5FHIA

Crystallographic structure of psoe without co
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
b'MVFGTLYTFPGDQCRTIAIKAVAKANGLDLDIRETPRTPDHLSISKLGKVPAFQGADSFKLFECMAIALYITSQNEQTTLLGKDKKEYAEIIKWMSFFNTEIVILMTQQLLPQLGVIPYDRDQVEFFANMTQRSVDVVEEYLQDRTFLVGDQLSLADLFCAGNISLGFQFFYGKAWRQQNPNVSRWYEMVCHQPIYAAVTDKFQLLDEPKLTNNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, putative
publication title Oxidative trans to cis Isomerization of Olefins in Polyketide Biosynthesis.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Transferase
total genus 71
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5fhiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5fhiA01
1VF2A 1Z7RA 3H8QA 1K0NA 3KJYA 2OKAA 3MAKA 5CRWA 2MBSA 4IQ1A 2ON7A 3I69A 3APSA 1WRYA 4TR1B 3CSHA 4DSQA 14GSA 1MDIA 1TXXA 3F6DA 2GTUA 4X0XA 4Q5NA 1XVQA 3LYKA 1GLQA 2L5OA 3ZITA 3ZTLA 1PL1A 1EV9A 2KLXA 4WBJA 5ECSA 1WIKA 5IQYA 4BPYA 5HR3A 3DIEA 5DBQA 3M8NA 2V6OA 5HQPA 1TRWA 4LLRA 1TRUA 4WEYA 3L9VA 1O81A 5ECNB 3KH7A 1JZDA 1Z5YE 4YAPA 1O8XA 1DBYA 2V2GA 2MMNA 3WT2A 2GS3A 4ZBAA 1T4ZA 2HNLA 6GSVA 3LWAA 3CYNA 4L8EA 4OFTA 3Q19A 3VPTA 3QAWA 4ULXA 5IMCA 3LG6A 2F8FA 1GLPA 1XCCA 2PBJA 5IPHA 5H5SA 4IW9A 1KEBA 1GNEA 2WGRA 4HJMA 2X99A 1XVWA 2H70A 3APOA 4N10A 1JFUA 1QQ2A 2I3YA 4YQVA 4NWYA 3GKMA 2VLUA 5ECHB 6GSSA 4E8HA 1I9DA 1GUKA 4WBRD 4XS1A 1A8LA 4HQZA 4Q5QA 2L5LA 3MWHA 5ENUA 2VUPA 2YANA 4KW6A 1XPVA 3F0IA 2HRAA 1DUGA 2FNOA 2DMLA 1FVJA 4HU9A 1HQOA 3BJ5A 4KCAA 4GCIA 3TGZA 1Z6MA 1X5DA 4HOJA 3ERGA 3WGXA 3HDCA 4V1Ap 3BOAA 5DAKB 2DSAA 1BYEA 1ON4A 2YWNA 2B5YA 2H1BA 2CVDA 5JCWA 2KHPA 3ZL5A 2ON5A 5E4WA 4MZCA 4N30A 3VWWA 4F03A 2H0HA 2L59A 5FHIA 1M7TA 5H5QA 5IMZA 2PGTA 1KNGA 3FZAA 4WR5A 5FT3A 1S3CA 5LNKe 4F0BA 3CRTA 2UZ8A 4EUYA 2GZZA 3VI5A 2VM1A 3QFAC 3QMXA 3FW2A 2H6XA 4MJEA 5INYA 3MDKA 1G7OA 2LUSA 3M9JA 3FZ9A 3IK9A 1Q4JA 4POBA 2C0GA 5DDLA 5F8BA 2WJUA 2M80A 4PQIA 3V1WA 3GL3A 5CREA 5ECLB 3KD0A 4ECIA 3TJBA 1AXDA 5ELAA 2K8SA 2CX3A 3LGCA 4GLTA 1GWCA 3UARA 3KMOA 4IBPA 5D93A 2GQLA 1ERTA 1TK8B 2ALBA 1AUCA 2BJXA 3R2QA 4TR3A 4NXIA 1PSQA 4IP1A 5ECMB 4G19A 3VK9A 4TOPA 1ILOA 3NOFA 4IGJA 1R5AA 1GL8A 4IP6A 4ZL9A 4K0GA 1AW9A 1GH2A 5IOXA 3TDGA 4EDZA 1B8XA 4V2NA 3BBYA 1AC1A 1AQXA 3SWLA 2VL9A 4EDYA 5BMUA 3DKSA 4EVMA 5IPGA 5EVOA 4XS6A 1EOHA 1ZOFA 1UA5A 1KBNA 4BVYA 2JSYA 5EY6A 2FA8A 2X8HA 3WD6A 4K6XA 2YWIA 2GZYA 5KN3A 4HEA2 4OMVA 2OE0A 4PGTA 2H30A 4WKWA 5KN0A 4K7NA 4L0UA 3TKRA 4D73A 3QDNA 1QGVA 16GSA 4F9ZA 3LJRA 2NTOA 4G0LA 1XW6A 1USBA 4KSMA 2IIYA 4O92A 2J9HA 4PUAA 3ZIVA 4ZBBA 4XS4B 1F3BA 4EF0A 5D96A 3G9BA 1M9BA 2HSNB 3G7YA 2QSIA 2LRCA 1R4WA 4X43A 2H19A 1SK1A 2DIZA 2LNSA 3MNGA 4POMA 1M2AA 4G10A 1IYIA 3UEMA 2OADA 1U87A 20GSA 3F3QA 1RQMA 2DBCA 5J9BA 1QXHA 1SYXA 1SL2B 4RI6A 4Q5FA 3H4KA 2AUVA 3FR3A 4DVCA 4FO5A 3KXOA 3GN3A 1WE0A 2OACA 1H4OA 3C73A 4H86A 1K0DA 2H76A 4E8EA 1A0FA 1YZXA 3GSSA 2WDUA 2V6KA 3D22A 1GTUA 3ISOA 2YJHA 5IMDA 4RI7A 2WRTA 4KDYA 2F9SA 4HZ4A 4GWRA 1XIYA 4TXOA 2WCIA 3F9UA 4POKA 4MJCA 2GZPA 2VCVA 3TJKA 1X9MB 4XIHA 2YCDA 4QQ7A 3FEUA 5G31A 1FOVA 2AV4A 1RW1A 5IO2A 1XWCA 1JHBA 1GTIA 1W89A 4JE1A 3NIVA 1VF1A 4JR6A 3UAPA 3L9UA 1BG5A 2AB6A 4NMUA 4I97A 1S3AA 2CZ3A 3IBHA 1T4YA 4MPGA 2YJ7A 2QC7A 2L6CA 3FYGA 3QFBC 5F05A 2HRNA 2IN3A 2LV3A 3MSZA 4L5OA 5LD0A 2LRTA 2ZCTA 1NHYA 2O87A 3E9JB 3VFIA 2FCHA 5ABRA 3FZ4A 3ZRDA 4G0KA 1JZRA 4K7IA 3I6AA 5HR0A 4K0NA 3HZ4A 5HR1A 3WGEA 5B6MA 1Z6NA 3D0ZA 2DJ3A 2HRFA 1ZMAA 3GH9A 1B4QA 1BAYA 19GSA 3I43A 4AJ6A 4PQ1A 2X8GA 4WR4A 2VAFA 2CZ2A 1A0RP 2HLSA 1SU9A 4ECJA 3GRXA 3VURA 4MA9A 1XZOA 4POLA 2OBKA 3DGQA 1WJKA 1TRVA 4PUFC 5JWRB 1C72A 1SENA 3ZZXA 2WZ9A 3Q6OA 2MBTA 4QL7A 1U3IA 1A8YA 3Q18A 5KN1A 5J5NA 4K8MA 2H0IA 3F6FA 2H1GA 1GTAA 1YY7A 5AISA 2VLVA 4V2LA 4YAVA 3GKXA 4IELA 2B3SA 4PNFA 2HZFA 2P0GA 4ZIJA 5ECRB 2H8LA 2RUFA 3EC3A 3N9JA 2I1UA 1B9XC 5DALA 5CO3A 1ZCPA 2C3QA 3GNJA 1SK0A 4LA1A 3KM6A 2PU9C 3DYRA 5JCUA 1FAAA 3W8JA 2B5EA 1VF3A 2C4JA 2HXKA 3ZYWA 4YH2A 1FB0A 1A2JA 1JZOA 1K0BA 1YJ6A 4EXJA 4OFMA 3TRPA 3DEXA 1ABAA 1SJZA 4KDUA 1HNCA 3GIXA 2G2QA 3P7XA 4BL7B 3ZIJA 4FH8A 2VD0A 4OFNA 2L6DA 4P3YB 5IM9A 5AIXA 1TU7A 2MMOA 10GSA 1YDKA 5EL8A 5DJLA 3TRQA 1CQGA 2B1LA 1AAZA 5HFGA 2HRKB 2RM6A 4GSSA 2JSZA 2C3TA 2QGVA 5J41A 5G1KA 4X1UA 1A24A 1TW9A 3FRCA 4JR4A 2O85A 3TKSE 2F3MA 1JZWA 2N5AA 4G0IA 9GSSA 1PX6A 3QR6A 2MZCA 1OAZA 1X5EA 3ZFBA 1PKWA 4TXVA 2R3XA 2R4VA 3GHAA 4KF9A 2LQQA 1GNWA 1SKRB 1J0FA 3PR8A 5CAXA 2C0EA 4ML6A 3GKKA 5D9WA 2DMMA 1V9WA 3GURA 4JEDA 3ME7A 1EGRA 4EL1A 4MF6A 2DLXA 4XHMA 4G2EA 3QOUA 2GLRA 3GTUA 1QUWA 2H6YA 4ZB6A 5ID2B 4KA0A 1GRXA 1V58A 1FVKA 5GAPD 2VM2A 3TOTA 3TJFA 5IO0A 1B9YC 2V32A 2ZNMA 2L57A 1KTEA 3EE2A 2VCQA 1MTCA 1R7HA 2M46A 3HCZA 2YN1A 1SKSB 2HE3A 3DXBA 2H0GA 5CRGA 5CNWA 3D4MA 4IQAA 3HZ8A 2NBSA 4NAXA 2CQ9A 2IFQB 2VO4A 2P31A 2GQKA 2IMEA 1XWAA 2HYXA 6GSYA 1WWJA 3C71A 4KNDA 4BVXB 1SKWB 1GUMA 2IPAA 8GSSA 1THOA 2C0FA 2QKEA 1O85A 2HT9A 1DSBA 1K3YA 3IE3A 3HJPA 2F8AA 1U88A 3GA4A 5GSSA 4NV2A 4MF5A 2CV4A 4QL9A 5B8BA 3L0HA 3P90A 2O8VB 2LSTA 1X9WB 1SYRA 1BX9A 1OC9A 1LBKA 2N5FA 1RK4A 3IXRA 3HHVA 4TR4A 1LU4A 3LSZA 1THXA 2EC4A 4KCEA 1OC8A 2REMA 1SD9A 3D5JA 2HSMA 3TKQA 4DSSB 5D9TA 3TRXA 1F9MA 3IAM2 3TKSC 2LJKA 4ZL7A 2LJRA 3IHQA 2ES7A 4XRAA 2IMFA 2GVPA 3FHKA 2Z9SA 1YKCA 4KAEA 5A4VA 4WF4A 4KGIA 4YQMA 5CRHA 2KOKA 3M1GA 4OO4A 4LMWA 2XC2A 2MYGA 2OA7A 2FY6A 2HQTA 5JCGA 1SJ6A 2H1AA 1TKDB 5ECPB 4PTSA 4N11A 4JU5A 4TKYA 5J4UA 3FR6A 4GSNA 3O6TA 5IMAA 1NHOA 4TR1A 5ELGA 1GULA 2CX4A 4MZBA 3BD2A 3G7JA 1BQ7A 1TTZA 4DSRA 4EO3A 3TJJA 3ZVJD 1M99A 1UVZA 1F37A 5HFIA 4HI7A 1SL0B 2VCXA 2JADA 2RLIA 1O6JA 3HXSA 3TKSA 1U3AA 4JZQA 6GSUA 3A5WA 1MDJA 1AIUA 4L5LA 4ID0A 1PMTA 2LNTA 3P8WA 1X9SB 3QAVA 1EGOA 3LXTA 1MEKA 3UIWA 1AQVA 2PVQA 1EEMA 3W6GA 3H1NA 1PA3A 4HJ2A 2YZUA 4EC0A 4Z7XA 4GF0A 2JZRA 4L0WA 2PMTA 1PN9A 4FYUA 2LEGA 5DCGA 1YF0A 2GQMA 3RDWA 1G7EA 3WYWA 4F82A 4I6XA 5A4UA 3C1SA 2L4CA 2GDRA 3M0FA 1J9BA 4K9ZA 2B6MA 3A3TA 4ZBDA 3TJGA 4RQXA 2B7JA 4IN0A 2GT6A 1OE8A 1J08A 2CVBA 2VCTA 3IK7A 7GSSA 3IR4A 4HZ2A 5C04A 2GSQA 1XW5A 2GSSA 4CDOA 1T3BA 3KP9A 2IFQA 1EP8A 3KP8A 3ZLPA 3NZNA 2NVLA 2ZUPA 2V41A 4MK3A 2IJYA 2R6KA 3GH6A 5G1LA 2GGTA 5DAKA 4FIWA 4BVXA 4LL1B 2JU5A 4CW9A 2H73A 6GSTA 5ECIB 5ECOB 4MH2A 1V40A 3D21A 2AJQB 5KEJA 4KSOA 1GSDA 2VL2C 3EYTA 5EPFA 1ZYEA 2FA4A 4IVFA 2K8VA 3GMFA 4KH7A 3UBLA 1TDIA 1V98A 3PINA 4KUNA 3ME8A 2O7KA 5B6NA 5D73A 1BEDA 2B7KA 2H66A 3BCIA 22GSA 3DRNA 3HKRA 5D9VA 4K7OA 1FB6A 2IMKA 2LTKA 1XOAA 4ECCA 4HS1A 3EVIA 1HNAA 4AF2A 1SJIA 4O5RA 3IAS2 2B1KA 2DJKA 2FWHA 4KE3A 2WFCA 2HFDA 2CVKA 2FWEA 5C00A 3C7MA 2X64A 1H75A 1I5GA 3K8NA 4GRFA 4KX4A 2JZSA 2LKUA 3UJ1A 4IJIA 3L78A 1PQNA 3GX0A 3TCOA 1V57A 1K0CA 5IMFA 3M9KA 4ECBA 3PPUA 5JWQB 4GQFA 1EP7A 3D4TA 3F63A 1GSSA 1NSWA 1XWGA 2VL2A 3ZMKA 3PH9A 5GSTA 2DIYA 4EE0A 4YQUA 3VWVA 2AYTA 2DC5A 1TJDA 3IOSA 4F2IA 1O73A 4USSA 4RQRA 1ERUA 2F51A 5G30A 3US3A 3I9V2 2XPDA 3HA9A 2WS2A 2BMXA 3FK8A 4AGSA 2YWMA 1O8WA 1TU8A 2R37A 3J7Yk 3IV4A 2A4VA 4J57E 1Y25A 3UL3A 3KTBA 1MDKA 3JCML 2HSYA 1TI3A 1K0OA 2C1YA 5DQYA 2GT5A 3UBKA 2TIRA 3HD5A 2OE3A 2EIRA 4V1Ag 1EWXA 4JRRA 3LEFA 3A2VA 5B7CA 4XCSA 2PUKC 1T8EB 13GSA 4XS4A 1GSUA 3HJMA 3IA1A 3KGKA 5AIVA 2E7PA 3SBCA 1AQWA 2YOIA 3KZQA 1M0UA 2NDOA 4DEJA 4GTUA 1E2YA 4MABA 1PD21 5E59A 5CRDA 2H71A 3CMIA 1XWKA 4N0VA 3F4RA 1GSEA 1GTBA 2OE1A 5D9XA 5KN2A 2IMIA 3J7Yb 3EMXA 3RAZA 2YZHA 1WPIA 2GSTA 1FO5A 1TRSA 1F6MC 1M9AA 3IC8A 1U6TA 2IWTA 2E2GA 2H72A 4MMMA 1QMVA 12GSA 2L4QA 1OKDA 4ACSA 4MJBA 3KCMA 5ECKB 2KUCA 3CBUA 4BVYB 2OBIA 1F3AA 1FG4A 2EIQA 5LCZA 1TI1A 3FZ5A 4J2FA 4O32A 2E2MA 4G9HA 5HFKA 1DE1A 2E0QA 2KP1A 4PX1A 2VLTA 2CA8A 3VLNA 2VIMA 3IDVA 4N0ZA 2C80A 2JZTA 5CYYA 4OCEA 4D73B 2I9HA 2TRXA 3G7IA 4ZXGA 4OWYA 2HI7A 4IS0A 5G2ZA 5J9CA 2RUEA 2VOCA 3S9FA 3HY2A 1UN2A 4HDEA 4LMVA 6GSXA 4MH3A 4XRDA 2O89A 3LFLA 2RIIA 2D2ZA 3QCPA 1E6BA 5HR2A 2N5BA 3BCKA 3HVSA 3E0UA 3TOUA 3FKFA 2WULA 5J3RA 1SK2A 2YNXA 1OE7A 4K1FA 3TUEA 3EWLA 3F8UA 1QFNA 3L4NA 4FYCA 4OO5A 1ZL9A 1YF1A 5DCHA 1V2AA 2I81A 1NM3A 3KMNA 3U6VA 3U5RE 2EIOA 5IIZA 4TW5A 5D8IA 1B4PA 1PKZA 1PX7A 2FUG2 5COHA 1A2LA 2PPTA 1DE2A 1FHEA 4AJ7A 3PGTA 1OKTA 4J56E 4KDXA 1EOGA 4O7HA 4TXOB 2PN8A 3H93A 1ERVA 5A4WA 4GSTA 4HQSA 4NHWA 1IYHA 4XTSA 2M72A 2X8CA 1WMJA 3A2WA 1X0RA 1OYJA 2LQOA 1XW9A 4ZL8A 4K2DA 1MD4A 2IL3A 2CAQA 4IHUA 1SD8A 1ACVA 1M2BA 1TK0B 5FWGA 3VI7A 1GSYA 1N2AA 2YPMA 3RHCA 3VPQA 4MDCA 1FW1A 5ECQB 3EURA 2XPEA 11GSA 1TK5B 5DQSA 2AHEA 2PVOC 3RPPA 3DWVA 3F4TA 4TR0A 2HSHA 3OR5A 4WETA 2DJ1A 3O3TA 1A23A 2WB9A 2GSRA 2R2JA 1EV4A 2PWJA 4BL7A 1W4VA 4NV5A 5DJMA 4I2UA 1K0AA 2K9FA 4ML1A 1K0MA 4MP4A 4HUAA 2HZEB 1OC3A 2PERA 3AY8A 1XXUA 3CRUA 2HRKA 2JL4A 4MF7A 2J23A 2VCWA 5GZZB 1JLWA 3UOMA 2FWFA 1URMA 4LL4B 1ERWA 2KP2A 17GSA 4NHZA 5AGYA 2XHFA 2MMAA 3N5OA 3O76A 4WF5A 5GAND 2P5QA 2AAWA 1G6YA 2P5RA 5IMVA 2LRNA 4BWSA 4GQCA 3LXZA 2C8UA 1R26A 2H1DA 1ST9A 4AJ8A 3ZMLA 1B48A 3P2AA 2LS5A 3A2XA 2K18A 3L9SA 1QK8A 4ZB9A 1ZGNA 2CAIA 4IKHA 2DJ2A 3VWXA 5DALB 6GSWA 3HYPA 1NW2A 5ID2A 1TP9A 2FLSA 1HNBA 4MPFA 3M3MA 3W8SA 5AN1A 4GXZA 3WT1A 3E3EA 2CT6A 4JBBA 1UC7A 3CSIA 2BTOT 2FD3A 2H01A 3QPMA 4NPBA 1LJRA 1N8JA 2YP6A 1BJXA 1R5PA 1Z9HA 4OCFA 4I2TA 4IJ3A 3LQ7A 2VD1A 4FQUA 2OJLA 3DMLA 4MJAA 4TN8A 1HYUA 3IRAA 3RBTA 3QAGA 3KTLA 3UVHA 3D6IA 3HJOA 2H74A 1YKAA 4BWQA 2DJ0A 1K3OA 1GSQA 3VWUA 2G0FA 1JLVA 4V2MA 3EU3A 3ERWA 3APQA 5B8AA 1ZYQB 3H79A 1M2DA 3F4SA 5DVBA 3R3EA 4Q5RA 3ZFLA 4I5QA 1O7UA 3GFKA 3EU4A 1YEXA 3UVTA 3KIJA 1SL1B 3QD9A 4I8BA 3WGDA 1VF4A 2A2RA 3GSTA 5F07A 3ZREA 3GTUB 4EKZA 3IC4A 1XOBA 5F06A 1T7PB 1ZZYA 3DVXA 4ZILA 5G5FA 2C3NA 2YV7A 1MD3A 4ISDA 1S3DA 3FY7A 1PL2A 4MLYA 1VRSD 2R5GA 3ERFA 3UMAA 4DSSA 3ED3A 3GV1A 4TVEA 1Q98A 1F2EA 3GL5A 2XBQA 3KEBA 1WOUA 1T1VA 1HD2A 2FGXA 3C8EA 1XFLA 3GYKA 2VL3A 1XBSA 1TOFA 5L71A 4MZWA 4TRXA 3CXGA 5A5KA 2I4AA 2DJJA 2V1MA 1Y6EA 3KH9A 2LJAA 4MCUA 3TB2A 4RUVA 5IOWA 2A2SA 3RHBA 2C0DA 4PXOA 3LYPA 1EEJA 2IMDA 3CTGA 3HVXA 2HZEA 4ILFA 2NPBA 1OVNA 2B5XA 4FYBA 2H6ZA 5G5EA 4PURA 1YEPA 1VGLA 2XBIA 1PRXA 4OD7A 3GUSA 3DD3A 2MMZA 2H75A 4HU7A 1Z3EA 4WXTA 3LORA 1Z7PA 3TKPA 2YWOA 2K6VA 1OC9B 1T00A 3CSJA 3RPNA 5CP1A 3GKNA 1ML6A 2YV9A 4F0CA 4PNGA 1YQ1A 1K3LA 3F3RA 2RM5A 3EINA 2HSMB 2JACA 3EMPA 1GP1A 4KB3A 2VCZA 1PGTA 1G0TA 18GSA 3ZVJA 1GUHA 4PQHA 2FHEA 1G6WA 5H5RA 3DVWA 1WP0A 3C1RA 3HVVA 5JWOB 2TRCP 5F0GA 3CTFA 3GX8A 1X5CA 4CHSA 4BA7A 3Q74A 1A2MA 1EZKA 4ZB8A 3FR9A 1CQHA 1XWBA 1GSFA 2FWGA 3IPZA
chains in the Genus database with same CATH superfamily
1VF2A 1Z7RA 3H8QA 1K0NA 3KJYA 2OKAA 3MAKA 1BG1A 5CRWA 2MBSA 2WW1A 4IQ1A 5A5HB 2ON7A 3I69A 3APSA 1WRYA 5A1NA 4TR1B 3CSHA 4DSQA 14GSA 1MDIA 1TXXA 3F6DA 2GTUA 4X0XA 4Q5NA 1XVQA 3LYKA 1GLQA 2L5OA 3ZITA 3ZTLA 1PL1A 2DKHA 1EV9A 2KLXA 4WBJA 5ECSA 1WIKA 5IQYA 4BPYA 5HR3A 3DIEA 3RGBC 5DBQA 3M8NA 2V6OA 5HQPA 1TRWA 4LLRA 1TRUA 4WEYA 3L9VA 1O81A 5ECNB 3KH7A 1JZDA 1Z5YE 4YAPA 1O8XA 1DBYA 2V2GA 2MMNA 3WT2A 2GS3A 4ZBAA 1T4ZA 2HNLA 6GSVA 3LWAA 3CYNA 4L8EA 4OFTA 3Q19A 3VPTA 3QAWA 4ULXA 5IMCA 3LG6A 2F8FA 1GLPA 1XCCA 2PBJA 5IPHA 5H5SA 4IW9A 1KEBA 1GNEA 1S3RA 2WGRA 4HJMA 2X99A 1XVWA 2H70A 3APOA 4N10A 1JFUA 1QQ2A 2I3YA 3LW9A 4YQVA 4NWYA 3GKMA 2VLUA 5ECHB 6GSSA 5A34A 4E8HA 1I9DA 1GUKA 4WBRD 4XS1A 1A8LA 4HQZA 4Q5QA 2L5LA 3MWHA 5ENUA 2VUPA 2YANA 4KW6A 1XPVA 3F0IA 2HRAA 1DUGA 2FNOA 2DMLA 1FVJA 4HU9A 1HQOA 3BJ5A 4KCAA 4GCIA 3TGZA 1Z6MA 1X5DA 4HOJA 3ERGA 3WGXA 3HDCA 4V1Ap 3BOAA 5DAKB 2DSAA 1BYEA 1ON4A 2B5YA 2H1BA 2KHPA 2CVDA 5JCWA 2YWNA 3ZL5A 2ON5A 5E4WA 4MZCA 4N30A 3VWWA 4F03A 2H0HA 2L59A 5FHIA 1M7TA 5H5QA 5IMZA 2PGTA 1KNGA 3FZAA 4WR5A 5FT3A 1S3CA 5LNKe 4F0BA 3CRTA 2EFCA 2UZ8A 4EUYA 2GZZA 3VI5A 2VM1A 3QFAC 4AI6A 3QMXA 3FW2A 2H6XA 2OT3A 4MJEA 5INYA 3MDKA 1G7OA 2LUSA 3M9JA 3FZ9A 3IK9A 1Q4JA 4POBA 2C0GA 1YVLA 5DDLA 5F8BA 2WJUA 2M80A 4PQIA 3V1WA 3GL3A 5CREA 5ECLB 3KD0A 5J40A 4ECIA 3TJBA 1AXDA 5ELAA 2K8SA 2CX3A 4E68A 3LGCA 1M3JA 4GLTA 1GWCA 3MYDA 3UARA 3KMOA 4IBPA 5D93A 2GQLA 1YEWC 1ERTA 1TK8B 2ALBA 1AUCA 2BJXA 3R2QA 4TR3A 4NXIA 1PSQA 4IP1A 5ECMB 4G19A 3VK9A 4TOPA 1ILOA 3NOFA 4IGJA 1R5AA 1GL8A 4IP6A 4ZL9A 4K0GA 1AW9A 1GH2A 5IOXA 3TDGA 4EDZA 1B8XA 4V2NA 3BBYA 1AC1A 1AQXA 3SWLA 2VL9A 4EDYA 5BMUA 3DKSA 4EVMA 5IPGA 5EVOA 4XS6A 1EOHA 1ZOFA 1UA5A 1KBNA 4BVYA 2JSYA 5EY6A 2FA8A 2X8HA 3WD6A 4K6XA 2YWIA 2GZYA 5KN3A 4HEA2 4OMVA 2OE0A 4PGTA 2H30A 4WKWA 5KN0A 4K7NA 4L0UA 3TKRA 4D73A 3QDNA 1QGVA 16GSA 4F9ZA 3LJRA 2NTOA 4G0LA 1XW6A 1USBA 4KSMA 2IIYA 4O92A 2J9HA 4PUAA 3ZIVA 5J47A 4ZBBA 4XS4B 1F3BA 4EF0A 5D96A 3G9BA 1M9BA 2HSNB 3G7YA 2QSIA 2LRCA 1R4WA 4X43A 2H19A 1SK1A 2DIZA 2LNSA 3MNGA 4POMA 1M2AA 4G10A 1IYIA 3UEMA 2OADA 1U87A 20GSA 3F3QA 1RQMA 2DBCA 5J9BA 1QXHA 1SYXA 1SL2B 4RI6A 4Q5FA 3H4KA 2AUVA 3FR3A 4DVCA 4FO5A 3KXOA 3GN3A 1WE0A 2OACA 1H4OA 3C73A 4ZB7A 4H86A 3MIXA 1K0DA 2H76A 4E8EA 1A0FA 1YZXA 3GSSA 2WDUA 2V6KA 1SVOA 3D22A 1GTUA 3ISOA 2YJHA 5IMDA 4RI7A 4CY6A 5BRTA 2WRTA 4KDYA 2F9SA 4HZ4A 4GWRA 1XIYA 4TXOA 2WCIA 3F9UA 4POKA 4MJCA 2GZPA 2VCVA 3TJKA 1X9MB 4XIHA 2YCDA 4QQ7A 3FEUA 5G31A 1FOVA 2AV4A 1RW1A 5IO2A 1XWCA 1JHBA 1GTIA 1W89A 4JE1A 3NIVA 1VF1A 4JR6A 3UAPA 3L9UA 1BG5A 2AB6A 4NMUA 4I97A 1S3AA 2CZ3A 3IBHA 1T4YA 4MPGA 2YJ7A 2QC7A 2L6CA 3FYGA 3QFBC 4K5RA 5F05A 2HRNA 2IN3A 2LV3A 3MSZA 4L5OA 5LD0A 2LRTA 2ZCTA 1NHYA 2O87A 3E9JB 3VFIA 2FCHA 5ABRA 3FZ4A 3ZRDA 4G0KA 1JZRA 2WW0A 4K7IA 3I6AA 5HR0A 4K0NA 3HMJG 3HZ4A 5HR1A 3WGEA 5B6MA 1Z6NA 3D0ZA 2DJ3A 2HRFA 1ZMAA 3GH9A 1B4QA 1BAYA 19GSA 3I43A 4AJ6A 4Z2RA 4PQ1A 2X8GA 4WR4A 2VAFA 2CZ2A 1A0RP 2HLSA 1SU9A 4ECJA 3GRXA 3VURA 4MA9A 1XZOA 4POLA 2OBKA 3DGQA 1WJKA 1TRVA 4PUFC 5JWRB 1C72A 1SENA 3ZZXA 2WZ9A 3Q6OA 1XG8A 2MBTA 4QL7A 1U3IA 4W66A 1A8YA 3Q18A 5KN1A 5J5NA 4K8MA 2H0IA 3F6FA 2H1GA 1GTAA 2VLVA 1YY7A 5AISA 4V2LA 4YAVA 3GKXA 4IELA 2B3SA 4PNFA 2HZFA 4G01A 2P0GA 4ZIJA 5ECRB 4MNNA 2H8LA 2RUFA 3EC3A 3N9JA 2I1UA 1B9XC 5DALA 4O5QA 5CO3A 1ZCPA 2C3QA 3A5IA 3GNJA 1SK0A 4LA1A 3KM6A 2PU9C 3DYRA 5JCUA 1FAAA 3W8JA 2B5EA 1VF3A 2C4JA 2HXKA 3ZYWA 4YH2A 1FB0A 1A2JA 1JZOA 2HSNA 1K0BA 1YJ6A 4EXJA 1S4BP 4OFMA 1M3IA 3TRPA 3DEXA 1ABAA 1SJZA 4KDUA 1HNCA 3GIXA 2G2QA 3P7XA 4BL7B 3ZIJA 4FH8A 2VD0A 4OFNA 2L6DA 4P3YB 5IM9A 5AIXA 1TU7A 2MMOA 10GSA 1YDKA 5EL8A 5DJLA 3TRQA 1CQGA 2B1LA 1AAZA 5HFGA 2HRKB 2RM6A 4GSSA 2JSZA 4AKXB 2C3TA 2QGVA 5J41A 5G1KA 4X1UA 1A24A 1TW9A 3FRCA 4JR4A 2O85A 3TKSE 2F3MA 1JZWA 2N5AA 4G0IA 9GSSA 1PX6A 4K2XA 3QR6A 2MZCA 1OAZA 1X5EA 3ZFBA 1PKWA 4TXVA 2R3XA 2R4VA 3GHAA 4KF9A 2LQQA 1FOHA 1GNWA 1SKRB 1J0FA 4AKGA 3PR8A 4PI0C 5CAXA 2C0EA 4ML6A 3GKKA 5D9WA 2DMMA 1V9WA 3GURA 4YKFA 4JEDA 3ME7A 1EGRA 4EL1A 4MF6A 2DLXA 4XHMA 4G2EA 3QOUA 2GLRA 4O5UA 3GTUA 4CY8A 1QUWA 2H6YA 4ZB6A 5ID2B 4KA0A 1GRXA 1V58A 1FVKA 5GAPD 2VM2A 3TOTA 3TJFA 5IO0A 1B9YC 2V32A 2ZNMA 2L57A 4K5SA 1KTEA 4FXYP 3EE2A 2VCQA 1MTCA 1R7HA 2M46A 3HCZA 2YN1A 1SKSB 2HE3A 3DXBA 2H0GA 5CRGA 5CNWA 3D4MA 4IQAA 3HZ8A 2NBSA 2R0GA 4NAXA 4GDFA 2CQ9A 2IFQB 2VO4A 2P31A 2GQKA 2IMEA 1XWAA 2HYXA 6GSYA 1WWJA 3C71A 4KNDA 4BVXB 1SKWB 1GUMA 2IPAA 4A5PA 8GSSA 1THOA 2C0FA 2QKEA 1O85A 2HT9A 1DSBA 1K3YA 3IE3A 3HJPA 2F8AA 1U88A 3GA4A 5GSSA 4NV2A 4MF5A 2CV4A 4QL9A 1N25A 1SVMA 5B8BA 3L0HA 3P90A 4EIPA 2O8VB 2LSTA 1X9WB 1SYRA 5J4VA 1BX9A 1OC9A 1LBKA 2N5FA 1RK4A 3IXRA 3HHVA 4TR4A 1LU4A 3LSZA 1THXA 2EC4A 4KCEA 1OC8A 2REMA 1SD9A 3D5JA 2HSMA 3TKQA 4DSSB 5D9TA 3TRXA 1F9MA 4QMKA 3IAM2 3TKSC 2LJKA 4ZL7A 2LJRA 3IHQA 2R0CA 2ES7A 4XRAA 2IMFA 2GVPA 3FHKA 2Z9SA 1YKCA 4KAEA 5A4VA 4WF4A 4KGIA 4YQMA 1SVLA 5CRHA 2KOKA 3M1GA 4OO4A 4LMWA 2XC2A 2MYGA 2OA7A 2FY6A 2HQTA 5JCGA 1SJ6A 2H1AA 1TKDB 5ECPB 4PTSA 4N11A 5A5HA 4JU5A 4TKYA 5J4UA 3FR6A 4GSNA 3O6TA 5IMAA 1NHOA 4TR1A 5ELGA 1GULA 2CX4A 4MZBA 3BD2A 3G7JA 1BQ7A 1TTZA 4DSRA 4EO3A 3TJJA 3ZVJD 1M99A 1UVZA 1F37A 5HFIA 3CWGA 4HI7A 1SL0B 2VCXA 2JADA 2RLIA 1O6JA 2WVXB 3HXSA 3TKSA 1U3AA 4JZQA 6GSUA 3A5WA 1MDJA 1AIUA 2R0PA 4L5LA 4ID0A 1PMTA 2LNTA 3P8WA 1X9SB 3QAVA 1EGOA 3LXTA 1MEKA 3UIWA 1AQVA 2PVQA 1EEMA 3W6GA 3H1NA 1PA3A 4HJ2A 2YZUA 4EC0A 4Z7XA 4GF0A 2WW2A 2JZRA 4L0WA 2PMTA 1PN9A 4FYUA 2LEGA 5DCGA 1YF0A 2GQMA 3RDWA 1G7EA 3WYWA 4F82A 4I6XA 2X49A 5A4UA 3C1SA 2L4CA 2GDRA 3M0FA 1J9BA 4K9ZA 2B6MA 3A3TA 4ZBDA 3TJGA 4RQXA 2B7JA 4IN0A 2GT6A 1OE8A 1J08A 2CVBA 2VCTA 3IK7A 7GSSA 3IR4A 4HZ2A 5C04A 2GSQA 5A1NB 1XW5A 2GSSA 4CDOA 1T3BA 3KP9A 2IFQA 1EP8A 3KP8A 3ZLPA 3NZNA 2NVLA 2ZUPA 2V41A 4MK3A 2IJYA 2R6KA 3GH6A 5G1LA 2GGTA 5DAKA 4FIWA 4BVXA 4LL1B 2JU5A 4CW9A 2H73A 6GSTA 5ECIB 5ECOB 4MH2A 1V40A 3D21A 2AJQB 5KEJA 4KSOA 1GSDA 2VL2C 3EYTA 5EPFA 1ZYEA 2X4AA 2FA4A 4IVFA 2K8VA 3GMFA 4KH7A 3UBLA 1TDIA 2QA1A 3CHXC 1V98A 3PINA 4KUNA 3ME8A 2O7KA 5B6NA 5D73A 1BEDA 2B7KA 2H66A 3BCIA 22GSA 3DRNA 3HKRA 3TU3B 5D9VA 4K7OA 1FB6A 2IMKA 2LTKA 1XOAA 4ECCA 4HS1A 3EVIA 1HNAA 4AF2A 1SJIA 4O5RA 3IAS2 2B1KA 2DJKA 2FWHA 1Y1UA 4KE3A 2O3EA 2O36A 2WFCA 2HFDA 2CVKA 2FWEA 5C00A 3C7MA 2X64A 1H75A 1I5GA 2A4HA 3K8NA 4GRFA 4KX4A 2JZSA 2LKUA 3UJ1A 5A34B 4IJIA 3L78A 1PQNA 3GX0A 4PHZC 3TCOA 1V57A 1K0CA 5IMFA 3M9KA 4ECBA 3PPUA 5JWQB 4GQFA 1EP7A 3D4TA 3F63A 1GSSA 1NSWA 1XWGA 2VL2A 3ZMKA 3PH9A 5GSTA 2DIYA 4EE0A 1ZYNA 4YQUA 3VWVA 2AYTA 2DC5A 1TJDA 3IOSA 4F2IA 1O73A 4USSA 4RQRA 1ERUA 2F51A 5G30A 3US3A 3I9V2 2XPDA 3HA9A 2WS2A 2BMXA 3FK8A 4AGSA 2YWMA 1O8WA 3EPTA 1TU8A 2R37A 3J7Yk 3IV4A 2A4VA 4J57E 4Z2TA 1Y25A 3UL3A 3KTBA 1MDKA 1I1IP 3JCML 3CQFA 2HSYA 1TI3A 1K0OA 2C1YA 5DQYA 2GT5A 3UBKA 2TIRA 3HD5A 2OE3A 2EIRA 4V1Ag 4YKGA 1EWXA 4JRRA 3LEFA 3A2VA 5B7CA 4XCSA 2PUKC 3RFRC 1T8EB 13GSA 4HSCX 4XS4A 1GSUA 3HJMA 3IA1A 3KGKA 5AIVA 2E7PA 3SBCA 1AQWA 2YOIA 3KZQA 1M0UA 2NDOA 4DEJA 4GTUA 1E2YA 4MABA 1PD21 5E59A 5CRDA 2H71A 3CMIA 4X4JA 1XWKA 2H1LA 4N0VA 3F4RA 1GSEA 1GTBA 2OE1A 5D9XA 5KN2A 2IMIA 3J7Yb 3EMXA 3RAZA 2YZHA 1WPIA 2GSTA 1FO5A 1TRSA 1F6MC 1M9AA 3IC8A 1U6TA 2IWTA 2E2GA 5BMUB 2H72A 4MMMA 1QMVA 12GSA 2L4QA 1OKDA 4ACSA 4MJBA 3KCMA 5ECKB 2KUCA 3CBUA 4BVYB 2OBIA 1F3AA 1FG4A 2EIQA 5LCZA 1TI1A 3FZ5A 4J2FA 4O32A 2E2MA 4G9HA 5HFKA 1DE1A 2E0QA 2KP1A 4PX1A 2VLTA 2CA8A 3VLNA 2VIMA 3IDVA 4N0ZA 2C80A 2JZTA 5CYYA 4OCEA 4D73B 2I9HA 2TRXA 3G7IA 4BIKA 4ZXGA 4OWYA 2HI7A 4IS0A 5G2ZA 5J9CA 2RUEA 2VOCA 3S9FA 3HY2A 1UN2A 4HDEA 4LMVA 6GSXA 4MH3A 2A2PA 4XRDA 2O89A 3LFLA 2RIIA 2D2ZA 3QCPA 1E6BA 5HR2A 2N5BA 3BCKA 3HVSA 3E0UA 3TOUA 3FKFA 2WULA 5J3RA 1SK2A 2YNXA 1OE7A 4K1FA 3TUEA 3EWLA 3F8UA 1QFNA 3L4NA 4FYCA 4OO5A 1ZL9A 1YF1A 5DCHA 1V2AA 2I81A 1NM3A 3IHGA 3KMNA 3U6VA 3U5RE 2EIOA 5IIZA 4TW5A 5D8IA 1B4PA 2FUG2 1PKZA 1PX7A 2WVYA 5COHA 1A2LA 2WVZA 2PPTA 1DE2A 1FHEA 4AJ7A 3PGTA 1OKTA 4J56E 4KDXA 1EOGA 4O7HA 4TXOB 2PN8A 3H93A 2VKZG 1ERVA 5A4WA 4GSTA 4HQSA 4NHWA 1IYHA 4XTSA 2M72A 2X8CA 1WMJA 3A2WA 1X0RA 1OYJA 2LQOA 1XW9A 4ZL8A 4K2DA 1MD4A 2IL3A 2CAQA 4IHUA 5J4YA 1SD8A 1ACVA 1M2BA 1TK0B 5FWGA 3VI7A 1GSYA 1N2AA 2DKIA 2YPMA 3RHCA 3VPQA 4MDCA 1FW1A 5ECQB 3EURA 2XPEA 11GSA 2EFHA 1TK5B 5DQSA 2AHEA 2PVOC 3RPPA 3DWVA 3F4TA 4TR0A 2HSHA 3OR5A 4WETA 2DJ1A 3O3TA 1A23A 2WB9A 2GSRA 2R2JA 1EV4A 2PWJA 4BL7A 1W4VA 4NV5A 5DJMA 4I2UA 1K0AA 2EFEA 2K9FA 4ML1A 1K0MA 4MP4A 4HUAA 2HZEB 1OC3A 2PERA 3AY8A 1XXUA 3CRUA 1BF5A 2HRKA 2WZSA 2JL4A 4MF7A 2J23A 2VCWA 5GZZB 1JLWA 3UOMA 2FWFA 1URMA 4LL4B 1ERWA 2KP2A 17GSA 1PN0A 4NHZA 5AGYA 2XHFA 2MMAA 3N5OA 3O76A 4WF5A 5GAND 4PI2C 2P5QA 2AAWA 1G6YA 2P5RA 5IMVA 2LRNA 4BWSA 4GQCA 3LXZA 2C8UA 1R26A 2H1DA 1ST9A 4AJ8A 3ZMLA 1B48A 3P2AA 2LS5A 3A2XA 2K18A 3L9SA 1QK8A 4ZB9A 1ZGNA 2CAIA 4IKHA 2DJ2A 3VWXA 5DALB 6GSWA 3HYPA 1NW2A 3FMWA 5ID2A 1TP9A 2FLSA 1HNBA 4MPFA 3M3MA 3W8SA 5AN1A 4GXZA 3WT1A 3E3EA 2CT6A 4JBBA 1UC7A 3CSIA 4ICYA 2BTOT 2FD3A 2H01A 3QPMA 4NPBA 1LJRA 1N8JA 2YP6A 1BJXA 1R5PA 1Z9HA 4OCFA 4I2TA 4IJ3A 3LQ7A 4N3ZA 2VD1A 4FQUA 2OJLA 3DMLA 4MJAA 4TN8A 1HYUA 3IRAA 3RBTA 3QAGA 3KTLA 3UVHA 3D6IA 3HJOA 2H74A 1YKAA 4BWQA 2DJ0A 1K3OA 1GSQA 4Z2UA 3VWUA 2G0FA 1JLVA 4V2MA 3EU3A 3ERWA 3APQA 5B8AA 1ZYQB 3H79A 1M2DA 3F4SA 5DVBA 3R3EA 4Q5RA 3ZFLA 4I5QA 1O7UA 3GFKA 3EU4A 1YEXA 3UVTA 3KIJA 1SL1B 3QD9A 4I8BA 3WGDA 1VF4A 2A2RA 3GSTA 5F07A 1PFOA 3ZREA 3GTUB 4EKZA 3IC4A 1XOBA 5F06A 1T7PB 1ZZYA 3DVXA 4ZILA 5G5FA 2C3NA 2YV7A 1MD3A 4ISDA 1S3DA 3FY7A 1PL2A 4MLYA 1VRSD 2R5GA 3ERFA 3UMAA 4DSSA 3ED3A 3GV1A 4TVEA 1Q98A 1F2EA 3GL5A 4AKIA 2XBQA 5KOWA 3KEBA 4EIQA 1WOUA 1T1VA 1HD2A 2WW3A 2FGXA 2EFDA 3C8EA 1XFLA 4AKHA 3GYKA 2VL3A 1XBSA 1TOFA 5L71A 4MZWA 4TRXA 3CXGA 5A5KA 2I4AA 2DJJA 2V1MA 1Y6EA 3KH9A 2QA2A 2LJAA 4MCUA 3TB2A 4RUVA 5IOWA 5KOXA 2A2SA 3RHBA 2C0DA 4PXOA 3LYPA 1EEJA 2IMDA 3CTGA 3HVXA 2HZEA 4ILFA 2NPBA 1OVNA 2B5XA 2H6ZA 4FYBA 5G5EA 4PURA 1TXUA 1YEPA 1VGLA 2XBIA 1PRXA 4OD7A 3GUSA 3DD3A 2MMZA 2H75A 4HU7A 2UV8G 1Z3EA 1ZYPA 4WXTA 3LORA 1Z7PA 3TKPA 2YWOA 2K6VA 2WVXA 1OC9B 1T00A 3CSJA 3RPNA 5CP1A 3GKNA 2O5VA 1ML6A 2YV9A 4F0CA 4PNGA 1YQ1A 1K3LA 3F3RA 2RM5A 3EINA 2HSMB 2JACA 3EMPA 1GP1A 4KB3A 2VCZA 1PGTA 1G0TA 18GSA 3ZVJA 1GUHA 4PQHA 2FHEA 1G6WA 5H5RA 3DVWA 3HVNA 1WP0A 3C1RA 3HVVA 5JWOB 2TRCP 5F0GA 3CTFA 3GX8A 1X5CA 4CHSA 4BA7A 3Q74A 1A2MA 1EZKA 4ZB8A 3FR9A 1CQHA 1XWBA 1GSFA 2FWGA 3IPZA
chains in the Genus database with same CATH topology
1VF2A 1Z7RA 3H8QA 1K0NA 3KJYA 2OKAA 3MAKA 1BG1A 5CRWA 2MBSA 4IQ1A 5A5HB 2ON7A 3I69A 3APSA 1WRYA 5A1NA 4TR1B 3CSHA 4DSQA 14GSA 1MDIA 1TXXA 3F6DA 2GTUA 4X0XA 4Q5NA 1XVQA 3LYKA 1GLQA 2L5OA 3ZITA 3ZTLA 1PL1A 2DKHA 1EV9A 2KLXA 4WBJA 5ECSA 1WIKA 5IQYA 4BPYA 5HR3A 3DIEA 5DBQA 3M8NA 2V6OA 5HQPA 1TRWA 4LLRA 1TRUA 4WEYA 3L9VA 1O81A 5ECNB 3KH7A 1JZDA 1Z5YE 4YAPA 1O8XA 1DBYA 2V2GA 2MMNA 3WT2A 2GS3A 4ZBAA 1T4ZA 2HNLA 6GSVA 3LWAA 3CYNA 4L8EA 4OFTA 3Q19A 3VPTA 3QAWA 4ULXA 5IMCA 3LG6A 2F8FA 1GLPA 1XCCA 2PBJA 5IPHA 5H5SA 4IW9A 1KEBA 1GNEA 2WGRA 4HJMA 2X99A 1XVWA 2H70A 3APOA 4N10A 1JFUA 1QQ2A 2I3YA 3LW9A 4YQVA 4NWYA 3GKMA 2VLUA 5ECHB 6GSSA 5A34A 4E8HA 1I9DA 1GUKA 4WBRD 4XS1A 1A8LA 4HQZA 4Q5QA 2L5LA 3MWHA 5ENUA 2VUPA 2YANA 4KW6A 1XPVA 3F0IA 2HRAA 1DUGA 2FNOA 2DMLA 1FVJA 4HU9A 1HQOA 3BJ5A 4KCAA 4GCIA 3TGZA 1Z6MA 1X5DA 4HOJA 3ERGA 3WGXA 3HDCA 4V1Ap 3BOAA 5DAKB 2DSAA 1BYEA 1ON4A 2B5YA 2H1BA 2KHPA 2CVDA 5JCWA 2YWNA 3ZL5A 2ON5A 5E4WA 4MZCA 4N30A 3VWWA 4F03A 2H0HA 2L59A 5FHIA 1M7TA 5H5QA 5IMZA 2PGTA 1KNGA 3FZAA 4WR5A 5FT3A 1S3CA 5LNKe 4F0BA 3CRTA 2EFCA 2UZ8A 4EUYA 2GZZA 3VI5A 2VM1A 3QFAC 4AI6A 3QMXA 3FW2A 2H6XA 2OT3A 4MJEA 5INYA 3MDKA 1G7OA 2LUSA 3M9JA 3FZ9A 3IK9A 1Q4JA 4POBA 2C0GA 1YVLA 5DDLA 5F8BA 2WJUA 2M80A 4PQIA 3V1WA 3GL3A 5CREA 5ECLB 3KD0A 5J40A 4ECIA 3TJBA 1AXDA 5ELAA 2K8SA 2CX3A 4E68A 3LGCA 4GLTA 1GWCA 3MYDA 3UARA 3KMOA 4IBPA 5D93A 2GQLA 1ERTA 1TK8B 2ALBA 1AUCA 2BJXA 3R2QA 4TR3A 4NXIA 1PSQA 4IP1A 5ECMB 4G19A 3VK9A 4TOPA 1ILOA 3NOFA 4IGJA 1R5AA 1GL8A 4IP6A 4ZL9A 4K0GA 1AW9A 1GH2A 5IOXA 3TDGA 4EDZA 1B8XA 4V2NA 3BBYA 1AC1A 1AQXA 3SWLA 2VL9A 4EDYA 5BMUA 3DKSA 4EVMA 5IPGA 5EVOA 4XS6A 1EOHA 1ZOFA 1UA5A 1KBNA 4BVYA 2JSYA 5EY6A 2FA8A 2X8HA 3WD6A 4K6XA 2YWIA 2GZYA 5KN3A 4HEA2 4OMVA 2OE0A 4PGTA 2H30A 4WKWA 5KN0A 4K7NA 4L0UA 3TKRA 4D73A 3QDNA 1QGVA 16GSA 4F9ZA 3LJRA 2NTOA 4G0LA 1XW6A 1USBA 4KSMA 2IIYA 4O92A 2J9HA 4PUAA 3ZIVA 5J47A 4ZBBA 4XS4B 1F3BA 4EF0A 5D96A 3G9BA 1M9BA 2HSNB 3G7YA 2QSIA 2LRCA 1R4WA 4X43A 2H19A 1SK1A 2DIZA 2LNSA 3MNGA 4POMA 1M2AA 4G10A 1IYIA 3UEMA 2OADA 1U87A 20GSA 3F3QA 1RQMA 2DBCA 5J9BA 1QXHA 1SYXA 1SL2B 4RI6A 4Q5FA 3H4KA 2AUVA 3FR3A 4DVCA 4FO5A 3KXOA 3GN3A 1WE0A 2OACA 1H4OA 3C73A 4ZB7A 4H86A 3MIXA 1K0DA 2H76A 4E8EA 1A0FA 1YZXA 3GSSA 2WDUA 2V6KA 1SVOA 3D22A 1GTUA 3ISOA 2YJHA 5IMDA 4RI7A 4CY6A 5BRTA 2WRTA 4KDYA 2F9SA 4HZ4A 4GWRA 1XIYA 4TXOA 2WCIA 3F9UA 4POKA 4MJCA 2GZPA 2VCVA 3TJKA 1X9MB 4XIHA 2YCDA 4QQ7A 3FEUA 5G31A 1FOVA 2AV4A 1RW1A 5IO2A 1XWCA 1JHBA 1GTIA 1W89A 4JE1A 3NIVA 1VF1A 4JR6A 3UAPA 3L9UA 1BG5A 2AB6A 4NMUA 4I97A 1S3AA 2CZ3A 3IBHA 1T4YA 4MPGA 2YJ7A 2QC7A 2L6CA 3FYGA 3QFBC 4K5RA 5F05A 2HRNA 2IN3A 2LV3A 3MSZA 4L5OA 5LD0A 2LRTA 2ZCTA 1NHYA 2O87A 3E9JB 3VFIA 2FCHA 5ABRA 3FZ4A 3ZRDA 4G0KA 1JZRA 4K7IA 3I6AA 5HR0A 4K0NA 3HMJG 3HZ4A 5HR1A 3WGEA 5B6MA 1Z6NA 3D0ZA 2DJ3A 2HRFA 1ZMAA 3GH9A 1B4QA 1BAYA 19GSA 3I43A 4AJ6A 4Z2RA 4PQ1A 2X8GA 4WR4A 2VAFA 2CZ2A 1A0RP 2HLSA 1SU9A 4ECJA 3GRXA 3VURA 4MA9A 1XZOA 4POLA 2OBKA 3DGQA 1WJKA 1TRVA 4PUFC 5JWRB 1C72A 1SENA 3ZZXA 2WZ9A 3Q6OA 2MBTA 4QL7A 1U3IA 4W66A 1A8YA 3Q18A 5KN1A 5J5NA 4K8MA 2H0IA 3F6FA 2H1GA 1GTAA 1YY7A 5AISA 2VLVA 4V2LA 4YAVA 3GKXA 4IELA 2B3SA 4PNFA 2HZFA 4G01A 2P0GA 4ZIJA 5ECRB 4MNNA 2H8LA 2RUFA 3EC3A 3N9JA 2I1UA 1B9XC 5DALA 4O5QA 5CO3A 1ZCPA 2C3QA 3A5IA 3GNJA 1SK0A 4LA1A 3KM6A 2PU9C 3DYRA 5JCUA 1FAAA 3W8JA 2B5EA 1VF3A 2C4JA 2HXKA 3ZYWA 4YH2A 1FB0A 1A2JA 1JZOA 2HSNA 1K0BA 1YJ6A 4EXJA 4OFMA 3TRPA 3DEXA 1ABAA 1SJZA 4KDUA 1HNCA 3GIXA 2G2QA 3P7XA 4BL7B 3ZIJA 4FH8A 2VD0A 4OFNA 2L6DA 4P3YB 5IM9A 5AIXA 1TU7A 2MMOA 10GSA 1YDKA 5EL8A 5DJLA 3TRQA 1CQGA 2B1LA 1AAZA 5HFGA 2HRKB 2RM6A 4GSSA 2JSZA 4AKXB 2C3TA 2QGVA 5J41A 5G1KA 4X1UA 1A24A 1TW9A 3FRCA 4JR4A 2O85A 3TKSE 2F3MA 1JZWA 2N5AA 4G0IA 9GSSA 1PX6A 4K2XA 3QR6A 2MZCA 1OAZA 1X5EA 3ZFBA 1PKWA 4TXVA 2R3XA 2R4VA 3GHAA 4KF9A 2LQQA 1FOHA 1GNWA 1SKRB 1J0FA 4AKGA 3PR8A 5CAXA 2C0EA 4ML6A 3GKKA 5D9WA 2DMMA 1V9WA 3GURA 4YKFA 4JEDA 3ME7A 1EGRA 4EL1A 4MF6A 2DLXA 4XHMA 4G2EA 3QOUA 2GLRA 4O5UA 3GTUA 4CY8A 1QUWA 2H6YA 4ZB6A 5ID2B 4KA0A 1GRXA 1V58A 1FVKA 5GAPD 2VM2A 3TOTA 3TJFA 5IO0A 1B9YC 2V32A 2ZNMA 2L57A 4K5SA 1KTEA 3EE2A 2VCQA 1MTCA 1R7HA 2M46A 3HCZA 2YN1A 1SKSB 2HE3A 3DXBA 2H0GA 5CRGA 5CNWA 3D4MA 4IQAA 3HZ8A 2NBSA 2R0GA 4NAXA 4GDFA 2CQ9A 2IFQB 2VO4A 2P31A 2GQKA 2IMEA 1XWAA 2HYXA 6GSYA 1WWJA 3C71A 4KNDA 4BVXB 1SKWB 1GUMA 2IPAA 4A5PA 8GSSA 1THOA 2C0FA 2QKEA 1O85A 2HT9A 1DSBA 1K3YA 3IE3A 3HJPA 2F8AA 1U88A 3GA4A 5GSSA 4NV2A 4MF5A 2CV4A 4QL9A 1N25A 1SVMA 5B8BA 3L0HA 3P90A 4EIPA 2O8VB 2LSTA 1X9WB 1SYRA 5J4VA 1BX9A 1OC9A 1LBKA 2N5FA 1RK4A 3IXRA 3HHVA 4TR4A 1LU4A 3LSZA 1THXA 2EC4A 4KCEA 1OC8A 2REMA 1SD9A 3D5JA 2HSMA 3TKQA 4DSSB 5D9TA 3TRXA 1F9MA 4QMKA 3IAM2 3TKSC 2LJKA 4ZL7A 2LJRA 3IHQA 2R0CA 2ES7A 4XRAA 2IMFA 2GVPA 3FHKA 2Z9SA 1YKCA 4KAEA 5A4VA 4WF4A 4KGIA 4YQMA 1SVLA 5CRHA 2KOKA 3M1GA 4OO4A 4LMWA 2XC2A 2MYGA 2OA7A 2FY6A 2HQTA 5JCGA 1SJ6A 2H1AA 1TKDB 5ECPB 4PTSA 4N11A 5A5HA 4JU5A 4TKYA 5J4UA 3FR6A 4GSNA 3O6TA 5IMAA 1NHOA 4TR1A 5ELGA 1GULA 2CX4A 4MZBA 3BD2A 3G7JA 1BQ7A 1TTZA 4DSRA 4EO3A 3TJJA 3ZVJD 1M99A 1UVZA 1F37A 5HFIA 3CWGA 4HI7A 1SL0B 2VCXA 2JADA 2RLIA 1O6JA 3HXSA 3TKSA 1U3AA 4JZQA 6GSUA 3A5WA 1MDJA 1AIUA 2R0PA 4L5LA 4ID0A 1PMTA 2LNTA 3P8WA 1X9SB 3QAVA 1EGOA 3LXTA 1MEKA 3UIWA 1AQVA 2PVQA 1EEMA 3W6GA 3H1NA 1PA3A 4HJ2A 2YZUA 4EC0A 4Z7XA 4GF0A 2JZRA 4L0WA 2PMTA 1PN9A 4FYUA 2LEGA 5DCGA 1YF0A 2GQMA 3RDWA 1G7EA 3WYWA 4F82A 4I6XA 2X49A 5A4UA 3C1SA 2L4CA 2GDRA 3M0FA 1J9BA 4K9ZA 2B6MA 3A3TA 4ZBDA 3TJGA 4RQXA 2B7JA 4IN0A 2GT6A 1OE8A 1J08A 2CVBA 2VCTA 3IK7A 7GSSA 3IR4A 4HZ2A 5C04A 2GSQA 5A1NB 1XW5A 2GSSA 4CDOA 1T3BA 3KP9A 2IFQA 1EP8A 3KP8A 3ZLPA 3NZNA 2NVLA 2ZUPA 2V41A 4MK3A 2IJYA 2R6KA 3GH6A 5G1LA 2GGTA 5DAKA 4FIWA 4BVXA 4LL1B 2JU5A 4CW9A 2H73A 6GSTA 5ECIB 5ECOB 4MH2A 1V40A 3D21A 2AJQB 5KEJA 4KSOA 1GSDA 2VL2C 3EYTA 5EPFA 1ZYEA 2X4AA 2FA4A 4IVFA 2K8VA 3GMFA 4KH7A 3UBLA 1TDIA 2QA1A 1V98A 3PINA 4KUNA 3ME8A 2O7KA 5B6NA 5D73A 1BEDA 2B7KA 2H66A 3BCIA 22GSA 3DRNA 3HKRA 3TU3B 5D9VA 4K7OA 1FB6A 2IMKA 2LTKA 1XOAA 4ECCA 4HS1A 3EVIA 1HNAA 4AF2A 1SJIA 4O5RA 3IAS2 2B1KA 2DJKA 2FWHA 1Y1UA 4KE3A 2WFCA 2HFDA 2CVKA 2FWEA 5C00A 3C7MA 2X64A 1H75A 1I5GA 2A4HA 3K8NA 4GRFA 4KX4A 2JZSA 2LKUA 3UJ1A 5A34B 4IJIA 3L78A 1PQNA 3GX0A 3TCOA 1V57A 1K0CA 5IMFA 3M9KA 4ECBA 3PPUA 5JWQB 4GQFA 1EP7A 3D4TA 3F63A 1GSSA 1NSWA 1XWGA 2VL2A 3ZMKA 3PH9A 5GSTA 2DIYA 4EE0A 1ZYNA 4YQUA 3VWVA 2AYTA 2DC5A 1TJDA 3IOSA 4F2IA 1O73A 4USSA 4RQRA 1ERUA 2F51A 5G30A 3US3A 3I9V2 2XPDA 3HA9A 2WS2A 2BMXA 3FK8A 4AGSA 2YWMA 1O8WA 3EPTA 1TU8A 2R37A 3J7Yk 3IV4A 2A4VA 4J57E 4Z2TA 1Y25A 3UL3A 3KTBA 1MDKA 3JCML 2HSYA 1TI3A 1K0OA 2C1YA 5DQYA 2GT5A 3UBKA 2TIRA 3HD5A 2OE3A 2EIRA 4V1Ag 4YKGA 1EWXA 4JRRA 3LEFA 3A2VA 5B7CA 4XCSA 2PUKC 1T8EB 13GSA 4XS4A 1GSUA 3HJMA 3IA1A 3KGKA 5AIVA 2E7PA 3SBCA 1AQWA 2YOIA 3KZQA 1M0UA 2NDOA 4DEJA 4GTUA 1E2YA 4MABA 1PD21 5E59A 5CRDA 2H71A 3CMIA 4X4JA 1XWKA 2H1LA 4N0VA 3F4RA 1GSEA 1GTBA 2OE1A 5D9XA 5KN2A 2IMIA 3J7Yb 3EMXA 3RAZA 2YZHA 1WPIA 2GSTA 1FO5A 1TRSA 1F6MC 1M9AA 3IC8A 1U6TA 2IWTA 2E2GA 5BMUB 2H72A 4MMMA 1QMVA 12GSA 2L4QA 1OKDA 4ACSA 4MJBA 3KCMA 5ECKB 2KUCA 3CBUA 4BVYB 2OBIA 1F3AA 1FG4A 2EIQA 5LCZA 1TI1A 3FZ5A 4J2FA 4O32A 2E2MA 4G9HA 5HFKA 1DE1A 2E0QA 2KP1A 4PX1A 2VLTA 2CA8A 3VLNA 2VIMA 3IDVA 4N0ZA 2C80A 2JZTA 5CYYA 4OCEA 4D73B 2I9HA 2TRXA 3G7IA 4ZXGA 4OWYA 2HI7A 4IS0A 5G2ZA 5J9CA 2RUEA 2VOCA 3S9FA 3HY2A 1UN2A 4HDEA 4LMVA 6GSXA 4MH3A 2A2PA 4XRDA 2O89A 3LFLA 2RIIA 2D2ZA 3QCPA 1E6BA 5HR2A 2N5BA 3BCKA 3HVSA 3E0UA 3TOUA 3FKFA 2WULA 5J3RA 1SK2A 2YNXA 1OE7A 4K1FA 3TUEA 3EWLA 3F8UA 1QFNA 3L4NA 4FYCA 4OO5A 1ZL9A 1YF1A 5DCHA 1V2AA 2I81A 1NM3A 3IHGA 3KMNA 3U6VA 3U5RE 2EIOA 5IIZA 4TW5A 5D8IA 1B4PA 1PKZA 1PX7A 2FUG2 5COHA 1A2LA 2PPTA 1DE2A 1FHEA 4AJ7A 3PGTA 1OKTA 4J56E 4KDXA 1EOGA 4O7HA 4TXOB 2PN8A 3H93A 2VKZG 1ERVA 5A4WA 4GSTA 4HQSA 4NHWA 1IYHA 4XTSA 2M72A 2X8CA 1WMJA 3A2WA 1X0RA 1OYJA 2LQOA 1XW9A 4ZL8A 4K2DA 1MD4A 2IL3A 2CAQA 4IHUA 5J4YA 1SD8A 1ACVA 1M2BA 1TK0B 5FWGA 3VI7A 1GSYA 1N2AA 2DKIA 2YPMA 3RHCA 3VPQA 4MDCA 1FW1A 5ECQB 3EURA 2XPEA 11GSA 2EFHA 1TK5B 5DQSA 2AHEA 2PVOC 3RPPA 3DWVA 3F4TA 4TR0A 2HSHA 3OR5A 4WETA 2DJ1A 3O3TA 1A23A 2WB9A 2GSRA 2R2JA 1EV4A 2PWJA 4BL7A 1W4VA 4NV5A 5DJMA 4I2UA 1K0AA 2EFEA 2K9FA 4ML1A 1K0MA 4MP4A 4HUAA 2HZEB 1OC3A 2PERA 3AY8A 1XXUA 3CRUA 1BF5A 2HRKA 2JL4A 4MF7A 2J23A 2VCWA 5GZZB 1JLWA 3UOMA 2FWFA 1URMA 4LL4B 1ERWA 2KP2A 17GSA 1PN0A 4NHZA 5AGYA 2XHFA 2MMAA 3N5OA 3O76A 4WF5A 5GAND 2P5QA 2AAWA 1G6YA 2P5RA 5IMVA 2LRNA 4BWSA 4GQCA 3LXZA 2C8UA 1R26A 2H1DA 1ST9A 4AJ8A 3ZMLA 1B48A 3P2AA 2LS5A 3A2XA 2K18A 3L9SA 1QK8A 4ZB9A 1ZGNA 2CAIA 4IKHA 2DJ2A 3VWXA 5DALB 6GSWA 3HYPA 1NW2A 3FMWA 5ID2A 1TP9A 2FLSA 1HNBA 4MPFA 3M3MA 3W8SA 5AN1A 4GXZA 3WT1A 3E3EA 2CT6A 4JBBA 1UC7A 3CSIA 4ICYA 2BTOT 2FD3A 2H01A 3QPMA 4NPBA 1LJRA 1N8JA 2YP6A 1BJXA 1R5PA 1Z9HA 4OCFA 4I2TA 4IJ3A 3LQ7A 4N3ZA 2VD1A 4FQUA 2OJLA 3DMLA 4MJAA 4TN8A 1HYUA 3IRAA 3RBTA 3QAGA 3KTLA 3UVHA 3D6IA 3HJOA 2H74A 1YKAA 4BWQA 2DJ0A 1K3OA 1GSQA 4Z2UA 3VWUA 2G0FA 1JLVA 4V2MA 3EU3A 3ERWA 3APQA 5B8AA 1ZYQB 3H79A 1M2DA 3F4SA 5DVBA 3R3EA 4Q5RA 3ZFLA 4I5QA 1O7UA 3GFKA 3EU4A 1YEXA 3UVTA 3KIJA 1SL1B 3QD9A 4I8BA 3WGDA 1VF4A 2A2RA 3GSTA 5F07A 3ZREA 3GTUB 4EKZA 3IC4A 1XOBA 5F06A 1T7PB 1ZZYA 3DVXA 4ZILA 5G5FA 2C3NA 2YV7A 1MD3A 4ISDA 1S3DA 3FY7A 1PL2A 4MLYA 1VRSD 2R5GA 3ERFA 3UMAA 4DSSA 3ED3A 3GV1A 4TVEA 1Q98A 1F2EA 3GL5A 4AKIA 2XBQA 5KOWA 3KEBA 4EIQA 1WOUA 1T1VA 1HD2A 2FGXA 2EFDA 3C8EA 1XFLA 4AKHA 3GYKA 2VL3A 1XBSA 1TOFA 5L71A 4MZWA 4TRXA 3CXGA 5A5KA 2I4AA 2DJJA 2V1MA 1Y6EA 3KH9A 2QA2A 2LJAA 4MCUA 3TB2A 4RUVA 5IOWA 5KOXA 2A2SA 3RHBA 2C0DA 4PXOA 3LYPA 1EEJA 2IMDA 3CTGA 3HVXA 2HZEA 4ILFA 2NPBA 1OVNA 2B5XA 2H6ZA 4FYBA 5G5EA 4PURA 1TXUA 1YEPA 1VGLA 2XBIA 1PRXA 4OD7A 3GUSA 3DD3A 2MMZA 2H75A 4HU7A 2UV8G 1Z3EA 1ZYPA 4WXTA 3LORA 1Z7PA 3TKPA 2YWOA 2K6VA 1OC9B 1T00A 3CSJA 3RPNA 5CP1A 3GKNA 2O5VA 1ML6A 2YV9A 4F0CA 4PNGA 1YQ1A 1K3LA 3F3RA 2RM5A 3EINA 2HSMB 2JACA 3EMPA 1GP1A 4KB3A 2VCZA 1PGTA 1G0TA 18GSA 3ZVJA 1GUHA 4PQHA 2FHEA 1G6WA 5H5RA 3DVWA 1WP0A 3C1RA 3HVVA 5JWOB 2TRCP 5F0GA 3CTFA 3GX8A 1X5CA 4CHSA 4BA7A 3Q74A 1A2MA 1EZKA 4ZB8A 3FR9A 1CQHA 1XWBA 1GSFA 2FWGA 3IPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF2 A;  1Z7R A;  3H8Q A;  1K0N A;  3KJY A;  2OKA A;  3MAK A;  5CRW A;  2MBS A;  4IQ1 A;  2ON7 A;  3I69 A;  3APS A;  1WRY A;  4TR1 B;  3CSH A;  4DSQ A;  14GS A;  1MDI A;  1TXX A;  3F6D A;  2GTU A;  4X0X A;  4Q5N A;  1XVQ A;  3LYK A;  1GLQ A;  2L5O A;  3ZIT A;  3ZTL A;  1PL1 A;  1EV9 A;  2KLX A;  4WBJ A;  5ECS A;  1WIK A;  5IQY A;  4BPY A;  5HR3 A;  3DIE A;  5DBQ A;  3M8N A;  2V6O A;  5HQP A;  1TRW A;  4LLR A;  1TRU A;  4WEY A;  3L9V A;  1O81 A;  5ECN B;  3KH7 A;  1JZD A;  1Z5Y E;  4YAP A;  1O8X A;  1DBY A;  2V2G A;  2MMN A;  3WT2 A;  2GS3 A;  4ZBA A;  1T4Z A;  2HNL A;  6GSV A;  3LWA A;  3CYN A;  4L8E A;  4OFT A;  3Q19 A;  3VPT A;  3QAW A;  4ULX A;  5IMC A;  3LG6 A;  2F8F A;  1GLP A;  1XCC A;  2PBJ A;  5IPH A;  5H5S A;  4IW9 A;  1KEB A;  1GNE A;  2WGR A;  4HJM A;  2X99 A;  1XVW A;  2H70 A;  3APO A;  4N10 A;  1JFU A;  1QQ2 A;  2I3Y A;  4YQV A;  4NWY A;  3GKM A;  2VLU A;  5ECH B;  6GSS A;  4E8H A;  1I9D A;  1GUK A;  4WBR D;  4XS1 A;  1A8L A;  4HQZ A;  4Q5Q A;  2L5L A;  3MWH A;  5ENU A;  2VUP A;  2YAN A;  4KW6 A;  1XPV A;  3F0I A;  2HRA A;  1DUG A;  2FNO A;  2DML A;  1FVJ A;  4HU9 A;  1HQO A;  3BJ5 A;  4KCA A;  4GCI A;  3TGZ A;  1Z6M A;  1X5D A;  4HOJ A;  3ERG A;  3WGX A;  3HDC A;  4V1A p;  3BOA A;  5DAK B;  2DSA A;  1BYE A;  1ON4 A;  2YWN A;  2B5Y A;  2H1B A;  2CVD A;  5JCW A;  2KHP A;  3ZL5 A;  2ON5 A;  5E4W A;  4MZC A;  4N30 A;  3VWW A;  4F03 A;  2H0H A;  2L59 A;  5FHI A;  1M7T A;  5H5Q A;  5IMZ A;  2PGT A;  1KNG A;  3FZA A;  4WR5 A;  5FT3 A;  1S3C A;  5LNK e;  4F0B A;  3CRT A;  2UZ8 A;  4EUY A;  2GZZ A;  3VI5 A;  2VM1 A;  3QFA C;  3QMX A;  3FW2 A;  2H6X A;  4MJE A;  5INY A;  3MDK A;  1G7O A;  2LUS A;  3M9J A;  3FZ9 A;  3IK9 A;  1Q4J A;  4POB A;  2C0G A;  5DDL A;  5F8B A;  2WJU A;  2M80 A;  4PQI A;  3V1W A;  3GL3 A;  5CRE A;  5ECL B;  3KD0 A;  4ECI A;  3TJB A;  1AXD A;  5ELA A;  2K8S A;  2CX3 A;  3LGC A;  4GLT A;  1GWC A;  3UAR A;  3KMO A;  4IBP A;  5D93 A;  2GQL A;  1ERT A;  1TK8 B;  2ALB A;  1AUC A;  2BJX A;  3R2Q A;  4TR3 A;  4NXI A;  1PSQ A;  4IP1 A;  5ECM B;  4G19 A;  3VK9 A;  4TOP A;  1ILO A;  3NOF A;  4IGJ A;  1R5A A;  1GL8 A;  4IP6 A;  4ZL9 A;  4K0G A;  1AW9 A;  1GH2 A;  5IOX A;  3TDG A;  4EDZ A;  1B8X A;  4V2N A;  3BBY A;  1AC1 A;  1AQX A;  3SWL A;  2VL9 A;  4EDY A;  5BMU A;  3DKS A;  4EVM A;  5IPG A;  5EVO A;  4XS6 A;  1EOH A;  1ZOF A;  1UA5 A;  1KBN A;  4BVY A;  2JSY A;  5EY6 A;  2FA8 A;  2X8H A;  3WD6 A;  4K6X A;  2YWI A;  2GZY A;  5KN3 A;  4HEA 2;  4OMV A;  2OE0 A;  4PGT A;  2H30 A;  4WKW A;  5KN0 A;  4K7N A;  4L0U A;  3TKR A;  4D73 A;  3QDN A;  1QGV A;  16GS A;  4F9Z A;  3LJR A;  2NTO A;  4G0L A;  1XW6 A;  1USB A;  4KSM A;  2IIY A;  4O92 A;  2J9H A;  4PUA A;  3ZIV A;  4ZBB A;  4XS4 B;  1F3B A;  4EF0 A;  5D96 A;  3G9B A;  1M9B A;  2HSN B;  3G7Y A;  2QSI A;  2LRC A;  1R4W A;  4X43 A;  2H19 A;  1SK1 A;  2DIZ A;  2LNS A;  3MNG A;  4POM A;  1M2A A;  4G10 A;  1IYI A;  3UEM A;  2OAD A;  1U87 A;  20GS A;  3F3Q A;  1RQM A;  2DBC A;  5J9B A;  1QXH A;  1SYX A;  1SL2 B;  4RI6 A;  4Q5F A;  3H4K A;  2AUV A;  3FR3 A;  4DVC A;  4FO5 A;  3KXO A;  3GN3 A;  1WE0 A;  2OAC A;  1H4O A;  3C73 A;  4H86 A;  1K0D A;  2H76 A;  4E8E A;  1A0F A;  1YZX A;  3GSS A;  2WDU A;  2V6K A;  3D22 A;  1GTU A;  3ISO A;  2YJH A;  5IMD A;  4RI7 A;  2WRT A;  4KDY A;  2F9S A;  4HZ4 A;  4GWR A;  1XIY A;  4TXO A;  2WCI A;  3F9U A;  4POK A;  4MJC A;  2GZP A;  2VCV A;  3TJK A;  1X9M B;  4XIH A;  2YCD A;  4QQ7 A;  3FEU A;  5G31 A;  1FOV A;  2AV4 A;  1RW1 A;  5IO2 A;  1XWC A;  1JHB A;  1GTI A;  1W89 A;  4JE1 A;  3NIV A;  1VF1 A;  4JR6 A;  3UAP A;  3L9U A;  1BG5 A;  2AB6 A;  4NMU A;  4I97 A;  1S3A A;  2CZ3 A;  3IBH A;  1T4Y A;  4MPG A;  2YJ7 A;  2QC7 A;  2L6C A;  3FYG A;  3QFB C;  5F05 A;  2HRN A;  2IN3 A;  2LV3 A;  3MSZ A;  4L5O A;  5LD0 A;  2LRT A;  2ZCT A;  1NHY A;  2O87 A;  3E9J B;  3VFI A;  2FCH A;  5ABR A;  3FZ4 A;  3ZRD A;  4G0K A;  1JZR A;  4K7I A;  3I6A A;  5HR0 A;  4K0N A;  3HZ4 A;  5HR1 A;  3WGE A;  5B6M A;  1Z6N A;  3D0Z A;  2DJ3 A;  2HRF A;  1ZMA A;  3GH9 A;  1B4Q A;  1BAY A;  19GS A;  3I43 A;  4AJ6 A;  4PQ1 A;  2X8G A;  4WR4 A;  2VAF A;  2CZ2 A;  1A0R P;  2HLS A;  1SU9 A;  4ECJ A;  3GRX A;  3VUR A;  4MA9 A;  1XZO A;  4POL A;  2OBK A;  3DGQ A;  1WJK A;  1TRV A;  4PUF C;  5JWR B;  1C72 A;  1SEN A;  3ZZX A;  2WZ9 A;  3Q6O A;  2MBT A;  4QL7 A;  1U3I A;  1A8Y A;  3Q18 A;  5KN1 A;  5J5N A;  4K8M A;  2H0I A;  3F6F A;  2H1G A;  1GTA A;  1YY7 A;  5AIS A;  2VLV A;  4V2L A;  4YAV A;  3GKX A;  4IEL A;  2B3S A;  4PNF A;  2HZF A;  2P0G A;  4ZIJ A;  5ECR B;  2H8L A;  2RUF A;  3EC3 A;  3N9J A;  2I1U A;  1B9X C;  5DAL A;  5CO3 A;  1ZCP A;  2C3Q A;  3GNJ A;  1SK0 A;  4LA1 A;  3KM6 A;  2PU9 C;  3DYR A;  5JCU A;  1FAA A;  3W8J A;  2B5E A;  1VF3 A;  2C4J A;  2HXK A;  3ZYW A;  4YH2 A;  1FB0 A;  1A2J A;  1JZO A;  1K0B A;  1YJ6 A;  4EXJ A;  4OFM A;  3TRP A;  3DEX A;  1ABA A;  1SJZ A;  4KDU A;  1HNC A;  3GIX A;  2G2Q A;  3P7X A;  4BL7 B;  3ZIJ A;  4FH8 A;  2VD0 A;  4OFN A;  2L6D A;  4P3Y B;  5IM9 A;  5AIX A;  1TU7 A;  2MMO A;  10GS A;  1YDK A;  5EL8 A;  5DJL A;  3TRQ A;  1CQG A;  2B1L A;  1AAZ A;  5HFG A;  2HRK B;  2RM6 A;  4GSS A;  2JSZ A;  2C3T A;  2QGV A;  5J41 A;  5G1K A;  4X1U A;  1A24 A;  1TW9 A;  3FRC A;  4JR4 A;  2O85 A;  3TKS E;  2F3M A;  1JZW A;  2N5A A;  4G0I A;  9GSS A;  1PX6 A;  3QR6 A;  2MZC A;  1OAZ A;  1X5E A;  3ZFB A;  1PKW A;  4TXV A;  2R3X A;  2R4V A;  3GHA A;  4KF9 A;  2LQQ A;  1GNW A;  1SKR B;  1J0F A;  3PR8 A;  5CAX A;  2C0E A;  4ML6 A;  3GKK A;  5D9W A;  2DMM A;  1V9W A;  3GUR A;  4JED A;  3ME7 A;  1EGR A;  4EL1 A;  4MF6 A;  2DLX A;  4XHM A;  4G2E A;  3QOU A;  2GLR A;  3GTU A;  1QUW A;  2H6Y A;  4ZB6 A;  5ID2 B;  4KA0 A;  1GRX A;  1V58 A;  1FVK A;  5GAP D;  2VM2 A;  3TOT A;  3TJF A;  5IO0 A;  1B9Y C;  2V32 A;  2ZNM A;  2L57 A;  1KTE A;  3EE2 A;  2VCQ A;  1MTC A;  1R7H A;  2M46 A;  3HCZ A;  2YN1 A;  1SKS B;  2HE3 A;  3DXB A;  2H0G A;  5CRG A;  5CNW A;  3D4M A;  4IQA A;  3HZ8 A;  2NBS A;  4NAX A;  2CQ9 A;  2IFQ B;  2VO4 A;  2P31 A;  2GQK A;  2IME A;  1XWA A;  2HYX A;  6GSY A;  1WWJ A;  3C71 A;  4KND A;  4BVX B;  1SKW B;  1GUM A;  2IPA A;  8GSS A;  1THO A;  2C0F A;  2QKE A;  1O85 A;  2HT9 A;  1DSB A;  1K3Y A;  3IE3 A;  3HJP A;  2F8A A;  1U88 A;  3GA4 A;  5GSS A;  4NV2 A;  4MF5 A;  2CV4 A;  4QL9 A;  5B8B A;  3L0H A;  3P90 A;  2O8V B;  2LST A;  1X9W B;  1SYR A;  1BX9 A;  1OC9 A;  1LBK A;  2N5F A;  1RK4 A;  3IXR A;  3HHV A;  4TR4 A;  1LU4 A;  3LSZ A;  1THX A;  2EC4 A;  4KCE A;  1OC8 A;  2REM A;  1SD9 A;  3D5J A;  2HSM A;  3TKQ A;  4DSS B;  5D9T A;  3TRX A;  1F9M A;  3IAM 2;  3TKS C;  2LJK A;  4ZL7 A;  2LJR A;  3IHQ A;  2ES7 A;  4XRA A;  2IMF A;  2GVP A;  3FHK A;  2Z9S A;  1YKC A;  4KAE A;  5A4V A;  4WF4 A;  4KGI A;  4YQM A;  5CRH A;  2KOK A;  3M1G A;  4OO4 A;  4LMW A;  2XC2 A;  2MYG A;  2OA7 A;  2FY6 A;  2HQT A;  5JCG A;  1SJ6 A;  2H1A A;  1TKD B;  5ECP B;  4PTS A;  4N11 A;  4JU5 A;  4TKY A;  5J4U A;  3FR6 A;  4GSN A;  3O6T A;  5IMA A;  1NHO A;  4TR1 A;  5ELG A;  1GUL A;  2CX4 A;  4MZB A;  3BD2 A;  3G7J A;  1BQ7 A;  1TTZ A;  4DSR A;  4EO3 A;  3TJJ A;  3ZVJ D;  1M99 A;  1UVZ A;  1F37 A;  5HFI A;  4HI7 A;  1SL0 B;  2VCX A;  2JAD A;  2RLI A;  1O6J A;  3HXS A;  3TKS A;  1U3A A;  4JZQ A;  6GSU A;  3A5W A;  1MDJ A;  1AIU A;  4L5L A;  4ID0 A;  1PMT A;  2LNT A;  3P8W A;  1X9S B;  3QAV A;  1EGO A;  3LXT A;  1MEK A;  3UIW A;  1AQV A;  2PVQ A;  1EEM A;  3W6G A;  3H1N A;  1PA3 A;  4HJ2 A;  2YZU A;  4EC0 A;  4Z7X A;  4GF0 A;  2JZR A;  4L0W A;  2PMT A;  1PN9 A;  4FYU A;  2LEG A;  5DCG A;  1YF0 A;  2GQM A;  3RDW A;  1G7E A;  3WYW A;  4F82 A;  4I6X A;  5A4U A;  3C1S A;  2L4C A;  2GDR A;  3M0F A;  1J9B A;  4K9Z A;  2B6M A;  3A3T A;  4ZBD A;  3TJG A;  4RQX A;  2B7J A;  4IN0 A;  2GT6 A;  1OE8 A;  1J08 A;  2CVB A;  2VCT A;  3IK7 A;  7GSS A;  3IR4 A;  4HZ2 A;  5C04 A;  2GSQ A;  1XW5 A;  2GSS A;  4CDO A;  1T3B A;  3KP9 A;  2IFQ A;  1EP8 A;  3KP8 A;  3ZLP A;  3NZN A;  2NVL A;  2ZUP A;  2V41 A;  4MK3 A;  2IJY A;  2R6K A;  3GH6 A;  5G1L A;  2GGT A;  5DAK A;  4FIW A;  4BVX A;  4LL1 B;  2JU5 A;  4CW9 A;  2H73 A;  6GST A;  5ECI B;  5ECO B;  4MH2 A;  1V40 A;  3D21 A;  2AJQ B;  5KEJ A;  4KSO A;  1GSD A;  2VL2 C;  3EYT A;  5EPF A;  1ZYE A;  2FA4 A;  4IVF A;  2K8V A;  3GMF A;  4KH7 A;  3UBL A;  1TDI A;  1V98 A;  3PIN A;  4KUN A;  3ME8 A;  2O7K A;  5B6N A;  5D73 A;  1BED A;  2B7K A;  2H66 A;  3BCI A;  22GS A;  3DRN A;  3HKR A;  5D9V A;  4K7O A;  1FB6 A;  2IMK A;  2LTK A;  1XOA A;  4ECC A;  4HS1 A;  3EVI A;  1HNA A;  4AF2 A;  1SJI A;  4O5R A;  3IAS 2;  2B1K A;  2DJK A;  2FWH A;  4KE3 A;  2WFC A;  2HFD A;  2CVK A;  2FWE A;  5C00 A;  3C7M A;  2X64 A;  1H75 A;  1I5G A;  3K8N A;  4GRF A;  4KX4 A;  2JZS A;  2LKU A;  3UJ1 A;  4IJI A;  3L78 A;  1PQN A;  3GX0 A;  3TCO A;  1V57 A;  1K0C A;  5IMF A;  3M9K A;  4ECB A;  3PPU A;  5JWQ B;  4GQF A;  1EP7 A;  3D4T A;  3F63 A;  1GSS A;  1NSW A;  1XWG A;  2VL2 A;  3ZMK A;  3PH9 A;  5GST A;  2DIY A;  4EE0 A;  4YQU A;  3VWV A;  2AYT A;  2DC5 A;  1TJD A;  3IOS A;  4F2I A;  1O73 A;  4USS A;  4RQR A;  1ERU A;  2F51 A;  5G30 A;  3US3 A;  3I9V 2;  2XPD A;  3HA9 A;  2WS2 A;  2BMX A;  3FK8 A;  4AGS A;  2YWM A;  1O8W A;  1TU8 A;  2R37 A;  3J7Y k;  3IV4 A;  2A4V A;  4J57 E;  1Y25 A;  3UL3 A;  3KTB A;  1MDK A;  3JCM L;  2HSY A;  1TI3 A;  1K0O A;  2C1Y A;  5DQY A;  2GT5 A;  3UBK A;  2TIR A;  3HD5 A;  2OE3 A;  2EIR A;  4V1A g;  1EWX A;  4JRR A;  3LEF A;  3A2V A;  5B7C A;  4XCS A;  2PUK C;  1T8E B;  13GS A;  4XS4 A;  1GSU A;  3HJM A;  3IA1 A;  3KGK A;  5AIV A;  2E7P A;  3SBC A;  1AQW A;  2YOI A;  3KZQ A;  1M0U A;  2NDO A;  4DEJ A;  4GTU A;  1E2Y A;  4MAB A;  1PD2 1;  5E59 A;  5CRD A;  2H71 A;  3CMI A;  1XWK A;  4N0V A;  3F4R A;  1GSE A;  1GTB A;  2OE1 A;  5D9X A;  5KN2 A;  2IMI A;  3J7Y b;  3EMX A;  3RAZ A;  2YZH A;  1WPI A;  2GST A;  1FO5 A;  1TRS A;  1F6M C;  1M9A A;  3IC8 A;  1U6T A;  2IWT A;  2E2G A;  2H72 A;  4MMM A;  1QMV A;  12GS A;  2L4Q A;  1OKD A;  4ACS A;  4MJB A;  3KCM A;  5ECK B;  2KUC A;  3CBU A;  4BVY B;  2OBI A;  1F3A A;  1FG4 A;  2EIQ A;  5LCZ A;  1TI1 A;  3FZ5 A;  4J2F A;  4O32 A;  2E2M A;  4G9H A;  5HFK A;  1DE1 A;  2E0Q A;  2KP1 A;  4PX1 A;  2VLT A;  2CA8 A;  3VLN A;  2VIM A;  3IDV A;  4N0Z A;  2C80 A;  2JZT A;  5CYY A;  4OCE A;  4D73 B;  2I9H A;  2TRX A;  3G7I A;  4ZXG A;  4OWY A;  2HI7 A;  4IS0 A;  5G2Z A;  5J9C A;  2RUE A;  2VOC A;  3S9F A;  3HY2 A;  1UN2 A;  4HDE A;  4LMV A;  6GSX A;  4MH3 A;  4XRD A;  2O89 A;  3LFL A;  2RII A;  2D2Z A;  3QCP A;  1E6B A;  5HR2 A;  2N5B A;  3BCK A;  3HVS A;  3E0U A;  3TOU A;  3FKF A;  2WUL A;  5J3R A;  1SK2 A;  2YNX A;  1OE7 A;  4K1F A;  3TUE A;  3EWL A;  3F8U A;  1QFN A;  3L4N A;  4FYC A;  4OO5 A;  1ZL9 A;  1YF1 A;  5DCH A;  1V2A A;  2I81 A;  1NM3 A;  3KMN A;  3U6V A;  3U5R E;  2EIO A;  5IIZ A;  4TW5 A;  5D8I A;  1B4P A;  1PKZ A;  1PX7 A;  2FUG 2;  5COH A;  1A2L A;  2PPT A;  1DE2 A;  1FHE A;  4AJ7 A;  3PGT A;  1OKT A;  4J56 E;  4KDX A;  1EOG A;  4O7H A;  4TXO B;  2PN8 A;  3H93 A;  1ERV A;  5A4W A;  4GST A;  4HQS A;  4NHW A;  1IYH A;  4XTS A;  2M72 A;  2X8C A;  1WMJ A;  3A2W A;  1X0R A;  1OYJ A;  2LQO A;  1XW9 A;  4ZL8 A;  4K2D A;  1MD4 A;  2IL3 A;  2CAQ A;  4IHU A;  1SD8 A;  1ACV A;  1M2B A;  1TK0 B;  5FWG A;  3VI7 A;  1GSY A;  1N2A A;  2YPM A;  3RHC A;  3VPQ A;  4MDC A;  1FW1 A;  5ECQ B;  3EUR A;  2XPE A;  11GS A;  1TK5 B;  5DQS A;  2AHE A;  2PVO C;  3RPP A;  3DWV A;  3F4T A;  4TR0 A;  2HSH A;  3OR5 A;  4WET A;  2DJ1 A;  3O3T A;  1A23 A;  2WB9 A;  2GSR A;  2R2J A;  1EV4 A;  2PWJ A;  4BL7 A;  1W4V A;  4NV5 A;  5DJM A;  4I2U A;  1K0A A;  2K9F A;  4ML1 A;  1K0M A;  4MP4 A;  4HUA A;  2HZE B;  1OC3 A;  2PER A;  3AY8 A;  1XXU A;  3CRU A;  2HRK A;  2JL4 A;  4MF7 A;  2J23 A;  2VCW A;  5GZZ B;  1JLW A;  3UOM A;  2FWF A;  1URM A;  4LL4 B;  1ERW A;  2KP2 A;  17GS A;  4NHZ A;  5AGY A;  2XHF A;  2MMA A;  3N5O A;  3O76 A;  4WF5 A;  5GAN D;  2P5Q A;  2AAW A;  1G6Y A;  2P5R A;  5IMV A;  2LRN A;  4BWS A;  4GQC A;  3LXZ A;  2C8U A;  1R26 A;  2H1D A;  1ST9 A;  4AJ8 A;  3ZML A;  1B48 A;  3P2A A;  2LS5 A;  3A2X A;  2K18 A;  3L9S A;  1QK8 A;  4ZB9 A;  1ZGN A;  2CAI A;  4IKH A;  2DJ2 A;  3VWX A;  5DAL B;  6GSW A;  3HYP A;  1NW2 A;  5ID2 A;  1TP9 A;  2FLS A;  1HNB A;  4MPF A;  3M3M A;  3W8S A;  5AN1 A;  4GXZ A;  3WT1 A;  3E3E A;  2CT6 A;  4JBB A;  1UC7 A;  3CSI A;  2BTO T;  2FD3 A;  2H01 A;  3QPM A;  4NPB A;  1LJR A;  1N8J A;  2YP6 A;  1BJX A;  1R5P A;  1Z9H A;  4OCF A;  4I2T A;  4IJ3 A;  3LQ7 A;  2VD1 A;  4FQU A;  2OJL A;  3DML A;  4MJA A;  4TN8 A;  1HYU A;  3IRA A;  3RBT A;  3QAG A;  3KTL A;  3UVH A;  3D6I A;  3HJO A;  2H74 A;  1YKA A;  4BWQ A;  2DJ0 A;  1K3O A;  1GSQ A;  3VWU A;  2G0F A;  1JLV A;  4V2M A;  3EU3 A;  3ERW A;  3APQ A;  5B8A A;  1ZYQ B;  3H79 A;  1M2D A;  3F4S A;  5DVB A;  3R3E A;  4Q5R A;  3ZFL A;  4I5Q A;  1O7U A;  3GFK A;  3EU4 A;  1YEX A;  3UVT A;  3KIJ A;  1SL1 B;  3QD9 A;  4I8B A;  3WGD A;  1VF4 A;  2A2R A;  3GST A;  5F07 A;  3ZRE A;  3GTU B;  4EKZ A;  3IC4 A;  1XOB A;  5F06 A;  1T7P B;  1ZZY A;  3DVX A;  4ZIL A;  5G5F A;  2C3N A;  2YV7 A;  1MD3 A;  4ISD A;  1S3D A;  3FY7 A;  1PL2 A;  4MLY A;  1VRS D;  2R5G A;  3ERF A;  3UMA A;  4DSS A;  3ED3 A;  3GV1 A;  4TVE A;  1Q98 A;  1F2E A;  3GL5 A;  2XBQ A;  3KEB A;  1WOU A;  1T1V A;  1HD2 A;  2FGX A;  3C8E A;  1XFL A;  3GYK A;  2VL3 A;  1XBS A;  1TOF A;  5L71 A;  4MZW A;  4TRX A;  3CXG A;  5A5K A;  2I4A A;  2DJJ A;  2V1M A;  1Y6E A;  3KH9 A;  2LJA A;  4MCU A;  3TB2 A;  4RUV A;  5IOW A;  2A2S A;  3RHB A;  2C0D A;  4PXO A;  3LYP A;  1EEJ A;  2IMD A;  3CTG A;  3HVX A;  2HZE A;  4ILF A;  2NPB A;  1OVN A;  2B5X A;  4FYB A;  2H6Z A;  5G5E A;  4PUR A;  1YEP A;  1VGL A;  2XBI A;  1PRX A;  4OD7 A;  3GUS A;  3DD3 A;  2MMZ A;  2H75 A;  4HU7 A;  1Z3E A;  4WXT A;  3LOR A;  1Z7P A;  3TKP A;  2YWO A;  2K6V A;  1OC9 B;  1T00 A;  3CSJ A;  3RPN A;  5CP1 A;  3GKN A;  1ML6 A;  2YV9 A;  4F0C A;  4PNG A;  1YQ1 A;  1K3L A;  3F3R A;  2RM5 A;  3EIN A;  2HSM B;  2JAC A;  3EMP A;  1GP1 A;  4KB3 A;  2VCZ A;  1PGT A;  1G0T A;  18GS A;  3ZVJ A;  1GUH A;  4PQH A;  2FHE A;  1G6W A;  5H5R A;  3DVW A;  1WP0 A;  3C1R A;  3HVV A;  5JWO B;  2TRC P;  5F0G A;  3CTF A;  3GX8 A;  1X5C A;  4CHS A;  4BA7 A;  3Q74 A;  1A2M A;  1EZK A;  4ZB8 A;  3FR9 A;  1CQH A;  1XWB A;  1GSF A;  2FWG A;  3IPZ A; 
#chains in the Genus database with same CATH topology
 1VF2 A;  1Z7R A;  3H8Q A;  1K0N A;  3KJY A;  2OKA A;  3MAK A;  1BG1 A;  5CRW A;  2MBS A;  2WW1 A;  4IQ1 A;  5A5H B;  2ON7 A;  3I69 A;  3APS A;  1WRY A;  5A1N A;  4TR1 B;  3CSH A;  4DSQ A;  14GS A;  1MDI A;  1TXX A;  3F6D A;  2GTU A;  4X0X A;  4Q5N A;  1XVQ A;  3LYK A;  1GLQ A;  2L5O A;  3ZIT A;  3ZTL A;  1PL1 A;  2DKH A;  1EV9 A;  2KLX A;  4WBJ A;  5ECS A;  1WIK A;  5IQY A;  4BPY A;  5HR3 A;  3DIE A;  3RGB C;  5DBQ A;  3M8N A;  2V6O A;  5HQP A;  1TRW A;  4LLR A;  1TRU A;  4WEY A;  3L9V A;  1O81 A;  5ECN B;  3KH7 A;  1JZD A;  1Z5Y E;  4YAP A;  1O8X A;  1DBY A;  2V2G A;  2MMN A;  3WT2 A;  2GS3 A;  4ZBA A;  1T4Z A;  2HNL A;  6GSV A;  3LWA A;  3CYN A;  4L8E A;  4OFT A;  3Q19 A;  3VPT A;  3QAW A;  4ULX A;  5IMC A;  3LG6 A;  2F8F A;  1GLP A;  1XCC A;  2PBJ A;  5IPH A;  5H5S A;  4IW9 A;  1KEB A;  1GNE A;  1S3R A;  2WGR A;  4HJM A;  2X99 A;  1XVW A;  2H70 A;  3APO A;  4N10 A;  1JFU A;  1QQ2 A;  2I3Y A;  3LW9 A;  4YQV A;  4NWY A;  3GKM A;  2VLU A;  5ECH B;  6GSS A;  5A34 A;  4E8H A;  1I9D A;  1GUK A;  4WBR D;  4XS1 A;  1A8L A;  4HQZ A;  4Q5Q A;  2L5L A;  3MWH A;  5ENU A;  2VUP A;  2YAN A;  4KW6 A;  1XPV A;  3F0I A;  2HRA A;  1DUG A;  2FNO A;  2DML A;  1FVJ A;  4HU9 A;  1HQO A;  3BJ5 A;  4KCA A;  4GCI A;  3TGZ A;  1Z6M A;  1X5D A;  4HOJ A;  3ERG A;  3WGX A;  3HDC A;  4V1A p;  3BOA A;  5DAK B;  2DSA A;  1BYE A;  1ON4 A;  2B5Y A;  2H1B A;  2KHP A;  2CVD A;  5JCW A;  2YWN A;  3ZL5 A;  2ON5 A;  5E4W A;  4MZC A;  4N30 A;  3VWW A;  4F03 A;  2H0H A;  2L59 A;  5FHI A;  1M7T A;  5H5Q A;  5IMZ A;  2PGT A;  1KNG A;  3FZA A;  4WR5 A;  5FT3 A;  1S3C A;  5LNK e;  4F0B A;  3CRT A;  2EFC A;  2UZ8 A;  4EUY A;  2GZZ A;  3VI5 A;  2VM1 A;  3QFA C;  4AI6 A;  3QMX A;  3FW2 A;  2H6X A;  2OT3 A;  4MJE A;  5INY A;  3MDK A;  1G7O A;  2LUS A;  3M9J A;  3FZ9 A;  3IK9 A;  1Q4J A;  4POB A;  2C0G A;  1YVL A;  5DDL A;  5F8B A;  2WJU A;  2M80 A;  4PQI A;  3V1W A;  3GL3 A;  5CRE A;  5ECL B;  3KD0 A;  5J40 A;  4ECI A;  3TJB A;  1AXD A;  5ELA A;  2K8S A;  2CX3 A;  4E68 A;  3LGC A;  1M3J A;  4GLT A;  1GWC A;  3MYD A;  3UAR A;  3KMO A;  4IBP A;  5D93 A;  2GQL A;  1YEW C;  1ERT A;  1TK8 B;  2ALB A;  1AUC A;  2BJX A;  3R2Q A;  4TR3 A;  4NXI A;  1PSQ A;  4IP1 A;  5ECM B;  4G19 A;  3VK9 A;  4TOP A;  1ILO A;  3NOF A;  4IGJ A;  1R5A A;  1GL8 A;  4IP6 A;  4ZL9 A;  4K0G A;  1AW9 A;  1GH2 A;  5IOX A;  3TDG A;  4EDZ A;  1B8X A;  4V2N A;  3BBY A;  1AC1 A;  1AQX A;  3SWL A;  2VL9 A;  4EDY A;  5BMU A;  3DKS A;  4EVM A;  5IPG A;  5EVO A;  4XS6 A;  1EOH A;  1ZOF A;  1UA5 A;  1KBN A;  4BVY A;  2JSY A;  5EY6 A;  2FA8 A;  2X8H A;  3WD6 A;  4K6X A;  2YWI A;  2GZY A;  5KN3 A;  4HEA 2;  4OMV A;  2OE0 A;  4PGT A;  2H30 A;  4WKW A;  5KN0 A;  4K7N A;  4L0U A;  3TKR A;  4D73 A;  3QDN A;  1QGV A;  16GS A;  4F9Z A;  3LJR A;  2NTO A;  4G0L A;  1XW6 A;  1USB A;  4KSM A;  2IIY A;  4O92 A;  2J9H A;  4PUA A;  3ZIV A;  5J47 A;  4ZBB A;  4XS4 B;  1F3B A;  4EF0 A;  5D96 A;  3G9B A;  1M9B A;  2HSN B;  3G7Y A;  2QSI A;  2LRC A;  1R4W A;  4X43 A;  2H19 A;  1SK1 A;  2DIZ A;  2LNS A;  3MNG A;  4POM A;  1M2A A;  4G10 A;  1IYI A;  3UEM A;  2OAD A;  1U87 A;  20GS A;  3F3Q A;  1RQM A;  2DBC A;  5J9B A;  1QXH A;  1SYX A;  1SL2 B;  4RI6 A;  4Q5F A;  3H4K A;  2AUV A;  3FR3 A;  4DVC A;  4FO5 A;  3KXO A;  3GN3 A;  1WE0 A;  2OAC A;  1H4O A;  3C73 A;  4ZB7 A;  4H86 A;  3MIX A;  1K0D A;  2H76 A;  4E8E A;  1A0F A;  1YZX A;  3GSS A;  2WDU A;  2V6K A;  1SVO A;  3D22 A;  1GTU A;  3ISO A;  2YJH A;  5IMD A;  4RI7 A;  4CY6 A;  5BRT A;  2WRT A;  4KDY A;  2F9S A;  4HZ4 A;  4GWR A;  1XIY A;  4TXO A;  2WCI A;  3F9U A;  4POK A;  4MJC A;  2GZP A;  2VCV A;  3TJK A;  1X9M B;  4XIH A;  2YCD A;  4QQ7 A;  3FEU A;  5G31 A;  1FOV A;  2AV4 A;  1RW1 A;  5IO2 A;  1XWC A;  1JHB A;  1GTI A;  1W89 A;  4JE1 A;  3NIV A;  1VF1 A;  4JR6 A;  3UAP A;  3L9U A;  1BG5 A;  2AB6 A;  4NMU A;  4I97 A;  1S3A A;  2CZ3 A;  3IBH A;  1T4Y A;  4MPG A;  2YJ7 A;  2QC7 A;  2L6C A;  3FYG A;  3QFB C;  4K5R A;  5F05 A;  2HRN A;  2IN3 A;  2LV3 A;  3MSZ A;  4L5O A;  5LD0 A;  2LRT A;  2ZCT A;  1NHY A;  2O87 A;  3E9J B;  3VFI A;  2FCH A;  5ABR A;  3FZ4 A;  3ZRD A;  4G0K A;  1JZR A;  2WW0 A;  4K7I A;  3I6A A;  5HR0 A;  4K0N A;  3HMJ G;  3HZ4 A;  5HR1 A;  3WGE A;  5B6M A;  1Z6N A;  3D0Z A;  2DJ3 A;  2HRF A;  1ZMA A;  3GH9 A;  1B4Q A;  1BAY A;  19GS A;  3I43 A;  4AJ6 A;  4Z2R A;  4PQ1 A;  2X8G A;  4WR4 A;  2VAF A;  2CZ2 A;  1A0R P;  2HLS A;  1SU9 A;  4ECJ A;  3GRX A;  3VUR A;  4MA9 A;  1XZO A;  4POL A;  2OBK A;  3DGQ A;  1WJK A;  1TRV A;  4PUF C;  5JWR B;  1C72 A;  1SEN A;  3ZZX A;  2WZ9 A;  3Q6O A;  1XG8 A;  2MBT A;  4QL7 A;  1U3I A;  4W66 A;  1A8Y A;  3Q18 A;  5KN1 A;  5J5N A;  4K8M A;  2H0I A;  3F6F A;  2H1G A;  1GTA A;  2VLV A;  1YY7 A;  5AIS A;  4V2L A;  4YAV A;  3GKX A;  4IEL A;  2B3S A;  4PNF A;  2HZF A;  4G01 A;  2P0G A;  4ZIJ A;  5ECR B;  4MNN A;  2H8L A;  2RUF A;  3EC3 A;  3N9J A;  2I1U A;  1B9X C;  5DAL A;  4O5Q A;  5CO3 A;  1ZCP A;  2C3Q A;  3A5I A;  3GNJ A;  1SK0 A;  4LA1 A;  3KM6 A;  2PU9 C;  3DYR A;  5JCU A;  1FAA A;  3W8J A;  2B5E A;  1VF3 A;  2C4J A;  2HXK A;  3ZYW A;  4YH2 A;  1FB0 A;  1A2J A;  1JZO A;  2HSN A;  1K0B A;  1YJ6 A;  4EXJ A;  1S4B P;  4OFM A;  1M3I A;  3TRP A;  3DEX A;  1ABA A;  1SJZ A;  4KDU A;  1HNC A;  3GIX A;  2G2Q A;  3P7X A;  4BL7 B;  3ZIJ A;  4FH8 A;  2VD0 A;  4OFN A;  2L6D A;  4P3Y B;  5IM9 A;  5AIX A;  1TU7 A;  2MMO A;  10GS A;  1YDK A;  5EL8 A;  5DJL A;  3TRQ A;  1CQG A;  2B1L A;  1AAZ A;  5HFG A;  2HRK B;  2RM6 A;  4GSS A;  2JSZ A;  4AKX B;  2C3T A;  2QGV A;  5J41 A;  5G1K A;  4X1U A;  1A24 A;  1TW9 A;  3FRC A;  4JR4 A;  2O85 A;  3TKS E;  2F3M A;  1JZW A;  2N5A A;  4G0I A;  9GSS A;  1PX6 A;  4K2X A;  3QR6 A;  2MZC A;  1OAZ A;  1X5E A;  3ZFB A;  1PKW A;  4TXV A;  2R3X A;  2R4V A;  3GHA A;  4KF9 A;  2LQQ A;  1FOH A;  1GNW A;  1SKR B;  1J0F A;  4AKG A;  3PR8 A;  4PI0 C;  5CAX A;  2C0E A;  4ML6 A;  3GKK A;  5D9W A;  2DMM A;  1V9W A;  3GUR A;  4YKF A;  4JED A;  3ME7 A;  1EGR A;  4EL1 A;  4MF6 A;  2DLX A;  4XHM A;  4G2E A;  3QOU A;  2GLR A;  4O5U A;  3GTU A;  4CY8 A;  1QUW A;  2H6Y A;  4ZB6 A;  5ID2 B;  4KA0 A;  1GRX A;  1V58 A;  1FVK A;  5GAP D;  2VM2 A;  3TOT A;  3TJF A;  5IO0 A;  1B9Y C;  2V32 A;  2ZNM A;  2L57 A;  4K5S A;  1KTE A;  4FXY P;  3EE2 A;  2VCQ A;  1MTC A;  1R7H A;  2M46 A;  3HCZ A;  2YN1 A;  1SKS B;  2HE3 A;  3DXB A;  2H0G A;  5CRG A;  5CNW A;  3D4M A;  4IQA A;  3HZ8 A;  2NBS A;  2R0G A;  4NAX A;  4GDF A;  2CQ9 A;  2IFQ B;  2VO4 A;  2P31 A;  2GQK A;  2IME A;  1XWA A;  2HYX A;  6GSY A;  1WWJ A;  3C71 A;  4KND A;  4BVX B;  1SKW B;  1GUM A;  2IPA A;  4A5P A;  8GSS A;  1THO A;  2C0F A;  2QKE A;  1O85 A;  2HT9 A;  1DSB A;  1K3Y A;  3IE3 A;  3HJP A;  2F8A A;  1U88 A;  3GA4 A;  5GSS A;  4NV2 A;  4MF5 A;  2CV4 A;  4QL9 A;  1N25 A;  1SVM A;  5B8B A;  3L0H A;  3P90 A;  4EIP A;  2O8V B;  2LST A;  1X9W B;  1SYR A;  5J4V A;  1BX9 A;  1OC9 A;  1LBK A;  2N5F A;  1RK4 A;  3IXR A;  3HHV A;  4TR4 A;  1LU4 A;  3LSZ A;  1THX A;  2EC4 A;  4KCE A;  1OC8 A;  2REM A;  1SD9 A;  3D5J A;  2HSM A;  3TKQ A;  4DSS B;  5D9T A;  3TRX A;  1F9M A;  4QMK A;  3IAM 2;  3TKS C;  2LJK A;  4ZL7 A;  2LJR A;  3IHQ A;  2R0C A;  2ES7 A;  4XRA A;  2IMF A;  2GVP A;  3FHK A;  2Z9S A;  1YKC A;  4KAE A;  5A4V A;  4WF4 A;  4KGI A;  4YQM A;  1SVL A;  5CRH A;  2KOK A;  3M1G A;  4OO4 A;  4LMW A;  2XC2 A;  2MYG A;  2OA7 A;  2FY6 A;  2HQT A;  5JCG A;  1SJ6 A;  2H1A A;  1TKD B;  5ECP B;  4PTS A;  4N11 A;  5A5H A;  4JU5 A;  4TKY A;  5J4U A;  3FR6 A;  4GSN A;  3O6T A;  5IMA A;  1NHO A;  4TR1 A;  5ELG A;  1GUL A;  2CX4 A;  4MZB A;  3BD2 A;  3G7J A;  1BQ7 A;  1TTZ A;  4DSR A;  4EO3 A;  3TJJ A;  3ZVJ D;  1M99 A;  1UVZ A;  1F37 A;  5HFI A;  3CWG A;  4HI7 A;  1SL0 B;  2VCX A;  2JAD A;  2RLI A;  1O6J A;  2WVX B;  3HXS A;  3TKS A;  1U3A A;  4JZQ A;  6GSU A;  3A5W A;  1MDJ A;  1AIU A;  2R0P A;  4L5L A;  4ID0 A;  1PMT A;  2LNT A;  3P8W A;  1X9S B;  3QAV A;  1EGO A;  3LXT A;  1MEK A;  3UIW A;  1AQV A;  2PVQ A;  1EEM A;  3W6G A;  3H1N A;  1PA3 A;  4HJ2 A;  2YZU A;  4EC0 A;  4Z7X A;  4GF0 A;  2WW2 A;  2JZR A;  4L0W A;  2PMT A;  1PN9 A;  4FYU A;  2LEG A;  5DCG A;  1YF0 A;  2GQM A;  3RDW A;  1G7E A;  3WYW A;  4F82 A;  4I6X A;  2X49 A;  5A4U A;  3C1S A;  2L4C A;  2GDR A;  3M0F A;  1J9B A;  4K9Z A;  2B6M A;  3A3T A;  4ZBD A;  3TJG A;  4RQX A;  2B7J A;  4IN0 A;  2GT6 A;  1OE8 A;  1J08 A;  2CVB A;  2VCT A;  3IK7 A;  7GSS A;  3IR4 A;  4HZ2 A;  5C04 A;  2GSQ A;  5A1N B;  1XW5 A;  2GSS A;  4CDO A;  1T3B A;  3KP9 A;  2IFQ A;  1EP8 A;  3KP8 A;  3ZLP A;  3NZN A;  2NVL A;  2ZUP A;  2V41 A;  4MK3 A;  2IJY A;  2R6K A;  3GH6 A;  5G1L A;  2GGT A;  5DAK A;  4FIW A;  4BVX A;  4LL1 B;  2JU5 A;  4CW9 A;  2H73 A;  6GST A;  5ECI B;  5ECO B;  4MH2 A;  1V40 A;  3D21 A;  2AJQ B;  5KEJ A;  4KSO A;  1GSD A;  2VL2 C;  3EYT A;  5EPF A;  1ZYE A;  2X4A A;  2FA4 A;  4IVF A;  2K8V A;  3GMF A;  4KH7 A;  3UBL A;  1TDI A;  2QA1 A;  3CHX C;  1V98 A;  3PIN A;  4KUN A;  3ME8 A;  2O7K A;  5B6N A;  5D73 A;  1BED A;  2B7K A;  2H66 A;  3BCI A;  22GS A;  3DRN A;  3HKR A;  3TU3 B;  5D9V A;  4K7O A;  1FB6 A;  2IMK A;  2LTK A;  1XOA A;  4ECC A;  4HS1 A;  3EVI A;  1HNA A;  4AF2 A;  1SJI A;  4O5R A;  3IAS 2;  2B1K A;  2DJK A;  2FWH A;  1Y1U A;  4KE3 A;  2O3E A;  2O36 A;  2WFC A;  2HFD A;  2CVK A;  2FWE A;  5C00 A;  3C7M A;  2X64 A;  1H75 A;  1I5G A;  2A4H A;  3K8N A;  4GRF A;  4KX4 A;  2JZS A;  2LKU A;  3UJ1 A;  5A34 B;  4IJI A;  3L78 A;  1PQN A;  3GX0 A;  4PHZ C;  3TCO A;  1V57 A;  1K0C A;  5IMF A;  3M9K A;  4ECB A;  3PPU A;  5JWQ B;  4GQF A;  1EP7 A;  3D4T A;  3F63 A;  1GSS A;  1NSW A;  1XWG A;  2VL2 A;  3ZMK A;  3PH9 A;  5GST A;  2DIY A;  4EE0 A;  1ZYN A;  4YQU A;  3VWV A;  2AYT A;  2DC5 A;  1TJD A;  3IOS A;  4F2I A;  1O73 A;  4USS A;  4RQR A;  1ERU A;  2F51 A;  5G30 A;  3US3 A;  3I9V 2;  2XPD A;  3HA9 A;  2WS2 A;  2BMX A;  3FK8 A;  4AGS A;  2YWM A;  1O8W A;  3EPT A;  1TU8 A;  2R37 A;  3J7Y k;  3IV4 A;  2A4V A;  4J57 E;  4Z2T A;  1Y25 A;  3UL3 A;  3KTB A;  1MDK A;  1I1I P;  3JCM L;  3CQF A;  2HSY A;  1TI3 A;  1K0O A;  2C1Y A;  5DQY A;  2GT5 A;  3UBK A;  2TIR A;  3HD5 A;  2OE3 A;  2EIR A;  4V1A g;  4YKG A;  1EWX A;  4JRR A;  3LEF A;  3A2V A;  5B7C A;  4XCS A;  2PUK C;  3RFR C;  1T8E B;  13GS A;  4HSC X;  4XS4 A;  1GSU A;  3HJM A;  3IA1 A;  3KGK A;  5AIV A;  2E7P A;  3SBC A;  1AQW A;  2YOI A;  3KZQ A;  1M0U A;  2NDO A;  4DEJ A;  4GTU A;  1E2Y A;  4MAB A;  1PD2 1;  5E59 A;  5CRD A;  2H71 A;  3CMI A;  4X4J A;  1XWK A;  2H1L A;  4N0V A;  3F4R A;  1GSE A;  1GTB A;  2OE1 A;  5D9X A;  5KN2 A;  2IMI A;  3J7Y b;  3EMX A;  3RAZ A;  2YZH A;  1WPI A;  2GST A;  1FO5 A;  1TRS A;  1F6M C;  1M9A A;  3IC8 A;  1U6T A;  2IWT A;  2E2G A;  5BMU B;  2H72 A;  4MMM A;  1QMV A;  12GS A;  2L4Q A;  1OKD A;  4ACS A;  4MJB A;  3KCM A;  5ECK B;  2KUC A;  3CBU A;  4BVY B;  2OBI A;  1F3A A;  1FG4 A;  2EIQ A;  5LCZ A;  1TI1 A;  3FZ5 A;  4J2F A;  4O32 A;  2E2M A;  4G9H A;  5HFK A;  1DE1 A;  2E0Q A;  2KP1 A;  4PX1 A;  2VLT A;  2CA8 A;  3VLN A;  2VIM A;  3IDV A;  4N0Z A;  2C80 A;  2JZT A;  5CYY A;  4OCE A;  4D73 B;  2I9H A;  2TRX A;  3G7I A;  4BIK A;  4ZXG A;  4OWY A;  2HI7 A;  4IS0 A;  5G2Z A;  5J9C A;  2RUE A;  2VOC A;  3S9F A;  3HY2 A;  1UN2 A;  4HDE A;  4LMV A;  6GSX A;  4MH3 A;  2A2P A;  4XRD A;  2O89 A;  3LFL A;  2RII A;  2D2Z A;  3QCP A;  1E6B A;  5HR2 A;  2N5B A;  3BCK A;  3HVS A;  3E0U A;  3TOU A;  3FKF A;  2WUL A;  5J3R A;  1SK2 A;  2YNX A;  1OE7 A;  4K1F A;  3TUE A;  3EWL A;  3F8U A;  1QFN A;  3L4N A;  4FYC A;  4OO5 A;  1ZL9 A;  1YF1 A;  5DCH A;  1V2A A;  2I81 A;  1NM3 A;  3IHG A;  3KMN A;  3U6V A;  3U5R E;  2EIO A;  5IIZ A;  4TW5 A;  5D8I A;  1B4P A;  2FUG 2;  1PKZ A;  1PX7 A;  2WVY A;  5COH A;  1A2L A;  2WVZ A;  2PPT A;  1DE2 A;  1FHE A;  4AJ7 A;  3PGT A;  1OKT A;  4J56 E;  4KDX A;  1EOG A;  4O7H A;  4TXO B;  2PN8 A;  3H93 A;  2VKZ G;  1ERV A;  5A4W A;  4GST A;  4HQS A;  4NHW A;  1IYH A;  4XTS A;  2M72 A;  2X8C A;  1WMJ A;  3A2W A;  1X0R A;  1OYJ A;  2LQO A;  1XW9 A;  4ZL8 A;  4K2D A;  1MD4 A;  2IL3 A;  2CAQ A;  4IHU A;  5J4Y A;  1SD8 A;  1ACV A;  1M2B A;  1TK0 B;  5FWG A;  3VI7 A;  1GSY A;  1N2A A;  2DKI A;  2YPM A;  3RHC A;  3VPQ A;  4MDC A;  1FW1 A;  5ECQ B;  3EUR A;  2XPE A;  11GS A;  2EFH A;  1TK5 B;  5DQS A;  2AHE A;  2PVO C;  3RPP A;  3DWV A;  3F4T A;  4TR0 A;  2HSH A;  3OR5 A;  4WET A;  2DJ1 A;  3O3T A;  1A23 A;  2WB9 A;  2GSR A;  2R2J A;  1EV4 A;  2PWJ A;  4BL7 A;  1W4V A;  4NV5 A;  5DJM A;  4I2U A;  1K0A A;  2EFE A;  2K9F A;  4ML1 A;  1K0M A;  4MP4 A;  4HUA A;  2HZE B;  1OC3 A;  2PER A;  3AY8 A;  1XXU A;  3CRU A;  1BF5 A;  2HRK A;  2WZS A;  2JL4 A;  4MF7 A;  2J23 A;  2VCW A;  5GZZ B;  1JLW A;  3UOM A;  2FWF A;  1URM A;  4LL4 B;  1ERW A;  2KP2 A;  17GS A;  1PN0 A;  4NHZ A;  5AGY A;  2XHF A;  2MMA A;  3N5O A;  3O76 A;  4WF5 A;  5GAN D;  4PI2 C;  2P5Q A;  2AAW A;  1G6Y A;  2P5R A;  5IMV A;  2LRN A;  4BWS A;  4GQC A;  3LXZ A;  2C8U A;  1R26 A;  2H1D A;  1ST9 A;  4AJ8 A;  3ZML A;  1B48 A;  3P2A A;  2LS5 A;  3A2X A;  2K18 A;  3L9S A;  1QK8 A;  4ZB9 A;  1ZGN A;  2CAI A;  4IKH A;  2DJ2 A;  3VWX A;  5DAL B;  6GSW A;  3HYP A;  1NW2 A;  3FMW A;  5ID2 A;  1TP9 A;  2FLS A;  1HNB A;  4MPF A;  3M3M A;  3W8S A;  5AN1 A;  4GXZ A;  3WT1 A;  3E3E A;  2CT6 A;  4JBB A;  1UC7 A;  3CSI A;  4ICY A;  2BTO T;  2FD3 A;  2H01 A;  3QPM A;  4NPB A;  1LJR A;  1N8J A;  2YP6 A;  1BJX A;  1R5P A;  1Z9H A;  4OCF A;  4I2T A;  4IJ3 A;  3LQ7 A;  4N3Z A;  2VD1 A;  4FQU A;  2OJL A;  3DML A;  4MJA A;  4TN8 A;  1HYU A;  3IRA A;  3RBT A;  3QAG A;  3KTL A;  3UVH A;  3D6I A;  3HJO A;  2H74 A;  1YKA A;  4BWQ A;  2DJ0 A;  1K3O A;  1GSQ A;  4Z2U A;  3VWU A;  2G0F A;  1JLV A;  4V2M A;  3EU3 A;  3ERW A;  3APQ A;  5B8A A;  1ZYQ B;  3H79 A;  1M2D A;  3F4S A;  5DVB A;  3R3E A;  4Q5R A;  3ZFL A;  4I5Q A;  1O7U A;  3GFK A;  3EU4 A;  1YEX A;  3UVT A;  3KIJ A;  1SL1 B;  3QD9 A;  4I8B A;  3WGD A;  1VF4 A;  2A2R A;  3GST A;  5F07 A;  1PFO A;  3ZRE A;  3GTU B;  4EKZ A;  3IC4 A;  1XOB A;  5F06 A;  1T7P B;  1ZZY A;  3DVX A;  4ZIL A;  5G5F A;  2C3N A;  2YV7 A;  1MD3 A;  4ISD A;  1S3D A;  3FY7 A;  1PL2 A;  4MLY A;  1VRS D;  2R5G A;  3ERF A;  3UMA A;  4DSS A;  3ED3 A;  3GV1 A;  4TVE A;  1Q98 A;  1F2E A;  3GL5 A;  4AKI A;  2XBQ A;  5KOW A;  3KEB A;  4EIQ A;  1WOU A;  1T1V A;  1HD2 A;  2WW3 A;  2FGX A;  2EFD A;  3C8E A;  1XFL A;  4AKH A;  3GYK A;  2VL3 A;  1XBS A;  1TOF A;  5L71 A;  4MZW A;  4TRX A;  3CXG A;  5A5K A;  2I4A A;  2DJJ A;  2V1M A;  1Y6E A;  3KH9 A;  2QA2 A;  2LJA A;  4MCU A;  3TB2 A;  4RUV A;  5IOW A;  5KOX A;  2A2S A;  3RHB A;  2C0D A;  4PXO A;  3LYP A;  1EEJ A;  2IMD A;  3CTG A;  3HVX A;  2HZE A;  4ILF A;  2NPB A;  1OVN A;  2B5X A;  2H6Z A;  4FYB A;  5G5E A;  4PUR A;  1TXU A;  1YEP A;  1VGL A;  2XBI A;  1PRX A;  4OD7 A;  3GUS A;  3DD3 A;  2MMZ A;  2H75 A;  4HU7 A;  2UV8 G;  1Z3E A;  1ZYP A;  4WXT A;  3LOR A;  1Z7P A;  3TKP A;  2YWO A;  2K6V A;  2WVX A;  1OC9 B;  1T00 A;  3CSJ A;  3RPN A;  5CP1 A;  3GKN A;  2O5V A;  1ML6 A;  2YV9 A;  4F0C A;  4PNG A;  1YQ1 A;  1K3L A;  3F3R A;  2RM5 A;  3EIN A;  2HSM B;  2JAC A;  3EMP A;  1GP1 A;  4KB3 A;  2VCZ A;  1PGT A;  1G0T A;  18GS A;  3ZVJ A;  1GUH A;  4PQH A;  2FHE A;  1G6W A;  5H5R A;  3DVW A;  3HVN A;  1WP0 A;  3C1R A;  3HVV A;  5JWO B;  2TRC P;  5F0G A;  3CTF A;  3GX8 A;  1X5C A;  4CHS A;  4BA7 A;  3Q74 A;  1A2M A;  1EZK A;  4ZB8 A;  3FR9 A;  1CQH A;  1XWB A;  1GSF A;  2FWG A;  3IPZ A; 
#chains in the Genus database with same CATH homology
 1VF2 A;  1Z7R A;  3H8Q A;  1K0N A;  3KJY A;  2OKA A;  3MAK A;  1BG1 A;  5CRW A;  2MBS A;  4IQ1 A;  5A5H B;  2ON7 A;  3I69 A;  3APS A;  1WRY A;  5A1N A;  4TR1 B;  3CSH A;  4DSQ A;  14GS A;  1MDI A;  1TXX A;  3F6D A;  2GTU A;  4X0X A;  4Q5N A;  1XVQ A;  3LYK A;  1GLQ A;  2L5O A;  3ZIT A;  3ZTL A;  1PL1 A;  2DKH A;  1EV9 A;  2KLX A;  4WBJ A;  5ECS A;  1WIK A;  5IQY A;  4BPY A;  5HR3 A;  3DIE A;  5DBQ A;  3M8N A;  2V6O A;  5HQP A;  1TRW A;  4LLR A;  1TRU A;  4WEY A;  3L9V A;  1O81 A;  5ECN B;  3KH7 A;  1JZD A;  1Z5Y E;  4YAP A;  1O8X A;  1DBY A;  2V2G A;  2MMN A;  3WT2 A;  2GS3 A;  4ZBA A;  1T4Z A;  2HNL A;  6GSV A;  3LWA A;  3CYN A;  4L8E A;  4OFT A;  3Q19 A;  3VPT A;  3QAW A;  4ULX A;  5IMC A;  3LG6 A;  2F8F A;  1GLP A;  1XCC A;  2PBJ A;  5IPH A;  5H5S A;  4IW9 A;  1KEB A;  1GNE A;  2WGR A;  4HJM A;  2X99 A;  1XVW A;  2H70 A;  3APO A;  4N10 A;  1JFU A;  1QQ2 A;  2I3Y A;  3LW9 A;  4YQV A;  4NWY A;  3GKM A;  2VLU A;  5ECH B;  6GSS A;  5A34 A;  4E8H A;  1I9D A;  1GUK A;  4WBR D;  4XS1 A;  1A8L A;  4HQZ A;  4Q5Q A;  2L5L A;  3MWH A;  5ENU A;  2VUP A;  2YAN A;  4KW6 A;  1XPV A;  3F0I A;  2HRA A;  1DUG A;  2FNO A;  2DML A;  1FVJ A;  4HU9 A;  1HQO A;  3BJ5 A;  4KCA A;  4GCI A;  3TGZ A;  1Z6M A;  1X5D A;  4HOJ A;  3ERG A;  3WGX A;  3HDC A;  4V1A p;  3BOA A;  5DAK B;  2DSA A;  1BYE A;  1ON4 A;  2B5Y A;  2H1B A;  2KHP A;  2CVD A;  5JCW A;  2YWN A;  3ZL5 A;  2ON5 A;  5E4W A;  4MZC A;  4N30 A;  3VWW A;  4F03 A;  2H0H A;  2L59 A;  5FHI A;  1M7T A;  5H5Q A;  5IMZ A;  2PGT A;  1KNG A;  3FZA A;  4WR5 A;  5FT3 A;  1S3C A;  5LNK e;  4F0B A;  3CRT A;  2EFC A;  2UZ8 A;  4EUY A;  2GZZ A;  3VI5 A;  2VM1 A;  3QFA C;  4AI6 A;  3QMX A;  3FW2 A;  2H6X A;  2OT3 A;  4MJE A;  5INY A;  3MDK A;  1G7O A;  2LUS A;  3M9J A;  3FZ9 A;  3IK9 A;  1Q4J A;  4POB A;  2C0G A;  1YVL A;  5DDL A;  5F8B A;  2WJU A;  2M80 A;  4PQI A;  3V1W A;  3GL3 A;  5CRE A;  5ECL B;  3KD0 A;  5J40 A;  4ECI A;  3TJB A;  1AXD A;  5ELA A;  2K8S A;  2CX3 A;  4E68 A;  3LGC A;  4GLT A;  1GWC A;  3MYD A;  3UAR A;  3KMO A;  4IBP A;  5D93 A;  2GQL A;  1ERT A;  1TK8 B;  2ALB A;  1AUC A;  2BJX A;  3R2Q A;  4TR3 A;  4NXI A;  1PSQ A;  4IP1 A;  5ECM B;  4G19 A;  3VK9 A;  4TOP A;  1ILO A;  3NOF A;  4IGJ A;  1R5A A;  1GL8 A;  4IP6 A;  4ZL9 A;  4K0G A;  1AW9 A;  1GH2 A;  5IOX A;  3TDG A;  4EDZ A;  1B8X A;  4V2N A;  3BBY A;  1AC1 A;  1AQX A;  3SWL A;  2VL9 A;  4EDY A;  5BMU A;  3DKS A;  4EVM A;  5IPG A;  5EVO A;  4XS6 A;  1EOH A;  1ZOF A;  1UA5 A;  1KBN A;  4BVY A;  2JSY A;  5EY6 A;  2FA8 A;  2X8H A;  3WD6 A;  4K6X A;  2YWI A;  2GZY A;  5KN3 A;  4HEA 2;  4OMV A;  2OE0 A;  4PGT A;  2H30 A;  4WKW A;  5KN0 A;  4K7N A;  4L0U A;  3TKR A;  4D73 A;  3QDN A;  1QGV A;  16GS A;  4F9Z A;  3LJR A;  2NTO A;  4G0L A;  1XW6 A;  1USB A;  4KSM A;  2IIY A;  4O92 A;  2J9H A;  4PUA A;  3ZIV A;  5J47 A;  4ZBB A;  4XS4 B;  1F3B A;  4EF0 A;  5D96 A;  3G9B A;  1M9B A;  2HSN B;  3G7Y A;  2QSI A;  2LRC A;  1R4W A;  4X43 A;  2H19 A;  1SK1 A;  2DIZ A;  2LNS A;  3MNG A;  4POM A;  1M2A A;  4G10 A;  1IYI A;  3UEM A;  2OAD A;  1U87 A;  20GS A;  3F3Q A;  1RQM A;  2DBC A;  5J9B A;  1QXH A;  1SYX A;  1SL2 B;  4RI6 A;  4Q5F A;  3H4K A;  2AUV A;  3FR3 A;  4DVC A;  4FO5 A;  3KXO A;  3GN3 A;  1WE0 A;  2OAC A;  1H4O A;  3C73 A;  4ZB7 A;  4H86 A;  3MIX A;  1K0D A;  2H76 A;  4E8E A;  1A0F A;  1YZX A;  3GSS A;  2WDU A;  2V6K A;  1SVO A;  3D22 A;  1GTU A;  3ISO A;  2YJH A;  5IMD A;  4RI7 A;  4CY6 A;  5BRT A;  2WRT A;  4KDY A;  2F9S A;  4HZ4 A;  4GWR A;  1XIY A;  4TXO A;  2WCI A;  3F9U A;  4POK A;  4MJC A;  2GZP A;  2VCV A;  3TJK A;  1X9M B;  4XIH A;  2YCD A;  4QQ7 A;  3FEU A;  5G31 A;  1FOV A;  2AV4 A;  1RW1 A;  5IO2 A;  1XWC A;  1JHB A;  1GTI A;  1W89 A;  4JE1 A;  3NIV A;  1VF1 A;  4JR6 A;  3UAP A;  3L9U A;  1BG5 A;  2AB6 A;  4NMU A;  4I97 A;  1S3A A;  2CZ3 A;  3IBH A;  1T4Y A;  4MPG A;  2YJ7 A;  2QC7 A;  2L6C A;  3FYG A;  3QFB C;  4K5R A;  5F05 A;  2HRN A;  2IN3 A;  2LV3 A;  3MSZ A;  4L5O A;  5LD0 A;  2LRT A;  2ZCT A;  1NHY A;  2O87 A;  3E9J B;  3VFI A;  2FCH A;  5ABR A;  3FZ4 A;  3ZRD A;  4G0K A;  1JZR A;  4K7I A;  3I6A A;  5HR0 A;  4K0N A;  3HMJ G;  3HZ4 A;  5HR1 A;  3WGE A;  5B6M A;  1Z6N A;  3D0Z A;  2DJ3 A;  2HRF A;  1ZMA A;  3GH9 A;  1B4Q A;  1BAY A;  19GS A;  3I43 A;  4AJ6 A;  4Z2R A;  4PQ1 A;  2X8G A;  4WR4 A;  2VAF A;  2CZ2 A;  1A0R P;  2HLS A;  1SU9 A;  4ECJ A;  3GRX A;  3VUR A;  4MA9 A;  1XZO A;  4POL A;  2OBK A;  3DGQ A;  1WJK A;  1TRV A;  4PUF C;  5JWR B;  1C72 A;  1SEN A;  3ZZX A;  2WZ9 A;  3Q6O A;  2MBT A;  4QL7 A;  1U3I A;  4W66 A;  1A8Y A;  3Q18 A;  5KN1 A;  5J5N A;  4K8M A;  2H0I A;  3F6F A;  2H1G A;  1GTA A;  1YY7 A;  5AIS A;  2VLV A;  4V2L A;  4YAV A;  3GKX A;  4IEL A;  2B3S A;  4PNF A;  2HZF A;  4G01 A;  2P0G A;  4ZIJ A;  5ECR B;  4MNN A;  2H8L A;  2RUF A;  3EC3 A;  3N9J A;  2I1U A;  1B9X C;  5DAL A;  4O5Q A;  5CO3 A;  1ZCP A;  2C3Q A;  3A5I A;  3GNJ A;  1SK0 A;  4LA1 A;  3KM6 A;  2PU9 C;  3DYR A;  5JCU A;  1FAA A;  3W8J A;  2B5E A;  1VF3 A;  2C4J A;  2HXK A;  3ZYW A;  4YH2 A;  1FB0 A;  1A2J A;  1JZO A;  2HSN A;  1K0B A;  1YJ6 A;  4EXJ A;  4OFM A;  3TRP A;  3DEX A;  1ABA A;  1SJZ A;  4KDU A;  1HNC A;  3GIX A;  2G2Q A;  3P7X A;  4BL7 B;  3ZIJ A;  4FH8 A;  2VD0 A;  4OFN A;  2L6D A;  4P3Y B;  5IM9 A;  5AIX A;  1TU7 A;  2MMO A;  10GS A;  1YDK A;  5EL8 A;  5DJL A;  3TRQ A;  1CQG A;  2B1L A;  1AAZ A;  5HFG A;  2HRK B;  2RM6 A;  4GSS A;  2JSZ A;  4AKX B;  2C3T A;  2QGV A;  5J41 A;  5G1K A;  4X1U A;  1A24 A;  1TW9 A;  3FRC A;  4JR4 A;  2O85 A;  3TKS E;  2F3M A;  1JZW A;  2N5A A;  4G0I A;  9GSS A;  1PX6 A;  4K2X A;  3QR6 A;  2MZC A;  1OAZ A;  1X5E A;  3ZFB A;  1PKW A;  4TXV A;  2R3X A;  2R4V A;  3GHA A;  4KF9 A;  2LQQ A;  1FOH A;  1GNW A;  1SKR B;  1J0F A;  4AKG A;  3PR8 A;  5CAX A;  2C0E A;  4ML6 A;  3GKK A;  5D9W A;  2DMM A;  1V9W A;  3GUR A;  4YKF A;  4JED A;  3ME7 A;  1EGR A;  4EL1 A;  4MF6 A;  2DLX A;  4XHM A;  4G2E A;  3QOU A;  2GLR A;  4O5U A;  3GTU A;  4CY8 A;  1QUW A;  2H6Y A;  4ZB6 A;  5ID2 B;  4KA0 A;  1GRX A;  1V58 A;  1FVK A;  5GAP D;  2VM2 A;  3TOT A;  3TJF A;  5IO0 A;  1B9Y C;  2V32 A;  2ZNM A;  2L57 A;  4K5S A;  1KTE A;  3EE2 A;  2VCQ A;  1MTC A;  1R7H A;  2M46 A;  3HCZ A;  2YN1 A;  1SKS B;  2HE3 A;  3DXB A;  2H0G A;  5CRG A;  5CNW A;  3D4M A;  4IQA A;  3HZ8 A;  2NBS A;  2R0G A;  4NAX A;  4GDF A;  2CQ9 A;  2IFQ B;  2VO4 A;  2P31 A;  2GQK A;  2IME A;  1XWA A;  2HYX A;  6GSY A;  1WWJ A;  3C71 A;  4KND A;  4BVX B;  1SKW B;  1GUM A;  2IPA A;  4A5P A;  8GSS A;  1THO A;  2C0F A;  2QKE A;  1O85 A;  2HT9 A;  1DSB A;  1K3Y A;  3IE3 A;  3HJP A;  2F8A A;  1U88 A;  3GA4 A;  5GSS A;  4NV2 A;  4MF5 A;  2CV4 A;  4QL9 A;  1N25 A;  1SVM A;  5B8B A;  3L0H A;  3P90 A;  4EIP A;  2O8V B;  2LST A;  1X9W B;  1SYR A;  5J4V A;  1BX9 A;  1OC9 A;  1LBK A;  2N5F A;  1RK4 A;  3IXR A;  3HHV A;  4TR4 A;  1LU4 A;  3LSZ A;  1THX A;  2EC4 A;  4KCE A;  1OC8 A;  2REM A;  1SD9 A;  3D5J A;  2HSM A;  3TKQ A;  4DSS B;  5D9T A;  3TRX A;  1F9M A;  4QMK A;  3IAM 2;  3TKS C;  2LJK A;  4ZL7 A;  2LJR A;  3IHQ A;  2R0C A;  2ES7 A;  4XRA A;  2IMF A;  2GVP A;  3FHK A;  2Z9S A;  1YKC A;  4KAE A;  5A4V A;  4WF4 A;  4KGI A;  4YQM A;  1SVL A;  5CRH A;  2KOK A;  3M1G A;  4OO4 A;  4LMW A;  2XC2 A;  2MYG A;  2OA7 A;  2FY6 A;  2HQT A;  5JCG A;  1SJ6 A;  2H1A A;  1TKD B;  5ECP B;  4PTS A;  4N11 A;  5A5H A;  4JU5 A;  4TKY A;  5J4U A;  3FR6 A;  4GSN A;  3O6T A;  5IMA A;  1NHO A;  4TR1 A;  5ELG A;  1GUL A;  2CX4 A;  4MZB A;  3BD2 A;  3G7J A;  1BQ7 A;  1TTZ A;  4DSR A;  4EO3 A;  3TJJ A;  3ZVJ D;  1M99 A;  1UVZ A;  1F37 A;  5HFI A;  3CWG A;  4HI7 A;  1SL0 B;  2VCX A;  2JAD A;  2RLI A;  1O6J A;  3HXS A;  3TKS A;  1U3A A;  4JZQ A;  6GSU A;  3A5W A;  1MDJ A;  1AIU A;  2R0P A;  4L5L A;  4ID0 A;  1PMT A;  2LNT A;  3P8W A;  1X9S B;  3QAV A;  1EGO A;  3LXT A;  1MEK A;  3UIW A;  1AQV A;  2PVQ A;  1EEM A;  3W6G A;  3H1N A;  1PA3 A;  4HJ2 A;  2YZU A;  4EC0 A;  4Z7X A;  4GF0 A;  2JZR A;  4L0W A;  2PMT A;  1PN9 A;  4FYU A;  2LEG A;  5DCG A;  1YF0 A;  2GQM A;  3RDW A;  1G7E A;  3WYW A;  4F82 A;  4I6X A;  2X49 A;  5A4U A;  3C1S A;  2L4C A;  2GDR A;  3M0F A;  1J9B A;  4K9Z A;  2B6M A;  3A3T A;  4ZBD A;  3TJG A;  4RQX A;  2B7J A;  4IN0 A;  2GT6 A;  1OE8 A;  1J08 A;  2CVB A;  2VCT A;  3IK7 A;  7GSS A;  3IR4 A;  4HZ2 A;  5C04 A;  2GSQ A;  5A1N B;  1XW5 A;  2GSS A;  4CDO A;  1T3B A;  3KP9 A;  2IFQ A;  1EP8 A;  3KP8 A;  3ZLP A;  3NZN A;  2NVL A;  2ZUP A;  2V41 A;  4MK3 A;  2IJY A;  2R6K A;  3GH6 A;  5G1L A;  2GGT A;  5DAK A;  4FIW A;  4BVX A;  4LL1 B;  2JU5 A;  4CW9 A;  2H73 A;  6GST A;  5ECI B;  5ECO B;  4MH2 A;  1V40 A;  3D21 A;  2AJQ B;  5KEJ A;  4KSO A;  1GSD A;  2VL2 C;  3EYT A;  5EPF A;  1ZYE A;  2X4A A;  2FA4 A;  4IVF A;  2K8V A;  3GMF A;  4KH7 A;  3UBL A;  1TDI A;  2QA1 A;  1V98 A;  3PIN A;  4KUN A;  3ME8 A;  2O7K A;  5B6N A;  5D73 A;  1BED A;  2B7K A;  2H66 A;  3BCI A;  22GS A;  3DRN A;  3HKR A;  3TU3 B;  5D9V A;  4K7O A;  1FB6 A;  2IMK A;  2LTK A;  1XOA A;  4ECC A;  4HS1 A;  3EVI A;  1HNA A;  4AF2 A;  1SJI A;  4O5R A;  3IAS 2;  2B1K A;  2DJK A;  2FWH A;  1Y1U A;  4KE3 A;  2WFC A;  2HFD A;  2CVK A;  2FWE A;  5C00 A;  3C7M A;  2X64 A;  1H75 A;  1I5G A;  2A4H A;  3K8N A;  4GRF A;  4KX4 A;  2JZS A;  2LKU A;  3UJ1 A;  5A34 B;  4IJI A;  3L78 A;  1PQN A;  3GX0 A;  3TCO A;  1V57 A;  1K0C A;  5IMF A;  3M9K A;  4ECB A;  3PPU A;  5JWQ B;  4GQF A;  1EP7 A;  3D4T A;  3F63 A;  1GSS A;  1NSW A;  1XWG A;  2VL2 A;  3ZMK A;  3PH9 A;  5GST A;  2DIY A;  4EE0 A;  1ZYN A;  4YQU A;  3VWV A;  2AYT A;  2DC5 A;  1TJD A;  3IOS A;  4F2I A;  1O73 A;  4USS A;  4RQR A;  1ERU A;  2F51 A;  5G30 A;  3US3 A;  3I9V 2;  2XPD A;  3HA9 A;  2WS2 A;  2BMX A;  3FK8 A;  4AGS A;  2YWM A;  1O8W A;  3EPT A;  1TU8 A;  2R37 A;  3J7Y k;  3IV4 A;  2A4V A;  4J57 E;  4Z2T A;  1Y25 A;  3UL3 A;  3KTB A;  1MDK A;  3JCM L;  2HSY A;  1TI3 A;  1K0O A;  2C1Y A;  5DQY A;  2GT5 A;  3UBK A;  2TIR A;  3HD5 A;  2OE3 A;  2EIR A;  4V1A g;  4YKG A;  1EWX A;  4JRR A;  3LEF A;  3A2V A;  5B7C A;  4XCS A;  2PUK C;  1T8E B;  13GS A;  4XS4 A;  1GSU A;  3HJM A;  3IA1 A;  3KGK A;  5AIV A;  2E7P A;  3SBC A;  1AQW A;  2YOI A;  3KZQ A;  1M0U A;  2NDO A;  4DEJ A;  4GTU A;  1E2Y A;  4MAB A;  1PD2 1;  5E59 A;  5CRD A;  2H71 A;  3CMI A;  4X4J A;  1XWK A;  2H1L A;  4N0V A;  3F4R A;  1GSE A;  1GTB A;  2OE1 A;  5D9X A;  5KN2 A;  2IMI A;  3J7Y b;  3EMX A;  3RAZ A;  2YZH A;  1WPI A;  2GST A;  1FO5 A;  1TRS A;  1F6M C;  1M9A A;  3IC8 A;  1U6T A;  2IWT A;  2E2G A;  5BMU B;  2H72 A;  4MMM A;  1QMV A;  12GS A;  2L4Q A;  1OKD A;  4ACS A;  4MJB A;  3KCM A;  5ECK B;  2KUC A;  3CBU A;  4BVY B;  2OBI A;  1F3A A;  1FG4 A;  2EIQ A;  5LCZ A;  1TI1 A;  3FZ5 A;  4J2F A;  4O32 A;  2E2M A;  4G9H A;  5HFK A;  1DE1 A;  2E0Q A;  2KP1 A;  4PX1 A;  2VLT A;  2CA8 A;  3VLN A;  2VIM A;  3IDV A;  4N0Z A;  2C80 A;  2JZT A;  5CYY A;  4OCE A;  4D73 B;  2I9H A;  2TRX A;  3G7I A;  4ZXG A;  4OWY A;  2HI7 A;  4IS0 A;  5G2Z A;  5J9C A;  2RUE A;  2VOC A;  3S9F A;  3HY2 A;  1UN2 A;  4HDE A;  4LMV A;  6GSX A;  4MH3 A;  2A2P A;  4XRD A;  2O89 A;  3LFL A;  2RII A;  2D2Z A;  3QCP A;  1E6B A;  5HR2 A;  2N5B A;  3BCK A;  3HVS A;  3E0U A;  3TOU A;  3FKF A;  2WUL A;  5J3R A;  1SK2 A;  2YNX A;  1OE7 A;  4K1F A;  3TUE A;  3EWL A;  3F8U A;  1QFN A;  3L4N A;  4FYC A;  4OO5 A;  1ZL9 A;  1YF1 A;  5DCH A;  1V2A A;  2I81 A;  1NM3 A;  3IHG A;  3KMN A;  3U6V A;  3U5R E;  2EIO A;  5IIZ A;  4TW5 A;  5D8I A;  1B4P A;  1PKZ A;  1PX7 A;  2FUG 2;  5COH A;  1A2L A;  2PPT A;  1DE2 A;  1FHE A;  4AJ7 A;  3PGT A;  1OKT A;  4J56 E;  4KDX A;  1EOG A;  4O7H A;  4TXO B;  2PN8 A;  3H93 A;  2VKZ G;  1ERV A;  5A4W A;  4GST A;  4HQS A;  4NHW A;  1IYH A;  4XTS A;  2M72 A;  2X8C A;  1WMJ A;  3A2W A;  1X0R A;  1OYJ A;  2LQO A;  1XW9 A;  4ZL8 A;  4K2D A;  1MD4 A;  2IL3 A;  2CAQ A;  4IHU A;  5J4Y A;  1SD8 A;  1ACV A;  1M2B A;  1TK0 B;  5FWG A;  3VI7 A;  1GSY A;  1N2A A;  2DKI A;  2YPM A;  3RHC A;  3VPQ A;  4MDC A;  1FW1 A;  5ECQ B;  3EUR A;  2XPE A;  11GS A;  2EFH A;  1TK5 B;  5DQS A;  2AHE A;  2PVO C;  3RPP A;  3DWV A;  3F4T A;  4TR0 A;  2HSH A;  3OR5 A;  4WET A;  2DJ1 A;  3O3T A;  1A23 A;  2WB9 A;  2GSR A;  2R2J A;  1EV4 A;  2PWJ A;  4BL7 A;  1W4V A;  4NV5 A;  5DJM A;  4I2U A;  1K0A A;  2EFE A;  2K9F A;  4ML1 A;  1K0M A;  4MP4 A;  4HUA A;  2HZE B;  1OC3 A;  2PER A;  3AY8 A;  1XXU A;  3CRU A;  1BF5 A;  2HRK A;  2JL4 A;  4MF7 A;  2J23 A;  2VCW A;  5GZZ B;  1JLW A;  3UOM A;  2FWF A;  1URM A;  4LL4 B;  1ERW A;  2KP2 A;  17GS A;  1PN0 A;  4NHZ A;  5AGY A;  2XHF A;  2MMA A;  3N5O A;  3O76 A;  4WF5 A;  5GAN D;  2P5Q A;  2AAW A;  1G6Y A;  2P5R A;  5IMV A;  2LRN A;  4BWS A;  4GQC A;  3LXZ A;  2C8U A;  1R26 A;  2H1D A;  1ST9 A;  4AJ8 A;  3ZML A;  1B48 A;  3P2A A;  2LS5 A;  3A2X A;  2K18 A;  3L9S A;  1QK8 A;  4ZB9 A;  1ZGN A;  2CAI A;  4IKH A;  2DJ2 A;  3VWX A;  5DAL B;  6GSW A;  3HYP A;  1NW2 A;  3FMW A;  5ID2 A;  1TP9 A;  2FLS A;  1HNB A;  4MPF A;  3M3M A;  3W8S A;  5AN1 A;  4GXZ A;  3WT1 A;  3E3E A;  2CT6 A;  4JBB A;  1UC7 A;  3CSI A;  4ICY A;  2BTO T;  2FD3 A;  2H01 A;  3QPM A;  4NPB A;  1LJR A;  1N8J A;  2YP6 A;  1BJX A;  1R5P A;  1Z9H A;  4OCF A;  4I2T A;  4IJ3 A;  3LQ7 A;  4N3Z A;  2VD1 A;  4FQU A;  2OJL A;  3DML A;  4MJA A;  4TN8 A;  1HYU A;  3IRA A;  3RBT A;  3QAG A;  3KTL A;  3UVH A;  3D6I A;  3HJO A;  2H74 A;  1YKA A;  4BWQ A;  2DJ0 A;  1K3O A;  1GSQ A;  4Z2U A;  3VWU A;  2G0F A;  1JLV A;  4V2M A;  3EU3 A;  3ERW A;  3APQ A;  5B8A A;  1ZYQ B;  3H79 A;  1M2D A;  3F4S A;  5DVB A;  3R3E A;  4Q5R A;  3ZFL A;  4I5Q A;  1O7U A;  3GFK A;  3EU4 A;  1YEX A;  3UVT A;  3KIJ A;  1SL1 B;  3QD9 A;  4I8B A;  3WGD A;  1VF4 A;  2A2R A;  3GST A;  5F07 A;  3ZRE A;  3GTU B;  4EKZ A;  3IC4 A;  1XOB A;  5F06 A;  1T7P B;  1ZZY A;  3DVX A;  4ZIL A;  5G5F A;  2C3N A;  2YV7 A;  1MD3 A;  4ISD A;  1S3D A;  3FY7 A;  1PL2 A;  4MLY A;  1VRS D;  2R5G A;  3ERF A;  3UMA A;  4DSS A;  3ED3 A;  3GV1 A;  4TVE A;  1Q98 A;  1F2E A;  3GL5 A;  4AKI A;  2XBQ A;  5KOW A;  3KEB A;  4EIQ A;  1WOU A;  1T1V A;  1HD2 A;  2FGX A;  2EFD A;  3C8E A;  1XFL A;  4AKH A;  3GYK A;  2VL3 A;  1XBS A;  1TOF A;  5L71 A;  4MZW A;  4TRX A;  3CXG A;  5A5K A;  2I4A A;  2DJJ A;  2V1M A;  1Y6E A;  3KH9 A;  2QA2 A;  2LJA A;  4MCU A;  3TB2 A;  4RUV A;  5IOW A;  5KOX A;  2A2S A;  3RHB A;  2C0D A;  4PXO A;  3LYP A;  1EEJ A;  2IMD A;  3CTG A;  3HVX A;  2HZE A;  4ILF A;  2NPB A;  1OVN A;  2B5X A;  2H6Z A;  4FYB A;  5G5E A;  4PUR A;  1TXU A;  1YEP A;  1VGL A;  2XBI A;  1PRX A;  4OD7 A;  3GUS A;  3DD3 A;  2MMZ A;  2H75 A;  4HU7 A;  2UV8 G;  1Z3E A;  1ZYP A;  4WXT A;  3LOR A;  1Z7P A;  3TKP A;  2YWO A;  2K6V A;  1OC9 B;  1T00 A;  3CSJ A;  3RPN A;  5CP1 A;  3GKN A;  2O5V A;  1ML6 A;  2YV9 A;  4F0C A;  4PNG A;  1YQ1 A;  1K3L A;  3F3R A;  2RM5 A;  3EIN A;  2HSM B;  2JAC A;  3EMP A;  1GP1 A;  4KB3 A;  2VCZ A;  1PGT A;  1G0T A;  18GS A;  3ZVJ A;  1GUH A;  4PQH A;  2FHE A;  1G6W A;  5H5R A;  3DVW A;  1WP0 A;  3C1R A;  3HVV A;  5JWO B;  2TRC P;  5F0G A;  3CTF A;  3GX8 A;  1X5C A;  4CHS A;  4BA7 A;  3Q74 A;  1A2M A;  1EZK A;  4ZB8 A;  3FR9 A;  1CQH A;  1XWB A;  1GSF A;  2FWG A;  3IPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...