2ON7A

Structure of nagst-1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
206
Chain Sequence
b'MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na Glutathione S-transferase 1
publication title X-ray structures of Na-GST-1 and Na-GST-2 two glutathione s-transferase from the human hookworm Necator americanus
pubmed doi rcsb
source organism Necator americanus
molecule tags Transferase
total genus 77
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2on7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2on7A01
1TI1A 4HZ4A 2HZEB 4D73A 1TK5B 3H1NA 2NDOA 3C71A 5J9BA 1G6WA 2C3TA 4GCIA 2DJ1A 2VAFA 3HD5A 4JE1A 3TKQA 1G7OA 4IS0A 3HXSA 2X8GA 5F0GA 1TK8B 2VCXA 1T7PB 1RW1A 4WBRD 4I8BA 4O7HA 17GSA 2H70A 5HFIA 5ENUA 2MMAA 3TKRA 3U5RE 1RK4A 3ZREA 1QQ2A 2H8LA 2CZ3A 3QFAC 2V41A 2L4CA 1MDJA 2V6KA 3I69A 5A5KA 3GURA 3MNGA 3A5WA 3C1SA 4KE3A 1TP9A 5ID2A 1DE2A 3O76A 4PQ1A 2J23A 3TOUA 2YN1A 1MDIA 1JZOA 3ISOA 3Q18A 1M99A 2H1DA 2LNSA 4MMMA 4MZBA 1G7EA 3GKKA 2GZPA 3HCZA 1MTCA 5DAKB 5G1LA 4J56E 2F9SA 4BA7A 5EPFA 3ZFLA 1XWGA 5FWGA 2VO4A 4PTSA 5JCWA 2HSYA 2H73A 4BWQA 4I5QA 4KNDA 4IVFA 2KP1A 4YQMA 1ZCPA 2GT6A 2ALBA 1GNEA 2M46A 4L5OA 1SK1A 2QKEA 2GT5A 2PERA 2CAQA 5IMAA 4ILFA 1PMTA 3M3MA 4K7NA 4AF2A 12GSA 4TR4A 3HJMA 5J9CA 1Z5YE 2MYGA 4TVEA 2LJRA 1O81A 3N9JA 4BVYB 4AJ6A 3L4NA 3LFLA 4LMVA 1U3AA 1EP8A 1Z9HA 4XCSA 4KCEA 5LCZA 5ECHB 2PVQA 1DSBA 5DJMA 1SJ6A 5AGYA 3IBHA 1TXXA 4MF7A 2VLUA 4L8EA 4KX4A 4FO5A 2VCQA 2QGVA 2B1KA 4FYCA 4I2TA 4N30A 1DE1A 3KP8A 1XW9A 2B7KA 2GSQA 3QOUA 3DGQA 4F0BA 5A4VA 5DDLA 1GNWA 3QPMA 2MMOA 3WD6A 4KB3A 4D73B 4HS1A 2DSAA 2VD0A 2HT9A 2LRTA 1THOA 4MJCA 2HSHA 10GSA 1NM3A 2DMMA 3TJGA 1LBKA 1OC9A 4KGIA 4HI7A 2MMNA 4XRDA 2I4AA 2CQ9A 3GYKA 1GRXA 4POKA 3KCMA 5IPHA 1ML6A 4G10A 3WGEA 5D8IA 5IOWA 1XZOA 3LEFA 2L6DA 2AYTA 3PINA 5D9VA 1AQXA 1A0RP 1U3IA 3IK7A 2PPTA 19GSA 5JCGA 2OE1A 4XS4B 2C1YA 4MZCA 5GAND 3FKFA 2A2RA 3HHVA 2WULA 2YPMA 4KUNA 4HEA2 4LL1B 4K2DA 3IPZA 2B3SA 5ID2B 4EC0A 2L5OA 5HFKA 3DVXA 4FYBA 4ECIA 5AIXA 3IA1A 2KHPA 4TKYA 5IMFA 5AIVA 4ZBBA 2LRCA 1M9AA 1TRUA 4J57E 4K9ZA 2EC4A 2RUEA 5IMCA 3LXTA 3HVSA 2CVDA 2PUKC 4KAEA 5IO2A 3UL3A 1K0DA 1XOAA 3RPNA 1MEKA 2LKUA 5E4WA 5DJLA 3AY8A 4OFNA 5EY6A 2MMZA 1JZDA 1NHYA 4IHUA 1PRXA 2K8SA 3DD3A 1XWCA 3LYPA 3GA4A 2LJKA 1K3LA 5ECMB 1KTEA 1U6TA 3KMOA 4WF4A 1ZMAA 1T4ZA 1XW6A 3RAZA 3KEBA 1WJKA 3DXBA 3TRXA 1TOFA 4NV2A 1W4VA 2O87A 3L9SA 3DEXA 3GSTA 2PVOC 1BJXA 3FZ9A 4WKWA 5G30A 3US3A 4HQZA 1MDKA 2NBSA 3F63A 4MF5A 1TJDA 1Z3EA 1FAAA 3KH9A 1AQVA 2VCZA 4J2FA 2HFDA 4YQUA 3P2AA 5A4UA 3M8NA 2LQOA 3VK9A 1GP1A 3IR4A 2VLTA 2YP6A 2GVPA 2GTUA 1GTBA 3EINA 3D5JA 3TGZA 2EIQA 1A2LA 3SBCA 5IPGA 4RUVA 1ZYQB 1QMVA 2F3MA 3LGCA 1ERVA 1QK8A 3VI5A 3ERWA 2NTOA 5HFGA 1YY7A 2TRCP 2JSYA 3HZ8A 1PX7A 1OE8A 1OC9B 4BL7A 3IXRA 1TRSA 1PN9A 1YEXA 1NHOA 5HQPA 1NSWA 1F3BA 2FWGA 4Z7XA 5ECKB 2VL9A 3ZZXA 4IW9A 1JHBA 2HRNA 4I97A 2C80A 2RM5A 5ELGA 3KP9A 4JR4A 5LNKe 1FG4A 2O8VB 4PGTA 4MJEA 5ELAA 3CSIA 3F6FA 1K3OA 3KGKA 3HKRA 2R3XA 5ABRA 4MPGA 3ZL5A 1M7TA 2FGXA 4AGSA 3OR5A 2H74A 2LTKA 4GWRA 4BPYA 1V98A 4OO4A 3NIVA 2HSMA 6GSXA 5J5NA 2PBJA 2QC7A 2HRFA 2IPAA 5ECLB 1EWXA 3HY2A 2VLVA 4WR5A 1YJ6A 4KW6A 4TR0A 4RQRA 1LU4A 1UVZA 3G7JA 4ULXA 3TDGA 2IL3A 1X0RA 2M72A 3HJOA 4HU9A 4MCUA 5E59A 2IMEA 4NHWA 4F03A 4JZQA 1GLQA 2AUVA 3ZVJD 1X5EA 4KSOA 2IJYA 2VUPA 4N11A 3FK8A 2RM6A 4F2IA 2VL3A 3R2QA 4ML1A 3L9VA 2HRAA 2VM2A 2YWOA 2HSNB 4PQHA 2G2QA 1GSFA 2DJKA 1XBSA 5IMVA 4X0XA 5CAXA 1YF0A 5ECIB 1VRSD 3KD0A 3TRQA 4YAPA 2IMFA 2DBCA 4DSSA 3LWAA 4MH3A 5EL8A 1PKZA 2KOKA 1TRVA 2NPBA 4NPBA 2CVBA 4YQVA 1B8XA 3F4RA 3GH9A 4GSTA 4MABA 4FIWA 3F3QA 2YNXA 2XBIA 5FHIA 3D4TA 1PX6A 5AN1A 3DVWA 1SK0A 4MZWA 2YANA 4JU5A 2IIYA 4TR1A 9GSSA 11GSA 1A24A 3N5OA 1JZRA 3WYWA 1ACVA 4HZ2A 4ECCA 3IAS2 1SD8A 2IMIA 3PGTA 2HQTA 2LNTA 1GTIA 2DC5A 1PD21 4O92A 4QL7A 3WT2A 1FOVA 4PNFA 1ERTA 1GLPA 1A8YA 3O3TA 1A0FA 2MBSA 1FW1A 4Q5QA 3NOFA 4HU7A 3LYKA 2GQLA 1FB6A 3FZ5A 3APOA 1IYHA 2JZTA 2ZCTA 2ES7A 4XS4A 1O7UA 5L71A 2GSRA 1TK0B 3GIXA 4BL7B 5IO0A 1U88A 2TRXA 1XOBA 4GLTA 1WP0A 3UBLA 3IDVA 2OKAA 3CYNA 5D73A 4DEJA 1AUCA 4NV5A 1X9SB 4KA0A 2OJLA 4WXTA 1WMJA 2VCVA 1X5CA 5CREA 1XW5A 2LRNA 4IN0A 2GQMA 1Z6MA 4OCFA 5JWOB 3F6DA 2O89A 3ZIJA 2YV9A 3FR9A 3TB2A 3V1WA 3RBTA 4MK3A 3BCIA 5CRHA 1O6JA 4QQ7A 1ZL9A 4ID0A 2CX3A 1ABAA 1EEMA 2YOIA 2HSMB 2C4JA 3ED3A 3ZLPA 3HA9A 1SKWB 5A4WA 3I43A 4CHSA 4EDYA 2FY6A 3MDKA 3TJFA 1CQGA 4Q5RA 4GQCA 4F9ZA 2BTOT 1O85A 2XPDA 1TKDB 3FRCA 5H5SA 3ZFBA 4WETA 3ZYWA 2P5RA 2C0FA 1WWJA 1T8EB 1BX9A 5B8AA 4TRXA 3NZNA 5CRDA 3QAGA 18GSA 1Y25A 4N0ZA 3O6TA 1XXUA 5CRGA 5J3RA 2VL2C 4ECBA 2CA8A 3VURA 1FVJA 13GSA 4DSSB 3CTGA 3ERFA 1N8JA 4AJ7A 2CZ2A 2LJAA 1I5GA 2KLXA 4NMUA 4POBA 1Z6NA 2HXKA 2OACA 1PGTA 4OFTA 3EVIA 4EUYA 2UZ8A 3A2WA 4V2MA 2R5GA 2FA4A 4PUAA 1O73A 3KM6A 4MPFA 1F9MA 2O85A 2A2SA 3UIWA 5HR1A 5IMZA 2C8UA 3LG6A 3QMXA 4TR1B 1R4WA 3EU3A 2H1AA 2IMDA 3SWLA 3CBUA 3EURA 3W8JA 3M0FA 3TJKA 3MAKA 4IKHA 2L6CA 3TOTA 1I9DA 1GTAA 2C0EA 2MZCA 2L57A 1AQWA 5D9WA 5KN1A 4GF0A 2CV4A 3QFBC 2N5FA 2RIIA 3UVHA 4TOPA 2VD1A 5CNWA 1QFNA 1A2JA 2P5QA 1EV4A 3M9KA 1O8WA 3G7YA 3C73A 1JLVA 1T00A 3KIJA 2H0GA 4XIHA 1GL8A 3VPTA 1BAYA 2YJHA 4LL4B 1XPVA 3DWVA 1USBA 1K0NA 2FCHA 5COHA 2RLIA 3KTLA 4MH2A 4HOJA 2OE3A 3D0ZA 2JSZA 2WS2A 1J0FA 1J08A 1SL2B 1N2AA 4ZL9A 4X43A 3TUEA 3HDCA 2FLSA 2P0GA 2B5XA 2AV4A 5INYA 3M1GA 3HVVA 5ECNB 3GMFA 3GX8A 1BG5A 1M2BA 5J4UA 4IQ1A 3PH9A 2AJQB 2A4VA 3GFKA 4EDZA 3C7MA 1X9MB 2JZRA 2D2ZA 4XRAA 3L0HA 4IJIA 2YZHA 3ZITA 3CRUA 2DIYA 2EIRA 1CQHA 3GUSA 1SD9A 2I81A 16GSA 3KJYA 3HVXA 3A3TA 2JL4A 1JZWA 5J41A 3C1RA 3QDNA 2J9HA 3VWUA 2AAWA 3WGXA 2FWEA 1B48A 1AAZA 1OYJA 3CRTA 4EVMA 5D9TA 3TKSC 5ECRB 3J7Yb 2CVKA 5G5EA 4GTUA 2Z9SA 2N5AA 4G0LA 5BMUA 1UC7A 3GTUA 1HD2A 2CT6A 3QR6A 3GV1A 5LD0A 2F8FA 2E0QA 1E2YA 4L0UA 2WJUA 1VF1A 5IQYA 1Q4JA 2I1UA 2C0DA 1DUGA 3P90A 4ZB8A 2AB6A 3BJ5A 4K0GA 3CXGA 3DMLA 4RI7A 2JACA 2PWJA 1TU8A 3APQA 1GUHA 4MLYA 2YV7A 1OAZA 1PQNA 3GNJA 4N10A 2LSTA 3APSA 3ZVJA 4Q5FA 1B9XC 4ML6A 1SJZA 5JWQB 4GRFA 2FHEA 2FWFA 2DMLA 1FVKA 3F3RA 1GUMA 5IM9A 2JZSA 2L5LA 2DIZA 1AXDA 4WBJA 3FHKA 2K9FA 2LV3A 3IHQA 3W8SA 1F6MC 4LMWA 20GSA 2VL2A 3WGDA 3F8UA 4PX1A 2V2GA 5D96A 2KUCA 3FR6A 1UN2A 3UEMA 4TN8A 1YDKA 3GSSA 3GX0A 5CYYA 3PPUA 1R5AA 4KDUA 1THXA 2H30A 2H0HA 3DIEA 3ZMLA 1AW9A 1K0MA 5EVOA 4EF0A 3DRNA 1TW9A 2L59A 2V6OA 1V2AA 4EKZA 4POLA 2VIMA 3QCPA 3LXZA 4ZL7A 4PXOA 2V32A 3QAVA 1TU7A 4RI6A 1FHEA 4ZBDA 2LS5A 3UOMA 3GRXA 4MJBA 4ACSA 1SKSB 4USSA 6GSVA 4JBBA 5B6NA 2H0IA 4K6XA 2HRKA 2I3YA 3VWVA 22GSA 3H4KA 4E8HA 4PQIA 3F0IA 1EGRA 2LEGA 3I9V2 2E7PA 2XC2A 1B4PA 4HDEA 2B5YA 4MA9A 1PL2A 1PA3A 2H19A 2WDUA 2HE3A 2XHFA 3RHCA 1GSDA 2H1BA 5IOXA 3RPPA 4X1UA 1K0OA 4GSSA 3P8WA 4OD7A 1T1VA 1DBYA 1SL0B 4P3YB 4JEDA 5GAPD 2R2JA 3LSZA 4HJ2A 1B9YC 4ZILA 1VF3A 1GSYA 1URMA 1GTUA 3GTUB 5JWRB 2OE0A 4FH8A 2VCWA 5GSTA 2B5EA 1YF1A 3R3EA 1EV9A 3E9JB 1OE7A 4V2NA 1YZXA 1TTZA 3EC3A 1BEDA 1WOUA 4AJ8A 3MWHA 3VLNA 1OVNA 2DJ2A 5G1KA 3CSJA 4V1Ap 1TRWA 1GSSA 1S3AA 3I6AA 2GZZA 3IE3A 3L78A 1SYXA 4L0WA 1EP7A 3TKSA 4DSQA 2G0FA 2X99A 2GSSA 1Z7RA 1TDIA 3UMAA 3DKSA 2GSTA 4NAXA 2R4VA 3VWWA 2KP2A 3HYPA 3UJ1A 2IFQA 1R7HA 1TI3A 1OC8A 2BJXA 1SL1B 4FYUA 2LQQA 1ILOA 2OADA 2BMXA 2GQKA 2GGTA 3IOSA 1XIYA 2IN3A 1E6BA 2H01A 3TKSE 1HQOA 5IIZA 4F0CA 5F07A 1WPIA 3HJPA 1M0UA 4TR3A 4EXJA 1O8XA 4GQFA 4K7IA 3EMPA 4BVXB 3GL5A 2IMKA 1A2MA 4OWYA 5H5QA 4KDYA 4TXOA 1F2EA 1GSEA 1AIUA 1V58A 1K0CA 4I2UA 2HZFA 1GSQA 4K1FA 2FWHA 2H71A 4LA1A 3TJBA 4G9HA 5GSSA 3Q74A 2JU5A 3UBKA 4NWYA 5ECOB 1XVQA 2R6KA 3JCML 3GL3A 2DLXA 5B7CA 3EE2A 1HYUA 3GH6A 4KSMA 4XTSA 5HR0A 5G31A 2OBIA 4DVCA 2HI7A 5KN3A 4V2LA 2VCTA 1ST9A 3D22A 1A8LA 1F37A 4MP4A 1XWAA 1R5PA 3IRAA 4PUFC 1M2AA 1V40A 3HZ4A 1VF2A 2HRKB 1PL1A 2JADA 5D9XA 3Q19A 1T4YA 4L5LA 3BOAA 2DJ3A 6GSTA 3UAPA 5F05A 1ZGNA 2MBTA 4OFMA 2H1GA 4TW5A 3K8NA 1AC1A 1F3AA 3KZQA 4QL9A 4ZIJA 3KXOA 1GULA 3RDWA 1WIKA 4K0NA 3GN3A 1JLWA 5DCHA 4IP1A 4GSNA 1FO5A 1HNBA 1EZKA 1H4OA 2ZUPA 4NXIA 3EMXA 1IYIA 4KH7A 4ZL8A 5ECSA 5G5FA 1S3DA 4ECJA 3TJJA 5IMDA 5CRWA 2NVLA 1UA5A 3FZ4A 1GWCA 3Q6OA 1EEJA 1J9BA 4GXZA 3H8QA 3IK9A 2M80A 2EIOA 4WEYA 4XS6A 4OO5A 6GSUA 6GSSA 2GS3A 1KNGA 2VOCA 3FW2A 4H86A 2GDRA 2TIRA 1R26A 3GKXA 1XCCA 2F8AA 3VFIA 2YWIA 3G9BA 4K7OA 1WRYA 1FB0A 3LORA 2WB9A 2IFQB 5KN0A 5B6MA 2H6YA 4FQUA 5DALA 5DQYA 2HLSA 1YQ1A 1MD4A 2H6XA 3FZAA 5ECPB 3TKPA 2X8CA 3CMIA 2H66A 3FEUA 5DCGA 4ZB6A 4CDOA 1Y6EA 5DQSA 3FY7A 1G6YA 1XFLA 4EL1A 5C00A 1SU9A 3C8EA 2FUG2 1MD3A 1EOHA 2E2MA 1BYEA 2C3QA 3TCOA 1SKRB 4TXOB 1W89A 4OMVA 2YCDA 1XVWA 2IWTA 1XWKA 3IC8A 5F06A 3U6VA 2H76A 1ZZYA 1Z7PA 2CAIA 3ME8A 1XWBA 3F4TA 1PKWA 1EOGA 3KMNA 2LUSA 4V1Ag 1YKCA 1K0AA 2N5BA 3A2XA 4K8MA 4MJAA 5H5RA 1M2DA 3ZIVA 8GSSA 1A23A 1ERUA 2ON7A 6GSWA 2FA8A 4KF9A 2K6VA 2PMTA 4RQXA 1T3BA 3W6GA 2C3NA 3MSZA 3D4MA 1HNCA 1WE0A 4ZB9A 4G0KA 3LJRA 1SJIA 1OKTA 2OA7A 2XBQA 5CP1A 2YZUA 2WRTA 1X5DA 5JCUA 2GZYA 1SYRA 5KN2A 5D93A 2E2GA 3GKMA 4TXVA 1U87A 3WT1A 4JRRA 4IELA 4MDCA 5B8BA 1VF4A 4IQAA 2L4QA 4O32A 3GKNA 2O7KA 1K3YA 3ZTLA 3A2VA 3KH7A 1QGVA 3IAM2 3RHBA 1ZOFA 5DBQA 2FNOA 3QAWA 2HZEA 1PSQA 4CW9A 4G2EA 1X9WB 2VM1A 3FYGA 3EWLA 5F8BA 2CX4A 2H75A 2WFCA 14GSA 5AISA 2PN8A 4N0VA 4YAVA 2HYXA 4JR6A 2FD3A 5G2ZA 3ZMKA 3G7IA 4ZBAA 2B1LA 1OKDA 2GLRA 4IJ3A 1GSUA 3J7Yk 1SK2A 2I9HA 1LJRA 1G0TA 1QUWA 1C72A 4IP6A 2F51A 1B4QA 4BVXA 3LQ7A 5DALB 2K8VA 4HQSA 1ZYEA 2RUFA 2OBKA 4EO3A 2B6MA 3EU4A 3IC4A 4XS1A 1NW2A 4G0IA 3DYRA 1ON4A 4IGJA 3VPQA 1EGOA 1V57A 1H75A 2H6ZA 5HR2A 2X8HA 2C0GA 4DSRA 1KBNA 1K0BA 5CO3A 4XHMA 1V9WA 2R37A 4G19A 3CSHA 4KDXA 1HNAA 3BD2A 1GH2A 2REMA 5KEJA 4PNGA 5ECQB 4ISDA 5DVBA 2ZNMA 1OC3A 1GUKA 4IBPA 3S9FA 4PURA 5DAKA 3KTBA 4POMA 3D6IA 4O5RA 5C04A 4EE0A 3ZRDA 3IV4A 3BBYA 2YWNA 3GHAA 2X64A 5GZZB 1Q98A 4F82A 2ON5A 4OCEA 2WZ9A 3PR8A 5FT3A 2AHEA 3VWXA 3F4SA 4YH2A 2YWMA 1YEPA 4BWSA 1KEBA 1VGLA 3QD9A 2DJ0A 3L9UA 4ZXGA 3ME7A 4E8EA 4BVYA 1BQ7A 4KCAA 2PU9C 1YKAA 2P31A 3E0UA 3M9JA 7GSSA 3H93A 2PGTA 3BCKA 3D21A 1S3CA 5HR3A 3F9UA 4I6XA 1JFUA 3ERGA 4MF6A 1SENA 3E3EA 4NHZA 3VI7A 3P7XA 1ERWA 2XPEA 4HJMA 3TRPA 2H72A 1QXHA 3UARA 2QSIA 4WR4A 4WF5A 2V1MA 3EYTA 2HNLA 2DJJA 4HUAA 4LLRA 6GSYA 1RQMA 3CTFA 3H79A 2YJ7A 2K18A 2B7JA 2WCIA 3FR3A 2WGRA 3UVTA 4Q5NA 1M9BA
chains in the Genus database with same CATH superfamily
1TI1A 4HZ4A 2HZEB 4D73A 1TK5B 4PHZC 3H1NA 2NDOA 3C71A 5J9BA 1G6WA 2C3TA 4GCIA 5J40A 2DJ1A 2VAFA 3HD5A 4JE1A 3TKQA 1G7OA 4IS0A 3HXSA 2X8GA 5F0GA 1TK8B 2VCXA 1T7PB 1RW1A 1N25A 4WBRD 1S3RA 4I8BA 4O7HA 17GSA 2H70A 5HFIA 5ENUA 2MMAA 3TKRA 3U5RE 1RK4A 3ZREA 1QQ2A 2H8LA 2CZ3A 3QFAC 2V41A 2L4CA 1MDJA 2V6KA 3I69A 5A5KA 3GURA 3MNGA 3A5WA 3C1SA 4KE3A 1TP9A 5ID2A 1DE2A 3O76A 4PQ1A 2J23A 3TOUA 2YN1A 1MDIA 1JZOA 2WW3A 3ISOA 3Q18A 1M99A 2H1DA 2LNSA 4MMMA 4MZBA 1G7EA 3GKKA 2GZPA 3HCZA 1MTCA 5DAKB 5G1LA 4J56E 4PI2C 5J4VA 2F9SA 4BA7A 5EPFA 3ZFLA 1XWGA 5FWGA 2VO4A 4PTSA 5JCWA 2HSYA 2H73A 4BWQA 4I5QA 4KNDA 4IVFA 2KP1A 4YQMA 1ZCPA 2GT6A 2ALBA 1GNEA 2M46A 4L5OA 2QA2A 5A34A 1SK1A 2QKEA 2GT5A 2PERA 2CAQA 5IMAA 4ILFA 1PMTA 3M3MA 4K7NA 4AF2A 12GSA 4TR4A 2O3EA 3HJMA 5J9CA 1Z5YE 2MYGA 4TVEA 2LJRA 1O81A 3N9JA 4BVYB 4AJ6A 3L4NA 3LFLA 4LMVA 1U3AA 1EP8A 1Z9HA 4XCSA 4KCEA 5LCZA 5ECHB 2PVQA 1DSBA 5DJMA 1SJ6A 5AGYA 3IBHA 1TXXA 4MF7A 2VLUA 4L8EA 4KX4A 4FO5A 2VCQA 2QGVA 2B1KA 4FYCA 4I2TA 4N30A 1DE1A 3KP8A 1XW9A 2B7KA 2GSQA 3QOUA 3DGQA 4F0BA 5A4VA 5DDLA 1GNWA 3QPMA 2MMOA 3WD6A 4KB3A 4D73B 4HS1A 2DSAA 2VD0A 2HT9A 2LRTA 5A1NB 1THOA 4MJCA 2HSHA 10GSA 1NM3A 2DMMA 3TJGA 1LBKA 1OC9A 4KGIA 4HI7A 2MMNA 4XRDA 2I4AA 2CQ9A 3GYKA 1GRXA 4POKA 3KCMA 5IPHA 1ML6A 4G10A 3WGEA 5D8IA 5IOWA 1XZOA 3LEFA 2L6DA 2AYTA 3PINA 5D9VA 1AQXA 1A0RP 1U3IA 3IK7A 2PPTA 19GSA 5JCGA 2OE1A 4XS4B 2C1YA 4MZCA 5GAND 3FKFA 2A2RA 3HHVA 2WULA 2YPMA 4A5PA 4KUNA 4HEA2 4LL1B 4K2DA 3IPZA 2B3SA 5ID2B 4EC0A 2L5OA 5HFKA 3DVXA 4FYBA 4ECIA 5AIXA 3IA1A 2KHPA 4TKYA 5IMFA 5AIVA 4ZBBA 2LRCA 1M9AA 1TRUA 4J57E 4K9ZA 2WVZA 2EC4A 2RUEA 5IMCA 3LXTA 3HVSA 2CVDA 2PUKC 4KAEA 5IO2A 4AI6A 3UL3A 1K0DA 1XOAA 3RPNA 1MEKA 2HSNA 2LKUA 4N3ZA 5E4WA 5DJLA 3AY8A 4OFNA 5EY6A 2MMZA 1JZDA 1NHYA 4IHUA 1PRXA 2K8SA 5A34B 3DD3A 1XWCA 3LYPA 3GA4A 2LJKA 1K3LA 5ECMB 1KTEA 1U6TA 3KMOA 4WF4A 1ZMAA 1T4ZA 1XW6A 3RAZA 3KEBA 1WJKA 3DXBA 3TRXA 1TOFA 3HMJG 4NV2A 1W4VA 2O87A 3L9SA 3DEXA 3GSTA 2PVOC 1BJXA 3FZ9A 4WKWA 5G30A 3US3A 4HQZA 1MDKA 2NBSA 3F63A 4MF5A 1TJDA 1Z3EA 1FAAA 3KH9A 1AQVA 2VCZA 4J2FA 2HFDA 4YQUA 3P2AA 5A4UA 3M8NA 2LQOA 3VK9A 1GP1A 3IR4A 2VLTA 2YP6A 2GVPA 2GTUA 1GTBA 3EINA 3D5JA 3TGZA 2EIQA 1A2LA 3SBCA 2X49A 5IPGA 4RUVA 1ZYQB 1QMVA 2F3MA 3LGCA 1ERVA 1QK8A 3VI5A 3ERWA 2NTOA 5HFGA 1YY7A 2TRCP 2JSYA 3HZ8A 1PX7A 1OE8A 1OC9B 4BL7A 3IXRA 1TRSA 1PN9A 1YEXA 1NHOA 2WW1A 5HQPA 1NSWA 1F3BA 2FWGA 4Z7XA 5ECKB 2VL9A 3ZZXA 4IW9A 1JHBA 2HRNA 4I97A 2C80A 2X4AA 2RM5A 5ELGA 3KP9A 4JR4A 5LNKe 1FG4A 2O8VB 5A5HA 4PGTA 4MJEA 5ELAA 3CSIA 3F6FA 1K3OA 3KGKA 3HKRA 2R3XA 5ABRA 4MPGA 3ZL5A 1M7TA 2FGXA 4AGSA 3OR5A 2H74A 2LTKA 4GWRA 4BPYA 1V98A 4OO4A 3NIVA 2HSMA 6GSXA 5J5NA 2PBJA 2QC7A 2HRFA 2IPAA 5ECLB 1EWXA 3HY2A 2VLVA 4WR5A 1YJ6A 4KW6A 4TR0A 5KOXA 4RQRA 1LU4A 1UVZA 3G7JA 4ULXA 3TDGA 2IL3A 1X0RA 2M72A 3HJOA 4HU9A 4MCUA 5E59A 2IMEA 4NHWA 4F03A 4JZQA 1GLQA 2AUVA 3ZVJD 1X5EA 4KSOA 2IJYA 2VUPA 4N11A 3FK8A 1M3JA 3EPTA 2RM6A 4F2IA 2OT3A 2VL3A 3R2QA 4ML1A 3L9VA 2HRAA 2VM2A 2YWOA 2HSNB 4PQHA 2G2QA 1GSFA 2DJKA 1XBSA 5BRTA 5IMVA 4X0XA 5CAXA 1YF0A 5ECIB 1VRSD 3KD0A 3TRQA 4YAPA 2IMFA 2DBCA 4DSSA 3LWAA 4MH3A 5EL8A 1PKZA 2KOKA 1TRVA 2NPBA 4NPBA 2CVBA 4YQVA 4YKGA 1B8XA 3F4RA 3GH9A 3FMWA 4GSTA 4MABA 4FIWA 3F3QA 2YNXA 2XBIA 5FHIA 3D4TA 1PX6A 5AN1A 3DVWA 1SK0A 4MZWA 2YANA 4JU5A 2IIYA 4TR1A 9GSSA 11GSA 1A24A 4MNNA 5A1NA 3N5OA 1JZRA 3WYWA 4AKGA 1ACVA 4HZ2A 2A2PA 4ECCA 3IAS2 1SD8A 2IMIA 3PGTA 2HQTA 2LNTA 4CY6A 1GTIA 2DC5A 3A5IA 1PN0A 1PD21 4O92A 4QL7A 3WT2A 1FOVA 4PNFA 1ERTA 4EIQA 1GLPA 1A8YA 3O3TA 1A0FA 2MBSA 1FW1A 4Q5QA 3NOFA 4HU7A 3LYKA 2GQLA 1FB6A 3FZ5A 3APOA 1IYHA 2JZTA 2ZCTA 2ES7A 4XS4A 1O7UA 5L71A 2GSRA 1TK0B 3GIXA 4BL7B 5IO0A 1U88A 2TRXA 1XOBA 4GLTA 1WP0A 3UBLA 3IDVA 2OKAA 3CYNA 5D73A 4DEJA 1AUCA 4NV5A 1X9SB 4KA0A 2OJLA 4WXTA 1WMJA 2VCVA 1X5CA 5CREA 1XW5A 2LRNA 4IN0A 2GQMA 5A5HB 1Z6MA 4OCFA 5JWOB 3F6DA 2O89A 3ZIJA 2YV9A 3FR9A 3TB2A 3V1WA 3RBTA 4MK3A 3BCIA 5CRHA 1O6JA 4QQ7A 1ZL9A 4ID0A 2CX3A 1ABAA 1EEMA 2YOIA 2HSMB 2C4JA 3ED3A 3ZLPA 3HA9A 1SKWB 5A4WA 3I43A 4CHSA 4EDYA 2FY6A 3MDKA 3TJFA 1CQGA 4Q5RA 4GQCA 4F9ZA 1PFOA 2BTOT 1O85A 2XPDA 1TKDB 3FRCA 5H5SA 3ZFBA 4WETA 1S4BP 3ZYWA 2P5RA 2C0FA 1WWJA 1T8EB 1BX9A 5B8AA 4TRXA 3NZNA 5CRDA 3QAGA 18GSA 1Y25A 4N0ZA 3O6TA 1XXUA 5CRGA 5J3RA 2VL2C 4ECBA 2CA8A 3VURA 1FVJA 1SVOA 13GSA 4DSSB 3CTGA 3ERFA 1N8JA 4AJ7A 2CZ2A 2LJAA 1I5GA 2KLXA 4NMUA 4POBA 1Z6NA 2HXKA 2OACA 1PGTA 4OFTA 3EVIA 4EUYA 2UZ8A 3A2WA 4V2MA 2R5GA 2FA4A 4PUAA 1O73A 3KM6A 4MPFA 1F9MA 2O85A 1FOHA 2A2SA 3UIWA 5HR1A 5IMZA 3RGBC 2C8UA 3LG6A 3QMXA 4TR1B 1BF5A 1R4WA 3EU3A 3MIXA 2H1AA 2IMDA 3SWLA 3CBUA 3EURA 3W8JA 3M0FA 3TJKA 3MAKA 4IKHA 2L6CA 3TOTA 1I9DA 1GTAA 2C0EA 2MZCA 2L57A 1AQWA 5D9WA 5KN1A 4GF0A 2CV4A 3QFBC 2N5FA 2RIIA 3UVHA 4TOPA 2VD1A 5CNWA 1QFNA 1A2JA 2P5QA 1EV4A 3M9KA 1O8WA 3G7YA 3C73A 1JLVA 1T00A 3KIJA 3HVNA 3CHXC 2H0GA 4XIHA 1GL8A 3VPTA 1BAYA 2YJHA 4E68A 4LL4B 4GDFA 1XPVA 4K2XA 4YKFA 3DWVA 1USBA 1K0NA 2FCHA 3IHGA 5COHA 2RLIA 3KTLA 4MH2A 4HOJA 2OE3A 4X4JA 3D0ZA 2JSZA 2WS2A 1J0FA 1SVLA 1J08A 1SL2B 1N2AA 1ZYPA 2R0GA 4ZL9A 4X43A 3TUEA 3HDCA 2FLSA 2P0GA 2B5XA 2AV4A 5INYA 3M1GA 3HVVA 5ECNB 4EIPA 3GMFA 3GX8A 1BG5A 5J4UA 1M2BA 4IQ1A 3PH9A 2AJQB 2A4VA 2A4HA 3GFKA 4EDZA 3C7MA 1ZYNA 3RFRC 1X9MB 2JZRA 2D2ZA 4XRAA 3L0HA 4IJIA 2YZHA 3ZITA 3CRUA 2DIYA 2EIRA 1CQHA 3GUSA 1SD9A 2I81A 16GSA 3KJYA 3HVXA 3A3TA 1YVLA 2JL4A 1JZWA 5J41A 3C1RA 3QDNA 2J9HA 3VWUA 2AAWA 3WGXA 2FWEA 1B48A 1AAZA 1OYJA 3CRTA 4EVMA 5D9TA 3TKSC 5ECRB 3J7Yb 2CVKA 5G5EA 4GTUA 2Z9SA 2N5AA 4G0LA 5BMUA 1UC7A 3GTUA 1HD2A 2CT6A 3QR6A 3GV1A 5LD0A 2F8FA 2E0QA 1E2YA 4L0UA 3CWGA 2WJUA 1VF1A 5IQYA 1Q4JA 4Z2RA 2I1UA 2C0DA 1DUGA 3P90A 4ZB8A 2VKZG 4FXYP 5J4YA 2AB6A 3BJ5A 4K0GA 3CXGA 3DMLA 4RI7A 2JACA 2PWJA 1TU8A 3APQA 1GUHA 4MLYA 2YV7A 1OAZA 1PQNA 3GNJA 4N10A 2LSTA 3APSA 3ZVJA 4Q5FA 1B9XC 4ML6A 1SJZA 5JWQB 4GRFA 5KOWA 2FHEA 2FWFA 2DMLA 1FVKA 3F3RA 1GUMA 5IM9A 2JZSA 2L5LA 2DIZA 1AXDA 4WBJA 2WW0A 3FHKA 2K9FA 2LV3A 3IHQA 2WVXA 3W8SA 1F6MC 4LMWA 20GSA 2VL2A 3WGDA 3F8UA 4PX1A 2V2GA 5D96A 2KUCA 3FR6A 1UN2A 3UEMA 4TN8A 4Z2TA 1YDKA 3GSSA 3GX0A 5CYYA 3PPUA 1R5AA 4KDUA 1THXA 2H30A 2H0HA 3DIEA 3ZMLA 1AW9A 1K0MA 5EVOA 4EF0A 3DRNA 1TW9A 2L59A 2V6OA 1V2AA 4EKZA 4POLA 2VIMA 3QCPA 3LXZA 2DKIA 4ZL7A 4PXOA 2V32A 3QAVA 1TU7A 4RI6A 1FHEA 4ZBDA 2LS5A 4Z2UA 3UOMA 3GRXA 4MJBA 4ACSA 1SKSB 4USSA 6GSVA 4JBBA 5B6NA 2H0IA 4K6XA 2HRKA 2I3YA 3VWVA 22GSA 3H4KA 5J47A 4E8HA 4PQIA 3F0IA 1EGRA 2LEGA 3I9V2 2E7PA 2XC2A 1B4PA 4HDEA 2B5YA 4MA9A 1PL2A 1PA3A 2H19A 2WDUA 2HE3A 2XHFA 3RHCA 1GSDA 2H1BA 5IOXA 3RPPA 4X1UA 1K0OA 4GSSA 3P8WA 4OD7A 4ICYA 1T1VA 1DBYA 1SL0B 4P3YB 2WZSA 4JEDA 5GAPD 2R2JA 3LSZA 4HJ2A 1B9YC 4ZILA 1VF3A 1GSYA 1URMA 1GTUA 5BMUB 2WW2A 3GTUB 5JWRB 2OE0A 4FH8A 2VCWA 5GSTA 2B5EA 1YF1A 3R3EA 1EV9A 3E9JB 1OE7A 4V2NA 1YZXA 1TTZA 3EC3A 1BEDA 1WOUA 4AJ8A 3MWHA 3VLNA 1OVNA 2DJ2A 5G1KA 3CSJA 4V1Ap 1TRWA 1GSSA 1S3AA 4CY8A 3I6AA 2GZZA 4O5UA 3IE3A 3L78A 1SYXA 4L0WA 1EP7A 3TKSA 4DSQA 2G0FA 2X99A 2GSSA 1Z7RA 1TDIA 3UMAA 3DKSA 2GSTA 4NAXA 2R4VA 3VWWA 2KP2A 3HYPA 3UJ1A 2IFQA 1R7HA 1TI3A 1OC8A 2BJXA 1SL1B 4FYUA 2LQQA 1ILOA 2O5VA 2OADA 3TU3B 2BMXA 3CQFA 2GQKA 2GGTA 3IOSA 1XIYA 2WVXB 2IN3A 1E6BA 2H01A 3TKSE 1HQOA 5IIZA 4F0CA 5F07A 4W66A 1WPIA 3HJPA 1M0UA 4TR3A 4EXJA 1I1IP 1O8XA 4GQFA 4K7IA 3EMPA 4BVXB 3GL5A 2IMKA 1A2MA 4OWYA 5H5QA 4KDYA 4TXOA 1F2EA 1GSEA 1AIUA 1V58A 1K0CA 4I2UA 2HZFA 1GSQA 4K1FA 2FWHA 2H71A 4LA1A 2UV8G 3TJBA 4G9HA 5GSSA 3Q74A 2JU5A 3UBKA 4NWYA 5ECOB 1XVQA 2R6KA 3JCML 3GL3A 2DLXA 5B7CA 3EE2A 1HYUA 3GH6A 4KSMA 4XTSA 5HR0A 5G31A 2OBIA 4DVCA 2HI7A 5KN3A 4V2LA 2VCTA 4ZB7A 1ST9A 3D22A 1A8LA 1F37A 4MP4A 1XWAA 1R5PA 3IRAA 4PUFC 1M2AA 1V40A 3HZ4A 1VF2A 2HRKB 1PL1A 2JADA 5D9XA 3Q19A 1T4YA 4L5LA 3BOAA 2DJ3A 6GSTA 3UAPA 5F05A 1ZGNA 2MBTA 4OFMA 2H1GA 4TW5A 3K8NA 1AC1A 1F3AA 3KZQA 4QL9A 4ZIJA 3KXOA 1GULA 3RDWA 2EFEA 1WIKA 4K0NA 3GN3A 1JLWA 5DCHA 4IP1A 4GSNA 1FO5A 1HNBA 1EZKA 1H4OA 2ZUPA 4NXIA 3EMXA 1IYIA 4KH7A 4ZL8A 5ECSA 5G5FA 1S3DA 4ECJA 3TJJA 5IMDA 5CRWA 2NVLA 4QMKA 1UA5A 3FZ4A 1GWCA 3Q6OA 1EEJA 1J9BA 4GXZA 3H8QA 3IK9A 4AKXB 2M80A 2EIOA 4WEYA 4XS6A 4OO5A 6GSUA 6GSSA 2GS3A 1KNGA 2VOCA 3FW2A 4H86A 4HSCX 2GDRA 2TIRA 1R26A 3GKXA 2R0CA 1XCCA 2F8AA 3VFIA 2YWIA 3G9BA 4K7OA 1WRYA 1FB0A 2DKHA 3LORA 2WB9A 2IFQB 2R0PA 5KN0A 5B6MA 2H6YA 4FQUA 2EFDA 5DALA 5DQYA 2HLSA 1YQ1A 1MD4A 2H6XA 3FZAA 5ECPB 3TKPA 2X8CA 3CMIA 2H66A 3FEUA 5DCGA 4ZB6A 4CDOA 1Y6EA 4K5RA 5DQSA 3FY7A 1G6YA 1XFLA 4EL1A 5C00A 1SU9A 3C8EA 1BG1A 2FUG2 1MD3A 1EOHA 2E2MA 1BYEA 2C3QA 3TCOA 1SKRB 4TXOB 1W89A 4OMVA 2YCDA 1XVWA 2IWTA 1XG8A 1XWKA 3IC8A 5F06A 3U6VA 2H76A 1ZZYA 1Z7PA 2CAIA 3ME8A 1XWBA 3F4TA 1PKWA 1EOGA 3KMNA 2LUSA 4V1Ag 1YKCA 1K0AA 2N5BA 3A2XA 4K8MA 4MJAA 5H5RA 1M2DA 3ZIVA 8GSSA 1A23A 1ERUA 2ON7A 6GSWA 2FA8A 4KF9A 2K6VA 2PMTA 4RQXA 1T3BA 3W6GA 2C3NA 3MSZA 3D4MA 1HNCA 1WE0A 4ZB9A 4G0KA 4BIKA 3LJRA 1SJIA 1OKTA 2OA7A 2XBQA 5CP1A 2YZUA 2WRTA 1X5DA 5JCUA 2GZYA 1SYRA 4O5QA 5KN2A 5D93A 2E2GA 3GKMA 4TXVA 1U87A 3WT1A 4JRRA 4IELA 4MDCA 5B8BA 1VF4A 4IQAA 2L4QA 4O32A 3GKNA 2O7KA 4K5SA 1K3YA 3ZTLA 3A2VA 3KH7A 1QGVA 3IAM2 3RHBA 1ZOFA 5DBQA 2FNOA 3QAWA 2HZEA 1PSQA 4CW9A 4G2EA 1X9WB 2VM1A 3FYGA 3EWLA 5F8BA 2CX4A 2H75A 1TXUA 2WFCA 14GSA 5AISA 2PN8A 4N0VA 3MYDA 4YAVA 2HYXA 4JR6A 2FD3A 5G2ZA 3ZMKA 3G7IA 4ZBAA 2B1LA 1OKDA 2GLRA 4IJ3A 1GSUA 3J7Yk 1SK2A 2I9HA 1LJRA 1G0TA 1QUWA 1C72A 4IP6A 2F51A 1B4QA 4BVXA 3LQ7A 5DALB 2K8VA 3LW9A 2O36A 4HQSA 1ZYEA 2RUFA 2OBKA 4EO3A 2B6MA 4AKHA 3EU4A 3IC4A 4XS1A 1NW2A 4G0IA 4G01A 3DYRA 1ON4A 4IGJA 3VPQA 1EGOA 1V57A 1H75A 2H6ZA 5HR2A 1Y1UA 2X8HA 2C0GA 4DSRA 1KBNA 1K0BA 5CO3A 4XHMA 1V9WA 2R37A 4G19A 3CSHA 4KDXA 1HNAA 3BD2A 1GH2A 2REMA 5KEJA 4PNGA 5ECQB 4ISDA 5DVBA 2ZNMA 1SVMA 1OC3A 1GUKA 4IBPA 3S9FA 4PURA 5DAKA 3KTBA 4POMA 3D6IA 2WVYA 4O5RA 5C04A 4EE0A 3ZRDA 3IV4A 3BBYA 2YWNA 3GHAA 2X64A 5GZZB 1Q98A 4F82A 2ON5A 4OCEA 2H1LA 2WZ9A 3PR8A 5FT3A 2AHEA 3VWXA 3F4SA 4YH2A 2YWMA 1M3IA 1YEPA 4BWSA 1KEBA 2QA1A 1VGLA 3QD9A 2DJ0A 4PI0C 3L9UA 4ZXGA 3ME7A 4E8EA 4BVYA 1BQ7A 4KCAA 1YEWC 2PU9C 1YKAA 2P31A 3E0UA 3M9JA 7GSSA 3H93A 2PGTA 3BCKA 3D21A 1S3CA 5HR3A 3F9UA 4I6XA 2EFCA 1JFUA 3ERGA 4MF6A 1SENA 3E3EA 4NHZA 3VI7A 3P7XA 1ERWA 2XPEA 4HJMA 3TRPA 2H72A 1QXHA 3UARA 2QSIA 4WR4A 4WF5A 2V1MA 3EYTA 2HNLA 2DJJA 4HUAA 2EFHA 4LLRA 6GSYA 1RQMA 3CTFA 4AKIA 3H79A 2YJ7A 2K18A 2B7JA 2WCIA 3FR3A 2WGRA 3UVTA 4Q5NA 1M9BA
chains in the Genus database with same CATH topology
1TI1A 4HZ4A 2HZEB 4D73A 1TK5B 3H1NA 2NDOA 3C71A 5J9BA 1G6WA 2C3TA 4GCIA 5J40A 2DJ1A 2VAFA 3HD5A 4JE1A 3TKQA 1G7OA 4IS0A 3HXSA 2X8GA 5F0GA 1TK8B 2VCXA 1T7PB 1RW1A 1N25A 4WBRD 4I8BA 4O7HA 17GSA 2H70A 5HFIA 5ENUA 2MMAA 3TKRA 3U5RE 1RK4A 3ZREA 1QQ2A 2H8LA 2CZ3A 3QFAC 2V41A 2L4CA 1MDJA 2V6KA 3I69A 5A5KA 3GURA 3MNGA 3A5WA 3C1SA 4KE3A 1TP9A 5ID2A 1DE2A 3O76A 4PQ1A 2J23A 3TOUA 2YN1A 1MDIA 1JZOA 3ISOA 3Q18A 1M99A 2H1DA 2LNSA 4MMMA 4MZBA 1G7EA 3GKKA 2GZPA 3HCZA 1MTCA 5DAKB 5G1LA 4J56E 5J4VA 2F9SA 4BA7A 5EPFA 3ZFLA 1XWGA 5FWGA 2VO4A 4PTSA 5JCWA 2HSYA 2H73A 4BWQA 4I5QA 4KNDA 4IVFA 2KP1A 4YQMA 1ZCPA 2GT6A 2ALBA 1GNEA 2M46A 4L5OA 2QA2A 5A34A 1SK1A 2QKEA 2GT5A 2PERA 2CAQA 5IMAA 4ILFA 1PMTA 3M3MA 4K7NA 4AF2A 12GSA 4TR4A 3HJMA 5J9CA 1Z5YE 2MYGA 4TVEA 2LJRA 1O81A 3N9JA 4BVYB 4AJ6A 3L4NA 3LFLA 4LMVA 1U3AA 1EP8A 1Z9HA 4XCSA 4KCEA 5LCZA 5ECHB 2PVQA 1DSBA 5DJMA 1SJ6A 5AGYA 3IBHA 1TXXA 4MF7A 2VLUA 4L8EA 4KX4A 4FO5A 2VCQA 2QGVA 2B1KA 4FYCA 4I2TA 4N30A 1DE1A 3KP8A 1XW9A 2B7KA 2GSQA 3QOUA 3DGQA 4F0BA 5A4VA 5DDLA 1GNWA 3QPMA 2MMOA 3WD6A 4KB3A 4D73B 4HS1A 2DSAA 2VD0A 2HT9A 2LRTA 5A1NB 1THOA 4MJCA 2HSHA 10GSA 1NM3A 2DMMA 3TJGA 1LBKA 1OC9A 4KGIA 4HI7A 2MMNA 4XRDA 2I4AA 2CQ9A 3GYKA 1GRXA 4POKA 3KCMA 5IPHA 1ML6A 4G10A 3WGEA 5D8IA 5IOWA 1XZOA 3LEFA 2L6DA 2AYTA 3PINA 5D9VA 1AQXA 1A0RP 1U3IA 3IK7A 2PPTA 19GSA 5JCGA 2OE1A 4XS4B 2C1YA 4MZCA 5GAND 3FKFA 2A2RA 3HHVA 2WULA 2YPMA 4A5PA 4KUNA 4HEA2 4LL1B 4K2DA 3IPZA 2B3SA 5ID2B 4EC0A 2L5OA 5HFKA 3DVXA 4FYBA 4ECIA 5AIXA 3IA1A 2KHPA 4TKYA 5IMFA 5AIVA 4ZBBA 2LRCA 1M9AA 1TRUA 4J57E 4K9ZA 2EC4A 2RUEA 5IMCA 3LXTA 3HVSA 2CVDA 2PUKC 4KAEA 5IO2A 4AI6A 3UL3A 1K0DA 1XOAA 3RPNA 1MEKA 2HSNA 2LKUA 4N3ZA 5E4WA 5DJLA 3AY8A 4OFNA 5EY6A 2MMZA 1JZDA 1NHYA 4IHUA 1PRXA 2K8SA 5A34B 3DD3A 1XWCA 3LYPA 3GA4A 2LJKA 1K3LA 5ECMB 1KTEA 1U6TA 3KMOA 4WF4A 1ZMAA 1T4ZA 1XW6A 3RAZA 3KEBA 1WJKA 3DXBA 3TRXA 1TOFA 3HMJG 4NV2A 1W4VA 2O87A 3L9SA 3DEXA 3GSTA 2PVOC 1BJXA 3FZ9A 4WKWA 5G30A 3US3A 4HQZA 1MDKA 2NBSA 3F63A 4MF5A 1TJDA 1Z3EA 1FAAA 3KH9A 1AQVA 2VCZA 4J2FA 2HFDA 4YQUA 3P2AA 5A4UA 3M8NA 2LQOA 3VK9A 1GP1A 3IR4A 2VLTA 2YP6A 2GVPA 2GTUA 1GTBA 3EINA 3D5JA 3TGZA 2EIQA 1A2LA 3SBCA 2X49A 5IPGA 4RUVA 1ZYQB 1QMVA 2F3MA 3LGCA 1ERVA 1QK8A 3VI5A 3ERWA 2NTOA 5HFGA 1YY7A 2TRCP 2JSYA 3HZ8A 1PX7A 1OE8A 1OC9B 4BL7A 3IXRA 1TRSA 1PN9A 1YEXA 1NHOA 5HQPA 1NSWA 1F3BA 2FWGA 4Z7XA 5ECKB 2VL9A 3ZZXA 4IW9A 1JHBA 2HRNA 4I97A 2C80A 2X4AA 2RM5A 5ELGA 3KP9A 4JR4A 5LNKe 1FG4A 2O8VB 5A5HA 4PGTA 4MJEA 5ELAA 3CSIA 3F6FA 1K3OA 3KGKA 3HKRA 2R3XA 5ABRA 4MPGA 3ZL5A 1M7TA 2FGXA 4AGSA 3OR5A 2H74A 2LTKA 4GWRA 4BPYA 1V98A 4OO4A 3NIVA 2HSMA 6GSXA 5J5NA 2PBJA 2QC7A 2HRFA 2IPAA 5ECLB 1EWXA 3HY2A 2VLVA 4WR5A 1YJ6A 4KW6A 4TR0A 5KOXA 4RQRA 1LU4A 1UVZA 3G7JA 4ULXA 3TDGA 2IL3A 1X0RA 2M72A 3HJOA 4HU9A 4MCUA 5E59A 2IMEA 4NHWA 4F03A 4JZQA 1GLQA 2AUVA 3ZVJD 1X5EA 4KSOA 2IJYA 2VUPA 4N11A 3FK8A 3EPTA 2RM6A 4F2IA 2OT3A 2VL3A 3R2QA 4ML1A 3L9VA 2HRAA 2VM2A 2YWOA 2HSNB 4PQHA 2G2QA 1GSFA 2DJKA 1XBSA 5BRTA 5IMVA 4X0XA 5CAXA 1YF0A 5ECIB 1VRSD 3KD0A 3TRQA 4YAPA 2IMFA 2DBCA 4DSSA 3LWAA 4MH3A 5EL8A 1PKZA 2KOKA 1TRVA 2NPBA 4NPBA 2CVBA 4YQVA 4YKGA 1B8XA 3F4RA 3GH9A 3FMWA 4GSTA 4MABA 4FIWA 3F3QA 2YNXA 2XBIA 5FHIA 3D4TA 1PX6A 5AN1A 3DVWA 1SK0A 4MZWA 2YANA 4JU5A 2IIYA 4TR1A 9GSSA 11GSA 1A24A 4MNNA 5A1NA 3N5OA 1JZRA 3WYWA 4AKGA 1ACVA 4HZ2A 2A2PA 4ECCA 3IAS2 1SD8A 2IMIA 3PGTA 2HQTA 2LNTA 4CY6A 1GTIA 2DC5A 3A5IA 1PN0A 1PD21 4O92A 4QL7A 3WT2A 1FOVA 4PNFA 1ERTA 4EIQA 1GLPA 1A8YA 3O3TA 1A0FA 2MBSA 1FW1A 4Q5QA 3NOFA 4HU7A 3LYKA 2GQLA 1FB6A 3FZ5A 3APOA 1IYHA 2JZTA 2ZCTA 2ES7A 4XS4A 1O7UA 5L71A 2GSRA 1TK0B 3GIXA 4BL7B 5IO0A 1U88A 2TRXA 1XOBA 4GLTA 1WP0A 3UBLA 3IDVA 2OKAA 3CYNA 5D73A 4DEJA 1AUCA 4NV5A 1X9SB 4KA0A 2OJLA 4WXTA 1WMJA 2VCVA 1X5CA 5CREA 1XW5A 2LRNA 4IN0A 2GQMA 5A5HB 1Z6MA 4OCFA 5JWOB 3F6DA 2O89A 3ZIJA 2YV9A 3FR9A 3TB2A 3V1WA 3RBTA 4MK3A 3BCIA 5CRHA 1O6JA 4QQ7A 1ZL9A 4ID0A 2CX3A 1ABAA 1EEMA 2YOIA 2HSMB 2C4JA 3ED3A 3ZLPA 3HA9A 1SKWB 5A4WA 3I43A 4CHSA 4EDYA 2FY6A 3MDKA 3TJFA 1CQGA 4Q5RA 4GQCA 4F9ZA 2BTOT 1O85A 2XPDA 1TKDB 3FRCA 5H5SA 3ZFBA 4WETA 3ZYWA 2P5RA 2C0FA 1WWJA 1T8EB 1BX9A 5B8AA 4TRXA 3NZNA 5CRDA 3QAGA 18GSA 1Y25A 4N0ZA 3O6TA 1XXUA 5CRGA 5J3RA 2VL2C 4ECBA 2CA8A 3VURA 1FVJA 1SVOA 13GSA 4DSSB 3CTGA 3ERFA 1N8JA 4AJ7A 2CZ2A 2LJAA 1I5GA 2KLXA 4NMUA 4POBA 1Z6NA 2HXKA 2OACA 1PGTA 4OFTA 3EVIA 4EUYA 2UZ8A 3A2WA 4V2MA 2R5GA 2FA4A 4PUAA 1O73A 3KM6A 4MPFA 1F9MA 2O85A 1FOHA 2A2SA 3UIWA 5HR1A 5IMZA 2C8UA 3LG6A 3QMXA 4TR1B 1BF5A 1R4WA 3EU3A 3MIXA 2H1AA 2IMDA 3SWLA 3CBUA 3EURA 3W8JA 3M0FA 3TJKA 3MAKA 4IKHA 2L6CA 3TOTA 1I9DA 1GTAA 2C0EA 2MZCA 2L57A 1AQWA 5D9WA 5KN1A 4GF0A 2CV4A 3QFBC 2N5FA 2RIIA 3UVHA 4TOPA 2VD1A 5CNWA 1QFNA 1A2JA 2P5QA 1EV4A 3M9KA 1O8WA 3G7YA 3C73A 1JLVA 1T00A 3KIJA 2H0GA 4XIHA 1GL8A 3VPTA 1BAYA 2YJHA 4E68A 4LL4B 4GDFA 1XPVA 4K2XA 4YKFA 3DWVA 1USBA 1K0NA 2FCHA 3IHGA 5COHA 2RLIA 3KTLA 4MH2A 4HOJA 2OE3A 4X4JA 3D0ZA 2JSZA 2WS2A 1J0FA 1SVLA 1J08A 1SL2B 1N2AA 1ZYPA 2R0GA 4ZL9A 4X43A 3TUEA 3HDCA 2FLSA 2P0GA 2B5XA 2AV4A 5INYA 3M1GA 3HVVA 5ECNB 4EIPA 3GMFA 3GX8A 1BG5A 1M2BA 5J4UA 4IQ1A 3PH9A 2AJQB 2A4VA 2A4HA 3GFKA 4EDZA 3C7MA 1ZYNA 1X9MB 2JZRA 2D2ZA 4XRAA 3L0HA 4IJIA 2YZHA 3ZITA 3CRUA 2DIYA 2EIRA 1CQHA 3GUSA 1SD9A 2I81A 16GSA 3KJYA 3HVXA 3A3TA 1YVLA 2JL4A 1JZWA 5J41A 3C1RA 3QDNA 2J9HA 3VWUA 2AAWA 3WGXA 2FWEA 1B48A 1AAZA 1OYJA 3CRTA 4EVMA 5D9TA 3TKSC 5ECRB 3J7Yb 2CVKA 5G5EA 4GTUA 2Z9SA 2N5AA 4G0LA 5BMUA 1UC7A 3GTUA 1HD2A 2CT6A 3QR6A 3GV1A 5LD0A 2F8FA 2E0QA 1E2YA 4L0UA 3CWGA 2WJUA 1VF1A 5IQYA 1Q4JA 4Z2RA 2I1UA 2C0DA 1DUGA 3P90A 4ZB8A 2VKZG 5J4YA 2AB6A 3BJ5A 4K0GA 3CXGA 3DMLA 4RI7A 2JACA 2PWJA 1TU8A 3APQA 1GUHA 4MLYA 2YV7A 1OAZA 1PQNA 3GNJA 4N10A 2LSTA 3APSA 3ZVJA 4Q5FA 1B9XC 4ML6A 1SJZA 5JWQB 4GRFA 5KOWA 2FHEA 2FWFA 2DMLA 1FVKA 3F3RA 1GUMA 5IM9A 2JZSA 2L5LA 2DIZA 1AXDA 4WBJA 3FHKA 2K9FA 2LV3A 3IHQA 3W8SA 1F6MC 4LMWA 20GSA 2VL2A 3WGDA 3F8UA 4PX1A 2V2GA 5D96A 2KUCA 3FR6A 1UN2A 3UEMA 4TN8A 4Z2TA 1YDKA 3GSSA 3GX0A 5CYYA 3PPUA 1R5AA 4KDUA 1THXA 2H30A 2H0HA 3DIEA 3ZMLA 1AW9A 1K0MA 5EVOA 4EF0A 3DRNA 1TW9A 2L59A 2V6OA 1V2AA 4EKZA 4POLA 2VIMA 3QCPA 3LXZA 2DKIA 4ZL7A 4PXOA 2V32A 3QAVA 1TU7A 4RI6A 1FHEA 4ZBDA 2LS5A 4Z2UA 3UOMA 3GRXA 4MJBA 4ACSA 1SKSB 4USSA 6GSVA 4JBBA 5B6NA 2H0IA 4K6XA 2HRKA 2I3YA 3VWVA 22GSA 3H4KA 5J47A 4E8HA 4PQIA 3F0IA 1EGRA 2LEGA 3I9V2 2E7PA 2XC2A 1B4PA 4HDEA 2B5YA 4MA9A 1PL2A 1PA3A 2H19A 2WDUA 2HE3A 2XHFA 3RHCA 1GSDA 2H1BA 5IOXA 3RPPA 4X1UA 1K0OA 4GSSA 3P8WA 4OD7A 4ICYA 1T1VA 1DBYA 1SL0B 4P3YB 4JEDA 5GAPD 2R2JA 3LSZA 4HJ2A 1B9YC 4ZILA 1VF3A 1GSYA 1URMA 1GTUA 5BMUB 3GTUB 5JWRB 2OE0A 4FH8A 2VCWA 5GSTA 2B5EA 1YF1A 3R3EA 1EV9A 3E9JB 1OE7A 4V2NA 1YZXA 1TTZA 3EC3A 1BEDA 1WOUA 4AJ8A 3MWHA 3VLNA 1OVNA 2DJ2A 5G1KA 3CSJA 4V1Ap 1TRWA 1GSSA 1S3AA 4CY8A 3I6AA 2GZZA 4O5UA 3IE3A 3L78A 1SYXA 4L0WA 1EP7A 3TKSA 4DSQA 2G0FA 2X99A 2GSSA 1Z7RA 1TDIA 3UMAA 3DKSA 2GSTA 4NAXA 2R4VA 3VWWA 2KP2A 3HYPA 3UJ1A 2IFQA 1R7HA 1TI3A 1OC8A 2BJXA 1SL1B 4FYUA 2LQQA 1ILOA 2O5VA 2OADA 3TU3B 2BMXA 2GQKA 2GGTA 3IOSA 1XIYA 2IN3A 1E6BA 2H01A 3TKSE 1HQOA 5IIZA 4F0CA 5F07A 4W66A 1WPIA 3HJPA 1M0UA 4TR3A 4EXJA 1O8XA 4GQFA 4K7IA 3EMPA 4BVXB 3GL5A 2IMKA 1A2MA 4OWYA 5H5QA 4KDYA 4TXOA 1F2EA 1GSEA 1AIUA 1V58A 1K0CA 4I2UA 2HZFA 1GSQA 4K1FA 2FWHA 2H71A 4LA1A 2UV8G 3TJBA 4G9HA 5GSSA 3Q74A 2JU5A 3UBKA 4NWYA 5ECOB 1XVQA 2R6KA 3JCML 3GL3A 2DLXA 5B7CA 3EE2A 1HYUA 3GH6A 4KSMA 4XTSA 5HR0A 5G31A 2OBIA 4DVCA 2HI7A 5KN3A 4V2LA 2VCTA 4ZB7A 1ST9A 3D22A 1A8LA 1F37A 4MP4A 1XWAA 1R5PA 3IRAA 4PUFC 1M2AA 1V40A 3HZ4A 1VF2A 2HRKB 1PL1A 2JADA 5D9XA 3Q19A 1T4YA 4L5LA 3BOAA 2DJ3A 6GSTA 3UAPA 5F05A 1ZGNA 2MBTA 4OFMA 2H1GA 4TW5A 3K8NA 1AC1A 1F3AA 3KZQA 4QL9A 4ZIJA 3KXOA 1GULA 3RDWA 2EFEA 1WIKA 4K0NA 3GN3A 1JLWA 5DCHA 4IP1A 4GSNA 1FO5A 1HNBA 1EZKA 1H4OA 2ZUPA 4NXIA 3EMXA 1IYIA 4KH7A 4ZL8A 5ECSA 5G5FA 1S3DA 4ECJA 3TJJA 5IMDA 5CRWA 2NVLA 4QMKA 1UA5A 3FZ4A 1GWCA 3Q6OA 1EEJA 1J9BA 4GXZA 3H8QA 3IK9A 4AKXB 2M80A 2EIOA 4WEYA 4XS6A 4OO5A 6GSUA 6GSSA 2GS3A 1KNGA 2VOCA 3FW2A 4H86A 2GDRA 2TIRA 1R26A 3GKXA 2R0CA 1XCCA 2F8AA 3VFIA 2YWIA 3G9BA 4K7OA 1WRYA 1FB0A 2DKHA 3LORA 2WB9A 2IFQB 2R0PA 5KN0A 5B6MA 2H6YA 4FQUA 2EFDA 5DALA 5DQYA 2HLSA 1YQ1A 1MD4A 2H6XA 3FZAA 5ECPB 3TKPA 2X8CA 3CMIA 2H66A 3FEUA 5DCGA 4ZB6A 4CDOA 1Y6EA 4K5RA 5DQSA 3FY7A 1G6YA 1XFLA 4EL1A 5C00A 1SU9A 3C8EA 1BG1A 2FUG2 1MD3A 1EOHA 2E2MA 1BYEA 2C3QA 3TCOA 1SKRB 4TXOB 1W89A 4OMVA 2YCDA 1XVWA 2IWTA 1XWKA 3IC8A 5F06A 3U6VA 2H76A 1ZZYA 1Z7PA 2CAIA 3ME8A 1XWBA 3F4TA 1PKWA 1EOGA 3KMNA 2LUSA 4V1Ag 1YKCA 1K0AA 2N5BA 3A2XA 4K8MA 4MJAA 5H5RA 1M2DA 3ZIVA 8GSSA 1A23A 1ERUA 2ON7A 6GSWA 2FA8A 4KF9A 2K6VA 2PMTA 4RQXA 1T3BA 3W6GA 2C3NA 3MSZA 3D4MA 1HNCA 1WE0A 4ZB9A 4G0KA 3LJRA 1SJIA 1OKTA 2OA7A 2XBQA 5CP1A 2YZUA 2WRTA 1X5DA 5JCUA 2GZYA 1SYRA 4O5QA 5KN2A 5D93A 2E2GA 3GKMA 4TXVA 1U87A 3WT1A 4JRRA 4IELA 4MDCA 5B8BA 1VF4A 4IQAA 2L4QA 4O32A 3GKNA 2O7KA 4K5SA 1K3YA 3ZTLA 3A2VA 3KH7A 1QGVA 3IAM2 3RHBA 1ZOFA 5DBQA 2FNOA 3QAWA 2HZEA 1PSQA 4CW9A 4G2EA 1X9WB 2VM1A 3FYGA 3EWLA 5F8BA 2CX4A 2H75A 1TXUA 2WFCA 14GSA 5AISA 2PN8A 4N0VA 3MYDA 4YAVA 2HYXA 4JR6A 2FD3A 5G2ZA 3ZMKA 3G7IA 4ZBAA 2B1LA 1OKDA 2GLRA 4IJ3A 1GSUA 3J7Yk 1SK2A 2I9HA 1LJRA 1G0TA 1QUWA 1C72A 4IP6A 2F51A 1B4QA 4BVXA 3LQ7A 5DALB 2K8VA 3LW9A 4HQSA 1ZYEA 2RUFA 2OBKA 4EO3A 2B6MA 4AKHA 3EU4A 3IC4A 4XS1A 1NW2A 4G0IA 4G01A 3DYRA 1ON4A 4IGJA 3VPQA 1EGOA 1V57A 1H75A 2H6ZA 5HR2A 1Y1UA 2X8HA 2C0GA 4DSRA 1KBNA 1K0BA 5CO3A 4XHMA 1V9WA 2R37A 4G19A 3CSHA 4KDXA 1HNAA 3BD2A 1GH2A 2REMA 5KEJA 4PNGA 5ECQB 4ISDA 5DVBA 2ZNMA 1SVMA 1OC3A 1GUKA 4IBPA 3S9FA 4PURA 5DAKA 3KTBA 4POMA 3D6IA 4O5RA 5C04A 4EE0A 3ZRDA 3IV4A 3BBYA 2YWNA 3GHAA 2X64A 5GZZB 1Q98A 4F82A 2ON5A 4OCEA 2H1LA 2WZ9A 3PR8A 5FT3A 2AHEA 3VWXA 3F4SA 4YH2A 2YWMA 1YEPA 4BWSA 1KEBA 2QA1A 1VGLA 3QD9A 2DJ0A 3L9UA 4ZXGA 3ME7A 4E8EA 4BVYA 1BQ7A 4KCAA 2PU9C 1YKAA 2P31A 3E0UA 3M9JA 7GSSA 3H93A 2PGTA 3BCKA 3D21A 1S3CA 5HR3A 3F9UA 4I6XA 2EFCA 1JFUA 3ERGA 4MF6A 1SENA 3E3EA 4NHZA 3VI7A 3P7XA 1ERWA 2XPEA 4HJMA 3TRPA 2H72A 1QXHA 3UARA 2QSIA 4WR4A 4WF5A 2V1MA 3EYTA 2HNLA 2DJJA 4HUAA 2EFHA 4LLRA 6GSYA 1RQMA 3CTFA 4AKIA 3H79A 2YJ7A 2K18A 2B7JA 2WCIA 3FR3A 2WGRA 3UVTA 4Q5NA 1M9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TI1 A;  4HZ4 A;  2HZE B;  4D73 A;  1TK5 B;  3H1N A;  2NDO A;  3C71 A;  5J9B A;  1G6W A;  2C3T A;  4GCI A;  2DJ1 A;  2VAF A;  3HD5 A;  4JE1 A;  3TKQ A;  1G7O A;  4IS0 A;  3HXS A;  2X8G A;  5F0G A;  1TK8 B;  2VCX A;  1T7P B;  1RW1 A;  4WBR D;  4I8B A;  4O7H A;  17GS A;  2H70 A;  5HFI A;  5ENU A;  2MMA A;  3TKR A;  3U5R E;  1RK4 A;  3ZRE A;  1QQ2 A;  2H8L A;  2CZ3 A;  3QFA C;  2V41 A;  2L4C A;  1MDJ A;  2V6K A;  3I69 A;  5A5K A;  3GUR A;  3MNG A;  3A5W A;  3C1S A;  4KE3 A;  1TP9 A;  5ID2 A;  1DE2 A;  3O76 A;  4PQ1 A;  2J23 A;  3TOU A;  2YN1 A;  1MDI A;  1JZO A;  3ISO A;  3Q18 A;  1M99 A;  2H1D A;  2LNS A;  4MMM A;  4MZB A;  1G7E A;  3GKK A;  2GZP A;  3HCZ A;  1MTC A;  5DAK B;  5G1L A;  4J56 E;  2F9S A;  4BA7 A;  5EPF A;  3ZFL A;  1XWG A;  5FWG A;  2VO4 A;  4PTS A;  5JCW A;  2HSY A;  2H73 A;  4BWQ A;  4I5Q A;  4KND A;  4IVF A;  2KP1 A;  4YQM A;  1ZCP A;  2GT6 A;  2ALB A;  1GNE A;  2M46 A;  4L5O A;  1SK1 A;  2QKE A;  2GT5 A;  2PER A;  2CAQ A;  5IMA A;  4ILF A;  1PMT A;  3M3M A;  4K7N A;  4AF2 A;  12GS A;  4TR4 A;  3HJM A;  5J9C A;  1Z5Y E;  2MYG A;  4TVE A;  2LJR A;  1O81 A;  3N9J A;  4BVY B;  4AJ6 A;  3L4N A;  3LFL A;  4LMV A;  1U3A A;  1EP8 A;  1Z9H A;  4XCS A;  4KCE A;  5LCZ A;  5ECH B;  2PVQ A;  1DSB A;  5DJM A;  1SJ6 A;  5AGY A;  3IBH A;  1TXX A;  4MF7 A;  2VLU A;  4L8E A;  4KX4 A;  4FO5 A;  2VCQ A;  2QGV A;  2B1K A;  4FYC A;  4I2T A;  4N30 A;  1DE1 A;  3KP8 A;  1XW9 A;  2B7K A;  2GSQ A;  3QOU A;  3DGQ A;  4F0B A;  5A4V A;  5DDL A;  1GNW A;  3QPM A;  2MMO A;  3WD6 A;  4KB3 A;  4D73 B;  4HS1 A;  2DSA A;  2VD0 A;  2HT9 A;  2LRT A;  1THO A;  4MJC A;  2HSH A;  10GS A;  1NM3 A;  2DMM A;  3TJG A;  1LBK A;  1OC9 A;  4KGI A;  4HI7 A;  2MMN A;  4XRD A;  2I4A A;  2CQ9 A;  3GYK A;  1GRX A;  4POK A;  3KCM A;  5IPH A;  1ML6 A;  4G10 A;  3WGE A;  5D8I A;  5IOW A;  1XZO A;  3LEF A;  2L6D A;  2AYT A;  3PIN A;  5D9V A;  1AQX A;  1A0R P;  1U3I A;  3IK7 A;  2PPT A;  19GS A;  5JCG A;  2OE1 A;  4XS4 B;  2C1Y A;  4MZC A;  5GAN D;  3FKF A;  2A2R A;  3HHV A;  2WUL A;  2YPM A;  4KUN A;  4HEA 2;  4LL1 B;  4K2D A;  3IPZ A;  2B3S A;  5ID2 B;  4EC0 A;  2L5O A;  5HFK A;  3DVX A;  4FYB A;  4ECI A;  5AIX A;  3IA1 A;  2KHP A;  4TKY A;  5IMF A;  5AIV A;  4ZBB A;  2LRC A;  1M9A A;  1TRU A;  4J57 E;  4K9Z A;  2EC4 A;  2RUE A;  5IMC A;  3LXT A;  3HVS A;  2CVD A;  2PUK C;  4KAE A;  5IO2 A;  3UL3 A;  1K0D A;  1XOA A;  3RPN A;  1MEK A;  2LKU A;  5E4W A;  5DJL A;  3AY8 A;  4OFN A;  5EY6 A;  2MMZ A;  1JZD A;  1NHY A;  4IHU A;  1PRX A;  2K8S A;  3DD3 A;  1XWC A;  3LYP A;  3GA4 A;  2LJK A;  1K3L A;  5ECM B;  1KTE A;  1U6T A;  3KMO A;  4WF4 A;  1ZMA A;  1T4Z A;  1XW6 A;  3RAZ A;  3KEB A;  1WJK A;  3DXB A;  3TRX A;  1TOF A;  4NV2 A;  1W4V A;  2O87 A;  3L9S A;  3DEX A;  3GST A;  2PVO C;  1BJX A;  3FZ9 A;  4WKW A;  5G30 A;  3US3 A;  4HQZ A;  1MDK A;  2NBS A;  3F63 A;  4MF5 A;  1TJD A;  1Z3E A;  1FAA A;  3KH9 A;  1AQV A;  2VCZ A;  4J2F A;  2HFD A;  4YQU A;  3P2A A;  5A4U A;  3M8N A;  2LQO A;  3VK9 A;  1GP1 A;  3IR4 A;  2VLT A;  2YP6 A;  2GVP A;  2GTU A;  1GTB A;  3EIN A;  3D5J A;  3TGZ A;  2EIQ A;  1A2L A;  3SBC A;  5IPG A;  4RUV A;  1ZYQ B;  1QMV A;  2F3M A;  3LGC A;  1ERV A;  1QK8 A;  3VI5 A;  3ERW A;  2NTO A;  5HFG A;  1YY7 A;  2TRC P;  2JSY A;  3HZ8 A;  1PX7 A;  1OE8 A;  1OC9 B;  4BL7 A;  3IXR A;  1TRS A;  1PN9 A;  1YEX A;  1NHO A;  5HQP A;  1NSW A;  1F3B A;  2FWG A;  4Z7X A;  5ECK B;  2VL9 A;  3ZZX A;  4IW9 A;  1JHB A;  2HRN A;  4I97 A;  2C80 A;  2RM5 A;  5ELG A;  3KP9 A;  4JR4 A;  5LNK e;  1FG4 A;  2O8V B;  4PGT A;  4MJE A;  5ELA A;  3CSI A;  3F6F A;  1K3O A;  3KGK A;  3HKR A;  2R3X A;  5ABR A;  4MPG A;  3ZL5 A;  1M7T A;  2FGX A;  4AGS A;  3OR5 A;  2H74 A;  2LTK A;  4GWR A;  4BPY A;  1V98 A;  4OO4 A;  3NIV A;  2HSM A;  6GSX A;  5J5N A;  2PBJ A;  2QC7 A;  2HRF A;  2IPA A;  5ECL B;  1EWX A;  3HY2 A;  2VLV A;  4WR5 A;  1YJ6 A;  4KW6 A;  4TR0 A;  4RQR A;  1LU4 A;  1UVZ A;  3G7J A;  4ULX A;  3TDG A;  2IL3 A;  1X0R A;  2M72 A;  3HJO A;  4HU9 A;  4MCU A;  5E59 A;  2IME A;  4NHW A;  4F03 A;  4JZQ A;  1GLQ A;  2AUV A;  3ZVJ D;  1X5E A;  4KSO A;  2IJY A;  2VUP A;  4N11 A;  3FK8 A;  2RM6 A;  4F2I A;  2VL3 A;  3R2Q A;  4ML1 A;  3L9V A;  2HRA A;  2VM2 A;  2YWO A;  2HSN B;  4PQH A;  2G2Q A;  1GSF A;  2DJK A;  1XBS A;  5IMV A;  4X0X A;  5CAX A;  1YF0 A;  5ECI B;  1VRS D;  3KD0 A;  3TRQ A;  4YAP A;  2IMF A;  2DBC A;  4DSS A;  3LWA A;  4MH3 A;  5EL8 A;  1PKZ A;  2KOK A;  1TRV A;  2NPB A;  4NPB A;  2CVB A;  4YQV A;  1B8X A;  3F4R A;  3GH9 A;  4GST A;  4MAB A;  4FIW A;  3F3Q A;  2YNX A;  2XBI A;  5FHI A;  3D4T A;  1PX6 A;  5AN1 A;  3DVW A;  1SK0 A;  4MZW A;  2YAN A;  4JU5 A;  2IIY A;  4TR1 A;  9GSS A;  11GS A;  1A24 A;  3N5O A;  1JZR A;  3WYW A;  1ACV A;  4HZ2 A;  4ECC A;  3IAS 2;  1SD8 A;  2IMI A;  3PGT A;  2HQT A;  2LNT A;  1GTI A;  2DC5 A;  1PD2 1;  4O92 A;  4QL7 A;  3WT2 A;  1FOV A;  4PNF A;  1ERT A;  1GLP A;  1A8Y A;  3O3T A;  1A0F A;  2MBS A;  1FW1 A;  4Q5Q A;  3NOF A;  4HU7 A;  3LYK A;  2GQL A;  1FB6 A;  3FZ5 A;  3APO A;  1IYH A;  2JZT A;  2ZCT A;  2ES7 A;  4XS4 A;  1O7U A;  5L71 A;  2GSR A;  1TK0 B;  3GIX A;  4BL7 B;  5IO0 A;  1U88 A;  2TRX A;  1XOB A;  4GLT A;  1WP0 A;  3UBL A;  3IDV A;  2OKA A;  3CYN A;  5D73 A;  4DEJ A;  1AUC A;  4NV5 A;  1X9S B;  4KA0 A;  2OJL A;  4WXT A;  1WMJ A;  2VCV A;  1X5C A;  5CRE A;  1XW5 A;  2LRN A;  4IN0 A;  2GQM A;  1Z6M A;  4OCF A;  5JWO B;  3F6D A;  2O89 A;  3ZIJ A;  2YV9 A;  3FR9 A;  3TB2 A;  3V1W A;  3RBT A;  4MK3 A;  3BCI A;  5CRH A;  1O6J A;  4QQ7 A;  1ZL9 A;  4ID0 A;  2CX3 A;  1ABA A;  1EEM A;  2YOI A;  2HSM B;  2C4J A;  3ED3 A;  3ZLP A;  3HA9 A;  1SKW B;  5A4W A;  3I43 A;  4CHS A;  4EDY A;  2FY6 A;  3MDK A;  3TJF A;  1CQG A;  4Q5R A;  4GQC A;  4F9Z A;  2BTO T;  1O85 A;  2XPD A;  1TKD B;  3FRC A;  5H5S A;  3ZFB A;  4WET A;  3ZYW A;  2P5R A;  2C0F A;  1WWJ A;  1T8E B;  1BX9 A;  5B8A A;  4TRX A;  3NZN A;  5CRD A;  3QAG A;  18GS A;  1Y25 A;  4N0Z A;  3O6T A;  1XXU A;  5CRG A;  5J3R A;  2VL2 C;  4ECB A;  2CA8 A;  3VUR A;  1FVJ A;  13GS A;  4DSS B;  3CTG A;  3ERF A;  1N8J A;  4AJ7 A;  2CZ2 A;  2LJA A;  1I5G A;  2KLX A;  4NMU A;  4POB A;  1Z6N A;  2HXK A;  2OAC A;  1PGT A;  4OFT A;  3EVI A;  4EUY A;  2UZ8 A;  3A2W A;  4V2M A;  2R5G A;  2FA4 A;  4PUA A;  1O73 A;  3KM6 A;  4MPF A;  1F9M A;  2O85 A;  2A2S A;  3UIW A;  5HR1 A;  5IMZ A;  2C8U A;  3LG6 A;  3QMX A;  4TR1 B;  1R4W A;  3EU3 A;  2H1A A;  2IMD A;  3SWL A;  3CBU A;  3EUR A;  3W8J A;  3M0F A;  3TJK A;  3MAK A;  4IKH A;  2L6C A;  3TOT A;  1I9D A;  1GTA A;  2C0E A;  2MZC A;  2L57 A;  1AQW A;  5D9W A;  5KN1 A;  4GF0 A;  2CV4 A;  3QFB C;  2N5F A;  2RII A;  3UVH A;  4TOP A;  2VD1 A;  5CNW A;  1QFN A;  1A2J A;  2P5Q A;  1EV4 A;  3M9K A;  1O8W A;  3G7Y A;  3C73 A;  1JLV A;  1T00 A;  3KIJ A;  2H0G A;  4XIH A;  1GL8 A;  3VPT A;  1BAY A;  2YJH A;  4LL4 B;  1XPV A;  3DWV A;  1USB A;  1K0N A;  2FCH A;  5COH A;  2RLI A;  3KTL A;  4MH2 A;  4HOJ A;  2OE3 A;  3D0Z A;  2JSZ A;  2WS2 A;  1J0F A;  1J08 A;  1SL2 B;  1N2A A;  4ZL9 A;  4X43 A;  3TUE A;  3HDC A;  2FLS A;  2P0G A;  2B5X A;  2AV4 A;  5INY A;  3M1G A;  3HVV A;  5ECN B;  3GMF A;  3GX8 A;  1BG5 A;  1M2B A;  5J4U A;  4IQ1 A;  3PH9 A;  2AJQ B;  2A4V A;  3GFK A;  4EDZ A;  3C7M A;  1X9M B;  2JZR A;  2D2Z A;  4XRA A;  3L0H A;  4IJI A;  2YZH A;  3ZIT A;  3CRU A;  2DIY A;  2EIR A;  1CQH A;  3GUS A;  1SD9 A;  2I81 A;  16GS A;  3KJY A;  3HVX A;  3A3T A;  2JL4 A;  1JZW A;  5J41 A;  3C1R A;  3QDN A;  2J9H A;  3VWU A;  2AAW A;  3WGX A;  2FWE A;  1B48 A;  1AAZ A;  1OYJ A;  3CRT A;  4EVM A;  5D9T A;  3TKS C;  5ECR B;  3J7Y b;  2CVK A;  5G5E A;  4GTU A;  2Z9S A;  2N5A A;  4G0L A;  5BMU A;  1UC7 A;  3GTU A;  1HD2 A;  2CT6 A;  3QR6 A;  3GV1 A;  5LD0 A;  2F8F A;  2E0Q A;  1E2Y A;  4L0U A;  2WJU A;  1VF1 A;  5IQY A;  1Q4J A;  2I1U A;  2C0D A;  1DUG A;  3P90 A;  4ZB8 A;  2AB6 A;  3BJ5 A;  4K0G A;  3CXG A;  3DML A;  4RI7 A;  2JAC A;  2PWJ A;  1TU8 A;  3APQ A;  1GUH A;  4MLY A;  2YV7 A;  1OAZ A;  1PQN A;  3GNJ A;  4N10 A;  2LST A;  3APS A;  3ZVJ A;  4Q5F A;  1B9X C;  4ML6 A;  1SJZ A;  5JWQ B;  4GRF A;  2FHE A;  2FWF A;  2DML A;  1FVK A;  3F3R A;  1GUM A;  5IM9 A;  2JZS A;  2L5L A;  2DIZ A;  1AXD A;  4WBJ A;  3FHK A;  2K9F A;  2LV3 A;  3IHQ A;  3W8S A;  1F6M C;  4LMW A;  20GS A;  2VL2 A;  3WGD A;  3F8U A;  4PX1 A;  2V2G A;  5D96 A;  2KUC A;  3FR6 A;  1UN2 A;  3UEM A;  4TN8 A;  1YDK A;  3GSS A;  3GX0 A;  5CYY A;  3PPU A;  1R5A A;  4KDU A;  1THX A;  2H30 A;  2H0H A;  3DIE A;  3ZML A;  1AW9 A;  1K0M A;  5EVO A;  4EF0 A;  3DRN A;  1TW9 A;  2L59 A;  2V6O A;  1V2A A;  4EKZ A;  4POL A;  2VIM A;  3QCP A;  3LXZ A;  4ZL7 A;  4PXO A;  2V32 A;  3QAV A;  1TU7 A;  4RI6 A;  1FHE A;  4ZBD A;  2LS5 A;  3UOM A;  3GRX A;  4MJB A;  4ACS A;  1SKS B;  4USS A;  6GSV A;  4JBB A;  5B6N A;  2H0I A;  4K6X A;  2HRK A;  2I3Y A;  3VWV A;  22GS A;  3H4K A;  4E8H A;  4PQI A;  3F0I A;  1EGR A;  2LEG A;  3I9V 2;  2E7P A;  2XC2 A;  1B4P A;  4HDE A;  2B5Y A;  4MA9 A;  1PL2 A;  1PA3 A;  2H19 A;  2WDU A;  2HE3 A;  2XHF A;  3RHC A;  1GSD A;  2H1B A;  5IOX A;  3RPP A;  4X1U A;  1K0O A;  4GSS A;  3P8W A;  4OD7 A;  1T1V A;  1DBY A;  1SL0 B;  4P3Y B;  4JED A;  5GAP D;  2R2J A;  3LSZ A;  4HJ2 A;  1B9Y C;  4ZIL A;  1VF3 A;  1GSY A;  1URM A;  1GTU A;  3GTU B;  5JWR B;  2OE0 A;  4FH8 A;  2VCW A;  5GST A;  2B5E A;  1YF1 A;  3R3E A;  1EV9 A;  3E9J B;  1OE7 A;  4V2N A;  1YZX A;  1TTZ A;  3EC3 A;  1BED A;  1WOU A;  4AJ8 A;  3MWH A;  3VLN A;  1OVN A;  2DJ2 A;  5G1K A;  3CSJ A;  4V1A p;  1TRW A;  1GSS A;  1S3A A;  3I6A A;  2GZZ A;  3IE3 A;  3L78 A;  1SYX A;  4L0W A;  1EP7 A;  3TKS A;  4DSQ A;  2G0F A;  2X99 A;  2GSS A;  1Z7R A;  1TDI A;  3UMA A;  3DKS A;  2GST A;  4NAX A;  2R4V A;  3VWW A;  2KP2 A;  3HYP A;  3UJ1 A;  2IFQ A;  1R7H A;  1TI3 A;  1OC8 A;  2BJX A;  1SL1 B;  4FYU A;  2LQQ A;  1ILO A;  2OAD A;  2BMX A;  2GQK A;  2GGT A;  3IOS A;  1XIY A;  2IN3 A;  1E6B A;  2H01 A;  3TKS E;  1HQO A;  5IIZ A;  4F0C A;  5F07 A;  1WPI A;  3HJP A;  1M0U A;  4TR3 A;  4EXJ A;  1O8X A;  4GQF A;  4K7I A;  3EMP A;  4BVX B;  3GL5 A;  2IMK A;  1A2M A;  4OWY A;  5H5Q A;  4KDY A;  4TXO A;  1F2E A;  1GSE A;  1AIU A;  1V58 A;  1K0C A;  4I2U A;  2HZF A;  1GSQ A;  4K1F A;  2FWH A;  2H71 A;  4LA1 A;  3TJB A;  4G9H A;  5GSS A;  3Q74 A;  2JU5 A;  3UBK A;  4NWY A;  5ECO B;  1XVQ A;  2R6K A;  3JCM L;  3GL3 A;  2DLX A;  5B7C A;  3EE2 A;  1HYU A;  3GH6 A;  4KSM A;  4XTS A;  5HR0 A;  5G31 A;  2OBI A;  4DVC A;  2HI7 A;  5KN3 A;  4V2L A;  2VCT A;  1ST9 A;  3D22 A;  1A8L A;  1F37 A;  4MP4 A;  1XWA A;  1R5P A;  3IRA A;  4PUF C;  1M2A A;  1V40 A;  3HZ4 A;  1VF2 A;  2HRK B;  1PL1 A;  2JAD A;  5D9X A;  3Q19 A;  1T4Y A;  4L5L A;  3BOA A;  2DJ3 A;  6GST A;  3UAP A;  5F05 A;  1ZGN A;  2MBT A;  4OFM A;  2H1G A;  4TW5 A;  3K8N A;  1AC1 A;  1F3A A;  3KZQ A;  4QL9 A;  4ZIJ A;  3KXO A;  1GUL A;  3RDW A;  1WIK A;  4K0N A;  3GN3 A;  1JLW A;  5DCH A;  4IP1 A;  4GSN A;  1FO5 A;  1HNB A;  1EZK A;  1H4O A;  2ZUP A;  4NXI A;  3EMX A;  1IYI A;  4KH7 A;  4ZL8 A;  5ECS A;  5G5F A;  1S3D A;  4ECJ A;  3TJJ A;  5IMD A;  5CRW A;  2NVL A;  1UA5 A;  3FZ4 A;  1GWC A;  3Q6O A;  1EEJ A;  1J9B A;  4GXZ A;  3H8Q A;  3IK9 A;  2M80 A;  2EIO A;  4WEY A;  4XS6 A;  4OO5 A;  6GSU A;  6GSS A;  2GS3 A;  1KNG A;  2VOC A;  3FW2 A;  4H86 A;  2GDR A;  2TIR A;  1R26 A;  3GKX A;  1XCC A;  2F8A A;  3VFI A;  2YWI A;  3G9B A;  4K7O A;  1WRY A;  1FB0 A;  3LOR A;  2WB9 A;  2IFQ B;  5KN0 A;  5B6M A;  2H6Y A;  4FQU A;  5DAL A;  5DQY A;  2HLS A;  1YQ1 A;  1MD4 A;  2H6X A;  3FZA A;  5ECP B;  3TKP A;  2X8C A;  3CMI A;  2H66 A;  3FEU A;  5DCG A;  4ZB6 A;  4CDO A;  1Y6E A;  5DQS A;  3FY7 A;  1G6Y A;  1XFL A;  4EL1 A;  5C00 A;  1SU9 A;  3C8E A;  2FUG 2;  1MD3 A;  1EOH A;  2E2M A;  1BYE A;  2C3Q A;  3TCO A;  1SKR B;  4TXO B;  1W89 A;  4OMV A;  2YCD A;  1XVW A;  2IWT A;  1XWK A;  3IC8 A;  5F06 A;  3U6V A;  2H76 A;  1ZZY A;  1Z7P A;  2CAI A;  3ME8 A;  1XWB A;  3F4T A;  1PKW A;  1EOG A;  3KMN A;  2LUS A;  4V1A g;  1YKC A;  1K0A A;  2N5B A;  3A2X A;  4K8M A;  4MJA A;  5H5R A;  1M2D A;  3ZIV A;  8GSS A;  1A23 A;  1ERU A;  2ON7 A;  6GSW A;  2FA8 A;  4KF9 A;  2K6V A;  2PMT A;  4RQX A;  1T3B A;  3W6G A;  2C3N A;  3MSZ A;  3D4M A;  1HNC A;  1WE0 A;  4ZB9 A;  4G0K A;  3LJR A;  1SJI A;  1OKT A;  2OA7 A;  2XBQ A;  5CP1 A;  2YZU A;  2WRT A;  1X5D A;  5JCU A;  2GZY A;  1SYR A;  5KN2 A;  5D93 A;  2E2G A;  3GKM A;  4TXV A;  1U87 A;  3WT1 A;  4JRR A;  4IEL A;  4MDC A;  5B8B A;  1VF4 A;  4IQA A;  2L4Q A;  4O32 A;  3GKN A;  2O7K A;  1K3Y A;  3ZTL A;  3A2V A;  3KH7 A;  1QGV A;  3IAM 2;  3RHB A;  1ZOF A;  5DBQ A;  2FNO A;  3QAW A;  2HZE A;  1PSQ A;  4CW9 A;  4G2E A;  1X9W B;  2VM1 A;  3FYG A;  3EWL A;  5F8B A;  2CX4 A;  2H75 A;  2WFC A;  14GS A;  5AIS A;  2PN8 A;  4N0V A;  4YAV A;  2HYX A;  4JR6 A;  2FD3 A;  5G2Z A;  3ZMK A;  3G7I A;  4ZBA A;  2B1L A;  1OKD A;  2GLR A;  4IJ3 A;  1GSU A;  3J7Y k;  1SK2 A;  2I9H A;  1LJR A;  1G0T A;  1QUW A;  1C72 A;  4IP6 A;  2F51 A;  1B4Q A;  4BVX A;  3LQ7 A;  5DAL B;  2K8V A;  4HQS A;  1ZYE A;  2RUF A;  2OBK A;  4EO3 A;  2B6M A;  3EU4 A;  3IC4 A;  4XS1 A;  1NW2 A;  4G0I A;  3DYR A;  1ON4 A;  4IGJ A;  3VPQ A;  1EGO A;  1V57 A;  1H75 A;  2H6Z A;  5HR2 A;  2X8H A;  2C0G A;  4DSR A;  1KBN A;  1K0B A;  5CO3 A;  4XHM A;  1V9W A;  2R37 A;  4G19 A;  3CSH A;  4KDX A;  1HNA A;  3BD2 A;  1GH2 A;  2REM A;  5KEJ A;  4PNG A;  5ECQ B;  4ISD A;  5DVB A;  2ZNM A;  1OC3 A;  1GUK A;  4IBP A;  3S9F A;  4PUR A;  5DAK A;  3KTB A;  4POM A;  3D6I A;  4O5R A;  5C04 A;  4EE0 A;  3ZRD A;  3IV4 A;  3BBY A;  2YWN A;  3GHA A;  2X64 A;  5GZZ B;  1Q98 A;  4F82 A;  2ON5 A;  4OCE A;  2WZ9 A;  3PR8 A;  5FT3 A;  2AHE A;  3VWX A;  3F4S A;  4YH2 A;  2YWM A;  1YEP A;  4BWS A;  1KEB A;  1VGL A;  3QD9 A;  2DJ0 A;  3L9U A;  4ZXG A;  3ME7 A;  4E8E A;  4BVY A;  1BQ7 A;  4KCA A;  2PU9 C;  1YKA A;  2P31 A;  3E0U A;  3M9J A;  7GSS A;  3H93 A;  2PGT A;  3BCK A;  3D21 A;  1S3C A;  5HR3 A;  3F9U A;  4I6X A;  1JFU A;  3ERG A;  4MF6 A;  1SEN A;  3E3E A;  4NHZ A;  3VI7 A;  3P7X A;  1ERW A;  2XPE A;  4HJM A;  3TRP A;  2H72 A;  1QXH A;  3UAR A;  2QSI A;  4WR4 A;  4WF5 A;  2V1M A;  3EYT A;  2HNL A;  2DJJ A;  4HUA A;  4LLR A;  6GSY A;  1RQM A;  3CTF A;  3H79 A;  2YJ7 A;  2K18 A;  2B7J A;  2WCI A;  3FR3 A;  2WGR A;  3UVT A;  4Q5N A;  1M9B A; 
#chains in the Genus database with same CATH topology
 1TI1 A;  4HZ4 A;  2HZE B;  4D73 A;  1TK5 B;  4PHZ C;  3H1N A;  2NDO A;  3C71 A;  5J9B A;  1G6W A;  2C3T A;  4GCI A;  5J40 A;  2DJ1 A;  2VAF A;  3HD5 A;  4JE1 A;  3TKQ A;  1G7O A;  4IS0 A;  3HXS A;  2X8G A;  5F0G A;  1TK8 B;  2VCX A;  1T7P B;  1RW1 A;  1N25 A;  4WBR D;  1S3R A;  4I8B A;  4O7H A;  17GS A;  2H70 A;  5HFI A;  5ENU A;  2MMA A;  3TKR A;  3U5R E;  1RK4 A;  3ZRE A;  1QQ2 A;  2H8L A;  2CZ3 A;  3QFA C;  2V41 A;  2L4C A;  1MDJ A;  2V6K A;  3I69 A;  5A5K A;  3GUR A;  3MNG A;  3A5W A;  3C1S A;  4KE3 A;  1TP9 A;  5ID2 A;  1DE2 A;  3O76 A;  4PQ1 A;  2J23 A;  3TOU A;  2YN1 A;  1MDI A;  1JZO A;  2WW3 A;  3ISO A;  3Q18 A;  1M99 A;  2H1D A;  2LNS A;  4MMM A;  4MZB A;  1G7E A;  3GKK A;  2GZP A;  3HCZ A;  1MTC A;  5DAK B;  5G1L A;  4J56 E;  4PI2 C;  5J4V A;  2F9S A;  4BA7 A;  5EPF A;  3ZFL A;  1XWG A;  5FWG A;  2VO4 A;  4PTS A;  5JCW A;  2HSY A;  2H73 A;  4BWQ A;  4I5Q A;  4KND A;  4IVF A;  2KP1 A;  4YQM A;  1ZCP A;  2GT6 A;  2ALB A;  1GNE A;  2M46 A;  4L5O A;  2QA2 A;  5A34 A;  1SK1 A;  2QKE A;  2GT5 A;  2PER A;  2CAQ A;  5IMA A;  4ILF A;  1PMT A;  3M3M A;  4K7N A;  4AF2 A;  12GS A;  4TR4 A;  2O3E A;  3HJM A;  5J9C A;  1Z5Y E;  2MYG A;  4TVE A;  2LJR A;  1O81 A;  3N9J A;  4BVY B;  4AJ6 A;  3L4N A;  3LFL A;  4LMV A;  1U3A A;  1EP8 A;  1Z9H A;  4XCS A;  4KCE A;  5LCZ A;  5ECH B;  2PVQ A;  1DSB A;  5DJM A;  1SJ6 A;  5AGY A;  3IBH A;  1TXX A;  4MF7 A;  2VLU A;  4L8E A;  4KX4 A;  4FO5 A;  2VCQ A;  2QGV A;  2B1K A;  4FYC A;  4I2T A;  4N30 A;  1DE1 A;  3KP8 A;  1XW9 A;  2B7K A;  2GSQ A;  3QOU A;  3DGQ A;  4F0B A;  5A4V A;  5DDL A;  1GNW A;  3QPM A;  2MMO A;  3WD6 A;  4KB3 A;  4D73 B;  4HS1 A;  2DSA A;  2VD0 A;  2HT9 A;  2LRT A;  5A1N B;  1THO A;  4MJC A;  2HSH A;  10GS A;  1NM3 A;  2DMM A;  3TJG A;  1LBK A;  1OC9 A;  4KGI A;  4HI7 A;  2MMN A;  4XRD A;  2I4A A;  2CQ9 A;  3GYK A;  1GRX A;  4POK A;  3KCM A;  5IPH A;  1ML6 A;  4G10 A;  3WGE A;  5D8I A;  5IOW A;  1XZO A;  3LEF A;  2L6D A;  2AYT A;  3PIN A;  5D9V A;  1AQX A;  1A0R P;  1U3I A;  3IK7 A;  2PPT A;  19GS A;  5JCG A;  2OE1 A;  4XS4 B;  2C1Y A;  4MZC A;  5GAN D;  3FKF A;  2A2R A;  3HHV A;  2WUL A;  2YPM A;  4A5P A;  4KUN A;  4HEA 2;  4LL1 B;  4K2D A;  3IPZ A;  2B3S A;  5ID2 B;  4EC0 A;  2L5O A;  5HFK A;  3DVX A;  4FYB A;  4ECI A;  5AIX A;  3IA1 A;  2KHP A;  4TKY A;  5IMF A;  5AIV A;  4ZBB A;  2LRC A;  1M9A A;  1TRU A;  4J57 E;  4K9Z A;  2WVZ A;  2EC4 A;  2RUE A;  5IMC A;  3LXT A;  3HVS A;  2CVD A;  2PUK C;  4KAE A;  5IO2 A;  4AI6 A;  3UL3 A;  1K0D A;  1XOA A;  3RPN A;  1MEK A;  2HSN A;  2LKU A;  4N3Z A;  5E4W A;  5DJL A;  3AY8 A;  4OFN A;  5EY6 A;  2MMZ A;  1JZD A;  1NHY A;  4IHU A;  1PRX A;  2K8S A;  5A34 B;  3DD3 A;  1XWC A;  3LYP A;  3GA4 A;  2LJK A;  1K3L A;  5ECM B;  1KTE A;  1U6T A;  3KMO A;  4WF4 A;  1ZMA A;  1T4Z A;  1XW6 A;  3RAZ A;  3KEB A;  1WJK A;  3DXB A;  3TRX A;  1TOF A;  3HMJ G;  4NV2 A;  1W4V A;  2O87 A;  3L9S A;  3DEX A;  3GST A;  2PVO C;  1BJX A;  3FZ9 A;  4WKW A;  5G30 A;  3US3 A;  4HQZ A;  1MDK A;  2NBS A;  3F63 A;  4MF5 A;  1TJD A;  1Z3E A;  1FAA A;  3KH9 A;  1AQV A;  2VCZ A;  4J2F A;  2HFD A;  4YQU A;  3P2A A;  5A4U A;  3M8N A;  2LQO A;  3VK9 A;  1GP1 A;  3IR4 A;  2VLT A;  2YP6 A;  2GVP A;  2GTU A;  1GTB A;  3EIN A;  3D5J A;  3TGZ A;  2EIQ A;  1A2L A;  3SBC A;  2X49 A;  5IPG A;  4RUV A;  1ZYQ B;  1QMV A;  2F3M A;  3LGC A;  1ERV A;  1QK8 A;  3VI5 A;  3ERW A;  2NTO A;  5HFG A;  1YY7 A;  2TRC P;  2JSY A;  3HZ8 A;  1PX7 A;  1OE8 A;  1OC9 B;  4BL7 A;  3IXR A;  1TRS A;  1PN9 A;  1YEX A;  1NHO A;  2WW1 A;  5HQP A;  1NSW A;  1F3B A;  2FWG A;  4Z7X A;  5ECK B;  2VL9 A;  3ZZX A;  4IW9 A;  1JHB A;  2HRN A;  4I97 A;  2C80 A;  2X4A A;  2RM5 A;  5ELG A;  3KP9 A;  4JR4 A;  5LNK e;  1FG4 A;  2O8V B;  5A5H A;  4PGT A;  4MJE A;  5ELA A;  3CSI A;  3F6F A;  1K3O A;  3KGK A;  3HKR A;  2R3X A;  5ABR A;  4MPG A;  3ZL5 A;  1M7T A;  2FGX A;  4AGS A;  3OR5 A;  2H74 A;  2LTK A;  4GWR A;  4BPY A;  1V98 A;  4OO4 A;  3NIV A;  2HSM A;  6GSX A;  5J5N A;  2PBJ A;  2QC7 A;  2HRF A;  2IPA A;  5ECL B;  1EWX A;  3HY2 A;  2VLV A;  4WR5 A;  1YJ6 A;  4KW6 A;  4TR0 A;  5KOX A;  4RQR A;  1LU4 A;  1UVZ A;  3G7J A;  4ULX A;  3TDG A;  2IL3 A;  1X0R A;  2M72 A;  3HJO A;  4HU9 A;  4MCU A;  5E59 A;  2IME A;  4NHW A;  4F03 A;  4JZQ A;  1GLQ A;  2AUV A;  3ZVJ D;  1X5E A;  4KSO A;  2IJY A;  2VUP A;  4N11 A;  3FK8 A;  1M3J A;  3EPT A;  2RM6 A;  4F2I A;  2OT3 A;  2VL3 A;  3R2Q A;  4ML1 A;  3L9V A;  2HRA A;  2VM2 A;  2YWO A;  2HSN B;  4PQH A;  2G2Q A;  1GSF A;  2DJK A;  1XBS A;  5BRT A;  5IMV A;  4X0X A;  5CAX A;  1YF0 A;  5ECI B;  1VRS D;  3KD0 A;  3TRQ A;  4YAP A;  2IMF A;  2DBC A;  4DSS A;  3LWA A;  4MH3 A;  5EL8 A;  1PKZ A;  2KOK A;  1TRV A;  2NPB A;  4NPB A;  2CVB A;  4YQV A;  4YKG A;  1B8X A;  3F4R A;  3GH9 A;  3FMW A;  4GST A;  4MAB A;  4FIW A;  3F3Q A;  2YNX A;  2XBI A;  5FHI A;  3D4T A;  1PX6 A;  5AN1 A;  3DVW A;  1SK0 A;  4MZW A;  2YAN A;  4JU5 A;  2IIY A;  4TR1 A;  9GSS A;  11GS A;  1A24 A;  4MNN A;  5A1N A;  3N5O A;  1JZR A;  3WYW A;  4AKG A;  1ACV A;  4HZ2 A;  2A2P A;  4ECC A;  3IAS 2;  1SD8 A;  2IMI A;  3PGT A;  2HQT A;  2LNT A;  4CY6 A;  1GTI A;  2DC5 A;  3A5I A;  1PN0 A;  1PD2 1;  4O92 A;  4QL7 A;  3WT2 A;  1FOV A;  4PNF A;  1ERT A;  4EIQ A;  1GLP A;  1A8Y A;  3O3T A;  1A0F A;  2MBS A;  1FW1 A;  4Q5Q A;  3NOF A;  4HU7 A;  3LYK A;  2GQL A;  1FB6 A;  3FZ5 A;  3APO A;  1IYH A;  2JZT A;  2ZCT A;  2ES7 A;  4XS4 A;  1O7U A;  5L71 A;  2GSR A;  1TK0 B;  3GIX A;  4BL7 B;  5IO0 A;  1U88 A;  2TRX A;  1XOB A;  4GLT A;  1WP0 A;  3UBL A;  3IDV A;  2OKA A;  3CYN A;  5D73 A;  4DEJ A;  1AUC A;  4NV5 A;  1X9S B;  4KA0 A;  2OJL A;  4WXT A;  1WMJ A;  2VCV A;  1X5C A;  5CRE A;  1XW5 A;  2LRN A;  4IN0 A;  2GQM A;  5A5H B;  1Z6M A;  4OCF A;  5JWO B;  3F6D A;  2O89 A;  3ZIJ A;  2YV9 A;  3FR9 A;  3TB2 A;  3V1W A;  3RBT A;  4MK3 A;  3BCI A;  5CRH A;  1O6J A;  4QQ7 A;  1ZL9 A;  4ID0 A;  2CX3 A;  1ABA A;  1EEM A;  2YOI A;  2HSM B;  2C4J A;  3ED3 A;  3ZLP A;  3HA9 A;  1SKW B;  5A4W A;  3I43 A;  4CHS A;  4EDY A;  2FY6 A;  3MDK A;  3TJF A;  1CQG A;  4Q5R A;  4GQC A;  4F9Z A;  1PFO A;  2BTO T;  1O85 A;  2XPD A;  1TKD B;  3FRC A;  5H5S A;  3ZFB A;  4WET A;  1S4B P;  3ZYW A;  2P5R A;  2C0F A;  1WWJ A;  1T8E B;  1BX9 A;  5B8A A;  4TRX A;  3NZN A;  5CRD A;  3QAG A;  18GS A;  1Y25 A;  4N0Z A;  3O6T A;  1XXU A;  5CRG A;  5J3R A;  2VL2 C;  4ECB A;  2CA8 A;  3VUR A;  1FVJ A;  1SVO A;  13GS A;  4DSS B;  3CTG A;  3ERF A;  1N8J A;  4AJ7 A;  2CZ2 A;  2LJA A;  1I5G A;  2KLX A;  4NMU A;  4POB A;  1Z6N A;  2HXK A;  2OAC A;  1PGT A;  4OFT A;  3EVI A;  4EUY A;  2UZ8 A;  3A2W A;  4V2M A;  2R5G A;  2FA4 A;  4PUA A;  1O73 A;  3KM6 A;  4MPF A;  1F9M A;  2O85 A;  1FOH A;  2A2S A;  3UIW A;  5HR1 A;  5IMZ A;  3RGB C;  2C8U A;  3LG6 A;  3QMX A;  4TR1 B;  1BF5 A;  1R4W A;  3EU3 A;  3MIX A;  2H1A A;  2IMD A;  3SWL A;  3CBU A;  3EUR A;  3W8J A;  3M0F A;  3TJK A;  3MAK A;  4IKH A;  2L6C A;  3TOT A;  1I9D A;  1GTA A;  2C0E A;  2MZC A;  2L57 A;  1AQW A;  5D9W A;  5KN1 A;  4GF0 A;  2CV4 A;  3QFB C;  2N5F A;  2RII A;  3UVH A;  4TOP A;  2VD1 A;  5CNW A;  1QFN A;  1A2J A;  2P5Q A;  1EV4 A;  3M9K A;  1O8W A;  3G7Y A;  3C73 A;  1JLV A;  1T00 A;  3KIJ A;  3HVN A;  3CHX C;  2H0G A;  4XIH A;  1GL8 A;  3VPT A;  1BAY A;  2YJH A;  4E68 A;  4LL4 B;  4GDF A;  1XPV A;  4K2X A;  4YKF A;  3DWV A;  1USB A;  1K0N A;  2FCH A;  3IHG A;  5COH A;  2RLI A;  3KTL A;  4MH2 A;  4HOJ A;  2OE3 A;  4X4J A;  3D0Z A;  2JSZ A;  2WS2 A;  1J0F A;  1SVL A;  1J08 A;  1SL2 B;  1N2A A;  1ZYP A;  2R0G A;  4ZL9 A;  4X43 A;  3TUE A;  3HDC A;  2FLS A;  2P0G A;  2B5X A;  2AV4 A;  5INY A;  3M1G A;  3HVV A;  5ECN B;  4EIP A;  3GMF A;  3GX8 A;  1BG5 A;  5J4U A;  1M2B A;  4IQ1 A;  3PH9 A;  2AJQ B;  2A4V A;  2A4H A;  3GFK A;  4EDZ A;  3C7M A;  1ZYN A;  3RFR C;  1X9M B;  2JZR A;  2D2Z A;  4XRA A;  3L0H A;  4IJI A;  2YZH A;  3ZIT A;  3CRU A;  2DIY A;  2EIR A;  1CQH A;  3GUS A;  1SD9 A;  2I81 A;  16GS A;  3KJY A;  3HVX A;  3A3T A;  1YVL A;  2JL4 A;  1JZW A;  5J41 A;  3C1R A;  3QDN A;  2J9H A;  3VWU A;  2AAW A;  3WGX A;  2FWE A;  1B48 A;  1AAZ A;  1OYJ A;  3CRT A;  4EVM A;  5D9T A;  3TKS C;  5ECR B;  3J7Y b;  2CVK A;  5G5E A;  4GTU A;  2Z9S A;  2N5A A;  4G0L A;  5BMU A;  1UC7 A;  3GTU A;  1HD2 A;  2CT6 A;  3QR6 A;  3GV1 A;  5LD0 A;  2F8F A;  2E0Q A;  1E2Y A;  4L0U A;  3CWG A;  2WJU A;  1VF1 A;  5IQY A;  1Q4J A;  4Z2R A;  2I1U A;  2C0D A;  1DUG A;  3P90 A;  4ZB8 A;  2VKZ G;  4FXY P;  5J4Y A;  2AB6 A;  3BJ5 A;  4K0G A;  3CXG A;  3DML A;  4RI7 A;  2JAC A;  2PWJ A;  1TU8 A;  3APQ A;  1GUH A;  4MLY A;  2YV7 A;  1OAZ A;  1PQN A;  3GNJ A;  4N10 A;  2LST A;  3APS A;  3ZVJ A;  4Q5F A;  1B9X C;  4ML6 A;  1SJZ A;  5JWQ B;  4GRF A;  5KOW A;  2FHE A;  2FWF A;  2DML A;  1FVK A;  3F3R A;  1GUM A;  5IM9 A;  2JZS A;  2L5L A;  2DIZ A;  1AXD A;  4WBJ A;  2WW0 A;  3FHK A;  2K9F A;  2LV3 A;  3IHQ A;  2WVX A;  3W8S A;  1F6M C;  4LMW A;  20GS A;  2VL2 A;  3WGD A;  3F8U A;  4PX1 A;  2V2G A;  5D96 A;  2KUC A;  3FR6 A;  1UN2 A;  3UEM A;  4TN8 A;  4Z2T A;  1YDK A;  3GSS A;  3GX0 A;  5CYY A;  3PPU A;  1R5A A;  4KDU A;  1THX A;  2H30 A;  2H0H A;  3DIE A;  3ZML A;  1AW9 A;  1K0M A;  5EVO A;  4EF0 A;  3DRN A;  1TW9 A;  2L59 A;  2V6O A;  1V2A A;  4EKZ A;  4POL A;  2VIM A;  3QCP A;  3LXZ A;  2DKI A;  4ZL7 A;  4PXO A;  2V32 A;  3QAV A;  1TU7 A;  4RI6 A;  1FHE A;  4ZBD A;  2LS5 A;  4Z2U A;  3UOM A;  3GRX A;  4MJB A;  4ACS A;  1SKS B;  4USS A;  6GSV A;  4JBB A;  5B6N A;  2H0I A;  4K6X A;  2HRK A;  2I3Y A;  3VWV A;  22GS A;  3H4K A;  5J47 A;  4E8H A;  4PQI A;  3F0I A;  1EGR A;  2LEG A;  3I9V 2;  2E7P A;  2XC2 A;  1B4P A;  4HDE A;  2B5Y A;  4MA9 A;  1PL2 A;  1PA3 A;  2H19 A;  2WDU A;  2HE3 A;  2XHF A;  3RHC A;  1GSD A;  2H1B A;  5IOX A;  3RPP A;  4X1U A;  1K0O A;  4GSS A;  3P8W A;  4OD7 A;  4ICY A;  1T1V A;  1DBY A;  1SL0 B;  4P3Y B;  2WZS A;  4JED A;  5GAP D;  2R2J A;  3LSZ A;  4HJ2 A;  1B9Y C;  4ZIL A;  1VF3 A;  1GSY A;  1URM A;  1GTU A;  5BMU B;  2WW2 A;  3GTU B;  5JWR B;  2OE0 A;  4FH8 A;  2VCW A;  5GST A;  2B5E A;  1YF1 A;  3R3E A;  1EV9 A;  3E9J B;  1OE7 A;  4V2N A;  1YZX A;  1TTZ A;  3EC3 A;  1BED A;  1WOU A;  4AJ8 A;  3MWH A;  3VLN A;  1OVN A;  2DJ2 A;  5G1K A;  3CSJ A;  4V1A p;  1TRW A;  1GSS A;  1S3A A;  4CY8 A;  3I6A A;  2GZZ A;  4O5U A;  3IE3 A;  3L78 A;  1SYX A;  4L0W A;  1EP7 A;  3TKS A;  4DSQ A;  2G0F A;  2X99 A;  2GSS A;  1Z7R A;  1TDI A;  3UMA A;  3DKS A;  2GST A;  4NAX A;  2R4V A;  3VWW A;  2KP2 A;  3HYP A;  3UJ1 A;  2IFQ A;  1R7H A;  1TI3 A;  1OC8 A;  2BJX A;  1SL1 B;  4FYU A;  2LQQ A;  1ILO A;  2O5V A;  2OAD A;  3TU3 B;  2BMX A;  3CQF A;  2GQK A;  2GGT A;  3IOS A;  1XIY A;  2WVX B;  2IN3 A;  1E6B A;  2H01 A;  3TKS E;  1HQO A;  5IIZ A;  4F0C A;  5F07 A;  4W66 A;  1WPI A;  3HJP A;  1M0U A;  4TR3 A;  4EXJ A;  1I1I P;  1O8X A;  4GQF A;  4K7I A;  3EMP A;  4BVX B;  3GL5 A;  2IMK A;  1A2M A;  4OWY A;  5H5Q A;  4KDY A;  4TXO A;  1F2E A;  1GSE A;  1AIU A;  1V58 A;  1K0C A;  4I2U A;  2HZF A;  1GSQ A;  4K1F A;  2FWH A;  2H71 A;  4LA1 A;  2UV8 G;  3TJB A;  4G9H A;  5GSS A;  3Q74 A;  2JU5 A;  3UBK A;  4NWY A;  5ECO B;  1XVQ A;  2R6K A;  3JCM L;  3GL3 A;  2DLX A;  5B7C A;  3EE2 A;  1HYU A;  3GH6 A;  4KSM A;  4XTS A;  5HR0 A;  5G31 A;  2OBI A;  4DVC A;  2HI7 A;  5KN3 A;  4V2L A;  2VCT A;  4ZB7 A;  1ST9 A;  3D22 A;  1A8L A;  1F37 A;  4MP4 A;  1XWA A;  1R5P A;  3IRA A;  4PUF C;  1M2A A;  1V40 A;  3HZ4 A;  1VF2 A;  2HRK B;  1PL1 A;  2JAD A;  5D9X A;  3Q19 A;  1T4Y A;  4L5L A;  3BOA A;  2DJ3 A;  6GST A;  3UAP A;  5F05 A;  1ZGN A;  2MBT A;  4OFM A;  2H1G A;  4TW5 A;  3K8N A;  1AC1 A;  1F3A A;  3KZQ A;  4QL9 A;  4ZIJ A;  3KXO A;  1GUL A;  3RDW A;  2EFE A;  1WIK A;  4K0N A;  3GN3 A;  1JLW A;  5DCH A;  4IP1 A;  4GSN A;  1FO5 A;  1HNB A;  1EZK A;  1H4O A;  2ZUP A;  4NXI A;  3EMX A;  1IYI A;  4KH7 A;  4ZL8 A;  5ECS A;  5G5F A;  1S3D A;  4ECJ A;  3TJJ A;  5IMD A;  5CRW A;  2NVL A;  4QMK A;  1UA5 A;  3FZ4 A;  1GWC A;  3Q6O A;  1EEJ A;  1J9B A;  4GXZ A;  3H8Q A;  3IK9 A;  4AKX B;  2M80 A;  2EIO A;  4WEY A;  4XS6 A;  4OO5 A;  6GSU A;  6GSS A;  2GS3 A;  1KNG A;  2VOC A;  3FW2 A;  4H86 A;  4HSC X;  2GDR A;  2TIR A;  1R26 A;  3GKX A;  2R0C A;  1XCC A;  2F8A A;  3VFI A;  2YWI A;  3G9B A;  4K7O A;  1WRY A;  1FB0 A;  2DKH A;  3LOR A;  2WB9 A;  2IFQ B;  2R0P A;  5KN0 A;  5B6M A;  2H6Y A;  4FQU A;  2EFD A;  5DAL A;  5DQY A;  2HLS A;  1YQ1 A;  1MD4 A;  2H6X A;  3FZA A;  5ECP B;  3TKP A;  2X8C A;  3CMI A;  2H66 A;  3FEU A;  5DCG A;  4ZB6 A;  4CDO A;  1Y6E A;  4K5R A;  5DQS A;  3FY7 A;  1G6Y A;  1XFL A;  4EL1 A;  5C00 A;  1SU9 A;  3C8E A;  1BG1 A;  2FUG 2;  1MD3 A;  1EOH A;  2E2M A;  1BYE A;  2C3Q A;  3TCO A;  1SKR B;  4TXO B;  1W89 A;  4OMV A;  2YCD A;  1XVW A;  2IWT A;  1XG8 A;  1XWK A;  3IC8 A;  5F06 A;  3U6V A;  2H76 A;  1ZZY A;  1Z7P A;  2CAI A;  3ME8 A;  1XWB A;  3F4T A;  1PKW A;  1EOG A;  3KMN A;  2LUS A;  4V1A g;  1YKC A;  1K0A A;  2N5B A;  3A2X A;  4K8M A;  4MJA A;  5H5R A;  1M2D A;  3ZIV A;  8GSS A;  1A23 A;  1ERU A;  2ON7 A;  6GSW A;  2FA8 A;  4KF9 A;  2K6V A;  2PMT A;  4RQX A;  1T3B A;  3W6G A;  2C3N A;  3MSZ A;  3D4M A;  1HNC A;  1WE0 A;  4ZB9 A;  4G0K A;  4BIK A;  3LJR A;  1SJI A;  1OKT A;  2OA7 A;  2XBQ A;  5CP1 A;  2YZU A;  2WRT A;  1X5D A;  5JCU A;  2GZY A;  1SYR A;  4O5Q A;  5KN2 A;  5D93 A;  2E2G A;  3GKM A;  4TXV A;  1U87 A;  3WT1 A;  4JRR A;  4IEL A;  4MDC A;  5B8B A;  1VF4 A;  4IQA A;  2L4Q A;  4O32 A;  3GKN A;  2O7K A;  4K5S A;  1K3Y A;  3ZTL A;  3A2V A;  3KH7 A;  1QGV A;  3IAM 2;  3RHB A;  1ZOF A;  5DBQ A;  2FNO A;  3QAW A;  2HZE A;  1PSQ A;  4CW9 A;  4G2E A;  1X9W B;  2VM1 A;  3FYG A;  3EWL A;  5F8B A;  2CX4 A;  2H75 A;  1TXU A;  2WFC A;  14GS A;  5AIS A;  2PN8 A;  4N0V A;  3MYD A;  4YAV A;  2HYX A;  4JR6 A;  2FD3 A;  5G2Z A;  3ZMK A;  3G7I A;  4ZBA A;  2B1L A;  1OKD A;  2GLR A;  4IJ3 A;  1GSU A;  3J7Y k;  1SK2 A;  2I9H A;  1LJR A;  1G0T A;  1QUW A;  1C72 A;  4IP6 A;  2F51 A;  1B4Q A;  4BVX A;  3LQ7 A;  5DAL B;  2K8V A;  3LW9 A;  2O36 A;  4HQS A;  1ZYE A;  2RUF A;  2OBK A;  4EO3 A;  2B6M A;  4AKH A;  3EU4 A;  3IC4 A;  4XS1 A;  1NW2 A;  4G0I A;  4G01 A;  3DYR A;  1ON4 A;  4IGJ A;  3VPQ A;  1EGO A;  1V57 A;  1H75 A;  2H6Z A;  5HR2 A;  1Y1U A;  2X8H A;  2C0G A;  4DSR A;  1KBN A;  1K0B A;  5CO3 A;  4XHM A;  1V9W A;  2R37 A;  4G19 A;  3CSH A;  4KDX A;  1HNA A;  3BD2 A;  1GH2 A;  2REM A;  5KEJ A;  4PNG A;  5ECQ B;  4ISD A;  5DVB A;  2ZNM A;  1SVM A;  1OC3 A;  1GUK A;  4IBP A;  3S9F A;  4PUR A;  5DAK A;  3KTB A;  4POM A;  3D6I A;  2WVY A;  4O5R A;  5C04 A;  4EE0 A;  3ZRD A;  3IV4 A;  3BBY A;  2YWN A;  3GHA A;  2X64 A;  5GZZ B;  1Q98 A;  4F82 A;  2ON5 A;  4OCE A;  2H1L A;  2WZ9 A;  3PR8 A;  5FT3 A;  2AHE A;  3VWX A;  3F4S A;  4YH2 A;  2YWM A;  1M3I A;  1YEP A;  4BWS A;  1KEB A;  2QA1 A;  1VGL A;  3QD9 A;  2DJ0 A;  4PI0 C;  3L9U A;  4ZXG A;  3ME7 A;  4E8E A;  4BVY A;  1BQ7 A;  4KCA A;  1YEW C;  2PU9 C;  1YKA A;  2P31 A;  3E0U A;  3M9J A;  7GSS A;  3H93 A;  2PGT A;  3BCK A;  3D21 A;  1S3C A;  5HR3 A;  3F9U A;  4I6X A;  2EFC A;  1JFU A;  3ERG A;  4MF6 A;  1SEN A;  3E3E A;  4NHZ A;  3VI7 A;  3P7X A;  1ERW A;  2XPE A;  4HJM A;  3TRP A;  2H72 A;  1QXH A;  3UAR A;  2QSI A;  4WR4 A;  4WF5 A;  2V1M A;  3EYT A;  2HNL A;  2DJJ A;  4HUA A;  2EFH A;  4LLR A;  6GSY A;  1RQM A;  3CTF A;  4AKI A;  3H79 A;  2YJ7 A;  2K18 A;  2B7J A;  2WCI A;  3FR3 A;  2WGR A;  3UVT A;  4Q5N A;  1M9B A; 
#chains in the Genus database with same CATH homology
 1TI1 A;  4HZ4 A;  2HZE B;  4D73 A;  1TK5 B;  3H1N A;  2NDO A;  3C71 A;  5J9B A;  1G6W A;  2C3T A;  4GCI A;  5J40 A;  2DJ1 A;  2VAF A;  3HD5 A;  4JE1 A;  3TKQ A;  1G7O A;  4IS0 A;  3HXS A;  2X8G A;  5F0G A;  1TK8 B;  2VCX A;  1T7P B;  1RW1 A;  1N25 A;  4WBR D;  4I8B A;  4O7H A;  17GS A;  2H70 A;  5HFI A;  5ENU A;  2MMA A;  3TKR A;  3U5R E;  1RK4 A;  3ZRE A;  1QQ2 A;  2H8L A;  2CZ3 A;  3QFA C;  2V41 A;  2L4C A;  1MDJ A;  2V6K A;  3I69 A;  5A5K A;  3GUR A;  3MNG A;  3A5W A;  3C1S A;  4KE3 A;  1TP9 A;  5ID2 A;  1DE2 A;  3O76 A;  4PQ1 A;  2J23 A;  3TOU A;  2YN1 A;  1MDI A;  1JZO A;  3ISO A;  3Q18 A;  1M99 A;  2H1D A;  2LNS A;  4MMM A;  4MZB A;  1G7E A;  3GKK A;  2GZP A;  3HCZ A;  1MTC A;  5DAK B;  5G1L A;  4J56 E;  5J4V A;  2F9S A;  4BA7 A;  5EPF A;  3ZFL A;  1XWG A;  5FWG A;  2VO4 A;  4PTS A;  5JCW A;  2HSY A;  2H73 A;  4BWQ A;  4I5Q A;  4KND A;  4IVF A;  2KP1 A;  4YQM A;  1ZCP A;  2GT6 A;  2ALB A;  1GNE A;  2M46 A;  4L5O A;  2QA2 A;  5A34 A;  1SK1 A;  2QKE A;  2GT5 A;  2PER A;  2CAQ A;  5IMA A;  4ILF A;  1PMT A;  3M3M A;  4K7N A;  4AF2 A;  12GS A;  4TR4 A;  3HJM A;  5J9C A;  1Z5Y E;  2MYG A;  4TVE A;  2LJR A;  1O81 A;  3N9J A;  4BVY B;  4AJ6 A;  3L4N A;  3LFL A;  4LMV A;  1U3A A;  1EP8 A;  1Z9H A;  4XCS A;  4KCE A;  5LCZ A;  5ECH B;  2PVQ A;  1DSB A;  5DJM A;  1SJ6 A;  5AGY A;  3IBH A;  1TXX A;  4MF7 A;  2VLU A;  4L8E A;  4KX4 A;  4FO5 A;  2VCQ A;  2QGV A;  2B1K A;  4FYC A;  4I2T A;  4N30 A;  1DE1 A;  3KP8 A;  1XW9 A;  2B7K A;  2GSQ A;  3QOU A;  3DGQ A;  4F0B A;  5A4V A;  5DDL A;  1GNW A;  3QPM A;  2MMO A;  3WD6 A;  4KB3 A;  4D73 B;  4HS1 A;  2DSA A;  2VD0 A;  2HT9 A;  2LRT A;  5A1N B;  1THO A;  4MJC A;  2HSH A;  10GS A;  1NM3 A;  2DMM A;  3TJG A;  1LBK A;  1OC9 A;  4KGI A;  4HI7 A;  2MMN A;  4XRD A;  2I4A A;  2CQ9 A;  3GYK A;  1GRX A;  4POK A;  3KCM A;  5IPH A;  1ML6 A;  4G10 A;  3WGE A;  5D8I A;  5IOW A;  1XZO A;  3LEF A;  2L6D A;  2AYT A;  3PIN A;  5D9V A;  1AQX A;  1A0R P;  1U3I A;  3IK7 A;  2PPT A;  19GS A;  5JCG A;  2OE1 A;  4XS4 B;  2C1Y A;  4MZC A;  5GAN D;  3FKF A;  2A2R A;  3HHV A;  2WUL A;  2YPM A;  4A5P A;  4KUN A;  4HEA 2;  4LL1 B;  4K2D A;  3IPZ A;  2B3S A;  5ID2 B;  4EC0 A;  2L5O A;  5HFK A;  3DVX A;  4FYB A;  4ECI A;  5AIX A;  3IA1 A;  2KHP A;  4TKY A;  5IMF A;  5AIV A;  4ZBB A;  2LRC A;  1M9A A;  1TRU A;  4J57 E;  4K9Z A;  2EC4 A;  2RUE A;  5IMC A;  3LXT A;  3HVS A;  2CVD A;  2PUK C;  4KAE A;  5IO2 A;  4AI6 A;  3UL3 A;  1K0D A;  1XOA A;  3RPN A;  1MEK A;  2HSN A;  2LKU A;  4N3Z A;  5E4W A;  5DJL A;  3AY8 A;  4OFN A;  5EY6 A;  2MMZ A;  1JZD A;  1NHY A;  4IHU A;  1PRX A;  2K8S A;  5A34 B;  3DD3 A;  1XWC A;  3LYP A;  3GA4 A;  2LJK A;  1K3L A;  5ECM B;  1KTE A;  1U6T A;  3KMO A;  4WF4 A;  1ZMA A;  1T4Z A;  1XW6 A;  3RAZ A;  3KEB A;  1WJK A;  3DXB A;  3TRX A;  1TOF A;  3HMJ G;  4NV2 A;  1W4V A;  2O87 A;  3L9S A;  3DEX A;  3GST A;  2PVO C;  1BJX A;  3FZ9 A;  4WKW A;  5G30 A;  3US3 A;  4HQZ A;  1MDK A;  2NBS A;  3F63 A;  4MF5 A;  1TJD A;  1Z3E A;  1FAA A;  3KH9 A;  1AQV A;  2VCZ A;  4J2F A;  2HFD A;  4YQU A;  3P2A A;  5A4U A;  3M8N A;  2LQO A;  3VK9 A;  1GP1 A;  3IR4 A;  2VLT A;  2YP6 A;  2GVP A;  2GTU A;  1GTB A;  3EIN A;  3D5J A;  3TGZ A;  2EIQ A;  1A2L A;  3SBC A;  2X49 A;  5IPG A;  4RUV A;  1ZYQ B;  1QMV A;  2F3M A;  3LGC A;  1ERV A;  1QK8 A;  3VI5 A;  3ERW A;  2NTO A;  5HFG A;  1YY7 A;  2TRC P;  2JSY A;  3HZ8 A;  1PX7 A;  1OE8 A;  1OC9 B;  4BL7 A;  3IXR A;  1TRS A;  1PN9 A;  1YEX A;  1NHO A;  5HQP A;  1NSW A;  1F3B A;  2FWG A;  4Z7X A;  5ECK B;  2VL9 A;  3ZZX A;  4IW9 A;  1JHB A;  2HRN A;  4I97 A;  2C80 A;  2X4A A;  2RM5 A;  5ELG A;  3KP9 A;  4JR4 A;  5LNK e;  1FG4 A;  2O8V B;  5A5H A;  4PGT A;  4MJE A;  5ELA A;  3CSI A;  3F6F A;  1K3O A;  3KGK A;  3HKR A;  2R3X A;  5ABR A;  4MPG A;  3ZL5 A;  1M7T A;  2FGX A;  4AGS A;  3OR5 A;  2H74 A;  2LTK A;  4GWR A;  4BPY A;  1V98 A;  4OO4 A;  3NIV A;  2HSM A;  6GSX A;  5J5N A;  2PBJ A;  2QC7 A;  2HRF A;  2IPA A;  5ECL B;  1EWX A;  3HY2 A;  2VLV A;  4WR5 A;  1YJ6 A;  4KW6 A;  4TR0 A;  5KOX A;  4RQR A;  1LU4 A;  1UVZ A;  3G7J A;  4ULX A;  3TDG A;  2IL3 A;  1X0R A;  2M72 A;  3HJO A;  4HU9 A;  4MCU A;  5E59 A;  2IME A;  4NHW A;  4F03 A;  4JZQ A;  1GLQ A;  2AUV A;  3ZVJ D;  1X5E A;  4KSO A;  2IJY A;  2VUP A;  4N11 A;  3FK8 A;  3EPT A;  2RM6 A;  4F2I A;  2OT3 A;  2VL3 A;  3R2Q A;  4ML1 A;  3L9V A;  2HRA A;  2VM2 A;  2YWO A;  2HSN B;  4PQH A;  2G2Q A;  1GSF A;  2DJK A;  1XBS A;  5BRT A;  5IMV A;  4X0X A;  5CAX A;  1YF0 A;  5ECI B;  1VRS D;  3KD0 A;  3TRQ A;  4YAP A;  2IMF A;  2DBC A;  4DSS A;  3LWA A;  4MH3 A;  5EL8 A;  1PKZ A;  2KOK A;  1TRV A;  2NPB A;  4NPB A;  2CVB A;  4YQV A;  4YKG A;  1B8X A;  3F4R A;  3GH9 A;  3FMW A;  4GST A;  4MAB A;  4FIW A;  3F3Q A;  2YNX A;  2XBI A;  5FHI A;  3D4T A;  1PX6 A;  5AN1 A;  3DVW A;  1SK0 A;  4MZW A;  2YAN A;  4JU5 A;  2IIY A;  4TR1 A;  9GSS A;  11GS A;  1A24 A;  4MNN A;  5A1N A;  3N5O A;  1JZR A;  3WYW A;  4AKG A;  1ACV A;  4HZ2 A;  2A2P A;  4ECC A;  3IAS 2;  1SD8 A;  2IMI A;  3PGT A;  2HQT A;  2LNT A;  4CY6 A;  1GTI A;  2DC5 A;  3A5I A;  1PN0 A;  1PD2 1;  4O92 A;  4QL7 A;  3WT2 A;  1FOV A;  4PNF A;  1ERT A;  4EIQ A;  1GLP A;  1A8Y A;  3O3T A;  1A0F A;  2MBS A;  1FW1 A;  4Q5Q A;  3NOF A;  4HU7 A;  3LYK A;  2GQL A;  1FB6 A;  3FZ5 A;  3APO A;  1IYH A;  2JZT A;  2ZCT A;  2ES7 A;  4XS4 A;  1O7U A;  5L71 A;  2GSR A;  1TK0 B;  3GIX A;  4BL7 B;  5IO0 A;  1U88 A;  2TRX A;  1XOB A;  4GLT A;  1WP0 A;  3UBL A;  3IDV A;  2OKA A;  3CYN A;  5D73 A;  4DEJ A;  1AUC A;  4NV5 A;  1X9S B;  4KA0 A;  2OJL A;  4WXT A;  1WMJ A;  2VCV A;  1X5C A;  5CRE A;  1XW5 A;  2LRN A;  4IN0 A;  2GQM A;  5A5H B;  1Z6M A;  4OCF A;  5JWO B;  3F6D A;  2O89 A;  3ZIJ A;  2YV9 A;  3FR9 A;  3TB2 A;  3V1W A;  3RBT A;  4MK3 A;  3BCI A;  5CRH A;  1O6J A;  4QQ7 A;  1ZL9 A;  4ID0 A;  2CX3 A;  1ABA A;  1EEM A;  2YOI A;  2HSM B;  2C4J A;  3ED3 A;  3ZLP A;  3HA9 A;  1SKW B;  5A4W A;  3I43 A;  4CHS A;  4EDY A;  2FY6 A;  3MDK A;  3TJF A;  1CQG A;  4Q5R A;  4GQC A;  4F9Z A;  2BTO T;  1O85 A;  2XPD A;  1TKD B;  3FRC A;  5H5S A;  3ZFB A;  4WET A;  3ZYW A;  2P5R A;  2C0F A;  1WWJ A;  1T8E B;  1BX9 A;  5B8A A;  4TRX A;  3NZN A;  5CRD A;  3QAG A;  18GS A;  1Y25 A;  4N0Z A;  3O6T A;  1XXU A;  5CRG A;  5J3R A;  2VL2 C;  4ECB A;  2CA8 A;  3VUR A;  1FVJ A;  1SVO A;  13GS A;  4DSS B;  3CTG A;  3ERF A;  1N8J A;  4AJ7 A;  2CZ2 A;  2LJA A;  1I5G A;  2KLX A;  4NMU A;  4POB A;  1Z6N A;  2HXK A;  2OAC A;  1PGT A;  4OFT A;  3EVI A;  4EUY A;  2UZ8 A;  3A2W A;  4V2M A;  2R5G A;  2FA4 A;  4PUA A;  1O73 A;  3KM6 A;  4MPF A;  1F9M A;  2O85 A;  1FOH A;  2A2S A;  3UIW A;  5HR1 A;  5IMZ A;  2C8U A;  3LG6 A;  3QMX A;  4TR1 B;  1BF5 A;  1R4W A;  3EU3 A;  3MIX A;  2H1A A;  2IMD A;  3SWL A;  3CBU A;  3EUR A;  3W8J A;  3M0F A;  3TJK A;  3MAK A;  4IKH A;  2L6C A;  3TOT A;  1I9D A;  1GTA A;  2C0E A;  2MZC A;  2L57 A;  1AQW A;  5D9W A;  5KN1 A;  4GF0 A;  2CV4 A;  3QFB C;  2N5F A;  2RII A;  3UVH A;  4TOP A;  2VD1 A;  5CNW A;  1QFN A;  1A2J A;  2P5Q A;  1EV4 A;  3M9K A;  1O8W A;  3G7Y A;  3C73 A;  1JLV A;  1T00 A;  3KIJ A;  2H0G A;  4XIH A;  1GL8 A;  3VPT A;  1BAY A;  2YJH A;  4E68 A;  4LL4 B;  4GDF A;  1XPV A;  4K2X A;  4YKF A;  3DWV A;  1USB A;  1K0N A;  2FCH A;  3IHG A;  5COH A;  2RLI A;  3KTL A;  4MH2 A;  4HOJ A;  2OE3 A;  4X4J A;  3D0Z A;  2JSZ A;  2WS2 A;  1J0F A;  1SVL A;  1J08 A;  1SL2 B;  1N2A A;  1ZYP A;  2R0G A;  4ZL9 A;  4X43 A;  3TUE A;  3HDC A;  2FLS A;  2P0G A;  2B5X A;  2AV4 A;  5INY A;  3M1G A;  3HVV A;  5ECN B;  4EIP A;  3GMF A;  3GX8 A;  1BG5 A;  1M2B A;  5J4U A;  4IQ1 A;  3PH9 A;  2AJQ B;  2A4V A;  2A4H A;  3GFK A;  4EDZ A;  3C7M A;  1ZYN A;  1X9M B;  2JZR A;  2D2Z A;  4XRA A;  3L0H A;  4IJI A;  2YZH A;  3ZIT A;  3CRU A;  2DIY A;  2EIR A;  1CQH A;  3GUS A;  1SD9 A;  2I81 A;  16GS A;  3KJY A;  3HVX A;  3A3T A;  1YVL A;  2JL4 A;  1JZW A;  5J41 A;  3C1R A;  3QDN A;  2J9H A;  3VWU A;  2AAW A;  3WGX A;  2FWE A;  1B48 A;  1AAZ A;  1OYJ A;  3CRT A;  4EVM A;  5D9T A;  3TKS C;  5ECR B;  3J7Y b;  2CVK A;  5G5E A;  4GTU A;  2Z9S A;  2N5A A;  4G0L A;  5BMU A;  1UC7 A;  3GTU A;  1HD2 A;  2CT6 A;  3QR6 A;  3GV1 A;  5LD0 A;  2F8F A;  2E0Q A;  1E2Y A;  4L0U A;  3CWG A;  2WJU A;  1VF1 A;  5IQY A;  1Q4J A;  4Z2R A;  2I1U A;  2C0D A;  1DUG A;  3P90 A;  4ZB8 A;  2VKZ G;  5J4Y A;  2AB6 A;  3BJ5 A;  4K0G A;  3CXG A;  3DML A;  4RI7 A;  2JAC A;  2PWJ A;  1TU8 A;  3APQ A;  1GUH A;  4MLY A;  2YV7 A;  1OAZ A;  1PQN A;  3GNJ A;  4N10 A;  2LST A;  3APS A;  3ZVJ A;  4Q5F A;  1B9X C;  4ML6 A;  1SJZ A;  5JWQ B;  4GRF A;  5KOW A;  2FHE A;  2FWF A;  2DML A;  1FVK A;  3F3R A;  1GUM A;  5IM9 A;  2JZS A;  2L5L A;  2DIZ A;  1AXD A;  4WBJ A;  3FHK A;  2K9F A;  2LV3 A;  3IHQ A;  3W8S A;  1F6M C;  4LMW A;  20GS A;  2VL2 A;  3WGD A;  3F8U A;  4PX1 A;  2V2G A;  5D96 A;  2KUC A;  3FR6 A;  1UN2 A;  3UEM A;  4TN8 A;  4Z2T A;  1YDK A;  3GSS A;  3GX0 A;  5CYY A;  3PPU A;  1R5A A;  4KDU A;  1THX A;  2H30 A;  2H0H A;  3DIE A;  3ZML A;  1AW9 A;  1K0M A;  5EVO A;  4EF0 A;  3DRN A;  1TW9 A;  2L59 A;  2V6O A;  1V2A A;  4EKZ A;  4POL A;  2VIM A;  3QCP A;  3LXZ A;  2DKI A;  4ZL7 A;  4PXO A;  2V32 A;  3QAV A;  1TU7 A;  4RI6 A;  1FHE A;  4ZBD A;  2LS5 A;  4Z2U A;  3UOM A;  3GRX A;  4MJB A;  4ACS A;  1SKS B;  4USS A;  6GSV A;  4JBB A;  5B6N A;  2H0I A;  4K6X A;  2HRK A;  2I3Y A;  3VWV A;  22GS A;  3H4K A;  5J47 A;  4E8H A;  4PQI A;  3F0I A;  1EGR A;  2LEG A;  3I9V 2;  2E7P A;  2XC2 A;  1B4P A;  4HDE A;  2B5Y A;  4MA9 A;  1PL2 A;  1PA3 A;  2H19 A;  2WDU A;  2HE3 A;  2XHF A;  3RHC A;  1GSD A;  2H1B A;  5IOX A;  3RPP A;  4X1U A;  1K0O A;  4GSS A;  3P8W A;  4OD7 A;  4ICY A;  1T1V A;  1DBY A;  1SL0 B;  4P3Y B;  4JED A;  5GAP D;  2R2J A;  3LSZ A;  4HJ2 A;  1B9Y C;  4ZIL A;  1VF3 A;  1GSY A;  1URM A;  1GTU A;  5BMU B;  3GTU B;  5JWR B;  2OE0 A;  4FH8 A;  2VCW A;  5GST A;  2B5E A;  1YF1 A;  3R3E A;  1EV9 A;  3E9J B;  1OE7 A;  4V2N A;  1YZX A;  1TTZ A;  3EC3 A;  1BED A;  1WOU A;  4AJ8 A;  3MWH A;  3VLN A;  1OVN A;  2DJ2 A;  5G1K A;  3CSJ A;  4V1A p;  1TRW A;  1GSS A;  1S3A A;  4CY8 A;  3I6A A;  2GZZ A;  4O5U A;  3IE3 A;  3L78 A;  1SYX A;  4L0W A;  1EP7 A;  3TKS A;  4DSQ A;  2G0F A;  2X99 A;  2GSS A;  1Z7R A;  1TDI A;  3UMA A;  3DKS A;  2GST A;  4NAX A;  2R4V A;  3VWW A;  2KP2 A;  3HYP A;  3UJ1 A;  2IFQ A;  1R7H A;  1TI3 A;  1OC8 A;  2BJX A;  1SL1 B;  4FYU A;  2LQQ A;  1ILO A;  2O5V A;  2OAD A;  3TU3 B;  2BMX A;  2GQK A;  2GGT A;  3IOS A;  1XIY A;  2IN3 A;  1E6B A;  2H01 A;  3TKS E;  1HQO A;  5IIZ A;  4F0C A;  5F07 A;  4W66 A;  1WPI A;  3HJP A;  1M0U A;  4TR3 A;  4EXJ A;  1O8X A;  4GQF A;  4K7I A;  3EMP A;  4BVX B;  3GL5 A;  2IMK A;  1A2M A;  4OWY A;  5H5Q A;  4KDY A;  4TXO A;  1F2E A;  1GSE A;  1AIU A;  1V58 A;  1K0C A;  4I2U A;  2HZF A;  1GSQ A;  4K1F A;  2FWH A;  2H71 A;  4LA1 A;  2UV8 G;  3TJB A;  4G9H A;  5GSS A;  3Q74 A;  2JU5 A;  3UBK A;  4NWY A;  5ECO B;  1XVQ A;  2R6K A;  3JCM L;  3GL3 A;  2DLX A;  5B7C A;  3EE2 A;  1HYU A;  3GH6 A;  4KSM A;  4XTS A;  5HR0 A;  5G31 A;  2OBI A;  4DVC A;  2HI7 A;  5KN3 A;  4V2L A;  2VCT A;  4ZB7 A;  1ST9 A;  3D22 A;  1A8L A;  1F37 A;  4MP4 A;  1XWA A;  1R5P A;  3IRA A;  4PUF C;  1M2A A;  1V40 A;  3HZ4 A;  1VF2 A;  2HRK B;  1PL1 A;  2JAD A;  5D9X A;  3Q19 A;  1T4Y A;  4L5L A;  3BOA A;  2DJ3 A;  6GST A;  3UAP A;  5F05 A;  1ZGN A;  2MBT A;  4OFM A;  2H1G A;  4TW5 A;  3K8N A;  1AC1 A;  1F3A A;  3KZQ A;  4QL9 A;  4ZIJ A;  3KXO A;  1GUL A;  3RDW A;  2EFE A;  1WIK A;  4K0N A;  3GN3 A;  1JLW A;  5DCH A;  4IP1 A;  4GSN A;  1FO5 A;  1HNB A;  1EZK A;  1H4O A;  2ZUP A;  4NXI A;  3EMX A;  1IYI A;  4KH7 A;  4ZL8 A;  5ECS A;  5G5F A;  1S3D A;  4ECJ A;  3TJJ A;  5IMD A;  5CRW A;  2NVL A;  4QMK A;  1UA5 A;  3FZ4 A;  1GWC A;  3Q6O A;  1EEJ A;  1J9B A;  4GXZ A;  3H8Q A;  3IK9 A;  4AKX B;  2M80 A;  2EIO A;  4WEY A;  4XS6 A;  4OO5 A;  6GSU A;  6GSS A;  2GS3 A;  1KNG A;  2VOC A;  3FW2 A;  4H86 A;  2GDR A;  2TIR A;  1R26 A;  3GKX A;  2R0C A;  1XCC A;  2F8A A;  3VFI A;  2YWI A;  3G9B A;  4K7O A;  1WRY A;  1FB0 A;  2DKH A;  3LOR A;  2WB9 A;  2IFQ B;  2R0P A;  5KN0 A;  5B6M A;  2H6Y A;  4FQU A;  2EFD A;  5DAL A;  5DQY A;  2HLS A;  1YQ1 A;  1MD4 A;  2H6X A;  3FZA A;  5ECP B;  3TKP A;  2X8C A;  3CMI A;  2H66 A;  3FEU A;  5DCG A;  4ZB6 A;  4CDO A;  1Y6E A;  4K5R A;  5DQS A;  3FY7 A;  1G6Y A;  1XFL A;  4EL1 A;  5C00 A;  1SU9 A;  3C8E A;  1BG1 A;  2FUG 2;  1MD3 A;  1EOH A;  2E2M A;  1BYE A;  2C3Q A;  3TCO A;  1SKR B;  4TXO B;  1W89 A;  4OMV A;  2YCD A;  1XVW A;  2IWT A;  1XWK A;  3IC8 A;  5F06 A;  3U6V A;  2H76 A;  1ZZY A;  1Z7P A;  2CAI A;  3ME8 A;  1XWB A;  3F4T A;  1PKW A;  1EOG A;  3KMN A;  2LUS A;  4V1A g;  1YKC A;  1K0A A;  2N5B A;  3A2X A;  4K8M A;  4MJA A;  5H5R A;  1M2D A;  3ZIV A;  8GSS A;  1A23 A;  1ERU A;  2ON7 A;  6GSW A;  2FA8 A;  4KF9 A;  2K6V A;  2PMT A;  4RQX A;  1T3B A;  3W6G A;  2C3N A;  3MSZ A;  3D4M A;  1HNC A;  1WE0 A;  4ZB9 A;  4G0K A;  3LJR A;  1SJI A;  1OKT A;  2OA7 A;  2XBQ A;  5CP1 A;  2YZU A;  2WRT A;  1X5D A;  5JCU A;  2GZY A;  1SYR A;  4O5Q A;  5KN2 A;  5D93 A;  2E2G A;  3GKM A;  4TXV A;  1U87 A;  3WT1 A;  4JRR A;  4IEL A;  4MDC A;  5B8B A;  1VF4 A;  4IQA A;  2L4Q A;  4O32 A;  3GKN A;  2O7K A;  4K5S A;  1K3Y A;  3ZTL A;  3A2V A;  3KH7 A;  1QGV A;  3IAM 2;  3RHB A;  1ZOF A;  5DBQ A;  2FNO A;  3QAW A;  2HZE A;  1PSQ A;  4CW9 A;  4G2E A;  1X9W B;  2VM1 A;  3FYG A;  3EWL A;  5F8B A;  2CX4 A;  2H75 A;  1TXU A;  2WFC A;  14GS A;  5AIS A;  2PN8 A;  4N0V A;  3MYD A;  4YAV A;  2HYX A;  4JR6 A;  2FD3 A;  5G2Z A;  3ZMK A;  3G7I A;  4ZBA A;  2B1L A;  1OKD A;  2GLR A;  4IJ3 A;  1GSU A;  3J7Y k;  1SK2 A;  2I9H A;  1LJR A;  1G0T A;  1QUW A;  1C72 A;  4IP6 A;  2F51 A;  1B4Q A;  4BVX A;  3LQ7 A;  5DAL B;  2K8V A;  3LW9 A;  4HQS A;  1ZYE A;  2RUF A;  2OBK A;  4EO3 A;  2B6M A;  4AKH A;  3EU4 A;  3IC4 A;  4XS1 A;  1NW2 A;  4G0I A;  4G01 A;  3DYR A;  1ON4 A;  4IGJ A;  3VPQ A;  1EGO A;  1V57 A;  1H75 A;  2H6Z A;  5HR2 A;  1Y1U A;  2X8H A;  2C0G A;  4DSR A;  1KBN A;  1K0B A;  5CO3 A;  4XHM A;  1V9W A;  2R37 A;  4G19 A;  3CSH A;  4KDX A;  1HNA A;  3BD2 A;  1GH2 A;  2REM A;  5KEJ A;  4PNG A;  5ECQ B;  4ISD A;  5DVB A;  2ZNM A;  1SVM A;  1OC3 A;  1GUK A;  4IBP A;  3S9F A;  4PUR A;  5DAK A;  3KTB A;  4POM A;  3D6I A;  4O5R A;  5C04 A;  4EE0 A;  3ZRD A;  3IV4 A;  3BBY A;  2YWN A;  3GHA A;  2X64 A;  5GZZ B;  1Q98 A;  4F82 A;  2ON5 A;  4OCE A;  2H1L A;  2WZ9 A;  3PR8 A;  5FT3 A;  2AHE A;  3VWX A;  3F4S A;  4YH2 A;  2YWM A;  1YEP A;  4BWS A;  1KEB A;  2QA1 A;  1VGL A;  3QD9 A;  2DJ0 A;  3L9U A;  4ZXG A;  3ME7 A;  4E8E A;  4BVY A;  1BQ7 A;  4KCA A;  2PU9 C;  1YKA A;  2P31 A;  3E0U A;  3M9J A;  7GSS A;  3H93 A;  2PGT A;  3BCK A;  3D21 A;  1S3C A;  5HR3 A;  3F9U A;  4I6X A;  2EFC A;  1JFU A;  3ERG A;  4MF6 A;  1SEN A;  3E3E A;  4NHZ A;  3VI7 A;  3P7X A;  1ERW A;  2XPE A;  4HJM A;  3TRP A;  2H72 A;  1QXH A;  3UAR A;  2QSI A;  4WR4 A;  4WF5 A;  2V1M A;  3EYT A;  2HNL A;  2DJJ A;  4HUA A;  2EFH A;  4LLR A;  6GSY A;  1RQM A;  3CTF A;  4AKI A;  3H79 A;  2YJ7 A;  2K18 A;  2B7J A;  2WCI A;  3FR3 A;  2WGR A;  3UVT A;  4Q5N A;  1M9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...