3FR3A

Tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
201
structure length
201
Chain Sequence
NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTAANETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 66
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fr3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fr3A01
3J7Yk 1PQNA 3VI5A 4HJMA 3GH6A 2E7PA 2K8VA 4TR1A 4TR0A 3GSSA 1GSYA 3TUEA 4ZIJA 1HQOA 4F2IA 1KNGA 1PGTA 5INYA 4MF7A 4MABA 6GSWA 3WGDA 4EC0A 1EOHA 4IJ3A 3UL3A 2B5EA 3IR4A 2GSRA 3WT1A 4DEJA 2YP6A 4N30A 2LRNA 4PXOA 2JADA 1X9SB 5ECKB 1EP7A 4KSMA 2H0GA 1OE7A 3CYNA 2PERA 5ID2A 3K8NA 4NMUA 4HZ2A 2P5RA 3PH9A 2X99A 3ME7A 1GSSA 1K0DA 4MF5A 2LJAA 5ECOB 2JSYA 1LJRA 2WFCA 5G5FA 6GSXA 3IAS2 3KEBA 3GUSA 4HDEA 17GSA 3VFIA 3GRXA 4LA1A 5G1LA 5J5NA 3RHCA 2GSSA 4BWQA 4BVYB 8GSSA 2LJRA 2HRKB 3D5JA 3TGZA 3W8SA 4MZBA 3LORA 4KA0A 1K0BA 4JE1A 4YAPA 4N0VA 4RI7A 5H5SA 5CRGA 3KJYA 2L6CA 1GTAA 4POBA 2LNTA 3H79A 3QD9A 3BCIA 4FQUA 3EURA 3UAPA 2VO4A 2X64A 5HR1A 4OFMA 3IC4A 1XOAA 4ZBAA 1WMJA 1X0RA 2OBKA 2H66A 3VWXA 1SL0B 1XW5A 3P2AA 1FB6A 2G0FA 3DIEA 4J2FA 5LNKe 13GSA 3F6FA 2FWHA 3HJMA 2YWOA 4NV5A 3QFAC 1A23A 4EDZA 2P0GA 1A24A 1W4VA 3LJRA 2VL9A 4V1Ap 1YF0A 3G7JA 2WCIA 3M8NA 2EIQA 2GSQA 4NV2A 4I2TA 4ZL9A 5FT3A 4TXVA 2CVBA 1Q4JA 5EVOA 1AUCA 4KB3A 1QFNA 3GX0A 5FHIA 2L5OA 5J4UA 2VIMA 1R7HA 1SYRA 2H8LA 2CT6A 4PQ1A 1PX6A 1M9BA 5C00A 2IWTA 2NBSA 2DMLA 3EMXA 4K9ZA 4ACSA 4HU7A 4ZILA 5CP1A 3CRUA 2DC5A 2RLIA 4GSNA 1OC3A 1BYEA 3EU3A 3G7IA 3N5OA 4GRFA 2RUFA 3RAZA 4PQIA 6GSVA 2C0DA 5G31A 1GUKA 5ECMB 3L9SA 3KM6A 3QAGA 3GKNA 3GKXA 3TJKA 3SBCA 2OACA 1OYJA 1QQ2A 3HYPA 2H6XA 3ISOA 4HI7A 4I2UA 1SD8A 1KTEA 2F51A 2FUG2 2WRTA 2WB9A 3TB2A 3CTFA 1GP1A 5J9CA 2HZEB 2YOIA 3VWWA 5A4UA 1O8WA 4MDCA 2MMNA 5HR0A 3KXOA 5LCZA 3GYKA 1Z7PA 2F9SA 2KUCA 2LV3A 2XC2A 1XWBA 2UZ8A 3SWLA 5ABRA 4TXOA 4I97A 1JHBA 5ECRB 5CNWA 3H8QA 4MCUA 3NIVA 4OO5A 1XWCA 4ECIA 1M9AA 4GSSA 3LGCA 2GT5A 4XS6A 2H0IA 1TRWA 5ECQB 1DE1A 4YAVA 2H0HA 1U88A 2DMMA 3HVSA 2I9HA 1SKWB 2CAIA 1OAZA 1O73A 2LQQA 1Y25A 1U87A 5EPFA 5IOXA 2XBIA 5JWOB 1PN9A 4O7HA 1TTZA 1A2MA 5B7CA 4KUNA 1ST9A 5IO0A 5DQYA 1ABAA 4MZCA 1PL2A 3CXGA 2JL4A 4K6XA 2FA4A 4EE0A 2DSAA 4OCEA 4KDUA 4BL7A 3FR9A 1HNBA 2MMZA 1T8EB 2MMAA 4PGTA 2WS2A 3GKMA 2VCQA 1TI3A 2H30A 5JWRB 2C3QA 5D9WA 5G5EA 2CQ9A 1QGVA 2NVLA 1WWJA 2RUEA 5DDLA 1Z6MA 3W8JA 1XWAA 5D96A 4EDYA 1SYXA 3UARA 1N8JA 1JZRA 3ME8A 2TIRA 3IOSA 5F0GA 2YJHA 1XWGA 1EWXA 2VOCA 3W6GA 1TK8B 2L4CA 4BWSA 1DBYA 4O92A 1WOUA 4WBJA 1XPVA 4TXOB 4KNDA 1ZYEA 2CVDA 4AJ8A 3KZQA 5IQYA 4E8HA 1ZMAA 4I6XA 5KN0A 2O8VB 5AIVA 4IQ1A 3L4NA 5JCGA 1X5EA 3FR3A 4MF6A 2V32A 2HRAA 3C71A 3GV1A 1XOBA 3GURA 4IJIA 3GTUA 1OC9A 2L6DA 2LUSA 2R3XA 4IS0A 4XCSA 2O7KA 1UC7A 2F3MA 1TI1A 5AGYA 2H01A 3US3A 3DYRA 3ZVJA 4MH2A 3NZNA 3AY8A 4DSRA 2ALBA 1VRSD 3RPNA 1EOGA 3WGXA 4FYUA 2R5GA 2E2GA 2JU5A 4RUVA 1B9YC 3HA9A 2CZ3A 3RBTA 4YQVA 3NOFA 4Q5NA 3UMAA 4AGSA 1EZKA 1JZWA 4ECBA 3FEUA 1OE8A 2O87A 1GLQA 3UIWA 2DJKA 4BL7B 3IDVA 4KH7A 1ERUA 3CBUA 2GDRA 2AB6A 3O76A 4TOPA 1V98A 2A2SA 4TR4A 1YKCA 2R2JA 1EEJA 1THXA 1N2AA 1JFUA 3QCPA 5IMCA 4WKWA 3J7Yb 1PD21 3GMFA 1MDKA 1TK0B 4G10A 4LL4B 1ML6A 1T4ZA 4FH8A 5H5RA 4MP4A 4BVYA 3M9JA 2H73A 2MYGA 4EO3A 4WR5A 1TK5B 4V2LA 2HRKA 1UN2A 3HZ4A 4KCEA 4V2NA 3GSTA 3H4KA 1THOA 2QC7A 3GKKA 5H5QA 1ERTA 1B9XC 4RI6A 2NTOA 4CW9A 2LS5A 3D6IA 2J23A 1YKAA 4DSQA 1AW9A 3OR5A 2C80A 2DJJA 1G6YA 3TKQA 1M2AA 3TJBA 5AN1A 4AJ6A 16GSA 4K7NA 3ZREA 1EGRA 18GSA 4FO5A 2YWMA 3G9BA 1UA5A 1VF2A 5DJLA 4NXIA 6GSYA 4GSTA 12GSA 1T00A 3GTUB 2DJ2A 6GSSA 5B8AA 5DCHA 1OC9B 5KEJA 1ON4A 3IHQA 4XS4B 5HR2A 3GHAA 4MJBA 2LKUA 1YQ1A 1SK2A 3R2QA 2FHEA 4POMA 4HOJA 1GSDA 3Q74A 4KX4A 2B3SA 2C8UA 2C4JA 3Q19A 1Z5YE 3C1RA 3WYWA 2H75A 1BG5A 2AHEA 2XPDA 2AJQB 2OE3A 3TJGA 1T3BA 3IXRA 4JEDA 2GVPA 4PX1A 1G7OA 1LU4A 2HE3A 4G19A 1MDIA 2PBJA 1A0RP 5ECIB 4IQAA 2VCZA 2YN1A 2I81A 3GL5A 3TRQA 2IN3A 3HD5A 1AIUA 2FWFA 2HXKA 3FW2A 4GQFA 4K7IA 1VF1A 5CRWA 3MSZA 3ZIVA 3HVXA 3ZFLA 5J41A 1KBNA 1K3LA 3DVWA 4P3YB 4YQUA 1SU9A 5GSSA 4I5QA 1OVNA 2X8HA 4OD7A 2VL2A 3L9UA 3GX8A 4G0KA 1BEDA 4KDXA 2AYTA 4IHUA 2H6YA 1TJDA 2HZEA 4ZB6A 1M99A 3VURA 4ZBDA 4WF4A 2YJ7A 3I69A 3RHBA 2I3YA 3A2WA 1ERWA 1X5CA 3D4MA 4TRXA 2IPAA 4XRAA 4G9HA 3KMOA 22GSA 1GRXA 1AC1A 4GQCA 2H74A 4L5OA 1PL1A 2PN8A 5AIXA 4ECJA 3Q6OA 1IYHA 2VAFA 1HYUA 3ZYWA 1ILOA 3TKSE 1G6WA 1Z9HA 5CRHA 1O7UA 3VWVA 2IJYA 3FKFA 1F3AA 1NHYA 2PMTA 3DVXA 1JLVA 1I5GA 5F05A 3ZMKA 3IPZA 1TP9A 2EC4A 2HSNB 2M72A 1TU7A 4FIWA 1XW6A 3EC3A 3WGEA 3F9UA 2LJKA 3UVHA 2C1YA 2L57A 3DWVA 3ERWA 2R6KA 4PNGA 4F9ZA 4X1UA 5GSTA 1S3AA 1GUMA 3HZ8A 1VF3A 4G0LA 3QOUA 2V1MA 3G7YA 3ZLPA 2D2ZA 1EV4A 5ELGA 5IIZA 3LG6A 3GH9A 4X0XA 1K3YA 4F0CA 4POKA 4NHZA 1HNAA 3MAKA 1A2LA 3WD6A 2Z9SA 1J9BA 5B6NA 3HY2A 1T7PB 1AQWA 3F8UA 2JZRA 1OKTA 3GL3A 3TOTA 2B5YA 2H19A 3F63A 1K0NA 3PR8A 2ZNMA 4JR4A 3U5RE 4MJCA 4K7OA 4EUYA 5DAKB 1FW1A 4EL1A 4PQHA 1ZYQB 3F4TA 1YY7A 2HRNA 1X5DA 1HNCA 2CX4A 3KGKA 2HLSA 5F8BA 4OFNA 5GZZB 2ES7A 4KAEA 1WRYA 4OCFA 2HFDA 4BPYA 3HDCA 3TKRA 2DIZA 2FY6A 1V2AA 4JRRA 4TN8A 5HFIA 1GULA 2QSIA 2X8CA 2PVQA 3RPPA 3UEMA 2OKAA 3LQ7A 3VK9A 2L5LA 2KLXA 1PRXA 1WP0A 1V9WA 2M46A 4KF9A 3C1SA 3KTBA 4FYCA 2XHFA 1FB0A 1ZZYA 1YF1A 2YNXA 1TOFA 4ECCA 3FHKA 1GH2A 4L0UA 5L71A 1GUHA 3UVTA 19GSA 2CX3A 3KH7A 1Z7RA 2VLVA 4G0IA 3S9FA 2R37A 5A5KA 3V1WA 1PA3A 3TKSC 4N11A 4XIHA 2YWNA 3DEXA 1OKDA 1B4QA 1SJ6A 2B1LA 2GQMA 1J08A 4IKHA 5EY6A 2LQOA 3IE3A 4PNFA 4MJAA 3D21A 5D8IA 2N5BA 1BJXA 2C0FA 1XZOA 4TKYA 1XXUA 1JLWA 3LFLA 2IIYA 2GLRA 2MMOA 4K2DA 2C3TA 4CDOA 1GSUA 3KMNA 4OMVA 3PGTA 2YWIA 2LSTA 3F3RA 4IP6A 1CQHA 4KSOA 2OE0A 3APQA 4WF5A 1GNEA 5DQSA 14GSA 1PX7A 5HFGA 6GSTA 5CO3A 2IMFA 4IP1A 1K0AA 1MD3A 3WT2A 2IFQB 2FCHA 4HUAA 2RM6A 4HS1A 6GSUA 3LXZA 2JSZA 1MTCA 3FK8A 2KP1A 3QFBC 1GL8A 2HYXA 2VLTA 5LD0A 3F3QA 4NPBA 5ENUA 3ZRDA 3L0HA 2H72A 4K0NA 3EMPA 3CSIA 4ZL7A 2KP2A 1SL1B 5HFKA 3H1NA 3CSHA 3LYPA 1TRVA 3BOAA 3I43A 1PMTA 2HSHA 1U3AA 1H75A 1O8XA 1UVZA 1IYIA 3I6AA 3MWHA 4PURA 2AAWA 2E2MA 1ZCPA 2V6KA 5B6MA 4MH3A 4WEYA 4O32A 2N5AA 9GSSA 2EIOA 3KIJA 1K0CA 3FZAA 3GA4A 2VUPA 4XHMA 1B48A 2VD1A 1XBSA 3VLNA 1NSWA 4OO4A 1QK8A 5CRDA 4WETA 1T4YA 1FO5A 1AAZA 4LL1B 3VI7A 4HZ4A 3FZ5A 1TRUA 4XS4A 5ECHB 1GSEA 4N10A 3HJPA 3EWLA 4HJ2A 3EINA 2CVKA 4ML6A 4DVCA 4JZQA 2YCDA 5IMFA 1U6TA 4ILFA 1EP8A 1B4PA 3TCOA 1T1VA 5E4WA 3ERGA 3N9JA 5D93A 2HRFA 4KDYA 2ZCTA 2HZFA 3DXBA 2GZPA 2QKEA 3TJJA 2XBQA 1BQ7A 2CV4A 4F0BA 1YZXA 1GWCA 3H93A 3CSJA 5J9BA 4BVXB 2GZYA 4EKZA 5C04A 2RIIA 1MEKA 4LLRA 5JCUA 4KE3A 3C73A 1FG4A 1F6MC 4HU9A 3QR6A 3MNGA 1NHOA 5DJMA 5F06A 4QL9A 1GTUA 1RK4A 3L9VA 2GZZA 2V6OA 3HCZA 4MMMA 5HQPA 3QMXA 4JU5A 1Q98A 1M2BA 4HEA2 4V1Ag 2B6MA 5IMDA 4IVFA 2O85A 4YQMA 4FYBA 1WJKA 3P7XA 3PINA 2WGRA 2VCTA 1SENA 3UBKA 2V2GA 3BCKA 1J0FA 1A8LA 4QQ7A 1LBKA 1VGLA 4QL7A 2K9FA 2HI7A 3DD3A 3CTGA 3DRNA 3E9JB 5KN3A 4KW6A 3ZIJA 4CHSA 3EU4A 4OFTA 2JZTA 3GN3A 4D73B 1O81A 4BA7A 4XTSA 5B8BA 1URMA 4H86A 4L0WA 1K0MA 1S3DA 3QPMA 5A4VA 3A5WA 4JBBA 3ZZXA 1GTBA 1OC8A 2XPEA 3M1GA 1USBA 2ZUPA 2IMKA 5IMAA 3ZTLA 1RW1A 2YANA 3CRTA 3HKRA 1R5PA 1W89A 2C0GA 2P5QA 3C7MA 5DVBA 4NAXA 2O89A 3D4TA 1SL2B 5ECPB 3JCML 4HQZA 5GAND 4GXZA 2FLSA 2EIRA 1QMVA 3M9KA 3GIXA 2PUKC 3FZ9A 2LRCA 4ZBBA 1KEBA 1EGOA 3A2XA 3ED3A 2I4AA 1S3CA 2L59A 1EEMA 1O6JA 2JZSA 3KTLA 1PSQA 2VCWA 2B5XA 1TKDB 1I9DA 2A2RA 2DJ0A 4V2MA 4NHWA 5DAKA 2VCXA 4WR4A 2NPBA 3EVIA 2H71A 4GTUA 4ZB8A 5ELAA 4PTSA 2FA8A 1GNWA 2HSMB 1SK1A 2RM5A 1SKSB 3IBHA 4XRDA 2H70A 2BMXA 1TDIA 3LSZA 1ZL9A 5HR3A 3LYKA 2WJUA 1FAAA 2IMEA 3P90A 1MD4A 1R5AA 3VPTA 2MBSA 4IN0A 2B1KA 1FVJA 1DUGA 4L8EA 3IRAA 2H6ZA 4XS1A 4WBRD 2F8AA 3HVVA 4ZL8A 4LMWA 5AISA 1R26A 2AV4A 3IA1A 5IPHA 2IL3A 1K0OA 2ON7A 3DGQA 2TRXA 2MZCA 5IOWA 3TJFA 2YZHA 4TVEA 4GWRA 4K8MA 4YH2A 2VCVA 2JACA 4EXJA 1WIKA 2OBIA 4TR1B 1X9WB 5JWQB 3BD2A 2PU9C 1YEPA 4L5LA 2GTUA 5GAPD 1SD9A 5BMUA 1XFLA 1Z6NA 5ECSA 4EVMA 2K6VA 4J57E 2G2QA 4I8BA 3DKSA 3PPUA 5DCGA 2OE1A 2IMIA 3L78A 4TW5A 3EYTA 3QDNA 2DBCA 5IM9A 1JZOA 2GT6A 2VM1A 3F4SA 4AJ7A 4K1FA 5ID2B 4Q5RA 3EE2A 2X8GA 2IFQA 5FWGA 3FY7A 3KD0A 3ERFA 1F3BA 2OADA 1XWKA 1H4OA 2K18A 4ZB9A 1NM3A 3A3TA 1E6BA 1GSFA 3LWAA 4E8EA 2YZUA 1BAYA 1V40A 3DMLA 2CZ2A 4GCIA 2DIYA 4TR3A 10GSA 5F07A 3I9V2 2VLUA 5ECLB 3IV4A 1G0TA 4USSA 2WZ9A 1QXHA 3ZVJD 3O3TA 1GTIA 2V41A 2IMDA 1M2DA 3ZITA 5IO2A 1XCCA 1F2EA 3KP9A 4ZXGA 2I1UA 3APSA 4MJEA 2L4QA 4IGJA 3IAM2 2B7JA 2H76A 3TRPA 5COHA 2FGXA 4X43A 1JZDA 5KN2A 3BBYA 2DJ1A 5D9XA 5ECNB 3FZ4A 4MPGA 2HT9A 7GSSA 1ERVA 1A2JA 4IBPA 2WULA 2ON5A 2VD0A 2YV7A 3IK7A 2H1AA 2PWJA 4NWYA 4KCAA 2PVOC 4G2EA 3KP8A 2PGTA 3IC8A 1TU8A 1K3OA 1PKZA 4PUAA 1M7TA 3VWUA 1FHEA 2GGTA 5IMZA 1R4WA 1E2YA 1RQMA 4BVXA 3F4RA 5IPGA 1F37A 2FD3A 2KHPA 3KCMA 5G2ZA 3APOA 2YPMA 4HQSA 4KGIA 2LNSA 2FWGA 1MDJA 2NDOA 5IMVA 1XW9A 1V58A 1ZGNA 1TW9A 3TRXA 2OJLA 2LTKA 3M3MA 1PKWA 4RQRA 3D22A 4K0GA 5DALA 3D0ZA 1CQGA 3VPQA 4LMVA 1VF4A 2GSTA 4Q5QA 4EF0A 1QUWA 1WE0A 3F6DA 5EL8A 3CMIA 3FR6A 1WPIA 4ID0A 4ML1A 2H1BA 2VL2C 1ZOFA 4DSSA 3HHVA 1GLPA 2CAQA 1NW2A 4GF0A 3HXSA 5J3RA 1AQVA 4MPFA 3A2VA 2H1DA 4POLA 4IELA 4IW9A 2FNOA 1ACVA 2BJXA 3RDWA 4MK3A 1XIYA 4WXTA 4Z7XA 3ZMLA 3M0FA 11GSA 5DBQA 4D73A 4N0ZA 3E0UA 1FVKA 3BJ5A 1X9MB 1A8YA 1TRSA 3UJ1A 5JCWA 1GSQA 5CYYA 2DJ3A 2E0QA 4ISDA 4Q5FA 1SJIA 1YEXA 2M80A 3TKPA 5A4WA 3QAWA 1XVQA 4MZWA 2R4VA 1AQXA 3R3EA 3UOMA 2HSYA 4RQXA 2GQKA 20GSA 3HJOA 2VM2A 1F9MA 1V57A 1Z3EA 1TXXA 2CA8A 4PUFC 2LEGA 4MLYA 5E59A 3LXTA 2N5FA 5D73A 4AF2A 3ZFBA 2MBTA 1EV9A 2PPTA 1AXDA 3O6TA 3UBLA 2K8SA 3ZL5A 1DSBA 3KH9A 2J9HA 1FOVA 2H1GA 4OWYA 1DE2A 3GFKA 2C3NA 3MDKA 1U3IA 1SJZA 1YDKA 1G7EA 5D9TA 2FWEA 4JR6A 2P31A 2VL3A 4ULXA 2HNLA 5KN1A 3Q18A 1BX9A 2WDUA 4F03A 1Y6EA 3U6VA 3E3EA 5DALB 2GQLA 1A0FA 3TOUA 3IK9A 4MA9A 2YV9A 3F0IA 4J56E 2HSMA 2AUVA 1O85A 1SK0A 3C8EA 2QGVA 4F82A 4GLTA 4DSSB 5CREA 2KOKA 2F8FA 5CAXA 2B7KA 2LRTA 5G30A 5D9VA 5G1KA 1M0UA 2TRCP 2DLXA 3TDGA 1C72A 3FRCA 4O5RA 1B8XA 1YJ6A 2OA7A 2C0EA 3LEFA 2GS3A 2HQTA 3P8WA 1SKRB 3FYGA 1HD2A 3TKSA 2BTOT 1XVWA 2A4VA 2REMA 3GNJA 3QAVA
chains in the Genus database with same CATH superfamily
4N3ZA 4A5PA 3J7Yk 1PQNA 3VI5A 4HJMA 1BG1A 3GH6A 2OT3A 2E7PA 2K8VA 4TR1A 4TR0A 3GSSA 1GSYA 3TUEA 4ZIJA 1HQOA 4F2IA 1KNGA 1PGTA 5INYA 4MF7A 4MABA 6GSWA 1YEWC 3WGDA 4EC0A 1EOHA 4IJ3A 3UL3A 2B5EA 3IR4A 2GSRA 3WT1A 4DEJA 2YP6A 4N30A 2LRNA 4PXOA 2JADA 1X9SB 5ECKB 1EP7A 4KSMA 2H0GA 1OE7A 3CYNA 2PERA 5ID2A 3K8NA 4NMUA 4HZ2A 2P5RA 3PH9A 2X99A 4Z2TA 3ME7A 1GSSA 1K0DA 4MF5A 2LJAA 5ECOB 2JSYA 1LJRA 2WFCA 5G5FA 6GSXA 3IAS2 3KEBA 3GUSA 4HDEA 17GSA 3VFIA 3GRXA 4LA1A 5G1LA 5J5NA 3RHCA 2GSSA 4BWQA 4BVYB 2EFCA 8GSSA 2LJRA 2HRKB 3D5JA 3TGZA 3W8SA 4MZBA 4O5UA 3LORA 4KA0A 1K0BA 4JE1A 4YAPA 4N0VA 4RI7A 5H5SA 5CRGA 3KJYA 2L6CA 1GTAA 4POBA 2LNTA 3H79A 3QD9A 3BCIA 4FQUA 3EURA 3UAPA 2VO4A 2X64A 5HR1A 4OFMA 3IC4A 1XOAA 4ZBAA 1WMJA 1X0RA 2OBKA 2H66A 3VWXA 1SL0B 1XW5A 3P2AA 1FB6A 2G0FA 3DIEA 4J2FA 5LNKe 13GSA 3F6FA 2FWHA 3HJMA 2YWOA 4NV5A 3QFAC 1A23A 4EDZA 2P0GA 1A24A 1W4VA 3LJRA 2VL9A 4V1Ap 1YF0A 3G7JA 2WCIA 3M8NA 2EIQA 2GSQA 4NV2A 4I2TA 4ZL9A 5FT3A 4TXVA 2CVBA 1Q4JA 1FOHA 5EVOA 1AUCA 4KB3A 1QFNA 3GX0A 5FHIA 2L5OA 5J4UA 2VIMA 1M3IA 1R7HA 1SYRA 2H8LA 2CT6A 4PQ1A 1PX6A 1M9BA 5C00A 2IWTA 2NBSA 2DMLA 3EMXA 4K9ZA 4ACSA 4HU7A 4ZILA 5CP1A 3CRUA 2DC5A 2RLIA 4GSNA 1OC3A 1BYEA 3EU3A 3G7IA 3N5OA 4GRFA 2RUFA 3RAZA 4PQIA 6GSVA 4AKGA 2C0DA 5G31A 1GUKA 5ECMB 3L9SA 1M3JA 3KM6A 3QAGA 3GKNA 3GKXA 3TJKA 3SBCA 2OACA 1OYJA 1QQ2A 3HYPA 2H6XA 3ISOA 4HI7A 4I2UA 1SD8A 1KTEA 2F51A 2FUG2 2WRTA 5KOXA 2WB9A 5J4VA 1XG8A 3TB2A 3CTFA 1GP1A 5J9CA 2HZEB 2YOIA 3VWWA 5A4UA 1O8WA 4MDCA 2MMNA 5HR0A 3KXOA 5LCZA 3GYKA 1Z7PA 2F9SA 2KUCA 2LV3A 2XC2A 1XWBA 4AI6A 2UZ8A 3SWLA 5ABRA 4TXOA 4I97A 1JHBA 5ECRB 5CNWA 3H8QA 2WVYA 4MCUA 3NIVA 4OO5A 1XWCA 4ECIA 1M9AA 4GSSA 3LGCA 2GT5A 4XS6A 2H0IA 1TRWA 5ECQB 1DE1A 4YAVA 2H0HA 1U88A 2DMMA 3HVSA 2I9HA 4EIPA 1SKWB 2CAIA 1OAZA 1O73A 2LQQA 1Y25A 1U87A 5EPFA 5IOXA 2XBIA 5JWOB 1PN9A 4O7HA 1TTZA 2H1LA 1A2MA 5B7CA 4KUNA 1ST9A 5IO0A 5DQYA 1ABAA 4MZCA 1PL2A 3CXGA 2JL4A 4K6XA 2FA4A 1ZYPA 4EE0A 2DSAA 4OCEA 4KDUA 4BL7A 3FR9A 1HNBA 2MMZA 1SVLA 1T8EB 2WZSA 2MMAA 4PGTA 2WS2A 3GKMA 2VCQA 1TI3A 2R0PA 2H30A 5JWRB 2C3QA 5D9WA 5G5EA 2CQ9A 1QGVA 2NVLA 1WWJA 2RUEA 5DDLA 1Z6MA 3W8JA 2X49A 1XWAA 5D96A 4EDYA 1SYXA 3UARA 1N8JA 1JZRA 3ME8A 2TIRA 3IOSA 5A5HA 5F0GA 2YJHA 1XWGA 1EWXA 2VOCA 3W6GA 4QMKA 1TK8B 2L4CA 4BWSA 1DBYA 4O92A 1WOUA 4WBJA 1XPVA 4TXOB 4KNDA 1ZYEA 2CVDA 4AJ8A 3KZQA 5IQYA 4E8HA 1ZMAA 4I6XA 5KN0A 2O8VB 1SVMA 4IQ1A 5AIVA 3L4NA 2EFDA 5JCGA 1X5EA 3FR3A 4MF6A 2V32A 2HRAA 3C71A 3GV1A 1XOBA 3GURA 4IJIA 3GTUA 1OC9A 2L6DA 2LUSA 2R3XA 4CY6A 4IS0A 4XCSA 2O7KA 1UC7A 2F3MA 1TI1A 5AGYA 2H01A 3US3A 3DYRA 3ZVJA 4MH2A 3NZNA 3AY8A 4DSRA 2ALBA 1VRSD 3RPNA 1EOGA 3WGXA 4FYUA 2R5GA 2E2GA 2JU5A 4RUVA 1B9YC 3HA9A 2CZ3A 3RBTA 4YQVA 3NOFA 4Q5NA 3UMAA 4AGSA 1EZKA 1JZWA 4ECBA 3FEUA 4X4JA 1OE8A 2O87A 3MYDA 1GLQA 3UIWA 2DJKA 4BL7B 3IDVA 4KH7A 1ERUA 3CBUA 2GDRA 4MNNA 2AB6A 3O76A 4TOPA 3CHXC 1V98A 2A2SA 4TR4A 4BIKA 1YKCA 3RFRC 2R2JA 1EEJA 1THXA 1N2AA 1JFUA 3QCPA 5IMCA 4WKWA 3J7Yb 1PD21 3GMFA 1MDKA 1TK0B 4G10A 4LL4B 1ML6A 1T4ZA 4FH8A 5H5RA 4MP4A 4BVYA 3M9JA 2H73A 2MYGA 4EO3A 4WR5A 1TK5B 4V2LA 2HRKA 1UN2A 3HZ4A 4KCEA 2EFEA 3GSTA 4V2NA 3H4KA 1THOA 2QC7A 3GKKA 5H5QA 1ERTA 1B9XC 4RI6A 2NTOA 4CW9A 2LS5A 3D6IA 2J23A 1YKAA 4DSQA 4ZB7A 1AW9A 3OR5A 2C80A 2DJJA 1G6YA 3TKQA 1M2AA 3TJBA 2WVZA 5AN1A 4AJ6A 16GSA 4K7NA 3ZREA 1EGRA 18GSA 4FO5A 2YWMA 3G9BA 1UA5A 1VF2A 5DJLA 4NXIA 6GSYA 4GSTA 12GSA 1T00A 3GTUB 2DJ2A 6GSSA 5B8AA 5DCHA 1OC9B 4Z2RA 5KEJA 1ON4A 3IHQA 4XS4B 5HR2A 4K5SA 3GHAA 4MJBA 2LKUA 1YQ1A 1SK2A 3R2QA 2FHEA 4POMA 4HOJA 3CQFA 1GSDA 3Q74A 4KX4A 2B3SA 3RGBC 2C8UA 2C4JA 3Q19A 1Z5YE 3C1RA 3WYWA 2H75A 1BG5A 2AHEA 2XPDA 2AJQB 3HVNA 2OE3A 3TJGA 1T3BA 3IXRA 4JEDA 2GVPA 4PX1A 1G7OA 1LU4A 2HE3A 4G19A 1MDIA 2PBJA 1A0RP 5ECIB 4IQAA 2VCZA 2YN1A 2I81A 3GL5A 3TRQA 2IN3A 3HD5A 1AIUA 2FWFA 2HXKA 3FW2A 4GQFA 4K7IA 1VF1A 5CRWA 3MSZA 3ZIVA 3HVXA 3ZFLA 5J41A 1KBNA 1K3LA 3DVWA 4P3YB 4YQUA 1SU9A 5GSSA 4I5QA 1OVNA 2X8HA 4OD7A 2VL2A 3L9UA 3GX8A 4G0KA 4W66A 1BEDA 4KDXA 2AYTA 4IHUA 2H6YA 1TJDA 2HZEA 4ZB6A 1M99A 3VURA 4ZBDA 4WF4A 2YJ7A 3I69A 3RHBA 2I3YA 3A2WA 1ERWA 1X5CA 3D4MA 4TRXA 2IPAA 4XRAA 4G9HA 3KMOA 22GSA 1GRXA 1AC1A 4GQCA 2H74A 4L5OA 1PL1A 2PN8A 5AIXA 4ECJA 3Q6OA 1IYHA 2VAFA 1HYUA 3ZYWA 1ILOA 3TKSE 1G6WA 1Z9HA 5CRHA 1O7UA 3VWVA 2IJYA 3FKFA 1F3AA 1NHYA 2PMTA 3DVXA 1JLVA 1I5GA 5F05A 3ZMKA 3IPZA 1TP9A 2EC4A 2HSNB 2M72A 1TU7A 4FIWA 1XW6A 3EC3A 3WGEA 3F9UA 2LJKA 3UVHA 2C1YA 2L57A 3DWVA 3ERWA 2R6KA 4PNGA 4F9ZA 4X1UA 5GSTA 1S3AA 1GUMA 3HZ8A 1VF3A 4G0LA 3QOUA 2V1MA 3G7YA 5A34A 3ZLPA 2D2ZA 1EV4A 5ELGA 5IIZA 3LG6A 3GH9A 4X0XA 1K3YA 4F0CA 4POKA 4NHZA 1HNAA 3MAKA 1A2LA 3WD6A 2Z9SA 1J9BA 5B6NA 3HY2A 1T7PB 1AQWA 3F8UA 2JZRA 1OKTA 3GL3A 3TOTA 2B5YA 2H19A 3F63A 2VKZG 1K0NA 3PR8A 2ZNMA 4JR4A 3U5RE 4MJCA 4K7OA 4EUYA 5DAKB 1FW1A 4EL1A 4PQHA 1ZYQB 3F4TA 1YY7A 2HRNA 1X5DA 1HNCA 2CX4A 3KGKA 2HLSA 5F8BA 4YKGA 4OFNA 5GZZB 2ES7A 4KAEA 1WRYA 4OCFA 2HFDA 4BPYA 3HDCA 3TKRA 2DIZA 2FY6A 1V2AA 4JRRA 4TN8A 5HFIA 1GULA 2QSIA 2X8CA 2PVQA 3RPPA 3UEMA 2OKAA 3LQ7A 3VK9A 2L5LA 2KLXA 5J4YA 1PRXA 1WP0A 1V9WA 2M46A 4KF9A 3C1SA 3KTBA 4FYCA 2XHFA 1FB0A 1ZZYA 1YF1A 2YNXA 1TOFA 4ECCA 3FHKA 1GH2A 4L0UA 5L71A 1GUHA 3UVTA 19GSA 2CX3A 1Z7RA 3KH7A 2VLVA 4G0IA 3S9FA 2R37A 5A5KA 3V1WA 4K2XA 1PA3A 3TKSC 4N11A 4XIHA 2YWNA 3DEXA 1OKDA 1B4QA 1SJ6A 2B1LA 2GQMA 1J08A 4IKHA 2O36A 5EY6A 2LQOA 3IE3A 4PNFA 4MJAA 3D21A 5D8IA 2N5BA 1BJXA 2C0FA 2QA2A 1XZOA 4TKYA 1XXUA 1JLWA 3LFLA 2IIYA 2GLRA 2MMOA 4K2DA 2C3TA 4CDOA 2A4HA 1GSUA 3KMNA 4OMVA 5A34B 4O5QA 3PGTA 2YWIA 2LSTA 3F3RA 4IP6A 1CQHA 4KSOA 4ICYA 2OE0A 3APQA 1S3RA 4WF5A 2DKIA 1GNEA 5DQSA 14GSA 1PX7A 5HFGA 1Y1UA 6GSTA 5CO3A 2IMFA 4Z2UA 4IP1A 1K0AA 1MD3A 3WT2A 2IFQB 2FCHA 4HUAA 2RM6A 4HS1A 6GSUA 3LXZA 2JSZA 5KOWA 1MTCA 3FK8A 2KP1A 3QFBC 1GL8A 2HYXA 2VLTA 5LD0A 3F3QA 4NPBA 5ENUA 3ZRDA 3L0HA 2H72A 4K0NA 3EMPA 3CSIA 4ZL7A 2KP2A 1SL1B 5HFKA 3H1NA 3CSHA 3LYPA 1TRVA 3BOAA 3I43A 1PMTA 2HSHA 1U3AA 1H75A 1O8XA 1UVZA 1IYIA 3I6AA 3MWHA 4PURA 2AAWA 2E2MA 1ZCPA 2V6KA 5B6MA 4MH3A 4FXYP 4WEYA 4O32A 2N5AA 9GSSA 2EIOA 3A5IA 1K0CA 3KIJA 3FZAA 3GA4A 2VUPA 4XHMA 1B48A 2VD1A 1XBSA 3VLNA 1NSWA 4OO4A 1QK8A 5CRDA 5A1NB 4WETA 1T4YA 1FO5A 1AAZA 4LL1B 3VI7A 4HZ4A 3FZ5A 1TRUA 4XS4A 5ECHB 1GSEA 4N10A 3HJPA 3EWLA 4HJ2A 3EINA 2CVKA 4ML6A 4DVCA 4JZQA 2YCDA 4K5RA 4HSCX 5IMFA 1U6TA 4ILFA 1EP8A 1B4PA 3TCOA 1T1VA 5E4WA 3ERGA 3N9JA 3IHGA 5D93A 2HRFA 4KDYA 2ZCTA 2HZFA 4PI0C 3DXBA 2GZPA 2QKEA 3TJJA 2XBQA 1BQ7A 2CV4A 4F0BA 1YZXA 1GWCA 3H93A 3CSJA 5J9BA 4BVXB 2GZYA 4EKZA 5C04A 2RIIA 1MEKA 4LLRA 1SVOA 5JCUA 4KE3A 3C73A 1FG4A 1F6MC 4HU9A 3QR6A 3MNGA 1NHOA 5DJMA 5F06A 4QL9A 1GTUA 1RK4A 3L9VA 2GZZA 2V6OA 3HCZA 4MMMA 5HQPA 3QMXA 4JU5A 1Q98A 1M2BA 4PHZC 4HEA2 4V1Ag 2B6MA 5IMDA 4IVFA 2O85A 4YQMA 2DKHA 4FYBA 1WJKA 3P7XA 3PINA 2WGRA 2VCTA 1SENA 3UBKA 2V2GA 3BCKA 1J0FA 1A8LA 4QQ7A 1LBKA 1VGLA 4QL7A 2K9FA 2HI7A 3DD3A 3CTGA 3DRNA 3E9JB 5KN3A 4KW6A 3ZIJA 4CHSA 3EU4A 4OFTA 2JZTA 3GN3A 4D73B 1O81A 4AKIA 4BA7A 4XTSA 5B8BA 1URMA 4H86A 4L0WA 1K0MA 1S3DA 3QPMA 2HSNA 5A4VA 5J40A 3A5WA 1S4BP 4JBBA 3ZZXA 1GTBA 1OC8A 2XPEA 3M1GA 1USBA 4G01A 2ZUPA 2IMKA 5IMAA 3ZTLA 1RW1A 3LW9A 2YANA 3CRTA 3HKRA 1R5PA 5J47A 1W89A 2C0GA 2P5QA 3C7MA 5DVBA 4EIQA 4NAXA 2O89A 2R0GA 3D4TA 1SL2B 3MIXA 5ECPB 3JCML 4HQZA 5GAND 4GXZA 2FLSA 2EIRA 1QMVA 3M9KA 3GIXA 3FMWA 2PUKC 3FZ9A 2LRCA 4ZBBA 1KEBA 1EGOA 3A2XA 3ED3A 2I4AA 1S3CA 2L59A 1EEMA 3TU3B 1O6JA 2JZSA 2UV8G 3KTLA 1PSQA 2VCWA 2B5XA 1TKDB 1I9DA 2A2RA 2DJ0A 4V2MA 4NHWA 5DAKA 2VCXA 4WR4A 2NPBA 3EVIA 4PI2C 2H71A 4GTUA 4ZB8A 5ELAA 1BF5A 4PTSA 2FA8A 2WW1A 1GNWA 2HSMB 1SK1A 2RM5A 1SKSB 3IBHA 4XRDA 2H70A 2BMXA 1TDIA 3LSZA 1ZL9A 2O5VA 5HR3A 3LYKA 2WJUA 1FAAA 2IMEA 3P90A 1MD4A 1R5AA 4GDFA 3VPTA 2MBSA 4IN0A 2B1KA 1FVJA 1DUGA 4L8EA 3IRAA 2H6ZA 4XS1A 4WBRD 2F8AA 3HVVA 4ZL8A 4LMWA 5AISA 1R26A 1TXUA 2AV4A 3IA1A 5IPHA 2IL3A 1K0OA 2ON7A 3DGQA 2TRXA 2X4AA 2MZCA 5IOWA 3TJFA 2YZHA 4TVEA 4GWRA 4K8MA 4YH2A 2VCVA 2JACA 4EXJA 1WIKA 2OBIA 4TR1B 1X9WB 5JWQB 3BD2A 2PU9C 1YEPA 4L5LA 2GTUA 5GAPD 1SD9A 5BMUA 1XFLA 1Z6NA 5ECSA 4EVMA 2K6VA 4J57E 2G2QA 4I8BA 3DKSA 2WVXA 3PPUA 5DCGA 2OE1A 2IMIA 3L78A 4TW5A 3EYTA 3QDNA 2DBCA 5IM9A 3EPTA 1JZOA 2GT6A 2VM1A 3F4SA 4AJ7A 4K1FA 5ID2B 4Q5RA 3EE2A 2X8GA 2IFQA 5FWGA 3FY7A 3KD0A 3ERFA 1F3BA 2OADA 1XWKA 1H4OA 2K18A 4ZB9A 1NM3A 3A3TA 2QA1A 1E6BA 1GSFA 3LWAA 4E8EA 2YZUA 1BAYA 1V40A 3DMLA 2CZ2A 4GCIA 2DIYA 4TR3A 10GSA 5F07A 3I9V2 2VLUA 5ECLB 3IV4A 1G0TA 4USSA 2WZ9A 3CWGA 1QXHA 3ZVJD 3O3TA 1GTIA 2V41A 2IMDA 1M2DA 3ZITA 5IO2A 1XCCA 5BRTA 1F2EA 3KP9A 4ZXGA 2I1UA 3APSA 4MJEA 2L4QA 4IGJA 5A1NA 3IAM2 2B7JA 2H76A 3TRPA 5COHA 2FGXA 4X43A 1JZDA 5KN2A 3BBYA 2DJ1A 5D9XA 5ECNB 3FZ4A 4MPGA 2HT9A 7GSSA 1ERVA 1A2JA 1PFOA 4IBPA 2WULA 2ON5A 2VD0A 2YV7A 2EFHA 3IK7A 2H1AA 3HMJG 2PWJA 4NWYA 4AKXB 4KCAA 4E68A 2PVOC 4G2EA 3KP8A 2PGTA 5BMUB 3IC8A 1TU8A 1K3OA 1PKZA 4PUAA 1M7TA 2WVXB 3VWUA 1FHEA 2GGTA 5IMZA 1R4WA 1E2YA 1RQMA 4BVXA 3F4RA 5IPGA 1F37A 2FD3A 2KHPA 3KCMA 2WW3A 5G2ZA 3APOA 2YPMA 4CY8A 4HQSA 4KGIA 2LNSA 2FWGA 1MDJA 2NDOA 5IMVA 1XW9A 1V58A 1ZGNA 1TW9A 3TRXA 2OJLA 2LTKA 3M3MA 1PKWA 4RQRA 3D22A 4K0GA 5DALA 3D0ZA 1CQGA 3VPQA 4LMVA 1VF4A 2GSTA 4Q5QA 4EF0A 1QUWA 1WE0A 3F6DA 5EL8A 3CMIA 3FR6A 1WPIA 2R0CA 4ID0A 4ML1A 2H1BA 2VL2C 1ZOFA 4DSSA 3HHVA 4AKHA 1GLPA 2CAQA 1NW2A 4GF0A 3HXSA 5J3RA 1AQVA 2WW2A 4MPFA 3A2VA 2H1DA 4POLA 4IELA 4IW9A 1YVLA 2FNOA 1ACVA 2BJXA 3RDWA 4MK3A 1XIYA 4WXTA 4Z7XA 3ZMLA 3M0FA 11GSA 5DBQA 4D73A 4N0ZA 2WW0A 3E0UA 1FVKA 3BJ5A 1X9MB 1A8YA 1TRSA 3UJ1A 5JCWA 1N25A 1GSQA 5CYYA 2DJ3A 2E0QA 4ISDA 4Q5FA 1SJIA 1YEXA 2O3EA 4YKFA 2M80A 3TKPA 5A4WA 3QAWA 1XVQA 4MZWA 2R4VA 1AQXA 3R3EA 3UOMA 2HSYA 4RQXA 2GQKA 20GSA 3HJOA 2VM2A 1F9MA 1V57A 1Z3EA 1TXXA 2CA8A 4PUFC 2LEGA 4MLYA 1PN0A 5E59A 3LXTA 2N5FA 5D73A 4AF2A 3ZFBA 2MBTA 1EV9A 1ZYNA 2PPTA 1AXDA 3O6TA 3UBLA 2K8SA 3ZL5A 1DSBA 3KH9A 1I1IP 2J9HA 1FOVA 2H1GA 4OWYA 1DE2A 3GFKA 2C3NA 3MDKA 1U3IA 1SJZA 1YDKA 1G7EA 5D9TA 2FWEA 4JR6A 2P31A 2VL3A 4ULXA 2HNLA 5KN1A 3Q18A 1BX9A 2WDUA 4F03A 1Y6EA 3U6VA 3E3EA 5DALB 2GQLA 1A0FA 3TOUA 3IK9A 4MA9A 2YV9A 3F0IA 4J56E 2HSMA 5A5HB 2AUVA 1O85A 1SK0A 3C8EA 2QGVA 4F82A 4GLTA 4DSSB 5CREA 2KOKA 2F8FA 5CAXA 2B7KA 2LRTA 5G30A 5D9VA 5G1KA 1M0UA 2TRCP 2DLXA 3TDGA 1C72A 3FRCA 2A2PA 4O5RA 1B8XA 1YJ6A 2OA7A 2C0EA 3LEFA 2GS3A 2HQTA 3P8WA 1SKRB 3FYGA 1HD2A 3TKSA 2BTOT 1XVWA 2A4VA 2REMA 3GNJA 3QAVA
chains in the Genus database with same CATH topology
4N3ZA 4A5PA 3J7Yk 1PQNA 3VI5A 4HJMA 1BG1A 3GH6A 2OT3A 2E7PA 2K8VA 4TR1A 4TR0A 3GSSA 1GSYA 3TUEA 4ZIJA 1HQOA 4F2IA 1KNGA 1PGTA 5INYA 4MF7A 4MABA 6GSWA 3WGDA 4EC0A 1EOHA 4IJ3A 3UL3A 2B5EA 3IR4A 2GSRA 3WT1A 4DEJA 2YP6A 4N30A 2LRNA 4PXOA 2JADA 1X9SB 5ECKB 1EP7A 4KSMA 2H0GA 1OE7A 3CYNA 2PERA 5ID2A 3K8NA 4NMUA 4HZ2A 2P5RA 3PH9A 2X99A 4Z2TA 3ME7A 1GSSA 1K0DA 4MF5A 2LJAA 5ECOB 2JSYA 1LJRA 2WFCA 5G5FA 6GSXA 3IAS2 3KEBA 3GUSA 4HDEA 17GSA 3VFIA 3GRXA 4LA1A 5G1LA 5J5NA 3RHCA 2GSSA 4BWQA 4BVYB 2EFCA 8GSSA 2LJRA 2HRKB 3D5JA 3TGZA 3W8SA 4MZBA 4O5UA 3LORA 4KA0A 1K0BA 4JE1A 4YAPA 4N0VA 4RI7A 5H5SA 5CRGA 3KJYA 2L6CA 1GTAA 4POBA 2LNTA 3H79A 3QD9A 3BCIA 4FQUA 3EURA 3UAPA 2VO4A 2X64A 5HR1A 4OFMA 3IC4A 1XOAA 4ZBAA 1WMJA 1X0RA 2OBKA 2H66A 3VWXA 1SL0B 1XW5A 3P2AA 1FB6A 2G0FA 3DIEA 4J2FA 5LNKe 13GSA 3F6FA 2FWHA 3HJMA 2YWOA 4NV5A 3QFAC 1A23A 4EDZA 2P0GA 1A24A 1W4VA 3LJRA 2VL9A 4V1Ap 1YF0A 3G7JA 2WCIA 3M8NA 2EIQA 2GSQA 4NV2A 4I2TA 4ZL9A 5FT3A 4TXVA 2CVBA 1Q4JA 1FOHA 5EVOA 1AUCA 4KB3A 1QFNA 3GX0A 5FHIA 2L5OA 5J4UA 2VIMA 1R7HA 1SYRA 2H8LA 2CT6A 4PQ1A 1PX6A 1M9BA 5C00A 2IWTA 2NBSA 2DMLA 3EMXA 4K9ZA 4ACSA 4HU7A 4ZILA 5CP1A 3CRUA 2DC5A 2RLIA 4GSNA 1OC3A 1BYEA 3EU3A 3G7IA 3N5OA 4GRFA 2RUFA 3RAZA 4PQIA 6GSVA 4AKGA 2C0DA 5G31A 1GUKA 5ECMB 3L9SA 3KM6A 3QAGA 3GKNA 3GKXA 3TJKA 3SBCA 2OACA 1OYJA 1QQ2A 3HYPA 2H6XA 3ISOA 4HI7A 4I2UA 1SD8A 1KTEA 2F51A 2FUG2 2WRTA 5KOXA 2WB9A 5J4VA 3TB2A 3CTFA 1GP1A 5J9CA 2HZEB 2YOIA 3VWWA 5A4UA 1O8WA 4MDCA 2MMNA 5HR0A 3KXOA 5LCZA 3GYKA 1Z7PA 2F9SA 2KUCA 2LV3A 2XC2A 1XWBA 4AI6A 2UZ8A 3SWLA 5ABRA 4TXOA 4I97A 1JHBA 5ECRB 5CNWA 3H8QA 4MCUA 3NIVA 4OO5A 1XWCA 4ECIA 1M9AA 4GSSA 3LGCA 2GT5A 4XS6A 2H0IA 1TRWA 5ECQB 1DE1A 4YAVA 2H0HA 1U88A 2DMMA 3HVSA 2I9HA 4EIPA 1SKWB 2CAIA 1OAZA 1O73A 2LQQA 1Y25A 1U87A 5EPFA 5IOXA 2XBIA 5JWOB 1PN9A 4O7HA 1TTZA 2H1LA 1A2MA 5B7CA 4KUNA 1ST9A 5IO0A 5DQYA 1ABAA 4MZCA 1PL2A 3CXGA 2JL4A 4K6XA 2FA4A 1ZYPA 4EE0A 2DSAA 4OCEA 4KDUA 4BL7A 3FR9A 1HNBA 2MMZA 1SVLA 1T8EB 2MMAA 4PGTA 2WS2A 3GKMA 2VCQA 1TI3A 2R0PA 2H30A 5JWRB 2C3QA 5D9WA 5G5EA 2CQ9A 1QGVA 2NVLA 1WWJA 2RUEA 5DDLA 1Z6MA 3W8JA 2X49A 1XWAA 5D96A 4EDYA 1SYXA 3UARA 1N8JA 1JZRA 3ME8A 2TIRA 3IOSA 5A5HA 5F0GA 2YJHA 1XWGA 1EWXA 2VOCA 3W6GA 4QMKA 1TK8B 2L4CA 4BWSA 1DBYA 4O92A 1WOUA 4WBJA 1XPVA 4TXOB 4KNDA 1ZYEA 2CVDA 4AJ8A 3KZQA 5IQYA 4E8HA 1ZMAA 4I6XA 5KN0A 2O8VB 1SVMA 4IQ1A 5AIVA 3L4NA 2EFDA 5JCGA 1X5EA 3FR3A 4MF6A 2V32A 2HRAA 3C71A 3GV1A 1XOBA 3GURA 4IJIA 3GTUA 1OC9A 2L6DA 2LUSA 2R3XA 4CY6A 4IS0A 4XCSA 2O7KA 1UC7A 2F3MA 1TI1A 5AGYA 2H01A 3US3A 3DYRA 3ZVJA 4MH2A 3NZNA 3AY8A 4DSRA 2ALBA 1VRSD 3RPNA 1EOGA 3WGXA 4FYUA 2R5GA 2E2GA 2JU5A 4RUVA 1B9YC 3HA9A 2CZ3A 3RBTA 4YQVA 3NOFA 4Q5NA 3UMAA 4AGSA 1EZKA 1JZWA 4ECBA 3FEUA 4X4JA 1OE8A 2O87A 3MYDA 1GLQA 3UIWA 2DJKA 4BL7B 3IDVA 4KH7A 1ERUA 3CBUA 2GDRA 4MNNA 2AB6A 3O76A 4TOPA 1V98A 2A2SA 4TR4A 1YKCA 2R2JA 1EEJA 1THXA 1N2AA 1JFUA 3QCPA 5IMCA 4WKWA 3J7Yb 1PD21 3GMFA 1MDKA 1TK0B 4G10A 4LL4B 1ML6A 1T4ZA 4FH8A 5H5RA 4MP4A 4BVYA 3M9JA 2H73A 2MYGA 4EO3A 4WR5A 1TK5B 4V2LA 2HRKA 1UN2A 3HZ4A 4KCEA 2EFEA 3GSTA 4V2NA 3H4KA 1THOA 2QC7A 3GKKA 5H5QA 1ERTA 1B9XC 4RI6A 2NTOA 4CW9A 2LS5A 3D6IA 2J23A 1YKAA 4DSQA 4ZB7A 1AW9A 3OR5A 2C80A 2DJJA 1G6YA 3TKQA 1M2AA 3TJBA 5AN1A 4AJ6A 16GSA 4K7NA 3ZREA 1EGRA 18GSA 4FO5A 2YWMA 3G9BA 1UA5A 1VF2A 5DJLA 4NXIA 6GSYA 4GSTA 12GSA 1T00A 3GTUB 2DJ2A 6GSSA 5B8AA 5DCHA 1OC9B 4Z2RA 5KEJA 1ON4A 3IHQA 4XS4B 5HR2A 4K5SA 3GHAA 4MJBA 2LKUA 1YQ1A 1SK2A 3R2QA 2FHEA 4POMA 4HOJA 1GSDA 3Q74A 4KX4A 2B3SA 2C8UA 2C4JA 3Q19A 1Z5YE 3C1RA 3WYWA 2H75A 1BG5A 2AHEA 2XPDA 2AJQB 2OE3A 3TJGA 1T3BA 3IXRA 4JEDA 2GVPA 4PX1A 1G7OA 1LU4A 2HE3A 4G19A 1MDIA 2PBJA 1A0RP 5ECIB 4IQAA 2VCZA 2YN1A 2I81A 3GL5A 3TRQA 2IN3A 3HD5A 1AIUA 2FWFA 2HXKA 3FW2A 4GQFA 4K7IA 1VF1A 5CRWA 3MSZA 3ZIVA 3HVXA 3ZFLA 5J41A 1KBNA 1K3LA 3DVWA 4P3YB 4YQUA 1SU9A 5GSSA 4I5QA 1OVNA 2X8HA 4OD7A 2VL2A 3L9UA 3GX8A 4G0KA 4W66A 1BEDA 4KDXA 2AYTA 4IHUA 2H6YA 1TJDA 2HZEA 4ZB6A 1M99A 3VURA 4ZBDA 4WF4A 2YJ7A 3I69A 3RHBA 2I3YA 3A2WA 1ERWA 1X5CA 3D4MA 4TRXA 2IPAA 4XRAA 4G9HA 3KMOA 22GSA 1GRXA 1AC1A 4GQCA 2H74A 4L5OA 1PL1A 2PN8A 5AIXA 4ECJA 3Q6OA 1IYHA 2VAFA 1HYUA 3ZYWA 1ILOA 3TKSE 1G6WA 1Z9HA 5CRHA 1O7UA 3VWVA 2IJYA 3FKFA 1F3AA 1NHYA 2PMTA 3DVXA 1JLVA 1I5GA 5F05A 3ZMKA 3IPZA 1TP9A 2EC4A 2HSNB 2M72A 1TU7A 4FIWA 1XW6A 3EC3A 3WGEA 3F9UA 2LJKA 3UVHA 2C1YA 2L57A 3DWVA 3ERWA 2R6KA 4PNGA 4F9ZA 4X1UA 5GSTA 1S3AA 1GUMA 3HZ8A 1VF3A 4G0LA 3QOUA 2V1MA 3G7YA 5A34A 3ZLPA 2D2ZA 1EV4A 5ELGA 5IIZA 3LG6A 3GH9A 4X0XA 1K3YA 4F0CA 4POKA 4NHZA 1HNAA 3MAKA 1A2LA 3WD6A 2Z9SA 1J9BA 5B6NA 3HY2A 1T7PB 1AQWA 3F8UA 2JZRA 1OKTA 3GL3A 3TOTA 2B5YA 2H19A 3F63A 2VKZG 1K0NA 3PR8A 2ZNMA 4JR4A 3U5RE 4MJCA 4K7OA 4EUYA 5DAKB 1FW1A 4EL1A 4PQHA 1ZYQB 3F4TA 1YY7A 2HRNA 1X5DA 1HNCA 2CX4A 3KGKA 2HLSA 5F8BA 4YKGA 4OFNA 5GZZB 2ES7A 4KAEA 1WRYA 4OCFA 2HFDA 4BPYA 3HDCA 3TKRA 2DIZA 2FY6A 1V2AA 4JRRA 4TN8A 5HFIA 1GULA 2QSIA 2X8CA 2PVQA 3RPPA 3UEMA 2OKAA 3LQ7A 3VK9A 2L5LA 2KLXA 5J4YA 1PRXA 1WP0A 1V9WA 2M46A 4KF9A 3C1SA 3KTBA 4FYCA 2XHFA 1FB0A 1ZZYA 1YF1A 2YNXA 1TOFA 4ECCA 3FHKA 1GH2A 4L0UA 5L71A 1GUHA 3UVTA 19GSA 2CX3A 3KH7A 1Z7RA 2VLVA 4G0IA 3S9FA 2R37A 5A5KA 3V1WA 4K2XA 1PA3A 3TKSC 4N11A 4XIHA 2YWNA 3DEXA 1OKDA 1B4QA 1SJ6A 2B1LA 2GQMA 1J08A 4IKHA 5EY6A 2LQOA 3IE3A 4PNFA 4MJAA 3D21A 5D8IA 2N5BA 1BJXA 2C0FA 2QA2A 1XZOA 4TKYA 1XXUA 1JLWA 3LFLA 2IIYA 2GLRA 2MMOA 4K2DA 2C3TA 4CDOA 2A4HA 1GSUA 3KMNA 4OMVA 5A34B 4O5QA 3PGTA 2YWIA 2LSTA 3F3RA 4IP6A 1CQHA 4KSOA 4ICYA 2OE0A 3APQA 4WF5A 2DKIA 1GNEA 5DQSA 14GSA 1PX7A 5HFGA 1Y1UA 6GSTA 5CO3A 2IMFA 4Z2UA 4IP1A 1K0AA 1MD3A 3WT2A 2IFQB 2FCHA 4HUAA 2RM6A 4HS1A 6GSUA 3LXZA 2JSZA 5KOWA 1MTCA 3FK8A 2KP1A 3QFBC 1GL8A 2HYXA 2VLTA 5LD0A 3F3QA 4NPBA 5ENUA 3ZRDA 3L0HA 2H72A 4K0NA 3EMPA 3CSIA 4ZL7A 2KP2A 1SL1B 5HFKA 3H1NA 3CSHA 3LYPA 1TRVA 3BOAA 3I43A 1PMTA 2HSHA 1U3AA 1H75A 1O8XA 1UVZA 1IYIA 3I6AA 3MWHA 4PURA 2AAWA 2E2MA 1ZCPA 2V6KA 5B6MA 4MH3A 4WEYA 4O32A 2N5AA 9GSSA 2EIOA 3A5IA 1K0CA 3KIJA 3FZAA 3GA4A 2VUPA 4XHMA 1B48A 2VD1A 1XBSA 3VLNA 1NSWA 4OO4A 1QK8A 5CRDA 5A1NB 4WETA 1T4YA 1FO5A 1AAZA 4LL1B 3VI7A 4HZ4A 3FZ5A 1TRUA 4XS4A 5ECHB 1GSEA 4N10A 3HJPA 3EWLA 4HJ2A 3EINA 2CVKA 4ML6A 4DVCA 4JZQA 2YCDA 4K5RA 5IMFA 1U6TA 4ILFA 1EP8A 1B4PA 3TCOA 1T1VA 5E4WA 3ERGA 3N9JA 3IHGA 5D93A 2HRFA 4KDYA 2ZCTA 2HZFA 3DXBA 2GZPA 2QKEA 3TJJA 2XBQA 1BQ7A 2CV4A 4F0BA 1YZXA 1GWCA 3H93A 3CSJA 5J9BA 4BVXB 2GZYA 4EKZA 5C04A 2RIIA 1MEKA 4LLRA 1SVOA 5JCUA 4KE3A 3C73A 1FG4A 1F6MC 4HU9A 3QR6A 3MNGA 1NHOA 5DJMA 5F06A 4QL9A 1GTUA 1RK4A 3L9VA 2GZZA 2V6OA 3HCZA 4MMMA 5HQPA 3QMXA 4JU5A 1Q98A 1M2BA 4HEA2 4V1Ag 2B6MA 5IMDA 4IVFA 2O85A 4YQMA 2DKHA 4FYBA 1WJKA 3P7XA 3PINA 2WGRA 2VCTA 1SENA 3UBKA 2V2GA 3BCKA 1J0FA 1A8LA 4QQ7A 1LBKA 1VGLA 4QL7A 2K9FA 2HI7A 3DD3A 3CTGA 3DRNA 3E9JB 5KN3A 4KW6A 3ZIJA 4CHSA 3EU4A 4OFTA 2JZTA 3GN3A 4D73B 1O81A 4AKIA 4BA7A 4XTSA 5B8BA 1URMA 4H86A 4L0WA 1K0MA 1S3DA 3QPMA 2HSNA 5A4VA 5J40A 3A5WA 4JBBA 3ZZXA 1GTBA 1OC8A 2XPEA 3M1GA 1USBA 4G01A 2ZUPA 2IMKA 5IMAA 3ZTLA 1RW1A 3LW9A 2YANA 3CRTA 3HKRA 1R5PA 5J47A 1W89A 2C0GA 2P5QA 3C7MA 5DVBA 4EIQA 4NAXA 2O89A 2R0GA 3D4TA 1SL2B 3MIXA 5ECPB 3JCML 4HQZA 5GAND 4GXZA 2FLSA 2EIRA 1QMVA 3M9KA 3GIXA 3FMWA 2PUKC 3FZ9A 2LRCA 4ZBBA 1KEBA 1EGOA 3A2XA 3ED3A 2I4AA 1S3CA 2L59A 1EEMA 3TU3B 1O6JA 2JZSA 2UV8G 3KTLA 1PSQA 2VCWA 2B5XA 1TKDB 1I9DA 2A2RA 2DJ0A 4V2MA 4NHWA 5DAKA 2VCXA 4WR4A 2NPBA 3EVIA 2H71A 4GTUA 4ZB8A 5ELAA 1BF5A 4PTSA 2FA8A 1GNWA 2HSMB 1SK1A 2RM5A 1SKSB 3IBHA 4XRDA 2H70A 2BMXA 1TDIA 3LSZA 1ZL9A 2O5VA 5HR3A 3LYKA 2WJUA 1FAAA 2IMEA 3P90A 1MD4A 1R5AA 4GDFA 3VPTA 2MBSA 4IN0A 2B1KA 1FVJA 1DUGA 4L8EA 3IRAA 2H6ZA 4XS1A 4WBRD 2F8AA 3HVVA 4ZL8A 4LMWA 5AISA 1R26A 1TXUA 2AV4A 3IA1A 5IPHA 2IL3A 1K0OA 2ON7A 3DGQA 2TRXA 2X4AA 2MZCA 5IOWA 3TJFA 2YZHA 4TVEA 4GWRA 4K8MA 4YH2A 2VCVA 2JACA 4EXJA 1WIKA 2OBIA 4TR1B 1X9WB 5JWQB 3BD2A 2PU9C 1YEPA 4L5LA 2GTUA 5GAPD 1SD9A 5BMUA 1XFLA 1Z6NA 5ECSA 4EVMA 2K6VA 4J57E 2G2QA 4I8BA 3DKSA 3PPUA 5DCGA 2OE1A 2IMIA 3L78A 4TW5A 3EYTA 3QDNA 2DBCA 5IM9A 3EPTA 1JZOA 2GT6A 2VM1A 3F4SA 4AJ7A 4K1FA 5ID2B 4Q5RA 3EE2A 2X8GA 2IFQA 5FWGA 3FY7A 3KD0A 3ERFA 1F3BA 2OADA 1XWKA 1H4OA 2K18A 4ZB9A 1NM3A 3A3TA 2QA1A 1E6BA 1GSFA 3LWAA 4E8EA 2YZUA 1BAYA 1V40A 3DMLA 2CZ2A 4GCIA 2DIYA 4TR3A 10GSA 5F07A 3I9V2 2VLUA 5ECLB 3IV4A 1G0TA 4USSA 2WZ9A 3CWGA 1QXHA 3ZVJD 3O3TA 1GTIA 2V41A 2IMDA 1M2DA 3ZITA 5IO2A 1XCCA 5BRTA 1F2EA 3KP9A 4ZXGA 2I1UA 3APSA 4MJEA 2L4QA 4IGJA 5A1NA 3IAM2 2B7JA 2H76A 3TRPA 5COHA 2FGXA 4X43A 1JZDA 5KN2A 3BBYA 2DJ1A 5D9XA 5ECNB 3FZ4A 4MPGA 2HT9A 7GSSA 1ERVA 1A2JA 4IBPA 2WULA 2ON5A 2VD0A 2YV7A 2EFHA 3IK7A 2H1AA 3HMJG 2PWJA 4NWYA 4AKXB 4KCAA 4E68A 2PVOC 4G2EA 3KP8A 2PGTA 5BMUB 3IC8A 1TU8A 1K3OA 1PKZA 4PUAA 1M7TA 3VWUA 1FHEA 2GGTA 5IMZA 1R4WA 1E2YA 1RQMA 4BVXA 3F4RA 5IPGA 1F37A 2FD3A 2KHPA 3KCMA 5G2ZA 3APOA 2YPMA 4CY8A 4HQSA 4KGIA 2LNSA 2FWGA 1MDJA 2NDOA 5IMVA 1XW9A 1V58A 1ZGNA 1TW9A 3TRXA 2OJLA 2LTKA 3M3MA 1PKWA 4RQRA 3D22A 4K0GA 5DALA 3D0ZA 1CQGA 3VPQA 4LMVA 1VF4A 2GSTA 4Q5QA 4EF0A 1QUWA 1WE0A 3F6DA 5EL8A 3CMIA 3FR6A 1WPIA 2R0CA 4ID0A 4ML1A 2H1BA 2VL2C 1ZOFA 4DSSA 3HHVA 4AKHA 1GLPA 2CAQA 1NW2A 4GF0A 3HXSA 5J3RA 1AQVA 4MPFA 3A2VA 2H1DA 4POLA 4IELA 4IW9A 1YVLA 2FNOA 1ACVA 2BJXA 3RDWA 4MK3A 1XIYA 4WXTA 4Z7XA 3ZMLA 3M0FA 11GSA 5DBQA 4D73A 4N0ZA 3E0UA 1FVKA 3BJ5A 1X9MB 1A8YA 1TRSA 3UJ1A 5JCWA 1N25A 1GSQA 5CYYA 2DJ3A 2E0QA 4ISDA 4Q5FA 1SJIA 1YEXA 4YKFA 2M80A 3TKPA 5A4WA 3QAWA 1XVQA 4MZWA 2R4VA 1AQXA 3R3EA 3UOMA 2HSYA 4RQXA 2GQKA 20GSA 3HJOA 2VM2A 1F9MA 1V57A 1Z3EA 1TXXA 2CA8A 4PUFC 2LEGA 4MLYA 1PN0A 5E59A 3LXTA 2N5FA 5D73A 4AF2A 3ZFBA 2MBTA 1EV9A 1ZYNA 2PPTA 1AXDA 3O6TA 3UBLA 2K8SA 3ZL5A 1DSBA 3KH9A 2J9HA 1FOVA 2H1GA 4OWYA 1DE2A 3GFKA 2C3NA 3MDKA 1U3IA 1SJZA 1YDKA 1G7EA 5D9TA 2FWEA 4JR6A 2P31A 2VL3A 4ULXA 2HNLA 5KN1A 3Q18A 1BX9A 2WDUA 4F03A 1Y6EA 3U6VA 3E3EA 5DALB 2GQLA 1A0FA 3TOUA 3IK9A 4MA9A 2YV9A 3F0IA 4J56E 2HSMA 5A5HB 2AUVA 1O85A 1SK0A 3C8EA 2QGVA 4F82A 4GLTA 4DSSB 5CREA 2KOKA 2F8FA 5CAXA 2B7KA 2LRTA 5G30A 5D9VA 5G1KA 1M0UA 2TRCP 2DLXA 3TDGA 1C72A 3FRCA 2A2PA 4O5RA 1B8XA 1YJ6A 2OA7A 2C0EA 3LEFA 2GS3A 2HQTA 3P8WA 1SKRB 3FYGA 1HD2A 3TKSA 2BTOT 1XVWA 2A4VA 2REMA 3GNJA 3QAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y k;  1PQN A;  3VI5 A;  4HJM A;  3GH6 A;  2E7P A;  2K8V A;  4TR1 A;  4TR0 A;  3GSS A;  1GSY A;  3TUE A;  4ZIJ A;  1HQO A;  4F2I A;  1KNG A;  1PGT A;  5INY A;  4MF7 A;  4MAB A;  6GSW A;  3WGD A;  4EC0 A;  1EOH A;  4IJ3 A;  3UL3 A;  2B5E A;  3IR4 A;  2GSR A;  3WT1 A;  4DEJ A;  2YP6 A;  4N30 A;  2LRN A;  4PXO A;  2JAD A;  1X9S B;  5ECK B;  1EP7 A;  4KSM A;  2H0G A;  1OE7 A;  3CYN A;  2PER A;  5ID2 A;  3K8N A;  4NMU A;  4HZ2 A;  2P5R A;  3PH9 A;  2X99 A;  3ME7 A;  1GSS A;  1K0D A;  4MF5 A;  2LJA A;  5ECO B;  2JSY A;  1LJR A;  2WFC A;  5G5F A;  6GSX A;  3IAS 2;  3KEB A;  3GUS A;  4HDE A;  17GS A;  3VFI A;  3GRX A;  4LA1 A;  5G1L A;  5J5N A;  3RHC A;  2GSS A;  4BWQ A;  4BVY B;  8GSS A;  2LJR A;  2HRK B;  3D5J A;  3TGZ A;  3W8S A;  4MZB A;  3LOR A;  4KA0 A;  1K0B A;  4JE1 A;  4YAP A;  4N0V A;  4RI7 A;  5H5S A;  5CRG A;  3KJY A;  2L6C A;  1GTA A;  4POB A;  2LNT A;  3H79 A;  3QD9 A;  3BCI A;  4FQU A;  3EUR A;  3UAP A;  2VO4 A;  2X64 A;  5HR1 A;  4OFM A;  3IC4 A;  1XOA A;  4ZBA A;  1WMJ A;  1X0R A;  2OBK A;  2H66 A;  3VWX A;  1SL0 B;  1XW5 A;  3P2A A;  1FB6 A;  2G0F A;  3DIE A;  4J2F A;  5LNK e;  13GS A;  3F6F A;  2FWH A;  3HJM A;  2YWO A;  4NV5 A;  3QFA C;  1A23 A;  4EDZ A;  2P0G A;  1A24 A;  1W4V A;  3LJR A;  2VL9 A;  4V1A p;  1YF0 A;  3G7J A;  2WCI A;  3M8N A;  2EIQ A;  2GSQ A;  4NV2 A;  4I2T A;  4ZL9 A;  5FT3 A;  4TXV A;  2CVB A;  1Q4J A;  5EVO A;  1AUC A;  4KB3 A;  1QFN A;  3GX0 A;  5FHI A;  2L5O A;  5J4U A;  2VIM A;  1R7H A;  1SYR A;  2H8L A;  2CT6 A;  4PQ1 A;  1PX6 A;  1M9B A;  5C00 A;  2IWT A;  2NBS A;  2DML A;  3EMX A;  4K9Z A;  4ACS A;  4HU7 A;  4ZIL A;  5CP1 A;  3CRU A;  2DC5 A;  2RLI A;  4GSN A;  1OC3 A;  1BYE A;  3EU3 A;  3G7I A;  3N5O A;  4GRF A;  2RUF A;  3RAZ A;  4PQI A;  6GSV A;  2C0D A;  5G31 A;  1GUK A;  5ECM B;  3L9S A;  3KM6 A;  3QAG A;  3GKN A;  3GKX A;  3TJK A;  3SBC A;  2OAC A;  1OYJ A;  1QQ2 A;  3HYP A;  2H6X A;  3ISO A;  4HI7 A;  4I2U A;  1SD8 A;  1KTE A;  2F51 A;  2FUG 2;  2WRT A;  2WB9 A;  3TB2 A;  3CTF A;  1GP1 A;  5J9C A;  2HZE B;  2YOI A;  3VWW A;  5A4U A;  1O8W A;  4MDC A;  2MMN A;  5HR0 A;  3KXO A;  5LCZ A;  3GYK A;  1Z7P A;  2F9S A;  2KUC A;  2LV3 A;  2XC2 A;  1XWB A;  2UZ8 A;  3SWL A;  5ABR A;  4TXO A;  4I97 A;  1JHB A;  5ECR B;  5CNW A;  3H8Q A;  4MCU A;  3NIV A;  4OO5 A;  1XWC A;  4ECI A;  1M9A A;  4GSS A;  3LGC A;  2GT5 A;  4XS6 A;  2H0I A;  1TRW A;  5ECQ B;  1DE1 A;  4YAV A;  2H0H A;  1U88 A;  2DMM A;  3HVS A;  2I9H A;  1SKW B;  2CAI A;  1OAZ A;  1O73 A;  2LQQ A;  1Y25 A;  1U87 A;  5EPF A;  5IOX A;  2XBI A;  5JWO B;  1PN9 A;  4O7H A;  1TTZ A;  1A2M A;  5B7C A;  4KUN A;  1ST9 A;  5IO0 A;  5DQY A;  1ABA A;  4MZC A;  1PL2 A;  3CXG A;  2JL4 A;  4K6X A;  2FA4 A;  4EE0 A;  2DSA A;  4OCE A;  4KDU A;  4BL7 A;  3FR9 A;  1HNB A;  2MMZ A;  1T8E B;  2MMA A;  4PGT A;  2WS2 A;  3GKM A;  2VCQ A;  1TI3 A;  2H30 A;  5JWR B;  2C3Q A;  5D9W A;  5G5E A;  2CQ9 A;  1QGV A;  2NVL A;  1WWJ A;  2RUE A;  5DDL A;  1Z6M A;  3W8J A;  1XWA A;  5D96 A;  4EDY A;  1SYX A;  3UAR A;  1N8J A;  1JZR A;  3ME8 A;  2TIR A;  3IOS A;  5F0G A;  2YJH A;  1XWG A;  1EWX A;  2VOC A;  3W6G A;  1TK8 B;  2L4C A;  4BWS A;  1DBY A;  4O92 A;  1WOU A;  4WBJ A;  1XPV A;  4TXO B;  4KND A;  1ZYE A;  2CVD A;  4AJ8 A;  3KZQ A;  5IQY A;  4E8H A;  1ZMA A;  4I6X A;  5KN0 A;  2O8V B;  5AIV A;  4IQ1 A;  3L4N A;  5JCG A;  1X5E A;  3FR3 A;  4MF6 A;  2V32 A;  2HRA A;  3C71 A;  3GV1 A;  1XOB A;  3GUR A;  4IJI A;  3GTU A;  1OC9 A;  2L6D A;  2LUS A;  2R3X A;  4IS0 A;  4XCS A;  2O7K A;  1UC7 A;  2F3M A;  1TI1 A;  5AGY A;  2H01 A;  3US3 A;  3DYR A;  3ZVJ A;  4MH2 A;  3NZN A;  3AY8 A;  4DSR A;  2ALB A;  1VRS D;  3RPN A;  1EOG A;  3WGX A;  4FYU A;  2R5G A;  2E2G A;  2JU5 A;  4RUV A;  1B9Y C;  3HA9 A;  2CZ3 A;  3RBT A;  4YQV A;  3NOF A;  4Q5N A;  3UMA A;  4AGS A;  1EZK A;  1JZW A;  4ECB A;  3FEU A;  1OE8 A;  2O87 A;  1GLQ A;  3UIW A;  2DJK A;  4BL7 B;  3IDV A;  4KH7 A;  1ERU A;  3CBU A;  2GDR A;  2AB6 A;  3O76 A;  4TOP A;  1V98 A;  2A2S A;  4TR4 A;  1YKC A;  2R2J A;  1EEJ A;  1THX A;  1N2A A;  1JFU A;  3QCP A;  5IMC A;  4WKW A;  3J7Y b;  1PD2 1;  3GMF A;  1MDK A;  1TK0 B;  4G10 A;  4LL4 B;  1ML6 A;  1T4Z A;  4FH8 A;  5H5R A;  4MP4 A;  4BVY A;  3M9J A;  2H73 A;  2MYG A;  4EO3 A;  4WR5 A;  1TK5 B;  4V2L A;  2HRK A;  1UN2 A;  3HZ4 A;  4KCE A;  4V2N A;  3GST A;  3H4K A;  1THO A;  2QC7 A;  3GKK A;  5H5Q A;  1ERT A;  1B9X C;  4RI6 A;  2NTO A;  4CW9 A;  2LS5 A;  3D6I A;  2J23 A;  1YKA A;  4DSQ A;  1AW9 A;  3OR5 A;  2C80 A;  2DJJ A;  1G6Y A;  3TKQ A;  1M2A A;  3TJB A;  5AN1 A;  4AJ6 A;  16GS A;  4K7N A;  3ZRE A;  1EGR A;  18GS A;  4FO5 A;  2YWM A;  3G9B A;  1UA5 A;  1VF2 A;  5DJL A;  4NXI A;  6GSY A;  4GST A;  12GS A;  1T00 A;  3GTU B;  2DJ2 A;  6GSS A;  5B8A A;  5DCH A;  1OC9 B;  5KEJ A;  1ON4 A;  3IHQ A;  4XS4 B;  5HR2 A;  3GHA A;  4MJB A;  2LKU A;  1YQ1 A;  1SK2 A;  3R2Q A;  2FHE A;  4POM A;  4HOJ A;  1GSD A;  3Q74 A;  4KX4 A;  2B3S A;  2C8U A;  2C4J A;  3Q19 A;  1Z5Y E;  3C1R A;  3WYW A;  2H75 A;  1BG5 A;  2AHE A;  2XPD A;  2AJQ B;  2OE3 A;  3TJG A;  1T3B A;  3IXR A;  4JED A;  2GVP A;  4PX1 A;  1G7O A;  1LU4 A;  2HE3 A;  4G19 A;  1MDI A;  2PBJ A;  1A0R P;  5ECI B;  4IQA A;  2VCZ A;  2YN1 A;  2I81 A;  3GL5 A;  3TRQ A;  2IN3 A;  3HD5 A;  1AIU A;  2FWF A;  2HXK A;  3FW2 A;  4GQF A;  4K7I A;  1VF1 A;  5CRW A;  3MSZ A;  3ZIV A;  3HVX A;  3ZFL A;  5J41 A;  1KBN A;  1K3L A;  3DVW A;  4P3Y B;  4YQU A;  1SU9 A;  5GSS A;  4I5Q A;  1OVN A;  2X8H A;  4OD7 A;  2VL2 A;  3L9U A;  3GX8 A;  4G0K A;  1BED A;  4KDX A;  2AYT A;  4IHU A;  2H6Y A;  1TJD A;  2HZE A;  4ZB6 A;  1M99 A;  3VUR A;  4ZBD A;  4WF4 A;  2YJ7 A;  3I69 A;  3RHB A;  2I3Y A;  3A2W A;  1ERW A;  1X5C A;  3D4M A;  4TRX A;  2IPA A;  4XRA A;  4G9H A;  3KMO A;  22GS A;  1GRX A;  1AC1 A;  4GQC A;  2H74 A;  4L5O A;  1PL1 A;  2PN8 A;  5AIX A;  4ECJ A;  3Q6O A;  1IYH A;  2VAF A;  1HYU A;  3ZYW A;  1ILO A;  3TKS E;  1G6W A;  1Z9H A;  5CRH A;  1O7U A;  3VWV A;  2IJY A;  3FKF A;  1F3A A;  1NHY A;  2PMT A;  3DVX A;  1JLV A;  1I5G A;  5F05 A;  3ZMK A;  3IPZ A;  1TP9 A;  2EC4 A;  2HSN B;  2M72 A;  1TU7 A;  4FIW A;  1XW6 A;  3EC3 A;  3WGE A;  3F9U A;  2LJK A;  3UVH A;  2C1Y A;  2L57 A;  3DWV A;  3ERW A;  2R6K A;  4PNG A;  4F9Z A;  4X1U A;  5GST A;  1S3A A;  1GUM A;  3HZ8 A;  1VF3 A;  4G0L A;  3QOU A;  2V1M A;  3G7Y A;  3ZLP A;  2D2Z A;  1EV4 A;  5ELG A;  5IIZ A;  3LG6 A;  3GH9 A;  4X0X A;  1K3Y A;  4F0C A;  4POK A;  4NHZ A;  1HNA A;  3MAK A;  1A2L A;  3WD6 A;  2Z9S A;  1J9B A;  5B6N A;  3HY2 A;  1T7P B;  1AQW A;  3F8U A;  2JZR A;  1OKT A;  3GL3 A;  3TOT A;  2B5Y A;  2H19 A;  3F63 A;  1K0N A;  3PR8 A;  2ZNM A;  4JR4 A;  3U5R E;  4MJC A;  4K7O A;  4EUY A;  5DAK B;  1FW1 A;  4EL1 A;  4PQH A;  1ZYQ B;  3F4T A;  1YY7 A;  2HRN A;  1X5D A;  1HNC A;  2CX4 A;  3KGK A;  2HLS A;  5F8B A;  4OFN A;  5GZZ B;  2ES7 A;  4KAE A;  1WRY A;  4OCF A;  2HFD A;  4BPY A;  3HDC A;  3TKR A;  2DIZ A;  2FY6 A;  1V2A A;  4JRR A;  4TN8 A;  5HFI A;  1GUL A;  2QSI A;  2X8C A;  2PVQ A;  3RPP A;  3UEM A;  2OKA A;  3LQ7 A;  3VK9 A;  2L5L A;  2KLX A;  1PRX A;  1WP0 A;  1V9W A;  2M46 A;  4KF9 A;  3C1S A;  3KTB A;  4FYC A;  2XHF A;  1FB0 A;  1ZZY A;  1YF1 A;  2YNX A;  1TOF A;  4ECC A;  3FHK A;  1GH2 A;  4L0U A;  5L71 A;  1GUH A;  3UVT A;  19GS A;  2CX3 A;  3KH7 A;  1Z7R A;  2VLV A;  4G0I A;  3S9F A;  2R37 A;  5A5K A;  3V1W A;  1PA3 A;  3TKS C;  4N11 A;  4XIH A;  2YWN A;  3DEX A;  1OKD A;  1B4Q A;  1SJ6 A;  2B1L A;  2GQM A;  1J08 A;  4IKH A;  5EY6 A;  2LQO A;  3IE3 A;  4PNF A;  4MJA A;  3D21 A;  5D8I A;  2N5B A;  1BJX A;  2C0F A;  1XZO A;  4TKY A;  1XXU A;  1JLW A;  3LFL A;  2IIY A;  2GLR A;  2MMO A;  4K2D A;  2C3T A;  4CDO A;  1GSU A;  3KMN A;  4OMV A;  3PGT A;  2YWI A;  2LST A;  3F3R A;  4IP6 A;  1CQH A;  4KSO A;  2OE0 A;  3APQ A;  4WF5 A;  1GNE A;  5DQS A;  14GS A;  1PX7 A;  5HFG A;  6GST A;  5CO3 A;  2IMF A;  4IP1 A;  1K0A A;  1MD3 A;  3WT2 A;  2IFQ B;  2FCH A;  4HUA A;  2RM6 A;  4HS1 A;  6GSU A;  3LXZ A;  2JSZ A;  1MTC A;  3FK8 A;  2KP1 A;  3QFB C;  1GL8 A;  2HYX A;  2VLT A;  5LD0 A;  3F3Q A;  4NPB A;  5ENU A;  3ZRD A;  3L0H A;  2H72 A;  4K0N A;  3EMP A;  3CSI A;  4ZL7 A;  2KP2 A;  1SL1 B;  5HFK A;  3H1N A;  3CSH A;  3LYP A;  1TRV A;  3BOA A;  3I43 A;  1PMT A;  2HSH A;  1U3A A;  1H75 A;  1O8X A;  1UVZ A;  1IYI A;  3I6A A;  3MWH A;  4PUR A;  2AAW A;  2E2M A;  1ZCP A;  2V6K A;  5B6M A;  4MH3 A;  4WEY A;  4O32 A;  2N5A A;  9GSS A;  2EIO A;  3KIJ A;  1K0C A;  3FZA A;  3GA4 A;  2VUP A;  4XHM A;  1B48 A;  2VD1 A;  1XBS A;  3VLN A;  1NSW A;  4OO4 A;  1QK8 A;  5CRD A;  4WET A;  1T4Y A;  1FO5 A;  1AAZ A;  4LL1 B;  3VI7 A;  4HZ4 A;  3FZ5 A;  1TRU A;  4XS4 A;  5ECH B;  1GSE A;  4N10 A;  3HJP A;  3EWL A;  4HJ2 A;  3EIN A;  2CVK A;  4ML6 A;  4DVC A;  4JZQ A;  2YCD A;  5IMF A;  1U6T A;  4ILF A;  1EP8 A;  1B4P A;  3TCO A;  1T1V A;  5E4W A;  3ERG A;  3N9J A;  5D93 A;  2HRF A;  4KDY A;  2ZCT A;  2HZF A;  3DXB A;  2GZP A;  2QKE A;  3TJJ A;  2XBQ A;  1BQ7 A;  2CV4 A;  4F0B A;  1YZX A;  1GWC A;  3H93 A;  3CSJ A;  5J9B A;  4BVX B;  2GZY A;  4EKZ A;  5C04 A;  2RII A;  1MEK A;  4LLR A;  5JCU A;  4KE3 A;  3C73 A;  1FG4 A;  1F6M C;  4HU9 A;  3QR6 A;  3MNG A;  1NHO A;  5DJM A;  5F06 A;  4QL9 A;  1GTU A;  1RK4 A;  3L9V A;  2GZZ A;  2V6O A;  3HCZ A;  4MMM A;  5HQP A;  3QMX A;  4JU5 A;  1Q98 A;  1M2B A;  4HEA 2;  4V1A g;  2B6M A;  5IMD A;  4IVF A;  2O85 A;  4YQM A;  4FYB A;  1WJK A;  3P7X A;  3PIN A;  2WGR A;  2VCT A;  1SEN A;  3UBK A;  2V2G A;  3BCK A;  1J0F A;  1A8L A;  4QQ7 A;  1LBK A;  1VGL A;  4QL7 A;  2K9F A;  2HI7 A;  3DD3 A;  3CTG A;  3DRN A;  3E9J B;  5KN3 A;  4KW6 A;  3ZIJ A;  4CHS A;  3EU4 A;  4OFT A;  2JZT A;  3GN3 A;  4D73 B;  1O81 A;  4BA7 A;  4XTS A;  5B8B A;  1URM A;  4H86 A;  4L0W A;  1K0M A;  1S3D A;  3QPM A;  5A4V A;  3A5W A;  4JBB A;  3ZZX A;  1GTB A;  1OC8 A;  2XPE A;  3M1G A;  1USB A;  2ZUP A;  2IMK A;  5IMA A;  3ZTL A;  1RW1 A;  2YAN A;  3CRT A;  3HKR A;  1R5P A;  1W89 A;  2C0G A;  2P5Q A;  3C7M A;  5DVB A;  4NAX A;  2O89 A;  3D4T A;  1SL2 B;  5ECP B;  3JCM L;  4HQZ A;  5GAN D;  4GXZ A;  2FLS A;  2EIR A;  1QMV A;  3M9K A;  3GIX A;  2PUK C;  3FZ9 A;  2LRC A;  4ZBB A;  1KEB A;  1EGO A;  3A2X A;  3ED3 A;  2I4A A;  1S3C A;  2L59 A;  1EEM A;  1O6J A;  2JZS A;  3KTL A;  1PSQ A;  2VCW A;  2B5X A;  1TKD B;  1I9D A;  2A2R A;  2DJ0 A;  4V2M A;  4NHW A;  5DAK A;  2VCX A;  4WR4 A;  2NPB A;  3EVI A;  2H71 A;  4GTU A;  4ZB8 A;  5ELA A;  4PTS A;  2FA8 A;  1GNW A;  2HSM B;  1SK1 A;  2RM5 A;  1SKS B;  3IBH A;  4XRD A;  2H70 A;  2BMX A;  1TDI A;  3LSZ A;  1ZL9 A;  5HR3 A;  3LYK A;  2WJU A;  1FAA A;  2IME A;  3P90 A;  1MD4 A;  1R5A A;  3VPT A;  2MBS A;  4IN0 A;  2B1K A;  1FVJ A;  1DUG A;  4L8E A;  3IRA A;  2H6Z A;  4XS1 A;  4WBR D;  2F8A A;  3HVV A;  4ZL8 A;  4LMW A;  5AIS A;  1R26 A;  2AV4 A;  3IA1 A;  5IPH A;  2IL3 A;  1K0O A;  2ON7 A;  3DGQ A;  2TRX A;  2MZC A;  5IOW A;  3TJF A;  2YZH A;  4TVE A;  4GWR A;  4K8M A;  4YH2 A;  2VCV A;  2JAC A;  4EXJ A;  1WIK A;  2OBI A;  4TR1 B;  1X9W B;  5JWQ B;  3BD2 A;  2PU9 C;  1YEP A;  4L5L A;  2GTU A;  5GAP D;  1SD9 A;  5BMU A;  1XFL A;  1Z6N A;  5ECS A;  4EVM A;  2K6V A;  4J57 E;  2G2Q A;  4I8B A;  3DKS A;  3PPU A;  5DCG A;  2OE1 A;  2IMI A;  3L78 A;  4TW5 A;  3EYT A;  3QDN A;  2DBC A;  5IM9 A;  1JZO A;  2GT6 A;  2VM1 A;  3F4S A;  4AJ7 A;  4K1F A;  5ID2 B;  4Q5R A;  3EE2 A;  2X8G A;  2IFQ A;  5FWG A;  3FY7 A;  3KD0 A;  3ERF A;  1F3B A;  2OAD A;  1XWK A;  1H4O A;  2K18 A;  4ZB9 A;  1NM3 A;  3A3T A;  1E6B A;  1GSF A;  3LWA A;  4E8E A;  2YZU A;  1BAY A;  1V40 A;  3DML A;  2CZ2 A;  4GCI A;  2DIY A;  4TR3 A;  10GS A;  5F07 A;  3I9V 2;  2VLU A;  5ECL B;  3IV4 A;  1G0T A;  4USS A;  2WZ9 A;  1QXH A;  3ZVJ D;  3O3T A;  1GTI A;  2V41 A;  2IMD A;  1M2D A;  3ZIT A;  5IO2 A;  1XCC A;  1F2E A;  3KP9 A;  4ZXG A;  2I1U A;  3APS A;  4MJE A;  2L4Q A;  4IGJ A;  3IAM 2;  2B7J A;  2H76 A;  3TRP A;  5COH A;  2FGX A;  4X43 A;  1JZD A;  5KN2 A;  3BBY A;  2DJ1 A;  5D9X A;  5ECN B;  3FZ4 A;  4MPG A;  2HT9 A;  7GSS A;  1ERV A;  1A2J A;  4IBP A;  2WUL A;  2ON5 A;  2VD0 A;  2YV7 A;  3IK7 A;  2H1A A;  2PWJ A;  4NWY A;  4KCA A;  2PVO C;  4G2E A;  3KP8 A;  2PGT A;  3IC8 A;  1TU8 A;  1K3O A;  1PKZ A;  4PUA A;  1M7T A;  3VWU A;  1FHE A;  2GGT A;  5IMZ A;  1R4W A;  1E2Y A;  1RQM A;  4BVX A;  3F4R A;  5IPG A;  1F37 A;  2FD3 A;  2KHP A;  3KCM A;  5G2Z A;  3APO A;  2YPM A;  4HQS A;  4KGI A;  2LNS A;  2FWG A;  1MDJ A;  2NDO A;  5IMV A;  1XW9 A;  1V58 A;  1ZGN A;  1TW9 A;  3TRX A;  2OJL A;  2LTK A;  3M3M A;  1PKW A;  4RQR A;  3D22 A;  4K0G A;  5DAL A;  3D0Z A;  1CQG A;  3VPQ A;  4LMV A;  1VF4 A;  2GST A;  4Q5Q A;  4EF0 A;  1QUW A;  1WE0 A;  3F6D A;  5EL8 A;  3CMI A;  3FR6 A;  1WPI A;  4ID0 A;  4ML1 A;  2H1B A;  2VL2 C;  1ZOF A;  4DSS A;  3HHV A;  1GLP A;  2CAQ A;  1NW2 A;  4GF0 A;  3HXS A;  5J3R A;  1AQV A;  4MPF A;  3A2V A;  2H1D A;  4POL A;  4IEL A;  4IW9 A;  2FNO A;  1ACV A;  2BJX A;  3RDW A;  4MK3 A;  1XIY A;  4WXT A;  4Z7X A;  3ZML A;  3M0F A;  11GS A;  5DBQ A;  4D73 A;  4N0Z A;  3E0U A;  1FVK A;  3BJ5 A;  1X9M B;  1A8Y A;  1TRS A;  3UJ1 A;  5JCW A;  1GSQ A;  5CYY A;  2DJ3 A;  2E0Q A;  4ISD A;  4Q5F A;  1SJI A;  1YEX A;  2M80 A;  3TKP A;  5A4W A;  3QAW A;  1XVQ A;  4MZW A;  2R4V A;  1AQX A;  3R3E A;  3UOM A;  2HSY A;  4RQX A;  2GQK A;  20GS A;  3HJO A;  2VM2 A;  1F9M A;  1V57 A;  1Z3E A;  1TXX A;  2CA8 A;  4PUF C;  2LEG A;  4MLY A;  5E59 A;  3LXT A;  2N5F A;  5D73 A;  4AF2 A;  3ZFB A;  2MBT A;  1EV9 A;  2PPT A;  1AXD A;  3O6T A;  3UBL A;  2K8S A;  3ZL5 A;  1DSB A;  3KH9 A;  2J9H A;  1FOV A;  2H1G A;  4OWY A;  1DE2 A;  3GFK A;  2C3N A;  3MDK A;  1U3I A;  1SJZ A;  1YDK A;  1G7E A;  5D9T A;  2FWE A;  4JR6 A;  2P31 A;  2VL3 A;  4ULX A;  2HNL A;  5KN1 A;  3Q18 A;  1BX9 A;  2WDU A;  4F03 A;  1Y6E A;  3U6V A;  3E3E A;  5DAL B;  2GQL A;  1A0F A;  3TOU A;  3IK9 A;  4MA9 A;  2YV9 A;  3F0I A;  4J56 E;  2HSM A;  2AUV A;  1O85 A;  1SK0 A;  3C8E A;  2QGV A;  4F82 A;  4GLT A;  4DSS B;  5CRE A;  2KOK A;  2F8F A;  5CAX A;  2B7K A;  2LRT A;  5G30 A;  5D9V A;  5G1K A;  1M0U A;  2TRC P;  2DLX A;  3TDG A;  1C72 A;  3FRC A;  4O5R A;  1B8X A;  1YJ6 A;  2OA7 A;  2C0E A;  3LEF A;  2GS3 A;  2HQT A;  3P8W A;  1SKR B;  3FYG A;  1HD2 A;  3TKS A;  2BTO T;  1XVW A;  2A4V A;  2REM A;  3GNJ A;  3QAV A; 
#chains in the Genus database with same CATH topology
 4N3Z A;  4A5P A;  3J7Y k;  1PQN A;  3VI5 A;  4HJM A;  1BG1 A;  3GH6 A;  2OT3 A;  2E7P A;  2K8V A;  4TR1 A;  4TR0 A;  3GSS A;  1GSY A;  3TUE A;  4ZIJ A;  1HQO A;  4F2I A;  1KNG A;  1PGT A;  5INY A;  4MF7 A;  4MAB A;  6GSW A;  1YEW C;  3WGD A;  4EC0 A;  1EOH A;  4IJ3 A;  3UL3 A;  2B5E A;  3IR4 A;  2GSR A;  3WT1 A;  4DEJ A;  2YP6 A;  4N30 A;  2LRN A;  4PXO A;  2JAD A;  1X9S B;  5ECK B;  1EP7 A;  4KSM A;  2H0G A;  1OE7 A;  3CYN A;  2PER A;  5ID2 A;  3K8N A;  4NMU A;  4HZ2 A;  2P5R A;  3PH9 A;  2X99 A;  4Z2T A;  3ME7 A;  1GSS A;  1K0D A;  4MF5 A;  2LJA A;  5ECO B;  2JSY A;  1LJR A;  2WFC A;  5G5F A;  6GSX A;  3IAS 2;  3KEB A;  3GUS A;  4HDE A;  17GS A;  3VFI A;  3GRX A;  4LA1 A;  5G1L A;  5J5N A;  3RHC A;  2GSS A;  4BWQ A;  4BVY B;  2EFC A;  8GSS A;  2LJR A;  2HRK B;  3D5J A;  3TGZ A;  3W8S A;  4MZB A;  4O5U A;  3LOR A;  4KA0 A;  1K0B A;  4JE1 A;  4YAP A;  4N0V A;  4RI7 A;  5H5S A;  5CRG A;  3KJY A;  2L6C A;  1GTA A;  4POB A;  2LNT A;  3H79 A;  3QD9 A;  3BCI A;  4FQU A;  3EUR A;  3UAP A;  2VO4 A;  2X64 A;  5HR1 A;  4OFM A;  3IC4 A;  1XOA A;  4ZBA A;  1WMJ A;  1X0R A;  2OBK A;  2H66 A;  3VWX A;  1SL0 B;  1XW5 A;  3P2A A;  1FB6 A;  2G0F A;  3DIE A;  4J2F A;  5LNK e;  13GS A;  3F6F A;  2FWH A;  3HJM A;  2YWO A;  4NV5 A;  3QFA C;  1A23 A;  4EDZ A;  2P0G A;  1A24 A;  1W4V A;  3LJR A;  2VL9 A;  4V1A p;  1YF0 A;  3G7J A;  2WCI A;  3M8N A;  2EIQ A;  2GSQ A;  4NV2 A;  4I2T A;  4ZL9 A;  5FT3 A;  4TXV A;  2CVB A;  1Q4J A;  1FOH A;  5EVO A;  1AUC A;  4KB3 A;  1QFN A;  3GX0 A;  5FHI A;  2L5O A;  5J4U A;  2VIM A;  1M3I A;  1R7H A;  1SYR A;  2H8L A;  2CT6 A;  4PQ1 A;  1PX6 A;  1M9B A;  5C00 A;  2IWT A;  2NBS A;  2DML A;  3EMX A;  4K9Z A;  4ACS A;  4HU7 A;  4ZIL A;  5CP1 A;  3CRU A;  2DC5 A;  2RLI A;  4GSN A;  1OC3 A;  1BYE A;  3EU3 A;  3G7I A;  3N5O A;  4GRF A;  2RUF A;  3RAZ A;  4PQI A;  6GSV A;  4AKG A;  2C0D A;  5G31 A;  1GUK A;  5ECM B;  3L9S A;  1M3J A;  3KM6 A;  3QAG A;  3GKN A;  3GKX A;  3TJK A;  3SBC A;  2OAC A;  1OYJ A;  1QQ2 A;  3HYP A;  2H6X A;  3ISO A;  4HI7 A;  4I2U A;  1SD8 A;  1KTE A;  2F51 A;  2FUG 2;  2WRT A;  5KOX A;  2WB9 A;  5J4V A;  1XG8 A;  3TB2 A;  3CTF A;  1GP1 A;  5J9C A;  2HZE B;  2YOI A;  3VWW A;  5A4U A;  1O8W A;  4MDC A;  2MMN A;  5HR0 A;  3KXO A;  5LCZ A;  3GYK A;  1Z7P A;  2F9S A;  2KUC A;  2LV3 A;  2XC2 A;  1XWB A;  4AI6 A;  2UZ8 A;  3SWL A;  5ABR A;  4TXO A;  4I97 A;  1JHB A;  5ECR B;  5CNW A;  3H8Q A;  2WVY A;  4MCU A;  3NIV A;  4OO5 A;  1XWC A;  4ECI A;  1M9A A;  4GSS A;  3LGC A;  2GT5 A;  4XS6 A;  2H0I A;  1TRW A;  5ECQ B;  1DE1 A;  4YAV A;  2H0H A;  1U88 A;  2DMM A;  3HVS A;  2I9H A;  4EIP A;  1SKW B;  2CAI A;  1OAZ A;  1O73 A;  2LQQ A;  1Y25 A;  1U87 A;  5EPF A;  5IOX A;  2XBI A;  5JWO B;  1PN9 A;  4O7H A;  1TTZ A;  2H1L A;  1A2M A;  5B7C A;  4KUN A;  1ST9 A;  5IO0 A;  5DQY A;  1ABA A;  4MZC A;  1PL2 A;  3CXG A;  2JL4 A;  4K6X A;  2FA4 A;  1ZYP A;  4EE0 A;  2DSA A;  4OCE A;  4KDU A;  4BL7 A;  3FR9 A;  1HNB A;  2MMZ A;  1SVL A;  1T8E B;  2WZS A;  2MMA A;  4PGT A;  2WS2 A;  3GKM A;  2VCQ A;  1TI3 A;  2R0P A;  2H30 A;  5JWR B;  2C3Q A;  5D9W A;  5G5E A;  2CQ9 A;  1QGV A;  2NVL A;  1WWJ A;  2RUE A;  5DDL A;  1Z6M A;  3W8J A;  2X49 A;  1XWA A;  5D96 A;  4EDY A;  1SYX A;  3UAR A;  1N8J A;  1JZR A;  3ME8 A;  2TIR A;  3IOS A;  5A5H A;  5F0G A;  2YJH A;  1XWG A;  1EWX A;  2VOC A;  3W6G A;  4QMK A;  1TK8 B;  2L4C A;  4BWS A;  1DBY A;  4O92 A;  1WOU A;  4WBJ A;  1XPV A;  4TXO B;  4KND A;  1ZYE A;  2CVD A;  4AJ8 A;  3KZQ A;  5IQY A;  4E8H A;  1ZMA A;  4I6X A;  5KN0 A;  2O8V B;  1SVM A;  4IQ1 A;  5AIV A;  3L4N A;  2EFD A;  5JCG A;  1X5E A;  3FR3 A;  4MF6 A;  2V32 A;  2HRA A;  3C71 A;  3GV1 A;  1XOB A;  3GUR A;  4IJI A;  3GTU A;  1OC9 A;  2L6D A;  2LUS A;  2R3X A;  4CY6 A;  4IS0 A;  4XCS A;  2O7K A;  1UC7 A;  2F3M A;  1TI1 A;  5AGY A;  2H01 A;  3US3 A;  3DYR A;  3ZVJ A;  4MH2 A;  3NZN A;  3AY8 A;  4DSR A;  2ALB A;  1VRS D;  3RPN A;  1EOG A;  3WGX A;  4FYU A;  2R5G A;  2E2G A;  2JU5 A;  4RUV A;  1B9Y C;  3HA9 A;  2CZ3 A;  3RBT A;  4YQV A;  3NOF A;  4Q5N A;  3UMA A;  4AGS A;  1EZK A;  1JZW A;  4ECB A;  3FEU A;  4X4J A;  1OE8 A;  2O87 A;  3MYD A;  1GLQ A;  3UIW A;  2DJK A;  4BL7 B;  3IDV A;  4KH7 A;  1ERU A;  3CBU A;  2GDR A;  4MNN A;  2AB6 A;  3O76 A;  4TOP A;  3CHX C;  1V98 A;  2A2S A;  4TR4 A;  4BIK A;  1YKC A;  3RFR C;  2R2J A;  1EEJ A;  1THX A;  1N2A A;  1JFU A;  3QCP A;  5IMC A;  4WKW A;  3J7Y b;  1PD2 1;  3GMF A;  1MDK A;  1TK0 B;  4G10 A;  4LL4 B;  1ML6 A;  1T4Z A;  4FH8 A;  5H5R A;  4MP4 A;  4BVY A;  3M9J A;  2H73 A;  2MYG A;  4EO3 A;  4WR5 A;  1TK5 B;  4V2L A;  2HRK A;  1UN2 A;  3HZ4 A;  4KCE A;  2EFE A;  3GST A;  4V2N A;  3H4K A;  1THO A;  2QC7 A;  3GKK A;  5H5Q A;  1ERT A;  1B9X C;  4RI6 A;  2NTO A;  4CW9 A;  2LS5 A;  3D6I A;  2J23 A;  1YKA A;  4DSQ A;  4ZB7 A;  1AW9 A;  3OR5 A;  2C80 A;  2DJJ A;  1G6Y A;  3TKQ A;  1M2A A;  3TJB A;  2WVZ A;  5AN1 A;  4AJ6 A;  16GS A;  4K7N A;  3ZRE A;  1EGR A;  18GS A;  4FO5 A;  2YWM A;  3G9B A;  1UA5 A;  1VF2 A;  5DJL A;  4NXI A;  6GSY A;  4GST A;  12GS A;  1T00 A;  3GTU B;  2DJ2 A;  6GSS A;  5B8A A;  5DCH A;  1OC9 B;  4Z2R A;  5KEJ A;  1ON4 A;  3IHQ A;  4XS4 B;  5HR2 A;  4K5S A;  3GHA A;  4MJB A;  2LKU A;  1YQ1 A;  1SK2 A;  3R2Q A;  2FHE A;  4POM A;  4HOJ A;  3CQF A;  1GSD A;  3Q74 A;  4KX4 A;  2B3S A;  3RGB C;  2C8U A;  2C4J A;  3Q19 A;  1Z5Y E;  3C1R A;  3WYW A;  2H75 A;  1BG5 A;  2AHE A;  2XPD A;  2AJQ B;  3HVN A;  2OE3 A;  3TJG A;  1T3B A;  3IXR A;  4JED A;  2GVP A;  4PX1 A;  1G7O A;  1LU4 A;  2HE3 A;  4G19 A;  1MDI A;  2PBJ A;  1A0R P;  5ECI B;  4IQA A;  2VCZ A;  2YN1 A;  2I81 A;  3GL5 A;  3TRQ A;  2IN3 A;  3HD5 A;  1AIU A;  2FWF A;  2HXK A;  3FW2 A;  4GQF A;  4K7I A;  1VF1 A;  5CRW A;  3MSZ A;  3ZIV A;  3HVX A;  3ZFL A;  5J41 A;  1KBN A;  1K3L A;  3DVW A;  4P3Y B;  4YQU A;  1SU9 A;  5GSS A;  4I5Q A;  1OVN A;  2X8H A;  4OD7 A;  2VL2 A;  3L9U A;  3GX8 A;  4G0K A;  4W66 A;  1BED A;  4KDX A;  2AYT A;  4IHU A;  2H6Y A;  1TJD A;  2HZE A;  4ZB6 A;  1M99 A;  3VUR A;  4ZBD A;  4WF4 A;  2YJ7 A;  3I69 A;  3RHB A;  2I3Y A;  3A2W A;  1ERW A;  1X5C A;  3D4M A;  4TRX A;  2IPA A;  4XRA A;  4G9H A;  3KMO A;  22GS A;  1GRX A;  1AC1 A;  4GQC A;  2H74 A;  4L5O A;  1PL1 A;  2PN8 A;  5AIX A;  4ECJ A;  3Q6O A;  1IYH A;  2VAF A;  1HYU A;  3ZYW A;  1ILO A;  3TKS E;  1G6W A;  1Z9H A;  5CRH A;  1O7U A;  3VWV A;  2IJY A;  3FKF A;  1F3A A;  1NHY A;  2PMT A;  3DVX A;  1JLV A;  1I5G A;  5F05 A;  3ZMK A;  3IPZ A;  1TP9 A;  2EC4 A;  2HSN B;  2M72 A;  1TU7 A;  4FIW A;  1XW6 A;  3EC3 A;  3WGE A;  3F9U A;  2LJK A;  3UVH A;  2C1Y A;  2L57 A;  3DWV A;  3ERW A;  2R6K A;  4PNG A;  4F9Z A;  4X1U A;  5GST A;  1S3A A;  1GUM A;  3HZ8 A;  1VF3 A;  4G0L A;  3QOU A;  2V1M A;  3G7Y A;  5A34 A;  3ZLP A;  2D2Z A;  1EV4 A;  5ELG A;  5IIZ A;  3LG6 A;  3GH9 A;  4X0X A;  1K3Y A;  4F0C A;  4POK A;  4NHZ A;  1HNA A;  3MAK A;  1A2L A;  3WD6 A;  2Z9S A;  1J9B A;  5B6N A;  3HY2 A;  1T7P B;  1AQW A;  3F8U A;  2JZR A;  1OKT A;  3GL3 A;  3TOT A;  2B5Y A;  2H19 A;  3F63 A;  2VKZ G;  1K0N A;  3PR8 A;  2ZNM A;  4JR4 A;  3U5R E;  4MJC A;  4K7O A;  4EUY A;  5DAK B;  1FW1 A;  4EL1 A;  4PQH A;  1ZYQ B;  3F4T A;  1YY7 A;  2HRN A;  1X5D A;  1HNC A;  2CX4 A;  3KGK A;  2HLS A;  5F8B A;  4YKG A;  4OFN A;  5GZZ B;  2ES7 A;  4KAE A;  1WRY A;  4OCF A;  2HFD A;  4BPY A;  3HDC A;  3TKR A;  2DIZ A;  2FY6 A;  1V2A A;  4JRR A;  4TN8 A;  5HFI A;  1GUL A;  2QSI A;  2X8C A;  2PVQ A;  3RPP A;  3UEM A;  2OKA A;  3LQ7 A;  3VK9 A;  2L5L A;  2KLX A;  5J4Y A;  1PRX A;  1WP0 A;  1V9W A;  2M46 A;  4KF9 A;  3C1S A;  3KTB A;  4FYC A;  2XHF A;  1FB0 A;  1ZZY A;  1YF1 A;  2YNX A;  1TOF A;  4ECC A;  3FHK A;  1GH2 A;  4L0U A;  5L71 A;  1GUH A;  3UVT A;  19GS A;  2CX3 A;  1Z7R A;  3KH7 A;  2VLV A;  4G0I A;  3S9F A;  2R37 A;  5A5K A;  3V1W A;  4K2X A;  1PA3 A;  3TKS C;  4N11 A;  4XIH A;  2YWN A;  3DEX A;  1OKD A;  1B4Q A;  1SJ6 A;  2B1L A;  2GQM A;  1J08 A;  4IKH A;  2O36 A;  5EY6 A;  2LQO A;  3IE3 A;  4PNF A;  4MJA A;  3D21 A;  5D8I A;  2N5B A;  1BJX A;  2C0F A;  2QA2 A;  1XZO A;  4TKY A;  1XXU A;  1JLW A;  3LFL A;  2IIY A;  2GLR A;  2MMO A;  4K2D A;  2C3T A;  4CDO A;  2A4H A;  1GSU A;  3KMN A;  4OMV A;  5A34 B;  4O5Q A;  3PGT A;  2YWI A;  2LST A;  3F3R A;  4IP6 A;  1CQH A;  4KSO A;  4ICY A;  2OE0 A;  3APQ A;  1S3R A;  4WF5 A;  2DKI A;  1GNE A;  5DQS A;  14GS A;  1PX7 A;  5HFG A;  1Y1U A;  6GST A;  5CO3 A;  2IMF A;  4Z2U A;  4IP1 A;  1K0A A;  1MD3 A;  3WT2 A;  2IFQ B;  2FCH A;  4HUA A;  2RM6 A;  4HS1 A;  6GSU A;  3LXZ A;  2JSZ A;  5KOW A;  1MTC A;  3FK8 A;  2KP1 A;  3QFB C;  1GL8 A;  2HYX A;  2VLT A;  5LD0 A;  3F3Q A;  4NPB A;  5ENU A;  3ZRD A;  3L0H A;  2H72 A;  4K0N A;  3EMP A;  3CSI A;  4ZL7 A;  2KP2 A;  1SL1 B;  5HFK A;  3H1N A;  3CSH A;  3LYP A;  1TRV A;  3BOA A;  3I43 A;  1PMT A;  2HSH A;  1U3A A;  1H75 A;  1O8X A;  1UVZ A;  1IYI A;  3I6A A;  3MWH A;  4PUR A;  2AAW A;  2E2M A;  1ZCP A;  2V6K A;  5B6M A;  4MH3 A;  4FXY P;  4WEY A;  4O32 A;  2N5A A;  9GSS A;  2EIO A;  3A5I A;  1K0C A;  3KIJ A;  3FZA A;  3GA4 A;  2VUP A;  4XHM A;  1B48 A;  2VD1 A;  1XBS A;  3VLN A;  1NSW A;  4OO4 A;  1QK8 A;  5CRD A;  5A1N B;  4WET A;  1T4Y A;  1FO5 A;  1AAZ A;  4LL1 B;  3VI7 A;  4HZ4 A;  3FZ5 A;  1TRU A;  4XS4 A;  5ECH B;  1GSE A;  4N10 A;  3HJP A;  3EWL A;  4HJ2 A;  3EIN A;  2CVK A;  4ML6 A;  4DVC A;  4JZQ A;  2YCD A;  4K5R A;  4HSC X;  5IMF A;  1U6T A;  4ILF A;  1EP8 A;  1B4P A;  3TCO A;  1T1V A;  5E4W A;  3ERG A;  3N9J A;  3IHG A;  5D93 A;  2HRF A;  4KDY A;  2ZCT A;  2HZF A;  4PI0 C;  3DXB A;  2GZP A;  2QKE A;  3TJJ A;  2XBQ A;  1BQ7 A;  2CV4 A;  4F0B A;  1YZX A;  1GWC A;  3H93 A;  3CSJ A;  5J9B A;  4BVX B;  2GZY A;  4EKZ A;  5C04 A;  2RII A;  1MEK A;  4LLR A;  1SVO A;  5JCU A;  4KE3 A;  3C73 A;  1FG4 A;  1F6M C;  4HU9 A;  3QR6 A;  3MNG A;  1NHO A;  5DJM A;  5F06 A;  4QL9 A;  1GTU A;  1RK4 A;  3L9V A;  2GZZ A;  2V6O A;  3HCZ A;  4MMM A;  5HQP A;  3QMX A;  4JU5 A;  1Q98 A;  1M2B A;  4PHZ C;  4HEA 2;  4V1A g;  2B6M A;  5IMD A;  4IVF A;  2O85 A;  4YQM A;  2DKH A;  4FYB A;  1WJK A;  3P7X A;  3PIN A;  2WGR A;  2VCT A;  1SEN A;  3UBK A;  2V2G A;  3BCK A;  1J0F A;  1A8L A;  4QQ7 A;  1LBK A;  1VGL A;  4QL7 A;  2K9F A;  2HI7 A;  3DD3 A;  3CTG A;  3DRN A;  3E9J B;  5KN3 A;  4KW6 A;  3ZIJ A;  4CHS A;  3EU4 A;  4OFT A;  2JZT A;  3GN3 A;  4D73 B;  1O81 A;  4AKI A;  4BA7 A;  4XTS A;  5B8B A;  1URM A;  4H86 A;  4L0W A;  1K0M A;  1S3D A;  3QPM A;  2HSN A;  5A4V A;  5J40 A;  3A5W A;  1S4B P;  4JBB A;  3ZZX A;  1GTB A;  1OC8 A;  2XPE A;  3M1G A;  1USB A;  4G01 A;  2ZUP A;  2IMK A;  5IMA A;  3ZTL A;  1RW1 A;  3LW9 A;  2YAN A;  3CRT A;  3HKR A;  1R5P A;  5J47 A;  1W89 A;  2C0G A;  2P5Q A;  3C7M A;  5DVB A;  4EIQ A;  4NAX A;  2O89 A;  2R0G A;  3D4T A;  1SL2 B;  3MIX A;  5ECP B;  3JCM L;  4HQZ A;  5GAN D;  4GXZ A;  2FLS A;  2EIR A;  1QMV A;  3M9K A;  3GIX A;  3FMW A;  2PUK C;  3FZ9 A;  2LRC A;  4ZBB A;  1KEB A;  1EGO A;  3A2X A;  3ED3 A;  2I4A A;  1S3C A;  2L59 A;  1EEM A;  3TU3 B;  1O6J A;  2JZS A;  2UV8 G;  3KTL A;  1PSQ A;  2VCW A;  2B5X A;  1TKD B;  1I9D A;  2A2R A;  2DJ0 A;  4V2M A;  4NHW A;  5DAK A;  2VCX A;  4WR4 A;  2NPB A;  3EVI A;  4PI2 C;  2H71 A;  4GTU A;  4ZB8 A;  5ELA A;  1BF5 A;  4PTS A;  2FA8 A;  2WW1 A;  1GNW A;  2HSM B;  1SK1 A;  2RM5 A;  1SKS B;  3IBH A;  4XRD A;  2H70 A;  2BMX A;  1TDI A;  3LSZ A;  1ZL9 A;  2O5V A;  5HR3 A;  3LYK A;  2WJU A;  1FAA A;  2IME A;  3P90 A;  1MD4 A;  1R5A A;  4GDF A;  3VPT A;  2MBS A;  4IN0 A;  2B1K A;  1FVJ A;  1DUG A;  4L8E A;  3IRA A;  2H6Z A;  4XS1 A;  4WBR D;  2F8A A;  3HVV A;  4ZL8 A;  4LMW A;  5AIS A;  1R26 A;  1TXU A;  2AV4 A;  3IA1 A;  5IPH A;  2IL3 A;  1K0O A;  2ON7 A;  3DGQ A;  2TRX A;  2X4A A;  2MZC A;  5IOW A;  3TJF A;  2YZH A;  4TVE A;  4GWR A;  4K8M A;  4YH2 A;  2VCV A;  2JAC A;  4EXJ A;  1WIK A;  2OBI A;  4TR1 B;  1X9W B;  5JWQ B;  3BD2 A;  2PU9 C;  1YEP A;  4L5L A;  2GTU A;  5GAP D;  1SD9 A;  5BMU A;  1XFL A;  1Z6N A;  5ECS A;  4EVM A;  2K6V A;  4J57 E;  2G2Q A;  4I8B A;  3DKS A;  2WVX A;  3PPU A;  5DCG A;  2OE1 A;  2IMI A;  3L78 A;  4TW5 A;  3EYT A;  3QDN A;  2DBC A;  5IM9 A;  3EPT A;  1JZO A;  2GT6 A;  2VM1 A;  3F4S A;  4AJ7 A;  4K1F A;  5ID2 B;  4Q5R A;  3EE2 A;  2X8G A;  2IFQ A;  5FWG A;  3FY7 A;  3KD0 A;  3ERF A;  1F3B A;  2OAD A;  1XWK A;  1H4O A;  2K18 A;  4ZB9 A;  1NM3 A;  3A3T A;  2QA1 A;  1E6B A;  1GSF A;  3LWA A;  4E8E A;  2YZU A;  1BAY A;  1V40 A;  3DML A;  2CZ2 A;  4GCI A;  2DIY A;  4TR3 A;  10GS A;  5F07 A;  3I9V 2;  2VLU A;  5ECL B;  3IV4 A;  1G0T A;  4USS A;  2WZ9 A;  3CWG A;  1QXH A;  3ZVJ D;  3O3T A;  1GTI A;  2V41 A;  2IMD A;  1M2D A;  3ZIT A;  5IO2 A;  1XCC A;  5BRT A;  1F2E A;  3KP9 A;  4ZXG A;  2I1U A;  3APS A;  4MJE A;  2L4Q A;  4IGJ A;  5A1N A;  3IAM 2;  2B7J A;  2H76 A;  3TRP A;  5COH A;  2FGX A;  4X43 A;  1JZD A;  5KN2 A;  3BBY A;  2DJ1 A;  5D9X A;  5ECN B;  3FZ4 A;  4MPG A;  2HT9 A;  7GSS A;  1ERV A;  1A2J A;  1PFO A;  4IBP A;  2WUL A;  2ON5 A;  2VD0 A;  2YV7 A;  2EFH A;  3IK7 A;  2H1A A;  3HMJ G;  2PWJ A;  4NWY A;  4AKX B;  4KCA A;  4E68 A;  2PVO C;  4G2E A;  3KP8 A;  2PGT A;  5BMU B;  3IC8 A;  1TU8 A;  1K3O A;  1PKZ A;  4PUA A;  1M7T A;  2WVX B;  3VWU A;  1FHE A;  2GGT A;  5IMZ A;  1R4W A;  1E2Y A;  1RQM A;  4BVX A;  3F4R A;  5IPG A;  1F37 A;  2FD3 A;  2KHP A;  3KCM A;  2WW3 A;  5G2Z A;  3APO A;  2YPM A;  4CY8 A;  4HQS A;  4KGI A;  2LNS A;  2FWG A;  1MDJ A;  2NDO A;  5IMV A;  1XW9 A;  1V58 A;  1ZGN A;  1TW9 A;  3TRX A;  2OJL A;  2LTK A;  3M3M A;  1PKW A;  4RQR A;  3D22 A;  4K0G A;  5DAL A;  3D0Z A;  1CQG A;  3VPQ A;  4LMV A;  1VF4 A;  2GST A;  4Q5Q A;  4EF0 A;  1QUW A;  1WE0 A;  3F6D A;  5EL8 A;  3CMI A;  3FR6 A;  1WPI A;  2R0C A;  4ID0 A;  4ML1 A;  2H1B A;  2VL2 C;  1ZOF A;  4DSS A;  3HHV A;  4AKH A;  1GLP A;  2CAQ A;  1NW2 A;  4GF0 A;  3HXS A;  5J3R A;  1AQV A;  2WW2 A;  4MPF A;  3A2V A;  2H1D A;  4POL A;  4IEL A;  4IW9 A;  1YVL A;  2FNO A;  1ACV A;  2BJX A;  3RDW A;  4MK3 A;  1XIY A;  4WXT A;  4Z7X A;  3ZML A;  3M0F A;  11GS A;  5DBQ A;  4D73 A;  4N0Z A;  2WW0 A;  3E0U A;  1FVK A;  3BJ5 A;  1X9M B;  1A8Y A;  1TRS A;  3UJ1 A;  5JCW A;  1N25 A;  1GSQ A;  5CYY A;  2DJ3 A;  2E0Q A;  4ISD A;  4Q5F A;  1SJI A;  1YEX A;  2O3E A;  4YKF A;  2M80 A;  3TKP A;  5A4W A;  3QAW A;  1XVQ A;  4MZW A;  2R4V A;  1AQX A;  3R3E A;  3UOM A;  2HSY A;  4RQX A;  2GQK A;  20GS A;  3HJO A;  2VM2 A;  1F9M A;  1V57 A;  1Z3E A;  1TXX A;  2CA8 A;  4PUF C;  2LEG A;  4MLY A;  1PN0 A;  5E59 A;  3LXT A;  2N5F A;  5D73 A;  4AF2 A;  3ZFB A;  2MBT A;  1EV9 A;  1ZYN A;  2PPT A;  1AXD A;  3O6T A;  3UBL A;  2K8S A;  3ZL5 A;  1DSB A;  3KH9 A;  1I1I P;  2J9H A;  1FOV A;  2H1G A;  4OWY A;  1DE2 A;  3GFK A;  2C3N A;  3MDK A;  1U3I A;  1SJZ A;  1YDK A;  1G7E A;  5D9T A;  2FWE A;  4JR6 A;  2P31 A;  2VL3 A;  4ULX A;  2HNL A;  5KN1 A;  3Q18 A;  1BX9 A;  2WDU A;  4F03 A;  1Y6E A;  3U6V A;  3E3E A;  5DAL B;  2GQL A;  1A0F A;  3TOU A;  3IK9 A;  4MA9 A;  2YV9 A;  3F0I A;  4J56 E;  2HSM A;  5A5H B;  2AUV A;  1O85 A;  1SK0 A;  3C8E A;  2QGV A;  4F82 A;  4GLT A;  4DSS B;  5CRE A;  2KOK A;  2F8F A;  5CAX A;  2B7K A;  2LRT A;  5G30 A;  5D9V A;  5G1K A;  1M0U A;  2TRC P;  2DLX A;  3TDG A;  1C72 A;  3FRC A;  2A2P A;  4O5R A;  1B8X A;  1YJ6 A;  2OA7 A;  2C0E A;  3LEF A;  2GS3 A;  2HQT A;  3P8W A;  1SKR B;  3FYG A;  1HD2 A;  3TKS A;  2BTO T;  1XVW A;  2A4V A;  2REM A;  3GNJ A;  3QAV A; 
#chains in the Genus database with same CATH homology
 4N3Z A;  4A5P A;  3J7Y k;  1PQN A;  3VI5 A;  4HJM A;  1BG1 A;  3GH6 A;  2OT3 A;  2E7P A;  2K8V A;  4TR1 A;  4TR0 A;  3GSS A;  1GSY A;  3TUE A;  4ZIJ A;  1HQO A;  4F2I A;  1KNG A;  1PGT A;  5INY A;  4MF7 A;  4MAB A;  6GSW A;  3WGD A;  4EC0 A;  1EOH A;  4IJ3 A;  3UL3 A;  2B5E A;  3IR4 A;  2GSR A;  3WT1 A;  4DEJ A;  2YP6 A;  4N30 A;  2LRN A;  4PXO A;  2JAD A;  1X9S B;  5ECK B;  1EP7 A;  4KSM A;  2H0G A;  1OE7 A;  3CYN A;  2PER A;  5ID2 A;  3K8N A;  4NMU A;  4HZ2 A;  2P5R A;  3PH9 A;  2X99 A;  4Z2T A;  3ME7 A;  1GSS A;  1K0D A;  4MF5 A;  2LJA A;  5ECO B;  2JSY A;  1LJR A;  2WFC A;  5G5F A;  6GSX A;  3IAS 2;  3KEB A;  3GUS A;  4HDE A;  17GS A;  3VFI A;  3GRX A;  4LA1 A;  5G1L A;  5J5N A;  3RHC A;  2GSS A;  4BWQ A;  4BVY B;  2EFC A;  8GSS A;  2LJR A;  2HRK B;  3D5J A;  3TGZ A;  3W8S A;  4MZB A;  4O5U A;  3LOR A;  4KA0 A;  1K0B A;  4JE1 A;  4YAP A;  4N0V A;  4RI7 A;  5H5S A;  5CRG A;  3KJY A;  2L6C A;  1GTA A;  4POB A;  2LNT A;  3H79 A;  3QD9 A;  3BCI A;  4FQU A;  3EUR A;  3UAP A;  2VO4 A;  2X64 A;  5HR1 A;  4OFM A;  3IC4 A;  1XOA A;  4ZBA A;  1WMJ A;  1X0R A;  2OBK A;  2H66 A;  3VWX A;  1SL0 B;  1XW5 A;  3P2A A;  1FB6 A;  2G0F A;  3DIE A;  4J2F A;  5LNK e;  13GS A;  3F6F A;  2FWH A;  3HJM A;  2YWO A;  4NV5 A;  3QFA C;  1A23 A;  4EDZ A;  2P0G A;  1A24 A;  1W4V A;  3LJR A;  2VL9 A;  4V1A p;  1YF0 A;  3G7J A;  2WCI A;  3M8N A;  2EIQ A;  2GSQ A;  4NV2 A;  4I2T A;  4ZL9 A;  5FT3 A;  4TXV A;  2CVB A;  1Q4J A;  1FOH A;  5EVO A;  1AUC A;  4KB3 A;  1QFN A;  3GX0 A;  5FHI A;  2L5O A;  5J4U A;  2VIM A;  1R7H A;  1SYR A;  2H8L A;  2CT6 A;  4PQ1 A;  1PX6 A;  1M9B A;  5C00 A;  2IWT A;  2NBS A;  2DML A;  3EMX A;  4K9Z A;  4ACS A;  4HU7 A;  4ZIL A;  5CP1 A;  3CRU A;  2DC5 A;  2RLI A;  4GSN A;  1OC3 A;  1BYE A;  3EU3 A;  3G7I A;  3N5O A;  4GRF A;  2RUF A;  3RAZ A;  4PQI A;  6GSV A;  4AKG A;  2C0D A;  5G31 A;  1GUK A;  5ECM B;  3L9S A;  3KM6 A;  3QAG A;  3GKN A;  3GKX A;  3TJK A;  3SBC A;  2OAC A;  1OYJ A;  1QQ2 A;  3HYP A;  2H6X A;  3ISO A;  4HI7 A;  4I2U A;  1SD8 A;  1KTE A;  2F51 A;  2FUG 2;  2WRT A;  5KOX A;  2WB9 A;  5J4V A;  3TB2 A;  3CTF A;  1GP1 A;  5J9C A;  2HZE B;  2YOI A;  3VWW A;  5A4U A;  1O8W A;  4MDC A;  2MMN A;  5HR0 A;  3KXO A;  5LCZ A;  3GYK A;  1Z7P A;  2F9S A;  2KUC A;  2LV3 A;  2XC2 A;  1XWB A;  4AI6 A;  2UZ8 A;  3SWL A;  5ABR A;  4TXO A;  4I97 A;  1JHB A;  5ECR B;  5CNW A;  3H8Q A;  4MCU A;  3NIV A;  4OO5 A;  1XWC A;  4ECI A;  1M9A A;  4GSS A;  3LGC A;  2GT5 A;  4XS6 A;  2H0I A;  1TRW A;  5ECQ B;  1DE1 A;  4YAV A;  2H0H A;  1U88 A;  2DMM A;  3HVS A;  2I9H A;  4EIP A;  1SKW B;  2CAI A;  1OAZ A;  1O73 A;  2LQQ A;  1Y25 A;  1U87 A;  5EPF A;  5IOX A;  2XBI A;  5JWO B;  1PN9 A;  4O7H A;  1TTZ A;  2H1L A;  1A2M A;  5B7C A;  4KUN A;  1ST9 A;  5IO0 A;  5DQY A;  1ABA A;  4MZC A;  1PL2 A;  3CXG A;  2JL4 A;  4K6X A;  2FA4 A;  1ZYP A;  4EE0 A;  2DSA A;  4OCE A;  4KDU A;  4BL7 A;  3FR9 A;  1HNB A;  2MMZ A;  1SVL A;  1T8E B;  2MMA A;  4PGT A;  2WS2 A;  3GKM A;  2VCQ A;  1TI3 A;  2R0P A;  2H30 A;  5JWR B;  2C3Q A;  5D9W A;  5G5E A;  2CQ9 A;  1QGV A;  2NVL A;  1WWJ A;  2RUE A;  5DDL A;  1Z6M A;  3W8J A;  2X49 A;  1XWA A;  5D96 A;  4EDY A;  1SYX A;  3UAR A;  1N8J A;  1JZR A;  3ME8 A;  2TIR A;  3IOS A;  5A5H A;  5F0G A;  2YJH A;  1XWG A;  1EWX A;  2VOC A;  3W6G A;  4QMK A;  1TK8 B;  2L4C A;  4BWS A;  1DBY A;  4O92 A;  1WOU A;  4WBJ A;  1XPV A;  4TXO B;  4KND A;  1ZYE A;  2CVD A;  4AJ8 A;  3KZQ A;  5IQY A;  4E8H A;  1ZMA A;  4I6X A;  5KN0 A;  2O8V B;  1SVM A;  4IQ1 A;  5AIV A;  3L4N A;  2EFD A;  5JCG A;  1X5E A;  3FR3 A;  4MF6 A;  2V32 A;  2HRA A;  3C71 A;  3GV1 A;  1XOB A;  3GUR A;  4IJI A;  3GTU A;  1OC9 A;  2L6D A;  2LUS A;  2R3X A;  4CY6 A;  4IS0 A;  4XCS A;  2O7K A;  1UC7 A;  2F3M A;  1TI1 A;  5AGY A;  2H01 A;  3US3 A;  3DYR A;  3ZVJ A;  4MH2 A;  3NZN A;  3AY8 A;  4DSR A;  2ALB A;  1VRS D;  3RPN A;  1EOG A;  3WGX A;  4FYU A;  2R5G A;  2E2G A;  2JU5 A;  4RUV A;  1B9Y C;  3HA9 A;  2CZ3 A;  3RBT A;  4YQV A;  3NOF A;  4Q5N A;  3UMA A;  4AGS A;  1EZK A;  1JZW A;  4ECB A;  3FEU A;  4X4J A;  1OE8 A;  2O87 A;  3MYD A;  1GLQ A;  3UIW A;  2DJK A;  4BL7 B;  3IDV A;  4KH7 A;  1ERU A;  3CBU A;  2GDR A;  4MNN A;  2AB6 A;  3O76 A;  4TOP A;  1V98 A;  2A2S A;  4TR4 A;  1YKC A;  2R2J A;  1EEJ A;  1THX A;  1N2A A;  1JFU A;  3QCP A;  5IMC A;  4WKW A;  3J7Y b;  1PD2 1;  3GMF A;  1MDK A;  1TK0 B;  4G10 A;  4LL4 B;  1ML6 A;  1T4Z A;  4FH8 A;  5H5R A;  4MP4 A;  4BVY A;  3M9J A;  2H73 A;  2MYG A;  4EO3 A;  4WR5 A;  1TK5 B;  4V2L A;  2HRK A;  1UN2 A;  3HZ4 A;  4KCE A;  2EFE A;  3GST A;  4V2N A;  3H4K A;  1THO A;  2QC7 A;  3GKK A;  5H5Q A;  1ERT A;  1B9X C;  4RI6 A;  2NTO A;  4CW9 A;  2LS5 A;  3D6I A;  2J23 A;  1YKA A;  4DSQ A;  4ZB7 A;  1AW9 A;  3OR5 A;  2C80 A;  2DJJ A;  1G6Y A;  3TKQ A;  1M2A A;  3TJB A;  5AN1 A;  4AJ6 A;  16GS A;  4K7N A;  3ZRE A;  1EGR A;  18GS A;  4FO5 A;  2YWM A;  3G9B A;  1UA5 A;  1VF2 A;  5DJL A;  4NXI A;  6GSY A;  4GST A;  12GS A;  1T00 A;  3GTU B;  2DJ2 A;  6GSS A;  5B8A A;  5DCH A;  1OC9 B;  4Z2R A;  5KEJ A;  1ON4 A;  3IHQ A;  4XS4 B;  5HR2 A;  4K5S A;  3GHA A;  4MJB A;  2LKU A;  1YQ1 A;  1SK2 A;  3R2Q A;  2FHE A;  4POM A;  4HOJ A;  1GSD A;  3Q74 A;  4KX4 A;  2B3S A;  2C8U A;  2C4J A;  3Q19 A;  1Z5Y E;  3C1R A;  3WYW A;  2H75 A;  1BG5 A;  2AHE A;  2XPD A;  2AJQ B;  2OE3 A;  3TJG A;  1T3B A;  3IXR A;  4JED A;  2GVP A;  4PX1 A;  1G7O A;  1LU4 A;  2HE3 A;  4G19 A;  1MDI A;  2PBJ A;  1A0R P;  5ECI B;  4IQA A;  2VCZ A;  2YN1 A;  2I81 A;  3GL5 A;  3TRQ A;  2IN3 A;  3HD5 A;  1AIU A;  2FWF A;  2HXK A;  3FW2 A;  4GQF A;  4K7I A;  1VF1 A;  5CRW A;  3MSZ A;  3ZIV A;  3HVX A;  3ZFL A;  5J41 A;  1KBN A;  1K3L A;  3DVW A;  4P3Y B;  4YQU A;  1SU9 A;  5GSS A;  4I5Q A;  1OVN A;  2X8H A;  4OD7 A;  2VL2 A;  3L9U A;  3GX8 A;  4G0K A;  4W66 A;  1BED A;  4KDX A;  2AYT A;  4IHU A;  2H6Y A;  1TJD A;  2HZE A;  4ZB6 A;  1M99 A;  3VUR A;  4ZBD A;  4WF4 A;  2YJ7 A;  3I69 A;  3RHB A;  2I3Y A;  3A2W A;  1ERW A;  1X5C A;  3D4M A;  4TRX A;  2IPA A;  4XRA A;  4G9H A;  3KMO A;  22GS A;  1GRX A;  1AC1 A;  4GQC A;  2H74 A;  4L5O A;  1PL1 A;  2PN8 A;  5AIX A;  4ECJ A;  3Q6O A;  1IYH A;  2VAF A;  1HYU A;  3ZYW A;  1ILO A;  3TKS E;  1G6W A;  1Z9H A;  5CRH A;  1O7U A;  3VWV A;  2IJY A;  3FKF A;  1F3A A;  1NHY A;  2PMT A;  3DVX A;  1JLV A;  1I5G A;  5F05 A;  3ZMK A;  3IPZ A;  1TP9 A;  2EC4 A;  2HSN B;  2M72 A;  1TU7 A;  4FIW A;  1XW6 A;  3EC3 A;  3WGE A;  3F9U A;  2LJK A;  3UVH A;  2C1Y A;  2L57 A;  3DWV A;  3ERW A;  2R6K A;  4PNG A;  4F9Z A;  4X1U A;  5GST A;  1S3A A;  1GUM A;  3HZ8 A;  1VF3 A;  4G0L A;  3QOU A;  2V1M A;  3G7Y A;  5A34 A;  3ZLP A;  2D2Z A;  1EV4 A;  5ELG A;  5IIZ A;  3LG6 A;  3GH9 A;  4X0X A;  1K3Y A;  4F0C A;  4POK A;  4NHZ A;  1HNA A;  3MAK A;  1A2L A;  3WD6 A;  2Z9S A;  1J9B A;  5B6N A;  3HY2 A;  1T7P B;  1AQW A;  3F8U A;  2JZR A;  1OKT A;  3GL3 A;  3TOT A;  2B5Y A;  2H19 A;  3F63 A;  2VKZ G;  1K0N A;  3PR8 A;  2ZNM A;  4JR4 A;  3U5R E;  4MJC A;  4K7O A;  4EUY A;  5DAK B;  1FW1 A;  4EL1 A;  4PQH A;  1ZYQ B;  3F4T A;  1YY7 A;  2HRN A;  1X5D A;  1HNC A;  2CX4 A;  3KGK A;  2HLS A;  5F8B A;  4YKG A;  4OFN A;  5GZZ B;  2ES7 A;  4KAE A;  1WRY A;  4OCF A;  2HFD A;  4BPY A;  3HDC A;  3TKR A;  2DIZ A;  2FY6 A;  1V2A A;  4JRR A;  4TN8 A;  5HFI A;  1GUL A;  2QSI A;  2X8C A;  2PVQ A;  3RPP A;  3UEM A;  2OKA A;  3LQ7 A;  3VK9 A;  2L5L A;  2KLX A;  5J4Y A;  1PRX A;  1WP0 A;  1V9W A;  2M46 A;  4KF9 A;  3C1S A;  3KTB A;  4FYC A;  2XHF A;  1FB0 A;  1ZZY A;  1YF1 A;  2YNX A;  1TOF A;  4ECC A;  3FHK A;  1GH2 A;  4L0U A;  5L71 A;  1GUH A;  3UVT A;  19GS A;  2CX3 A;  3KH7 A;  1Z7R A;  2VLV A;  4G0I A;  3S9F A;  2R37 A;  5A5K A;  3V1W A;  4K2X A;  1PA3 A;  3TKS C;  4N11 A;  4XIH A;  2YWN A;  3DEX A;  1OKD A;  1B4Q A;  1SJ6 A;  2B1L A;  2GQM A;  1J08 A;  4IKH A;  5EY6 A;  2LQO A;  3IE3 A;  4PNF A;  4MJA A;  3D21 A;  5D8I A;  2N5B A;  1BJX A;  2C0F A;  2QA2 A;  1XZO A;  4TKY A;  1XXU A;  1JLW A;  3LFL A;  2IIY A;  2GLR A;  2MMO A;  4K2D A;  2C3T A;  4CDO A;  2A4H A;  1GSU A;  3KMN A;  4OMV A;  5A34 B;  4O5Q A;  3PGT A;  2YWI A;  2LST A;  3F3R A;  4IP6 A;  1CQH A;  4KSO A;  4ICY A;  2OE0 A;  3APQ A;  4WF5 A;  2DKI A;  1GNE A;  5DQS A;  14GS A;  1PX7 A;  5HFG A;  1Y1U A;  6GST A;  5CO3 A;  2IMF A;  4Z2U A;  4IP1 A;  1K0A A;  1MD3 A;  3WT2 A;  2IFQ B;  2FCH A;  4HUA A;  2RM6 A;  4HS1 A;  6GSU A;  3LXZ A;  2JSZ A;  5KOW A;  1MTC A;  3FK8 A;  2KP1 A;  3QFB C;  1GL8 A;  2HYX A;  2VLT A;  5LD0 A;  3F3Q A;  4NPB A;  5ENU A;  3ZRD A;  3L0H A;  2H72 A;  4K0N A;  3EMP A;  3CSI A;  4ZL7 A;  2KP2 A;  1SL1 B;  5HFK A;  3H1N A;  3CSH A;  3LYP A;  1TRV A;  3BOA A;  3I43 A;  1PMT A;  2HSH A;  1U3A A;  1H75 A;  1O8X A;  1UVZ A;  1IYI A;  3I6A A;  3MWH A;  4PUR A;  2AAW A;  2E2M A;  1ZCP A;  2V6K A;  5B6M A;  4MH3 A;  4WEY A;  4O32 A;  2N5A A;  9GSS A;  2EIO A;  3A5I A;  1K0C A;  3KIJ A;  3FZA A;  3GA4 A;  2VUP A;  4XHM A;  1B48 A;  2VD1 A;  1XBS A;  3VLN A;  1NSW A;  4OO4 A;  1QK8 A;  5CRD A;  5A1N B;  4WET A;  1T4Y A;  1FO5 A;  1AAZ A;  4LL1 B;  3VI7 A;  4HZ4 A;  3FZ5 A;  1TRU A;  4XS4 A;  5ECH B;  1GSE A;  4N10 A;  3HJP A;  3EWL A;  4HJ2 A;  3EIN A;  2CVK A;  4ML6 A;  4DVC A;  4JZQ A;  2YCD A;  4K5R A;  5IMF A;  1U6T A;  4ILF A;  1EP8 A;  1B4P A;  3TCO A;  1T1V A;  5E4W A;  3ERG A;  3N9J A;  3IHG A;  5D93 A;  2HRF A;  4KDY A;  2ZCT A;  2HZF A;  3DXB A;  2GZP A;  2QKE A;  3TJJ A;  2XBQ A;  1BQ7 A;  2CV4 A;  4F0B A;  1YZX A;  1GWC A;  3H93 A;  3CSJ A;  5J9B A;  4BVX B;  2GZY A;  4EKZ A;  5C04 A;  2RII A;  1MEK A;  4LLR A;  1SVO A;  5JCU A;  4KE3 A;  3C73 A;  1FG4 A;  1F6M C;  4HU9 A;  3QR6 A;  3MNG A;  1NHO A;  5DJM A;  5F06 A;  4QL9 A;  1GTU A;  1RK4 A;  3L9V A;  2GZZ A;  2V6O A;  3HCZ A;  4MMM A;  5HQP A;  3QMX A;  4JU5 A;  1Q98 A;  1M2B A;  4HEA 2;  4V1A g;  2B6M A;  5IMD A;  4IVF A;  2O85 A;  4YQM A;  2DKH A;  4FYB A;  1WJK A;  3P7X A;  3PIN A;  2WGR A;  2VCT A;  1SEN A;  3UBK A;  2V2G A;  3BCK A;  1J0F A;  1A8L A;  4QQ7 A;  1LBK A;  1VGL A;  4QL7 A;  2K9F A;  2HI7 A;  3DD3 A;  3CTG A;  3DRN A;  3E9J B;  5KN3 A;  4KW6 A;  3ZIJ A;  4CHS A;  3EU4 A;  4OFT A;  2JZT A;  3GN3 A;  4D73 B;  1O81 A;  4AKI A;  4BA7 A;  4XTS A;  5B8B A;  1URM A;  4H86 A;  4L0W A;  1K0M A;  1S3D A;  3QPM A;  2HSN A;  5A4V A;  5J40 A;  3A5W A;  4JBB A;  3ZZX A;  1GTB A;  1OC8 A;  2XPE A;  3M1G A;  1USB A;  4G01 A;  2ZUP A;  2IMK A;  5IMA A;  3ZTL A;  1RW1 A;  3LW9 A;  2YAN A;  3CRT A;  3HKR A;  1R5P A;  5J47 A;  1W89 A;  2C0G A;  2P5Q A;  3C7M A;  5DVB A;  4EIQ A;  4NAX A;  2O89 A;  2R0G A;  3D4T A;  1SL2 B;  3MIX A;  5ECP B;  3JCM L;  4HQZ A;  5GAN D;  4GXZ A;  2FLS A;  2EIR A;  1QMV A;  3M9K A;  3GIX A;  3FMW A;  2PUK C;  3FZ9 A;  2LRC A;  4ZBB A;  1KEB A;  1EGO A;  3A2X A;  3ED3 A;  2I4A A;  1S3C A;  2L59 A;  1EEM A;  3TU3 B;  1O6J A;  2JZS A;  2UV8 G;  3KTL A;  1PSQ A;  2VCW A;  2B5X A;  1TKD B;  1I9D A;  2A2R A;  2DJ0 A;  4V2M A;  4NHW A;  5DAK A;  2VCX A;  4WR4 A;  2NPB A;  3EVI A;  2H71 A;  4GTU A;  4ZB8 A;  5ELA A;  1BF5 A;  4PTS A;  2FA8 A;  1GNW A;  2HSM B;  1SK1 A;  2RM5 A;  1SKS B;  3IBH A;  4XRD A;  2H70 A;  2BMX A;  1TDI A;  3LSZ A;  1ZL9 A;  2O5V A;  5HR3 A;  3LYK A;  2WJU A;  1FAA A;  2IME A;  3P90 A;  1MD4 A;  1R5A A;  4GDF A;  3VPT A;  2MBS A;  4IN0 A;  2B1K A;  1FVJ A;  1DUG A;  4L8E A;  3IRA A;  2H6Z A;  4XS1 A;  4WBR D;  2F8A A;  3HVV A;  4ZL8 A;  4LMW A;  5AIS A;  1R26 A;  1TXU A;  2AV4 A;  3IA1 A;  5IPH A;  2IL3 A;  1K0O A;  2ON7 A;  3DGQ A;  2TRX A;  2X4A A;  2MZC A;  5IOW A;  3TJF A;  2YZH A;  4TVE A;  4GWR A;  4K8M A;  4YH2 A;  2VCV A;  2JAC A;  4EXJ A;  1WIK A;  2OBI A;  4TR1 B;  1X9W B;  5JWQ B;  3BD2 A;  2PU9 C;  1YEP A;  4L5L A;  2GTU A;  5GAP D;  1SD9 A;  5BMU A;  1XFL A;  1Z6N A;  5ECS A;  4EVM A;  2K6V A;  4J57 E;  2G2Q A;  4I8B A;  3DKS A;  3PPU A;  5DCG A;  2OE1 A;  2IMI A;  3L78 A;  4TW5 A;  3EYT A;  3QDN A;  2DBC A;  5IM9 A;  3EPT A;  1JZO A;  2GT6 A;  2VM1 A;  3F4S A;  4AJ7 A;  4K1F A;  5ID2 B;  4Q5R A;  3EE2 A;  2X8G A;  2IFQ A;  5FWG A;  3FY7 A;  3KD0 A;  3ERF A;  1F3B A;  2OAD A;  1XWK A;  1H4O A;  2K18 A;  4ZB9 A;  1NM3 A;  3A3T A;  2QA1 A;  1E6B A;  1GSF A;  3LWA A;  4E8E A;  2YZU A;  1BAY A;  1V40 A;  3DML A;  2CZ2 A;  4GCI A;  2DIY A;  4TR3 A;  10GS A;  5F07 A;  3I9V 2;  2VLU A;  5ECL B;  3IV4 A;  1G0T A;  4USS A;  2WZ9 A;  3CWG A;  1QXH A;  3ZVJ D;  3O3T A;  1GTI A;  2V41 A;  2IMD A;  1M2D A;  3ZIT A;  5IO2 A;  1XCC A;  5BRT A;  1F2E A;  3KP9 A;  4ZXG A;  2I1U A;  3APS A;  4MJE A;  2L4Q A;  4IGJ A;  5A1N A;  3IAM 2;  2B7J A;  2H76 A;  3TRP A;  5COH A;  2FGX A;  4X43 A;  1JZD A;  5KN2 A;  3BBY A;  2DJ1 A;  5D9X A;  5ECN B;  3FZ4 A;  4MPG A;  2HT9 A;  7GSS A;  1ERV A;  1A2J A;  4IBP A;  2WUL A;  2ON5 A;  2VD0 A;  2YV7 A;  2EFH A;  3IK7 A;  2H1A A;  3HMJ G;  2PWJ A;  4NWY A;  4AKX B;  4KCA A;  4E68 A;  2PVO C;  4G2E A;  3KP8 A;  2PGT A;  5BMU B;  3IC8 A;  1TU8 A;  1K3O A;  1PKZ A;  4PUA A;  1M7T A;  3VWU A;  1FHE A;  2GGT A;  5IMZ A;  1R4W A;  1E2Y A;  1RQM A;  4BVX A;  3F4R A;  5IPG A;  1F37 A;  2FD3 A;  2KHP A;  3KCM A;  5G2Z A;  3APO A;  2YPM A;  4CY8 A;  4HQS A;  4KGI A;  2LNS A;  2FWG A;  1MDJ A;  2NDO A;  5IMV A;  1XW9 A;  1V58 A;  1ZGN A;  1TW9 A;  3TRX A;  2OJL A;  2LTK A;  3M3M A;  1PKW A;  4RQR A;  3D22 A;  4K0G A;  5DAL A;  3D0Z A;  1CQG A;  3VPQ A;  4LMV A;  1VF4 A;  2GST A;  4Q5Q A;  4EF0 A;  1QUW A;  1WE0 A;  3F6D A;  5EL8 A;  3CMI A;  3FR6 A;  1WPI A;  2R0C A;  4ID0 A;  4ML1 A;  2H1B A;  2VL2 C;  1ZOF A;  4DSS A;  3HHV A;  4AKH A;  1GLP A;  2CAQ A;  1NW2 A;  4GF0 A;  3HXS A;  5J3R A;  1AQV A;  4MPF A;  3A2V A;  2H1D A;  4POL A;  4IEL A;  4IW9 A;  1YVL A;  2FNO A;  1ACV A;  2BJX A;  3RDW A;  4MK3 A;  1XIY A;  4WXT A;  4Z7X A;  3ZML A;  3M0F A;  11GS A;  5DBQ A;  4D73 A;  4N0Z A;  3E0U A;  1FVK A;  3BJ5 A;  1X9M B;  1A8Y A;  1TRS A;  3UJ1 A;  5JCW A;  1N25 A;  1GSQ A;  5CYY A;  2DJ3 A;  2E0Q A;  4ISD A;  4Q5F A;  1SJI A;  1YEX A;  4YKF A;  2M80 A;  3TKP A;  5A4W A;  3QAW A;  1XVQ A;  4MZW A;  2R4V A;  1AQX A;  3R3E A;  3UOM A;  2HSY A;  4RQX A;  2GQK A;  20GS A;  3HJO A;  2VM2 A;  1F9M A;  1V57 A;  1Z3E A;  1TXX A;  2CA8 A;  4PUF C;  2LEG A;  4MLY A;  1PN0 A;  5E59 A;  3LXT A;  2N5F A;  5D73 A;  4AF2 A;  3ZFB A;  2MBT A;  1EV9 A;  1ZYN A;  2PPT A;  1AXD A;  3O6T A;  3UBL A;  2K8S A;  3ZL5 A;  1DSB A;  3KH9 A;  2J9H A;  1FOV A;  2H1G A;  4OWY A;  1DE2 A;  3GFK A;  2C3N A;  3MDK A;  1U3I A;  1SJZ A;  1YDK A;  1G7E A;  5D9T A;  2FWE A;  4JR6 A;  2P31 A;  2VL3 A;  4ULX A;  2HNL A;  5KN1 A;  3Q18 A;  1BX9 A;  2WDU A;  4F03 A;  1Y6E A;  3U6V A;  3E3E A;  5DAL B;  2GQL A;  1A0F A;  3TOU A;  3IK9 A;  4MA9 A;  2YV9 A;  3F0I A;  4J56 E;  2HSM A;  5A5H B;  2AUV A;  1O85 A;  1SK0 A;  3C8E A;  2QGV A;  4F82 A;  4GLT A;  4DSS B;  5CRE A;  2KOK A;  2F8F A;  5CAX A;  2B7K A;  2LRT A;  5G30 A;  5D9V A;  5G1K A;  1M0U A;  2TRC P;  2DLX A;  3TDG A;  1C72 A;  3FRC A;  2A2P A;  4O5R A;  1B8X A;  1YJ6 A;  2OA7 A;  2C0E A;  3LEF A;  2GS3 A;  2HQT A;  3P8W A;  1SKR B;  3FYG A;  1HD2 A;  3TKS A;  2BTO T;  1XVW A;  2A4V A;  2REM A;  3GNJ A;  3QAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...