4ZBAA

Crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium with oxidized glutathione.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
222
structure length
222
Chain Sequence
ASHDKQFSLFLHKASAHGWKVAFVLEELSLSYEIVLVDVAKNEQKSPEFMKLNPNGRTPALIDHGNSDFVIWESNAMVQYVADKYDTERKISMAPGTDDFYIQLQWQYFQGTGQGPYFGQLVWFTLYHEEKIPSAVTRYKEEALRVFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFLDNFDFEKEFPATAAWHYKMLKRPTIKRPWDERRKLMSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p8
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 87
structure length 222
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zbaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zbaA01
2IWTA 4Q5QA 1GNWA 5IMFA 2TRXA 2A4VA 1EEJA 3FKFA 4WF4A 1UA5A 8GSSA 3TJKA 3ERWA 5GAPD 4JU5A 1GULA 1XOBA 3DKSA 4OFNA 2R3XA 5HR0A 1O85A 4HZ4A 3PGTA 4KSOA 4POMA 1XWKA 2YWNA 3IRAA 2YCDA 6GSUA 1JZOA 4Q5RA 4NMUA 2PPTA 2HZFA 1B9XC 3L9VA 3GTUA 2L57A 4ID0A 4NWYA 3G7YA 4WR5A 4MJAA 2FY6A 3TOUA 3KGKA 4ML6A 3EE2A 5ECPB 4BVYA 2A2SA 2EIOA 5DDLA 4IJ3A 1GSUA 5CRGA 4GRFA 3VWWA 4I6XA 4G0IA 2OJLA 3TGZA 1NHYA 2B1KA 2WGRA 2H0IA 1ON4A 5JWOB 1ACVA 5KEJA 3IBHA 4NV2A 2YN1A 2VCXA 3D6IA 5AIVA 1BYEA 4TR1B 3FY7A 3FRCA 3FYGA 2KUCA 2O7KA 5DJMA 3RDWA 4EE0A 4CW9A 2KP2A 5AISA 3VI7A 1MDIA 1QXHA 1VF4A 2JSYA 3Q18A 1HNCA 5LCZA 2NTOA 2E2MA 2IFQB 2X64A 4AF2A 2H70A 3V1WA 1U3AA 3HYPA 2R37A 5A4VA 4FYBA 4JEDA 5ELGA 5D93A 2REMA 4GXZA 2DMMA 1URMA 5H5SA 2VO4A 1Z3EA 1E2YA 4I5QA 1WOUA 4XS4B 3MSZA 1TI3A 4KUNA 4MABA 4G19A 1SJZA 3W6GA 2HRFA 2CVBA 4OWYA 2P31A 4HJMA 5ECKB 3QOUA 1SYRA 1QK8A 3F6FA 3GKXA 3IHQA 3TKQA 5IPHA 2JZRA 2G0FA 5JWQB 2QC7A 1ZZYA 1J0FA 4K1FA 2CVDA 1MDJA 2RUEA 2B7KA 2C0FA 3A3TA 2XBQA 2H75A 3CBUA 4HI7A 4KGIA 2CX3A 4J57E 3CRTA 4GSTA 2MMOA 4F0BA 4IP1A 2IMFA 2YWIA 2F8FA 1A0FA 4QL7A 3ERFA 1N2AA 1WRYA 1R5AA 4IQ1A 1ERUA 3FEUA 3FZ9A 3GKMA 4LLRA 4TR1A 3QD9A 2GS3A 4MH2A 1W4VA 4TW5A 1EGRA 1TI1A 4TOPA 3HJMA 1USBA 2HRNA 1F3BA 4TR3A 1GWCA 2JADA 5F8BA 4EC0A 2IMDA 4TN8A 3TKRA 4G0KA 3O76A 4ZL9A 4GCIA 5CRWA 1KTEA 3FZ5A 5F05A 1F9MA 2IFQA 4L5LA 1FVKA 4ZL8A 1FB0A 1TXXA 4OO4A 4ECBA 2WCIA 1K3OA 4WBJA 3UOMA 3LSZA 1TK8B 5G2ZA 2O89A 1GSFA 2C3QA 4PXOA 3ZRDA 1AXDA 4XS4A 2OBIA 4DSSB 1XBSA 3GH6A 3KM6A 2B3SA 5DVBA 1XFLA 4G9HA 3FK8A 2E0QA 4KA0A 4LA1A 3ME8A 2FUG2 1FW1A 2YWMA 3PH9A 2PMTA 5G5FA 1EEMA 2V41A 3L78A 4X43A 3IA1A 2FLSA 1GUMA 2YV7A 5D9XA 4N30A 1ABAA 5LNKe 3HJPA 1HYUA 1T3BA 3FZ4A 4YAVA 1NSWA 3EU3A 2VD1A 2F3MA 3ZITA 1GSSA 3TJBA 3WYWA 1QFNA 3RPPA 4TXVA 3ZVJD 2VLTA 3IAS2 2IMKA 5KN1A 4E8EA 5IMAA 1B48A 5F07A 2C0GA 4MPFA 3MDKA 1EGOA 4MA9A 5IM9A 3M8NA 1XWBA 5J41A 2C3TA 4KE3A 3GL5A 3IDVA 2L6CA 4O32A 5GAND 1X9MB 4DSQA 3GHAA 3Q74A 1SJIA 3HVXA 1A23A 4O7HA 1BJXA 2YWOA 4E8HA 4GF0A 1MD4A 2WS2A 4KH7A 1K0OA 1XVWA 3LORA 3TJFA 1XW5A 4ECJA 3TRQA 4LMVA 1Q98A 4CDOA 3E9JB 3EU4A 4JBBA 3VLNA 1SKWB 1ERWA 1SENA 2LRCA 1VF1A 4DSSA 1J08A 2CT6A 3M9JA 1AQVA 1UVZA 4OFMA 1TKDB 5J5NA 5KN3A 2FCHA 2H1AA 1OAZA 2DJ3A 5FT3A 3KH9A 4DSRA 3ZFBA 4WF5A 3KTLA 4MCUA 4K7NA 1A0RP 1B8XA 1M0UA 4JRRA 4F2IA 2HI7A 3HHVA 3WT1A 1B4QA 3D5JA 4PURA 4GQCA 1H75A 4F03A 1GTUA 1GSDA 17GSA 5IIZA 3N9JA 4MF6A 4FH8A 2LEGA 3UAPA 5ECSA 1GH2A 4JZQA 4XRAA 3MNGA 1BG5A 4K9ZA 3C73A 2V32A 3ED3A 5CRHA 4IHUA 3ZIJA 5J9BA 2LS5A 4GLTA 1EP8A 2NPBA 4TR4A 5GZZB 1JZRA 3IV4A 1U3IA 3ZTLA 2FA8A 4EXJA 2WDUA 4MJBA 4WETA 5HFGA 1SD8A 1TRUA 1VGLA 1TRSA 2IPAA 1EV9A 2HLSA 2AAWA 3I69A 1JZDA 2RUFA 4NHWA 3F3QA 3UEMA 2BTOT 2HT9A 2FWEA 2GSSA 2RM6A 1FHEA 3QFBC 1VF2A 2B5XA 2H6XA 5F0GA 2DC5A 5AN1A 2FD3A 5FWGA 2LJAA 3PR8A 1YEXA 3I43A 4I2UA 4TR0A 3A5WA 1Z9HA 2C1YA 5COHA 4Z7XA 3EC3A 5CYYA 1Z7PA 3CSJA 4ZBAA 4HU7A 5EPFA 3D4TA 4CHSA 4ULXA 1Z6NA 1SYXA 3UBLA 1XCCA 5DAKB 2P5QA 2AV4A 2GT5A 3TKSC 4FYUA 1G7OA 4PNFA 2C0DA 4N11A 3F4SA 2VCZA 3ISOA 2ZUPA 4XHMA 2AHEA 2GDRA 4EDZA 2GT6A 2HFDA 1FO5A 1EV4A 2GTUA 2DJ0A 4V2LA 2NBSA 1FB6A 2FA4A 2LNSA 2MBSA 3RBTA 4H86A 2VLVA 2H1DA 2H0GA 2OE3A 1G7EA 3BCIA 3LQ7A 5IOWA 1TRVA 5EVOA 1TU7A 2K18A 3IAM2 2H1GA 5CO3A 3LJRA 1DUGA 3DVWA 2ON5A 1EZKA 3WGXA 1Z5YE 3HA9A 1FVJA 4PGTA 1M99A 1A24A 2LJKA 2F51A 2VCWA 1ZYEA 1XW6A 2ALBA 2VCTA 3TDGA 2C0EA 2QKEA 3UVTA 2YNXA 5D73A 1CQGA 4MF7A 4MLYA 3G9BA 1X9WB 3KP9A 5DAKA 3KH7A 2B1LA 1T4ZA 4FO5A 5IMZA 2M72A 1O8XA 2RIIA 3WGEA 2F8AA 4F82A 3TJJA 2VLUA 4POBA 5DQSA 3LFLA 2ZCTA 2X8GA 4K7OA 2XBIA 2KP1A 2A2RA 5ECQB 2VD0A 4BA7A 1TRWA 4MJCA 4K0NA 3F63A 4KCAA 3GX0A 3IC4A 4MPGA 2DLXA 2PVQA 3HZ8A 3GRXA 1OKTA 4LL4B 3H8QA 3M0FA 3HZ4A 1H4OA 2B5YA 1V9WA 2OADA 6GSSA 1SKRB 5ECRB 3US3A 3LWAA 1SK0A 3H79A 3HVSA 6GSTA 4PUFC 5AIXA 3DVXA 5DALB 2I3YA 5D9TA 5E59A 1PGTA 2DMLA 4ML1A 1XXUA 2BMXA 1YY7A 2LNTA 6GSWA 3DD3A 2CAIA 1JZWA 5ABRA 1NW2A 5DQYA 4MP4A 4MMMA 2L4QA 2LV3A 4QL9A 2AUVA 5GSSA 2K9FA 4K0GA 3LXTA 3DXBA 4IKHA 1ERVA 4GSSA 1GSYA 3BD2A 4OCEA 4EF0A 2LTKA 5D9WA 4K6XA 3TKSA 2F9SA 5ELAA 1KNGA 2HZEB 2GQMA 1V40A 2EC4A 3AY8A 1B9YC 2L5OA 1SL0B 4HZ2A 2L59A 2FWFA 2G2QA 1BX9A 4KF9A 2OBKA 3EURA 5G1KA 3HVVA 4HJ2A 1Z7RA 4BPYA 3GSTA 3GX8A 3C71A 4G2EA 2MYGA 5G30A 5ECOB 2TRCP 2GLRA 1EP7A 2PN8A 3J7Yb 2H8LA 5IO2A 3GSSA 1T7PB 1MDKA 1O7UA 4OO5A 1R4WA 2LUSA 2HNLA 4HQSA 1A2LA 3GH9A 3GMFA 2DJ2A 5ID2B 2JU5A 4GSNA 5JCGA 3DMLA 1YZXA 2WJUA 1KBNA 3F4TA 2R5GA 4KDUA 1QGVA 1EOGA 12GSA 1I5GA 1ZYQB 4IP6A 2JACA 4KDYA 5GSTA 3GNJA 3TB2A 3GYKA 4PX1A 1ML6A 1ZCPA 2CA8A 4OD7A 2I4AA 3SBCA 3TKPA 1F2EA 3IE3A 4JE1A 2FGXA 3ERGA 3C1RA 2B5EA 4HUAA 3CSHA 1ILOA 2MMZA 2DJ1A 4L8EA 4OMVA 3QAVA 2XHFA 2O87A 1GRXA 3H4KA 2H1BA 3IC8A 2L4CA 3J7Yk 4OCFA 2H66A 4EUYA 1OKDA 19GSA 4V1Ap 1KEBA 1V57A 5C00A 2VM1A 1FAAA 2C4JA 3GKNA 3LYKA 3CTGA 1YKCA 10GSA 1OC9B 1MTCA 4ZB9A 4BL7B 3DIEA 3SWLA 5CRDA 2DSAA 3M1GA 3D4MA 1ZL9A 1GSEA 1S3DA 1THXA 4G10A 5LD0A 1F37A 5HR2A 1EOHA 2IJYA 2PERA 2Z9SA 1T4YA 1HNAA 2R4VA 3LGCA 3GKKA 2DJKA 3G7IA 2I81A 18GSA 14GSA 2GSTA 2YJHA 5ID2A 2VL9A 3QAGA 3TUEA 2VM2A 2YANA 1SKSB 3KTBA 3F6DA 9GSSA 1AUCA 1PQNA 1XOAA 2FWHA 4GTUA 4WEYA 3KEBA 5B7CA 2I1UA 3IK7A 1GTBA 1OC8A 1OYJA 1GUKA 1DE1A 2O8VB 1SD9A 5B6MA 2QGVA 3KJYA 1F6MC 5B8BA 3A2VA 1YDKA 2JZSA 1OVNA 2YP6A 3GL3A 3UARA 3APSA 3FR6A 4ILFA 1JFUA 1LU4A 3U5RE 4NPBA 2JL4A 4YH2A 3ZIVA 2HRKB 1LJRA 1PD21 1GTIA 3RAZA 1XWGA 5ECIB 1DBYA 2OA7A 4PUAA 2B6MA 2KHPA 3A2XA 4BVXB 2XC2A 5KN0A 1THOA 2OE1A 3F9UA 1X0RA 3HDCA 2LQQA 1LBKA 2MMNA 1Z6MA 3VK9A 1OC9A 4BL7A 1PMTA 3ZMKA 1GUHA 4RQRA 1IYIA 1XWCA 4POKA 1YF0A 2ES7A 4HQZA 3L4NA 3VURA 1OE7A 5KN2A 2P0GA 3WD6A 4RQXA 2WZ9A 1V98A 5B6NA 3DEXA 3LEFA 5HFIA 2YOIA 4GWRA 2GQLA 3FW2A 4O92A 3M9KA 4XTSA 3FHKA 3QDNA 1OC3A 2NVLA 2EIRA 4DVCA 3L9UA 1HNBA 2HRAA 2LRTA 1A8LA 3IPZA 5CREA 1Y25A 3ZYWA 3HY2A 1R26A 5HQPA 5INYA 1U88A 3VWXA 3W8SA 2IIYA 2CZ2A 2K8VA 1TP9A 4FYCA 4HS1A 4KX4A 1PX7A 4J56E 2YPMA 4K8MA 2R6KA 5FHIA 1ZOFA 4TXOB 3MWHA 4MDCA 1AC1A 4XCSA 1YF1A 1T00A 2V1MA 4J2FA 4P3YB 5CNWA 5J3RA 4V2MA 2YV9A 2HSNB 2PU9C 2ZNMA 1K0NA 4YQUA 4GQFA 3I9V2 5ECLB 4PQIA 4PQHA 16GSA 2HRKA 1PL2A 3APQA 4ZB8A 3DWVA 4EKZA 4RI6A 2ON7A 1TW9A 2JZTA 5IMVA 4MZWA 1J9BA 2GVPA 1PL1A 2FNOA 4BVXA 1X5DA 4MZBA 3QCPA 2N5AA 3TCOA 5DCGA 3VPTA 1M9AA 1VF3A 1HQOA 3NOFA 3BJ5A 1U6TA 3GIXA 2CV4A 3UVHA 1GTAA 2UZ8A 1U87A 5H5QA 1X9SB 2N5FA 1BEDA 3W8JA 4EDYA 4HDEA 2VAFA 2PBJA 4DEJA 2RM5A 2N5BA 1RK4A 2VUPA 5C04A 1A8YA 1JHBA 3CRUA 2C8UA 2HXKA 1O81A 3ME7A 2X8HA 2H74A 3LYPA 2BJXA 5B8AA 2IL3A 4TKYA 1PA3A 4WR4A 4USSA 4ZL7A 5DCHA 2CZ3A 2RLIA 2B7JA 4NAXA 1A2JA 5L71A 1W89A 1AAZA 1G0TA 1R7HA 3CSIA 2H72A 1PRXA 2H30A 3KMNA 3L0HA 1G6WA 1O8WA 1K0BA 4X1UA 4EL1A 3WGDA 1YKAA 4TXOA 3EWLA 2PWJA 7GSSA 4ZXGA 3D0ZA 3IR4A 4AGSA 4ZILA 1N8JA 4X0XA 6GSXA 3RPNA 1WP0A 4XIHA 1VRSD 2E7PA 4ISDA 2VL2C 2LRNA 4IVFA 1X5EA 3G7JA 1SU9A 3TOTA 3C1SA 3GUSA 1PX6A 3UBKA 4KCEA 1TU8A 4HOJA 1C72A 2E2GA 5E4WA 3IK9A 2M80A 2IMIA 4L5OA 2H73A 2YZUA 3VWUA 1WMJA 4F0CA 2CVKA 3APOA 2EIQA 2HE3A 1QMVA 1GSQA 3BOAA 4TRXA 3HKRA 2FWGA 3ZLPA 1MD3A 3QMXA 1O6JA 3DGQA 2VL3A 2KLXA 4G0LA 1FOVA 4KNDA 3VFIA 1OE8A 2R2JA 5IPGA 3VWVA 4BWSA 5IOXA 3VPQA 1CQHA 5G1LA 3F0IA 2GZYA 4LL1B 3DRNA 3QR6A 4N10A 1XZOA 5D96A 22GSA 5A5KA 2JSZA 4PTSA 2X8CA 4AJ6A 3S9FA 1V2AA 1A2MA 1SK1A 4QQ7A 3D22A 3RHBA 5AGYA 2OKAA 4AJ8A 3BCKA 2HSMB 2H0HA 1GP1A 5H5RA 5HFKA 2CAQA 3CMIA 1K3YA 1RW1A 3KZQA 3N5OA 4K7IA 1S3CA 1M2BA 3BBYA 1XPVA 1BQ7A 1TJDA 4IW9A 2AB6A 1DE2A 1ZMAA 3C8EA 5J4UA 5ECHB 4Q5NA 4YAPA 4JR6A 1M7TA 2HYXA 5IO0A 3Q19A 5CP1A 1EWXA 2CX4A 3NZNA 2HQTA 3KIJA 5A4UA 2J23A 4KAEA 1XIYA 3I6AA 1AQXA 1FG4A 1YEPA 3H93A 1M2AA 1K0CA 1K3LA 5CAXA 3OR5A 3E0UA 4FQUA 1JLVA 2H6YA 3RHCA 3TJGA 4MJEA 3FZAA 3FR3A 3PPUA 5DALA 2IN3A 4ZBDA 4L0WA 3LXZA 2GZPA 2H76A 3HCZA 4KDXA 4MZCA 3F4RA 2L6DA 4D73B 1SL1B 1NM3A 3ZZXA 1SK2A 3P2AA 4PQ1A 4I97A 3CTFA 1PKZA 3R2QA 3ZL5A 3HXSA 3IOSA 6GSYA 5A4WA 2LKUA 2WB9A 2GQKA 5EY6A 3Q6OA 5JCUA 2QSIA 3ZVJA 3UMAA 2VOCA 1WWJA 5IQYA 3ZREA 3MAKA 4RI7A 4K2DA 1B4PA 3QPMA 2HSMA 2HZEA 1JLWA 1HD2A 4V1Ag 2GSRA 4ZB6A 1GL8A 3KXOA 2VL2A 1DSBA 4KB3A 1K0AA 3GV1A 5G5EA 2OACA 4IS0A 2V6OA 1QQ2A 3HJOA 1K0MA 2PVOC 1UN2A 3F8UA 1GNEA 1WJKA 2MZCA 11GSA 3F3RA 5DJLA 3GN3A 1M9BA 1QUWA 3NIVA 3CYNA 20GSA 1PKWA 3EYTA 2I9HA 2H71A 4RUVA 3L9SA 4EVMA 5BMUA 2L5LA 3CXGA 5ECNB 3HD5A 1WE0A 1AIUA 3KMOA 3PINA 1T8EB 2WFCA 4NHZA 3A2WA 3UJ1A 2LSTA 4N0ZA 2V6KA 2MBTA 2CQ9A 4NV5A 4IELA 2LJRA 1ERTA 4PNGA 4I8BA 1O73A 4IGJA 2HSYA 1WIKA 3UL3A 4D73A 1XW9A 3D21A 4TVEA 13GSA 4FIWA 2YJ7A 4HEA2 4WKWA 1Q4JA 4POLA 1R5PA 3QFAC 2P5RA 1YQ1A 5IMDA 4I2TA 1XVQA 2DIZA 1MEKA 1WPIA 4AJ7A 1BAYA 2DJJA 4WXTA 5ECMB 1TOFA 1G6YA 1GLQA 1SL2B 4IBPA 1TK0B 4L0UA 4IJIA 2VCVA 5JCWA 1TK5B 1ST9A 3TKSE 2K8SA 2O85A 4BWQA 3TRPA 1E6BA 4LMWA 4KSMA 1YJ6A 2XPDA 2NDOA 1TTZA 4ECIA 2PUKC 3O3TA 5D9VA 2XPEA 3KP8A 4ZIJA 5F06A 2AYTA 4N0VA 2WRTA 1NHOA 2GZZA 2M46A 3P7XA 2C80A 2H6ZA 5D8IA 3R3EA 4YQMA 2DIYA 3WT2A 5J9CA 2PGTA 3P90A 1X5CA 3IXRA 4EO3A 4HU9A 1XWAA 2K6VA 3U6VA 2KOKA 2AJQB 4KW6A 2J9HA 3K8NA 3GURA 3M3MA 2HSHA 2WULA 3ZFLA 1GLPA 1F3AA 4OFTA 3DYRA 3KCMA 3KD0A 1V58A 3ZMLA 1RQMA 5HR3A 3VI5A 4F9ZA 4Q5FA 1TDIA 2TIRA 4JR4A 1K0DA 1AW9A 4XS1A 2DBCA 2GSQA 1I9DA 3GTUB 3FR9A 3EMXA 3EINA 2MMAA 4IQAA 4ZBBA 3LG6A 3JCML 3E3EA 3O6TA 4XS6A 3H1NA 4BVYB 2X99A 4WBRD 4MH3A 2VIMA 2D2ZA 4IN0A 2GGTA 3UIWA 1PN9A 3QAWA 4XRDA 1AQWA 5JWRB 3EMPA 4MK3A 1Y6EA 4YQVA 1ZGNA 5DBQA 4V2NA 1UC7A 2FHEA 2LQOA 5IMCA 5EL8A 2H01A 6GSVA 2C3NA 3P8WA 1T1VA 2OE0A 3TRXA 2YZHA 3C7MA 5G31A 3GFKA 1PSQA 3EVIA 4ECCA 1S3AA 2IMEA 2VCQA 4NXIA 2V2GA 4O5RA 4ACSA 4MF5A 5ENUA 1SJ6A 1M2DA 2H19A 3GA4A 5HR1A 1IYHA
chains in the Genus database with same CATH superfamily
2IWTA 4Q5QA 1GNWA 5IMFA 2TRXA 2A4VA 1EEJA 3FKFA 4WF4A 1UA5A 8GSSA 3TJKA 3ERWA 5GAPD 4JU5A 1GULA 1XOBA 4ZB7A 3DKSA 4OFNA 2R3XA 5HR0A 1O85A 4HZ4A 3PGTA 4KSOA 4POMA 1XWKA 2YWNA 3IRAA 2YCDA 6GSUA 1JZOA 4Q5RA 4NMUA 2PPTA 2HZFA 1B9XC 3L9VA 3GTUA 1PN0A 2L57A 4ID0A 4NWYA 3G7YA 4WR5A 4MJAA 2FY6A 3TOUA 3KGKA 4ML6A 3EE2A 5ECPB 4BVYA 2A2SA 2EIOA 5DDLA 4IJ3A 1GSUA 5CRGA 4GRFA 3VWWA 4G0IA 4I6XA 2OJLA 3TGZA 1NHYA 2B1KA 2WGRA 2H0IA 1ON4A 5JWOB 1ACVA 5KEJA 3IBHA 4NV2A 2YN1A 2VCXA 3D6IA 5AIVA 1BYEA 4TR1B 3FY7A 4X4JA 3FRCA 3FYGA 2KUCA 2O7KA 5DJMA 3RDWA 4EE0A 4CW9A 2KP2A 5AISA 3VI7A 1MDIA 1QXHA 1VF4A 2JSYA 2H1LA 3Q18A 1HNCA 5LCZA 2NTOA 2E2MA 2IFQB 2X64A 4AF2A 2H70A 3V1WA 1U3AA 3HYPA 2R37A 5A4VA 4FYBA 4JEDA 5ELGA 5D93A 2REMA 4GXZA 2DMMA 1URMA 5H5SA 2VO4A 1Z3EA 1E2YA 4I5QA 1WOUA 4XS4B 3MSZA 2O36A 1TI3A 4KUNA 4MABA 4G19A 4GDFA 1SJZA 3W6GA 2HRFA 2CVBA 4OWYA 2P31A 4HJMA 3HMJG 5ECKB 3QOUA 1SYRA 2UV8G 1QK8A 3F6FA 3GKXA 3IHQA 3TKQA 5IPHA 2JZRA 2G0FA 5JWQB 4K5RA 2QC7A 1ZZYA 1J0FA 4K1FA 2CVDA 1MDJA 2RUEA 2B7KA 2C0FA 3A3TA 2XBQA 2H75A 4O5UA 3CBUA 4HI7A 4KGIA 2CX3A 4J57E 3CRTA 4GSTA 2MMOA 4F0BA 4IP1A 2IMFA 2YWIA 2F8FA 1A0FA 4QL7A 3ERFA 1N2AA 1WRYA 1R5AA 4IQ1A 1ERUA 3FEUA 3FZ9A 4O5QA 3GKMA 4LLRA 5A1NB 4TR1A 3QD9A 2GS3A 4MH2A 1W4VA 4TW5A 1S3RA 1EGRA 1TI1A 4TOPA 3HJMA 1USBA 2HRNA 1F3BA 4TR3A 1GWCA 2JADA 5F8BA 4EC0A 2IMDA 4TN8A 3TKRA 4G0KA 3O76A 1SVMA 4ZL9A 4GCIA 5CRWA 1KTEA 3FZ5A 5F05A 1F9MA 4YKGA 2IFQA 4L5LA 1FVKA 4ZL8A 1FB0A 1TXXA 4OO4A 4ECBA 2WCIA 1K3OA 4WBJA 3UOMA 3LSZA 1TK8B 5G2ZA 2O89A 1GSFA 2C3QA 4PXOA 3ZRDA 1AXDA 4XS4A 2OBIA 4DSSB 1XBSA 3GH6A 3KM6A 2B3SA 5DVBA 1XFLA 4G9HA 3FK8A 2A4HA 2E0QA 4KA0A 4LA1A 3ME8A 2FUG2 1FW1A 2YWMA 3PH9A 2PMTA 5G5FA 1EEMA 2V41A 3L78A 4X43A 3IA1A 2FLSA 1GUMA 2YV7A 5D9XA 4N30A 1ABAA 5LNKe 3HJPA 1HYUA 1T3BA 3FZ4A 4YAVA 1NSWA 3EU3A 2VD1A 2F3MA 3ZITA 1GSSA 3TJBA 3WYWA 3IHGA 1QFNA 3RPPA 4TXVA 3ZVJD 2VLTA 3IAS2 2IMKA 5KN1A 4E8EA 5IMAA 1B48A 2WVXB 5F07A 2C0GA 4MPFA 3MDKA 1EGOA 4MA9A 5IM9A 3M8NA 4G01A 5J41A 1XWBA 5A1NA 2C3TA 4KE3A 3IDVA 3GL5A 2L6CA 4O32A 5GAND 1X9MB 4DSQA 3GHAA 3Q74A 1SJIA 3HVXA 1A23A 4O7HA 1BJXA 2YWOA 4E8HA 4GF0A 1MD4A 2WS2A 4KH7A 1K0OA 1XVWA 3LORA 3TJFA 1XW5A 4ECJA 3TRQA 4LMVA 1Q98A 4CDOA 3E9JB 3EU4A 4JBBA 3VLNA 1SKWB 1ERWA 4AKIA 1SENA 2LRCA 1VF1A 4DSSA 1J08A 2CT6A 3M9JA 1AQVA 1UVZA 4OFMA 1TKDB 5J5NA 5KN3A 2FCHA 2H1AA 1OAZA 2DJ3A 5FT3A 2EFDA 3KH9A 4DSRA 3ZFBA 4WF5A 3KTLA 4MCUA 4K7NA 1SVLA 1B8XA 1A0RP 5BRTA 1M0UA 4JRRA 4F2IA 2HI7A 3CWGA 3HHVA 3WT1A 1B4QA 5J4VA 3D5JA 5J4YA 4PURA 4GQCA 1H75A 4F03A 1GTUA 1GSDA 3RFRC 17GSA 3EPTA 5IIZA 3N9JA 2WVXA 4MF6A 4FH8A 2LEGA 3UAPA 5ECSA 1GH2A 4JZQA 4XRAA 3MNGA 1BG5A 3C73A 4K9ZA 2V32A 3ED3A 5CRHA 4IHUA 3ZIJA 5J9BA 2LS5A 4GLTA 1EP8A 2NPBA 4TR4A 5GZZB 1JZRA 2WW1A 3IV4A 1U3IA 3ZTLA 2FA8A 4EXJA 2WDUA 4MJBA 4WETA 5HFGA 1SD8A 1TRUA 1VGLA 1TRSA 5J40A 2IPAA 1EV9A 2HLSA 2AAWA 3I69A 1JZDA 2RUFA 4NHWA 3F3QA 3UEMA 2BTOT 2HT9A 2FWEA 2GSSA 2RM6A 1FHEA 3QFBC 1VF2A 2B5XA 2H6XA 5F0GA 2DC5A 5AN1A 2LJAA 5FWGA 2FD3A 3PR8A 1YEXA 3I43A 4I2UA 4TR0A 3A5WA 1Z9HA 2C1YA 2DKHA 5COHA 4Z7XA 3EC3A 5CYYA 1Z7PA 3CSJA 4ZBAA 4HU7A 5EPFA 3D4TA 2WVZA 4CHSA 4ULXA 1Z6NA 1SYXA 3UBLA 4AKGA 1SVOA 1XCCA 5DAKB 2P5QA 3MIXA 2AV4A 2GT5A 3TKSC 4FYUA 1G7OA 4PNFA 2C0DA 4N11A 2WVYA 3F4SA 2VCZA 3ISOA 4YKFA 3LW9A 2ZUPA 4XHMA 2AHEA 2GDRA 4EDZA 2GT6A 2HFDA 4FXYP 1FO5A 1EV4A 2GTUA 2DJ0A 4V2LA 2NBSA 1FB6A 2WW0A 2FA4A 2LNSA 2MBSA 3RBTA 4H86A 2VLVA 2H1DA 2H0GA 2OE3A 1G7EA 3BCIA 3LQ7A 5IOWA 1TRVA 5EVOA 1TU7A 2K18A 3IAM2 2H1GA 5CO3A 3LJRA 1DUGA 3DVWA 2ON5A 1EZKA 3WGXA 1Z5YE 3HA9A 1FVJA 4PGTA 5A34B 1M99A 1A24A 2LJKA 2F51A 2VCWA 1ZYEA 1XW6A 1I1IP 2ALBA 2VCTA 3TDGA 2C0EA 2QKEA 3UVTA 2YNXA 5D73A 1CQGA 4MF7A 4MLYA 3G9BA 1X9WB 3KP9A 5DAKA 3KH7A 2B1LA 1T4ZA 4FO5A 5IMZA 2M72A 1O8XA 2RIIA 3CHXC 3WGEA 2F8AA 4F82A 3TJJA 2VLUA 4POBA 5DQSA 3LFLA 2ZCTA 2X8GA 4K7OA 2XBIA 2KP1A 2A2RA 5ECQB 2VD0A 4BA7A 1TRWA 4MJCA 4K0NA 3F63A 4KCAA 3GX0A 3IC4A 4MPGA 2DLXA 2PVQA 3HZ8A 3GRXA 1OKTA 4LL4B 3H8QA 4Z2UA 3M0FA 3HZ4A 1H4OA 2B5YA 1V9WA 2OADA 6GSSA 1SKRB 5ECRB 3US3A 3LWAA 1SK0A 3H79A 3HVSA 6GSTA 4PUFC 5AIXA 3DVXA 5DALB 2I3YA 5D9TA 5E59A 1PGTA 2DMLA 4ML1A 1XXUA 2BMXA 1YY7A 2LNTA 6GSWA 3DD3A 2CAIA 1JZWA 5ABRA 1NW2A 5DQYA 4MP4A 4MMMA 2DKIA 2L4QA 2LV3A 4QL9A 2AUVA 5GSSA 2K9FA 4K0GA 3LXTA 3DXBA 4IKHA 1ERVA 4GSSA 1GSYA 3BD2A 4OCEA 4EF0A 2LTKA 5D9WA 4K6XA 3TKSA 2F9SA 1YVLA 2HZEB 5ELAA 1KNGA 2GQMA 1V40A 2WZSA 2EC4A 3AY8A 1B9YC 2L5OA 1SL0B 4HZ2A 2L59A 2FWFA 2G2QA 1BX9A 4KF9A 2OBKA 3EURA 2A2PA 5G1KA 3HVVA 4HJ2A 1Z7RA 4BPYA 3GSTA 4AI6A 2WW3A 3GX8A 3C71A 4G2EA 2MYGA 5G30A 5ECOB 2TRCP 2GLRA 1EP7A 2PN8A 3J7Yb 2H8LA 5IO2A 3GSSA 1T7PB 1MDKA 1O7UA 4OO5A 1R4WA 2LUSA 2HNLA 4HQSA 1A2LA 3GH9A 3GMFA 2DJ2A 5ID2B 2JU5A 4GSNA 5JCGA 3DMLA 1YZXA 2WJUA 1KBNA 3F4TA 2R5GA 4KDUA 1QGVA 1EOGA 2EFHA 2X4AA 12GSA 1I5GA 1ZYQB 4IP6A 2JACA 4KDYA 5GSTA 3GNJA 3TB2A 3GYKA 4PX1A 1ML6A 1ZCPA 2CA8A 4OD7A 2I4AA 3SBCA 3TKPA 1F2EA 3IE3A 4JE1A 2FGXA 4CY8A 3ERGA 3C1RA 2B5EA 4HUAA 3CSHA 1ILOA 2MMZA 2DJ1A 4L8EA 4OMVA 3QAVA 2XHFA 2O87A 1GRXA 3H4KA 2H1BA 3IC8A 1N25A 2L4CA 3J7Yk 4OCFA 2H66A 4EUYA 2QA2A 1OKDA 19GSA 4V1Ap 1KEBA 1V57A 5C00A 2VM1A 1FAAA 2C4JA 3GKNA 4N3ZA 3LYKA 3CTGA 1YKCA 10GSA 1OC9B 1MTCA 4ZB9A 4BL7B 3DIEA 3SWLA 5CRDA 2DSAA 3M1GA 3D4MA 1ZL9A 1GSEA 1S3DA 1THXA 4G10A 5LD0A 1F37A 5HR2A 1EOHA 2IJYA 2PERA 2EFEA 2Z9SA 1T4YA 1HNAA 2R4VA 3LGCA 3GKKA 2DJKA 3G7IA 2I81A 18GSA 3MYDA 14GSA 2GSTA 2YJHA 5ID2A 2VL9A 3QAGA 3TUEA 5J47A 2VM2A 2YANA 1SKSB 3KTBA 3F6DA 9GSSA 1AUCA 1PQNA 1XOAA 2FWHA 4GTUA 4WEYA 3KEBA 5B7CA 1BG1A 2I1UA 3IK7A 1GTBA 1OC8A 1OYJA 1GUKA 1DE1A 2O8VB 1SD9A 5B6MA 2QGVA 3KJYA 1F6MC 5B8BA 3A2VA 1YDKA 2JZSA 1OVNA 2YP6A 3GL3A 3UARA 3APSA 3FR6A 4ILFA 1JFUA 1LU4A 3U5RE 4NPBA 2JL4A 4YH2A 3ZIVA 2HRKB 1LJRA 1PD21 4Z2RA 2EFCA 1GTIA 3RAZA 1XWGA 5ECIB 1DBYA 2OA7A 4PUAA 2B6MA 2KHPA 3A2XA 4BVXB 2XC2A 5KN0A 1THOA 2OE1A 3F9UA 1X0RA 3HDCA 2LQQA 4ICYA 1LBKA 2MMNA 1Z6MA 3VK9A 1OC9A 4BL7A 1PMTA 3ZMKA 1GUHA 4RQRA 1IYIA 1XWCA 4POKA 1YF0A 2ES7A 4HQZA 3L4NA 3VURA 1OE7A 5KN2A 2P0GA 3WD6A 4RQXA 2WZ9A 1V98A 5B6NA 3DEXA 3LEFA 5HFIA 2YOIA 4GWRA 2GQLA 3FW2A 4O92A 1TXUA 3M9KA 4HSCX 4XTSA 3FHKA 3QDNA 1OC3A 2NVLA 2EIRA 4DVCA 3L9UA 1HNBA 2HRAA 2LRTA 1A8LA 3IPZA 5CREA 1Y25A 3ZYWA 3HY2A 1R26A 5HQPA 5INYA 1U88A 3VWXA 3W8SA 2IIYA 2CZ2A 2K8VA 1TP9A 4FYCA 4K5SA 4HS1A 4KX4A 1PX7A 4J56E 2YPMA 4K8MA 2R6KA 5FHIA 1ZOFA 4TXOB 3MWHA 4MDCA 1AC1A 4XCSA 1YF1A 1T00A 2V1MA 4J2FA 4P3YB 5CNWA 5J3RA 4CY6A 4V2MA 2YV9A 2HSNB 2PU9C 2ZNMA 1K0NA 4YQUA 4GQFA 3I9V2 5ECLB 4PQIA 4PQHA 16GSA 2HRKA 1PL2A 3APQA 4ZB8A 3DWVA 4EKZA 4RI6A 2ON7A 1TW9A 2JZTA 4Z2TA 5IMVA 2OT3A 4MZWA 1J9BA 2GVPA 1PL1A 2FNOA 4BVXA 1X5DA 4MZBA 3QCPA 4W66A 2N5AA 3TCOA 5DCGA 3VPTA 1M9AA 1VF3A 1HQOA 3NOFA 3BJ5A 1U6TA 3GIXA 2CV4A 3UVHA 1GTAA 2UZ8A 1U87A 5H5QA 1X9SB 2N5FA 1BEDA 3W8JA 4EDYA 4HDEA 2VAFA 2PBJA 4DEJA 2RM5A 2N5BA 1RK4A 1FOHA 2VUPA 5C04A 1A8YA 1JHBA 3CRUA 2C8UA 2HXKA 1O81A 3ME7A 2X8HA 2H74A 3LYPA 2BJXA 5B8AA 2IL3A 4TKYA 1PA3A 4WR4A 4USSA 4ZL7A 5DCHA 2CZ3A 2RLIA 2B7JA 4NAXA 1A2JA 5L71A 1W89A 1AAZA 1G0TA 1R7HA 3CSIA 5KOXA 2H72A 1PRXA 2H30A 3KMNA 3L0HA 1G6WA 1O8WA 1K0BA 4X1UA 4EL1A 3WGDA 1YKAA 4TXOA 3EWLA 2PWJA 7GSSA 4ZXGA 3D0ZA 3IR4A 4AGSA 2HSNA 4ZILA 1N8JA 4X0XA 6GSXA 3RPNA 1WP0A 4XIHA 4EIQA 1VRSD 2E7PA 4ISDA 2VL2C 2LRNA 4IVFA 1X5EA 4BIKA 3G7JA 1SU9A 3TOTA 3C1SA 3GUSA 1PX6A 3UBKA 4KCEA 1TU8A 4HOJA 1C72A 3A5IA 2E2GA 5E4WA 3IK9A 2M80A 2IMIA 4L5OA 2H73A 2YZUA 3VWUA 1WMJA 4F0CA 2CVKA 3APOA 2EIQA 2HE3A 1QMVA 1GSQA 3BOAA 4TRXA 3HKRA 2FWGA 3ZLPA 1MD3A 3QMXA 1O6JA 3DGQA 2VL3A 2KLXA 4G0LA 1FOVA 4KNDA 3VFIA 1OE8A 2R2JA 5IPGA 3VWVA 4BWSA 5IOXA 3VPQA 1CQHA 4PI2C 5G1LA 5A34A 3F0IA 2GZYA 3TU3B 4LL1B 3CQFA 3DRNA 3QR6A 4N10A 1XZOA 5D96A 22GSA 5A5KA 2JSZA 4PTSA 2X8CA 4AJ6A 3S9FA 1V2AA 1A2MA 1SK1A 4QQ7A 3D22A 3RHBA 5AGYA 2WW2A 2OKAA 4AJ8A 3BCKA 2HSMB 2H0HA 1GP1A 5H5RA 5HFKA 2CAQA 3CMIA 1K3YA 1RW1A 3KZQA 3N5OA 1PFOA 4K7IA 1S3CA 1M2BA 3BBYA 1XPVA 1BQ7A 1TJDA 4IW9A 2AB6A 1DE2A 1ZMAA 3C8EA 5J4UA 5ECHB 4Q5NA 4YAPA 4JR6A 1M7TA 2HYXA 5IO0A 3Q19A 5CP1A 1EWXA 2CX4A 3NZNA 2HQTA 3KIJA 5A4UA 2J23A 1M3JA 4KAEA 1XIYA 3I6AA 1YEWC 5BMUB 1AQXA 1FG4A 1YEPA 3H93A 1M2AA 1K0CA 2R0GA 1K3LA 5CAXA 3OR5A 2O5VA 3E0UA 4FQUA 1JLVA 2H6YA 2R0PA 3RHCA 3TJGA 4MJEA 3FZAA 3FR3A 3PPUA 5DALA 2IN3A 4ZBDA 4L0WA 3LXZA 2GZPA 2H76A 3HCZA 4KDXA 4MZCA 3F4RA 2L6DA 4D73B 1SL1B 5A5HB 1NM3A 2O3EA 3ZZXA 1SK2A 1S4BP 3P2AA 4PQ1A 1BF5A 4I97A 3RGBC 3CTFA 1PKZA 4PHZC 3R2QA 3ZL5A 3HXSA 3IOSA 6GSYA 5A4WA 2LKUA 2WB9A 1ZYPA 2GQKA 5EY6A 3Q6OA 5JCUA 2QSIA 3ZVJA 3UMAA 2VOCA 1WWJA 5IQYA 3ZREA 3MAKA 4RI7A 4K2DA 1B4PA 3QPMA 2HSMA 2HZEA 1JLWA 1HD2A 4V1Ag 2GSRA 4ZB6A 1GL8A 4PI0C 3KXOA 2VL2A 1DSBA 4KB3A 1K0AA 3GV1A 5G5EA 2OACA 4IS0A 2V6OA 1QQ2A 3HJOA 1K0MA 2PVOC 1UN2A 3F8UA 1GNEA 1WJKA 2MZCA 11GSA 3F3RA 5DJLA 3GN3A 2X49A 1M9BA 1QUWA 3NIVA 3CYNA 20GSA 1PKWA 3EYTA 2I9HA 2H71A 4RUVA 3L9SA 4EVMA 5BMUA 2L5LA 3CXGA 5ECNB 3HD5A 1WE0A 1AIUA 3KMOA 3PINA 1T8EB 2WFCA 4NHZA 4AKXB 3A2WA 3UJ1A 2LSTA 4N0ZA 2V6KA 2MBTA 4K2XA 2CQ9A 4NV5A 4IELA 2LJRA 1ERTA 4PNGA 4I8BA 1O73A 4IGJA 2HSYA 1WIKA 3UL3A 4D73A 1XW9A 3D21A 5A5HA 4TVEA 13GSA 4FIWA 2R0CA 2YJ7A 4HEA2 4WKWA 1Q4JA 4POLA 1R5PA 3QFAC 2P5RA 1Y1UA 1YQ1A 5IMDA 4I2TA 1XVQA 2DIZA 1MEKA 1WPIA 4AJ7A 1BAYA 2DJJA 4WXTA 5ECMB 1TOFA 1G6YA 1GLQA 1SL2B 4IBPA 1TK0B 4L0UA 4IJIA 2VCVA 5JCWA 1TK5B 1ST9A 3TKSE 2K8SA 2O85A 4BWQA 3TRPA 1E6BA 4LMWA 4KSMA 1YJ6A 2XPDA 2NDOA 1TTZA 5KOWA 4ECIA 2PUKC 3O3TA 5D9VA 2XPEA 3KP8A 4ZIJA 5F06A 2AYTA 4N0VA 2WRTA 1NHOA 1XG8A 2GZZA 2M46A 3P7XA 2C80A 2H6ZA 5D8IA 3R3EA 4YQMA 2DIYA 3WT2A 5J9CA 2PGTA 3P90A 1X5CA 3IXRA 2VKZG 4MNNA 4HU9A 4EO3A 1XWAA 2K6VA 3U6VA 2KOKA 2AJQB 4KW6A 4QMKA 2J9HA 3K8NA 3GURA 3M3MA 4EIPA 2HSHA 2WULA 3ZFLA 4AKHA 1GLPA 1F3AA 4OFTA 3DYRA 3KCMA 3FMWA 2QA1A 3KD0A 1V58A 3ZMLA 3HVNA 1RQMA 5HR3A 3VI5A 4F9ZA 4Q5FA 1TDIA 2TIRA 4JR4A 1ZYNA 1K0DA 1AW9A 4XS1A 2DBCA 2GSQA 1I9DA 3GTUB 3FR9A 3EMXA 3EINA 2MMAA 4IQAA 4ZBBA 3LG6A 3JCML 3E3EA 3O6TA 4XS6A 3H1NA 4BVYB 2X99A 4WBRD 4MH3A 2VIMA 2D2ZA 4IN0A 2GGTA 3UIWA 1PN9A 3QAWA 4A5PA 4XRDA 1AQWA 5JWRB 3EMPA 4MK3A 1Y6EA 4YQVA 1ZGNA 5DBQA 4V2NA 1UC7A 2FHEA 2LQOA 5IMCA 5EL8A 2H01A 1M3IA 6GSVA 2C3NA 3P8WA 1T1VA 2OE0A 3TRXA 2YZHA 4E68A 3C7MA 5G31A 3GFKA 1PSQA 3EVIA 4ECCA 1S3AA 2IMEA 2VCQA 4NXIA 2V2GA 4O5RA 4ACSA 4MF5A 5ENUA 1SJ6A 1M2DA 2H19A 3GA4A 5HR1A 1IYHA
chains in the Genus database with same CATH topology
2IWTA 4Q5QA 1GNWA 5IMFA 2TRXA 2A4VA 1EEJA 3FKFA 4WF4A 1UA5A 8GSSA 3TJKA 3ERWA 5GAPD 4JU5A 1GULA 1XOBA 4ZB7A 3DKSA 4OFNA 2R3XA 5HR0A 1O85A 4HZ4A 3PGTA 4KSOA 4POMA 1XWKA 2YWNA 3IRAA 2YCDA 6GSUA 1JZOA 4Q5RA 4NMUA 2PPTA 2HZFA 1B9XC 3L9VA 3GTUA 1PN0A 2L57A 4ID0A 4NWYA 3G7YA 4WR5A 4MJAA 2FY6A 3TOUA 3KGKA 4ML6A 3EE2A 5ECPB 4BVYA 2A2SA 2EIOA 5DDLA 4IJ3A 1GSUA 5CRGA 4GRFA 3VWWA 4G0IA 4I6XA 2OJLA 3TGZA 1NHYA 2B1KA 2WGRA 2H0IA 1ON4A 5JWOB 1ACVA 5KEJA 3IBHA 4NV2A 2YN1A 2VCXA 3D6IA 5AIVA 1BYEA 4TR1B 3FY7A 4X4JA 3FRCA 3FYGA 2KUCA 2O7KA 5DJMA 3RDWA 4EE0A 4CW9A 2KP2A 5AISA 3VI7A 1MDIA 1QXHA 1VF4A 2JSYA 2H1LA 3Q18A 1HNCA 5LCZA 2NTOA 2E2MA 2IFQB 2X64A 4AF2A 2H70A 3V1WA 1U3AA 3HYPA 2R37A 5A4VA 4FYBA 4JEDA 5ELGA 5D93A 2REMA 4GXZA 2DMMA 1URMA 5H5SA 2VO4A 1Z3EA 1E2YA 4I5QA 1WOUA 4XS4B 3MSZA 1TI3A 4KUNA 4MABA 4G19A 4GDFA 1SJZA 3W6GA 2HRFA 2CVBA 4OWYA 2P31A 4HJMA 3HMJG 5ECKB 3QOUA 1SYRA 2UV8G 1QK8A 3F6FA 3GKXA 3IHQA 3TKQA 5IPHA 2JZRA 2G0FA 5JWQB 4K5RA 2QC7A 1ZZYA 1J0FA 4K1FA 2CVDA 1MDJA 2RUEA 2B7KA 2C0FA 3A3TA 2XBQA 2H75A 4O5UA 3CBUA 4HI7A 4KGIA 2CX3A 4J57E 3CRTA 4GSTA 2MMOA 4F0BA 4IP1A 2IMFA 2YWIA 2F8FA 1A0FA 4QL7A 3ERFA 1N2AA 1WRYA 1R5AA 4IQ1A 1ERUA 3FEUA 3FZ9A 4O5QA 3GKMA 4LLRA 5A1NB 4TR1A 3QD9A 2GS3A 4MH2A 1W4VA 4TW5A 1EGRA 1TI1A 4TOPA 3HJMA 1USBA 2HRNA 1F3BA 4TR3A 1GWCA 2JADA 5F8BA 4EC0A 2IMDA 4TN8A 3TKRA 4G0KA 3O76A 1SVMA 4ZL9A 4GCIA 5CRWA 1KTEA 3FZ5A 5F05A 1F9MA 4YKGA 2IFQA 4L5LA 1FVKA 4ZL8A 1FB0A 1TXXA 4OO4A 4ECBA 2WCIA 1K3OA 4WBJA 3UOMA 3LSZA 1TK8B 5G2ZA 2O89A 1GSFA 2C3QA 4PXOA 3ZRDA 1AXDA 4XS4A 2OBIA 4DSSB 1XBSA 3GH6A 3KM6A 2B3SA 5DVBA 1XFLA 4G9HA 3FK8A 2A4HA 2E0QA 4KA0A 4LA1A 3ME8A 2FUG2 1FW1A 2YWMA 3PH9A 2PMTA 5G5FA 1EEMA 2V41A 3L78A 4X43A 3IA1A 2FLSA 1GUMA 2YV7A 5D9XA 4N30A 1ABAA 5LNKe 3HJPA 1HYUA 1T3BA 3FZ4A 4YAVA 1NSWA 3EU3A 2VD1A 2F3MA 3ZITA 1GSSA 3TJBA 3WYWA 3IHGA 1QFNA 3RPPA 4TXVA 3ZVJD 2VLTA 3IAS2 2IMKA 5KN1A 4E8EA 5IMAA 1B48A 5F07A 2C0GA 4MPFA 3MDKA 1EGOA 4MA9A 5IM9A 3M8NA 4G01A 5J41A 1XWBA 5A1NA 2C3TA 4KE3A 3GL5A 3IDVA 2L6CA 4O32A 5GAND 1X9MB 4DSQA 3GHAA 3Q74A 1SJIA 3HVXA 1A23A 4O7HA 1BJXA 2YWOA 4E8HA 4GF0A 1MD4A 2WS2A 4KH7A 1K0OA 1XVWA 3LORA 3TJFA 1XW5A 4ECJA 3TRQA 4LMVA 1Q98A 4CDOA 3E9JB 3EU4A 4JBBA 3VLNA 1SKWB 1ERWA 4AKIA 1SENA 2LRCA 1VF1A 4DSSA 1J08A 2CT6A 3M9JA 1AQVA 1UVZA 4OFMA 1TKDB 5J5NA 5KN3A 2FCHA 2H1AA 1OAZA 2DJ3A 5FT3A 2EFDA 3KH9A 4DSRA 3ZFBA 4WF5A 3KTLA 4MCUA 4K7NA 1SVLA 1B8XA 1A0RP 5BRTA 1M0UA 4JRRA 4F2IA 2HI7A 3CWGA 3HHVA 3WT1A 1B4QA 5J4VA 3D5JA 5J4YA 4PURA 4GQCA 1H75A 4F03A 1GTUA 1GSDA 17GSA 3EPTA 5IIZA 3N9JA 4MF6A 4FH8A 2LEGA 3UAPA 5ECSA 1GH2A 4JZQA 4XRAA 3MNGA 1BG5A 3C73A 4K9ZA 2V32A 3ED3A 5CRHA 4IHUA 3ZIJA 5J9BA 2LS5A 4GLTA 1EP8A 2NPBA 4TR4A 5GZZB 1JZRA 3IV4A 1U3IA 3ZTLA 2FA8A 4EXJA 2WDUA 4MJBA 4WETA 5HFGA 1SD8A 1TRUA 1VGLA 1TRSA 5J40A 2IPAA 1EV9A 2HLSA 2AAWA 3I69A 1JZDA 2RUFA 4NHWA 3F3QA 3UEMA 2BTOT 2HT9A 2FWEA 2GSSA 2RM6A 1FHEA 3QFBC 1VF2A 2B5XA 2H6XA 5F0GA 2DC5A 5AN1A 2LJAA 5FWGA 2FD3A 3PR8A 1YEXA 3I43A 4I2UA 4TR0A 3A5WA 1Z9HA 2C1YA 2DKHA 5COHA 4Z7XA 3EC3A 5CYYA 1Z7PA 3CSJA 4ZBAA 4HU7A 5EPFA 3D4TA 4CHSA 4ULXA 1Z6NA 1SYXA 3UBLA 4AKGA 1SVOA 1XCCA 5DAKB 2P5QA 3MIXA 2AV4A 2GT5A 3TKSC 4FYUA 1G7OA 4PNFA 2C0DA 4N11A 3F4SA 2VCZA 3ISOA 4YKFA 3LW9A 2ZUPA 4XHMA 2AHEA 2GDRA 4EDZA 2GT6A 2HFDA 1FO5A 1EV4A 2GTUA 2DJ0A 4V2LA 2NBSA 1FB6A 2FA4A 2LNSA 2MBSA 3RBTA 4H86A 2VLVA 2H1DA 2H0GA 2OE3A 1G7EA 3BCIA 3LQ7A 5IOWA 1TRVA 5EVOA 1TU7A 2K18A 3IAM2 2H1GA 5CO3A 3LJRA 1DUGA 3DVWA 2ON5A 1EZKA 3WGXA 1Z5YE 3HA9A 1FVJA 4PGTA 5A34B 1M99A 1A24A 2LJKA 2F51A 2VCWA 1ZYEA 1XW6A 2ALBA 2VCTA 3TDGA 2C0EA 2QKEA 3UVTA 2YNXA 5D73A 1CQGA 4MF7A 4MLYA 3G9BA 1X9WB 3KP9A 5DAKA 3KH7A 2B1LA 1T4ZA 4FO5A 5IMZA 2M72A 1O8XA 2RIIA 3WGEA 2F8AA 4F82A 3TJJA 2VLUA 4POBA 5DQSA 3LFLA 2ZCTA 2X8GA 4K7OA 2XBIA 2KP1A 2A2RA 5ECQB 2VD0A 4BA7A 1TRWA 4MJCA 4K0NA 3F63A 4KCAA 3GX0A 3IC4A 4MPGA 2DLXA 2PVQA 3HZ8A 3GRXA 1OKTA 4LL4B 3H8QA 4Z2UA 3M0FA 3HZ4A 1H4OA 2B5YA 1V9WA 2OADA 6GSSA 1SKRB 5ECRB 3US3A 3LWAA 1SK0A 3H79A 3HVSA 6GSTA 4PUFC 5AIXA 3DVXA 5DALB 2I3YA 5D9TA 5E59A 1PGTA 2DMLA 4ML1A 1XXUA 2BMXA 1YY7A 2LNTA 6GSWA 3DD3A 2CAIA 1JZWA 5ABRA 1NW2A 5DQYA 4MP4A 4MMMA 2DKIA 2L4QA 2LV3A 4QL9A 2AUVA 5GSSA 2K9FA 4K0GA 3LXTA 3DXBA 4IKHA 1ERVA 4GSSA 1GSYA 3BD2A 4OCEA 4EF0A 2LTKA 5D9WA 4K6XA 3TKSA 2F9SA 1YVLA 2HZEB 5ELAA 1KNGA 2GQMA 1V40A 2EC4A 3AY8A 1B9YC 2L5OA 1SL0B 4HZ2A 2L59A 2FWFA 2G2QA 1BX9A 4KF9A 2OBKA 3EURA 2A2PA 5G1KA 3HVVA 4HJ2A 1Z7RA 4BPYA 3GSTA 4AI6A 3GX8A 3C71A 4G2EA 2MYGA 5G30A 5ECOB 2TRCP 2GLRA 1EP7A 2PN8A 3J7Yb 2H8LA 5IO2A 3GSSA 1T7PB 1MDKA 1O7UA 4OO5A 1R4WA 2LUSA 2HNLA 4HQSA 1A2LA 3GH9A 3GMFA 2DJ2A 5ID2B 2JU5A 4GSNA 5JCGA 3DMLA 1YZXA 2WJUA 1KBNA 3F4TA 2R5GA 4KDUA 1QGVA 1EOGA 2EFHA 2X4AA 12GSA 1I5GA 1ZYQB 4IP6A 2JACA 4KDYA 5GSTA 3GNJA 3TB2A 3GYKA 4PX1A 1ML6A 1ZCPA 2CA8A 4OD7A 2I4AA 3SBCA 3TKPA 1F2EA 3IE3A 4JE1A 2FGXA 4CY8A 3ERGA 3C1RA 2B5EA 4HUAA 3CSHA 1ILOA 2MMZA 2DJ1A 4L8EA 4OMVA 3QAVA 2XHFA 2O87A 1GRXA 3H4KA 2H1BA 3IC8A 1N25A 2L4CA 3J7Yk 4OCFA 2H66A 4EUYA 2QA2A 1OKDA 19GSA 4V1Ap 1KEBA 1V57A 5C00A 2VM1A 1FAAA 2C4JA 3GKNA 4N3ZA 3LYKA 3CTGA 1YKCA 10GSA 1OC9B 1MTCA 4ZB9A 4BL7B 3DIEA 3SWLA 5CRDA 2DSAA 3M1GA 3D4MA 1ZL9A 1GSEA 1S3DA 1THXA 4G10A 5LD0A 1F37A 5HR2A 1EOHA 2IJYA 2PERA 2EFEA 2Z9SA 1T4YA 1HNAA 2R4VA 3LGCA 3GKKA 2DJKA 3G7IA 2I81A 18GSA 3MYDA 14GSA 2GSTA 2YJHA 5ID2A 2VL9A 3QAGA 3TUEA 5J47A 2VM2A 2YANA 1SKSB 3KTBA 3F6DA 9GSSA 1AUCA 1PQNA 1XOAA 2FWHA 4GTUA 4WEYA 3KEBA 5B7CA 1BG1A 2I1UA 3IK7A 1GTBA 1OC8A 1OYJA 1GUKA 1DE1A 2O8VB 1SD9A 5B6MA 2QGVA 3KJYA 1F6MC 5B8BA 3A2VA 1YDKA 2JZSA 1OVNA 2YP6A 3GL3A 3UARA 3APSA 3FR6A 4ILFA 1JFUA 1LU4A 3U5RE 4NPBA 2JL4A 4YH2A 3ZIVA 2HRKB 1LJRA 1PD21 4Z2RA 2EFCA 1GTIA 3RAZA 1XWGA 5ECIB 1DBYA 2OA7A 4PUAA 2B6MA 2KHPA 3A2XA 4BVXB 2XC2A 5KN0A 1THOA 2OE1A 3F9UA 1X0RA 3HDCA 2LQQA 4ICYA 1LBKA 2MMNA 1Z6MA 3VK9A 1OC9A 4BL7A 1PMTA 3ZMKA 1GUHA 4RQRA 1IYIA 1XWCA 4POKA 1YF0A 2ES7A 4HQZA 3L4NA 3VURA 1OE7A 5KN2A 2P0GA 3WD6A 4RQXA 2WZ9A 1V98A 5B6NA 3DEXA 3LEFA 5HFIA 2YOIA 4GWRA 2GQLA 3FW2A 4O92A 1TXUA 3M9KA 4XTSA 3FHKA 3QDNA 1OC3A 2NVLA 2EIRA 4DVCA 3L9UA 1HNBA 2HRAA 2LRTA 1A8LA 3IPZA 5CREA 1Y25A 3ZYWA 3HY2A 1R26A 5HQPA 5INYA 1U88A 3VWXA 3W8SA 2IIYA 2CZ2A 2K8VA 1TP9A 4FYCA 4K5SA 4HS1A 4KX4A 1PX7A 4J56E 2YPMA 4K8MA 2R6KA 5FHIA 1ZOFA 4TXOB 3MWHA 4MDCA 1AC1A 4XCSA 1YF1A 1T00A 2V1MA 4J2FA 4P3YB 5CNWA 5J3RA 4CY6A 4V2MA 2YV9A 2HSNB 2PU9C 2ZNMA 1K0NA 4YQUA 4GQFA 3I9V2 5ECLB 4PQIA 4PQHA 16GSA 2HRKA 1PL2A 3APQA 4ZB8A 3DWVA 4EKZA 4RI6A 2ON7A 1TW9A 2JZTA 4Z2TA 5IMVA 2OT3A 4MZWA 1J9BA 2GVPA 1PL1A 2FNOA 4BVXA 1X5DA 4MZBA 3QCPA 4W66A 2N5AA 3TCOA 5DCGA 3VPTA 1M9AA 1VF3A 1HQOA 3NOFA 3BJ5A 1U6TA 3GIXA 2CV4A 3UVHA 1GTAA 2UZ8A 1U87A 5H5QA 1X9SB 2N5FA 1BEDA 3W8JA 4EDYA 4HDEA 2VAFA 2PBJA 4DEJA 2RM5A 2N5BA 1RK4A 1FOHA 2VUPA 5C04A 1A8YA 1JHBA 3CRUA 2C8UA 2HXKA 1O81A 3ME7A 2X8HA 2H74A 3LYPA 2BJXA 5B8AA 2IL3A 4TKYA 1PA3A 4WR4A 4USSA 4ZL7A 5DCHA 2CZ3A 2RLIA 2B7JA 4NAXA 1A2JA 5L71A 1W89A 1AAZA 1G0TA 1R7HA 3CSIA 5KOXA 2H72A 1PRXA 2H30A 3KMNA 3L0HA 1G6WA 1O8WA 1K0BA 4X1UA 4EL1A 3WGDA 1YKAA 4TXOA 3EWLA 2PWJA 7GSSA 4ZXGA 3D0ZA 3IR4A 4AGSA 2HSNA 4ZILA 1N8JA 4X0XA 6GSXA 3RPNA 1WP0A 4XIHA 4EIQA 1VRSD 2E7PA 4ISDA 2VL2C 2LRNA 4IVFA 1X5EA 3G7JA 1SU9A 3TOTA 3C1SA 3GUSA 1PX6A 3UBKA 4KCEA 1TU8A 4HOJA 1C72A 3A5IA 2E2GA 5E4WA 3IK9A 2M80A 2IMIA 4L5OA 2H73A 2YZUA 3VWUA 1WMJA 4F0CA 2CVKA 3APOA 2EIQA 2HE3A 1QMVA 1GSQA 3BOAA 4TRXA 3HKRA 2FWGA 3ZLPA 1MD3A 3QMXA 1O6JA 3DGQA 2VL3A 2KLXA 4G0LA 1FOVA 4KNDA 3VFIA 1OE8A 2R2JA 5IPGA 3VWVA 4BWSA 5IOXA 3VPQA 1CQHA 5G1LA 5A34A 3F0IA 2GZYA 3TU3B 4LL1B 3DRNA 3QR6A 4N10A 1XZOA 5D96A 22GSA 5A5KA 2JSZA 4PTSA 2X8CA 4AJ6A 3S9FA 1V2AA 1A2MA 1SK1A 4QQ7A 3D22A 3RHBA 5AGYA 2OKAA 4AJ8A 3BCKA 2HSMB 2H0HA 1GP1A 5H5RA 5HFKA 2CAQA 3CMIA 1K3YA 1RW1A 3KZQA 3N5OA 4K7IA 1S3CA 1M2BA 3BBYA 1XPVA 1BQ7A 1TJDA 4IW9A 2AB6A 1DE2A 1ZMAA 3C8EA 5J4UA 5ECHB 4Q5NA 4YAPA 4JR6A 1M7TA 2HYXA 5IO0A 3Q19A 5CP1A 1EWXA 2CX4A 3NZNA 2HQTA 3KIJA 5A4UA 2J23A 4KAEA 1XIYA 3I6AA 5BMUB 1AQXA 1FG4A 1YEPA 3H93A 1M2AA 1K0CA 2R0GA 1K3LA 5CAXA 3OR5A 2O5VA 3E0UA 4FQUA 1JLVA 2H6YA 2R0PA 3RHCA 3TJGA 4MJEA 3FZAA 3FR3A 3PPUA 5DALA 2IN3A 4ZBDA 4L0WA 3LXZA 2GZPA 2H76A 3HCZA 4KDXA 4MZCA 3F4RA 2L6DA 4D73B 1SL1B 5A5HB 1NM3A 3ZZXA 1SK2A 3P2AA 4PQ1A 1BF5A 4I97A 3CTFA 1PKZA 3R2QA 3ZL5A 3HXSA 3IOSA 6GSYA 5A4WA 2LKUA 2WB9A 1ZYPA 2GQKA 5EY6A 3Q6OA 5JCUA 2QSIA 3ZVJA 3UMAA 2VOCA 1WWJA 5IQYA 3ZREA 3MAKA 4RI7A 4K2DA 1B4PA 3QPMA 2HSMA 2HZEA 1JLWA 1HD2A 4V1Ag 2GSRA 4ZB6A 1GL8A 3KXOA 2VL2A 1DSBA 4KB3A 1K0AA 3GV1A 5G5EA 2OACA 4IS0A 2V6OA 1QQ2A 3HJOA 1K0MA 2PVOC 1UN2A 3F8UA 1GNEA 1WJKA 2MZCA 11GSA 3F3RA 5DJLA 3GN3A 2X49A 1M9BA 1QUWA 3NIVA 3CYNA 20GSA 1PKWA 3EYTA 2I9HA 2H71A 4RUVA 3L9SA 4EVMA 5BMUA 2L5LA 3CXGA 5ECNB 3HD5A 1WE0A 1AIUA 3KMOA 3PINA 1T8EB 2WFCA 4NHZA 4AKXB 3A2WA 3UJ1A 2LSTA 4N0ZA 2V6KA 2MBTA 4K2XA 2CQ9A 4NV5A 4IELA 2LJRA 1ERTA 4PNGA 4I8BA 1O73A 4IGJA 2HSYA 1WIKA 3UL3A 4D73A 1XW9A 3D21A 5A5HA 4TVEA 13GSA 4FIWA 2R0CA 2YJ7A 4HEA2 4WKWA 1Q4JA 4POLA 1R5PA 3QFAC 2P5RA 1Y1UA 1YQ1A 5IMDA 4I2TA 1XVQA 2DIZA 1MEKA 1WPIA 4AJ7A 1BAYA 2DJJA 4WXTA 5ECMB 1TOFA 1G6YA 1GLQA 1SL2B 4IBPA 1TK0B 4L0UA 4IJIA 2VCVA 5JCWA 1TK5B 1ST9A 3TKSE 2K8SA 2O85A 4BWQA 3TRPA 1E6BA 4LMWA 4KSMA 1YJ6A 2XPDA 2NDOA 1TTZA 5KOWA 4ECIA 2PUKC 3O3TA 5D9VA 2XPEA 3KP8A 4ZIJA 5F06A 2AYTA 4N0VA 2WRTA 1NHOA 2GZZA 2M46A 3P7XA 2C80A 2H6ZA 5D8IA 3R3EA 4YQMA 2DIYA 3WT2A 5J9CA 2PGTA 3P90A 1X5CA 3IXRA 2VKZG 4MNNA 4HU9A 4EO3A 1XWAA 2K6VA 3U6VA 2KOKA 2AJQB 4KW6A 4QMKA 2J9HA 3K8NA 3GURA 3M3MA 4EIPA 2HSHA 2WULA 3ZFLA 4AKHA 1GLPA 1F3AA 4OFTA 3DYRA 3KCMA 3FMWA 2QA1A 3KD0A 1V58A 3ZMLA 1RQMA 5HR3A 3VI5A 4F9ZA 4Q5FA 1TDIA 2TIRA 4JR4A 1ZYNA 1K0DA 1AW9A 4XS1A 2DBCA 2GSQA 1I9DA 3GTUB 3FR9A 3EMXA 3EINA 2MMAA 4IQAA 4ZBBA 3LG6A 3JCML 3E3EA 3O6TA 4XS6A 3H1NA 4BVYB 2X99A 4WBRD 4MH3A 2VIMA 2D2ZA 4IN0A 2GGTA 3UIWA 1PN9A 3QAWA 4A5PA 4XRDA 1AQWA 5JWRB 3EMPA 4MK3A 1Y6EA 4YQVA 1ZGNA 5DBQA 4V2NA 1UC7A 2FHEA 2LQOA 5IMCA 5EL8A 2H01A 6GSVA 2C3NA 3P8WA 1T1VA 2OE0A 3TRXA 2YZHA 4E68A 3C7MA 5G31A 3GFKA 1PSQA 3EVIA 4ECCA 1S3AA 2IMEA 2VCQA 4NXIA 2V2GA 4O5RA 4ACSA 4MF5A 5ENUA 1SJ6A 1M2DA 2H19A 3GA4A 5HR1A 1IYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWT A;  4Q5Q A;  1GNW A;  5IMF A;  2TRX A;  2A4V A;  1EEJ A;  3FKF A;  4WF4 A;  1UA5 A;  8GSS A;  3TJK A;  3ERW A;  5GAP D;  4JU5 A;  1GUL A;  1XOB A;  3DKS A;  4OFN A;  2R3X A;  5HR0 A;  1O85 A;  4HZ4 A;  3PGT A;  4KSO A;  4POM A;  1XWK A;  2YWN A;  3IRA A;  2YCD A;  6GSU A;  1JZO A;  4Q5R A;  4NMU A;  2PPT A;  2HZF A;  1B9X C;  3L9V A;  3GTU A;  2L57 A;  4ID0 A;  4NWY A;  3G7Y A;  4WR5 A;  4MJA A;  2FY6 A;  3TOU A;  3KGK A;  4ML6 A;  3EE2 A;  5ECP B;  4BVY A;  2A2S A;  2EIO A;  5DDL A;  4IJ3 A;  1GSU A;  5CRG A;  4GRF A;  3VWW A;  4I6X A;  4G0I A;  2OJL A;  3TGZ A;  1NHY A;  2B1K A;  2WGR A;  2H0I A;  1ON4 A;  5JWO B;  1ACV A;  5KEJ A;  3IBH A;  4NV2 A;  2YN1 A;  2VCX A;  3D6I A;  5AIV A;  1BYE A;  4TR1 B;  3FY7 A;  3FRC A;  3FYG A;  2KUC A;  2O7K A;  5DJM A;  3RDW A;  4EE0 A;  4CW9 A;  2KP2 A;  5AIS A;  3VI7 A;  1MDI A;  1QXH A;  1VF4 A;  2JSY A;  3Q18 A;  1HNC A;  5LCZ A;  2NTO A;  2E2M A;  2IFQ B;  2X64 A;  4AF2 A;  2H70 A;  3V1W A;  1U3A A;  3HYP A;  2R37 A;  5A4V A;  4FYB A;  4JED A;  5ELG A;  5D93 A;  2REM A;  4GXZ A;  2DMM A;  1URM A;  5H5S A;  2VO4 A;  1Z3E A;  1E2Y A;  4I5Q A;  1WOU A;  4XS4 B;  3MSZ A;  1TI3 A;  4KUN A;  4MAB A;  4G19 A;  1SJZ A;  3W6G A;  2HRF A;  2CVB A;  4OWY A;  2P31 A;  4HJM A;  5ECK B;  3QOU A;  1SYR A;  1QK8 A;  3F6F A;  3GKX A;  3IHQ A;  3TKQ A;  5IPH A;  2JZR A;  2G0F A;  5JWQ B;  2QC7 A;  1ZZY A;  1J0F A;  4K1F A;  2CVD A;  1MDJ A;  2RUE A;  2B7K A;  2C0F A;  3A3T A;  2XBQ A;  2H75 A;  3CBU A;  4HI7 A;  4KGI A;  2CX3 A;  4J57 E;  3CRT A;  4GST A;  2MMO A;  4F0B A;  4IP1 A;  2IMF A;  2YWI A;  2F8F A;  1A0F A;  4QL7 A;  3ERF A;  1N2A A;  1WRY A;  1R5A A;  4IQ1 A;  1ERU A;  3FEU A;  3FZ9 A;  3GKM A;  4LLR A;  4TR1 A;  3QD9 A;  2GS3 A;  4MH2 A;  1W4V A;  4TW5 A;  1EGR A;  1TI1 A;  4TOP A;  3HJM A;  1USB A;  2HRN A;  1F3B A;  4TR3 A;  1GWC A;  2JAD A;  5F8B A;  4EC0 A;  2IMD A;  4TN8 A;  3TKR A;  4G0K A;  3O76 A;  4ZL9 A;  4GCI A;  5CRW A;  1KTE A;  3FZ5 A;  5F05 A;  1F9M A;  2IFQ A;  4L5L A;  1FVK A;  4ZL8 A;  1FB0 A;  1TXX A;  4OO4 A;  4ECB A;  2WCI A;  1K3O A;  4WBJ A;  3UOM A;  3LSZ A;  1TK8 B;  5G2Z A;  2O89 A;  1GSF A;  2C3Q A;  4PXO A;  3ZRD A;  1AXD A;  4XS4 A;  2OBI A;  4DSS B;  1XBS A;  3GH6 A;  3KM6 A;  2B3S A;  5DVB A;  1XFL A;  4G9H A;  3FK8 A;  2E0Q A;  4KA0 A;  4LA1 A;  3ME8 A;  2FUG 2;  1FW1 A;  2YWM A;  3PH9 A;  2PMT A;  5G5F A;  1EEM A;  2V41 A;  3L78 A;  4X43 A;  3IA1 A;  2FLS A;  1GUM A;  2YV7 A;  5D9X A;  4N30 A;  1ABA A;  5LNK e;  3HJP A;  1HYU A;  1T3B A;  3FZ4 A;  4YAV A;  1NSW A;  3EU3 A;  2VD1 A;  2F3M A;  3ZIT A;  1GSS A;  3TJB A;  3WYW A;  1QFN A;  3RPP A;  4TXV A;  3ZVJ D;  2VLT A;  3IAS 2;  2IMK A;  5KN1 A;  4E8E A;  5IMA A;  1B48 A;  5F07 A;  2C0G A;  4MPF A;  3MDK A;  1EGO A;  4MA9 A;  5IM9 A;  3M8N A;  1XWB A;  5J41 A;  2C3T A;  4KE3 A;  3GL5 A;  3IDV A;  2L6C A;  4O32 A;  5GAN D;  1X9M B;  4DSQ A;  3GHA A;  3Q74 A;  1SJI A;  3HVX A;  1A23 A;  4O7H A;  1BJX A;  2YWO A;  4E8H A;  4GF0 A;  1MD4 A;  2WS2 A;  4KH7 A;  1K0O A;  1XVW A;  3LOR A;  3TJF A;  1XW5 A;  4ECJ A;  3TRQ A;  4LMV A;  1Q98 A;  4CDO A;  3E9J B;  3EU4 A;  4JBB A;  3VLN A;  1SKW B;  1ERW A;  1SEN A;  2LRC A;  1VF1 A;  4DSS A;  1J08 A;  2CT6 A;  3M9J A;  1AQV A;  1UVZ A;  4OFM A;  1TKD B;  5J5N A;  5KN3 A;  2FCH A;  2H1A A;  1OAZ A;  2DJ3 A;  5FT3 A;  3KH9 A;  4DSR A;  3ZFB A;  4WF5 A;  3KTL A;  4MCU A;  4K7N A;  1A0R P;  1B8X A;  1M0U A;  4JRR A;  4F2I A;  2HI7 A;  3HHV A;  3WT1 A;  1B4Q A;  3D5J A;  4PUR A;  4GQC A;  1H75 A;  4F03 A;  1GTU A;  1GSD A;  17GS A;  5IIZ A;  3N9J A;  4MF6 A;  4FH8 A;  2LEG A;  3UAP A;  5ECS A;  1GH2 A;  4JZQ A;  4XRA A;  3MNG A;  1BG5 A;  4K9Z A;  3C73 A;  2V32 A;  3ED3 A;  5CRH A;  4IHU A;  3ZIJ A;  5J9B A;  2LS5 A;  4GLT A;  1EP8 A;  2NPB A;  4TR4 A;  5GZZ B;  1JZR A;  3IV4 A;  1U3I A;  3ZTL A;  2FA8 A;  4EXJ A;  2WDU A;  4MJB A;  4WET A;  5HFG A;  1SD8 A;  1TRU A;  1VGL A;  1TRS A;  2IPA A;  1EV9 A;  2HLS A;  2AAW A;  3I69 A;  1JZD A;  2RUF A;  4NHW A;  3F3Q A;  3UEM A;  2BTO T;  2HT9 A;  2FWE A;  2GSS A;  2RM6 A;  1FHE A;  3QFB C;  1VF2 A;  2B5X A;  2H6X A;  5F0G A;  2DC5 A;  5AN1 A;  2FD3 A;  5FWG A;  2LJA A;  3PR8 A;  1YEX A;  3I43 A;  4I2U A;  4TR0 A;  3A5W A;  1Z9H A;  2C1Y A;  5COH A;  4Z7X A;  3EC3 A;  5CYY A;  1Z7P A;  3CSJ A;  4ZBA A;  4HU7 A;  5EPF A;  3D4T A;  4CHS A;  4ULX A;  1Z6N A;  1SYX A;  3UBL A;  1XCC A;  5DAK B;  2P5Q A;  2AV4 A;  2GT5 A;  3TKS C;  4FYU A;  1G7O A;  4PNF A;  2C0D A;  4N11 A;  3F4S A;  2VCZ A;  3ISO A;  2ZUP A;  4XHM A;  2AHE A;  2GDR A;  4EDZ A;  2GT6 A;  2HFD A;  1FO5 A;  1EV4 A;  2GTU A;  2DJ0 A;  4V2L A;  2NBS A;  1FB6 A;  2FA4 A;  2LNS A;  2MBS A;  3RBT A;  4H86 A;  2VLV A;  2H1D A;  2H0G A;  2OE3 A;  1G7E A;  3BCI A;  3LQ7 A;  5IOW A;  1TRV A;  5EVO A;  1TU7 A;  2K18 A;  3IAM 2;  2H1G A;  5CO3 A;  3LJR A;  1DUG A;  3DVW A;  2ON5 A;  1EZK A;  3WGX A;  1Z5Y E;  3HA9 A;  1FVJ A;  4PGT A;  1M99 A;  1A24 A;  2LJK A;  2F51 A;  2VCW A;  1ZYE A;  1XW6 A;  2ALB A;  2VCT A;  3TDG A;  2C0E A;  2QKE A;  3UVT A;  2YNX A;  5D73 A;  1CQG A;  4MF7 A;  4MLY A;  3G9B A;  1X9W B;  3KP9 A;  5DAK A;  3KH7 A;  2B1L A;  1T4Z A;  4FO5 A;  5IMZ A;  2M72 A;  1O8X A;  2RII A;  3WGE A;  2F8A A;  4F82 A;  3TJJ A;  2VLU A;  4POB A;  5DQS A;  3LFL A;  2ZCT A;  2X8G A;  4K7O A;  2XBI A;  2KP1 A;  2A2R A;  5ECQ B;  2VD0 A;  4BA7 A;  1TRW A;  4MJC A;  4K0N A;  3F63 A;  4KCA A;  3GX0 A;  3IC4 A;  4MPG A;  2DLX A;  2PVQ A;  3HZ8 A;  3GRX A;  1OKT A;  4LL4 B;  3H8Q A;  3M0F A;  3HZ4 A;  1H4O A;  2B5Y A;  1V9W A;  2OAD A;  6GSS A;  1SKR B;  5ECR B;  3US3 A;  3LWA A;  1SK0 A;  3H79 A;  3HVS A;  6GST A;  4PUF C;  5AIX A;  3DVX A;  5DAL B;  2I3Y A;  5D9T A;  5E59 A;  1PGT A;  2DML A;  4ML1 A;  1XXU A;  2BMX A;  1YY7 A;  2LNT A;  6GSW A;  3DD3 A;  2CAI A;  1JZW A;  5ABR A;  1NW2 A;  5DQY A;  4MP4 A;  4MMM A;  2L4Q A;  2LV3 A;  4QL9 A;  2AUV A;  5GSS A;  2K9F A;  4K0G A;  3LXT A;  3DXB A;  4IKH A;  1ERV A;  4GSS A;  1GSY A;  3BD2 A;  4OCE A;  4EF0 A;  2LTK A;  5D9W A;  4K6X A;  3TKS A;  2F9S A;  5ELA A;  1KNG A;  2HZE B;  2GQM A;  1V40 A;  2EC4 A;  3AY8 A;  1B9Y C;  2L5O A;  1SL0 B;  4HZ2 A;  2L59 A;  2FWF A;  2G2Q A;  1BX9 A;  4KF9 A;  2OBK A;  3EUR A;  5G1K A;  3HVV A;  4HJ2 A;  1Z7R A;  4BPY A;  3GST A;  3GX8 A;  3C71 A;  4G2E A;  2MYG A;  5G30 A;  5ECO B;  2TRC P;  2GLR A;  1EP7 A;  2PN8 A;  3J7Y b;  2H8L A;  5IO2 A;  3GSS A;  1T7P B;  1MDK A;  1O7U A;  4OO5 A;  1R4W A;  2LUS A;  2HNL A;  4HQS A;  1A2L A;  3GH9 A;  3GMF A;  2DJ2 A;  5ID2 B;  2JU5 A;  4GSN A;  5JCG A;  3DML A;  1YZX A;  2WJU A;  1KBN A;  3F4T A;  2R5G A;  4KDU A;  1QGV A;  1EOG A;  12GS A;  1I5G A;  1ZYQ B;  4IP6 A;  2JAC A;  4KDY A;  5GST A;  3GNJ A;  3TB2 A;  3GYK A;  4PX1 A;  1ML6 A;  1ZCP A;  2CA8 A;  4OD7 A;  2I4A A;  3SBC A;  3TKP A;  1F2E A;  3IE3 A;  4JE1 A;  2FGX A;  3ERG A;  3C1R A;  2B5E A;  4HUA A;  3CSH A;  1ILO A;  2MMZ A;  2DJ1 A;  4L8E A;  4OMV A;  3QAV A;  2XHF A;  2O87 A;  1GRX A;  3H4K A;  2H1B A;  3IC8 A;  2L4C A;  3J7Y k;  4OCF A;  2H66 A;  4EUY A;  1OKD A;  19GS A;  4V1A p;  1KEB A;  1V57 A;  5C00 A;  2VM1 A;  1FAA A;  2C4J A;  3GKN A;  3LYK A;  3CTG A;  1YKC A;  10GS A;  1OC9 B;  1MTC A;  4ZB9 A;  4BL7 B;  3DIE A;  3SWL A;  5CRD A;  2DSA A;  3M1G A;  3D4M A;  1ZL9 A;  1GSE A;  1S3D A;  1THX A;  4G10 A;  5LD0 A;  1F37 A;  5HR2 A;  1EOH A;  2IJY A;  2PER A;  2Z9S A;  1T4Y A;  1HNA A;  2R4V A;  3LGC A;  3GKK A;  2DJK A;  3G7I A;  2I81 A;  18GS A;  14GS A;  2GST A;  2YJH A;  5ID2 A;  2VL9 A;  3QAG A;  3TUE A;  2VM2 A;  2YAN A;  1SKS B;  3KTB A;  3F6D A;  9GSS A;  1AUC A;  1PQN A;  1XOA A;  2FWH A;  4GTU A;  4WEY A;  3KEB A;  5B7C A;  2I1U A;  3IK7 A;  1GTB A;  1OC8 A;  1OYJ A;  1GUK A;  1DE1 A;  2O8V B;  1SD9 A;  5B6M A;  2QGV A;  3KJY A;  1F6M C;  5B8B A;  3A2V A;  1YDK A;  2JZS A;  1OVN A;  2YP6 A;  3GL3 A;  3UAR A;  3APS A;  3FR6 A;  4ILF A;  1JFU A;  1LU4 A;  3U5R E;  4NPB A;  2JL4 A;  4YH2 A;  3ZIV A;  2HRK B;  1LJR A;  1PD2 1;  1GTI A;  3RAZ A;  1XWG A;  5ECI B;  1DBY A;  2OA7 A;  4PUA A;  2B6M A;  2KHP A;  3A2X A;  4BVX B;  2XC2 A;  5KN0 A;  1THO A;  2OE1 A;  3F9U A;  1X0R A;  3HDC A;  2LQQ A;  1LBK A;  2MMN A;  1Z6M A;  3VK9 A;  1OC9 A;  4BL7 A;  1PMT A;  3ZMK A;  1GUH A;  4RQR A;  1IYI A;  1XWC A;  4POK A;  1YF0 A;  2ES7 A;  4HQZ A;  3L4N A;  3VUR A;  1OE7 A;  5KN2 A;  2P0G A;  3WD6 A;  4RQX A;  2WZ9 A;  1V98 A;  5B6N A;  3DEX A;  3LEF A;  5HFI A;  2YOI A;  4GWR A;  2GQL A;  3FW2 A;  4O92 A;  3M9K A;  4XTS A;  3FHK A;  3QDN A;  1OC3 A;  2NVL A;  2EIR A;  4DVC A;  3L9U A;  1HNB A;  2HRA A;  2LRT A;  1A8L A;  3IPZ A;  5CRE A;  1Y25 A;  3ZYW A;  3HY2 A;  1R26 A;  5HQP A;  5INY A;  1U88 A;  3VWX A;  3W8S A;  2IIY A;  2CZ2 A;  2K8V A;  1TP9 A;  4FYC A;  4HS1 A;  4KX4 A;  1PX7 A;  4J56 E;  2YPM A;  4K8M A;  2R6K A;  5FHI A;  1ZOF A;  4TXO B;  3MWH A;  4MDC A;  1AC1 A;  4XCS A;  1YF1 A;  1T00 A;  2V1M A;  4J2F A;  4P3Y B;  5CNW A;  5J3R A;  4V2M A;  2YV9 A;  2HSN B;  2PU9 C;  2ZNM A;  1K0N A;  4YQU A;  4GQF A;  3I9V 2;  5ECL B;  4PQI A;  4PQH A;  16GS A;  2HRK A;  1PL2 A;  3APQ A;  4ZB8 A;  3DWV A;  4EKZ A;  4RI6 A;  2ON7 A;  1TW9 A;  2JZT A;  5IMV A;  4MZW A;  1J9B A;  2GVP A;  1PL1 A;  2FNO A;  4BVX A;  1X5D A;  4MZB A;  3QCP A;  2N5A A;  3TCO A;  5DCG A;  3VPT A;  1M9A A;  1VF3 A;  1HQO A;  3NOF A;  3BJ5 A;  1U6T A;  3GIX A;  2CV4 A;  3UVH A;  1GTA A;  2UZ8 A;  1U87 A;  5H5Q A;  1X9S B;  2N5F A;  1BED A;  3W8J A;  4EDY A;  4HDE A;  2VAF A;  2PBJ A;  4DEJ A;  2RM5 A;  2N5B A;  1RK4 A;  2VUP A;  5C04 A;  1A8Y A;  1JHB A;  3CRU A;  2C8U A;  2HXK A;  1O81 A;  3ME7 A;  2X8H A;  2H74 A;  3LYP A;  2BJX A;  5B8A A;  2IL3 A;  4TKY A;  1PA3 A;  4WR4 A;  4USS A;  4ZL7 A;  5DCH A;  2CZ3 A;  2RLI A;  2B7J A;  4NAX A;  1A2J A;  5L71 A;  1W89 A;  1AAZ A;  1G0T A;  1R7H A;  3CSI A;  2H72 A;  1PRX A;  2H30 A;  3KMN A;  3L0H A;  1G6W A;  1O8W A;  1K0B A;  4X1U A;  4EL1 A;  3WGD A;  1YKA A;  4TXO A;  3EWL A;  2PWJ A;  7GSS A;  4ZXG A;  3D0Z A;  3IR4 A;  4AGS A;  4ZIL A;  1N8J A;  4X0X A;  6GSX A;  3RPN A;  1WP0 A;  4XIH A;  1VRS D;  2E7P A;  4ISD A;  2VL2 C;  2LRN A;  4IVF A;  1X5E A;  3G7J A;  1SU9 A;  3TOT A;  3C1S A;  3GUS A;  1PX6 A;  3UBK A;  4KCE A;  1TU8 A;  4HOJ A;  1C72 A;  2E2G A;  5E4W A;  3IK9 A;  2M80 A;  2IMI A;  4L5O A;  2H73 A;  2YZU A;  3VWU A;  1WMJ A;  4F0C A;  2CVK A;  3APO A;  2EIQ A;  2HE3 A;  1QMV A;  1GSQ A;  3BOA A;  4TRX A;  3HKR A;  2FWG A;  3ZLP A;  1MD3 A;  3QMX A;  1O6J A;  3DGQ A;  2VL3 A;  2KLX A;  4G0L A;  1FOV A;  4KND A;  3VFI A;  1OE8 A;  2R2J A;  5IPG A;  3VWV A;  4BWS A;  5IOX A;  3VPQ A;  1CQH A;  5G1L A;  3F0I A;  2GZY A;  4LL1 B;  3DRN A;  3QR6 A;  4N10 A;  1XZO A;  5D96 A;  22GS A;  5A5K A;  2JSZ A;  4PTS A;  2X8C A;  4AJ6 A;  3S9F A;  1V2A A;  1A2M A;  1SK1 A;  4QQ7 A;  3D22 A;  3RHB A;  5AGY A;  2OKA A;  4AJ8 A;  3BCK A;  2HSM B;  2H0H A;  1GP1 A;  5H5R A;  5HFK A;  2CAQ A;  3CMI A;  1K3Y A;  1RW1 A;  3KZQ A;  3N5O A;  4K7I A;  1S3C A;  1M2B A;  3BBY A;  1XPV A;  1BQ7 A;  1TJD A;  4IW9 A;  2AB6 A;  1DE2 A;  1ZMA A;  3C8E A;  5J4U A;  5ECH B;  4Q5N A;  4YAP A;  4JR6 A;  1M7T A;  2HYX A;  5IO0 A;  3Q19 A;  5CP1 A;  1EWX A;  2CX4 A;  3NZN A;  2HQT A;  3KIJ A;  5A4U A;  2J23 A;  4KAE A;  1XIY A;  3I6A A;  1AQX A;  1FG4 A;  1YEP A;  3H93 A;  1M2A A;  1K0C A;  1K3L A;  5CAX A;  3OR5 A;  3E0U A;  4FQU A;  1JLV A;  2H6Y A;  3RHC A;  3TJG A;  4MJE A;  3FZA A;  3FR3 A;  3PPU A;  5DAL A;  2IN3 A;  4ZBD A;  4L0W A;  3LXZ A;  2GZP A;  2H76 A;  3HCZ A;  4KDX A;  4MZC A;  3F4R A;  2L6D A;  4D73 B;  1SL1 B;  1NM3 A;  3ZZX A;  1SK2 A;  3P2A A;  4PQ1 A;  4I97 A;  3CTF A;  1PKZ A;  3R2Q A;  3ZL5 A;  3HXS A;  3IOS A;  6GSY A;  5A4W A;  2LKU A;  2WB9 A;  2GQK A;  5EY6 A;  3Q6O A;  5JCU A;  2QSI A;  3ZVJ A;  3UMA A;  2VOC A;  1WWJ A;  5IQY A;  3ZRE A;  3MAK A;  4RI7 A;  4K2D A;  1B4P A;  3QPM A;  2HSM A;  2HZE A;  1JLW A;  1HD2 A;  4V1A g;  2GSR A;  4ZB6 A;  1GL8 A;  3KXO A;  2VL2 A;  1DSB A;  4KB3 A;  1K0A A;  3GV1 A;  5G5E A;  2OAC A;  4IS0 A;  2V6O A;  1QQ2 A;  3HJO A;  1K0M A;  2PVO C;  1UN2 A;  3F8U A;  1GNE A;  1WJK A;  2MZC A;  11GS A;  3F3R A;  5DJL A;  3GN3 A;  1M9B A;  1QUW A;  3NIV A;  3CYN A;  20GS A;  1PKW A;  3EYT A;  2I9H A;  2H71 A;  4RUV A;  3L9S A;  4EVM A;  5BMU A;  2L5L A;  3CXG A;  5ECN B;  3HD5 A;  1WE0 A;  1AIU A;  3KMO A;  3PIN A;  1T8E B;  2WFC A;  4NHZ A;  3A2W A;  3UJ1 A;  2LST A;  4N0Z A;  2V6K A;  2MBT A;  2CQ9 A;  4NV5 A;  4IEL A;  2LJR A;  1ERT A;  4PNG A;  4I8B A;  1O73 A;  4IGJ A;  2HSY A;  1WIK A;  3UL3 A;  4D73 A;  1XW9 A;  3D21 A;  4TVE A;  13GS A;  4FIW A;  2YJ7 A;  4HEA 2;  4WKW A;  1Q4J A;  4POL A;  1R5P A;  3QFA C;  2P5R A;  1YQ1 A;  5IMD A;  4I2T A;  1XVQ A;  2DIZ A;  1MEK A;  1WPI A;  4AJ7 A;  1BAY A;  2DJJ A;  4WXT A;  5ECM B;  1TOF A;  1G6Y A;  1GLQ A;  1SL2 B;  4IBP A;  1TK0 B;  4L0U A;  4IJI A;  2VCV A;  5JCW A;  1TK5 B;  1ST9 A;  3TKS E;  2K8S A;  2O85 A;  4BWQ A;  3TRP A;  1E6B A;  4LMW A;  4KSM A;  1YJ6 A;  2XPD A;  2NDO A;  1TTZ A;  4ECI A;  2PUK C;  3O3T A;  5D9V A;  2XPE A;  3KP8 A;  4ZIJ A;  5F06 A;  2AYT A;  4N0V A;  2WRT A;  1NHO A;  2GZZ A;  2M46 A;  3P7X A;  2C80 A;  2H6Z A;  5D8I A;  3R3E A;  4YQM A;  2DIY A;  3WT2 A;  5J9C A;  2PGT A;  3P90 A;  1X5C A;  3IXR A;  4EO3 A;  4HU9 A;  1XWA A;  2K6V A;  3U6V A;  2KOK A;  2AJQ B;  4KW6 A;  2J9H A;  3K8N A;  3GUR A;  3M3M A;  2HSH A;  2WUL A;  3ZFL A;  1GLP A;  1F3A A;  4OFT A;  3DYR A;  3KCM A;  3KD0 A;  1V58 A;  3ZML A;  1RQM A;  5HR3 A;  3VI5 A;  4F9Z A;  4Q5F A;  1TDI A;  2TIR A;  4JR4 A;  1K0D A;  1AW9 A;  4XS1 A;  2DBC A;  2GSQ A;  1I9D A;  3GTU B;  3FR9 A;  3EMX A;  3EIN A;  2MMA A;  4IQA A;  4ZBB A;  3LG6 A;  3JCM L;  3E3E A;  3O6T A;  4XS6 A;  3H1N A;  4BVY B;  2X99 A;  4WBR D;  4MH3 A;  2VIM A;  2D2Z A;  4IN0 A;  2GGT A;  3UIW A;  1PN9 A;  3QAW A;  4XRD A;  1AQW A;  5JWR B;  3EMP A;  4MK3 A;  1Y6E A;  4YQV A;  1ZGN A;  5DBQ A;  4V2N A;  1UC7 A;  2FHE A;  2LQO A;  5IMC A;  5EL8 A;  2H01 A;  6GSV A;  2C3N A;  3P8W A;  1T1V A;  2OE0 A;  3TRX A;  2YZH A;  3C7M A;  5G31 A;  3GFK A;  1PSQ A;  3EVI A;  4ECC A;  1S3A A;  2IME A;  2VCQ A;  4NXI A;  2V2G A;  4O5R A;  4ACS A;  4MF5 A;  5ENU A;  1SJ6 A;  1M2D A;  2H19 A;  3GA4 A;  5HR1 A;  1IYH A; 
#chains in the Genus database with same CATH topology
 2IWT A;  4Q5Q A;  1GNW A;  5IMF A;  2TRX A;  2A4V A;  1EEJ A;  3FKF A;  4WF4 A;  1UA5 A;  8GSS A;  3TJK A;  3ERW A;  5GAP D;  4JU5 A;  1GUL A;  1XOB A;  4ZB7 A;  3DKS A;  4OFN A;  2R3X A;  5HR0 A;  1O85 A;  4HZ4 A;  3PGT A;  4KSO A;  4POM A;  1XWK A;  2YWN A;  3IRA A;  2YCD A;  6GSU A;  1JZO A;  4Q5R A;  4NMU A;  2PPT A;  2HZF A;  1B9X C;  3L9V A;  3GTU A;  1PN0 A;  2L57 A;  4ID0 A;  4NWY A;  3G7Y A;  4WR5 A;  4MJA A;  2FY6 A;  3TOU A;  3KGK A;  4ML6 A;  3EE2 A;  5ECP B;  4BVY A;  2A2S A;  2EIO A;  5DDL A;  4IJ3 A;  1GSU A;  5CRG A;  4GRF A;  3VWW A;  4G0I A;  4I6X A;  2OJL A;  3TGZ A;  1NHY A;  2B1K A;  2WGR A;  2H0I A;  1ON4 A;  5JWO B;  1ACV A;  5KEJ A;  3IBH A;  4NV2 A;  2YN1 A;  2VCX A;  3D6I A;  5AIV A;  1BYE A;  4TR1 B;  3FY7 A;  4X4J A;  3FRC A;  3FYG A;  2KUC A;  2O7K A;  5DJM A;  3RDW A;  4EE0 A;  4CW9 A;  2KP2 A;  5AIS A;  3VI7 A;  1MDI A;  1QXH A;  1VF4 A;  2JSY A;  2H1L A;  3Q18 A;  1HNC A;  5LCZ A;  2NTO A;  2E2M A;  2IFQ B;  2X64 A;  4AF2 A;  2H70 A;  3V1W A;  1U3A A;  3HYP A;  2R37 A;  5A4V A;  4FYB A;  4JED A;  5ELG A;  5D93 A;  2REM A;  4GXZ A;  2DMM A;  1URM A;  5H5S A;  2VO4 A;  1Z3E A;  1E2Y A;  4I5Q A;  1WOU A;  4XS4 B;  3MSZ A;  2O36 A;  1TI3 A;  4KUN A;  4MAB A;  4G19 A;  4GDF A;  1SJZ A;  3W6G A;  2HRF A;  2CVB A;  4OWY A;  2P31 A;  4HJM A;  3HMJ G;  5ECK B;  3QOU A;  1SYR A;  2UV8 G;  1QK8 A;  3F6F A;  3GKX A;  3IHQ A;  3TKQ A;  5IPH A;  2JZR A;  2G0F A;  5JWQ B;  4K5R A;  2QC7 A;  1ZZY A;  1J0F A;  4K1F A;  2CVD A;  1MDJ A;  2RUE A;  2B7K A;  2C0F A;  3A3T A;  2XBQ A;  2H75 A;  4O5U A;  3CBU A;  4HI7 A;  4KGI A;  2CX3 A;  4J57 E;  3CRT A;  4GST A;  2MMO A;  4F0B A;  4IP1 A;  2IMF A;  2YWI A;  2F8F A;  1A0F A;  4QL7 A;  3ERF A;  1N2A A;  1WRY A;  1R5A A;  4IQ1 A;  1ERU A;  3FEU A;  3FZ9 A;  4O5Q A;  3GKM A;  4LLR A;  5A1N B;  4TR1 A;  3QD9 A;  2GS3 A;  4MH2 A;  1W4V A;  4TW5 A;  1S3R A;  1EGR A;  1TI1 A;  4TOP A;  3HJM A;  1USB A;  2HRN A;  1F3B A;  4TR3 A;  1GWC A;  2JAD A;  5F8B A;  4EC0 A;  2IMD A;  4TN8 A;  3TKR A;  4G0K A;  3O76 A;  1SVM A;  4ZL9 A;  4GCI A;  5CRW A;  1KTE A;  3FZ5 A;  5F05 A;  1F9M A;  4YKG A;  2IFQ A;  4L5L A;  1FVK A;  4ZL8 A;  1FB0 A;  1TXX A;  4OO4 A;  4ECB A;  2WCI A;  1K3O A;  4WBJ A;  3UOM A;  3LSZ A;  1TK8 B;  5G2Z A;  2O89 A;  1GSF A;  2C3Q A;  4PXO A;  3ZRD A;  1AXD A;  4XS4 A;  2OBI A;  4DSS B;  1XBS A;  3GH6 A;  3KM6 A;  2B3S A;  5DVB A;  1XFL A;  4G9H A;  3FK8 A;  2A4H A;  2E0Q A;  4KA0 A;  4LA1 A;  3ME8 A;  2FUG 2;  1FW1 A;  2YWM A;  3PH9 A;  2PMT A;  5G5F A;  1EEM A;  2V41 A;  3L78 A;  4X43 A;  3IA1 A;  2FLS A;  1GUM A;  2YV7 A;  5D9X A;  4N30 A;  1ABA A;  5LNK e;  3HJP A;  1HYU A;  1T3B A;  3FZ4 A;  4YAV A;  1NSW A;  3EU3 A;  2VD1 A;  2F3M A;  3ZIT A;  1GSS A;  3TJB A;  3WYW A;  3IHG A;  1QFN A;  3RPP A;  4TXV A;  3ZVJ D;  2VLT A;  3IAS 2;  2IMK A;  5KN1 A;  4E8E A;  5IMA A;  1B48 A;  2WVX B;  5F07 A;  2C0G A;  4MPF A;  3MDK A;  1EGO A;  4MA9 A;  5IM9 A;  3M8N A;  4G01 A;  5J41 A;  1XWB A;  5A1N A;  2C3T A;  4KE3 A;  3IDV A;  3GL5 A;  2L6C A;  4O32 A;  5GAN D;  1X9M B;  4DSQ A;  3GHA A;  3Q74 A;  1SJI A;  3HVX A;  1A23 A;  4O7H A;  1BJX A;  2YWO A;  4E8H A;  4GF0 A;  1MD4 A;  2WS2 A;  4KH7 A;  1K0O A;  1XVW A;  3LOR A;  3TJF A;  1XW5 A;  4ECJ A;  3TRQ A;  4LMV A;  1Q98 A;  4CDO A;  3E9J B;  3EU4 A;  4JBB A;  3VLN A;  1SKW B;  1ERW A;  4AKI A;  1SEN A;  2LRC A;  1VF1 A;  4DSS A;  1J08 A;  2CT6 A;  3M9J A;  1AQV A;  1UVZ A;  4OFM A;  1TKD B;  5J5N A;  5KN3 A;  2FCH A;  2H1A A;  1OAZ A;  2DJ3 A;  5FT3 A;  2EFD A;  3KH9 A;  4DSR A;  3ZFB A;  4WF5 A;  3KTL A;  4MCU A;  4K7N A;  1SVL A;  1B8X A;  1A0R P;  5BRT A;  1M0U A;  4JRR A;  4F2I A;  2HI7 A;  3CWG A;  3HHV A;  3WT1 A;  1B4Q A;  5J4V A;  3D5J A;  5J4Y A;  4PUR A;  4GQC A;  1H75 A;  4F03 A;  1GTU A;  1GSD A;  3RFR C;  17GS A;  3EPT A;  5IIZ A;  3N9J A;  2WVX A;  4MF6 A;  4FH8 A;  2LEG A;  3UAP A;  5ECS A;  1GH2 A;  4JZQ A;  4XRA A;  3MNG A;  1BG5 A;  3C73 A;  4K9Z A;  2V32 A;  3ED3 A;  5CRH A;  4IHU A;  3ZIJ A;  5J9B A;  2LS5 A;  4GLT A;  1EP8 A;  2NPB A;  4TR4 A;  5GZZ B;  1JZR A;  2WW1 A;  3IV4 A;  1U3I A;  3ZTL A;  2FA8 A;  4EXJ A;  2WDU A;  4MJB A;  4WET A;  5HFG A;  1SD8 A;  1TRU A;  1VGL A;  1TRS A;  5J40 A;  2IPA A;  1EV9 A;  2HLS A;  2AAW A;  3I69 A;  1JZD A;  2RUF A;  4NHW A;  3F3Q A;  3UEM A;  2BTO T;  2HT9 A;  2FWE A;  2GSS A;  2RM6 A;  1FHE A;  3QFB C;  1VF2 A;  2B5X A;  2H6X A;  5F0G A;  2DC5 A;  5AN1 A;  2LJA A;  5FWG A;  2FD3 A;  3PR8 A;  1YEX A;  3I43 A;  4I2U A;  4TR0 A;  3A5W A;  1Z9H A;  2C1Y A;  2DKH A;  5COH A;  4Z7X A;  3EC3 A;  5CYY A;  1Z7P A;  3CSJ A;  4ZBA A;  4HU7 A;  5EPF A;  3D4T A;  2WVZ A;  4CHS A;  4ULX A;  1Z6N A;  1SYX A;  3UBL A;  4AKG A;  1SVO A;  1XCC A;  5DAK B;  2P5Q A;  3MIX A;  2AV4 A;  2GT5 A;  3TKS C;  4FYU A;  1G7O A;  4PNF A;  2C0D A;  4N11 A;  2WVY A;  3F4S A;  2VCZ A;  3ISO A;  4YKF A;  3LW9 A;  2ZUP A;  4XHM A;  2AHE A;  2GDR A;  4EDZ A;  2GT6 A;  2HFD A;  4FXY P;  1FO5 A;  1EV4 A;  2GTU A;  2DJ0 A;  4V2L A;  2NBS A;  1FB6 A;  2WW0 A;  2FA4 A;  2LNS A;  2MBS A;  3RBT A;  4H86 A;  2VLV A;  2H1D A;  2H0G A;  2OE3 A;  1G7E A;  3BCI A;  3LQ7 A;  5IOW A;  1TRV A;  5EVO A;  1TU7 A;  2K18 A;  3IAM 2;  2H1G A;  5CO3 A;  3LJR A;  1DUG A;  3DVW A;  2ON5 A;  1EZK A;  3WGX A;  1Z5Y E;  3HA9 A;  1FVJ A;  4PGT A;  5A34 B;  1M99 A;  1A24 A;  2LJK A;  2F51 A;  2VCW A;  1ZYE A;  1XW6 A;  1I1I P;  2ALB A;  2VCT A;  3TDG A;  2C0E A;  2QKE A;  3UVT A;  2YNX A;  5D73 A;  1CQG A;  4MF7 A;  4MLY A;  3G9B A;  1X9W B;  3KP9 A;  5DAK A;  3KH7 A;  2B1L A;  1T4Z A;  4FO5 A;  5IMZ A;  2M72 A;  1O8X A;  2RII A;  3CHX C;  3WGE A;  2F8A A;  4F82 A;  3TJJ A;  2VLU A;  4POB A;  5DQS A;  3LFL A;  2ZCT A;  2X8G A;  4K7O A;  2XBI A;  2KP1 A;  2A2R A;  5ECQ B;  2VD0 A;  4BA7 A;  1TRW A;  4MJC A;  4K0N A;  3F63 A;  4KCA A;  3GX0 A;  3IC4 A;  4MPG A;  2DLX A;  2PVQ A;  3HZ8 A;  3GRX A;  1OKT A;  4LL4 B;  3H8Q A;  4Z2U A;  3M0F A;  3HZ4 A;  1H4O A;  2B5Y A;  1V9W A;  2OAD A;  6GSS A;  1SKR B;  5ECR B;  3US3 A;  3LWA A;  1SK0 A;  3H79 A;  3HVS A;  6GST A;  4PUF C;  5AIX A;  3DVX A;  5DAL B;  2I3Y A;  5D9T A;  5E59 A;  1PGT A;  2DML A;  4ML1 A;  1XXU A;  2BMX A;  1YY7 A;  2LNT A;  6GSW A;  3DD3 A;  2CAI A;  1JZW A;  5ABR A;  1NW2 A;  5DQY A;  4MP4 A;  4MMM A;  2DKI A;  2L4Q A;  2LV3 A;  4QL9 A;  2AUV A;  5GSS A;  2K9F A;  4K0G A;  3LXT A;  3DXB A;  4IKH A;  1ERV A;  4GSS A;  1GSY A;  3BD2 A;  4OCE A;  4EF0 A;  2LTK A;  5D9W A;  4K6X A;  3TKS A;  2F9S A;  1YVL A;  2HZE B;  5ELA A;  1KNG A;  2GQM A;  1V40 A;  2WZS A;  2EC4 A;  3AY8 A;  1B9Y C;  2L5O A;  1SL0 B;  4HZ2 A;  2L59 A;  2FWF A;  2G2Q A;  1BX9 A;  4KF9 A;  2OBK A;  3EUR A;  2A2P A;  5G1K A;  3HVV A;  4HJ2 A;  1Z7R A;  4BPY A;  3GST A;  4AI6 A;  2WW3 A;  3GX8 A;  3C71 A;  4G2E A;  2MYG A;  5G30 A;  5ECO B;  2TRC P;  2GLR A;  1EP7 A;  2PN8 A;  3J7Y b;  2H8L A;  5IO2 A;  3GSS A;  1T7P B;  1MDK A;  1O7U A;  4OO5 A;  1R4W A;  2LUS A;  2HNL A;  4HQS A;  1A2L A;  3GH9 A;  3GMF A;  2DJ2 A;  5ID2 B;  2JU5 A;  4GSN A;  5JCG A;  3DML A;  1YZX A;  2WJU A;  1KBN A;  3F4T A;  2R5G A;  4KDU A;  1QGV A;  1EOG A;  2EFH A;  2X4A A;  12GS A;  1I5G A;  1ZYQ B;  4IP6 A;  2JAC A;  4KDY A;  5GST A;  3GNJ A;  3TB2 A;  3GYK A;  4PX1 A;  1ML6 A;  1ZCP A;  2CA8 A;  4OD7 A;  2I4A A;  3SBC A;  3TKP A;  1F2E A;  3IE3 A;  4JE1 A;  2FGX A;  4CY8 A;  3ERG A;  3C1R A;  2B5E A;  4HUA A;  3CSH A;  1ILO A;  2MMZ A;  2DJ1 A;  4L8E A;  4OMV A;  3QAV A;  2XHF A;  2O87 A;  1GRX A;  3H4K A;  2H1B A;  3IC8 A;  1N25 A;  2L4C A;  3J7Y k;  4OCF A;  2H66 A;  4EUY A;  2QA2 A;  1OKD A;  19GS A;  4V1A p;  1KEB A;  1V57 A;  5C00 A;  2VM1 A;  1FAA A;  2C4J A;  3GKN A;  4N3Z A;  3LYK A;  3CTG A;  1YKC A;  10GS A;  1OC9 B;  1MTC A;  4ZB9 A;  4BL7 B;  3DIE A;  3SWL A;  5CRD A;  2DSA A;  3M1G A;  3D4M A;  1ZL9 A;  1GSE A;  1S3D A;  1THX A;  4G10 A;  5LD0 A;  1F37 A;  5HR2 A;  1EOH A;  2IJY A;  2PER A;  2EFE A;  2Z9S A;  1T4Y A;  1HNA A;  2R4V A;  3LGC A;  3GKK A;  2DJK A;  3G7I A;  2I81 A;  18GS A;  3MYD A;  14GS A;  2GST A;  2YJH A;  5ID2 A;  2VL9 A;  3QAG A;  3TUE A;  5J47 A;  2VM2 A;  2YAN A;  1SKS B;  3KTB A;  3F6D A;  9GSS A;  1AUC A;  1PQN A;  1XOA A;  2FWH A;  4GTU A;  4WEY A;  3KEB A;  5B7C A;  1BG1 A;  2I1U A;  3IK7 A;  1GTB A;  1OC8 A;  1OYJ A;  1GUK A;  1DE1 A;  2O8V B;  1SD9 A;  5B6M A;  2QGV A;  3KJY A;  1F6M C;  5B8B A;  3A2V A;  1YDK A;  2JZS A;  1OVN A;  2YP6 A;  3GL3 A;  3UAR A;  3APS A;  3FR6 A;  4ILF A;  1JFU A;  1LU4 A;  3U5R E;  4NPB A;  2JL4 A;  4YH2 A;  3ZIV A;  2HRK B;  1LJR A;  1PD2 1;  4Z2R A;  2EFC A;  1GTI A;  3RAZ A;  1XWG A;  5ECI B;  1DBY A;  2OA7 A;  4PUA A;  2B6M A;  2KHP A;  3A2X A;  4BVX B;  2XC2 A;  5KN0 A;  1THO A;  2OE1 A;  3F9U A;  1X0R A;  3HDC A;  2LQQ A;  4ICY A;  1LBK A;  2MMN A;  1Z6M A;  3VK9 A;  1OC9 A;  4BL7 A;  1PMT A;  3ZMK A;  1GUH A;  4RQR A;  1IYI A;  1XWC A;  4POK A;  1YF0 A;  2ES7 A;  4HQZ A;  3L4N A;  3VUR A;  1OE7 A;  5KN2 A;  2P0G A;  3WD6 A;  4RQX A;  2WZ9 A;  1V98 A;  5B6N A;  3DEX A;  3LEF A;  5HFI A;  2YOI A;  4GWR A;  2GQL A;  3FW2 A;  4O92 A;  1TXU A;  3M9K A;  4HSC X;  4XTS A;  3FHK A;  3QDN A;  1OC3 A;  2NVL A;  2EIR A;  4DVC A;  3L9U A;  1HNB A;  2HRA A;  2LRT A;  1A8L A;  3IPZ A;  5CRE A;  1Y25 A;  3ZYW A;  3HY2 A;  1R26 A;  5HQP A;  5INY A;  1U88 A;  3VWX A;  3W8S A;  2IIY A;  2CZ2 A;  2K8V A;  1TP9 A;  4FYC A;  4K5S A;  4HS1 A;  4KX4 A;  1PX7 A;  4J56 E;  2YPM A;  4K8M A;  2R6K A;  5FHI A;  1ZOF A;  4TXO B;  3MWH A;  4MDC A;  1AC1 A;  4XCS A;  1YF1 A;  1T00 A;  2V1M A;  4J2F A;  4P3Y B;  5CNW A;  5J3R A;  4CY6 A;  4V2M A;  2YV9 A;  2HSN B;  2PU9 C;  2ZNM A;  1K0N A;  4YQU A;  4GQF A;  3I9V 2;  5ECL B;  4PQI A;  4PQH A;  16GS A;  2HRK A;  1PL2 A;  3APQ A;  4ZB8 A;  3DWV A;  4EKZ A;  4RI6 A;  2ON7 A;  1TW9 A;  2JZT A;  4Z2T A;  5IMV A;  2OT3 A;  4MZW A;  1J9B A;  2GVP A;  1PL1 A;  2FNO A;  4BVX A;  1X5D A;  4MZB A;  3QCP A;  4W66 A;  2N5A A;  3TCO A;  5DCG A;  3VPT A;  1M9A A;  1VF3 A;  1HQO A;  3NOF A;  3BJ5 A;  1U6T A;  3GIX A;  2CV4 A;  3UVH A;  1GTA A;  2UZ8 A;  1U87 A;  5H5Q A;  1X9S B;  2N5F A;  1BED A;  3W8J A;  4EDY A;  4HDE A;  2VAF A;  2PBJ A;  4DEJ A;  2RM5 A;  2N5B A;  1RK4 A;  1FOH A;  2VUP A;  5C04 A;  1A8Y A;  1JHB A;  3CRU A;  2C8U A;  2HXK A;  1O81 A;  3ME7 A;  2X8H A;  2H74 A;  3LYP A;  2BJX A;  5B8A A;  2IL3 A;  4TKY A;  1PA3 A;  4WR4 A;  4USS A;  4ZL7 A;  5DCH A;  2CZ3 A;  2RLI A;  2B7J A;  4NAX A;  1A2J A;  5L71 A;  1W89 A;  1AAZ A;  1G0T A;  1R7H A;  3CSI A;  5KOX A;  2H72 A;  1PRX A;  2H30 A;  3KMN A;  3L0H A;  1G6W A;  1O8W A;  1K0B A;  4X1U A;  4EL1 A;  3WGD A;  1YKA A;  4TXO A;  3EWL A;  2PWJ A;  7GSS A;  4ZXG A;  3D0Z A;  3IR4 A;  4AGS A;  2HSN A;  4ZIL A;  1N8J A;  4X0X A;  6GSX A;  3RPN A;  1WP0 A;  4XIH A;  4EIQ A;  1VRS D;  2E7P A;  4ISD A;  2VL2 C;  2LRN A;  4IVF A;  1X5E A;  4BIK A;  3G7J A;  1SU9 A;  3TOT A;  3C1S A;  3GUS A;  1PX6 A;  3UBK A;  4KCE A;  1TU8 A;  4HOJ A;  1C72 A;  3A5I A;  2E2G A;  5E4W A;  3IK9 A;  2M80 A;  2IMI A;  4L5O A;  2H73 A;  2YZU A;  3VWU A;  1WMJ A;  4F0C A;  2CVK A;  3APO A;  2EIQ A;  2HE3 A;  1QMV A;  1GSQ A;  3BOA A;  4TRX A;  3HKR A;  2FWG A;  3ZLP A;  1MD3 A;  3QMX A;  1O6J A;  3DGQ A;  2VL3 A;  2KLX A;  4G0L A;  1FOV A;  4KND A;  3VFI A;  1OE8 A;  2R2J A;  5IPG A;  3VWV A;  4BWS A;  5IOX A;  3VPQ A;  1CQH A;  4PI2 C;  5G1L A;  5A34 A;  3F0I A;  2GZY A;  3TU3 B;  4LL1 B;  3CQF A;  3DRN A;  3QR6 A;  4N10 A;  1XZO A;  5D96 A;  22GS A;  5A5K A;  2JSZ A;  4PTS A;  2X8C A;  4AJ6 A;  3S9F A;  1V2A A;  1A2M A;  1SK1 A;  4QQ7 A;  3D22 A;  3RHB A;  5AGY A;  2WW2 A;  2OKA A;  4AJ8 A;  3BCK A;  2HSM B;  2H0H A;  1GP1 A;  5H5R A;  5HFK A;  2CAQ A;  3CMI A;  1K3Y A;  1RW1 A;  3KZQ A;  3N5O A;  1PFO A;  4K7I A;  1S3C A;  1M2B A;  3BBY A;  1XPV A;  1BQ7 A;  1TJD A;  4IW9 A;  2AB6 A;  1DE2 A;  1ZMA A;  3C8E A;  5J4U A;  5ECH B;  4Q5N A;  4YAP A;  4JR6 A;  1M7T A;  2HYX A;  5IO0 A;  3Q19 A;  5CP1 A;  1EWX A;  2CX4 A;  3NZN A;  2HQT A;  3KIJ A;  5A4U A;  2J23 A;  1M3J A;  4KAE A;  1XIY A;  3I6A A;  1YEW C;  5BMU B;  1AQX A;  1FG4 A;  1YEP A;  3H93 A;  1M2A A;  1K0C A;  2R0G A;  1K3L A;  5CAX A;  3OR5 A;  2O5V A;  3E0U A;  4FQU A;  1JLV A;  2H6Y A;  2R0P A;  3RHC A;  3TJG A;  4MJE A;  3FZA A;  3FR3 A;  3PPU A;  5DAL A;  2IN3 A;  4ZBD A;  4L0W A;  3LXZ A;  2GZP A;  2H76 A;  3HCZ A;  4KDX A;  4MZC A;  3F4R A;  2L6D A;  4D73 B;  1SL1 B;  5A5H B;  1NM3 A;  2O3E A;  3ZZX A;  1SK2 A;  1S4B P;  3P2A A;  4PQ1 A;  1BF5 A;  4I97 A;  3RGB C;  3CTF A;  1PKZ A;  4PHZ C;  3R2Q A;  3ZL5 A;  3HXS A;  3IOS A;  6GSY A;  5A4W A;  2LKU A;  2WB9 A;  1ZYP A;  2GQK A;  5EY6 A;  3Q6O A;  5JCU A;  2QSI A;  3ZVJ A;  3UMA A;  2VOC A;  1WWJ A;  5IQY A;  3ZRE A;  3MAK A;  4RI7 A;  4K2D A;  1B4P A;  3QPM A;  2HSM A;  2HZE A;  1JLW A;  1HD2 A;  4V1A g;  2GSR A;  4ZB6 A;  1GL8 A;  4PI0 C;  3KXO A;  2VL2 A;  1DSB A;  4KB3 A;  1K0A A;  3GV1 A;  5G5E A;  2OAC A;  4IS0 A;  2V6O A;  1QQ2 A;  3HJO A;  1K0M A;  2PVO C;  1UN2 A;  3F8U A;  1GNE A;  1WJK A;  2MZC A;  11GS A;  3F3R A;  5DJL A;  3GN3 A;  2X49 A;  1M9B A;  1QUW A;  3NIV A;  3CYN A;  20GS A;  1PKW A;  3EYT A;  2I9H A;  2H71 A;  4RUV A;  3L9S A;  4EVM A;  5BMU A;  2L5L A;  3CXG A;  5ECN B;  3HD5 A;  1WE0 A;  1AIU A;  3KMO A;  3PIN A;  1T8E B;  2WFC A;  4NHZ A;  4AKX B;  3A2W A;  3UJ1 A;  2LST A;  4N0Z A;  2V6K A;  2MBT A;  4K2X A;  2CQ9 A;  4NV5 A;  4IEL A;  2LJR A;  1ERT A;  4PNG A;  4I8B A;  1O73 A;  4IGJ A;  2HSY A;  1WIK A;  3UL3 A;  4D73 A;  1XW9 A;  3D21 A;  5A5H A;  4TVE A;  13GS A;  4FIW A;  2R0C A;  2YJ7 A;  4HEA 2;  4WKW A;  1Q4J A;  4POL A;  1R5P A;  3QFA C;  2P5R A;  1Y1U A;  1YQ1 A;  5IMD A;  4I2T A;  1XVQ A;  2DIZ A;  1MEK A;  1WPI A;  4AJ7 A;  1BAY A;  2DJJ A;  4WXT A;  5ECM B;  1TOF A;  1G6Y A;  1GLQ A;  1SL2 B;  4IBP A;  1TK0 B;  4L0U A;  4IJI A;  2VCV A;  5JCW A;  1TK5 B;  1ST9 A;  3TKS E;  2K8S A;  2O85 A;  4BWQ A;  3TRP A;  1E6B A;  4LMW A;  4KSM A;  1YJ6 A;  2XPD A;  2NDO A;  1TTZ A;  5KOW A;  4ECI A;  2PUK C;  3O3T A;  5D9V A;  2XPE A;  3KP8 A;  4ZIJ A;  5F06 A;  2AYT A;  4N0V A;  2WRT A;  1NHO A;  1XG8 A;  2GZZ A;  2M46 A;  3P7X A;  2C80 A;  2H6Z A;  5D8I A;  3R3E A;  4YQM A;  2DIY A;  3WT2 A;  5J9C A;  2PGT A;  3P90 A;  1X5C A;  3IXR A;  2VKZ G;  4MNN A;  4HU9 A;  4EO3 A;  1XWA A;  2K6V A;  3U6V A;  2KOK A;  2AJQ B;  4KW6 A;  4QMK A;  2J9H A;  3K8N A;  3GUR A;  3M3M A;  4EIP A;  2HSH A;  2WUL A;  3ZFL A;  4AKH A;  1GLP A;  1F3A A;  4OFT A;  3DYR A;  3KCM A;  3FMW A;  2QA1 A;  3KD0 A;  1V58 A;  3ZML A;  3HVN A;  1RQM A;  5HR3 A;  3VI5 A;  4F9Z A;  4Q5F A;  1TDI A;  2TIR A;  4JR4 A;  1ZYN A;  1K0D A;  1AW9 A;  4XS1 A;  2DBC A;  2GSQ A;  1I9D A;  3GTU B;  3FR9 A;  3EMX A;  3EIN A;  2MMA A;  4IQA A;  4ZBB A;  3LG6 A;  3JCM L;  3E3E A;  3O6T A;  4XS6 A;  3H1N A;  4BVY B;  2X99 A;  4WBR D;  4MH3 A;  2VIM A;  2D2Z A;  4IN0 A;  2GGT A;  3UIW A;  1PN9 A;  3QAW A;  4A5P A;  4XRD A;  1AQW A;  5JWR B;  3EMP A;  4MK3 A;  1Y6E A;  4YQV A;  1ZGN A;  5DBQ A;  4V2N A;  1UC7 A;  2FHE A;  2LQO A;  5IMC A;  5EL8 A;  2H01 A;  1M3I A;  6GSV A;  2C3N A;  3P8W A;  1T1V A;  2OE0 A;  3TRX A;  2YZH A;  4E68 A;  3C7M A;  5G31 A;  3GFK A;  1PSQ A;  3EVI A;  4ECC A;  1S3A A;  2IME A;  2VCQ A;  4NXI A;  2V2G A;  4O5R A;  4ACS A;  4MF5 A;  5ENU A;  1SJ6 A;  1M2D A;  2H19 A;  3GA4 A;  5HR1 A;  1IYH A; 
#chains in the Genus database with same CATH homology
 2IWT A;  4Q5Q A;  1GNW A;  5IMF A;  2TRX A;  2A4V A;  1EEJ A;  3FKF A;  4WF4 A;  1UA5 A;  8GSS A;  3TJK A;  3ERW A;  5GAP D;  4JU5 A;  1GUL A;  1XOB A;  4ZB7 A;  3DKS A;  4OFN A;  2R3X A;  5HR0 A;  1O85 A;  4HZ4 A;  3PGT A;  4KSO A;  4POM A;  1XWK A;  2YWN A;  3IRA A;  2YCD A;  6GSU A;  1JZO A;  4Q5R A;  4NMU A;  2PPT A;  2HZF A;  1B9X C;  3L9V A;  3GTU A;  1PN0 A;  2L57 A;  4ID0 A;  4NWY A;  3G7Y A;  4WR5 A;  4MJA A;  2FY6 A;  3TOU A;  3KGK A;  4ML6 A;  3EE2 A;  5ECP B;  4BVY A;  2A2S A;  2EIO A;  5DDL A;  4IJ3 A;  1GSU A;  5CRG A;  4GRF A;  3VWW A;  4G0I A;  4I6X A;  2OJL A;  3TGZ A;  1NHY A;  2B1K A;  2WGR A;  2H0I A;  1ON4 A;  5JWO B;  1ACV A;  5KEJ A;  3IBH A;  4NV2 A;  2YN1 A;  2VCX A;  3D6I A;  5AIV A;  1BYE A;  4TR1 B;  3FY7 A;  4X4J A;  3FRC A;  3FYG A;  2KUC A;  2O7K A;  5DJM A;  3RDW A;  4EE0 A;  4CW9 A;  2KP2 A;  5AIS A;  3VI7 A;  1MDI A;  1QXH A;  1VF4 A;  2JSY A;  2H1L A;  3Q18 A;  1HNC A;  5LCZ A;  2NTO A;  2E2M A;  2IFQ B;  2X64 A;  4AF2 A;  2H70 A;  3V1W A;  1U3A A;  3HYP A;  2R37 A;  5A4V A;  4FYB A;  4JED A;  5ELG A;  5D93 A;  2REM A;  4GXZ A;  2DMM A;  1URM A;  5H5S A;  2VO4 A;  1Z3E A;  1E2Y A;  4I5Q A;  1WOU A;  4XS4 B;  3MSZ A;  1TI3 A;  4KUN A;  4MAB A;  4G19 A;  4GDF A;  1SJZ A;  3W6G A;  2HRF A;  2CVB A;  4OWY A;  2P31 A;  4HJM A;  3HMJ G;  5ECK B;  3QOU A;  1SYR A;  2UV8 G;  1QK8 A;  3F6F A;  3GKX A;  3IHQ A;  3TKQ A;  5IPH A;  2JZR A;  2G0F A;  5JWQ B;  4K5R A;  2QC7 A;  1ZZY A;  1J0F A;  4K1F A;  2CVD A;  1MDJ A;  2RUE A;  2B7K A;  2C0F A;  3A3T A;  2XBQ A;  2H75 A;  4O5U A;  3CBU A;  4HI7 A;  4KGI A;  2CX3 A;  4J57 E;  3CRT A;  4GST A;  2MMO A;  4F0B A;  4IP1 A;  2IMF A;  2YWI A;  2F8F A;  1A0F A;  4QL7 A;  3ERF A;  1N2A A;  1WRY A;  1R5A A;  4IQ1 A;  1ERU A;  3FEU A;  3FZ9 A;  4O5Q A;  3GKM A;  4LLR A;  5A1N B;  4TR1 A;  3QD9 A;  2GS3 A;  4MH2 A;  1W4V A;  4TW5 A;  1EGR A;  1TI1 A;  4TOP A;  3HJM A;  1USB A;  2HRN A;  1F3B A;  4TR3 A;  1GWC A;  2JAD A;  5F8B A;  4EC0 A;  2IMD A;  4TN8 A;  3TKR A;  4G0K A;  3O76 A;  1SVM A;  4ZL9 A;  4GCI A;  5CRW A;  1KTE A;  3FZ5 A;  5F05 A;  1F9M A;  4YKG A;  2IFQ A;  4L5L A;  1FVK A;  4ZL8 A;  1FB0 A;  1TXX A;  4OO4 A;  4ECB A;  2WCI A;  1K3O A;  4WBJ A;  3UOM A;  3LSZ A;  1TK8 B;  5G2Z A;  2O89 A;  1GSF A;  2C3Q A;  4PXO A;  3ZRD A;  1AXD A;  4XS4 A;  2OBI A;  4DSS B;  1XBS A;  3GH6 A;  3KM6 A;  2B3S A;  5DVB A;  1XFL A;  4G9H A;  3FK8 A;  2A4H A;  2E0Q A;  4KA0 A;  4LA1 A;  3ME8 A;  2FUG 2;  1FW1 A;  2YWM A;  3PH9 A;  2PMT A;  5G5F A;  1EEM A;  2V41 A;  3L78 A;  4X43 A;  3IA1 A;  2FLS A;  1GUM A;  2YV7 A;  5D9X A;  4N30 A;  1ABA A;  5LNK e;  3HJP A;  1HYU A;  1T3B A;  3FZ4 A;  4YAV A;  1NSW A;  3EU3 A;  2VD1 A;  2F3M A;  3ZIT A;  1GSS A;  3TJB A;  3WYW A;  3IHG A;  1QFN A;  3RPP A;  4TXV A;  3ZVJ D;  2VLT A;  3IAS 2;  2IMK A;  5KN1 A;  4E8E A;  5IMA A;  1B48 A;  5F07 A;  2C0G A;  4MPF A;  3MDK A;  1EGO A;  4MA9 A;  5IM9 A;  3M8N A;  4G01 A;  5J41 A;  1XWB A;  5A1N A;  2C3T A;  4KE3 A;  3GL5 A;  3IDV A;  2L6C A;  4O32 A;  5GAN D;  1X9M B;  4DSQ A;  3GHA A;  3Q74 A;  1SJI A;  3HVX A;  1A23 A;  4O7H A;  1BJX A;  2YWO A;  4E8H A;  4GF0 A;  1MD4 A;  2WS2 A;  4KH7 A;  1K0O A;  1XVW A;  3LOR A;  3TJF A;  1XW5 A;  4ECJ A;  3TRQ A;  4LMV A;  1Q98 A;  4CDO A;  3E9J B;  3EU4 A;  4JBB A;  3VLN A;  1SKW B;  1ERW A;  4AKI A;  1SEN A;  2LRC A;  1VF1 A;  4DSS A;  1J08 A;  2CT6 A;  3M9J A;  1AQV A;  1UVZ A;  4OFM A;  1TKD B;  5J5N A;  5KN3 A;  2FCH A;  2H1A A;  1OAZ A;  2DJ3 A;  5FT3 A;  2EFD A;  3KH9 A;  4DSR A;  3ZFB A;  4WF5 A;  3KTL A;  4MCU A;  4K7N A;  1SVL A;  1B8X A;  1A0R P;  5BRT A;  1M0U A;  4JRR A;  4F2I A;  2HI7 A;  3CWG A;  3HHV A;  3WT1 A;  1B4Q A;  5J4V A;  3D5J A;  5J4Y A;  4PUR A;  4GQC A;  1H75 A;  4F03 A;  1GTU A;  1GSD A;  17GS A;  3EPT A;  5IIZ A;  3N9J A;  4MF6 A;  4FH8 A;  2LEG A;  3UAP A;  5ECS A;  1GH2 A;  4JZQ A;  4XRA A;  3MNG A;  1BG5 A;  3C73 A;  4K9Z A;  2V32 A;  3ED3 A;  5CRH A;  4IHU A;  3ZIJ A;  5J9B A;  2LS5 A;  4GLT A;  1EP8 A;  2NPB A;  4TR4 A;  5GZZ B;  1JZR A;  3IV4 A;  1U3I A;  3ZTL A;  2FA8 A;  4EXJ A;  2WDU A;  4MJB A;  4WET A;  5HFG A;  1SD8 A;  1TRU A;  1VGL A;  1TRS A;  5J40 A;  2IPA A;  1EV9 A;  2HLS A;  2AAW A;  3I69 A;  1JZD A;  2RUF A;  4NHW A;  3F3Q A;  3UEM A;  2BTO T;  2HT9 A;  2FWE A;  2GSS A;  2RM6 A;  1FHE A;  3QFB C;  1VF2 A;  2B5X A;  2H6X A;  5F0G A;  2DC5 A;  5AN1 A;  2LJA A;  5FWG A;  2FD3 A;  3PR8 A;  1YEX A;  3I43 A;  4I2U A;  4TR0 A;  3A5W A;  1Z9H A;  2C1Y A;  2DKH A;  5COH A;  4Z7X A;  3EC3 A;  5CYY A;  1Z7P A;  3CSJ A;  4ZBA A;  4HU7 A;  5EPF A;  3D4T A;  4CHS A;  4ULX A;  1Z6N A;  1SYX A;  3UBL A;  4AKG A;  1SVO A;  1XCC A;  5DAK B;  2P5Q A;  3MIX A;  2AV4 A;  2GT5 A;  3TKS C;  4FYU A;  1G7O A;  4PNF A;  2C0D A;  4N11 A;  3F4S A;  2VCZ A;  3ISO A;  4YKF A;  3LW9 A;  2ZUP A;  4XHM A;  2AHE A;  2GDR A;  4EDZ A;  2GT6 A;  2HFD A;  1FO5 A;  1EV4 A;  2GTU A;  2DJ0 A;  4V2L A;  2NBS A;  1FB6 A;  2FA4 A;  2LNS A;  2MBS A;  3RBT A;  4H86 A;  2VLV A;  2H1D A;  2H0G A;  2OE3 A;  1G7E A;  3BCI A;  3LQ7 A;  5IOW A;  1TRV A;  5EVO A;  1TU7 A;  2K18 A;  3IAM 2;  2H1G A;  5CO3 A;  3LJR A;  1DUG A;  3DVW A;  2ON5 A;  1EZK A;  3WGX A;  1Z5Y E;  3HA9 A;  1FVJ A;  4PGT A;  5A34 B;  1M99 A;  1A24 A;  2LJK A;  2F51 A;  2VCW A;  1ZYE A;  1XW6 A;  2ALB A;  2VCT A;  3TDG A;  2C0E A;  2QKE A;  3UVT A;  2YNX A;  5D73 A;  1CQG A;  4MF7 A;  4MLY A;  3G9B A;  1X9W B;  3KP9 A;  5DAK A;  3KH7 A;  2B1L A;  1T4Z A;  4FO5 A;  5IMZ A;  2M72 A;  1O8X A;  2RII A;  3WGE A;  2F8A A;  4F82 A;  3TJJ A;  2VLU A;  4POB A;  5DQS A;  3LFL A;  2ZCT A;  2X8G A;  4K7O A;  2XBI A;  2KP1 A;  2A2R A;  5ECQ B;  2VD0 A;  4BA7 A;  1TRW A;  4MJC A;  4K0N A;  3F63 A;  4KCA A;  3GX0 A;  3IC4 A;  4MPG A;  2DLX A;  2PVQ A;  3HZ8 A;  3GRX A;  1OKT A;  4LL4 B;  3H8Q A;  4Z2U A;  3M0F A;  3HZ4 A;  1H4O A;  2B5Y A;  1V9W A;  2OAD A;  6GSS A;  1SKR B;  5ECR B;  3US3 A;  3LWA A;  1SK0 A;  3H79 A;  3HVS A;  6GST A;  4PUF C;  5AIX A;  3DVX A;  5DAL B;  2I3Y A;  5D9T A;  5E59 A;  1PGT A;  2DML A;  4ML1 A;  1XXU A;  2BMX A;  1YY7 A;  2LNT A;  6GSW A;  3DD3 A;  2CAI A;  1JZW A;  5ABR A;  1NW2 A;  5DQY A;  4MP4 A;  4MMM A;  2DKI A;  2L4Q A;  2LV3 A;  4QL9 A;  2AUV A;  5GSS A;  2K9F A;  4K0G A;  3LXT A;  3DXB A;  4IKH A;  1ERV A;  4GSS A;  1GSY A;  3BD2 A;  4OCE A;  4EF0 A;  2LTK A;  5D9W A;  4K6X A;  3TKS A;  2F9S A;  1YVL A;  2HZE B;  5ELA A;  1KNG A;  2GQM A;  1V40 A;  2EC4 A;  3AY8 A;  1B9Y C;  2L5O A;  1SL0 B;  4HZ2 A;  2L59 A;  2FWF A;  2G2Q A;  1BX9 A;  4KF9 A;  2OBK A;  3EUR A;  2A2P A;  5G1K A;  3HVV A;  4HJ2 A;  1Z7R A;  4BPY A;  3GST A;  4AI6 A;  3GX8 A;  3C71 A;  4G2E A;  2MYG A;  5G30 A;  5ECO B;  2TRC P;  2GLR A;  1EP7 A;  2PN8 A;  3J7Y b;  2H8L A;  5IO2 A;  3GSS A;  1T7P B;  1MDK A;  1O7U A;  4OO5 A;  1R4W A;  2LUS A;  2HNL A;  4HQS A;  1A2L A;  3GH9 A;  3GMF A;  2DJ2 A;  5ID2 B;  2JU5 A;  4GSN A;  5JCG A;  3DML A;  1YZX A;  2WJU A;  1KBN A;  3F4T A;  2R5G A;  4KDU A;  1QGV A;  1EOG A;  2EFH A;  2X4A A;  12GS A;  1I5G A;  1ZYQ B;  4IP6 A;  2JAC A;  4KDY A;  5GST A;  3GNJ A;  3TB2 A;  3GYK A;  4PX1 A;  1ML6 A;  1ZCP A;  2CA8 A;  4OD7 A;  2I4A A;  3SBC A;  3TKP A;  1F2E A;  3IE3 A;  4JE1 A;  2FGX A;  4CY8 A;  3ERG A;  3C1R A;  2B5E A;  4HUA A;  3CSH A;  1ILO A;  2MMZ A;  2DJ1 A;  4L8E A;  4OMV A;  3QAV A;  2XHF A;  2O87 A;  1GRX A;  3H4K A;  2H1B A;  3IC8 A;  1N25 A;  2L4C A;  3J7Y k;  4OCF A;  2H66 A;  4EUY A;  2QA2 A;  1OKD A;  19GS A;  4V1A p;  1KEB A;  1V57 A;  5C00 A;  2VM1 A;  1FAA A;  2C4J A;  3GKN A;  4N3Z A;  3LYK A;  3CTG A;  1YKC A;  10GS A;  1OC9 B;  1MTC A;  4ZB9 A;  4BL7 B;  3DIE A;  3SWL A;  5CRD A;  2DSA A;  3M1G A;  3D4M A;  1ZL9 A;  1GSE A;  1S3D A;  1THX A;  4G10 A;  5LD0 A;  1F37 A;  5HR2 A;  1EOH A;  2IJY A;  2PER A;  2EFE A;  2Z9S A;  1T4Y A;  1HNA A;  2R4V A;  3LGC A;  3GKK A;  2DJK A;  3G7I A;  2I81 A;  18GS A;  3MYD A;  14GS A;  2GST A;  2YJH A;  5ID2 A;  2VL9 A;  3QAG A;  3TUE A;  5J47 A;  2VM2 A;  2YAN A;  1SKS B;  3KTB A;  3F6D A;  9GSS A;  1AUC A;  1PQN A;  1XOA A;  2FWH A;  4GTU A;  4WEY A;  3KEB A;  5B7C A;  1BG1 A;  2I1U A;  3IK7 A;  1GTB A;  1OC8 A;  1OYJ A;  1GUK A;  1DE1 A;  2O8V B;  1SD9 A;  5B6M A;  2QGV A;  3KJY A;  1F6M C;  5B8B A;  3A2V A;  1YDK A;  2JZS A;  1OVN A;  2YP6 A;  3GL3 A;  3UAR A;  3APS A;  3FR6 A;  4ILF A;  1JFU A;  1LU4 A;  3U5R E;  4NPB A;  2JL4 A;  4YH2 A;  3ZIV A;  2HRK B;  1LJR A;  1PD2 1;  4Z2R A;  2EFC A;  1GTI A;  3RAZ A;  1XWG A;  5ECI B;  1DBY A;  2OA7 A;  4PUA A;  2B6M A;  2KHP A;  3A2X A;  4BVX B;  2XC2 A;  5KN0 A;  1THO A;  2OE1 A;  3F9U A;  1X0R A;  3HDC A;  2LQQ A;  4ICY A;  1LBK A;  2MMN A;  1Z6M A;  3VK9 A;  1OC9 A;  4BL7 A;  1PMT A;  3ZMK A;  1GUH A;  4RQR A;  1IYI A;  1XWC A;  4POK A;  1YF0 A;  2ES7 A;  4HQZ A;  3L4N A;  3VUR A;  1OE7 A;  5KN2 A;  2P0G A;  3WD6 A;  4RQX A;  2WZ9 A;  1V98 A;  5B6N A;  3DEX A;  3LEF A;  5HFI A;  2YOI A;  4GWR A;  2GQL A;  3FW2 A;  4O92 A;  1TXU A;  3M9K A;  4XTS A;  3FHK A;  3QDN A;  1OC3 A;  2NVL A;  2EIR A;  4DVC A;  3L9U A;  1HNB A;  2HRA A;  2LRT A;  1A8L A;  3IPZ A;  5CRE A;  1Y25 A;  3ZYW A;  3HY2 A;  1R26 A;  5HQP A;  5INY A;  1U88 A;  3VWX A;  3W8S A;  2IIY A;  2CZ2 A;  2K8V A;  1TP9 A;  4FYC A;  4K5S A;  4HS1 A;  4KX4 A;  1PX7 A;  4J56 E;  2YPM A;  4K8M A;  2R6K A;  5FHI A;  1ZOF A;  4TXO B;  3MWH A;  4MDC A;  1AC1 A;  4XCS A;  1YF1 A;  1T00 A;  2V1M A;  4J2F A;  4P3Y B;  5CNW A;  5J3R A;  4CY6 A;  4V2M A;  2YV9 A;  2HSN B;  2PU9 C;  2ZNM A;  1K0N A;  4YQU A;  4GQF A;  3I9V 2;  5ECL B;  4PQI A;  4PQH A;  16GS A;  2HRK A;  1PL2 A;  3APQ A;  4ZB8 A;  3DWV A;  4EKZ A;  4RI6 A;  2ON7 A;  1TW9 A;  2JZT A;  4Z2T A;  5IMV A;  2OT3 A;  4MZW A;  1J9B A;  2GVP A;  1PL1 A;  2FNO A;  4BVX A;  1X5D A;  4MZB A;  3QCP A;  4W66 A;  2N5A A;  3TCO A;  5DCG A;  3VPT A;  1M9A A;  1VF3 A;  1HQO A;  3NOF A;  3BJ5 A;  1U6T A;  3GIX A;  2CV4 A;  3UVH A;  1GTA A;  2UZ8 A;  1U87 A;  5H5Q A;  1X9S B;  2N5F A;  1BED A;  3W8J A;  4EDY A;  4HDE A;  2VAF A;  2PBJ A;  4DEJ A;  2RM5 A;  2N5B A;  1RK4 A;  1FOH A;  2VUP A;  5C04 A;  1A8Y A;  1JHB A;  3CRU A;  2C8U A;  2HXK A;  1O81 A;  3ME7 A;  2X8H A;  2H74 A;  3LYP A;  2BJX A;  5B8A A;  2IL3 A;  4TKY A;  1PA3 A;  4WR4 A;  4USS A;  4ZL7 A;  5DCH A;  2CZ3 A;  2RLI A;  2B7J A;  4NAX A;  1A2J A;  5L71 A;  1W89 A;  1AAZ A;  1G0T A;  1R7H A;  3CSI A;  5KOX A;  2H72 A;  1PRX A;  2H30 A;  3KMN A;  3L0H A;  1G6W A;  1O8W A;  1K0B A;  4X1U A;  4EL1 A;  3WGD A;  1YKA A;  4TXO A;  3EWL A;  2PWJ A;  7GSS A;  4ZXG A;  3D0Z A;  3IR4 A;  4AGS A;  2HSN A;  4ZIL A;  1N8J A;  4X0X A;  6GSX A;  3RPN A;  1WP0 A;  4XIH A;  4EIQ A;  1VRS D;  2E7P A;  4ISD A;  2VL2 C;  2LRN A;  4IVF A;  1X5E A;  3G7J A;  1SU9 A;  3TOT A;  3C1S A;  3GUS A;  1PX6 A;  3UBK A;  4KCE A;  1TU8 A;  4HOJ A;  1C72 A;  3A5I A;  2E2G A;  5E4W A;  3IK9 A;  2M80 A;  2IMI A;  4L5O A;  2H73 A;  2YZU A;  3VWU A;  1WMJ A;  4F0C A;  2CVK A;  3APO A;  2EIQ A;  2HE3 A;  1QMV A;  1GSQ A;  3BOA A;  4TRX A;  3HKR A;  2FWG A;  3ZLP A;  1MD3 A;  3QMX A;  1O6J A;  3DGQ A;  2VL3 A;  2KLX A;  4G0L A;  1FOV A;  4KND A;  3VFI A;  1OE8 A;  2R2J A;  5IPG A;  3VWV A;  4BWS A;  5IOX A;  3VPQ A;  1CQH A;  5G1L A;  5A34 A;  3F0I A;  2GZY A;  3TU3 B;  4LL1 B;  3DRN A;  3QR6 A;  4N10 A;  1XZO A;  5D96 A;  22GS A;  5A5K A;  2JSZ A;  4PTS A;  2X8C A;  4AJ6 A;  3S9F A;  1V2A A;  1A2M A;  1SK1 A;  4QQ7 A;  3D22 A;  3RHB A;  5AGY A;  2OKA A;  4AJ8 A;  3BCK A;  2HSM B;  2H0H A;  1GP1 A;  5H5R A;  5HFK A;  2CAQ A;  3CMI A;  1K3Y A;  1RW1 A;  3KZQ A;  3N5O A;  4K7I A;  1S3C A;  1M2B A;  3BBY A;  1XPV A;  1BQ7 A;  1TJD A;  4IW9 A;  2AB6 A;  1DE2 A;  1ZMA A;  3C8E A;  5J4U A;  5ECH B;  4Q5N A;  4YAP A;  4JR6 A;  1M7T A;  2HYX A;  5IO0 A;  3Q19 A;  5CP1 A;  1EWX A;  2CX4 A;  3NZN A;  2HQT A;  3KIJ A;  5A4U A;  2J23 A;  4KAE A;  1XIY A;  3I6A A;  5BMU B;  1AQX A;  1FG4 A;  1YEP A;  3H93 A;  1M2A A;  1K0C A;  2R0G A;  1K3L A;  5CAX A;  3OR5 A;  2O5V A;  3E0U A;  4FQU A;  1JLV A;  2H6Y A;  2R0P A;  3RHC A;  3TJG A;  4MJE A;  3FZA A;  3FR3 A;  3PPU A;  5DAL A;  2IN3 A;  4ZBD A;  4L0W A;  3LXZ A;  2GZP A;  2H76 A;  3HCZ A;  4KDX A;  4MZC A;  3F4R A;  2L6D A;  4D73 B;  1SL1 B;  5A5H B;  1NM3 A;  3ZZX A;  1SK2 A;  3P2A A;  4PQ1 A;  1BF5 A;  4I97 A;  3CTF A;  1PKZ A;  3R2Q A;  3ZL5 A;  3HXS A;  3IOS A;  6GSY A;  5A4W A;  2LKU A;  2WB9 A;  1ZYP A;  2GQK A;  5EY6 A;  3Q6O A;  5JCU A;  2QSI A;  3ZVJ A;  3UMA A;  2VOC A;  1WWJ A;  5IQY A;  3ZRE A;  3MAK A;  4RI7 A;  4K2D A;  1B4P A;  3QPM A;  2HSM A;  2HZE A;  1JLW A;  1HD2 A;  4V1A g;  2GSR A;  4ZB6 A;  1GL8 A;  3KXO A;  2VL2 A;  1DSB A;  4KB3 A;  1K0A A;  3GV1 A;  5G5E A;  2OAC A;  4IS0 A;  2V6O A;  1QQ2 A;  3HJO A;  1K0M A;  2PVO C;  1UN2 A;  3F8U A;  1GNE A;  1WJK A;  2MZC A;  11GS A;  3F3R A;  5DJL A;  3GN3 A;  2X49 A;  1M9B A;  1QUW A;  3NIV A;  3CYN A;  20GS A;  1PKW A;  3EYT A;  2I9H A;  2H71 A;  4RUV A;  3L9S A;  4EVM A;  5BMU A;  2L5L A;  3CXG A;  5ECN B;  3HD5 A;  1WE0 A;  1AIU A;  3KMO A;  3PIN A;  1T8E B;  2WFC A;  4NHZ A;  4AKX B;  3A2W A;  3UJ1 A;  2LST A;  4N0Z A;  2V6K A;  2MBT A;  4K2X A;  2CQ9 A;  4NV5 A;  4IEL A;  2LJR A;  1ERT A;  4PNG A;  4I8B A;  1O73 A;  4IGJ A;  2HSY A;  1WIK A;  3UL3 A;  4D73 A;  1XW9 A;  3D21 A;  5A5H A;  4TVE A;  13GS A;  4FIW A;  2R0C A;  2YJ7 A;  4HEA 2;  4WKW A;  1Q4J A;  4POL A;  1R5P A;  3QFA C;  2P5R A;  1Y1U A;  1YQ1 A;  5IMD A;  4I2T A;  1XVQ A;  2DIZ A;  1MEK A;  1WPI A;  4AJ7 A;  1BAY A;  2DJJ A;  4WXT A;  5ECM B;  1TOF A;  1G6Y A;  1GLQ A;  1SL2 B;  4IBP A;  1TK0 B;  4L0U A;  4IJI A;  2VCV A;  5JCW A;  1TK5 B;  1ST9 A;  3TKS E;  2K8S A;  2O85 A;  4BWQ A;  3TRP A;  1E6B A;  4LMW A;  4KSM A;  1YJ6 A;  2XPD A;  2NDO A;  1TTZ A;  5KOW A;  4ECI A;  2PUK C;  3O3T A;  5D9V A;  2XPE A;  3KP8 A;  4ZIJ A;  5F06 A;  2AYT A;  4N0V A;  2WRT A;  1NHO A;  2GZZ A;  2M46 A;  3P7X A;  2C80 A;  2H6Z A;  5D8I A;  3R3E A;  4YQM A;  2DIY A;  3WT2 A;  5J9C A;  2PGT A;  3P90 A;  1X5C A;  3IXR A;  2VKZ G;  4MNN A;  4HU9 A;  4EO3 A;  1XWA A;  2K6V A;  3U6V A;  2KOK A;  2AJQ B;  4KW6 A;  4QMK A;  2J9H A;  3K8N A;  3GUR A;  3M3M A;  4EIP A;  2HSH A;  2WUL A;  3ZFL A;  4AKH A;  1GLP A;  1F3A A;  4OFT A;  3DYR A;  3KCM A;  3FMW A;  2QA1 A;  3KD0 A;  1V58 A;  3ZML A;  1RQM A;  5HR3 A;  3VI5 A;  4F9Z A;  4Q5F A;  1TDI A;  2TIR A;  4JR4 A;  1ZYN A;  1K0D A;  1AW9 A;  4XS1 A;  2DBC A;  2GSQ A;  1I9D A;  3GTU B;  3FR9 A;  3EMX A;  3EIN A;  2MMA A;  4IQA A;  4ZBB A;  3LG6 A;  3JCM L;  3E3E A;  3O6T A;  4XS6 A;  3H1N A;  4BVY B;  2X99 A;  4WBR D;  4MH3 A;  2VIM A;  2D2Z A;  4IN0 A;  2GGT A;  3UIW A;  1PN9 A;  3QAW A;  4A5P A;  4XRD A;  1AQW A;  5JWR B;  3EMP A;  4MK3 A;  1Y6E A;  4YQV A;  1ZGN A;  5DBQ A;  4V2N A;  1UC7 A;  2FHE A;  2LQO A;  5IMC A;  5EL8 A;  2H01 A;  6GSV A;  2C3N A;  3P8W A;  1T1V A;  2OE0 A;  3TRX A;  2YZH A;  4E68 A;  3C7M A;  5G31 A;  3GFK A;  1PSQ A;  3EVI A;  4ECC A;  1S3A A;  2IME A;  2VCQ A;  4NXI A;  2V2G A;  4O5R A;  4ACS A;  4MF5 A;  5ENU A;  1SJ6 A;  1M2D A;  2H19 A;  3GA4 A;  5HR1 A;  1IYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...