3LYKA

Structure of stringent starvation protein a homolog from haemophilus influenzae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
VMTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQALPEDLMELNPYGTVPTLVDRDLVLFNSRIIMEYLDERFPHPPLMQVYPVSRAKDRLLMLRIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQMPYFMNEEFGLVDCYVAPLLWKLKHLGVEFTGTGSKAIKAYMERVFTRDSFLQSVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Stringent starvation protein A homolog
publication title Structure of stringent starvation protein A homolog from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lykA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lykA01
5DALB 4RI7A 1GRXA 2FWGA 5ECNB 3VWUA 2GSTA 3RPPA 4HUAA 3D5JA 3EC3A 1HNAA 1QMVA 2QC7A 4LA1A 1M2DA 5A5KA 3I69A 3APOA 5H5QA 4CDOA 2HI7A 1K0OA 3WGXA 4HU9A 2LQOA 5G30A 3GV1A 3TKQA 3ISOA 1M9AA 4EC0A 2H76A 2IMEA 3EMXA 1ABAA 2B1LA 2E0QA 4TR1A 2VL9A 5GZZB 1XXUA 4NV2A 4HU7A 3KP9A 2GZYA 1VF2A 3GKKA 4J56E 2G2QA 5DQSA 1OC3A 4TW5A 3EU4A 4IJ3A 4ZBAA 1X5EA 2ZUPA 2GT5A 4BPYA 2MMAA 4OD7A 1G7EA 3K8NA 4NWYA 2ZCTA 2DC5A 3ZLPA 1GSUA 4MH2A 4G9HA 4XRAA 1LJRA 4KDXA 4MH3A 3WD6A 3EINA 1TJDA 2I9HA 4G0KA 4OCFA 2H0GA 4NHZA 4DSSB 1K3OA 3ZITA 4H86A 3SBCA 4ECJA 4ISDA 4ML1A 2R3XA 2YP6A 3US3A 1XWGA 4Q5QA 1H4OA 4TR0A 2L5LA 1OE7A 4K9ZA 2BMXA 3KCMA 1S3AA 4XTSA 3QPMA 3Q74A 2PVOC 2B7KA 3TKSA 2HE3A 2LRCA 4AF2A 5FWGA 4AJ6A 4TXOA 2LEGA 2IMIA 2L6CA 1GNEA 1SL0B 3RDWA 1NSWA 3ZREA 3NOFA 2DBCA 2MMZA 1MTCA 5F8BA 2WDUA 3ZL5A 2VLUA 5G31A 5D73A 1B8XA 3S9FA 3MDKA 4I8BA 1TU7A 3FR3A 3LSZA 5CRDA 1EP7A 2O87A 1G6WA 6GSSA 4PNGA 5KN1A 2LKUA 1JLWA 1WE0A 1EGRA 12GSA 4F03A 2DMMA 4Q5FA 2H73A 1AUCA 2YANA 5HR2A 2F8AA 2GSRA 3CSHA 1XCCA 2ZNMA 4V2LA 1K0CA 2A2RA 1QGVA 3VI5A 3UL3A 1PX6A 4BA7A 1FB0A 3HVSA 3G7YA 2I1UA 4J2FA 4OFTA 1EOHA 4WETA 1MDJA 2GGTA 2WB9A 1O7UA 3NZNA 4KAEA 4DSQA 1O6JA 3GMFA 3KMNA 4KGIA 4NHWA 3BOAA 1SL2B 2YJ7A 3TJJA 1USBA 5F0GA 1G6YA 4EO3A 2O7KA 4MCUA 2KUCA 2FLSA 1K0AA 3BCKA 5IO2A 4PQHA 3FKFA 1UN2A 3HZ4A 4JEDA 3HVVA 4NPBA 1T7PB 3GNJA 3D6IA 3E9JB 5JWQB 2V6OA 4K7IA 5G2ZA 2B1KA 10GSA 4XS1A 2JACA 2VLTA 3P2AA 4AGSA 2XBIA 2L59A 1TDIA 3KTBA 1SL1B 2XC2A 2HSMA 5COHA 2R4VA 1XWAA 1F9MA 2QGVA 2H66A 1M2BA 2IN3A 3IPZA 2MBSA 3MAKA 4DVCA 2AJQB 2HNLA 3VK9A 2C4JA 4QQ7A 3DGQA 3DRNA 1A0FA 2X99A 2FWEA 1WMJA 1WRYA 1NHYA 1A2JA 3FR6A 4KX4A 1PL1A 5JCGA 3ZIVA 2VL2C 3PPUA 2WS2A 2HRAA 4FYBA 2IIYA 1PA3A 2DIYA 4FH8A 2LV3A 1JZDA 4WF5A 1AXDA 4TRXA 2H1AA 4LMWA 1XOBA 3IAS2 3U5RE 3HJOA 4GQFA 4V1Ag 6GSYA 4MPGA 1TTZA 3TGZA 4P3YB 3UBLA 2PVQA 2H75A 3LG6A 2C3QA 3IA1A 5ID2B 6GSXA 4GTUA 5JWRB 2DJ2A 4NAXA 2YV7A 3R3EA 3HHVA 4MDCA 1THOA 2CX3A 4GWRA 4TXOB 5F06A 4GSNA 1SJ6A 4KUNA 4G10A 3LYPA 2CVKA 1SKRB 4Q5RA 2Z9SA 1M2AA 1PKWA 1Z5YE 4RI6A 2B5YA 1K0MA 5GSSA 1B4PA 2N5AA 1GTUA 5ELGA 5JCUA 1O73A 1GUMA 3DD3A 2GSQA 5DQYA 5J3RA 2VO4A 4I5QA 1A0RP 1T3BA 3RHCA 2VCTA 3GTUA 4WEYA 2B3SA 1Z7RA 2HXKA 1PMTA 3PGTA 2H1GA 3E0UA 1DSBA 1F3BA 4GLTA 2OA7A 1AW9A 4L0UA 2LTKA 4PQ1A 3GKMA 4QL7A 3TJGA 2FA4A 1MDKA 1QUWA 3HJMA 5INYA 1F2EA 2VLVA 20GSA 3M1GA 4PTSA 5A4WA 1ERTA 2B5EA 3IRAA 4HJMA 5IMVA 4BL7B 2CVBA 1YF0A 3IOSA 2CVDA 4WF4A 4D73A 3CYNA 4PX1A 3R2QA 2RM6A 4ECBA 2JZSA 4LL4B 3UVHA 2BJXA 3HD5A 1XW9A 1FVKA 4HEA2 1OKDA 4EKZA 2L4CA 3KZQA 4IN0A 2R6KA 3N5OA 4L8EA 4OO4A 3CXGA 1W89A 3TRQA 1U6TA 5DDLA 3CTGA 4F0CA 5LNKe 1GUHA 1TRUA 4F0BA 1ILOA 3QAWA 3FK8A 1OYJA 2H6YA 1JHBA 1LU4A 4ILFA 5ABRA 1K0DA 3ME8A 2YWIA 3TJBA 1K0NA 4DSRA 3BJ5A 5EY6A 5DBQA 3IK9A 2YZUA 3Q18A 3MWHA 3O3TA 1OAZA 3W8JA 5HFKA 1DBYA 4JBBA 1XW5A 2HSMB 4O7HA 5C04A 3UVTA 3VPTA 4GRFA 2FGXA 4DEJA 3FZ4A 1HNCA 2LNSA 3A2XA 3MSZA 3GN3A 1PN9A 2CZ3A 1QK8A 3L0HA 4HZ2A 3HXSA 3EWLA 2UZ8A 4KCEA 4IW9A 1GSSA 4KDYA 1Q98A 3ZTLA 2XPDA 5DCGA 1M9BA 6GSVA 2DIZA 1TRWA 2OACA 3A3TA 2HFDA 1GSQA 3H1NA 3O6TA 3APSA 5IMAA 2AHEA 1VGLA 4IP1A 2GQMA 1WP0A 3DKSA 4IS0A 1Z6MA 1SENA 16GSA 4RUVA 1MD3A 2L57A 2J23A 2B7JA 1LBKA 3CSIA 3QFAC 3KEBA 1VF3A 3EE2A 3OR5A 2HZEA 3P8WA 5AIVA 1T8EB 1GULA 2OE1A 2H1DA 3EU3A 3M9JA 1FAAA 2EIQA 2V41A 1PQNA 5E4WA 2JSYA 3D4MA 22GSA 3IC8A 3TRXA 1XWKA 5JCWA 1PGTA 1H75A 4LMVA 4PQIA 1Z6NA 4ACSA 4YAPA 2HZFA 1SK1A 2MMNA 3QCPA 1T1VA 3CTFA 4I2TA 2ES7A 1UC7A 3LXZA 2X8GA 4TR3A 3TB2A 1E6BA 5GAND 3VI7A 1HNBA 2D2ZA 3TCOA 4EXJA 3PR8A 1MEKA 2RIIA 4MZBA 1SU9A 2E7PA 1SJZA 1N2AA 4MK3A 1R4WA 1GSYA 2PGTA 3FYGA 4HOJA 4NV5A 2C80A 1OKTA 5ECOB 1NHOA 2VCQA 2CQ9A 4G0IA 4ML6A 5CRHA 5EL8A 4G2EA 1RK4A 4WBRD 2M72A 2RUFA 1XWBA 8GSSA 4OFNA 1E2YA 3F8UA 1DE1A 2IFQA 4MJAA 4IVFA 2TIRA 5B7CA 11GSA 2K9FA 1V57A 2RUEA 4KA0A 3KJYA 3TRPA 5IOWA 3RHBA 3ZMLA 4AJ8A 3LYKA 2GVPA 1Z3EA 3J7Yk 1U3AA 2PN8A 1TK8B 4ZL8A 3L78A 1VF4A 2ON5A 2DJ3A 3LEFA 3F0IA 3J7Yb 1B9XC 4PGTA 1YEPA 1G7OA 3FZ9A 1ACVA 1MDIA 1ERUA 1BAYA 3ZVJA 1F3AA 3KP8A 4N0VA 3EMPA 4WR5A 3V1WA 2FA8A 1T00A 3G9BA 2JSZA 4MP4A 2JZRA 5FT3A 3TKPA 5KN2A 2CX4A 1Z7PA 4K7NA 3FW2A 4GSTA 4K0GA 5CRGA 5DVBA 1TK0B 4BVYB 4I6XA 17GSA 1TOFA 5G5FA 4MA9A 3O76A 4ZXGA 3IDVA 5AGYA 1ON4A 1AQVA 3DXBA 4IQ1A 1GTAA 2LNTA 1GNWA 2CT6A 5EVOA 5IMDA 1AC1A 3GH6A 3W6GA 2KOKA 1TXXA 3L9VA 1ZYQB 2VCWA 3F3RA 2GT6A 2MZCA 2LJRA 5IIZA 3VWWA 5D9XA 14GSA 2L6DA 2HZEB 4HDEA 2HRNA 3CSJA 3RBTA 4HQZA 3GH9A 3KD0A 2MMOA 1QXHA 2FY6A 4KB3A 1FB6A 2EC4A 3IXRA 4JZQA 3RPNA 4YQMA 3DYRA 4K1FA 2V1MA 2IPAA 2XBQA 1BQ7A 1CQHA 2RLIA 1SK0A 2C3TA 5ECKB 2GQKA 4TR1B 3GIXA 1TRVA 4ZILA 1W4VA 5D9WA 1NM3A 2LUSA 2K8SA 4EDZA 4G19A 1X5DA 4KNDA 1AQWA 4X0XA 2LJAA 3PINA 2K6VA 3FZAA 5IOXA 1K0BA 2AV4A 3UJ1A 1R7HA 19GSA 5HR0A 4FIWA 1IYIA 4XS4A 5GSTA 1QFNA 3M3MA 2EIOA 3NIVA 1WPIA 1X5CA 5ECLB 4CHSA 3I43A 4FYUA 3H79A 3HA9A 2YWOA 4K8MA 1X9SB 1JLVA 4XRDA 3C73A 1ZZYA 2CV4A 1WWJA 2FWHA 2V32A 2MBTA 4ZBDA 4EVMA 3LWAA 5HFGA 3M8NA 3ME7A 1SYRA 5IPHA 3F4SA 4ZB8A 1VF1A 2P5QA 2KP2A 3VWXA 1GSDA 2GTUA 5ENUA 4JU5A 1T4YA 1X0RA 4K0NA 3F4RA 4V1Ap 1PRXA 1XPVA 4BWQA 1U88A 4POBA 1EGOA 4O92A 4QL9A 2KP1A 1BYEA 5JWOB 2IMKA 1XIYA 4OO5A 3HY2A 1Q4JA 1ERWA 1BEDA 3TOTA 3A5WA 4E8EA 2OE0A 5CO3A 3ED3A 5B8AA 2YWMA 4N10A 1YY7A 3N9JA 2DJ1A 5DALA 3C7MA 3U6VA 2EIRA 4MJCA 4HZ4A 1SK2A 3KXOA 2H71A 4K7OA 3M0FA 3GHAA 5IO0A 2JU5A 1IYHA 2DJJA 3VURA 5J41A 4LLRA 1GTIA 3Q19A 1V98A 1KNGA 5EPFA 2H0HA 4ID0A 18GSA 3AY8A 2PERA 5DCHA 2E2MA 3DIEA 3EURA 2HSNB 3IC4A 4YQVA 2KHPA 2H19A 4N30A 5LCZA 2NDOA 2NVLA 3P90A 2HRKA 2A2SA 1I9DA 3QD9A 4GXZA 3SWLA 4MMMA 5IMZA 4ECCA 3ZIJA 1X9WB 5CNWA 5G1KA 4OCEA 5D96A 2GSSA 3F9UA 3IAM2 5HFIA 4MABA 2B5XA 3FEUA 2P0GA 2TRXA 2VCVA 3QOUA 2AAWA 4ZL7A 2R5GA 4PURA 2GZZA 1XVQA 4IQAA 4NMUA 4ZB6A 1OE8A 2ALBA 3EYTA 3KGKA 1GL8A 2TRCP 3DEXA 4DSSA 4GF0A 1EV9A 3ZZXA 1Z9HA 4KE3A 4KSMA 4IELA 3IK7A 4HS1A 2VCXA 3GURA 2NTOA 5IM9A 5HR1A 1EV4A 1EWXA 3GX0A 1VRSD 2GS3A 2H0IA 1THXA 1XZOA 2YN1A 1SJIA 3BBYA 2OBIA 4TKYA 2HT9A 1ZYEA 6GSTA 1J08A 1M99A 1KEBA 2X8HA 3FHKA 3WT1A 2NPBA 4YAVA 2HSYA 4J57E 2IMFA 2YCDA 4CW9A 3HKRA 3W8SA 4ECIA 4IJIA 1GSEA 3HYPA 4TVEA 1PKZA 2WZ9A 2OKAA 2I4AA 3A2VA 4V2MA 3IV4A 3ZFBA 1R5PA 3GKXA 3I9V2 5B6MA 5B8BA 1HQOA 4JR4A 2YNXA 4USSA 2DJ0A 5IMFA 1PSQA 1GUKA 2I81A 3E3EA 3G7JA 2N5BA 3I6AA 3RAZA 5F07A 3FY7A 5AISA 3GYKA 3TOUA 1V9WA 3KH9A 1BJXA 3JCML 2BTOT 5L71A 2JZTA 1XWCA 2OADA 4KF9A 1XOAA 1U3IA 2L4QA 3TDGA 1B4QA 2H30A 5IMCA 1JZOA 2HRFA 2YV9A 3UOMA 2DJKA 3UIWA 4IBPA 1Y6EA 5IPGA 1YQ1A 4HI7A 2LSTA 3HZ8A 7GSSA 4FQUA 2FUG2 3F6DA 5J9CA 1YDKA 1A2LA 4BWSA 3VLNA 3GTUB 3IE3A 2VD0A 3VFIA 4XCSA 4PUFC 2H70A 4E8HA 5DJLA 1RW1A 3QAGA 2YWNA 2F8FA 4MZWA 4JR6A 3ZFLA 1X9MB 4X1UA 4KDUA 4TN8A 2CZ2A 2HRKB 1OC9A 1CQGA 4MLYA 1TKDB 1OVNA 3KIJA 2PMTA 5ECHB 2VUPA 4N0ZA 1A2MA 1DE2A 1S3CA 3Q6OA 1V2AA 4MJBA 2H74A 2N5FA 5DAKA 1ZMAA 1V40A 2WULA 4D73B 4OFMA 3GSSA 2VD1A 3EVIA 3F6FA 4IKHA 1GLPA 3HCZA 1O8WA 1F6MC 3LJRA 3D0ZA 1G0TA 4X43A 3WGEA 4IHUA 4JRRA 3TKRA 3FZ5A 3PH9A 1B9YC 1A23A 4HJ2A 3GSTA 4BVXA 1M0UA 2M46A 3UBKA 2LJKA 2PBJA 3D22A 4ZIJA 2F9SA 1HD2A 3QFBC 4KH7A 5CRWA 1YZXA 5ELAA 2LRNA 3IBHA 2JL4A 4PUAA 4TOPA 4XS6A 4V2NA 5ECPB 2P5RA 4MJEA 2C0EA 2DSAA 4F9ZA 3GL5A 5CREA 3ZMKA 3LQ7A 1SKSB 1ZL9A 3ZVJD 4EF0A 5G5EA 1GH2A 2IL3A 5BMUA 2O85A 5ID2A 3GFKA 2AYTA 2VIMA 3ERGA 2FWFA 2WRTA 4AJ7A 3WGDA 5G1LA 2H6ZA 1TP9A 2OJLA 4LL1B 2HQTA 2DLXA 3C1SA 2A4VA 1AQXA 5D8IA 2YOIA 1MD4A 2AB6A 1EP8A 4WR4A 3IR4A 4O5RA 5J9BA 3ERFA 3M9KA 4EUYA 1K3LA 3UEMA 5D9VA 4PXOA 3LFLA 2REMA 3QR6A 1JZRA 1A8LA 1ML6A 5F05A 3QDNA 1PD21 3APQA 4GCIA 4RQXA 5AIXA 1NW2A 1YEXA 2H72A 3LXTA 2HSHA 2XPEA 4ZB9A 1ST9A 3DMLA 5E59A 3ZYWA 5ECMB 3TUEA 3C8EA 4L5LA 2VL3A 4WKWA 4N11A 6GSWA 3F4TA 2GZPA 2L5OA 4TR4A 1YF1A 2M80A 2IJYA 3CRUA 2E2GA 2OBKA 1TU8A 2V2GA 2O89A 2WCIA 2YJHA 1FO5A 2GDRA 1T4ZA 2FNOA 4MPFA 5ECSA 4BL7A 4ZBBA 2ON7A 1EOGA 4GSSA 2F3MA 1SKWB 2CAQA 2B6MA 2I3YA 2C8UA 4MF7A 1URMA 1B48A 1GSFA 4XIHA 4ULXA 5C00A 1N8JA 4POKA 2FHEA 3LORA 5DJMA 1PX7A 1TI3A 1OC8A 3UAPA 2YPMA 1GLQA 2GLRA 1Y25A 3HVXA 2H01A 2HLSA 4XHMA 3C71A 4OMVA 1OC9B 3VPQA 2H1BA 2QSIA 1V58A 4G0LA 4F82A 2IWTA 4JE1A 1BX9A 3LGCA 1ERVA 1JFUA 5DAKB 1RQMA 3WT2A 3KM6A 2FCHA 1F37A 2J9HA 1M7TA 5GAPD 1C72A 1XW6A 2C0DA 2AUVA 3GUSA 1KTEA 1YKCA 2NBSA 1TI1A 3L4NA 3C1RA 1FOVA 3DVXA 1GTBA 3DWVA 5A4UA 1SYXA 2H8LA 2IFQB 3BD2A 5H5RA 3KH7A 2C1YA 4BVXB 5CP1A 5KN0A 1FHEA 1XVWA 1PL2A 3DVWA 1FG4A 1HYUA 2LQQA 2XHFA 2MYGA 2IMDA 4YH2A 5J4UA 5ECRB 2CA8A 1GWCA 4KW6A 9GSSA 3H93A 3GL3A 5KEJA 3CBUA 3BCIA 4MF5A 2VM1A 5D9TA 3F3QA 1R5AA 3VWVA 1ZCPA 4IP6A 5B6NA 1UVZA 2G0FA 3MNGA 2K8VA 4Q5NA 5KN3A 5LD0A 3GRXA 2PUKC 2WFCA 3UMAA 1J0FA 1R26A 2K18A 1FVJA 2VAFA 2OE3A 3G7IA 4OWYA 5AN1A 5J5NA 2KLXA 3ERWA 3TJFA 4MZCA 3HJPA 3IHQA 1EZKA 2LS5A 1XBSA 3D21A 2VM2A 1EEMA 1TK5B 1ZOFA 2X8CA 3GKNA 3A2WA 1WIKA 2R37A 2RM5A 1O8XA 4L0WA 2YZHA 3GX8A 3CMIA 1KBNA 5FHIA 4I97A 2WJUA 1WJKA 2VOCA 1WOUA 2C3NA 2F51A 3QMXA 1BG5A 3D4TA 2C0FA 4NXIA 2GQLA 3CRTA 3TKSE 3L9UA 2PU9C 4Z7XA 4MF6A 3ZRDA 2P31A 3KTLA 4KCAA 3FR9A 2O8VB 3HDCA 5CAXA 2CAIA 4GQCA 1GP1A 3KMOA 1DUGA 1U87A 5IQYA 5ECQB 2VCZA 4PNFA 2C0GA 4WBJA 2JADA 4EE0A 4HQSA 1S3DA 3QAVA 4K2DA 4POMA 2R2JA 4KSOA 3P7XA 3UARA 4L5OA 1SD8A 4XS4B 5D93A 1QQ2A 2QKEA 4IGJA 5A4VA 4RQRA 2VL2A 3H4KA 13GSA 4YQUA 3FRCA 2LRTA 5CYYA 3L9SA 3F63A 2WGRA 1ZGNA 2DMLA 2FD3A 4FO5A 1EEJA 1UA5A 4I2UA 4FYCA 6GSUA 3TKSC 1A8YA 1FW1A 4EL1A 4EDYA 1TRSA 1J9BA 4POLA 1A24A 1XFLA 4WXTA 1YKAA 2PPTA 4TXVA 5H5SA 3TJKA 2X64A 2PWJA 4O32A 1YJ6A 3GA4A 1I5GA 1AIUA 5HR3A 3H8QA 4F2IA 1TW9A 1O81A 3WYWA 4ZL9A 1O85A 1AAZA 4BVYA 2V6KA 1JZWA 2H6XA 5ECIB 4K6XA 5HQPA 2HYXA 1K3YA 1SD9A
chains in the Genus database with same CATH superfamily
4K5SA 5DALB 4RI7A 1GRXA 2FWGA 5ECNB 3VWUA 2GSTA 3RPPA 4HUAA 3D5JA 3EC3A 1HNAA 1QMVA 2QC7A 4LA1A 1M2DA 5A5KA 3I69A 3APOA 5H5QA 4CDOA 2HI7A 1K0OA 3WGXA 4HU9A 2LQOA 5G30A 2EFDA 3GV1A 3TKQA 3ISOA 1M9AA 4EC0A 2H76A 2IMEA 5A34A 3EMXA 1ABAA 2B1LA 2E0QA 4TR1A 2VL9A 5GZZB 1XXUA 4NV2A 4HU7A 4PI0C 3KP9A 2GZYA 1VF2A 3GKKA 4J56E 2G2QA 5DQSA 1OC3A 4TW5A 3EU4A 4IJ3A 4ZBAA 2EFEA 1X5EA 2ZUPA 2GT5A 4BPYA 2MMAA 4OD7A 1G7EA 3K8NA 4NWYA 2ZCTA 2DC5A 3ZLPA 1GSUA 4MH2A 4G9HA 4XRAA 1LJRA 4KDXA 4MH3A 3WD6A 3EINA 1TJDA 2I9HA 4G0KA 4OCFA 2H0GA 4NHZA 4DSSB 1K3OA 3ZITA 4H86A 3SBCA 4ECJA 4ISDA 4ML1A 2R3XA 2YP6A 3US3A 1XWGA 4Q5QA 1H4OA 4TR0A 2L5LA 1OE7A 4K9ZA 2BMXA 3KCMA 1S3AA 4XTSA 3QPMA 3Q74A 2PVOC 2B7KA 3TKSA 1YVLA 2HE3A 2LRCA 4AF2A 5FWGA 4AJ6A 4TXOA 2LEGA 2IMIA 2L6CA 1GNEA 1SL0B 3RDWA 1NSWA 3ZREA 3NOFA 2DBCA 2MMZA 1MTCA 5F8BA 2WDUA 3ZL5A 2VLUA 5G31A 5D73A 1B8XA 3S9FA 3MDKA 4I8BA 1TU7A 3FR3A 3LSZA 5CRDA 1EP7A 2O87A 1G6WA 6GSSA 4PNGA 5KN1A 2LKUA 1JLWA 1WE0A 1EGRA 12GSA 4F03A 2DMMA 4O5UA 4Q5FA 2H73A 1AUCA 2YANA 5HR2A 4N3ZA 2F8AA 2GSRA 3CSHA 1XCCA 2ZNMA 4BIKA 4V2LA 1K0CA 2A2RA 1QGVA 3VI5A 3UL3A 1PX6A 4BA7A 1FB0A 3HVSA 3G7YA 2I1UA 4J2FA 4OFTA 1EOHA 4WETA 1MDJA 2GGTA 2WB9A 1O7UA 3NZNA 4KAEA 4DSQA 1O6JA 3GMFA 3KMNA 4KGIA 4NHWA 3BOAA 2O36A 1SL2B 2YJ7A 3TJJA 1USBA 5F0GA 1G6YA 4EO3A 2O7KA 4MCUA 2EFCA 2KUCA 2FLSA 1K0AA 3BCKA 5IO2A 4PQHA 3FKFA 1UN2A 3HZ4A 4JEDA 3HVVA 4PHZC 4NPBA 1T7PB 3GNJA 4K2XA 3D6IA 3E9JB 5JWQB 2V6OA 1S3RA 4K7IA 5G2ZA 2B1KA 2WZSA 10GSA 4XS1A 2JACA 2VLTA 3P2AA 4AGSA 2XBIA 2L59A 1TDIA 3KTBA 1SL1B 2XC2A 2HSMA 5COHA 2R4VA 1XWAA 1F9MA 2QGVA 2H66A 1M2BA 2IN3A 3IPZA 2MBSA 3MAKA 4DVCA 2AJQB 2HNLA 3VK9A 2C4JA 4QQ7A 3DGQA 3DRNA 1A0FA 2X99A 2FWEA 2X49A 1WMJA 1WRYA 1NHYA 3IHGA 1A2JA 3FR6A 4KX4A 1PL1A 5JCGA 3ZIVA 2VL2C 3PPUA 2WS2A 2HRAA 4FYBA 2IIYA 1PA3A 2DIYA 4FH8A 2LV3A 1JZDA 1SVLA 1AXDA 4TRXA 4WF5A 2H1AA 4LMWA 1XOBA 3IAS2 4O5QA 3U5RE 3HJOA 4GQFA 4V1Ag 6GSYA 4MPGA 1TTZA 3TGZA 4P3YB 4A5PA 4E68A 3UBLA 2PVQA 2H75A 3LG6A 2C3QA 3IA1A 5ID2B 6GSXA 4GTUA 1TXUA 2DJ2A 4NAXA 2YV7A 3R3EA 5JWRB 3HHVA 4MDCA 1THOA 2CX3A 4GWRA 4TXOB 5F06A 4GSNA 1SJ6A 4KUNA 4G10A 3LYPA 2CVKA 1SKRB 4Q5RA 3HMJG 2Z9SA 1M2AA 1PKWA 1Z5YE 4RI6A 3RGBC 1M3IA 2B5YA 3A5IA 1K0MA 5GSSA 1B4PA 2N5AA 1GTUA 5ELGA 5JCUA 1O73A 1GUMA 2WW3A 3DD3A 2GSQA 5DQYA 5J3RA 2VO4A 3EPTA 1A0RP 1T3BA 4I5QA 2VCTA 3RHCA 3GTUA 4WEYA 2B3SA 1Z7RA 2HXKA 1PMTA 3PGTA 2H1GA 3E0UA 1DSBA 1F3BA 4GLTA 2OA7A 1AW9A 4L0UA 2LTKA 4PQ1A 3GKMA 4QL7A 1PN0A 3TJGA 2FA4A 1MDKA 1QUWA 3HJMA 5INYA 5J4YA 1F2EA 2VLVA 20GSA 3M1GA 4PTSA 5A4WA 4FXYP 1ERTA 2B5EA 3IRAA 4HJMA 5IMVA 4BL7B 2CVBA 1YF0A 3IOSA 2CVDA 4WF4A 4D73A 3CYNA 4PI2C 4PX1A 3R2QA 2RM6A 4ECBA 2JZSA 4LL4B 3UVHA 2BJXA 3HD5A 1XW9A 1FVKA 4HEA2 1OKDA 4EKZA 2L4CA 3KZQA 4IN0A 2R6KA 3N5OA 4L8EA 4OO4A 3CXGA 1W89A 3TRQA 1U6TA 4CY8A 5DDLA 3CTGA 4F0CA 5LNKe 1GUHA 1TRUA 4F0BA 1ILOA 3QAWA 3FK8A 1OYJA 2H6YA 1JHBA 1LU4A 4ILFA 5ABRA 1K0DA 3ME8A 2YWIA 3TJBA 1K0NA 4DSRA 3BJ5A 5EY6A 5DBQA 3IK9A 2YZUA 3Q18A 3MWHA 3O3TA 1OAZA 3W8JA 5HFKA 1DBYA 4JBBA 1XW5A 2HSMB 4O7HA 5C04A 3UVTA 3VPTA 4GRFA 4AKGA 2FGXA 4DEJA 3FZ4A 1HNCA 4EIQA 2LNSA 3A2XA 3MSZA 4AKHA 3GN3A 1PN9A 2CZ3A 1QK8A 3L0HA 4HZ2A 3HXSA 3EWLA 2UZ8A 4KCEA 4IW9A 1GSSA 4KDYA 1Q98A 3ZTLA 2XPDA 5DCGA 1M9BA 6GSVA 2DIZA 4YKGA 1TRWA 2OACA 3A3TA 2HFDA 1GSQA 3H1NA 3O6TA 3APSA 5IMAA 2AHEA 1VGLA 4IP1A 2GQMA 1WP0A 3DKSA 4IS0A 1Z6MA 1SENA 16GSA 4RUVA 1MD3A 2L57A 2J23A 2B7JA 1LBKA 3CSIA 3QFAC 3KEBA 1VF3A 3EE2A 3OR5A 2HZEA 3P8WA 5AIVA 1T8EB 1GULA 2OE1A 2H1DA 3EU3A 3M9JA 1FAAA 2EIQA 2V41A 1PQNA 3CQFA 5E4WA 2JSYA 3D4MA 22GSA 3IC8A 3TRXA 1XWKA 5JCWA 1PGTA 1H75A 4LMVA 4PQIA 1Z6NA 4ACSA 4YAPA 2HZFA 1SK1A 2MMNA 3QCPA 1SVMA 1T1VA 3CTFA 4I2TA 2WW0A 2ES7A 2DKIA 1UC7A 3LXZA 2X8GA 4TR3A 3TB2A 1E6BA 5GAND 3VI7A 1HNBA 2D2ZA 1Y1UA 3TCOA 4EXJA 3PR8A 1MEKA 2RIIA 4MZBA 1SU9A 2E7PA 4W66A 1SJZA 1N2AA 4MK3A 1R4WA 1GSYA 2PGTA 3FYGA 4HOJA 4NV5A 2C80A 1OKTA 5ECOB 1NHOA 2VCQA 2CQ9A 4G0IA 4ML6A 5CRHA 5EL8A 4G2EA 1RK4A 4WBRD 2WVYA 3TU3B 2M72A 2RUFA 1XWBA 8GSSA 4OFNA 1E2YA 3F8UA 2UV8G 1DE1A 2IFQA 4MJAA 4IVFA 2TIRA 5B7CA 11GSA 2K9FA 1V57A 2RUEA 4KA0A 3KJYA 3TRPA 5IOWA 3RHBA 3ZMLA 4AJ8A 3LYKA 2GVPA 1Z3EA 3J7Yk 1U3AA 2PN8A 1TK8B 4ZL8A 3L78A 1VF4A 2ON5A 1BG1A 2DJ3A 3LEFA 3F0IA 3J7Yb 1B9XC 4PGTA 1YEPA 1G7OA 1PFOA 3FZ9A 1ACVA 1MDIA 1ERUA 1BAYA 3ZVJA 1F3AA 5A1NA 3KP8A 4N0VA 3EMPA 4WR5A 3V1WA 2FA8A 1T00A 3G9BA 2JSZA 4MP4A 2JZRA 5FT3A 3TKPA 5KN2A 2CX4A 1Z7PA 4K7NA 3FW2A 4GSTA 4K0GA 5CRGA 5DVBA 1TK0B 4BVYB 4I6XA 17GSA 1TOFA 2HSNA 5G5FA 4MA9A 3O76A 4ZXGA 3IDVA 5AGYA 4Z2RA 1ON4A 1AQVA 3DXBA 4IQ1A 3LW9A 1GTAA 2LNTA 1GNWA 2CT6A 5EVOA 5IMDA 1AC1A 3GH6A 2A2PA 3W6GA 2KOKA 1TXXA 3L9VA 1ZYQB 2VCWA 3F3RA 2GT6A 2MZCA 2LJRA 5IIZA 3VWWA 5D9XA 14GSA 2L6DA 2HZEB 4HDEA 2HRNA 3CSJA 2O3EA 3RBTA 4HQZA 3GH9A 3KD0A 4MNNA 2MMOA 1QXHA 2FY6A 4KB3A 1FB6A 2EC4A 3IXRA 4JZQA 3RPNA 4YQMA 3DYRA 4K1FA 2V1MA 2IPAA 2XBQA 1BQ7A 5A34B 1CQHA 2RLIA 1SK0A 2C3TA 5ECKB 2GQKA 4TR1B 3GIXA 1I1IP 1TRVA 4ZILA 1W4VA 5D9WA 1NM3A 2LUSA 2K8SA 4EDZA 4G19A 1X5DA 4KNDA 1AQWA 4X0XA 2LJAA 3PINA 2K6VA 3FZAA 5IOXA 1K0BA 2AV4A 3UJ1A 1R7HA 19GSA 5HR0A 4FIWA 1IYIA 4XS4A 5GSTA 1QFNA 3M3MA 2EIOA 3NIVA 1WPIA 1BF5A 1X5CA 5ECLB 4CHSA 3I43A 4FYUA 3H79A 3HA9A 2YWOA 4K8MA 1X9SB 1JLVA 4XRDA 3C73A 1ZZYA 2CV4A 1WWJA 2FWHA 2V32A 2MBTA 4ZBDA 4EVMA 3LWAA 5HFGA 3M8NA 3ME7A 1SYRA 5IPHA 3F4SA 4ZB8A 1VF1A 2P5QA 2KP2A 3VWXA 1GSDA 4G01A 2GTUA 5ENUA 4JU5A 1T4YA 1X0RA 4K0NA 3F4RA 4V1Ap 1PRXA 5J47A 1XPVA 4BWQA 3CWGA 1U88A 4POBA 1EGOA 4O92A 2R0PA 4QL9A 2KP1A 1BYEA 5JWOB 2IMKA 1XIYA 4OO5A 3HY2A 1Q4JA 1ERWA 1BEDA 2O5VA 3TOTA 3A5WA 4E8EA 2OE0A 5CO3A 3ED3A 5B8AA 2YWMA 4N10A 1YY7A 3N9JA 2DJ1A 5DALA 3C7MA 3U6VA 2EIRA 4MJCA 4HZ4A 1SK2A 3KXOA 2H71A 4K7OA 3M0FA 3GHAA 5IO0A 2JU5A 1IYHA 2DJJA 3VURA 5J41A 1SVOA 4LLRA 2EFHA 1GTIA 3Q19A 1V98A 1KNGA 5EPFA 2H0HA 4ID0A 18GSA 3AY8A 2PERA 5DCHA 3FMWA 2E2MA 3DIEA 3EURA 2HSNB 3IC4A 4YQVA 2KHPA 2H19A 4N30A 5LCZA 4Z2TA 2NDOA 2NVLA 3P90A 2HRKA 2A2SA 1I9DA 3QD9A 4GXZA 3SWLA 4MMMA 5IMZA 4ECCA 3ZIJA 1X9WB 5CNWA 5G1KA 4OCEA 5D96A 2WVZA 2GSSA 3F9UA 3IAM2 5HFIA 4MABA 2B5XA 3FEUA 2P0GA 2TRXA 2VCVA 3QOUA 2AAWA 4ZL7A 2R5GA 4PURA 4AKIA 2GZZA 1XVQA 4IQAA 4NMUA 4ZB6A 1OE8A 2ALBA 3EYTA 3KGKA 1GL8A 2TRCP 3DEXA 4DSSA 4GF0A 1EV9A 3ZZXA 1Z9HA 4KE3A 4KSMA 4IELA 3IK7A 4HS1A 2VCXA 3GURA 2NTOA 5IM9A 5HR1A 1EV4A 1EWXA 3GX0A 1VRSD 2GS3A 2R0CA 2H0IA 1THXA 1XZOA 2YN1A 1SJIA 3BBYA 2OBIA 4TKYA 2HT9A 1ZYEA 6GSTA 1J08A 1M99A 1KEBA 2X8HA 3FHKA 3WT1A 4Z2UA 2NPBA 4YAVA 2HSYA 4J57E 2IMFA 2YCDA 4CW9A 3HKRA 3W8SA 4ECIA 4IJIA 1GSEA 3HYPA 4TVEA 1PKZA 2WZ9A 2OKAA 2I4AA 3A2VA 4V2MA 3IV4A 3ZFBA 1R5PA 3GKXA 3I9V2 5B6MA 5B8BA 1HQOA 4JR4A 2YNXA 4USSA 2DJ0A 5IMFA 1PSQA 1GUKA 2I81A 3E3EA 3G7JA 2N5BA 3I6AA 3RAZA 5F07A 3FY7A 5AISA 3GYKA 3TOUA 4ZB7A 1V9WA 3KH9A 1BJXA 3JCML 2BTOT 5L71A 2JZTA 1XWCA 2OADA 1XG8A 4KF9A 1XOAA 1U3IA 2L4QA 3TDGA 1B4QA 2H1LA 2H30A 5IMCA 1JZOA 2HRFA 2YV9A 3UOMA 2DJKA 3UIWA 4IBPA 1Y6EA 5IPGA 1YQ1A 4HI7A 2LSTA 3HZ8A 7GSSA 4FQUA 2FUG2 3F6DA 5J9CA 1YDKA 1A2LA 4BWSA 3VLNA 3GTUB 3IE3A 2VD0A 3VFIA 4XCSA 4PUFC 2H70A 3RFRC 4E8HA 5DJLA 1RW1A 3QAGA 2YWNA 2F8FA 4MZWA 4JR6A 3ZFLA 1X9MB 4X1UA 4KDUA 4TN8A 2CZ2A 2HRKB 1OC9A 1ZYPA 1CQGA 4MLYA 1TKDB 1OVNA 3KIJA 2PMTA 5ECHB 2VUPA 4N0ZA 4EIPA 1A2MA 1DE2A 1S3CA 3Q6OA 1V2AA 4MJBA 2H74A 2N5FA 5DAKA 1ZMAA 1V40A 2WULA 4D73B 4OFMA 3GSSA 2VD1A 3EVIA 3F6FA 4IKHA 1GLPA 2WVXA 3HCZA 1O8WA 1F6MC 3LJRA 3D0ZA 1G0TA 4X43A 3WGEA 4IHUA 4JRRA 3TKRA 3FZ5A 3PH9A 1B9YC 1A23A 4HJ2A 3GSTA 4BVXA 1M0UA 2M46A 3UBKA 2LJKA 2PBJA 3D22A 4ZIJA 2F9SA 1HD2A 3QFBC 4KH7A 4AI6A 5CRWA 1YZXA 2QA1A 5ELAA 2LRNA 3IBHA 2JL4A 1S4BP 4PUAA 4TOPA 4XS6A 4V2NA 5ECPB 2P5RA 4MJEA 2C0EA 2DSAA 4F9ZA 3GL5A 5CREA 3ZMKA 3LQ7A 1SKSB 1ZL9A 3ZVJD 4EF0A 5G5EA 1GH2A 2IL3A 5BMUA 2O85A 5ID2A 3GFKA 2AYTA 2VIMA 3ERGA 2FWFA 2WRTA 4AJ7A 3WGDA 5G1LA 2H6ZA 1TP9A 2OJLA 4LL1B 2HQTA 2DLXA 2DKHA 3C1SA 3HVNA 2A4VA 1AQXA 5D8IA 2YOIA 1MD4A 2AB6A 1EP8A 4WR4A 3IR4A 4O5RA 5J9BA 3ERFA 3M9KA 4EUYA 1K3LA 2VKZG 3UEMA 5D9VA 4PXOA 3LFLA 2REMA 3QR6A 1JZRA 1A8LA 1ML6A 5F05A 3QDNA 1PD21 3APQA 4GCIA 4RQXA 5AIXA 5J40A 1NW2A 1YEXA 2H72A 3LXTA 2HSHA 2XPEA 4ZB9A 1ST9A 3DMLA 5E59A 3ZYWA 5ECMB 3TUEA 3C8EA 4L5LA 2VL3A 4WKWA 4N11A 6GSWA 3F4TA 2GZPA 2L5OA 4TR4A 3MYDA 1YF1A 2M80A 2IJYA 4GDFA 3CRUA 2E2GA 2OBKA 1TU8A 2V2GA 2O89A 2WCIA 2YJHA 4YKFA 1FO5A 2GDRA 1T4ZA 2FNOA 4X4JA 4MPFA 5ECSA 4BL7A 4ZBBA 2ON7A 1EOGA 4GSSA 2F3MA 1SKWB 2CAQA 2B6MA 2I3YA 2C8UA 4MF7A 1URMA 1B48A 1GSFA 4XIHA 4ULXA 5C00A 1N8JA 4POKA 2FHEA 3LORA 5DJMA 1PX7A 1TI3A 1OC8A 3UAPA 2YPMA 1GLQA 2WW2A 2GLRA 2QA2A 1Y25A 3HVXA 2H01A 2HLSA 4XHMA 3C71A 4OMVA 1OC9B 3VPQA 2H1BA 2QSIA 1V58A 4G0LA 4F82A 2IWTA 4JE1A 1BX9A 3LGCA 1ERVA 1JFUA 5DAKB 1RQMA 3WT2A 3KM6A 2FCHA 1F37A 4CY6A 2J9HA 1M7TA 5GAPD 5BRTA 2WVXB 5KOWA 1C72A 1YEWC 1XW6A 2C0DA 2AUVA 3GUSA 1KTEA 1YKCA 5A5HA 2NBSA 1TI1A 3L4NA 3C1RA 1FOVA 3DVXA 1GTBA 3DWVA 5A4UA 1SYXA 2H8LA 2IFQB 3BD2A 5H5RA 3KH7A 2C1YA 4BVXB 5CP1A 5KN0A 1FHEA 1XVWA 1PL2A 3CHXC 3DVWA 1FG4A 1HYUA 2LQQA 2XHFA 2MYGA 2IMDA 4YH2A 5J4UA 5ECRB 2CA8A 1GWCA 4KW6A 9GSSA 3H93A 3GL3A 5KEJA 3CBUA 3BCIA 4MF5A 2VM1A 5D9TA 3F3QA 5BMUB 1R5AA 5A1NB 3VWVA 1ZCPA 4IP6A 5B6NA 1UVZA 2G0FA 3MNGA 2K8VA 4Q5NA 5KN3A 5LD0A 3GRXA 2PUKC 2WFCA 3UMAA 1J0FA 1R26A 2K18A 1FVJA 2VAFA 2OE3A 3G7IA 4OWYA 5AN1A 5J5NA 2KLXA 2X4AA 3ERWA 3TJFA 4MZCA 3HJPA 3IHQA 1EZKA 2LS5A 1XBSA 3D21A 4AKXB 2VM2A 4K5RA 1EEMA 1TK5B 1ZOFA 2X8CA 3GKNA 3A2WA 2WW1A 1WIKA 2R37A 2RM5A 1O8XA 4L0WA 2YZHA 3GX8A 3CMIA 1KBNA 5FHIA 4I97A 2WJUA 1WJKA 3MIXA 2VOCA 1WOUA 2C3NA 2OT3A 2F51A 3QMXA 1BG5A 3D4TA 2C0FA 4NXIA 2GQLA 3CRTA 3TKSE 3L9UA 2PU9C 4Z7XA 4MF6A 1M3JA 3ZRDA 2P31A 3KTLA 4HSCX 3FR9A 4KCAA 2O8VB 3HDCA 5CAXA 2CAIA 4GQCA 1GP1A 3KMOA 1DUGA 1U87A 5IQYA 5ECQB 2VCZA 4PNFA 2C0GA 4WBJA 2JADA 4EE0A 5KOXA 4HQSA 4QMKA 1S3DA 3QAVA 4K2DA 2A4HA 4POMA 2R2JA 4KSOA 3P7XA 3UARA 4L5OA 1SD8A 4XS4B 5D93A 1QQ2A 2QKEA 4IGJA 5A4VA 1ZYNA 4RQRA 2VL2A 3H4KA 13GSA 4YQUA 3FRCA 2LRTA 5CYYA 3L9SA 3F63A 2WGRA 1ZGNA 2DMLA 2FD3A 4FO5A 1EEJA 1UA5A 5A5HB 4I2UA 4FYCA 6GSUA 3TKSC 1A8YA 1FW1A 4EL1A 4EDYA 1TRSA 1N25A 1J9BA 4POLA 1A24A 1XFLA 4WXTA 1YKAA 2PPTA 4TXVA 5H5SA 3TJKA 2X64A 2PWJA 4O32A 1YJ6A 3GA4A 1I5GA 5J4VA 1AIUA 5HR3A 3H8QA 4F2IA 1TW9A 1O81A 3WYWA 2R0GA 4ZL9A 1O85A 1AAZA 4BVYA 2V6KA 4ICYA 1JZWA 2H6XA 5ECIB 1FOHA 4K6XA 5HQPA 2HYXA 1K3YA 1SD9A
chains in the Genus database with same CATH topology
4K5SA 5DALB 4RI7A 1GRXA 2FWGA 5ECNB 3VWUA 2GSTA 3RPPA 4HUAA 3D5JA 3EC3A 1HNAA 1QMVA 2QC7A 4LA1A 1M2DA 5A5KA 3I69A 3APOA 5H5QA 4CDOA 2HI7A 1K0OA 3WGXA 4HU9A 2LQOA 5G30A 2EFDA 3GV1A 3TKQA 3ISOA 1M9AA 4EC0A 2H76A 2IMEA 5A34A 3EMXA 1ABAA 2B1LA 2E0QA 4TR1A 2VL9A 5GZZB 1XXUA 4NV2A 4HU7A 3KP9A 2GZYA 1VF2A 3GKKA 4J56E 2G2QA 5DQSA 1OC3A 4TW5A 3EU4A 4IJ3A 4ZBAA 2EFEA 1X5EA 2ZUPA 2GT5A 4BPYA 2MMAA 4OD7A 1G7EA 3K8NA 4NWYA 2ZCTA 2DC5A 3ZLPA 1GSUA 4MH2A 4G9HA 4XRAA 1LJRA 4KDXA 4MH3A 3WD6A 3EINA 1TJDA 2I9HA 4G0KA 4OCFA 2H0GA 4NHZA 4DSSB 1K3OA 3ZITA 4H86A 3SBCA 4ECJA 4ISDA 4ML1A 2R3XA 2YP6A 3US3A 1XWGA 4Q5QA 1H4OA 4TR0A 2L5LA 1OE7A 4K9ZA 2BMXA 3KCMA 1S3AA 4XTSA 3QPMA 3Q74A 2PVOC 2B7KA 3TKSA 1YVLA 2HE3A 2LRCA 4AF2A 5FWGA 4AJ6A 4TXOA 2LEGA 2IMIA 2L6CA 1GNEA 1SL0B 3RDWA 1NSWA 3ZREA 3NOFA 2DBCA 2MMZA 1MTCA 5F8BA 2WDUA 3ZL5A 2VLUA 5G31A 5D73A 1B8XA 3S9FA 3MDKA 4I8BA 1TU7A 3FR3A 3LSZA 5CRDA 1EP7A 2O87A 1G6WA 6GSSA 4PNGA 5KN1A 2LKUA 1JLWA 1WE0A 1EGRA 12GSA 4F03A 2DMMA 4O5UA 4Q5FA 2H73A 1AUCA 2YANA 5HR2A 4N3ZA 2F8AA 2GSRA 3CSHA 1XCCA 2ZNMA 4V2LA 1K0CA 2A2RA 1QGVA 3VI5A 3UL3A 1PX6A 4BA7A 1FB0A 3HVSA 3G7YA 2I1UA 4J2FA 4OFTA 1EOHA 4WETA 1MDJA 2GGTA 2WB9A 1O7UA 3NZNA 4KAEA 4DSQA 1O6JA 3GMFA 3KMNA 4KGIA 4NHWA 3BOAA 1SL2B 2YJ7A 3TJJA 1USBA 5F0GA 1G6YA 4EO3A 2O7KA 4MCUA 2EFCA 2KUCA 2FLSA 1K0AA 3BCKA 5IO2A 4PQHA 3FKFA 1UN2A 3HZ4A 4JEDA 3HVVA 4NPBA 1T7PB 3GNJA 4K2XA 3D6IA 3E9JB 5JWQB 2V6OA 4K7IA 5G2ZA 2B1KA 10GSA 4XS1A 2JACA 2VLTA 3P2AA 4AGSA 2XBIA 2L59A 1TDIA 3KTBA 1SL1B 2XC2A 2HSMA 5COHA 2R4VA 1XWAA 1F9MA 2QGVA 2H66A 1M2BA 2IN3A 3IPZA 2MBSA 3MAKA 4DVCA 2AJQB 2HNLA 3VK9A 2C4JA 4QQ7A 3DGQA 3DRNA 1A0FA 2X99A 2FWEA 2X49A 1WMJA 1WRYA 1NHYA 3IHGA 1A2JA 3FR6A 4KX4A 1PL1A 5JCGA 3ZIVA 2VL2C 3PPUA 2WS2A 2HRAA 4FYBA 2IIYA 1PA3A 2DIYA 4FH8A 2LV3A 1JZDA 1SVLA 1AXDA 4TRXA 4WF5A 2H1AA 4LMWA 1XOBA 3IAS2 4O5QA 3U5RE 3HJOA 4GQFA 4V1Ag 6GSYA 4MPGA 1TTZA 3TGZA 4P3YB 4A5PA 4E68A 3UBLA 2PVQA 2H75A 3LG6A 2C3QA 3IA1A 5ID2B 6GSXA 4GTUA 1TXUA 2DJ2A 4NAXA 2YV7A 3R3EA 5JWRB 3HHVA 4MDCA 1THOA 2CX3A 4GWRA 4TXOB 5F06A 4GSNA 1SJ6A 4KUNA 4G10A 3LYPA 2CVKA 1SKRB 4Q5RA 3HMJG 2Z9SA 1M2AA 1PKWA 1Z5YE 4RI6A 2B5YA 3A5IA 1K0MA 5GSSA 1B4PA 2N5AA 1GTUA 5ELGA 5JCUA 1O73A 1GUMA 3DD3A 2GSQA 5DQYA 5J3RA 2VO4A 3EPTA 1A0RP 1T3BA 4I5QA 2VCTA 3RHCA 3GTUA 4WEYA 2B3SA 1Z7RA 2HXKA 1PMTA 3PGTA 2H1GA 3E0UA 1DSBA 1F3BA 4GLTA 2OA7A 1AW9A 4L0UA 2LTKA 4PQ1A 3GKMA 4QL7A 1PN0A 3TJGA 2FA4A 1MDKA 1QUWA 3HJMA 5INYA 5J4YA 1F2EA 2VLVA 20GSA 3M1GA 4PTSA 5A4WA 1ERTA 2B5EA 3IRAA 4HJMA 5IMVA 4BL7B 2CVBA 1YF0A 3IOSA 2CVDA 4WF4A 4D73A 3CYNA 4PX1A 3R2QA 2RM6A 4ECBA 2JZSA 4LL4B 3UVHA 2BJXA 3HD5A 1XW9A 1FVKA 4HEA2 1OKDA 4EKZA 2L4CA 3KZQA 4IN0A 2R6KA 3N5OA 4L8EA 4OO4A 3CXGA 1W89A 3TRQA 1U6TA 4CY8A 5DDLA 3CTGA 4F0CA 5LNKe 1GUHA 1TRUA 4F0BA 1ILOA 3QAWA 3FK8A 1OYJA 2H6YA 1JHBA 1LU4A 4ILFA 5ABRA 1K0DA 3ME8A 2YWIA 3TJBA 1K0NA 4DSRA 3BJ5A 5EY6A 5DBQA 3IK9A 2YZUA 3Q18A 3MWHA 3O3TA 1OAZA 3W8JA 5HFKA 1DBYA 4JBBA 1XW5A 2HSMB 4O7HA 5C04A 3UVTA 3VPTA 4GRFA 4AKGA 2FGXA 4DEJA 3FZ4A 1HNCA 4EIQA 2LNSA 3A2XA 3MSZA 4AKHA 3GN3A 1PN9A 2CZ3A 1QK8A 3L0HA 4HZ2A 3HXSA 3EWLA 2UZ8A 4KCEA 4IW9A 1GSSA 4KDYA 1Q98A 3ZTLA 2XPDA 5DCGA 1M9BA 6GSVA 2DIZA 4YKGA 1TRWA 2OACA 3A3TA 2HFDA 1GSQA 3H1NA 3O6TA 3APSA 5IMAA 2AHEA 1VGLA 4IP1A 2GQMA 1WP0A 3DKSA 4IS0A 1Z6MA 1SENA 16GSA 4RUVA 1MD3A 2L57A 2J23A 2B7JA 1LBKA 3CSIA 3QFAC 3KEBA 1VF3A 3EE2A 3OR5A 2HZEA 3P8WA 5AIVA 1T8EB 1GULA 2OE1A 2H1DA 3EU3A 3M9JA 1FAAA 2EIQA 2V41A 1PQNA 5E4WA 2JSYA 3D4MA 22GSA 3IC8A 3TRXA 1XWKA 5JCWA 1PGTA 1H75A 4LMVA 4PQIA 1Z6NA 4ACSA 4YAPA 2HZFA 1SK1A 2MMNA 3QCPA 1SVMA 1T1VA 3CTFA 4I2TA 2ES7A 2DKIA 1UC7A 3LXZA 2X8GA 4TR3A 3TB2A 1E6BA 5GAND 3VI7A 1HNBA 2D2ZA 1Y1UA 3TCOA 4EXJA 3PR8A 1MEKA 2RIIA 4MZBA 1SU9A 2E7PA 4W66A 1SJZA 1N2AA 4MK3A 1R4WA 1GSYA 2PGTA 3FYGA 4HOJA 4NV5A 2C80A 1OKTA 5ECOB 1NHOA 2VCQA 2CQ9A 4G0IA 4ML6A 5CRHA 5EL8A 4G2EA 1RK4A 4WBRD 3TU3B 2M72A 2RUFA 1XWBA 8GSSA 4OFNA 1E2YA 3F8UA 2UV8G 1DE1A 2IFQA 4MJAA 4IVFA 2TIRA 5B7CA 11GSA 2K9FA 1V57A 2RUEA 4KA0A 3KJYA 3TRPA 5IOWA 3RHBA 3ZMLA 4AJ8A 3LYKA 2GVPA 1Z3EA 3J7Yk 1U3AA 2PN8A 1TK8B 4ZL8A 3L78A 1VF4A 2ON5A 1BG1A 2DJ3A 3LEFA 3F0IA 3J7Yb 1B9XC 4PGTA 1YEPA 1G7OA 3FZ9A 1ACVA 1MDIA 1ERUA 1BAYA 3ZVJA 1F3AA 5A1NA 3KP8A 4N0VA 3EMPA 4WR5A 3V1WA 2FA8A 1T00A 3G9BA 2JSZA 4MP4A 2JZRA 5FT3A 3TKPA 5KN2A 2CX4A 1Z7PA 4K7NA 3FW2A 4GSTA 4K0GA 5CRGA 5DVBA 1TK0B 4BVYB 4I6XA 17GSA 1TOFA 2HSNA 5G5FA 4MA9A 3O76A 4ZXGA 3IDVA 5AGYA 4Z2RA 1ON4A 1AQVA 3DXBA 4IQ1A 3LW9A 1GTAA 2LNTA 1GNWA 2CT6A 5EVOA 5IMDA 1AC1A 3GH6A 2A2PA 3W6GA 2KOKA 1TXXA 3L9VA 1ZYQB 2VCWA 3F3RA 2GT6A 2MZCA 2LJRA 5IIZA 3VWWA 5D9XA 14GSA 2L6DA 2HZEB 4HDEA 2HRNA 3CSJA 3RBTA 4HQZA 3GH9A 3KD0A 4MNNA 2MMOA 1QXHA 2FY6A 4KB3A 1FB6A 2EC4A 3IXRA 4JZQA 3RPNA 4YQMA 3DYRA 4K1FA 2V1MA 2IPAA 2XBQA 1BQ7A 5A34B 1CQHA 2RLIA 1SK0A 2C3TA 5ECKB 2GQKA 4TR1B 3GIXA 1TRVA 4ZILA 1W4VA 5D9WA 1NM3A 2LUSA 2K8SA 4EDZA 4G19A 1X5DA 4KNDA 1AQWA 4X0XA 2LJAA 3PINA 2K6VA 3FZAA 5IOXA 1K0BA 2AV4A 3UJ1A 1R7HA 19GSA 5HR0A 4FIWA 1IYIA 4XS4A 5GSTA 1QFNA 3M3MA 2EIOA 3NIVA 1WPIA 1BF5A 1X5CA 5ECLB 4CHSA 3I43A 4FYUA 3H79A 3HA9A 2YWOA 4K8MA 1X9SB 1JLVA 4XRDA 3C73A 1ZZYA 2CV4A 1WWJA 2FWHA 2V32A 2MBTA 4ZBDA 4EVMA 3LWAA 5HFGA 3M8NA 3ME7A 1SYRA 5IPHA 3F4SA 4ZB8A 1VF1A 2P5QA 2KP2A 3VWXA 1GSDA 4G01A 2GTUA 5ENUA 4JU5A 1T4YA 1X0RA 4K0NA 3F4RA 4V1Ap 1PRXA 5J47A 1XPVA 4BWQA 3CWGA 1U88A 4POBA 1EGOA 4O92A 2R0PA 4QL9A 2KP1A 1BYEA 5JWOB 2IMKA 1XIYA 4OO5A 3HY2A 1Q4JA 1ERWA 1BEDA 2O5VA 3TOTA 3A5WA 4E8EA 2OE0A 5CO3A 3ED3A 5B8AA 2YWMA 4N10A 1YY7A 3N9JA 2DJ1A 5DALA 3C7MA 3U6VA 2EIRA 4MJCA 4HZ4A 1SK2A 3KXOA 2H71A 4K7OA 3M0FA 3GHAA 5IO0A 2JU5A 1IYHA 2DJJA 3VURA 5J41A 1SVOA 4LLRA 2EFHA 1GTIA 3Q19A 1V98A 1KNGA 5EPFA 2H0HA 4ID0A 18GSA 3AY8A 2PERA 5DCHA 3FMWA 2E2MA 3DIEA 3EURA 2HSNB 3IC4A 4YQVA 2KHPA 2H19A 4N30A 5LCZA 4Z2TA 2NDOA 2NVLA 3P90A 2HRKA 2A2SA 1I9DA 3QD9A 4GXZA 3SWLA 4MMMA 5IMZA 4ECCA 3ZIJA 1X9WB 5CNWA 5G1KA 4OCEA 5D96A 2GSSA 3F9UA 3IAM2 5HFIA 4MABA 2B5XA 3FEUA 2P0GA 2TRXA 2VCVA 3QOUA 2AAWA 4ZL7A 2R5GA 4PURA 4AKIA 2GZZA 1XVQA 4IQAA 4NMUA 4ZB6A 1OE8A 2ALBA 3EYTA 3KGKA 1GL8A 2TRCP 3DEXA 4DSSA 4GF0A 1EV9A 3ZZXA 1Z9HA 4KE3A 4KSMA 4IELA 3IK7A 4HS1A 2VCXA 3GURA 2NTOA 5IM9A 5HR1A 1EV4A 1EWXA 3GX0A 1VRSD 2GS3A 2R0CA 2H0IA 1THXA 1XZOA 2YN1A 1SJIA 3BBYA 2OBIA 4TKYA 2HT9A 1ZYEA 6GSTA 1J08A 1M99A 1KEBA 2X8HA 3FHKA 3WT1A 4Z2UA 2NPBA 4YAVA 2HSYA 4J57E 2IMFA 2YCDA 4CW9A 3HKRA 3W8SA 4ECIA 4IJIA 1GSEA 3HYPA 4TVEA 1PKZA 2WZ9A 2OKAA 2I4AA 3A2VA 4V2MA 3IV4A 3ZFBA 1R5PA 3GKXA 3I9V2 5B6MA 5B8BA 1HQOA 4JR4A 2YNXA 4USSA 2DJ0A 5IMFA 1PSQA 1GUKA 2I81A 3E3EA 3G7JA 2N5BA 3I6AA 3RAZA 5F07A 3FY7A 5AISA 3GYKA 3TOUA 4ZB7A 1V9WA 3KH9A 1BJXA 3JCML 2BTOT 5L71A 2JZTA 1XWCA 2OADA 4KF9A 1XOAA 1U3IA 2L4QA 3TDGA 1B4QA 2H1LA 2H30A 5IMCA 1JZOA 2HRFA 2YV9A 3UOMA 2DJKA 3UIWA 4IBPA 1Y6EA 5IPGA 1YQ1A 4HI7A 2LSTA 3HZ8A 7GSSA 4FQUA 2FUG2 3F6DA 5J9CA 1YDKA 1A2LA 4BWSA 3VLNA 3GTUB 3IE3A 2VD0A 3VFIA 4XCSA 4PUFC 2H70A 4E8HA 5DJLA 1RW1A 3QAGA 2YWNA 2F8FA 4MZWA 4JR6A 3ZFLA 1X9MB 4X1UA 4KDUA 4TN8A 2CZ2A 2HRKB 1OC9A 1ZYPA 1CQGA 4MLYA 1TKDB 1OVNA 3KIJA 2PMTA 5ECHB 2VUPA 4N0ZA 4EIPA 1A2MA 1DE2A 1S3CA 3Q6OA 1V2AA 4MJBA 2H74A 2N5FA 5DAKA 1ZMAA 1V40A 2WULA 4D73B 4OFMA 3GSSA 2VD1A 3EVIA 3F6FA 4IKHA 1GLPA 3HCZA 1O8WA 1F6MC 3LJRA 3D0ZA 1G0TA 4X43A 3WGEA 4IHUA 4JRRA 3TKRA 3FZ5A 3PH9A 1B9YC 1A23A 4HJ2A 3GSTA 4BVXA 1M0UA 2M46A 3UBKA 2LJKA 2PBJA 3D22A 4ZIJA 2F9SA 1HD2A 3QFBC 4KH7A 4AI6A 5CRWA 1YZXA 2QA1A 5ELAA 2LRNA 3IBHA 2JL4A 4PUAA 4TOPA 4XS6A 4V2NA 5ECPB 2P5RA 4MJEA 2C0EA 2DSAA 4F9ZA 3GL5A 5CREA 3ZMKA 3LQ7A 1SKSB 1ZL9A 3ZVJD 4EF0A 5G5EA 1GH2A 2IL3A 5BMUA 2O85A 5ID2A 3GFKA 2AYTA 2VIMA 3ERGA 2FWFA 2WRTA 4AJ7A 3WGDA 5G1LA 2H6ZA 1TP9A 2OJLA 4LL1B 2HQTA 2DLXA 2DKHA 3C1SA 2A4VA 1AQXA 5D8IA 2YOIA 1MD4A 2AB6A 1EP8A 4WR4A 3IR4A 4O5RA 5J9BA 3ERFA 3M9KA 4EUYA 1K3LA 2VKZG 3UEMA 5D9VA 4PXOA 3LFLA 2REMA 3QR6A 1JZRA 1A8LA 1ML6A 5F05A 3QDNA 1PD21 3APQA 4GCIA 4RQXA 5AIXA 5J40A 1NW2A 1YEXA 2H72A 3LXTA 2HSHA 2XPEA 4ZB9A 1ST9A 3DMLA 5E59A 3ZYWA 5ECMB 3TUEA 3C8EA 4L5LA 2VL3A 4WKWA 4N11A 6GSWA 3F4TA 2GZPA 2L5OA 4TR4A 3MYDA 1YF1A 2M80A 2IJYA 4GDFA 3CRUA 2E2GA 2OBKA 1TU8A 2V2GA 2O89A 2WCIA 2YJHA 4YKFA 1FO5A 2GDRA 1T4ZA 2FNOA 4X4JA 4MPFA 5ECSA 4BL7A 4ZBBA 2ON7A 1EOGA 4GSSA 2F3MA 1SKWB 2CAQA 2B6MA 2I3YA 2C8UA 4MF7A 1URMA 1B48A 1GSFA 4XIHA 4ULXA 5C00A 1N8JA 4POKA 2FHEA 3LORA 5DJMA 1PX7A 1TI3A 1OC8A 3UAPA 2YPMA 1GLQA 2GLRA 2QA2A 1Y25A 3HVXA 2H01A 2HLSA 4XHMA 3C71A 4OMVA 1OC9B 3VPQA 2H1BA 2QSIA 1V58A 4G0LA 4F82A 2IWTA 4JE1A 1BX9A 3LGCA 1ERVA 1JFUA 5DAKB 1RQMA 3WT2A 3KM6A 2FCHA 1F37A 4CY6A 2J9HA 1M7TA 5GAPD 5BRTA 5KOWA 1C72A 1XW6A 2C0DA 2AUVA 3GUSA 1KTEA 1YKCA 5A5HA 2NBSA 1TI1A 3L4NA 3C1RA 1FOVA 3DVXA 1GTBA 3DWVA 5A4UA 1SYXA 2H8LA 2IFQB 3BD2A 5H5RA 3KH7A 2C1YA 4BVXB 5CP1A 5KN0A 1FHEA 1XVWA 1PL2A 3DVWA 1FG4A 1HYUA 2LQQA 2XHFA 2MYGA 2IMDA 4YH2A 5J4UA 5ECRB 2CA8A 1GWCA 4KW6A 9GSSA 3H93A 3GL3A 5KEJA 3CBUA 3BCIA 4MF5A 2VM1A 5D9TA 3F3QA 5BMUB 1R5AA 5A1NB 3VWVA 1ZCPA 4IP6A 5B6NA 1UVZA 2G0FA 3MNGA 2K8VA 4Q5NA 5KN3A 5LD0A 3GRXA 2PUKC 2WFCA 3UMAA 1J0FA 1R26A 2K18A 1FVJA 2VAFA 2OE3A 3G7IA 4OWYA 5AN1A 5J5NA 2KLXA 2X4AA 3ERWA 3TJFA 4MZCA 3HJPA 3IHQA 1EZKA 2LS5A 1XBSA 3D21A 4AKXB 2VM2A 4K5RA 1EEMA 1TK5B 1ZOFA 2X8CA 3GKNA 3A2WA 1WIKA 2R37A 2RM5A 1O8XA 4L0WA 2YZHA 3GX8A 3CMIA 1KBNA 5FHIA 4I97A 2WJUA 1WJKA 3MIXA 2VOCA 1WOUA 2C3NA 2OT3A 2F51A 3QMXA 1BG5A 3D4TA 2C0FA 4NXIA 2GQLA 3CRTA 3TKSE 3L9UA 2PU9C 4Z7XA 4MF6A 3ZRDA 2P31A 3KTLA 4KCAA 3FR9A 2O8VB 3HDCA 5CAXA 2CAIA 4GQCA 1GP1A 3KMOA 1DUGA 1U87A 5IQYA 5ECQB 2VCZA 4PNFA 2C0GA 4WBJA 2JADA 4EE0A 5KOXA 4HQSA 4QMKA 1S3DA 3QAVA 4K2DA 2A4HA 4POMA 2R2JA 4KSOA 3P7XA 3UARA 4L5OA 1SD8A 4XS4B 5D93A 1QQ2A 2QKEA 4IGJA 5A4VA 1ZYNA 4RQRA 2VL2A 3H4KA 13GSA 4YQUA 3FRCA 2LRTA 5CYYA 3L9SA 3F63A 2WGRA 1ZGNA 2DMLA 2FD3A 4FO5A 1EEJA 1UA5A 5A5HB 4I2UA 4FYCA 6GSUA 3TKSC 1A8YA 1FW1A 4EL1A 4EDYA 1TRSA 1N25A 1J9BA 4POLA 1A24A 1XFLA 4WXTA 1YKAA 2PPTA 4TXVA 5H5SA 3TJKA 2X64A 2PWJA 4O32A 1YJ6A 3GA4A 1I5GA 5J4VA 1AIUA 5HR3A 3H8QA 4F2IA 1TW9A 1O81A 3WYWA 2R0GA 4ZL9A 1O85A 1AAZA 4BVYA 2V6KA 4ICYA 1JZWA 2H6XA 5ECIB 1FOHA 4K6XA 5HQPA 2HYXA 1K3YA 1SD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAL B;  4RI7 A;  1GRX A;  2FWG A;  5ECN B;  3VWU A;  2GST A;  3RPP A;  4HUA A;  3D5J A;  3EC3 A;  1HNA A;  1QMV A;  2QC7 A;  4LA1 A;  1M2D A;  5A5K A;  3I69 A;  3APO A;  5H5Q A;  4CDO A;  2HI7 A;  1K0O A;  3WGX A;  4HU9 A;  2LQO A;  5G30 A;  3GV1 A;  3TKQ A;  3ISO A;  1M9A A;  4EC0 A;  2H76 A;  2IME A;  3EMX A;  1ABA A;  2B1L A;  2E0Q A;  4TR1 A;  2VL9 A;  5GZZ B;  1XXU A;  4NV2 A;  4HU7 A;  3KP9 A;  2GZY A;  1VF2 A;  3GKK A;  4J56 E;  2G2Q A;  5DQS A;  1OC3 A;  4TW5 A;  3EU4 A;  4IJ3 A;  4ZBA A;  1X5E A;  2ZUP A;  2GT5 A;  4BPY A;  2MMA A;  4OD7 A;  1G7E A;  3K8N A;  4NWY A;  2ZCT A;  2DC5 A;  3ZLP A;  1GSU A;  4MH2 A;  4G9H A;  4XRA A;  1LJR A;  4KDX A;  4MH3 A;  3WD6 A;  3EIN A;  1TJD A;  2I9H A;  4G0K A;  4OCF A;  2H0G A;  4NHZ A;  4DSS B;  1K3O A;  3ZIT A;  4H86 A;  3SBC A;  4ECJ A;  4ISD A;  4ML1 A;  2R3X A;  2YP6 A;  3US3 A;  1XWG A;  4Q5Q A;  1H4O A;  4TR0 A;  2L5L A;  1OE7 A;  4K9Z A;  2BMX A;  3KCM A;  1S3A A;  4XTS A;  3QPM A;  3Q74 A;  2PVO C;  2B7K A;  3TKS A;  2HE3 A;  2LRC A;  4AF2 A;  5FWG A;  4AJ6 A;  4TXO A;  2LEG A;  2IMI A;  2L6C A;  1GNE A;  1SL0 B;  3RDW A;  1NSW A;  3ZRE A;  3NOF A;  2DBC A;  2MMZ A;  1MTC A;  5F8B A;  2WDU A;  3ZL5 A;  2VLU A;  5G31 A;  5D73 A;  1B8X A;  3S9F A;  3MDK A;  4I8B A;  1TU7 A;  3FR3 A;  3LSZ A;  5CRD A;  1EP7 A;  2O87 A;  1G6W A;  6GSS A;  4PNG A;  5KN1 A;  2LKU A;  1JLW A;  1WE0 A;  1EGR A;  12GS A;  4F03 A;  2DMM A;  4Q5F A;  2H73 A;  1AUC A;  2YAN A;  5HR2 A;  2F8A A;  2GSR A;  3CSH A;  1XCC A;  2ZNM A;  4V2L A;  1K0C A;  2A2R A;  1QGV A;  3VI5 A;  3UL3 A;  1PX6 A;  4BA7 A;  1FB0 A;  3HVS A;  3G7Y A;  2I1U A;  4J2F A;  4OFT A;  1EOH A;  4WET A;  1MDJ A;  2GGT A;  2WB9 A;  1O7U A;  3NZN A;  4KAE A;  4DSQ A;  1O6J A;  3GMF A;  3KMN A;  4KGI A;  4NHW A;  3BOA A;  1SL2 B;  2YJ7 A;  3TJJ A;  1USB A;  5F0G A;  1G6Y A;  4EO3 A;  2O7K A;  4MCU A;  2KUC A;  2FLS A;  1K0A A;  3BCK A;  5IO2 A;  4PQH A;  3FKF A;  1UN2 A;  3HZ4 A;  4JED A;  3HVV A;  4NPB A;  1T7P B;  3GNJ A;  3D6I A;  3E9J B;  5JWQ B;  2V6O A;  4K7I A;  5G2Z A;  2B1K A;  10GS A;  4XS1 A;  2JAC A;  2VLT A;  3P2A A;  4AGS A;  2XBI A;  2L59 A;  1TDI A;  3KTB A;  1SL1 B;  2XC2 A;  2HSM A;  5COH A;  2R4V A;  1XWA A;  1F9M A;  2QGV A;  2H66 A;  1M2B A;  2IN3 A;  3IPZ A;  2MBS A;  3MAK A;  4DVC A;  2AJQ B;  2HNL A;  3VK9 A;  2C4J A;  4QQ7 A;  3DGQ A;  3DRN A;  1A0F A;  2X99 A;  2FWE A;  1WMJ A;  1WRY A;  1NHY A;  1A2J A;  3FR6 A;  4KX4 A;  1PL1 A;  5JCG A;  3ZIV A;  2VL2 C;  3PPU A;  2WS2 A;  2HRA A;  4FYB A;  2IIY A;  1PA3 A;  2DIY A;  4FH8 A;  2LV3 A;  1JZD A;  4WF5 A;  1AXD A;  4TRX A;  2H1A A;  4LMW A;  1XOB A;  3IAS 2;  3U5R E;  3HJO A;  4GQF A;  4V1A g;  6GSY A;  4MPG A;  1TTZ A;  3TGZ A;  4P3Y B;  3UBL A;  2PVQ A;  2H75 A;  3LG6 A;  2C3Q A;  3IA1 A;  5ID2 B;  6GSX A;  4GTU A;  5JWR B;  2DJ2 A;  4NAX A;  2YV7 A;  3R3E A;  3HHV A;  4MDC A;  1THO A;  2CX3 A;  4GWR A;  4TXO B;  5F06 A;  4GSN A;  1SJ6 A;  4KUN A;  4G10 A;  3LYP A;  2CVK A;  1SKR B;  4Q5R A;  2Z9S A;  1M2A A;  1PKW A;  1Z5Y E;  4RI6 A;  2B5Y A;  1K0M A;  5GSS A;  1B4P A;  2N5A A;  1GTU A;  5ELG A;  5JCU A;  1O73 A;  1GUM A;  3DD3 A;  2GSQ A;  5DQY A;  5J3R A;  2VO4 A;  4I5Q A;  1A0R P;  1T3B A;  3RHC A;  2VCT A;  3GTU A;  4WEY A;  2B3S A;  1Z7R A;  2HXK A;  1PMT A;  3PGT A;  2H1G A;  3E0U A;  1DSB A;  1F3B A;  4GLT A;  2OA7 A;  1AW9 A;  4L0U A;  2LTK A;  4PQ1 A;  3GKM A;  4QL7 A;  3TJG A;  2FA4 A;  1MDK A;  1QUW A;  3HJM A;  5INY A;  1F2E A;  2VLV A;  20GS A;  3M1G A;  4PTS A;  5A4W A;  1ERT A;  2B5E A;  3IRA A;  4HJM A;  5IMV A;  4BL7 B;  2CVB A;  1YF0 A;  3IOS A;  2CVD A;  4WF4 A;  4D73 A;  3CYN A;  4PX1 A;  3R2Q A;  2RM6 A;  4ECB A;  2JZS A;  4LL4 B;  3UVH A;  2BJX A;  3HD5 A;  1XW9 A;  1FVK A;  4HEA 2;  1OKD A;  4EKZ A;  2L4C A;  3KZQ A;  4IN0 A;  2R6K A;  3N5O A;  4L8E A;  4OO4 A;  3CXG A;  1W89 A;  3TRQ A;  1U6T A;  5DDL A;  3CTG A;  4F0C A;  5LNK e;  1GUH A;  1TRU A;  4F0B A;  1ILO A;  3QAW A;  3FK8 A;  1OYJ A;  2H6Y A;  1JHB A;  1LU4 A;  4ILF A;  5ABR A;  1K0D A;  3ME8 A;  2YWI A;  3TJB A;  1K0N A;  4DSR A;  3BJ5 A;  5EY6 A;  5DBQ A;  3IK9 A;  2YZU A;  3Q18 A;  3MWH A;  3O3T A;  1OAZ A;  3W8J A;  5HFK A;  1DBY A;  4JBB A;  1XW5 A;  2HSM B;  4O7H A;  5C04 A;  3UVT A;  3VPT A;  4GRF A;  2FGX A;  4DEJ A;  3FZ4 A;  1HNC A;  2LNS A;  3A2X A;  3MSZ A;  3GN3 A;  1PN9 A;  2CZ3 A;  1QK8 A;  3L0H A;  4HZ2 A;  3HXS A;  3EWL A;  2UZ8 A;  4KCE A;  4IW9 A;  1GSS A;  4KDY A;  1Q98 A;  3ZTL A;  2XPD A;  5DCG A;  1M9B A;  6GSV A;  2DIZ A;  1TRW A;  2OAC A;  3A3T A;  2HFD A;  1GSQ A;  3H1N A;  3O6T A;  3APS A;  5IMA A;  2AHE A;  1VGL A;  4IP1 A;  2GQM A;  1WP0 A;  3DKS A;  4IS0 A;  1Z6M A;  1SEN A;  16GS A;  4RUV A;  1MD3 A;  2L57 A;  2J23 A;  2B7J A;  1LBK A;  3CSI A;  3QFA C;  3KEB A;  1VF3 A;  3EE2 A;  3OR5 A;  2HZE A;  3P8W A;  5AIV A;  1T8E B;  1GUL A;  2OE1 A;  2H1D A;  3EU3 A;  3M9J A;  1FAA A;  2EIQ A;  2V41 A;  1PQN A;  5E4W A;  2JSY A;  3D4M A;  22GS A;  3IC8 A;  3TRX A;  1XWK A;  5JCW A;  1PGT A;  1H75 A;  4LMV A;  4PQI A;  1Z6N A;  4ACS A;  4YAP A;  2HZF A;  1SK1 A;  2MMN A;  3QCP A;  1T1V A;  3CTF A;  4I2T A;  2ES7 A;  1UC7 A;  3LXZ A;  2X8G A;  4TR3 A;  3TB2 A;  1E6B A;  5GAN D;  3VI7 A;  1HNB A;  2D2Z A;  3TCO A;  4EXJ A;  3PR8 A;  1MEK A;  2RII A;  4MZB A;  1SU9 A;  2E7P A;  1SJZ A;  1N2A A;  4MK3 A;  1R4W A;  1GSY A;  2PGT A;  3FYG A;  4HOJ A;  4NV5 A;  2C80 A;  1OKT A;  5ECO B;  1NHO A;  2VCQ A;  2CQ9 A;  4G0I A;  4ML6 A;  5CRH A;  5EL8 A;  4G2E A;  1RK4 A;  4WBR D;  2M72 A;  2RUF A;  1XWB A;  8GSS A;  4OFN A;  1E2Y A;  3F8U A;  1DE1 A;  2IFQ A;  4MJA A;  4IVF A;  2TIR A;  5B7C A;  11GS A;  2K9F A;  1V57 A;  2RUE A;  4KA0 A;  3KJY A;  3TRP A;  5IOW A;  3RHB A;  3ZML A;  4AJ8 A;  3LYK A;  2GVP A;  1Z3E A;  3J7Y k;  1U3A A;  2PN8 A;  1TK8 B;  4ZL8 A;  3L78 A;  1VF4 A;  2ON5 A;  2DJ3 A;  3LEF A;  3F0I A;  3J7Y b;  1B9X C;  4PGT A;  1YEP A;  1G7O A;  3FZ9 A;  1ACV A;  1MDI A;  1ERU A;  1BAY A;  3ZVJ A;  1F3A A;  3KP8 A;  4N0V A;  3EMP A;  4WR5 A;  3V1W A;  2FA8 A;  1T00 A;  3G9B A;  2JSZ A;  4MP4 A;  2JZR A;  5FT3 A;  3TKP A;  5KN2 A;  2CX4 A;  1Z7P A;  4K7N A;  3FW2 A;  4GST A;  4K0G A;  5CRG A;  5DVB A;  1TK0 B;  4BVY B;  4I6X A;  17GS A;  1TOF A;  5G5F A;  4MA9 A;  3O76 A;  4ZXG A;  3IDV A;  5AGY A;  1ON4 A;  1AQV A;  3DXB A;  4IQ1 A;  1GTA A;  2LNT A;  1GNW A;  2CT6 A;  5EVO A;  5IMD A;  1AC1 A;  3GH6 A;  3W6G A;  2KOK A;  1TXX A;  3L9V A;  1ZYQ B;  2VCW A;  3F3R A;  2GT6 A;  2MZC A;  2LJR A;  5IIZ A;  3VWW A;  5D9X A;  14GS A;  2L6D A;  2HZE B;  4HDE A;  2HRN A;  3CSJ A;  3RBT A;  4HQZ A;  3GH9 A;  3KD0 A;  2MMO A;  1QXH A;  2FY6 A;  4KB3 A;  1FB6 A;  2EC4 A;  3IXR A;  4JZQ A;  3RPN A;  4YQM A;  3DYR A;  4K1F A;  2V1M A;  2IPA A;  2XBQ A;  1BQ7 A;  1CQH A;  2RLI A;  1SK0 A;  2C3T A;  5ECK B;  2GQK A;  4TR1 B;  3GIX A;  1TRV A;  4ZIL A;  1W4V A;  5D9W A;  1NM3 A;  2LUS A;  2K8S A;  4EDZ A;  4G19 A;  1X5D A;  4KND A;  1AQW A;  4X0X A;  2LJA A;  3PIN A;  2K6V A;  3FZA A;  5IOX A;  1K0B A;  2AV4 A;  3UJ1 A;  1R7H A;  19GS A;  5HR0 A;  4FIW A;  1IYI A;  4XS4 A;  5GST A;  1QFN A;  3M3M A;  2EIO A;  3NIV A;  1WPI A;  1X5C A;  5ECL B;  4CHS A;  3I43 A;  4FYU A;  3H79 A;  3HA9 A;  2YWO A;  4K8M A;  1X9S B;  1JLV A;  4XRD A;  3C73 A;  1ZZY A;  2CV4 A;  1WWJ A;  2FWH A;  2V32 A;  2MBT A;  4ZBD A;  4EVM A;  3LWA A;  5HFG A;  3M8N A;  3ME7 A;  1SYR A;  5IPH A;  3F4S A;  4ZB8 A;  1VF1 A;  2P5Q A;  2KP2 A;  3VWX A;  1GSD A;  2GTU A;  5ENU A;  4JU5 A;  1T4Y A;  1X0R A;  4K0N A;  3F4R A;  4V1A p;  1PRX A;  1XPV A;  4BWQ A;  1U88 A;  4POB A;  1EGO A;  4O92 A;  4QL9 A;  2KP1 A;  1BYE A;  5JWO B;  2IMK A;  1XIY A;  4OO5 A;  3HY2 A;  1Q4J A;  1ERW A;  1BED A;  3TOT A;  3A5W A;  4E8E A;  2OE0 A;  5CO3 A;  3ED3 A;  5B8A A;  2YWM A;  4N10 A;  1YY7 A;  3N9J A;  2DJ1 A;  5DAL A;  3C7M A;  3U6V A;  2EIR A;  4MJC A;  4HZ4 A;  1SK2 A;  3KXO A;  2H71 A;  4K7O A;  3M0F A;  3GHA A;  5IO0 A;  2JU5 A;  1IYH A;  2DJJ A;  3VUR A;  5J41 A;  4LLR A;  1GTI A;  3Q19 A;  1V98 A;  1KNG A;  5EPF A;  2H0H A;  4ID0 A;  18GS A;  3AY8 A;  2PER A;  5DCH A;  2E2M A;  3DIE A;  3EUR A;  2HSN B;  3IC4 A;  4YQV A;  2KHP A;  2H19 A;  4N30 A;  5LCZ A;  2NDO A;  2NVL A;  3P90 A;  2HRK A;  2A2S A;  1I9D A;  3QD9 A;  4GXZ A;  3SWL A;  4MMM A;  5IMZ A;  4ECC A;  3ZIJ A;  1X9W B;  5CNW A;  5G1K A;  4OCE A;  5D96 A;  2GSS A;  3F9U A;  3IAM 2;  5HFI A;  4MAB A;  2B5X A;  3FEU A;  2P0G A;  2TRX A;  2VCV A;  3QOU A;  2AAW A;  4ZL7 A;  2R5G A;  4PUR A;  2GZZ A;  1XVQ A;  4IQA A;  4NMU A;  4ZB6 A;  1OE8 A;  2ALB A;  3EYT A;  3KGK A;  1GL8 A;  2TRC P;  3DEX A;  4DSS A;  4GF0 A;  1EV9 A;  3ZZX A;  1Z9H A;  4KE3 A;  4KSM A;  4IEL A;  3IK7 A;  4HS1 A;  2VCX A;  3GUR A;  2NTO A;  5IM9 A;  5HR1 A;  1EV4 A;  1EWX A;  3GX0 A;  1VRS D;  2GS3 A;  2H0I A;  1THX A;  1XZO A;  2YN1 A;  1SJI A;  3BBY A;  2OBI A;  4TKY A;  2HT9 A;  1ZYE A;  6GST A;  1J08 A;  1M99 A;  1KEB A;  2X8H A;  3FHK A;  3WT1 A;  2NPB A;  4YAV A;  2HSY A;  4J57 E;  2IMF A;  2YCD A;  4CW9 A;  3HKR A;  3W8S A;  4ECI A;  4IJI A;  1GSE A;  3HYP A;  4TVE A;  1PKZ A;  2WZ9 A;  2OKA A;  2I4A A;  3A2V A;  4V2M A;  3IV4 A;  3ZFB A;  1R5P A;  3GKX A;  3I9V 2;  5B6M A;  5B8B A;  1HQO A;  4JR4 A;  2YNX A;  4USS A;  2DJ0 A;  5IMF A;  1PSQ A;  1GUK A;  2I81 A;  3E3E A;  3G7J A;  2N5B A;  3I6A A;  3RAZ A;  5F07 A;  3FY7 A;  5AIS A;  3GYK A;  3TOU A;  1V9W A;  3KH9 A;  1BJX A;  3JCM L;  2BTO T;  5L71 A;  2JZT A;  1XWC A;  2OAD A;  4KF9 A;  1XOA A;  1U3I A;  2L4Q A;  3TDG A;  1B4Q A;  2H30 A;  5IMC A;  1JZO A;  2HRF A;  2YV9 A;  3UOM A;  2DJK A;  3UIW A;  4IBP A;  1Y6E A;  5IPG A;  1YQ1 A;  4HI7 A;  2LST A;  3HZ8 A;  7GSS A;  4FQU A;  2FUG 2;  3F6D A;  5J9C A;  1YDK A;  1A2L A;  4BWS A;  3VLN A;  3GTU B;  3IE3 A;  2VD0 A;  3VFI A;  4XCS A;  4PUF C;  2H70 A;  4E8H A;  5DJL A;  1RW1 A;  3QAG A;  2YWN A;  2F8F A;  4MZW A;  4JR6 A;  3ZFL A;  1X9M B;  4X1U A;  4KDU A;  4TN8 A;  2CZ2 A;  2HRK B;  1OC9 A;  1CQG A;  4MLY A;  1TKD B;  1OVN A;  3KIJ A;  2PMT A;  5ECH B;  2VUP A;  4N0Z A;  1A2M A;  1DE2 A;  1S3C A;  3Q6O A;  1V2A A;  4MJB A;  2H74 A;  2N5F A;  5DAK A;  1ZMA A;  1V40 A;  2WUL A;  4D73 B;  4OFM A;  3GSS A;  2VD1 A;  3EVI A;  3F6F A;  4IKH A;  1GLP A;  3HCZ A;  1O8W A;  1F6M C;  3LJR A;  3D0Z A;  1G0T A;  4X43 A;  3WGE A;  4IHU A;  4JRR A;  3TKR A;  3FZ5 A;  3PH9 A;  1B9Y C;  1A23 A;  4HJ2 A;  3GST A;  4BVX A;  1M0U A;  2M46 A;  3UBK A;  2LJK A;  2PBJ A;  3D22 A;  4ZIJ A;  2F9S A;  1HD2 A;  3QFB C;  4KH7 A;  5CRW A;  1YZX A;  5ELA A;  2LRN A;  3IBH A;  2JL4 A;  4PUA A;  4TOP A;  4XS6 A;  4V2N A;  5ECP B;  2P5R A;  4MJE A;  2C0E A;  2DSA A;  4F9Z A;  3GL5 A;  5CRE A;  3ZMK A;  3LQ7 A;  1SKS B;  1ZL9 A;  3ZVJ D;  4EF0 A;  5G5E A;  1GH2 A;  2IL3 A;  5BMU A;  2O85 A;  5ID2 A;  3GFK A;  2AYT A;  2VIM A;  3ERG A;  2FWF A;  2WRT A;  4AJ7 A;  3WGD A;  5G1L A;  2H6Z A;  1TP9 A;  2OJL A;  4LL1 B;  2HQT A;  2DLX A;  3C1S A;  2A4V A;  1AQX A;  5D8I A;  2YOI A;  1MD4 A;  2AB6 A;  1EP8 A;  4WR4 A;  3IR4 A;  4O5R A;  5J9B A;  3ERF A;  3M9K A;  4EUY A;  1K3L A;  3UEM A;  5D9V A;  4PXO A;  3LFL A;  2REM A;  3QR6 A;  1JZR A;  1A8L A;  1ML6 A;  5F05 A;  3QDN A;  1PD2 1;  3APQ A;  4GCI A;  4RQX A;  5AIX A;  1NW2 A;  1YEX A;  2H72 A;  3LXT A;  2HSH A;  2XPE A;  4ZB9 A;  1ST9 A;  3DML A;  5E59 A;  3ZYW A;  5ECM B;  3TUE A;  3C8E A;  4L5L A;  2VL3 A;  4WKW A;  4N11 A;  6GSW A;  3F4T A;  2GZP A;  2L5O A;  4TR4 A;  1YF1 A;  2M80 A;  2IJY A;  3CRU A;  2E2G A;  2OBK A;  1TU8 A;  2V2G A;  2O89 A;  2WCI A;  2YJH A;  1FO5 A;  2GDR A;  1T4Z A;  2FNO A;  4MPF A;  5ECS A;  4BL7 A;  4ZBB A;  2ON7 A;  1EOG A;  4GSS A;  2F3M A;  1SKW B;  2CAQ A;  2B6M A;  2I3Y A;  2C8U A;  4MF7 A;  1URM A;  1B48 A;  1GSF A;  4XIH A;  4ULX A;  5C00 A;  1N8J A;  4POK A;  2FHE A;  3LOR A;  5DJM A;  1PX7 A;  1TI3 A;  1OC8 A;  3UAP A;  2YPM A;  1GLQ A;  2GLR A;  1Y25 A;  3HVX A;  2H01 A;  2HLS A;  4XHM A;  3C71 A;  4OMV A;  1OC9 B;  3VPQ A;  2H1B A;  2QSI A;  1V58 A;  4G0L A;  4F82 A;  2IWT A;  4JE1 A;  1BX9 A;  3LGC A;  1ERV A;  1JFU A;  5DAK B;  1RQM A;  3WT2 A;  3KM6 A;  2FCH A;  1F37 A;  2J9H A;  1M7T A;  5GAP D;  1C72 A;  1XW6 A;  2C0D A;  2AUV A;  3GUS A;  1KTE A;  1YKC A;  2NBS A;  1TI1 A;  3L4N A;  3C1R A;  1FOV A;  3DVX A;  1GTB A;  3DWV A;  5A4U A;  1SYX A;  2H8L A;  2IFQ B;  3BD2 A;  5H5R A;  3KH7 A;  2C1Y A;  4BVX B;  5CP1 A;  5KN0 A;  1FHE A;  1XVW A;  1PL2 A;  3DVW A;  1FG4 A;  1HYU A;  2LQQ A;  2XHF A;  2MYG A;  2IMD A;  4YH2 A;  5J4U A;  5ECR B;  2CA8 A;  1GWC A;  4KW6 A;  9GSS A;  3H93 A;  3GL3 A;  5KEJ A;  3CBU A;  3BCI A;  4MF5 A;  2VM1 A;  5D9T A;  3F3Q A;  1R5A A;  3VWV A;  1ZCP A;  4IP6 A;  5B6N A;  1UVZ A;  2G0F A;  3MNG A;  2K8V A;  4Q5N A;  5KN3 A;  5LD0 A;  3GRX A;  2PUK C;  2WFC A;  3UMA A;  1J0F A;  1R26 A;  2K18 A;  1FVJ A;  2VAF A;  2OE3 A;  3G7I A;  4OWY A;  5AN1 A;  5J5N A;  2KLX A;  3ERW A;  3TJF A;  4MZC A;  3HJP A;  3IHQ A;  1EZK A;  2LS5 A;  1XBS A;  3D21 A;  2VM2 A;  1EEM A;  1TK5 B;  1ZOF A;  2X8C A;  3GKN A;  3A2W A;  1WIK A;  2R37 A;  2RM5 A;  1O8X A;  4L0W A;  2YZH A;  3GX8 A;  3CMI A;  1KBN A;  5FHI A;  4I97 A;  2WJU A;  1WJK A;  2VOC A;  1WOU A;  2C3N A;  2F51 A;  3QMX A;  1BG5 A;  3D4T A;  2C0F A;  4NXI A;  2GQL A;  3CRT A;  3TKS E;  3L9U A;  2PU9 C;  4Z7X A;  4MF6 A;  3ZRD A;  2P31 A;  3KTL A;  4KCA A;  3FR9 A;  2O8V B;  3HDC A;  5CAX A;  2CAI A;  4GQC A;  1GP1 A;  3KMO A;  1DUG A;  1U87 A;  5IQY A;  5ECQ B;  2VCZ A;  4PNF A;  2C0G A;  4WBJ A;  2JAD A;  4EE0 A;  4HQS A;  1S3D A;  3QAV A;  4K2D A;  4POM A;  2R2J A;  4KSO A;  3P7X A;  3UAR A;  4L5O A;  1SD8 A;  4XS4 B;  5D93 A;  1QQ2 A;  2QKE A;  4IGJ A;  5A4V A;  4RQR A;  2VL2 A;  3H4K A;  13GS A;  4YQU A;  3FRC A;  2LRT A;  5CYY A;  3L9S A;  3F63 A;  2WGR A;  1ZGN A;  2DML A;  2FD3 A;  4FO5 A;  1EEJ A;  1UA5 A;  4I2U A;  4FYC A;  6GSU A;  3TKS C;  1A8Y A;  1FW1 A;  4EL1 A;  4EDY A;  1TRS A;  1J9B A;  4POL A;  1A24 A;  1XFL A;  4WXT A;  1YKA A;  2PPT A;  4TXV A;  5H5S A;  3TJK A;  2X64 A;  2PWJ A;  4O32 A;  1YJ6 A;  3GA4 A;  1I5G A;  1AIU A;  5HR3 A;  3H8Q A;  4F2I A;  1TW9 A;  1O81 A;  3WYW A;  4ZL9 A;  1O85 A;  1AAZ A;  4BVY A;  2V6K A;  1JZW A;  2H6X A;  5ECI B;  4K6X A;  5HQP A;  2HYX A;  1K3Y A;  1SD9 A; 
#chains in the Genus database with same CATH topology
 4K5S A;  5DAL B;  4RI7 A;  1GRX A;  2FWG A;  5ECN B;  3VWU A;  2GST A;  3RPP A;  4HUA A;  3D5J A;  3EC3 A;  1HNA A;  1QMV A;  2QC7 A;  4LA1 A;  1M2D A;  5A5K A;  3I69 A;  3APO A;  5H5Q A;  4CDO A;  2HI7 A;  1K0O A;  3WGX A;  4HU9 A;  2LQO A;  5G30 A;  2EFD A;  3GV1 A;  3TKQ A;  3ISO A;  1M9A A;  4EC0 A;  2H76 A;  2IME A;  5A34 A;  3EMX A;  1ABA A;  2B1L A;  2E0Q A;  4TR1 A;  2VL9 A;  5GZZ B;  1XXU A;  4NV2 A;  4HU7 A;  4PI0 C;  3KP9 A;  2GZY A;  1VF2 A;  3GKK A;  4J56 E;  2G2Q A;  5DQS A;  1OC3 A;  4TW5 A;  3EU4 A;  4IJ3 A;  4ZBA A;  2EFE A;  1X5E A;  2ZUP A;  2GT5 A;  4BPY A;  2MMA A;  4OD7 A;  1G7E A;  3K8N A;  4NWY A;  2ZCT A;  2DC5 A;  3ZLP A;  1GSU A;  4MH2 A;  4G9H A;  4XRA A;  1LJR A;  4KDX A;  4MH3 A;  3WD6 A;  3EIN A;  1TJD A;  2I9H A;  4G0K A;  4OCF A;  2H0G A;  4NHZ A;  4DSS B;  1K3O A;  3ZIT A;  4H86 A;  3SBC A;  4ECJ A;  4ISD A;  4ML1 A;  2R3X A;  2YP6 A;  3US3 A;  1XWG A;  4Q5Q A;  1H4O A;  4TR0 A;  2L5L A;  1OE7 A;  4K9Z A;  2BMX A;  3KCM A;  1S3A A;  4XTS A;  3QPM A;  3Q74 A;  2PVO C;  2B7K A;  3TKS A;  1YVL A;  2HE3 A;  2LRC A;  4AF2 A;  5FWG A;  4AJ6 A;  4TXO A;  2LEG A;  2IMI A;  2L6C A;  1GNE A;  1SL0 B;  3RDW A;  1NSW A;  3ZRE A;  3NOF A;  2DBC A;  2MMZ A;  1MTC A;  5F8B A;  2WDU A;  3ZL5 A;  2VLU A;  5G31 A;  5D73 A;  1B8X A;  3S9F A;  3MDK A;  4I8B A;  1TU7 A;  3FR3 A;  3LSZ A;  5CRD A;  1EP7 A;  2O87 A;  1G6W A;  6GSS A;  4PNG A;  5KN1 A;  2LKU A;  1JLW A;  1WE0 A;  1EGR A;  12GS A;  4F03 A;  2DMM A;  4O5U A;  4Q5F A;  2H73 A;  1AUC A;  2YAN A;  5HR2 A;  4N3Z A;  2F8A A;  2GSR A;  3CSH A;  1XCC A;  2ZNM A;  4BIK A;  4V2L A;  1K0C A;  2A2R A;  1QGV A;  3VI5 A;  3UL3 A;  1PX6 A;  4BA7 A;  1FB0 A;  3HVS A;  3G7Y A;  2I1U A;  4J2F A;  4OFT A;  1EOH A;  4WET A;  1MDJ A;  2GGT A;  2WB9 A;  1O7U A;  3NZN A;  4KAE A;  4DSQ A;  1O6J A;  3GMF A;  3KMN A;  4KGI A;  4NHW A;  3BOA A;  2O36 A;  1SL2 B;  2YJ7 A;  3TJJ A;  1USB A;  5F0G A;  1G6Y A;  4EO3 A;  2O7K A;  4MCU A;  2EFC A;  2KUC A;  2FLS A;  1K0A A;  3BCK A;  5IO2 A;  4PQH A;  3FKF A;  1UN2 A;  3HZ4 A;  4JED A;  3HVV A;  4PHZ C;  4NPB A;  1T7P B;  3GNJ A;  4K2X A;  3D6I A;  3E9J B;  5JWQ B;  2V6O A;  1S3R A;  4K7I A;  5G2Z A;  2B1K A;  2WZS A;  10GS A;  4XS1 A;  2JAC A;  2VLT A;  3P2A A;  4AGS A;  2XBI A;  2L59 A;  1TDI A;  3KTB A;  1SL1 B;  2XC2 A;  2HSM A;  5COH A;  2R4V A;  1XWA A;  1F9M A;  2QGV A;  2H66 A;  1M2B A;  2IN3 A;  3IPZ A;  2MBS A;  3MAK A;  4DVC A;  2AJQ B;  2HNL A;  3VK9 A;  2C4J A;  4QQ7 A;  3DGQ A;  3DRN A;  1A0F A;  2X99 A;  2FWE A;  2X49 A;  1WMJ A;  1WRY A;  1NHY A;  3IHG A;  1A2J A;  3FR6 A;  4KX4 A;  1PL1 A;  5JCG A;  3ZIV A;  2VL2 C;  3PPU A;  2WS2 A;  2HRA A;  4FYB A;  2IIY A;  1PA3 A;  2DIY A;  4FH8 A;  2LV3 A;  1JZD A;  1SVL A;  1AXD A;  4TRX A;  4WF5 A;  2H1A A;  4LMW A;  1XOB A;  3IAS 2;  4O5Q A;  3U5R E;  3HJO A;  4GQF A;  4V1A g;  6GSY A;  4MPG A;  1TTZ A;  3TGZ A;  4P3Y B;  4A5P A;  4E68 A;  3UBL A;  2PVQ A;  2H75 A;  3LG6 A;  2C3Q A;  3IA1 A;  5ID2 B;  6GSX A;  4GTU A;  1TXU A;  2DJ2 A;  4NAX A;  2YV7 A;  3R3E A;  5JWR B;  3HHV A;  4MDC A;  1THO A;  2CX3 A;  4GWR A;  4TXO B;  5F06 A;  4GSN A;  1SJ6 A;  4KUN A;  4G10 A;  3LYP A;  2CVK A;  1SKR B;  4Q5R A;  3HMJ G;  2Z9S A;  1M2A A;  1PKW A;  1Z5Y E;  4RI6 A;  3RGB C;  1M3I A;  2B5Y A;  3A5I A;  1K0M A;  5GSS A;  1B4P A;  2N5A A;  1GTU A;  5ELG A;  5JCU A;  1O73 A;  1GUM A;  2WW3 A;  3DD3 A;  2GSQ A;  5DQY A;  5J3R A;  2VO4 A;  3EPT A;  1A0R P;  1T3B A;  4I5Q A;  2VCT A;  3RHC A;  3GTU A;  4WEY A;  2B3S A;  1Z7R A;  2HXK A;  1PMT A;  3PGT A;  2H1G A;  3E0U A;  1DSB A;  1F3B A;  4GLT A;  2OA7 A;  1AW9 A;  4L0U A;  2LTK A;  4PQ1 A;  3GKM A;  4QL7 A;  1PN0 A;  3TJG A;  2FA4 A;  1MDK A;  1QUW A;  3HJM A;  5INY A;  5J4Y A;  1F2E A;  2VLV A;  20GS A;  3M1G A;  4PTS A;  5A4W A;  4FXY P;  1ERT A;  2B5E A;  3IRA A;  4HJM A;  5IMV A;  4BL7 B;  2CVB A;  1YF0 A;  3IOS A;  2CVD A;  4WF4 A;  4D73 A;  3CYN A;  4PI2 C;  4PX1 A;  3R2Q A;  2RM6 A;  4ECB A;  2JZS A;  4LL4 B;  3UVH A;  2BJX A;  3HD5 A;  1XW9 A;  1FVK A;  4HEA 2;  1OKD A;  4EKZ A;  2L4C A;  3KZQ A;  4IN0 A;  2R6K A;  3N5O A;  4L8E A;  4OO4 A;  3CXG A;  1W89 A;  3TRQ A;  1U6T A;  4CY8 A;  5DDL A;  3CTG A;  4F0C A;  5LNK e;  1GUH A;  1TRU A;  4F0B A;  1ILO A;  3QAW A;  3FK8 A;  1OYJ A;  2H6Y A;  1JHB A;  1LU4 A;  4ILF A;  5ABR A;  1K0D A;  3ME8 A;  2YWI A;  3TJB A;  1K0N A;  4DSR A;  3BJ5 A;  5EY6 A;  5DBQ A;  3IK9 A;  2YZU A;  3Q18 A;  3MWH A;  3O3T A;  1OAZ A;  3W8J A;  5HFK A;  1DBY A;  4JBB A;  1XW5 A;  2HSM B;  4O7H A;  5C04 A;  3UVT A;  3VPT A;  4GRF A;  4AKG A;  2FGX A;  4DEJ A;  3FZ4 A;  1HNC A;  4EIQ A;  2LNS A;  3A2X A;  3MSZ A;  4AKH A;  3GN3 A;  1PN9 A;  2CZ3 A;  1QK8 A;  3L0H A;  4HZ2 A;  3HXS A;  3EWL A;  2UZ8 A;  4KCE A;  4IW9 A;  1GSS A;  4KDY A;  1Q98 A;  3ZTL A;  2XPD A;  5DCG A;  1M9B A;  6GSV A;  2DIZ A;  4YKG A;  1TRW A;  2OAC A;  3A3T A;  2HFD A;  1GSQ A;  3H1N A;  3O6T A;  3APS A;  5IMA A;  2AHE A;  1VGL A;  4IP1 A;  2GQM A;  1WP0 A;  3DKS A;  4IS0 A;  1Z6M A;  1SEN A;  16GS A;  4RUV A;  1MD3 A;  2L57 A;  2J23 A;  2B7J A;  1LBK A;  3CSI A;  3QFA C;  3KEB A;  1VF3 A;  3EE2 A;  3OR5 A;  2HZE A;  3P8W A;  5AIV A;  1T8E B;  1GUL A;  2OE1 A;  2H1D A;  3EU3 A;  3M9J A;  1FAA A;  2EIQ A;  2V41 A;  1PQN A;  3CQF A;  5E4W A;  2JSY A;  3D4M A;  22GS A;  3IC8 A;  3TRX A;  1XWK A;  5JCW A;  1PGT A;  1H75 A;  4LMV A;  4PQI A;  1Z6N A;  4ACS A;  4YAP A;  2HZF A;  1SK1 A;  2MMN A;  3QCP A;  1SVM A;  1T1V A;  3CTF A;  4I2T A;  2WW0 A;  2ES7 A;  2DKI A;  1UC7 A;  3LXZ A;  2X8G A;  4TR3 A;  3TB2 A;  1E6B A;  5GAN D;  3VI7 A;  1HNB A;  2D2Z A;  1Y1U A;  3TCO A;  4EXJ A;  3PR8 A;  1MEK A;  2RII A;  4MZB A;  1SU9 A;  2E7P A;  4W66 A;  1SJZ A;  1N2A A;  4MK3 A;  1R4W A;  1GSY A;  2PGT A;  3FYG A;  4HOJ A;  4NV5 A;  2C80 A;  1OKT A;  5ECO B;  1NHO A;  2VCQ A;  2CQ9 A;  4G0I A;  4ML6 A;  5CRH A;  5EL8 A;  4G2E A;  1RK4 A;  4WBR D;  2WVY A;  3TU3 B;  2M72 A;  2RUF A;  1XWB A;  8GSS A;  4OFN A;  1E2Y A;  3F8U A;  2UV8 G;  1DE1 A;  2IFQ A;  4MJA A;  4IVF A;  2TIR A;  5B7C A;  11GS A;  2K9F A;  1V57 A;  2RUE A;  4KA0 A;  3KJY A;  3TRP A;  5IOW A;  3RHB A;  3ZML A;  4AJ8 A;  3LYK A;  2GVP A;  1Z3E A;  3J7Y k;  1U3A A;  2PN8 A;  1TK8 B;  4ZL8 A;  3L78 A;  1VF4 A;  2ON5 A;  1BG1 A;  2DJ3 A;  3LEF A;  3F0I A;  3J7Y b;  1B9X C;  4PGT A;  1YEP A;  1G7O A;  1PFO A;  3FZ9 A;  1ACV A;  1MDI A;  1ERU A;  1BAY A;  3ZVJ A;  1F3A A;  5A1N A;  3KP8 A;  4N0V A;  3EMP A;  4WR5 A;  3V1W A;  2FA8 A;  1T00 A;  3G9B A;  2JSZ A;  4MP4 A;  2JZR A;  5FT3 A;  3TKP A;  5KN2 A;  2CX4 A;  1Z7P A;  4K7N A;  3FW2 A;  4GST A;  4K0G A;  5CRG A;  5DVB A;  1TK0 B;  4BVY B;  4I6X A;  17GS A;  1TOF A;  2HSN A;  5G5F A;  4MA9 A;  3O76 A;  4ZXG A;  3IDV A;  5AGY A;  4Z2R A;  1ON4 A;  1AQV A;  3DXB A;  4IQ1 A;  3LW9 A;  1GTA A;  2LNT A;  1GNW A;  2CT6 A;  5EVO A;  5IMD A;  1AC1 A;  3GH6 A;  2A2P A;  3W6G A;  2KOK A;  1TXX A;  3L9V A;  1ZYQ B;  2VCW A;  3F3R A;  2GT6 A;  2MZC A;  2LJR A;  5IIZ A;  3VWW A;  5D9X A;  14GS A;  2L6D A;  2HZE B;  4HDE A;  2HRN A;  3CSJ A;  2O3E A;  3RBT A;  4HQZ A;  3GH9 A;  3KD0 A;  4MNN A;  2MMO A;  1QXH A;  2FY6 A;  4KB3 A;  1FB6 A;  2EC4 A;  3IXR A;  4JZQ A;  3RPN A;  4YQM A;  3DYR A;  4K1F A;  2V1M A;  2IPA A;  2XBQ A;  1BQ7 A;  5A34 B;  1CQH A;  2RLI A;  1SK0 A;  2C3T A;  5ECK B;  2GQK A;  4TR1 B;  3GIX A;  1I1I P;  1TRV A;  4ZIL A;  1W4V A;  5D9W A;  1NM3 A;  2LUS A;  2K8S A;  4EDZ A;  4G19 A;  1X5D A;  4KND A;  1AQW A;  4X0X A;  2LJA A;  3PIN A;  2K6V A;  3FZA A;  5IOX A;  1K0B A;  2AV4 A;  3UJ1 A;  1R7H A;  19GS A;  5HR0 A;  4FIW A;  1IYI A;  4XS4 A;  5GST A;  1QFN A;  3M3M A;  2EIO A;  3NIV A;  1WPI A;  1BF5 A;  1X5C A;  5ECL B;  4CHS A;  3I43 A;  4FYU A;  3H79 A;  3HA9 A;  2YWO A;  4K8M A;  1X9S B;  1JLV A;  4XRD A;  3C73 A;  1ZZY A;  2CV4 A;  1WWJ A;  2FWH A;  2V32 A;  2MBT A;  4ZBD A;  4EVM A;  3LWA A;  5HFG A;  3M8N A;  3ME7 A;  1SYR A;  5IPH A;  3F4S A;  4ZB8 A;  1VF1 A;  2P5Q A;  2KP2 A;  3VWX A;  1GSD A;  4G01 A;  2GTU A;  5ENU A;  4JU5 A;  1T4Y A;  1X0R A;  4K0N A;  3F4R A;  4V1A p;  1PRX A;  5J47 A;  1XPV A;  4BWQ A;  3CWG A;  1U88 A;  4POB A;  1EGO A;  4O92 A;  2R0P A;  4QL9 A;  2KP1 A;  1BYE A;  5JWO B;  2IMK A;  1XIY A;  4OO5 A;  3HY2 A;  1Q4J A;  1ERW A;  1BED A;  2O5V A;  3TOT A;  3A5W A;  4E8E A;  2OE0 A;  5CO3 A;  3ED3 A;  5B8A A;  2YWM A;  4N10 A;  1YY7 A;  3N9J A;  2DJ1 A;  5DAL A;  3C7M A;  3U6V A;  2EIR A;  4MJC A;  4HZ4 A;  1SK2 A;  3KXO A;  2H71 A;  4K7O A;  3M0F A;  3GHA A;  5IO0 A;  2JU5 A;  1IYH A;  2DJJ A;  3VUR A;  5J41 A;  1SVO A;  4LLR A;  2EFH A;  1GTI A;  3Q19 A;  1V98 A;  1KNG A;  5EPF A;  2H0H A;  4ID0 A;  18GS A;  3AY8 A;  2PER A;  5DCH A;  3FMW A;  2E2M A;  3DIE A;  3EUR A;  2HSN B;  3IC4 A;  4YQV A;  2KHP A;  2H19 A;  4N30 A;  5LCZ A;  4Z2T A;  2NDO A;  2NVL A;  3P90 A;  2HRK A;  2A2S A;  1I9D A;  3QD9 A;  4GXZ A;  3SWL A;  4MMM A;  5IMZ A;  4ECC A;  3ZIJ A;  1X9W B;  5CNW A;  5G1K A;  4OCE A;  5D96 A;  2WVZ A;  2GSS A;  3F9U A;  3IAM 2;  5HFI A;  4MAB A;  2B5X A;  3FEU A;  2P0G A;  2TRX A;  2VCV A;  3QOU A;  2AAW A;  4ZL7 A;  2R5G A;  4PUR A;  4AKI A;  2GZZ A;  1XVQ A;  4IQA A;  4NMU A;  4ZB6 A;  1OE8 A;  2ALB A;  3EYT A;  3KGK A;  1GL8 A;  2TRC P;  3DEX A;  4DSS A;  4GF0 A;  1EV9 A;  3ZZX A;  1Z9H A;  4KE3 A;  4KSM A;  4IEL A;  3IK7 A;  4HS1 A;  2VCX A;  3GUR A;  2NTO A;  5IM9 A;  5HR1 A;  1EV4 A;  1EWX A;  3GX0 A;  1VRS D;  2GS3 A;  2R0C A;  2H0I A;  1THX A;  1XZO A;  2YN1 A;  1SJI A;  3BBY A;  2OBI A;  4TKY A;  2HT9 A;  1ZYE A;  6GST A;  1J08 A;  1M99 A;  1KEB A;  2X8H A;  3FHK A;  3WT1 A;  4Z2U A;  2NPB A;  4YAV A;  2HSY A;  4J57 E;  2IMF A;  2YCD A;  4CW9 A;  3HKR A;  3W8S A;  4ECI A;  4IJI A;  1GSE A;  3HYP A;  4TVE A;  1PKZ A;  2WZ9 A;  2OKA A;  2I4A A;  3A2V A;  4V2M A;  3IV4 A;  3ZFB A;  1R5P A;  3GKX A;  3I9V 2;  5B6M A;  5B8B A;  1HQO A;  4JR4 A;  2YNX A;  4USS A;  2DJ0 A;  5IMF A;  1PSQ A;  1GUK A;  2I81 A;  3E3E A;  3G7J A;  2N5B A;  3I6A A;  3RAZ A;  5F07 A;  3FY7 A;  5AIS A;  3GYK A;  3TOU A;  4ZB7 A;  1V9W A;  3KH9 A;  1BJX A;  3JCM L;  2BTO T;  5L71 A;  2JZT A;  1XWC A;  2OAD A;  1XG8 A;  4KF9 A;  1XOA A;  1U3I A;  2L4Q A;  3TDG A;  1B4Q A;  2H1L A;  2H30 A;  5IMC A;  1JZO A;  2HRF A;  2YV9 A;  3UOM A;  2DJK A;  3UIW A;  4IBP A;  1Y6E A;  5IPG A;  1YQ1 A;  4HI7 A;  2LST A;  3HZ8 A;  7GSS A;  4FQU A;  2FUG 2;  3F6D A;  5J9C A;  1YDK A;  1A2L A;  4BWS A;  3VLN A;  3GTU B;  3IE3 A;  2VD0 A;  3VFI A;  4XCS A;  4PUF C;  2H70 A;  3RFR C;  4E8H A;  5DJL A;  1RW1 A;  3QAG A;  2YWN A;  2F8F A;  4MZW A;  4JR6 A;  3ZFL A;  1X9M B;  4X1U A;  4KDU A;  4TN8 A;  2CZ2 A;  2HRK B;  1OC9 A;  1ZYP A;  1CQG A;  4MLY A;  1TKD B;  1OVN A;  3KIJ A;  2PMT A;  5ECH B;  2VUP A;  4N0Z A;  4EIP A;  1A2M A;  1DE2 A;  1S3C A;  3Q6O A;  1V2A A;  4MJB A;  2H74 A;  2N5F A;  5DAK A;  1ZMA A;  1V40 A;  2WUL A;  4D73 B;  4OFM A;  3GSS A;  2VD1 A;  3EVI A;  3F6F A;  4IKH A;  1GLP A;  2WVX A;  3HCZ A;  1O8W A;  1F6M C;  3LJR A;  3D0Z A;  1G0T A;  4X43 A;  3WGE A;  4IHU A;  4JRR A;  3TKR A;  3FZ5 A;  3PH9 A;  1B9Y C;  1A23 A;  4HJ2 A;  3GST A;  4BVX A;  1M0U A;  2M46 A;  3UBK A;  2LJK A;  2PBJ A;  3D22 A;  4ZIJ A;  2F9S A;  1HD2 A;  3QFB C;  4KH7 A;  4AI6 A;  5CRW A;  1YZX A;  2QA1 A;  5ELA A;  2LRN A;  3IBH A;  2JL4 A;  1S4B P;  4PUA A;  4TOP A;  4XS6 A;  4V2N A;  5ECP B;  2P5R A;  4MJE A;  2C0E A;  2DSA A;  4F9Z A;  3GL5 A;  5CRE A;  3ZMK A;  3LQ7 A;  1SKS B;  1ZL9 A;  3ZVJ D;  4EF0 A;  5G5E A;  1GH2 A;  2IL3 A;  5BMU A;  2O85 A;  5ID2 A;  3GFK A;  2AYT A;  2VIM A;  3ERG A;  2FWF A;  2WRT A;  4AJ7 A;  3WGD A;  5G1L A;  2H6Z A;  1TP9 A;  2OJL A;  4LL1 B;  2HQT A;  2DLX A;  2DKH A;  3C1S A;  3HVN A;  2A4V A;  1AQX A;  5D8I A;  2YOI A;  1MD4 A;  2AB6 A;  1EP8 A;  4WR4 A;  3IR4 A;  4O5R A;  5J9B A;  3ERF A;  3M9K A;  4EUY A;  1K3L A;  2VKZ G;  3UEM A;  5D9V A;  4PXO A;  3LFL A;  2REM A;  3QR6 A;  1JZR A;  1A8L A;  1ML6 A;  5F05 A;  3QDN A;  1PD2 1;  3APQ A;  4GCI A;  4RQX A;  5AIX A;  5J40 A;  1NW2 A;  1YEX A;  2H72 A;  3LXT A;  2HSH A;  2XPE A;  4ZB9 A;  1ST9 A;  3DML A;  5E59 A;  3ZYW A;  5ECM B;  3TUE A;  3C8E A;  4L5L A;  2VL3 A;  4WKW A;  4N11 A;  6GSW A;  3F4T A;  2GZP A;  2L5O A;  4TR4 A;  3MYD A;  1YF1 A;  2M80 A;  2IJY A;  4GDF A;  3CRU A;  2E2G A;  2OBK A;  1TU8 A;  2V2G A;  2O89 A;  2WCI A;  2YJH A;  4YKF A;  1FO5 A;  2GDR A;  1T4Z A;  2FNO A;  4X4J A;  4MPF A;  5ECS A;  4BL7 A;  4ZBB A;  2ON7 A;  1EOG A;  4GSS A;  2F3M A;  1SKW B;  2CAQ A;  2B6M A;  2I3Y A;  2C8U A;  4MF7 A;  1URM A;  1B48 A;  1GSF A;  4XIH A;  4ULX A;  5C00 A;  1N8J A;  4POK A;  2FHE A;  3LOR A;  5DJM A;  1PX7 A;  1TI3 A;  1OC8 A;  3UAP A;  2YPM A;  1GLQ A;  2WW2 A;  2GLR A;  2QA2 A;  1Y25 A;  3HVX A;  2H01 A;  2HLS A;  4XHM A;  3C71 A;  4OMV A;  1OC9 B;  3VPQ A;  2H1B A;  2QSI A;  1V58 A;  4G0L A;  4F82 A;  2IWT A;  4JE1 A;  1BX9 A;  3LGC A;  1ERV A;  1JFU A;  5DAK B;  1RQM A;  3WT2 A;  3KM6 A;  2FCH A;  1F37 A;  4CY6 A;  2J9H A;  1M7T A;  5GAP D;  5BRT A;  2WVX B;  5KOW A;  1C72 A;  1YEW C;  1XW6 A;  2C0D A;  2AUV A;  3GUS A;  1KTE A;  1YKC A;  5A5H A;  2NBS A;  1TI1 A;  3L4N A;  3C1R A;  1FOV A;  3DVX A;  1GTB A;  3DWV A;  5A4U A;  1SYX A;  2H8L A;  2IFQ B;  3BD2 A;  5H5R A;  3KH7 A;  2C1Y A;  4BVX B;  5CP1 A;  5KN0 A;  1FHE A;  1XVW A;  1PL2 A;  3CHX C;  3DVW A;  1FG4 A;  1HYU A;  2LQQ A;  2XHF A;  2MYG A;  2IMD A;  4YH2 A;  5J4U A;  5ECR B;  2CA8 A;  1GWC A;  4KW6 A;  9GSS A;  3H93 A;  3GL3 A;  5KEJ A;  3CBU A;  3BCI A;  4MF5 A;  2VM1 A;  5D9T A;  3F3Q A;  5BMU B;  1R5A A;  5A1N B;  3VWV A;  1ZCP A;  4IP6 A;  5B6N A;  1UVZ A;  2G0F A;  3MNG A;  2K8V A;  4Q5N A;  5KN3 A;  5LD0 A;  3GRX A;  2PUK C;  2WFC A;  3UMA A;  1J0F A;  1R26 A;  2K18 A;  1FVJ A;  2VAF A;  2OE3 A;  3G7I A;  4OWY A;  5AN1 A;  5J5N A;  2KLX A;  2X4A A;  3ERW A;  3TJF A;  4MZC A;  3HJP A;  3IHQ A;  1EZK A;  2LS5 A;  1XBS A;  3D21 A;  4AKX B;  2VM2 A;  4K5R A;  1EEM A;  1TK5 B;  1ZOF A;  2X8C A;  3GKN A;  3A2W A;  2WW1 A;  1WIK A;  2R37 A;  2RM5 A;  1O8X A;  4L0W A;  2YZH A;  3GX8 A;  3CMI A;  1KBN A;  5FHI A;  4I97 A;  2WJU A;  1WJK A;  3MIX A;  2VOC A;  1WOU A;  2C3N A;  2OT3 A;  2F51 A;  3QMX A;  1BG5 A;  3D4T A;  2C0F A;  4NXI A;  2GQL A;  3CRT A;  3TKS E;  3L9U A;  2PU9 C;  4Z7X A;  4MF6 A;  1M3J A;  3ZRD A;  2P31 A;  3KTL A;  4HSC X;  3FR9 A;  4KCA A;  2O8V B;  3HDC A;  5CAX A;  2CAI A;  4GQC A;  1GP1 A;  3KMO A;  1DUG A;  1U87 A;  5IQY A;  5ECQ B;  2VCZ A;  4PNF A;  2C0G A;  4WBJ A;  2JAD A;  4EE0 A;  5KOX A;  4HQS A;  4QMK A;  1S3D A;  3QAV A;  4K2D A;  2A4H A;  4POM A;  2R2J A;  4KSO A;  3P7X A;  3UAR A;  4L5O A;  1SD8 A;  4XS4 B;  5D93 A;  1QQ2 A;  2QKE A;  4IGJ A;  5A4V A;  1ZYN A;  4RQR A;  2VL2 A;  3H4K A;  13GS A;  4YQU A;  3FRC A;  2LRT A;  5CYY A;  3L9S A;  3F63 A;  2WGR A;  1ZGN A;  2DML A;  2FD3 A;  4FO5 A;  1EEJ A;  1UA5 A;  5A5H B;  4I2U A;  4FYC A;  6GSU A;  3TKS C;  1A8Y A;  1FW1 A;  4EL1 A;  4EDY A;  1TRS A;  1N25 A;  1J9B A;  4POL A;  1A24 A;  1XFL A;  4WXT A;  1YKA A;  2PPT A;  4TXV A;  5H5S A;  3TJK A;  2X64 A;  2PWJ A;  4O32 A;  1YJ6 A;  3GA4 A;  1I5G A;  5J4V A;  1AIU A;  5HR3 A;  3H8Q A;  4F2I A;  1TW9 A;  1O81 A;  3WYW A;  2R0G A;  4ZL9 A;  1O85 A;  1AAZ A;  4BVY A;  2V6K A;  4ICY A;  1JZW A;  2H6X A;  5ECI B;  1FOH A;  4K6X A;  5HQP A;  2HYX A;  1K3Y A;  1SD9 A; 
#chains in the Genus database with same CATH homology
 4K5S A;  5DAL B;  4RI7 A;  1GRX A;  2FWG A;  5ECN B;  3VWU A;  2GST A;  3RPP A;  4HUA A;  3D5J A;  3EC3 A;  1HNA A;  1QMV A;  2QC7 A;  4LA1 A;  1M2D A;  5A5K A;  3I69 A;  3APO A;  5H5Q A;  4CDO A;  2HI7 A;  1K0O A;  3WGX A;  4HU9 A;  2LQO A;  5G30 A;  2EFD A;  3GV1 A;  3TKQ A;  3ISO A;  1M9A A;  4EC0 A;  2H76 A;  2IME A;  5A34 A;  3EMX A;  1ABA A;  2B1L A;  2E0Q A;  4TR1 A;  2VL9 A;  5GZZ B;  1XXU A;  4NV2 A;  4HU7 A;  3KP9 A;  2GZY A;  1VF2 A;  3GKK A;  4J56 E;  2G2Q A;  5DQS A;  1OC3 A;  4TW5 A;  3EU4 A;  4IJ3 A;  4ZBA A;  2EFE A;  1X5E A;  2ZUP A;  2GT5 A;  4BPY A;  2MMA A;  4OD7 A;  1G7E A;  3K8N A;  4NWY A;  2ZCT A;  2DC5 A;  3ZLP A;  1GSU A;  4MH2 A;  4G9H A;  4XRA A;  1LJR A;  4KDX A;  4MH3 A;  3WD6 A;  3EIN A;  1TJD A;  2I9H A;  4G0K A;  4OCF A;  2H0G A;  4NHZ A;  4DSS B;  1K3O A;  3ZIT A;  4H86 A;  3SBC A;  4ECJ A;  4ISD A;  4ML1 A;  2R3X A;  2YP6 A;  3US3 A;  1XWG A;  4Q5Q A;  1H4O A;  4TR0 A;  2L5L A;  1OE7 A;  4K9Z A;  2BMX A;  3KCM A;  1S3A A;  4XTS A;  3QPM A;  3Q74 A;  2PVO C;  2B7K A;  3TKS A;  1YVL A;  2HE3 A;  2LRC A;  4AF2 A;  5FWG A;  4AJ6 A;  4TXO A;  2LEG A;  2IMI A;  2L6C A;  1GNE A;  1SL0 B;  3RDW A;  1NSW A;  3ZRE A;  3NOF A;  2DBC A;  2MMZ A;  1MTC A;  5F8B A;  2WDU A;  3ZL5 A;  2VLU A;  5G31 A;  5D73 A;  1B8X A;  3S9F A;  3MDK A;  4I8B A;  1TU7 A;  3FR3 A;  3LSZ A;  5CRD A;  1EP7 A;  2O87 A;  1G6W A;  6GSS A;  4PNG A;  5KN1 A;  2LKU A;  1JLW A;  1WE0 A;  1EGR A;  12GS A;  4F03 A;  2DMM A;  4O5U A;  4Q5F A;  2H73 A;  1AUC A;  2YAN A;  5HR2 A;  4N3Z A;  2F8A A;  2GSR A;  3CSH A;  1XCC A;  2ZNM A;  4V2L A;  1K0C A;  2A2R A;  1QGV A;  3VI5 A;  3UL3 A;  1PX6 A;  4BA7 A;  1FB0 A;  3HVS A;  3G7Y A;  2I1U A;  4J2F A;  4OFT A;  1EOH A;  4WET A;  1MDJ A;  2GGT A;  2WB9 A;  1O7U A;  3NZN A;  4KAE A;  4DSQ A;  1O6J A;  3GMF A;  3KMN A;  4KGI A;  4NHW A;  3BOA A;  1SL2 B;  2YJ7 A;  3TJJ A;  1USB A;  5F0G A;  1G6Y A;  4EO3 A;  2O7K A;  4MCU A;  2EFC A;  2KUC A;  2FLS A;  1K0A A;  3BCK A;  5IO2 A;  4PQH A;  3FKF A;  1UN2 A;  3HZ4 A;  4JED A;  3HVV A;  4NPB A;  1T7P B;  3GNJ A;  4K2X A;  3D6I A;  3E9J B;  5JWQ B;  2V6O A;  4K7I A;  5G2Z A;  2B1K A;  10GS A;  4XS1 A;  2JAC A;  2VLT A;  3P2A A;  4AGS A;  2XBI A;  2L59 A;  1TDI A;  3KTB A;  1SL1 B;  2XC2 A;  2HSM A;  5COH A;  2R4V A;  1XWA A;  1F9M A;  2QGV A;  2H66 A;  1M2B A;  2IN3 A;  3IPZ A;  2MBS A;  3MAK A;  4DVC A;  2AJQ B;  2HNL A;  3VK9 A;  2C4J A;  4QQ7 A;  3DGQ A;  3DRN A;  1A0F A;  2X99 A;  2FWE A;  2X49 A;  1WMJ A;  1WRY A;  1NHY A;  3IHG A;  1A2J A;  3FR6 A;  4KX4 A;  1PL1 A;  5JCG A;  3ZIV A;  2VL2 C;  3PPU A;  2WS2 A;  2HRA A;  4FYB A;  2IIY A;  1PA3 A;  2DIY A;  4FH8 A;  2LV3 A;  1JZD A;  1SVL A;  1AXD A;  4TRX A;  4WF5 A;  2H1A A;  4LMW A;  1XOB A;  3IAS 2;  4O5Q A;  3U5R E;  3HJO A;  4GQF A;  4V1A g;  6GSY A;  4MPG A;  1TTZ A;  3TGZ A;  4P3Y B;  4A5P A;  4E68 A;  3UBL A;  2PVQ A;  2H75 A;  3LG6 A;  2C3Q A;  3IA1 A;  5ID2 B;  6GSX A;  4GTU A;  1TXU A;  2DJ2 A;  4NAX A;  2YV7 A;  3R3E A;  5JWR B;  3HHV A;  4MDC A;  1THO A;  2CX3 A;  4GWR A;  4TXO B;  5F06 A;  4GSN A;  1SJ6 A;  4KUN A;  4G10 A;  3LYP A;  2CVK A;  1SKR B;  4Q5R A;  3HMJ G;  2Z9S A;  1M2A A;  1PKW A;  1Z5Y E;  4RI6 A;  2B5Y A;  3A5I A;  1K0M A;  5GSS A;  1B4P A;  2N5A A;  1GTU A;  5ELG A;  5JCU A;  1O73 A;  1GUM A;  3DD3 A;  2GSQ A;  5DQY A;  5J3R A;  2VO4 A;  3EPT A;  1A0R P;  1T3B A;  4I5Q A;  2VCT A;  3RHC A;  3GTU A;  4WEY A;  2B3S A;  1Z7R A;  2HXK A;  1PMT A;  3PGT A;  2H1G A;  3E0U A;  1DSB A;  1F3B A;  4GLT A;  2OA7 A;  1AW9 A;  4L0U A;  2LTK A;  4PQ1 A;  3GKM A;  4QL7 A;  1PN0 A;  3TJG A;  2FA4 A;  1MDK A;  1QUW A;  3HJM A;  5INY A;  5J4Y A;  1F2E A;  2VLV A;  20GS A;  3M1G A;  4PTS A;  5A4W A;  1ERT A;  2B5E A;  3IRA A;  4HJM A;  5IMV A;  4BL7 B;  2CVB A;  1YF0 A;  3IOS A;  2CVD A;  4WF4 A;  4D73 A;  3CYN A;  4PX1 A;  3R2Q A;  2RM6 A;  4ECB A;  2JZS A;  4LL4 B;  3UVH A;  2BJX A;  3HD5 A;  1XW9 A;  1FVK A;  4HEA 2;  1OKD A;  4EKZ A;  2L4C A;  3KZQ A;  4IN0 A;  2R6K A;  3N5O A;  4L8E A;  4OO4 A;  3CXG A;  1W89 A;  3TRQ A;  1U6T A;  4CY8 A;  5DDL A;  3CTG A;  4F0C A;  5LNK e;  1GUH A;  1TRU A;  4F0B A;  1ILO A;  3QAW A;  3FK8 A;  1OYJ A;  2H6Y A;  1JHB A;  1LU4 A;  4ILF A;  5ABR A;  1K0D A;  3ME8 A;  2YWI A;  3TJB A;  1K0N A;  4DSR A;  3BJ5 A;  5EY6 A;  5DBQ A;  3IK9 A;  2YZU A;  3Q18 A;  3MWH A;  3O3T A;  1OAZ A;  3W8J A;  5HFK A;  1DBY A;  4JBB A;  1XW5 A;  2HSM B;  4O7H A;  5C04 A;  3UVT A;  3VPT A;  4GRF A;  4AKG A;  2FGX A;  4DEJ A;  3FZ4 A;  1HNC A;  4EIQ A;  2LNS A;  3A2X A;  3MSZ A;  4AKH A;  3GN3 A;  1PN9 A;  2CZ3 A;  1QK8 A;  3L0H A;  4HZ2 A;  3HXS A;  3EWL A;  2UZ8 A;  4KCE A;  4IW9 A;  1GSS A;  4KDY A;  1Q98 A;  3ZTL A;  2XPD A;  5DCG A;  1M9B A;  6GSV A;  2DIZ A;  4YKG A;  1TRW A;  2OAC A;  3A3T A;  2HFD A;  1GSQ A;  3H1N A;  3O6T A;  3APS A;  5IMA A;  2AHE A;  1VGL A;  4IP1 A;  2GQM A;  1WP0 A;  3DKS A;  4IS0 A;  1Z6M A;  1SEN A;  16GS A;  4RUV A;  1MD3 A;  2L57 A;  2J23 A;  2B7J A;  1LBK A;  3CSI A;  3QFA C;  3KEB A;  1VF3 A;  3EE2 A;  3OR5 A;  2HZE A;  3P8W A;  5AIV A;  1T8E B;  1GUL A;  2OE1 A;  2H1D A;  3EU3 A;  3M9J A;  1FAA A;  2EIQ A;  2V41 A;  1PQN A;  5E4W A;  2JSY A;  3D4M A;  22GS A;  3IC8 A;  3TRX A;  1XWK A;  5JCW A;  1PGT A;  1H75 A;  4LMV A;  4PQI A;  1Z6N A;  4ACS A;  4YAP A;  2HZF A;  1SK1 A;  2MMN A;  3QCP A;  1SVM A;  1T1V A;  3CTF A;  4I2T A;  2ES7 A;  2DKI A;  1UC7 A;  3LXZ A;  2X8G A;  4TR3 A;  3TB2 A;  1E6B A;  5GAN D;  3VI7 A;  1HNB A;  2D2Z A;  1Y1U A;  3TCO A;  4EXJ A;  3PR8 A;  1MEK A;  2RII A;  4MZB A;  1SU9 A;  2E7P A;  4W66 A;  1SJZ A;  1N2A A;  4MK3 A;  1R4W A;  1GSY A;  2PGT A;  3FYG A;  4HOJ A;  4NV5 A;  2C80 A;  1OKT A;  5ECO B;  1NHO A;  2VCQ A;  2CQ9 A;  4G0I A;  4ML6 A;  5CRH A;  5EL8 A;  4G2E A;  1RK4 A;  4WBR D;  3TU3 B;  2M72 A;  2RUF A;  1XWB A;  8GSS A;  4OFN A;  1E2Y A;  3F8U A;  2UV8 G;  1DE1 A;  2IFQ A;  4MJA A;  4IVF A;  2TIR A;  5B7C A;  11GS A;  2K9F A;  1V57 A;  2RUE A;  4KA0 A;  3KJY A;  3TRP A;  5IOW A;  3RHB A;  3ZML A;  4AJ8 A;  3LYK A;  2GVP A;  1Z3E A;  3J7Y k;  1U3A A;  2PN8 A;  1TK8 B;  4ZL8 A;  3L78 A;  1VF4 A;  2ON5 A;  1BG1 A;  2DJ3 A;  3LEF A;  3F0I A;  3J7Y b;  1B9X C;  4PGT A;  1YEP A;  1G7O A;  3FZ9 A;  1ACV A;  1MDI A;  1ERU A;  1BAY A;  3ZVJ A;  1F3A A;  5A1N A;  3KP8 A;  4N0V A;  3EMP A;  4WR5 A;  3V1W A;  2FA8 A;  1T00 A;  3G9B A;  2JSZ A;  4MP4 A;  2JZR A;  5FT3 A;  3TKP A;  5KN2 A;  2CX4 A;  1Z7P A;  4K7N A;  3FW2 A;  4GST A;  4K0G A;  5CRG A;  5DVB A;  1TK0 B;  4BVY B;  4I6X A;  17GS A;  1TOF A;  2HSN A;  5G5F A;  4MA9 A;  3O76 A;  4ZXG A;  3IDV A;  5AGY A;  4Z2R A;  1ON4 A;  1AQV A;  3DXB A;  4IQ1 A;  3LW9 A;  1GTA A;  2LNT A;  1GNW A;  2CT6 A;  5EVO A;  5IMD A;  1AC1 A;  3GH6 A;  2A2P A;  3W6G A;  2KOK A;  1TXX A;  3L9V A;  1ZYQ B;  2VCW A;  3F3R A;  2GT6 A;  2MZC A;  2LJR A;  5IIZ A;  3VWW A;  5D9X A;  14GS A;  2L6D A;  2HZE B;  4HDE A;  2HRN A;  3CSJ A;  3RBT A;  4HQZ A;  3GH9 A;  3KD0 A;  4MNN A;  2MMO A;  1QXH A;  2FY6 A;  4KB3 A;  1FB6 A;  2EC4 A;  3IXR A;  4JZQ A;  3RPN A;  4YQM A;  3DYR A;  4K1F A;  2V1M A;  2IPA A;  2XBQ A;  1BQ7 A;  5A34 B;  1CQH A;  2RLI A;  1SK0 A;  2C3T A;  5ECK B;  2GQK A;  4TR1 B;  3GIX A;  1TRV A;  4ZIL A;  1W4V A;  5D9W A;  1NM3 A;  2LUS A;  2K8S A;  4EDZ A;  4G19 A;  1X5D A;  4KND A;  1AQW A;  4X0X A;  2LJA A;  3PIN A;  2K6V A;  3FZA A;  5IOX A;  1K0B A;  2AV4 A;  3UJ1 A;  1R7H A;  19GS A;  5HR0 A;  4FIW A;  1IYI A;  4XS4 A;  5GST A;  1QFN A;  3M3M A;  2EIO A;  3NIV A;  1WPI A;  1BF5 A;  1X5C A;  5ECL B;  4CHS A;  3I43 A;  4FYU A;  3H79 A;  3HA9 A;  2YWO A;  4K8M A;  1X9S B;  1JLV A;  4XRD A;  3C73 A;  1ZZY A;  2CV4 A;  1WWJ A;  2FWH A;  2V32 A;  2MBT A;  4ZBD A;  4EVM A;  3LWA A;  5HFG A;  3M8N A;  3ME7 A;  1SYR A;  5IPH A;  3F4S A;  4ZB8 A;  1VF1 A;  2P5Q A;  2KP2 A;  3VWX A;  1GSD A;  4G01 A;  2GTU A;  5ENU A;  4JU5 A;  1T4Y A;  1X0R A;  4K0N A;  3F4R A;  4V1A p;  1PRX A;  5J47 A;  1XPV A;  4BWQ A;  3CWG A;  1U88 A;  4POB A;  1EGO A;  4O92 A;  2R0P A;  4QL9 A;  2KP1 A;  1BYE A;  5JWO B;  2IMK A;  1XIY A;  4OO5 A;  3HY2 A;  1Q4J A;  1ERW A;  1BED A;  2O5V A;  3TOT A;  3A5W A;  4E8E A;  2OE0 A;  5CO3 A;  3ED3 A;  5B8A A;  2YWM A;  4N10 A;  1YY7 A;  3N9J A;  2DJ1 A;  5DAL A;  3C7M A;  3U6V A;  2EIR A;  4MJC A;  4HZ4 A;  1SK2 A;  3KXO A;  2H71 A;  4K7O A;  3M0F A;  3GHA A;  5IO0 A;  2JU5 A;  1IYH A;  2DJJ A;  3VUR A;  5J41 A;  1SVO A;  4LLR A;  2EFH A;  1GTI A;  3Q19 A;  1V98 A;  1KNG A;  5EPF A;  2H0H A;  4ID0 A;  18GS A;  3AY8 A;  2PER A;  5DCH A;  3FMW A;  2E2M A;  3DIE A;  3EUR A;  2HSN B;  3IC4 A;  4YQV A;  2KHP A;  2H19 A;  4N30 A;  5LCZ A;  4Z2T A;  2NDO A;  2NVL A;  3P90 A;  2HRK A;  2A2S A;  1I9D A;  3QD9 A;  4GXZ A;  3SWL A;  4MMM A;  5IMZ A;  4ECC A;  3ZIJ A;  1X9W B;  5CNW A;  5G1K A;  4OCE A;  5D96 A;  2GSS A;  3F9U A;  3IAM 2;  5HFI A;  4MAB A;  2B5X A;  3FEU A;  2P0G A;  2TRX A;  2VCV A;  3QOU A;  2AAW A;  4ZL7 A;  2R5G A;  4PUR A;  4AKI A;  2GZZ A;  1XVQ A;  4IQA A;  4NMU A;  4ZB6 A;  1OE8 A;  2ALB A;  3EYT A;  3KGK A;  1GL8 A;  2TRC P;  3DEX A;  4DSS A;  4GF0 A;  1EV9 A;  3ZZX A;  1Z9H A;  4KE3 A;  4KSM A;  4IEL A;  3IK7 A;  4HS1 A;  2VCX A;  3GUR A;  2NTO A;  5IM9 A;  5HR1 A;  1EV4 A;  1EWX A;  3GX0 A;  1VRS D;  2GS3 A;  2R0C A;  2H0I A;  1THX A;  1XZO A;  2YN1 A;  1SJI A;  3BBY A;  2OBI A;  4TKY A;  2HT9 A;  1ZYE A;  6GST A;  1J08 A;  1M99 A;  1KEB A;  2X8H A;  3FHK A;  3WT1 A;  4Z2U A;  2NPB A;  4YAV A;  2HSY A;  4J57 E;  2IMF A;  2YCD A;  4CW9 A;  3HKR A;  3W8S A;  4ECI A;  4IJI A;  1GSE A;  3HYP A;  4TVE A;  1PKZ A;  2WZ9 A;  2OKA A;  2I4A A;  3A2V A;  4V2M A;  3IV4 A;  3ZFB A;  1R5P A;  3GKX A;  3I9V 2;  5B6M A;  5B8B A;  1HQO A;  4JR4 A;  2YNX A;  4USS A;  2DJ0 A;  5IMF A;  1PSQ A;  1GUK A;  2I81 A;  3E3E A;  3G7J A;  2N5B A;  3I6A A;  3RAZ A;  5F07 A;  3FY7 A;  5AIS A;  3GYK A;  3TOU A;  4ZB7 A;  1V9W A;  3KH9 A;  1BJX A;  3JCM L;  2BTO T;  5L71 A;  2JZT A;  1XWC A;  2OAD A;  4KF9 A;  1XOA A;  1U3I A;  2L4Q A;  3TDG A;  1B4Q A;  2H1L A;  2H30 A;  5IMC A;  1JZO A;  2HRF A;  2YV9 A;  3UOM A;  2DJK A;  3UIW A;  4IBP A;  1Y6E A;  5IPG A;  1YQ1 A;  4HI7 A;  2LST A;  3HZ8 A;  7GSS A;  4FQU A;  2FUG 2;  3F6D A;  5J9C A;  1YDK A;  1A2L A;  4BWS A;  3VLN A;  3GTU B;  3IE3 A;  2VD0 A;  3VFI A;  4XCS A;  4PUF C;  2H70 A;  4E8H A;  5DJL A;  1RW1 A;  3QAG A;  2YWN A;  2F8F A;  4MZW A;  4JR6 A;  3ZFL A;  1X9M B;  4X1U A;  4KDU A;  4TN8 A;  2CZ2 A;  2HRK B;  1OC9 A;  1ZYP A;  1CQG A;  4MLY A;  1TKD B;  1OVN A;  3KIJ A;  2PMT A;  5ECH B;  2VUP A;  4N0Z A;  4EIP A;  1A2M A;  1DE2 A;  1S3C A;  3Q6O A;  1V2A A;  4MJB A;  2H74 A;  2N5F A;  5DAK A;  1ZMA A;  1V40 A;  2WUL A;  4D73 B;  4OFM A;  3GSS A;  2VD1 A;  3EVI A;  3F6F A;  4IKH A;  1GLP A;  3HCZ A;  1O8W A;  1F6M C;  3LJR A;  3D0Z A;  1G0T A;  4X43 A;  3WGE A;  4IHU A;  4JRR A;  3TKR A;  3FZ5 A;  3PH9 A;  1B9Y C;  1A23 A;  4HJ2 A;  3GST A;  4BVX A;  1M0U A;  2M46 A;  3UBK A;  2LJK A;  2PBJ A;  3D22 A;  4ZIJ A;  2F9S A;  1HD2 A;  3QFB C;  4KH7 A;  4AI6 A;  5CRW A;  1YZX A;  2QA1 A;  5ELA A;  2LRN A;  3IBH A;  2JL4 A;  4PUA A;  4TOP A;  4XS6 A;  4V2N A;  5ECP B;  2P5R A;  4MJE A;  2C0E A;  2DSA A;  4F9Z A;  3GL5 A;  5CRE A;  3ZMK A;  3LQ7 A;  1SKS B;  1ZL9 A;  3ZVJ D;  4EF0 A;  5G5E A;  1GH2 A;  2IL3 A;  5BMU A;  2O85 A;  5ID2 A;  3GFK A;  2AYT A;  2VIM A;  3ERG A;  2FWF A;  2WRT A;  4AJ7 A;  3WGD A;  5G1L A;  2H6Z A;  1TP9 A;  2OJL A;  4LL1 B;  2HQT A;  2DLX A;  2DKH A;  3C1S A;  2A4V A;  1AQX A;  5D8I A;  2YOI A;  1MD4 A;  2AB6 A;  1EP8 A;  4WR4 A;  3IR4 A;  4O5R A;  5J9B A;  3ERF A;  3M9K A;  4EUY A;  1K3L A;  2VKZ G;  3UEM A;  5D9V A;  4PXO A;  3LFL A;  2REM A;  3QR6 A;  1JZR A;  1A8L A;  1ML6 A;  5F05 A;  3QDN A;  1PD2 1;  3APQ A;  4GCI A;  4RQX A;  5AIX A;  5J40 A;  1NW2 A;  1YEX A;  2H72 A;  3LXT A;  2HSH A;  2XPE A;  4ZB9 A;  1ST9 A;  3DML A;  5E59 A;  3ZYW A;  5ECM B;  3TUE A;  3C8E A;  4L5L A;  2VL3 A;  4WKW A;  4N11 A;  6GSW A;  3F4T A;  2GZP A;  2L5O A;  4TR4 A;  3MYD A;  1YF1 A;  2M80 A;  2IJY A;  4GDF A;  3CRU A;  2E2G A;  2OBK A;  1TU8 A;  2V2G A;  2O89 A;  2WCI A;  2YJH A;  4YKF A;  1FO5 A;  2GDR A;  1T4Z A;  2FNO A;  4X4J A;  4MPF A;  5ECS A;  4BL7 A;  4ZBB A;  2ON7 A;  1EOG A;  4GSS A;  2F3M A;  1SKW B;  2CAQ A;  2B6M A;  2I3Y A;  2C8U A;  4MF7 A;  1URM A;  1B48 A;  1GSF A;  4XIH A;  4ULX A;  5C00 A;  1N8J A;  4POK A;  2FHE A;  3LOR A;  5DJM A;  1PX7 A;  1TI3 A;  1OC8 A;  3UAP A;  2YPM A;  1GLQ A;  2GLR A;  2QA2 A;  1Y25 A;  3HVX A;  2H01 A;  2HLS A;  4XHM A;  3C71 A;  4OMV A;  1OC9 B;  3VPQ A;  2H1B A;  2QSI A;  1V58 A;  4G0L A;  4F82 A;  2IWT A;  4JE1 A;  1BX9 A;  3LGC A;  1ERV A;  1JFU A;  5DAK B;  1RQM A;  3WT2 A;  3KM6 A;  2FCH A;  1F37 A;  4CY6 A;  2J9H A;  1M7T A;  5GAP D;  5BRT A;  5KOW A;  1C72 A;  1XW6 A;  2C0D A;  2AUV A;  3GUS A;  1KTE A;  1YKC A;  5A5H A;  2NBS A;  1TI1 A;  3L4N A;  3C1R A;  1FOV A;  3DVX A;  1GTB A;  3DWV A;  5A4U A;  1SYX A;  2H8L A;  2IFQ B;  3BD2 A;  5H5R A;  3KH7 A;  2C1Y A;  4BVX B;  5CP1 A;  5KN0 A;  1FHE A;  1XVW A;  1PL2 A;  3DVW A;  1FG4 A;  1HYU A;  2LQQ A;  2XHF A;  2MYG A;  2IMD A;  4YH2 A;  5J4U A;  5ECR B;  2CA8 A;  1GWC A;  4KW6 A;  9GSS A;  3H93 A;  3GL3 A;  5KEJ A;  3CBU A;  3BCI A;  4MF5 A;  2VM1 A;  5D9T A;  3F3Q A;  5BMU B;  1R5A A;  5A1N B;  3VWV A;  1ZCP A;  4IP6 A;  5B6N A;  1UVZ A;  2G0F A;  3MNG A;  2K8V A;  4Q5N A;  5KN3 A;  5LD0 A;  3GRX A;  2PUK C;  2WFC A;  3UMA A;  1J0F A;  1R26 A;  2K18 A;  1FVJ A;  2VAF A;  2OE3 A;  3G7I A;  4OWY A;  5AN1 A;  5J5N A;  2KLX A;  2X4A A;  3ERW A;  3TJF A;  4MZC A;  3HJP A;  3IHQ A;  1EZK A;  2LS5 A;  1XBS A;  3D21 A;  4AKX B;  2VM2 A;  4K5R A;  1EEM A;  1TK5 B;  1ZOF A;  2X8C A;  3GKN A;  3A2W A;  1WIK A;  2R37 A;  2RM5 A;  1O8X A;  4L0W A;  2YZH A;  3GX8 A;  3CMI A;  1KBN A;  5FHI A;  4I97 A;  2WJU A;  1WJK A;  3MIX A;  2VOC A;  1WOU A;  2C3N A;  2OT3 A;  2F51 A;  3QMX A;  1BG5 A;  3D4T A;  2C0F A;  4NXI A;  2GQL A;  3CRT A;  3TKS E;  3L9U A;  2PU9 C;  4Z7X A;  4MF6 A;  3ZRD A;  2P31 A;  3KTL A;  4KCA A;  3FR9 A;  2O8V B;  3HDC A;  5CAX A;  2CAI A;  4GQC A;  1GP1 A;  3KMO A;  1DUG A;  1U87 A;  5IQY A;  5ECQ B;  2VCZ A;  4PNF A;  2C0G A;  4WBJ A;  2JAD A;  4EE0 A;  5KOX A;  4HQS A;  4QMK A;  1S3D A;  3QAV A;  4K2D A;  2A4H A;  4POM A;  2R2J A;  4KSO A;  3P7X A;  3UAR A;  4L5O A;  1SD8 A;  4XS4 B;  5D93 A;  1QQ2 A;  2QKE A;  4IGJ A;  5A4V A;  1ZYN A;  4RQR A;  2VL2 A;  3H4K A;  13GS A;  4YQU A;  3FRC A;  2LRT A;  5CYY A;  3L9S A;  3F63 A;  2WGR A;  1ZGN A;  2DML A;  2FD3 A;  4FO5 A;  1EEJ A;  1UA5 A;  5A5H B;  4I2U A;  4FYC A;  6GSU A;  3TKS C;  1A8Y A;  1FW1 A;  4EL1 A;  4EDY A;  1TRS A;  1N25 A;  1J9B A;  4POL A;  1A24 A;  1XFL A;  4WXT A;  1YKA A;  2PPT A;  4TXV A;  5H5S A;  3TJK A;  2X64 A;  2PWJ A;  4O32 A;  1YJ6 A;  3GA4 A;  1I5G A;  5J4V A;  1AIU A;  5HR3 A;  3H8Q A;  4F2I A;  1TW9 A;  1O81 A;  3WYW A;  2R0G A;  4ZL9 A;  1O85 A;  1AAZ A;  4BVY A;  2V6K A;  4ICY A;  1JZW A;  2H6X A;  5ECI B;  1FOH A;  4K6X A;  5HQP A;  2HYX A;  1K3Y A;  1SD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...