6GSUA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLAHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsuA01
2LS5A 3L0HA 1RK4A 4RI7A 2IL3A 2LRCA 3FZ4A 2XHFA 3GV1A 3IXRA 2HQTA 1ERVA 4ECBA 2BTOT 3BCKA 1XOBA 2PVOC 2JZSA 1GL8A 1V58A 4J57E 3GURA 3L9VA 4OMVA 3CYNA 2H8LA 1RW1A 1AC1A 2YCDA 4MABA 2VL9A 5CP1A 3MWHA 2I81A 5A4UA 2IFQB 2REMA 2HI7A 4K0NA 4KGIA 3C1RA 4L5LA 1XZOA 4IJ3A 3MAKA 2H19A 5IMAA 4IW9A 4IVFA 1THOA 4KAEA 1XWAA 4OFNA 3O3TA 2CT6A 3GIXA 2YV9A 1C72A 3E3EA 1O8WA 1HNBA 4I5QA 4GLTA 5A4VA 2B1KA 3DIEA 2H1GA 4MH2A 3LYPA 1X5DA 3VPQA 4BVYB 2C1YA 5DALB 1YEXA 2N5FA 1BYEA 2LNSA 3TRXA 4KF9A 4EE0A 2MZCA 5CAXA 1T8EB 3I6AA 2CVKA 4NHZA 3LQ7A 2K8VA 1J0FA 4QL7A 2O87A 3P90A 4MZCA 4ID0A 4XS4A 1NHYA 3U6VA 1XVQA 3IC8A 2C0GA 4FO5A 3UVHA 3ZFLA 1IYIA 1GP1A 1XW6A 4MJAA 2X8HA 3KH7A 3LORA 3RBTA 5IMFA 1JZRA 3D6IA 5DCGA 1WP0A 2WCIA 3ISOA 1NM3A 3TGZA 7GSSA 5HFKA 2FY6A 1AXDA 3LYKA 1WIKA 4D73A 3MDKA 1TRWA 3GYKA 2G0FA 1X5EA 5IIZA 1O85A 5BMUA 3FKFA 1Z5YE 2GSRA 4AJ7A 2MYGA 1E6BA 3GKXA 5EPFA 1O7UA 4ECJA 5JCGA 1T00A 1NW2A 2O7KA 2L59A 2F9SA 1GSYA 4KSOA 2MMAA 5JCUA 2PBJA 1SD9A 1XWGA 2R3XA 3GX0A 2DBCA 2TRCP 3W8SA 1K0BA 4KSMA 2LNTA 1QUWA 3L9UA 5JWOB 1A2JA 1FVJA 4JRRA 1GUKA 4OWYA 1OC8A 5F8BA 3HVSA 4Z7XA 4GTUA 3ZIJA 2AYTA 3F3QA 2H6YA 2HRNA 1WPIA 1PRXA 1AQWA 4MA9A 2VD0A 3VWVA 1K3OA 3FZAA 3KEBA 4G10A 2YZHA 3BJ5A 3SWLA 2M80A 1XW5A 2VIMA 2MBSA 2NVLA 3HDCA 1H75A 4K7NA 1F9MA 5E59A 1SKSB 5IOXA 4BL7B 1VRSD 3D4MA 1EZKA 2HSMA 2DJ1A 4HJ2A 3UBKA 2FUG2 4XCSA 13GSA 3WGDA 3LSZA 5F05A 4NHWA 2X8CA 4KH7A 2MMZA 1PQNA 1IYHA 2LTKA 4WF4A 2ES7A 14GSA 3ZL5A 1J9BA 2MMNA 1Q4JA 3F4SA 4KX4A 4TXVA 4L0UA 2QKEA 5EVOA 1MTCA 1FB6A 1HYUA 4OD7A 4MJEA 2CVBA 3HZ8A 1MDJA 4GF0A 3A2WA 2C3NA 3M8NA 1GUMA 1JZOA 2HSYA 4HU7A 4MH3A 3ZVJD 1AUCA 5DJMA 1BJXA 4PGTA 4DSSB 4KDYA 1CQGA 1HQOA 4ZB8A 4IP6A 3RHBA 4HU9A 5GZZB 2IN3A 1XW9A 20GSA 3VFIA 1G6YA 3CRTA 4PURA 4I8BA 1F3BA 2HSNB 3LJRA 1Z7PA 3TRQA 1F3AA 3IA1A 2V41A 3IK7A 4ACSA 3DKSA 4QQ7A 1G0TA 2C80A 5J9BA 4EF0A 3H8QA 2L4CA 3WYWA 1ZMAA 5E4WA 2DMMA 2G2QA 2JL4A 3LFLA 3G7JA 3C1SA 1B4PA 1VF2A 5JWRB 2CX4A 2FWHA 1PX7A 1XWBA 5ELGA 1Y25A 1ML6A 2OACA 1O8XA 3CSHA 1KEBA 3MSZA 3EVIA 4NV5A 1YKCA 4GWRA 1A23A 1Z9HA 4PNGA 1M99A 4CHSA 1QFNA 2CZ3A 3D0ZA 5IOWA 3S9FA 1O81A 3HJPA 2IMDA 1XCCA 3UVTA 2WDUA 3Q19A 2GT6A 2R5GA 3APSA 4MPGA 3CTFA 4TR4A 4ZL7A 2IJYA 4PQ1A 2LJAA 2K8SA 1OC9A 4JE1A 1FG4A 4K8MA 4K1FA 2KP1A 3QDNA 2JSYA 3UBLA 1S3CA 2H76A 2WS2A 1M2DA 5A4WA 4MF6A 4JZQA 3C7MA 2F51A 4O5RA 2KOKA 2O85A 2FWGA 4XTSA 4MF7A 2GZZA 5H5QA 3A2XA 4WXTA 4ZL8A 2VM2A 2P5RA 1FHEA 4OCEA 3ME8A 2AV4A 2WB9A 1U3AA 4POBA 3JCML 2ON7A 3UL3A 4PNFA 3EWLA 3A3TA 3G7YA 3I43A 1DUGA 3RPPA 1X9SB 1U3IA 5KN3A 22GSA 1THXA 4WR5A 3VURA 4K0GA 3W8JA 1GTIA 2NDOA 2WFCA 1NHOA 6GSWA 1GRXA 2LJKA 4PUAA 2B5YA 3HJOA 1TK8B 1SL0B 3GTUA 2B3SA 3KM6A 4GSSA 1TTZA 2H73A 1I5GA 5B6MA 2A2RA 3RHCA 4I6XA 1GSEA 2OE1A 1TW9A 2AJQB 4KCEA 2RM5A 2OE3A 3KIJA 4RQRA 2YWNA 3BOAA 4MJCA 4NXIA 4GCIA 5FT3A 4I97A 6GSXA 1BAYA 2LQOA 1TU7A 2JADA 1JLVA 4MPFA 5IMDA 2MBTA 2HFDA 3Q6OA 4EDZA 5IMVA 1A8LA 4ISDA 4H86A 1B9YC 3K8NA 3FYGA 1ZGNA 3QMXA 5ECPB 2VM1A 5CYYA 3GMFA 2HRKA 5J5NA 3FK8A 4K2DA 3ZLPA 4G0KA 1LBKA 2PPTA 4HUAA 4HEA2 1XXUA 2RLIA 2DJKA 2YN1A 3V1WA 4WBRD 2H66A 3UEMA 4TR1A 4F0CA 1T4YA 4BWQA 4XRAA 5HQPA 4ZILA 2V6KA 2DIZA 1Z6MA 5ENUA 1GNWA 3O76A 2XC2A 4JR6A 4HZ2A 1EP7A 2LEGA 1T1VA 4EUYA 3IK9A 2OJLA 4XS4B 4RQXA 2VCVA 2E7PA 1XOAA 2LUSA 1GSSA 2M46A 2L6CA 4BWSA 1K0CA 1KTEA 4AGSA 5AGYA 2H0GA 3WD6A 5ECQB 2ZCTA 1R4WA 3FHKA 3M0FA 2FHEA 1PA3A 4AJ6A 4JU5A 2YWIA 2JZTA 2FA8A 4IGJA 1SL1B 1GSFA 1AIUA 1K0AA 2E2GA 3FW2A 1B8XA 2IMKA 3WGXA 4YAPA 3QPMA 4EL1A 2KHPA 1JZDA 3D5JA 2XBQA 1XFLA 4DSQA 1PGTA 5ECRB 3IDVA 3E0UA 4TOPA 2JZRA 3D22A 3P8WA 1YY7A 2YWMA 4KUNA 3A2VA 1H4OA 2YWOA 2I1UA 4OFMA 2L5OA 1B4QA 3KMOA 1A8YA 1EEJA 1QXHA 4TXOB 3VPTA 1SKWB 4K7IA 2R6KA 1X9MB 5IPGA 5G5EA 3RPNA 1GNEA 4Q5FA 10GSA 1EV4A 2H71A 3TKSA 4F2IA 1OKDA 5ELAA 5D8IA 2DIYA 4XIHA 2E2MA 2N5BA 4V2LA 5C04A 1FAAA 5IM9A 5DDLA 3DRNA 1Z6NA 3DVWA 1MD3A 2DMLA 3F9UA 4POKA 5D9TA 2BJXA 4PUFC 4V1Ag 2C4JA 5KEJA 2GTUA 5KN1A 19GSA 2PU9C 1WWJA 4WETA 2IWTA 1MDIA 2LV3A 4FYBA 2GZPA 2ZNMA 2H1AA 2YP6A 3IPZA 4TRXA 1VGLA 4V2MA 1ABAA 2C0EA 5HFGA 2J23A 2P5QA 1A2LA 2H75A 4TN8A 1USBA 3LXTA 2OBKA 4NMUA 3APQA 5J41A 1T3BA 4KNDA 4G0IA 1SJ6A 1Z3EA 3KTBA 5ID2A 4GQFA 1N2AA 4NWYA 5B8AA 2HZEA 5CRGA 4EVMA 3KXOA 2PUKC 2IFQA 1HNCA 5IQYA 5DAKB 4XRDA 5LNKe 1SL2B 4MJBA 1OE7A 3EMPA 2D2ZA 4XS6A 2J9HA 1SJZA 3R2QA 1YF0A 4KDUA 4PX1A 4BVXA 2H0IA 4O32A 1V2AA 3TKPA 4K6XA 3ZMKA 4G2EA 4DVCA 2OBIA 2H70A 2F8AA 3GRXA 2HNLA 3VLNA 4IHUA 1FO5A 4LMWA 5GSSA 3ZIVA 2VLVA 1ILOA 3QAGA 1SJIA 3TKSC 5DALA 1W4VA 1PMTA 3GFKA 5L71A 1EGOA 5D73A 2FNOA 2V1MA 4ZBDA 4KB3A 2CX3A 18GSA 3H79A 2YJHA 3KGKA 1M0UA 1GWCA 5DJLA 4O7HA 5F0GA 1ERUA 2ZUPA 1DE2A 2PMTA 6GSVA 1OC3A 8GSSA 3QAWA 2IIYA 3KCMA 4I2TA 4GXZA 1X5CA 4Q5QA 2EC4A 3FY7A 2V6OA 3FR3A 3I9V2 3NIVA 1I9DA 4KE3A 5GAND 4AF2A 5G2ZA 5ECSA 2YZUA 5DQYA 4N10A 2WZ9A 1CQHA 3IHQA 5ABRA 4HQZA 3KD0A 5JWQB 3QCPA 1EP8A 3J7Yb 5IMCA 2YPMA 2MMOA 3KP9A 4BPYA 1XWCA 1WOUA 2GQKA 1QMVA 2X64A 1R5PA 1SK1A 1TJDA 2KP2A 1TOFA 2WULA 4ZBBA 1K0MA 2K9FA 1ON4A 2LQQA 3ERGA 3FRCA 6GSSA 3KJYA 1XVWA 3GL3A 6GSTA 2YOIA 3QR6A 3HJMA 1SK0A 3GKKA 2VL2C 3ZVJA 1PD21 1G6WA 1GSUA 1GTAA 1GLQA 2OKAA 2YJ7A 1M2AA 1R26A 4JR4A 5COHA 1FB0A 3EINA 4POLA 4MMMA 3GTUB 2VCQA 5AIVA 1R7HA 3TJKA 4IQ1A 1YEPA 2X8GA 3TJFA 2LKUA 5IMZA 4FH8A 4FIWA 3EU4A 1TDIA 4BL7A 4KA0A 17GSA 3ZMLA 4J2FA 1S3DA 3D21A 2NPBA 3ERFA 2GQLA 4ML6A 2YNXA 4CW9A 3GH6A 4XS1A 2R4VA 2C3QA 5DQSA 1XPVA 3ZFBA 1YZXA 2NBSA 1ST9A 5KN2A 1V98A 2VCTA 4ECCA 4LL1B 3F63A 1JFUA 2HRFA 2VO4A 2JU5A 4BA7A 2V32A 3RAZA 3ZRDA 2IPAA 2OA7A 2OE0A 1LU4A 4DSRA 3DXBA 3LG6A 5FWGA 4HDEA 1ZYEA 5INYA 5AIXA 4TR1B 1K3LA 4HI7A 5CREA 3IAS2 3GL5A 4TVEA 4DSSA 3KTLA 3F4TA 3QOUA 2TIRA 4EO3A 1EEMA 4X43A 5G1LA 4EC0A 3G7IA 3C71A 1A0RP 4YH2A 4MZWA 2WGRA 2YANA 3VWXA 4GSNA 1FW1A 3TCOA 5CRDA 1BX9A 1A24A 2PN8A 2P31A 1HNAA 4HS1A 5IO0A 2IMEA 2H6XA 3QFBC 2GT5A 3L4NA 5B8BA 2H74A 3MNGA 5H5SA 3HA9A 1PL2A 4KW6A 1BG5A 1MD4A 1ZCPA 3HHVA 1WMJA 3GNJA 4IN0A 3C8EA 5FHIA 2B7JA 1JZWA 4ULXA 1QQ2A 2H1BA 3FZ9A 4G0LA 3P7XA 1MEKA 5D9XA 2O8VB 3KP8A 2VCXA 1T4ZA 4XHMA 2A2SA 3TKSE 5B6NA 3TUEA 1UN2A 3PINA 4FYCA 5F06A 1EWXA 1K3YA 5DBQA 3ME7A 3DGQA 2FGXA 5HR0A 1G7OA 4ZBAA 5C00A 5EY6A 1TRUA 2GGTA 3TKRA 4WBJA 2GS3A 1Z7RA 3OR5A 3KMNA 3M1GA 3CBUA 4L8EA 2R2JA 3J7Yk 5HFIA 2AAWA 4MK3A 2R37A 2V2GA 2B1LA 3CSJA 5HR1A 3TJGA 1YDKA 2YV7A 2RUEA 1UA5A 3C73A 3VI5A 2AUVA 2I3YA 3DEXA 3KH9A 2DLXA 3EU3A 2OADA 2PERA 3BBYA 1F37A 4LL4B 4LMVA 3E9JB 2K18A 5B7CA 2C0DA 1XIYA 1TK0B 4F9ZA 5G5FA 4N11A 3LGCA 1T7PB 3NZNA 2QGVA 1EGRA 3IR4A 5AN1A 1TXXA 2L5LA 2FWFA 3HZ4A 1PL1A 5ECNB 2HXKA 3DD3A 1X9WB 2QC7A 3BD2A 1TRSA 1AAZA 3CMIA 4D73B 2VOCA 3US3A 3ZTLA 1WE0A 4K9ZA 1VF3A 4EDYA 1SK2A 3M9JA 5G31A 1N8JA 5F07A 3G9BA 2HYXA 3R3EA 2DJ0A 5ID2B 1VF1A 2PGTA 3UAPA 4N30A 2EIOA 4Q5RA 1WRYA 2HT9A 2HZEB 4MCUA 1JLWA 3IE3A 4QL9A 3GN3A 2KUCA 3TJJA 4BVXB 1AQVA 2K6VA 3DMLA 1PX6A 2C8UA 2UZ8A 2QSIA 4N0ZA 3M9KA 4TR3A 2F3MA 5A5KA 3BCIA 1M9BA 4I2UA 1DSBA 2DSAA 3ERWA 5J3RA 3PR8A 1TRVA 2C3TA 1E2YA 2RIIA 5LD0A 3O6TA 3F4RA 3HXSA 2HSMB 1TI3A 3HD5A 2IMFA 2DJJA 4ZL9A 4X1UA 4ZIJA 4YQVA 1EOHA 3F0IA 2IMIA 4MP4A 3HYPA 5G1KA 4EXJA 4DEJA 1TU8A 2FLSA 3IC4A 1PN9A 1V9WA 1GSQA 3IRAA 1GH2A 4J56E 2GZYA 3ZZXA 4USSA 3LWAA 3CXGA 3EYTA 3HY2A 2KLXA 2VLTA 1HD2A 2XPDA 4ZB6A 1YKAA 2CAIA 5LCZA 3UIWA 2HSHA 4GRFA 4PXOA 3VK9A 1FOVA 2FD3A 5J4UA 5ECIB 9GSSA 3VI7A 4OFTA 2CV4A 4ILFA 5G30A 1QK8A 5HR2A 3QAVA 4Q5NA 3HVVA 2HRAA 4G9HA 3H1NA 3L78A 2VUPA 1KNGA 5D9VA 1Q98A 4WF5A 2VL2A 1OAZA 3RDWA 3IAM2 4NPBA 3N9JA 3GSTA 3TRPA 1GTUA 3TDGA 1ZL9A 1U88A 2RM6A 2GSTA 4MF5A 1F2EA 1PKWA 1SYRA 1U87A 2AB6A 3UJ1A 4F82A 4X0XA 2VCZA 2XPEA 1M2BA 4IS0A 4YQMA 1GULA 1YF1A 3F6FA 1DE1A 4OO5A 4G19A 4TXOA 4HZ4A 4HQSA 2VCWA 2JACA 4V2NA 4BVYA 1TKDB 4L0WA 3IOSA 2XBIA 5CRWA 2GQMA 2FCHA 3IBHA 4OO4A 5JCWA 2FA4A 3VWUA 3LEFA 1GLPA 2M72A 3WT2A 3GUSA 2B5XA 1F6MC 3I69A 1XWKA 2C0FA 2GSQA 4F0BA 4IJIA 4MDCA 5GSTA 4P3YB 3HCZA 5D96A 4POMA 3UOMA 4KCAA 3CRUA 1ZOFA 1BEDA 1AW9A 3Q74A 1M7TA 2GLRA 5ECKB 1OC9B 1GUHA 5DCHA 4CDOA 3EURA 1KBNA 2CVDA 4IKHA 3GKNA 2WJUA 4YAVA 5HR3A 3H4KA 2H1DA 1SKRB 3Q18A 4ML1A 4PQIA 5IO2A 3P2AA 3U5RE 1JHBA 6GSUA 2VD1A 2VAFA 1QGVA 1TK5B 1ACVA 3DWVA 1K0DA 3FZ5A 2CAQA 1OKTA 3F6DA 4MZBA 5DAKA 3HVXA 3WGEA 3CTGA 1OE8A 2CA8A 2Z9SA 3PGTA 4IBPA 1URMA 3FR6A 2FWEA 2TRXA 3HKRA 3GH9A 2DC5A 3KZQA 2L4QA 2GSSA 2HLSA 4AJ8A 3ZREA 1B9XC 4LLRA 3H93A 1Y6EA 3QFAC 3WT1A 2X99A 4YQUA 1OVNA 4HOJA 1J08A 16GSA 2VL3A 3ED3A 1UVZA 2ON5A 4E8EA 2L57A 4TKYA 3ZITA 4ECIA 4IELA 4TW5A 2LJRA 3PPUA 2N5AA 3M3MA 2WRTA 1O73A 1BQ7A 3TB2A 4WKWA 1PSQA 4ZXGA 2AHEA 4GSTA 1B48A 2CZ2A 2PWJA 1ERTA 2B5EA 4K7OA 1V40A 1SYXA 4IP1A 2HRKB 3F8UA 2CQ9A 1GTBA 2GVPA 1OYJA 1TP9A 2F8FA 1U6TA 1ZYQB 4TR0A 1S3AA 3EE2A 1UC7A 2NTOA 1MDKA 3DVXA 3GHAA 1WJKA 1W89A 5CRHA 1A0FA 12GSA 3FEUA 2JSZA 3D4TA 1R5AA 5GAPD 4FYUA 1VF4A 2L6DA 2ALBA 3TKQA 1EOGA 5D9WA 4ZB9A 1SENA 3EMXA 2LSTA 4E8HA 5ECOB 2H6ZA 1TI1A 1EV9A 5KN0A 3APOA 1RQMA 1FVKA 4N0VA 5H5RA 11GSA 2B7KA 4WEYA 3GSSA 1M9AA 1NSWA 1O6JA 3LXZA 3GA4A 3TOTA 4LA1A 1GSDA 5D93A 5J9CA 5CNWA 2EIRA 4EKZA 4JBBA 3IV4A 4MLYA 4NAXA 2H72A 3AY8A 4NV2A 1ZZYA 2BMXA 1SU9A 3DYRA 3FR9A 2RUFA 6GSYA 3PH9A 2PVQA 4V1Ap 4L5OA 2HE3A 4WR4A 1XBSA 3TOUA 2VLUA 1YJ6A 1K0OA 4GQCA 3UMAA 4IQAA 3EC3A 3UARA 1X0RA 3GKMA 5ECHB 1PKZA 3TJBA 2EIQA 4PTSA 1DBYA 2I4AA 5ECMB 4HJMA 2H30A 4F03A 2A4VA 1LJRA 2H0HA 4RI6A 1ERWA 4OCFA 3VWWA 2LRTA 1G7EA 1AQXA 3GX8A 3ZYWA 3SBCA 1K0NA 3CSIA 1V57A 4O92A 5EL8A 2E0QA 5IPHA 3F3RA 2I9HA 2O89A 2B6MA 3QD9A 4FQUA 3A5WA 4KDXA 2H01A 2DJ3A 1YQ1A 2HZFA 2P0GA 4JEDA 4RUVA 3N5OA 2LRNA 1A2MA 3L9SA 4PQHA 1SD8A 3NOFA 3W6GA 2DJ2A 5CO3A 5ECLB 2GDRA 5AISA 5DVBA
chains in the Genus database with same CATH superfamily
2LS5A 3L0HA 1RK4A 4RI7A 2IL3A 2LRCA 3FZ4A 2XHFA 3GV1A 3IXRA 2HQTA 1ERVA 4ECBA 2BTOT 3BCKA 1XOBA 1BF5A 2PVOC 2JZSA 2EFHA 1GL8A 1V58A 4J57E 3GURA 3L9VA 4K5SA 4OMVA 1SVLA 3CYNA 2H8LA 1RW1A 1AC1A 2YCDA 4MABA 2WW2A 2VL9A 5CP1A 3MWHA 2I81A 5A4UA 4E68A 2IFQB 2REMA 2VKZG 2HI7A 4K0NA 4KGIA 3C1RA 4L5LA 1XZOA 4IJ3A 5BRTA 3MAKA 2H19A 5IMAA 4IW9A 4IVFA 1THOA 4KAEA 1XWAA 4OFNA 4CY8A 3O3TA 2CT6A 3GIXA 2YV9A 1C72A 3E3EA 1O8WA 1HNBA 4I5QA 4GLTA 5A4VA 2B1KA 3DIEA 2H1GA 4MH2A 3LYPA 1X5DA 3VPQA 4BVYB 2C1YA 5DALB 1YEXA 2N5FA 1BYEA 2LNSA 3TRXA 4KF9A 4EE0A 2MZCA 5CAXA 1T8EB 4Z2UA 3I6AA 2CVKA 4NHZA 3LQ7A 2K8VA 1J0FA 4QL7A 2O87A 3P90A 4MZCA 4ID0A 4XS4A 1NHYA 3U6VA 1XVQA 3IC8A 2C0GA 4AKXB 4FO5A 3UVHA 3ZFLA 1IYIA 1GP1A 1XW6A 4MJAA 2X8HA 3KH7A 4K2XA 3LORA 3RBTA 5IMFA 1JZRA 3D6IA 5DCGA 3LW9A 1WP0A 2WCIA 3ISOA 1NM3A 3TGZA 7GSSA 5HFKA 4AKGA 2FY6A 1AXDA 3LYKA 1WIKA 4D73A 3MDKA 1TRWA 3GYKA 2G0FA 1X5EA 5IIZA 1O85A 5BMUA 3FKFA 1Z5YE 2GSRA 4AJ7A 2MYGA 1E6BA 3GKXA 5EPFA 1O7UA 4ECJA 5JCGA 1T00A 1NW2A 2O7KA 2L59A 2F9SA 1GSYA 4KSOA 2MMAA 5JCUA 2PBJA 1SD9A 1XWGA 5J47A 2R3XA 3GX0A 2DBCA 2TRCP 3W8SA 1K0BA 4KSMA 2LNTA 1QUWA 3L9UA 5JWOB 1A2JA 1FVJA 4JRRA 1GUKA 4OWYA 1OC8A 5F8BA 3HVSA 4Z7XA 4GTUA 3ZIJA 2AYTA 3F3QA 2H6YA 2HRNA 1WPIA 4O5QA 1PRXA 1AQWA 4MA9A 2VD0A 3VWVA 1K3OA 3FZAA 2EFDA 3KEBA 4G10A 2DKIA 4AKIA 2YZHA 3BJ5A 3SWLA 2M80A 1XW5A 2VIMA 2MBSA 2NVLA 3HDCA 1H75A 4K7NA 1F9MA 5E59A 1SKSB 5IOXA 4G01A 4BL7B 1VRSD 3D4MA 1EZKA 2HSMA 2DJ1A 4HJ2A 3UBKA 5A5HA 2FUG2 4XCSA 13GSA 3WGDA 3LSZA 5F05A 4NHWA 2X8CA 4KH7A 2MMZA 1PQNA 1IYHA 2LTKA 4WF4A 2ES7A 14GSA 3ZL5A 1J9BA 2MMNA 1Q4JA 4PI2C 3F4SA 4KX4A 4TXVA 4L0UA 2QKEA 5EVOA 1MTCA 1FB6A 4QMKA 1HYUA 4OD7A 4MJEA 2CVBA 3HZ8A 1MDJA 4GF0A 3A2WA 2C3NA 3M8NA 1GUMA 1JZOA 2HSYA 4HU7A 4MH3A 3ZVJD 1AUCA 5DJMA 2A4HA 1BJXA 4PGTA 4DSSB 4KDYA 1CQGA 1HQOA 4ZB8A 4IP6A 3RHBA 4HU9A 5GZZB 2IN3A 1XW9A 20GSA 3VFIA 1G6YA 3FMWA 4Z2RA 3CRTA 4PURA 4I8BA 1F3BA 2HSNB 3LJRA 1Z7PA 3TRQA 1F3AA 3IA1A 2V41A 3IK7A 2WVZA 4ACSA 3DKSA 4QQ7A 1G0TA 2C80A 5J9BA 4EF0A 3H8QA 2L4CA 3WYWA 1ZMAA 5E4WA 2DMMA 2G2QA 2JL4A 3LFLA 3G7JA 3C1SA 1B4PA 1VF2A 5JWRB 2CX4A 2FWHA 1PX7A 1XWBA 5ELGA 1Y25A 1ML6A 2OACA 1O8XA 3CSHA 1KEBA 3MSZA 3EVIA 4NV5A 1YKCA 4GWRA 1A23A 1Z9HA 4PNGA 4ZB7A 2O3EA 1M99A 4CHSA 1QFNA 2CZ3A 3D0ZA 5IOWA 3S9FA 1O81A 3HJPA 2IMDA 1XCCA 1S3RA 3UVTA 2WDUA 3Q19A 2GT6A 2R5GA 3APSA 4EIQA 4MPGA 3CTFA 4TR4A 4ZL7A 2IJYA 4PQ1A 4ICYA 2LJAA 2K8SA 1OC9A 4JE1A 1FG4A 4K8MA 4K1FA 2KP1A 3QDNA 2JSYA 3UBLA 1S3CA 2H76A 2WS2A 1M2DA 5A4WA 4MF6A 4JZQA 3C7MA 2F51A 4O5RA 2KOKA 2O85A 2FWGA 3CHXC 4XTSA 4MF7A 2GZZA 5H5QA 3A2XA 4WXTA 4ZL8A 2VM2A 2P5RA 1FHEA 4OCEA 3ME8A 2AV4A 2WB9A 1U3AA 4AKHA 4POBA 2ON7A 3JCML 4PNFA 3EWLA 3A3TA 3G7YA 3UL3A 3I43A 1DUGA 1YVLA 3RPPA 4N3ZA 1X9SB 1U3IA 5KN3A 22GSA 1THXA 4WR5A 1SVMA 3VURA 4K0GA 3W8JA 1GTIA 2NDOA 2WFCA 1NHOA 6GSWA 1GRXA 2LJKA 4PUAA 2B5YA 3HJOA 1TK8B 1SL0B 3GTUA 2B3SA 3KM6A 4GSSA 1TTZA 2H73A 1I5GA 5B6MA 2A2RA 3RHCA 4I6XA 1GSEA 2EFCA 2OE1A 1TW9A 2AJQB 4KCEA 2RM5A 2OE3A 3KIJA 4RQRA 2YWNA 3BOAA 4MJCA 4NXIA 4GCIA 5FT3A 4I97A 6GSXA 1BAYA 2LQOA 1S4BP 1TU7A 2JADA 1JLVA 4MPFA 5IMDA 2MBTA 2HFDA 3Q6OA 4EDZA 5IMVA 1A8LA 4ISDA 1FOHA 4H86A 1B9YC 3K8NA 3FYGA 1ZGNA 3QMXA 5KOWA 5ECPB 2VM1A 5CYYA 3GMFA 2HRKA 5J5NA 3FK8A 4K2DA 3ZLPA 4G0KA 1LBKA 2PPTA 4HUAA 4HEA2 1XXUA 2RLIA 2DJKA 2YN1A 3V1WA 4WBRD 4Z2TA 2H66A 3UEMA 4TR1A 4F0CA 1T4YA 4BWQA 4XRAA 5HQPA 4ZILA 2V6KA 2DIZA 1Z6MA 5ENUA 1GNWA 3O76A 2XC2A 4JR6A 4HZ2A 1EP7A 2LEGA 1T1VA 4EUYA 3IK9A 2OJLA 4XS4B 4RQXA 2VCVA 2E7PA 1XOAA 2LUSA 1GSSA 2M46A 2L6CA 4BWSA 1K0CA 1KTEA 4AGSA 5AGYA 2H0GA 3WD6A 5ECQB 2ZCTA 1R4WA 3FHKA 3M0FA 2FHEA 1PA3A 4AJ6A 4JU5A 2YWIA 2JZTA 2FA8A 4IGJA 1SL1B 1GSFA 1AIUA 4YKGA 1K0AA 2E2GA 3FW2A 1B8XA 2IMKA 3WGXA 4YAPA 3QPMA 4EL1A 2KHPA 1JZDA 3D5JA 2XBQA 1XFLA 4DSQA 1PGTA 5ECRB 3IDVA 3E0UA 4TOPA 2JZRA 3RFRC 3D22A 3P8WA 1YY7A 2YWMA 4KUNA 3A2VA 1H4OA 2YWOA 4MNNA 2I1UA 4OFMA 2L5OA 1B4QA 3KMOA 2H1LA 1A8YA 1EEJA 1QXHA 4TXOB 3VPTA 1SKWB 4K7IA 2R6KA 1X9MB 5IPGA 5G5EA 3RPNA 1GNEA 4Q5FA 10GSA 1EV4A 2H71A 3TKSA 4F2IA 1OKDA 5ELAA 5D8IA 2DIYA 4XIHA 2E2MA 2N5BA 4V2LA 5C04A 1FAAA 5IM9A 5DDLA 3DRNA 1Z6NA 3DVWA 1MD3A 2DMLA 3F9UA 4POKA 5D9TA 2BJXA 4PUFC 4V1Ag 2C4JA 5KEJA 2GTUA 5A1NA 3EPTA 5KN1A 19GSA 2PU9C 1WWJA 5J40A 4WETA 2IWTA 1MDIA 3HVNA 2LV3A 4FYBA 2GZPA 2ZNMA 1N25A 2H1AA 2YP6A 3IPZA 4TRXA 1VGLA 4V2MA 1ABAA 2C0EA 5HFGA 2J23A 2P5QA 1A2LA 2H75A 4TN8A 1USBA 3LXTA 2OBKA 4NMUA 3APQA 5J41A 1T3BA 4KNDA 4G0IA 1SJ6A 1Z3EA 3KTBA 5ID2A 4GQFA 1N2AA 4NWYA 5B8AA 2HZEA 5CRGA 4EVMA 3KXOA 2PUKC 2IFQA 1HNCA 5IQYA 5DAKB 4XRDA 5LNKe 1SL2B 4MJBA 1OE7A 3EMPA 2D2ZA 4XS6A 2J9HA 1SJZA 4X4JA 3R2QA 1YF0A 4KDUA 4PX1A 4BVXA 2H0IA 1ZYNA 1Y1UA 4O32A 1V2AA 3TKPA 3ZMKA 4K6XA 4G2EA 4DVCA 2OBIA 2H70A 2F8AA 3GRXA 2HNLA 3VLNA 4IHUA 1FO5A 4LMWA 4BIKA 5GSSA 3ZIVA 2VLVA 1ILOA 3QAGA 1SJIA 3TKSC 5DALA 1W4VA 3CQFA 1PMTA 3GFKA 5L71A 1EGOA 5D73A 2FNOA 2V1MA 4CY6A 4ZBDA 4KB3A 2CX3A 18GSA 3H79A 2YJHA 3KGKA 1M0UA 4PHZC 1GWCA 5DJLA 4O7HA 5F0GA 1ERUA 2ZUPA 1DE2A 2PMTA 6GSVA 1OC3A 8GSSA 3QAWA 2IIYA 3KCMA 4I2TA 4GXZA 1X5CA 4Q5QA 2EC4A 3FY7A 2V6OA 3FR3A 3I9V2 3NIVA 1I9DA 4KE3A 5GAND 4AF2A 5G2ZA 5ECSA 2YZUA 5A34B 5DQYA 4N10A 2WZ9A 1CQHA 1M3JA 4O5UA 3IHQA 5ABRA 4HQZA 3KD0A 5JWQB 1EP8A 3QCPA 3J7Yb 5IMCA 2YPMA 2MMOA 3KP9A 4BPYA 2WW0A 1XWCA 1WOUA 2GQKA 1QMVA 2X64A 1R5PA 1SK1A 1TJDA 2KP2A 1TOFA 2WULA 4ZBBA 1K0MA 2K9FA 1ON4A 2LQQA 3ERGA 3FRCA 6GSSA 3KJYA 1XVWA 3GL3A 6GSTA 4GDFA 2YOIA 3QR6A 3HJMA 1SK0A 3GKKA 2VL2C 3ZVJA 1PD21 1G6WA 1GSUA 1GTAA 1GLQA 2OKAA 2YJ7A 1M2AA 1R26A 4JR4A 5COHA 1FB0A 3EINA 4PI0C 4POLA 1TXUA 4MMMA 3GTUB 2VCQA 5AIVA 1R7HA 3TJKA 4IQ1A 1YEPA 2X8GA 3TJFA 2LKUA 5IMZA 4FH8A 4FIWA 3EU4A 1TDIA 4BL7A 4KA0A 17GSA 3ZMLA 4J2FA 1S3DA 3D21A 2NPBA 3ERFA 2GQLA 4ML6A 2YNXA 4CW9A 3GH6A 4XS1A 2R4VA 2C3QA 5DQSA 1XPVA 1XG8A 3ZFBA 1YZXA 2NBSA 1ST9A 5KN2A 1V98A 2VCTA 4ECCA 4LL1B 3F63A 2O36A 1JFUA 2HRFA 2VO4A 2JU5A 4BA7A 2V32A 3RAZA 3ZRDA 2WW3A 2IPAA 2OA7A 2OE0A 1LU4A 4DSRA 3DXBA 3LG6A 5FWGA 4HDEA 1ZYEA 5INYA 5AIXA 2EFEA 4TR1B 1K3LA 4HI7A 5CREA 3IAS2 3GL5A 1M3IA 4TVEA 4DSSA 3KTLA 3F4TA 3QOUA 2TIRA 4EO3A 1EEMA 4X43A 5G1LA 4EC0A 3G7IA 4EIPA 3C71A 2HSNA 1A0RP 4YH2A 2A2PA 4MZWA 2WGRA 2YANA 3VWXA 4GSNA 1FW1A 3TCOA 5CRDA 1BX9A 1A24A 2PN8A 2P31A 1HNAA 4HS1A 5IO0A 2IMEA 2H6XA 3QFBC 2GT5A 3L4NA 5B8BA 2H74A 3MNGA 4W66A 5H5SA 3HA9A 1PL2A 4KW6A 1BG5A 3HMJG 2WZSA 1MD4A 1ZCPA 3HHVA 2WVXA 1WMJA 3GNJA 4IN0A 3C8EA 5FHIA 2B7JA 1SVOA 1JZWA 4ULXA 1QQ2A 2H1BA 3FZ9A 4G0LA 3P7XA 1MEKA 5D9XA 2O8VB 3KP8A 2VCXA 1T4ZA 4XHMA 2A2SA 3TKSE 5B6NA 3TUEA 1UN2A 3PINA 4FYCA 5F06A 1EWXA 1K3YA 5DBQA 3ME7A 3DGQA 2FGXA 5HR0A 1G7OA 4ZBAA 5C00A 5EY6A 1TRUA 2GGTA 3TKRA 4WBJA 2GS3A 1Z7RA 3OR5A 3KMNA 3M1GA 3CBUA 4L8EA 2R2JA 3J7Yk 5HFIA 2AAWA 4YKFA 4MK3A 2R37A 2V2GA 2B1LA 3CSJA 5HR1A 3TJGA 1YDKA 2YV7A 2RUEA 1UA5A 3C73A 3VI5A 2AUVA 2I3YA 3DEXA 3KH9A 2DLXA 3EU3A 2OADA 2PERA 3BBYA 1F37A 4LL4B 4LMVA 3E9JB 2K18A 5B7CA 2C0DA 1XIYA 1TK0B 4F9ZA 5G5FA 4N11A 3LGCA 1T7PB 3NZNA 2QGVA 4A5PA 1EGRA 3IR4A 5AN1A 1TXXA 2L5LA 2FWFA 3HZ4A 1PL1A 5ECNB 2HXKA 3DD3A 1X9WB 2QC7A 3BD2A 1TRSA 1AAZA 3MIXA 3CMIA 4D73B 2VOCA 3US3A 3ZTLA 1WE0A 5BMUB 4K9ZA 1VF3A 4EDYA 1SK2A 3M9JA 5G31A 1N8JA 5F07A 3G9BA 2HYXA 3R3EA 2DJ0A 5ID2B 1VF1A 2PGTA 3UAPA 4N30A 2EIOA 4Q5RA 1WRYA 2HT9A 2HZEB 4MCUA 4AI6A 2WW1A 1JLWA 3IE3A 2OT3A 4QL9A 3GN3A 2KUCA 3TJJA 4BVXB 1AQVA 2K6VA 3DMLA 1PX6A 2C8UA 2UZ8A 2QSIA 4N0ZA 1PFOA 3M9KA 4TR3A 2F3MA 5A5KA 3BCIA 1M9BA 4I2UA 1DSBA 2DSAA 3ERWA 5J3RA 3PR8A 1TRVA 2C3TA 1E2YA 2RIIA 5LD0A 3O6TA 3F4RA 3HXSA 2HSMB 1TI3A 5A5HB 3HD5A 3CWGA 2IMFA 2DJJA 4ZL9A 2UV8G 4X1UA 4ZIJA 4YQVA 1EOHA 3F0IA 2IMIA 4MP4A 3A5IA 3HYPA 5G1KA 4EXJA 4DEJA 1TU8A 2FLSA 3IC4A 1PN0A 1PN9A 1V9WA 1GSQA 3IRAA 1GH2A 4J56E 2GZYA 3ZZXA 4USSA 3LWAA 3CXGA 3EYTA 3HY2A 2KLXA 2VLTA 3TU3B 1HD2A 2XPDA 4ZB6A 1YKAA 2CAIA 5LCZA 3UIWA 2HSHA 4GRFA 4PXOA 3VK9A 1FOVA 2FD3A 5J4UA 5ECIB 2QA1A 9GSSA 3VI7A 4OFTA 2CV4A 2X49A 4ILFA 5G30A 1QK8A 5HR2A 3QAVA 4Q5NA 3HVVA 2HRAA 4G9HA 3H1NA 3L78A 2VUPA 1KNGA 5D9VA 1Q98A 4WF5A 2VL2A 1OAZA 3RDWA 3IAM2 4NPBA 3N9JA 3GSTA 3TRPA 1GTUA 3TDGA 1ZL9A 1U88A 2RM6A 2GSTA 4FXYP 1F2EA 1PKWA 4MF5A 1SYRA 1U87A 2AB6A 3UJ1A 4F82A 4X0XA 2VCZA 2XPEA 1M2BA 4IS0A 4YQMA 1GULA 1YF1A 3F6FA 1DE1A 4OO5A 4G19A 4TXOA 4HZ4A 4HQSA 2VCWA 2JACA 4V2NA 4BVYA 1TKDB 4L0WA 3IOSA 2XBIA 2DKHA 5CRWA 2GQMA 2FCHA 3IBHA 4OO4A 5J4YA 5JCWA 2FA4A 3VWUA 3LEFA 1GLPA 2M72A 3WT2A 3GUSA 2B5XA 1F6MC 3I69A 1XWKA 2C0FA 2R0PA 2GSQA 4F0BA 4IJIA 4MDCA 5GSTA 3IHGA 4P3YB 3HCZA 5D96A 4POMA 3UOMA 4KCAA 3CRUA 1ZOFA 1BEDA 1AW9A 3Q74A 1M7TA 2GLRA 5ECKB 1OC9B 1GUHA 5DCHA 4CDOA 3EURA 1KBNA 2CVDA 4IKHA 3GKNA 2WJUA 3MYDA 2O5VA 4YAVA 5HR3A 3H4KA 2H1DA 1SKRB 3Q18A 4ML1A 4PQIA 5IO2A 5KOXA 3P2AA 3U5RE 1JHBA 6GSUA 2VD1A 2VAFA 1QGVA 1TK5B 1ACVA 3DWVA 1K0DA 3FZ5A 2CAQA 1OKTA 3F6DA 4MZBA 2WVYA 5DAKA 3HVXA 3WGEA 3CTGA 1OE8A 2CA8A 2Z9SA 3PGTA 4IBPA 1URMA 3FR6A 2FWEA 2TRXA 3HKRA 3GH9A 2DC5A 2QA2A 3KZQA 2L4QA 2GSSA 2HLSA 4AJ8A 3ZREA 1B9XC 4LLRA 3H93A 4HSCX 1Y6EA 3QFAC 3WT1A 2X99A 4YQUA 1OVNA 4HOJA 1J08A 16GSA 2VL3A 3ED3A 2WVXB 1UVZA 1ZYPA 2ON5A 4E8EA 2L57A 4TKYA 3ZITA 4ECIA 4IELA 4TW5A 2LJRA 3PPUA 2N5AA 3M3MA 2WRTA 1O73A 1BQ7A 3TB2A 4WKWA 1PSQA 4ZXGA 2AHEA 4GSTA 1B48A 2CZ2A 2PWJA 1ERTA 2B5EA 4K7OA 1V40A 1SYXA 4IP1A 2HRKB 3F8UA 2CQ9A 1GTBA 2GVPA 1OYJA 1TP9A 2F8FA 1U6TA 1ZYQB 4TR0A 1S3AA 3EE2A 1UC7A 2NTOA 5A34A 1MDKA 3DVXA 3GHAA 5J4VA 1WJKA 1W89A 5CRHA 1A0FA 12GSA 3FEUA 2JSZA 3D4TA 1R5AA 5GAPD 4FYUA 1VF4A 2L6DA 2ALBA 3TKQA 1EOGA 5D9WA 4ZB9A 1SENA 3EMXA 2LSTA 4E8HA 5ECOB 2H6ZA 3RGBC 1TI1A 1EV9A 5KN0A 3APOA 1RQMA 1FVKA 4N0VA 5H5RA 11GSA 2B7KA 4WEYA 3GSSA 1M9AA 1NSWA 1O6JA 3LXZA 3GA4A 3TOTA 4LA1A 1GSDA 5D93A 5J9CA 5CNWA 2EIRA 4EKZA 4JBBA 3IV4A 4MLYA 4NAXA 2H72A 3AY8A 4NV2A 1ZZYA 2BMXA 1SU9A 3DYRA 3FR9A 2RUFA 6GSYA 3PH9A 2PVQA 4V1Ap 4L5OA 2HE3A 1BG1A 4WR4A 1XBSA 3TOUA 2VLUA 1YJ6A 1K0OA 4GQCA 3UMAA 4IQAA 3EC3A 3UARA 1X0RA 3GKMA 5ECHB 1PKZA 3TJBA 2EIQA 4PTSA 1DBYA 2I4AA 5ECMB 4HJMA 2X4AA 2H30A 4F03A 2A4VA 1LJRA 2H0HA 4RI6A 1ERWA 4OCFA 3VWWA 2LRTA 1G7EA 1AQXA 3GX8A 3ZYWA 3SBCA 1K0NA 3CSIA 2R0GA 1V57A 4O92A 5EL8A 1YEWC 2E0QA 5IPHA 3F3RA 2I9HA 2O89A 4K5RA 2B6MA 4FQUA 3A5WA 3QD9A 4KDXA 2H01A 2DJ3A 1YQ1A 2HZFA 2P0GA 4JEDA 4RUVA 1I1IP 3N5OA 5A1NB 2R0CA 2LRNA 1A2MA 3L9SA 4PQHA 1SD8A 3NOFA 3W6GA 2DJ2A 5CO3A 5ECLB 2GDRA 5AISA 5DVBA
chains in the Genus database with same CATH topology
2LS5A 3L0HA 1RK4A 4RI7A 2IL3A 2LRCA 3FZ4A 2XHFA 3GV1A 3IXRA 2HQTA 1ERVA 4ECBA 2BTOT 3BCKA 1XOBA 1BF5A 2PVOC 2JZSA 2EFHA 1GL8A 1V58A 4J57E 3GURA 3L9VA 4K5SA 4OMVA 1SVLA 3CYNA 2H8LA 1RW1A 1AC1A 2YCDA 4MABA 2VL9A 5CP1A 3MWHA 2I81A 5A4UA 4E68A 2IFQB 2REMA 2VKZG 2HI7A 4K0NA 4KGIA 3C1RA 4L5LA 1XZOA 4IJ3A 5BRTA 3MAKA 2H19A 5IMAA 4IW9A 4IVFA 1THOA 4KAEA 1XWAA 4OFNA 4CY8A 3O3TA 2CT6A 3GIXA 2YV9A 1C72A 3E3EA 1O8WA 1HNBA 4I5QA 4GLTA 5A4VA 2B1KA 3DIEA 2H1GA 4MH2A 3LYPA 1X5DA 3VPQA 4BVYB 2C1YA 5DALB 1YEXA 2N5FA 1BYEA 2LNSA 3TRXA 4KF9A 4EE0A 2MZCA 5CAXA 1T8EB 4Z2UA 3I6AA 2CVKA 4NHZA 3LQ7A 2K8VA 1J0FA 4QL7A 2O87A 3P90A 4MZCA 4ID0A 4XS4A 1NHYA 3U6VA 1XVQA 3IC8A 2C0GA 4AKXB 4FO5A 3UVHA 3ZFLA 1IYIA 1GP1A 1XW6A 4MJAA 2X8HA 3KH7A 4K2XA 3LORA 3RBTA 5IMFA 1JZRA 3D6IA 5DCGA 3LW9A 1WP0A 2WCIA 3ISOA 1NM3A 3TGZA 7GSSA 5HFKA 4AKGA 2FY6A 1AXDA 3LYKA 1WIKA 4D73A 3MDKA 1TRWA 3GYKA 2G0FA 1X5EA 5IIZA 1O85A 5BMUA 3FKFA 1Z5YE 2GSRA 4AJ7A 2MYGA 1E6BA 3GKXA 5EPFA 1O7UA 4ECJA 5JCGA 1T00A 1NW2A 2O7KA 2L59A 2F9SA 1GSYA 4KSOA 2MMAA 5JCUA 2PBJA 1SD9A 1XWGA 5J47A 2R3XA 3GX0A 2DBCA 2TRCP 3W8SA 1K0BA 4KSMA 2LNTA 1QUWA 3L9UA 5JWOB 1A2JA 1FVJA 4JRRA 1GUKA 4OWYA 1OC8A 5F8BA 3HVSA 4Z7XA 4GTUA 3ZIJA 2AYTA 3F3QA 2H6YA 2HRNA 1WPIA 4O5QA 1PRXA 1AQWA 4MA9A 2VD0A 3VWVA 1K3OA 3FZAA 2EFDA 3KEBA 4G10A 2DKIA 4AKIA 2YZHA 3BJ5A 3SWLA 2M80A 1XW5A 2VIMA 2MBSA 2NVLA 3HDCA 1H75A 4K7NA 1F9MA 5E59A 1SKSB 5IOXA 4G01A 4BL7B 1VRSD 3D4MA 1EZKA 2HSMA 2DJ1A 4HJ2A 3UBKA 5A5HA 2FUG2 4XCSA 13GSA 3WGDA 3LSZA 5F05A 4NHWA 2X8CA 4KH7A 2MMZA 1PQNA 1IYHA 2LTKA 4WF4A 2ES7A 14GSA 3ZL5A 1J9BA 2MMNA 1Q4JA 3F4SA 4KX4A 4TXVA 4L0UA 2QKEA 5EVOA 1MTCA 1FB6A 4QMKA 1HYUA 4OD7A 4MJEA 2CVBA 3HZ8A 1MDJA 4GF0A 3A2WA 2C3NA 3M8NA 1GUMA 1JZOA 2HSYA 4HU7A 4MH3A 3ZVJD 1AUCA 5DJMA 2A4HA 1BJXA 4PGTA 4DSSB 4KDYA 1CQGA 1HQOA 4ZB8A 4IP6A 3RHBA 4HU9A 5GZZB 2IN3A 1XW9A 20GSA 3VFIA 1G6YA 3FMWA 4Z2RA 3CRTA 4PURA 4I8BA 1F3BA 2HSNB 3LJRA 1Z7PA 3TRQA 1F3AA 3IA1A 2V41A 3IK7A 4ACSA 3DKSA 4QQ7A 1G0TA 2C80A 5J9BA 4EF0A 3H8QA 2L4CA 3WYWA 1ZMAA 5E4WA 2DMMA 2G2QA 2JL4A 3LFLA 3G7JA 3C1SA 1B4PA 1VF2A 5JWRB 2CX4A 2FWHA 1PX7A 1XWBA 5ELGA 1Y25A 1ML6A 2OACA 1O8XA 3CSHA 1KEBA 3MSZA 3EVIA 4NV5A 1YKCA 4GWRA 1A23A 1Z9HA 4PNGA 4ZB7A 1M99A 4CHSA 1QFNA 2CZ3A 3D0ZA 5IOWA 3S9FA 1O81A 3HJPA 2IMDA 1XCCA 3UVTA 2WDUA 3Q19A 2GT6A 2R5GA 3APSA 4EIQA 4MPGA 3CTFA 4TR4A 4ZL7A 2IJYA 4PQ1A 4ICYA 2LJAA 2K8SA 1OC9A 4JE1A 1FG4A 4K8MA 4K1FA 2KP1A 3QDNA 2JSYA 3UBLA 1S3CA 2H76A 2WS2A 1M2DA 5A4WA 4MF6A 4JZQA 3C7MA 2F51A 4O5RA 2KOKA 2O85A 2FWGA 4XTSA 4MF7A 2GZZA 5H5QA 3A2XA 4WXTA 4ZL8A 2VM2A 2P5RA 1FHEA 4OCEA 3ME8A 2AV4A 2WB9A 1U3AA 4AKHA 4POBA 2ON7A 3JCML 4PNFA 3EWLA 3A3TA 3G7YA 3UL3A 3I43A 1DUGA 1YVLA 3RPPA 4N3ZA 1X9SB 1U3IA 5KN3A 22GSA 1THXA 4WR5A 1SVMA 3VURA 4K0GA 3W8JA 1GTIA 2NDOA 2WFCA 1NHOA 6GSWA 1GRXA 2LJKA 4PUAA 2B5YA 3HJOA 1TK8B 1SL0B 3GTUA 2B3SA 3KM6A 4GSSA 1TTZA 2H73A 1I5GA 5B6MA 2A2RA 3RHCA 4I6XA 1GSEA 2EFCA 2OE1A 1TW9A 2AJQB 4KCEA 2RM5A 2OE3A 3KIJA 4RQRA 2YWNA 3BOAA 4MJCA 4NXIA 4GCIA 5FT3A 4I97A 6GSXA 1BAYA 2LQOA 1TU7A 2JADA 1JLVA 4MPFA 5IMDA 2MBTA 2HFDA 3Q6OA 4EDZA 5IMVA 1A8LA 4ISDA 1FOHA 4H86A 1B9YC 3K8NA 3FYGA 1ZGNA 3QMXA 5KOWA 5ECPB 2VM1A 5CYYA 3GMFA 2HRKA 5J5NA 3FK8A 4K2DA 3ZLPA 4G0KA 1LBKA 2PPTA 4HUAA 4HEA2 1XXUA 2RLIA 2DJKA 2YN1A 3V1WA 4WBRD 4Z2TA 2H66A 3UEMA 4TR1A 4F0CA 1T4YA 4BWQA 4XRAA 5HQPA 4ZILA 2V6KA 2DIZA 1Z6MA 5ENUA 1GNWA 3O76A 2XC2A 4JR6A 4HZ2A 1EP7A 2LEGA 1T1VA 4EUYA 3IK9A 2OJLA 4XS4B 4RQXA 2VCVA 2E7PA 1XOAA 2LUSA 1GSSA 2M46A 2L6CA 4BWSA 1K0CA 1KTEA 4AGSA 5AGYA 2H0GA 3WD6A 5ECQB 2ZCTA 1R4WA 3FHKA 3M0FA 2FHEA 1PA3A 4AJ6A 4JU5A 2YWIA 2JZTA 2FA8A 4IGJA 1SL1B 1GSFA 1AIUA 4YKGA 1K0AA 2E2GA 3FW2A 1B8XA 2IMKA 3WGXA 4YAPA 3QPMA 4EL1A 2KHPA 1JZDA 3D5JA 2XBQA 1XFLA 4DSQA 1PGTA 5ECRB 3IDVA 3E0UA 4TOPA 2JZRA 3D22A 3P8WA 1YY7A 2YWMA 4KUNA 3A2VA 1H4OA 2YWOA 4MNNA 2I1UA 4OFMA 2L5OA 1B4QA 3KMOA 2H1LA 1A8YA 1EEJA 1QXHA 4TXOB 3VPTA 1SKWB 4K7IA 2R6KA 1X9MB 5IPGA 5G5EA 3RPNA 1GNEA 4Q5FA 10GSA 1EV4A 2H71A 3TKSA 4F2IA 1OKDA 5ELAA 5D8IA 2DIYA 4XIHA 2E2MA 2N5BA 4V2LA 5C04A 1FAAA 5IM9A 5DDLA 3DRNA 1Z6NA 3DVWA 1MD3A 2DMLA 3F9UA 4POKA 5D9TA 2BJXA 4PUFC 4V1Ag 2C4JA 5KEJA 2GTUA 5A1NA 3EPTA 5KN1A 19GSA 2PU9C 1WWJA 5J40A 4WETA 2IWTA 1MDIA 2LV3A 4FYBA 2GZPA 2ZNMA 1N25A 2H1AA 2YP6A 3IPZA 4TRXA 1VGLA 4V2MA 1ABAA 2C0EA 5HFGA 2J23A 2P5QA 1A2LA 2H75A 4TN8A 1USBA 3LXTA 2OBKA 4NMUA 3APQA 5J41A 1T3BA 4KNDA 4G0IA 1SJ6A 1Z3EA 3KTBA 5ID2A 4GQFA 1N2AA 4NWYA 5B8AA 2HZEA 5CRGA 4EVMA 3KXOA 2PUKC 2IFQA 1HNCA 5IQYA 5DAKB 4XRDA 5LNKe 1SL2B 4MJBA 1OE7A 3EMPA 2D2ZA 4XS6A 2J9HA 1SJZA 4X4JA 3R2QA 1YF0A 4KDUA 4PX1A 4BVXA 2H0IA 1ZYNA 1Y1UA 4O32A 1V2AA 3TKPA 3ZMKA 4K6XA 4G2EA 4DVCA 2OBIA 2H70A 2F8AA 3GRXA 2HNLA 3VLNA 4IHUA 1FO5A 4LMWA 5GSSA 3ZIVA 2VLVA 1ILOA 3QAGA 1SJIA 3TKSC 5DALA 1W4VA 1PMTA 3GFKA 5L71A 1EGOA 5D73A 2FNOA 2V1MA 4CY6A 4ZBDA 4KB3A 2CX3A 18GSA 3H79A 2YJHA 3KGKA 1M0UA 1GWCA 5DJLA 4O7HA 5F0GA 1ERUA 2ZUPA 1DE2A 2PMTA 6GSVA 1OC3A 8GSSA 3QAWA 2IIYA 3KCMA 4I2TA 4GXZA 1X5CA 4Q5QA 2EC4A 3FY7A 2V6OA 3FR3A 3I9V2 3NIVA 1I9DA 4KE3A 5GAND 4AF2A 5G2ZA 5ECSA 2YZUA 5A34B 5DQYA 4N10A 2WZ9A 1CQHA 4O5UA 3IHQA 5ABRA 4HQZA 3KD0A 5JWQB 1EP8A 3QCPA 3J7Yb 5IMCA 2YPMA 2MMOA 3KP9A 4BPYA 1XWCA 1WOUA 2GQKA 1QMVA 2X64A 1R5PA 1SK1A 1TJDA 2KP2A 1TOFA 2WULA 4ZBBA 1K0MA 2K9FA 1ON4A 2LQQA 3ERGA 3FRCA 6GSSA 3KJYA 1XVWA 3GL3A 6GSTA 4GDFA 2YOIA 3QR6A 3HJMA 1SK0A 3GKKA 2VL2C 3ZVJA 1PD21 1G6WA 1GSUA 1GTAA 1GLQA 2OKAA 2YJ7A 1M2AA 1R26A 4JR4A 5COHA 1FB0A 3EINA 4POLA 1TXUA 4MMMA 3GTUB 2VCQA 5AIVA 1R7HA 3TJKA 4IQ1A 1YEPA 2X8GA 3TJFA 2LKUA 5IMZA 4FH8A 4FIWA 3EU4A 1TDIA 4BL7A 4KA0A 17GSA 3ZMLA 4J2FA 1S3DA 3D21A 2NPBA 3ERFA 2GQLA 4ML6A 2YNXA 4CW9A 3GH6A 4XS1A 2R4VA 2C3QA 5DQSA 1XPVA 3ZFBA 1YZXA 2NBSA 1ST9A 5KN2A 1V98A 2VCTA 4ECCA 4LL1B 3F63A 1JFUA 2HRFA 2VO4A 2JU5A 4BA7A 2V32A 3RAZA 3ZRDA 2IPAA 2OA7A 2OE0A 1LU4A 4DSRA 3DXBA 3LG6A 5FWGA 4HDEA 1ZYEA 5INYA 5AIXA 2EFEA 4TR1B 1K3LA 4HI7A 5CREA 3IAS2 3GL5A 4TVEA 4DSSA 3KTLA 3F4TA 3QOUA 2TIRA 4EO3A 1EEMA 4X43A 5G1LA 4EC0A 3G7IA 4EIPA 3C71A 2HSNA 1A0RP 4YH2A 2A2PA 4MZWA 2WGRA 2YANA 3VWXA 4GSNA 1FW1A 3TCOA 5CRDA 1BX9A 1A24A 2PN8A 2P31A 1HNAA 4HS1A 5IO0A 2IMEA 2H6XA 3QFBC 2GT5A 3L4NA 5B8BA 2H74A 3MNGA 4W66A 5H5SA 3HA9A 1PL2A 4KW6A 1BG5A 3HMJG 1MD4A 1ZCPA 3HHVA 1WMJA 3GNJA 4IN0A 3C8EA 5FHIA 2B7JA 1SVOA 1JZWA 4ULXA 1QQ2A 2H1BA 3FZ9A 4G0LA 3P7XA 1MEKA 5D9XA 2O8VB 3KP8A 2VCXA 1T4ZA 4XHMA 2A2SA 3TKSE 5B6NA 3TUEA 1UN2A 3PINA 4FYCA 5F06A 1EWXA 1K3YA 5DBQA 3ME7A 3DGQA 2FGXA 5HR0A 1G7OA 4ZBAA 5C00A 5EY6A 1TRUA 2GGTA 3TKRA 4WBJA 2GS3A 1Z7RA 3OR5A 3KMNA 3M1GA 3CBUA 4L8EA 2R2JA 3J7Yk 5HFIA 2AAWA 4YKFA 4MK3A 2R37A 2V2GA 2B1LA 3CSJA 5HR1A 3TJGA 1YDKA 2YV7A 2RUEA 1UA5A 3C73A 3VI5A 2AUVA 2I3YA 3DEXA 3KH9A 2DLXA 3EU3A 2OADA 2PERA 3BBYA 1F37A 4LL4B 4LMVA 3E9JB 2K18A 5B7CA 2C0DA 1XIYA 1TK0B 4F9ZA 5G5FA 4N11A 3LGCA 1T7PB 3NZNA 2QGVA 4A5PA 1EGRA 3IR4A 5AN1A 1TXXA 2L5LA 2FWFA 3HZ4A 1PL1A 5ECNB 2HXKA 3DD3A 1X9WB 2QC7A 3BD2A 1TRSA 1AAZA 3MIXA 3CMIA 4D73B 2VOCA 3US3A 3ZTLA 1WE0A 5BMUB 4K9ZA 1VF3A 4EDYA 1SK2A 3M9JA 5G31A 1N8JA 5F07A 3G9BA 2HYXA 3R3EA 2DJ0A 5ID2B 1VF1A 2PGTA 3UAPA 4N30A 2EIOA 4Q5RA 1WRYA 2HT9A 2HZEB 4MCUA 4AI6A 1JLWA 3IE3A 2OT3A 4QL9A 3GN3A 2KUCA 3TJJA 4BVXB 1AQVA 2K6VA 3DMLA 1PX6A 2C8UA 2UZ8A 2QSIA 4N0ZA 3M9KA 4TR3A 2F3MA 5A5KA 3BCIA 1M9BA 4I2UA 1DSBA 2DSAA 3ERWA 5J3RA 3PR8A 1TRVA 2C3TA 1E2YA 2RIIA 5LD0A 3O6TA 3F4RA 3HXSA 2HSMB 1TI3A 5A5HB 3HD5A 3CWGA 2IMFA 2DJJA 4ZL9A 2UV8G 4X1UA 4ZIJA 4YQVA 1EOHA 3F0IA 2IMIA 4MP4A 3A5IA 3HYPA 5G1KA 4EXJA 4DEJA 1TU8A 2FLSA 3IC4A 1PN0A 1PN9A 1V9WA 1GSQA 3IRAA 1GH2A 4J56E 2GZYA 3ZZXA 4USSA 3LWAA 3CXGA 3EYTA 3HY2A 2KLXA 2VLTA 3TU3B 1HD2A 2XPDA 4ZB6A 1YKAA 2CAIA 5LCZA 3UIWA 2HSHA 4GRFA 4PXOA 3VK9A 1FOVA 2FD3A 5J4UA 5ECIB 2QA1A 9GSSA 3VI7A 4OFTA 2CV4A 2X49A 4ILFA 5G30A 1QK8A 5HR2A 3QAVA 4Q5NA 3HVVA 2HRAA 4G9HA 3H1NA 3L78A 2VUPA 1KNGA 5D9VA 1Q98A 4WF5A 2VL2A 1OAZA 3RDWA 3IAM2 4NPBA 3N9JA 3GSTA 3TRPA 1GTUA 3TDGA 1ZL9A 1U88A 2RM6A 2GSTA 4MF5A 1F2EA 1PKWA 1SYRA 1U87A 2AB6A 3UJ1A 4F82A 4X0XA 2VCZA 2XPEA 1M2BA 4IS0A 4YQMA 1GULA 1YF1A 3F6FA 1DE1A 4OO5A 4G19A 4TXOA 4HZ4A 4HQSA 2VCWA 2JACA 4V2NA 4BVYA 1TKDB 4L0WA 3IOSA 2XBIA 2DKHA 5CRWA 2GQMA 2FCHA 3IBHA 4OO4A 5J4YA 5JCWA 2FA4A 3VWUA 3LEFA 1GLPA 2M72A 3WT2A 3GUSA 2B5XA 1F6MC 3I69A 1XWKA 2C0FA 2R0PA 2GSQA 4F0BA 4IJIA 4MDCA 5GSTA 3IHGA 4P3YB 3HCZA 5D96A 4POMA 3UOMA 4KCAA 3CRUA 1ZOFA 1BEDA 1AW9A 3Q74A 1M7TA 2GLRA 5ECKB 1OC9B 1GUHA 5DCHA 4CDOA 3EURA 1KBNA 2CVDA 4IKHA 3GKNA 2WJUA 3MYDA 2O5VA 4YAVA 5HR3A 3H4KA 2H1DA 1SKRB 3Q18A 4ML1A 4PQIA 5IO2A 5KOXA 3P2AA 3U5RE 1JHBA 6GSUA 2VD1A 2VAFA 1QGVA 1TK5B 1ACVA 3DWVA 1K0DA 3FZ5A 2CAQA 1OKTA 3F6DA 4MZBA 5DAKA 3HVXA 3WGEA 3CTGA 1OE8A 2CA8A 2Z9SA 3PGTA 4IBPA 1URMA 3FR6A 2FWEA 2TRXA 3HKRA 3GH9A 2DC5A 2QA2A 3KZQA 2L4QA 2GSSA 2HLSA 4AJ8A 3ZREA 1B9XC 4LLRA 3H93A 1Y6EA 3QFAC 3WT1A 2X99A 4YQUA 1OVNA 4HOJA 1J08A 16GSA 2VL3A 3ED3A 1UVZA 1ZYPA 2ON5A 4E8EA 2L57A 4TKYA 3ZITA 4ECIA 4IELA 4TW5A 2LJRA 3PPUA 2N5AA 3M3MA 2WRTA 1O73A 1BQ7A 3TB2A 4WKWA 1PSQA 4ZXGA 2AHEA 4GSTA 1B48A 2CZ2A 2PWJA 1ERTA 2B5EA 4K7OA 1V40A 1SYXA 4IP1A 2HRKB 3F8UA 2CQ9A 1GTBA 2GVPA 1OYJA 1TP9A 2F8FA 1U6TA 1ZYQB 4TR0A 1S3AA 3EE2A 1UC7A 2NTOA 5A34A 1MDKA 3DVXA 3GHAA 5J4VA 1WJKA 1W89A 5CRHA 1A0FA 12GSA 3FEUA 2JSZA 3D4TA 1R5AA 5GAPD 4FYUA 1VF4A 2L6DA 2ALBA 3TKQA 1EOGA 5D9WA 4ZB9A 1SENA 3EMXA 2LSTA 4E8HA 5ECOB 2H6ZA 1TI1A 1EV9A 5KN0A 3APOA 1RQMA 1FVKA 4N0VA 5H5RA 11GSA 2B7KA 4WEYA 3GSSA 1M9AA 1NSWA 1O6JA 3LXZA 3GA4A 3TOTA 4LA1A 1GSDA 5D93A 5J9CA 5CNWA 2EIRA 4EKZA 4JBBA 3IV4A 4MLYA 4NAXA 2H72A 3AY8A 4NV2A 1ZZYA 2BMXA 1SU9A 3DYRA 3FR9A 2RUFA 6GSYA 3PH9A 2PVQA 4V1Ap 4L5OA 2HE3A 1BG1A 4WR4A 1XBSA 3TOUA 2VLUA 1YJ6A 1K0OA 4GQCA 3UMAA 4IQAA 3EC3A 3UARA 1X0RA 3GKMA 5ECHB 1PKZA 3TJBA 2EIQA 4PTSA 1DBYA 2I4AA 5ECMB 4HJMA 2X4AA 2H30A 4F03A 2A4VA 1LJRA 2H0HA 4RI6A 1ERWA 4OCFA 3VWWA 2LRTA 1G7EA 1AQXA 3GX8A 3ZYWA 3SBCA 1K0NA 3CSIA 2R0GA 1V57A 4O92A 5EL8A 2E0QA 5IPHA 3F3RA 2I9HA 2O89A 4K5RA 2B6MA 4FQUA 3A5WA 3QD9A 4KDXA 2H01A 2DJ3A 1YQ1A 2HZFA 2P0GA 4JEDA 4RUVA 3N5OA 5A1NB 2R0CA 2LRNA 1A2MA 3L9SA 4PQHA 1SD8A 3NOFA 3W6GA 2DJ2A 5CO3A 5ECLB 2GDRA 5AISA 5DVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LS5 A;  3L0H A;  1RK4 A;  4RI7 A;  2IL3 A;  2LRC A;  3FZ4 A;  2XHF A;  3GV1 A;  3IXR A;  2HQT A;  1ERV A;  4ECB A;  2BTO T;  3BCK A;  1XOB A;  2PVO C;  2JZS A;  1GL8 A;  1V58 A;  4J57 E;  3GUR A;  3L9V A;  4OMV A;  3CYN A;  2H8L A;  1RW1 A;  1AC1 A;  2YCD A;  4MAB A;  2VL9 A;  5CP1 A;  3MWH A;  2I81 A;  5A4U A;  2IFQ B;  2REM A;  2HI7 A;  4K0N A;  4KGI A;  3C1R A;  4L5L A;  1XZO A;  4IJ3 A;  3MAK A;  2H19 A;  5IMA A;  4IW9 A;  4IVF A;  1THO A;  4KAE A;  1XWA A;  4OFN A;  3O3T A;  2CT6 A;  3GIX A;  2YV9 A;  1C72 A;  3E3E A;  1O8W A;  1HNB A;  4I5Q A;  4GLT A;  5A4V A;  2B1K A;  3DIE A;  2H1G A;  4MH2 A;  3LYP A;  1X5D A;  3VPQ A;  4BVY B;  2C1Y A;  5DAL B;  1YEX A;  2N5F A;  1BYE A;  2LNS A;  3TRX A;  4KF9 A;  4EE0 A;  2MZC A;  5CAX A;  1T8E B;  3I6A A;  2CVK A;  4NHZ A;  3LQ7 A;  2K8V A;  1J0F A;  4QL7 A;  2O87 A;  3P90 A;  4MZC A;  4ID0 A;  4XS4 A;  1NHY A;  3U6V A;  1XVQ A;  3IC8 A;  2C0G A;  4FO5 A;  3UVH A;  3ZFL A;  1IYI A;  1GP1 A;  1XW6 A;  4MJA A;  2X8H A;  3KH7 A;  3LOR A;  3RBT A;  5IMF A;  1JZR A;  3D6I A;  5DCG A;  1WP0 A;  2WCI A;  3ISO A;  1NM3 A;  3TGZ A;  7GSS A;  5HFK A;  2FY6 A;  1AXD A;  3LYK A;  1WIK A;  4D73 A;  3MDK A;  1TRW A;  3GYK A;  2G0F A;  1X5E A;  5IIZ A;  1O85 A;  5BMU A;  3FKF A;  1Z5Y E;  2GSR A;  4AJ7 A;  2MYG A;  1E6B A;  3GKX A;  5EPF A;  1O7U A;  4ECJ A;  5JCG A;  1T00 A;  1NW2 A;  2O7K A;  2L59 A;  2F9S A;  1GSY A;  4KSO A;  2MMA A;  5JCU A;  2PBJ A;  1SD9 A;  1XWG A;  2R3X A;  3GX0 A;  2DBC A;  2TRC P;  3W8S A;  1K0B A;  4KSM A;  2LNT A;  1QUW A;  3L9U A;  5JWO B;  1A2J A;  1FVJ A;  4JRR A;  1GUK A;  4OWY A;  1OC8 A;  5F8B A;  3HVS A;  4Z7X A;  4GTU A;  3ZIJ A;  2AYT A;  3F3Q A;  2H6Y A;  2HRN A;  1WPI A;  1PRX A;  1AQW A;  4MA9 A;  2VD0 A;  3VWV A;  1K3O A;  3FZA A;  3KEB A;  4G10 A;  2YZH A;  3BJ5 A;  3SWL A;  2M80 A;  1XW5 A;  2VIM A;  2MBS A;  2NVL A;  3HDC A;  1H75 A;  4K7N A;  1F9M A;  5E59 A;  1SKS B;  5IOX A;  4BL7 B;  1VRS D;  3D4M A;  1EZK A;  2HSM A;  2DJ1 A;  4HJ2 A;  3UBK A;  2FUG 2;  4XCS A;  13GS A;  3WGD A;  3LSZ A;  5F05 A;  4NHW A;  2X8C A;  4KH7 A;  2MMZ A;  1PQN A;  1IYH A;  2LTK A;  4WF4 A;  2ES7 A;  14GS A;  3ZL5 A;  1J9B A;  2MMN A;  1Q4J A;  3F4S A;  4KX4 A;  4TXV A;  4L0U A;  2QKE A;  5EVO A;  1MTC A;  1FB6 A;  1HYU A;  4OD7 A;  4MJE A;  2CVB A;  3HZ8 A;  1MDJ A;  4GF0 A;  3A2W A;  2C3N A;  3M8N A;  1GUM A;  1JZO A;  2HSY A;  4HU7 A;  4MH3 A;  3ZVJ D;  1AUC A;  5DJM A;  1BJX A;  4PGT A;  4DSS B;  4KDY A;  1CQG A;  1HQO A;  4ZB8 A;  4IP6 A;  3RHB A;  4HU9 A;  5GZZ B;  2IN3 A;  1XW9 A;  20GS A;  3VFI A;  1G6Y A;  3CRT A;  4PUR A;  4I8B A;  1F3B A;  2HSN B;  3LJR A;  1Z7P A;  3TRQ A;  1F3A A;  3IA1 A;  2V41 A;  3IK7 A;  4ACS A;  3DKS A;  4QQ7 A;  1G0T A;  2C80 A;  5J9B A;  4EF0 A;  3H8Q A;  2L4C A;  3WYW A;  1ZMA A;  5E4W A;  2DMM A;  2G2Q A;  2JL4 A;  3LFL A;  3G7J A;  3C1S A;  1B4P A;  1VF2 A;  5JWR B;  2CX4 A;  2FWH A;  1PX7 A;  1XWB A;  5ELG A;  1Y25 A;  1ML6 A;  2OAC A;  1O8X A;  3CSH A;  1KEB A;  3MSZ A;  3EVI A;  4NV5 A;  1YKC A;  4GWR A;  1A23 A;  1Z9H A;  4PNG A;  1M99 A;  4CHS A;  1QFN A;  2CZ3 A;  3D0Z A;  5IOW A;  3S9F A;  1O81 A;  3HJP A;  2IMD A;  1XCC A;  3UVT A;  2WDU A;  3Q19 A;  2GT6 A;  2R5G A;  3APS A;  4MPG A;  3CTF A;  4TR4 A;  4ZL7 A;  2IJY A;  4PQ1 A;  2LJA A;  2K8S A;  1OC9 A;  4JE1 A;  1FG4 A;  4K8M A;  4K1F A;  2KP1 A;  3QDN A;  2JSY A;  3UBL A;  1S3C A;  2H76 A;  2WS2 A;  1M2D A;  5A4W A;  4MF6 A;  4JZQ A;  3C7M A;  2F51 A;  4O5R A;  2KOK A;  2O85 A;  2FWG A;  4XTS A;  4MF7 A;  2GZZ A;  5H5Q A;  3A2X A;  4WXT A;  4ZL8 A;  2VM2 A;  2P5R A;  1FHE A;  4OCE A;  3ME8 A;  2AV4 A;  2WB9 A;  1U3A A;  4POB A;  3JCM L;  2ON7 A;  3UL3 A;  4PNF A;  3EWL A;  3A3T A;  3G7Y A;  3I43 A;  1DUG A;  3RPP A;  1X9S B;  1U3I A;  5KN3 A;  22GS A;  1THX A;  4WR5 A;  3VUR A;  4K0G A;  3W8J A;  1GTI A;  2NDO A;  2WFC A;  1NHO A;  6GSW A;  1GRX A;  2LJK A;  4PUA A;  2B5Y A;  3HJO A;  1TK8 B;  1SL0 B;  3GTU A;  2B3S A;  3KM6 A;  4GSS A;  1TTZ A;  2H73 A;  1I5G A;  5B6M A;  2A2R A;  3RHC A;  4I6X A;  1GSE A;  2OE1 A;  1TW9 A;  2AJQ B;  4KCE A;  2RM5 A;  2OE3 A;  3KIJ A;  4RQR A;  2YWN A;  3BOA A;  4MJC A;  4NXI A;  4GCI A;  5FT3 A;  4I97 A;  6GSX A;  1BAY A;  2LQO A;  1TU7 A;  2JAD A;  1JLV A;  4MPF A;  5IMD A;  2MBT A;  2HFD A;  3Q6O A;  4EDZ A;  5IMV A;  1A8L A;  4ISD A;  4H86 A;  1B9Y C;  3K8N A;  3FYG A;  1ZGN A;  3QMX A;  5ECP B;  2VM1 A;  5CYY A;  3GMF A;  2HRK A;  5J5N A;  3FK8 A;  4K2D A;  3ZLP A;  4G0K A;  1LBK A;  2PPT A;  4HUA A;  4HEA 2;  1XXU A;  2RLI A;  2DJK A;  2YN1 A;  3V1W A;  4WBR D;  2H66 A;  3UEM A;  4TR1 A;  4F0C A;  1T4Y A;  4BWQ A;  4XRA A;  5HQP A;  4ZIL A;  2V6K A;  2DIZ A;  1Z6M A;  5ENU A;  1GNW A;  3O76 A;  2XC2 A;  4JR6 A;  4HZ2 A;  1EP7 A;  2LEG A;  1T1V A;  4EUY A;  3IK9 A;  2OJL A;  4XS4 B;  4RQX A;  2VCV A;  2E7P A;  1XOA A;  2LUS A;  1GSS A;  2M46 A;  2L6C A;  4BWS A;  1K0C A;  1KTE A;  4AGS A;  5AGY A;  2H0G A;  3WD6 A;  5ECQ B;  2ZCT A;  1R4W A;  3FHK A;  3M0F A;  2FHE A;  1PA3 A;  4AJ6 A;  4JU5 A;  2YWI A;  2JZT A;  2FA8 A;  4IGJ A;  1SL1 B;  1GSF A;  1AIU A;  1K0A A;  2E2G A;  3FW2 A;  1B8X A;  2IMK A;  3WGX A;  4YAP A;  3QPM A;  4EL1 A;  2KHP A;  1JZD A;  3D5J A;  2XBQ A;  1XFL A;  4DSQ A;  1PGT A;  5ECR B;  3IDV A;  3E0U A;  4TOP A;  2JZR A;  3D22 A;  3P8W A;  1YY7 A;  2YWM A;  4KUN A;  3A2V A;  1H4O A;  2YWO A;  2I1U A;  4OFM A;  2L5O A;  1B4Q A;  3KMO A;  1A8Y A;  1EEJ A;  1QXH A;  4TXO B;  3VPT A;  1SKW B;  4K7I A;  2R6K A;  1X9M B;  5IPG A;  5G5E A;  3RPN A;  1GNE A;  4Q5F A;  10GS A;  1EV4 A;  2H71 A;  3TKS A;  4F2I A;  1OKD A;  5ELA A;  5D8I A;  2DIY A;  4XIH A;  2E2M A;  2N5B A;  4V2L A;  5C04 A;  1FAA A;  5IM9 A;  5DDL A;  3DRN A;  1Z6N A;  3DVW A;  1MD3 A;  2DML A;  3F9U A;  4POK A;  5D9T A;  2BJX A;  4PUF C;  4V1A g;  2C4J A;  5KEJ A;  2GTU A;  5KN1 A;  19GS A;  2PU9 C;  1WWJ A;  4WET A;  2IWT A;  1MDI A;  2LV3 A;  4FYB A;  2GZP A;  2ZNM A;  2H1A A;  2YP6 A;  3IPZ A;  4TRX A;  1VGL A;  4V2M A;  1ABA A;  2C0E A;  5HFG A;  2J23 A;  2P5Q A;  1A2L A;  2H75 A;  4TN8 A;  1USB A;  3LXT A;  2OBK A;  4NMU A;  3APQ A;  5J41 A;  1T3B A;  4KND A;  4G0I A;  1SJ6 A;  1Z3E A;  3KTB A;  5ID2 A;  4GQF A;  1N2A A;  4NWY A;  5B8A A;  2HZE A;  5CRG A;  4EVM A;  3KXO A;  2PUK C;  2IFQ A;  1HNC A;  5IQY A;  5DAK B;  4XRD A;  5LNK e;  1SL2 B;  4MJB A;  1OE7 A;  3EMP A;  2D2Z A;  4XS6 A;  2J9H A;  1SJZ A;  3R2Q A;  1YF0 A;  4KDU A;  4PX1 A;  4BVX A;  2H0I A;  4O32 A;  1V2A A;  3TKP A;  4K6X A;  3ZMK A;  4G2E A;  4DVC A;  2OBI A;  2H70 A;  2F8A A;  3GRX A;  2HNL A;  3VLN A;  4IHU A;  1FO5 A;  4LMW A;  5GSS A;  3ZIV A;  2VLV A;  1ILO A;  3QAG A;  1SJI A;  3TKS C;  5DAL A;  1W4V A;  1PMT A;  3GFK A;  5L71 A;  1EGO A;  5D73 A;  2FNO A;  2V1M A;  4ZBD A;  4KB3 A;  2CX3 A;  18GS A;  3H79 A;  2YJH A;  3KGK A;  1M0U A;  1GWC A;  5DJL A;  4O7H A;  5F0G A;  1ERU A;  2ZUP A;  1DE2 A;  2PMT A;  6GSV A;  1OC3 A;  8GSS A;  3QAW A;  2IIY A;  3KCM A;  4I2T A;  4GXZ A;  1X5C A;  4Q5Q A;  2EC4 A;  3FY7 A;  2V6O A;  3FR3 A;  3I9V 2;  3NIV A;  1I9D A;  4KE3 A;  5GAN D;  4AF2 A;  5G2Z A;  5ECS A;  2YZU A;  5DQY A;  4N10 A;  2WZ9 A;  1CQH A;  3IHQ A;  5ABR A;  4HQZ A;  3KD0 A;  5JWQ B;  3QCP A;  1EP8 A;  3J7Y b;  5IMC A;  2YPM A;  2MMO A;  3KP9 A;  4BPY A;  1XWC A;  1WOU A;  2GQK A;  1QMV A;  2X64 A;  1R5P A;  1SK1 A;  1TJD A;  2KP2 A;  1TOF A;  2WUL A;  4ZBB A;  1K0M A;  2K9F A;  1ON4 A;  2LQQ A;  3ERG A;  3FRC A;  6GSS A;  3KJY A;  1XVW A;  3GL3 A;  6GST A;  2YOI A;  3QR6 A;  3HJM A;  1SK0 A;  3GKK A;  2VL2 C;  3ZVJ A;  1PD2 1;  1G6W A;  1GSU A;  1GTA A;  1GLQ A;  2OKA A;  2YJ7 A;  1M2A A;  1R26 A;  4JR4 A;  5COH A;  1FB0 A;  3EIN A;  4POL A;  4MMM A;  3GTU B;  2VCQ A;  5AIV A;  1R7H A;  3TJK A;  4IQ1 A;  1YEP A;  2X8G A;  3TJF A;  2LKU A;  5IMZ A;  4FH8 A;  4FIW A;  3EU4 A;  1TDI A;  4BL7 A;  4KA0 A;  17GS A;  3ZML A;  4J2F A;  1S3D A;  3D21 A;  2NPB A;  3ERF A;  2GQL A;  4ML6 A;  2YNX A;  4CW9 A;  3GH6 A;  4XS1 A;  2R4V A;  2C3Q A;  5DQS A;  1XPV A;  3ZFB A;  1YZX A;  2NBS A;  1ST9 A;  5KN2 A;  1V98 A;  2VCT A;  4ECC A;  4LL1 B;  3F63 A;  1JFU A;  2HRF A;  2VO4 A;  2JU5 A;  4BA7 A;  2V32 A;  3RAZ A;  3ZRD A;  2IPA A;  2OA7 A;  2OE0 A;  1LU4 A;  4DSR A;  3DXB A;  3LG6 A;  5FWG A;  4HDE A;  1ZYE A;  5INY A;  5AIX A;  4TR1 B;  1K3L A;  4HI7 A;  5CRE A;  3IAS 2;  3GL5 A;  4TVE A;  4DSS A;  3KTL A;  3F4T A;  3QOU A;  2TIR A;  4EO3 A;  1EEM A;  4X43 A;  5G1L A;  4EC0 A;  3G7I A;  3C71 A;  1A0R P;  4YH2 A;  4MZW A;  2WGR A;  2YAN A;  3VWX A;  4GSN A;  1FW1 A;  3TCO A;  5CRD A;  1BX9 A;  1A24 A;  2PN8 A;  2P31 A;  1HNA A;  4HS1 A;  5IO0 A;  2IME A;  2H6X A;  3QFB C;  2GT5 A;  3L4N A;  5B8B A;  2H74 A;  3MNG A;  5H5S A;  3HA9 A;  1PL2 A;  4KW6 A;  1BG5 A;  1MD4 A;  1ZCP A;  3HHV A;  1WMJ A;  3GNJ A;  4IN0 A;  3C8E A;  5FHI A;  2B7J A;  1JZW A;  4ULX A;  1QQ2 A;  2H1B A;  3FZ9 A;  4G0L A;  3P7X A;  1MEK A;  5D9X A;  2O8V B;  3KP8 A;  2VCX A;  1T4Z A;  4XHM A;  2A2S A;  3TKS E;  5B6N A;  3TUE A;  1UN2 A;  3PIN A;  4FYC A;  5F06 A;  1EWX A;  1K3Y A;  5DBQ A;  3ME7 A;  3DGQ A;  2FGX A;  5HR0 A;  1G7O A;  4ZBA A;  5C00 A;  5EY6 A;  1TRU A;  2GGT A;  3TKR A;  4WBJ A;  2GS3 A;  1Z7R A;  3OR5 A;  3KMN A;  3M1G A;  3CBU A;  4L8E A;  2R2J A;  3J7Y k;  5HFI A;  2AAW A;  4MK3 A;  2R37 A;  2V2G A;  2B1L A;  3CSJ A;  5HR1 A;  3TJG A;  1YDK A;  2YV7 A;  2RUE A;  1UA5 A;  3C73 A;  3VI5 A;  2AUV A;  2I3Y A;  3DEX A;  3KH9 A;  2DLX A;  3EU3 A;  2OAD A;  2PER A;  3BBY A;  1F37 A;  4LL4 B;  4LMV A;  3E9J B;  2K18 A;  5B7C A;  2C0D A;  1XIY A;  1TK0 B;  4F9Z A;  5G5F A;  4N11 A;  3LGC A;  1T7P B;  3NZN A;  2QGV A;  1EGR A;  3IR4 A;  5AN1 A;  1TXX A;  2L5L A;  2FWF A;  3HZ4 A;  1PL1 A;  5ECN B;  2HXK A;  3DD3 A;  1X9W B;  2QC7 A;  3BD2 A;  1TRS A;  1AAZ A;  3CMI A;  4D73 B;  2VOC A;  3US3 A;  3ZTL A;  1WE0 A;  4K9Z A;  1VF3 A;  4EDY A;  1SK2 A;  3M9J A;  5G31 A;  1N8J A;  5F07 A;  3G9B A;  2HYX A;  3R3E A;  2DJ0 A;  5ID2 B;  1VF1 A;  2PGT A;  3UAP A;  4N30 A;  2EIO A;  4Q5R A;  1WRY A;  2HT9 A;  2HZE B;  4MCU A;  1JLW A;  3IE3 A;  4QL9 A;  3GN3 A;  2KUC A;  3TJJ A;  4BVX B;  1AQV A;  2K6V A;  3DML A;  1PX6 A;  2C8U A;  2UZ8 A;  2QSI A;  4N0Z A;  3M9K A;  4TR3 A;  2F3M A;  5A5K A;  3BCI A;  1M9B A;  4I2U A;  1DSB A;  2DSA A;  3ERW A;  5J3R A;  3PR8 A;  1TRV A;  2C3T A;  1E2Y A;  2RII A;  5LD0 A;  3O6T A;  3F4R A;  3HXS A;  2HSM B;  1TI3 A;  3HD5 A;  2IMF A;  2DJJ A;  4ZL9 A;  4X1U A;  4ZIJ A;  4YQV A;  1EOH A;  3F0I A;  2IMI A;  4MP4 A;  3HYP A;  5G1K A;  4EXJ A;  4DEJ A;  1TU8 A;  2FLS A;  3IC4 A;  1PN9 A;  1V9W A;  1GSQ A;  3IRA A;  1GH2 A;  4J56 E;  2GZY A;  3ZZX A;  4USS A;  3LWA A;  3CXG A;  3EYT A;  3HY2 A;  2KLX A;  2VLT A;  1HD2 A;  2XPD A;  4ZB6 A;  1YKA A;  2CAI A;  5LCZ A;  3UIW A;  2HSH A;  4GRF A;  4PXO A;  3VK9 A;  1FOV A;  2FD3 A;  5J4U A;  5ECI B;  9GSS A;  3VI7 A;  4OFT A;  2CV4 A;  4ILF A;  5G30 A;  1QK8 A;  5HR2 A;  3QAV A;  4Q5N A;  3HVV A;  2HRA A;  4G9H A;  3H1N A;  3L78 A;  2VUP A;  1KNG A;  5D9V A;  1Q98 A;  4WF5 A;  2VL2 A;  1OAZ A;  3RDW A;  3IAM 2;  4NPB A;  3N9J A;  3GST A;  3TRP A;  1GTU A;  3TDG A;  1ZL9 A;  1U88 A;  2RM6 A;  2GST A;  4MF5 A;  1F2E A;  1PKW A;  1SYR A;  1U87 A;  2AB6 A;  3UJ1 A;  4F82 A;  4X0X A;  2VCZ A;  2XPE A;  1M2B A;  4IS0 A;  4YQM A;  1GUL A;  1YF1 A;  3F6F A;  1DE1 A;  4OO5 A;  4G19 A;  4TXO A;  4HZ4 A;  4HQS A;  2VCW A;  2JAC A;  4V2N A;  4BVY A;  1TKD B;  4L0W A;  3IOS A;  2XBI A;  5CRW A;  2GQM A;  2FCH A;  3IBH A;  4OO4 A;  5JCW A;  2FA4 A;  3VWU A;  3LEF A;  1GLP A;  2M72 A;  3WT2 A;  3GUS A;  2B5X A;  1F6M C;  3I69 A;  1XWK A;  2C0F A;  2GSQ A;  4F0B A;  4IJI A;  4MDC A;  5GST A;  4P3Y B;  3HCZ A;  5D96 A;  4POM A;  3UOM A;  4KCA A;  3CRU A;  1ZOF A;  1BED A;  1AW9 A;  3Q74 A;  1M7T A;  2GLR A;  5ECK B;  1OC9 B;  1GUH A;  5DCH A;  4CDO A;  3EUR A;  1KBN A;  2CVD A;  4IKH A;  3GKN A;  2WJU A;  4YAV A;  5HR3 A;  3H4K A;  2H1D A;  1SKR B;  3Q18 A;  4ML1 A;  4PQI A;  5IO2 A;  3P2A A;  3U5R E;  1JHB A;  6GSU A;  2VD1 A;  2VAF A;  1QGV A;  1TK5 B;  1ACV A;  3DWV A;  1K0D A;  3FZ5 A;  2CAQ A;  1OKT A;  3F6D A;  4MZB A;  5DAK A;  3HVX A;  3WGE A;  3CTG A;  1OE8 A;  2CA8 A;  2Z9S A;  3PGT A;  4IBP A;  1URM A;  3FR6 A;  2FWE A;  2TRX A;  3HKR A;  3GH9 A;  2DC5 A;  3KZQ A;  2L4Q A;  2GSS A;  2HLS A;  4AJ8 A;  3ZRE A;  1B9X C;  4LLR A;  3H93 A;  1Y6E A;  3QFA C;  3WT1 A;  2X99 A;  4YQU A;  1OVN A;  4HOJ A;  1J08 A;  16GS A;  2VL3 A;  3ED3 A;  1UVZ A;  2ON5 A;  4E8E A;  2L57 A;  4TKY A;  3ZIT A;  4ECI A;  4IEL A;  4TW5 A;  2LJR A;  3PPU A;  2N5A A;  3M3M A;  2WRT A;  1O73 A;  1BQ7 A;  3TB2 A;  4WKW A;  1PSQ A;  4ZXG A;  2AHE A;  4GST A;  1B48 A;  2CZ2 A;  2PWJ A;  1ERT A;  2B5E A;  4K7O A;  1V40 A;  1SYX A;  4IP1 A;  2HRK B;  3F8U A;  2CQ9 A;  1GTB A;  2GVP A;  1OYJ A;  1TP9 A;  2F8F A;  1U6T A;  1ZYQ B;  4TR0 A;  1S3A A;  3EE2 A;  1UC7 A;  2NTO A;  1MDK A;  3DVX A;  3GHA A;  1WJK A;  1W89 A;  5CRH A;  1A0F A;  12GS A;  3FEU A;  2JSZ A;  3D4T A;  1R5A A;  5GAP D;  4FYU A;  1VF4 A;  2L6D A;  2ALB A;  3TKQ A;  1EOG A;  5D9W A;  4ZB9 A;  1SEN A;  3EMX A;  2LST A;  4E8H A;  5ECO B;  2H6Z A;  1TI1 A;  1EV9 A;  5KN0 A;  3APO A;  1RQM A;  1FVK A;  4N0V A;  5H5R A;  11GS A;  2B7K A;  4WEY A;  3GSS A;  1M9A A;  1NSW A;  1O6J A;  3LXZ A;  3GA4 A;  3TOT A;  4LA1 A;  1GSD A;  5D93 A;  5J9C A;  5CNW A;  2EIR A;  4EKZ A;  4JBB A;  3IV4 A;  4MLY A;  4NAX A;  2H72 A;  3AY8 A;  4NV2 A;  1ZZY A;  2BMX A;  1SU9 A;  3DYR A;  3FR9 A;  2RUF A;  6GSY A;  3PH9 A;  2PVQ A;  4V1A p;  4L5O A;  2HE3 A;  4WR4 A;  1XBS A;  3TOU A;  2VLU A;  1YJ6 A;  1K0O A;  4GQC A;  3UMA A;  4IQA A;  3EC3 A;  3UAR A;  1X0R A;  3GKM A;  5ECH B;  1PKZ A;  3TJB A;  2EIQ A;  4PTS A;  1DBY A;  2I4A A;  5ECM B;  4HJM A;  2H30 A;  4F03 A;  2A4V A;  1LJR A;  2H0H A;  4RI6 A;  1ERW A;  4OCF A;  3VWW A;  2LRT A;  1G7E A;  1AQX A;  3GX8 A;  3ZYW A;  3SBC A;  1K0N A;  3CSI A;  1V57 A;  4O92 A;  5EL8 A;  2E0Q A;  5IPH A;  3F3R A;  2I9H A;  2O89 A;  2B6M A;  3QD9 A;  4FQU A;  3A5W A;  4KDX A;  2H01 A;  2DJ3 A;  1YQ1 A;  2HZF A;  2P0G A;  4JED A;  4RUV A;  3N5O A;  2LRN A;  1A2M A;  3L9S A;  4PQH A;  1SD8 A;  3NOF A;  3W6G A;  2DJ2 A;  5CO3 A;  5ECL B;  2GDR A;  5AIS A;  5DVB A; 
#chains in the Genus database with same CATH topology
 2LS5 A;  3L0H A;  1RK4 A;  4RI7 A;  2IL3 A;  2LRC A;  3FZ4 A;  2XHF A;  3GV1 A;  3IXR A;  2HQT A;  1ERV A;  4ECB A;  2BTO T;  3BCK A;  1XOB A;  1BF5 A;  2PVO C;  2JZS A;  2EFH A;  1GL8 A;  1V58 A;  4J57 E;  3GUR A;  3L9V A;  4K5S A;  4OMV A;  1SVL A;  3CYN A;  2H8L A;  1RW1 A;  1AC1 A;  2YCD A;  4MAB A;  2WW2 A;  2VL9 A;  5CP1 A;  3MWH A;  2I81 A;  5A4U A;  4E68 A;  2IFQ B;  2REM A;  2VKZ G;  2HI7 A;  4K0N A;  4KGI A;  3C1R A;  4L5L A;  1XZO A;  4IJ3 A;  5BRT A;  3MAK A;  2H19 A;  5IMA A;  4IW9 A;  4IVF A;  1THO A;  4KAE A;  1XWA A;  4OFN A;  4CY8 A;  3O3T A;  2CT6 A;  3GIX A;  2YV9 A;  1C72 A;  3E3E A;  1O8W A;  1HNB A;  4I5Q A;  4GLT A;  5A4V A;  2B1K A;  3DIE A;  2H1G A;  4MH2 A;  3LYP A;  1X5D A;  3VPQ A;  4BVY B;  2C1Y A;  5DAL B;  1YEX A;  2N5F A;  1BYE A;  2LNS A;  3TRX A;  4KF9 A;  4EE0 A;  2MZC A;  5CAX A;  1T8E B;  4Z2U A;  3I6A A;  2CVK A;  4NHZ A;  3LQ7 A;  2K8V A;  1J0F A;  4QL7 A;  2O87 A;  3P90 A;  4MZC A;  4ID0 A;  4XS4 A;  1NHY A;  3U6V A;  1XVQ A;  3IC8 A;  2C0G A;  4AKX B;  4FO5 A;  3UVH A;  3ZFL A;  1IYI A;  1GP1 A;  1XW6 A;  4MJA A;  2X8H A;  3KH7 A;  4K2X A;  3LOR A;  3RBT A;  5IMF A;  1JZR A;  3D6I A;  5DCG A;  3LW9 A;  1WP0 A;  2WCI A;  3ISO A;  1NM3 A;  3TGZ A;  7GSS A;  5HFK A;  4AKG A;  2FY6 A;  1AXD A;  3LYK A;  1WIK A;  4D73 A;  3MDK A;  1TRW A;  3GYK A;  2G0F A;  1X5E A;  5IIZ A;  1O85 A;  5BMU A;  3FKF A;  1Z5Y E;  2GSR A;  4AJ7 A;  2MYG A;  1E6B A;  3GKX A;  5EPF A;  1O7U A;  4ECJ A;  5JCG A;  1T00 A;  1NW2 A;  2O7K A;  2L59 A;  2F9S A;  1GSY A;  4KSO A;  2MMA A;  5JCU A;  2PBJ A;  1SD9 A;  1XWG A;  5J47 A;  2R3X A;  3GX0 A;  2DBC A;  2TRC P;  3W8S A;  1K0B A;  4KSM A;  2LNT A;  1QUW A;  3L9U A;  5JWO B;  1A2J A;  1FVJ A;  4JRR A;  1GUK A;  4OWY A;  1OC8 A;  5F8B A;  3HVS A;  4Z7X A;  4GTU A;  3ZIJ A;  2AYT A;  3F3Q A;  2H6Y A;  2HRN A;  1WPI A;  4O5Q A;  1PRX A;  1AQW A;  4MA9 A;  2VD0 A;  3VWV A;  1K3O A;  3FZA A;  2EFD A;  3KEB A;  4G10 A;  2DKI A;  4AKI A;  2YZH A;  3BJ5 A;  3SWL A;  2M80 A;  1XW5 A;  2VIM A;  2MBS A;  2NVL A;  3HDC A;  1H75 A;  4K7N A;  1F9M A;  5E59 A;  1SKS B;  5IOX A;  4G01 A;  4BL7 B;  1VRS D;  3D4M A;  1EZK A;  2HSM A;  2DJ1 A;  4HJ2 A;  3UBK A;  5A5H A;  2FUG 2;  4XCS A;  13GS A;  3WGD A;  3LSZ A;  5F05 A;  4NHW A;  2X8C A;  4KH7 A;  2MMZ A;  1PQN A;  1IYH A;  2LTK A;  4WF4 A;  2ES7 A;  14GS A;  3ZL5 A;  1J9B A;  2MMN A;  1Q4J A;  4PI2 C;  3F4S A;  4KX4 A;  4TXV A;  4L0U A;  2QKE A;  5EVO A;  1MTC A;  1FB6 A;  4QMK A;  1HYU A;  4OD7 A;  4MJE A;  2CVB A;  3HZ8 A;  1MDJ A;  4GF0 A;  3A2W A;  2C3N A;  3M8N A;  1GUM A;  1JZO A;  2HSY A;  4HU7 A;  4MH3 A;  3ZVJ D;  1AUC A;  5DJM A;  2A4H A;  1BJX A;  4PGT A;  4DSS B;  4KDY A;  1CQG A;  1HQO A;  4ZB8 A;  4IP6 A;  3RHB A;  4HU9 A;  5GZZ B;  2IN3 A;  1XW9 A;  20GS A;  3VFI A;  1G6Y A;  3FMW A;  4Z2R A;  3CRT A;  4PUR A;  4I8B A;  1F3B A;  2HSN B;  3LJR A;  1Z7P A;  3TRQ A;  1F3A A;  3IA1 A;  2V41 A;  3IK7 A;  2WVZ A;  4ACS A;  3DKS A;  4QQ7 A;  1G0T A;  2C80 A;  5J9B A;  4EF0 A;  3H8Q A;  2L4C A;  3WYW A;  1ZMA A;  5E4W A;  2DMM A;  2G2Q A;  2JL4 A;  3LFL A;  3G7J A;  3C1S A;  1B4P A;  1VF2 A;  5JWR B;  2CX4 A;  2FWH A;  1PX7 A;  1XWB A;  5ELG A;  1Y25 A;  1ML6 A;  2OAC A;  1O8X A;  3CSH A;  1KEB A;  3MSZ A;  3EVI A;  4NV5 A;  1YKC A;  4GWR A;  1A23 A;  1Z9H A;  4PNG A;  4ZB7 A;  2O3E A;  1M99 A;  4CHS A;  1QFN A;  2CZ3 A;  3D0Z A;  5IOW A;  3S9F A;  1O81 A;  3HJP A;  2IMD A;  1XCC A;  1S3R A;  3UVT A;  2WDU A;  3Q19 A;  2GT6 A;  2R5G A;  3APS A;  4EIQ A;  4MPG A;  3CTF A;  4TR4 A;  4ZL7 A;  2IJY A;  4PQ1 A;  4ICY A;  2LJA A;  2K8S A;  1OC9 A;  4JE1 A;  1FG4 A;  4K8M A;  4K1F A;  2KP1 A;  3QDN A;  2JSY A;  3UBL A;  1S3C A;  2H76 A;  2WS2 A;  1M2D A;  5A4W A;  4MF6 A;  4JZQ A;  3C7M A;  2F51 A;  4O5R A;  2KOK A;  2O85 A;  2FWG A;  3CHX C;  4XTS A;  4MF7 A;  2GZZ A;  5H5Q A;  3A2X A;  4WXT A;  4ZL8 A;  2VM2 A;  2P5R A;  1FHE A;  4OCE A;  3ME8 A;  2AV4 A;  2WB9 A;  1U3A A;  4AKH A;  4POB A;  2ON7 A;  3JCM L;  4PNF A;  3EWL A;  3A3T A;  3G7Y A;  3UL3 A;  3I43 A;  1DUG A;  1YVL A;  3RPP A;  4N3Z A;  1X9S B;  1U3I A;  5KN3 A;  22GS A;  1THX A;  4WR5 A;  1SVM A;  3VUR A;  4K0G A;  3W8J A;  1GTI A;  2NDO A;  2WFC A;  1NHO A;  6GSW A;  1GRX A;  2LJK A;  4PUA A;  2B5Y A;  3HJO A;  1TK8 B;  1SL0 B;  3GTU A;  2B3S A;  3KM6 A;  4GSS A;  1TTZ A;  2H73 A;  1I5G A;  5B6M A;  2A2R A;  3RHC A;  4I6X A;  1GSE A;  2EFC A;  2OE1 A;  1TW9 A;  2AJQ B;  4KCE A;  2RM5 A;  2OE3 A;  3KIJ A;  4RQR A;  2YWN A;  3BOA A;  4MJC A;  4NXI A;  4GCI A;  5FT3 A;  4I97 A;  6GSX A;  1BAY A;  2LQO A;  1S4B P;  1TU7 A;  2JAD A;  1JLV A;  4MPF A;  5IMD A;  2MBT A;  2HFD A;  3Q6O A;  4EDZ A;  5IMV A;  1A8L A;  4ISD A;  1FOH A;  4H86 A;  1B9Y C;  3K8N A;  3FYG A;  1ZGN A;  3QMX A;  5KOW A;  5ECP B;  2VM1 A;  5CYY A;  3GMF A;  2HRK A;  5J5N A;  3FK8 A;  4K2D A;  3ZLP A;  4G0K A;  1LBK A;  2PPT A;  4HUA A;  4HEA 2;  1XXU A;  2RLI A;  2DJK A;  2YN1 A;  3V1W A;  4WBR D;  4Z2T A;  2H66 A;  3UEM A;  4TR1 A;  4F0C A;  1T4Y A;  4BWQ A;  4XRA A;  5HQP A;  4ZIL A;  2V6K A;  2DIZ A;  1Z6M A;  5ENU A;  1GNW A;  3O76 A;  2XC2 A;  4JR6 A;  4HZ2 A;  1EP7 A;  2LEG A;  1T1V A;  4EUY A;  3IK9 A;  2OJL A;  4XS4 B;  4RQX A;  2VCV A;  2E7P A;  1XOA A;  2LUS A;  1GSS A;  2M46 A;  2L6C A;  4BWS A;  1K0C A;  1KTE A;  4AGS A;  5AGY A;  2H0G A;  3WD6 A;  5ECQ B;  2ZCT A;  1R4W A;  3FHK A;  3M0F A;  2FHE A;  1PA3 A;  4AJ6 A;  4JU5 A;  2YWI A;  2JZT A;  2FA8 A;  4IGJ A;  1SL1 B;  1GSF A;  1AIU A;  4YKG A;  1K0A A;  2E2G A;  3FW2 A;  1B8X A;  2IMK A;  3WGX A;  4YAP A;  3QPM A;  4EL1 A;  2KHP A;  1JZD A;  3D5J A;  2XBQ A;  1XFL A;  4DSQ A;  1PGT A;  5ECR B;  3IDV A;  3E0U A;  4TOP A;  2JZR A;  3RFR C;  3D22 A;  3P8W A;  1YY7 A;  2YWM A;  4KUN A;  3A2V A;  1H4O A;  2YWO A;  4MNN A;  2I1U A;  4OFM A;  2L5O A;  1B4Q A;  3KMO A;  2H1L A;  1A8Y A;  1EEJ A;  1QXH A;  4TXO B;  3VPT A;  1SKW B;  4K7I A;  2R6K A;  1X9M B;  5IPG A;  5G5E A;  3RPN A;  1GNE A;  4Q5F A;  10GS A;  1EV4 A;  2H71 A;  3TKS A;  4F2I A;  1OKD A;  5ELA A;  5D8I A;  2DIY A;  4XIH A;  2E2M A;  2N5B A;  4V2L A;  5C04 A;  1FAA A;  5IM9 A;  5DDL A;  3DRN A;  1Z6N A;  3DVW A;  1MD3 A;  2DML A;  3F9U A;  4POK A;  5D9T A;  2BJX A;  4PUF C;  4V1A g;  2C4J A;  5KEJ A;  2GTU A;  5A1N A;  3EPT A;  5KN1 A;  19GS A;  2PU9 C;  1WWJ A;  5J40 A;  4WET A;  2IWT A;  1MDI A;  3HVN A;  2LV3 A;  4FYB A;  2GZP A;  2ZNM A;  1N25 A;  2H1A A;  2YP6 A;  3IPZ A;  4TRX A;  1VGL A;  4V2M A;  1ABA A;  2C0E A;  5HFG A;  2J23 A;  2P5Q A;  1A2L A;  2H75 A;  4TN8 A;  1USB A;  3LXT A;  2OBK A;  4NMU A;  3APQ A;  5J41 A;  1T3B A;  4KND A;  4G0I A;  1SJ6 A;  1Z3E A;  3KTB A;  5ID2 A;  4GQF A;  1N2A A;  4NWY A;  5B8A A;  2HZE A;  5CRG A;  4EVM A;  3KXO A;  2PUK C;  2IFQ A;  1HNC A;  5IQY A;  5DAK B;  4XRD A;  5LNK e;  1SL2 B;  4MJB A;  1OE7 A;  3EMP A;  2D2Z A;  4XS6 A;  2J9H A;  1SJZ A;  4X4J A;  3R2Q A;  1YF0 A;  4KDU A;  4PX1 A;  4BVX A;  2H0I A;  1ZYN A;  1Y1U A;  4O32 A;  1V2A A;  3TKP A;  3ZMK A;  4K6X A;  4G2E A;  4DVC A;  2OBI A;  2H70 A;  2F8A A;  3GRX A;  2HNL A;  3VLN A;  4IHU A;  1FO5 A;  4LMW A;  4BIK A;  5GSS A;  3ZIV A;  2VLV A;  1ILO A;  3QAG A;  1SJI A;  3TKS C;  5DAL A;  1W4V A;  3CQF A;  1PMT A;  3GFK A;  5L71 A;  1EGO A;  5D73 A;  2FNO A;  2V1M A;  4CY6 A;  4ZBD A;  4KB3 A;  2CX3 A;  18GS A;  3H79 A;  2YJH A;  3KGK A;  1M0U A;  4PHZ C;  1GWC A;  5DJL A;  4O7H A;  5F0G A;  1ERU A;  2ZUP A;  1DE2 A;  2PMT A;  6GSV A;  1OC3 A;  8GSS A;  3QAW A;  2IIY A;  3KCM A;  4I2T A;  4GXZ A;  1X5C A;  4Q5Q A;  2EC4 A;  3FY7 A;  2V6O A;  3FR3 A;  3I9V 2;  3NIV A;  1I9D A;  4KE3 A;  5GAN D;  4AF2 A;  5G2Z A;  5ECS A;  2YZU A;  5A34 B;  5DQY A;  4N10 A;  2WZ9 A;  1CQH A;  1M3J A;  4O5U A;  3IHQ A;  5ABR A;  4HQZ A;  3KD0 A;  5JWQ B;  1EP8 A;  3QCP A;  3J7Y b;  5IMC A;  2YPM A;  2MMO A;  3KP9 A;  4BPY A;  2WW0 A;  1XWC A;  1WOU A;  2GQK A;  1QMV A;  2X64 A;  1R5P A;  1SK1 A;  1TJD A;  2KP2 A;  1TOF A;  2WUL A;  4ZBB A;  1K0M A;  2K9F A;  1ON4 A;  2LQQ A;  3ERG A;  3FRC A;  6GSS A;  3KJY A;  1XVW A;  3GL3 A;  6GST A;  4GDF A;  2YOI A;  3QR6 A;  3HJM A;  1SK0 A;  3GKK A;  2VL2 C;  3ZVJ A;  1PD2 1;  1G6W A;  1GSU A;  1GTA A;  1GLQ A;  2OKA A;  2YJ7 A;  1M2A A;  1R26 A;  4JR4 A;  5COH A;  1FB0 A;  3EIN A;  4PI0 C;  4POL A;  1TXU A;  4MMM A;  3GTU B;  2VCQ A;  5AIV A;  1R7H A;  3TJK A;  4IQ1 A;  1YEP A;  2X8G A;  3TJF A;  2LKU A;  5IMZ A;  4FH8 A;  4FIW A;  3EU4 A;  1TDI A;  4BL7 A;  4KA0 A;  17GS A;  3ZML A;  4J2F A;  1S3D A;  3D21 A;  2NPB A;  3ERF A;  2GQL A;  4ML6 A;  2YNX A;  4CW9 A;  3GH6 A;  4XS1 A;  2R4V A;  2C3Q A;  5DQS A;  1XPV A;  1XG8 A;  3ZFB A;  1YZX A;  2NBS A;  1ST9 A;  5KN2 A;  1V98 A;  2VCT A;  4ECC A;  4LL1 B;  3F63 A;  2O36 A;  1JFU A;  2HRF A;  2VO4 A;  2JU5 A;  4BA7 A;  2V32 A;  3RAZ A;  3ZRD A;  2WW3 A;  2IPA A;  2OA7 A;  2OE0 A;  1LU4 A;  4DSR A;  3DXB A;  3LG6 A;  5FWG A;  4HDE A;  1ZYE A;  5INY A;  5AIX A;  2EFE A;  4TR1 B;  1K3L A;  4HI7 A;  5CRE A;  3IAS 2;  3GL5 A;  1M3I A;  4TVE A;  4DSS A;  3KTL A;  3F4T A;  3QOU A;  2TIR A;  4EO3 A;  1EEM A;  4X43 A;  5G1L A;  4EC0 A;  3G7I A;  4EIP A;  3C71 A;  2HSN A;  1A0R P;  4YH2 A;  2A2P A;  4MZW A;  2WGR A;  2YAN A;  3VWX A;  4GSN A;  1FW1 A;  3TCO A;  5CRD A;  1BX9 A;  1A24 A;  2PN8 A;  2P31 A;  1HNA A;  4HS1 A;  5IO0 A;  2IME A;  2H6X A;  3QFB C;  2GT5 A;  3L4N A;  5B8B A;  2H74 A;  3MNG A;  4W66 A;  5H5S A;  3HA9 A;  1PL2 A;  4KW6 A;  1BG5 A;  3HMJ G;  2WZS A;  1MD4 A;  1ZCP A;  3HHV A;  2WVX A;  1WMJ A;  3GNJ A;  4IN0 A;  3C8E A;  5FHI A;  2B7J A;  1SVO A;  1JZW A;  4ULX A;  1QQ2 A;  2H1B A;  3FZ9 A;  4G0L A;  3P7X A;  1MEK A;  5D9X A;  2O8V B;  3KP8 A;  2VCX A;  1T4Z A;  4XHM A;  2A2S A;  3TKS E;  5B6N A;  3TUE A;  1UN2 A;  3PIN A;  4FYC A;  5F06 A;  1EWX A;  1K3Y A;  5DBQ A;  3ME7 A;  3DGQ A;  2FGX A;  5HR0 A;  1G7O A;  4ZBA A;  5C00 A;  5EY6 A;  1TRU A;  2GGT A;  3TKR A;  4WBJ A;  2GS3 A;  1Z7R A;  3OR5 A;  3KMN A;  3M1G A;  3CBU A;  4L8E A;  2R2J A;  3J7Y k;  5HFI A;  2AAW A;  4YKF A;  4MK3 A;  2R37 A;  2V2G A;  2B1L A;  3CSJ A;  5HR1 A;  3TJG A;  1YDK A;  2YV7 A;  2RUE A;  1UA5 A;  3C73 A;  3VI5 A;  2AUV A;  2I3Y A;  3DEX A;  3KH9 A;  2DLX A;  3EU3 A;  2OAD A;  2PER A;  3BBY A;  1F37 A;  4LL4 B;  4LMV A;  3E9J B;  2K18 A;  5B7C A;  2C0D A;  1XIY A;  1TK0 B;  4F9Z A;  5G5F A;  4N11 A;  3LGC A;  1T7P B;  3NZN A;  2QGV A;  4A5P A;  1EGR A;  3IR4 A;  5AN1 A;  1TXX A;  2L5L A;  2FWF A;  3HZ4 A;  1PL1 A;  5ECN B;  2HXK A;  3DD3 A;  1X9W B;  2QC7 A;  3BD2 A;  1TRS A;  1AAZ A;  3MIX A;  3CMI A;  4D73 B;  2VOC A;  3US3 A;  3ZTL A;  1WE0 A;  5BMU B;  4K9Z A;  1VF3 A;  4EDY A;  1SK2 A;  3M9J A;  5G31 A;  1N8J A;  5F07 A;  3G9B A;  2HYX A;  3R3E A;  2DJ0 A;  5ID2 B;  1VF1 A;  2PGT A;  3UAP A;  4N30 A;  2EIO A;  4Q5R A;  1WRY A;  2HT9 A;  2HZE B;  4MCU A;  4AI6 A;  2WW1 A;  1JLW A;  3IE3 A;  2OT3 A;  4QL9 A;  3GN3 A;  2KUC A;  3TJJ A;  4BVX B;  1AQV A;  2K6V A;  3DML A;  1PX6 A;  2C8U A;  2UZ8 A;  2QSI A;  4N0Z A;  1PFO A;  3M9K A;  4TR3 A;  2F3M A;  5A5K A;  3BCI A;  1M9B A;  4I2U A;  1DSB A;  2DSA A;  3ERW A;  5J3R A;  3PR8 A;  1TRV A;  2C3T A;  1E2Y A;  2RII A;  5LD0 A;  3O6T A;  3F4R A;  3HXS A;  2HSM B;  1TI3 A;  5A5H B;  3HD5 A;  3CWG A;  2IMF A;  2DJJ A;  4ZL9 A;  2UV8 G;  4X1U A;  4ZIJ A;  4YQV A;  1EOH A;  3F0I A;  2IMI A;  4MP4 A;  3A5I A;  3HYP A;  5G1K A;  4EXJ A;  4DEJ A;  1TU8 A;  2FLS A;  3IC4 A;  1PN0 A;  1PN9 A;  1V9W A;  1GSQ A;  3IRA A;  1GH2 A;  4J56 E;  2GZY A;  3ZZX A;  4USS A;  3LWA A;  3CXG A;  3EYT A;  3HY2 A;  2KLX A;  2VLT A;  3TU3 B;  1HD2 A;  2XPD A;  4ZB6 A;  1YKA A;  2CAI A;  5LCZ A;  3UIW A;  2HSH A;  4GRF A;  4PXO A;  3VK9 A;  1FOV A;  2FD3 A;  5J4U A;  5ECI B;  2QA1 A;  9GSS A;  3VI7 A;  4OFT A;  2CV4 A;  2X49 A;  4ILF A;  5G30 A;  1QK8 A;  5HR2 A;  3QAV A;  4Q5N A;  3HVV A;  2HRA A;  4G9H A;  3H1N A;  3L78 A;  2VUP A;  1KNG A;  5D9V A;  1Q98 A;  4WF5 A;  2VL2 A;  1OAZ A;  3RDW A;  3IAM 2;  4NPB A;  3N9J A;  3GST A;  3TRP A;  1GTU A;  3TDG A;  1ZL9 A;  1U88 A;  2RM6 A;  2GST A;  4FXY P;  1F2E A;  1PKW A;  4MF5 A;  1SYR A;  1U87 A;  2AB6 A;  3UJ1 A;  4F82 A;  4X0X A;  2VCZ A;  2XPE A;  1M2B A;  4IS0 A;  4YQM A;  1GUL A;  1YF1 A;  3F6F A;  1DE1 A;  4OO5 A;  4G19 A;  4TXO A;  4HZ4 A;  4HQS A;  2VCW A;  2JAC A;  4V2N A;  4BVY A;  1TKD B;  4L0W A;  3IOS A;  2XBI A;  2DKH A;  5CRW A;  2GQM A;  2FCH A;  3IBH A;  4OO4 A;  5J4Y A;  5JCW A;  2FA4 A;  3VWU A;  3LEF A;  1GLP A;  2M72 A;  3WT2 A;  3GUS A;  2B5X A;  1F6M C;  3I69 A;  1XWK A;  2C0F A;  2R0P A;  2GSQ A;  4F0B A;  4IJI A;  4MDC A;  5GST A;  3IHG A;  4P3Y B;  3HCZ A;  5D96 A;  4POM A;  3UOM A;  4KCA A;  3CRU A;  1ZOF A;  1BED A;  1AW9 A;  3Q74 A;  1M7T A;  2GLR A;  5ECK B;  1OC9 B;  1GUH A;  5DCH A;  4CDO A;  3EUR A;  1KBN A;  2CVD A;  4IKH A;  3GKN A;  2WJU A;  3MYD A;  2O5V A;  4YAV A;  5HR3 A;  3H4K A;  2H1D A;  1SKR B;  3Q18 A;  4ML1 A;  4PQI A;  5IO2 A;  5KOX A;  3P2A A;  3U5R E;  1JHB A;  6GSU A;  2VD1 A;  2VAF A;  1QGV A;  1TK5 B;  1ACV A;  3DWV A;  1K0D A;  3FZ5 A;  2CAQ A;  1OKT A;  3F6D A;  4MZB A;  2WVY A;  5DAK A;  3HVX A;  3WGE A;  3CTG A;  1OE8 A;  2CA8 A;  2Z9S A;  3PGT A;  4IBP A;  1URM A;  3FR6 A;  2FWE A;  2TRX A;  3HKR A;  3GH9 A;  2DC5 A;  2QA2 A;  3KZQ A;  2L4Q A;  2GSS A;  2HLS A;  4AJ8 A;  3ZRE A;  1B9X C;  4LLR A;  3H93 A;  4HSC X;  1Y6E A;  3QFA C;  3WT1 A;  2X99 A;  4YQU A;  1OVN A;  4HOJ A;  1J08 A;  16GS A;  2VL3 A;  3ED3 A;  2WVX B;  1UVZ A;  1ZYP A;  2ON5 A;  4E8E A;  2L57 A;  4TKY A;  3ZIT A;  4ECI A;  4IEL A;  4TW5 A;  2LJR A;  3PPU A;  2N5A A;  3M3M A;  2WRT A;  1O73 A;  1BQ7 A;  3TB2 A;  4WKW A;  1PSQ A;  4ZXG A;  2AHE A;  4GST A;  1B48 A;  2CZ2 A;  2PWJ A;  1ERT A;  2B5E A;  4K7O A;  1V40 A;  1SYX A;  4IP1 A;  2HRK B;  3F8U A;  2CQ9 A;  1GTB A;  2GVP A;  1OYJ A;  1TP9 A;  2F8F A;  1U6T A;  1ZYQ B;  4TR0 A;  1S3A A;  3EE2 A;  1UC7 A;  2NTO A;  5A34 A;  1MDK A;  3DVX A;  3GHA A;  5J4V A;  1WJK A;  1W89 A;  5CRH A;  1A0F A;  12GS A;  3FEU A;  2JSZ A;  3D4T A;  1R5A A;  5GAP D;  4FYU A;  1VF4 A;  2L6D A;  2ALB A;  3TKQ A;  1EOG A;  5D9W A;  4ZB9 A;  1SEN A;  3EMX A;  2LST A;  4E8H A;  5ECO B;  2H6Z A;  3RGB C;  1TI1 A;  1EV9 A;  5KN0 A;  3APO A;  1RQM A;  1FVK A;  4N0V A;  5H5R A;  11GS A;  2B7K A;  4WEY A;  3GSS A;  1M9A A;  1NSW A;  1O6J A;  3LXZ A;  3GA4 A;  3TOT A;  4LA1 A;  1GSD A;  5D93 A;  5J9C A;  5CNW A;  2EIR A;  4EKZ A;  4JBB A;  3IV4 A;  4MLY A;  4NAX A;  2H72 A;  3AY8 A;  4NV2 A;  1ZZY A;  2BMX A;  1SU9 A;  3DYR A;  3FR9 A;  2RUF A;  6GSY A;  3PH9 A;  2PVQ A;  4V1A p;  4L5O A;  2HE3 A;  1BG1 A;  4WR4 A;  1XBS A;  3TOU A;  2VLU A;  1YJ6 A;  1K0O A;  4GQC A;  3UMA A;  4IQA A;  3EC3 A;  3UAR A;  1X0R A;  3GKM A;  5ECH B;  1PKZ A;  3TJB A;  2EIQ A;  4PTS A;  1DBY A;  2I4A A;  5ECM B;  4HJM A;  2X4A A;  2H30 A;  4F03 A;  2A4V A;  1LJR A;  2H0H A;  4RI6 A;  1ERW A;  4OCF A;  3VWW A;  2LRT A;  1G7E A;  1AQX A;  3GX8 A;  3ZYW A;  3SBC A;  1K0N A;  3CSI A;  2R0G A;  1V57 A;  4O92 A;  5EL8 A;  1YEW C;  2E0Q A;  5IPH A;  3F3R A;  2I9H A;  2O89 A;  4K5R A;  2B6M A;  4FQU A;  3A5W A;  3QD9 A;  4KDX A;  2H01 A;  2DJ3 A;  1YQ1 A;  2HZF A;  2P0G A;  4JED A;  4RUV A;  1I1I P;  3N5O A;  5A1N B;  2R0C A;  2LRN A;  1A2M A;  3L9S A;  4PQH A;  1SD8 A;  3NOF A;  3W6G A;  2DJ2 A;  5CO3 A;  5ECL B;  2GDR A;  5AIS A;  5DVB A; 
#chains in the Genus database with same CATH homology
 2LS5 A;  3L0H A;  1RK4 A;  4RI7 A;  2IL3 A;  2LRC A;  3FZ4 A;  2XHF A;  3GV1 A;  3IXR A;  2HQT A;  1ERV A;  4ECB A;  2BTO T;  3BCK A;  1XOB A;  1BF5 A;  2PVO C;  2JZS A;  2EFH A;  1GL8 A;  1V58 A;  4J57 E;  3GUR A;  3L9V A;  4K5S A;  4OMV A;  1SVL A;  3CYN A;  2H8L A;  1RW1 A;  1AC1 A;  2YCD A;  4MAB A;  2VL9 A;  5CP1 A;  3MWH A;  2I81 A;  5A4U A;  4E68 A;  2IFQ B;  2REM A;  2VKZ G;  2HI7 A;  4K0N A;  4KGI A;  3C1R A;  4L5L A;  1XZO A;  4IJ3 A;  5BRT A;  3MAK A;  2H19 A;  5IMA A;  4IW9 A;  4IVF A;  1THO A;  4KAE A;  1XWA A;  4OFN A;  4CY8 A;  3O3T A;  2CT6 A;  3GIX A;  2YV9 A;  1C72 A;  3E3E A;  1O8W A;  1HNB A;  4I5Q A;  4GLT A;  5A4V A;  2B1K A;  3DIE A;  2H1G A;  4MH2 A;  3LYP A;  1X5D A;  3VPQ A;  4BVY B;  2C1Y A;  5DAL B;  1YEX A;  2N5F A;  1BYE A;  2LNS A;  3TRX A;  4KF9 A;  4EE0 A;  2MZC A;  5CAX A;  1T8E B;  4Z2U A;  3I6A A;  2CVK A;  4NHZ A;  3LQ7 A;  2K8V A;  1J0F A;  4QL7 A;  2O87 A;  3P90 A;  4MZC A;  4ID0 A;  4XS4 A;  1NHY A;  3U6V A;  1XVQ A;  3IC8 A;  2C0G A;  4AKX B;  4FO5 A;  3UVH A;  3ZFL A;  1IYI A;  1GP1 A;  1XW6 A;  4MJA A;  2X8H A;  3KH7 A;  4K2X A;  3LOR A;  3RBT A;  5IMF A;  1JZR A;  3D6I A;  5DCG A;  3LW9 A;  1WP0 A;  2WCI A;  3ISO A;  1NM3 A;  3TGZ A;  7GSS A;  5HFK A;  4AKG A;  2FY6 A;  1AXD A;  3LYK A;  1WIK A;  4D73 A;  3MDK A;  1TRW A;  3GYK A;  2G0F A;  1X5E A;  5IIZ A;  1O85 A;  5BMU A;  3FKF A;  1Z5Y E;  2GSR A;  4AJ7 A;  2MYG A;  1E6B A;  3GKX A;  5EPF A;  1O7U A;  4ECJ A;  5JCG A;  1T00 A;  1NW2 A;  2O7K A;  2L59 A;  2F9S A;  1GSY A;  4KSO A;  2MMA A;  5JCU A;  2PBJ A;  1SD9 A;  1XWG A;  5J47 A;  2R3X A;  3GX0 A;  2DBC A;  2TRC P;  3W8S A;  1K0B A;  4KSM A;  2LNT A;  1QUW A;  3L9U A;  5JWO B;  1A2J A;  1FVJ A;  4JRR A;  1GUK A;  4OWY A;  1OC8 A;  5F8B A;  3HVS A;  4Z7X A;  4GTU A;  3ZIJ A;  2AYT A;  3F3Q A;  2H6Y A;  2HRN A;  1WPI A;  4O5Q A;  1PRX A;  1AQW A;  4MA9 A;  2VD0 A;  3VWV A;  1K3O A;  3FZA A;  2EFD A;  3KEB A;  4G10 A;  2DKI A;  4AKI A;  2YZH A;  3BJ5 A;  3SWL A;  2M80 A;  1XW5 A;  2VIM A;  2MBS A;  2NVL A;  3HDC A;  1H75 A;  4K7N A;  1F9M A;  5E59 A;  1SKS B;  5IOX A;  4G01 A;  4BL7 B;  1VRS D;  3D4M A;  1EZK A;  2HSM A;  2DJ1 A;  4HJ2 A;  3UBK A;  5A5H A;  2FUG 2;  4XCS A;  13GS A;  3WGD A;  3LSZ A;  5F05 A;  4NHW A;  2X8C A;  4KH7 A;  2MMZ A;  1PQN A;  1IYH A;  2LTK A;  4WF4 A;  2ES7 A;  14GS A;  3ZL5 A;  1J9B A;  2MMN A;  1Q4J A;  3F4S A;  4KX4 A;  4TXV A;  4L0U A;  2QKE A;  5EVO A;  1MTC A;  1FB6 A;  4QMK A;  1HYU A;  4OD7 A;  4MJE A;  2CVB A;  3HZ8 A;  1MDJ A;  4GF0 A;  3A2W A;  2C3N A;  3M8N A;  1GUM A;  1JZO A;  2HSY A;  4HU7 A;  4MH3 A;  3ZVJ D;  1AUC A;  5DJM A;  2A4H A;  1BJX A;  4PGT A;  4DSS B;  4KDY A;  1CQG A;  1HQO A;  4ZB8 A;  4IP6 A;  3RHB A;  4HU9 A;  5GZZ B;  2IN3 A;  1XW9 A;  20GS A;  3VFI A;  1G6Y A;  3FMW A;  4Z2R A;  3CRT A;  4PUR A;  4I8B A;  1F3B A;  2HSN B;  3LJR A;  1Z7P A;  3TRQ A;  1F3A A;  3IA1 A;  2V41 A;  3IK7 A;  4ACS A;  3DKS A;  4QQ7 A;  1G0T A;  2C80 A;  5J9B A;  4EF0 A;  3H8Q A;  2L4C A;  3WYW A;  1ZMA A;  5E4W A;  2DMM A;  2G2Q A;  2JL4 A;  3LFL A;  3G7J A;  3C1S A;  1B4P A;  1VF2 A;  5JWR B;  2CX4 A;  2FWH A;  1PX7 A;  1XWB A;  5ELG A;  1Y25 A;  1ML6 A;  2OAC A;  1O8X A;  3CSH A;  1KEB A;  3MSZ A;  3EVI A;  4NV5 A;  1YKC A;  4GWR A;  1A23 A;  1Z9H A;  4PNG A;  4ZB7 A;  1M99 A;  4CHS A;  1QFN A;  2CZ3 A;  3D0Z A;  5IOW A;  3S9F A;  1O81 A;  3HJP A;  2IMD A;  1XCC A;  3UVT A;  2WDU A;  3Q19 A;  2GT6 A;  2R5G A;  3APS A;  4EIQ A;  4MPG A;  3CTF A;  4TR4 A;  4ZL7 A;  2IJY A;  4PQ1 A;  4ICY A;  2LJA A;  2K8S A;  1OC9 A;  4JE1 A;  1FG4 A;  4K8M A;  4K1F A;  2KP1 A;  3QDN A;  2JSY A;  3UBL A;  1S3C A;  2H76 A;  2WS2 A;  1M2D A;  5A4W A;  4MF6 A;  4JZQ A;  3C7M A;  2F51 A;  4O5R A;  2KOK A;  2O85 A;  2FWG A;  4XTS A;  4MF7 A;  2GZZ A;  5H5Q A;  3A2X A;  4WXT A;  4ZL8 A;  2VM2 A;  2P5R A;  1FHE A;  4OCE A;  3ME8 A;  2AV4 A;  2WB9 A;  1U3A A;  4AKH A;  4POB A;  2ON7 A;  3JCM L;  4PNF A;  3EWL A;  3A3T A;  3G7Y A;  3UL3 A;  3I43 A;  1DUG A;  1YVL A;  3RPP A;  4N3Z A;  1X9S B;  1U3I A;  5KN3 A;  22GS A;  1THX A;  4WR5 A;  1SVM A;  3VUR A;  4K0G A;  3W8J A;  1GTI A;  2NDO A;  2WFC A;  1NHO A;  6GSW A;  1GRX A;  2LJK A;  4PUA A;  2B5Y A;  3HJO A;  1TK8 B;  1SL0 B;  3GTU A;  2B3S A;  3KM6 A;  4GSS A;  1TTZ A;  2H73 A;  1I5G A;  5B6M A;  2A2R A;  3RHC A;  4I6X A;  1GSE A;  2EFC A;  2OE1 A;  1TW9 A;  2AJQ B;  4KCE A;  2RM5 A;  2OE3 A;  3KIJ A;  4RQR A;  2YWN A;  3BOA A;  4MJC A;  4NXI A;  4GCI A;  5FT3 A;  4I97 A;  6GSX A;  1BAY A;  2LQO A;  1TU7 A;  2JAD A;  1JLV A;  4MPF A;  5IMD A;  2MBT A;  2HFD A;  3Q6O A;  4EDZ A;  5IMV A;  1A8L A;  4ISD A;  1FOH A;  4H86 A;  1B9Y C;  3K8N A;  3FYG A;  1ZGN A;  3QMX A;  5KOW A;  5ECP B;  2VM1 A;  5CYY A;  3GMF A;  2HRK A;  5J5N A;  3FK8 A;  4K2D A;  3ZLP A;  4G0K A;  1LBK A;  2PPT A;  4HUA A;  4HEA 2;  1XXU A;  2RLI A;  2DJK A;  2YN1 A;  3V1W A;  4WBR D;  4Z2T A;  2H66 A;  3UEM A;  4TR1 A;  4F0C A;  1T4Y A;  4BWQ A;  4XRA A;  5HQP A;  4ZIL A;  2V6K A;  2DIZ A;  1Z6M A;  5ENU A;  1GNW A;  3O76 A;  2XC2 A;  4JR6 A;  4HZ2 A;  1EP7 A;  2LEG A;  1T1V A;  4EUY A;  3IK9 A;  2OJL A;  4XS4 B;  4RQX A;  2VCV A;  2E7P A;  1XOA A;  2LUS A;  1GSS A;  2M46 A;  2L6C A;  4BWS A;  1K0C A;  1KTE A;  4AGS A;  5AGY A;  2H0G A;  3WD6 A;  5ECQ B;  2ZCT A;  1R4W A;  3FHK A;  3M0F A;  2FHE A;  1PA3 A;  4AJ6 A;  4JU5 A;  2YWI A;  2JZT A;  2FA8 A;  4IGJ A;  1SL1 B;  1GSF A;  1AIU A;  4YKG A;  1K0A A;  2E2G A;  3FW2 A;  1B8X A;  2IMK A;  3WGX A;  4YAP A;  3QPM A;  4EL1 A;  2KHP A;  1JZD A;  3D5J A;  2XBQ A;  1XFL A;  4DSQ A;  1PGT A;  5ECR B;  3IDV A;  3E0U A;  4TOP A;  2JZR A;  3D22 A;  3P8W A;  1YY7 A;  2YWM A;  4KUN A;  3A2V A;  1H4O A;  2YWO A;  4MNN A;  2I1U A;  4OFM A;  2L5O A;  1B4Q A;  3KMO A;  2H1L A;  1A8Y A;  1EEJ A;  1QXH A;  4TXO B;  3VPT A;  1SKW B;  4K7I A;  2R6K A;  1X9M B;  5IPG A;  5G5E A;  3RPN A;  1GNE A;  4Q5F A;  10GS A;  1EV4 A;  2H71 A;  3TKS A;  4F2I A;  1OKD A;  5ELA A;  5D8I A;  2DIY A;  4XIH A;  2E2M A;  2N5B A;  4V2L A;  5C04 A;  1FAA A;  5IM9 A;  5DDL A;  3DRN A;  1Z6N A;  3DVW A;  1MD3 A;  2DML A;  3F9U A;  4POK A;  5D9T A;  2BJX A;  4PUF C;  4V1A g;  2C4J A;  5KEJ A;  2GTU A;  5A1N A;  3EPT A;  5KN1 A;  19GS A;  2PU9 C;  1WWJ A;  5J40 A;  4WET A;  2IWT A;  1MDI A;  2LV3 A;  4FYB A;  2GZP A;  2ZNM A;  1N25 A;  2H1A A;  2YP6 A;  3IPZ A;  4TRX A;  1VGL A;  4V2M A;  1ABA A;  2C0E A;  5HFG A;  2J23 A;  2P5Q A;  1A2L A;  2H75 A;  4TN8 A;  1USB A;  3LXT A;  2OBK A;  4NMU A;  3APQ A;  5J41 A;  1T3B A;  4KND A;  4G0I A;  1SJ6 A;  1Z3E A;  3KTB A;  5ID2 A;  4GQF A;  1N2A A;  4NWY A;  5B8A A;  2HZE A;  5CRG A;  4EVM A;  3KXO A;  2PUK C;  2IFQ A;  1HNC A;  5IQY A;  5DAK B;  4XRD A;  5LNK e;  1SL2 B;  4MJB A;  1OE7 A;  3EMP A;  2D2Z A;  4XS6 A;  2J9H A;  1SJZ A;  4X4J A;  3R2Q A;  1YF0 A;  4KDU A;  4PX1 A;  4BVX A;  2H0I A;  1ZYN A;  1Y1U A;  4O32 A;  1V2A A;  3TKP A;  3ZMK A;  4K6X A;  4G2E A;  4DVC A;  2OBI A;  2H70 A;  2F8A A;  3GRX A;  2HNL A;  3VLN A;  4IHU A;  1FO5 A;  4LMW A;  5GSS A;  3ZIV A;  2VLV A;  1ILO A;  3QAG A;  1SJI A;  3TKS C;  5DAL A;  1W4V A;  1PMT A;  3GFK A;  5L71 A;  1EGO A;  5D73 A;  2FNO A;  2V1M A;  4CY6 A;  4ZBD A;  4KB3 A;  2CX3 A;  18GS A;  3H79 A;  2YJH A;  3KGK A;  1M0U A;  1GWC A;  5DJL A;  4O7H A;  5F0G A;  1ERU A;  2ZUP A;  1DE2 A;  2PMT A;  6GSV A;  1OC3 A;  8GSS A;  3QAW A;  2IIY A;  3KCM A;  4I2T A;  4GXZ A;  1X5C A;  4Q5Q A;  2EC4 A;  3FY7 A;  2V6O A;  3FR3 A;  3I9V 2;  3NIV A;  1I9D A;  4KE3 A;  5GAN D;  4AF2 A;  5G2Z A;  5ECS A;  2YZU A;  5A34 B;  5DQY A;  4N10 A;  2WZ9 A;  1CQH A;  4O5U A;  3IHQ A;  5ABR A;  4HQZ A;  3KD0 A;  5JWQ B;  1EP8 A;  3QCP A;  3J7Y b;  5IMC A;  2YPM A;  2MMO A;  3KP9 A;  4BPY A;  1XWC A;  1WOU A;  2GQK A;  1QMV A;  2X64 A;  1R5P A;  1SK1 A;  1TJD A;  2KP2 A;  1TOF A;  2WUL A;  4ZBB A;  1K0M A;  2K9F A;  1ON4 A;  2LQQ A;  3ERG A;  3FRC A;  6GSS A;  3KJY A;  1XVW A;  3GL3 A;  6GST A;  4GDF A;  2YOI A;  3QR6 A;  3HJM A;  1SK0 A;  3GKK A;  2VL2 C;  3ZVJ A;  1PD2 1;  1G6W A;  1GSU A;  1GTA A;  1GLQ A;  2OKA A;  2YJ7 A;  1M2A A;  1R26 A;  4JR4 A;  5COH A;  1FB0 A;  3EIN A;  4POL A;  1TXU A;  4MMM A;  3GTU B;  2VCQ A;  5AIV A;  1R7H A;  3TJK A;  4IQ1 A;  1YEP A;  2X8G A;  3TJF A;  2LKU A;  5IMZ A;  4FH8 A;  4FIW A;  3EU4 A;  1TDI A;  4BL7 A;  4KA0 A;  17GS A;  3ZML A;  4J2F A;  1S3D A;  3D21 A;  2NPB A;  3ERF A;  2GQL A;  4ML6 A;  2YNX A;  4CW9 A;  3GH6 A;  4XS1 A;  2R4V A;  2C3Q A;  5DQS A;  1XPV A;  3ZFB A;  1YZX A;  2NBS A;  1ST9 A;  5KN2 A;  1V98 A;  2VCT A;  4ECC A;  4LL1 B;  3F63 A;  1JFU A;  2HRF A;  2VO4 A;  2JU5 A;  4BA7 A;  2V32 A;  3RAZ A;  3ZRD A;  2IPA A;  2OA7 A;  2OE0 A;  1LU4 A;  4DSR A;  3DXB A;  3LG6 A;  5FWG A;  4HDE A;  1ZYE A;  5INY A;  5AIX A;  2EFE A;  4TR1 B;  1K3L A;  4HI7 A;  5CRE A;  3IAS 2;  3GL5 A;  4TVE A;  4DSS A;  3KTL A;  3F4T A;  3QOU A;  2TIR A;  4EO3 A;  1EEM A;  4X43 A;  5G1L A;  4EC0 A;  3G7I A;  4EIP A;  3C71 A;  2HSN A;  1A0R P;  4YH2 A;  2A2P A;  4MZW A;  2WGR A;  2YAN A;  3VWX A;  4GSN A;  1FW1 A;  3TCO A;  5CRD A;  1BX9 A;  1A24 A;  2PN8 A;  2P31 A;  1HNA A;  4HS1 A;  5IO0 A;  2IME A;  2H6X A;  3QFB C;  2GT5 A;  3L4N A;  5B8B A;  2H74 A;  3MNG A;  4W66 A;  5H5S A;  3HA9 A;  1PL2 A;  4KW6 A;  1BG5 A;  3HMJ G;  1MD4 A;  1ZCP A;  3HHV A;  1WMJ A;  3GNJ A;  4IN0 A;  3C8E A;  5FHI A;  2B7J A;  1SVO A;  1JZW A;  4ULX A;  1QQ2 A;  2H1B A;  3FZ9 A;  4G0L A;  3P7X A;  1MEK A;  5D9X A;  2O8V B;  3KP8 A;  2VCX A;  1T4Z A;  4XHM A;  2A2S A;  3TKS E;  5B6N A;  3TUE A;  1UN2 A;  3PIN A;  4FYC A;  5F06 A;  1EWX A;  1K3Y A;  5DBQ A;  3ME7 A;  3DGQ A;  2FGX A;  5HR0 A;  1G7O A;  4ZBA A;  5C00 A;  5EY6 A;  1TRU A;  2GGT A;  3TKR A;  4WBJ A;  2GS3 A;  1Z7R A;  3OR5 A;  3KMN A;  3M1G A;  3CBU A;  4L8E A;  2R2J A;  3J7Y k;  5HFI A;  2AAW A;  4YKF A;  4MK3 A;  2R37 A;  2V2G A;  2B1L A;  3CSJ A;  5HR1 A;  3TJG A;  1YDK A;  2YV7 A;  2RUE A;  1UA5 A;  3C73 A;  3VI5 A;  2AUV A;  2I3Y A;  3DEX A;  3KH9 A;  2DLX A;  3EU3 A;  2OAD A;  2PER A;  3BBY A;  1F37 A;  4LL4 B;  4LMV A;  3E9J B;  2K18 A;  5B7C A;  2C0D A;  1XIY A;  1TK0 B;  4F9Z A;  5G5F A;  4N11 A;  3LGC A;  1T7P B;  3NZN A;  2QGV A;  4A5P A;  1EGR A;  3IR4 A;  5AN1 A;  1TXX A;  2L5L A;  2FWF A;  3HZ4 A;  1PL1 A;  5ECN B;  2HXK A;  3DD3 A;  1X9W B;  2QC7 A;  3BD2 A;  1TRS A;  1AAZ A;  3MIX A;  3CMI A;  4D73 B;  2VOC A;  3US3 A;  3ZTL A;  1WE0 A;  5BMU B;  4K9Z A;  1VF3 A;  4EDY A;  1SK2 A;  3M9J A;  5G31 A;  1N8J A;  5F07 A;  3G9B A;  2HYX A;  3R3E A;  2DJ0 A;  5ID2 B;  1VF1 A;  2PGT A;  3UAP A;  4N30 A;  2EIO A;  4Q5R A;  1WRY A;  2HT9 A;  2HZE B;  4MCU A;  4AI6 A;  1JLW A;  3IE3 A;  2OT3 A;  4QL9 A;  3GN3 A;  2KUC A;  3TJJ A;  4BVX B;  1AQV A;  2K6V A;  3DML A;  1PX6 A;  2C8U A;  2UZ8 A;  2QSI A;  4N0Z A;  3M9K A;  4TR3 A;  2F3M A;  5A5K A;  3BCI A;  1M9B A;  4I2U A;  1DSB A;  2DSA A;  3ERW A;  5J3R A;  3PR8 A;  1TRV A;  2C3T A;  1E2Y A;  2RII A;  5LD0 A;  3O6T A;  3F4R A;  3HXS A;  2HSM B;  1TI3 A;  5A5H B;  3HD5 A;  3CWG A;  2IMF A;  2DJJ A;  4ZL9 A;  2UV8 G;  4X1U A;  4ZIJ A;  4YQV A;  1EOH A;  3F0I A;  2IMI A;  4MP4 A;  3A5I A;  3HYP A;  5G1K A;  4EXJ A;  4DEJ A;  1TU8 A;  2FLS A;  3IC4 A;  1PN0 A;  1PN9 A;  1V9W A;  1GSQ A;  3IRA A;  1GH2 A;  4J56 E;  2GZY A;  3ZZX A;  4USS A;  3LWA A;  3CXG A;  3EYT A;  3HY2 A;  2KLX A;  2VLT A;  3TU3 B;  1HD2 A;  2XPD A;  4ZB6 A;  1YKA A;  2CAI A;  5LCZ A;  3UIW A;  2HSH A;  4GRF A;  4PXO A;  3VK9 A;  1FOV A;  2FD3 A;  5J4U A;  5ECI B;  2QA1 A;  9GSS A;  3VI7 A;  4OFT A;  2CV4 A;  2X49 A;  4ILF A;  5G30 A;  1QK8 A;  5HR2 A;  3QAV A;  4Q5N A;  3HVV A;  2HRA A;  4G9H A;  3H1N A;  3L78 A;  2VUP A;  1KNG A;  5D9V A;  1Q98 A;  4WF5 A;  2VL2 A;  1OAZ A;  3RDW A;  3IAM 2;  4NPB A;  3N9J A;  3GST A;  3TRP A;  1GTU A;  3TDG A;  1ZL9 A;  1U88 A;  2RM6 A;  2GST A;  4MF5 A;  1F2E A;  1PKW A;  1SYR A;  1U87 A;  2AB6 A;  3UJ1 A;  4F82 A;  4X0X A;  2VCZ A;  2XPE A;  1M2B A;  4IS0 A;  4YQM A;  1GUL A;  1YF1 A;  3F6F A;  1DE1 A;  4OO5 A;  4G19 A;  4TXO A;  4HZ4 A;  4HQS A;  2VCW A;  2JAC A;  4V2N A;  4BVY A;  1TKD B;  4L0W A;  3IOS A;  2XBI A;  2DKH A;  5CRW A;  2GQM A;  2FCH A;  3IBH A;  4OO4 A;  5J4Y A;  5JCW A;  2FA4 A;  3VWU A;  3LEF A;  1GLP A;  2M72 A;  3WT2 A;  3GUS A;  2B5X A;  1F6M C;  3I69 A;  1XWK A;  2C0F A;  2R0P A;  2GSQ A;  4F0B A;  4IJI A;  4MDC A;  5GST A;  3IHG A;  4P3Y B;  3HCZ A;  5D96 A;  4POM A;  3UOM A;  4KCA A;  3CRU A;  1ZOF A;  1BED A;  1AW9 A;  3Q74 A;  1M7T A;  2GLR A;  5ECK B;  1OC9 B;  1GUH A;  5DCH A;  4CDO A;  3EUR A;  1KBN A;  2CVD A;  4IKH A;  3GKN A;  2WJU A;  3MYD A;  2O5V A;  4YAV A;  5HR3 A;  3H4K A;  2H1D A;  1SKR B;  3Q18 A;  4ML1 A;  4PQI A;  5IO2 A;  5KOX A;  3P2A A;  3U5R E;  1JHB A;  6GSU A;  2VD1 A;  2VAF A;  1QGV A;  1TK5 B;  1ACV A;  3DWV A;  1K0D A;  3FZ5 A;  2CAQ A;  1OKT A;  3F6D A;  4MZB A;  5DAK A;  3HVX A;  3WGE A;  3CTG A;  1OE8 A;  2CA8 A;  2Z9S A;  3PGT A;  4IBP A;  1URM A;  3FR6 A;  2FWE A;  2TRX A;  3HKR A;  3GH9 A;  2DC5 A;  2QA2 A;  3KZQ A;  2L4Q A;  2GSS A;  2HLS A;  4AJ8 A;  3ZRE A;  1B9X C;  4LLR A;  3H93 A;  1Y6E A;  3QFA C;  3WT1 A;  2X99 A;  4YQU A;  1OVN A;  4HOJ A;  1J08 A;  16GS A;  2VL3 A;  3ED3 A;  1UVZ A;  1ZYP A;  2ON5 A;  4E8E A;  2L57 A;  4TKY A;  3ZIT A;  4ECI A;  4IEL A;  4TW5 A;  2LJR A;  3PPU A;  2N5A A;  3M3M A;  2WRT A;  1O73 A;  1BQ7 A;  3TB2 A;  4WKW A;  1PSQ A;  4ZXG A;  2AHE A;  4GST A;  1B48 A;  2CZ2 A;  2PWJ A;  1ERT A;  2B5E A;  4K7O A;  1V40 A;  1SYX A;  4IP1 A;  2HRK B;  3F8U A;  2CQ9 A;  1GTB A;  2GVP A;  1OYJ A;  1TP9 A;  2F8F A;  1U6T A;  1ZYQ B;  4TR0 A;  1S3A A;  3EE2 A;  1UC7 A;  2NTO A;  5A34 A;  1MDK A;  3DVX A;  3GHA A;  5J4V A;  1WJK A;  1W89 A;  5CRH A;  1A0F A;  12GS A;  3FEU A;  2JSZ A;  3D4T A;  1R5A A;  5GAP D;  4FYU A;  1VF4 A;  2L6D A;  2ALB A;  3TKQ A;  1EOG A;  5D9W A;  4ZB9 A;  1SEN A;  3EMX A;  2LST A;  4E8H A;  5ECO B;  2H6Z A;  1TI1 A;  1EV9 A;  5KN0 A;  3APO A;  1RQM A;  1FVK A;  4N0V A;  5H5R A;  11GS A;  2B7K A;  4WEY A;  3GSS A;  1M9A A;  1NSW A;  1O6J A;  3LXZ A;  3GA4 A;  3TOT A;  4LA1 A;  1GSD A;  5D93 A;  5J9C A;  5CNW A;  2EIR A;  4EKZ A;  4JBB A;  3IV4 A;  4MLY A;  4NAX A;  2H72 A;  3AY8 A;  4NV2 A;  1ZZY A;  2BMX A;  1SU9 A;  3DYR A;  3FR9 A;  2RUF A;  6GSY A;  3PH9 A;  2PVQ A;  4V1A p;  4L5O A;  2HE3 A;  1BG1 A;  4WR4 A;  1XBS A;  3TOU A;  2VLU A;  1YJ6 A;  1K0O A;  4GQC A;  3UMA A;  4IQA A;  3EC3 A;  3UAR A;  1X0R A;  3GKM A;  5ECH B;  1PKZ A;  3TJB A;  2EIQ A;  4PTS A;  1DBY A;  2I4A A;  5ECM B;  4HJM A;  2X4A A;  2H30 A;  4F03 A;  2A4V A;  1LJR A;  2H0H A;  4RI6 A;  1ERW A;  4OCF A;  3VWW A;  2LRT A;  1G7E A;  1AQX A;  3GX8 A;  3ZYW A;  3SBC A;  1K0N A;  3CSI A;  2R0G A;  1V57 A;  4O92 A;  5EL8 A;  2E0Q A;  5IPH A;  3F3R A;  2I9H A;  2O89 A;  4K5R A;  2B6M A;  4FQU A;  3A5W A;  3QD9 A;  4KDX A;  2H01 A;  2DJ3 A;  1YQ1 A;  2HZF A;  2P0G A;  4JED A;  4RUV A;  3N5O A;  5A1N B;  2R0C A;  2LRN A;  1A2M A;  3L9S A;  4PQH A;  1SD8 A;  3NOF A;  3W6G A;  2DJ2 A;  5CO3 A;  5ECL B;  2GDR A;  5AIS A;  5DVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...