2ON7A

Structure of nagst-1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
206
Chain Sequence
MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na Glutathione S-transferase 1
publication title X-ray structures of Na-GST-1 and Na-GST-2 two glutathione s-transferase from the human hookworm Necator americanus
pubmed doi rcsb
source organism Necator americanus
molecule tags Transferase
total genus 77
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2on7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2on7A01
2CT6A 5ECNB 5HFKA 1X9MB 3EINA 3IPZA 4FO5A 1Z5YE 2CV4A 1Z6NA 5KN0A 3WGXA 2MMZA 3ZL5A 1EGOA 3QAWA 2HQTA 1PX6A 1SYXA 4BL7B 3DRNA 1XOBA 2XPEA 2YJHA 1A24A 2E7PA 4QL9A 1XWGA 3FW2A 3KGKA 4IQAA 4WBJA 5DCHA 1SL2B 4GWRA 5J5NA 4TRXA 1WMJA 4YQMA 3QFAC 4WKWA 4RI6A 1GSYA 3F4SA 1ZMAA 3IAS2 3TDGA 2OBIA 4AJ6A 3GH6A 5CRGA 2LEGA 1E2YA 1V2AA 4AJ7A 3ME8A 3GYKA 4HU7A 3MSZA 5HFIA 1K0OA 2VCTA 3KH7A 2ZUPA 3EURA 4X0XA 4FYCA 3E3EA 2L4CA 3OR5A 1Z3EA 3D0ZA 1TRUA 2ALBA 1ZZYA 3H8QA 1CQGA 7GSSA 1K0NA 3GIXA 5F8BA 3APSA 2H0IA 3TOUA 3LXZA 3VK9A 3C1SA 2CZ2A 4ZB6A 3GX0A 2WS2A 2MBTA 2JZSA 2FHEA 3QR6A 2H70A 2IL3A 3RPNA 4N0ZA 4JEDA 3ZMKA 5J41A 4IJIA 4NV5A 2YWIA 4DSSA 4LA1A 3D22A 2B5XA 1YY7A 1LJRA 4YH2A 4KGIA 1GULA 4E8EA 3LYKA 3HYPA 2C3QA 4NWYA 2O85A 5ECKB 2GVPA 4ZB9A 3NZNA 3HJOA 2K8VA 3VWXA 3KMOA 4F2IA 3LORA 2ZCTA 2WJUA 4X43A 3O6TA 1TU7A 1OAZA 2K6VA 3QPMA 1YF1A 3LXTA 3TJBA 3ZLPA 4TW5A 3ED3A 2J9HA 3F0IA 3I43A 1NM3A 2HRKB 5DQYA 4KW6A 4WXTA 4ECCA 1TK8B 2KP1A 3Q18A 2C80A 4O7HA 3WYWA 4DSRA 3M9JA 6GSUA 2H19A 22GSA 2I9HA 3F63A 1GTUA 1MDJA 4MF6A 2YWNA 14GSA 3MDKA 3NOFA 3K8NA 3IBHA 4XRAA 4OO5A 3P7XA 4HU9A 2H66A 3FKFA 3VI7A 1AQWA 3UL3A 1OC8A 1M2AA 3EE2A 1GSFA 5IMDA 3TJJA 2DLXA 2IMIA 3HCZA 5LD0A 2VCXA 3D4MA 1QQ2A 1T4ZA 5D9XA 2TRXA 2JSYA 4RUVA 5A4VA 6GSSA 2GZZA 4FQUA 5DDLA 3KMNA 5IM9A 1G6YA 4G0KA 1DE1A 1EGRA 3TRXA 1N8JA 3BCKA 1SU9A 1ERWA 5ID2B 1Y6EA 2VUPA 5DALA 1XWAA 3UARA 1WPIA 1ERUA 3J7Yb 2LRTA 4HZ4A 2HI7A 2V6OA 4I6XA 4N11A 3IA1A 4L5LA 4K7IA 3DGQA 4TVEA 2NPBA 1QUWA 1HD2A 1GLPA 1EEMA 3AY8A 2FWHA 4XRDA 3CYNA 1ILOA 2V1MA 1K0BA 1R5AA 4HI7A 3EU3A 3EVIA 4ULXA 4G0LA 2PUKC 2RUEA 4JR6A 4ZL9A 2XHFA 3TRQA 4ML1A 3KP9A 4ZBBA 3M3MA 2DJ3A 5CAXA 3ZREA 2C0GA 4HEA2 2G0FA 4KB3A 1N2AA 1OC3A 1VF1A 3GL3A 3L4NA 3ERGA 3GN3A 4XS1A 3A2XA 2B5YA 1YKCA 2I4AA 2IMEA 4POMA 2VCQA 1TTZA 3QOUA 2H6XA 3DMLA 4LL4B 2PERA 2M72A 4IN0A 4MCUA 1O7UA 3FR9A 3BJ5A 1A2JA 5CRHA 5J3RA 2HNLA 2B3SA 2OACA 3I69A 3FYGA 1B4QA 4OFNA 2CAIA 2F8AA 2B7KA 4KE3A 2MMNA 5AIVA 3FZ4A 5H5SA 2FNOA 4EVMA 4GQFA 3HD5A 1OE8A 1OYJA 3ZFBA 2O89A 1LU4A 2H75A 2LNSA 3TKPA 1O8WA 3CSJA 4K6XA 4GTUA 4MDCA 2UZ8A 4NPBA 4L0UA 3TJGA 3F8UA 1GSEA 5B6MA 1A23A 5IMCA 1V98A 2V41A 3FEUA 5D9TA 4X1UA 1EOHA 4N0VA 4OFMA 3IC8A 2H1DA 1AUCA 2YV9A 1PGTA 2QC7A 4OD7A 5IO0A 3C7MA 4K7NA 5ECQB 1YQ1A 2LSTA 5IO2A 1XBSA 4MMMA 2YN1A 4K1FA 4XS4A 5L71A 4HJ2A 2X8GA 2PWJA 5INYA 1THXA 1OVNA 2P0GA 4BWSA 5DCGA 5GZZB 4ZL7A 1JZRA 2GSQA 2VO4A 1S3DA 3CSHA 4WR4A 4AF2A 4KDXA 3L9SA 4MZCA 3VWWA 1ZYQB 3HDCA 4ACSA 3IDVA 1XVWA 5FHIA 2JADA 1U87A 3HXSA 1XWKA 3ZIVA 3DVXA 1B9XC 1SJZA 5AISA 1QFNA 1V57A 4MA9A 2IFQB 2WZ9A 4K0GA 3SWLA 1TDIA 3E0UA 1YEPA 4MH2A 4MF7A 2IN3A 3LEFA 3BBYA 5B7CA 4BVYB 2MMOA 1HQOA 4KH7A 2C1YA 4RQRA 2E0QA 3D4TA 5G1KA 3H4KA 4OCEA 2L57A 4TOPA 3GMFA 2H6YA 4ECJA 2P5QA 1IYIA 4D73A 3L0HA 1O73A 1YEXA 4OWYA 3HZ4A 5DVBA 4JZQA 2B5EA 5H5RA 2H0GA 4F03A 2DIYA 1A8LA 2RM5A 3HVXA 2F8FA 3UVTA 1ERTA 3CBUA 4PUFC 5LCZA 1T4YA 4WF4A 4JBBA 6GSTA 2OADA 4I5QA 1VF4A 2AV4A 5G2ZA 4FH8A 3DEXA 3WD6A 3E9JB 2PN8A 2VD0A 5A4WA 3UMAA 6GSXA 5ECRB 3CMIA 5IMAA 12GSA 5G30A 4HQSA 4JU5A 4GSSA 3DYRA 1Q4JA 3H79A 2H0HA 3HKRA 1Z9HA 1SENA 5ELAA 4ZILA 4HUAA 5DAKA 4J56E 3RHCA 2ES7A 2YNXA 4MABA 2MYGA 2X8HA 2H72A 3C71A 1XPVA 2HSHA 1TRSA 4MF5A 4JE1A 1K3LA 1BEDA 1B4PA 1WOUA 1GSUA 1GRXA 1X5EA 1ZCPA 1O81A 2MZCA 1CQHA 1AXDA 2DIZA 10GSA 1MD3A 6GSWA 1GLQA 1PX7A 5DQSA 3KCMA 1FB0A 1FO5A 1USBA 3WGEA 5ECPB 2NTOA 3QDNA 5B8AA 4XCSA 2FCHA 5HR2A 2H01A 2JZRA 1M2DA 2VLTA 11GSA 3I6AA 2HZEB 5IPGA 3GFKA 1F3BA 3C8EA 3FZ9A 2I1UA 2FWEA 4MLYA 4PNGA 3D5JA 3UIWA 2YCDA 4EC0A 2VLUA 1V58A 1ZOFA 2H74A 1G6WA 4TXVA 2X8CA 2VM2A 4EF0A 2DJJA 1Z7RA 4I97A 1SL1B 1OE7A 4WR5A 5E4WA 4MZWA 2L5OA 2NVLA 3APQA 5B8BA 4IBPA 4IQ1A 1F37A 2PVQA 1UA5A 1GTBA 3BCIA 20GSA 2H71A 2L6CA 3M0FA 2V2GA 2B1LA 2R4VA 4JR4A 1ABAA 1I9DA 2Z9SA 2DJ0A 2LQOA 4TR1A 5D8IA 1SK0A 3EYTA 3N5OA 5ECOB 3TKSE 2GQLA 6GSYA 1WIKA 9GSSA 2FD3A 2M80A 4G0IA 3ZIJA 4LLRA 4KDUA 4ECBA 1HNBA 2EIQA 1XFLA 1O6JA 1OC9B 3CRUA 3TKRA 1G0TA 2CX3A 3BOAA 3DIEA 3QMXA 1T7PB 1K0CA 2REMA 4GSTA 2WGRA 4J57E 4K9ZA 5D93A 2LJAA 3L78A 2EIRA 4PTSA 1XWCA 2G2QA 2VL9A 4IELA 5D9VA 3ZRDA 4IP1A 2KOKA 2B1KA 3GNJA 5F07A 1ZL9A 1SK2A 1XW6A 3HVVA 5G31A 2XBIA 3GSTA 1O85A 3HJMA 3UBKA 2HXKA 2H1AA 3KXOA 3GKXA 3FRCA 3PPUA 1WJKA 2I3YA 1PL2A 2CA8A 2CZ3A 2FLSA 3F4RA 3GKNA 1EP7A 1TOFA 3QD9A 1B48A 2HE3A 2HRFA 3US3A 3TUEA 13GSA 2AYTA 3NIVA 1AIUA 3FZ5A 1M2BA 2O7KA 3MWHA 4CHSA 2YOIA 1J9BA 3FK8A 2AJQB 5CP1A 2NDOA 1PKWA 2B6MA 4XS6A 2IIYA 3GL5A 2X64A 4AGSA 1U6TA 5HFGA 1T3BA 1QMVA 1GSSA 5F06A 3TKQA 5EVOA 2VAFA 1X9SB 3UAPA 1FHEA 3H93A 1E6BA 3QFBC 4TKYA 2K8SA 1IYHA 4PXOA 2F51A 3BD2A 1DE2A 1M99A 1MEKA 5J9CA 4DSSB 4F9ZA 3QAVA 1GSDA 3FY7A 4O92A 4BVXA 4KAEA 3KJYA 4YQUA 3SBCA 2KLXA 3A2VA 1LBKA 1SYRA 4ILFA 3IK9A 3PR8A 2FA8A 3WGDA 5J9BA 1VF2A 3V1WA 1R4WA 2EC4A 2WFCA 4PQIA 3D21A 1FVKA 3Q19A 3VWVA 3D6IA 1GUHA 2VIMA 4DSQA 1H75A 1K0MA 1XWBA 4TXOA 3F4TA 2DMMA 4KSMA 4ISDA 5GAND 5HR1A 19GSA 5JWOB 3J7Yk 3KM6A 2GSTA 1TXXA 4BWQA 3GTUA 2LJRA 16GSA 2PGTA 1PD21 2AAWA 4K0NA 1U3AA 2N5FA 5C00A 1FG4A 1UVZA 4GCIA 2MMAA 2VLVA 8GSSA 2XBQA 5DJLA 1YDKA 5KEJA 4Q5NA 4XHMA 2BTOT 1XW9A 5JWRB 2WB9A 1SKWB 3O3TA 3GURA 2RM6A 3ERFA 2H1GA 3IRAA 4WBRD 2M46A 3G7YA 4GLTA 1QXHA 1DSBA 4V2NA 2GSSA 2BJXA 1AC1A 2IMDA 2DBCA 1PRXA 1W4VA 5A5KA 4V2LA 3GKMA 1GNWA 2R37A 4WEYA 4KCAA 2AHEA 4K2DA 4MP4A 4MH3A 4GRFA 1JZOA 3QAGA 1GTAA 3IAM2 4L0WA 5AIXA 4MPFA 4NXIA 5G1LA 3U6VA 1OKTA 4MJCA 5DALB 3IOSA 5ABRA 1YJ6A 1KBNA 4DVCA 3ME7A 2H6ZA 4USSA 2WRTA 1GP1A 1FAAA 1EP8A 3TCOA 1BQ7A 1F2EA 2HSMA 2HFDA 1PKZA 5GSTA 4GF0A 1HNCA 3KD0A 1TP9A 5J4UA 1MDIA 3C73A 1SJIA 3QCPA 1HNAA 3A3TA 3RPPA 2XPDA 2GGTA 2H30A 3UEMA 5ECLB 3KTBA 3G7IA 2YZHA 3TJKA 1FOVA 5ECSA 1GTIA 3F3QA 4V1Ap 1RW1A 2VL3A 2WCIA 4F0CA 5FWGA 4KDYA 4HQZA 5EPFA 1PN9A 5KN2A 4L5OA 3GRXA 4HJMA 4TN8A 4F82A 2BMXA 3PINA 3HA9A 4BL7A 2V6KA 1TW9A 2L4QA 1WP0A 3L9VA 2PMTA 4V2MA 2H73A 1SK1A 5EY6A 3M1GA 2OA7A 4ZXGA 3U5RE 3CRTA 4P3YB 5KN1A 3VWUA 3A2WA 3EC3A 2H1BA 3Q6OA 4ZL8A 5AN1A 3A5WA 2IPAA 1UC7A 1X5DA 5D96A 2YZUA 3GX8A 4YQVA 3PH9A 5FT3A 2YV7A 3P8WA 1JFUA 1TI3A 2QSIA 3F3RA 2FUG2 4RQXA 3RBTA 4NHZA 2GS3A 1Q98A 3EU4A 1Y25A 1G7OA 2VCZA 2L59A 4WF5A 3ZVJA 4EXJA 3EMXA 2JZTA 5F0GA 2DJ1A 5B6NA 1BYEA 1BX9A 4Q5RA 3LGCA 4YAVA 2GT5A 3ZYWA 1Z6MA 5EL8A 3TOTA 4ZBAA 1B9YC 3LWAA 4ZB8A 1TRWA 1VGLA 1XCCA 1FVJA 4L8EA 2OJLA 4XS4B 3ZFLA 3HVSA 5DJMA 1O8XA 1GUMA 2IMFA 3DKSA 1X5CA 2C8UA 2P31A 1JLVA 17GSA 4GSNA 2F3MA 2R2JA 3FR6A 3R2QA 5HQPA 1EV4A 2ZNMA 3ERWA 1R26A 4F0BA 1EWXA 2WULA 3C1RA 2GDRA 1ACVA 1NHYA 4XIHA 2C0EA 4PUAA 3FHKA 4KA0A 1F9MA 3GKKA 4Q5FA 1X0RA 1X9WB 2HRKA 3UOMA 1WRYA 3TGZA 5DBQA 1TRVA 5IMZA 2PPTA 3ZVJD 1W89A 5G5EA 2HT9A 5HR3A 1VF3A 2NBSA 4KUNA 2LQQA 4Q5QA 3EMPA 4EO3A 4GQCA 2F9SA 2L5LA 4O32A 5D9WA 1FB6A 1PSQA 3DXBA 3IV4A 2C4JA 1TKDB 3FR3A 5E59A 5LNKe 1A8YA 1RK4A 2VCVA 5CREA 5F05A 4D73B 1GWCA 1AW9A 4EL1A 2LV3A 2DMLA 1KTEA 1OKDA 5IOXA 4IW9A 3GSSA 1MDKA 5ENUA 4CW9A 4G19A 2YWOA 3MAKA 1A0FA 1WWJA 4KCEA 2P5RA 1XW5A 2CVBA 1XOAA 2A4VA 2FY6A 2EIOA 2JL4A 2RLIA 2I81A 1F3AA 5IQYA 2E2GA 4IP6A 3G7JA 2K18A 2DJKA 5ID2A 4EDYA 1JZWA 3HJPA 4NAXA 1PMTA 5DAKB 2MBSA 2OE3A 3W8SA 3TRPA 1NSWA 5C04A 3UJ1A 2LS5A 4GXZA 1VRSD 4EE0A 3ZMLA 4HS1A 1TU8A 5CYYA 2R5GA 1ON4A 2CAQA 3Q74A 1AQVA 2RUFA 5A4UA 2IJYA 5IMFA 4MJAA 2KHPA 4HDEA 3M8NA 3IC4A 4K8MA 1C72A 1K0DA 3TB2A 4I8BA 3VPTA 4POBA 1JZDA 1PQNA 2FWFA 3LJRA 2YP6A 3I9V2 1GNEA 4KSOA 3FZAA 5IIZA 1JHBA 1SJ6A 3GA4A 3HY2A 3DD3A 3ZTLA 2YPMA 2ON5A 1XVQA 5JWQB 4RI7A 2CVKA 2DC5A 3KZQA 1GSQA 1ERVA 4KF9A 1ML6A 3H1NA 3P2AA 3M9KA 1F6MC 4WETA 3LG6A 2LNTA 1S3CA 4EKZA 5ECIB 3G9BA 2JU5A 1R7HA 2OBKA 1EZKA 5CO3A 1XXUA 4POLA 5H5QA 4Z7XA 3UVHA 1BJXA 4K7OA 2TIRA 3S9FA 4DEJA 1TK5B 3GHAA 2CVDA 3KEBA 1TI1A 2J23A 3DVWA 4FIWA 2HRNA 1YF0A 4BA7A 1A0RP 2C0DA 3WT2A 5COHA 2OKAA 2YJ7A 3RAZA 2GQKA 1RQMA 4MK3A 1G7EA 3GUSA 1H4OA 2LUSA 3KTLA 1XIYA 2H76A 3N9JA 4PNFA 4NV2A 4QQ7A 1NHOA 1T8EB 4FYBA 2FWGA 2GZPA 2GT6A 1R5PA 4NHWA 4MJBA 2LTKA 1T1VA 4TR1B 3ISOA 4LMWA 1V9WA 1Z7PA 4G9HA 2LJKA 4JRRA 2TRCP 2N5BA 5CNWA 1U88A 2HSYA 6GSVA 4PX1A 2HRAA 1NW2A 3F9UA 3HHVA 3LYPA 1SKSB 1SL0B 2E2MA 5BMUA 1I5GA 1A2LA 5HR0A 18GSA 3CSIA 1UN2A 4ID0A 2CQ9A 5ECMB 3UBLA 3WT1A 3F6DA 1TK0B 2O87A 4PURA 2C3TA 2CX4A 2FGXA 5KN3A 2GQMA 4G10A 3MNGA 5IMVA 4I2UA 2VM1A 1M9AA 2IFQA 1XZOA 2KP2A 1BG5A 4BVYA 1TJDA 3IE3A 5JCWA 3PGTA 3KP8A 4IGJA 2GLRA 2JACA 3CXGA 1K3OA 2WDUA 4ZIJA 3IHQA 3LQ7A 2GTUA 4E8HA 2H8LA 4O5RA 3RDWA 3W6GA 1EEJA 4KNDA 2IWTA 3O76A 4PQ1A 2JSZA 1YZXA 2R6KA 2O8VB 1ZYEA 3GV1A 4LMVA 1J08A 2HSNB 1J0FA 2VOCA 3IR4A 1V40A 4PQHA 4EDZA 2LKUA 4IKHA 1B8XA 2AB6A 1BAYA 3R3EA 2AUVA 3JCML 4ZBDA 1GUKA 2A2SA 3KIJA 2L6DA 2PVOC 4N30A 1AQXA 3VLNA 2RIIA 1PL1A 2VD1A 4HZ2A 2IMKA 1KEBA 5IOWA 2GSRA 1EV9A 4PGTA 3IK7A 5JCGA 2VCWA 2KUCA 1JLWA 1M0UA 2K9FA 4HOJA 4MZBA 2HZFA 3TKSC 2B7JA 2D2ZA 1YKAA 3CTFA 3EWLA 3TKSA 3L9UA 2LRCA 3HZ8A 3W8JA 4BPYA 1SKRB 2XC2A 3VFIA 4G2EA 4BVXB 3LSZA 4QL7A 1URMA 3APOA 5JCUA 1M9BA 4AJ8A 2DSAA 4MPGA 1AAZA 5D73A 4ECIA 2HLSA 2R3XA 2QKEA 4IJ3A 1QK8A 4V1Ag 4H86A 1A2MA 3DWVA 1K0AA 4TR0A 4TXOB 1KNGA 2GZYA 1DUGA 2HYXA 4YAPA 4IS0A 1WE0A 5CRDA 2OE0A 4I2TA 3ZZXA 2HZEA 1ZGNA 1SD8A 3KH9A 3GTUB 4J2FA 4POKA 2C0FA 4OO4A 2FA4A 1SD9A 2A2RA 5ELGA 2PU9C 1GH2A 2N5AA 5CRWA 2ON7A 4OFTA 4FYUA 3P90A 5GSSA 3LFLA 1QGVA 1K3YA 2X99A 4KX4A 2YWMA 4IHUA 4IVFA 4TR3A 5G5FA 1DBYA 1THOA 2LRNA 4OCFA 2OE1A 3CTGA 2DJ2A 1T00A 5IPHA 3TJFA 1S3AA 1EOGA 4ML6A 4N10A 1U3IA 2PBJA 2V32A 3VURA 4TR4A 4EUYA 1HYUA 3IXRA 1ST9A 4LL1B 2VL2C 3VI5A 2QGVA 3F6FA 2VL2A 1MTCA 1PA3A 1MD4A 1M7TA 2YANA 1FW1A 3VPQA 3GH9A 4OMVA 1OC9A 4CDOA 2HSMB 3ZITA 4NMUA 4MJEA 2C3NA 5ECHB 4XTSA 5GAPD 5AGYA 3RHBA 1GL8A
chains in the Genus database with same CATH superfamily
2CT6A 5ECNB 5HFKA 2OT3A 1X9MB 3EINA 3IPZA 4FO5A 1Z5YE 2CV4A 1Z6NA 5KN0A 3WGXA 2MMZA 3ZL5A 1EGOA 3QAWA 2HQTA 1PX6A 1SYXA 4BL7B 3DRNA 1XOBA 2XPEA 2YJHA 1A24A 2E7PA 4QL9A 1XWGA 3FW2A 3KGKA 4IQAA 4WBJA 5DCHA 1SL2B 4ZB7A 4GWRA 5J5NA 4TRXA 1WMJA 4YQMA 3QFAC 4WKWA 4RI6A 1GSYA 3F4SA 1ZMAA 3IAS2 3TDGA 2OBIA 4YKGA 4AJ6A 3GH6A 5CRGA 2LEGA 1E2YA 2R0PA 1V2AA 4AJ7A 3ME8A 3GYKA 4HU7A 3MSZA 5HFIA 1K0OA 2VCTA 1N25A 2ZUPA 3KH7A 3EURA 4X0XA 4FYCA 3E3EA 2L4CA 3OR5A 4Z2TA 1Z3EA 3D0ZA 1TRUA 2ALBA 4EIQA 1ZZYA 3H8QA 1CQGA 7GSSA 1K0NA 3GIXA 5F8BA 5A5HB 3APSA 2H0IA 3TOUA 3LXZA 3VK9A 3C1SA 2CZ2A 4ZB6A 3GX0A 2WS2A 2MBTA 2JZSA 2FHEA 3QR6A 2X4AA 2H70A 2IL3A 3RPNA 4N0ZA 4JEDA 3ZMKA 5J41A 4IJIA 4W66A 4NV5A 2YWIA 4DSSA 4LA1A 3D22A 2B5XA 1YY7A 1LJRA 4E68A 4YH2A 4KGIA 1GULA 4E8EA 3LYKA 3HYPA 2C3QA 4NWYA 2O85A 5ECKB 2GVPA 4ZB9A 3NZNA 3HJOA 2K8VA 3VWXA 3KMOA 4F2IA 3LORA 2ZCTA 2WJUA 4X43A 3O6TA 1TU7A 1OAZA 2K6VA 3QPMA 1YF1A 3LXTA 3TJBA 3ZLPA 4TW5A 3ED3A 2J9HA 3F0IA 3I43A 1NM3A 2HRKB 5DQYA 4KW6A 4WXTA 4ECCA 1TK8B 2KP1A 3Q18A 2C80A 4O7HA 3WYWA 4DSRA 3M9JA 6GSUA 2H19A 22GSA 2I9HA 3F63A 1GTUA 1MDJA 4MF6A 2YWNA 4ICYA 14GSA 3MDKA 3NOFA 3K8NA 3IBHA 4XRAA 4OO5A 3P7XA 4HU9A 2WVZA 2H66A 3FKFA 3VI7A 1AQWA 3UL3A 1OC8A 1M2AA 3EE2A 1GSFA 5IMDA 3TJJA 4BIKA 2DLXA 2IMIA 3HCZA 5LD0A 2VCXA 3D4MA 1S3RA 1QQ2A 4PI2C 2VKZG 1T4ZA 5D9XA 2TRXA 2JSYA 4RUVA 5A4VA 6GSSA 2GZZA 4FQUA 4AKGA 3HVNA 5DDLA 3KMNA 5IM9A 1G6YA 4G0KA 1DE1A 1EGRA 3TRXA 1N8JA 3BCKA 1SU9A 1ERWA 5ID2B 1Y6EA 2VUPA 5DALA 1SVMA 1XWAA 3UARA 1WPIA 1ERUA 2UV8G 3J7Yb 2LRTA 4HZ4A 2HI7A 2V6OA 4I6XA 4N11A 3IA1A 3LW9A 2O5VA 4L5LA 4K7IA 3DGQA 4TVEA 2NPBA 1QUWA 1HD2A 1GLPA 1EEMA 3AY8A 2FWHA 4XRDA 3CYNA 1ILOA 2V1MA 1K0BA 1R5AA 4HI7A 3EU3A 3EVIA 4ULXA 4G0LA 2PUKC 2RUEA 4JR6A 4ZL9A 2XHFA 3TRQA 4ML1A 5BRTA 3KP9A 4ZBBA 3M3MA 2DJ3A 5CAXA 3ZREA 2C0GA 5KOXA 4HEA2 2G0FA 4KB3A 1N2AA 1OC3A 1VF1A 3GL3A 3L4NA 3ERGA 3GN3A 4XS1A 3A2XA 2B5YA 1YKCA 2I4AA 2IMEA 4POMA 2VCQA 1TTZA 3QOUA 2H6XA 3DMLA 4LL4B 2PERA 2M72A 4IN0A 4MCUA 1O7UA 3FR9A 1FOHA 4Z2UA 3BJ5A 1A2JA 5CRHA 5J3RA 2HNLA 2B3SA 2OACA 3I69A 3FYGA 1B4QA 2X49A 4OFNA 2CAIA 2F8AA 2B7KA 4KE3A 2MMNA 1XG8A 5AIVA 3FZ4A 5H5SA 3IHGA 3MIXA 2FNOA 4EVMA 4GQFA 3HD5A 1OE8A 1OYJA 3ZFBA 2O89A 4YKFA 1LU4A 2H75A 2LNSA 3TKPA 1O8WA 3CSJA 4K6XA 2EFDA 4GTUA 4MDCA 2UZ8A 4NPBA 4L0UA 3TJGA 3F8UA 1GSEA 5B6MA 1A23A 5IMCA 1V98A 2V41A 3FEUA 5D9TA 4X1UA 1EOHA 4N0VA 4OFMA 3IC8A 2H1DA 1AUCA 2YV9A 1PGTA 2QC7A 4OD7A 5IO0A 3C7MA 4K7NA 5ECQB 1YQ1A 2LSTA 5IO2A 1XBSA 4K5SA 4MMMA 2YN1A 4K1FA 4XS4A 5L71A 4HJ2A 2X8GA 2PWJA 5A34B 5INYA 1THXA 1OVNA 2P0GA 4BWSA 5DCGA 5GZZB 4ZL7A 1JZRA 2GSQA 2VO4A 1S3DA 3CSHA 4WR4A 4AF2A 1PN0A 4KDXA 3L9SA 5BMUB 4MZCA 3VWWA 1ZYQB 3HDCA 3RGBC 4ACSA 3IDVA 1XVWA 2A2PA 5FHIA 2JADA 1U87A 3HXSA 1XWKA 3ZIVA 3DVXA 1B9XC 1SJZA 5AISA 3CHXC 1QFNA 1V57A 4MA9A 2IFQB 2WZ9A 4K0GA 3SWLA 1TDIA 3E0UA 1YEPA 4MH2A 4MF7A 2IN3A 3LEFA 3BBYA 5B7CA 4BVYB 2MMOA 1HQOA 4KH7A 2C1YA 4RQRA 2E0QA 3D4TA 5G1KA 3H4KA 4OCEA 2L57A 4TOPA 3GMFA 2WW0A 2H6YA 4ECJA 2P5QA 1IYIA 4D73A 3L0HA 1O73A 1YEXA 4OWYA 3HZ4A 5DVBA 4JZQA 4X4JA 2B5EA 5H5RA 2H0GA 4F03A 2DIYA 1A8LA 2RM5A 3HVXA 2F8FA 3UVTA 1ERTA 3CBUA 4PUFC 5LCZA 1T4YA 4WF4A 4JBBA 6GSTA 2OADA 4I5QA 1M3JA 1VF4A 2AV4A 5G2ZA 4FH8A 3DEXA 3WD6A 3E9JB 2PN8A 2VD0A 5A4WA 3UMAA 6GSXA 5ECRB 2H1LA 3CMIA 5IMAA 12GSA 5G30A 4HSCX 4HQSA 4JU5A 4GSSA 3DYRA 1Q4JA 3H79A 2H0HA 3HKRA 1Z9HA 1SENA 5ELAA 4ZILA 4HUAA 5DAKA 4J56E 3RHCA 2ES7A 2YNXA 4MABA 2MYGA 4K2XA 2X8HA 2H72A 3C71A 1XPVA 2HSHA 1TRSA 4MF5A 4JE1A 1K3LA 5KOWA 1BEDA 1B4PA 4Z2RA 1WOUA 1GSUA 4EIPA 1GRXA 4G01A 1X5EA 1ZCPA 1O81A 2MZCA 3CQFA 1CQHA 1AXDA 2DIZA 10GSA 1MD3A 4QMKA 5A1NA 6GSWA 1GLQA 1PX7A 5DQSA 3KCMA 1FB0A 1FO5A 1USBA 4AKXB 3WGEA 5ECPB 2NTOA 3QDNA 5B8AA 4XCSA 2FCHA 5HR2A 2H01A 2JZRA 1M2DA 2VLTA 11GSA 3I6AA 2HZEB 1ZYNA 5IPGA 3GFKA 1F3BA 3C8EA 3FZ9A 2I1UA 2FWEA 4MLYA 4PNGA 3D5JA 4CY8A 3UIWA 2YCDA 4EC0A 2VLUA 1V58A 1ZOFA 2H74A 1G6WA 4TXVA 2X8CA 2VM2A 4EF0A 2DJJA 1Z7RA 4I97A 1SL1B 1OE7A 4WR5A 5E4WA 4MZWA 2L5OA 2NVLA 3APQA 5B8BA 4IBPA 4IQ1A 1F37A 2PVQA 1UA5A 1GTBA 3BCIA 20GSA 2H71A 2L6CA 3M0FA 2V2GA 2B1LA 2R4VA 4JR4A 1ABAA 1I9DA 2Z9SA 4A5PA 2DJ0A 2LQOA 4TR1A 5D8IA 1SK0A 3EYTA 3N5OA 5ECOB 3TKSE 2GQLA 6GSYA 1WIKA 9GSSA 2FD3A 2M80A 4G0IA 3ZIJA 4LLRA 4KDUA 4ECBA 1HNBA 2EIQA 1XFLA 1O6JA 1OC9B 3CRUA 3TKRA 1G0TA 2CX3A 3BOAA 3DIEA 3QMXA 1T7PB 1K0CA 2REMA 4GSTA 2WGRA 4J57E 4K9ZA 4CY6A 5D93A 2LJAA 3L78A 2EIRA 4PTSA 1XWCA 2G2QA 2VL9A 4IELA 5D9VA 3ZRDA 4IP1A 2KOKA 2B1KA 3GNJA 5F07A 1ZL9A 1SK2A 1XW6A 3HVVA 5G31A 2XBIA 3GSTA 1O85A 3HJMA 3UBKA 3EPTA 2HXKA 2H1AA 3KXOA 3GKXA 3FRCA 3PPUA 1WJKA 2I3YA 1PL2A 2CA8A 2CZ3A 2FLSA 3F4RA 1YEWC 3GKNA 1EP7A 1TOFA 3QD9A 1B48A 2HE3A 2HRFA 3US3A 4AI6A 3TUEA 13GSA 1S4BP 2AYTA 3NIVA 1AIUA 3FZ5A 3TU3B 1M2BA 2O7KA 3MWHA 4CHSA 2YOIA 1J9BA 3FK8A 2AJQB 5CP1A 2WVXA 2NDOA 1PKWA 2HSNA 2B6MA 4XS6A 5J4YA 2IIYA 3GL5A 2WZSA 2X64A 4AGSA 1U6TA 5HFGA 1T3BA 1QMVA 1GSSA 5F06A 3TKQA 5EVOA 2VAFA 1X9SB 3RFRC 3UAPA 1FHEA 3H93A 5J40A 1E6BA 3QFBC 4TKYA 2K8SA 1IYHA 4PXOA 2WVYA 1BF5A 2F51A 3BD2A 1DE2A 1M99A 1MEKA 5J9CA 4DSSB 4F9ZA 3QAVA 1GSDA 3FY7A 4O92A 4BVXA 4KAEA 3KJYA 4YQUA 1PFOA 3SBCA 2KLXA 3A2VA 1LBKA 1SYRA 4ILFA 3IK9A 3PR8A 2FA8A 3WGDA 5J9BA 1VF2A 4AKHA 3V1WA 1R4WA 2EC4A 2WFCA 4PQIA 3D21A 1FVKA 3Q19A 3VWVA 3D6IA 1GUHA 2VIMA 4DSQA 1H75A 1K0MA 1XWBA 4TXOA 3F4TA 2DMMA 4KSMA 4ISDA 3FMWA 5GAND 5HR1A 19GSA 5JWOB 3J7Yk 3KM6A 2GSTA 1TXXA 4BWQA 3GTUA 2LJRA 16GSA 2PGTA 1PD21 4O5QA 2AAWA 4K0NA 1U3AA 2N5FA 5C00A 1FG4A 1UVZA 4GCIA 2MMAA 2VLVA 8GSSA 2XBQA 5DJLA 1YDKA 5KEJA 4Q5NA 4XHMA 2BTOT 1XW9A 5JWRB 2WB9A 1SKWB 3O3TA 3GURA 2RM6A 3ERFA 2H1GA 3IRAA 4WBRD 2M46A 3G7YA 4GLTA 1QXHA 1DSBA 4V2NA 2GSSA 2BJXA 1AC1A 2IMDA 2DBCA 1PRXA 1W4VA 2A4HA 5A5KA 4V2LA 3GKMA 2R0GA 1GNWA 2R37A 4WEYA 4KCAA 2AHEA 4K2DA 4MP4A 4MH3A 4GRFA 1JZOA 3QAGA 1GTAA 3IAM2 4L0WA 5AIXA 4MPFA 4NXIA 5G1LA 3U6VA 1OKTA 4MJCA 5DALB 3IOSA 5ABRA 1YJ6A 1KBNA 4DVCA 3ME7A 2H6ZA 4USSA 2WRTA 1GP1A 1FAAA 4FXYP 1EP8A 3TCOA 1BQ7A 1F2EA 2HSMA 2HFDA 1PKZA 5GSTA 4GF0A 1HNCA 3KD0A 1TP9A 5J4UA 1MDIA 3C73A 1SJIA 3QCPA 1HNAA 3A3TA 3RPPA 2XPDA 2GGTA 2H30A 3UEMA 5ECLB 3KTBA 3G7IA 2YZHA 3TJKA 1FOVA 5ECSA 1GTIA 3F3QA 4V1Ap 1RW1A 2VL3A 2WCIA 4F0CA 5FWGA 4KDYA 4HQZA 5EPFA 1PN9A 5KN2A 1TXUA 4L5OA 3GRXA 4HJMA 2WW2A 4TN8A 4F82A 2BMXA 3PINA 3HA9A 4BL7A 2EFEA 2V6KA 1TW9A 2L4QA 1WP0A 3L9VA 2PMTA 4V2MA 2H73A 1SK1A 5EY6A 3M1GA 2OA7A 4ZXGA 3U5RE 3CRTA 4P3YB 5KN1A 3VWUA 3A2WA 3EC3A 2H1BA 3Q6OA 4ZL8A 5AN1A 3A5WA 2IPAA 1UC7A 1Y1UA 1X5DA 5D96A 2YZUA 3GX8A 4YQVA 3PH9A 4MNNA 5FT3A 2YV7A 3P8WA 1JFUA 1TI3A 2QSIA 3F3RA 2FUG2 4RQXA 3RBTA 4NHZA 2GS3A 2QA2A 1Q98A 3EU4A 1Y25A 1G7OA 4N3ZA 2VCZA 2L59A 4WF5A 3ZVJA 4EXJA 3EMXA 2JZTA 5F0GA 1ZYPA 5A5HA 2DJ1A 2O36A 5B6NA 1BYEA 1BX9A 4Q5RA 3LGCA 4YAVA 2GT5A 3ZYWA 1Z6MA 5EL8A 3TOTA 4ZBAA 1B9YC 3LWAA 4ZB8A 1TRWA 1VGLA 1XCCA 1FVJA 4L8EA 2OJLA 4XS4B 3ZFLA 3HVSA 5DJMA 1O8XA 1GUMA 2IMFA 3DKSA 1X5CA 2C8UA 2P31A 1JLVA 17GSA 4GSNA 2F3MA 2R2JA 3FR6A 3R2QA 5HQPA 1EV4A 2ZNMA 3ERWA 1R26A 4F0BA 1EWXA 2WULA 3C1RA 2GDRA 1ACVA 1NHYA 4XIHA 2C0EA 4PUAA 3FHKA 4KA0A 1F9MA 3GKKA 4Q5FA 1X0RA 1X9WB 2HRKA 3UOMA 1WRYA 3TGZA 5DBQA 1TRVA 1M3IA 5IMZA 2PPTA 3ZVJD 1W89A 4AKIA 5G5EA 2HT9A 5HR3A 1VF3A 2NBSA 4KUNA 2LQQA 4Q5QA 3EMPA 4EO3A 4GQCA 2F9SA 2L5LA 4O32A 5D9WA 1FB6A 1PSQA 3DXBA 4PHZC 2C4JA 3IV4A 1TKDB 3FR3A 5J4VA 5E59A 5LNKe 1A8YA 1RK4A 2VCVA 5CREA 5F05A 1SVOA 4D73B 1GWCA 1AW9A 4EL1A 2LV3A 2DMLA 3CWGA 1KTEA 1OKDA 5IOXA 4IW9A 3GSSA 1MDKA 1I1IP 5ENUA 4CW9A 4G19A 2YWOA 3MAKA 1A0FA 1WWJA 4KCEA 2P5RA 1XW5A 2CVBA 1XOAA 2A4VA 2FY6A 2EIOA 2JL4A 2RLIA 2I81A 1F3AA 5IQYA 2E2GA 4IP6A 3G7JA 2QA1A 2K18A 2DJKA 5ID2A 4EDYA 1JZWA 3HJPA 4NAXA 1PMTA 5DAKB 2MBSA 2OE3A 3W8SA 3TRPA 1NSWA 5C04A 3UJ1A 2LS5A 4GXZA 1VRSD 4EE0A 3ZMLA 1TU8A 4HS1A 5CYYA 2R5GA 1ON4A 2CAQA 3Q74A 1AQVA 2RUFA 3MYDA 5A4UA 2IJYA 5IMFA 4MJAA 2KHPA 4HDEA 3M8NA 3IC4A 4K8MA 1C72A 1K0DA 3TB2A 4I8BA 3VPTA 4POBA 1JZDA 1PQNA 2FWFA 3LJRA 2YP6A 3I9V2 1GNEA 4KSOA 5A1NB 3FZAA 5IIZA 1JHBA 1SJ6A 3GA4A 3HY2A 3DD3A 3ZTLA 2YPMA 2ON5A 1XVQA 5JWQB 4RI7A 2CVKA 2DC5A 3KZQA 1GSQA 1ERVA 4KF9A 1ML6A 3H1NA 3P2AA 3M9KA 1F6MC 4WETA 3LG6A 2LNTA 1S3CA 4EKZA 5ECIB 3G9BA 2JU5A 2WW3A 1R7HA 2OBKA 1EZKA 5CO3A 1XXUA 4POLA 5H5QA 4Z7XA 3UVHA 1BJXA 4K7OA 2TIRA 3S9FA 4DEJA 1TK5B 3GHAA 2CVDA 3KEBA 1TI1A 2J23A 3DVWA 4FIWA 2HRNA 1YF0A 4BA7A 1A0RP 2C0DA 3WT2A 5COHA 2OKAA 2YJ7A 3RAZA 2GQKA 1RQMA 4MK3A 1G7EA 3GUSA 1H4OA 2LUSA 3KTLA 1XIYA 2H76A 3N9JA 4PNFA 4NV2A 4QQ7A 1NHOA 1T8EB 4FYBA 2FWGA 2EFCA 2GT6A 2GZPA 1R5PA 4NHWA 4MJBA 2LTKA 1T1VA 4TR1B 3ISOA 4LMWA 1V9WA 1Z7PA 4G9HA 2LJKA 4JRRA 2TRCP 2N5BA 5CNWA 1U88A 2HSYA 6GSVA 5A34A 1SVLA 4PX1A 2HRAA 1NW2A 3F9UA 3HHVA 3LYPA 1SKSB 1SL0B 2E2MA 5BMUA 1I5GA 1A2LA 5HR0A 18GSA 3CSIA 1UN2A 4ID0A 3HMJG 2CQ9A 5ECMB 3UBLA 3WT1A 3F6DA 1TK0B 2O87A 4PURA 2C3TA 2CX4A 2FGXA 5KN3A 2GQMA 4G10A 3MNGA 5IMVA 4I2UA 2VM1A 1M9AA 2IFQA 1XZOA 2KP2A 1BG5A 4BVYA 1TJDA 3IE3A 5JCWA 3PGTA 3KP8A 4IGJA 2GLRA 2JACA 3CXGA 1K3OA 2WDUA 4ZIJA 3IHQA 3LQ7A 2WW1A 2GTUA 4E8HA 2H8LA 4O5RA 3RDWA 2O3EA 3W6GA 1EEJA 4KNDA 2IWTA 3O76A 4PQ1A 2JSZA 1YZXA 2R6KA 2DKHA 2O8VB 1ZYEA 3GV1A 2WVXB 4LMVA 1J08A 2HSNB 1J0FA 2VOCA 3IR4A 1V40A 5J47A 4PQHA 4EDZA 2LKUA 4IKHA 1B8XA 2AB6A 1BAYA 3R3EA 2AUVA 3JCML 4ZBDA 1GUKA 2A2SA 3KIJA 2L6DA 2PVOC 3A5IA 4N30A 1AQXA 3VLNA 2RIIA 1PL1A 2VD1A 4HZ2A 2R0CA 2IMKA 1KEBA 5IOWA 2GSRA 1EV9A 4PGTA 3IK7A 5JCGA 2VCWA 2KUCA 1JLWA 4O5UA 1M0UA 2K9FA 1YVLA 4HOJA 4MZBA 2HZFA 3TKSC 2B7JA 2D2ZA 1YKAA 3CTFA 3EWLA 3TKSA 3L9UA 2LRCA 3HZ8A 3W8JA 4BPYA 1SKRB 2XC2A 3VFIA 4G2EA 4BVXB 3LSZA 4QL7A 2EFHA 1URMA 3APOA 5JCUA 1M9BA 4AJ8A 2DSAA 4MPGA 1AAZA 5D73A 4ECIA 2HLSA 2R3XA 2QKEA 4IJ3A 1QK8A 4V1Ag 4H86A 1A2MA 3DWVA 1K0AA 4TR0A 4TXOB 1KNGA 2GZYA 1DUGA 2HYXA 4YAPA 4IS0A 1WE0A 5CRDA 2OE0A 4I2TA 3ZZXA 2HZEA 1ZGNA 1SD8A 3KH9A 3GTUB 4J2FA 4POKA 2C0FA 4OO4A 2FA4A 1SD9A 2A2RA 5ELGA 2PU9C 1GH2A 2N5AA 5CRWA 2ON7A 4OFTA 4FYUA 3P90A 5GSSA 3LFLA 1QGVA 1K3YA 2X99A 4KX4A 2YWMA 4IHUA 4IVFA 4TR3A 5G5FA 1DBYA 1THOA 2LRNA 4OCFA 2OE1A 3CTGA 4PI0C 2DJ2A 1BG1A 1T00A 5IPHA 3TJFA 1S3AA 1EOGA 4ML6A 4N10A 1U3IA 2PBJA 2V32A 3VURA 4TR4A 4EUYA 1HYUA 3IXRA 1ST9A 4LL1B 2VL2C 3VI5A 2QGVA 3F6FA 2VL2A 1MTCA 1PA3A 1MD4A 1M7TA 2YANA 1FW1A 3VPQA 3GH9A 4OMVA 1OC9A 4CDOA 2HSMB 4K5RA 3ZITA 4GDFA 4NMUA 4MJEA 2C3NA 2DKIA 5ECHB 4XTSA 5GAPD 5AGYA 3RHBA 1GL8A
chains in the Genus database with same CATH topology
2CT6A 5ECNB 5HFKA 2OT3A 1X9MB 3EINA 3IPZA 4FO5A 1Z5YE 2CV4A 1Z6NA 5KN0A 3WGXA 2MMZA 3ZL5A 1EGOA 3QAWA 2HQTA 1PX6A 1SYXA 4BL7B 3DRNA 1XOBA 2XPEA 2YJHA 1A24A 2E7PA 4QL9A 1XWGA 3FW2A 3KGKA 4IQAA 4WBJA 5DCHA 1SL2B 4ZB7A 4GWRA 5J5NA 4TRXA 1WMJA 4YQMA 3QFAC 4WKWA 4RI6A 1GSYA 3F4SA 1ZMAA 3IAS2 3TDGA 2OBIA 4YKGA 4AJ6A 3GH6A 5CRGA 2LEGA 1E2YA 2R0PA 1V2AA 4AJ7A 3ME8A 3GYKA 4HU7A 3MSZA 5HFIA 1K0OA 2VCTA 1N25A 2ZUPA 3KH7A 3EURA 4X0XA 4FYCA 3E3EA 2L4CA 3OR5A 4Z2TA 1Z3EA 3D0ZA 1TRUA 2ALBA 4EIQA 1ZZYA 3H8QA 1CQGA 7GSSA 1K0NA 3GIXA 5F8BA 5A5HB 3APSA 2H0IA 3TOUA 3LXZA 3VK9A 3C1SA 2CZ2A 4ZB6A 3GX0A 2WS2A 2MBTA 2JZSA 2FHEA 3QR6A 2X4AA 2H70A 2IL3A 3RPNA 4N0ZA 4JEDA 3ZMKA 5J41A 4IJIA 4W66A 4NV5A 2YWIA 4DSSA 4LA1A 3D22A 2B5XA 1YY7A 1LJRA 4E68A 4YH2A 4KGIA 1GULA 4E8EA 3LYKA 3HYPA 2C3QA 4NWYA 2O85A 5ECKB 2GVPA 4ZB9A 3NZNA 3HJOA 2K8VA 3VWXA 3KMOA 4F2IA 3LORA 2ZCTA 2WJUA 4X43A 3O6TA 1TU7A 1OAZA 2K6VA 3QPMA 1YF1A 3LXTA 3TJBA 3ZLPA 4TW5A 3ED3A 2J9HA 3F0IA 3I43A 1NM3A 2HRKB 5DQYA 4KW6A 4WXTA 4ECCA 1TK8B 2KP1A 3Q18A 2C80A 4O7HA 3WYWA 4DSRA 3M9JA 6GSUA 2H19A 22GSA 2I9HA 3F63A 1GTUA 1MDJA 4MF6A 2YWNA 4ICYA 14GSA 3MDKA 3NOFA 3K8NA 3IBHA 4XRAA 4OO5A 3P7XA 4HU9A 2H66A 3FKFA 3VI7A 1AQWA 3UL3A 1OC8A 1M2AA 3EE2A 1GSFA 5IMDA 3TJJA 2DLXA 2IMIA 3HCZA 5LD0A 2VCXA 3D4MA 1QQ2A 2VKZG 1T4ZA 5D9XA 2TRXA 2JSYA 4RUVA 5A4VA 6GSSA 2GZZA 4FQUA 4AKGA 5DDLA 3KMNA 5IM9A 1G6YA 4G0KA 1DE1A 1EGRA 3TRXA 1N8JA 3BCKA 1SU9A 1ERWA 5ID2B 1Y6EA 2VUPA 5DALA 1SVMA 1XWAA 3UARA 1WPIA 1ERUA 2UV8G 3J7Yb 2LRTA 4HZ4A 2HI7A 2V6OA 4I6XA 4N11A 3IA1A 3LW9A 2O5VA 4L5LA 4K7IA 3DGQA 4TVEA 2NPBA 1QUWA 1HD2A 1GLPA 1EEMA 3AY8A 2FWHA 4XRDA 3CYNA 1ILOA 2V1MA 1K0BA 1R5AA 4HI7A 3EU3A 3EVIA 4ULXA 4G0LA 2PUKC 2RUEA 4JR6A 4ZL9A 2XHFA 3TRQA 4ML1A 5BRTA 3KP9A 4ZBBA 3M3MA 2DJ3A 5CAXA 3ZREA 2C0GA 5KOXA 4HEA2 2G0FA 4KB3A 1N2AA 1OC3A 1VF1A 3GL3A 3L4NA 3ERGA 3GN3A 4XS1A 3A2XA 2B5YA 1YKCA 2I4AA 2IMEA 4POMA 2VCQA 1TTZA 3QOUA 2H6XA 3DMLA 4LL4B 2PERA 2M72A 4IN0A 4MCUA 1O7UA 3FR9A 1FOHA 4Z2UA 3BJ5A 1A2JA 5CRHA 5J3RA 2HNLA 2B3SA 2OACA 3I69A 3FYGA 1B4QA 2X49A 4OFNA 2CAIA 2F8AA 2B7KA 4KE3A 2MMNA 5AIVA 3FZ4A 5H5SA 3IHGA 3MIXA 2FNOA 4EVMA 4GQFA 3HD5A 1OE8A 1OYJA 3ZFBA 2O89A 4YKFA 1LU4A 2H75A 2LNSA 3TKPA 1O8WA 3CSJA 4K6XA 2EFDA 4GTUA 4MDCA 2UZ8A 4NPBA 4L0UA 3TJGA 3F8UA 1GSEA 5B6MA 1A23A 5IMCA 1V98A 2V41A 3FEUA 5D9TA 4X1UA 1EOHA 4N0VA 4OFMA 3IC8A 2H1DA 1AUCA 2YV9A 1PGTA 2QC7A 4OD7A 5IO0A 3C7MA 4K7NA 5ECQB 1YQ1A 2LSTA 5IO2A 1XBSA 4K5SA 4MMMA 2YN1A 4K1FA 4XS4A 5L71A 4HJ2A 2X8GA 2PWJA 5A34B 5INYA 1THXA 1OVNA 2P0GA 4BWSA 5DCGA 5GZZB 4ZL7A 1JZRA 2GSQA 2VO4A 1S3DA 3CSHA 4WR4A 4AF2A 1PN0A 4KDXA 3L9SA 5BMUB 4MZCA 3VWWA 1ZYQB 3HDCA 4ACSA 3IDVA 1XVWA 2A2PA 5FHIA 2JADA 1U87A 3HXSA 1XWKA 3ZIVA 3DVXA 1B9XC 1SJZA 5AISA 1QFNA 1V57A 4MA9A 2IFQB 2WZ9A 4K0GA 3SWLA 1TDIA 3E0UA 1YEPA 4MH2A 4MF7A 2IN3A 3LEFA 3BBYA 5B7CA 4BVYB 2MMOA 1HQOA 4KH7A 2C1YA 4RQRA 2E0QA 3D4TA 5G1KA 3H4KA 4OCEA 2L57A 4TOPA 3GMFA 2H6YA 4ECJA 2P5QA 1IYIA 4D73A 3L0HA 1O73A 1YEXA 4OWYA 3HZ4A 5DVBA 4JZQA 4X4JA 2B5EA 5H5RA 2H0GA 4F03A 2DIYA 1A8LA 2RM5A 3HVXA 2F8FA 3UVTA 1ERTA 3CBUA 4PUFC 5LCZA 1T4YA 4WF4A 4JBBA 6GSTA 2OADA 4I5QA 1VF4A 2AV4A 5G2ZA 4FH8A 3DEXA 3WD6A 3E9JB 2PN8A 2VD0A 5A4WA 3UMAA 6GSXA 5ECRB 2H1LA 3CMIA 5IMAA 12GSA 5G30A 4HQSA 4JU5A 4GSSA 3DYRA 1Q4JA 3H79A 2H0HA 3HKRA 1Z9HA 1SENA 5ELAA 4ZILA 4HUAA 5DAKA 4J56E 3RHCA 2ES7A 2YNXA 4MABA 2MYGA 4K2XA 2X8HA 2H72A 3C71A 1XPVA 2HSHA 1TRSA 4MF5A 4JE1A 1K3LA 5KOWA 1BEDA 1B4PA 4Z2RA 1WOUA 1GSUA 4EIPA 1GRXA 4G01A 1X5EA 1ZCPA 1O81A 2MZCA 1CQHA 1AXDA 2DIZA 10GSA 1MD3A 4QMKA 5A1NA 6GSWA 1GLQA 1PX7A 5DQSA 3KCMA 1FB0A 1FO5A 1USBA 4AKXB 3WGEA 5ECPB 2NTOA 3QDNA 5B8AA 4XCSA 2FCHA 5HR2A 2H01A 2JZRA 1M2DA 2VLTA 11GSA 3I6AA 2HZEB 1ZYNA 5IPGA 3GFKA 1F3BA 3C8EA 3FZ9A 2I1UA 2FWEA 4MLYA 4PNGA 3D5JA 4CY8A 3UIWA 2YCDA 4EC0A 2VLUA 1V58A 1ZOFA 2H74A 1G6WA 4TXVA 2X8CA 2VM2A 4EF0A 2DJJA 1Z7RA 4I97A 1SL1B 1OE7A 4WR5A 5E4WA 4MZWA 2L5OA 2NVLA 3APQA 5B8BA 4IBPA 4IQ1A 1F37A 2PVQA 1UA5A 1GTBA 3BCIA 20GSA 2H71A 2L6CA 3M0FA 2V2GA 2B1LA 2R4VA 4JR4A 1ABAA 1I9DA 2Z9SA 4A5PA 2DJ0A 2LQOA 4TR1A 5D8IA 1SK0A 3EYTA 3N5OA 5ECOB 3TKSE 2GQLA 6GSYA 1WIKA 9GSSA 2FD3A 2M80A 4G0IA 3ZIJA 4LLRA 4KDUA 4ECBA 1HNBA 2EIQA 1XFLA 1O6JA 1OC9B 3CRUA 3TKRA 1G0TA 2CX3A 3BOAA 3DIEA 3QMXA 1T7PB 1K0CA 2REMA 4GSTA 2WGRA 4J57E 4K9ZA 4CY6A 5D93A 2LJAA 3L78A 2EIRA 4PTSA 1XWCA 2G2QA 2VL9A 4IELA 5D9VA 3ZRDA 4IP1A 2KOKA 2B1KA 3GNJA 5F07A 1ZL9A 1SK2A 1XW6A 3HVVA 5G31A 2XBIA 3GSTA 1O85A 3HJMA 3UBKA 3EPTA 2HXKA 2H1AA 3KXOA 3GKXA 3FRCA 3PPUA 1WJKA 2I3YA 1PL2A 2CA8A 2CZ3A 2FLSA 3F4RA 3GKNA 1EP7A 1TOFA 3QD9A 1B48A 2HE3A 2HRFA 3US3A 4AI6A 3TUEA 13GSA 2AYTA 3NIVA 1AIUA 3FZ5A 3TU3B 1M2BA 2O7KA 3MWHA 4CHSA 2YOIA 1J9BA 3FK8A 2AJQB 5CP1A 2NDOA 1PKWA 2HSNA 2B6MA 4XS6A 5J4YA 2IIYA 3GL5A 2X64A 4AGSA 1U6TA 5HFGA 1T3BA 1QMVA 1GSSA 5F06A 3TKQA 5EVOA 2VAFA 1X9SB 3UAPA 1FHEA 3H93A 5J40A 1E6BA 3QFBC 4TKYA 2K8SA 1IYHA 4PXOA 1BF5A 2F51A 3BD2A 1DE2A 1M99A 1MEKA 5J9CA 4DSSB 4F9ZA 3QAVA 1GSDA 3FY7A 4O92A 4BVXA 4KAEA 3KJYA 4YQUA 3SBCA 2KLXA 3A2VA 1LBKA 1SYRA 4ILFA 3IK9A 3PR8A 2FA8A 3WGDA 5J9BA 1VF2A 4AKHA 3V1WA 1R4WA 2EC4A 2WFCA 4PQIA 3D21A 1FVKA 3Q19A 3VWVA 3D6IA 1GUHA 2VIMA 4DSQA 1H75A 1K0MA 1XWBA 4TXOA 3F4TA 2DMMA 4KSMA 4ISDA 3FMWA 5GAND 5HR1A 19GSA 5JWOB 3J7Yk 3KM6A 2GSTA 1TXXA 4BWQA 3GTUA 2LJRA 16GSA 2PGTA 1PD21 4O5QA 2AAWA 4K0NA 1U3AA 2N5FA 5C00A 1FG4A 1UVZA 4GCIA 2MMAA 2VLVA 8GSSA 2XBQA 5DJLA 1YDKA 5KEJA 4Q5NA 4XHMA 2BTOT 1XW9A 5JWRB 2WB9A 1SKWB 3O3TA 3GURA 2RM6A 3ERFA 2H1GA 3IRAA 4WBRD 2M46A 3G7YA 4GLTA 1QXHA 1DSBA 4V2NA 2GSSA 2BJXA 1AC1A 2IMDA 2DBCA 1PRXA 1W4VA 2A4HA 5A5KA 4V2LA 3GKMA 2R0GA 1GNWA 2R37A 4WEYA 4KCAA 2AHEA 4K2DA 4MP4A 4MH3A 4GRFA 1JZOA 3QAGA 1GTAA 3IAM2 4L0WA 5AIXA 4MPFA 4NXIA 5G1LA 3U6VA 1OKTA 4MJCA 5DALB 3IOSA 5ABRA 1YJ6A 1KBNA 4DVCA 3ME7A 2H6ZA 4USSA 2WRTA 1GP1A 1FAAA 1EP8A 3TCOA 1BQ7A 1F2EA 2HSMA 2HFDA 1PKZA 5GSTA 4GF0A 1HNCA 3KD0A 1TP9A 5J4UA 1MDIA 3C73A 1SJIA 3QCPA 1HNAA 3A3TA 3RPPA 2XPDA 2GGTA 2H30A 3UEMA 5ECLB 3KTBA 3G7IA 2YZHA 3TJKA 1FOVA 5ECSA 1GTIA 3F3QA 4V1Ap 1RW1A 2VL3A 2WCIA 4F0CA 5FWGA 4KDYA 4HQZA 5EPFA 1PN9A 5KN2A 1TXUA 4L5OA 3GRXA 4HJMA 4TN8A 4F82A 2BMXA 3PINA 3HA9A 4BL7A 2EFEA 2V6KA 1TW9A 2L4QA 1WP0A 3L9VA 2PMTA 4V2MA 2H73A 1SK1A 5EY6A 3M1GA 2OA7A 4ZXGA 3U5RE 3CRTA 4P3YB 5KN1A 3VWUA 3A2WA 3EC3A 2H1BA 3Q6OA 4ZL8A 5AN1A 3A5WA 2IPAA 1UC7A 1Y1UA 1X5DA 5D96A 2YZUA 3GX8A 4YQVA 3PH9A 4MNNA 5FT3A 2YV7A 3P8WA 1JFUA 1TI3A 2QSIA 3F3RA 2FUG2 4RQXA 3RBTA 4NHZA 2GS3A 2QA2A 1Q98A 3EU4A 1Y25A 1G7OA 4N3ZA 2VCZA 2L59A 4WF5A 3ZVJA 4EXJA 3EMXA 2JZTA 5F0GA 1ZYPA 5A5HA 2DJ1A 5B6NA 1BYEA 1BX9A 4Q5RA 3LGCA 4YAVA 2GT5A 3ZYWA 1Z6MA 5EL8A 3TOTA 4ZBAA 1B9YC 3LWAA 4ZB8A 1TRWA 1VGLA 1XCCA 1FVJA 4L8EA 2OJLA 4XS4B 3ZFLA 3HVSA 5DJMA 1O8XA 1GUMA 2IMFA 3DKSA 1X5CA 2C8UA 2P31A 1JLVA 17GSA 4GSNA 2F3MA 2R2JA 3FR6A 3R2QA 5HQPA 1EV4A 2ZNMA 3ERWA 1R26A 4F0BA 1EWXA 2WULA 3C1RA 2GDRA 1ACVA 1NHYA 4XIHA 2C0EA 4PUAA 3FHKA 4KA0A 1F9MA 3GKKA 4Q5FA 1X0RA 1X9WB 2HRKA 3UOMA 1WRYA 3TGZA 5DBQA 1TRVA 5IMZA 2PPTA 3ZVJD 1W89A 4AKIA 5G5EA 2HT9A 5HR3A 1VF3A 2NBSA 4KUNA 2LQQA 4Q5QA 3EMPA 4EO3A 4GQCA 2F9SA 2L5LA 4O32A 5D9WA 1FB6A 1PSQA 3DXBA 3IV4A 2C4JA 1TKDB 3FR3A 5J4VA 5E59A 5LNKe 1A8YA 1RK4A 2VCVA 5CREA 5F05A 1SVOA 4D73B 1GWCA 1AW9A 4EL1A 2LV3A 2DMLA 3CWGA 1KTEA 1OKDA 5IOXA 4IW9A 3GSSA 1MDKA 5ENUA 4CW9A 4G19A 2YWOA 3MAKA 1A0FA 1WWJA 4KCEA 2P5RA 1XW5A 2CVBA 1XOAA 2A4VA 2FY6A 2EIOA 2JL4A 2RLIA 2I81A 1F3AA 5IQYA 2E2GA 4IP6A 3G7JA 2QA1A 2K18A 2DJKA 5ID2A 4EDYA 1JZWA 3HJPA 4NAXA 1PMTA 5DAKB 2MBSA 2OE3A 3W8SA 3TRPA 1NSWA 5C04A 3UJ1A 2LS5A 4GXZA 1VRSD 4EE0A 3ZMLA 1TU8A 4HS1A 5CYYA 2R5GA 1ON4A 2CAQA 3Q74A 1AQVA 2RUFA 3MYDA 5A4UA 2IJYA 5IMFA 4MJAA 2KHPA 4HDEA 3M8NA 3IC4A 4K8MA 1C72A 1K0DA 3TB2A 4I8BA 3VPTA 4POBA 1JZDA 1PQNA 2FWFA 3LJRA 2YP6A 3I9V2 1GNEA 4KSOA 5A1NB 3FZAA 5IIZA 1JHBA 1SJ6A 3GA4A 3HY2A 3DD3A 3ZTLA 2YPMA 2ON5A 1XVQA 5JWQB 4RI7A 2CVKA 2DC5A 3KZQA 1GSQA 1ERVA 4KF9A 1ML6A 3H1NA 3P2AA 3M9KA 1F6MC 4WETA 3LG6A 2LNTA 1S3CA 4EKZA 5ECIB 3G9BA 2JU5A 1R7HA 2OBKA 1EZKA 5CO3A 1XXUA 4POLA 5H5QA 4Z7XA 3UVHA 1BJXA 4K7OA 2TIRA 3S9FA 4DEJA 1TK5B 3GHAA 2CVDA 3KEBA 1TI1A 2J23A 3DVWA 4FIWA 2HRNA 1YF0A 4BA7A 1A0RP 2C0DA 3WT2A 5COHA 2OKAA 2YJ7A 3RAZA 2GQKA 1RQMA 4MK3A 1G7EA 3GUSA 1H4OA 2LUSA 3KTLA 1XIYA 2H76A 3N9JA 4PNFA 4NV2A 4QQ7A 1NHOA 1T8EB 4FYBA 2FWGA 2EFCA 2GT6A 2GZPA 1R5PA 4NHWA 4MJBA 2LTKA 1T1VA 4TR1B 3ISOA 4LMWA 1V9WA 1Z7PA 4G9HA 2LJKA 4JRRA 2TRCP 2N5BA 5CNWA 1U88A 2HSYA 6GSVA 5A34A 1SVLA 4PX1A 2HRAA 1NW2A 3F9UA 3HHVA 3LYPA 1SKSB 1SL0B 2E2MA 5BMUA 1I5GA 1A2LA 5HR0A 18GSA 3CSIA 1UN2A 4ID0A 3HMJG 2CQ9A 5ECMB 3UBLA 3WT1A 3F6DA 1TK0B 2O87A 4PURA 2C3TA 2CX4A 2FGXA 5KN3A 2GQMA 4G10A 3MNGA 5IMVA 4I2UA 2VM1A 1M9AA 2IFQA 1XZOA 2KP2A 1BG5A 4BVYA 1TJDA 3IE3A 5JCWA 3PGTA 3KP8A 4IGJA 2GLRA 2JACA 3CXGA 1K3OA 2WDUA 4ZIJA 3IHQA 3LQ7A 2GTUA 4E8HA 2H8LA 4O5RA 3RDWA 3W6GA 1EEJA 4KNDA 2IWTA 3O76A 4PQ1A 2JSZA 1YZXA 2R6KA 2DKHA 2O8VB 1ZYEA 3GV1A 4LMVA 1J08A 2HSNB 1J0FA 2VOCA 3IR4A 1V40A 5J47A 4PQHA 4EDZA 2LKUA 4IKHA 1B8XA 2AB6A 1BAYA 3R3EA 2AUVA 3JCML 4ZBDA 1GUKA 2A2SA 3KIJA 2L6DA 2PVOC 3A5IA 4N30A 1AQXA 3VLNA 2RIIA 1PL1A 2VD1A 4HZ2A 2R0CA 2IMKA 1KEBA 5IOWA 2GSRA 1EV9A 4PGTA 3IK7A 5JCGA 2VCWA 2KUCA 1JLWA 4O5UA 1M0UA 2K9FA 1YVLA 4HOJA 4MZBA 2HZFA 3TKSC 2B7JA 2D2ZA 1YKAA 3CTFA 3EWLA 3TKSA 3L9UA 2LRCA 3HZ8A 3W8JA 4BPYA 1SKRB 2XC2A 3VFIA 4G2EA 4BVXB 3LSZA 4QL7A 2EFHA 1URMA 3APOA 5JCUA 1M9BA 4AJ8A 2DSAA 4MPGA 1AAZA 5D73A 4ECIA 2HLSA 2R3XA 2QKEA 4IJ3A 1QK8A 4V1Ag 4H86A 1A2MA 3DWVA 1K0AA 4TR0A 4TXOB 1KNGA 2GZYA 1DUGA 2HYXA 4YAPA 4IS0A 1WE0A 5CRDA 2OE0A 4I2TA 3ZZXA 2HZEA 1ZGNA 1SD8A 3KH9A 3GTUB 4J2FA 4POKA 2C0FA 4OO4A 2FA4A 1SD9A 2A2RA 5ELGA 2PU9C 1GH2A 2N5AA 5CRWA 2ON7A 4OFTA 4FYUA 3P90A 5GSSA 3LFLA 1QGVA 1K3YA 2X99A 4KX4A 2YWMA 4IHUA 4IVFA 4TR3A 5G5FA 1DBYA 1THOA 2LRNA 4OCFA 2OE1A 3CTGA 2DJ2A 1BG1A 1T00A 5IPHA 3TJFA 1S3AA 1EOGA 4ML6A 4N10A 1U3IA 2PBJA 2V32A 3VURA 4TR4A 4EUYA 1HYUA 3IXRA 1ST9A 4LL1B 2VL2C 3VI5A 2QGVA 3F6FA 2VL2A 1MTCA 1PA3A 1MD4A 1M7TA 2YANA 1FW1A 3VPQA 3GH9A 4OMVA 1OC9A 4CDOA 2HSMB 4K5RA 3ZITA 4GDFA 4NMUA 4MJEA 2C3NA 2DKIA 5ECHB 4XTSA 5GAPD 5AGYA 3RHBA 1GL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT6 A;  5ECN B;  5HFK A;  1X9M B;  3EIN A;  3IPZ A;  4FO5 A;  1Z5Y E;  2CV4 A;  1Z6N A;  5KN0 A;  3WGX A;  2MMZ A;  3ZL5 A;  1EGO A;  3QAW A;  2HQT A;  1PX6 A;  1SYX A;  4BL7 B;  3DRN A;  1XOB A;  2XPE A;  2YJH A;  1A24 A;  2E7P A;  4QL9 A;  1XWG A;  3FW2 A;  3KGK A;  4IQA A;  4WBJ A;  5DCH A;  1SL2 B;  4GWR A;  5J5N A;  4TRX A;  1WMJ A;  4YQM A;  3QFA C;  4WKW A;  4RI6 A;  1GSY A;  3F4S A;  1ZMA A;  3IAS 2;  3TDG A;  2OBI A;  4AJ6 A;  3GH6 A;  5CRG A;  2LEG A;  1E2Y A;  1V2A A;  4AJ7 A;  3ME8 A;  3GYK A;  4HU7 A;  3MSZ A;  5HFI A;  1K0O A;  2VCT A;  3KH7 A;  2ZUP A;  3EUR A;  4X0X A;  4FYC A;  3E3E A;  2L4C A;  3OR5 A;  1Z3E A;  3D0Z A;  1TRU A;  2ALB A;  1ZZY A;  3H8Q A;  1CQG A;  7GSS A;  1K0N A;  3GIX A;  5F8B A;  3APS A;  2H0I A;  3TOU A;  3LXZ A;  3VK9 A;  3C1S A;  2CZ2 A;  4ZB6 A;  3GX0 A;  2WS2 A;  2MBT A;  2JZS A;  2FHE A;  3QR6 A;  2H70 A;  2IL3 A;  3RPN A;  4N0Z A;  4JED A;  3ZMK A;  5J41 A;  4IJI A;  4NV5 A;  2YWI A;  4DSS A;  4LA1 A;  3D22 A;  2B5X A;  1YY7 A;  1LJR A;  4YH2 A;  4KGI A;  1GUL A;  4E8E A;  3LYK A;  3HYP A;  2C3Q A;  4NWY A;  2O85 A;  5ECK B;  2GVP A;  4ZB9 A;  3NZN A;  3HJO A;  2K8V A;  3VWX A;  3KMO A;  4F2I A;  3LOR A;  2ZCT A;  2WJU A;  4X43 A;  3O6T A;  1TU7 A;  1OAZ A;  2K6V A;  3QPM A;  1YF1 A;  3LXT A;  3TJB A;  3ZLP A;  4TW5 A;  3ED3 A;  2J9H A;  3F0I A;  3I43 A;  1NM3 A;  2HRK B;  5DQY A;  4KW6 A;  4WXT A;  4ECC A;  1TK8 B;  2KP1 A;  3Q18 A;  2C80 A;  4O7H A;  3WYW A;  4DSR A;  3M9J A;  6GSU A;  2H19 A;  22GS A;  2I9H A;  3F63 A;  1GTU A;  1MDJ A;  4MF6 A;  2YWN A;  14GS A;  3MDK A;  3NOF A;  3K8N A;  3IBH A;  4XRA A;  4OO5 A;  3P7X A;  4HU9 A;  2H66 A;  3FKF A;  3VI7 A;  1AQW A;  3UL3 A;  1OC8 A;  1M2A A;  3EE2 A;  1GSF A;  5IMD A;  3TJJ A;  2DLX A;  2IMI A;  3HCZ A;  5LD0 A;  2VCX A;  3D4M A;  1QQ2 A;  1T4Z A;  5D9X A;  2TRX A;  2JSY A;  4RUV A;  5A4V A;  6GSS A;  2GZZ A;  4FQU A;  5DDL A;  3KMN A;  5IM9 A;  1G6Y A;  4G0K A;  1DE1 A;  1EGR A;  3TRX A;  1N8J A;  3BCK A;  1SU9 A;  1ERW A;  5ID2 B;  1Y6E A;  2VUP A;  5DAL A;  1XWA A;  3UAR A;  1WPI A;  1ERU A;  3J7Y b;  2LRT A;  4HZ4 A;  2HI7 A;  2V6O A;  4I6X A;  4N11 A;  3IA1 A;  4L5L A;  4K7I A;  3DGQ A;  4TVE A;  2NPB A;  1QUW A;  1HD2 A;  1GLP A;  1EEM A;  3AY8 A;  2FWH A;  4XRD A;  3CYN A;  1ILO A;  2V1M A;  1K0B A;  1R5A A;  4HI7 A;  3EU3 A;  3EVI A;  4ULX A;  4G0L A;  2PUK C;  2RUE A;  4JR6 A;  4ZL9 A;  2XHF A;  3TRQ A;  4ML1 A;  3KP9 A;  4ZBB A;  3M3M A;  2DJ3 A;  5CAX A;  3ZRE A;  2C0G A;  4HEA 2;  2G0F A;  4KB3 A;  1N2A A;  1OC3 A;  1VF1 A;  3GL3 A;  3L4N A;  3ERG A;  3GN3 A;  4XS1 A;  3A2X A;  2B5Y A;  1YKC A;  2I4A A;  2IME A;  4POM A;  2VCQ A;  1TTZ A;  3QOU A;  2H6X A;  3DML A;  4LL4 B;  2PER A;  2M72 A;  4IN0 A;  4MCU A;  1O7U A;  3FR9 A;  3BJ5 A;  1A2J A;  5CRH A;  5J3R A;  2HNL A;  2B3S A;  2OAC A;  3I69 A;  3FYG A;  1B4Q A;  4OFN A;  2CAI A;  2F8A A;  2B7K A;  4KE3 A;  2MMN A;  5AIV A;  3FZ4 A;  5H5S A;  2FNO A;  4EVM A;  4GQF A;  3HD5 A;  1OE8 A;  1OYJ A;  3ZFB A;  2O89 A;  1LU4 A;  2H75 A;  2LNS A;  3TKP A;  1O8W A;  3CSJ A;  4K6X A;  4GTU A;  4MDC A;  2UZ8 A;  4NPB A;  4L0U A;  3TJG A;  3F8U A;  1GSE A;  5B6M A;  1A23 A;  5IMC A;  1V98 A;  2V41 A;  3FEU A;  5D9T A;  4X1U A;  1EOH A;  4N0V A;  4OFM A;  3IC8 A;  2H1D A;  1AUC A;  2YV9 A;  1PGT A;  2QC7 A;  4OD7 A;  5IO0 A;  3C7M A;  4K7N A;  5ECQ B;  1YQ1 A;  2LST A;  5IO2 A;  1XBS A;  4MMM A;  2YN1 A;  4K1F A;  4XS4 A;  5L71 A;  4HJ2 A;  2X8G A;  2PWJ A;  5INY A;  1THX A;  1OVN A;  2P0G A;  4BWS A;  5DCG A;  5GZZ B;  4ZL7 A;  1JZR A;  2GSQ A;  2VO4 A;  1S3D A;  3CSH A;  4WR4 A;  4AF2 A;  4KDX A;  3L9S A;  4MZC A;  3VWW A;  1ZYQ B;  3HDC A;  4ACS A;  3IDV A;  1XVW A;  5FHI A;  2JAD A;  1U87 A;  3HXS A;  1XWK A;  3ZIV A;  3DVX A;  1B9X C;  1SJZ A;  5AIS A;  1QFN A;  1V57 A;  4MA9 A;  2IFQ B;  2WZ9 A;  4K0G A;  3SWL A;  1TDI A;  3E0U A;  1YEP A;  4MH2 A;  4MF7 A;  2IN3 A;  3LEF A;  3BBY A;  5B7C A;  4BVY B;  2MMO A;  1HQO A;  4KH7 A;  2C1Y A;  4RQR A;  2E0Q A;  3D4T A;  5G1K A;  3H4K A;  4OCE A;  2L57 A;  4TOP A;  3GMF A;  2H6Y A;  4ECJ A;  2P5Q A;  1IYI A;  4D73 A;  3L0H A;  1O73 A;  1YEX A;  4OWY A;  3HZ4 A;  5DVB A;  4JZQ A;  2B5E A;  5H5R A;  2H0G A;  4F03 A;  2DIY A;  1A8L A;  2RM5 A;  3HVX A;  2F8F A;  3UVT A;  1ERT A;  3CBU A;  4PUF C;  5LCZ A;  1T4Y A;  4WF4 A;  4JBB A;  6GST A;  2OAD A;  4I5Q A;  1VF4 A;  2AV4 A;  5G2Z A;  4FH8 A;  3DEX A;  3WD6 A;  3E9J B;  2PN8 A;  2VD0 A;  5A4W A;  3UMA A;  6GSX A;  5ECR B;  3CMI A;  5IMA A;  12GS A;  5G30 A;  4HQS A;  4JU5 A;  4GSS A;  3DYR A;  1Q4J A;  3H79 A;  2H0H A;  3HKR A;  1Z9H A;  1SEN A;  5ELA A;  4ZIL A;  4HUA A;  5DAK A;  4J56 E;  3RHC A;  2ES7 A;  2YNX A;  4MAB A;  2MYG A;  2X8H A;  2H72 A;  3C71 A;  1XPV A;  2HSH A;  1TRS A;  4MF5 A;  4JE1 A;  1K3L A;  1BED A;  1B4P A;  1WOU A;  1GSU A;  1GRX A;  1X5E A;  1ZCP A;  1O81 A;  2MZC A;  1CQH A;  1AXD A;  2DIZ A;  10GS A;  1MD3 A;  6GSW A;  1GLQ A;  1PX7 A;  5DQS A;  3KCM A;  1FB0 A;  1FO5 A;  1USB A;  3WGE A;  5ECP B;  2NTO A;  3QDN A;  5B8A A;  4XCS A;  2FCH A;  5HR2 A;  2H01 A;  2JZR A;  1M2D A;  2VLT A;  11GS A;  3I6A A;  2HZE B;  5IPG A;  3GFK A;  1F3B A;  3C8E A;  3FZ9 A;  2I1U A;  2FWE A;  4MLY A;  4PNG A;  3D5J A;  3UIW A;  2YCD A;  4EC0 A;  2VLU A;  1V58 A;  1ZOF A;  2H74 A;  1G6W A;  4TXV A;  2X8C A;  2VM2 A;  4EF0 A;  2DJJ A;  1Z7R A;  4I97 A;  1SL1 B;  1OE7 A;  4WR5 A;  5E4W A;  4MZW A;  2L5O A;  2NVL A;  3APQ A;  5B8B A;  4IBP A;  4IQ1 A;  1F37 A;  2PVQ A;  1UA5 A;  1GTB A;  3BCI A;  20GS A;  2H71 A;  2L6C A;  3M0F A;  2V2G A;  2B1L A;  2R4V A;  4JR4 A;  1ABA A;  1I9D A;  2Z9S A;  2DJ0 A;  2LQO A;  4TR1 A;  5D8I A;  1SK0 A;  3EYT A;  3N5O A;  5ECO B;  3TKS E;  2GQL A;  6GSY A;  1WIK A;  9GSS A;  2FD3 A;  2M80 A;  4G0I A;  3ZIJ A;  4LLR A;  4KDU A;  4ECB A;  1HNB A;  2EIQ A;  1XFL A;  1O6J A;  1OC9 B;  3CRU A;  3TKR A;  1G0T A;  2CX3 A;  3BOA A;  3DIE A;  3QMX A;  1T7P B;  1K0C A;  2REM A;  4GST A;  2WGR A;  4J57 E;  4K9Z A;  5D93 A;  2LJA A;  3L78 A;  2EIR A;  4PTS A;  1XWC A;  2G2Q A;  2VL9 A;  4IEL A;  5D9V A;  3ZRD A;  4IP1 A;  2KOK A;  2B1K A;  3GNJ A;  5F07 A;  1ZL9 A;  1SK2 A;  1XW6 A;  3HVV A;  5G31 A;  2XBI A;  3GST A;  1O85 A;  3HJM A;  3UBK A;  2HXK A;  2H1A A;  3KXO A;  3GKX A;  3FRC A;  3PPU A;  1WJK A;  2I3Y A;  1PL2 A;  2CA8 A;  2CZ3 A;  2FLS A;  3F4R A;  3GKN A;  1EP7 A;  1TOF A;  3QD9 A;  1B48 A;  2HE3 A;  2HRF A;  3US3 A;  3TUE A;  13GS A;  2AYT A;  3NIV A;  1AIU A;  3FZ5 A;  1M2B A;  2O7K A;  3MWH A;  4CHS A;  2YOI A;  1J9B A;  3FK8 A;  2AJQ B;  5CP1 A;  2NDO A;  1PKW A;  2B6M A;  4XS6 A;  2IIY A;  3GL5 A;  2X64 A;  4AGS A;  1U6T A;  5HFG A;  1T3B A;  1QMV A;  1GSS A;  5F06 A;  3TKQ A;  5EVO A;  2VAF A;  1X9S B;  3UAP A;  1FHE A;  3H93 A;  1E6B A;  3QFB C;  4TKY A;  2K8S A;  1IYH A;  4PXO A;  2F51 A;  3BD2 A;  1DE2 A;  1M99 A;  1MEK A;  5J9C A;  4DSS B;  4F9Z A;  3QAV A;  1GSD A;  3FY7 A;  4O92 A;  4BVX A;  4KAE A;  3KJY A;  4YQU A;  3SBC A;  2KLX A;  3A2V A;  1LBK A;  1SYR A;  4ILF A;  3IK9 A;  3PR8 A;  2FA8 A;  3WGD A;  5J9B A;  1VF2 A;  3V1W A;  1R4W A;  2EC4 A;  2WFC A;  4PQI A;  3D21 A;  1FVK A;  3Q19 A;  3VWV A;  3D6I A;  1GUH A;  2VIM A;  4DSQ A;  1H75 A;  1K0M A;  1XWB A;  4TXO A;  3F4T A;  2DMM A;  4KSM A;  4ISD A;  5GAN D;  5HR1 A;  19GS A;  5JWO B;  3J7Y k;  3KM6 A;  2GST A;  1TXX A;  4BWQ A;  3GTU A;  2LJR A;  16GS A;  2PGT A;  1PD2 1;  2AAW A;  4K0N A;  1U3A A;  2N5F A;  5C00 A;  1FG4 A;  1UVZ A;  4GCI A;  2MMA A;  2VLV A;  8GSS A;  2XBQ A;  5DJL A;  1YDK A;  5KEJ A;  4Q5N A;  4XHM A;  2BTO T;  1XW9 A;  5JWR B;  2WB9 A;  1SKW B;  3O3T A;  3GUR A;  2RM6 A;  3ERF A;  2H1G A;  3IRA A;  4WBR D;  2M46 A;  3G7Y A;  4GLT A;  1QXH A;  1DSB A;  4V2N A;  2GSS A;  2BJX A;  1AC1 A;  2IMD A;  2DBC A;  1PRX A;  1W4V A;  5A5K A;  4V2L A;  3GKM A;  1GNW A;  2R37 A;  4WEY A;  4KCA A;  2AHE A;  4K2D A;  4MP4 A;  4MH3 A;  4GRF A;  1JZO A;  3QAG A;  1GTA A;  3IAM 2;  4L0W A;  5AIX A;  4MPF A;  4NXI A;  5G1L A;  3U6V A;  1OKT A;  4MJC A;  5DAL B;  3IOS A;  5ABR A;  1YJ6 A;  1KBN A;  4DVC A;  3ME7 A;  2H6Z A;  4USS A;  2WRT A;  1GP1 A;  1FAA A;  1EP8 A;  3TCO A;  1BQ7 A;  1F2E A;  2HSM A;  2HFD A;  1PKZ A;  5GST A;  4GF0 A;  1HNC A;  3KD0 A;  1TP9 A;  5J4U A;  1MDI A;  3C73 A;  1SJI A;  3QCP A;  1HNA A;  3A3T A;  3RPP A;  2XPD A;  2GGT A;  2H30 A;  3UEM A;  5ECL B;  3KTB A;  3G7I A;  2YZH A;  3TJK A;  1FOV A;  5ECS A;  1GTI A;  3F3Q A;  4V1A p;  1RW1 A;  2VL3 A;  2WCI A;  4F0C A;  5FWG A;  4KDY A;  4HQZ A;  5EPF A;  1PN9 A;  5KN2 A;  4L5O A;  3GRX A;  4HJM A;  4TN8 A;  4F82 A;  2BMX A;  3PIN A;  3HA9 A;  4BL7 A;  2V6K A;  1TW9 A;  2L4Q A;  1WP0 A;  3L9V A;  2PMT A;  4V2M A;  2H73 A;  1SK1 A;  5EY6 A;  3M1G A;  2OA7 A;  4ZXG A;  3U5R E;  3CRT A;  4P3Y B;  5KN1 A;  3VWU A;  3A2W A;  3EC3 A;  2H1B A;  3Q6O A;  4ZL8 A;  5AN1 A;  3A5W A;  2IPA A;  1UC7 A;  1X5D A;  5D96 A;  2YZU A;  3GX8 A;  4YQV A;  3PH9 A;  5FT3 A;  2YV7 A;  3P8W A;  1JFU A;  1TI3 A;  2QSI A;  3F3R A;  2FUG 2;  4RQX A;  3RBT A;  4NHZ A;  2GS3 A;  1Q98 A;  3EU4 A;  1Y25 A;  1G7O A;  2VCZ A;  2L59 A;  4WF5 A;  3ZVJ A;  4EXJ A;  3EMX A;  2JZT A;  5F0G A;  2DJ1 A;  5B6N A;  1BYE A;  1BX9 A;  4Q5R A;  3LGC A;  4YAV A;  2GT5 A;  3ZYW A;  1Z6M A;  5EL8 A;  3TOT A;  4ZBA A;  1B9Y C;  3LWA A;  4ZB8 A;  1TRW A;  1VGL A;  1XCC A;  1FVJ A;  4L8E A;  2OJL A;  4XS4 B;  3ZFL A;  3HVS A;  5DJM A;  1O8X A;  1GUM A;  2IMF A;  3DKS A;  1X5C A;  2C8U A;  2P31 A;  1JLV A;  17GS A;  4GSN A;  2F3M A;  2R2J A;  3FR6 A;  3R2Q A;  5HQP A;  1EV4 A;  2ZNM A;  3ERW A;  1R26 A;  4F0B A;  1EWX A;  2WUL A;  3C1R A;  2GDR A;  1ACV A;  1NHY A;  4XIH A;  2C0E A;  4PUA A;  3FHK A;  4KA0 A;  1F9M A;  3GKK A;  4Q5F A;  1X0R A;  1X9W B;  2HRK A;  3UOM A;  1WRY A;  3TGZ A;  5DBQ A;  1TRV A;  5IMZ A;  2PPT A;  3ZVJ D;  1W89 A;  5G5E A;  2HT9 A;  5HR3 A;  1VF3 A;  2NBS A;  4KUN A;  2LQQ A;  4Q5Q A;  3EMP A;  4EO3 A;  4GQC A;  2F9S A;  2L5L A;  4O32 A;  5D9W A;  1FB6 A;  1PSQ A;  3DXB A;  3IV4 A;  2C4J A;  1TKD B;  3FR3 A;  5E59 A;  5LNK e;  1A8Y A;  1RK4 A;  2VCV A;  5CRE A;  5F05 A;  4D73 B;  1GWC A;  1AW9 A;  4EL1 A;  2LV3 A;  2DML A;  1KTE A;  1OKD A;  5IOX A;  4IW9 A;  3GSS A;  1MDK A;  5ENU A;  4CW9 A;  4G19 A;  2YWO A;  3MAK A;  1A0F A;  1WWJ A;  4KCE A;  2P5R A;  1XW5 A;  2CVB A;  1XOA A;  2A4V A;  2FY6 A;  2EIO A;  2JL4 A;  2RLI A;  2I81 A;  1F3A A;  5IQY A;  2E2G A;  4IP6 A;  3G7J A;  2K18 A;  2DJK A;  5ID2 A;  4EDY A;  1JZW A;  3HJP A;  4NAX A;  1PMT A;  5DAK B;  2MBS A;  2OE3 A;  3W8S A;  3TRP A;  1NSW A;  5C04 A;  3UJ1 A;  2LS5 A;  4GXZ A;  1VRS D;  4EE0 A;  3ZML A;  4HS1 A;  1TU8 A;  5CYY A;  2R5G A;  1ON4 A;  2CAQ A;  3Q74 A;  1AQV A;  2RUF A;  5A4U A;  2IJY A;  5IMF A;  4MJA A;  2KHP A;  4HDE A;  3M8N A;  3IC4 A;  4K8M A;  1C72 A;  1K0D A;  3TB2 A;  4I8B A;  3VPT A;  4POB A;  1JZD A;  1PQN A;  2FWF A;  3LJR A;  2YP6 A;  3I9V 2;  1GNE A;  4KSO A;  3FZA A;  5IIZ A;  1JHB A;  1SJ6 A;  3GA4 A;  3HY2 A;  3DD3 A;  3ZTL A;  2YPM A;  2ON5 A;  1XVQ A;  5JWQ B;  4RI7 A;  2CVK A;  2DC5 A;  3KZQ A;  1GSQ A;  1ERV A;  4KF9 A;  1ML6 A;  3H1N A;  3P2A A;  3M9K A;  1F6M C;  4WET A;  3LG6 A;  2LNT A;  1S3C A;  4EKZ A;  5ECI B;  3G9B A;  2JU5 A;  1R7H A;  2OBK A;  1EZK A;  5CO3 A;  1XXU A;  4POL A;  5H5Q A;  4Z7X A;  3UVH A;  1BJX A;  4K7O A;  2TIR A;  3S9F A;  4DEJ A;  1TK5 B;  3GHA A;  2CVD A;  3KEB A;  1TI1 A;  2J23 A;  3DVW A;  4FIW A;  2HRN A;  1YF0 A;  4BA7 A;  1A0R P;  2C0D A;  3WT2 A;  5COH A;  2OKA A;  2YJ7 A;  3RAZ A;  2GQK A;  1RQM A;  4MK3 A;  1G7E A;  3GUS A;  1H4O A;  2LUS A;  3KTL A;  1XIY A;  2H76 A;  3N9J A;  4PNF A;  4NV2 A;  4QQ7 A;  1NHO A;  1T8E B;  4FYB A;  2FWG A;  2GZP A;  2GT6 A;  1R5P A;  4NHW A;  4MJB A;  2LTK A;  1T1V A;  4TR1 B;  3ISO A;  4LMW A;  1V9W A;  1Z7P A;  4G9H A;  2LJK A;  4JRR A;  2TRC P;  2N5B A;  5CNW A;  1U88 A;  2HSY A;  6GSV A;  4PX1 A;  2HRA A;  1NW2 A;  3F9U A;  3HHV A;  3LYP A;  1SKS B;  1SL0 B;  2E2M A;  5BMU A;  1I5G A;  1A2L A;  5HR0 A;  18GS A;  3CSI A;  1UN2 A;  4ID0 A;  2CQ9 A;  5ECM B;  3UBL A;  3WT1 A;  3F6D A;  1TK0 B;  2O87 A;  4PUR A;  2C3T A;  2CX4 A;  2FGX A;  5KN3 A;  2GQM A;  4G10 A;  3MNG A;  5IMV A;  4I2U A;  2VM1 A;  1M9A A;  2IFQ A;  1XZO A;  2KP2 A;  1BG5 A;  4BVY A;  1TJD A;  3IE3 A;  5JCW A;  3PGT A;  3KP8 A;  4IGJ A;  2GLR A;  2JAC A;  3CXG A;  1K3O A;  2WDU A;  4ZIJ A;  3IHQ A;  3LQ7 A;  2GTU A;  4E8H A;  2H8L A;  4O5R A;  3RDW A;  3W6G A;  1EEJ A;  4KND A;  2IWT A;  3O76 A;  4PQ1 A;  2JSZ A;  1YZX A;  2R6K A;  2O8V B;  1ZYE A;  3GV1 A;  4LMV A;  1J08 A;  2HSN B;  1J0F A;  2VOC A;  3IR4 A;  1V40 A;  4PQH A;  4EDZ A;  2LKU A;  4IKH A;  1B8X A;  2AB6 A;  1BAY A;  3R3E A;  2AUV A;  3JCM L;  4ZBD A;  1GUK A;  2A2S A;  3KIJ A;  2L6D A;  2PVO C;  4N30 A;  1AQX A;  3VLN A;  2RII A;  1PL1 A;  2VD1 A;  4HZ2 A;  2IMK A;  1KEB A;  5IOW A;  2GSR A;  1EV9 A;  4PGT A;  3IK7 A;  5JCG A;  2VCW A;  2KUC A;  1JLW A;  1M0U A;  2K9F A;  4HOJ A;  4MZB A;  2HZF A;  3TKS C;  2B7J A;  2D2Z A;  1YKA A;  3CTF A;  3EWL A;  3TKS A;  3L9U A;  2LRC A;  3HZ8 A;  3W8J A;  4BPY A;  1SKR B;  2XC2 A;  3VFI A;  4G2E A;  4BVX B;  3LSZ A;  4QL7 A;  1URM A;  3APO A;  5JCU A;  1M9B A;  4AJ8 A;  2DSA A;  4MPG A;  1AAZ A;  5D73 A;  4ECI A;  2HLS A;  2R3X A;  2QKE A;  4IJ3 A;  1QK8 A;  4V1A g;  4H86 A;  1A2M A;  3DWV A;  1K0A A;  4TR0 A;  4TXO B;  1KNG A;  2GZY A;  1DUG A;  2HYX A;  4YAP A;  4IS0 A;  1WE0 A;  5CRD A;  2OE0 A;  4I2T A;  3ZZX A;  2HZE A;  1ZGN A;  1SD8 A;  3KH9 A;  3GTU B;  4J2F A;  4POK A;  2C0F A;  4OO4 A;  2FA4 A;  1SD9 A;  2A2R A;  5ELG A;  2PU9 C;  1GH2 A;  2N5A A;  5CRW A;  2ON7 A;  4OFT A;  4FYU A;  3P90 A;  5GSS A;  3LFL A;  1QGV A;  1K3Y A;  2X99 A;  4KX4 A;  2YWM A;  4IHU A;  4IVF A;  4TR3 A;  5G5F A;  1DBY A;  1THO A;  2LRN A;  4OCF A;  2OE1 A;  3CTG A;  2DJ2 A;  1T00 A;  5IPH A;  3TJF A;  1S3A A;  1EOG A;  4ML6 A;  4N10 A;  1U3I A;  2PBJ A;  2V32 A;  3VUR A;  4TR4 A;  4EUY A;  1HYU A;  3IXR A;  1ST9 A;  4LL1 B;  2VL2 C;  3VI5 A;  2QGV A;  3F6F A;  2VL2 A;  1MTC A;  1PA3 A;  1MD4 A;  1M7T A;  2YAN A;  1FW1 A;  3VPQ A;  3GH9 A;  4OMV A;  1OC9 A;  4CDO A;  2HSM B;  3ZIT A;  4NMU A;  4MJE A;  2C3N A;  5ECH B;  4XTS A;  5GAP D;  5AGY A;  3RHB A;  1GL8 A; 
#chains in the Genus database with same CATH topology
 2CT6 A;  5ECN B;  5HFK A;  2OT3 A;  1X9M B;  3EIN A;  3IPZ A;  4FO5 A;  1Z5Y E;  2CV4 A;  1Z6N A;  5KN0 A;  3WGX A;  2MMZ A;  3ZL5 A;  1EGO A;  3QAW A;  2HQT A;  1PX6 A;  1SYX A;  4BL7 B;  3DRN A;  1XOB A;  2XPE A;  2YJH A;  1A24 A;  2E7P A;  4QL9 A;  1XWG A;  3FW2 A;  3KGK A;  4IQA A;  4WBJ A;  5DCH A;  1SL2 B;  4ZB7 A;  4GWR A;  5J5N A;  4TRX A;  1WMJ A;  4YQM A;  3QFA C;  4WKW A;  4RI6 A;  1GSY A;  3F4S A;  1ZMA A;  3IAS 2;  3TDG A;  2OBI A;  4YKG A;  4AJ6 A;  3GH6 A;  5CRG A;  2LEG A;  1E2Y A;  2R0P A;  1V2A A;  4AJ7 A;  3ME8 A;  3GYK A;  4HU7 A;  3MSZ A;  5HFI A;  1K0O A;  2VCT A;  1N25 A;  2ZUP A;  3KH7 A;  3EUR A;  4X0X A;  4FYC A;  3E3E A;  2L4C A;  3OR5 A;  4Z2T A;  1Z3E A;  3D0Z A;  1TRU A;  2ALB A;  4EIQ A;  1ZZY A;  3H8Q A;  1CQG A;  7GSS A;  1K0N A;  3GIX A;  5F8B A;  5A5H B;  3APS A;  2H0I A;  3TOU A;  3LXZ A;  3VK9 A;  3C1S A;  2CZ2 A;  4ZB6 A;  3GX0 A;  2WS2 A;  2MBT A;  2JZS A;  2FHE A;  3QR6 A;  2X4A A;  2H70 A;  2IL3 A;  3RPN A;  4N0Z A;  4JED A;  3ZMK A;  5J41 A;  4IJI A;  4W66 A;  4NV5 A;  2YWI A;  4DSS A;  4LA1 A;  3D22 A;  2B5X A;  1YY7 A;  1LJR A;  4E68 A;  4YH2 A;  4KGI A;  1GUL A;  4E8E A;  3LYK A;  3HYP A;  2C3Q A;  4NWY A;  2O85 A;  5ECK B;  2GVP A;  4ZB9 A;  3NZN A;  3HJO A;  2K8V A;  3VWX A;  3KMO A;  4F2I A;  3LOR A;  2ZCT A;  2WJU A;  4X43 A;  3O6T A;  1TU7 A;  1OAZ A;  2K6V A;  3QPM A;  1YF1 A;  3LXT A;  3TJB A;  3ZLP A;  4TW5 A;  3ED3 A;  2J9H A;  3F0I A;  3I43 A;  1NM3 A;  2HRK B;  5DQY A;  4KW6 A;  4WXT A;  4ECC A;  1TK8 B;  2KP1 A;  3Q18 A;  2C80 A;  4O7H A;  3WYW A;  4DSR A;  3M9J A;  6GSU A;  2H19 A;  22GS A;  2I9H A;  3F63 A;  1GTU A;  1MDJ A;  4MF6 A;  2YWN A;  4ICY A;  14GS A;  3MDK A;  3NOF A;  3K8N A;  3IBH A;  4XRA A;  4OO5 A;  3P7X A;  4HU9 A;  2WVZ A;  2H66 A;  3FKF A;  3VI7 A;  1AQW A;  3UL3 A;  1OC8 A;  1M2A A;  3EE2 A;  1GSF A;  5IMD A;  3TJJ A;  4BIK A;  2DLX A;  2IMI A;  3HCZ A;  5LD0 A;  2VCX A;  3D4M A;  1S3R A;  1QQ2 A;  4PI2 C;  2VKZ G;  1T4Z A;  5D9X A;  2TRX A;  2JSY A;  4RUV A;  5A4V A;  6GSS A;  2GZZ A;  4FQU A;  4AKG A;  3HVN A;  5DDL A;  3KMN A;  5IM9 A;  1G6Y A;  4G0K A;  1DE1 A;  1EGR A;  3TRX A;  1N8J A;  3BCK A;  1SU9 A;  1ERW A;  5ID2 B;  1Y6E A;  2VUP A;  5DAL A;  1SVM A;  1XWA A;  3UAR A;  1WPI A;  1ERU A;  2UV8 G;  3J7Y b;  2LRT A;  4HZ4 A;  2HI7 A;  2V6O A;  4I6X A;  4N11 A;  3IA1 A;  3LW9 A;  2O5V A;  4L5L A;  4K7I A;  3DGQ A;  4TVE A;  2NPB A;  1QUW A;  1HD2 A;  1GLP A;  1EEM A;  3AY8 A;  2FWH A;  4XRD A;  3CYN A;  1ILO A;  2V1M A;  1K0B A;  1R5A A;  4HI7 A;  3EU3 A;  3EVI A;  4ULX A;  4G0L A;  2PUK C;  2RUE A;  4JR6 A;  4ZL9 A;  2XHF A;  3TRQ A;  4ML1 A;  5BRT A;  3KP9 A;  4ZBB A;  3M3M A;  2DJ3 A;  5CAX A;  3ZRE A;  2C0G A;  5KOX A;  4HEA 2;  2G0F A;  4KB3 A;  1N2A A;  1OC3 A;  1VF1 A;  3GL3 A;  3L4N A;  3ERG A;  3GN3 A;  4XS1 A;  3A2X A;  2B5Y A;  1YKC A;  2I4A A;  2IME A;  4POM A;  2VCQ A;  1TTZ A;  3QOU A;  2H6X A;  3DML A;  4LL4 B;  2PER A;  2M72 A;  4IN0 A;  4MCU A;  1O7U A;  3FR9 A;  1FOH A;  4Z2U A;  3BJ5 A;  1A2J A;  5CRH A;  5J3R A;  2HNL A;  2B3S A;  2OAC A;  3I69 A;  3FYG A;  1B4Q A;  2X49 A;  4OFN A;  2CAI A;  2F8A A;  2B7K A;  4KE3 A;  2MMN A;  1XG8 A;  5AIV A;  3FZ4 A;  5H5S A;  3IHG A;  3MIX A;  2FNO A;  4EVM A;  4GQF A;  3HD5 A;  1OE8 A;  1OYJ A;  3ZFB A;  2O89 A;  4YKF A;  1LU4 A;  2H75 A;  2LNS A;  3TKP A;  1O8W A;  3CSJ A;  4K6X A;  2EFD A;  4GTU A;  4MDC A;  2UZ8 A;  4NPB A;  4L0U A;  3TJG A;  3F8U A;  1GSE A;  5B6M A;  1A23 A;  5IMC A;  1V98 A;  2V41 A;  3FEU A;  5D9T A;  4X1U A;  1EOH A;  4N0V A;  4OFM A;  3IC8 A;  2H1D A;  1AUC A;  2YV9 A;  1PGT A;  2QC7 A;  4OD7 A;  5IO0 A;  3C7M A;  4K7N A;  5ECQ B;  1YQ1 A;  2LST A;  5IO2 A;  1XBS A;  4K5S A;  4MMM A;  2YN1 A;  4K1F A;  4XS4 A;  5L71 A;  4HJ2 A;  2X8G A;  2PWJ A;  5A34 B;  5INY A;  1THX A;  1OVN A;  2P0G A;  4BWS A;  5DCG A;  5GZZ B;  4ZL7 A;  1JZR A;  2GSQ A;  2VO4 A;  1S3D A;  3CSH A;  4WR4 A;  4AF2 A;  1PN0 A;  4KDX A;  3L9S A;  5BMU B;  4MZC A;  3VWW A;  1ZYQ B;  3HDC A;  3RGB C;  4ACS A;  3IDV A;  1XVW A;  2A2P A;  5FHI A;  2JAD A;  1U87 A;  3HXS A;  1XWK A;  3ZIV A;  3DVX A;  1B9X C;  1SJZ A;  5AIS A;  3CHX C;  1QFN A;  1V57 A;  4MA9 A;  2IFQ B;  2WZ9 A;  4K0G A;  3SWL A;  1TDI A;  3E0U A;  1YEP A;  4MH2 A;  4MF7 A;  2IN3 A;  3LEF A;  3BBY A;  5B7C A;  4BVY B;  2MMO A;  1HQO A;  4KH7 A;  2C1Y A;  4RQR A;  2E0Q A;  3D4T A;  5G1K A;  3H4K A;  4OCE A;  2L57 A;  4TOP A;  3GMF A;  2WW0 A;  2H6Y A;  4ECJ A;  2P5Q A;  1IYI A;  4D73 A;  3L0H A;  1O73 A;  1YEX A;  4OWY A;  3HZ4 A;  5DVB A;  4JZQ A;  4X4J A;  2B5E A;  5H5R A;  2H0G A;  4F03 A;  2DIY A;  1A8L A;  2RM5 A;  3HVX A;  2F8F A;  3UVT A;  1ERT A;  3CBU A;  4PUF C;  5LCZ A;  1T4Y A;  4WF4 A;  4JBB A;  6GST A;  2OAD A;  4I5Q A;  1M3J A;  1VF4 A;  2AV4 A;  5G2Z A;  4FH8 A;  3DEX A;  3WD6 A;  3E9J B;  2PN8 A;  2VD0 A;  5A4W A;  3UMA A;  6GSX A;  5ECR B;  2H1L A;  3CMI A;  5IMA A;  12GS A;  5G30 A;  4HSC X;  4HQS A;  4JU5 A;  4GSS A;  3DYR A;  1Q4J A;  3H79 A;  2H0H A;  3HKR A;  1Z9H A;  1SEN A;  5ELA A;  4ZIL A;  4HUA A;  5DAK A;  4J56 E;  3RHC A;  2ES7 A;  2YNX A;  4MAB A;  2MYG A;  4K2X A;  2X8H A;  2H72 A;  3C71 A;  1XPV A;  2HSH A;  1TRS A;  4MF5 A;  4JE1 A;  1K3L A;  5KOW A;  1BED A;  1B4P A;  4Z2R A;  1WOU A;  1GSU A;  4EIP A;  1GRX A;  4G01 A;  1X5E A;  1ZCP A;  1O81 A;  2MZC A;  3CQF A;  1CQH A;  1AXD A;  2DIZ A;  10GS A;  1MD3 A;  4QMK A;  5A1N A;  6GSW A;  1GLQ A;  1PX7 A;  5DQS A;  3KCM A;  1FB0 A;  1FO5 A;  1USB A;  4AKX B;  3WGE A;  5ECP B;  2NTO A;  3QDN A;  5B8A A;  4XCS A;  2FCH A;  5HR2 A;  2H01 A;  2JZR A;  1M2D A;  2VLT A;  11GS A;  3I6A A;  2HZE B;  1ZYN A;  5IPG A;  3GFK A;  1F3B A;  3C8E A;  3FZ9 A;  2I1U A;  2FWE A;  4MLY A;  4PNG A;  3D5J A;  4CY8 A;  3UIW A;  2YCD A;  4EC0 A;  2VLU A;  1V58 A;  1ZOF A;  2H74 A;  1G6W A;  4TXV A;  2X8C A;  2VM2 A;  4EF0 A;  2DJJ A;  1Z7R A;  4I97 A;  1SL1 B;  1OE7 A;  4WR5 A;  5E4W A;  4MZW A;  2L5O A;  2NVL A;  3APQ A;  5B8B A;  4IBP A;  4IQ1 A;  1F37 A;  2PVQ A;  1UA5 A;  1GTB A;  3BCI A;  20GS A;  2H71 A;  2L6C A;  3M0F A;  2V2G A;  2B1L A;  2R4V A;  4JR4 A;  1ABA A;  1I9D A;  2Z9S A;  4A5P A;  2DJ0 A;  2LQO A;  4TR1 A;  5D8I A;  1SK0 A;  3EYT A;  3N5O A;  5ECO B;  3TKS E;  2GQL A;  6GSY A;  1WIK A;  9GSS A;  2FD3 A;  2M80 A;  4G0I A;  3ZIJ A;  4LLR A;  4KDU A;  4ECB A;  1HNB A;  2EIQ A;  1XFL A;  1O6J A;  1OC9 B;  3CRU A;  3TKR A;  1G0T A;  2CX3 A;  3BOA A;  3DIE A;  3QMX A;  1T7P B;  1K0C A;  2REM A;  4GST A;  2WGR A;  4J57 E;  4K9Z A;  4CY6 A;  5D93 A;  2LJA A;  3L78 A;  2EIR A;  4PTS A;  1XWC A;  2G2Q A;  2VL9 A;  4IEL A;  5D9V A;  3ZRD A;  4IP1 A;  2KOK A;  2B1K A;  3GNJ A;  5F07 A;  1ZL9 A;  1SK2 A;  1XW6 A;  3HVV A;  5G31 A;  2XBI A;  3GST A;  1O85 A;  3HJM A;  3UBK A;  3EPT A;  2HXK A;  2H1A A;  3KXO A;  3GKX A;  3FRC A;  3PPU A;  1WJK A;  2I3Y A;  1PL2 A;  2CA8 A;  2CZ3 A;  2FLS A;  3F4R A;  1YEW C;  3GKN A;  1EP7 A;  1TOF A;  3QD9 A;  1B48 A;  2HE3 A;  2HRF A;  3US3 A;  4AI6 A;  3TUE A;  13GS A;  1S4B P;  2AYT A;  3NIV A;  1AIU A;  3FZ5 A;  3TU3 B;  1M2B A;  2O7K A;  3MWH A;  4CHS A;  2YOI A;  1J9B A;  3FK8 A;  2AJQ B;  5CP1 A;  2WVX A;  2NDO A;  1PKW A;  2HSN A;  2B6M A;  4XS6 A;  5J4Y A;  2IIY A;  3GL5 A;  2WZS A;  2X64 A;  4AGS A;  1U6T A;  5HFG A;  1T3B A;  1QMV A;  1GSS A;  5F06 A;  3TKQ A;  5EVO A;  2VAF A;  1X9S B;  3RFR C;  3UAP A;  1FHE A;  3H93 A;  5J40 A;  1E6B A;  3QFB C;  4TKY A;  2K8S A;  1IYH A;  4PXO A;  2WVY A;  1BF5 A;  2F51 A;  3BD2 A;  1DE2 A;  1M99 A;  1MEK A;  5J9C A;  4DSS B;  4F9Z A;  3QAV A;  1GSD A;  3FY7 A;  4O92 A;  4BVX A;  4KAE A;  3KJY A;  4YQU A;  1PFO A;  3SBC A;  2KLX A;  3A2V A;  1LBK A;  1SYR A;  4ILF A;  3IK9 A;  3PR8 A;  2FA8 A;  3WGD A;  5J9B A;  1VF2 A;  4AKH A;  3V1W A;  1R4W A;  2EC4 A;  2WFC A;  4PQI A;  3D21 A;  1FVK A;  3Q19 A;  3VWV A;  3D6I A;  1GUH A;  2VIM A;  4DSQ A;  1H75 A;  1K0M A;  1XWB A;  4TXO A;  3F4T A;  2DMM A;  4KSM A;  4ISD A;  3FMW A;  5GAN D;  5HR1 A;  19GS A;  5JWO B;  3J7Y k;  3KM6 A;  2GST A;  1TXX A;  4BWQ A;  3GTU A;  2LJR A;  16GS A;  2PGT A;  1PD2 1;  4O5Q A;  2AAW A;  4K0N A;  1U3A A;  2N5F A;  5C00 A;  1FG4 A;  1UVZ A;  4GCI A;  2MMA A;  2VLV A;  8GSS A;  2XBQ A;  5DJL A;  1YDK A;  5KEJ A;  4Q5N A;  4XHM A;  2BTO T;  1XW9 A;  5JWR B;  2WB9 A;  1SKW B;  3O3T A;  3GUR A;  2RM6 A;  3ERF A;  2H1G A;  3IRA A;  4WBR D;  2M46 A;  3G7Y A;  4GLT A;  1QXH A;  1DSB A;  4V2N A;  2GSS A;  2BJX A;  1AC1 A;  2IMD A;  2DBC A;  1PRX A;  1W4V A;  2A4H A;  5A5K A;  4V2L A;  3GKM A;  2R0G A;  1GNW A;  2R37 A;  4WEY A;  4KCA A;  2AHE A;  4K2D A;  4MP4 A;  4MH3 A;  4GRF A;  1JZO A;  3QAG A;  1GTA A;  3IAM 2;  4L0W A;  5AIX A;  4MPF A;  4NXI A;  5G1L A;  3U6V A;  1OKT A;  4MJC A;  5DAL B;  3IOS A;  5ABR A;  1YJ6 A;  1KBN A;  4DVC A;  3ME7 A;  2H6Z A;  4USS A;  2WRT A;  1GP1 A;  1FAA A;  4FXY P;  1EP8 A;  3TCO A;  1BQ7 A;  1F2E A;  2HSM A;  2HFD A;  1PKZ A;  5GST A;  4GF0 A;  1HNC A;  3KD0 A;  1TP9 A;  5J4U A;  1MDI A;  3C73 A;  1SJI A;  3QCP A;  1HNA A;  3A3T A;  3RPP A;  2XPD A;  2GGT A;  2H30 A;  3UEM A;  5ECL B;  3KTB A;  3G7I A;  2YZH A;  3TJK A;  1FOV A;  5ECS A;  1GTI A;  3F3Q A;  4V1A p;  1RW1 A;  2VL3 A;  2WCI A;  4F0C A;  5FWG A;  4KDY A;  4HQZ A;  5EPF A;  1PN9 A;  5KN2 A;  1TXU A;  4L5O A;  3GRX A;  4HJM A;  2WW2 A;  4TN8 A;  4F82 A;  2BMX A;  3PIN A;  3HA9 A;  4BL7 A;  2EFE A;  2V6K A;  1TW9 A;  2L4Q A;  1WP0 A;  3L9V A;  2PMT A;  4V2M A;  2H73 A;  1SK1 A;  5EY6 A;  3M1G A;  2OA7 A;  4ZXG A;  3U5R E;  3CRT A;  4P3Y B;  5KN1 A;  3VWU A;  3A2W A;  3EC3 A;  2H1B A;  3Q6O A;  4ZL8 A;  5AN1 A;  3A5W A;  2IPA A;  1UC7 A;  1Y1U A;  1X5D A;  5D96 A;  2YZU A;  3GX8 A;  4YQV A;  3PH9 A;  4MNN A;  5FT3 A;  2YV7 A;  3P8W A;  1JFU A;  1TI3 A;  2QSI A;  3F3R A;  2FUG 2;  4RQX A;  3RBT A;  4NHZ A;  2GS3 A;  2QA2 A;  1Q98 A;  3EU4 A;  1Y25 A;  1G7O A;  4N3Z A;  2VCZ A;  2L59 A;  4WF5 A;  3ZVJ A;  4EXJ A;  3EMX A;  2JZT A;  5F0G A;  1ZYP A;  5A5H A;  2DJ1 A;  2O36 A;  5B6N A;  1BYE A;  1BX9 A;  4Q5R A;  3LGC A;  4YAV A;  2GT5 A;  3ZYW A;  1Z6M A;  5EL8 A;  3TOT A;  4ZBA A;  1B9Y C;  3LWA A;  4ZB8 A;  1TRW A;  1VGL A;  1XCC A;  1FVJ A;  4L8E A;  2OJL A;  4XS4 B;  3ZFL A;  3HVS A;  5DJM A;  1O8X A;  1GUM A;  2IMF A;  3DKS A;  1X5C A;  2C8U A;  2P31 A;  1JLV A;  17GS A;  4GSN A;  2F3M A;  2R2J A;  3FR6 A;  3R2Q A;  5HQP A;  1EV4 A;  2ZNM A;  3ERW A;  1R26 A;  4F0B A;  1EWX A;  2WUL A;  3C1R A;  2GDR A;  1ACV A;  1NHY A;  4XIH A;  2C0E A;  4PUA A;  3FHK A;  4KA0 A;  1F9M A;  3GKK A;  4Q5F A;  1X0R A;  1X9W B;  2HRK A;  3UOM A;  1WRY A;  3TGZ A;  5DBQ A;  1TRV A;  1M3I A;  5IMZ A;  2PPT A;  3ZVJ D;  1W89 A;  4AKI A;  5G5E A;  2HT9 A;  5HR3 A;  1VF3 A;  2NBS A;  4KUN A;  2LQQ A;  4Q5Q A;  3EMP A;  4EO3 A;  4GQC A;  2F9S A;  2L5L A;  4O32 A;  5D9W A;  1FB6 A;  1PSQ A;  3DXB A;  4PHZ C;  2C4J A;  3IV4 A;  1TKD B;  3FR3 A;  5J4V A;  5E59 A;  5LNK e;  1A8Y A;  1RK4 A;  2VCV A;  5CRE A;  5F05 A;  1SVO A;  4D73 B;  1GWC A;  1AW9 A;  4EL1 A;  2LV3 A;  2DML A;  3CWG A;  1KTE A;  1OKD A;  5IOX A;  4IW9 A;  3GSS A;  1MDK A;  1I1I P;  5ENU A;  4CW9 A;  4G19 A;  2YWO A;  3MAK A;  1A0F A;  1WWJ A;  4KCE A;  2P5R A;  1XW5 A;  2CVB A;  1XOA A;  2A4V A;  2FY6 A;  2EIO A;  2JL4 A;  2RLI A;  2I81 A;  1F3A A;  5IQY A;  2E2G A;  4IP6 A;  3G7J A;  2QA1 A;  2K18 A;  2DJK A;  5ID2 A;  4EDY A;  1JZW A;  3HJP A;  4NAX A;  1PMT A;  5DAK B;  2MBS A;  2OE3 A;  3W8S A;  3TRP A;  1NSW A;  5C04 A;  3UJ1 A;  2LS5 A;  4GXZ A;  1VRS D;  4EE0 A;  3ZML A;  1TU8 A;  4HS1 A;  5CYY A;  2R5G A;  1ON4 A;  2CAQ A;  3Q74 A;  1AQV A;  2RUF A;  3MYD A;  5A4U A;  2IJY A;  5IMF A;  4MJA A;  2KHP A;  4HDE A;  3M8N A;  3IC4 A;  4K8M A;  1C72 A;  1K0D A;  3TB2 A;  4I8B A;  3VPT A;  4POB A;  1JZD A;  1PQN A;  2FWF A;  3LJR A;  2YP6 A;  3I9V 2;  1GNE A;  4KSO A;  5A1N B;  3FZA A;  5IIZ A;  1JHB A;  1SJ6 A;  3GA4 A;  3HY2 A;  3DD3 A;  3ZTL A;  2YPM A;  2ON5 A;  1XVQ A;  5JWQ B;  4RI7 A;  2CVK A;  2DC5 A;  3KZQ A;  1GSQ A;  1ERV A;  4KF9 A;  1ML6 A;  3H1N A;  3P2A A;  3M9K A;  1F6M C;  4WET A;  3LG6 A;  2LNT A;  1S3C A;  4EKZ A;  5ECI B;  3G9B A;  2JU5 A;  2WW3 A;  1R7H A;  2OBK A;  1EZK A;  5CO3 A;  1XXU A;  4POL A;  5H5Q A;  4Z7X A;  3UVH A;  1BJX A;  4K7O A;  2TIR A;  3S9F A;  4DEJ A;  1TK5 B;  3GHA A;  2CVD A;  3KEB A;  1TI1 A;  2J23 A;  3DVW A;  4FIW A;  2HRN A;  1YF0 A;  4BA7 A;  1A0R P;  2C0D A;  3WT2 A;  5COH A;  2OKA A;  2YJ7 A;  3RAZ A;  2GQK A;  1RQM A;  4MK3 A;  1G7E A;  3GUS A;  1H4O A;  2LUS A;  3KTL A;  1XIY A;  2H76 A;  3N9J A;  4PNF A;  4NV2 A;  4QQ7 A;  1NHO A;  1T8E B;  4FYB A;  2FWG A;  2EFC A;  2GT6 A;  2GZP A;  1R5P A;  4NHW A;  4MJB A;  2LTK A;  1T1V A;  4TR1 B;  3ISO A;  4LMW A;  1V9W A;  1Z7P A;  4G9H A;  2LJK A;  4JRR A;  2TRC P;  2N5B A;  5CNW A;  1U88 A;  2HSY A;  6GSV A;  5A34 A;  1SVL A;  4PX1 A;  2HRA A;  1NW2 A;  3F9U A;  3HHV A;  3LYP A;  1SKS B;  1SL0 B;  2E2M A;  5BMU A;  1I5G A;  1A2L A;  5HR0 A;  18GS A;  3CSI A;  1UN2 A;  4ID0 A;  3HMJ G;  2CQ9 A;  5ECM B;  3UBL A;  3WT1 A;  3F6D A;  1TK0 B;  2O87 A;  4PUR A;  2C3T A;  2CX4 A;  2FGX A;  5KN3 A;  2GQM A;  4G10 A;  3MNG A;  5IMV A;  4I2U A;  2VM1 A;  1M9A A;  2IFQ A;  1XZO A;  2KP2 A;  1BG5 A;  4BVY A;  1TJD A;  3IE3 A;  5JCW A;  3PGT A;  3KP8 A;  4IGJ A;  2GLR A;  2JAC A;  3CXG A;  1K3O A;  2WDU A;  4ZIJ A;  3IHQ A;  3LQ7 A;  2WW1 A;  2GTU A;  4E8H A;  2H8L A;  4O5R A;  3RDW A;  2O3E A;  3W6G A;  1EEJ A;  4KND A;  2IWT A;  3O76 A;  4PQ1 A;  2JSZ A;  1YZX A;  2R6K A;  2DKH A;  2O8V B;  1ZYE A;  3GV1 A;  2WVX B;  4LMV A;  1J08 A;  2HSN B;  1J0F A;  2VOC A;  3IR4 A;  1V40 A;  5J47 A;  4PQH A;  4EDZ A;  2LKU A;  4IKH A;  1B8X A;  2AB6 A;  1BAY A;  3R3E A;  2AUV A;  3JCM L;  4ZBD A;  1GUK A;  2A2S A;  3KIJ A;  2L6D A;  2PVO C;  3A5I A;  4N30 A;  1AQX A;  3VLN A;  2RII A;  1PL1 A;  2VD1 A;  4HZ2 A;  2R0C A;  2IMK A;  1KEB A;  5IOW A;  2GSR A;  1EV9 A;  4PGT A;  3IK7 A;  5JCG A;  2VCW A;  2KUC A;  1JLW A;  4O5U A;  1M0U A;  2K9F A;  1YVL A;  4HOJ A;  4MZB A;  2HZF A;  3TKS C;  2B7J A;  2D2Z A;  1YKA A;  3CTF A;  3EWL A;  3TKS A;  3L9U A;  2LRC A;  3HZ8 A;  3W8J A;  4BPY A;  1SKR B;  2XC2 A;  3VFI A;  4G2E A;  4BVX B;  3LSZ A;  4QL7 A;  2EFH A;  1URM A;  3APO A;  5JCU A;  1M9B A;  4AJ8 A;  2DSA A;  4MPG A;  1AAZ A;  5D73 A;  4ECI A;  2HLS A;  2R3X A;  2QKE A;  4IJ3 A;  1QK8 A;  4V1A g;  4H86 A;  1A2M A;  3DWV A;  1K0A A;  4TR0 A;  4TXO B;  1KNG A;  2GZY A;  1DUG A;  2HYX A;  4YAP A;  4IS0 A;  1WE0 A;  5CRD A;  2OE0 A;  4I2T A;  3ZZX A;  2HZE A;  1ZGN A;  1SD8 A;  3KH9 A;  3GTU B;  4J2F A;  4POK A;  2C0F A;  4OO4 A;  2FA4 A;  1SD9 A;  2A2R A;  5ELG A;  2PU9 C;  1GH2 A;  2N5A A;  5CRW A;  2ON7 A;  4OFT A;  4FYU A;  3P90 A;  5GSS A;  3LFL A;  1QGV A;  1K3Y A;  2X99 A;  4KX4 A;  2YWM A;  4IHU A;  4IVF A;  4TR3 A;  5G5F A;  1DBY A;  1THO A;  2LRN A;  4OCF A;  2OE1 A;  3CTG A;  4PI0 C;  2DJ2 A;  1BG1 A;  1T00 A;  5IPH A;  3TJF A;  1S3A A;  1EOG A;  4ML6 A;  4N10 A;  1U3I A;  2PBJ A;  2V32 A;  3VUR A;  4TR4 A;  4EUY A;  1HYU A;  3IXR A;  1ST9 A;  4LL1 B;  2VL2 C;  3VI5 A;  2QGV A;  3F6F A;  2VL2 A;  1MTC A;  1PA3 A;  1MD4 A;  1M7T A;  2YAN A;  1FW1 A;  3VPQ A;  3GH9 A;  4OMV A;  1OC9 A;  4CDO A;  2HSM B;  4K5R A;  3ZIT A;  4GDF A;  4NMU A;  4MJE A;  2C3N A;  2DKI A;  5ECH B;  4XTS A;  5GAP D;  5AGY A;  3RHB A;  1GL8 A; 
#chains in the Genus database with same CATH homology
 2CT6 A;  5ECN B;  5HFK A;  2OT3 A;  1X9M B;  3EIN A;  3IPZ A;  4FO5 A;  1Z5Y E;  2CV4 A;  1Z6N A;  5KN0 A;  3WGX A;  2MMZ A;  3ZL5 A;  1EGO A;  3QAW A;  2HQT A;  1PX6 A;  1SYX A;  4BL7 B;  3DRN A;  1XOB A;  2XPE A;  2YJH A;  1A24 A;  2E7P A;  4QL9 A;  1XWG A;  3FW2 A;  3KGK A;  4IQA A;  4WBJ A;  5DCH A;  1SL2 B;  4ZB7 A;  4GWR A;  5J5N A;  4TRX A;  1WMJ A;  4YQM A;  3QFA C;  4WKW A;  4RI6 A;  1GSY A;  3F4S A;  1ZMA A;  3IAS 2;  3TDG A;  2OBI A;  4YKG A;  4AJ6 A;  3GH6 A;  5CRG A;  2LEG A;  1E2Y A;  2R0P A;  1V2A A;  4AJ7 A;  3ME8 A;  3GYK A;  4HU7 A;  3MSZ A;  5HFI A;  1K0O A;  2VCT A;  1N25 A;  2ZUP A;  3KH7 A;  3EUR A;  4X0X A;  4FYC A;  3E3E A;  2L4C A;  3OR5 A;  4Z2T A;  1Z3E A;  3D0Z A;  1TRU A;  2ALB A;  4EIQ A;  1ZZY A;  3H8Q A;  1CQG A;  7GSS A;  1K0N A;  3GIX A;  5F8B A;  5A5H B;  3APS A;  2H0I A;  3TOU A;  3LXZ A;  3VK9 A;  3C1S A;  2CZ2 A;  4ZB6 A;  3GX0 A;  2WS2 A;  2MBT A;  2JZS A;  2FHE A;  3QR6 A;  2X4A A;  2H70 A;  2IL3 A;  3RPN A;  4N0Z A;  4JED A;  3ZMK A;  5J41 A;  4IJI A;  4W66 A;  4NV5 A;  2YWI A;  4DSS A;  4LA1 A;  3D22 A;  2B5X A;  1YY7 A;  1LJR A;  4E68 A;  4YH2 A;  4KGI A;  1GUL A;  4E8E A;  3LYK A;  3HYP A;  2C3Q A;  4NWY A;  2O85 A;  5ECK B;  2GVP A;  4ZB9 A;  3NZN A;  3HJO A;  2K8V A;  3VWX A;  3KMO A;  4F2I A;  3LOR A;  2ZCT A;  2WJU A;  4X43 A;  3O6T A;  1TU7 A;  1OAZ A;  2K6V A;  3QPM A;  1YF1 A;  3LXT A;  3TJB A;  3ZLP A;  4TW5 A;  3ED3 A;  2J9H A;  3F0I A;  3I43 A;  1NM3 A;  2HRK B;  5DQY A;  4KW6 A;  4WXT A;  4ECC A;  1TK8 B;  2KP1 A;  3Q18 A;  2C80 A;  4O7H A;  3WYW A;  4DSR A;  3M9J A;  6GSU A;  2H19 A;  22GS A;  2I9H A;  3F63 A;  1GTU A;  1MDJ A;  4MF6 A;  2YWN A;  4ICY A;  14GS A;  3MDK A;  3NOF A;  3K8N A;  3IBH A;  4XRA A;  4OO5 A;  3P7X A;  4HU9 A;  2H66 A;  3FKF A;  3VI7 A;  1AQW A;  3UL3 A;  1OC8 A;  1M2A A;  3EE2 A;  1GSF A;  5IMD A;  3TJJ A;  2DLX A;  2IMI A;  3HCZ A;  5LD0 A;  2VCX A;  3D4M A;  1QQ2 A;  2VKZ G;  1T4Z A;  5D9X A;  2TRX A;  2JSY A;  4RUV A;  5A4V A;  6GSS A;  2GZZ A;  4FQU A;  4AKG A;  5DDL A;  3KMN A;  5IM9 A;  1G6Y A;  4G0K A;  1DE1 A;  1EGR A;  3TRX A;  1N8J A;  3BCK A;  1SU9 A;  1ERW A;  5ID2 B;  1Y6E A;  2VUP A;  5DAL A;  1SVM A;  1XWA A;  3UAR A;  1WPI A;  1ERU A;  2UV8 G;  3J7Y b;  2LRT A;  4HZ4 A;  2HI7 A;  2V6O A;  4I6X A;  4N11 A;  3IA1 A;  3LW9 A;  2O5V A;  4L5L A;  4K7I A;  3DGQ A;  4TVE A;  2NPB A;  1QUW A;  1HD2 A;  1GLP A;  1EEM A;  3AY8 A;  2FWH A;  4XRD A;  3CYN A;  1ILO A;  2V1M A;  1K0B A;  1R5A A;  4HI7 A;  3EU3 A;  3EVI A;  4ULX A;  4G0L A;  2PUK C;  2RUE A;  4JR6 A;  4ZL9 A;  2XHF A;  3TRQ A;  4ML1 A;  5BRT A;  3KP9 A;  4ZBB A;  3M3M A;  2DJ3 A;  5CAX A;  3ZRE A;  2C0G A;  5KOX A;  4HEA 2;  2G0F A;  4KB3 A;  1N2A A;  1OC3 A;  1VF1 A;  3GL3 A;  3L4N A;  3ERG A;  3GN3 A;  4XS1 A;  3A2X A;  2B5Y A;  1YKC A;  2I4A A;  2IME A;  4POM A;  2VCQ A;  1TTZ A;  3QOU A;  2H6X A;  3DML A;  4LL4 B;  2PER A;  2M72 A;  4IN0 A;  4MCU A;  1O7U A;  3FR9 A;  1FOH A;  4Z2U A;  3BJ5 A;  1A2J A;  5CRH A;  5J3R A;  2HNL A;  2B3S A;  2OAC A;  3I69 A;  3FYG A;  1B4Q A;  2X49 A;  4OFN A;  2CAI A;  2F8A A;  2B7K A;  4KE3 A;  2MMN A;  5AIV A;  3FZ4 A;  5H5S A;  3IHG A;  3MIX A;  2FNO A;  4EVM A;  4GQF A;  3HD5 A;  1OE8 A;  1OYJ A;  3ZFB A;  2O89 A;  4YKF A;  1LU4 A;  2H75 A;  2LNS A;  3TKP A;  1O8W A;  3CSJ A;  4K6X A;  2EFD A;  4GTU A;  4MDC A;  2UZ8 A;  4NPB A;  4L0U A;  3TJG A;  3F8U A;  1GSE A;  5B6M A;  1A23 A;  5IMC A;  1V98 A;  2V41 A;  3FEU A;  5D9T A;  4X1U A;  1EOH A;  4N0V A;  4OFM A;  3IC8 A;  2H1D A;  1AUC A;  2YV9 A;  1PGT A;  2QC7 A;  4OD7 A;  5IO0 A;  3C7M A;  4K7N A;  5ECQ B;  1YQ1 A;  2LST A;  5IO2 A;  1XBS A;  4K5S A;  4MMM A;  2YN1 A;  4K1F A;  4XS4 A;  5L71 A;  4HJ2 A;  2X8G A;  2PWJ A;  5A34 B;  5INY A;  1THX A;  1OVN A;  2P0G A;  4BWS A;  5DCG A;  5GZZ B;  4ZL7 A;  1JZR A;  2GSQ A;  2VO4 A;  1S3D A;  3CSH A;  4WR4 A;  4AF2 A;  1PN0 A;  4KDX A;  3L9S A;  5BMU B;  4MZC A;  3VWW A;  1ZYQ B;  3HDC A;  4ACS A;  3IDV A;  1XVW A;  2A2P A;  5FHI A;  2JAD A;  1U87 A;  3HXS A;  1XWK A;  3ZIV A;  3DVX A;  1B9X C;  1SJZ A;  5AIS A;  1QFN A;  1V57 A;  4MA9 A;  2IFQ B;  2WZ9 A;  4K0G A;  3SWL A;  1TDI A;  3E0U A;  1YEP A;  4MH2 A;  4MF7 A;  2IN3 A;  3LEF A;  3BBY A;  5B7C A;  4BVY B;  2MMO A;  1HQO A;  4KH7 A;  2C1Y A;  4RQR A;  2E0Q A;  3D4T A;  5G1K A;  3H4K A;  4OCE A;  2L57 A;  4TOP A;  3GMF A;  2H6Y A;  4ECJ A;  2P5Q A;  1IYI A;  4D73 A;  3L0H A;  1O73 A;  1YEX A;  4OWY A;  3HZ4 A;  5DVB A;  4JZQ A;  4X4J A;  2B5E A;  5H5R A;  2H0G A;  4F03 A;  2DIY A;  1A8L A;  2RM5 A;  3HVX A;  2F8F A;  3UVT A;  1ERT A;  3CBU A;  4PUF C;  5LCZ A;  1T4Y A;  4WF4 A;  4JBB A;  6GST A;  2OAD A;  4I5Q A;  1VF4 A;  2AV4 A;  5G2Z A;  4FH8 A;  3DEX A;  3WD6 A;  3E9J B;  2PN8 A;  2VD0 A;  5A4W A;  3UMA A;  6GSX A;  5ECR B;  2H1L A;  3CMI A;  5IMA A;  12GS A;  5G30 A;  4HQS A;  4JU5 A;  4GSS A;  3DYR A;  1Q4J A;  3H79 A;  2H0H A;  3HKR A;  1Z9H A;  1SEN A;  5ELA A;  4ZIL A;  4HUA A;  5DAK A;  4J56 E;  3RHC A;  2ES7 A;  2YNX A;  4MAB A;  2MYG A;  4K2X A;  2X8H A;  2H72 A;  3C71 A;  1XPV A;  2HSH A;  1TRS A;  4MF5 A;  4JE1 A;  1K3L A;  5KOW A;  1BED A;  1B4P A;  4Z2R A;  1WOU A;  1GSU A;  4EIP A;  1GRX A;  4G01 A;  1X5E A;  1ZCP A;  1O81 A;  2MZC A;  1CQH A;  1AXD A;  2DIZ A;  10GS A;  1MD3 A;  4QMK A;  5A1N A;  6GSW A;  1GLQ A;  1PX7 A;  5DQS A;  3KCM A;  1FB0 A;  1FO5 A;  1USB A;  4AKX B;  3WGE A;  5ECP B;  2NTO A;  3QDN A;  5B8A A;  4XCS A;  2FCH A;  5HR2 A;  2H01 A;  2JZR A;  1M2D A;  2VLT A;  11GS A;  3I6A A;  2HZE B;  1ZYN A;  5IPG A;  3GFK A;  1F3B A;  3C8E A;  3FZ9 A;  2I1U A;  2FWE A;  4MLY A;  4PNG A;  3D5J A;  4CY8 A;  3UIW A;  2YCD A;  4EC0 A;  2VLU A;  1V58 A;  1ZOF A;  2H74 A;  1G6W A;  4TXV A;  2X8C A;  2VM2 A;  4EF0 A;  2DJJ A;  1Z7R A;  4I97 A;  1SL1 B;  1OE7 A;  4WR5 A;  5E4W A;  4MZW A;  2L5O A;  2NVL A;  3APQ A;  5B8B A;  4IBP A;  4IQ1 A;  1F37 A;  2PVQ A;  1UA5 A;  1GTB A;  3BCI A;  20GS A;  2H71 A;  2L6C A;  3M0F A;  2V2G A;  2B1L A;  2R4V A;  4JR4 A;  1ABA A;  1I9D A;  2Z9S A;  4A5P A;  2DJ0 A;  2LQO A;  4TR1 A;  5D8I A;  1SK0 A;  3EYT A;  3N5O A;  5ECO B;  3TKS E;  2GQL A;  6GSY A;  1WIK A;  9GSS A;  2FD3 A;  2M80 A;  4G0I A;  3ZIJ A;  4LLR A;  4KDU A;  4ECB A;  1HNB A;  2EIQ A;  1XFL A;  1O6J A;  1OC9 B;  3CRU A;  3TKR A;  1G0T A;  2CX3 A;  3BOA A;  3DIE A;  3QMX A;  1T7P B;  1K0C A;  2REM A;  4GST A;  2WGR A;  4J57 E;  4K9Z A;  4CY6 A;  5D93 A;  2LJA A;  3L78 A;  2EIR A;  4PTS A;  1XWC A;  2G2Q A;  2VL9 A;  4IEL A;  5D9V A;  3ZRD A;  4IP1 A;  2KOK A;  2B1K A;  3GNJ A;  5F07 A;  1ZL9 A;  1SK2 A;  1XW6 A;  3HVV A;  5G31 A;  2XBI A;  3GST A;  1O85 A;  3HJM A;  3UBK A;  3EPT A;  2HXK A;  2H1A A;  3KXO A;  3GKX A;  3FRC A;  3PPU A;  1WJK A;  2I3Y A;  1PL2 A;  2CA8 A;  2CZ3 A;  2FLS A;  3F4R A;  3GKN A;  1EP7 A;  1TOF A;  3QD9 A;  1B48 A;  2HE3 A;  2HRF A;  3US3 A;  4AI6 A;  3TUE A;  13GS A;  2AYT A;  3NIV A;  1AIU A;  3FZ5 A;  3TU3 B;  1M2B A;  2O7K A;  3MWH A;  4CHS A;  2YOI A;  1J9B A;  3FK8 A;  2AJQ B;  5CP1 A;  2NDO A;  1PKW A;  2HSN A;  2B6M A;  4XS6 A;  5J4Y A;  2IIY A;  3GL5 A;  2X64 A;  4AGS A;  1U6T A;  5HFG A;  1T3B A;  1QMV A;  1GSS A;  5F06 A;  3TKQ A;  5EVO A;  2VAF A;  1X9S B;  3UAP A;  1FHE A;  3H93 A;  5J40 A;  1E6B A;  3QFB C;  4TKY A;  2K8S A;  1IYH A;  4PXO A;  1BF5 A;  2F51 A;  3BD2 A;  1DE2 A;  1M99 A;  1MEK A;  5J9C A;  4DSS B;  4F9Z A;  3QAV A;  1GSD A;  3FY7 A;  4O92 A;  4BVX A;  4KAE A;  3KJY A;  4YQU A;  3SBC A;  2KLX A;  3A2V A;  1LBK A;  1SYR A;  4ILF A;  3IK9 A;  3PR8 A;  2FA8 A;  3WGD A;  5J9B A;  1VF2 A;  4AKH A;  3V1W A;  1R4W A;  2EC4 A;  2WFC A;  4PQI A;  3D21 A;  1FVK A;  3Q19 A;  3VWV A;  3D6I A;  1GUH A;  2VIM A;  4DSQ A;  1H75 A;  1K0M A;  1XWB A;  4TXO A;  3F4T A;  2DMM A;  4KSM A;  4ISD A;  3FMW A;  5GAN D;  5HR1 A;  19GS A;  5JWO B;  3J7Y k;  3KM6 A;  2GST A;  1TXX A;  4BWQ A;  3GTU A;  2LJR A;  16GS A;  2PGT A;  1PD2 1;  4O5Q A;  2AAW A;  4K0N A;  1U3A A;  2N5F A;  5C00 A;  1FG4 A;  1UVZ A;  4GCI A;  2MMA A;  2VLV A;  8GSS A;  2XBQ A;  5DJL A;  1YDK A;  5KEJ A;  4Q5N A;  4XHM A;  2BTO T;  1XW9 A;  5JWR B;  2WB9 A;  1SKW B;  3O3T A;  3GUR A;  2RM6 A;  3ERF A;  2H1G A;  3IRA A;  4WBR D;  2M46 A;  3G7Y A;  4GLT A;  1QXH A;  1DSB A;  4V2N A;  2GSS A;  2BJX A;  1AC1 A;  2IMD A;  2DBC A;  1PRX A;  1W4V A;  2A4H A;  5A5K A;  4V2L A;  3GKM A;  2R0G A;  1GNW A;  2R37 A;  4WEY A;  4KCA A;  2AHE A;  4K2D A;  4MP4 A;  4MH3 A;  4GRF A;  1JZO A;  3QAG A;  1GTA A;  3IAM 2;  4L0W A;  5AIX A;  4MPF A;  4NXI A;  5G1L A;  3U6V A;  1OKT A;  4MJC A;  5DAL B;  3IOS A;  5ABR A;  1YJ6 A;  1KBN A;  4DVC A;  3ME7 A;  2H6Z A;  4USS A;  2WRT A;  1GP1 A;  1FAA A;  1EP8 A;  3TCO A;  1BQ7 A;  1F2E A;  2HSM A;  2HFD A;  1PKZ A;  5GST A;  4GF0 A;  1HNC A;  3KD0 A;  1TP9 A;  5J4U A;  1MDI A;  3C73 A;  1SJI A;  3QCP A;  1HNA A;  3A3T A;  3RPP A;  2XPD A;  2GGT A;  2H30 A;  3UEM A;  5ECL B;  3KTB A;  3G7I A;  2YZH A;  3TJK A;  1FOV A;  5ECS A;  1GTI A;  3F3Q A;  4V1A p;  1RW1 A;  2VL3 A;  2WCI A;  4F0C A;  5FWG A;  4KDY A;  4HQZ A;  5EPF A;  1PN9 A;  5KN2 A;  1TXU A;  4L5O A;  3GRX A;  4HJM A;  4TN8 A;  4F82 A;  2BMX A;  3PIN A;  3HA9 A;  4BL7 A;  2EFE A;  2V6K A;  1TW9 A;  2L4Q A;  1WP0 A;  3L9V A;  2PMT A;  4V2M A;  2H73 A;  1SK1 A;  5EY6 A;  3M1G A;  2OA7 A;  4ZXG A;  3U5R E;  3CRT A;  4P3Y B;  5KN1 A;  3VWU A;  3A2W A;  3EC3 A;  2H1B A;  3Q6O A;  4ZL8 A;  5AN1 A;  3A5W A;  2IPA A;  1UC7 A;  1Y1U A;  1X5D A;  5D96 A;  2YZU A;  3GX8 A;  4YQV A;  3PH9 A;  4MNN A;  5FT3 A;  2YV7 A;  3P8W A;  1JFU A;  1TI3 A;  2QSI A;  3F3R A;  2FUG 2;  4RQX A;  3RBT A;  4NHZ A;  2GS3 A;  2QA2 A;  1Q98 A;  3EU4 A;  1Y25 A;  1G7O A;  4N3Z A;  2VCZ A;  2L59 A;  4WF5 A;  3ZVJ A;  4EXJ A;  3EMX A;  2JZT A;  5F0G A;  1ZYP A;  5A5H A;  2DJ1 A;  5B6N A;  1BYE A;  1BX9 A;  4Q5R A;  3LGC A;  4YAV A;  2GT5 A;  3ZYW A;  1Z6M A;  5EL8 A;  3TOT A;  4ZBA A;  1B9Y C;  3LWA A;  4ZB8 A;  1TRW A;  1VGL A;  1XCC A;  1FVJ A;  4L8E A;  2OJL A;  4XS4 B;  3ZFL A;  3HVS A;  5DJM A;  1O8X A;  1GUM A;  2IMF A;  3DKS A;  1X5C A;  2C8U A;  2P31 A;  1JLV A;  17GS A;  4GSN A;  2F3M A;  2R2J A;  3FR6 A;  3R2Q A;  5HQP A;  1EV4 A;  2ZNM A;  3ERW A;  1R26 A;  4F0B A;  1EWX A;  2WUL A;  3C1R A;  2GDR A;  1ACV A;  1NHY A;  4XIH A;  2C0E A;  4PUA A;  3FHK A;  4KA0 A;  1F9M A;  3GKK A;  4Q5F A;  1X0R A;  1X9W B;  2HRK A;  3UOM A;  1WRY A;  3TGZ A;  5DBQ A;  1TRV A;  5IMZ A;  2PPT A;  3ZVJ D;  1W89 A;  4AKI A;  5G5E A;  2HT9 A;  5HR3 A;  1VF3 A;  2NBS A;  4KUN A;  2LQQ A;  4Q5Q A;  3EMP A;  4EO3 A;  4GQC A;  2F9S A;  2L5L A;  4O32 A;  5D9W A;  1FB6 A;  1PSQ A;  3DXB A;  3IV4 A;  2C4J A;  1TKD B;  3FR3 A;  5J4V A;  5E59 A;  5LNK e;  1A8Y A;  1RK4 A;  2VCV A;  5CRE A;  5F05 A;  1SVO A;  4D73 B;  1GWC A;  1AW9 A;  4EL1 A;  2LV3 A;  2DML A;  3CWG A;  1KTE A;  1OKD A;  5IOX A;  4IW9 A;  3GSS A;  1MDK A;  5ENU A;  4CW9 A;  4G19 A;  2YWO A;  3MAK A;  1A0F A;  1WWJ A;  4KCE A;  2P5R A;  1XW5 A;  2CVB A;  1XOA A;  2A4V A;  2FY6 A;  2EIO A;  2JL4 A;  2RLI A;  2I81 A;  1F3A A;  5IQY A;  2E2G A;  4IP6 A;  3G7J A;  2QA1 A;  2K18 A;  2DJK A;  5ID2 A;  4EDY A;  1JZW A;  3HJP A;  4NAX A;  1PMT A;  5DAK B;  2MBS A;  2OE3 A;  3W8S A;  3TRP A;  1NSW A;  5C04 A;  3UJ1 A;  2LS5 A;  4GXZ A;  1VRS D;  4EE0 A;  3ZML A;  1TU8 A;  4HS1 A;  5CYY A;  2R5G A;  1ON4 A;  2CAQ A;  3Q74 A;  1AQV A;  2RUF A;  3MYD A;  5A4U A;  2IJY A;  5IMF A;  4MJA A;  2KHP A;  4HDE A;  3M8N A;  3IC4 A;  4K8M A;  1C72 A;  1K0D A;  3TB2 A;  4I8B A;  3VPT A;  4POB A;  1JZD A;  1PQN A;  2FWF A;  3LJR A;  2YP6 A;  3I9V 2;  1GNE A;  4KSO A;  5A1N B;  3FZA A;  5IIZ A;  1JHB A;  1SJ6 A;  3GA4 A;  3HY2 A;  3DD3 A;  3ZTL A;  2YPM A;  2ON5 A;  1XVQ A;  5JWQ B;  4RI7 A;  2CVK A;  2DC5 A;  3KZQ A;  1GSQ A;  1ERV A;  4KF9 A;  1ML6 A;  3H1N A;  3P2A A;  3M9K A;  1F6M C;  4WET A;  3LG6 A;  2LNT A;  1S3C A;  4EKZ A;  5ECI B;  3G9B A;  2JU5 A;  1R7H A;  2OBK A;  1EZK A;  5CO3 A;  1XXU A;  4POL A;  5H5Q A;  4Z7X A;  3UVH A;  1BJX A;  4K7O A;  2TIR A;  3S9F A;  4DEJ A;  1TK5 B;  3GHA A;  2CVD A;  3KEB A;  1TI1 A;  2J23 A;  3DVW A;  4FIW A;  2HRN A;  1YF0 A;  4BA7 A;  1A0R P;  2C0D A;  3WT2 A;  5COH A;  2OKA A;  2YJ7 A;  3RAZ A;  2GQK A;  1RQM A;  4MK3 A;  1G7E A;  3GUS A;  1H4O A;  2LUS A;  3KTL A;  1XIY A;  2H76 A;  3N9J A;  4PNF A;  4NV2 A;  4QQ7 A;  1NHO A;  1T8E B;  4FYB A;  2FWG A;  2EFC A;  2GT6 A;  2GZP A;  1R5P A;  4NHW A;  4MJB A;  2LTK A;  1T1V A;  4TR1 B;  3ISO A;  4LMW A;  1V9W A;  1Z7P A;  4G9H A;  2LJK A;  4JRR A;  2TRC P;  2N5B A;  5CNW A;  1U88 A;  2HSY A;  6GSV A;  5A34 A;  1SVL A;  4PX1 A;  2HRA A;  1NW2 A;  3F9U A;  3HHV A;  3LYP A;  1SKS B;  1SL0 B;  2E2M A;  5BMU A;  1I5G A;  1A2L A;  5HR0 A;  18GS A;  3CSI A;  1UN2 A;  4ID0 A;  3HMJ G;  2CQ9 A;  5ECM B;  3UBL A;  3WT1 A;  3F6D A;  1TK0 B;  2O87 A;  4PUR A;  2C3T A;  2CX4 A;  2FGX A;  5KN3 A;  2GQM A;  4G10 A;  3MNG A;  5IMV A;  4I2U A;  2VM1 A;  1M9A A;  2IFQ A;  1XZO A;  2KP2 A;  1BG5 A;  4BVY A;  1TJD A;  3IE3 A;  5JCW A;  3PGT A;  3KP8 A;  4IGJ A;  2GLR A;  2JAC A;  3CXG A;  1K3O A;  2WDU A;  4ZIJ A;  3IHQ A;  3LQ7 A;  2GTU A;  4E8H A;  2H8L A;  4O5R A;  3RDW A;  3W6G A;  1EEJ A;  4KND A;  2IWT A;  3O76 A;  4PQ1 A;  2JSZ A;  1YZX A;  2R6K A;  2DKH A;  2O8V B;  1ZYE A;  3GV1 A;  4LMV A;  1J08 A;  2HSN B;  1J0F A;  2VOC A;  3IR4 A;  1V40 A;  5J47 A;  4PQH A;  4EDZ A;  2LKU A;  4IKH A;  1B8X A;  2AB6 A;  1BAY A;  3R3E A;  2AUV A;  3JCM L;  4ZBD A;  1GUK A;  2A2S A;  3KIJ A;  2L6D A;  2PVO C;  3A5I A;  4N30 A;  1AQX A;  3VLN A;  2RII A;  1PL1 A;  2VD1 A;  4HZ2 A;  2R0C A;  2IMK A;  1KEB A;  5IOW A;  2GSR A;  1EV9 A;  4PGT A;  3IK7 A;  5JCG A;  2VCW A;  2KUC A;  1JLW A;  4O5U A;  1M0U A;  2K9F A;  1YVL A;  4HOJ A;  4MZB A;  2HZF A;  3TKS C;  2B7J A;  2D2Z A;  1YKA A;  3CTF A;  3EWL A;  3TKS A;  3L9U A;  2LRC A;  3HZ8 A;  3W8J A;  4BPY A;  1SKR B;  2XC2 A;  3VFI A;  4G2E A;  4BVX B;  3LSZ A;  4QL7 A;  2EFH A;  1URM A;  3APO A;  5JCU A;  1M9B A;  4AJ8 A;  2DSA A;  4MPG A;  1AAZ A;  5D73 A;  4ECI A;  2HLS A;  2R3X A;  2QKE A;  4IJ3 A;  1QK8 A;  4V1A g;  4H86 A;  1A2M A;  3DWV A;  1K0A A;  4TR0 A;  4TXO B;  1KNG A;  2GZY A;  1DUG A;  2HYX A;  4YAP A;  4IS0 A;  1WE0 A;  5CRD A;  2OE0 A;  4I2T A;  3ZZX A;  2HZE A;  1ZGN A;  1SD8 A;  3KH9 A;  3GTU B;  4J2F A;  4POK A;  2C0F A;  4OO4 A;  2FA4 A;  1SD9 A;  2A2R A;  5ELG A;  2PU9 C;  1GH2 A;  2N5A A;  5CRW A;  2ON7 A;  4OFT A;  4FYU A;  3P90 A;  5GSS A;  3LFL A;  1QGV A;  1K3Y A;  2X99 A;  4KX4 A;  2YWM A;  4IHU A;  4IVF A;  4TR3 A;  5G5F A;  1DBY A;  1THO A;  2LRN A;  4OCF A;  2OE1 A;  3CTG A;  2DJ2 A;  1BG1 A;  1T00 A;  5IPH A;  3TJF A;  1S3A A;  1EOG A;  4ML6 A;  4N10 A;  1U3I A;  2PBJ A;  2V32 A;  3VUR A;  4TR4 A;  4EUY A;  1HYU A;  3IXR A;  1ST9 A;  4LL1 B;  2VL2 C;  3VI5 A;  2QGV A;  3F6F A;  2VL2 A;  1MTC A;  1PA3 A;  1MD4 A;  1M7T A;  2YAN A;  1FW1 A;  3VPQ A;  3GH9 A;  4OMV A;  1OC9 A;  4CDO A;  2HSM B;  4K5R A;  3ZIT A;  4GDF A;  4NMU A;  4MJE A;  2C3N A;  2DKI A;  5ECH B;  4XTS A;  5GAP D;  5AGY A;  3RHB A;  1GL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...