2ON7A

Structure of nagst-1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
206
structure length
206
Chain Sequence
MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQLAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRVEIKSFFYTVIGMREGDVEQLKKEVLLPARDKFFGFITKFLKKSPSGFLVGDSLTWVDLLVSEHNATMLTFVPEFLEGYPEVKEHMEKIRAIPKLKKWIETRPETLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Na Glutathione S-transferase 1
publication title X-ray structures of Na-GST-1 and Na-GST-2 two glutathione s-transferase from the human hookworm Necator americanus
pubmed doi rcsb
source organism Necator americanus
total genus 77
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2on7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2on7A01
2LJRA 2YCDA 1J08A 5EPFA 1GWCA 1T7PB 2JZSA 1ILOA 5J3RA 4ML1A 4DSSB 2VAFA 3F4SA 2AHEA 2J9HA 4HDEA 5D9WA 14GSA 3EE2A 1KTEA 4P3YB 2I1UA 2LEGA 2X99A 4OO5A 4K2DA 1A2JA 1THXA 4ZBAA 4K6XA 2VL2C 5D9VA 5ECOB 1RW1A 3DEXA 3UL3A 2V6OA 3TUEA 1U88A 1K0AA 1O81A 4MJAA 3ZTLA 5ECRB 4HJ2A 3G7YA 4L0WA 2VIMA 1WE0A 3GURA 1JZDA 4K7NA 4AJ7A 4N0ZA 2TRXA 2GTUA 2XBIA 4MPFA 3SWLA 1AQXA 1XFLA 5JWQB 1XWKA 2IJYA 5ECMB 5F06A 3TJKA 1TRSA 1XVQA 1MD3A 1GSQA 4YH2A 2OBIA 3NOFA 1FO5A 3F6DA 1UN2A 3TJGA 2VCZA 2LRTA 4NHWA 1F9MA 4V2NA 1THOA 2LS5A 2RUEA 1Y6EA 1GTBA 2RIIA 2DIZA 1G6WA 3HKRA 1A0RP 5KN2A 2OE1A 4HI7A 3QMXA 3F9UA 1BYEA 4HZ4A 5D9XA 4AJ8A 2REMA 1A8LA 3KXOA 4TR1A 3CYNA 5B8BA 5JWRB 1NW2A 1U3AA 5CREA 3HVXA 5KN3A 4XS4A 1OAZA 4BA7A 4I97A 4WKWA 3HYPA 1TOFA 3TKSE 1EV9A 2FNOA 4K0GA 3IC4A 4I5QA 5HQPA 5DAKA 5J41A 3IRAA 3HA9A 2WGRA 2O89A 2YJ7A 3G7JA 1VRSD 4ISDA 4ECBA 4GSTA 1YDKA 4TN8A 3L4NA 3GMFA 3AY8A 1E2YA 3GX0A 4JU5A 4NMUA 3QAWA 4Q5QA 5LNKe 3C1RA 5JCUA 4LMVA 3M0FA 1XWBA 3R3EA 2NDOA 4OO4A 3R2QA 2VM1A 3QFBC 2H6XA 4TOPA 2LSTA 3GV1A 3FZAA 3ZLPA 4TW5A 4K1FA 3FHKA 1R26A 4POMA 1GRXA 2WJUA 3GUSA 3GN3A 1SYXA 4PUAA 4WBJA 3UMAA 1HQOA 2LJAA 2GSTA 3GTUB 2H73A 4NAXA 1JLVA 4G9HA 2KP1A 3RHCA 3GH9A 2FA8A 5ECLB 5AISA 2WS2A 1Z5YE 4K0NA 1BJXA 3M9JA 4I6XA 2O8VB 3C1SA 13GSA 5GZZB 5IPHA 2H19A 2DJ3A 1PKZA 4XS6A 3FY7A 5L71A 3FKFA 1ZGNA 1GLPA 3QAGA 4Q5FA 1O8XA 5J9BA 2MMOA 1TP9A 1G7OA 5KN1A 1GSSA 4FYUA 1G6YA 3WT1A 1B9YC 2FGXA 2B1LA 1V40A 5HFKA 3TJBA 6GSYA 4J57E 4BL7A 5DVBA 4NV2A 2N5BA 1GH2A 3KH7A 1Z3EA 4MH3A 1XW6A 1K0OA 3IC8A 1TDIA 4JR4A 3CSHA 4BVXA 3QCPA 6GSUA 2HFDA 3IK7A 5IMFA 3I69A 4EKZA 2K8VA 3UEMA 4EUYA 1X9WB 2H76A 1JLWA 1GULA 4MF7A 4USSA 3D22A 4OCFA 4F0BA 1T3BA 3DXBA 2LUSA 1CQHA 2V1MA 1SK1A 2IN3A 4IQAA 2XC2A 4X0XA 1X5DA 4N10A 1GSUA 5LCZA 3UBLA 3GSSA 3L9SA 1XOAA 5DDLA 4F03A 4PNFA 2CAQA 3H1NA 5B8AA 1XWCA 3U6VA 2EC4A 1SK0A 3LG6A 2FA4A 4TR4A 5D73A 1ERVA 4BWQA 1M9BA 2LV3A 2HRKB 2GSSA 1JZRA 2HRAA 3FZ9A 1SL1B 1K0MA 1J9BA 1ABAA 4FO5A 5COHA 5F07A 1GP1A 1GUHA 3GL3A 3IAS2 3GH6A 1S3AA 4PX1A 4XRDA 2HSHA 5F0GA 3A2VA 3I6AA 3CXGA 1ZYQB 3IDVA 4HU7A 5D96A 4ZL9A 1M2DA 4GSSA 1OC3A 3U5RE 1YF1A 4H86A 2MYGA 5D93A 3TKPA 3J7Yb 5ECHB 1XIYA 2YWOA 2WFCA 4L8EA 2HSNB 3HJPA 2PWJA 2XBQA 5CNWA 1Y25A 1GTUA 2YWMA 2ON7A 1TRUA 1WIKA 2O85A 3FR6A 2PN8A 4TR0A 2H0HA 2WDUA 4J2FA 2F8AA 2OJLA 2H0GA 3HCZA 2L4CA 3C7MA 4N30A 2G2QA 2KLXA 3GSTA 4MLYA 4ML6A 4V1Ap 5C00A 2C0EA 4TXVA 3A2WA 2IWTA 2H71A 4WEYA 2L5OA 2I81A 2QC7A 3MAKA 5ENUA 1BEDA 5A4UA 1EZKA 5A4WA 4HOJA 2HXKA 4YQUA 6GSXA 1Z7PA 2BMXA 4GQFA 1FW1A 1SL0B 2HRNA 5ECQB 3KIJA 1YEPA 2L57A 2E7PA 3LGCA 2OE3A 4WR5A 2H66A 4CDOA 5KN0A 2HZEB 3BBYA 2O87A 2NPBA 3HJMA 1A8YA 3MWHA 1TK0B 3GL5A 2VLVA 2B1KA 4E8HA 2LRNA 4V2MA 3WGDA 1TJDA 3VWWA 5AGYA 2BTOT 3H93A 1UC7A 1NSWA 2IMEA 3UARA 4KSMA 1YKAA 3S9FA 4Z7XA 3F4TA 3D5JA 4WETA 2H1DA 1FHEA 3Q18A 5G5EA 4QL9A 4LA1A 3UOMA 5C04A 2MBTA 3DIEA 2ES7A 4XCSA 4MJEA 3A2XA 1M0UA 2CVKA 4KX4A 1HYUA 3ME8A 3H4KA 3D4TA 3M8NA 2X8CA 1QXHA 3KMNA 2YWIA 3FR3A 4IVFA 4WF5A 1SYRA 4ZBBA 5CYYA 1JFUA 1WRYA 1ON4A 1S3DA 3TKRA 11GSA 1U3IA 5IOXA 3WYWA 3TKSA 1TI1A 3CMIA 1R5PA 4IBPA 1OKTA 4I2TA 4L5OA 3M9KA 4KE3A 4PQIA 1AQVA 2YZHA 2GSRA 2FWEA 4OD7A 2IMKA 1SKSB 1F37A 2R3XA 2DMMA 3DRNA 3KH9A 4HUAA 1ERWA 5E59A 1CQGA 1PD21 2MMZA 3EMXA 2P5QA 5IMCA 3KEBA 4YQMA 1PN9A 3VWUA 1SJIA 4KUNA 3N5OA 2B3SA 1EP8A 4KA0A 1VF4A 3VI5A 3DGQA 4WF4A 3RPNA 19GSA 5DCHA 2V41A 2X8GA 1FAAA 1OYJA 4I8BA 2E2GA 3TGZA 3I43A 4MF6A 2DC5A 1TW9A 4ZBDA 3P90A 4HJMA 4BVYA 2EIRA 1AXDA 1GSFA 1W4VA 4XTSA 2JSYA 2H6ZA 1BX9A 1NHOA 2B7KA 3IHQA 2K8SA 4MZCA 3GNJA 3QFAC 4LLRA 1ZYEA 4MZWA 3ZMLA 3ZRDA 2HRFA 4TRXA 4ZB8A 2C1YA 3CTGA 1QUWA 1VF3A 3KCMA 1NHYA 2CAIA 2M46A 3A5WA 3GHAA 4GTUA 1V58A 2CT6A 1USBA 3ZMKA 1OC8A 2M72A 1GTIA 1PX6A 3LSZA 5ELGA 2C4JA 1DE1A 4G0IA 1PSQA 2PBJA 5IMAA 1GSYA 5EL8A 2H70A 2QKEA 2VLUA 22GSA 1YZXA 2DJKA 4D73B 1R5AA 1SK2A 5G31A 3IOSA 4GXZA 3VPTA 2X64A 5HR2A 3QR6A 4BPYA 1S3CA 3ZREA 4ECCA 1EWXA 4G19A 3NZNA 2R37A 3HZ8A 1WPIA 2HSMB 4OMVA 3QD9A 4FH8A 3IBHA 1VF1A 3LYPA 4YAPA 5HR3A 2AB6A 2FWFA 3MNGA 2JADA 3O3TA 3BCKA 4Q5NA 3IE3A 1XOBA 3GRXA 4CW9A 1X9SB 2IFQA 4OWYA 3UAPA 1OC9A 1LBKA 1SJZA 5B6MA 3PINA 1W89A 2H72A 5HFGA 1ERUA 3F6FA 2AAWA 4JEDA 3L78A 1M2AA 3UJ1A 3UVTA 3ME7A 1MDKA 3LXTA 3FR9A 5DJLA 4IS0A 4N0VA 1PKWA 3VK9A 1U87A 1X5EA 4HU9A 1J0FA 1Q4JA 1ACVA 1XVWA 2AV4A 2FWHA 4G0LA 1GSDA 2GS3A 1UA5A 2LNSA 2RM6A 3EMPA 2JACA 3D0ZA 4MZBA 5IOWA 4EE0A 2GGTA 2OKAA 3P2AA 2L6CA 1XWAA 3TRXA 5ECKB 3PPUA 1FVJA 4JR6A 3EURA 1GL8A 6GSTA 3N9JA 4F0CA 3EYTA 3ZITA 2NVLA 1R7HA 2KP2A 4IKHA 4EDYA 1ZMAA 1KNGA 2KHPA 3LJRA 3CRTA 3GA4A 4K8MA 5J5NA 1VF2A 2G0FA 1WOUA 3LWAA 4POBA 3QDNA 2C80A 4GCIA 3KMOA 3IK9A 1F3BA 20GSA 4OFNA 18GSA 4TVEA 3GX8A 4RI6A 1H75A 2FWGA 3ZIVA 2P5RA 4XS4B 2C0FA 5DALB 3VLNA 3MSZA 2PGTA 4WBRD 4HEA2 2VL3A 2XHFA 5DAKB 5ECSA 5EY6A 1AW9A 3OR5A 3LFLA 4KF9A 5DJMA 4GWRA 2RUFA 2B6MA 2PVOC 4IN0A 4NV5A 1FG4A 2C3TA 5B7CA 4F82A 3QOUA 2OA7A 2DMLA 5CP1A 1XBSA 4DVCA 4WR4A 2IMFA 2DJ0A 2PVQA 3C71A 4KH7A 1MDJA 1NM3A 5JWOB 5H5QA 2EIQA 3EINA 3MDKA 3F0IA 2YP6A 3BJ5A 4O5RA 1T8EB 7GSSA 3KJYA 2XPEA 2HQTA 1FB6A 10GSA 2H8LA 4ZB6A 2YNXA 3L9VA 3HD5A 1RK4A 3F4RA 1U6TA 2HSYA 3RPPA 1X5CA 1RQMA 2YV9A 5ID2A 3M1GA 2GQKA 3VURA 5ECNB 1MTCA 1M9AA 1X0RA 2C8UA 3TRPA 2DJ2A 2LTKA 2MZCA 4K7OA 4PXOA 5D9TA 3D21A 3TKQA 1A2LA 5HR0A 4XIHA 1TU7A 1PL1A 2B5EA 3ED3A 1O85A 4IHUA 2DJJA 3C8EA 2E0QA 2CX4A 5A5KA 2L59A 4TXOA 5IMZA 2HZFA 1AAZA 4HQSA 5F05A 3WT2A 1YF0A 2TRCP 4ZXGA 3H79A 4MCUA 4KGIA 1F2EA 1O7UA 4MMMA 2IMIA 1H4OA 3UBKA 4DSSA 5H5SA 4CHSA 1PMTA 3APOA 2YPMA 4ZILA 1M7TA 3TOUA 3ZIJA 2L6DA 1AUCA 3Q19A 4BL7B 5CRWA 1TK8B 2H1GA 5AIVA 1A24A 4NHZA 5GAND 4IQ1A 2K9FA 3CTFA 1A0FA 3DYRA 1WMJA 3P7XA 4TKYA 2QGVA 4JBBA 2B7JA 2ZNMA 4OFMA 3ERWA 2PMTA 1TKDB 2MMNA 2GZPA 2AYTA 3EWLA 4ZL8A 5DCGA 1Z9HA 2NTOA 1ST9A 4JE1A 3KD0A 3G7IA 2N5FA 2CVDA 5JCGA 1DSBA 1QGVA 5DQYA 3BCIA 1G7EA 3KTLA 2H30A 2F3MA 2YV7A 2P0GA 2H1BA 5CAXA 1YKCA 1EEJA 2OADA 3IAM2 3M3MA 2K18A 3D6IA 3HXSA 2HE3A 4GF0A 1B4PA 3RBTA 5HFIA 1EOHA 4QL7A 4EO3A 4GRFA 1GNEA 3HHVA 1WJKA 2NBSA 3KP9A 4KNDA 4POKA 5J9CA 3K8NA 4IP1A 5FWGA 4D73A 1SKWB 5G1LA 2VO4A 5DQSA 4V2LA 4BWSA 1DUGA 1PA3A 1V98A 2FCHA 1ZZYA 3ZVJD 1B4QA 3VI7A 3SBCA 1HNCA 2V32A 4J56E 2LJKA 3APSA 2HSMA 2YJHA 4POLA 5IO2A 1XZOA 2P31A 1HNBA 2GQLA 3KM6A 4G2EA 4MPGA 4WXTA 4FIWA 1SL2B 3TKSC 4MK3A 4E8EA 2BJXA 17GSA 1V57A 1C72A 2D2ZA 5CRGA 3WGEA 2E2MA 9GSSA 2YZUA 1BQ7A 5GSTA 1DE2A 5ABRA 5E4WA 1TRVA 5CRHA 2VL2A 1M2BA 1MDIA 3E0UA 2GSQA 4KAEA 1TK5B 3QPMA 1GLQA 4EF0A 4ULXA 5IMVA 1B9XC 4NPBA 1GUKA 4GSNA 1SD9A 1UVZA 2DLXA 1V9WA 4MJCA 1T4YA 2JSZA 1OVNA 4O32A 4AGSA 2YANA 4EDZA 2O7KA 2R6KA 4PNGA 1K0BA 4V1Ag 5HR1A 3KGKA 1Z6MA 1EGOA 6GSWA 3KP8A 5JCWA 1WWJA 4QQ7A 3FYGA 8GSSA 3HVSA 2YOIA 1YJ6A 1K3YA 1PQNA 2B5XA 3GTUA 1OKDA 2VM2A 3DVWA 4MH2A 3APQA 2GT6A 3CSJA 2YN1A 1QK8A 3DMLA 3ISOA 5AIXA 3PR8A 4JZQA 5EVOA 1JZOA 3TJJA 3G9BA 3BOAA 1YEXA 2EIOA 4F2IA 2OE0A 3QAVA 2JZRA 3W8JA 5IQYA 1OE7A 3PH9A 2HLSA 1HD2A 4IJ3A 3FEUA 4IGJA 2V2GA 1IYIA 3FZ5A 3L9UA 3E3EA 3IR4A 1GSEA 2TIRA 3IXRA 1AIUA 1FVKA 2GLRA 5DALA 4KB3A 3CRUA 1Z6NA 3IPZA 4IP6A 3LORA 5D8IA 3O76A 4G0KA 2KOKA 3GIXA 5G1KA 2HI7A 1FOVA 4YQVA 2WULA 1VGLA 1K0CA 4K9ZA 3H8QA 2GVPA 1O8WA 1TI3A 2JU5A 3TCOA 4HZ2A 1N8JA 4KDYA 1Z7RA 1EP7A 2KUCA 5G5FA 2I9HA 1FB0A 2FLSA 2F8FA 2CQ9A 1PGTA 2F51A 1X9MB 1M99A 2C3QA 2YWNA 4EVMA 3GKXA 4XS1A 1EEMA 4HQZA 4KCAA 3VFIA 1XXUA 4DSRA 1XCCA 3RDWA 1ZOFA 4ILFA 2C0DA 2VUPA 2GDRA 2DSAA 4GQCA 4ZL7A 2H01A 3EU4A 3V1WA 5FT3A 2HRKA 2IPAA 3EC3A 3DKSA 2VCXA 4BVYB 4MDCA 1BAYA 2H0IA 1I5GA 4LL4B 2DIYA 2XPDA 1LU4A 3GKKA 1N2AA 1LJRA 2R2JA 4OCEA 4JRRA 3HY2A 4RQXA 5IM9A 1E6BA 4KDUA 2HT9A 3E9JB 2FUG2 2H1AA 3LXZA 4ZIJA 5J4UA 3KTBA 3D4MA 4RQRA 3BD2A 1SKRB 2F9SA 5IIZA 3CBUA 1GTAA 1B8XA 1MEKA 1TU8A 2UZ8A 2DJ1A 3ERGA 3FK8A 1ZL9A 4TR1B 1XPVA 3RAZA 2OACA 3LYKA 5BMUA 1PRXA 5KEJA 2L5LA 4HS1A 3W6GA 4LL1B 3ZVJA 2VOCA 1PX7A 2A2RA 2N5AA 2VL9A 3ZYWA 2FD3A 4EXJA 2A2SA 4N11A 1GNWA 5ELAA 4KDXA 3VPQA 5B6NA 2R5GA 3EU3A 2MBSA 4FYBA 4MP4A 3F63A 3TOTA 2PU9C 5F8BA 3KZQA 2I3YA 1QFNA 4GLTA 1HNAA 2IFQB 4KW6A 1BG5A 1OC9B 2HZEA 2H6YA 4AJ6A 3DVXA 5DBQA 2V6KA 4F9ZA 4O7HA 3DD3A 1AQWA 2CZ3A 4TR3A 3JCML 4MF5A 3PGTA 1ZCPA 4ECIA 2VCQA 5A4VA 3Q6OA 2R4VA 2I4AA 2GZYA 2WCIA 5GAPD 2LKUA 5CO3A 5G2ZA 4ACSA 2ALBA 4PGTA 2B5YA 2GQMA 1SENA 4MJBA 3O6TA 2PPTA 1SD8A 4FQUA 4G10A 2PERA 2FHEA 2MMAA 1YY7A 2CA8A 3ZFBA 5IMDA 2VLTA 2PUKC 2IMDA 3CSIA 4LMWA 2CVBA 3HDCA 4L5LA 1ML6A 2CX3A 3W8SA 1TTZA 4MABA 2VD1A 1JHBA 2CZ2A 2ON5A 2CV4A 3FZ4A 2VD0A 1K0DA 1F6MC 4O92A 1XW5A 3TB2A 2WZ9A 6GSSA 1Q98A 2DBCA 2GZZA 1SJ6A 5G30A 3F3QA 2QSIA 3ZFLA 2VCWA 4PQHA 3IA1A 4PURA 4FYCA 3LEFA 3WGXA 1O73A 2GT5A 2C3NA 1K3OA 4Q5RA 1SU9A 2AJQB 3A3TA 3I9V2 5CRDA 1R4WA 5IO0A 2LNTA 3DWVA 4L0UA 5H5RA 2K6VA 4MA9A 3ERFA 4RUVA 2J23A 3HZ4A 5GSSA 1K0NA 1WP0A 1URMA 5LD0A 3HVVA 3J7Yk 1MD4A 1F3AA 1YQ1A 4EL1A 2LQQA 2Z9SA 4ZB9A 4BVXB 5AN1A 3NIVA 2LRCA 1JZWA 2M80A 3ZZXA 3GKNA 1B48A 2ZCTA 2HNLA 2C0GA 1EOGA 4IJIA 3UVHA 1XWGA 2AUVA 3WD6A 2A4VA 4DSQA 3IV4A 4I2UA 2RLIA 3TRQA 3P8WA 3EVIA 1KEBA 3LQ7A 1O6JA 4PQ1A 1T1VA 1A2MA 4PTSA 2HYXA 3TJFA 3UIWA 4OFTA 4EC0A 2JL4A 4IW9A 2L4QA 4KSOA 2VCVA 1V2AA 4KCEA 1A23A 3FRCA 1G0TA 1GUMA 2X8HA 1QQ2A 4K7IA 4X43A 5IPGA 1TRWA 6GSVA 3Q74A 3HJOA 2IL3A 2IIYA 4RI7A 1PL2A 4XRAA 3F8UA 2H75A 3C73A 4ECJA 3GYKA 4X1UA 4XHMA 3RHBA 1DBYA 16GSA 4ID0A 4NXIA 1EV4A 1KBNA 1ERTA 3GFKA 4DEJA 5ECIB 1OE8A 2OBKA 5ID2B 1T4ZA 2RM5A 3VWVA 2FY6A 4IELA 3VWXA 1T00A 2VCTA 3US3A 4YAVA 3GKMA 3F3RA 2H74A 3ZL5A 4AF2A 2LQOA 2ZUPA 1IYHA 3TDGA 2WB9A 4NWYA 5INYA 1QMVA 1AC1A 5FHIA 2WRTA 1K3LA 2JZTA 4TXOB 3L0HA 1XW9A 1I9DA 1EGRA 3FW2A 5ECPB 1TXXA 4PUFC 12GSA
chains in the Genus database with same CATH superfamily
2LJRA 2YCDA 1J08A 5EPFA 1GWCA 5A5HB 2JZSA 1T7PB 1ILOA 5J3RA 4ML1A 4DSSB 2VAFA 3F4SA 2AHEA 2J9HA 2DKHA 4HDEA 5D9WA 14GSA 3EE2A 1KTEA 4P3YB 2I1UA 2LEGA 2X99A 4OO5A 4K2DA 1A2JA 1THXA 4ZBAA 4K6XA 1XG8A 2VL2C 3HVNA 5D9VA 5ECOB 1RW1A 3DEXA 3UL3A 2V6OA 1SVOA 3TUEA 1U88A 1K0AA 3RFRC 1O81A 4MJAA 3ZTLA 5ECRB 3TU3B 4HJ2A 3G7YA 4L0WA 2VIMA 1WE0A 3GURA 1JZDA 4K7NA 4AJ7A 4N0ZA 2TRXA 2GTUA 2XBIA 4MPFA 3SWLA 1AQXA 1XFLA 5JWQB 2WW0A 1XWKA 2IJYA 5ECMB 5F06A 3TJKA 1TRSA 1XVQA 2A4HA 1MD3A 1GSQA 4YH2A 2OBIA 3NOFA 1FO5A 3F6DA 1UN2A 3TJGA 3CQFA 2VCZA 2LRTA 4NHWA 1F9MA 4V2NA 1THOA 2LS5A 2RUEA 1Y6EA 1GTBA 2WW3A 2RIIA 2DIZA 1G6WA 3HKRA 1A0RP 5KN2A 2OE1A 4HI7A 3QMXA 3F9UA 3HMJG 1BYEA 4PI2C 4HZ4A 4Z2TA 5D9XA 4AJ8A 2REMA 1A8LA 3KXOA 4TR1A 3CYNA 1M3JA 5JWRB 1NW2A 5B8BA 1U3AA 5CREA 3HVXA 5KN3A 4XS4A 2WVXB 1OAZA 4BA7A 4I97A 4WKWA 4ICYA 3HYPA 1TOFA 3TKSE 1EV9A 2FNOA 4K0GA 3IC4A 4I5QA 5HQPA 5DAKA 5J41A 3IRAA 3HA9A 2WGRA 2O89A 2YJ7A 3G7JA 1VRSD 4ISDA 4ECBA 4GSTA 4AKIA 1YDKA 4TN8A 3L4NA 3GMFA 3AY8A 1E2YA 3EPTA 3GX0A 4JU5A 4NMUA 5A34A 3QAWA 4Q5QA 5LNKe 3C1RA 5JCUA 4LMVA 3M0FA 1XWBA 3R3EA 2NDOA 4OO4A 3R2QA 2VM1A 3QFBC 2H6XA 4TOPA 2LSTA 3GV1A 3FZAA 3ZLPA 4TW5A 4K1FA 2EFDA 2UV8G 3FHKA 1BF5A 4CY8A 1ZYPA 1R26A 4POMA 1GRXA 2WJUA 3GUSA 2R0GA 3GN3A 1SYXA 4PUAA 4WBJA 3UMAA 1HQOA 4G01A 2LJAA 2GSTA 3GTUB 2H73A 4NAXA 1JLVA 4AKHA 4G9HA 2KP1A 3RHCA 3GH9A 2FA8A 2R0CA 5ECLB 5AISA 2WS2A 1Z5YE 4K0NA 1BJXA 4CY6A 3M9JA 4I6XA 2O8VB 3C1SA 13GSA 5GZZB 5IPHA 2H19A 2DJ3A 1PKZA 4XS6A 3FY7A 5L71A 3FKFA 1ZGNA 1GLPA 4YKFA 3QAGA 4Q5FA 1O8XA 5J9BA 2MMOA 1TP9A 1G7OA 5KN1A 1GSSA 4FYUA 1G6YA 3WT1A 1B9YC 2X49A 2FGXA 2B1LA 1V40A 5HFKA 3TJBA 6GSYA 4J57E 4BL7A 5DVBA 4NV2A 2N5BA 1GH2A 3KH7A 1Z3EA 4MH3A 1XW6A 1K0OA 3IC8A 1TDIA 4JR4A 3CSHA 4BVXA 3QCPA 6GSUA 4K2XA 2HFDA 3IK7A 2WW1A 5J4YA 5IMFA 3I69A 4EKZA 2K8VA 3UEMA 3CWGA 4EUYA 1X9WB 2H76A 1JLWA 1GULA 4MF7A 4USSA 3D22A 4OCFA 4F0BA 1T3BA 3DXBA 2LUSA 1CQHA 2V1MA 1SK1A 2IN3A 4IQAA 2XC2A 4X0XA 1X5DA 4N10A 1GSUA 5LCZA 3UBLA 3GSSA 3L9SA 1XOAA 5DDLA 4F03A 4PNFA 2CAQA 3H1NA 5B8AA 1XWCA 3U6VA 2EC4A 1SK0A 3LG6A 2FA4A 4TR4A 5D73A 1ERVA 4QMKA 4BWQA 1M9BA 2LV3A 2HRKB 2GSSA 1JZRA 2HRAA 3FZ9A 1SL1B 1K0MA 1J9BA 1ABAA 4FO5A 5COHA 5F07A 1Y1UA 1GP1A 1GUHA 3GL3A 3IAS2 3GH6A 1S3AA 4PX1A 4XRDA 2HSHA 5F0GA 3A2VA 3I6AA 3CXGA 2EFHA 1ZYQB 3IDVA 4HU7A 5D96A 4ZL9A 1M2DA 4GSSA 1OC3A 3U5RE 1YF1A 4H86A 2MYGA 5D93A 3TKPA 3J7Yb 5ECHB 1XIYA 2YWOA 2WFCA 4L8EA 2HSNB 3HJPA 2PWJA 2XBQA 5CNWA 4AKGA 1Y25A 1GTUA 2YWMA 2ON7A 5BMUB 1TRUA 1WIKA 2O85A 3FR6A 2PN8A 4TR0A 2H0HA 2WDUA 4J2FA 2F8AA 2OJLA 2H0GA 3HCZA 2L4CA 3C7MA 4N30A 2G2QA 2KLXA 3GSTA 4MLYA 4ML6A 4V1Ap 5C00A 2C0EA 4TXVA 3A2WA 2IWTA 2H71A 4WEYA 2L5OA 2I81A 2QC7A 3MAKA 4EIPA 5ENUA 1BEDA 5A4UA 1EZKA 5A4WA 4HOJA 2HXKA 4YQUA 6GSXA 2WW2A 1Z7PA 2BMXA 4GQFA 1FW1A 1SL0B 2HRNA 5ECQB 3KIJA 1YEPA 2L57A 2E7PA 3LGCA 2OE3A 4WR5A 2H66A 4O5QA 4CDOA 5KN0A 2HZEB 3BBYA 2O87A 2NPBA 3HJMA 1M3IA 1A8YA 3MWHA 5KOXA 1TK0B 3GL5A 2VLVA 2B1KA 4E8HA 2LRNA 4V2MA 3WGDA 1TJDA 3VWWA 5AGYA 2BTOT 3H93A 1UC7A 1NSWA 2IMEA 3UARA 4KSMA 1YKAA 3S9FA 4Z7XA 3F4TA 3D5JA 4WETA 2H1DA 1S4BP 1FHEA 3Q18A 5G5EA 4QL9A 4LA1A 3UOMA 5C04A 2MBTA 3DIEA 2ES7A 4XCSA 4MJEA 3A2XA 3A5IA 1M0UA 2CVKA 4KX4A 1HYUA 3ME8A 3H4KA 3D4TA 3M8NA 2X8CA 3MYDA 1QXHA 3KMNA 2YWIA 3FR3A 4IVFA 4WF5A 1SYRA 1YEWC 2WVXA 4ZBBA 5CYYA 1JFUA 1WRYA 1ON4A 1S3DA 3TKRA 11GSA 1U3IA 5IOXA 3WYWA 3TKSA 1TI1A 3CMIA 3MIXA 1R5PA 4IBPA 1OKTA 4I2TA 4L5OA 3M9KA 4KE3A 4PQIA 1AQVA 2YZHA 2GSRA 2FWEA 4OD7A 2IMKA 1SKSB 1F37A 2R3XA 2DMMA 3DRNA 3KH9A 4HUAA 1ERWA 5E59A 1CQGA 1PD21 4ZB7A 2MMZA 3EMXA 2P5QA 5IMCA 4YKGA 3KEBA 4YQMA 1PN9A 3VWUA 1SJIA 4KUNA 1BG1A 3N5OA 2B3SA 1EP8A 4KA0A 1VF4A 3VI5A 3DGQA 4WF4A 2O36A 3RPNA 19GSA 1S3RA 5DCHA 2V41A 2X8GA 1FAAA 1OYJA 4I8BA 2E2GA 3TGZA 3I43A 4MF6A 2DC5A 1TW9A 4ZBDA 3P90A 4HJMA 4BVYA 2EIRA 1AXDA 1GSFA 1W4VA 4XTSA 2JSYA 2H6ZA 1BX9A 1NHOA 2B7KA 3IHQA 2K8SA 4MZCA 5A1NB 3GNJA 3QFAC 4LLRA 1ZYEA 4MZWA 3ZMLA 3ZRDA 2HRFA 4TRXA 4ZB8A 2C1YA 3CTGA 1QUWA 1VF3A 2WVZA 3KCMA 1NHYA 2CAIA 2M46A 3A5WA 3GHAA 4GTUA 1V58A 2CT6A 1USBA 2OT3A 3ZMKA 1OC8A 2M72A 1GTIA 1PX6A 3LSZA 5ELGA 2C4JA 1DE1A 4G0IA 1PSQA 2PBJA 5IMAA 1GSYA 5EL8A 2H70A 2QKEA 2VLUA 22GSA 1YZXA 4K5RA 2DJKA 4D73B 1R5AA 1SK2A 5G31A 3IOSA 4GXZA 3VPTA 2X64A 5HR2A 3CHXC 3QR6A 4BPYA 1S3CA 3ZREA 4ECCA 1EWXA 4G19A 3NZNA 2R37A 3HZ8A 1I1IP 1WPIA 2HSMB 4OMVA 3QD9A 4FH8A 3IBHA 1VF1A 3LYPA 4YAPA 5HR3A 2AB6A 2FWFA 3MNGA 2JADA 3O3TA 3BCKA 4Q5NA 3IE3A 1XOBA 3GRXA 4CW9A 1X9SB 2IFQA 4OWYA 3UAPA 1OC9A 1LBKA 1SJZA 5B6MA 3PINA 1W89A 2H72A 5HFGA 1ERUA 3F6FA 4EIQA 2AAWA 4JEDA 3L78A 1M2AA 3UJ1A 3UVTA 3ME7A 1MDKA 3LXTA 3FR9A 5DJLA 4IS0A 4N0VA 1PKWA 3VK9A 1U87A 1X5EA 4HU9A 1J0FA 1Q4JA 1ACVA 1XVWA 2AV4A 2FWHA 4G0LA 1GSDA 2GS3A 1UA5A 2LNSA 2RM6A 3EMPA 2JACA 3D0ZA 4MZBA 5IOWA 4EE0A 2GGTA 2OKAA 3P2AA 2L6CA 1XWAA 3TRXA 5ECKB 3PPUA 1FVJA 4JR6A 3EURA 1GL8A 6GSTA 3N9JA 4F0CA 3EYTA 3ZITA 2NVLA 1TXUA 1R7HA 2KP2A 4IKHA 5J47A 4EDYA 1ZMAA 1KNGA 2KHPA 3LJRA 3CRTA 3GA4A 4K8MA 5J5NA 1VF2A 2G0FA 1WOUA 3LWAA 4POBA 3QDNA 2C80A 4GCIA 3KMOA 3LW9A 3IK9A 1F3BA 20GSA 4OFNA 18GSA 4TVEA 3GX8A 4RI6A 1H75A 2FWGA 3ZIVA 1PN0A 2P5RA 4XS4B 2C0FA 5DALB 3VLNA 3MSZA 2PGTA 4WBRD 4HEA2 2VL3A 2XHFA 5DAKB 5ECSA 5EY6A 1AW9A 3OR5A 3LFLA 4KF9A 5DJMA 4GWRA 2DKIA 2RUFA 2B6MA 2PVOC 4IN0A 2O5VA 4NV5A 1FG4A 2C3TA 5B7CA 4F82A 5A34B 3QOUA 2OA7A 2DMLA 5CP1A 1XBSA 4DVCA 4WR4A 2IMFA 2DJ0A 2PVQA 3C71A 4KH7A 1MDJA 1NM3A 5JWOB 1SVMA 5H5QA 2EIQA 3EINA 3MDKA 3F0IA 2YP6A 3BJ5A 4O5RA 1T8EB 5J4VA 7GSSA 3KJYA 2XPEA 2HQTA 1FB6A 10GSA 2H8LA 4ZB6A 2YNXA 3L9VA 3HD5A 1RK4A 3F4RA 1U6TA 2HSYA 3RPPA 1X5CA 1RQMA 2YV9A 4GDFA 5ID2A 3M1GA 2GQKA 3VURA 2R0PA 5ECNB 1MTCA 1M9AA 1X0RA 2C8UA 3TRPA 2DJ2A 2LTKA 2MZCA 4K7OA 4PXOA 5D9TA 3D21A 3TKQA 1A2LA 5HR0A 4XIHA 1TU7A 1PL1A 2B5EA 3IHGA 3ED3A 1O85A 4IHUA 2DJJA 3C8EA 2E0QA 2CX4A 5A5KA 2L59A 4TXOA 5IMZA 2HZFA 1AAZA 5BRTA 4HQSA 5F05A 3WT2A 1YF0A 2TRCP 4ZXGA 3H79A 4MCUA 4KGIA 1F2EA 1O7UA 5A5HA 4MMMA 2IMIA 1H4OA 3UBKA 4DSSA 5H5SA 4CHSA 1PMTA 3APOA 2YPMA 4ZILA 1M7TA 3TOUA 3ZIJA 2L6DA 1AUCA 3Q19A 4BL7B 5CRWA 1TK8B 2H1GA 5AIVA 1A24A 4NHZA 5GAND 4IQ1A 1YVLA 2K9FA 3CTFA 1A0FA 3DYRA 1WMJA 3P7XA 4TKYA 2QGVA 4JBBA 2B7JA 2ZNMA 4OFMA 3ERWA 2WVYA 2PMTA 1TKDB 2MMNA 2GZPA 2AYTA 3EWLA 4ZL8A 5DCGA 1Z9HA 2NTOA 5A1NA 1ST9A 4JE1A 3KD0A 3G7IA 2N5FA 4N3ZA 2CVDA 5JCGA 1DSBA 1QGVA 5DQYA 3BCIA 1G7EA 3KTLA 2H30A 2F3MA 2YV7A 2P0GA 2H1BA 5CAXA 1YKCA 1EEJA 2OADA 3IAM2 3M3MA 2K18A 3HXSA 3D6IA 2HE3A 4GF0A 1B4PA 3RBTA 5HFIA 1EOHA 4QL7A 4EO3A 4GRFA 1GNEA 3HHVA 1WJKA 2NBSA 3KP9A 4KNDA 4POKA 5J9CA 3K8NA 4IP1A 5FWGA 4D73A 1SKWB 5G1LA 2VO4A 5DQSA 4E68A 4V2LA 4BWSA 1DUGA 1PA3A 1V98A 2FCHA 1ZZYA 3ZVJD 1B4QA 4PHZC 3VI7A 3SBCA 1HNCA 2V32A 4J56E 2LJKA 3APSA 2HSMA 2YJHA 4POLA 5IO2A 1XZOA 2P31A 1HNBA 2GQLA 3KM6A 4G2EA 4MPGA 4WXTA 4FIWA 1SL2B 3TKSC 4MK3A 4E8EA 4A5PA 2BJXA 17GSA 1V57A 2QA1A 1C72A 2D2ZA 4X4JA 5CRGA 3WGEA 2E2MA 9GSSA 2YZUA 1BQ7A 5GSTA 1DE2A 5ABRA 5E4WA 1TRVA 5CRHA 2VL2A 1M2BA 1MDIA 3E0UA 2GSQA 4KAEA 1TK5B 3QPMA 1GLQA 4EF0A 4ULXA 5IMVA 1B9XC 4NPBA 1GUKA 4GSNA 1SD9A 1UVZA 2DLXA 1V9WA 4MJCA 1T4YA 2JSZA 1OVNA 4O32A 4AGSA 2YANA 4EDZA 2O7KA 2R6KA 4PNGA 1K0BA 4V1Ag 5HR1A 1SVLA 3KGKA 1Z6MA 1EGOA 6GSWA 1WWJA 5JCWA 3KP8A 4QQ7A 3FYGA 8GSSA 3HVSA 2VKZG 2YOIA 1YJ6A 1ZYNA 1K3YA 1PQNA 2B5XA 3GTUA 1OKDA 2VM2A 4AI6A 3DVWA 5J40A 4MH2A 3APQA 2GT6A 3CSJA 2YN1A 1QK8A 3DMLA 3ISOA 5AIXA 3PR8A 4JZQA 5EVOA 1JZOA 3TJJA 3G9BA 3BOAA 1YEXA 2EIOA 4W66A 4F2IA 2OE0A 3QAVA 2JZRA 3W8JA 5IQYA 1OE7A 3PH9A 2O3EA 5KOWA 2HLSA 1HD2A 4IJ3A 4MNNA 3FEUA 4IGJA 4O5UA 2V2GA 1IYIA 3FZ5A 3L9UA 3E3EA 3IR4A 1GSEA 2TIRA 3IXRA 1AIUA 1FVKA 2GLRA 5DALA 4K5SA 4KB3A 3CRUA 1Z6NA 3IPZA 4IP6A 3LORA 5D8IA 3O76A 4G0KA 2KOKA 3GIXA 5G1KA 2HI7A 1FOVA 4YQVA 2WULA 1VGLA 1K0CA 4K9ZA 3H8QA 2GVPA 1O8WA 3FMWA 1TI3A 2JU5A 3TCOA 4HZ2A 4PI0C 1N8JA 4KDYA 4FXYP 1Z7RA 1EP7A 2KUCA 5G5FA 2I9HA 1FB0A 2FLSA 4Z2UA 2F8FA 2CQ9A 1PGTA 2F51A 1X9MB 1M99A 2C3QA 2YWNA 4EVMA 3GKXA 4XS1A 1EEMA 4HQZA 4KCAA 3VFIA 1XXUA 4DSRA 2H1LA 1XCCA 3RDWA 1ZOFA 4ILFA 2C0DA 2VUPA 2GDRA 2DSAA 4GQCA 4ZL7A 2H01A 3EU4A 3V1WA 5FT3A 2HRKA 2IPAA 3EC3A 3DKSA 2VCXA 4BVYB 4MDCA 1BAYA 2H0IA 1I5GA 4LL4B 2DIYA 2XPDA 1LU4A 3GKKA 1N2AA 1PFOA 1LJRA 2R2JA 4OCEA 4JRRA 3HY2A 4RQXA 5IM9A 1E6BA 4KDUA 2HT9A 3E9JB 2FUG2 2H1AA 3LXZA 4ZIJA 5J4UA 3KTBA 3D4MA 4RQRA 3BD2A 1SKRB 2F9SA 5IIZA 3CBUA 1GTAA 1B8XA 1MEKA 1TU8A 2UZ8A 2DJ1A 3ERGA 2HSNA 3FK8A 1ZL9A 4TR1B 1XPVA 2X4AA 2OACA 3RAZA 3LYKA 5BMUA 1PRXA 5KEJA 2L5LA 4HS1A 3W6GA 4LL1B 3ZVJA 2VOCA 1PX7A 2A2RA 2N5AA 2VL9A 3ZYWA 2EFEA 2FD3A 4EXJA 2A2SA 4N11A 1GNWA 5ELAA 4KDXA 3VPQA 5B6NA 2R5GA 3EU3A 2MBSA 4FYBA 4MP4A 3F63A 3TOTA 2PU9C 5F8BA 3KZQA 2I3YA 1QFNA 4HSCX 4GLTA 1HNAA 2IFQB 4KW6A 1BG5A 1OC9B 2HZEA 2H6YA 4AJ6A 3DVXA 5DBQA 2V6KA 4F9ZA 4O7HA 3DD3A 1AQWA 2CZ3A 4TR3A 3JCML 4MF5A 3PGTA 1ZCPA 4ECIA 2VCQA 2QA2A 5A4VA 3Q6OA 2R4VA 2I4AA 2GZYA 2WCIA 5GAPD 2LKUA 5CO3A 5G2ZA 4ACSA 2ALBA 4PGTA 2B5YA 2GQMA 1SENA 4MJBA 3O6TA 2PPTA 1SD8A 4FQUA 4G10A 4BIKA 2PERA 2FHEA 2MMAA 1YY7A 2CA8A 3ZFBA 5IMDA 2VLTA 2PUKC 2IMDA 3CSIA 4LMWA 2CVBA 3HDCA 4L5LA 1ML6A 2CX3A 3W8SA 1TTZA 4MABA 2VD1A 1JHBA 2CZ2A 2ON5A 2CV4A 3FZ4A 2VD0A 1K0DA 1F6MC 4O92A 1XW5A 3TB2A 2WZ9A 6GSSA 1Q98A 2DBCA 2GZZA 1SJ6A 5G30A 3F3QA 2QSIA 3ZFLA 2VCWA 4PQHA 3IA1A 4PURA 4FYCA 3LEFA 3WGXA 1O73A 2GT5A 2C3NA 1K3OA 4Q5RA 1SU9A 2AJQB 3A3TA 3I9V2 5CRDA 1R4WA 5IO0A 2LNTA 3DWVA 4L0UA 5H5RA 2K6VA 4MA9A 3ERFA 4RUVA 2J23A 3HZ4A 5GSSA 1K0NA 1WP0A 1URMA 5LD0A 3HVVA 3J7Yk 1MD4A 1F3AA 1YQ1A 4EL1A 2LQQA 2Z9SA 4ZB9A 4BVXB 5AN1A 3NIVA 2LRCA 1JZWA 2M80A 3ZZXA 2EFCA 3GKNA 1B48A 1FOHA 2ZCTA 2HNLA 2C0GA 1EOGA 4IJIA 3UVHA 1XWGA 2AUVA 3WD6A 2A4VA 4DSQA 3IV4A 4I2UA 2RLIA 3TRQA 3P8WA 3EVIA 1KEBA 4Z2RA 3LQ7A 1O6JA 4PQ1A 1T1VA 1A2MA 4PTSA 2HYXA 3TJFA 1N25A 3UIWA 4OFTA 4EC0A 2JL4A 2L4QA 4IW9A 4KSOA 2VCVA 1V2AA 4KCEA 1A23A 3FRCA 1G0TA 1GUMA 2X8HA 1QQ2A 4K7IA 4X43A 5IPGA 1TRWA 6GSVA 3Q74A 3HJOA 2IL3A 3RGBC 2IIYA 4RI7A 1PL2A 4XRAA 3F8UA 2H75A 3C73A 4ECJA 3GYKA 4X1UA 4XHMA 3RHBA 1DBYA 16GSA 4ID0A 4NXIA 1EV4A 1KBNA 1ERTA 3GFKA 4DEJA 5ECIB 1OE8A 2OBKA 5ID2B 1T4ZA 2RM5A 3VWVA 2FY6A 4AKXB 4IELA 3VWXA 1T00A 2VCTA 3US3A 4YAVA 3GKMA 3F3RA 2H74A 3ZL5A 4AF2A 2LQOA 2ZUPA 2A2PA 1IYHA 3TDGA 2WB9A 4NWYA 5INYA 1QMVA 1AC1A 5FHIA 2WRTA 1K3LA 2JZTA 4TXOB 2WZSA 3L0HA 1XW9A 1I9DA 1EGRA 3FW2A 5ECPB 1TXXA 4PUFC 12GSA
chains in the Genus database with same CATH topology
2LJRA 2YCDA 1J08A 5EPFA 1GWCA 5A5HB 2JZSA 1T7PB 1ILOA 5J3RA 4ML1A 4DSSB 2VAFA 3F4SA 2AHEA 2J9HA 2DKHA 4HDEA 5D9WA 14GSA 3EE2A 1KTEA 4P3YB 2I1UA 2LEGA 2X99A 4OO5A 4K2DA 1A2JA 1THXA 4ZBAA 4K6XA 2VL2C 5D9VA 5ECOB 1RW1A 3DEXA 3UL3A 2V6OA 1SVOA 3TUEA 1U88A 1K0AA 1O81A 4MJAA 3ZTLA 5ECRB 3TU3B 4HJ2A 3G7YA 4L0WA 2VIMA 1WE0A 3GURA 1JZDA 4K7NA 4AJ7A 4N0ZA 2TRXA 2GTUA 2XBIA 4MPFA 3SWLA 1AQXA 1XFLA 5JWQB 1XWKA 2IJYA 5ECMB 5F06A 3TJKA 1TRSA 1XVQA 2A4HA 1MD3A 1GSQA 4YH2A 2OBIA 3NOFA 1FO5A 3F6DA 1UN2A 3TJGA 2VCZA 2LRTA 4NHWA 1F9MA 4V2NA 1THOA 2LS5A 2RUEA 1Y6EA 1GTBA 2RIIA 2DIZA 1G6WA 3HKRA 1A0RP 5KN2A 2OE1A 4HI7A 3QMXA 3F9UA 3HMJG 1BYEA 4HZ4A 4Z2TA 5D9XA 4AJ8A 2REMA 1A8LA 3KXOA 4TR1A 3CYNA 5B8BA 5JWRB 1NW2A 1U3AA 5CREA 3HVXA 5KN3A 4XS4A 1OAZA 4BA7A 4I97A 4WKWA 4ICYA 3HYPA 1TOFA 3TKSE 1EV9A 2FNOA 4K0GA 3IC4A 4I5QA 5HQPA 5DAKA 5J41A 3IRAA 3HA9A 2WGRA 2O89A 2YJ7A 3G7JA 1VRSD 4ISDA 4ECBA 4GSTA 4AKIA 1YDKA 4TN8A 3L4NA 3GMFA 3AY8A 1E2YA 3EPTA 3GX0A 4JU5A 4NMUA 5A34A 3QAWA 4Q5QA 5LNKe 3C1RA 5JCUA 4LMVA 3M0FA 1XWBA 3R3EA 2NDOA 4OO4A 3R2QA 2VM1A 3QFBC 2H6XA 4TOPA 2LSTA 3GV1A 3FZAA 3ZLPA 4TW5A 4K1FA 2EFDA 2UV8G 3FHKA 1BF5A 4CY8A 1ZYPA 1R26A 4POMA 1GRXA 2WJUA 3GUSA 2R0GA 3GN3A 1SYXA 4PUAA 4WBJA 3UMAA 1HQOA 4G01A 2LJAA 2GSTA 3GTUB 2H73A 4NAXA 1JLVA 4AKHA 4G9HA 2KP1A 3RHCA 3GH9A 2FA8A 2R0CA 5ECLB 5AISA 2WS2A 1Z5YE 4K0NA 1BJXA 4CY6A 3M9JA 4I6XA 2O8VB 3C1SA 13GSA 5GZZB 5IPHA 2H19A 2DJ3A 1PKZA 4XS6A 3FY7A 5L71A 3FKFA 1ZGNA 1GLPA 4YKFA 3QAGA 4Q5FA 1O8XA 5J9BA 2MMOA 1TP9A 1G7OA 5KN1A 1GSSA 4FYUA 1G6YA 3WT1A 1B9YC 2X49A 2FGXA 2B1LA 1V40A 5HFKA 3TJBA 6GSYA 4J57E 4BL7A 5DVBA 4NV2A 2N5BA 1GH2A 3KH7A 1Z3EA 4MH3A 1XW6A 1K0OA 3IC8A 1TDIA 4JR4A 3CSHA 4BVXA 3QCPA 6GSUA 4K2XA 2HFDA 3IK7A 5J4YA 5IMFA 3I69A 4EKZA 2K8VA 3UEMA 3CWGA 4EUYA 1X9WB 2H76A 1JLWA 1GULA 4MF7A 4USSA 3D22A 4OCFA 4F0BA 1T3BA 3DXBA 2LUSA 1CQHA 2V1MA 1SK1A 2IN3A 4IQAA 2XC2A 4X0XA 1X5DA 4N10A 1GSUA 5LCZA 3UBLA 3GSSA 3L9SA 1XOAA 5DDLA 4F03A 4PNFA 2CAQA 3H1NA 5B8AA 1XWCA 3U6VA 2EC4A 1SK0A 3LG6A 2FA4A 4TR4A 5D73A 1ERVA 4QMKA 4BWQA 1M9BA 2LV3A 2HRKB 2GSSA 1JZRA 2HRAA 3FZ9A 1SL1B 1K0MA 1J9BA 1ABAA 4FO5A 5COHA 5F07A 1Y1UA 1GP1A 1GUHA 3GL3A 3IAS2 3GH6A 1S3AA 4PX1A 4XRDA 2HSHA 5F0GA 3A2VA 3I6AA 3CXGA 2EFHA 1ZYQB 3IDVA 4HU7A 5D96A 4ZL9A 1M2DA 4GSSA 1OC3A 3U5RE 1YF1A 4H86A 2MYGA 5D93A 3TKPA 3J7Yb 5ECHB 1XIYA 2YWOA 2WFCA 4L8EA 2HSNB 3HJPA 2PWJA 2XBQA 5CNWA 4AKGA 1Y25A 1GTUA 2YWMA 2ON7A 5BMUB 1TRUA 1WIKA 2O85A 3FR6A 2PN8A 4TR0A 2H0HA 2WDUA 4J2FA 2F8AA 2OJLA 2H0GA 3HCZA 2L4CA 3C7MA 4N30A 2G2QA 2KLXA 3GSTA 4MLYA 4ML6A 4V1Ap 5C00A 2C0EA 4TXVA 3A2WA 2IWTA 2H71A 4WEYA 2L5OA 2I81A 2QC7A 3MAKA 4EIPA 5ENUA 1BEDA 5A4UA 1EZKA 5A4WA 4HOJA 2HXKA 4YQUA 6GSXA 1Z7PA 2BMXA 4GQFA 1FW1A 1SL0B 2HRNA 5ECQB 3KIJA 1YEPA 2L57A 2E7PA 3LGCA 2OE3A 4WR5A 2H66A 4O5QA 4CDOA 5KN0A 2HZEB 3BBYA 2O87A 2NPBA 3HJMA 1A8YA 3MWHA 5KOXA 1TK0B 3GL5A 2VLVA 2B1KA 4E8HA 2LRNA 4V2MA 3WGDA 1TJDA 3VWWA 5AGYA 2BTOT 3H93A 1UC7A 1NSWA 2IMEA 3UARA 4KSMA 1YKAA 3S9FA 4Z7XA 3F4TA 3D5JA 4WETA 2H1DA 1FHEA 3Q18A 5G5EA 4QL9A 4LA1A 3UOMA 5C04A 2MBTA 3DIEA 2ES7A 4XCSA 4MJEA 3A2XA 3A5IA 1M0UA 2CVKA 4KX4A 1HYUA 3ME8A 3H4KA 3D4TA 3M8NA 2X8CA 3MYDA 1QXHA 3KMNA 2YWIA 3FR3A 4IVFA 4WF5A 1SYRA 4ZBBA 5CYYA 1JFUA 1WRYA 1ON4A 1S3DA 3TKRA 11GSA 1U3IA 5IOXA 3WYWA 3TKSA 1TI1A 3CMIA 3MIXA 1R5PA 4IBPA 1OKTA 4I2TA 4L5OA 3M9KA 4KE3A 4PQIA 1AQVA 2YZHA 2GSRA 2FWEA 4OD7A 2IMKA 1SKSB 1F37A 2R3XA 2DMMA 3DRNA 3KH9A 4HUAA 1ERWA 5E59A 1CQGA 1PD21 4ZB7A 2MMZA 3EMXA 2P5QA 5IMCA 4YKGA 3KEBA 4YQMA 1PN9A 3VWUA 1SJIA 4KUNA 1BG1A 3N5OA 2B3SA 1EP8A 4KA0A 1VF4A 3VI5A 3DGQA 4WF4A 3RPNA 19GSA 5DCHA 2V41A 2X8GA 1FAAA 1OYJA 4I8BA 2E2GA 3TGZA 3I43A 4MF6A 2DC5A 1TW9A 4ZBDA 3P90A 4HJMA 4BVYA 2EIRA 1AXDA 1GSFA 1W4VA 4XTSA 2JSYA 2H6ZA 1BX9A 1NHOA 2B7KA 3IHQA 2K8SA 4MZCA 5A1NB 3GNJA 3QFAC 4LLRA 1ZYEA 4MZWA 3ZMLA 3ZRDA 2HRFA 4TRXA 4ZB8A 2C1YA 3CTGA 1QUWA 1VF3A 3KCMA 1NHYA 2CAIA 2M46A 3A5WA 3GHAA 4GTUA 1V58A 2CT6A 1USBA 2OT3A 3ZMKA 1OC8A 2M72A 1GTIA 1PX6A 3LSZA 5ELGA 2C4JA 1DE1A 4G0IA 1PSQA 2PBJA 5IMAA 1GSYA 5EL8A 2H70A 2QKEA 2VLUA 22GSA 1YZXA 4K5RA 2DJKA 4D73B 1R5AA 1SK2A 5G31A 3IOSA 4GXZA 3VPTA 2X64A 5HR2A 3QR6A 4BPYA 1S3CA 3ZREA 4ECCA 1EWXA 4G19A 3NZNA 2R37A 3HZ8A 1WPIA 2HSMB 4OMVA 3QD9A 4FH8A 3IBHA 1VF1A 3LYPA 4YAPA 5HR3A 2AB6A 2FWFA 3MNGA 2JADA 3O3TA 3BCKA 4Q5NA 3IE3A 1XOBA 3GRXA 4CW9A 1X9SB 2IFQA 4OWYA 3UAPA 1OC9A 1LBKA 1SJZA 5B6MA 3PINA 1W89A 2H72A 5HFGA 1ERUA 3F6FA 4EIQA 2AAWA 4JEDA 3L78A 1M2AA 3UJ1A 3UVTA 3ME7A 1MDKA 3LXTA 3FR9A 5DJLA 4IS0A 4N0VA 1PKWA 3VK9A 1U87A 1X5EA 4HU9A 1J0FA 1Q4JA 1ACVA 1XVWA 2AV4A 2FWHA 4G0LA 1GSDA 2GS3A 1UA5A 2LNSA 2RM6A 3EMPA 2JACA 3D0ZA 4MZBA 5IOWA 4EE0A 2GGTA 2OKAA 3P2AA 2L6CA 1XWAA 3TRXA 5ECKB 3PPUA 1FVJA 4JR6A 3EURA 1GL8A 6GSTA 3N9JA 4F0CA 3EYTA 3ZITA 2NVLA 1TXUA 1R7HA 2KP2A 4IKHA 5J47A 4EDYA 1ZMAA 1KNGA 2KHPA 3LJRA 3CRTA 3GA4A 4K8MA 5J5NA 1VF2A 2G0FA 1WOUA 3LWAA 4POBA 3QDNA 2C80A 4GCIA 3KMOA 3LW9A 3IK9A 1F3BA 20GSA 4OFNA 18GSA 4TVEA 3GX8A 4RI6A 1H75A 2FWGA 3ZIVA 1PN0A 2P5RA 4XS4B 2C0FA 5DALB 3VLNA 3MSZA 2PGTA 4WBRD 4HEA2 2VL3A 2XHFA 5DAKB 5ECSA 5EY6A 1AW9A 3OR5A 3LFLA 4KF9A 5DJMA 4GWRA 2DKIA 2RUFA 2B6MA 2PVOC 4IN0A 2O5VA 4NV5A 1FG4A 2C3TA 5B7CA 4F82A 5A34B 3QOUA 2OA7A 2DMLA 5CP1A 1XBSA 4DVCA 4WR4A 2IMFA 2DJ0A 2PVQA 3C71A 4KH7A 1MDJA 1NM3A 5JWOB 1SVMA 5H5QA 2EIQA 3EINA 3MDKA 3F0IA 2YP6A 3BJ5A 4O5RA 1T8EB 5J4VA 7GSSA 3KJYA 2XPEA 2HQTA 1FB6A 10GSA 2H8LA 4ZB6A 2YNXA 3L9VA 3HD5A 1RK4A 3F4RA 1U6TA 2HSYA 3RPPA 1X5CA 1RQMA 2YV9A 4GDFA 5ID2A 3M1GA 2GQKA 3VURA 2R0PA 5ECNB 1MTCA 1M9AA 1X0RA 2C8UA 3TRPA 2DJ2A 2LTKA 2MZCA 4K7OA 4PXOA 5D9TA 3D21A 3TKQA 1A2LA 5HR0A 4XIHA 1TU7A 1PL1A 2B5EA 3IHGA 3ED3A 1O85A 4IHUA 2DJJA 3C8EA 2E0QA 2CX4A 5A5KA 2L59A 4TXOA 5IMZA 2HZFA 1AAZA 5BRTA 4HQSA 5F05A 3WT2A 1YF0A 2TRCP 4ZXGA 3H79A 4MCUA 4KGIA 1F2EA 1O7UA 5A5HA 4MMMA 2IMIA 1H4OA 3UBKA 4DSSA 5H5SA 4CHSA 1PMTA 3APOA 2YPMA 4ZILA 1M7TA 3TOUA 3ZIJA 2L6DA 1AUCA 3Q19A 4BL7B 5CRWA 1TK8B 2H1GA 5AIVA 1A24A 4NHZA 5GAND 4IQ1A 1YVLA 2K9FA 3CTFA 1A0FA 3DYRA 1WMJA 3P7XA 4TKYA 2QGVA 4JBBA 2B7JA 2ZNMA 4OFMA 3ERWA 2PMTA 1TKDB 2MMNA 2GZPA 2AYTA 3EWLA 4ZL8A 5DCGA 1Z9HA 2NTOA 5A1NA 1ST9A 4JE1A 3KD0A 3G7IA 2N5FA 4N3ZA 2CVDA 5JCGA 1DSBA 1QGVA 5DQYA 3BCIA 1G7EA 3KTLA 2H30A 2F3MA 2YV7A 2P0GA 2H1BA 5CAXA 1YKCA 1EEJA 2OADA 3IAM2 3M3MA 2K18A 3HXSA 3D6IA 2HE3A 4GF0A 1B4PA 3RBTA 5HFIA 1EOHA 4QL7A 4EO3A 4GRFA 1GNEA 3HHVA 1WJKA 2NBSA 3KP9A 4KNDA 4POKA 5J9CA 3K8NA 4IP1A 5FWGA 4D73A 1SKWB 5G1LA 2VO4A 5DQSA 4E68A 4V2LA 4BWSA 1DUGA 1PA3A 1V98A 2FCHA 1ZZYA 3ZVJD 1B4QA 3VI7A 3SBCA 1HNCA 2V32A 4J56E 2LJKA 3APSA 2HSMA 2YJHA 4POLA 5IO2A 1XZOA 2P31A 1HNBA 2GQLA 3KM6A 4G2EA 4MPGA 4WXTA 4FIWA 1SL2B 3TKSC 4MK3A 4E8EA 4A5PA 2BJXA 17GSA 1V57A 2QA1A 1C72A 2D2ZA 4X4JA 5CRGA 3WGEA 2E2MA 9GSSA 2YZUA 1BQ7A 5GSTA 1DE2A 5ABRA 5E4WA 1TRVA 5CRHA 2VL2A 1M2BA 1MDIA 3E0UA 2GSQA 4KAEA 1TK5B 3QPMA 1GLQA 4EF0A 4ULXA 5IMVA 1B9XC 4NPBA 1GUKA 4GSNA 1SD9A 1UVZA 2DLXA 1V9WA 4MJCA 1T4YA 2JSZA 1OVNA 4O32A 4AGSA 2YANA 4EDZA 2O7KA 2R6KA 4PNGA 1K0BA 4V1Ag 5HR1A 1SVLA 3KGKA 1Z6MA 1EGOA 6GSWA 3KP8A 5JCWA 1WWJA 4QQ7A 3FYGA 8GSSA 3HVSA 2VKZG 2YOIA 1YJ6A 1ZYNA 1K3YA 1PQNA 2B5XA 3GTUA 1OKDA 2VM2A 4AI6A 3DVWA 5J40A 4MH2A 3APQA 2GT6A 3CSJA 2YN1A 1QK8A 3DMLA 3ISOA 5AIXA 3PR8A 4JZQA 5EVOA 1JZOA 3TJJA 3G9BA 3BOAA 1YEXA 2EIOA 4W66A 4F2IA 2OE0A 3QAVA 2JZRA 3W8JA 5IQYA 1OE7A 3PH9A 5KOWA 2HLSA 1HD2A 4IJ3A 4MNNA 3FEUA 4IGJA 4O5UA 2V2GA 1IYIA 3FZ5A 3L9UA 3E3EA 3IR4A 1GSEA 2TIRA 3IXRA 1AIUA 1FVKA 2GLRA 5DALA 4K5SA 4KB3A 3CRUA 1Z6NA 3IPZA 4IP6A 3LORA 5D8IA 3O76A 4G0KA 2KOKA 3GIXA 5G1KA 2HI7A 1FOVA 4YQVA 2WULA 1VGLA 1K0CA 4K9ZA 3H8QA 2GVPA 1O8WA 3FMWA 1TI3A 2JU5A 3TCOA 4HZ2A 1N8JA 4KDYA 1Z7RA 1EP7A 2KUCA 5G5FA 2I9HA 1FB0A 2FLSA 4Z2UA 2F8FA 2CQ9A 1PGTA 2F51A 1X9MB 1M99A 2C3QA 2YWNA 4EVMA 3GKXA 4XS1A 1EEMA 4HQZA 4KCAA 3VFIA 1XXUA 4DSRA 2H1LA 1XCCA 3RDWA 1ZOFA 4ILFA 2C0DA 2VUPA 2GDRA 2DSAA 4GQCA 4ZL7A 2H01A 3EU4A 3V1WA 5FT3A 2HRKA 2IPAA 3EC3A 3DKSA 2VCXA 4BVYB 4MDCA 1BAYA 2H0IA 1I5GA 4LL4B 2DIYA 2XPDA 1LU4A 3GKKA 1N2AA 1LJRA 2R2JA 4OCEA 4JRRA 3HY2A 4RQXA 5IM9A 1E6BA 4KDUA 2HT9A 3E9JB 2FUG2 2H1AA 3LXZA 4ZIJA 5J4UA 3KTBA 3D4MA 4RQRA 3BD2A 1SKRB 2F9SA 5IIZA 3CBUA 1GTAA 1B8XA 1MEKA 1TU8A 2UZ8A 2DJ1A 3ERGA 2HSNA 3FK8A 1ZL9A 4TR1B 1XPVA 2X4AA 2OACA 3RAZA 3LYKA 5BMUA 1PRXA 5KEJA 2L5LA 4HS1A 3W6GA 4LL1B 3ZVJA 2VOCA 1PX7A 2A2RA 2N5AA 2VL9A 3ZYWA 2EFEA 2FD3A 4EXJA 2A2SA 4N11A 1GNWA 5ELAA 4KDXA 3VPQA 5B6NA 2R5GA 3EU3A 2MBSA 4FYBA 4MP4A 3F63A 3TOTA 2PU9C 5F8BA 3KZQA 2I3YA 1QFNA 4GLTA 1HNAA 2IFQB 4KW6A 1BG5A 1OC9B 2HZEA 2H6YA 4AJ6A 3DVXA 5DBQA 2V6KA 4F9ZA 4O7HA 3DD3A 1AQWA 2CZ3A 4TR3A 3JCML 4MF5A 3PGTA 1ZCPA 4ECIA 2VCQA 2QA2A 5A4VA 3Q6OA 2R4VA 2I4AA 2GZYA 2WCIA 5GAPD 2LKUA 5CO3A 5G2ZA 4ACSA 2ALBA 4PGTA 2B5YA 2GQMA 1SENA 4MJBA 3O6TA 2PPTA 1SD8A 4FQUA 4G10A 2PERA 2FHEA 2MMAA 1YY7A 2CA8A 3ZFBA 5IMDA 2VLTA 2PUKC 2IMDA 3CSIA 4LMWA 2CVBA 3HDCA 4L5LA 1ML6A 2CX3A 3W8SA 1TTZA 4MABA 2VD1A 1JHBA 2CZ2A 2ON5A 2CV4A 3FZ4A 2VD0A 1K0DA 1F6MC 4O92A 1XW5A 3TB2A 2WZ9A 6GSSA 1Q98A 2DBCA 2GZZA 1SJ6A 5G30A 3F3QA 2QSIA 3ZFLA 2VCWA 4PQHA 3IA1A 4PURA 4FYCA 3LEFA 3WGXA 1O73A 2GT5A 2C3NA 1K3OA 4Q5RA 1SU9A 2AJQB 3A3TA 3I9V2 5CRDA 1R4WA 5IO0A 2LNTA 3DWVA 4L0UA 5H5RA 2K6VA 4MA9A 3ERFA 4RUVA 2J23A 3HZ4A 5GSSA 1K0NA 1WP0A 1URMA 5LD0A 3HVVA 3J7Yk 1MD4A 1F3AA 1YQ1A 4EL1A 2LQQA 2Z9SA 4ZB9A 4BVXB 5AN1A 3NIVA 2LRCA 1JZWA 2M80A 3ZZXA 2EFCA 3GKNA 1B48A 1FOHA 2ZCTA 2HNLA 2C0GA 1EOGA 4IJIA 3UVHA 1XWGA 2AUVA 3WD6A 2A4VA 4DSQA 3IV4A 4I2UA 2RLIA 3TRQA 3P8WA 3EVIA 1KEBA 4Z2RA 3LQ7A 1O6JA 4PQ1A 1T1VA 1A2MA 4PTSA 2HYXA 3TJFA 1N25A 3UIWA 4OFTA 4EC0A 2JL4A 2L4QA 4IW9A 4KSOA 2VCVA 1V2AA 4KCEA 1A23A 3FRCA 1G0TA 1GUMA 2X8HA 1QQ2A 4K7IA 4X43A 5IPGA 1TRWA 6GSVA 3Q74A 3HJOA 2IL3A 2IIYA 4RI7A 1PL2A 4XRAA 3F8UA 2H75A 3C73A 4ECJA 3GYKA 4X1UA 4XHMA 3RHBA 1DBYA 16GSA 4ID0A 4NXIA 1EV4A 1KBNA 1ERTA 3GFKA 4DEJA 5ECIB 1OE8A 2OBKA 5ID2B 1T4ZA 2RM5A 3VWVA 2FY6A 4AKXB 4IELA 3VWXA 1T00A 2VCTA 3US3A 4YAVA 3GKMA 3F3RA 2H74A 3ZL5A 4AF2A 2LQOA 2ZUPA 2A2PA 1IYHA 3TDGA 2WB9A 4NWYA 5INYA 1QMVA 1AC1A 5FHIA 2WRTA 1K3LA 2JZTA 4TXOB 3L0HA 1XW9A 1I9DA 1EGRA 3FW2A 5ECPB 1TXXA 4PUFC 12GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJR A;  2YCD A;  1J08 A;  5EPF A;  1GWC A;  1T7P B;  2JZS A;  1ILO A;  5J3R A;  4ML1 A;  4DSS B;  2VAF A;  3F4S A;  2AHE A;  2J9H A;  4HDE A;  5D9W A;  14GS A;  3EE2 A;  1KTE A;  4P3Y B;  2I1U A;  2LEG A;  2X99 A;  4OO5 A;  4K2D A;  1A2J A;  1THX A;  4ZBA A;  4K6X A;  2VL2 C;  5D9V A;  5ECO B;  1RW1 A;  3DEX A;  3UL3 A;  2V6O A;  3TUE A;  1U88 A;  1K0A A;  1O81 A;  4MJA A;  3ZTL A;  5ECR B;  4HJ2 A;  3G7Y A;  4L0W A;  2VIM A;  1WE0 A;  3GUR A;  1JZD A;  4K7N A;  4AJ7 A;  4N0Z A;  2TRX A;  2GTU A;  2XBI A;  4MPF A;  3SWL A;  1AQX A;  1XFL A;  5JWQ B;  1XWK A;  2IJY A;  5ECM B;  5F06 A;  3TJK A;  1TRS A;  1XVQ A;  1MD3 A;  1GSQ A;  4YH2 A;  2OBI A;  3NOF A;  1FO5 A;  3F6D A;  1UN2 A;  3TJG A;  2VCZ A;  2LRT A;  4NHW A;  1F9M A;  4V2N A;  1THO A;  2LS5 A;  2RUE A;  1Y6E A;  1GTB A;  2RII A;  2DIZ A;  1G6W A;  3HKR A;  1A0R P;  5KN2 A;  2OE1 A;  4HI7 A;  3QMX A;  3F9U A;  1BYE A;  4HZ4 A;  5D9X A;  4AJ8 A;  2REM A;  1A8L A;  3KXO A;  4TR1 A;  3CYN A;  5B8B A;  5JWR B;  1NW2 A;  1U3A A;  5CRE A;  3HVX A;  5KN3 A;  4XS4 A;  1OAZ A;  4BA7 A;  4I97 A;  4WKW A;  3HYP A;  1TOF A;  3TKS E;  1EV9 A;  2FNO A;  4K0G A;  3IC4 A;  4I5Q A;  5HQP A;  5DAK A;  5J41 A;  3IRA A;  3HA9 A;  2WGR A;  2O89 A;  2YJ7 A;  3G7J A;  1VRS D;  4ISD A;  4ECB A;  4GST A;  1YDK A;  4TN8 A;  3L4N A;  3GMF A;  3AY8 A;  1E2Y A;  3GX0 A;  4JU5 A;  4NMU A;  3QAW A;  4Q5Q A;  5LNK e;  3C1R A;  5JCU A;  4LMV A;  3M0F A;  1XWB A;  3R3E A;  2NDO A;  4OO4 A;  3R2Q A;  2VM1 A;  3QFB C;  2H6X A;  4TOP A;  2LST A;  3GV1 A;  3FZA A;  3ZLP A;  4TW5 A;  4K1F A;  3FHK A;  1R26 A;  4POM A;  1GRX A;  2WJU A;  3GUS A;  3GN3 A;  1SYX A;  4PUA A;  4WBJ A;  3UMA A;  1HQO A;  2LJA A;  2GST A;  3GTU B;  2H73 A;  4NAX A;  1JLV A;  4G9H A;  2KP1 A;  3RHC A;  3GH9 A;  2FA8 A;  5ECL B;  5AIS A;  2WS2 A;  1Z5Y E;  4K0N A;  1BJX A;  3M9J A;  4I6X A;  2O8V B;  3C1S A;  13GS A;  5GZZ B;  5IPH A;  2H19 A;  2DJ3 A;  1PKZ A;  4XS6 A;  3FY7 A;  5L71 A;  3FKF A;  1ZGN A;  1GLP A;  3QAG A;  4Q5F A;  1O8X A;  5J9B A;  2MMO A;  1TP9 A;  1G7O A;  5KN1 A;  1GSS A;  4FYU A;  1G6Y A;  3WT1 A;  1B9Y C;  2FGX A;  2B1L A;  1V40 A;  5HFK A;  3TJB A;  6GSY A;  4J57 E;  4BL7 A;  5DVB A;  4NV2 A;  2N5B A;  1GH2 A;  3KH7 A;  1Z3E A;  4MH3 A;  1XW6 A;  1K0O A;  3IC8 A;  1TDI A;  4JR4 A;  3CSH A;  4BVX A;  3QCP A;  6GSU A;  2HFD A;  3IK7 A;  5IMF A;  3I69 A;  4EKZ A;  2K8V A;  3UEM A;  4EUY A;  1X9W B;  2H76 A;  1JLW A;  1GUL A;  4MF7 A;  4USS A;  3D22 A;  4OCF A;  4F0B A;  1T3B A;  3DXB A;  2LUS A;  1CQH A;  2V1M A;  1SK1 A;  2IN3 A;  4IQA A;  2XC2 A;  4X0X A;  1X5D A;  4N10 A;  1GSU A;  5LCZ A;  3UBL A;  3GSS A;  3L9S A;  1XOA A;  5DDL A;  4F03 A;  4PNF A;  2CAQ A;  3H1N A;  5B8A A;  1XWC A;  3U6V A;  2EC4 A;  1SK0 A;  3LG6 A;  2FA4 A;  4TR4 A;  5D73 A;  1ERV A;  4BWQ A;  1M9B A;  2LV3 A;  2HRK B;  2GSS A;  1JZR A;  2HRA A;  3FZ9 A;  1SL1 B;  1K0M A;  1J9B A;  1ABA A;  4FO5 A;  5COH A;  5F07 A;  1GP1 A;  1GUH A;  3GL3 A;  3IAS 2;  3GH6 A;  1S3A A;  4PX1 A;  4XRD A;  2HSH A;  5F0G A;  3A2V A;  3I6A A;  3CXG A;  1ZYQ B;  3IDV A;  4HU7 A;  5D96 A;  4ZL9 A;  1M2D A;  4GSS A;  1OC3 A;  3U5R E;  1YF1 A;  4H86 A;  2MYG A;  5D93 A;  3TKP A;  3J7Y b;  5ECH B;  1XIY A;  2YWO A;  2WFC A;  4L8E A;  2HSN B;  3HJP A;  2PWJ A;  2XBQ A;  5CNW A;  1Y25 A;  1GTU A;  2YWM A;  2ON7 A;  1TRU A;  1WIK A;  2O85 A;  3FR6 A;  2PN8 A;  4TR0 A;  2H0H A;  2WDU A;  4J2F A;  2F8A A;  2OJL A;  2H0G A;  3HCZ A;  2L4C A;  3C7M A;  4N30 A;  2G2Q A;  2KLX A;  3GST A;  4MLY A;  4ML6 A;  4V1A p;  5C00 A;  2C0E A;  4TXV A;  3A2W A;  2IWT A;  2H71 A;  4WEY A;  2L5O A;  2I81 A;  2QC7 A;  3MAK A;  5ENU A;  1BED A;  5A4U A;  1EZK A;  5A4W A;  4HOJ A;  2HXK A;  4YQU A;  6GSX A;  1Z7P A;  2BMX A;  4GQF A;  1FW1 A;  1SL0 B;  2HRN A;  5ECQ B;  3KIJ A;  1YEP A;  2L57 A;  2E7P A;  3LGC A;  2OE3 A;  4WR5 A;  2H66 A;  4CDO A;  5KN0 A;  2HZE B;  3BBY A;  2O87 A;  2NPB A;  3HJM A;  1A8Y A;  3MWH A;  1TK0 B;  3GL5 A;  2VLV A;  2B1K A;  4E8H A;  2LRN A;  4V2M A;  3WGD A;  1TJD A;  3VWW A;  5AGY A;  2BTO T;  3H93 A;  1UC7 A;  1NSW A;  2IME A;  3UAR A;  4KSM A;  1YKA A;  3S9F A;  4Z7X A;  3F4T A;  3D5J A;  4WET A;  2H1D A;  1FHE A;  3Q18 A;  5G5E A;  4QL9 A;  4LA1 A;  3UOM A;  5C04 A;  2MBT A;  3DIE A;  2ES7 A;  4XCS A;  4MJE A;  3A2X A;  1M0U A;  2CVK A;  4KX4 A;  1HYU A;  3ME8 A;  3H4K A;  3D4T A;  3M8N A;  2X8C A;  1QXH A;  3KMN A;  2YWI A;  3FR3 A;  4IVF A;  4WF5 A;  1SYR A;  4ZBB A;  5CYY A;  1JFU A;  1WRY A;  1ON4 A;  1S3D A;  3TKR A;  11GS A;  1U3I A;  5IOX A;  3WYW A;  3TKS A;  1TI1 A;  3CMI A;  1R5P A;  4IBP A;  1OKT A;  4I2T A;  4L5O A;  3M9K A;  4KE3 A;  4PQI A;  1AQV A;  2YZH A;  2GSR A;  2FWE A;  4OD7 A;  2IMK A;  1SKS B;  1F37 A;  2R3X A;  2DMM A;  3DRN A;  3KH9 A;  4HUA A;  1ERW A;  5E59 A;  1CQG A;  1PD2 1;  2MMZ A;  3EMX A;  2P5Q A;  5IMC A;  3KEB A;  4YQM A;  1PN9 A;  3VWU A;  1SJI A;  4KUN A;  3N5O A;  2B3S A;  1EP8 A;  4KA0 A;  1VF4 A;  3VI5 A;  3DGQ A;  4WF4 A;  3RPN A;  19GS A;  5DCH A;  2V41 A;  2X8G A;  1FAA A;  1OYJ A;  4I8B A;  2E2G A;  3TGZ A;  3I43 A;  4MF6 A;  2DC5 A;  1TW9 A;  4ZBD A;  3P90 A;  4HJM A;  4BVY A;  2EIR A;  1AXD A;  1GSF A;  1W4V A;  4XTS A;  2JSY A;  2H6Z A;  1BX9 A;  1NHO A;  2B7K A;  3IHQ A;  2K8S A;  4MZC A;  3GNJ A;  3QFA C;  4LLR A;  1ZYE A;  4MZW A;  3ZML A;  3ZRD A;  2HRF A;  4TRX A;  4ZB8 A;  2C1Y A;  3CTG A;  1QUW A;  1VF3 A;  3KCM A;  1NHY A;  2CAI A;  2M46 A;  3A5W A;  3GHA A;  4GTU A;  1V58 A;  2CT6 A;  1USB A;  3ZMK A;  1OC8 A;  2M72 A;  1GTI A;  1PX6 A;  3LSZ A;  5ELG A;  2C4J A;  1DE1 A;  4G0I A;  1PSQ A;  2PBJ A;  5IMA A;  1GSY A;  5EL8 A;  2H70 A;  2QKE A;  2VLU A;  22GS A;  1YZX A;  2DJK A;  4D73 B;  1R5A A;  1SK2 A;  5G31 A;  3IOS A;  4GXZ A;  3VPT A;  2X64 A;  5HR2 A;  3QR6 A;  4BPY A;  1S3C A;  3ZRE A;  4ECC A;  1EWX A;  4G19 A;  3NZN A;  2R37 A;  3HZ8 A;  1WPI A;  2HSM B;  4OMV A;  3QD9 A;  4FH8 A;  3IBH A;  1VF1 A;  3LYP A;  4YAP A;  5HR3 A;  2AB6 A;  2FWF A;  3MNG A;  2JAD A;  3O3T A;  3BCK A;  4Q5N A;  3IE3 A;  1XOB A;  3GRX A;  4CW9 A;  1X9S B;  2IFQ A;  4OWY A;  3UAP A;  1OC9 A;  1LBK A;  1SJZ A;  5B6M A;  3PIN A;  1W89 A;  2H72 A;  5HFG A;  1ERU A;  3F6F A;  2AAW A;  4JED A;  3L78 A;  1M2A A;  3UJ1 A;  3UVT A;  3ME7 A;  1MDK A;  3LXT A;  3FR9 A;  5DJL A;  4IS0 A;  4N0V A;  1PKW A;  3VK9 A;  1U87 A;  1X5E A;  4HU9 A;  1J0F A;  1Q4J A;  1ACV A;  1XVW A;  2AV4 A;  2FWH A;  4G0L A;  1GSD A;  2GS3 A;  1UA5 A;  2LNS A;  2RM6 A;  3EMP A;  2JAC A;  3D0Z A;  4MZB A;  5IOW A;  4EE0 A;  2GGT A;  2OKA A;  3P2A A;  2L6C A;  1XWA A;  3TRX A;  5ECK B;  3PPU A;  1FVJ A;  4JR6 A;  3EUR A;  1GL8 A;  6GST A;  3N9J A;  4F0C A;  3EYT A;  3ZIT A;  2NVL A;  1R7H A;  2KP2 A;  4IKH A;  4EDY A;  1ZMA A;  1KNG A;  2KHP A;  3LJR A;  3CRT A;  3GA4 A;  4K8M A;  5J5N A;  1VF2 A;  2G0F A;  1WOU A;  3LWA A;  4POB A;  3QDN A;  2C80 A;  4GCI A;  3KMO A;  3IK9 A;  1F3B A;  20GS A;  4OFN A;  18GS A;  4TVE A;  3GX8 A;  4RI6 A;  1H75 A;  2FWG A;  3ZIV A;  2P5R A;  4XS4 B;  2C0F A;  5DAL B;  3VLN A;  3MSZ A;  2PGT A;  4WBR D;  4HEA 2;  2VL3 A;  2XHF A;  5DAK B;  5ECS A;  5EY6 A;  1AW9 A;  3OR5 A;  3LFL A;  4KF9 A;  5DJM A;  4GWR A;  2RUF A;  2B6M A;  2PVO C;  4IN0 A;  4NV5 A;  1FG4 A;  2C3T A;  5B7C A;  4F82 A;  3QOU A;  2OA7 A;  2DML A;  5CP1 A;  1XBS A;  4DVC A;  4WR4 A;  2IMF A;  2DJ0 A;  2PVQ A;  3C71 A;  4KH7 A;  1MDJ A;  1NM3 A;  5JWO B;  5H5Q A;  2EIQ A;  3EIN A;  3MDK A;  3F0I A;  2YP6 A;  3BJ5 A;  4O5R A;  1T8E B;  7GSS A;  3KJY A;  2XPE A;  2HQT A;  1FB6 A;  10GS A;  2H8L A;  4ZB6 A;  2YNX A;  3L9V A;  3HD5 A;  1RK4 A;  3F4R A;  1U6T A;  2HSY A;  3RPP A;  1X5C A;  1RQM A;  2YV9 A;  5ID2 A;  3M1G A;  2GQK A;  3VUR A;  5ECN B;  1MTC A;  1M9A A;  1X0R A;  2C8U A;  3TRP A;  2DJ2 A;  2LTK A;  2MZC A;  4K7O A;  4PXO A;  5D9T A;  3D21 A;  3TKQ A;  1A2L A;  5HR0 A;  4XIH A;  1TU7 A;  1PL1 A;  2B5E A;  3ED3 A;  1O85 A;  4IHU A;  2DJJ A;  3C8E A;  2E0Q A;  2CX4 A;  5A5K A;  2L59 A;  4TXO A;  5IMZ A;  2HZF A;  1AAZ A;  4HQS A;  5F05 A;  3WT2 A;  1YF0 A;  2TRC P;  4ZXG A;  3H79 A;  4MCU A;  4KGI A;  1F2E A;  1O7U A;  4MMM A;  2IMI A;  1H4O A;  3UBK A;  4DSS A;  5H5S A;  4CHS A;  1PMT A;  3APO A;  2YPM A;  4ZIL A;  1M7T A;  3TOU A;  3ZIJ A;  2L6D A;  1AUC A;  3Q19 A;  4BL7 B;  5CRW A;  1TK8 B;  2H1G A;  5AIV A;  1A24 A;  4NHZ A;  5GAN D;  4IQ1 A;  2K9F A;  3CTF A;  1A0F A;  3DYR A;  1WMJ A;  3P7X A;  4TKY A;  2QGV A;  4JBB A;  2B7J A;  2ZNM A;  4OFM A;  3ERW A;  2PMT A;  1TKD B;  2MMN A;  2GZP A;  2AYT A;  3EWL A;  4ZL8 A;  5DCG A;  1Z9H A;  2NTO A;  1ST9 A;  4JE1 A;  3KD0 A;  3G7I A;  2N5F A;  2CVD A;  5JCG A;  1DSB A;  1QGV A;  5DQY A;  3BCI A;  1G7E A;  3KTL A;  2H30 A;  2F3M A;  2YV7 A;  2P0G A;  2H1B A;  5CAX A;  1YKC A;  1EEJ A;  2OAD A;  3IAM 2;  3M3M A;  2K18 A;  3D6I A;  3HXS A;  2HE3 A;  4GF0 A;  1B4P A;  3RBT A;  5HFI A;  1EOH A;  4QL7 A;  4EO3 A;  4GRF A;  1GNE A;  3HHV A;  1WJK A;  2NBS A;  3KP9 A;  4KND A;  4POK A;  5J9C A;  3K8N A;  4IP1 A;  5FWG A;  4D73 A;  1SKW B;  5G1L A;  2VO4 A;  5DQS A;  4V2L A;  4BWS A;  1DUG A;  1PA3 A;  1V98 A;  2FCH A;  1ZZY A;  3ZVJ D;  1B4Q A;  3VI7 A;  3SBC A;  1HNC A;  2V32 A;  4J56 E;  2LJK A;  3APS A;  2HSM A;  2YJH A;  4POL A;  5IO2 A;  1XZO A;  2P31 A;  1HNB A;  2GQL A;  3KM6 A;  4G2E A;  4MPG A;  4WXT A;  4FIW A;  1SL2 B;  3TKS C;  4MK3 A;  4E8E A;  2BJX A;  17GS A;  1V57 A;  1C72 A;  2D2Z A;  5CRG A;  3WGE A;  2E2M A;  9GSS A;  2YZU A;  1BQ7 A;  5GST A;  1DE2 A;  5ABR A;  5E4W A;  1TRV A;  5CRH A;  2VL2 A;  1M2B A;  1MDI A;  3E0U A;  2GSQ A;  4KAE A;  1TK5 B;  3QPM A;  1GLQ A;  4EF0 A;  4ULX A;  5IMV A;  1B9X C;  4NPB A;  1GUK A;  4GSN A;  1SD9 A;  1UVZ A;  2DLX A;  1V9W A;  4MJC A;  1T4Y A;  2JSZ A;  1OVN A;  4O32 A;  4AGS A;  2YAN A;  4EDZ A;  2O7K A;  2R6K A;  4PNG A;  1K0B A;  4V1A g;  5HR1 A;  3KGK A;  1Z6M A;  1EGO A;  6GSW A;  3KP8 A;  5JCW A;  1WWJ A;  4QQ7 A;  3FYG A;  8GSS A;  3HVS A;  2YOI A;  1YJ6 A;  1K3Y A;  1PQN A;  2B5X A;  3GTU A;  1OKD A;  2VM2 A;  3DVW A;  4MH2 A;  3APQ A;  2GT6 A;  3CSJ A;  2YN1 A;  1QK8 A;  3DML A;  3ISO A;  5AIX A;  3PR8 A;  4JZQ A;  5EVO A;  1JZO A;  3TJJ A;  3G9B A;  3BOA A;  1YEX A;  2EIO A;  4F2I A;  2OE0 A;  3QAV A;  2JZR A;  3W8J A;  5IQY A;  1OE7 A;  3PH9 A;  2HLS A;  1HD2 A;  4IJ3 A;  3FEU A;  4IGJ A;  2V2G A;  1IYI A;  3FZ5 A;  3L9U A;  3E3E A;  3IR4 A;  1GSE A;  2TIR A;  3IXR A;  1AIU A;  1FVK A;  2GLR A;  5DAL A;  4KB3 A;  3CRU A;  1Z6N A;  3IPZ A;  4IP6 A;  3LOR A;  5D8I A;  3O76 A;  4G0K A;  2KOK A;  3GIX A;  5G1K A;  2HI7 A;  1FOV A;  4YQV A;  2WUL A;  1VGL A;  1K0C A;  4K9Z A;  3H8Q A;  2GVP A;  1O8W A;  1TI3 A;  2JU5 A;  3TCO A;  4HZ2 A;  1N8J A;  4KDY A;  1Z7R A;  1EP7 A;  2KUC A;  5G5F A;  2I9H A;  1FB0 A;  2FLS A;  2F8F A;  2CQ9 A;  1PGT A;  2F51 A;  1X9M B;  1M99 A;  2C3Q A;  2YWN A;  4EVM A;  3GKX A;  4XS1 A;  1EEM A;  4HQZ A;  4KCA A;  3VFI A;  1XXU A;  4DSR A;  1XCC A;  3RDW A;  1ZOF A;  4ILF A;  2C0D A;  2VUP A;  2GDR A;  2DSA A;  4GQC A;  4ZL7 A;  2H01 A;  3EU4 A;  3V1W A;  5FT3 A;  2HRK A;  2IPA A;  3EC3 A;  3DKS A;  2VCX A;  4BVY B;  4MDC A;  1BAY A;  2H0I A;  1I5G A;  4LL4 B;  2DIY A;  2XPD A;  1LU4 A;  3GKK A;  1N2A A;  1LJR A;  2R2J A;  4OCE A;  4JRR A;  3HY2 A;  4RQX A;  5IM9 A;  1E6B A;  4KDU A;  2HT9 A;  3E9J B;  2FUG 2;  2H1A A;  3LXZ A;  4ZIJ A;  5J4U A;  3KTB A;  3D4M A;  4RQR A;  3BD2 A;  1SKR B;  2F9S A;  5IIZ A;  3CBU A;  1GTA A;  1B8X A;  1MEK A;  1TU8 A;  2UZ8 A;  2DJ1 A;  3ERG A;  3FK8 A;  1ZL9 A;  4TR1 B;  1XPV A;  3RAZ A;  2OAC A;  3LYK A;  5BMU A;  1PRX A;  5KEJ A;  2L5L A;  4HS1 A;  3W6G A;  4LL1 B;  3ZVJ A;  2VOC A;  1PX7 A;  2A2R A;  2N5A A;  2VL9 A;  3ZYW A;  2FD3 A;  4EXJ A;  2A2S A;  4N11 A;  1GNW A;  5ELA A;  4KDX A;  3VPQ A;  5B6N A;  2R5G A;  3EU3 A;  2MBS A;  4FYB A;  4MP4 A;  3F63 A;  3TOT A;  2PU9 C;  5F8B A;  3KZQ A;  2I3Y A;  1QFN A;  4GLT A;  1HNA A;  2IFQ B;  4KW6 A;  1BG5 A;  1OC9 B;  2HZE A;  2H6Y A;  4AJ6 A;  3DVX A;  5DBQ A;  2V6K A;  4F9Z A;  4O7H A;  3DD3 A;  1AQW A;  2CZ3 A;  4TR3 A;  3JCM L;  4MF5 A;  3PGT A;  1ZCP A;  4ECI A;  2VCQ A;  5A4V A;  3Q6O A;  2R4V A;  2I4A A;  2GZY A;  2WCI A;  5GAP D;  2LKU A;  5CO3 A;  5G2Z A;  4ACS A;  2ALB A;  4PGT A;  2B5Y A;  2GQM A;  1SEN A;  4MJB A;  3O6T A;  2PPT A;  1SD8 A;  4FQU A;  4G10 A;  2PER A;  2FHE A;  2MMA A;  1YY7 A;  2CA8 A;  3ZFB A;  5IMD A;  2VLT A;  2PUK C;  2IMD A;  3CSI A;  4LMW A;  2CVB A;  3HDC A;  4L5L A;  1ML6 A;  2CX3 A;  3W8S A;  1TTZ A;  4MAB A;  2VD1 A;  1JHB A;  2CZ2 A;  2ON5 A;  2CV4 A;  3FZ4 A;  2VD0 A;  1K0D A;  1F6M C;  4O92 A;  1XW5 A;  3TB2 A;  2WZ9 A;  6GSS A;  1Q98 A;  2DBC A;  2GZZ A;  1SJ6 A;  5G30 A;  3F3Q A;  2QSI A;  3ZFL A;  2VCW A;  4PQH A;  3IA1 A;  4PUR A;  4FYC A;  3LEF A;  3WGX A;  1O73 A;  2GT5 A;  2C3N A;  1K3O A;  4Q5R A;  1SU9 A;  2AJQ B;  3A3T A;  3I9V 2;  5CRD A;  1R4W A;  5IO0 A;  2LNT A;  3DWV A;  4L0U A;  5H5R A;  2K6V A;  4MA9 A;  3ERF A;  4RUV A;  2J23 A;  3HZ4 A;  5GSS A;  1K0N A;  1WP0 A;  1URM A;  5LD0 A;  3HVV A;  3J7Y k;  1MD4 A;  1F3A A;  1YQ1 A;  4EL1 A;  2LQQ A;  2Z9S A;  4ZB9 A;  4BVX B;  5AN1 A;  3NIV A;  2LRC A;  1JZW A;  2M80 A;  3ZZX A;  3GKN A;  1B48 A;  2ZCT A;  2HNL A;  2C0G A;  1EOG A;  4IJI A;  3UVH A;  1XWG A;  2AUV A;  3WD6 A;  2A4V A;  4DSQ A;  3IV4 A;  4I2U A;  2RLI A;  3TRQ A;  3P8W A;  3EVI A;  1KEB A;  3LQ7 A;  1O6J A;  4PQ1 A;  1T1V A;  1A2M A;  4PTS A;  2HYX A;  3TJF A;  3UIW A;  4OFT A;  4EC0 A;  2JL4 A;  4IW9 A;  2L4Q A;  4KSO A;  2VCV A;  1V2A A;  4KCE A;  1A23 A;  3FRC A;  1G0T A;  1GUM A;  2X8H A;  1QQ2 A;  4K7I A;  4X43 A;  5IPG A;  1TRW A;  6GSV A;  3Q74 A;  3HJO A;  2IL3 A;  2IIY A;  4RI7 A;  1PL2 A;  4XRA A;  3F8U A;  2H75 A;  3C73 A;  4ECJ A;  3GYK A;  4X1U A;  4XHM A;  3RHB A;  1DBY A;  16GS A;  4ID0 A;  4NXI A;  1EV4 A;  1KBN A;  1ERT A;  3GFK A;  4DEJ A;  5ECI B;  1OE8 A;  2OBK A;  5ID2 B;  1T4Z A;  2RM5 A;  3VWV A;  2FY6 A;  4IEL A;  3VWX A;  1T00 A;  2VCT A;  3US3 A;  4YAV A;  3GKM A;  3F3R A;  2H74 A;  3ZL5 A;  4AF2 A;  2LQO A;  2ZUP A;  1IYH A;  3TDG A;  2WB9 A;  4NWY A;  5INY A;  1QMV A;  1AC1 A;  5FHI A;  2WRT A;  1K3L A;  2JZT A;  4TXO B;  3L0H A;  1XW9 A;  1I9D A;  1EGR A;  3FW2 A;  5ECP B;  1TXX A;  4PUF C;  12GS A; 
#chains in the Genus database with same CATH topology
 2LJR A;  2YCD A;  1J08 A;  5EPF A;  1GWC A;  5A5H B;  2JZS A;  1T7P B;  1ILO A;  5J3R A;  4ML1 A;  4DSS B;  2VAF A;  3F4S A;  2AHE A;  2J9H A;  2DKH A;  4HDE A;  5D9W A;  14GS A;  3EE2 A;  1KTE A;  4P3Y B;  2I1U A;  2LEG A;  2X99 A;  4OO5 A;  4K2D A;  1A2J A;  1THX A;  4ZBA A;  4K6X A;  1XG8 A;  2VL2 C;  3HVN A;  5D9V A;  5ECO B;  1RW1 A;  3DEX A;  3UL3 A;  2V6O A;  1SVO A;  3TUE A;  1U88 A;  1K0A A;  3RFR C;  1O81 A;  4MJA A;  3ZTL A;  5ECR B;  3TU3 B;  4HJ2 A;  3G7Y A;  4L0W A;  2VIM A;  1WE0 A;  3GUR A;  1JZD A;  4K7N A;  4AJ7 A;  4N0Z A;  2TRX A;  2GTU A;  2XBI A;  4MPF A;  3SWL A;  1AQX A;  1XFL A;  5JWQ B;  2WW0 A;  1XWK A;  2IJY A;  5ECM B;  5F06 A;  3TJK A;  1TRS A;  1XVQ A;  2A4H A;  1MD3 A;  1GSQ A;  4YH2 A;  2OBI A;  3NOF A;  1FO5 A;  3F6D A;  1UN2 A;  3TJG A;  3CQF A;  2VCZ A;  2LRT A;  4NHW A;  1F9M A;  4V2N A;  1THO A;  2LS5 A;  2RUE A;  1Y6E A;  1GTB A;  2WW3 A;  2RII A;  2DIZ A;  1G6W A;  3HKR A;  1A0R P;  5KN2 A;  2OE1 A;  4HI7 A;  3QMX A;  3F9U A;  3HMJ G;  1BYE A;  4PI2 C;  4HZ4 A;  4Z2T A;  5D9X A;  4AJ8 A;  2REM A;  1A8L A;  3KXO A;  4TR1 A;  3CYN A;  1M3J A;  5JWR B;  1NW2 A;  5B8B A;  1U3A A;  5CRE A;  3HVX A;  5KN3 A;  4XS4 A;  2WVX B;  1OAZ A;  4BA7 A;  4I97 A;  4WKW A;  4ICY A;  3HYP A;  1TOF A;  3TKS E;  1EV9 A;  2FNO A;  4K0G A;  3IC4 A;  4I5Q A;  5HQP A;  5DAK A;  5J41 A;  3IRA A;  3HA9 A;  2WGR A;  2O89 A;  2YJ7 A;  3G7J A;  1VRS D;  4ISD A;  4ECB A;  4GST A;  4AKI A;  1YDK A;  4TN8 A;  3L4N A;  3GMF A;  3AY8 A;  1E2Y A;  3EPT A;  3GX0 A;  4JU5 A;  4NMU A;  5A34 A;  3QAW A;  4Q5Q A;  5LNK e;  3C1R A;  5JCU A;  4LMV A;  3M0F A;  1XWB A;  3R3E A;  2NDO A;  4OO4 A;  3R2Q A;  2VM1 A;  3QFB C;  2H6X A;  4TOP A;  2LST A;  3GV1 A;  3FZA A;  3ZLP A;  4TW5 A;  4K1F A;  2EFD A;  2UV8 G;  3FHK A;  1BF5 A;  4CY8 A;  1ZYP A;  1R26 A;  4POM A;  1GRX A;  2WJU A;  3GUS A;  2R0G A;  3GN3 A;  1SYX A;  4PUA A;  4WBJ A;  3UMA A;  1HQO A;  4G01 A;  2LJA A;  2GST A;  3GTU B;  2H73 A;  4NAX A;  1JLV A;  4AKH A;  4G9H A;  2KP1 A;  3RHC A;  3GH9 A;  2FA8 A;  2R0C A;  5ECL B;  5AIS A;  2WS2 A;  1Z5Y E;  4K0N A;  1BJX A;  4CY6 A;  3M9J A;  4I6X A;  2O8V B;  3C1S A;  13GS A;  5GZZ B;  5IPH A;  2H19 A;  2DJ3 A;  1PKZ A;  4XS6 A;  3FY7 A;  5L71 A;  3FKF A;  1ZGN A;  1GLP A;  4YKF A;  3QAG A;  4Q5F A;  1O8X A;  5J9B A;  2MMO A;  1TP9 A;  1G7O A;  5KN1 A;  1GSS A;  4FYU A;  1G6Y A;  3WT1 A;  1B9Y C;  2X49 A;  2FGX A;  2B1L A;  1V40 A;  5HFK A;  3TJB A;  6GSY A;  4J57 E;  4BL7 A;  5DVB A;  4NV2 A;  2N5B A;  1GH2 A;  3KH7 A;  1Z3E A;  4MH3 A;  1XW6 A;  1K0O A;  3IC8 A;  1TDI A;  4JR4 A;  3CSH A;  4BVX A;  3QCP A;  6GSU A;  4K2X A;  2HFD A;  3IK7 A;  2WW1 A;  5J4Y A;  5IMF A;  3I69 A;  4EKZ A;  2K8V A;  3UEM A;  3CWG A;  4EUY A;  1X9W B;  2H76 A;  1JLW A;  1GUL A;  4MF7 A;  4USS A;  3D22 A;  4OCF A;  4F0B A;  1T3B A;  3DXB A;  2LUS A;  1CQH A;  2V1M A;  1SK1 A;  2IN3 A;  4IQA A;  2XC2 A;  4X0X A;  1X5D A;  4N10 A;  1GSU A;  5LCZ A;  3UBL A;  3GSS A;  3L9S A;  1XOA A;  5DDL A;  4F03 A;  4PNF A;  2CAQ A;  3H1N A;  5B8A A;  1XWC A;  3U6V A;  2EC4 A;  1SK0 A;  3LG6 A;  2FA4 A;  4TR4 A;  5D73 A;  1ERV A;  4QMK A;  4BWQ A;  1M9B A;  2LV3 A;  2HRK B;  2GSS A;  1JZR A;  2HRA A;  3FZ9 A;  1SL1 B;  1K0M A;  1J9B A;  1ABA A;  4FO5 A;  5COH A;  5F07 A;  1Y1U A;  1GP1 A;  1GUH A;  3GL3 A;  3IAS 2;  3GH6 A;  1S3A A;  4PX1 A;  4XRD A;  2HSH A;  5F0G A;  3A2V A;  3I6A A;  3CXG A;  2EFH A;  1ZYQ B;  3IDV A;  4HU7 A;  5D96 A;  4ZL9 A;  1M2D A;  4GSS A;  1OC3 A;  3U5R E;  1YF1 A;  4H86 A;  2MYG A;  5D93 A;  3TKP A;  3J7Y b;  5ECH B;  1XIY A;  2YWO A;  2WFC A;  4L8E A;  2HSN B;  3HJP A;  2PWJ A;  2XBQ A;  5CNW A;  4AKG A;  1Y25 A;  1GTU A;  2YWM A;  2ON7 A;  5BMU B;  1TRU A;  1WIK A;  2O85 A;  3FR6 A;  2PN8 A;  4TR0 A;  2H0H A;  2WDU A;  4J2F A;  2F8A A;  2OJL A;  2H0G A;  3HCZ A;  2L4C A;  3C7M A;  4N30 A;  2G2Q A;  2KLX A;  3GST A;  4MLY A;  4ML6 A;  4V1A p;  5C00 A;  2C0E A;  4TXV A;  3A2W A;  2IWT A;  2H71 A;  4WEY A;  2L5O A;  2I81 A;  2QC7 A;  3MAK A;  4EIP A;  5ENU A;  1BED A;  5A4U A;  1EZK A;  5A4W A;  4HOJ A;  2HXK A;  4YQU A;  6GSX A;  2WW2 A;  1Z7P A;  2BMX A;  4GQF A;  1FW1 A;  1SL0 B;  2HRN A;  5ECQ B;  3KIJ A;  1YEP A;  2L57 A;  2E7P A;  3LGC A;  2OE3 A;  4WR5 A;  2H66 A;  4O5Q A;  4CDO A;  5KN0 A;  2HZE B;  3BBY A;  2O87 A;  2NPB A;  3HJM A;  1M3I A;  1A8Y A;  3MWH A;  5KOX A;  1TK0 B;  3GL5 A;  2VLV A;  2B1K A;  4E8H A;  2LRN A;  4V2M A;  3WGD A;  1TJD A;  3VWW A;  5AGY A;  2BTO T;  3H93 A;  1UC7 A;  1NSW A;  2IME A;  3UAR A;  4KSM A;  1YKA A;  3S9F A;  4Z7X A;  3F4T A;  3D5J A;  4WET A;  2H1D A;  1S4B P;  1FHE A;  3Q18 A;  5G5E A;  4QL9 A;  4LA1 A;  3UOM A;  5C04 A;  2MBT A;  3DIE A;  2ES7 A;  4XCS A;  4MJE A;  3A2X A;  3A5I A;  1M0U A;  2CVK A;  4KX4 A;  1HYU A;  3ME8 A;  3H4K A;  3D4T A;  3M8N A;  2X8C A;  3MYD A;  1QXH A;  3KMN A;  2YWI A;  3FR3 A;  4IVF A;  4WF5 A;  1SYR A;  1YEW C;  2WVX A;  4ZBB A;  5CYY A;  1JFU A;  1WRY A;  1ON4 A;  1S3D A;  3TKR A;  11GS A;  1U3I A;  5IOX A;  3WYW A;  3TKS A;  1TI1 A;  3CMI A;  3MIX A;  1R5P A;  4IBP A;  1OKT A;  4I2T A;  4L5O A;  3M9K A;  4KE3 A;  4PQI A;  1AQV A;  2YZH A;  2GSR A;  2FWE A;  4OD7 A;  2IMK A;  1SKS B;  1F37 A;  2R3X A;  2DMM A;  3DRN A;  3KH9 A;  4HUA A;  1ERW A;  5E59 A;  1CQG A;  1PD2 1;  4ZB7 A;  2MMZ A;  3EMX A;  2P5Q A;  5IMC A;  4YKG A;  3KEB A;  4YQM A;  1PN9 A;  3VWU A;  1SJI A;  4KUN A;  1BG1 A;  3N5O A;  2B3S A;  1EP8 A;  4KA0 A;  1VF4 A;  3VI5 A;  3DGQ A;  4WF4 A;  2O36 A;  3RPN A;  19GS A;  1S3R A;  5DCH A;  2V41 A;  2X8G A;  1FAA A;  1OYJ A;  4I8B A;  2E2G A;  3TGZ A;  3I43 A;  4MF6 A;  2DC5 A;  1TW9 A;  4ZBD A;  3P90 A;  4HJM A;  4BVY A;  2EIR A;  1AXD A;  1GSF A;  1W4V A;  4XTS A;  2JSY A;  2H6Z A;  1BX9 A;  1NHO A;  2B7K A;  3IHQ A;  2K8S A;  4MZC A;  5A1N B;  3GNJ A;  3QFA C;  4LLR A;  1ZYE A;  4MZW A;  3ZML A;  3ZRD A;  2HRF A;  4TRX A;  4ZB8 A;  2C1Y A;  3CTG A;  1QUW A;  1VF3 A;  2WVZ A;  3KCM A;  1NHY A;  2CAI A;  2M46 A;  3A5W A;  3GHA A;  4GTU A;  1V58 A;  2CT6 A;  1USB A;  2OT3 A;  3ZMK A;  1OC8 A;  2M72 A;  1GTI A;  1PX6 A;  3LSZ A;  5ELG A;  2C4J A;  1DE1 A;  4G0I A;  1PSQ A;  2PBJ A;  5IMA A;  1GSY A;  5EL8 A;  2H70 A;  2QKE A;  2VLU A;  22GS A;  1YZX A;  4K5R A;  2DJK A;  4D73 B;  1R5A A;  1SK2 A;  5G31 A;  3IOS A;  4GXZ A;  3VPT A;  2X64 A;  5HR2 A;  3CHX C;  3QR6 A;  4BPY A;  1S3C A;  3ZRE A;  4ECC A;  1EWX A;  4G19 A;  3NZN A;  2R37 A;  3HZ8 A;  1I1I P;  1WPI A;  2HSM B;  4OMV A;  3QD9 A;  4FH8 A;  3IBH A;  1VF1 A;  3LYP A;  4YAP A;  5HR3 A;  2AB6 A;  2FWF A;  3MNG A;  2JAD A;  3O3T A;  3BCK A;  4Q5N A;  3IE3 A;  1XOB A;  3GRX A;  4CW9 A;  1X9S B;  2IFQ A;  4OWY A;  3UAP A;  1OC9 A;  1LBK A;  1SJZ A;  5B6M A;  3PIN A;  1W89 A;  2H72 A;  5HFG A;  1ERU A;  3F6F A;  4EIQ A;  2AAW A;  4JED A;  3L78 A;  1M2A A;  3UJ1 A;  3UVT A;  3ME7 A;  1MDK A;  3LXT A;  3FR9 A;  5DJL A;  4IS0 A;  4N0V A;  1PKW A;  3VK9 A;  1U87 A;  1X5E A;  4HU9 A;  1J0F A;  1Q4J A;  1ACV A;  1XVW A;  2AV4 A;  2FWH A;  4G0L A;  1GSD A;  2GS3 A;  1UA5 A;  2LNS A;  2RM6 A;  3EMP A;  2JAC A;  3D0Z A;  4MZB A;  5IOW A;  4EE0 A;  2GGT A;  2OKA A;  3P2A A;  2L6C A;  1XWA A;  3TRX A;  5ECK B;  3PPU A;  1FVJ A;  4JR6 A;  3EUR A;  1GL8 A;  6GST A;  3N9J A;  4F0C A;  3EYT A;  3ZIT A;  2NVL A;  1TXU A;  1R7H A;  2KP2 A;  4IKH A;  5J47 A;  4EDY A;  1ZMA A;  1KNG A;  2KHP A;  3LJR A;  3CRT A;  3GA4 A;  4K8M A;  5J5N A;  1VF2 A;  2G0F A;  1WOU A;  3LWA A;  4POB A;  3QDN A;  2C80 A;  4GCI A;  3KMO A;  3LW9 A;  3IK9 A;  1F3B A;  20GS A;  4OFN A;  18GS A;  4TVE A;  3GX8 A;  4RI6 A;  1H75 A;  2FWG A;  3ZIV A;  1PN0 A;  2P5R A;  4XS4 B;  2C0F A;  5DAL B;  3VLN A;  3MSZ A;  2PGT A;  4WBR D;  4HEA 2;  2VL3 A;  2XHF A;  5DAK B;  5ECS A;  5EY6 A;  1AW9 A;  3OR5 A;  3LFL A;  4KF9 A;  5DJM A;  4GWR A;  2DKI A;  2RUF A;  2B6M A;  2PVO C;  4IN0 A;  2O5V A;  4NV5 A;  1FG4 A;  2C3T A;  5B7C A;  4F82 A;  5A34 B;  3QOU A;  2OA7 A;  2DML A;  5CP1 A;  1XBS A;  4DVC A;  4WR4 A;  2IMF A;  2DJ0 A;  2PVQ A;  3C71 A;  4KH7 A;  1MDJ A;  1NM3 A;  5JWO B;  1SVM A;  5H5Q A;  2EIQ A;  3EIN A;  3MDK A;  3F0I A;  2YP6 A;  3BJ5 A;  4O5R A;  1T8E B;  5J4V A;  7GSS A;  3KJY A;  2XPE A;  2HQT A;  1FB6 A;  10GS A;  2H8L A;  4ZB6 A;  2YNX A;  3L9V A;  3HD5 A;  1RK4 A;  3F4R A;  1U6T A;  2HSY A;  3RPP A;  1X5C A;  1RQM A;  2YV9 A;  4GDF A;  5ID2 A;  3M1G A;  2GQK A;  3VUR A;  2R0P A;  5ECN B;  1MTC A;  1M9A A;  1X0R A;  2C8U A;  3TRP A;  2DJ2 A;  2LTK A;  2MZC A;  4K7O A;  4PXO A;  5D9T A;  3D21 A;  3TKQ A;  1A2L A;  5HR0 A;  4XIH A;  1TU7 A;  1PL1 A;  2B5E A;  3IHG A;  3ED3 A;  1O85 A;  4IHU A;  2DJJ A;  3C8E A;  2E0Q A;  2CX4 A;  5A5K A;  2L59 A;  4TXO A;  5IMZ A;  2HZF A;  1AAZ A;  5BRT A;  4HQS A;  5F05 A;  3WT2 A;  1YF0 A;  2TRC P;  4ZXG A;  3H79 A;  4MCU A;  4KGI A;  1F2E A;  1O7U A;  5A5H A;  4MMM A;  2IMI A;  1H4O A;  3UBK A;  4DSS A;  5H5S A;  4CHS A;  1PMT A;  3APO A;  2YPM A;  4ZIL A;  1M7T A;  3TOU A;  3ZIJ A;  2L6D A;  1AUC A;  3Q19 A;  4BL7 B;  5CRW A;  1TK8 B;  2H1G A;  5AIV A;  1A24 A;  4NHZ A;  5GAN D;  4IQ1 A;  1YVL A;  2K9F A;  3CTF A;  1A0F A;  3DYR A;  1WMJ A;  3P7X A;  4TKY A;  2QGV A;  4JBB A;  2B7J A;  2ZNM A;  4OFM A;  3ERW A;  2WVY A;  2PMT A;  1TKD B;  2MMN A;  2GZP A;  2AYT A;  3EWL A;  4ZL8 A;  5DCG A;  1Z9H A;  2NTO A;  5A1N A;  1ST9 A;  4JE1 A;  3KD0 A;  3G7I A;  2N5F A;  4N3Z A;  2CVD A;  5JCG A;  1DSB A;  1QGV A;  5DQY A;  3BCI A;  1G7E A;  3KTL A;  2H30 A;  2F3M A;  2YV7 A;  2P0G A;  2H1B A;  5CAX A;  1YKC A;  1EEJ A;  2OAD A;  3IAM 2;  3M3M A;  2K18 A;  3HXS A;  3D6I A;  2HE3 A;  4GF0 A;  1B4P A;  3RBT A;  5HFI A;  1EOH A;  4QL7 A;  4EO3 A;  4GRF A;  1GNE A;  3HHV A;  1WJK A;  2NBS A;  3KP9 A;  4KND A;  4POK A;  5J9C A;  3K8N A;  4IP1 A;  5FWG A;  4D73 A;  1SKW B;  5G1L A;  2VO4 A;  5DQS A;  4E68 A;  4V2L A;  4BWS A;  1DUG A;  1PA3 A;  1V98 A;  2FCH A;  1ZZY A;  3ZVJ D;  1B4Q A;  4PHZ C;  3VI7 A;  3SBC A;  1HNC A;  2V32 A;  4J56 E;  2LJK A;  3APS A;  2HSM A;  2YJH A;  4POL A;  5IO2 A;  1XZO A;  2P31 A;  1HNB A;  2GQL A;  3KM6 A;  4G2E A;  4MPG A;  4WXT A;  4FIW A;  1SL2 B;  3TKS C;  4MK3 A;  4E8E A;  4A5P A;  2BJX A;  17GS A;  1V57 A;  2QA1 A;  1C72 A;  2D2Z A;  4X4J A;  5CRG A;  3WGE A;  2E2M A;  9GSS A;  2YZU A;  1BQ7 A;  5GST A;  1DE2 A;  5ABR A;  5E4W A;  1TRV A;  5CRH A;  2VL2 A;  1M2B A;  1MDI A;  3E0U A;  2GSQ A;  4KAE A;  1TK5 B;  3QPM A;  1GLQ A;  4EF0 A;  4ULX A;  5IMV A;  1B9X C;  4NPB A;  1GUK A;  4GSN A;  1SD9 A;  1UVZ A;  2DLX A;  1V9W A;  4MJC A;  1T4Y A;  2JSZ A;  1OVN A;  4O32 A;  4AGS A;  2YAN A;  4EDZ A;  2O7K A;  2R6K A;  4PNG A;  1K0B A;  4V1A g;  5HR1 A;  1SVL A;  3KGK A;  1Z6M A;  1EGO A;  6GSW A;  1WWJ A;  5JCW A;  3KP8 A;  4QQ7 A;  3FYG A;  8GSS A;  3HVS A;  2VKZ G;  2YOI A;  1YJ6 A;  1ZYN A;  1K3Y A;  1PQN A;  2B5X A;  3GTU A;  1OKD A;  2VM2 A;  4AI6 A;  3DVW A;  5J40 A;  4MH2 A;  3APQ A;  2GT6 A;  3CSJ A;  2YN1 A;  1QK8 A;  3DML A;  3ISO A;  5AIX A;  3PR8 A;  4JZQ A;  5EVO A;  1JZO A;  3TJJ A;  3G9B A;  3BOA A;  1YEX A;  2EIO A;  4W66 A;  4F2I A;  2OE0 A;  3QAV A;  2JZR A;  3W8J A;  5IQY A;  1OE7 A;  3PH9 A;  2O3E A;  5KOW A;  2HLS A;  1HD2 A;  4IJ3 A;  4MNN A;  3FEU A;  4IGJ A;  4O5U A;  2V2G A;  1IYI A;  3FZ5 A;  3L9U A;  3E3E A;  3IR4 A;  1GSE A;  2TIR A;  3IXR A;  1AIU A;  1FVK A;  2GLR A;  5DAL A;  4K5S A;  4KB3 A;  3CRU A;  1Z6N A;  3IPZ A;  4IP6 A;  3LOR A;  5D8I A;  3O76 A;  4G0K A;  2KOK A;  3GIX A;  5G1K A;  2HI7 A;  1FOV A;  4YQV A;  2WUL A;  1VGL A;  1K0C A;  4K9Z A;  3H8Q A;  2GVP A;  1O8W A;  3FMW A;  1TI3 A;  2JU5 A;  3TCO A;  4HZ2 A;  4PI0 C;  1N8J A;  4KDY A;  4FXY P;  1Z7R A;  1EP7 A;  2KUC A;  5G5F A;  2I9H A;  1FB0 A;  2FLS A;  4Z2U A;  2F8F A;  2CQ9 A;  1PGT A;  2F51 A;  1X9M B;  1M99 A;  2C3Q A;  2YWN A;  4EVM A;  3GKX A;  4XS1 A;  1EEM A;  4HQZ A;  4KCA A;  3VFI A;  1XXU A;  4DSR A;  2H1L A;  1XCC A;  3RDW A;  1ZOF A;  4ILF A;  2C0D A;  2VUP A;  2GDR A;  2DSA A;  4GQC A;  4ZL7 A;  2H01 A;  3EU4 A;  3V1W A;  5FT3 A;  2HRK A;  2IPA A;  3EC3 A;  3DKS A;  2VCX A;  4BVY B;  4MDC A;  1BAY A;  2H0I A;  1I5G A;  4LL4 B;  2DIY A;  2XPD A;  1LU4 A;  3GKK A;  1N2A A;  1PFO A;  1LJR A;  2R2J A;  4OCE A;  4JRR A;  3HY2 A;  4RQX A;  5IM9 A;  1E6B A;  4KDU A;  2HT9 A;  3E9J B;  2FUG 2;  2H1A A;  3LXZ A;  4ZIJ A;  5J4U A;  3KTB A;  3D4M A;  4RQR A;  3BD2 A;  1SKR B;  2F9S A;  5IIZ A;  3CBU A;  1GTA A;  1B8X A;  1MEK A;  1TU8 A;  2UZ8 A;  2DJ1 A;  3ERG A;  2HSN A;  3FK8 A;  1ZL9 A;  4TR1 B;  1XPV A;  2X4A A;  2OAC A;  3RAZ A;  3LYK A;  5BMU A;  1PRX A;  5KEJ A;  2L5L A;  4HS1 A;  3W6G A;  4LL1 B;  3ZVJ A;  2VOC A;  1PX7 A;  2A2R A;  2N5A A;  2VL9 A;  3ZYW A;  2EFE A;  2FD3 A;  4EXJ A;  2A2S A;  4N11 A;  1GNW A;  5ELA A;  4KDX A;  3VPQ A;  5B6N A;  2R5G A;  3EU3 A;  2MBS A;  4FYB A;  4MP4 A;  3F63 A;  3TOT A;  2PU9 C;  5F8B A;  3KZQ A;  2I3Y A;  1QFN A;  4HSC X;  4GLT A;  1HNA A;  2IFQ B;  4KW6 A;  1BG5 A;  1OC9 B;  2HZE A;  2H6Y A;  4AJ6 A;  3DVX A;  5DBQ A;  2V6K A;  4F9Z A;  4O7H A;  3DD3 A;  1AQW A;  2CZ3 A;  4TR3 A;  3JCM L;  4MF5 A;  3PGT A;  1ZCP A;  4ECI A;  2VCQ A;  2QA2 A;  5A4V A;  3Q6O A;  2R4V A;  2I4A A;  2GZY A;  2WCI A;  5GAP D;  2LKU A;  5CO3 A;  5G2Z A;  4ACS A;  2ALB A;  4PGT A;  2B5Y A;  2GQM A;  1SEN A;  4MJB A;  3O6T A;  2PPT A;  1SD8 A;  4FQU A;  4G10 A;  4BIK A;  2PER A;  2FHE A;  2MMA A;  1YY7 A;  2CA8 A;  3ZFB A;  5IMD A;  2VLT A;  2PUK C;  2IMD A;  3CSI A;  4LMW A;  2CVB A;  3HDC A;  4L5L A;  1ML6 A;  2CX3 A;  3W8S A;  1TTZ A;  4MAB A;  2VD1 A;  1JHB A;  2CZ2 A;  2ON5 A;  2CV4 A;  3FZ4 A;  2VD0 A;  1K0D A;  1F6M C;  4O92 A;  1XW5 A;  3TB2 A;  2WZ9 A;  6GSS A;  1Q98 A;  2DBC A;  2GZZ A;  1SJ6 A;  5G30 A;  3F3Q A;  2QSI A;  3ZFL A;  2VCW A;  4PQH A;  3IA1 A;  4PUR A;  4FYC A;  3LEF A;  3WGX A;  1O73 A;  2GT5 A;  2C3N A;  1K3O A;  4Q5R A;  1SU9 A;  2AJQ B;  3A3T A;  3I9V 2;  5CRD A;  1R4W A;  5IO0 A;  2LNT A;  3DWV A;  4L0U A;  5H5R A;  2K6V A;  4MA9 A;  3ERF A;  4RUV A;  2J23 A;  3HZ4 A;  5GSS A;  1K0N A;  1WP0 A;  1URM A;  5LD0 A;  3HVV A;  3J7Y k;  1MD4 A;  1F3A A;  1YQ1 A;  4EL1 A;  2LQQ A;  2Z9S A;  4ZB9 A;  4BVX B;  5AN1 A;  3NIV A;  2LRC A;  1JZW A;  2M80 A;  3ZZX A;  2EFC A;  3GKN A;  1B48 A;  1FOH A;  2ZCT A;  2HNL A;  2C0G A;  1EOG A;  4IJI A;  3UVH A;  1XWG A;  2AUV A;  3WD6 A;  2A4V A;  4DSQ A;  3IV4 A;  4I2U A;  2RLI A;  3TRQ A;  3P8W A;  3EVI A;  1KEB A;  4Z2R A;  3LQ7 A;  1O6J A;  4PQ1 A;  1T1V A;  1A2M A;  4PTS A;  2HYX A;  3TJF A;  1N25 A;  3UIW A;  4OFT A;  4EC0 A;  2JL4 A;  2L4Q A;  4IW9 A;  4KSO A;  2VCV A;  1V2A A;  4KCE A;  1A23 A;  3FRC A;  1G0T A;  1GUM A;  2X8H A;  1QQ2 A;  4K7I A;  4X43 A;  5IPG A;  1TRW A;  6GSV A;  3Q74 A;  3HJO A;  2IL3 A;  3RGB C;  2IIY A;  4RI7 A;  1PL2 A;  4XRA A;  3F8U A;  2H75 A;  3C73 A;  4ECJ A;  3GYK A;  4X1U A;  4XHM A;  3RHB A;  1DBY A;  16GS A;  4ID0 A;  4NXI A;  1EV4 A;  1KBN A;  1ERT A;  3GFK A;  4DEJ A;  5ECI B;  1OE8 A;  2OBK A;  5ID2 B;  1T4Z A;  2RM5 A;  3VWV A;  2FY6 A;  4AKX B;  4IEL A;  3VWX A;  1T00 A;  2VCT A;  3US3 A;  4YAV A;  3GKM A;  3F3R A;  2H74 A;  3ZL5 A;  4AF2 A;  2LQO A;  2ZUP A;  2A2P A;  1IYH A;  3TDG A;  2WB9 A;  4NWY A;  5INY A;  1QMV A;  1AC1 A;  5FHI A;  2WRT A;  1K3L A;  2JZT A;  4TXO B;  2WZS A;  3L0H A;  1XW9 A;  1I9D A;  1EGR A;  3FW2 A;  5ECP B;  1TXX A;  4PUF C;  12GS A; 
#chains in the Genus database with same CATH homology
 2LJR A;  2YCD A;  1J08 A;  5EPF A;  1GWC A;  5A5H B;  2JZS A;  1T7P B;  1ILO A;  5J3R A;  4ML1 A;  4DSS B;  2VAF A;  3F4S A;  2AHE A;  2J9H A;  2DKH A;  4HDE A;  5D9W A;  14GS A;  3EE2 A;  1KTE A;  4P3Y B;  2I1U A;  2LEG A;  2X99 A;  4OO5 A;  4K2D A;  1A2J A;  1THX A;  4ZBA A;  4K6X A;  2VL2 C;  5D9V A;  5ECO B;  1RW1 A;  3DEX A;  3UL3 A;  2V6O A;  1SVO A;  3TUE A;  1U88 A;  1K0A A;  1O81 A;  4MJA A;  3ZTL A;  5ECR B;  3TU3 B;  4HJ2 A;  3G7Y A;  4L0W A;  2VIM A;  1WE0 A;  3GUR A;  1JZD A;  4K7N A;  4AJ7 A;  4N0Z A;  2TRX A;  2GTU A;  2XBI A;  4MPF A;  3SWL A;  1AQX A;  1XFL A;  5JWQ B;  1XWK A;  2IJY A;  5ECM B;  5F06 A;  3TJK A;  1TRS A;  1XVQ A;  2A4H A;  1MD3 A;  1GSQ A;  4YH2 A;  2OBI A;  3NOF A;  1FO5 A;  3F6D A;  1UN2 A;  3TJG A;  2VCZ A;  2LRT A;  4NHW A;  1F9M A;  4V2N A;  1THO A;  2LS5 A;  2RUE A;  1Y6E A;  1GTB A;  2RII A;  2DIZ A;  1G6W A;  3HKR A;  1A0R P;  5KN2 A;  2OE1 A;  4HI7 A;  3QMX A;  3F9U A;  3HMJ G;  1BYE A;  4HZ4 A;  4Z2T A;  5D9X A;  4AJ8 A;  2REM A;  1A8L A;  3KXO A;  4TR1 A;  3CYN A;  5B8B A;  5JWR B;  1NW2 A;  1U3A A;  5CRE A;  3HVX A;  5KN3 A;  4XS4 A;  1OAZ A;  4BA7 A;  4I97 A;  4WKW A;  4ICY A;  3HYP A;  1TOF A;  3TKS E;  1EV9 A;  2FNO A;  4K0G A;  3IC4 A;  4I5Q A;  5HQP A;  5DAK A;  5J41 A;  3IRA A;  3HA9 A;  2WGR A;  2O89 A;  2YJ7 A;  3G7J A;  1VRS D;  4ISD A;  4ECB A;  4GST A;  4AKI A;  1YDK A;  4TN8 A;  3L4N A;  3GMF A;  3AY8 A;  1E2Y A;  3EPT A;  3GX0 A;  4JU5 A;  4NMU A;  5A34 A;  3QAW A;  4Q5Q A;  5LNK e;  3C1R A;  5JCU A;  4LMV A;  3M0F A;  1XWB A;  3R3E A;  2NDO A;  4OO4 A;  3R2Q A;  2VM1 A;  3QFB C;  2H6X A;  4TOP A;  2LST A;  3GV1 A;  3FZA A;  3ZLP A;  4TW5 A;  4K1F A;  2EFD A;  2UV8 G;  3FHK A;  1BF5 A;  4CY8 A;  1ZYP A;  1R26 A;  4POM A;  1GRX A;  2WJU A;  3GUS A;  2R0G A;  3GN3 A;  1SYX A;  4PUA A;  4WBJ A;  3UMA A;  1HQO A;  4G01 A;  2LJA A;  2GST A;  3GTU B;  2H73 A;  4NAX A;  1JLV A;  4AKH A;  4G9H A;  2KP1 A;  3RHC A;  3GH9 A;  2FA8 A;  2R0C A;  5ECL B;  5AIS A;  2WS2 A;  1Z5Y E;  4K0N A;  1BJX A;  4CY6 A;  3M9J A;  4I6X A;  2O8V B;  3C1S A;  13GS A;  5GZZ B;  5IPH A;  2H19 A;  2DJ3 A;  1PKZ A;  4XS6 A;  3FY7 A;  5L71 A;  3FKF A;  1ZGN A;  1GLP A;  4YKF A;  3QAG A;  4Q5F A;  1O8X A;  5J9B A;  2MMO A;  1TP9 A;  1G7O A;  5KN1 A;  1GSS A;  4FYU A;  1G6Y A;  3WT1 A;  1B9Y C;  2X49 A;  2FGX A;  2B1L A;  1V40 A;  5HFK A;  3TJB A;  6GSY A;  4J57 E;  4BL7 A;  5DVB A;  4NV2 A;  2N5B A;  1GH2 A;  3KH7 A;  1Z3E A;  4MH3 A;  1XW6 A;  1K0O A;  3IC8 A;  1TDI A;  4JR4 A;  3CSH A;  4BVX A;  3QCP A;  6GSU A;  4K2X A;  2HFD A;  3IK7 A;  5J4Y A;  5IMF A;  3I69 A;  4EKZ A;  2K8V A;  3UEM A;  3CWG A;  4EUY A;  1X9W B;  2H76 A;  1JLW A;  1GUL A;  4MF7 A;  4USS A;  3D22 A;  4OCF A;  4F0B A;  1T3B A;  3DXB A;  2LUS A;  1CQH A;  2V1M A;  1SK1 A;  2IN3 A;  4IQA A;  2XC2 A;  4X0X A;  1X5D A;  4N10 A;  1GSU A;  5LCZ A;  3UBL A;  3GSS A;  3L9S A;  1XOA A;  5DDL A;  4F03 A;  4PNF A;  2CAQ A;  3H1N A;  5B8A A;  1XWC A;  3U6V A;  2EC4 A;  1SK0 A;  3LG6 A;  2FA4 A;  4TR4 A;  5D73 A;  1ERV A;  4QMK A;  4BWQ A;  1M9B A;  2LV3 A;  2HRK B;  2GSS A;  1JZR A;  2HRA A;  3FZ9 A;  1SL1 B;  1K0M A;  1J9B A;  1ABA A;  4FO5 A;  5COH A;  5F07 A;  1Y1U A;  1GP1 A;  1GUH A;  3GL3 A;  3IAS 2;  3GH6 A;  1S3A A;  4PX1 A;  4XRD A;  2HSH A;  5F0G A;  3A2V A;  3I6A A;  3CXG A;  2EFH A;  1ZYQ B;  3IDV A;  4HU7 A;  5D96 A;  4ZL9 A;  1M2D A;  4GSS A;  1OC3 A;  3U5R E;  1YF1 A;  4H86 A;  2MYG A;  5D93 A;  3TKP A;  3J7Y b;  5ECH B;  1XIY A;  2YWO A;  2WFC A;  4L8E A;  2HSN B;  3HJP A;  2PWJ A;  2XBQ A;  5CNW A;  4AKG A;  1Y25 A;  1GTU A;  2YWM A;  2ON7 A;  5BMU B;  1TRU A;  1WIK A;  2O85 A;  3FR6 A;  2PN8 A;  4TR0 A;  2H0H A;  2WDU A;  4J2F A;  2F8A A;  2OJL A;  2H0G A;  3HCZ A;  2L4C A;  3C7M A;  4N30 A;  2G2Q A;  2KLX A;  3GST A;  4MLY A;  4ML6 A;  4V1A p;  5C00 A;  2C0E A;  4TXV A;  3A2W A;  2IWT A;  2H71 A;  4WEY A;  2L5O A;  2I81 A;  2QC7 A;  3MAK A;  4EIP A;  5ENU A;  1BED A;  5A4U A;  1EZK A;  5A4W A;  4HOJ A;  2HXK A;  4YQU A;  6GSX A;  1Z7P A;  2BMX A;  4GQF A;  1FW1 A;  1SL0 B;  2HRN A;  5ECQ B;  3KIJ A;  1YEP A;  2L57 A;  2E7P A;  3LGC A;  2OE3 A;  4WR5 A;  2H66 A;  4O5Q A;  4CDO A;  5KN0 A;  2HZE B;  3BBY A;  2O87 A;  2NPB A;  3HJM A;  1A8Y A;  3MWH A;  5KOX A;  1TK0 B;  3GL5 A;  2VLV A;  2B1K A;  4E8H A;  2LRN A;  4V2M A;  3WGD A;  1TJD A;  3VWW A;  5AGY A;  2BTO T;  3H93 A;  1UC7 A;  1NSW A;  2IME A;  3UAR A;  4KSM A;  1YKA A;  3S9F A;  4Z7X A;  3F4T A;  3D5J A;  4WET A;  2H1D A;  1FHE A;  3Q18 A;  5G5E A;  4QL9 A;  4LA1 A;  3UOM A;  5C04 A;  2MBT A;  3DIE A;  2ES7 A;  4XCS A;  4MJE A;  3A2X A;  3A5I A;  1M0U A;  2CVK A;  4KX4 A;  1HYU A;  3ME8 A;  3H4K A;  3D4T A;  3M8N A;  2X8C A;  3MYD A;  1QXH A;  3KMN A;  2YWI A;  3FR3 A;  4IVF A;  4WF5 A;  1SYR A;  4ZBB A;  5CYY A;  1JFU A;  1WRY A;  1ON4 A;  1S3D A;  3TKR A;  11GS A;  1U3I A;  5IOX A;  3WYW A;  3TKS A;  1TI1 A;  3CMI A;  3MIX A;  1R5P A;  4IBP A;  1OKT A;  4I2T A;  4L5O A;  3M9K A;  4KE3 A;  4PQI A;  1AQV A;  2YZH A;  2GSR A;  2FWE A;  4OD7 A;  2IMK A;  1SKS B;  1F37 A;  2R3X A;  2DMM A;  3DRN A;  3KH9 A;  4HUA A;  1ERW A;  5E59 A;  1CQG A;  1PD2 1;  4ZB7 A;  2MMZ A;  3EMX A;  2P5Q A;  5IMC A;  4YKG A;  3KEB A;  4YQM A;  1PN9 A;  3VWU A;  1SJI A;  4KUN A;  1BG1 A;  3N5O A;  2B3S A;  1EP8 A;  4KA0 A;  1VF4 A;  3VI5 A;  3DGQ A;  4WF4 A;  3RPN A;  19GS A;  5DCH A;  2V41 A;  2X8G A;  1FAA A;  1OYJ A;  4I8B A;  2E2G A;  3TGZ A;  3I43 A;  4MF6 A;  2DC5 A;  1TW9 A;  4ZBD A;  3P90 A;  4HJM A;  4BVY A;  2EIR A;  1AXD A;  1GSF A;  1W4V A;  4XTS A;  2JSY A;  2H6Z A;  1BX9 A;  1NHO A;  2B7K A;  3IHQ A;  2K8S A;  4MZC A;  5A1N B;  3GNJ A;  3QFA C;  4LLR A;  1ZYE A;  4MZW A;  3ZML A;  3ZRD A;  2HRF A;  4TRX A;  4ZB8 A;  2C1Y A;  3CTG A;  1QUW A;  1VF3 A;  3KCM A;  1NHY A;  2CAI A;  2M46 A;  3A5W A;  3GHA A;  4GTU A;  1V58 A;  2CT6 A;  1USB A;  2OT3 A;  3ZMK A;  1OC8 A;  2M72 A;  1GTI A;  1PX6 A;  3LSZ A;  5ELG A;  2C4J A;  1DE1 A;  4G0I A;  1PSQ A;  2PBJ A;  5IMA A;  1GSY A;  5EL8 A;  2H70 A;  2QKE A;  2VLU A;  22GS A;  1YZX A;  4K5R A;  2DJK A;  4D73 B;  1R5A A;  1SK2 A;  5G31 A;  3IOS A;  4GXZ A;  3VPT A;  2X64 A;  5HR2 A;  3QR6 A;  4BPY A;  1S3C A;  3ZRE A;  4ECC A;  1EWX A;  4G19 A;  3NZN A;  2R37 A;  3HZ8 A;  1WPI A;  2HSM B;  4OMV A;  3QD9 A;  4FH8 A;  3IBH A;  1VF1 A;  3LYP A;  4YAP A;  5HR3 A;  2AB6 A;  2FWF A;  3MNG A;  2JAD A;  3O3T A;  3BCK A;  4Q5N A;  3IE3 A;  1XOB A;  3GRX A;  4CW9 A;  1X9S B;  2IFQ A;  4OWY A;  3UAP A;  1OC9 A;  1LBK A;  1SJZ A;  5B6M A;  3PIN A;  1W89 A;  2H72 A;  5HFG A;  1ERU A;  3F6F A;  4EIQ A;  2AAW A;  4JED A;  3L78 A;  1M2A A;  3UJ1 A;  3UVT A;  3ME7 A;  1MDK A;  3LXT A;  3FR9 A;  5DJL A;  4IS0 A;  4N0V A;  1PKW A;  3VK9 A;  1U87 A;  1X5E A;  4HU9 A;  1J0F A;  1Q4J A;  1ACV A;  1XVW A;  2AV4 A;  2FWH A;  4G0L A;  1GSD A;  2GS3 A;  1UA5 A;  2LNS A;  2RM6 A;  3EMP A;  2JAC A;  3D0Z A;  4MZB A;  5IOW A;  4EE0 A;  2GGT A;  2OKA A;  3P2A A;  2L6C A;  1XWA A;  3TRX A;  5ECK B;  3PPU A;  1FVJ A;  4JR6 A;  3EUR A;  1GL8 A;  6GST A;  3N9J A;  4F0C A;  3EYT A;  3ZIT A;  2NVL A;  1TXU A;  1R7H A;  2KP2 A;  4IKH A;  5J47 A;  4EDY A;  1ZMA A;  1KNG A;  2KHP A;  3LJR A;  3CRT A;  3GA4 A;  4K8M A;  5J5N A;  1VF2 A;  2G0F A;  1WOU A;  3LWA A;  4POB A;  3QDN A;  2C80 A;  4GCI A;  3KMO A;  3LW9 A;  3IK9 A;  1F3B A;  20GS A;  4OFN A;  18GS A;  4TVE A;  3GX8 A;  4RI6 A;  1H75 A;  2FWG A;  3ZIV A;  1PN0 A;  2P5R A;  4XS4 B;  2C0F A;  5DAL B;  3VLN A;  3MSZ A;  2PGT A;  4WBR D;  4HEA 2;  2VL3 A;  2XHF A;  5DAK B;  5ECS A;  5EY6 A;  1AW9 A;  3OR5 A;  3LFL A;  4KF9 A;  5DJM A;  4GWR A;  2DKI A;  2RUF A;  2B6M A;  2PVO C;  4IN0 A;  2O5V A;  4NV5 A;  1FG4 A;  2C3T A;  5B7C A;  4F82 A;  5A34 B;  3QOU A;  2OA7 A;  2DML A;  5CP1 A;  1XBS A;  4DVC A;  4WR4 A;  2IMF A;  2DJ0 A;  2PVQ A;  3C71 A;  4KH7 A;  1MDJ A;  1NM3 A;  5JWO B;  1SVM A;  5H5Q A;  2EIQ A;  3EIN A;  3MDK A;  3F0I A;  2YP6 A;  3BJ5 A;  4O5R A;  1T8E B;  5J4V A;  7GSS A;  3KJY A;  2XPE A;  2HQT A;  1FB6 A;  10GS A;  2H8L A;  4ZB6 A;  2YNX A;  3L9V A;  3HD5 A;  1RK4 A;  3F4R A;  1U6T A;  2HSY A;  3RPP A;  1X5C A;  1RQM A;  2YV9 A;  4GDF A;  5ID2 A;  3M1G A;  2GQK A;  3VUR A;  2R0P A;  5ECN B;  1MTC A;  1M9A A;  1X0R A;  2C8U A;  3TRP A;  2DJ2 A;  2LTK A;  2MZC A;  4K7O A;  4PXO A;  5D9T A;  3D21 A;  3TKQ A;  1A2L A;  5HR0 A;  4XIH A;  1TU7 A;  1PL1 A;  2B5E A;  3IHG A;  3ED3 A;  1O85 A;  4IHU A;  2DJJ A;  3C8E A;  2E0Q A;  2CX4 A;  5A5K A;  2L59 A;  4TXO A;  5IMZ A;  2HZF A;  1AAZ A;  5BRT A;  4HQS A;  5F05 A;  3WT2 A;  1YF0 A;  2TRC P;  4ZXG A;  3H79 A;  4MCU A;  4KGI A;  1F2E A;  1O7U A;  5A5H A;  4MMM A;  2IMI A;  1H4O A;  3UBK A;  4DSS A;  5H5S A;  4CHS A;  1PMT A;  3APO A;  2YPM A;  4ZIL A;  1M7T A;  3TOU A;  3ZIJ A;  2L6D A;  1AUC A;  3Q19 A;  4BL7 B;  5CRW A;  1TK8 B;  2H1G A;  5AIV A;  1A24 A;  4NHZ A;  5GAN D;  4IQ1 A;  1YVL A;  2K9F A;  3CTF A;  1A0F A;  3DYR A;  1WMJ A;  3P7X A;  4TKY A;  2QGV A;  4JBB A;  2B7J A;  2ZNM A;  4OFM A;  3ERW A;  2PMT A;  1TKD B;  2MMN A;  2GZP A;  2AYT A;  3EWL A;  4ZL8 A;  5DCG A;  1Z9H A;  2NTO A;  5A1N A;  1ST9 A;  4JE1 A;  3KD0 A;  3G7I A;  2N5F A;  4N3Z A;  2CVD A;  5JCG A;  1DSB A;  1QGV A;  5DQY A;  3BCI A;  1G7E A;  3KTL A;  2H30 A;  2F3M A;  2YV7 A;  2P0G A;  2H1B A;  5CAX A;  1YKC A;  1EEJ A;  2OAD A;  3IAM 2;  3M3M A;  2K18 A;  3HXS A;  3D6I A;  2HE3 A;  4GF0 A;  1B4P A;  3RBT A;  5HFI A;  1EOH A;  4QL7 A;  4EO3 A;  4GRF A;  1GNE A;  3HHV A;  1WJK A;  2NBS A;  3KP9 A;  4KND A;  4POK A;  5J9C A;  3K8N A;  4IP1 A;  5FWG A;  4D73 A;  1SKW B;  5G1L A;  2VO4 A;  5DQS A;  4E68 A;  4V2L A;  4BWS A;  1DUG A;  1PA3 A;  1V98 A;  2FCH A;  1ZZY A;  3ZVJ D;  1B4Q A;  3VI7 A;  3SBC A;  1HNC A;  2V32 A;  4J56 E;  2LJK A;  3APS A;  2HSM A;  2YJH A;  4POL A;  5IO2 A;  1XZO A;  2P31 A;  1HNB A;  2GQL A;  3KM6 A;  4G2E A;  4MPG A;  4WXT A;  4FIW A;  1SL2 B;  3TKS C;  4MK3 A;  4E8E A;  4A5P A;  2BJX A;  17GS A;  1V57 A;  2QA1 A;  1C72 A;  2D2Z A;  4X4J A;  5CRG A;  3WGE A;  2E2M A;  9GSS A;  2YZU A;  1BQ7 A;  5GST A;  1DE2 A;  5ABR A;  5E4W A;  1TRV A;  5CRH A;  2VL2 A;  1M2B A;  1MDI A;  3E0U A;  2GSQ A;  4KAE A;  1TK5 B;  3QPM A;  1GLQ A;  4EF0 A;  4ULX A;  5IMV A;  1B9X C;  4NPB A;  1GUK A;  4GSN A;  1SD9 A;  1UVZ A;  2DLX A;  1V9W A;  4MJC A;  1T4Y A;  2JSZ A;  1OVN A;  4O32 A;  4AGS A;  2YAN A;  4EDZ A;  2O7K A;  2R6K A;  4PNG A;  1K0B A;  4V1A g;  5HR1 A;  1SVL A;  3KGK A;  1Z6M A;  1EGO A;  6GSW A;  3KP8 A;  5JCW A;  1WWJ A;  4QQ7 A;  3FYG A;  8GSS A;  3HVS A;  2VKZ G;  2YOI A;  1YJ6 A;  1ZYN A;  1K3Y A;  1PQN A;  2B5X A;  3GTU A;  1OKD A;  2VM2 A;  4AI6 A;  3DVW A;  5J40 A;  4MH2 A;  3APQ A;  2GT6 A;  3CSJ A;  2YN1 A;  1QK8 A;  3DML A;  3ISO A;  5AIX A;  3PR8 A;  4JZQ A;  5EVO A;  1JZO A;  3TJJ A;  3G9B A;  3BOA A;  1YEX A;  2EIO A;  4W66 A;  4F2I A;  2OE0 A;  3QAV A;  2JZR A;  3W8J A;  5IQY A;  1OE7 A;  3PH9 A;  5KOW A;  2HLS A;  1HD2 A;  4IJ3 A;  4MNN A;  3FEU A;  4IGJ A;  4O5U A;  2V2G A;  1IYI A;  3FZ5 A;  3L9U A;  3E3E A;  3IR4 A;  1GSE A;  2TIR A;  3IXR A;  1AIU A;  1FVK A;  2GLR A;  5DAL A;  4K5S A;  4KB3 A;  3CRU A;  1Z6N A;  3IPZ A;  4IP6 A;  3LOR A;  5D8I A;  3O76 A;  4G0K A;  2KOK A;  3GIX A;  5G1K A;  2HI7 A;  1FOV A;  4YQV A;  2WUL A;  1VGL A;  1K0C A;  4K9Z A;  3H8Q A;  2GVP A;  1O8W A;  3FMW A;  1TI3 A;  2JU5 A;  3TCO A;  4HZ2 A;  1N8J A;  4KDY A;  1Z7R A;  1EP7 A;  2KUC A;  5G5F A;  2I9H A;  1FB0 A;  2FLS A;  4Z2U A;  2F8F A;  2CQ9 A;  1PGT A;  2F51 A;  1X9M B;  1M99 A;  2C3Q A;  2YWN A;  4EVM A;  3GKX A;  4XS1 A;  1EEM A;  4HQZ A;  4KCA A;  3VFI A;  1XXU A;  4DSR A;  2H1L A;  1XCC A;  3RDW A;  1ZOF A;  4ILF A;  2C0D A;  2VUP A;  2GDR A;  2DSA A;  4GQC A;  4ZL7 A;  2H01 A;  3EU4 A;  3V1W A;  5FT3 A;  2HRK A;  2IPA A;  3EC3 A;  3DKS A;  2VCX A;  4BVY B;  4MDC A;  1BAY A;  2H0I A;  1I5G A;  4LL4 B;  2DIY A;  2XPD A;  1LU4 A;  3GKK A;  1N2A A;  1LJR A;  2R2J A;  4OCE A;  4JRR A;  3HY2 A;  4RQX A;  5IM9 A;  1E6B A;  4KDU A;  2HT9 A;  3E9J B;  2FUG 2;  2H1A A;  3LXZ A;  4ZIJ A;  5J4U A;  3KTB A;  3D4M A;  4RQR A;  3BD2 A;  1SKR B;  2F9S A;  5IIZ A;  3CBU A;  1GTA A;  1B8X A;  1MEK A;  1TU8 A;  2UZ8 A;  2DJ1 A;  3ERG A;  2HSN A;  3FK8 A;  1ZL9 A;  4TR1 B;  1XPV A;  2X4A A;  2OAC A;  3RAZ A;  3LYK A;  5BMU A;  1PRX A;  5KEJ A;  2L5L A;  4HS1 A;  3W6G A;  4LL1 B;  3ZVJ A;  2VOC A;  1PX7 A;  2A2R A;  2N5A A;  2VL9 A;  3ZYW A;  2EFE A;  2FD3 A;  4EXJ A;  2A2S A;  4N11 A;  1GNW A;  5ELA A;  4KDX A;  3VPQ A;  5B6N A;  2R5G A;  3EU3 A;  2MBS A;  4FYB A;  4MP4 A;  3F63 A;  3TOT A;  2PU9 C;  5F8B A;  3KZQ A;  2I3Y A;  1QFN A;  4GLT A;  1HNA A;  2IFQ B;  4KW6 A;  1BG5 A;  1OC9 B;  2HZE A;  2H6Y A;  4AJ6 A;  3DVX A;  5DBQ A;  2V6K A;  4F9Z A;  4O7H A;  3DD3 A;  1AQW A;  2CZ3 A;  4TR3 A;  3JCM L;  4MF5 A;  3PGT A;  1ZCP A;  4ECI A;  2VCQ A;  2QA2 A;  5A4V A;  3Q6O A;  2R4V A;  2I4A A;  2GZY A;  2WCI A;  5GAP D;  2LKU A;  5CO3 A;  5G2Z A;  4ACS A;  2ALB A;  4PGT A;  2B5Y A;  2GQM A;  1SEN A;  4MJB A;  3O6T A;  2PPT A;  1SD8 A;  4FQU A;  4G10 A;  2PER A;  2FHE A;  2MMA A;  1YY7 A;  2CA8 A;  3ZFB A;  5IMD A;  2VLT A;  2PUK C;  2IMD A;  3CSI A;  4LMW A;  2CVB A;  3HDC A;  4L5L A;  1ML6 A;  2CX3 A;  3W8S A;  1TTZ A;  4MAB A;  2VD1 A;  1JHB A;  2CZ2 A;  2ON5 A;  2CV4 A;  3FZ4 A;  2VD0 A;  1K0D A;  1F6M C;  4O92 A;  1XW5 A;  3TB2 A;  2WZ9 A;  6GSS A;  1Q98 A;  2DBC A;  2GZZ A;  1SJ6 A;  5G30 A;  3F3Q A;  2QSI A;  3ZFL A;  2VCW A;  4PQH A;  3IA1 A;  4PUR A;  4FYC A;  3LEF A;  3WGX A;  1O73 A;  2GT5 A;  2C3N A;  1K3O A;  4Q5R A;  1SU9 A;  2AJQ B;  3A3T A;  3I9V 2;  5CRD A;  1R4W A;  5IO0 A;  2LNT A;  3DWV A;  4L0U A;  5H5R A;  2K6V A;  4MA9 A;  3ERF A;  4RUV A;  2J23 A;  3HZ4 A;  5GSS A;  1K0N A;  1WP0 A;  1URM A;  5LD0 A;  3HVV A;  3J7Y k;  1MD4 A;  1F3A A;  1YQ1 A;  4EL1 A;  2LQQ A;  2Z9S A;  4ZB9 A;  4BVX B;  5AN1 A;  3NIV A;  2LRC A;  1JZW A;  2M80 A;  3ZZX A;  2EFC A;  3GKN A;  1B48 A;  1FOH A;  2ZCT A;  2HNL A;  2C0G A;  1EOG A;  4IJI A;  3UVH A;  1XWG A;  2AUV A;  3WD6 A;  2A4V A;  4DSQ A;  3IV4 A;  4I2U A;  2RLI A;  3TRQ A;  3P8W A;  3EVI A;  1KEB A;  4Z2R A;  3LQ7 A;  1O6J A;  4PQ1 A;  1T1V A;  1A2M A;  4PTS A;  2HYX A;  3TJF A;  1N25 A;  3UIW A;  4OFT A;  4EC0 A;  2JL4 A;  2L4Q A;  4IW9 A;  4KSO A;  2VCV A;  1V2A A;  4KCE A;  1A23 A;  3FRC A;  1G0T A;  1GUM A;  2X8H A;  1QQ2 A;  4K7I A;  4X43 A;  5IPG A;  1TRW A;  6GSV A;  3Q74 A;  3HJO A;  2IL3 A;  2IIY A;  4RI7 A;  1PL2 A;  4XRA A;  3F8U A;  2H75 A;  3C73 A;  4ECJ A;  3GYK A;  4X1U A;  4XHM A;  3RHB A;  1DBY A;  16GS A;  4ID0 A;  4NXI A;  1EV4 A;  1KBN A;  1ERT A;  3GFK A;  4DEJ A;  5ECI B;  1OE8 A;  2OBK A;  5ID2 B;  1T4Z A;  2RM5 A;  3VWV A;  2FY6 A;  4AKX B;  4IEL A;  3VWX A;  1T00 A;  2VCT A;  3US3 A;  4YAV A;  3GKM A;  3F3R A;  2H74 A;  3ZL5 A;  4AF2 A;  2LQO A;  2ZUP A;  2A2P A;  1IYH A;  3TDG A;  2WB9 A;  4NWY A;  5INY A;  1QMV A;  1AC1 A;  5FHI A;  2WRT A;  1K3L A;  2JZT A;  4TXO B;  3L0H A;  1XW9 A;  1I9D A;  1EGR A;  3FW2 A;  5ECP B;  1TXX A;  4PUF C;  12GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...