2C3QA

Human glutathione-s-transferase t1-1 w234r mutant, complex with s- hexylglutathione
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
239
structure length
239
Chain Sequence
b'GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPRVLAMIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE THETA 1
publication title Structural Basis of the Suppressed Catalytic Activity of Wild-Type Human Glutathione Transferase T1-1 Compared to its W234R Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c3qA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c3qA01
1K3OA 1EZKA 3O76A 3F0IA 4HZ4A 5J4UA 3TKPA 3RDWA 3EURA 3HDCA 2VCWA 4OFNA 3D4MA 5IOXA 4J2FA 4GQCA 4LL1B 5D73A 2R2JA 1YY7A 3EU3A 1OKDA 3FEUA 3G7IA 1M2DA 2AUVA 2MMNA 1BJXA 5IMAA 5FT3A 2P0GA 3LYPA 4PNGA 4J56E 1Y6EA 4L0UA 5ECRB 3W6GA 4JZQA 2P5QA 4G9HA 3GH6A 2HLSA 3Q18A 2CVKA 5J3RA 2MMAA 2HRNA 4BL7B 2XC2A 3ZFLA 5KN2A 4DSRA 1ML6A 4EDZA 1GSFA 2VLVA 5LD0A 1OC3A 4WF4A 4DSSB 4FIWA 4ML6A 1V2AA 3EU4A 12GSA 3Q19A 1JZOA 1OC9A 4AJ8A 7GSSA 1YKCA 2DIZA 3SBCA 2FUG2 1QXHA 1XWCA 3RAZA 4EDYA 4RQXA 5D9XA 5D96A 1WRYA 2CZ3A 4MF6A 2J23A 3N9JA 3EYTA 3EMXA 1K0DA 2IJYA 3TRXA 1Z7PA 1NHOA 3U5RE 1GRXA 5D9VA 1NW2A 1HNCA 1SD8A 1PX6A 2X64A 1G7EA 5GAPD 3J7Yk 2H73A 5EY6A 4YQMA 3F8UA 2EIRA 3TGZA 5HR1A 4G0KA 1T7PB 4POBA 4HZ2A 4F9ZA 1I9DA 1XW9A 1OC8A 1GSUA 3UARA 3I6AA 2L5OA 2VAFA 2K8SA 4POMA 6GSVA 3GA4A 1A2JA 4GLTA 3UVTA 3D4TA 1YQ1A 3KJYA 3DEXA 1G0TA 5INYA 1U3IA 4FQUA 1WE0A 4IGJA 3GIXA 1SK1A 4XS1A 3UAPA 1MD4A 5ECIB 2DJ1A 1EEJA 2MYGA 2WGRA 3LYKA 1GP1A 1DE1A 1FO5A 2H0GA 1J0FA 3PH9A 1V57A 4XS4B 2NDOA 2EIOA 1ZOFA 2OBIA 3F9UA 2H1AA 2CAIA 3VPTA 2DMLA 5IMCA 4G19A 3DRNA 5KN3A 1BX9A 3S9FA 2IL3A 2YNXA 3NIVA 19GSA 3IDVA 3EMPA 4EUYA 4PUAA 1V9WA 1KEBA 4WBRD 3PPUA 4ECCA 2VCTA 2L6CA 2L4CA 2ZCTA 5LCZA 1TOFA 2JSYA 1V58A 1XW5A 4E8EA 4TR4A 1LBKA 2DJJA 5A4UA 1LU4A 4H86A 5D8IA 1PX7A 4IQ1A 3TDGA 2YP6A 3IRAA 3CTGA 2YZUA 4MF5A 1VF1A 2R3XA 2B3SA 4MLYA 5ECNB 1ON4A 2XPEA 1QGVA 3F3QA 5AIVA 1RW1A 1FW1A 2F8AA 5DBQA 1K0NA 4ZB8A 4I8BA 1ERUA 3GKKA 1JZWA 3ZYWA 3F3RA 3D6IA 4KCAA 1XOBA 2AV4A 1VGLA 2CT6A 3A2WA 5DAKA 1T4YA 1FVKA 1EWXA 1V98A 2IMKA 3ZRDA 3IOSA 2F3MA 1TXXA 4PQ1A 4XTSA 3C1RA 4PTSA 5ID2A 4K9ZA 3FZ4A 5G1KA 2KP2A 2M80A 4MDCA 4HQSA 3KEBA 2YJ7A 1EV9A 3RPPA 2GZYA 4RI7A 1ERVA 1WPIA 4ZL9A 4ZBBA 3HZ4A 2F51A 3HVSA 1Z7RA 4O92A 3DKSA 4EF0A 4MK3A 5CRWA 5LNKe 3KP8A 1FHEA 3TKQA 1A0FA 4Z7XA 4YQUA 1X5DA 2I3YA 2HQTA 1T1VA 3GN3A 4YAVA 1HNAA 1Z3EA 1M0UA 1PD21 2MMZA 5IO0A 1M9AA 4TW5A 3F4SA 1GSQA 3GL3A 1AIUA 1F37A 3IHQA 2K9FA 3LJRA 4KNDA 4HU9A 5AGYA 3ZFBA 3TJFA 1YDKA 3QPMA 2KUCA 5F07A 1TK0B 3AY8A 3I43A 1PL1A 2C0GA 4N10A 2ZNMA 4KSOA 3QFAC 3KH9A 2FA8A 5JCWA 1K0BA 3ZREA 1ZYQB 1ERWA 1R5PA 1GULA 2DSAA 4MH2A 4L8EA 2OE1A 3PINA 1XXUA 2UZ8A 3GURA 1B4PA 3DGQA 3G7YA 1EGOA 4HEA2 1FOVA 2LJAA 4Q5QA 3MNGA 4Q5NA 3HJMA 4I5QA 3KD0A 5B7CA 4FH8A 2KOKA 3GKXA 4F0BA 2VIMA 2JADA 2IFQB 3RBTA 1FG4A 2FA4A 3GSTA 3VPQA 4X1UA 4O7HA 1K0OA 1MDIA 2I9HA 3LEFA 5ABRA 5IMZA 3BCKA 5ECHB 1KBNA 5IPHA 1WJKA 2B7JA 3C1SA 2HSNB 5CP1A 3VURA 1H75A 3G9BA 1ERTA 3NOFA 3GYKA 1TU8A 4D73A 3EINA 1GL8A 2VCXA 1QK8A 3W8SA 1AC1A 4IN0A 4L5LA 4BA7A 1BAYA 4AGSA 2CZ2A 4IW9A 5ID2B 2WCIA 3QMXA 2HFDA 4G0LA 3H79A 1X9SB 3HHVA 4MPFA 2FWFA 4GQFA 3EWLA 2E7PA 4P3YB 4ECIA 5HFIA 4EO3A 4ZIJA 1GTBA 1XWGA 2WRTA 3I9V2 4MJCA 4GRFA 4QL7A 1SL0B 1JZRA 5ECSA 2IMDA 1UC7A 3CTFA 3IV4A 3HY2A 3ZIJA 1XWAA 2PN8A 2RUEA 4ULXA 2IN3A 5HFKA 5ECPB 1DUGA 2YOIA 2VL3A 5J9CA 1AXDA 3M1GA 5G31A 3A2VA 4WEYA 2HZEA 2LJKA 2H1GA 3WYWA 3FK8A 3L9SA 3APSA 2VM1A 4ACSA 2JZSA 2G0FA 5H5QA 2HYXA 4PXOA 3GTUB 5G1LA 3LWAA 3GH9A 4USSA 1FVJA 1SYRA 1B8XA 3IAS2 4POKA 5G5FA 2DIYA 3C73A 1PRXA 2AJQB 4ML1A 2I4AA 4N11A 1Z6NA 1R7HA 4K2DA 4JE1A 2LUSA 5HQPA 6GSYA 4BWSA 3BJ5A 1MDKA 2O8VB 3OR5A 4JRRA 2L57A 2H72A 2V6KA 2C0FA 4TR1B 1PGTA 1Z6MA 4CHSA 2TRXA 3VWWA 3KMOA 3IK7A 3KGKA 4GSTA 5B6MA 3VWXA 2FD3A 2QSIA 3QOUA 2VLUA 3ME8A 4OO4A 4MA9A 3GX0A 3H93A 2CA8A 3QAGA 3IPZA 5HFGA 2B5EA 2A2SA 1SYXA 3VLNA 3HD5A 5J5NA 4HU7A 8GSSA 2YWNA 5J41A 3QAVA 1ZMAA 2FNOA 2GQMA 4GXZA 1K0AA 3L9VA 4KA0A 4PQIA 1O73A 3ED3A 2VL9A 4DEJA 3UBKA 3R2QA 5DJMA 2K8VA 1O85A 3KMNA 4ECJA 1ZZYA 1Q4JA 2K6VA 2IMEA 3PGTA 2I1UA 1BG5A 2R4VA 2YZHA 5CRGA 2A2RA 1GUKA 3UOMA 2HT9A 2HSMA 3TOUA 2LQOA 2PBJA 3ZITA 3M3MA 1BQ7A 1MD3A 4EC0A 4BWQA 1SL1B 2H6XA 4RQRA 2YV7A 1YEXA 1GSSA 2IWTA 1ABAA 2LNTA 5H5RA 5IQYA 3FW2A 5C00A 1SJZA 2H19A 1TP9A 5AIXA 5KN1A 2PVOC 3IR4A 1W89A 1HNBA 4RI6A 5IMDA 4L5OA 1R26A 2FWHA 2C80A 4KAEA 2TRCP 3C8EA 3TJKA 1MTCA 4BVXA 3LSZA 3L0HA 1SD9A 2MZCA 1GNEA 2KHPA 4N0VA 2LNSA 5H5SA 3IAM2 3FZ9A 4N30A 2NBSA 5GAND 4NV2A 1S3CA 5CREA 4I6XA 5DDLA 1U87A 4PGTA 3FKFA 3FZ5A 4NPBA 4GCIA 2B5YA 2GZZA 3FZAA 3EE2A 4HDEA 1U6TA 2H1DA 2O89A 3TKSE 3FR9A 4F2IA 1UVZA 3UL3A 3O6TA 2ES7A 4TXOA 1IYIA 2MMOA 2BMXA 2P5RA 1TRUA 1QMVA 4XHMA 2LS5A 2PGTA 5DALA 4NHWA 3APQA 1CQHA 1VF2A 5FHIA 3P8WA 1EOHA 4MH3A 2N5FA 1OC9B 3TB2A 2QKEA 1U88A 2X8CA 3HYPA 1MDJA 1Z5YE 3M9KA 4NMUA 2JACA 3QD9A 2H0HA 4OFMA 4EE0A 4QQ7A 2H6YA 5G2ZA 1JLWA 2E2MA 3ME7A 4MZWA 5BMUA 1JHBA 1T3BA 6GSTA 3D5JA 2OBKA 1SK2A 3ZIVA 5DQSA 1WWJA 3KZQA 5AN1A 3DIEA 4OMVA 2H1BA 16GSA 2HSHA 1OVNA 3VWVA 1SENA 5DCGA 2O87A 1THXA 2B6MA 1SKWB 1LJRA 3MWHA 3D21A 1B9YC 4BVYA 1HD2A 1BEDA 2CVBA 3ERFA 2YWOA 4PUFC 2AHEA 1G7OA 1WMJA 3Q6OA 2JZTA 3E9JB 4WKWA 5CRHA 3HJPA 1ZL9A 3FR3A 3F6FA 1RK4A 4IQAA 2MBTA 4NV5A 2GQLA 4GF0A 1ZYEA 4OO5A 4NAXA 5A5KA 1AQXA 3A5WA 1J9BA 2KP1A 5F8BA 3M9JA 3L9UA 3WGDA 2RM5A 2H6ZA 2WJUA 2HXKA 5AISA 4KW6A 3IXRA 4GWRA 3H1NA 1VF3A 1XZOA 4BPYA 2AAWA 4HI7A 4KSMA 1XW6A 2FWEA 3UIWA 2DLXA 4ID0A 2IMIA 4TKYA 5JWRB 1X9MB 3GKNA 5EVOA 5F05A 1K3YA 1FB0A 3KM6A 2FCHA 3IE3A 2VUPA 1S3DA 3RHBA 1SKRB 1GUHA 3IBHA 1TRSA 3C7MA 4K8MA 1XWKA 4PQHA 3D0ZA 1R4WA 1XVWA 4ZBAA 3GSSA 4NHZA 1A2MA 5JCUA 1GWCA 4MJAA 2CVDA 4YAPA 2HZFA 2OE3A 2EIQA 5KEJA 3GNJA 3HXSA 2R5GA 2V2GA 1XPVA 1M7TA 2TIRA 1OE8A 5ELGA 2XBQA 5D9TA 1IYHA 1F9MA 4OD7A 2VD1A 1G6WA 4V1Ap 2F8FA 4AF2A 1C72A 2LRNA 4GSNA 2OA7A 4L0WA 2E0QA 1EEMA 2GSQA 1SJIA 1A24A 1YF0A 1K0CA 4WR4A 1USBA 1B4QA 3HCZA 2VD0A 2H0IA 1UN2A 2OE0A 3LG6A 2NPBA 3ZVJA 2V1MA 4K0NA 4BVYB 1A2LA 2L59A 1GNWA 5ECLB 2RM6A 6GSUA 3KIJA 1A23A 1OKTA 1A8YA 3Q74A 4MJEA 2VCQA 1AUCA 3GMFA 2CV4A 1O81A 1ZCPA 4MABA 1X5EA 3ERGA 5ELAA 1M2AA 1PSQA 5GZZB 4JU5A 5DAKB 4KDYA 3HVVA 4JEDA 2HI7A 5DVBA 2ALBA 2X99A 5J9BA 3LXZA 2O85A 1HYUA 1XCCA 2C3QA 1TDIA 2HNLA 3U6VA 1O7UA 2VLTA 3E3EA 2VCZA 2FGXA 3US3A 3QCPA 2Z9SA 1O6JA 5CO3A 4XS6A 4IVFA 4HQZA 5FWGA 2C1YA 3MDKA 4I2UA 2IPAA 1M2BA 1THOA 3PR8A 4OCEA 5ECMB 4G0IA 2NTOA 3P7XA 4TN8A 3TKSC 1AQWA 2GT5A 3UMAA 4BL7A 3CMIA 3TJGA 1U3AA 1F3AA 2F9SA 4K7IA 2R6KA 1A8LA 1E2YA 2L5LA 2WS2A 2M72A 2DMMA 4KF9A 2JU5A 4DSSA 3FR6A 1Z9HA 3LQ7A 3GKMA 3TRPA 4WETA 2GSSA 2PUKC 2CQ9A 4IJIA 2GLRA 4X43A 1Y25A 2PWJA 1TI3A 1S3AA 4KUNA 3H4KA 5B6NA 2FY6A 3F4TA 4Q5RA 2J9HA 2GGTA 3W8JA 4MZBA 2H71A 3APOA 1PL2A 4OFTA 2NVLA 1GTIA 4O32A 3A3TA 1AQVA 4PNFA 1W4VA 1GSEA 3WD6A 2OACA 4ZL8A 2HRKA 3ZMKA 5D9WA 2DJ0A 3E0UA 3N5OA 3MSZA 3TUEA 5HR2A 1H4OA 4WXTA 1WP0A 1YJ6A 3LXTA 5EL8A 2DBCA 3KTBA 20GSA 2YWMA 1I5GA 2FLSA 2OJLA 4D73B 4ISDA 1TRWA 1XFLA 1SU9A 2GZPA 5E4WA 4ZB9A 5B8AA 1J08A 4TRXA 4ZBDA 1F6MC 2XBIA 2G2QA 5ECKB 3VI7A 2DC5A 1TK5B 1GSYA 4HUAA 4XRAA 5G5EA 2B1KA 2H01A 5IMVA 4ZXGA 1BYEA 3CSJA 1NM3A 3F6DA 2XPDA 3VWUA 2RIIA 9GSSA 3P90A 1YEPA 2IIYA 1TKDB 4G10A 3R3EA 2N5AA 3L78A 5C04A 2QGVA 1GH2A 3KCMA 3GRXA 4XS4A 1PA3A 2YN1A 1QQ2A 1A0RP 1ST9A 3MAKA 3F4RA 3BBYA 5HR0A 2HZEB 2JSZA 1GSDA 2OKAA 4LLRA 3A2XA 2VO4A 1F2EA 1WIKA 4IHUA 1TK8B 2FWGA 2GT6A 2H76A 3ZZXA 2AYTA 2VL2C 2H8LA 4E8HA 11GSA 2PVQA 3HKRA 5F0GA 1K3LA 4YH2A 2IMFA 1TRVA 2YCDA 2HRFA 2WULA 1PMTA 2N5BA 4OCFA 1EP8A 1ACVA 4DVCA 5B8BA 2PU9C 3VK9A 2I81A 5KN0A 3ERWA 13GSA 3M0FA 5ECOB 3HZ8A 3KH7A 1V40A 2HRAA 2HRKB 2D2ZA 2AB6A 2WZ9A 4RUVA 2HE3A 3DMLA 5F06A 4X0XA 3DVWA 4K6XA 5DJLA 4TXVA 1T4ZA 5DQYA 4TOPA 1AAZA 4EL1A 4JBBA 3RPNA 2C3NA 3TCOA 2L4QA 2E2GA 1YZXA 2GTUA 4YQVA 4V1Ag 2GDRA 2RLIA 4F82A 2L6DA 2PERA 3UBLA 2LQQA 3WGEA 3IC4A 3QDNA 1ILOA 2WB9A 4ZL7A 3CXGA 4DSQA 1F3BA 4QL9A 2LRTA 2C3TA 2M46A 2YPMA 1O8WA 2V32A 1JZDA 3EVIA 2C8UA 3H8QA 5D93A 2LEGA 5CNWA 2C4JA 3HA9A 4Q5FA 3CBUA 4KDXA 1FAAA 3LFLA 18GSA 3FYGA 3CSIA 4IP1A 2HSMB 4ZILA 1SKSB 2MBSA 2H70A 1OYJA 3UJ1A 1DSBA 4TR0A 2DJ3A 4MJBA 4GTUA 3GUSA 4EKZA 1SL2B 1ZGNA 1N8JA 4KB3A 5CYYA 4MCUA 2K18A 5L71A 3KXOA 3DXBA 3DD3A 4IS0A 4WBJA 4K7NA 4NXIA 3D22A 3WGXA 1KTEA 3DVXA 2C0DA 4G2EA 1SK0A 5A4WA 2BTOT 3GX8A 1DBYA 1CQGA 1TI1A 4BVXB 2P31A 2ZUPA 1GLPA 1G6YA 3KP9A 4POLA 1GUMA 4NWYA 3BOAA 4K0GA 1NHYA 2IFQA 1TJDA 2DJ2A 4XIHA 3FRCA 4AJ6A 3QAWA 1AW9A 1YF1A 3L4NA 1UA5A 2H66A 4KH7A 2GQKA 4TVEA 4IJ3A 1WOUA 6GSXA 4HS1A 1XIYA 1T00A 2BJXA 3TKSA 2YV9A 2V41A 1OE7A 1PKWA 2CX3A 4J57E 1GLQA 4MF7A 1Q98A 1DE2A 4WF5A 3O3TA 2QC7A 4I2TA 3TKRA 1O8XA 4TR3A 2DJKA 4LMWA 3UVHA 14GSA 4KGIA 3F63A 4ECBA 3C71A 1XVQA 3RHCA 4TXOB 5JWQB 3ZMLA 2LRCA 2H74A 22GSA 1VRSD 2JL4A 3NZNA 1YKAA 5DALB 3VI5A 5CRDA 4HJMA 1RQMA 4I97A 3TJBA 3CSHA 3J7Yb 3CRTA 2CX4A 2VCVA 1M99A 3ZTLA 1XBSA 2VOCA 3FHKA 4V2LA 4MPGA 2FHEA 4IKHA 3ZVJD 4KDUA 2XHFA 3FY7A 2RUFA 3QFBC 3M8NA 2GVPA 1JFUA 2B7KA 4GSSA 3BCIA 5HR3A 3DWVA 3DYRA 3EC3A 3BD2A 3CYNA 4KCEA 5IPGA 2JZRA 1GTUA 5GSSA 2C0EA 1E6BA 2R37A 4V2NA 1KNGA 5IO2A 5DCHA 1TU7A 3ZL5A 1VF4A 3GTUA 5A4VA 5JWOB 6GSSA 1PKZA 3SWLA 1X9WB 1EGRA 4XRDA 3JCML 4EVMA 4CW9A 1B48A 4EXJA 17GSA 3P2AA 1HQOA 1URMA 4K7OA 5EPFA 2GSTA 5GSTA 3KTLA 3HVXA 3GL5A 4XCSA 2PPTA 4PURA 4N0ZA 4JR4A 2B1LA 4CDOA 2OADA 1EOGA 5JCGA 3G7JA 2LJRA 3IC8A 2A4VA 4TR1A 1XOAA 3VFIA 2WFCA 5G30A 2WDUA 2X8GA 3CRUA 2YJHA 1TW9A 4ZB6A 3ZLPA 4LA1A 1OAZA 4O5RA 4FO5A 2LSTA 2V6OA 4MZCA 1XWBA 3WT2A 4FYBA 5COHA 2EC4A 1X0RA 4IBPA 4F0CA 1PN9A 1EP7A 2CAQA 3GFKA 5CAXA 4ILFA 1T8EB 2LTKA 2X8HA 3IK9A 4K1FA 3GV1A 2GSRA 1R5AA 2HSYA 2VL2A 1EV4A 3UEMA 1TTZA 4HJ2A 1FB6A 2YANA 6GSWA 2GS3A 5ENUA 4OWYA 2H75A 1NSWA 2PMTA 3IA1A 4MP4A 3ISOA 3WT1A 3V1WA 1M9BA 1GTAA 2B5XA 4LMVA 1JLVA 5IMFA 4F03A 2VM2A 3HJOA 4AJ7A 2ON5A 1PQNA 3TRQA 4WR5A 4MMMA 1K0MA 3GHAA 5IOWA 2REMA 4KE3A 3LGCA 2ON7A 4PX1A 1SJ6A 5IM9A 4FYUA 3TJJA 2KLXA 2LKUA 5IIZA 4IELA 4HOJA 3K8NA 2H30A 10GSA 4FYCA 1B9XC 1QUWA 3QR6A 3I69A 2YWIA 2O7KA 5ECQB 5E59A 1QFNA 3LORA 1N2AA 4V2MA 1X5CA 4KX4A 4JR6A 3TOTA 4LL4B 1MEKA 2LV3A 4IP6A
chains in the Genus database with same CATH superfamily
1K3OA 1EZKA 3O76A 3F0IA 4HZ4A 5J4UA 3TKPA 3RDWA 3EURA 2X49A 3HDCA 2VCWA 4OFNA 3D4MA 5IOXA 4J2FA 4GQCA 4LL1B 5D73A 2R2JA 1YY7A 3EU3A 1OKDA 3FEUA 3G7IA 1M2DA 2AUVA 2MMNA 1BJXA 5IMAA 5FT3A 2P0GA 2WW2A 3LYPA 3HVNA 4PNGA 4J56E 1Y6EA 4L0UA 5ECRB 3W6GA 4JZQA 2P5QA 4G9HA 3GH6A 2HLSA 3Q18A 2CVKA 5J3RA 2MMAA 2HRNA 4BL7B 2XC2A 3ZFLA 5KN2A 4DSRA 1ML6A 4EDZA 1GSFA 2VLVA 5LD0A 1OC3A 4WF4A 4DSSB 4FIWA 2WZSA 4ML6A 1V2AA 3EU4A 12GSA 3Q19A 1JZOA 1OC9A 4AJ8A 7GSSA 1YKCA 2DIZA 3SBCA 2FUG2 2A4HA 1QXHA 2WW3A 1XWCA 3RAZA 4EDYA 4RQXA 5D9XA 5D96A 1WRYA 2CZ3A 4MF6A 2J23A 3N9JA 3EYTA 3EMXA 1K0DA 2IJYA 3TRXA 1Z7PA 1NHOA 3U5RE 1GRXA 5D9VA 1NW2A 1HNCA 1SD8A 1PX6A 2X64A 1G7EA 5GAPD 3J7Yk 2H73A 5EY6A 4YQMA 3F8UA 2EIRA 3TGZA 5HR1A 4G0KA 1T7PB 2X4AA 4POBA 4HZ2A 4F9ZA 1I9DA 1XW9A 1OC8A 3CHXC 1GSUA 3UARA 3I6AA 2L5OA 2VAFA 2K8SA 4POMA 6GSVA 3GA4A 1A2JA 4GLTA 3UVTA 3D4TA 1YQ1A 3KJYA 3DEXA 1G0TA 5INYA 1U3IA 4FQUA 1WE0A 4IGJA 3GIXA 1SK1A 4XS1A 3UAPA 1MD4A 5ECIB 2DJ1A 1EEJA 2MYGA 2WGRA 3LYKA 1GP1A 1DE1A 1FO5A 2H0GA 1J0FA 3PH9A 1V57A 4XS4B 2NDOA 2EIOA 1ZOFA 2OBIA 3F9UA 2H1AA 2DMLA 2CAIA 3VPTA 4E68A 5IMCA 4PHZC 4G19A 3DRNA 5KN3A 3RGBC 1BX9A 3S9FA 2IL3A 2YNXA 3NIVA 19GSA 3IDVA 3EMPA 4EUYA 4PUAA 1V9WA 1KEBA 4WBRD 3PPUA 4ECCA 2VCTA 2L6CA 2L4CA 2ZCTA 5LCZA 1TOFA 2JSYA 1V58A 4ZB7A 1XW5A 4E8EA 4TR4A 1LBKA 2DJJA 5A4UA 1YEWC 1LU4A 4H86A 5D8IA 1PX7A 4IQ1A 3TDGA 2YP6A 3IRAA 3CTGA 2YZUA 4MF5A 4AKGA 1VF1A 2R3XA 2B3SA 4MLYA 5ECNB 5J4YA 1ON4A 2XPEA 1QGVA 3F3QA 5AIVA 1RW1A 1FW1A 2F8AA 5DBQA 2O3EA 1K0NA 4ZB8A 4I8BA 1ERUA 3GKKA 1JZWA 3ZYWA 3F3RA 3D6IA 4KCAA 1TXUA 4EIQA 2HSNA 1XOBA 2AV4A 1VGLA 2CT6A 3A2WA 4HSCX 5DAKA 1T4YA 1FVKA 2WW1A 1EWXA 1V98A 4K2XA 2IMKA 5A1NB 3ZRDA 3IOSA 2F3MA 1TXXA 1ZYNA 4PQ1A 4XTSA 3C1RA 4PTSA 5ID2A 3CQFA 4K9ZA 3FZ4A 5G1KA 2KP2A 2M80A 4MDCA 4HQSA 3KEBA 2YJ7A 1EV9A 3RPPA 2GZYA 4RI7A 1ERVA 1WPIA 4ZL9A 4ZBBA 3HZ4A 2F51A 3HVSA 1Z7RA 4O92A 3DKSA 4EF0A 4MK3A 5CRWA 5LNKe 3KP8A 1FHEA 3TKQA 1A0FA 4Z7XA 4YQUA 1X5DA 2I3YA 2HQTA 1T1VA 3GN3A 4YAVA 1HNAA 1Z3EA 1M0UA 1PD21 2MMZA 5IO0A 1M9AA 4TW5A 3F4SA 1GSQA 4CY6A 3GL3A 1AIUA 1F37A 3IHQA 2K9FA 3LJRA 4KNDA 4HU9A 5AGYA 3ZFBA 3TJFA 1YDKA 3QPMA 2KUCA 3EPTA 5F07A 1TK0B 3AY8A 3I43A 1PL1A 2C0GA 4N10A 2ZNMA 1SVLA 4KSOA 3QFAC 3KH9A 2FA8A 2WVXB 5JCWA 1K0BA 3ZREA 1ZYQB 1ERWA 1R5PA 1GULA 2QA1A 2DSAA 4MH2A 4L8EA 2OE1A 3PINA 1XXUA 4YKGA 2UZ8A 3GURA 1B4PA 3DGQA 3G7YA 1EGOA 4HEA2 1FOVA 2LJAA 4Q5QA 3MNGA 4Q5NA 3HJMA 1M3JA 4I5QA 3KD0A 4A5PA 5B7CA 4FH8A 2KOKA 3GKXA 4F0BA 2VIMA 2JADA 2IFQB 3RBTA 1FG4A 2FA4A 3GSTA 3VPQA 4X1UA 4X4JA 4O7HA 1K0OA 1MDIA 2I9HA 3LEFA 5ABRA 5IMZA 3BCKA 5ECHB 1KBNA 5IPHA 1WJKA 2B7JA 3C1SA 2HSNB 5CP1A 3VURA 1H75A 3G9BA 1ERTA 3NOFA 3GYKA 1TU8A 4D73A 3EINA 1GL8A 2VCXA 1QK8A 3W8SA 4AKIA 1AC1A 2QA2A 4IN0A 4L5LA 4BA7A 1BAYA 4AGSA 2CZ2A 4IW9A 5ID2B 2WCIA 3QMXA 2HFDA 4G0LA 3H79A 1X9SB 3HHVA 4MPFA 2FWFA 4GQFA 3EWLA 2E7PA 4P3YB 4ECIA 5HFIA 4EO3A 4ZIJA 1GTBA 1XWGA 2WRTA 4EIPA 3I9V2 3LW9A 4MJCA 4GRFA 4QL7A 1SL0B 1JZRA 5ECSA 2IMDA 1UC7A 3CTFA 3IV4A 3HY2A 3ZIJA 1XWAA 2PN8A 2RUEA 4ULXA 2IN3A 5HFKA 5ECPB 1DUGA 2YOIA 2VL3A 5J9CA 1AXDA 1SVMA 3M1GA 5G31A 3A2VA 4WEYA 2HZEA 2LJKA 2H1GA 3WYWA 2O36A 3FK8A 3L9SA 3APSA 2VM1A 4ACSA 2JZSA 2G0FA 5H5QA 2HYXA 4PXOA 3GTUB 5G1LA 3LWAA 3GH9A 4USSA 1FVJA 1SYRA 1B8XA 3IAS2 4POKA 5G5FA 2DIYA 3C73A 4N3ZA 1PRXA 2AJQB 4ML1A 2I4AA 4N11A 1Z6NA 1R7HA 4K2DA 4JE1A 2LUSA 5HQPA 6GSYA 4BWSA 3BJ5A 1MDKA 2O8VB 3OR5A 4JRRA 2L57A 2H72A 2V6KA 2C0FA 4TR1B 1PGTA 1Z6MA 4CHSA 2TRXA 3VWWA 3KMOA 3IK7A 1BF5A 3KGKA 4GSTA 1SVOA 5B6MA 3VWXA 2FD3A 2QSIA 3QOUA 2VLUA 3ME8A 4OO4A 4MA9A 3GX0A 3H93A 2CA8A 3QAGA 3IPZA 5HFGA 2B5EA 3A5IA 2A2SA 1SYXA 4YKFA 3VLNA 3HD5A 5J5NA 4HU7A 8GSSA 1I1IP 2YWNA 2EFDA 5J41A 3QAVA 4AKHA 1ZMAA 2FNOA 2GQMA 4GXZA 1K0AA 3L9VA 4KA0A 4PQIA 1O73A 3ED3A 2VL9A 4DEJA 3UBKA 3R2QA 5DJMA 2K8VA 1O85A 3KMNA 1S4BP 4ECJA 1ZZYA 1Q4JA 2K6VA 2IMEA 3PGTA 2I1UA 1BG5A 2R4VA 2YZHA 5CRGA 2A2RA 1GUKA 3UOMA 2HT9A 2HSMA 3TOUA 2LQOA 2PBJA 3ZITA 2EFCA 3M3MA 1BQ7A 1MD3A 4EC0A 4BWQA 1SL1B 1BG1A 2H6XA 4RQRA 2YV7A 1YEXA 1GSSA 2IWTA 1ABAA 2LNTA 5H5RA 5IQYA 3FW2A 5C00A 1SJZA 2H19A 1TP9A 5AIXA 5KN1A 2PVOC 3IR4A 1W89A 1HNBA 4RI6A 5J47A 5IMDA 4L5OA 1R26A 2FWHA 2C80A 4KAEA 2TRCP 4Z2TA 3C8EA 3TJKA 1MTCA 4BVXA 3LSZA 3L0HA 1SD9A 2MZCA 1GNEA 2KHPA 4N0VA 2LNSA 5H5SA 3IAM2 3FZ9A 4N30A 2NBSA 5GAND 4NV2A 1S3CA 5CREA 4I6XA 5DDLA 1U87A 4PGTA 3FKFA 3FZ5A 4NPBA 4GCIA 4G01A 2B5YA 2GZZA 3FZAA 3EE2A 5KOXA 4HDEA 1U6TA 2H1DA 2A2PA 2O89A 3TKSE 3FR9A 4F2IA 1UVZA 3UL3A 3O6TA 2ES7A 4TXOA 1IYIA 2MMOA 2BMXA 2P5RA 1TRUA 1QMVA 4XHMA 4AKXB 2LS5A 2PGTA 5DALA 4NHWA 3APQA 1CQHA 1VF2A 5FHIA 3P8WA 1EOHA 4MH3A 2N5FA 1OC9B 3TB2A 2QKEA 1U88A 2X8CA 3HYPA 1MDJA 1Z5YE 3M9KA 4NMUA 2JACA 3QD9A 2H0HA 4CY8A 4OFMA 4EE0A 4QQ7A 2H6YA 5G2ZA 1JLWA 2E2MA 3ME7A 4MZWA 5BMUA 1JHBA 1T3BA 6GSTA 3D5JA 3MYDA 2OBKA 1SK2A 3ZIVA 5DQSA 1WWJA 3KZQA 5AN1A 3DIEA 4OMVA 2H1BA 16GSA 2HSHA 1OVNA 3VWVA 1SENA 5DCGA 2O87A 1THXA 2B6MA 1SKWB 1LJRA 3MWHA 2R0PA 3D21A 1B9YC 4BVYA 1HD2A 1BEDA 2CVBA 3ERFA 2YWOA 4PUFC 4ICYA 2AHEA 1G7OA 1WMJA 3Q6OA 2JZTA 3E9JB 4WKWA 5CRHA 3HJPA 1ZL9A 3FR3A 3F6FA 1RK4A 4IQAA 2MBTA 4NV5A 4QMKA 2GQLA 4GF0A 1ZYEA 4OO5A 5KOWA 2DKHA 4NAXA 5A5KA 1AQXA 3A5WA 1J9BA 2KP1A 5F8BA 3M9JA 3L9UA 3WGDA 2RM5A 2H6ZA 2WJUA 2HXKA 5AISA 4KW6A 3IXRA 4GWRA 3H1NA 1VF3A 1XZOA 4BPYA 2AAWA 3CWGA 4HI7A 4KSMA 1XW6A 2FWEA 3UIWA 2DLXA 4ID0A 2IMIA 4TKYA 5JWRB 1X9MB 3GKNA 5EVOA 5F05A 1K3YA 1FB0A 3KM6A 2FCHA 3IE3A 2VUPA 1S3DA 3RHBA 1SKRB 1GUHA 3IBHA 1TRSA 3C7MA 4K8MA 1XWKA 4PQHA 3D0ZA 5A34A 1R4WA 1XVWA 4ZBAA 3GSSA 4NHZA 1A2MA 5JCUA 1GWCA 4MJAA 2CVDA 4YAPA 2HZFA 2OE3A 2EIQA 4PI0C 5KEJA 3GNJA 3HXSA 2R5GA 2V2GA 1XPVA 1M7TA 2TIRA 1OE8A 5ELGA 2XBQA 5D9TA 1IYHA 1F9MA 4OD7A 2VD1A 1G6WA 4V1Ap 2F8FA 4AF2A 1C72A 2LRNA 4GSNA 2OA7A 4L0WA 2E0QA 1EEMA 2GSQA 1SJIA 1A24A 1YF0A 1K0CA 4WR4A 1USBA 1B4QA 3HCZA 2VD0A 2H0IA 1UN2A 2OE0A 3LG6A 2NPBA 2WVZA 2V1MA 3ZVJA 4K0NA 4BVYB 1A2LA 2L59A 1GNWA 5ECLB 2RM6A 6GSUA 4K5SA 3KIJA 4Z2RA 1A23A 1OKTA 1A8YA 3Q74A 4K5RA 4MJEA 2VCQA 1AUCA 3GMFA 2CV4A 1O81A 1ZCPA 4MABA 1X5EA 3ERGA 5ELAA 1M2AA 1PSQA 5GZZB 4JU5A 5DAKB 4KDYA 3HVVA 4JEDA 2HI7A 5DVBA 2ALBA 2X99A 5J9BA 3LXZA 2O85A 1HYUA 1XCCA 2C3QA 1TDIA 2HNLA 3U6VA 1O7UA 4BIKA 2VLTA 3E3EA 2VCZA 2FGXA 3US3A 3QCPA 2Z9SA 1O6JA 5CO3A 4XS6A 4IVFA 4HQZA 5FWGA 2C1YA 3MDKA 4I2UA 2IPAA 1M2BA 2H1LA 1THOA 3PR8A 4OCEA 5ECMB 4G0IA 2NTOA 3P7XA 4TN8A 3TKSC 1AQWA 2GT5A 3UMAA 4BL7A 3CMIA 3TJGA 1U3AA 1F3AA 2F9SA 4K7IA 2R6KA 1A8LA 1E2YA 5A34B 2L5LA 2WS2A 2M72A 2DMMA 4KF9A 2JU5A 4DSSA 3FR6A 1Z9HA 3LQ7A 3GKMA 4Z2UA 3TRPA 4WETA 2GSSA 2PUKC 2CQ9A 4IJIA 2GLRA 4X43A 1Y25A 2PWJA 1TI3A 3RFRC 1S3AA 4KUNA 3H4KA 5B6NA 2FY6A 3F4TA 4Q5RA 2J9HA 2GGTA 3W8JA 4MZBA 2H71A 3APOA 1PL2A 4OFTA 2NVLA 1GTIA 4O32A 3A3TA 1ZYPA 1AQVA 4PNFA 1W4VA 1GSEA 3WD6A 5J40A 2OACA 4ZL8A 2HRKA 3ZMKA 5D9WA 2DJ0A 3E0UA 3N5OA 3MSZA 3TUEA 5HR2A 1H4OA 4WXTA 1WP0A 1YJ6A 3LXTA 5EL8A 2DBCA 3KTBA 20GSA 2YWMA 1I5GA 2FLSA 2OJLA 4D73B 4ISDA 1TRWA 1XFLA 1SU9A 2GZPA 5E4WA 4ZB9A 5B8AA 1J08A 4TRXA 1M3IA 4W66A 4ZBDA 1F6MC 4MNNA 2XBIA 2G2QA 5ECKB 3VI7A 2DC5A 1TK5B 1GSYA 4HUAA 4XRAA 5G5EA 2B1KA 2H01A 5IMVA 4ZXGA 2EFEA 1BYEA 3CSJA 1NM3A 3F6DA 2XPDA 3VWUA 2RIIA 9GSSA 3P90A 1YEPA 2IIYA 1TKDB 4G10A 3R3EA 2N5AA 3L78A 5C04A 3TU3B 2QGVA 1GH2A 3KCMA 3GRXA 4XS4A 1PA3A 2YN1A 1QQ2A 1A0RP 1ST9A 3MAKA 3F4RA 3BBYA 5HR0A 2HZEB 2JSZA 1GSDA 2OKAA 4LLRA 3A2XA 2VO4A 1F2EA 1WIKA 4IHUA 1TK8B 2R0GA 3FMWA 2FWGA 2GT6A 2H76A 3ZZXA 2AYTA 2VL2C 2H8LA 4E8HA 11GSA 2PVQA 3HKRA 5F0GA 1K3LA 4YH2A 2IMFA 1TRVA 2YCDA 2HRFA 2WULA 1PMTA 2N5BA 4OCFA 1EP8A 1ACVA 4DVCA 5B8BA 2PU9C 3VK9A 2I81A 5KN0A 3ERWA 13GSA 3M0FA 5ECOB 3HZ8A 3KH7A 1V40A 2HRAA 2HRKB 2D2ZA 2AB6A 2WZ9A 4RUVA 2HE3A 3DMLA 5F06A 4X0XA 3DVWA 4K6XA 5DJLA 4TXVA 1T4ZA 5DQYA 4TOPA 1AAZA 4EL1A 4JBBA 3RPNA 2C3NA 1N25A 3TCOA 1Y1UA 2L4QA 2E2GA 1YZXA 2GTUA 2UV8G 4YQVA 4V1Ag 2GDRA 2RLIA 4F82A 2L6DA 2PERA 3UBLA 2LQQA 3WGEA 3IC4A 3QDNA 1ILOA 2WB9A 5A1NA 3CXGA 4ZL7A 4DSQA 1F3BA 4QL9A 2LRTA 2C3TA 2M46A 2YPMA 1O8WA 4O5UA 3IHGA 2V32A 1JZDA 3EVIA 2C8UA 3H8QA 1FOHA 5D93A 2LEGA 5CNWA 2C4JA 3HA9A 4Q5FA 3CBUA 4KDXA 1FAAA 3LFLA 18GSA 3FYGA 3CSIA 4IP1A 3HMJG 2HSMB 4ZILA 1SKSB 2MBSA 2H70A 1OYJA 3UJ1A 1DSBA 4TR0A 2DJ3A 4MJBA 4GTUA 3GUSA 4EKZA 1SL2B 1ZGNA 2EFHA 2WVXA 1N8JA 4KB3A 5CYYA 4MCUA 2K18A 5L71A 3KXOA 3DXBA 3DD3A 4IS0A 4WBJA 5J4VA 4K7NA 4NXIA 3D22A 3WGXA 1KTEA 3DVXA 2C0DA 4G2EA 1SK0A 5A4WA 2BTOT 3GX8A 1DBYA 2O5VA 2WW0A 1CQGA 1TI1A 4BVXB 2P31A 2ZUPA 1GLPA 1G6YA 3KP9A 4POLA 1GUMA 4NWYA 3BOAA 4K0GA 1NHYA 5A5HA 2IFQA 1TJDA 2DJ2A 4XIHA 3FRCA 4AJ6A 3QAWA 1AW9A 1YF1A 3L4NA 1UA5A 1XG8A 2H66A 4KH7A 4GDFA 2GQKA 4TVEA 4IJ3A 1WOUA 6GSXA 4HS1A 1XIYA 1T00A 2BJXA 1YVLA 3TKSA 2YV9A 2V41A 1OE7A 1PKWA 2CX3A 4J57E 1GLQA 4MF7A 1Q98A 1DE2A 4WF5A 3O3TA 2QC7A 4I2TA 3TKRA 1O8XA 4TR3A 2DJKA 4LMWA 3UVHA 14GSA 4KGIA 3F63A 4ECBA 3C71A 1XVQA 3RHCA 4TXOB 5JWQB 3ZMLA 2LRCA 2H74A 22GSA 1VRSD 2JL4A 3NZNA 1YKAA 5DALB 3VI5A 5CRDA 2OT3A 4HJMA 1RQMA 4I97A 3TJBA 3CSHA 3J7Yb 2VKZG 3CRTA 2CX4A 2VCVA 1M99A 3ZTLA 1XBSA 2VOCA 3FHKA 4V2LA 4MPGA 2FHEA 4IKHA 3ZVJD 4KDUA 2XHFA 3FY7A 2RUFA 3QFBC 5BRTA 3M8NA 2GVPA 1JFUA 2B7KA 4GSSA 3BCIA 5HR3A 3DWVA 3DYRA 3EC3A 3BD2A 5BMUB 3CYNA 4KCEA 5IPGA 2JZRA 1GTUA 5GSSA 2C0EA 1E6BA 2R37A 4V2NA 1KNGA 5IO2A 5DCHA 1TU7A 3ZL5A 1VF4A 4FXYP 3GTUA 5A4VA 5JWOB 6GSSA 4O5QA 1PKZA 3SWLA 1X9WB 1EGRA 4XRDA 3JCML 4EVMA 4CW9A 1B48A 4EXJA 17GSA 3P2AA 1HQOA 1URMA 4K7OA 5EPFA 2GSTA 5GSTA 3KTLA 3HVXA 3GL5A 4XCSA 2PPTA 4PURA 4N0ZA 4JR4A 2B1LA 4CDOA 2OADA 1PN0A 1EOGA 5JCGA 3G7JA 2LJRA 3IC8A 5A5HB 2A4VA 4TR1A 1XOAA 3VFIA 1PFOA 2WFCA 5G30A 2WDUA 2R0CA 2X8GA 3CRUA 3MIXA 2YJHA 1TW9A 4ZB6A 3ZLPA 4LA1A 1OAZA 4O5RA 2WVYA 4FO5A 2LSTA 2V6OA 4MZCA 1XWBA 3WT2A 1S3RA 4FYBA 5COHA 2EC4A 1X0RA 4IBPA 4F0CA 1PN9A 1EP7A 2CAQA 3GFKA 5CAXA 4ILFA 1T8EB 2LTKA 2X8HA 3IK9A 4K1FA 3GV1A 2GSRA 1R5AA 2HSYA 2VL2A 1EV4A 3UEMA 1TTZA 4HJ2A 1FB6A 2YANA 6GSWA 2GS3A 2DKIA 5ENUA 4OWYA 2H75A 1NSWA 2PMTA 3IA1A 4MP4A 3ISOA 3WT1A 3V1WA 1M9BA 1GTAA 2B5XA 4LMVA 1JLVA 5IMFA 4F03A 2VM2A 3HJOA 4AJ7A 2ON5A 1PQNA 3TRQA 4WR5A 4MMMA 1K0MA 3GHAA 5IOWA 2REMA 4KE3A 3LGCA 2ON7A 4PX1A 1SJ6A 5IM9A 4FYUA 3TJJA 4AI6A 2KLXA 2LKUA 5IIZA 4IELA 4HOJA 3K8NA 2H30A 10GSA 4FYCA 1B9XC 1QUWA 3QR6A 3I69A 2YWIA 2O7KA 5ECQB 5E59A 4PI2C 1QFNA 3LORA 1N2AA 4V2MA 1X5CA 4KX4A 4JR6A 3TOTA 4LL4B 1MEKA 2LV3A 4IP6A
chains in the Genus database with same CATH topology
1K3OA 1EZKA 3O76A 3F0IA 4HZ4A 5J4UA 3TKPA 3RDWA 3EURA 2X49A 3HDCA 2VCWA 4OFNA 3D4MA 5IOXA 4J2FA 4GQCA 4LL1B 5D73A 2R2JA 1YY7A 3EU3A 1OKDA 3FEUA 3G7IA 1M2DA 2AUVA 2MMNA 1BJXA 5IMAA 5FT3A 2P0GA 3LYPA 4PNGA 4J56E 1Y6EA 4L0UA 5ECRB 3W6GA 4JZQA 2P5QA 4G9HA 3GH6A 2HLSA 3Q18A 2CVKA 5J3RA 2MMAA 2HRNA 4BL7B 2XC2A 3ZFLA 5KN2A 4DSRA 1ML6A 4EDZA 1GSFA 2VLVA 5LD0A 1OC3A 4WF4A 4DSSB 4FIWA 4ML6A 1V2AA 3EU4A 12GSA 3Q19A 1JZOA 1OC9A 4AJ8A 7GSSA 1YKCA 2DIZA 3SBCA 2FUG2 2A4HA 1QXHA 1XWCA 3RAZA 4EDYA 4RQXA 5D9XA 5D96A 1WRYA 2CZ3A 4MF6A 2J23A 3N9JA 3EYTA 3EMXA 1K0DA 2IJYA 3TRXA 1Z7PA 1NHOA 3U5RE 1GRXA 5D9VA 1NW2A 1HNCA 1SD8A 1PX6A 2X64A 1G7EA 5GAPD 3J7Yk 2H73A 5EY6A 4YQMA 3F8UA 2EIRA 3TGZA 5HR1A 4G0KA 1T7PB 2X4AA 4POBA 4HZ2A 4F9ZA 1I9DA 1XW9A 1OC8A 1GSUA 3UARA 3I6AA 2L5OA 2VAFA 2K8SA 4POMA 6GSVA 3GA4A 1A2JA 4GLTA 3UVTA 3D4TA 1YQ1A 3KJYA 3DEXA 1G0TA 5INYA 1U3IA 4FQUA 1WE0A 4IGJA 3GIXA 1SK1A 4XS1A 3UAPA 1MD4A 5ECIB 2DJ1A 1EEJA 2MYGA 2WGRA 3LYKA 1GP1A 1DE1A 1FO5A 2H0GA 1J0FA 3PH9A 1V57A 4XS4B 2NDOA 2EIOA 1ZOFA 2OBIA 3F9UA 2H1AA 2DMLA 2CAIA 3VPTA 4E68A 5IMCA 4G19A 3DRNA 5KN3A 1BX9A 3S9FA 2IL3A 2YNXA 3NIVA 19GSA 3IDVA 3EMPA 4EUYA 4PUAA 1V9WA 1KEBA 4WBRD 3PPUA 4ECCA 2VCTA 2L6CA 2L4CA 2ZCTA 5LCZA 1TOFA 2JSYA 1V58A 4ZB7A 1XW5A 4E8EA 4TR4A 1LBKA 2DJJA 5A4UA 1LU4A 4H86A 5D8IA 1PX7A 4IQ1A 3TDGA 2YP6A 3IRAA 3CTGA 2YZUA 4MF5A 4AKGA 1VF1A 2R3XA 2B3SA 4MLYA 5ECNB 5J4YA 1ON4A 2XPEA 1QGVA 3F3QA 5AIVA 1RW1A 1FW1A 2F8AA 5DBQA 1K0NA 4ZB8A 4I8BA 1ERUA 3GKKA 1JZWA 3ZYWA 3F3RA 3D6IA 4KCAA 1TXUA 4EIQA 2HSNA 1XOBA 2AV4A 1VGLA 2CT6A 3A2WA 5DAKA 1T4YA 1FVKA 1EWXA 1V98A 4K2XA 2IMKA 5A1NB 3ZRDA 3IOSA 2F3MA 1TXXA 1ZYNA 4PQ1A 4XTSA 3C1RA 4PTSA 5ID2A 4K9ZA 3FZ4A 5G1KA 2KP2A 2M80A 4MDCA 4HQSA 3KEBA 2YJ7A 1EV9A 3RPPA 2GZYA 4RI7A 1ERVA 1WPIA 4ZL9A 4ZBBA 3HZ4A 2F51A 3HVSA 1Z7RA 4O92A 3DKSA 4EF0A 4MK3A 5CRWA 5LNKe 3KP8A 1FHEA 3TKQA 1A0FA 4Z7XA 4YQUA 1X5DA 2I3YA 2HQTA 1T1VA 3GN3A 4YAVA 1HNAA 1Z3EA 1M0UA 1PD21 2MMZA 5IO0A 1M9AA 4TW5A 3F4SA 1GSQA 4CY6A 3GL3A 1AIUA 1F37A 3IHQA 2K9FA 3LJRA 4KNDA 4HU9A 5AGYA 3ZFBA 3TJFA 1YDKA 3QPMA 2KUCA 3EPTA 5F07A 1TK0B 3AY8A 3I43A 1PL1A 2C0GA 4N10A 2ZNMA 1SVLA 4KSOA 3QFAC 3KH9A 2FA8A 5JCWA 1K0BA 3ZREA 1ZYQB 1ERWA 1R5PA 1GULA 2QA1A 2DSAA 4MH2A 4L8EA 2OE1A 3PINA 1XXUA 4YKGA 2UZ8A 3GURA 1B4PA 3DGQA 3G7YA 1EGOA 4HEA2 1FOVA 2LJAA 4Q5QA 3MNGA 4Q5NA 3HJMA 4I5QA 3KD0A 4A5PA 5B7CA 4FH8A 2KOKA 3GKXA 4F0BA 2VIMA 2JADA 2IFQB 3RBTA 1FG4A 2FA4A 3GSTA 3VPQA 4X1UA 4X4JA 4O7HA 1K0OA 1MDIA 2I9HA 3LEFA 5ABRA 5IMZA 3BCKA 5ECHB 1KBNA 5IPHA 1WJKA 2B7JA 3C1SA 2HSNB 5CP1A 3VURA 1H75A 3G9BA 1ERTA 3NOFA 3GYKA 1TU8A 4D73A 3EINA 1GL8A 2VCXA 1QK8A 3W8SA 4AKIA 1AC1A 2QA2A 4IN0A 4L5LA 4BA7A 1BAYA 4AGSA 2CZ2A 4IW9A 5ID2B 2WCIA 3QMXA 2HFDA 4G0LA 3H79A 1X9SB 3HHVA 4MPFA 2FWFA 4GQFA 3EWLA 2E7PA 4P3YB 4ECIA 5HFIA 4EO3A 4ZIJA 1GTBA 1XWGA 2WRTA 4EIPA 3I9V2 3LW9A 4MJCA 4GRFA 4QL7A 1SL0B 1JZRA 5ECSA 2IMDA 1UC7A 3CTFA 3IV4A 3HY2A 3ZIJA 1XWAA 2PN8A 2RUEA 4ULXA 2IN3A 5HFKA 5ECPB 1DUGA 2YOIA 2VL3A 5J9CA 1AXDA 1SVMA 3M1GA 5G31A 3A2VA 4WEYA 2HZEA 2LJKA 2H1GA 3WYWA 3FK8A 3L9SA 3APSA 2VM1A 4ACSA 2JZSA 2G0FA 5H5QA 2HYXA 4PXOA 3GTUB 5G1LA 3LWAA 3GH9A 4USSA 1FVJA 1SYRA 1B8XA 3IAS2 4POKA 5G5FA 2DIYA 3C73A 4N3ZA 1PRXA 2AJQB 4ML1A 2I4AA 4N11A 1Z6NA 1R7HA 4K2DA 4JE1A 2LUSA 5HQPA 6GSYA 4BWSA 3BJ5A 1MDKA 2O8VB 3OR5A 4JRRA 2L57A 2H72A 2V6KA 2C0FA 4TR1B 1PGTA 1Z6MA 4CHSA 2TRXA 3VWWA 3KMOA 3IK7A 1BF5A 3KGKA 4GSTA 1SVOA 5B6MA 3VWXA 2FD3A 2QSIA 3QOUA 2VLUA 3ME8A 4OO4A 4MA9A 3GX0A 3H93A 2CA8A 3QAGA 3IPZA 5HFGA 2B5EA 3A5IA 2A2SA 1SYXA 4YKFA 3VLNA 3HD5A 5J5NA 4HU7A 8GSSA 2YWNA 2EFDA 5J41A 3QAVA 4AKHA 1ZMAA 2FNOA 2GQMA 4GXZA 1K0AA 3L9VA 4KA0A 4PQIA 1O73A 3ED3A 2VL9A 4DEJA 3UBKA 3R2QA 5DJMA 2K8VA 1O85A 3KMNA 4ECJA 1ZZYA 1Q4JA 2K6VA 2IMEA 3PGTA 2I1UA 1BG5A 2R4VA 2YZHA 5CRGA 2A2RA 1GUKA 3UOMA 2HT9A 2HSMA 3TOUA 2LQOA 2PBJA 3ZITA 2EFCA 3M3MA 1BQ7A 1MD3A 4EC0A 4BWQA 1SL1B 1BG1A 2H6XA 4RQRA 2YV7A 1YEXA 1GSSA 2IWTA 1ABAA 2LNTA 5H5RA 5IQYA 3FW2A 5C00A 1SJZA 2H19A 1TP9A 5AIXA 5KN1A 2PVOC 3IR4A 1W89A 1HNBA 4RI6A 5J47A 5IMDA 4L5OA 1R26A 2FWHA 2C80A 4KAEA 2TRCP 4Z2TA 3C8EA 3TJKA 1MTCA 4BVXA 3LSZA 3L0HA 1SD9A 2MZCA 1GNEA 2KHPA 4N0VA 2LNSA 5H5SA 3IAM2 3FZ9A 4N30A 2NBSA 5GAND 4NV2A 1S3CA 5CREA 4I6XA 5DDLA 1U87A 4PGTA 3FKFA 3FZ5A 4NPBA 4GCIA 4G01A 2B5YA 2GZZA 3FZAA 3EE2A 5KOXA 4HDEA 1U6TA 2H1DA 2A2PA 2O89A 3TKSE 3FR9A 4F2IA 1UVZA 3UL3A 3O6TA 2ES7A 4TXOA 1IYIA 2MMOA 2BMXA 2P5RA 1TRUA 1QMVA 4XHMA 4AKXB 2LS5A 2PGTA 5DALA 4NHWA 3APQA 1CQHA 1VF2A 5FHIA 3P8WA 1EOHA 4MH3A 2N5FA 1OC9B 3TB2A 2QKEA 1U88A 2X8CA 3HYPA 1MDJA 1Z5YE 3M9KA 4NMUA 2JACA 3QD9A 2H0HA 4CY8A 4OFMA 4EE0A 4QQ7A 2H6YA 5G2ZA 1JLWA 2E2MA 3ME7A 4MZWA 5BMUA 1JHBA 1T3BA 6GSTA 3D5JA 3MYDA 2OBKA 1SK2A 3ZIVA 5DQSA 1WWJA 3KZQA 5AN1A 3DIEA 4OMVA 2H1BA 16GSA 2HSHA 1OVNA 3VWVA 1SENA 5DCGA 2O87A 1THXA 2B6MA 1SKWB 1LJRA 3MWHA 2R0PA 3D21A 1B9YC 4BVYA 1HD2A 1BEDA 2CVBA 3ERFA 2YWOA 4PUFC 4ICYA 2AHEA 1G7OA 1WMJA 3Q6OA 2JZTA 3E9JB 4WKWA 5CRHA 3HJPA 1ZL9A 3FR3A 3F6FA 1RK4A 4IQAA 2MBTA 4NV5A 4QMKA 2GQLA 4GF0A 1ZYEA 4OO5A 5KOWA 2DKHA 4NAXA 5A5KA 1AQXA 3A5WA 1J9BA 2KP1A 5F8BA 3M9JA 3L9UA 3WGDA 2RM5A 2H6ZA 2WJUA 2HXKA 5AISA 4KW6A 3IXRA 4GWRA 3H1NA 1VF3A 1XZOA 4BPYA 2AAWA 3CWGA 4HI7A 4KSMA 1XW6A 2FWEA 3UIWA 2DLXA 4ID0A 2IMIA 4TKYA 5JWRB 1X9MB 3GKNA 5EVOA 5F05A 1K3YA 1FB0A 3KM6A 2FCHA 3IE3A 2VUPA 1S3DA 3RHBA 1SKRB 1GUHA 3IBHA 1TRSA 3C7MA 4K8MA 1XWKA 4PQHA 3D0ZA 5A34A 1R4WA 1XVWA 4ZBAA 3GSSA 4NHZA 1A2MA 5JCUA 1GWCA 4MJAA 2CVDA 4YAPA 2HZFA 2OE3A 2EIQA 5KEJA 3GNJA 3HXSA 2R5GA 2V2GA 1XPVA 1M7TA 2TIRA 1OE8A 5ELGA 2XBQA 5D9TA 1IYHA 1F9MA 4OD7A 2VD1A 1G6WA 4V1Ap 2F8FA 4AF2A 1C72A 2LRNA 4GSNA 2OA7A 4L0WA 2E0QA 1EEMA 2GSQA 1SJIA 1A24A 1YF0A 1K0CA 4WR4A 1USBA 1B4QA 3HCZA 2VD0A 2H0IA 1UN2A 2OE0A 3LG6A 2NPBA 3ZVJA 2V1MA 4K0NA 4BVYB 1A2LA 2L59A 1GNWA 5ECLB 2RM6A 6GSUA 4K5SA 3KIJA 4Z2RA 1A23A 1OKTA 1A8YA 3Q74A 4K5RA 4MJEA 2VCQA 1AUCA 3GMFA 2CV4A 1O81A 1ZCPA 4MABA 1X5EA 3ERGA 5ELAA 1M2AA 1PSQA 5GZZB 4JU5A 5DAKB 4KDYA 3HVVA 4JEDA 2HI7A 5DVBA 2ALBA 2X99A 5J9BA 3LXZA 2O85A 1HYUA 1XCCA 2C3QA 1TDIA 2HNLA 3U6VA 1O7UA 2VLTA 3E3EA 2VCZA 2FGXA 3US3A 3QCPA 2Z9SA 1O6JA 5CO3A 4XS6A 4IVFA 4HQZA 5FWGA 2C1YA 3MDKA 4I2UA 2IPAA 1M2BA 2H1LA 1THOA 3PR8A 4OCEA 5ECMB 4G0IA 2NTOA 3P7XA 4TN8A 3TKSC 1AQWA 2GT5A 3UMAA 4BL7A 3CMIA 3TJGA 1U3AA 1F3AA 2F9SA 4K7IA 2R6KA 1A8LA 1E2YA 5A34B 2L5LA 2WS2A 2M72A 2DMMA 4KF9A 2JU5A 4DSSA 3FR6A 1Z9HA 3LQ7A 3GKMA 4Z2UA 3TRPA 4WETA 2GSSA 2PUKC 2CQ9A 4IJIA 2GLRA 4X43A 1Y25A 2PWJA 1TI3A 1S3AA 4KUNA 3H4KA 5B6NA 2FY6A 3F4TA 4Q5RA 2J9HA 2GGTA 3W8JA 4MZBA 2H71A 3APOA 1PL2A 4OFTA 2NVLA 1GTIA 4O32A 3A3TA 1ZYPA 1AQVA 4PNFA 1W4VA 1GSEA 3WD6A 5J40A 2OACA 4ZL8A 2HRKA 3ZMKA 5D9WA 2DJ0A 3E0UA 3N5OA 3MSZA 3TUEA 5HR2A 1H4OA 4WXTA 1WP0A 1YJ6A 3LXTA 5EL8A 2DBCA 3KTBA 20GSA 2YWMA 1I5GA 2FLSA 2OJLA 4D73B 4ISDA 1TRWA 1XFLA 1SU9A 2GZPA 5E4WA 4ZB9A 5B8AA 1J08A 4TRXA 4W66A 4ZBDA 1F6MC 4MNNA 2XBIA 2G2QA 5ECKB 3VI7A 2DC5A 1TK5B 1GSYA 4HUAA 4XRAA 5G5EA 2B1KA 2H01A 5IMVA 4ZXGA 2EFEA 1BYEA 3CSJA 1NM3A 3F6DA 2XPDA 3VWUA 2RIIA 9GSSA 3P90A 1YEPA 2IIYA 1TKDB 4G10A 3R3EA 2N5AA 3L78A 5C04A 3TU3B 2QGVA 1GH2A 3KCMA 3GRXA 4XS4A 1PA3A 2YN1A 1QQ2A 1A0RP 1ST9A 3MAKA 3F4RA 3BBYA 5HR0A 2HZEB 2JSZA 1GSDA 2OKAA 4LLRA 3A2XA 2VO4A 1F2EA 1WIKA 4IHUA 1TK8B 2R0GA 3FMWA 2FWGA 2GT6A 2H76A 3ZZXA 2AYTA 2VL2C 2H8LA 4E8HA 11GSA 2PVQA 3HKRA 5F0GA 1K3LA 4YH2A 2IMFA 1TRVA 2YCDA 2HRFA 2WULA 1PMTA 2N5BA 4OCFA 1EP8A 1ACVA 4DVCA 5B8BA 2PU9C 3VK9A 2I81A 5KN0A 3ERWA 13GSA 3M0FA 5ECOB 3HZ8A 3KH7A 1V40A 2HRAA 2HRKB 2D2ZA 2AB6A 2WZ9A 4RUVA 2HE3A 3DMLA 5F06A 4X0XA 3DVWA 4K6XA 5DJLA 4TXVA 1T4ZA 5DQYA 4TOPA 1AAZA 4EL1A 4JBBA 3RPNA 2C3NA 1N25A 3TCOA 1Y1UA 2L4QA 2E2GA 1YZXA 2GTUA 2UV8G 4YQVA 4V1Ag 2GDRA 2RLIA 4F82A 2L6DA 2PERA 3UBLA 2LQQA 3WGEA 3IC4A 3QDNA 1ILOA 2WB9A 5A1NA 3CXGA 4ZL7A 4DSQA 1F3BA 4QL9A 2LRTA 2C3TA 2M46A 2YPMA 1O8WA 4O5UA 3IHGA 2V32A 1JZDA 3EVIA 2C8UA 3H8QA 1FOHA 5D93A 2LEGA 5CNWA 2C4JA 3HA9A 4Q5FA 3CBUA 4KDXA 1FAAA 3LFLA 18GSA 3FYGA 3CSIA 4IP1A 3HMJG 2HSMB 4ZILA 1SKSB 2MBSA 2H70A 1OYJA 3UJ1A 1DSBA 4TR0A 2DJ3A 4MJBA 4GTUA 3GUSA 4EKZA 1SL2B 1ZGNA 2EFHA 1N8JA 4KB3A 5CYYA 4MCUA 2K18A 5L71A 3KXOA 3DXBA 3DD3A 4IS0A 4WBJA 5J4VA 4K7NA 4NXIA 3D22A 3WGXA 1KTEA 3DVXA 2C0DA 4G2EA 1SK0A 5A4WA 2BTOT 3GX8A 1DBYA 2O5VA 1CQGA 1TI1A 4BVXB 2P31A 2ZUPA 1GLPA 1G6YA 3KP9A 4POLA 1GUMA 4NWYA 3BOAA 4K0GA 1NHYA 5A5HA 2IFQA 1TJDA 2DJ2A 4XIHA 3FRCA 4AJ6A 3QAWA 1AW9A 1YF1A 3L4NA 1UA5A 2H66A 4KH7A 4GDFA 2GQKA 4TVEA 4IJ3A 1WOUA 6GSXA 4HS1A 1XIYA 1T00A 2BJXA 1YVLA 3TKSA 2YV9A 2V41A 1OE7A 1PKWA 2CX3A 4J57E 1GLQA 4MF7A 1Q98A 1DE2A 4WF5A 3O3TA 2QC7A 4I2TA 3TKRA 1O8XA 4TR3A 2DJKA 4LMWA 3UVHA 14GSA 4KGIA 3F63A 4ECBA 3C71A 1XVQA 3RHCA 4TXOB 5JWQB 3ZMLA 2LRCA 2H74A 22GSA 1VRSD 2JL4A 3NZNA 1YKAA 5DALB 3VI5A 5CRDA 2OT3A 4HJMA 1RQMA 4I97A 3TJBA 3CSHA 3J7Yb 2VKZG 3CRTA 2CX4A 2VCVA 1M99A 3ZTLA 1XBSA 2VOCA 3FHKA 4V2LA 4MPGA 2FHEA 4IKHA 3ZVJD 4KDUA 2XHFA 3FY7A 2RUFA 3QFBC 5BRTA 3M8NA 2GVPA 1JFUA 2B7KA 4GSSA 3BCIA 5HR3A 3DWVA 3DYRA 3EC3A 3BD2A 5BMUB 3CYNA 4KCEA 5IPGA 2JZRA 1GTUA 5GSSA 2C0EA 1E6BA 2R37A 4V2NA 1KNGA 5IO2A 5DCHA 1TU7A 3ZL5A 1VF4A 3GTUA 5A4VA 5JWOB 6GSSA 4O5QA 1PKZA 3SWLA 1X9WB 1EGRA 4XRDA 3JCML 4EVMA 4CW9A 1B48A 4EXJA 17GSA 3P2AA 1HQOA 1URMA 4K7OA 5EPFA 2GSTA 5GSTA 3KTLA 3HVXA 3GL5A 4XCSA 2PPTA 4PURA 4N0ZA 4JR4A 2B1LA 4CDOA 2OADA 1PN0A 1EOGA 5JCGA 3G7JA 2LJRA 3IC8A 5A5HB 2A4VA 4TR1A 1XOAA 3VFIA 2WFCA 5G30A 2WDUA 2R0CA 2X8GA 3CRUA 3MIXA 2YJHA 1TW9A 4ZB6A 3ZLPA 4LA1A 1OAZA 4O5RA 4FO5A 2LSTA 2V6OA 4MZCA 1XWBA 3WT2A 4FYBA 5COHA 2EC4A 1X0RA 4IBPA 4F0CA 1PN9A 1EP7A 2CAQA 3GFKA 5CAXA 4ILFA 1T8EB 2LTKA 2X8HA 3IK9A 4K1FA 3GV1A 2GSRA 1R5AA 2HSYA 2VL2A 1EV4A 3UEMA 1TTZA 4HJ2A 1FB6A 2YANA 6GSWA 2GS3A 2DKIA 5ENUA 4OWYA 2H75A 1NSWA 2PMTA 3IA1A 4MP4A 3ISOA 3WT1A 3V1WA 1M9BA 1GTAA 2B5XA 4LMVA 1JLVA 5IMFA 4F03A 2VM2A 3HJOA 4AJ7A 2ON5A 1PQNA 3TRQA 4WR5A 4MMMA 1K0MA 3GHAA 5IOWA 2REMA 4KE3A 3LGCA 2ON7A 4PX1A 1SJ6A 5IM9A 4FYUA 3TJJA 4AI6A 2KLXA 2LKUA 5IIZA 4IELA 4HOJA 3K8NA 2H30A 10GSA 4FYCA 1B9XC 1QUWA 3QR6A 3I69A 2YWIA 2O7KA 5ECQB 5E59A 1QFNA 3LORA 1N2AA 4V2MA 1X5CA 4KX4A 4JR6A 3TOTA 4LL4B 1MEKA 2LV3A 4IP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3O A;  1EZK A;  3O76 A;  3F0I A;  4HZ4 A;  5J4U A;  3TKP A;  3RDW A;  3EUR A;  3HDC A;  2VCW A;  4OFN A;  3D4M A;  5IOX A;  4J2F A;  4GQC A;  4LL1 B;  5D73 A;  2R2J A;  1YY7 A;  3EU3 A;  1OKD A;  3FEU A;  3G7I A;  1M2D A;  2AUV A;  2MMN A;  1BJX A;  5IMA A;  5FT3 A;  2P0G A;  3LYP A;  4PNG A;  4J56 E;  1Y6E A;  4L0U A;  5ECR B;  3W6G A;  4JZQ A;  2P5Q A;  4G9H A;  3GH6 A;  2HLS A;  3Q18 A;  2CVK A;  5J3R A;  2MMA A;  2HRN A;  4BL7 B;  2XC2 A;  3ZFL A;  5KN2 A;  4DSR A;  1ML6 A;  4EDZ A;  1GSF A;  2VLV A;  5LD0 A;  1OC3 A;  4WF4 A;  4DSS B;  4FIW A;  4ML6 A;  1V2A A;  3EU4 A;  12GS A;  3Q19 A;  1JZO A;  1OC9 A;  4AJ8 A;  7GSS A;  1YKC A;  2DIZ A;  3SBC A;  2FUG 2;  1QXH A;  1XWC A;  3RAZ A;  4EDY A;  4RQX A;  5D9X A;  5D96 A;  1WRY A;  2CZ3 A;  4MF6 A;  2J23 A;  3N9J A;  3EYT A;  3EMX A;  1K0D A;  2IJY A;  3TRX A;  1Z7P A;  1NHO A;  3U5R E;  1GRX A;  5D9V A;  1NW2 A;  1HNC A;  1SD8 A;  1PX6 A;  2X64 A;  1G7E A;  5GAP D;  3J7Y k;  2H73 A;  5EY6 A;  4YQM A;  3F8U A;  2EIR A;  3TGZ A;  5HR1 A;  4G0K A;  1T7P B;  4POB A;  4HZ2 A;  4F9Z A;  1I9D A;  1XW9 A;  1OC8 A;  1GSU A;  3UAR A;  3I6A A;  2L5O A;  2VAF A;  2K8S A;  4POM A;  6GSV A;  3GA4 A;  1A2J A;  4GLT A;  3UVT A;  3D4T A;  1YQ1 A;  3KJY A;  3DEX A;  1G0T A;  5INY A;  1U3I A;  4FQU A;  1WE0 A;  4IGJ A;  3GIX A;  1SK1 A;  4XS1 A;  3UAP A;  1MD4 A;  5ECI B;  2DJ1 A;  1EEJ A;  2MYG A;  2WGR A;  3LYK A;  1GP1 A;  1DE1 A;  1FO5 A;  2H0G A;  1J0F A;  3PH9 A;  1V57 A;  4XS4 B;  2NDO A;  2EIO A;  1ZOF A;  2OBI A;  3F9U A;  2H1A A;  2CAI A;  3VPT A;  2DML A;  5IMC A;  4G19 A;  3DRN A;  5KN3 A;  1BX9 A;  3S9F A;  2IL3 A;  2YNX A;  3NIV A;  19GS A;  3IDV A;  3EMP A;  4EUY A;  4PUA A;  1V9W A;  1KEB A;  4WBR D;  3PPU A;  4ECC A;  2VCT A;  2L6C A;  2L4C A;  2ZCT A;  5LCZ A;  1TOF A;  2JSY A;  1V58 A;  1XW5 A;  4E8E A;  4TR4 A;  1LBK A;  2DJJ A;  5A4U A;  1LU4 A;  4H86 A;  5D8I A;  1PX7 A;  4IQ1 A;  3TDG A;  2YP6 A;  3IRA A;  3CTG A;  2YZU A;  4MF5 A;  1VF1 A;  2R3X A;  2B3S A;  4MLY A;  5ECN B;  1ON4 A;  2XPE A;  1QGV A;  3F3Q A;  5AIV A;  1RW1 A;  1FW1 A;  2F8A A;  5DBQ A;  1K0N A;  4ZB8 A;  4I8B A;  1ERU A;  3GKK A;  1JZW A;  3ZYW A;  3F3R A;  3D6I A;  4KCA A;  1XOB A;  2AV4 A;  1VGL A;  2CT6 A;  3A2W A;  5DAK A;  1T4Y A;  1FVK A;  1EWX A;  1V98 A;  2IMK A;  3ZRD A;  3IOS A;  2F3M A;  1TXX A;  4PQ1 A;  4XTS A;  3C1R A;  4PTS A;  5ID2 A;  4K9Z A;  3FZ4 A;  5G1K A;  2KP2 A;  2M80 A;  4MDC A;  4HQS A;  3KEB A;  2YJ7 A;  1EV9 A;  3RPP A;  2GZY A;  4RI7 A;  1ERV A;  1WPI A;  4ZL9 A;  4ZBB A;  3HZ4 A;  2F51 A;  3HVS A;  1Z7R A;  4O92 A;  3DKS A;  4EF0 A;  4MK3 A;  5CRW A;  5LNK e;  3KP8 A;  1FHE A;  3TKQ A;  1A0F A;  4Z7X A;  4YQU A;  1X5D A;  2I3Y A;  2HQT A;  1T1V A;  3GN3 A;  4YAV A;  1HNA A;  1Z3E A;  1M0U A;  1PD2 1;  2MMZ A;  5IO0 A;  1M9A A;  4TW5 A;  3F4S A;  1GSQ A;  3GL3 A;  1AIU A;  1F37 A;  3IHQ A;  2K9F A;  3LJR A;  4KND A;  4HU9 A;  5AGY A;  3ZFB A;  3TJF A;  1YDK A;  3QPM A;  2KUC A;  5F07 A;  1TK0 B;  3AY8 A;  3I43 A;  1PL1 A;  2C0G A;  4N10 A;  2ZNM A;  4KSO A;  3QFA C;  3KH9 A;  2FA8 A;  5JCW A;  1K0B A;  3ZRE A;  1ZYQ B;  1ERW A;  1R5P A;  1GUL A;  2DSA A;  4MH2 A;  4L8E A;  2OE1 A;  3PIN A;  1XXU A;  2UZ8 A;  3GUR A;  1B4P A;  3DGQ A;  3G7Y A;  1EGO A;  4HEA 2;  1FOV A;  2LJA A;  4Q5Q A;  3MNG A;  4Q5N A;  3HJM A;  4I5Q A;  3KD0 A;  5B7C A;  4FH8 A;  2KOK A;  3GKX A;  4F0B A;  2VIM A;  2JAD A;  2IFQ B;  3RBT A;  1FG4 A;  2FA4 A;  3GST A;  3VPQ A;  4X1U A;  4O7H A;  1K0O A;  1MDI A;  2I9H A;  3LEF A;  5ABR A;  5IMZ A;  3BCK A;  5ECH B;  1KBN A;  5IPH A;  1WJK A;  2B7J A;  3C1S A;  2HSN B;  5CP1 A;  3VUR A;  1H75 A;  3G9B A;  1ERT A;  3NOF A;  3GYK A;  1TU8 A;  4D73 A;  3EIN A;  1GL8 A;  2VCX A;  1QK8 A;  3W8S A;  1AC1 A;  4IN0 A;  4L5L A;  4BA7 A;  1BAY A;  4AGS A;  2CZ2 A;  4IW9 A;  5ID2 B;  2WCI A;  3QMX A;  2HFD A;  4G0L A;  3H79 A;  1X9S B;  3HHV A;  4MPF A;  2FWF A;  4GQF A;  3EWL A;  2E7P A;  4P3Y B;  4ECI A;  5HFI A;  4EO3 A;  4ZIJ A;  1GTB A;  1XWG A;  2WRT A;  3I9V 2;  4MJC A;  4GRF A;  4QL7 A;  1SL0 B;  1JZR A;  5ECS A;  2IMD A;  1UC7 A;  3CTF A;  3IV4 A;  3HY2 A;  3ZIJ A;  1XWA A;  2PN8 A;  2RUE A;  4ULX A;  2IN3 A;  5HFK A;  5ECP B;  1DUG A;  2YOI A;  2VL3 A;  5J9C A;  1AXD A;  3M1G A;  5G31 A;  3A2V A;  4WEY A;  2HZE A;  2LJK A;  2H1G A;  3WYW A;  3FK8 A;  3L9S A;  3APS A;  2VM1 A;  4ACS A;  2JZS A;  2G0F A;  5H5Q A;  2HYX A;  4PXO A;  3GTU B;  5G1L A;  3LWA A;  3GH9 A;  4USS A;  1FVJ A;  1SYR A;  1B8X A;  3IAS 2;  4POK A;  5G5F A;  2DIY A;  3C73 A;  1PRX A;  2AJQ B;  4ML1 A;  2I4A A;  4N11 A;  1Z6N A;  1R7H A;  4K2D A;  4JE1 A;  2LUS A;  5HQP A;  6GSY A;  4BWS A;  3BJ5 A;  1MDK A;  2O8V B;  3OR5 A;  4JRR A;  2L57 A;  2H72 A;  2V6K A;  2C0F A;  4TR1 B;  1PGT A;  1Z6M A;  4CHS A;  2TRX A;  3VWW A;  3KMO A;  3IK7 A;  3KGK A;  4GST A;  5B6M A;  3VWX A;  2FD3 A;  2QSI A;  3QOU A;  2VLU A;  3ME8 A;  4OO4 A;  4MA9 A;  3GX0 A;  3H93 A;  2CA8 A;  3QAG A;  3IPZ A;  5HFG A;  2B5E A;  2A2S A;  1SYX A;  3VLN A;  3HD5 A;  5J5N A;  4HU7 A;  8GSS A;  2YWN A;  5J41 A;  3QAV A;  1ZMA A;  2FNO A;  2GQM A;  4GXZ A;  1K0A A;  3L9V A;  4KA0 A;  4PQI A;  1O73 A;  3ED3 A;  2VL9 A;  4DEJ A;  3UBK A;  3R2Q A;  5DJM A;  2K8V A;  1O85 A;  3KMN A;  4ECJ A;  1ZZY A;  1Q4J A;  2K6V A;  2IME A;  3PGT A;  2I1U A;  1BG5 A;  2R4V A;  2YZH A;  5CRG A;  2A2R A;  1GUK A;  3UOM A;  2HT9 A;  2HSM A;  3TOU A;  2LQO A;  2PBJ A;  3ZIT A;  3M3M A;  1BQ7 A;  1MD3 A;  4EC0 A;  4BWQ A;  1SL1 B;  2H6X A;  4RQR A;  2YV7 A;  1YEX A;  1GSS A;  2IWT A;  1ABA A;  2LNT A;  5H5R A;  5IQY A;  3FW2 A;  5C00 A;  1SJZ A;  2H19 A;  1TP9 A;  5AIX A;  5KN1 A;  2PVO C;  3IR4 A;  1W89 A;  1HNB A;  4RI6 A;  5IMD A;  4L5O A;  1R26 A;  2FWH A;  2C80 A;  4KAE A;  2TRC P;  3C8E A;  3TJK A;  1MTC A;  4BVX A;  3LSZ A;  3L0H A;  1SD9 A;  2MZC A;  1GNE A;  2KHP A;  4N0V A;  2LNS A;  5H5S A;  3IAM 2;  3FZ9 A;  4N30 A;  2NBS A;  5GAN D;  4NV2 A;  1S3C A;  5CRE A;  4I6X A;  5DDL A;  1U87 A;  4PGT A;  3FKF A;  3FZ5 A;  4NPB A;  4GCI A;  2B5Y A;  2GZZ A;  3FZA A;  3EE2 A;  4HDE A;  1U6T A;  2H1D A;  2O89 A;  3TKS E;  3FR9 A;  4F2I A;  1UVZ A;  3UL3 A;  3O6T A;  2ES7 A;  4TXO A;  1IYI A;  2MMO A;  2BMX A;  2P5R A;  1TRU A;  1QMV A;  4XHM A;  2LS5 A;  2PGT A;  5DAL A;  4NHW A;  3APQ A;  1CQH A;  1VF2 A;  5FHI A;  3P8W A;  1EOH A;  4MH3 A;  2N5F A;  1OC9 B;  3TB2 A;  2QKE A;  1U88 A;  2X8C A;  3HYP A;  1MDJ A;  1Z5Y E;  3M9K A;  4NMU A;  2JAC A;  3QD9 A;  2H0H A;  4OFM A;  4EE0 A;  4QQ7 A;  2H6Y A;  5G2Z A;  1JLW A;  2E2M A;  3ME7 A;  4MZW A;  5BMU A;  1JHB A;  1T3B A;  6GST A;  3D5J A;  2OBK A;  1SK2 A;  3ZIV A;  5DQS A;  1WWJ A;  3KZQ A;  5AN1 A;  3DIE A;  4OMV A;  2H1B A;  16GS A;  2HSH A;  1OVN A;  3VWV A;  1SEN A;  5DCG A;  2O87 A;  1THX A;  2B6M A;  1SKW B;  1LJR A;  3MWH A;  3D21 A;  1B9Y C;  4BVY A;  1HD2 A;  1BED A;  2CVB A;  3ERF A;  2YWO A;  4PUF C;  2AHE A;  1G7O A;  1WMJ A;  3Q6O A;  2JZT A;  3E9J B;  4WKW A;  5CRH A;  3HJP A;  1ZL9 A;  3FR3 A;  3F6F A;  1RK4 A;  4IQA A;  2MBT A;  4NV5 A;  2GQL A;  4GF0 A;  1ZYE A;  4OO5 A;  4NAX A;  5A5K A;  1AQX A;  3A5W A;  1J9B A;  2KP1 A;  5F8B A;  3M9J A;  3L9U A;  3WGD A;  2RM5 A;  2H6Z A;  2WJU A;  2HXK A;  5AIS A;  4KW6 A;  3IXR A;  4GWR A;  3H1N A;  1VF3 A;  1XZO A;  4BPY A;  2AAW A;  4HI7 A;  4KSM A;  1XW6 A;  2FWE A;  3UIW A;  2DLX A;  4ID0 A;  2IMI A;  4TKY A;  5JWR B;  1X9M B;  3GKN A;  5EVO A;  5F05 A;  1K3Y A;  1FB0 A;  3KM6 A;  2FCH A;  3IE3 A;  2VUP A;  1S3D A;  3RHB A;  1SKR B;  1GUH A;  3IBH A;  1TRS A;  3C7M A;  4K8M A;  1XWK A;  4PQH A;  3D0Z A;  1R4W A;  1XVW A;  4ZBA A;  3GSS A;  4NHZ A;  1A2M A;  5JCU A;  1GWC A;  4MJA A;  2CVD A;  4YAP A;  2HZF A;  2OE3 A;  2EIQ A;  5KEJ A;  3GNJ A;  3HXS A;  2R5G A;  2V2G A;  1XPV A;  1M7T A;  2TIR A;  1OE8 A;  5ELG A;  2XBQ A;  5D9T A;  1IYH A;  1F9M A;  4OD7 A;  2VD1 A;  1G6W A;  4V1A p;  2F8F A;  4AF2 A;  1C72 A;  2LRN A;  4GSN A;  2OA7 A;  4L0W A;  2E0Q A;  1EEM A;  2GSQ A;  1SJI A;  1A24 A;  1YF0 A;  1K0C A;  4WR4 A;  1USB A;  1B4Q A;  3HCZ A;  2VD0 A;  2H0I A;  1UN2 A;  2OE0 A;  3LG6 A;  2NPB A;  3ZVJ A;  2V1M A;  4K0N A;  4BVY B;  1A2L A;  2L59 A;  1GNW A;  5ECL B;  2RM6 A;  6GSU A;  3KIJ A;  1A23 A;  1OKT A;  1A8Y A;  3Q74 A;  4MJE A;  2VCQ A;  1AUC A;  3GMF A;  2CV4 A;  1O81 A;  1ZCP A;  4MAB A;  1X5E A;  3ERG A;  5ELA A;  1M2A A;  1PSQ A;  5GZZ B;  4JU5 A;  5DAK B;  4KDY A;  3HVV A;  4JED A;  2HI7 A;  5DVB A;  2ALB A;  2X99 A;  5J9B A;  3LXZ A;  2O85 A;  1HYU A;  1XCC A;  2C3Q A;  1TDI A;  2HNL A;  3U6V A;  1O7U A;  2VLT A;  3E3E A;  2VCZ A;  2FGX A;  3US3 A;  3QCP A;  2Z9S A;  1O6J A;  5CO3 A;  4XS6 A;  4IVF A;  4HQZ A;  5FWG A;  2C1Y A;  3MDK A;  4I2U A;  2IPA A;  1M2B A;  1THO A;  3PR8 A;  4OCE A;  5ECM B;  4G0I A;  2NTO A;  3P7X A;  4TN8 A;  3TKS C;  1AQW A;  2GT5 A;  3UMA A;  4BL7 A;  3CMI A;  3TJG A;  1U3A A;  1F3A A;  2F9S A;  4K7I A;  2R6K A;  1A8L A;  1E2Y A;  2L5L A;  2WS2 A;  2M72 A;  2DMM A;  4KF9 A;  2JU5 A;  4DSS A;  3FR6 A;  1Z9H A;  3LQ7 A;  3GKM A;  3TRP A;  4WET A;  2GSS A;  2PUK C;  2CQ9 A;  4IJI A;  2GLR A;  4X43 A;  1Y25 A;  2PWJ A;  1TI3 A;  1S3A A;  4KUN A;  3H4K A;  5B6N A;  2FY6 A;  3F4T A;  4Q5R A;  2J9H A;  2GGT A;  3W8J A;  4MZB A;  2H71 A;  3APO A;  1PL2 A;  4OFT A;  2NVL A;  1GTI A;  4O32 A;  3A3T A;  1AQV A;  4PNF A;  1W4V A;  1GSE A;  3WD6 A;  2OAC A;  4ZL8 A;  2HRK A;  3ZMK A;  5D9W A;  2DJ0 A;  3E0U A;  3N5O A;  3MSZ A;  3TUE A;  5HR2 A;  1H4O A;  4WXT A;  1WP0 A;  1YJ6 A;  3LXT A;  5EL8 A;  2DBC A;  3KTB A;  20GS A;  2YWM A;  1I5G A;  2FLS A;  2OJL A;  4D73 B;  4ISD A;  1TRW A;  1XFL A;  1SU9 A;  2GZP A;  5E4W A;  4ZB9 A;  5B8A A;  1J08 A;  4TRX A;  4ZBD A;  1F6M C;  2XBI A;  2G2Q A;  5ECK B;  3VI7 A;  2DC5 A;  1TK5 B;  1GSY A;  4HUA A;  4XRA A;  5G5E A;  2B1K A;  2H01 A;  5IMV A;  4ZXG A;  1BYE A;  3CSJ A;  1NM3 A;  3F6D A;  2XPD A;  3VWU A;  2RII A;  9GSS A;  3P90 A;  1YEP A;  2IIY A;  1TKD B;  4G10 A;  3R3E A;  2N5A A;  3L78 A;  5C04 A;  2QGV A;  1GH2 A;  3KCM A;  3GRX A;  4XS4 A;  1PA3 A;  2YN1 A;  1QQ2 A;  1A0R P;  1ST9 A;  3MAK A;  3F4R A;  3BBY A;  5HR0 A;  2HZE B;  2JSZ A;  1GSD A;  2OKA A;  4LLR A;  3A2X A;  2VO4 A;  1F2E A;  1WIK A;  4IHU A;  1TK8 B;  2FWG A;  2GT6 A;  2H76 A;  3ZZX A;  2AYT A;  2VL2 C;  2H8L A;  4E8H A;  11GS A;  2PVQ A;  3HKR A;  5F0G A;  1K3L A;  4YH2 A;  2IMF A;  1TRV A;  2YCD A;  2HRF A;  2WUL A;  1PMT A;  2N5B A;  4OCF A;  1EP8 A;  1ACV A;  4DVC A;  5B8B A;  2PU9 C;  3VK9 A;  2I81 A;  5KN0 A;  3ERW A;  13GS A;  3M0F A;  5ECO B;  3HZ8 A;  3KH7 A;  1V40 A;  2HRA A;  2HRK B;  2D2Z A;  2AB6 A;  2WZ9 A;  4RUV A;  2HE3 A;  3DML A;  5F06 A;  4X0X A;  3DVW A;  4K6X A;  5DJL A;  4TXV A;  1T4Z A;  5DQY A;  4TOP A;  1AAZ A;  4EL1 A;  4JBB A;  3RPN A;  2C3N A;  3TCO A;  2L4Q A;  2E2G A;  1YZX A;  2GTU A;  4YQV A;  4V1A g;  2GDR A;  2RLI A;  4F82 A;  2L6D A;  2PER A;  3UBL A;  2LQQ A;  3WGE A;  3IC4 A;  3QDN A;  1ILO A;  2WB9 A;  4ZL7 A;  3CXG A;  4DSQ A;  1F3B A;  4QL9 A;  2LRT A;  2C3T A;  2M46 A;  2YPM A;  1O8W A;  2V32 A;  1JZD A;  3EVI A;  2C8U A;  3H8Q A;  5D93 A;  2LEG A;  5CNW A;  2C4J A;  3HA9 A;  4Q5F A;  3CBU A;  4KDX A;  1FAA A;  3LFL A;  18GS A;  3FYG A;  3CSI A;  4IP1 A;  2HSM B;  4ZIL A;  1SKS B;  2MBS A;  2H70 A;  1OYJ A;  3UJ1 A;  1DSB A;  4TR0 A;  2DJ3 A;  4MJB A;  4GTU A;  3GUS A;  4EKZ A;  1SL2 B;  1ZGN A;  1N8J A;  4KB3 A;  5CYY A;  4MCU A;  2K18 A;  5L71 A;  3KXO A;  3DXB A;  3DD3 A;  4IS0 A;  4WBJ A;  4K7N A;  4NXI A;  3D22 A;  3WGX A;  1KTE A;  3DVX A;  2C0D A;  4G2E A;  1SK0 A;  5A4W A;  2BTO T;  3GX8 A;  1DBY A;  1CQG A;  1TI1 A;  4BVX B;  2P31 A;  2ZUP A;  1GLP A;  1G6Y A;  3KP9 A;  4POL A;  1GUM A;  4NWY A;  3BOA A;  4K0G A;  1NHY A;  2IFQ A;  1TJD A;  2DJ2 A;  4XIH A;  3FRC A;  4AJ6 A;  3QAW A;  1AW9 A;  1YF1 A;  3L4N A;  1UA5 A;  2H66 A;  4KH7 A;  2GQK A;  4TVE A;  4IJ3 A;  1WOU A;  6GSX A;  4HS1 A;  1XIY A;  1T00 A;  2BJX A;  3TKS A;  2YV9 A;  2V41 A;  1OE7 A;  1PKW A;  2CX3 A;  4J57 E;  1GLQ A;  4MF7 A;  1Q98 A;  1DE2 A;  4WF5 A;  3O3T A;  2QC7 A;  4I2T A;  3TKR A;  1O8X A;  4TR3 A;  2DJK A;  4LMW A;  3UVH A;  14GS A;  4KGI A;  3F63 A;  4ECB A;  3C71 A;  1XVQ A;  3RHC A;  4TXO B;  5JWQ B;  3ZML A;  2LRC A;  2H74 A;  22GS A;  1VRS D;  2JL4 A;  3NZN A;  1YKA A;  5DAL B;  3VI5 A;  5CRD A;  4HJM A;  1RQM A;  4I97 A;  3TJB A;  3CSH A;  3J7Y b;  3CRT A;  2CX4 A;  2VCV A;  1M99 A;  3ZTL A;  1XBS A;  2VOC A;  3FHK A;  4V2L A;  4MPG A;  2FHE A;  4IKH A;  3ZVJ D;  4KDU A;  2XHF A;  3FY7 A;  2RUF A;  3QFB C;  3M8N A;  2GVP A;  1JFU A;  2B7K A;  4GSS A;  3BCI A;  5HR3 A;  3DWV A;  3DYR A;  3EC3 A;  3BD2 A;  3CYN A;  4KCE A;  5IPG A;  2JZR A;  1GTU A;  5GSS A;  2C0E A;  1E6B A;  2R37 A;  4V2N A;  1KNG A;  5IO2 A;  5DCH A;  1TU7 A;  3ZL5 A;  1VF4 A;  3GTU A;  5A4V A;  5JWO B;  6GSS A;  1PKZ A;  3SWL A;  1X9W B;  1EGR A;  4XRD A;  3JCM L;  4EVM A;  4CW9 A;  1B48 A;  4EXJ A;  17GS A;  3P2A A;  1HQO A;  1URM A;  4K7O A;  5EPF A;  2GST A;  5GST A;  3KTL A;  3HVX A;  3GL5 A;  4XCS A;  2PPT A;  4PUR A;  4N0Z A;  4JR4 A;  2B1L A;  4CDO A;  2OAD A;  1EOG A;  5JCG A;  3G7J A;  2LJR A;  3IC8 A;  2A4V A;  4TR1 A;  1XOA A;  3VFI A;  2WFC A;  5G30 A;  2WDU A;  2X8G A;  3CRU A;  2YJH A;  1TW9 A;  4ZB6 A;  3ZLP A;  4LA1 A;  1OAZ A;  4O5R A;  4FO5 A;  2LST A;  2V6O A;  4MZC A;  1XWB A;  3WT2 A;  4FYB A;  5COH A;  2EC4 A;  1X0R A;  4IBP A;  4F0C A;  1PN9 A;  1EP7 A;  2CAQ A;  3GFK A;  5CAX A;  4ILF A;  1T8E B;  2LTK A;  2X8H A;  3IK9 A;  4K1F A;  3GV1 A;  2GSR A;  1R5A A;  2HSY A;  2VL2 A;  1EV4 A;  3UEM A;  1TTZ A;  4HJ2 A;  1FB6 A;  2YAN A;  6GSW A;  2GS3 A;  5ENU A;  4OWY A;  2H75 A;  1NSW A;  2PMT A;  3IA1 A;  4MP4 A;  3ISO A;  3WT1 A;  3V1W A;  1M9B A;  1GTA A;  2B5X A;  4LMV A;  1JLV A;  5IMF A;  4F03 A;  2VM2 A;  3HJO A;  4AJ7 A;  2ON5 A;  1PQN A;  3TRQ A;  4WR5 A;  4MMM A;  1K0M A;  3GHA A;  5IOW A;  2REM A;  4KE3 A;  3LGC A;  2ON7 A;  4PX1 A;  1SJ6 A;  5IM9 A;  4FYU A;  3TJJ A;  2KLX A;  2LKU A;  5IIZ A;  4IEL A;  4HOJ A;  3K8N A;  2H30 A;  10GS A;  4FYC A;  1B9X C;  1QUW A;  3QR6 A;  3I69 A;  2YWI A;  2O7K A;  5ECQ B;  5E59 A;  1QFN A;  3LOR A;  1N2A A;  4V2M A;  1X5C A;  4KX4 A;  4JR6 A;  3TOT A;  4LL4 B;  1MEK A;  2LV3 A;  4IP6 A; 
#chains in the Genus database with same CATH topology
 1K3O A;  1EZK A;  3O76 A;  3F0I A;  4HZ4 A;  5J4U A;  3TKP A;  3RDW A;  3EUR A;  2X49 A;  3HDC A;  2VCW A;  4OFN A;  3D4M A;  5IOX A;  4J2F A;  4GQC A;  4LL1 B;  5D73 A;  2R2J A;  1YY7 A;  3EU3 A;  1OKD A;  3FEU A;  3G7I A;  1M2D A;  2AUV A;  2MMN A;  1BJX A;  5IMA A;  5FT3 A;  2P0G A;  2WW2 A;  3LYP A;  3HVN A;  4PNG A;  4J56 E;  1Y6E A;  4L0U A;  5ECR B;  3W6G A;  4JZQ A;  2P5Q A;  4G9H A;  3GH6 A;  2HLS A;  3Q18 A;  2CVK A;  5J3R A;  2MMA A;  2HRN A;  4BL7 B;  2XC2 A;  3ZFL A;  5KN2 A;  4DSR A;  1ML6 A;  4EDZ A;  1GSF A;  2VLV A;  5LD0 A;  1OC3 A;  4WF4 A;  4DSS B;  4FIW A;  2WZS A;  4ML6 A;  1V2A A;  3EU4 A;  12GS A;  3Q19 A;  1JZO A;  1OC9 A;  4AJ8 A;  7GSS A;  1YKC A;  2DIZ A;  3SBC A;  2FUG 2;  2A4H A;  1QXH A;  2WW3 A;  1XWC A;  3RAZ A;  4EDY A;  4RQX A;  5D9X A;  5D96 A;  1WRY A;  2CZ3 A;  4MF6 A;  2J23 A;  3N9J A;  3EYT A;  3EMX A;  1K0D A;  2IJY A;  3TRX A;  1Z7P A;  1NHO A;  3U5R E;  1GRX A;  5D9V A;  1NW2 A;  1HNC A;  1SD8 A;  1PX6 A;  2X64 A;  1G7E A;  5GAP D;  3J7Y k;  2H73 A;  5EY6 A;  4YQM A;  3F8U A;  2EIR A;  3TGZ A;  5HR1 A;  4G0K A;  1T7P B;  2X4A A;  4POB A;  4HZ2 A;  4F9Z A;  1I9D A;  1XW9 A;  1OC8 A;  3CHX C;  1GSU A;  3UAR A;  3I6A A;  2L5O A;  2VAF A;  2K8S A;  4POM A;  6GSV A;  3GA4 A;  1A2J A;  4GLT A;  3UVT A;  3D4T A;  1YQ1 A;  3KJY A;  3DEX A;  1G0T A;  5INY A;  1U3I A;  4FQU A;  1WE0 A;  4IGJ A;  3GIX A;  1SK1 A;  4XS1 A;  3UAP A;  1MD4 A;  5ECI B;  2DJ1 A;  1EEJ A;  2MYG A;  2WGR A;  3LYK A;  1GP1 A;  1DE1 A;  1FO5 A;  2H0G A;  1J0F A;  3PH9 A;  1V57 A;  4XS4 B;  2NDO A;  2EIO A;  1ZOF A;  2OBI A;  3F9U A;  2H1A A;  2DML A;  2CAI A;  3VPT A;  4E68 A;  5IMC A;  4PHZ C;  4G19 A;  3DRN A;  5KN3 A;  3RGB C;  1BX9 A;  3S9F A;  2IL3 A;  2YNX A;  3NIV A;  19GS A;  3IDV A;  3EMP A;  4EUY A;  4PUA A;  1V9W A;  1KEB A;  4WBR D;  3PPU A;  4ECC A;  2VCT A;  2L6C A;  2L4C A;  2ZCT A;  5LCZ A;  1TOF A;  2JSY A;  1V58 A;  4ZB7 A;  1XW5 A;  4E8E A;  4TR4 A;  1LBK A;  2DJJ A;  5A4U A;  1YEW C;  1LU4 A;  4H86 A;  5D8I A;  1PX7 A;  4IQ1 A;  3TDG A;  2YP6 A;  3IRA A;  3CTG A;  2YZU A;  4MF5 A;  4AKG A;  1VF1 A;  2R3X A;  2B3S A;  4MLY A;  5ECN B;  5J4Y A;  1ON4 A;  2XPE A;  1QGV A;  3F3Q A;  5AIV A;  1RW1 A;  1FW1 A;  2F8A A;  5DBQ A;  2O3E A;  1K0N A;  4ZB8 A;  4I8B A;  1ERU A;  3GKK A;  1JZW A;  3ZYW A;  3F3R A;  3D6I A;  4KCA A;  1TXU A;  4EIQ A;  2HSN A;  1XOB A;  2AV4 A;  1VGL A;  2CT6 A;  3A2W A;  4HSC X;  5DAK A;  1T4Y A;  1FVK A;  2WW1 A;  1EWX A;  1V98 A;  4K2X A;  2IMK A;  5A1N B;  3ZRD A;  3IOS A;  2F3M A;  1TXX A;  1ZYN A;  4PQ1 A;  4XTS A;  3C1R A;  4PTS A;  5ID2 A;  3CQF A;  4K9Z A;  3FZ4 A;  5G1K A;  2KP2 A;  2M80 A;  4MDC A;  4HQS A;  3KEB A;  2YJ7 A;  1EV9 A;  3RPP A;  2GZY A;  4RI7 A;  1ERV A;  1WPI A;  4ZL9 A;  4ZBB A;  3HZ4 A;  2F51 A;  3HVS A;  1Z7R A;  4O92 A;  3DKS A;  4EF0 A;  4MK3 A;  5CRW A;  5LNK e;  3KP8 A;  1FHE A;  3TKQ A;  1A0F A;  4Z7X A;  4YQU A;  1X5D A;  2I3Y A;  2HQT A;  1T1V A;  3GN3 A;  4YAV A;  1HNA A;  1Z3E A;  1M0U A;  1PD2 1;  2MMZ A;  5IO0 A;  1M9A A;  4TW5 A;  3F4S A;  1GSQ A;  4CY6 A;  3GL3 A;  1AIU A;  1F37 A;  3IHQ A;  2K9F A;  3LJR A;  4KND A;  4HU9 A;  5AGY A;  3ZFB A;  3TJF A;  1YDK A;  3QPM A;  2KUC A;  3EPT A;  5F07 A;  1TK0 B;  3AY8 A;  3I43 A;  1PL1 A;  2C0G A;  4N10 A;  2ZNM A;  1SVL A;  4KSO A;  3QFA C;  3KH9 A;  2FA8 A;  2WVX B;  5JCW A;  1K0B A;  3ZRE A;  1ZYQ B;  1ERW A;  1R5P A;  1GUL A;  2QA1 A;  2DSA A;  4MH2 A;  4L8E A;  2OE1 A;  3PIN A;  1XXU A;  4YKG A;  2UZ8 A;  3GUR A;  1B4P A;  3DGQ A;  3G7Y A;  1EGO A;  4HEA 2;  1FOV A;  2LJA A;  4Q5Q A;  3MNG A;  4Q5N A;  3HJM A;  1M3J A;  4I5Q A;  3KD0 A;  4A5P A;  5B7C A;  4FH8 A;  2KOK A;  3GKX A;  4F0B A;  2VIM A;  2JAD A;  2IFQ B;  3RBT A;  1FG4 A;  2FA4 A;  3GST A;  3VPQ A;  4X1U A;  4X4J A;  4O7H A;  1K0O A;  1MDI A;  2I9H A;  3LEF A;  5ABR A;  5IMZ A;  3BCK A;  5ECH B;  1KBN A;  5IPH A;  1WJK A;  2B7J A;  3C1S A;  2HSN B;  5CP1 A;  3VUR A;  1H75 A;  3G9B A;  1ERT A;  3NOF A;  3GYK A;  1TU8 A;  4D73 A;  3EIN A;  1GL8 A;  2VCX A;  1QK8 A;  3W8S A;  4AKI A;  1AC1 A;  2QA2 A;  4IN0 A;  4L5L A;  4BA7 A;  1BAY A;  4AGS A;  2CZ2 A;  4IW9 A;  5ID2 B;  2WCI A;  3QMX A;  2HFD A;  4G0L A;  3H79 A;  1X9S B;  3HHV A;  4MPF A;  2FWF A;  4GQF A;  3EWL A;  2E7P A;  4P3Y B;  4ECI A;  5HFI A;  4EO3 A;  4ZIJ A;  1GTB A;  1XWG A;  2WRT A;  4EIP A;  3I9V 2;  3LW9 A;  4MJC A;  4GRF A;  4QL7 A;  1SL0 B;  1JZR A;  5ECS A;  2IMD A;  1UC7 A;  3CTF A;  3IV4 A;  3HY2 A;  3ZIJ A;  1XWA A;  2PN8 A;  2RUE A;  4ULX A;  2IN3 A;  5HFK A;  5ECP B;  1DUG A;  2YOI A;  2VL3 A;  5J9C A;  1AXD A;  1SVM A;  3M1G A;  5G31 A;  3A2V A;  4WEY A;  2HZE A;  2LJK A;  2H1G A;  3WYW A;  2O36 A;  3FK8 A;  3L9S A;  3APS A;  2VM1 A;  4ACS A;  2JZS A;  2G0F A;  5H5Q A;  2HYX A;  4PXO A;  3GTU B;  5G1L A;  3LWA A;  3GH9 A;  4USS A;  1FVJ A;  1SYR A;  1B8X A;  3IAS 2;  4POK A;  5G5F A;  2DIY A;  3C73 A;  4N3Z A;  1PRX A;  2AJQ B;  4ML1 A;  2I4A A;  4N11 A;  1Z6N A;  1R7H A;  4K2D A;  4JE1 A;  2LUS A;  5HQP A;  6GSY A;  4BWS A;  3BJ5 A;  1MDK A;  2O8V B;  3OR5 A;  4JRR A;  2L57 A;  2H72 A;  2V6K A;  2C0F A;  4TR1 B;  1PGT A;  1Z6M A;  4CHS A;  2TRX A;  3VWW A;  3KMO A;  3IK7 A;  1BF5 A;  3KGK A;  4GST A;  1SVO A;  5B6M A;  3VWX A;  2FD3 A;  2QSI A;  3QOU A;  2VLU A;  3ME8 A;  4OO4 A;  4MA9 A;  3GX0 A;  3H93 A;  2CA8 A;  3QAG A;  3IPZ A;  5HFG A;  2B5E A;  3A5I A;  2A2S A;  1SYX A;  4YKF A;  3VLN A;  3HD5 A;  5J5N A;  4HU7 A;  8GSS A;  1I1I P;  2YWN A;  2EFD A;  5J41 A;  3QAV A;  4AKH A;  1ZMA A;  2FNO A;  2GQM A;  4GXZ A;  1K0A A;  3L9V A;  4KA0 A;  4PQI A;  1O73 A;  3ED3 A;  2VL9 A;  4DEJ A;  3UBK A;  3R2Q A;  5DJM A;  2K8V A;  1O85 A;  3KMN A;  1S4B P;  4ECJ A;  1ZZY A;  1Q4J A;  2K6V A;  2IME A;  3PGT A;  2I1U A;  1BG5 A;  2R4V A;  2YZH A;  5CRG A;  2A2R A;  1GUK A;  3UOM A;  2HT9 A;  2HSM A;  3TOU A;  2LQO A;  2PBJ A;  3ZIT A;  2EFC A;  3M3M A;  1BQ7 A;  1MD3 A;  4EC0 A;  4BWQ A;  1SL1 B;  1BG1 A;  2H6X A;  4RQR A;  2YV7 A;  1YEX A;  1GSS A;  2IWT A;  1ABA A;  2LNT A;  5H5R A;  5IQY A;  3FW2 A;  5C00 A;  1SJZ A;  2H19 A;  1TP9 A;  5AIX A;  5KN1 A;  2PVO C;  3IR4 A;  1W89 A;  1HNB A;  4RI6 A;  5J47 A;  5IMD A;  4L5O A;  1R26 A;  2FWH A;  2C80 A;  4KAE A;  2TRC P;  4Z2T A;  3C8E A;  3TJK A;  1MTC A;  4BVX A;  3LSZ A;  3L0H A;  1SD9 A;  2MZC A;  1GNE A;  2KHP A;  4N0V A;  2LNS A;  5H5S A;  3IAM 2;  3FZ9 A;  4N30 A;  2NBS A;  5GAN D;  4NV2 A;  1S3C A;  5CRE A;  4I6X A;  5DDL A;  1U87 A;  4PGT A;  3FKF A;  3FZ5 A;  4NPB A;  4GCI A;  4G01 A;  2B5Y A;  2GZZ A;  3FZA A;  3EE2 A;  5KOX A;  4HDE A;  1U6T A;  2H1D A;  2A2P A;  2O89 A;  3TKS E;  3FR9 A;  4F2I A;  1UVZ A;  3UL3 A;  3O6T A;  2ES7 A;  4TXO A;  1IYI A;  2MMO A;  2BMX A;  2P5R A;  1TRU A;  1QMV A;  4XHM A;  4AKX B;  2LS5 A;  2PGT A;  5DAL A;  4NHW A;  3APQ A;  1CQH A;  1VF2 A;  5FHI A;  3P8W A;  1EOH A;  4MH3 A;  2N5F A;  1OC9 B;  3TB2 A;  2QKE A;  1U88 A;  2X8C A;  3HYP A;  1MDJ A;  1Z5Y E;  3M9K A;  4NMU A;  2JAC A;  3QD9 A;  2H0H A;  4CY8 A;  4OFM A;  4EE0 A;  4QQ7 A;  2H6Y A;  5G2Z A;  1JLW A;  2E2M A;  3ME7 A;  4MZW A;  5BMU A;  1JHB A;  1T3B A;  6GST A;  3D5J A;  3MYD A;  2OBK A;  1SK2 A;  3ZIV A;  5DQS A;  1WWJ A;  3KZQ A;  5AN1 A;  3DIE A;  4OMV A;  2H1B A;  16GS A;  2HSH A;  1OVN A;  3VWV A;  1SEN A;  5DCG A;  2O87 A;  1THX A;  2B6M A;  1SKW B;  1LJR A;  3MWH A;  2R0P A;  3D21 A;  1B9Y C;  4BVY A;  1HD2 A;  1BED A;  2CVB A;  3ERF A;  2YWO A;  4PUF C;  4ICY A;  2AHE A;  1G7O A;  1WMJ A;  3Q6O A;  2JZT A;  3E9J B;  4WKW A;  5CRH A;  3HJP A;  1ZL9 A;  3FR3 A;  3F6F A;  1RK4 A;  4IQA A;  2MBT A;  4NV5 A;  4QMK A;  2GQL A;  4GF0 A;  1ZYE A;  4OO5 A;  5KOW A;  2DKH A;  4NAX A;  5A5K A;  1AQX A;  3A5W A;  1J9B A;  2KP1 A;  5F8B A;  3M9J A;  3L9U A;  3WGD A;  2RM5 A;  2H6Z A;  2WJU A;  2HXK A;  5AIS A;  4KW6 A;  3IXR A;  4GWR A;  3H1N A;  1VF3 A;  1XZO A;  4BPY A;  2AAW A;  3CWG A;  4HI7 A;  4KSM A;  1XW6 A;  2FWE A;  3UIW A;  2DLX A;  4ID0 A;  2IMI A;  4TKY A;  5JWR B;  1X9M B;  3GKN A;  5EVO A;  5F05 A;  1K3Y A;  1FB0 A;  3KM6 A;  2FCH A;  3IE3 A;  2VUP A;  1S3D A;  3RHB A;  1SKR B;  1GUH A;  3IBH A;  1TRS A;  3C7M A;  4K8M A;  1XWK A;  4PQH A;  3D0Z A;  5A34 A;  1R4W A;  1XVW A;  4ZBA A;  3GSS A;  4NHZ A;  1A2M A;  5JCU A;  1GWC A;  4MJA A;  2CVD A;  4YAP A;  2HZF A;  2OE3 A;  2EIQ A;  4PI0 C;  5KEJ A;  3GNJ A;  3HXS A;  2R5G A;  2V2G A;  1XPV A;  1M7T A;  2TIR A;  1OE8 A;  5ELG A;  2XBQ A;  5D9T A;  1IYH A;  1F9M A;  4OD7 A;  2VD1 A;  1G6W A;  4V1A p;  2F8F A;  4AF2 A;  1C72 A;  2LRN A;  4GSN A;  2OA7 A;  4L0W A;  2E0Q A;  1EEM A;  2GSQ A;  1SJI A;  1A24 A;  1YF0 A;  1K0C A;  4WR4 A;  1USB A;  1B4Q A;  3HCZ A;  2VD0 A;  2H0I A;  1UN2 A;  2OE0 A;  3LG6 A;  2NPB A;  2WVZ A;  2V1M A;  3ZVJ A;  4K0N A;  4BVY B;  1A2L A;  2L59 A;  1GNW A;  5ECL B;  2RM6 A;  6GSU A;  4K5S A;  3KIJ A;  4Z2R A;  1A23 A;  1OKT A;  1A8Y A;  3Q74 A;  4K5R A;  4MJE A;  2VCQ A;  1AUC A;  3GMF A;  2CV4 A;  1O81 A;  1ZCP A;  4MAB A;  1X5E A;  3ERG A;  5ELA A;  1M2A A;  1PSQ A;  5GZZ B;  4JU5 A;  5DAK B;  4KDY A;  3HVV A;  4JED A;  2HI7 A;  5DVB A;  2ALB A;  2X99 A;  5J9B A;  3LXZ A;  2O85 A;  1HYU A;  1XCC A;  2C3Q A;  1TDI A;  2HNL A;  3U6V A;  1O7U A;  4BIK A;  2VLT A;  3E3E A;  2VCZ A;  2FGX A;  3US3 A;  3QCP A;  2Z9S A;  1O6J A;  5CO3 A;  4XS6 A;  4IVF A;  4HQZ A;  5FWG A;  2C1Y A;  3MDK A;  4I2U A;  2IPA A;  1M2B A;  2H1L A;  1THO A;  3PR8 A;  4OCE A;  5ECM B;  4G0I A;  2NTO A;  3P7X A;  4TN8 A;  3TKS C;  1AQW A;  2GT5 A;  3UMA A;  4BL7 A;  3CMI A;  3TJG A;  1U3A A;  1F3A A;  2F9S A;  4K7I A;  2R6K A;  1A8L A;  1E2Y A;  5A34 B;  2L5L A;  2WS2 A;  2M72 A;  2DMM A;  4KF9 A;  2JU5 A;  4DSS A;  3FR6 A;  1Z9H A;  3LQ7 A;  3GKM A;  4Z2U A;  3TRP A;  4WET A;  2GSS A;  2PUK C;  2CQ9 A;  4IJI A;  2GLR A;  4X43 A;  1Y25 A;  2PWJ A;  1TI3 A;  3RFR C;  1S3A A;  4KUN A;  3H4K A;  5B6N A;  2FY6 A;  3F4T A;  4Q5R A;  2J9H A;  2GGT A;  3W8J A;  4MZB A;  2H71 A;  3APO A;  1PL2 A;  4OFT A;  2NVL A;  1GTI A;  4O32 A;  3A3T A;  1ZYP A;  1AQV A;  4PNF A;  1W4V A;  1GSE A;  3WD6 A;  5J40 A;  2OAC A;  4ZL8 A;  2HRK A;  3ZMK A;  5D9W A;  2DJ0 A;  3E0U A;  3N5O A;  3MSZ A;  3TUE A;  5HR2 A;  1H4O A;  4WXT A;  1WP0 A;  1YJ6 A;  3LXT A;  5EL8 A;  2DBC A;  3KTB A;  20GS A;  2YWM A;  1I5G A;  2FLS A;  2OJL A;  4D73 B;  4ISD A;  1TRW A;  1XFL A;  1SU9 A;  2GZP A;  5E4W A;  4ZB9 A;  5B8A A;  1J08 A;  4TRX A;  1M3I A;  4W66 A;  4ZBD A;  1F6M C;  4MNN A;  2XBI A;  2G2Q A;  5ECK B;  3VI7 A;  2DC5 A;  1TK5 B;  1GSY A;  4HUA A;  4XRA A;  5G5E A;  2B1K A;  2H01 A;  5IMV A;  4ZXG A;  2EFE A;  1BYE A;  3CSJ A;  1NM3 A;  3F6D A;  2XPD A;  3VWU A;  2RII A;  9GSS A;  3P90 A;  1YEP A;  2IIY A;  1TKD B;  4G10 A;  3R3E A;  2N5A A;  3L78 A;  5C04 A;  3TU3 B;  2QGV A;  1GH2 A;  3KCM A;  3GRX A;  4XS4 A;  1PA3 A;  2YN1 A;  1QQ2 A;  1A0R P;  1ST9 A;  3MAK A;  3F4R A;  3BBY A;  5HR0 A;  2HZE B;  2JSZ A;  1GSD A;  2OKA A;  4LLR A;  3A2X A;  2VO4 A;  1F2E A;  1WIK A;  4IHU A;  1TK8 B;  2R0G A;  3FMW A;  2FWG A;  2GT6 A;  2H76 A;  3ZZX A;  2AYT A;  2VL2 C;  2H8L A;  4E8H A;  11GS A;  2PVQ A;  3HKR A;  5F0G A;  1K3L A;  4YH2 A;  2IMF A;  1TRV A;  2YCD A;  2HRF A;  2WUL A;  1PMT A;  2N5B A;  4OCF A;  1EP8 A;  1ACV A;  4DVC A;  5B8B A;  2PU9 C;  3VK9 A;  2I81 A;  5KN0 A;  3ERW A;  13GS A;  3M0F A;  5ECO B;  3HZ8 A;  3KH7 A;  1V40 A;  2HRA A;  2HRK B;  2D2Z A;  2AB6 A;  2WZ9 A;  4RUV A;  2HE3 A;  3DML A;  5F06 A;  4X0X A;  3DVW A;  4K6X A;  5DJL A;  4TXV A;  1T4Z A;  5DQY A;  4TOP A;  1AAZ A;  4EL1 A;  4JBB A;  3RPN A;  2C3N A;  1N25 A;  3TCO A;  1Y1U A;  2L4Q A;  2E2G A;  1YZX A;  2GTU A;  2UV8 G;  4YQV A;  4V1A g;  2GDR A;  2RLI A;  4F82 A;  2L6D A;  2PER A;  3UBL A;  2LQQ A;  3WGE A;  3IC4 A;  3QDN A;  1ILO A;  2WB9 A;  5A1N A;  3CXG A;  4ZL7 A;  4DSQ A;  1F3B A;  4QL9 A;  2LRT A;  2C3T A;  2M46 A;  2YPM A;  1O8W A;  4O5U A;  3IHG A;  2V32 A;  1JZD A;  3EVI A;  2C8U A;  3H8Q A;  1FOH A;  5D93 A;  2LEG A;  5CNW A;  2C4J A;  3HA9 A;  4Q5F A;  3CBU A;  4KDX A;  1FAA A;  3LFL A;  18GS A;  3FYG A;  3CSI A;  4IP1 A;  3HMJ G;  2HSM B;  4ZIL A;  1SKS B;  2MBS A;  2H70 A;  1OYJ A;  3UJ1 A;  1DSB A;  4TR0 A;  2DJ3 A;  4MJB A;  4GTU A;  3GUS A;  4EKZ A;  1SL2 B;  1ZGN A;  2EFH A;  2WVX A;  1N8J A;  4KB3 A;  5CYY A;  4MCU A;  2K18 A;  5L71 A;  3KXO A;  3DXB A;  3DD3 A;  4IS0 A;  4WBJ A;  5J4V A;  4K7N A;  4NXI A;  3D22 A;  3WGX A;  1KTE A;  3DVX A;  2C0D A;  4G2E A;  1SK0 A;  5A4W A;  2BTO T;  3GX8 A;  1DBY A;  2O5V A;  2WW0 A;  1CQG A;  1TI1 A;  4BVX B;  2P31 A;  2ZUP A;  1GLP A;  1G6Y A;  3KP9 A;  4POL A;  1GUM A;  4NWY A;  3BOA A;  4K0G A;  1NHY A;  5A5H A;  2IFQ A;  1TJD A;  2DJ2 A;  4XIH A;  3FRC A;  4AJ6 A;  3QAW A;  1AW9 A;  1YF1 A;  3L4N A;  1UA5 A;  1XG8 A;  2H66 A;  4KH7 A;  4GDF A;  2GQK A;  4TVE A;  4IJ3 A;  1WOU A;  6GSX A;  4HS1 A;  1XIY A;  1T00 A;  2BJX A;  1YVL A;  3TKS A;  2YV9 A;  2V41 A;  1OE7 A;  1PKW A;  2CX3 A;  4J57 E;  1GLQ A;  4MF7 A;  1Q98 A;  1DE2 A;  4WF5 A;  3O3T A;  2QC7 A;  4I2T A;  3TKR A;  1O8X A;  4TR3 A;  2DJK A;  4LMW A;  3UVH A;  14GS A;  4KGI A;  3F63 A;  4ECB A;  3C71 A;  1XVQ A;  3RHC A;  4TXO B;  5JWQ B;  3ZML A;  2LRC A;  2H74 A;  22GS A;  1VRS D;  2JL4 A;  3NZN A;  1YKA A;  5DAL B;  3VI5 A;  5CRD A;  2OT3 A;  4HJM A;  1RQM A;  4I97 A;  3TJB A;  3CSH A;  3J7Y b;  2VKZ G;  3CRT A;  2CX4 A;  2VCV A;  1M99 A;  3ZTL A;  1XBS A;  2VOC A;  3FHK A;  4V2L A;  4MPG A;  2FHE A;  4IKH A;  3ZVJ D;  4KDU A;  2XHF A;  3FY7 A;  2RUF A;  3QFB C;  5BRT A;  3M8N A;  2GVP A;  1JFU A;  2B7K A;  4GSS A;  3BCI A;  5HR3 A;  3DWV A;  3DYR A;  3EC3 A;  3BD2 A;  5BMU B;  3CYN A;  4KCE A;  5IPG A;  2JZR A;  1GTU A;  5GSS A;  2C0E A;  1E6B A;  2R37 A;  4V2N A;  1KNG A;  5IO2 A;  5DCH A;  1TU7 A;  3ZL5 A;  1VF4 A;  4FXY P;  3GTU A;  5A4V A;  5JWO B;  6GSS A;  4O5Q A;  1PKZ A;  3SWL A;  1X9W B;  1EGR A;  4XRD A;  3JCM L;  4EVM A;  4CW9 A;  1B48 A;  4EXJ A;  17GS A;  3P2A A;  1HQO A;  1URM A;  4K7O A;  5EPF A;  2GST A;  5GST A;  3KTL A;  3HVX A;  3GL5 A;  4XCS A;  2PPT A;  4PUR A;  4N0Z A;  4JR4 A;  2B1L A;  4CDO A;  2OAD A;  1PN0 A;  1EOG A;  5JCG A;  3G7J A;  2LJR A;  3IC8 A;  5A5H B;  2A4V A;  4TR1 A;  1XOA A;  3VFI A;  1PFO A;  2WFC A;  5G30 A;  2WDU A;  2R0C A;  2X8G A;  3CRU A;  3MIX A;  2YJH A;  1TW9 A;  4ZB6 A;  3ZLP A;  4LA1 A;  1OAZ A;  4O5R A;  2WVY A;  4FO5 A;  2LST A;  2V6O A;  4MZC A;  1XWB A;  3WT2 A;  1S3R A;  4FYB A;  5COH A;  2EC4 A;  1X0R A;  4IBP A;  4F0C A;  1PN9 A;  1EP7 A;  2CAQ A;  3GFK A;  5CAX A;  4ILF A;  1T8E B;  2LTK A;  2X8H A;  3IK9 A;  4K1F A;  3GV1 A;  2GSR A;  1R5A A;  2HSY A;  2VL2 A;  1EV4 A;  3UEM A;  1TTZ A;  4HJ2 A;  1FB6 A;  2YAN A;  6GSW A;  2GS3 A;  2DKI A;  5ENU A;  4OWY A;  2H75 A;  1NSW A;  2PMT A;  3IA1 A;  4MP4 A;  3ISO A;  3WT1 A;  3V1W A;  1M9B A;  1GTA A;  2B5X A;  4LMV A;  1JLV A;  5IMF A;  4F03 A;  2VM2 A;  3HJO A;  4AJ7 A;  2ON5 A;  1PQN A;  3TRQ A;  4WR5 A;  4MMM A;  1K0M A;  3GHA A;  5IOW A;  2REM A;  4KE3 A;  3LGC A;  2ON7 A;  4PX1 A;  1SJ6 A;  5IM9 A;  4FYU A;  3TJJ A;  4AI6 A;  2KLX A;  2LKU A;  5IIZ A;  4IEL A;  4HOJ A;  3K8N A;  2H30 A;  10GS A;  4FYC A;  1B9X C;  1QUW A;  3QR6 A;  3I69 A;  2YWI A;  2O7K A;  5ECQ B;  5E59 A;  4PI2 C;  1QFN A;  3LOR A;  1N2A A;  4V2M A;  1X5C A;  4KX4 A;  4JR6 A;  3TOT A;  4LL4 B;  1MEK A;  2LV3 A;  4IP6 A; 
#chains in the Genus database with same CATH homology
 1K3O A;  1EZK A;  3O76 A;  3F0I A;  4HZ4 A;  5J4U A;  3TKP A;  3RDW A;  3EUR A;  2X49 A;  3HDC A;  2VCW A;  4OFN A;  3D4M A;  5IOX A;  4J2F A;  4GQC A;  4LL1 B;  5D73 A;  2R2J A;  1YY7 A;  3EU3 A;  1OKD A;  3FEU A;  3G7I A;  1M2D A;  2AUV A;  2MMN A;  1BJX A;  5IMA A;  5FT3 A;  2P0G A;  3LYP A;  4PNG A;  4J56 E;  1Y6E A;  4L0U A;  5ECR B;  3W6G A;  4JZQ A;  2P5Q A;  4G9H A;  3GH6 A;  2HLS A;  3Q18 A;  2CVK A;  5J3R A;  2MMA A;  2HRN A;  4BL7 B;  2XC2 A;  3ZFL A;  5KN2 A;  4DSR A;  1ML6 A;  4EDZ A;  1GSF A;  2VLV A;  5LD0 A;  1OC3 A;  4WF4 A;  4DSS B;  4FIW A;  4ML6 A;  1V2A A;  3EU4 A;  12GS A;  3Q19 A;  1JZO A;  1OC9 A;  4AJ8 A;  7GSS A;  1YKC A;  2DIZ A;  3SBC A;  2FUG 2;  2A4H A;  1QXH A;  1XWC A;  3RAZ A;  4EDY A;  4RQX A;  5D9X A;  5D96 A;  1WRY A;  2CZ3 A;  4MF6 A;  2J23 A;  3N9J A;  3EYT A;  3EMX A;  1K0D A;  2IJY A;  3TRX A;  1Z7P A;  1NHO A;  3U5R E;  1GRX A;  5D9V A;  1NW2 A;  1HNC A;  1SD8 A;  1PX6 A;  2X64 A;  1G7E A;  5GAP D;  3J7Y k;  2H73 A;  5EY6 A;  4YQM A;  3F8U A;  2EIR A;  3TGZ A;  5HR1 A;  4G0K A;  1T7P B;  2X4A A;  4POB A;  4HZ2 A;  4F9Z A;  1I9D A;  1XW9 A;  1OC8 A;  1GSU A;  3UAR A;  3I6A A;  2L5O A;  2VAF A;  2K8S A;  4POM A;  6GSV A;  3GA4 A;  1A2J A;  4GLT A;  3UVT A;  3D4T A;  1YQ1 A;  3KJY A;  3DEX A;  1G0T A;  5INY A;  1U3I A;  4FQU A;  1WE0 A;  4IGJ A;  3GIX A;  1SK1 A;  4XS1 A;  3UAP A;  1MD4 A;  5ECI B;  2DJ1 A;  1EEJ A;  2MYG A;  2WGR A;  3LYK A;  1GP1 A;  1DE1 A;  1FO5 A;  2H0G A;  1J0F A;  3PH9 A;  1V57 A;  4XS4 B;  2NDO A;  2EIO A;  1ZOF A;  2OBI A;  3F9U A;  2H1A A;  2DML A;  2CAI A;  3VPT A;  4E68 A;  5IMC A;  4G19 A;  3DRN A;  5KN3 A;  1BX9 A;  3S9F A;  2IL3 A;  2YNX A;  3NIV A;  19GS A;  3IDV A;  3EMP A;  4EUY A;  4PUA A;  1V9W A;  1KEB A;  4WBR D;  3PPU A;  4ECC A;  2VCT A;  2L6C A;  2L4C A;  2ZCT A;  5LCZ A;  1TOF A;  2JSY A;  1V58 A;  4ZB7 A;  1XW5 A;  4E8E A;  4TR4 A;  1LBK A;  2DJJ A;  5A4U A;  1LU4 A;  4H86 A;  5D8I A;  1PX7 A;  4IQ1 A;  3TDG A;  2YP6 A;  3IRA A;  3CTG A;  2YZU A;  4MF5 A;  4AKG A;  1VF1 A;  2R3X A;  2B3S A;  4MLY A;  5ECN B;  5J4Y A;  1ON4 A;  2XPE A;  1QGV A;  3F3Q A;  5AIV A;  1RW1 A;  1FW1 A;  2F8A A;  5DBQ A;  1K0N A;  4ZB8 A;  4I8B A;  1ERU A;  3GKK A;  1JZW A;  3ZYW A;  3F3R A;  3D6I A;  4KCA A;  1TXU A;  4EIQ A;  2HSN A;  1XOB A;  2AV4 A;  1VGL A;  2CT6 A;  3A2W A;  5DAK A;  1T4Y A;  1FVK A;  1EWX A;  1V98 A;  4K2X A;  2IMK A;  5A1N B;  3ZRD A;  3IOS A;  2F3M A;  1TXX A;  1ZYN A;  4PQ1 A;  4XTS A;  3C1R A;  4PTS A;  5ID2 A;  4K9Z A;  3FZ4 A;  5G1K A;  2KP2 A;  2M80 A;  4MDC A;  4HQS A;  3KEB A;  2YJ7 A;  1EV9 A;  3RPP A;  2GZY A;  4RI7 A;  1ERV A;  1WPI A;  4ZL9 A;  4ZBB A;  3HZ4 A;  2F51 A;  3HVS A;  1Z7R A;  4O92 A;  3DKS A;  4EF0 A;  4MK3 A;  5CRW A;  5LNK e;  3KP8 A;  1FHE A;  3TKQ A;  1A0F A;  4Z7X A;  4YQU A;  1X5D A;  2I3Y A;  2HQT A;  1T1V A;  3GN3 A;  4YAV A;  1HNA A;  1Z3E A;  1M0U A;  1PD2 1;  2MMZ A;  5IO0 A;  1M9A A;  4TW5 A;  3F4S A;  1GSQ A;  4CY6 A;  3GL3 A;  1AIU A;  1F37 A;  3IHQ A;  2K9F A;  3LJR A;  4KND A;  4HU9 A;  5AGY A;  3ZFB A;  3TJF A;  1YDK A;  3QPM A;  2KUC A;  3EPT A;  5F07 A;  1TK0 B;  3AY8 A;  3I43 A;  1PL1 A;  2C0G A;  4N10 A;  2ZNM A;  1SVL A;  4KSO A;  3QFA C;  3KH9 A;  2FA8 A;  5JCW A;  1K0B A;  3ZRE A;  1ZYQ B;  1ERW A;  1R5P A;  1GUL A;  2QA1 A;  2DSA A;  4MH2 A;  4L8E A;  2OE1 A;  3PIN A;  1XXU A;  4YKG A;  2UZ8 A;  3GUR A;  1B4P A;  3DGQ A;  3G7Y A;  1EGO A;  4HEA 2;  1FOV A;  2LJA A;  4Q5Q A;  3MNG A;  4Q5N A;  3HJM A;  4I5Q A;  3KD0 A;  4A5P A;  5B7C A;  4FH8 A;  2KOK A;  3GKX A;  4F0B A;  2VIM A;  2JAD A;  2IFQ B;  3RBT A;  1FG4 A;  2FA4 A;  3GST A;  3VPQ A;  4X1U A;  4X4J A;  4O7H A;  1K0O A;  1MDI A;  2I9H A;  3LEF A;  5ABR A;  5IMZ A;  3BCK A;  5ECH B;  1KBN A;  5IPH A;  1WJK A;  2B7J A;  3C1S A;  2HSN B;  5CP1 A;  3VUR A;  1H75 A;  3G9B A;  1ERT A;  3NOF A;  3GYK A;  1TU8 A;  4D73 A;  3EIN A;  1GL8 A;  2VCX A;  1QK8 A;  3W8S A;  4AKI A;  1AC1 A;  2QA2 A;  4IN0 A;  4L5L A;  4BA7 A;  1BAY A;  4AGS A;  2CZ2 A;  4IW9 A;  5ID2 B;  2WCI A;  3QMX A;  2HFD A;  4G0L A;  3H79 A;  1X9S B;  3HHV A;  4MPF A;  2FWF A;  4GQF A;  3EWL A;  2E7P A;  4P3Y B;  4ECI A;  5HFI A;  4EO3 A;  4ZIJ A;  1GTB A;  1XWG A;  2WRT A;  4EIP A;  3I9V 2;  3LW9 A;  4MJC A;  4GRF A;  4QL7 A;  1SL0 B;  1JZR A;  5ECS A;  2IMD A;  1UC7 A;  3CTF A;  3IV4 A;  3HY2 A;  3ZIJ A;  1XWA A;  2PN8 A;  2RUE A;  4ULX A;  2IN3 A;  5HFK A;  5ECP B;  1DUG A;  2YOI A;  2VL3 A;  5J9C A;  1AXD A;  1SVM A;  3M1G A;  5G31 A;  3A2V A;  4WEY A;  2HZE A;  2LJK A;  2H1G A;  3WYW A;  3FK8 A;  3L9S A;  3APS A;  2VM1 A;  4ACS A;  2JZS A;  2G0F A;  5H5Q A;  2HYX A;  4PXO A;  3GTU B;  5G1L A;  3LWA A;  3GH9 A;  4USS A;  1FVJ A;  1SYR A;  1B8X A;  3IAS 2;  4POK A;  5G5F A;  2DIY A;  3C73 A;  4N3Z A;  1PRX A;  2AJQ B;  4ML1 A;  2I4A A;  4N11 A;  1Z6N A;  1R7H A;  4K2D A;  4JE1 A;  2LUS A;  5HQP A;  6GSY A;  4BWS A;  3BJ5 A;  1MDK A;  2O8V B;  3OR5 A;  4JRR A;  2L57 A;  2H72 A;  2V6K A;  2C0F A;  4TR1 B;  1PGT A;  1Z6M A;  4CHS A;  2TRX A;  3VWW A;  3KMO A;  3IK7 A;  1BF5 A;  3KGK A;  4GST A;  1SVO A;  5B6M A;  3VWX A;  2FD3 A;  2QSI A;  3QOU A;  2VLU A;  3ME8 A;  4OO4 A;  4MA9 A;  3GX0 A;  3H93 A;  2CA8 A;  3QAG A;  3IPZ A;  5HFG A;  2B5E A;  3A5I A;  2A2S A;  1SYX A;  4YKF A;  3VLN A;  3HD5 A;  5J5N A;  4HU7 A;  8GSS A;  2YWN A;  2EFD A;  5J41 A;  3QAV A;  4AKH A;  1ZMA A;  2FNO A;  2GQM A;  4GXZ A;  1K0A A;  3L9V A;  4KA0 A;  4PQI A;  1O73 A;  3ED3 A;  2VL9 A;  4DEJ A;  3UBK A;  3R2Q A;  5DJM A;  2K8V A;  1O85 A;  3KMN A;  4ECJ A;  1ZZY A;  1Q4J A;  2K6V A;  2IME A;  3PGT A;  2I1U A;  1BG5 A;  2R4V A;  2YZH A;  5CRG A;  2A2R A;  1GUK A;  3UOM A;  2HT9 A;  2HSM A;  3TOU A;  2LQO A;  2PBJ A;  3ZIT A;  2EFC A;  3M3M A;  1BQ7 A;  1MD3 A;  4EC0 A;  4BWQ A;  1SL1 B;  1BG1 A;  2H6X A;  4RQR A;  2YV7 A;  1YEX A;  1GSS A;  2IWT A;  1ABA A;  2LNT A;  5H5R A;  5IQY A;  3FW2 A;  5C00 A;  1SJZ A;  2H19 A;  1TP9 A;  5AIX A;  5KN1 A;  2PVO C;  3IR4 A;  1W89 A;  1HNB A;  4RI6 A;  5J47 A;  5IMD A;  4L5O A;  1R26 A;  2FWH A;  2C80 A;  4KAE A;  2TRC P;  4Z2T A;  3C8E A;  3TJK A;  1MTC A;  4BVX A;  3LSZ A;  3L0H A;  1SD9 A;  2MZC A;  1GNE A;  2KHP A;  4N0V A;  2LNS A;  5H5S A;  3IAM 2;  3FZ9 A;  4N30 A;  2NBS A;  5GAN D;  4NV2 A;  1S3C A;  5CRE A;  4I6X A;  5DDL A;  1U87 A;  4PGT A;  3FKF A;  3FZ5 A;  4NPB A;  4GCI A;  4G01 A;  2B5Y A;  2GZZ A;  3FZA A;  3EE2 A;  5KOX A;  4HDE A;  1U6T A;  2H1D A;  2A2P A;  2O89 A;  3TKS E;  3FR9 A;  4F2I A;  1UVZ A;  3UL3 A;  3O6T A;  2ES7 A;  4TXO A;  1IYI A;  2MMO A;  2BMX A;  2P5R A;  1TRU A;  1QMV A;  4XHM A;  4AKX B;  2LS5 A;  2PGT A;  5DAL A;  4NHW A;  3APQ A;  1CQH A;  1VF2 A;  5FHI A;  3P8W A;  1EOH A;  4MH3 A;  2N5F A;  1OC9 B;  3TB2 A;  2QKE A;  1U88 A;  2X8C A;  3HYP A;  1MDJ A;  1Z5Y E;  3M9K A;  4NMU A;  2JAC A;  3QD9 A;  2H0H A;  4CY8 A;  4OFM A;  4EE0 A;  4QQ7 A;  2H6Y A;  5G2Z A;  1JLW A;  2E2M A;  3ME7 A;  4MZW A;  5BMU A;  1JHB A;  1T3B A;  6GST A;  3D5J A;  3MYD A;  2OBK A;  1SK2 A;  3ZIV A;  5DQS A;  1WWJ A;  3KZQ A;  5AN1 A;  3DIE A;  4OMV A;  2H1B A;  16GS A;  2HSH A;  1OVN A;  3VWV A;  1SEN A;  5DCG A;  2O87 A;  1THX A;  2B6M A;  1SKW B;  1LJR A;  3MWH A;  2R0P A;  3D21 A;  1B9Y C;  4BVY A;  1HD2 A;  1BED A;  2CVB A;  3ERF A;  2YWO A;  4PUF C;  4ICY A;  2AHE A;  1G7O A;  1WMJ A;  3Q6O A;  2JZT A;  3E9J B;  4WKW A;  5CRH A;  3HJP A;  1ZL9 A;  3FR3 A;  3F6F A;  1RK4 A;  4IQA A;  2MBT A;  4NV5 A;  4QMK A;  2GQL A;  4GF0 A;  1ZYE A;  4OO5 A;  5KOW A;  2DKH A;  4NAX A;  5A5K A;  1AQX A;  3A5W A;  1J9B A;  2KP1 A;  5F8B A;  3M9J A;  3L9U A;  3WGD A;  2RM5 A;  2H6Z A;  2WJU A;  2HXK A;  5AIS A;  4KW6 A;  3IXR A;  4GWR A;  3H1N A;  1VF3 A;  1XZO A;  4BPY A;  2AAW A;  3CWG A;  4HI7 A;  4KSM A;  1XW6 A;  2FWE A;  3UIW A;  2DLX A;  4ID0 A;  2IMI A;  4TKY A;  5JWR B;  1X9M B;  3GKN A;  5EVO A;  5F05 A;  1K3Y A;  1FB0 A;  3KM6 A;  2FCH A;  3IE3 A;  2VUP A;  1S3D A;  3RHB A;  1SKR B;  1GUH A;  3IBH A;  1TRS A;  3C7M A;  4K8M A;  1XWK A;  4PQH A;  3D0Z A;  5A34 A;  1R4W A;  1XVW A;  4ZBA A;  3GSS A;  4NHZ A;  1A2M A;  5JCU A;  1GWC A;  4MJA A;  2CVD A;  4YAP A;  2HZF A;  2OE3 A;  2EIQ A;  5KEJ A;  3GNJ A;  3HXS A;  2R5G A;  2V2G A;  1XPV A;  1M7T A;  2TIR A;  1OE8 A;  5ELG A;  2XBQ A;  5D9T A;  1IYH A;  1F9M A;  4OD7 A;  2VD1 A;  1G6W A;  4V1A p;  2F8F A;  4AF2 A;  1C72 A;  2LRN A;  4GSN A;  2OA7 A;  4L0W A;  2E0Q A;  1EEM A;  2GSQ A;  1SJI A;  1A24 A;  1YF0 A;  1K0C A;  4WR4 A;  1USB A;  1B4Q A;  3HCZ A;  2VD0 A;  2H0I A;  1UN2 A;  2OE0 A;  3LG6 A;  2NPB A;  3ZVJ A;  2V1M A;  4K0N A;  4BVY B;  1A2L A;  2L59 A;  1GNW A;  5ECL B;  2RM6 A;  6GSU A;  4K5S A;  3KIJ A;  4Z2R A;  1A23 A;  1OKT A;  1A8Y A;  3Q74 A;  4K5R A;  4MJE A;  2VCQ A;  1AUC A;  3GMF A;  2CV4 A;  1O81 A;  1ZCP A;  4MAB A;  1X5E A;  3ERG A;  5ELA A;  1M2A A;  1PSQ A;  5GZZ B;  4JU5 A;  5DAK B;  4KDY A;  3HVV A;  4JED A;  2HI7 A;  5DVB A;  2ALB A;  2X99 A;  5J9B A;  3LXZ A;  2O85 A;  1HYU A;  1XCC A;  2C3Q A;  1TDI A;  2HNL A;  3U6V A;  1O7U A;  2VLT A;  3E3E A;  2VCZ A;  2FGX A;  3US3 A;  3QCP A;  2Z9S A;  1O6J A;  5CO3 A;  4XS6 A;  4IVF A;  4HQZ A;  5FWG A;  2C1Y A;  3MDK A;  4I2U A;  2IPA A;  1M2B A;  2H1L A;  1THO A;  3PR8 A;  4OCE A;  5ECM B;  4G0I A;  2NTO A;  3P7X A;  4TN8 A;  3TKS C;  1AQW A;  2GT5 A;  3UMA A;  4BL7 A;  3CMI A;  3TJG A;  1U3A A;  1F3A A;  2F9S A;  4K7I A;  2R6K A;  1A8L A;  1E2Y A;  5A34 B;  2L5L A;  2WS2 A;  2M72 A;  2DMM A;  4KF9 A;  2JU5 A;  4DSS A;  3FR6 A;  1Z9H A;  3LQ7 A;  3GKM A;  4Z2U A;  3TRP A;  4WET A;  2GSS A;  2PUK C;  2CQ9 A;  4IJI A;  2GLR A;  4X43 A;  1Y25 A;  2PWJ A;  1TI3 A;  1S3A A;  4KUN A;  3H4K A;  5B6N A;  2FY6 A;  3F4T A;  4Q5R A;  2J9H A;  2GGT A;  3W8J A;  4MZB A;  2H71 A;  3APO A;  1PL2 A;  4OFT A;  2NVL A;  1GTI A;  4O32 A;  3A3T A;  1ZYP A;  1AQV A;  4PNF A;  1W4V A;  1GSE A;  3WD6 A;  5J40 A;  2OAC A;  4ZL8 A;  2HRK A;  3ZMK A;  5D9W A;  2DJ0 A;  3E0U A;  3N5O A;  3MSZ A;  3TUE A;  5HR2 A;  1H4O A;  4WXT A;  1WP0 A;  1YJ6 A;  3LXT A;  5EL8 A;  2DBC A;  3KTB A;  20GS A;  2YWM A;  1I5G A;  2FLS A;  2OJL A;  4D73 B;  4ISD A;  1TRW A;  1XFL A;  1SU9 A;  2GZP A;  5E4W A;  4ZB9 A;  5B8A A;  1J08 A;  4TRX A;  4W66 A;  4ZBD A;  1F6M C;  4MNN A;  2XBI A;  2G2Q A;  5ECK B;  3VI7 A;  2DC5 A;  1TK5 B;  1GSY A;  4HUA A;  4XRA A;  5G5E A;  2B1K A;  2H01 A;  5IMV A;  4ZXG A;  2EFE A;  1BYE A;  3CSJ A;  1NM3 A;  3F6D A;  2XPD A;  3VWU A;  2RII A;  9GSS A;  3P90 A;  1YEP A;  2IIY A;  1TKD B;  4G10 A;  3R3E A;  2N5A A;  3L78 A;  5C04 A;  3TU3 B;  2QGV A;  1GH2 A;  3KCM A;  3GRX A;  4XS4 A;  1PA3 A;  2YN1 A;  1QQ2 A;  1A0R P;  1ST9 A;  3MAK A;  3F4R A;  3BBY A;  5HR0 A;  2HZE B;  2JSZ A;  1GSD A;  2OKA A;  4LLR A;  3A2X A;  2VO4 A;  1F2E A;  1WIK A;  4IHU A;  1TK8 B;  2R0G A;  3FMW A;  2FWG A;  2GT6 A;  2H76 A;  3ZZX A;  2AYT A;  2VL2 C;  2H8L A;  4E8H A;  11GS A;  2PVQ A;  3HKR A;  5F0G A;  1K3L A;  4YH2 A;  2IMF A;  1TRV A;  2YCD A;  2HRF A;  2WUL A;  1PMT A;  2N5B A;  4OCF A;  1EP8 A;  1ACV A;  4DVC A;  5B8B A;  2PU9 C;  3VK9 A;  2I81 A;  5KN0 A;  3ERW A;  13GS A;  3M0F A;  5ECO B;  3HZ8 A;  3KH7 A;  1V40 A;  2HRA A;  2HRK B;  2D2Z A;  2AB6 A;  2WZ9 A;  4RUV A;  2HE3 A;  3DML A;  5F06 A;  4X0X A;  3DVW A;  4K6X A;  5DJL A;  4TXV A;  1T4Z A;  5DQY A;  4TOP A;  1AAZ A;  4EL1 A;  4JBB A;  3RPN A;  2C3N A;  1N25 A;  3TCO A;  1Y1U A;  2L4Q A;  2E2G A;  1YZX A;  2GTU A;  2UV8 G;  4YQV A;  4V1A g;  2GDR A;  2RLI A;  4F82 A;  2L6D A;  2PER A;  3UBL A;  2LQQ A;  3WGE A;  3IC4 A;  3QDN A;  1ILO A;  2WB9 A;  5A1N A;  3CXG A;  4ZL7 A;  4DSQ A;  1F3B A;  4QL9 A;  2LRT A;  2C3T A;  2M46 A;  2YPM A;  1O8W A;  4O5U A;  3IHG A;  2V32 A;  1JZD A;  3EVI A;  2C8U A;  3H8Q A;  1FOH A;  5D93 A;  2LEG A;  5CNW A;  2C4J A;  3HA9 A;  4Q5F A;  3CBU A;  4KDX A;  1FAA A;  3LFL A;  18GS A;  3FYG A;  3CSI A;  4IP1 A;  3HMJ G;  2HSM B;  4ZIL A;  1SKS B;  2MBS A;  2H70 A;  1OYJ A;  3UJ1 A;  1DSB A;  4TR0 A;  2DJ3 A;  4MJB A;  4GTU A;  3GUS A;  4EKZ A;  1SL2 B;  1ZGN A;  2EFH A;  1N8J A;  4KB3 A;  5CYY A;  4MCU A;  2K18 A;  5L71 A;  3KXO A;  3DXB A;  3DD3 A;  4IS0 A;  4WBJ A;  5J4V A;  4K7N A;  4NXI A;  3D22 A;  3WGX A;  1KTE A;  3DVX A;  2C0D A;  4G2E A;  1SK0 A;  5A4W A;  2BTO T;  3GX8 A;  1DBY A;  2O5V A;  1CQG A;  1TI1 A;  4BVX B;  2P31 A;  2ZUP A;  1GLP A;  1G6Y A;  3KP9 A;  4POL A;  1GUM A;  4NWY A;  3BOA A;  4K0G A;  1NHY A;  5A5H A;  2IFQ A;  1TJD A;  2DJ2 A;  4XIH A;  3FRC A;  4AJ6 A;  3QAW A;  1AW9 A;  1YF1 A;  3L4N A;  1UA5 A;  2H66 A;  4KH7 A;  4GDF A;  2GQK A;  4TVE A;  4IJ3 A;  1WOU A;  6GSX A;  4HS1 A;  1XIY A;  1T00 A;  2BJX A;  1YVL A;  3TKS A;  2YV9 A;  2V41 A;  1OE7 A;  1PKW A;  2CX3 A;  4J57 E;  1GLQ A;  4MF7 A;  1Q98 A;  1DE2 A;  4WF5 A;  3O3T A;  2QC7 A;  4I2T A;  3TKR A;  1O8X A;  4TR3 A;  2DJK A;  4LMW A;  3UVH A;  14GS A;  4KGI A;  3F63 A;  4ECB A;  3C71 A;  1XVQ A;  3RHC A;  4TXO B;  5JWQ B;  3ZML A;  2LRC A;  2H74 A;  22GS A;  1VRS D;  2JL4 A;  3NZN A;  1YKA A;  5DAL B;  3VI5 A;  5CRD A;  2OT3 A;  4HJM A;  1RQM A;  4I97 A;  3TJB A;  3CSH A;  3J7Y b;  2VKZ G;  3CRT A;  2CX4 A;  2VCV A;  1M99 A;  3ZTL A;  1XBS A;  2VOC A;  3FHK A;  4V2L A;  4MPG A;  2FHE A;  4IKH A;  3ZVJ D;  4KDU A;  2XHF A;  3FY7 A;  2RUF A;  3QFB C;  5BRT A;  3M8N A;  2GVP A;  1JFU A;  2B7K A;  4GSS A;  3BCI A;  5HR3 A;  3DWV A;  3DYR A;  3EC3 A;  3BD2 A;  5BMU B;  3CYN A;  4KCE A;  5IPG A;  2JZR A;  1GTU A;  5GSS A;  2C0E A;  1E6B A;  2R37 A;  4V2N A;  1KNG A;  5IO2 A;  5DCH A;  1TU7 A;  3ZL5 A;  1VF4 A;  3GTU A;  5A4V A;  5JWO B;  6GSS A;  4O5Q A;  1PKZ A;  3SWL A;  1X9W B;  1EGR A;  4XRD A;  3JCM L;  4EVM A;  4CW9 A;  1B48 A;  4EXJ A;  17GS A;  3P2A A;  1HQO A;  1URM A;  4K7O A;  5EPF A;  2GST A;  5GST A;  3KTL A;  3HVX A;  3GL5 A;  4XCS A;  2PPT A;  4PUR A;  4N0Z A;  4JR4 A;  2B1L A;  4CDO A;  2OAD A;  1PN0 A;  1EOG A;  5JCG A;  3G7J A;  2LJR A;  3IC8 A;  5A5H B;  2A4V A;  4TR1 A;  1XOA A;  3VFI A;  2WFC A;  5G30 A;  2WDU A;  2R0C A;  2X8G A;  3CRU A;  3MIX A;  2YJH A;  1TW9 A;  4ZB6 A;  3ZLP A;  4LA1 A;  1OAZ A;  4O5R A;  4FO5 A;  2LST A;  2V6O A;  4MZC A;  1XWB A;  3WT2 A;  4FYB A;  5COH A;  2EC4 A;  1X0R A;  4IBP A;  4F0C A;  1PN9 A;  1EP7 A;  2CAQ A;  3GFK A;  5CAX A;  4ILF A;  1T8E B;  2LTK A;  2X8H A;  3IK9 A;  4K1F A;  3GV1 A;  2GSR A;  1R5A A;  2HSY A;  2VL2 A;  1EV4 A;  3UEM A;  1TTZ A;  4HJ2 A;  1FB6 A;  2YAN A;  6GSW A;  2GS3 A;  2DKI A;  5ENU A;  4OWY A;  2H75 A;  1NSW A;  2PMT A;  3IA1 A;  4MP4 A;  3ISO A;  3WT1 A;  3V1W A;  1M9B A;  1GTA A;  2B5X A;  4LMV A;  1JLV A;  5IMF A;  4F03 A;  2VM2 A;  3HJO A;  4AJ7 A;  2ON5 A;  1PQN A;  3TRQ A;  4WR5 A;  4MMM A;  1K0M A;  3GHA A;  5IOW A;  2REM A;  4KE3 A;  3LGC A;  2ON7 A;  4PX1 A;  1SJ6 A;  5IM9 A;  4FYU A;  3TJJ A;  4AI6 A;  2KLX A;  2LKU A;  5IIZ A;  4IEL A;  4HOJ A;  3K8N A;  2H30 A;  10GS A;  4FYC A;  1B9X C;  1QUW A;  3QR6 A;  3I69 A;  2YWI A;  2O7K A;  5ECQ B;  5E59 A;  1QFN A;  3LOR A;  1N2A A;  4V2M A;  1X5C A;  4KX4 A;  4JR6 A;  3TOT A;  4LL4 B;  1MEK A;  2LV3 A;  4IP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...