3LYKA

Structure of stringent starvation protein a homolog from haemophilus influenzae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
VMTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQALPEDLMELNPYGTVPTLVDRDLVLFNSRIIMEYLDERFPHPPLMQVYPVSRAKDRLLMLRIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQMPYFMNEEFGLVDCYVAPLLWKLKHLGVEFTGTGSKAIKAYMERVFTRDSFLQSVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein A homolog
publication title Structure of stringent starvation protein A homolog from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lykA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lykA01
2RUEA 3QAGA 3CRUA 13GSA 3UBLA 3F63A 5CRHA 1EEMA 4LMVA 2OE0A 2VLTA 3KEBA 3KTBA 1NHOA 5D9XA 4L0WA 1XWBA 3QD9A 1V58A 2I81A 2MMNA 2WGRA 1PX6A 3ZMLA 2QKEA 5HR0A 1Z7RA 2VCQA 1F2EA 2LTKA 4FYUA 4K0GA 4K9ZA 3KGKA 1Z7PA 2B5XA 5B8AA 2H76A 3ZTLA 2CVKA 4PQHA 6GSYA 4OCFA 1EZKA 4HQZA 1TRSA 3GFKA 5B6NA 2F9SA 4I2TA 4IN0A 3UARA 1BYEA 2LJAA 3G9BA 3ZITA 4DVCA 2A2SA 4HEA2 1TP9A 4EE0A 3HY2A 2PERA 3ZFLA 3TKPA 3ZVJD 4MABA 1MDJA 3WT1A 5D9TA 1WPIA 1XIYA 3PPUA 1A8LA 4EL1A 1GH2A 2H70A 1OE8A 3P90A 1ERVA 1X5EA 4WETA 2PN8A 1HD2A 4JR4A 4OO4A 2NTOA 2O8VB 4EC0A 1G7OA 4F0CA 2JSZA 4TR1B 3DYRA 5DBQA 5ECOB 4L5OA 2OACA 4PNFA 3HVXA 2L4QA 2C0GA 4TW5A 1BQ7A 1YF0A 2TRCP 3F4TA 3PR8A 5HR3A 2AHEA 1U6TA 4LA1A 3WT2A 4O7HA 2C80A 4KB3A 2V6KA 3L9VA 1S3CA 3NIVA 1R26A 2KP1A 1WRYA 4OMVA 2CAQA 2OJLA 5E59A 3ZIJA 1YY7A 5D73A 4TOPA 4TKYA 1PL2A 1O73A 3TKQA 2V2GA 1GSYA 4XS1A 2VL9A 1ZYEA 4BVXB 3Q74A 2E0QA 3GMFA 3D0ZA 4MZCA 5CRWA 3QMXA 3A5WA 3IHQA 1PD21 4J2FA 3O6TA 4TR0A 1AXDA 3TB2A 2JACA 1Z6NA 3RBTA 2H73A 1K0NA 5J9CA 1QQ2A 4GWRA 2IJYA 4KUNA 2VL2A 1A23A 1AQWA 1J9BA 1FVKA 1H4OA 5AISA 3OR5A 1Q98A 1X9SB 4V2NA 1TK5B 4NHWA 1FVJA 2XPEA 3QPMA 3VPTA 3IOSA 2ES7A 2A2RA 1HNCA 2FNOA 1TU8A 2PWJA 1S3AA 4GQCA 2VCTA 1ML6A 2VCVA 2KHPA 4LL4B 4ISDA 2R4VA 1K0AA 4MF5A 5IQYA 3APSA 3DD3A 2A4VA 3EURA 4G0IA 5IO2A 3GTUA 5EY6A 3EC3A 1AUCA 2H1AA 2H6YA 1SYXA 1XCCA 4L5LA 2ALBA 5IO0A 1CQHA 2RLIA 2IPAA 18GSA 2AB6A 3KP8A 5F06A 1FB0A 1K0OA 4FYBA 3CSIA 4KA0A 1A2LA 1FOVA 1JZDA 3M8NA 3IAM2 3L4NA 3U5RE 1U3IA 4KGIA 3HZ4A 1Z5YE 2K9FA 3EWLA 2F51A 4PTSA 2VAFA 2V1MA 3IDVA 3GNJA 1BG5A 5HR1A 2CAIA 3UOMA 5AGYA 3LXTA 1XWGA 3MAKA 4Q5QA 3I9V2 3IC8A 3QOUA 4NMUA 2HI7A 1V40A 1OKDA 4EVMA 2LJKA 4N0VA 4TRXA 1X0RA 2IWTA 3LYKA 3VWVA 3TJKA 3I43A 2FGXA 1XFLA 3HHVA 1KBNA 2NVLA 1MD4A 3DXBA 4IQAA 2B7KA 5EVOA 3TOUA 3W8JA 3APOA 1WP0A 3J7Yb 2R5GA 1SJIA 2WDUA 2HSMB 3DGQA 2YWNA 1TDIA 5H5SA 3GN3A 3ME7A 4JE1A 2C0EA 5COHA 4POMA 3CSJA 5J9BA 2VLUA 3VK9A 5JCUA 1VRSD 1W89A 4ECIA 1TK0B 4IJ3A 1C72A 1AW9A 3M0FA 3KZQA 2H6XA 3NZNA 2GZZA 3C8EA 4HZ2A 5AN1A 1J0FA 4MH3A 1ZL9A 5GSTA 16GSA 4IBPA 3FR9A 3I69A 4IS0A 3F6FA 2VL3A 3VWWA 2CX4A 4YQVA 5IPGA 4KDYA 4OFNA 2VCXA 4PUAA 3D21A 5IIZA 3M9KA 4BVYA 2OBKA 2X8HA 2HT9A 1XXUA 1A2MA 4PURA 2L4CA 2PMTA 4RUVA 1FW1A 2VO4A 1QMVA 2YWIA 4G0LA 4AGSA 2GQLA 2IL3A 1JLVA 4DSSB 3M3MA 4TN8A 3KH7A 2IMFA 3DIEA 3P2AA 2DJ2A 5ECIB 1SKSB 5CREA 1T7PB 2B6MA 5AIVA 12GSA 1URMA 1XBSA 2NBSA 4NHZA 1MD3A 3QAVA 2AYTA 2VCWA 1GLPA 1K3YA 2RIIA 3IAS2 4JRRA 5JWRB 2FHEA 1XW9A 3TRPA 4IVFA 3LFLA 1ZCPA 2ZNMA 3TRXA 3ZMKA 1Q4JA 1B48A 5CYYA 1F3BA 3HA9A 4IP6A 3GYKA 1WJKA 5DJMA 6GSWA 1S3DA 2LEGA 5A4UA 2DSAA 1Z9HA 2LNTA 3FEUA 3O76A 2F8AA 1TU7A 2AUVA 4TVEA 1V98A 2FWGA 1F9MA 2X8CA 4MJCA 4POLA 2CZ2A 1E6BA 3SBCA 2LKUA 3F3RA 3GL3A 4EKZA 3ERGA 3TJBA 4BWQA 4JR6A 4XHMA 2WRTA 3J7Yk 2H19A 1K0BA 3UAPA 3F3QA 3IPZA 4K1FA 4XRAA 3RAZA 3GKKA 1DUGA 4PQIA 1UC7A 3VI7A 2GVPA 4I8BA 1NM3A 1R5AA 5DDLA 1ZZYA 4L8EA 2V6OA 3A3TA 2H1GA 1PL1A 1TKDB 4ML6A 3APQA 2FCHA 4DSRA 2ON7A 2ZCTA 2HRAA 2EIQA 1Z6MA 3L9UA 3W6GA 3MSZA 2PBJA 4POBA 5L71A 1W4VA 1YF1A 3L78A 3VPQA 1DSBA 3ED3A 4I6XA 3C7MA 2E2GA 3ERWA 4N0ZA 5J3RA 1U87A 4O92A 4F2IA 1PA3A 4KSOA 2DMMA 1XZOA 3QFBC 2LJRA 2GQKA 2K6VA 1UVZA 2H6ZA 2L5LA 4PUFC 5ECLB 4D73B 5LD0A 4O5RA 5DCGA 1GTBA 3GTUB 2ON5A 4KF9A 5ECRB 2I4AA 4GTUA 2DIZA 2YJHA 3DWVA 2REMA 2F8FA 3BD2A 1I9DA 2C1YA 5G5FA 2FWHA 1R5PA 3GSTA 2AV4A 4IJIA 1O8XA 1XOAA 2F3MA 4ID0A 1CQGA 2MZCA 4NWYA 1Z3EA 5IMVA 5D9WA 7GSSA 1GSQA 3EE2A 2YPMA 4ULXA 1WWJA 2VUPA 3CRTA 4KH7A 1YEXA 2H1BA 5ECNB 1VF1A 3PGTA 3ZREA 1GSFA 1T8EB 1JHBA 3KJYA 1PQNA 1XW6A 4ZBBA 2PVQA 5INYA 2VD0A 1LU4A 2C0FA 1DE1A 3TKSA 4K0NA 3RHCA 4OWYA 5G1LA 3D4MA 4MF7A 1A8YA 1PRXA 1SJZA 4USSA 1AC1A 5IMDA 5ID2A 2HRKA 4WBJA 5G1KA 4XS4A 2YCDA 5D8IA 1V57A 3CBUA 2BMXA 4CHSA 3H79A 1NW2A 5D96A 3UJ1A 5DQYA 1GUMA 4DSQA 2H0GA 3GURA 1X9WB 1K0DA 3H93A 1TOFA 3HVSA 2DLXA 3WD6A 1JZWA 3KTLA 4QL9A 1EOGA 1T1VA 2IFQA 19GSA 4IELA 3JCML 3KD0A 3RHBA 4E8HA 1ZYQB 4WEYA 4EDYA 4GQFA 4KX4A 5JWOB 6GSTA 4MZBA 4IW9A 5EPFA 3A2WA 2MMZA 4K7IA 4Q5RA 1GNWA 4IP1A 1EGOA 5CAXA 1WIKA 5IOWA 1M9AA 2DC5A 4BVYB 1USBA 2J23A 5F0GA 2E7PA 2LQQA 1GULA 3WGEA 1RW1A 1T4ZA 2GTUA 1VF2A 5CP1A 1X5DA 3KM6A 2PU9C 3M1GA 2JL4A 3LQ7A 1AIUA 3D5JA 1G7EA 2P31A 4MPFA 4NPBA 1PKZA 2GLRA 2M80A 1EV4A 1TRVA 3NOFA 4IKHA 3CSHA 4KCAA 2O85A 2IN3A 2H71A 1JZOA 1XWKA 3GKMA 2BJXA 4NV5A 5IMFA 1B8XA 3H8QA 2NPBA 3O3TA 4EXJA 4XIHA 3BBYA 1YJ6A 2NDOA 1YKAA 4Z7XA 2H30A 4TXOB 22GSA 3GSSA 2GQMA 1M0UA 5F8BA 4RQRA 8GSSA 4G19A 3I6AA 5IOXA 3KCMA 2B5EA 1KEBA 3S9FA 5A4WA 3A2XA 3GV1A 2KUCA 5ELAA 1MDIA 3RPPA 1O7UA 1PN9A 3Q19A 4MCUA 4MDCA 4NAXA 3ZFBA 3FY7A 2XHFA 4LMWA 3ME8A 4H86A 3H1NA 4KSMA 1O6JA 4F9ZA 1ZGNA 1HYUA 2QSIA 4L0UA 4RQXA 2P5QA 2EC4A 1GUHA 2LQOA 3FW2A 4YQUA 2C3QA 4X43A 1BEDA 1IYIA 2RM5A 3EU4A 4K7NA 2RUFA 1OC3A 2VL2C 1BX9A 4YQMA 4G9HA 4FIWA 2WZ9A 2HRNA 2VM2A 2HXKA 4QL7A 1MDKA 5IMCA 1ZOFA 5DAKA 3VWUA 5KN3A 1ZMAA 4LLRA 3GH6A 6GSXA 3KP9A 4ZL8A 4NXIA 4HI7A 2GZPA 1XWCA 3GIXA 2JZRA 5C00A 4ZBAA 3UEMA 3KIJA 2UZ8A 3RPNA 3LEFA 2L59A 1GLQA 2WS2A 2B1LA 3ZLPA 2IMEA 1OKTA 5EL8A 3FZ9A 2I3YA 2WJUA 3GA4A 2WCIA 1ST9A 1A24A 3LXZA 4G10A 4XRDA 2HZEA 1GWCA 1M9BA 2H74A 4BA7A 2JZTA 3TJGA 1EEJA 1GNEA 1NHYA 3TDGA 1WE0A 3UL3A 5E4WA 3HJOA 4V1Ag 5JCWA 20GSA 4ECCA 3U6VA 2OADA 1ILOA 2C3TA 4XTSA 1SD9A 5CRDA 3N5OA 4KE3A 2C8UA 4KDXA 1U3AA 3GX8A 2XBIA 1V9WA 4BVXA 2X8GA 3ZVJA 2MYGA 5ELGA 5J5NA 4KAEA 2RM6A 1XPVA 3TUEA 5F05A 1G0TA 2C3NA 2GSRA 3BCIA 1GUKA 4YH2A 5B7CA 3CTFA 4E8EA 4FYCA 4JEDA 2DIYA 2B3SA 3ZL5A 2MMAA 1TI3A 3C73A 4IQ1A 2WB9A 4MH2A 1GTUA 2MBTA 4V2LA 5BMUA 4O32A 1AAZA 2C4JA 4HU9A 3LYPA 2C0DA 4JU5A 5JWQB 1FG4A 1SK1A 3D22A 1FB6A 2MMOA 2X64A 2N5AA 1YDKA 5ID2B 3ISOA 4XS4B 3ERFA 1LBKA 2LRTA 2CV4A 1M2BA 1HNBA 4GF0A 2JADA 2VLVA 3C71A 2DJ1A 2IMIA 4PGTA 4OO5A 4KCEA 3QCPA 3UVTA 3GRXA 4ZILA 2N5BA 4BPYA 5H5QA 1WOUA 2O7KA 2AAWA 5ECQB 4K8MA 1SU9A 2FUG2 4MJBA 4PX1A 5DALA 3MWHA 1OVNA 3EMXA 5IMAA 2IFQB 4MJEA 1AQXA 1OE7A 1YQ1A 4J56E 4ECBA 1SYRA 2H01A 3TJFA 1QXHA 3G7YA 1X9MB 3L9SA 4V1Ap 4N10A 2YWMA 1EOHA 1XVQA 2GZYA 4WKWA 2FY6A 2YZUA 4K2DA 3F6DA 3FYGA 3GUSA 3DVXA 3EVIA 5GAPD 2H8LA 3UMAA 1X5CA 5ECSA 1MEKA 1B9XC 2H0HA 1QGVA 3ZZXA 3BJ5A 3CYNA 2OA7A 2QC7A 4BL7A 2CVDA 4ZBDA 3FKFA 2HSMA 2OE3A 1HNAA 4HUAA 3TJJA 1QUWA 3VWXA 2HSYA 2CX3A 3VLNA 3LWAA 2B1KA 3FK8A 4ZXGA 5ECPB 2OBIA 3PINA 10GSA 3FR6A 1T4YA 5LNKe 4QQ7A 1FAAA 1TW9A 2CVBA 2PGTA 4IHUA 2L57A 1PKWA 1ACVA 4X1UA 4OFTA 2R3XA 3W8SA 5FHIA 2FLSA 3DKSA 2VM1A 1O8WA 1T3BA 2GDRA 4WR4A 2QGVA 3SWLA 5H5RA 2DJKA 5J4UA 2GSSA 2EIRA 3HZ8A 1TTZA 2HNLA 2TRXA 3F4RA 3EYTA 1O81A 1KNGA 4ZB9A 1AQVA 2FA4A 2LUSA 1WMJA 3QAWA 6GSVA 3CXGA 4JZQA 3LJRA 2LV3A 4K6XA 2HLSA 3UBKA 5DJLA 2K18A 2XC2A 1OYJA 5GZZB 3E9JB 3GHAA 4DSSA 3IK7A 3A2VA 1JLWA 2CQ9A 4WF4A 4ECJA 4TXVA 5LCZA 3FZ5A 1B9YC 3VFIA 1SJ6A 2I1UA 4F03A 1TJDA 1T00A 2FWFA 3QR6A 1A0FA 2YP6A 1BAYA 5B6MA 2MBSA 4ZB8A 5DAKB 4ZB6A 4LL1B 1GTIA 1I5GA 3BOAA 4OFMA 1GTAA 4EO3A 4MLYA 1BJXA 1NSWA 4GLTA 4RI7A 1LJRA 4HQSA 1K0MA 4ZL7A 3DRNA 4MMMA 5C04A 5F07A 3IA1A 3C1SA 4GXZA 1OAZA 2O87A 3C1RA 2JSYA 4MK3A 2HFDA 2HZEB 2B5YA 5KEJA 2K8VA 4EDZA 5DQSA 1FO5A 1Y6EA 1YEPA 4N11A 5D93A 4TR3A 2KP2A 3TCOA 2OE1A 2XPDA 3G7IA 1O85A 3VURA 4MA9A 5DCHA 4I2UA 3IK9A 5A5KA 4FH8A 1M2DA 2JZSA 3DMLA 5G31A 5G5EA 1A0RP 2GS3A 4EF0A 3EMPA 3D6IA 3HXSA 4HJMA 2N5FA 2G0FA 3F9UA 2YWOA 3HYPA 3TKSC 4AJ8A 2YN1A 1R4WA 2H75A 1OC9A 1RQMA 3M9JA 5HFIA 1ERWA 2YV7A 4AJ7A 3CMIA 2LRNA 6GSUA 1F37A 2YANA 1KTEA 2G2QA 3RDWA 4ML1A 1K3LA 2L6DA 2H1DA 3KMOA 4GRFA 4MPGA 5HFKA 2HSHA 1VGLA 1EP8A 1K0CA 5ECKB 5KN2A 3HCZA 4PQ1A 1EGRA 4F0BA 1ERTA 3ZRDA 4POKA 3P7XA 4GSTA 2KLXA 4CW9A 1FHEA 2R6KA 4MJAA 3QFAC 2H72A 2DJ3A 2DJJA 3BCKA 3IRAA 5KN0A 3WYWA 3FR3A 14GSA 2I9HA 1TRUA 5B8BA 4D73A 3MDKA 2GSTA 4YAVA 2PUKC 2V41A 1YZXA 5CO3A 5J41A 4V2MA 4WR5A 4RI6A 3FZ4A 2YV9A 2PPTA 5ENUA 3GKXA 2LRCA 1GRXA 5HQPA 3QDNA 3VI5A 5AIXA 2M72A 2CZ3A 4BWSA 5GSSA 4NV2A 3DVWA 3UVHA 2K8SA 2M46A 5DALB 4HJ2A 4CDOA 4DEJA 2VIMA 3PH9A 3D4TA 3IC4A 1TXXA 4TR4A 3E3EA 3KXOA 4Q5NA 4KNDA 5DVBA 3FHKA 2YNXA 1B4QA 1GSUA 3Q18A 3ZYWA 1ABAA 5G30A 2AJQB 1QK8A 4G2EA 1OC8A 1SL1B 1U88A 2Z9SA 2GSQA 4MP4A 1THXA 4OD7A 3N9JA 4MZWA 2YZHA 1GSEA 3L0HA 1ON4A 4AJ6A 3EINA 4PXOA 3EU3A 4TR1A 1R7HA 4BL7B 1F3AA 1E2YA 3V1WA 1VF3A 2LS5A 4ZL9A 3TKRA 2HZFA 3MNGA 5D9VA 3R3EA 1RK4A 3H4KA 3IV4A 5G2ZA 4EUYA 3LSZA 2L6CA 1TRWA 1XVWA 5IMZA 5CRGA 1PMTA 5FWGA 4ACSA 4WF5A 4HU7A 9GSSA 1XW5A 4F82A 1J08A 2P5RA 5HR2A 1PGTA 3HJMA 1Y25A 4N30A 1UA5A 4X0XA 4P3YB 2VOCA 2LSTA 3HD5A 2WULA 3LORA 4I5QA 3F8UA 2DBCA 1M7TA 3P8WA 4KW6A 1EV9A 3F4SA 5A4VA 4J57E 1IYHA 4GSSA 2EIOA 3TGZA 2WFCA 3GL5A 4K7OA 4JBBA 3HDCA 1N8JA 1SENA 1EWXA 2TIRA 3E0UA 2FWEA 5CNWA 2FD3A 1TI1A 3KMNA 3KH9A 1SL2B 3K8NA 1SK2A 2J9HA 1B4PA 1GSDA 1DE2A 4PNGA 2CT6A 5FT3A 1UN2A 1MTCA 2GGTA 5IM9A 3F0IA 4HS1A 1M99A 1HQOA 3G7JA 1SK0A 1YKCA 2HRKB 3CTGA 2HE3A 2D2ZA 5GAND 3AY8A 6GSSA 5HFGA 1SD8A 1F6MC 2CA8A 1K3OA 1M2AA 3IBHA 3WGXA 4TXOA 4AF2A 2X99A 3TKSE 1GP1A 1XWAA 2R37A 1QFNA 4XS6A 2GT6A 1DBYA 3IR4A 4MF6A 3GX0A 1XOBA 4HZ4A 4ILFA 2BTOT 2HSNB 3US3A 4GCIA 4HOJA 2IMKA 2PVOC 1PSQA 3HKRA 2LNSA 1PX7A 4YAPA 1THOA 3ZIVA 3TRQA 2YOIA 3R2QA 2DMLA 5JCGA 2ZUPA 4HDEA 5ECHB 17GSA 1N2AA 2YJ7A 1GSSA 3IXRA 3DEXA 4KDUA 2P0GA 4FQUA 4OCEA 2B7JA 1H75A 2VCZA 1G6WA 5IPHA 1EP7A 2FA8A 3LGCA 2DJ0A 2E2MA 11GSA 3WGDA 2KOKA 2H0IA 1VF4A 3GH9A 3HVVA 2GT5A 3Q6OA 1SKRB 4WBRD 2XBQA 3LG6A 4XCSA 1SL0B 3UIWA 3TOTA 1OC9B 2R2JA 2O89A 1A2JA 3IE3A 2HQTA 1V2AA 4GSNA 3FZAA 4Q5FA 4ZIJA 2OKAA 2H66A 4IGJA 2V32A 1ERUA 1TK8B 3GKNA 2VD1A 3FRCA 4G0KA 2IMDA 2IIYA 2JU5A 3HJPA 5KN1A 4FO5A 4WXTA 1GL8A 5ECMB 2HRFA 1SKWB 1JFUA 2HYXA 1JZRA 2L5OA 5ABRA 1G6YA 4I97A
chains in the Genus database with same CATH superfamily
2RUEA 3QAGA 3CRUA 13GSA 3UBLA 3F63A 5CRHA 1EEMA 4LMVA 2OE0A 2VLTA 3KEBA 3KTBA 1NHOA 5D9XA 4L0WA 1XWBA 3QD9A 2R0PA 1V58A 2I81A 2MMNA 5A34B 2WGRA 1PX6A 3ZMLA 1FOHA 2QKEA 5HR0A 1Z7RA 2VCQA 1F2EA 2LTKA 4FYUA 4K5SA 4K0GA 4K9ZA 3KGKA 1Z7PA 2B5XA 5B8AA 2H76A 3ZTLA 2CVKA 2EFCA 4PQHA 6GSYA 4OCFA 1EZKA 4HQZA 1TRSA 3GFKA 5B6NA 2F9SA 4I2TA 4IN0A 3UARA 1BYEA 2LJAA 3G9BA 3ZITA 4DVCA 2A2SA 4HEA2 1TP9A 2R0CA 4EE0A 3HY2A 2PERA 3ZFLA 3IHGA 4PHZC 3TKPA 3ZVJD 4MABA 4EIPA 1MDJA 3WT1A 5D9TA 1WPIA 1XIYA 3PPUA 1A8LA 4EL1A 1GH2A 2H70A 1OE8A 3P90A 2DKHA 1ERVA 1X5EA 4WETA 2PN8A 1HD2A 4JR4A 4OO4A 2NTOA 2O8VB 4EC0A 1G7OA 4F0CA 2JSZA 2WVXB 4TR1B 3DYRA 5DBQA 5ECOB 4L5OA 2OACA 4PNFA 3HVXA 2L4QA 2C0GA 4TW5A 1BQ7A 1YF0A 2TRCP 3F4TA 3PR8A 5HR3A 2AHEA 1U6TA 4LA1A 3WT2A 4O7HA 2C80A 4KB3A 3HVNA 2V6KA 3L9VA 1S3CA 3NIVA 4PI2C 1R26A 2KP1A 1WRYA 4OMVA 2CAQA 2OJLA 5E59A 3ZIJA 1YY7A 5D73A 4TOPA 4TKYA 1PL2A 1O73A 3TKQA 2V2GA 1GSYA 4XS1A 2VL9A 1ZYEA 4BVXB 3RGBC 5J40A 3Q74A 2E0QA 3GMFA 3D0ZA 4MZCA 5CRWA 3QMXA 3A5WA 3IHQA 1PD21 4J2FA 1YVLA 3O6TA 4TR0A 1AXDA 3TB2A 2JACA 1Z6NA 3RBTA 2H73A 1K0NA 5J9CA 1QQ2A 4GWRA 2IJYA 4KUNA 2VL2A 1A23A 1AQWA 1J9BA 1FVKA 1H4OA 5AISA 3OR5A 1Q98A 1X9SB 4V2NA 1TK5B 5BMUB 4NHWA 1FVJA 2XPEA 3QPMA 3VPTA 4G01A 3IOSA 2ES7A 2A2RA 1HNCA 2FNOA 1TU8A 2PWJA 1S3AA 4GQCA 2VCTA 1ML6A 2VCVA 2KHPA 4LL4B 4ISDA 2R4VA 1K0AA 4MF5A 5IQYA 3APSA 3DD3A 1PFOA 2QA1A 2A4VA 3EURA 4G0IA 5IO2A 3GTUA 5EY6A 3EC3A 1AUCA 2H1AA 2H6YA 2X49A 1SYXA 2WZSA 1XCCA 4L5LA 2ALBA 5IO0A 1CQHA 2RLIA 2IPAA 18GSA 2AB6A 3KP8A 5F06A 1FB0A 1K0OA 4FYBA 3CSIA 4KA0A 1A2LA 1M3IA 1FOVA 1JZDA 3M8NA 3IAM2 3L4NA 3U5RE 1U3IA 4KGIA 3HZ4A 1Z5YE 2K9FA 3EWLA 2F51A 4PTSA 2VAFA 2V1MA 3IDVA 3GNJA 2WW0A 1BG5A 5HR1A 2CAIA 3UOMA 5AGYA 3LXTA 1XWGA 3MAKA 4Q5QA 3I9V2 3IC8A 3QOUA 4NMUA 2A2PA 2HI7A 1V40A 1OKDA 4EVMA 2LJKA 4N0VA 4TRXA 1X0RA 2IWTA 3LYKA 3VWVA 3TJKA 3I43A 2FGXA 1XFLA 3HHVA 1KBNA 2NVLA 1MD4A 3DXBA 4IQAA 2B7KA 5EVOA 3TOUA 3W8JA 3APOA 1WP0A 3J7Yb 2R5GA 1SJIA 2WDUA 5A5HB 2HSMB 3DGQA 2YWNA 1TDIA 5H5SA 3GN3A 3ME7A 4JE1A 2C0EA 5COHA 4POMA 3CSJA 5J9BA 2VLUA 3VK9A 5JCUA 1VRSD 1W89A 4ECIA 1TK0B 4Z2UA 4IJ3A 1C72A 1AW9A 3M0FA 3KZQA 2H6XA 3NZNA 2GZZA 3C8EA 4HZ2A 5AN1A 1J0FA 4MH3A 1ZL9A 5GSTA 16GSA 4IBPA 3FR9A 3I69A 4IS0A 3F6FA 2VL3A 3VWWA 2CX4A 4YQVA 5IPGA 4KDYA 4OFNA 2VCXA 4PUAA 3D21A 5IIZA 3M9KA 4BVYA 2OBKA 2X8HA 2HT9A 1XXUA 1A2MA 4PURA 2L4CA 2PMTA 4RUVA 1FW1A 2VO4A 1QMVA 2YWIA 4G0LA 4AGSA 2GQLA 2IL3A 1JLVA 4MNNA 4DSSB 3M3MA 4TN8A 3KH7A 2IMFA 3DIEA 3P2AA 2DJ2A 5ECIB 1SKSB 4W66A 5CREA 1T7PB 2B6MA 5AIVA 12GSA 1URMA 1XBSA 2NBSA 4NHZA 1MD3A 3QAVA 2AYTA 2VCWA 1GLPA 1K3YA 1YEWC 2RIIA 3IAS2 4JRRA 5JWRB 2FHEA 1XW9A 3TRPA 4IVFA 3LFLA 1ZCPA 2ZNMA 3TRXA 3ZMKA 2A4HA 1Q4JA 1B48A 5KOXA 5CYYA 1F3BA 3HA9A 4IP6A 3GYKA 1WJKA 5DJMA 6GSWA 1S3DA 2LEGA 5A4UA 2DSAA 3HMJG 1Z9HA 2LNTA 3FEUA 3O76A 2F8AA 1TU7A 2AUVA 4TVEA 1V98A 2FWGA 1SVMA 1F9MA 2X8CA 4MJCA 4POLA 2CZ2A 1E6BA 3SBCA 2LKUA 3F3RA 2R0GA 3GL3A 4EKZA 3ERGA 3TJBA 4BWQA 4AKIA 4JR6A 4XHMA 2OT3A 2WRTA 3J7Yk 2H19A 1K0BA 3UAPA 3F3QA 3IPZA 4K1FA 4XRAA 3RAZA 3GKKA 1DUGA 4PQIA 1UC7A 3VI7A 2GVPA 4I8BA 1NM3A 1R5AA 5DDLA 1ZZYA 4L8EA 2V6OA 3A3TA 2H1GA 1PL1A 1TKDB 4ML6A 3APQA 2FCHA 4DSRA 2ON7A 4Z2TA 2ZCTA 2HRAA 2EIQA 4A5PA 1Z6MA 3L9UA 3W6GA 3MSZA 2PBJA 4POBA 5L71A 1W4VA 1YF1A 3L78A 3VPQA 2VKZG 1DSBA 3ED3A 4I6XA 3C7MA 2E2GA 3ERWA 4N0ZA 5J3RA 1U87A 4O92A 4F2IA 1PA3A 4KSOA 2DMMA 1XZOA 3QFBC 2X4AA 2LJRA 2GQKA 2K6VA 1UVZA 2H6ZA 2L5LA 4PUFC 5ECLB 4D73B 5LD0A 4O5RA 5DCGA 1GTBA 3GTUB 2ON5A 1I1IP 4KF9A 5ECRB 2I4AA 4GTUA 2DIZA 2YJHA 3DWVA 2REMA 2F8FA 2WVZA 3BD2A 1I9DA 2C1YA 5G5FA 2FWHA 1R5PA 3GSTA 2AV4A 4IJIA 1O8XA 3CQFA 1XOAA 2F3MA 4ID0A 4X4JA 1CQGA 2MZCA 4NWYA 1Z3EA 5IMVA 5D9WA 7GSSA 1GSQA 3EE2A 2YPMA 4ULXA 1WWJA 2VUPA 3CRTA 4KH7A 1YEXA 2H1BA 5ECNB 1VF1A 3PGTA 3ZREA 1GSFA 1T8EB 1JHBA 3KJYA 1PQNA 1XW6A 4ZBBA 2PVQA 5INYA 2VD0A 1LU4A 5J4YA 2C0FA 1DE1A 3TKSA 4K0NA 3RHCA 4OWYA 5G1LA 3D4MA 4MF7A 1A8YA 1PRXA 1SJZA 4USSA 1AC1A 5IMDA 5ID2A 2HRKA 4WBJA 5G1KA 4XS4A 2YCDA 5D8IA 1V57A 3CBUA 2BMXA 4CHSA 3H79A 1NW2A 5D96A 3UJ1A 5DQYA 1GUMA 4DSQA 2H0GA 3GURA 5KOWA 1X9WB 1K0DA 3H93A 1TOFA 3HVSA 2DLXA 3WD6A 1JZWA 3KTLA 4QL9A 1EOGA 1T1VA 2IFQA 19GSA 4IELA 3JCML 3KD0A 3RHBA 4E8HA 1ZYQB 4WEYA 4EDYA 4GQFA 4KX4A 5JWOB 6GSTA 4MZBA 4IW9A 5EPFA 3A2WA 1SVLA 2MMZA 4K7IA 4Q5RA 1GNWA 4IP1A 1EGOA 5CAXA 1WIKA 5IOWA 1M9AA 2DC5A 4BVYB 1USBA 2J23A 5F0GA 2E7PA 2LQQA 1GULA 3WGEA 1RW1A 1T4ZA 2GTUA 1VF2A 2EFDA 5CP1A 1X5DA 3KM6A 2PU9C 3M1GA 2JL4A 3LQ7A 1AIUA 3D5JA 1G7EA 2P31A 3MIXA 4MPFA 4NPBA 1PKZA 2GLRA 2M80A 1EV4A 1TRVA 3NOFA 4IKHA 3CSHA 4KCAA 2O85A 2IN3A 2H71A 1JZOA 1XWKA 3GKMA 2BJXA 4NV5A 5IMFA 1B8XA 3H8QA 2NPBA 3O3TA 4EXJA 4XIHA 3BBYA 1YJ6A 5A1NA 2NDOA 1YKAA 4Z7XA 2H30A 4HSCX 4TXOB 22GSA 3GSSA 2GQMA 1M0UA 5F8BA 4RQRA 8GSSA 4G19A 3I6AA 5IOXA 3KCMA 2B5EA 1KEBA 3S9FA 4K2XA 5A4WA 3A2XA 3GV1A 2KUCA 5ELAA 1MDIA 3RPPA 1O7UA 4EIQA 1PN9A 3Q19A 4MCUA 4MDCA 4NAXA 3ZFBA 3FY7A 2XHFA 4LMWA 3ME8A 4H86A 3H1NA 4KSMA 1O6JA 4F9ZA 1ZGNA 1HYUA 2QSIA 4L0UA 4RQXA 1Y1UA 2P5QA 2DKIA 2EC4A 1GUHA 2LQOA 3FW2A 4YQUA 2C3QA 4X43A 1BEDA 1IYIA 2RM5A 3EU4A 4K7NA 2RUFA 1OC3A 1ZYPA 2VL2C 1BX9A 4YQMA 2O5VA 4G9HA 4FIWA 2WVYA 2WZ9A 2HRNA 2VM2A 2HXKA 4QL7A 1MDKA 5IMCA 1ZOFA 5DAKA 3VWUA 5KN3A 1ZMAA 4LLRA 3GH6A 2QA2A 6GSXA 4PI0C 3KP9A 4ZL8A 4NXIA 4HI7A 2GZPA 1XWCA 3GIXA 2JZRA 5C00A 4ZBAA 3UEMA 3KIJA 2UZ8A 3RPNA 3LEFA 2L59A 1GLQA 2WS2A 2B1LA 3ZLPA 2IMEA 1OKTA 5EL8A 3FZ9A 2I3YA 1BG1A 2WJUA 3GA4A 2WCIA 1ST9A 1A24A 3LXZA 4G10A 4XRDA 2HZEA 1GWCA 1M9BA 2H74A 4BA7A 2JZTA 3TJGA 1EEJA 1GNEA 1NHYA 3TDGA 1WE0A 3UL3A 5E4WA 3HJOA 4V1Ag 5JCWA 20GSA 4ECCA 3U6VA 2OADA 1ILOA 2C3TA 4XTSA 3FMWA 1SD9A 5CRDA 3N5OA 4KE3A 2C8UA 4KDXA 1U3AA 3GX8A 2XBIA 1V9WA 4BVXA 2X8GA 3ZVJA 2MYGA 5ELGA 5J5NA 4KAEA 2RM6A 1XPVA 3TUEA 5F05A 1G0TA 2C3NA 2GSRA 3BCIA 1GUKA 4YH2A 5B7CA 3CTFA 4GDFA 4E8EA 4FYCA 4JEDA 2DIYA 2B3SA 3ZL5A 2MMAA 1TI3A 3C73A 4IQ1A 1S4BP 2WB9A 4MH2A 1GTUA 2MBTA 4V2LA 5BMUA 4O32A 1AAZA 2C4JA 4HU9A 3LYPA 2C0DA 4JU5A 5JWQB 4ICYA 1FG4A 1SK1A 3D22A 1FB6A 2MMOA 2X64A 2N5AA 1YDKA 5ID2B 3ISOA 4XS4B 3ERFA 1LBKA 2LRTA 2WW2A 2CV4A 1M2BA 1HNBA 4GF0A 2JADA 2VLVA 3C71A 2DJ1A 2IMIA 4PGTA 4OO5A 4KCEA 2EFHA 3QCPA 3UVTA 3GRXA 4ZILA 2N5BA 4BPYA 5H5QA 1WOUA 2O7KA 2AAWA 5ECQB 4K8MA 1SU9A 3MYDA 2FUG2 4MJBA 4PX1A 5DALA 3MWHA 1OVNA 3EMXA 5IMAA 2IFQB 4MJEA 1AQXA 1OE7A 1YQ1A 4J56E 4ECBA 1SYRA 2H01A 3TJFA 1QXHA 3G7YA 1X9MB 3L9SA 4V1Ap 4N10A 2YWMA 1EOHA 1XVQA 2GZYA 4WKWA 2FY6A 2YZUA 4K2DA 3F6DA 4K5RA 3FYGA 3GUSA 3DVXA 3EVIA 5GAPD 2H8LA 3UMAA 1X5CA 5ECSA 1MEKA 1B9XC 2H0HA 1QGVA 3ZZXA 3BJ5A 3CYNA 2OA7A 2QC7A 4BL7A 2CVDA 4ZBDA 3FKFA 2HSMA 2OE3A 1HNAA 4HUAA 3TJJA 1QUWA 3VWXA 2HSYA 2CX3A 3VLNA 2B1KA 3FK8A 3LWAA 4ZXGA 5ECPB 2OBIA 3PINA 10GSA 3FR6A 1T4YA 5LNKe 4QQ7A 1FAAA 1TW9A 2CVBA 2PGTA 2L57A 4IHUA 1PKWA 1ACVA 4X1UA 4OFTA 5A1NB 4FXYP 2R3XA 3W8SA 5FHIA 2FLSA 3DKSA 2VM1A 1O8WA 1T3BA 2GDRA 4WR4A 2QGVA 3SWLA 5H5RA 2DJKA 5J4UA 2GSSA 2EIRA 3HZ8A 1TTZA 2HNLA 2TRXA 3F4RA 3EYTA 1O81A 1KNGA 4ZB9A 1AQVA 2FA4A 2LUSA 1WMJA 3QAWA 6GSVA 3CXGA 4JZQA 3LJRA 2LV3A 4K6XA 2HLSA 3UBKA 5DJLA 2K18A 2XC2A 1OYJA 5GZZB 3E9JB 3GHAA 4DSSA 3IK7A 1SVOA 3A2VA 1JLWA 1M3JA 2CQ9A 4WF4A 4ECJA 4TXVA 5LCZA 3FZ5A 1B9YC 3VFIA 1SJ6A 2I1UA 4F03A 1TJDA 1T00A 2FWFA 3QR6A 1A0FA 2YP6A 4QMKA 2UV8G 1BAYA 4BIKA 5B6MA 2MBSA 4ZB8A 5DAKB 4ZB6A 4LL1B 4YKGA 1GTIA 1I5GA 3CWGA 3BOAA 4OFMA 4AKXB 1GTAA 4EO3A 4MLYA 1BJXA 1NSWA 4GLTA 4RI7A 1LJRA 4HQSA 1K0MA 4ZL7A 2HSNA 3DRNA 4MMMA 5C04A 5F07A 3IA1A 3C1SA 4GXZA 1OAZA 2O87A 3C1RA 2JSYA 4MK3A 2HFDA 2HZEB 2B5YA 5KEJA 2K8VA 4EDZA 5DQSA 1FO5A 1Y6EA 1YEPA 4N11A 5D93A 4TR3A 2KP2A 3CHXC 3TCOA 2OE1A 2XPDA 3G7IA 1O85A 3VURA 4MA9A 5DCHA 4I2UA 3IK9A 5A5KA 4ZB7A 4FH8A 1M2DA 2JZSA 3DMLA 5G31A 5G5EA 1A0RP 5BRTA 3A5IA 2GS3A 4EF0A 3EMPA 3D6IA 3HXSA 4HJMA 2EFEA 4YKFA 2N5FA 2G0FA 3F9UA 2YWOA 3HYPA 3TKSC 4AJ8A 2YN1A 1R4WA 2H75A 1OC9A 1RQMA 3M9JA 5HFIA 1ERWA 2YV7A 4AJ7A 3CMIA 2LRNA 6GSUA 1F37A 2YANA 1KTEA 2G2QA 3RDWA 4ML1A 1K3LA 2L6DA 4AKHA 2H1DA 3KMOA 4GRFA 4MPGA 5HFKA 2HSHA 1VGLA 1EP8A 1K0CA 5ECKB 5KN2A 3HCZA 4PQ1A 1EGRA 4F0BA 1ERTA 3ZRDA 4POKA 3P7XA 4GSTA 2KLXA 4CW9A 1FHEA 2R6KA 4MJAA 3QFAC 2H72A 4Z2RA 2DJ3A 2DJJA 3BCKA 3IRAA 5KN0A 3WYWA 3FR3A 14GSA 2I9HA 1TRUA 5B8BA 4D73A 3MDKA 2GSTA 4YAVA 2PUKC 2V41A 1YZXA 4O5UA 5CO3A 3TU3B 5J41A 4V2MA 4WR5A 4RI6A 3FZ4A 2YV9A 2PPTA 5ENUA 3GKXA 5A34A 2LRCA 1GRXA 5HQPA 3QDNA 3VI5A 5AIXA 2M72A 2CZ3A 4BWSA 5GSSA 4NV2A 3DVWA 3UVHA 2K8SA 2M46A 5DALB 4HJ2A 4CDOA 4DEJA 2VIMA 3PH9A 3D4TA 3IC4A 1TXXA 4TR4A 3E3EA 3KXOA 4Q5NA 4KNDA 5DVBA 3FHKA 2YNXA 1B4QA 1GSUA 5J4VA 3Q18A 3ZYWA 1ABAA 5G30A 2AJQB 1QK8A 4G2EA 1OC8A 1SL1B 1U88A 2Z9SA 2GSQA 4MP4A 3LW9A 1THXA 4OD7A 3N9JA 4MZWA 2YZHA 1GSEA 3L0HA 1ON4A 4AJ6A 3EINA 2WVXA 4PXOA 3EU3A 4TR1A 1R7HA 4BL7B 1F3AA 1E2YA 3V1WA 1VF3A 2WW3A 2LS5A 4ZL9A 3TKRA 2HZFA 3MNGA 5D9VA 3R3EA 1RK4A 3H4KA 3IV4A 5G2ZA 4EUYA 3LSZA 4E68A 2L6CA 4O5QA 1TRWA 3RFRC 1XVWA 5IMZA 5CRGA 1XG8A 1PMTA 5FWGA 4ACSA 4WF5A 4HU7A 4CY8A 9GSSA 1XW5A 4CY6A 4F82A 1J08A 2P5RA 5HR2A 1PGTA 3HJMA 1Y25A 4N30A 1UA5A 4X0XA 4P3YB 2VOCA 2LSTA 3HD5A 2WULA 3LORA 4I5QA 3F8UA 2DBCA 1M7TA 3P8WA 5J47A 4KW6A 1EV9A 3F4SA 5A4VA 4J57E 1IYHA 4GSSA 2EIOA 3TGZA 2WFCA 3GL5A 1BF5A 4K7OA 4JBBA 3HDCA 1N8JA 1SENA 1EWXA 2TIRA 1TXUA 3E0UA 2FWEA 5CNWA 2FD3A 1TI1A 3KMNA 3KH9A 1SL2B 3K8NA 1SK2A 2J9HA 1B4PA 1GSDA 1DE2A 4PNGA 2CT6A 5FT3A 1UN2A 1MTCA 2GGTA 5IM9A 3F0IA 4HS1A 1M99A 1HQOA 3G7JA 1SK0A 1YKCA 3CTGA 2HRKB 2HE3A 2D2ZA 1PN0A 2H1LA 5GAND 3AY8A 6GSSA 5HFGA 1SD8A 1F6MC 2CA8A 1K3OA 1M2AA 3IBHA 3WGXA 4TXOA 4AF2A 2X99A 3TKSE 4AI6A 1GP1A 1XWAA 2R37A 1N25A 1QFNA 4XS6A 2GT6A 1DBYA 3IR4A 4MF6A 3GX0A 1XOBA 4HZ4A 2WW1A 4ILFA 2BTOT 2HSNB 3US3A 4GCIA 4HOJA 2IMKA 2O36A 2PVOC 1PSQA 3HKRA 2LNSA 1PX7A 4YAPA 1THOA 3ZIVA 3TRQA 2YOIA 3R2QA 2DMLA 5JCGA 2ZUPA 4HDEA 5ECHB 17GSA 1N2AA 1S3RA 2YJ7A 1GSSA 3IXRA 3DEXA 3EPTA 4KDUA 2P0GA 4FQUA 4OCEA 2B7JA 1H75A 2VCZA 1G6WA 5IPHA 1EP7A 2FA8A 3LGCA 2DJ0A 2E2MA 11GSA 3WGDA 2KOKA 2H0IA 1VF4A 3GH9A 3HVVA 2GT5A 3Q6OA 1SKRB 4WBRD 4N3ZA 2XBQA 3LG6A 4XCSA 5A5HA 1SL0B 3UIWA 3TOTA 1OC9B 2R2JA 2O89A 1A2JA 4AKGA 3IE3A 2HQTA 1V2AA 4GSNA 3FZAA 4Q5FA 4ZIJA 2OKAA 2H66A 4IGJA 2V32A 1ERUA 1TK8B 3GKNA 2VD1A 3FRCA 1ZYNA 4G0KA 2IMDA 2IIYA 2JU5A 3HJPA 5KN1A 4FO5A 4WXTA 1GL8A 5ECMB 2HRFA 1SKWB 1JFUA 2HYXA 1JZRA 2L5OA 2O3EA 5ABRA 1G6YA 4I97A
chains in the Genus database with same CATH topology
2RUEA 3QAGA 3CRUA 13GSA 3UBLA 3F63A 5CRHA 1EEMA 4LMVA 2OE0A 2VLTA 3KEBA 3KTBA 1NHOA 5D9XA 4L0WA 1XWBA 3QD9A 2R0PA 1V58A 2I81A 2MMNA 5A34B 2WGRA 1PX6A 3ZMLA 1FOHA 2QKEA 5HR0A 1Z7RA 2VCQA 1F2EA 2LTKA 4FYUA 4K5SA 4K0GA 4K9ZA 3KGKA 1Z7PA 2B5XA 5B8AA 2H76A 3ZTLA 2CVKA 2EFCA 4PQHA 6GSYA 4OCFA 1EZKA 4HQZA 1TRSA 3GFKA 5B6NA 2F9SA 4I2TA 4IN0A 3UARA 1BYEA 2LJAA 3G9BA 3ZITA 4DVCA 2A2SA 4HEA2 1TP9A 2R0CA 4EE0A 3HY2A 2PERA 3ZFLA 3IHGA 3TKPA 3ZVJD 4MABA 4EIPA 1MDJA 3WT1A 5D9TA 1WPIA 1XIYA 3PPUA 1A8LA 4EL1A 1GH2A 2H70A 1OE8A 3P90A 2DKHA 1ERVA 1X5EA 4WETA 2PN8A 1HD2A 4JR4A 4OO4A 2NTOA 2O8VB 4EC0A 1G7OA 4F0CA 2JSZA 4TR1B 3DYRA 5DBQA 5ECOB 4L5OA 2OACA 4PNFA 3HVXA 2L4QA 2C0GA 4TW5A 1BQ7A 1YF0A 2TRCP 3F4TA 3PR8A 5HR3A 2AHEA 1U6TA 4LA1A 3WT2A 4O7HA 2C80A 4KB3A 2V6KA 3L9VA 1S3CA 3NIVA 1R26A 2KP1A 1WRYA 4OMVA 2CAQA 2OJLA 5E59A 3ZIJA 1YY7A 5D73A 4TOPA 4TKYA 1PL2A 1O73A 3TKQA 2V2GA 1GSYA 4XS1A 2VL9A 1ZYEA 4BVXB 5J40A 3Q74A 2E0QA 3GMFA 3D0ZA 4MZCA 5CRWA 3QMXA 3A5WA 3IHQA 1PD21 4J2FA 1YVLA 3O6TA 4TR0A 1AXDA 3TB2A 2JACA 1Z6NA 3RBTA 2H73A 1K0NA 5J9CA 1QQ2A 4GWRA 2IJYA 4KUNA 2VL2A 1A23A 1AQWA 1J9BA 1FVKA 1H4OA 5AISA 3OR5A 1Q98A 1X9SB 4V2NA 1TK5B 5BMUB 4NHWA 1FVJA 2XPEA 3QPMA 3VPTA 4G01A 3IOSA 2ES7A 2A2RA 1HNCA 2FNOA 1TU8A 2PWJA 1S3AA 4GQCA 2VCTA 1ML6A 2VCVA 2KHPA 4LL4B 4ISDA 2R4VA 1K0AA 4MF5A 5IQYA 3APSA 3DD3A 2QA1A 2A4VA 3EURA 4G0IA 5IO2A 3GTUA 5EY6A 3EC3A 1AUCA 2H1AA 2H6YA 2X49A 1SYXA 1XCCA 4L5LA 2ALBA 5IO0A 1CQHA 2RLIA 2IPAA 18GSA 2AB6A 3KP8A 5F06A 1FB0A 1K0OA 4FYBA 3CSIA 4KA0A 1A2LA 1FOVA 1JZDA 3M8NA 3IAM2 3L4NA 3U5RE 1U3IA 4KGIA 3HZ4A 1Z5YE 2K9FA 3EWLA 2F51A 4PTSA 2VAFA 2V1MA 3IDVA 3GNJA 1BG5A 5HR1A 2CAIA 3UOMA 5AGYA 3LXTA 1XWGA 3MAKA 4Q5QA 3I9V2 3IC8A 3QOUA 4NMUA 2A2PA 2HI7A 1V40A 1OKDA 4EVMA 2LJKA 4N0VA 4TRXA 1X0RA 2IWTA 3LYKA 3VWVA 3TJKA 3I43A 2FGXA 1XFLA 3HHVA 1KBNA 2NVLA 1MD4A 3DXBA 4IQAA 2B7KA 5EVOA 3TOUA 3W8JA 3APOA 1WP0A 3J7Yb 2R5GA 1SJIA 2WDUA 5A5HB 2HSMB 3DGQA 2YWNA 1TDIA 5H5SA 3GN3A 3ME7A 4JE1A 2C0EA 5COHA 4POMA 3CSJA 5J9BA 2VLUA 3VK9A 5JCUA 1VRSD 1W89A 4ECIA 1TK0B 4Z2UA 4IJ3A 1C72A 1AW9A 3M0FA 3KZQA 2H6XA 3NZNA 2GZZA 3C8EA 4HZ2A 5AN1A 1J0FA 4MH3A 1ZL9A 5GSTA 16GSA 4IBPA 3FR9A 3I69A 4IS0A 3F6FA 2VL3A 3VWWA 2CX4A 4YQVA 5IPGA 4KDYA 4OFNA 2VCXA 4PUAA 3D21A 5IIZA 3M9KA 4BVYA 2OBKA 2X8HA 2HT9A 1XXUA 1A2MA 4PURA 2L4CA 2PMTA 4RUVA 1FW1A 2VO4A 1QMVA 2YWIA 4G0LA 4AGSA 2GQLA 2IL3A 1JLVA 4MNNA 4DSSB 3M3MA 4TN8A 3KH7A 2IMFA 3DIEA 3P2AA 2DJ2A 5ECIB 1SKSB 4W66A 5CREA 1T7PB 2B6MA 5AIVA 12GSA 1URMA 1XBSA 2NBSA 4NHZA 1MD3A 3QAVA 2AYTA 2VCWA 1GLPA 1K3YA 2RIIA 3IAS2 4JRRA 5JWRB 2FHEA 1XW9A 3TRPA 4IVFA 3LFLA 1ZCPA 2ZNMA 3TRXA 3ZMKA 2A4HA 1Q4JA 1B48A 5KOXA 5CYYA 1F3BA 3HA9A 4IP6A 3GYKA 1WJKA 5DJMA 6GSWA 1S3DA 2LEGA 5A4UA 2DSAA 3HMJG 1Z9HA 2LNTA 3FEUA 3O76A 2F8AA 1TU7A 2AUVA 4TVEA 1V98A 2FWGA 1SVMA 1F9MA 2X8CA 4MJCA 4POLA 2CZ2A 1E6BA 3SBCA 2LKUA 3F3RA 2R0GA 3GL3A 4EKZA 3ERGA 3TJBA 4BWQA 4AKIA 4JR6A 4XHMA 2OT3A 2WRTA 3J7Yk 2H19A 1K0BA 3UAPA 3F3QA 3IPZA 4K1FA 4XRAA 3RAZA 3GKKA 1DUGA 4PQIA 1UC7A 3VI7A 2GVPA 4I8BA 1NM3A 1R5AA 5DDLA 1ZZYA 4L8EA 2V6OA 3A3TA 2H1GA 1PL1A 1TKDB 4ML6A 3APQA 2FCHA 4DSRA 2ON7A 4Z2TA 2ZCTA 2HRAA 2EIQA 4A5PA 1Z6MA 3L9UA 3W6GA 3MSZA 2PBJA 4POBA 5L71A 1W4VA 1YF1A 3L78A 3VPQA 2VKZG 1DSBA 3ED3A 4I6XA 3C7MA 2E2GA 3ERWA 4N0ZA 5J3RA 1U87A 4O92A 4F2IA 1PA3A 4KSOA 2DMMA 1XZOA 3QFBC 2X4AA 2LJRA 2GQKA 2K6VA 1UVZA 2H6ZA 2L5LA 4PUFC 5ECLB 4D73B 5LD0A 4O5RA 5DCGA 1GTBA 3GTUB 2ON5A 4KF9A 5ECRB 2I4AA 4GTUA 2DIZA 2YJHA 3DWVA 2REMA 2F8FA 3BD2A 1I9DA 2C1YA 5G5FA 2FWHA 1R5PA 3GSTA 2AV4A 4IJIA 1O8XA 1XOAA 2F3MA 4ID0A 4X4JA 1CQGA 2MZCA 4NWYA 1Z3EA 5IMVA 5D9WA 7GSSA 1GSQA 3EE2A 2YPMA 4ULXA 1WWJA 2VUPA 3CRTA 4KH7A 1YEXA 2H1BA 5ECNB 1VF1A 3PGTA 3ZREA 1GSFA 1T8EB 1JHBA 3KJYA 1PQNA 1XW6A 4ZBBA 2PVQA 5INYA 2VD0A 1LU4A 5J4YA 2C0FA 1DE1A 3TKSA 4K0NA 3RHCA 4OWYA 5G1LA 3D4MA 4MF7A 1A8YA 1PRXA 1SJZA 4USSA 1AC1A 5IMDA 5ID2A 2HRKA 4WBJA 5G1KA 4XS4A 2YCDA 5D8IA 1V57A 3CBUA 2BMXA 4CHSA 3H79A 1NW2A 5D96A 3UJ1A 5DQYA 1GUMA 4DSQA 2H0GA 3GURA 5KOWA 1X9WB 1K0DA 3H93A 1TOFA 3HVSA 2DLXA 3WD6A 1JZWA 3KTLA 4QL9A 1EOGA 1T1VA 2IFQA 19GSA 4IELA 3JCML 3KD0A 3RHBA 4E8HA 1ZYQB 4WEYA 4EDYA 4GQFA 4KX4A 5JWOB 6GSTA 4MZBA 4IW9A 5EPFA 3A2WA 1SVLA 2MMZA 4K7IA 4Q5RA 1GNWA 4IP1A 1EGOA 5CAXA 1WIKA 5IOWA 1M9AA 2DC5A 4BVYB 1USBA 2J23A 5F0GA 2E7PA 2LQQA 1GULA 3WGEA 1RW1A 1T4ZA 2GTUA 1VF2A 2EFDA 5CP1A 1X5DA 3KM6A 2PU9C 3M1GA 2JL4A 3LQ7A 1AIUA 3D5JA 1G7EA 2P31A 3MIXA 4MPFA 4NPBA 1PKZA 2GLRA 2M80A 1EV4A 1TRVA 3NOFA 4IKHA 3CSHA 4KCAA 2O85A 2IN3A 2H71A 1JZOA 1XWKA 3GKMA 2BJXA 4NV5A 5IMFA 1B8XA 3H8QA 2NPBA 3O3TA 4EXJA 4XIHA 3BBYA 1YJ6A 5A1NA 2NDOA 1YKAA 4Z7XA 2H30A 4TXOB 22GSA 3GSSA 2GQMA 1M0UA 5F8BA 4RQRA 8GSSA 4G19A 3I6AA 5IOXA 3KCMA 2B5EA 1KEBA 3S9FA 4K2XA 5A4WA 3A2XA 3GV1A 2KUCA 5ELAA 1MDIA 3RPPA 1O7UA 4EIQA 1PN9A 3Q19A 4MCUA 4MDCA 4NAXA 3ZFBA 3FY7A 2XHFA 4LMWA 3ME8A 4H86A 3H1NA 4KSMA 1O6JA 4F9ZA 1ZGNA 1HYUA 2QSIA 4L0UA 4RQXA 1Y1UA 2P5QA 2DKIA 2EC4A 1GUHA 2LQOA 3FW2A 4YQUA 2C3QA 4X43A 1BEDA 1IYIA 2RM5A 3EU4A 4K7NA 2RUFA 1OC3A 1ZYPA 2VL2C 1BX9A 4YQMA 2O5VA 4G9HA 4FIWA 2WZ9A 2HRNA 2VM2A 2HXKA 4QL7A 1MDKA 5IMCA 1ZOFA 5DAKA 3VWUA 5KN3A 1ZMAA 4LLRA 3GH6A 2QA2A 6GSXA 3KP9A 4ZL8A 4NXIA 4HI7A 2GZPA 1XWCA 3GIXA 2JZRA 5C00A 4ZBAA 3UEMA 3KIJA 2UZ8A 3RPNA 3LEFA 2L59A 1GLQA 2WS2A 2B1LA 3ZLPA 2IMEA 1OKTA 5EL8A 3FZ9A 2I3YA 1BG1A 2WJUA 3GA4A 2WCIA 1ST9A 1A24A 3LXZA 4G10A 4XRDA 2HZEA 1GWCA 1M9BA 2H74A 4BA7A 2JZTA 3TJGA 1EEJA 1GNEA 1NHYA 3TDGA 1WE0A 3UL3A 5E4WA 3HJOA 4V1Ag 5JCWA 20GSA 4ECCA 3U6VA 2OADA 1ILOA 2C3TA 4XTSA 3FMWA 1SD9A 5CRDA 3N5OA 4KE3A 2C8UA 4KDXA 1U3AA 3GX8A 2XBIA 1V9WA 4BVXA 2X8GA 3ZVJA 2MYGA 5ELGA 5J5NA 4KAEA 2RM6A 1XPVA 3TUEA 5F05A 1G0TA 2C3NA 2GSRA 3BCIA 1GUKA 4YH2A 5B7CA 3CTFA 4GDFA 4E8EA 4FYCA 4JEDA 2DIYA 2B3SA 3ZL5A 2MMAA 1TI3A 3C73A 4IQ1A 2WB9A 4MH2A 1GTUA 2MBTA 4V2LA 5BMUA 4O32A 1AAZA 2C4JA 4HU9A 3LYPA 2C0DA 4JU5A 5JWQB 4ICYA 1FG4A 1SK1A 3D22A 1FB6A 2MMOA 2X64A 2N5AA 1YDKA 5ID2B 3ISOA 4XS4B 3ERFA 1LBKA 2LRTA 2CV4A 1M2BA 1HNBA 4GF0A 2JADA 2VLVA 3C71A 2DJ1A 2IMIA 4PGTA 4OO5A 4KCEA 2EFHA 3QCPA 3UVTA 3GRXA 4ZILA 2N5BA 4BPYA 5H5QA 1WOUA 2O7KA 2AAWA 5ECQB 4K8MA 1SU9A 3MYDA 2FUG2 4MJBA 4PX1A 5DALA 3MWHA 1OVNA 3EMXA 5IMAA 2IFQB 4MJEA 1AQXA 1OE7A 1YQ1A 4J56E 4ECBA 1SYRA 2H01A 3TJFA 1QXHA 3G7YA 1X9MB 3L9SA 4V1Ap 4N10A 2YWMA 1EOHA 1XVQA 2GZYA 4WKWA 2FY6A 2YZUA 4K2DA 3F6DA 4K5RA 3FYGA 3GUSA 3DVXA 3EVIA 5GAPD 2H8LA 3UMAA 1X5CA 5ECSA 1MEKA 1B9XC 2H0HA 1QGVA 3ZZXA 3BJ5A 3CYNA 2OA7A 2QC7A 4BL7A 2CVDA 4ZBDA 3FKFA 2HSMA 2OE3A 1HNAA 4HUAA 3TJJA 1QUWA 3VWXA 2HSYA 2CX3A 3VLNA 3LWAA 2B1KA 3FK8A 4ZXGA 5ECPB 2OBIA 3PINA 10GSA 3FR6A 1T4YA 5LNKe 4QQ7A 1FAAA 1TW9A 2CVBA 2PGTA 2L57A 4IHUA 1PKWA 1ACVA 4X1UA 4OFTA 5A1NB 2R3XA 3W8SA 5FHIA 2FLSA 3DKSA 2VM1A 1O8WA 1T3BA 2GDRA 4WR4A 2QGVA 3SWLA 5H5RA 2DJKA 5J4UA 2GSSA 2EIRA 3HZ8A 1TTZA 2HNLA 2TRXA 3F4RA 3EYTA 1O81A 1KNGA 4ZB9A 1AQVA 2FA4A 2LUSA 1WMJA 3QAWA 6GSVA 3CXGA 4JZQA 3LJRA 2LV3A 4K6XA 2HLSA 3UBKA 5DJLA 2K18A 2XC2A 1OYJA 5GZZB 3E9JB 3GHAA 4DSSA 3IK7A 1SVOA 3A2VA 1JLWA 2CQ9A 4WF4A 4ECJA 4TXVA 5LCZA 3FZ5A 1B9YC 3VFIA 1SJ6A 2I1UA 4F03A 1TJDA 1T00A 2FWFA 3QR6A 1A0FA 2YP6A 4QMKA 2UV8G 1BAYA 5B6MA 2MBSA 4ZB8A 5DAKB 4ZB6A 4LL1B 4YKGA 1GTIA 1I5GA 3CWGA 3BOAA 4OFMA 4AKXB 1GTAA 4EO3A 4MLYA 1BJXA 1NSWA 4GLTA 4RI7A 1LJRA 4HQSA 1K0MA 4ZL7A 2HSNA 3DRNA 4MMMA 5C04A 5F07A 3IA1A 3C1SA 4GXZA 1OAZA 2O87A 3C1RA 2JSYA 4MK3A 2HFDA 2HZEB 2B5YA 5KEJA 2K8VA 4EDZA 5DQSA 1FO5A 1Y6EA 1YEPA 4N11A 5D93A 4TR3A 2KP2A 3TCOA 2OE1A 2XPDA 3G7IA 1O85A 3VURA 4MA9A 5DCHA 4I2UA 3IK9A 5A5KA 4ZB7A 4FH8A 1M2DA 2JZSA 3DMLA 5G31A 5G5EA 1A0RP 5BRTA 3A5IA 2GS3A 4EF0A 3EMPA 3D6IA 3HXSA 4HJMA 2EFEA 4YKFA 2N5FA 2G0FA 3F9UA 2YWOA 3HYPA 3TKSC 4AJ8A 2YN1A 1R4WA 2H75A 1OC9A 1RQMA 3M9JA 5HFIA 1ERWA 2YV7A 4AJ7A 3CMIA 2LRNA 6GSUA 1F37A 2YANA 1KTEA 2G2QA 3RDWA 4ML1A 1K3LA 2L6DA 4AKHA 2H1DA 3KMOA 4GRFA 4MPGA 5HFKA 2HSHA 1VGLA 1EP8A 1K0CA 5ECKB 5KN2A 3HCZA 4PQ1A 1EGRA 4F0BA 1ERTA 3ZRDA 4POKA 3P7XA 4GSTA 2KLXA 4CW9A 1FHEA 2R6KA 4MJAA 3QFAC 2H72A 4Z2RA 2DJ3A 2DJJA 3BCKA 3IRAA 5KN0A 3WYWA 3FR3A 14GSA 2I9HA 1TRUA 5B8BA 4D73A 3MDKA 2GSTA 4YAVA 2PUKC 2V41A 1YZXA 4O5UA 5CO3A 3TU3B 5J41A 4V2MA 4WR5A 4RI6A 3FZ4A 2YV9A 2PPTA 5ENUA 3GKXA 5A34A 2LRCA 1GRXA 5HQPA 3QDNA 3VI5A 5AIXA 2M72A 2CZ3A 4BWSA 5GSSA 4NV2A 3DVWA 3UVHA 2K8SA 2M46A 5DALB 4HJ2A 4CDOA 4DEJA 2VIMA 3PH9A 3D4TA 3IC4A 1TXXA 4TR4A 3E3EA 3KXOA 4Q5NA 4KNDA 5DVBA 3FHKA 2YNXA 1B4QA 1GSUA 5J4VA 3Q18A 3ZYWA 1ABAA 5G30A 2AJQB 1QK8A 4G2EA 1OC8A 1SL1B 1U88A 2Z9SA 2GSQA 4MP4A 3LW9A 1THXA 4OD7A 3N9JA 4MZWA 2YZHA 1GSEA 3L0HA 1ON4A 4AJ6A 3EINA 4PXOA 3EU3A 4TR1A 1R7HA 4BL7B 1F3AA 1E2YA 3V1WA 1VF3A 2LS5A 4ZL9A 3TKRA 2HZFA 3MNGA 5D9VA 3R3EA 1RK4A 3H4KA 3IV4A 5G2ZA 4EUYA 3LSZA 4E68A 2L6CA 4O5QA 1TRWA 1XVWA 5IMZA 5CRGA 1PMTA 5FWGA 4ACSA 4WF5A 4HU7A 4CY8A 9GSSA 1XW5A 4CY6A 4F82A 1J08A 2P5RA 5HR2A 1PGTA 3HJMA 1Y25A 4N30A 1UA5A 4X0XA 4P3YB 2VOCA 2LSTA 3HD5A 2WULA 3LORA 4I5QA 3F8UA 2DBCA 1M7TA 3P8WA 5J47A 4KW6A 1EV9A 3F4SA 5A4VA 4J57E 1IYHA 4GSSA 2EIOA 3TGZA 2WFCA 3GL5A 1BF5A 4K7OA 4JBBA 3HDCA 1N8JA 1SENA 1EWXA 2TIRA 1TXUA 3E0UA 2FWEA 5CNWA 2FD3A 1TI1A 3KMNA 3KH9A 1SL2B 3K8NA 1SK2A 2J9HA 1B4PA 1GSDA 1DE2A 4PNGA 2CT6A 5FT3A 1UN2A 1MTCA 2GGTA 5IM9A 3F0IA 4HS1A 1M99A 1HQOA 3G7JA 1SK0A 1YKCA 3CTGA 2HRKB 2HE3A 2D2ZA 1PN0A 2H1LA 5GAND 3AY8A 6GSSA 5HFGA 1SD8A 1F6MC 2CA8A 1K3OA 1M2AA 3IBHA 3WGXA 4TXOA 4AF2A 2X99A 3TKSE 4AI6A 1GP1A 1XWAA 2R37A 1N25A 1QFNA 4XS6A 2GT6A 1DBYA 3IR4A 4MF6A 3GX0A 1XOBA 4HZ4A 4ILFA 2BTOT 2HSNB 3US3A 4GCIA 4HOJA 2IMKA 2PVOC 1PSQA 3HKRA 2LNSA 1PX7A 4YAPA 1THOA 3ZIVA 3TRQA 2YOIA 3R2QA 2DMLA 5JCGA 2ZUPA 4HDEA 5ECHB 17GSA 1N2AA 2YJ7A 1GSSA 3IXRA 3DEXA 3EPTA 4KDUA 2P0GA 4FQUA 4OCEA 2B7JA 1H75A 2VCZA 1G6WA 5IPHA 1EP7A 2FA8A 3LGCA 2DJ0A 2E2MA 11GSA 3WGDA 2KOKA 2H0IA 1VF4A 3GH9A 3HVVA 2GT5A 3Q6OA 1SKRB 4WBRD 4N3ZA 2XBQA 3LG6A 4XCSA 5A5HA 1SL0B 3UIWA 3TOTA 1OC9B 2R2JA 2O89A 1A2JA 4AKGA 3IE3A 2HQTA 1V2AA 4GSNA 3FZAA 4Q5FA 4ZIJA 2OKAA 2H66A 4IGJA 2V32A 1ERUA 1TK8B 3GKNA 2VD1A 3FRCA 1ZYNA 4G0KA 2IMDA 2IIYA 2JU5A 3HJPA 5KN1A 4FO5A 4WXTA 1GL8A 5ECMB 2HRFA 1SKWB 1JFUA 2HYXA 1JZRA 2L5OA 5ABRA 1G6YA 4I97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUE A;  3QAG A;  3CRU A;  13GS A;  3UBL A;  3F63 A;  5CRH A;  1EEM A;  4LMV A;  2OE0 A;  2VLT A;  3KEB A;  3KTB A;  1NHO A;  5D9X A;  4L0W A;  1XWB A;  3QD9 A;  1V58 A;  2I81 A;  2MMN A;  2WGR A;  1PX6 A;  3ZML A;  2QKE A;  5HR0 A;  1Z7R A;  2VCQ A;  1F2E A;  2LTK A;  4FYU A;  4K0G A;  4K9Z A;  3KGK A;  1Z7P A;  2B5X A;  5B8A A;  2H76 A;  3ZTL A;  2CVK A;  4PQH A;  6GSY A;  4OCF A;  1EZK A;  4HQZ A;  1TRS A;  3GFK A;  5B6N A;  2F9S A;  4I2T A;  4IN0 A;  3UAR A;  1BYE A;  2LJA A;  3G9B A;  3ZIT A;  4DVC A;  2A2S A;  4HEA 2;  1TP9 A;  4EE0 A;  3HY2 A;  2PER A;  3ZFL A;  3TKP A;  3ZVJ D;  4MAB A;  1MDJ A;  3WT1 A;  5D9T A;  1WPI A;  1XIY A;  3PPU A;  1A8L A;  4EL1 A;  1GH2 A;  2H70 A;  1OE8 A;  3P90 A;  1ERV A;  1X5E A;  4WET A;  2PN8 A;  1HD2 A;  4JR4 A;  4OO4 A;  2NTO A;  2O8V B;  4EC0 A;  1G7O A;  4F0C A;  2JSZ A;  4TR1 B;  3DYR A;  5DBQ A;  5ECO B;  4L5O A;  2OAC A;  4PNF A;  3HVX A;  2L4Q A;  2C0G A;  4TW5 A;  1BQ7 A;  1YF0 A;  2TRC P;  3F4T A;  3PR8 A;  5HR3 A;  2AHE A;  1U6T A;  4LA1 A;  3WT2 A;  4O7H A;  2C80 A;  4KB3 A;  2V6K A;  3L9V A;  1S3C A;  3NIV A;  1R26 A;  2KP1 A;  1WRY A;  4OMV A;  2CAQ A;  2OJL A;  5E59 A;  3ZIJ A;  1YY7 A;  5D73 A;  4TOP A;  4TKY A;  1PL2 A;  1O73 A;  3TKQ A;  2V2G A;  1GSY A;  4XS1 A;  2VL9 A;  1ZYE A;  4BVX B;  3Q74 A;  2E0Q A;  3GMF A;  3D0Z A;  4MZC A;  5CRW A;  3QMX A;  3A5W A;  3IHQ A;  1PD2 1;  4J2F A;  3O6T A;  4TR0 A;  1AXD A;  3TB2 A;  2JAC A;  1Z6N A;  3RBT A;  2H73 A;  1K0N A;  5J9C A;  1QQ2 A;  4GWR A;  2IJY A;  4KUN A;  2VL2 A;  1A23 A;  1AQW A;  1J9B A;  1FVK A;  1H4O A;  5AIS A;  3OR5 A;  1Q98 A;  1X9S B;  4V2N A;  1TK5 B;  4NHW A;  1FVJ A;  2XPE A;  3QPM A;  3VPT A;  3IOS A;  2ES7 A;  2A2R A;  1HNC A;  2FNO A;  1TU8 A;  2PWJ A;  1S3A A;  4GQC A;  2VCT A;  1ML6 A;  2VCV A;  2KHP A;  4LL4 B;  4ISD A;  2R4V A;  1K0A A;  4MF5 A;  5IQY A;  3APS A;  3DD3 A;  2A4V A;  3EUR A;  4G0I A;  5IO2 A;  3GTU A;  5EY6 A;  3EC3 A;  1AUC A;  2H1A A;  2H6Y A;  1SYX A;  1XCC A;  4L5L A;  2ALB A;  5IO0 A;  1CQH A;  2RLI A;  2IPA A;  18GS A;  2AB6 A;  3KP8 A;  5F06 A;  1FB0 A;  1K0O A;  4FYB A;  3CSI A;  4KA0 A;  1A2L A;  1FOV A;  1JZD A;  3M8N A;  3IAM 2;  3L4N A;  3U5R E;  1U3I A;  4KGI A;  3HZ4 A;  1Z5Y E;  2K9F A;  3EWL A;  2F51 A;  4PTS A;  2VAF A;  2V1M A;  3IDV A;  3GNJ A;  1BG5 A;  5HR1 A;  2CAI A;  3UOM A;  5AGY A;  3LXT A;  1XWG A;  3MAK A;  4Q5Q A;  3I9V 2;  3IC8 A;  3QOU A;  4NMU A;  2HI7 A;  1V40 A;  1OKD A;  4EVM A;  2LJK A;  4N0V A;  4TRX A;  1X0R A;  2IWT A;  3LYK A;  3VWV A;  3TJK A;  3I43 A;  2FGX A;  1XFL A;  3HHV A;  1KBN A;  2NVL A;  1MD4 A;  3DXB A;  4IQA A;  2B7K A;  5EVO A;  3TOU A;  3W8J A;  3APO A;  1WP0 A;  3J7Y b;  2R5G A;  1SJI A;  2WDU A;  2HSM B;  3DGQ A;  2YWN A;  1TDI A;  5H5S A;  3GN3 A;  3ME7 A;  4JE1 A;  2C0E A;  5COH A;  4POM A;  3CSJ A;  5J9B A;  2VLU A;  3VK9 A;  5JCU A;  1VRS D;  1W89 A;  4ECI A;  1TK0 B;  4IJ3 A;  1C72 A;  1AW9 A;  3M0F A;  3KZQ A;  2H6X A;  3NZN A;  2GZZ A;  3C8E A;  4HZ2 A;  5AN1 A;  1J0F A;  4MH3 A;  1ZL9 A;  5GST A;  16GS A;  4IBP A;  3FR9 A;  3I69 A;  4IS0 A;  3F6F A;  2VL3 A;  3VWW A;  2CX4 A;  4YQV A;  5IPG A;  4KDY A;  4OFN A;  2VCX A;  4PUA A;  3D21 A;  5IIZ A;  3M9K A;  4BVY A;  2OBK A;  2X8H A;  2HT9 A;  1XXU A;  1A2M A;  4PUR A;  2L4C A;  2PMT A;  4RUV A;  1FW1 A;  2VO4 A;  1QMV A;  2YWI A;  4G0L A;  4AGS A;  2GQL A;  2IL3 A;  1JLV A;  4DSS B;  3M3M A;  4TN8 A;  3KH7 A;  2IMF A;  3DIE A;  3P2A A;  2DJ2 A;  5ECI B;  1SKS B;  5CRE A;  1T7P B;  2B6M A;  5AIV A;  12GS A;  1URM A;  1XBS A;  2NBS A;  4NHZ A;  1MD3 A;  3QAV A;  2AYT A;  2VCW A;  1GLP A;  1K3Y A;  2RII A;  3IAS 2;  4JRR A;  5JWR B;  2FHE A;  1XW9 A;  3TRP A;  4IVF A;  3LFL A;  1ZCP A;  2ZNM A;  3TRX A;  3ZMK A;  1Q4J A;  1B48 A;  5CYY A;  1F3B A;  3HA9 A;  4IP6 A;  3GYK A;  1WJK A;  5DJM A;  6GSW A;  1S3D A;  2LEG A;  5A4U A;  2DSA A;  1Z9H A;  2LNT A;  3FEU A;  3O76 A;  2F8A A;  1TU7 A;  2AUV A;  4TVE A;  1V98 A;  2FWG A;  1F9M A;  2X8C A;  4MJC A;  4POL A;  2CZ2 A;  1E6B A;  3SBC A;  2LKU A;  3F3R A;  3GL3 A;  4EKZ A;  3ERG A;  3TJB A;  4BWQ A;  4JR6 A;  4XHM A;  2WRT A;  3J7Y k;  2H19 A;  1K0B A;  3UAP A;  3F3Q A;  3IPZ A;  4K1F A;  4XRA A;  3RAZ A;  3GKK A;  1DUG A;  4PQI A;  1UC7 A;  3VI7 A;  2GVP A;  4I8B A;  1NM3 A;  1R5A A;  5DDL A;  1ZZY A;  4L8E A;  2V6O A;  3A3T A;  2H1G A;  1PL1 A;  1TKD B;  4ML6 A;  3APQ A;  2FCH A;  4DSR A;  2ON7 A;  2ZCT A;  2HRA A;  2EIQ A;  1Z6M A;  3L9U A;  3W6G A;  3MSZ A;  2PBJ A;  4POB A;  5L71 A;  1W4V A;  1YF1 A;  3L78 A;  3VPQ A;  1DSB A;  3ED3 A;  4I6X A;  3C7M A;  2E2G A;  3ERW A;  4N0Z A;  5J3R A;  1U87 A;  4O92 A;  4F2I A;  1PA3 A;  4KSO A;  2DMM A;  1XZO A;  3QFB C;  2LJR A;  2GQK A;  2K6V A;  1UVZ A;  2H6Z A;  2L5L A;  4PUF C;  5ECL B;  4D73 B;  5LD0 A;  4O5R A;  5DCG A;  1GTB A;  3GTU B;  2ON5 A;  4KF9 A;  5ECR B;  2I4A A;  4GTU A;  2DIZ A;  2YJH A;  3DWV A;  2REM A;  2F8F A;  3BD2 A;  1I9D A;  2C1Y A;  5G5F A;  2FWH A;  1R5P A;  3GST A;  2AV4 A;  4IJI A;  1O8X A;  1XOA A;  2F3M A;  4ID0 A;  1CQG A;  2MZC A;  4NWY A;  1Z3E A;  5IMV A;  5D9W A;  7GSS A;  1GSQ A;  3EE2 A;  2YPM A;  4ULX A;  1WWJ A;  2VUP A;  3CRT A;  4KH7 A;  1YEX A;  2H1B A;  5ECN B;  1VF1 A;  3PGT A;  3ZRE A;  1GSF A;  1T8E B;  1JHB A;  3KJY A;  1PQN A;  1XW6 A;  4ZBB A;  2PVQ A;  5INY A;  2VD0 A;  1LU4 A;  2C0F A;  1DE1 A;  3TKS A;  4K0N A;  3RHC A;  4OWY A;  5G1L A;  3D4M A;  4MF7 A;  1A8Y A;  1PRX A;  1SJZ A;  4USS A;  1AC1 A;  5IMD A;  5ID2 A;  2HRK A;  4WBJ A;  5G1K A;  4XS4 A;  2YCD A;  5D8I A;  1V57 A;  3CBU A;  2BMX A;  4CHS A;  3H79 A;  1NW2 A;  5D96 A;  3UJ1 A;  5DQY A;  1GUM A;  4DSQ A;  2H0G A;  3GUR A;  1X9W B;  1K0D A;  3H93 A;  1TOF A;  3HVS A;  2DLX A;  3WD6 A;  1JZW A;  3KTL A;  4QL9 A;  1EOG A;  1T1V A;  2IFQ A;  19GS A;  4IEL A;  3JCM L;  3KD0 A;  3RHB A;  4E8H A;  1ZYQ B;  4WEY A;  4EDY A;  4GQF A;  4KX4 A;  5JWO B;  6GST A;  4MZB A;  4IW9 A;  5EPF A;  3A2W A;  2MMZ A;  4K7I A;  4Q5R A;  1GNW A;  4IP1 A;  1EGO A;  5CAX A;  1WIK A;  5IOW A;  1M9A A;  2DC5 A;  4BVY B;  1USB A;  2J23 A;  5F0G A;  2E7P A;  2LQQ A;  1GUL A;  3WGE A;  1RW1 A;  1T4Z A;  2GTU A;  1VF2 A;  5CP1 A;  1X5D A;  3KM6 A;  2PU9 C;  3M1G A;  2JL4 A;  3LQ7 A;  1AIU A;  3D5J A;  1G7E A;  2P31 A;  4MPF A;  4NPB A;  1PKZ A;  2GLR A;  2M80 A;  1EV4 A;  1TRV A;  3NOF A;  4IKH A;  3CSH A;  4KCA A;  2O85 A;  2IN3 A;  2H71 A;  1JZO A;  1XWK A;  3GKM A;  2BJX A;  4NV5 A;  5IMF A;  1B8X A;  3H8Q A;  2NPB A;  3O3T A;  4EXJ A;  4XIH A;  3BBY A;  1YJ6 A;  2NDO A;  1YKA A;  4Z7X A;  2H30 A;  4TXO B;  22GS A;  3GSS A;  2GQM A;  1M0U A;  5F8B A;  4RQR A;  8GSS A;  4G19 A;  3I6A A;  5IOX A;  3KCM A;  2B5E A;  1KEB A;  3S9F A;  5A4W A;  3A2X A;  3GV1 A;  2KUC A;  5ELA A;  1MDI A;  3RPP A;  1O7U A;  1PN9 A;  3Q19 A;  4MCU A;  4MDC A;  4NAX A;  3ZFB A;  3FY7 A;  2XHF A;  4LMW A;  3ME8 A;  4H86 A;  3H1N A;  4KSM A;  1O6J A;  4F9Z A;  1ZGN A;  1HYU A;  2QSI A;  4L0U A;  4RQX A;  2P5Q A;  2EC4 A;  1GUH A;  2LQO A;  3FW2 A;  4YQU A;  2C3Q A;  4X43 A;  1BED A;  1IYI A;  2RM5 A;  3EU4 A;  4K7N A;  2RUF A;  1OC3 A;  2VL2 C;  1BX9 A;  4YQM A;  4G9H A;  4FIW A;  2WZ9 A;  2HRN A;  2VM2 A;  2HXK A;  4QL7 A;  1MDK A;  5IMC A;  1ZOF A;  5DAK A;  3VWU A;  5KN3 A;  1ZMA A;  4LLR A;  3GH6 A;  6GSX A;  3KP9 A;  4ZL8 A;  4NXI A;  4HI7 A;  2GZP A;  1XWC A;  3GIX A;  2JZR A;  5C00 A;  4ZBA A;  3UEM A;  3KIJ A;  2UZ8 A;  3RPN A;  3LEF A;  2L59 A;  1GLQ A;  2WS2 A;  2B1L A;  3ZLP A;  2IME A;  1OKT A;  5EL8 A;  3FZ9 A;  2I3Y A;  2WJU A;  3GA4 A;  2WCI A;  1ST9 A;  1A24 A;  3LXZ A;  4G10 A;  4XRD A;  2HZE A;  1GWC A;  1M9B A;  2H74 A;  4BA7 A;  2JZT A;  3TJG A;  1EEJ A;  1GNE A;  1NHY A;  3TDG A;  1WE0 A;  3UL3 A;  5E4W A;  3HJO A;  4V1A g;  5JCW A;  20GS A;  4ECC A;  3U6V A;  2OAD A;  1ILO A;  2C3T A;  4XTS A;  1SD9 A;  5CRD A;  3N5O A;  4KE3 A;  2C8U A;  4KDX A;  1U3A A;  3GX8 A;  2XBI A;  1V9W A;  4BVX A;  2X8G A;  3ZVJ A;  2MYG A;  5ELG A;  5J5N A;  4KAE A;  2RM6 A;  1XPV A;  3TUE A;  5F05 A;  1G0T A;  2C3N A;  2GSR A;  3BCI A;  1GUK A;  4YH2 A;  5B7C A;  3CTF A;  4E8E A;  4FYC A;  4JED A;  2DIY A;  2B3S A;  3ZL5 A;  2MMA A;  1TI3 A;  3C73 A;  4IQ1 A;  2WB9 A;  4MH2 A;  1GTU A;  2MBT A;  4V2L A;  5BMU A;  4O32 A;  1AAZ A;  2C4J A;  4HU9 A;  3LYP A;  2C0D A;  4JU5 A;  5JWQ B;  1FG4 A;  1SK1 A;  3D22 A;  1FB6 A;  2MMO A;  2X64 A;  2N5A A;  1YDK A;  5ID2 B;  3ISO A;  4XS4 B;  3ERF A;  1LBK A;  2LRT A;  2CV4 A;  1M2B A;  1HNB A;  4GF0 A;  2JAD A;  2VLV A;  3C71 A;  2DJ1 A;  2IMI A;  4PGT A;  4OO5 A;  4KCE A;  3QCP A;  3UVT A;  3GRX A;  4ZIL A;  2N5B A;  4BPY A;  5H5Q A;  1WOU A;  2O7K A;  2AAW A;  5ECQ B;  4K8M A;  1SU9 A;  2FUG 2;  4MJB A;  4PX1 A;  5DAL A;  3MWH A;  1OVN A;  3EMX A;  5IMA A;  2IFQ B;  4MJE A;  1AQX A;  1OE7 A;  1YQ1 A;  4J56 E;  4ECB A;  1SYR A;  2H01 A;  3TJF A;  1QXH A;  3G7Y A;  1X9M B;  3L9S A;  4V1A p;  4N10 A;  2YWM A;  1EOH A;  1XVQ A;  2GZY A;  4WKW A;  2FY6 A;  2YZU A;  4K2D A;  3F6D A;  3FYG A;  3GUS A;  3DVX A;  3EVI A;  5GAP D;  2H8L A;  3UMA A;  1X5C A;  5ECS A;  1MEK A;  1B9X C;  2H0H A;  1QGV A;  3ZZX A;  3BJ5 A;  3CYN A;  2OA7 A;  2QC7 A;  4BL7 A;  2CVD A;  4ZBD A;  3FKF A;  2HSM A;  2OE3 A;  1HNA A;  4HUA A;  3TJJ A;  1QUW A;  3VWX A;  2HSY A;  2CX3 A;  3VLN A;  3LWA A;  2B1K A;  3FK8 A;  4ZXG A;  5ECP B;  2OBI A;  3PIN A;  10GS A;  3FR6 A;  1T4Y A;  5LNK e;  4QQ7 A;  1FAA A;  1TW9 A;  2CVB A;  2PGT A;  4IHU A;  2L57 A;  1PKW A;  1ACV A;  4X1U A;  4OFT A;  2R3X A;  3W8S A;  5FHI A;  2FLS A;  3DKS A;  2VM1 A;  1O8W A;  1T3B A;  2GDR A;  4WR4 A;  2QGV A;  3SWL A;  5H5R A;  2DJK A;  5J4U A;  2GSS A;  2EIR A;  3HZ8 A;  1TTZ A;  2HNL A;  2TRX A;  3F4R A;  3EYT A;  1O81 A;  1KNG A;  4ZB9 A;  1AQV A;  2FA4 A;  2LUS A;  1WMJ A;  3QAW A;  6GSV A;  3CXG A;  4JZQ A;  3LJR A;  2LV3 A;  4K6X A;  2HLS A;  3UBK A;  5DJL A;  2K18 A;  2XC2 A;  1OYJ A;  5GZZ B;  3E9J B;  3GHA A;  4DSS A;  3IK7 A;  3A2V A;  1JLW A;  2CQ9 A;  4WF4 A;  4ECJ A;  4TXV A;  5LCZ A;  3FZ5 A;  1B9Y C;  3VFI A;  1SJ6 A;  2I1U A;  4F03 A;  1TJD A;  1T00 A;  2FWF A;  3QR6 A;  1A0F A;  2YP6 A;  1BAY A;  5B6M A;  2MBS A;  4ZB8 A;  5DAK B;  4ZB6 A;  4LL1 B;  1GTI A;  1I5G A;  3BOA A;  4OFM A;  1GTA A;  4EO3 A;  4MLY A;  1BJX A;  1NSW A;  4GLT A;  4RI7 A;  1LJR A;  4HQS A;  1K0M A;  4ZL7 A;  3DRN A;  4MMM A;  5C04 A;  5F07 A;  3IA1 A;  3C1S A;  4GXZ A;  1OAZ A;  2O87 A;  3C1R A;  2JSY A;  4MK3 A;  2HFD A;  2HZE B;  2B5Y A;  5KEJ A;  2K8V A;  4EDZ A;  5DQS A;  1FO5 A;  1Y6E A;  1YEP A;  4N11 A;  5D93 A;  4TR3 A;  2KP2 A;  3TCO A;  2OE1 A;  2XPD A;  3G7I A;  1O85 A;  3VUR A;  4MA9 A;  5DCH A;  4I2U A;  3IK9 A;  5A5K A;  4FH8 A;  1M2D A;  2JZS A;  3DML A;  5G31 A;  5G5E A;  1A0R P;  2GS3 A;  4EF0 A;  3EMP A;  3D6I A;  3HXS A;  4HJM A;  2N5F A;  2G0F A;  3F9U A;  2YWO A;  3HYP A;  3TKS C;  4AJ8 A;  2YN1 A;  1R4W A;  2H75 A;  1OC9 A;  1RQM A;  3M9J A;  5HFI A;  1ERW A;  2YV7 A;  4AJ7 A;  3CMI A;  2LRN A;  6GSU A;  1F37 A;  2YAN A;  1KTE A;  2G2Q A;  3RDW A;  4ML1 A;  1K3L A;  2L6D A;  2H1D A;  3KMO A;  4GRF A;  4MPG A;  5HFK A;  2HSH A;  1VGL A;  1EP8 A;  1K0C A;  5ECK B;  5KN2 A;  3HCZ A;  4PQ1 A;  1EGR A;  4F0B A;  1ERT A;  3ZRD A;  4POK A;  3P7X A;  4GST A;  2KLX A;  4CW9 A;  1FHE A;  2R6K A;  4MJA A;  3QFA C;  2H72 A;  2DJ3 A;  2DJJ A;  3BCK A;  3IRA A;  5KN0 A;  3WYW A;  3FR3 A;  14GS A;  2I9H A;  1TRU A;  5B8B A;  4D73 A;  3MDK A;  2GST A;  4YAV A;  2PUK C;  2V41 A;  1YZX A;  5CO3 A;  5J41 A;  4V2M A;  4WR5 A;  4RI6 A;  3FZ4 A;  2YV9 A;  2PPT A;  5ENU A;  3GKX A;  2LRC A;  1GRX A;  5HQP A;  3QDN A;  3VI5 A;  5AIX A;  2M72 A;  2CZ3 A;  4BWS A;  5GSS A;  4NV2 A;  3DVW A;  3UVH A;  2K8S A;  2M46 A;  5DAL B;  4HJ2 A;  4CDO A;  4DEJ A;  2VIM A;  3PH9 A;  3D4T A;  3IC4 A;  1TXX A;  4TR4 A;  3E3E A;  3KXO A;  4Q5N A;  4KND A;  5DVB A;  3FHK A;  2YNX A;  1B4Q A;  1GSU A;  3Q18 A;  3ZYW A;  1ABA A;  5G30 A;  2AJQ B;  1QK8 A;  4G2E A;  1OC8 A;  1SL1 B;  1U88 A;  2Z9S A;  2GSQ A;  4MP4 A;  1THX A;  4OD7 A;  3N9J A;  4MZW A;  2YZH A;  1GSE A;  3L0H A;  1ON4 A;  4AJ6 A;  3EIN A;  4PXO A;  3EU3 A;  4TR1 A;  1R7H A;  4BL7 B;  1F3A A;  1E2Y A;  3V1W A;  1VF3 A;  2LS5 A;  4ZL9 A;  3TKR A;  2HZF A;  3MNG A;  5D9V A;  3R3E A;  1RK4 A;  3H4K A;  3IV4 A;  5G2Z A;  4EUY A;  3LSZ A;  2L6C A;  1TRW A;  1XVW A;  5IMZ A;  5CRG A;  1PMT A;  5FWG A;  4ACS A;  4WF5 A;  4HU7 A;  9GSS A;  1XW5 A;  4F82 A;  1J08 A;  2P5R A;  5HR2 A;  1PGT A;  3HJM A;  1Y25 A;  4N30 A;  1UA5 A;  4X0X A;  4P3Y B;  2VOC A;  2LST A;  3HD5 A;  2WUL A;  3LOR A;  4I5Q A;  3F8U A;  2DBC A;  1M7T A;  3P8W A;  4KW6 A;  1EV9 A;  3F4S A;  5A4V A;  4J57 E;  1IYH A;  4GSS A;  2EIO A;  3TGZ A;  2WFC A;  3GL5 A;  4K7O A;  4JBB A;  3HDC A;  1N8J A;  1SEN A;  1EWX A;  2TIR A;  3E0U A;  2FWE A;  5CNW A;  2FD3 A;  1TI1 A;  3KMN A;  3KH9 A;  1SL2 B;  3K8N A;  1SK2 A;  2J9H A;  1B4P A;  1GSD A;  1DE2 A;  4PNG A;  2CT6 A;  5FT3 A;  1UN2 A;  1MTC A;  2GGT A;  5IM9 A;  3F0I A;  4HS1 A;  1M99 A;  1HQO A;  3G7J A;  1SK0 A;  1YKC A;  2HRK B;  3CTG A;  2HE3 A;  2D2Z A;  5GAN D;  3AY8 A;  6GSS A;  5HFG A;  1SD8 A;  1F6M C;  2CA8 A;  1K3O A;  1M2A A;  3IBH A;  3WGX A;  4TXO A;  4AF2 A;  2X99 A;  3TKS E;  1GP1 A;  1XWA A;  2R37 A;  1QFN A;  4XS6 A;  2GT6 A;  1DBY A;  3IR4 A;  4MF6 A;  3GX0 A;  1XOB A;  4HZ4 A;  4ILF A;  2BTO T;  2HSN B;  3US3 A;  4GCI A;  4HOJ A;  2IMK A;  2PVO C;  1PSQ A;  3HKR A;  2LNS A;  1PX7 A;  4YAP A;  1THO A;  3ZIV A;  3TRQ A;  2YOI A;  3R2Q A;  2DML A;  5JCG A;  2ZUP A;  4HDE A;  5ECH B;  17GS A;  1N2A A;  2YJ7 A;  1GSS A;  3IXR A;  3DEX A;  4KDU A;  2P0G A;  4FQU A;  4OCE A;  2B7J A;  1H75 A;  2VCZ A;  1G6W A;  5IPH A;  1EP7 A;  2FA8 A;  3LGC A;  2DJ0 A;  2E2M A;  11GS A;  3WGD A;  2KOK A;  2H0I A;  1VF4 A;  3GH9 A;  3HVV A;  2GT5 A;  3Q6O A;  1SKR B;  4WBR D;  2XBQ A;  3LG6 A;  4XCS A;  1SL0 B;  3UIW A;  3TOT A;  1OC9 B;  2R2J A;  2O89 A;  1A2J A;  3IE3 A;  2HQT A;  1V2A A;  4GSN A;  3FZA A;  4Q5F A;  4ZIJ A;  2OKA A;  2H66 A;  4IGJ A;  2V32 A;  1ERU A;  1TK8 B;  3GKN A;  2VD1 A;  3FRC A;  4G0K A;  2IMD A;  2IIY A;  2JU5 A;  3HJP A;  5KN1 A;  4FO5 A;  4WXT A;  1GL8 A;  5ECM B;  2HRF A;  1SKW B;  1JFU A;  2HYX A;  1JZR A;  2L5O A;  5ABR A;  1G6Y A;  4I97 A; 
#chains in the Genus database with same CATH topology
 2RUE A;  3QAG A;  3CRU A;  13GS A;  3UBL A;  3F63 A;  5CRH A;  1EEM A;  4LMV A;  2OE0 A;  2VLT A;  3KEB A;  3KTB A;  1NHO A;  5D9X A;  4L0W A;  1XWB A;  3QD9 A;  2R0P A;  1V58 A;  2I81 A;  2MMN A;  5A34 B;  2WGR A;  1PX6 A;  3ZML A;  1FOH A;  2QKE A;  5HR0 A;  1Z7R A;  2VCQ A;  1F2E A;  2LTK A;  4FYU A;  4K5S A;  4K0G A;  4K9Z A;  3KGK A;  1Z7P A;  2B5X A;  5B8A A;  2H76 A;  3ZTL A;  2CVK A;  2EFC A;  4PQH A;  6GSY A;  4OCF A;  1EZK A;  4HQZ A;  1TRS A;  3GFK A;  5B6N A;  2F9S A;  4I2T A;  4IN0 A;  3UAR A;  1BYE A;  2LJA A;  3G9B A;  3ZIT A;  4DVC A;  2A2S A;  4HEA 2;  1TP9 A;  2R0C A;  4EE0 A;  3HY2 A;  2PER A;  3ZFL A;  3IHG A;  4PHZ C;  3TKP A;  3ZVJ D;  4MAB A;  4EIP A;  1MDJ A;  3WT1 A;  5D9T A;  1WPI A;  1XIY A;  3PPU A;  1A8L A;  4EL1 A;  1GH2 A;  2H70 A;  1OE8 A;  3P90 A;  2DKH A;  1ERV A;  1X5E A;  4WET A;  2PN8 A;  1HD2 A;  4JR4 A;  4OO4 A;  2NTO A;  2O8V B;  4EC0 A;  1G7O A;  4F0C A;  2JSZ A;  2WVX B;  4TR1 B;  3DYR A;  5DBQ A;  5ECO B;  4L5O A;  2OAC A;  4PNF A;  3HVX A;  2L4Q A;  2C0G A;  4TW5 A;  1BQ7 A;  1YF0 A;  2TRC P;  3F4T A;  3PR8 A;  5HR3 A;  2AHE A;  1U6T A;  4LA1 A;  3WT2 A;  4O7H A;  2C80 A;  4KB3 A;  3HVN A;  2V6K A;  3L9V A;  1S3C A;  3NIV A;  4PI2 C;  1R26 A;  2KP1 A;  1WRY A;  4OMV A;  2CAQ A;  2OJL A;  5E59 A;  3ZIJ A;  1YY7 A;  5D73 A;  4TOP A;  4TKY A;  1PL2 A;  1O73 A;  3TKQ A;  2V2G A;  1GSY A;  4XS1 A;  2VL9 A;  1ZYE A;  4BVX B;  3RGB C;  5J40 A;  3Q74 A;  2E0Q A;  3GMF A;  3D0Z A;  4MZC A;  5CRW A;  3QMX A;  3A5W A;  3IHQ A;  1PD2 1;  4J2F A;  1YVL A;  3O6T A;  4TR0 A;  1AXD A;  3TB2 A;  2JAC A;  1Z6N A;  3RBT A;  2H73 A;  1K0N A;  5J9C A;  1QQ2 A;  4GWR A;  2IJY A;  4KUN A;  2VL2 A;  1A23 A;  1AQW A;  1J9B A;  1FVK A;  1H4O A;  5AIS A;  3OR5 A;  1Q98 A;  1X9S B;  4V2N A;  1TK5 B;  5BMU B;  4NHW A;  1FVJ A;  2XPE A;  3QPM A;  3VPT A;  4G01 A;  3IOS A;  2ES7 A;  2A2R A;  1HNC A;  2FNO A;  1TU8 A;  2PWJ A;  1S3A A;  4GQC A;  2VCT A;  1ML6 A;  2VCV A;  2KHP A;  4LL4 B;  4ISD A;  2R4V A;  1K0A A;  4MF5 A;  5IQY A;  3APS A;  3DD3 A;  1PFO A;  2QA1 A;  2A4V A;  3EUR A;  4G0I A;  5IO2 A;  3GTU A;  5EY6 A;  3EC3 A;  1AUC A;  2H1A A;  2H6Y A;  2X49 A;  1SYX A;  2WZS A;  1XCC A;  4L5L A;  2ALB A;  5IO0 A;  1CQH A;  2RLI A;  2IPA A;  18GS A;  2AB6 A;  3KP8 A;  5F06 A;  1FB0 A;  1K0O A;  4FYB A;  3CSI A;  4KA0 A;  1A2L A;  1M3I A;  1FOV A;  1JZD A;  3M8N A;  3IAM 2;  3L4N A;  3U5R E;  1U3I A;  4KGI A;  3HZ4 A;  1Z5Y E;  2K9F A;  3EWL A;  2F51 A;  4PTS A;  2VAF A;  2V1M A;  3IDV A;  3GNJ A;  2WW0 A;  1BG5 A;  5HR1 A;  2CAI A;  3UOM A;  5AGY A;  3LXT A;  1XWG A;  3MAK A;  4Q5Q A;  3I9V 2;  3IC8 A;  3QOU A;  4NMU A;  2A2P A;  2HI7 A;  1V40 A;  1OKD A;  4EVM A;  2LJK A;  4N0V A;  4TRX A;  1X0R A;  2IWT A;  3LYK A;  3VWV A;  3TJK A;  3I43 A;  2FGX A;  1XFL A;  3HHV A;  1KBN A;  2NVL A;  1MD4 A;  3DXB A;  4IQA A;  2B7K A;  5EVO A;  3TOU A;  3W8J A;  3APO A;  1WP0 A;  3J7Y b;  2R5G A;  1SJI A;  2WDU A;  5A5H B;  2HSM B;  3DGQ A;  2YWN A;  1TDI A;  5H5S A;  3GN3 A;  3ME7 A;  4JE1 A;  2C0E A;  5COH A;  4POM A;  3CSJ A;  5J9B A;  2VLU A;  3VK9 A;  5JCU A;  1VRS D;  1W89 A;  4ECI A;  1TK0 B;  4Z2U A;  4IJ3 A;  1C72 A;  1AW9 A;  3M0F A;  3KZQ A;  2H6X A;  3NZN A;  2GZZ A;  3C8E A;  4HZ2 A;  5AN1 A;  1J0F A;  4MH3 A;  1ZL9 A;  5GST A;  16GS A;  4IBP A;  3FR9 A;  3I69 A;  4IS0 A;  3F6F A;  2VL3 A;  3VWW A;  2CX4 A;  4YQV A;  5IPG A;  4KDY A;  4OFN A;  2VCX A;  4PUA A;  3D21 A;  5IIZ A;  3M9K A;  4BVY A;  2OBK A;  2X8H A;  2HT9 A;  1XXU A;  1A2M A;  4PUR A;  2L4C A;  2PMT A;  4RUV A;  1FW1 A;  2VO4 A;  1QMV A;  2YWI A;  4G0L A;  4AGS A;  2GQL A;  2IL3 A;  1JLV A;  4MNN A;  4DSS B;  3M3M A;  4TN8 A;  3KH7 A;  2IMF A;  3DIE A;  3P2A A;  2DJ2 A;  5ECI B;  1SKS B;  4W66 A;  5CRE A;  1T7P B;  2B6M A;  5AIV A;  12GS A;  1URM A;  1XBS A;  2NBS A;  4NHZ A;  1MD3 A;  3QAV A;  2AYT A;  2VCW A;  1GLP A;  1K3Y A;  1YEW C;  2RII A;  3IAS 2;  4JRR A;  5JWR B;  2FHE A;  1XW9 A;  3TRP A;  4IVF A;  3LFL A;  1ZCP A;  2ZNM A;  3TRX A;  3ZMK A;  2A4H A;  1Q4J A;  1B48 A;  5KOX A;  5CYY A;  1F3B A;  3HA9 A;  4IP6 A;  3GYK A;  1WJK A;  5DJM A;  6GSW A;  1S3D A;  2LEG A;  5A4U A;  2DSA A;  3HMJ G;  1Z9H A;  2LNT A;  3FEU A;  3O76 A;  2F8A A;  1TU7 A;  2AUV A;  4TVE A;  1V98 A;  2FWG A;  1SVM A;  1F9M A;  2X8C A;  4MJC A;  4POL A;  2CZ2 A;  1E6B A;  3SBC A;  2LKU A;  3F3R A;  2R0G A;  3GL3 A;  4EKZ A;  3ERG A;  3TJB A;  4BWQ A;  4AKI A;  4JR6 A;  4XHM A;  2OT3 A;  2WRT A;  3J7Y k;  2H19 A;  1K0B A;  3UAP A;  3F3Q A;  3IPZ A;  4K1F A;  4XRA A;  3RAZ A;  3GKK A;  1DUG A;  4PQI A;  1UC7 A;  3VI7 A;  2GVP A;  4I8B A;  1NM3 A;  1R5A A;  5DDL A;  1ZZY A;  4L8E A;  2V6O A;  3A3T A;  2H1G A;  1PL1 A;  1TKD B;  4ML6 A;  3APQ A;  2FCH A;  4DSR A;  2ON7 A;  4Z2T A;  2ZCT A;  2HRA A;  2EIQ A;  4A5P A;  1Z6M A;  3L9U A;  3W6G A;  3MSZ A;  2PBJ A;  4POB A;  5L71 A;  1W4V A;  1YF1 A;  3L78 A;  3VPQ A;  2VKZ G;  1DSB A;  3ED3 A;  4I6X A;  3C7M A;  2E2G A;  3ERW A;  4N0Z A;  5J3R A;  1U87 A;  4O92 A;  4F2I A;  1PA3 A;  4KSO A;  2DMM A;  1XZO A;  3QFB C;  2X4A A;  2LJR A;  2GQK A;  2K6V A;  1UVZ A;  2H6Z A;  2L5L A;  4PUF C;  5ECL B;  4D73 B;  5LD0 A;  4O5R A;  5DCG A;  1GTB A;  3GTU B;  2ON5 A;  1I1I P;  4KF9 A;  5ECR B;  2I4A A;  4GTU A;  2DIZ A;  2YJH A;  3DWV A;  2REM A;  2F8F A;  2WVZ A;  3BD2 A;  1I9D A;  2C1Y A;  5G5F A;  2FWH A;  1R5P A;  3GST A;  2AV4 A;  4IJI A;  1O8X A;  3CQF A;  1XOA A;  2F3M A;  4ID0 A;  4X4J A;  1CQG A;  2MZC A;  4NWY A;  1Z3E A;  5IMV A;  5D9W A;  7GSS A;  1GSQ A;  3EE2 A;  2YPM A;  4ULX A;  1WWJ A;  2VUP A;  3CRT A;  4KH7 A;  1YEX A;  2H1B A;  5ECN B;  1VF1 A;  3PGT A;  3ZRE A;  1GSF A;  1T8E B;  1JHB A;  3KJY A;  1PQN A;  1XW6 A;  4ZBB A;  2PVQ A;  5INY A;  2VD0 A;  1LU4 A;  5J4Y A;  2C0F A;  1DE1 A;  3TKS A;  4K0N A;  3RHC A;  4OWY A;  5G1L A;  3D4M A;  4MF7 A;  1A8Y A;  1PRX A;  1SJZ A;  4USS A;  1AC1 A;  5IMD A;  5ID2 A;  2HRK A;  4WBJ A;  5G1K A;  4XS4 A;  2YCD A;  5D8I A;  1V57 A;  3CBU A;  2BMX A;  4CHS A;  3H79 A;  1NW2 A;  5D96 A;  3UJ1 A;  5DQY A;  1GUM A;  4DSQ A;  2H0G A;  3GUR A;  5KOW A;  1X9W B;  1K0D A;  3H93 A;  1TOF A;  3HVS A;  2DLX A;  3WD6 A;  1JZW A;  3KTL A;  4QL9 A;  1EOG A;  1T1V A;  2IFQ A;  19GS A;  4IEL A;  3JCM L;  3KD0 A;  3RHB A;  4E8H A;  1ZYQ B;  4WEY A;  4EDY A;  4GQF A;  4KX4 A;  5JWO B;  6GST A;  4MZB A;  4IW9 A;  5EPF A;  3A2W A;  1SVL A;  2MMZ A;  4K7I A;  4Q5R A;  1GNW A;  4IP1 A;  1EGO A;  5CAX A;  1WIK A;  5IOW A;  1M9A A;  2DC5 A;  4BVY B;  1USB A;  2J23 A;  5F0G A;  2E7P A;  2LQQ A;  1GUL A;  3WGE A;  1RW1 A;  1T4Z A;  2GTU A;  1VF2 A;  2EFD A;  5CP1 A;  1X5D A;  3KM6 A;  2PU9 C;  3M1G A;  2JL4 A;  3LQ7 A;  1AIU A;  3D5J A;  1G7E A;  2P31 A;  3MIX A;  4MPF A;  4NPB A;  1PKZ A;  2GLR A;  2M80 A;  1EV4 A;  1TRV A;  3NOF A;  4IKH A;  3CSH A;  4KCA A;  2O85 A;  2IN3 A;  2H71 A;  1JZO A;  1XWK A;  3GKM A;  2BJX A;  4NV5 A;  5IMF A;  1B8X A;  3H8Q A;  2NPB A;  3O3T A;  4EXJ A;  4XIH A;  3BBY A;  1YJ6 A;  5A1N A;  2NDO A;  1YKA A;  4Z7X A;  2H30 A;  4HSC X;  4TXO B;  22GS A;  3GSS A;  2GQM A;  1M0U A;  5F8B A;  4RQR A;  8GSS A;  4G19 A;  3I6A A;  5IOX A;  3KCM A;  2B5E A;  1KEB A;  3S9F A;  4K2X A;  5A4W A;  3A2X A;  3GV1 A;  2KUC A;  5ELA A;  1MDI A;  3RPP A;  1O7U A;  4EIQ A;  1PN9 A;  3Q19 A;  4MCU A;  4MDC A;  4NAX A;  3ZFB A;  3FY7 A;  2XHF A;  4LMW A;  3ME8 A;  4H86 A;  3H1N A;  4KSM A;  1O6J A;  4F9Z A;  1ZGN A;  1HYU A;  2QSI A;  4L0U A;  4RQX A;  1Y1U A;  2P5Q A;  2DKI A;  2EC4 A;  1GUH A;  2LQO A;  3FW2 A;  4YQU A;  2C3Q A;  4X43 A;  1BED A;  1IYI A;  2RM5 A;  3EU4 A;  4K7N A;  2RUF A;  1OC3 A;  1ZYP A;  2VL2 C;  1BX9 A;  4YQM A;  2O5V A;  4G9H A;  4FIW A;  2WVY A;  2WZ9 A;  2HRN A;  2VM2 A;  2HXK A;  4QL7 A;  1MDK A;  5IMC A;  1ZOF A;  5DAK A;  3VWU A;  5KN3 A;  1ZMA A;  4LLR A;  3GH6 A;  2QA2 A;  6GSX A;  4PI0 C;  3KP9 A;  4ZL8 A;  4NXI A;  4HI7 A;  2GZP A;  1XWC A;  3GIX A;  2JZR A;  5C00 A;  4ZBA A;  3UEM A;  3KIJ A;  2UZ8 A;  3RPN A;  3LEF A;  2L59 A;  1GLQ A;  2WS2 A;  2B1L A;  3ZLP A;  2IME A;  1OKT A;  5EL8 A;  3FZ9 A;  2I3Y A;  1BG1 A;  2WJU A;  3GA4 A;  2WCI A;  1ST9 A;  1A24 A;  3LXZ A;  4G10 A;  4XRD A;  2HZE A;  1GWC A;  1M9B A;  2H74 A;  4BA7 A;  2JZT A;  3TJG A;  1EEJ A;  1GNE A;  1NHY A;  3TDG A;  1WE0 A;  3UL3 A;  5E4W A;  3HJO A;  4V1A g;  5JCW A;  20GS A;  4ECC A;  3U6V A;  2OAD A;  1ILO A;  2C3T A;  4XTS A;  3FMW A;  1SD9 A;  5CRD A;  3N5O A;  4KE3 A;  2C8U A;  4KDX A;  1U3A A;  3GX8 A;  2XBI A;  1V9W A;  4BVX A;  2X8G A;  3ZVJ A;  2MYG A;  5ELG A;  5J5N A;  4KAE A;  2RM6 A;  1XPV A;  3TUE A;  5F05 A;  1G0T A;  2C3N A;  2GSR A;  3BCI A;  1GUK A;  4YH2 A;  5B7C A;  3CTF A;  4GDF A;  4E8E A;  4FYC A;  4JED A;  2DIY A;  2B3S A;  3ZL5 A;  2MMA A;  1TI3 A;  3C73 A;  4IQ1 A;  1S4B P;  2WB9 A;  4MH2 A;  1GTU A;  2MBT A;  4V2L A;  5BMU A;  4O32 A;  1AAZ A;  2C4J A;  4HU9 A;  3LYP A;  2C0D A;  4JU5 A;  5JWQ B;  4ICY A;  1FG4 A;  1SK1 A;  3D22 A;  1FB6 A;  2MMO A;  2X64 A;  2N5A A;  1YDK A;  5ID2 B;  3ISO A;  4XS4 B;  3ERF A;  1LBK A;  2LRT A;  2WW2 A;  2CV4 A;  1M2B A;  1HNB A;  4GF0 A;  2JAD A;  2VLV A;  3C71 A;  2DJ1 A;  2IMI A;  4PGT A;  4OO5 A;  4KCE A;  2EFH A;  3QCP A;  3UVT A;  3GRX A;  4ZIL A;  2N5B A;  4BPY A;  5H5Q A;  1WOU A;  2O7K A;  2AAW A;  5ECQ B;  4K8M A;  1SU9 A;  3MYD A;  2FUG 2;  4MJB A;  4PX1 A;  5DAL A;  3MWH A;  1OVN A;  3EMX A;  5IMA A;  2IFQ B;  4MJE A;  1AQX A;  1OE7 A;  1YQ1 A;  4J56 E;  4ECB A;  1SYR A;  2H01 A;  3TJF A;  1QXH A;  3G7Y A;  1X9M B;  3L9S A;  4V1A p;  4N10 A;  2YWM A;  1EOH A;  1XVQ A;  2GZY A;  4WKW A;  2FY6 A;  2YZU A;  4K2D A;  3F6D A;  4K5R A;  3FYG A;  3GUS A;  3DVX A;  3EVI A;  5GAP D;  2H8L A;  3UMA A;  1X5C A;  5ECS A;  1MEK A;  1B9X C;  2H0H A;  1QGV A;  3ZZX A;  3BJ5 A;  3CYN A;  2OA7 A;  2QC7 A;  4BL7 A;  2CVD A;  4ZBD A;  3FKF A;  2HSM A;  2OE3 A;  1HNA A;  4HUA A;  3TJJ A;  1QUW A;  3VWX A;  2HSY A;  2CX3 A;  3VLN A;  2B1K A;  3FK8 A;  3LWA A;  4ZXG A;  5ECP B;  2OBI A;  3PIN A;  10GS A;  3FR6 A;  1T4Y A;  5LNK e;  4QQ7 A;  1FAA A;  1TW9 A;  2CVB A;  2PGT A;  2L57 A;  4IHU A;  1PKW A;  1ACV A;  4X1U A;  4OFT A;  5A1N B;  4FXY P;  2R3X A;  3W8S A;  5FHI A;  2FLS A;  3DKS A;  2VM1 A;  1O8W A;  1T3B A;  2GDR A;  4WR4 A;  2QGV A;  3SWL A;  5H5R A;  2DJK A;  5J4U A;  2GSS A;  2EIR A;  3HZ8 A;  1TTZ A;  2HNL A;  2TRX A;  3F4R A;  3EYT A;  1O81 A;  1KNG A;  4ZB9 A;  1AQV A;  2FA4 A;  2LUS A;  1WMJ A;  3QAW A;  6GSV A;  3CXG A;  4JZQ A;  3LJR A;  2LV3 A;  4K6X A;  2HLS A;  3UBK A;  5DJL A;  2K18 A;  2XC2 A;  1OYJ A;  5GZZ B;  3E9J B;  3GHA A;  4DSS A;  3IK7 A;  1SVO A;  3A2V A;  1JLW A;  1M3J A;  2CQ9 A;  4WF4 A;  4ECJ A;  4TXV A;  5LCZ A;  3FZ5 A;  1B9Y C;  3VFI A;  1SJ6 A;  2I1U A;  4F03 A;  1TJD A;  1T00 A;  2FWF A;  3QR6 A;  1A0F A;  2YP6 A;  4QMK A;  2UV8 G;  1BAY A;  4BIK A;  5B6M A;  2MBS A;  4ZB8 A;  5DAK B;  4ZB6 A;  4LL1 B;  4YKG A;  1GTI A;  1I5G A;  3CWG A;  3BOA A;  4OFM A;  4AKX B;  1GTA A;  4EO3 A;  4MLY A;  1BJX A;  1NSW A;  4GLT A;  4RI7 A;  1LJR A;  4HQS A;  1K0M A;  4ZL7 A;  2HSN A;  3DRN A;  4MMM A;  5C04 A;  5F07 A;  3IA1 A;  3C1S A;  4GXZ A;  1OAZ A;  2O87 A;  3C1R A;  2JSY A;  4MK3 A;  2HFD A;  2HZE B;  2B5Y A;  5KEJ A;  2K8V A;  4EDZ A;  5DQS A;  1FO5 A;  1Y6E A;  1YEP A;  4N11 A;  5D93 A;  4TR3 A;  2KP2 A;  3CHX C;  3TCO A;  2OE1 A;  2XPD A;  3G7I A;  1O85 A;  3VUR A;  4MA9 A;  5DCH A;  4I2U A;  3IK9 A;  5A5K A;  4ZB7 A;  4FH8 A;  1M2D A;  2JZS A;  3DML A;  5G31 A;  5G5E A;  1A0R P;  5BRT A;  3A5I A;  2GS3 A;  4EF0 A;  3EMP A;  3D6I A;  3HXS A;  4HJM A;  2EFE A;  4YKF A;  2N5F A;  2G0F A;  3F9U A;  2YWO A;  3HYP A;  3TKS C;  4AJ8 A;  2YN1 A;  1R4W A;  2H75 A;  1OC9 A;  1RQM A;  3M9J A;  5HFI A;  1ERW A;  2YV7 A;  4AJ7 A;  3CMI A;  2LRN A;  6GSU A;  1F37 A;  2YAN A;  1KTE A;  2G2Q A;  3RDW A;  4ML1 A;  1K3L A;  2L6D A;  4AKH A;  2H1D A;  3KMO A;  4GRF A;  4MPG A;  5HFK A;  2HSH A;  1VGL A;  1EP8 A;  1K0C A;  5ECK B;  5KN2 A;  3HCZ A;  4PQ1 A;  1EGR A;  4F0B A;  1ERT A;  3ZRD A;  4POK A;  3P7X A;  4GST A;  2KLX A;  4CW9 A;  1FHE A;  2R6K A;  4MJA A;  3QFA C;  2H72 A;  4Z2R A;  2DJ3 A;  2DJJ A;  3BCK A;  3IRA A;  5KN0 A;  3WYW A;  3FR3 A;  14GS A;  2I9H A;  1TRU A;  5B8B A;  4D73 A;  3MDK A;  2GST A;  4YAV A;  2PUK C;  2V41 A;  1YZX A;  4O5U A;  5CO3 A;  3TU3 B;  5J41 A;  4V2M A;  4WR5 A;  4RI6 A;  3FZ4 A;  2YV9 A;  2PPT A;  5ENU A;  3GKX A;  5A34 A;  2LRC A;  1GRX A;  5HQP A;  3QDN A;  3VI5 A;  5AIX A;  2M72 A;  2CZ3 A;  4BWS A;  5GSS A;  4NV2 A;  3DVW A;  3UVH A;  2K8S A;  2M46 A;  5DAL B;  4HJ2 A;  4CDO A;  4DEJ A;  2VIM A;  3PH9 A;  3D4T A;  3IC4 A;  1TXX A;  4TR4 A;  3E3E A;  3KXO A;  4Q5N A;  4KND A;  5DVB A;  3FHK A;  2YNX A;  1B4Q A;  1GSU A;  5J4V A;  3Q18 A;  3ZYW A;  1ABA A;  5G30 A;  2AJQ B;  1QK8 A;  4G2E A;  1OC8 A;  1SL1 B;  1U88 A;  2Z9S A;  2GSQ A;  4MP4 A;  3LW9 A;  1THX A;  4OD7 A;  3N9J A;  4MZW A;  2YZH A;  1GSE A;  3L0H A;  1ON4 A;  4AJ6 A;  3EIN A;  2WVX A;  4PXO A;  3EU3 A;  4TR1 A;  1R7H A;  4BL7 B;  1F3A A;  1E2Y A;  3V1W A;  1VF3 A;  2WW3 A;  2LS5 A;  4ZL9 A;  3TKR A;  2HZF A;  3MNG A;  5D9V A;  3R3E A;  1RK4 A;  3H4K A;  3IV4 A;  5G2Z A;  4EUY A;  3LSZ A;  4E68 A;  2L6C A;  4O5Q A;  1TRW A;  3RFR C;  1XVW A;  5IMZ A;  5CRG A;  1XG8 A;  1PMT A;  5FWG A;  4ACS A;  4WF5 A;  4HU7 A;  4CY8 A;  9GSS A;  1XW5 A;  4CY6 A;  4F82 A;  1J08 A;  2P5R A;  5HR2 A;  1PGT A;  3HJM A;  1Y25 A;  4N30 A;  1UA5 A;  4X0X A;  4P3Y B;  2VOC A;  2LST A;  3HD5 A;  2WUL A;  3LOR A;  4I5Q A;  3F8U A;  2DBC A;  1M7T A;  3P8W A;  5J47 A;  4KW6 A;  1EV9 A;  3F4S A;  5A4V A;  4J57 E;  1IYH A;  4GSS A;  2EIO A;  3TGZ A;  2WFC A;  3GL5 A;  1BF5 A;  4K7O A;  4JBB A;  3HDC A;  1N8J A;  1SEN A;  1EWX A;  2TIR A;  1TXU A;  3E0U A;  2FWE A;  5CNW A;  2FD3 A;  1TI1 A;  3KMN A;  3KH9 A;  1SL2 B;  3K8N A;  1SK2 A;  2J9H A;  1B4P A;  1GSD A;  1DE2 A;  4PNG A;  2CT6 A;  5FT3 A;  1UN2 A;  1MTC A;  2GGT A;  5IM9 A;  3F0I A;  4HS1 A;  1M99 A;  1HQO A;  3G7J A;  1SK0 A;  1YKC A;  3CTG A;  2HRK B;  2HE3 A;  2D2Z A;  1PN0 A;  2H1L A;  5GAN D;  3AY8 A;  6GSS A;  5HFG A;  1SD8 A;  1F6M C;  2CA8 A;  1K3O A;  1M2A A;  3IBH A;  3WGX A;  4TXO A;  4AF2 A;  2X99 A;  3TKS E;  4AI6 A;  1GP1 A;  1XWA A;  2R37 A;  1N25 A;  1QFN A;  4XS6 A;  2GT6 A;  1DBY A;  3IR4 A;  4MF6 A;  3GX0 A;  1XOB A;  4HZ4 A;  2WW1 A;  4ILF A;  2BTO T;  2HSN B;  3US3 A;  4GCI A;  4HOJ A;  2IMK A;  2O36 A;  2PVO C;  1PSQ A;  3HKR A;  2LNS A;  1PX7 A;  4YAP A;  1THO A;  3ZIV A;  3TRQ A;  2YOI A;  3R2Q A;  2DML A;  5JCG A;  2ZUP A;  4HDE A;  5ECH B;  17GS A;  1N2A A;  1S3R A;  2YJ7 A;  1GSS A;  3IXR A;  3DEX A;  3EPT A;  4KDU A;  2P0G A;  4FQU A;  4OCE A;  2B7J A;  1H75 A;  2VCZ A;  1G6W A;  5IPH A;  1EP7 A;  2FA8 A;  3LGC A;  2DJ0 A;  2E2M A;  11GS A;  3WGD A;  2KOK A;  2H0I A;  1VF4 A;  3GH9 A;  3HVV A;  2GT5 A;  3Q6O A;  1SKR B;  4WBR D;  4N3Z A;  2XBQ A;  3LG6 A;  4XCS A;  5A5H A;  1SL0 B;  3UIW A;  3TOT A;  1OC9 B;  2R2J A;  2O89 A;  1A2J A;  4AKG A;  3IE3 A;  2HQT A;  1V2A A;  4GSN A;  3FZA A;  4Q5F A;  4ZIJ A;  2OKA A;  2H66 A;  4IGJ A;  2V32 A;  1ERU A;  1TK8 B;  3GKN A;  2VD1 A;  3FRC A;  1ZYN A;  4G0K A;  2IMD A;  2IIY A;  2JU5 A;  3HJP A;  5KN1 A;  4FO5 A;  4WXT A;  1GL8 A;  5ECM B;  2HRF A;  1SKW B;  1JFU A;  2HYX A;  1JZR A;  2L5O A;  2O3E A;  5ABR A;  1G6Y A;  4I97 A; 
#chains in the Genus database with same CATH homology
 2RUE A;  3QAG A;  3CRU A;  13GS A;  3UBL A;  3F63 A;  5CRH A;  1EEM A;  4LMV A;  2OE0 A;  2VLT A;  3KEB A;  3KTB A;  1NHO A;  5D9X A;  4L0W A;  1XWB A;  3QD9 A;  2R0P A;  1V58 A;  2I81 A;  2MMN A;  5A34 B;  2WGR A;  1PX6 A;  3ZML A;  1FOH A;  2QKE A;  5HR0 A;  1Z7R A;  2VCQ A;  1F2E A;  2LTK A;  4FYU A;  4K5S A;  4K0G A;  4K9Z A;  3KGK A;  1Z7P A;  2B5X A;  5B8A A;  2H76 A;  3ZTL A;  2CVK A;  2EFC A;  4PQH A;  6GSY A;  4OCF A;  1EZK A;  4HQZ A;  1TRS A;  3GFK A;  5B6N A;  2F9S A;  4I2T A;  4IN0 A;  3UAR A;  1BYE A;  2LJA A;  3G9B A;  3ZIT A;  4DVC A;  2A2S A;  4HEA 2;  1TP9 A;  2R0C A;  4EE0 A;  3HY2 A;  2PER A;  3ZFL A;  3IHG A;  3TKP A;  3ZVJ D;  4MAB A;  4EIP A;  1MDJ A;  3WT1 A;  5D9T A;  1WPI A;  1XIY A;  3PPU A;  1A8L A;  4EL1 A;  1GH2 A;  2H70 A;  1OE8 A;  3P90 A;  2DKH A;  1ERV A;  1X5E A;  4WET A;  2PN8 A;  1HD2 A;  4JR4 A;  4OO4 A;  2NTO A;  2O8V B;  4EC0 A;  1G7O A;  4F0C A;  2JSZ A;  4TR1 B;  3DYR A;  5DBQ A;  5ECO B;  4L5O A;  2OAC A;  4PNF A;  3HVX A;  2L4Q A;  2C0G A;  4TW5 A;  1BQ7 A;  1YF0 A;  2TRC P;  3F4T A;  3PR8 A;  5HR3 A;  2AHE A;  1U6T A;  4LA1 A;  3WT2 A;  4O7H A;  2C80 A;  4KB3 A;  2V6K A;  3L9V A;  1S3C A;  3NIV A;  1R26 A;  2KP1 A;  1WRY A;  4OMV A;  2CAQ A;  2OJL A;  5E59 A;  3ZIJ A;  1YY7 A;  5D73 A;  4TOP A;  4TKY A;  1PL2 A;  1O73 A;  3TKQ A;  2V2G A;  1GSY A;  4XS1 A;  2VL9 A;  1ZYE A;  4BVX B;  5J40 A;  3Q74 A;  2E0Q A;  3GMF A;  3D0Z A;  4MZC A;  5CRW A;  3QMX A;  3A5W A;  3IHQ A;  1PD2 1;  4J2F A;  1YVL A;  3O6T A;  4TR0 A;  1AXD A;  3TB2 A;  2JAC A;  1Z6N A;  3RBT A;  2H73 A;  1K0N A;  5J9C A;  1QQ2 A;  4GWR A;  2IJY A;  4KUN A;  2VL2 A;  1A23 A;  1AQW A;  1J9B A;  1FVK A;  1H4O A;  5AIS A;  3OR5 A;  1Q98 A;  1X9S B;  4V2N A;  1TK5 B;  5BMU B;  4NHW A;  1FVJ A;  2XPE A;  3QPM A;  3VPT A;  4G01 A;  3IOS A;  2ES7 A;  2A2R A;  1HNC A;  2FNO A;  1TU8 A;  2PWJ A;  1S3A A;  4GQC A;  2VCT A;  1ML6 A;  2VCV A;  2KHP A;  4LL4 B;  4ISD A;  2R4V A;  1K0A A;  4MF5 A;  5IQY A;  3APS A;  3DD3 A;  2QA1 A;  2A4V A;  3EUR A;  4G0I A;  5IO2 A;  3GTU A;  5EY6 A;  3EC3 A;  1AUC A;  2H1A A;  2H6Y A;  2X49 A;  1SYX A;  1XCC A;  4L5L A;  2ALB A;  5IO0 A;  1CQH A;  2RLI A;  2IPA A;  18GS A;  2AB6 A;  3KP8 A;  5F06 A;  1FB0 A;  1K0O A;  4FYB A;  3CSI A;  4KA0 A;  1A2L A;  1FOV A;  1JZD A;  3M8N A;  3IAM 2;  3L4N A;  3U5R E;  1U3I A;  4KGI A;  3HZ4 A;  1Z5Y E;  2K9F A;  3EWL A;  2F51 A;  4PTS A;  2VAF A;  2V1M A;  3IDV A;  3GNJ A;  1BG5 A;  5HR1 A;  2CAI A;  3UOM A;  5AGY A;  3LXT A;  1XWG A;  3MAK A;  4Q5Q A;  3I9V 2;  3IC8 A;  3QOU A;  4NMU A;  2A2P A;  2HI7 A;  1V40 A;  1OKD A;  4EVM A;  2LJK A;  4N0V A;  4TRX A;  1X0R A;  2IWT A;  3LYK A;  3VWV A;  3TJK A;  3I43 A;  2FGX A;  1XFL A;  3HHV A;  1KBN A;  2NVL A;  1MD4 A;  3DXB A;  4IQA A;  2B7K A;  5EVO A;  3TOU A;  3W8J A;  3APO A;  1WP0 A;  3J7Y b;  2R5G A;  1SJI A;  2WDU A;  5A5H B;  2HSM B;  3DGQ A;  2YWN A;  1TDI A;  5H5S A;  3GN3 A;  3ME7 A;  4JE1 A;  2C0E A;  5COH A;  4POM A;  3CSJ A;  5J9B A;  2VLU A;  3VK9 A;  5JCU A;  1VRS D;  1W89 A;  4ECI A;  1TK0 B;  4Z2U A;  4IJ3 A;  1C72 A;  1AW9 A;  3M0F A;  3KZQ A;  2H6X A;  3NZN A;  2GZZ A;  3C8E A;  4HZ2 A;  5AN1 A;  1J0F A;  4MH3 A;  1ZL9 A;  5GST A;  16GS A;  4IBP A;  3FR9 A;  3I69 A;  4IS0 A;  3F6F A;  2VL3 A;  3VWW A;  2CX4 A;  4YQV A;  5IPG A;  4KDY A;  4OFN A;  2VCX A;  4PUA A;  3D21 A;  5IIZ A;  3M9K A;  4BVY A;  2OBK A;  2X8H A;  2HT9 A;  1XXU A;  1A2M A;  4PUR A;  2L4C A;  2PMT A;  4RUV A;  1FW1 A;  2VO4 A;  1QMV A;  2YWI A;  4G0L A;  4AGS A;  2GQL A;  2IL3 A;  1JLV A;  4MNN A;  4DSS B;  3M3M A;  4TN8 A;  3KH7 A;  2IMF A;  3DIE A;  3P2A A;  2DJ2 A;  5ECI B;  1SKS B;  4W66 A;  5CRE A;  1T7P B;  2B6M A;  5AIV A;  12GS A;  1URM A;  1XBS A;  2NBS A;  4NHZ A;  1MD3 A;  3QAV A;  2AYT A;  2VCW A;  1GLP A;  1K3Y A;  2RII A;  3IAS 2;  4JRR A;  5JWR B;  2FHE A;  1XW9 A;  3TRP A;  4IVF A;  3LFL A;  1ZCP A;  2ZNM A;  3TRX A;  3ZMK A;  2A4H A;  1Q4J A;  1B48 A;  5KOX A;  5CYY A;  1F3B A;  3HA9 A;  4IP6 A;  3GYK A;  1WJK A;  5DJM A;  6GSW A;  1S3D A;  2LEG A;  5A4U A;  2DSA A;  3HMJ G;  1Z9H A;  2LNT A;  3FEU A;  3O76 A;  2F8A A;  1TU7 A;  2AUV A;  4TVE A;  1V98 A;  2FWG A;  1SVM A;  1F9M A;  2X8C A;  4MJC A;  4POL A;  2CZ2 A;  1E6B A;  3SBC A;  2LKU A;  3F3R A;  2R0G A;  3GL3 A;  4EKZ A;  3ERG A;  3TJB A;  4BWQ A;  4AKI A;  4JR6 A;  4XHM A;  2OT3 A;  2WRT A;  3J7Y k;  2H19 A;  1K0B A;  3UAP A;  3F3Q A;  3IPZ A;  4K1F A;  4XRA A;  3RAZ A;  3GKK A;  1DUG A;  4PQI A;  1UC7 A;  3VI7 A;  2GVP A;  4I8B A;  1NM3 A;  1R5A A;  5DDL A;  1ZZY A;  4L8E A;  2V6O A;  3A3T A;  2H1G A;  1PL1 A;  1TKD B;  4ML6 A;  3APQ A;  2FCH A;  4DSR A;  2ON7 A;  4Z2T A;  2ZCT A;  2HRA A;  2EIQ A;  4A5P A;  1Z6M A;  3L9U A;  3W6G A;  3MSZ A;  2PBJ A;  4POB A;  5L71 A;  1W4V A;  1YF1 A;  3L78 A;  3VPQ A;  2VKZ G;  1DSB A;  3ED3 A;  4I6X A;  3C7M A;  2E2G A;  3ERW A;  4N0Z A;  5J3R A;  1U87 A;  4O92 A;  4F2I A;  1PA3 A;  4KSO A;  2DMM A;  1XZO A;  3QFB C;  2X4A A;  2LJR A;  2GQK A;  2K6V A;  1UVZ A;  2H6Z A;  2L5L A;  4PUF C;  5ECL B;  4D73 B;  5LD0 A;  4O5R A;  5DCG A;  1GTB A;  3GTU B;  2ON5 A;  4KF9 A;  5ECR B;  2I4A A;  4GTU A;  2DIZ A;  2YJH A;  3DWV A;  2REM A;  2F8F A;  3BD2 A;  1I9D A;  2C1Y A;  5G5F A;  2FWH A;  1R5P A;  3GST A;  2AV4 A;  4IJI A;  1O8X A;  1XOA A;  2F3M A;  4ID0 A;  4X4J A;  1CQG A;  2MZC A;  4NWY A;  1Z3E A;  5IMV A;  5D9W A;  7GSS A;  1GSQ A;  3EE2 A;  2YPM A;  4ULX A;  1WWJ A;  2VUP A;  3CRT A;  4KH7 A;  1YEX A;  2H1B A;  5ECN B;  1VF1 A;  3PGT A;  3ZRE A;  1GSF A;  1T8E B;  1JHB A;  3KJY A;  1PQN A;  1XW6 A;  4ZBB A;  2PVQ A;  5INY A;  2VD0 A;  1LU4 A;  5J4Y A;  2C0F A;  1DE1 A;  3TKS A;  4K0N A;  3RHC A;  4OWY A;  5G1L A;  3D4M A;  4MF7 A;  1A8Y A;  1PRX A;  1SJZ A;  4USS A;  1AC1 A;  5IMD A;  5ID2 A;  2HRK A;  4WBJ A;  5G1K A;  4XS4 A;  2YCD A;  5D8I A;  1V57 A;  3CBU A;  2BMX A;  4CHS A;  3H79 A;  1NW2 A;  5D96 A;  3UJ1 A;  5DQY A;  1GUM A;  4DSQ A;  2H0G A;  3GUR A;  5KOW A;  1X9W B;  1K0D A;  3H93 A;  1TOF A;  3HVS A;  2DLX A;  3WD6 A;  1JZW A;  3KTL A;  4QL9 A;  1EOG A;  1T1V A;  2IFQ A;  19GS A;  4IEL A;  3JCM L;  3KD0 A;  3RHB A;  4E8H A;  1ZYQ B;  4WEY A;  4EDY A;  4GQF A;  4KX4 A;  5JWO B;  6GST A;  4MZB A;  4IW9 A;  5EPF A;  3A2W A;  1SVL A;  2MMZ A;  4K7I A;  4Q5R A;  1GNW A;  4IP1 A;  1EGO A;  5CAX A;  1WIK A;  5IOW A;  1M9A A;  2DC5 A;  4BVY B;  1USB A;  2J23 A;  5F0G A;  2E7P A;  2LQQ A;  1GUL A;  3WGE A;  1RW1 A;  1T4Z A;  2GTU A;  1VF2 A;  2EFD A;  5CP1 A;  1X5D A;  3KM6 A;  2PU9 C;  3M1G A;  2JL4 A;  3LQ7 A;  1AIU A;  3D5J A;  1G7E A;  2P31 A;  3MIX A;  4MPF A;  4NPB A;  1PKZ A;  2GLR A;  2M80 A;  1EV4 A;  1TRV A;  3NOF A;  4IKH A;  3CSH A;  4KCA A;  2O85 A;  2IN3 A;  2H71 A;  1JZO A;  1XWK A;  3GKM A;  2BJX A;  4NV5 A;  5IMF A;  1B8X A;  3H8Q A;  2NPB A;  3O3T A;  4EXJ A;  4XIH A;  3BBY A;  1YJ6 A;  5A1N A;  2NDO A;  1YKA A;  4Z7X A;  2H30 A;  4TXO B;  22GS A;  3GSS A;  2GQM A;  1M0U A;  5F8B A;  4RQR A;  8GSS A;  4G19 A;  3I6A A;  5IOX A;  3KCM A;  2B5E A;  1KEB A;  3S9F A;  4K2X A;  5A4W A;  3A2X A;  3GV1 A;  2KUC A;  5ELA A;  1MDI A;  3RPP A;  1O7U A;  4EIQ A;  1PN9 A;  3Q19 A;  4MCU A;  4MDC A;  4NAX A;  3ZFB A;  3FY7 A;  2XHF A;  4LMW A;  3ME8 A;  4H86 A;  3H1N A;  4KSM A;  1O6J A;  4F9Z A;  1ZGN A;  1HYU A;  2QSI A;  4L0U A;  4RQX A;  1Y1U A;  2P5Q A;  2DKI A;  2EC4 A;  1GUH A;  2LQO A;  3FW2 A;  4YQU A;  2C3Q A;  4X43 A;  1BED A;  1IYI A;  2RM5 A;  3EU4 A;  4K7N A;  2RUF A;  1OC3 A;  1ZYP A;  2VL2 C;  1BX9 A;  4YQM A;  2O5V A;  4G9H A;  4FIW A;  2WZ9 A;  2HRN A;  2VM2 A;  2HXK A;  4QL7 A;  1MDK A;  5IMC A;  1ZOF A;  5DAK A;  3VWU A;  5KN3 A;  1ZMA A;  4LLR A;  3GH6 A;  2QA2 A;  6GSX A;  3KP9 A;  4ZL8 A;  4NXI A;  4HI7 A;  2GZP A;  1XWC A;  3GIX A;  2JZR A;  5C00 A;  4ZBA A;  3UEM A;  3KIJ A;  2UZ8 A;  3RPN A;  3LEF A;  2L59 A;  1GLQ A;  2WS2 A;  2B1L A;  3ZLP A;  2IME A;  1OKT A;  5EL8 A;  3FZ9 A;  2I3Y A;  1BG1 A;  2WJU A;  3GA4 A;  2WCI A;  1ST9 A;  1A24 A;  3LXZ A;  4G10 A;  4XRD A;  2HZE A;  1GWC A;  1M9B A;  2H74 A;  4BA7 A;  2JZT A;  3TJG A;  1EEJ A;  1GNE A;  1NHY A;  3TDG A;  1WE0 A;  3UL3 A;  5E4W A;  3HJO A;  4V1A g;  5JCW A;  20GS A;  4ECC A;  3U6V A;  2OAD A;  1ILO A;  2C3T A;  4XTS A;  3FMW A;  1SD9 A;  5CRD A;  3N5O A;  4KE3 A;  2C8U A;  4KDX A;  1U3A A;  3GX8 A;  2XBI A;  1V9W A;  4BVX A;  2X8G A;  3ZVJ A;  2MYG A;  5ELG A;  5J5N A;  4KAE A;  2RM6 A;  1XPV A;  3TUE A;  5F05 A;  1G0T A;  2C3N A;  2GSR A;  3BCI A;  1GUK A;  4YH2 A;  5B7C A;  3CTF A;  4GDF A;  4E8E A;  4FYC A;  4JED A;  2DIY A;  2B3S A;  3ZL5 A;  2MMA A;  1TI3 A;  3C73 A;  4IQ1 A;  2WB9 A;  4MH2 A;  1GTU A;  2MBT A;  4V2L A;  5BMU A;  4O32 A;  1AAZ A;  2C4J A;  4HU9 A;  3LYP A;  2C0D A;  4JU5 A;  5JWQ B;  4ICY A;  1FG4 A;  1SK1 A;  3D22 A;  1FB6 A;  2MMO A;  2X64 A;  2N5A A;  1YDK A;  5ID2 B;  3ISO A;  4XS4 B;  3ERF A;  1LBK A;  2LRT A;  2CV4 A;  1M2B A;  1HNB A;  4GF0 A;  2JAD A;  2VLV A;  3C71 A;  2DJ1 A;  2IMI A;  4PGT A;  4OO5 A;  4KCE A;  2EFH A;  3QCP A;  3UVT A;  3GRX A;  4ZIL A;  2N5B A;  4BPY A;  5H5Q A;  1WOU A;  2O7K A;  2AAW A;  5ECQ B;  4K8M A;  1SU9 A;  3MYD A;  2FUG 2;  4MJB A;  4PX1 A;  5DAL A;  3MWH A;  1OVN A;  3EMX A;  5IMA A;  2IFQ B;  4MJE A;  1AQX A;  1OE7 A;  1YQ1 A;  4J56 E;  4ECB A;  1SYR A;  2H01 A;  3TJF A;  1QXH A;  3G7Y A;  1X9M B;  3L9S A;  4V1A p;  4N10 A;  2YWM A;  1EOH A;  1XVQ A;  2GZY A;  4WKW A;  2FY6 A;  2YZU A;  4K2D A;  3F6D A;  4K5R A;  3FYG A;  3GUS A;  3DVX A;  3EVI A;  5GAP D;  2H8L A;  3UMA A;  1X5C A;  5ECS A;  1MEK A;  1B9X C;  2H0H A;  1QGV A;  3ZZX A;  3BJ5 A;  3CYN A;  2OA7 A;  2QC7 A;  4BL7 A;  2CVD A;  4ZBD A;  3FKF A;  2HSM A;  2OE3 A;  1HNA A;  4HUA A;  3TJJ A;  1QUW A;  3VWX A;  2HSY A;  2CX3 A;  3VLN A;  3LWA A;  2B1K A;  3FK8 A;  4ZXG A;  5ECP B;  2OBI A;  3PIN A;  10GS A;  3FR6 A;  1T4Y A;  5LNK e;  4QQ7 A;  1FAA A;  1TW9 A;  2CVB A;  2PGT A;  2L57 A;  4IHU A;  1PKW A;  1ACV A;  4X1U A;  4OFT A;  5A1N B;  2R3X A;  3W8S A;  5FHI A;  2FLS A;  3DKS A;  2VM1 A;  1O8W A;  1T3B A;  2GDR A;  4WR4 A;  2QGV A;  3SWL A;  5H5R A;  2DJK A;  5J4U A;  2GSS A;  2EIR A;  3HZ8 A;  1TTZ A;  2HNL A;  2TRX A;  3F4R A;  3EYT A;  1O81 A;  1KNG A;  4ZB9 A;  1AQV A;  2FA4 A;  2LUS A;  1WMJ A;  3QAW A;  6GSV A;  3CXG A;  4JZQ A;  3LJR A;  2LV3 A;  4K6X A;  2HLS A;  3UBK A;  5DJL A;  2K18 A;  2XC2 A;  1OYJ A;  5GZZ B;  3E9J B;  3GHA A;  4DSS A;  3IK7 A;  1SVO A;  3A2V A;  1JLW A;  2CQ9 A;  4WF4 A;  4ECJ A;  4TXV A;  5LCZ A;  3FZ5 A;  1B9Y C;  3VFI A;  1SJ6 A;  2I1U A;  4F03 A;  1TJD A;  1T00 A;  2FWF A;  3QR6 A;  1A0F A;  2YP6 A;  4QMK A;  2UV8 G;  1BAY A;  5B6M A;  2MBS A;  4ZB8 A;  5DAK B;  4ZB6 A;  4LL1 B;  4YKG A;  1GTI A;  1I5G A;  3CWG A;  3BOA A;  4OFM A;  4AKX B;  1GTA A;  4EO3 A;  4MLY A;  1BJX A;  1NSW A;  4GLT A;  4RI7 A;  1LJR A;  4HQS A;  1K0M A;  4ZL7 A;  2HSN A;  3DRN A;  4MMM A;  5C04 A;  5F07 A;  3IA1 A;  3C1S A;  4GXZ A;  1OAZ A;  2O87 A;  3C1R A;  2JSY A;  4MK3 A;  2HFD A;  2HZE B;  2B5Y A;  5KEJ A;  2K8V A;  4EDZ A;  5DQS A;  1FO5 A;  1Y6E A;  1YEP A;  4N11 A;  5D93 A;  4TR3 A;  2KP2 A;  3TCO A;  2OE1 A;  2XPD A;  3G7I A;  1O85 A;  3VUR A;  4MA9 A;  5DCH A;  4I2U A;  3IK9 A;  5A5K A;  4ZB7 A;  4FH8 A;  1M2D A;  2JZS A;  3DML A;  5G31 A;  5G5E A;  1A0R P;  5BRT A;  3A5I A;  2GS3 A;  4EF0 A;  3EMP A;  3D6I A;  3HXS A;  4HJM A;  2EFE A;  4YKF A;  2N5F A;  2G0F A;  3F9U A;  2YWO A;  3HYP A;  3TKS C;  4AJ8 A;  2YN1 A;  1R4W A;  2H75 A;  1OC9 A;  1RQM A;  3M9J A;  5HFI A;  1ERW A;  2YV7 A;  4AJ7 A;  3CMI A;  2LRN A;  6GSU A;  1F37 A;  2YAN A;  1KTE A;  2G2Q A;  3RDW A;  4ML1 A;  1K3L A;  2L6D A;  4AKH A;  2H1D A;  3KMO A;  4GRF A;  4MPG A;  5HFK A;  2HSH A;  1VGL A;  1EP8 A;  1K0C A;  5ECK B;  5KN2 A;  3HCZ A;  4PQ1 A;  1EGR A;  4F0B A;  1ERT A;  3ZRD A;  4POK A;  3P7X A;  4GST A;  2KLX A;  4CW9 A;  1FHE A;  2R6K A;  4MJA A;  3QFA C;  2H72 A;  4Z2R A;  2DJ3 A;  2DJJ A;  3BCK A;  3IRA A;  5KN0 A;  3WYW A;  3FR3 A;  14GS A;  2I9H A;  1TRU A;  5B8B A;  4D73 A;  3MDK A;  2GST A;  4YAV A;  2PUK C;  2V41 A;  1YZX A;  4O5U A;  5CO3 A;  3TU3 B;  5J41 A;  4V2M A;  4WR5 A;  4RI6 A;  3FZ4 A;  2YV9 A;  2PPT A;  5ENU A;  3GKX A;  5A34 A;  2LRC A;  1GRX A;  5HQP A;  3QDN A;  3VI5 A;  5AIX A;  2M72 A;  2CZ3 A;  4BWS A;  5GSS A;  4NV2 A;  3DVW A;  3UVH A;  2K8S A;  2M46 A;  5DAL B;  4HJ2 A;  4CDO A;  4DEJ A;  2VIM A;  3PH9 A;  3D4T A;  3IC4 A;  1TXX A;  4TR4 A;  3E3E A;  3KXO A;  4Q5N A;  4KND A;  5DVB A;  3FHK A;  2YNX A;  1B4Q A;  1GSU A;  5J4V A;  3Q18 A;  3ZYW A;  1ABA A;  5G30 A;  2AJQ B;  1QK8 A;  4G2E A;  1OC8 A;  1SL1 B;  1U88 A;  2Z9S A;  2GSQ A;  4MP4 A;  3LW9 A;  1THX A;  4OD7 A;  3N9J A;  4MZW A;  2YZH A;  1GSE A;  3L0H A;  1ON4 A;  4AJ6 A;  3EIN A;  4PXO A;  3EU3 A;  4TR1 A;  1R7H A;  4BL7 B;  1F3A A;  1E2Y A;  3V1W A;  1VF3 A;  2LS5 A;  4ZL9 A;  3TKR A;  2HZF A;  3MNG A;  5D9V A;  3R3E A;  1RK4 A;  3H4K A;  3IV4 A;  5G2Z A;  4EUY A;  3LSZ A;  4E68 A;  2L6C A;  4O5Q A;  1TRW A;  1XVW A;  5IMZ A;  5CRG A;  1PMT A;  5FWG A;  4ACS A;  4WF5 A;  4HU7 A;  4CY8 A;  9GSS A;  1XW5 A;  4CY6 A;  4F82 A;  1J08 A;  2P5R A;  5HR2 A;  1PGT A;  3HJM A;  1Y25 A;  4N30 A;  1UA5 A;  4X0X A;  4P3Y B;  2VOC A;  2LST A;  3HD5 A;  2WUL A;  3LOR A;  4I5Q A;  3F8U A;  2DBC A;  1M7T A;  3P8W A;  5J47 A;  4KW6 A;  1EV9 A;  3F4S A;  5A4V A;  4J57 E;  1IYH A;  4GSS A;  2EIO A;  3TGZ A;  2WFC A;  3GL5 A;  1BF5 A;  4K7O A;  4JBB A;  3HDC A;  1N8J A;  1SEN A;  1EWX A;  2TIR A;  1TXU A;  3E0U A;  2FWE A;  5CNW A;  2FD3 A;  1TI1 A;  3KMN A;  3KH9 A;  1SL2 B;  3K8N A;  1SK2 A;  2J9H A;  1B4P A;  1GSD A;  1DE2 A;  4PNG A;  2CT6 A;  5FT3 A;  1UN2 A;  1MTC A;  2GGT A;  5IM9 A;  3F0I A;  4HS1 A;  1M99 A;  1HQO A;  3G7J A;  1SK0 A;  1YKC A;  3CTG A;  2HRK B;  2HE3 A;  2D2Z A;  1PN0 A;  2H1L A;  5GAN D;  3AY8 A;  6GSS A;  5HFG A;  1SD8 A;  1F6M C;  2CA8 A;  1K3O A;  1M2A A;  3IBH A;  3WGX A;  4TXO A;  4AF2 A;  2X99 A;  3TKS E;  4AI6 A;  1GP1 A;  1XWA A;  2R37 A;  1N25 A;  1QFN A;  4XS6 A;  2GT6 A;  1DBY A;  3IR4 A;  4MF6 A;  3GX0 A;  1XOB A;  4HZ4 A;  4ILF A;  2BTO T;  2HSN B;  3US3 A;  4GCI A;  4HOJ A;  2IMK A;  2PVO C;  1PSQ A;  3HKR A;  2LNS A;  1PX7 A;  4YAP A;  1THO A;  3ZIV A;  3TRQ A;  2YOI A;  3R2Q A;  2DML A;  5JCG A;  2ZUP A;  4HDE A;  5ECH B;  17GS A;  1N2A A;  2YJ7 A;  1GSS A;  3IXR A;  3DEX A;  3EPT A;  4KDU A;  2P0G A;  4FQU A;  4OCE A;  2B7J A;  1H75 A;  2VCZ A;  1G6W A;  5IPH A;  1EP7 A;  2FA8 A;  3LGC A;  2DJ0 A;  2E2M A;  11GS A;  3WGD A;  2KOK A;  2H0I A;  1VF4 A;  3GH9 A;  3HVV A;  2GT5 A;  3Q6O A;  1SKR B;  4WBR D;  4N3Z A;  2XBQ A;  3LG6 A;  4XCS A;  5A5H A;  1SL0 B;  3UIW A;  3TOT A;  1OC9 B;  2R2J A;  2O89 A;  1A2J A;  4AKG A;  3IE3 A;  2HQT A;  1V2A A;  4GSN A;  3FZA A;  4Q5F A;  4ZIJ A;  2OKA A;  2H66 A;  4IGJ A;  2V32 A;  1ERU A;  1TK8 B;  3GKN A;  2VD1 A;  3FRC A;  1ZYN A;  4G0K A;  2IMD A;  2IIY A;  2JU5 A;  3HJP A;  5KN1 A;  4FO5 A;  4WXT A;  1GL8 A;  5ECM B;  2HRF A;  1SKW B;  1JFU A;  2HYX A;  1JZR A;  2L5O A;  5ABR A;  1G6Y A;  4I97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...