3FR3A

Tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
201
structure length
201
Chain Sequence
NIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTAANETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
rcsb
source organism Plasmodium falciparum
total genus 66
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fr3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fr3A01
2HSMA 2WGRA 1ERWA 2KUCA 4EVMA 5ENUA 1EZKA 2RUEA 2TIRA 1SKSB 4AF2A 1H4OA 2E2GA 2VL2C 2KOKA 1TI1A 4BVYA 5GSSA 2A2RA 3DGQA 5ECHB 5CAXA 5CRGA 5GAND 3O76A 2FWEA 1K3LA 1TRUA 1XBSA 4ML1A 1YZXA 1XFLA 5CP1A 2L6CA 3C73A 5JWQB 5IOXA 2ON7A 1XXUA 4QL7A 3VFIA 2ALBA 2IMKA 1YF0A 3IR4A 1HD2A 2AHEA 1GP1A 1FOVA 1THXA 1UN2A 2YNXA 1AQWA 1ON4A 3LYKA 3Q18A 3L0HA 4BL7B 1SK0A 1WIKA 1ZYEA 4TKYA 5D9XA 3BCIA 2LRCA 3DKSA 5JCUA 3TJFA 3ZYWA 4N30A 1GTBA 2L59A 1MD4A 1T00A 5DVBA 3GRXA 4HJMA 2F9SA 2H1GA 1GUKA 2FY6A 2DC5A 3NZNA 1K0CA 3H4KA 1FG4A 3U5RE 4ZBDA 5CRHA 4HQZA 1KNGA 1T8EB 2X64A 1Q98A 4MCUA 1URMA 2V41A 1F2EA 1M9BA 4GSTA 1V58A 1PSQA 5EY6A 4DSRA 3E0UA 3BJ5A 1YKAA 1YY7A 3RDWA 2N5FA 2CZ3A 5D96A 3D0ZA 2LRTA 4TR1B 3FY7A 1G7EA 1SK1A 4EO3A 1JZOA 4POKA 3KP8A 1F6MC 2IMIA 3I9V2 4I2UA 2H0HA 2IMDA 2TRCP 3FRCA 4Q5FA 3IK9A 3C1RA 1PMTA 4H86A 1B48A 5CO3A 2H6XA 4YAVA 5IQYA 5FWGA 2A2SA 1TK0B 3VPQA 6GSVA 1RW1A 5G30A 3GUSA 4HEA2 5D73A 3RAZA 2XBIA 2H70A 3UBLA 4AJ7A 2EC4A 4GF0A 1G7OA 1A8YA 2PUKC 1XWBA 1PL2A 1BQ7A 1Z5YE 1TRVA 2C3NA 2LJRA 4LMVA 3H79A 4KE3A 4DSSA 1AQVA 3APOA 3QFBC 5BMUA 4RI6A 4PNGA 2YZUA 3QMXA 2GGTA 3FR9A 3C8EA 2IJYA 1EWXA 2H75A 1VGLA 2PPTA 2YJ7A 1WJKA 2HNLA 2CX3A 5F06A 2XPDA 2H6YA 22GSA 4MH3A 2MMNA 5G1KA 3E3EA 2GVPA 3GIXA 4NV5A 2K18A 2LSTA 4N0ZA 3F3RA 1LBKA 3RBTA 4PTSA 4ZB9A 4O7HA 3SWLA 1OAZA 3EYTA 3VK9A 2E0QA 4KCAA 1QFNA 4KX4A 1K0BA 4F0CA 3G7JA 3QOUA 3U6VA 2O89A 1ERTA 3HZ8A 3KM6A 4OFNA 2H1DA 3HHVA 2DMLA 4K8MA 4MA9A 4O5RA 4J56E 2BMXA 2XBQA 6GSWA 3UVTA 4N10A 1OYJA 3WGXA 3FZ5A 3CXGA 2HLSA 1WRYA 1PKZA 2HZEB 4X1UA 5AIXA 4E8EA 4MH2A 1IYHA 4ML6A 2HSNB 4OCEA 1E2YA 2JU5A 2DJ1A 2LJKA 4NPBA 1OE7A 5ELAA 2AJQB 4IP1A 1B4QA 3IV4A 2KLXA 5KN1A 2LS5A 5AIVA 4RQRA 2H72A 1O73A 4NHWA 3SBCA 5IPGA 3P7XA 3GL3A 5JWOB 2C3TA 2H1BA 7GSSA 3DYRA 4J2FA 2YJHA 3LJRA 4HJ2A 5DDLA 2N5AA 4MF6A 2GSSA 4MMMA 1B4PA 4IN0A 1AXDA 2B5EA 1TOFA 1B8XA 5INYA 1AAZA 3VWUA 3IHQA 3BD2A 2OBKA 1N2AA 1UC7A 2Z9SA 4V2MA 1GUHA 4HS1A 3F6FA 3K8NA 4TR1A 4CHSA 1PA3A 3N5OA 1XWCA 6GSSA 1J0FA 5JCGA 3ZREA 2V32A 1FW1A 4LL1B 5DCGA 1GUMA 4EKZA 2AV4A 4XS4B 1QK8A 5IO2A 3DWVA 3LGCA 1T4YA 2F8AA 4XS6A 2JZTA 1AQXA 4LLRA 4NHZA 3GA4A 1TU7A 3TUEA 1Y25A 5AISA 4IW9A 2MMZA 4KCEA 3IK7A 1QXHA 2VLTA 3IAS2 1X5DA 3TJGA 2O8VB 3UIWA 3FYGA 3CSIA 3FZ9A 2NVLA 4BA7A 2P5QA 5DJMA 3HXSA 1FVJA 4ILFA 2H74A 3KH7A 2AB6A 1GSYA 2IIYA 4MJAA 2C0FA 3BCKA 3KP9A 2V6KA 1GSQA 1XVWA 4OCFA 1GSSA 3DXBA 4JRRA 3WYWA 4TVEA 2R37A 2HRAA 2EIOA 3EVIA 3JCML 4GSNA 3HD5A 1V2AA 2IMFA 2YWIA 3HJOA 2O87A 4PQ1A 5F0GA 2GSTA 1T7PB 1U3IA 2N5BA 4WBRD 3F6DA 2K9FA 4EXJA 2P0GA 2HQTA 2EIQA 1UA5A 1XWAA 4LL4B 1GWCA 2REMA 1YQ1A 3FZ4A 4WXTA 1IYIA 3TGZA 2VLVA 4V2LA 4JBBA 2OE3A 1NHOA 1Z6NA 4OWYA 2MMAA 2OE1A 3ISOA 1I9DA 4K7IA 3CMIA 1W4VA 3ERFA 3GH6A 5HFKA 4BPYA 3TOUA 1E6BA 4F03A 4OFTA 5G2ZA 1XWKA 1HNAA 1VRSD 2KP2A 2HYXA 5J3RA 4GQFA 4KUNA 4KDXA 2B3SA 3PGTA 5EPFA 3F4TA 19GSA 3C7MA 3ZIVA 4FYBA 1SJZA 2G0FA 4PX1A 1TJDA 5IM9A 4DSSB 1T4ZA 3FK8A 3N9JA 1MTCA 4IBPA 1M2BA 3FKFA 4K2DA 1YEXA 1EEJA 3GNJA 3ZMLA 5D9WA 1MDKA 2FWFA 3TKSA 1SL1B 4KGIA 5D8IA 4I5QA 1OE8A 3GTUB 3UVHA 3G9BA 3GN3A 3F4RA 1XZOA 4TXOB 3L4NA 5G31A 2NPBA 1VF1A 2D2ZA 1U3AA 5DBQA 1LU4A 1XIYA 1VF3A 1ZYQB 1EV4A 3VWWA 5DAKB 4MZBA 3EWLA 1ML6A 1G6YA 1PRXA 1BX9A 3QDNA 4I97A 2R5GA 1S3DA 1XCCA 1OKDA 4TR4A 4YH2A 1SD9A 4XHMA 3IOSA 2IN3A 2YCDA 2FD3A 2PN8A 1Z9HA 3ZZXA 4XS4A 13GSA 5A4VA 2ON5A 1T3BA 1W89A 3ZTLA 3HZ4A 3DMLA 4ID0A 4IKHA 2YANA 4GQCA 3W8SA 2BJXA 2FWGA 1PQNA 3GSSA 2XPEA 2PWJA 5IMVA 3M3MA 4G9HA 5B8AA 3IPZA 1EOHA 3VLNA 2B5XA 3M9JA 2OJLA 3P90A 4EUYA 5D93A 3TOTA 1TU8A 2CT6A 1O8WA 1XW6A 2X8HA 1XOBA 5F07A 4WKWA 3KZQA 3HVXA 2WB9A 1O81A 2PVQA 1M0UA 1BYEA 3KD0A 2GZZA 4DVCA 4O92A 4V1Ap 1QUWA 4L0WA 1GTUA 1ABAA 3US3A 5HR1A 1GLPA 2E2MA 3TCOA 3VI5A 4RI7A 4MZCA 4ZB8A 1SENA 4I6XA 2GLRA 3EC3A 4K7NA 5E59A 5FT3A 3S9FA 4G0IA 4KW6A 3J7Yb 1UVZA 3D6IA 2HT9A 3KIJA 3HY2A 4O32A 4XRAA 2C4JA 2IFQA 3A2WA 4KSOA 4TW5A 2DLXA 4V2NA 2JSZA 1T1VA 3UMAA 3CBUA 4GCIA 2L6DA 1YEPA 4TN8A 1CQGA 4CW9A 1Z7RA 4G19A 1JLWA 4ACSA 2C3QA 5KEJA 2PVOC 2HRKB 1H75A 5B6NA 5G5EA 4IHUA 5IMAA 1PKWA 4WETA 1JZWA 3IAM2 3KGKA 2GS3A 4KDYA 1NSWA 2H01A 2YN1A 3TB2A 1AC1A 2DJ2A 4F0BA 5EL8A 3F4SA 3IC8A 3ED3A 3GH9A 5ECIB 3FZAA 5IMCA 4K9ZA 3FR3A 2VL9A 2NDOA 3D5JA 4KH7A 4HOJA 16GSA 3WGEA 5ECKB 3H93A 4MF7A 4Q5RA 1JZRA 4PUFC 4WF5A 4FYCA 1V40A 4YQVA 4IQAA 4KA0A 11GSA 3GTUA 2P5RA 4TXOA 5J4UA 4ECBA 4V1Ag 1GLQA 5C00A 1EGOA 1J08A 3CRUA 1MDIA 3V1WA 4GSSA 6GSXA 3KTBA 2HFDA 3O6TA 4EC0A 4OO5A 3F0IA 5F05A 4OO4A 2LQOA 3UBKA 1FAAA 1U6TA 1F9MA 3MDKA 4BWQA 3PPUA 5DAKA 4I2TA 5AGYA 5HR2A 2RM6A 1SK2A 1WOUA 4L5OA 3Q74A 1ZOFA 5ID2A 3APQA 1DUGA 4QQ7A 3KTLA 2IMEA 2ZCTA 5C04A 2X8GA 2H19A 2R2JA 3ME7A 5ELGA 2VOCA 5CREA 5KN2A 3C71A 3DEXA 3Q6OA 1K0NA 1OC9B 1JHBA 3O3TA 4MJBA 2H30A 1GTAA 2R3XA 4L8EA 4K6XA 5HQPA 1K3YA 2X99A 4POLA 5JWRB 1HYUA 1O8XA 4ZL8A 2M80A 2VCVA 14GSA 1GNEA 3LQ7A 1GL8A 1GSEA 3F8UA 2RM5A 3J7Yk 2C0EA 1GH2A 2QGVA 5A4WA 3IDVA 3NOFA 3QFAC 4F9ZA 1TK8B 2GDRA 3EU3A 2V1MA 4JZQA 5ABRA 4IELA 4XIHA 1A24A 2XHFA 2OKAA 3KXOA 4HUAA 2YZHA 4K7OA 3APSA 1PD21 1C72A 2AAWA 4MJEA 2GZYA 2PBJA 2LQQA 1K0DA 5HFGA 4DEJA 1DBYA 4JU5A 3HYPA 3A5WA 1M99A 3G7IA 4NXIA 2BTOT 2IWTA 2H71A 2OE0A 4J57E 3NIVA 5CNWA 4FH8A 1K0AA 5AN1A 2WULA 2YV7A 2WS2A 1I5GA 5B8BA 5IPHA 4MLYA 3HVVA 4PQIA 2IL3A 5J9CA 3A3TA 1ERVA 2LJAA 3EE2A 1QGVA 3ZVJD 4GTUA 2I9HA 1LJRA 2YWMA 2VCQA 2FGXA 4FQUA 2VCXA 1X0RA 1F37A 2G2QA 4KSMA 1Z7PA 2GT6A 3GX0A 1OVNA 5CYYA 4ZBAA 2RLIA 1YJ6A 2FWHA 2HRKA 3H8QA 4ZILA 2GSQA 2JZRA 2VLUA 4GLTA 2TRXA 4MP4A 1BG5A 4K1FA 2OADA 2CA8A 1GSFA 1XPVA 4JEDA 2L4QA 2DSAA 1DSBA 1EGRA 3TKQA 3L9VA 3KMNA 1M2AA 2C8UA 1DE1A 1K0MA 4NMUA 1WWJA 1X9WB 1WP0A 6GSTA 3P8WA 1PX7A 3FEUA 5LCZA 1DE2A 4EDZA 2FNOA 2B5YA 5ECSA 1X9MB 2QSIA 2QKEA 3IC4A 4PURA 2WZ9A 1TTZA 3GKXA 4MF5A 2LKUA 4WBJA 1Y6EA 1M7TA 3F3QA 1NM3A 3TRPA 2IFQB 2LTKA 3D4TA 1A8LA 3ME8A 3UAPA 4NV2A 2QC7A 5DQYA 5J5NA 3HA9A 3BBYA 4N11A 2JSYA 1BJXA 2PGTA 3HDCA 3PINA 4IQ1A 1A23A 3HJMA 2YPMA 3RHBA 2M46A 2CQ9A 1XVQA 20GSA 1TW9A 1FB6A 1GSDA 4KF9A 5J41A 5KN0A 1EP8A 4EE0A 1OC9A 3TJJA 1ILOA 1FO5A 3LFLA 2DIYA 1M9AA 1Z6MA 5D9VA 1YF1A 1TRWA 5G1LA 1Q4JA 8GSSA 2H6ZA 1QQ2A 4PNFA 3KCMA 1R7HA 2UZ8A 1TDIA 1M2DA 5H5RA 1GTIA 3Q19A 1TRSA 4JR6A 2WJUA 3LXTA 6GSYA 4KAEA 3W6GA 2VM1A 2I3YA 3L9SA 4YQMA 2VCWA 1RK4A 1WPIA 1VF4A 4G0LA 3WT2A 5ECQB 3WT1A 5E4WA 2DIZA 4YAPA 2F3MA 4MDCA 3MSZA 2R6KA 4ECIA 4XS1A 1FHEA 2OACA 3LORA 1X5EA 3ZFBA 3EMPA 1Z3EA 2B1LA 4XRDA 4KDUA 2OBIA 3AY8A 3H1NA 1TP9A 2OA7A 2KP1A 4LA1A 3PH9A 2L57A 1TI3A 2FA4A 4ISDA 3OR5A 1MEKA 2CVKA 18GSA 1SU9A 2RIIA 1G6WA 2FLSA 3M9KA 3R3EA 2GZPA 1XW9A 4TRXA 3ZIJA 1F3BA 1GSUA 1PN9A 5ID2B 1GRXA 5CRDA 2VCZA 4BVXB 3FHKA 3GURA 3DVWA 3GL5A 2O7KA 3LYPA 1TKDB 4G0KA 4IVFA 1XOAA 4IP6A 1V98A 1ACVA 4L0UA 1ZGNA 2HZFA 3F9UA 4ZL9A 1A2JA 3DRNA 3F63A 2H73A 4E8HA 3KH9A 3LG6A 2J23A 3VWVA 2E7PA 3GKKA 4GWRA 2VL3A 3UARA 3TKRA 3FR6A 1EV9A 5H5QA 2VD0A 3DVXA 3QPMA 3ZRDA 3M1GA 1ZZYA 1B9YC 3A2XA 4YQUA 3TJKA 4KNDA 2C0DA 3QAVA 5ECLB 3IA1A 4MK3A 1AIUA 2CAQA 4ZB6A 3UEMA 5DQSA 3ZFLA 2VL2A 4HZ2A 2PMTA 4USSA 12GSA 5IMDA 5A5KA 1A2MA 4ZIJA 1X5CA 2XC2A 2CZ2A 2ZUPA 4OMVA 5ECPB 1O85A 5HR3A 4EDYA 3KJYA 3QAWA 4D73B 4EL1A 5IMZA 2HSHA 4WF4A 4IJ3A 1SYRA 2WCIA 1G0TA 3M0FA 1SKRB 4MPGA 1S3CA 4F2IA 2PERA 1V57A 1NW2A 3ZVJA 1EOGA 4MPFA 5GZZB 4MZWA 5JCWA 3KMOA 3HKRA 3VI7A 2EIRA 1JZDA 2IPAA 3UL3A 2MMOA 4ZL7A 3RHCA 1SL0B 5IMFA 4HU7A 5B6MA 4HU9A 2H0GA 5COHA 5EVOA 1SJIA 2WDUA 2FCHA 2MBSA 3GX8A 9GSSA 3VWXA 2M72A 2NBSA 1R5AA 2AYTA 3TJBA 1O6JA 1VF2A 5ECMB 2H76A 5GSTA 3ERWA 4Q5QA 4FIWA 2RUFA 1ST9A 2VUPA 2VCTA 2VIMA 3VPTA 1MD3A 2V6OA 4KB3A 2I4AA 2LRNA 3ZITA 4X43A 5ECNB 4L5LA 1AUCA 3TRQA 1R26A 3GFKA 2I81A 5GAPD 3TRXA 4PXOA 1XW5A 1YDKA 4ULXA 3D21A 3GSTA 1SJ6A 2VM2A 17GSA 1N8JA 3I43A 3C1SA 1ZMAA 4MJCA 2K6VA 3PR8A 4FO5A 4XCSA 5DALB 2MBTA 2VO4A 2HXKA 4PGTA 2MYGA 10GSA 2LNTA 4BVXA 2FUG2 4HQSA 1JLVA 4GRFA 2F8FA 2HRFA 3RPNA 1OC3A 3UOMA 2GQLA 1ZCPA 5ECRB 1PL1A 2GQMA 2CV4A 4WR5A 3IBHA 4POBA 2KHPA 1U87A 2I1UA 2CX4A 1K0OA 2FHEA 1A2LA 3GKNA 3ERGA 3FW2A 2P31A 2JACA 4G2EA 5FHIA 1NHYA 5KN3A 2FA8A 2CVBA 1SL2B 3L9UA 4AJ8A 5CRWA 3EURA 3QCPA 3EINA 1FB0A 2B7JA 4BL7A 3UJ1A 4N0VA 2LUSA 5G5FA 2H66A 4JR4A 1HNBA 1KTEA 1ZL9A 1O7UA 3W8JA 3KEBA 1KEBA 3TDGA 2WFCA 1THOA 3G7YA 4DSQA 1FVKA 2LNSA 1AW9A 3IXRA 2YWOA 2VD1A 3LSZA 2GSRA 3WD6A 2DMMA 1KBNA 2L4CA 5LNKe 2LV3A 4WR4A 1JFUA 1BAYA 2HSMB 2DJKA 3GYKA 3MAKA 4AJ6A 4CDOA 1SYXA 4TR3A 1F3AA 4NAXA 1ERUA 4D73A 3VURA 2WRTA 2L5LA 4TOPA 2GQKA 4PQHA 3ZLPA 3LWAA 5DCHA 4BVYB 1HQOA 3ZMKA 4OFMA 4OD7A 2B7KA 3BOAA 3LXZA 3QD9A 2DJ3A 3A2VA 4I8BA 2NTOA 4ZBBA 2L5OA 3EU4A 2F51A 3HCZA 3TKSE 3EMXA 3D22A 4K0GA 1TXXA 5IO0A 4AGSA 1YKCA 4HI7A 2K8VA 4Q5NA 4WEYA 1R4WA 5J9BA 5H5SA 2HE3A 4RQXA 2HRNA 4IJIA 4G10A 4X0XA 2V2GA 2C0GA 2AUVA 2HSYA 4HDEA 6GSUA 3QR6A 5IOWA 3QAGA 2HI7A 4POMA 3D4MA 1CQHA 4LMWA 2J9HA 1R5PA 2K8SA 1HNCA 3R2QA 5B7CA 2VAFA 4PUAA 1XWGA 2H8LA 2H0IA 3DD3A 5L71A 5F8BA 1QMVA 4MABA 4NWYA 3CTGA 3MNGA 5HR0A 3GHAA 3LEFA 1U88A 4QL9A 1A0FA 2DJ0A 2X8CA 1SKWB 4RUVA 2B6MA 2A4VA 2CAIA 2YOIA 3E9JB 3CSJA 3TKSC 1MDJA 2YWNA 3HJPA 3IE3A 1USBA 4ECCA 2C1YA 3DIEA 4EF0A 4BWSA 5DALA 1PGTA 1V9WA 3TKPA 3RPPA 1J9BA 1GNWA 4JE1A 1K3OA 4XTSA 4ZXGA 2CVDA 2B1KA 3WGDA 2O85A 1PX6A 1WMJA 2PU9C 5ECOB 2DJJA 4TR0A 3CRTA 4GXZA 3CSHA 4IS0A 3HVSA 5LD0A 2LEGA 4P3YB 4HZ4A 1OC8A 2YV9A 5A4UA 1SD8A 3CYNA 2DBCA 2HZEA 4FYUA 4F82A 3M8NA 5DJLA 3MWHA 1OKTA 4K0NA 1B9XC 2MZCA 4Z7XA 3I6AA 1WE0A 2GTUA 2H1AA 2ES7A 5HFIA 1RQMA 5D9TA 1A0RP 3IRAA 3CTFA 1EEMA 3P2AA 2ZNMA 4IGJA 1GULA 1X9SB 1BEDA 2YP6A 3GMFA 2JZSA 4ECJA 3GV1A 2R4VA 1EP7A 4TXVA 1S3AA 2GT5A 5IIZA 2C80A 2JL4A 2JADA 3ZL5A 1TK5B 3I69A 3GKMA 3L78A
chains in the Genus database with same CATH superfamily
2HSMA 2WGRA 1ERWA 2KUCA 4EVMA 5ENUA 1EZKA 2RUEA 2TIRA 1SKSB 4AF2A 1H4OA 2E2GA 2VL2C 2KOKA 1TI1A 4BVYA 5J4VA 5GSSA 4MNNA 2A2RA 3DGQA 5ECHB 5CAXA 5CRGA 5GAND 3O76A 2FWEA 2UV8G 1K3LA 1TRUA 1XBSA 4ML1A 1YZXA 1XFLA 2DKIA 2L6CA 3C73A 5CP1A 5JWQB 5IOXA 2ON7A 1XXUA 4QL7A 3VFIA 2ALBA 2IMKA 1YF0A 3IR4A 1HD2A 2AHEA 1GP1A 1FOVA 1THXA 1UN2A 2YNXA 1AQWA 1ON4A 3LYKA 3Q18A 3L0HA 4BL7B 1SK0A 1WIKA 4EIPA 1ZYEA 4TKYA 5D9XA 3BCIA 2LRCA 3DKSA 5JCUA 3TJFA 3ZYWA 4N30A 1GTBA 2L59A 1MD4A 1T00A 5DVBA 3GRXA 4HJMA 2F9SA 2H1GA 1GUKA 2FY6A 2DC5A 3NZNA 1K0CA 3H4KA 1FG4A 3U5RE 4W66A 4ZBDA 5CRHA 4FXYP 4HQZA 1KNGA 1T8EB 2X64A 1Q98A 4MCUA 4AKIA 1URMA 2V41A 1F2EA 1M9BA 4GSTA 1V58A 1PSQA 5EY6A 4DSRA 3E0UA 3BJ5A 1YKAA 1YY7A 3RDWA 1Y1UA 2N5FA 2CZ3A 5D96A 4ICYA 3D0ZA 2LRTA 4TR1B 3FY7A 1G7EA 1SK1A 4EO3A 1JZOA 4POKA 3KP8A 1F6MC 2IMIA 3I9V2 4I2UA 1S4BP 2H0HA 5A1NB 2IMDA 2TRCP 3FRCA 4Q5FA 3IK9A 3C1RA 1PMTA 4H86A 1B48A 5CO3A 2H6XA 4YAVA 3FMWA 5IQYA 5A5HB 5FWGA 2A2SA 1TK0B 3VPQA 6GSVA 1RW1A 5G30A 3GUSA 4HEA2 5D73A 3RAZA 2XBIA 2H70A 3UBLA 4AJ7A 2EC4A 4GF0A 1G7OA 1A8YA 2PUKC 1XWBA 1PL2A 1BQ7A 1Z5YE 1TRVA 2C3NA 2LJRA 4LMVA 3H79A 4KE3A 4DSSA 1AQVA 3APOA 3QFBC 5BMUA 4RI6A 4PNGA 3HVNA 2YZUA 3QMXA 2GGTA 3FR9A 3C8EA 2IJYA 1EWXA 2H75A 4Z2UA 1VGLA 2PPTA 2X49A 2YJ7A 1WJKA 2HNLA 2CX3A 2WW1A 5F06A 2XPDA 2H6YA 22GSA 4MH3A 2MMNA 5G1KA 3E3EA 2GVPA 3GIXA 4NV5A 2K18A 2LSTA 4N0ZA 3F3RA 1LBKA 3RBTA 4PTSA 4ZB9A 4O7HA 3SWLA 1OAZA 3EYTA 3VK9A 2E0QA 4KCAA 1QFNA 4KX4A 1K0BA 4F0CA 3G7JA 3QOUA 3U6VA 2O89A 1ERTA 3HZ8A 3KM6A 4OFNA 2H1DA 3HHVA 2DMLA 4K8MA 4MA9A 4O5RA 4J56E 2BMXA 2XBQA 6GSWA 3UVTA 4N10A 1OYJA 3WGXA 3FZ5A 3CXGA 2HLSA 1WRYA 1PKZA 2HZEB 4X1UA 5AIXA 4E8EA 4MH2A 1IYHA 4ML6A 2HSNB 4K2XA 4OCEA 1E2YA 2JU5A 2DJ1A 2LJKA 4NPBA 1OE7A 5ELAA 2AJQB 4IP1A 1B4QA 3IV4A 2KLXA 5KN1A 2LS5A 5AIVA 4RQRA 4O5UA 2H72A 1O73A 4NHWA 3SBCA 5IPGA 3P7XA 3GL3A 5JWOB 2C3TA 2H1BA 7GSSA 3DYRA 4J2FA 2YJHA 3LJRA 4HJ2A 4PI2C 4K5RA 5DDLA 2N5AA 4MF6A 2GSSA 4MMMA 1B4PA 4IN0A 1M3IA 1AXDA 2B5EA 1TOFA 1B8XA 3CWGA 5INYA 2DKHA 1AAZA 3VWUA 3IHQA 3BD2A 2OBKA 1N2AA 1UC7A 2Z9SA 4V2MA 1GUHA 4HS1A 3F6FA 1SVOA 3K8NA 4TR1A 4CHSA 1PA3A 3N5OA 1XWCA 6GSSA 1J0FA 5JCGA 3ZREA 2V32A 1FW1A 4LL1B 5DCGA 1GUMA 4EKZA 2AV4A 4XS4B 1QK8A 5IO2A 3DWVA 3LGCA 1T4YA 2F8AA 4XS6A 2JZTA 1AQXA 4LLRA 4NHZA 3GA4A 2QA2A 1TU7A 3TUEA 5A5HA 1Y25A 5AISA 4IW9A 2MMZA 4KCEA 3IK7A 1QXHA 2VLTA 3IAS2 1X5DA 3TJGA 1M3JA 2O8VB 3FYGA 3UIWA 3CSIA 3FZ9A 2NVLA 4BA7A 2P5QA 5DJMA 3HXSA 1FVJA 4ILFA 2H74A 3KH7A 2AB6A 1GSYA 3CQFA 2IIYA 4MJAA 2C0FA 3BCKA 3KP9A 2V6KA 1GSQA 1XVWA 4OCFA 3MYDA 1GSSA 3DXBA 4JRRA 3WYWA 4TVEA 2A2PA 2R37A 2HRAA 2EIOA 3EVIA 3JCML 4GSNA 3HD5A 1V2AA 2IMFA 2YWIA 3HJOA 2O87A 4PQ1A 5F0GA 4G01A 2GSTA 1T7PB 1U3IA 2N5BA 4WBRD 3F6DA 2K9FA 4EXJA 2P0GA 2HQTA 2EIQA 1UA5A 1XWAA 4LL4B 1GWCA 2REMA 1YQ1A 3FZ4A 4WXTA 1IYIA 3TGZA 3TU3B 2VLVA 4V2LA 4JBBA 2OE3A 1NHOA 1Z6NA 4OWYA 2MMAA 2OE1A 3ISOA 1I9DA 4K7IA 3CMIA 1W4VA 3ERFA 3GH6A 5HFKA 4BPYA 3TOUA 1E6BA 4F03A 4OFTA 5G2ZA 1XWKA 1HNAA 1VRSD 2KP2A 2HYXA 5J3RA 4GQFA 4KUNA 4KDXA 2B3SA 2HSNA 3PGTA 4CY6A 5EPFA 3F4TA 19GSA 3C7MA 3ZIVA 4FYBA 1BF5A 1SJZA 2G0FA 4PX1A 1TJDA 5IM9A 1SVMA 4DSSB 1T4ZA 3FK8A 3N9JA 1MTCA 4IBPA 1M2BA 3FKFA 5BMUB 4K2DA 1YEXA 1EEJA 3GNJA 4O5QA 3ZMLA 5D9WA 1MDKA 2FWFA 3TKSA 1SL1B 4KGIA 5D8IA 4I5QA 1OE8A 3GTUB 3UVHA 3G9BA 3GN3A 3F4RA 1XZOA 4TXOB 2R0PA 3L4NA 5G31A 2NPBA 1VF1A 2D2ZA 1U3AA 5DBQA 1LU4A 1XIYA 1VF3A 1ZYQB 1EV4A 1ZYPA 3VWWA 2WVYA 5DAKB 4MZBA 3EWLA 1ML6A 1G6YA 1PRXA 1BX9A 3QDNA 4I97A 2R5GA 1S3DA 1XCCA 1OKDA 4TR4A 4YH2A 4Z2RA 1SD9A 4XHMA 3IOSA 2IN3A 2YCDA 1YEWC 2FD3A 2PN8A 1Z9HA 3ZZXA 4XS4A 13GSA 5A4VA 2ON5A 1T3BA 1W89A 3ZTLA 3HZ4A 3DMLA 4ID0A 4IKHA 2YANA 4GQCA 3W8SA 2BJXA 2FWGA 1PQNA 3GSSA 2XPEA 4E68A 2PWJA 5IMVA 3M3MA 4G9HA 5B8AA 3IPZA 2QA1A 1EOHA 3VLNA 2B5XA 3M9JA 2OJLA 3P90A 4EUYA 5D93A 3TOTA 1TU8A 2CT6A 1O8WA 1XW6A 2X8HA 1XOBA 1I1IP 5F07A 4WKWA 3KZQA 3HVXA 2WB9A 1O81A 2PVQA 1M0UA 1BYEA 3KD0A 2GZZA 4DVCA 4O92A 4GDFA 4V1Ap 1QUWA 4L0WA 1GTUA 1ABAA 3US3A 5HR1A 1GLPA 2E2MA 3TCOA 3VI5A 4RI7A 4MZCA 4ZB8A 1SENA 4I6XA 2GLRA 3EC3A 4K7NA 5E59A 5FT3A 3S9FA 4G0IA 4KW6A 3J7Yb 1UVZA 3D6IA 2HT9A 3KIJA 3HY2A 4O32A 4XRAA 2C4JA 2IFQA 3A2WA 5J47A 4KSOA 4TW5A 2DLXA 4V2NA 2JSZA 1T1VA 3UMAA 4N3ZA 3CBUA 4GCIA 2L6DA 1YEPA 4TN8A 1CQGA 4CW9A 1Z7RA 4G19A 1JLWA 4ACSA 2C3QA 5KEJA 2PVOC 2HRKB 1H75A 5B6NA 2X4AA 5G5EA 4IHUA 5IMAA 1PKWA 4WETA 1JZWA 3IAM2 3KGKA 2GS3A 4KDYA 1NSWA 2H01A 2YN1A 3TB2A 1AC1A 2DJ2A 4F0BA 5EL8A 3F4SA 3IC8A 3ED3A 3GH9A 5ECIB 3FZAA 5IMCA 4K9ZA 3FR3A 2VL9A 2NDOA 3D5JA 4KH7A 4HOJA 3A5IA 16GSA 3WGEA 5ECKB 3H93A 4MF7A 4Q5RA 1JZRA 4PUFC 4WF5A 4FYCA 1V40A 4YQVA 4IQAA 4KA0A 11GSA 3GTUA 2EFHA 2P5RA 4TXOA 5J4UA 4ECBA 4V1Ag 1GLQA 5C00A 1EGOA 4AKGA 1J08A 3CRUA 1MDIA 3V1WA 4GSSA 6GSXA 3KTBA 3O6TA 4EC0A 4OO5A 3F0IA 5F05A 4OO4A 1YVLA 2LQOA 3UBKA 1FAAA 1U6TA 1F9MA 3MDKA 4BWQA 3PPUA 5DAKA 4I2TA 5AGYA 5HR2A 2RM6A 1SK2A 1WOUA 4L5OA 3Q74A 1ZOFA 5ID2A 3APQA 1DUGA 4QQ7A 3KTLA 2IMEA 2ZCTA 5C04A 2X8GA 2H19A 2R2JA 3ME7A 5ELGA 2VOCA 5CREA 5KN2A 3C71A 3DEXA 3Q6OA 1K0NA 1OC9B 1JHBA 3O3TA 4MJBA 2H30A 1GTAA 2R3XA 4L8EA 4K5SA 4K6XA 4Z2TA 5HQPA 1K3YA 2X99A 4POLA 5JWRB 1HYUA 1O8XA 4ZL8A 2M80A 2VCVA 14GSA 1GNEA 3LQ7A 4QMKA 1GL8A 1GSEA 3F8UA 2RM5A 3J7Yk 2C0EA 1GH2A 2QGVA 5A4WA 3IDVA 3NOFA 3QFAC 4F9ZA 4PHZC 2VKZG 1TK8B 2GDRA 3EU3A 2V1MA 4JZQA 5ABRA 4IELA 4XIHA 1A24A 2XHFA 2OKAA 3KXOA 4HUAA 2YZHA 4K7OA 3APSA 1PD21 1C72A 2AAWA 4MJEA 2GZYA 2PBJA 2LQQA 1K0DA 5HFGA 4DEJA 1DBYA 4JU5A 3HYPA 3A5WA 1M99A 3G7IA 4NXIA 2BTOT 2IWTA 4PI0C 2H71A 2OE0A 4J57E 3NIVA 5CNWA 4FH8A 1K0AA 4CY8A 2A4HA 5AN1A 2WULA 2YV7A 2WS2A 1I5GA 5B8BA 5IPHA 4MLYA 3HVVA 4PQIA 2IL3A 5KOWA 5J9CA 3A3TA 1ERVA 2LJAA 3EE2A 1QGVA 3ZVJD 2EFEA 4GTUA 2I9HA 1LJRA 2YWMA 2VCQA 2FGXA 4FQUA 2VCXA 1X0RA 1F37A 2G2QA 4KSMA 1Z7PA 2GT6A 3GX0A 1OVNA 5CYYA 4ZBAA 2RLIA 1YJ6A 2FWHA 2HRKA 3H8QA 4ZILA 2GSQA 2JZRA 2WVXA 2VLUA 4GLTA 2TRXA 4MP4A 1BG5A 4K1FA 2OADA 2CA8A 1GSFA 1XPVA 4JEDA 2L4QA 2DSAA 1DSBA 1EGRA 3TKQA 3L9VA 3KMNA 1M2AA 2C8UA 1DE1A 1K0MA 4NMUA 1WWJA 1X9WB 1N25A 1WP0A 6GSTA 3P8WA 1PX7A 3FEUA 5LCZA 1DE2A 4EDZA 2FNOA 2B5YA 5ECSA 1X9MB 2QSIA 2QKEA 3IC4A 4PURA 2WZ9A 1TTZA 3GKXA 4MF5A 2LKUA 4WBJA 1Y6EA 1M7TA 1TXUA 3F3QA 1NM3A 3TRPA 2IFQB 2LTKA 2WW3A 1ZYNA 3D4TA 1A8LA 3ME8A 3UAPA 4NV2A 2QC7A 5DQYA 5J5NA 3HA9A 3BBYA 4N11A 2JSYA 1BJXA 2PGTA 3HDCA 3PINA 4IQ1A 1A23A 3HJMA 2YPMA 3RHBA 2M46A 2CQ9A 1XVQA 20GSA 1TW9A 1FB6A 1GSDA 4KF9A 5J41A 5KN0A 1EP8A 3L78A 1XG8A 4EE0A 1OC9A 3TJJA 1ILOA 1FO5A 3LFLA 2DIYA 1M9AA 1Z6MA 5D9VA 1YF1A 1TRWA 5G1LA 1Q4JA 8GSSA 2H6ZA 1QQ2A 4PNFA 3KCMA 1R7HA 2UZ8A 1TDIA 1M2DA 5H5RA 1GTIA 3Q19A 1TRSA 4JR6A 2WJUA 3LXTA 6GSYA 4KAEA 3W6GA 2VM1A 2I3YA 3L9SA 4YQMA 2VCWA 1RK4A 1WPIA 1VF4A 4G0LA 3WT2A 5ECQB 3WT1A 5E4WA 2DIZA 4YAPA 2F3MA 4MDCA 3MSZA 2R6KA 4ECIA 4XS1A 1FHEA 2OACA 3LORA 1X5EA 3ZFBA 3EMPA 1Z3EA 2B1LA 4XRDA 4KDUA 2OBIA 2WW0A 3AY8A 3H1NA 1TP9A 2OA7A 2KP1A 4LA1A 3PH9A 2L57A 1TI3A 2FA4A 4ISDA 3OR5A 1MEKA 2CVKA 18GSA 1SU9A 2RIIA 1G6WA 2FLSA 3M9KA 3R3EA 2GZPA 1XW9A 4TRXA 3ZIJA 1F3BA 1GSUA 1PN9A 5ID2B 1GRXA 4ZB7A 5CRDA 2VCZA 4BVXB 3FHKA 2WW2A 3GURA 3DVWA 3GL5A 2O7KA 3LYPA 1TKDB 4G0KA 4IVFA 1XOAA 4IP6A 1V98A 3CHXC 1ACVA 4L0UA 1BG1A 1ZGNA 2HZFA 3F9UA 4ZL9A 1A2JA 3DRNA 3F63A 2H73A 2O3EA 4E8HA 4AI6A 3KH9A 3LG6A 2J23A 3VWVA 2E7PA 3GKKA 4GWRA 2VL3A 3UARA 3TKRA 3FR6A 1EV9A 5H5QA 2VD0A 3DVXA 3QPMA 3ZRDA 3M1GA 1ZZYA 5J40A 1B9YC 3A2XA 4YQUA 3TJKA 2OT3A 4KNDA 2C0DA 3QAVA 5ECLB 3IA1A 4MK3A 1AIUA 2CAQA 3RGBC 4ZB6A 3UEMA 5DQSA 3ZFLA 2VL2A 4HZ2A 2PMTA 4USSA 12GSA 2WZSA 5IMDA 5A5KA 1A2MA 4ZIJA 1X5CA 2XC2A 2CZ2A 2ZUPA 4OMVA 5ECPB 1O85A 5HR3A 4EDYA 3KJYA 3QAWA 5KOXA 4D73B 4EL1A 5IMZA 2HSHA 4WF4A 4IJ3A 3MIXA 1SYRA 2WCIA 1G0TA 3M0FA 1SKRB 4MPGA 5BRTA 1S3CA 4F2IA 2PERA 2H1LA 1V57A 1NW2A 3ZVJA 1EOGA 4MPFA 5GZZB 4MZWA 5JCWA 3KMOA 3HKRA 3VI7A 2EIRA 1JZDA 2IPAA 3UL3A 2WVXB 2MMOA 4ZL7A 3RHCA 1SL0B 5IMFA 4HU7A 5B6MA 4HU9A 2H0GA 5COHA 5EVOA 1SJIA 2WDUA 2FCHA 5J4YA 2MBSA 3GX8A 9GSSA 3VWXA 2M72A 2NBSA 1R5AA 2AYTA 3TJBA 1O6JA 1VF2A 5ECMB 2H76A 5GSTA 3ERWA 4Q5QA 4YKFA 4FIWA 2RUFA 1ST9A 2VUPA 2O5VA 2VCTA 2VIMA 3VPTA 1MD3A 2V6OA 4KB3A 2I4AA 2LRNA 3ZITA 4X43A 5ECNB 4L5LA 1AUCA 3TRQA 1R26A 3GFKA 2I81A 5GAPD 3TRXA 4PXOA 1XW5A 1YDKA 4ULXA 3D21A 3GSTA 1SJ6A 2VM2A 17GSA 1N8JA 3I43A 3C1SA 1ZMAA 4MJCA 2K6VA 3PR8A 4FO5A 4XCSA 5DALB 2MBTA 5A34B 2VO4A 2HXKA 4PGTA 2MYGA 10GSA 2LNTA 4BVXA 2FUG2 4HQSA 1JLVA 4GRFA 2F8FA 2HRFA 3RPNA 1OC3A 3UOMA 2GQLA 2R0GA 1ZCPA 5ECRB 1PL1A 2GQMA 2CV4A 4WR5A 3IBHA 4POBA 2KHPA 1U87A 2I1UA 2CX4A 4YKGA 1K0OA 2FHEA 1A2LA 3GKNA 3ERGA 3FW2A 2P31A 2JACA 4G2EA 5FHIA 1NHYA 5KN3A 2FA8A 2CVBA 1SL2B 3L9UA 4AJ8A 5CRWA 2EFCA 3EURA 3QCPA 3EINA 1FB0A 2B7JA 4BL7A 3IHGA 3UJ1A 4N0VA 2LUSA 5G5FA 2H66A 4JR4A 1HNBA 1KTEA 1ZL9A 1O7UA 3W8JA 3KEBA 1KEBA 3TDGA 2WFCA 1THOA 3G7YA 4DSQA 1FVKA 2LNSA 1AW9A 3IXRA 2YWOA 2VD1A 3LSZA 2GSRA 3WD6A 2WVZA 2DMMA 1KBNA 2L4CA 5LNKe 4EIQA 2LV3A 4WR4A 1JFUA 1PN0A 1BAYA 2HSMB 2DJKA 3GYKA 3MAKA 4AJ6A 4CDOA 1SYXA 4A5PA 4TR3A 1F3AA 4NAXA 1ERUA 4D73A 3VURA 2WRTA 2L5LA 4TOPA 2GQKA 4PQHA 3ZLPA 4BIKA 3LWAA 5DCHA 4BVYB 1HQOA 3ZMKA 4OFMA 4OD7A 4AKXB 2B7KA 3BOAA 3LXZA 3QD9A 2DJ3A 3A2VA 4I8BA 2NTOA 4ZBBA 2L5OA 3EU4A 2F51A 3HCZA 3TKSE 3EMXA 3D22A 4K0GA 1TXXA 5IO0A 4AGSA 1YKCA 2EFDA 4HI7A 2K8VA 4Q5NA 4WEYA 1R4WA 5A1NA 4HSCX 5J9BA 5H5SA 2HE3A 4RQXA 2HRNA 4IJIA 4G10A 4X0XA 2V2GA 2C0GA 2AUVA 2HSYA 4HDEA 6GSUA 3QR6A 5IOWA 2O36A 3QAGA 2HI7A 4POMA 3D4MA 1CQHA 4LMWA 2J9HA 1R5PA 2K8SA 1HNCA 3R2QA 5B7CA 2VAFA 4PUAA 1XWGA 2H8LA 2H0IA 3DD3A 5L71A 5F8BA 1QMVA 4MABA 4NWYA 3CTGA 3MNGA 5HR0A 3GHAA 3LEFA 1U88A 4QL9A 1A0FA 2DJ0A 2X8CA 1SKWB 4RUVA 2B6MA 2A4VA 1S3RA 2CAIA 2YOIA 3E9JB 3CSJA 3TKSC 1MDJA 2YWNA 3HJPA 3IE3A 1USBA 4ECCA 2C1YA 3DIEA 4AKHA 4EF0A 4BWSA 5DALA 5A34A 1PGTA 4X4JA 1V9WA 3TKPA 3RPPA 1J9BA 1GNWA 4JE1A 1K3OA 4XTSA 4ZXGA 3RFRC 2CVDA 2B1KA 3WGDA 2O85A 1PX6A 1WMJA 2PU9C 5ECOB 2DJJA 4TR0A 3CRTA 4GXZA 3CSHA 4IS0A 3HVSA 5LD0A 2LEGA 4P3YB 3LW9A 4HZ4A 1OC8A 2YV9A 5A4UA 1SD8A 3CYNA 2DBCA 2HZEA 4FYUA 4F82A 3M8NA 5DJLA 1FOHA 3MWHA 1OKTA 4K0NA 3HMJG 1B9XC 3EPTA 2MZCA 4Z7XA 3I6AA 1WE0A 2GTUA 2H1AA 2ES7A 5HFIA 1RQMA 5D9TA 1A0RP 3IRAA 3CTFA 1EEMA 2ZNMA 3P2AA 4IGJA 1GULA 1X9SB 1BEDA 2YP6A 3GMFA 1PFOA 2JZSA 4ECJA 3GV1A 2R4VA 1EP7A 4TXVA 1S3AA 2GT5A 5IIZA 1SVLA 2C80A 2JL4A 2JADA 3ZL5A 1TK5B 3I69A 3GKMA 2HFDA 2R0CA
chains in the Genus database with same CATH topology
2HSMA 2WGRA 1ERWA 2KUCA 4EVMA 5ENUA 1EZKA 2RUEA 2TIRA 1SKSB 4AF2A 1H4OA 2E2GA 2VL2C 2KOKA 1TI1A 4BVYA 5J4VA 5GSSA 4MNNA 2A2RA 3DGQA 5ECHB 5CAXA 5CRGA 5GAND 3O76A 2FWEA 2UV8G 1K3LA 1TRUA 1XBSA 4ML1A 1YZXA 1XFLA 2DKIA 2L6CA 3C73A 5CP1A 5JWQB 5IOXA 2ON7A 1XXUA 4QL7A 3VFIA 2ALBA 2IMKA 1YF0A 3IR4A 1HD2A 2AHEA 1GP1A 1FOVA 1THXA 1UN2A 2YNXA 1AQWA 1ON4A 3LYKA 3Q18A 3L0HA 4BL7B 1SK0A 1WIKA 4EIPA 1ZYEA 4TKYA 5D9XA 3BCIA 2LRCA 3DKSA 5JCUA 3TJFA 3ZYWA 4N30A 1GTBA 2L59A 1MD4A 1T00A 5DVBA 3GRXA 4HJMA 2F9SA 2H1GA 1GUKA 2FY6A 2DC5A 3NZNA 1K0CA 3H4KA 1FG4A 3U5RE 4W66A 4ZBDA 5CRHA 4HQZA 1KNGA 1T8EB 2X64A 1Q98A 4MCUA 4AKIA 1URMA 2V41A 1F2EA 1M9BA 4GSTA 1V58A 1PSQA 5EY6A 4DSRA 3E0UA 3BJ5A 1YKAA 1YY7A 3RDWA 1Y1UA 2N5FA 2CZ3A 5D96A 4ICYA 3D0ZA 2LRTA 4TR1B 3FY7A 1G7EA 1SK1A 4EO3A 1JZOA 4POKA 3KP8A 1F6MC 2IMIA 3I9V2 4I2UA 2H0HA 5A1NB 2IMDA 2TRCP 3FRCA 4Q5FA 3IK9A 3C1RA 1PMTA 4H86A 1B48A 5CO3A 2H6XA 4YAVA 3FMWA 5IQYA 5A5HB 5FWGA 2A2SA 1TK0B 3VPQA 6GSVA 1RW1A 5G30A 3GUSA 4HEA2 5D73A 3RAZA 2XBIA 2H70A 3UBLA 4AJ7A 2EC4A 4GF0A 1G7OA 1A8YA 2PUKC 1XWBA 1PL2A 1BQ7A 1Z5YE 1TRVA 2C3NA 2LJRA 4LMVA 3H79A 4KE3A 4DSSA 1AQVA 3APOA 3QFBC 5BMUA 4RI6A 4PNGA 2YZUA 3QMXA 2GGTA 3FR9A 3C8EA 2IJYA 1EWXA 2H75A 4Z2UA 1VGLA 2PPTA 2X49A 2YJ7A 1WJKA 2HNLA 2CX3A 5F06A 2XPDA 2H6YA 22GSA 4MH3A 2MMNA 5G1KA 3E3EA 2GVPA 3GIXA 4NV5A 2K18A 2LSTA 4N0ZA 3F3RA 1LBKA 3RBTA 4PTSA 4ZB9A 4O7HA 3SWLA 1OAZA 3EYTA 3VK9A 2E0QA 4KCAA 1QFNA 4KX4A 1K0BA 4F0CA 3G7JA 3QOUA 3U6VA 2O89A 1ERTA 3HZ8A 3KM6A 4OFNA 2H1DA 3HHVA 2DMLA 4K8MA 4MA9A 4O5RA 4J56E 2BMXA 2XBQA 6GSWA 3UVTA 4N10A 1OYJA 3WGXA 3FZ5A 3CXGA 2HLSA 1WRYA 1PKZA 2HZEB 4X1UA 5AIXA 4E8EA 4MH2A 1IYHA 4ML6A 2HSNB 4K2XA 4OCEA 1E2YA 2JU5A 2DJ1A 2LJKA 4NPBA 1OE7A 5ELAA 2AJQB 4IP1A 1B4QA 3IV4A 2KLXA 5KN1A 2LS5A 5AIVA 4RQRA 4O5UA 2H72A 1O73A 4NHWA 3SBCA 5IPGA 3P7XA 3GL3A 5JWOB 2C3TA 2H1BA 7GSSA 3DYRA 4J2FA 2YJHA 3LJRA 4HJ2A 4K5RA 5DDLA 2N5AA 4MF6A 2GSSA 4MMMA 1B4PA 4IN0A 1AXDA 2B5EA 1TOFA 1B8XA 3CWGA 5INYA 2DKHA 1AAZA 3VWUA 3IHQA 3BD2A 2OBKA 1N2AA 1UC7A 2Z9SA 4V2MA 1GUHA 4HS1A 3F6FA 1SVOA 3K8NA 4TR1A 4CHSA 1PA3A 3N5OA 1XWCA 6GSSA 1J0FA 5JCGA 3ZREA 2V32A 1FW1A 4LL1B 5DCGA 1GUMA 4EKZA 2AV4A 4XS4B 1QK8A 5IO2A 3DWVA 3LGCA 1T4YA 2F8AA 4XS6A 2JZTA 1AQXA 4LLRA 4NHZA 3GA4A 2QA2A 1TU7A 3TUEA 5A5HA 1Y25A 5AISA 4IW9A 2MMZA 4KCEA 3IK7A 1QXHA 2VLTA 3IAS2 1X5DA 3TJGA 2O8VB 3UIWA 3FYGA 3CSIA 3FZ9A 2NVLA 4BA7A 2P5QA 5DJMA 3HXSA 1FVJA 4ILFA 2H74A 3KH7A 2AB6A 1GSYA 2IIYA 4MJAA 2C0FA 3BCKA 3KP9A 2V6KA 1GSQA 1XVWA 4OCFA 3MYDA 1GSSA 3DXBA 4JRRA 3WYWA 4TVEA 2A2PA 2R37A 2HRAA 2EIOA 3EVIA 3JCML 4GSNA 3HD5A 1V2AA 2IMFA 2YWIA 3HJOA 2O87A 4PQ1A 5F0GA 4G01A 2GSTA 1T7PB 1U3IA 2N5BA 4WBRD 3F6DA 2K9FA 4EXJA 2P0GA 2HQTA 2EIQA 1UA5A 1XWAA 4LL4B 1GWCA 2REMA 1YQ1A 3FZ4A 4WXTA 1IYIA 3TGZA 3TU3B 2VLVA 4V2LA 4JBBA 2OE3A 1NHOA 1Z6NA 4OWYA 2MMAA 2OE1A 3ISOA 1I9DA 4K7IA 3CMIA 1W4VA 3ERFA 3GH6A 5HFKA 4BPYA 3TOUA 1E6BA 4F03A 4OFTA 5G2ZA 1XWKA 1HNAA 1VRSD 2KP2A 2HYXA 5J3RA 4GQFA 4KUNA 4KDXA 2B3SA 2HSNA 3PGTA 4CY6A 5EPFA 3F4TA 19GSA 3C7MA 3ZIVA 4FYBA 1BF5A 1SJZA 2G0FA 4PX1A 1TJDA 5IM9A 1SVMA 4DSSB 1T4ZA 3FK8A 3N9JA 1MTCA 4IBPA 1M2BA 3FKFA 5BMUB 4K2DA 1YEXA 1EEJA 3GNJA 4O5QA 3ZMLA 5D9WA 1MDKA 2FWFA 3TKSA 1SL1B 4KGIA 5D8IA 4I5QA 1OE8A 3GTUB 3UVHA 3G9BA 3GN3A 3F4RA 1XZOA 4TXOB 2R0PA 3L4NA 5G31A 2NPBA 1VF1A 2D2ZA 1U3AA 5DBQA 1LU4A 1XIYA 1VF3A 1ZYQB 1EV4A 1ZYPA 3VWWA 5DAKB 4MZBA 3EWLA 1ML6A 1G6YA 1PRXA 1BX9A 3QDNA 4I97A 2R5GA 1S3DA 1XCCA 1OKDA 4TR4A 4YH2A 4Z2RA 1SD9A 4XHMA 3IOSA 2IN3A 2YCDA 2FD3A 2PN8A 1Z9HA 3ZZXA 4XS4A 13GSA 5A4VA 2ON5A 1T3BA 1W89A 3ZTLA 3HZ4A 3DMLA 4ID0A 4IKHA 2YANA 4GQCA 3W8SA 2BJXA 2FWGA 1PQNA 3GSSA 2XPEA 4E68A 2PWJA 5IMVA 3M3MA 4G9HA 5B8AA 3IPZA 2QA1A 1EOHA 3VLNA 2B5XA 3M9JA 2OJLA 3P90A 4EUYA 5D93A 3TOTA 1TU8A 2CT6A 1O8WA 1XW6A 2X8HA 1XOBA 5F07A 4WKWA 3KZQA 3HVXA 2WB9A 1O81A 2PVQA 1M0UA 1BYEA 3KD0A 2GZZA 4DVCA 4O92A 4GDFA 4V1Ap 1QUWA 4L0WA 1GTUA 1ABAA 3US3A 5HR1A 1GLPA 2E2MA 3TCOA 3VI5A 4RI7A 4MZCA 4ZB8A 1SENA 4I6XA 2GLRA 3EC3A 4K7NA 5E59A 5FT3A 3S9FA 4G0IA 4KW6A 3J7Yb 1UVZA 3D6IA 2HT9A 3KIJA 3HY2A 4O32A 4XRAA 2C4JA 2IFQA 3A2WA 5J47A 4KSOA 4TW5A 2DLXA 4V2NA 2JSZA 1T1VA 3UMAA 4N3ZA 3CBUA 4GCIA 2L6DA 1YEPA 4TN8A 1CQGA 4CW9A 1Z7RA 4G19A 1JLWA 4ACSA 2C3QA 5KEJA 2PVOC 2HRKB 1H75A 5B6NA 2X4AA 5G5EA 4IHUA 5IMAA 1PKWA 4WETA 1JZWA 3IAM2 3KGKA 2GS3A 4KDYA 1NSWA 2H01A 2YN1A 3TB2A 1AC1A 2DJ2A 4F0BA 5EL8A 3F4SA 3IC8A 3ED3A 3GH9A 5ECIB 3FZAA 5IMCA 4K9ZA 3FR3A 2VL9A 2NDOA 3D5JA 4KH7A 4HOJA 3A5IA 16GSA 3WGEA 5ECKB 3H93A 4MF7A 4Q5RA 1JZRA 4PUFC 4WF5A 4FYCA 1V40A 4YQVA 4IQAA 4KA0A 11GSA 3GTUA 2EFHA 2P5RA 4TXOA 5J4UA 4ECBA 4V1Ag 1GLQA 5C00A 1EGOA 4AKGA 1J08A 3CRUA 1MDIA 3V1WA 4GSSA 6GSXA 3KTBA 2HFDA 3O6TA 4EC0A 4OO5A 3F0IA 5F05A 4OO4A 1YVLA 2LQOA 3UBKA 1FAAA 1U6TA 1F9MA 3MDKA 4BWQA 3PPUA 5DAKA 4I2TA 5AGYA 5HR2A 2RM6A 1SK2A 1WOUA 4L5OA 3Q74A 1ZOFA 5ID2A 3APQA 1DUGA 4QQ7A 3KTLA 2IMEA 2ZCTA 5C04A 2X8GA 2H19A 2R2JA 3ME7A 5ELGA 2VOCA 5CREA 5KN2A 3C71A 3DEXA 3Q6OA 1K0NA 1OC9B 1JHBA 3O3TA 4MJBA 2H30A 1GTAA 2R3XA 4L8EA 4K5SA 4K6XA 4Z2TA 5HQPA 1K3YA 2X99A 4POLA 5JWRB 1HYUA 1O8XA 4ZL8A 2M80A 2VCVA 14GSA 1GNEA 3LQ7A 4QMKA 1GL8A 1GSEA 3F8UA 2RM5A 3J7Yk 2C0EA 1GH2A 2QGVA 5A4WA 3IDVA 3NOFA 3QFAC 4F9ZA 2VKZG 1TK8B 2GDRA 3EU3A 2V1MA 4JZQA 5ABRA 4IELA 4XIHA 1A24A 2XHFA 2OKAA 3KXOA 4HUAA 2YZHA 4K7OA 3APSA 1PD21 1C72A 2AAWA 4MJEA 2GZYA 2PBJA 2LQQA 1K0DA 5HFGA 4DEJA 1DBYA 4JU5A 3HYPA 3A5WA 1M99A 3G7IA 4NXIA 2BTOT 2IWTA 2H71A 2OE0A 4J57E 3NIVA 5CNWA 4FH8A 1K0AA 4CY8A 2A4HA 5AN1A 2WULA 2YV7A 2WS2A 1I5GA 5B8BA 5IPHA 4MLYA 3HVVA 4PQIA 2IL3A 5KOWA 5J9CA 3A3TA 1ERVA 2LJAA 3EE2A 1QGVA 3ZVJD 2EFEA 4GTUA 2I9HA 1LJRA 2YWMA 2VCQA 2FGXA 4FQUA 2VCXA 1X0RA 1F37A 2G2QA 4KSMA 1Z7PA 2GT6A 3GX0A 1OVNA 5CYYA 4ZBAA 2RLIA 1YJ6A 2FWHA 2HRKA 3H8QA 4ZILA 2GSQA 2JZRA 2VLUA 4GLTA 2TRXA 4MP4A 1BG5A 4K1FA 2OADA 2CA8A 1GSFA 1XPVA 4JEDA 2L4QA 2DSAA 1DSBA 1EGRA 3TKQA 3L9VA 3KMNA 1M2AA 2C8UA 1DE1A 1K0MA 4NMUA 1WWJA 1X9WB 1N25A 1WP0A 6GSTA 3P8WA 1PX7A 3FEUA 5LCZA 1DE2A 4EDZA 2FNOA 2B5YA 5ECSA 1X9MB 2QSIA 2QKEA 3IC4A 4PURA 2WZ9A 1TTZA 3GKXA 4MF5A 2LKUA 4WBJA 1Y6EA 1M7TA 1TXUA 3F3QA 1NM3A 3TRPA 2IFQB 2LTKA 3D4TA 1ZYNA 1A8LA 3ME8A 3UAPA 4NV2A 2QC7A 5DQYA 5J5NA 3HA9A 3BBYA 4N11A 2JSYA 1BJXA 2PGTA 3HDCA 3PINA 4IQ1A 1A23A 3HJMA 2YPMA 3RHBA 2M46A 2CQ9A 1XVQA 20GSA 1TW9A 1FB6A 1GSDA 4KF9A 5J41A 5KN0A 1EP8A 4EE0A 1OC9A 3TJJA 1ILOA 1FO5A 3LFLA 2DIYA 1M9AA 1Z6MA 5D9VA 1YF1A 1TRWA 5G1LA 1Q4JA 8GSSA 2H6ZA 1QQ2A 4PNFA 3KCMA 1R7HA 2UZ8A 1TDIA 1M2DA 5H5RA 1GTIA 3Q19A 1TRSA 4JR6A 2WJUA 3LXTA 6GSYA 4KAEA 3W6GA 2VM1A 2I3YA 3L9SA 4YQMA 2VCWA 1RK4A 1WPIA 1VF4A 4G0LA 3WT2A 5ECQB 3WT1A 5E4WA 2DIZA 4YAPA 2F3MA 4MDCA 3MSZA 2R6KA 4ECIA 4XS1A 1FHEA 2OACA 3LORA 1X5EA 3ZFBA 3EMPA 1Z3EA 2B1LA 4XRDA 4KDUA 2OBIA 3AY8A 3H1NA 1TP9A 2OA7A 2KP1A 4LA1A 3PH9A 2L57A 1TI3A 2FA4A 4ISDA 3OR5A 1MEKA 2CVKA 18GSA 1SU9A 2RIIA 1G6WA 2FLSA 3M9KA 3R3EA 2GZPA 1XW9A 4TRXA 3ZIJA 1F3BA 1GSUA 1PN9A 5ID2B 1GRXA 4ZB7A 5CRDA 2VCZA 4BVXB 3FHKA 3GURA 3DVWA 3GL5A 2O7KA 3LYPA 1TKDB 4G0KA 4IVFA 1XOAA 4IP6A 1V98A 1ACVA 4L0UA 1BG1A 1ZGNA 2HZFA 3F9UA 4ZL9A 1A2JA 3DRNA 3F63A 2H73A 4E8HA 4AI6A 3KH9A 3LG6A 2J23A 3VWVA 2E7PA 3GKKA 4GWRA 2VL3A 3UARA 3TKRA 3FR6A 1EV9A 5H5QA 2VD0A 3DVXA 3QPMA 3ZRDA 3M1GA 1ZZYA 5J40A 1B9YC 3A2XA 4YQUA 3TJKA 2OT3A 4KNDA 2C0DA 3QAVA 5ECLB 3IA1A 4MK3A 1AIUA 2CAQA 4ZB6A 3UEMA 5DQSA 3ZFLA 2VL2A 4HZ2A 2PMTA 4USSA 12GSA 5IMDA 5A5KA 1A2MA 4ZIJA 1X5CA 2XC2A 2CZ2A 2ZUPA 4OMVA 5ECPB 1O85A 5HR3A 4EDYA 3KJYA 3QAWA 5KOXA 4D73B 4EL1A 5IMZA 2HSHA 4WF4A 4IJ3A 3MIXA 1SYRA 2WCIA 1G0TA 3M0FA 1SKRB 4MPGA 5BRTA 1S3CA 4F2IA 2PERA 2H1LA 1V57A 1NW2A 3ZVJA 1EOGA 4MPFA 5GZZB 4MZWA 5JCWA 3KMOA 3HKRA 3VI7A 2EIRA 1JZDA 2IPAA 3UL3A 2MMOA 4ZL7A 3RHCA 1SL0B 5IMFA 4HU7A 5B6MA 4HU9A 2H0GA 5COHA 5EVOA 1SJIA 2WDUA 2FCHA 5J4YA 2MBSA 3GX8A 9GSSA 3VWXA 2M72A 2NBSA 1R5AA 2AYTA 3TJBA 1O6JA 1VF2A 5ECMB 2H76A 5GSTA 3ERWA 4Q5QA 4YKFA 4FIWA 2RUFA 1ST9A 2VUPA 2O5VA 2VCTA 2VIMA 3VPTA 1MD3A 2V6OA 4KB3A 2I4AA 2LRNA 3ZITA 4X43A 5ECNB 4L5LA 1AUCA 3TRQA 1R26A 3GFKA 2I81A 5GAPD 3TRXA 4PXOA 1XW5A 1YDKA 4ULXA 3D21A 3GSTA 1SJ6A 2VM2A 17GSA 1N8JA 3I43A 3C1SA 1ZMAA 4MJCA 2K6VA 3PR8A 4FO5A 4XCSA 5DALB 2MBTA 5A34B 2VO4A 2HXKA 4PGTA 2MYGA 10GSA 2LNTA 4BVXA 2FUG2 4HQSA 1JLVA 4GRFA 2F8FA 2HRFA 3RPNA 1OC3A 3UOMA 2GQLA 2R0GA 1ZCPA 5ECRB 1PL1A 2GQMA 2CV4A 4WR5A 3IBHA 4POBA 2KHPA 1U87A 2I1UA 2CX4A 4YKGA 1K0OA 2FHEA 1A2LA 3GKNA 3ERGA 3FW2A 2P31A 2JACA 4G2EA 5FHIA 1NHYA 5KN3A 2FA8A 2CVBA 1SL2B 3L9UA 4AJ8A 5CRWA 2EFCA 3EURA 3QCPA 3EINA 1FB0A 2B7JA 4BL7A 3IHGA 3UJ1A 4N0VA 2LUSA 5G5FA 2H66A 4JR4A 1HNBA 1KTEA 1ZL9A 1O7UA 3W8JA 3KEBA 1KEBA 3TDGA 2WFCA 1THOA 3G7YA 4DSQA 1FVKA 2LNSA 1AW9A 3IXRA 2YWOA 2VD1A 3LSZA 2GSRA 3WD6A 2DMMA 1KBNA 2L4CA 5LNKe 4EIQA 2LV3A 4WR4A 1JFUA 1PN0A 1BAYA 2HSMB 2DJKA 3GYKA 3MAKA 4AJ6A 4CDOA 1SYXA 4A5PA 4TR3A 1F3AA 4NAXA 1ERUA 4D73A 3VURA 2WRTA 2L5LA 4TOPA 2GQKA 4PQHA 3ZLPA 3LWAA 5DCHA 4BVYB 1HQOA 3ZMKA 4OFMA 4OD7A 4AKXB 2B7KA 3BOAA 3LXZA 3QD9A 2DJ3A 3A2VA 4I8BA 2NTOA 4ZBBA 2L5OA 3EU4A 2F51A 3HCZA 3TKSE 3EMXA 3D22A 4K0GA 1TXXA 5IO0A 4AGSA 1YKCA 2EFDA 4HI7A 2K8VA 4Q5NA 4WEYA 1R4WA 5A1NA 5J9BA 5H5SA 2HE3A 4RQXA 2HRNA 4IJIA 4G10A 4X0XA 2V2GA 2C0GA 2AUVA 2HSYA 4HDEA 6GSUA 3QR6A 5IOWA 3QAGA 2HI7A 4POMA 3D4MA 1CQHA 4LMWA 2J9HA 1R5PA 2K8SA 1HNCA 3R2QA 5B7CA 2VAFA 4PUAA 1XWGA 2H8LA 2H0IA 3DD3A 5L71A 5F8BA 1QMVA 4MABA 4NWYA 3CTGA 3MNGA 5HR0A 3GHAA 3LEFA 1U88A 4QL9A 1A0FA 2DJ0A 2X8CA 1SKWB 4RUVA 2B6MA 2A4VA 2CAIA 2YOIA 3E9JB 3CSJA 3TKSC 1MDJA 2YWNA 3HJPA 3IE3A 1USBA 4ECCA 2C1YA 3DIEA 4AKHA 4EF0A 4BWSA 5DALA 5A34A 1PGTA 4X4JA 1V9WA 3TKPA 3RPPA 1J9BA 1GNWA 4JE1A 1K3OA 4XTSA 4ZXGA 2CVDA 2B1KA 3WGDA 2O85A 1PX6A 1WMJA 2PU9C 5ECOB 2DJJA 4TR0A 3CRTA 4GXZA 3CSHA 4IS0A 3HVSA 5LD0A 2LEGA 4P3YB 3LW9A 4HZ4A 1OC8A 2YV9A 5A4UA 1SD8A 3CYNA 2DBCA 2HZEA 4FYUA 4F82A 3M8NA 5DJLA 1FOHA 3MWHA 1OKTA 4K0NA 3HMJG 1B9XC 3EPTA 2MZCA 4Z7XA 3I6AA 1WE0A 2GTUA 2H1AA 2ES7A 5HFIA 1RQMA 5D9TA 1A0RP 3IRAA 3CTFA 1EEMA 2ZNMA 3P2AA 4IGJA 1GULA 1X9SB 1BEDA 2YP6A 3GMFA 2JZSA 4ECJA 3GV1A 2R4VA 1EP7A 4TXVA 1S3AA 2GT5A 5IIZA 1SVLA 2C80A 2JL4A 2JADA 3ZL5A 1TK5B 3I69A 3GKMA 3L78A 2R0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSM A;  2WGR A;  1ERW A;  2KUC A;  4EVM A;  5ENU A;  1EZK A;  2RUE A;  2TIR A;  1SKS B;  4AF2 A;  1H4O A;  2E2G A;  2VL2 C;  2KOK A;  1TI1 A;  4BVY A;  5GSS A;  2A2R A;  3DGQ A;  5ECH B;  5CAX A;  5CRG A;  5GAN D;  3O76 A;  2FWE A;  1K3L A;  1TRU A;  1XBS A;  4ML1 A;  1YZX A;  1XFL A;  5CP1 A;  2L6C A;  3C73 A;  5JWQ B;  5IOX A;  2ON7 A;  1XXU A;  4QL7 A;  3VFI A;  2ALB A;  2IMK A;  1YF0 A;  3IR4 A;  1HD2 A;  2AHE A;  1GP1 A;  1FOV A;  1THX A;  1UN2 A;  2YNX A;  1AQW A;  1ON4 A;  3LYK A;  3Q18 A;  3L0H A;  4BL7 B;  1SK0 A;  1WIK A;  1ZYE A;  4TKY A;  5D9X A;  3BCI A;  2LRC A;  3DKS A;  5JCU A;  3TJF A;  3ZYW A;  4N30 A;  1GTB A;  2L59 A;  1MD4 A;  1T00 A;  5DVB A;  3GRX A;  4HJM A;  2F9S A;  2H1G A;  1GUK A;  2FY6 A;  2DC5 A;  3NZN A;  1K0C A;  3H4K A;  1FG4 A;  3U5R E;  4ZBD A;  5CRH A;  4HQZ A;  1KNG A;  1T8E B;  2X64 A;  1Q98 A;  4MCU A;  1URM A;  2V41 A;  1F2E A;  1M9B A;  4GST A;  1V58 A;  1PSQ A;  5EY6 A;  4DSR A;  3E0U A;  3BJ5 A;  1YKA A;  1YY7 A;  3RDW A;  2N5F A;  2CZ3 A;  5D96 A;  3D0Z A;  2LRT A;  4TR1 B;  3FY7 A;  1G7E A;  1SK1 A;  4EO3 A;  1JZO A;  4POK A;  3KP8 A;  1F6M C;  2IMI A;  3I9V 2;  4I2U A;  2H0H A;  2IMD A;  2TRC P;  3FRC A;  4Q5F A;  3IK9 A;  3C1R A;  1PMT A;  4H86 A;  1B48 A;  5CO3 A;  2H6X A;  4YAV A;  5IQY A;  5FWG A;  2A2S A;  1TK0 B;  3VPQ A;  6GSV A;  1RW1 A;  5G30 A;  3GUS A;  4HEA 2;  5D73 A;  3RAZ A;  2XBI A;  2H70 A;  3UBL A;  4AJ7 A;  2EC4 A;  4GF0 A;  1G7O A;  1A8Y A;  2PUK C;  1XWB A;  1PL2 A;  1BQ7 A;  1Z5Y E;  1TRV A;  2C3N A;  2LJR A;  4LMV A;  3H79 A;  4KE3 A;  4DSS A;  1AQV A;  3APO A;  3QFB C;  5BMU A;  4RI6 A;  4PNG A;  2YZU A;  3QMX A;  2GGT A;  3FR9 A;  3C8E A;  2IJY A;  1EWX A;  2H75 A;  1VGL A;  2PPT A;  2YJ7 A;  1WJK A;  2HNL A;  2CX3 A;  5F06 A;  2XPD A;  2H6Y A;  22GS A;  4MH3 A;  2MMN A;  5G1K A;  3E3E A;  2GVP A;  3GIX A;  4NV5 A;  2K18 A;  2LST A;  4N0Z A;  3F3R A;  1LBK A;  3RBT A;  4PTS A;  4ZB9 A;  4O7H A;  3SWL A;  1OAZ A;  3EYT A;  3VK9 A;  2E0Q A;  4KCA A;  1QFN A;  4KX4 A;  1K0B A;  4F0C A;  3G7J A;  3QOU A;  3U6V A;  2O89 A;  1ERT A;  3HZ8 A;  3KM6 A;  4OFN A;  2H1D A;  3HHV A;  2DML A;  4K8M A;  4MA9 A;  4O5R A;  4J56 E;  2BMX A;  2XBQ A;  6GSW A;  3UVT A;  4N10 A;  1OYJ A;  3WGX A;  3FZ5 A;  3CXG A;  2HLS A;  1WRY A;  1PKZ A;  2HZE B;  4X1U A;  5AIX A;  4E8E A;  4MH2 A;  1IYH A;  4ML6 A;  2HSN B;  4OCE A;  1E2Y A;  2JU5 A;  2DJ1 A;  2LJK A;  4NPB A;  1OE7 A;  5ELA A;  2AJQ B;  4IP1 A;  1B4Q A;  3IV4 A;  2KLX A;  5KN1 A;  2LS5 A;  5AIV A;  4RQR A;  2H72 A;  1O73 A;  4NHW A;  3SBC A;  5IPG A;  3P7X A;  3GL3 A;  5JWO B;  2C3T A;  2H1B A;  7GSS A;  3DYR A;  4J2F A;  2YJH A;  3LJR A;  4HJ2 A;  5DDL A;  2N5A A;  4MF6 A;  2GSS A;  4MMM A;  1B4P A;  4IN0 A;  1AXD A;  2B5E A;  1TOF A;  1B8X A;  5INY A;  1AAZ A;  3VWU A;  3IHQ A;  3BD2 A;  2OBK A;  1N2A A;  1UC7 A;  2Z9S A;  4V2M A;  1GUH A;  4HS1 A;  3F6F A;  3K8N A;  4TR1 A;  4CHS A;  1PA3 A;  3N5O A;  1XWC A;  6GSS A;  1J0F A;  5JCG A;  3ZRE A;  2V32 A;  1FW1 A;  4LL1 B;  5DCG A;  1GUM A;  4EKZ A;  2AV4 A;  4XS4 B;  1QK8 A;  5IO2 A;  3DWV A;  3LGC A;  1T4Y A;  2F8A A;  4XS6 A;  2JZT A;  1AQX A;  4LLR A;  4NHZ A;  3GA4 A;  1TU7 A;  3TUE A;  1Y25 A;  5AIS A;  4IW9 A;  2MMZ A;  4KCE A;  3IK7 A;  1QXH A;  2VLT A;  3IAS 2;  1X5D A;  3TJG A;  2O8V B;  3UIW A;  3FYG A;  3CSI A;  3FZ9 A;  2NVL A;  4BA7 A;  2P5Q A;  5DJM A;  3HXS A;  1FVJ A;  4ILF A;  2H74 A;  3KH7 A;  2AB6 A;  1GSY A;  2IIY A;  4MJA A;  2C0F A;  3BCK A;  3KP9 A;  2V6K A;  1GSQ A;  1XVW A;  4OCF A;  1GSS A;  3DXB A;  4JRR A;  3WYW A;  4TVE A;  2R37 A;  2HRA A;  2EIO A;  3EVI A;  3JCM L;  4GSN A;  3HD5 A;  1V2A A;  2IMF A;  2YWI A;  3HJO A;  2O87 A;  4PQ1 A;  5F0G A;  2GST A;  1T7P B;  1U3I A;  2N5B A;  4WBR D;  3F6D A;  2K9F A;  4EXJ A;  2P0G A;  2HQT A;  2EIQ A;  1UA5 A;  1XWA A;  4LL4 B;  1GWC A;  2REM A;  1YQ1 A;  3FZ4 A;  4WXT A;  1IYI A;  3TGZ A;  2VLV A;  4V2L A;  4JBB A;  2OE3 A;  1NHO A;  1Z6N A;  4OWY A;  2MMA A;  2OE1 A;  3ISO A;  1I9D A;  4K7I A;  3CMI A;  1W4V A;  3ERF A;  3GH6 A;  5HFK A;  4BPY A;  3TOU A;  1E6B A;  4F03 A;  4OFT A;  5G2Z A;  1XWK A;  1HNA A;  1VRS D;  2KP2 A;  2HYX A;  5J3R A;  4GQF A;  4KUN A;  4KDX A;  2B3S A;  3PGT A;  5EPF A;  3F4T A;  19GS A;  3C7M A;  3ZIV A;  4FYB A;  1SJZ A;  2G0F A;  4PX1 A;  1TJD A;  5IM9 A;  4DSS B;  1T4Z A;  3FK8 A;  3N9J A;  1MTC A;  4IBP A;  1M2B A;  3FKF A;  4K2D A;  1YEX A;  1EEJ A;  3GNJ A;  3ZML A;  5D9W A;  1MDK A;  2FWF A;  3TKS A;  1SL1 B;  4KGI A;  5D8I A;  4I5Q A;  1OE8 A;  3GTU B;  3UVH A;  3G9B A;  3GN3 A;  3F4R A;  1XZO A;  4TXO B;  3L4N A;  5G31 A;  2NPB A;  1VF1 A;  2D2Z A;  1U3A A;  5DBQ A;  1LU4 A;  1XIY A;  1VF3 A;  1ZYQ B;  1EV4 A;  3VWW A;  5DAK B;  4MZB A;  3EWL A;  1ML6 A;  1G6Y A;  1PRX A;  1BX9 A;  3QDN A;  4I97 A;  2R5G A;  1S3D A;  1XCC A;  1OKD A;  4TR4 A;  4YH2 A;  1SD9 A;  4XHM A;  3IOS A;  2IN3 A;  2YCD A;  2FD3 A;  2PN8 A;  1Z9H A;  3ZZX A;  4XS4 A;  13GS A;  5A4V A;  2ON5 A;  1T3B A;  1W89 A;  3ZTL A;  3HZ4 A;  3DML A;  4ID0 A;  4IKH A;  2YAN A;  4GQC A;  3W8S A;  2BJX A;  2FWG A;  1PQN A;  3GSS A;  2XPE A;  2PWJ A;  5IMV A;  3M3M A;  4G9H A;  5B8A A;  3IPZ A;  1EOH A;  3VLN A;  2B5X A;  3M9J A;  2OJL A;  3P90 A;  4EUY A;  5D93 A;  3TOT A;  1TU8 A;  2CT6 A;  1O8W A;  1XW6 A;  2X8H A;  1XOB A;  5F07 A;  4WKW A;  3KZQ A;  3HVX A;  2WB9 A;  1O81 A;  2PVQ A;  1M0U A;  1BYE A;  3KD0 A;  2GZZ A;  4DVC A;  4O92 A;  4V1A p;  1QUW A;  4L0W A;  1GTU A;  1ABA A;  3US3 A;  5HR1 A;  1GLP A;  2E2M A;  3TCO A;  3VI5 A;  4RI7 A;  4MZC A;  4ZB8 A;  1SEN A;  4I6X A;  2GLR A;  3EC3 A;  4K7N A;  5E59 A;  5FT3 A;  3S9F A;  4G0I A;  4KW6 A;  3J7Y b;  1UVZ A;  3D6I A;  2HT9 A;  3KIJ A;  3HY2 A;  4O32 A;  4XRA A;  2C4J A;  2IFQ A;  3A2W A;  4KSO A;  4TW5 A;  2DLX A;  4V2N A;  2JSZ A;  1T1V A;  3UMA A;  3CBU A;  4GCI A;  2L6D A;  1YEP A;  4TN8 A;  1CQG A;  4CW9 A;  1Z7R A;  4G19 A;  1JLW A;  4ACS A;  2C3Q A;  5KEJ A;  2PVO C;  2HRK B;  1H75 A;  5B6N A;  5G5E A;  4IHU A;  5IMA A;  1PKW A;  4WET A;  1JZW A;  3IAM 2;  3KGK A;  2GS3 A;  4KDY A;  1NSW A;  2H01 A;  2YN1 A;  3TB2 A;  1AC1 A;  2DJ2 A;  4F0B A;  5EL8 A;  3F4S A;  3IC8 A;  3ED3 A;  3GH9 A;  5ECI B;  3FZA A;  5IMC A;  4K9Z A;  3FR3 A;  2VL9 A;  2NDO A;  3D5J A;  4KH7 A;  4HOJ A;  16GS A;  3WGE A;  5ECK B;  3H93 A;  4MF7 A;  4Q5R A;  1JZR A;  4PUF C;  4WF5 A;  4FYC A;  1V40 A;  4YQV A;  4IQA A;  4KA0 A;  11GS A;  3GTU A;  2P5R A;  4TXO A;  5J4U A;  4ECB A;  4V1A g;  1GLQ A;  5C00 A;  1EGO A;  1J08 A;  3CRU A;  1MDI A;  3V1W A;  4GSS A;  6GSX A;  3KTB A;  2HFD A;  3O6T A;  4EC0 A;  4OO5 A;  3F0I A;  5F05 A;  4OO4 A;  2LQO A;  3UBK A;  1FAA A;  1U6T A;  1F9M A;  3MDK A;  4BWQ A;  3PPU A;  5DAK A;  4I2T A;  5AGY A;  5HR2 A;  2RM6 A;  1SK2 A;  1WOU A;  4L5O A;  3Q74 A;  1ZOF A;  5ID2 A;  3APQ A;  1DUG A;  4QQ7 A;  3KTL A;  2IME A;  2ZCT A;  5C04 A;  2X8G A;  2H19 A;  2R2J A;  3ME7 A;  5ELG A;  2VOC A;  5CRE A;  5KN2 A;  3C71 A;  3DEX A;  3Q6O A;  1K0N A;  1OC9 B;  1JHB A;  3O3T A;  4MJB A;  2H30 A;  1GTA A;  2R3X A;  4L8E A;  4K6X A;  5HQP A;  1K3Y A;  2X99 A;  4POL A;  5JWR B;  1HYU A;  1O8X A;  4ZL8 A;  2M80 A;  2VCV A;  14GS A;  1GNE A;  3LQ7 A;  1GL8 A;  1GSE A;  3F8U A;  2RM5 A;  3J7Y k;  2C0E A;  1GH2 A;  2QGV A;  5A4W A;  3IDV A;  3NOF A;  3QFA C;  4F9Z A;  1TK8 B;  2GDR A;  3EU3 A;  2V1M A;  4JZQ A;  5ABR A;  4IEL A;  4XIH A;  1A24 A;  2XHF A;  2OKA A;  3KXO A;  4HUA A;  2YZH A;  4K7O A;  3APS A;  1PD2 1;  1C72 A;  2AAW A;  4MJE A;  2GZY A;  2PBJ A;  2LQQ A;  1K0D A;  5HFG A;  4DEJ A;  1DBY A;  4JU5 A;  3HYP A;  3A5W A;  1M99 A;  3G7I A;  4NXI A;  2BTO T;  2IWT A;  2H71 A;  2OE0 A;  4J57 E;  3NIV A;  5CNW A;  4FH8 A;  1K0A A;  5AN1 A;  2WUL A;  2YV7 A;  2WS2 A;  1I5G A;  5B8B A;  5IPH A;  4MLY A;  3HVV A;  4PQI A;  2IL3 A;  5J9C A;  3A3T A;  1ERV A;  2LJA A;  3EE2 A;  1QGV A;  3ZVJ D;  4GTU A;  2I9H A;  1LJR A;  2YWM A;  2VCQ A;  2FGX A;  4FQU A;  2VCX A;  1X0R A;  1F37 A;  2G2Q A;  4KSM A;  1Z7P A;  2GT6 A;  3GX0 A;  1OVN A;  5CYY A;  4ZBA A;  2RLI A;  1YJ6 A;  2FWH A;  2HRK A;  3H8Q A;  4ZIL A;  2GSQ A;  2JZR A;  2VLU A;  4GLT A;  2TRX A;  4MP4 A;  1BG5 A;  4K1F A;  2OAD A;  2CA8 A;  1GSF A;  1XPV A;  4JED A;  2L4Q A;  2DSA A;  1DSB A;  1EGR A;  3TKQ A;  3L9V A;  3KMN A;  1M2A A;  2C8U A;  1DE1 A;  1K0M A;  4NMU A;  1WWJ A;  1X9W B;  1WP0 A;  6GST A;  3P8W A;  1PX7 A;  3FEU A;  5LCZ A;  1DE2 A;  4EDZ A;  2FNO A;  2B5Y A;  5ECS A;  1X9M B;  2QSI A;  2QKE A;  3IC4 A;  4PUR A;  2WZ9 A;  1TTZ A;  3GKX A;  4MF5 A;  2LKU A;  4WBJ A;  1Y6E A;  1M7T A;  3F3Q A;  1NM3 A;  3TRP A;  2IFQ B;  2LTK A;  3D4T A;  1A8L A;  3ME8 A;  3UAP A;  4NV2 A;  2QC7 A;  5DQY A;  5J5N A;  3HA9 A;  3BBY A;  4N11 A;  2JSY A;  1BJX A;  2PGT A;  3HDC A;  3PIN A;  4IQ1 A;  1A23 A;  3HJM A;  2YPM A;  3RHB A;  2M46 A;  2CQ9 A;  1XVQ A;  20GS A;  1TW9 A;  1FB6 A;  1GSD A;  4KF9 A;  5J41 A;  5KN0 A;  1EP8 A;  4EE0 A;  1OC9 A;  3TJJ A;  1ILO A;  1FO5 A;  3LFL A;  2DIY A;  1M9A A;  1Z6M A;  5D9V A;  1YF1 A;  1TRW A;  5G1L A;  1Q4J A;  8GSS A;  2H6Z A;  1QQ2 A;  4PNF A;  3KCM A;  1R7H A;  2UZ8 A;  1TDI A;  1M2D A;  5H5R A;  1GTI A;  3Q19 A;  1TRS A;  4JR6 A;  2WJU A;  3LXT A;  6GSY A;  4KAE A;  3W6G A;  2VM1 A;  2I3Y A;  3L9S A;  4YQM A;  2VCW A;  1RK4 A;  1WPI A;  1VF4 A;  4G0L A;  3WT2 A;  5ECQ B;  3WT1 A;  5E4W A;  2DIZ A;  4YAP A;  2F3M A;  4MDC A;  3MSZ A;  2R6K A;  4ECI A;  4XS1 A;  1FHE A;  2OAC A;  3LOR A;  1X5E A;  3ZFB A;  3EMP A;  1Z3E A;  2B1L A;  4XRD A;  4KDU A;  2OBI A;  3AY8 A;  3H1N A;  1TP9 A;  2OA7 A;  2KP1 A;  4LA1 A;  3PH9 A;  2L57 A;  1TI3 A;  2FA4 A;  4ISD A;  3OR5 A;  1MEK A;  2CVK A;  18GS A;  1SU9 A;  2RII A;  1G6W A;  2FLS A;  3M9K A;  3R3E A;  2GZP A;  1XW9 A;  4TRX A;  3ZIJ A;  1F3B A;  1GSU A;  1PN9 A;  5ID2 B;  1GRX A;  5CRD A;  2VCZ A;  4BVX B;  3FHK A;  3GUR A;  3DVW A;  3GL5 A;  2O7K A;  3LYP A;  1TKD B;  4G0K A;  4IVF A;  1XOA A;  4IP6 A;  1V98 A;  1ACV A;  4L0U A;  1ZGN A;  2HZF A;  3F9U A;  4ZL9 A;  1A2J A;  3DRN A;  3F63 A;  2H73 A;  4E8H A;  3KH9 A;  3LG6 A;  2J23 A;  3VWV A;  2E7P A;  3GKK A;  4GWR A;  2VL3 A;  3UAR A;  3TKR A;  3FR6 A;  1EV9 A;  5H5Q A;  2VD0 A;  3DVX A;  3QPM A;  3ZRD A;  3M1G A;  1ZZY A;  1B9Y C;  3A2X A;  4YQU A;  3TJK A;  4KND A;  2C0D A;  3QAV A;  5ECL B;  3IA1 A;  4MK3 A;  1AIU A;  2CAQ A;  4ZB6 A;  3UEM A;  5DQS A;  3ZFL A;  2VL2 A;  4HZ2 A;  2PMT A;  4USS A;  12GS A;  5IMD A;  5A5K A;  1A2M A;  4ZIJ A;  1X5C A;  2XC2 A;  2CZ2 A;  2ZUP A;  4OMV A;  5ECP B;  1O85 A;  5HR3 A;  4EDY A;  3KJY A;  3QAW A;  4D73 B;  4EL1 A;  5IMZ A;  2HSH A;  4WF4 A;  4IJ3 A;  1SYR A;  2WCI A;  1G0T A;  3M0F A;  1SKR B;  4MPG A;  1S3C A;  4F2I A;  2PER A;  1V57 A;  1NW2 A;  3ZVJ A;  1EOG A;  4MPF A;  5GZZ B;  4MZW A;  5JCW A;  3KMO A;  3HKR A;  3VI7 A;  2EIR A;  1JZD A;  2IPA A;  3UL3 A;  2MMO A;  4ZL7 A;  3RHC A;  1SL0 B;  5IMF A;  4HU7 A;  5B6M A;  4HU9 A;  2H0G A;  5COH A;  5EVO A;  1SJI A;  2WDU A;  2FCH A;  2MBS A;  3GX8 A;  9GSS A;  3VWX A;  2M72 A;  2NBS A;  1R5A A;  2AYT A;  3TJB A;  1O6J A;  1VF2 A;  5ECM B;  2H76 A;  5GST A;  3ERW A;  4Q5Q A;  4FIW A;  2RUF A;  1ST9 A;  2VUP A;  2VCT A;  2VIM A;  3VPT A;  1MD3 A;  2V6O A;  4KB3 A;  2I4A A;  2LRN A;  3ZIT A;  4X43 A;  5ECN B;  4L5L A;  1AUC A;  3TRQ A;  1R26 A;  3GFK A;  2I81 A;  5GAP D;  3TRX A;  4PXO A;  1XW5 A;  1YDK A;  4ULX A;  3D21 A;  3GST A;  1SJ6 A;  2VM2 A;  17GS A;  1N8J A;  3I43 A;  3C1S A;  1ZMA A;  4MJC A;  2K6V A;  3PR8 A;  4FO5 A;  4XCS A;  5DAL B;  2MBT A;  2VO4 A;  2HXK A;  4PGT A;  2MYG A;  10GS A;  2LNT A;  4BVX A;  2FUG 2;  4HQS A;  1JLV A;  4GRF A;  2F8F A;  2HRF A;  3RPN A;  1OC3 A;  3UOM A;  2GQL A;  1ZCP A;  5ECR B;  1PL1 A;  2GQM A;  2CV4 A;  4WR5 A;  3IBH A;  4POB A;  2KHP A;  1U87 A;  2I1U A;  2CX4 A;  1K0O A;  2FHE A;  1A2L A;  3GKN A;  3ERG A;  3FW2 A;  2P31 A;  2JAC A;  4G2E A;  5FHI A;  1NHY A;  5KN3 A;  2FA8 A;  2CVB A;  1SL2 B;  3L9U A;  4AJ8 A;  5CRW A;  3EUR A;  3QCP A;  3EIN A;  1FB0 A;  2B7J A;  4BL7 A;  3UJ1 A;  4N0V A;  2LUS A;  5G5F A;  2H66 A;  4JR4 A;  1HNB A;  1KTE A;  1ZL9 A;  1O7U A;  3W8J A;  3KEB A;  1KEB A;  3TDG A;  2WFC A;  1THO A;  3G7Y A;  4DSQ A;  1FVK A;  2LNS A;  1AW9 A;  3IXR A;  2YWO A;  2VD1 A;  3LSZ A;  2GSR A;  3WD6 A;  2DMM A;  1KBN A;  2L4C A;  5LNK e;  2LV3 A;  4WR4 A;  1JFU A;  1BAY A;  2HSM B;  2DJK A;  3GYK A;  3MAK A;  4AJ6 A;  4CDO A;  1SYX A;  4TR3 A;  1F3A A;  4NAX A;  1ERU A;  4D73 A;  3VUR A;  2WRT A;  2L5L A;  4TOP A;  2GQK A;  4PQH A;  3ZLP A;  3LWA A;  5DCH A;  4BVY B;  1HQO A;  3ZMK A;  4OFM A;  4OD7 A;  2B7K A;  3BOA A;  3LXZ A;  3QD9 A;  2DJ3 A;  3A2V A;  4I8B A;  2NTO A;  4ZBB A;  2L5O A;  3EU4 A;  2F51 A;  3HCZ A;  3TKS E;  3EMX A;  3D22 A;  4K0G A;  1TXX A;  5IO0 A;  4AGS A;  1YKC A;  4HI7 A;  2K8V A;  4Q5N A;  4WEY A;  1R4W A;  5J9B A;  5H5S A;  2HE3 A;  4RQX A;  2HRN A;  4IJI A;  4G10 A;  4X0X A;  2V2G A;  2C0G A;  2AUV A;  2HSY A;  4HDE A;  6GSU A;  3QR6 A;  5IOW A;  3QAG A;  2HI7 A;  4POM A;  3D4M A;  1CQH A;  4LMW A;  2J9H A;  1R5P A;  2K8S A;  1HNC A;  3R2Q A;  5B7C A;  2VAF A;  4PUA A;  1XWG A;  2H8L A;  2H0I A;  3DD3 A;  5L71 A;  5F8B A;  1QMV A;  4MAB A;  4NWY A;  3CTG A;  3MNG A;  5HR0 A;  3GHA A;  3LEF A;  1U88 A;  4QL9 A;  1A0F A;  2DJ0 A;  2X8C A;  1SKW B;  4RUV A;  2B6M A;  2A4V A;  2CAI A;  2YOI A;  3E9J B;  3CSJ A;  3TKS C;  1MDJ A;  2YWN A;  3HJP A;  3IE3 A;  1USB A;  4ECC A;  2C1Y A;  3DIE A;  4EF0 A;  4BWS A;  5DAL A;  1PGT A;  1V9W A;  3TKP A;  3RPP A;  1J9B A;  1GNW A;  4JE1 A;  1K3O A;  4XTS A;  4ZXG A;  2CVD A;  2B1K A;  3WGD A;  2O85 A;  1PX6 A;  1WMJ A;  2PU9 C;  5ECO B;  2DJJ A;  4TR0 A;  3CRT A;  4GXZ A;  3CSH A;  4IS0 A;  3HVS A;  5LD0 A;  2LEG A;  4P3Y B;  4HZ4 A;  1OC8 A;  2YV9 A;  5A4U A;  1SD8 A;  3CYN A;  2DBC A;  2HZE A;  4FYU A;  4F82 A;  3M8N A;  5DJL A;  3MWH A;  1OKT A;  4K0N A;  1B9X C;  2MZC A;  4Z7X A;  3I6A A;  1WE0 A;  2GTU A;  2H1A A;  2ES7 A;  5HFI A;  1RQM A;  5D9T A;  1A0R P;  3IRA A;  3CTF A;  1EEM A;  3P2A A;  2ZNM A;  4IGJ A;  1GUL A;  1X9S B;  1BED A;  2YP6 A;  3GMF A;  2JZS A;  4ECJ A;  3GV1 A;  2R4V A;  1EP7 A;  4TXV A;  1S3A A;  2GT5 A;  5IIZ A;  2C80 A;  2JL4 A;  2JAD A;  3ZL5 A;  1TK5 B;  3I69 A;  3GKM A;  3L78 A; 
#chains in the Genus database with same CATH topology
 2HSM A;  2WGR A;  1ERW A;  2KUC A;  4EVM A;  5ENU A;  1EZK A;  2RUE A;  2TIR A;  1SKS B;  4AF2 A;  1H4O A;  2E2G A;  2VL2 C;  2KOK A;  1TI1 A;  4BVY A;  5J4V A;  5GSS A;  4MNN A;  2A2R A;  3DGQ A;  5ECH B;  5CAX A;  5CRG A;  5GAN D;  3O76 A;  2FWE A;  2UV8 G;  1K3L A;  1TRU A;  1XBS A;  4ML1 A;  1YZX A;  1XFL A;  2DKI A;  2L6C A;  3C73 A;  5CP1 A;  5JWQ B;  5IOX A;  2ON7 A;  1XXU A;  4QL7 A;  3VFI A;  2ALB A;  2IMK A;  1YF0 A;  3IR4 A;  1HD2 A;  2AHE A;  1GP1 A;  1FOV A;  1THX A;  1UN2 A;  2YNX A;  1AQW A;  1ON4 A;  3LYK A;  3Q18 A;  3L0H A;  4BL7 B;  1SK0 A;  1WIK A;  4EIP A;  1ZYE A;  4TKY A;  5D9X A;  3BCI A;  2LRC A;  3DKS A;  5JCU A;  3TJF A;  3ZYW A;  4N30 A;  1GTB A;  2L59 A;  1MD4 A;  1T00 A;  5DVB A;  3GRX A;  4HJM A;  2F9S A;  2H1G A;  1GUK A;  2FY6 A;  2DC5 A;  3NZN A;  1K0C A;  3H4K A;  1FG4 A;  3U5R E;  4W66 A;  4ZBD A;  5CRH A;  4FXY P;  4HQZ A;  1KNG A;  1T8E B;  2X64 A;  1Q98 A;  4MCU A;  4AKI A;  1URM A;  2V41 A;  1F2E A;  1M9B A;  4GST A;  1V58 A;  1PSQ A;  5EY6 A;  4DSR A;  3E0U A;  3BJ5 A;  1YKA A;  1YY7 A;  3RDW A;  1Y1U A;  2N5F A;  2CZ3 A;  5D96 A;  4ICY A;  3D0Z A;  2LRT A;  4TR1 B;  3FY7 A;  1G7E A;  1SK1 A;  4EO3 A;  1JZO A;  4POK A;  3KP8 A;  1F6M C;  2IMI A;  3I9V 2;  4I2U A;  1S4B P;  2H0H A;  5A1N B;  2IMD A;  2TRC P;  3FRC A;  4Q5F A;  3IK9 A;  3C1R A;  1PMT A;  4H86 A;  1B48 A;  5CO3 A;  2H6X A;  4YAV A;  3FMW A;  5IQY A;  5A5H B;  5FWG A;  2A2S A;  1TK0 B;  3VPQ A;  6GSV A;  1RW1 A;  5G30 A;  3GUS A;  4HEA 2;  5D73 A;  3RAZ A;  2XBI A;  2H70 A;  3UBL A;  4AJ7 A;  2EC4 A;  4GF0 A;  1G7O A;  1A8Y A;  2PUK C;  1XWB A;  1PL2 A;  1BQ7 A;  1Z5Y E;  1TRV A;  2C3N A;  2LJR A;  4LMV A;  3H79 A;  4KE3 A;  4DSS A;  1AQV A;  3APO A;  3QFB C;  5BMU A;  4RI6 A;  4PNG A;  3HVN A;  2YZU A;  3QMX A;  2GGT A;  3FR9 A;  3C8E A;  2IJY A;  1EWX A;  2H75 A;  4Z2U A;  1VGL A;  2PPT A;  2X49 A;  2YJ7 A;  1WJK A;  2HNL A;  2CX3 A;  2WW1 A;  5F06 A;  2XPD A;  2H6Y A;  22GS A;  4MH3 A;  2MMN A;  5G1K A;  3E3E A;  2GVP A;  3GIX A;  4NV5 A;  2K18 A;  2LST A;  4N0Z A;  3F3R A;  1LBK A;  3RBT A;  4PTS A;  4ZB9 A;  4O7H A;  3SWL A;  1OAZ A;  3EYT A;  3VK9 A;  2E0Q A;  4KCA A;  1QFN A;  4KX4 A;  1K0B A;  4F0C A;  3G7J A;  3QOU A;  3U6V A;  2O89 A;  1ERT A;  3HZ8 A;  3KM6 A;  4OFN A;  2H1D A;  3HHV A;  2DML A;  4K8M A;  4MA9 A;  4O5R A;  4J56 E;  2BMX A;  2XBQ A;  6GSW A;  3UVT A;  4N10 A;  1OYJ A;  3WGX A;  3FZ5 A;  3CXG A;  2HLS A;  1WRY A;  1PKZ A;  2HZE B;  4X1U A;  5AIX A;  4E8E A;  4MH2 A;  1IYH A;  4ML6 A;  2HSN B;  4K2X A;  4OCE A;  1E2Y A;  2JU5 A;  2DJ1 A;  2LJK A;  4NPB A;  1OE7 A;  5ELA A;  2AJQ B;  4IP1 A;  1B4Q A;  3IV4 A;  2KLX A;  5KN1 A;  2LS5 A;  5AIV A;  4RQR A;  4O5U A;  2H72 A;  1O73 A;  4NHW A;  3SBC A;  5IPG A;  3P7X A;  3GL3 A;  5JWO B;  2C3T A;  2H1B A;  7GSS A;  3DYR A;  4J2F A;  2YJH A;  3LJR A;  4HJ2 A;  4PI2 C;  4K5R A;  5DDL A;  2N5A A;  4MF6 A;  2GSS A;  4MMM A;  1B4P A;  4IN0 A;  1M3I A;  1AXD A;  2B5E A;  1TOF A;  1B8X A;  3CWG A;  5INY A;  2DKH A;  1AAZ A;  3VWU A;  3IHQ A;  3BD2 A;  2OBK A;  1N2A A;  1UC7 A;  2Z9S A;  4V2M A;  1GUH A;  4HS1 A;  3F6F A;  1SVO A;  3K8N A;  4TR1 A;  4CHS A;  1PA3 A;  3N5O A;  1XWC A;  6GSS A;  1J0F A;  5JCG A;  3ZRE A;  2V32 A;  1FW1 A;  4LL1 B;  5DCG A;  1GUM A;  4EKZ A;  2AV4 A;  4XS4 B;  1QK8 A;  5IO2 A;  3DWV A;  3LGC A;  1T4Y A;  2F8A A;  4XS6 A;  2JZT A;  1AQX A;  4LLR A;  4NHZ A;  3GA4 A;  2QA2 A;  1TU7 A;  3TUE A;  5A5H A;  1Y25 A;  5AIS A;  4IW9 A;  2MMZ A;  4KCE A;  3IK7 A;  1QXH A;  2VLT A;  3IAS 2;  1X5D A;  3TJG A;  1M3J A;  2O8V B;  3FYG A;  3UIW A;  3CSI A;  3FZ9 A;  2NVL A;  4BA7 A;  2P5Q A;  5DJM A;  3HXS A;  1FVJ A;  4ILF A;  2H74 A;  3KH7 A;  2AB6 A;  1GSY A;  3CQF A;  2IIY A;  4MJA A;  2C0F A;  3BCK A;  3KP9 A;  2V6K A;  1GSQ A;  1XVW A;  4OCF A;  3MYD A;  1GSS A;  3DXB A;  4JRR A;  3WYW A;  4TVE A;  2A2P A;  2R37 A;  2HRA A;  2EIO A;  3EVI A;  3JCM L;  4GSN A;  3HD5 A;  1V2A A;  2IMF A;  2YWI A;  3HJO A;  2O87 A;  4PQ1 A;  5F0G A;  4G01 A;  2GST A;  1T7P B;  1U3I A;  2N5B A;  4WBR D;  3F6D A;  2K9F A;  4EXJ A;  2P0G A;  2HQT A;  2EIQ A;  1UA5 A;  1XWA A;  4LL4 B;  1GWC A;  2REM A;  1YQ1 A;  3FZ4 A;  4WXT A;  1IYI A;  3TGZ A;  3TU3 B;  2VLV A;  4V2L A;  4JBB A;  2OE3 A;  1NHO A;  1Z6N A;  4OWY A;  2MMA A;  2OE1 A;  3ISO A;  1I9D A;  4K7I A;  3CMI A;  1W4V A;  3ERF A;  3GH6 A;  5HFK A;  4BPY A;  3TOU A;  1E6B A;  4F03 A;  4OFT A;  5G2Z A;  1XWK A;  1HNA A;  1VRS D;  2KP2 A;  2HYX A;  5J3R A;  4GQF A;  4KUN A;  4KDX A;  2B3S A;  2HSN A;  3PGT A;  4CY6 A;  5EPF A;  3F4T A;  19GS A;  3C7M A;  3ZIV A;  4FYB A;  1BF5 A;  1SJZ A;  2G0F A;  4PX1 A;  1TJD A;  5IM9 A;  1SVM A;  4DSS B;  1T4Z A;  3FK8 A;  3N9J A;  1MTC A;  4IBP A;  1M2B A;  3FKF A;  5BMU B;  4K2D A;  1YEX A;  1EEJ A;  3GNJ A;  4O5Q A;  3ZML A;  5D9W A;  1MDK A;  2FWF A;  3TKS A;  1SL1 B;  4KGI A;  5D8I A;  4I5Q A;  1OE8 A;  3GTU B;  3UVH A;  3G9B A;  3GN3 A;  3F4R A;  1XZO A;  4TXO B;  2R0P A;  3L4N A;  5G31 A;  2NPB A;  1VF1 A;  2D2Z A;  1U3A A;  5DBQ A;  1LU4 A;  1XIY A;  1VF3 A;  1ZYQ B;  1EV4 A;  1ZYP A;  3VWW A;  2WVY A;  5DAK B;  4MZB A;  3EWL A;  1ML6 A;  1G6Y A;  1PRX A;  1BX9 A;  3QDN A;  4I97 A;  2R5G A;  1S3D A;  1XCC A;  1OKD A;  4TR4 A;  4YH2 A;  4Z2R A;  1SD9 A;  4XHM A;  3IOS A;  2IN3 A;  2YCD A;  1YEW C;  2FD3 A;  2PN8 A;  1Z9H A;  3ZZX A;  4XS4 A;  13GS A;  5A4V A;  2ON5 A;  1T3B A;  1W89 A;  3ZTL A;  3HZ4 A;  3DML A;  4ID0 A;  4IKH A;  2YAN A;  4GQC A;  3W8S A;  2BJX A;  2FWG A;  1PQN A;  3GSS A;  2XPE A;  4E68 A;  2PWJ A;  5IMV A;  3M3M A;  4G9H A;  5B8A A;  3IPZ A;  2QA1 A;  1EOH A;  3VLN A;  2B5X A;  3M9J A;  2OJL A;  3P90 A;  4EUY A;  5D93 A;  3TOT A;  1TU8 A;  2CT6 A;  1O8W A;  1XW6 A;  2X8H A;  1XOB A;  1I1I P;  5F07 A;  4WKW A;  3KZQ A;  3HVX A;  2WB9 A;  1O81 A;  2PVQ A;  1M0U A;  1BYE A;  3KD0 A;  2GZZ A;  4DVC A;  4O92 A;  4GDF A;  4V1A p;  1QUW A;  4L0W A;  1GTU A;  1ABA A;  3US3 A;  5HR1 A;  1GLP A;  2E2M A;  3TCO A;  3VI5 A;  4RI7 A;  4MZC A;  4ZB8 A;  1SEN A;  4I6X A;  2GLR A;  3EC3 A;  4K7N A;  5E59 A;  5FT3 A;  3S9F A;  4G0I A;  4KW6 A;  3J7Y b;  1UVZ A;  3D6I A;  2HT9 A;  3KIJ A;  3HY2 A;  4O32 A;  4XRA A;  2C4J A;  2IFQ A;  3A2W A;  5J47 A;  4KSO A;  4TW5 A;  2DLX A;  4V2N A;  2JSZ A;  1T1V A;  3UMA A;  4N3Z A;  3CBU A;  4GCI A;  2L6D A;  1YEP A;  4TN8 A;  1CQG A;  4CW9 A;  1Z7R A;  4G19 A;  1JLW A;  4ACS A;  2C3Q A;  5KEJ A;  2PVO C;  2HRK B;  1H75 A;  5B6N A;  2X4A A;  5G5E A;  4IHU A;  5IMA A;  1PKW A;  4WET A;  1JZW A;  3IAM 2;  3KGK A;  2GS3 A;  4KDY A;  1NSW A;  2H01 A;  2YN1 A;  3TB2 A;  1AC1 A;  2DJ2 A;  4F0B A;  5EL8 A;  3F4S A;  3IC8 A;  3ED3 A;  3GH9 A;  5ECI B;  3FZA A;  5IMC A;  4K9Z A;  3FR3 A;  2VL9 A;  2NDO A;  3D5J A;  4KH7 A;  4HOJ A;  3A5I A;  16GS A;  3WGE A;  5ECK B;  3H93 A;  4MF7 A;  4Q5R A;  1JZR A;  4PUF C;  4WF5 A;  4FYC A;  1V40 A;  4YQV A;  4IQA A;  4KA0 A;  11GS A;  3GTU A;  2EFH A;  2P5R A;  4TXO A;  5J4U A;  4ECB A;  4V1A g;  1GLQ A;  5C00 A;  1EGO A;  4AKG A;  1J08 A;  3CRU A;  1MDI A;  3V1W A;  4GSS A;  6GSX A;  3KTB A;  3O6T A;  4EC0 A;  4OO5 A;  3F0I A;  5F05 A;  4OO4 A;  1YVL A;  2LQO A;  3UBK A;  1FAA A;  1U6T A;  1F9M A;  3MDK A;  4BWQ A;  3PPU A;  5DAK A;  4I2T A;  5AGY A;  5HR2 A;  2RM6 A;  1SK2 A;  1WOU A;  4L5O A;  3Q74 A;  1ZOF A;  5ID2 A;  3APQ A;  1DUG A;  4QQ7 A;  3KTL A;  2IME A;  2ZCT A;  5C04 A;  2X8G A;  2H19 A;  2R2J A;  3ME7 A;  5ELG A;  2VOC A;  5CRE A;  5KN2 A;  3C71 A;  3DEX A;  3Q6O A;  1K0N A;  1OC9 B;  1JHB A;  3O3T A;  4MJB A;  2H30 A;  1GTA A;  2R3X A;  4L8E A;  4K5S A;  4K6X A;  4Z2T A;  5HQP A;  1K3Y A;  2X99 A;  4POL A;  5JWR B;  1HYU A;  1O8X A;  4ZL8 A;  2M80 A;  2VCV A;  14GS A;  1GNE A;  3LQ7 A;  4QMK A;  1GL8 A;  1GSE A;  3F8U A;  2RM5 A;  3J7Y k;  2C0E A;  1GH2 A;  2QGV A;  5A4W A;  3IDV A;  3NOF A;  3QFA C;  4F9Z A;  4PHZ C;  2VKZ G;  1TK8 B;  2GDR A;  3EU3 A;  2V1M A;  4JZQ A;  5ABR A;  4IEL A;  4XIH A;  1A24 A;  2XHF A;  2OKA A;  3KXO A;  4HUA A;  2YZH A;  4K7O A;  3APS A;  1PD2 1;  1C72 A;  2AAW A;  4MJE A;  2GZY A;  2PBJ A;  2LQQ A;  1K0D A;  5HFG A;  4DEJ A;  1DBY A;  4JU5 A;  3HYP A;  3A5W A;  1M99 A;  3G7I A;  4NXI A;  2BTO T;  2IWT A;  4PI0 C;  2H71 A;  2OE0 A;  4J57 E;  3NIV A;  5CNW A;  4FH8 A;  1K0A A;  4CY8 A;  2A4H A;  5AN1 A;  2WUL A;  2YV7 A;  2WS2 A;  1I5G A;  5B8B A;  5IPH A;  4MLY A;  3HVV A;  4PQI A;  2IL3 A;  5KOW A;  5J9C A;  3A3T A;  1ERV A;  2LJA A;  3EE2 A;  1QGV A;  3ZVJ D;  2EFE A;  4GTU A;  2I9H A;  1LJR A;  2YWM A;  2VCQ A;  2FGX A;  4FQU A;  2VCX A;  1X0R A;  1F37 A;  2G2Q A;  4KSM A;  1Z7P A;  2GT6 A;  3GX0 A;  1OVN A;  5CYY A;  4ZBA A;  2RLI A;  1YJ6 A;  2FWH A;  2HRK A;  3H8Q A;  4ZIL A;  2GSQ A;  2JZR A;  2WVX A;  2VLU A;  4GLT A;  2TRX A;  4MP4 A;  1BG5 A;  4K1F A;  2OAD A;  2CA8 A;  1GSF A;  1XPV A;  4JED A;  2L4Q A;  2DSA A;  1DSB A;  1EGR A;  3TKQ A;  3L9V A;  3KMN A;  1M2A A;  2C8U A;  1DE1 A;  1K0M A;  4NMU A;  1WWJ A;  1X9W B;  1N25 A;  1WP0 A;  6GST A;  3P8W A;  1PX7 A;  3FEU A;  5LCZ A;  1DE2 A;  4EDZ A;  2FNO A;  2B5Y A;  5ECS A;  1X9M B;  2QSI A;  2QKE A;  3IC4 A;  4PUR A;  2WZ9 A;  1TTZ A;  3GKX A;  4MF5 A;  2LKU A;  4WBJ A;  1Y6E A;  1M7T A;  1TXU A;  3F3Q A;  1NM3 A;  3TRP A;  2IFQ B;  2LTK A;  2WW3 A;  1ZYN A;  3D4T A;  1A8L A;  3ME8 A;  3UAP A;  4NV2 A;  2QC7 A;  5DQY A;  5J5N A;  3HA9 A;  3BBY A;  4N11 A;  2JSY A;  1BJX A;  2PGT A;  3HDC A;  3PIN A;  4IQ1 A;  1A23 A;  3HJM A;  2YPM A;  3RHB A;  2M46 A;  2CQ9 A;  1XVQ A;  20GS A;  1TW9 A;  1FB6 A;  1GSD A;  4KF9 A;  5J41 A;  5KN0 A;  1EP8 A;  3L78 A;  1XG8 A;  4EE0 A;  1OC9 A;  3TJJ A;  1ILO A;  1FO5 A;  3LFL A;  2DIY A;  1M9A A;  1Z6M A;  5D9V A;  1YF1 A;  1TRW A;  5G1L A;  1Q4J A;  8GSS A;  2H6Z A;  1QQ2 A;  4PNF A;  3KCM A;  1R7H A;  2UZ8 A;  1TDI A;  1M2D A;  5H5R A;  1GTI A;  3Q19 A;  1TRS A;  4JR6 A;  2WJU A;  3LXT A;  6GSY A;  4KAE A;  3W6G A;  2VM1 A;  2I3Y A;  3L9S A;  4YQM A;  2VCW A;  1RK4 A;  1WPI A;  1VF4 A;  4G0L A;  3WT2 A;  5ECQ B;  3WT1 A;  5E4W A;  2DIZ A;  4YAP A;  2F3M A;  4MDC A;  3MSZ A;  2R6K A;  4ECI A;  4XS1 A;  1FHE A;  2OAC A;  3LOR A;  1X5E A;  3ZFB A;  3EMP A;  1Z3E A;  2B1L A;  4XRD A;  4KDU A;  2OBI A;  2WW0 A;  3AY8 A;  3H1N A;  1TP9 A;  2OA7 A;  2KP1 A;  4LA1 A;  3PH9 A;  2L57 A;  1TI3 A;  2FA4 A;  4ISD A;  3OR5 A;  1MEK A;  2CVK A;  18GS A;  1SU9 A;  2RII A;  1G6W A;  2FLS A;  3M9K A;  3R3E A;  2GZP A;  1XW9 A;  4TRX A;  3ZIJ A;  1F3B A;  1GSU A;  1PN9 A;  5ID2 B;  1GRX A;  4ZB7 A;  5CRD A;  2VCZ A;  4BVX B;  3FHK A;  2WW2 A;  3GUR A;  3DVW A;  3GL5 A;  2O7K A;  3LYP A;  1TKD B;  4G0K A;  4IVF A;  1XOA A;  4IP6 A;  1V98 A;  3CHX C;  1ACV A;  4L0U A;  1BG1 A;  1ZGN A;  2HZF A;  3F9U A;  4ZL9 A;  1A2J A;  3DRN A;  3F63 A;  2H73 A;  2O3E A;  4E8H A;  4AI6 A;  3KH9 A;  3LG6 A;  2J23 A;  3VWV A;  2E7P A;  3GKK A;  4GWR A;  2VL3 A;  3UAR A;  3TKR A;  3FR6 A;  1EV9 A;  5H5Q A;  2VD0 A;  3DVX A;  3QPM A;  3ZRD A;  3M1G A;  1ZZY A;  5J40 A;  1B9Y C;  3A2X A;  4YQU A;  3TJK A;  2OT3 A;  4KND A;  2C0D A;  3QAV A;  5ECL B;  3IA1 A;  4MK3 A;  1AIU A;  2CAQ A;  3RGB C;  4ZB6 A;  3UEM A;  5DQS A;  3ZFL A;  2VL2 A;  4HZ2 A;  2PMT A;  4USS A;  12GS A;  2WZS A;  5IMD A;  5A5K A;  1A2M A;  4ZIJ A;  1X5C A;  2XC2 A;  2CZ2 A;  2ZUP A;  4OMV A;  5ECP B;  1O85 A;  5HR3 A;  4EDY A;  3KJY A;  3QAW A;  5KOX A;  4D73 B;  4EL1 A;  5IMZ A;  2HSH A;  4WF4 A;  4IJ3 A;  3MIX A;  1SYR A;  2WCI A;  1G0T A;  3M0F A;  1SKR B;  4MPG A;  5BRT A;  1S3C A;  4F2I A;  2PER A;  2H1L A;  1V57 A;  1NW2 A;  3ZVJ A;  1EOG A;  4MPF A;  5GZZ B;  4MZW A;  5JCW A;  3KMO A;  3HKR A;  3VI7 A;  2EIR A;  1JZD A;  2IPA A;  3UL3 A;  2WVX B;  2MMO A;  4ZL7 A;  3RHC A;  1SL0 B;  5IMF A;  4HU7 A;  5B6M A;  4HU9 A;  2H0G A;  5COH A;  5EVO A;  1SJI A;  2WDU A;  2FCH A;  5J4Y A;  2MBS A;  3GX8 A;  9GSS A;  3VWX A;  2M72 A;  2NBS A;  1R5A A;  2AYT A;  3TJB A;  1O6J A;  1VF2 A;  5ECM B;  2H76 A;  5GST A;  3ERW A;  4Q5Q A;  4YKF A;  4FIW A;  2RUF A;  1ST9 A;  2VUP A;  2O5V A;  2VCT A;  2VIM A;  3VPT A;  1MD3 A;  2V6O A;  4KB3 A;  2I4A A;  2LRN A;  3ZIT A;  4X43 A;  5ECN B;  4L5L A;  1AUC A;  3TRQ A;  1R26 A;  3GFK A;  2I81 A;  5GAP D;  3TRX A;  4PXO A;  1XW5 A;  1YDK A;  4ULX A;  3D21 A;  3GST A;  1SJ6 A;  2VM2 A;  17GS A;  1N8J A;  3I43 A;  3C1S A;  1ZMA A;  4MJC A;  2K6V A;  3PR8 A;  4FO5 A;  4XCS A;  5DAL B;  2MBT A;  5A34 B;  2VO4 A;  2HXK A;  4PGT A;  2MYG A;  10GS A;  2LNT A;  4BVX A;  2FUG 2;  4HQS A;  1JLV A;  4GRF A;  2F8F A;  2HRF A;  3RPN A;  1OC3 A;  3UOM A;  2GQL A;  2R0G A;  1ZCP A;  5ECR B;  1PL1 A;  2GQM A;  2CV4 A;  4WR5 A;  3IBH A;  4POB A;  2KHP A;  1U87 A;  2I1U A;  2CX4 A;  4YKG A;  1K0O A;  2FHE A;  1A2L A;  3GKN A;  3ERG A;  3FW2 A;  2P31 A;  2JAC A;  4G2E A;  5FHI A;  1NHY A;  5KN3 A;  2FA8 A;  2CVB A;  1SL2 B;  3L9U A;  4AJ8 A;  5CRW A;  2EFC A;  3EUR A;  3QCP A;  3EIN A;  1FB0 A;  2B7J A;  4BL7 A;  3IHG A;  3UJ1 A;  4N0V A;  2LUS A;  5G5F A;  2H66 A;  4JR4 A;  1HNB A;  1KTE A;  1ZL9 A;  1O7U A;  3W8J A;  3KEB A;  1KEB A;  3TDG A;  2WFC A;  1THO A;  3G7Y A;  4DSQ A;  1FVK A;  2LNS A;  1AW9 A;  3IXR A;  2YWO A;  2VD1 A;  3LSZ A;  2GSR A;  3WD6 A;  2WVZ A;  2DMM A;  1KBN A;  2L4C A;  5LNK e;  4EIQ A;  2LV3 A;  4WR4 A;  1JFU A;  1PN0 A;  1BAY A;  2HSM B;  2DJK A;  3GYK A;  3MAK A;  4AJ6 A;  4CDO A;  1SYX A;  4A5P A;  4TR3 A;  1F3A A;  4NAX A;  1ERU A;  4D73 A;  3VUR A;  2WRT A;  2L5L A;  4TOP A;  2GQK A;  4PQH A;  3ZLP A;  4BIK A;  3LWA A;  5DCH A;  4BVY B;  1HQO A;  3ZMK A;  4OFM A;  4OD7 A;  4AKX B;  2B7K A;  3BOA A;  3LXZ A;  3QD9 A;  2DJ3 A;  3A2V A;  4I8B A;  2NTO A;  4ZBB A;  2L5O A;  3EU4 A;  2F51 A;  3HCZ A;  3TKS E;  3EMX A;  3D22 A;  4K0G A;  1TXX A;  5IO0 A;  4AGS A;  1YKC A;  2EFD A;  4HI7 A;  2K8V A;  4Q5N A;  4WEY A;  1R4W A;  5A1N A;  4HSC X;  5J9B A;  5H5S A;  2HE3 A;  4RQX A;  2HRN A;  4IJI A;  4G10 A;  4X0X A;  2V2G A;  2C0G A;  2AUV A;  2HSY A;  4HDE A;  6GSU A;  3QR6 A;  5IOW A;  2O36 A;  3QAG A;  2HI7 A;  4POM A;  3D4M A;  1CQH A;  4LMW A;  2J9H A;  1R5P A;  2K8S A;  1HNC A;  3R2Q A;  5B7C A;  2VAF A;  4PUA A;  1XWG A;  2H8L A;  2H0I A;  3DD3 A;  5L71 A;  5F8B A;  1QMV A;  4MAB A;  4NWY A;  3CTG A;  3MNG A;  5HR0 A;  3GHA A;  3LEF A;  1U88 A;  4QL9 A;  1A0F A;  2DJ0 A;  2X8C A;  1SKW B;  4RUV A;  2B6M A;  2A4V A;  1S3R A;  2CAI A;  2YOI A;  3E9J B;  3CSJ A;  3TKS C;  1MDJ A;  2YWN A;  3HJP A;  3IE3 A;  1USB A;  4ECC A;  2C1Y A;  3DIE A;  4AKH A;  4EF0 A;  4BWS A;  5DAL A;  5A34 A;  1PGT A;  4X4J A;  1V9W A;  3TKP A;  3RPP A;  1J9B A;  1GNW A;  4JE1 A;  1K3O A;  4XTS A;  4ZXG A;  3RFR C;  2CVD A;  2B1K A;  3WGD A;  2O85 A;  1PX6 A;  1WMJ A;  2PU9 C;  5ECO B;  2DJJ A;  4TR0 A;  3CRT A;  4GXZ A;  3CSH A;  4IS0 A;  3HVS A;  5LD0 A;  2LEG A;  4P3Y B;  3LW9 A;  4HZ4 A;  1OC8 A;  2YV9 A;  5A4U A;  1SD8 A;  3CYN A;  2DBC A;  2HZE A;  4FYU A;  4F82 A;  3M8N A;  5DJL A;  1FOH A;  3MWH A;  1OKT A;  4K0N A;  3HMJ G;  1B9X C;  3EPT A;  2MZC A;  4Z7X A;  3I6A A;  1WE0 A;  2GTU A;  2H1A A;  2ES7 A;  5HFI A;  1RQM A;  5D9T A;  1A0R P;  3IRA A;  3CTF A;  1EEM A;  2ZNM A;  3P2A A;  4IGJ A;  1GUL A;  1X9S B;  1BED A;  2YP6 A;  3GMF A;  1PFO A;  2JZS A;  4ECJ A;  3GV1 A;  2R4V A;  1EP7 A;  4TXV A;  1S3A A;  2GT5 A;  5IIZ A;  1SVL A;  2C80 A;  2JL4 A;  2JAD A;  3ZL5 A;  1TK5 B;  3I69 A;  3GKM A;  2HFD A;  2R0C A; 
#chains in the Genus database with same CATH homology
 2HSM A;  2WGR A;  1ERW A;  2KUC A;  4EVM A;  5ENU A;  1EZK A;  2RUE A;  2TIR A;  1SKS B;  4AF2 A;  1H4O A;  2E2G A;  2VL2 C;  2KOK A;  1TI1 A;  4BVY A;  5J4V A;  5GSS A;  4MNN A;  2A2R A;  3DGQ A;  5ECH B;  5CAX A;  5CRG A;  5GAN D;  3O76 A;  2FWE A;  2UV8 G;  1K3L A;  1TRU A;  1XBS A;  4ML1 A;  1YZX A;  1XFL A;  2DKI A;  2L6C A;  3C73 A;  5CP1 A;  5JWQ B;  5IOX A;  2ON7 A;  1XXU A;  4QL7 A;  3VFI A;  2ALB A;  2IMK A;  1YF0 A;  3IR4 A;  1HD2 A;  2AHE A;  1GP1 A;  1FOV A;  1THX A;  1UN2 A;  2YNX A;  1AQW A;  1ON4 A;  3LYK A;  3Q18 A;  3L0H A;  4BL7 B;  1SK0 A;  1WIK A;  4EIP A;  1ZYE A;  4TKY A;  5D9X A;  3BCI A;  2LRC A;  3DKS A;  5JCU A;  3TJF A;  3ZYW A;  4N30 A;  1GTB A;  2L59 A;  1MD4 A;  1T00 A;  5DVB A;  3GRX A;  4HJM A;  2F9S A;  2H1G A;  1GUK A;  2FY6 A;  2DC5 A;  3NZN A;  1K0C A;  3H4K A;  1FG4 A;  3U5R E;  4W66 A;  4ZBD A;  5CRH A;  4HQZ A;  1KNG A;  1T8E B;  2X64 A;  1Q98 A;  4MCU A;  4AKI A;  1URM A;  2V41 A;  1F2E A;  1M9B A;  4GST A;  1V58 A;  1PSQ A;  5EY6 A;  4DSR A;  3E0U A;  3BJ5 A;  1YKA A;  1YY7 A;  3RDW A;  1Y1U A;  2N5F A;  2CZ3 A;  5D96 A;  4ICY A;  3D0Z A;  2LRT A;  4TR1 B;  3FY7 A;  1G7E A;  1SK1 A;  4EO3 A;  1JZO A;  4POK A;  3KP8 A;  1F6M C;  2IMI A;  3I9V 2;  4I2U A;  2H0H A;  5A1N B;  2IMD A;  2TRC P;  3FRC A;  4Q5F A;  3IK9 A;  3C1R A;  1PMT A;  4H86 A;  1B48 A;  5CO3 A;  2H6X A;  4YAV A;  3FMW A;  5IQY A;  5A5H B;  5FWG A;  2A2S A;  1TK0 B;  3VPQ A;  6GSV A;  1RW1 A;  5G30 A;  3GUS A;  4HEA 2;  5D73 A;  3RAZ A;  2XBI A;  2H70 A;  3UBL A;  4AJ7 A;  2EC4 A;  4GF0 A;  1G7O A;  1A8Y A;  2PUK C;  1XWB A;  1PL2 A;  1BQ7 A;  1Z5Y E;  1TRV A;  2C3N A;  2LJR A;  4LMV A;  3H79 A;  4KE3 A;  4DSS A;  1AQV A;  3APO A;  3QFB C;  5BMU A;  4RI6 A;  4PNG A;  2YZU A;  3QMX A;  2GGT A;  3FR9 A;  3C8E A;  2IJY A;  1EWX A;  2H75 A;  4Z2U A;  1VGL A;  2PPT A;  2X49 A;  2YJ7 A;  1WJK A;  2HNL A;  2CX3 A;  5F06 A;  2XPD A;  2H6Y A;  22GS A;  4MH3 A;  2MMN A;  5G1K A;  3E3E A;  2GVP A;  3GIX A;  4NV5 A;  2K18 A;  2LST A;  4N0Z A;  3F3R A;  1LBK A;  3RBT A;  4PTS A;  4ZB9 A;  4O7H A;  3SWL A;  1OAZ A;  3EYT A;  3VK9 A;  2E0Q A;  4KCA A;  1QFN A;  4KX4 A;  1K0B A;  4F0C A;  3G7J A;  3QOU A;  3U6V A;  2O89 A;  1ERT A;  3HZ8 A;  3KM6 A;  4OFN A;  2H1D A;  3HHV A;  2DML A;  4K8M A;  4MA9 A;  4O5R A;  4J56 E;  2BMX A;  2XBQ A;  6GSW A;  3UVT A;  4N10 A;  1OYJ A;  3WGX A;  3FZ5 A;  3CXG A;  2HLS A;  1WRY A;  1PKZ A;  2HZE B;  4X1U A;  5AIX A;  4E8E A;  4MH2 A;  1IYH A;  4ML6 A;  2HSN B;  4K2X A;  4OCE A;  1E2Y A;  2JU5 A;  2DJ1 A;  2LJK A;  4NPB A;  1OE7 A;  5ELA A;  2AJQ B;  4IP1 A;  1B4Q A;  3IV4 A;  2KLX A;  5KN1 A;  2LS5 A;  5AIV A;  4RQR A;  4O5U A;  2H72 A;  1O73 A;  4NHW A;  3SBC A;  5IPG A;  3P7X A;  3GL3 A;  5JWO B;  2C3T A;  2H1B A;  7GSS A;  3DYR A;  4J2F A;  2YJH A;  3LJR A;  4HJ2 A;  4K5R A;  5DDL A;  2N5A A;  4MF6 A;  2GSS A;  4MMM A;  1B4P A;  4IN0 A;  1AXD A;  2B5E A;  1TOF A;  1B8X A;  3CWG A;  5INY A;  2DKH A;  1AAZ A;  3VWU A;  3IHQ A;  3BD2 A;  2OBK A;  1N2A A;  1UC7 A;  2Z9S A;  4V2M A;  1GUH A;  4HS1 A;  3F6F A;  1SVO A;  3K8N A;  4TR1 A;  4CHS A;  1PA3 A;  3N5O A;  1XWC A;  6GSS A;  1J0F A;  5JCG A;  3ZRE A;  2V32 A;  1FW1 A;  4LL1 B;  5DCG A;  1GUM A;  4EKZ A;  2AV4 A;  4XS4 B;  1QK8 A;  5IO2 A;  3DWV A;  3LGC A;  1T4Y A;  2F8A A;  4XS6 A;  2JZT A;  1AQX A;  4LLR A;  4NHZ A;  3GA4 A;  2QA2 A;  1TU7 A;  3TUE A;  5A5H A;  1Y25 A;  5AIS A;  4IW9 A;  2MMZ A;  4KCE A;  3IK7 A;  1QXH A;  2VLT A;  3IAS 2;  1X5D A;  3TJG A;  2O8V B;  3UIW A;  3FYG A;  3CSI A;  3FZ9 A;  2NVL A;  4BA7 A;  2P5Q A;  5DJM A;  3HXS A;  1FVJ A;  4ILF A;  2H74 A;  3KH7 A;  2AB6 A;  1GSY A;  2IIY A;  4MJA A;  2C0F A;  3BCK A;  3KP9 A;  2V6K A;  1GSQ A;  1XVW A;  4OCF A;  3MYD A;  1GSS A;  3DXB A;  4JRR A;  3WYW A;  4TVE A;  2A2P A;  2R37 A;  2HRA A;  2EIO A;  3EVI A;  3JCM L;  4GSN A;  3HD5 A;  1V2A A;  2IMF A;  2YWI A;  3HJO A;  2O87 A;  4PQ1 A;  5F0G A;  4G01 A;  2GST A;  1T7P B;  1U3I A;  2N5B A;  4WBR D;  3F6D A;  2K9F A;  4EXJ A;  2P0G A;  2HQT A;  2EIQ A;  1UA5 A;  1XWA A;  4LL4 B;  1GWC A;  2REM A;  1YQ1 A;  3FZ4 A;  4WXT A;  1IYI A;  3TGZ A;  3TU3 B;  2VLV A;  4V2L A;  4JBB A;  2OE3 A;  1NHO A;  1Z6N A;  4OWY A;  2MMA A;  2OE1 A;  3ISO A;  1I9D A;  4K7I A;  3CMI A;  1W4V A;  3ERF A;  3GH6 A;  5HFK A;  4BPY A;  3TOU A;  1E6B A;  4F03 A;  4OFT A;  5G2Z A;  1XWK A;  1HNA A;  1VRS D;  2KP2 A;  2HYX A;  5J3R A;  4GQF A;  4KUN A;  4KDX A;  2B3S A;  2HSN A;  3PGT A;  4CY6 A;  5EPF A;  3F4T A;  19GS A;  3C7M A;  3ZIV A;  4FYB A;  1BF5 A;  1SJZ A;  2G0F A;  4PX1 A;  1TJD A;  5IM9 A;  1SVM A;  4DSS B;  1T4Z A;  3FK8 A;  3N9J A;  1MTC A;  4IBP A;  1M2B A;  3FKF A;  5BMU B;  4K2D A;  1YEX A;  1EEJ A;  3GNJ A;  4O5Q A;  3ZML A;  5D9W A;  1MDK A;  2FWF A;  3TKS A;  1SL1 B;  4KGI A;  5D8I A;  4I5Q A;  1OE8 A;  3GTU B;  3UVH A;  3G9B A;  3GN3 A;  3F4R A;  1XZO A;  4TXO B;  2R0P A;  3L4N A;  5G31 A;  2NPB A;  1VF1 A;  2D2Z A;  1U3A A;  5DBQ A;  1LU4 A;  1XIY A;  1VF3 A;  1ZYQ B;  1EV4 A;  1ZYP A;  3VWW A;  5DAK B;  4MZB A;  3EWL A;  1ML6 A;  1G6Y A;  1PRX A;  1BX9 A;  3QDN A;  4I97 A;  2R5G A;  1S3D A;  1XCC A;  1OKD A;  4TR4 A;  4YH2 A;  4Z2R A;  1SD9 A;  4XHM A;  3IOS A;  2IN3 A;  2YCD A;  2FD3 A;  2PN8 A;  1Z9H A;  3ZZX A;  4XS4 A;  13GS A;  5A4V A;  2ON5 A;  1T3B A;  1W89 A;  3ZTL A;  3HZ4 A;  3DML A;  4ID0 A;  4IKH A;  2YAN A;  4GQC A;  3W8S A;  2BJX A;  2FWG A;  1PQN A;  3GSS A;  2XPE A;  4E68 A;  2PWJ A;  5IMV A;  3M3M A;  4G9H A;  5B8A A;  3IPZ A;  2QA1 A;  1EOH A;  3VLN A;  2B5X A;  3M9J A;  2OJL A;  3P90 A;  4EUY A;  5D93 A;  3TOT A;  1TU8 A;  2CT6 A;  1O8W A;  1XW6 A;  2X8H A;  1XOB A;  5F07 A;  4WKW A;  3KZQ A;  3HVX A;  2WB9 A;  1O81 A;  2PVQ A;  1M0U A;  1BYE A;  3KD0 A;  2GZZ A;  4DVC A;  4O92 A;  4GDF A;  4V1A p;  1QUW A;  4L0W A;  1GTU A;  1ABA A;  3US3 A;  5HR1 A;  1GLP A;  2E2M A;  3TCO A;  3VI5 A;  4RI7 A;  4MZC A;  4ZB8 A;  1SEN A;  4I6X A;  2GLR A;  3EC3 A;  4K7N A;  5E59 A;  5FT3 A;  3S9F A;  4G0I A;  4KW6 A;  3J7Y b;  1UVZ A;  3D6I A;  2HT9 A;  3KIJ A;  3HY2 A;  4O32 A;  4XRA A;  2C4J A;  2IFQ A;  3A2W A;  5J47 A;  4KSO A;  4TW5 A;  2DLX A;  4V2N A;  2JSZ A;  1T1V A;  3UMA A;  4N3Z A;  3CBU A;  4GCI A;  2L6D A;  1YEP A;  4TN8 A;  1CQG A;  4CW9 A;  1Z7R A;  4G19 A;  1JLW A;  4ACS A;  2C3Q A;  5KEJ A;  2PVO C;  2HRK B;  1H75 A;  5B6N A;  2X4A A;  5G5E A;  4IHU A;  5IMA A;  1PKW A;  4WET A;  1JZW A;  3IAM 2;  3KGK A;  2GS3 A;  4KDY A;  1NSW A;  2H01 A;  2YN1 A;  3TB2 A;  1AC1 A;  2DJ2 A;  4F0B A;  5EL8 A;  3F4S A;  3IC8 A;  3ED3 A;  3GH9 A;  5ECI B;  3FZA A;  5IMC A;  4K9Z A;  3FR3 A;  2VL9 A;  2NDO A;  3D5J A;  4KH7 A;  4HOJ A;  3A5I A;  16GS A;  3WGE A;  5ECK B;  3H93 A;  4MF7 A;  4Q5R A;  1JZR A;  4PUF C;  4WF5 A;  4FYC A;  1V40 A;  4YQV A;  4IQA A;  4KA0 A;  11GS A;  3GTU A;  2EFH A;  2P5R A;  4TXO A;  5J4U A;  4ECB A;  4V1A g;  1GLQ A;  5C00 A;  1EGO A;  4AKG A;  1J08 A;  3CRU A;  1MDI A;  3V1W A;  4GSS A;  6GSX A;  3KTB A;  2HFD A;  3O6T A;  4EC0 A;  4OO5 A;  3F0I A;  5F05 A;  4OO4 A;  1YVL A;  2LQO A;  3UBK A;  1FAA A;  1U6T A;  1F9M A;  3MDK A;  4BWQ A;  3PPU A;  5DAK A;  4I2T A;  5AGY A;  5HR2 A;  2RM6 A;  1SK2 A;  1WOU A;  4L5O A;  3Q74 A;  1ZOF A;  5ID2 A;  3APQ A;  1DUG A;  4QQ7 A;  3KTL A;  2IME A;  2ZCT A;  5C04 A;  2X8G A;  2H19 A;  2R2J A;  3ME7 A;  5ELG A;  2VOC A;  5CRE A;  5KN2 A;  3C71 A;  3DEX A;  3Q6O A;  1K0N A;  1OC9 B;  1JHB A;  3O3T A;  4MJB A;  2H30 A;  1GTA A;  2R3X A;  4L8E A;  4K5S A;  4K6X A;  4Z2T A;  5HQP A;  1K3Y A;  2X99 A;  4POL A;  5JWR B;  1HYU A;  1O8X A;  4ZL8 A;  2M80 A;  2VCV A;  14GS A;  1GNE A;  3LQ7 A;  4QMK A;  1GL8 A;  1GSE A;  3F8U A;  2RM5 A;  3J7Y k;  2C0E A;  1GH2 A;  2QGV A;  5A4W A;  3IDV A;  3NOF A;  3QFA C;  4F9Z A;  2VKZ G;  1TK8 B;  2GDR A;  3EU3 A;  2V1M A;  4JZQ A;  5ABR A;  4IEL A;  4XIH A;  1A24 A;  2XHF A;  2OKA A;  3KXO A;  4HUA A;  2YZH A;  4K7O A;  3APS A;  1PD2 1;  1C72 A;  2AAW A;  4MJE A;  2GZY A;  2PBJ A;  2LQQ A;  1K0D A;  5HFG A;  4DEJ A;  1DBY A;  4JU5 A;  3HYP A;  3A5W A;  1M99 A;  3G7I A;  4NXI A;  2BTO T;  2IWT A;  2H71 A;  2OE0 A;  4J57 E;  3NIV A;  5CNW A;  4FH8 A;  1K0A A;  4CY8 A;  2A4H A;  5AN1 A;  2WUL A;  2YV7 A;  2WS2 A;  1I5G A;  5B8B A;  5IPH A;  4MLY A;  3HVV A;  4PQI A;  2IL3 A;  5KOW A;  5J9C A;  3A3T A;  1ERV A;  2LJA A;  3EE2 A;  1QGV A;  3ZVJ D;  2EFE A;  4GTU A;  2I9H A;  1LJR A;  2YWM A;  2VCQ A;  2FGX A;  4FQU A;  2VCX A;  1X0R A;  1F37 A;  2G2Q A;  4KSM A;  1Z7P A;  2GT6 A;  3GX0 A;  1OVN A;  5CYY A;  4ZBA A;  2RLI A;  1YJ6 A;  2FWH A;  2HRK A;  3H8Q A;  4ZIL A;  2GSQ A;  2JZR A;  2VLU A;  4GLT A;  2TRX A;  4MP4 A;  1BG5 A;  4K1F A;  2OAD A;  2CA8 A;  1GSF A;  1XPV A;  4JED A;  2L4Q A;  2DSA A;  1DSB A;  1EGR A;  3TKQ A;  3L9V A;  3KMN A;  1M2A A;  2C8U A;  1DE1 A;  1K0M A;  4NMU A;  1WWJ A;  1X9W B;  1N25 A;  1WP0 A;  6GST A;  3P8W A;  1PX7 A;  3FEU A;  5LCZ A;  1DE2 A;  4EDZ A;  2FNO A;  2B5Y A;  5ECS A;  1X9M B;  2QSI A;  2QKE A;  3IC4 A;  4PUR A;  2WZ9 A;  1TTZ A;  3GKX A;  4MF5 A;  2LKU A;  4WBJ A;  1Y6E A;  1M7T A;  1TXU A;  3F3Q A;  1NM3 A;  3TRP A;  2IFQ B;  2LTK A;  3D4T A;  1ZYN A;  1A8L A;  3ME8 A;  3UAP A;  4NV2 A;  2QC7 A;  5DQY A;  5J5N A;  3HA9 A;  3BBY A;  4N11 A;  2JSY A;  1BJX A;  2PGT A;  3HDC A;  3PIN A;  4IQ1 A;  1A23 A;  3HJM A;  2YPM A;  3RHB A;  2M46 A;  2CQ9 A;  1XVQ A;  20GS A;  1TW9 A;  1FB6 A;  1GSD A;  4KF9 A;  5J41 A;  5KN0 A;  1EP8 A;  4EE0 A;  1OC9 A;  3TJJ A;  1ILO A;  1FO5 A;  3LFL A;  2DIY A;  1M9A A;  1Z6M A;  5D9V A;  1YF1 A;  1TRW A;  5G1L A;  1Q4J A;  8GSS A;  2H6Z A;  1QQ2 A;  4PNF A;  3KCM A;  1R7H A;  2UZ8 A;  1TDI A;  1M2D A;  5H5R A;  1GTI A;  3Q19 A;  1TRS A;  4JR6 A;  2WJU A;  3LXT A;  6GSY A;  4KAE A;  3W6G A;  2VM1 A;  2I3Y A;  3L9S A;  4YQM A;  2VCW A;  1RK4 A;  1WPI A;  1VF4 A;  4G0L A;  3WT2 A;  5ECQ B;  3WT1 A;  5E4W A;  2DIZ A;  4YAP A;  2F3M A;  4MDC A;  3MSZ A;  2R6K A;  4ECI A;  4XS1 A;  1FHE A;  2OAC A;  3LOR A;  1X5E A;  3ZFB A;  3EMP A;  1Z3E A;  2B1L A;  4XRD A;  4KDU A;  2OBI A;  3AY8 A;  3H1N A;  1TP9 A;  2OA7 A;  2KP1 A;  4LA1 A;  3PH9 A;  2L57 A;  1TI3 A;  2FA4 A;  4ISD A;  3OR5 A;  1MEK A;  2CVK A;  18GS A;  1SU9 A;  2RII A;  1G6W A;  2FLS A;  3M9K A;  3R3E A;  2GZP A;  1XW9 A;  4TRX A;  3ZIJ A;  1F3B A;  1GSU A;  1PN9 A;  5ID2 B;  1GRX A;  4ZB7 A;  5CRD A;  2VCZ A;  4BVX B;  3FHK A;  3GUR A;  3DVW A;  3GL5 A;  2O7K A;  3LYP A;  1TKD B;  4G0K A;  4IVF A;  1XOA A;  4IP6 A;  1V98 A;  1ACV A;  4L0U A;  1BG1 A;  1ZGN A;  2HZF A;  3F9U A;  4ZL9 A;  1A2J A;  3DRN A;  3F63 A;  2H73 A;  4E8H A;  4AI6 A;  3KH9 A;  3LG6 A;  2J23 A;  3VWV A;  2E7P A;  3GKK A;  4GWR A;  2VL3 A;  3UAR A;  3TKR A;  3FR6 A;  1EV9 A;  5H5Q A;  2VD0 A;  3DVX A;  3QPM A;  3ZRD A;  3M1G A;  1ZZY A;  5J40 A;  1B9Y C;  3A2X A;  4YQU A;  3TJK A;  2OT3 A;  4KND A;  2C0D A;  3QAV A;  5ECL B;  3IA1 A;  4MK3 A;  1AIU A;  2CAQ A;  4ZB6 A;  3UEM A;  5DQS A;  3ZFL A;  2VL2 A;  4HZ2 A;  2PMT A;  4USS A;  12GS A;  5IMD A;  5A5K A;  1A2M A;  4ZIJ A;  1X5C A;  2XC2 A;  2CZ2 A;  2ZUP A;  4OMV A;  5ECP B;  1O85 A;  5HR3 A;  4EDY A;  3KJY A;  3QAW A;  5KOX A;  4D73 B;  4EL1 A;  5IMZ A;  2HSH A;  4WF4 A;  4IJ3 A;  3MIX A;  1SYR A;  2WCI A;  1G0T A;  3M0F A;  1SKR B;  4MPG A;  5BRT A;  1S3C A;  4F2I A;  2PER A;  2H1L A;  1V57 A;  1NW2 A;  3ZVJ A;  1EOG A;  4MPF A;  5GZZ B;  4MZW A;  5JCW A;  3KMO A;  3HKR A;  3VI7 A;  2EIR A;  1JZD A;  2IPA A;  3UL3 A;  2MMO A;  4ZL7 A;  3RHC A;  1SL0 B;  5IMF A;  4HU7 A;  5B6M A;  4HU9 A;  2H0G A;  5COH A;  5EVO A;  1SJI A;  2WDU A;  2FCH A;  5J4Y A;  2MBS A;  3GX8 A;  9GSS A;  3VWX A;  2M72 A;  2NBS A;  1R5A A;  2AYT A;  3TJB A;  1O6J A;  1VF2 A;  5ECM B;  2H76 A;  5GST A;  3ERW A;  4Q5Q A;  4YKF A;  4FIW A;  2RUF A;  1ST9 A;  2VUP A;  2O5V A;  2VCT A;  2VIM A;  3VPT A;  1MD3 A;  2V6O A;  4KB3 A;  2I4A A;  2LRN A;  3ZIT A;  4X43 A;  5ECN B;  4L5L A;  1AUC A;  3TRQ A;  1R26 A;  3GFK A;  2I81 A;  5GAP D;  3TRX A;  4PXO A;  1XW5 A;  1YDK A;  4ULX A;  3D21 A;  3GST A;  1SJ6 A;  2VM2 A;  17GS A;  1N8J A;  3I43 A;  3C1S A;  1ZMA A;  4MJC A;  2K6V A;  3PR8 A;  4FO5 A;  4XCS A;  5DAL B;  2MBT A;  5A34 B;  2VO4 A;  2HXK A;  4PGT A;  2MYG A;  10GS A;  2LNT A;  4BVX A;  2FUG 2;  4HQS A;  1JLV A;  4GRF A;  2F8F A;  2HRF A;  3RPN A;  1OC3 A;  3UOM A;  2GQL A;  2R0G A;  1ZCP A;  5ECR B;  1PL1 A;  2GQM A;  2CV4 A;  4WR5 A;  3IBH A;  4POB A;  2KHP A;  1U87 A;  2I1U A;  2CX4 A;  4YKG A;  1K0O A;  2FHE A;  1A2L A;  3GKN A;  3ERG A;  3FW2 A;  2P31 A;  2JAC A;  4G2E A;  5FHI A;  1NHY A;  5KN3 A;  2FA8 A;  2CVB A;  1SL2 B;  3L9U A;  4AJ8 A;  5CRW A;  2EFC A;  3EUR A;  3QCP A;  3EIN A;  1FB0 A;  2B7J A;  4BL7 A;  3IHG A;  3UJ1 A;  4N0V A;  2LUS A;  5G5F A;  2H66 A;  4JR4 A;  1HNB A;  1KTE A;  1ZL9 A;  1O7U A;  3W8J A;  3KEB A;  1KEB A;  3TDG A;  2WFC A;  1THO A;  3G7Y A;  4DSQ A;  1FVK A;  2LNS A;  1AW9 A;  3IXR A;  2YWO A;  2VD1 A;  3LSZ A;  2GSR A;  3WD6 A;  2DMM A;  1KBN A;  2L4C A;  5LNK e;  4EIQ A;  2LV3 A;  4WR4 A;  1JFU A;  1PN0 A;  1BAY A;  2HSM B;  2DJK A;  3GYK A;  3MAK A;  4AJ6 A;  4CDO A;  1SYX A;  4A5P A;  4TR3 A;  1F3A A;  4NAX A;  1ERU A;  4D73 A;  3VUR A;  2WRT A;  2L5L A;  4TOP A;  2GQK A;  4PQH A;  3ZLP A;  3LWA A;  5DCH A;  4BVY B;  1HQO A;  3ZMK A;  4OFM A;  4OD7 A;  4AKX B;  2B7K A;  3BOA A;  3LXZ A;  3QD9 A;  2DJ3 A;  3A2V A;  4I8B A;  2NTO A;  4ZBB A;  2L5O A;  3EU4 A;  2F51 A;  3HCZ A;  3TKS E;  3EMX A;  3D22 A;  4K0G A;  1TXX A;  5IO0 A;  4AGS A;  1YKC A;  2EFD A;  4HI7 A;  2K8V A;  4Q5N A;  4WEY A;  1R4W A;  5A1N A;  5J9B A;  5H5S A;  2HE3 A;  4RQX A;  2HRN A;  4IJI A;  4G10 A;  4X0X A;  2V2G A;  2C0G A;  2AUV A;  2HSY A;  4HDE A;  6GSU A;  3QR6 A;  5IOW A;  3QAG A;  2HI7 A;  4POM A;  3D4M A;  1CQH A;  4LMW A;  2J9H A;  1R5P A;  2K8S A;  1HNC A;  3R2Q A;  5B7C A;  2VAF A;  4PUA A;  1XWG A;  2H8L A;  2H0I A;  3DD3 A;  5L71 A;  5F8B A;  1QMV A;  4MAB A;  4NWY A;  3CTG A;  3MNG A;  5HR0 A;  3GHA A;  3LEF A;  1U88 A;  4QL9 A;  1A0F A;  2DJ0 A;  2X8C A;  1SKW B;  4RUV A;  2B6M A;  2A4V A;  2CAI A;  2YOI A;  3E9J B;  3CSJ A;  3TKS C;  1MDJ A;  2YWN A;  3HJP A;  3IE3 A;  1USB A;  4ECC A;  2C1Y A;  3DIE A;  4AKH A;  4EF0 A;  4BWS A;  5DAL A;  5A34 A;  1PGT A;  4X4J A;  1V9W A;  3TKP A;  3RPP A;  1J9B A;  1GNW A;  4JE1 A;  1K3O A;  4XTS A;  4ZXG A;  2CVD A;  2B1K A;  3WGD A;  2O85 A;  1PX6 A;  1WMJ A;  2PU9 C;  5ECO B;  2DJJ A;  4TR0 A;  3CRT A;  4GXZ A;  3CSH A;  4IS0 A;  3HVS A;  5LD0 A;  2LEG A;  4P3Y B;  3LW9 A;  4HZ4 A;  1OC8 A;  2YV9 A;  5A4U A;  1SD8 A;  3CYN A;  2DBC A;  2HZE A;  4FYU A;  4F82 A;  3M8N A;  5DJL A;  1FOH A;  3MWH A;  1OKT A;  4K0N A;  3HMJ G;  1B9X C;  3EPT A;  2MZC A;  4Z7X A;  3I6A A;  1WE0 A;  2GTU A;  2H1A A;  2ES7 A;  5HFI A;  1RQM A;  5D9T A;  1A0R P;  3IRA A;  3CTF A;  1EEM A;  2ZNM A;  3P2A A;  4IGJ A;  1GUL A;  1X9S B;  1BED A;  2YP6 A;  3GMF A;  2JZS A;  4ECJ A;  3GV1 A;  2R4V A;  1EP7 A;  4TXV A;  1S3A A;  2GT5 A;  5IIZ A;  1SVL A;  2C80 A;  2JL4 A;  2JAD A;  3ZL5 A;  1TK5 B;  3I69 A;  3GKM A;  3L78 A;  2R0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...