4YH2A

Glutathione transferase e6 from drosophila melanogaster
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
221
structure length
221
Chain Sequence
VKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTNFTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S transferase E6
publication title Epsilon glutathione transferases possess a unique class-conserved subunit interface motif that directly interacts with glutathione in the active site
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 83
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yh2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yh2A01
4MF7A 1M99A 3PR8A 4KGIA 1OKDA 2PMTA 1THXA 1FOVA 2HSMA 1EV9A 1PD21 1VF3A 1OAZA 2VCXA 1Y6EA 4IVFA 1G7EA 2NPBA 1A0FA 3HHVA 2WDUA 4BVYA 1GTAA 2XC2A 3F8UA 2PERA 1EWXA 2KP2A 1F6MC 2JSYA 1MD4A 1ERVA 2JSZA 1PGTA 4K0NA 4L0UA 2CAIA 1XWGA 2GSSA 5EVOA 5EL8A 3LXTA 6GSSA 4AGSA 3ED3A 2C0FA 5E59A 1BJXA 4Q5FA 1YF1A 4L0WA 4JBBA 3IOSA 5KN3A 3UMAA 4ZIJA 3LWAA 5ECOB 2L57A 1F2EA 4MLYA 3GFKA 1X0RA 1N8JA 3M9JA 3EINA 1O85A 2PUKC 2DMLA 4XCSA 4O7HA 3D4MA 4G19A 5IMFA 4HOJA 1AAZA 3APSA 3KP8A 1HNCA 3M0FA 2PGTA 2X8CA 5DJMA 1B4PA 4MMMA 3WT1A 2PBJA 1O8WA 5JWQB 1HD2A 3IK7A 2HNLA 3TGZA 3IR4A 4XIHA 1JZDA 1YDKA 3H79A 3GKNA 4JR4A 1ZGNA 4WR5A 2H75A 4TXOB 2I3YA 3KIJA 2C0DA 2PVOC 2H30A 5DJLA 2ZCTA 5IPGA 2OACA 4JU5A 2YWIA 4E8EA 4XS4A 2FHEA 12GSA 3GRXA 2LJAA 5AISA 4QL7A 5F07A 4F2IA 3W8JA 5CRGA 2H0GA 1A8LA 4ECCA 1TKDB 4NHWA 3VURA 2H6ZA 4XS1A 2VM1A 4MJAA 1N2AA 3F6DA 3VI5A 2AAWA 1H75A 2B1LA 3VFIA 18GSA 1MDKA 2YV7A 3FR9A 4HQSA 5JCGA 2CAQA 2R37A 2VCTA 4IGJA 1DE1A 2H76A 2LRNA 2YOIA 1M7TA 5IMCA 3G7YA 2KHPA 5DALB 1EEJA 5HR2A 3O6TA 1UVZA 4KSMA 1DSBA 1XBSA 1AQWA 3PINA 3P90A 1QUWA 1FVJA 3KTBA 2VD1A 1ERWA 2H01A 3UIWA 2IFQA 3TKSC 4NMUA 4EO3A 1S3CA 3NOFA 4J56E 3A2XA 3GA4A 3ZIJA 3KH7A 4MJBA 1GSSA 5CRWA 1NHOA 3TJFA 3GV1A 3D6IA 1J0FA 1OKTA 3GH9A 3GKKA 3FR6A 2A2SA 4HEA2 1A24A 2IMDA 4IJ3A 3GL5A 1ST9A 4IW9A 3EMXA 3H8QA 1LBKA 1GSDA 1GP1A 3RDWA 1F9MA 1SJZA 3RPNA 1HNAA 4AJ6A 3BOAA 2LRTA 2YJ7A 2PN8A 5HR1A 4L5LA 1FHEA 3E0UA 2VL9A 1DE2A 2CV4A 1ZMAA 5FHIA 2H6YA 5A4UA 3TJGA 3LJRA 3U6VA 2GSRA 1IYIA 2C3QA 1Q98A 4EKZA 4ULXA 2VO4A 1EOHA 4TR1A 4N0VA 1EGRA 1YQ1A 3TJJA 2HSHA 2YPMA 3IHQA 1PL2A 1Z5YE 3VLNA 1NW2A 4Q5NA 3IAS2 5ABRA 3GL3A 2PU9C 1SJIA 4IKHA 1AUCA 3F9UA 4TR3A 5DQYA 3ZMLA 4IP1A 1XW5A 4MCUA 1U3AA 1WRYA 4F0CA 2GQLA 2VOCA 2REMA 2A4VA 4GSNA 5G30A 1HYUA 4Q5RA 1VRSD 3J7Yk 1SKRB 1O8XA 4MJCA 1X9SB 1PX7A 2O7KA 3GX0A 4ECBA 2VAFA 4NV2A 4QQ7A 1ABAA 5DCGA 1BQ7A 3HA9A 2FA4A 3N5OA 1TRSA 5J3RA 3LQ7A 3HJMA 4KDXA 1YJ6A 3CRTA 7GSSA 4D73A 3CSIA 3ZVJA 4IQ1A 4RI7A 5ECHB 2IN3A 2VCVA 5DCHA 3MDKA 2KOKA 3UJ1A 4ISDA 3GHAA 4BL7A 1EP7A 4PX1A 3ERFA 5ECPB 2H0HA 2MMNA 1U3IA 4TR0A 4WF4A 3LGCA 1TK0B 4I8BA 4GXZA 4MH3A 1AQXA 4KDYA 2RM6A 3VWUA 4MPFA 3GIXA 3F6FA 3ZMKA 3SBCA 2F8AA 2XBIA 1TU7A 2GDRA 3D5JA 2LV3A 3GSTA 1YZXA 1GNWA 4J2FA 1F3BA 4K9ZA 1ON4A 2DIYA 1LJRA 2CVKA 3UARA 5HFGA 2GZZA 1XWKA 2HRKB 5EY6A 4JE1A 2G0FA 1A23A 5IMVA 4MJEA 3VI7A 2OJLA 2EC4A 1GSYA 3M3MA 2PWJA 3GN3A 5IMZA 5H5SA 3KMOA 3D0ZA 3GMFA 3I43A 5IM9A 2CZ2A 2JL4A 2H1AA 4X43A 3M8NA 1M0UA 4EDZA 3EWLA 1XW6A 1GLQA 4KCEA 1T4ZA 2RLIA 1QK8A 3WT2A 1Z9HA 3WGXA 1YKCA 2OA7A 3OR5A 3QR6A 1FVKA 1FW1A 2P31A 1BYEA 1PMTA 5D9XA 5C04A 1R5PA 3MSZA 2QC7A 4GRFA 2VL2A 2M80A 1PL1A 1ZYQB 3KJYA 1F3AA 2Z9SA 5KEJA 3VPTA 4EXJA 1Q4JA 2P5RA 5G31A 2HFDA 4K7IA 2VLUA 4OFNA 3E9JB 1PRXA 5C00A 1TK8B 4ACSA 2XBQA 3C73A 1NHYA 4O92A 5HFKA 1JZWA 3UBLA 2LTKA 3RAZA 3TKSA 2YZHA 2R3XA 4FYCA 10GSA 5IPHA 4G0LA 1E2YA 2HE3A 4POMA 2O87A 4KX4A 16GSA 3FK8A 3LEFA 3RBTA 2L59A 2FD3A 1FAAA 1PX6A 5ECNB 2BJXA 9GSSA 3ERGA 3KCMA 1T4YA 4IJIA 6GSXA 3DKSA 5D9VA 2D2ZA 4E8HA 4ZBDA 3IAM2 2IIYA 4BWQA 1K0AA 4ZL9A 2CQ9A 4YAVA 5IMAA 3F4RA 3LORA 3QD9A 4FYUA 3UVTA 1W4VA 2ES7A 3ERWA 1USBA 6GSYA 3IA1A 4K7NA 4O32A 4K8MA 1FB0A 4MZBA 2HZEB 3HJOA 3CBUA 1Z6NA 5J5NA 4PUAA 1SD9A 5BMUA 5CRHA 2GTUA 3TRXA 2K8VA 4OWYA 5D93A 1PN9A 2YCDA 1PKZA 2I81A 1QXHA 1FB6A 2KUCA 1GUHA 4WBRD 4ZB6A 3IC4A 5DBQA 4FH8A 1SKSB 1XOBA 2J23A 2B7KA 3KEBA 3GURA 2N5BA 1WJKA 4YQVA 4XHMA 2CX3A 1BX9A 4BVXB 2FGXA 4PXOA 3TKSE 2XPEA 3NIVA 4K0GA 2E0QA 2MMZA 4JEDA 1K0OA 2JU5A 1BAYA 1CQGA 1VGLA 3HZ4A 1SKWB 4POLA 1K0BA 1Z3EA 2LS5A 2VUPA 1GULA 2VLTA 5D96A 5E4WA 5CNWA 1Z6MA 2GQMA 5IOWA 3FZAA 3JCML 4LL1B 2LSTA 3O76A 3HKRA 4MDCA 4KA0A 1TRVA 4ILFA 2DJJA 1GSUA 2RUFA 2AYTA 1A2MA 4YH2A 3FEUA 4KW6A 2E7PA 2X99A 5INYA 5ID2B 2V6OA 2H1BA 1ERUA 5GAND 1KTEA 2OBKA 4PQ1A 5DVBA 3IV4A 1MTCA 1R4WA 2P5QA 1JHBA 1M9AA 4V2MA 2YN1A 1WPIA 4GWRA 2LRCA 5H5RA 1EOGA 2F3MA 3HZ8A 4TVEA 2CZ3A 2ON5A 1K0CA 3Q6OA 4GCIA 5JCWA 3RPPA 5IO0A 5JWOB 4NAXA 2KP1A 4MP4A 2MMAA 5CRDA 4ID0A 4EE0A 4DSRA 1GTUA 1TW9A 2UZ8A 4IELA 4ZXGA 2VD0A 3M1GA 2LKUA 3HVVA 2YWMA 3C1RA 2BMXA 3QOUA 4DSSB 3H1NA 2AB6A 1R7HA 1GLPA 3GX8A 1M2BA 1XWBA 4FYBA 3H93A 1G7OA 4TXOA 3US3A 3DVXA 5DQSA 4LMVA 4ECJA 2VCQA 3HVXA 3L4NA 4FIWA 3GNJA 4P3YB 2V1MA 3IXRA 5DDLA 3MWHA 4KB3A 3P2AA 2BTOT 1ERTA 3FRCA 3TDGA 3M9KA 1JLWA 4OO5A 2DJ2A 3CRUA 1KBNA 2E2GA 2EIQA 2R2JA 2B7JA 4I6XA 4AF2A 4I5QA 3R2QA 3IPZA 3F3RA 1U88A 1CQHA 2YZUA 4KE3A 3ME7A 4F0BA 1SL0B 1G6WA 1YKAA 1X9WB 2F8FA 5DALA 1OC9B 1SL1B 1SYRA 5L71A 4POKA 2C3NA 2PPTA 2GZYA 1O7UA 2AHEA 1PSQA 2JADA 1XIYA 1SL2B 3A5WA 4I2UA 4EF0A 5IO2A 2IL3A 1HQOA 1EZKA 3GKXA 4EDYA 1TI3A 5ENUA 3DRNA 2VCZA 4LL4B 3EU4A 19GSA 2CVDA 1MDJA 5CO3A 3KZQA 2HSNB 1U87A 3C8EA 3D4TA 1BG5A 3KMNA 4PNFA 2R6KA 4OD7A 5B6MA 1C72A 2K8SA 1ZCPA 2HRNA 3ZRDA 4J57E 1T8EB 2O8VB 4MABA 1ZL9A 2H66A 2GLRA 4RUVA 5A5KA 1I5GA 3ZZXA 1RW1A 1TTZA 2L6DA 1UN2A 4G2EA 4RI6A 2HQTA 3EU3A 1UC7A 1XWCA 1A0RP 3GSSA 4MH2A 4HS1A 2EIRA 3ZTLA 3WD6A 1GH2A 1XVQA 1GSEA 4X0XA 4HJ2A 5J9BA 3GUSA 3KTLA 3APQA 1SJ6A 5ECKB 3FYGA 3HDCA 5B8AA 3FY7A 4RQXA 3FZ4A 3CTGA 3DMLA 3D22A 2LJKA 2FWGA 4HJMA 1G6YA 1GNEA 1AW9A 2FA8A 5DAKB 3P7XA 4OFTA 3ZIVA 2B3SA 4TR4A 3UVHA 3FZ9A 3L0HA 5F0GA 3FR3A 4NV5A 5AGYA 2K18A 2KLXA 4DVCA 2NTOA 2I9HA 2MMOA 2ZNMA 4MZWA 1QFNA 2LQQA 2GZPA 3WGEA 2LEGA 1URMA 4K2DA 1QMVA 3TKRA 3UL3A 2HRFA 1B8XA 4GSTA 1V98A 5D9TA 1OC3A 3O3TA 3LYKA 5CYYA 5F05A 3U5RE 5J9CA 2YP6A 5H5QA 1OVNA 3L9UA 4KSOA 1K0NA 2VM2A 3UBKA 5COHA 5HQPA 1T00A 2LNTA 3L9VA 3ZFLA 3H4KA 3TUEA 3TJBA 2A2RA 2H73A 6GSVA 3KH9A 1XPVA 3QAWA 3MNGA 5FWGA 4L8EA 3ZREA 3A2WA 3D21A 1Y25A 2WRTA 3EMPA 20GSA 4FQUA 4GTUA 2X8HA 3VK9A 2GT6A 4POBA 2HLSA 4GSSA 4ZBAA 4XRDA 2YV9A 2GQKA 2OE3A 1JLVA 2DIZA 4PURA 1XVWA 4I97A 3ME8A 1O6JA 3EVIA 3ZYWA 1TI1A 1MD3A 1LU4A 1ML6A 3KP9A 4HUAA 5HR0A 2N5AA 2H71A 3IBHA 4WXTA 4NXIA 2DJ3A 1B4QA 1XCCA 2MBTA 3EURA 3L78A 2GSTA 1XZOA 1G0TA 4BWSA 3ZL5A 1SK0A 4OCEA 5B7CA 2YJHA 4BA7A 4LMWA 4ECIA 4TXVA 2HRKA 1M9BA 3TOUA 1B9YC 4ZILA 5G5FA 2HZFA 4WETA 3DGQA 1A2JA 2JZRA 1XW9A 3DEXA 2H1GA 1T3BA 4KUNA 4WKWA 4XS6A 1HNBA 1JZOA 4EVMA 3G7JA 3DYRA 3UOMA 1JFUA 3KD0A 2YWNA 1KNGA 3IE3A 2B6MA 1TK5B 2V2GA 4G9HA 1X5CA 3RHBA 3TCOA 2M46A 3C1SA 4IQAA 1H4OA 3AY8A 2H19A 3F4SA 2ON7A 1X5DA 1V40A 2FWHA 2H8LA 5JCUA 3Q18A 2QKEA 3GTUB 3A3TA 4PQIA 4PUFC 2CA8A 3C7MA 2X64A 1XWAA 2IMFA 2HSMB 3VWXA 3W6GA 4WEYA 4IP6A 2H6XA 1WP0A 1QQ2A 1TOFA 2LJRA 1A2LA 4O5RA 3ZITA 5GZZB 5A4VA 3RHCA 2H70A 1K0MA 1Z7PA 2B5EA 5HFIA 4EL1A 2V41A 3TKPA 4V1Ap 1VF4A 5GSTA 4BVYB 2V32A 1K3LA 4YQMA 1T1VA 4V2NA 3N9JA 3QDNA 3ISOA 4ML6A 3HD5A 4MA9A 4K6XA 1F37A 3DXBA 3QMXA 4K1FA 4HZ4A 5IMDA 4IBPA 17GSA 2WCIA 1GRXA 2WJUA 1XFLA 3K8NA 4ZB8A 1X9MB 4QL9A 2WFCA 2FY6A 3DWVA 2PVQA 2TIRA 1EEMA 2OBIA 3HY2A 4N11A 5G2ZA 4HQZA 3WYWA 3I9V2 2B5XA 4V2LA 8GSSA 1J9BA 4EC0A 1M2AA 22GSA 5F06A 2ZUPA 6GSWA 4WR4A 1K0DA 2HZEA 1TXXA 1OYJA 1SENA 3KM6A 1GWCA 3IC8A 6GSTA 2O85A 1SD8A 2O89A 1ZYEA 1SU9A 2C80A 2CT6A 4Z7XA 1THOA 2DSAA 1PA3A 2DJ0A 4XS4B 2V6KA 5IIZA 3TOTA 4BVXA 2ALBA 4GQCA 1BEDA 2DLXA 2DC5A 1K3OA 4TN8A 2HXKA 4HDEA 3VPQA 2YWOA 2OE1A 1EV4A 4G10A 2XHFA 2HSYA 4GF0A 2H72A 2L4QA 2DBCA 5D73A 4YAPA 2GT5A 1PKWA 5HR3A 3SWLA 2L5LA 3QFAC 3KXOA 4ZB9A 2C1YA 3S9FA 2R5GA 4WF5A 5FT3A 1TU8A 4V1Ag 3WGDA 3CSHA 4KCAA 2WULA 4USSA 1VF1A 4OCFA 4TRXA 5ID2A 1T7PB 2IFQB 5LCZA 1IYHA 4I2TA 3G7IA 2HYXA 3P8WA 1O81A 3IK9A 1NSWA 1A8YA 3GKMA 5GAPD 1ILOA 3QAVA 3EE2A 1J08A 2VL2C 2G2QA 1WE0A 1OE8A 2IMEA 3APOA 2IPAA 1AQVA 5ECSA 1X5EA 4KF9A 4TKYA 5EPFA 3BCKA 3E3EA 3ZFBA 4KNDA 4N0ZA 1YEPA 4TOPA 5ECLB 5B6NA 4DSSA 5J41A 3BCIA 5ECQB 2L6CA 4HZ2A 2L5OA 3CMIA 2F51A 4HU7A 3QCPA 3TJKA 3CTFA 2XPDA 3BJ5A 1ZZYA 1NM3A 4N30A 2IMIA 2VCWA 2JZSA 4MZCA 5G1LA 3TKQA 4DSQA 3F3QA 2HI7A 4G0IA 4H86A 4IN0A 3LSZA 2B5YA 3PPUA 4AJ7A 4BPYA 4CW9A 3R3EA 13GSA 2VLVA 3ZLPA 4CHSA 1S3DA 1WIKA 1EGOA 4TR1B 3CSJA 2C4JA 4JZQA 2WGRA 3FZ5A 4NWYA 2MBSA 3LG6A 1SK2A 1K3YA 1OC9A 4MPGA 5JWRB 4Q5QA 5D8IA 4GLTA 2R4VA 5AN1A 4JR6A 4F82A 1MEKA 2RIIA 2VIMA 5CP1A 3F0IA 5GSSA 1MDIA 5A4WA 4PQHA 5F8BA 1YEXA 2RUEA 2OKAA 3DD3A 3LFLA 1WOUA 1GSQA 5ECMB 5J4UA 5KN2A 2IWTA 2QGVA 2NDOA 1ZOFA 4NHZA 2C0GA 1FO5A 3Q74A 3ZVJD 2GS3A 2HRAA 14GSA 1PQNA 2B1KA 2MZCA 4YQUA 2AV4A 2C0EA 2K6VA 2LUSA 5G1KA 4D73B 2WS2A 1OC8A 4PGTA 2X8GA 3V1WA 3HXSA 1RK4A 2DJKA 4OO4A 5AIXA 2FWEA 2N5FA 1EP8A 1U6TA 4BL7B 2MYGA 1ACVA 3J7Yb 1GUMA 4EUYA 1DBYA 1W89A 3F63A 2OADA 5D9WA 5B8BA 1M2DA 4MF6A 4TW5A 2YNXA 2RM5A 5ELAA 1VF2A 3EC3A 1XXUA 1TDIA 3FKFA 3BBYA 2F9SA 5AIVA 2NBSA 3FW2A 4F03A 2EIOA 3HYPA 4ZBBA 5DAKA 3QFBC 4N10A 2VL3A 1GTBA 1QGVA 4MF5A 4CDOA 2C3TA 3Q19A 1R26A 2YANA 1B48A 4PNGA 4JRRA 2AUVA 1YY7A 5LNKe 2GGTA 1AIUA 3BD2A 1SK1A 4KH7A 4LLRA 4ZL7A 4MK3A 2JZTA 4ZL8A 2I4AA 2I1UA 3W8SA 3I6AA 11GSA 2NVLA 4X1UA 2FNOA 1OE7A 3G9BA 2L4CA 1AC1A 1R5AA 3PH9A 4L5OA 1S3AA 2QSIA 4K7OA 2GSQA 4IS0A 3PGTA 2E2MA 4ML1A 2H74A 5ELGA 1TJDA 5CREA 2GVPA 5IQYA 3CYNA 2WB9A 4XRAA 2C8UA 2H0IA 1RQMA 4WBJA 1XOAA 4HU9A 2JACA 2LNSA 2J9HA 1UA5A 5ECRB 3LYPA 2P0GA 1GL8A 5LD0A 3EYTA 1B9XC 4XTSA 4AJ8A 4RQRA 5IOXA 2LQOA 1YF0A 3NZNA 2FLSA 1GSFA 1I9DA 3IDVA 2CX4A 5KN0A 3MAKA 4OMVA 2TRXA 3DIEA 3HJPA 1TRWA 3VWVA 2IMKA 6GSUA 4PTSA 2FCHA 4DEJA 2FWFA 2OE0A 3IRAA 2HT9A 4IHUA 4NPBA 3HCZA 2M72A 3GYKA 4HI7A 1TP9A 2H1DA 3QPMA 3F4TA 5KN1A 1SYXA 3HVSA 4F9ZA 5CAXA 3QAGA 1V57A 3DVWA 4KAEA 1TRUA 2TRCP 1WWJA 1FG4A 1JZRA 5G5EA 3CXGA 1WMJA 3FHKA 2AJQB 2CVBA 2FUG2 3LXZA 2WZ9A 3KGKA 3C71A 3I69A 2DJ1A 1DUGA 4OFMA 1GTIA 1O73A 4G0KA 3TB2A 1V58A 2DMMA 1AXDA 1Z7RA 5ECIB 3UAPA 3TRPA 2K9FA 1KEBA 3TRQA 3VWWA 3L9SA 1E6BA 4KDUA 4FO5A 3A2VA 1V2AA 3GH6A 4LA1A 3GTUA 1V9WA 3UEMA 1GUKA 4GQFA 2IJYA
chains in the Genus database with same CATH superfamily
4MF7A 1M99A 3PR8A 4KGIA 1OKDA 2PMTA 1THXA 1FOVA 2QA2A 2HSMA 1EV9A 4YKFA 1PD21 2R0GA 1VF3A 1OAZA 3TU3B 2VCXA 1Y6EA 4IVFA 1G7EA 2NPBA 1A0FA 2EFEA 3HHVA 2WDUA 4BVYA 1GTAA 5A1NA 2XC2A 3F8UA 2PERA 1EWXA 2KP2A 1F6MC 2JSYA 1MD4A 1ERVA 2JSZA 1PGTA 4K0NA 4L0UA 2CAIA 1XWGA 2GSSA 5EVOA 5EL8A 2R0CA 3LXTA 6GSSA 4AGSA 3ED3A 2C0FA 5E59A 1BJXA 4Q5FA 2DKHA 1YF1A 4L0WA 4JBBA 3IOSA 5KN3A 3UMAA 4ZIJA 3LWAA 5ECOB 2L57A 1F2EA 4MLYA 3GFKA 1PFOA 2WZSA 1X0RA 1N8JA 3M9JA 3EINA 3RGBC 1O85A 2PUKC 2DMLA 4XCSA 4O7HA 3D4MA 4G19A 5IMFA 4HOJA 1AAZA 3APSA 3KP8A 1HNCA 3M0FA 2PGTA 2X8CA 5DJMA 1B4PA 4MMMA 3WT1A 5KOXA 2PBJA 1O8WA 5JWQB 4EIQA 1HD2A 3IK7A 2HNLA 3TGZA 3IR4A 4XIHA 1JZDA 1YDKA 3H79A 3GKNA 4JR4A 1ZGNA 4WR5A 2H75A 4TXOB 2I3YA 3KIJA 2C0DA 2PVOC 2H30A 5DJLA 2ZCTA 5IPGA 2OACA 4JU5A 2YWIA 4E8EA 4XS4A 2FHEA 12GSA 3GRXA 2LJAA 5AISA 4QL7A 5F07A 4F2IA 3W8JA 5CRGA 4Z2RA 2H0GA 1A8LA 4ECCA 1BG1A 4NHWA 3VURA 2H6ZA 4XS1A 1TKDB 2VM1A 4MJAA 1N2AA 3F6DA 3VI5A 2AAWA 1H75A 2B1LA 3VFIA 18GSA 1MDKA 2YV7A 3FR9A 4HQSA 5JCGA 2CAQA 2R37A 4ZB7A 2VCTA 4IGJA 4O5QA 1DE1A 2H76A 2LRNA 2YOIA 1M7TA 5IMCA 3G7YA 2KHPA 5DALB 1EEJA 5HR2A 3O6TA 1UVZA 4KSMA 1DSBA 1XBSA 1AQWA 3PINA 3P90A 1QUWA 1FVJA 3KTBA 2VD1A 1ERWA 2H01A 3UIWA 2IFQA 3TKSC 4NMUA 4EO3A 1S3CA 3NOFA 4J56E 3A2XA 3GA4A 4A5PA 3ZIJA 4YKGA 3KH7A 4MJBA 1GSSA 5CRWA 1NHOA 3TJFA 4AI6A 3GV1A 3D6IA 1J0FA 1OKTA 1TXUA 3GH9A 3GKKA 3FR6A 2A2SA 4HEA2 1A24A 2IMDA 4IJ3A 3GL5A 1ST9A 4IW9A 3EMXA 3H8QA 1LBKA 1GSDA 1GP1A 3RDWA 1F9MA 1SJZA 3RPNA 1HNAA 4AJ6A 3BOAA 2LRTA 2YJ7A 2PN8A 5HR1A 4L5LA 1FHEA 3E0UA 2VL9A 1DE2A 2CV4A 2WVXB 1ZMAA 2O5VA 5FHIA 2H6YA 5A4UA 3TJGA 3LJRA 3U6VA 2GSRA 1IYIA 2C3QA 1Q98A 4EKZA 4ULXA 2VO4A 1EOHA 4TR1A 4N0VA 1EGRA 1YQ1A 3TJJA 2HSHA 2YPMA 3IHQA 1PL2A 1Z5YE 3VLNA 1NW2A 4Q5NA 3IAS2 5ABRA 3GL3A 2PU9C 1SJIA 4IKHA 1AUCA 3F9UA 4TR3A 5DQYA 1SVLA 3ZMLA 4IP1A 1XW5A 4MCUA 1U3AA 1WRYA 4F0CA 2GQLA 2VOCA 2REMA 2A4VA 4GSNA 5G30A 1HYUA 4Q5RA 1VRSD 3J7Yk 1SKRB 1Y1UA 1O8XA 4MJCA 1X9SB 1PX7A 2O7KA 3GX0A 4ECBA 2VAFA 4NV2A 4QQ7A 1ABAA 5DCGA 1BQ7A 3HA9A 2FA4A 3N5OA 1TRSA 5J3RA 3LQ7A 3HJMA 4KDXA 1YJ6A 3IHGA 3CRTA 7GSSA 4D73A 3CSIA 3ZVJA 4IQ1A 4RI7A 5ECHB 2IN3A 2VCVA 5DCHA 3MDKA 2KOKA 3UJ1A 4ISDA 3GHAA 4BL7A 1EP7A 4PX1A 3ERFA 5ECPB 2H0HA 2MMNA 1U3IA 4TR0A 4AKHA 4WF4A 3LGCA 1TK0B 4I8BA 4GXZA 4MH3A 1AQXA 4KDYA 2RM6A 3VWUA 4MPFA 3GIXA 3F6FA 3ZMKA 3SBCA 2F8AA 2XBIA 1TU7A 2GDRA 3D5JA 2LV3A 3GSTA 1YZXA 1GNWA 4J2FA 1F3BA 4K9ZA 1ON4A 2DIYA 1LJRA 2CVKA 3UARA 5HFGA 2GZZA 1XWKA 2HRKB 5EY6A 4JE1A 2G0FA 1A23A 5IMVA 4MJEA 3VI7A 2OJLA 2EC4A 1GSYA 3M3MA 2PWJA 3GN3A 5IMZA 5H5SA 3KMOA 3D0ZA 3GMFA 3I43A 5IM9A 2CZ2A 2JL4A 2H1AA 4X43A 3M8NA 1M0UA 4EDZA 3EWLA 1XW6A 1GLQA 4KCEA 1T4ZA 2RLIA 1QK8A 2WW2A 3WT2A 1Z9HA 3WGXA 1YKCA 2OA7A 3OR5A 3QR6A 1ZYNA 1FVKA 1FW1A 2P31A 1BYEA 1PMTA 5D9XA 5C04A 1R5PA 3MSZA 2QC7A 4GRFA 2VL2A 2M80A 1PL1A 1ZYQB 3KJYA 1F3AA 2Z9SA 5KEJA 3VPTA 4EXJA 1Q4JA 2P5RA 3MYDA 5G31A 2HFDA 4K7IA 2VLUA 3EPTA 4OFNA 3E9JB 1PRXA 5A5HB 5C00A 1TK8B 4ACSA 2XBQA 3C73A 1NHYA 4O92A 5HFKA 1JZWA 3UBLA 2LTKA 3RAZA 3TKSA 2YZHA 2R3XA 4FYCA 10GSA 5IPHA 4G0LA 1E2YA 2HE3A 4POMA 2O87A 4KX4A 16GSA 3FK8A 3LEFA 5KOWA 3RBTA 2L59A 2FD3A 1FAAA 1PX6A 5ECNB 2BJXA 9GSSA 3ERGA 3KCMA 1T4YA 4IJIA 4PHZC 6GSXA 3DKSA 5D9VA 2D2ZA 4E8HA 4ZBDA 3IAM2 2IIYA 4BWQA 1K0AA 4ZL9A 2CQ9A 4YAVA 5IMAA 3F4RA 3LORA 3QD9A 4FYUA 3UVTA 1W4VA 2ES7A 3ERWA 1USBA 6GSYA 3IA1A 4K7NA 4O32A 4K8MA 1FB0A 4MZBA 2HZEB 3HJOA 1XG8A 3CBUA 1Z6NA 5J5NA 4PUAA 1SD9A 3HVNA 5BMUA 5CRHA 2GTUA 3TRXA 2K8VA 4OWYA 5D93A 1PN9A 2YCDA 1PKZA 1PN0A 2I81A 1QXHA 1FB6A 2KUCA 1GUHA 4WBRD 4ZB6A 3IC4A 5DBQA 4FH8A 1SKSB 1XOBA 2J23A 2B7KA 3KEBA 3GURA 2N5BA 1WJKA 4YQVA 4XHMA 2CX3A 1BX9A 4BVXB 2FGXA 4PXOA 3TKSE 2XPEA 3NIVA 4K0GA 4X4JA 2E0QA 2MMZA 4JEDA 1K0OA 2JU5A 1BAYA 3HMJG 1CQGA 1VGLA 3HZ4A 1SKWB 4POLA 1K0BA 1Z3EA 2LS5A 2VUPA 4EIPA 1GULA 2VLTA 5D96A 5E4WA 5CNWA 1Z6MA 2GQMA 5IOWA 3FZAA 3JCML 4LL1B 2LSTA 3HKRA 3O76A 4MDCA 4KA0A 1TRVA 4ILFA 2DJJA 1GSUA 2RUFA 2AYTA 1A2MA 4YH2A 3FEUA 4KW6A 2E7PA 2X99A 5INYA 5ID2B 2V6OA 2H1BA 1ERUA 5GAND 1KTEA 2OBKA 4PQ1A 5DVBA 3IV4A 1MTCA 1R4WA 2P5QA 1JHBA 1M9AA 4V2MA 2YN1A 1WPIA 4GWRA 2LRCA 5H5RA 1EOGA 2F3MA 3HZ8A 4TVEA 2CZ3A 2ON5A 1K0CA 3Q6OA 4GCIA 5JCWA 3RPPA 5IO0A 5JWOB 4NAXA 2KP1A 4MP4A 2MMAA 5CRDA 4ID0A 4EE0A 4DSRA 1GTUA 1TW9A 2UZ8A 4IELA 4ZXGA 2VD0A 3M1GA 2LKUA 3HVVA 2YWMA 3C1RA 2BMXA 2O3EA 3QOUA 4DSSB 3H1NA 2AB6A 4K5RA 1R7HA 1GLPA 3GX8A 1M2BA 1XWBA 4FYBA 3H93A 1G7OA 4TXOA 3US3A 3DVXA 5DQSA 4LMVA 4ECJA 2VCQA 3HVXA 3L4NA 4FIWA 3GNJA 4P3YB 2V1MA 4GQFA 3IXRA 5DDLA 3MWHA 4KB3A 3P2AA 2BTOT 1ERTA 3FRCA 3TDGA 3M9KA 1JLWA 4Z2UA 1I1IP 4OO5A 2DJ2A 3CRUA 1KBNA 2E2GA 2EIQA 2R2JA 2B7JA 4I6XA 4AF2A 2WW0A 4I5QA 3R2QA 3IPZA 3F3RA 1U88A 4PI2C 1CQHA 2YZUA 4KE3A 3ME7A 4F0BA 1SL0B 1G6WA 1YKAA 1ZYPA 2F8FA 5DALA 1X9WB 1OC9B 1SL1B 1SYRA 5L71A 4POKA 2OT3A 2C3NA 2PPTA 2GZYA 1O7UA 2AHEA 1PSQA 2JADA 1XIYA 1SL2B 3A5WA 4I2UA 4EF0A 2EFDA 5IO2A 2IL3A 1HQOA 1EZKA 2UV8G 3GKXA 4EDYA 1TI3A 5ENUA 3DRNA 2VCZA 4LL4B 3EU4A 19GSA 2CVDA 1MDJA 5CO3A 3KZQA 2HSNB 1U87A 3C8EA 3D4TA 1BG5A 2DKIA 3KMNA 4PNFA 2R6KA 4OD7A 5B6MA 1C72A 2K8SA 1ZCPA 4K5SA 2HRNA 3ZRDA 4J57E 1T8EB 2O8VB 4MABA 1ZL9A 2H66A 2GLRA 4RUVA 5A5KA 1I5GA 3ZZXA 1RW1A 1TTZA 2L6DA 1UN2A 4G2EA 4RI6A 2VKZG 4N3ZA 2HQTA 3EU3A 1UC7A 1XWCA 1A0RP 3GSSA 4MH2A 4HS1A 2EIRA 3ZTLA 3WD6A 1GH2A 1XVQA 1GSEA 4X0XA 4HJ2A 5J9BA 3GUSA 3KTLA 3CWGA 3APQA 3FMWA 1SJ6A 5ECKB 3FYGA 3HDCA 2WVXA 5B8AA 3FY7A 4RQXA 3FZ4A 3CTGA 3DMLA 3D22A 2LJKA 2FWGA 4HJMA 1G6YA 1GNEA 1AW9A 2FA8A 4FXYP 5DAKB 3P7XA 4OFTA 3ZIVA 2B3SA 4TR4A 3UVHA 3FZ9A 3L0HA 5F0GA 2A4HA 3FR3A 4NV5A 5AGYA 2K18A 2KLXA 4DVCA 2NTOA 2I9HA 2MMOA 2ZNMA 4MZWA 1QFNA 4GDFA 2LQQA 4G01A 2GZPA 3WGEA 2X4AA 2LEGA 1URMA 4K2DA 1QMVA 3TKRA 3UL3A 2HRFA 1B8XA 4GSTA 1V98A 5D9TA 1OC3A 3O3TA 3LYKA 5CYYA 5F05A 3U5RE 5J9CA 2YP6A 5H5QA 1OVNA 3L9UA 4KSOA 1K0NA 2VM2A 3UBKA 5COHA 5HQPA 1T00A 2LNTA 3L9VA 3ZFLA 3H4KA 3TUEA 3TJBA 2A2RA 2H73A 6GSVA 3KH9A 1XPVA 3QAWA 5A34B 3MNGA 5FWGA 4L8EA 3ZREA 3A2WA 3D21A 1Y25A 2WRTA 3EMPA 20GSA 4FQUA 4GTUA 2X8HA 3VK9A 2GT6A 4POBA 2HLSA 4GSSA 4ZBAA 4XRDA 2YV9A 1BF5A 2GQKA 2OE3A 1JLVA 2DIZA 4PURA 1XVWA 4I97A 3ME8A 1O6JA 3EVIA 3ZYWA 1TI1A 1MD3A 1LU4A 1ML6A 3KP9A 4HUAA 5HR0A 2N5AA 2WVZA 2H71A 3IBHA 4WXTA 4NXIA 2DJ3A 1B4QA 1XCCA 2MBTA 3EURA 3L78A 2O36A 2GSTA 2A2PA 1XZOA 1G0TA 4BWSA 3ZL5A 1SK0A 4OCEA 5B7CA 2YJHA 4BA7A 4LMWA 4ECIA 4TXVA 2HRKA 4AKIA 1M9BA 3TOUA 1B9YC 4ZILA 5G5FA 2HZFA 4WETA 3DGQA 1A2JA 2JZRA 1XW9A 3DEXA 2H1GA 1T3BA 4KUNA 4WKWA 4XS6A 1HNBA 4HSCX 1JZOA 4EVMA 3G7JA 3DYRA 3UOMA 1JFUA 3KD0A 2YWNA 1KNGA 3IE3A 2B6MA 1TK5B 2V2GA 4G9HA 1X5CA 3RHBA 1N25A 3TCOA 2M46A 3C1SA 4IQAA 1H4OA 3AY8A 2H19A 3F4SA 2ON7A 1X5DA 1V40A 2FWHA 2H8LA 5JCUA 3Q18A 2QKEA 3GTUB 3A3TA 4PQIA 4PUFC 2CA8A 3C7MA 3A5IA 4E68A 2X64A 1XWAA 2QA1A 2IMFA 2HSMB 3VWXA 3W6GA 4WEYA 4QMKA 4IP6A 2H6XA 1WP0A 1QQ2A 1TOFA 2LJRA 1A2LA 4O5RA 3ZITA 5A5HA 5GZZB 5A4VA 3RHCA 2H70A 1K0MA 1Z7PA 2B5EA 5HFIA 4EL1A 2V41A 3TKPA 4V1Ap 1VF4A 5GSTA 4BVYB 2V32A 5A1NB 1K3LA 1FOHA 4YQMA 1T1VA 4V2NA 3N9JA 3QDNA 3ISOA 4ML6A 2X49A 3HD5A 4MA9A 4K6XA 1F37A 3DXBA 3QMXA 4K1FA 4HZ4A 5IMDA 4IBPA 17GSA 2WCIA 1GRXA 2WJUA 1XFLA 3K8NA 4ZB8A 1X9MB 4QL9A 2WFCA 2FY6A 3DWVA 2PVQA 4AKXB 2TIRA 1EEMA 2OBIA 3HY2A 4N11A 5G2ZA 4HQZA 3WYWA 3I9V2 2B5XA 4V2LA 8GSSA 1J9BA 4EC0A 1M2AA 22GSA 2WVYA 5F06A 2ZUPA 6GSWA 4WR4A 1K0DA 2HZEA 1TXXA 1OYJA 1SENA 3KM6A 1GWCA 3IC8A 6GSTA 2O85A 1SD8A 2O89A 1ZYEA 1SU9A 1SVMA 2C80A 2CT6A 4Z7XA 1THOA 2DSAA 1PA3A 4XS4B 2EFCA 2V6KA 5IIZA 3TOTA 4BVXA 2ALBA 4GQCA 1BEDA 2DLXA 2DC5A 1K3OA 4TN8A 2HXKA 4PI0C 4HDEA 3VPQA 2YWOA 2OE1A 2WW3A 1EV4A 4G10A 2XHFA 2HSYA 4GF0A 2H72A 2L4QA 2DBCA 5D73A 4YAPA 2GT5A 1PKWA 5HR3A 3SWLA 4CY6A 2L5LA 3QFAC 3KXOA 4ZB9A 2C1YA 3S9FA 2R5GA 4WF5A 5FT3A 1TU8A 4V1Ag 3WGDA 3CSHA 4KCAA 2WULA 4USSA 3MIXA 1VF1A 4OCFA 3CHXC 4TRXA 5ID2A 1T7PB 2IFQB 2EFHA 5LCZA 4BIKA 1IYHA 4I2TA 3G7IA 2HYXA 3P8WA 1O81A 3IK9A 4Z2TA 1NSWA 1A8YA 3GKMA 5GAPD 1ILOA 3QAVA 3EE2A 1J08A 2VL2C 2G2QA 1WE0A 1OE8A 2IMEA 3APOA 2IPAA 1AQVA 5ECSA 1X5EA 4KF9A 4TKYA 5EPFA 3BCKA 3E3EA 3ZFBA 4KNDA 4N0ZA 1YEPA 4TOPA 5ECLB 5B6NA 4DSSA 5J41A 1M3JA 3BCIA 5ECQB 2L6CA 4HZ2A 2L5OA 3CMIA 2F51A 4HU7A 3QCPA 3TJKA 3CTFA 2XPDA 3BJ5A 1ZZYA 1NM3A 4N30A 2IMIA 2VCWA 2JZSA 4MZCA 5G1LA 3TKQA 4DSQA 3F3QA 2HI7A 4G0IA 4H86A 4IN0A 3LSZA 2B5YA 3PPUA 4AJ7A 4BPYA 4CW9A 3R3EA 13GSA 2VLVA 3ZLPA 4CHSA 1S3DA 1WIKA 1EGOA 4TR1B 3CSJA 2C4JA 4JZQA 2WGRA 3FZ5A 4NWYA 2MBSA 4ICYA 3LG6A 1SK2A 1K3YA 1OC9A 4MPGA 5JWRB 4Q5QA 5D8IA 1S3RA 4GLTA 2R4VA 1YEWC 5AN1A 4JR6A 4O5UA 4F82A 1MEKA 2RIIA 2VIMA 5CP1A 3F0IA 5GSSA 1MDIA 5A4WA 4PQHA 5F8BA 1YEXA 2RUEA 2OKAA 1M3IA 3DD3A 3LFLA 1WOUA 1GSQA 5ECMB 5J4UA 5KN2A 2IWTA 2QGVA 2HSNA 2NDOA 1ZOFA 4NHZA 2R0PA 2C0GA 1FO5A 3Q74A 3ZVJD 2GS3A 2HRAA 14GSA 1PQNA 2B1KA 2MZCA 4YQUA 1YVLA 2AV4A 2C0EA 2K6VA 2LUSA 5G1KA 4D73B 2WS2A 1OC8A 4PGTA 2X8GA 3V1WA 3HXSA 1RK4A 2DJKA 4OO4A 5AIXA 2FWEA 2N5FA 1EP8A 1U6TA 4BL7B 2MYGA 1ACVA 3J7Yb 1GUMA 4EUYA 1DBYA 1W89A 3F63A 2OADA 5D9WA 5B8BA 1M2DA 4MF6A 4TW5A 3CQFA 2YNXA 2RM5A 5ELAA 1VF2A 3EC3A 1XXUA 1TDIA 3FKFA 3BBYA 2F9SA 5AIVA 2NBSA 3FW2A 4F03A 2EIOA 3HYPA 4ZBBA 5DAKA 3QFBC 4N10A 2VL3A 1GTBA 1QGVA 4MF5A 4CDOA 2C3TA 3Q19A 1R26A 2YANA 1B48A 4PNGA 4JRRA 2AUVA 1YY7A 5LNKe 2GGTA 1AIUA 3BD2A 1SK1A 4KH7A 4LLRA 4ZL7A 4MK3A 2JZTA 4ZL8A 2I4AA 4AKGA 2I1UA 3W8SA 2WW1A 3I6AA 11GSA 2NVLA 4MNNA 4X1UA 2FNOA 1OE7A 5J4YA 3G9BA 2H1LA 5BRTA 2L4CA 1AC1A 1R5AA 3PH9A 4L5OA 1S3AA 2QSIA 4K7OA 2GSQA 4IS0A 3PGTA 2E2MA 4ML1A 2H74A 1SVOA 5ELGA 1TJDA 4K2XA 5CREA 2GVPA 5IQYA 3CYNA 4CY8A 2WB9A 5A34A 5J4VA 4XRAA 2C8UA 2H0IA 1RQMA 4WBJA 1XOAA 4HU9A 3RFRC 2JACA 2LNSA 2J9HA 1UA5A 5ECRB 3LYPA 5J40A 2P0GA 1GL8A 5LD0A 3EYTA 1B9XC 4XTSA 4AJ8A 1S4BP 4RQRA 5IOXA 3LW9A 2LQOA 1YF0A 3NZNA 2FLSA 1GSFA 1I9DA 3IDVA 2CX4A 5KN0A 3MAKA 4OMVA 2TRXA 3DIEA 3HJPA 1TRWA 3VWVA 2IMKA 6GSUA 4PTSA 2FCHA 4DEJA 2FWFA 2OE0A 3IRAA 2HT9A 4IHUA 4NPBA 3HCZA 2M72A 3GYKA 4HI7A 1TP9A 2H1DA 3QPMA 3F4TA 5KN1A 1SYXA 3HVSA 4F9ZA 5CAXA 3QAGA 1V57A 3DVWA 4KAEA 1TRUA 2TRCP 1WWJA 1FG4A 1JZRA 5G5EA 3CXGA 1WMJA 3FHKA 2AJQB 2CVBA 2FUG2 3LXZA 2WZ9A 3KGKA 3C71A 3I69A 2DJ1A 1DUGA 4OFMA 1GTIA 1O73A 4G0KA 3TB2A 1V58A 2DMMA 4W66A 5BMUB 1AXDA 1Z7RA 5ECIB 3UAPA 3TRPA 2K9FA 1KEBA 3TRQA 3VWWA 3L9SA 1E6BA 4KDUA 4FO5A 3A2VA 5J47A 1V2AA 3GH6A 4LA1A 3GTUA 1V9WA 3UEMA 1GUKA 2DJ0A 2IJYA
chains in the Genus database with same CATH topology
4MF7A 1M99A 3PR8A 4KGIA 1OKDA 2PMTA 1THXA 1FOVA 2QA2A 2HSMA 1EV9A 4YKFA 1PD21 2R0GA 1VF3A 1OAZA 3TU3B 2VCXA 1Y6EA 4IVFA 1G7EA 2NPBA 1A0FA 2EFEA 3HHVA 2WDUA 4BVYA 1GTAA 5A1NA 2XC2A 3F8UA 2PERA 1EWXA 2KP2A 1F6MC 2JSYA 1MD4A 1ERVA 2JSZA 1PGTA 4K0NA 4L0UA 2CAIA 1XWGA 2GSSA 5EVOA 5EL8A 2R0CA 3LXTA 6GSSA 4AGSA 3ED3A 2C0FA 5E59A 1BJXA 4Q5FA 2DKHA 1YF1A 4L0WA 4JBBA 3IOSA 5KN3A 3UMAA 4ZIJA 3LWAA 5ECOB 2L57A 1F2EA 4MLYA 3GFKA 1X0RA 1N8JA 3M9JA 3EINA 1O85A 2PUKC 2DMLA 4XCSA 4O7HA 3D4MA 4G19A 5IMFA 4HOJA 1AAZA 3APSA 3KP8A 1HNCA 3M0FA 2PGTA 2X8CA 5DJMA 1B4PA 4MMMA 3WT1A 5KOXA 2PBJA 1O8WA 5JWQB 4EIQA 1HD2A 3IK7A 2HNLA 3TGZA 3IR4A 4XIHA 1JZDA 1YDKA 3H79A 3GKNA 4JR4A 1ZGNA 4WR5A 2H75A 4TXOB 2I3YA 3KIJA 2C0DA 2PVOC 2H30A 5DJLA 2ZCTA 5IPGA 2OACA 4JU5A 2YWIA 4E8EA 4XS4A 2FHEA 12GSA 3GRXA 2LJAA 5AISA 4QL7A 5F07A 4F2IA 3W8JA 5CRGA 4Z2RA 2H0GA 1A8LA 4ECCA 1BG1A 4NHWA 3VURA 2H6ZA 4XS1A 1TKDB 2VM1A 4MJAA 1N2AA 3F6DA 3VI5A 2AAWA 1H75A 2B1LA 3VFIA 18GSA 1MDKA 2YV7A 3FR9A 4HQSA 5JCGA 2CAQA 2R37A 4ZB7A 2VCTA 4IGJA 4O5QA 1DE1A 2H76A 2LRNA 2YOIA 1M7TA 5IMCA 3G7YA 2KHPA 5DALB 1EEJA 5HR2A 3O6TA 1UVZA 4KSMA 1DSBA 1XBSA 1AQWA 3PINA 3P90A 1QUWA 1FVJA 3KTBA 2VD1A 1ERWA 2H01A 3UIWA 2IFQA 3TKSC 4NMUA 4EO3A 1S3CA 3NOFA 4J56E 3A2XA 3GA4A 4A5PA 3ZIJA 4YKGA 3KH7A 4MJBA 1GSSA 5CRWA 1NHOA 3TJFA 4AI6A 3GV1A 3D6IA 1J0FA 1OKTA 1TXUA 3GH9A 3GKKA 3FR6A 2A2SA 4HEA2 1A24A 2IMDA 4IJ3A 3GL5A 1ST9A 4IW9A 3EMXA 3H8QA 1LBKA 1GSDA 1GP1A 3RDWA 1F9MA 1SJZA 3RPNA 1HNAA 4AJ6A 3BOAA 2LRTA 2YJ7A 2PN8A 5HR1A 4L5LA 1FHEA 3E0UA 2VL9A 1DE2A 2CV4A 1ZMAA 2O5VA 5FHIA 2H6YA 5A4UA 3TJGA 3LJRA 3U6VA 2GSRA 1IYIA 2C3QA 1Q98A 4EKZA 4ULXA 2VO4A 1EOHA 4TR1A 4N0VA 1EGRA 1YQ1A 3TJJA 2HSHA 2YPMA 3IHQA 1PL2A 1Z5YE 3VLNA 1NW2A 4Q5NA 3IAS2 5ABRA 3GL3A 2PU9C 1SJIA 4IKHA 1AUCA 3F9UA 4TR3A 5DQYA 1SVLA 3ZMLA 4IP1A 1XW5A 4MCUA 1U3AA 1WRYA 4F0CA 2GQLA 2VOCA 2REMA 2A4VA 4GSNA 5G30A 1HYUA 4Q5RA 1VRSD 3J7Yk 1SKRB 1Y1UA 1O8XA 4MJCA 1X9SB 1PX7A 2O7KA 3GX0A 4ECBA 2VAFA 4NV2A 4QQ7A 1ABAA 5DCGA 1BQ7A 3HA9A 2FA4A 3N5OA 1TRSA 5J3RA 3LQ7A 3HJMA 4KDXA 1YJ6A 3IHGA 3CRTA 7GSSA 4D73A 3CSIA 3ZVJA 4IQ1A 4RI7A 5ECHB 2IN3A 2VCVA 5DCHA 3MDKA 2KOKA 3UJ1A 4ISDA 3GHAA 4BL7A 1EP7A 4PX1A 3ERFA 5ECPB 2H0HA 2MMNA 1U3IA 4TR0A 4AKHA 4WF4A 3LGCA 1TK0B 4I8BA 4GXZA 4MH3A 1AQXA 4KDYA 2RM6A 3VWUA 4MPFA 3GIXA 3F6FA 3ZMKA 3SBCA 2F8AA 2XBIA 1TU7A 2GDRA 3D5JA 2LV3A 3GSTA 1YZXA 1GNWA 4J2FA 1F3BA 4K9ZA 1ON4A 2DIYA 1LJRA 2CVKA 3UARA 5HFGA 2GZZA 1XWKA 2HRKB 5EY6A 4JE1A 2G0FA 1A23A 5IMVA 4MJEA 3VI7A 2OJLA 2EC4A 1GSYA 3M3MA 2PWJA 3GN3A 5IMZA 5H5SA 3KMOA 3D0ZA 3GMFA 3I43A 5IM9A 2CZ2A 2JL4A 2H1AA 4X43A 3M8NA 1M0UA 4EDZA 3EWLA 1XW6A 1GLQA 4KCEA 1T4ZA 2RLIA 1QK8A 3WT2A 1Z9HA 3WGXA 1YKCA 2OA7A 3OR5A 3QR6A 1ZYNA 1FVKA 1FW1A 2P31A 1BYEA 1PMTA 5D9XA 5C04A 1R5PA 3MSZA 2QC7A 4GRFA 2VL2A 2M80A 1PL1A 1ZYQB 3KJYA 1F3AA 2Z9SA 5KEJA 3VPTA 4EXJA 1Q4JA 2P5RA 3MYDA 5G31A 2HFDA 4K7IA 2VLUA 3EPTA 4OFNA 3E9JB 1PRXA 5A5HB 5C00A 1TK8B 4ACSA 2XBQA 3C73A 1NHYA 4O92A 5HFKA 1JZWA 3UBLA 2LTKA 3RAZA 3TKSA 2YZHA 2R3XA 4FYCA 10GSA 5IPHA 4G0LA 1E2YA 2HE3A 4POMA 2O87A 4KX4A 16GSA 3FK8A 3LEFA 5KOWA 3RBTA 2L59A 2FD3A 1FAAA 1PX6A 5ECNB 2BJXA 9GSSA 3ERGA 3KCMA 1T4YA 4IJIA 6GSXA 3DKSA 5D9VA 2D2ZA 4E8HA 4ZBDA 3IAM2 2IIYA 4BWQA 1K0AA 4ZL9A 2CQ9A 4YAVA 5IMAA 3F4RA 3LORA 3QD9A 4FYUA 3UVTA 1W4VA 2ES7A 3ERWA 1USBA 6GSYA 3IA1A 4K7NA 4O32A 4K8MA 1FB0A 4MZBA 2HZEB 3HJOA 3CBUA 1Z6NA 5J5NA 4PUAA 1SD9A 5BMUA 5CRHA 2GTUA 3TRXA 2K8VA 4OWYA 5D93A 1PN9A 2YCDA 1PKZA 1PN0A 2I81A 1QXHA 1FB6A 2KUCA 1GUHA 4WBRD 4ZB6A 3IC4A 5DBQA 4FH8A 1SKSB 1XOBA 2J23A 2B7KA 3KEBA 3GURA 2N5BA 1WJKA 4YQVA 4XHMA 2CX3A 1BX9A 4BVXB 2FGXA 4PXOA 3TKSE 2XPEA 3NIVA 4K0GA 4X4JA 2E0QA 2MMZA 4JEDA 1K0OA 2JU5A 1BAYA 3HMJG 1CQGA 1VGLA 3HZ4A 1SKWB 4POLA 1K0BA 1Z3EA 2LS5A 2VUPA 4EIPA 1GULA 2VLTA 5D96A 5E4WA 5CNWA 1Z6MA 2GQMA 5IOWA 3FZAA 3JCML 4LL1B 2LSTA 3HKRA 3O76A 4MDCA 4KA0A 1TRVA 4ILFA 2DJJA 1GSUA 2RUFA 2AYTA 1A2MA 4YH2A 3FEUA 4KW6A 2E7PA 2X99A 5INYA 5ID2B 2V6OA 2H1BA 1ERUA 5GAND 1KTEA 2OBKA 4PQ1A 5DVBA 3IV4A 1MTCA 1R4WA 2P5QA 1JHBA 1M9AA 4V2MA 2YN1A 1WPIA 4GWRA 2LRCA 5H5RA 1EOGA 2F3MA 3HZ8A 4TVEA 2CZ3A 2ON5A 1K0CA 3Q6OA 4GCIA 5JCWA 3RPPA 5IO0A 5JWOB 4NAXA 2KP1A 4MP4A 2MMAA 5CRDA 4ID0A 4EE0A 4DSRA 1GTUA 1TW9A 2UZ8A 4IELA 4ZXGA 2VD0A 3M1GA 2LKUA 3HVVA 2YWMA 3C1RA 2BMXA 3QOUA 4DSSB 3H1NA 2AB6A 4K5RA 1R7HA 1GLPA 3GX8A 1M2BA 1XWBA 4FYBA 3H93A 1G7OA 4TXOA 3US3A 3DVXA 5DQSA 4LMVA 4ECJA 2VCQA 3HVXA 3L4NA 4FIWA 3GNJA 4P3YB 2V1MA 4GQFA 3IXRA 5DDLA 3MWHA 4KB3A 3P2AA 2BTOT 1ERTA 3FRCA 3TDGA 3M9KA 1JLWA 4Z2UA 4OO5A 2DJ2A 3CRUA 1KBNA 2E2GA 2EIQA 2R2JA 2B7JA 4I6XA 4AF2A 4I5QA 3R2QA 3IPZA 3F3RA 1U88A 1CQHA 2YZUA 4KE3A 3ME7A 4F0BA 1SL0B 1G6WA 1YKAA 1ZYPA 2F8FA 5DALA 1X9WB 1OC9B 1SL1B 1SYRA 5L71A 4POKA 2OT3A 2C3NA 2PPTA 2GZYA 1O7UA 2AHEA 1PSQA 2JADA 1XIYA 1SL2B 3A5WA 4I2UA 4EF0A 2EFDA 5IO2A 2IL3A 1HQOA 1EZKA 2UV8G 3GKXA 4EDYA 1TI3A 5ENUA 3DRNA 2VCZA 4LL4B 3EU4A 19GSA 2CVDA 1MDJA 5CO3A 3KZQA 2HSNB 1U87A 3C8EA 3D4TA 1BG5A 2DKIA 3KMNA 4PNFA 2R6KA 4OD7A 5B6MA 1C72A 2K8SA 1ZCPA 4K5SA 2HRNA 3ZRDA 4J57E 1T8EB 2O8VB 4MABA 1ZL9A 2H66A 2GLRA 4RUVA 5A5KA 1I5GA 3ZZXA 1RW1A 1TTZA 2L6DA 1UN2A 4G2EA 4RI6A 2VKZG 4N3ZA 2HQTA 3EU3A 1UC7A 1XWCA 1A0RP 3GSSA 4MH2A 4HS1A 2EIRA 3ZTLA 3WD6A 1GH2A 1XVQA 1GSEA 4X0XA 4HJ2A 5J9BA 3GUSA 3KTLA 3CWGA 3APQA 3FMWA 1SJ6A 5ECKB 3FYGA 3HDCA 5B8AA 3FY7A 4RQXA 3FZ4A 3CTGA 3DMLA 3D22A 2LJKA 2FWGA 4HJMA 1G6YA 1GNEA 1AW9A 2FA8A 5DAKB 3P7XA 4OFTA 3ZIVA 2B3SA 4TR4A 3UVHA 3FZ9A 3L0HA 5F0GA 2A4HA 3FR3A 4NV5A 5AGYA 2K18A 2KLXA 4DVCA 2NTOA 2I9HA 2MMOA 2ZNMA 4MZWA 1QFNA 4GDFA 2LQQA 4G01A 2GZPA 3WGEA 2X4AA 2LEGA 1URMA 4K2DA 1QMVA 3TKRA 3UL3A 2HRFA 1B8XA 4GSTA 1V98A 5D9TA 1OC3A 3O3TA 3LYKA 5CYYA 5F05A 3U5RE 5J9CA 2YP6A 5H5QA 1OVNA 3L9UA 4KSOA 1K0NA 2VM2A 3UBKA 5COHA 5HQPA 1T00A 2LNTA 3L9VA 3ZFLA 3H4KA 3TUEA 3TJBA 2A2RA 2H73A 6GSVA 3KH9A 1XPVA 3QAWA 5A34B 3MNGA 5FWGA 4L8EA 3ZREA 3A2WA 3D21A 1Y25A 2WRTA 3EMPA 20GSA 4FQUA 4GTUA 2X8HA 3VK9A 2GT6A 4POBA 2HLSA 4GSSA 4ZBAA 4XRDA 2YV9A 1BF5A 2GQKA 2OE3A 1JLVA 2DIZA 4PURA 1XVWA 4I97A 3ME8A 1O6JA 3EVIA 3ZYWA 1TI1A 1MD3A 1LU4A 1ML6A 3KP9A 4HUAA 5HR0A 2N5AA 2H71A 3IBHA 4WXTA 4NXIA 2DJ3A 1B4QA 1XCCA 2MBTA 3EURA 3L78A 2GSTA 2A2PA 1XZOA 1G0TA 4BWSA 3ZL5A 1SK0A 4OCEA 5B7CA 2YJHA 4BA7A 4LMWA 4ECIA 4TXVA 2HRKA 4AKIA 1M9BA 3TOUA 1B9YC 4ZILA 5G5FA 2HZFA 4WETA 3DGQA 1A2JA 2JZRA 1XW9A 3DEXA 2H1GA 1T3BA 4KUNA 4WKWA 4XS6A 1HNBA 1JZOA 4EVMA 3G7JA 3DYRA 3UOMA 1JFUA 3KD0A 2YWNA 1KNGA 3IE3A 2B6MA 1TK5B 2V2GA 4G9HA 1X5CA 3RHBA 1N25A 3TCOA 2M46A 3C1SA 4IQAA 1H4OA 3AY8A 2H19A 3F4SA 2ON7A 1X5DA 1V40A 2FWHA 2H8LA 5JCUA 3Q18A 2QKEA 3GTUB 3A3TA 4PQIA 4PUFC 2CA8A 3C7MA 3A5IA 4E68A 2X64A 1XWAA 2QA1A 2IMFA 2HSMB 3VWXA 3W6GA 4WEYA 4QMKA 4IP6A 2H6XA 1WP0A 1QQ2A 1TOFA 2LJRA 1A2LA 4O5RA 3ZITA 5A5HA 5GZZB 5A4VA 3RHCA 2H70A 1K0MA 1Z7PA 2B5EA 5HFIA 4EL1A 2V41A 3TKPA 4V1Ap 1VF4A 5GSTA 4BVYB 2V32A 5A1NB 1K3LA 1FOHA 4YQMA 1T1VA 4V2NA 3N9JA 3QDNA 3ISOA 4ML6A 2X49A 3HD5A 4MA9A 4K6XA 1F37A 3DXBA 3QMXA 4K1FA 4HZ4A 5IMDA 4IBPA 17GSA 2WCIA 1GRXA 2WJUA 1XFLA 3K8NA 4ZB8A 1X9MB 4QL9A 2WFCA 2FY6A 3DWVA 2PVQA 4AKXB 2TIRA 1EEMA 2OBIA 3HY2A 4N11A 5G2ZA 4HQZA 3WYWA 3I9V2 2B5XA 4V2LA 8GSSA 1J9BA 4EC0A 1M2AA 22GSA 5F06A 2ZUPA 6GSWA 4WR4A 1K0DA 2HZEA 1TXXA 1OYJA 1SENA 3KM6A 1GWCA 3IC8A 6GSTA 2O85A 1SD8A 2O89A 1ZYEA 1SU9A 1SVMA 2C80A 2CT6A 4Z7XA 1THOA 2DSAA 1PA3A 4XS4B 2EFCA 2V6KA 5IIZA 3TOTA 4BVXA 2ALBA 4GQCA 1BEDA 2DLXA 2DC5A 1K3OA 4TN8A 2HXKA 4HDEA 3VPQA 2YWOA 2OE1A 1EV4A 4G10A 2XHFA 2HSYA 4GF0A 2H72A 2L4QA 2DBCA 5D73A 4YAPA 2GT5A 1PKWA 5HR3A 3SWLA 4CY6A 2L5LA 3QFAC 3KXOA 4ZB9A 2C1YA 3S9FA 2R5GA 4WF5A 5FT3A 1TU8A 4V1Ag 3WGDA 3CSHA 4KCAA 2WULA 4USSA 3MIXA 1VF1A 4OCFA 4TRXA 5ID2A 1T7PB 2IFQB 2EFHA 5LCZA 1IYHA 4I2TA 3G7IA 2HYXA 3P8WA 1O81A 3IK9A 4Z2TA 1NSWA 1A8YA 3GKMA 5GAPD 1ILOA 3QAVA 3EE2A 1J08A 2VL2C 2G2QA 1WE0A 1OE8A 2IMEA 3APOA 2IPAA 1AQVA 5ECSA 1X5EA 4KF9A 4TKYA 5EPFA 3BCKA 3E3EA 3ZFBA 4KNDA 4N0ZA 1YEPA 4TOPA 5ECLB 5B6NA 4DSSA 5J41A 3BCIA 5ECQB 2L6CA 4HZ2A 2L5OA 3CMIA 2F51A 4HU7A 3QCPA 3TJKA 3CTFA 2XPDA 3BJ5A 1ZZYA 1NM3A 4N30A 2IMIA 2VCWA 2JZSA 4MZCA 5G1LA 3TKQA 4DSQA 3F3QA 2HI7A 4G0IA 4H86A 4IN0A 3LSZA 2B5YA 3PPUA 4AJ7A 4BPYA 4CW9A 3R3EA 13GSA 2VLVA 3ZLPA 4CHSA 1S3DA 1WIKA 1EGOA 4TR1B 3CSJA 2C4JA 4JZQA 2WGRA 3FZ5A 4NWYA 2MBSA 4ICYA 3LG6A 1SK2A 1K3YA 1OC9A 4MPGA 5JWRB 4Q5QA 5D8IA 4GLTA 2R4VA 5AN1A 4JR6A 4O5UA 4F82A 1MEKA 2RIIA 2VIMA 5CP1A 3F0IA 5GSSA 1MDIA 5A4WA 4PQHA 5F8BA 1YEXA 2RUEA 2OKAA 3DD3A 3LFLA 1WOUA 1GSQA 5ECMB 5J4UA 5KN2A 2IWTA 2QGVA 2HSNA 2NDOA 1ZOFA 4NHZA 2R0PA 2C0GA 1FO5A 3Q74A 3ZVJD 2GS3A 2HRAA 14GSA 1PQNA 2B1KA 2MZCA 4YQUA 1YVLA 2AV4A 2C0EA 2K6VA 2LUSA 5G1KA 4D73B 2WS2A 1OC8A 4PGTA 2X8GA 3V1WA 3HXSA 1RK4A 2DJKA 4OO4A 5AIXA 2FWEA 2N5FA 1EP8A 1U6TA 4BL7B 2MYGA 1ACVA 3J7Yb 1GUMA 4EUYA 1DBYA 1W89A 3F63A 2OADA 5D9WA 5B8BA 1M2DA 4MF6A 4TW5A 2YNXA 2RM5A 5ELAA 1VF2A 3EC3A 1XXUA 1TDIA 3FKFA 3BBYA 2F9SA 5AIVA 2NBSA 3FW2A 4F03A 2EIOA 3HYPA 4ZBBA 5DAKA 3QFBC 4N10A 2VL3A 1GTBA 1QGVA 4MF5A 4CDOA 2C3TA 3Q19A 1R26A 2YANA 1B48A 4PNGA 4JRRA 2AUVA 1YY7A 5LNKe 2GGTA 1AIUA 3BD2A 1SK1A 4KH7A 4LLRA 4ZL7A 4MK3A 2JZTA 4ZL8A 2I4AA 4AKGA 2I1UA 3W8SA 3I6AA 11GSA 2NVLA 4MNNA 4X1UA 2FNOA 1OE7A 5J4YA 3G9BA 2H1LA 5BRTA 2L4CA 1AC1A 1R5AA 3PH9A 4L5OA 1S3AA 2QSIA 4K7OA 2GSQA 4IS0A 3PGTA 2E2MA 4ML1A 2H74A 1SVOA 5ELGA 1TJDA 4K2XA 5CREA 2GVPA 5IQYA 3CYNA 4CY8A 2WB9A 5A34A 5J4VA 4XRAA 2C8UA 2H0IA 1RQMA 4WBJA 1XOAA 4HU9A 2JACA 2LNSA 2J9HA 1UA5A 5ECRB 3LYPA 5J40A 2P0GA 1GL8A 5LD0A 3EYTA 1B9XC 4XTSA 4AJ8A 4RQRA 5IOXA 3LW9A 2LQOA 1YF0A 3NZNA 2FLSA 1GSFA 1I9DA 3IDVA 2CX4A 5KN0A 3MAKA 4OMVA 2TRXA 3DIEA 3HJPA 1TRWA 3VWVA 2IMKA 6GSUA 4PTSA 2FCHA 4DEJA 2FWFA 2OE0A 3IRAA 2HT9A 4IHUA 4NPBA 3HCZA 2M72A 3GYKA 4HI7A 1TP9A 2H1DA 3QPMA 3F4TA 5KN1A 1SYXA 3HVSA 4F9ZA 5CAXA 3QAGA 1V57A 3DVWA 4KAEA 1TRUA 2TRCP 1WWJA 1FG4A 1JZRA 5G5EA 3CXGA 1WMJA 3FHKA 2AJQB 2CVBA 2FUG2 3LXZA 2WZ9A 3KGKA 3C71A 3I69A 2DJ1A 1DUGA 4OFMA 1GTIA 1O73A 4G0KA 3TB2A 1V58A 2DMMA 4W66A 5BMUB 1AXDA 1Z7RA 5ECIB 3UAPA 3TRPA 2K9FA 1KEBA 3TRQA 3VWWA 3L9SA 1E6BA 4KDUA 4FO5A 3A2VA 5J47A 1V2AA 3GH6A 4LA1A 3GTUA 1V9WA 3UEMA 1GUKA 2DJ0A 2IJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MF7 A;  1M99 A;  3PR8 A;  4KGI A;  1OKD A;  2PMT A;  1THX A;  1FOV A;  2HSM A;  1EV9 A;  1PD2 1;  1VF3 A;  1OAZ A;  2VCX A;  1Y6E A;  4IVF A;  1G7E A;  2NPB A;  1A0F A;  3HHV A;  2WDU A;  4BVY A;  1GTA A;  2XC2 A;  3F8U A;  2PER A;  1EWX A;  2KP2 A;  1F6M C;  2JSY A;  1MD4 A;  1ERV A;  2JSZ A;  1PGT A;  4K0N A;  4L0U A;  2CAI A;  1XWG A;  2GSS A;  5EVO A;  5EL8 A;  3LXT A;  6GSS A;  4AGS A;  3ED3 A;  2C0F A;  5E59 A;  1BJX A;  4Q5F A;  1YF1 A;  4L0W A;  4JBB A;  3IOS A;  5KN3 A;  3UMA A;  4ZIJ A;  3LWA A;  5ECO B;  2L57 A;  1F2E A;  4MLY A;  3GFK A;  1X0R A;  1N8J A;  3M9J A;  3EIN A;  1O85 A;  2PUK C;  2DML A;  4XCS A;  4O7H A;  3D4M A;  4G19 A;  5IMF A;  4HOJ A;  1AAZ A;  3APS A;  3KP8 A;  1HNC A;  3M0F A;  2PGT A;  2X8C A;  5DJM A;  1B4P A;  4MMM A;  3WT1 A;  2PBJ A;  1O8W A;  5JWQ B;  1HD2 A;  3IK7 A;  2HNL A;  3TGZ A;  3IR4 A;  4XIH A;  1JZD A;  1YDK A;  3H79 A;  3GKN A;  4JR4 A;  1ZGN A;  4WR5 A;  2H75 A;  4TXO B;  2I3Y A;  3KIJ A;  2C0D A;  2PVO C;  2H30 A;  5DJL A;  2ZCT A;  5IPG A;  2OAC A;  4JU5 A;  2YWI A;  4E8E A;  4XS4 A;  2FHE A;  12GS A;  3GRX A;  2LJA A;  5AIS A;  4QL7 A;  5F07 A;  4F2I A;  3W8J A;  5CRG A;  2H0G A;  1A8L A;  4ECC A;  1TKD B;  4NHW A;  3VUR A;  2H6Z A;  4XS1 A;  2VM1 A;  4MJA A;  1N2A A;  3F6D A;  3VI5 A;  2AAW A;  1H75 A;  2B1L A;  3VFI A;  18GS A;  1MDK A;  2YV7 A;  3FR9 A;  4HQS A;  5JCG A;  2CAQ A;  2R37 A;  2VCT A;  4IGJ A;  1DE1 A;  2H76 A;  2LRN A;  2YOI A;  1M7T A;  5IMC A;  3G7Y A;  2KHP A;  5DAL B;  1EEJ A;  5HR2 A;  3O6T A;  1UVZ A;  4KSM A;  1DSB A;  1XBS A;  1AQW A;  3PIN A;  3P90 A;  1QUW A;  1FVJ A;  3KTB A;  2VD1 A;  1ERW A;  2H01 A;  3UIW A;  2IFQ A;  3TKS C;  4NMU A;  4EO3 A;  1S3C A;  3NOF A;  4J56 E;  3A2X A;  3GA4 A;  3ZIJ A;  3KH7 A;  4MJB A;  1GSS A;  5CRW A;  1NHO A;  3TJF A;  3GV1 A;  3D6I A;  1J0F A;  1OKT A;  3GH9 A;  3GKK A;  3FR6 A;  2A2S A;  4HEA 2;  1A24 A;  2IMD A;  4IJ3 A;  3GL5 A;  1ST9 A;  4IW9 A;  3EMX A;  3H8Q A;  1LBK A;  1GSD A;  1GP1 A;  3RDW A;  1F9M A;  1SJZ A;  3RPN A;  1HNA A;  4AJ6 A;  3BOA A;  2LRT A;  2YJ7 A;  2PN8 A;  5HR1 A;  4L5L A;  1FHE A;  3E0U A;  2VL9 A;  1DE2 A;  2CV4 A;  1ZMA A;  5FHI A;  2H6Y A;  5A4U A;  3TJG A;  3LJR A;  3U6V A;  2GSR A;  1IYI A;  2C3Q A;  1Q98 A;  4EKZ A;  4ULX A;  2VO4 A;  1EOH A;  4TR1 A;  4N0V A;  1EGR A;  1YQ1 A;  3TJJ A;  2HSH A;  2YPM A;  3IHQ A;  1PL2 A;  1Z5Y E;  3VLN A;  1NW2 A;  4Q5N A;  3IAS 2;  5ABR A;  3GL3 A;  2PU9 C;  1SJI A;  4IKH A;  1AUC A;  3F9U A;  4TR3 A;  5DQY A;  3ZML A;  4IP1 A;  1XW5 A;  4MCU A;  1U3A A;  1WRY A;  4F0C A;  2GQL A;  2VOC A;  2REM A;  2A4V A;  4GSN A;  5G30 A;  1HYU A;  4Q5R A;  1VRS D;  3J7Y k;  1SKR B;  1O8X A;  4MJC A;  1X9S B;  1PX7 A;  2O7K A;  3GX0 A;  4ECB A;  2VAF A;  4NV2 A;  4QQ7 A;  1ABA A;  5DCG A;  1BQ7 A;  3HA9 A;  2FA4 A;  3N5O A;  1TRS A;  5J3R A;  3LQ7 A;  3HJM A;  4KDX A;  1YJ6 A;  3CRT A;  7GSS A;  4D73 A;  3CSI A;  3ZVJ A;  4IQ1 A;  4RI7 A;  5ECH B;  2IN3 A;  2VCV A;  5DCH A;  3MDK A;  2KOK A;  3UJ1 A;  4ISD A;  3GHA A;  4BL7 A;  1EP7 A;  4PX1 A;  3ERF A;  5ECP B;  2H0H A;  2MMN A;  1U3I A;  4TR0 A;  4WF4 A;  3LGC A;  1TK0 B;  4I8B A;  4GXZ A;  4MH3 A;  1AQX A;  4KDY A;  2RM6 A;  3VWU A;  4MPF A;  3GIX A;  3F6F A;  3ZMK A;  3SBC A;  2F8A A;  2XBI A;  1TU7 A;  2GDR A;  3D5J A;  2LV3 A;  3GST A;  1YZX A;  1GNW A;  4J2F A;  1F3B A;  4K9Z A;  1ON4 A;  2DIY A;  1LJR A;  2CVK A;  3UAR A;  5HFG A;  2GZZ A;  1XWK A;  2HRK B;  5EY6 A;  4JE1 A;  2G0F A;  1A23 A;  5IMV A;  4MJE A;  3VI7 A;  2OJL A;  2EC4 A;  1GSY A;  3M3M A;  2PWJ A;  3GN3 A;  5IMZ A;  5H5S A;  3KMO A;  3D0Z A;  3GMF A;  3I43 A;  5IM9 A;  2CZ2 A;  2JL4 A;  2H1A A;  4X43 A;  3M8N A;  1M0U A;  4EDZ A;  3EWL A;  1XW6 A;  1GLQ A;  4KCE A;  1T4Z A;  2RLI A;  1QK8 A;  3WT2 A;  1Z9H A;  3WGX A;  1YKC A;  2OA7 A;  3OR5 A;  3QR6 A;  1FVK A;  1FW1 A;  2P31 A;  1BYE A;  1PMT A;  5D9X A;  5C04 A;  1R5P A;  3MSZ A;  2QC7 A;  4GRF A;  2VL2 A;  2M80 A;  1PL1 A;  1ZYQ B;  3KJY A;  1F3A A;  2Z9S A;  5KEJ A;  3VPT A;  4EXJ A;  1Q4J A;  2P5R A;  5G31 A;  2HFD A;  4K7I A;  2VLU A;  4OFN A;  3E9J B;  1PRX A;  5C00 A;  1TK8 B;  4ACS A;  2XBQ A;  3C73 A;  1NHY A;  4O92 A;  5HFK A;  1JZW A;  3UBL A;  2LTK A;  3RAZ A;  3TKS A;  2YZH A;  2R3X A;  4FYC A;  10GS A;  5IPH A;  4G0L A;  1E2Y A;  2HE3 A;  4POM A;  2O87 A;  4KX4 A;  16GS A;  3FK8 A;  3LEF A;  3RBT A;  2L59 A;  2FD3 A;  1FAA A;  1PX6 A;  5ECN B;  2BJX A;  9GSS A;  3ERG A;  3KCM A;  1T4Y A;  4IJI A;  6GSX A;  3DKS A;  5D9V A;  2D2Z A;  4E8H A;  4ZBD A;  3IAM 2;  2IIY A;  4BWQ A;  1K0A A;  4ZL9 A;  2CQ9 A;  4YAV A;  5IMA A;  3F4R A;  3LOR A;  3QD9 A;  4FYU A;  3UVT A;  1W4V A;  2ES7 A;  3ERW A;  1USB A;  6GSY A;  3IA1 A;  4K7N A;  4O32 A;  4K8M A;  1FB0 A;  4MZB A;  2HZE B;  3HJO A;  3CBU A;  1Z6N A;  5J5N A;  4PUA A;  1SD9 A;  5BMU A;  5CRH A;  2GTU A;  3TRX A;  2K8V A;  4OWY A;  5D93 A;  1PN9 A;  2YCD A;  1PKZ A;  2I81 A;  1QXH A;  1FB6 A;  2KUC A;  1GUH A;  4WBR D;  4ZB6 A;  3IC4 A;  5DBQ A;  4FH8 A;  1SKS B;  1XOB A;  2J23 A;  2B7K A;  3KEB A;  3GUR A;  2N5B A;  1WJK A;  4YQV A;  4XHM A;  2CX3 A;  1BX9 A;  4BVX B;  2FGX A;  4PXO A;  3TKS E;  2XPE A;  3NIV A;  4K0G A;  2E0Q A;  2MMZ A;  4JED A;  1K0O A;  2JU5 A;  1BAY A;  1CQG A;  1VGL A;  3HZ4 A;  1SKW B;  4POL A;  1K0B A;  1Z3E A;  2LS5 A;  2VUP A;  1GUL A;  2VLT A;  5D96 A;  5E4W A;  5CNW A;  1Z6M A;  2GQM A;  5IOW A;  3FZA A;  3JCM L;  4LL1 B;  2LST A;  3O76 A;  3HKR A;  4MDC A;  4KA0 A;  1TRV A;  4ILF A;  2DJJ A;  1GSU A;  2RUF A;  2AYT A;  1A2M A;  4YH2 A;  3FEU A;  4KW6 A;  2E7P A;  2X99 A;  5INY A;  5ID2 B;  2V6O A;  2H1B A;  1ERU A;  5GAN D;  1KTE A;  2OBK A;  4PQ1 A;  5DVB A;  3IV4 A;  1MTC A;  1R4W A;  2P5Q A;  1JHB A;  1M9A A;  4V2M A;  2YN1 A;  1WPI A;  4GWR A;  2LRC A;  5H5R A;  1EOG A;  2F3M A;  3HZ8 A;  4TVE A;  2CZ3 A;  2ON5 A;  1K0C A;  3Q6O A;  4GCI A;  5JCW A;  3RPP A;  5IO0 A;  5JWO B;  4NAX A;  2KP1 A;  4MP4 A;  2MMA A;  5CRD A;  4ID0 A;  4EE0 A;  4DSR A;  1GTU A;  1TW9 A;  2UZ8 A;  4IEL A;  4ZXG A;  2VD0 A;  3M1G A;  2LKU A;  3HVV A;  2YWM A;  3C1R A;  2BMX A;  3QOU A;  4DSS B;  3H1N A;  2AB6 A;  1R7H A;  1GLP A;  3GX8 A;  1M2B A;  1XWB A;  4FYB A;  3H93 A;  1G7O A;  4TXO A;  3US3 A;  3DVX A;  5DQS A;  4LMV A;  4ECJ A;  2VCQ A;  3HVX A;  3L4N A;  4FIW A;  3GNJ A;  4P3Y B;  2V1M A;  3IXR A;  5DDL A;  3MWH A;  4KB3 A;  3P2A A;  2BTO T;  1ERT A;  3FRC A;  3TDG A;  3M9K A;  1JLW A;  4OO5 A;  2DJ2 A;  3CRU A;  1KBN A;  2E2G A;  2EIQ A;  2R2J A;  2B7J A;  4I6X A;  4AF2 A;  4I5Q A;  3R2Q A;  3IPZ A;  3F3R A;  1U88 A;  1CQH A;  2YZU A;  4KE3 A;  3ME7 A;  4F0B A;  1SL0 B;  1G6W A;  1YKA A;  1X9W B;  2F8F A;  5DAL A;  1OC9 B;  1SL1 B;  1SYR A;  5L71 A;  4POK A;  2C3N A;  2PPT A;  2GZY A;  1O7U A;  2AHE A;  1PSQ A;  2JAD A;  1XIY A;  1SL2 B;  3A5W A;  4I2U A;  4EF0 A;  5IO2 A;  2IL3 A;  1HQO A;  1EZK A;  3GKX A;  4EDY A;  1TI3 A;  5ENU A;  3DRN A;  2VCZ A;  4LL4 B;  3EU4 A;  19GS A;  2CVD A;  1MDJ A;  5CO3 A;  3KZQ A;  2HSN B;  1U87 A;  3C8E A;  3D4T A;  1BG5 A;  3KMN A;  4PNF A;  2R6K A;  4OD7 A;  5B6M A;  1C72 A;  2K8S A;  1ZCP A;  2HRN A;  3ZRD A;  4J57 E;  1T8E B;  2O8V B;  4MAB A;  1ZL9 A;  2H66 A;  2GLR A;  4RUV A;  5A5K A;  1I5G A;  3ZZX A;  1RW1 A;  1TTZ A;  2L6D A;  1UN2 A;  4G2E A;  4RI6 A;  2HQT A;  3EU3 A;  1UC7 A;  1XWC A;  1A0R P;  3GSS A;  4MH2 A;  4HS1 A;  2EIR A;  3ZTL A;  3WD6 A;  1GH2 A;  1XVQ A;  1GSE A;  4X0X A;  4HJ2 A;  5J9B A;  3GUS A;  3KTL A;  3APQ A;  1SJ6 A;  5ECK B;  3FYG A;  3HDC A;  5B8A A;  3FY7 A;  4RQX A;  3FZ4 A;  3CTG A;  3DML A;  3D22 A;  2LJK A;  2FWG A;  4HJM A;  1G6Y A;  1GNE A;  1AW9 A;  2FA8 A;  5DAK B;  3P7X A;  4OFT A;  3ZIV A;  2B3S A;  4TR4 A;  3UVH A;  3FZ9 A;  3L0H A;  5F0G A;  3FR3 A;  4NV5 A;  5AGY A;  2K18 A;  2KLX A;  4DVC A;  2NTO A;  2I9H A;  2MMO A;  2ZNM A;  4MZW A;  1QFN A;  2LQQ A;  2GZP A;  3WGE A;  2LEG A;  1URM A;  4K2D A;  1QMV A;  3TKR A;  3UL3 A;  2HRF A;  1B8X A;  4GST A;  1V98 A;  5D9T A;  1OC3 A;  3O3T A;  3LYK A;  5CYY A;  5F05 A;  3U5R E;  5J9C A;  2YP6 A;  5H5Q A;  1OVN A;  3L9U A;  4KSO A;  1K0N A;  2VM2 A;  3UBK A;  5COH A;  5HQP A;  1T00 A;  2LNT A;  3L9V A;  3ZFL A;  3H4K A;  3TUE A;  3TJB A;  2A2R A;  2H73 A;  6GSV A;  3KH9 A;  1XPV A;  3QAW A;  3MNG A;  5FWG A;  4L8E A;  3ZRE A;  3A2W A;  3D21 A;  1Y25 A;  2WRT A;  3EMP A;  20GS A;  4FQU A;  4GTU A;  2X8H A;  3VK9 A;  2GT6 A;  4POB A;  2HLS A;  4GSS A;  4ZBA A;  4XRD A;  2YV9 A;  2GQK A;  2OE3 A;  1JLV A;  2DIZ A;  4PUR A;  1XVW A;  4I97 A;  3ME8 A;  1O6J A;  3EVI A;  3ZYW A;  1TI1 A;  1MD3 A;  1LU4 A;  1ML6 A;  3KP9 A;  4HUA A;  5HR0 A;  2N5A A;  2H71 A;  3IBH A;  4WXT A;  4NXI A;  2DJ3 A;  1B4Q A;  1XCC A;  2MBT A;  3EUR A;  3L78 A;  2GST A;  1XZO A;  1G0T A;  4BWS A;  3ZL5 A;  1SK0 A;  4OCE A;  5B7C A;  2YJH A;  4BA7 A;  4LMW A;  4ECI A;  4TXV A;  2HRK A;  1M9B A;  3TOU A;  1B9Y C;  4ZIL A;  5G5F A;  2HZF A;  4WET A;  3DGQ A;  1A2J A;  2JZR A;  1XW9 A;  3DEX A;  2H1G A;  1T3B A;  4KUN A;  4WKW A;  4XS6 A;  1HNB A;  1JZO A;  4EVM A;  3G7J A;  3DYR A;  3UOM A;  1JFU A;  3KD0 A;  2YWN A;  1KNG A;  3IE3 A;  2B6M A;  1TK5 B;  2V2G A;  4G9H A;  1X5C A;  3RHB A;  3TCO A;  2M46 A;  3C1S A;  4IQA A;  1H4O A;  3AY8 A;  2H19 A;  3F4S A;  2ON7 A;  1X5D A;  1V40 A;  2FWH A;  2H8L A;  5JCU A;  3Q18 A;  2QKE A;  3GTU B;  3A3T A;  4PQI A;  4PUF C;  2CA8 A;  3C7M A;  2X64 A;  1XWA A;  2IMF A;  2HSM B;  3VWX A;  3W6G A;  4WEY A;  4IP6 A;  2H6X A;  1WP0 A;  1QQ2 A;  1TOF A;  2LJR A;  1A2L A;  4O5R A;  3ZIT A;  5GZZ B;  5A4V A;  3RHC A;  2H70 A;  1K0M A;  1Z7P A;  2B5E A;  5HFI A;  4EL1 A;  2V41 A;  3TKP A;  4V1A p;  1VF4 A;  5GST A;  4BVY B;  2V32 A;  1K3L A;  4YQM A;  1T1V A;  4V2N A;  3N9J A;  3QDN A;  3ISO A;  4ML6 A;  3HD5 A;  4MA9 A;  4K6X A;  1F37 A;  3DXB A;  3QMX A;  4K1F A;  4HZ4 A;  5IMD A;  4IBP A;  17GS A;  2WCI A;  1GRX A;  2WJU A;  1XFL A;  3K8N A;  4ZB8 A;  1X9M B;  4QL9 A;  2WFC A;  2FY6 A;  3DWV A;  2PVQ A;  2TIR A;  1EEM A;  2OBI A;  3HY2 A;  4N11 A;  5G2Z A;  4HQZ A;  3WYW A;  3I9V 2;  2B5X A;  4V2L A;  8GSS A;  1J9B A;  4EC0 A;  1M2A A;  22GS A;  5F06 A;  2ZUP A;  6GSW A;  4WR4 A;  1K0D A;  2HZE A;  1TXX A;  1OYJ A;  1SEN A;  3KM6 A;  1GWC A;  3IC8 A;  6GST A;  2O85 A;  1SD8 A;  2O89 A;  1ZYE A;  1SU9 A;  2C80 A;  2CT6 A;  4Z7X A;  1THO A;  2DSA A;  1PA3 A;  2DJ0 A;  4XS4 B;  2V6K A;  5IIZ A;  3TOT A;  4BVX A;  2ALB A;  4GQC A;  1BED A;  2DLX A;  2DC5 A;  1K3O A;  4TN8 A;  2HXK A;  4HDE A;  3VPQ A;  2YWO A;  2OE1 A;  1EV4 A;  4G10 A;  2XHF A;  2HSY A;  4GF0 A;  2H72 A;  2L4Q A;  2DBC A;  5D73 A;  4YAP A;  2GT5 A;  1PKW A;  5HR3 A;  3SWL A;  2L5L A;  3QFA C;  3KXO A;  4ZB9 A;  2C1Y A;  3S9F A;  2R5G A;  4WF5 A;  5FT3 A;  1TU8 A;  4V1A g;  3WGD A;  3CSH A;  4KCA A;  2WUL A;  4USS A;  1VF1 A;  4OCF A;  4TRX A;  5ID2 A;  1T7P B;  2IFQ B;  5LCZ A;  1IYH A;  4I2T A;  3G7I A;  2HYX A;  3P8W A;  1O81 A;  3IK9 A;  1NSW A;  1A8Y A;  3GKM A;  5GAP D;  1ILO A;  3QAV A;  3EE2 A;  1J08 A;  2VL2 C;  2G2Q A;  1WE0 A;  1OE8 A;  2IME A;  3APO A;  2IPA A;  1AQV A;  5ECS A;  1X5E A;  4KF9 A;  4TKY A;  5EPF A;  3BCK A;  3E3E A;  3ZFB A;  4KND A;  4N0Z A;  1YEP A;  4TOP A;  5ECL B;  5B6N A;  4DSS A;  5J41 A;  3BCI A;  5ECQ B;  2L6C A;  4HZ2 A;  2L5O A;  3CMI A;  2F51 A;  4HU7 A;  3QCP A;  3TJK A;  3CTF A;  2XPD A;  3BJ5 A;  1ZZY A;  1NM3 A;  4N30 A;  2IMI A;  2VCW A;  2JZS A;  4MZC A;  5G1L A;  3TKQ A;  4DSQ A;  3F3Q A;  2HI7 A;  4G0I A;  4H86 A;  4IN0 A;  3LSZ A;  2B5Y A;  3PPU A;  4AJ7 A;  4BPY A;  4CW9 A;  3R3E A;  13GS A;  2VLV A;  3ZLP A;  4CHS A;  1S3D A;  1WIK A;  1EGO A;  4TR1 B;  3CSJ A;  2C4J A;  4JZQ A;  2WGR A;  3FZ5 A;  4NWY A;  2MBS A;  3LG6 A;  1SK2 A;  1K3Y A;  1OC9 A;  4MPG A;  5JWR B;  4Q5Q A;  5D8I A;  4GLT A;  2R4V A;  5AN1 A;  4JR6 A;  4F82 A;  1MEK A;  2RII A;  2VIM A;  5CP1 A;  3F0I A;  5GSS A;  1MDI A;  5A4W A;  4PQH A;  5F8B A;  1YEX A;  2RUE A;  2OKA A;  3DD3 A;  3LFL A;  1WOU A;  1GSQ A;  5ECM B;  5J4U A;  5KN2 A;  2IWT A;  2QGV A;  2NDO A;  1ZOF A;  4NHZ A;  2C0G A;  1FO5 A;  3Q74 A;  3ZVJ D;  2GS3 A;  2HRA A;  14GS A;  1PQN A;  2B1K A;  2MZC A;  4YQU A;  2AV4 A;  2C0E A;  2K6V A;  2LUS A;  5G1K A;  4D73 B;  2WS2 A;  1OC8 A;  4PGT A;  2X8G A;  3V1W A;  3HXS A;  1RK4 A;  2DJK A;  4OO4 A;  5AIX A;  2FWE A;  2N5F A;  1EP8 A;  1U6T A;  4BL7 B;  2MYG A;  1ACV A;  3J7Y b;  1GUM A;  4EUY A;  1DBY A;  1W89 A;  3F63 A;  2OAD A;  5D9W A;  5B8B A;  1M2D A;  4MF6 A;  4TW5 A;  2YNX A;  2RM5 A;  5ELA A;  1VF2 A;  3EC3 A;  1XXU A;  1TDI A;  3FKF A;  3BBY A;  2F9S A;  5AIV A;  2NBS A;  3FW2 A;  4F03 A;  2EIO A;  3HYP A;  4ZBB A;  5DAK A;  3QFB C;  4N10 A;  2VL3 A;  1GTB A;  1QGV A;  4MF5 A;  4CDO A;  2C3T A;  3Q19 A;  1R26 A;  2YAN A;  1B48 A;  4PNG A;  4JRR A;  2AUV A;  1YY7 A;  5LNK e;  2GGT A;  1AIU A;  3BD2 A;  1SK1 A;  4KH7 A;  4LLR A;  4ZL7 A;  4MK3 A;  2JZT A;  4ZL8 A;  2I4A A;  2I1U A;  3W8S A;  3I6A A;  11GS A;  2NVL A;  4X1U A;  2FNO A;  1OE7 A;  3G9B A;  2L4C A;  1AC1 A;  1R5A A;  3PH9 A;  4L5O A;  1S3A A;  2QSI A;  4K7O A;  2GSQ A;  4IS0 A;  3PGT A;  2E2M A;  4ML1 A;  2H74 A;  5ELG A;  1TJD A;  5CRE A;  2GVP A;  5IQY A;  3CYN A;  2WB9 A;  4XRA A;  2C8U A;  2H0I A;  1RQM A;  4WBJ A;  1XOA A;  4HU9 A;  2JAC A;  2LNS A;  2J9H A;  1UA5 A;  5ECR B;  3LYP A;  2P0G A;  1GL8 A;  5LD0 A;  3EYT A;  1B9X C;  4XTS A;  4AJ8 A;  4RQR A;  5IOX A;  2LQO A;  1YF0 A;  3NZN A;  2FLS A;  1GSF A;  1I9D A;  3IDV A;  2CX4 A;  5KN0 A;  3MAK A;  4OMV A;  2TRX A;  3DIE A;  3HJP A;  1TRW A;  3VWV A;  2IMK A;  6GSU A;  4PTS A;  2FCH A;  4DEJ A;  2FWF A;  2OE0 A;  3IRA A;  2HT9 A;  4IHU A;  4NPB A;  3HCZ A;  2M72 A;  3GYK A;  4HI7 A;  1TP9 A;  2H1D A;  3QPM A;  3F4T A;  5KN1 A;  1SYX A;  3HVS A;  4F9Z A;  5CAX A;  3QAG A;  1V57 A;  3DVW A;  4KAE A;  1TRU A;  2TRC P;  1WWJ A;  1FG4 A;  1JZR A;  5G5E A;  3CXG A;  1WMJ A;  3FHK A;  2AJQ B;  2CVB A;  2FUG 2;  3LXZ A;  2WZ9 A;  3KGK A;  3C71 A;  3I69 A;  2DJ1 A;  1DUG A;  4OFM A;  1GTI A;  1O73 A;  4G0K A;  3TB2 A;  1V58 A;  2DMM A;  1AXD A;  1Z7R A;  5ECI B;  3UAP A;  3TRP A;  2K9F A;  1KEB A;  3TRQ A;  3VWW A;  3L9S A;  1E6B A;  4KDU A;  4FO5 A;  3A2V A;  1V2A A;  3GH6 A;  4LA1 A;  3GTU A;  1V9W A;  3UEM A;  1GUK A;  4GQF A;  2IJY A; 
#chains in the Genus database with same CATH topology
 4MF7 A;  1M99 A;  3PR8 A;  4KGI A;  1OKD A;  2PMT A;  1THX A;  1FOV A;  2QA2 A;  2HSM A;  1EV9 A;  4YKF A;  1PD2 1;  2R0G A;  1VF3 A;  1OAZ A;  3TU3 B;  2VCX A;  1Y6E A;  4IVF A;  1G7E A;  2NPB A;  1A0F A;  2EFE A;  3HHV A;  2WDU A;  4BVY A;  1GTA A;  5A1N A;  2XC2 A;  3F8U A;  2PER A;  1EWX A;  2KP2 A;  1F6M C;  2JSY A;  1MD4 A;  1ERV A;  2JSZ A;  1PGT A;  4K0N A;  4L0U A;  2CAI A;  1XWG A;  2GSS A;  5EVO A;  5EL8 A;  2R0C A;  3LXT A;  6GSS A;  4AGS A;  3ED3 A;  2C0F A;  5E59 A;  1BJX A;  4Q5F A;  2DKH A;  1YF1 A;  4L0W A;  4JBB A;  3IOS A;  5KN3 A;  3UMA A;  4ZIJ A;  3LWA A;  5ECO B;  2L57 A;  1F2E A;  4MLY A;  3GFK A;  1PFO A;  2WZS A;  1X0R A;  1N8J A;  3M9J A;  3EIN A;  3RGB C;  1O85 A;  2PUK C;  2DML A;  4XCS A;  4O7H A;  3D4M A;  4G19 A;  5IMF A;  4HOJ A;  1AAZ A;  3APS A;  3KP8 A;  1HNC A;  3M0F A;  2PGT A;  2X8C A;  5DJM A;  1B4P A;  4MMM A;  3WT1 A;  5KOX A;  2PBJ A;  1O8W A;  5JWQ B;  4EIQ A;  1HD2 A;  3IK7 A;  2HNL A;  3TGZ A;  3IR4 A;  4XIH A;  1JZD A;  1YDK A;  3H79 A;  3GKN A;  4JR4 A;  1ZGN A;  4WR5 A;  2H75 A;  4TXO B;  2I3Y A;  3KIJ A;  2C0D A;  2PVO C;  2H30 A;  5DJL A;  2ZCT A;  5IPG A;  2OAC A;  4JU5 A;  2YWI A;  4E8E A;  4XS4 A;  2FHE A;  12GS A;  3GRX A;  2LJA A;  5AIS A;  4QL7 A;  5F07 A;  4F2I A;  3W8J A;  5CRG A;  4Z2R A;  2H0G A;  1A8L A;  4ECC A;  1BG1 A;  4NHW A;  3VUR A;  2H6Z A;  4XS1 A;  1TKD B;  2VM1 A;  4MJA A;  1N2A A;  3F6D A;  3VI5 A;  2AAW A;  1H75 A;  2B1L A;  3VFI A;  18GS A;  1MDK A;  2YV7 A;  3FR9 A;  4HQS A;  5JCG A;  2CAQ A;  2R37 A;  4ZB7 A;  2VCT A;  4IGJ A;  4O5Q A;  1DE1 A;  2H76 A;  2LRN A;  2YOI A;  1M7T A;  5IMC A;  3G7Y A;  2KHP A;  5DAL B;  1EEJ A;  5HR2 A;  3O6T A;  1UVZ A;  4KSM A;  1DSB A;  1XBS A;  1AQW A;  3PIN A;  3P90 A;  1QUW A;  1FVJ A;  3KTB A;  2VD1 A;  1ERW A;  2H01 A;  3UIW A;  2IFQ A;  3TKS C;  4NMU A;  4EO3 A;  1S3C A;  3NOF A;  4J56 E;  3A2X A;  3GA4 A;  4A5P A;  3ZIJ A;  4YKG A;  3KH7 A;  4MJB A;  1GSS A;  5CRW A;  1NHO A;  3TJF A;  4AI6 A;  3GV1 A;  3D6I A;  1J0F A;  1OKT A;  1TXU A;  3GH9 A;  3GKK A;  3FR6 A;  2A2S A;  4HEA 2;  1A24 A;  2IMD A;  4IJ3 A;  3GL5 A;  1ST9 A;  4IW9 A;  3EMX A;  3H8Q A;  1LBK A;  1GSD A;  1GP1 A;  3RDW A;  1F9M A;  1SJZ A;  3RPN A;  1HNA A;  4AJ6 A;  3BOA A;  2LRT A;  2YJ7 A;  2PN8 A;  5HR1 A;  4L5L A;  1FHE A;  3E0U A;  2VL9 A;  1DE2 A;  2CV4 A;  2WVX B;  1ZMA A;  2O5V A;  5FHI A;  2H6Y A;  5A4U A;  3TJG A;  3LJR A;  3U6V A;  2GSR A;  1IYI A;  2C3Q A;  1Q98 A;  4EKZ A;  4ULX A;  2VO4 A;  1EOH A;  4TR1 A;  4N0V A;  1EGR A;  1YQ1 A;  3TJJ A;  2HSH A;  2YPM A;  3IHQ A;  1PL2 A;  1Z5Y E;  3VLN A;  1NW2 A;  4Q5N A;  3IAS 2;  5ABR A;  3GL3 A;  2PU9 C;  1SJI A;  4IKH A;  1AUC A;  3F9U A;  4TR3 A;  5DQY A;  1SVL A;  3ZML A;  4IP1 A;  1XW5 A;  4MCU A;  1U3A A;  1WRY A;  4F0C A;  2GQL A;  2VOC A;  2REM A;  2A4V A;  4GSN A;  5G30 A;  1HYU A;  4Q5R A;  1VRS D;  3J7Y k;  1SKR B;  1Y1U A;  1O8X A;  4MJC A;  1X9S B;  1PX7 A;  2O7K A;  3GX0 A;  4ECB A;  2VAF A;  4NV2 A;  4QQ7 A;  1ABA A;  5DCG A;  1BQ7 A;  3HA9 A;  2FA4 A;  3N5O A;  1TRS A;  5J3R A;  3LQ7 A;  3HJM A;  4KDX A;  1YJ6 A;  3IHG A;  3CRT A;  7GSS A;  4D73 A;  3CSI A;  3ZVJ A;  4IQ1 A;  4RI7 A;  5ECH B;  2IN3 A;  2VCV A;  5DCH A;  3MDK A;  2KOK A;  3UJ1 A;  4ISD A;  3GHA A;  4BL7 A;  1EP7 A;  4PX1 A;  3ERF A;  5ECP B;  2H0H A;  2MMN A;  1U3I A;  4TR0 A;  4AKH A;  4WF4 A;  3LGC A;  1TK0 B;  4I8B A;  4GXZ A;  4MH3 A;  1AQX A;  4KDY A;  2RM6 A;  3VWU A;  4MPF A;  3GIX A;  3F6F A;  3ZMK A;  3SBC A;  2F8A A;  2XBI A;  1TU7 A;  2GDR A;  3D5J A;  2LV3 A;  3GST A;  1YZX A;  1GNW A;  4J2F A;  1F3B A;  4K9Z A;  1ON4 A;  2DIY A;  1LJR A;  2CVK A;  3UAR A;  5HFG A;  2GZZ A;  1XWK A;  2HRK B;  5EY6 A;  4JE1 A;  2G0F A;  1A23 A;  5IMV A;  4MJE A;  3VI7 A;  2OJL A;  2EC4 A;  1GSY A;  3M3M A;  2PWJ A;  3GN3 A;  5IMZ A;  5H5S A;  3KMO A;  3D0Z A;  3GMF A;  3I43 A;  5IM9 A;  2CZ2 A;  2JL4 A;  2H1A A;  4X43 A;  3M8N A;  1M0U A;  4EDZ A;  3EWL A;  1XW6 A;  1GLQ A;  4KCE A;  1T4Z A;  2RLI A;  1QK8 A;  2WW2 A;  3WT2 A;  1Z9H A;  3WGX A;  1YKC A;  2OA7 A;  3OR5 A;  3QR6 A;  1ZYN A;  1FVK A;  1FW1 A;  2P31 A;  1BYE A;  1PMT A;  5D9X A;  5C04 A;  1R5P A;  3MSZ A;  2QC7 A;  4GRF A;  2VL2 A;  2M80 A;  1PL1 A;  1ZYQ B;  3KJY A;  1F3A A;  2Z9S A;  5KEJ A;  3VPT A;  4EXJ A;  1Q4J A;  2P5R A;  3MYD A;  5G31 A;  2HFD A;  4K7I A;  2VLU A;  3EPT A;  4OFN A;  3E9J B;  1PRX A;  5A5H B;  5C00 A;  1TK8 B;  4ACS A;  2XBQ A;  3C73 A;  1NHY A;  4O92 A;  5HFK A;  1JZW A;  3UBL A;  2LTK A;  3RAZ A;  3TKS A;  2YZH A;  2R3X A;  4FYC A;  10GS A;  5IPH A;  4G0L A;  1E2Y A;  2HE3 A;  4POM A;  2O87 A;  4KX4 A;  16GS A;  3FK8 A;  3LEF A;  5KOW A;  3RBT A;  2L59 A;  2FD3 A;  1FAA A;  1PX6 A;  5ECN B;  2BJX A;  9GSS A;  3ERG A;  3KCM A;  1T4Y A;  4IJI A;  4PHZ C;  6GSX A;  3DKS A;  5D9V A;  2D2Z A;  4E8H A;  4ZBD A;  3IAM 2;  2IIY A;  4BWQ A;  1K0A A;  4ZL9 A;  2CQ9 A;  4YAV A;  5IMA A;  3F4R A;  3LOR A;  3QD9 A;  4FYU A;  3UVT A;  1W4V A;  2ES7 A;  3ERW A;  1USB A;  6GSY A;  3IA1 A;  4K7N A;  4O32 A;  4K8M A;  1FB0 A;  4MZB A;  2HZE B;  3HJO A;  1XG8 A;  3CBU A;  1Z6N A;  5J5N A;  4PUA A;  1SD9 A;  3HVN A;  5BMU A;  5CRH A;  2GTU A;  3TRX A;  2K8V A;  4OWY A;  5D93 A;  1PN9 A;  2YCD A;  1PKZ A;  1PN0 A;  2I81 A;  1QXH A;  1FB6 A;  2KUC A;  1GUH A;  4WBR D;  4ZB6 A;  3IC4 A;  5DBQ A;  4FH8 A;  1SKS B;  1XOB A;  2J23 A;  2B7K A;  3KEB A;  3GUR A;  2N5B A;  1WJK A;  4YQV A;  4XHM A;  2CX3 A;  1BX9 A;  4BVX B;  2FGX A;  4PXO A;  3TKS E;  2XPE A;  3NIV A;  4K0G A;  4X4J A;  2E0Q A;  2MMZ A;  4JED A;  1K0O A;  2JU5 A;  1BAY A;  3HMJ G;  1CQG A;  1VGL A;  3HZ4 A;  1SKW B;  4POL A;  1K0B A;  1Z3E A;  2LS5 A;  2VUP A;  4EIP A;  1GUL A;  2VLT A;  5D96 A;  5E4W A;  5CNW A;  1Z6M A;  2GQM A;  5IOW A;  3FZA A;  3JCM L;  4LL1 B;  2LST A;  3HKR A;  3O76 A;  4MDC A;  4KA0 A;  1TRV A;  4ILF A;  2DJJ A;  1GSU A;  2RUF A;  2AYT A;  1A2M A;  4YH2 A;  3FEU A;  4KW6 A;  2E7P A;  2X99 A;  5INY A;  5ID2 B;  2V6O A;  2H1B A;  1ERU A;  5GAN D;  1KTE A;  2OBK A;  4PQ1 A;  5DVB A;  3IV4 A;  1MTC A;  1R4W A;  2P5Q A;  1JHB A;  1M9A A;  4V2M A;  2YN1 A;  1WPI A;  4GWR A;  2LRC A;  5H5R A;  1EOG A;  2F3M A;  3HZ8 A;  4TVE A;  2CZ3 A;  2ON5 A;  1K0C A;  3Q6O A;  4GCI A;  5JCW A;  3RPP A;  5IO0 A;  5JWO B;  4NAX A;  2KP1 A;  4MP4 A;  2MMA A;  5CRD A;  4ID0 A;  4EE0 A;  4DSR A;  1GTU A;  1TW9 A;  2UZ8 A;  4IEL A;  4ZXG A;  2VD0 A;  3M1G A;  2LKU A;  3HVV A;  2YWM A;  3C1R A;  2BMX A;  2O3E A;  3QOU A;  4DSS B;  3H1N A;  2AB6 A;  4K5R A;  1R7H A;  1GLP A;  3GX8 A;  1M2B A;  1XWB A;  4FYB A;  3H93 A;  1G7O A;  4TXO A;  3US3 A;  3DVX A;  5DQS A;  4LMV A;  4ECJ A;  2VCQ A;  3HVX A;  3L4N A;  4FIW A;  3GNJ A;  4P3Y B;  2V1M A;  4GQF A;  3IXR A;  5DDL A;  3MWH A;  4KB3 A;  3P2A A;  2BTO T;  1ERT A;  3FRC A;  3TDG A;  3M9K A;  1JLW A;  4Z2U A;  1I1I P;  4OO5 A;  2DJ2 A;  3CRU A;  1KBN A;  2E2G A;  2EIQ A;  2R2J A;  2B7J A;  4I6X A;  4AF2 A;  2WW0 A;  4I5Q A;  3R2Q A;  3IPZ A;  3F3R A;  1U88 A;  4PI2 C;  1CQH A;  2YZU A;  4KE3 A;  3ME7 A;  4F0B A;  1SL0 B;  1G6W A;  1YKA A;  1ZYP A;  2F8F A;  5DAL A;  1X9W B;  1OC9 B;  1SL1 B;  1SYR A;  5L71 A;  4POK A;  2OT3 A;  2C3N A;  2PPT A;  2GZY A;  1O7U A;  2AHE A;  1PSQ A;  2JAD A;  1XIY A;  1SL2 B;  3A5W A;  4I2U A;  4EF0 A;  2EFD A;  5IO2 A;  2IL3 A;  1HQO A;  1EZK A;  2UV8 G;  3GKX A;  4EDY A;  1TI3 A;  5ENU A;  3DRN A;  2VCZ A;  4LL4 B;  3EU4 A;  19GS A;  2CVD A;  1MDJ A;  5CO3 A;  3KZQ A;  2HSN B;  1U87 A;  3C8E A;  3D4T A;  1BG5 A;  2DKI A;  3KMN A;  4PNF A;  2R6K A;  4OD7 A;  5B6M A;  1C72 A;  2K8S A;  1ZCP A;  4K5S A;  2HRN A;  3ZRD A;  4J57 E;  1T8E B;  2O8V B;  4MAB A;  1ZL9 A;  2H66 A;  2GLR A;  4RUV A;  5A5K A;  1I5G A;  3ZZX A;  1RW1 A;  1TTZ A;  2L6D A;  1UN2 A;  4G2E A;  4RI6 A;  2VKZ G;  4N3Z A;  2HQT A;  3EU3 A;  1UC7 A;  1XWC A;  1A0R P;  3GSS A;  4MH2 A;  4HS1 A;  2EIR A;  3ZTL A;  3WD6 A;  1GH2 A;  1XVQ A;  1GSE A;  4X0X A;  4HJ2 A;  5J9B A;  3GUS A;  3KTL A;  3CWG A;  3APQ A;  3FMW A;  1SJ6 A;  5ECK B;  3FYG A;  3HDC A;  2WVX A;  5B8A A;  3FY7 A;  4RQX A;  3FZ4 A;  3CTG A;  3DML A;  3D22 A;  2LJK A;  2FWG A;  4HJM A;  1G6Y A;  1GNE A;  1AW9 A;  2FA8 A;  4FXY P;  5DAK B;  3P7X A;  4OFT A;  3ZIV A;  2B3S A;  4TR4 A;  3UVH A;  3FZ9 A;  3L0H A;  5F0G A;  2A4H A;  3FR3 A;  4NV5 A;  5AGY A;  2K18 A;  2KLX A;  4DVC A;  2NTO A;  2I9H A;  2MMO A;  2ZNM A;  4MZW A;  1QFN A;  4GDF A;  2LQQ A;  4G01 A;  2GZP A;  3WGE A;  2X4A A;  2LEG A;  1URM A;  4K2D A;  1QMV A;  3TKR A;  3UL3 A;  2HRF A;  1B8X A;  4GST A;  1V98 A;  5D9T A;  1OC3 A;  3O3T A;  3LYK A;  5CYY A;  5F05 A;  3U5R E;  5J9C A;  2YP6 A;  5H5Q A;  1OVN A;  3L9U A;  4KSO A;  1K0N A;  2VM2 A;  3UBK A;  5COH A;  5HQP A;  1T00 A;  2LNT A;  3L9V A;  3ZFL A;  3H4K A;  3TUE A;  3TJB A;  2A2R A;  2H73 A;  6GSV A;  3KH9 A;  1XPV A;  3QAW A;  5A34 B;  3MNG A;  5FWG A;  4L8E A;  3ZRE A;  3A2W A;  3D21 A;  1Y25 A;  2WRT A;  3EMP A;  20GS A;  4FQU A;  4GTU A;  2X8H A;  3VK9 A;  2GT6 A;  4POB A;  2HLS A;  4GSS A;  4ZBA A;  4XRD A;  2YV9 A;  1BF5 A;  2GQK A;  2OE3 A;  1JLV A;  2DIZ A;  4PUR A;  1XVW A;  4I97 A;  3ME8 A;  1O6J A;  3EVI A;  3ZYW A;  1TI1 A;  1MD3 A;  1LU4 A;  1ML6 A;  3KP9 A;  4HUA A;  5HR0 A;  2N5A A;  2WVZ A;  2H71 A;  3IBH A;  4WXT A;  4NXI A;  2DJ3 A;  1B4Q A;  1XCC A;  2MBT A;  3EUR A;  3L78 A;  2O36 A;  2GST A;  2A2P A;  1XZO A;  1G0T A;  4BWS A;  3ZL5 A;  1SK0 A;  4OCE A;  5B7C A;  2YJH A;  4BA7 A;  4LMW A;  4ECI A;  4TXV A;  2HRK A;  4AKI A;  1M9B A;  3TOU A;  1B9Y C;  4ZIL A;  5G5F A;  2HZF A;  4WET A;  3DGQ A;  1A2J A;  2JZR A;  1XW9 A;  3DEX A;  2H1G A;  1T3B A;  4KUN A;  4WKW A;  4XS6 A;  1HNB A;  4HSC X;  1JZO A;  4EVM A;  3G7J A;  3DYR A;  3UOM A;  1JFU A;  3KD0 A;  2YWN A;  1KNG A;  3IE3 A;  2B6M A;  1TK5 B;  2V2G A;  4G9H A;  1X5C A;  3RHB A;  1N25 A;  3TCO A;  2M46 A;  3C1S A;  4IQA A;  1H4O A;  3AY8 A;  2H19 A;  3F4S A;  2ON7 A;  1X5D A;  1V40 A;  2FWH A;  2H8L A;  5JCU A;  3Q18 A;  2QKE A;  3GTU B;  3A3T A;  4PQI A;  4PUF C;  2CA8 A;  3C7M A;  3A5I A;  4E68 A;  2X64 A;  1XWA A;  2QA1 A;  2IMF A;  2HSM B;  3VWX A;  3W6G A;  4WEY A;  4QMK A;  4IP6 A;  2H6X A;  1WP0 A;  1QQ2 A;  1TOF A;  2LJR A;  1A2L A;  4O5R A;  3ZIT A;  5A5H A;  5GZZ B;  5A4V A;  3RHC A;  2H70 A;  1K0M A;  1Z7P A;  2B5E A;  5HFI A;  4EL1 A;  2V41 A;  3TKP A;  4V1A p;  1VF4 A;  5GST A;  4BVY B;  2V32 A;  5A1N B;  1K3L A;  1FOH A;  4YQM A;  1T1V A;  4V2N A;  3N9J A;  3QDN A;  3ISO A;  4ML6 A;  2X49 A;  3HD5 A;  4MA9 A;  4K6X A;  1F37 A;  3DXB A;  3QMX A;  4K1F A;  4HZ4 A;  5IMD A;  4IBP A;  17GS A;  2WCI A;  1GRX A;  2WJU A;  1XFL A;  3K8N A;  4ZB8 A;  1X9M B;  4QL9 A;  2WFC A;  2FY6 A;  3DWV A;  2PVQ A;  4AKX B;  2TIR A;  1EEM A;  2OBI A;  3HY2 A;  4N11 A;  5G2Z A;  4HQZ A;  3WYW A;  3I9V 2;  2B5X A;  4V2L A;  8GSS A;  1J9B A;  4EC0 A;  1M2A A;  22GS A;  2WVY A;  5F06 A;  2ZUP A;  6GSW A;  4WR4 A;  1K0D A;  2HZE A;  1TXX A;  1OYJ A;  1SEN A;  3KM6 A;  1GWC A;  3IC8 A;  6GST A;  2O85 A;  1SD8 A;  2O89 A;  1ZYE A;  1SU9 A;  1SVM A;  2C80 A;  2CT6 A;  4Z7X A;  1THO A;  2DSA A;  1PA3 A;  4XS4 B;  2EFC A;  2V6K A;  5IIZ A;  3TOT A;  4BVX A;  2ALB A;  4GQC A;  1BED A;  2DLX A;  2DC5 A;  1K3O A;  4TN8 A;  2HXK A;  4PI0 C;  4HDE A;  3VPQ A;  2YWO A;  2OE1 A;  2WW3 A;  1EV4 A;  4G10 A;  2XHF A;  2HSY A;  4GF0 A;  2H72 A;  2L4Q A;  2DBC A;  5D73 A;  4YAP A;  2GT5 A;  1PKW A;  5HR3 A;  3SWL A;  4CY6 A;  2L5L A;  3QFA C;  3KXO A;  4ZB9 A;  2C1Y A;  3S9F A;  2R5G A;  4WF5 A;  5FT3 A;  1TU8 A;  4V1A g;  3WGD A;  3CSH A;  4KCA A;  2WUL A;  4USS A;  3MIX A;  1VF1 A;  4OCF A;  3CHX C;  4TRX A;  5ID2 A;  1T7P B;  2IFQ B;  2EFH A;  5LCZ A;  4BIK A;  1IYH A;  4I2T A;  3G7I A;  2HYX A;  3P8W A;  1O81 A;  3IK9 A;  4Z2T A;  1NSW A;  1A8Y A;  3GKM A;  5GAP D;  1ILO A;  3QAV A;  3EE2 A;  1J08 A;  2VL2 C;  2G2Q A;  1WE0 A;  1OE8 A;  2IME A;  3APO A;  2IPA A;  1AQV A;  5ECS A;  1X5E A;  4KF9 A;  4TKY A;  5EPF A;  3BCK A;  3E3E A;  3ZFB A;  4KND A;  4N0Z A;  1YEP A;  4TOP A;  5ECL B;  5B6N A;  4DSS A;  5J41 A;  1M3J A;  3BCI A;  5ECQ B;  2L6C A;  4HZ2 A;  2L5O A;  3CMI A;  2F51 A;  4HU7 A;  3QCP A;  3TJK A;  3CTF A;  2XPD A;  3BJ5 A;  1ZZY A;  1NM3 A;  4N30 A;  2IMI A;  2VCW A;  2JZS A;  4MZC A;  5G1L A;  3TKQ A;  4DSQ A;  3F3Q A;  2HI7 A;  4G0I A;  4H86 A;  4IN0 A;  3LSZ A;  2B5Y A;  3PPU A;  4AJ7 A;  4BPY A;  4CW9 A;  3R3E A;  13GS A;  2VLV A;  3ZLP A;  4CHS A;  1S3D A;  1WIK A;  1EGO A;  4TR1 B;  3CSJ A;  2C4J A;  4JZQ A;  2WGR A;  3FZ5 A;  4NWY A;  2MBS A;  4ICY A;  3LG6 A;  1SK2 A;  1K3Y A;  1OC9 A;  4MPG A;  5JWR B;  4Q5Q A;  5D8I A;  1S3R A;  4GLT A;  2R4V A;  1YEW C;  5AN1 A;  4JR6 A;  4O5U A;  4F82 A;  1MEK A;  2RII A;  2VIM A;  5CP1 A;  3F0I A;  5GSS A;  1MDI A;  5A4W A;  4PQH A;  5F8B A;  1YEX A;  2RUE A;  2OKA A;  1M3I A;  3DD3 A;  3LFL A;  1WOU A;  1GSQ A;  5ECM B;  5J4U A;  5KN2 A;  2IWT A;  2QGV A;  2HSN A;  2NDO A;  1ZOF A;  4NHZ A;  2R0P A;  2C0G A;  1FO5 A;  3Q74 A;  3ZVJ D;  2GS3 A;  2HRA A;  14GS A;  1PQN A;  2B1K A;  2MZC A;  4YQU A;  1YVL A;  2AV4 A;  2C0E A;  2K6V A;  2LUS A;  5G1K A;  4D73 B;  2WS2 A;  1OC8 A;  4PGT A;  2X8G A;  3V1W A;  3HXS A;  1RK4 A;  2DJK A;  4OO4 A;  5AIX A;  2FWE A;  2N5F A;  1EP8 A;  1U6T A;  4BL7 B;  2MYG A;  1ACV A;  3J7Y b;  1GUM A;  4EUY A;  1DBY A;  1W89 A;  3F63 A;  2OAD A;  5D9W A;  5B8B A;  1M2D A;  4MF6 A;  4TW5 A;  3CQF A;  2YNX A;  2RM5 A;  5ELA A;  1VF2 A;  3EC3 A;  1XXU A;  1TDI A;  3FKF A;  3BBY A;  2F9S A;  5AIV A;  2NBS A;  3FW2 A;  4F03 A;  2EIO A;  3HYP A;  4ZBB A;  5DAK A;  3QFB C;  4N10 A;  2VL3 A;  1GTB A;  1QGV A;  4MF5 A;  4CDO A;  2C3T A;  3Q19 A;  1R26 A;  2YAN A;  1B48 A;  4PNG A;  4JRR A;  2AUV A;  1YY7 A;  5LNK e;  2GGT A;  1AIU A;  3BD2 A;  1SK1 A;  4KH7 A;  4LLR A;  4ZL7 A;  4MK3 A;  2JZT A;  4ZL8 A;  2I4A A;  4AKG A;  2I1U A;  3W8S A;  2WW1 A;  3I6A A;  11GS A;  2NVL A;  4MNN A;  4X1U A;  2FNO A;  1OE7 A;  5J4Y A;  3G9B A;  2H1L A;  5BRT A;  2L4C A;  1AC1 A;  1R5A A;  3PH9 A;  4L5O A;  1S3A A;  2QSI A;  4K7O A;  2GSQ A;  4IS0 A;  3PGT A;  2E2M A;  4ML1 A;  2H74 A;  1SVO A;  5ELG A;  1TJD A;  4K2X A;  5CRE A;  2GVP A;  5IQY A;  3CYN A;  4CY8 A;  2WB9 A;  5A34 A;  5J4V A;  4XRA A;  2C8U A;  2H0I A;  1RQM A;  4WBJ A;  1XOA A;  4HU9 A;  3RFR C;  2JAC A;  2LNS A;  2J9H A;  1UA5 A;  5ECR B;  3LYP A;  5J40 A;  2P0G A;  1GL8 A;  5LD0 A;  3EYT A;  1B9X C;  4XTS A;  4AJ8 A;  1S4B P;  4RQR A;  5IOX A;  3LW9 A;  2LQO A;  1YF0 A;  3NZN A;  2FLS A;  1GSF A;  1I9D A;  3IDV A;  2CX4 A;  5KN0 A;  3MAK A;  4OMV A;  2TRX A;  3DIE A;  3HJP A;  1TRW A;  3VWV A;  2IMK A;  6GSU A;  4PTS A;  2FCH A;  4DEJ A;  2FWF A;  2OE0 A;  3IRA A;  2HT9 A;  4IHU A;  4NPB A;  3HCZ A;  2M72 A;  3GYK A;  4HI7 A;  1TP9 A;  2H1D A;  3QPM A;  3F4T A;  5KN1 A;  1SYX A;  3HVS A;  4F9Z A;  5CAX A;  3QAG A;  1V57 A;  3DVW A;  4KAE A;  1TRU A;  2TRC P;  1WWJ A;  1FG4 A;  1JZR A;  5G5E A;  3CXG A;  1WMJ A;  3FHK A;  2AJQ B;  2CVB A;  2FUG 2;  3LXZ A;  2WZ9 A;  3KGK A;  3C71 A;  3I69 A;  2DJ1 A;  1DUG A;  4OFM A;  1GTI A;  1O73 A;  4G0K A;  3TB2 A;  1V58 A;  2DMM A;  4W66 A;  5BMU B;  1AXD A;  1Z7R A;  5ECI B;  3UAP A;  3TRP A;  2K9F A;  1KEB A;  3TRQ A;  3VWW A;  3L9S A;  1E6B A;  4KDU A;  4FO5 A;  3A2V A;  5J47 A;  1V2A A;  3GH6 A;  4LA1 A;  3GTU A;  1V9W A;  3UEM A;  1GUK A;  2DJ0 A;  2IJY A; 
#chains in the Genus database with same CATH homology
 4MF7 A;  1M99 A;  3PR8 A;  4KGI A;  1OKD A;  2PMT A;  1THX A;  1FOV A;  2QA2 A;  2HSM A;  1EV9 A;  4YKF A;  1PD2 1;  2R0G A;  1VF3 A;  1OAZ A;  3TU3 B;  2VCX A;  1Y6E A;  4IVF A;  1G7E A;  2NPB A;  1A0F A;  2EFE A;  3HHV A;  2WDU A;  4BVY A;  1GTA A;  5A1N A;  2XC2 A;  3F8U A;  2PER A;  1EWX A;  2KP2 A;  1F6M C;  2JSY A;  1MD4 A;  1ERV A;  2JSZ A;  1PGT A;  4K0N A;  4L0U A;  2CAI A;  1XWG A;  2GSS A;  5EVO A;  5EL8 A;  2R0C A;  3LXT A;  6GSS A;  4AGS A;  3ED3 A;  2C0F A;  5E59 A;  1BJX A;  4Q5F A;  2DKH A;  1YF1 A;  4L0W A;  4JBB A;  3IOS A;  5KN3 A;  3UMA A;  4ZIJ A;  3LWA A;  5ECO B;  2L57 A;  1F2E A;  4MLY A;  3GFK A;  1X0R A;  1N8J A;  3M9J A;  3EIN A;  1O85 A;  2PUK C;  2DML A;  4XCS A;  4O7H A;  3D4M A;  4G19 A;  5IMF A;  4HOJ A;  1AAZ A;  3APS A;  3KP8 A;  1HNC A;  3M0F A;  2PGT A;  2X8C A;  5DJM A;  1B4P A;  4MMM A;  3WT1 A;  5KOX A;  2PBJ A;  1O8W A;  5JWQ B;  4EIQ A;  1HD2 A;  3IK7 A;  2HNL A;  3TGZ A;  3IR4 A;  4XIH A;  1JZD A;  1YDK A;  3H79 A;  3GKN A;  4JR4 A;  1ZGN A;  4WR5 A;  2H75 A;  4TXO B;  2I3Y A;  3KIJ A;  2C0D A;  2PVO C;  2H30 A;  5DJL A;  2ZCT A;  5IPG A;  2OAC A;  4JU5 A;  2YWI A;  4E8E A;  4XS4 A;  2FHE A;  12GS A;  3GRX A;  2LJA A;  5AIS A;  4QL7 A;  5F07 A;  4F2I A;  3W8J A;  5CRG A;  4Z2R A;  2H0G A;  1A8L A;  4ECC A;  1BG1 A;  4NHW A;  3VUR A;  2H6Z A;  4XS1 A;  1TKD B;  2VM1 A;  4MJA A;  1N2A A;  3F6D A;  3VI5 A;  2AAW A;  1H75 A;  2B1L A;  3VFI A;  18GS A;  1MDK A;  2YV7 A;  3FR9 A;  4HQS A;  5JCG A;  2CAQ A;  2R37 A;  4ZB7 A;  2VCT A;  4IGJ A;  4O5Q A;  1DE1 A;  2H76 A;  2LRN A;  2YOI A;  1M7T A;  5IMC A;  3G7Y A;  2KHP A;  5DAL B;  1EEJ A;  5HR2 A;  3O6T A;  1UVZ A;  4KSM A;  1DSB A;  1XBS A;  1AQW A;  3PIN A;  3P90 A;  1QUW A;  1FVJ A;  3KTB A;  2VD1 A;  1ERW A;  2H01 A;  3UIW A;  2IFQ A;  3TKS C;  4NMU A;  4EO3 A;  1S3C A;  3NOF A;  4J56 E;  3A2X A;  3GA4 A;  4A5P A;  3ZIJ A;  4YKG A;  3KH7 A;  4MJB A;  1GSS A;  5CRW A;  1NHO A;  3TJF A;  4AI6 A;  3GV1 A;  3D6I A;  1J0F A;  1OKT A;  1TXU A;  3GH9 A;  3GKK A;  3FR6 A;  2A2S A;  4HEA 2;  1A24 A;  2IMD A;  4IJ3 A;  3GL5 A;  1ST9 A;  4IW9 A;  3EMX A;  3H8Q A;  1LBK A;  1GSD A;  1GP1 A;  3RDW A;  1F9M A;  1SJZ A;  3RPN A;  1HNA A;  4AJ6 A;  3BOA A;  2LRT A;  2YJ7 A;  2PN8 A;  5HR1 A;  4L5L A;  1FHE A;  3E0U A;  2VL9 A;  1DE2 A;  2CV4 A;  1ZMA A;  2O5V A;  5FHI A;  2H6Y A;  5A4U A;  3TJG A;  3LJR A;  3U6V A;  2GSR A;  1IYI A;  2C3Q A;  1Q98 A;  4EKZ A;  4ULX A;  2VO4 A;  1EOH A;  4TR1 A;  4N0V A;  1EGR A;  1YQ1 A;  3TJJ A;  2HSH A;  2YPM A;  3IHQ A;  1PL2 A;  1Z5Y E;  3VLN A;  1NW2 A;  4Q5N A;  3IAS 2;  5ABR A;  3GL3 A;  2PU9 C;  1SJI A;  4IKH A;  1AUC A;  3F9U A;  4TR3 A;  5DQY A;  1SVL A;  3ZML A;  4IP1 A;  1XW5 A;  4MCU A;  1U3A A;  1WRY A;  4F0C A;  2GQL A;  2VOC A;  2REM A;  2A4V A;  4GSN A;  5G30 A;  1HYU A;  4Q5R A;  1VRS D;  3J7Y k;  1SKR B;  1Y1U A;  1O8X A;  4MJC A;  1X9S B;  1PX7 A;  2O7K A;  3GX0 A;  4ECB A;  2VAF A;  4NV2 A;  4QQ7 A;  1ABA A;  5DCG A;  1BQ7 A;  3HA9 A;  2FA4 A;  3N5O A;  1TRS A;  5J3R A;  3LQ7 A;  3HJM A;  4KDX A;  1YJ6 A;  3IHG A;  3CRT A;  7GSS A;  4D73 A;  3CSI A;  3ZVJ A;  4IQ1 A;  4RI7 A;  5ECH B;  2IN3 A;  2VCV A;  5DCH A;  3MDK A;  2KOK A;  3UJ1 A;  4ISD A;  3GHA A;  4BL7 A;  1EP7 A;  4PX1 A;  3ERF A;  5ECP B;  2H0H A;  2MMN A;  1U3I A;  4TR0 A;  4AKH A;  4WF4 A;  3LGC A;  1TK0 B;  4I8B A;  4GXZ A;  4MH3 A;  1AQX A;  4KDY A;  2RM6 A;  3VWU A;  4MPF A;  3GIX A;  3F6F A;  3ZMK A;  3SBC A;  2F8A A;  2XBI A;  1TU7 A;  2GDR A;  3D5J A;  2LV3 A;  3GST A;  1YZX A;  1GNW A;  4J2F A;  1F3B A;  4K9Z A;  1ON4 A;  2DIY A;  1LJR A;  2CVK A;  3UAR A;  5HFG A;  2GZZ A;  1XWK A;  2HRK B;  5EY6 A;  4JE1 A;  2G0F A;  1A23 A;  5IMV A;  4MJE A;  3VI7 A;  2OJL A;  2EC4 A;  1GSY A;  3M3M A;  2PWJ A;  3GN3 A;  5IMZ A;  5H5S A;  3KMO A;  3D0Z A;  3GMF A;  3I43 A;  5IM9 A;  2CZ2 A;  2JL4 A;  2H1A A;  4X43 A;  3M8N A;  1M0U A;  4EDZ A;  3EWL A;  1XW6 A;  1GLQ A;  4KCE A;  1T4Z A;  2RLI A;  1QK8 A;  3WT2 A;  1Z9H A;  3WGX A;  1YKC A;  2OA7 A;  3OR5 A;  3QR6 A;  1ZYN A;  1FVK A;  1FW1 A;  2P31 A;  1BYE A;  1PMT A;  5D9X A;  5C04 A;  1R5P A;  3MSZ A;  2QC7 A;  4GRF A;  2VL2 A;  2M80 A;  1PL1 A;  1ZYQ B;  3KJY A;  1F3A A;  2Z9S A;  5KEJ A;  3VPT A;  4EXJ A;  1Q4J A;  2P5R A;  3MYD A;  5G31 A;  2HFD A;  4K7I A;  2VLU A;  3EPT A;  4OFN A;  3E9J B;  1PRX A;  5A5H B;  5C00 A;  1TK8 B;  4ACS A;  2XBQ A;  3C73 A;  1NHY A;  4O92 A;  5HFK A;  1JZW A;  3UBL A;  2LTK A;  3RAZ A;  3TKS A;  2YZH A;  2R3X A;  4FYC A;  10GS A;  5IPH A;  4G0L A;  1E2Y A;  2HE3 A;  4POM A;  2O87 A;  4KX4 A;  16GS A;  3FK8 A;  3LEF A;  5KOW A;  3RBT A;  2L59 A;  2FD3 A;  1FAA A;  1PX6 A;  5ECN B;  2BJX A;  9GSS A;  3ERG A;  3KCM A;  1T4Y A;  4IJI A;  6GSX A;  3DKS A;  5D9V A;  2D2Z A;  4E8H A;  4ZBD A;  3IAM 2;  2IIY A;  4BWQ A;  1K0A A;  4ZL9 A;  2CQ9 A;  4YAV A;  5IMA A;  3F4R A;  3LOR A;  3QD9 A;  4FYU A;  3UVT A;  1W4V A;  2ES7 A;  3ERW A;  1USB A;  6GSY A;  3IA1 A;  4K7N A;  4O32 A;  4K8M A;  1FB0 A;  4MZB A;  2HZE B;  3HJO A;  3CBU A;  1Z6N A;  5J5N A;  4PUA A;  1SD9 A;  5BMU A;  5CRH A;  2GTU A;  3TRX A;  2K8V A;  4OWY A;  5D93 A;  1PN9 A;  2YCD A;  1PKZ A;  1PN0 A;  2I81 A;  1QXH A;  1FB6 A;  2KUC A;  1GUH A;  4WBR D;  4ZB6 A;  3IC4 A;  5DBQ A;  4FH8 A;  1SKS B;  1XOB A;  2J23 A;  2B7K A;  3KEB A;  3GUR A;  2N5B A;  1WJK A;  4YQV A;  4XHM A;  2CX3 A;  1BX9 A;  4BVX B;  2FGX A;  4PXO A;  3TKS E;  2XPE A;  3NIV A;  4K0G A;  4X4J A;  2E0Q A;  2MMZ A;  4JED A;  1K0O A;  2JU5 A;  1BAY A;  3HMJ G;  1CQG A;  1VGL A;  3HZ4 A;  1SKW B;  4POL A;  1K0B A;  1Z3E A;  2LS5 A;  2VUP A;  4EIP A;  1GUL A;  2VLT A;  5D96 A;  5E4W A;  5CNW A;  1Z6M A;  2GQM A;  5IOW A;  3FZA A;  3JCM L;  4LL1 B;  2LST A;  3HKR A;  3O76 A;  4MDC A;  4KA0 A;  1TRV A;  4ILF A;  2DJJ A;  1GSU A;  2RUF A;  2AYT A;  1A2M A;  4YH2 A;  3FEU A;  4KW6 A;  2E7P A;  2X99 A;  5INY A;  5ID2 B;  2V6O A;  2H1B A;  1ERU A;  5GAN D;  1KTE A;  2OBK A;  4PQ1 A;  5DVB A;  3IV4 A;  1MTC A;  1R4W A;  2P5Q A;  1JHB A;  1M9A A;  4V2M A;  2YN1 A;  1WPI A;  4GWR A;  2LRC A;  5H5R A;  1EOG A;  2F3M A;  3HZ8 A;  4TVE A;  2CZ3 A;  2ON5 A;  1K0C A;  3Q6O A;  4GCI A;  5JCW A;  3RPP A;  5IO0 A;  5JWO B;  4NAX A;  2KP1 A;  4MP4 A;  2MMA A;  5CRD A;  4ID0 A;  4EE0 A;  4DSR A;  1GTU A;  1TW9 A;  2UZ8 A;  4IEL A;  4ZXG A;  2VD0 A;  3M1G A;  2LKU A;  3HVV A;  2YWM A;  3C1R A;  2BMX A;  3QOU A;  4DSS B;  3H1N A;  2AB6 A;  4K5R A;  1R7H A;  1GLP A;  3GX8 A;  1M2B A;  1XWB A;  4FYB A;  3H93 A;  1G7O A;  4TXO A;  3US3 A;  3DVX A;  5DQS A;  4LMV A;  4ECJ A;  2VCQ A;  3HVX A;  3L4N A;  4FIW A;  3GNJ A;  4P3Y B;  2V1M A;  4GQF A;  3IXR A;  5DDL A;  3MWH A;  4KB3 A;  3P2A A;  2BTO T;  1ERT A;  3FRC A;  3TDG A;  3M9K A;  1JLW A;  4Z2U A;  4OO5 A;  2DJ2 A;  3CRU A;  1KBN A;  2E2G A;  2EIQ A;  2R2J A;  2B7J A;  4I6X A;  4AF2 A;  4I5Q A;  3R2Q A;  3IPZ A;  3F3R A;  1U88 A;  1CQH A;  2YZU A;  4KE3 A;  3ME7 A;  4F0B A;  1SL0 B;  1G6W A;  1YKA A;  1ZYP A;  2F8F A;  5DAL A;  1X9W B;  1OC9 B;  1SL1 B;  1SYR A;  5L71 A;  4POK A;  2OT3 A;  2C3N A;  2PPT A;  2GZY A;  1O7U A;  2AHE A;  1PSQ A;  2JAD A;  1XIY A;  1SL2 B;  3A5W A;  4I2U A;  4EF0 A;  2EFD A;  5IO2 A;  2IL3 A;  1HQO A;  1EZK A;  2UV8 G;  3GKX A;  4EDY A;  1TI3 A;  5ENU A;  3DRN A;  2VCZ A;  4LL4 B;  3EU4 A;  19GS A;  2CVD A;  1MDJ A;  5CO3 A;  3KZQ A;  2HSN B;  1U87 A;  3C8E A;  3D4T A;  1BG5 A;  2DKI A;  3KMN A;  4PNF A;  2R6K A;  4OD7 A;  5B6M A;  1C72 A;  2K8S A;  1ZCP A;  4K5S A;  2HRN A;  3ZRD A;  4J57 E;  1T8E B;  2O8V B;  4MAB A;  1ZL9 A;  2H66 A;  2GLR A;  4RUV A;  5A5K A;  1I5G A;  3ZZX A;  1RW1 A;  1TTZ A;  2L6D A;  1UN2 A;  4G2E A;  4RI6 A;  2VKZ G;  4N3Z A;  2HQT A;  3EU3 A;  1UC7 A;  1XWC A;  1A0R P;  3GSS A;  4MH2 A;  4HS1 A;  2EIR A;  3ZTL A;  3WD6 A;  1GH2 A;  1XVQ A;  1GSE A;  4X0X A;  4HJ2 A;  5J9B A;  3GUS A;  3KTL A;  3CWG A;  3APQ A;  3FMW A;  1SJ6 A;  5ECK B;  3FYG A;  3HDC A;  5B8A A;  3FY7 A;  4RQX A;  3FZ4 A;  3CTG A;  3DML A;  3D22 A;  2LJK A;  2FWG A;  4HJM A;  1G6Y A;  1GNE A;  1AW9 A;  2FA8 A;  5DAK B;  3P7X A;  4OFT A;  3ZIV A;  2B3S A;  4TR4 A;  3UVH A;  3FZ9 A;  3L0H A;  5F0G A;  2A4H A;  3FR3 A;  4NV5 A;  5AGY A;  2K18 A;  2KLX A;  4DVC A;  2NTO A;  2I9H A;  2MMO A;  2ZNM A;  4MZW A;  1QFN A;  4GDF A;  2LQQ A;  4G01 A;  2GZP A;  3WGE A;  2X4A A;  2LEG A;  1URM A;  4K2D A;  1QMV A;  3TKR A;  3UL3 A;  2HRF A;  1B8X A;  4GST A;  1V98 A;  5D9T A;  1OC3 A;  3O3T A;  3LYK A;  5CYY A;  5F05 A;  3U5R E;  5J9C A;  2YP6 A;  5H5Q A;  1OVN A;  3L9U A;  4KSO A;  1K0N A;  2VM2 A;  3UBK A;  5COH A;  5HQP A;  1T00 A;  2LNT A;  3L9V A;  3ZFL A;  3H4K A;  3TUE A;  3TJB A;  2A2R A;  2H73 A;  6GSV A;  3KH9 A;  1XPV A;  3QAW A;  5A34 B;  3MNG A;  5FWG A;  4L8E A;  3ZRE A;  3A2W A;  3D21 A;  1Y25 A;  2WRT A;  3EMP A;  20GS A;  4FQU A;  4GTU A;  2X8H A;  3VK9 A;  2GT6 A;  4POB A;  2HLS A;  4GSS A;  4ZBA A;  4XRD A;  2YV9 A;  1BF5 A;  2GQK A;  2OE3 A;  1JLV A;  2DIZ A;  4PUR A;  1XVW A;  4I97 A;  3ME8 A;  1O6J A;  3EVI A;  3ZYW A;  1TI1 A;  1MD3 A;  1LU4 A;  1ML6 A;  3KP9 A;  4HUA A;  5HR0 A;  2N5A A;  2H71 A;  3IBH A;  4WXT A;  4NXI A;  2DJ3 A;  1B4Q A;  1XCC A;  2MBT A;  3EUR A;  3L78 A;  2GST A;  2A2P A;  1XZO A;  1G0T A;  4BWS A;  3ZL5 A;  1SK0 A;  4OCE A;  5B7C A;  2YJH A;  4BA7 A;  4LMW A;  4ECI A;  4TXV A;  2HRK A;  4AKI A;  1M9B A;  3TOU A;  1B9Y C;  4ZIL A;  5G5F A;  2HZF A;  4WET A;  3DGQ A;  1A2J A;  2JZR A;  1XW9 A;  3DEX A;  2H1G A;  1T3B A;  4KUN A;  4WKW A;  4XS6 A;  1HNB A;  1JZO A;  4EVM A;  3G7J A;  3DYR A;  3UOM A;  1JFU A;  3KD0 A;  2YWN A;  1KNG A;  3IE3 A;  2B6M A;  1TK5 B;  2V2G A;  4G9H A;  1X5C A;  3RHB A;  1N25 A;  3TCO A;  2M46 A;  3C1S A;  4IQA A;  1H4O A;  3AY8 A;  2H19 A;  3F4S A;  2ON7 A;  1X5D A;  1V40 A;  2FWH A;  2H8L A;  5JCU A;  3Q18 A;  2QKE A;  3GTU B;  3A3T A;  4PQI A;  4PUF C;  2CA8 A;  3C7M A;  3A5I A;  4E68 A;  2X64 A;  1XWA A;  2QA1 A;  2IMF A;  2HSM B;  3VWX A;  3W6G A;  4WEY A;  4QMK A;  4IP6 A;  2H6X A;  1WP0 A;  1QQ2 A;  1TOF A;  2LJR A;  1A2L A;  4O5R A;  3ZIT A;  5A5H A;  5GZZ B;  5A4V A;  3RHC A;  2H70 A;  1K0M A;  1Z7P A;  2B5E A;  5HFI A;  4EL1 A;  2V41 A;  3TKP A;  4V1A p;  1VF4 A;  5GST A;  4BVY B;  2V32 A;  5A1N B;  1K3L A;  1FOH A;  4YQM A;  1T1V A;  4V2N A;  3N9J A;  3QDN A;  3ISO A;  4ML6 A;  2X49 A;  3HD5 A;  4MA9 A;  4K6X A;  1F37 A;  3DXB A;  3QMX A;  4K1F A;  4HZ4 A;  5IMD A;  4IBP A;  17GS A;  2WCI A;  1GRX A;  2WJU A;  1XFL A;  3K8N A;  4ZB8 A;  1X9M B;  4QL9 A;  2WFC A;  2FY6 A;  3DWV A;  2PVQ A;  4AKX B;  2TIR A;  1EEM A;  2OBI A;  3HY2 A;  4N11 A;  5G2Z A;  4HQZ A;  3WYW A;  3I9V 2;  2B5X A;  4V2L A;  8GSS A;  1J9B A;  4EC0 A;  1M2A A;  22GS A;  5F06 A;  2ZUP A;  6GSW A;  4WR4 A;  1K0D A;  2HZE A;  1TXX A;  1OYJ A;  1SEN A;  3KM6 A;  1GWC A;  3IC8 A;  6GST A;  2O85 A;  1SD8 A;  2O89 A;  1ZYE A;  1SU9 A;  1SVM A;  2C80 A;  2CT6 A;  4Z7X A;  1THO A;  2DSA A;  1PA3 A;  4XS4 B;  2EFC A;  2V6K A;  5IIZ A;  3TOT A;  4BVX A;  2ALB A;  4GQC A;  1BED A;  2DLX A;  2DC5 A;  1K3O A;  4TN8 A;  2HXK A;  4HDE A;  3VPQ A;  2YWO A;  2OE1 A;  1EV4 A;  4G10 A;  2XHF A;  2HSY A;  4GF0 A;  2H72 A;  2L4Q A;  2DBC A;  5D73 A;  4YAP A;  2GT5 A;  1PKW A;  5HR3 A;  3SWL A;  4CY6 A;  2L5L A;  3QFA C;  3KXO A;  4ZB9 A;  2C1Y A;  3S9F A;  2R5G A;  4WF5 A;  5FT3 A;  1TU8 A;  4V1A g;  3WGD A;  3CSH A;  4KCA A;  2WUL A;  4USS A;  3MIX A;  1VF1 A;  4OCF A;  4TRX A;  5ID2 A;  1T7P B;  2IFQ B;  2EFH A;  5LCZ A;  1IYH A;  4I2T A;  3G7I A;  2HYX A;  3P8W A;  1O81 A;  3IK9 A;  4Z2T A;  1NSW A;  1A8Y A;  3GKM A;  5GAP D;  1ILO A;  3QAV A;  3EE2 A;  1J08 A;  2VL2 C;  2G2Q A;  1WE0 A;  1OE8 A;  2IME A;  3APO A;  2IPA A;  1AQV A;  5ECS A;  1X5E A;  4KF9 A;  4TKY A;  5EPF A;  3BCK A;  3E3E A;  3ZFB A;  4KND A;  4N0Z A;  1YEP A;  4TOP A;  5ECL B;  5B6N A;  4DSS A;  5J41 A;  3BCI A;  5ECQ B;  2L6C A;  4HZ2 A;  2L5O A;  3CMI A;  2F51 A;  4HU7 A;  3QCP A;  3TJK A;  3CTF A;  2XPD A;  3BJ5 A;  1ZZY A;  1NM3 A;  4N30 A;  2IMI A;  2VCW A;  2JZS A;  4MZC A;  5G1L A;  3TKQ A;  4DSQ A;  3F3Q A;  2HI7 A;  4G0I A;  4H86 A;  4IN0 A;  3LSZ A;  2B5Y A;  3PPU A;  4AJ7 A;  4BPY A;  4CW9 A;  3R3E A;  13GS A;  2VLV A;  3ZLP A;  4CHS A;  1S3D A;  1WIK A;  1EGO A;  4TR1 B;  3CSJ A;  2C4J A;  4JZQ A;  2WGR A;  3FZ5 A;  4NWY A;  2MBS A;  4ICY A;  3LG6 A;  1SK2 A;  1K3Y A;  1OC9 A;  4MPG A;  5JWR B;  4Q5Q A;  5D8I A;  4GLT A;  2R4V A;  5AN1 A;  4JR6 A;  4O5U A;  4F82 A;  1MEK A;  2RII A;  2VIM A;  5CP1 A;  3F0I A;  5GSS A;  1MDI A;  5A4W A;  4PQH A;  5F8B A;  1YEX A;  2RUE A;  2OKA A;  3DD3 A;  3LFL A;  1WOU A;  1GSQ A;  5ECM B;  5J4U A;  5KN2 A;  2IWT A;  2QGV A;  2HSN A;  2NDO A;  1ZOF A;  4NHZ A;  2R0P A;  2C0G A;  1FO5 A;  3Q74 A;  3ZVJ D;  2GS3 A;  2HRA A;  14GS A;  1PQN A;  2B1K A;  2MZC A;  4YQU A;  1YVL A;  2AV4 A;  2C0E A;  2K6V A;  2LUS A;  5G1K A;  4D73 B;  2WS2 A;  1OC8 A;  4PGT A;  2X8G A;  3V1W A;  3HXS A;  1RK4 A;  2DJK A;  4OO4 A;  5AIX A;  2FWE A;  2N5F A;  1EP8 A;  1U6T A;  4BL7 B;  2MYG A;  1ACV A;  3J7Y b;  1GUM A;  4EUY A;  1DBY A;  1W89 A;  3F63 A;  2OAD A;  5D9W A;  5B8B A;  1M2D A;  4MF6 A;  4TW5 A;  2YNX A;  2RM5 A;  5ELA A;  1VF2 A;  3EC3 A;  1XXU A;  1TDI A;  3FKF A;  3BBY A;  2F9S A;  5AIV A;  2NBS A;  3FW2 A;  4F03 A;  2EIO A;  3HYP A;  4ZBB A;  5DAK A;  3QFB C;  4N10 A;  2VL3 A;  1GTB A;  1QGV A;  4MF5 A;  4CDO A;  2C3T A;  3Q19 A;  1R26 A;  2YAN A;  1B48 A;  4PNG A;  4JRR A;  2AUV A;  1YY7 A;  5LNK e;  2GGT A;  1AIU A;  3BD2 A;  1SK1 A;  4KH7 A;  4LLR A;  4ZL7 A;  4MK3 A;  2JZT A;  4ZL8 A;  2I4A A;  4AKG A;  2I1U A;  3W8S A;  3I6A A;  11GS A;  2NVL A;  4MNN A;  4X1U A;  2FNO A;  1OE7 A;  5J4Y A;  3G9B A;  2H1L A;  5BRT A;  2L4C A;  1AC1 A;  1R5A A;  3PH9 A;  4L5O A;  1S3A A;  2QSI A;  4K7O A;  2GSQ A;  4IS0 A;  3PGT A;  2E2M A;  4ML1 A;  2H74 A;  1SVO A;  5ELG A;  1TJD A;  4K2X A;  5CRE A;  2GVP A;  5IQY A;  3CYN A;  4CY8 A;  2WB9 A;  5A34 A;  5J4V A;  4XRA A;  2C8U A;  2H0I A;  1RQM A;  4WBJ A;  1XOA A;  4HU9 A;  2JAC A;  2LNS A;  2J9H A;  1UA5 A;  5ECR B;  3LYP A;  5J40 A;  2P0G A;  1GL8 A;  5LD0 A;  3EYT A;  1B9X C;  4XTS A;  4AJ8 A;  4RQR A;  5IOX A;  3LW9 A;  2LQO A;  1YF0 A;  3NZN A;  2FLS A;  1GSF A;  1I9D A;  3IDV A;  2CX4 A;  5KN0 A;  3MAK A;  4OMV A;  2TRX A;  3DIE A;  3HJP A;  1TRW A;  3VWV A;  2IMK A;  6GSU A;  4PTS A;  2FCH A;  4DEJ A;  2FWF A;  2OE0 A;  3IRA A;  2HT9 A;  4IHU A;  4NPB A;  3HCZ A;  2M72 A;  3GYK A;  4HI7 A;  1TP9 A;  2H1D A;  3QPM A;  3F4T A;  5KN1 A;  1SYX A;  3HVS A;  4F9Z A;  5CAX A;  3QAG A;  1V57 A;  3DVW A;  4KAE A;  1TRU A;  2TRC P;  1WWJ A;  1FG4 A;  1JZR A;  5G5E A;  3CXG A;  1WMJ A;  3FHK A;  2AJQ B;  2CVB A;  2FUG 2;  3LXZ A;  2WZ9 A;  3KGK A;  3C71 A;  3I69 A;  2DJ1 A;  1DUG A;  4OFM A;  1GTI A;  1O73 A;  4G0K A;  3TB2 A;  1V58 A;  2DMM A;  4W66 A;  5BMU B;  1AXD A;  1Z7R A;  5ECI B;  3UAP A;  3TRP A;  2K9F A;  1KEB A;  3TRQ A;  3VWW A;  3L9S A;  1E6B A;  4KDU A;  4FO5 A;  3A2V A;  5J47 A;  1V2A A;  3GH6 A;  4LA1 A;  3GTU A;  1V9W A;  3UEM A;  1GUK A;  2DJ0 A;  2IJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...