5FHIA

Crystallographic structure of psoe without co
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
b'MVFGTLYTFPGDQCRTIAIKAVAKANGLDLDIRETPRTPDHLSISKLGKVPAFQGADSFKLFECMAIALYITSQNEQTTLLGKDKKEYAEIIKWMSFFNTEIVILMTQQLLPQLGVIPYDRDQVEFFANMTQRSVDVVEEYLQDRTFLVGDQLSLADLFCAGNISLGFQFFYGKAWRQQNPNVSRWYEMVCHQPIYAAVTDKFQLLDEPKLTNNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, putative
publication title Oxidative trans to cis Isomerization of Olefins in Polyketide Biosynthesis.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Transferase
total genus 71
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5fhiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5fhiA01
3ED3A 3U6VA 4XCSA 3LQ7A 1GL8A 4JZQA 4QQ7A 3PPUA 2DJ0A 3LJRA 3VPQA 1WJKA 4PUAA 2ES7A 1GTUA 2CZ3A 2YJHA 2VLVA 3GIXA 1UA5A 3EU4A 22GSA 5ECKB 1QQ2A 2K6VA 1ZYQB 5IMDA 5L71A 2GSRA 1FW1A 2C4JA 1V58A 1QGVA 2K8VA 1RK4A 4CDOA 1THOA 4EF0A 2HRNA 2WDUA 2E0QA 1B4PA 4IJIA 1SYXA 4ZXGA 3DWVA 2LKUA 5FHIA 3TJGA 3LGCA 5CP1A 1TTZA 2CAIA 2PN8A 1WWJA 3GSSA 5DJMA 2ZNMA 5JCGA 2NBSA 1A8YA 1G6WA 2GSSA 2C3QA 3ZITA 2AB6A 4JBBA 2YWIA 5CO3A 1EP8A 4KB3A 1YDKA 4OMVA 3H4KA 3PH9A 1PRXA 4MABA 2NDOA 3F3QA 2DJKA 1SL2B 2RIIA 2OADA 5DDLA 5ECSA 3EMXA 1ON4A 5B7CA 3FR9A 2YN1A 3GURA 2VM2A 3SWLA 3M9JA 2HXKA 5AISA 3KEBA 4BL7A 3VWUA 2OA7A 3TRQA 3U5RE 2VAFA 4RQXA 1T4ZA 2AUVA 2YZHA 2GSQA 2H71A 1F3AA 4NPBA 5ECPB 4TXOA 5J5NA 4EDYA 2GQMA 3IAS2 4BA7A 3QMXA 3QD9A 1TI1A 4IP6A 3GRXA 5HR2A 2C0GA 2HZFA 1CQGA 4OCEA 5KN3A 2FLSA 2C0DA 1ZL9A 5DALA 1R5AA 5AIVA 3ERFA 1M9BA 2P5QA 2C0EA 2D2ZA 4KX4A 4WBRD 3LWAA 1A2JA 3D0ZA 1A8LA 1EEJA 3IRAA 2ALBA 1PQNA 3HD5A 1DBYA 4IN0A 1A0FA 6GSYA 2GGTA 2REMA 1Z5YE 3ZFLA 1FG4A 4NWYA 2VCVA 3Q18A 1SKRB 1TDIA 2F8FA 2GTUA 3UVHA 2LRTA 2DC5A 3GX0A 1PMTA 3FRCA 5A4UA 4MZWA 2AYTA 3TKSC 1MTCA 2FNOA 3QCPA 3ME7A 1G0TA 3OR5A 1T1VA 4ZL9A 2RM5A 1AIUA 5B8BA 3P7XA 2HYXA 3EINA 4I97A 3M9KA 4YH2A 2CX4A 3DGQA 2RUEA 4D73B 1X5DA 3HVVA 4OO5A 2FWFA 2B6MA 1EV4A 1ZMAA 3GL3A 1YEPA 3ZREA 4EKZA 5GAPD 6GSUA 2VLUA 3IE3A 3FR6A 1SJIA 3ERWA 4AF2A 1GUHA 2K9FA 3GKKA 4K0GA 3BD2A 3TJKA 1OYJA 2N5BA 3VLNA 4MCUA 2CQ9A 5JWQB 3M0FA 2GLRA 4L0WA 4OWYA 4CHSA 4FQUA 3TKSA 3FR3A 3O76A 3F4TA 3IBHA 3FHKA 2R6KA 3HHVA 5H5QA 4BVYB 3HZ8A 3K8NA 5LD0A 2H6XA 4PURA 3KD0A 2YCDA 3E0UA 3TB2A 4V2NA 2R5GA 4RUVA 3KTLA 2PPTA 4XRAA 3EMPA 1OE8A 4YQUA 1F3BA 4JE1A 1K0AA 4XS4B 1XZOA 3HVSA 1YEXA 2IMEA 3F6FA 5DAKB 3IV4A 5IO0A 1SL0B 1WIKA 1THXA 4POKA 4O92A 3HXSA 1SD8A 4G9HA 4NMUA 3NOFA 1SENA 1K3OA 4IGJA 2A2SA 3NZNA 1EOGA 1DSBA 4OFTA 2HSNB 4FO5A 3DD3A 4IBPA 1FO5A 4L5LA 1O8WA 4DSQA 3QAVA 2C3TA 5G5EA 3GMFA 4TXVA 1V2AA 2N5AA 5IIZA 1FOVA 1YF1A 3CXGA 1XWGA 4MJCA 1OC9A 4XHMA 1GRXA 2K8SA 3ISOA 3QFBC 4Q5NA 2HSYA 1OC8A 3LORA 4IELA 1B48A 4IKHA 2XBIA 3FZAA 2V6KA 2YZUA 2L5OA 3R2QA 5ECLB 5CRDA 4ZILA 2MMOA 4POLA 2IMFA 4BVXA 2H70A 4ID0A 1N8JA 1Y25A 1EOHA 5ELAA 3UL3A 1PGTA 2FA8A 3F6DA 6GSTA 1XBSA 2YJ7A 4P3YB 3ZVJD 1Z6MA 2JZSA 3TKQA 3CMIA 4WETA 3BBYA 3L0HA 5EVOA 2IN3A 3APOA 1QK8A 5ENUA 5D9TA 3KTBA 4AJ7A 2GDRA 4I8BA 3JCML 4HEA2 2X64A 3LYKA 4LMWA 1EEMA 5KEJA 3P2AA 4ZB8A 4HDEA 4MP4A 1EGRA 4BL7B 4GQFA 3MSZA 2PGTA 5G1LA 1KTEA 2R3XA 4JR4A 3FKFA 4NHZA 4TXOB 5IM9A 4YAVA 2L57A 4LL4B 3DMLA 4IS0A 5EPFA 2I4AA 4L0UA 2HSHA 4V2MA 1ML6A 2JSYA 1SL1B 2LSTA 2WB9A 3E3EA 2YWMA 3FZ5A 3Q74A 4WR4A 2MZCA 1K3YA 1K0OA 2WZ9A 2P0GA 2IPAA 2OBKA 1N2AA 2X8GA 2LTKA 1TK8B 2CX3A 1S3AA 2GZPA 2YV7A 5DALB 5DJLA 4PNFA 3KMOA 1R26A 5D9WA 4F2IA 4ZBAA 3FYGA 4ZB6A 1U6TA 2Z9SA 2YWOA 3GH9A 1GUKA 4QL9A 2H30A 2OJLA 4HQSA 5J4UA 3IDVA 5ECNB 2HRAA 4FYUA 3F0IA 2IWTA 1FVJA 4XTSA 6GSSA 5EY6A 3UBLA 1XVQA 3D22A 2MMNA 1AUCA 4EUYA 5KN0A 5CAXA 4NAXA 2PERA 4I2UA 4TR4A 4F9ZA 2OBIA 5CYYA 3QAWA 3GYKA 3TRXA 1YKCA 2I3YA 4IQAA 1M99A 2GZZA 4YQMA 2FY6A 3CTFA 5D93A 3CSHA 4G2EA 4HU7A 1I9DA 1B4QA 1RW1A 4ILFA 1RQMA 3UARA 2PVOC 4KSOA 3HJMA 3VWXA 1XW9A 4KDYA 3UBKA 2DLXA 3TRPA 1Z6NA 2LEGA 4JEDA 4X1UA 3F8UA 1UC7A 5CREA 5IPGA 1XCCA 2R37A 1XWKA 1SJZA 2DJ2A 3CBUA 1ILOA 3RDWA 5ID2A 3TKPA 3D21A 5G2ZA 2BTOT 1JFUA 2VL9A 1ERWA 4DEJA 5LCZA 3ZVJA 1NW2A 2H1AA 4I2TA 1GP1A 4IJ3A 2B7KA 4IW9A 4KA0A 1BG5A 3C7MA 3GNJA 2J9HA 2FWHA 1BJXA 3CYNA 3LSZA 1XWBA 1DE2A 4K8MA 1PN9A 3LXZA 3GN3A 2WS2A 2CT6A 3KM6A 3IK9A 1ZGNA 4BWQA 3RAZA 4FH8A 2FWGA 2H76A 3GV1A 1URMA 2DSAA 1Y6EA 3LYPA 2TRCP 4O7HA 1BYEA 2YNXA 3TKRA 4GWRA 3TJJA 2KUCA 4E8HA 1TI3A 5DVBA 3S9FA 1SKSB 1WOUA 2V2GA 2NPBA 1GSFA 4TRXA 6GSXA 3N9JA 1QUWA 5F8BA 1JZDA 3ZMLA 2CVBA 2LJAA 4PQ1A 5D73A 4L5OA 3L9UA 3J7Yk 4OFMA 2H1GA 3DKSA 5G5FA 1XOBA 3M8NA 19GSA 3ZRDA 4LA1A 1F6MC 3KH7A 2L59A 2ZCTA 3QPMA 2O7KA 5HQPA 4BVXB 2BMXA 2LQOA 4K6XA 3A5WA 1SK1A 3FZ9A 3J7Yb 2YPMA 2M72A 4KNDA 2C8UA 3CTGA 5A4VA 3APQA 2B3SA 1M2AA 2H66A 4TR1A 3PR8A 4WF5A 2MBTA 1S3DA 3ZIJA 1FVKA 5A5KA 4MA9A 3NIVA 3F63A 5F0GA 5CNWA 3UVTA 5HR1A 2AV4A 4N11A 5B6MA 3C1SA 1B9XC 2E2GA 2GSTA 1G6YA 1K0DA 4K7NA 2WGRA 9GSSA 4MJAA 1X5CA 1XW5A 13GSA 5DCHA 3MDKA 1PKWA 3CSIA 2L6DA 4ISDA 1LBKA 4I5QA 4RI7A 3IPZA 1M2BA 4MPFA 3IC8A 3FK8A 3M1GA 14GSA 4PQIA 3CRUA 4MDCA 4K2DA 1E6BA 3IAM2 2XHFA 16GSA 4WBJA 1SD9A 1X0RA 3ZL5A 3KMNA 4TN8A 5GAND 3N5OA 4EL1A 4XS1A 4G10A 1Z9HA 3V1WA 4F82A 3EYTA 1AXDA 3MWHA 5BMUA 2QGVA 4PNGA 5ECOB 2GQLA 3GKNA 4ECJA 2OE0A 4E8EA 3TGZA 4PGTA 4KAEA 2B5EA 1TRSA 1O8XA 3TCOA 3GTUB 5HFGA 4MMMA 1U3AA 3TUEA 5ECHB 2IFQA 4HS1A 1WP0A 1GSYA 3US3A 1V40A 18GSA 5HFIA 3HDCA 4MJEA 4XS6A 1KEBA 2GQKA 3IC4A 2MMAA 3GUSA 3VI5A 3D6IA 2HSMB 2ON5A 3G7IA 1GSDA 6GSVA 7GSSA 1A2LA 3RBTA 1QMVA 5IMAA 3IR4A 5J3RA 1EZKA 2FWEA 4I6XA 5CRHA 1ACVA 2L6CA 2TIRA 1ST9A 4N10A 4K7IA 1XWAA 3O6TA 2KP2A 3KXOA 2PUKC 5D8IA 1M7TA 3VK9A 1O85A 5E59A 2PVQA 1I5GA 1T00A 3TDGA 2B1LA 4POBA 3W8JA 2H8LA 4F03A 4N0ZA 4ECCA 1NM3A 3ZLPA 1FAAA 4GSTA 5ID2B 20GSA 2JL4A 1C72A 1ERVA 4ML1A 4ACSA 1IYIA 3VPTA 1O6JA 4PX1A 4DSSA 1VRSD 4AGSA 3WT1A 2DBCA 1VGLA 4OO4A 1QFNA 1TKDB 1WMJA 1ZZYA 3G7JA 4TR3A 4ECBA 3EVIA 3APSA 1GH2A 3FEUA 2IL3A 3QOUA 2VIMA 3QR6A 3KIJA 5IO2A 5H5SA 4DSRA 4MJBA 2YV9A 2A4VA 1GSUA 4JRRA 2L4QA 2A2RA 3MNGA 1TJDA 5GSSA 2VOCA 1F9MA 3LG6A 4HU9A 4JU5A 1XW6A 5IPHA 2VL2C 2HZEA 3D5JA 3DXBA 5IOWA 3HVXA 1AQWA 4J56E 3DVWA 1MD4A 1BQ7A 2PWJA 4WEYA 1H4OA 1HNAA 2R4VA 3GL5A 3Q19A 2O8VB 1M0UA 2H1BA 2EIRA 5FWGA 2EIOA 3RPNA 5ECMB 2RM6A 3DRNA 2VCWA 3GH6A 1K0MA 4EO3A 2H72A 2I1UA 2LRNA 4KCEA 1H75A 1O7UA 2X99A 3VFIA 1Z7RA 3IHQA 1AAZA 4KGIA 5D96A 2H19A 2V41A 1GTAA 1EP7A 4XIHA 3HYPA 5J9BA 2LV3A 1GTBA 4YQVA 5A4WA 1XPVA 5ECQB 3C1RA 1JLWA 3GX8A 2VL2A 2VL3A 3DYRA 3HCZA 2VUPA 2PMTA 5LNKe 2HRKA 2E2MA 4MF5A 3HZ4A 1VF4A 3KGKA 1MEKA 3GHAA 1HYUA 3L78A 4GRFA 2GVPA 2DJJA 2X8HA 4GXZA 1K0CA 2V1MA 4KDXA 1EWXA 4TR1B 3SBCA 4G0LA 3EE2A 2C80A 4X43A 1X9SB 4GCIA 5B6NA 3D4MA 2MYGA 3G9BA 3L4NA 1V98A 1X9WB 5HFKA 4YAPA 2EIQA 3ME8A 4AJ6A 1OC3A 4V2LA 1TP9A 4WXTA 3A3TA 3D4TA 4NV2A 4KE3A 2GT6A 4ULXA 2HLSA 2CA8A 3WYWA 1YY7A 17GSA 1PA3A 2XPEA 1V57A 2V32A 4MF6A 3BCKA 5EL8A 5D9VA 1YZXA 2G2QA 2DJ1A 3G7YA 2ZUPA 2CVDA 2TRXA 2O85A 1MDKA 4MH3A 4KUNA 1GTIA 4G19A 2OE1A 1T3BA 5E4WA 4MK3A 3QDNA 3C73A 2JU5A 2F9SA 2IJYA 4TKYA 4PQHA 3ERGA 3GA4A 3UMAA 2FA4A 2LNTA 3WGXA 5F05A 3O3TA 2VCZA 2LJKA 3EC3A 4G0IA 1PSQA 5DBQA 2VO4A 1BEDA 5F06A 4NV5A 2VCXA 4Q5QA 2VLTA 4FYCA 4XS4A 2IFQB 4F0BA 5INYA 5DAKA 4HJ2A 2AJQB 3TKSE 4EE0A 4LL1B 1QXHA 3HY2A 3ZTLA 2JADA 2WFCA 4HJMA 3VWVA 2DIYA 3C8EA 2VM1A 3GSTA 1LU4A 4Z7XA 2O89A 3PGTA 5GSTA 1ABAA 2AAWA 1TU8A 2PBJA 4WR5A 1GSEA 1PKZA 2M46A 3UEMA 2HQTA 1U87A 4J2FA 1MD3A 1HQOA 12GSA 1S3CA 1IYHA 1PL1A 4HZ2A 2XC2A 5IQYA 3DIEA 3P8WA 2FGXA 5KN1A 1A0RP 3FZ4A 1HNCA 5G31A 2F3MA 1JZOA 2DIZA 3UJ1A 2OKAA 2OE3A 2P5RA 2K18A 2P31A 2CV4A 1OKDA 4MPGA 2H0HA 1K0BA 1B8XA 2KP1A 1W4VA 3W8SA 1MDIA 3BOAA 2JZTA 2CVKA 4DSSB 4TW5A 1GUMA 4MZCA 1R7HA 3GKXA 4K0NA 3ZFBA 2HNLA 1F37A 5COHA 3WD6A 5B8AA 1SK2A 1OC9B 1GSSA 1XVWA 2H73A 3WGDA 3A2VA 5AN1A 1OVNA 3H79A 1VF2A 1ZYEA 1CQHA 1DE1A 2XBQA 4K9ZA 2WCIA 3IOSA 4K7OA 2HZEB 4IHUA 1OKTA 3MAKA 3HKRA 2RUFA 1TOFA 2KOKA 3RHBA 4KSMA 4O32A 1W89A 2XPDA 5JWOB 4WF4A 4TR0A 2LJRA 3C71A 2GZYA 2IIYA 2R2JA 4OD7A 2I9HA 2J23A 1FB6A 2FHEA 1M9AA 3KP8A 2E7PA 4ECIA 2C1YA 1XXUA 1YKAA 4ZB9A 1R5PA 1AQVA 1GSQA 1TRVA 1Z3EA 2B1KA 5J41A 2IMDA 1DUGA 1TU7A 3TOTA 1YJ6A 2JACA 4Q5FA 5ABRA 4Q5RA 1K0NA 4FYBA 2DMMA 1XFLA 1TK0B 2H01A 1SYRA 4K1FA 4NXIA 1GLQA 1KNGA 1X5EA 3R3EA 3PINA 1ERUA 4HUAA 2QC7A 3W6GA 1NSWA 4EC0A 5GZZB 2HRKB 3ZYWA 4BPYA 1U88A 2YP6A 3TJFA 3VWWA 3I69A 4KDUA 2ON7A 2DJ3A 3LEFA 2X8CA 1GLPA 4X0XA 2KLXA 3KP9A 4LLRA 1Q98A 5J9CA 1ZOFA 3DVXA 5JWRB 2CAQA 2EC4A 2H74A 2F51A 1TXXA 3QAGA 2QSIA 2GT5A 3GKMA 4GLTA 1AC1A 3L9VA 1SK0A 10GSA 5KN2A 3F3RA 1B9YC 1PD21 1NHOA 4KCAA 2H6YA 2UZ8A 1SJ6A 3F9UA 4DVCA 4FIWA 3RPPA 1X9MB 3M3MA 4GSNA 2GS3A 1KBNA 2LRCA 4EDZA 1UN2A 3EWLA 1O73A 5JCUA 4HZ4A 3GFKA 3HJPA 1MDJA 5AIXA 1ZCPA 4RQRA 2B5XA 1G7EA 2HI7A 2FUG2 2HE3A 2C0FA 4F0CA 4LMVA 3H1NA 1G7OA 4OFNA 1E2YA 2JSZA 1BX9A 4V1Ap 3A2WA 5ECRB 5FT3A 2FCHA 1SU9A 3BJ5A 2WRTA 5IMZA 4HOJA 4HQZA 4POMA 3ZIVA 3WT2A 5IOXA 1GNEA 2O87A 4ML6A 4EXJA 1PX7A 3FW2A 1JLVA 1OAZA 2YOIA 1J9BA 2VCQA 4IP1A 3ZZXA 2L5LA 5D9XA 1UVZA 3IXRA 3DEXA 4EVMA 2PU9C 4PTSA 4TVEA 4MZBA 1T7PB 2VD1A 1A24A 2QKEA 2H0IA 4O5RA 5HR3A 8GSSA 2WULA 1M2DA 4MH2A 2HRFA 5G30A 1J0FA 3LFLA 4PXOA 3H93A 2MMZA 5C00A 2JZRA 2M80A 2NVLA 3VI7A 3IA1A 4H86A 4HI7A 4GQCA 5CRWA 3TOUA 3BCIA 3RHCA 1WRYA 2VCTA 4USSA 3LXTA 5AGYA 5C04A 4BWSA 2VD0A 1T4YA 4OCFA 3I9V2 3AY8A 4ZBBA 1XOAA 1TW9A 1O81A 5JCWA 1JHBA 4PUFC 1USBA 3E9JB 3HJOA 3FY7A 4CW9A 5IMFA 5IMCA 4IQ1A 3EU3A 5ELGA 2DMLA 5DQSA 4KH7A 2B7JA 2CZ2A 6GSWA 1AW9A 1OE7A 2L4CA 2N5FA 4ZBDA 4GTUA 2B5YA 5IMVA 2LUSA 2YANA 3A2XA 1R4WA 1TRWA 3HA9A 5CRGA 1T8EB 1YQ1A 2WJUA 3CSJA 1XWCA 3KCMA 5H5RA 4WKWA 1TRUA 2H0GA 1BAYA 1WE0A 1PX6A 2LNSA 1GWCA 4ZIJA 2HT9A 4XRDA 1HNBA 1V9WA 1JZWA 2BJXA 3KH9A 1K3LA 3EURA 1J08A 2IMKA 2H75A 2IMIA 1U3IA 4D73A 1VF3A 5DQYA 4ZL8A 3IK7A 3L9SA 1XIYA 1GULA 4J57E 4GF0A 2FD3A 1GNWA 2LQQA 4KW6A 1WPIA 1A23A 4RI6A 3TJBA 3UAPA 3I6AA 4JR6A 3F4RA 1Q4JA 3I43A 3QFAC 1SKWB 4V1Ag 4MF7A 1F2EA 1FHEA 3GTUA 2G0FA 2NTOA 2I81A 4ZL7A 4MLYA 1ERTA 11GSA 3WGEA 4N30A 1PL2A 4G0KA 3P90A 4TOPA 1VF1A 4QL7A 2C3NA 1TK5B 1HD2A 2HSMA 4IVFA 1AQXA 3H8QA 5G1KA 5ECIB 3ZMKA 5DCGA 2KHPA 2F8AA 4GSSA 4BVYA 3UOMA 3F4SA 5F07A 1NHYA 3KZQA 2OACA 1LJRA 1EGOA 1A2MA 3CRTA 2RLIA 4N0VA 3UIWA 3Q6OA 2MBSA 2YWNA 4L8EA 1FB0A 3KJYA 1YF0A 4KF9A 2H6ZA 5HR0A 1JZRA 1Z7PA 2LS5A 4NHWA 2AHEA 2H1DA 4AJ8A 2HFDA 2V6OA 3VURA 1EV9A
chains in the Genus database with same CATH superfamily
3ED3A 3U6VA 4XCSA 3LQ7A 1GL8A 4JZQA 5BRTA 1ZYNA 4QQ7A 3PPUA 2DJ0A 3LJRA 3VPQA 1WJKA 4PUAA 2ES7A 1GTUA 2CZ3A 2YJHA 2VLVA 3GIXA 2HSNA 1UA5A 3EU4A 22GSA 5ECKB 1QQ2A 2K6VA 1ZYQB 5IMDA 5L71A 2GSRA 5J4VA 1FW1A 2C4JA 1V58A 1QGVA 2K8VA 1RK4A 4CDOA 1THOA 4EF0A 2HRNA 2WDUA 2E0QA 1B4PA 4IJIA 4AKGA 1SYXA 4ZXGA 3DWVA 2LKUA 5FHIA 4AKHA 3TJGA 3LGCA 5CP1A 1TTZA 2CAIA 2PN8A 1WWJA 4O5QA 3GSSA 3CQFA 5DJMA 2WVZA 2ZNMA 5JCGA 2NBSA 1A8YA 1G6WA 2GSSA 2C3QA 3ZITA 2AB6A 4JBBA 2YWIA 5CO3A 1EP8A 4KB3A 1YDKA 4OMVA 3H4KA 3PH9A 1PRXA 4MABA 2NDOA 3F3QA 2DJKA 1SL2B 2RIIA 2OADA 5DDLA 5ECSA 3EMXA 1ON4A 5B7CA 3FR9A 2YN1A 2VM2A 3GURA 3SWLA 3M9JA 2HXKA 5AISA 3KEBA 4BL7A 3VWUA 2OA7A 3TRQA 3U5RE 2VAFA 4RQXA 1T4ZA 2AUVA 2YZHA 2GSQA 2H71A 1F3AA 4NPBA 4G01A 5ECPB 4TXOA 5J5NA 4EDYA 2GQMA 3IAS2 4BA7A 3QMXA 3QD9A 1TI1A 4IP6A 3GRXA 5HR2A 4Z2RA 2C0GA 2HZFA 1CQGA 4OCEA 5KN3A 2FLSA 2C0DA 1ZL9A 5DALA 1R5AA 5AIVA 3ERFA 1M9BA 2P5QA 2C0EA 2D2ZA 4KX4A 4WBRD 3LWAA 1A2JA 3D0ZA 1A8LA 1EEJA 3IRAA 2ALBA 1PQNA 3HD5A 1DBYA 4IN0A 1A0FA 6GSYA 3FMWA 2GGTA 2REMA 1Z5YE 3ZFLA 2VKZG 1FG4A 4NWYA 2VCVA 3Q18A 1TXUA 1SKRB 1TDIA 2F8FA 2GTUA 3UVHA 2LRTA 2DC5A 3GX0A 1PMTA 3FRCA 5A4UA 4MZWA 2AYTA 3TKSC 1MTCA 2FNOA 3ME7A 3QCPA 4ZB7A 1G0TA 1T1VA 3OR5A 4ZL9A 2RM5A 1AIUA 5B8BA 3P7XA 2HYXA 3CWGA 3EINA 4I97A 4YH2A 3M9KA 2CX4A 3DGQA 2RUEA 4D73B 1X5DA 3HVVA 4OO5A 2FWFA 2B6MA 1EV4A 1ZMAA 3GL3A 1YEPA 3ZREA 4EKZA 5GAPD 6GSUA 2VLUA 3IE3A 3FR6A 1SJIA 3ERWA 4AF2A 4PHZC 1GUHA 2K9FA 3GKKA 4K0GA 3BD2A 3TJKA 3MYDA 1OYJA 2N5BA 3VLNA 4MCUA 2CQ9A 5JWQB 3M0FA 2GLRA 4L0WA 4OWYA 4CHSA 4FQUA 3TKSA 3FR3A 3O76A 3F4TA 3IBHA 3FHKA 2R6KA 3HHVA 5H5QA 4BVYB 3HZ8A 3K8NA 3RFRC 5LD0A 2H6XA 4PURA 3KD0A 2YCDA 3E0UA 3TB2A 4V2NA 2R5GA 4RUVA 3KTLA 2PPTA 4XRAA 3EMPA 1OE8A 4YQUA 1F3BA 4JE1A 1K0AA 4XS4B 1XZOA 3HVSA 1YEXA 2IMEA 3F6FA 5DAKB 3IV4A 4W66A 5IO0A 1SL0B 1WIKA 1THXA 4POKA 4O92A 3HXSA 1SD8A 4G9HA 4NMUA 3NOFA 1SVLA 1SENA 1K3OA 4IGJA 2A2SA 3NZNA 1EOGA 1DSBA 4OFTA 2HSNB 4FO5A 3DD3A 4IBPA 1FO5A 4L5LA 1O8WA 4DSQA 3GMFA 3QAVA 2C3TA 5G5EA 4TXVA 1V2AA 2N5AA 5IIZA 1FOVA 1YF1A 3CXGA 1XWGA 4MJCA 1OC9A 4CY6A 4XHMA 1GRXA 2K8SA 3ISOA 3QFBC 3A5IA 4Q5NA 2HSYA 1OC8A 3LORA 4IELA 1SVOA 1B48A 4IKHA 2XBIA 3FZAA 2V6KA 2UV8G 2YZUA 2L5OA 3R2QA 5ECLB 5CRDA 4ZILA 2MMOA 4POLA 2IMFA 4BVXA 2H70A 4ID0A 1N8JA 1Y25A 1EOHA 5ELAA 3UL3A 1PGTA 2FA8A 3F6DA 6GSTA 1XBSA 2YJ7A 4P3YB 3ZVJD 1Z6MA 2JZSA 3TKQA 3CMIA 4WETA 1Y1UA 3BBYA 3L0HA 5EVOA 2IN3A 3APOA 1QK8A 5ENUA 5D9TA 3KTBA 4AJ7A 2GDRA 4I8BA 3JCML 4HEA2 2X64A 3LYKA 4LMWA 4AI6A 1EEMA 5KEJA 3P2AA 4ZB8A 4HDEA 2H1LA 4MP4A 1EGRA 4BL7B 1XG8A 3EPTA 4GQFA 3MSZA 2PGTA 5A5HA 5G1LA 1KTEA 2R3XA 2WW3A 4JR4A 3FKFA 4NHZA 4TXOB 5IM9A 4YAVA 2L57A 4LL4B 3DMLA 4IS0A 5EPFA 3LW9A 2I4AA 4YKGA 4L0UA 2HSHA 2O36A 4V2MA 1ML6A 2JSYA 1SL1B 2LSTA 2WB9A 3E3EA 2YWMA 3FZ5A 4FXYP 3Q74A 4WR4A 2MZCA 1K3YA 1K0OA 2WZ9A 5A1NB 2P0GA 2IPAA 4YKFA 2OBKA 1N2AA 1BG1A 4N3ZA 2X8GA 2LTKA 1TK8B 4EIQA 2CX3A 1S3AA 2GZPA 2YV7A 5DALB 5DJLA 4PNFA 3KMOA 1R26A 5D9WA 4F2IA 4ZBAA 3FYGA 4ZB6A 1U6TA 2Z9SA 2YWOA 3GH9A 1GUKA 4QL9A 5KOXA 2H30A 2OJLA 4HQSA 5J4UA 3IDVA 5ECNB 2HRAA 4FYUA 3F0IA 2IWTA 1FVJA 4XTSA 2DKHA 6GSSA 5EY6A 3UBLA 1XVQA 3D22A 2MMNA 1AUCA 4EUYA 5KN0A 5CAXA 4NAXA 2PERA 4I2UA 4TR4A 4F9ZA 2OBIA 5CYYA 3QAWA 1ZYPA 3GYKA 3TRXA 1YKCA 2I3YA 4IQAA 1M99A 2GZZA 4YQMA 2FY6A 3CTFA 5D93A 3CSHA 4G2EA 4HU7A 1I9DA 1B4QA 1RW1A 4ILFA 1RQMA 3UARA 2PVOC 4KSOA 3HJMA 3VWXA 1XW9A 4KDYA 3UBKA 2DLXA 3TRPA 5KOWA 1I1IP 1Z6NA 2LEGA 4JEDA 4X1UA 3F8UA 1UC7A 5CREA 5IPGA 1XCCA 2R37A 1XWKA 1SJZA 2DJ2A 3CBUA 1ILOA 3RDWA 5ID2A 3TKPA 3D21A 5G2ZA 2BTOT 1JFUA 2VL9A 4GDFA 1ERWA 4DEJA 5LCZA 3ZVJA 1NW2A 2H1AA 4I2TA 1GP1A 4IJ3A 2B7KA 4IW9A 4KA0A 1BG5A 3C7MA 3GNJA 2J9HA 2FWHA 1BJXA 3CYNA 3LSZA 1XWBA 4PI0C 1DE2A 4K8MA 1PN9A 3LXZA 3GN3A 1M3JA 2WS2A 2CT6A 3KM6A 3IK9A 1ZGNA 4BWQA 3RAZA 4FH8A 2FWGA 2H76A 3GV1A 1URMA 2DSAA 1Y6EA 3LYPA 2TRCP 4O7HA 2X49A 1BYEA 2YNXA 3TKRA 2WVXB 4GWRA 3TJJA 2KUCA 4E8HA 1TI3A 5DVBA 3S9FA 1SKSB 1WOUA 2V2GA 2NPBA 1GSFA 4TRXA 6GSXA 3N9JA 1QUWA 5F8BA 1JZDA 3ZMLA 2CVBA 5J47A 2LJAA 4PQ1A 5D73A 4L5OA 3L9UA 3J7Yk 4OFMA 2H1GA 3DKSA 5G5FA 1XOBA 2WW0A 3M8NA 19GSA 3ZRDA 2WVYA 4LA1A 1F6MC 3KH7A 2L59A 4CY8A 2ZCTA 3QPMA 2O7KA 5HQPA 4BVXB 2BMXA 2O3EA 2LQOA 4K6XA 3A5WA 1SK1A 3FZ9A 3J7Yb 2YPMA 2M72A 4KNDA 2C8UA 3CTGA 5A4VA 3APQA 2B3SA 1M2AA 2H66A 4A5PA 4TR1A 3PR8A 4WF5A 2MBTA 1S3DA 3ZIJA 1FVKA 5A5KA 4MA9A 4X4JA 3NIVA 3F63A 5F0GA 5CNWA 3UVTA 5HR1A 2AV4A 4N11A 5B6MA 3C1SA 1B9XC 2E2GA 2GSTA 1G6YA 1K0DA 4K7NA 2WGRA 9GSSA 4AKIA 4MJAA 1X5CA 1BF5A 1XW5A 13GSA 5DCHA 3MDKA 1PKWA 3CSIA 2L6DA 4ISDA 1LBKA 4I5QA 3IHGA 4RI7A 3IPZA 1M2BA 4MPFA 3IC8A 3FK8A 3M1GA 14GSA 4PQIA 3CRUA 4MDCA 4K2DA 1E6BA 3IAM2 2OT3A 2XHFA 16GSA 4WBJA 1SD9A 1X0RA 3ZL5A 3KMNA 4TN8A 5GAND 3N5OA 4EL1A 4XS1A 4G10A 1Z9HA 3V1WA 4F82A 3EYTA 1AXDA 3MWHA 5BMUA 2QGVA 4PNGA 5ECOB 2GQLA 3GKNA 4ECJA 2OE0A 4E8EA 3TGZA 4PGTA 4KAEA 2B5EA 4ICYA 1TRSA 1O8XA 3TCOA 3GTUB 5HFGA 4MMMA 1U3AA 3TUEA 5J40A 5ECHB 2IFQA 4HS1A 1WP0A 1GSYA 3US3A 1V40A 18GSA 5HFIA 3HDCA 4MJEA 4XS6A 1KEBA 2GQKA 3IC4A 2MMAA 3GUSA 3VI5A 3D6IA 2HSMB 2ON5A 3G7IA 1GSDA 6GSVA 7GSSA 1A2LA 3RBTA 1QMVA 5IMAA 3IR4A 5J3RA 1EZKA 2FWEA 4I6XA 5CRHA 1ACVA 2L6CA 2TIRA 4Z2TA 1ST9A 4N10A 4K7IA 1XWAA 3O6TA 2KP2A 3KXOA 2PUKC 5D8IA 1M7TA 3VK9A 1O85A 5E59A 2PVQA 1I5GA 1T00A 3TDGA 2B1LA 4POBA 3W8JA 4K5RA 2H8LA 4F03A 4N0ZA 4ECCA 1NM3A 3ZLPA 1FAAA 4GSTA 5ID2B 20GSA 2JL4A 1C72A 1ERVA 4ML1A 4ACSA 1IYIA 3VPTA 1O6JA 4PX1A 4DSSA 1VRSD 4AGSA 3WT1A 2DBCA 1VGLA 4OO4A 1QFNA 1TKDB 1WMJA 4O5UA 1ZZYA 3G7JA 4TR3A 4ECBA 3EVIA 3APSA 1FOHA 1GH2A 3FEUA 2IL3A 3QOUA 2VIMA 2EFHA 3QR6A 3KIJA 2R0GA 5IO2A 5H5SA 4DSRA 4MJBA 2YV9A 2A4VA 1GSUA 4JRRA 2L4QA 2A2RA 3MNGA 1TJDA 5GSSA 2VOCA 1F9MA 3LG6A 4HU9A 4JU5A 1XW6A 5IPHA 2VL2C 2HZEA 3D5JA 3DXBA 5IOWA 3HVXA 1AQWA 4J56E 3DVWA 1MD4A 1BQ7A 2PWJA 4WEYA 1H4OA 1HNAA 2R4VA 3GL5A 1YVLA 2O5VA 3Q19A 2O8VB 1M0UA 2H1BA 2EIRA 5FWGA 2EIOA 3RPNA 5ECMB 2RM6A 3DRNA 2VCWA 3GH6A 1K0MA 4EO3A 2H72A 2I1UA 2LRNA 4KCEA 1H75A 1O7UA 2X99A 3VFIA 1Z7RA 2EFDA 3IHQA 1AAZA 4KGIA 5D96A 2H19A 2V41A 1GTAA 1EP7A 4XIHA 3HYPA 5J9BA 2LV3A 1GTBA 4YQVA 5A4WA 1XPVA 5ECQB 3C1RA 1JLWA 3GX8A 2VL2A 2VL3A 3DYRA 3HCZA 2VUPA 2PMTA 5LNKe 2HRKA 2DKIA 2E2MA 4MF5A 3HZ4A 4Z2UA 1VF4A 3KGKA 1MEKA 3GHAA 1HYUA 3L78A 4GRFA 2GVPA 2DJJA 2X8HA 4GXZA 1K0CA 2V1MA 4KDXA 1EWXA 4TR1B 3SBCA 4G0LA 3EE2A 2C80A 4X43A 1X9SB 4GCIA 5B6NA 3D4MA 2MYGA 3G9BA 3L4NA 1V98A 1X9WB 5HFKA 4YAPA 2EIQA 3ME8A 4AJ6A 1OC3A 4V2LA 1TP9A 4WXTA 4BIKA 3A3TA 3D4TA 4NV2A 4KE3A 2GT6A 3HVNA 4ULXA 2HLSA 2CA8A 3WYWA 1YY7A 17GSA 1PA3A 2XPEA 1V57A 2V32A 4MF6A 3BCKA 5EL8A 5D9VA 1YZXA 2G2QA 2DJ1A 3G7YA 2ZUPA 1N25A 2CVDA 2TRXA 2O85A 1S4BP 1MDKA 4MH3A 4KUNA 1GTIA 4G19A 2OE1A 1T3BA 5E4WA 4MK3A 3QDNA 3C73A 2JU5A 2F9SA 2IJYA 4TKYA 4PQHA 2QA2A 3ERGA 3GA4A 3UMAA 2FA4A 2LNTA 3WGXA 5F05A 3O3TA 2VCZA 2LJKA 3EC3A 4G0IA 1PSQA 5DBQA 2VO4A 1BEDA 5F06A 4NV5A 2VCXA 4Q5QA 2VLTA 4FYCA 4XS4A 2IFQB 4F0BA 5INYA 5DAKA 4HJ2A 2A4HA 2AJQB 3TKSE 4EE0A 4LL1B 1QXHA 3HY2A 3ZTLA 2JADA 2WFCA 4HJMA 3VWVA 2DIYA 3C8EA 2VM1A 3GSTA 1LU4A 4Z7XA 1PFOA 2O89A 3PGTA 5GSTA 1ABAA 2AAWA 1TU8A 2PBJA 4WR5A 2QA1A 4PI2C 1GSEA 1PKZA 2M46A 3UEMA 2HQTA 1U87A 4J2FA 3HMJG 1MD3A 1HQOA 12GSA 1S3CA 1IYHA 1PL1A 4HZ2A 2XC2A 5IQYA 3DIEA 3P8WA 2FGXA 5KN1A 4K2XA 1A0RP 3FZ4A 1HNCA 5G31A 2F3MA 1JZOA 2DIZA 3UJ1A 2OKAA 2OE3A 2R0PA 2P5RA 2K18A 2P31A 2CV4A 1OKDA 4MPGA 2H0HA 1K0BA 1B8XA 2KP1A 1W4VA 3W8SA 3BOAA 1MDIA 2JZTA 2CVKA 4DSSB 4TW5A 1GUMA 4MZCA 1R7HA 3GKXA 4K0NA 3ZFBA 2HNLA 1F37A 5COHA 3WD6A 5B8AA 1SK2A 1OC9B 1GSSA 1XVWA 2H73A 3WGDA 3A2VA 5AN1A 1OVNA 3H79A 2WZSA 1VF2A 1ZYEA 1CQHA 1DE1A 2XBQA 4K9ZA 2WCIA 3IOSA 4K7OA 2HZEB 4IHUA 1OKTA 3MAKA 3HKRA 2RUFA 1TOFA 2KOKA 3RHBA 4KSMA 4O32A 1W89A 4EIPA 2XPDA 5JWOB 4WF4A 4TR0A 2LJRA 3C71A 2GZYA 2IIYA 2R2JA 4OD7A 2I9HA 2J23A 1FB6A 2FHEA 1M9AA 3KP8A 2E7PA 4ECIA 2C1YA 1XXUA 1YKAA 4ZB9A 1R5PA 1AQVA 5A1NA 1GSQA 1TRVA 1Z3EA 2B1KA 5J41A 2IMDA 1DUGA 1TU7A 3TOTA 1YJ6A 2JACA 4Q5FA 5ABRA 4Q5RA 3MIXA 1K0NA 4E68A 4FYBA 2DMMA 1XFLA 1TK0B 5A5HB 2H01A 1SYRA 4K1FA 4NXIA 1GLQA 1KNGA 1X5EA 3R3EA 3PINA 1ERUA 4HUAA 2QC7A 3W6GA 1NSWA 4EC0A 5GZZB 2HRKB 3ZYWA 4BPYA 1U88A 2YP6A 3TJFA 3VWWA 3I69A 4KDUA 2ON7A 2DJ3A 3LEFA 2X8CA 1GLPA 4X0XA 2KLXA 3KP9A 4LLRA 5A34A 1Q98A 5J9CA 1ZOFA 3DVXA 5JWRB 3CHXC 2CAQA 2EC4A 2A2PA 2H74A 2F51A 1TXXA 3QAGA 2QSIA 2GT5A 3GKMA 4GLTA 1AC1A 3L9VA 1SK0A 10GSA 5KN2A 2R0CA 3F3RA 1B9YC 1PD21 1S3RA 1NHOA 4KCAA 2H6YA 2UZ8A 1SJ6A 3F9UA 4DVCA 4FIWA 3RPPA 1X9MB 3M3MA 4GSNA 2GS3A 1KBNA 2LRCA 4EDZA 1UN2A 3EWLA 1O73A 5JCUA 2WW2A 4HZ4A 3GFKA 5J4YA 3HJPA 1MDJA 5AIXA 1ZCPA 4RQRA 2B5XA 1G7EA 2HI7A 2FUG2 2HE3A 2C0FA 4F0CA 4LMVA 4HSCX 3H1NA 2X4AA 1G7OA 4OFNA 1E2YA 2JSZA 1BX9A 4V1Ap 3A2WA 5ECRB 5FT3A 2FCHA 1SU9A 3BJ5A 2WRTA 5IMZA 4HOJA 4HQZA 4POMA 3ZIVA 3WT2A 5IOXA 1GNEA 2O87A 4ML6A 4EXJA 1PX7A 3FW2A 1JLVA 1OAZA 2YOIA 1J9BA 2VCQA 2WVXA 4IP1A 3ZZXA 2L5LA 5D9XA 1UVZA 3IXRA 3DEXA 4EVMA 2PU9C 4PTSA 4TVEA 4MZBA 1T7PB 2VD1A 1A24A 2QKEA 2H0IA 4O5RA 5HR3A 8GSSA 2WULA 1M2DA 4MH2A 2HRFA 4MNNA 5G30A 2EFEA 3LFLA 1J0FA 4PXOA 3H93A 2MMZA 5C00A 2JZRA 2M80A 2NVLA 3VI7A 3IA1A 4H86A 4HI7A 4GQCA 5CRWA 3TOUA 3BCIA 3RHCA 3TU3B 1WRYA 2VCTA 4USSA 3LXTA 5AGYA 5C04A 4BWSA 2VD0A 1T4YA 4OCFA 3RGBC 3I9V2 3AY8A 4ZBBA 1XOAA 1TW9A 1O81A 5JCWA 1JHBA 4PUFC 1USBA 3E9JB 3HJOA 3FY7A 4CW9A 5IMFA 5IMCA 4IQ1A 3EU3A 5ELGA 2DMLA 5DQSA 4AKXB 4KH7A 2B7JA 2CZ2A 6GSWA 1AW9A 1OE7A 2L4CA 2N5FA 4ZBDA 4GTUA 2B5YA 5IMVA 2LUSA 2YANA 3A2XA 1R4WA 1TRWA 3HA9A 5CRGA 1T8EB 1YQ1A 2WJUA 3CSJA 1SVMA 1XWCA 3KCMA 5H5RA 4WKWA 1TRUA 2H0GA 1BAYA 1WE0A 1PX6A 2LNSA 1GWCA 4ZIJA 2HT9A 4XRDA 4K5SA 1HNBA 1V9WA 1JZWA 2BJXA 3KH9A 1K3LA 3EURA 1J08A 2IMKA 2H75A 2IMIA 1U3IA 4D73A 1VF3A 5DQYA 4ZL8A 3IK7A 3L9SA 1XIYA 1GULA 4J57E 4GF0A 2FD3A 1GNWA 2LQQA 4KW6A 1WPIA 4QMKA 1A23A 4RI6A 3TJBA 3UAPA 3I6AA 4JR6A 3F4RA 1Q4JA 3I43A 3QFAC 1SKWB 4V1Ag 4MF7A 1F2EA 1FHEA 3GTUA 2G0FA 2NTOA 2WW1A 2I81A 4ZL7A 4MLYA 1ERTA 11GSA 1PN0A 3WGEA 4N30A 1PL2A 1M3IA 4G0KA 3P90A 4TOPA 1VF1A 4QL7A 1YEWC 2C3NA 1TK5B 1HD2A 2HSMA 4IVFA 1AQXA 3H8QA 5G1KA 5ECIB 3ZMKA 5DCGA 2KHPA 2EFCA 5BMUB 2F8AA 4GSSA 4BVYA 3UOMA 3F4SA 5F07A 1NHYA 3KZQA 2OACA 1LJRA 5A34B 1EGOA 1A2MA 3CRTA 2RLIA 4N0VA 3UIWA 3Q6OA 2MBSA 2YWNA 4L8EA 1FB0A 3KJYA 1YF0A 4KF9A 2H6ZA 5HR0A 1JZRA 1Z7PA 2LS5A 4NHWA 2AHEA 2H1DA 4AJ8A 2HFDA 2V6OA 3VURA 1EV9A
chains in the Genus database with same CATH topology
3ED3A 3U6VA 4XCSA 3LQ7A 1GL8A 4JZQA 5BRTA 1ZYNA 4QQ7A 3PPUA 2DJ0A 3LJRA 3VPQA 1WJKA 4PUAA 2ES7A 1GTUA 2CZ3A 2YJHA 2VLVA 3GIXA 2HSNA 1UA5A 3EU4A 22GSA 5ECKB 1QQ2A 2K6VA 1ZYQB 5IMDA 5L71A 2GSRA 5J4VA 1FW1A 2C4JA 1V58A 1QGVA 2K8VA 1RK4A 4CDOA 1THOA 4EF0A 2HRNA 2WDUA 2E0QA 1B4PA 4IJIA 4AKGA 1SYXA 4ZXGA 3DWVA 2LKUA 5FHIA 4AKHA 3TJGA 3LGCA 5CP1A 1TTZA 2CAIA 2PN8A 1WWJA 4O5QA 3GSSA 5DJMA 2ZNMA 5JCGA 2NBSA 1A8YA 1G6WA 2GSSA 2C3QA 3ZITA 2AB6A 4JBBA 2YWIA 5CO3A 1EP8A 4KB3A 1YDKA 4OMVA 3H4KA 3PH9A 1PRXA 4MABA 2NDOA 3F3QA 2DJKA 1SL2B 2RIIA 2OADA 5DDLA 5ECSA 3EMXA 1ON4A 5B7CA 3FR9A 2YN1A 2VM2A 3GURA 3SWLA 3M9JA 2HXKA 5AISA 3KEBA 4BL7A 3VWUA 2OA7A 3TRQA 3U5RE 2VAFA 4RQXA 1T4ZA 2AUVA 2YZHA 2GSQA 2H71A 1F3AA 4NPBA 4G01A 5ECPB 4TXOA 5J5NA 4EDYA 2GQMA 3IAS2 4BA7A 3QMXA 3QD9A 1TI1A 4IP6A 3GRXA 5HR2A 4Z2RA 2C0GA 2HZFA 1CQGA 4OCEA 5KN3A 2FLSA 2C0DA 1ZL9A 5DALA 1R5AA 5AIVA 3ERFA 1M9BA 2P5QA 2C0EA 2D2ZA 4KX4A 4WBRD 3LWAA 1A2JA 3D0ZA 1A8LA 1EEJA 3IRAA 2ALBA 1PQNA 3HD5A 1DBYA 4IN0A 1A0FA 6GSYA 3FMWA 2GGTA 2REMA 1Z5YE 3ZFLA 2VKZG 1FG4A 4NWYA 2VCVA 3Q18A 1TXUA 1SKRB 1TDIA 2F8FA 2GTUA 3UVHA 2LRTA 2DC5A 3GX0A 1PMTA 3FRCA 5A4UA 4MZWA 2AYTA 3TKSC 1MTCA 2FNOA 3ME7A 3QCPA 4ZB7A 1G0TA 1T1VA 3OR5A 4ZL9A 2RM5A 1AIUA 5B8BA 3P7XA 2HYXA 3CWGA 3EINA 4I97A 4YH2A 3M9KA 2CX4A 3DGQA 2RUEA 4D73B 1X5DA 3HVVA 4OO5A 2FWFA 2B6MA 1EV4A 1ZMAA 3GL3A 1YEPA 3ZREA 4EKZA 5GAPD 6GSUA 2VLUA 3IE3A 3FR6A 1SJIA 3ERWA 4AF2A 1GUHA 2K9FA 3GKKA 4K0GA 3BD2A 3TJKA 3MYDA 1OYJA 2N5BA 3VLNA 4MCUA 2CQ9A 5JWQB 3M0FA 2GLRA 4L0WA 4OWYA 4CHSA 4FQUA 3TKSA 3FR3A 3O76A 3F4TA 3IBHA 3FHKA 2R6KA 3HHVA 5H5QA 4BVYB 3HZ8A 3K8NA 5LD0A 2H6XA 4PURA 3KD0A 2YCDA 3E0UA 3TB2A 4V2NA 2R5GA 4RUVA 3KTLA 2PPTA 4XRAA 3EMPA 1OE8A 4YQUA 1F3BA 4JE1A 1K0AA 4XS4B 1XZOA 3HVSA 1YEXA 2IMEA 3F6FA 5DAKB 3IV4A 4W66A 5IO0A 1SL0B 1WIKA 1THXA 4POKA 4O92A 3HXSA 1SD8A 4G9HA 4NMUA 3NOFA 1SVLA 1SENA 1K3OA 4IGJA 2A2SA 3NZNA 1EOGA 1DSBA 4OFTA 2HSNB 4FO5A 3DD3A 4IBPA 1FO5A 4L5LA 1O8WA 4DSQA 3GMFA 3QAVA 2C3TA 5G5EA 4TXVA 1V2AA 2N5AA 5IIZA 1FOVA 1YF1A 3CXGA 1XWGA 4MJCA 1OC9A 4CY6A 4XHMA 1GRXA 2K8SA 3ISOA 3QFBC 3A5IA 4Q5NA 2HSYA 1OC8A 3LORA 4IELA 1SVOA 1B48A 4IKHA 2XBIA 3FZAA 2V6KA 2UV8G 2YZUA 2L5OA 3R2QA 5ECLB 5CRDA 4ZILA 2MMOA 4POLA 2IMFA 4BVXA 2H70A 4ID0A 1N8JA 1Y25A 1EOHA 5ELAA 3UL3A 1PGTA 2FA8A 3F6DA 6GSTA 1XBSA 2YJ7A 4P3YB 3ZVJD 1Z6MA 2JZSA 3TKQA 3CMIA 4WETA 1Y1UA 3BBYA 3L0HA 5EVOA 2IN3A 3APOA 1QK8A 5ENUA 5D9TA 3KTBA 4AJ7A 2GDRA 4I8BA 3JCML 4HEA2 2X64A 3LYKA 4LMWA 4AI6A 1EEMA 5KEJA 3P2AA 4ZB8A 4HDEA 2H1LA 4MP4A 1EGRA 4BL7B 3EPTA 4GQFA 3MSZA 2PGTA 5A5HA 5G1LA 1KTEA 2R3XA 4JR4A 3FKFA 4NHZA 4TXOB 5IM9A 4YAVA 2L57A 4LL4B 3DMLA 4IS0A 5EPFA 3LW9A 2I4AA 4YKGA 4L0UA 2HSHA 4V2MA 1ML6A 2JSYA 1SL1B 2LSTA 2WB9A 3E3EA 2YWMA 3FZ5A 3Q74A 4WR4A 2MZCA 1K3YA 1K0OA 2WZ9A 5A1NB 2P0GA 2IPAA 4YKFA 2OBKA 1N2AA 1BG1A 4N3ZA 2X8GA 2LTKA 1TK8B 4EIQA 2CX3A 1S3AA 2GZPA 2YV7A 5DALB 5DJLA 4PNFA 3KMOA 1R26A 5D9WA 4F2IA 4ZBAA 3FYGA 4ZB6A 1U6TA 2Z9SA 2YWOA 3GH9A 1GUKA 4QL9A 5KOXA 2H30A 2OJLA 4HQSA 5J4UA 3IDVA 5ECNB 2HRAA 4FYUA 3F0IA 2IWTA 1FVJA 4XTSA 2DKHA 6GSSA 5EY6A 3UBLA 1XVQA 3D22A 2MMNA 1AUCA 4EUYA 5KN0A 5CAXA 4NAXA 2PERA 4I2UA 4TR4A 4F9ZA 2OBIA 5CYYA 3QAWA 1ZYPA 3GYKA 3TRXA 1YKCA 2I3YA 4IQAA 1M99A 2GZZA 4YQMA 2FY6A 3CTFA 5D93A 3CSHA 4G2EA 4HU7A 1I9DA 1B4QA 1RW1A 4ILFA 1RQMA 3UARA 2PVOC 4KSOA 3HJMA 3VWXA 1XW9A 4KDYA 3UBKA 2DLXA 3TRPA 5KOWA 1Z6NA 2LEGA 4JEDA 4X1UA 3F8UA 1UC7A 5CREA 5IPGA 1XCCA 2R37A 1XWKA 1SJZA 2DJ2A 3CBUA 1ILOA 3RDWA 5ID2A 3TKPA 3D21A 5G2ZA 2BTOT 1JFUA 2VL9A 4GDFA 1ERWA 4DEJA 5LCZA 3ZVJA 1NW2A 2H1AA 4I2TA 1GP1A 4IJ3A 2B7KA 4IW9A 4KA0A 1BG5A 3C7MA 3GNJA 2J9HA 2FWHA 1BJXA 3CYNA 3LSZA 1XWBA 1DE2A 4K8MA 1PN9A 3LXZA 3GN3A 2WS2A 2CT6A 3KM6A 3IK9A 1ZGNA 4BWQA 3RAZA 4FH8A 2FWGA 2H76A 3GV1A 1URMA 2DSAA 1Y6EA 3LYPA 2TRCP 4O7HA 2X49A 1BYEA 2YNXA 3TKRA 4GWRA 3TJJA 2KUCA 4E8HA 1TI3A 5DVBA 3S9FA 1SKSB 1WOUA 2V2GA 2NPBA 1GSFA 4TRXA 6GSXA 3N9JA 1QUWA 5F8BA 1JZDA 3ZMLA 2CVBA 5J47A 2LJAA 4PQ1A 5D73A 4L5OA 3L9UA 3J7Yk 4OFMA 2H1GA 3DKSA 5G5FA 1XOBA 3M8NA 19GSA 3ZRDA 4LA1A 1F6MC 3KH7A 2L59A 4CY8A 2ZCTA 3QPMA 2O7KA 5HQPA 4BVXB 2BMXA 2LQOA 4K6XA 3A5WA 1SK1A 3FZ9A 3J7Yb 2YPMA 2M72A 4KNDA 2C8UA 3CTGA 5A4VA 3APQA 2B3SA 1M2AA 2H66A 4A5PA 4TR1A 3PR8A 4WF5A 2MBTA 1S3DA 3ZIJA 1FVKA 5A5KA 4MA9A 4X4JA 3NIVA 3F63A 5F0GA 5CNWA 3UVTA 5HR1A 2AV4A 4N11A 5B6MA 3C1SA 1B9XC 2E2GA 2GSTA 1G6YA 1K0DA 4K7NA 2WGRA 9GSSA 4AKIA 4MJAA 1X5CA 1BF5A 1XW5A 13GSA 5DCHA 3MDKA 1PKWA 3CSIA 2L6DA 4ISDA 1LBKA 4I5QA 3IHGA 4RI7A 3IPZA 1M2BA 4MPFA 3IC8A 3FK8A 3M1GA 14GSA 4PQIA 3CRUA 4MDCA 4K2DA 1E6BA 3IAM2 2OT3A 2XHFA 16GSA 4WBJA 1SD9A 1X0RA 3ZL5A 3KMNA 4TN8A 5GAND 3N5OA 4EL1A 4XS1A 4G10A 1Z9HA 3V1WA 4F82A 3EYTA 1AXDA 3MWHA 5BMUA 2QGVA 4PNGA 5ECOB 2GQLA 3GKNA 4ECJA 2OE0A 4E8EA 3TGZA 4PGTA 4KAEA 2B5EA 4ICYA 1TRSA 1O8XA 3TCOA 3GTUB 5HFGA 4MMMA 1U3AA 3TUEA 5J40A 5ECHB 2IFQA 4HS1A 1WP0A 1GSYA 3US3A 1V40A 18GSA 5HFIA 3HDCA 4MJEA 4XS6A 1KEBA 2GQKA 3IC4A 2MMAA 3GUSA 3VI5A 3D6IA 2HSMB 2ON5A 3G7IA 1GSDA 6GSVA 7GSSA 1A2LA 3RBTA 1QMVA 5IMAA 3IR4A 5J3RA 1EZKA 2FWEA 4I6XA 5CRHA 1ACVA 2L6CA 2TIRA 4Z2TA 1ST9A 4N10A 4K7IA 1XWAA 3O6TA 2KP2A 3KXOA 2PUKC 5D8IA 1M7TA 3VK9A 1O85A 5E59A 2PVQA 1I5GA 1T00A 3TDGA 2B1LA 4POBA 3W8JA 4K5RA 2H8LA 4F03A 4N0ZA 4ECCA 1NM3A 3ZLPA 1FAAA 4GSTA 5ID2B 20GSA 2JL4A 1C72A 1ERVA 4ML1A 4ACSA 1IYIA 3VPTA 1O6JA 4PX1A 4DSSA 1VRSD 4AGSA 3WT1A 2DBCA 1VGLA 4OO4A 1QFNA 1TKDB 1WMJA 4O5UA 1ZZYA 3G7JA 4TR3A 4ECBA 3EVIA 3APSA 1FOHA 1GH2A 3FEUA 2IL3A 3QOUA 2VIMA 2EFHA 3QR6A 3KIJA 2R0GA 5IO2A 5H5SA 4DSRA 4MJBA 2YV9A 2A4VA 1GSUA 4JRRA 2L4QA 2A2RA 3MNGA 1TJDA 5GSSA 2VOCA 1F9MA 3LG6A 4HU9A 4JU5A 1XW6A 5IPHA 2VL2C 2HZEA 3D5JA 3DXBA 5IOWA 3HVXA 1AQWA 4J56E 3DVWA 1MD4A 1BQ7A 2PWJA 4WEYA 1H4OA 1HNAA 2R4VA 3GL5A 1YVLA 2O5VA 3Q19A 2O8VB 1M0UA 2H1BA 2EIRA 5FWGA 2EIOA 3RPNA 5ECMB 2RM6A 3DRNA 2VCWA 3GH6A 1K0MA 4EO3A 2H72A 2I1UA 2LRNA 4KCEA 1H75A 1O7UA 2X99A 3VFIA 1Z7RA 2EFDA 3IHQA 1AAZA 4KGIA 5D96A 2H19A 2V41A 1GTAA 1EP7A 4XIHA 3HYPA 5J9BA 2LV3A 1GTBA 4YQVA 5A4WA 1XPVA 5ECQB 3C1RA 1JLWA 3GX8A 2VL2A 2VL3A 3DYRA 3HCZA 2VUPA 2PMTA 5LNKe 2HRKA 2DKIA 2E2MA 4MF5A 3HZ4A 4Z2UA 1VF4A 3KGKA 1MEKA 3GHAA 1HYUA 3L78A 4GRFA 2GVPA 2DJJA 2X8HA 4GXZA 1K0CA 2V1MA 4KDXA 1EWXA 4TR1B 3SBCA 4G0LA 3EE2A 2C80A 4X43A 1X9SB 4GCIA 5B6NA 3D4MA 2MYGA 3G9BA 3L4NA 1V98A 1X9WB 5HFKA 4YAPA 2EIQA 3ME8A 4AJ6A 1OC3A 4V2LA 1TP9A 4WXTA 3A3TA 3D4TA 4NV2A 4KE3A 2GT6A 4ULXA 2HLSA 2CA8A 3WYWA 1YY7A 17GSA 1PA3A 2XPEA 1V57A 2V32A 4MF6A 3BCKA 5EL8A 5D9VA 1YZXA 2G2QA 2DJ1A 3G7YA 2ZUPA 1N25A 2CVDA 2TRXA 2O85A 1MDKA 4MH3A 4KUNA 1GTIA 4G19A 2OE1A 1T3BA 5E4WA 4MK3A 3QDNA 3C73A 2JU5A 2F9SA 2IJYA 4TKYA 4PQHA 2QA2A 3ERGA 3GA4A 3UMAA 2FA4A 2LNTA 3WGXA 5F05A 3O3TA 2VCZA 2LJKA 3EC3A 4G0IA 1PSQA 5DBQA 2VO4A 1BEDA 5F06A 4NV5A 2VCXA 4Q5QA 2VLTA 4FYCA 4XS4A 2IFQB 4F0BA 5INYA 5DAKA 4HJ2A 2A4HA 2AJQB 3TKSE 4EE0A 4LL1B 1QXHA 3HY2A 3ZTLA 2JADA 2WFCA 4HJMA 3VWVA 2DIYA 3C8EA 2VM1A 3GSTA 1LU4A 4Z7XA 2O89A 3PGTA 5GSTA 1ABAA 2AAWA 1TU8A 2PBJA 4WR5A 2QA1A 1GSEA 1PKZA 2M46A 3UEMA 2HQTA 1U87A 4J2FA 3HMJG 1MD3A 1HQOA 12GSA 1S3CA 1IYHA 1PL1A 4HZ2A 2XC2A 5IQYA 3DIEA 3P8WA 2FGXA 5KN1A 4K2XA 1A0RP 3FZ4A 1HNCA 5G31A 2F3MA 1JZOA 2DIZA 3UJ1A 2OKAA 2OE3A 2R0PA 2P5RA 2K18A 2P31A 2CV4A 1OKDA 4MPGA 2H0HA 1K0BA 1B8XA 2KP1A 1W4VA 3W8SA 3BOAA 1MDIA 2JZTA 2CVKA 4DSSB 4TW5A 1GUMA 4MZCA 1R7HA 3GKXA 4K0NA 3ZFBA 2HNLA 1F37A 5COHA 3WD6A 5B8AA 1SK2A 1OC9B 1GSSA 1XVWA 2H73A 3WGDA 3A2VA 5AN1A 1OVNA 3H79A 1VF2A 1ZYEA 1CQHA 1DE1A 2XBQA 4K9ZA 2WCIA 3IOSA 4K7OA 2HZEB 4IHUA 1OKTA 3MAKA 3HKRA 2RUFA 1TOFA 2KOKA 3RHBA 4KSMA 4O32A 1W89A 4EIPA 2XPDA 5JWOB 4WF4A 4TR0A 2LJRA 3C71A 2GZYA 2IIYA 2R2JA 4OD7A 2I9HA 2J23A 1FB6A 2FHEA 1M9AA 3KP8A 2E7PA 4ECIA 2C1YA 1XXUA 1YKAA 4ZB9A 1R5PA 1AQVA 5A1NA 1GSQA 1TRVA 1Z3EA 2B1KA 5J41A 2IMDA 1DUGA 1TU7A 3TOTA 1YJ6A 2JACA 4Q5FA 5ABRA 4Q5RA 3MIXA 1K0NA 4E68A 4FYBA 2DMMA 1XFLA 1TK0B 5A5HB 2H01A 1SYRA 4K1FA 4NXIA 1GLQA 1KNGA 1X5EA 3R3EA 3PINA 1ERUA 4HUAA 2QC7A 3W6GA 1NSWA 4EC0A 5GZZB 2HRKB 3ZYWA 4BPYA 1U88A 2YP6A 3TJFA 3VWWA 3I69A 4KDUA 2ON7A 2DJ3A 3LEFA 2X8CA 1GLPA 4X0XA 2KLXA 3KP9A 4LLRA 5A34A 1Q98A 5J9CA 1ZOFA 3DVXA 5JWRB 2CAQA 2EC4A 2A2PA 2H74A 2F51A 1TXXA 3QAGA 2QSIA 2GT5A 3GKMA 4GLTA 1AC1A 3L9VA 1SK0A 10GSA 5KN2A 2R0CA 3F3RA 1B9YC 1PD21 1NHOA 4KCAA 2H6YA 2UZ8A 1SJ6A 3F9UA 4DVCA 4FIWA 3RPPA 1X9MB 3M3MA 4GSNA 2GS3A 1KBNA 2LRCA 4EDZA 1UN2A 3EWLA 1O73A 5JCUA 4HZ4A 3GFKA 5J4YA 3HJPA 1MDJA 5AIXA 1ZCPA 4RQRA 2B5XA 1G7EA 2HI7A 2FUG2 2HE3A 2C0FA 4F0CA 4LMVA 3H1NA 2X4AA 1G7OA 4OFNA 1E2YA 2JSZA 1BX9A 4V1Ap 3A2WA 5ECRB 5FT3A 2FCHA 1SU9A 3BJ5A 2WRTA 5IMZA 4HOJA 4HQZA 4POMA 3ZIVA 3WT2A 5IOXA 1GNEA 2O87A 4ML6A 4EXJA 1PX7A 3FW2A 1JLVA 1OAZA 2YOIA 1J9BA 2VCQA 4IP1A 3ZZXA 2L5LA 5D9XA 1UVZA 3IXRA 3DEXA 4EVMA 2PU9C 4PTSA 4TVEA 4MZBA 1T7PB 2VD1A 1A24A 2QKEA 2H0IA 4O5RA 5HR3A 8GSSA 2WULA 1M2DA 4MH2A 2HRFA 4MNNA 5G30A 2EFEA 3LFLA 1J0FA 4PXOA 3H93A 2MMZA 5C00A 2JZRA 2M80A 2NVLA 3VI7A 3IA1A 4H86A 4HI7A 4GQCA 5CRWA 3TOUA 3BCIA 3RHCA 3TU3B 1WRYA 2VCTA 4USSA 3LXTA 5AGYA 5C04A 4BWSA 2VD0A 1T4YA 4OCFA 3I9V2 3AY8A 4ZBBA 1XOAA 1TW9A 1O81A 5JCWA 1JHBA 4PUFC 1USBA 3E9JB 3HJOA 3FY7A 4CW9A 5IMFA 5IMCA 4IQ1A 3EU3A 5ELGA 2DMLA 5DQSA 4AKXB 4KH7A 2B7JA 2CZ2A 6GSWA 1AW9A 1OE7A 2L4CA 2N5FA 4ZBDA 4GTUA 2B5YA 5IMVA 2LUSA 2YANA 3A2XA 1R4WA 1TRWA 3HA9A 5CRGA 1T8EB 1YQ1A 2WJUA 3CSJA 1SVMA 1XWCA 3KCMA 5H5RA 4WKWA 1TRUA 2H0GA 1BAYA 1WE0A 1PX6A 2LNSA 1GWCA 4ZIJA 2HT9A 4XRDA 4K5SA 1HNBA 1V9WA 1JZWA 2BJXA 3KH9A 1K3LA 3EURA 1J08A 2IMKA 2H75A 2IMIA 1U3IA 4D73A 1VF3A 5DQYA 4ZL8A 3IK7A 3L9SA 1XIYA 1GULA 4J57E 4GF0A 2FD3A 1GNWA 2LQQA 4KW6A 1WPIA 4QMKA 1A23A 4RI6A 3TJBA 3UAPA 3I6AA 4JR6A 3F4RA 1Q4JA 3I43A 3QFAC 1SKWB 4V1Ag 4MF7A 1F2EA 1FHEA 3GTUA 2G0FA 2NTOA 2I81A 4ZL7A 4MLYA 1ERTA 11GSA 1PN0A 3WGEA 4N30A 1PL2A 4G0KA 3P90A 4TOPA 1VF1A 4QL7A 2C3NA 1TK5B 1HD2A 2HSMA 4IVFA 1AQXA 3H8QA 5G1KA 5ECIB 3ZMKA 5DCGA 2KHPA 2EFCA 5BMUB 2F8AA 4GSSA 4BVYA 3UOMA 3F4SA 5F07A 1NHYA 3KZQA 2OACA 1LJRA 5A34B 1EGOA 1A2MA 3CRTA 2RLIA 4N0VA 3UIWA 3Q6OA 2MBSA 2YWNA 4L8EA 1FB0A 3KJYA 1YF0A 4KF9A 2H6ZA 5HR0A 1JZRA 1Z7PA 2LS5A 4NHWA 2AHEA 2H1DA 4AJ8A 2HFDA 2V6OA 3VURA 1EV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ED3 A;  3U6V A;  4XCS A;  3LQ7 A;  1GL8 A;  4JZQ A;  4QQ7 A;  3PPU A;  2DJ0 A;  3LJR A;  3VPQ A;  1WJK A;  4PUA A;  2ES7 A;  1GTU A;  2CZ3 A;  2YJH A;  2VLV A;  3GIX A;  1UA5 A;  3EU4 A;  22GS A;  5ECK B;  1QQ2 A;  2K6V A;  1ZYQ B;  5IMD A;  5L71 A;  2GSR A;  1FW1 A;  2C4J A;  1V58 A;  1QGV A;  2K8V A;  1RK4 A;  4CDO A;  1THO A;  4EF0 A;  2HRN A;  2WDU A;  2E0Q A;  1B4P A;  4IJI A;  1SYX A;  4ZXG A;  3DWV A;  2LKU A;  5FHI A;  3TJG A;  3LGC A;  5CP1 A;  1TTZ A;  2CAI A;  2PN8 A;  1WWJ A;  3GSS A;  5DJM A;  2ZNM A;  5JCG A;  2NBS A;  1A8Y A;  1G6W A;  2GSS A;  2C3Q A;  3ZIT A;  2AB6 A;  4JBB A;  2YWI A;  5CO3 A;  1EP8 A;  4KB3 A;  1YDK A;  4OMV A;  3H4K A;  3PH9 A;  1PRX A;  4MAB A;  2NDO A;  3F3Q A;  2DJK A;  1SL2 B;  2RII A;  2OAD A;  5DDL A;  5ECS A;  3EMX A;  1ON4 A;  5B7C A;  3FR9 A;  2YN1 A;  3GUR A;  2VM2 A;  3SWL A;  3M9J A;  2HXK A;  5AIS A;  3KEB A;  4BL7 A;  3VWU A;  2OA7 A;  3TRQ A;  3U5R E;  2VAF A;  4RQX A;  1T4Z A;  2AUV A;  2YZH A;  2GSQ A;  2H71 A;  1F3A A;  4NPB A;  5ECP B;  4TXO A;  5J5N A;  4EDY A;  2GQM A;  3IAS 2;  4BA7 A;  3QMX A;  3QD9 A;  1TI1 A;  4IP6 A;  3GRX A;  5HR2 A;  2C0G A;  2HZF A;  1CQG A;  4OCE A;  5KN3 A;  2FLS A;  2C0D A;  1ZL9 A;  5DAL A;  1R5A A;  5AIV A;  3ERF A;  1M9B A;  2P5Q A;  2C0E A;  2D2Z A;  4KX4 A;  4WBR D;  3LWA A;  1A2J A;  3D0Z A;  1A8L A;  1EEJ A;  3IRA A;  2ALB A;  1PQN A;  3HD5 A;  1DBY A;  4IN0 A;  1A0F A;  6GSY A;  2GGT A;  2REM A;  1Z5Y E;  3ZFL A;  1FG4 A;  4NWY A;  2VCV A;  3Q18 A;  1SKR B;  1TDI A;  2F8F A;  2GTU A;  3UVH A;  2LRT A;  2DC5 A;  3GX0 A;  1PMT A;  3FRC A;  5A4U A;  4MZW A;  2AYT A;  3TKS C;  1MTC A;  2FNO A;  3QCP A;  3ME7 A;  1G0T A;  3OR5 A;  1T1V A;  4ZL9 A;  2RM5 A;  1AIU A;  5B8B A;  3P7X A;  2HYX A;  3EIN A;  4I97 A;  3M9K A;  4YH2 A;  2CX4 A;  3DGQ A;  2RUE A;  4D73 B;  1X5D A;  3HVV A;  4OO5 A;  2FWF A;  2B6M A;  1EV4 A;  1ZMA A;  3GL3 A;  1YEP A;  3ZRE A;  4EKZ A;  5GAP D;  6GSU A;  2VLU A;  3IE3 A;  3FR6 A;  1SJI A;  3ERW A;  4AF2 A;  1GUH A;  2K9F A;  3GKK A;  4K0G A;  3BD2 A;  3TJK A;  1OYJ A;  2N5B A;  3VLN A;  4MCU A;  2CQ9 A;  5JWQ B;  3M0F A;  2GLR A;  4L0W A;  4OWY A;  4CHS A;  4FQU A;  3TKS A;  3FR3 A;  3O76 A;  3F4T A;  3IBH A;  3FHK A;  2R6K A;  3HHV A;  5H5Q A;  4BVY B;  3HZ8 A;  3K8N A;  5LD0 A;  2H6X A;  4PUR A;  3KD0 A;  2YCD A;  3E0U A;  3TB2 A;  4V2N A;  2R5G A;  4RUV A;  3KTL A;  2PPT A;  4XRA A;  3EMP A;  1OE8 A;  4YQU A;  1F3B A;  4JE1 A;  1K0A A;  4XS4 B;  1XZO A;  3HVS A;  1YEX A;  2IME A;  3F6F A;  5DAK B;  3IV4 A;  5IO0 A;  1SL0 B;  1WIK A;  1THX A;  4POK A;  4O92 A;  3HXS A;  1SD8 A;  4G9H A;  4NMU A;  3NOF A;  1SEN A;  1K3O A;  4IGJ A;  2A2S A;  3NZN A;  1EOG A;  1DSB A;  4OFT A;  2HSN B;  4FO5 A;  3DD3 A;  4IBP A;  1FO5 A;  4L5L A;  1O8W A;  4DSQ A;  3QAV A;  2C3T A;  5G5E A;  3GMF A;  4TXV A;  1V2A A;  2N5A A;  5IIZ A;  1FOV A;  1YF1 A;  3CXG A;  1XWG A;  4MJC A;  1OC9 A;  4XHM A;  1GRX A;  2K8S A;  3ISO A;  3QFB C;  4Q5N A;  2HSY A;  1OC8 A;  3LOR A;  4IEL A;  1B48 A;  4IKH A;  2XBI A;  3FZA A;  2V6K A;  2YZU A;  2L5O A;  3R2Q A;  5ECL B;  5CRD A;  4ZIL A;  2MMO A;  4POL A;  2IMF A;  4BVX A;  2H70 A;  4ID0 A;  1N8J A;  1Y25 A;  1EOH A;  5ELA A;  3UL3 A;  1PGT A;  2FA8 A;  3F6D A;  6GST A;  1XBS A;  2YJ7 A;  4P3Y B;  3ZVJ D;  1Z6M A;  2JZS A;  3TKQ A;  3CMI A;  4WET A;  3BBY A;  3L0H A;  5EVO A;  2IN3 A;  3APO A;  1QK8 A;  5ENU A;  5D9T A;  3KTB A;  4AJ7 A;  2GDR A;  4I8B A;  3JCM L;  4HEA 2;  2X64 A;  3LYK A;  4LMW A;  1EEM A;  5KEJ A;  3P2A A;  4ZB8 A;  4HDE A;  4MP4 A;  1EGR A;  4BL7 B;  4GQF A;  3MSZ A;  2PGT A;  5G1L A;  1KTE A;  2R3X A;  4JR4 A;  3FKF A;  4NHZ A;  4TXO B;  5IM9 A;  4YAV A;  2L57 A;  4LL4 B;  3DML A;  4IS0 A;  5EPF A;  2I4A A;  4L0U A;  2HSH A;  4V2M A;  1ML6 A;  2JSY A;  1SL1 B;  2LST A;  2WB9 A;  3E3E A;  2YWM A;  3FZ5 A;  3Q74 A;  4WR4 A;  2MZC A;  1K3Y A;  1K0O A;  2WZ9 A;  2P0G A;  2IPA A;  2OBK A;  1N2A A;  2X8G A;  2LTK A;  1TK8 B;  2CX3 A;  1S3A A;  2GZP A;  2YV7 A;  5DAL B;  5DJL A;  4PNF A;  3KMO A;  1R26 A;  5D9W A;  4F2I A;  4ZBA A;  3FYG A;  4ZB6 A;  1U6T A;  2Z9S A;  2YWO A;  3GH9 A;  1GUK A;  4QL9 A;  2H30 A;  2OJL A;  4HQS A;  5J4U A;  3IDV A;  5ECN B;  2HRA A;  4FYU A;  3F0I A;  2IWT A;  1FVJ A;  4XTS A;  6GSS A;  5EY6 A;  3UBL A;  1XVQ A;  3D22 A;  2MMN A;  1AUC A;  4EUY A;  5KN0 A;  5CAX A;  4NAX A;  2PER A;  4I2U A;  4TR4 A;  4F9Z A;  2OBI A;  5CYY A;  3QAW A;  3GYK A;  3TRX A;  1YKC A;  2I3Y A;  4IQA A;  1M99 A;  2GZZ A;  4YQM A;  2FY6 A;  3CTF A;  5D93 A;  3CSH A;  4G2E A;  4HU7 A;  1I9D A;  1B4Q A;  1RW1 A;  4ILF A;  1RQM A;  3UAR A;  2PVO C;  4KSO A;  3HJM A;  3VWX A;  1XW9 A;  4KDY A;  3UBK A;  2DLX A;  3TRP A;  1Z6N A;  2LEG A;  4JED A;  4X1U A;  3F8U A;  1UC7 A;  5CRE A;  5IPG A;  1XCC A;  2R37 A;  1XWK A;  1SJZ A;  2DJ2 A;  3CBU A;  1ILO A;  3RDW A;  5ID2 A;  3TKP A;  3D21 A;  5G2Z A;  2BTO T;  1JFU A;  2VL9 A;  1ERW A;  4DEJ A;  5LCZ A;  3ZVJ A;  1NW2 A;  2H1A A;  4I2T A;  1GP1 A;  4IJ3 A;  2B7K A;  4IW9 A;  4KA0 A;  1BG5 A;  3C7M A;  3GNJ A;  2J9H A;  2FWH A;  1BJX A;  3CYN A;  3LSZ A;  1XWB A;  1DE2 A;  4K8M A;  1PN9 A;  3LXZ A;  3GN3 A;  2WS2 A;  2CT6 A;  3KM6 A;  3IK9 A;  1ZGN A;  4BWQ A;  3RAZ A;  4FH8 A;  2FWG A;  2H76 A;  3GV1 A;  1URM A;  2DSA A;  1Y6E A;  3LYP A;  2TRC P;  4O7H A;  1BYE A;  2YNX A;  3TKR A;  4GWR A;  3TJJ A;  2KUC A;  4E8H A;  1TI3 A;  5DVB A;  3S9F A;  1SKS B;  1WOU A;  2V2G A;  2NPB A;  1GSF A;  4TRX A;  6GSX A;  3N9J A;  1QUW A;  5F8B A;  1JZD A;  3ZML A;  2CVB A;  2LJA A;  4PQ1 A;  5D73 A;  4L5O A;  3L9U A;  3J7Y k;  4OFM A;  2H1G A;  3DKS A;  5G5F A;  1XOB A;  3M8N A;  19GS A;  3ZRD A;  4LA1 A;  1F6M C;  3KH7 A;  2L59 A;  2ZCT A;  3QPM A;  2O7K A;  5HQP A;  4BVX B;  2BMX A;  2LQO A;  4K6X A;  3A5W A;  1SK1 A;  3FZ9 A;  3J7Y b;  2YPM A;  2M72 A;  4KND A;  2C8U A;  3CTG A;  5A4V A;  3APQ A;  2B3S A;  1M2A A;  2H66 A;  4TR1 A;  3PR8 A;  4WF5 A;  2MBT A;  1S3D A;  3ZIJ A;  1FVK A;  5A5K A;  4MA9 A;  3NIV A;  3F63 A;  5F0G A;  5CNW A;  3UVT A;  5HR1 A;  2AV4 A;  4N11 A;  5B6M A;  3C1S A;  1B9X C;  2E2G A;  2GST A;  1G6Y A;  1K0D A;  4K7N A;  2WGR A;  9GSS A;  4MJA A;  1X5C A;  1XW5 A;  13GS A;  5DCH A;  3MDK A;  1PKW A;  3CSI A;  2L6D A;  4ISD A;  1LBK A;  4I5Q A;  4RI7 A;  3IPZ A;  1M2B A;  4MPF A;  3IC8 A;  3FK8 A;  3M1G A;  14GS A;  4PQI A;  3CRU A;  4MDC A;  4K2D A;  1E6B A;  3IAM 2;  2XHF A;  16GS A;  4WBJ A;  1SD9 A;  1X0R A;  3ZL5 A;  3KMN A;  4TN8 A;  5GAN D;  3N5O A;  4EL1 A;  4XS1 A;  4G10 A;  1Z9H A;  3V1W A;  4F82 A;  3EYT A;  1AXD A;  3MWH A;  5BMU A;  2QGV A;  4PNG A;  5ECO B;  2GQL A;  3GKN A;  4ECJ A;  2OE0 A;  4E8E A;  3TGZ A;  4PGT A;  4KAE A;  2B5E A;  1TRS A;  1O8X A;  3TCO A;  3GTU B;  5HFG A;  4MMM A;  1U3A A;  3TUE A;  5ECH B;  2IFQ A;  4HS1 A;  1WP0 A;  1GSY A;  3US3 A;  1V40 A;  18GS A;  5HFI A;  3HDC A;  4MJE A;  4XS6 A;  1KEB A;  2GQK A;  3IC4 A;  2MMA A;  3GUS A;  3VI5 A;  3D6I A;  2HSM B;  2ON5 A;  3G7I A;  1GSD A;  6GSV A;  7GSS A;  1A2L A;  3RBT A;  1QMV A;  5IMA A;  3IR4 A;  5J3R A;  1EZK A;  2FWE A;  4I6X A;  5CRH A;  1ACV A;  2L6C A;  2TIR A;  1ST9 A;  4N10 A;  4K7I A;  1XWA A;  3O6T A;  2KP2 A;  3KXO A;  2PUK C;  5D8I A;  1M7T A;  3VK9 A;  1O85 A;  5E59 A;  2PVQ A;  1I5G A;  1T00 A;  3TDG A;  2B1L A;  4POB A;  3W8J A;  2H8L A;  4F03 A;  4N0Z A;  4ECC A;  1NM3 A;  3ZLP A;  1FAA A;  4GST A;  5ID2 B;  20GS A;  2JL4 A;  1C72 A;  1ERV A;  4ML1 A;  4ACS A;  1IYI A;  3VPT A;  1O6J A;  4PX1 A;  4DSS A;  1VRS D;  4AGS A;  3WT1 A;  2DBC A;  1VGL A;  4OO4 A;  1QFN A;  1TKD B;  1WMJ A;  1ZZY A;  3G7J A;  4TR3 A;  4ECB A;  3EVI A;  3APS A;  1GH2 A;  3FEU A;  2IL3 A;  3QOU A;  2VIM A;  3QR6 A;  3KIJ A;  5IO2 A;  5H5S A;  4DSR A;  4MJB A;  2YV9 A;  2A4V A;  1GSU A;  4JRR A;  2L4Q A;  2A2R A;  3MNG A;  1TJD A;  5GSS A;  2VOC A;  1F9M A;  3LG6 A;  4HU9 A;  4JU5 A;  1XW6 A;  5IPH A;  2VL2 C;  2HZE A;  3D5J A;  3DXB A;  5IOW A;  3HVX A;  1AQW A;  4J56 E;  3DVW A;  1MD4 A;  1BQ7 A;  2PWJ A;  4WEY A;  1H4O A;  1HNA A;  2R4V A;  3GL5 A;  3Q19 A;  2O8V B;  1M0U A;  2H1B A;  2EIR A;  5FWG A;  2EIO A;  3RPN A;  5ECM B;  2RM6 A;  3DRN A;  2VCW A;  3GH6 A;  1K0M A;  4EO3 A;  2H72 A;  2I1U A;  2LRN A;  4KCE A;  1H75 A;  1O7U A;  2X99 A;  3VFI A;  1Z7R A;  3IHQ A;  1AAZ A;  4KGI A;  5D96 A;  2H19 A;  2V41 A;  1GTA A;  1EP7 A;  4XIH A;  3HYP A;  5J9B A;  2LV3 A;  1GTB A;  4YQV A;  5A4W A;  1XPV A;  5ECQ B;  3C1R A;  1JLW A;  3GX8 A;  2VL2 A;  2VL3 A;  3DYR A;  3HCZ A;  2VUP A;  2PMT A;  5LNK e;  2HRK A;  2E2M A;  4MF5 A;  3HZ4 A;  1VF4 A;  3KGK A;  1MEK A;  3GHA A;  1HYU A;  3L78 A;  4GRF A;  2GVP A;  2DJJ A;  2X8H A;  4GXZ A;  1K0C A;  2V1M A;  4KDX A;  1EWX A;  4TR1 B;  3SBC A;  4G0L A;  3EE2 A;  2C80 A;  4X43 A;  1X9S B;  4GCI A;  5B6N A;  3D4M A;  2MYG A;  3G9B A;  3L4N A;  1V98 A;  1X9W B;  5HFK A;  4YAP A;  2EIQ A;  3ME8 A;  4AJ6 A;  1OC3 A;  4V2L A;  1TP9 A;  4WXT A;  3A3T A;  3D4T A;  4NV2 A;  4KE3 A;  2GT6 A;  4ULX A;  2HLS A;  2CA8 A;  3WYW A;  1YY7 A;  17GS A;  1PA3 A;  2XPE A;  1V57 A;  2V32 A;  4MF6 A;  3BCK A;  5EL8 A;  5D9V A;  1YZX A;  2G2Q A;  2DJ1 A;  3G7Y A;  2ZUP A;  2CVD A;  2TRX A;  2O85 A;  1MDK A;  4MH3 A;  4KUN A;  1GTI A;  4G19 A;  2OE1 A;  1T3B A;  5E4W A;  4MK3 A;  3QDN A;  3C73 A;  2JU5 A;  2F9S A;  2IJY A;  4TKY A;  4PQH A;  3ERG A;  3GA4 A;  3UMA A;  2FA4 A;  2LNT A;  3WGX A;  5F05 A;  3O3T A;  2VCZ A;  2LJK A;  3EC3 A;  4G0I A;  1PSQ A;  5DBQ A;  2VO4 A;  1BED A;  5F06 A;  4NV5 A;  2VCX A;  4Q5Q A;  2VLT A;  4FYC A;  4XS4 A;  2IFQ B;  4F0B A;  5INY A;  5DAK A;  4HJ2 A;  2AJQ B;  3TKS E;  4EE0 A;  4LL1 B;  1QXH A;  3HY2 A;  3ZTL A;  2JAD A;  2WFC A;  4HJM A;  3VWV A;  2DIY A;  3C8E A;  2VM1 A;  3GST A;  1LU4 A;  4Z7X A;  2O89 A;  3PGT A;  5GST A;  1ABA A;  2AAW A;  1TU8 A;  2PBJ A;  4WR5 A;  1GSE A;  1PKZ A;  2M46 A;  3UEM A;  2HQT A;  1U87 A;  4J2F A;  1MD3 A;  1HQO A;  12GS A;  1S3C A;  1IYH A;  1PL1 A;  4HZ2 A;  2XC2 A;  5IQY A;  3DIE A;  3P8W A;  2FGX A;  5KN1 A;  1A0R P;  3FZ4 A;  1HNC A;  5G31 A;  2F3M A;  1JZO A;  2DIZ A;  3UJ1 A;  2OKA A;  2OE3 A;  2P5R A;  2K18 A;  2P31 A;  2CV4 A;  1OKD A;  4MPG A;  2H0H A;  1K0B A;  1B8X A;  2KP1 A;  1W4V A;  3W8S A;  1MDI A;  3BOA A;  2JZT A;  2CVK A;  4DSS B;  4TW5 A;  1GUM A;  4MZC A;  1R7H A;  3GKX A;  4K0N A;  3ZFB A;  2HNL A;  1F37 A;  5COH A;  3WD6 A;  5B8A A;  1SK2 A;  1OC9 B;  1GSS A;  1XVW A;  2H73 A;  3WGD A;  3A2V A;  5AN1 A;  1OVN A;  3H79 A;  1VF2 A;  1ZYE A;  1CQH A;  1DE1 A;  2XBQ A;  4K9Z A;  2WCI A;  3IOS A;  4K7O A;  2HZE B;  4IHU A;  1OKT A;  3MAK A;  3HKR A;  2RUF A;  1TOF A;  2KOK A;  3RHB A;  4KSM A;  4O32 A;  1W89 A;  2XPD A;  5JWO B;  4WF4 A;  4TR0 A;  2LJR A;  3C71 A;  2GZY A;  2IIY A;  2R2J A;  4OD7 A;  2I9H A;  2J23 A;  1FB6 A;  2FHE A;  1M9A A;  3KP8 A;  2E7P A;  4ECI A;  2C1Y A;  1XXU A;  1YKA A;  4ZB9 A;  1R5P A;  1AQV A;  1GSQ A;  1TRV A;  1Z3E A;  2B1K A;  5J41 A;  2IMD A;  1DUG A;  1TU7 A;  3TOT A;  1YJ6 A;  2JAC A;  4Q5F A;  5ABR A;  4Q5R A;  1K0N A;  4FYB A;  2DMM A;  1XFL A;  1TK0 B;  2H01 A;  1SYR A;  4K1F A;  4NXI A;  1GLQ A;  1KNG A;  1X5E A;  3R3E A;  3PIN A;  1ERU A;  4HUA A;  2QC7 A;  3W6G A;  1NSW A;  4EC0 A;  5GZZ B;  2HRK B;  3ZYW A;  4BPY A;  1U88 A;  2YP6 A;  3TJF A;  3VWW A;  3I69 A;  4KDU A;  2ON7 A;  2DJ3 A;  3LEF A;  2X8C A;  1GLP A;  4X0X A;  2KLX A;  3KP9 A;  4LLR A;  1Q98 A;  5J9C A;  1ZOF A;  3DVX A;  5JWR B;  2CAQ A;  2EC4 A;  2H74 A;  2F51 A;  1TXX A;  3QAG A;  2QSI A;  2GT5 A;  3GKM A;  4GLT A;  1AC1 A;  3L9V A;  1SK0 A;  10GS A;  5KN2 A;  3F3R A;  1B9Y C;  1PD2 1;  1NHO A;  4KCA A;  2H6Y A;  2UZ8 A;  1SJ6 A;  3F9U A;  4DVC A;  4FIW A;  3RPP A;  1X9M B;  3M3M A;  4GSN A;  2GS3 A;  1KBN A;  2LRC A;  4EDZ A;  1UN2 A;  3EWL A;  1O73 A;  5JCU A;  4HZ4 A;  3GFK A;  3HJP A;  1MDJ A;  5AIX A;  1ZCP A;  4RQR A;  2B5X A;  1G7E A;  2HI7 A;  2FUG 2;  2HE3 A;  2C0F A;  4F0C A;  4LMV A;  3H1N A;  1G7O A;  4OFN A;  1E2Y A;  2JSZ A;  1BX9 A;  4V1A p;  3A2W A;  5ECR B;  5FT3 A;  2FCH A;  1SU9 A;  3BJ5 A;  2WRT A;  5IMZ A;  4HOJ A;  4HQZ A;  4POM A;  3ZIV A;  3WT2 A;  5IOX A;  1GNE A;  2O87 A;  4ML6 A;  4EXJ A;  1PX7 A;  3FW2 A;  1JLV A;  1OAZ A;  2YOI A;  1J9B A;  2VCQ A;  4IP1 A;  3ZZX A;  2L5L A;  5D9X A;  1UVZ A;  3IXR A;  3DEX A;  4EVM A;  2PU9 C;  4PTS A;  4TVE A;  4MZB A;  1T7P B;  2VD1 A;  1A24 A;  2QKE A;  2H0I A;  4O5R A;  5HR3 A;  8GSS A;  2WUL A;  1M2D A;  4MH2 A;  2HRF A;  5G30 A;  1J0F A;  3LFL A;  4PXO A;  3H93 A;  2MMZ A;  5C00 A;  2JZR A;  2M80 A;  2NVL A;  3VI7 A;  3IA1 A;  4H86 A;  4HI7 A;  4GQC A;  5CRW A;  3TOU A;  3BCI A;  3RHC A;  1WRY A;  2VCT A;  4USS A;  3LXT A;  5AGY A;  5C04 A;  4BWS A;  2VD0 A;  1T4Y A;  4OCF A;  3I9V 2;  3AY8 A;  4ZBB A;  1XOA A;  1TW9 A;  1O81 A;  5JCW A;  1JHB A;  4PUF C;  1USB A;  3E9J B;  3HJO A;  3FY7 A;  4CW9 A;  5IMF A;  5IMC A;  4IQ1 A;  3EU3 A;  5ELG A;  2DML A;  5DQS A;  4KH7 A;  2B7J A;  2CZ2 A;  6GSW A;  1AW9 A;  1OE7 A;  2L4C A;  2N5F A;  4ZBD A;  4GTU A;  2B5Y A;  5IMV A;  2LUS A;  2YAN A;  3A2X A;  1R4W A;  1TRW A;  3HA9 A;  5CRG A;  1T8E B;  1YQ1 A;  2WJU A;  3CSJ A;  1XWC A;  3KCM A;  5H5R A;  4WKW A;  1TRU A;  2H0G A;  1BAY A;  1WE0 A;  1PX6 A;  2LNS A;  1GWC A;  4ZIJ A;  2HT9 A;  4XRD A;  1HNB A;  1V9W A;  1JZW A;  2BJX A;  3KH9 A;  1K3L A;  3EUR A;  1J08 A;  2IMK A;  2H75 A;  2IMI A;  1U3I A;  4D73 A;  1VF3 A;  5DQY A;  4ZL8 A;  3IK7 A;  3L9S A;  1XIY A;  1GUL A;  4J57 E;  4GF0 A;  2FD3 A;  1GNW A;  2LQQ A;  4KW6 A;  1WPI A;  1A23 A;  4RI6 A;  3TJB A;  3UAP A;  3I6A A;  4JR6 A;  3F4R A;  1Q4J A;  3I43 A;  3QFA C;  1SKW B;  4V1A g;  4MF7 A;  1F2E A;  1FHE A;  3GTU A;  2G0F A;  2NTO A;  2I81 A;  4ZL7 A;  4MLY A;  1ERT A;  11GS A;  3WGE A;  4N30 A;  1PL2 A;  4G0K A;  3P90 A;  4TOP A;  1VF1 A;  4QL7 A;  2C3N A;  1TK5 B;  1HD2 A;  2HSM A;  4IVF A;  1AQX A;  3H8Q A;  5G1K A;  5ECI B;  3ZMK A;  5DCG A;  2KHP A;  2F8A A;  4GSS A;  4BVY A;  3UOM A;  3F4S A;  5F07 A;  1NHY A;  3KZQ A;  2OAC A;  1LJR A;  1EGO A;  1A2M A;  3CRT A;  2RLI A;  4N0V A;  3UIW A;  3Q6O A;  2MBS A;  2YWN A;  4L8E A;  1FB0 A;  3KJY A;  1YF0 A;  4KF9 A;  2H6Z A;  5HR0 A;  1JZR A;  1Z7P A;  2LS5 A;  4NHW A;  2AHE A;  2H1D A;  4AJ8 A;  2HFD A;  2V6O A;  3VUR A;  1EV9 A; 
#chains in the Genus database with same CATH topology
 3ED3 A;  3U6V A;  4XCS A;  3LQ7 A;  1GL8 A;  4JZQ A;  5BRT A;  1ZYN A;  4QQ7 A;  3PPU A;  2DJ0 A;  3LJR A;  3VPQ A;  1WJK A;  4PUA A;  2ES7 A;  1GTU A;  2CZ3 A;  2YJH A;  2VLV A;  3GIX A;  2HSN A;  1UA5 A;  3EU4 A;  22GS A;  5ECK B;  1QQ2 A;  2K6V A;  1ZYQ B;  5IMD A;  5L71 A;  2GSR A;  5J4V A;  1FW1 A;  2C4J A;  1V58 A;  1QGV A;  2K8V A;  1RK4 A;  4CDO A;  1THO A;  4EF0 A;  2HRN A;  2WDU A;  2E0Q A;  1B4P A;  4IJI A;  4AKG A;  1SYX A;  4ZXG A;  3DWV A;  2LKU A;  5FHI A;  4AKH A;  3TJG A;  3LGC A;  5CP1 A;  1TTZ A;  2CAI A;  2PN8 A;  1WWJ A;  4O5Q A;  3GSS A;  3CQF A;  5DJM A;  2WVZ A;  2ZNM A;  5JCG A;  2NBS A;  1A8Y A;  1G6W A;  2GSS A;  2C3Q A;  3ZIT A;  2AB6 A;  4JBB A;  2YWI A;  5CO3 A;  1EP8 A;  4KB3 A;  1YDK A;  4OMV A;  3H4K A;  3PH9 A;  1PRX A;  4MAB A;  2NDO A;  3F3Q A;  2DJK A;  1SL2 B;  2RII A;  2OAD A;  5DDL A;  5ECS A;  3EMX A;  1ON4 A;  5B7C A;  3FR9 A;  2YN1 A;  2VM2 A;  3GUR A;  3SWL A;  3M9J A;  2HXK A;  5AIS A;  3KEB A;  4BL7 A;  3VWU A;  2OA7 A;  3TRQ A;  3U5R E;  2VAF A;  4RQX A;  1T4Z A;  2AUV A;  2YZH A;  2GSQ A;  2H71 A;  1F3A A;  4NPB A;  4G01 A;  5ECP B;  4TXO A;  5J5N A;  4EDY A;  2GQM A;  3IAS 2;  4BA7 A;  3QMX A;  3QD9 A;  1TI1 A;  4IP6 A;  3GRX A;  5HR2 A;  4Z2R A;  2C0G A;  2HZF A;  1CQG A;  4OCE A;  5KN3 A;  2FLS A;  2C0D A;  1ZL9 A;  5DAL A;  1R5A A;  5AIV A;  3ERF A;  1M9B A;  2P5Q A;  2C0E A;  2D2Z A;  4KX4 A;  4WBR D;  3LWA A;  1A2J A;  3D0Z A;  1A8L A;  1EEJ A;  3IRA A;  2ALB A;  1PQN A;  3HD5 A;  1DBY A;  4IN0 A;  1A0F A;  6GSY A;  3FMW A;  2GGT A;  2REM A;  1Z5Y E;  3ZFL A;  2VKZ G;  1FG4 A;  4NWY A;  2VCV A;  3Q18 A;  1TXU A;  1SKR B;  1TDI A;  2F8F A;  2GTU A;  3UVH A;  2LRT A;  2DC5 A;  3GX0 A;  1PMT A;  3FRC A;  5A4U A;  4MZW A;  2AYT A;  3TKS C;  1MTC A;  2FNO A;  3ME7 A;  3QCP A;  4ZB7 A;  1G0T A;  1T1V A;  3OR5 A;  4ZL9 A;  2RM5 A;  1AIU A;  5B8B A;  3P7X A;  2HYX A;  3CWG A;  3EIN A;  4I97 A;  4YH2 A;  3M9K A;  2CX4 A;  3DGQ A;  2RUE A;  4D73 B;  1X5D A;  3HVV A;  4OO5 A;  2FWF A;  2B6M A;  1EV4 A;  1ZMA A;  3GL3 A;  1YEP A;  3ZRE A;  4EKZ A;  5GAP D;  6GSU A;  2VLU A;  3IE3 A;  3FR6 A;  1SJI A;  3ERW A;  4AF2 A;  4PHZ C;  1GUH A;  2K9F A;  3GKK A;  4K0G A;  3BD2 A;  3TJK A;  3MYD A;  1OYJ A;  2N5B A;  3VLN A;  4MCU A;  2CQ9 A;  5JWQ B;  3M0F A;  2GLR A;  4L0W A;  4OWY A;  4CHS A;  4FQU A;  3TKS A;  3FR3 A;  3O76 A;  3F4T A;  3IBH A;  3FHK A;  2R6K A;  3HHV A;  5H5Q A;  4BVY B;  3HZ8 A;  3K8N A;  3RFR C;  5LD0 A;  2H6X A;  4PUR A;  3KD0 A;  2YCD A;  3E0U A;  3TB2 A;  4V2N A;  2R5G A;  4RUV A;  3KTL A;  2PPT A;  4XRA A;  3EMP A;  1OE8 A;  4YQU A;  1F3B A;  4JE1 A;  1K0A A;  4XS4 B;  1XZO A;  3HVS A;  1YEX A;  2IME A;  3F6F A;  5DAK B;  3IV4 A;  4W66 A;  5IO0 A;  1SL0 B;  1WIK A;  1THX A;  4POK A;  4O92 A;  3HXS A;  1SD8 A;  4G9H A;  4NMU A;  3NOF A;  1SVL A;  1SEN A;  1K3O A;  4IGJ A;  2A2S A;  3NZN A;  1EOG A;  1DSB A;  4OFT A;  2HSN B;  4FO5 A;  3DD3 A;  4IBP A;  1FO5 A;  4L5L A;  1O8W A;  4DSQ A;  3GMF A;  3QAV A;  2C3T A;  5G5E A;  4TXV A;  1V2A A;  2N5A A;  5IIZ A;  1FOV A;  1YF1 A;  3CXG A;  1XWG A;  4MJC A;  1OC9 A;  4CY6 A;  4XHM A;  1GRX A;  2K8S A;  3ISO A;  3QFB C;  3A5I A;  4Q5N A;  2HSY A;  1OC8 A;  3LOR A;  4IEL A;  1SVO A;  1B48 A;  4IKH A;  2XBI A;  3FZA A;  2V6K A;  2UV8 G;  2YZU A;  2L5O A;  3R2Q A;  5ECL B;  5CRD A;  4ZIL A;  2MMO A;  4POL A;  2IMF A;  4BVX A;  2H70 A;  4ID0 A;  1N8J A;  1Y25 A;  1EOH A;  5ELA A;  3UL3 A;  1PGT A;  2FA8 A;  3F6D A;  6GST A;  1XBS A;  2YJ7 A;  4P3Y B;  3ZVJ D;  1Z6M A;  2JZS A;  3TKQ A;  3CMI A;  4WET A;  1Y1U A;  3BBY A;  3L0H A;  5EVO A;  2IN3 A;  3APO A;  1QK8 A;  5ENU A;  5D9T A;  3KTB A;  4AJ7 A;  2GDR A;  4I8B A;  3JCM L;  4HEA 2;  2X64 A;  3LYK A;  4LMW A;  4AI6 A;  1EEM A;  5KEJ A;  3P2A A;  4ZB8 A;  4HDE A;  2H1L A;  4MP4 A;  1EGR A;  4BL7 B;  1XG8 A;  3EPT A;  4GQF A;  3MSZ A;  2PGT A;  5A5H A;  5G1L A;  1KTE A;  2R3X A;  2WW3 A;  4JR4 A;  3FKF A;  4NHZ A;  4TXO B;  5IM9 A;  4YAV A;  2L57 A;  4LL4 B;  3DML A;  4IS0 A;  5EPF A;  3LW9 A;  2I4A A;  4YKG A;  4L0U A;  2HSH A;  2O36 A;  4V2M A;  1ML6 A;  2JSY A;  1SL1 B;  2LST A;  2WB9 A;  3E3E A;  2YWM A;  3FZ5 A;  4FXY P;  3Q74 A;  4WR4 A;  2MZC A;  1K3Y A;  1K0O A;  2WZ9 A;  5A1N B;  2P0G A;  2IPA A;  4YKF A;  2OBK A;  1N2A A;  1BG1 A;  4N3Z A;  2X8G A;  2LTK A;  1TK8 B;  4EIQ A;  2CX3 A;  1S3A A;  2GZP A;  2YV7 A;  5DAL B;  5DJL A;  4PNF A;  3KMO A;  1R26 A;  5D9W A;  4F2I A;  4ZBA A;  3FYG A;  4ZB6 A;  1U6T A;  2Z9S A;  2YWO A;  3GH9 A;  1GUK A;  4QL9 A;  5KOX A;  2H30 A;  2OJL A;  4HQS A;  5J4U A;  3IDV A;  5ECN B;  2HRA A;  4FYU A;  3F0I A;  2IWT A;  1FVJ A;  4XTS A;  2DKH A;  6GSS A;  5EY6 A;  3UBL A;  1XVQ A;  3D22 A;  2MMN A;  1AUC A;  4EUY A;  5KN0 A;  5CAX A;  4NAX A;  2PER A;  4I2U A;  4TR4 A;  4F9Z A;  2OBI A;  5CYY A;  3QAW A;  1ZYP A;  3GYK A;  3TRX A;  1YKC A;  2I3Y A;  4IQA A;  1M99 A;  2GZZ A;  4YQM A;  2FY6 A;  3CTF A;  5D93 A;  3CSH A;  4G2E A;  4HU7 A;  1I9D A;  1B4Q A;  1RW1 A;  4ILF A;  1RQM A;  3UAR A;  2PVO C;  4KSO A;  3HJM A;  3VWX A;  1XW9 A;  4KDY A;  3UBK A;  2DLX A;  3TRP A;  5KOW A;  1I1I P;  1Z6N A;  2LEG A;  4JED A;  4X1U A;  3F8U A;  1UC7 A;  5CRE A;  5IPG A;  1XCC A;  2R37 A;  1XWK A;  1SJZ A;  2DJ2 A;  3CBU A;  1ILO A;  3RDW A;  5ID2 A;  3TKP A;  3D21 A;  5G2Z A;  2BTO T;  1JFU A;  2VL9 A;  4GDF A;  1ERW A;  4DEJ A;  5LCZ A;  3ZVJ A;  1NW2 A;  2H1A A;  4I2T A;  1GP1 A;  4IJ3 A;  2B7K A;  4IW9 A;  4KA0 A;  1BG5 A;  3C7M A;  3GNJ A;  2J9H A;  2FWH A;  1BJX A;  3CYN A;  3LSZ A;  1XWB A;  4PI0 C;  1DE2 A;  4K8M A;  1PN9 A;  3LXZ A;  3GN3 A;  1M3J A;  2WS2 A;  2CT6 A;  3KM6 A;  3IK9 A;  1ZGN A;  4BWQ A;  3RAZ A;  4FH8 A;  2FWG A;  2H76 A;  3GV1 A;  1URM A;  2DSA A;  1Y6E A;  3LYP A;  2TRC P;  4O7H A;  2X49 A;  1BYE A;  2YNX A;  3TKR A;  2WVX B;  4GWR A;  3TJJ A;  2KUC A;  4E8H A;  1TI3 A;  5DVB A;  3S9F A;  1SKS B;  1WOU A;  2V2G A;  2NPB A;  1GSF A;  4TRX A;  6GSX A;  3N9J A;  1QUW A;  5F8B A;  1JZD A;  3ZML A;  2CVB A;  5J47 A;  2LJA A;  4PQ1 A;  5D73 A;  4L5O A;  3L9U A;  3J7Y k;  4OFM A;  2H1G A;  3DKS A;  5G5F A;  1XOB A;  2WW0 A;  3M8N A;  19GS A;  3ZRD A;  2WVY A;  4LA1 A;  1F6M C;  3KH7 A;  2L59 A;  4CY8 A;  2ZCT A;  3QPM A;  2O7K A;  5HQP A;  4BVX B;  2BMX A;  2O3E A;  2LQO A;  4K6X A;  3A5W A;  1SK1 A;  3FZ9 A;  3J7Y b;  2YPM A;  2M72 A;  4KND A;  2C8U A;  3CTG A;  5A4V A;  3APQ A;  2B3S A;  1M2A A;  2H66 A;  4A5P A;  4TR1 A;  3PR8 A;  4WF5 A;  2MBT A;  1S3D A;  3ZIJ A;  1FVK A;  5A5K A;  4MA9 A;  4X4J A;  3NIV A;  3F63 A;  5F0G A;  5CNW A;  3UVT A;  5HR1 A;  2AV4 A;  4N11 A;  5B6M A;  3C1S A;  1B9X C;  2E2G A;  2GST A;  1G6Y A;  1K0D A;  4K7N A;  2WGR A;  9GSS A;  4AKI A;  4MJA A;  1X5C A;  1BF5 A;  1XW5 A;  13GS A;  5DCH A;  3MDK A;  1PKW A;  3CSI A;  2L6D A;  4ISD A;  1LBK A;  4I5Q A;  3IHG A;  4RI7 A;  3IPZ A;  1M2B A;  4MPF A;  3IC8 A;  3FK8 A;  3M1G A;  14GS A;  4PQI A;  3CRU A;  4MDC A;  4K2D A;  1E6B A;  3IAM 2;  2OT3 A;  2XHF A;  16GS A;  4WBJ A;  1SD9 A;  1X0R A;  3ZL5 A;  3KMN A;  4TN8 A;  5GAN D;  3N5O A;  4EL1 A;  4XS1 A;  4G10 A;  1Z9H A;  3V1W A;  4F82 A;  3EYT A;  1AXD A;  3MWH A;  5BMU A;  2QGV A;  4PNG A;  5ECO B;  2GQL A;  3GKN A;  4ECJ A;  2OE0 A;  4E8E A;  3TGZ A;  4PGT A;  4KAE A;  2B5E A;  4ICY A;  1TRS A;  1O8X A;  3TCO A;  3GTU B;  5HFG A;  4MMM A;  1U3A A;  3TUE A;  5J40 A;  5ECH B;  2IFQ A;  4HS1 A;  1WP0 A;  1GSY A;  3US3 A;  1V40 A;  18GS A;  5HFI A;  3HDC A;  4MJE A;  4XS6 A;  1KEB A;  2GQK A;  3IC4 A;  2MMA A;  3GUS A;  3VI5 A;  3D6I A;  2HSM B;  2ON5 A;  3G7I A;  1GSD A;  6GSV A;  7GSS A;  1A2L A;  3RBT A;  1QMV A;  5IMA A;  3IR4 A;  5J3R A;  1EZK A;  2FWE A;  4I6X A;  5CRH A;  1ACV A;  2L6C A;  2TIR A;  4Z2T A;  1ST9 A;  4N10 A;  4K7I A;  1XWA A;  3O6T A;  2KP2 A;  3KXO A;  2PUK C;  5D8I A;  1M7T A;  3VK9 A;  1O85 A;  5E59 A;  2PVQ A;  1I5G A;  1T00 A;  3TDG A;  2B1L A;  4POB A;  3W8J A;  4K5R A;  2H8L A;  4F03 A;  4N0Z A;  4ECC A;  1NM3 A;  3ZLP A;  1FAA A;  4GST A;  5ID2 B;  20GS A;  2JL4 A;  1C72 A;  1ERV A;  4ML1 A;  4ACS A;  1IYI A;  3VPT A;  1O6J A;  4PX1 A;  4DSS A;  1VRS D;  4AGS A;  3WT1 A;  2DBC A;  1VGL A;  4OO4 A;  1QFN A;  1TKD B;  1WMJ A;  4O5U A;  1ZZY A;  3G7J A;  4TR3 A;  4ECB A;  3EVI A;  3APS A;  1FOH A;  1GH2 A;  3FEU A;  2IL3 A;  3QOU A;  2VIM A;  2EFH A;  3QR6 A;  3KIJ A;  2R0G A;  5IO2 A;  5H5S A;  4DSR A;  4MJB A;  2YV9 A;  2A4V A;  1GSU A;  4JRR A;  2L4Q A;  2A2R A;  3MNG A;  1TJD A;  5GSS A;  2VOC A;  1F9M A;  3LG6 A;  4HU9 A;  4JU5 A;  1XW6 A;  5IPH A;  2VL2 C;  2HZE A;  3D5J A;  3DXB A;  5IOW A;  3HVX A;  1AQW A;  4J56 E;  3DVW A;  1MD4 A;  1BQ7 A;  2PWJ A;  4WEY A;  1H4O A;  1HNA A;  2R4V A;  3GL5 A;  1YVL A;  2O5V A;  3Q19 A;  2O8V B;  1M0U A;  2H1B A;  2EIR A;  5FWG A;  2EIO A;  3RPN A;  5ECM B;  2RM6 A;  3DRN A;  2VCW A;  3GH6 A;  1K0M A;  4EO3 A;  2H72 A;  2I1U A;  2LRN A;  4KCE A;  1H75 A;  1O7U A;  2X99 A;  3VFI A;  1Z7R A;  2EFD A;  3IHQ A;  1AAZ A;  4KGI A;  5D96 A;  2H19 A;  2V41 A;  1GTA A;  1EP7 A;  4XIH A;  3HYP A;  5J9B A;  2LV3 A;  1GTB A;  4YQV A;  5A4W A;  1XPV A;  5ECQ B;  3C1R A;  1JLW A;  3GX8 A;  2VL2 A;  2VL3 A;  3DYR A;  3HCZ A;  2VUP A;  2PMT A;  5LNK e;  2HRK A;  2DKI A;  2E2M A;  4MF5 A;  3HZ4 A;  4Z2U A;  1VF4 A;  3KGK A;  1MEK A;  3GHA A;  1HYU A;  3L78 A;  4GRF A;  2GVP A;  2DJJ A;  2X8H A;  4GXZ A;  1K0C A;  2V1M A;  4KDX A;  1EWX A;  4TR1 B;  3SBC A;  4G0L A;  3EE2 A;  2C80 A;  4X43 A;  1X9S B;  4GCI A;  5B6N A;  3D4M A;  2MYG A;  3G9B A;  3L4N A;  1V98 A;  1X9W B;  5HFK A;  4YAP A;  2EIQ A;  3ME8 A;  4AJ6 A;  1OC3 A;  4V2L A;  1TP9 A;  4WXT A;  4BIK A;  3A3T A;  3D4T A;  4NV2 A;  4KE3 A;  2GT6 A;  3HVN A;  4ULX A;  2HLS A;  2CA8 A;  3WYW A;  1YY7 A;  17GS A;  1PA3 A;  2XPE A;  1V57 A;  2V32 A;  4MF6 A;  3BCK A;  5EL8 A;  5D9V A;  1YZX A;  2G2Q A;  2DJ1 A;  3G7Y A;  2ZUP A;  1N25 A;  2CVD A;  2TRX A;  2O85 A;  1S4B P;  1MDK A;  4MH3 A;  4KUN A;  1GTI A;  4G19 A;  2OE1 A;  1T3B A;  5E4W A;  4MK3 A;  3QDN A;  3C73 A;  2JU5 A;  2F9S A;  2IJY A;  4TKY A;  4PQH A;  2QA2 A;  3ERG A;  3GA4 A;  3UMA A;  2FA4 A;  2LNT A;  3WGX A;  5F05 A;  3O3T A;  2VCZ A;  2LJK A;  3EC3 A;  4G0I A;  1PSQ A;  5DBQ A;  2VO4 A;  1BED A;  5F06 A;  4NV5 A;  2VCX A;  4Q5Q A;  2VLT A;  4FYC A;  4XS4 A;  2IFQ B;  4F0B A;  5INY A;  5DAK A;  4HJ2 A;  2A4H A;  2AJQ B;  3TKS E;  4EE0 A;  4LL1 B;  1QXH A;  3HY2 A;  3ZTL A;  2JAD A;  2WFC A;  4HJM A;  3VWV A;  2DIY A;  3C8E A;  2VM1 A;  3GST A;  1LU4 A;  4Z7X A;  1PFO A;  2O89 A;  3PGT A;  5GST A;  1ABA A;  2AAW A;  1TU8 A;  2PBJ A;  4WR5 A;  2QA1 A;  4PI2 C;  1GSE A;  1PKZ A;  2M46 A;  3UEM A;  2HQT A;  1U87 A;  4J2F A;  3HMJ G;  1MD3 A;  1HQO A;  12GS A;  1S3C A;  1IYH A;  1PL1 A;  4HZ2 A;  2XC2 A;  5IQY A;  3DIE A;  3P8W A;  2FGX A;  5KN1 A;  4K2X A;  1A0R P;  3FZ4 A;  1HNC A;  5G31 A;  2F3M A;  1JZO A;  2DIZ A;  3UJ1 A;  2OKA A;  2OE3 A;  2R0P A;  2P5R A;  2K18 A;  2P31 A;  2CV4 A;  1OKD A;  4MPG A;  2H0H A;  1K0B A;  1B8X A;  2KP1 A;  1W4V A;  3W8S A;  3BOA A;  1MDI A;  2JZT A;  2CVK A;  4DSS B;  4TW5 A;  1GUM A;  4MZC A;  1R7H A;  3GKX A;  4K0N A;  3ZFB A;  2HNL A;  1F37 A;  5COH A;  3WD6 A;  5B8A A;  1SK2 A;  1OC9 B;  1GSS A;  1XVW A;  2H73 A;  3WGD A;  3A2V A;  5AN1 A;  1OVN A;  3H79 A;  2WZS A;  1VF2 A;  1ZYE A;  1CQH A;  1DE1 A;  2XBQ A;  4K9Z A;  2WCI A;  3IOS A;  4K7O A;  2HZE B;  4IHU A;  1OKT A;  3MAK A;  3HKR A;  2RUF A;  1TOF A;  2KOK A;  3RHB A;  4KSM A;  4O32 A;  1W89 A;  4EIP A;  2XPD A;  5JWO B;  4WF4 A;  4TR0 A;  2LJR A;  3C71 A;  2GZY A;  2IIY A;  2R2J A;  4OD7 A;  2I9H A;  2J23 A;  1FB6 A;  2FHE A;  1M9A A;  3KP8 A;  2E7P A;  4ECI A;  2C1Y A;  1XXU A;  1YKA A;  4ZB9 A;  1R5P A;  1AQV A;  5A1N A;  1GSQ A;  1TRV A;  1Z3E A;  2B1K A;  5J41 A;  2IMD A;  1DUG A;  1TU7 A;  3TOT A;  1YJ6 A;  2JAC A;  4Q5F A;  5ABR A;  4Q5R A;  3MIX A;  1K0N A;  4E68 A;  4FYB A;  2DMM A;  1XFL A;  1TK0 B;  5A5H B;  2H01 A;  1SYR A;  4K1F A;  4NXI A;  1GLQ A;  1KNG A;  1X5E A;  3R3E A;  3PIN A;  1ERU A;  4HUA A;  2QC7 A;  3W6G A;  1NSW A;  4EC0 A;  5GZZ B;  2HRK B;  3ZYW A;  4BPY A;  1U88 A;  2YP6 A;  3TJF A;  3VWW A;  3I69 A;  4KDU A;  2ON7 A;  2DJ3 A;  3LEF A;  2X8C A;  1GLP A;  4X0X A;  2KLX A;  3KP9 A;  4LLR A;  5A34 A;  1Q98 A;  5J9C A;  1ZOF A;  3DVX A;  5JWR B;  3CHX C;  2CAQ A;  2EC4 A;  2A2P A;  2H74 A;  2F51 A;  1TXX A;  3QAG A;  2QSI A;  2GT5 A;  3GKM A;  4GLT A;  1AC1 A;  3L9V A;  1SK0 A;  10GS A;  5KN2 A;  2R0C A;  3F3R A;  1B9Y C;  1PD2 1;  1S3R A;  1NHO A;  4KCA A;  2H6Y A;  2UZ8 A;  1SJ6 A;  3F9U A;  4DVC A;  4FIW A;  3RPP A;  1X9M B;  3M3M A;  4GSN A;  2GS3 A;  1KBN A;  2LRC A;  4EDZ A;  1UN2 A;  3EWL A;  1O73 A;  5JCU A;  2WW2 A;  4HZ4 A;  3GFK A;  5J4Y A;  3HJP A;  1MDJ A;  5AIX A;  1ZCP A;  4RQR A;  2B5X A;  1G7E A;  2HI7 A;  2FUG 2;  2HE3 A;  2C0F A;  4F0C A;  4LMV A;  4HSC X;  3H1N A;  2X4A A;  1G7O A;  4OFN A;  1E2Y A;  2JSZ A;  1BX9 A;  4V1A p;  3A2W A;  5ECR B;  5FT3 A;  2FCH A;  1SU9 A;  3BJ5 A;  2WRT A;  5IMZ A;  4HOJ A;  4HQZ A;  4POM A;  3ZIV A;  3WT2 A;  5IOX A;  1GNE A;  2O87 A;  4ML6 A;  4EXJ A;  1PX7 A;  3FW2 A;  1JLV A;  1OAZ A;  2YOI A;  1J9B A;  2VCQ A;  2WVX A;  4IP1 A;  3ZZX A;  2L5L A;  5D9X A;  1UVZ A;  3IXR A;  3DEX A;  4EVM A;  2PU9 C;  4PTS A;  4TVE A;  4MZB A;  1T7P B;  2VD1 A;  1A24 A;  2QKE A;  2H0I A;  4O5R A;  5HR3 A;  8GSS A;  2WUL A;  1M2D A;  4MH2 A;  2HRF A;  4MNN A;  5G30 A;  2EFE A;  3LFL A;  1J0F A;  4PXO A;  3H93 A;  2MMZ A;  5C00 A;  2JZR A;  2M80 A;  2NVL A;  3VI7 A;  3IA1 A;  4H86 A;  4HI7 A;  4GQC A;  5CRW A;  3TOU A;  3BCI A;  3RHC A;  3TU3 B;  1WRY A;  2VCT A;  4USS A;  3LXT A;  5AGY A;  5C04 A;  4BWS A;  2VD0 A;  1T4Y A;  4OCF A;  3RGB C;  3I9V 2;  3AY8 A;  4ZBB A;  1XOA A;  1TW9 A;  1O81 A;  5JCW A;  1JHB A;  4PUF C;  1USB A;  3E9J B;  3HJO A;  3FY7 A;  4CW9 A;  5IMF A;  5IMC A;  4IQ1 A;  3EU3 A;  5ELG A;  2DML A;  5DQS A;  4AKX B;  4KH7 A;  2B7J A;  2CZ2 A;  6GSW A;  1AW9 A;  1OE7 A;  2L4C A;  2N5F A;  4ZBD A;  4GTU A;  2B5Y A;  5IMV A;  2LUS A;  2YAN A;  3A2X A;  1R4W A;  1TRW A;  3HA9 A;  5CRG A;  1T8E B;  1YQ1 A;  2WJU A;  3CSJ A;  1SVM A;  1XWC A;  3KCM A;  5H5R A;  4WKW A;  1TRU A;  2H0G A;  1BAY A;  1WE0 A;  1PX6 A;  2LNS A;  1GWC A;  4ZIJ A;  2HT9 A;  4XRD A;  4K5S A;  1HNB A;  1V9W A;  1JZW A;  2BJX A;  3KH9 A;  1K3L A;  3EUR A;  1J08 A;  2IMK A;  2H75 A;  2IMI A;  1U3I A;  4D73 A;  1VF3 A;  5DQY A;  4ZL8 A;  3IK7 A;  3L9S A;  1XIY A;  1GUL A;  4J57 E;  4GF0 A;  2FD3 A;  1GNW A;  2LQQ A;  4KW6 A;  1WPI A;  4QMK A;  1A23 A;  4RI6 A;  3TJB A;  3UAP A;  3I6A A;  4JR6 A;  3F4R A;  1Q4J A;  3I43 A;  3QFA C;  1SKW B;  4V1A g;  4MF7 A;  1F2E A;  1FHE A;  3GTU A;  2G0F A;  2NTO A;  2WW1 A;  2I81 A;  4ZL7 A;  4MLY A;  1ERT A;  11GS A;  1PN0 A;  3WGE A;  4N30 A;  1PL2 A;  1M3I A;  4G0K A;  3P90 A;  4TOP A;  1VF1 A;  4QL7 A;  1YEW C;  2C3N A;  1TK5 B;  1HD2 A;  2HSM A;  4IVF A;  1AQX A;  3H8Q A;  5G1K A;  5ECI B;  3ZMK A;  5DCG A;  2KHP A;  2EFC A;  5BMU B;  2F8A A;  4GSS A;  4BVY A;  3UOM A;  3F4S A;  5F07 A;  1NHY A;  3KZQ A;  2OAC A;  1LJR A;  5A34 B;  1EGO A;  1A2M A;  3CRT A;  2RLI A;  4N0V A;  3UIW A;  3Q6O A;  2MBS A;  2YWN A;  4L8E A;  1FB0 A;  3KJY A;  1YF0 A;  4KF9 A;  2H6Z A;  5HR0 A;  1JZR A;  1Z7P A;  2LS5 A;  4NHW A;  2AHE A;  2H1D A;  4AJ8 A;  2HFD A;  2V6O A;  3VUR A;  1EV9 A; 
#chains in the Genus database with same CATH homology
 3ED3 A;  3U6V A;  4XCS A;  3LQ7 A;  1GL8 A;  4JZQ A;  5BRT A;  1ZYN A;  4QQ7 A;  3PPU A;  2DJ0 A;  3LJR A;  3VPQ A;  1WJK A;  4PUA A;  2ES7 A;  1GTU A;  2CZ3 A;  2YJH A;  2VLV A;  3GIX A;  2HSN A;  1UA5 A;  3EU4 A;  22GS A;  5ECK B;  1QQ2 A;  2K6V A;  1ZYQ B;  5IMD A;  5L71 A;  2GSR A;  5J4V A;  1FW1 A;  2C4J A;  1V58 A;  1QGV A;  2K8V A;  1RK4 A;  4CDO A;  1THO A;  4EF0 A;  2HRN A;  2WDU A;  2E0Q A;  1B4P A;  4IJI A;  4AKG A;  1SYX A;  4ZXG A;  3DWV A;  2LKU A;  5FHI A;  4AKH A;  3TJG A;  3LGC A;  5CP1 A;  1TTZ A;  2CAI A;  2PN8 A;  1WWJ A;  4O5Q A;  3GSS A;  5DJM A;  2ZNM A;  5JCG A;  2NBS A;  1A8Y A;  1G6W A;  2GSS A;  2C3Q A;  3ZIT A;  2AB6 A;  4JBB A;  2YWI A;  5CO3 A;  1EP8 A;  4KB3 A;  1YDK A;  4OMV A;  3H4K A;  3PH9 A;  1PRX A;  4MAB A;  2NDO A;  3F3Q A;  2DJK A;  1SL2 B;  2RII A;  2OAD A;  5DDL A;  5ECS A;  3EMX A;  1ON4 A;  5B7C A;  3FR9 A;  2YN1 A;  2VM2 A;  3GUR A;  3SWL A;  3M9J A;  2HXK A;  5AIS A;  3KEB A;  4BL7 A;  3VWU A;  2OA7 A;  3TRQ A;  3U5R E;  2VAF A;  4RQX A;  1T4Z A;  2AUV A;  2YZH A;  2GSQ A;  2H71 A;  1F3A A;  4NPB A;  4G01 A;  5ECP B;  4TXO A;  5J5N A;  4EDY A;  2GQM A;  3IAS 2;  4BA7 A;  3QMX A;  3QD9 A;  1TI1 A;  4IP6 A;  3GRX A;  5HR2 A;  4Z2R A;  2C0G A;  2HZF A;  1CQG A;  4OCE A;  5KN3 A;  2FLS A;  2C0D A;  1ZL9 A;  5DAL A;  1R5A A;  5AIV A;  3ERF A;  1M9B A;  2P5Q A;  2C0E A;  2D2Z A;  4KX4 A;  4WBR D;  3LWA A;  1A2J A;  3D0Z A;  1A8L A;  1EEJ A;  3IRA A;  2ALB A;  1PQN A;  3HD5 A;  1DBY A;  4IN0 A;  1A0F A;  6GSY A;  3FMW A;  2GGT A;  2REM A;  1Z5Y E;  3ZFL A;  2VKZ G;  1FG4 A;  4NWY A;  2VCV A;  3Q18 A;  1TXU A;  1SKR B;  1TDI A;  2F8F A;  2GTU A;  3UVH A;  2LRT A;  2DC5 A;  3GX0 A;  1PMT A;  3FRC A;  5A4U A;  4MZW A;  2AYT A;  3TKS C;  1MTC A;  2FNO A;  3ME7 A;  3QCP A;  4ZB7 A;  1G0T A;  1T1V A;  3OR5 A;  4ZL9 A;  2RM5 A;  1AIU A;  5B8B A;  3P7X A;  2HYX A;  3CWG A;  3EIN A;  4I97 A;  4YH2 A;  3M9K A;  2CX4 A;  3DGQ A;  2RUE A;  4D73 B;  1X5D A;  3HVV A;  4OO5 A;  2FWF A;  2B6M A;  1EV4 A;  1ZMA A;  3GL3 A;  1YEP A;  3ZRE A;  4EKZ A;  5GAP D;  6GSU A;  2VLU A;  3IE3 A;  3FR6 A;  1SJI A;  3ERW A;  4AF2 A;  1GUH A;  2K9F A;  3GKK A;  4K0G A;  3BD2 A;  3TJK A;  3MYD A;  1OYJ A;  2N5B A;  3VLN A;  4MCU A;  2CQ9 A;  5JWQ B;  3M0F A;  2GLR A;  4L0W A;  4OWY A;  4CHS A;  4FQU A;  3TKS A;  3FR3 A;  3O76 A;  3F4T A;  3IBH A;  3FHK A;  2R6K A;  3HHV A;  5H5Q A;  4BVY B;  3HZ8 A;  3K8N A;  5LD0 A;  2H6X A;  4PUR A;  3KD0 A;  2YCD A;  3E0U A;  3TB2 A;  4V2N A;  2R5G A;  4RUV A;  3KTL A;  2PPT A;  4XRA A;  3EMP A;  1OE8 A;  4YQU A;  1F3B A;  4JE1 A;  1K0A A;  4XS4 B;  1XZO A;  3HVS A;  1YEX A;  2IME A;  3F6F A;  5DAK B;  3IV4 A;  4W66 A;  5IO0 A;  1SL0 B;  1WIK A;  1THX A;  4POK A;  4O92 A;  3HXS A;  1SD8 A;  4G9H A;  4NMU A;  3NOF A;  1SVL A;  1SEN A;  1K3O A;  4IGJ A;  2A2S A;  3NZN A;  1EOG A;  1DSB A;  4OFT A;  2HSN B;  4FO5 A;  3DD3 A;  4IBP A;  1FO5 A;  4L5L A;  1O8W A;  4DSQ A;  3GMF A;  3QAV A;  2C3T A;  5G5E A;  4TXV A;  1V2A A;  2N5A A;  5IIZ A;  1FOV A;  1YF1 A;  3CXG A;  1XWG A;  4MJC A;  1OC9 A;  4CY6 A;  4XHM A;  1GRX A;  2K8S A;  3ISO A;  3QFB C;  3A5I A;  4Q5N A;  2HSY A;  1OC8 A;  3LOR A;  4IEL A;  1SVO A;  1B48 A;  4IKH A;  2XBI A;  3FZA A;  2V6K A;  2UV8 G;  2YZU A;  2L5O A;  3R2Q A;  5ECL B;  5CRD A;  4ZIL A;  2MMO A;  4POL A;  2IMF A;  4BVX A;  2H70 A;  4ID0 A;  1N8J A;  1Y25 A;  1EOH A;  5ELA A;  3UL3 A;  1PGT A;  2FA8 A;  3F6D A;  6GST A;  1XBS A;  2YJ7 A;  4P3Y B;  3ZVJ D;  1Z6M A;  2JZS A;  3TKQ A;  3CMI A;  4WET A;  1Y1U A;  3BBY A;  3L0H A;  5EVO A;  2IN3 A;  3APO A;  1QK8 A;  5ENU A;  5D9T A;  3KTB A;  4AJ7 A;  2GDR A;  4I8B A;  3JCM L;  4HEA 2;  2X64 A;  3LYK A;  4LMW A;  4AI6 A;  1EEM A;  5KEJ A;  3P2A A;  4ZB8 A;  4HDE A;  2H1L A;  4MP4 A;  1EGR A;  4BL7 B;  3EPT A;  4GQF A;  3MSZ A;  2PGT A;  5A5H A;  5G1L A;  1KTE A;  2R3X A;  4JR4 A;  3FKF A;  4NHZ A;  4TXO B;  5IM9 A;  4YAV A;  2L57 A;  4LL4 B;  3DML A;  4IS0 A;  5EPF A;  3LW9 A;  2I4A A;  4YKG A;  4L0U A;  2HSH A;  4V2M A;  1ML6 A;  2JSY A;  1SL1 B;  2LST A;  2WB9 A;  3E3E A;  2YWM A;  3FZ5 A;  3Q74 A;  4WR4 A;  2MZC A;  1K3Y A;  1K0O A;  2WZ9 A;  5A1N B;  2P0G A;  2IPA A;  4YKF A;  2OBK A;  1N2A A;  1BG1 A;  4N3Z A;  2X8G A;  2LTK A;  1TK8 B;  4EIQ A;  2CX3 A;  1S3A A;  2GZP A;  2YV7 A;  5DAL B;  5DJL A;  4PNF A;  3KMO A;  1R26 A;  5D9W A;  4F2I A;  4ZBA A;  3FYG A;  4ZB6 A;  1U6T A;  2Z9S A;  2YWO A;  3GH9 A;  1GUK A;  4QL9 A;  5KOX A;  2H30 A;  2OJL A;  4HQS A;  5J4U A;  3IDV A;  5ECN B;  2HRA A;  4FYU A;  3F0I A;  2IWT A;  1FVJ A;  4XTS A;  2DKH A;  6GSS A;  5EY6 A;  3UBL A;  1XVQ A;  3D22 A;  2MMN A;  1AUC A;  4EUY A;  5KN0 A;  5CAX A;  4NAX A;  2PER A;  4I2U A;  4TR4 A;  4F9Z A;  2OBI A;  5CYY A;  3QAW A;  1ZYP A;  3GYK A;  3TRX A;  1YKC A;  2I3Y A;  4IQA A;  1M99 A;  2GZZ A;  4YQM A;  2FY6 A;  3CTF A;  5D93 A;  3CSH A;  4G2E A;  4HU7 A;  1I9D A;  1B4Q A;  1RW1 A;  4ILF A;  1RQM A;  3UAR A;  2PVO C;  4KSO A;  3HJM A;  3VWX A;  1XW9 A;  4KDY A;  3UBK A;  2DLX A;  3TRP A;  5KOW A;  1Z6N A;  2LEG A;  4JED A;  4X1U A;  3F8U A;  1UC7 A;  5CRE A;  5IPG A;  1XCC A;  2R37 A;  1XWK A;  1SJZ A;  2DJ2 A;  3CBU A;  1ILO A;  3RDW A;  5ID2 A;  3TKP A;  3D21 A;  5G2Z A;  2BTO T;  1JFU A;  2VL9 A;  4GDF A;  1ERW A;  4DEJ A;  5LCZ A;  3ZVJ A;  1NW2 A;  2H1A A;  4I2T A;  1GP1 A;  4IJ3 A;  2B7K A;  4IW9 A;  4KA0 A;  1BG5 A;  3C7M A;  3GNJ A;  2J9H A;  2FWH A;  1BJX A;  3CYN A;  3LSZ A;  1XWB A;  1DE2 A;  4K8M A;  1PN9 A;  3LXZ A;  3GN3 A;  2WS2 A;  2CT6 A;  3KM6 A;  3IK9 A;  1ZGN A;  4BWQ A;  3RAZ A;  4FH8 A;  2FWG A;  2H76 A;  3GV1 A;  1URM A;  2DSA A;  1Y6E A;  3LYP A;  2TRC P;  4O7H A;  2X49 A;  1BYE A;  2YNX A;  3TKR A;  4GWR A;  3TJJ A;  2KUC A;  4E8H A;  1TI3 A;  5DVB A;  3S9F A;  1SKS B;  1WOU A;  2V2G A;  2NPB A;  1GSF A;  4TRX A;  6GSX A;  3N9J A;  1QUW A;  5F8B A;  1JZD A;  3ZML A;  2CVB A;  5J47 A;  2LJA A;  4PQ1 A;  5D73 A;  4L5O A;  3L9U A;  3J7Y k;  4OFM A;  2H1G A;  3DKS A;  5G5F A;  1XOB A;  3M8N A;  19GS A;  3ZRD A;  4LA1 A;  1F6M C;  3KH7 A;  2L59 A;  4CY8 A;  2ZCT A;  3QPM A;  2O7K A;  5HQP A;  4BVX B;  2BMX A;  2LQO A;  4K6X A;  3A5W A;  1SK1 A;  3FZ9 A;  3J7Y b;  2YPM A;  2M72 A;  4KND A;  2C8U A;  3CTG A;  5A4V A;  3APQ A;  2B3S A;  1M2A A;  2H66 A;  4A5P A;  4TR1 A;  3PR8 A;  4WF5 A;  2MBT A;  1S3D A;  3ZIJ A;  1FVK A;  5A5K A;  4MA9 A;  4X4J A;  3NIV A;  3F63 A;  5F0G A;  5CNW A;  3UVT A;  5HR1 A;  2AV4 A;  4N11 A;  5B6M A;  3C1S A;  1B9X C;  2E2G A;  2GST A;  1G6Y A;  1K0D A;  4K7N A;  2WGR A;  9GSS A;  4AKI A;  4MJA A;  1X5C A;  1BF5 A;  1XW5 A;  13GS A;  5DCH A;  3MDK A;  1PKW A;  3CSI A;  2L6D A;  4ISD A;  1LBK A;  4I5Q A;  3IHG A;  4RI7 A;  3IPZ A;  1M2B A;  4MPF A;  3IC8 A;  3FK8 A;  3M1G A;  14GS A;  4PQI A;  3CRU A;  4MDC A;  4K2D A;  1E6B A;  3IAM 2;  2OT3 A;  2XHF A;  16GS A;  4WBJ A;  1SD9 A;  1X0R A;  3ZL5 A;  3KMN A;  4TN8 A;  5GAN D;  3N5O A;  4EL1 A;  4XS1 A;  4G10 A;  1Z9H A;  3V1W A;  4F82 A;  3EYT A;  1AXD A;  3MWH A;  5BMU A;  2QGV A;  4PNG A;  5ECO B;  2GQL A;  3GKN A;  4ECJ A;  2OE0 A;  4E8E A;  3TGZ A;  4PGT A;  4KAE A;  2B5E A;  4ICY A;  1TRS A;  1O8X A;  3TCO A;  3GTU B;  5HFG A;  4MMM A;  1U3A A;  3TUE A;  5J40 A;  5ECH B;  2IFQ A;  4HS1 A;  1WP0 A;  1GSY A;  3US3 A;  1V40 A;  18GS A;  5HFI A;  3HDC A;  4MJE A;  4XS6 A;  1KEB A;  2GQK A;  3IC4 A;  2MMA A;  3GUS A;  3VI5 A;  3D6I A;  2HSM B;  2ON5 A;  3G7I A;  1GSD A;  6GSV A;  7GSS A;  1A2L A;  3RBT A;  1QMV A;  5IMA A;  3IR4 A;  5J3R A;  1EZK A;  2FWE A;  4I6X A;  5CRH A;  1ACV A;  2L6C A;  2TIR A;  4Z2T A;  1ST9 A;  4N10 A;  4K7I A;  1XWA A;  3O6T A;  2KP2 A;  3KXO A;  2PUK C;  5D8I A;  1M7T A;  3VK9 A;  1O85 A;  5E59 A;  2PVQ A;  1I5G A;  1T00 A;  3TDG A;  2B1L A;  4POB A;  3W8J A;  4K5R A;  2H8L A;  4F03 A;  4N0Z A;  4ECC A;  1NM3 A;  3ZLP A;  1FAA A;  4GST A;  5ID2 B;  20GS A;  2JL4 A;  1C72 A;  1ERV A;  4ML1 A;  4ACS A;  1IYI A;  3VPT A;  1O6J A;  4PX1 A;  4DSS A;  1VRS D;  4AGS A;  3WT1 A;  2DBC A;  1VGL A;  4OO4 A;  1QFN A;  1TKD B;  1WMJ A;  4O5U A;  1ZZY A;  3G7J A;  4TR3 A;  4ECB A;  3EVI A;  3APS A;  1FOH A;  1GH2 A;  3FEU A;  2IL3 A;  3QOU A;  2VIM A;  2EFH A;  3QR6 A;  3KIJ A;  2R0G A;  5IO2 A;  5H5S A;  4DSR A;  4MJB A;  2YV9 A;  2A4V A;  1GSU A;  4JRR A;  2L4Q A;  2A2R A;  3MNG A;  1TJD A;  5GSS A;  2VOC A;  1F9M A;  3LG6 A;  4HU9 A;  4JU5 A;  1XW6 A;  5IPH A;  2VL2 C;  2HZE A;  3D5J A;  3DXB A;  5IOW A;  3HVX A;  1AQW A;  4J56 E;  3DVW A;  1MD4 A;  1BQ7 A;  2PWJ A;  4WEY A;  1H4O A;  1HNA A;  2R4V A;  3GL5 A;  1YVL A;  2O5V A;  3Q19 A;  2O8V B;  1M0U A;  2H1B A;  2EIR A;  5FWG A;  2EIO A;  3RPN A;  5ECM B;  2RM6 A;  3DRN A;  2VCW A;  3GH6 A;  1K0M A;  4EO3 A;  2H72 A;  2I1U A;  2LRN A;  4KCE A;  1H75 A;  1O7U A;  2X99 A;  3VFI A;  1Z7R A;  2EFD A;  3IHQ A;  1AAZ A;  4KGI A;  5D96 A;  2H19 A;  2V41 A;  1GTA A;  1EP7 A;  4XIH A;  3HYP A;  5J9B A;  2LV3 A;  1GTB A;  4YQV A;  5A4W A;  1XPV A;  5ECQ B;  3C1R A;  1JLW A;  3GX8 A;  2VL2 A;  2VL3 A;  3DYR A;  3HCZ A;  2VUP A;  2PMT A;  5LNK e;  2HRK A;  2DKI A;  2E2M A;  4MF5 A;  3HZ4 A;  4Z2U A;  1VF4 A;  3KGK A;  1MEK A;  3GHA A;  1HYU A;  3L78 A;  4GRF A;  2GVP A;  2DJJ A;  2X8H A;  4GXZ A;  1K0C A;  2V1M A;  4KDX A;  1EWX A;  4TR1 B;  3SBC A;  4G0L A;  3EE2 A;  2C80 A;  4X43 A;  1X9S B;  4GCI A;  5B6N A;  3D4M A;  2MYG A;  3G9B A;  3L4N A;  1V98 A;  1X9W B;  5HFK A;  4YAP A;  2EIQ A;  3ME8 A;  4AJ6 A;  1OC3 A;  4V2L A;  1TP9 A;  4WXT A;  3A3T A;  3D4T A;  4NV2 A;  4KE3 A;  2GT6 A;  4ULX A;  2HLS A;  2CA8 A;  3WYW A;  1YY7 A;  17GS A;  1PA3 A;  2XPE A;  1V57 A;  2V32 A;  4MF6 A;  3BCK A;  5EL8 A;  5D9V A;  1YZX A;  2G2Q A;  2DJ1 A;  3G7Y A;  2ZUP A;  1N25 A;  2CVD A;  2TRX A;  2O85 A;  1MDK A;  4MH3 A;  4KUN A;  1GTI A;  4G19 A;  2OE1 A;  1T3B A;  5E4W A;  4MK3 A;  3QDN A;  3C73 A;  2JU5 A;  2F9S A;  2IJY A;  4TKY A;  4PQH A;  2QA2 A;  3ERG A;  3GA4 A;  3UMA A;  2FA4 A;  2LNT A;  3WGX A;  5F05 A;  3O3T A;  2VCZ A;  2LJK A;  3EC3 A;  4G0I A;  1PSQ A;  5DBQ A;  2VO4 A;  1BED A;  5F06 A;  4NV5 A;  2VCX A;  4Q5Q A;  2VLT A;  4FYC A;  4XS4 A;  2IFQ B;  4F0B A;  5INY A;  5DAK A;  4HJ2 A;  2A4H A;  2AJQ B;  3TKS E;  4EE0 A;  4LL1 B;  1QXH A;  3HY2 A;  3ZTL A;  2JAD A;  2WFC A;  4HJM A;  3VWV A;  2DIY A;  3C8E A;  2VM1 A;  3GST A;  1LU4 A;  4Z7X A;  2O89 A;  3PGT A;  5GST A;  1ABA A;  2AAW A;  1TU8 A;  2PBJ A;  4WR5 A;  2QA1 A;  1GSE A;  1PKZ A;  2M46 A;  3UEM A;  2HQT A;  1U87 A;  4J2F A;  3HMJ G;  1MD3 A;  1HQO A;  12GS A;  1S3C A;  1IYH A;  1PL1 A;  4HZ2 A;  2XC2 A;  5IQY A;  3DIE A;  3P8W A;  2FGX A;  5KN1 A;  4K2X A;  1A0R P;  3FZ4 A;  1HNC A;  5G31 A;  2F3M A;  1JZO A;  2DIZ A;  3UJ1 A;  2OKA A;  2OE3 A;  2R0P A;  2P5R A;  2K18 A;  2P31 A;  2CV4 A;  1OKD A;  4MPG A;  2H0H A;  1K0B A;  1B8X A;  2KP1 A;  1W4V A;  3W8S A;  3BOA A;  1MDI A;  2JZT A;  2CVK A;  4DSS B;  4TW5 A;  1GUM A;  4MZC A;  1R7H A;  3GKX A;  4K0N A;  3ZFB A;  2HNL A;  1F37 A;  5COH A;  3WD6 A;  5B8A A;  1SK2 A;  1OC9 B;  1GSS A;  1XVW A;  2H73 A;  3WGD A;  3A2V A;  5AN1 A;  1OVN A;  3H79 A;  1VF2 A;  1ZYE A;  1CQH A;  1DE1 A;  2XBQ A;  4K9Z A;  2WCI A;  3IOS A;  4K7O A;  2HZE B;  4IHU A;  1OKT A;  3MAK A;  3HKR A;  2RUF A;  1TOF A;  2KOK A;  3RHB A;  4KSM A;  4O32 A;  1W89 A;  4EIP A;  2XPD A;  5JWO B;  4WF4 A;  4TR0 A;  2LJR A;  3C71 A;  2GZY A;  2IIY A;  2R2J A;  4OD7 A;  2I9H A;  2J23 A;  1FB6 A;  2FHE A;  1M9A A;  3KP8 A;  2E7P A;  4ECI A;  2C1Y A;  1XXU A;  1YKA A;  4ZB9 A;  1R5P A;  1AQV A;  5A1N A;  1GSQ A;  1TRV A;  1Z3E A;  2B1K A;  5J41 A;  2IMD A;  1DUG A;  1TU7 A;  3TOT A;  1YJ6 A;  2JAC A;  4Q5F A;  5ABR A;  4Q5R A;  3MIX A;  1K0N A;  4E68 A;  4FYB A;  2DMM A;  1XFL A;  1TK0 B;  5A5H B;  2H01 A;  1SYR A;  4K1F A;  4NXI A;  1GLQ A;  1KNG A;  1X5E A;  3R3E A;  3PIN A;  1ERU A;  4HUA A;  2QC7 A;  3W6G A;  1NSW A;  4EC0 A;  5GZZ B;  2HRK B;  3ZYW A;  4BPY A;  1U88 A;  2YP6 A;  3TJF A;  3VWW A;  3I69 A;  4KDU A;  2ON7 A;  2DJ3 A;  3LEF A;  2X8C A;  1GLP A;  4X0X A;  2KLX A;  3KP9 A;  4LLR A;  5A34 A;  1Q98 A;  5J9C A;  1ZOF A;  3DVX A;  5JWR B;  2CAQ A;  2EC4 A;  2A2P A;  2H74 A;  2F51 A;  1TXX A;  3QAG A;  2QSI A;  2GT5 A;  3GKM A;  4GLT A;  1AC1 A;  3L9V A;  1SK0 A;  10GS A;  5KN2 A;  2R0C A;  3F3R A;  1B9Y C;  1PD2 1;  1NHO A;  4KCA A;  2H6Y A;  2UZ8 A;  1SJ6 A;  3F9U A;  4DVC A;  4FIW A;  3RPP A;  1X9M B;  3M3M A;  4GSN A;  2GS3 A;  1KBN A;  2LRC A;  4EDZ A;  1UN2 A;  3EWL A;  1O73 A;  5JCU A;  4HZ4 A;  3GFK A;  5J4Y A;  3HJP A;  1MDJ A;  5AIX A;  1ZCP A;  4RQR A;  2B5X A;  1G7E A;  2HI7 A;  2FUG 2;  2HE3 A;  2C0F A;  4F0C A;  4LMV A;  3H1N A;  2X4A A;  1G7O A;  4OFN A;  1E2Y A;  2JSZ A;  1BX9 A;  4V1A p;  3A2W A;  5ECR B;  5FT3 A;  2FCH A;  1SU9 A;  3BJ5 A;  2WRT A;  5IMZ A;  4HOJ A;  4HQZ A;  4POM A;  3ZIV A;  3WT2 A;  5IOX A;  1GNE A;  2O87 A;  4ML6 A;  4EXJ A;  1PX7 A;  3FW2 A;  1JLV A;  1OAZ A;  2YOI A;  1J9B A;  2VCQ A;  4IP1 A;  3ZZX A;  2L5L A;  5D9X A;  1UVZ A;  3IXR A;  3DEX A;  4EVM A;  2PU9 C;  4PTS A;  4TVE A;  4MZB A;  1T7P B;  2VD1 A;  1A24 A;  2QKE A;  2H0I A;  4O5R A;  5HR3 A;  8GSS A;  2WUL A;  1M2D A;  4MH2 A;  2HRF A;  4MNN A;  5G30 A;  2EFE A;  3LFL A;  1J0F A;  4PXO A;  3H93 A;  2MMZ A;  5C00 A;  2JZR A;  2M80 A;  2NVL A;  3VI7 A;  3IA1 A;  4H86 A;  4HI7 A;  4GQC A;  5CRW A;  3TOU A;  3BCI A;  3RHC A;  3TU3 B;  1WRY A;  2VCT A;  4USS A;  3LXT A;  5AGY A;  5C04 A;  4BWS A;  2VD0 A;  1T4Y A;  4OCF A;  3I9V 2;  3AY8 A;  4ZBB A;  1XOA A;  1TW9 A;  1O81 A;  5JCW A;  1JHB A;  4PUF C;  1USB A;  3E9J B;  3HJO A;  3FY7 A;  4CW9 A;  5IMF A;  5IMC A;  4IQ1 A;  3EU3 A;  5ELG A;  2DML A;  5DQS A;  4AKX B;  4KH7 A;  2B7J A;  2CZ2 A;  6GSW A;  1AW9 A;  1OE7 A;  2L4C A;  2N5F A;  4ZBD A;  4GTU A;  2B5Y A;  5IMV A;  2LUS A;  2YAN A;  3A2X A;  1R4W A;  1TRW A;  3HA9 A;  5CRG A;  1T8E B;  1YQ1 A;  2WJU A;  3CSJ A;  1SVM A;  1XWC A;  3KCM A;  5H5R A;  4WKW A;  1TRU A;  2H0G A;  1BAY A;  1WE0 A;  1PX6 A;  2LNS A;  1GWC A;  4ZIJ A;  2HT9 A;  4XRD A;  4K5S A;  1HNB A;  1V9W A;  1JZW A;  2BJX A;  3KH9 A;  1K3L A;  3EUR A;  1J08 A;  2IMK A;  2H75 A;  2IMI A;  1U3I A;  4D73 A;  1VF3 A;  5DQY A;  4ZL8 A;  3IK7 A;  3L9S A;  1XIY A;  1GUL A;  4J57 E;  4GF0 A;  2FD3 A;  1GNW A;  2LQQ A;  4KW6 A;  1WPI A;  4QMK A;  1A23 A;  4RI6 A;  3TJB A;  3UAP A;  3I6A A;  4JR6 A;  3F4R A;  1Q4J A;  3I43 A;  3QFA C;  1SKW B;  4V1A g;  4MF7 A;  1F2E A;  1FHE A;  3GTU A;  2G0F A;  2NTO A;  2I81 A;  4ZL7 A;  4MLY A;  1ERT A;  11GS A;  1PN0 A;  3WGE A;  4N30 A;  1PL2 A;  4G0K A;  3P90 A;  4TOP A;  1VF1 A;  4QL7 A;  2C3N A;  1TK5 B;  1HD2 A;  2HSM A;  4IVF A;  1AQX A;  3H8Q A;  5G1K A;  5ECI B;  3ZMK A;  5DCG A;  2KHP A;  2EFC A;  5BMU B;  2F8A A;  4GSS A;  4BVY A;  3UOM A;  3F4S A;  5F07 A;  1NHY A;  3KZQ A;  2OAC A;  1LJR A;  5A34 B;  1EGO A;  1A2M A;  3CRT A;  2RLI A;  4N0V A;  3UIW A;  3Q6O A;  2MBS A;  2YWN A;  4L8E A;  1FB0 A;  3KJY A;  1YF0 A;  4KF9 A;  2H6Z A;  5HR0 A;  1JZR A;  1Z7P A;  2LS5 A;  4NHW A;  2AHE A;  2H1D A;  4AJ8 A;  2HFD A;  2V6O A;  3VUR A;  1EV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...