2C3QA

Human glutathione-s-transferase t1-1 w234r mutant, complex with s- hexylglutathione
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
239
structure length
239
Chain Sequence
GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPRVLAMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE THETA 1
publication title Structural Basis of the Suppressed Catalytic Activity of Wild-Type Human Glutathione Transferase T1-1 Compared to its W234R Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c3qA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c3qA01
4I8BA 4K9ZA 3F9UA 3ZITA 3W6GA 4KA0A 5E4WA 3IXRA 4PUFC 1A2JA 2H8LA 1X5CA 1MD3A 1BX9A 1B9XC 2H0GA 3RHCA 2HRKA 2YP6A 5B8BA 2VCVA 1M7TA 3TJJA 2MYGA 4RUVA 3P90A 2O89A 1EP8A 4PNFA 4HZ4A 1HD2A 2H76A 2C1YA 3FHKA 2OADA 4XRDA 1XW9A 4GRFA 16GSA 1TI1A 4XIHA 5IOWA 4L5LA 5D73A 3BJ5A 1O81A 2FY6A 4G19A 3IE3A 5LD0A 4MPFA 14GSA 4E8EA 1NW2A 2L4CA 2LEGA 5IQYA 3HY2A 4OO4A 2KLXA 1YY7A 2DC5A 1WOUA 3FZ4A 2R2JA 3EU4A 4LL4B 3UAPA 3IA1A 4KNDA 5BMUA 3F3QA 3US3A 3HA9A 2V1MA 3DXBA 5GAPD 3APSA 3CSIA 2YJHA 3WGEA 3ZMLA 1YKCA 1J08A 2E2GA 1SKSB 3LEFA 1NHOA 2H6ZA 1U87A 4ZBAA 4CW9A 5AN1A 2OE1A 4KSMA 1TOFA 4KGIA 3GH9A 2OKAA 3DKSA 1B4QA 4MZCA 4L5OA 5KN1A 1WP0A 2GSRA 2H72A 2L5LA 2MBTA 1K3LA 2B5YA 4MF6A 4TXVA 2FCHA 4MPGA 2H73A 4N0ZA 3DVWA 4BVXA 3TCOA 1URMA 1BYEA 1Z5YE 1SKRB 2C3TA 1G6YA 1XVWA 4WBRD 4ZIJA 5ECKB 3EVIA 5H5QA 2WS2A 4XS4B 6GSTA 1EZKA 3VPTA 1EEJA 2B1KA 1XPVA 2WRTA 4TR1A 1DSBA 5DAKB 1Z3EA 1TW9A 3GN3A 1YEPA 3MWHA 4BVYB 3H93A 2LTKA 3U6VA 4WETA 2LRNA 4HDEA 4BWQA 1PRXA 4HU9A 2CX4A 1E2YA 4HJ2A 1ZYQB 2X8CA 1WMJA 1Z9HA 2PMTA 5IO0A 3RAZA 3UOMA 2B1LA 1T1VA 4EDYA 5CAXA 4ZB6A 5ELGA 1B48A 1V2AA 1TP9A 3GH6A 1O73A 2YANA 1BQ7A 4AJ6A 4I2TA 4V1Ag 3HD5A 3E0UA 3MDKA 1PGTA 5COHA 2DMMA 2OBKA 5CRHA 2WZ9A 2I3YA 1ML6A 1AUCA 2CVKA 4EC0A 1N8JA 1VF2A 3GL3A 3QMXA 4RI7A 4F82A 5HR1A 3C7MA 1R7HA 5G31A 4N30A 11GSA 4EDZA 3L4NA 1W89A 2ZCTA 1F3BA 1S3DA 4KDYA 4TR3A 4V2MA 1A8LA 1SK2A 4DVCA 2Z9SA 1IYIA 3CRTA 4JRRA 6GSVA 4MCUA 2P0GA 4LL1B 5ECIB 4IW9A 4ZL7A 1RK4A 4L8EA 3M3MA 1IYHA 2DJ0A 3TKSA 3GL5A 2GT6A 3VURA 4IJ3A 3P8WA 2K8SA 2VLTA 1V40A 3E3EA 4I2UA 3ZVJD 2HRKB 1XZOA 2IL3A 4PX1A 3D6IA 3H4KA 2C0EA 5EVOA 4ZBBA 1FG4A 3KP9A 2H71A 3VK9A 4DEJA 1M9BA 1J0FA 1OC8A 3GSTA 2L6CA 1GLPA 3CSHA 2OE0A 2IMEA 2VL2A 1BAYA 1M2BA 5A5KA 3ZTLA 4EKZA 5H5RA 1AQVA 2BMXA 5KEJA 1ERVA 3VWVA 6GSSA 2C0FA 2MMOA 1GUKA 5EPFA 4F0CA 2I9HA 1XWCA 4MH2A 2K8VA 3PR8A 3GTUA 1M9AA 3HZ4A 2GVPA 1WJKA 1B8XA 5HFKA 1OC9A 3F8UA 1FVKA 2DMLA 4OD7A 3DGQA 3Q19A 3TGZA 1JZOA 1GLQA 4ECCA 3HKRA 3CXGA 3C73A 2VCZA 2OACA 4IJIA 1SD8A 3DYRA 2RUFA 5ECLB 2B7JA 4TR0A 5CRDA 4MJBA 2C80A 3QFAC 1GSSA 1TDIA 3HVXA 1A0FA 4NHZA 2VM1A 1XFLA 4PQIA 5DBQA 2IWTA 2N5AA 4PQHA 1OKTA 4GSSA 1VF1A 2LQOA 3K8NA 20GSA 1R5PA 1TRVA 3WD6A 3FEUA 2FUG2 3OR5A 1ILOA 6GSXA 1ON4A 1PN9A 3O6TA 2N5BA 4BVXB 2HSMA 1BJXA 5HR2A 5ECRB 2RUEA 3M9JA 2X8GA 1QFNA 1A8YA 4F0BA 3C8EA 1JZRA 3KCMA 2QC7A 3L9SA 3F4RA 2UZ8A 1MDKA 2DJKA 4KSOA 5ECMB 4AGSA 4TR1B 4GLTA 4EE0A 4HOJA 4K2DA 3O3TA 2VD1A 3FW2A 1AXDA 2LRCA 1A2LA 2O85A 3GV1A 5JCGA 3D21A 3NOFA 2OJLA 18GSA 3GYKA 3I43A 4WBJA 4O32A 1JLVA 1M99A 3M9KA 2V32A 1TKDB 3F0IA 1H75A 5C04A 5F06A 3RBTA 3QAGA 4MZBA 4O92A 1B9YC 2MZCA 4FH8A 1CQHA 2ALBA 5CNWA 2VL9A 2M46A 3TJBA 2IN3A 3AY8A 2KOKA 4MH3A 2YWIA 4KH7A 3KEBA 5DQSA 1XOBA 1SL1B 3EMXA 2WCIA 3WT2A 1THOA 3M1GA 1ZMAA 4V1Ap 5ABRA 3SWLA 4TR4A 4Q5QA 1K0MA 1U3IA 1XXUA 5D96A 3DWVA 3FRCA 1GSEA 4HS1A 3RDWA 2NDOA 4IKHA 5IMVA 3IV4A 4YAVA 3CTFA 1XVQA 2H0HA 2TRXA 3TKRA 7GSSA 3J7Yk 1LBKA 4XS1A 5ECHB 2DJ2A 1GL8A 1Y6EA 3ME7A 2VO4A 1PSQA 3VWWA 1XCCA 2L4QA 2VOCA 3EURA 1I9DA 5LNKe 4GXZA 3HVVA 1FHEA 5IMFA 3GSSA 1YZXA 3R2QA 1U88A 5DCGA 1PA3A 1HNAA 4NV5A 1J9BA 2H1BA 3ERWA 4GQFA 2C0GA 2HZEB 1FOVA 1G6WA 1ST9A 1SKWB 5A4UA 4ZXGA 3CSJA 3FR6A 2YWOA 4PTSA 4POKA 4NMUA 1PX7A 4TKYA 2FA8A 2KP1A 4ML6A 3O76A 3GKMA 3L78A 4ILFA 3KTLA 19GSA 3GFKA 3Q6OA 2VAFA 4AJ7A 1ABAA 3EYTA 2PVQA 4OMVA 4ML1A 3QCPA 1GRXA 2LRTA 3GUSA 2H6XA 3A2XA 5D9WA 2ON5A 4KX4A 17GSA 2IMDA 3GURA 5AISA 1LJRA 3GRXA 4DSSA 4F03A 1TJDA 4J57E 4HI7A 1XIYA 2B5EA 2EIQA 1UA5A 5EL8A 3D4TA 5G30A 2HNLA 1QGVA 4YQVA 3UBKA 3TRQA 4E8HA 3ZMKA 1X5EA 5D9VA 5G2ZA 4KW6A 1SYRA 2IJYA 4G2EA 3EE2A 1EWXA 4NWYA 1FVJA 1HYUA 5IM9A 5J3RA 3LWAA 4EF0A 4PGTA 4EXJA 3LYKA 1B4PA 3LORA 5HFGA 5IMDA 4KDUA 4FO5A 2FGXA 2GQLA 1GNWA 1RW1A 4MA9A 3VI5A 3C71A 3PINA 5DJLA 2HSMB 2ZUPA 3ZL5A 4PURA 5LCZA 3FZ5A 3W8SA 1UC7A 4LMVA 1TRSA 1N2AA 1ERUA 1JZDA 2KP2A 4K0GA 1MDIA 2IMKA 2E7PA 5A4WA 1HQOA 1GTUA 5ECQB 4GTUA 2VIMA 5DVBA 2K18A 3PH9A 3VI7A 1O7UA 5HQPA 3FKFA 2YN1A 2IMFA 3RHBA 2CA8A 4HU7A 3I69A 2CT6A 2GSSA 4K7OA 1R5AA 3ERFA 4HZ2A 4OCFA 3QAWA 4WF4A 1SYXA 2RIIA 3A2VA 1EP7A 3DMLA 2F9SA 1K0BA 3IHQA 4HEA2 2KHPA 1X9WB 2DSAA 2H66A 1JHBA 5AGYA 3ZFBA 4JU5A 4K8MA 4IBPA 3F6DA 1NM3A 2DIYA 3G7YA 1YJ6A 5DCHA 1KNGA 3HZ8A 2XHFA 1G7EA 2K9FA 1MTCA 1S3CA 3KMOA 2V6OA 1K0CA 4POLA 2R5GA 4XRAA 3RPNA 2XPEA 1OE7A 2M80A 1FB0A 5IMCA 1V98A 1U6TA 2CVBA 2X8HA 4FYCA 5IPGA 1F2EA 3MAKA 5DJMA 4PNGA 3F4SA 3ZRDA 2LNTA 4EL1A 3ZREA 4J2FA 1TU8A 5F0GA 2C4JA 4DSQA 2QKEA 2YPMA 3P7XA 2VCTA 5JCUA 4KCEA 2GDRA 1K0OA 12GSA 1T4YA 2LSTA 3EC3A 5ECOB 4WEYA 4ZBDA 4ULXA 2X64A 5IMAA 2XC2A 2HRFA 4GSTA 4NHWA 1ZOFA 1U3AA 4KAEA 4RQRA 2L6DA 1MEKA 3PGTA 1XOAA 4IP6A 3SBCA 5JWQB 1ZYEA 2ON7A 4TVEA 3ZVJA 3QPMA 5J9BA 2GSQA 1K0AA 5HR0A 3TJKA 4POMA 2PERA 2PPTA 2FWHA 13GSA 2I1UA 1X0RA 1GSUA 2G0FA 4N10A 2LV3A 3A3TA 2LJAA 4XHMA 1TK5B 4L0UA 3A2WA 2HI7A 4ZILA 1I5GA 3KIJA 1F6MC 2YWMA 3UARA 3D22A 2EIOA 3KGKA 2VCXA 6GSWA 4IQAA 4K7IA 3L9UA 2I4AA 3TUEA 4WKWA 2HQTA 5A4VA 2N5FA 5B7CA 4D73A 2AHEA 4BA7A 3HHVA 5FHIA 2AAWA 2WB9A 3H8QA 5ID2A 1UVZA 2YOIA 2HT9A 2MMNA 4BL7A 4AJ8A 4J56E 2LKUA 1ERWA 5J9CA 2M72A 5IPHA 4RQXA 3IAM2 4TN8A 5CYYA 2VD0A 2XBIA 4NXIA 4CDOA 4OFMA 4USSA 3G7IA 4YH2A 4HQSA 2JSZA 3KXOA 2HLSA 3LJRA 5AIVA 2DJ3A 4N0VA 5ECPB 3EU3A 2FWGA 2YZUA 3GX8A 2RM5A 5CP1A 1SK1A 3APOA 1X5DA 4O5RA 1PKZA 2AJQB 5IMZA 4I5QA 4YQMA 4NPBA 3NIVA 1K3YA 2FA4A 1HNBA 5G1KA 2JZRA 4IP1A 3UL3A 2VLVA 2GZZA 3N5OA 4AF2A 1JZWA 3IRAA 2CV4A 1H4OA 1S3AA 4KF9A 1XWAA 3KZQA 2H74A 2CVDA 2R4VA 1JLWA 5IO2A 3KMNA 2A2RA 1K3OA 4GF0A 4F2IA 2J9HA 3U5RE 3QD9A 3TJFA 3WT1A 3FK8A 1F37A 4MJCA 4TW5A 1G7OA 1A2MA 4IGJA 2PUKC 1OC3A 4MZWA 1SJIA 4ID0A 1FO5A 3F3RA 2GQKA 5FT3A 3IOSA 2IFQA 3Q74A 2VL3A 3UEMA 2CAQA 2GLRA 4GCIA 4JR4A 2AV4A 3QR6A 4XS4A 4BWSA 2MMAA 3UJ1A 4BPYA 4PQ1A 4ZL9A 3LG6A 3W8JA 1M2DA 1QXHA 5ECNB 3QFBC 2VUPA 3WGDA 3BCKA 4HUAA 4G9HA 4QL7A 4FIWA 2DJ1A 4L0WA 1A24A 4EO3A 3FR9A 1AC1A 3IAS2 1EGOA 3HVSA 1SD9A 2H1GA 3M8NA 1OVNA 2B6MA 2FHEA 4O7HA 4ECIA 2J23A 2EC4A 3KH9A 1SL2B 2D2ZA 6GSYA 2YWNA 2VLUA 1XWBA 1SU9A 4MDCA 2H01A 2LQQA 4OFNA 4IQ1A 2WDUA 3TOUA 4K7NA 1Z7RA 4Q5NA 3LQ7A 3HXSA 3KH7A 1TTZA 5J5NA 4YQUA 3CBUA 1G0TA 4TOPA 3VLNA 4WR4A 2NBSA 1GSYA 2YV9A 2H1DA 3H1NA 2QGVA 2WJUA 3M0FA 1A0RP 1OKDA 3I9V2 4ZL8A 2FD3A 2GZPA 5FWGA 2GQMA 4ZB9A 2B5XA 4DSRA 1OAZA 1O8XA 5KN2A 1THXA 2O87A 2CZ3A 3KJYA 4FQUA 4MLYA 3J7Yb 4Q5RA 4KCAA 2F8AA 5GSTA 3TDGA 3HJPA 2L59A 4Q5FA 3ISOA 2F51A 3TRPA 2C0DA 4YAPA 5D8IA 3I6AA 1UN2A 2HSNB 3A5WA 3GTUB 3TOTA 5CO3A 4D73B 1OC9B 5ID2B 2JSYA 5J4UA 4OCEA 3BOAA 2WULA 1GP1A 4XTSA 2HFDA 2K6VA 3LXTA 1R4WA 1O8WA 1Q98A 2V6KA 3L0HA 4BL7B 2HZFA 3VWUA 1PKWA 3RPPA 2CX3A 5L71A 1GTAA 2I81A 3FZ9A 1SJZA 1T3BA 4NV2A 5INYA 1T7PB 2P5QA 4JBBA 4KB3A 2IMIA 2DLXA 5D93A 5F07A 3MSZA 5F8BA 1GSDA 2YCDA 2HXKA 3V1WA 3TJGA 1SK0A 3F6FA 2C3QA 3GNJA 1TXXA 2IPAA 1WWJA 1PL1A 1ZGNA 3IDVA 2E0QA 4FYUA 1YF1A 1K0NA 1NHYA 3IC4A 2JU5A 5ELAA 2XPDA 2R3XA 1FB6A 2R37A 2NVLA 2ES7A 4F9ZA 2A2SA 4TRXA 2OE3A 4H86A 5C00A 1A23A 1XWGA 5F05A 2H6YA 3D4MA 4LMWA 1WE0A 5G5FA 1SENA 4WF5A 4MF5A 1QQ2A 2H0IA 5DALA 2OBIA 4MABA 4QL9A 2E2MA 3G7JA 2R6KA 4GWRA 1KBNA 4JE1A 3FYGA 2PU9C 5DQYA 3UIWA 1EGRA 1VRSD 3TKSE 1WPIA 3UVTA 6GSUA 2HE3A 1F3AA 5DDLA 4N11A 1XW5A 4X1UA 2IIYA 3G9BA 3FY7A 1X9MB 5HFIA 5B6MA 2A4VA 2P5RA 1YF0A 4IHUA 4G0LA 3VWXA 2BTOT 1TK0B 2IFQB 3CTGA 1PQNA 1TRUA 1SL0B 5EY6A 3N9JA 3PPUA 3NZNA 2GTUA 3KP8A 4HQZA 4POBA 4IS0A 1TK8B 2O7KA 4K6XA 5H5SA 3GKNA 22GSA 3ME8A 4FYBA 3Q18A 3DVXA 1SJ6A 4WXTA 5JCWA 1QK8A 2L57A 3EINA 3S9FA 2CZ2A 3IBHA 1AW9A 1T00A 3TKSC 5KN0A 1ZZYA 3WYWA 4X43A 3IK7A 1DBYA 2ZNMA 2JZSA 4ACSA 4LA1A 1DE2A 1TI3A 1GWCA 1V58A 2HYXA 1YEXA 2GZYA 3VPQA 3IK9A 1YKAA 2GGTA 1OE8A 1M0UA 2G2QA 3WGXA 1PX6A 2H1AA 5CRGA 3HYPA 3TRXA 2VL2C 2B3SA 3EWLA 1GUMA 3TKQA 1K0DA 4QQ7A 3IR4A 3E9JB 3BCIA 5AIXA 2AYTA 2VM2A 4NAXA 1TRWA 1CQGA 2MMZA 3KD0A 1YQ1A 5CRWA 2RLIA 3ZIJA 1ACVA 1T8EB 3GKXA 1PL2A 5GAND 2NTOA 3LGCA 2JL4A 1PD21 4MJAA 2YNXA 3CYNA 3CRUA 2H30A 2NPBA 2V41A 4I97A 3TB2A 4RI6A 3BBYA 4TXOA 1XW6A 3GMFA 2AB6A 4V2NA 5D9TA 4X0XA 1AQXA 1GTBA 2C3NA 3ZLPA 3EMPA 3ERGA 3LXZA 2TRCP 5IOXA 1WRYA 2WFCA 4PXOA 1Z6MA 4P3YB 4V2LA 2LJRA 2YV7A 3KTBA 4ISDA 2EIRA 4DSSB 5IIZA 2HZEA 1F9MA 4IVFA 2PN8A 3H79A 2REMA 3LSZA 1T4ZA 3KM6A 4MMMA 2LJKA 1HNCA 5JWRB 1EV9A 4IELA 4JEDA 3UMAA 5GSSA 2AUVA 1GH2A 3HJOA 1QMVA 4JR6A 5B6NA 1RQMA 3D0ZA 2KUCA 4JZQA 4KDXA 1JFUA 2XBQA 1W4VA 3P2AA 3ZIVA 2PBJA 5JWOB 3F63A 2H70A 2WGRA 1TU7A 3HJMA 4OO5A 2JZTA 2GSTA 1EOHA 5E59A 2BJXA 1EOGA 2F3MA 3ZZXA 2OA7A 1FAAA 3R3EA 1M2AA 1Q4JA 4OFTA 3QOUA 2DJJA 2FWFA 2VCWA 5DALB 1EV4A 1USBA 3JCML 1C72A 1Z7PA 3C1SA 4K0NA 4EVMA 3FZAA 2H19A 2GS3A 3DD3A 4ZB8A 1OYJA 1KEBA 1O6JA 9GSSA 2F8FA 1GUHA 3UVHA 4OWYA 2MBSA 1MD4A 4G0KA 2QSIA 4CHSA 4MK3A 5ECSA 4EUYA 1V9WA 4G10A 1DE1A 1O85A 2HSYA 1YDKA 2O8VB 3TKPA 5ENUA 3HCZA 4ECBA 2GT5A 2LUSA 3GIXA 2DIZA 5KN3A 1R26A 4WR5A 3BD2A 1GSFA 4MP4A 5G5EA 4KUNA 2VCQA 1ZL9A 2V2GA 4KE3A 3QDNA 2LNSA 4HJMA 2CAIA 2LS5A 1AAZA 1XBSA 4G0IA 2PGTA 5CREA 4GQCA 1MDJA 2JACA 4XCSA 3LFLA 1VF4A 4XS6A 1GSQA 4PUAA 5D9XA 5J41A 3CMIA 5B8AA 3IPZA 5DAKA 3GKKA 2JADA 2CQ9A 3GX0A 4K1FA 4BVYA 1WIKA 4MF7A 1Y25A 2HRNA 3GA4A 1KTEA 2YJ7A 1VGLA 2B7KA 3FR3A 1DUGA 3HDCA 1ZCPA 2DBCA 1LU4A 2FWEA 3MNGA 4MJEA 3IC8A 1AIUA 2HRAA 1Z6NA 2HSHA 4I6XA 10GSA 3D5JA 4LLRA 3DEXA 3C1RA 3VFIA 1BG5A 5HR3A 3QAVA 1NSWA 1ERTA 3ED3A 2RM6A 2TIRA 2X99A 1PMTA 1EEMA 1VF3A 5GZZB 1GNEA 2PVOC 1AQWA 3L9VA 3GHAA 1BEDA 1GULA 3UBLA 5G1LA 1FW1A 4IN0A 4Z7XA 2L5OA 1QUWA 3DIEA 1GTIA 1X9SB 3DRNA 2C8UA 3F4TA 3ZYWA 2YZHA 4TXOB 3APQA 2FNOA 1V57A 2H75A 8GSSA 4ECJA 2P31A 1E6BA 3ZFLA 4GSNA 2FLSA 2PWJA 1XWKA 3LYPA
chains in the Genus database with same CATH superfamily
4I8BA 4K9ZA 3F9UA 3ZITA 3W6GA 4KA0A 5E4WA 3IXRA 4PUFC 1A2JA 2H8LA 1X5CA 1MD3A 2WW1A 1BX9A 1B9XC 2H0GA 3RHCA 2HRKA 2YP6A 5B8BA 2VCVA 1M7TA 3TJJA 2MYGA 4RUVA 3P90A 2O89A 1EP8A 4PNFA 4HZ4A 1HD2A 2H76A 2C1YA 3FHKA 2OADA 3CHXC 4XRDA 1XW9A 4GRFA 16GSA 3RGBC 1TI1A 4X4JA 4XIHA 5IOWA 4L5LA 5D73A 3BJ5A 1O81A 2FY6A 3IE3A 4G19A 5LD0A 4MPFA 14GSA 4K5SA 2WVXB 4E8EA 1NW2A 2L4CA 2LEGA 5IQYA 3EPTA 3HY2A 4OO4A 2KLXA 1YY7A 2DC5A 1WOUA 3FZ4A 2R2JA 3EU4A 4LL4B 3UAPA 1SVMA 1SVLA 3IA1A 4KNDA 5BMUA 3F3QA 3US3A 3HA9A 2V1MA 3DXBA 5GAPD 3APSA 5J47A 3CSIA 2YJHA 3WGEA 1S4BP 1YKCA 3ZMLA 2QA2A 2WVYA 1J08A 2E2GA 1SKSB 3LEFA 1NHOA 2H6ZA 2H1LA 1U87A 4K5RA 4ZBAA 4AI6A 4CW9A 5AN1A 2OE1A 4KSMA 1TOFA 4KGIA 3GH9A 2OKAA 3DKSA 1B4QA 4MZCA 4L5OA 5KN1A 1WP0A 2GSRA 2H72A 2L5LA 2MBTA 1K3LA 2B5YA 4MF6A 4TXVA 2FCHA 4MPGA 2H73A 4PI0C 4N0ZA 3DVWA 4BVXA 3TCOA 1URMA 1BYEA 1Z5YE 1SKRB 2C3TA 1G6YA 1XVWA 4WBRD 4ZIJA 5ECKB 3EVIA 5H5QA 2WS2A 4XS4B 6GSTA 1EZKA 3VPTA 1EEJA 2B1KA 1XPVA 2WRTA 4TR1A 1DSBA 5DAKB 1Z3EA 1TW9A 3GN3A 1YEPA 3MWHA 4BVYB 3H93A 2LTKA 3U6VA 4WETA 2LRNA 3LW9A 4HDEA 4BWQA 1PRXA 4HU9A 2CX4A 1E2YA 4HJ2A 1ZYQB 2X8CA 4E68A 1WMJA 1Z9HA 2PMTA 5IO0A 3RAZA 3UOMA 2B1LA 1T1VA 4EDYA 5CAXA 4ZB6A 5ELGA 1B48A 1V2AA 1TP9A 3GH6A 1O73A 2YANA 1BQ7A 4AJ6A 4I2TA 4V1Ag 3HD5A 3E0UA 3MDKA 1PGTA 5COHA 2DMMA 3TU3B 2OBKA 5CRHA 2WZ9A 2I3YA 1ML6A 1AUCA 2CVKA 4EC0A 1N8JA 1VF2A 3GL3A 4PHZC 3CQFA 3QMXA 4RI7A 4F82A 4HSCX 2WVZA 5HR1A 3C7MA 1R7HA 5G31A 4N30A 11GSA 4EDZA 3L4NA 1W89A 2ZCTA 1F3BA 1S3DA 4KDYA 4TR3A 4V2MA 1A8LA 1SK2A 4DVCA 2Z9SA 1IYIA 3CRTA 4JRRA 6GSVA 1ZYNA 4O5QA 4MCUA 2P0GA 4LL1B 5ECIB 4IW9A 4ZL7A 1RK4A 4L8EA 3M3MA 1IYHA 2DJ0A 3TKSA 3GL5A 2O5VA 2GT6A 3VURA 4IJ3A 3P8WA 2K8SA 2VLTA 1V40A 3E3EA 4I2UA 3ZVJD 2HRKB 2EFCA 4N3ZA 1XZOA 2IL3A 4PX1A 3RFRC 3D6IA 3H4KA 2C0EA 5EVOA 4ZBBA 1FG4A 3KP9A 2H71A 3VK9A 4DEJA 1M3IA 1M9BA 1J0FA 1OC8A 3GSTA 2L6CA 1GLPA 3CSHA 2OE0A 2IMEA 2VL2A 1BAYA 1M2BA 5A5KA 3ZTLA 4EKZA 5H5RA 1AQVA 2BMXA 5KEJA 1ERVA 3MIXA 3VWVA 6GSSA 2C0FA 2MMOA 1GUKA 5EPFA 4F0CA 2I9HA 1XWCA 4MH2A 2K8VA 3PR8A 2X4AA 3GTUA 1M9AA 3HZ4A 2GVPA 1WJKA 1B8XA 5HFKA 1OC9A 3F8UA 1FVKA 2DMLA 4OD7A 3DGQA 3Q19A 3TGZA 1JZOA 1GLQA 4ECCA 3HKRA 4Z2UA 3CXGA 3C73A 2VCZA 2OACA 4IJIA 1SD8A 3DYRA 2RUFA 5ECLB 2B7JA 4TR0A 5CRDA 4MJBA 2C80A 3QFAC 4K2XA 1GSSA 1TDIA 3HVXA 1A0FA 4NHZA 2VM1A 3HMJG 1XFLA 4PQIA 5DBQA 2IWTA 2N5AA 4PQHA 1OKTA 4GSSA 4ZB7A 1VF1A 2LQOA 3K8NA 20GSA 1R5PA 3FEUA 1TRVA 3WD6A 2FUG2 3OR5A 1ILOA 6GSXA 1ON4A 1PN9A 3O6TA 2N5BA 4BVXB 2HSMA 1BJXA 5HR2A 5ECRB 2O36A 2RUEA 1I1IP 3M9JA 2X8GA 1QFNA 1A8YA 4F0BA 3C8EA 1JZRA 3KCMA 2QC7A 3L9SA 3F4RA 2UZ8A 1MDKA 2DJKA 4KSOA 5ECMB 4AGSA 4TR1B 4GLTA 4EE0A 4HOJA 4K2DA 3O3TA 2VD1A 3FW2A 1AXDA 2LRCA 1A2LA 2O85A 3GV1A 3A5IA 5JCGA 3D21A 3NOFA 2OJLA 18GSA 3GYKA 3I43A 4WBJA 4O32A 1JLVA 1M99A 3M9KA 2V32A 1TKDB 3F0IA 1H75A 5C04A 5F06A 3RBTA 3QAGA 4MZBA 4O92A 1B9YC 2MZCA 4FH8A 1CQHA 2ALBA 5CNWA 2VL9A 2M46A 3TJBA 2IN3A 3AY8A 2KOKA 4MH3A 2YWIA 4KH7A 3KEBA 1ZYPA 5DQSA 1XOBA 1SL1B 3EMXA 2WCIA 3WT2A 1THOA 3M1GA 1ZMAA 4V1Ap 5ABRA 3SWLA 4TR4A 4Q5QA 1K0MA 1U3IA 1XXUA 5D96A 3DWVA 3FRCA 1GSEA 4HS1A 3RDWA 2NDOA 4IKHA 5IMVA 3IV4A 4YAVA 3CTFA 1XVQA 2H0HA 2TRXA 3TKRA 7GSSA 3J7Yk 1LBKA 4XS1A 5ECHB 2DJ2A 1GL8A 1Y6EA 3ME7A 2VO4A 1PSQA 2QA1A 3VWWA 1XCCA 2L4QA 2VOCA 3EURA 1I9DA 5LNKe 4GXZA 3HVVA 1FHEA 5IMFA 3GSSA 1YZXA 3R2QA 5A34A 1U88A 5DCGA 1PA3A 1HNAA 4NV5A 1J9BA 2H1BA 3ERWA 4GQFA 2C0GA 4YKFA 4YKGA 2HZEB 1FOVA 1G6WA 1ST9A 1SKWB 5A4UA 4ZXGA 3CSJA 3FR6A 2YWOA 4PTSA 4POKA 4NMUA 1PX7A 4TKYA 2FA8A 2KP1A 4ML6A 3O76A 3GKMA 3L78A 4ILFA 3KTLA 19GSA 3GFKA 3Q6OA 2VAFA 2UV8G 4AJ7A 1ABAA 3EYTA 2PVQA 4OMVA 3MYDA 4ML1A 3QCPA 4Z2TA 1GRXA 2LRTA 3GUSA 2H6XA 3A2XA 5D9WA 2ON5A 4KX4A 17GSA 2IMDA 2DKIA 3GURA 5AISA 1TXUA 1LJRA 3GRXA 4DSSA 4F03A 1TJDA 4AKGA 4J57E 1YVLA 4HI7A 1XIYA 2B5EA 2EIQA 1UA5A 5EL8A 3D4TA 5G30A 2HNLA 1QGVA 4YQVA 3UBKA 3TRQA 4E8HA 3ZMKA 1X5EA 5D9VA 5G2ZA 4KW6A 1SYRA 2IJYA 4G2EA 3EE2A 1EWXA 4NWYA 1FVJA 1HYUA 5IM9A 5J3RA 3LWAA 4EF0A 4PGTA 4EXJA 3LYKA 1B4PA 3LORA 5HFGA 5IMDA 4KDUA 4FO5A 2FGXA 2GQLA 1GNWA 1RW1A 4MA9A 3VI5A 2WZSA 3C71A 5BRTA 3PINA 5DJLA 2HSMB 2ZUPA 3ZL5A 4PURA 5LCZA 3FZ5A 3W8SA 1UC7A 4LMVA 1TRSA 1N2AA 1ERUA 1JZDA 4EIQA 2KP2A 4K0GA 1MDIA 2IMKA 2E7PA 4G01A 5A4WA 1HQOA 1GTUA 5ECQB 4GTUA 2VIMA 5DVBA 2K18A 3PH9A 3VI7A 1O7UA 1S3RA 5HQPA 3FKFA 2YN1A 2IMFA 3RHBA 2CA8A 4HU7A 3I69A 2CT6A 2GSSA 4K7OA 1R5AA 3ERFA 4HZ2A 2A4HA 3QAWA 4OCFA 4WF4A 1SYXA 2RIIA 3A2VA 1EP7A 3DMLA 2F9SA 1K0BA 3IHQA 4HEA2 2KHPA 1X9WB 2DSAA 2H66A 1JHBA 5AGYA 3ZFBA 4JU5A 4K8MA 4IBPA 3F6DA 1NM3A 2DIYA 3G7YA 1YJ6A 5DCHA 1KNGA 3HZ8A 2XHFA 1G7EA 2K9FA 1MTCA 1S3CA 3KMOA 2V6OA 1K0CA 4POLA 2R5GA 4XRAA 3RPNA 2XPEA 1OE7A 1BF5A 2M80A 1FB0A 5IMCA 1V98A 1U6TA 2CVBA 2X8HA 4FYCA 5IPGA 1F2EA 3MAKA 5DJMA 4CY6A 4PNGA 3F4SA 3ZRDA 2LNTA 4EL1A 3ZREA 4J2FA 1TU8A 5A1NA 5F0GA 2C4JA 4DSQA 2QKEA 2YPMA 3P7XA 1M3JA 2VCTA 5JCUA 4KCEA 2GDRA 1K0OA 12GSA 1T4YA 2LSTA 5A34B 3EC3A 5ECOB 4WEYA 4ZBDA 4ULXA 2X64A 5IMAA 2XC2A 2HRFA 4GSTA 4NHWA 1ZOFA 1U3AA 4KAEA 4RQRA 2L6DA 1MEKA 3PGTA 4MNNA 1XOAA 4IP6A 3SBCA 5JWQB 1ZYEA 2ON7A 4TVEA 3ZVJA 3QPMA 5J9BA 2GSQA 1K0AA 5HR0A 3TJKA 4POMA 2PERA 2PPTA 2FWHA 13GSA 2I1UA 1X0RA 1GSUA 2G0FA 4N10A 2LV3A 3A3TA 2LJAA 4XHMA 1TK5B 4L0UA 3A2WA 2HI7A 4ZILA 2X49A 1I5GA 3KIJA 1F6MC 2YWMA 3UARA 3D22A 2EIOA 2HSNA 3KGKA 2VCXA 4FXYP 6GSWA 4IQAA 4K7IA 3L9UA 2I4AA 3TUEA 4WKWA 2HQTA 5A4VA 4AKXB 2N5FA 5B7CA 4D73A 2AHEA 4BA7A 4AKIA 3HHVA 5FHIA 2AAWA 2WB9A 3H8QA 5ID2A 1Y1UA 1UVZA 2YOIA 2HT9A 5BMUB 2MMNA 4BL7A 4AJ8A 4J56E 2LKUA 1ERWA 2WW3A 5J9CA 2M72A 5IPHA 4RQXA 3IAM2 4TN8A 5CYYA 2VD0A 2XBIA 4NXIA 4CDOA 4OFMA 5KOWA 4USSA 3G7IA 4YH2A 4HQSA 2JSZA 3KXOA 2HLSA 3LJRA 5AIVA 2DJ3A 4N0VA 5ECPB 3EU3A 2FWGA 2YZUA 3GX8A 2RM5A 5CP1A 1SK1A 3APOA 1X5DA 4O5RA 1PKZA 2AJQB 5IMZA 2VKZG 4I5QA 4YQMA 4NPBA 3NIVA 1K3YA 2FA4A 1HNBA 5G1KA 2JZRA 4IP1A 3UL3A 2VLVA 2GZZA 3N5OA 4AF2A 1JZWA 3IRAA 2CV4A 1H4OA 1S3AA 4KF9A 1XWAA 3KZQA 2H74A 2CVDA 2R4VA 1JLWA 5IO2A 3KMNA 2A2RA 1K3OA 4GF0A 4F2IA 2J9HA 3U5RE 3QD9A 3TJFA 3WT1A 3FK8A 1F37A 4MJCA 4TW5A 1G7OA 1A2MA 4IGJA 2PUKC 1OC3A 4MZWA 1SJIA 4ID0A 1FO5A 3F3RA 2GQKA 5FT3A 3IOSA 2IFQA 3Q74A 2VL3A 3UEMA 2CAQA 2GLRA 4GCIA 4JR4A 2AV4A 3QR6A 4XS4A 5KOXA 4BWSA 2MMAA 3UJ1A 4BPYA 4PQ1A 4ZL9A 3LG6A 3W8JA 1M2DA 1QXHA 5ECNB 3QFBC 2VUPA 3WGDA 3BCKA 4HUAA 4G9HA 4QL7A 4FIWA 5A1NB 2DJ1A 4L0WA 1A24A 4EO3A 3FR9A 1AC1A 3IAS2 1EGOA 4CY8A 3HVSA 1SD9A 2H1GA 3M8NA 1OVNA 2B6MA 2FHEA 4O7HA 4ECIA 2J23A 2EC4A 3KH9A 1SL2B 2EFEA 2D2ZA 6GSYA 2YWNA 2VLUA 1XWBA 1SU9A 4MDCA 2H01A 2LQQA 4OFNA 4IQ1A 2WDUA 3TOUA 1PN0A 4K7NA 4O5UA 1Z7RA 4Q5NA 3LQ7A 3HXSA 3KH7A 1TTZA 5J5NA 4YQUA 3CBUA 5J40A 1G0TA 4TOPA 3VLNA 4WR4A 2NBSA 1GSYA 2YV9A 1N25A 2H1DA 5A5HA 3H1NA 2QGVA 2WJUA 3M0FA 1A0RP 1OKDA 3I9V2 2WW0A 3IHGA 4ZL8A 2FD3A 2GZPA 5FWGA 2GQMA 4ZB9A 2B5XA 4DSRA 1OAZA 1O8XA 5KN2A 1THXA 2O87A 2CZ3A 3KJYA 4FQUA 4MLYA 3J7Yb 4Q5RA 4KCAA 2F8AA 5GSTA 3TDGA 3HJPA 2L59A 4Q5FA 1FOHA 3ISOA 2F51A 3TRPA 2C0DA 4YAPA 5D8IA 3I6AA 1UN2A 3CWGA 2HSNB 3A5WA 3GTUB 3TOTA 5CO3A 4D73B 4GDFA 1OC9B 5ID2B 2JSYA 5J4UA 4OCEA 3BOAA 2WULA 1GP1A 4XTSA 2HFDA 2K6VA 3LXTA 1R4WA 1O8WA 1Q98A 2V6KA 3L0HA 4BL7B 2HZFA 3VWUA 2DKHA 1PKWA 3RPPA 2CX3A 5L71A 1GTAA 2I81A 3FZ9A 1SJZA 1T3BA 4NV2A 5INYA 1YEWC 1T7PB 2P5QA 4JBBA 4KB3A 2IMIA 2DLXA 5D93A 5F07A 3MSZA 5F8BA 1GSDA 2YCDA 2HXKA 3V1WA 3TJGA 1SK0A 3F6FA 2C3QA 3GNJA 1TXXA 2IPAA 1WWJA 1PL1A 1ZGNA 3IDVA 2E0QA 4FYUA 1YF1A 1K0NA 1NHYA 3IC4A 2JU5A 2EFDA 5ELAA 2XPDA 2R3XA 1FB6A 2R37A 2NVLA 2ES7A 4F9ZA 2A2SA 4TRXA 2OE3A 4H86A 5C00A 1A23A 3HVNA 1XWGA 5F05A 2H6YA 3D4MA 4LMWA 1WE0A 5G5FA 1SENA 4WF5A 4MF5A 1QQ2A 2H0IA 5DALA 2OBIA 4MABA 4QL9A 2E2MA 3G7JA 2R6KA 4GWRA 1KBNA 4JE1A 3FYGA 2PU9C 5DQYA 3UIWA 1EGRA 1VRSD 3TKSE 1WPIA 3UVTA 6GSUA 2HE3A 1F3AA 5DDLA 4N11A 1XW5A 4X1UA 2IIYA 3G9BA 3FY7A 1X9MB 5HFIA 5B6MA 2A4VA 2P5RA 1YF0A 4IHUA 4QMKA 4G0LA 3VWXA 2BTOT 1TK0B 2IFQB 4A5PA 3CTGA 1PQNA 1TRUA 1SL0B 5EY6A 3N9JA 3PPUA 3NZNA 2GTUA 3KP8A 4HQZA 4POBA 4IS0A 1TK8B 2O7KA 4K6XA 5H5SA 3GKNA 22GSA 3ME8A 4FYBA 3Q18A 3DVXA 5J4VA 1SJ6A 4Z2RA 4WXTA 5JCWA 1QK8A 2L57A 3EINA 3S9FA 2CZ2A 3IBHA 1AW9A 1T00A 3TKSC 5KN0A 1ZZYA 3WYWA 4X43A 3IK7A 1DBYA 2ZNMA 2JZSA 4ACSA 4LA1A 1DE2A 1TI3A 1GWCA 1V58A 2HYXA 1YEXA 2GZYA 3VPQA 3IK9A 1YKAA 2GGTA 1OE8A 1M0UA 2G2QA 3WGXA 1PX6A 2H1AA 5CRGA 3HYPA 3TRXA 1XG8A 2VL2C 2B3SA 5A5HB 3EWLA 1GUMA 3TKQA 1K0DA 4QQ7A 3IR4A 3E9JB 1BG1A 3BCIA 5AIXA 2O3EA 2AYTA 2VM2A 4NAXA 1TRWA 1CQGA 2MMZA 3KD0A 1YQ1A 5CRWA 2RLIA 3ZIJA 1ACVA 1T8EB 4W66A 2R0CA 3GKXA 1PL2A 5GAND 2NTOA 2A2PA 4EIPA 3LGCA 2JL4A 1PD21 4MJAA 2YNXA 3CYNA 3CRUA 2H30A 2NPBA 1SVOA 5J4YA 2V41A 4I97A 3TB2A 4RI6A 3BBYA 4TXOA 1XW6A 2WW2A 3GMFA 2AB6A 4V2NA 5D9TA 4BIKA 4X0XA 1AQXA 1GTBA 2C3NA 4AKHA 3EMPA 3ERGA 3ZLPA 3LXZA 2TRCP 5IOXA 1WRYA 2WFCA 4PXOA 1Z6MA 4P3YB 4V2LA 2LJRA 2YV7A 3KTBA 4ISDA 2EIRA 4DSSB 5IIZA 2HZEA 1F9MA 4IVFA 2PN8A 3H79A 2REMA 3LSZA 1T4ZA 3KM6A 4MMMA 2LJKA 1HNCA 5JWRB 1EV9A 4IELA 4JEDA 3UMAA 5GSSA 2AUVA 1GH2A 3HJOA 2OT3A 1QMVA 4JR6A 5B6NA 1RQMA 3D0ZA 2KUCA 4JZQA 4KDXA 1JFUA 2XBQA 2EFHA 1W4VA 3P2AA 3ZIVA 2PBJA 5JWOB 3F63A 2H70A 2WGRA 1TU7A 3HJMA 2WVXA 4OO5A 2JZTA 2GSTA 1EOHA 5E59A 2BJXA 1EOGA 2F3MA 3ZZXA 2OA7A 1FAAA 3R3EA 1M2AA 1Q4JA 4OFTA 3QOUA 2DJJA 2FWFA 2VCWA 5DALB 1EV4A 1USBA 3JCML 1C72A 1Z7PA 3C1SA 4K0NA 4EVMA 3FZAA 2H19A 2GS3A 3DD3A 4ZB8A 1OYJA 1KEBA 1O6JA 9GSSA 2F8FA 1GUHA 3UVHA 4OWYA 2MBSA 1MD4A 4G0KA 2QSIA 4CHSA 4MK3A 5ECSA 4EUYA 1V9WA 4G10A 1DE1A 1O85A 2HSYA 1YDKA 2O8VB 3TKPA 5ENUA 4ECBA 2GT5A 3HCZA 2LUSA 2R0PA 3GIXA 2DIZA 5KN3A 1R26A 4WR5A 3BD2A 1GSFA 4MP4A 5G5EA 4KUNA 2VCQA 1ZL9A 2V2GA 4KE3A 3QDNA 2LNSA 4HJMA 2CAIA 2LS5A 1AAZA 1XBSA 4G0IA 2PGTA 5CREA 4GQCA 1MDJA 2JACA 4XCSA 3LFLA 1VF4A 4XS6A 1GSQA 4PUAA 5D9XA 5J41A 4ICYA 3CMIA 5B8AA 3IPZA 5DAKA 3GKKA 2JADA 2CQ9A 3FMWA 3GX0A 4K1FA 4BVYA 1WIKA 4MF7A 4PI2C 1Y25A 2HRNA 3GA4A 1KTEA 2YJ7A 1VGLA 2B7KA 3FR3A 1DUGA 3HDCA 1ZCPA 2DBCA 1LU4A 2FWEA 3MNGA 4MJEA 3IC8A 1AIUA 2R0GA 2HRAA 1Z6NA 2HSHA 4I6XA 10GSA 3D5JA 4LLRA 3DEXA 3C1RA 3VFIA 1BG5A 5HR3A 3QAVA 1NSWA 1ERTA 3ED3A 2RM6A 2TIRA 2X99A 1PMTA 1EEMA 1VF3A 5GZZB 1GNEA 2PVOC 1AQWA 1PFOA 3L9VA 3GHAA 1BEDA 1GULA 3UBLA 5G1LA 1FW1A 4IN0A 4Z7XA 2L5OA 1QUWA 3DIEA 1GTIA 1X9SB 3DRNA 2C8UA 3F4TA 3ZYWA 2YZHA 4TXOB 3APQA 2FNOA 1V57A 2H75A 8GSSA 4ECJA 2P31A 1E6BA 3ZFLA 4GSNA 2FLSA 2PWJA 1XWKA 3LYPA
chains in the Genus database with same CATH topology
4I8BA 4K9ZA 3F9UA 3ZITA 3W6GA 4KA0A 5E4WA 3IXRA 4PUFC 1A2JA 2H8LA 1X5CA 1MD3A 1BX9A 1B9XC 2H0GA 3RHCA 2HRKA 2YP6A 5B8BA 2VCVA 1M7TA 3TJJA 2MYGA 4RUVA 3P90A 2O89A 1EP8A 4PNFA 4HZ4A 1HD2A 2H76A 2C1YA 3FHKA 2OADA 4XRDA 1XW9A 4GRFA 16GSA 1TI1A 4X4JA 4XIHA 5IOWA 4L5LA 5D73A 3BJ5A 1O81A 2FY6A 3IE3A 4G19A 5LD0A 4MPFA 14GSA 4K5SA 4E8EA 1NW2A 2L4CA 2LEGA 5IQYA 3EPTA 3HY2A 4OO4A 2KLXA 1YY7A 2DC5A 1WOUA 3FZ4A 2R2JA 3EU4A 4LL4B 3UAPA 1SVMA 1SVLA 3IA1A 4KNDA 5BMUA 3F3QA 3US3A 3HA9A 2V1MA 3DXBA 5GAPD 3APSA 5J47A 3CSIA 2YJHA 3WGEA 3ZMLA 1YKCA 2QA2A 1J08A 2E2GA 1SKSB 3LEFA 1NHOA 2H6ZA 2H1LA 1U87A 4K5RA 4ZBAA 4AI6A 4CW9A 5AN1A 2OE1A 4KSMA 1TOFA 4KGIA 3GH9A 2OKAA 3DKSA 1B4QA 4MZCA 4L5OA 5KN1A 1WP0A 2GSRA 2H72A 2L5LA 2MBTA 1K3LA 2B5YA 4MF6A 4TXVA 2FCHA 4MPGA 2H73A 4N0ZA 3DVWA 4BVXA 3TCOA 1URMA 1BYEA 1Z5YE 1SKRB 2C3TA 1G6YA 1XVWA 4WBRD 4ZIJA 5ECKB 3EVIA 5H5QA 2WS2A 4XS4B 6GSTA 1EZKA 3VPTA 1EEJA 2B1KA 1XPVA 2WRTA 4TR1A 1DSBA 5DAKB 1Z3EA 1TW9A 3GN3A 1YEPA 3MWHA 4BVYB 3H93A 2LTKA 3U6VA 4WETA 2LRNA 3LW9A 4HDEA 4BWQA 1PRXA 4HU9A 2CX4A 1E2YA 4HJ2A 1ZYQB 2X8CA 4E68A 1WMJA 1Z9HA 2PMTA 5IO0A 3RAZA 3UOMA 2B1LA 1T1VA 4EDYA 5CAXA 4ZB6A 5ELGA 1B48A 1V2AA 1TP9A 3GH6A 1O73A 2YANA 1BQ7A 4AJ6A 4I2TA 4V1Ag 3HD5A 3E0UA 3MDKA 1PGTA 5COHA 2DMMA 3TU3B 2OBKA 5CRHA 2WZ9A 2I3YA 1ML6A 1AUCA 2CVKA 4EC0A 1N8JA 1VF2A 3GL3A 3QMXA 4RI7A 4F82A 5HR1A 3C7MA 1R7HA 5G31A 4N30A 11GSA 4EDZA 3L4NA 1W89A 2ZCTA 1F3BA 1S3DA 4KDYA 4TR3A 4V2MA 1A8LA 1SK2A 4DVCA 2Z9SA 1IYIA 3CRTA 4JRRA 6GSVA 1ZYNA 4O5QA 4MCUA 2P0GA 4LL1B 5ECIB 4IW9A 4ZL7A 1RK4A 4L8EA 3M3MA 1IYHA 2DJ0A 3TKSA 3GL5A 2O5VA 2GT6A 3VURA 4IJ3A 3P8WA 2K8SA 2VLTA 1V40A 3E3EA 4I2UA 3ZVJD 2HRKB 2EFCA 4N3ZA 1XZOA 2IL3A 4PX1A 3D6IA 3H4KA 2C0EA 5EVOA 4ZBBA 1FG4A 3KP9A 2H71A 3VK9A 4DEJA 1M9BA 1J0FA 1OC8A 3GSTA 2L6CA 1GLPA 3CSHA 2OE0A 2IMEA 2VL2A 1BAYA 1M2BA 5A5KA 3ZTLA 4EKZA 5H5RA 1AQVA 2BMXA 5KEJA 1ERVA 3MIXA 3VWVA 6GSSA 2C0FA 2MMOA 1GUKA 5EPFA 4F0CA 2I9HA 1XWCA 4MH2A 2K8VA 3PR8A 2X4AA 3GTUA 1M9AA 3HZ4A 2GVPA 1WJKA 1B8XA 5HFKA 1OC9A 3F8UA 1FVKA 2DMLA 4OD7A 3DGQA 3Q19A 3TGZA 1JZOA 1GLQA 4ECCA 3HKRA 4Z2UA 3CXGA 3C73A 2VCZA 2OACA 4IJIA 1SD8A 3DYRA 2RUFA 5ECLB 2B7JA 4TR0A 5CRDA 4MJBA 2C80A 3QFAC 4K2XA 1GSSA 1TDIA 3HVXA 1A0FA 4NHZA 2VM1A 3HMJG 1XFLA 4PQIA 5DBQA 2IWTA 2N5AA 4PQHA 1OKTA 4GSSA 4ZB7A 1VF1A 2LQOA 3K8NA 20GSA 1R5PA 1TRVA 3WD6A 3FEUA 2FUG2 3OR5A 1ILOA 6GSXA 1ON4A 1PN9A 3O6TA 2N5BA 4BVXB 2HSMA 1BJXA 5HR2A 5ECRB 2RUEA 3M9JA 2X8GA 1QFNA 1A8YA 4F0BA 3C8EA 1JZRA 3KCMA 2QC7A 3L9SA 3F4RA 2UZ8A 1MDKA 2DJKA 4KSOA 5ECMB 4AGSA 4TR1B 4GLTA 4EE0A 4HOJA 4K2DA 3O3TA 2VD1A 3FW2A 1AXDA 2LRCA 1A2LA 2O85A 3GV1A 3A5IA 5JCGA 3D21A 3NOFA 2OJLA 18GSA 3GYKA 3I43A 4WBJA 4O32A 1JLVA 1M99A 3M9KA 2V32A 1TKDB 3F0IA 1H75A 5C04A 5F06A 3RBTA 3QAGA 4MZBA 4O92A 1B9YC 2MZCA 4FH8A 1CQHA 2ALBA 5CNWA 2VL9A 2M46A 3TJBA 2IN3A 3AY8A 2KOKA 4MH3A 2YWIA 4KH7A 3KEBA 1ZYPA 5DQSA 1XOBA 1SL1B 3EMXA 2WCIA 3WT2A 1THOA 3M1GA 1ZMAA 4V1Ap 5ABRA 3SWLA 4TR4A 4Q5QA 1K0MA 1U3IA 1XXUA 5D96A 3DWVA 3FRCA 1GSEA 4HS1A 3RDWA 2NDOA 4IKHA 5IMVA 3IV4A 4YAVA 3CTFA 1XVQA 2H0HA 2TRXA 3TKRA 7GSSA 3J7Yk 1LBKA 4XS1A 5ECHB 2DJ2A 1GL8A 1Y6EA 3ME7A 2VO4A 1PSQA 2QA1A 3VWWA 1XCCA 2L4QA 2VOCA 3EURA 1I9DA 5LNKe 4GXZA 3HVVA 1FHEA 5IMFA 3GSSA 1YZXA 3R2QA 5A34A 1U88A 5DCGA 1PA3A 1HNAA 4NV5A 1J9BA 2H1BA 3ERWA 4GQFA 2C0GA 4YKFA 4YKGA 2HZEB 1FOVA 1G6WA 1ST9A 1SKWB 5A4UA 4ZXGA 3CSJA 3FR6A 2YWOA 4PTSA 4POKA 4NMUA 1PX7A 4TKYA 2FA8A 2KP1A 4ML6A 3O76A 3GKMA 3L78A 4ILFA 3KTLA 19GSA 3GFKA 3Q6OA 2VAFA 2UV8G 4AJ7A 1ABAA 3EYTA 2PVQA 4OMVA 3MYDA 4ML1A 3QCPA 4Z2TA 1GRXA 2LRTA 3GUSA 2H6XA 3A2XA 5D9WA 2ON5A 4KX4A 17GSA 2IMDA 2DKIA 3GURA 5AISA 1TXUA 1LJRA 3GRXA 4DSSA 4F03A 1TJDA 4AKGA 4J57E 1YVLA 4HI7A 1XIYA 2B5EA 2EIQA 1UA5A 5EL8A 3D4TA 5G30A 2HNLA 1QGVA 4YQVA 3UBKA 3TRQA 4E8HA 3ZMKA 1X5EA 5D9VA 5G2ZA 4KW6A 1SYRA 2IJYA 4G2EA 3EE2A 1EWXA 4NWYA 1FVJA 1HYUA 5IM9A 5J3RA 3LWAA 4EF0A 4PGTA 4EXJA 3LYKA 1B4PA 3LORA 5HFGA 5IMDA 4KDUA 4FO5A 2FGXA 2GQLA 1GNWA 1RW1A 4MA9A 3VI5A 3C71A 5BRTA 3PINA 5DJLA 2HSMB 2ZUPA 3ZL5A 4PURA 5LCZA 3FZ5A 3W8SA 1UC7A 4LMVA 1TRSA 1N2AA 1ERUA 1JZDA 4EIQA 2KP2A 4K0GA 1MDIA 2IMKA 2E7PA 4G01A 5A4WA 1HQOA 1GTUA 5ECQB 4GTUA 2VIMA 5DVBA 2K18A 3PH9A 3VI7A 1O7UA 5HQPA 3FKFA 2YN1A 2IMFA 3RHBA 2CA8A 4HU7A 3I69A 2CT6A 2GSSA 4K7OA 1R5AA 3ERFA 4HZ2A 2A4HA 3QAWA 4OCFA 4WF4A 1SYXA 2RIIA 3A2VA 1EP7A 3DMLA 2F9SA 1K0BA 3IHQA 4HEA2 2KHPA 1X9WB 2DSAA 2H66A 1JHBA 5AGYA 3ZFBA 4JU5A 4K8MA 4IBPA 3F6DA 1NM3A 2DIYA 3G7YA 1YJ6A 5DCHA 1KNGA 3HZ8A 2XHFA 1G7EA 2K9FA 1MTCA 1S3CA 3KMOA 2V6OA 1K0CA 4POLA 2R5GA 4XRAA 3RPNA 2XPEA 1OE7A 1BF5A 2M80A 1FB0A 5IMCA 1V98A 1U6TA 2CVBA 2X8HA 4FYCA 5IPGA 1F2EA 3MAKA 5DJMA 4CY6A 4PNGA 3F4SA 3ZRDA 2LNTA 4EL1A 3ZREA 4J2FA 1TU8A 5A1NA 5F0GA 2C4JA 4DSQA 2QKEA 2YPMA 3P7XA 2VCTA 5JCUA 4KCEA 2GDRA 1K0OA 12GSA 1T4YA 2LSTA 5A34B 3EC3A 5ECOB 4WEYA 4ZBDA 4ULXA 2X64A 5IMAA 2XC2A 2HRFA 4GSTA 4NHWA 1ZOFA 1U3AA 4KAEA 4RQRA 2L6DA 1MEKA 3PGTA 4MNNA 1XOAA 4IP6A 3SBCA 5JWQB 1ZYEA 2ON7A 4TVEA 3ZVJA 3QPMA 5J9BA 2GSQA 1K0AA 5HR0A 3TJKA 4POMA 2PERA 2PPTA 2FWHA 13GSA 2I1UA 1X0RA 1GSUA 2G0FA 4N10A 2LV3A 3A3TA 2LJAA 4XHMA 1TK5B 4L0UA 3A2WA 2HI7A 4ZILA 2X49A 1I5GA 3KIJA 1F6MC 2YWMA 3UARA 3D22A 2EIOA 2HSNA 3KGKA 2VCXA 6GSWA 4IQAA 4K7IA 3L9UA 2I4AA 3TUEA 4WKWA 2HQTA 5A4VA 4AKXB 2N5FA 5B7CA 4D73A 2AHEA 4BA7A 4AKIA 3HHVA 5FHIA 2AAWA 2WB9A 3H8QA 5ID2A 1Y1UA 1UVZA 2YOIA 2HT9A 5BMUB 2MMNA 4BL7A 4AJ8A 4J56E 2LKUA 1ERWA 5J9CA 2M72A 5IPHA 4RQXA 3IAM2 4TN8A 5CYYA 2VD0A 2XBIA 4NXIA 4CDOA 4OFMA 5KOWA 4USSA 3G7IA 4YH2A 4HQSA 2JSZA 3KXOA 2HLSA 3LJRA 5AIVA 2DJ3A 4N0VA 5ECPB 3EU3A 2FWGA 2YZUA 3GX8A 2RM5A 5CP1A 1SK1A 3APOA 1X5DA 4O5RA 1PKZA 2AJQB 5IMZA 2VKZG 4I5QA 4YQMA 4NPBA 3NIVA 1K3YA 2FA4A 1HNBA 5G1KA 2JZRA 4IP1A 3UL3A 2VLVA 2GZZA 3N5OA 4AF2A 1JZWA 3IRAA 2CV4A 1H4OA 1S3AA 4KF9A 1XWAA 3KZQA 2H74A 2CVDA 2R4VA 1JLWA 5IO2A 3KMNA 2A2RA 1K3OA 4GF0A 4F2IA 2J9HA 3U5RE 3QD9A 3TJFA 3WT1A 3FK8A 1F37A 4MJCA 4TW5A 1G7OA 1A2MA 4IGJA 2PUKC 1OC3A 4MZWA 1SJIA 4ID0A 1FO5A 3F3RA 2GQKA 5FT3A 3IOSA 2IFQA 3Q74A 2VL3A 3UEMA 2CAQA 2GLRA 4GCIA 4JR4A 2AV4A 3QR6A 4XS4A 5KOXA 4BWSA 2MMAA 3UJ1A 4BPYA 4PQ1A 4ZL9A 3LG6A 3W8JA 1M2DA 1QXHA 5ECNB 3QFBC 2VUPA 3WGDA 3BCKA 4HUAA 4G9HA 4QL7A 4FIWA 5A1NB 2DJ1A 4L0WA 1A24A 4EO3A 3FR9A 1AC1A 3IAS2 1EGOA 4CY8A 3HVSA 1SD9A 2H1GA 3M8NA 1OVNA 2B6MA 2FHEA 4O7HA 4ECIA 2J23A 2EC4A 3KH9A 1SL2B 2EFEA 2D2ZA 6GSYA 2YWNA 2VLUA 1XWBA 1SU9A 4MDCA 2H01A 2LQQA 4OFNA 4IQ1A 2WDUA 3TOUA 1PN0A 4K7NA 4O5UA 1Z7RA 4Q5NA 3LQ7A 3HXSA 3KH7A 1TTZA 5J5NA 4YQUA 3CBUA 5J40A 1G0TA 4TOPA 3VLNA 4WR4A 2NBSA 1GSYA 2YV9A 1N25A 2H1DA 5A5HA 3H1NA 2QGVA 2WJUA 3M0FA 1A0RP 1OKDA 3I9V2 3IHGA 4ZL8A 2FD3A 2GZPA 5FWGA 2GQMA 4ZB9A 2B5XA 4DSRA 1OAZA 1O8XA 5KN2A 1THXA 2O87A 2CZ3A 3KJYA 4FQUA 4MLYA 3J7Yb 4Q5RA 4KCAA 2F8AA 5GSTA 3TDGA 3HJPA 2L59A 4Q5FA 1FOHA 3ISOA 2F51A 3TRPA 2C0DA 4YAPA 5D8IA 3I6AA 1UN2A 3CWGA 2HSNB 3A5WA 3GTUB 3TOTA 5CO3A 4D73B 4GDFA 1OC9B 5ID2B 2JSYA 5J4UA 4OCEA 3BOAA 2WULA 1GP1A 4XTSA 2HFDA 2K6VA 3LXTA 1R4WA 1O8WA 1Q98A 2V6KA 3L0HA 4BL7B 2HZFA 3VWUA 2DKHA 1PKWA 3RPPA 2CX3A 5L71A 1GTAA 2I81A 3FZ9A 1SJZA 1T3BA 4NV2A 5INYA 1T7PB 2P5QA 4JBBA 4KB3A 2IMIA 2DLXA 5D93A 5F07A 3MSZA 5F8BA 1GSDA 2YCDA 2HXKA 3V1WA 3TJGA 1SK0A 3F6FA 2C3QA 3GNJA 1TXXA 2IPAA 1WWJA 1PL1A 1ZGNA 3IDVA 2E0QA 4FYUA 1YF1A 1K0NA 1NHYA 3IC4A 2JU5A 2EFDA 5ELAA 2XPDA 2R3XA 1FB6A 2R37A 2NVLA 2ES7A 4F9ZA 2A2SA 4TRXA 2OE3A 4H86A 5C00A 1A23A 1XWGA 5F05A 2H6YA 3D4MA 4LMWA 1WE0A 5G5FA 1SENA 4WF5A 4MF5A 1QQ2A 2H0IA 5DALA 2OBIA 4MABA 4QL9A 2E2MA 3G7JA 2R6KA 4GWRA 1KBNA 4JE1A 3FYGA 2PU9C 5DQYA 3UIWA 1EGRA 1VRSD 3TKSE 1WPIA 3UVTA 6GSUA 2HE3A 1F3AA 5DDLA 4N11A 1XW5A 4X1UA 2IIYA 3G9BA 3FY7A 1X9MB 5HFIA 5B6MA 2A4VA 2P5RA 1YF0A 4IHUA 4QMKA 4G0LA 3VWXA 2BTOT 1TK0B 2IFQB 4A5PA 3CTGA 1PQNA 1TRUA 1SL0B 5EY6A 3N9JA 3PPUA 3NZNA 2GTUA 3KP8A 4HQZA 4POBA 4IS0A 1TK8B 2O7KA 4K6XA 5H5SA 3GKNA 22GSA 3ME8A 4FYBA 3Q18A 3DVXA 5J4VA 1SJ6A 4Z2RA 4WXTA 5JCWA 1QK8A 2L57A 3EINA 3S9FA 2CZ2A 3IBHA 1AW9A 1T00A 3TKSC 5KN0A 1ZZYA 3WYWA 4X43A 3IK7A 1DBYA 2ZNMA 2JZSA 4ACSA 4LA1A 1DE2A 1TI3A 1GWCA 1V58A 2HYXA 1YEXA 2GZYA 3VPQA 3IK9A 1YKAA 2GGTA 1OE8A 1M0UA 2G2QA 3WGXA 1PX6A 2H1AA 5CRGA 3HYPA 3TRXA 2VL2C 2B3SA 5A5HB 3EWLA 1GUMA 3TKQA 1K0DA 4QQ7A 3IR4A 3E9JB 1BG1A 3BCIA 5AIXA 2AYTA 2VM2A 4NAXA 1TRWA 1CQGA 2MMZA 3KD0A 1YQ1A 5CRWA 2RLIA 3ZIJA 1ACVA 1T8EB 4W66A 2R0CA 3GKXA 1PL2A 5GAND 2NTOA 2A2PA 4EIPA 3LGCA 2JL4A 1PD21 4MJAA 2YNXA 3CYNA 3CRUA 2H30A 2NPBA 1SVOA 5J4YA 2V41A 4I97A 3TB2A 4RI6A 3BBYA 4TXOA 1XW6A 3GMFA 2AB6A 4V2NA 5D9TA 4X0XA 1AQXA 1GTBA 2C3NA 4AKHA 3EMPA 3ERGA 3ZLPA 3LXZA 2TRCP 5IOXA 1WRYA 2WFCA 4PXOA 1Z6MA 4P3YB 4V2LA 2LJRA 2YV7A 3KTBA 4ISDA 2EIRA 4DSSB 5IIZA 2HZEA 1F9MA 4IVFA 2PN8A 3H79A 2REMA 3LSZA 1T4ZA 3KM6A 4MMMA 2LJKA 1HNCA 5JWRB 1EV9A 4IELA 4JEDA 3UMAA 5GSSA 2AUVA 1GH2A 3HJOA 2OT3A 1QMVA 4JR6A 5B6NA 1RQMA 3D0ZA 2KUCA 4JZQA 4KDXA 1JFUA 2XBQA 2EFHA 1W4VA 3P2AA 3ZIVA 2PBJA 5JWOB 3F63A 2H70A 2WGRA 1TU7A 3HJMA 4OO5A 2JZTA 2GSTA 1EOHA 5E59A 2BJXA 1EOGA 2F3MA 3ZZXA 2OA7A 1FAAA 3R3EA 1M2AA 1Q4JA 4OFTA 3QOUA 2DJJA 2FWFA 2VCWA 5DALB 1EV4A 1USBA 3JCML 1C72A 1Z7PA 3C1SA 4K0NA 4EVMA 3FZAA 2H19A 2GS3A 3DD3A 4ZB8A 1OYJA 1KEBA 1O6JA 9GSSA 2F8FA 1GUHA 3UVHA 4OWYA 2MBSA 1MD4A 4G0KA 2QSIA 4CHSA 4MK3A 5ECSA 4EUYA 1V9WA 4G10A 1DE1A 1O85A 2HSYA 1YDKA 2O8VB 3TKPA 5ENUA 4ECBA 2GT5A 3HCZA 2LUSA 2R0PA 3GIXA 2DIZA 5KN3A 1R26A 4WR5A 3BD2A 1GSFA 4MP4A 5G5EA 4KUNA 2VCQA 1ZL9A 2V2GA 4KE3A 3QDNA 2LNSA 4HJMA 2CAIA 2LS5A 1AAZA 1XBSA 4G0IA 2PGTA 5CREA 4GQCA 1MDJA 2JACA 4XCSA 3LFLA 1VF4A 4XS6A 1GSQA 4PUAA 5D9XA 5J41A 4ICYA 3CMIA 5B8AA 3IPZA 5DAKA 3GKKA 2JADA 2CQ9A 3FMWA 3GX0A 4K1FA 4BVYA 1WIKA 4MF7A 1Y25A 2HRNA 3GA4A 1KTEA 2YJ7A 1VGLA 2B7KA 3FR3A 1DUGA 3HDCA 1ZCPA 2DBCA 1LU4A 2FWEA 3MNGA 4MJEA 3IC8A 1AIUA 2R0GA 2HRAA 1Z6NA 2HSHA 4I6XA 10GSA 3D5JA 4LLRA 3DEXA 3C1RA 3VFIA 1BG5A 5HR3A 3QAVA 1NSWA 1ERTA 3ED3A 2RM6A 2TIRA 2X99A 1PMTA 1EEMA 1VF3A 5GZZB 1GNEA 2PVOC 1AQWA 3L9VA 3GHAA 1BEDA 1GULA 3UBLA 5G1LA 1FW1A 4IN0A 4Z7XA 2L5OA 1QUWA 3DIEA 1GTIA 1X9SB 3DRNA 2C8UA 3F4TA 3ZYWA 2YZHA 4TXOB 3APQA 2FNOA 1V57A 2H75A 8GSSA 4ECJA 2P31A 1E6BA 3ZFLA 4GSNA 2FLSA 2PWJA 1XWKA 3LYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I8B A;  4K9Z A;  3F9U A;  3ZIT A;  3W6G A;  4KA0 A;  5E4W A;  3IXR A;  4PUF C;  1A2J A;  2H8L A;  1X5C A;  1MD3 A;  1BX9 A;  1B9X C;  2H0G A;  3RHC A;  2HRK A;  2YP6 A;  5B8B A;  2VCV A;  1M7T A;  3TJJ A;  2MYG A;  4RUV A;  3P90 A;  2O89 A;  1EP8 A;  4PNF A;  4HZ4 A;  1HD2 A;  2H76 A;  2C1Y A;  3FHK A;  2OAD A;  4XRD A;  1XW9 A;  4GRF A;  16GS A;  1TI1 A;  4XIH A;  5IOW A;  4L5L A;  5D73 A;  3BJ5 A;  1O81 A;  2FY6 A;  4G19 A;  3IE3 A;  5LD0 A;  4MPF A;  14GS A;  4E8E A;  1NW2 A;  2L4C A;  2LEG A;  5IQY A;  3HY2 A;  4OO4 A;  2KLX A;  1YY7 A;  2DC5 A;  1WOU A;  3FZ4 A;  2R2J A;  3EU4 A;  4LL4 B;  3UAP A;  3IA1 A;  4KND A;  5BMU A;  3F3Q A;  3US3 A;  3HA9 A;  2V1M A;  3DXB A;  5GAP D;  3APS A;  3CSI A;  2YJH A;  3WGE A;  3ZML A;  1YKC A;  1J08 A;  2E2G A;  1SKS B;  3LEF A;  1NHO A;  2H6Z A;  1U87 A;  4ZBA A;  4CW9 A;  5AN1 A;  2OE1 A;  4KSM A;  1TOF A;  4KGI A;  3GH9 A;  2OKA A;  3DKS A;  1B4Q A;  4MZC A;  4L5O A;  5KN1 A;  1WP0 A;  2GSR A;  2H72 A;  2L5L A;  2MBT A;  1K3L A;  2B5Y A;  4MF6 A;  4TXV A;  2FCH A;  4MPG A;  2H73 A;  4N0Z A;  3DVW A;  4BVX A;  3TCO A;  1URM A;  1BYE A;  1Z5Y E;  1SKR B;  2C3T A;  1G6Y A;  1XVW A;  4WBR D;  4ZIJ A;  5ECK B;  3EVI A;  5H5Q A;  2WS2 A;  4XS4 B;  6GST A;  1EZK A;  3VPT A;  1EEJ A;  2B1K A;  1XPV A;  2WRT A;  4TR1 A;  1DSB A;  5DAK B;  1Z3E A;  1TW9 A;  3GN3 A;  1YEP A;  3MWH A;  4BVY B;  3H93 A;  2LTK A;  3U6V A;  4WET A;  2LRN A;  4HDE A;  4BWQ A;  1PRX A;  4HU9 A;  2CX4 A;  1E2Y A;  4HJ2 A;  1ZYQ B;  2X8C A;  1WMJ A;  1Z9H A;  2PMT A;  5IO0 A;  3RAZ A;  3UOM A;  2B1L A;  1T1V A;  4EDY A;  5CAX A;  4ZB6 A;  5ELG A;  1B48 A;  1V2A A;  1TP9 A;  3GH6 A;  1O73 A;  2YAN A;  1BQ7 A;  4AJ6 A;  4I2T A;  4V1A g;  3HD5 A;  3E0U A;  3MDK A;  1PGT A;  5COH A;  2DMM A;  2OBK A;  5CRH A;  2WZ9 A;  2I3Y A;  1ML6 A;  1AUC A;  2CVK A;  4EC0 A;  1N8J A;  1VF2 A;  3GL3 A;  3QMX A;  4RI7 A;  4F82 A;  5HR1 A;  3C7M A;  1R7H A;  5G31 A;  4N30 A;  11GS A;  4EDZ A;  3L4N A;  1W89 A;  2ZCT A;  1F3B A;  1S3D A;  4KDY A;  4TR3 A;  4V2M A;  1A8L A;  1SK2 A;  4DVC A;  2Z9S A;  1IYI A;  3CRT A;  4JRR A;  6GSV A;  4MCU A;  2P0G A;  4LL1 B;  5ECI B;  4IW9 A;  4ZL7 A;  1RK4 A;  4L8E A;  3M3M A;  1IYH A;  2DJ0 A;  3TKS A;  3GL5 A;  2GT6 A;  3VUR A;  4IJ3 A;  3P8W A;  2K8S A;  2VLT A;  1V40 A;  3E3E A;  4I2U A;  3ZVJ D;  2HRK B;  1XZO A;  2IL3 A;  4PX1 A;  3D6I A;  3H4K A;  2C0E A;  5EVO A;  4ZBB A;  1FG4 A;  3KP9 A;  2H71 A;  3VK9 A;  4DEJ A;  1M9B A;  1J0F A;  1OC8 A;  3GST A;  2L6C A;  1GLP A;  3CSH A;  2OE0 A;  2IME A;  2VL2 A;  1BAY A;  1M2B A;  5A5K A;  3ZTL A;  4EKZ A;  5H5R A;  1AQV A;  2BMX A;  5KEJ A;  1ERV A;  3VWV A;  6GSS A;  2C0F A;  2MMO A;  1GUK A;  5EPF A;  4F0C A;  2I9H A;  1XWC A;  4MH2 A;  2K8V A;  3PR8 A;  3GTU A;  1M9A A;  3HZ4 A;  2GVP A;  1WJK A;  1B8X A;  5HFK A;  1OC9 A;  3F8U A;  1FVK A;  2DML A;  4OD7 A;  3DGQ A;  3Q19 A;  3TGZ A;  1JZO A;  1GLQ A;  4ECC A;  3HKR A;  3CXG A;  3C73 A;  2VCZ A;  2OAC A;  4IJI A;  1SD8 A;  3DYR A;  2RUF A;  5ECL B;  2B7J A;  4TR0 A;  5CRD A;  4MJB A;  2C80 A;  3QFA C;  1GSS A;  1TDI A;  3HVX A;  1A0F A;  4NHZ A;  2VM1 A;  1XFL A;  4PQI A;  5DBQ A;  2IWT A;  2N5A A;  4PQH A;  1OKT A;  4GSS A;  1VF1 A;  2LQO A;  3K8N A;  20GS A;  1R5P A;  1TRV A;  3WD6 A;  3FEU A;  2FUG 2;  3OR5 A;  1ILO A;  6GSX A;  1ON4 A;  1PN9 A;  3O6T A;  2N5B A;  4BVX B;  2HSM A;  1BJX A;  5HR2 A;  5ECR B;  2RUE A;  3M9J A;  2X8G A;  1QFN A;  1A8Y A;  4F0B A;  3C8E A;  1JZR A;  3KCM A;  2QC7 A;  3L9S A;  3F4R A;  2UZ8 A;  1MDK A;  2DJK A;  4KSO A;  5ECM B;  4AGS A;  4TR1 B;  4GLT A;  4EE0 A;  4HOJ A;  4K2D A;  3O3T A;  2VD1 A;  3FW2 A;  1AXD A;  2LRC A;  1A2L A;  2O85 A;  3GV1 A;  5JCG A;  3D21 A;  3NOF A;  2OJL A;  18GS A;  3GYK A;  3I43 A;  4WBJ A;  4O32 A;  1JLV A;  1M99 A;  3M9K A;  2V32 A;  1TKD B;  3F0I A;  1H75 A;  5C04 A;  5F06 A;  3RBT A;  3QAG A;  4MZB A;  4O92 A;  1B9Y C;  2MZC A;  4FH8 A;  1CQH A;  2ALB A;  5CNW A;  2VL9 A;  2M46 A;  3TJB A;  2IN3 A;  3AY8 A;  2KOK A;  4MH3 A;  2YWI A;  4KH7 A;  3KEB A;  5DQS A;  1XOB A;  1SL1 B;  3EMX A;  2WCI A;  3WT2 A;  1THO A;  3M1G A;  1ZMA A;  4V1A p;  5ABR A;  3SWL A;  4TR4 A;  4Q5Q A;  1K0M A;  1U3I A;  1XXU A;  5D96 A;  3DWV A;  3FRC A;  1GSE A;  4HS1 A;  3RDW A;  2NDO A;  4IKH A;  5IMV A;  3IV4 A;  4YAV A;  3CTF A;  1XVQ A;  2H0H A;  2TRX A;  3TKR A;  7GSS A;  3J7Y k;  1LBK A;  4XS1 A;  5ECH B;  2DJ2 A;  1GL8 A;  1Y6E A;  3ME7 A;  2VO4 A;  1PSQ A;  3VWW A;  1XCC A;  2L4Q A;  2VOC A;  3EUR A;  1I9D A;  5LNK e;  4GXZ A;  3HVV A;  1FHE A;  5IMF A;  3GSS A;  1YZX A;  3R2Q A;  1U88 A;  5DCG A;  1PA3 A;  1HNA A;  4NV5 A;  1J9B A;  2H1B A;  3ERW A;  4GQF A;  2C0G A;  2HZE B;  1FOV A;  1G6W A;  1ST9 A;  1SKW B;  5A4U A;  4ZXG A;  3CSJ A;  3FR6 A;  2YWO A;  4PTS A;  4POK A;  4NMU A;  1PX7 A;  4TKY A;  2FA8 A;  2KP1 A;  4ML6 A;  3O76 A;  3GKM A;  3L78 A;  4ILF A;  3KTL A;  19GS A;  3GFK A;  3Q6O A;  2VAF A;  4AJ7 A;  1ABA A;  3EYT A;  2PVQ A;  4OMV A;  4ML1 A;  3QCP A;  1GRX A;  2LRT A;  3GUS A;  2H6X A;  3A2X A;  5D9W A;  2ON5 A;  4KX4 A;  17GS A;  2IMD A;  3GUR A;  5AIS A;  1LJR A;  3GRX A;  4DSS A;  4F03 A;  1TJD A;  4J57 E;  4HI7 A;  1XIY A;  2B5E A;  2EIQ A;  1UA5 A;  5EL8 A;  3D4T A;  5G30 A;  2HNL A;  1QGV A;  4YQV A;  3UBK A;  3TRQ A;  4E8H A;  3ZMK A;  1X5E A;  5D9V A;  5G2Z A;  4KW6 A;  1SYR A;  2IJY A;  4G2E A;  3EE2 A;  1EWX A;  4NWY A;  1FVJ A;  1HYU A;  5IM9 A;  5J3R A;  3LWA A;  4EF0 A;  4PGT A;  4EXJ A;  3LYK A;  1B4P A;  3LOR A;  5HFG A;  5IMD A;  4KDU A;  4FO5 A;  2FGX A;  2GQL A;  1GNW A;  1RW1 A;  4MA9 A;  3VI5 A;  3C71 A;  3PIN A;  5DJL A;  2HSM B;  2ZUP A;  3ZL5 A;  4PUR A;  5LCZ A;  3FZ5 A;  3W8S A;  1UC7 A;  4LMV A;  1TRS A;  1N2A A;  1ERU A;  1JZD A;  2KP2 A;  4K0G A;  1MDI A;  2IMK A;  2E7P A;  5A4W A;  1HQO A;  1GTU A;  5ECQ B;  4GTU A;  2VIM A;  5DVB A;  2K18 A;  3PH9 A;  3VI7 A;  1O7U A;  5HQP A;  3FKF A;  2YN1 A;  2IMF A;  3RHB A;  2CA8 A;  4HU7 A;  3I69 A;  2CT6 A;  2GSS A;  4K7O A;  1R5A A;  3ERF A;  4HZ2 A;  4OCF A;  3QAW A;  4WF4 A;  1SYX A;  2RII A;  3A2V A;  1EP7 A;  3DML A;  2F9S A;  1K0B A;  3IHQ A;  4HEA 2;  2KHP A;  1X9W B;  2DSA A;  2H66 A;  1JHB A;  5AGY A;  3ZFB A;  4JU5 A;  4K8M A;  4IBP A;  3F6D A;  1NM3 A;  2DIY A;  3G7Y A;  1YJ6 A;  5DCH A;  1KNG A;  3HZ8 A;  2XHF A;  1G7E A;  2K9F A;  1MTC A;  1S3C A;  3KMO A;  2V6O A;  1K0C A;  4POL A;  2R5G A;  4XRA A;  3RPN A;  2XPE A;  1OE7 A;  2M80 A;  1FB0 A;  5IMC A;  1V98 A;  1U6T A;  2CVB A;  2X8H A;  4FYC A;  5IPG A;  1F2E A;  3MAK A;  5DJM A;  4PNG A;  3F4S A;  3ZRD A;  2LNT A;  4EL1 A;  3ZRE A;  4J2F A;  1TU8 A;  5F0G A;  2C4J A;  4DSQ A;  2QKE A;  2YPM A;  3P7X A;  2VCT A;  5JCU A;  4KCE A;  2GDR A;  1K0O A;  12GS A;  1T4Y A;  2LST A;  3EC3 A;  5ECO B;  4WEY A;  4ZBD A;  4ULX A;  2X64 A;  5IMA A;  2XC2 A;  2HRF A;  4GST A;  4NHW A;  1ZOF A;  1U3A A;  4KAE A;  4RQR A;  2L6D A;  1MEK A;  3PGT A;  1XOA A;  4IP6 A;  3SBC A;  5JWQ B;  1ZYE A;  2ON7 A;  4TVE A;  3ZVJ A;  3QPM A;  5J9B A;  2GSQ A;  1K0A A;  5HR0 A;  3TJK A;  4POM A;  2PER A;  2PPT A;  2FWH A;  13GS A;  2I1U A;  1X0R A;  1GSU A;  2G0F A;  4N10 A;  2LV3 A;  3A3T A;  2LJA A;  4XHM A;  1TK5 B;  4L0U A;  3A2W A;  2HI7 A;  4ZIL A;  1I5G A;  3KIJ A;  1F6M C;  2YWM A;  3UAR A;  3D22 A;  2EIO A;  3KGK A;  2VCX A;  6GSW A;  4IQA A;  4K7I A;  3L9U A;  2I4A A;  3TUE A;  4WKW A;  2HQT A;  5A4V A;  2N5F A;  5B7C A;  4D73 A;  2AHE A;  4BA7 A;  3HHV A;  5FHI A;  2AAW A;  2WB9 A;  3H8Q A;  5ID2 A;  1UVZ A;  2YOI A;  2HT9 A;  2MMN A;  4BL7 A;  4AJ8 A;  4J56 E;  2LKU A;  1ERW A;  5J9C A;  2M72 A;  5IPH A;  4RQX A;  3IAM 2;  4TN8 A;  5CYY A;  2VD0 A;  2XBI A;  4NXI A;  4CDO A;  4OFM A;  4USS A;  3G7I A;  4YH2 A;  4HQS A;  2JSZ A;  3KXO A;  2HLS A;  3LJR A;  5AIV A;  2DJ3 A;  4N0V A;  5ECP B;  3EU3 A;  2FWG A;  2YZU A;  3GX8 A;  2RM5 A;  5CP1 A;  1SK1 A;  3APO A;  1X5D A;  4O5R A;  1PKZ A;  2AJQ B;  5IMZ A;  4I5Q A;  4YQM A;  4NPB A;  3NIV A;  1K3Y A;  2FA4 A;  1HNB A;  5G1K A;  2JZR A;  4IP1 A;  3UL3 A;  2VLV A;  2GZZ A;  3N5O A;  4AF2 A;  1JZW A;  3IRA A;  2CV4 A;  1H4O A;  1S3A A;  4KF9 A;  1XWA A;  3KZQ A;  2H74 A;  2CVD A;  2R4V A;  1JLW A;  5IO2 A;  3KMN A;  2A2R A;  1K3O A;  4GF0 A;  4F2I A;  2J9H A;  3U5R E;  3QD9 A;  3TJF A;  3WT1 A;  3FK8 A;  1F37 A;  4MJC A;  4TW5 A;  1G7O A;  1A2M A;  4IGJ A;  2PUK C;  1OC3 A;  4MZW A;  1SJI A;  4ID0 A;  1FO5 A;  3F3R A;  2GQK A;  5FT3 A;  3IOS A;  2IFQ A;  3Q74 A;  2VL3 A;  3UEM A;  2CAQ A;  2GLR A;  4GCI A;  4JR4 A;  2AV4 A;  3QR6 A;  4XS4 A;  4BWS A;  2MMA A;  3UJ1 A;  4BPY A;  4PQ1 A;  4ZL9 A;  3LG6 A;  3W8J A;  1M2D A;  1QXH A;  5ECN B;  3QFB C;  2VUP A;  3WGD A;  3BCK A;  4HUA A;  4G9H A;  4QL7 A;  4FIW A;  2DJ1 A;  4L0W A;  1A24 A;  4EO3 A;  3FR9 A;  1AC1 A;  3IAS 2;  1EGO A;  3HVS A;  1SD9 A;  2H1G A;  3M8N A;  1OVN A;  2B6M A;  2FHE A;  4O7H A;  4ECI A;  2J23 A;  2EC4 A;  3KH9 A;  1SL2 B;  2D2Z A;  6GSY A;  2YWN A;  2VLU A;  1XWB A;  1SU9 A;  4MDC A;  2H01 A;  2LQQ A;  4OFN A;  4IQ1 A;  2WDU A;  3TOU A;  4K7N A;  1Z7R A;  4Q5N A;  3LQ7 A;  3HXS A;  3KH7 A;  1TTZ A;  5J5N A;  4YQU A;  3CBU A;  1G0T A;  4TOP A;  3VLN A;  4WR4 A;  2NBS A;  1GSY A;  2YV9 A;  2H1D A;  3H1N A;  2QGV A;  2WJU A;  3M0F A;  1A0R P;  1OKD A;  3I9V 2;  4ZL8 A;  2FD3 A;  2GZP A;  5FWG A;  2GQM A;  4ZB9 A;  2B5X A;  4DSR A;  1OAZ A;  1O8X A;  5KN2 A;  1THX A;  2O87 A;  2CZ3 A;  3KJY A;  4FQU A;  4MLY A;  3J7Y b;  4Q5R A;  4KCA A;  2F8A A;  5GST A;  3TDG A;  3HJP A;  2L59 A;  4Q5F A;  3ISO A;  2F51 A;  3TRP A;  2C0D A;  4YAP A;  5D8I A;  3I6A A;  1UN2 A;  2HSN B;  3A5W A;  3GTU B;  3TOT A;  5CO3 A;  4D73 B;  1OC9 B;  5ID2 B;  2JSY A;  5J4U A;  4OCE A;  3BOA A;  2WUL A;  1GP1 A;  4XTS A;  2HFD A;  2K6V A;  3LXT A;  1R4W A;  1O8W A;  1Q98 A;  2V6K A;  3L0H A;  4BL7 B;  2HZF A;  3VWU A;  1PKW A;  3RPP A;  2CX3 A;  5L71 A;  1GTA A;  2I81 A;  3FZ9 A;  1SJZ A;  1T3B A;  4NV2 A;  5INY A;  1T7P B;  2P5Q A;  4JBB A;  4KB3 A;  2IMI A;  2DLX A;  5D93 A;  5F07 A;  3MSZ A;  5F8B A;  1GSD A;  2YCD A;  2HXK A;  3V1W A;  3TJG A;  1SK0 A;  3F6F A;  2C3Q A;  3GNJ A;  1TXX A;  2IPA A;  1WWJ A;  1PL1 A;  1ZGN A;  3IDV A;  2E0Q A;  4FYU A;  1YF1 A;  1K0N A;  1NHY A;  3IC4 A;  2JU5 A;  5ELA A;  2XPD A;  2R3X A;  1FB6 A;  2R37 A;  2NVL A;  2ES7 A;  4F9Z A;  2A2S A;  4TRX A;  2OE3 A;  4H86 A;  5C00 A;  1A23 A;  1XWG A;  5F05 A;  2H6Y A;  3D4M A;  4LMW A;  1WE0 A;  5G5F A;  1SEN A;  4WF5 A;  4MF5 A;  1QQ2 A;  2H0I A;  5DAL A;  2OBI A;  4MAB A;  4QL9 A;  2E2M A;  3G7J A;  2R6K A;  4GWR A;  1KBN A;  4JE1 A;  3FYG A;  2PU9 C;  5DQY A;  3UIW A;  1EGR A;  1VRS D;  3TKS E;  1WPI A;  3UVT A;  6GSU A;  2HE3 A;  1F3A A;  5DDL A;  4N11 A;  1XW5 A;  4X1U A;  2IIY A;  3G9B A;  3FY7 A;  1X9M B;  5HFI A;  5B6M A;  2A4V A;  2P5R A;  1YF0 A;  4IHU A;  4G0L A;  3VWX A;  2BTO T;  1TK0 B;  2IFQ B;  3CTG A;  1PQN A;  1TRU A;  1SL0 B;  5EY6 A;  3N9J A;  3PPU A;  3NZN A;  2GTU A;  3KP8 A;  4HQZ A;  4POB A;  4IS0 A;  1TK8 B;  2O7K A;  4K6X A;  5H5S A;  3GKN A;  22GS A;  3ME8 A;  4FYB A;  3Q18 A;  3DVX A;  1SJ6 A;  4WXT A;  5JCW A;  1QK8 A;  2L57 A;  3EIN A;  3S9F A;  2CZ2 A;  3IBH A;  1AW9 A;  1T00 A;  3TKS C;  5KN0 A;  1ZZY A;  3WYW A;  4X43 A;  3IK7 A;  1DBY A;  2ZNM A;  2JZS A;  4ACS A;  4LA1 A;  1DE2 A;  1TI3 A;  1GWC A;  1V58 A;  2HYX A;  1YEX A;  2GZY A;  3VPQ A;  3IK9 A;  1YKA A;  2GGT A;  1OE8 A;  1M0U A;  2G2Q A;  3WGX A;  1PX6 A;  2H1A A;  5CRG A;  3HYP A;  3TRX A;  2VL2 C;  2B3S A;  3EWL A;  1GUM A;  3TKQ A;  1K0D A;  4QQ7 A;  3IR4 A;  3E9J B;  3BCI A;  5AIX A;  2AYT A;  2VM2 A;  4NAX A;  1TRW A;  1CQG A;  2MMZ A;  3KD0 A;  1YQ1 A;  5CRW A;  2RLI A;  3ZIJ A;  1ACV A;  1T8E B;  3GKX A;  1PL2 A;  5GAN D;  2NTO A;  3LGC A;  2JL4 A;  1PD2 1;  4MJA A;  2YNX A;  3CYN A;  3CRU A;  2H30 A;  2NPB A;  2V41 A;  4I97 A;  3TB2 A;  4RI6 A;  3BBY A;  4TXO A;  1XW6 A;  3GMF A;  2AB6 A;  4V2N A;  5D9T A;  4X0X A;  1AQX A;  1GTB A;  2C3N A;  3ZLP A;  3EMP A;  3ERG A;  3LXZ A;  2TRC P;  5IOX A;  1WRY A;  2WFC A;  4PXO A;  1Z6M A;  4P3Y B;  4V2L A;  2LJR A;  2YV7 A;  3KTB A;  4ISD A;  2EIR A;  4DSS B;  5IIZ A;  2HZE A;  1F9M A;  4IVF A;  2PN8 A;  3H79 A;  2REM A;  3LSZ A;  1T4Z A;  3KM6 A;  4MMM A;  2LJK A;  1HNC A;  5JWR B;  1EV9 A;  4IEL A;  4JED A;  3UMA A;  5GSS A;  2AUV A;  1GH2 A;  3HJO A;  1QMV A;  4JR6 A;  5B6N A;  1RQM A;  3D0Z A;  2KUC A;  4JZQ A;  4KDX A;  1JFU A;  2XBQ A;  1W4V A;  3P2A A;  3ZIV A;  2PBJ A;  5JWO B;  3F63 A;  2H70 A;  2WGR A;  1TU7 A;  3HJM A;  4OO5 A;  2JZT A;  2GST A;  1EOH A;  5E59 A;  2BJX A;  1EOG A;  2F3M A;  3ZZX A;  2OA7 A;  1FAA A;  3R3E A;  1M2A A;  1Q4J A;  4OFT A;  3QOU A;  2DJJ A;  2FWF A;  2VCW A;  5DAL B;  1EV4 A;  1USB A;  3JCM L;  1C72 A;  1Z7P A;  3C1S A;  4K0N A;  4EVM A;  3FZA A;  2H19 A;  2GS3 A;  3DD3 A;  4ZB8 A;  1OYJ A;  1KEB A;  1O6J A;  9GSS A;  2F8F A;  1GUH A;  3UVH A;  4OWY A;  2MBS A;  1MD4 A;  4G0K A;  2QSI A;  4CHS A;  4MK3 A;  5ECS A;  4EUY A;  1V9W A;  4G10 A;  1DE1 A;  1O85 A;  2HSY A;  1YDK A;  2O8V B;  3TKP A;  5ENU A;  3HCZ A;  4ECB A;  2GT5 A;  2LUS A;  3GIX A;  2DIZ A;  5KN3 A;  1R26 A;  4WR5 A;  3BD2 A;  1GSF A;  4MP4 A;  5G5E A;  4KUN A;  2VCQ A;  1ZL9 A;  2V2G A;  4KE3 A;  3QDN A;  2LNS A;  4HJM A;  2CAI A;  2LS5 A;  1AAZ A;  1XBS A;  4G0I A;  2PGT A;  5CRE A;  4GQC A;  1MDJ A;  2JAC A;  4XCS A;  3LFL A;  1VF4 A;  4XS6 A;  1GSQ A;  4PUA A;  5D9X A;  5J41 A;  3CMI A;  5B8A A;  3IPZ A;  5DAK A;  3GKK A;  2JAD A;  2CQ9 A;  3GX0 A;  4K1F A;  4BVY A;  1WIK A;  4MF7 A;  1Y25 A;  2HRN A;  3GA4 A;  1KTE A;  2YJ7 A;  1VGL A;  2B7K A;  3FR3 A;  1DUG A;  3HDC A;  1ZCP A;  2DBC A;  1LU4 A;  2FWE A;  3MNG A;  4MJE A;  3IC8 A;  1AIU A;  2HRA A;  1Z6N A;  2HSH A;  4I6X A;  10GS A;  3D5J A;  4LLR A;  3DEX A;  3C1R A;  3VFI A;  1BG5 A;  5HR3 A;  3QAV A;  1NSW A;  1ERT A;  3ED3 A;  2RM6 A;  2TIR A;  2X99 A;  1PMT A;  1EEM A;  1VF3 A;  5GZZ B;  1GNE A;  2PVO C;  1AQW A;  3L9V A;  3GHA A;  1BED A;  1GUL A;  3UBL A;  5G1L A;  1FW1 A;  4IN0 A;  4Z7X A;  2L5O A;  1QUW A;  3DIE A;  1GTI A;  1X9S B;  3DRN A;  2C8U A;  3F4T A;  3ZYW A;  2YZH A;  4TXO B;  3APQ A;  2FNO A;  1V57 A;  2H75 A;  8GSS A;  4ECJ A;  2P31 A;  1E6B A;  3ZFL A;  4GSN A;  2FLS A;  2PWJ A;  1XWK A;  3LYP A; 
#chains in the Genus database with same CATH topology
 4I8B A;  4K9Z A;  3F9U A;  3ZIT A;  3W6G A;  4KA0 A;  5E4W A;  3IXR A;  4PUF C;  1A2J A;  2H8L A;  1X5C A;  1MD3 A;  2WW1 A;  1BX9 A;  1B9X C;  2H0G A;  3RHC A;  2HRK A;  2YP6 A;  5B8B A;  2VCV A;  1M7T A;  3TJJ A;  2MYG A;  4RUV A;  3P90 A;  2O89 A;  1EP8 A;  4PNF A;  4HZ4 A;  1HD2 A;  2H76 A;  2C1Y A;  3FHK A;  2OAD A;  3CHX C;  4XRD A;  1XW9 A;  4GRF A;  16GS A;  3RGB C;  1TI1 A;  4X4J A;  4XIH A;  5IOW A;  4L5L A;  5D73 A;  3BJ5 A;  1O81 A;  2FY6 A;  3IE3 A;  4G19 A;  5LD0 A;  4MPF A;  14GS A;  4K5S A;  2WVX B;  4E8E A;  1NW2 A;  2L4C A;  2LEG A;  5IQY A;  3EPT A;  3HY2 A;  4OO4 A;  2KLX A;  1YY7 A;  2DC5 A;  1WOU A;  3FZ4 A;  2R2J A;  3EU4 A;  4LL4 B;  3UAP A;  1SVM A;  1SVL A;  3IA1 A;  4KND A;  5BMU A;  3F3Q A;  3US3 A;  3HA9 A;  2V1M A;  3DXB A;  5GAP D;  3APS A;  5J47 A;  3CSI A;  2YJH A;  3WGE A;  1S4B P;  1YKC A;  3ZML A;  2QA2 A;  2WVY A;  1J08 A;  2E2G A;  1SKS B;  3LEF A;  1NHO A;  2H6Z A;  2H1L A;  1U87 A;  4K5R A;  4ZBA A;  4AI6 A;  4CW9 A;  5AN1 A;  2OE1 A;  4KSM A;  1TOF A;  4KGI A;  3GH9 A;  2OKA A;  3DKS A;  1B4Q A;  4MZC A;  4L5O A;  5KN1 A;  1WP0 A;  2GSR A;  2H72 A;  2L5L A;  2MBT A;  1K3L A;  2B5Y A;  4MF6 A;  4TXV A;  2FCH A;  4MPG A;  2H73 A;  4PI0 C;  4N0Z A;  3DVW A;  4BVX A;  3TCO A;  1URM A;  1BYE A;  1Z5Y E;  1SKR B;  2C3T A;  1G6Y A;  1XVW A;  4WBR D;  4ZIJ A;  5ECK B;  3EVI A;  5H5Q A;  2WS2 A;  4XS4 B;  6GST A;  1EZK A;  3VPT A;  1EEJ A;  2B1K A;  1XPV A;  2WRT A;  4TR1 A;  1DSB A;  5DAK B;  1Z3E A;  1TW9 A;  3GN3 A;  1YEP A;  3MWH A;  4BVY B;  3H93 A;  2LTK A;  3U6V A;  4WET A;  2LRN A;  3LW9 A;  4HDE A;  4BWQ A;  1PRX A;  4HU9 A;  2CX4 A;  1E2Y A;  4HJ2 A;  1ZYQ B;  2X8C A;  4E68 A;  1WMJ A;  1Z9H A;  2PMT A;  5IO0 A;  3RAZ A;  3UOM A;  2B1L A;  1T1V A;  4EDY A;  5CAX A;  4ZB6 A;  5ELG A;  1B48 A;  1V2A A;  1TP9 A;  3GH6 A;  1O73 A;  2YAN A;  1BQ7 A;  4AJ6 A;  4I2T A;  4V1A g;  3HD5 A;  3E0U A;  3MDK A;  1PGT A;  5COH A;  2DMM A;  3TU3 B;  2OBK A;  5CRH A;  2WZ9 A;  2I3Y A;  1ML6 A;  1AUC A;  2CVK A;  4EC0 A;  1N8J A;  1VF2 A;  3GL3 A;  4PHZ C;  3CQF A;  3QMX A;  4RI7 A;  4F82 A;  4HSC X;  2WVZ A;  5HR1 A;  3C7M A;  1R7H A;  5G31 A;  4N30 A;  11GS A;  4EDZ A;  3L4N A;  1W89 A;  2ZCT A;  1F3B A;  1S3D A;  4KDY A;  4TR3 A;  4V2M A;  1A8L A;  1SK2 A;  4DVC A;  2Z9S A;  1IYI A;  3CRT A;  4JRR A;  6GSV A;  1ZYN A;  4O5Q A;  4MCU A;  2P0G A;  4LL1 B;  5ECI B;  4IW9 A;  4ZL7 A;  1RK4 A;  4L8E A;  3M3M A;  1IYH A;  2DJ0 A;  3TKS A;  3GL5 A;  2O5V A;  2GT6 A;  3VUR A;  4IJ3 A;  3P8W A;  2K8S A;  2VLT A;  1V40 A;  3E3E A;  4I2U A;  3ZVJ D;  2HRK B;  2EFC A;  4N3Z A;  1XZO A;  2IL3 A;  4PX1 A;  3RFR C;  3D6I A;  3H4K A;  2C0E A;  5EVO A;  4ZBB A;  1FG4 A;  3KP9 A;  2H71 A;  3VK9 A;  4DEJ A;  1M3I A;  1M9B A;  1J0F A;  1OC8 A;  3GST A;  2L6C A;  1GLP A;  3CSH A;  2OE0 A;  2IME A;  2VL2 A;  1BAY A;  1M2B A;  5A5K A;  3ZTL A;  4EKZ A;  5H5R A;  1AQV A;  2BMX A;  5KEJ A;  1ERV A;  3MIX A;  3VWV A;  6GSS A;  2C0F A;  2MMO A;  1GUK A;  5EPF A;  4F0C A;  2I9H A;  1XWC A;  4MH2 A;  2K8V A;  3PR8 A;  2X4A A;  3GTU A;  1M9A A;  3HZ4 A;  2GVP A;  1WJK A;  1B8X A;  5HFK A;  1OC9 A;  3F8U A;  1FVK A;  2DML A;  4OD7 A;  3DGQ A;  3Q19 A;  3TGZ A;  1JZO A;  1GLQ A;  4ECC A;  3HKR A;  4Z2U A;  3CXG A;  3C73 A;  2VCZ A;  2OAC A;  4IJI A;  1SD8 A;  3DYR A;  2RUF A;  5ECL B;  2B7J A;  4TR0 A;  5CRD A;  4MJB A;  2C80 A;  3QFA C;  4K2X A;  1GSS A;  1TDI A;  3HVX A;  1A0F A;  4NHZ A;  2VM1 A;  3HMJ G;  1XFL A;  4PQI A;  5DBQ A;  2IWT A;  2N5A A;  4PQH A;  1OKT A;  4GSS A;  4ZB7 A;  1VF1 A;  2LQO A;  3K8N A;  20GS A;  1R5P A;  3FEU A;  1TRV A;  3WD6 A;  2FUG 2;  3OR5 A;  1ILO A;  6GSX A;  1ON4 A;  1PN9 A;  3O6T A;  2N5B A;  4BVX B;  2HSM A;  1BJX A;  5HR2 A;  5ECR B;  2O36 A;  2RUE A;  1I1I P;  3M9J A;  2X8G A;  1QFN A;  1A8Y A;  4F0B A;  3C8E A;  1JZR A;  3KCM A;  2QC7 A;  3L9S A;  3F4R A;  2UZ8 A;  1MDK A;  2DJK A;  4KSO A;  5ECM B;  4AGS A;  4TR1 B;  4GLT A;  4EE0 A;  4HOJ A;  4K2D A;  3O3T A;  2VD1 A;  3FW2 A;  1AXD A;  2LRC A;  1A2L A;  2O85 A;  3GV1 A;  3A5I A;  5JCG A;  3D21 A;  3NOF A;  2OJL A;  18GS A;  3GYK A;  3I43 A;  4WBJ A;  4O32 A;  1JLV A;  1M99 A;  3M9K A;  2V32 A;  1TKD B;  3F0I A;  1H75 A;  5C04 A;  5F06 A;  3RBT A;  3QAG A;  4MZB A;  4O92 A;  1B9Y C;  2MZC A;  4FH8 A;  1CQH A;  2ALB A;  5CNW A;  2VL9 A;  2M46 A;  3TJB A;  2IN3 A;  3AY8 A;  2KOK A;  4MH3 A;  2YWI A;  4KH7 A;  3KEB A;  1ZYP A;  5DQS A;  1XOB A;  1SL1 B;  3EMX A;  2WCI A;  3WT2 A;  1THO A;  3M1G A;  1ZMA A;  4V1A p;  5ABR A;  3SWL A;  4TR4 A;  4Q5Q A;  1K0M A;  1U3I A;  1XXU A;  5D96 A;  3DWV A;  3FRC A;  1GSE A;  4HS1 A;  3RDW A;  2NDO A;  4IKH A;  5IMV A;  3IV4 A;  4YAV A;  3CTF A;  1XVQ A;  2H0H A;  2TRX A;  3TKR A;  7GSS A;  3J7Y k;  1LBK A;  4XS1 A;  5ECH B;  2DJ2 A;  1GL8 A;  1Y6E A;  3ME7 A;  2VO4 A;  1PSQ A;  2QA1 A;  3VWW A;  1XCC A;  2L4Q A;  2VOC A;  3EUR A;  1I9D A;  5LNK e;  4GXZ A;  3HVV A;  1FHE A;  5IMF A;  3GSS A;  1YZX A;  3R2Q A;  5A34 A;  1U88 A;  5DCG A;  1PA3 A;  1HNA A;  4NV5 A;  1J9B A;  2H1B A;  3ERW A;  4GQF A;  2C0G A;  4YKF A;  4YKG A;  2HZE B;  1FOV A;  1G6W A;  1ST9 A;  1SKW B;  5A4U A;  4ZXG A;  3CSJ A;  3FR6 A;  2YWO A;  4PTS A;  4POK A;  4NMU A;  1PX7 A;  4TKY A;  2FA8 A;  2KP1 A;  4ML6 A;  3O76 A;  3GKM A;  3L78 A;  4ILF A;  3KTL A;  19GS A;  3GFK A;  3Q6O A;  2VAF A;  2UV8 G;  4AJ7 A;  1ABA A;  3EYT A;  2PVQ A;  4OMV A;  3MYD A;  4ML1 A;  3QCP A;  4Z2T A;  1GRX A;  2LRT A;  3GUS A;  2H6X A;  3A2X A;  5D9W A;  2ON5 A;  4KX4 A;  17GS A;  2IMD A;  2DKI A;  3GUR A;  5AIS A;  1TXU A;  1LJR A;  3GRX A;  4DSS A;  4F03 A;  1TJD A;  4AKG A;  4J57 E;  1YVL A;  4HI7 A;  1XIY A;  2B5E A;  2EIQ A;  1UA5 A;  5EL8 A;  3D4T A;  5G30 A;  2HNL A;  1QGV A;  4YQV A;  3UBK A;  3TRQ A;  4E8H A;  3ZMK A;  1X5E A;  5D9V A;  5G2Z A;  4KW6 A;  1SYR A;  2IJY A;  4G2E A;  3EE2 A;  1EWX A;  4NWY A;  1FVJ A;  1HYU A;  5IM9 A;  5J3R A;  3LWA A;  4EF0 A;  4PGT A;  4EXJ A;  3LYK A;  1B4P A;  3LOR A;  5HFG A;  5IMD A;  4KDU A;  4FO5 A;  2FGX A;  2GQL A;  1GNW A;  1RW1 A;  4MA9 A;  3VI5 A;  2WZS A;  3C71 A;  5BRT A;  3PIN A;  5DJL A;  2HSM B;  2ZUP A;  3ZL5 A;  4PUR A;  5LCZ A;  3FZ5 A;  3W8S A;  1UC7 A;  4LMV A;  1TRS A;  1N2A A;  1ERU A;  1JZD A;  4EIQ A;  2KP2 A;  4K0G A;  1MDI A;  2IMK A;  2E7P A;  4G01 A;  5A4W A;  1HQO A;  1GTU A;  5ECQ B;  4GTU A;  2VIM A;  5DVB A;  2K18 A;  3PH9 A;  3VI7 A;  1O7U A;  1S3R A;  5HQP A;  3FKF A;  2YN1 A;  2IMF A;  3RHB A;  2CA8 A;  4HU7 A;  3I69 A;  2CT6 A;  2GSS A;  4K7O A;  1R5A A;  3ERF A;  4HZ2 A;  2A4H A;  3QAW A;  4OCF A;  4WF4 A;  1SYX A;  2RII A;  3A2V A;  1EP7 A;  3DML A;  2F9S A;  1K0B A;  3IHQ A;  4HEA 2;  2KHP A;  1X9W B;  2DSA A;  2H66 A;  1JHB A;  5AGY A;  3ZFB A;  4JU5 A;  4K8M A;  4IBP A;  3F6D A;  1NM3 A;  2DIY A;  3G7Y A;  1YJ6 A;  5DCH A;  1KNG A;  3HZ8 A;  2XHF A;  1G7E A;  2K9F A;  1MTC A;  1S3C A;  3KMO A;  2V6O A;  1K0C A;  4POL A;  2R5G A;  4XRA A;  3RPN A;  2XPE A;  1OE7 A;  1BF5 A;  2M80 A;  1FB0 A;  5IMC A;  1V98 A;  1U6T A;  2CVB A;  2X8H A;  4FYC A;  5IPG A;  1F2E A;  3MAK A;  5DJM A;  4CY6 A;  4PNG A;  3F4S A;  3ZRD A;  2LNT A;  4EL1 A;  3ZRE A;  4J2F A;  1TU8 A;  5A1N A;  5F0G A;  2C4J A;  4DSQ A;  2QKE A;  2YPM A;  3P7X A;  1M3J A;  2VCT A;  5JCU A;  4KCE A;  2GDR A;  1K0O A;  12GS A;  1T4Y A;  2LST A;  5A34 B;  3EC3 A;  5ECO B;  4WEY A;  4ZBD A;  4ULX A;  2X64 A;  5IMA A;  2XC2 A;  2HRF A;  4GST A;  4NHW A;  1ZOF A;  1U3A A;  4KAE A;  4RQR A;  2L6D A;  1MEK A;  3PGT A;  4MNN A;  1XOA A;  4IP6 A;  3SBC A;  5JWQ B;  1ZYE A;  2ON7 A;  4TVE A;  3ZVJ A;  3QPM A;  5J9B A;  2GSQ A;  1K0A A;  5HR0 A;  3TJK A;  4POM A;  2PER A;  2PPT A;  2FWH A;  13GS A;  2I1U A;  1X0R A;  1GSU A;  2G0F A;  4N10 A;  2LV3 A;  3A3T A;  2LJA A;  4XHM A;  1TK5 B;  4L0U A;  3A2W A;  2HI7 A;  4ZIL A;  2X49 A;  1I5G A;  3KIJ A;  1F6M C;  2YWM A;  3UAR A;  3D22 A;  2EIO A;  2HSN A;  3KGK A;  2VCX A;  4FXY P;  6GSW A;  4IQA A;  4K7I A;  3L9U A;  2I4A A;  3TUE A;  4WKW A;  2HQT A;  5A4V A;  4AKX B;  2N5F A;  5B7C A;  4D73 A;  2AHE A;  4BA7 A;  4AKI A;  3HHV A;  5FHI A;  2AAW A;  2WB9 A;  3H8Q A;  5ID2 A;  1Y1U A;  1UVZ A;  2YOI A;  2HT9 A;  5BMU B;  2MMN A;  4BL7 A;  4AJ8 A;  4J56 E;  2LKU A;  1ERW A;  2WW3 A;  5J9C A;  2M72 A;  5IPH A;  4RQX A;  3IAM 2;  4TN8 A;  5CYY A;  2VD0 A;  2XBI A;  4NXI A;  4CDO A;  4OFM A;  5KOW A;  4USS A;  3G7I A;  4YH2 A;  4HQS A;  2JSZ A;  3KXO A;  2HLS A;  3LJR A;  5AIV A;  2DJ3 A;  4N0V A;  5ECP B;  3EU3 A;  2FWG A;  2YZU A;  3GX8 A;  2RM5 A;  5CP1 A;  1SK1 A;  3APO A;  1X5D A;  4O5R A;  1PKZ A;  2AJQ B;  5IMZ A;  2VKZ G;  4I5Q A;  4YQM A;  4NPB A;  3NIV A;  1K3Y A;  2FA4 A;  1HNB A;  5G1K A;  2JZR A;  4IP1 A;  3UL3 A;  2VLV A;  2GZZ A;  3N5O A;  4AF2 A;  1JZW A;  3IRA A;  2CV4 A;  1H4O A;  1S3A A;  4KF9 A;  1XWA A;  3KZQ A;  2H74 A;  2CVD A;  2R4V A;  1JLW A;  5IO2 A;  3KMN A;  2A2R A;  1K3O A;  4GF0 A;  4F2I A;  2J9H A;  3U5R E;  3QD9 A;  3TJF A;  3WT1 A;  3FK8 A;  1F37 A;  4MJC A;  4TW5 A;  1G7O A;  1A2M A;  4IGJ A;  2PUK C;  1OC3 A;  4MZW A;  1SJI A;  4ID0 A;  1FO5 A;  3F3R A;  2GQK A;  5FT3 A;  3IOS A;  2IFQ A;  3Q74 A;  2VL3 A;  3UEM A;  2CAQ A;  2GLR A;  4GCI A;  4JR4 A;  2AV4 A;  3QR6 A;  4XS4 A;  5KOX A;  4BWS A;  2MMA A;  3UJ1 A;  4BPY A;  4PQ1 A;  4ZL9 A;  3LG6 A;  3W8J A;  1M2D A;  1QXH A;  5ECN B;  3QFB C;  2VUP A;  3WGD A;  3BCK A;  4HUA A;  4G9H A;  4QL7 A;  4FIW A;  5A1N B;  2DJ1 A;  4L0W A;  1A24 A;  4EO3 A;  3FR9 A;  1AC1 A;  3IAS 2;  1EGO A;  4CY8 A;  3HVS A;  1SD9 A;  2H1G A;  3M8N A;  1OVN A;  2B6M A;  2FHE A;  4O7H A;  4ECI A;  2J23 A;  2EC4 A;  3KH9 A;  1SL2 B;  2EFE A;  2D2Z A;  6GSY A;  2YWN A;  2VLU A;  1XWB A;  1SU9 A;  4MDC A;  2H01 A;  2LQQ A;  4OFN A;  4IQ1 A;  2WDU A;  3TOU A;  1PN0 A;  4K7N A;  4O5U A;  1Z7R A;  4Q5N A;  3LQ7 A;  3HXS A;  3KH7 A;  1TTZ A;  5J5N A;  4YQU A;  3CBU A;  5J40 A;  1G0T A;  4TOP A;  3VLN A;  4WR4 A;  2NBS A;  1GSY A;  2YV9 A;  1N25 A;  2H1D A;  5A5H A;  3H1N A;  2QGV A;  2WJU A;  3M0F A;  1A0R P;  1OKD A;  3I9V 2;  2WW0 A;  3IHG A;  4ZL8 A;  2FD3 A;  2GZP A;  5FWG A;  2GQM A;  4ZB9 A;  2B5X A;  4DSR A;  1OAZ A;  1O8X A;  5KN2 A;  1THX A;  2O87 A;  2CZ3 A;  3KJY A;  4FQU A;  4MLY A;  3J7Y b;  4Q5R A;  4KCA A;  2F8A A;  5GST A;  3TDG A;  3HJP A;  2L59 A;  4Q5F A;  1FOH A;  3ISO A;  2F51 A;  3TRP A;  2C0D A;  4YAP A;  5D8I A;  3I6A A;  1UN2 A;  3CWG A;  2HSN B;  3A5W A;  3GTU B;  3TOT A;  5CO3 A;  4D73 B;  4GDF A;  1OC9 B;  5ID2 B;  2JSY A;  5J4U A;  4OCE A;  3BOA A;  2WUL A;  1GP1 A;  4XTS A;  2HFD A;  2K6V A;  3LXT A;  1R4W A;  1O8W A;  1Q98 A;  2V6K A;  3L0H A;  4BL7 B;  2HZF A;  3VWU A;  2DKH A;  1PKW A;  3RPP A;  2CX3 A;  5L71 A;  1GTA A;  2I81 A;  3FZ9 A;  1SJZ A;  1T3B A;  4NV2 A;  5INY A;  1YEW C;  1T7P B;  2P5Q A;  4JBB A;  4KB3 A;  2IMI A;  2DLX A;  5D93 A;  5F07 A;  3MSZ A;  5F8B A;  1GSD A;  2YCD A;  2HXK A;  3V1W A;  3TJG A;  1SK0 A;  3F6F A;  2C3Q A;  3GNJ A;  1TXX A;  2IPA A;  1WWJ A;  1PL1 A;  1ZGN A;  3IDV A;  2E0Q A;  4FYU A;  1YF1 A;  1K0N A;  1NHY A;  3IC4 A;  2JU5 A;  2EFD A;  5ELA A;  2XPD A;  2R3X A;  1FB6 A;  2R37 A;  2NVL A;  2ES7 A;  4F9Z A;  2A2S A;  4TRX A;  2OE3 A;  4H86 A;  5C00 A;  1A23 A;  3HVN A;  1XWG A;  5F05 A;  2H6Y A;  3D4M A;  4LMW A;  1WE0 A;  5G5F A;  1SEN A;  4WF5 A;  4MF5 A;  1QQ2 A;  2H0I A;  5DAL A;  2OBI A;  4MAB A;  4QL9 A;  2E2M A;  3G7J A;  2R6K A;  4GWR A;  1KBN A;  4JE1 A;  3FYG A;  2PU9 C;  5DQY A;  3UIW A;  1EGR A;  1VRS D;  3TKS E;  1WPI A;  3UVT A;  6GSU A;  2HE3 A;  1F3A A;  5DDL A;  4N11 A;  1XW5 A;  4X1U A;  2IIY A;  3G9B A;  3FY7 A;  1X9M B;  5HFI A;  5B6M A;  2A4V A;  2P5R A;  1YF0 A;  4IHU A;  4QMK A;  4G0L A;  3VWX A;  2BTO T;  1TK0 B;  2IFQ B;  4A5P A;  3CTG A;  1PQN A;  1TRU A;  1SL0 B;  5EY6 A;  3N9J A;  3PPU A;  3NZN A;  2GTU A;  3KP8 A;  4HQZ A;  4POB A;  4IS0 A;  1TK8 B;  2O7K A;  4K6X A;  5H5S A;  3GKN A;  22GS A;  3ME8 A;  4FYB A;  3Q18 A;  3DVX A;  5J4V A;  1SJ6 A;  4Z2R A;  4WXT A;  5JCW A;  1QK8 A;  2L57 A;  3EIN A;  3S9F A;  2CZ2 A;  3IBH A;  1AW9 A;  1T00 A;  3TKS C;  5KN0 A;  1ZZY A;  3WYW A;  4X43 A;  3IK7 A;  1DBY A;  2ZNM A;  2JZS A;  4ACS A;  4LA1 A;  1DE2 A;  1TI3 A;  1GWC A;  1V58 A;  2HYX A;  1YEX A;  2GZY A;  3VPQ A;  3IK9 A;  1YKA A;  2GGT A;  1OE8 A;  1M0U A;  2G2Q A;  3WGX A;  1PX6 A;  2H1A A;  5CRG A;  3HYP A;  3TRX A;  1XG8 A;  2VL2 C;  2B3S A;  5A5H B;  3EWL A;  1GUM A;  3TKQ A;  1K0D A;  4QQ7 A;  3IR4 A;  3E9J B;  1BG1 A;  3BCI A;  5AIX A;  2O3E A;  2AYT A;  2VM2 A;  4NAX A;  1TRW A;  1CQG A;  2MMZ A;  3KD0 A;  1YQ1 A;  5CRW A;  2RLI A;  3ZIJ A;  1ACV A;  1T8E B;  4W66 A;  2R0C A;  3GKX A;  1PL2 A;  5GAN D;  2NTO A;  2A2P A;  4EIP A;  3LGC A;  2JL4 A;  1PD2 1;  4MJA A;  2YNX A;  3CYN A;  3CRU A;  2H30 A;  2NPB A;  1SVO A;  5J4Y A;  2V41 A;  4I97 A;  3TB2 A;  4RI6 A;  3BBY A;  4TXO A;  1XW6 A;  2WW2 A;  3GMF A;  2AB6 A;  4V2N A;  5D9T A;  4BIK A;  4X0X A;  1AQX A;  1GTB A;  2C3N A;  4AKH A;  3EMP A;  3ERG A;  3ZLP A;  3LXZ A;  2TRC P;  5IOX A;  1WRY A;  2WFC A;  4PXO A;  1Z6M A;  4P3Y B;  4V2L A;  2LJR A;  2YV7 A;  3KTB A;  4ISD A;  2EIR A;  4DSS B;  5IIZ A;  2HZE A;  1F9M A;  4IVF A;  2PN8 A;  3H79 A;  2REM A;  3LSZ A;  1T4Z A;  3KM6 A;  4MMM A;  2LJK A;  1HNC A;  5JWR B;  1EV9 A;  4IEL A;  4JED A;  3UMA A;  5GSS A;  2AUV A;  1GH2 A;  3HJO A;  2OT3 A;  1QMV A;  4JR6 A;  5B6N A;  1RQM A;  3D0Z A;  2KUC A;  4JZQ A;  4KDX A;  1JFU A;  2XBQ A;  2EFH A;  1W4V A;  3P2A A;  3ZIV A;  2PBJ A;  5JWO B;  3F63 A;  2H70 A;  2WGR A;  1TU7 A;  3HJM A;  2WVX A;  4OO5 A;  2JZT A;  2GST A;  1EOH A;  5E59 A;  2BJX A;  1EOG A;  2F3M A;  3ZZX A;  2OA7 A;  1FAA A;  3R3E A;  1M2A A;  1Q4J A;  4OFT A;  3QOU A;  2DJJ A;  2FWF A;  2VCW A;  5DAL B;  1EV4 A;  1USB A;  3JCM L;  1C72 A;  1Z7P A;  3C1S A;  4K0N A;  4EVM A;  3FZA A;  2H19 A;  2GS3 A;  3DD3 A;  4ZB8 A;  1OYJ A;  1KEB A;  1O6J A;  9GSS A;  2F8F A;  1GUH A;  3UVH A;  4OWY A;  2MBS A;  1MD4 A;  4G0K A;  2QSI A;  4CHS A;  4MK3 A;  5ECS A;  4EUY A;  1V9W A;  4G10 A;  1DE1 A;  1O85 A;  2HSY A;  1YDK A;  2O8V B;  3TKP A;  5ENU A;  4ECB A;  2GT5 A;  3HCZ A;  2LUS A;  2R0P A;  3GIX A;  2DIZ A;  5KN3 A;  1R26 A;  4WR5 A;  3BD2 A;  1GSF A;  4MP4 A;  5G5E A;  4KUN A;  2VCQ A;  1ZL9 A;  2V2G A;  4KE3 A;  3QDN A;  2LNS A;  4HJM A;  2CAI A;  2LS5 A;  1AAZ A;  1XBS A;  4G0I A;  2PGT A;  5CRE A;  4GQC A;  1MDJ A;  2JAC A;  4XCS A;  3LFL A;  1VF4 A;  4XS6 A;  1GSQ A;  4PUA A;  5D9X A;  5J41 A;  4ICY A;  3CMI A;  5B8A A;  3IPZ A;  5DAK A;  3GKK A;  2JAD A;  2CQ9 A;  3FMW A;  3GX0 A;  4K1F A;  4BVY A;  1WIK A;  4MF7 A;  4PI2 C;  1Y25 A;  2HRN A;  3GA4 A;  1KTE A;  2YJ7 A;  1VGL A;  2B7K A;  3FR3 A;  1DUG A;  3HDC A;  1ZCP A;  2DBC A;  1LU4 A;  2FWE A;  3MNG A;  4MJE A;  3IC8 A;  1AIU A;  2R0G A;  2HRA A;  1Z6N A;  2HSH A;  4I6X A;  10GS A;  3D5J A;  4LLR A;  3DEX A;  3C1R A;  3VFI A;  1BG5 A;  5HR3 A;  3QAV A;  1NSW A;  1ERT A;  3ED3 A;  2RM6 A;  2TIR A;  2X99 A;  1PMT A;  1EEM A;  1VF3 A;  5GZZ B;  1GNE A;  2PVO C;  1AQW A;  1PFO A;  3L9V A;  3GHA A;  1BED A;  1GUL A;  3UBL A;  5G1L A;  1FW1 A;  4IN0 A;  4Z7X A;  2L5O A;  1QUW A;  3DIE A;  1GTI A;  1X9S B;  3DRN A;  2C8U A;  3F4T A;  3ZYW A;  2YZH A;  4TXO B;  3APQ A;  2FNO A;  1V57 A;  2H75 A;  8GSS A;  4ECJ A;  2P31 A;  1E6B A;  3ZFL A;  4GSN A;  2FLS A;  2PWJ A;  1XWK A;  3LYP A; 
#chains in the Genus database with same CATH homology
 4I8B A;  4K9Z A;  3F9U A;  3ZIT A;  3W6G A;  4KA0 A;  5E4W A;  3IXR A;  4PUF C;  1A2J A;  2H8L A;  1X5C A;  1MD3 A;  1BX9 A;  1B9X C;  2H0G A;  3RHC A;  2HRK A;  2YP6 A;  5B8B A;  2VCV A;  1M7T A;  3TJJ A;  2MYG A;  4RUV A;  3P90 A;  2O89 A;  1EP8 A;  4PNF A;  4HZ4 A;  1HD2 A;  2H76 A;  2C1Y A;  3FHK A;  2OAD A;  4XRD A;  1XW9 A;  4GRF A;  16GS A;  1TI1 A;  4X4J A;  4XIH A;  5IOW A;  4L5L A;  5D73 A;  3BJ5 A;  1O81 A;  2FY6 A;  3IE3 A;  4G19 A;  5LD0 A;  4MPF A;  14GS A;  4K5S A;  4E8E A;  1NW2 A;  2L4C A;  2LEG A;  5IQY A;  3EPT A;  3HY2 A;  4OO4 A;  2KLX A;  1YY7 A;  2DC5 A;  1WOU A;  3FZ4 A;  2R2J A;  3EU4 A;  4LL4 B;  3UAP A;  1SVM A;  1SVL A;  3IA1 A;  4KND A;  5BMU A;  3F3Q A;  3US3 A;  3HA9 A;  2V1M A;  3DXB A;  5GAP D;  3APS A;  5J47 A;  3CSI A;  2YJH A;  3WGE A;  3ZML A;  1YKC A;  2QA2 A;  1J08 A;  2E2G A;  1SKS B;  3LEF A;  1NHO A;  2H6Z A;  2H1L A;  1U87 A;  4K5R A;  4ZBA A;  4AI6 A;  4CW9 A;  5AN1 A;  2OE1 A;  4KSM A;  1TOF A;  4KGI A;  3GH9 A;  2OKA A;  3DKS A;  1B4Q A;  4MZC A;  4L5O A;  5KN1 A;  1WP0 A;  2GSR A;  2H72 A;  2L5L A;  2MBT A;  1K3L A;  2B5Y A;  4MF6 A;  4TXV A;  2FCH A;  4MPG A;  2H73 A;  4N0Z A;  3DVW A;  4BVX A;  3TCO A;  1URM A;  1BYE A;  1Z5Y E;  1SKR B;  2C3T A;  1G6Y A;  1XVW A;  4WBR D;  4ZIJ A;  5ECK B;  3EVI A;  5H5Q A;  2WS2 A;  4XS4 B;  6GST A;  1EZK A;  3VPT A;  1EEJ A;  2B1K A;  1XPV A;  2WRT A;  4TR1 A;  1DSB A;  5DAK B;  1Z3E A;  1TW9 A;  3GN3 A;  1YEP A;  3MWH A;  4BVY B;  3H93 A;  2LTK A;  3U6V A;  4WET A;  2LRN A;  3LW9 A;  4HDE A;  4BWQ A;  1PRX A;  4HU9 A;  2CX4 A;  1E2Y A;  4HJ2 A;  1ZYQ B;  2X8C A;  4E68 A;  1WMJ A;  1Z9H A;  2PMT A;  5IO0 A;  3RAZ A;  3UOM A;  2B1L A;  1T1V A;  4EDY A;  5CAX A;  4ZB6 A;  5ELG A;  1B48 A;  1V2A A;  1TP9 A;  3GH6 A;  1O73 A;  2YAN A;  1BQ7 A;  4AJ6 A;  4I2T A;  4V1A g;  3HD5 A;  3E0U A;  3MDK A;  1PGT A;  5COH A;  2DMM A;  3TU3 B;  2OBK A;  5CRH A;  2WZ9 A;  2I3Y A;  1ML6 A;  1AUC A;  2CVK A;  4EC0 A;  1N8J A;  1VF2 A;  3GL3 A;  3QMX A;  4RI7 A;  4F82 A;  5HR1 A;  3C7M A;  1R7H A;  5G31 A;  4N30 A;  11GS A;  4EDZ A;  3L4N A;  1W89 A;  2ZCT A;  1F3B A;  1S3D A;  4KDY A;  4TR3 A;  4V2M A;  1A8L A;  1SK2 A;  4DVC A;  2Z9S A;  1IYI A;  3CRT A;  4JRR A;  6GSV A;  1ZYN A;  4O5Q A;  4MCU A;  2P0G A;  4LL1 B;  5ECI B;  4IW9 A;  4ZL7 A;  1RK4 A;  4L8E A;  3M3M A;  1IYH A;  2DJ0 A;  3TKS A;  3GL5 A;  2O5V A;  2GT6 A;  3VUR A;  4IJ3 A;  3P8W A;  2K8S A;  2VLT A;  1V40 A;  3E3E A;  4I2U A;  3ZVJ D;  2HRK B;  2EFC A;  4N3Z A;  1XZO A;  2IL3 A;  4PX1 A;  3D6I A;  3H4K A;  2C0E A;  5EVO A;  4ZBB A;  1FG4 A;  3KP9 A;  2H71 A;  3VK9 A;  4DEJ A;  1M9B A;  1J0F A;  1OC8 A;  3GST A;  2L6C A;  1GLP A;  3CSH A;  2OE0 A;  2IME A;  2VL2 A;  1BAY A;  1M2B A;  5A5K A;  3ZTL A;  4EKZ A;  5H5R A;  1AQV A;  2BMX A;  5KEJ A;  1ERV A;  3MIX A;  3VWV A;  6GSS A;  2C0F A;  2MMO A;  1GUK A;  5EPF A;  4F0C A;  2I9H A;  1XWC A;  4MH2 A;  2K8V A;  3PR8 A;  2X4A A;  3GTU A;  1M9A A;  3HZ4 A;  2GVP A;  1WJK A;  1B8X A;  5HFK A;  1OC9 A;  3F8U A;  1FVK A;  2DML A;  4OD7 A;  3DGQ A;  3Q19 A;  3TGZ A;  1JZO A;  1GLQ A;  4ECC A;  3HKR A;  4Z2U A;  3CXG A;  3C73 A;  2VCZ A;  2OAC A;  4IJI A;  1SD8 A;  3DYR A;  2RUF A;  5ECL B;  2B7J A;  4TR0 A;  5CRD A;  4MJB A;  2C80 A;  3QFA C;  4K2X A;  1GSS A;  1TDI A;  3HVX A;  1A0F A;  4NHZ A;  2VM1 A;  3HMJ G;  1XFL A;  4PQI A;  5DBQ A;  2IWT A;  2N5A A;  4PQH A;  1OKT A;  4GSS A;  4ZB7 A;  1VF1 A;  2LQO A;  3K8N A;  20GS A;  1R5P A;  1TRV A;  3WD6 A;  3FEU A;  2FUG 2;  3OR5 A;  1ILO A;  6GSX A;  1ON4 A;  1PN9 A;  3O6T A;  2N5B A;  4BVX B;  2HSM A;  1BJX A;  5HR2 A;  5ECR B;  2RUE A;  3M9J A;  2X8G A;  1QFN A;  1A8Y A;  4F0B A;  3C8E A;  1JZR A;  3KCM A;  2QC7 A;  3L9S A;  3F4R A;  2UZ8 A;  1MDK A;  2DJK A;  4KSO A;  5ECM B;  4AGS A;  4TR1 B;  4GLT A;  4EE0 A;  4HOJ A;  4K2D A;  3O3T A;  2VD1 A;  3FW2 A;  1AXD A;  2LRC A;  1A2L A;  2O85 A;  3GV1 A;  3A5I A;  5JCG A;  3D21 A;  3NOF A;  2OJL A;  18GS A;  3GYK A;  3I43 A;  4WBJ A;  4O32 A;  1JLV A;  1M99 A;  3M9K A;  2V32 A;  1TKD B;  3F0I A;  1H75 A;  5C04 A;  5F06 A;  3RBT A;  3QAG A;  4MZB A;  4O92 A;  1B9Y C;  2MZC A;  4FH8 A;  1CQH A;  2ALB A;  5CNW A;  2VL9 A;  2M46 A;  3TJB A;  2IN3 A;  3AY8 A;  2KOK A;  4MH3 A;  2YWI A;  4KH7 A;  3KEB A;  1ZYP A;  5DQS A;  1XOB A;  1SL1 B;  3EMX A;  2WCI A;  3WT2 A;  1THO A;  3M1G A;  1ZMA A;  4V1A p;  5ABR A;  3SWL A;  4TR4 A;  4Q5Q A;  1K0M A;  1U3I A;  1XXU A;  5D96 A;  3DWV A;  3FRC A;  1GSE A;  4HS1 A;  3RDW A;  2NDO A;  4IKH A;  5IMV A;  3IV4 A;  4YAV A;  3CTF A;  1XVQ A;  2H0H A;  2TRX A;  3TKR A;  7GSS A;  3J7Y k;  1LBK A;  4XS1 A;  5ECH B;  2DJ2 A;  1GL8 A;  1Y6E A;  3ME7 A;  2VO4 A;  1PSQ A;  2QA1 A;  3VWW A;  1XCC A;  2L4Q A;  2VOC A;  3EUR A;  1I9D A;  5LNK e;  4GXZ A;  3HVV A;  1FHE A;  5IMF A;  3GSS A;  1YZX A;  3R2Q A;  5A34 A;  1U88 A;  5DCG A;  1PA3 A;  1HNA A;  4NV5 A;  1J9B A;  2H1B A;  3ERW A;  4GQF A;  2C0G A;  4YKF A;  4YKG A;  2HZE B;  1FOV A;  1G6W A;  1ST9 A;  1SKW B;  5A4U A;  4ZXG A;  3CSJ A;  3FR6 A;  2YWO A;  4PTS A;  4POK A;  4NMU A;  1PX7 A;  4TKY A;  2FA8 A;  2KP1 A;  4ML6 A;  3O76 A;  3GKM A;  3L78 A;  4ILF A;  3KTL A;  19GS A;  3GFK A;  3Q6O A;  2VAF A;  2UV8 G;  4AJ7 A;  1ABA A;  3EYT A;  2PVQ A;  4OMV A;  3MYD A;  4ML1 A;  3QCP A;  4Z2T A;  1GRX A;  2LRT A;  3GUS A;  2H6X A;  3A2X A;  5D9W A;  2ON5 A;  4KX4 A;  17GS A;  2IMD A;  2DKI A;  3GUR A;  5AIS A;  1TXU A;  1LJR A;  3GRX A;  4DSS A;  4F03 A;  1TJD A;  4AKG A;  4J57 E;  1YVL A;  4HI7 A;  1XIY A;  2B5E A;  2EIQ A;  1UA5 A;  5EL8 A;  3D4T A;  5G30 A;  2HNL A;  1QGV A;  4YQV A;  3UBK A;  3TRQ A;  4E8H A;  3ZMK A;  1X5E A;  5D9V A;  5G2Z A;  4KW6 A;  1SYR A;  2IJY A;  4G2E A;  3EE2 A;  1EWX A;  4NWY A;  1FVJ A;  1HYU A;  5IM9 A;  5J3R A;  3LWA A;  4EF0 A;  4PGT A;  4EXJ A;  3LYK A;  1B4P A;  3LOR A;  5HFG A;  5IMD A;  4KDU A;  4FO5 A;  2FGX A;  2GQL A;  1GNW A;  1RW1 A;  4MA9 A;  3VI5 A;  3C71 A;  5BRT A;  3PIN A;  5DJL A;  2HSM B;  2ZUP A;  3ZL5 A;  4PUR A;  5LCZ A;  3FZ5 A;  3W8S A;  1UC7 A;  4LMV A;  1TRS A;  1N2A A;  1ERU A;  1JZD A;  4EIQ A;  2KP2 A;  4K0G A;  1MDI A;  2IMK A;  2E7P A;  4G01 A;  5A4W A;  1HQO A;  1GTU A;  5ECQ B;  4GTU A;  2VIM A;  5DVB A;  2K18 A;  3PH9 A;  3VI7 A;  1O7U A;  5HQP A;  3FKF A;  2YN1 A;  2IMF A;  3RHB A;  2CA8 A;  4HU7 A;  3I69 A;  2CT6 A;  2GSS A;  4K7O A;  1R5A A;  3ERF A;  4HZ2 A;  2A4H A;  3QAW A;  4OCF A;  4WF4 A;  1SYX A;  2RII A;  3A2V A;  1EP7 A;  3DML A;  2F9S A;  1K0B A;  3IHQ A;  4HEA 2;  2KHP A;  1X9W B;  2DSA A;  2H66 A;  1JHB A;  5AGY A;  3ZFB A;  4JU5 A;  4K8M A;  4IBP A;  3F6D A;  1NM3 A;  2DIY A;  3G7Y A;  1YJ6 A;  5DCH A;  1KNG A;  3HZ8 A;  2XHF A;  1G7E A;  2K9F A;  1MTC A;  1S3C A;  3KMO A;  2V6O A;  1K0C A;  4POL A;  2R5G A;  4XRA A;  3RPN A;  2XPE A;  1OE7 A;  1BF5 A;  2M80 A;  1FB0 A;  5IMC A;  1V98 A;  1U6T A;  2CVB A;  2X8H A;  4FYC A;  5IPG A;  1F2E A;  3MAK A;  5DJM A;  4CY6 A;  4PNG A;  3F4S A;  3ZRD A;  2LNT A;  4EL1 A;  3ZRE A;  4J2F A;  1TU8 A;  5A1N A;  5F0G A;  2C4J A;  4DSQ A;  2QKE A;  2YPM A;  3P7X A;  2VCT A;  5JCU A;  4KCE A;  2GDR A;  1K0O A;  12GS A;  1T4Y A;  2LST A;  5A34 B;  3EC3 A;  5ECO B;  4WEY A;  4ZBD A;  4ULX A;  2X64 A;  5IMA A;  2XC2 A;  2HRF A;  4GST A;  4NHW A;  1ZOF A;  1U3A A;  4KAE A;  4RQR A;  2L6D A;  1MEK A;  3PGT A;  4MNN A;  1XOA A;  4IP6 A;  3SBC A;  5JWQ B;  1ZYE A;  2ON7 A;  4TVE A;  3ZVJ A;  3QPM A;  5J9B A;  2GSQ A;  1K0A A;  5HR0 A;  3TJK A;  4POM A;  2PER A;  2PPT A;  2FWH A;  13GS A;  2I1U A;  1X0R A;  1GSU A;  2G0F A;  4N10 A;  2LV3 A;  3A3T A;  2LJA A;  4XHM A;  1TK5 B;  4L0U A;  3A2W A;  2HI7 A;  4ZIL A;  2X49 A;  1I5G A;  3KIJ A;  1F6M C;  2YWM A;  3UAR A;  3D22 A;  2EIO A;  2HSN A;  3KGK A;  2VCX A;  6GSW A;  4IQA A;  4K7I A;  3L9U A;  2I4A A;  3TUE A;  4WKW A;  2HQT A;  5A4V A;  4AKX B;  2N5F A;  5B7C A;  4D73 A;  2AHE A;  4BA7 A;  4AKI A;  3HHV A;  5FHI A;  2AAW A;  2WB9 A;  3H8Q A;  5ID2 A;  1Y1U A;  1UVZ A;  2YOI A;  2HT9 A;  5BMU B;  2MMN A;  4BL7 A;  4AJ8 A;  4J56 E;  2LKU A;  1ERW A;  5J9C A;  2M72 A;  5IPH A;  4RQX A;  3IAM 2;  4TN8 A;  5CYY A;  2VD0 A;  2XBI A;  4NXI A;  4CDO A;  4OFM A;  5KOW A;  4USS A;  3G7I A;  4YH2 A;  4HQS A;  2JSZ A;  3KXO A;  2HLS A;  3LJR A;  5AIV A;  2DJ3 A;  4N0V A;  5ECP B;  3EU3 A;  2FWG A;  2YZU A;  3GX8 A;  2RM5 A;  5CP1 A;  1SK1 A;  3APO A;  1X5D A;  4O5R A;  1PKZ A;  2AJQ B;  5IMZ A;  2VKZ G;  4I5Q A;  4YQM A;  4NPB A;  3NIV A;  1K3Y A;  2FA4 A;  1HNB A;  5G1K A;  2JZR A;  4IP1 A;  3UL3 A;  2VLV A;  2GZZ A;  3N5O A;  4AF2 A;  1JZW A;  3IRA A;  2CV4 A;  1H4O A;  1S3A A;  4KF9 A;  1XWA A;  3KZQ A;  2H74 A;  2CVD A;  2R4V A;  1JLW A;  5IO2 A;  3KMN A;  2A2R A;  1K3O A;  4GF0 A;  4F2I A;  2J9H A;  3U5R E;  3QD9 A;  3TJF A;  3WT1 A;  3FK8 A;  1F37 A;  4MJC A;  4TW5 A;  1G7O A;  1A2M A;  4IGJ A;  2PUK C;  1OC3 A;  4MZW A;  1SJI A;  4ID0 A;  1FO5 A;  3F3R A;  2GQK A;  5FT3 A;  3IOS A;  2IFQ A;  3Q74 A;  2VL3 A;  3UEM A;  2CAQ A;  2GLR A;  4GCI A;  4JR4 A;  2AV4 A;  3QR6 A;  4XS4 A;  5KOX A;  4BWS A;  2MMA A;  3UJ1 A;  4BPY A;  4PQ1 A;  4ZL9 A;  3LG6 A;  3W8J A;  1M2D A;  1QXH A;  5ECN B;  3QFB C;  2VUP A;  3WGD A;  3BCK A;  4HUA A;  4G9H A;  4QL7 A;  4FIW A;  5A1N B;  2DJ1 A;  4L0W A;  1A24 A;  4EO3 A;  3FR9 A;  1AC1 A;  3IAS 2;  1EGO A;  4CY8 A;  3HVS A;  1SD9 A;  2H1G A;  3M8N A;  1OVN A;  2B6M A;  2FHE A;  4O7H A;  4ECI A;  2J23 A;  2EC4 A;  3KH9 A;  1SL2 B;  2EFE A;  2D2Z A;  6GSY A;  2YWN A;  2VLU A;  1XWB A;  1SU9 A;  4MDC A;  2H01 A;  2LQQ A;  4OFN A;  4IQ1 A;  2WDU A;  3TOU A;  1PN0 A;  4K7N A;  4O5U A;  1Z7R A;  4Q5N A;  3LQ7 A;  3HXS A;  3KH7 A;  1TTZ A;  5J5N A;  4YQU A;  3CBU A;  5J40 A;  1G0T A;  4TOP A;  3VLN A;  4WR4 A;  2NBS A;  1GSY A;  2YV9 A;  1N25 A;  2H1D A;  5A5H A;  3H1N A;  2QGV A;  2WJU A;  3M0F A;  1A0R P;  1OKD A;  3I9V 2;  3IHG A;  4ZL8 A;  2FD3 A;  2GZP A;  5FWG A;  2GQM A;  4ZB9 A;  2B5X A;  4DSR A;  1OAZ A;  1O8X A;  5KN2 A;  1THX A;  2O87 A;  2CZ3 A;  3KJY A;  4FQU A;  4MLY A;  3J7Y b;  4Q5R A;  4KCA A;  2F8A A;  5GST A;  3TDG A;  3HJP A;  2L59 A;  4Q5F A;  1FOH A;  3ISO A;  2F51 A;  3TRP A;  2C0D A;  4YAP A;  5D8I A;  3I6A A;  1UN2 A;  3CWG A;  2HSN B;  3A5W A;  3GTU B;  3TOT A;  5CO3 A;  4D73 B;  4GDF A;  1OC9 B;  5ID2 B;  2JSY A;  5J4U A;  4OCE A;  3BOA A;  2WUL A;  1GP1 A;  4XTS A;  2HFD A;  2K6V A;  3LXT A;  1R4W A;  1O8W A;  1Q98 A;  2V6K A;  3L0H A;  4BL7 B;  2HZF A;  3VWU A;  2DKH A;  1PKW A;  3RPP A;  2CX3 A;  5L71 A;  1GTA A;  2I81 A;  3FZ9 A;  1SJZ A;  1T3B A;  4NV2 A;  5INY A;  1T7P B;  2P5Q A;  4JBB A;  4KB3 A;  2IMI A;  2DLX A;  5D93 A;  5F07 A;  3MSZ A;  5F8B A;  1GSD A;  2YCD A;  2HXK A;  3V1W A;  3TJG A;  1SK0 A;  3F6F A;  2C3Q A;  3GNJ A;  1TXX A;  2IPA A;  1WWJ A;  1PL1 A;  1ZGN A;  3IDV A;  2E0Q A;  4FYU A;  1YF1 A;  1K0N A;  1NHY A;  3IC4 A;  2JU5 A;  2EFD A;  5ELA A;  2XPD A;  2R3X A;  1FB6 A;  2R37 A;  2NVL A;  2ES7 A;  4F9Z A;  2A2S A;  4TRX A;  2OE3 A;  4H86 A;  5C00 A;  1A23 A;  1XWG A;  5F05 A;  2H6Y A;  3D4M A;  4LMW A;  1WE0 A;  5G5F A;  1SEN A;  4WF5 A;  4MF5 A;  1QQ2 A;  2H0I A;  5DAL A;  2OBI A;  4MAB A;  4QL9 A;  2E2M A;  3G7J A;  2R6K A;  4GWR A;  1KBN A;  4JE1 A;  3FYG A;  2PU9 C;  5DQY A;  3UIW A;  1EGR A;  1VRS D;  3TKS E;  1WPI A;  3UVT A;  6GSU A;  2HE3 A;  1F3A A;  5DDL A;  4N11 A;  1XW5 A;  4X1U A;  2IIY A;  3G9B A;  3FY7 A;  1X9M B;  5HFI A;  5B6M A;  2A4V A;  2P5R A;  1YF0 A;  4IHU A;  4QMK A;  4G0L A;  3VWX A;  2BTO T;  1TK0 B;  2IFQ B;  4A5P A;  3CTG A;  1PQN A;  1TRU A;  1SL0 B;  5EY6 A;  3N9J A;  3PPU A;  3NZN A;  2GTU A;  3KP8 A;  4HQZ A;  4POB A;  4IS0 A;  1TK8 B;  2O7K A;  4K6X A;  5H5S A;  3GKN A;  22GS A;  3ME8 A;  4FYB A;  3Q18 A;  3DVX A;  5J4V A;  1SJ6 A;  4Z2R A;  4WXT A;  5JCW A;  1QK8 A;  2L57 A;  3EIN A;  3S9F A;  2CZ2 A;  3IBH A;  1AW9 A;  1T00 A;  3TKS C;  5KN0 A;  1ZZY A;  3WYW A;  4X43 A;  3IK7 A;  1DBY A;  2ZNM A;  2JZS A;  4ACS A;  4LA1 A;  1DE2 A;  1TI3 A;  1GWC A;  1V58 A;  2HYX A;  1YEX A;  2GZY A;  3VPQ A;  3IK9 A;  1YKA A;  2GGT A;  1OE8 A;  1M0U A;  2G2Q A;  3WGX A;  1PX6 A;  2H1A A;  5CRG A;  3HYP A;  3TRX A;  2VL2 C;  2B3S A;  5A5H B;  3EWL A;  1GUM A;  3TKQ A;  1K0D A;  4QQ7 A;  3IR4 A;  3E9J B;  1BG1 A;  3BCI A;  5AIX A;  2AYT A;  2VM2 A;  4NAX A;  1TRW A;  1CQG A;  2MMZ A;  3KD0 A;  1YQ1 A;  5CRW A;  2RLI A;  3ZIJ A;  1ACV A;  1T8E B;  4W66 A;  2R0C A;  3GKX A;  1PL2 A;  5GAN D;  2NTO A;  2A2P A;  4EIP A;  3LGC A;  2JL4 A;  1PD2 1;  4MJA A;  2YNX A;  3CYN A;  3CRU A;  2H30 A;  2NPB A;  1SVO A;  5J4Y A;  2V41 A;  4I97 A;  3TB2 A;  4RI6 A;  3BBY A;  4TXO A;  1XW6 A;  3GMF A;  2AB6 A;  4V2N A;  5D9T A;  4X0X A;  1AQX A;  1GTB A;  2C3N A;  4AKH A;  3EMP A;  3ERG A;  3ZLP A;  3LXZ A;  2TRC P;  5IOX A;  1WRY A;  2WFC A;  4PXO A;  1Z6M A;  4P3Y B;  4V2L A;  2LJR A;  2YV7 A;  3KTB A;  4ISD A;  2EIR A;  4DSS B;  5IIZ A;  2HZE A;  1F9M A;  4IVF A;  2PN8 A;  3H79 A;  2REM A;  3LSZ A;  1T4Z A;  3KM6 A;  4MMM A;  2LJK A;  1HNC A;  5JWR B;  1EV9 A;  4IEL A;  4JED A;  3UMA A;  5GSS A;  2AUV A;  1GH2 A;  3HJO A;  2OT3 A;  1QMV A;  4JR6 A;  5B6N A;  1RQM A;  3D0Z A;  2KUC A;  4JZQ A;  4KDX A;  1JFU A;  2XBQ A;  2EFH A;  1W4V A;  3P2A A;  3ZIV A;  2PBJ A;  5JWO B;  3F63 A;  2H70 A;  2WGR A;  1TU7 A;  3HJM A;  4OO5 A;  2JZT A;  2GST A;  1EOH A;  5E59 A;  2BJX A;  1EOG A;  2F3M A;  3ZZX A;  2OA7 A;  1FAA A;  3R3E A;  1M2A A;  1Q4J A;  4OFT A;  3QOU A;  2DJJ A;  2FWF A;  2VCW A;  5DAL B;  1EV4 A;  1USB A;  3JCM L;  1C72 A;  1Z7P A;  3C1S A;  4K0N A;  4EVM A;  3FZA A;  2H19 A;  2GS3 A;  3DD3 A;  4ZB8 A;  1OYJ A;  1KEB A;  1O6J A;  9GSS A;  2F8F A;  1GUH A;  3UVH A;  4OWY A;  2MBS A;  1MD4 A;  4G0K A;  2QSI A;  4CHS A;  4MK3 A;  5ECS A;  4EUY A;  1V9W A;  4G10 A;  1DE1 A;  1O85 A;  2HSY A;  1YDK A;  2O8V B;  3TKP A;  5ENU A;  4ECB A;  2GT5 A;  3HCZ A;  2LUS A;  2R0P A;  3GIX A;  2DIZ A;  5KN3 A;  1R26 A;  4WR5 A;  3BD2 A;  1GSF A;  4MP4 A;  5G5E A;  4KUN A;  2VCQ A;  1ZL9 A;  2V2G A;  4KE3 A;  3QDN A;  2LNS A;  4HJM A;  2CAI A;  2LS5 A;  1AAZ A;  1XBS A;  4G0I A;  2PGT A;  5CRE A;  4GQC A;  1MDJ A;  2JAC A;  4XCS A;  3LFL A;  1VF4 A;  4XS6 A;  1GSQ A;  4PUA A;  5D9X A;  5J41 A;  4ICY A;  3CMI A;  5B8A A;  3IPZ A;  5DAK A;  3GKK A;  2JAD A;  2CQ9 A;  3FMW A;  3GX0 A;  4K1F A;  4BVY A;  1WIK A;  4MF7 A;  1Y25 A;  2HRN A;  3GA4 A;  1KTE A;  2YJ7 A;  1VGL A;  2B7K A;  3FR3 A;  1DUG A;  3HDC A;  1ZCP A;  2DBC A;  1LU4 A;  2FWE A;  3MNG A;  4MJE A;  3IC8 A;  1AIU A;  2R0G A;  2HRA A;  1Z6N A;  2HSH A;  4I6X A;  10GS A;  3D5J A;  4LLR A;  3DEX A;  3C1R A;  3VFI A;  1BG5 A;  5HR3 A;  3QAV A;  1NSW A;  1ERT A;  3ED3 A;  2RM6 A;  2TIR A;  2X99 A;  1PMT A;  1EEM A;  1VF3 A;  5GZZ B;  1GNE A;  2PVO C;  1AQW A;  3L9V A;  3GHA A;  1BED A;  1GUL A;  3UBL A;  5G1L A;  1FW1 A;  4IN0 A;  4Z7X A;  2L5O A;  1QUW A;  3DIE A;  1GTI A;  1X9S B;  3DRN A;  2C8U A;  3F4T A;  3ZYW A;  2YZH A;  4TXO B;  3APQ A;  2FNO A;  1V57 A;  2H75 A;  8GSS A;  4ECJ A;  2P31 A;  1E6B A;  3ZFL A;  4GSN A;  2FLS A;  2PWJ A;  1XWK A;  3LYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...