6GSUA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
b'PMILGYWNVRGLAHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Transferase
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsuA01
2B5YA 4RI7A 4MJEA 3FR6A 4IJIA 3KTBA 3PPUA 2ON7A 5JCWA 1V40A 4HZ2A 1A2LA 1VRSD 4EC0A 3EYTA 5F8BA 4K8MA 1PRXA 4OFNA 1DUGA 2M46A 2G2QA 5CRDA 2PERA 3CMIA 1NHOA 13GSA 3VFIA 4GQFA 3HZ4A 1B4PA 1XWGA 3K8NA 4K9ZA 5JCUA 2IIYA 3J7Yb 1N2AA 4L0WA 4EXJA 3VI5A 2L4CA 3O6TA 3KH7A 3KP9A 4IQAA 5IQYA 1X0RA 2F51A 5CRGA 1B48A 2JU5A 1PKWA 3A2WA 3LYKA 2IFQB 1FAAA 2H70A 1QQ2A 1R5AA 2O7KA 3UVTA 3TKQA 2R5GA 2KP2A 3QDNA 4O92A 2DJ2A 2VO4A 4KDXA 4PGTA 2VLVA 1TXXA 4BA7A 3WGXA 1GH2A 2HXKA 1SYRA 3ZFLA 4DVCA 3D4MA 1HYUA 3TKSC 3OR5A 7GSSA 1SL1B 4G19A 4N0ZA 1A24A 1ERVA 3GMFA 4BWQA 2YPMA 2K8SA 4ZL7A 3UL3A 1SD8A 1AQWA 1OE7A 2LJAA 4G0LA 3WD6A 4MJBA 4N30A 2J9HA 1I5GA 1K0CA 3HJOA 5DQYA 1G6YA 1FOVA 4Q5QA 5B6NA 2NPBA 3F9UA 3QOUA 1FO5A 1Z9HA 3GX0A 4GXZA 3HVXA 5GZZB 2HRKB 1LBKA 2PBJA 4HU9A 5EY6A 2TIRA 2DIZA 1NW2A 2OACA 4IELA 4CDOA 2H76A 1YDKA 4K0GA 2VM2A 4EKZA 4JZQA 4HOJA 3ISOA 5A4UA 4XHMA 3ZYWA 2LRNA 5KN3A 2CVBA 3KMOA 3DRNA 5KEJA 3LEFA 5AIXA 4BVXA 2P31A 1ACVA 4ACSA 2E2GA 4YQMA 1FB6A 4AGSA 3EU4A 3PR8A 2O87A 5IPGA 1K0NA 3TJFA 2C4JA 5GAND 2I9HA 4ID0A 3LFLA 2FY6A 1GTUA 3DYRA 4TXVA 4H86A 3HVSA 1K0OA 5E59A 4XS6A 1I9DA 5DJMA 2OE0A 2AJQB 3GYKA 2VIMA 2IMFA 2LRTA 5DQSA 4GWRA 3DIEA 3ERGA 1Z6MA 1EGRA 5KN0A 4DSSA 3ZTLA 1F3BA 1K0MA 3QAVA 1SU9A 3LXZA 1QGVA 1GUHA 4TKYA 2FA4A 1R4WA 1M2BA 2L6CA 5ECPB 1GSUA 4NWYA 2LTKA 3IK9A 2C3TA 4K6XA 2H6YA 3GTUA 1GSDA 4FYUA 2QKEA 1JLVA 3O3TA 1VF2A 2IL3A 3QAGA 2C3QA 2XPEA 14GSA 4KDUA 1SKWB 2VCVA 1XWCA 3GH9A 3DVXA 2CA8A 3TKSE 4HZ4A 4ML1A 4KX4A 3R3EA 8GSSA 1XZOA 1OC3A 5HR2A 1ST9A 1GULA 2JSYA 5AN1A 2VLTA 3G9BA 2ZNMA 3E0UA 3WGEA 3M9KA 3L9SA 3CSHA 3E9JB 1QFNA 4MZCA 5ELAA 3GURA 4I5QA 4K7NA 4ECJA 3GIXA 1GNEA 3CSIA 4IQ1A 2GZZA 3QPMA 4ULXA 3KMNA 1V57A 2YOIA 3HYPA 2WRTA 1F6MC 4GCIA 1T4ZA 2VCXA 2HRAA 1FHEA 1WJKA 5D9VA 4KF9A 3CTFA 3D4TA 2G0FA 2KLXA 4JEDA 2F8AA 5COHA 5ECOB 4BL7B 3ZL5A 3I69A 5IO0A 3KZQA 3F6FA 2CZ3A 4FIWA 1AW9A 3F3RA 2A2RA 3FKFA 1J9BA 2L5LA 5J5NA 2V6KA 1TU8A 3DD3A 1A8YA 1WP0A 4IBPA 1G7OA 4V2MA 4ZBAA 2IMKA 4KH7A 5D93A 4OCFA 1FW1A 5CO3A 4G2EA 3UARA 1XCCA 3UBLA 1M9BA 3D0ZA 1SJ6A 1S3CA 4E8HA 2B7KA 1BJXA 1YJ6A 1LJRA 4XTSA 4NHWA 4P3YB 2R4VA 1ERUA 2C80A 1V2AA 4L0UA 2GZPA 2H66A 1JZOA 3WYWA 3NZNA 5IMDA 1MDJA 4EUYA 3TJBA 2H8LA 3V1WA 2XBIA 3TDGA 18GSA 5D9WA 2L5OA 4O32A 3A5WA 1R26A 4OO4A 2E0QA 1T4YA 1XXUA 2P0GA 6GSUA 3A2XA 1AIUA 1J08A 2GQKA 2EIOA 4FH8A 4EF0A 2GZYA 5ECQB 2H71A 3TKSA 1T00A 3KJYA 3NOFA 1AQXA 3ZIJA 2XHFA 5J41A 1K0DA 5CRHA 4ZL8A 1URMA 1EZKA 2IWTA 4TR3A 4TXOB 4BVYA 1EEJA 2BJXA 1THOA 4EVMA 3GN3A 9GSSA 4YQUA 2H6XA 6GSXA 4PNGA 3Q19A 1XIYA 5IOXA 2WCIA 4PUFC 1GWCA 1TW9A 1GP1A 1TKDB 3RPNA 5IMCA 3VWWA 4ZL9A 2HSMB 3PINA 1G6WA 1WPIA 1G7EA 2RUEA 4XS4A 1GUMA 1V98A 3F4TA 2E2MA 4KUNA 2P5RA 3RHCA 4IW9A 4ZXGA 2XBQA 5IM9A 5F06A 5J9BA 4V2NA 3ZRDA 3C73A 1B9XC 4OD7A 4MF5A 3TRXA 1CQHA 3IAM2 4YH2A 2EC4A 5CREA 1RQMA 4GSTA 4PQ1A 3O76A 3HDCA 2GSRA 3FR3A 10GSA 2UZ8A 5ID2B 2L4QA 4MLYA 4TR0A 4J56E 1UC7A 3P90A 2C3NA 2B6MA 2F8FA 5DALB 3IOSA 2GDRA 3KP8A 1OYJA 1MDIA 4MF7A 5F05A 5D9XA 4GSSA 4GTUA 3QFBC 3FZ5A 4J57E 3U5RE 5BMUA 2CAQA 2X64A 3HJMA 2H1DA 1EP8A 2FD3A 2IFQA 5HFIA 2RLIA 1OC9A 1N8JA 4MJCA 3BCKA 4TR1A 1YY7A 2HRNA 3F4SA 2DMMA 2PUKC 4FO5A 4I8BA 2GT6A 1AQVA 1WRYA 4G0IA 3RDWA 4PQHA 4MCUA 4HS1A 1TK8B 2N5AA 4V1Ap 5CP1A 4IHUA 2V2GA 4X0XA 5G1KA 3H1NA 4ECCA 1ZL9A 4MDCA 4DSRA 4WEYA 1YKAA 6GSVA 3AY8A 1S3AA 1ZMAA 4IKHA 1V9WA 1M2DA 4PUAA 2OJLA 5ECMB 4GQCA 1X5EA 5EL8A 1Z7PA 5CAXA 4RI6A 1OE8A 5G5EA 1O73A 2KOKA 1A0RP 3F0IA 3KH9A 3I9V2 20GSA 3TRPA 3I6AA 4WXTA 3FW2A 2O89A 2HFDA 3IXRA 1DE1A 3H93A 4JRRA 5G1LA 2DJJA 1TRSA 3DGQA 4LMWA 3VWXA 3BJ5A 3RBTA 2P5QA 3GUSA 3GSTA 1Z3EA 1QUWA 4G0KA 5FHIA 1ZCPA 2YWIA 1UVZA 2OA7A 4HU7A 1BAYA 1WMJA 3VK9A 3P2AA 1XW6A 2HT9A 3TJGA 2WB9A 2CX3A 1ERWA 3FEUA 5H5RA 1SK2A 2IJYA 4MF6A 2YWOA 2DBCA 3LWAA 4D73A 2H1AA 3ZREA 2YCDA 4XS1A 1GTAA 3CSJA 4JR6A 3Q18A 4RUVA 3TJJA 1VF4A 1E2YA 3DVWA 5AGYA 4X1UA 2J23A 2AUVA 3ZFBA 3QCPA 1KTEA 2VUPA 3BBYA 5CRWA 1PL1A 5DCGA 5AISA 2VLUA 2I81A 5ECSA 3ED3A 3M3MA 2V32A 3TOUA 3UMAA 1Q4JA 2IMEA 3BD2A 5CNWA 4KNDA 1KBNA 5EVOA 4KDYA 4V2LA 5DAKA 3TJKA 4MJAA 5JWOB 2CX4A 1TRUA 3L9UA 4MMMA 2TRCP 1YZXA 1SYXA 1VGLA 3ZMKA 3US3A 2HQTA 4XIHA 3MNGA 1PQNA 1GL8A 2JZTA 4IJ3A 3W8JA 1J0FA 4YAPA 3LG6A 2HSYA 4WKWA 5D9TA 4OFMA 2N5FA 2YV9A 5ECKB 4IS0A 1YF0A 2MBTA 1GLQA 2LUSA 3KGKA 4FYBA 3HD5A 5LCZA 2CT6A 3WGDA 4FQUA 3LGCA 4HDEA 3FRCA 1PA3A 1ON4A 2OKAA 1U6TA 1VF3A 3TCOA 5IPHA 2REMA 1DBYA 2CAIA 2RIIA 2H0HA 3VWUA 1X5DA 3CTGA 5HR1A 5C04A 3IE3A 2GVPA 3VWVA 1K0AA 1XPVA 4WF4A 2HLSA 4KSMA 3U6VA 5JWQB 2B7JA 2YJ7A 2GQLA 2B3SA 3ZITA 1WOUA 4ZB9A 4KA0A 2H74A 4NV2A 3TB2A 1AC1A 5B8BA 2YJHA 2AB6A 4BVXB 4WR4A 4MZWA 3E3EA 3G7JA 5GSTA 3GKXA 3BCIA 4PX1A 5G2ZA 3KXOA 4EDZA 2YWMA 1U87A 2JL4A 2HYXA 2VCWA 2OADA 1TRWA 5B6MA 4I6XA 2FHEA 3TKPA 1XVWA 3GX8A 3N5OA 1AAZA 2IMIA 2PMTA 2NBSA 2HE3A 2HZEA 4TRXA 1DSBA 1WIKA 4F9ZA 4G9HA 2GT5A 3QFAC 2GSTA 2I1UA 3EMXA 5DJLA 5AIVA 2GS3A 2FWHA 2H0GA 4DSSB 4O5RA 4I2TA 1HNBA 3N9JA 2CVDA 2C0DA 1XWAA 5H5SA 4POMA 4WETA 4ZBBA 5FT3A 2ZCTA 4KGIA 3KEBA 4POKA 3L9VA 4TXOA 1GTIA 3IR4A 2VL2C 3RAZA 1TP9A 1A23A 1SL2B 2VOCA 2VD1A 3Q74A 2VCZA 3P7XA 5HQPA 4NAXA 3TUEA 1EOHA 3L0HA 3TOTA 1YEPA 2LNSA 2TRXA 3GL5A 4F82A 2HSMA 3L78A 3HCZA 5EPFA 4MPGA 3KM6A 1BQ7A 5G31A 3C7MA 1F2EA 1SJIA 2PGTA 3MSZA 1XW5A 3IC4A 1SKRB 1XOBA 3UEMA 1Q98A 5JCGA 3LORA 4V1Ag 1F37A 1PL2A 3VLNA 4KW6A 4HQSA 2HNLA 12GSA 2C0GA 22GSA 2N5BA 4OCEA 4F0CA 2PVOC 2X8HA 4HUAA 5J9CA 3LQ7A 2M80A 1JZWA 1EGOA 1NM3A 1SL0B 1YQ1A 2HSNB 3HY2A 4O7HA 1SK1A 1OAZA 2K8VA 3F3QA 2XPDA 4Z7XA 1GSSA 16GSA 3G7IA 1K3LA 3ERFA 4K7OA 4L5LA 2I4AA 5DBQA 4OMVA 2H6ZA 5ECLB 1WWJA 2L57A 5HFGA 3RHBA 2X8CA 3DXBA 2E7PA 4DEJA 2H30A 2VM1A 3EWLA 3IA1A 3FZ9A 3HKRA 1E6BA 1TU7A 3WT2A 1F9MA 4AJ6A 3C71A 3C8EA 2B5EA 3EVIA 2Z9SA 1Y25A 4KCAA 2DJ1A 2H75A 3UIWA 3VPTA 3GKMA 2H01A 4POBA 2KHPA 1PX6A 4J2FA 1XOAA 3UBKA 4JR4A 2AAWA 1OC8A 2F9SA 4BPYA 4GF0A 1XWKA 2V1MA 1HNCA 2D2ZA 3IV4A 1M0UA 5IMZA 1ZYEA 5ECNB 1XW9A 3KCMA 5F0GA 1K0BA 1X9WB 3Q6OA 3MDKA 5G5FA 3W6GA 1A8LA 2VAFA 4CW9A 3F6DA 1U3IA 2KUCA 3TGZA 1PGTA 2NDOA 3GHAA 1B8XA 5DDLA 2NVLA 1KEBA 5ECRB 4OWYA 3KTLA 3UJ1A 2C8UA 3ZZXA 3ZMLA 5D8IA 2QC7A 1IYIA 5INYA 4TN8A 4EL1A 5IO2A 1MD3A 1GRXA 1T3BA 3IHQA 2ON5A 2FWFA 4NXIA 2YNXA 5HR3A 1F3AA 2MYGA 3GV1A 5F07A 3ME7A 2H72A 4WR5A 1GTBA 4MZBA 4XS4B 1O85A 4G10A 4K7IA 1V58A 1XBSA 4ZIJA 4MA9A 2F3MA 5FWGA 1NHYA 6GSSA 1ZGNA 4TW5A 2DSAA 1TI3A 3H79A 2QSIA 2DJKA 3GKKA 4I2UA 2DC5A 3IBHA 2ES7A 3M1GA 1WE0A 5GSSA 5IIZA 3GNJA 2C1YA 3GL3A 5J4UA 2EIQA 2HRKA 1OKDA 3UOMA 1YKCA 1SJZA 5A4WA 3MAKA 2OE1A 2PPTA 1ZOFA 1A2JA 3JCML 1GSFA 4N10A 3IRAA 1TDIA 2YANA 4PXOA 4PTSA 4HJMA 4KSOA 2WULA 1PN9A 3SWLA 1FG4A 3HXSA 1OC9B 3CRTA 3IDVA 4TR1B 1TK0B 5IMVA 1S3DA 3DEXA 2VL2A 2R3XA 3H8QA 3CBUA 2VL9A 1JZDA 2L59A 3EU3A 2WDUA 1XFLA 2LJKA 3HJPA 1W4VA 1O8WA 2FUG2 1SK0A 1O81A 1GNWA 2LSTA 2EIRA 2GQMA 3H4KA 2CV4A 2K6VA 1AXDA 2AYTA 2BTOT 2R2JA 4K0NA 1A0FA 4MPFA 1TOFA 3APSA 1EOGA 2RM6A 3M8NA 2AHEA 3FYGA 4PNFA 3FK8A 2M72A 2LV3A 3DWVA 3PGTA 2LJRA 2JADA 2L6DA 3HA9A 5ENUA 5DCHA 1JHBA 5B7CA 1SENA 2YV7A 2MMNA 1PX7A 1TTZA 2PVQA 5IMAA 3VPQA 4CHSA 1THXA 2GSQA 3D5JA 4HEA2 2MMZA 1QXHA 3CXGA 2H1BA 3M9JA 3UVHA 1HQOA 4ZILA 1PMTA 5H5QA 2KP1A 2LRCA 2R6KA 3C1SA 4ECBA 3GSSA 1R7HA 4L8EA 2CZ2A 4MH2A 1GUKA 1GSQA 3FY7A 3W8SA 4ZBDA 4HJ2A 1HD2A 4JBBA 1FB0A 3FR9A 1USBA 2ZUPA 2C0FA 4MABA 3ZIVA 2B5XA 5IMFA 4AJ8A 4ML6A 6GSTA 1X5CA 5A5KA 5KN1A 2OBIA 3QR6A 5HFKA 3HZ8A 1BYEA 2FLSA 1CQGA 2GSSA 4I97A 3ZVJD 3DMLA 3D22A 5IOWA 5ABRA 1A2MA 2AV4A 2FWEA 4YAVA 2MMOA 4QL7A 4D73B 3QD9A 4WF5A 3L4NA 4AF2A 2V41A 1B4QA 4F0BA 2LQOA 4N0VA 4USSA 3SBCA 4YQVA 5B8AA 2DJ0A 1K3OA 1Y6EA 2RM5A 3CYNA 4BL7A 4Q5FA 4XCSA 5LD0A 2WGRA 3ERWA 3F63A 3VURA 4GLTA 4NV5A 5D96A 1K3YA 5J3RA 4IP1A 1O8XA 5L71A 3QAWA 2DMLA 1PD21 1MEKA 4KE3A 1OVNA 4DSQA 3MWHA 1Z7RA 4RQRA 1UA5A 1GSYA 5ECHB 1U88A 5DAKB 4ECIA 3M0FA 2PWJA 3G7YA 4POLA 4QQ7A 5D73A 1T1VA 2IPAA 2DIYA 1RK4A 2V6OA 1MD4A 4EO3A 11GSA 5HR0A 1VF1A 4LL1B 4KAEA 2YP6A 3D6IA 2K9FA 3A3TA 19GSA 1H4OA 1EV9A 3FHKA 4F2IA 2FWGA 1SKSB 4NPBA 4MK3A 2DJ3A 2HSHA 4K2DA 2HI7A 2ALBA 2FA8A 2WFCA 4ILFA 2FCHA 2PU9C 1EP7A 1JZRA 1MTCA 2JZRA 4OO5A 4KCEA 1PKZA 5ECIB 3HHVA 2VL3A 4IGJA 2O85A 2LKUA 3D21A 4NMUA 3GTUB 2QGVA 3BOAA 3KIJA 2YZUA 2CQ9A 2PN8A 3IC8A 4KB3A 3GRXA 1BEDA 2GLRA 2FNOA 1LU4A 3F4RA 3GH6A 2WZ9A 2R37A 1RW1A 4XRAA 2GGTA 1EV4A 3S9FA 4GRFA 3EMPA 2JZSA 1TRVA 3EINA 2HRFA 2MMAA 3F8UA 4IN0A 3TRQA 1TJDA 5CYYA 6GSYA 4PQIA 3GA4A 4F03A 4XRDA 1YEXA 4EE0A 3FZAA 3ME8A 3IK7A 5ELGA 3CRUA 4OFTA 4LL4B 3VI7A 4FYCA 2XC2A 1U3AA 4RQXA 1XVQA 1GLPA 3GKNA 1EWXA 1X9SB 1T7PB 4QL9A 2LNTA 2HZEB 2RUFA 3EURA 4GSNA 5GAPD 4ZB6A 5LNKe 4HI7A 1ERTA 1M2AA 1TI1A 4AJ7A 4IP6A 3APQA 5ID2A 1JLWA 3LXTA 4TOPA 2VD0A 1C72A 5DALA 1SD9A 1XWBA 1Z5YE 3R2QA 6GSWA 1R5PA 1M9AA 3NIVA 2A4VA 4MH3A 4WBRD 17GSA 1M99A 5G30A 2HZFA 4TR4A 2YZHA 4L5OA 4X43A 4N11A 4PURA 3RPPA 4BWSA 2LEGA 2OE3A 3WT1A 3LSZA 2JACA 1O6JA 4LLRA 3UAPA 2WJUA 3FZ4A 1ILOA 1BG5A 2WS2A 3P8WA 1IYHA 1T8EB 4LA1A 1EEMA 1H75A 1DE2A 2YN1A 1ML6A 2LQQA 1TK5B 3QMXA 1M7TA 4K1FA 3IAS2 1OKTA 4EDYA 3LYPA 2H0IA 3APOA 1QK8A 3IPZA 1YF1A 1MDKA 5JWRB 1Z6NA 5DVBA 1ZYQB 1QMVA 2LS5A 4ISDA 1UN2A 4JE1A 5C00A 5E4WA 2H19A 3EE2A 3I43A 4E8EA 2IMDA 1HNAA 3ZLPA 1JFUA 4BVYB 2H73A 2VCTA 5A4VA 4LMVA 1PSQA 3HVVA 5KN2A 1FVKA 2OBKA 1G0TA 2NTOA 4MP4A 2O8VB 2IN3A 1GSEA 3LJRA 1ABAA 2H1GA 1FVJA 2YWNA 3C1RA 4JU5A 2DLXA 1O7UA 2B1LA 2X8GA 2I3YA 3EC3A 3PH9A 2BMXA 3J7Yk 4Q5RA 3DKSA 2C0EA 3GFKA 2A2SA 4ZB8A 2MZCA 1ZZYA 3TKRA 1X9MB 2X99A 1BX9A 3A2VA 3ZVJA 4WBJA 4TVEA 3KD0A 4NHZA 1NSWA 4IVFA 2FGXA 2MBSA 1KNGA 2JSZA 2K18A 1B9YC 2VCQA 2GTUA 1W89A 2B1KA 2CVKA 1AUCA 4HQZA 4Q5NA
chains in the Genus database with same CATH superfamily
2B5YA 4RI7A 4MJEA 3FR6A 4IJIA 3KTBA 3PPUA 3HVNA 2ON7A 5JCWA 1V40A 4HZ2A 1A2LA 1VRSD 4EC0A 3EYTA 5F8BA 4K8MA 4ZB7A 1PRXA 4AKGA 4OFNA 1DUGA 2M46A 2G2QA 5CRDA 2PERA 3CMIA 1NHOA 13GSA 3VFIA 4GQFA 3HZ4A 1B4PA 1XWGA 3K8NA 4K9ZA 2DKIA 5JCUA 2IIYA 3J7Yb 1N2AA 4L0WA 4EXJA 3VI5A 2L4CA 3O6TA 3KH7A 3KP9A 4IQAA 5IQYA 1X0RA 2F51A 5CRGA 1B48A 2JU5A 1PKWA 3A2WA 3LYKA 3CHXC 4GDFA 1FAAA 1QQ2A 2H70A 2IFQB 1R5AA 2O7KA 3UVTA 3TKQA 2R5GA 2KP2A 3QDNA 4O92A 2DJ2A 2VO4A 4KDXA 4PGTA 2VLVA 1TXXA 4BA7A 3WGXA 1GH2A 2HXKA 2O36A 1SYRA 4X4JA 3ZFLA 4DVCA 3D4MA 1HYUA 3TKSC 3OR5A 7GSSA 4A5PA 1SL1B 4G19A 4N0ZA 1A24A 1ERVA 3GMFA 4BWQA 2YPMA 2K8SA 4ZL7A 3UL3A 1SD8A 1AQWA 1OE7A 3EPTA 2LJAA 4G0LA 3WD6A 4MJBA 4N30A 2J9HA 1I5GA 1SVMA 1K0CA 3HJOA 1SVLA 5DQYA 5A34A 1G6YA 1FOVA 4Q5QA 5B6NA 2NPBA 2WVZA 3F9UA 3QOUA 1FO5A 1Z9HA 3GX0A 4GXZA 3HVXA 5GZZB 2HRKB 1LBKA 2PBJA 4HU9A 5EY6A 2TIRA 2DIZA 1NW2A 2OACA 2X49A 4IELA 4CDOA 2H76A 1YDKA 4K0GA 2VM2A 4EKZA 4JZQA 4HOJA 3ISOA 5A4UA 4XHMA 3ZYWA 2LRNA 5KN3A 2CVBA 3KMOA 3DRNA 5KEJA 3LEFA 5AIXA 4BVXA 2P31A 1ACVA 4ACSA 2E2GA 4YQMA 1FB6A 4AGSA 3EU4A 3PR8A 2O87A 5IPGA 1K0NA 1M3IA 3TJFA 2C4JA 5GAND 2I9HA 4ID0A 3LFLA 2FY6A 1GTUA 3DYRA 3FMWA 4TXVA 2EFHA 4H86A 3HVSA 1K0OA 5E59A 4XS6A 1I9DA 5DJMA 2OE0A 2AJQB 3GYKA 2VIMA 2IMFA 2LRTA 5DQSA 4GWRA 3DIEA 4K5SA 3ERGA 1Z6MA 1EGRA 5KN0A 4DSSA 3ZTLA 1F3BA 1K0MA 3QAVA 1SU9A 2R0PA 1YVLA 3LXZA 1QGVA 1GUHA 4TKYA 2VKZG 2FA4A 1R4WA 1M2BA 2L6CA 5ECPB 4YKGA 1GSUA 4NWYA 2LTKA 3IK9A 5A5HA 2C3TA 4K6XA 2H6YA 3GTUA 1GSDA 4FYUA 2QKEA 1JLVA 3O3TA 2WW0A 1VF2A 2IL3A 3QAGA 2C3QA 2XPEA 14GSA 4KDUA 1SKWB 2VCVA 1XWCA 4K5RA 3GH9A 3DVXA 2CA8A 3TKSE 4HZ4A 4ML1A 4KX4A 3R3EA 8GSSA 1XZOA 1OC3A 5HR2A 1ST9A 1GULA 2JSYA 5AN1A 2VLTA 3G9BA 2ZNMA 3E0UA 2QA1A 3WGEA 3M9KA 4Z2TA 3L9SA 4AI6A 3CSHA 3E9JB 1QFNA 4MZCA 5ELAA 3GURA 5J4YA 4I5QA 4K7NA 4ECJA 3GIXA 1GNEA 3CSIA 4IQ1A 2GZZA 4N3ZA 3QPMA 4ULXA 3KMNA 1V57A 2YOIA 3HYPA 2WRTA 1F6MC 4GCIA 1T4ZA 2VCXA 2WVYA 2HRAA 1FHEA 1WJKA 5D9VA 4KF9A 3CTFA 3D4TA 2G0FA 2KLXA 4JEDA 2F8AA 5COHA 5ECOB 4BL7B 3ZL5A 2HSNA 3I69A 5IO0A 3KZQA 3F6FA 2CZ3A 1Y1UA 4PHZC 4AKHA 1AW9A 1PFOA 3F3RA 4FIWA 2A2RA 3FKFA 1J9BA 2L5LA 5J5NA 2V6KA 1TU8A 3DD3A 1A8YA 1WP0A 4IBPA 1G7OA 4V2MA 4ZBAA 2IMKA 1S3RA 4KH7A 5D93A 4OCFA 1FW1A 5CO3A 4G2EA 3UARA 1XCCA 3UBLA 1M9BA 3D0ZA 1SJ6A 1S3CA 4E8HA 2B7KA 1BJXA 1YJ6A 1LJRA 4XTSA 4NHWA 4P3YB 2R4VA 1ERUA 2C80A 2O3EA 1V2AA 4L0UA 2GZPA 2H66A 1JZOA 3WYWA 3NZNA 5IMDA 1MDJA 4EUYA 3TJBA 2H8LA 3V1WA 1ZYPA 2XBIA 3TDGA 18GSA 5D9WA 2L5OA 4O32A 3A5WA 1R26A 4OO4A 2E0QA 1T4YA 1XXUA 2P0GA 6GSUA 3A2XA 1YEWC 1AIUA 1J08A 2GQKA 2EIOA 4FH8A 4EF0A 4AKIA 2GZYA 5ECQB 2H71A 3TKSA 1T00A 3KJYA 3NOFA 1AQXA 3ZIJA 2XHFA 5J41A 1K0DA 5CRHA 4ZL8A 1URMA 1EZKA 2IWTA 4TR3A 4TXOB 4BVYA 1EEJA 2BJXA 1THOA 4EVMA 3GN3A 9GSSA 3MYDA 4YQUA 2H6XA 6GSXA 4PNGA 3Q19A 2R0CA 1XIYA 5IOXA 2WCIA 4PUFC 1GWCA 1TW9A 1GP1A 1TKDB 3RPNA 5IMCA 3VWWA 4ZL9A 2HSMB 3PINA 1G6WA 1WPIA 1G7EA 2RUEA 4XS4A 1GUMA 1V98A 3F4TA 2WZSA 2E2MA 4KUNA 2P5RA 2EFDA 3RHCA 4IW9A 4ZXGA 2XBQA 5IM9A 5F06A 5J9BA 4V2NA 3ZRDA 3C73A 1B9XC 4OD7A 1FOHA 4MF5A 3TRXA 1CQHA 3IAM2 4YH2A 2EC4A 5CREA 1RQMA 4GSTA 4PQ1A 3O76A 3HDCA 2GSRA 3FR3A 10GSA 2UZ8A 5ID2B 2L4QA 4MLYA 4TR0A 4J56E 4CY6A 1UC7A 3P90A 2C3NA 2B6MA 2F8FA 5DALB 3IOSA 2GDRA 3KP8A 1OYJA 1MDIA 4MF7A 5F05A 5D9XA 4GSSA 4GTUA 3QFBC 3FZ5A 4J57E 3U5RE 2EFCA 5BMUA 2CAQA 2X64A 3HJMA 2H1DA 1EP8A 2FD3A 5J47A 2IFQA 5HFIA 2RLIA 1OC9A 1N8JA 2QA2A 4MJCA 3BCKA 4TR1A 1YY7A 2HRNA 3F4SA 2DMMA 2PUKC 4FO5A 4I8BA 2GT6A 1AQVA 1WRYA 4G0IA 3RDWA 4PQHA 4MCUA 4HS1A 1TK8B 2N5AA 4V1Ap 5CP1A 4IHUA 2V2GA 4X0XA 5G1KA 3H1NA 4ECCA 1ZL9A 4MDCA 4DSRA 4WEYA 1YKAA 6GSVA 3AY8A 1S3AA 1ZMAA 4IKHA 1V9WA 1M2DA 4PUAA 2OJLA 5ECMB 4GQCA 1X5EA 5EL8A 1Z7PA 5CAXA 4RI6A 1OE8A 5G5EA 1O73A 2KOKA 1A0RP 5BRTA 3F0IA 3KH9A 3I9V2 20GSA 3TRPA 3I6AA 4WXTA 4O5QA 3FW2A 2O89A 2HFDA 3IXRA 1DE1A 3H93A 4JRRA 5G1LA 2DJJA 1TRSA 3DGQA 4LMWA 3VWXA 3BJ5A 3RBTA 2P5QA 3GUSA 3GSTA 1Z3EA 1QUWA 4G0KA 5FHIA 1ZCPA 2YWIA 1UVZA 2OA7A 4HU7A 1BAYA 1WMJA 3VK9A 3P2AA 1XW6A 2HT9A 3TJGA 2WB9A 2CX3A 1ERWA 3FEUA 5H5RA 4MNNA 5KOWA 5KOXA 5A1NB 1SK2A 2IJYA 4MF6A 2YWOA 2DBCA 3LWAA 4D73A 2H1AA 3ZREA 2YCDA 1PN0A 4XS1A 1GTAA 2WVXA 3CSJA 4JR6A 3Q18A 4RUVA 3TJJA 1VF4A 1E2YA 1ZYNA 3DVWA 5AGYA 4X1UA 2J23A 2AUVA 3ZFBA 3QCPA 1KTEA 2VUPA 2H1LA 3BBYA 5CRWA 1PL1A 5DCGA 5AISA 2VLUA 2I81A 5ECSA 3ED3A 3M3MA 2V32A 3TOUA 3UMAA 1Q4JA 2IMEA 3BD2A 5CNWA 4KNDA 1KBNA 5EVOA 4KDYA 4V2LA 5DAKA 3TJKA 4MJAA 5JWOB 2CX4A 1TRUA 3L9UA 4MMMA 2TRCP 1YZXA 1SYXA 1VGLA 3ZMKA 3US3A 2HQTA 4XIHA 3MNGA 1PQNA 1GL8A 2JZTA 4IJ3A 3W8JA 1J0FA 4YAPA 1TXUA 3LG6A 2HSYA 4WKWA 5D9TA 4OFMA 2N5FA 2YV9A 5ECKB 4IS0A 1YF0A 2MBTA 1GLQA 2LUSA 3KGKA 4FYBA 3HD5A 5A34B 5LCZA 2CT6A 3WGDA 1SVOA 4FQUA 3LGCA 4HDEA 3FRCA 1PA3A 1ON4A 2OKAA 1U6TA 1VF3A 3TCOA 5IPHA 2REMA 1DBYA 2CAIA 2RIIA 2H0HA 3VWUA 1X5DA 3CTGA 4G01A 5HR1A 5C04A 3IE3A 2GVPA 3VWVA 1K0AA 1XPVA 4WF4A 2HLSA 4KSMA 3U6VA 5JWQB 2B7JA 2YJ7A 2GQLA 2B3SA 3ZITA 1WOUA 3LW9A 4ZB9A 4KA0A 2H74A 4NV2A 3TB2A 1AC1A 4PI0C 5B8BA 2YJHA 2AB6A 4BVXB 4WR4A 4MZWA 3E3EA 3G7JA 5GSTA 3GKXA 3BCIA 4PX1A 2OT3A 5G2ZA 3KXOA 4EDZA 2YWMA 1U87A 2JL4A 2HYXA 2VCWA 2OADA 1TRWA 5B6MA 4I6XA 2FHEA 3TKPA 1XVWA 3GX8A 3N5OA 1AAZA 2IMIA 2PMTA 2NBSA 2HE3A 2HZEA 4TRXA 1DSBA 1WIKA 4F9ZA 4G9HA 2GT5A 3QFAC 2GSTA 2I1UA 3EMXA 5DJLA 5AIVA 2GS3A 2FWHA 2H0GA 4DSSB 4O5RA 4I2TA 1HNBA 3N9JA 2CVDA 2C0DA 1XWAA 4FXYP 5H5SA 4POMA 4WETA 4ZBBA 5A5HB 5FT3A 2ZCTA 4KGIA 3KEBA 4POKA 3L9VA 4TXOA 1GTIA 3IR4A 2VL2C 3RAZA 1TP9A 1A23A 1SL2B 2VOCA 3MIXA 1I1IP 1M3JA 2VD1A 3Q74A 2VCZA 3P7XA 5HQPA 4NAXA 3TUEA 1EOHA 3L0HA 2WW3A 3TOTA 1YEPA 2LNSA 2TRXA 3GL5A 4F82A 2HSMA 3L78A 2DKHA 3HCZA 5EPFA 4MPGA 3KM6A 1BQ7A 5G31A 3C7MA 1F2EA 1SJIA 2PGTA 3MSZA 1XW5A 3IC4A 1SKRB 1XOBA 3UEMA 4PI2C 1Q98A 5JCGA 3LORA 4V1Ag 1F37A 1PL2A 3VLNA 4KW6A 4HQSA 2HNLA 12GSA 2C0GA 2WW2A 22GSA 2N5BA 4OCEA 4F0CA 2PVOC 2X8HA 4HUAA 5J9CA 3LQ7A 2M80A 1JZWA 1EGOA 1NM3A 1SL0B 1YQ1A 2HSNB 3HY2A 4O7HA 1SK1A 1OAZA 2K8VA 3F3QA 2XPDA 4Z7XA 5J40A 1GSSA 16GSA 3G7IA 1K3LA 3ERFA 4K7OA 4L5LA 2I4AA 5DBQA 4OMVA 2H6ZA 5ECLB 1WWJA 2L57A 5HFGA 3RHBA 2X8CA 3DXBA 2E7PA 4DEJA 2H30A 2VM1A 3EWLA 3IA1A 3FZ9A 3HKRA 1E6BA 1TU7A 3WT2A 1F9MA 1BG1A 4AJ6A 3C71A 4BIKA 3C8EA 2B5EA 3EVIA 2Z9SA 1Y25A 4KCAA 2DJ1A 2H75A 3UIWA 3VPTA 3GKMA 2H01A 4POBA 2KHPA 1PX6A 4J2FA 1XOAA 3UBKA 4JR4A 2AAWA 1OC8A 2F9SA 4BPYA 4GF0A 1XWKA 2V1MA 4QMKA 1HNCA 2D2ZA 3IV4A 1M0UA 5IMZA 1ZYEA 5ECNB 1XW9A 3KCMA 5F0GA 1K0BA 3CQFA 1X9WB 3Q6OA 2X4AA 3MDKA 5G5FA 3W6GA 1A8LA 2VAFA 4CW9A 2EFEA 3F6DA 1U3IA 3RFRC 2KUCA 3TGZA 1PGTA 4EIPA 2NDOA 3GHAA 1B8XA 5DDLA 2NVLA 1KEBA 5ECRB 4OWYA 3KTLA 3UJ1A 2C8UA 3ZZXA 3ZMLA 5D8IA 4AKXB 2QC7A 2WW1A 4Z2UA 1IYIA 5INYA 4TN8A 4EL1A 5IO2A 1MD3A 1GRXA 1T3BA 3IHQA 2ON5A 2FWFA 4NXIA 2YNXA 5HR3A 1F3AA 2MYGA 3GV1A 5F07A 3ME7A 2H72A 4WR5A 1GTBA 4MZBA 4XS4B 1O85A 4G10A 4K7IA 1V58A 1XBSA 1XG8A 4ZIJA 2O5VA 2R0GA 2F3MA 5FWGA 4MA9A 1NHYA 6GSSA 1ZGNA 4TW5A 2DSAA 1TI3A 3H79A 2QSIA 2DJKA 3GKKA 4I2UA 2DC5A 3IBHA 2ES7A 3M1GA 1WE0A 5GSSA 5IIZA 3GNJA 2C1YA 3GL3A 5J4UA 4ICYA 2EIQA 3A5IA 4YKFA 2HRKA 1OKDA 3UOMA 1YKCA 1SJZA 5A4WA 3MAKA 2OE1A 2PPTA 1ZOFA 1A2JA 3JCML 4K2XA 1GSFA 4N10A 3IRAA 1TDIA 2YANA 5BMUB 4PXOA 4PTSA 5J4VA 4HJMA 4KSOA 2WULA 1PN9A 3SWLA 1FG4A 3HXSA 1N25A 1OC9B 3CRTA 3IDVA 4TR1B 3RGBC 1TK0B 5IMVA 1S3DA 3DEXA 2VL2A 2R3XA 3H8QA 3CBUA 2VL9A 1BF5A 2UV8G 1JZDA 2L59A 3EU3A 2WDUA 1XFLA 2LJKA 3HJPA 1W4VA 1O8WA 2FUG2 1SK0A 1O81A 1GNWA 2LSTA 2EIRA 2GQMA 3H4KA 2CV4A 2K6VA 1AXDA 2AYTA 2BTOT 2R2JA 4K0NA 1A0FA 4MPFA 1TOFA 3APSA 1EOGA 2RM6A 3M8NA 2AHEA 3FYGA 4PNFA 3FK8A 2M72A 2LV3A 3DWVA 3PGTA 2LJRA 2JADA 2L6DA 3HA9A 5ENUA 5DCHA 1JHBA 5B7CA 1SENA 2YV7A 2MMNA 4CY8A 1PX7A 1TTZA 2PVQA 5IMAA 3VPQA 4CHSA 1THXA 2GSQA 3D5JA 4HEA2 2MMZA 1QXHA 3CXGA 2H1BA 3M9JA 3UVHA 1HQOA 4ZILA 1PMTA 5H5QA 2KP1A 2LRCA 2R6KA 3C1SA 4ECBA 3GSSA 1R7HA 4L8EA 2CZ2A 4MH2A 1GUKA 1GSQA 3FY7A 3W8SA 4ZBDA 4HJ2A 1HD2A 3IHGA 4JBBA 1FB0A 3FR9A 1USBA 2ZUPA 2C0FA 4MABA 3ZIVA 2B5XA 5IMFA 4AJ8A 4ML6A 6GSTA 1X5CA 5A5KA 5KN1A 2A2PA 2OBIA 3QR6A 5HFKA 3HZ8A 2A4HA 1BYEA 2FLSA 1CQGA 2GSSA 4I97A 3ZVJD 3DMLA 3D22A 3CWGA 5IOWA 5ABRA 1A2MA 2AV4A 2FWEA 4YAVA 2MMOA 4QL7A 4D73B 3QD9A 4WF5A 3L4NA 4AF2A 2V41A 1B4QA 4F0BA 2LQOA 4N0VA 4USSA 3SBCA 4YQVA 5B8AA 2DJ0A 1K3OA 1Y6EA 2WVXB 2RM5A 3CYNA 3HMJG 4BL7A 4Q5FA 4XCSA 5LD0A 2WGRA 3ERWA 3F63A 3VURA 4GLTA 4NV5A 5D96A 1K3YA 5J3RA 4IP1A 1O8XA 5L71A 3QAWA 2DMLA 1PD21 1MEKA 4KE3A 1OVNA 4DSQA 3MWHA 1Z7RA 4RQRA 1UA5A 1GSYA 5ECHB 1U88A 5DAKB 4ECIA 3M0FA 2PWJA 3G7YA 4POLA 4QQ7A 5D73A 1T1VA 2IPAA 4W66A 2DIYA 1RK4A 2V6OA 1MD4A 4EO3A 11GSA 5HR0A 1VF1A 4LL1B 4KAEA 2YP6A 3D6IA 2K9FA 3A3TA 19GSA 1H4OA 1EV9A 3FHKA 4F2IA 2FWGA 1SKSB 4NPBA 4MK3A 2DJ3A 1S4BP 2HSHA 4K2DA 2HI7A 2ALBA 2FA8A 2WFCA 4ILFA 2FCHA 2PU9C 1EP7A 1JZRA 1MTCA 2JZRA 4OO5A 4KCEA 1PKZA 5ECIB 3HHVA 2VL3A 4IGJA 2O85A 4EIQA 2LKUA 3D21A 4NMUA 3GTUB 2QGVA 3BOAA 3KIJA 2YZUA 2CQ9A 2PN8A 3IC8A 4KB3A 3GRXA 1BEDA 4HSCX 2GLRA 2FNOA 1LU4A 3F4RA 3GH6A 2WZ9A 2R37A 1RW1A 4XRAA 2GGTA 1EV4A 3S9FA 4GRFA 3EMPA 2JZSA 1TRVA 3EINA 2HRFA 2MMAA 3F8UA 4IN0A 3TRQA 1TJDA 5CYYA 6GSYA 4PQIA 3GA4A 4F03A 4XRDA 1YEXA 4EE0A 3FZAA 3ME8A 3IK7A 5ELGA 3CRUA 4OFTA 4LL4B 3VI7A 4FYCA 2XC2A 1U3AA 4RQXA 1XVQA 1GLPA 3GKNA 1EWXA 1X9SB 1T7PB 4QL9A 2LNTA 2HZEB 2RUFA 3EURA 4GSNA 5GAPD 4ZB6A 5LNKe 4HI7A 1ERTA 1M2AA 1TI1A 4AJ7A 4IP6A 3APQA 5ID2A 1JLWA 3LXTA 4TOPA 2VD0A 1C72A 5DALA 1SD9A 1XWBA 1Z5YE 3R2QA 6GSWA 1R5PA 1M9AA 3NIVA 2A4VA 4MH3A 4WBRD 4O5UA 17GSA 1M99A 5G30A 2HZFA 4TR4A 2YZHA 4L5OA 4X43A 4N11A 4PURA 3RPPA 4BWSA 2LEGA 2OE3A 3WT1A 3LSZA 2JACA 1O6JA 4LLRA 4E68A 3UAPA 2WJUA 3FZ4A 1ILOA 1BG5A 2WS2A 3TU3B 3P8WA 1IYHA 1T8EB 4LA1A 1EEMA 1H75A 1DE2A 2YN1A 1ML6A 2LQQA 1TK5B 3QMXA 1M7TA 4K1FA 3IAS2 1OKTA 4EDYA 3LYPA 2H0IA 3APOA 1QK8A 3IPZA 1YF1A 1MDKA 5JWRB 1Z6NA 5DVBA 1ZYQB 1QMVA 2LS5A 4ISDA 1UN2A 4JE1A 5C00A 5E4WA 2H19A 3EE2A 3I43A 4E8EA 2IMDA 1HNAA 3ZLPA 1JFUA 4BVYB 2H73A 2VCTA 5A4VA 4LMVA 1PSQA 3HVVA 5KN2A 1FVKA 2OBKA 1G0TA 2NTOA 4MP4A 2O8VB 2IN3A 1GSEA 4Z2RA 3LJRA 1ABAA 2H1GA 1FVJA 2YWNA 3C1RA 4JU5A 2DLXA 1O7UA 2B1LA 2X8GA 2I3YA 3EC3A 3PH9A 2BMXA 3J7Yk 4Q5RA 3DKSA 2C0EA 3GFKA 2A2SA 4ZB8A 2MZCA 1ZZYA 3TKRA 1X9MB 2X99A 1BX9A 3A2VA 3ZVJA 4WBJA 4TVEA 3KD0A 4NHZA 1NSWA 4IVFA 2FGXA 2MBSA 1KNGA 2JSZA 2K18A 1B9YC 2VCQA 2GTUA 1W89A 2B1KA 5A1NA 2CVKA 1AUCA 4HQZA 4Q5NA
chains in the Genus database with same CATH topology
2B5YA 4RI7A 4MJEA 3FR6A 4IJIA 3KTBA 3PPUA 2ON7A 5JCWA 1V40A 4HZ2A 1A2LA 1VRSD 4EC0A 3EYTA 5F8BA 4K8MA 4ZB7A 1PRXA 4AKGA 4OFNA 1DUGA 2M46A 2G2QA 5CRDA 2PERA 3CMIA 1NHOA 13GSA 3VFIA 4GQFA 3HZ4A 1B4PA 1XWGA 3K8NA 4K9ZA 2DKIA 5JCUA 2IIYA 3J7Yb 1N2AA 4L0WA 4EXJA 3VI5A 2L4CA 3O6TA 3KH7A 3KP9A 4IQAA 5IQYA 1X0RA 2F51A 5CRGA 1B48A 2JU5A 1PKWA 3A2WA 3LYKA 2IFQB 4GDFA 1FAAA 1QQ2A 2H70A 1R5AA 2O7KA 3UVTA 3TKQA 2R5GA 2KP2A 3QDNA 4O92A 2DJ2A 2VO4A 4KDXA 4PGTA 2VLVA 1TXXA 4BA7A 3WGXA 1GH2A 2HXKA 1SYRA 4X4JA 3ZFLA 4DVCA 3D4MA 1HYUA 3TKSC 3OR5A 7GSSA 4A5PA 1SL1B 4G19A 4N0ZA 1A24A 1ERVA 3GMFA 4BWQA 2YPMA 2K8SA 4ZL7A 3UL3A 1SD8A 1AQWA 1OE7A 3EPTA 2LJAA 4G0LA 3WD6A 4MJBA 4N30A 2J9HA 1I5GA 1SVMA 1K0CA 3HJOA 1SVLA 5DQYA 5A34A 1G6YA 1FOVA 4Q5QA 5B6NA 2NPBA 3F9UA 3QOUA 1FO5A 1Z9HA 3GX0A 4GXZA 3HVXA 5GZZB 2HRKB 1LBKA 2PBJA 4HU9A 5EY6A 2TIRA 2DIZA 1NW2A 2OACA 2X49A 4IELA 4CDOA 2H76A 1YDKA 4K0GA 2VM2A 4EKZA 4JZQA 4HOJA 3ISOA 5A4UA 4XHMA 3ZYWA 2LRNA 5KN3A 2CVBA 3KMOA 3DRNA 5KEJA 3LEFA 5AIXA 4BVXA 2P31A 1ACVA 4ACSA 2E2GA 4YQMA 1FB6A 4AGSA 3EU4A 3PR8A 2O87A 5IPGA 1K0NA 3TJFA 2C4JA 5GAND 2I9HA 4ID0A 3LFLA 2FY6A 1GTUA 3DYRA 3FMWA 4TXVA 2EFHA 4H86A 3HVSA 1K0OA 5E59A 4XS6A 1I9DA 5DJMA 2OE0A 2AJQB 3GYKA 2VIMA 2IMFA 2LRTA 5DQSA 4GWRA 3DIEA 4K5SA 3ERGA 1Z6MA 1EGRA 5KN0A 4DSSA 3ZTLA 1F3BA 1K0MA 3QAVA 1SU9A 2R0PA 1YVLA 3LXZA 1QGVA 1GUHA 4TKYA 2VKZG 2FA4A 1R4WA 1M2BA 2L6CA 5ECPB 4YKGA 1GSUA 4NWYA 2LTKA 3IK9A 5A5HA 2C3TA 4K6XA 2H6YA 3GTUA 1GSDA 4FYUA 2QKEA 1JLVA 3O3TA 1VF2A 2IL3A 3QAGA 2C3QA 2XPEA 14GSA 4KDUA 1SKWB 2VCVA 1XWCA 4K5RA 3GH9A 3DVXA 2CA8A 3TKSE 4HZ4A 4ML1A 4KX4A 3R3EA 8GSSA 1XZOA 1OC3A 5HR2A 1ST9A 1GULA 2JSYA 5AN1A 2VLTA 3G9BA 2ZNMA 3E0UA 2QA1A 3WGEA 3M9KA 4Z2TA 3L9SA 4AI6A 3CSHA 3E9JB 1QFNA 4MZCA 5ELAA 3GURA 5J4YA 4I5QA 4K7NA 4ECJA 3GIXA 1GNEA 3CSIA 4IQ1A 2GZZA 4N3ZA 3QPMA 4ULXA 3KMNA 1V57A 2YOIA 3HYPA 2WRTA 1F6MC 4GCIA 1T4ZA 2VCXA 2HRAA 1FHEA 1WJKA 5D9VA 4KF9A 3CTFA 3D4TA 2G0FA 2KLXA 4JEDA 2F8AA 5COHA 5ECOB 4BL7B 3ZL5A 2HSNA 3I69A 5IO0A 3KZQA 3F6FA 2CZ3A 1Y1UA 4AKHA 4FIWA 1AW9A 3F3RA 2A2RA 3FKFA 1J9BA 2L5LA 5J5NA 2V6KA 1TU8A 3DD3A 1A8YA 1WP0A 4IBPA 1G7OA 4V2MA 4ZBAA 2IMKA 4KH7A 5D93A 4OCFA 1FW1A 5CO3A 4G2EA 3UARA 1XCCA 3UBLA 1M9BA 3D0ZA 1SJ6A 1S3CA 4E8HA 2B7KA 1BJXA 1YJ6A 1LJRA 4XTSA 4NHWA 4P3YB 2R4VA 1ERUA 2C80A 1V2AA 4L0UA 2GZPA 2H66A 1JZOA 3WYWA 3NZNA 5IMDA 1MDJA 4EUYA 3TJBA 2H8LA 3V1WA 1ZYPA 2XBIA 3TDGA 18GSA 5D9WA 2L5OA 4O32A 3A5WA 1R26A 4OO4A 2E0QA 1T4YA 1XXUA 2P0GA 6GSUA 3A2XA 1AIUA 1J08A 2GQKA 2EIOA 4FH8A 4EF0A 4AKIA 2GZYA 5ECQB 2H71A 3TKSA 1T00A 3KJYA 3NOFA 1AQXA 3ZIJA 2XHFA 5J41A 1K0DA 5CRHA 4ZL8A 1URMA 1EZKA 2IWTA 4TR3A 4TXOB 4BVYA 1EEJA 2BJXA 1THOA 4EVMA 3GN3A 9GSSA 3MYDA 4YQUA 2H6XA 6GSXA 4PNGA 3Q19A 2R0CA 1XIYA 5IOXA 2WCIA 4PUFC 1GWCA 1TW9A 1GP1A 1TKDB 3RPNA 5IMCA 3VWWA 4ZL9A 2HSMB 3PINA 1G6WA 1WPIA 1G7EA 2RUEA 4XS4A 1GUMA 1V98A 3F4TA 2E2MA 4KUNA 2P5RA 2EFDA 3RHCA 4IW9A 4ZXGA 2XBQA 5IM9A 5F06A 5J9BA 4V2NA 3ZRDA 3C73A 1B9XC 4OD7A 1FOHA 4MF5A 3TRXA 1CQHA 3IAM2 4YH2A 2EC4A 5CREA 1RQMA 4GSTA 4PQ1A 3O76A 3HDCA 2GSRA 3FR3A 10GSA 2UZ8A 5ID2B 2L4QA 4MLYA 4TR0A 4J56E 4CY6A 1UC7A 3P90A 2C3NA 2B6MA 2F8FA 5DALB 3IOSA 2GDRA 3KP8A 1OYJA 1MDIA 4MF7A 5F05A 5D9XA 4GSSA 4GTUA 3QFBC 3FZ5A 4J57E 3U5RE 2EFCA 5BMUA 2CAQA 2X64A 3HJMA 2H1DA 1EP8A 2FD3A 5J47A 2IFQA 5HFIA 2RLIA 1OC9A 1N8JA 2QA2A 4MJCA 3BCKA 4TR1A 1YY7A 2HRNA 3F4SA 2DMMA 2PUKC 4FO5A 4I8BA 2GT6A 1AQVA 1WRYA 4G0IA 3RDWA 4PQHA 4MCUA 4HS1A 1TK8B 2N5AA 4V1Ap 5CP1A 4IHUA 2V2GA 4X0XA 5G1KA 3H1NA 4ECCA 1ZL9A 4MDCA 4DSRA 4WEYA 1YKAA 6GSVA 3AY8A 1S3AA 1ZMAA 4IKHA 1V9WA 1M2DA 4PUAA 2OJLA 5ECMB 4GQCA 1X5EA 5EL8A 1Z7PA 5CAXA 4RI6A 1OE8A 5G5EA 1O73A 2KOKA 1A0RP 5BRTA 3F0IA 3KH9A 3I9V2 20GSA 3TRPA 3I6AA 4WXTA 4O5QA 3FW2A 2O89A 2HFDA 3IXRA 1DE1A 3H93A 4JRRA 5G1LA 2DJJA 1TRSA 3DGQA 4LMWA 3VWXA 3BJ5A 3RBTA 2P5QA 3GUSA 3GSTA 1Z3EA 1QUWA 4G0KA 5FHIA 1ZCPA 2YWIA 1UVZA 2OA7A 4HU7A 1BAYA 1WMJA 3VK9A 3P2AA 1XW6A 2HT9A 3TJGA 2WB9A 2CX3A 1ERWA 3FEUA 5H5RA 4MNNA 5KOWA 5KOXA 5A1NB 1SK2A 2IJYA 4MF6A 2YWOA 2DBCA 3LWAA 4D73A 2H1AA 3ZREA 2YCDA 1PN0A 4XS1A 1GTAA 3CSJA 4JR6A 3Q18A 4RUVA 3TJJA 1VF4A 1E2YA 1ZYNA 3DVWA 5AGYA 4X1UA 2J23A 2AUVA 3ZFBA 3QCPA 1KTEA 2VUPA 2H1LA 3BBYA 5CRWA 1PL1A 5DCGA 5AISA 2VLUA 2I81A 5ECSA 3ED3A 3M3MA 2V32A 3TOUA 3UMAA 1Q4JA 2IMEA 3BD2A 5CNWA 4KNDA 1KBNA 5EVOA 4KDYA 4V2LA 5DAKA 3TJKA 4MJAA 5JWOB 2CX4A 1TRUA 3L9UA 4MMMA 2TRCP 1YZXA 1SYXA 1VGLA 3ZMKA 3US3A 2HQTA 4XIHA 3MNGA 1PQNA 1GL8A 2JZTA 4IJ3A 3W8JA 1J0FA 4YAPA 1TXUA 3LG6A 2HSYA 4WKWA 5D9TA 4OFMA 2N5FA 2YV9A 5ECKB 4IS0A 1YF0A 2MBTA 1GLQA 2LUSA 3KGKA 4FYBA 3HD5A 5A34B 5LCZA 2CT6A 3WGDA 1SVOA 4FQUA 3LGCA 4HDEA 3FRCA 1PA3A 1ON4A 2OKAA 1U6TA 1VF3A 3TCOA 5IPHA 2REMA 1DBYA 2CAIA 2RIIA 2H0HA 3VWUA 1X5DA 3CTGA 4G01A 5HR1A 5C04A 3IE3A 2GVPA 3VWVA 1K0AA 1XPVA 4WF4A 2HLSA 4KSMA 3U6VA 5JWQB 2B7JA 2YJ7A 2GQLA 2B3SA 3ZITA 1WOUA 3LW9A 4ZB9A 4KA0A 2H74A 4NV2A 3TB2A 1AC1A 5B8BA 2YJHA 2AB6A 4BVXB 4WR4A 4MZWA 3E3EA 3G7JA 5GSTA 3GKXA 3BCIA 4PX1A 2OT3A 5G2ZA 3KXOA 4EDZA 2YWMA 1U87A 2JL4A 2HYXA 2VCWA 2OADA 1TRWA 5B6MA 4I6XA 2FHEA 3TKPA 1XVWA 3GX8A 3N5OA 1AAZA 2IMIA 2PMTA 2NBSA 2HE3A 2HZEA 4TRXA 1DSBA 1WIKA 4F9ZA 4G9HA 2GT5A 3QFAC 2GSTA 2I1UA 3EMXA 5DJLA 5AIVA 2GS3A 2FWHA 2H0GA 4DSSB 4O5RA 4I2TA 3N9JA 1HNBA 2CVDA 2C0DA 1XWAA 5H5SA 4POMA 4WETA 4ZBBA 5A5HB 5FT3A 2ZCTA 4KGIA 3KEBA 4POKA 3L9VA 4TXOA 1GTIA 3IR4A 2VL2C 3RAZA 1TP9A 1A23A 1SL2B 2VOCA 3MIXA 2VD1A 3Q74A 2VCZA 3P7XA 5HQPA 4NAXA 3TUEA 1EOHA 3L0HA 3TOTA 1YEPA 2LNSA 2TRXA 3GL5A 4F82A 2HSMA 3L78A 2DKHA 3HCZA 5EPFA 4MPGA 3KM6A 1BQ7A 5G31A 3C7MA 1F2EA 1SJIA 2PGTA 3MSZA 1XW5A 3IC4A 1SKRB 1XOBA 3UEMA 1Q98A 5JCGA 3LORA 4V1Ag 1F37A 1PL2A 3VLNA 4KW6A 4HQSA 2HNLA 12GSA 2C0GA 22GSA 2N5BA 4OCEA 4F0CA 2PVOC 2X8HA 4HUAA 5J9CA 3LQ7A 2M80A 1JZWA 1EGOA 1NM3A 1SL0B 1YQ1A 2HSNB 3HY2A 4O7HA 1SK1A 1OAZA 2K8VA 3F3QA 2XPDA 4Z7XA 5J40A 1GSSA 16GSA 3G7IA 1K3LA 3ERFA 4K7OA 4L5LA 2I4AA 5DBQA 4OMVA 2H6ZA 5ECLB 1WWJA 2L57A 5HFGA 3RHBA 2X8CA 3DXBA 2E7PA 4DEJA 2H30A 2VM1A 3EWLA 3IA1A 3FZ9A 3HKRA 1E6BA 1TU7A 3WT2A 1F9MA 1BG1A 4AJ6A 3C71A 3C8EA 2B5EA 3EVIA 2Z9SA 1Y25A 4KCAA 2DJ1A 2H75A 3UIWA 3VPTA 3GKMA 2H01A 4POBA 2KHPA 1PX6A 4J2FA 1XOAA 3UBKA 4JR4A 2AAWA 1OC8A 2F9SA 4BPYA 4GF0A 1XWKA 2V1MA 4QMKA 1HNCA 2D2ZA 3IV4A 1M0UA 5IMZA 1ZYEA 5ECNB 1XW9A 3KCMA 5F0GA 1K0BA 1X9WB 3Q6OA 2X4AA 3MDKA 5G5FA 3W6GA 1A8LA 2VAFA 4CW9A 2EFEA 3F6DA 1U3IA 2KUCA 3TGZA 1PGTA 4EIPA 2NDOA 3GHAA 1B8XA 5DDLA 2NVLA 1KEBA 5ECRB 4OWYA 3KTLA 3UJ1A 2C8UA 3ZZXA 3ZMLA 5D8IA 4AKXB 2QC7A 4Z2UA 1IYIA 5INYA 4TN8A 4EL1A 5IO2A 1MD3A 1GRXA 1T3BA 3IHQA 2ON5A 2FWFA 4NXIA 2YNXA 5HR3A 1F3AA 2MYGA 3GV1A 5F07A 3ME7A 2H72A 4WR5A 1GTBA 4MZBA 4XS4B 1O85A 4G10A 4K7IA 1V58A 1XBSA 4ZIJA 2O5VA 2R0GA 2F3MA 5FWGA 4MA9A 1NHYA 6GSSA 1ZGNA 4TW5A 2DSAA 1TI3A 3H79A 2QSIA 2DJKA 3GKKA 4I2UA 2DC5A 3IBHA 2ES7A 3M1GA 1WE0A 5GSSA 5IIZA 3GNJA 2C1YA 3GL3A 5J4UA 4ICYA 2EIQA 3A5IA 4YKFA 2HRKA 1OKDA 3UOMA 1YKCA 1SJZA 5A4WA 3MAKA 2OE1A 2PPTA 1ZOFA 1A2JA 3JCML 4K2XA 1GSFA 4N10A 3IRAA 1TDIA 2YANA 5BMUB 4PXOA 4PTSA 5J4VA 4HJMA 4KSOA 2WULA 1PN9A 3SWLA 1FG4A 3HXSA 1N25A 1OC9B 3CRTA 3IDVA 4TR1B 1TK0B 5IMVA 1S3DA 3DEXA 2VL2A 2R3XA 3H8QA 3CBUA 2VL9A 1BF5A 2UV8G 1JZDA 2L59A 3EU3A 2WDUA 1XFLA 2LJKA 3HJPA 1W4VA 1O8WA 2FUG2 1SK0A 1O81A 1GNWA 2LSTA 2EIRA 2GQMA 3H4KA 2CV4A 2K6VA 1AXDA 2AYTA 2BTOT 2R2JA 4K0NA 1A0FA 4MPFA 1TOFA 3APSA 1EOGA 2RM6A 3M8NA 2AHEA 3FYGA 4PNFA 3FK8A 2M72A 2LV3A 3DWVA 3PGTA 2LJRA 2JADA 2L6DA 3HA9A 5ENUA 5DCHA 1JHBA 5B7CA 1SENA 2YV7A 2MMNA 4CY8A 1PX7A 1TTZA 2PVQA 5IMAA 3VPQA 4CHSA 1THXA 2GSQA 3D5JA 4HEA2 2MMZA 1QXHA 3CXGA 2H1BA 3M9JA 3UVHA 1HQOA 4ZILA 1PMTA 5H5QA 2KP1A 2LRCA 2R6KA 3C1SA 4ECBA 3GSSA 1R7HA 4L8EA 2CZ2A 4MH2A 1GUKA 1GSQA 3FY7A 3W8SA 4ZBDA 4HJ2A 1HD2A 3IHGA 4JBBA 1FB0A 3FR9A 1USBA 2ZUPA 2C0FA 4MABA 3ZIVA 2B5XA 5IMFA 4AJ8A 4ML6A 6GSTA 1X5CA 5A5KA 5KN1A 2A2PA 2OBIA 3QR6A 5HFKA 3HZ8A 2A4HA 1BYEA 2FLSA 1CQGA 2GSSA 4I97A 3ZVJD 3DMLA 3D22A 3CWGA 5IOWA 5ABRA 1A2MA 2AV4A 2FWEA 4YAVA 2MMOA 4QL7A 4D73B 3QD9A 4WF5A 3L4NA 4AF2A 2V41A 1B4QA 4F0BA 2LQOA 4N0VA 4USSA 3SBCA 4YQVA 5B8AA 2DJ0A 1K3OA 1Y6EA 2RM5A 3CYNA 3HMJG 4BL7A 4Q5FA 4XCSA 5LD0A 2WGRA 3ERWA 3F63A 3VURA 4GLTA 4NV5A 5D96A 1K3YA 5J3RA 4IP1A 1O8XA 5L71A 3QAWA 2DMLA 1PD21 1MEKA 4KE3A 1OVNA 4DSQA 3MWHA 1Z7RA 4RQRA 1UA5A 1GSYA 5ECHB 1U88A 5DAKB 4ECIA 3M0FA 2PWJA 3G7YA 4POLA 4QQ7A 5D73A 1T1VA 2IPAA 4W66A 2DIYA 1RK4A 2V6OA 1MD4A 4EO3A 11GSA 5HR0A 1VF1A 4LL1B 4KAEA 2YP6A 3D6IA 2K9FA 3A3TA 19GSA 1H4OA 1EV9A 3FHKA 4F2IA 2FWGA 1SKSB 4NPBA 4MK3A 2DJ3A 2HSHA 4K2DA 2HI7A 2ALBA 2FA8A 2WFCA 4ILFA 2FCHA 2PU9C 1EP7A 1JZRA 1MTCA 2JZRA 4OO5A 4KCEA 1PKZA 5ECIB 3HHVA 2VL3A 4IGJA 2O85A 4EIQA 2LKUA 3D21A 4NMUA 3GTUB 2QGVA 3BOAA 3KIJA 2YZUA 2CQ9A 2PN8A 3IC8A 4KB3A 3GRXA 1BEDA 2GLRA 2FNOA 1LU4A 3F4RA 3GH6A 2WZ9A 2R37A 1RW1A 4XRAA 2GGTA 1EV4A 3S9FA 4GRFA 3EMPA 2JZSA 1TRVA 3EINA 2HRFA 2MMAA 3F8UA 4IN0A 3TRQA 1TJDA 5CYYA 6GSYA 4PQIA 3GA4A 4F03A 4XRDA 1YEXA 4EE0A 3FZAA 3ME8A 3IK7A 5ELGA 3CRUA 4OFTA 4LL4B 3VI7A 4FYCA 2XC2A 1U3AA 4RQXA 1XVQA 1GLPA 3GKNA 1EWXA 1X9SB 1T7PB 4QL9A 2LNTA 2HZEB 2RUFA 3EURA 4GSNA 5GAPD 4ZB6A 5LNKe 4HI7A 1ERTA 1M2AA 1TI1A 4AJ7A 4IP6A 3APQA 5ID2A 1JLWA 3LXTA 4TOPA 2VD0A 1C72A 5DALA 1SD9A 1XWBA 1Z5YE 3R2QA 6GSWA 1R5PA 1M9AA 3NIVA 2A4VA 4MH3A 4WBRD 4O5UA 17GSA 1M99A 5G30A 2HZFA 4TR4A 2YZHA 4L5OA 4X43A 4N11A 4PURA 3RPPA 4BWSA 2LEGA 2OE3A 3WT1A 3LSZA 2JACA 1O6JA 4LLRA 4E68A 3UAPA 2WJUA 3FZ4A 1ILOA 1BG5A 2WS2A 3TU3B 3P8WA 1IYHA 1T8EB 4LA1A 1EEMA 1H75A 1DE2A 2YN1A 1ML6A 2LQQA 1TK5B 3QMXA 1M7TA 4K1FA 3IAS2 1OKTA 4EDYA 3LYPA 2H0IA 3APOA 1QK8A 3IPZA 1YF1A 1MDKA 5JWRB 1Z6NA 5DVBA 1ZYQB 1QMVA 2LS5A 4ISDA 1UN2A 4JE1A 5C00A 5E4WA 2H19A 3EE2A 3I43A 4E8EA 2IMDA 1HNAA 3ZLPA 1JFUA 4BVYB 2H73A 2VCTA 5A4VA 4LMVA 1PSQA 3HVVA 5KN2A 1FVKA 2OBKA 1G0TA 2NTOA 4MP4A 2O8VB 2IN3A 1GSEA 4Z2RA 3LJRA 1ABAA 2H1GA 1FVJA 2YWNA 3C1RA 4JU5A 2DLXA 1O7UA 2B1LA 2X8GA 2I3YA 3EC3A 3PH9A 2BMXA 3J7Yk 4Q5RA 3DKSA 2C0EA 3GFKA 2A2SA 4ZB8A 2MZCA 1ZZYA 3TKRA 1X9MB 2X99A 1BX9A 3A2VA 3ZVJA 4WBJA 4TVEA 3KD0A 4NHZA 1NSWA 4IVFA 2FGXA 2MBSA 1KNGA 2JSZA 2K18A 1B9YC 2VCQA 2GTUA 1W89A 2B1KA 5A1NA 2CVKA 1AUCA 4HQZA 4Q5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5Y A;  4RI7 A;  4MJE A;  3FR6 A;  4IJI A;  3KTB A;  3PPU A;  2ON7 A;  5JCW A;  1V40 A;  4HZ2 A;  1A2L A;  1VRS D;  4EC0 A;  3EYT A;  5F8B A;  4K8M A;  1PRX A;  4OFN A;  1DUG A;  2M46 A;  2G2Q A;  5CRD A;  2PER A;  3CMI A;  1NHO A;  13GS A;  3VFI A;  4GQF A;  3HZ4 A;  1B4P A;  1XWG A;  3K8N A;  4K9Z A;  5JCU A;  2IIY A;  3J7Y b;  1N2A A;  4L0W A;  4EXJ A;  3VI5 A;  2L4C A;  3O6T A;  3KH7 A;  3KP9 A;  4IQA A;  5IQY A;  1X0R A;  2F51 A;  5CRG A;  1B48 A;  2JU5 A;  1PKW A;  3A2W A;  3LYK A;  2IFQ B;  1FAA A;  2H70 A;  1QQ2 A;  1R5A A;  2O7K A;  3UVT A;  3TKQ A;  2R5G A;  2KP2 A;  3QDN A;  4O92 A;  2DJ2 A;  2VO4 A;  4KDX A;  4PGT A;  2VLV A;  1TXX A;  4BA7 A;  3WGX A;  1GH2 A;  2HXK A;  1SYR A;  3ZFL A;  4DVC A;  3D4M A;  1HYU A;  3TKS C;  3OR5 A;  7GSS A;  1SL1 B;  4G19 A;  4N0Z A;  1A24 A;  1ERV A;  3GMF A;  4BWQ A;  2YPM A;  2K8S A;  4ZL7 A;  3UL3 A;  1SD8 A;  1AQW A;  1OE7 A;  2LJA A;  4G0L A;  3WD6 A;  4MJB A;  4N30 A;  2J9H A;  1I5G A;  1K0C A;  3HJO A;  5DQY A;  1G6Y A;  1FOV A;  4Q5Q A;  5B6N A;  2NPB A;  3F9U A;  3QOU A;  1FO5 A;  1Z9H A;  3GX0 A;  4GXZ A;  3HVX A;  5GZZ B;  2HRK B;  1LBK A;  2PBJ A;  4HU9 A;  5EY6 A;  2TIR A;  2DIZ A;  1NW2 A;  2OAC A;  4IEL A;  4CDO A;  2H76 A;  1YDK A;  4K0G A;  2VM2 A;  4EKZ A;  4JZQ A;  4HOJ A;  3ISO A;  5A4U A;  4XHM A;  3ZYW A;  2LRN A;  5KN3 A;  2CVB A;  3KMO A;  3DRN A;  5KEJ A;  3LEF A;  5AIX A;  4BVX A;  2P31 A;  1ACV A;  4ACS A;  2E2G A;  4YQM A;  1FB6 A;  4AGS A;  3EU4 A;  3PR8 A;  2O87 A;  5IPG A;  1K0N A;  3TJF A;  2C4J A;  5GAN D;  2I9H A;  4ID0 A;  3LFL A;  2FY6 A;  1GTU A;  3DYR A;  4TXV A;  4H86 A;  3HVS A;  1K0O A;  5E59 A;  4XS6 A;  1I9D A;  5DJM A;  2OE0 A;  2AJQ B;  3GYK A;  2VIM A;  2IMF A;  2LRT A;  5DQS A;  4GWR A;  3DIE A;  3ERG A;  1Z6M A;  1EGR A;  5KN0 A;  4DSS A;  3ZTL A;  1F3B A;  1K0M A;  3QAV A;  1SU9 A;  3LXZ A;  1QGV A;  1GUH A;  4TKY A;  2FA4 A;  1R4W A;  1M2B A;  2L6C A;  5ECP B;  1GSU A;  4NWY A;  2LTK A;  3IK9 A;  2C3T A;  4K6X A;  2H6Y A;  3GTU A;  1GSD A;  4FYU A;  2QKE A;  1JLV A;  3O3T A;  1VF2 A;  2IL3 A;  3QAG A;  2C3Q A;  2XPE A;  14GS A;  4KDU A;  1SKW B;  2VCV A;  1XWC A;  3GH9 A;  3DVX A;  2CA8 A;  3TKS E;  4HZ4 A;  4ML1 A;  4KX4 A;  3R3E A;  8GSS A;  1XZO A;  1OC3 A;  5HR2 A;  1ST9 A;  1GUL A;  2JSY A;  5AN1 A;  2VLT A;  3G9B A;  2ZNM A;  3E0U A;  3WGE A;  3M9K A;  3L9S A;  3CSH A;  3E9J B;  1QFN A;  4MZC A;  5ELA A;  3GUR A;  4I5Q A;  4K7N A;  4ECJ A;  3GIX A;  1GNE A;  3CSI A;  4IQ1 A;  2GZZ A;  3QPM A;  4ULX A;  3KMN A;  1V57 A;  2YOI A;  3HYP A;  2WRT A;  1F6M C;  4GCI A;  1T4Z A;  2VCX A;  2HRA A;  1FHE A;  1WJK A;  5D9V A;  4KF9 A;  3CTF A;  3D4T A;  2G0F A;  2KLX A;  4JED A;  2F8A A;  5COH A;  5ECO B;  4BL7 B;  3ZL5 A;  3I69 A;  5IO0 A;  3KZQ A;  3F6F A;  2CZ3 A;  4FIW A;  1AW9 A;  3F3R A;  2A2R A;  3FKF A;  1J9B A;  2L5L A;  5J5N A;  2V6K A;  1TU8 A;  3DD3 A;  1A8Y A;  1WP0 A;  4IBP A;  1G7O A;  4V2M A;  4ZBA A;  2IMK A;  4KH7 A;  5D93 A;  4OCF A;  1FW1 A;  5CO3 A;  4G2E A;  3UAR A;  1XCC A;  3UBL A;  1M9B A;  3D0Z A;  1SJ6 A;  1S3C A;  4E8H A;  2B7K A;  1BJX A;  1YJ6 A;  1LJR A;  4XTS A;  4NHW A;  4P3Y B;  2R4V A;  1ERU A;  2C80 A;  1V2A A;  4L0U A;  2GZP A;  2H66 A;  1JZO A;  3WYW A;  3NZN A;  5IMD A;  1MDJ A;  4EUY A;  3TJB A;  2H8L A;  3V1W A;  2XBI A;  3TDG A;  18GS A;  5D9W A;  2L5O A;  4O32 A;  3A5W A;  1R26 A;  4OO4 A;  2E0Q A;  1T4Y A;  1XXU A;  2P0G A;  6GSU A;  3A2X A;  1AIU A;  1J08 A;  2GQK A;  2EIO A;  4FH8 A;  4EF0 A;  2GZY A;  5ECQ B;  2H71 A;  3TKS A;  1T00 A;  3KJY A;  3NOF A;  1AQX A;  3ZIJ A;  2XHF A;  5J41 A;  1K0D A;  5CRH A;  4ZL8 A;  1URM A;  1EZK A;  2IWT A;  4TR3 A;  4TXO B;  4BVY A;  1EEJ A;  2BJX A;  1THO A;  4EVM A;  3GN3 A;  9GSS A;  4YQU A;  2H6X A;  6GSX A;  4PNG A;  3Q19 A;  1XIY A;  5IOX A;  2WCI A;  4PUF C;  1GWC A;  1TW9 A;  1GP1 A;  1TKD B;  3RPN A;  5IMC A;  3VWW A;  4ZL9 A;  2HSM B;  3PIN A;  1G6W A;  1WPI A;  1G7E A;  2RUE A;  4XS4 A;  1GUM A;  1V98 A;  3F4T A;  2E2M A;  4KUN A;  2P5R A;  3RHC A;  4IW9 A;  4ZXG A;  2XBQ A;  5IM9 A;  5F06 A;  5J9B A;  4V2N A;  3ZRD A;  3C73 A;  1B9X C;  4OD7 A;  4MF5 A;  3TRX A;  1CQH A;  3IAM 2;  4YH2 A;  2EC4 A;  5CRE A;  1RQM A;  4GST A;  4PQ1 A;  3O76 A;  3HDC A;  2GSR A;  3FR3 A;  10GS A;  2UZ8 A;  5ID2 B;  2L4Q A;  4MLY A;  4TR0 A;  4J56 E;  1UC7 A;  3P90 A;  2C3N A;  2B6M A;  2F8F A;  5DAL B;  3IOS A;  2GDR A;  3KP8 A;  1OYJ A;  1MDI A;  4MF7 A;  5F05 A;  5D9X A;  4GSS A;  4GTU A;  3QFB C;  3FZ5 A;  4J57 E;  3U5R E;  5BMU A;  2CAQ A;  2X64 A;  3HJM A;  2H1D A;  1EP8 A;  2FD3 A;  2IFQ A;  5HFI A;  2RLI A;  1OC9 A;  1N8J A;  4MJC A;  3BCK A;  4TR1 A;  1YY7 A;  2HRN A;  3F4S A;  2DMM A;  2PUK C;  4FO5 A;  4I8B A;  2GT6 A;  1AQV A;  1WRY A;  4G0I A;  3RDW A;  4PQH A;  4MCU A;  4HS1 A;  1TK8 B;  2N5A A;  4V1A p;  5CP1 A;  4IHU A;  2V2G A;  4X0X A;  5G1K A;  3H1N A;  4ECC A;  1ZL9 A;  4MDC A;  4DSR A;  4WEY A;  1YKA A;  6GSV A;  3AY8 A;  1S3A A;  1ZMA A;  4IKH A;  1V9W A;  1M2D A;  4PUA A;  2OJL A;  5ECM B;  4GQC A;  1X5E A;  5EL8 A;  1Z7P A;  5CAX A;  4RI6 A;  1OE8 A;  5G5E A;  1O73 A;  2KOK A;  1A0R P;  3F0I A;  3KH9 A;  3I9V 2;  20GS A;  3TRP A;  3I6A A;  4WXT A;  3FW2 A;  2O89 A;  2HFD A;  3IXR A;  1DE1 A;  3H93 A;  4JRR A;  5G1L A;  2DJJ A;  1TRS A;  3DGQ A;  4LMW A;  3VWX A;  3BJ5 A;  3RBT A;  2P5Q A;  3GUS A;  3GST A;  1Z3E A;  1QUW A;  4G0K A;  5FHI A;  1ZCP A;  2YWI A;  1UVZ A;  2OA7 A;  4HU7 A;  1BAY A;  1WMJ A;  3VK9 A;  3P2A A;  1XW6 A;  2HT9 A;  3TJG A;  2WB9 A;  2CX3 A;  1ERW A;  3FEU A;  5H5R A;  1SK2 A;  2IJY A;  4MF6 A;  2YWO A;  2DBC A;  3LWA A;  4D73 A;  2H1A A;  3ZRE A;  2YCD A;  4XS1 A;  1GTA A;  3CSJ A;  4JR6 A;  3Q18 A;  4RUV A;  3TJJ A;  1VF4 A;  1E2Y A;  3DVW A;  5AGY A;  4X1U A;  2J23 A;  2AUV A;  3ZFB A;  3QCP A;  1KTE A;  2VUP A;  3BBY A;  5CRW A;  1PL1 A;  5DCG A;  5AIS A;  2VLU A;  2I81 A;  5ECS A;  3ED3 A;  3M3M A;  2V32 A;  3TOU A;  3UMA A;  1Q4J A;  2IME A;  3BD2 A;  5CNW A;  4KND A;  1KBN A;  5EVO A;  4KDY A;  4V2L A;  5DAK A;  3TJK A;  4MJA A;  5JWO B;  2CX4 A;  1TRU A;  3L9U A;  4MMM A;  2TRC P;  1YZX A;  1SYX A;  1VGL A;  3ZMK A;  3US3 A;  2HQT A;  4XIH A;  3MNG A;  1PQN A;  1GL8 A;  2JZT A;  4IJ3 A;  3W8J A;  1J0F A;  4YAP A;  3LG6 A;  2HSY A;  4WKW A;  5D9T A;  4OFM A;  2N5F A;  2YV9 A;  5ECK B;  4IS0 A;  1YF0 A;  2MBT A;  1GLQ A;  2LUS A;  3KGK A;  4FYB A;  3HD5 A;  5LCZ A;  2CT6 A;  3WGD A;  4FQU A;  3LGC A;  4HDE A;  3FRC A;  1PA3 A;  1ON4 A;  2OKA A;  1U6T A;  1VF3 A;  3TCO A;  5IPH A;  2REM A;  1DBY A;  2CAI A;  2RII A;  2H0H A;  3VWU A;  1X5D A;  3CTG A;  5HR1 A;  5C04 A;  3IE3 A;  2GVP A;  3VWV A;  1K0A A;  1XPV A;  4WF4 A;  2HLS A;  4KSM A;  3U6V A;  5JWQ B;  2B7J A;  2YJ7 A;  2GQL A;  2B3S A;  3ZIT A;  1WOU A;  4ZB9 A;  4KA0 A;  2H74 A;  4NV2 A;  3TB2 A;  1AC1 A;  5B8B A;  2YJH A;  2AB6 A;  4BVX B;  4WR4 A;  4MZW A;  3E3E A;  3G7J A;  5GST A;  3GKX A;  3BCI A;  4PX1 A;  5G2Z A;  3KXO A;  4EDZ A;  2YWM A;  1U87 A;  2JL4 A;  2HYX A;  2VCW A;  2OAD A;  1TRW A;  5B6M A;  4I6X A;  2FHE A;  3TKP A;  1XVW A;  3GX8 A;  3N5O A;  1AAZ A;  2IMI A;  2PMT A;  2NBS A;  2HE3 A;  2HZE A;  4TRX A;  1DSB A;  1WIK A;  4F9Z A;  4G9H A;  2GT5 A;  3QFA C;  2GST A;  2I1U A;  3EMX A;  5DJL A;  5AIV A;  2GS3 A;  2FWH A;  2H0G A;  4DSS B;  4O5R A;  4I2T A;  1HNB A;  3N9J A;  2CVD A;  2C0D A;  1XWA A;  5H5S A;  4POM A;  4WET A;  4ZBB A;  5FT3 A;  2ZCT A;  4KGI A;  3KEB A;  4POK A;  3L9V A;  4TXO A;  1GTI A;  3IR4 A;  2VL2 C;  3RAZ A;  1TP9 A;  1A23 A;  1SL2 B;  2VOC A;  2VD1 A;  3Q74 A;  2VCZ A;  3P7X A;  5HQP A;  4NAX A;  3TUE A;  1EOH A;  3L0H A;  3TOT A;  1YEP A;  2LNS A;  2TRX A;  3GL5 A;  4F82 A;  2HSM A;  3L78 A;  3HCZ A;  5EPF A;  4MPG A;  3KM6 A;  1BQ7 A;  5G31 A;  3C7M A;  1F2E A;  1SJI A;  2PGT A;  3MSZ A;  1XW5 A;  3IC4 A;  1SKR B;  1XOB A;  3UEM A;  1Q98 A;  5JCG A;  3LOR A;  4V1A g;  1F37 A;  1PL2 A;  3VLN A;  4KW6 A;  4HQS A;  2HNL A;  12GS A;  2C0G A;  22GS A;  2N5B A;  4OCE A;  4F0C A;  2PVO C;  2X8H A;  4HUA A;  5J9C A;  3LQ7 A;  2M80 A;  1JZW A;  1EGO A;  1NM3 A;  1SL0 B;  1YQ1 A;  2HSN B;  3HY2 A;  4O7H A;  1SK1 A;  1OAZ A;  2K8V A;  3F3Q A;  2XPD A;  4Z7X A;  1GSS A;  16GS A;  3G7I A;  1K3L A;  3ERF A;  4K7O A;  4L5L A;  2I4A A;  5DBQ A;  4OMV A;  2H6Z A;  5ECL B;  1WWJ A;  2L57 A;  5HFG A;  3RHB A;  2X8C A;  3DXB A;  2E7P A;  4DEJ A;  2H30 A;  2VM1 A;  3EWL A;  3IA1 A;  3FZ9 A;  3HKR A;  1E6B A;  1TU7 A;  3WT2 A;  1F9M A;  4AJ6 A;  3C71 A;  3C8E A;  2B5E A;  3EVI A;  2Z9S A;  1Y25 A;  4KCA A;  2DJ1 A;  2H75 A;  3UIW A;  3VPT A;  3GKM A;  2H01 A;  4POB A;  2KHP A;  1PX6 A;  4J2F A;  1XOA A;  3UBK A;  4JR4 A;  2AAW A;  1OC8 A;  2F9S A;  4BPY A;  4GF0 A;  1XWK A;  2V1M A;  1HNC A;  2D2Z A;  3IV4 A;  1M0U A;  5IMZ A;  1ZYE A;  5ECN B;  1XW9 A;  3KCM A;  5F0G A;  1K0B A;  1X9W B;  3Q6O A;  3MDK A;  5G5F A;  3W6G A;  1A8L A;  2VAF A;  4CW9 A;  3F6D A;  1U3I A;  2KUC A;  3TGZ A;  1PGT A;  2NDO A;  3GHA A;  1B8X A;  5DDL A;  2NVL A;  1KEB A;  5ECR B;  4OWY A;  3KTL A;  3UJ1 A;  2C8U A;  3ZZX A;  3ZML A;  5D8I A;  2QC7 A;  1IYI A;  5INY A;  4TN8 A;  4EL1 A;  5IO2 A;  1MD3 A;  1GRX A;  1T3B A;  3IHQ A;  2ON5 A;  2FWF A;  4NXI A;  2YNX A;  5HR3 A;  1F3A A;  2MYG A;  3GV1 A;  5F07 A;  3ME7 A;  2H72 A;  4WR5 A;  1GTB A;  4MZB A;  4XS4 B;  1O85 A;  4G10 A;  4K7I A;  1V58 A;  1XBS A;  4ZIJ A;  4MA9 A;  2F3M A;  5FWG A;  1NHY A;  6GSS A;  1ZGN A;  4TW5 A;  2DSA A;  1TI3 A;  3H79 A;  2QSI A;  2DJK A;  3GKK A;  4I2U A;  2DC5 A;  3IBH A;  2ES7 A;  3M1G A;  1WE0 A;  5GSS A;  5IIZ A;  3GNJ A;  2C1Y A;  3GL3 A;  5J4U A;  2EIQ A;  2HRK A;  1OKD A;  3UOM A;  1YKC A;  1SJZ A;  5A4W A;  3MAK A;  2OE1 A;  2PPT A;  1ZOF A;  1A2J A;  3JCM L;  1GSF A;  4N10 A;  3IRA A;  1TDI A;  2YAN A;  4PXO A;  4PTS A;  4HJM A;  4KSO A;  2WUL A;  1PN9 A;  3SWL A;  1FG4 A;  3HXS A;  1OC9 B;  3CRT A;  3IDV A;  4TR1 B;  1TK0 B;  5IMV A;  1S3D A;  3DEX A;  2VL2 A;  2R3X A;  3H8Q A;  3CBU A;  2VL9 A;  1JZD A;  2L59 A;  3EU3 A;  2WDU A;  1XFL A;  2LJK A;  3HJP A;  1W4V A;  1O8W A;  2FUG 2;  1SK0 A;  1O81 A;  1GNW A;  2LST A;  2EIR A;  2GQM A;  3H4K A;  2CV4 A;  2K6V A;  1AXD A;  2AYT A;  2BTO T;  2R2J A;  4K0N A;  1A0F A;  4MPF A;  1TOF A;  3APS A;  1EOG A;  2RM6 A;  3M8N A;  2AHE A;  3FYG A;  4PNF A;  3FK8 A;  2M72 A;  2LV3 A;  3DWV A;  3PGT A;  2LJR A;  2JAD A;  2L6D A;  3HA9 A;  5ENU A;  5DCH A;  1JHB A;  5B7C A;  1SEN A;  2YV7 A;  2MMN A;  1PX7 A;  1TTZ A;  2PVQ A;  5IMA A;  3VPQ A;  4CHS A;  1THX A;  2GSQ A;  3D5J A;  4HEA 2;  2MMZ A;  1QXH A;  3CXG A;  2H1B A;  3M9J A;  3UVH A;  1HQO A;  4ZIL A;  1PMT A;  5H5Q A;  2KP1 A;  2LRC A;  2R6K A;  3C1S A;  4ECB A;  3GSS A;  1R7H A;  4L8E A;  2CZ2 A;  4MH2 A;  1GUK A;  1GSQ A;  3FY7 A;  3W8S A;  4ZBD A;  4HJ2 A;  1HD2 A;  4JBB A;  1FB0 A;  3FR9 A;  1USB A;  2ZUP A;  2C0F A;  4MAB A;  3ZIV A;  2B5X A;  5IMF A;  4AJ8 A;  4ML6 A;  6GST A;  1X5C A;  5A5K A;  5KN1 A;  2OBI A;  3QR6 A;  5HFK A;  3HZ8 A;  1BYE A;  2FLS A;  1CQG A;  2GSS A;  4I97 A;  3ZVJ D;  3DML A;  3D22 A;  5IOW A;  5ABR A;  1A2M A;  2AV4 A;  2FWE A;  4YAV A;  2MMO A;  4QL7 A;  4D73 B;  3QD9 A;  4WF5 A;  3L4N A;  4AF2 A;  2V41 A;  1B4Q A;  4F0B A;  2LQO A;  4N0V A;  4USS A;  3SBC A;  4YQV A;  5B8A A;  2DJ0 A;  1K3O A;  1Y6E A;  2RM5 A;  3CYN A;  4BL7 A;  4Q5F A;  4XCS A;  5LD0 A;  2WGR A;  3ERW A;  3F63 A;  3VUR A;  4GLT A;  4NV5 A;  5D96 A;  1K3Y A;  5J3R A;  4IP1 A;  1O8X A;  5L71 A;  3QAW A;  2DML A;  1PD2 1;  1MEK A;  4KE3 A;  1OVN A;  4DSQ A;  3MWH A;  1Z7R A;  4RQR A;  1UA5 A;  1GSY A;  5ECH B;  1U88 A;  5DAK B;  4ECI A;  3M0F A;  2PWJ A;  3G7Y A;  4POL A;  4QQ7 A;  5D73 A;  1T1V A;  2IPA A;  2DIY A;  1RK4 A;  2V6O A;  1MD4 A;  4EO3 A;  11GS A;  5HR0 A;  1VF1 A;  4LL1 B;  4KAE A;  2YP6 A;  3D6I A;  2K9F A;  3A3T A;  19GS A;  1H4O A;  1EV9 A;  3FHK A;  4F2I A;  2FWG A;  1SKS B;  4NPB A;  4MK3 A;  2DJ3 A;  2HSH A;  4K2D A;  2HI7 A;  2ALB A;  2FA8 A;  2WFC A;  4ILF A;  2FCH A;  2PU9 C;  1EP7 A;  1JZR A;  1MTC A;  2JZR A;  4OO5 A;  4KCE A;  1PKZ A;  5ECI B;  3HHV A;  2VL3 A;  4IGJ A;  2O85 A;  2LKU A;  3D21 A;  4NMU A;  3GTU B;  2QGV A;  3BOA A;  3KIJ A;  2YZU A;  2CQ9 A;  2PN8 A;  3IC8 A;  4KB3 A;  3GRX A;  1BED A;  2GLR A;  2FNO A;  1LU4 A;  3F4R A;  3GH6 A;  2WZ9 A;  2R37 A;  1RW1 A;  4XRA A;  2GGT A;  1EV4 A;  3S9F A;  4GRF A;  3EMP A;  2JZS A;  1TRV A;  3EIN A;  2HRF A;  2MMA A;  3F8U A;  4IN0 A;  3TRQ A;  1TJD A;  5CYY A;  6GSY A;  4PQI A;  3GA4 A;  4F03 A;  4XRD A;  1YEX A;  4EE0 A;  3FZA A;  3ME8 A;  3IK7 A;  5ELG A;  3CRU A;  4OFT A;  4LL4 B;  3VI7 A;  4FYC A;  2XC2 A;  1U3A A;  4RQX A;  1XVQ A;  1GLP A;  3GKN A;  1EWX A;  1X9S B;  1T7P B;  4QL9 A;  2LNT A;  2HZE B;  2RUF A;  3EUR A;  4GSN A;  5GAP D;  4ZB6 A;  5LNK e;  4HI7 A;  1ERT A;  1M2A A;  1TI1 A;  4AJ7 A;  4IP6 A;  3APQ A;  5ID2 A;  1JLW A;  3LXT A;  4TOP A;  2VD0 A;  1C72 A;  5DAL A;  1SD9 A;  1XWB A;  1Z5Y E;  3R2Q A;  6GSW A;  1R5P A;  1M9A A;  3NIV A;  2A4V A;  4MH3 A;  4WBR D;  17GS A;  1M99 A;  5G30 A;  2HZF A;  4TR4 A;  2YZH A;  4L5O A;  4X43 A;  4N11 A;  4PUR A;  3RPP A;  4BWS A;  2LEG A;  2OE3 A;  3WT1 A;  3LSZ A;  2JAC A;  1O6J A;  4LLR A;  3UAP A;  2WJU A;  3FZ4 A;  1ILO A;  1BG5 A;  2WS2 A;  3P8W A;  1IYH A;  1T8E B;  4LA1 A;  1EEM A;  1H75 A;  1DE2 A;  2YN1 A;  1ML6 A;  2LQQ A;  1TK5 B;  3QMX A;  1M7T A;  4K1F A;  3IAS 2;  1OKT A;  4EDY A;  3LYP A;  2H0I A;  3APO A;  1QK8 A;  3IPZ A;  1YF1 A;  1MDK A;  5JWR B;  1Z6N A;  5DVB A;  1ZYQ B;  1QMV A;  2LS5 A;  4ISD A;  1UN2 A;  4JE1 A;  5C00 A;  5E4W A;  2H19 A;  3EE2 A;  3I43 A;  4E8E A;  2IMD A;  1HNA A;  3ZLP A;  1JFU A;  4BVY B;  2H73 A;  2VCT A;  5A4V A;  4LMV A;  1PSQ A;  3HVV A;  5KN2 A;  1FVK A;  2OBK A;  1G0T A;  2NTO A;  4MP4 A;  2O8V B;  2IN3 A;  1GSE A;  3LJR A;  1ABA A;  2H1G A;  1FVJ A;  2YWN A;  3C1R A;  4JU5 A;  2DLX A;  1O7U A;  2B1L A;  2X8G A;  2I3Y A;  3EC3 A;  3PH9 A;  2BMX A;  3J7Y k;  4Q5R A;  3DKS A;  2C0E A;  3GFK A;  2A2S A;  4ZB8 A;  2MZC A;  1ZZY A;  3TKR A;  1X9M B;  2X99 A;  1BX9 A;  3A2V A;  3ZVJ A;  4WBJ A;  4TVE A;  3KD0 A;  4NHZ A;  1NSW A;  4IVF A;  2FGX A;  2MBS A;  1KNG A;  2JSZ A;  2K18 A;  1B9Y C;  2VCQ A;  2GTU A;  1W89 A;  2B1K A;  2CVK A;  1AUC A;  4HQZ A;  4Q5N A; 
#chains in the Genus database with same CATH topology
 2B5Y A;  4RI7 A;  4MJE A;  3FR6 A;  4IJI A;  3KTB A;  3PPU A;  3HVN A;  2ON7 A;  5JCW A;  1V40 A;  4HZ2 A;  1A2L A;  1VRS D;  4EC0 A;  3EYT A;  5F8B A;  4K8M A;  4ZB7 A;  1PRX A;  4AKG A;  4OFN A;  1DUG A;  2M46 A;  2G2Q A;  5CRD A;  2PER A;  3CMI A;  1NHO A;  13GS A;  3VFI A;  4GQF A;  3HZ4 A;  1B4P A;  1XWG A;  3K8N A;  4K9Z A;  2DKI A;  5JCU A;  2IIY A;  3J7Y b;  1N2A A;  4L0W A;  4EXJ A;  3VI5 A;  2L4C A;  3O6T A;  3KH7 A;  3KP9 A;  4IQA A;  5IQY A;  1X0R A;  2F51 A;  5CRG A;  1B48 A;  2JU5 A;  1PKW A;  3A2W A;  3LYK A;  3CHX C;  4GDF A;  1FAA A;  1QQ2 A;  2H70 A;  2IFQ B;  1R5A A;  2O7K A;  3UVT A;  3TKQ A;  2R5G A;  2KP2 A;  3QDN A;  4O92 A;  2DJ2 A;  2VO4 A;  4KDX A;  4PGT A;  2VLV A;  1TXX A;  4BA7 A;  3WGX A;  1GH2 A;  2HXK A;  2O36 A;  1SYR A;  4X4J A;  3ZFL A;  4DVC A;  3D4M A;  1HYU A;  3TKS C;  3OR5 A;  7GSS A;  4A5P A;  1SL1 B;  4G19 A;  4N0Z A;  1A24 A;  1ERV A;  3GMF A;  4BWQ A;  2YPM A;  2K8S A;  4ZL7 A;  3UL3 A;  1SD8 A;  1AQW A;  1OE7 A;  3EPT A;  2LJA A;  4G0L A;  3WD6 A;  4MJB A;  4N30 A;  2J9H A;  1I5G A;  1SVM A;  1K0C A;  3HJO A;  1SVL A;  5DQY A;  5A34 A;  1G6Y A;  1FOV A;  4Q5Q A;  5B6N A;  2NPB A;  2WVZ A;  3F9U A;  3QOU A;  1FO5 A;  1Z9H A;  3GX0 A;  4GXZ A;  3HVX A;  5GZZ B;  2HRK B;  1LBK A;  2PBJ A;  4HU9 A;  5EY6 A;  2TIR A;  2DIZ A;  1NW2 A;  2OAC A;  2X49 A;  4IEL A;  4CDO A;  2H76 A;  1YDK A;  4K0G A;  2VM2 A;  4EKZ A;  4JZQ A;  4HOJ A;  3ISO A;  5A4U A;  4XHM A;  3ZYW A;  2LRN A;  5KN3 A;  2CVB A;  3KMO A;  3DRN A;  5KEJ A;  3LEF A;  5AIX A;  4BVX A;  2P31 A;  1ACV A;  4ACS A;  2E2G A;  4YQM A;  1FB6 A;  4AGS A;  3EU4 A;  3PR8 A;  2O87 A;  5IPG A;  1K0N A;  1M3I A;  3TJF A;  2C4J A;  5GAN D;  2I9H A;  4ID0 A;  3LFL A;  2FY6 A;  1GTU A;  3DYR A;  3FMW A;  4TXV A;  2EFH A;  4H86 A;  3HVS A;  1K0O A;  5E59 A;  4XS6 A;  1I9D A;  5DJM A;  2OE0 A;  2AJQ B;  3GYK A;  2VIM A;  2IMF A;  2LRT A;  5DQS A;  4GWR A;  3DIE A;  4K5S A;  3ERG A;  1Z6M A;  1EGR A;  5KN0 A;  4DSS A;  3ZTL A;  1F3B A;  1K0M A;  3QAV A;  1SU9 A;  2R0P A;  1YVL A;  3LXZ A;  1QGV A;  1GUH A;  4TKY A;  2VKZ G;  2FA4 A;  1R4W A;  1M2B A;  2L6C A;  5ECP B;  4YKG A;  1GSU A;  4NWY A;  2LTK A;  3IK9 A;  5A5H A;  2C3T A;  4K6X A;  2H6Y A;  3GTU A;  1GSD A;  4FYU A;  2QKE A;  1JLV A;  3O3T A;  2WW0 A;  1VF2 A;  2IL3 A;  3QAG A;  2C3Q A;  2XPE A;  14GS A;  4KDU A;  1SKW B;  2VCV A;  1XWC A;  4K5R A;  3GH9 A;  3DVX A;  2CA8 A;  3TKS E;  4HZ4 A;  4ML1 A;  4KX4 A;  3R3E A;  8GSS A;  1XZO A;  1OC3 A;  5HR2 A;  1ST9 A;  1GUL A;  2JSY A;  5AN1 A;  2VLT A;  3G9B A;  2ZNM A;  3E0U A;  2QA1 A;  3WGE A;  3M9K A;  4Z2T A;  3L9S A;  4AI6 A;  3CSH A;  3E9J B;  1QFN A;  4MZC A;  5ELA A;  3GUR A;  5J4Y A;  4I5Q A;  4K7N A;  4ECJ A;  3GIX A;  1GNE A;  3CSI A;  4IQ1 A;  2GZZ A;  4N3Z A;  3QPM A;  4ULX A;  3KMN A;  1V57 A;  2YOI A;  3HYP A;  2WRT A;  1F6M C;  4GCI A;  1T4Z A;  2VCX A;  2WVY A;  2HRA A;  1FHE A;  1WJK A;  5D9V A;  4KF9 A;  3CTF A;  3D4T A;  2G0F A;  2KLX A;  4JED A;  2F8A A;  5COH A;  5ECO B;  4BL7 B;  3ZL5 A;  2HSN A;  3I69 A;  5IO0 A;  3KZQ A;  3F6F A;  2CZ3 A;  1Y1U A;  4PHZ C;  4AKH A;  1AW9 A;  1PFO A;  3F3R A;  4FIW A;  2A2R A;  3FKF A;  1J9B A;  2L5L A;  5J5N A;  2V6K A;  1TU8 A;  3DD3 A;  1A8Y A;  1WP0 A;  4IBP A;  1G7O A;  4V2M A;  4ZBA A;  2IMK A;  1S3R A;  4KH7 A;  5D93 A;  4OCF A;  1FW1 A;  5CO3 A;  4G2E A;  3UAR A;  1XCC A;  3UBL A;  1M9B A;  3D0Z A;  1SJ6 A;  1S3C A;  4E8H A;  2B7K A;  1BJX A;  1YJ6 A;  1LJR A;  4XTS A;  4NHW A;  4P3Y B;  2R4V A;  1ERU A;  2C80 A;  2O3E A;  1V2A A;  4L0U A;  2GZP A;  2H66 A;  1JZO A;  3WYW A;  3NZN A;  5IMD A;  1MDJ A;  4EUY A;  3TJB A;  2H8L A;  3V1W A;  1ZYP A;  2XBI A;  3TDG A;  18GS A;  5D9W A;  2L5O A;  4O32 A;  3A5W A;  1R26 A;  4OO4 A;  2E0Q A;  1T4Y A;  1XXU A;  2P0G A;  6GSU A;  3A2X A;  1YEW C;  1AIU A;  1J08 A;  2GQK A;  2EIO A;  4FH8 A;  4EF0 A;  4AKI A;  2GZY A;  5ECQ B;  2H71 A;  3TKS A;  1T00 A;  3KJY A;  3NOF A;  1AQX A;  3ZIJ A;  2XHF A;  5J41 A;  1K0D A;  5CRH A;  4ZL8 A;  1URM A;  1EZK A;  2IWT A;  4TR3 A;  4TXO B;  4BVY A;  1EEJ A;  2BJX A;  1THO A;  4EVM A;  3GN3 A;  9GSS A;  3MYD A;  4YQU A;  2H6X A;  6GSX A;  4PNG A;  3Q19 A;  2R0C A;  1XIY A;  5IOX A;  2WCI A;  4PUF C;  1GWC A;  1TW9 A;  1GP1 A;  1TKD B;  3RPN A;  5IMC A;  3VWW A;  4ZL9 A;  2HSM B;  3PIN A;  1G6W A;  1WPI A;  1G7E A;  2RUE A;  4XS4 A;  1GUM A;  1V98 A;  3F4T A;  2WZS A;  2E2M A;  4KUN A;  2P5R A;  2EFD A;  3RHC A;  4IW9 A;  4ZXG A;  2XBQ A;  5IM9 A;  5F06 A;  5J9B A;  4V2N A;  3ZRD A;  3C73 A;  1B9X C;  4OD7 A;  1FOH A;  4MF5 A;  3TRX A;  1CQH A;  3IAM 2;  4YH2 A;  2EC4 A;  5CRE A;  1RQM A;  4GST A;  4PQ1 A;  3O76 A;  3HDC A;  2GSR A;  3FR3 A;  10GS A;  2UZ8 A;  5ID2 B;  2L4Q A;  4MLY A;  4TR0 A;  4J56 E;  4CY6 A;  1UC7 A;  3P90 A;  2C3N A;  2B6M A;  2F8F A;  5DAL B;  3IOS A;  2GDR A;  3KP8 A;  1OYJ A;  1MDI A;  4MF7 A;  5F05 A;  5D9X A;  4GSS A;  4GTU A;  3QFB C;  3FZ5 A;  4J57 E;  3U5R E;  2EFC A;  5BMU A;  2CAQ A;  2X64 A;  3HJM A;  2H1D A;  1EP8 A;  2FD3 A;  5J47 A;  2IFQ A;  5HFI A;  2RLI A;  1OC9 A;  1N8J A;  2QA2 A;  4MJC A;  3BCK A;  4TR1 A;  1YY7 A;  2HRN A;  3F4S A;  2DMM A;  2PUK C;  4FO5 A;  4I8B A;  2GT6 A;  1AQV A;  1WRY A;  4G0I A;  3RDW A;  4PQH A;  4MCU A;  4HS1 A;  1TK8 B;  2N5A A;  4V1A p;  5CP1 A;  4IHU A;  2V2G A;  4X0X A;  5G1K A;  3H1N A;  4ECC A;  1ZL9 A;  4MDC A;  4DSR A;  4WEY A;  1YKA A;  6GSV A;  3AY8 A;  1S3A A;  1ZMA A;  4IKH A;  1V9W A;  1M2D A;  4PUA A;  2OJL A;  5ECM B;  4GQC A;  1X5E A;  5EL8 A;  1Z7P A;  5CAX A;  4RI6 A;  1OE8 A;  5G5E A;  1O73 A;  2KOK A;  1A0R P;  5BRT A;  3F0I A;  3KH9 A;  3I9V 2;  20GS A;  3TRP A;  3I6A A;  4WXT A;  4O5Q A;  3FW2 A;  2O89 A;  2HFD A;  3IXR A;  1DE1 A;  3H93 A;  4JRR A;  5G1L A;  2DJJ A;  1TRS A;  3DGQ A;  4LMW A;  3VWX A;  3BJ5 A;  3RBT A;  2P5Q A;  3GUS A;  3GST A;  1Z3E A;  1QUW A;  4G0K A;  5FHI A;  1ZCP A;  2YWI A;  1UVZ A;  2OA7 A;  4HU7 A;  1BAY A;  1WMJ A;  3VK9 A;  3P2A A;  1XW6 A;  2HT9 A;  3TJG A;  2WB9 A;  2CX3 A;  1ERW A;  3FEU A;  5H5R A;  4MNN A;  5KOW A;  5KOX A;  5A1N B;  1SK2 A;  2IJY A;  4MF6 A;  2YWO A;  2DBC A;  3LWA A;  4D73 A;  2H1A A;  3ZRE A;  2YCD A;  1PN0 A;  4XS1 A;  1GTA A;  2WVX A;  3CSJ A;  4JR6 A;  3Q18 A;  4RUV A;  3TJJ A;  1VF4 A;  1E2Y A;  1ZYN A;  3DVW A;  5AGY A;  4X1U A;  2J23 A;  2AUV A;  3ZFB A;  3QCP A;  1KTE A;  2VUP A;  2H1L A;  3BBY A;  5CRW A;  1PL1 A;  5DCG A;  5AIS A;  2VLU A;  2I81 A;  5ECS A;  3ED3 A;  3M3M A;  2V32 A;  3TOU A;  3UMA A;  1Q4J A;  2IME A;  3BD2 A;  5CNW A;  4KND A;  1KBN A;  5EVO A;  4KDY A;  4V2L A;  5DAK A;  3TJK A;  4MJA A;  5JWO B;  2CX4 A;  1TRU A;  3L9U A;  4MMM A;  2TRC P;  1YZX A;  1SYX A;  1VGL A;  3ZMK A;  3US3 A;  2HQT A;  4XIH A;  3MNG A;  1PQN A;  1GL8 A;  2JZT A;  4IJ3 A;  3W8J A;  1J0F A;  4YAP A;  1TXU A;  3LG6 A;  2HSY A;  4WKW A;  5D9T A;  4OFM A;  2N5F A;  2YV9 A;  5ECK B;  4IS0 A;  1YF0 A;  2MBT A;  1GLQ A;  2LUS A;  3KGK A;  4FYB A;  3HD5 A;  5A34 B;  5LCZ A;  2CT6 A;  3WGD A;  1SVO A;  4FQU A;  3LGC A;  4HDE A;  3FRC A;  1PA3 A;  1ON4 A;  2OKA A;  1U6T A;  1VF3 A;  3TCO A;  5IPH A;  2REM A;  1DBY A;  2CAI A;  2RII A;  2H0H A;  3VWU A;  1X5D A;  3CTG A;  4G01 A;  5HR1 A;  5C04 A;  3IE3 A;  2GVP A;  3VWV A;  1K0A A;  1XPV A;  4WF4 A;  2HLS A;  4KSM A;  3U6V A;  5JWQ B;  2B7J A;  2YJ7 A;  2GQL A;  2B3S A;  3ZIT A;  1WOU A;  3LW9 A;  4ZB9 A;  4KA0 A;  2H74 A;  4NV2 A;  3TB2 A;  1AC1 A;  4PI0 C;  5B8B A;  2YJH A;  2AB6 A;  4BVX B;  4WR4 A;  4MZW A;  3E3E A;  3G7J A;  5GST A;  3GKX A;  3BCI A;  4PX1 A;  2OT3 A;  5G2Z A;  3KXO A;  4EDZ A;  2YWM A;  1U87 A;  2JL4 A;  2HYX A;  2VCW A;  2OAD A;  1TRW A;  5B6M A;  4I6X A;  2FHE A;  3TKP A;  1XVW A;  3GX8 A;  3N5O A;  1AAZ A;  2IMI A;  2PMT A;  2NBS A;  2HE3 A;  2HZE A;  4TRX A;  1DSB A;  1WIK A;  4F9Z A;  4G9H A;  2GT5 A;  3QFA C;  2GST A;  2I1U A;  3EMX A;  5DJL A;  5AIV A;  2GS3 A;  2FWH A;  2H0G A;  4DSS B;  4O5R A;  4I2T A;  1HNB A;  3N9J A;  2CVD A;  2C0D A;  1XWA A;  4FXY P;  5H5S A;  4POM A;  4WET A;  4ZBB A;  5A5H B;  5FT3 A;  2ZCT A;  4KGI A;  3KEB A;  4POK A;  3L9V A;  4TXO A;  1GTI A;  3IR4 A;  2VL2 C;  3RAZ A;  1TP9 A;  1A23 A;  1SL2 B;  2VOC A;  3MIX A;  1I1I P;  1M3J A;  2VD1 A;  3Q74 A;  2VCZ A;  3P7X A;  5HQP A;  4NAX A;  3TUE A;  1EOH A;  3L0H A;  2WW3 A;  3TOT A;  1YEP A;  2LNS A;  2TRX A;  3GL5 A;  4F82 A;  2HSM A;  3L78 A;  2DKH A;  3HCZ A;  5EPF A;  4MPG A;  3KM6 A;  1BQ7 A;  5G31 A;  3C7M A;  1F2E A;  1SJI A;  2PGT A;  3MSZ A;  1XW5 A;  3IC4 A;  1SKR B;  1XOB A;  3UEM A;  4PI2 C;  1Q98 A;  5JCG A;  3LOR A;  4V1A g;  1F37 A;  1PL2 A;  3VLN A;  4KW6 A;  4HQS A;  2HNL A;  12GS A;  2C0G A;  2WW2 A;  22GS A;  2N5B A;  4OCE A;  4F0C A;  2PVO C;  2X8H A;  4HUA A;  5J9C A;  3LQ7 A;  2M80 A;  1JZW A;  1EGO A;  1NM3 A;  1SL0 B;  1YQ1 A;  2HSN B;  3HY2 A;  4O7H A;  1SK1 A;  1OAZ A;  2K8V A;  3F3Q A;  2XPD A;  4Z7X A;  5J40 A;  1GSS A;  16GS A;  3G7I A;  1K3L A;  3ERF A;  4K7O A;  4L5L A;  2I4A A;  5DBQ A;  4OMV A;  2H6Z A;  5ECL B;  1WWJ A;  2L57 A;  5HFG A;  3RHB A;  2X8C A;  3DXB A;  2E7P A;  4DEJ A;  2H30 A;  2VM1 A;  3EWL A;  3IA1 A;  3FZ9 A;  3HKR A;  1E6B A;  1TU7 A;  3WT2 A;  1F9M A;  1BG1 A;  4AJ6 A;  3C71 A;  4BIK A;  3C8E A;  2B5E A;  3EVI A;  2Z9S A;  1Y25 A;  4KCA A;  2DJ1 A;  2H75 A;  3UIW A;  3VPT A;  3GKM A;  2H01 A;  4POB A;  2KHP A;  1PX6 A;  4J2F A;  1XOA A;  3UBK A;  4JR4 A;  2AAW A;  1OC8 A;  2F9S A;  4BPY A;  4GF0 A;  1XWK A;  2V1M A;  4QMK A;  1HNC A;  2D2Z A;  3IV4 A;  1M0U A;  5IMZ A;  1ZYE A;  5ECN B;  1XW9 A;  3KCM A;  5F0G A;  1K0B A;  3CQF A;  1X9W B;  3Q6O A;  2X4A A;  3MDK A;  5G5F A;  3W6G A;  1A8L A;  2VAF A;  4CW9 A;  2EFE A;  3F6D A;  1U3I A;  3RFR C;  2KUC A;  3TGZ A;  1PGT A;  4EIP A;  2NDO A;  3GHA A;  1B8X A;  5DDL A;  2NVL A;  1KEB A;  5ECR B;  4OWY A;  3KTL A;  3UJ1 A;  2C8U A;  3ZZX A;  3ZML A;  5D8I A;  4AKX B;  2QC7 A;  2WW1 A;  4Z2U A;  1IYI A;  5INY A;  4TN8 A;  4EL1 A;  5IO2 A;  1MD3 A;  1GRX A;  1T3B A;  3IHQ A;  2ON5 A;  2FWF A;  4NXI A;  2YNX A;  5HR3 A;  1F3A A;  2MYG A;  3GV1 A;  5F07 A;  3ME7 A;  2H72 A;  4WR5 A;  1GTB A;  4MZB A;  4XS4 B;  1O85 A;  4G10 A;  4K7I A;  1V58 A;  1XBS A;  1XG8 A;  4ZIJ A;  2O5V A;  2R0G A;  2F3M A;  5FWG A;  4MA9 A;  1NHY A;  6GSS A;  1ZGN A;  4TW5 A;  2DSA A;  1TI3 A;  3H79 A;  2QSI A;  2DJK A;  3GKK A;  4I2U A;  2DC5 A;  3IBH A;  2ES7 A;  3M1G A;  1WE0 A;  5GSS A;  5IIZ A;  3GNJ A;  2C1Y A;  3GL3 A;  5J4U A;  4ICY A;  2EIQ A;  3A5I A;  4YKF A;  2HRK A;  1OKD A;  3UOM A;  1YKC A;  1SJZ A;  5A4W A;  3MAK A;  2OE1 A;  2PPT A;  1ZOF A;  1A2J A;  3JCM L;  4K2X A;  1GSF A;  4N10 A;  3IRA A;  1TDI A;  2YAN A;  5BMU B;  4PXO A;  4PTS A;  5J4V A;  4HJM A;  4KSO A;  2WUL A;  1PN9 A;  3SWL A;  1FG4 A;  3HXS A;  1N25 A;  1OC9 B;  3CRT A;  3IDV A;  4TR1 B;  3RGB C;  1TK0 B;  5IMV A;  1S3D A;  3DEX A;  2VL2 A;  2R3X A;  3H8Q A;  3CBU A;  2VL9 A;  1BF5 A;  2UV8 G;  1JZD A;  2L59 A;  3EU3 A;  2WDU A;  1XFL A;  2LJK A;  3HJP A;  1W4V A;  1O8W A;  2FUG 2;  1SK0 A;  1O81 A;  1GNW A;  2LST A;  2EIR A;  2GQM A;  3H4K A;  2CV4 A;  2K6V A;  1AXD A;  2AYT A;  2BTO T;  2R2J A;  4K0N A;  1A0F A;  4MPF A;  1TOF A;  3APS A;  1EOG A;  2RM6 A;  3M8N A;  2AHE A;  3FYG A;  4PNF A;  3FK8 A;  2M72 A;  2LV3 A;  3DWV A;  3PGT A;  2LJR A;  2JAD A;  2L6D A;  3HA9 A;  5ENU A;  5DCH A;  1JHB A;  5B7C A;  1SEN A;  2YV7 A;  2MMN A;  4CY8 A;  1PX7 A;  1TTZ A;  2PVQ A;  5IMA A;  3VPQ A;  4CHS A;  1THX A;  2GSQ A;  3D5J A;  4HEA 2;  2MMZ A;  1QXH A;  3CXG A;  2H1B A;  3M9J A;  3UVH A;  1HQO A;  4ZIL A;  1PMT A;  5H5Q A;  2KP1 A;  2LRC A;  2R6K A;  3C1S A;  4ECB A;  3GSS A;  1R7H A;  4L8E A;  2CZ2 A;  4MH2 A;  1GUK A;  1GSQ A;  3FY7 A;  3W8S A;  4ZBD A;  4HJ2 A;  1HD2 A;  3IHG A;  4JBB A;  1FB0 A;  3FR9 A;  1USB A;  2ZUP A;  2C0F A;  4MAB A;  3ZIV A;  2B5X A;  5IMF A;  4AJ8 A;  4ML6 A;  6GST A;  1X5C A;  5A5K A;  5KN1 A;  2A2P A;  2OBI A;  3QR6 A;  5HFK A;  3HZ8 A;  2A4H A;  1BYE A;  2FLS A;  1CQG A;  2GSS A;  4I97 A;  3ZVJ D;  3DML A;  3D22 A;  3CWG A;  5IOW A;  5ABR A;  1A2M A;  2AV4 A;  2FWE A;  4YAV A;  2MMO A;  4QL7 A;  4D73 B;  3QD9 A;  4WF5 A;  3L4N A;  4AF2 A;  2V41 A;  1B4Q A;  4F0B A;  2LQO A;  4N0V A;  4USS A;  3SBC A;  4YQV A;  5B8A A;  2DJ0 A;  1K3O A;  1Y6E A;  2WVX B;  2RM5 A;  3CYN A;  3HMJ G;  4BL7 A;  4Q5F A;  4XCS A;  5LD0 A;  2WGR A;  3ERW A;  3F63 A;  3VUR A;  4GLT A;  4NV5 A;  5D96 A;  1K3Y A;  5J3R A;  4IP1 A;  1O8X A;  5L71 A;  3QAW A;  2DML A;  1PD2 1;  1MEK A;  4KE3 A;  1OVN A;  4DSQ A;  3MWH A;  1Z7R A;  4RQR A;  1UA5 A;  1GSY A;  5ECH B;  1U88 A;  5DAK B;  4ECI A;  3M0F A;  2PWJ A;  3G7Y A;  4POL A;  4QQ7 A;  5D73 A;  1T1V A;  2IPA A;  4W66 A;  2DIY A;  1RK4 A;  2V6O A;  1MD4 A;  4EO3 A;  11GS A;  5HR0 A;  1VF1 A;  4LL1 B;  4KAE A;  2YP6 A;  3D6I A;  2K9F A;  3A3T A;  19GS A;  1H4O A;  1EV9 A;  3FHK A;  4F2I A;  2FWG A;  1SKS B;  4NPB A;  4MK3 A;  2DJ3 A;  1S4B P;  2HSH A;  4K2D A;  2HI7 A;  2ALB A;  2FA8 A;  2WFC A;  4ILF A;  2FCH A;  2PU9 C;  1EP7 A;  1JZR A;  1MTC A;  2JZR A;  4OO5 A;  4KCE A;  1PKZ A;  5ECI B;  3HHV A;  2VL3 A;  4IGJ A;  2O85 A;  4EIQ A;  2LKU A;  3D21 A;  4NMU A;  3GTU B;  2QGV A;  3BOA A;  3KIJ A;  2YZU A;  2CQ9 A;  2PN8 A;  3IC8 A;  4KB3 A;  3GRX A;  1BED A;  4HSC X;  2GLR A;  2FNO A;  1LU4 A;  3F4R A;  3GH6 A;  2WZ9 A;  2R37 A;  1RW1 A;  4XRA A;  2GGT A;  1EV4 A;  3S9F A;  4GRF A;  3EMP A;  2JZS A;  1TRV A;  3EIN A;  2HRF A;  2MMA A;  3F8U A;  4IN0 A;  3TRQ A;  1TJD A;  5CYY A;  6GSY A;  4PQI A;  3GA4 A;  4F03 A;  4XRD A;  1YEX A;  4EE0 A;  3FZA A;  3ME8 A;  3IK7 A;  5ELG A;  3CRU A;  4OFT A;  4LL4 B;  3VI7 A;  4FYC A;  2XC2 A;  1U3A A;  4RQX A;  1XVQ A;  1GLP A;  3GKN A;  1EWX A;  1X9S B;  1T7P B;  4QL9 A;  2LNT A;  2HZE B;  2RUF A;  3EUR A;  4GSN A;  5GAP D;  4ZB6 A;  5LNK e;  4HI7 A;  1ERT A;  1M2A A;  1TI1 A;  4AJ7 A;  4IP6 A;  3APQ A;  5ID2 A;  1JLW A;  3LXT A;  4TOP A;  2VD0 A;  1C72 A;  5DAL A;  1SD9 A;  1XWB A;  1Z5Y E;  3R2Q A;  6GSW A;  1R5P A;  1M9A A;  3NIV A;  2A4V A;  4MH3 A;  4WBR D;  4O5U A;  17GS A;  1M99 A;  5G30 A;  2HZF A;  4TR4 A;  2YZH A;  4L5O A;  4X43 A;  4N11 A;  4PUR A;  3RPP A;  4BWS A;  2LEG A;  2OE3 A;  3WT1 A;  3LSZ A;  2JAC A;  1O6J A;  4LLR A;  4E68 A;  3UAP A;  2WJU A;  3FZ4 A;  1ILO A;  1BG5 A;  2WS2 A;  3TU3 B;  3P8W A;  1IYH A;  1T8E B;  4LA1 A;  1EEM A;  1H75 A;  1DE2 A;  2YN1 A;  1ML6 A;  2LQQ A;  1TK5 B;  3QMX A;  1M7T A;  4K1F A;  3IAS 2;  1OKT A;  4EDY A;  3LYP A;  2H0I A;  3APO A;  1QK8 A;  3IPZ A;  1YF1 A;  1MDK A;  5JWR B;  1Z6N A;  5DVB A;  1ZYQ B;  1QMV A;  2LS5 A;  4ISD A;  1UN2 A;  4JE1 A;  5C00 A;  5E4W A;  2H19 A;  3EE2 A;  3I43 A;  4E8E A;  2IMD A;  1HNA A;  3ZLP A;  1JFU A;  4BVY B;  2H73 A;  2VCT A;  5A4V A;  4LMV A;  1PSQ A;  3HVV A;  5KN2 A;  1FVK A;  2OBK A;  1G0T A;  2NTO A;  4MP4 A;  2O8V B;  2IN3 A;  1GSE A;  4Z2R A;  3LJR A;  1ABA A;  2H1G A;  1FVJ A;  2YWN A;  3C1R A;  4JU5 A;  2DLX A;  1O7U A;  2B1L A;  2X8G A;  2I3Y A;  3EC3 A;  3PH9 A;  2BMX A;  3J7Y k;  4Q5R A;  3DKS A;  2C0E A;  3GFK A;  2A2S A;  4ZB8 A;  2MZC A;  1ZZY A;  3TKR A;  1X9M B;  2X99 A;  1BX9 A;  3A2V A;  3ZVJ A;  4WBJ A;  4TVE A;  3KD0 A;  4NHZ A;  1NSW A;  4IVF A;  2FGX A;  2MBS A;  1KNG A;  2JSZ A;  2K18 A;  1B9Y C;  2VCQ A;  2GTU A;  1W89 A;  2B1K A;  5A1N A;  2CVK A;  1AUC A;  4HQZ A;  4Q5N A; 
#chains in the Genus database with same CATH homology
 2B5Y A;  4RI7 A;  4MJE A;  3FR6 A;  4IJI A;  3KTB A;  3PPU A;  2ON7 A;  5JCW A;  1V40 A;  4HZ2 A;  1A2L A;  1VRS D;  4EC0 A;  3EYT A;  5F8B A;  4K8M A;  4ZB7 A;  1PRX A;  4AKG A;  4OFN A;  1DUG A;  2M46 A;  2G2Q A;  5CRD A;  2PER A;  3CMI A;  1NHO A;  13GS A;  3VFI A;  4GQF A;  3HZ4 A;  1B4P A;  1XWG A;  3K8N A;  4K9Z A;  2DKI A;  5JCU A;  2IIY A;  3J7Y b;  1N2A A;  4L0W A;  4EXJ A;  3VI5 A;  2L4C A;  3O6T A;  3KH7 A;  3KP9 A;  4IQA A;  5IQY A;  1X0R A;  2F51 A;  5CRG A;  1B48 A;  2JU5 A;  1PKW A;  3A2W A;  3LYK A;  2IFQ B;  4GDF A;  1FAA A;  1QQ2 A;  2H70 A;  1R5A A;  2O7K A;  3UVT A;  3TKQ A;  2R5G A;  2KP2 A;  3QDN A;  4O92 A;  2DJ2 A;  2VO4 A;  4KDX A;  4PGT A;  2VLV A;  1TXX A;  4BA7 A;  3WGX A;  1GH2 A;  2HXK A;  1SYR A;  4X4J A;  3ZFL A;  4DVC A;  3D4M A;  1HYU A;  3TKS C;  3OR5 A;  7GSS A;  4A5P A;  1SL1 B;  4G19 A;  4N0Z A;  1A24 A;  1ERV A;  3GMF A;  4BWQ A;  2YPM A;  2K8S A;  4ZL7 A;  3UL3 A;  1SD8 A;  1AQW A;  1OE7 A;  3EPT A;  2LJA A;  4G0L A;  3WD6 A;  4MJB A;  4N30 A;  2J9H A;  1I5G A;  1SVM A;  1K0C A;  3HJO A;  1SVL A;  5DQY A;  5A34 A;  1G6Y A;  1FOV A;  4Q5Q A;  5B6N A;  2NPB A;  3F9U A;  3QOU A;  1FO5 A;  1Z9H A;  3GX0 A;  4GXZ A;  3HVX A;  5GZZ B;  2HRK B;  1LBK A;  2PBJ A;  4HU9 A;  5EY6 A;  2TIR A;  2DIZ A;  1NW2 A;  2OAC A;  2X49 A;  4IEL A;  4CDO A;  2H76 A;  1YDK A;  4K0G A;  2VM2 A;  4EKZ A;  4JZQ A;  4HOJ A;  3ISO A;  5A4U A;  4XHM A;  3ZYW A;  2LRN A;  5KN3 A;  2CVB A;  3KMO A;  3DRN A;  5KEJ A;  3LEF A;  5AIX A;  4BVX A;  2P31 A;  1ACV A;  4ACS A;  2E2G A;  4YQM A;  1FB6 A;  4AGS A;  3EU4 A;  3PR8 A;  2O87 A;  5IPG A;  1K0N A;  3TJF A;  2C4J A;  5GAN D;  2I9H A;  4ID0 A;  3LFL A;  2FY6 A;  1GTU A;  3DYR A;  3FMW A;  4TXV A;  2EFH A;  4H86 A;  3HVS A;  1K0O A;  5E59 A;  4XS6 A;  1I9D A;  5DJM A;  2OE0 A;  2AJQ B;  3GYK A;  2VIM A;  2IMF A;  2LRT A;  5DQS A;  4GWR A;  3DIE A;  4K5S A;  3ERG A;  1Z6M A;  1EGR A;  5KN0 A;  4DSS A;  3ZTL A;  1F3B A;  1K0M A;  3QAV A;  1SU9 A;  2R0P A;  1YVL A;  3LXZ A;  1QGV A;  1GUH A;  4TKY A;  2VKZ G;  2FA4 A;  1R4W A;  1M2B A;  2L6C A;  5ECP B;  4YKG A;  1GSU A;  4NWY A;  2LTK A;  3IK9 A;  5A5H A;  2C3T A;  4K6X A;  2H6Y A;  3GTU A;  1GSD A;  4FYU A;  2QKE A;  1JLV A;  3O3T A;  1VF2 A;  2IL3 A;  3QAG A;  2C3Q A;  2XPE A;  14GS A;  4KDU A;  1SKW B;  2VCV A;  1XWC A;  4K5R A;  3GH9 A;  3DVX A;  2CA8 A;  3TKS E;  4HZ4 A;  4ML1 A;  4KX4 A;  3R3E A;  8GSS A;  1XZO A;  1OC3 A;  5HR2 A;  1ST9 A;  1GUL A;  2JSY A;  5AN1 A;  2VLT A;  3G9B A;  2ZNM A;  3E0U A;  2QA1 A;  3WGE A;  3M9K A;  4Z2T A;  3L9S A;  4AI6 A;  3CSH A;  3E9J B;  1QFN A;  4MZC A;  5ELA A;  3GUR A;  5J4Y A;  4I5Q A;  4K7N A;  4ECJ A;  3GIX A;  1GNE A;  3CSI A;  4IQ1 A;  2GZZ A;  4N3Z A;  3QPM A;  4ULX A;  3KMN A;  1V57 A;  2YOI A;  3HYP A;  2WRT A;  1F6M C;  4GCI A;  1T4Z A;  2VCX A;  2HRA A;  1FHE A;  1WJK A;  5D9V A;  4KF9 A;  3CTF A;  3D4T A;  2G0F A;  2KLX A;  4JED A;  2F8A A;  5COH A;  5ECO B;  4BL7 B;  3ZL5 A;  2HSN A;  3I69 A;  5IO0 A;  3KZQ A;  3F6F A;  2CZ3 A;  1Y1U A;  4AKH A;  4FIW A;  1AW9 A;  3F3R A;  2A2R A;  3FKF A;  1J9B A;  2L5L A;  5J5N A;  2V6K A;  1TU8 A;  3DD3 A;  1A8Y A;  1WP0 A;  4IBP A;  1G7O A;  4V2M A;  4ZBA A;  2IMK A;  4KH7 A;  5D93 A;  4OCF A;  1FW1 A;  5CO3 A;  4G2E A;  3UAR A;  1XCC A;  3UBL A;  1M9B A;  3D0Z A;  1SJ6 A;  1S3C A;  4E8H A;  2B7K A;  1BJX A;  1YJ6 A;  1LJR A;  4XTS A;  4NHW A;  4P3Y B;  2R4V A;  1ERU A;  2C80 A;  1V2A A;  4L0U A;  2GZP A;  2H66 A;  1JZO A;  3WYW A;  3NZN A;  5IMD A;  1MDJ A;  4EUY A;  3TJB A;  2H8L A;  3V1W A;  1ZYP A;  2XBI A;  3TDG A;  18GS A;  5D9W A;  2L5O A;  4O32 A;  3A5W A;  1R26 A;  4OO4 A;  2E0Q A;  1T4Y A;  1XXU A;  2P0G A;  6GSU A;  3A2X A;  1AIU A;  1J08 A;  2GQK A;  2EIO A;  4FH8 A;  4EF0 A;  4AKI A;  2GZY A;  5ECQ B;  2H71 A;  3TKS A;  1T00 A;  3KJY A;  3NOF A;  1AQX A;  3ZIJ A;  2XHF A;  5J41 A;  1K0D A;  5CRH A;  4ZL8 A;  1URM A;  1EZK A;  2IWT A;  4TR3 A;  4TXO B;  4BVY A;  1EEJ A;  2BJX A;  1THO A;  4EVM A;  3GN3 A;  9GSS A;  3MYD A;  4YQU A;  2H6X A;  6GSX A;  4PNG A;  3Q19 A;  2R0C A;  1XIY A;  5IOX A;  2WCI A;  4PUF C;  1GWC A;  1TW9 A;  1GP1 A;  1TKD B;  3RPN A;  5IMC A;  3VWW A;  4ZL9 A;  2HSM B;  3PIN A;  1G6W A;  1WPI A;  1G7E A;  2RUE A;  4XS4 A;  1GUM A;  1V98 A;  3F4T A;  2E2M A;  4KUN A;  2P5R A;  2EFD A;  3RHC A;  4IW9 A;  4ZXG A;  2XBQ A;  5IM9 A;  5F06 A;  5J9B A;  4V2N A;  3ZRD A;  3C73 A;  1B9X C;  4OD7 A;  1FOH A;  4MF5 A;  3TRX A;  1CQH A;  3IAM 2;  4YH2 A;  2EC4 A;  5CRE A;  1RQM A;  4GST A;  4PQ1 A;  3O76 A;  3HDC A;  2GSR A;  3FR3 A;  10GS A;  2UZ8 A;  5ID2 B;  2L4Q A;  4MLY A;  4TR0 A;  4J56 E;  4CY6 A;  1UC7 A;  3P90 A;  2C3N A;  2B6M A;  2F8F A;  5DAL B;  3IOS A;  2GDR A;  3KP8 A;  1OYJ A;  1MDI A;  4MF7 A;  5F05 A;  5D9X A;  4GSS A;  4GTU A;  3QFB C;  3FZ5 A;  4J57 E;  3U5R E;  2EFC A;  5BMU A;  2CAQ A;  2X64 A;  3HJM A;  2H1D A;  1EP8 A;  2FD3 A;  5J47 A;  2IFQ A;  5HFI A;  2RLI A;  1OC9 A;  1N8J A;  2QA2 A;  4MJC A;  3BCK A;  4TR1 A;  1YY7 A;  2HRN A;  3F4S A;  2DMM A;  2PUK C;  4FO5 A;  4I8B A;  2GT6 A;  1AQV A;  1WRY A;  4G0I A;  3RDW A;  4PQH A;  4MCU A;  4HS1 A;  1TK8 B;  2N5A A;  4V1A p;  5CP1 A;  4IHU A;  2V2G A;  4X0X A;  5G1K A;  3H1N A;  4ECC A;  1ZL9 A;  4MDC A;  4DSR A;  4WEY A;  1YKA A;  6GSV A;  3AY8 A;  1S3A A;  1ZMA A;  4IKH A;  1V9W A;  1M2D A;  4PUA A;  2OJL A;  5ECM B;  4GQC A;  1X5E A;  5EL8 A;  1Z7P A;  5CAX A;  4RI6 A;  1OE8 A;  5G5E A;  1O73 A;  2KOK A;  1A0R P;  5BRT A;  3F0I A;  3KH9 A;  3I9V 2;  20GS A;  3TRP A;  3I6A A;  4WXT A;  4O5Q A;  3FW2 A;  2O89 A;  2HFD A;  3IXR A;  1DE1 A;  3H93 A;  4JRR A;  5G1L A;  2DJJ A;  1TRS A;  3DGQ A;  4LMW A;  3VWX A;  3BJ5 A;  3RBT A;  2P5Q A;  3GUS A;  3GST A;  1Z3E A;  1QUW A;  4G0K A;  5FHI A;  1ZCP A;  2YWI A;  1UVZ A;  2OA7 A;  4HU7 A;  1BAY A;  1WMJ A;  3VK9 A;  3P2A A;  1XW6 A;  2HT9 A;  3TJG A;  2WB9 A;  2CX3 A;  1ERW A;  3FEU A;  5H5R A;  4MNN A;  5KOW A;  5KOX A;  5A1N B;  1SK2 A;  2IJY A;  4MF6 A;  2YWO A;  2DBC A;  3LWA A;  4D73 A;  2H1A A;  3ZRE A;  2YCD A;  1PN0 A;  4XS1 A;  1GTA A;  3CSJ A;  4JR6 A;  3Q18 A;  4RUV A;  3TJJ A;  1VF4 A;  1E2Y A;  1ZYN A;  3DVW A;  5AGY A;  4X1U A;  2J23 A;  2AUV A;  3ZFB A;  3QCP A;  1KTE A;  2VUP A;  2H1L A;  3BBY A;  5CRW A;  1PL1 A;  5DCG A;  5AIS A;  2VLU A;  2I81 A;  5ECS A;  3ED3 A;  3M3M A;  2V32 A;  3TOU A;  3UMA A;  1Q4J A;  2IME A;  3BD2 A;  5CNW A;  4KND A;  1KBN A;  5EVO A;  4KDY A;  4V2L A;  5DAK A;  3TJK A;  4MJA A;  5JWO B;  2CX4 A;  1TRU A;  3L9U A;  4MMM A;  2TRC P;  1YZX A;  1SYX A;  1VGL A;  3ZMK A;  3US3 A;  2HQT A;  4XIH A;  3MNG A;  1PQN A;  1GL8 A;  2JZT A;  4IJ3 A;  3W8J A;  1J0F A;  4YAP A;  1TXU A;  3LG6 A;  2HSY A;  4WKW A;  5D9T A;  4OFM A;  2N5F A;  2YV9 A;  5ECK B;  4IS0 A;  1YF0 A;  2MBT A;  1GLQ A;  2LUS A;  3KGK A;  4FYB A;  3HD5 A;  5A34 B;  5LCZ A;  2CT6 A;  3WGD A;  1SVO A;  4FQU A;  3LGC A;  4HDE A;  3FRC A;  1PA3 A;  1ON4 A;  2OKA A;  1U6T A;  1VF3 A;  3TCO A;  5IPH A;  2REM A;  1DBY A;  2CAI A;  2RII A;  2H0H A;  3VWU A;  1X5D A;  3CTG A;  4G01 A;  5HR1 A;  5C04 A;  3IE3 A;  2GVP A;  3VWV A;  1K0A A;  1XPV A;  4WF4 A;  2HLS A;  4KSM A;  3U6V A;  5JWQ B;  2B7J A;  2YJ7 A;  2GQL A;  2B3S A;  3ZIT A;  1WOU A;  3LW9 A;  4ZB9 A;  4KA0 A;  2H74 A;  4NV2 A;  3TB2 A;  1AC1 A;  5B8B A;  2YJH A;  2AB6 A;  4BVX B;  4WR4 A;  4MZW A;  3E3E A;  3G7J A;  5GST A;  3GKX A;  3BCI A;  4PX1 A;  2OT3 A;  5G2Z A;  3KXO A;  4EDZ A;  2YWM A;  1U87 A;  2JL4 A;  2HYX A;  2VCW A;  2OAD A;  1TRW A;  5B6M A;  4I6X A;  2FHE A;  3TKP A;  1XVW A;  3GX8 A;  3N5O A;  1AAZ A;  2IMI A;  2PMT A;  2NBS A;  2HE3 A;  2HZE A;  4TRX A;  1DSB A;  1WIK A;  4F9Z A;  4G9H A;  2GT5 A;  3QFA C;  2GST A;  2I1U A;  3EMX A;  5DJL A;  5AIV A;  2GS3 A;  2FWH A;  2H0G A;  4DSS B;  4O5R A;  4I2T A;  3N9J A;  1HNB A;  2CVD A;  2C0D A;  1XWA A;  5H5S A;  4POM A;  4WET A;  4ZBB A;  5A5H B;  5FT3 A;  2ZCT A;  4KGI A;  3KEB A;  4POK A;  3L9V A;  4TXO A;  1GTI A;  3IR4 A;  2VL2 C;  3RAZ A;  1TP9 A;  1A23 A;  1SL2 B;  2VOC A;  3MIX A;  2VD1 A;  3Q74 A;  2VCZ A;  3P7X A;  5HQP A;  4NAX A;  3TUE A;  1EOH A;  3L0H A;  3TOT A;  1YEP A;  2LNS A;  2TRX A;  3GL5 A;  4F82 A;  2HSM A;  3L78 A;  2DKH A;  3HCZ A;  5EPF A;  4MPG A;  3KM6 A;  1BQ7 A;  5G31 A;  3C7M A;  1F2E A;  1SJI A;  2PGT A;  3MSZ A;  1XW5 A;  3IC4 A;  1SKR B;  1XOB A;  3UEM A;  1Q98 A;  5JCG A;  3LOR A;  4V1A g;  1F37 A;  1PL2 A;  3VLN A;  4KW6 A;  4HQS A;  2HNL A;  12GS A;  2C0G A;  22GS A;  2N5B A;  4OCE A;  4F0C A;  2PVO C;  2X8H A;  4HUA A;  5J9C A;  3LQ7 A;  2M80 A;  1JZW A;  1EGO A;  1NM3 A;  1SL0 B;  1YQ1 A;  2HSN B;  3HY2 A;  4O7H A;  1SK1 A;  1OAZ A;  2K8V A;  3F3Q A;  2XPD A;  4Z7X A;  5J40 A;  1GSS A;  16GS A;  3G7I A;  1K3L A;  3ERF A;  4K7O A;  4L5L A;  2I4A A;  5DBQ A;  4OMV A;  2H6Z A;  5ECL B;  1WWJ A;  2L57 A;  5HFG A;  3RHB A;  2X8C A;  3DXB A;  2E7P A;  4DEJ A;  2H30 A;  2VM1 A;  3EWL A;  3IA1 A;  3FZ9 A;  3HKR A;  1E6B A;  1TU7 A;  3WT2 A;  1F9M A;  1BG1 A;  4AJ6 A;  3C71 A;  3C8E A;  2B5E A;  3EVI A;  2Z9S A;  1Y25 A;  4KCA A;  2DJ1 A;  2H75 A;  3UIW A;  3VPT A;  3GKM A;  2H01 A;  4POB A;  2KHP A;  1PX6 A;  4J2F A;  1XOA A;  3UBK A;  4JR4 A;  2AAW A;  1OC8 A;  2F9S A;  4BPY A;  4GF0 A;  1XWK A;  2V1M A;  4QMK A;  1HNC A;  2D2Z A;  3IV4 A;  1M0U A;  5IMZ A;  1ZYE A;  5ECN B;  1XW9 A;  3KCM A;  5F0G A;  1K0B A;  1X9W B;  3Q6O A;  2X4A A;  3MDK A;  5G5F A;  3W6G A;  1A8L A;  2VAF A;  4CW9 A;  2EFE A;  3F6D A;  1U3I A;  2KUC A;  3TGZ A;  1PGT A;  4EIP A;  2NDO A;  3GHA A;  1B8X A;  5DDL A;  2NVL A;  1KEB A;  5ECR B;  4OWY A;  3KTL A;  3UJ1 A;  2C8U A;  3ZZX A;  3ZML A;  5D8I A;  4AKX B;  2QC7 A;  4Z2U A;  1IYI A;  5INY A;  4TN8 A;  4EL1 A;  5IO2 A;  1MD3 A;  1GRX A;  1T3B A;  3IHQ A;  2ON5 A;  2FWF A;  4NXI A;  2YNX A;  5HR3 A;  1F3A A;  2MYG A;  3GV1 A;  5F07 A;  3ME7 A;  2H72 A;  4WR5 A;  1GTB A;  4MZB A;  4XS4 B;  1O85 A;  4G10 A;  4K7I A;  1V58 A;  1XBS A;  4ZIJ A;  2O5V A;  2R0G A;  2F3M A;  5FWG A;  4MA9 A;  1NHY A;  6GSS A;  1ZGN A;  4TW5 A;  2DSA A;  1TI3 A;  3H79 A;  2QSI A;  2DJK A;  3GKK A;  4I2U A;  2DC5 A;  3IBH A;  2ES7 A;  3M1G A;  1WE0 A;  5GSS A;  5IIZ A;  3GNJ A;  2C1Y A;  3GL3 A;  5J4U A;  4ICY A;  2EIQ A;  3A5I A;  4YKF A;  2HRK A;  1OKD A;  3UOM A;  1YKC A;  1SJZ A;  5A4W A;  3MAK A;  2OE1 A;  2PPT A;  1ZOF A;  1A2J A;  3JCM L;  4K2X A;  1GSF A;  4N10 A;  3IRA A;  1TDI A;  2YAN A;  5BMU B;  4PXO A;  4PTS A;  5J4V A;  4HJM A;  4KSO A;  2WUL A;  1PN9 A;  3SWL A;  1FG4 A;  3HXS A;  1N25 A;  1OC9 B;  3CRT A;  3IDV A;  4TR1 B;  1TK0 B;  5IMV A;  1S3D A;  3DEX A;  2VL2 A;  2R3X A;  3H8Q A;  3CBU A;  2VL9 A;  1BF5 A;  2UV8 G;  1JZD A;  2L59 A;  3EU3 A;  2WDU A;  1XFL A;  2LJK A;  3HJP A;  1W4V A;  1O8W A;  2FUG 2;  1SK0 A;  1O81 A;  1GNW A;  2LST A;  2EIR A;  2GQM A;  3H4K A;  2CV4 A;  2K6V A;  1AXD A;  2AYT A;  2BTO T;  2R2J A;  4K0N A;  1A0F A;  4MPF A;  1TOF A;  3APS A;  1EOG A;  2RM6 A;  3M8N A;  2AHE A;  3FYG A;  4PNF A;  3FK8 A;  2M72 A;  2LV3 A;  3DWV A;  3PGT A;  2LJR A;  2JAD A;  2L6D A;  3HA9 A;  5ENU A;  5DCH A;  1JHB A;  5B7C A;  1SEN A;  2YV7 A;  2MMN A;  4CY8 A;  1PX7 A;  1TTZ A;  2PVQ A;  5IMA A;  3VPQ A;  4CHS A;  1THX A;  2GSQ A;  3D5J A;  4HEA 2;  2MMZ A;  1QXH A;  3CXG A;  2H1B A;  3M9J A;  3UVH A;  1HQO A;  4ZIL A;  1PMT A;  5H5Q A;  2KP1 A;  2LRC A;  2R6K A;  3C1S A;  4ECB A;  3GSS A;  1R7H A;  4L8E A;  2CZ2 A;  4MH2 A;  1GUK A;  1GSQ A;  3FY7 A;  3W8S A;  4ZBD A;  4HJ2 A;  1HD2 A;  3IHG A;  4JBB A;  1FB0 A;  3FR9 A;  1USB A;  2ZUP A;  2C0F A;  4MAB A;  3ZIV A;  2B5X A;  5IMF A;  4AJ8 A;  4ML6 A;  6GST A;  1X5C A;  5A5K A;  5KN1 A;  2A2P A;  2OBI A;  3QR6 A;  5HFK A;  3HZ8 A;  2A4H A;  1BYE A;  2FLS A;  1CQG A;  2GSS A;  4I97 A;  3ZVJ D;  3DML A;  3D22 A;  3CWG A;  5IOW A;  5ABR A;  1A2M A;  2AV4 A;  2FWE A;  4YAV A;  2MMO A;  4QL7 A;  4D73 B;  3QD9 A;  4WF5 A;  3L4N A;  4AF2 A;  2V41 A;  1B4Q A;  4F0B A;  2LQO A;  4N0V A;  4USS A;  3SBC A;  4YQV A;  5B8A A;  2DJ0 A;  1K3O A;  1Y6E A;  2RM5 A;  3CYN A;  3HMJ G;  4BL7 A;  4Q5F A;  4XCS A;  5LD0 A;  2WGR A;  3ERW A;  3F63 A;  3VUR A;  4GLT A;  4NV5 A;  5D96 A;  1K3Y A;  5J3R A;  4IP1 A;  1O8X A;  5L71 A;  3QAW A;  2DML A;  1PD2 1;  1MEK A;  4KE3 A;  1OVN A;  4DSQ A;  3MWH A;  1Z7R A;  4RQR A;  1UA5 A;  1GSY A;  5ECH B;  1U88 A;  5DAK B;  4ECI A;  3M0F A;  2PWJ A;  3G7Y A;  4POL A;  4QQ7 A;  5D73 A;  1T1V A;  2IPA A;  4W66 A;  2DIY A;  1RK4 A;  2V6O A;  1MD4 A;  4EO3 A;  11GS A;  5HR0 A;  1VF1 A;  4LL1 B;  4KAE A;  2YP6 A;  3D6I A;  2K9F A;  3A3T A;  19GS A;  1H4O A;  1EV9 A;  3FHK A;  4F2I A;  2FWG A;  1SKS B;  4NPB A;  4MK3 A;  2DJ3 A;  2HSH A;  4K2D A;  2HI7 A;  2ALB A;  2FA8 A;  2WFC A;  4ILF A;  2FCH A;  2PU9 C;  1EP7 A;  1JZR A;  1MTC A;  2JZR A;  4OO5 A;  4KCE A;  1PKZ A;  5ECI B;  3HHV A;  2VL3 A;  4IGJ A;  2O85 A;  4EIQ A;  2LKU A;  3D21 A;  4NMU A;  3GTU B;  2QGV A;  3BOA A;  3KIJ A;  2YZU A;  2CQ9 A;  2PN8 A;  3IC8 A;  4KB3 A;  3GRX A;  1BED A;  2GLR A;  2FNO A;  1LU4 A;  3F4R A;  3GH6 A;  2WZ9 A;  2R37 A;  1RW1 A;  4XRA A;  2GGT A;  1EV4 A;  3S9F A;  4GRF A;  3EMP A;  2JZS A;  1TRV A;  3EIN A;  2HRF A;  2MMA A;  3F8U A;  4IN0 A;  3TRQ A;  1TJD A;  5CYY A;  6GSY A;  4PQI A;  3GA4 A;  4F03 A;  4XRD A;  1YEX A;  4EE0 A;  3FZA A;  3ME8 A;  3IK7 A;  5ELG A;  3CRU A;  4OFT A;  4LL4 B;  3VI7 A;  4FYC A;  2XC2 A;  1U3A A;  4RQX A;  1XVQ A;  1GLP A;  3GKN A;  1EWX A;  1X9S B;  1T7P B;  4QL9 A;  2LNT A;  2HZE B;  2RUF A;  3EUR A;  4GSN A;  5GAP D;  4ZB6 A;  5LNK e;  4HI7 A;  1ERT A;  1M2A A;  1TI1 A;  4AJ7 A;  4IP6 A;  3APQ A;  5ID2 A;  1JLW A;  3LXT A;  4TOP A;  2VD0 A;  1C72 A;  5DAL A;  1SD9 A;  1XWB A;  1Z5Y E;  3R2Q A;  6GSW A;  1R5P A;  1M9A A;  3NIV A;  2A4V A;  4MH3 A;  4WBR D;  4O5U A;  17GS A;  1M99 A;  5G30 A;  2HZF A;  4TR4 A;  2YZH A;  4L5O A;  4X43 A;  4N11 A;  4PUR A;  3RPP A;  4BWS A;  2LEG A;  2OE3 A;  3WT1 A;  3LSZ A;  2JAC A;  1O6J A;  4LLR A;  4E68 A;  3UAP A;  2WJU A;  3FZ4 A;  1ILO A;  1BG5 A;  2WS2 A;  3TU3 B;  3P8W A;  1IYH A;  1T8E B;  4LA1 A;  1EEM A;  1H75 A;  1DE2 A;  2YN1 A;  1ML6 A;  2LQQ A;  1TK5 B;  3QMX A;  1M7T A;  4K1F A;  3IAS 2;  1OKT A;  4EDY A;  3LYP A;  2H0I A;  3APO A;  1QK8 A;  3IPZ A;  1YF1 A;  1MDK A;  5JWR B;  1Z6N A;  5DVB A;  1ZYQ B;  1QMV A;  2LS5 A;  4ISD A;  1UN2 A;  4JE1 A;  5C00 A;  5E4W A;  2H19 A;  3EE2 A;  3I43 A;  4E8E A;  2IMD A;  1HNA A;  3ZLP A;  1JFU A;  4BVY B;  2H73 A;  2VCT A;  5A4V A;  4LMV A;  1PSQ A;  3HVV A;  5KN2 A;  1FVK A;  2OBK A;  1G0T A;  2NTO A;  4MP4 A;  2O8V B;  2IN3 A;  1GSE A;  4Z2R A;  3LJR A;  1ABA A;  2H1G A;  1FVJ A;  2YWN A;  3C1R A;  4JU5 A;  2DLX A;  1O7U A;  2B1L A;  2X8G A;  2I3Y A;  3EC3 A;  3PH9 A;  2BMX A;  3J7Y k;  4Q5R A;  3DKS A;  2C0E A;  3GFK A;  2A2S A;  4ZB8 A;  2MZC A;  1ZZY A;  3TKR A;  1X9M B;  2X99 A;  1BX9 A;  3A2V A;  3ZVJ A;  4WBJ A;  4TVE A;  3KD0 A;  4NHZ A;  1NSW A;  4IVF A;  2FGX A;  2MBS A;  1KNG A;  2JSZ A;  2K18 A;  1B9Y C;  2VCQ A;  2GTU A;  1W89 A;  2B1K A;  5A1N A;  2CVK A;  1AUC A;  4HQZ A;  4Q5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...