3LYKA

Structure of stringent starvation protein a homolog from haemophilus influenzae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
b'VMTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQALPEDLMELNPYGTVPTLVDRDLVLFNSRIIMEYLDERFPHPPLMQVYPVSRAKDRLLMLRIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQMPYFMNEEFGLVDCYVAPLLWKLKHLGVEFTGTGSKAIKAYMERVFTRDSFLQSVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein A homolog
publication title Structure of stringent starvation protein A homolog from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lykA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lykA01
1PA3A 5BMUA 4XRAA 2YN1A 3APOA 3KXOA 5ECRB 3GA4A 2LSTA 5ABRA 4G0LA 2AV4A 2H72A 2WRTA 4BVYB 4J57E 1FG4A 3A2VA 3IV4A 1ERWA 4L0WA 4AJ8A 2IMDA 3HY2A 3DD3A 1M9AA 5G1LA 11GSA 4YH2A 2OJLA 4XHMA 4IHUA 3LYKA 5HFIA 1C72A 4GTUA 1DE2A 2C0FA 4MPGA 4RI7A 3F63A 4P3YB 3E3EA 3GL3A 2C3QA 1GSQA 1GTIA 1JZOA 5D73A 3GNJA 4K0NA 3GN3A 2GSQA 2JU5A 2LV3A 3KH9A 1J0FA 8GSSA 1PKWA 1A8LA 2H76A 2HI7A 3GTUB 5G2ZA 2GLRA 1QXHA 2VLUA 3J7Yk 1GL8A 1U88A 2LTKA 4TN8A 4O7HA 1NSWA 1X0RA 4TXOB 3TKPA 5G5FA 4FYUA 3ZL5A 3A2WA 3IXRA 4CDOA 1OKDA 4MZCA 3FZ5A 3RPNA 3F3QA 4IN0A 2XC2A 18GSA 2Z9SA 1FVKA 4BPYA 1GLQA 4DEJA 2JACA 2R3XA 2A2SA 1R7HA 3D5JA 2LEGA 3L4NA 3HD5A 4DSQA 2YV9A 3VWXA 2YOIA 5LCZA 10GSA 1GH2A 2VCWA 1QK8A 4G2EA 1WPIA 3HXSA 5IMCA 4K9ZA 3VPTA 12GSA 2IMEA 4AJ6A 1V9WA 1DUGA 3BBYA 1TOFA 3GRXA 3KGKA 6GSYA 4LMWA 1U6TA 5J41A 2I4AA 5KEJA 1SYXA 5CRHA 5EL8A 1XFLA 2OBKA 4KCAA 1BQ7A 4V1Ag 5LNKe 1PSQA 1RW1A 4ECCA 5A4UA 4F0CA 1W89A 1SK0A 3D0ZA 2JADA 4RQRA 2PMTA 1GSYA 4MF7A 2RM5A 2HZEB 2LRCA 1JLVA 2C3NA 4GSTA 4F82A 5ECNB 5HR0A 1V2AA 1AQXA 2REMA 1ON4A 1AIUA 2GZYA 5ECMB 1GNEA 2I9HA 4ECJA 4I97A 4JZQA 4PQ1A 3TOUA 22GSA 1LU4A 4O92A 1TK0B 3KMOA 3L9UA 2OE3A 3HJPA 1G7OA 2HZFA 3N5OA 2PN8A 2DIYA 5F05A 1PD21 4GQFA 1Z3EA 4I5QA 5FHIA 1SJ6A 2C0EA 1CQGA 3D4TA 4LA1A 2CVDA 1OC8A 4BVXB 3O3TA 5D9XA 5B6MA 1ERTA 4MH2A 2CX3A 3QFAC 2R4VA 3S9FA 5IOXA 3GH6A 4TOPA 2YNXA 1ZCPA 1UVZA 3TJBA 4X0XA 5CO3A 2LQQA 4WKWA 3VI7A 1PL2A 2H74A 2EC4A 4BA7A 4HDEA 2MBTA 2CX4A 3VURA 2C0DA 1XOAA 4ACSA 2GT5A 1XW5A 1M2DA 1O7UA 4OWYA 4TR4A 2PVQA 1PKZA 2MMZA 3F6FA 3FR9A 1MD3A 5F06A 2OE1A 3ZIJA 3QMXA 2QSIA 4K0GA 3WGDA 1EGRA 2N5FA 2V41A 3L9VA 4JEDA 5IMVA 1VF1A 2V6OA 3HJMA 4N0ZA 3LQ7A 4FYBA 1T3BA 2L4CA 2F8FA 1ZOFA 1B4QA 4PUAA 1BJXA 3SWLA 3D21A 4V2LA 3TJKA 5DJMA 4F2IA 4PQHA 1W4VA 4HJ2A 3TUEA 4I2TA 5DAKA 3H79A 4GQCA 4DSSB 1AW9A 2VM2A 1XWGA 3FK8A 1A2JA 2QKEA 3EYTA 5IO0A 3KH7A 1GUHA 2X8HA 5A4VA 9GSSA 2VO4A 1FB0A 2VD0A 2L6DA 3QPMA 5GSTA 4O32A 1B48A 2LJKA 3UL3A 1WRYA 3ZFBA 1K0NA 3J7Yb 2VCZA 4HZ4A 1JZWA 3GIXA 3UOMA 4GCIA 1M2AA 5JWRB 3FYGA 4FH8A 2TRCP 3F8UA 1ILOA 4WR4A 3L0HA 3IE3A 2RUFA 4HQSA 3HDCA 1YKCA 2GS3A 1YF1A 3UVTA 1PRXA 3FR3A 3LYPA 4IQ1A 2X8GA 2L57A 1WWJA 4ISDA 4MZBA 1FO5A 4F0BA 3ISOA 1A24A 5F8BA 1WOUA 2AAWA 1GUMA 5D9VA 1FHEA 4GLTA 1SU9A 3P2AA 2FGXA 1ZYQB 4CHSA 1ABAA 2C8UA 3LEFA 3HCZA 5B6NA 2YJHA 3MAKA 1UC7A 4LMVA 1MDKA 2MMNA 3ZLPA 1QUWA 3W8SA 1V98A 3LG6A 1A0RP 2YANA 2MBSA 1OYJA 3TKRA 1ERVA 2HT9A 6GSVA 3US3A 4EDZA 2DC5A 4OMVA 2HE3A 4WF4A 4USSA 3FRCA 4MABA 1TP9A 2O85A 4KDXA 3D4MA 4MDCA 2H30A 3VFIA 1O73A 2FUG2 1V58A 3IOSA 1KNGA 1PX6A 1FW1A 1FB6A 3LXTA 2KP1A 1X9MB 4NXIA 4WBJA 1AQWA 1R4WA 1G0TA 4L0UA 1M9BA 1TRWA 5IM9A 2IWTA 5H5RA 5H5SA 19GSA 2OKAA 3NZNA 3APQA 1ZZYA 2ON5A 3GSSA 3TKSA 3TOTA 2GSRA 14GSA 3WT1A 2HRKA 2I81A 3VWWA 2IN3A 3DXBA 3QAGA 3MDKA 1JLWA 1YF0A 2H75A 3EURA 4OFNA 4D73B 1M0UA 2OADA 4DVCA 5AN1A 4KDYA 5CRGA 2LNTA 5IMZA 2XHFA 5ID2B 4ZL7A 1SL1B 1TI3A 5ENUA 2E7PA 4JRRA 5D9WA 3M3MA 4TXVA 2GQLA 2IL3A 1X9SB 1YJ6A 1RQMA 4WEYA 5FT3A 2C1YA 4L8EA 1BYEA 4I8BA 1XIYA 3F9UA 2AJQB 1WMJA 4ID0A 3RHBA 3KTBA 4HI7A 4OFTA 3KP9A 2AHEA 4OCFA 3LGCA 3CRTA 2IFQB 3HKRA 4Z7XA 3EVIA 1XCCA 4BL7A 5CRWA 5CNWA 5IMDA 2GSSA 4KUNA 3F0IA 2FD3A 4G19A 3TB2A 3GKNA 1N8JA 2LKUA 5GSSA 4NWYA 1IYHA 1SK1A 1O8WA 2EIOA 2CAIA 1B9YC 2YZHA 4G10A 3RHCA 1Z9HA 2N5BA 3HZ4A 2HSMB 2H1DA 1JHBA 1KTEA 1TXXA 1AQVA 4YAPA 2RIIA 1K3OA 5DALA 1Z6MA 3DRNA 3KM6A 1Q4JA 3BOAA 2RM6A 1YY7A 3GUSA 2C0GA 4DSRA 1PN9A 1OE8A 2WJUA 1U3AA 5IQYA 3UARA 4N30A 3UBLA 3H93A 5HR3A 1NHYA 2HSYA 5CREA 3VWVA 1LJRA 1TDIA 3HVVA 3MWHA 3ZYWA 3DWVA 1HNCA 7GSSA 4G0KA 1EV9A 4IP1A 5HR1A 3LFLA 1F9MA 1QGVA 2VLTA 1SL2B 1PGTA 3G7IA 3EE2A 1GULA 4HU9A 2VL3A 3TJJA 2MMOA 2B1KA 1WIKA 4KA0A 3QFBC 3VLNA 2HFDA 3KIJA 5JCWA 2KOKA 3GV1A 4J56E 1CQHA 3KCMA 4EXJA 4F03A 4XTSA 2CVBA 2FWFA 3G7JA 2FCHA 4ZBDA 4HUAA 3PINA 5B8AA 1PQNA 2FLSA 2WGRA 2V32A 2PPTA 2M72A 2L6CA 4BWSA 2D2ZA 2GZPA 4XCSA 5ECSA 1XVWA 1JFUA 1A2LA 2PWJA 1B8XA 1HQOA 1HYUA 1Z6NA 2H0GA 1S3AA 5EPFA 5HR2A 1O8XA 2R6KA 3LXZA 4PXOA 2M80A 3DEXA 3DIEA 2B5XA 6GSWA 5JWOB 1VRSD 5D9TA 4OO5A 1ERUA 5F07A 4FQUA 2YP6A 5DCHA 20GSA 3C73A 4K6XA 2X64A 3I69A 3L78A 2F8AA 4K2DA 2KLXA 4GXZA 5CYYA 2YCDA 2CA8A 2CZ3A 1YEXA 4QL9A 4TW5A 3WYWA 4AF2A 1A23A 3DVWA 4KW6A 5KN3A 1SD9A 2HNLA 1ZGNA 5ECPB 3ED3A 3VPQA 3VWUA 2HRNA 3IR4A 2RLIA 3HA9A 3O76A 5B8BA 2K8SA 2VIMA 4JE1A 2GTUA 2DJKA 2VCQA 3G7YA 1F2EA 5F0GA 5LD0A 3GHAA 4IVFA 2JZTA 2LQOA 3NOFA 1YKAA 1S3DA 4V2MA 2LRNA 3F4TA 1ZYEA 4HQZA 2B5YA 3LORA 4TVEA 3GL5A 2DIZA 3TJGA 4POBA 2YWMA 1HNAA 4OFMA 5HFKA 5ECKB 1XWAA 1I9DA 4EVMA 5E4WA 2GGTA 1N2AA 4BVYA 2ZNMA 3EU4A 1G6YA 1X5EA 2VAFA 2XPEA 5IPGA 3ZREA 1DBYA 4EKZA 3UMAA 2FNOA 2PUKC 5G30A 1TKDB 4IELA 2X8CA 2XBIA 3ZMLA 4AGSA 1M7TA 5IOWA 2ES7A 4MK3A 4MCUA 3KTLA 4QQ7A 4ML1A 4HS1A 2DJ2A 2WB9A 2B3SA 4XS1A 1EOGA 1EEMA 1EOHA 2VOCA 2FHEA 2JSYA 3KP8A 1V57A 4MF5A 3P90A 3ERGA 1XXUA 5IMAA 1AC1A 2ZCTA 3HYPA 1AAZA 3OR5A 3CSHA 4N10A 4YAVA 2RUEA 4WR5A 4POMA 3H8QA 3F4SA 1X5CA 1VF3A 3GTUA 1GSUA 4IW9A 3TRPA 2WDUA 4KF9A 1OC9B 1T7PB 4TXOA 4IKHA 4Q5QA 1O6JA 4KE3A 4XS4B 4JBBA 1LBKA 3HJOA 5ECQB 2E0QA 3TGZA 1MTCA 5EVOA 3PPUA 6GSXA 2YZUA 1TK8B 1HNBA 1U87A 2YWNA 2YPMA 1XBSA 4ZB6A 1XVQA 1AXDA 4K8MA 4ML6A 3GURA 3ME7A 4FO5A 1XWBA 1YEPA 4MJEA 4HJMA 3KD0A 2H01A 1OKTA 3QAWA 3R3EA 1ML6A 4IJIA 3KJYA 3CSJA 4JR6A 3Q19A 2NBSA 1Z7RA 2LUSA 3U6VA 5AGYA 1R5AA 4NV2A 2H6XA 5G31A 2YJ7A 13GSA 3CSIA 1UN2A 4KAEA 1GTUA 1K0AA 3BCIA 1XOBA 1SK2A 3BCKA 2HZEA 2P5QA 4KCEA 5INYA 1K0CA 5CP1A 5ECOB 3GFKA 4OCEA 3ME8A 2DJ0A 4PNGA 5DJLA 5J9CA 4YQUA 4KSOA 1EV4A 3ZITA 2A2RA 4J2FA 1MDIA 3VI5A 2XPDA 4F9ZA 2WULA 1JZRA 1DSBA 1TRUA 2V2GA 4IGJA 1G6WA 1QMVA 4NV5A 4EE0A 5IO2A 3C1RA 4TKYA 3I6AA 4GSSA 2FY6A 5FWGA 4K1FA 3FZAA 2MMAA 2BTOT 3IHQA 1Z7PA 1F6MC 1GRXA 4TRXA 1OVNA 1HD2A 1ST9A 1FVJA 2FA8A 3CRUA 1EP7A 3DYRA 3M9KA 4BVXA 2J9HA 3FY7A 1A0FA 4N0VA 2K18A 3KZQA 2VL2A 3UAPA 3EU3A 4OD7A 2WFCA 2NPBA 4WBRD 4TR3A 3CMIA 2VUPA 3G9BA 1OE7A 1GLPA 2C80A 4PNFA 2TIRA 4XS6A 5A5KA 3DKSA 5G1KA 3EINA 1QFNA 1OAZA 3FR6A 1TI1A 2QGVA 2HLSA 3TKSC 3D6IA 4KH7A 2OBIA 4YQMA 1TU7A 2GQMA 5HQPA 3IA1A 2VCXA 5KN2A 1O85A 3C71A 2C3TA 4ZBBA 3M9JA 1GWCA 2C4JA 2DJJA 3FZ9A 3F6DA 3ZIVA 4ZL9A 4N11A 5KN1A 5C00A 5ECHB 5C04A 1GSEA 3GKKA 4G9HA 1EP8A 2B6MA 1SL0B 2TRXA 2IPAA 3H4KA 4EC0A 6GSSA 4GRFA 5J5NA 3M8NA 5E59A 4IBPA 1THOA 1ZL9A 4TR1A 2CQ9A 2H1BA 2R5GA 1DE1A 4DSSA 3IC8A 3TJFA 1SD8A 4KNDA 2DMMA 2AB6A 2G2QA 1V40A 2UZ8A 1I5GA 4K7IA 1M99A 2MYGA 3JCML 3GX0A 4PUFC 3WT2A 4JR4A 4HOJA 2V6KA 4KX4A 4NPBA 1K3YA 1GP1A 2HYXA 2O8VB 1VF2A 1VF4A 4IQAA 2DMLA 3WGXA 3LWAA 3UEMA 4PX1A 2EIRA 1PMTA 1WJKA 3FZ4A 4BWQA 2VCTA 3L9SA 1E6BA 3UIWA 2LJAA 3LJRA 5DDLA 5L71A 2B5EA 3QD9A 2PGTA 1TRSA 3F4RA 4PTSA 3WD6A 2FWGA 3IDVA 2H1AA 3H1NA 1T1VA 3HHVA 5ECLB 5ELAA 4RI6A 5IMFA 5IIZA 3A3TA 1T4ZA 1B9XC 3GKMA 2KP2A 4V1Ap 3QAVA 3QCPA 1XPVA 1EZKA 4MA9A 4GF0A 4GSNA 2NVLA 2LRTA 4ECIA 3RBTA 1TJDA 2GZZA 4YQVA 1AUCA 2OE0A 2H73A 2IMKA 5D96A 2J23A 4HEA2 4MP4A 1ZMAA 4QL7A 3Q6OA 2OACA 5AIVA 2L5LA 3A5WA 1T4YA 3V1WA 4HU7A 3WGEA 2O7KA 1GSSA 4JU5A 3IK9A 1FOVA 3EWLA 5H5QA 3Q18A 3TRQA 1R26A 4EUYA 1GSFA 2P31A 1E2YA 2H6YA 3CTGA 3MNGA 4WXTA 4LLRA 3IBHA 5J3RA 2L5OA 5D93A 2ZUPA 5DAKB 2IMFA 1SKRB 2OA7A 2ALBA 3ERFA 1Y6EA 2L59A 3D22A 1USBA 2I1UA 1J08A 5J9BA 4MZWA 2XBQA 2F9SA 4XIHA 1UA5A 2JZRA 3P8WA 1JZDA 1XWKA 2NTOA 4K7OA 2P0GA 2GSTA 3TDGA 4D73A 1GUKA 2DBCA 1EWXA 2F3MA 4K7NA 2FWEA 1F3BA 1M2BA 3ZFLA 1GTAA 4ULXA 5ID2A 3EMPA 4FIWA 1T8EB 2JL4A 4RQXA 2CZ2A 5EY6A 2H8LA 5AISA 4Q5RA 2HSNB 1THXA 5A4WA 2H71A 4ILFA 1GTBA 4WF5A 4MF6A 3FKFA 4V2NA 2JSZA 2KHPA 2R37A 1K0BA 1PX7A 1H75A 4PGTA 4ZB9A 2WS2A 4ZILA 1XWCA 3CBUA 5GZZB 4I6XA 2YWOA 2IFQA 1TW9A 2V1MA 3IK7A 4ECBA 2GT6A 3PH9A 4Q5NA 2KUCA 1U3IA 2HQTA 3UVHA 4NAXA 3KMNA 1K0OA 4ZXGA 4IP6A 4Q5FA 1K3LA 1EEJA 2R2JA 2VLVA 4MH3A 2AUVA 2GQKA 4KDUA 2LNSA 4KGIA 5DQSA 4L5OA 4NHWA 4MMMA 3PR8A 4EF0A 1Z5YE 3CXGA 2H0IA 1H4OA 2HSMA 3CYNA 4KSMA 1F37A 4H86A 2YV7A 1PL1A 3ZVJA 4L5LA 4MLYA 2X99A 2IMIA 2H19A 5J4UA 1KEBA 1BX9A 2YWIA 1WE0A 4MPFA 2N5AA 3QOUA 3LSZA 2LJRA 1BEDA 4X1UA 4WETA 1MEKA 5GAPD 3IPZA 3RAZA 4IJ3A 3HVSA 3IAS2 3ZTLA 4XRDA 1SYRA 1J9BA 1IYIA 3HZ8A 2WCIA 3IC4A 2QC7A 3C1SA 4CW9A 1XW6A 1VGLA 5B7CA 3IRAA 5D8IA 1ACVA 2G0FA 17GSA 3SBCA 4I2UA 4IS0A 3E9JB 2BMXA 2JZSA 1Y25A 4ZL8A 2HRKB 4OO4A 2HSHA 2E2MA 2GVPA 2B7KA 3FEUA 2EIQA 2WZ9A 4G0IA 3KEBA 1TTZA 2K8VA 3IAM2 2CV4A 2IIYA 4KB3A 2IJYA 3ZRDA 5DQYA 2MZCA 3GX8A 2PVOC 5CRDA 5JWQB 4PQIA 5HFGA 3RDWA 1Q98A 1T00A 4EL1A 1NHOA 4TR1B 1KBNA 4ZB8A 3U5RE 2HRFA 2K6VA 3GSTA 5ELGA 2K9FA 1YZXA 2PU9C 3HVXA 2F51A 5COHA 1OC3A 2CVKA 16GSA 4LL4B 2I3YA 3ERWA 3FHKA 2M46A 1BAYA 1XW9A 1QQ2A 1TK5B 1K0MA 5JCUA 1SJZA 3APSA 2CT6A 2AYTA 4BL7B 1R5PA 3GH9A 4FYCA 3Q74A 2FWHA 3UBKA 3TKSE 1B4PA 4LL1B 2O89A 1YDKA 1A2MA 3C8EA 3ZMKA 1SKSB 1A8YA 2NDOA 2FA4A 2DLXA 6GSTA 1S3CA 3I43A 2HRAA 5JCGA 5KN0A 3CTFA 1FAAA 2BJXA 2H66A 3GMFA 3MSZA 4EO3A 1EGOA 5DALB 3DMLA 2HXKA 4MJCA 2DJ3A 4NMUA 4MJBA 2ON7A 2GDRA 1NM3A 4POKA 1WP0A 4GWRA 1GNWA 4E8EA 2VL2C 4POLA 2B1LA 2PERA 3TRXA 4TR0A 1BG5A 2L4QA 1X9WB 2LS5A 3EMXA 5DCGA 1TRVA 3W8JA 3NIVA 3PGTA 5DVBA 4X43A 4PURA 1X5DA 4O5RA 4MJAA 3BJ5A 5IPHA 1GSDA 4ZBAA 1MD4A 3VK9A 3N9JA 2VL9A 3A2XA 2E2GA 5CAXA 2B7JA 5GAND 4E8HA 4HZ2A 4RUVA 3O6TA 1RK4A 1OC9A 3K8NA 3C7MA 1K0DA 1SENA 2H70A 4XS4A 3R2QA 1F3AA 1SKWB 3QR6A 3M1GA 1YQ1A 2DJ1A 4NHZA 3QDNA 1TU8A 2H6ZA 2CAQA 3UJ1A 5DBQA 5ECIB 3TKQA 3RPPA 2H1GA 3DVXA 3FW2A 3TCOA 3ZZXA 1XZOA 3EC3A 2VM1A 6GSUA 3I9V2 2DSAA 3AY8A 3F3RA 1URMA 3ZVJD 4AJ7A 3W6GA 4ZIJA 1MDJA 2H0HA 2O87A 2PBJA 1NW2A 2A4VA 2VCVA 3E0UA 1SJIA 2P5RA 3GKXA 3DGQA 5AIXA 3GYKA 1O81A 3M0FA 2VD1A 1G7EA 5G5EA 4EDYA 3BD2A 3P7XA
chains in the Genus database with same CATH superfamily
1PA3A 5BMUA 4XRAA 2YN1A 3APOA 3KXOA 5ECRB 3GA4A 2LSTA 5ABRA 4G0LA 2AV4A 2H72A 2WRTA 4BVYB 1SVLA 4J57E 1FG4A 3A2VA 3IV4A 1ERWA 4L0WA 3RGBC 4AJ8A 2IMDA 3HY2A 3DD3A 1M9AA 5G1LA 11GSA 4YH2A 2OJLA 4XHMA 4IHUA 3LYKA 5HFIA 1C72A 4GTUA 1DE2A 2C0FA 4MPGA 4RI7A 3F63A 4P3YB 3E3EA 3GL3A 2C3QA 4N3ZA 4O5UA 1GSQA 1GTIA 1JZOA 5D73A 3GNJA 4K0NA 3GN3A 2GSQA 2JU5A 2LV3A 3KH9A 1J0FA 8GSSA 1PKWA 1A8LA 2H76A 2HI7A 3GTUB 5G2ZA 2GLRA 1QXHA 2VLUA 3J7Yk 1GL8A 1U88A 2LTKA 4TN8A 4O7HA 1NSWA 1X0RA 4TXOB 3TKPA 5G5FA 4FYUA 3ZL5A 3A2WA 3IXRA 4CDOA 1OKDA 4MZCA 3FZ5A 3TU3B 3RPNA 3F3QA 4IN0A 2XC2A 18GSA 2Z9SA 1FVKA 4BPYA 1GLQA 4DEJA 2JACA 2R3XA 2A2SA 1R7HA 3D5JA 2LEGA 1SVMA 3L4NA 3HD5A 4DSQA 2YV9A 1Y1UA 3VWXA 2YOIA 1ZYPA 5LCZA 10GSA 1GH2A 2VCWA 1QK8A 4G2EA 1WPIA 3HXSA 5IMCA 4K9ZA 3VPTA 12GSA 4E68A 2IMEA 4AJ6A 2WVXB 5A1NB 5KOWA 4PI0C 1V9WA 1DUGA 3BBYA 1TOFA 3GRXA 3KGKA 6GSYA 4LMWA 1U6TA 5J41A 2I4AA 5KEJA 1SYXA 5CRHA 5EL8A 2WVYA 1XFLA 2OBKA 4KCAA 1BQ7A 5BRTA 4V1Ag 5LNKe 1PSQA 1RW1A 1XG8A 4ECCA 5A4UA 4F0CA 1W89A 1SK0A 2WVZA 3D0ZA 2JADA 4RQRA 2PMTA 1GSYA 4MF7A 2RM5A 2O36A 2HZEB 2LRCA 1JLVA 2C3NA 4GSTA 4F82A 5ECNB 5HR0A 1V2AA 1AQXA 2REMA 1ON4A 1AIUA 4G01A 2GZYA 4W66A 5ECMB 1GNEA 2I9HA 4ECJA 4I97A 4JZQA 4PQ1A 3TOUA 22GSA 1LU4A 4O92A 2EFHA 1TK0B 3KMOA 3L9UA 2OE3A 3HJPA 1G7OA 2HZFA 3N5OA 2PN8A 2DIYA 5F05A 1PD21 4GQFA 1Z3EA 4I5QA 5FHIA 1SJ6A 2C0EA 1CQGA 3D4TA 5J40A 4LA1A 2CVDA 1OC8A 4BVXB 3O3TA 5KOXA 5D9XA 5B6MA 1ERTA 4MH2A 2CX3A 3QFAC 2R4VA 3S9FA 5IOXA 3GH6A 4TOPA 2YNXA 1ZCPA 2O3EA 1UVZA 3TJBA 4X0XA 5CO3A 2LQQA 4WKWA 3VI7A 1PL2A 2H74A 2EC4A 4BA7A 4HDEA 2MBTA 2CX4A 3VURA 2C0DA 1XOAA 4ACSA 2GT5A 1XW5A 1M2DA 1O7UA 4OWYA 2R0CA 4TR4A 2PVQA 1PKZA 2MMZA 3F6FA 3FR9A 1MD3A 5F06A 2OE1A 3ZIJA 3QMXA 2QSIA 4K0GA 3WGDA 1EGRA 2N5FA 2V41A 3L9VA 4JEDA 5IMVA 1VF1A 2V6OA 3HJMA 4N0ZA 3LQ7A 4FYBA 1T3BA 2L4CA 2F8FA 1ZOFA 1B4QA 4PUAA 1BJXA 3SWLA 3D21A 4V2LA 3TJKA 5DJMA 4F2IA 4PQHA 1W4VA 4HJ2A 3TUEA 4I2TA 5DAKA 3H79A 4GQCA 4DSSB 1AW9A 2VM2A 1XWGA 3FK8A 1A2JA 2X49A 4AKXB 2QKEA 3EYTA 2OT3A 5IO0A 3KH7A 1GUHA 2X8HA 5A4VA 9GSSA 2VO4A 1FB0A 2VD0A 2L6DA 3QPMA 5GSTA 4O32A 1B48A 2LJKA 3UL3A 1WRYA 3ZFBA 1K0NA 1FOHA 3J7Yb 2VCZA 4HZ4A 1JZWA 3GIXA 3UOMA 4GCIA 1M2AA 5BMUB 5JWRB 3FYGA 2HSNA 4FH8A 2TRCP 3F8UA 1ILOA 4WR4A 3L0HA 3IE3A 2RUFA 4HQSA 3HDCA 1YKCA 2GS3A 1YF1A 3UVTA 1TXUA 1PRXA 3FR3A 3LYPA 4IQ1A 2X8GA 2L57A 1WWJA 4ISDA 4MZBA 1FO5A 4F0BA 3ISOA 1A24A 5F8BA 1WOUA 4AKGA 2AAWA 1GUMA 5D9VA 1FHEA 4GLTA 1SU9A 3P2AA 2FGXA 1ZYQB 3CHXC 4CHSA 1ABAA 2C8UA 3LEFA 3HCZA 5B6NA 2YJHA 3MAKA 1UC7A 4LMVA 1MDKA 2MMNA 3ZLPA 1QUWA 3W8SA 1V98A 3LG6A 1A0RP 2YANA 2MBSA 1OYJA 3TKRA 1ERVA 2HT9A 6GSVA 3US3A 4EDZA 2DC5A 4OMVA 2HE3A 4WF4A 4USSA 3FRCA 4MABA 1TP9A 2O85A 4KDXA 3D4MA 4MDCA 2H30A 3VFIA 1O73A 2WW3A 2FUG2 1V58A 3IOSA 1KNGA 1PX6A 1FW1A 1FB6A 3LXTA 2KP1A 1X9MB 4NXIA 4WBJA 1AQWA 4PHZC 1R4WA 1G0TA 4L0UA 1M9BA 1TRWA 5IM9A 2IWTA 5H5RA 5H5SA 19GSA 2OKAA 3NZNA 3APQA 1ZZYA 2ON5A 3GSSA 3TKSA 3TOTA 2GSRA 14GSA 3WT1A 2HRKA 2I81A 3VWWA 2IN3A 3DXBA 3QAGA 3HMJG 3MDKA 1JLWA 1YF0A 2H75A 4K5SA 3EURA 4OFNA 4D73B 4YKGA 1M0UA 2OADA 4DVCA 5AN1A 4KDYA 5CRGA 2LNTA 5IMZA 2XHFA 5ID2B 4ZL7A 3FMWA 1SL1B 1TI3A 5ENUA 2E7PA 4JRRA 5D9WA 3M3MA 3A5IA 4TXVA 2GQLA 2IL3A 1X9SB 1YJ6A 4YKFA 1RQMA 4WEYA 5FT3A 2C1YA 4L8EA 1BYEA 4I8BA 1XIYA 3F9UA 2AJQB 1WMJA 4ID0A 3RHBA 3KTBA 4HI7A 4OFTA 3KP9A 4Z2UA 2AHEA 4OCFA 3LGCA 3CRTA 2IFQB 3HKRA 4Z7XA 3EVIA 1XCCA 4BL7A 5CRWA 5CNWA 5IMDA 2GSSA 4KUNA 3F0IA 2FD3A 4G19A 3TB2A 3GKNA 4HSCX 1N8JA 2LKUA 5GSSA 4NWYA 1IYHA 1SK1A 4Z2TA 1O8WA 2EIOA 2CAIA 1B9YC 2YZHA 4G10A 3RHCA 1Z9HA 2N5BA 3HZ4A 2HSMB 2H1DA 1JHBA 5A34A 1KTEA 1TXXA 1AQVA 4YAPA 2RIIA 1K3OA 5DALA 1Z6MA 3DRNA 3KM6A 1Q4JA 3BOAA 2RM6A 1YY7A 3GUSA 2C0GA 3IHGA 4DSRA 1PN9A 1OE8A 3EPTA 2WJUA 1U3AA 5IQYA 3UARA 4ICYA 4N30A 3UBLA 3H93A 5HR3A 1NHYA 2HSYA 5CREA 3VWVA 1LJRA 1TDIA 3HVVA 3MWHA 3ZYWA 3DWVA 1HNCA 7GSSA 4G0KA 1EV9A 4IP1A 5HR1A 3LFLA 1F9MA 1QGVA 2VLTA 1SL2B 1PGTA 3G7IA 3EE2A 1GULA 4HU9A 4QMKA 2VL3A 3TJJA 2MMOA 2B1KA 1WIKA 4KA0A 3QFBC 3VLNA 2HFDA 3KIJA 5JCWA 2KOKA 3GV1A 4J56E 1CQHA 3KCMA 4EXJA 4F03A 4XTSA 2CVBA 2FWFA 3G7JA 2FCHA 4ZBDA 2R0GA 4HUAA 5J47A 3PINA 5B8AA 1PQNA 2FLSA 2WGRA 2V32A 2PPTA 2M72A 2L6CA 4BWSA 2D2ZA 2GZPA 4XCSA 5ECSA 1XVWA 1JFUA 1A2LA 2PWJA 1B8XA 1HQOA 1HYUA 1Z6NA 2H0GA 1S3AA 5EPFA 5HR2A 1O8XA 2R6KA 3LXZA 4PXOA 2M80A 3DEXA 3DIEA 2B5XA 6GSWA 5JWOB 1VRSD 5D9TA 4OO5A 1ERUA 5F07A 4FQUA 4AKHA 2YP6A 5DCHA 20GSA 3C73A 4K6XA 2X64A 3I69A 3L78A 2F8AA 4K2DA 2KLXA 4GXZA 5CYYA 2YCDA 2CA8A 2CZ3A 1YEXA 4QL9A 4TW5A 3WYWA 4AF2A 1A23A 3DVWA 4GDFA 4KW6A 5KN3A 1SD9A 2HNLA 1ZGNA 5ECPB 3ED3A 3VPQA 3VWUA 2HRNA 3IR4A 2RLIA 3HA9A 3O76A 5B8BA 2K8SA 2VIMA 4JE1A 2GTUA 2DJKA 2QA2A 2VCQA 3G7YA 1F2EA 5F0GA 5LD0A 3GHAA 4IVFA 2JZTA 2LQOA 3NOFA 1YKAA 1S3DA 4V2MA 2LRNA 3F4TA 1ZYEA 4HQZA 2B5YA 3LORA 4TVEA 3GL5A 2DIZA 3TJGA 4POBA 2YWMA 1HNAA 4OFMA 5HFKA 5ECKB 1XWAA 1I9DA 4EVMA 5E4WA 2GGTA 1N2AA 4BVYA 2ZNMA 3EU4A 1G6YA 1X5EA 2VAFA 2XPEA 5IPGA 3ZREA 1DBYA 4EKZA 3UMAA 2FNOA 2PUKC 1S3RA 5G30A 1TKDB 4K2XA 5J4YA 4IELA 5A5HB 2X8CA 2XBIA 3ZMLA 4AGSA 1M7TA 5IOWA 2ES7A 4MK3A 4MCUA 3KTLA 4QQ7A 4ML1A 4HS1A 2DJ2A 2WB9A 2B3SA 4XS1A 1EOGA 1M3IA 1EEMA 1EOHA 2VOCA 2FHEA 2JSYA 3KP8A 1V57A 4MF5A 3P90A 3ERGA 1XXUA 5IMAA 1AC1A 2ZCTA 3HYPA 4X4JA 1YVLA 1AAZA 3OR5A 3CSHA 4N10A 2H1LA 4YAVA 2RUEA 4WR5A 4POMA 3H8QA 3F4SA 1X5CA 1VF3A 3GTUA 1GSUA 4IW9A 3TRPA 1I1IP 2WDUA 4KF9A 1OC9B 1T7PB 4TXOA 4IKHA 4Q5QA 1O6JA 4KE3A 4XS4B 4JBBA 1LBKA 3HJOA 5ECQB 2E0QA 3TGZA 1MTCA 5EVOA 3PPUA 6GSXA 2YZUA 1TK8B 1HNBA 1U87A 2YWNA 2YPMA 1XBSA 4ZB6A 1XVQA 1AXDA 4K8MA 4ML6A 3GURA 3ME7A 4FO5A 1XWBA 1YEPA 4MJEA 4HJMA 3KD0A 2H01A 5A1NA 1OKTA 3QAWA 3R3EA 2WW0A 1ML6A 4IJIA 3KJYA 3CSJA 4JR6A 3Q19A 2NBSA 1Z7RA 2LUSA 1SVOA 3U6VA 5AGYA 1R5AA 4NV2A 2H6XA 5G31A 2YJ7A 13GSA 3CSIA 1UN2A 4KAEA 1GTUA 1K0AA 3BCIA 1XOBA 1SK2A 3BCKA 2HZEA 2P5QA 4KCEA 5INYA 1K0CA 5CP1A 5ECOB 3GFKA 4OCEA 3ME8A 2DJ0A 4PNGA 5DJLA 5J9CA 1YEWC 4YQUA 4KSOA 4K5RA 1EV4A 3ZITA 2A2RA 4J2FA 1MDIA 3VI5A 2XPDA 4F9ZA 2WULA 1JZRA 1ZYNA 1DSBA 1TRUA 2V2GA 3LW9A 4IGJA 1G6WA 1QMVA 4NV5A 4EE0A 5IO2A 3C1RA 4TKYA 3I6AA 4GSSA 2FY6A 5FWGA 4K1FA 3FZAA 2MMAA 2BTOT 3IHQA 1Z7PA 1F6MC 1GRXA 2DKIA 4TRXA 1OVNA 1HD2A 1ST9A 1FVJA 2FA8A 3CRUA 1EP7A 3DYRA 3M9KA 4BVXA 2J9HA 3FY7A 1A0FA 4N0VA 2K18A 3KZQA 2VL2A 3UAPA 3EU3A 4OD7A 2WFCA 2NPBA 4WBRD 4TR3A 3CMIA 2VUPA 3G9BA 3CWGA 1OE7A 1GLPA 2C80A 4PNFA 2TIRA 4XS6A 5A5KA 3DKSA 5G1KA 3EINA 1QFNA 1OAZA 3FR6A 1TI1A 2QGVA 2HLSA 3TKSC 3D6IA 4KH7A 2OBIA 4YQMA 1TU7A 2GQMA 5HQPA 2DKHA 2VCXA 3IA1A 5KN2A 1O85A 2WW2A 4EIQA 4A5PA 3C71A 2C3TA 4ZBBA 1GWCA 3M9JA 2C4JA 2DJJA 3FZ9A 3F6DA 3ZIVA 4ZL9A 4N11A 5KN1A 5C00A 5ECHB 5C04A 1GSEA 3GKKA 4G9HA 1EP8A 2B6MA 1SL0B 2TRXA 2IPAA 3H4KA 4EC0A 3MYDA 6GSSA 4GRFA 1PN0A 5J5NA 3M8NA 2EFEA 5E59A 4IBPA 1THOA 1ZL9A 4TR1A 2CQ9A 2H1BA 2R5GA 1DE1A 4DSSA 3IC8A 3TJFA 1SD8A 4KNDA 2DMMA 2AB6A 2G2QA 1V40A 2UZ8A 1I5GA 4K7IA 1M99A 2MYGA 3JCML 3GX0A 4PUFC 3WT2A 4JR4A 4HOJA 2V6KA 4KX4A 4NPBA 1K3YA 1GP1A 2HYXA 2O8VB 1VF2A 1VF4A 4IQAA 2DMLA 3WGXA 3LWAA 3UEMA 4PX1A 2EIRA 1PMTA 1WJKA 3FZ4A 4BWQA 2VCTA 3L9SA 1E6BA 3UIWA 2LJAA 3LJRA 5DDLA 5L71A 2B5EA 3QD9A 2PGTA 1TRSA 3F4RA 4PTSA 3WD6A 2FWGA 3IDVA 2H1AA 3H1NA 1T1VA 3HHVA 5ECLB 5ELAA 4RI6A 5IMFA 5IIZA 3A3TA 1T4ZA 1B9XC 3GKMA 2KP2A 4V1Ap 1S4BP 3QAVA 3QCPA 1XPVA 1EZKA 4MA9A 4GF0A 4CY8A 4GSNA 2NVLA 2LRTA 4ECIA 3RBTA 1TJDA 2GZZA 4YQVA 1AUCA 2OE0A 2H73A 2IMKA 5D96A 2J23A 4HEA2 4MP4A 1ZMAA 4QL7A 3Q6OA 2UV8G 2OACA 5AIVA 2L5LA 3A5WA 1T4YA 3V1WA 4HU7A 3WGEA 2O7KA 1GSSA 4JU5A 2EFCA 3IK9A 1FOVA 3EWLA 5H5QA 3Q18A 3TRQA 1R26A 4EUYA 1GSFA 2P31A 1E2YA 2QA1A 2H6YA 3CTGA 3MNGA 4WXTA 4LLRA 3IBHA 5J3RA 2L5OA 5D93A 2ZUPA 5DAKB 2IMFA 1SKRB 2OA7A 2ALBA 3ERFA 1Y6EA 2L59A 3D22A 1USBA 2I1UA 1J08A 5J9BA 4MZWA 2XBQA 2F9SA 4XIHA 1UA5A 2JZRA 3P8WA 1JZDA 1XWKA 2NTOA 2WW1A 4K7OA 4CY6A 2P0GA 2GSTA 3TDGA 4D73A 2O5VA 1GUKA 2DBCA 1EWXA 2F3MA 4K7NA 2FWEA 1F3BA 1M2BA 3ZFLA 1GTAA 4ULXA 5ID2A 3EMPA 4AI6A 4FIWA 1T8EB 2JL4A 4RQXA 2CZ2A 5EY6A 2H8LA 5AISA 4Q5RA 2HSNB 1THXA 5A4WA 2H71A 4ILFA 1GTBA 4WF5A 4MF6A 4O5QA 3FKFA 4V2NA 2JSZA 2KHPA 2R37A 1K0BA 1PX7A 1H75A 4PGTA 4ZB9A 2WS2A 4ZILA 1XWCA 3HVNA 3CBUA 5GZZB 4I6XA 2R0PA 2YWOA 2IFQA 1TW9A 2V1MA 3IK7A 4ECBA 2GT6A 3PH9A 4Q5NA 2KUCA 1U3IA 2HQTA 4ZB7A 3UVHA 4NAXA 3KMNA 1K0OA 4ZXGA 4IP6A 4Q5FA 1K3LA 1EEJA 2R2JA 2VLVA 4MH3A 2AUVA 2GQKA 4KDUA 2LNSA 4KGIA 5DQSA 4L5OA 4NHWA 4MMMA 3PR8A 4EF0A 1Z5YE 3CXGA 2H0IA 1H4OA 2HSMA 3CYNA 4KSMA 1F37A 4H86A 2YV7A 1PL1A 3ZVJA 4L5LA 4MLYA 2X99A 2IMIA 5J4VA 2H19A 5J4UA 1KEBA 1BX9A 2YWIA 1WE0A 4MPFA 2N5AA 3QOUA 3LSZA 2LJRA 1BEDA 4X1UA 4WETA 4FXYP 1MEKA 5GAPD 3IPZA 3RAZA 4IJ3A 3HVSA 3IAS2 3ZTLA 4XRDA 1SYRA 1J9BA 1IYIA 3HZ8A 2WCIA 4EIPA 3IC4A 2QC7A 3C1SA 4CW9A 1PFOA 1XW6A 1VGLA 5B7CA 3IRAA 5D8IA 3CQFA 1ACVA 2G0FA 2A2PA 17GSA 3SBCA 1N25A 4I2UA 4IS0A 3E9JB 2BMXA 2JZSA 1Y25A 4ZL8A 2HRKB 4OO4A 2HSHA 2E2MA 2GVPA 2B7KA 3FEUA 2EIQA 2WZ9A 4G0IA 3KEBA 1TTZA 2K8VA 3IAM2 2CV4A 2IIYA 4KB3A 2IJYA 3ZRDA 2WVXA 5DQYA 1BG1A 2MZCA 3GX8A 2PVOC 5CRDA 5JWQB 4PQIA 5HFGA 3RDWA 1Q98A 1T00A 4EL1A 1NHOA 4TR1B 1KBNA 4ZB8A 1M3JA 3U5RE 1BF5A 2HRFA 2K6VA 3GSTA 5ELGA 2K9FA 1YZXA 2PU9C 3HVXA 2F51A 5COHA 1OC3A 2CVKA 16GSA 4LL4B 2I3YA 3ERWA 3FHKA 2M46A 1BAYA 1XW9A 1QQ2A 1TK5B 1K0MA 5JCUA 1SJZA 3APSA 2CT6A 2AYTA 4BL7B 1R5PA 3GH9A 4FYCA 3Q74A 2FWHA 2A4HA 3UBKA 3TKSE 1B4PA 4LL1B 2O89A 1YDKA 1A2MA 3C8EA 3ZMKA 1SKSB 1A8YA 2NDOA 2FA4A 2DLXA 6GSTA 1S3CA 3I43A 2HRAA 5JCGA 5A34B 5KN0A 3CTFA 1FAAA 2BJXA 2H66A 3GMFA 3MSZA 4EO3A 1EGOA 5DALB 3DMLA 2HXKA 4MJCA 2DJ3A 4NMUA 4MJBA 2ON7A 2GDRA 1NM3A 4POKA 1WP0A 4GWRA 4Z2RA 1GNWA 4E8EA 2VL2C 4POLA 2B1LA 2PERA 3TRXA 4TR0A 1BG5A 5A5HA 2L4QA 1X9WB 2EFDA 2LS5A 3EMXA 5DCGA 3RFRC 1TRVA 3W8JA 3NIVA 3PGTA 5DVBA 4X43A 4PURA 1X5DA 4O5RA 4MJAA 3BJ5A 5IPHA 1GSDA 4ZBAA 1MD4A 3VK9A 3N9JA 2VL9A 3A2XA 2E2GA 5CAXA 2B7JA 5GAND 3MIXA 4PI2C 4E8HA 4HZ2A 4RUVA 1RK4A 1OC9A 3O6TA 3K8NA 3C7MA 1K0DA 1SENA 2H70A 4XS4A 3R2QA 1F3AA 2WZSA 1SKWB 3QR6A 3M1GA 1YQ1A 2DJ1A 4NHZA 3QDNA 1TU8A 2H6ZA 2CAQA 3UJ1A 5DBQA 5ECIB 3TKQA 3RPPA 2H1GA 3DVXA 3FW2A 3TCOA 3ZZXA 1XZOA 3EC3A 2VM1A 6GSUA 3I9V2 2DSAA 3AY8A 4BIKA 3F3RA 1URMA 2X4AA 3ZVJD 4AKIA 4MNNA 4AJ7A 3W6GA 4ZIJA 1MDJA 2H0HA 2O87A 2PBJA 2VKZG 1NW2A 2A4VA 2VCVA 3E0UA 1SJIA 2P5RA 3GKXA 3DGQA 5AIXA 3GYKA 1O81A 3M0FA 2VD1A 1G7EA 5G5EA 4EDYA 3BD2A 3P7XA
chains in the Genus database with same CATH topology
1PA3A 5BMUA 4XRAA 2YN1A 3APOA 3KXOA 5ECRB 3GA4A 2LSTA 5ABRA 4G0LA 2AV4A 2H72A 2WRTA 4BVYB 1SVLA 4J57E 1FG4A 3A2VA 3IV4A 1ERWA 4L0WA 4AJ8A 2IMDA 3HY2A 3DD3A 1M9AA 5G1LA 11GSA 4YH2A 2OJLA 4XHMA 4IHUA 3LYKA 5HFIA 1C72A 4GTUA 1DE2A 2C0FA 4MPGA 4RI7A 3F63A 4P3YB 3E3EA 3GL3A 2C3QA 4N3ZA 4O5UA 1GSQA 1GTIA 1JZOA 5D73A 3GNJA 4K0NA 3GN3A 2GSQA 2JU5A 2LV3A 3KH9A 1J0FA 8GSSA 1PKWA 1A8LA 2H76A 2HI7A 3GTUB 5G2ZA 2GLRA 1QXHA 2VLUA 3J7Yk 1GL8A 1U88A 2LTKA 4TN8A 4O7HA 1NSWA 1X0RA 4TXOB 3TKPA 5G5FA 4FYUA 3ZL5A 3A2WA 3IXRA 4CDOA 1OKDA 4MZCA 3FZ5A 3TU3B 3RPNA 3F3QA 4IN0A 2XC2A 18GSA 2Z9SA 1FVKA 4BPYA 1GLQA 4DEJA 2JACA 2R3XA 2A2SA 1R7HA 3D5JA 2LEGA 1SVMA 3L4NA 3HD5A 4DSQA 2YV9A 1Y1UA 3VWXA 2YOIA 1ZYPA 5LCZA 10GSA 1GH2A 2VCWA 1QK8A 4G2EA 1WPIA 3HXSA 5IMCA 4K9ZA 3VPTA 12GSA 4E68A 2IMEA 4AJ6A 5A1NB 5KOWA 1V9WA 1DUGA 3BBYA 1TOFA 3GRXA 3KGKA 6GSYA 4LMWA 1U6TA 5J41A 2I4AA 5KEJA 1SYXA 5CRHA 5EL8A 1XFLA 2OBKA 4KCAA 5BRTA 1BQ7A 4V1Ag 5LNKe 1PSQA 1RW1A 4ECCA 5A4UA 4F0CA 1W89A 1SK0A 3D0ZA 2JADA 4RQRA 2PMTA 1GSYA 4MF7A 2RM5A 2HZEB 2LRCA 1JLVA 2C3NA 4GSTA 4F82A 5ECNB 5HR0A 1V2AA 1AQXA 2REMA 1ON4A 1AIUA 4G01A 2GZYA 4W66A 5ECMB 1GNEA 2I9HA 4ECJA 4I97A 4JZQA 4PQ1A 3TOUA 22GSA 1LU4A 4O92A 2EFHA 1TK0B 3KMOA 3L9UA 2OE3A 3HJPA 1G7OA 2HZFA 3N5OA 2PN8A 2DIYA 5F05A 1PD21 4GQFA 1Z3EA 4I5QA 5FHIA 1SJ6A 2C0EA 1CQGA 3D4TA 5J40A 4LA1A 2CVDA 1OC8A 4BVXB 3O3TA 5KOXA 5D9XA 5B6MA 1ERTA 4MH2A 2CX3A 3QFAC 2R4VA 3S9FA 5IOXA 3GH6A 4TOPA 2YNXA 1ZCPA 1UVZA 3TJBA 4X0XA 5CO3A 2LQQA 4WKWA 3VI7A 1PL2A 2H74A 2EC4A 4BA7A 4HDEA 2MBTA 2CX4A 3VURA 2C0DA 1XOAA 4ACSA 2GT5A 1XW5A 1M2DA 1O7UA 4OWYA 2R0CA 4TR4A 2PVQA 1PKZA 2MMZA 3F6FA 3FR9A 1MD3A 5F06A 2OE1A 3ZIJA 3QMXA 2QSIA 4K0GA 3WGDA 1EGRA 2N5FA 2V41A 3L9VA 4JEDA 5IMVA 1VF1A 2V6OA 3HJMA 4N0ZA 3LQ7A 4FYBA 1T3BA 2L4CA 2F8FA 1ZOFA 1B4QA 4PUAA 1BJXA 3SWLA 3D21A 4V2LA 3TJKA 5DJMA 4F2IA 4PQHA 1W4VA 4HJ2A 3TUEA 4I2TA 5DAKA 3H79A 4GQCA 4DSSB 1AW9A 2VM2A 1XWGA 3FK8A 1A2JA 2X49A 4AKXB 2QKEA 3EYTA 2OT3A 5IO0A 3KH7A 1GUHA 2X8HA 5A4VA 9GSSA 2VO4A 1FB0A 2VD0A 2L6DA 3QPMA 5GSTA 4O32A 1B48A 2LJKA 3UL3A 1WRYA 3ZFBA 1K0NA 1FOHA 3J7Yb 2VCZA 4HZ4A 1JZWA 3GIXA 3UOMA 4GCIA 1M2AA 5BMUB 5JWRB 3FYGA 2HSNA 4FH8A 2TRCP 3F8UA 1ILOA 4WR4A 3L0HA 3IE3A 2RUFA 4HQSA 3HDCA 1YKCA 2GS3A 1YF1A 3UVTA 1TXUA 1PRXA 3FR3A 3LYPA 4IQ1A 2X8GA 2L57A 1WWJA 4ISDA 4MZBA 1FO5A 4F0BA 3ISOA 1A24A 5F8BA 1WOUA 4AKGA 2AAWA 1GUMA 5D9VA 1FHEA 4GLTA 1SU9A 3P2AA 2FGXA 1ZYQB 4CHSA 1ABAA 2C8UA 3LEFA 3HCZA 5B6NA 2YJHA 3MAKA 1UC7A 4LMVA 1MDKA 2MMNA 3ZLPA 1QUWA 3W8SA 1V98A 3LG6A 1A0RP 2YANA 2MBSA 1OYJA 3TKRA 1ERVA 2HT9A 6GSVA 3US3A 4EDZA 2DC5A 4OMVA 2HE3A 4WF4A 4USSA 3FRCA 4MABA 1TP9A 2O85A 4KDXA 3D4MA 4MDCA 2H30A 3VFIA 1O73A 2FUG2 1V58A 3IOSA 1KNGA 1PX6A 1FW1A 1FB6A 3LXTA 2KP1A 1X9MB 4NXIA 4WBJA 1AQWA 1R4WA 1G0TA 4L0UA 1M9BA 1TRWA 5IM9A 2IWTA 5H5RA 5H5SA 19GSA 2OKAA 3NZNA 3APQA 1ZZYA 2ON5A 3GSSA 3TKSA 3TOTA 2GSRA 14GSA 3WT1A 2HRKA 2I81A 3VWWA 2IN3A 3DXBA 3QAGA 3HMJG 3MDKA 1JLWA 1YF0A 2H75A 4K5SA 3EURA 4OFNA 4D73B 4YKGA 1M0UA 2OADA 4DVCA 5AN1A 4KDYA 5CRGA 2LNTA 5IMZA 2XHFA 5ID2B 4ZL7A 3FMWA 1SL1B 1TI3A 5ENUA 2E7PA 4JRRA 5D9WA 3M3MA 3A5IA 4TXVA 2GQLA 2IL3A 1X9SB 1YJ6A 4YKFA 1RQMA 4WEYA 5FT3A 2C1YA 4L8EA 1BYEA 4I8BA 1XIYA 3F9UA 2AJQB 1WMJA 4ID0A 3RHBA 3KTBA 4HI7A 4OFTA 3KP9A 4Z2UA 2AHEA 4OCFA 3LGCA 3CRTA 2IFQB 3HKRA 4Z7XA 3EVIA 1XCCA 4BL7A 5CRWA 5CNWA 5IMDA 2GSSA 4KUNA 3F0IA 2FD3A 4G19A 3TB2A 3GKNA 1N8JA 2LKUA 5GSSA 4NWYA 1IYHA 1SK1A 4Z2TA 1O8WA 2EIOA 2CAIA 1B9YC 2YZHA 4G10A 3RHCA 1Z9HA 2N5BA 3HZ4A 2HSMB 2H1DA 1JHBA 5A34A 1KTEA 1TXXA 1AQVA 4YAPA 2RIIA 1K3OA 5DALA 1Z6MA 3DRNA 3KM6A 1Q4JA 3BOAA 2RM6A 1YY7A 3GUSA 2C0GA 3IHGA 4DSRA 1PN9A 1OE8A 3EPTA 2WJUA 1U3AA 5IQYA 3UARA 4ICYA 4N30A 3UBLA 3H93A 5HR3A 1NHYA 2HSYA 5CREA 3VWVA 1LJRA 1TDIA 3HVVA 3MWHA 3ZYWA 3DWVA 1HNCA 7GSSA 4G0KA 1EV9A 4IP1A 5HR1A 3LFLA 1F9MA 1QGVA 2VLTA 1SL2B 1PGTA 3G7IA 3EE2A 1GULA 4HU9A 4QMKA 2VL3A 3TJJA 2MMOA 2B1KA 1WIKA 4KA0A 3QFBC 3VLNA 2HFDA 3KIJA 5JCWA 2KOKA 3GV1A 4J56E 1CQHA 3KCMA 4EXJA 4F03A 4XTSA 2CVBA 2FWFA 3G7JA 2FCHA 4ZBDA 2R0GA 4HUAA 5J47A 3PINA 5B8AA 1PQNA 2FLSA 2WGRA 2V32A 2PPTA 2M72A 2L6CA 4BWSA 2D2ZA 2GZPA 4XCSA 5ECSA 1XVWA 1JFUA 1A2LA 2PWJA 1B8XA 1HQOA 1HYUA 1Z6NA 2H0GA 1S3AA 5EPFA 5HR2A 1O8XA 2R6KA 3LXZA 4PXOA 2M80A 3DEXA 3DIEA 2B5XA 6GSWA 5JWOB 1VRSD 5D9TA 4OO5A 1ERUA 5F07A 4FQUA 4AKHA 2YP6A 5DCHA 20GSA 3C73A 4K6XA 2X64A 3I69A 3L78A 2F8AA 4K2DA 2KLXA 4GXZA 5CYYA 2YCDA 2CA8A 2CZ3A 1YEXA 4QL9A 4TW5A 3WYWA 4AF2A 1A23A 3DVWA 4GDFA 4KW6A 5KN3A 1SD9A 2HNLA 1ZGNA 5ECPB 3ED3A 3VPQA 3VWUA 2HRNA 3IR4A 2RLIA 3HA9A 3O76A 5B8BA 2K8SA 2VIMA 4JE1A 2GTUA 2DJKA 2QA2A 2VCQA 3G7YA 1F2EA 5F0GA 5LD0A 3GHAA 4IVFA 2JZTA 2LQOA 3NOFA 1YKAA 1S3DA 4V2MA 2LRNA 3F4TA 1ZYEA 4HQZA 2B5YA 3LORA 4TVEA 3GL5A 2DIZA 3TJGA 4POBA 2YWMA 1HNAA 4OFMA 5HFKA 5ECKB 1XWAA 1I9DA 4EVMA 5E4WA 2GGTA 1N2AA 4BVYA 2ZNMA 3EU4A 1G6YA 1X5EA 2VAFA 2XPEA 5IPGA 3ZREA 1DBYA 4EKZA 3UMAA 2FNOA 2PUKC 5G30A 1TKDB 4K2XA 5J4YA 4IELA 5A5HB 2X8CA 2XBIA 3ZMLA 4AGSA 1M7TA 5IOWA 2ES7A 4MK3A 4MCUA 3KTLA 4QQ7A 4ML1A 4HS1A 2DJ2A 2WB9A 2B3SA 4XS1A 1EOGA 1EEMA 1EOHA 2VOCA 2FHEA 2JSYA 3KP8A 1V57A 4MF5A 3P90A 3ERGA 1XXUA 5IMAA 1AC1A 2ZCTA 3HYPA 4X4JA 1YVLA 1AAZA 3OR5A 3CSHA 4N10A 2H1LA 4YAVA 2RUEA 4WR5A 4POMA 3H8QA 3F4SA 1X5CA 1VF3A 3GTUA 1GSUA 4IW9A 3TRPA 2WDUA 4KF9A 1OC9B 1T7PB 4TXOA 4IKHA 4Q5QA 1O6JA 4KE3A 4XS4B 4JBBA 1LBKA 3HJOA 5ECQB 2E0QA 3TGZA 1MTCA 5EVOA 3PPUA 6GSXA 2YZUA 1TK8B 1HNBA 1U87A 2YWNA 2YPMA 1XBSA 4ZB6A 1XVQA 1AXDA 4K8MA 4ML6A 3GURA 3ME7A 4FO5A 1XWBA 1YEPA 4MJEA 4HJMA 3KD0A 2H01A 5A1NA 1OKTA 3QAWA 3R3EA 1ML6A 4IJIA 3KJYA 3CSJA 4JR6A 3Q19A 2NBSA 1Z7RA 2LUSA 1SVOA 3U6VA 5AGYA 1R5AA 4NV2A 2H6XA 5G31A 2YJ7A 13GSA 3CSIA 1UN2A 4KAEA 1GTUA 1K0AA 3BCIA 1XOBA 1SK2A 3BCKA 2HZEA 2P5QA 4KCEA 5INYA 1K0CA 5CP1A 5ECOB 3GFKA 4OCEA 3ME8A 2DJ0A 4PNGA 5DJLA 5J9CA 4YQUA 4KSOA 4K5RA 1EV4A 3ZITA 2A2RA 4J2FA 1MDIA 3VI5A 2XPDA 4F9ZA 2WULA 1JZRA 1ZYNA 1DSBA 1TRUA 2V2GA 3LW9A 4IGJA 1G6WA 1QMVA 4NV5A 4EE0A 5IO2A 3C1RA 4TKYA 3I6AA 4GSSA 2FY6A 5FWGA 4K1FA 3FZAA 2MMAA 2BTOT 3IHQA 1Z7PA 1F6MC 1GRXA 2DKIA 4TRXA 1OVNA 1HD2A 1ST9A 1FVJA 2FA8A 3CRUA 1EP7A 3DYRA 3M9KA 4BVXA 2J9HA 3FY7A 1A0FA 4N0VA 2K18A 3KZQA 2VL2A 3UAPA 3EU3A 4OD7A 2WFCA 2NPBA 4WBRD 4TR3A 3CMIA 2VUPA 3G9BA 3CWGA 1OE7A 1GLPA 2C80A 4PNFA 2TIRA 4XS6A 5A5KA 3DKSA 5G1KA 3EINA 1QFNA 1OAZA 3FR6A 1TI1A 2QGVA 2HLSA 3TKSC 3D6IA 4KH7A 2OBIA 4YQMA 1TU7A 2GQMA 5HQPA 2DKHA 2VCXA 3IA1A 5KN2A 1O85A 4EIQA 4A5PA 3C71A 2C3TA 4ZBBA 3M9JA 1GWCA 2C4JA 2DJJA 3FZ9A 3F6DA 3ZIVA 4ZL9A 4N11A 5KN1A 5C00A 5ECHB 5C04A 1GSEA 3GKKA 4G9HA 1EP8A 2B6MA 1SL0B 2TRXA 2IPAA 3H4KA 4EC0A 3MYDA 6GSSA 4GRFA 1PN0A 5J5NA 3M8NA 2EFEA 5E59A 4IBPA 1THOA 1ZL9A 4TR1A 2CQ9A 2H1BA 2R5GA 1DE1A 4DSSA 3IC8A 3TJFA 1SD8A 4KNDA 2DMMA 2AB6A 2G2QA 1V40A 2UZ8A 1I5GA 4K7IA 1M99A 2MYGA 3JCML 3GX0A 4PUFC 3WT2A 4JR4A 4HOJA 2V6KA 4KX4A 4NPBA 1K3YA 1GP1A 2HYXA 2O8VB 1VF2A 1VF4A 4IQAA 2DMLA 3WGXA 3LWAA 3UEMA 4PX1A 2EIRA 1PMTA 1WJKA 3FZ4A 4BWQA 2VCTA 3L9SA 1E6BA 3UIWA 2LJAA 3LJRA 5DDLA 5L71A 2B5EA 3QD9A 2PGTA 1TRSA 3F4RA 4PTSA 3WD6A 2FWGA 3IDVA 2H1AA 3H1NA 1T1VA 3HHVA 5ECLB 5ELAA 4RI6A 5IMFA 5IIZA 3A3TA 1T4ZA 1B9XC 3GKMA 2KP2A 4V1Ap 3QAVA 3QCPA 1XPVA 1EZKA 4MA9A 4GF0A 4CY8A 4GSNA 2NVLA 2LRTA 4ECIA 3RBTA 1TJDA 2GZZA 4YQVA 1AUCA 2OE0A 2H73A 2IMKA 5D96A 2J23A 4HEA2 4MP4A 1ZMAA 4QL7A 3Q6OA 2UV8G 2OACA 5AIVA 2L5LA 3A5WA 1T4YA 3V1WA 4HU7A 3WGEA 2O7KA 1GSSA 4JU5A 2EFCA 3IK9A 1FOVA 3EWLA 5H5QA 3Q18A 3TRQA 1R26A 4EUYA 1GSFA 2P31A 1E2YA 2QA1A 2H6YA 3CTGA 3MNGA 4WXTA 4LLRA 3IBHA 5J3RA 2L5OA 5D93A 2ZUPA 5DAKB 2IMFA 1SKRB 2OA7A 2ALBA 3ERFA 1Y6EA 2L59A 3D22A 1USBA 2I1UA 1J08A 5J9BA 4MZWA 2XBQA 2F9SA 4XIHA 1UA5A 2JZRA 3P8WA 1JZDA 1XWKA 2NTOA 4K7OA 4CY6A 2P0GA 2GSTA 3TDGA 4D73A 2O5VA 1GUKA 2DBCA 1EWXA 2F3MA 4K7NA 2FWEA 1F3BA 1M2BA 3ZFLA 1GTAA 4ULXA 5ID2A 3EMPA 4AI6A 4FIWA 1T8EB 2JL4A 4RQXA 2CZ2A 5EY6A 2H8LA 5AISA 4Q5RA 2HSNB 1THXA 5A4WA 2H71A 4ILFA 1GTBA 4WF5A 4MF6A 4O5QA 3FKFA 4V2NA 2JSZA 2KHPA 2R37A 1K0BA 1PX7A 1H75A 4PGTA 4ZB9A 2WS2A 4ZILA 1XWCA 3CBUA 5GZZB 4I6XA 2R0PA 2YWOA 2IFQA 1TW9A 2V1MA 3IK7A 4ECBA 2GT6A 3PH9A 4Q5NA 2KUCA 1U3IA 2HQTA 4ZB7A 3UVHA 4NAXA 3KMNA 1K0OA 4ZXGA 4IP6A 4Q5FA 1K3LA 1EEJA 2R2JA 2VLVA 4MH3A 2AUVA 2GQKA 4KDUA 2LNSA 4KGIA 5DQSA 4L5OA 4NHWA 4MMMA 3PR8A 4EF0A 1Z5YE 3CXGA 2H0IA 1H4OA 2HSMA 3CYNA 4KSMA 1F37A 4H86A 2YV7A 1PL1A 3ZVJA 4L5LA 4MLYA 2X99A 2IMIA 5J4VA 2H19A 5J4UA 1KEBA 1BX9A 2YWIA 1WE0A 4MPFA 2N5AA 3QOUA 3LSZA 2LJRA 1BEDA 4X1UA 4WETA 1MEKA 5GAPD 3IPZA 3RAZA 4IJ3A 3HVSA 3IAS2 3ZTLA 4XRDA 1SYRA 1J9BA 1IYIA 3HZ8A 2WCIA 4EIPA 3IC4A 2QC7A 3C1SA 4CW9A 1XW6A 1VGLA 5B7CA 3IRAA 5D8IA 1ACVA 2G0FA 2A2PA 17GSA 3SBCA 1N25A 4I2UA 4IS0A 3E9JB 2BMXA 2JZSA 1Y25A 4ZL8A 2HRKB 4OO4A 2HSHA 2E2MA 2GVPA 2B7KA 3FEUA 2EIQA 2WZ9A 4G0IA 3KEBA 1TTZA 2K8VA 3IAM2 2CV4A 2IIYA 4KB3A 2IJYA 3ZRDA 5DQYA 1BG1A 2MZCA 3GX8A 2PVOC 5CRDA 5JWQB 4PQIA 5HFGA 3RDWA 1Q98A 1T00A 4EL1A 1NHOA 4TR1B 1KBNA 4ZB8A 3U5RE 1BF5A 2HRFA 2K6VA 3GSTA 5ELGA 2K9FA 1YZXA 2PU9C 3HVXA 2F51A 5COHA 1OC3A 2CVKA 16GSA 4LL4B 2I3YA 3ERWA 3FHKA 2M46A 1BAYA 1XW9A 1QQ2A 1TK5B 1K0MA 5JCUA 1SJZA 3APSA 2CT6A 2AYTA 4BL7B 1R5PA 3GH9A 4FYCA 3Q74A 2FWHA 2A4HA 3UBKA 3TKSE 1B4PA 4LL1B 2O89A 1YDKA 1A2MA 3C8EA 3ZMKA 1SKSB 1A8YA 2NDOA 2FA4A 2DLXA 6GSTA 1S3CA 3I43A 2HRAA 5JCGA 5A34B 5KN0A 3CTFA 1FAAA 2BJXA 2H66A 3GMFA 3MSZA 4EO3A 1EGOA 5DALB 3DMLA 2HXKA 4MJCA 2DJ3A 4NMUA 4MJBA 2ON7A 2GDRA 1NM3A 4POKA 1WP0A 4GWRA 4Z2RA 1GNWA 4E8EA 2VL2C 4POLA 2B1LA 2PERA 3TRXA 4TR0A 1BG5A 5A5HA 2L4QA 1X9WB 2EFDA 2LS5A 3EMXA 5DCGA 1TRVA 3W8JA 3NIVA 3PGTA 5DVBA 4X43A 4PURA 1X5DA 4O5RA 4MJAA 3BJ5A 5IPHA 1GSDA 4ZBAA 1MD4A 3VK9A 3N9JA 2VL9A 3A2XA 2E2GA 5CAXA 2B7JA 5GAND 3MIXA 4E8HA 4HZ2A 4RUVA 1RK4A 1OC9A 3O6TA 3K8NA 3C7MA 1K0DA 1SENA 2H70A 4XS4A 3R2QA 1F3AA 1SKWB 3QR6A 3M1GA 1YQ1A 2DJ1A 4NHZA 3QDNA 1TU8A 2H6ZA 2CAQA 3UJ1A 5DBQA 5ECIB 3TKQA 3RPPA 2H1GA 3DVXA 3FW2A 3TCOA 3ZZXA 1XZOA 3EC3A 2VM1A 6GSUA 3I9V2 2DSAA 3AY8A 3F3RA 1URMA 2X4AA 3ZVJD 4AKIA 4MNNA 4AJ7A 3W6GA 4ZIJA 1MDJA 2H0HA 2O87A 2PBJA 2VKZG 1NW2A 2A4VA 2VCVA 3E0UA 1SJIA 2P5RA 3GKXA 3DGQA 5AIXA 3GYKA 1O81A 3M0FA 2VD1A 1G7EA 5G5EA 4EDYA 3BD2A 3P7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA3 A;  5BMU A;  4XRA A;  2YN1 A;  3APO A;  3KXO A;  5ECR B;  3GA4 A;  2LST A;  5ABR A;  4G0L A;  2AV4 A;  2H72 A;  2WRT A;  4BVY B;  4J57 E;  1FG4 A;  3A2V A;  3IV4 A;  1ERW A;  4L0W A;  4AJ8 A;  2IMD A;  3HY2 A;  3DD3 A;  1M9A A;  5G1L A;  11GS A;  4YH2 A;  2OJL A;  4XHM A;  4IHU A;  3LYK A;  5HFI A;  1C72 A;  4GTU A;  1DE2 A;  2C0F A;  4MPG A;  4RI7 A;  3F63 A;  4P3Y B;  3E3E A;  3GL3 A;  2C3Q A;  1GSQ A;  1GTI A;  1JZO A;  5D73 A;  3GNJ A;  4K0N A;  3GN3 A;  2GSQ A;  2JU5 A;  2LV3 A;  3KH9 A;  1J0F A;  8GSS A;  1PKW A;  1A8L A;  2H76 A;  2HI7 A;  3GTU B;  5G2Z A;  2GLR A;  1QXH A;  2VLU A;  3J7Y k;  1GL8 A;  1U88 A;  2LTK A;  4TN8 A;  4O7H A;  1NSW A;  1X0R A;  4TXO B;  3TKP A;  5G5F A;  4FYU A;  3ZL5 A;  3A2W A;  3IXR A;  4CDO A;  1OKD A;  4MZC A;  3FZ5 A;  3RPN A;  3F3Q A;  4IN0 A;  2XC2 A;  18GS A;  2Z9S A;  1FVK A;  4BPY A;  1GLQ A;  4DEJ A;  2JAC A;  2R3X A;  2A2S A;  1R7H A;  3D5J A;  2LEG A;  3L4N A;  3HD5 A;  4DSQ A;  2YV9 A;  3VWX A;  2YOI A;  5LCZ A;  10GS A;  1GH2 A;  2VCW A;  1QK8 A;  4G2E A;  1WPI A;  3HXS A;  5IMC A;  4K9Z A;  3VPT A;  12GS A;  2IME A;  4AJ6 A;  1V9W A;  1DUG A;  3BBY A;  1TOF A;  3GRX A;  3KGK A;  6GSY A;  4LMW A;  1U6T A;  5J41 A;  2I4A A;  5KEJ A;  1SYX A;  5CRH A;  5EL8 A;  1XFL A;  2OBK A;  4KCA A;  1BQ7 A;  4V1A g;  5LNK e;  1PSQ A;  1RW1 A;  4ECC A;  5A4U A;  4F0C A;  1W89 A;  1SK0 A;  3D0Z A;  2JAD A;  4RQR A;  2PMT A;  1GSY A;  4MF7 A;  2RM5 A;  2HZE B;  2LRC A;  1JLV A;  2C3N A;  4GST A;  4F82 A;  5ECN B;  5HR0 A;  1V2A A;  1AQX A;  2REM A;  1ON4 A;  1AIU A;  2GZY A;  5ECM B;  1GNE A;  2I9H A;  4ECJ A;  4I97 A;  4JZQ A;  4PQ1 A;  3TOU A;  22GS A;  1LU4 A;  4O92 A;  1TK0 B;  3KMO A;  3L9U A;  2OE3 A;  3HJP A;  1G7O A;  2HZF A;  3N5O A;  2PN8 A;  2DIY A;  5F05 A;  1PD2 1;  4GQF A;  1Z3E A;  4I5Q A;  5FHI A;  1SJ6 A;  2C0E A;  1CQG A;  3D4T A;  4LA1 A;  2CVD A;  1OC8 A;  4BVX B;  3O3T A;  5D9X A;  5B6M A;  1ERT A;  4MH2 A;  2CX3 A;  3QFA C;  2R4V A;  3S9F A;  5IOX A;  3GH6 A;  4TOP A;  2YNX A;  1ZCP A;  1UVZ A;  3TJB A;  4X0X A;  5CO3 A;  2LQQ A;  4WKW A;  3VI7 A;  1PL2 A;  2H74 A;  2EC4 A;  4BA7 A;  4HDE A;  2MBT A;  2CX4 A;  3VUR A;  2C0D A;  1XOA A;  4ACS A;  2GT5 A;  1XW5 A;  1M2D A;  1O7U A;  4OWY A;  4TR4 A;  2PVQ A;  1PKZ A;  2MMZ A;  3F6F A;  3FR9 A;  1MD3 A;  5F06 A;  2OE1 A;  3ZIJ A;  3QMX A;  2QSI A;  4K0G A;  3WGD A;  1EGR A;  2N5F A;  2V41 A;  3L9V A;  4JED A;  5IMV A;  1VF1 A;  2V6O A;  3HJM A;  4N0Z A;  3LQ7 A;  4FYB A;  1T3B A;  2L4C A;  2F8F A;  1ZOF A;  1B4Q A;  4PUA A;  1BJX A;  3SWL A;  3D21 A;  4V2L A;  3TJK A;  5DJM A;  4F2I A;  4PQH A;  1W4V A;  4HJ2 A;  3TUE A;  4I2T A;  5DAK A;  3H79 A;  4GQC A;  4DSS B;  1AW9 A;  2VM2 A;  1XWG A;  3FK8 A;  1A2J A;  2QKE A;  3EYT A;  5IO0 A;  3KH7 A;  1GUH A;  2X8H A;  5A4V A;  9GSS A;  2VO4 A;  1FB0 A;  2VD0 A;  2L6D A;  3QPM A;  5GST A;  4O32 A;  1B48 A;  2LJK A;  3UL3 A;  1WRY A;  3ZFB A;  1K0N A;  3J7Y b;  2VCZ A;  4HZ4 A;  1JZW A;  3GIX A;  3UOM A;  4GCI A;  1M2A A;  5JWR B;  3FYG A;  4FH8 A;  2TRC P;  3F8U A;  1ILO A;  4WR4 A;  3L0H A;  3IE3 A;  2RUF A;  4HQS A;  3HDC A;  1YKC A;  2GS3 A;  1YF1 A;  3UVT A;  1PRX A;  3FR3 A;  3LYP A;  4IQ1 A;  2X8G A;  2L57 A;  1WWJ A;  4ISD A;  4MZB A;  1FO5 A;  4F0B A;  3ISO A;  1A24 A;  5F8B A;  1WOU A;  2AAW A;  1GUM A;  5D9V A;  1FHE A;  4GLT A;  1SU9 A;  3P2A A;  2FGX A;  1ZYQ B;  4CHS A;  1ABA A;  2C8U A;  3LEF A;  3HCZ A;  5B6N A;  2YJH A;  3MAK A;  1UC7 A;  4LMV A;  1MDK A;  2MMN A;  3ZLP A;  1QUW A;  3W8S A;  1V98 A;  3LG6 A;  1A0R P;  2YAN A;  2MBS A;  1OYJ A;  3TKR A;  1ERV A;  2HT9 A;  6GSV A;  3US3 A;  4EDZ A;  2DC5 A;  4OMV A;  2HE3 A;  4WF4 A;  4USS A;  3FRC A;  4MAB A;  1TP9 A;  2O85 A;  4KDX A;  3D4M A;  4MDC A;  2H30 A;  3VFI A;  1O73 A;  2FUG 2;  1V58 A;  3IOS A;  1KNG A;  1PX6 A;  1FW1 A;  1FB6 A;  3LXT A;  2KP1 A;  1X9M B;  4NXI A;  4WBJ A;  1AQW A;  1R4W A;  1G0T A;  4L0U A;  1M9B A;  1TRW A;  5IM9 A;  2IWT A;  5H5R A;  5H5S A;  19GS A;  2OKA A;  3NZN A;  3APQ A;  1ZZY A;  2ON5 A;  3GSS A;  3TKS A;  3TOT A;  2GSR A;  14GS A;  3WT1 A;  2HRK A;  2I81 A;  3VWW A;  2IN3 A;  3DXB A;  3QAG A;  3MDK A;  1JLW A;  1YF0 A;  2H75 A;  3EUR A;  4OFN A;  4D73 B;  1M0U A;  2OAD A;  4DVC A;  5AN1 A;  4KDY A;  5CRG A;  2LNT A;  5IMZ A;  2XHF A;  5ID2 B;  4ZL7 A;  1SL1 B;  1TI3 A;  5ENU A;  2E7P A;  4JRR A;  5D9W A;  3M3M A;  4TXV A;  2GQL A;  2IL3 A;  1X9S B;  1YJ6 A;  1RQM A;  4WEY A;  5FT3 A;  2C1Y A;  4L8E A;  1BYE A;  4I8B A;  1XIY A;  3F9U A;  2AJQ B;  1WMJ A;  4ID0 A;  3RHB A;  3KTB A;  4HI7 A;  4OFT A;  3KP9 A;  2AHE A;  4OCF A;  3LGC A;  3CRT A;  2IFQ B;  3HKR A;  4Z7X A;  3EVI A;  1XCC A;  4BL7 A;  5CRW A;  5CNW A;  5IMD A;  2GSS A;  4KUN A;  3F0I A;  2FD3 A;  4G19 A;  3TB2 A;  3GKN A;  1N8J A;  2LKU A;  5GSS A;  4NWY A;  1IYH A;  1SK1 A;  1O8W A;  2EIO A;  2CAI A;  1B9Y C;  2YZH A;  4G10 A;  3RHC A;  1Z9H A;  2N5B A;  3HZ4 A;  2HSM B;  2H1D A;  1JHB A;  1KTE A;  1TXX A;  1AQV A;  4YAP A;  2RII A;  1K3O A;  5DAL A;  1Z6M A;  3DRN A;  3KM6 A;  1Q4J A;  3BOA A;  2RM6 A;  1YY7 A;  3GUS A;  2C0G A;  4DSR A;  1PN9 A;  1OE8 A;  2WJU A;  1U3A A;  5IQY A;  3UAR A;  4N30 A;  3UBL A;  3H93 A;  5HR3 A;  1NHY A;  2HSY A;  5CRE A;  3VWV A;  1LJR A;  1TDI A;  3HVV A;  3MWH A;  3ZYW A;  3DWV A;  1HNC A;  7GSS A;  4G0K A;  1EV9 A;  4IP1 A;  5HR1 A;  3LFL A;  1F9M A;  1QGV A;  2VLT A;  1SL2 B;  1PGT A;  3G7I A;  3EE2 A;  1GUL A;  4HU9 A;  2VL3 A;  3TJJ A;  2MMO A;  2B1K A;  1WIK A;  4KA0 A;  3QFB C;  3VLN A;  2HFD A;  3KIJ A;  5JCW A;  2KOK A;  3GV1 A;  4J56 E;  1CQH A;  3KCM A;  4EXJ A;  4F03 A;  4XTS A;  2CVB A;  2FWF A;  3G7J A;  2FCH A;  4ZBD A;  4HUA A;  3PIN A;  5B8A A;  1PQN A;  2FLS A;  2WGR A;  2V32 A;  2PPT A;  2M72 A;  2L6C A;  4BWS A;  2D2Z A;  2GZP A;  4XCS A;  5ECS A;  1XVW A;  1JFU A;  1A2L A;  2PWJ A;  1B8X A;  1HQO A;  1HYU A;  1Z6N A;  2H0G A;  1S3A A;  5EPF A;  5HR2 A;  1O8X A;  2R6K A;  3LXZ A;  4PXO A;  2M80 A;  3DEX A;  3DIE A;  2B5X A;  6GSW A;  5JWO B;  1VRS D;  5D9T A;  4OO5 A;  1ERU A;  5F07 A;  4FQU A;  2YP6 A;  5DCH A;  20GS A;  3C73 A;  4K6X A;  2X64 A;  3I69 A;  3L78 A;  2F8A A;  4K2D A;  2KLX A;  4GXZ A;  5CYY A;  2YCD A;  2CA8 A;  2CZ3 A;  1YEX A;  4QL9 A;  4TW5 A;  3WYW A;  4AF2 A;  1A23 A;  3DVW A;  4KW6 A;  5KN3 A;  1SD9 A;  2HNL A;  1ZGN A;  5ECP B;  3ED3 A;  3VPQ A;  3VWU A;  2HRN A;  3IR4 A;  2RLI A;  3HA9 A;  3O76 A;  5B8B A;  2K8S A;  2VIM A;  4JE1 A;  2GTU A;  2DJK A;  2VCQ A;  3G7Y A;  1F2E A;  5F0G A;  5LD0 A;  3GHA A;  4IVF A;  2JZT A;  2LQO A;  3NOF A;  1YKA A;  1S3D A;  4V2M A;  2LRN A;  3F4T A;  1ZYE A;  4HQZ A;  2B5Y A;  3LOR A;  4TVE A;  3GL5 A;  2DIZ A;  3TJG A;  4POB A;  2YWM A;  1HNA A;  4OFM A;  5HFK A;  5ECK B;  1XWA A;  1I9D A;  4EVM A;  5E4W A;  2GGT A;  1N2A A;  4BVY A;  2ZNM A;  3EU4 A;  1G6Y A;  1X5E A;  2VAF A;  2XPE A;  5IPG A;  3ZRE A;  1DBY A;  4EKZ A;  3UMA A;  2FNO A;  2PUK C;  5G30 A;  1TKD B;  4IEL A;  2X8C A;  2XBI A;  3ZML A;  4AGS A;  1M7T A;  5IOW A;  2ES7 A;  4MK3 A;  4MCU A;  3KTL A;  4QQ7 A;  4ML1 A;  4HS1 A;  2DJ2 A;  2WB9 A;  2B3S A;  4XS1 A;  1EOG A;  1EEM A;  1EOH A;  2VOC A;  2FHE A;  2JSY A;  3KP8 A;  1V57 A;  4MF5 A;  3P90 A;  3ERG A;  1XXU A;  5IMA A;  1AC1 A;  2ZCT A;  3HYP A;  1AAZ A;  3OR5 A;  3CSH A;  4N10 A;  4YAV A;  2RUE A;  4WR5 A;  4POM A;  3H8Q A;  3F4S A;  1X5C A;  1VF3 A;  3GTU A;  1GSU A;  4IW9 A;  3TRP A;  2WDU A;  4KF9 A;  1OC9 B;  1T7P B;  4TXO A;  4IKH A;  4Q5Q A;  1O6J A;  4KE3 A;  4XS4 B;  4JBB A;  1LBK A;  3HJO A;  5ECQ B;  2E0Q A;  3TGZ A;  1MTC A;  5EVO A;  3PPU A;  6GSX A;  2YZU A;  1TK8 B;  1HNB A;  1U87 A;  2YWN A;  2YPM A;  1XBS A;  4ZB6 A;  1XVQ A;  1AXD A;  4K8M A;  4ML6 A;  3GUR A;  3ME7 A;  4FO5 A;  1XWB A;  1YEP A;  4MJE A;  4HJM A;  3KD0 A;  2H01 A;  1OKT A;  3QAW A;  3R3E A;  1ML6 A;  4IJI A;  3KJY A;  3CSJ A;  4JR6 A;  3Q19 A;  2NBS A;  1Z7R A;  2LUS A;  3U6V A;  5AGY A;  1R5A A;  4NV2 A;  2H6X A;  5G31 A;  2YJ7 A;  13GS A;  3CSI A;  1UN2 A;  4KAE A;  1GTU A;  1K0A A;  3BCI A;  1XOB A;  1SK2 A;  3BCK A;  2HZE A;  2P5Q A;  4KCE A;  5INY A;  1K0C A;  5CP1 A;  5ECO B;  3GFK A;  4OCE A;  3ME8 A;  2DJ0 A;  4PNG A;  5DJL A;  5J9C A;  4YQU A;  4KSO A;  1EV4 A;  3ZIT A;  2A2R A;  4J2F A;  1MDI A;  3VI5 A;  2XPD A;  4F9Z A;  2WUL A;  1JZR A;  1DSB A;  1TRU A;  2V2G A;  4IGJ A;  1G6W A;  1QMV A;  4NV5 A;  4EE0 A;  5IO2 A;  3C1R A;  4TKY A;  3I6A A;  4GSS A;  2FY6 A;  5FWG A;  4K1F A;  3FZA A;  2MMA A;  2BTO T;  3IHQ A;  1Z7P A;  1F6M C;  1GRX A;  4TRX A;  1OVN A;  1HD2 A;  1ST9 A;  1FVJ A;  2FA8 A;  3CRU A;  1EP7 A;  3DYR A;  3M9K A;  4BVX A;  2J9H A;  3FY7 A;  1A0F A;  4N0V A;  2K18 A;  3KZQ A;  2VL2 A;  3UAP A;  3EU3 A;  4OD7 A;  2WFC A;  2NPB A;  4WBR D;  4TR3 A;  3CMI A;  2VUP A;  3G9B A;  1OE7 A;  1GLP A;  2C80 A;  4PNF A;  2TIR A;  4XS6 A;  5A5K A;  3DKS A;  5G1K A;  3EIN A;  1QFN A;  1OAZ A;  3FR6 A;  1TI1 A;  2QGV A;  2HLS A;  3TKS C;  3D6I A;  4KH7 A;  2OBI A;  4YQM A;  1TU7 A;  2GQM A;  5HQP A;  3IA1 A;  2VCX A;  5KN2 A;  1O85 A;  3C71 A;  2C3T A;  4ZBB A;  3M9J A;  1GWC A;  2C4J A;  2DJJ A;  3FZ9 A;  3F6D A;  3ZIV A;  4ZL9 A;  4N11 A;  5KN1 A;  5C00 A;  5ECH B;  5C04 A;  1GSE A;  3GKK A;  4G9H A;  1EP8 A;  2B6M A;  1SL0 B;  2TRX A;  2IPA A;  3H4K A;  4EC0 A;  6GSS A;  4GRF A;  5J5N A;  3M8N A;  5E59 A;  4IBP A;  1THO A;  1ZL9 A;  4TR1 A;  2CQ9 A;  2H1B A;  2R5G A;  1DE1 A;  4DSS A;  3IC8 A;  3TJF A;  1SD8 A;  4KND A;  2DMM A;  2AB6 A;  2G2Q A;  1V40 A;  2UZ8 A;  1I5G A;  4K7I A;  1M99 A;  2MYG A;  3JCM L;  3GX0 A;  4PUF C;  3WT2 A;  4JR4 A;  4HOJ A;  2V6K A;  4KX4 A;  4NPB A;  1K3Y A;  1GP1 A;  2HYX A;  2O8V B;  1VF2 A;  1VF4 A;  4IQA A;  2DML A;  3WGX A;  3LWA A;  3UEM A;  4PX1 A;  2EIR A;  1PMT A;  1WJK A;  3FZ4 A;  4BWQ A;  2VCT A;  3L9S A;  1E6B A;  3UIW A;  2LJA A;  3LJR A;  5DDL A;  5L71 A;  2B5E A;  3QD9 A;  2PGT A;  1TRS A;  3F4R A;  4PTS A;  3WD6 A;  2FWG A;  3IDV A;  2H1A A;  3H1N A;  1T1V A;  3HHV A;  5ECL B;  5ELA A;  4RI6 A;  5IMF A;  5IIZ A;  3A3T A;  1T4Z A;  1B9X C;  3GKM A;  2KP2 A;  4V1A p;  3QAV A;  3QCP A;  1XPV A;  1EZK A;  4MA9 A;  4GF0 A;  4GSN A;  2NVL A;  2LRT A;  4ECI A;  3RBT A;  1TJD A;  2GZZ A;  4YQV A;  1AUC A;  2OE0 A;  2H73 A;  2IMK A;  5D96 A;  2J23 A;  4HEA 2;  4MP4 A;  1ZMA A;  4QL7 A;  3Q6O A;  2OAC A;  5AIV A;  2L5L A;  3A5W A;  1T4Y A;  3V1W A;  4HU7 A;  3WGE A;  2O7K A;  1GSS A;  4JU5 A;  3IK9 A;  1FOV A;  3EWL A;  5H5Q A;  3Q18 A;  3TRQ A;  1R26 A;  4EUY A;  1GSF A;  2P31 A;  1E2Y A;  2H6Y A;  3CTG A;  3MNG A;  4WXT A;  4LLR A;  3IBH A;  5J3R A;  2L5O A;  5D93 A;  2ZUP A;  5DAK B;  2IMF A;  1SKR B;  2OA7 A;  2ALB A;  3ERF A;  1Y6E A;  2L59 A;  3D22 A;  1USB A;  2I1U A;  1J08 A;  5J9B A;  4MZW A;  2XBQ A;  2F9S A;  4XIH A;  1UA5 A;  2JZR A;  3P8W A;  1JZD A;  1XWK A;  2NTO A;  4K7O A;  2P0G A;  2GST A;  3TDG A;  4D73 A;  1GUK A;  2DBC A;  1EWX A;  2F3M A;  4K7N A;  2FWE A;  1F3B A;  1M2B A;  3ZFL A;  1GTA A;  4ULX A;  5ID2 A;  3EMP A;  4FIW A;  1T8E B;  2JL4 A;  4RQX A;  2CZ2 A;  5EY6 A;  2H8L A;  5AIS A;  4Q5R A;  2HSN B;  1THX A;  5A4W A;  2H71 A;  4ILF A;  1GTB A;  4WF5 A;  4MF6 A;  3FKF A;  4V2N A;  2JSZ A;  2KHP A;  2R37 A;  1K0B A;  1PX7 A;  1H75 A;  4PGT A;  4ZB9 A;  2WS2 A;  4ZIL A;  1XWC A;  3CBU A;  5GZZ B;  4I6X A;  2YWO A;  2IFQ A;  1TW9 A;  2V1M A;  3IK7 A;  4ECB A;  2GT6 A;  3PH9 A;  4Q5N A;  2KUC A;  1U3I A;  2HQT A;  3UVH A;  4NAX A;  3KMN A;  1K0O A;  4ZXG A;  4IP6 A;  4Q5F A;  1K3L A;  1EEJ A;  2R2J A;  2VLV A;  4MH3 A;  2AUV A;  2GQK A;  4KDU A;  2LNS A;  4KGI A;  5DQS A;  4L5O A;  4NHW A;  4MMM A;  3PR8 A;  4EF0 A;  1Z5Y E;  3CXG A;  2H0I A;  1H4O A;  2HSM A;  3CYN A;  4KSM A;  1F37 A;  4H86 A;  2YV7 A;  1PL1 A;  3ZVJ A;  4L5L A;  4MLY A;  2X99 A;  2IMI A;  2H19 A;  5J4U A;  1KEB A;  1BX9 A;  2YWI A;  1WE0 A;  4MPF A;  2N5A A;  3QOU A;  3LSZ A;  2LJR A;  1BED A;  4X1U A;  4WET A;  1MEK A;  5GAP D;  3IPZ A;  3RAZ A;  4IJ3 A;  3HVS A;  3IAS 2;  3ZTL A;  4XRD A;  1SYR A;  1J9B A;  1IYI A;  3HZ8 A;  2WCI A;  3IC4 A;  2QC7 A;  3C1S A;  4CW9 A;  1XW6 A;  1VGL A;  5B7C A;  3IRA A;  5D8I A;  1ACV A;  2G0F A;  17GS A;  3SBC A;  4I2U A;  4IS0 A;  3E9J B;  2BMX A;  2JZS A;  1Y25 A;  4ZL8 A;  2HRK B;  4OO4 A;  2HSH A;  2E2M A;  2GVP A;  2B7K A;  3FEU A;  2EIQ A;  2WZ9 A;  4G0I A;  3KEB A;  1TTZ A;  2K8V A;  3IAM 2;  2CV4 A;  2IIY A;  4KB3 A;  2IJY A;  3ZRD A;  5DQY A;  2MZC A;  3GX8 A;  2PVO C;  5CRD A;  5JWQ B;  4PQI A;  5HFG A;  3RDW A;  1Q98 A;  1T00 A;  4EL1 A;  1NHO A;  4TR1 B;  1KBN A;  4ZB8 A;  3U5R E;  2HRF A;  2K6V A;  3GST A;  5ELG A;  2K9F A;  1YZX A;  2PU9 C;  3HVX A;  2F51 A;  5COH A;  1OC3 A;  2CVK A;  16GS A;  4LL4 B;  2I3Y A;  3ERW A;  3FHK A;  2M46 A;  1BAY A;  1XW9 A;  1QQ2 A;  1TK5 B;  1K0M A;  5JCU A;  1SJZ A;  3APS A;  2CT6 A;  2AYT A;  4BL7 B;  1R5P A;  3GH9 A;  4FYC A;  3Q74 A;  2FWH A;  3UBK A;  3TKS E;  1B4P A;  4LL1 B;  2O89 A;  1YDK A;  1A2M A;  3C8E A;  3ZMK A;  1SKS B;  1A8Y A;  2NDO A;  2FA4 A;  2DLX A;  6GST A;  1S3C A;  3I43 A;  2HRA A;  5JCG A;  5KN0 A;  3CTF A;  1FAA A;  2BJX A;  2H66 A;  3GMF A;  3MSZ A;  4EO3 A;  1EGO A;  5DAL B;  3DML A;  2HXK A;  4MJC A;  2DJ3 A;  4NMU A;  4MJB A;  2ON7 A;  2GDR A;  1NM3 A;  4POK A;  1WP0 A;  4GWR A;  1GNW A;  4E8E A;  2VL2 C;  4POL A;  2B1L A;  2PER A;  3TRX A;  4TR0 A;  1BG5 A;  2L4Q A;  1X9W B;  2LS5 A;  3EMX A;  5DCG A;  1TRV A;  3W8J A;  3NIV A;  3PGT A;  5DVB A;  4X43 A;  4PUR A;  1X5D A;  4O5R A;  4MJA A;  3BJ5 A;  5IPH A;  1GSD A;  4ZBA A;  1MD4 A;  3VK9 A;  3N9J A;  2VL9 A;  3A2X A;  2E2G A;  5CAX A;  2B7J A;  5GAN D;  4E8H A;  4HZ2 A;  4RUV A;  3O6T A;  1RK4 A;  1OC9 A;  3K8N A;  3C7M A;  1K0D A;  1SEN A;  2H70 A;  4XS4 A;  3R2Q A;  1F3A A;  1SKW B;  3QR6 A;  3M1G A;  1YQ1 A;  2DJ1 A;  4NHZ A;  3QDN A;  1TU8 A;  2H6Z A;  2CAQ A;  3UJ1 A;  5DBQ A;  5ECI B;  3TKQ A;  3RPP A;  2H1G A;  3DVX A;  3FW2 A;  3TCO A;  3ZZX A;  1XZO A;  3EC3 A;  2VM1 A;  6GSU A;  3I9V 2;  2DSA A;  3AY8 A;  3F3R A;  1URM A;  3ZVJ D;  4AJ7 A;  3W6G A;  4ZIJ A;  1MDJ A;  2H0H A;  2O87 A;  2PBJ A;  1NW2 A;  2A4V A;  2VCV A;  3E0U A;  1SJI A;  2P5R A;  3GKX A;  3DGQ A;  5AIX A;  3GYK A;  1O81 A;  3M0F A;  2VD1 A;  1G7E A;  5G5E A;  4EDY A;  3BD2 A;  3P7X A; 
#chains in the Genus database with same CATH topology
 1PA3 A;  5BMU A;  4XRA A;  2YN1 A;  3APO A;  3KXO A;  5ECR B;  3GA4 A;  2LST A;  5ABR A;  4G0L A;  2AV4 A;  2H72 A;  2WRT A;  4BVY B;  1SVL A;  4J57 E;  1FG4 A;  3A2V A;  3IV4 A;  1ERW A;  4L0W A;  3RGB C;  4AJ8 A;  2IMD A;  3HY2 A;  3DD3 A;  1M9A A;  5G1L A;  11GS A;  4YH2 A;  2OJL A;  4XHM A;  4IHU A;  3LYK A;  5HFI A;  1C72 A;  4GTU A;  1DE2 A;  2C0F A;  4MPG A;  4RI7 A;  3F63 A;  4P3Y B;  3E3E A;  3GL3 A;  2C3Q A;  4N3Z A;  4O5U A;  1GSQ A;  1GTI A;  1JZO A;  5D73 A;  3GNJ A;  4K0N A;  3GN3 A;  2GSQ A;  2JU5 A;  2LV3 A;  3KH9 A;  1J0F A;  8GSS A;  1PKW A;  1A8L A;  2H76 A;  2HI7 A;  3GTU B;  5G2Z A;  2GLR A;  1QXH A;  2VLU A;  3J7Y k;  1GL8 A;  1U88 A;  2LTK A;  4TN8 A;  4O7H A;  1NSW A;  1X0R A;  4TXO B;  3TKP A;  5G5F A;  4FYU A;  3ZL5 A;  3A2W A;  3IXR A;  4CDO A;  1OKD A;  4MZC A;  3FZ5 A;  3TU3 B;  3RPN A;  3F3Q A;  4IN0 A;  2XC2 A;  18GS A;  2Z9S A;  1FVK A;  4BPY A;  1GLQ A;  4DEJ A;  2JAC A;  2R3X A;  2A2S A;  1R7H A;  3D5J A;  2LEG A;  1SVM A;  3L4N A;  3HD5 A;  4DSQ A;  2YV9 A;  1Y1U A;  3VWX A;  2YOI A;  1ZYP A;  5LCZ A;  10GS A;  1GH2 A;  2VCW A;  1QK8 A;  4G2E A;  1WPI A;  3HXS A;  5IMC A;  4K9Z A;  3VPT A;  12GS A;  4E68 A;  2IME A;  4AJ6 A;  2WVX B;  5A1N B;  5KOW A;  4PI0 C;  1V9W A;  1DUG A;  3BBY A;  1TOF A;  3GRX A;  3KGK A;  6GSY A;  4LMW A;  1U6T A;  5J41 A;  2I4A A;  5KEJ A;  1SYX A;  5CRH A;  5EL8 A;  2WVY A;  1XFL A;  2OBK A;  4KCA A;  1BQ7 A;  5BRT A;  4V1A g;  5LNK e;  1PSQ A;  1RW1 A;  1XG8 A;  4ECC A;  5A4U A;  4F0C A;  1W89 A;  1SK0 A;  2WVZ A;  3D0Z A;  2JAD A;  4RQR A;  2PMT A;  1GSY A;  4MF7 A;  2RM5 A;  2O36 A;  2HZE B;  2LRC A;  1JLV A;  2C3N A;  4GST A;  4F82 A;  5ECN B;  5HR0 A;  1V2A A;  1AQX A;  2REM A;  1ON4 A;  1AIU A;  4G01 A;  2GZY A;  4W66 A;  5ECM B;  1GNE A;  2I9H A;  4ECJ A;  4I97 A;  4JZQ A;  4PQ1 A;  3TOU A;  22GS A;  1LU4 A;  4O92 A;  2EFH A;  1TK0 B;  3KMO A;  3L9U A;  2OE3 A;  3HJP A;  1G7O A;  2HZF A;  3N5O A;  2PN8 A;  2DIY A;  5F05 A;  1PD2 1;  4GQF A;  1Z3E A;  4I5Q A;  5FHI A;  1SJ6 A;  2C0E A;  1CQG A;  3D4T A;  5J40 A;  4LA1 A;  2CVD A;  1OC8 A;  4BVX B;  3O3T A;  5KOX A;  5D9X A;  5B6M A;  1ERT A;  4MH2 A;  2CX3 A;  3QFA C;  2R4V A;  3S9F A;  5IOX A;  3GH6 A;  4TOP A;  2YNX A;  1ZCP A;  2O3E A;  1UVZ A;  3TJB A;  4X0X A;  5CO3 A;  2LQQ A;  4WKW A;  3VI7 A;  1PL2 A;  2H74 A;  2EC4 A;  4BA7 A;  4HDE A;  2MBT A;  2CX4 A;  3VUR A;  2C0D A;  1XOA A;  4ACS A;  2GT5 A;  1XW5 A;  1M2D A;  1O7U A;  4OWY A;  2R0C A;  4TR4 A;  2PVQ A;  1PKZ A;  2MMZ A;  3F6F A;  3FR9 A;  1MD3 A;  5F06 A;  2OE1 A;  3ZIJ A;  3QMX A;  2QSI A;  4K0G A;  3WGD A;  1EGR A;  2N5F A;  2V41 A;  3L9V A;  4JED A;  5IMV A;  1VF1 A;  2V6O A;  3HJM A;  4N0Z A;  3LQ7 A;  4FYB A;  1T3B A;  2L4C A;  2F8F A;  1ZOF A;  1B4Q A;  4PUA A;  1BJX A;  3SWL A;  3D21 A;  4V2L A;  3TJK A;  5DJM A;  4F2I A;  4PQH A;  1W4V A;  4HJ2 A;  3TUE A;  4I2T A;  5DAK A;  3H79 A;  4GQC A;  4DSS B;  1AW9 A;  2VM2 A;  1XWG A;  3FK8 A;  1A2J A;  2X49 A;  4AKX B;  2QKE A;  3EYT A;  2OT3 A;  5IO0 A;  3KH7 A;  1GUH A;  2X8H A;  5A4V A;  9GSS A;  2VO4 A;  1FB0 A;  2VD0 A;  2L6D A;  3QPM A;  5GST A;  4O32 A;  1B48 A;  2LJK A;  3UL3 A;  1WRY A;  3ZFB A;  1K0N A;  1FOH A;  3J7Y b;  2VCZ A;  4HZ4 A;  1JZW A;  3GIX A;  3UOM A;  4GCI A;  1M2A A;  5BMU B;  5JWR B;  3FYG A;  2HSN A;  4FH8 A;  2TRC P;  3F8U A;  1ILO A;  4WR4 A;  3L0H A;  3IE3 A;  2RUF A;  4HQS A;  3HDC A;  1YKC A;  2GS3 A;  1YF1 A;  3UVT A;  1TXU A;  1PRX A;  3FR3 A;  3LYP A;  4IQ1 A;  2X8G A;  2L57 A;  1WWJ A;  4ISD A;  4MZB A;  1FO5 A;  4F0B A;  3ISO A;  1A24 A;  5F8B A;  1WOU A;  4AKG A;  2AAW A;  1GUM A;  5D9V A;  1FHE A;  4GLT A;  1SU9 A;  3P2A A;  2FGX A;  1ZYQ B;  3CHX C;  4CHS A;  1ABA A;  2C8U A;  3LEF A;  3HCZ A;  5B6N A;  2YJH A;  3MAK A;  1UC7 A;  4LMV A;  1MDK A;  2MMN A;  3ZLP A;  1QUW A;  3W8S A;  1V98 A;  3LG6 A;  1A0R P;  2YAN A;  2MBS A;  1OYJ A;  3TKR A;  1ERV A;  2HT9 A;  6GSV A;  3US3 A;  4EDZ A;  2DC5 A;  4OMV A;  2HE3 A;  4WF4 A;  4USS A;  3FRC A;  4MAB A;  1TP9 A;  2O85 A;  4KDX A;  3D4M A;  4MDC A;  2H30 A;  3VFI A;  1O73 A;  2WW3 A;  2FUG 2;  1V58 A;  3IOS A;  1KNG A;  1PX6 A;  1FW1 A;  1FB6 A;  3LXT A;  2KP1 A;  1X9M B;  4NXI A;  4WBJ A;  1AQW A;  4PHZ C;  1R4W A;  1G0T A;  4L0U A;  1M9B A;  1TRW A;  5IM9 A;  2IWT A;  5H5R A;  5H5S A;  19GS A;  2OKA A;  3NZN A;  3APQ A;  1ZZY A;  2ON5 A;  3GSS A;  3TKS A;  3TOT A;  2GSR A;  14GS A;  3WT1 A;  2HRK A;  2I81 A;  3VWW A;  2IN3 A;  3DXB A;  3QAG A;  3HMJ G;  3MDK A;  1JLW A;  1YF0 A;  2H75 A;  4K5S A;  3EUR A;  4OFN A;  4D73 B;  4YKG A;  1M0U A;  2OAD A;  4DVC A;  5AN1 A;  4KDY A;  5CRG A;  2LNT A;  5IMZ A;  2XHF A;  5ID2 B;  4ZL7 A;  3FMW A;  1SL1 B;  1TI3 A;  5ENU A;  2E7P A;  4JRR A;  5D9W A;  3M3M A;  3A5I A;  4TXV A;  2GQL A;  2IL3 A;  1X9S B;  1YJ6 A;  4YKF A;  1RQM A;  4WEY A;  5FT3 A;  2C1Y A;  4L8E A;  1BYE A;  4I8B A;  1XIY A;  3F9U A;  2AJQ B;  1WMJ A;  4ID0 A;  3RHB A;  3KTB A;  4HI7 A;  4OFT A;  3KP9 A;  4Z2U A;  2AHE A;  4OCF A;  3LGC A;  3CRT A;  2IFQ B;  3HKR A;  4Z7X A;  3EVI A;  1XCC A;  4BL7 A;  5CRW A;  5CNW A;  5IMD A;  2GSS A;  4KUN A;  3F0I A;  2FD3 A;  4G19 A;  3TB2 A;  3GKN A;  4HSC X;  1N8J A;  2LKU A;  5GSS A;  4NWY A;  1IYH A;  1SK1 A;  4Z2T A;  1O8W A;  2EIO A;  2CAI A;  1B9Y C;  2YZH A;  4G10 A;  3RHC A;  1Z9H A;  2N5B A;  3HZ4 A;  2HSM B;  2H1D A;  1JHB A;  5A34 A;  1KTE A;  1TXX A;  1AQV A;  4YAP A;  2RII A;  1K3O A;  5DAL A;  1Z6M A;  3DRN A;  3KM6 A;  1Q4J A;  3BOA A;  2RM6 A;  1YY7 A;  3GUS A;  2C0G A;  3IHG A;  4DSR A;  1PN9 A;  1OE8 A;  3EPT A;  2WJU A;  1U3A A;  5IQY A;  3UAR A;  4ICY A;  4N30 A;  3UBL A;  3H93 A;  5HR3 A;  1NHY A;  2HSY A;  5CRE A;  3VWV A;  1LJR A;  1TDI A;  3HVV A;  3MWH A;  3ZYW A;  3DWV A;  1HNC A;  7GSS A;  4G0K A;  1EV9 A;  4IP1 A;  5HR1 A;  3LFL A;  1F9M A;  1QGV A;  2VLT A;  1SL2 B;  1PGT A;  3G7I A;  3EE2 A;  1GUL A;  4HU9 A;  4QMK A;  2VL3 A;  3TJJ A;  2MMO A;  2B1K A;  1WIK A;  4KA0 A;  3QFB C;  3VLN A;  2HFD A;  3KIJ A;  5JCW A;  2KOK A;  3GV1 A;  4J56 E;  1CQH A;  3KCM A;  4EXJ A;  4F03 A;  4XTS A;  2CVB A;  2FWF A;  3G7J A;  2FCH A;  4ZBD A;  2R0G A;  4HUA A;  5J47 A;  3PIN A;  5B8A A;  1PQN A;  2FLS A;  2WGR A;  2V32 A;  2PPT A;  2M72 A;  2L6C A;  4BWS A;  2D2Z A;  2GZP A;  4XCS A;  5ECS A;  1XVW A;  1JFU A;  1A2L A;  2PWJ A;  1B8X A;  1HQO A;  1HYU A;  1Z6N A;  2H0G A;  1S3A A;  5EPF A;  5HR2 A;  1O8X A;  2R6K A;  3LXZ A;  4PXO A;  2M80 A;  3DEX A;  3DIE A;  2B5X A;  6GSW A;  5JWO B;  1VRS D;  5D9T A;  4OO5 A;  1ERU A;  5F07 A;  4FQU A;  4AKH A;  2YP6 A;  5DCH A;  20GS A;  3C73 A;  4K6X A;  2X64 A;  3I69 A;  3L78 A;  2F8A A;  4K2D A;  2KLX A;  4GXZ A;  5CYY A;  2YCD A;  2CA8 A;  2CZ3 A;  1YEX A;  4QL9 A;  4TW5 A;  3WYW A;  4AF2 A;  1A23 A;  3DVW A;  4GDF A;  4KW6 A;  5KN3 A;  1SD9 A;  2HNL A;  1ZGN A;  5ECP B;  3ED3 A;  3VPQ A;  3VWU A;  2HRN A;  3IR4 A;  2RLI A;  3HA9 A;  3O76 A;  5B8B A;  2K8S A;  2VIM A;  4JE1 A;  2GTU A;  2DJK A;  2QA2 A;  2VCQ A;  3G7Y A;  1F2E A;  5F0G A;  5LD0 A;  3GHA A;  4IVF A;  2JZT A;  2LQO A;  3NOF A;  1YKA A;  1S3D A;  4V2M A;  2LRN A;  3F4T A;  1ZYE A;  4HQZ A;  2B5Y A;  3LOR A;  4TVE A;  3GL5 A;  2DIZ A;  3TJG A;  4POB A;  2YWM A;  1HNA A;  4OFM A;  5HFK A;  5ECK B;  1XWA A;  1I9D A;  4EVM A;  5E4W A;  2GGT A;  1N2A A;  4BVY A;  2ZNM A;  3EU4 A;  1G6Y A;  1X5E A;  2VAF A;  2XPE A;  5IPG A;  3ZRE A;  1DBY A;  4EKZ A;  3UMA A;  2FNO A;  2PUK C;  1S3R A;  5G30 A;  1TKD B;  4K2X A;  5J4Y A;  4IEL A;  5A5H B;  2X8C A;  2XBI A;  3ZML A;  4AGS A;  1M7T A;  5IOW A;  2ES7 A;  4MK3 A;  4MCU A;  3KTL A;  4QQ7 A;  4ML1 A;  4HS1 A;  2DJ2 A;  2WB9 A;  2B3S A;  4XS1 A;  1EOG A;  1M3I A;  1EEM A;  1EOH A;  2VOC A;  2FHE A;  2JSY A;  3KP8 A;  1V57 A;  4MF5 A;  3P90 A;  3ERG A;  1XXU A;  5IMA A;  1AC1 A;  2ZCT A;  3HYP A;  4X4J A;  1YVL A;  1AAZ A;  3OR5 A;  3CSH A;  4N10 A;  2H1L A;  4YAV A;  2RUE A;  4WR5 A;  4POM A;  3H8Q A;  3F4S A;  1X5C A;  1VF3 A;  3GTU A;  1GSU A;  4IW9 A;  3TRP A;  1I1I P;  2WDU A;  4KF9 A;  1OC9 B;  1T7P B;  4TXO A;  4IKH A;  4Q5Q A;  1O6J A;  4KE3 A;  4XS4 B;  4JBB A;  1LBK A;  3HJO A;  5ECQ B;  2E0Q A;  3TGZ A;  1MTC A;  5EVO A;  3PPU A;  6GSX A;  2YZU A;  1TK8 B;  1HNB A;  1U87 A;  2YWN A;  2YPM A;  1XBS A;  4ZB6 A;  1XVQ A;  1AXD A;  4K8M A;  4ML6 A;  3GUR A;  3ME7 A;  4FO5 A;  1XWB A;  1YEP A;  4MJE A;  4HJM A;  3KD0 A;  2H01 A;  5A1N A;  1OKT A;  3QAW A;  3R3E A;  2WW0 A;  1ML6 A;  4IJI A;  3KJY A;  3CSJ A;  4JR6 A;  3Q19 A;  2NBS A;  1Z7R A;  2LUS A;  1SVO A;  3U6V A;  5AGY A;  1R5A A;  4NV2 A;  2H6X A;  5G31 A;  2YJ7 A;  13GS A;  3CSI A;  1UN2 A;  4KAE A;  1GTU A;  1K0A A;  3BCI A;  1XOB A;  1SK2 A;  3BCK A;  2HZE A;  2P5Q A;  4KCE A;  5INY A;  1K0C A;  5CP1 A;  5ECO B;  3GFK A;  4OCE A;  3ME8 A;  2DJ0 A;  4PNG A;  5DJL A;  5J9C A;  1YEW C;  4YQU A;  4KSO A;  4K5R A;  1EV4 A;  3ZIT A;  2A2R A;  4J2F A;  1MDI A;  3VI5 A;  2XPD A;  4F9Z A;  2WUL A;  1JZR A;  1ZYN A;  1DSB A;  1TRU A;  2V2G A;  3LW9 A;  4IGJ A;  1G6W A;  1QMV A;  4NV5 A;  4EE0 A;  5IO2 A;  3C1R A;  4TKY A;  3I6A A;  4GSS A;  2FY6 A;  5FWG A;  4K1F A;  3FZA A;  2MMA A;  2BTO T;  3IHQ A;  1Z7P A;  1F6M C;  1GRX A;  2DKI A;  4TRX A;  1OVN A;  1HD2 A;  1ST9 A;  1FVJ A;  2FA8 A;  3CRU A;  1EP7 A;  3DYR A;  3M9K A;  4BVX A;  2J9H A;  3FY7 A;  1A0F A;  4N0V A;  2K18 A;  3KZQ A;  2VL2 A;  3UAP A;  3EU3 A;  4OD7 A;  2WFC A;  2NPB A;  4WBR D;  4TR3 A;  3CMI A;  2VUP A;  3G9B A;  3CWG A;  1OE7 A;  1GLP A;  2C80 A;  4PNF A;  2TIR A;  4XS6 A;  5A5K A;  3DKS A;  5G1K A;  3EIN A;  1QFN A;  1OAZ A;  3FR6 A;  1TI1 A;  2QGV A;  2HLS A;  3TKS C;  3D6I A;  4KH7 A;  2OBI A;  4YQM A;  1TU7 A;  2GQM A;  5HQP A;  2DKH A;  2VCX A;  3IA1 A;  5KN2 A;  1O85 A;  2WW2 A;  4EIQ A;  4A5P A;  3C71 A;  2C3T A;  4ZBB A;  1GWC A;  3M9J A;  2C4J A;  2DJJ A;  3FZ9 A;  3F6D A;  3ZIV A;  4ZL9 A;  4N11 A;  5KN1 A;  5C00 A;  5ECH B;  5C04 A;  1GSE A;  3GKK A;  4G9H A;  1EP8 A;  2B6M A;  1SL0 B;  2TRX A;  2IPA A;  3H4K A;  4EC0 A;  3MYD A;  6GSS A;  4GRF A;  1PN0 A;  5J5N A;  3M8N A;  2EFE A;  5E59 A;  4IBP A;  1THO A;  1ZL9 A;  4TR1 A;  2CQ9 A;  2H1B A;  2R5G A;  1DE1 A;  4DSS A;  3IC8 A;  3TJF A;  1SD8 A;  4KND A;  2DMM A;  2AB6 A;  2G2Q A;  1V40 A;  2UZ8 A;  1I5G A;  4K7I A;  1M99 A;  2MYG A;  3JCM L;  3GX0 A;  4PUF C;  3WT2 A;  4JR4 A;  4HOJ A;  2V6K A;  4KX4 A;  4NPB A;  1K3Y A;  1GP1 A;  2HYX A;  2O8V B;  1VF2 A;  1VF4 A;  4IQA A;  2DML A;  3WGX A;  3LWA A;  3UEM A;  4PX1 A;  2EIR A;  1PMT A;  1WJK A;  3FZ4 A;  4BWQ A;  2VCT A;  3L9S A;  1E6B A;  3UIW A;  2LJA A;  3LJR A;  5DDL A;  5L71 A;  2B5E A;  3QD9 A;  2PGT A;  1TRS A;  3F4R A;  4PTS A;  3WD6 A;  2FWG A;  3IDV A;  2H1A A;  3H1N A;  1T1V A;  3HHV A;  5ECL B;  5ELA A;  4RI6 A;  5IMF A;  5IIZ A;  3A3T A;  1T4Z A;  1B9X C;  3GKM A;  2KP2 A;  4V1A p;  1S4B P;  3QAV A;  3QCP A;  1XPV A;  1EZK A;  4MA9 A;  4GF0 A;  4CY8 A;  4GSN A;  2NVL A;  2LRT A;  4ECI A;  3RBT A;  1TJD A;  2GZZ A;  4YQV A;  1AUC A;  2OE0 A;  2H73 A;  2IMK A;  5D96 A;  2J23 A;  4HEA 2;  4MP4 A;  1ZMA A;  4QL7 A;  3Q6O A;  2UV8 G;  2OAC A;  5AIV A;  2L5L A;  3A5W A;  1T4Y A;  3V1W A;  4HU7 A;  3WGE A;  2O7K A;  1GSS A;  4JU5 A;  2EFC A;  3IK9 A;  1FOV A;  3EWL A;  5H5Q A;  3Q18 A;  3TRQ A;  1R26 A;  4EUY A;  1GSF A;  2P31 A;  1E2Y A;  2QA1 A;  2H6Y A;  3CTG A;  3MNG A;  4WXT A;  4LLR A;  3IBH A;  5J3R A;  2L5O A;  5D93 A;  2ZUP A;  5DAK B;  2IMF A;  1SKR B;  2OA7 A;  2ALB A;  3ERF A;  1Y6E A;  2L59 A;  3D22 A;  1USB A;  2I1U A;  1J08 A;  5J9B A;  4MZW A;  2XBQ A;  2F9S A;  4XIH A;  1UA5 A;  2JZR A;  3P8W A;  1JZD A;  1XWK A;  2NTO A;  2WW1 A;  4K7O A;  4CY6 A;  2P0G A;  2GST A;  3TDG A;  4D73 A;  2O5V A;  1GUK A;  2DBC A;  1EWX A;  2F3M A;  4K7N A;  2FWE A;  1F3B A;  1M2B A;  3ZFL A;  1GTA A;  4ULX A;  5ID2 A;  3EMP A;  4AI6 A;  4FIW A;  1T8E B;  2JL4 A;  4RQX A;  2CZ2 A;  5EY6 A;  2H8L A;  5AIS A;  4Q5R A;  2HSN B;  1THX A;  5A4W A;  2H71 A;  4ILF A;  1GTB A;  4WF5 A;  4MF6 A;  4O5Q A;  3FKF A;  4V2N A;  2JSZ A;  2KHP A;  2R37 A;  1K0B A;  1PX7 A;  1H75 A;  4PGT A;  4ZB9 A;  2WS2 A;  4ZIL A;  1XWC A;  3HVN A;  3CBU A;  5GZZ B;  4I6X A;  2R0P A;  2YWO A;  2IFQ A;  1TW9 A;  2V1M A;  3IK7 A;  4ECB A;  2GT6 A;  3PH9 A;  4Q5N A;  2KUC A;  1U3I A;  2HQT A;  4ZB7 A;  3UVH A;  4NAX A;  3KMN A;  1K0O A;  4ZXG A;  4IP6 A;  4Q5F A;  1K3L A;  1EEJ A;  2R2J A;  2VLV A;  4MH3 A;  2AUV A;  2GQK A;  4KDU A;  2LNS A;  4KGI A;  5DQS A;  4L5O A;  4NHW A;  4MMM A;  3PR8 A;  4EF0 A;  1Z5Y E;  3CXG A;  2H0I A;  1H4O A;  2HSM A;  3CYN A;  4KSM A;  1F37 A;  4H86 A;  2YV7 A;  1PL1 A;  3ZVJ A;  4L5L A;  4MLY A;  2X99 A;  2IMI A;  5J4V A;  2H19 A;  5J4U A;  1KEB A;  1BX9 A;  2YWI A;  1WE0 A;  4MPF A;  2N5A A;  3QOU A;  3LSZ A;  2LJR A;  1BED A;  4X1U A;  4WET A;  4FXY P;  1MEK A;  5GAP D;  3IPZ A;  3RAZ A;  4IJ3 A;  3HVS A;  3IAS 2;  3ZTL A;  4XRD A;  1SYR A;  1J9B A;  1IYI A;  3HZ8 A;  2WCI A;  4EIP A;  3IC4 A;  2QC7 A;  3C1S A;  4CW9 A;  1PFO A;  1XW6 A;  1VGL A;  5B7C A;  3IRA A;  5D8I A;  3CQF A;  1ACV A;  2G0F A;  2A2P A;  17GS A;  3SBC A;  1N25 A;  4I2U A;  4IS0 A;  3E9J B;  2BMX A;  2JZS A;  1Y25 A;  4ZL8 A;  2HRK B;  4OO4 A;  2HSH A;  2E2M A;  2GVP A;  2B7K A;  3FEU A;  2EIQ A;  2WZ9 A;  4G0I A;  3KEB A;  1TTZ A;  2K8V A;  3IAM 2;  2CV4 A;  2IIY A;  4KB3 A;  2IJY A;  3ZRD A;  2WVX A;  5DQY A;  1BG1 A;  2MZC A;  3GX8 A;  2PVO C;  5CRD A;  5JWQ B;  4PQI A;  5HFG A;  3RDW A;  1Q98 A;  1T00 A;  4EL1 A;  1NHO A;  4TR1 B;  1KBN A;  4ZB8 A;  1M3J A;  3U5R E;  1BF5 A;  2HRF A;  2K6V A;  3GST A;  5ELG A;  2K9F A;  1YZX A;  2PU9 C;  3HVX A;  2F51 A;  5COH A;  1OC3 A;  2CVK A;  16GS A;  4LL4 B;  2I3Y A;  3ERW A;  3FHK A;  2M46 A;  1BAY A;  1XW9 A;  1QQ2 A;  1TK5 B;  1K0M A;  5JCU A;  1SJZ A;  3APS A;  2CT6 A;  2AYT A;  4BL7 B;  1R5P A;  3GH9 A;  4FYC A;  3Q74 A;  2FWH A;  2A4H A;  3UBK A;  3TKS E;  1B4P A;  4LL1 B;  2O89 A;  1YDK A;  1A2M A;  3C8E A;  3ZMK A;  1SKS B;  1A8Y A;  2NDO A;  2FA4 A;  2DLX A;  6GST A;  1S3C A;  3I43 A;  2HRA A;  5JCG A;  5A34 B;  5KN0 A;  3CTF A;  1FAA A;  2BJX A;  2H66 A;  3GMF A;  3MSZ A;  4EO3 A;  1EGO A;  5DAL B;  3DML A;  2HXK A;  4MJC A;  2DJ3 A;  4NMU A;  4MJB A;  2ON7 A;  2GDR A;  1NM3 A;  4POK A;  1WP0 A;  4GWR A;  4Z2R A;  1GNW A;  4E8E A;  2VL2 C;  4POL A;  2B1L A;  2PER A;  3TRX A;  4TR0 A;  1BG5 A;  5A5H A;  2L4Q A;  1X9W B;  2EFD A;  2LS5 A;  3EMX A;  5DCG A;  3RFR C;  1TRV A;  3W8J A;  3NIV A;  3PGT A;  5DVB A;  4X43 A;  4PUR A;  1X5D A;  4O5R A;  4MJA A;  3BJ5 A;  5IPH A;  1GSD A;  4ZBA A;  1MD4 A;  3VK9 A;  3N9J A;  2VL9 A;  3A2X A;  2E2G A;  5CAX A;  2B7J A;  5GAN D;  3MIX A;  4PI2 C;  4E8H A;  4HZ2 A;  4RUV A;  1RK4 A;  1OC9 A;  3O6T A;  3K8N A;  3C7M A;  1K0D A;  1SEN A;  2H70 A;  4XS4 A;  3R2Q A;  1F3A A;  2WZS A;  1SKW B;  3QR6 A;  3M1G A;  1YQ1 A;  2DJ1 A;  4NHZ A;  3QDN A;  1TU8 A;  2H6Z A;  2CAQ A;  3UJ1 A;  5DBQ A;  5ECI B;  3TKQ A;  3RPP A;  2H1G A;  3DVX A;  3FW2 A;  3TCO A;  3ZZX A;  1XZO A;  3EC3 A;  2VM1 A;  6GSU A;  3I9V 2;  2DSA A;  3AY8 A;  4BIK A;  3F3R A;  1URM A;  2X4A A;  3ZVJ D;  4AKI A;  4MNN A;  4AJ7 A;  3W6G A;  4ZIJ A;  1MDJ A;  2H0H A;  2O87 A;  2PBJ A;  2VKZ G;  1NW2 A;  2A4V A;  2VCV A;  3E0U A;  1SJI A;  2P5R A;  3GKX A;  3DGQ A;  5AIX A;  3GYK A;  1O81 A;  3M0F A;  2VD1 A;  1G7E A;  5G5E A;  4EDY A;  3BD2 A;  3P7X A; 
#chains in the Genus database with same CATH homology
 1PA3 A;  5BMU A;  4XRA A;  2YN1 A;  3APO A;  3KXO A;  5ECR B;  3GA4 A;  2LST A;  5ABR A;  4G0L A;  2AV4 A;  2H72 A;  2WRT A;  4BVY B;  1SVL A;  4J57 E;  1FG4 A;  3A2V A;  3IV4 A;  1ERW A;  4L0W A;  4AJ8 A;  2IMD A;  3HY2 A;  3DD3 A;  1M9A A;  5G1L A;  11GS A;  4YH2 A;  2OJL A;  4XHM A;  4IHU A;  3LYK A;  5HFI A;  1C72 A;  4GTU A;  1DE2 A;  2C0F A;  4MPG A;  4RI7 A;  3F63 A;  4P3Y B;  3E3E A;  3GL3 A;  2C3Q A;  4N3Z A;  4O5U A;  1GSQ A;  1GTI A;  1JZO A;  5D73 A;  3GNJ A;  4K0N A;  3GN3 A;  2GSQ A;  2JU5 A;  2LV3 A;  3KH9 A;  1J0F A;  8GSS A;  1PKW A;  1A8L A;  2H76 A;  2HI7 A;  3GTU B;  5G2Z A;  2GLR A;  1QXH A;  2VLU A;  3J7Y k;  1GL8 A;  1U88 A;  2LTK A;  4TN8 A;  4O7H A;  1NSW A;  1X0R A;  4TXO B;  3TKP A;  5G5F A;  4FYU A;  3ZL5 A;  3A2W A;  3IXR A;  4CDO A;  1OKD A;  4MZC A;  3FZ5 A;  3TU3 B;  3RPN A;  3F3Q A;  4IN0 A;  2XC2 A;  18GS A;  2Z9S A;  1FVK A;  4BPY A;  1GLQ A;  4DEJ A;  2JAC A;  2R3X A;  2A2S A;  1R7H A;  3D5J A;  2LEG A;  1SVM A;  3L4N A;  3HD5 A;  4DSQ A;  2YV9 A;  1Y1U A;  3VWX A;  2YOI A;  1ZYP A;  5LCZ A;  10GS A;  1GH2 A;  2VCW A;  1QK8 A;  4G2E A;  1WPI A;  3HXS A;  5IMC A;  4K9Z A;  3VPT A;  12GS A;  4E68 A;  2IME A;  4AJ6 A;  5A1N B;  5KOW A;  1V9W A;  1DUG A;  3BBY A;  1TOF A;  3GRX A;  3KGK A;  6GSY A;  4LMW A;  1U6T A;  5J41 A;  2I4A A;  5KEJ A;  1SYX A;  5CRH A;  5EL8 A;  1XFL A;  2OBK A;  4KCA A;  5BRT A;  1BQ7 A;  4V1A g;  5LNK e;  1PSQ A;  1RW1 A;  4ECC A;  5A4U A;  4F0C A;  1W89 A;  1SK0 A;  3D0Z A;  2JAD A;  4RQR A;  2PMT A;  1GSY A;  4MF7 A;  2RM5 A;  2HZE B;  2LRC A;  1JLV A;  2C3N A;  4GST A;  4F82 A;  5ECN B;  5HR0 A;  1V2A A;  1AQX A;  2REM A;  1ON4 A;  1AIU A;  4G01 A;  2GZY A;  4W66 A;  5ECM B;  1GNE A;  2I9H A;  4ECJ A;  4I97 A;  4JZQ A;  4PQ1 A;  3TOU A;  22GS A;  1LU4 A;  4O92 A;  2EFH A;  1TK0 B;  3KMO A;  3L9U A;  2OE3 A;  3HJP A;  1G7O A;  2HZF A;  3N5O A;  2PN8 A;  2DIY A;  5F05 A;  1PD2 1;  4GQF A;  1Z3E A;  4I5Q A;  5FHI A;  1SJ6 A;  2C0E A;  1CQG A;  3D4T A;  5J40 A;  4LA1 A;  2CVD A;  1OC8 A;  4BVX B;  3O3T A;  5KOX A;  5D9X A;  5B6M A;  1ERT A;  4MH2 A;  2CX3 A;  3QFA C;  2R4V A;  3S9F A;  5IOX A;  3GH6 A;  4TOP A;  2YNX A;  1ZCP A;  1UVZ A;  3TJB A;  4X0X A;  5CO3 A;  2LQQ A;  4WKW A;  3VI7 A;  1PL2 A;  2H74 A;  2EC4 A;  4BA7 A;  4HDE A;  2MBT A;  2CX4 A;  3VUR A;  2C0D A;  1XOA A;  4ACS A;  2GT5 A;  1XW5 A;  1M2D A;  1O7U A;  4OWY A;  2R0C A;  4TR4 A;  2PVQ A;  1PKZ A;  2MMZ A;  3F6F A;  3FR9 A;  1MD3 A;  5F06 A;  2OE1 A;  3ZIJ A;  3QMX A;  2QSI A;  4K0G A;  3WGD A;  1EGR A;  2N5F A;  2V41 A;  3L9V A;  4JED A;  5IMV A;  1VF1 A;  2V6O A;  3HJM A;  4N0Z A;  3LQ7 A;  4FYB A;  1T3B A;  2L4C A;  2F8F A;  1ZOF A;  1B4Q A;  4PUA A;  1BJX A;  3SWL A;  3D21 A;  4V2L A;  3TJK A;  5DJM A;  4F2I A;  4PQH A;  1W4V A;  4HJ2 A;  3TUE A;  4I2T A;  5DAK A;  3H79 A;  4GQC A;  4DSS B;  1AW9 A;  2VM2 A;  1XWG A;  3FK8 A;  1A2J A;  2X49 A;  4AKX B;  2QKE A;  3EYT A;  2OT3 A;  5IO0 A;  3KH7 A;  1GUH A;  2X8H A;  5A4V A;  9GSS A;  2VO4 A;  1FB0 A;  2VD0 A;  2L6D A;  3QPM A;  5GST A;  4O32 A;  1B48 A;  2LJK A;  3UL3 A;  1WRY A;  3ZFB A;  1K0N A;  1FOH A;  3J7Y b;  2VCZ A;  4HZ4 A;  1JZW A;  3GIX A;  3UOM A;  4GCI A;  1M2A A;  5BMU B;  5JWR B;  3FYG A;  2HSN A;  4FH8 A;  2TRC P;  3F8U A;  1ILO A;  4WR4 A;  3L0H A;  3IE3 A;  2RUF A;  4HQS A;  3HDC A;  1YKC A;  2GS3 A;  1YF1 A;  3UVT A;  1TXU A;  1PRX A;  3FR3 A;  3LYP A;  4IQ1 A;  2X8G A;  2L57 A;  1WWJ A;  4ISD A;  4MZB A;  1FO5 A;  4F0B A;  3ISO A;  1A24 A;  5F8B A;  1WOU A;  4AKG A;  2AAW A;  1GUM A;  5D9V A;  1FHE A;  4GLT A;  1SU9 A;  3P2A A;  2FGX A;  1ZYQ B;  4CHS A;  1ABA A;  2C8U A;  3LEF A;  3HCZ A;  5B6N A;  2YJH A;  3MAK A;  1UC7 A;  4LMV A;  1MDK A;  2MMN A;  3ZLP A;  1QUW A;  3W8S A;  1V98 A;  3LG6 A;  1A0R P;  2YAN A;  2MBS A;  1OYJ A;  3TKR A;  1ERV A;  2HT9 A;  6GSV A;  3US3 A;  4EDZ A;  2DC5 A;  4OMV A;  2HE3 A;  4WF4 A;  4USS A;  3FRC A;  4MAB A;  1TP9 A;  2O85 A;  4KDX A;  3D4M A;  4MDC A;  2H30 A;  3VFI A;  1O73 A;  2FUG 2;  1V58 A;  3IOS A;  1KNG A;  1PX6 A;  1FW1 A;  1FB6 A;  3LXT A;  2KP1 A;  1X9M B;  4NXI A;  4WBJ A;  1AQW A;  1R4W A;  1G0T A;  4L0U A;  1M9B A;  1TRW A;  5IM9 A;  2IWT A;  5H5R A;  5H5S A;  19GS A;  2OKA A;  3NZN A;  3APQ A;  1ZZY A;  2ON5 A;  3GSS A;  3TKS A;  3TOT A;  2GSR A;  14GS A;  3WT1 A;  2HRK A;  2I81 A;  3VWW A;  2IN3 A;  3DXB A;  3QAG A;  3HMJ G;  3MDK A;  1JLW A;  1YF0 A;  2H75 A;  4K5S A;  3EUR A;  4OFN A;  4D73 B;  4YKG A;  1M0U A;  2OAD A;  4DVC A;  5AN1 A;  4KDY A;  5CRG A;  2LNT A;  5IMZ A;  2XHF A;  5ID2 B;  4ZL7 A;  3FMW A;  1SL1 B;  1TI3 A;  5ENU A;  2E7P A;  4JRR A;  5D9W A;  3M3M A;  3A5I A;  4TXV A;  2GQL A;  2IL3 A;  1X9S B;  1YJ6 A;  4YKF A;  1RQM A;  4WEY A;  5FT3 A;  2C1Y A;  4L8E A;  1BYE A;  4I8B A;  1XIY A;  3F9U A;  2AJQ B;  1WMJ A;  4ID0 A;  3RHB A;  3KTB A;  4HI7 A;  4OFT A;  3KP9 A;  4Z2U A;  2AHE A;  4OCF A;  3LGC A;  3CRT A;  2IFQ B;  3HKR A;  4Z7X A;  3EVI A;  1XCC A;  4BL7 A;  5CRW A;  5CNW A;  5IMD A;  2GSS A;  4KUN A;  3F0I A;  2FD3 A;  4G19 A;  3TB2 A;  3GKN A;  1N8J A;  2LKU A;  5GSS A;  4NWY A;  1IYH A;  1SK1 A;  4Z2T A;  1O8W A;  2EIO A;  2CAI A;  1B9Y C;  2YZH A;  4G10 A;  3RHC A;  1Z9H A;  2N5B A;  3HZ4 A;  2HSM B;  2H1D A;  1JHB A;  5A34 A;  1KTE A;  1TXX A;  1AQV A;  4YAP A;  2RII A;  1K3O A;  5DAL A;  1Z6M A;  3DRN A;  3KM6 A;  1Q4J A;  3BOA A;  2RM6 A;  1YY7 A;  3GUS A;  2C0G A;  3IHG A;  4DSR A;  1PN9 A;  1OE8 A;  3EPT A;  2WJU A;  1U3A A;  5IQY A;  3UAR A;  4ICY A;  4N30 A;  3UBL A;  3H93 A;  5HR3 A;  1NHY A;  2HSY A;  5CRE A;  3VWV A;  1LJR A;  1TDI A;  3HVV A;  3MWH A;  3ZYW A;  3DWV A;  1HNC A;  7GSS A;  4G0K A;  1EV9 A;  4IP1 A;  5HR1 A;  3LFL A;  1F9M A;  1QGV A;  2VLT A;  1SL2 B;  1PGT A;  3G7I A;  3EE2 A;  1GUL A;  4HU9 A;  4QMK A;  2VL3 A;  3TJJ A;  2MMO A;  2B1K A;  1WIK A;  4KA0 A;  3QFB C;  3VLN A;  2HFD A;  3KIJ A;  5JCW A;  2KOK A;  3GV1 A;  4J56 E;  1CQH A;  3KCM A;  4EXJ A;  4F03 A;  4XTS A;  2CVB A;  2FWF A;  3G7J A;  2FCH A;  4ZBD A;  2R0G A;  4HUA A;  5J47 A;  3PIN A;  5B8A A;  1PQN A;  2FLS A;  2WGR A;  2V32 A;  2PPT A;  2M72 A;  2L6C A;  4BWS A;  2D2Z A;  2GZP A;  4XCS A;  5ECS A;  1XVW A;  1JFU A;  1A2L A;  2PWJ A;  1B8X A;  1HQO A;  1HYU A;  1Z6N A;  2H0G A;  1S3A A;  5EPF A;  5HR2 A;  1O8X A;  2R6K A;  3LXZ A;  4PXO A;  2M80 A;  3DEX A;  3DIE A;  2B5X A;  6GSW A;  5JWO B;  1VRS D;  5D9T A;  4OO5 A;  1ERU A;  5F07 A;  4FQU A;  4AKH A;  2YP6 A;  5DCH A;  20GS A;  3C73 A;  4K6X A;  2X64 A;  3I69 A;  3L78 A;  2F8A A;  4K2D A;  2KLX A;  4GXZ A;  5CYY A;  2YCD A;  2CA8 A;  2CZ3 A;  1YEX A;  4QL9 A;  4TW5 A;  3WYW A;  4AF2 A;  1A23 A;  3DVW A;  4GDF A;  4KW6 A;  5KN3 A;  1SD9 A;  2HNL A;  1ZGN A;  5ECP B;  3ED3 A;  3VPQ A;  3VWU A;  2HRN A;  3IR4 A;  2RLI A;  3HA9 A;  3O76 A;  5B8B A;  2K8S A;  2VIM A;  4JE1 A;  2GTU A;  2DJK A;  2QA2 A;  2VCQ A;  3G7Y A;  1F2E A;  5F0G A;  5LD0 A;  3GHA A;  4IVF A;  2JZT A;  2LQO A;  3NOF A;  1YKA A;  1S3D A;  4V2M A;  2LRN A;  3F4T A;  1ZYE A;  4HQZ A;  2B5Y A;  3LOR A;  4TVE A;  3GL5 A;  2DIZ A;  3TJG A;  4POB A;  2YWM A;  1HNA A;  4OFM A;  5HFK A;  5ECK B;  1XWA A;  1I9D A;  4EVM A;  5E4W A;  2GGT A;  1N2A A;  4BVY A;  2ZNM A;  3EU4 A;  1G6Y A;  1X5E A;  2VAF A;  2XPE A;  5IPG A;  3ZRE A;  1DBY A;  4EKZ A;  3UMA A;  2FNO A;  2PUK C;  5G30 A;  1TKD B;  4K2X A;  5J4Y A;  4IEL A;  5A5H B;  2X8C A;  2XBI A;  3ZML A;  4AGS A;  1M7T A;  5IOW A;  2ES7 A;  4MK3 A;  4MCU A;  3KTL A;  4QQ7 A;  4ML1 A;  4HS1 A;  2DJ2 A;  2WB9 A;  2B3S A;  4XS1 A;  1EOG A;  1EEM A;  1EOH A;  2VOC A;  2FHE A;  2JSY A;  3KP8 A;  1V57 A;  4MF5 A;  3P90 A;  3ERG A;  1XXU A;  5IMA A;  1AC1 A;  2ZCT A;  3HYP A;  4X4J A;  1YVL A;  1AAZ A;  3OR5 A;  3CSH A;  4N10 A;  2H1L A;  4YAV A;  2RUE A;  4WR5 A;  4POM A;  3H8Q A;  3F4S A;  1X5C A;  1VF3 A;  3GTU A;  1GSU A;  4IW9 A;  3TRP A;  2WDU A;  4KF9 A;  1OC9 B;  1T7P B;  4TXO A;  4IKH A;  4Q5Q A;  1O6J A;  4KE3 A;  4XS4 B;  4JBB A;  1LBK A;  3HJO A;  5ECQ B;  2E0Q A;  3TGZ A;  1MTC A;  5EVO A;  3PPU A;  6GSX A;  2YZU A;  1TK8 B;  1HNB A;  1U87 A;  2YWN A;  2YPM A;  1XBS A;  4ZB6 A;  1XVQ A;  1AXD A;  4K8M A;  4ML6 A;  3GUR A;  3ME7 A;  4FO5 A;  1XWB A;  1YEP A;  4MJE A;  4HJM A;  3KD0 A;  2H01 A;  5A1N A;  1OKT A;  3QAW A;  3R3E A;  1ML6 A;  4IJI A;  3KJY A;  3CSJ A;  4JR6 A;  3Q19 A;  2NBS A;  1Z7R A;  2LUS A;  1SVO A;  3U6V A;  5AGY A;  1R5A A;  4NV2 A;  2H6X A;  5G31 A;  2YJ7 A;  13GS A;  3CSI A;  1UN2 A;  4KAE A;  1GTU A;  1K0A A;  3BCI A;  1XOB A;  1SK2 A;  3BCK A;  2HZE A;  2P5Q A;  4KCE A;  5INY A;  1K0C A;  5CP1 A;  5ECO B;  3GFK A;  4OCE A;  3ME8 A;  2DJ0 A;  4PNG A;  5DJL A;  5J9C A;  4YQU A;  4KSO A;  4K5R A;  1EV4 A;  3ZIT A;  2A2R A;  4J2F A;  1MDI A;  3VI5 A;  2XPD A;  4F9Z A;  2WUL A;  1JZR A;  1ZYN A;  1DSB A;  1TRU A;  2V2G A;  3LW9 A;  4IGJ A;  1G6W A;  1QMV A;  4NV5 A;  4EE0 A;  5IO2 A;  3C1R A;  4TKY A;  3I6A A;  4GSS A;  2FY6 A;  5FWG A;  4K1F A;  3FZA A;  2MMA A;  2BTO T;  3IHQ A;  1Z7P A;  1F6M C;  1GRX A;  2DKI A;  4TRX A;  1OVN A;  1HD2 A;  1ST9 A;  1FVJ A;  2FA8 A;  3CRU A;  1EP7 A;  3DYR A;  3M9K A;  4BVX A;  2J9H A;  3FY7 A;  1A0F A;  4N0V A;  2K18 A;  3KZQ A;  2VL2 A;  3UAP A;  3EU3 A;  4OD7 A;  2WFC A;  2NPB A;  4WBR D;  4TR3 A;  3CMI A;  2VUP A;  3G9B A;  3CWG A;  1OE7 A;  1GLP A;  2C80 A;  4PNF A;  2TIR A;  4XS6 A;  5A5K A;  3DKS A;  5G1K A;  3EIN A;  1QFN A;  1OAZ A;  3FR6 A;  1TI1 A;  2QGV A;  2HLS A;  3TKS C;  3D6I A;  4KH7 A;  2OBI A;  4YQM A;  1TU7 A;  2GQM A;  5HQP A;  2DKH A;  2VCX A;  3IA1 A;  5KN2 A;  1O85 A;  4EIQ A;  4A5P A;  3C71 A;  2C3T A;  4ZBB A;  3M9J A;  1GWC A;  2C4J A;  2DJJ A;  3FZ9 A;  3F6D A;  3ZIV A;  4ZL9 A;  4N11 A;  5KN1 A;  5C00 A;  5ECH B;  5C04 A;  1GSE A;  3GKK A;  4G9H A;  1EP8 A;  2B6M A;  1SL0 B;  2TRX A;  2IPA A;  3H4K A;  4EC0 A;  3MYD A;  6GSS A;  4GRF A;  1PN0 A;  5J5N A;  3M8N A;  2EFE A;  5E59 A;  4IBP A;  1THO A;  1ZL9 A;  4TR1 A;  2CQ9 A;  2H1B A;  2R5G A;  1DE1 A;  4DSS A;  3IC8 A;  3TJF A;  1SD8 A;  4KND A;  2DMM A;  2AB6 A;  2G2Q A;  1V40 A;  2UZ8 A;  1I5G A;  4K7I A;  1M99 A;  2MYG A;  3JCM L;  3GX0 A;  4PUF C;  3WT2 A;  4JR4 A;  4HOJ A;  2V6K A;  4KX4 A;  4NPB A;  1K3Y A;  1GP1 A;  2HYX A;  2O8V B;  1VF2 A;  1VF4 A;  4IQA A;  2DML A;  3WGX A;  3LWA A;  3UEM A;  4PX1 A;  2EIR A;  1PMT A;  1WJK A;  3FZ4 A;  4BWQ A;  2VCT A;  3L9S A;  1E6B A;  3UIW A;  2LJA A;  3LJR A;  5DDL A;  5L71 A;  2B5E A;  3QD9 A;  2PGT A;  1TRS A;  3F4R A;  4PTS A;  3WD6 A;  2FWG A;  3IDV A;  2H1A A;  3H1N A;  1T1V A;  3HHV A;  5ECL B;  5ELA A;  4RI6 A;  5IMF A;  5IIZ A;  3A3T A;  1T4Z A;  1B9X C;  3GKM A;  2KP2 A;  4V1A p;  3QAV A;  3QCP A;  1XPV A;  1EZK A;  4MA9 A;  4GF0 A;  4CY8 A;  4GSN A;  2NVL A;  2LRT A;  4ECI A;  3RBT A;  1TJD A;  2GZZ A;  4YQV A;  1AUC A;  2OE0 A;  2H73 A;  2IMK A;  5D96 A;  2J23 A;  4HEA 2;  4MP4 A;  1ZMA A;  4QL7 A;  3Q6O A;  2UV8 G;  2OAC A;  5AIV A;  2L5L A;  3A5W A;  1T4Y A;  3V1W A;  4HU7 A;  3WGE A;  2O7K A;  1GSS A;  4JU5 A;  2EFC A;  3IK9 A;  1FOV A;  3EWL A;  5H5Q A;  3Q18 A;  3TRQ A;  1R26 A;  4EUY A;  1GSF A;  2P31 A;  1E2Y A;  2QA1 A;  2H6Y A;  3CTG A;  3MNG A;  4WXT A;  4LLR A;  3IBH A;  5J3R A;  2L5O A;  5D93 A;  2ZUP A;  5DAK B;  2IMF A;  1SKR B;  2OA7 A;  2ALB A;  3ERF A;  1Y6E A;  2L59 A;  3D22 A;  1USB A;  2I1U A;  1J08 A;  5J9B A;  4MZW A;  2XBQ A;  2F9S A;  4XIH A;  1UA5 A;  2JZR A;  3P8W A;  1JZD A;  1XWK A;  2NTO A;  4K7O A;  4CY6 A;  2P0G A;  2GST A;  3TDG A;  4D73 A;  2O5V A;  1GUK A;  2DBC A;  1EWX A;  2F3M A;  4K7N A;  2FWE A;  1F3B A;  1M2B A;  3ZFL A;  1GTA A;  4ULX A;  5ID2 A;  3EMP A;  4AI6 A;  4FIW A;  1T8E B;  2JL4 A;  4RQX A;  2CZ2 A;  5EY6 A;  2H8L A;  5AIS A;  4Q5R A;  2HSN B;  1THX A;  5A4W A;  2H71 A;  4ILF A;  1GTB A;  4WF5 A;  4MF6 A;  4O5Q A;  3FKF A;  4V2N A;  2JSZ A;  2KHP A;  2R37 A;  1K0B A;  1PX7 A;  1H75 A;  4PGT A;  4ZB9 A;  2WS2 A;  4ZIL A;  1XWC A;  3CBU A;  5GZZ B;  4I6X A;  2R0P A;  2YWO A;  2IFQ A;  1TW9 A;  2V1M A;  3IK7 A;  4ECB A;  2GT6 A;  3PH9 A;  4Q5N A;  2KUC A;  1U3I A;  2HQT A;  4ZB7 A;  3UVH A;  4NAX A;  3KMN A;  1K0O A;  4ZXG A;  4IP6 A;  4Q5F A;  1K3L A;  1EEJ A;  2R2J A;  2VLV A;  4MH3 A;  2AUV A;  2GQK A;  4KDU A;  2LNS A;  4KGI A;  5DQS A;  4L5O A;  4NHW A;  4MMM A;  3PR8 A;  4EF0 A;  1Z5Y E;  3CXG A;  2H0I A;  1H4O A;  2HSM A;  3CYN A;  4KSM A;  1F37 A;  4H86 A;  2YV7 A;  1PL1 A;  3ZVJ A;  4L5L A;  4MLY A;  2X99 A;  2IMI A;  5J4V A;  2H19 A;  5J4U A;  1KEB A;  1BX9 A;  2YWI A;  1WE0 A;  4MPF A;  2N5A A;  3QOU A;  3LSZ A;  2LJR A;  1BED A;  4X1U A;  4WET A;  1MEK A;  5GAP D;  3IPZ A;  3RAZ A;  4IJ3 A;  3HVS A;  3IAS 2;  3ZTL A;  4XRD A;  1SYR A;  1J9B A;  1IYI A;  3HZ8 A;  2WCI A;  4EIP A;  3IC4 A;  2QC7 A;  3C1S A;  4CW9 A;  1XW6 A;  1VGL A;  5B7C A;  3IRA A;  5D8I A;  1ACV A;  2G0F A;  2A2P A;  17GS A;  3SBC A;  1N25 A;  4I2U A;  4IS0 A;  3E9J B;  2BMX A;  2JZS A;  1Y25 A;  4ZL8 A;  2HRK B;  4OO4 A;  2HSH A;  2E2M A;  2GVP A;  2B7K A;  3FEU A;  2EIQ A;  2WZ9 A;  4G0I A;  3KEB A;  1TTZ A;  2K8V A;  3IAM 2;  2CV4 A;  2IIY A;  4KB3 A;  2IJY A;  3ZRD A;  5DQY A;  1BG1 A;  2MZC A;  3GX8 A;  2PVO C;  5CRD A;  5JWQ B;  4PQI A;  5HFG A;  3RDW A;  1Q98 A;  1T00 A;  4EL1 A;  1NHO A;  4TR1 B;  1KBN A;  4ZB8 A;  3U5R E;  1BF5 A;  2HRF A;  2K6V A;  3GST A;  5ELG A;  2K9F A;  1YZX A;  2PU9 C;  3HVX A;  2F51 A;  5COH A;  1OC3 A;  2CVK A;  16GS A;  4LL4 B;  2I3Y A;  3ERW A;  3FHK A;  2M46 A;  1BAY A;  1XW9 A;  1QQ2 A;  1TK5 B;  1K0M A;  5JCU A;  1SJZ A;  3APS A;  2CT6 A;  2AYT A;  4BL7 B;  1R5P A;  3GH9 A;  4FYC A;  3Q74 A;  2FWH A;  2A4H A;  3UBK A;  3TKS E;  1B4P A;  4LL1 B;  2O89 A;  1YDK A;  1A2M A;  3C8E A;  3ZMK A;  1SKS B;  1A8Y A;  2NDO A;  2FA4 A;  2DLX A;  6GST A;  1S3C A;  3I43 A;  2HRA A;  5JCG A;  5A34 B;  5KN0 A;  3CTF A;  1FAA A;  2BJX A;  2H66 A;  3GMF A;  3MSZ A;  4EO3 A;  1EGO A;  5DAL B;  3DML A;  2HXK A;  4MJC A;  2DJ3 A;  4NMU A;  4MJB A;  2ON7 A;  2GDR A;  1NM3 A;  4POK A;  1WP0 A;  4GWR A;  4Z2R A;  1GNW A;  4E8E A;  2VL2 C;  4POL A;  2B1L A;  2PER A;  3TRX A;  4TR0 A;  1BG5 A;  5A5H A;  2L4Q A;  1X9W B;  2EFD A;  2LS5 A;  3EMX A;  5DCG A;  1TRV A;  3W8J A;  3NIV A;  3PGT A;  5DVB A;  4X43 A;  4PUR A;  1X5D A;  4O5R A;  4MJA A;  3BJ5 A;  5IPH A;  1GSD A;  4ZBA A;  1MD4 A;  3VK9 A;  3N9J A;  2VL9 A;  3A2X A;  2E2G A;  5CAX A;  2B7J A;  5GAN D;  3MIX A;  4E8H A;  4HZ2 A;  4RUV A;  1RK4 A;  1OC9 A;  3O6T A;  3K8N A;  3C7M A;  1K0D A;  1SEN A;  2H70 A;  4XS4 A;  3R2Q A;  1F3A A;  1SKW B;  3QR6 A;  3M1G A;  1YQ1 A;  2DJ1 A;  4NHZ A;  3QDN A;  1TU8 A;  2H6Z A;  2CAQ A;  3UJ1 A;  5DBQ A;  5ECI B;  3TKQ A;  3RPP A;  2H1G A;  3DVX A;  3FW2 A;  3TCO A;  3ZZX A;  1XZO A;  3EC3 A;  2VM1 A;  6GSU A;  3I9V 2;  2DSA A;  3AY8 A;  3F3R A;  1URM A;  2X4A A;  3ZVJ D;  4AKI A;  4MNN A;  4AJ7 A;  3W6G A;  4ZIJ A;  1MDJ A;  2H0H A;  2O87 A;  2PBJ A;  2VKZ G;  1NW2 A;  2A4V A;  2VCV A;  3E0U A;  1SJI A;  2P5R A;  3GKX A;  3DGQ A;  5AIX A;  3GYK A;  1O81 A;  3M0F A;  2VD1 A;  1G7E A;  5G5E A;  4EDY A;  3BD2 A;  3P7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...