KEB A;  4XS6 A;  5IIZ A;  2YWM A;  3DRN A;  3GIX A;  3F9U A;  3KTB A;  3LJR A;  2HQT A;  3TJG A;  4N3Z A;  2HFD A;  4NPB A;  4ZBA A;  3BCI A;  1GSU A;  4KA0 A;  2VCZ A;  2PER A;  5ELA A;  2VLV A;  3US3 A;  3G9B A;  4QQ7 A;  1XW9 A;  4HU9 A;  1ZZY A;  3F3Q A;  2GGT A;  4F0B A;  1BX9 A;  1WOU A;  2LQQ A;  4PXO A;  2NDO A;  5AIS A;  2FY6 A;  1SL0 B;  4GDF A;  2A2P A;  2C0F A;  5GSS A;  1YQ1 A;  1XWB A;  3MSZ A;  3D6I A;  4EKZ A;  2IFQ B;  3M1G A;  3GV1 A;  4I5Q A;  11GS A;  4RI6 A;  5D9T A;  2JZS A;  1R4W A;  3Q74 A;  2OE0 A;  5CRD A;  4ZB8 A;  1SK1 A;  1O8X A;  3DVW A;  1JZR A;  1M2D A;  1RK4 A;  4XTS A;  4IP6 A;  1KTE A;  2G0F A;  3NOF A;  14GS A;  5D8I A;  2HRK B;  4LL1 B;  5ECQ B;  5J47 A;  4HEA 2;  4BPY A;  1S3D A;  2NVL A;  3I69 A;  4KCE A;  2GSQ A;  2PUK C;  2GT5 A;  1U88 A;  1XVQ A;  1PQN A;  1OC3 A;  2ZUP A;  4XS4 A;  4KCA A;  5CRE A;  1PMT A;  4W66 A;  2YWN A;  3QOU A;  2B5E A;  2CA8 A;  2A4V A;  3L9U A;  3EE2 A;  5B8B A;  3PGT A;  2MYG A;  1R26 A;  3LXT A;  2GZZ A;  3TGZ A;  4EE0 A;  3ZVJ D;  2H6Y A;  4BL7 B;  1EP7 A;  5KN1 A;  1M2A A;  1M2B A;  1VGL A;  3IDV A;  3TJK A;  1YZX A;  2YV9 A;  1A24 A;  4ILF A;  4TXO B;  4D73 B;  4MNN A;  3D0Z A;  4FYB A;  1FOV A;  3QAW A;  1AUC A;  2TRC P;  3GN3 A;  3QFB C;  3IAM 2;  1TK5 B;  1XWG A;  4IP1 A;  2ON5 A;  2GSS A;  1XW5 A;  4K5S A;  3GH9 A;  1SK2 A;  4E8H A;  4DSS A;  1X9W B;  4ECB A;  2H30 A;  3KD0 A;  2VD1 A;  5JWQ B;  1UN2 A;  3QCP A;  3N9J A;  1I5G A;  4AGS A;  2YPM A;  1TRS A;  5DDL A;  4N30 A;  3ZRE A;  3ZIJ A;  1N25 A;  1TRW A;  4OO4 A;  1F9M A;  2HE3 A;  6GST A;  1O85 A;  3M0F A;  2VIM A;  3TOU A;  2YCD A;  1WMJ A;  1TOF A;  4OMV A;  4YQU A;  2OJL A;  3F63 A;  3IXR A;  2H0I A;  2F51 A;  1OKD A;  1MDJ A;  2TRX A;  3FK8 A;  4OCF A;  1XWK A;  2B7K A;  4G19 A;  4GSN A;  5E59 A;  1JHB A;  3UVH A;  2GQM A;  3VFI A;  4Z2U A;  1URM A;  2X64 A;  2CV4 A;  2LNS A;  2B7J A;  2ALB A;  3DXB A;  1G6W A;  2PN8 A;  2VL3 A;  4OFT A;  1B48 A;  2WUL A;  5COH A;  4N0Z A;  1PX6 A;  1GSE A;  4BVY A;  5GST A;  4V2L A;  5J9B A;  1B9X C;  5ABR A;  2GS3 A;  2EIO A;  4I6X A;  5HR0 A;  5H5R A;  5IMF A;  4LA1 A;  2V2G A;  1W4V A;  4NAX A;  2DC5 A;  1WWJ A;  4PQH A;  1XWA A;  2H19 A;  2LV3 A;  5IMV A;  4PQI A;  1GNW A;  5LD0 A;  4L5O A;  4XS4 B;  3ZVJ A;  3KMO A;  2PWJ A;  4ZL9 A;  2H72 A;  3GKX A;  3LOR A;  2AJQ B;  3WD6 A;  4K1F A;  4XS1 A;  2H66 A;  6GSS A;  4AKX B;  1FAA A;  1ILO A;  2L5O A;  1MDI A;  4WEY A;  5KOW A;  2MZC A;  3WT2 A;  5C04 A;  3ED3 A;  4IJI A;  4BL7 A;  2R5G A;  1HNB A;  5ECN B;  3HJM A;  3EPT A;  3KM6 A;  3H79 A;  2IJY A;  4AJ7 A;  5INY A;  3R3E A;  4E8E A;  1M9A A;  1I9D A;  2QA2 A;  1ZYP A;  4MPF A;  1EEJ A;  4DSQ A;  3GSS A;  2C3T A;  1TXX A;  2R0C A;  2H8L A;  5KN2 A;  3A3T A;  3A2W A;  2IPA A;  3EC3 A;  3ZLP A;  5EY6 A;  2GTU A;  1PN9 A;  5CRH A;  2V32 A;  3FRC A;  1Z3E A;  1U3I A;  2J9H A;  4HQS A;  3TRQ A;  2MMN A;  1K0A A;  2YN1 A;  3APO A;  5J41 A;  1CQH A;  2IMI A;  4NXI A;  3W8S A;  1G7E A;  3H4K A;  4ISD A;  2JU5 A;  3M9K A;  5IOX A;  4OWY A;  5IPH A;  4BWS A;  4O92 A;  3GX0 A;  3GUS A;  1USB A;  2FWH A;  4LL4 B;  4AJ8 A;  4MLY A;  5HFK A;  3JCM L;  3HXS A;  4YAV A;  2VLU A;  4EDY A;  3BOA A;  4AI6 A;  3ISO A;  5H5S A;  1A2J A;  3TRP A;  2FUG 2;  3IC8 A;  3ZRD A;  4POB A;  3NIV A;  4ID0 A;  2LST A;  4EVM A;  4ACS A;  3LYP A;  5DAK A;  2HZE B;  3IAS 2;  1A2L A;  4KSM A;  3F0I A;  2HRN A;  1VF2 A;  5J40 A;  2QA1 A;  3A5W A;  3WGX A;  4MPG A;  2H1B A;  3KH7 A;  4JE1 A;  2HLS A;  1YKA A;  5JWO B;  4G9H A;  2NBS A;  2RII A;  3KCM A;  3ZFB A;  4XCS A;  4XIH A;  2L57 A;  3TCO A;  2DSA A;  3FZ4 A;  4Q5R A;  4MJB A;  5A5H A;  2F3M A;  2HSN A;  2DML A;  4YQM A;  2FWG A;  5ECI B;  1EP8 A;  2KOK A;  2RUE A;  1HD2 A;  4V1A p;  1SEN A;  5HR3 A;  1XFL A;  3KH9 A;  2IN3 A;  2EIR A;  4IQ1 A;  2HT9 A;  4AKG A;  4NV5 A;  5DJM A;  3LWA A;  3UL3 A;  4MJC A;  4ML1 A;  4CW9 A;  3TKS A;  5DCH A;  3VI5 A;  1K0M A;  5IPG A;  3TKR A;  4F03 A;  2QSI A;  1UC7 A;  5J4Y A;  4O7H A;  4MDC A;  1IYH A;  2WS2 A;  2H70 A;  1T4Y A;  4ICY A;  3IRA A;  4CDO A;  4EF0 A;  4USS A;  2HI7 A;  2CVB A;  2LEG A;  2IMD A;  5IM9 A;  2OA7 A;  2B6M A;  1WIK A;  3IPZ A;  4EO3 A;  2EFC A;  3MYD A;  4JU5 A;  4MF7 A;  3QD9 A;  3SWL A;  1BG5 A;  2O7K A;  2C80 A;  4MZW A;  3CYN A;  1TP9 A;  4X43 A;  2JSZ A;  2C1Y A;  3Q6O A;  4KX4 A;  4MH3 A;  3WGD A;  4QMK A;  4I8B A;  4PGT A;  5IMZ A;  2FNO A;  5ECR B;  1T1V A;  2FLS A;  1NM3 A;  5B6M A;  3IV4 A;  5ENU A;  3L78 A;  2B5X A;  3FKF A;  3I6A A;  2L6C A;  3TDG A;  2RM6 A;  1X5E A;  2XBQ A;  1OC9 A;  1SJZ A;  2M72 A;  2B5Y A;  4WF4 A;  2DKH A;  3IHG A;  5A5H B;  4GCI A;  5ECH B;  1FW1 A;  3IBH A;  2R2J A;  1GLP A;  5D9X A;  1SU9 A;  5HFI A;  1PGT A;  4DVC A;  5ECK B;  4ECI A;  2AV4 A;  2OKA A;  3UIW A;  1F2E A;  2VCV A;  4ZBB A;  2C0E A;  3TJF A;  2P5Q A;  1Z6M A;  5KN3 A;  1QGV A;  2GSR A;  3D5J A;  1M99 A;  4TVE A;  4I2U A;  2OBI A;  1X0R A;  5F06 A;  4KND A;  1LU4 A;  5DAK B;  1GUH A;  1M9B A;  3H8Q A;  3GUR A;  3LQ7 A;  1JFU A;  1EOG A;  5F8B A;  4Q5F A;  4Z2T A;  3O3T A;  4G0I A;  3MNG A;  2QGV A;  4FO5 A;  2CAQ A;  1BG1 A;  3CBU A;  1WPI A;  3KP9 A;  5L71 A;  5G1L A;  5A4V A;  1WE0 A;  5AN1 A;  5DJL A;  1YDK A;  3AY8 A;  4L0W A;  5KOX A;  2I3Y A;  5D93 A;  5GAP D;  4IBP A;  1GP1 A;  4IJ3 A;  4TW5 A;  4G0K A;  1XBS A;  2EFH A;  2E2G A;  4I2T A;  3GTU A;  2AAW A;  4JR4 A;  2H1G A;  3UBL A;  2J23 A;  3ZIT A;  3L0H A;  4ZB9 A;  2AB6 A;  1BED A;  5IMD A;  2I1U A;  4HS1 A;  2DBC A;  3ZFL A;  2L4Q A;  1X5C A;  2K18 A;  3PR8 A;  2DJ2 A;  2I9H A;  1SD9 A;  2PPT A;  3HZ8 A;  2L59 A;  1XXU A;  2GST A;  1EZK A;  1ON4 A;  2DJ1 A;  4IEL A;  6GSU A;  4KE3 A;  3Q18 A;  3QDN A;  3TOT A;  4OCE A;  3GH6 A;  4YH2 A;  2P5R A;  4KDU A;  1TTZ A;  2CQ9 A;  4AKI A;  1E6B A;  2IL3 A;  1NHO A;  4TN8 A;  1GSS A;  3F8U A;  3HY2 A;  4KDY A;  4IQA A;  3LGC A;  3F4R A;  1R5A A;  2IIY A;  4F9Z A;  1PRX A;  3CTG A;  1SKS B;  2RLI A;  1XZO A;  2GZP A;  1ML6 A;  3CSI A;  2B1K A;  4EDZ A;  3LFL A;  3GMF A;  3HVV A;  4JR6 A;  1HNA A;  1YKC A;  1SKW B;  2FCH A;  4BVX B;  2MMA A;  3U5R E;  4F82 A;  4EUY A;  4MJE A;  1OYJ A;  2A4H A;  4K5R A;  4QL7 A;  2D2Z A;  1TKD B;  1OE8 A;  4JED A;  2K8V A;  1T00 A;  4NHZ A;  6GSW A;  2LS5 A;  1OVN A;  4HJ2 A;  2WFC A;  2B3S A;  2O85 A;  4K0N A;  1GTU A;  2GDR A;  4IGJ A;  1S3A A;  1GTB A;  1JZW A;  4K6X A;  5DBQ A;  3S9F A;  5CRG A;  2LTK A;  5J9C A;  3ZML A;  2L6D A;  1PL2 A;  5DAL A;  2YZH A;  2VOC A;  1TRU A;  4TOP A;  2Z9S A;  2LJA A;  3ERW A;  2I81 A;  3RHB A;  2VM1 A;  5DQY A;  5JCW A;  4G01 A;  1Z7P A;  2H71 A;  2HXK A;  4MF5 A;  1UVZ A;  5D9V A;  3H93 A;  2GLR A;  2IMK A;  4DSR A;  2F8F A;  4FIW A;  4LMV A;  3L4N A;  2CZ2 A;  2CAI A;  2R6K A;  1XIY A;  4MK3 A;  4HUA A;  2A2R A;  4WR4 A;  1AIU A;  1FB0 A;  1PD2 1;  4KGI A;  2VCT A;  1GWC A;  5B7C A;  5G31 A;  1TU7 A;  2HSY A;  3IHQ A;  1FVJ A;  5J4V A;  2DJ0 A;  2BTO T;  1THO A;  2KLX A;  2L5L A;  4LMW A;  1M7T A;  2C4J A;  4POL A;  3GTU B;  4FQU A;  1XWC A;  4HDE A;  1XVW A;  2XBI A;  1AQV A;  4PTS A;  3ERF A;  3A5I A;  4PUA A;  3FW2 A;  3UOM A;  4PX1 A;  4F0C A;  5G5E A;  3C73 A;  5D9W A;  1Y1U A;  3LW9 A;  2NPB A;  4KF9 A;  5CRW A;  1SD8 A;  1QXH A;  1SL2 B;  1HNC A;  3F6D A;  5IMA A;  3TKP A;  4J57 E;  2FWF A;  1SJ6 A;  3ZZX A;  2CVK A;  4ZL7 A;  1B4P A;  1KBN A;  1UA5 A;  1B9Y C;  1JZD A;  3CWG A;  1WP0 A;  1DSB A;  2V1M A;  2LNT A;  19GS A;  1H75 A;  3RBT A;  2R0P A;  2OAD A;  4ZB7 A;  5HR1 A;  2OE3 A;  1ZYN A;  1VF3 A;  2EFD A;  4TKY A;  2VD0 A;  2R0G A;  4X1U A;  5A34 B;  1GNE A;  4GST A;  4JZQ A;  3HKR A;  4CHS A;  1GUK A;  2P31 A;  2DJ3 A;  5ECP B;  4N10 A;  3A2X A;  2H1D A;  1ERT A;  2VM2 A;  3WGE A;  3DEX A;  2H6X A;  4RI7 A;  3CSJ A;  3D21 A;  3EUR A;  1SJI A;  1EEM A;  5IQY A;  3P8W A;  3HHV A;  4PUF C;  4K9Z A;  4CY8 A;  2AHE A;  3C8E A;  2HYX A;  1HYU A;  4GQC A;  2YOI A;  4DEJ A;  2JL4 A;  3WT1 A;  4ZBD A;  2LKU A;  3IE3 A;  1TRV A;  2FD3 A;  4X0X A;  1FOH A;  2YNX A;  1VRS D;  3HD5 A;  3PH9 A;  4TR4 A;  2H01 A;  5G5F A;  4E68 A;  2RUF A;  5C00 A;  4TR0 A;  1THX A;  2ZNM A;  3TKS C;  2YWI A;  3GKN A;  2KHP A;  1TK0 B;  1PN0 A;  3MIX A;  3ZIV A;  3E3E A;  3U6V A;  1ZYE A;  4NMU A;  3FY7 A;  2V6O A;  3TUE A;  3GHA A;  2GVP A;  3Q19 A;  1B8X A;  3HJO A;  5A1N A;  3HCZ A;  5IO0 A;  4AF2 A;  2OE1 A;  4I97 A;  2VL2 A;  5A1N B;  4TR1 B;  4MH2 A;  2DJJ A;  1R5P A;  4MA9 A;  12GS A;  2LUS A;  2VCW A;  2WB9 A;  2MBS A;  1GSF A;  1J08 A;  1ZOF A;  4WF5 A;  1K0D A;  2PBJ A;  1TW9 A;  5ELG A;  5J3R A;  2IWT A;  5JWR B;  3DVX A;  3C1R A;  3GL3 A;  1QFN A;  1SK0 A;  1SYR A;  4WBR D;  1YVL A;  2FA8 A;  1DE2 A;  4ZIL A;  1AQX A;  3ME8 A;  4K7O A;  4HI7 A;  17GS A;  5EVO A;  3CMI A;  3DKS A;  4KH7 A;  1SL1 B;  4IW9 A;  3GX8 A;  1VF4 A;  2VUP A;  3ZMK A;  1O73 A;  2HSM B;  1ZGN A;  4F2I A;  2DIZ A;  4PNG A;  2YJ7 A;  1JLV A;  3FYG A;  2H74 A;  1YJ6 A;  4N0V A;  2HZF A;  3W6G A;  5LCZ A;  2H0G A;  3P90 A;  4XHM A;  4EIP A;  5G1K A;  2JZR A;  4OD7 A;  1ZCP A;  1GUM A;  1ERW A;  4OFN A;  1TU8 A;  2E2M A;  4V1A g;  2C3N A;  1GSY A;  1AQW A;  2A2S A;  1SVL A;  1OKT A;  4TR1 A;  2X99 A;  1B4Q A;  3GYK A;  2CZ3 A;  2VO4 A;  4BWQ A;  4HU7 A;  4GQF A;  2HRA A;  3APS A;  1K3O A;  1A8L A;  3F4T A;  3W8J A;  2VL9 A;  3EIN A;  2VL2 C;  1C72 A;  2WZ9 A;  1ZYQ B;  4IKH A;  1KNG A;  3ZL5 A;  2L4C A;  3ZYW A;  1NW2 A;  4ECJ A;  1BQ7 A;  2ES7 A;  3P2A A;  4P3Y B;  5CP1 A;  3FMW A;  2DLX A;  5D73 A;  2WCI A;  2JSY A;  5JCU A;  1FG4 A;  1SKR B;  5E4W A;  4NV2 A;  2QKE A;  3G7J A;  4HZ2 A;  2CX3 A;  4POM A;  1U87 A;  3F6F A;  4K2X A;  3TKS E;  4MAB A;  2MBT A;  1T4Z A;  2P0G A;  3WYW A;  1X9S B;  3QFA C;  1O7U A;  3BBY A;  2IMF A;  2H0H A;  4Z7X A;  1IYI A;  4G0L A;  4MP4 A;  2F8A A;  2XPE A;  3HVS A;  2R3X A;  5ECM B;  22GS A;  2E7P A;  4MF6 A;  2VCQ A;  2LJK A;  1GSD A;  1QUW A;  1EGR A;  4KAE A;  3R2Q A;  1O81 A;  1EOH A;  3IA1 A;  1YY7 A;  5A4W A;  4FH8 A;  4RQX A;  3EVI A;  1HQO A;  2GQL A;  1GUL A;  2O89 A;  4MZB A;  6GSY A;  4MCU A;  4AJ6 A;  1MTC A;  3DD3 A;  2ZCT A;  2TIR A;  3A2V A;  3FZA A;  3IR4 A;  4YQV A;  4HOJ A;  5EPF A;  3CSH A;  1Q4J A;  1G6Y A;  2HRK A;  4XRA A;  2CT6 A;  1J0F A;  3TRX A;  2YZU A;  2N5A A;  2CVD A;  2UV8 G;  5B8A A;  1EV4 A;  4EIQ A;  4PUR A;  1PSQ A;  3C1S A;  4L5L A;  1ST9 A;  4WET A;  1A8Y A;  2O5V A;  2WDU A;  3KP8 A;  5IOW A;  2M80 A;  1TI1 A;  4O5R A;  3CTF A;  1Q98 A;  3APQ A;  4KSO A;  5AGY A;  6GSX A;  1SYX A;  1OE7 A;  5J4U A;  4K0G A;  5LNK e;  3I9V 2;  3RDW A;  1VF1 A;  2PVQ A;  3K8N A;  3UMA A;  4Z2R A;  2C0D A;  1Z5Y E;  1K0C A;  1R7H A;  3VK9 A;  5ID2 A;  1BF5 A;  5ID2 B;  3VWX A;  5ECO B;  2IFQ A;  3TJJ A;  4O5U A;  1JLW A;  3HYP A;  1EGO A;  4DSS B;  3E0U A;  2XC2 A;  2H6Z A;  3GA4 A;  2NTO A;  18GS A;  3DGQ A;  3HZ4 A;  2X8H A;  3VUR A;  1F3B A;  5ECS A;  3KZQ A;  2KP1 A;  2I4A A;  1XOB A;  4N11 A;  1K0B A;  3TU3 B;  2AYT A;  1T3B A;  5BMU B;  2R37 A;  4XRD A;  3D22 A;  2FHE A;  1AC1 A;  4V2M A;  2HZE A;  4JRR A;  2LRT A;  1BYE A;  1X5D A;  3L9S A;  1GTI A;  5F0G A;  1GLQ A;  1NSW A;  2VLT A;  2X4A A;  3UBK A;  3HDC A;  4TXO A;  1Y6E A;  4D73 A;  2YJH A;  2C8U A;  3HJP A;  4RQR A;  1FVK A;  3PPU A;  4MMM A;  2X8C A;  2VKZ G;  5DCG A;  4O32 A;  5G30 A;  1LBK A;  1ERU A;  4LLR A;  3L9V A;  2JZT A;  2EFE A;  2REM A;  1XCC A;  1ERV A;  3GFK A;  5HQP A;  4OFM A;  4ULX A;  3EWL A;  5CNW A;  4ZB6 A;  3H1N A;  2K6V A;  5F07 A;  1A0F A;  3VPT A;  3KGK A;  5A4U A;  4MJA A;  3ERG A;  3QAG A;  1N8J A;  4OO5 A;  3DIE A;  4GLT A;  2XPD A;  4YKG A;  4EXJ A;  5A5K A;  4EC0 A;  2PMT A;  2CX4 A;  1N2A A;  1V2A A;  4AKH A;  1GTA A;  5FWG A;  5A34 A;  2DMM A;  4NHW A;  3OR5 A;  1K3Y A;  5IO2 A;  3FHK A;  3IK7 A;  2UZ8 A;  2LRC A;  5B6N A;  4WR5 A;  2DKI A;  4J2F A;  2MMZ A;  3BJ5 A;  4EL1 A;  3C71 A;  3KIJ A;  3EU4 A;  4FYU A;  2M46 A;  5GZZ B;  3QPM A;  3GNJ A;  3MWH A;  1BAY A;  5HR2 A;  2FGX A;  3ZTL A;  1Y25 A;  3V1W A;  3CRT A;  3EU3 A;  8GSS A;  3FZ5 A;  4IHU A;  2F9S A;  4YKF A;  5KEJ A;  4TXV A;  1ZL9 A;  1U6T A;  3RHC A;  10GS A;  4GXZ A;  4FYC A;  1F37 A;  4GRF A;  1DUG A;  4IVF A;  1A2M A;  1MEK A;  2LRN A;  3UJ1 A;  3NZN A;  3HMJ G;  2KUC A;  1E2Y A;  3BD2 A;  4O5Q A;  1FB6 A;  2GT6 A;  1A23 A;  5H5Q A;  3G7I A;  3UAP A;  5DVB A;  3BCK A;  5JCG A;  1K3L A;  4ZIJ A;  3CXG A;  1EV9 A;  3UAR A;  5CYY A;  3FR6 A;  5FHI A;  1MDK A;  2AUV A;  1RW1 A;  4BA7 A;  3LG6 A;  2K8S A;  9GSS A;  5F05 A;  5AIV A;  2RM5 A;  1AXD A;  3GKK A;  1Z7R A;  3F4S A;  4L0U A;  1V40 A;  4K7N A;  16GS A;  4H86 A;  1V58 A;  1M0U A;  1JZO A;  3FZ9 A;  3M9J A;  3VI7 A;  4GTU A;  2WGR A;  5D96 A;  3UEM A;  3M3M A;  3O6T A;  1BJX A;  1TI3 A;  1O8W A;  4ECC A;  4BVX A;  2VCX A;  1S3C A;  1J9B A;  2EC4 A;  3KXO A;  1DE1 A;  3HA9 A;  1XPV A;  3IC4 A;  1TXU A;  1Z9H A;  1AW9 A;  4MZC A;  3PIN A;  4X4J A;  1F6M C;  2VAF A;  1ACV A;  1F3A A;  2HSN B;  5FT3 A;  4HZ4 A;  4KW6 A;  2V41 A;  4L8E A;  2X8G A;  4ZXG A;  1TK8 B;  2XHF A;  2K9F A;  5BMU A;  4WBJ A;  2H1A A;  4ML6 A;  1YEX A;  3FR9 A;  1GH2 A;  4V2N A;  4HQZ A;  2N5F A;  3LXZ A;  2H75 A;  1PKW A;  3GKM A;  1WRY A;  3IOS A;  4NWY A;  1K0O A;  3KJY A;  1MD3 A;  1O6J A;  4JBB A;  3C7M A;  2YWO A;  3MAK A;  5EL8 A;  5CAX A;  1LJR A;  3KMN A;  3SBC A;  5IMC A;  3O76 A;  1SVO A;  1OAZ A;  3EMP A;  1H4O A;  4RUV A;  1SVM A;  3E9J B;  5ECL B;  2YV7 A;  4QL9 A;  5BRT A;  1XOA A;  4PQ1 A;  1QMV A;  1QQ2 A;  4A5P A;  1NHY A;  2O87 A;  1MD4 A;  1V98 A;  1ZMA A;  3GRX A;  1G0T A;  2BMX A;  3CRU A;  4CY6 A;  4IS0 A;  2G2Q A;  1PX7 A;  4PNF A;  4G10 A;  2FWE A;  2KP2 A;  4Q5N A;  3DML A;  3RPN A;  2WRT A;  1RQM A;  1AAZ A;  3D4M A;  3VPQ A;  1EWX A;  1OC8 A;  2GQK A;  4YAP A;  6GSV A;  2N5B A;  4TR3 A;  4KUN A;  2E0Q A;  7GSS A;  2FA4 A;  1OC9 B;  1W89 A;  2JAC A;  3TB2 A;  3RPP A;  1PKZ A;  1FHE A;  3VWV A;  3KTL A;  1T7P B;  5DQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...