2C3QA

Human glutathione-s-transferase t1-1 w234r mutant, complex with s- hexylglutathione
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
239
structure length
239
Chain Sequence
GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPRVLAMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE THETA 1
publication title Structural Basis of the Suppressed Catalytic Activity of Wild-Type Human Glutathione Transferase T1-1 Compared to its W234R Mutant.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c3qA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c3qA01
5AN1A 3L4NA 4XRAA 3L78A 3UMAA 2V6KA 3KZQA 3FZ4A 5LCZA 4HI7A 1CQGA 1PRXA 1X9SB 4ULXA 2CX3A 1PX6A 4HJ2A 2H72A 2YJHA 1JLWA 4Q5FA 2B1LA 3R2QA 12GSA 4G0KA 3GNJA 1RQMA 2HQTA 2VM2A 1GTUA 4HQZA 3IR4A 5EL8A 2JZTA 2L6DA 5HFGA 1TU7A 1K0DA 3GA4A 5DJMA 4KA0A 4RUVA 2CV4A 4NV5A 1N8JA 2WGRA 2LNTA 1LU4A 1Y6EA 1S3DA 3RPNA 1DBYA 1B48A 2RLIA 2RM5A 4I5QA 3TCOA 4ZXGA 3TUEA 1THOA 2ON7A 2O7KA 4NHWA 1K0OA 1ERUA 3W8JA 2CAQA 2H01A 3EU3A 3QCPA 2LEGA 4OMVA 1AXDA 5CRHA 5CRDA 2A4VA 2H6YA 4WEYA 1OAZA 1WE0A 3ZREA 2X8HA 3C1RA 1EOHA 1XWKA 4X43A 4I2UA 2CZ2A 5ECOB 3BCKA 4F0CA 1PKZA 3APOA 5GAND 2C0DA 2PVOC 1YEPA 4DEJA 1GSQA 3D4TA 1SKRB 4J56E 4AF2A 5ECQB 4GWRA 1J9BA 2DJ0A 2I3YA 1EOGA 2MYGA 2JZSA 1JFUA 1A0RP 1GSYA 3EMXA 3DXBA 3PINA 2H71A 6GSVA 2R37A 2VCVA 1KTEA 2E2MA 3ISOA 4ILFA 2IPAA 3NOFA 3ZMLA 4NAXA 3H79A 5ECIB 5A4WA 2RIIA 2H75A 5E59A 3TRXA 4O5RA 2LRTA 2P0GA 3MWHA 2FA4A 4BVYA 1AIUA 3M9JA 3UAPA 4I6XA 1GNEA 1PA3A 1WRYA 2VOCA 1Q98A 5CNWA 4KUNA 1F9MA 1R5AA 3FKFA 2ES7A 4XIHA 1AAZA 4KSOA 2YV9A 2FWGA 4BWSA 1O7UA 1VF4A 2YZHA 3APSA 5G5FA 5LD0A 3QFAC 4ZB8A 3UL3A 2H66A 2F51A 1G6WA 3F3RA 4F9ZA 1B8XA 3UEMA 2XBIA 2OJLA 2MBTA 3HHVA 5AIVA 3FZ5A 2AB6A 5A5KA 1SJIA 1EWXA 2RUFA 3R3EA 1OE8A 2MMOA 3GTUB 2LQQA 1UA5A 3O6TA 4K0GA 4PQIA 3CRTA 4EO3A 4ZBBA 2H73A 5IO0A 4IGJA 4OFMA 4G0LA 2H0GA 1U88A 2JSZA 1AQXA 4OFTA 1PD21 4JRRA 4MMMA 1GUMA 5F06A 2EIOA 1EV9A 4IJIA 4GRFA 2IJYA 1X9MB 3WGEA 4H86A 1K0CA 4CDOA 2DJ3A 3M8NA 4L0UA 4YH2A 4IJ3A 2YANA 3CSJA 3ZZXA 3P2AA 4KH7A 2R4VA 2QSIA 2G0FA 3U6VA 2GQLA 2YZUA 1ZGNA 3O76A 1EEMA 2V6OA 1TK8B 1OC9A 2HZEB 1NW2A 4ECJA 4JR4A 4POKA 1VF1A 4WKWA 1K0AA 3QAWA 4TR1A 4J57E 3LXTA 1XWBA 2LSTA 3D0ZA 2R6KA 4I8BA 4BPYA 2PU9C 1SL2B 4KDYA 2HNLA 4BWQA 5DQYA 4NWYA 4LLRA 4ZB6A 1Z9HA 3QDNA 1Q4JA 4XS4A 3LG6A 3TOUA 4Q5RA 1ACVA 5ELGA 1F3BA 3BCIA 3ERFA 2AUVA 1A8LA 1O6JA 1W89A 3EC3A 3Q19A 2VLTA 3F6DA 3FW2A 1M99A 1GULA 5J4UA 4HU9A 4ISDA 2F3MA 3CMIA 4BA7A 1A8YA 3Q6OA 3J7Yb 1LBKA 3EMPA 1MTCA 2CQ9A 1EZKA 2WJUA 1XVQA 2YOIA 3M0FA 5ECKB 2DIYA 2PERA 2I4AA 3GL3A 5B7CA 4XCSA 2YWNA 3TJBA 1XWGA 2E2GA 3ZFBA 4EL1A 5L71A 5ECHB 4MZCA 4PNFA 2IMEA 1O73A 5ABRA 5DJLA 4WBRD 2IIYA 4YAPA 3GMFA 1M7TA 1H4OA 1VF2A 2O8VB 2PUKC 4IHUA 3W6GA 1JZWA 3SWLA 3UBKA 2GTUA 2K8VA 1MEKA 2HZFA 5ECPB 17GSA 4G19A 2OADA 3L9VA 3FR6A 3MNGA 2PMTA 1ZYEA 3A2XA 5A4VA 2PVQA 2CX4A 4IBPA 4E8HA 2VAFA 2NDOA 1TDIA 2NTOA 4DSSA 1T4ZA 4FH8A 4GQCA 4HZ2A 5C04A 1T1VA 3K8NA 3I69A 4I97A 4NHZA 3IAS2 3TKQA 3DRNA 2WRTA 2FY6A 4PQHA 3KXOA 5D73A 3A3TA 3FR9A 4KX4A 4FYUA 1B4QA 1ON4A 4HS1A 1Y25A 2YWMA 3ZMKA 4OO5A 4IN0A 3IOSA 1AC1A 3TJKA 2FA8A 4RQXA 1TK5B 2J9HA 1EEJA 2OACA 2R5GA 2H76A 3VWUA 4GXZA 4MPGA 4TVEA 1PQNA 2L4QA 4TR0A 1WOUA 1DE2A 5CREA 5ECNB 3HVVA 2GGTA 2WDUA 1N2AA 2VLVA 2HRNA 2C80A 2HRFA 2F8AA 7GSSA 4GSSA 2ZUPA 3RHCA 3EINA 3GSSA 5EVOA 3L0HA 5ID2B 2C0FA 2OKAA 3FK8A 3W8SA 1SENA 2VL2C 4J2FA 1R26A 1Z7PA 4DSRA 3DVXA 1T7PB 2MZCA 1K3LA 3TOTA 3F8UA 2BMXA 4ZL9A 3PPUA 2HFDA 9GSSA 2REMA 5D96A 2X64A 1FOVA 1M2BA 3N9JA 3IC8A 4FQUA 1YKAA 3US3A 3MDKA 1GLPA 5IPGA 2DMLA 5JCWA 4GTUA 1M9AA 2GSSA 5CO3A 1A0FA 3TJFA 1IYIA 2HSMB 4D73B 1J08A 3TJGA 4F03A 4GLTA 5DCHA 1YJ6A 1OVNA 3H4KA 3KP8A 1E6BA 3HJOA 2F9SA 2YP6A 5KN3A 4O92A 5G30A 3LORA 6GSWA 3HZ8A 2IWTA 4EXJA 1BX9A 1PN9A 1XZOA 3LWAA 5J9BA 1PGTA 3APQA 4KAEA 4GSNA 2ZCTA 1MDKA 2B7KA 3LQ7A 4PTSA 1PL2A 1BEDA 1QQ2A 3VK9A 4K1FA 4YQUA 2C0EA 1HQOA 2L59A 2R3XA 1GNWA 3IV4A 3MSZA 2QGVA 1FW1A 4V1Ag 3TJJA 2ON5A 2HRAA 2LRNA 3RHBA 3GYKA 3TKPA 1SK1A 1XPVA 3DD3A 4TXOA 4XRDA 2VD0A 5GSSA 2FUG2 1VGLA 4HJMA 3QD9A 2L5LA 1ZCPA 1HD2A 1DSBA 3H8QA 4KGIA 5IMCA 2UZ8A 1FB0A 5IM9A 2LQOA 1AUCA 2LJKA 2X8GA 5C00A 5FWGA 1X5EA 3ZYWA 1HYUA 3ERWA 1O85A 1GWCA 2IMFA 2HSNB 1VRSD 2DLXA 5F0GA 2VM1A 2JL4A 2HRKB 5D9WA 5GSTA 3VI7A 2NBSA 5HFIA 1VF3A 3F6FA 2VL3A 1HNCA 3VPTA 3OR5A 2XPDA 1SKWB 3ZITA 4G0IA 2YJ7A 2AV4A 2K8SA 5HFKA 3UJ1A 2N5AA 3G9BA 4ECCA 2IMKA 3IA1A 5GAPD 1XW5A 4OCFA 2VCWA 2P5RA 3CTFA 2OBKA 2GZZA 4I2TA 4ML6A 1K0MA 1TRUA 3GKNA 2WZ9A 2J23A 2PGTA 2IFQA 2FNOA 2H1BA 1SU9A 1FVKA 4LMVA 3GTUA 2WFCA 2YPMA 3IK9A 4JZQA 4NMUA 5DQSA 14GSA 1FO5A 2IN3A 4QL9A 2EC4A 3M9KA 5BMUA 3DKSA 5KN0A 4ZBDA 3GKMA 3F0IA 4TW5A 4YAVA 2Z9SA 3KEBA 4IQAA 4KW6A 1WIKA 1S3AA 2XBQA 3I43A 2OE0A 5H5RA 3ME7A 3AY8A 4TR3A 3VLNA 1OYJA 3IK7A 1V2AA 4EE0A 3HZ4A 2DJ1A 5EY6A 4OFNA 5DCGA 5B8BA 2V1MA 1T8EB 3TB2A 1TI1A 4MH3A 4QQ7A 2XPEA 3H1NA 3E0UA 5J5NA 5KN2A 4EC0A 1V58A 3I6AA 3U5RE 8GSSA 3FEUA 1TKDB 3D22A 3A2VA 5CRGA 3HDCA 3VURA 1FAAA 1USBA 1GUKA 5CRWA 1V9WA 1OKTA 4L5OA 4JBBA 13GSA 3KGKA 3GKKA 3KIJA 4IKHA 5JCGA 5DALB 4LA1A 2VD1A 2DIZA 3SBCA 2VLUA 5G1KA 3F4RA 3GURA 6GSSA 3LYPA 2H19A 3WYWA 2FD3A 1SL1B 1KNGA 6GSXA 1DE1A 3EURA 3VFIA 1GTIA 3GRXA 1KBNA 1BJXA 3F63A 4XTSA 5ECMB 3IC4A 1AW9A 3KJYA 2GS3A 1GSFA 4K6XA 4IQ1A 2H30A 2X99A 1UC7A 5DDLA 1FHEA 2C3TA 1G7EA 3KMNA 3TRPA 5JCUA 5B8AA 1JLVA 3S9FA 3RAZA 2KOKA 4JU5A 1K0BA 4IW9A 2HT9A 4O7HA 5HR1A 11GSA 5EPFA 2GSQA 4TR4A 3VWWA 1ERTA 2WS2A 2GT6A 2H8LA 2VL9A 3CSIA 3HY2A 1TK0B 4EF0A 1YF0A 3H93A 5IMDA 5IO2A 6GSYA 2D2ZA 2VCQA 22GSA 2OE3A 5G2ZA 4XHMA 3D6IA 3PGTA 2C4JA 4MF7A 1TRWA 4V2LA 4N11A 4HEA2 5HR2A 3HYPA 2LJRA 1GRXA 1Z5YE 1FVJA 2BTOT 5DAKA 2C1YA 2R2JA 5DBQA 4F82A 5DVBA 3L9SA 1A2JA 2XHFA 2B5EA 2GQKA 2M46A 3KP9A 4K9ZA 4PURA 1TW9A 2WULA 5JWRB 4N0VA 3ZVJA 1QGVA 1SK2A 16GSA 4PGTA 1TXXA 4K7NA 2LV3A 3EWLA 4TXVA 1TRSA 3IPZA 1LJRA 2L6CA 2DBCA 1K3YA 1TOFA 2MMAA 3GIXA 4KF9A 1MDIA 4N10A 1FB6A 3UIWA 4YQMA 3ZTLA 4JEDA 4MA9A 4ZILA 4MJCA 3Q74A 5F8BA 4E8EA 3GSTA 3LXZA 5D9XA 1XXUA 3G7IA 5FT3A 5CP1A 4NXIA 5D93A 4GCIA 2H1DA 2HSHA 5IMAA 4XS4B 4OWYA 2LRCA 2VCTA 4ZL8A 2DMMA 5COHA 2JSYA 1XBSA 2TIRA 4FIWA 1W4VA 3QMXA 4RI7A 3LJRA 2YCDA 1SD8A 3G7YA 2LTKA 3C7MA 3HD5A 4MH2A 3C1SA 5ECLB 4IP6A 2AAWA 3KMOA 1PX7A 4MPFA 1EGRA 3UARA 3N5OA 4PNGA 1OC3A 3M1GA 3J7Yk 3M3MA 3UBLA 2JADA 3KH9A 1GTBA 2NVLA 4HOJA 4NPBA 5CAXA 1ZYQB 2PWJA 1GUHA 4ID0A 1RK4A 3ZVJD 3HXSA 1SD9A 3CYNA 1A2MA 4G10A 1Z7RA 1I5GA 2B1KA 4X0XA 2B5YA 3KCMA 1TRVA 5D8IA 4G9HA 4LL4B 4EVMA 2X8CA 4IP1A 3TKSA 4O32A 2DJ2A 1QXHA 3ZL5A 4WR5A 1PSQA 4D73A 4YQVA 5KEJA 1ZZYA 4Q5NA 3GV1A 4IVFA 5J41A 3HVSA 5F07A 4PX1A 3DYRA 1ZMAA 1JZOA 1T4YA 4L0WA 5HR0A 3CBUA 1NM3A 4BL7B 1EP7A 1R7HA 1XIYA 1V98A 2I81A 2FWFA 4POLA 1UN2A 5IMVA 3ZRDA 2C8UA 3LYKA 1YZXA 3VI5A 2B7JA 1F6MC 3GKXA 3BD2A 1O81A 1BG5A 3IHQA 2OA7A 3F4TA 2VCZA 3EE2A 2O85A 1WMJA 4K8MA 2GQMA 3IE3A 1GH2A 4ZL7A 4MP4A 3FRCA 4K7IA 4G2EA 4HU7A 3QPMA 5E4WA 2YNXA 1HNBA 2GLRA 1JZDA 2KLXA 1UVZA 2V41A 1B4PA 4Q5QA 2P5QA 3WGXA 5G1LA 3CRUA 3TKSC 1WPIA 1ZOFA 1F37A 1JZRA 1ABAA 1TP9A 1Z3EA 3F3QA 5IPHA 2LJAA 2E7PA 3V1WA 4KB3A 5H5QA 2JZRA 2JU5A 3FY7A 1BQ7A 1E2YA 2QKEA 4LL1B 2KP1A 2ALBA 3KD0A 1YF1A 4FYCA 1PL1A 4USSA 3LSZA 2HRKA 1JHBA 3A2WA 1X0RA 1FG4A 3HVXA 2FCHA 3FZ9A 2E0QA 4TN8A 19GSA 1U3IA 1MDJA 5ELAA 2MMNA 2MMZA 3KTLA 1Z6MA 4BVXB 2C3QA 2YWIA 2WB9A 4WF5A 5IIZA 3NIVA 2EIQA 3GH9A 3A5WA 1MD4A 3IBHA 5B6NA 1XWCA 3DMLA 2A2RA 1A23A 1F3AA 3P7XA 4P3YB 2XC2A 1SKSB 4MF6A 1PMTA 2AYTA 2H6ZA 4AJ6A 4WETA 3DVWA 3CSHA 1ERVA 3ZIVA 4FO5A 4POBA 4XS1A 3CXGA 5F05A 4ZBAA 4DSQA 1OC8A 3C8EA 5JWOB 3RBTA 2DJJA 1A24A 2BJXA 5KN1A 1B9YC 1TI3A 3WT1A 1K3OA 2HSYA 1SJZA 4TRXA 1QFNA 3O3TA 4DVCA 5IOXA 2FWEA 1SYRA 2H0IA 5AISA 4HQSA 1J0FA 1F2EA 3IDVA 4ZB9A 1PKWA 2N5BA 18GSA 5AIXA 2HLSA 1YQ1A 4X1UA 1NHYA 3WT2A 2GZYA 1SJ6A 1XW6A 2TRXA 5IMZA 5JWQB 1EV4A 4EKZA 4TXOB 1SL0B 5FHIA 2L4CA 1M9BA 2PN8A 4EDZA 1OE7A 3QAVA 3GHAA 5DALA 1GTAA 3IRAA 5AGYA 1GSUA 4TOPA 1WWJA 1ILOA 3ZLPA 4MCUA 2FLSA 4AJ7A 5B6MA 3GH6A 4K7OA 4QL7A 2V2GA 3TKRA 4HDEA 1IYHA 1Z6NA 1XFLA 6GSUA 1BYEA 3L9UA 4OO4A 3ERGA 3D21A 1GSDA 1U3AA 1GSSA 2IMDA 2O87A 1V57A 2H74A 3GUSA 3ED3A 1BAYA 2VIMA 3GL5A 3LFLA 3LGCA 4Z7XA 2HZEA 3F9UA 3QAGA 3GFKA 3MAKA 5ECRB 1OKDA 4K0NA 4OD7A 1M2AA 2LKUA 1G7OA 4KNDA 2IFQB 4HUAA 4L8EA 2M80A 4HZ4A 1GLQA 1M0UA 2GVPA 5INYA 4IELA 3D4MA 4MLYA 1H75A 3TGZA 4OCEA 1V40A 2GSTA 4ECIA 2K18A 1X9WB 1ERWA 1TU8A 4KE3A 3ZFLA 4ACSA 4BVYB 1ZL9A 1ML6A 1WJKA 2I1UA 5LNKe 2P31A 2V32A 1XWAA 4RQRA 2DC5A 3DWVA 2RUEA 4JR6A 1YY7A 3VPQA 4KCAA 3NZNA 3GX0A 3JCML 1YDKA 1HNAA 2LNSA 2ZNMA 4MJBA 2KHPA 2C3NA 1EP8A 3F4SA 2H1GA 4KDXA 3C71A 3GX8A 3KTBA 4XS6A 4MABA 1XW9A 2H1AA 3VWVA 3UVTA 1KEBA 4K2DA 4V2MA 3EVIA 4F2IA 1S3CA 2AHEA 4CW9A 2HYXA 3ME8A 1TTZA 4MK3A 5IOWA 4MJAA 4AJ8A 4N0ZA 5ECSA 2O89A 3RPPA 1YKCA 2CA8A 1QUWA 5HR3A 1GSEA 1I9DA 4ECBA 1M2DA 3EU4A 1THXA 5ENUA 2L57A 4F0BA 1NHOA 1X5DA 2HI7A 2CZ3A 4WBJA 4MJEA 4MZBA 2H70A 3UVHA 1U87A 5J3RA 3EYTA 1R4WA 3Q18A 4WXTA 1K0NA 3D5JA 4KCEA 3TDGA 2JACA 1O8WA 1B9XC 4GF0A 4PXOA 2H0HA 1OC9B 3G7JA 3QR6A 1X5CA 2WCIA 4WR4A 3HA9A 4TR1B 1QK8A 2VCXA 2EIRA 3DIEA 4PUFC 1RW1A 5IQYA 4IS0A 4WF4A 4EUYA 2PBJA 3C73A 4LMWA 2C0GA 4MF5A 1TJDA 3DGQA 3HCZA 1MD3A 2LS5A 5A4UA 1T00A 2A2SA 2KP2A 4MDCA 5J9CA 3LEFA 2NPBA 1ST9A 20GSA 5G5EA 3PH9A 1U6TA 2AJQB 1SYXA 4RI6A 3BOAA 3HJMA 2PPTA 2GDRA 3FHKA 3TRQA 5DAKB 3PR8A 2QC7A 4NV2A 2L5OA 4V2NA 4ZIJA 2MBSA 4GQFA 3BBYA 6GSTA 2CVBA 5ID2A 3WGDA 3HJPA 3IAM2 2I9HA 4L5LA 1XOAA 2GT5A 2M72A 3IXRA 4BL7A 2VO4A 4N30A 1O8XA 4KSMA 1YEXA 4FYBA 2HE3A 5G31A 3QFBC 2FHEA 3WD6A 2OE1A 2VL2A 5IMFA 1AQVA 4GSTA 2YN1A 3TKSE 3DEXA 1DUGA 4ML1A 2B5XA 2LUSA 3I9V2 2TRCP 2OBIA 2IMIA 2CVDA 3QOUA 2IL3A 1WP0A 4POMA 3E9JB 4MZWA 5D9TA 1CQHA 4V1Ap 2HSMA 3HKRA 2FGXA 3KH7A 3FYGA 2RM6A 1A2LA 1EGOA 4EDYA 2CT6A 4PUAA 1XCCA 2N5FA 1SK0A 3P90A 1AQWA 2VUPA 2B6MA 1NSWA 1GP1A 2DJKA 3E3EA 2CVKA 4DSSB 2GZPA 2K9FA 4PQ1A 1C72A 2YV7A 3P8WA 5CYYA 1XVWA 2KUCA 5GZZB 4JE1A 2GSRA 2FWHA 2H6XA 2G2QA 3VWXA 10GSA 2DSAA 2B3SA 5HQPA 3FR3A 4BVXA 2CAIA 3CTGA 2K6VA 1G6YA 3KM6A 1G0TA 3GN3A 2F8FA 1XOBA 1URMA 1R5PA 2YWOA 3ZIJA 1T3BA 4AGSA 5H5SA 3BJ5A 2HXKA 3UOMA 5D9VA 4CHSA 3FZAA 3RDWA 4TKYA 1QMVA 1GL8A 4KDUA
chains in the Genus database with same CATH superfamily
5AN1A 3L4NA 4XRAA 3L78A 3UMAA 2V6KA 3KZQA 3FZ4A 5LCZA 4HI7A 1CQGA 1PRXA 1X9SB 4YKGA 4ULXA 5KOWA 2HSNA 2CX3A 1PX6A 4HJ2A 2H72A 2YJHA 1JLWA 4Q5FA 2B1LA 3R2QA 3EPTA 12GSA 4G0KA 3GNJA 1RQMA 2HQTA 2VM2A 1GTUA 4HQZA 3IR4A 5EL8A 2JZTA 2L6DA 4PI2C 5HFGA 1TU7A 1K0DA 3GA4A 5DJMA 4KA0A 4RUVA 2CV4A 4NV5A 1N8JA 2WGRA 2LNTA 1LU4A 1Y6EA 1S3DA 3RPNA 1DBYA 1B48A 2RLIA 2RM5A 4I5QA 3TCOA 4ZXGA 3TUEA 1THOA 2ON7A 2O7KA 4NHWA 1K0OA 1ERUA 3W8JA 2CAQA 2H01A 3EU3A 3QCPA 2LEGA 4OMVA 1AXDA 5CRHA 5CRDA 2A4VA 2H6YA 4WEYA 1OAZA 1WE0A 3ZREA 4HSCX 2X8HA 3C1RA 1EOHA 1XWKA 4X43A 4I2UA 3CWGA 2CZ2A 5ECOB 3BCKA 4F0CA 1PKZA 3APOA 5GAND 2C0DA 2PVOC 1YEPA 4DEJA 1GSQA 3D4TA 1SKRB 4J56E 4AF2A 5ECQB 4GWRA 1J9BA 2DJ0A 2I3YA 1EOGA 2MYGA 2JZSA 1JFUA 1A0RP 1GSYA 3EMXA 3DXBA 3PINA 2H71A 6GSVA 2R37A 2VCVA 1KTEA 2E2MA 3ISOA 4ILFA 2IPAA 3NOFA 3ZMLA 5A5HB 4NAXA 3H79A 5ECIB 5A4WA 2RIIA 2H75A 5E59A 3TRXA 4O5RA 2LRTA 2P0GA 3MWHA 2A2PA 2FA4A 4BVYA 1AIUA 3M9JA 3UAPA 4I6XA 1GNEA 1PA3A 1WRYA 2VOCA 1Q98A 5CNWA 4KUNA 1F9MA 1R5AA 3FKFA 1PN0A 2ES7A 4XIHA 1AAZA 4KSOA 2YV9A 2FWGA 4BWSA 1O7UA 1VF4A 2QA1A 2EFDA 2YZHA 3APSA 5G5FA 5LD0A 3QFAC 4QMKA 4ZB8A 3UL3A 2H66A 2F51A 1G6WA 3F3RA 4F9ZA 1B8XA 3UEMA 2XBIA 2OJLA 2MBTA 3HHVA 5AIVA 3FZ5A 2AB6A 5A5KA 1SJIA 1EWXA 2RUFA 3R3EA 1OE8A 2MMOA 3GTUB 2LQQA 1UA5A 3O6TA 4K0GA 4PQIA 3CRTA 4EO3A 4ZBBA 2H73A 5IO0A 4IGJA 4OFMA 4AI6A 4G0LA 2H0GA 1U88A 2JSZA 5BMUB 1AQXA 4OFTA 1PD21 2DKIA 4JRRA 4MMMA 1GUMA 5F06A 2EIOA 1EV9A 4IJIA 4GRFA 2IJYA 1X9MB 3WGEA 4H86A 1K0CA 4CDOA 2DJ3A 3M8NA 4L0UA 4YH2A 4IJ3A 2YANA 3CSJA 3ZZXA 4KH7A 2QSIA 2R4VA 3P2AA 2G0FA 3U6VA 2GQLA 2YZUA 1ZGNA 3O76A 1EEMA 2V6OA 1TK8B 2OT3A 1OC9A 2HZEB 1NW2A 4ECJA 4JR4A 4POKA 5A34A 2WW0A 1VF1A 4WKWA 1K0AA 3QAWA 4TR1A 4J57E 3LXTA 1XWBA 2LSTA 3D0ZA 2R6KA 4I8BA 2DKHA 4BPYA 2PU9C 1SVMA 1SL2B 4KDYA 2HNLA 4BWQA 5DQYA 4NWYA 4LLRA 4ZB6A 1Z9HA 3QDNA 1Q4JA 4XS4A 3LG6A 3TOUA 4Q5RA 1ACVA 5ELGA 1F3BA 3BCIA 3ERFA 2AUVA 1A8LA 1O6JA 1W89A 3EC3A 3Q19A 2VLTA 3F6DA 3FW2A 1M99A 1GULA 5J4UA 4HU9A 4ISDA 4ZB7A 2F3MA 3CMIA 4BA7A 4O5QA 3TU3B 1A8YA 3Q6OA 3J7Yb 1LBKA 3EMPA 1MTCA 2CQ9A 1EZKA 2WJUA 1XVQA 2YOIA 3M0FA 5ECKB 2DIYA 2PERA 2I4AA 3GL3A 5B7CA 4XCSA 2YWNA 3TJBA 1XWGA 2E2GA 3ZFBA 4EL1A 5L71A 5ECHB 4MZCA 4PNFA 2IMEA 1O73A 3MYDA 5ABRA 5DJLA 4WBRD 2IIYA 4YAPA 3GMFA 1M7TA 1H4OA 1VF2A 2O8VB 2PUKC 4X4JA 4IHUA 3W6GA 1JZWA 3SWLA 3UBKA 2GTUA 2K8VA 1MEKA 2HZFA 5ECPB 17GSA 4G19A 2OADA 2O36A 3L9VA 3FR6A 3MNGA 2PMTA 1ZYEA 3A2XA 5A4VA 2PVQA 2CX4A 4IBPA 4E8HA 2VAFA 2NDOA 1TDIA 2NTOA 4DSSA 1T4ZA 4FH8A 4GQCA 4HZ2A 5C04A 1T1VA 3K8NA 3I69A 4I97A 4NHZA 3IAS2 3TKQA 4AKHA 3DRNA 2WRTA 2FY6A 4PQHA 3KXOA 5D73A 1Y1UA 4A5PA 3A3TA 3FR9A 4KX4A 4FYUA 1B4QA 1ON4A 4HS1A 1Y25A 2YWMA 3ZMKA 4OO5A 2EFCA 4IN0A 3IOSA 1AC1A 2WW1A 3TJKA 2FA8A 4RQXA 1TK5B 2J9HA 1EEJA 2OACA 2R5GA 2H76A 3VWUA 4GXZA 4MPGA 4TVEA 1PQNA 2L4QA 4TR0A 1WOUA 1DE2A 5CREA 5ECNB 1ZYPA 2GGTA 3HVVA 2WDUA 1N2AA 5J4YA 2VLVA 2HRNA 2C80A 2HRFA 2F8AA 7GSSA 4GSSA 2ZUPA 3RHCA 3EINA 4CY6A 3GSSA 5EVOA 3L0HA 5ID2B 2C0FA 2OKAA 3FK8A 3W8SA 1SENA 2VL2C 4J2FA 1R26A 1Z7PA 4DSRA 3DVXA 1T7PB 2MZCA 1K3LA 3TOTA 3F8UA 2BMXA 4ZL9A 3LW9A 3PPUA 2HFDA 9GSSA 2WZSA 2REMA 4K2XA 5D96A 2X64A 1FOVA 1M2BA 3N9JA 3IC8A 4FQUA 1YKAA 3US3A 3MDKA 1GLPA 5IPGA 2DMLA 5JCWA 3HMJG 4GTUA 1M9AA 2GSSA 5CO3A 1A0FA 3TJFA 1IYIA 2HSMB 4D73B 2X4AA 1J08A 3TJGA 4F03A 4GLTA 5DCHA 1YJ6A 1OVNA 3H4KA 3KP8A 1E6BA 3HJOA 2F9SA 2YP6A 1N25A 5KN3A 2WVXA 4O92A 5G30A 3LORA 6GSWA 5KOXA 3HZ8A 2IWTA 4EXJA 1BX9A 1PN9A 1XZOA 3LWAA 5J9BA 1PGTA 3APQA 4KAEA 4GSNA 2ZCTA 1MDKA 2B7KA 3LQ7A 4PTSA 1PL2A 1BEDA 1QQ2A 3VK9A 4K1FA 4YQUA 2C0EA 1HQOA 2L59A 2R3XA 1GNWA 3IV4A 3MSZA 2QGVA 1FW1A 4V1Ag 3TJJA 2ON5A 2HRAA 2LRNA 3RHBA 3GYKA 3TKPA 1SK1A 1XPVA 3DD3A 4TXOA 4XRDA 2VD0A 5GSSA 2FUG2 1VGLA 4HJMA 3QD9A 4K5SA 2L5LA 1ZCPA 1HD2A 1DSBA 3H8QA 4KGIA 4W66A 5IMCA 2UZ8A 1FB0A 5IM9A 5A5HA 2LQOA 1AUCA 2LJKA 2X8GA 5C00A 5FWGA 1X5EA 3ZYWA 1HYUA 4AKIA 3ERWA 1O85A 1GWCA 2IMFA 2HSNB 1VRSD 2DLXA 5F0GA 2VM1A 2JL4A 2HRKB 5D9WA 5GSTA 3VI7A 2NBSA 5HFIA 1VF3A 3F6FA 2VL3A 1HNCA 3VPTA 3OR5A 2XPDA 1SKWB 3ZITA 4G0IA 2YJ7A 2AV4A 2K8SA 5HFKA 3UJ1A 2N5AA 3G9BA 4ECCA 2IMKA 3IA1A 5GAPD 1XW5A 4OCFA 2VCWA 2P5RA 3CTFA 2OBKA 2GZZA 4I2TA 4ML6A 1K0MA 1TRUA 3GKNA 2WZ9A 2J23A 2PGTA 2IFQA 2FNOA 2H1BA 1SU9A 2WVZA 1FVKA 4LMVA 3GTUA 2WFCA 2YPMA 3IK9A 4JZQA 4NMUA 5DQSA 14GSA 1FO5A 2IN3A 4QL9A 2EC4A 3M9KA 5BMUA 3DKSA 5KN0A 4ZBDA 3GKMA 3F0IA 4TW5A 4YAVA 4MNNA 2Z9SA 3KEBA 4IQAA 4KW6A 1WIKA 2R0GA 1S3AA 2XBQA 3I43A 2OE0A 5H5RA 3ME7A 3AY8A 4TR3A 3VLNA 1OYJA 3IK7A 1V2AA 4EE0A 3HZ4A 2DJ1A 5EY6A 4OFNA 5DCGA 5B8BA 4GDFA 2V1MA 1T8EB 3TB2A 1TI1A 4MH3A 4QQ7A 2XPEA 3H1NA 2WW3A 3E0UA 5J5NA 5KN2A 5J4VA 4EC0A 1V58A 3I6AA 3U5RE 8GSSA 3FEUA 1TKDB 2O3EA 3D22A 3A2VA 5CRGA 3HDCA 3VURA 1FAAA 1USBA 1GUKA 5CRWA 1V9WA 1OKTA 4L5OA 4JBBA 13GSA 3KGKA 3GKKA 3KIJA 4IKHA 5JCGA 5DALB 4LA1A 2VD1A 2DIZA 3SBCA 2VLUA 5G1KA 3F4RA 3GURA 6GSSA 3LYPA 2H19A 3WYWA 2FD3A 1SL1B 1KNGA 6GSXA 1DE1A 3EURA 3VFIA 1GTIA 3GRXA 1YEWC 1KBNA 1BJXA 3F63A 4XTSA 5ECMB 3IC4A 1AW9A 4E68A 3KJYA 2GS3A 3IHGA 1GSFA 4IQ1A 4K6XA 2H30A 2X99A 1UC7A 5DDLA 1FHEA 2C3TA 1G7EA 3KMNA 3TRPA 5JCUA 5B8AA 1JLVA 4AKXB 3S9FA 1SVOA 3RAZA 2KOKA 4JU5A 1K0BA 4IW9A 2HT9A 4O7HA 5HR1A 11GSA 5EPFA 2GSQA 4TR4A 3VWWA 1ERTA 2WS2A 2GT6A 2H8LA 2VL9A 3CSIA 3HY2A 1TK0B 4EF0A 1YF0A 3H93A 5IMDA 5IO2A 6GSYA 2D2ZA 2VCQA 22GSA 4PI0C 2OE3A 5G2ZA 4XHMA 3D6IA 3PGTA 2C4JA 4MF7A 1TRWA 4V2LA 4N11A 4HEA2 5HR2A 3HYPA 2LJRA 1GRXA 1Z5YE 1FVJA 2BTOT 5DAKA 2C1YA 2R2JA 5DBQA 4F82A 2WVYA 5DVBA 3L9SA 1A2JA 2XHFA 2B5EA 2GQKA 2M46A 3KP9A 4K9ZA 4PURA 1TW9A 2WULA 5JWRB 4N0VA 3ZVJA 1QGVA 1SK2A 16GSA 4PGTA 1TXXA 4K7NA 2LV3A 3EWLA 4TXVA 1TRSA 3IPZA 4O5UA 1LJRA 2L6CA 2DBCA 1K3YA 2R0PA 1TOFA 2MMAA 3GIXA 3CQFA 4KF9A 1MDIA 4N10A 1FB6A 3UIWA 4YQMA 3ZTLA 4JEDA 4MA9A 4ZILA 1M3JA 4MJCA 3Q74A 5F8BA 4E8EA 3GSTA 3LXZA 5D9XA 1XXUA 3G7IA 5FT3A 5A1NB 5CP1A 1YVLA 4NXIA 5D93A 4GCIA 2H1DA 2HSHA 5IMAA 4XS4B 4OWYA 2LRCA 2VCTA 4ZL8A 2DMMA 5COHA 2JSYA 1XBSA 2TIRA 4FIWA 1W4VA 3QMXA 4RI7A 3LJRA 2YCDA 1SD8A 3G7YA 2LTKA 3C7MA 1S3RA 3HD5A 4MH2A 3C1SA 5ECLB 4IP6A 2AAWA 3KMOA 1PX7A 4MPFA 1EGRA 3UARA 3N5OA 4PNGA 1OC3A 3M1GA 3J7Yk 3M3MA 4PHZC 3UBLA 2JADA 3KH9A 1GTBA 2NVLA 2X49A 4HOJA 4NPBA 5CAXA 1ZYQB 2PWJA 1GUHA 4ID0A 1RK4A 3ZVJD 3HXSA 1SD9A 3CYNA 1A2MA 4G10A 1Z7RA 1I5GA 2B1KA 4X0XA 2B5YA 3KCMA 3A5IA 1TRVA 5D8IA 4G9HA 4LL4B 4EVMA 2X8CA 4IP1A 3TKSA 4O32A 2DJ2A 1QXHA 3ZL5A 4WR5A 1PSQA 4D73A 4YQVA 5KEJA 1ZZYA 4Q5NA 3GV1A 3RGBC 4IVFA 5J41A 3HVSA 5F07A 4PX1A 3DYRA 1ZMAA 1JZOA 1T4YA 4L0WA 5HR0A 3CBUA 1NM3A 5BRTA 4BL7B 1EP7A 1R7HA 1XIYA 1V98A 2I81A 2FWFA 4POLA 1UN2A 5IMVA 3ZRDA 2C8UA 3LYKA 1YZXA 3VI5A 2B7JA 1F6MC 3GKXA 3BD2A 1O81A 1BG5A 3IHQA 2OA7A 3F4TA 2VCZA 3EE2A 2O85A 1WMJA 4K8MA 2GQMA 3IE3A 1GH2A 4ZL7A 1BG1A 4MP4A 3FRCA 4K7IA 4G2EA 4HU7A 3QPMA 5E4WA 2YNXA 1HNBA 2GLRA 1JZDA 2KLXA 1UVZA 2V41A 1B4PA 4Q5QA 2P5QA 3WGXA 5G1LA 3CRUA 3TKSC 1WPIA 1ZOFA 1F37A 1JZRA 1ABAA 1TP9A 1Z3EA 3F3QA 5IPHA 2LJAA 2E7PA 3V1WA 4KB3A 5H5QA 2JZRA 2JU5A 3FY7A 5J40A 1BQ7A 1E2YA 2QKEA 1I1IP 4LL1B 2KP1A 2ALBA 3KD0A 1YF1A 4FYCA 1PL1A 4USSA 3LSZA 2HRKA 1JHBA 3A2WA 1X0RA 1FG4A 3HVXA 2FCHA 3FZ9A 2E0QA 4TN8A 19GSA 1U3IA 1MDJA 5ELAA 2MMNA 2MMZA 3KTLA 1Z6MA 4BVXB 2C3QA 2YWIA 2WB9A 4WF5A 5IIZA 3NIVA 2EIQA 3GH9A 2H1LA 1MD4A 3A5WA 3IBHA 5B6NA 1XWCA 3DMLA 2A2RA 1A23A 1F3AA 3P7XA 4P3YB 2XC2A 1SKSB 4MF6A 1PMTA 2AYTA 2H6ZA 4AJ6A 4WETA 3DVWA 3CSHA 1ERVA 2EFHA 3ZIVA 4FO5A 4POBA 4XS1A 3CXGA 5F05A 4ZBAA 4DSQA 4Z2TA 1OC8A 3C8EA 5JWOB 1SVLA 3RBTA 2DJJA 1A24A 2BJXA 5KN1A 1B9YC 1TI3A 3WT1A 1K3OA 2HSYA 1SJZA 4TRXA 2WVXB 1QFNA 3O3TA 4DVCA 5IOXA 2FWEA 1SYRA 2H0IA 5AISA 4HQSA 1J0FA 4BIKA 1F2EA 3IDVA 4ZB9A 1PKWA 2N5BA 18GSA 5AIXA 2HLSA 1YQ1A 4X1UA 1NHYA 3WT2A 2GZYA 1SJ6A 1XW6A 2TRXA 5IMZA 5JWQB 1EV4A 4EKZA 4TXOB 1SL0B 5FHIA 2L4CA 1M9BA 2A4HA 2PN8A 4EDZA 1OE7A 3QAVA 3GHAA 5DALA 1GTAA 3IRAA 5AGYA 1GSUA 4TOPA 1WWJA 1ILOA 3ZLPA 4MCUA 2FLSA 4AJ7A 5B6MA 3GH6A 4K7OA 4QL7A 2V2GA 3TKRA 4HDEA 1IYHA 1Z6NA 1BF5A 1XFLA 6GSUA 1BYEA 3L9UA 4OO4A 3ERGA 3D21A 1GSDA 1U3AA 1GSSA 2IMDA 2O87A 2R0CA 1V57A 2H74A 3GUSA 3ED3A 1BAYA 4G01A 2VIMA 3GL5A 3LFLA 3LGCA 4Z7XA 2HZEA 3F9UA 3QAGA 3GFKA 3MAKA 5ECRB 1OKDA 4K0NA 4OD7A 4CY8A 1M2AA 2LKUA 1G7OA 4KNDA 3MIXA 2IFQB 4HUAA 4L8EA 2M80A 4HZ4A 1GLQA 1M0UA 2GVPA 5INYA 4IELA 3D4MA 4MLYA 1H75A 3TGZA 4OCEA 1S4BP 1V40A 2GSTA 4ECIA 2K18A 1X9WB 1ERWA 1TU8A 4KE3A 3ZFLA 4ACSA 4BVYB 1ZL9A 1ML6A 1WJKA 2I1UA 1PFOA 5LNKe 2P31A 2V32A 1XWAA 4RQRA 2DC5A 3DWVA 2RUEA 4JR6A 1YY7A 3VPQA 4KCAA 3NZNA 3GX0A 3JCML 1YDKA 1HNAA 2LNSA 2ZNMA 4MJBA 2KHPA 2C3NA 1EP8A 3F4SA 2H1GA 4KDXA 3C71A 3GX8A 3KTBA 4XS6A 4MABA 1XW9A 2H1AA 3VWVA 3UVTA 1KEBA 4K2DA 4V2MA 3EVIA 4F2IA 1S3CA 2EFEA 2AHEA 4CW9A 2HYXA 3ME8A 1TXUA 4EIPA 1TTZA 4MK3A 1M3IA 5IOWA 4MJAA 4AJ8A 3RFRC 4N0ZA 5ECSA 2O89A 5A1NA 2QA2A 4K5RA 3RPPA 4FXYP 1YKCA 2CA8A 1QUWA 5HR3A 1GSEA 1I9DA 4ECBA 1M2DA 3EU4A 1THXA 4Z2UA 5ENUA 2L57A 4F0BA 1NHOA 1X5DA 2HI7A 2CZ3A 4WBJA 4MJEA 4MZBA 2H70A 3UVHA 1U87A 5J3RA 3EYTA 1R4WA 3Q18A 4WXTA 1K0NA 3D5JA 4KCEA 3TDGA 2JACA 1O8WA 1B9XC 4GF0A 4N3ZA 4PXOA 3FMWA 2H0HA 1OC9B 3G7JA 3QR6A 1X5CA 2WCIA 4WR4A 5A34B 3HA9A 4TR1B 1QK8A 2VCXA 2EIRA 3DIEA 4PUFC 2VKZG 1RW1A 5IQYA 4IS0A 4WF4A 4EUYA 2PBJA 3C73A 4LMWA 2C0GA 4MF5A 1TJDA 3DGQA 3HCZA 1MD3A 2LS5A 5A4UA 1T00A 2A2SA 2KP2A 4MDCA 5J9CA 3LEFA 2NPBA 1ST9A 20GSA 5G5EA 3PH9A 1U6TA 2AJQB 1SYXA 4RI6A 3BOAA 3HJMA 2PPTA 2GDRA 3FHKA 3TRQA 5DAKB 3PR8A 2QC7A 4NV2A 2L5OA 5J47A 4V2NA 4ZIJA 2MBSA 1FOHA 4GQFA 3BBYA 6GSTA 2CVBA 5ID2A 3WGDA 3HJPA 3IAM2 2I9HA 4L5LA 1XOAA 2GT5A 2M72A 3IXRA 4BL7A 2VO4A 4N30A 1O8XA 4KSMA 1YEXA 4ICYA 4FYBA 2HE3A 4YKFA 5G31A 3QFBC 2FHEA 3WD6A 2OE1A 2VL2A 5IMFA 1AQVA 4GSTA 2YN1A 3TKSE 3DEXA 1DUGA 4ML1A 2B5XA 2LUSA 3HVNA 3I9V2 2TRCP 2OBIA 4AKGA 2IMIA 2CVDA 4EIQA 3QOUA 2IL3A 1WP0A 4POMA 3E9JB 4MZWA 5D9TA 1CQHA 4V1Ap 2HSMA 3HKRA 2FGXA 3KH7A 3FYGA 2RM6A 1A2LA 1EGOA 2WW2A 4EDYA 2CT6A 4PUAA 1XCCA 2UV8G 2N5FA 1SK0A 3P90A 1AQWA 2VUPA 2B6MA 1NSWA 1GP1A 2DJKA 3E3EA 2CVKA 4DSSB 2GZPA 2K9FA 4PQ1A 1C72A 2YV7A 3P8WA 5CYYA 1XVWA 2KUCA 3CHXC 5GZZB 4JE1A 2GSRA 1XG8A 1ZYNA 2FWHA 2H6XA 2G2QA 3VWXA 10GSA 2DSAA 2B3SA 5HQPA 4Z2RA 3FR3A 4BVXA 2CAIA 3CTGA 2K6VA 1G6YA 3KM6A 1G0TA 2O5VA 3GN3A 2F8FA 1XOBA 1URMA 1R5PA 2YWOA 3ZIJA 1T3BA 4AGSA 5H5SA 3BJ5A 2HXKA 3UOMA 5D9VA 4CHSA 3FZAA 3RDWA 4TKYA 1QMVA 1GL8A 4KDUA
chains in the Genus database with same CATH topology
5AN1A 3L4NA 4XRAA 3L78A 3UMAA 2V6KA 3KZQA 3FZ4A 5LCZA 4HI7A 1CQGA 1PRXA 1X9SB 4YKGA 4ULXA 5KOWA 2HSNA 2CX3A 1PX6A 4HJ2A 2H72A 2YJHA 1JLWA 4Q5FA 2B1LA 3R2QA 3EPTA 12GSA 4G0KA 3GNJA 1RQMA 2HQTA 2VM2A 1GTUA 4HQZA 3IR4A 5EL8A 2JZTA 2L6DA 5HFGA 1TU7A 1K0DA 3GA4A 5DJMA 4KA0A 4RUVA 2CV4A 4NV5A 1N8JA 2WGRA 2LNTA 1LU4A 1Y6EA 1S3DA 3RPNA 1DBYA 1B48A 2RLIA 2RM5A 4I5QA 3TCOA 4ZXGA 3TUEA 1THOA 2ON7A 2O7KA 4NHWA 1K0OA 1ERUA 3W8JA 2CAQA 2H01A 3EU3A 3QCPA 2LEGA 4OMVA 1AXDA 5CRHA 5CRDA 2A4VA 2H6YA 4WEYA 1OAZA 1WE0A 3ZREA 2X8HA 3C1RA 1EOHA 1XWKA 4X43A 4I2UA 3CWGA 2CZ2A 5ECOB 3BCKA 4F0CA 1PKZA 3APOA 5GAND 2C0DA 2PVOC 1YEPA 4DEJA 1GSQA 3D4TA 1SKRB 4J56E 4AF2A 5ECQB 4GWRA 1J9BA 2DJ0A 2I3YA 1EOGA 2MYGA 2JZSA 1JFUA 1A0RP 1GSYA 3EMXA 3DXBA 3PINA 2H71A 6GSVA 2R37A 2VCVA 1KTEA 2E2MA 3ISOA 4ILFA 2IPAA 3NOFA 3ZMLA 5A5HB 4NAXA 3H79A 5ECIB 5A4WA 2RIIA 2H75A 5E59A 3TRXA 4O5RA 2LRTA 2P0GA 3MWHA 2A2PA 2FA4A 4BVYA 1AIUA 3M9JA 3UAPA 4I6XA 1GNEA 1PA3A 1WRYA 2VOCA 1Q98A 5CNWA 4KUNA 1F9MA 1R5AA 3FKFA 1PN0A 2ES7A 4XIHA 1AAZA 4KSOA 2YV9A 2FWGA 4BWSA 1O7UA 1VF4A 2QA1A 2EFDA 2YZHA 3APSA 5G5FA 5LD0A 3QFAC 4QMKA 4ZB8A 3UL3A 2H66A 2F51A 1G6WA 3F3RA 4F9ZA 1B8XA 3UEMA 2XBIA 2OJLA 2MBTA 3HHVA 5AIVA 3FZ5A 2AB6A 5A5KA 1SJIA 1EWXA 2RUFA 3R3EA 1OE8A 2MMOA 3GTUB 2LQQA 1UA5A 3O6TA 4K0GA 4PQIA 3CRTA 4EO3A 4ZBBA 2H73A 5IO0A 4IGJA 4OFMA 4AI6A 4G0LA 2H0GA 1U88A 2JSZA 5BMUB 1AQXA 4OFTA 1PD21 2DKIA 4JRRA 4MMMA 1GUMA 5F06A 2EIOA 1EV9A 4IJIA 4GRFA 2IJYA 1X9MB 3WGEA 4H86A 1K0CA 4CDOA 2DJ3A 3M8NA 4L0UA 4YH2A 4IJ3A 2YANA 3CSJA 3ZZXA 4KH7A 2QSIA 2R4VA 3P2AA 2G0FA 3U6VA 2GQLA 2YZUA 1ZGNA 3O76A 1EEMA 2V6OA 1TK8B 2OT3A 1OC9A 2HZEB 1NW2A 4ECJA 4JR4A 4POKA 5A34A 1VF1A 4WKWA 1K0AA 3QAWA 4TR1A 4J57E 3LXTA 1XWBA 2LSTA 3D0ZA 2R6KA 4I8BA 2DKHA 4BPYA 2PU9C 1SVMA 1SL2B 4KDYA 2HNLA 4BWQA 5DQYA 4NWYA 4LLRA 4ZB6A 1Z9HA 3QDNA 1Q4JA 4XS4A 3LG6A 3TOUA 4Q5RA 1ACVA 5ELGA 1F3BA 3BCIA 3ERFA 2AUVA 1A8LA 1O6JA 1W89A 3EC3A 3Q19A 2VLTA 3F6DA 3FW2A 1M99A 1GULA 5J4UA 4HU9A 4ISDA 4ZB7A 2F3MA 3CMIA 4BA7A 4O5QA 3TU3B 1A8YA 3Q6OA 3J7Yb 1LBKA 3EMPA 1MTCA 2CQ9A 1EZKA 2WJUA 1XVQA 2YOIA 3M0FA 5ECKB 2DIYA 2PERA 2I4AA 3GL3A 5B7CA 4XCSA 2YWNA 3TJBA 1XWGA 2E2GA 3ZFBA 4EL1A 5L71A 5ECHB 4MZCA 4PNFA 2IMEA 1O73A 3MYDA 5ABRA 5DJLA 4WBRD 2IIYA 4YAPA 3GMFA 1M7TA 1H4OA 1VF2A 2O8VB 2PUKC 4X4JA 4IHUA 3W6GA 1JZWA 3SWLA 3UBKA 2GTUA 2K8VA 1MEKA 2HZFA 5ECPB 17GSA 4G19A 2OADA 3L9VA 3FR6A 3MNGA 2PMTA 1ZYEA 3A2XA 5A4VA 2PVQA 2CX4A 4IBPA 4E8HA 2VAFA 2NDOA 1TDIA 2NTOA 4DSSA 1T4ZA 4FH8A 4GQCA 4HZ2A 5C04A 1T1VA 3K8NA 3I69A 4I97A 4NHZA 3IAS2 3TKQA 4AKHA 3DRNA 2WRTA 2FY6A 4PQHA 3KXOA 5D73A 1Y1UA 4A5PA 3A3TA 3FR9A 4KX4A 4FYUA 1B4QA 1ON4A 4HS1A 1Y25A 2YWMA 3ZMKA 4OO5A 2EFCA 4IN0A 3IOSA 1AC1A 3TJKA 2FA8A 4RQXA 1TK5B 2J9HA 1EEJA 2OACA 2R5GA 2H76A 3VWUA 4GXZA 4MPGA 4TVEA 1PQNA 2L4QA 4TR0A 1WOUA 1DE2A 5CREA 5ECNB 1ZYPA 2GGTA 3HVVA 2WDUA 1N2AA 5J4YA 2VLVA 2HRNA 2C80A 2HRFA 2F8AA 7GSSA 4GSSA 2ZUPA 3RHCA 3EINA 4CY6A 3GSSA 5EVOA 3L0HA 5ID2B 2C0FA 2OKAA 3FK8A 3W8SA 1SENA 2VL2C 4J2FA 1R26A 1Z7PA 4DSRA 3DVXA 1T7PB 2MZCA 1K3LA 3TOTA 3F8UA 2BMXA 4ZL9A 3LW9A 3PPUA 2HFDA 9GSSA 2REMA 4K2XA 5D96A 2X64A 1FOVA 1M2BA 3N9JA 3IC8A 4FQUA 1YKAA 3US3A 3MDKA 1GLPA 5IPGA 2DMLA 5JCWA 3HMJG 4GTUA 1M9AA 2GSSA 5CO3A 1A0FA 3TJFA 1IYIA 2HSMB 4D73B 2X4AA 1J08A 3TJGA 4F03A 4GLTA 5DCHA 1YJ6A 1OVNA 3H4KA 3KP8A 1E6BA 3HJOA 2F9SA 2YP6A 1N25A 5KN3A 4O92A 5G30A 3LORA 6GSWA 5KOXA 3HZ8A 2IWTA 4EXJA 1BX9A 1PN9A 1XZOA 3LWAA 5J9BA 1PGTA 3APQA 4KAEA 4GSNA 2ZCTA 1MDKA 2B7KA 3LQ7A 4PTSA 1PL2A 1BEDA 1QQ2A 3VK9A 4K1FA 4YQUA 2C0EA 1HQOA 2L59A 2R3XA 1GNWA 3IV4A 3MSZA 2QGVA 1FW1A 4V1Ag 3TJJA 2ON5A 2HRAA 2LRNA 3RHBA 3GYKA 3TKPA 1SK1A 1XPVA 3DD3A 4TXOA 4XRDA 2VD0A 5GSSA 2FUG2 1VGLA 4HJMA 3QD9A 4K5SA 2L5LA 1ZCPA 1HD2A 1DSBA 3H8QA 4KGIA 4W66A 5IMCA 2UZ8A 1FB0A 5IM9A 5A5HA 2LQOA 1AUCA 2LJKA 2X8GA 5C00A 5FWGA 1X5EA 3ZYWA 1HYUA 4AKIA 3ERWA 1O85A 1GWCA 2IMFA 2HSNB 1VRSD 2DLXA 5F0GA 2VM1A 2JL4A 2HRKB 5D9WA 5GSTA 3VI7A 2NBSA 5HFIA 1VF3A 3F6FA 2VL3A 1HNCA 3VPTA 3OR5A 2XPDA 1SKWB 3ZITA 4G0IA 2YJ7A 2AV4A 2K8SA 5HFKA 3UJ1A 2N5AA 3G9BA 4ECCA 2IMKA 3IA1A 5GAPD 1XW5A 4OCFA 2VCWA 2P5RA 3CTFA 2OBKA 2GZZA 4I2TA 4ML6A 1K0MA 1TRUA 3GKNA 2WZ9A 2J23A 2PGTA 2IFQA 2FNOA 2H1BA 1SU9A 1FVKA 4LMVA 3GTUA 2WFCA 2YPMA 3IK9A 4JZQA 4NMUA 5DQSA 14GSA 1FO5A 2IN3A 4QL9A 2EC4A 3M9KA 5BMUA 3DKSA 5KN0A 4ZBDA 3GKMA 3F0IA 4TW5A 4YAVA 4MNNA 2Z9SA 3KEBA 4IQAA 4KW6A 1WIKA 2R0GA 1S3AA 2XBQA 3I43A 2OE0A 5H5RA 3ME7A 3AY8A 4TR3A 3VLNA 1OYJA 3IK7A 1V2AA 4EE0A 3HZ4A 2DJ1A 5EY6A 4OFNA 5DCGA 5B8BA 4GDFA 2V1MA 1T8EB 3TB2A 1TI1A 4MH3A 4QQ7A 2XPEA 3H1NA 3E0UA 5J5NA 5KN2A 5J4VA 4EC0A 1V58A 3I6AA 3U5RE 8GSSA 3FEUA 1TKDB 3D22A 3A2VA 5CRGA 3HDCA 3VURA 1FAAA 1USBA 1GUKA 5CRWA 1V9WA 1OKTA 4L5OA 4JBBA 13GSA 3KGKA 3GKKA 3KIJA 4IKHA 5JCGA 5DALB 4LA1A 2VD1A 2DIZA 3SBCA 2VLUA 5G1KA 3F4RA 3GURA 6GSSA 3LYPA 2H19A 3WYWA 2FD3A 1SL1B 1KNGA 6GSXA 1DE1A 3EURA 3VFIA 1GTIA 3GRXA 1KBNA 1BJXA 3F63A 4XTSA 5ECMB 3IC4A 1AW9A 4E68A 3KJYA 2GS3A 3IHGA 1GSFA 4IQ1A 4K6XA 2H30A 2X99A 1UC7A 5DDLA 1FHEA 2C3TA 1G7EA 3KMNA 3TRPA 5JCUA 5B8AA 1JLVA 4AKXB 3S9FA 1SVOA 3RAZA 2KOKA 4JU5A 1K0BA 4IW9A 2HT9A 4O7HA 5HR1A 11GSA 5EPFA 2GSQA 4TR4A 3VWWA 1ERTA 2WS2A 2GT6A 2H8LA 2VL9A 3CSIA 3HY2A 1TK0B 4EF0A 1YF0A 3H93A 5IMDA 5IO2A 6GSYA 2D2ZA 2VCQA 22GSA 2OE3A 5G2ZA 4XHMA 3D6IA 3PGTA 2C4JA 4MF7A 1TRWA 4V2LA 4N11A 4HEA2 5HR2A 3HYPA 2LJRA 1GRXA 1Z5YE 1FVJA 2BTOT 5DAKA 2C1YA 2R2JA 5DBQA 4F82A 5DVBA 3L9SA 1A2JA 2XHFA 2B5EA 2GQKA 2M46A 3KP9A 4K9ZA 4PURA 1TW9A 2WULA 5JWRB 4N0VA 3ZVJA 1QGVA 1SK2A 16GSA 4PGTA 1TXXA 4K7NA 2LV3A 3EWLA 4TXVA 1TRSA 3IPZA 4O5UA 1LJRA 2L6CA 2DBCA 1K3YA 2R0PA 1TOFA 2MMAA 3GIXA 4KF9A 1MDIA 4N10A 1FB6A 3UIWA 4YQMA 3ZTLA 4JEDA 4MA9A 4ZILA 4MJCA 3Q74A 5F8BA 4E8EA 3GSTA 3LXZA 5D9XA 1XXUA 3G7IA 5FT3A 5A1NB 5CP1A 1YVLA 4NXIA 5D93A 4GCIA 2H1DA 2HSHA 5IMAA 4XS4B 4OWYA 2LRCA 2VCTA 4ZL8A 2DMMA 5COHA 2JSYA 1XBSA 2TIRA 4FIWA 1W4VA 3QMXA 4RI7A 3LJRA 2YCDA 1SD8A 3G7YA 2LTKA 3C7MA 3HD5A 4MH2A 3C1SA 5ECLB 4IP6A 2AAWA 3KMOA 1PX7A 4MPFA 1EGRA 3UARA 3N5OA 4PNGA 1OC3A 3M1GA 3J7Yk 3M3MA 3UBLA 2JADA 3KH9A 1GTBA 2NVLA 2X49A 4HOJA 4NPBA 5CAXA 1ZYQB 2PWJA 1GUHA 4ID0A 1RK4A 3ZVJD 3HXSA 1SD9A 3CYNA 1A2MA 4G10A 1Z7RA 1I5GA 2B1KA 4X0XA 2B5YA 3KCMA 3A5IA 1TRVA 5D8IA 4G9HA 4LL4B 4EVMA 2X8CA 4IP1A 3TKSA 4O32A 2DJ2A 1QXHA 3ZL5A 4WR5A 1PSQA 4D73A 4YQVA 5KEJA 1ZZYA 4Q5NA 3GV1A 4IVFA 5J41A 3HVSA 5F07A 4PX1A 3DYRA 1ZMAA 1JZOA 1T4YA 4L0WA 5HR0A 3CBUA 1NM3A 5BRTA 4BL7B 1EP7A 1R7HA 1XIYA 1V98A 2I81A 2FWFA 4POLA 1UN2A 5IMVA 3ZRDA 2C8UA 3LYKA 1YZXA 3VI5A 2B7JA 1F6MC 3GKXA 3BD2A 1O81A 1BG5A 3IHQA 2OA7A 3F4TA 2VCZA 3EE2A 2O85A 1WMJA 4K8MA 2GQMA 3IE3A 1GH2A 4ZL7A 1BG1A 4MP4A 3FRCA 4K7IA 4G2EA 4HU7A 3QPMA 5E4WA 2YNXA 1HNBA 2GLRA 1JZDA 2KLXA 1UVZA 2V41A 1B4PA 4Q5QA 2P5QA 3WGXA 5G1LA 3CRUA 3TKSC 1WPIA 1ZOFA 1F37A 1JZRA 1ABAA 1TP9A 1Z3EA 3F3QA 5IPHA 2LJAA 2E7PA 3V1WA 4KB3A 5H5QA 2JZRA 2JU5A 3FY7A 5J40A 1BQ7A 1E2YA 2QKEA 4LL1B 2KP1A 2ALBA 3KD0A 1YF1A 4FYCA 1PL1A 4USSA 3LSZA 2HRKA 1JHBA 3A2WA 1X0RA 1FG4A 3HVXA 2FCHA 3FZ9A 2E0QA 4TN8A 19GSA 1U3IA 1MDJA 5ELAA 2MMNA 2MMZA 3KTLA 1Z6MA 4BVXB 2C3QA 2YWIA 2WB9A 4WF5A 5IIZA 3NIVA 2EIQA 3GH9A 2H1LA 1MD4A 3A5WA 3IBHA 5B6NA 1XWCA 3DMLA 2A2RA 1A23A 1F3AA 3P7XA 4P3YB 2XC2A 1SKSB 4MF6A 1PMTA 2AYTA 2H6ZA 4AJ6A 4WETA 3DVWA 3CSHA 1ERVA 2EFHA 3ZIVA 4FO5A 4POBA 4XS1A 3CXGA 5F05A 4ZBAA 4DSQA 4Z2TA 1OC8A 3C8EA 5JWOB 1SVLA 3RBTA 2DJJA 1A24A 2BJXA 5KN1A 1B9YC 1TI3A 3WT1A 1K3OA 2HSYA 1SJZA 4TRXA 1QFNA 3O3TA 4DVCA 5IOXA 2FWEA 1SYRA 2H0IA 5AISA 4HQSA 1J0FA 1F2EA 3IDVA 4ZB9A 1PKWA 2N5BA 18GSA 5AIXA 2HLSA 1YQ1A 4X1UA 1NHYA 3WT2A 2GZYA 1SJ6A 1XW6A 2TRXA 5IMZA 5JWQB 1EV4A 4EKZA 4TXOB 1SL0B 5FHIA 2L4CA 1M9BA 2A4HA 2PN8A 4EDZA 1OE7A 3QAVA 3GHAA 5DALA 1GTAA 3IRAA 5AGYA 1GSUA 4TOPA 1WWJA 1ILOA 3ZLPA 4MCUA 2FLSA 4AJ7A 5B6MA 3GH6A 4K7OA 4QL7A 2V2GA 3TKRA 4HDEA 1IYHA 1Z6NA 1BF5A 1XFLA 6GSUA 1BYEA 3L9UA 4OO4A 3ERGA 3D21A 1GSDA 1U3AA 1GSSA 2IMDA 2O87A 2R0CA 1V57A 2H74A 3GUSA 3ED3A 1BAYA 4G01A 2VIMA 3GL5A 3LFLA 3LGCA 4Z7XA 2HZEA 3F9UA 3QAGA 3GFKA 3MAKA 5ECRB 1OKDA 4K0NA 4OD7A 4CY8A 1M2AA 2LKUA 1G7OA 4KNDA 3MIXA 2IFQB 4HUAA 4L8EA 2M80A 4HZ4A 1GLQA 1M0UA 2GVPA 5INYA 4IELA 3D4MA 4MLYA 1H75A 3TGZA 4OCEA 1V40A 2GSTA 4ECIA 2K18A 1X9WB 1ERWA 1TU8A 4KE3A 3ZFLA 4ACSA 4BVYB 1ZL9A 1ML6A 1WJKA 2I1UA 5LNKe 2P31A 2V32A 1XWAA 4RQRA 2DC5A 3DWVA 2RUEA 4JR6A 1YY7A 3VPQA 4KCAA 3NZNA 3GX0A 3JCML 1YDKA 1HNAA 2LNSA 2ZNMA 4MJBA 2KHPA 2C3NA 1EP8A 3F4SA 2H1GA 4KDXA 3C71A 3GX8A 3KTBA 4XS6A 4MABA 1XW9A 2H1AA 3VWVA 3UVTA 1KEBA 4K2DA 4V2MA 3EVIA 4F2IA 1S3CA 2EFEA 2AHEA 4CW9A 2HYXA 3ME8A 1TXUA 4EIPA 1TTZA 4MK3A 5IOWA 4MJAA 4AJ8A 4N0ZA 5ECSA 2O89A 5A1NA 2QA2A 4K5RA 3RPPA 1YKCA 2CA8A 1QUWA 5HR3A 1GSEA 1I9DA 4ECBA 1M2DA 3EU4A 1THXA 4Z2UA 5ENUA 2L57A 4F0BA 1NHOA 1X5DA 2HI7A 2CZ3A 4WBJA 4MJEA 4MZBA 2H70A 3UVHA 1U87A 5J3RA 3EYTA 1R4WA 3Q18A 4WXTA 1K0NA 3D5JA 4KCEA 3TDGA 2JACA 1O8WA 1B9XC 4GF0A 4N3ZA 4PXOA 3FMWA 2H0HA 1OC9B 3G7JA 3QR6A 1X5CA 2WCIA 4WR4A 5A34B 3HA9A 4TR1B 1QK8A 2VCXA 2EIRA 3DIEA 4PUFC 2VKZG 1RW1A 5IQYA 4IS0A 4WF4A 4EUYA 2PBJA 3C73A 4LMWA 2C0GA 4MF5A 1TJDA 3DGQA 3HCZA 1MD3A 2LS5A 5A4UA 1T00A 2A2SA 2KP2A 4MDCA 5J9CA 3LEFA 2NPBA 1ST9A 20GSA 5G5EA 3PH9A 1U6TA 2AJQB 1SYXA 4RI6A 3BOAA 3HJMA 2PPTA 2GDRA 3FHKA 3TRQA 5DAKB 3PR8A 2QC7A 4NV2A 2L5OA 5J47A 4V2NA 4ZIJA 2MBSA 1FOHA 4GQFA 3BBYA 6GSTA 2CVBA 5ID2A 3WGDA 3HJPA 3IAM2 2I9HA 4L5LA 1XOAA 2GT5A 2M72A 3IXRA 4BL7A 2VO4A 4N30A 1O8XA 4KSMA 1YEXA 4ICYA 4FYBA 2HE3A 4YKFA 5G31A 3QFBC 2FHEA 3WD6A 2OE1A 2VL2A 5IMFA 1AQVA 4GSTA 2YN1A 3TKSE 3DEXA 1DUGA 4ML1A 2B5XA 2LUSA 3I9V2 2TRCP 2OBIA 4AKGA 2IMIA 2CVDA 4EIQA 3QOUA 2IL3A 1WP0A 4POMA 3E9JB 4MZWA 5D9TA 1CQHA 4V1Ap 2HSMA 3HKRA 2FGXA 3KH7A 3FYGA 2RM6A 1A2LA 1EGOA 4EDYA 2CT6A 4PUAA 1XCCA 2UV8G 2N5FA 1SK0A 3P90A 1AQWA 2VUPA 2B6MA 1NSWA 1GP1A 2DJKA 3E3EA 2CVKA 4DSSB 2GZPA 2K9FA 4PQ1A 1C72A 2YV7A 3P8WA 5CYYA 1XVWA 2KUCA 5GZZB 4JE1A 2GSRA 1ZYNA 2FWHA 2H6XA 2G2QA 3VWXA 10GSA 2DSAA 2B3SA 5HQPA 4Z2RA 3FR3A 4BVXA 2CAIA 3CTGA 2K6VA 1G6YA 3KM6A 1G0TA 2O5VA 3GN3A 2F8FA 1XOBA 1URMA 1R5PA 2YWOA 3ZIJA 1T3BA 4AGSA 5H5SA 3BJ5A 2HXKA 3UOMA 5D9VA 4CHSA 3FZAA 3RDWA 4TKYA 1QMVA 1GL8A 4KDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN1 A;  3L4N A;  4XRA A;  3L78 A;  3UMA A;  2V6K A;  3KZQ A;  3FZ4 A;  5LCZ A;  4HI7 A;  1CQG A;  1PRX A;  1X9S B;  4ULX A;  2CX3 A;  1PX6 A;  4HJ2 A;  2H72 A;  2YJH A;  1JLW A;  4Q5F A;  2B1L A;  3R2Q A;  12GS A;  4G0K A;  3GNJ A;  1RQM A;  2HQT A;  2VM2 A;  1GTU A;  4HQZ A;  3IR4 A;  5EL8 A;  2JZT A;  2L6D A;  5HFG A;  1TU7 A;  1K0D A;  3GA4 A;  5DJM A;  4KA0 A;  4RUV A;  2CV4 A;  4NV5 A;  1N8J A;  2WGR A;  2LNT A;  1LU4 A;  1Y6E A;  1S3D A;  3RPN A;  1DBY A;  1B48 A;  2RLI A;  2RM5 A;  4I5Q A;  3TCO A;  4ZXG A;  3TUE A;  1THO A;  2ON7 A;  2O7K A;  4NHW A;  1K0O A;  1ERU A;  3W8J A;  2CAQ A;  2H01 A;  3EU3 A;  3QCP A;  2LEG A;  4OMV A;  1AXD A;  5CRH A;  5CRD A;  2A4V A;  2H6Y A;  4WEY A;  1OAZ A;  1WE0 A;  3ZRE A;  2X8H A;  3C1R A;  1EOH A;  1XWK A;  4X43 A;  4I2U A;  2CZ2 A;  5ECO B;  3BCK A;  4F0C A;  1PKZ A;  3APO A;  5GAN D;  2C0D A;  2PVO C;  1YEP A;  4DEJ A;  1GSQ A;  3D4T A;  1SKR B;  4J56 E;  4AF2 A;  5ECQ B;  4GWR A;  1J9B A;  2DJ0 A;  2I3Y A;  1EOG A;  2MYG A;  2JZS A;  1JFU A;  1A0R P;  1GSY A;  3EMX A;  3DXB A;  3PIN A;  2H71 A;  6GSV A;  2R37 A;  2VCV A;  1KTE A;  2E2M A;  3ISO A;  4ILF A;  2IPA A;  3NOF A;  3ZML A;  4NAX A;  3H79 A;  5ECI B;  5A4W A;  2RII A;  2H75 A;  5E59 A;  3TRX A;  4O5R A;  2LRT A;  2P0G A;  3MWH A;  2FA4 A;  4BVY A;  1AIU A;  3M9J A;  3UAP A;  4I6X A;  1GNE A;  1PA3 A;  1WRY A;  2VOC A;  1Q98 A;  5CNW A;  4KUN A;  1F9M A;  1R5A A;  3FKF A;  2ES7 A;  4XIH A;  1AAZ A;  4KSO A;  2YV9 A;  2FWG A;  4BWS A;  1O7U A;  1VF4 A;  2YZH A;  3APS A;  5G5F A;  5LD0 A;  3QFA C;  4ZB8 A;  3UL3 A;  2H66 A;  2F51 A;  1G6W A;  3F3R A;  4F9Z A;  1B8X A;  3UEM A;  2XBI A;  2OJL A;  2MBT A;  3HHV A;  5AIV A;  3FZ5 A;  2AB6 A;  5A5K A;  1SJI A;  1EWX A;  2RUF A;  3R3E A;  1OE8 A;  2MMO A;  3GTU B;  2LQQ A;  1UA5 A;  3O6T A;  4K0G A;  4PQI A;  3CRT A;  4EO3 A;  4ZBB A;  2H73 A;  5IO0 A;  4IGJ A;  4OFM A;  4G0L A;  2H0G A;  1U88 A;  2JSZ A;  1AQX A;  4OFT A;  1PD2 1;  4JRR A;  4MMM A;  1GUM A;  5F06 A;  2EIO A;  1EV9 A;  4IJI A;  4GRF A;  2IJY A;  1X9M B;  3WGE A;  4H86 A;  1K0C A;  4CDO A;  2DJ3 A;  3M8N A;  4L0U A;  4YH2 A;  4IJ3 A;  2YAN A;  3CSJ A;  3ZZX A;  3P2A A;  4KH7 A;  2R4V A;  2QSI A;  2G0F A;  3U6V A;  2GQL A;  2YZU A;  1ZGN A;  3O76 A;  1EEM A;  2V6O A;  1TK8 B;  1OC9 A;  2HZE B;  1NW2 A;  4ECJ A;  4JR4 A;  4POK A;  1VF1 A;  4WKW A;  1K0A A;  3QAW A;  4TR1 A;  4J57 E;  3LXT A;  1XWB A;  2LST A;  3D0Z A;  2R6K A;  4I8B A;  4BPY A;  2PU9 C;  1SL2 B;  4KDY A;  2HNL A;  4BWQ A;  5DQY A;  4NWY A;  4LLR A;  4ZB6 A;  1Z9H A;  3QDN A;  1Q4J A;  4XS4 A;  3LG6 A;  3TOU A;  4Q5R A;  1ACV A;  5ELG A;  1F3B A;  3BCI A;  3ERF A;  2AUV A;  1A8L A;  1O6J A;  1W89 A;  3EC3 A;  3Q19 A;  2VLT A;  3F6D A;  3FW2 A;  1M99 A;  1GUL A;  5J4U A;  4HU9 A;  4ISD A;  2F3M A;  3CMI A;  4BA7 A;  1A8Y A;  3Q6O A;  3J7Y b;  1LBK A;  3EMP A;  1MTC A;  2CQ9 A;  1EZK A;  2WJU A;  1XVQ A;  2YOI A;  3M0F A;  5ECK B;  2DIY A;  2PER A;  2I4A A;  3GL3 A;  5B7C A;  4XCS A;  2YWN A;  3TJB A;  1XWG A;  2E2G A;  3ZFB A;  4EL1 A;  5L71 A;  5ECH B;  4MZC A;  4PNF A;  2IME A;  1O73 A;  5ABR A;  5DJL A;  4WBR D;  2IIY A;  4YAP A;  3GMF A;  1M7T A;  1H4O A;  1VF2 A;  2O8V B;  2PUK C;  4IHU A;  3W6G A;  1JZW A;  3SWL A;  3UBK A;  2GTU A;  2K8V A;  1MEK A;  2HZF A;  5ECP B;  17GS A;  4G19 A;  2OAD A;  3L9V A;  3FR6 A;  3MNG A;  2PMT A;  1ZYE A;  3A2X A;  5A4V A;  2PVQ A;  2CX4 A;  4IBP A;  4E8H A;  2VAF A;  2NDO A;  1TDI A;  2NTO A;  4DSS A;  1T4Z A;  4FH8 A;  4GQC A;  4HZ2 A;  5C04 A;  1T1V A;  3K8N A;  3I69 A;  4I97 A;  4NHZ A;  3IAS 2;  3TKQ A;  3DRN A;  2WRT A;  2FY6 A;  4PQH A;  3KXO A;  5D73 A;  3A3T A;  3FR9 A;  4KX4 A;  4FYU A;  1B4Q A;  1ON4 A;  4HS1 A;  1Y25 A;  2YWM A;  3ZMK A;  4OO5 A;  4IN0 A;  3IOS A;  1AC1 A;  3TJK A;  2FA8 A;  4RQX A;  1TK5 B;  2J9H A;  1EEJ A;  2OAC A;  2R5G A;  2H76 A;  3VWU A;  4GXZ A;  4MPG A;  4TVE A;  1PQN A;  2L4Q A;  4TR0 A;  1WOU A;  1DE2 A;  5CRE A;  5ECN B;  3HVV A;  2GGT A;  2WDU A;  1N2A A;  2VLV A;  2HRN A;  2C80 A;  2HRF A;  2F8A A;  7GSS A;  4GSS A;  2ZUP A;  3RHC A;  3EIN A;  3GSS A;  5EVO A;  3L0H A;  5ID2 B;  2C0F A;  2OKA A;  3FK8 A;  3W8S A;  1SEN A;  2VL2 C;  4J2F A;  1R26 A;  1Z7P A;  4DSR A;  3DVX A;  1T7P B;  2MZC A;  1K3L A;  3TOT A;  3F8U A;  2BMX A;  4ZL9 A;  3PPU A;  2HFD A;  9GSS A;  2REM A;  5D96 A;  2X64 A;  1FOV A;  1M2B A;  3N9J A;  3IC8 A;  4FQU A;  1YKA A;  3US3 A;  3MDK A;  1GLP A;  5IPG A;  2DML A;  5JCW A;  4GTU A;  1M9A A;  2GSS A;  5CO3 A;  1A0F A;  3TJF A;  1IYI A;  2HSM B;  4D73 B;  1J08 A;  3TJG A;  4F03 A;  4GLT A;  5DCH A;  1YJ6 A;  1OVN A;  3H4K A;  3KP8 A;  1E6B A;  3HJO A;  2F9S A;  2YP6 A;  5KN3 A;  4O92 A;  5G30 A;  3LOR A;  6GSW A;  3HZ8 A;  2IWT A;  4EXJ A;  1BX9 A;  1PN9 A;  1XZO A;  3LWA A;  5J9B A;  1PGT A;  3APQ A;  4KAE A;  4GSN A;  2ZCT A;  1MDK A;  2B7K A;  3LQ7 A;  4PTS A;  1PL2 A;  1BED A;  1QQ2 A;  3VK9 A;  4K1F A;  4YQU A;  2C0E A;  1HQO A;  2L59 A;  2R3X A;  1GNW A;  3IV4 A;  3MSZ A;  2QGV A;  1FW1 A;  4V1A g;  3TJJ A;  2ON5 A;  2HRA A;  2LRN A;  3RHB A;  3GYK A;  3TKP A;  1SK1 A;  1XPV A;  3DD3 A;  4TXO A;  4XRD A;  2VD0 A;  5GSS A;  2FUG 2;  1VGL A;  4HJM A;  3QD9 A;  2L5L A;  1ZCP A;  1HD2 A;  1DSB A;  3H8Q A;  4KGI A;  5IMC A;  2UZ8 A;  1FB0 A;  5IM9 A;  2LQO A;  1AUC A;  2LJK A;  2X8G A;  5C00 A;  5FWG A;  1X5E A;  3ZYW A;  1HYU A;  3ERW A;  1O85 A;  1GWC A;  2IMF A;  2HSN B;  1VRS D;  2DLX A;  5F0G A;  2VM1 A;  2JL4 A;  2HRK B;  5D9W A;  5GST A;  3VI7 A;  2NBS A;  5HFI A;  1VF3 A;  3F6F A;  2VL3 A;  1HNC A;  3VPT A;  3OR5 A;  2XPD A;  1SKW B;  3ZIT A;  4G0I A;  2YJ7 A;  2AV4 A;  2K8S A;  5HFK A;  3UJ1 A;  2N5A A;  3G9B A;  4ECC A;  2IMK A;  3IA1 A;  5GAP D;  1XW5 A;  4OCF A;  2VCW A;  2P5R A;  3CTF A;  2OBK A;  2GZZ A;  4I2T A;  4ML6 A;  1K0M A;  1TRU A;  3GKN A;  2WZ9 A;  2J23 A;  2PGT A;  2IFQ A;  2FNO A;  2H1B A;  1SU9 A;  1FVK A;  4LMV A;  3GTU A;  2WFC A;  2YPM A;  3IK9 A;  4JZQ A;  4NMU A;  5DQS A;  14GS A;  1FO5 A;  2IN3 A;  4QL9 A;  2EC4 A;  3M9K A;  5BMU A;  3DKS A;  5KN0 A;  4ZBD A;  3GKM A;  3F0I A;  4TW5 A;  4YAV A;  2Z9S A;  3KEB A;  4IQA A;  4KW6 A;  1WIK A;  1S3A A;  2XBQ A;  3I43 A;  2OE0 A;  5H5R A;  3ME7 A;  3AY8 A;  4TR3 A;  3VLN A;  1OYJ A;  3IK7 A;  1V2A A;  4EE0 A;  3HZ4 A;  2DJ1 A;  5EY6 A;  4OFN A;  5DCG A;  5B8B A;  2V1M A;  1T8E B;  3TB2 A;  1TI1 A;  4MH3 A;  4QQ7 A;  2XPE A;  3H1N A;  3E0U A;  5J5N A;  5KN2 A;  4EC0 A;  1V58 A;  3I6A A;  3U5R E;  8GSS A;  3FEU A;  1TKD B;  3D22 A;  3A2V A;  5CRG A;  3HDC A;  3VUR A;  1FAA A;  1USB A;  1GUK A;  5CRW A;  1V9W A;  1OKT A;  4L5O A;  4JBB A;  13GS A;  3KGK A;  3GKK A;  3KIJ A;  4IKH A;  5JCG A;  5DAL B;  4LA1 A;  2VD1 A;  2DIZ A;  3SBC A;  2VLU A;  5G1K A;  3F4R A;  3GUR A;  6GSS A;  3LYP A;  2H19 A;  3WYW A;  2FD3 A;  1SL1 B;  1KNG A;  6GSX A;  1DE1 A;  3EUR A;  3VFI A;  1GTI A;  3GRX A;  1KBN A;  1BJX A;  3F63 A;  4XTS A;  5ECM B;  3IC4 A;  1AW9 A;  3KJY A;  2GS3 A;  1GSF A;  4K6X A;  4IQ1 A;  2H30 A;  2X99 A;  1UC7 A;  5DDL A;  1FHE A;  2C3T A;  1G7E A;  3KMN A;  3TRP A;  5JCU A;  5B8A A;  1JLV A;  3S9F A;  3RAZ A;  2KOK A;  4JU5 A;  1K0B A;  4IW9 A;  2HT9 A;  4O7H A;  5HR1 A;  11GS A;  5EPF A;  2GSQ A;  4TR4 A;  3VWW A;  1ERT A;  2WS2 A;  2GT6 A;  2H8L A;  2VL9 A;  3CSI A;  3HY2 A;  1TK0 B;  4EF0 A;  1YF0 A;  3H93 A;  5IMD A;  5IO2 A;  6GSY A;  2D2Z A;  2VCQ A;  22GS A;  2OE3 A;  5G2Z A;  4XHM A;  3D6I A;  3PGT A;  2C4J A;  4MF7 A;  1TRW A;  4V2L A;  4N11 A;  4HEA 2;  5HR2 A;  3HYP A;  2LJR A;  1GRX A;  1Z5Y E;  1FVJ A;  2BTO T;  5DAK A;  2C1Y A;  2R2J A;  5DBQ A;  4F82 A;  5DVB A;  3L9S A;  1A2J A;  2XHF A;  2B5E A;  2GQK A;  2M46 A;  3KP9 A;  4K9Z A;  4PUR A;  1TW9 A;  2WUL A;  5JWR B;  4N0V A;  3ZVJ A;  1QGV A;  1SK2 A;  16GS A;  4PGT A;  1TXX A;  4K7N A;  2LV3 A;  3EWL A;  4TXV A;  1TRS A;  3IPZ A;  1LJR A;  2L6C A;  2DBC A;  1K3Y A;  1TOF A;  2MMA A;  3GIX A;  4KF9 A;  1MDI A;  4N10 A;  1FB6 A;  3UIW A;  4YQM A;  3ZTL A;  4JED A;  4MA9 A;  4ZIL A;  4MJC A;  3Q74 A;  5F8B A;  4E8E A;  3GST A;  3LXZ A;  5D9X A;  1XXU A;  3G7I A;  5FT3 A;  5CP1 A;  4NXI A;  5D93 A;  4GCI A;  2H1D A;  2HSH A;  5IMA A;  4XS4 B;  4OWY A;  2LRC A;  2VCT A;  4ZL8 A;  2DMM A;  5COH A;  2JSY A;  1XBS A;  2TIR A;  4FIW A;  1W4V A;  3QMX A;  4RI7 A;  3LJR A;  2YCD A;  1SD8 A;  3G7Y A;  2LTK A;  3C7M A;  3HD5 A;  4MH2 A;  3C1S A;  5ECL B;  4IP6 A;  2AAW A;  3KMO A;  1PX7 A;  4MPF A;  1EGR A;  3UAR A;  3N5O A;  4PNG A;  1OC3 A;  3M1G A;  3J7Y k;  3M3M A;  3UBL A;  2JAD A;  3KH9 A;  1GTB A;  2NVL A;  4HOJ A;  4NPB A;  5CAX A;  1ZYQ B;  2PWJ A;  1GUH A;  4ID0 A;  1RK4 A;  3ZVJ D;  3HXS A;  1SD9 A;  3CYN A;  1A2M A;  4G10 A;  1Z7R A;  1I5G A;  2B1K A;  4X0X A;  2B5Y A;  3KCM A;  1TRV A;  5D8I A;  4G9H A;  4LL4 B;  4EVM A;  2X8C A;  4IP1 A;  3TKS A;  4O32 A;  2DJ2 A;  1QXH A;  3ZL5 A;  4WR5 A;  1PSQ A;  4D73 A;  4YQV A;  5KEJ A;  1ZZY A;  4Q5N A;  3GV1 A;  4IVF A;  5J41 A;  3HVS A;  5F07 A;  4PX1 A;  3DYR A;  1ZMA A;  1JZO A;  1T4Y A;  4L0W A;  5HR0 A;  3CBU A;  1NM3 A;  4BL7 B;  1EP7 A;  1R7H A;  1XIY A;  1V98 A;  2I81 A;  2FWF A;  4POL A;  1UN2 A;  5IMV A;  3ZRD A;  2C8U A;  3LYK A;  1YZX A;  3VI5 A;  2B7J A;  1F6M C;  3GKX A;  3BD2 A;  1O81 A;  1BG5 A;  3IHQ A;  2OA7 A;  3F4T A;  2VCZ A;  3EE2 A;  2O85 A;  1WMJ A;  4K8M A;  2GQM A;  3IE3 A;  1GH2 A;  4ZL7 A;  4MP4 A;  3FRC A;  4K7I A;  4G2E A;  4HU7 A;  3QPM A;  5E4W A;  2YNX A;  1HNB A;  2GLR A;  1JZD A;  2KLX A;  1UVZ A;  2V41 A;  1B4P A;  4Q5Q A;  2P5Q A;  3WGX A;  5G1L A;  3CRU A;  3TKS C;  1WPI A;  1ZOF A;  1F37 A;  1JZR A;  1ABA A;  1TP9 A;  1Z3E A;  3F3Q A;  5IPH A;  2LJA A;  2E7P A;  3V1W A;  4KB3 A;  5H5Q A;  2JZR A;  2JU5 A;  3FY7 A;  1BQ7 A;  1E2Y A;  2QKE A;  4LL1 B;  2KP1 A;  2ALB A;  3KD0 A;  1YF1 A;  4FYC A;  1PL1 A;  4USS A;  3LSZ A;  2HRK A;  1JHB A;  3A2W A;  1X0R A;  1FG4 A;  3HVX A;  2FCH A;  3FZ9 A;  2E0Q A;  4TN8 A;  19GS A;  1U3I A;  1MDJ A;  5ELA A;  2MMN A;  2MMZ A;  3KTL A;  1Z6M A;  4BVX B;  2C3Q A;  2YWI A;  2WB9 A;  4WF5 A;  5IIZ A;  3NIV A;  2EIQ A;  3GH9 A;  3A5W A;  1MD4 A;  3IBH A;  5B6N A;  1XWC A;  3DML A;  2A2R A;  1A23 A;  1F3A A;  3P7X A;  4P3Y B;  2XC2 A;  1SKS B;  4MF6 A;  1PMT A;  2AYT A;  2H6Z A;  4AJ6 A;  4WET A;  3DVW A;  3CSH A;  1ERV A;  3ZIV A;  4FO5 A;  4POB A;  4XS1 A;  3CXG A;  5F05 A;  4ZBA A;  4DSQ A;  1OC8 A;  3C8E A;  5JWO B;  3RBT A;  2DJJ A;  1A24 A;  2BJX A;  5KN1 A;  1B9Y C;  1TI3 A;  3WT1 A;  1K3O A;  2HSY A;  1SJZ A;  4TRX A;  1QFN A;  3O3T A;  4DVC A;  5IOX A;  2FWE A;  1SYR A;  2H0I A;  5AIS A;  4HQS A;  1J0F A;  1F2E A;  3IDV A;  4ZB9 A;  1PKW A;  2N5B A;  18GS A;  5AIX A;  2HLS A;  1YQ1 A;  4X1U A;  1NHY A;  3WT2 A;  2GZY A;  1SJ6 A;  1XW6 A;  2TRX A;  5IMZ A;  5JWQ B;  1EV4 A;  4EKZ A;  4TXO B;  1SL0 B;  5FHI A;  2L4C A;  1M9B A;  2PN8 A;  4EDZ A;  1OE7 A;  3QAV A;  3GHA A;  5DAL A;  1GTA A;  3IRA A;  5AGY A;  1GSU A;  4TOP A;  1WWJ A;  1ILO A;  3ZLP A;  4MCU A;  2FLS A;  4AJ7 A;  5B6M A;  3GH6 A;  4K7O A;  4QL7 A;  2V2G A;  3TKR A;  4HDE A;  1IYH A;  1Z6N A;  1XFL A;  6GSU A;  1BYE A;  3L9U A;  4OO4 A;  3ERG A;  3D21 A;  1GSD A;  1U3A A;  1GSS A;  2IMD A;  2O87 A;  1V57 A;  2H74 A;  3GUS A;  3ED3 A;  1BAY A;  2VIM A;  3GL5 A;  3LFL A;  3LGC A;  4Z7X A;  2HZE A;  3F9U A;  3QAG A;  3GFK A;  3MAK A;  5ECR B;  1OKD A;  4K0N A;  4OD7 A;  1M2A A;  2LKU A;  1G7O A;  4KND A;  2IFQ B;  4HUA A;  4L8E A;  2M80 A;  4HZ4 A;  1GLQ A;  1M0U A;  2GVP A;  5INY A;  4IEL A;  3D4M A;  4MLY A;  1H75 A;  3TGZ A;  4OCE A;  1V40 A;  2GST A;  4ECI A;  2K18 A;  1X9W B;  1ERW A;  1TU8 A;  4KE3 A;  3ZFL A;  4ACS A;  4BVY B;  1ZL9 A;  1ML6 A;  1WJK A;  2I1U A;  5LNK e;  2P31 A;  2V32 A;  1XWA A;  4RQR A;  2DC5 A;  3DWV A;  2RUE A;  4JR6 A;  1YY7 A;  3VPQ A;  4KCA A;  3NZN A;  3GX0 A;  3JCM L;  1YDK A;  1HNA A;  2LNS A;  2ZNM A;  4MJB A;  2KHP A;  2C3N A;  1EP8 A;  3F4S A;  2H1G A;  4KDX A;  3C71 A;  3GX8 A;  3KTB A;  4XS6 A;  4MAB A;  1XW9 A;  2H1A A;  3VWV A;  3UVT A;  1KEB A;  4K2D A;  4V2M A;  3EVI A;  4F2I A;  1S3C A;  2AHE A;  4CW9 A;  2HYX A;  3ME8 A;  1TTZ A;  4MK3 A;  5IOW A;  4MJA A;  4AJ8 A;  4N0Z A;  5ECS A;  2O89 A;  3RPP A;  1YKC A;  2CA8 A;  1QUW A;  5HR3 A;  1GSE A;  1I9D A;  4ECB A;  1M2D A;  3EU4 A;  1THX A;  5ENU A;  2L57 A;  4F0B A;  1NHO A;  1X5D A;  2HI7 A;  2CZ3 A;  4WBJ A;  4MJE A;  4MZB A;  2H70 A;  3UVH A;  1U87 A;  5J3R A;  3EYT A;  1R4W A;  3Q18 A;  4WXT A;  1K0N A;  3D5J A;  4KCE A;  3TDG A;  2JAC A;  1O8W A;  1B9X C;  4GF0 A;  4PXO A;  2H0H A;  1OC9 B;  3G7J A;  3QR6 A;  1X5C A;  2WCI A;  4WR4 A;  3HA9 A;  4TR1 B;  1QK8 A;  2VCX A;  2EIR A;  3DIE A;  4PUF C;  1RW1 A;  5IQY A;  4IS0 A;  4WF4 A;  4EUY A;  2PBJ A;  3C73 A;  4LMW A;  2C0G A;  4MF5 A;  1TJD A;  3DGQ A;  3HCZ A;  1MD3 A;  2LS5 A;  5A4U A;  1T00 A;  2A2S A;  2KP2 A;  4MDC A;  5J9C A;  3LEF A;  2NPB A;  1ST9 A;  20GS A;  5G5E A;  3PH9 A;  1U6T A;  2AJQ B;  1SYX A;  4RI6 A;  3BOA A;  3HJM A;  2PPT A;  2GDR A;  3FHK A;  3TRQ A;  5DAK B;  3PR8 A;  2QC7 A;  4NV2 A;  2L5O A;  4V2N A;  4ZIJ A;  2MBS A;  4GQF A;  3BBY A;  6GST A;  2CVB A;  5ID2 A;  3WGD A;  3HJP A;  3IAM 2;  2I9H A;  4L5L A;  1XOA A;  2GT5 A;  2M72 A;  3IXR A;  4BL7 A;  2VO4 A;  4N30 A;  1O8X A;  4KSM A;  1YEX A;  4FYB A;  2HE3 A;  5G31 A;  3QFB C;  2FHE A;  3WD6 A;  2OE1 A;  2VL2 A;  5IMF A;  1AQV A;  4GST A;  2YN1 A;  3TKS E;  3DEX A;  1DUG A;  4ML1 A;  2B5X A;  2LUS A;  3I9V 2;  2TRC P;  2OBI A;  2IMI A;  2CVD A;  3QOU A;  2IL3 A;  1WP0 A;  4POM A;  3E9J B;  4MZW A;  5D9T A;  1CQH A;  4V1A p;  2HSM A;  3HKR A;  2FGX A;  3KH7 A;  3FYG A;  2RM6 A;  1A2L A;  1EGO A;  4EDY A;  2CT6 A;  4PUA A;  1XCC A;  2N5F A;  1SK0 A;  3P90 A;  1AQW A;  2VUP A;  2B6M A;  1NSW A;  1GP1 A;  2DJK A;  3E3E A;  2CVK A;  4DSS B;  2GZP A;  2K9F A;  4PQ1 A;  1C72 A;  2YV7 A;  3P8W A;  5CYY A;  1XVW A;  2KUC A;  5GZZ B;  4JE1 A;  2GSR A;  2FWH A;  2H6X A;  2G2Q A;  3VWX A;  10GS A;  2DSA A;  2B3S A;  5HQP A;  3FR3 A;  4BVX A;  2CAI A;  3CTG A;  2K6V A;  1G6Y A;  3KM6 A;  1G0T A;  3GN3 A;  2F8F A;  1XOB A;  1URM A;  1R5P A;  2YWO A;  3ZIJ A;  1T3B A;  4AGS A;  5H5S A;  3BJ5 A;  2HXK A;  3UOM A;  5D9V A;  4CHS A;  3FZA A;  3RDW A;  4TKY A;  1QMV A;  1GL8 A;  4KDU A; 
#chains in the Genus database with same CATH topology
 5AN1 A;  3L4N A;  4XRA A;  3L78 A;  3UMA A;  2V6K A;  3KZQ A;  3FZ4 A;  5LCZ A;  4HI7 A;  1CQG A;  1PRX A;  1X9S B;  4YKG A;  4ULX A;  5KOW A;  2HSN A;  2CX3 A;  1PX6 A;  4HJ2 A;  2H72 A;  2YJH A;  1JLW A;  4Q5F A;  2B1L A;  3R2Q A;  3EPT A;  12GS A;  4G0K A;  3GNJ A;  1RQM A;  2HQT A;  2VM2 A;  1GTU A;  4HQZ A;  3IR4 A;  5EL8 A;  2JZT A;  2L6D A;  4PI2 C;  5HFG A;  1TU7 A;  1K0D A;  3GA4 A;  5DJM A;  4KA0 A;  4RUV A;  2CV4 A;  4NV5 A;  1N8J A;  2WGR A;  2LNT A;  1LU4 A;  1Y6E A;  1S3D A;  3RPN A;  1DBY A;  1B48 A;  2RLI A;  2RM5 A;  4I5Q A;  3TCO A;  4ZXG A;  3TUE A;  1THO A;  2ON7 A;  2O7K A;  4NHW A;  1K0O A;  1ERU A;  3W8J A;  2CAQ A;  2H01 A;  3EU3 A;  3QCP A;  2LEG A;  4OMV A;  1AXD A;  5CRH A;  5CRD A;  2A4V A;  2H6Y A;  4WEY A;  1OAZ A;  1WE0 A;  3ZRE A;  4HSC X;  2X8H A;  3C1R A;  1EOH A;  1XWK A;  4X43 A;  4I2U A;  3CWG A;  2CZ2 A;  5ECO B;  3BCK A;  4F0C A;  1PKZ A;  3APO A;  5GAN D;  2C0D A;  2PVO C;  1YEP A;  4DEJ A;  1GSQ A;  3D4T A;  1SKR B;  4J56 E;  4AF2 A;  5ECQ B;  4GWR A;  1J9B A;  2DJ0 A;  2I3Y A;  1EOG A;  2MYG A;  2JZS A;  1JFU A;  1A0R P;  1GSY A;  3EMX A;  3DXB A;  3PIN A;  2H71 A;  6GSV A;  2R37 A;  2VCV A;  1KTE A;  2E2M A;  3ISO A;  4ILF A;  2IPA A;  3NOF A;  3ZML A;  5A5H B;  4NAX A;  3H79 A;  5ECI B;  5A4W A;  2RII A;  2H75 A;  5E59 A;  3TRX A;  4O5R A;  2LRT A;  2P0G A;  3MWH A;  2A2P A;  2FA4 A;  4BVY A;  1AIU A;  3M9J A;  3UAP A;  4I6X A;  1GNE A;  1PA3 A;  1WRY A;  2VOC A;  1Q98 A;  5CNW A;  4KUN A;  1F9M A;  1R5A A;  3FKF A;  1PN0 A;  2ES7 A;  4XIH A;  1AAZ A;  4KSO A;  2YV9 A;  2FWG A;  4BWS A;  1O7U A;  1VF4 A;  2QA1 A;  2EFD A;  2YZH A;  3APS A;  5G5F A;  5LD0 A;  3QFA C;  4QMK A;  4ZB8 A;  3UL3 A;  2H66 A;  2F51 A;  1G6W A;  3F3R A;  4F9Z A;  1B8X A;  3UEM A;  2XBI A;  2OJL A;  2MBT A;  3HHV A;  5AIV A;  3FZ5 A;  2AB6 A;  5A5K A;  1SJI A;  1EWX A;  2RUF A;  3R3E A;  1OE8 A;  2MMO A;  3GTU B;  2LQQ A;  1UA5 A;  3O6T A;  4K0G A;  4PQI A;  3CRT A;  4EO3 A;  4ZBB A;  2H73 A;  5IO0 A;  4IGJ A;  4OFM A;  4AI6 A;  4G0L A;  2H0G A;  1U88 A;  2JSZ A;  5BMU B;  1AQX A;  4OFT A;  1PD2 1;  2DKI A;  4JRR A;  4MMM A;  1GUM A;  5F06 A;  2EIO A;  1EV9 A;  4IJI A;  4GRF A;  2IJY A;  1X9M B;  3WGE A;  4H86 A;  1K0C A;  4CDO A;  2DJ3 A;  3M8N A;  4L0U A;  4YH2 A;  4IJ3 A;  2YAN A;  3CSJ A;  3ZZX A;  4KH7 A;  2QSI A;  2R4V A;  3P2A A;  2G0F A;  3U6V A;  2GQL A;  2YZU A;  1ZGN A;  3O76 A;  1EEM A;  2V6O A;  1TK8 B;  2OT3 A;  1OC9 A;  2HZE B;  1NW2 A;  4ECJ A;  4JR4 A;  4POK A;  5A34 A;  2WW0 A;  1VF1 A;  4WKW A;  1K0A A;  3QAW A;  4TR1 A;  4J57 E;  3LXT A;  1XWB A;  2LST A;  3D0Z A;  2R6K A;  4I8B A;  2DKH A;  4BPY A;  2PU9 C;  1SVM A;  1SL2 B;  4KDY A;  2HNL A;  4BWQ A;  5DQY A;  4NWY A;  4LLR A;  4ZB6 A;  1Z9H A;  3QDN A;  1Q4J A;  4XS4 A;  3LG6 A;  3TOU A;  4Q5R A;  1ACV A;  5ELG A;  1F3B A;  3BCI A;  3ERF A;  2AUV A;  1A8L A;  1O6J A;  1W89 A;  3EC3 A;  3Q19 A;  2VLT A;  3F6D A;  3FW2 A;  1M99 A;  1GUL A;  5J4U A;  4HU9 A;  4ISD A;  4ZB7 A;  2F3M A;  3CMI A;  4BA7 A;  4O5Q A;  3TU3 B;  1A8Y A;  3Q6O A;  3J7Y b;  1LBK A;  3EMP A;  1MTC A;  2CQ9 A;  1EZK A;  2WJU A;  1XVQ A;  2YOI A;  3M0F A;  5ECK B;  2DIY A;  2PER A;  2I4A A;  3GL3 A;  5B7C A;  4XCS A;  2YWN A;  3TJB A;  1XWG A;  2E2G A;  3ZFB A;  4EL1 A;  5L71 A;  5ECH B;  4MZC A;  4PNF A;  2IME A;  1O73 A;  3MYD A;  5ABR A;  5DJL A;  4WBR D;  2IIY A;  4YAP A;  3GMF A;  1M7T A;  1H4O A;  1VF2 A;  2O8V B;  2PUK C;  4X4J A;  4IHU A;  3W6G A;  1JZW A;  3SWL A;  3UBK A;  2GTU A;  2K8V A;  1MEK A;  2HZF A;  5ECP B;  17GS A;  4G19 A;  2OAD A;  2O36 A;  3L9V A;  3FR6 A;  3MNG A;  2PMT A;  1ZYE A;  3A2X A;  5A4V A;  2PVQ A;  2CX4 A;  4IBP A;  4E8H A;  2VAF A;  2NDO A;  1TDI A;  2NTO A;  4DSS A;  1T4Z A;  4FH8 A;  4GQC A;  4HZ2 A;  5C04 A;  1T1V A;  3K8N A;  3I69 A;  4I97 A;  4NHZ A;  3IAS 2;  3TKQ A;  4AKH A;  3DRN A;  2WRT A;  2FY6 A;  4PQH A;  3KXO A;  5D73 A;  1Y1U A;  4A5P A;  3A3T A;  3FR9 A;  4KX4 A;  4FYU A;  1B4Q A;  1ON4 A;  4HS1 A;  1Y25 A;  2YWM A;  3ZMK A;  4OO5 A;  2EFC A;  4IN0 A;  3IOS A;  1AC1 A;  2WW1 A;  3TJK A;  2FA8 A;  4RQX A;  1TK5 B;  2J9H A;  1EEJ A;  2OAC A;  2R5G A;  2H76 A;  3VWU A;  4GXZ A;  4MPG A;  4TVE A;  1PQN A;  2L4Q A;  4TR0 A;  1WOU A;  1DE2 A;  5CRE A;  5ECN B;  1ZYP A;  2GGT A;  3HVV A;  2WDU A;  1N2A A;  5J4Y A;  2VLV A;  2HRN A;  2C80 A;  2HRF A;  2F8A A;  7GSS A;  4GSS A;  2ZUP A;  3RHC A;  3EIN A;  4CY6 A;  3GSS A;  5EVO A;  3L0H A;  5ID2 B;  2C0F A;  2OKA A;  3FK8 A;  3W8S A;  1SEN A;  2VL2 C;  4J2F A;  1R26 A;  1Z7P A;  4DSR A;  3DVX A;  1T7P B;  2MZC A;  1K3L A;  3TOT A;  3F8U A;  2BMX A;  4ZL9 A;  3LW9 A;  3PPU A;  2HFD A;  9GSS A;  2WZS A;  2REM A;  4K2X A;  5D96 A;  2X64 A;  1FOV A;  1M2B A;  3N9J A;  3IC8 A;  4FQU A;  1YKA A;  3US3 A;  3MDK A;  1GLP A;  5IPG A;  2DML A;  5JCW A;  3HMJ G;  4GTU A;  1M9A A;  2GSS A;  5CO3 A;  1A0F A;  3TJF A;  1IYI A;  2HSM B;  4D73 B;  2X4A A;  1J08 A;  3TJG A;  4F03 A;  4GLT A;  5DCH A;  1YJ6 A;  1OVN A;  3H4K A;  3KP8 A;  1E6B A;  3HJO A;  2F9S A;  2YP6 A;  1N25 A;  5KN3 A;  2WVX A;  4O92 A;  5G30 A;  3LOR A;  6GSW A;  5KOX A;  3HZ8 A;  2IWT A;  4EXJ A;  1BX9 A;  1PN9 A;  1XZO A;  3LWA A;  5J9B A;  1PGT A;  3APQ A;  4KAE A;  4GSN A;  2ZCT A;  1MDK A;  2B7K A;  3LQ7 A;  4PTS A;  1PL2 A;  1BED A;  1QQ2 A;  3VK9 A;  4K1F A;  4YQU A;  2C0E A;  1HQO A;  2L59 A;  2R3X A;  1GNW A;  3IV4 A;  3MSZ A;  2QGV A;  1FW1 A;  4V1A g;  3TJJ A;  2ON5 A;  2HRA A;  2LRN A;  3RHB A;  3GYK A;  3TKP A;  1SK1 A;  1XPV A;  3DD3 A;  4TXO A;  4XRD A;  2VD0 A;  5GSS A;  2FUG 2;  1VGL A;  4HJM A;  3QD9 A;  4K5S A;  2L5L A;  1ZCP A;  1HD2 A;  1DSB A;  3H8Q A;  4KGI A;  4W66 A;  5IMC A;  2UZ8 A;  1FB0 A;  5IM9 A;  5A5H A;  2LQO A;  1AUC A;  2LJK A;  2X8G A;  5C00 A;  5FWG A;  1X5E A;  3ZYW A;  1HYU A;  4AKI A;  3ERW A;  1O85 A;  1GWC A;  2IMF A;  2HSN B;  1VRS D;  2DLX A;  5F0G A;  2VM1 A;  2JL4 A;  2HRK B;  5D9W A;  5GST A;  3VI7 A;  2NBS A;  5HFI A;  1VF3 A;  3F6F A;  2VL3 A;  1HNC A;  3VPT A;  3OR5 A;  2XPD A;  1SKW B;  3ZIT A;  4G0I A;  2YJ7 A;  2AV4 A;  2K8S A;  5HFK A;  3UJ1 A;  2N5A A;  3G9B A;  4ECC A;  2IMK A;  3IA1 A;  5GAP D;  1XW5 A;  4OCF A;  2VCW A;  2P5R A;  3CTF A;  2OBK A;  2GZZ A;  4I2T A;  4ML6 A;  1K0M A;  1TRU A;  3GKN A;  2WZ9 A;  2J23 A;  2PGT A;  2IFQ A;  2FNO A;  2H1B A;  1SU9 A;  2WVZ A;  1FVK A;  4LMV A;  3GTU A;  2WFC A;  2YPM A;  3IK9 A;  4JZQ A;  4NMU A;  5DQS A;  14GS A;  1FO5 A;  2IN3 A;  4QL9 A;  2EC4 A;  3M9K A;  5BMU A;  3DKS A;  5KN0 A;  4ZBD A;  3GKM A;  3F0I A;  4TW5 A;  4YAV A;  4MNN A;  2Z9S A;  3KEB A;  4IQA A;  4KW6 A;  1WIK A;  2R0G A;  1S3A A;  2XBQ A;  3I43 A;  2OE0 A;  5H5R A;  3ME7 A;  3AY8 A;  4TR3 A;  3VLN A;  1OYJ A;  3IK7 A;  1V2A A;  4EE0 A;  3HZ4 A;  2DJ1 A;  5EY6 A;  4OFN A;  5DCG A;  5B8B A;  4GDF A;  2V1M A;  1T8E B;  3TB2 A;  1TI1 A;  4MH3 A;  4QQ7 A;  2XPE A;  3H1N A;  2WW3 A;  3E0U A;  5J5N A;  5KN2 A;  5J4V A;  4EC0 A;  1V58 A;  3I6A A;  3U5R E;  8GSS A;  3FEU A;  1TKD B;  2O3E A;  3D22 A;  3A2V A;  5CRG A;  3HDC A;  3VUR A;  1FAA A;  1USB A;  1GUK A;  5CRW A;  1V9W A;  1OKT A;  4L5O A;  4JBB A;  13GS A;  3KGK A;  3GKK A;  3KIJ A;  4IKH A;  5JCG A;  5DAL B;  4LA1 A;  2VD1 A;  2DIZ A;  3SBC A;  2VLU A;  5G1K A;  3F4R A;  3GUR A;  6GSS A;  3LYP A;  2H19 A;  3WYW A;  2FD3 A;  1SL1 B;  1KNG A;  6GSX A;  1DE1 A;  3EUR A;  3VFI A;  1GTI A;  3GRX A;  1YEW C;  1KBN A;  1BJX A;  3F63 A;  4XTS A;  5ECM B;  3IC4 A;  1AW9 A;  4E68 A;  3KJY A;  2GS3 A;  3IHG A;  1GSF A;  4IQ1 A;  4K6X A;  2H30 A;  2X99 A;  1UC7 A;  5DDL A;  1FHE A;  2C3T A;  1G7E A;  3KMN A;  3TRP A;  5JCU A;  5B8A A;  1JLV A;  4AKX B;  3S9F A;  1SVO A;  3RAZ A;  2KOK A;  4JU5 A;  1K0B A;  4IW9 A;  2HT9 A;  4O7H A;  5HR1 A;  11GS A;  5EPF A;  2GSQ A;  4TR4 A;  3VWW A;  1ERT A;  2WS2 A;  2GT6 A;  2H8L A;  2VL9 A;  3CSI A;  3HY2 A;  1TK0 B;  4EF0 A;  1YF0 A;  3H93 A;  5IMD A;  5IO2 A;  6GSY A;  2D2Z A;  2VCQ A;  22GS A;  4PI0 C;  2OE3 A;  5G2Z A;  4XHM A;  3D6I A;  3PGT A;  2C4J A;  4MF7 A;  1TRW A;  4V2L A;  4N11 A;  4HEA 2;  5HR2 A;  3HYP A;  2LJR A;  1GRX A;  1Z5Y E;  1FVJ A;  2BTO T;  5DAK A;  2C1Y A;  2R2J A;  5DBQ A;  4F82 A;  2WVY A;  5DVB A;  3L9S A;  1A2J A;  2XHF A;  2B5E A;  2GQK A;  2M46 A;  3KP9 A;  4K9Z A;  4PUR A;  1TW9 A;  2WUL A;  5JWR B;  4N0V A;  3ZVJ A;  1QGV A;  1SK2 A;  16GS A;  4PGT A;  1TXX A;  4K7N A;  2LV3 A;  3EWL A;  4TXV A;  1TRS A;  3IPZ A;  4O5U A;  1LJR A;  2L6C A;  2DBC A;  1K3Y A;  2R0P A;  1TOF A;  2MMA A;  3GIX A;  3CQF A;  4KF9 A;  1MDI A;  4N10 A;  1FB6 A;  3UIW A;  4YQM A;  3ZTL A;  4JED A;  4MA9 A;  4ZIL A;  1M3J A;  4MJC A;  3Q74 A;  5F8B A;  4E8E A;  3GST A;  3LXZ A;  5D9X A;  1XXU A;  3G7I A;  5FT3 A;  5A1N B;  5CP1 A;  1YVL A;  4NXI A;  5D93 A;  4GCI A;  2H1D A;  2HSH A;  5IMA A;  4XS4 B;  4OWY A;  2LRC A;  2VCT A;  4ZL8 A;  2DMM A;  5COH A;  2JSY A;  1XBS A;  2TIR A;  4FIW A;  1W4V A;  3QMX A;  4RI7 A;  3LJR A;  2YCD A;  1SD8 A;  3G7Y A;  2LTK A;  3C7M A;  1S3R A;  3HD5 A;  4MH2 A;  3C1S A;  5ECL B;  4IP6 A;  2AAW A;  3KMO A;  1PX7 A;  4MPF A;  1EGR A;  3UAR A;  3N5O A;  4PNG A;  1OC3 A;  3M1G A;  3J7Y k;  3M3M A;  4PHZ C;  3UBL A;  2JAD A;  3KH9 A;  1GTB A;  2NVL A;  2X49 A;  4HOJ A;  4NPB A;  5CAX A;  1ZYQ B;  2PWJ A;  1GUH A;  4ID0 A;  1RK4 A;  3ZVJ D;  3HXS A;  1SD9 A;  3CYN A;  1A2M A;  4G10 A;  1Z7R A;  1I5G A;  2B1K A;  4X0X A;  2B5Y A;  3KCM A;  3A5I A;  1TRV A;  5D8I A;  4G9H A;  4LL4 B;  4EVM A;  2X8C A;  4IP1 A;  3TKS A;  4O32 A;  2DJ2 A;  1QXH A;  3ZL5 A;  4WR5 A;  1PSQ A;  4D73 A;  4YQV A;  5KEJ A;  1ZZY A;  4Q5N A;  3GV1 A;  3RGB C;  4IVF A;  5J41 A;  3HVS A;  5F07 A;  4PX1 A;  3DYR A;  1ZMA A;  1JZO A;  1T4Y A;  4L0W A;  5HR0 A;  3CBU A;  1NM3 A;  5BRT A;  4BL7 B;  1EP7 A;  1R7H A;  1XIY A;  1V98 A;  2I81 A;  2FWF A;  4POL A;  1UN2 A;  5IMV A;  3ZRD A;  2C8U A;  3LYK A;  1YZX A;  3VI5 A;  2B7J A;  1F6M C;  3GKX A;  3BD2 A;  1O81 A;  1BG5 A;  3IHQ A;  2OA7 A;  3F4T A;  2VCZ A;  3EE2 A;  2O85 A;  1WMJ A;  4K8M A;  2GQM A;  3IE3 A;  1GH2 A;  4ZL7 A;  1BG1 A;  4MP4 A;  3FRC A;  4K7I A;  4G2E A;  4HU7 A;  3QPM A;  5E4W A;  2YNX A;  1HNB A;  2GLR A;  1JZD A;  2KLX A;  1UVZ A;  2V41 A;  1B4P A;  4Q5Q A;  2P5Q A;  3WGX A;  5G1L A;  3CRU A;  3TKS C;  1WPI A;  1ZOF A;  1F37 A;  1JZR A;  1ABA A;  1TP9 A;  1Z3E A;  3F3Q A;  5IPH A;  2LJA A;  2E7P A;  3V1W A;  4KB3 A;  5H5Q A;  2JZR A;  2JU5 A;  3FY7 A;  5J40 A;  1BQ7 A;  1E2Y A;  2QKE A;  1I1I P;  4LL1 B;  2KP1 A;  2ALB A;  3KD0 A;  1YF1 A;  4FYC A;  1PL1 A;  4USS A;  3LSZ A;  2HRK A;  1JHB A;  3A2W A;  1X0R A;  1FG4 A;  3HVX A;  2FCH A;  3FZ9 A;  2E0Q A;  4TN8 A;  19GS A;  1U3I A;  1MDJ A;  5ELA A;  2MMN A;  2MMZ A;  3KTL A;  1Z6M A;  4BVX B;  2C3Q A;  2YWI A;  2WB9 A;  4WF5 A;  5IIZ A;  3NIV A;  2EIQ A;  3GH9 A;  2H1L A;  1MD4 A;  3A5W A;  3IBH A;  5B6N A;  1XWC A;  3DML A;  2A2R A;  1A23 A;  1F3A A;  3P7X A;  4P3Y B;  2XC2 A;  1SKS B;  4MF6 A;  1PMT A;  2AYT A;  2H6Z A;  4AJ6 A;  4WET A;  3DVW A;  3CSH A;  1ERV A;  2EFH A;  3ZIV A;  4FO5 A;  4POB A;  4XS1 A;  3CXG A;  5F05 A;  4ZBA A;  4DSQ A;  4Z2T A;  1OC8 A;  3C8E A;  5JWO B;  1SVL A;  3RBT A;  2DJJ A;  1A24 A;  2BJX A;  5KN1 A;  1B9Y C;  1TI3 A;  3WT1 A;  1K3O A;  2HSY A;  1SJZ A;  4TRX A;  2WVX B;  1QFN A;  3O3T A;  4DVC A;  5IOX A;  2FWE A;  1SYR A;  2H0I A;  5AIS A;  4HQS A;  1J0F A;  4BIK A;  1F2E A;  3IDV A;  4ZB9 A;  1PKW A;  2N5B A;  18GS A;  5AIX A;  2HLS A;  1YQ1 A;  4X1U A;  1NHY A;  3WT2 A;  2GZY A;  1SJ6 A;  1XW6 A;  2TRX A;  5IMZ A;  5JWQ B;  1EV4 A;  4EKZ A;  4TXO B;  1SL0 B;  5FHI A;  2L4C A;  1M9B A;  2A4H A;  2PN8 A;  4EDZ A;  1OE7 A;  3QAV A;  3GHA A;  5DAL A;  1GTA A;  3IRA A;  5AGY A;  1GSU A;  4TOP A;  1WWJ A;  1ILO A;  3ZLP A;  4MCU A;  2FLS A;  4AJ7 A;  5B6M A;  3GH6 A;  4K7O A;  4QL7 A;  2V2G A;  3TKR A;  4HDE A;  1IYH A;  1Z6N A;  1BF5 A;  1XFL A;  6GSU A;  1BYE A;  3L9U A;  4OO4 A;  3ERG A;  3D21 A;  1GSD A;  1U3A A;  1GSS A;  2IMD A;  2O87 A;  2R0C A;  1V57 A;  2H74 A;  3GUS A;  3ED3 A;  1BAY A;  4G01 A;  2VIM A;  3GL5 A;  3LFL A;  3LGC A;  4Z7X A;  2HZE A;  3F9U A;  3QAG A;  3GFK A;  3MAK A;  5ECR B;  1OKD A;  4K0N A;  4OD7 A;  4CY8 A;  1M2A A;  2LKU A;  1G7O A;  4KND A;  3MIX A;  2IFQ B;  4HUA A;  4L8E A;  2M80 A;  4HZ4 A;  1GLQ A;  1M0U A;  2GVP A;  5INY A;  4IEL A;  3D4M A;  4MLY A;  1H75 A;  3TGZ A;  4OCE A;  1S4B P;  1V40 A;  2GST A;  4ECI A;  2K18 A;  1X9W B;  1ERW A;  1TU8 A;  4KE3 A;  3ZFL A;  4ACS A;  4BVY B;  1ZL9 A;  1ML6 A;  1WJK A;  2I1U A;  1PFO A;  5LNK e;  2P31 A;  2V32 A;  1XWA A;  4RQR A;  2DC5 A;  3DWV A;  2RUE A;  4JR6 A;  1YY7 A;  3VPQ A;  4KCA A;  3NZN A;  3GX0 A;  3JCM L;  1YDK A;  1HNA A;  2LNS A;  2ZNM A;  4MJB A;  2KHP A;  2C3N A;  1EP8 A;  3F4S A;  2H1G A;  4KDX A;  3C71 A;  3GX8 A;  3KTB A;  4XS6 A;  4MAB A;  1XW9 A;  2H1A A;  3VWV A;  3UVT A;  1KEB A;  4K2D A;  4V2M A;  3EVI A;  4F2I A;  1S3C A;  2EFE A;  2AHE A;  4CW9 A;  2HYX A;  3ME8 A;  1TXU A;  4EIP A;  1TTZ A;  4MK3 A;  1M3I A;  5IOW A;  4MJA A;  4AJ8 A;  3RFR C;  4N0Z A;  5ECS A;  2O89 A;  5A1N A;  2QA2 A;  4K5R A;  3RPP A;  4FXY P;  1YKC A;  2CA8 A;  1QUW A;  5HR3 A;  1GSE A;  1I9D A;  4ECB A;  1M2D A;  3EU4 A;  1THX A;  4Z2U A;  5ENU A;  2L57 A;  4F0B A;  1NHO A;  1X5D A;  2HI7 A;  2CZ3 A;  4WBJ A;  4MJE A;  4MZB A;  2H70 A;  3UVH A;  1U87 A;  5J3R A;  3EYT A;  1R4W A;  3Q18 A;  4WXT A;  1K0N A;  3D5J A;  4KCE A;  3TDG A;  2JAC A;  1O8W A;  1B9X C;  4GF0 A;  4N3Z A;  4PXO A;  3FMW A;  2H0H A;  1OC9 B;  3G7J A;  3QR6 A;  1X5C A;  2WCI A;  4WR4 A;  5A34 B;  3HA9 A;  4TR1 B;  1QK8 A;  2VCX A;  2EIR A;  3DIE A;  4PUF C;  2VKZ G;  1RW1 A;  5IQY A;  4IS0 A;  4WF4 A;  4EUY A;  2PBJ A;  3C73 A;  4LMW A;  2C0G A;  4MF5 A;  1TJD A;  3DGQ A;  3HCZ A;  1MD3 A;  2LS5 A;  5A4U A;  1T00 A;  2A2S A;  2KP2 A;  4MDC A;  5J9C A;  3LEF A;  2NPB A;  1ST9 A;  20GS A;  5G5E A;  3PH9 A;  1U6T A;  2AJQ B;  1SYX A;  4RI6 A;  3BOA A;  3HJM A;  2PPT A;  2GDR A;  3FHK A;  3TRQ A;  5DAK B;  3PR8 A;  2QC7 A;  4NV2 A;  2L5O A;  5J47 A;  4V2N A;  4ZIJ A;  2MBS A;  1FOH A;  4GQF A;  3BBY A;  6GST A;  2CVB A;  5ID2 A;  3WGD A;  3HJP A;  3IAM 2;  2I9H A;  4L5L A;  1XOA A;  2GT5 A;  2M72 A;  3IXR A;  4BL7 A;  2VO4 A;  4N30 A;  1O8X A;  4KSM A;  1YEX A;  4ICY A;  4FYB A;  2HE3 A;  4YKF A;  5G31 A;  3QFB C;  2FHE A;  3WD6 A;  2OE1 A;  2VL2 A;  5IMF A;  1AQV A;  4GST A;  2YN1 A;  3TKS E;  3DEX A;  1DUG A;  4ML1 A;  2B5X A;  2LUS A;  3HVN A;  3I9V 2;  2TRC P;  2OBI A;  4AKG A;  2IMI A;  2CVD A;  4EIQ A;  3QOU A;  2IL3 A;  1WP0 A;  4POM A;  3E9J B;  4MZW A;  5D9T A;  1CQH A;  4V1A p;  2HSM A;  3HKR A;  2FGX A;  3KH7 A;  3FYG A;  2RM6 A;  1A2L A;  1EGO A;  2WW2 A;  4EDY A;  2CT6 A;  4PUA A;  1XCC A;  2UV8 G;  2N5F A;  1SK0 A;  3P90 A;  1AQW A;  2VUP A;  2B6M A;  1NSW A;  1GP1 A;  2DJK A;  3E3E A;  2CVK A;  4DSS B;  2GZP A;  2K9F A;  4PQ1 A;  1C72 A;  2YV7 A;  3P8W A;  5CYY A;  1XVW A;  2KUC A;  3CHX C;  5GZZ B;  4JE1 A;  2GSR A;  1XG8 A;  1ZYN A;  2FWH A;  2H6X A;  2G2Q A;  3VWX A;  10GS A;  2DSA A;  2B3S A;  5HQP A;  4Z2R A;  3FR3 A;  4BVX A;  2CAI A;  3CTG A;  2K6V A;  1G6Y A;  3KM6 A;  1G0T A;  2O5V A;  3GN3 A;  2F8F A;  1XOB A;  1URM A;  1R5P A;  2YWO A;  3ZIJ A;  1T3B A;  4AGS A;  5H5S A;  3BJ5 A;  2HXK A;  3UOM A;  5D9V A;  4CHS A;  3FZA A;  3RDW A;  4TKY A;  1QMV A;  1GL8 A;  4KDU A; 
#chains in the Genus database with same CATH homology
 5AN1 A;  3L4N A;  4XRA A;  3L78 A;  3UMA A;  2V6K A;  3KZQ A;  3FZ4 A;  5LCZ A;  4HI7 A;  1CQG A;  1PRX A;  1X9S B;  4YKG A;  4ULX A;  5KOW A;  2HSN A;  2CX3 A;  1PX6 A;  4HJ2 A;  2H72 A;  2YJH A;  1JLW A;  4Q5F A;  2B1L A;  3R2Q A;  3EPT A;  12GS A;  4G0K A;  3GNJ A;  1RQM A;  2HQT A;  2VM2 A;  1GTU A;  4HQZ A;  3IR4 A;  5EL8 A;  2JZT A;  2L6D A;  5HFG A;  1TU7 A;  1K0D A;  3GA4 A;  5DJM A;  4KA0 A;  4RUV A;  2CV4 A;  4NV5 A;  1N8J A;  2WGR A;  2LNT A;  1LU4 A;  1Y6E A;  1S3D A;  3RPN A;  1DBY A;  1B48 A;  2RLI A;  2RM5 A;  4I5Q A;  3TCO A;  4ZXG A;  3TUE A;  1THO A;  2ON7 A;  2O7K A;  4NHW A;  1K0O A;  1ERU A;  3W8J A;  2CAQ A;  2H01 A;  3EU3 A;  3QCP A;  2LEG A;  4OMV A;  1AXD A;  5CRH A;  5CRD A;  2A4V A;  2H6Y A;  4WEY A;  1OAZ A;  1WE0 A;  3ZRE A;  2X8H A;  3C1R A;  1EOH A;  1XWK A;  4X43 A;  4I2U A;  3CWG A;  2CZ2 A;  5ECO B;  3BCK A;  4F0C A;  1PKZ A;  3APO A;  5GAN D;  2C0D A;  2PVO C;  1YEP A;  4DEJ A;  1GSQ A;  3D4T A;  1SKR B;  4J56 E;  4AF2 A;  5ECQ B;  4GWR A;  1J9B A;  2DJ0 A;  2I3Y A;  1EOG A;  2MYG A;  2JZS A;  1JFU A;  1A0R P;  1GSY A;  3EMX A;  3DXB A;  3PIN A;  2H71 A;  6GSV A;  2R37 A;  2VCV A;  1KTE A;  2E2M A;  3ISO A;  4ILF A;  2IPA A;  3NOF A;  3ZML A;  5A5H B;  4NAX A;  3H79 A;  5ECI B;  5A4W A;  2RII A;  2H75 A;  5E59 A;  3TRX A;  4O5R A;  2LRT A;  2P0G A;  3MWH A;  2A2P A;  2FA4 A;  4BVY A;  1AIU A;  3M9J A;  3UAP A;  4I6X A;  1GNE A;  1PA3 A;  1WRY A;  2VOC A;  1Q98 A;  5CNW A;  4KUN A;  1F9M A;  1R5A A;  3FKF A;  1PN0 A;  2ES7 A;  4XIH A;  1AAZ A;  4KSO A;  2YV9 A;  2FWG A;  4BWS A;  1O7U A;  1VF4 A;  2QA1 A;  2EFD A;  2YZH A;  3APS A;  5G5F A;  5LD0 A;  3QFA C;  4QMK A;  4ZB8 A;  3UL3 A;  2H66 A;  2F51 A;  1G6W A;  3F3R A;  4F9Z A;  1B8X A;  3UEM A;  2XBI A;  2OJL A;  2MBT A;  3HHV A;  5AIV A;  3FZ5 A;  2AB6 A;  5A5K A;  1SJI A;  1EWX A;  2RUF A;  3R3E A;  1OE8 A;  2MMO A;  3GTU B;  2LQQ A;  1UA5 A;  3O6T A;  4K0G A;  4PQI A;  3CRT A;  4EO3 A;  4ZBB A;  2H73 A;  5IO0 A;  4IGJ A;  4OFM A;  4AI6 A;  4G0L A;  2H0G A;  1U88 A;  2JSZ A;  5BMU B;  1AQX A;  4OFT A;  1PD2 1;  2DKI A;  4JRR A;  4MMM A;  1GUM A;  5F06 A;  2EIO A;  1EV9 A;  4IJI A;  4GRF A;  2IJY A;  1X9M B;  3WGE A;  4H86 A;  1K0C A;  4CDO A;  2DJ3 A;  3M8N A;  4L0U A;  4YH2 A;  4IJ3 A;  2YAN A;  3CSJ A;  3ZZX A;  4KH7 A;  2QSI A;  2R4V A;  3P2A A;  2G0F A;  3U6V A;  2GQL A;  2YZU A;  1ZGN A;  3O76 A;  1EEM A;  2V6O A;  1TK8 B;  2OT3 A;  1OC9 A;  2HZE B;  1NW2 A;  4ECJ A;  4JR4 A;  4POK A;  5A34 A;  1VF1 A;  4WKW A;  1K0A A;  3QAW A;  4TR1 A;  4J57 E;  3LXT A;  1XWB A;  2LST A;  3D0Z A;  2R6K A;  4I8B A;  2DKH A;  4BPY A;  2PU9 C;  1SVM A;  1SL2 B;  4KDY A;  2HNL A;  4BWQ A;  5DQY A;  4NWY A;  4LLR A;  4ZB6 A;  1Z9H A;  3QDN A;  1Q4J A;  4XS4 A;  3LG6 A;  3TOU A;  4Q5R A;  1ACV A;  5ELG A;  1F3B A;  3BCI A;  3ERF A;  2AUV A;  1A8L A;  1O6J A;  1W89 A;  3EC3 A;  3Q19 A;  2VLT A;  3F6D A;  3FW2 A;  1M99 A;  1GUL A;  5J4U A;  4HU9 A;  4ISD A;  4ZB7 A;  2F3M A;  3CMI A;  4BA7 A;  4O5Q A;  3TU3 B;  1A8Y A;  3Q6O A;  3J7Y b;  1LBK A;  3EMP A;  1MTC A;  2CQ9 A;  1EZK A;  2WJU A;  1XVQ A;  2YOI A;  3M0F A;  5ECK B;  2DIY A;  2PER A;  2I4A A;  3GL3 A;  5B7C A;  4XCS A;  2YWN A;  3TJB A;  1XWG A;  2E2G A;  3ZFB A;  4EL1 A;  5L71 A;  5ECH B;  4MZC A;  4PNF A;  2IME A;  1O73 A;  3MYD A;  5ABR A;  5DJL A;  4WBR D;  2IIY A;  4YAP A;  3GMF A;  1M7T A;  1H4O A;  1VF2 A;  2O8V B;  2PUK C;  4X4J A;  4IHU A;  3W6G A;  1JZW A;  3SWL A;  3UBK A;  2GTU A;  2K8V A;  1MEK A;  2HZF A;  5ECP B;  17GS A;  4G19 A;  2OAD A;  3L9V A;  3FR6 A;  3MNG A;  2PMT A;  1ZYE A;  3A2X A;  5A4V A;  2PVQ A;  2CX4 A;  4IBP A;  4E8H A;  2VAF A;  2NDO A;  1TDI A;  2NTO A;  4DSS A;  1T4Z A;  4FH8 A;  4GQC A;  4HZ2 A;  5C04 A;  1T1V A;  3K8N A;  3I69 A;  4I97 A;  4NHZ A;  3IAS 2;  3TKQ A;  4AKH A;  3DRN A;  2WRT A;  2FY6 A;  4PQH A;  3KXO A;  5D73 A;  1Y1U A;  4A5P A;  3A3T A;  3FR9 A;  4KX4 A;  4FYU A;  1B4Q A;  1ON4 A;  4HS1 A;  1Y25 A;  2YWM A;  3ZMK A;  4OO5 A;  2EFC A;  4IN0 A;  3IOS A;  1AC1 A;  3TJK A;  2FA8 A;  4RQX A;  1TK5 B;  2J9H A;  1EEJ A;  2OAC A;  2R5G A;  2H76 A;  3VWU A;  4GXZ A;  4MPG A;  4TVE A;  1PQN A;  2L4Q A;  4TR0 A;  1WOU A;  1DE2 A;  5CRE A;  5ECN B;  1ZYP A;  2GGT A;  3HVV A;  2WDU A;  1N2A A;  5J4Y A;  2VLV A;  2HRN A;  2C80 A;  2HRF A;  2F8A A;  7GSS A;  4GSS A;  2ZUP A;  3RHC A;  3EIN A;  4CY6 A;  3GSS A;  5EVO A;  3L0H A;  5ID2 B;  2C0F A;  2OKA A;  3FK8 A;  3W8S A;  1SEN A;  2VL2 C;  4J2F A;  1R26 A;  1Z7P A;  4DSR A;  3DVX A;  1T7P B;  2MZC A;  1K3L A;  3TOT A;  3F8U A;  2BMX A;  4ZL9 A;  3LW9 A;  3PPU A;  2HFD A;  9GSS A;  2REM A;  4K2X A;  5D96 A;  2X64 A;  1FOV A;  1M2B A;  3N9J A;  3IC8 A;  4FQU A;  1YKA A;  3US3 A;  3MDK A;  1GLP A;  5IPG A;  2DML A;  5JCW A;  3HMJ G;  4GTU A;  1M9A A;  2GSS A;  5CO3 A;  1A0F A;  3TJF A;  1IYI A;  2HSM B;  4D73 B;  2X4A A;  1J08 A;  3TJG A;  4F03 A;  4GLT A;  5DCH A;  1YJ6 A;  1OVN A;  3H4K A;  3KP8 A;  1E6B A;  3HJO A;  2F9S A;  2YP6 A;  1N25 A;  5KN3 A;  4O92 A;  5G30 A;  3LOR A;  6GSW A;  5KOX A;  3HZ8 A;  2IWT A;  4EXJ A;  1BX9 A;  1PN9 A;  1XZO A;  3LWA A;  5J9B A;  1PGT A;  3APQ A;  4KAE A;  4GSN A;  2ZCT A;  1MDK A;  2B7K A;  3LQ7 A;  4PTS A;  1PL2 A;  1BED A;  1QQ2 A;  3VK9 A;  4K1F A;  4YQU A;  2C0E A;  1HQO A;  2L59 A;  2R3X A;  1GNW A;  3IV4 A;  3MSZ A;  2QGV A;  1FW1 A;  4V1A g;  3TJJ A;  2ON5 A;  2HRA A;  2LRN A;  3RHB A;  3GYK A;  3TKP A;  1SK1 A;  1XPV A;  3DD3 A;  4TXO A;  4XRD A;  2VD0 A;  5GSS A;  2FUG 2;  1VGL A;  4HJM A;  3QD9 A;  4K5S A;  2L5L A;  1ZCP A;  1HD2 A;  1DSB A;  3H8Q A;  4KGI A;  4W66 A;  5IMC A;  2UZ8 A;  1FB0 A;  5IM9 A;  5A5H A;  2LQO A;  1AUC A;  2LJK A;  2X8G A;  5C00 A;  5FWG A;  1X5E A;  3ZYW A;  1HYU A;  4AKI A;  3ERW A;  1O85 A;  1GWC A;  2IMF A;  2HSN B;  1VRS D;  2DLX A;  5F0G A;  2VM1 A;  2JL4 A;  2HRK B;  5D9W A;  5GST A;  3VI7 A;  2NBS A;  5HFI A;  1VF3 A;  3F6F A;  2VL3 A;  1HNC A;  3VPT A;  3OR5 A;  2XPD A;  1SKW B;  3ZIT A;  4G0I A;  2YJ7 A;  2AV4 A;  2K8S A;  5HFK A;  3UJ1 A;  2N5A A;  3G9B A;  4ECC A;  2IMK A;  3IA1 A;  5GAP D;  1XW5 A;  4OCF A;  2VCW A;  2P5R A;  3CTF A;  2OBK A;  2GZZ A;  4I2T A;  4ML6 A;  1K0M A;  1TRU A;  3GKN A;  2WZ9 A;  2J23 A;  2PGT A;  2IFQ A;  2FNO A;  2H1B A;  1SU9 A;  1FVK A;  4LMV A;  3GTU A;  2WFC A;  2YPM A;  3IK9 A;  4JZQ A;  4NMU A;  5DQS A;  14GS A;  1FO5 A;  2IN3 A;  4QL9 A;  2EC4 A;  3M9K A;  5BMU A;  3DKS A;  5KN0 A;  4ZBD A;  3GKM A;  3F0I A;  4TW5 A;  4YAV A;  4MNN A;  2Z9S A;  3KEB A;  4IQA A;  4KW6 A;  1WIK A;  2R0G A;  1S3A A;  2XBQ A;  3I43 A;  2OE0 A;  5H5R A;  3ME7 A;  3AY8 A;  4TR3 A;  3VLN A;  1OYJ A;  3IK7 A;  1V2A A;  4EE0 A;  3HZ4 A;  2DJ1 A;  5EY6 A;  4OFN A;  5DCG A;  5B8B A;  4GDF A;  2V1M A;  1T8E B;  3TB2 A;  1TI1 A;  4MH3 A;  4QQ7 A;  2XPE A;  3H1N A;  3E0U A;  5J5N A;  5KN2 A;  5J4V A;  4EC0 A;  1V58 A;  3I6A A;  3U5R E;  8GSS A;  3FEU A;  1TKD B;  3D22 A;  3A2V A;  5CRG A;  3HDC A;  3VUR A;  1FAA A;  1USB A;  1GUK A;  5CRW A;  1V9W A;  1OKT A;  4L5O A;  4JBB A;  13GS A;  3KGK A;  3GKK A;  3KIJ A;  4IKH A;  5JCG A;  5DAL B;  4LA1 A;  2VD1 A;  2DIZ A;  3SBC A;  2VLU A;  5G1K A;  3F4R A;  3GUR A;  6GSS A;  3LYP A;  2H19 A;  3WYW A;  2FD3 A;  1SL1 B;  1KNG A;  6GSX A;  1DE1 A;  3EUR A;  3VFI A;  1GTI A;  3GRX A;  1KBN A;  1BJX A;  3F63 A;  4XTS A;  5ECM B;  3IC4 A;  1AW9 A;  4E68 A;  3KJY A;  2GS3 A;  3IHG A;  1GSF A;  4IQ1 A;  4K6X A;  2H30 A;  2X99 A;  1UC7 A;  5DDL A;  1FHE A;  2C3T A;  1G7E A;  3KMN A;  3TRP A;  5JCU A;  5B8A A;  1JLV A;  4AKX B;  3S9F A;  1SVO A;  3RAZ A;  2KOK A;  4JU5 A;  1K0B A;  4IW9 A;  2HT9 A;  4O7H A;  5HR1 A;  11GS A;  5EPF A;  2GSQ A;  4TR4 A;  3VWW A;  1ERT A;  2WS2 A;  2GT6 A;  2H8L A;  2VL9 A;  3CSI A;  3HY2 A;  1TK0 B;  4EF0 A;  1YF0 A;  3H93 A;  5IMD A;  5IO2 A;  6GSY A;  2D2Z A;  2VCQ A;  22GS A;  2OE3 A;  5G2Z A;  4XHM A;  3D6I A;  3PGT A;  2C4J A;  4MF7 A;  1TRW A;  4V2L A;  4N11 A;  4HEA 2;  5HR2 A;  3HYP A;  2LJR A;  1GRX A;  1Z5Y E;  1FVJ A;  2BTO T;  5DAK A;  2C1Y A;  2R2J A;  5DBQ A;  4F82 A;  5DVB A;  3L9S A;  1A2J A;  2XHF A;  2B5E A;  2GQK A;  2M46 A;  3KP9 A;  4K9Z A;  4PUR A;  1TW9 A;  2WUL A;  5JWR B;  4N0V A;  3ZVJ A;  1QGV A;  1SK2 A;  16GS A;  4PGT A;  1TXX A;  4K7N A;  2LV3 A;  3EWL A;  4TXV A;  1TRS A;  3IPZ A;  4O5U A;  1LJR A;  2L6C A;  2DBC A;  1K3Y A;  2R0P A;  1TOF A;  2MMA A;  3GIX A;  4KF9 A;  1MDI A;  4N10 A;  1FB6 A;  3UIW A;  4YQM A;  3ZTL A;  4JED A;  4MA9 A;  4ZIL A;  4MJC A;  3Q74 A;  5F8B A;  4E8E A;  3GST A;  3LXZ A;  5D9X A;  1XXU A;  3G7I A;  5FT3 A;  5A1N B;  5CP1 A;  1YVL A;  4NXI A;  5D93 A;  4GCI A;  2H1D A;  2HSH A;  5IMA A;  4XS4 B;  4OWY A;  2LRC A;  2VCT A;  4ZL8 A;  2DMM A;  5COH A;  2JSY A;  1XBS A;  2TIR A;  4FIW A;  1W4V A;  3QMX A;  4RI7 A;  3LJR A;  2YCD A;  1SD8 A;  3G7Y A;  2LTK A;  3C7M A;  3HD5 A;  4MH2 A;  3C1S A;  5ECL B;  4IP6 A;  2AAW A;  3KMO A;  1PX7 A;  4MPF A;  1EGR A;  3UAR A;  3N5O A;  4PNG A;  1OC3 A;  3M1G A;  3J7Y k;  3M3M A;  3UBL A;  2JAD A;  3KH9 A;  1GTB A;  2NVL A;  2X49 A;  4HOJ A;  4NPB A;  5CAX A;  1ZYQ B;  2PWJ A;  1GUH A;  4ID0 A;  1RK4 A;  3ZVJ D;  3HXS A;  1SD9 A;  3CYN A;  1A2M A;  4G10 A;  1Z7R A;  1I5G A;  2B1K A;  4X0X A;  2B5Y A;  3KCM A;  3A5I A;  1TRV A;  5D8I A;  4G9H A;  4LL4 B;  4EVM A;  2X8C A;  4IP1 A;  3TKS A;  4O32 A;  2DJ2 A;  1QXH A;  3ZL5 A;  4WR5 A;  1PSQ A;  4D73 A;  4YQV A;  5KEJ A;  1ZZY A;  4Q5N A;  3GV1 A;  4IVF A;  5J41 A;  3HVS A;  5F07 A;  4PX1 A;  3DYR A;  1ZMA A;  1JZO A;  1T4Y A;  4L0W A;  5HR0 A;  3CBU A;  1NM3 A;  5BRT A;  4BL7 B;  1EP7 A;  1R7H A;  1XIY A;  1V98 A;  2I81 A;  2FWF A;  4POL A;  1UN2 A;  5IMV A;  3ZRD A;  2C8U A;  3LYK A;  1YZX A;  3VI5 A;  2B7J A;  1F6M C;  3GKX A;  3BD2 A;  1O81 A;  1BG5 A;  3IHQ A;  2OA7 A;  3F4T A;  2VCZ A;  3EE2 A;  2O85 A;  1WMJ A;  4K8M A;  2GQM A;  3IE3 A;  1GH2 A;  4ZL7 A;  1BG1 A;  4MP4 A;  3FRC A;  4K7I A;  4G2E A;  4HU7 A;  3QPM A;  5E4W A;  2YNX A;  1HNB A;  2GLR A;  1JZD A;  2KLX A;  1UVZ A;  2V41 A;  1B4P A;  4Q5Q A;  2P5Q A;  3WGX A;  5G1L A;  3CRU A;  3TKS C;  1WPI A;  1ZOF A;  1F37 A;  1JZR A;  1ABA A;  1TP9 A;  1Z3E A;  3F3Q A;  5IPH A;  2LJA A;  2E7P A;  3V1W A;  4KB3 A;  5H5Q A;  2JZR A;  2JU5 A;  3FY7 A;  5J40 A;  1BQ7 A;  1E2Y A;  2QKE A;  4LL1 B;  2KP1 A;  2ALB A;  3KD0 A;  1YF1 A;  4FYC A;  1PL1 A;  4USS A;  3LSZ A;  2HRK A;  1JHB A;  3A2W A;  1X0R A;  1FG4 A;  3HVX A;  2FCH A;  3FZ9 A;  2E0Q A;  4TN8 A;  19GS A;  1U3I A;  1MDJ A;  5ELA A;  2MMN A;  2MMZ A;  3KTL A;  1Z6M A;  4BVX B;  2C3Q A;  2YWI A;  2WB9 A;  4WF5 A;  5IIZ A;  3NIV A;  2EIQ A;  3GH9 A;  2H1L A;  1MD4 A;  3A5W A;  3IBH A;  5B6N A;  1XWC A;  3DML A;  2A2R A;  1A23 A;  1F3A A;  3P7X A;  4P3Y B;  2XC2 A;  1SKS B;  4MF6 A;  1PMT A;  2AYT A;  2H6Z A;  4AJ6 A;  4WET A;  3DVW A;  3CSH A;  1ERV A;  2EFH A;  3ZIV A;  4FO5 A;  4POB A;  4XS1 A;  3CXG A;  5F05 A;  4ZBA A;  4DSQ A;  4Z2T A;  1OC8 A;  3C8E A;  5JWO B;  1SVL A;  3RBT A;  2DJJ A;  1A24 A;  2BJX A;  5KN1 A;  1B9Y C;  1TI3 A;  3WT1 A;  1K3O A;  2HSY A;  1SJZ A;  4TRX A;  1QFN A;  3O3T A;  4DVC A;  5IOX A;  2FWE A;  1SYR A;  2H0I A;  5AIS A;  4HQS A;  1J0F A;  1F2E A;  3IDV A;  4ZB9 A;  1PKW A;  2N5B A;  18GS A;  5AIX A;  2HLS A;  1YQ1 A;  4X1U A;  1NHY A;  3WT2 A;  2GZY A;  1SJ6 A;  1XW6 A;  2TRX A;  5IMZ A;  5JWQ B;  1EV4 A;  4EKZ A;  4TXO B;  1SL0 B;  5FHI A;  2L4C A;  1M9B A;  2A4H A;  2PN8 A;  4EDZ A;  1OE7 A;  3QAV A;  3GHA A;  5DAL A;  1GTA A;  3IRA A;  5AGY A;  1GSU A;  4TOP A;  1WWJ A;  1ILO A;  3ZLP A;  4MCU A;  2FLS A;  4AJ7 A;  5B6M A;  3GH6 A;  4K7O A;  4QL7 A;  2V2G A;  3TKR A;  4HDE A;  1IYH A;  1Z6N A;  1BF5 A;  1XFL A;  6GSU A;  1BYE A;  3L9U A;  4OO4 A;  3ERG A;  3D21 A;  1GSD A;  1U3A A;  1GSS A;  2IMD A;  2O87 A;  2R0C A;  1V57 A;  2H74 A;  3GUS A;  3ED3 A;  1BAY A;  4G01 A;  2VIM A;  3GL5 A;  3LFL A;  3LGC A;  4Z7X A;  2HZE A;  3F9U A;  3QAG A;  3GFK A;  3MAK A;  5ECR B;  1OKD A;  4K0N A;  4OD7 A;  4CY8 A;  1M2A A;  2LKU A;  1G7O A;  4KND A;  3MIX A;  2IFQ B;  4HUA A;  4L8E A;  2M80 A;  4HZ4 A;  1GLQ A;  1M0U A;  2GVP A;  5INY A;  4IEL A;  3D4M A;  4MLY A;  1H75 A;  3TGZ A;  4OCE A;  1V40 A;  2GST A;  4ECI A;  2K18 A;  1X9W B;  1ERW A;  1TU8 A;  4KE3 A;  3ZFL A;  4ACS A;  4BVY B;  1ZL9 A;  1ML6 A;  1WJK A;  2I1U A;  5LNK e;  2P31 A;  2V32 A;  1XWA A;  4RQR A;  2DC5 A;  3DWV A;  2RUE A;  4JR6 A;  1YY7 A;  3VPQ A;  4KCA A;  3NZN A;  3GX0 A;  3JCM L;  1YDK A;  1HNA A;  2LNS A;  2ZNM A;  4MJB A;  2KHP A;  2C3N A;  1EP8 A;  3F4S A;  2H1G A;  4KDX A;  3C71 A;  3GX8 A;  3KTB A;  4XS6 A;  4MAB A;  1XW9 A;  2H1A A;  3VWV A;  3UVT A;  1KEB A;  4K2D A;  4V2M A;  3EVI A;  4F2I A;  1S3C A;  2EFE A;  2AHE A;  4CW9 A;  2HYX A;  3ME8 A;  1TXU A;  4EIP A;  1TTZ A;  4MK3 A;  5IOW A;  4MJA A;  4AJ8 A;  4N0Z A;  5ECS A;  2O89 A;  5A1N A;  2QA2 A;  4K5R A;  3RPP A;  1YKC A;  2CA8 A;  1QUW A;  5HR3 A;  1GSE A;  1I9D A;  4ECB A;  1M2D A;  3EU4 A;  1THX A;  4Z2U A;  5ENU A;  2L57 A;  4F0B A;  1NHO A;  1X5D A;  2HI7 A;  2CZ3 A;  4WBJ A;  4MJE A;  4MZB A;  2H70 A;  3UVH A;  1U87 A;  5J3R A;  3EYT A;  1R4W A;  3Q18 A;  4WXT A;  1K0N A;  3D5J A;  4KCE A;  3TDG A;  2JAC A;  1O8W A;  1B9X C;  4GF0 A;  4N3Z A;  4PXO A;  3FMW A;  2H0H A;  1OC9 B;  3G7J A;  3QR6 A;  1X5C A;  2WCI A;  4WR4 A;  5A34 B;  3HA9 A;  4TR1 B;  1QK8 A;  2VCX A;  2EIR A;  3DIE A;  4PUF C;  2VKZ G;  1RW1 A;  5IQY A;  4IS0 A;  4WF4 A;  4EUY A;  2PBJ A;  3C73 A;  4LMW A;  2C0G A;  4MF5 A;  1TJD A;  3DGQ A;  3HCZ A;  1MD3 A;  2LS5 A;  5A4U A;  1T00 A;  2A2S A;  2KP2 A;  4MDC A;  5J9C A;  3LEF A;  2NPB A;  1ST9 A;  20GS A;  5G5E A;  3PH9 A;  1U6T A;  2AJQ B;  1SYX A;  4RI6 A;  3BOA A;  3HJM A;  2PPT A;  2GDR A;  3FHK A;  3TRQ A;  5DAK B;  3PR8 A;  2QC7 A;  4NV2 A;  2L5O A;  5J47 A;  4V2N A;  4ZIJ A;  2MBS A;  1FOH A;  4GQF A;  3BBY A;  6GST A;  2CVB A;  5ID2 A;  3WGD A;  3HJP A;  3IAM 2;  2I9H A;  4L5L A;  1XOA A;  2GT5 A;  2M72 A;  3IXR A;  4BL7 A;  2VO4 A;  4N30 A;  1O8X A;  4KSM A;  1YEX A;  4ICY A;  4FYB A;  2HE3 A;  4YKF A;  5G31 A;  3QFB C;  2FHE A;  3WD6 A;  2OE1 A;  2VL2 A;  5IMF A;  1AQV A;  4GST A;  2YN1 A;  3TKS E;  3DEX A;  1DUG A;  4ML1 A;  2B5X A;  2LUS A;  3I9V 2;  2TRC P;  2OBI A;  4AKG A;  2IMI A;  2CVD A;  4EIQ A;  3QOU A;  2IL3 A;  1WP0 A;  4POM A;  3E9J B;  4MZW A;  5D9T A;  1CQH A;  4V1A p;  2HSM A;  3HKR A;  2FGX A;  3KH7 A;  3FYG A;  2RM6 A;  1A2L A;  1EGO A;  4EDY A;  2CT6 A;  4PUA A;  1XCC A;  2UV8 G;  2N5F A;  1SK0 A;  3P90 A;  1AQW A;  2VUP A;  2B6M A;  1NSW A;  1GP1 A;  2DJK A;  3E3E A;  2CVK A;  4DSS B;  2GZP A;  2K9F A;  4PQ1 A;  1C72 A;  2YV7 A;  3P8W A;  5CYY A;  1XVW A;  2KUC A;  5GZZ B;  4JE1 A;  2GSR A;  1ZYN A;  2FWH A;  2H6X A;  2G2Q A;  3VWX A;  10GS A;  2DSA A;  2B3S A;  5HQP A;  4Z2R A;  3FR3 A;  4BVX A;  2CAI A;  3CTG A;  2K6V A;  1G6Y A;  3KM6 A;  1G0T A;  2O5V A;  3GN3 A;  2F8F A;  1XOB A;  1URM A;  1R5P A;  2YWO A;  3ZIJ A;  1T3B A;  4AGS A;  5H5S A;  3BJ5 A;  2HXK A;  3UOM A;  5D9V A;  4CHS A;  3FZA A;  3RDW A;  4TKY A;  1QMV A;  1GL8 A;  4KDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...