4YH2A

Glutathione transferase e6 from drosophila melanogaster
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
221
structure length
221
Chain Sequence
VKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTNFTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S transferase E6
publication title Epsilon glutathione transferases possess a unique class-conserved subunit interface motif that directly interacts with glutathione in the active site
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 83
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yh2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yh2A01
4MF5A 1F2EA 4FYBA 5HFKA 1DBYA 1F37A 3G7IA 4PQIA 2VCTA 5A5KA 2E2GA 4HEA2 1EV4A 3KMNA 1ZCPA 1ZZYA 2Z9SA 4G9HA 3I43A 5DCGA 2VL2A 4I2UA 4PNFA 2YWNA 1PGTA 4USSA 2YN1A 4DSSB 1XPVA 4PXOA 4HZ4A 4AF2A 2YCDA 2IFQA 4GF0A 5J9BA 4ECIA 4YAPA 3JCML 2YP6A 4KDXA 3VWWA 1DUGA 3GKNA 2JL4A 1Z6MA 2B5YA 3I69A 3ZITA 3ZL5A 1S3CA 1GSFA 4WETA 1HD2A 1NHYA 3RHCA 1C72A 2HE3A 4ECCA 4D73B 3TJFA 1TRVA 4MLYA 1XFLA 6GSUA 3GN3A 2FWFA 2ALBA 3UVHA 2O89A 2J9HA 4BWSA 1GULA 1GH2A 1A24A 4IQ1A 3VWUA 2IFQB 3EU4A 2HLSA 4GWRA 5ECHB 1GTBA 4DSRA 2OE0A 4TR1A 2IMKA 4ZL9A 2B7KA 5HFIA 2X8HA 1X5EA 3BBYA 1A8LA 1K0NA 1PQNA 3C1RA 4RQXA 3F63A 2V6OA 2RM6A 3GA4A 4POKA 4IKHA 1GSUA 1X5DA 1YF0A 4XS4A 2I3YA 4FO5A 4IJ3A 1M99A 3IA1A 2KOKA 3ZMKA 3DXBA 2X64A 3KXOA 6GSYA 2FCHA 2NBSA 3GH6A 4ZL8A 3M8NA 1XOBA 1WIKA 3TKQA 2JACA 3KEBA 3R3EA 7GSSA 5COHA 2WDUA 3RHBA 4TR1B 2D2ZA 3DMLA 3WGEA 1EEMA 3M1GA 3VI5A 4PUAA 1TRUA 1IYHA 3TRPA 5IOWA 1T4ZA 1M2BA 3CBUA 3GKKA 3CSHA 1M7TA 2O87A 2OA7A 3C73A 4XS4B 2VCVA 1G7OA 2HSYA 2B1KA 2WCIA 1Y6EA 3W6GA 1GSYA 1MDIA 1SK2A 5H5SA 4CW9A 2RLIA 4MZCA 4PX1A 1K0BA 2R3XA 1T1VA 2C8UA 3ME8A 4K2DA 3EWLA 3CTGA 1XZOA 5DQYA 3GRXA 4AJ7A 2HRKA 3ZFBA 1G0TA 2VLVA 4WXTA 1E2YA 5GAND 1B8XA 3P90A 1BX9A 4EF0A 3APQA 2PMTA 2XPEA 1YQ1A 13GSA 3IBHA 1A2MA 3DYRA 4ECBA 1EEJA 4G10A 1T00A 4K0GA 2JZTA 1W89A 1RQMA 3O6TA 1TU8A 3M9JA 5AGYA 1T7PB 1BAYA 4V2NA 2VL9A 2GZPA 3PINA 2DSAA 1AW9A 4MDCA 5DJMA 2HSHA 3QCPA 2GZZA 4OO4A 3CRTA 3QPMA 1JFUA 1EGRA 1XWKA 4DSQA 4XIHA 5G2ZA 4KUNA 1EOGA 2HRKB 4NHWA 5J5NA 2FWGA 2LNSA 1BYEA 5ABRA 2DJKA 4MJCA 1U3AA 4HUAA 1SD8A 2I81A 3WT1A 4FQUA 2AV4A 5DCHA 2LJRA 4IP1A 2RIIA 2L59A 3H93A 4TRXA 1XCCA 2ON7A 2GVPA 2F9SA 3HJMA 3F4RA 2E2MA 2LRTA 1XWCA 1GUKA 4ML6A 4KNDA 2XBQA 4EUYA 3H79A 4MP4A 5DBQA 1XVWA 2FA8A 1UA5A 4X1UA 3QFAC 1UC7A 6GSVA 4GSSA 1GUMA 4GRFA 1WWJA 2MMOA 2PPTA 3GV1A 2H0HA 2WGRA 3EYTA 4IVFA 3ERWA 2DJJA 3C71A 2K8SA 3UAPA 3IOSA 1HNBA 5J41A 3O76A 5B7CA 1F6MC 5KN1A 1O8XA 2CZ2A 1PN9A 1O81A 3KTBA 2F8FA 3TKSC 5CAXA 3P7XA 5HR1A 3TJBA 3F3QA 5IOXA 1EWXA 2OBKA 3MWHA 3IC4A 4ZB9A 4IP6A 2FLSA 3AY8A 1Y25A 1XVQA 4JU5A 4XTSA 2AAWA 3F8UA 3HKRA 2J23A 1OC9A 2CT6A 4LL4B 2V41A 2OE3A 1S3DA 4P3YB 4WF4A 1FHEA 4GSNA 3LQ7A 3F4TA 2O7KA 4Z7XA 2HZEA 1SJ6A 2R4VA 3OR5A 2OE1A 2VM2A 1A23A 1J9BA 2PU9C 1XWAA 3S9FA 5AIVA 3G9BA 4MJEA 5FT3A 1M2AA 2VAFA 2H66A 5IMFA 3ZYWA 5A4UA 2IJYA 4F82A 1VF2A 4PGTA 5ECRB 4HU9A 4POBA 1V2AA 3D5JA 1LBKA 2C3QA 1AQWA 3C1SA 2YPMA 1AUCA 2DIZA 1OC9B 2VCZA 2PGTA 2LQQA 5KN3A 2H19A 2MBTA 1GSDA 3SWLA 4YQVA 3GKXA 1FAAA 1XBSA 2LRNA 1KBNA 2R6KA 22GSA 2C3NA 4OD7A 3QAVA 2L6CA 4BPYA 5AIXA 2H30A 4V2LA 4PTSA 4TVEA 5CNWA 2EC4A 2UZ8A 3PH9A 4PNGA 1AXDA 4GLTA 3FZ4A 3HZ4A 4J56E 3TJGA 1LJRA 1MEKA 5ECKB 3U5RE 1YDKA 4E8HA 3F6DA 5AN1A 1MTCA 3CXGA 2H72A 3D0ZA 2HNLA 1SKRB 5HQPA 1PKWA 2LRCA 3UIWA 1THOA 2IMFA 2YOIA 4TOPA 4OMVA 6GSWA 4O32A 2M72A 4I97A 1TXXA 4MABA 1SK1A 1DSBA 1K3OA 2CVKA 3DVXA 1XW9A 4Q5FA 3GNJA 2G0FA 4OFNA 2CA8A 20GSA 5DQSA 2GQMA 1M0UA 4ZB6A 2HZFA 4X43A 3ZLPA 5F06A 2I4AA 2CX4A 2YWOA 1PL2A 2QSIA 5DAKB 5GSSA 1JZDA 3QD9A 5IM9A 4ECJA 5B6NA 1T3BA 2OADA 3TB2A 2JADA 3GUSA 1FO5A 1Q98A 3HCZA 1E6BA 3ISOA 1NHOA 1GSQA 2HRAA 1PMTA 2NTOA 2A4VA 5EL8A 1R26A 5D8IA 4GQCA 2A2RA 4BVXA 3V1WA 3EMXA 2VL2C 1XWBA 4XCSA 1YKCA 3FR6A 3VPQA 1MD3A 2JU5A 2LUSA 4XRAA 3K8NA 3N5OA 2VCWA 3GSTA 1HNAA 4RI7A 2FHEA 1SYXA 3A2XA 2VD0A 3IDVA 3TOUA 4HU7A 3FY7A 1PX7A 1TTZA 2GTUA 4LMVA 2YZHA 3QDNA 1T4YA 5CP1A 17GSA 5JWRB 1HYUA 2H74A 1V9WA 3BJ5A 5JCGA 1R7HA 2H73A 1TRSA 4KAEA 2IMDA 1JLVA 3FZ5A 1XWGA 2H6XA 5F8BA 2WRTA 4BVXB 1TRWA 1SKSB 1QMVA 1HQOA 3PPUA 2FD3A 4IN0A 1G6YA 4ZL7A 1ZMAA 3L0HA 4AGSA 2TIRA 3APOA 1LU4A 1T8EB 3A5WA 3LEFA 4MZBA 2FY6A 1YY7A 5B8AA 1S3AA 1FVJA 5DALA 4K7OA 4ACSA 2YZUA 2VUPA 4ZBDA 4XS1A 4IS0A 2HSMA 4EDYA 3L78A 2L57A 5DVBA 2CQ9A 4JBBA 1QK8A 4LMWA 1JHBA 3VPTA 4MK3A 2V6KA 1MD4A 4WBRD 3L4NA 4G0KA 3A3TA 3IK9A 3ZVJA 4HOJA 1ZOFA 5LNKe 4BA7A 1KTEA 4L5LA 1N2AA 1PD21 1U3IA 2FGXA 1GTUA 4O7HA 1SU9A 3ME7A 2MZCA 3KJYA 2XHFA 3RPNA 1ST9A 5DALB 2HSMB 4N0ZA 6GSTA 1Z7RA 3EINA 4IW9A 1ACVA 3KH9A 2JZRA 4KSMA 1OYJA 10GSA 1ABAA 1YJ6A 3TDGA 2ES7A 2GT6A 4MF7A 2F3MA 5KEJA 2I9HA 5KN0A 4G19A 2RUEA 4NV2A 4IGJA 2DMMA 3CMIA 3DRNA 4ILFA 3GX8A 5G5FA 2GQLA 2GZYA 5LD0A 3A2WA 3FRCA 3H4KA 4YQMA 3HD5A 5ECLB 1EOHA 3KZQA 1YKAA 5IPHA 3KTLA 2R5GA 2YV9A 5JWOB 4K6XA 1NW2A 2P5QA 4WEYA 2HYXA 4KA0A 5IIZA 1F9MA 1I5GA 3IAS2 1TDIA 4JE1A 1GTAA 5LCZA 4HDEA 2FNOA 2L4CA 1PX6A 3DWVA 2DC5A 4GXZA 4G2EA 1OE8A 4KCEA 3W8SA 1AIUA 3Q6OA 4POMA 1U6TA 1A0FA 2GGTA 3F6FA 1X0RA 2DJ1A 1XIYA 2WJUA 3VWVA 2XC2A 5IPGA 2I1UA 2H75A 1AQVA 3M0FA 2DJ3A 2AHEA 3N9JA 3UJ1A 2GT5A 4ID0A 3VLNA 3NOFA 1SL1B 4YAVA 1GLPA 2C0GA 3HJPA 4EO3A 2LQOA 1TK8B 2NPBA 2B5EA 1GP1A 2VL3A 3KP8A 1UVZA 8GSSA 1NSWA 4QL9A 1ZYEA 2YJ7A 5J4UA 2MMAA 4KCAA 3R2QA 2PUKC 2M46A 3ED3A 1SD9A 3TKPA 4K8MA 1Z6NA 3ZVJD 3HY2A 3E0UA 3ZMLA 3MSZA 3WYWA 3HVSA 1EP7A 3LXTA 3FW2A 1OKDA 4OFTA 3LG6A 2CZ3A 2LS5A 4EE0A 4TXOA 3GL3A 5D9TA 1GRXA 2YWMA 4ZILA 2L4QA 4I6XA 5CRWA 4ZB8A 2X8CA 4BL7A 4H86A 2LV3A 1ZYQB 3GTUA 4NPBA 4Q5NA 4MPGA 1XXUA 3IV4A 4MMMA 4GQFA 5CREA 2VLUA 1R5AA 2BTOT 3TKRA 5ECSA 2IL3A 3FYGA 1AQXA 1YEPA 2KHPA 3TKSA 3L9SA 5G1KA 1PA3A 4WR4A 3ERGA 1XW5A 4V2MA 1TKDB 3DKSA 2C80A 2JZSA 2IPAA 4TXOB 5KN2A 2AYTA 1FOVA 1X9SB 2IIYA 3H1NA 4F0CA 4BL7B 4K7NA 6GSXA 2OKAA 5G30A 2LSTA 3VI7A 5H5QA 3GX0A 4FIWA 3LORA 4WF5A 3D6IA 4ZXGA 4L5OA 3FK8A 4KSOA 4N30A 4K9ZA 2VD1A 2X99A 1V58A 3F3RA 5L71A 2VO4A 12GSA 3I6AA 2QC7A 3HXSA 1DE2A 2R37A 3DEXA 2WZ9A 2NVLA 3DVWA 4KGIA 1O73A 1VGLA 1PL1A 1B4QA 2FWHA 2H8LA 3EURA 3E3EA 1EZKA 3ZFLA 3Q74A 1M2DA 2VCQA 1B9YC 1ZGNA 2HZEB 4HQZA 3UBKA 2H1GA 1GNEA 1WP0A 4TXVA 4ZBBA 1JZOA 1F3BA 4EL1A 3TOTA 1H75A 5CRHA 5ENUA 2H0GA 1O85A 2P31A 2CVDA 2DJ0A 3IXRA 2H71A 4G0LA 2N5AA 1FW1A 2HRNA 4LA1A 3UOMA 4RUVA 2C1YA 1Z3EA 1FB0A 1GL8A 5A4VA 4ULXA 14GSA 3UL3A 2C0EA 4FH8A 1NM3A 3CSIA 2DIYA 5D9WA 2WFCA 2OACA 2E7PA 1K3YA 2HT9A 1GSSA 1SENA 3W8JA 1IYIA 2KP2A 4IHUA 3LFLA 3KGKA 2DMLA 1G7EA 4ML1A 1YZXA 3TJKA 5F07A 5ECIB 5HR3A 4HJMA 4GSTA 2WB9A 4WR5A 5GZZB 2PWJA 5IMVA 1A2LA 2LKUA 4NWYA 1OKTA 3SBCA 4KB3A 2C0DA 4V1Ag 3Q18A 2HQTA 2KLXA 2VOCA 3APSA 4JR4A 3D22A 3HDCA 1TI1A 4WKWA 19GSA 2LEGA 2A2SA 3J7Yk 1ERWA 2N5FA 3IE3A 5BMUA 3TKSE 1HNCA 3MDKA 2YNXA 4TN8A 3LSZA 3ZIJA 3EMPA 5B6MA 4AJ6A 4MF6A 1GWCA 2FUG2 2KP1A 3TUEA 4NAXA 2C0FA 3Q19A 1SL2B 2PBJA 4DSSA 2RUFA 3L9UA 3PGTA 4EXJA 2TRXA 1DE1A 3EC3A 2E0QA 4TW5A 5J3RA 4QQ7A 1GSEA 3BCKA 2ZCTA 3HYPA 1PSQA 1MDJA 2CV4A 4MCUA 5JWQB 1M9BA 2BMXA 3FHKA 1Z7PA 2H6ZA 1RK4A 4JRRA 4D73A 3MNGA 1O7UA 1BEDA 3TGZA 4I8BA 1B4PA 1OC8A 4DVCA 3FZAA 3WGDA 1TU7A 1QUWA 4X0XA 2AUVA 1U87A 3LJRA 5HFGA 4MA9A 3WT2A 3LYPA 1OAZA 3D4TA 4AJ8A 3F0IA 1A8YA 5ECOB 4MJBA 2ON5A 2CAQA 2V1MA 5ELAA 3H8QA 3G7JA 1V98A 5DDLA 2GSSA 3UEMA 1Z5YE 2V2GA 2PERA 2N5BA 3G7YA 4PQHA 1A2JA 3KD0A 5FWGA 3U6VA 2AJQB 3M9KA 5C00A 4FYCA 5C04A 3VWXA 2P5RA 3BOAA 18GSA 4NMUA 2GLRA 2B6MA 3HJOA 1URMA 1X9WB 2B5XA 1CQHA 1JZWA 2IMEA 1WPIA 2MMNA 5F05A 2V32A 5G1LA 4F9ZA 3IHQA 1WRYA 4KX4A 1TI3A 3D21A 11GSA 1F3AA 2F51A 1Z9HA 1SYRA 5J9CA 3ZRDA 4MJAA 2KUCA 16GSA 1K3LA 4GCIA 2YJHA 1XOAA 1EP8A 4K1FA 3HHVA 3KP9A 3VK9A 3LYKA 2LJKA 3EE2A 1SJIA 3A2VA 5F0GA 4OFMA 1R5PA 1JLWA 5IO2A 1ERTA 3MAKA 1TW9A 2VLTA 2WULA 3GMFA 5A4WA 4Q5RA 3GSSA 1QFNA 5EPFA 3IRAA 4KF9A 4TR4A 5D96A 1R4WA 2FWEA 1QXHA 4HZ2A 4TKYA 3WD6A 1G6WA 4JR6A 1TJDA 2M80A 4TR0A 4IQAA 1EGOA 4FYUA 4NV5A 3FEUA 3HA9A 5GSTA 3KM6A 5IMDA 2L5LA 2L5OA 3ZTLA 2EIOA 3KMOA 4F2IA 5D9XA 4F03A 5E4WA 2B1LA 3RAZA 2H1BA 1VF3A 4GTUA 5G5EA 2L6DA 2JSZA 4QL7A 4MH2A 1BJXA 1ON4A 4IJIA 1EV9A 1RW1A 4HQSA 4KDYA 3FKFA 4O5RA 5CO3A 2MYGA 4G0IA 4I5QA 2HFDA 1SKWB 1KNGA 4LL1B 1VF1A 6GSSA 2LJAA 4KW6A 5G31A 2IWTA 5D73A 1PRXA 3LWAA 2HXKA 1GTIA 2MBSA 3NIVA 2H1AA 5EY6A 2QKEA 2WS2A 1GNWA 2REMA 3IPZA 4L0UA 1VF4A 4RI6A 3ERFA 9GSSA 3L9VA 2C4JA 3GH9A 4PURA 1K0DA 4JZQA 5INYA 2K9FA 2AB6A 1K0OA 3ZZXA 4PQ1A 1ML6A 3LXZA 2H70A 1A0RP 2H0IA 1ERVA 2HSNB 4JEDA 5CRGA 4ZBAA 1B48A 4LLRA 4CDOA 5IQYA 4HJ2A 3BD2A 1U88A 3VFIA 4XRDA 1PKZA 4PUFC 5D9VA 1FB6A 4MZWA 2VM1A 4EKZA 1JZRA 4OO5A 1V40A 4I2TA 4BVYA 3P2AA 3RPPA 4EDZA 5ECMB 3IAM2 4K7IA 2XPDA 1N8JA 3BCIA 5ECQB 3QMXA 2B3SA 5HR2A 3CSJA 1VRSD 3RDWA 3UARA 4J57E 3IR4A 2HRFA 2DLXA 3HVXA 1B9XC 4XHMA 2YWIA 4YH2A 3DGQA 3D4MA 2GQKA 2MMZA 5IMCA 2G2QA 1OE7A 1FG4A 3ZIVA 4J2FA 5AISA 1BG5A 5JCWA 5DJLA 3E9JB 2H01A 4BVYB 2H76A 1WJKA 5H5RA 4KE3A 2O85A 1ILOA 1AAZA 1J08A 2K18A 4HI7A 3EVIA 4L8EA 4WBJA 2LTKA 5B8BA 3QR6A 3O3TA 4MH3A 2YV7A 3GTUB 5D93A 1CQGA 4MPFA 3GFKA 2VCXA 2H6YA 3HZ8A 1GLQA 4IBPA 3UMAA 4ZIJA 4O92A 2RM5A 2XBIA 2P0GA 3P8WA 3DIEA 2GS3A 1K0CA 3PR8A 3DD3A 3HVVA 4EC0A 4IELA 1SJZA 2QGVA 2IN3A 5E59A 2TRCP 1OVNA 2YANA 3M3MA 3IC8A 1TP9A 2EIQA 3GYKA 1MDKA 2PN8A 4K0NA 1QGVA 1ERUA 4BWQA 3EU3A 3VURA 1YF1A 1O8WA 1X5CA 1M9AA 4ISDA 1SK0A 3ZREA 5ECPB 4HS1A 1GUHA 3TCOA 3FR3A 3KCMA 1UN2A 5ELGA 1YEXA 5EVOA 2JSYA 3C8EA 4EVMA 3GKMA 3GL5A 1W4VA 2BJXA 1J0FA 2R2JA 1THXA 1WOUA 2EIRA 5JCUA 4POLA 5ID2A 4N0VA 1SL0B 1K0AA 1X9MB 1I9DA 1XW6A 2C3TA 2HI7A 3GURA 5IO0A 4RQRA 1TK0B 3C7MA 2LNTA 3QFBC 2K8VA 1BQ7A 4NXIA 2IMIA 2X8GA 4KH7A 1ZL9A 3CYNA 4KDUA 3CTFA 3KIJA 4L0WA 5ECNB 4OCFA 3QOUA 3KH7A 1USBA 3QAGA 3RBTA 2PVQA 5HR0A 3CRUA 3IK7A 5IMZA 1WE0A 4OCEA 3NZNA 2GDRA 4CHSA 3LGCA 2OJLA 4XS6A 1TOFA 2ZNMA 3J7Yb 3F4SA 5CRDA 3UBLA 1QQ2A 4OWYA 4N10A 5ID2B 3I9V2 3TJJA 1H4OA 2CAIA 4Q5QA 1V57A 2NDOA 2DBCA 4N11A 3UVTA 2FA4A 5DAKA 2CX3A 2H1DA 3US3A 1WMJA 3FR9A 3TRXA 1K0MA 2VIMA 3TRQA 3F9UA 2F8AA 4YQUA 4F0BA 2GSTA 1Q4JA 1TK5B 4TR3A 3GHAA 2OBIA 2GSQA 4E8EA 2PVOC 2ZUPA 2B7JA 2CVBA 4V1Ap 5FHIA 2GSRA 1FVKA 5GAPD 3QAWA 5IMAA 1AC1A 1O6JA 2O8VB 5CYYA 2DJ2A 4NHZA 4DEJA 1OC3A 3GIXA 2K6VA 3WGXA 1KEBA 3FZ9A
chains in the Genus database with same CATH superfamily
4MF5A 1F2EA 4CY6A 4FYBA 5HFKA 1DBYA 1F37A 3G7IA 4PQIA 2VCTA 5A5KA 2E2GA 4HEA2 1EV4A 5A5HA 3KMNA 1ZCPA 1ZZYA 2Z9SA 4G9HA 1M3JA 3I43A 5DCGA 2VL2A 4I2UA 4PNFA 2YWNA 1PGTA 4USSA 2YN1A 4DSSB 1XPVA 4PXOA 4HZ4A 4AF2A 2YCDA 2IFQA 4GF0A 5J9BA 4ECIA 4YAPA 3JCML 2YP6A 4KDXA 3VWWA 1DUGA 3GKNA 2JL4A 1Z6MA 2B5YA 3I69A 3ZITA 3ZL5A 1S3CA 1GSFA 4WETA 1HD2A 1NHYA 3RHCA 1C72A 2HE3A 4ECCA 4D73B 3TJFA 1TRVA 4MLYA 1XFLA 6GSUA 5A5HB 3GN3A 2FWFA 2ALBA 3UVHA 2O89A 2J9HA 4BWSA 1GULA 1GH2A 1A24A 4IQ1A 3VWUA 2IFQB 3EU4A 2HLSA 4GWRA 5ECHB 4N3ZA 1GTBA 4DSRA 2OE0A 4TR1A 2IMKA 3MYDA 4ZL9A 2B7KA 5HFIA 2X8HA 1X5EA 3BBYA 1A8LA 1K0NA 1PQNA 3C1RA 4RQXA 3F63A 2V6OA 2RM6A 3GA4A 4POKA 4IKHA 1GSUA 1X5DA 1YF0A 4XS4A 2I3YA 4FO5A 4IJ3A 1M99A 3IA1A 2KOKA 4K5RA 3ZMKA 2R0GA 3DXBA 2X64A 3KXOA 6GSYA 2FCHA 2NBSA 3GH6A 4ZL8A 3M8NA 1XOBA 1WIKA 3TKQA 2JACA 3KEBA 3R3EA 7GSSA 2DKHA 2WDUA 5COHA 4AI6A 3RHBA 4TR1B 2D2ZA 3DMLA 3WGEA 1EEMA 3M1GA 3VI5A 4PUAA 1TRUA 1IYHA 3TRPA 5IOWA 1T4ZA 1M2BA 3CBUA 3GKKA 3CSHA 1M7TA 2O87A 2OA7A 3C73A 4XS4B 2VCVA 1G7OA 2HSYA 2B1KA 2WCIA 1Y6EA 3W6GA 1GSYA 1MDIA 1SK2A 5H5SA 4CW9A 2RLIA 3MIXA 4MZCA 4PX1A 1PN0A 1K0BA 2R3XA 1T1VA 2C8UA 3ME8A 4K2DA 3EWLA 3CTGA 1XZOA 5DQYA 3GRXA 4AJ7A 2HRKA 3ZFBA 1G0TA 2VLVA 4WXTA 1E2YA 5GAND 1B8XA 3P90A 1BX9A 4EF0A 3APQA 2PMTA 2XPEA 1YQ1A 13GSA 3IBHA 1A2MA 3DYRA 4ECBA 1EEJA 4G10A 1T00A 4K0GA 2JZTA 1W89A 1RQMA 3O6TA 1TU8A 3M9JA 5AGYA 1T7PB 1BAYA 4V2NA 2VL9A 2GZPA 3PINA 2DSAA 1AW9A 4MDCA 5DJMA 2HSHA 3QCPA 2GZZA 4OO4A 3CRTA 3QPMA 1JFUA 1EGRA 1XWKA 4DSQA 4XIHA 5G2ZA 4KUNA 1EOGA 2HRKB 4NHWA 5J5NA 2FWGA 2LNSA 1BYEA 5ABRA 2DJKA 4MJCA 1U3AA 4HUAA 1SD8A 2I81A 3WT1A 4FQUA 2AV4A 5DCHA 2LJRA 4IP1A 2RIIA 2L59A 3H93A 4TRXA 2EFCA 1XCCA 2ON7A 2GVPA 2F9SA 3HJMA 3F4RA 2E2MA 2LRTA 1XWCA 1GUKA 4ML6A 4KNDA 2XBQA 4EUYA 3H79A 4ICYA 4MP4A 5DBQA 1XVWA 2FA8A 1UA5A 4HSCX 4X1UA 3QFAC 1UC7A 4AKXB 6GSVA 4GSSA 1GUMA 4GRFA 1WWJA 2MMOA 2PPTA 3GV1A 2H0HA 2WGRA 3EYTA 4IVFA 3ERWA 2DJJA 3C71A 2K8SA 4Z2TA 3UAPA 3IOSA 4Z2UA 1HNBA 5J41A 3O76A 5B7CA 1F6MC 5KN1A 2A4HA 1O8XA 2EFEA 2CZ2A 1PN9A 1O81A 3KTBA 2F8FA 3TKSC 5CAXA 3P7XA 5HR1A 3TJBA 3F3QA 5IOXA 1EWXA 2OBKA 3MWHA 3IC4A 4ZB9A 4IP6A 2FLSA 3AY8A 1Y25A 1XVQA 4JU5A 4XTSA 2AAWA 3F8UA 3HKRA 2J23A 1OC9A 2CT6A 4LL4B 2V41A 2OE3A 1S3DA 4P3YB 4WF4A 1FHEA 4GSNA 3LQ7A 3F4TA 2O7KA 4Z7XA 2HZEA 1SJ6A 2R4VA 3OR5A 2OE1A 2VM2A 1A23A 1J9BA 2PU9C 1S4BP 1XWAA 3S9FA 5AIVA 3G9BA 4MJEA 5FT3A 1M2AA 2VAFA 2H66A 5J47A 5IMFA 3ZYWA 5A4UA 2IJYA 4F82A 1VF2A 4PGTA 5ECRB 4HU9A 4POBA 1V2AA 3D5JA 2WW0A 1LBKA 2C3QA 1AQWA 3C1SA 2YPMA 4FXYP 1AUCA 2DIZA 1OC9B 2VCZA 2PGTA 2LQQA 5KN3A 2H19A 2MBTA 1GSDA 3SWLA 4YQVA 3CWGA 3GKXA 1FAAA 1XBSA 2LRNA 1KBNA 2R6KA 22GSA 2C3NA 4OD7A 3QAVA 2L6CA 4BPYA 5AIXA 2H30A 4V2LA 4PTSA 4TVEA 1I1IP 5CNWA 2EC4A 2UZ8A 4AKIA 3PH9A 4PNGA 1AXDA 4GLTA 3FZ4A 3HZ4A 4J56E 3TJGA 1LJRA 1MEKA 5ECKB 3U5RE 1YDKA 4E8HA 3F6DA 5AN1A 1M3IA 1MTCA 3CXGA 2H72A 3D0ZA 2HNLA 1SKRB 5HQPA 1PKWA 2LRCA 3UIWA 1THOA 2IMFA 2YOIA 4TOPA 4OMVA 6GSWA 4O32A 2M72A 4I97A 1TXXA 4MABA 1SK1A 1DSBA 1K3OA 2CVKA 3DVXA 1XW9A 4Q5FA 3GNJA 2G0FA 4OFNA 2CA8A 20GSA 5DQSA 2GQMA 1M0UA 4ZB6A 2HZFA 4X43A 3ZLPA 5F06A 2I4AA 2CX4A 2YWOA 1PL2A 2QSIA 5DAKB 5GSSA 1JZDA 3QD9A 5IM9A 4ECJA 5B6NA 1T3BA 2OADA 3TB2A 4BIKA 2JADA 3GUSA 1FO5A 1Q98A 3HCZA 1E6BA 3ISOA 1NHOA 1GSQA 2HRAA 4K2XA 1PMTA 2NTOA 2A4VA 5EL8A 1R26A 5D8IA 4GQCA 2A2RA 4BVXA 3V1WA 3EMXA 2VL2C 1XWBA 4XCSA 1YKCA 1XG8A 3FR6A 3VPQA 1MD3A 2JU5A 2LUSA 4XRAA 3K8NA 3N5OA 2VCWA 3GSTA 1HNAA 4RI7A 2FHEA 1SYXA 3A2XA 2VD0A 3IDVA 3TOUA 4HU7A 3FY7A 1PX7A 1TTZA 2GTUA 4LMVA 2YZHA 3QDNA 1T4YA 5CP1A 17GSA 1Y1UA 5JWRB 1HYUA 2H74A 1V9WA 3BJ5A 5JCGA 1R7HA 2H73A 1TRSA 4KAEA 2IMDA 1JLVA 3FZ5A 1XWGA 2H6XA 5F8BA 2WRTA 4BVXB 1TRWA 2UV8G 1QMVA 1HQOA 1SKSB 1BF5A 3PPUA 2FD3A 4IN0A 1G6YA 4ZL7A 1ZMAA 3L0HA 4AGSA 3RGBC 2TIRA 3APOA 1LU4A 1T8EB 3A5WA 3LEFA 5J4VA 4MZBA 2FY6A 1YY7A 5B8AA 1S3AA 1FVJA 5DALA 4K7OA 4ACSA 1PFOA 2YZUA 2VUPA 4ZBDA 4XS1A 4IS0A 2HSMA 4EDYA 3L78A 2L57A 4Z2RA 5DVBA 2CQ9A 4JBBA 1QK8A 4LMWA 1JHBA 3VPTA 4MK3A 2V6KA 1MD4A 4WBRD 3L4NA 4G0KA 3A3TA 3IK9A 3ZVJA 4HOJA 1ZOFA 5LNKe 4BA7A 1KTEA 4L5LA 1N2AA 1PD21 1U3IA 2FGXA 1GTUA 4O7HA 1SU9A 3ME7A 2MZCA 3KJYA 2XHFA 1S3RA 3RPNA 1ST9A 5DALB 2HSMB 4N0ZA 6GSTA 1Z7RA 3EINA 4IW9A 1ACVA 2H1LA 3KH9A 2JZRA 3FMWA 4KSMA 1OYJA 10GSA 1ABAA 1YJ6A 3TDGA 4PHZC 2ES7A 2GT6A 1YVLA 4MF7A 2F3MA 5KEJA 2I9HA 5KN0A 4G19A 2RUEA 4NV2A 4IGJA 2DMMA 3CMIA 3DRNA 4ILFA 3GX8A 5G5FA 2GQLA 2GZYA 5LD0A 3A2WA 3FRCA 3H4KA 4YQMA 3HD5A 5ECLB 1EOHA 3KZQA 1YKAA 5IPHA 3KTLA 2R5GA 2YV9A 4X4JA 4EIPA 5JWOB 4K6XA 1NW2A 2P5QA 4WEYA 4E68A 2HYXA 4KA0A 5IIZA 1F9MA 1I5GA 1N25A 3IAS2 1TDIA 4JE1A 1GTAA 5LCZA 4HDEA 2FNOA 2L4CA 1PX6A 3DWVA 2DC5A 4GXZA 4G2EA 1OE8A 4KCEA 3W8SA 1AIUA 3Q6OA 4POMA 1U6TA 1A0FA 2GGTA 3F6FA 1X0RA 2DJ1A 1XIYA 2WJUA 2R0CA 3VWVA 2XC2A 5IPGA 2I1UA 2H75A 1AQVA 3M0FA 2DJ3A 2AHEA 3N9JA 3UJ1A 2GT5A 4ID0A 3VLNA 3NOFA 1SL1B 4YAVA 1GLPA 2C0GA 3HJPA 4EO3A 2LQOA 1TK8B 2NPBA 2B5EA 1GP1A 2VL3A 3KP8A 1UVZA 8GSSA 1NSWA 4QL9A 1ZYEA 2YJ7A 5J4UA 2MMAA 4KCAA 3R2QA 2PUKC 2M46A 3ED3A 1SD9A 5A34A 4K8MA 1Z6NA 3TKPA 3ZVJD 3HY2A 3E0UA 3ZMLA 3MSZA 3WYWA 3HVSA 1EP7A 3LXTA 2X49A 3FW2A 1OKDA 4OFTA 3LG6A 2CZ3A 2LS5A 4EE0A 4TXOA 3GL3A 5D9TA 1GRXA 2YWMA 3CHXC 4ZILA 2L4QA 4I6XA 5CRWA 4ZB8A 2X8CA 4BL7A 4H86A 2LV3A 1ZYQB 3GTUA 4NPBA 4Q5NA 4MPGA 1XXUA 3IV4A 4GDFA 4MMMA 3LW9A 4GQFA 5CREA 2VLUA 1R5AA 2BTOT 3TKRA 5ECSA 2IL3A 2WVXA 3FYGA 1AQXA 1YEPA 2KHPA 3TKSA 3L9SA 5G1KA 1PA3A 4WR4A 3ERGA 1XW5A 4V2MA 1TKDB 3DKSA 2C80A 2JZSA 2IPAA 2O5VA 4TXOB 5KN2A 2AYTA 1FOVA 1X9SB 2IIYA 3H1NA 4F0CA 4BL7B 4K7NA 6GSXA 2OKAA 5G30A 2LSTA 3VI7A 5H5QA 3GX0A 4FIWA 3LORA 4WF5A 3D6IA 4ZXGA 4L5OA 5BRTA 3FK8A 4KSOA 4N30A 2VKZG 4K9ZA 2VD1A 2X99A 1V58A 3F3RA 5L71A 2WVXB 2VO4A 12GSA 3I6AA 2QC7A 3HXSA 1DE2A 2R37A 3DEXA 2WZ9A 4AKGA 2NVLA 3DVWA 4KGIA 1O73A 1VGLA 1PL1A 1B4QA 4ZB7A 2FWHA 2H8LA 3EURA 3E3EA 1EZKA 3ZFLA 3Q74A 1M2DA 2WW1A 2VCQA 1B9YC 1ZGNA 2DKIA 2HZEB 4HQZA 3UBKA 2H1GA 1GNEA 1WP0A 4TXVA 4ZBBA 1JZOA 1F3BA 4EL1A 3TOTA 1H75A 5CRHA 5ENUA 2H0GA 1O85A 2P31A 2CVDA 2DJ0A 3IXRA 2H71A 4G0LA 2N5AA 1FW1A 2HRNA 4LA1A 3UOMA 4RUVA 2C1YA 1Z3EA 1FB0A 1GL8A 5A4VA 4ULXA 14GSA 3UL3A 2C0EA 4FH8A 1NM3A 3CSIA 2DIYA 5D9WA 4QMKA 5J40A 2WFCA 2OACA 2E7PA 1K3YA 2HT9A 1GSSA 1SENA 3W8JA 1IYIA 2KP2A 4IHUA 3LFLA 3KGKA 2DMLA 1G7EA 4ML1A 1YZXA 3TJKA 5F07A 5ECIB 5HR3A 4GSTA 4HJMA 2WB9A 4WR5A 5GZZB 2PWJA 5IMVA 1A2LA 2LKUA 4NWYA 1FOHA 1OKTA 3SBCA 2X4AA 4KB3A 2C0DA 4V1Ag 3Q18A 2HQTA 2KLXA 2EFHA 2VOCA 3APSA 4JR4A 3D22A 3CQFA 3HDCA 1TI1A 4WKWA 19GSA 2LEGA 2A2SA 3J7Yk 1ERWA 2N5FA 3IE3A 5BMUA 2WZSA 3TKSE 1HNCA 3MDKA 2YNXA 4TN8A 3LSZA 3ZIJA 3EMPA 5B6MA 4AJ6A 4MF6A 1GWCA 2FUG2 2KP1A 3TUEA 4NAXA 2C0FA 3Q19A 1SL2B 2PBJA 4DSSA 2RUFA 3L9UA 3PGTA 4EXJA 2TRXA 1DE1A 3EC3A 2E0QA 4TW5A 5J3RA 4QQ7A 1GSEA 3BCKA 2ZCTA 3HYPA 1PSQA 4O5QA 1MDJA 2CV4A 4MCUA 5JWQB 1M9BA 2BMXA 3FHKA 1Z7PA 5BMUB 2H6ZA 1RK4A 4JRRA 4D73A 3MNGA 1O7UA 1BEDA 3TGZA 4I8BA 1B4PA 4YKGA 1OC8A 4DVCA 3FZAA 3WGDA 1TU7A 1QUWA 4X0XA 2AUVA 1U87A 3LJRA 5HFGA 4MA9A 3WT2A 3LYPA 1OAZA 3D4TA 4AJ8A 3F0IA 1A8YA 5ECOB 4MJBA 2ON5A 2CAQA 2V1MA 5ELAA 3H8QA 3G7JA 1V98A 5DDLA 2GSSA 3UEMA 1Z5YE 2V2GA 2PERA 2N5BA 3G7YA 4PQHA 1A2JA 3KD0A 5FWGA 3U6VA 2AJQB 3M9KA 1SVMA 5C00A 2R0PA 4FYCA 5C04A 3VWXA 2P5RA 3BOAA 18GSA 4NMUA 2GLRA 2B6MA 2OT3A 3HJOA 1URMA 1X9WB 2B5XA 4MNNA 1CQHA 1JZWA 2IMEA 1WPIA 1SVLA 2MMNA 5F05A 5A1NA 2V32A 5G1LA 4F9ZA 3IHQA 1WRYA 4KX4A 4AKHA 1TI3A 3D21A 11GSA 1F3AA 2F51A 1Z9HA 1SYRA 5J9CA 3ZRDA 4MJAA 2KUCA 16GSA 1K3LA 4GCIA 2YJHA 1XOAA 1EP8A 4K1FA 3HHVA 3KP9A 3VK9A 3LYKA 2LJKA 3EE2A 1SJIA 3A2VA 3TU3B 5F0GA 4OFMA 1R5PA 1JLWA 5IO2A 1ERTA 1BG1A 1YEWC 3MAKA 1TW9A 2VLTA 2WULA 3GMFA 5A1NB 5A4WA 4Q5RA 3GSSA 1QFNA 1TXUA 5EPFA 2EFDA 3IRAA 4KF9A 4TR4A 5D96A 1R4WA 2FWEA 1QXHA 4HZ2A 4TKYA 3WD6A 1G6WA 4JR6A 1TJDA 2M80A 4TR0A 4IQAA 1EGOA 4FYUA 4NV5A 3FEUA 3HA9A 5GSTA 3KM6A 5IMDA 2L5LA 2L5OA 3ZTLA 2EIOA 3KMOA 3HVNA 4F2IA 5D9XA 4F03A 4K5SA 5E4WA 2B1LA 3RAZA 2H1BA 5J4YA 1VF3A 4GTUA 5KOXA 5G5EA 2L6DA 2JSZA 4QL7A 4MH2A 1BJXA 1ON4A 4IJIA 1EV9A 1RW1A 4HQSA 4KDYA 2HSNA 3A5IA 3FKFA 4O5RA 2O36A 5CO3A 2MYGA 4G0IA 4I5QA 2HFDA 1SKWB 1KNGA 4LL1B 1VF1A 6GSSA 2LJAA 4KW6A 4PI2C 5G31A 2IWTA 5D73A 1PRXA 3LWAA 2HXKA 1GTIA 2MBSA 3NIVA 2H1AA 5EY6A 2QKEA 2WS2A 1GNWA 2REMA 3IPZA 4L0UA 1VF4A 4RI6A 4PI0C 3ERFA 9GSSA 3L9VA 2C4JA 3GH9A 4PURA 2QA2A 1K0DA 4JZQA 5INYA 2K9FA 2AB6A 1K0OA 3ZZXA 4PQ1A 1ML6A 3LXZA 2H70A 1A0RP 2H0IA 1ERVA 2A2PA 2HSNB 4JEDA 5CRGA 4ZBAA 1B48A 4LLRA 4CDOA 5IQYA 4HJ2A 3BD2A 1U88A 3VFIA 4XRDA 1PKZA 1SVOA 4PUFC 3EPTA 5D9VA 5KOWA 1FB6A 4MZWA 2VM1A 4EKZA 1JZRA 4OO5A 1V40A 4I2TA 4BVYA 3P2AA 3RPPA 4EDZA 2O3EA 5ECMB 4O5UA 3IAM2 3IHGA 4K7IA 2XPDA 1N8JA 3BCIA 5ECQB 3QMXA 2B3SA 5HR2A 3CSJA 1VRSD 3RDWA 3UARA 4J57E 4G01A 3IR4A 2HRFA 2DLXA 5A34B 3HVXA 1B9XC 4XHMA 2YWIA 3HMJG 4YH2A 3DGQA 3D4MA 2GQKA 2MMZA 5IMCA 2G2QA 1OE7A 1FG4A 3ZIVA 4J2FA 5AISA 1BG5A 5JCWA 5DJLA 3E9JB 2H01A 2H76A 4BVYB 1WJKA 5H5RA 4KE3A 2O85A 1ILOA 1AAZA 1J08A 2K18A 4HI7A 3EVIA 4L8EA 4WBJA 2LTKA 5B8BA 3QR6A 3O3TA 4MH3A 2YV7A 3GTUB 5D93A 1CQGA 4MPFA 3GFKA 2VCXA 2H6YA 3HZ8A 1GLQA 4IBPA 3UMAA 4ZIJA 4O92A 2RM5A 2XBIA 2P0GA 3P8WA 3DIEA 2GS3A 1K0CA 3PR8A 3DD3A 3HVVA 4EC0A 4IELA 1SJZA 2QGVA 2IN3A 5E59A 2TRCP 1OVNA 2YANA 3M3MA 3IC8A 1TP9A 2EIQA 3GYKA 1MDKA 2PN8A 4K0NA 1QGVA 1ERUA 4BWQA 3EU3A 3VURA 4A5PA 1YF1A 1O8WA 1X5CA 2QA1A 1M9AA 4ISDA 1SK0A 2WVZA 3ZREA 5ECPB 4HS1A 1GUHA 3TCOA 3FR3A 3KCMA 1UN2A 5ELGA 1YEXA 5EVOA 2JSYA 3C8EA 4EVMA 3GKMA 3GL5A 1W4VA 2BJXA 1J0FA 2R2JA 1THXA 1WOUA 2EIRA 5JCUA 4POLA 5ID2A 4N0VA 1SL0B 1K0AA 1X9MB 1I9DA 1XW6A 2C3TA 2HI7A 3GURA 5IO0A 4RQRA 1TK0B 3C7MA 2LNTA 3QFBC 2K8VA 1BQ7A 4NXIA 2IMIA 2X8GA 4KH7A 1ZL9A 3CYNA 4KDUA 3CTFA 3KIJA 4L0WA 5ECNB 4OCFA 3QOUA 3KH7A 1USBA 4EIQA 3QAGA 3RBTA 2PVQA 5HR0A 3CRUA 3IK7A 5IMZA 1WE0A 4OCEA 3NZNA 2GDRA 4CHSA 3LGCA 2OJLA 4XS6A 1TOFA 2ZNMA 3J7Yb 3F4SA 5CRDA 3UBLA 1QQ2A 4OWYA 4N10A 5ID2B 3I9V2 3TJJA 1H4OA 2CAIA 4Q5QA 1V57A 4CY8A 2NDOA 2DBCA 2WW3A 4N11A 3UVTA 2FA4A 5DAKA 2WW2A 2CX3A 2H1DA 3US3A 1WMJA 3FR9A 3TRXA 1K0MA 2VIMA 3TRQA 3F9UA 2F8AA 4YQUA 4F0BA 2WVYA 2GSTA 1Q4JA 1TK5B 4TR3A 3GHAA 4W66A 2OBIA 2GSQA 4E8EA 1ZYNA 2PVOC 1ZYPA 2ZUPA 4YKFA 2B7JA 2CVBA 4V1Ap 5FHIA 2GSRA 1FVKA 5GAPD 3QAWA 5IMAA 1AC1A 1O6JA 2O8VB 5CYYA 2DJ2A 4NHZA 4DEJA 1OC3A 3GIXA 2K6VA 3RFRC 1KEBA 3WGXA 3FZ9A
chains in the Genus database with same CATH topology
4MF5A 1F2EA 4CY6A 4FYBA 5HFKA 1DBYA 1F37A 3G7IA 4PQIA 2VCTA 5A5KA 2E2GA 4HEA2 1EV4A 5A5HA 3KMNA 1ZCPA 1ZZYA 2Z9SA 4G9HA 3I43A 5DCGA 2VL2A 4I2UA 4PNFA 2YWNA 1PGTA 4USSA 2YN1A 4DSSB 1XPVA 4PXOA 4HZ4A 4AF2A 2YCDA 2IFQA 4GF0A 5J9BA 4ECIA 4YAPA 3JCML 2YP6A 4KDXA 3VWWA 1DUGA 3GKNA 2JL4A 1Z6MA 2B5YA 3I69A 3ZITA 3ZL5A 1S3CA 1GSFA 4WETA 1HD2A 1NHYA 3RHCA 1C72A 2HE3A 4ECCA 4D73B 3TJFA 1TRVA 4MLYA 1XFLA 6GSUA 5A5HB 3GN3A 2FWFA 2ALBA 3UVHA 2O89A 2J9HA 4BWSA 1GULA 1GH2A 1A24A 4IQ1A 3VWUA 2IFQB 3EU4A 2HLSA 4GWRA 5ECHB 4N3ZA 1GTBA 4DSRA 2OE0A 4TR1A 2IMKA 3MYDA 4ZL9A 2B7KA 5HFIA 2X8HA 1X5EA 3BBYA 1A8LA 1K0NA 1PQNA 3C1RA 4RQXA 3F63A 2V6OA 2RM6A 3GA4A 4POKA 4IKHA 1GSUA 1X5DA 1YF0A 4XS4A 2I3YA 4FO5A 4IJ3A 1M99A 3IA1A 2KOKA 4K5RA 3ZMKA 2R0GA 3DXBA 2X64A 3KXOA 6GSYA 2FCHA 2NBSA 3GH6A 4ZL8A 3M8NA 1XOBA 1WIKA 3TKQA 2JACA 3KEBA 3R3EA 7GSSA 2DKHA 2WDUA 5COHA 4AI6A 3RHBA 4TR1B 2D2ZA 3DMLA 3WGEA 1EEMA 3M1GA 3VI5A 4PUAA 1TRUA 1IYHA 3TRPA 5IOWA 1T4ZA 1M2BA 3CBUA 3GKKA 3CSHA 1M7TA 2O87A 2OA7A 3C73A 4XS4B 2VCVA 1G7OA 2HSYA 2B1KA 2WCIA 1Y6EA 3W6GA 1GSYA 1MDIA 1SK2A 5H5SA 4CW9A 2RLIA 3MIXA 4MZCA 4PX1A 1PN0A 1K0BA 2R3XA 1T1VA 2C8UA 3ME8A 4K2DA 3EWLA 3CTGA 1XZOA 5DQYA 3GRXA 4AJ7A 2HRKA 3ZFBA 1G0TA 2VLVA 4WXTA 1E2YA 5GAND 1B8XA 3P90A 1BX9A 4EF0A 3APQA 2PMTA 2XPEA 1YQ1A 13GSA 3IBHA 1A2MA 3DYRA 4ECBA 1EEJA 4G10A 1T00A 4K0GA 2JZTA 1W89A 1RQMA 3O6TA 1TU8A 3M9JA 5AGYA 1T7PB 1BAYA 4V2NA 2VL9A 2GZPA 3PINA 2DSAA 1AW9A 4MDCA 5DJMA 2HSHA 3QCPA 2GZZA 4OO4A 3CRTA 3QPMA 1JFUA 1EGRA 1XWKA 4DSQA 4XIHA 5G2ZA 4KUNA 1EOGA 2HRKB 4NHWA 5J5NA 2FWGA 2LNSA 1BYEA 5ABRA 2DJKA 4MJCA 1U3AA 4HUAA 1SD8A 2I81A 3WT1A 4FQUA 2AV4A 5DCHA 2LJRA 4IP1A 2RIIA 2L59A 3H93A 4TRXA 2EFCA 1XCCA 2ON7A 2GVPA 2F9SA 3HJMA 3F4RA 2E2MA 2LRTA 1XWCA 1GUKA 4ML6A 4KNDA 2XBQA 4EUYA 3H79A 4ICYA 4MP4A 5DBQA 1XVWA 2FA8A 1UA5A 4X1UA 3QFAC 1UC7A 4AKXB 6GSVA 4GSSA 1GUMA 4GRFA 1WWJA 2MMOA 2PPTA 3GV1A 2H0HA 2WGRA 3EYTA 4IVFA 3ERWA 2DJJA 3C71A 2K8SA 4Z2TA 3UAPA 3IOSA 4Z2UA 1HNBA 5J41A 3O76A 5B7CA 1F6MC 5KN1A 2A4HA 1O8XA 2EFEA 2CZ2A 1PN9A 1O81A 3KTBA 2F8FA 3TKSC 5CAXA 3P7XA 5HR1A 3TJBA 3F3QA 5IOXA 1EWXA 2OBKA 3MWHA 3IC4A 4ZB9A 4IP6A 2FLSA 3AY8A 1Y25A 1XVQA 4JU5A 4XTSA 2AAWA 3F8UA 3HKRA 2J23A 1OC9A 2CT6A 4LL4B 2V41A 2OE3A 1S3DA 4P3YB 4WF4A 1FHEA 4GSNA 3LQ7A 3F4TA 2O7KA 4Z7XA 2HZEA 1SJ6A 2R4VA 3OR5A 2OE1A 2VM2A 1A23A 1J9BA 2PU9C 1XWAA 3S9FA 5AIVA 3G9BA 4MJEA 5FT3A 1M2AA 2VAFA 2H66A 5J47A 5IMFA 3ZYWA 5A4UA 2IJYA 4F82A 1VF2A 4PGTA 5ECRB 4HU9A 4POBA 1V2AA 3D5JA 1LBKA 2C3QA 1AQWA 3C1SA 2YPMA 1AUCA 2DIZA 1OC9B 2VCZA 2PGTA 2LQQA 5KN3A 2H19A 2MBTA 1GSDA 3SWLA 4YQVA 3CWGA 3GKXA 1FAAA 1XBSA 2LRNA 1KBNA 2R6KA 22GSA 2C3NA 4OD7A 3QAVA 2L6CA 4BPYA 5AIXA 2H30A 4V2LA 4PTSA 4TVEA 5CNWA 2EC4A 2UZ8A 4AKIA 3PH9A 4PNGA 1AXDA 4GLTA 3FZ4A 3HZ4A 4J56E 3TJGA 1LJRA 1MEKA 5ECKB 3U5RE 1YDKA 4E8HA 3F6DA 5AN1A 1MTCA 3CXGA 2H72A 3D0ZA 2HNLA 1SKRB 5HQPA 1PKWA 2LRCA 3UIWA 1THOA 2IMFA 2YOIA 4TOPA 4OMVA 6GSWA 4O32A 2M72A 4I97A 1TXXA 4MABA 1SK1A 1DSBA 1K3OA 2CVKA 3DVXA 1XW9A 4Q5FA 3GNJA 2G0FA 4OFNA 2CA8A 20GSA 5DQSA 2GQMA 1M0UA 4ZB6A 2HZFA 4X43A 3ZLPA 5F06A 2I4AA 2CX4A 2YWOA 1PL2A 2QSIA 5DAKB 5GSSA 1JZDA 3QD9A 5IM9A 4ECJA 5B6NA 1T3BA 2OADA 3TB2A 2JADA 3GUSA 1FO5A 1Q98A 3HCZA 1E6BA 3ISOA 1NHOA 1GSQA 2HRAA 4K2XA 1PMTA 2NTOA 2A4VA 5EL8A 1R26A 5D8IA 4GQCA 2A2RA 4BVXA 3V1WA 3EMXA 2VL2C 1XWBA 4XCSA 1YKCA 3FR6A 3VPQA 1MD3A 2JU5A 2LUSA 4XRAA 3K8NA 3N5OA 2VCWA 3GSTA 1HNAA 4RI7A 2FHEA 1SYXA 3A2XA 2VD0A 3IDVA 3TOUA 4HU7A 3FY7A 1PX7A 1TTZA 2GTUA 4LMVA 2YZHA 3QDNA 1T4YA 5CP1A 17GSA 1Y1UA 5JWRB 1HYUA 2H74A 1V9WA 3BJ5A 5JCGA 1R7HA 2H73A 1TRSA 4KAEA 2IMDA 1JLVA 3FZ5A 1XWGA 2H6XA 5F8BA 2WRTA 4BVXB 1TRWA 2UV8G 1QMVA 1HQOA 1SKSB 1BF5A 3PPUA 2FD3A 4IN0A 1G6YA 4ZL7A 1ZMAA 3L0HA 4AGSA 2TIRA 3APOA 1LU4A 1T8EB 3A5WA 3LEFA 5J4VA 4MZBA 2FY6A 1YY7A 5B8AA 1S3AA 1FVJA 5DALA 4K7OA 4ACSA 2YZUA 2VUPA 4ZBDA 4XS1A 4IS0A 2HSMA 4EDYA 3L78A 2L57A 4Z2RA 5DVBA 2CQ9A 4JBBA 1QK8A 4LMWA 1JHBA 3VPTA 4MK3A 2V6KA 1MD4A 4WBRD 3L4NA 4G0KA 3A3TA 3IK9A 3ZVJA 4HOJA 1ZOFA 5LNKe 4BA7A 1KTEA 4L5LA 1N2AA 1PD21 1U3IA 2FGXA 1GTUA 4O7HA 1SU9A 3ME7A 2MZCA 3KJYA 2XHFA 3RPNA 1ST9A 5DALB 2HSMB 4N0ZA 6GSTA 1Z7RA 3EINA 4IW9A 1ACVA 2H1LA 3KH9A 2JZRA 3FMWA 4KSMA 1OYJA 10GSA 1ABAA 1YJ6A 3TDGA 2ES7A 2GT6A 1YVLA 4MF7A 2F3MA 5KEJA 2I9HA 5KN0A 4G19A 2RUEA 4NV2A 4IGJA 2DMMA 3CMIA 3DRNA 4ILFA 3GX8A 5G5FA 2GQLA 2GZYA 5LD0A 3A2WA 3FRCA 3H4KA 4YQMA 3HD5A 5ECLB 1EOHA 3KZQA 1YKAA 5IPHA 3KTLA 2R5GA 2YV9A 4X4JA 4EIPA 5JWOB 4K6XA 1NW2A 2P5QA 4WEYA 4E68A 2HYXA 4KA0A 5IIZA 1F9MA 1I5GA 1N25A 3IAS2 1TDIA 4JE1A 1GTAA 5LCZA 4HDEA 2FNOA 2L4CA 1PX6A 3DWVA 2DC5A 4GXZA 4G2EA 1OE8A 4KCEA 3W8SA 1AIUA 3Q6OA 4POMA 1U6TA 1A0FA 2GGTA 3F6FA 1X0RA 2DJ1A 1XIYA 2WJUA 2R0CA 3VWVA 2XC2A 5IPGA 2I1UA 2H75A 1AQVA 3M0FA 2DJ3A 2AHEA 3N9JA 3UJ1A 2GT5A 4ID0A 3VLNA 3NOFA 1SL1B 4YAVA 1GLPA 2C0GA 3HJPA 4EO3A 2LQOA 1TK8B 2NPBA 2B5EA 1GP1A 2VL3A 3KP8A 1UVZA 8GSSA 1NSWA 4QL9A 1ZYEA 2YJ7A 5J4UA 2MMAA 4KCAA 3R2QA 2PUKC 2M46A 3ED3A 1SD9A 5A34A 4K8MA 1Z6NA 3TKPA 3ZVJD 3HY2A 3E0UA 3ZMLA 3MSZA 3WYWA 3HVSA 1EP7A 3LXTA 2X49A 3FW2A 1OKDA 4OFTA 3LG6A 2CZ3A 2LS5A 4EE0A 4TXOA 3GL3A 5D9TA 1GRXA 2YWMA 4ZILA 2L4QA 4I6XA 5CRWA 4ZB8A 2X8CA 4BL7A 4H86A 2LV3A 1ZYQB 3GTUA 4NPBA 4Q5NA 4MPGA 1XXUA 3IV4A 4GDFA 4MMMA 3LW9A 4GQFA 5CREA 2VLUA 1R5AA 2BTOT 3TKRA 5ECSA 2IL3A 3FYGA 1AQXA 1YEPA 2KHPA 3TKSA 3L9SA 5G1KA 1PA3A 4WR4A 3ERGA 1XW5A 4V2MA 1TKDB 3DKSA 2C80A 2JZSA 2IPAA 2O5VA 4TXOB 5KN2A 2AYTA 1FOVA 1X9SB 2IIYA 3H1NA 4F0CA 4BL7B 4K7NA 6GSXA 2OKAA 5G30A 2LSTA 3VI7A 5H5QA 3GX0A 4FIWA 3LORA 4WF5A 3D6IA 4ZXGA 4L5OA 5BRTA 3FK8A 4KSOA 4N30A 2VKZG 4K9ZA 2VD1A 2X99A 1V58A 3F3RA 5L71A 2VO4A 12GSA 3I6AA 2QC7A 3HXSA 1DE2A 2R37A 3DEXA 2WZ9A 4AKGA 2NVLA 3DVWA 4KGIA 1O73A 1VGLA 1PL1A 1B4QA 4ZB7A 2FWHA 2H8LA 3EURA 3E3EA 1EZKA 3ZFLA 3Q74A 1M2DA 2VCQA 1B9YC 1ZGNA 2DKIA 2HZEB 4HQZA 3UBKA 2H1GA 1GNEA 1WP0A 4TXVA 4ZBBA 1JZOA 1F3BA 4EL1A 3TOTA 1H75A 5CRHA 5ENUA 2H0GA 1O85A 2P31A 2CVDA 2DJ0A 3IXRA 2H71A 4G0LA 2N5AA 1FW1A 2HRNA 4LA1A 3UOMA 4RUVA 2C1YA 1Z3EA 1FB0A 1GL8A 5A4VA 4ULXA 14GSA 3UL3A 2C0EA 4FH8A 1NM3A 3CSIA 2DIYA 5D9WA 4QMKA 5J40A 2WFCA 2OACA 2E7PA 1K3YA 2HT9A 1GSSA 1SENA 3W8JA 1IYIA 2KP2A 4IHUA 3LFLA 3KGKA 2DMLA 1G7EA 4ML1A 1YZXA 3TJKA 5F07A 5ECIB 5HR3A 4GSTA 4HJMA 2WB9A 4WR5A 5GZZB 2PWJA 5IMVA 1A2LA 2LKUA 4NWYA 1FOHA 1OKTA 3SBCA 2X4AA 4KB3A 2C0DA 4V1Ag 3Q18A 2HQTA 2KLXA 2EFHA 2VOCA 3APSA 4JR4A 3D22A 3HDCA 1TI1A 4WKWA 19GSA 2LEGA 2A2SA 3J7Yk 1ERWA 2N5FA 3IE3A 5BMUA 3TKSE 1HNCA 3MDKA 2YNXA 4TN8A 3LSZA 3ZIJA 3EMPA 5B6MA 4AJ6A 4MF6A 1GWCA 2FUG2 2KP1A 3TUEA 4NAXA 2C0FA 3Q19A 1SL2B 2PBJA 4DSSA 2RUFA 3L9UA 3PGTA 4EXJA 2TRXA 1DE1A 3EC3A 2E0QA 4TW5A 5J3RA 4QQ7A 1GSEA 3BCKA 2ZCTA 3HYPA 1PSQA 4O5QA 1MDJA 2CV4A 4MCUA 5JWQB 1M9BA 2BMXA 3FHKA 1Z7PA 5BMUB 2H6ZA 1RK4A 4JRRA 4D73A 3MNGA 1O7UA 1BEDA 3TGZA 4I8BA 1B4PA 4YKGA 1OC8A 4DVCA 3FZAA 3WGDA 1TU7A 1QUWA 4X0XA 2AUVA 1U87A 3LJRA 5HFGA 4MA9A 3WT2A 3LYPA 1OAZA 3D4TA 4AJ8A 3F0IA 1A8YA 5ECOB 4MJBA 2ON5A 2CAQA 2V1MA 5ELAA 3H8QA 3G7JA 1V98A 5DDLA 2GSSA 3UEMA 1Z5YE 2V2GA 2PERA 2N5BA 3G7YA 4PQHA 1A2JA 3KD0A 5FWGA 3U6VA 2AJQB 3M9KA 1SVMA 5C00A 2R0PA 4FYCA 5C04A 3VWXA 2P5RA 3BOAA 18GSA 4NMUA 2GLRA 2B6MA 2OT3A 3HJOA 1URMA 1X9WB 2B5XA 4MNNA 1CQHA 1JZWA 2IMEA 1WPIA 1SVLA 2MMNA 5F05A 5A1NA 2V32A 5G1LA 4F9ZA 3IHQA 1WRYA 4KX4A 4AKHA 1TI3A 3D21A 11GSA 1F3AA 2F51A 1Z9HA 1SYRA 5J9CA 3ZRDA 4MJAA 2KUCA 16GSA 1K3LA 4GCIA 2YJHA 1XOAA 1EP8A 4K1FA 3HHVA 3KP9A 3VK9A 3LYKA 2LJKA 3EE2A 1SJIA 3A2VA 3TU3B 5F0GA 4OFMA 1R5PA 1JLWA 5IO2A 1ERTA 1BG1A 3MAKA 1TW9A 2VLTA 2WULA 3GMFA 5A1NB 5A4WA 4Q5RA 3GSSA 1QFNA 1TXUA 5EPFA 2EFDA 3IRAA 4KF9A 4TR4A 5D96A 1R4WA 2FWEA 1QXHA 4HZ2A 4TKYA 3WD6A 1G6WA 4JR6A 1TJDA 2M80A 4TR0A 4IQAA 1EGOA 4FYUA 4NV5A 3FEUA 3HA9A 5GSTA 3KM6A 5IMDA 2L5LA 2L5OA 3ZTLA 2EIOA 3KMOA 4F2IA 5D9XA 4F03A 4K5SA 5E4WA 2B1LA 3RAZA 2H1BA 5J4YA 1VF3A 4GTUA 5KOXA 5G5EA 2L6DA 2JSZA 4QL7A 4MH2A 1BJXA 1ON4A 4IJIA 1EV9A 1RW1A 4HQSA 4KDYA 2HSNA 3A5IA 3FKFA 4O5RA 5CO3A 2MYGA 4G0IA 4I5QA 2HFDA 1SKWB 1KNGA 4LL1B 1VF1A 6GSSA 2LJAA 4KW6A 5G31A 2IWTA 5D73A 1PRXA 3LWAA 2HXKA 1GTIA 2MBSA 3NIVA 2H1AA 5EY6A 2QKEA 2WS2A 1GNWA 2REMA 3IPZA 4L0UA 1VF4A 4RI6A 3ERFA 9GSSA 3L9VA 2C4JA 3GH9A 4PURA 2QA2A 1K0DA 4JZQA 5INYA 2K9FA 2AB6A 1K0OA 3ZZXA 4PQ1A 1ML6A 3LXZA 2H70A 1A0RP 2H0IA 1ERVA 2A2PA 2HSNB 4JEDA 5CRGA 4ZBAA 1B48A 4LLRA 4CDOA 5IQYA 4HJ2A 3BD2A 1U88A 3VFIA 4XRDA 1PKZA 1SVOA 4PUFC 3EPTA 5D9VA 5KOWA 1FB6A 4MZWA 2VM1A 4EKZA 1JZRA 4OO5A 1V40A 4I2TA 4BVYA 3P2AA 3RPPA 4EDZA 5ECMB 4O5UA 3IAM2 3IHGA 4K7IA 2XPDA 1N8JA 3BCIA 5ECQB 3QMXA 2B3SA 5HR2A 3CSJA 1VRSD 3RDWA 3UARA 4J57E 4G01A 3IR4A 2HRFA 2DLXA 5A34B 3HVXA 1B9XC 4XHMA 2YWIA 3HMJG 4YH2A 3DGQA 3D4MA 2GQKA 2MMZA 5IMCA 2G2QA 1OE7A 1FG4A 3ZIVA 4J2FA 5AISA 1BG5A 5JCWA 5DJLA 3E9JB 2H01A 2H76A 4BVYB 1WJKA 5H5RA 4KE3A 2O85A 1ILOA 1AAZA 1J08A 2K18A 4HI7A 3EVIA 4L8EA 4WBJA 2LTKA 5B8BA 3QR6A 3O3TA 4MH3A 2YV7A 3GTUB 5D93A 1CQGA 4MPFA 3GFKA 2VCXA 2H6YA 3HZ8A 1GLQA 4IBPA 3UMAA 4ZIJA 4O92A 2RM5A 2XBIA 2P0GA 3P8WA 3DIEA 2GS3A 1K0CA 3PR8A 3DD3A 3HVVA 4EC0A 4IELA 1SJZA 2QGVA 2IN3A 5E59A 2TRCP 1OVNA 2YANA 3M3MA 3IC8A 1TP9A 2EIQA 3GYKA 1MDKA 2PN8A 4K0NA 1QGVA 1ERUA 4BWQA 3EU3A 3VURA 4A5PA 1YF1A 1O8WA 1X5CA 2QA1A 1M9AA 4ISDA 1SK0A 3ZREA 5ECPB 4HS1A 1GUHA 3TCOA 3FR3A 3KCMA 1UN2A 5ELGA 1YEXA 5EVOA 2JSYA 3C8EA 4EVMA 3GKMA 3GL5A 1W4VA 2BJXA 1J0FA 2R2JA 1THXA 1WOUA 2EIRA 5JCUA 4POLA 5ID2A 4N0VA 1SL0B 1K0AA 1X9MB 1I9DA 1XW6A 2C3TA 2HI7A 3GURA 5IO0A 4RQRA 1TK0B 3C7MA 2LNTA 3QFBC 2K8VA 1BQ7A 4NXIA 2IMIA 2X8GA 4KH7A 1ZL9A 3CYNA 4KDUA 3CTFA 3KIJA 4L0WA 5ECNB 4OCFA 3QOUA 3KH7A 1USBA 4EIQA 3QAGA 3RBTA 2PVQA 5HR0A 3CRUA 3IK7A 5IMZA 1WE0A 4OCEA 3NZNA 2GDRA 4CHSA 3LGCA 2OJLA 4XS6A 1TOFA 2ZNMA 3J7Yb 3F4SA 5CRDA 3UBLA 1QQ2A 4OWYA 4N10A 5ID2B 3I9V2 3TJJA 1H4OA 2CAIA 4Q5QA 1V57A 4CY8A 2NDOA 2DBCA 4N11A 3UVTA 2FA4A 5DAKA 2CX3A 2H1DA 3US3A 1WMJA 3FR9A 3TRXA 1K0MA 2VIMA 3TRQA 3F9UA 2F8AA 4YQUA 4F0BA 2GSTA 1Q4JA 1TK5B 4TR3A 3GHAA 4W66A 2OBIA 2GSQA 4E8EA 1ZYNA 2PVOC 1ZYPA 2ZUPA 4YKFA 2B7JA 2CVBA 4V1Ap 5FHIA 2GSRA 1FVKA 5GAPD 3QAWA 5IMAA 1AC1A 1O6JA 2O8VB 5CYYA 2DJ2A 4NHZA 4DEJA 1OC3A 3GIXA 2K6VA 3WGXA 1KEBA 3FZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MF5 A;  1F2E A;  4FYB A;  5HFK A;  1DBY A;  1F37 A;  3G7I A;  4PQI A;  2VCT A;  5A5K A;  2E2G A;  4HEA 2;  1EV4 A;  3KMN A;  1ZCP A;  1ZZY A;  2Z9S A;  4G9H A;  3I43 A;  5DCG A;  2VL2 A;  4I2U A;  4PNF A;  2YWN A;  1PGT A;  4USS A;  2YN1 A;  4DSS B;  1XPV A;  4PXO A;  4HZ4 A;  4AF2 A;  2YCD A;  2IFQ A;  4GF0 A;  5J9B A;  4ECI A;  4YAP A;  3JCM L;  2YP6 A;  4KDX A;  3VWW A;  1DUG A;  3GKN A;  2JL4 A;  1Z6M A;  2B5Y A;  3I69 A;  3ZIT A;  3ZL5 A;  1S3C A;  1GSF A;  4WET A;  1HD2 A;  1NHY A;  3RHC A;  1C72 A;  2HE3 A;  4ECC A;  4D73 B;  3TJF A;  1TRV A;  4MLY A;  1XFL A;  6GSU A;  3GN3 A;  2FWF A;  2ALB A;  3UVH A;  2O89 A;  2J9H A;  4BWS A;  1GUL A;  1GH2 A;  1A24 A;  4IQ1 A;  3VWU A;  2IFQ B;  3EU4 A;  2HLS A;  4GWR A;  5ECH B;  1GTB A;  4DSR A;  2OE0 A;  4TR1 A;  2IMK A;  4ZL9 A;  2B7K A;  5HFI A;  2X8H A;  1X5E A;  3BBY A;  1A8L A;  1K0N A;  1PQN A;  3C1R A;  4RQX A;  3F63 A;  2V6O A;  2RM6 A;  3GA4 A;  4POK A;  4IKH A;  1GSU A;  1X5D A;  1YF0 A;  4XS4 A;  2I3Y A;  4FO5 A;  4IJ3 A;  1M99 A;  3IA1 A;  2KOK A;  3ZMK A;  3DXB A;  2X64 A;  3KXO A;  6GSY A;  2FCH A;  2NBS A;  3GH6 A;  4ZL8 A;  3M8N A;  1XOB A;  1WIK A;  3TKQ A;  2JAC A;  3KEB A;  3R3E A;  7GSS A;  5COH A;  2WDU A;  3RHB A;  4TR1 B;  2D2Z A;  3DML A;  3WGE A;  1EEM A;  3M1G A;  3VI5 A;  4PUA A;  1TRU A;  1IYH A;  3TRP A;  5IOW A;  1T4Z A;  1M2B A;  3CBU A;  3GKK A;  3CSH A;  1M7T A;  2O87 A;  2OA7 A;  3C73 A;  4XS4 B;  2VCV A;  1G7O A;  2HSY A;  2B1K A;  2WCI A;  1Y6E A;  3W6G A;  1GSY A;  1MDI A;  1SK2 A;  5H5S A;  4CW9 A;  2RLI A;  4MZC A;  4PX1 A;  1K0B A;  2R3X A;  1T1V A;  2C8U A;  3ME8 A;  4K2D A;  3EWL A;  3CTG A;  1XZO A;  5DQY A;  3GRX A;  4AJ7 A;  2HRK A;  3ZFB A;  1G0T A;  2VLV A;  4WXT A;  1E2Y A;  5GAN D;  1B8X A;  3P90 A;  1BX9 A;  4EF0 A;  3APQ A;  2PMT A;  2XPE A;  1YQ1 A;  13GS A;  3IBH A;  1A2M A;  3DYR A;  4ECB A;  1EEJ A;  4G10 A;  1T00 A;  4K0G A;  2JZT A;  1W89 A;  1RQM A;  3O6T A;  1TU8 A;  3M9J A;  5AGY A;  1T7P B;  1BAY A;  4V2N A;  2VL9 A;  2GZP A;  3PIN A;  2DSA A;  1AW9 A;  4MDC A;  5DJM A;  2HSH A;  3QCP A;  2GZZ A;  4OO4 A;  3CRT A;  3QPM A;  1JFU A;  1EGR A;  1XWK A;  4DSQ A;  4XIH A;  5G2Z A;  4KUN A;  1EOG A;  2HRK B;  4NHW A;  5J5N A;  2FWG A;  2LNS A;  1BYE A;  5ABR A;  2DJK A;  4MJC A;  1U3A A;  4HUA A;  1SD8 A;  2I81 A;  3WT1 A;  4FQU A;  2AV4 A;  5DCH A;  2LJR A;  4IP1 A;  2RII A;  2L59 A;  3H93 A;  4TRX A;  1XCC A;  2ON7 A;  2GVP A;  2F9S A;  3HJM A;  3F4R A;  2E2M A;  2LRT A;  1XWC A;  1GUK A;  4ML6 A;  4KND A;  2XBQ A;  4EUY A;  3H79 A;  4MP4 A;  5DBQ A;  1XVW A;  2FA8 A;  1UA5 A;  4X1U A;  3QFA C;  1UC7 A;  6GSV A;  4GSS A;  1GUM A;  4GRF A;  1WWJ A;  2MMO A;  2PPT A;  3GV1 A;  2H0H A;  2WGR A;  3EYT A;  4IVF A;  3ERW A;  2DJJ A;  3C71 A;  2K8S A;  3UAP A;  3IOS A;  1HNB A;  5J41 A;  3O76 A;  5B7C A;  1F6M C;  5KN1 A;  1O8X A;  2CZ2 A;  1PN9 A;  1O81 A;  3KTB A;  2F8F A;  3TKS C;  5CAX A;  3P7X A;  5HR1 A;  3TJB A;  3F3Q A;  5IOX A;  1EWX A;  2OBK A;  3MWH A;  3IC4 A;  4ZB9 A;  4IP6 A;  2FLS A;  3AY8 A;  1Y25 A;  1XVQ A;  4JU5 A;  4XTS A;  2AAW A;  3F8U A;  3HKR A;  2J23 A;  1OC9 A;  2CT6 A;  4LL4 B;  2V41 A;  2OE3 A;  1S3D A;  4P3Y B;  4WF4 A;  1FHE A;  4GSN A;  3LQ7 A;  3F4T A;  2O7K A;  4Z7X A;  2HZE A;  1SJ6 A;  2R4V A;  3OR5 A;  2OE1 A;  2VM2 A;  1A23 A;  1J9B A;  2PU9 C;  1XWA A;  3S9F A;  5AIV A;  3G9B A;  4MJE A;  5FT3 A;  1M2A A;  2VAF A;  2H66 A;  5IMF A;  3ZYW A;  5A4U A;  2IJY A;  4F82 A;  1VF2 A;  4PGT A;  5ECR B;  4HU9 A;  4POB A;  1V2A A;  3D5J A;  1LBK A;  2C3Q A;  1AQW A;  3C1S A;  2YPM A;  1AUC A;  2DIZ A;  1OC9 B;  2VCZ A;  2PGT A;  2LQQ A;  5KN3 A;  2H19 A;  2MBT A;  1GSD A;  3SWL A;  4YQV A;  3GKX A;  1FAA A;  1XBS A;  2LRN A;  1KBN A;  2R6K A;  22GS A;  2C3N A;  4OD7 A;  3QAV A;  2L6C A;  4BPY A;  5AIX A;  2H30 A;  4V2L A;  4PTS A;  4TVE A;  5CNW A;  2EC4 A;  2UZ8 A;  3PH9 A;  4PNG A;  1AXD A;  4GLT A;  3FZ4 A;  3HZ4 A;  4J56 E;  3TJG A;  1LJR A;  1MEK A;  5ECK B;  3U5R E;  1YDK A;  4E8H A;  3F6D A;  5AN1 A;  1MTC A;  3CXG A;  2H72 A;  3D0Z A;  2HNL A;  1SKR B;  5HQP A;  1PKW A;  2LRC A;  3UIW A;  1THO A;  2IMF A;  2YOI A;  4TOP A;  4OMV A;  6GSW A;  4O32 A;  2M72 A;  4I97 A;  1TXX A;  4MAB A;  1SK1 A;  1DSB A;  1K3O A;  2CVK A;  3DVX A;  1XW9 A;  4Q5F A;  3GNJ A;  2G0F A;  4OFN A;  2CA8 A;  20GS A;  5DQS A;  2GQM A;  1M0U A;  4ZB6 A;  2HZF A;  4X43 A;  3ZLP A;  5F06 A;  2I4A A;  2CX4 A;  2YWO A;  1PL2 A;  2QSI A;  5DAK B;  5GSS A;  1JZD A;  3QD9 A;  5IM9 A;  4ECJ A;  5B6N A;  1T3B A;  2OAD A;  3TB2 A;  2JAD A;  3GUS A;  1FO5 A;  1Q98 A;  3HCZ A;  1E6B A;  3ISO A;  1NHO A;  1GSQ A;  2HRA A;  1PMT A;  2NTO A;  2A4V A;  5EL8 A;  1R26 A;  5D8I A;  4GQC A;  2A2R A;  4BVX A;  3V1W A;  3EMX A;  2VL2 C;  1XWB A;  4XCS A;  1YKC A;  3FR6 A;  3VPQ A;  1MD3 A;  2JU5 A;  2LUS A;  4XRA A;  3K8N A;  3N5O A;  2VCW A;  3GST A;  1HNA A;  4RI7 A;  2FHE A;  1SYX A;  3A2X A;  2VD0 A;  3IDV A;  3TOU A;  4HU7 A;  3FY7 A;  1PX7 A;  1TTZ A;  2GTU A;  4LMV A;  2YZH A;  3QDN A;  1T4Y A;  5CP1 A;  17GS A;  5JWR B;  1HYU A;  2H74 A;  1V9W A;  3BJ5 A;  5JCG A;  1R7H A;  2H73 A;  1TRS A;  4KAE A;  2IMD A;  1JLV A;  3FZ5 A;  1XWG A;  2H6X A;  5F8B A;  2WRT A;  4BVX B;  1TRW A;  1SKS B;  1QMV A;  1HQO A;  3PPU A;  2FD3 A;  4IN0 A;  1G6Y A;  4ZL7 A;  1ZMA A;  3L0H A;  4AGS A;  2TIR A;  3APO A;  1LU4 A;  1T8E B;  3A5W A;  3LEF A;  4MZB A;  2FY6 A;  1YY7 A;  5B8A A;  1S3A A;  1FVJ A;  5DAL A;  4K7O A;  4ACS A;  2YZU A;  2VUP A;  4ZBD A;  4XS1 A;  4IS0 A;  2HSM A;  4EDY A;  3L78 A;  2L57 A;  5DVB A;  2CQ9 A;  4JBB A;  1QK8 A;  4LMW A;  1JHB A;  3VPT A;  4MK3 A;  2V6K A;  1MD4 A;  4WBR D;  3L4N A;  4G0K A;  3A3T A;  3IK9 A;  3ZVJ A;  4HOJ A;  1ZOF A;  5LNK e;  4BA7 A;  1KTE A;  4L5L A;  1N2A A;  1PD2 1;  1U3I A;  2FGX A;  1GTU A;  4O7H A;  1SU9 A;  3ME7 A;  2MZC A;  3KJY A;  2XHF A;  3RPN A;  1ST9 A;  5DAL B;  2HSM B;  4N0Z A;  6GST A;  1Z7R A;  3EIN A;  4IW9 A;  1ACV A;  3KH9 A;  2JZR A;  4KSM A;  1OYJ A;  10GS A;  1ABA A;  1YJ6 A;  3TDG A;  2ES7 A;  2GT6 A;  4MF7 A;  2F3M A;  5KEJ A;  2I9H A;  5KN0 A;  4G19 A;  2RUE A;  4NV2 A;  4IGJ A;  2DMM A;  3CMI A;  3DRN A;  4ILF A;  3GX8 A;  5G5F A;  2GQL A;  2GZY A;  5LD0 A;  3A2W A;  3FRC A;  3H4K A;  4YQM A;  3HD5 A;  5ECL B;  1EOH A;  3KZQ A;  1YKA A;  5IPH A;  3KTL A;  2R5G A;  2YV9 A;  5JWO B;  4K6X A;  1NW2 A;  2P5Q A;  4WEY A;  2HYX A;  4KA0 A;  5IIZ A;  1F9M A;  1I5G A;  3IAS 2;  1TDI A;  4JE1 A;  1GTA A;  5LCZ A;  4HDE A;  2FNO A;  2L4C A;  1PX6 A;  3DWV A;  2DC5 A;  4GXZ A;  4G2E A;  1OE8 A;  4KCE A;  3W8S A;  1AIU A;  3Q6O A;  4POM A;  1U6T A;  1A0F A;  2GGT A;  3F6F A;  1X0R A;  2DJ1 A;  1XIY A;  2WJU A;  3VWV A;  2XC2 A;  5IPG A;  2I1U A;  2H75 A;  1AQV A;  3M0F A;  2DJ3 A;  2AHE A;  3N9J A;  3UJ1 A;  2GT5 A;  4ID0 A;  3VLN A;  3NOF A;  1SL1 B;  4YAV A;  1GLP A;  2C0G A;  3HJP A;  4EO3 A;  2LQO A;  1TK8 B;  2NPB A;  2B5E A;  1GP1 A;  2VL3 A;  3KP8 A;  1UVZ A;  8GSS A;  1NSW A;  4QL9 A;  1ZYE A;  2YJ7 A;  5J4U A;  2MMA A;  4KCA A;  3R2Q A;  2PUK C;  2M46 A;  3ED3 A;  1SD9 A;  3TKP A;  4K8M A;  1Z6N A;  3ZVJ D;  3HY2 A;  3E0U A;  3ZML A;  3MSZ A;  3WYW A;  3HVS A;  1EP7 A;  3LXT A;  3FW2 A;  1OKD A;  4OFT A;  3LG6 A;  2CZ3 A;  2LS5 A;  4EE0 A;  4TXO A;  3GL3 A;  5D9T A;  1GRX A;  2YWM A;  4ZIL A;  2L4Q A;  4I6X A;  5CRW A;  4ZB8 A;  2X8C A;  4BL7 A;  4H86 A;  2LV3 A;  1ZYQ B;  3GTU A;  4NPB A;  4Q5N A;  4MPG A;  1XXU A;  3IV4 A;  4MMM A;  4GQF A;  5CRE A;  2VLU A;  1R5A A;  2BTO T;  3TKR A;  5ECS A;  2IL3 A;  3FYG A;  1AQX A;  1YEP A;  2KHP A;  3TKS A;  3L9S A;  5G1K A;  1PA3 A;  4WR4 A;  3ERG A;  1XW5 A;  4V2M A;  1TKD B;  3DKS A;  2C80 A;  2JZS A;  2IPA A;  4TXO B;  5KN2 A;  2AYT A;  1FOV A;  1X9S B;  2IIY A;  3H1N A;  4F0C A;  4BL7 B;  4K7N A;  6GSX A;  2OKA A;  5G30 A;  2LST A;  3VI7 A;  5H5Q A;  3GX0 A;  4FIW A;  3LOR A;  4WF5 A;  3D6I A;  4ZXG A;  4L5O A;  3FK8 A;  4KSO A;  4N30 A;  4K9Z A;  2VD1 A;  2X99 A;  1V58 A;  3F3R A;  5L71 A;  2VO4 A;  12GS A;  3I6A A;  2QC7 A;  3HXS A;  1DE2 A;  2R37 A;  3DEX A;  2WZ9 A;  2NVL A;  3DVW A;  4KGI A;  1O73 A;  1VGL A;  1PL1 A;  1B4Q A;  2FWH A;  2H8L A;  3EUR A;  3E3E A;  1EZK A;  3ZFL A;  3Q74 A;  1M2D A;  2VCQ A;  1B9Y C;  1ZGN A;  2HZE B;  4HQZ A;  3UBK A;  2H1G A;  1GNE A;  1WP0 A;  4TXV A;  4ZBB A;  1JZO A;  1F3B A;  4EL1 A;  3TOT A;  1H75 A;  5CRH A;  5ENU A;  2H0G A;  1O85 A;  2P31 A;  2CVD A;  2DJ0 A;  3IXR A;  2H71 A;  4G0L A;  2N5A A;  1FW1 A;  2HRN A;  4LA1 A;  3UOM A;  4RUV A;  2C1Y A;  1Z3E A;  1FB0 A;  1GL8 A;  5A4V A;  4ULX A;  14GS A;  3UL3 A;  2C0E A;  4FH8 A;  1NM3 A;  3CSI A;  2DIY A;  5D9W A;  2WFC A;  2OAC A;  2E7P A;  1K3Y A;  2HT9 A;  1GSS A;  1SEN A;  3W8J A;  1IYI A;  2KP2 A;  4IHU A;  3LFL A;  3KGK A;  2DML A;  1G7E A;  4ML1 A;  1YZX A;  3TJK A;  5F07 A;  5ECI B;  5HR3 A;  4HJM A;  4GST A;  2WB9 A;  4WR5 A;  5GZZ B;  2PWJ A;  5IMV A;  1A2L A;  2LKU A;  4NWY A;  1OKT A;  3SBC A;  4KB3 A;  2C0D A;  4V1A g;  3Q18 A;  2HQT A;  2KLX A;  2VOC A;  3APS A;  4JR4 A;  3D22 A;  3HDC A;  1TI1 A;  4WKW A;  19GS A;  2LEG A;  2A2S A;  3J7Y k;  1ERW A;  2N5F A;  3IE3 A;  5BMU A;  3TKS E;  1HNC A;  3MDK A;  2YNX A;  4TN8 A;  3LSZ A;  3ZIJ A;  3EMP A;  5B6M A;  4AJ6 A;  4MF6 A;  1GWC A;  2FUG 2;  2KP1 A;  3TUE A;  4NAX A;  2C0F A;  3Q19 A;  1SL2 B;  2PBJ A;  4DSS A;  2RUF A;  3L9U A;  3PGT A;  4EXJ A;  2TRX A;  1DE1 A;  3EC3 A;  2E0Q A;  4TW5 A;  5J3R A;  4QQ7 A;  1GSE A;  3BCK A;  2ZCT A;  3HYP A;  1PSQ A;  1MDJ A;  2CV4 A;  4MCU A;  5JWQ B;  1M9B A;  2BMX A;  3FHK A;  1Z7P A;  2H6Z A;  1RK4 A;  4JRR A;  4D73 A;  3MNG A;  1O7U A;  1BED A;  3TGZ A;  4I8B A;  1B4P A;  1OC8 A;  4DVC A;  3FZA A;  3WGD A;  1TU7 A;  1QUW A;  4X0X A;  2AUV A;  1U87 A;  3LJR A;  5HFG A;  4MA9 A;  3WT2 A;  3LYP A;  1OAZ A;  3D4T A;  4AJ8 A;  3F0I A;  1A8Y A;  5ECO B;  4MJB A;  2ON5 A;  2CAQ A;  2V1M A;  5ELA A;  3H8Q A;  3G7J A;  1V98 A;  5DDL A;  2GSS A;  3UEM A;  1Z5Y E;  2V2G A;  2PER A;  2N5B A;  3G7Y A;  4PQH A;  1A2J A;  3KD0 A;  5FWG A;  3U6V A;  2AJQ B;  3M9K A;  5C00 A;  4FYC A;  5C04 A;  3VWX A;  2P5R A;  3BOA A;  18GS A;  4NMU A;  2GLR A;  2B6M A;  3HJO A;  1URM A;  1X9W B;  2B5X A;  1CQH A;  1JZW A;  2IME A;  1WPI A;  2MMN A;  5F05 A;  2V32 A;  5G1L A;  4F9Z A;  3IHQ A;  1WRY A;  4KX4 A;  1TI3 A;  3D21 A;  11GS A;  1F3A A;  2F51 A;  1Z9H A;  1SYR A;  5J9C A;  3ZRD A;  4MJA A;  2KUC A;  16GS A;  1K3L A;  4GCI A;  2YJH A;  1XOA A;  1EP8 A;  4K1F A;  3HHV A;  3KP9 A;  3VK9 A;  3LYK A;  2LJK A;  3EE2 A;  1SJI A;  3A2V A;  5F0G A;  4OFM A;  1R5P A;  1JLW A;  5IO2 A;  1ERT A;  3MAK A;  1TW9 A;  2VLT A;  2WUL A;  3GMF A;  5A4W A;  4Q5R A;  3GSS A;  1QFN A;  5EPF A;  3IRA A;  4KF9 A;  4TR4 A;  5D96 A;  1R4W A;  2FWE A;  1QXH A;  4HZ2 A;  4TKY A;  3WD6 A;  1G6W A;  4JR6 A;  1TJD A;  2M80 A;  4TR0 A;  4IQA A;  1EGO A;  4FYU A;  4NV5 A;  3FEU A;  3HA9 A;  5GST A;  3KM6 A;  5IMD A;  2L5L A;  2L5O A;  3ZTL A;  2EIO A;  3KMO A;  4F2I A;  5D9X A;  4F03 A;  5E4W A;  2B1L A;  3RAZ A;  2H1B A;  1VF3 A;  4GTU A;  5G5E A;  2L6D A;  2JSZ A;  4QL7 A;  4MH2 A;  1BJX A;  1ON4 A;  4IJI A;  1EV9 A;  1RW1 A;  4HQS A;  4KDY A;  3FKF A;  4O5R A;  5CO3 A;  2MYG A;  4G0I A;  4I5Q A;  2HFD A;  1SKW B;  1KNG A;  4LL1 B;  1VF1 A;  6GSS A;  2LJA A;  4KW6 A;  5G31 A;  2IWT A;  5D73 A;  1PRX A;  3LWA A;  2HXK A;  1GTI A;  2MBS A;  3NIV A;  2H1A A;  5EY6 A;  2QKE A;  2WS2 A;  1GNW A;  2REM A;  3IPZ A;  4L0U A;  1VF4 A;  4RI6 A;  3ERF A;  9GSS A;  3L9V A;  2C4J A;  3GH9 A;  4PUR A;  1K0D A;  4JZQ A;  5INY A;  2K9F A;  2AB6 A;  1K0O A;  3ZZX A;  4PQ1 A;  1ML6 A;  3LXZ A;  2H70 A;  1A0R P;  2H0I A;  1ERV A;  2HSN B;  4JED A;  5CRG A;  4ZBA A;  1B48 A;  4LLR A;  4CDO A;  5IQY A;  4HJ2 A;  3BD2 A;  1U88 A;  3VFI A;  4XRD A;  1PKZ A;  4PUF C;  5D9V A;  1FB6 A;  4MZW A;  2VM1 A;  4EKZ A;  1JZR A;  4OO5 A;  1V40 A;  4I2T A;  4BVY A;  3P2A A;  3RPP A;  4EDZ A;  5ECM B;  3IAM 2;  4K7I A;  2XPD A;  1N8J A;  3BCI A;  5ECQ B;  3QMX A;  2B3S A;  5HR2 A;  3CSJ A;  1VRS D;  3RDW A;  3UAR A;  4J57 E;  3IR4 A;  2HRF A;  2DLX A;  3HVX A;  1B9X C;  4XHM A;  2YWI A;  4YH2 A;  3DGQ A;  3D4M A;  2GQK A;  2MMZ A;  5IMC A;  2G2Q A;  1OE7 A;  1FG4 A;  3ZIV A;  4J2F A;  5AIS A;  1BG5 A;  5JCW A;  5DJL A;  3E9J B;  2H01 A;  4BVY B;  2H76 A;  1WJK A;  5H5R A;  4KE3 A;  2O85 A;  1ILO A;  1AAZ A;  1J08 A;  2K18 A;  4HI7 A;  3EVI A;  4L8E A;  4WBJ A;  2LTK A;  5B8B A;  3QR6 A;  3O3T A;  4MH3 A;  2YV7 A;  3GTU B;  5D93 A;  1CQG A;  4MPF A;  3GFK A;  2VCX A;  2H6Y A;  3HZ8 A;  1GLQ A;  4IBP A;  3UMA A;  4ZIJ A;  4O92 A;  2RM5 A;  2XBI A;  2P0G A;  3P8W A;  3DIE A;  2GS3 A;  1K0C A;  3PR8 A;  3DD3 A;  3HVV A;  4EC0 A;  4IEL A;  1SJZ A;  2QGV A;  2IN3 A;  5E59 A;  2TRC P;  1OVN A;  2YAN A;  3M3M A;  3IC8 A;  1TP9 A;  2EIQ A;  3GYK A;  1MDK A;  2PN8 A;  4K0N A;  1QGV A;  1ERU A;  4BWQ A;  3EU3 A;  3VUR A;  1YF1 A;  1O8W A;  1X5C A;  1M9A A;  4ISD A;  1SK0 A;  3ZRE A;  5ECP B;  4HS1 A;  1GUH A;  3TCO A;  3FR3 A;  3KCM A;  1UN2 A;  5ELG A;  1YEX A;  5EVO A;  2JSY A;  3C8E A;  4EVM A;  3GKM A;  3GL5 A;  1W4V A;  2BJX A;  1J0F A;  2R2J A;  1THX A;  1WOU A;  2EIR A;  5JCU A;  4POL A;  5ID2 A;  4N0V A;  1SL0 B;  1K0A A;  1X9M B;  1I9D A;  1XW6 A;  2C3T A;  2HI7 A;  3GUR A;  5IO0 A;  4RQR A;  1TK0 B;  3C7M A;  2LNT A;  3QFB C;  2K8V A;  1BQ7 A;  4NXI A;  2IMI A;  2X8G A;  4KH7 A;  1ZL9 A;  3CYN A;  4KDU A;  3CTF A;  3KIJ A;  4L0W A;  5ECN B;  4OCF A;  3QOU A;  3KH7 A;  1USB A;  3QAG A;  3RBT A;  2PVQ A;  5HR0 A;  3CRU A;  3IK7 A;  5IMZ A;  1WE0 A;  4OCE A;  3NZN A;  2GDR A;  4CHS A;  3LGC A;  2OJL A;  4XS6 A;  1TOF A;  2ZNM A;  3J7Y b;  3F4S A;  5CRD A;  3UBL A;  1QQ2 A;  4OWY A;  4N10 A;  5ID2 B;  3I9V 2;  3TJJ A;  1H4O A;  2CAI A;  4Q5Q A;  1V57 A;  2NDO A;  2DBC A;  4N11 A;  3UVT A;  2FA4 A;  5DAK A;  2CX3 A;  2H1D A;  3US3 A;  1WMJ A;  3FR9 A;  3TRX A;  1K0M A;  2VIM A;  3TRQ A;  3F9U A;  2F8A A;  4YQU A;  4F0B A;  2GST A;  1Q4J A;  1TK5 B;  4TR3 A;  3GHA A;  2OBI A;  2GSQ A;  4E8E A;  2PVO C;  2ZUP A;  2B7J A;  2CVB A;  4V1A p;  5FHI A;  2GSR A;  1FVK A;  5GAP D;  3QAW A;  5IMA A;  1AC1 A;  1O6J A;  2O8V B;  5CYY A;  2DJ2 A;  4NHZ A;  4DEJ A;  1OC3 A;  3GIX A;  2K6V A;  3WGX A;  1KEB A;  3FZ9 A; 
#chains in the Genus database with same CATH topology
 4MF5 A;  1F2E A;  4CY6 A;  4FYB A;  5HFK A;  1DBY A;  1F37 A;  3G7I A;  4PQI A;  2VCT A;  5A5K A;  2E2G A;  4HEA 2;  1EV4 A;  5A5H A;  3KMN A;  1ZCP A;  1ZZY A;  2Z9S A;  4G9H A;  1M3J A;  3I43 A;  5DCG A;  2VL2 A;  4I2U A;  4PNF A;  2YWN A;  1PGT A;  4USS A;  2YN1 A;  4DSS B;  1XPV A;  4PXO A;  4HZ4 A;  4AF2 A;  2YCD A;  2IFQ A;  4GF0 A;  5J9B A;  4ECI A;  4YAP A;  3JCM L;  2YP6 A;  4KDX A;  3VWW A;  1DUG A;  3GKN A;  2JL4 A;  1Z6M A;  2B5Y A;  3I69 A;  3ZIT A;  3ZL5 A;  1S3C A;  1GSF A;  4WET A;  1HD2 A;  1NHY A;  3RHC A;  1C72 A;  2HE3 A;  4ECC A;  4D73 B;  3TJF A;  1TRV A;  4MLY A;  1XFL A;  6GSU A;  5A5H B;  3GN3 A;  2FWF A;  2ALB A;  3UVH A;  2O89 A;  2J9H A;  4BWS A;  1GUL A;  1GH2 A;  1A24 A;  4IQ1 A;  3VWU A;  2IFQ B;  3EU4 A;  2HLS A;  4GWR A;  5ECH B;  4N3Z A;  1GTB A;  4DSR A;  2OE0 A;  4TR1 A;  2IMK A;  3MYD A;  4ZL9 A;  2B7K A;  5HFI A;  2X8H A;  1X5E A;  3BBY A;  1A8L A;  1K0N A;  1PQN A;  3C1R A;  4RQX A;  3F63 A;  2V6O A;  2RM6 A;  3GA4 A;  4POK A;  4IKH A;  1GSU A;  1X5D A;  1YF0 A;  4XS4 A;  2I3Y A;  4FO5 A;  4IJ3 A;  1M99 A;  3IA1 A;  2KOK A;  4K5R A;  3ZMK A;  2R0G A;  3DXB A;  2X64 A;  3KXO A;  6GSY A;  2FCH A;  2NBS A;  3GH6 A;  4ZL8 A;  3M8N A;  1XOB A;  1WIK A;  3TKQ A;  2JAC A;  3KEB A;  3R3E A;  7GSS A;  2DKH A;  2WDU A;  5COH A;  4AI6 A;  3RHB A;  4TR1 B;  2D2Z A;  3DML A;  3WGE A;  1EEM A;  3M1G A;  3VI5 A;  4PUA A;  1TRU A;  1IYH A;  3TRP A;  5IOW A;  1T4Z A;  1M2B A;  3CBU A;  3GKK A;  3CSH A;  1M7T A;  2O87 A;  2OA7 A;  3C73 A;  4XS4 B;  2VCV A;  1G7O A;  2HSY A;  2B1K A;  2WCI A;  1Y6E A;  3W6G A;  1GSY A;  1MDI A;  1SK2 A;  5H5S A;  4CW9 A;  2RLI A;  3MIX A;  4MZC A;  4PX1 A;  1PN0 A;  1K0B A;  2R3X A;  1T1V A;  2C8U A;  3ME8 A;  4K2D A;  3EWL A;  3CTG A;  1XZO A;  5DQY A;  3GRX A;  4AJ7 A;  2HRK A;  3ZFB A;  1G0T A;  2VLV A;  4WXT A;  1E2Y A;  5GAN D;  1B8X A;  3P90 A;  1BX9 A;  4EF0 A;  3APQ A;  2PMT A;  2XPE A;  1YQ1 A;  13GS A;  3IBH A;  1A2M A;  3DYR A;  4ECB A;  1EEJ A;  4G10 A;  1T00 A;  4K0G A;  2JZT A;  1W89 A;  1RQM A;  3O6T A;  1TU8 A;  3M9J A;  5AGY A;  1T7P B;  1BAY A;  4V2N A;  2VL9 A;  2GZP A;  3PIN A;  2DSA A;  1AW9 A;  4MDC A;  5DJM A;  2HSH A;  3QCP A;  2GZZ A;  4OO4 A;  3CRT A;  3QPM A;  1JFU A;  1EGR A;  1XWK A;  4DSQ A;  4XIH A;  5G2Z A;  4KUN A;  1EOG A;  2HRK B;  4NHW A;  5J5N A;  2FWG A;  2LNS A;  1BYE A;  5ABR A;  2DJK A;  4MJC A;  1U3A A;  4HUA A;  1SD8 A;  2I81 A;  3WT1 A;  4FQU A;  2AV4 A;  5DCH A;  2LJR A;  4IP1 A;  2RII A;  2L59 A;  3H93 A;  4TRX A;  2EFC A;  1XCC A;  2ON7 A;  2GVP A;  2F9S A;  3HJM A;  3F4R A;  2E2M A;  2LRT A;  1XWC A;  1GUK A;  4ML6 A;  4KND A;  2XBQ A;  4EUY A;  3H79 A;  4ICY A;  4MP4 A;  5DBQ A;  1XVW A;  2FA8 A;  1UA5 A;  4HSC X;  4X1U A;  3QFA C;  1UC7 A;  4AKX B;  6GSV A;  4GSS A;  1GUM A;  4GRF A;  1WWJ A;  2MMO A;  2PPT A;  3GV1 A;  2H0H A;  2WGR A;  3EYT A;  4IVF A;  3ERW A;  2DJJ A;  3C71 A;  2K8S A;  4Z2T A;  3UAP A;  3IOS A;  4Z2U A;  1HNB A;  5J41 A;  3O76 A;  5B7C A;  1F6M C;  5KN1 A;  2A4H A;  1O8X A;  2EFE A;  2CZ2 A;  1PN9 A;  1O81 A;  3KTB A;  2F8F A;  3TKS C;  5CAX A;  3P7X A;  5HR1 A;  3TJB A;  3F3Q A;  5IOX A;  1EWX A;  2OBK A;  3MWH A;  3IC4 A;  4ZB9 A;  4IP6 A;  2FLS A;  3AY8 A;  1Y25 A;  1XVQ A;  4JU5 A;  4XTS A;  2AAW A;  3F8U A;  3HKR A;  2J23 A;  1OC9 A;  2CT6 A;  4LL4 B;  2V41 A;  2OE3 A;  1S3D A;  4P3Y B;  4WF4 A;  1FHE A;  4GSN A;  3LQ7 A;  3F4T A;  2O7K A;  4Z7X A;  2HZE A;  1SJ6 A;  2R4V A;  3OR5 A;  2OE1 A;  2VM2 A;  1A23 A;  1J9B A;  2PU9 C;  1S4B P;  1XWA A;  3S9F A;  5AIV A;  3G9B A;  4MJE A;  5FT3 A;  1M2A A;  2VAF A;  2H66 A;  5J47 A;  5IMF A;  3ZYW A;  5A4U A;  2IJY A;  4F82 A;  1VF2 A;  4PGT A;  5ECR B;  4HU9 A;  4POB A;  1V2A A;  3D5J A;  2WW0 A;  1LBK A;  2C3Q A;  1AQW A;  3C1S A;  2YPM A;  4FXY P;  1AUC A;  2DIZ A;  1OC9 B;  2VCZ A;  2PGT A;  2LQQ A;  5KN3 A;  2H19 A;  2MBT A;  1GSD A;  3SWL A;  4YQV A;  3CWG A;  3GKX A;  1FAA A;  1XBS A;  2LRN A;  1KBN A;  2R6K A;  22GS A;  2C3N A;  4OD7 A;  3QAV A;  2L6C A;  4BPY A;  5AIX A;  2H30 A;  4V2L A;  4PTS A;  4TVE A;  1I1I P;  5CNW A;  2EC4 A;  2UZ8 A;  4AKI A;  3PH9 A;  4PNG A;  1AXD A;  4GLT A;  3FZ4 A;  3HZ4 A;  4J56 E;  3TJG A;  1LJR A;  1MEK A;  5ECK B;  3U5R E;  1YDK A;  4E8H A;  3F6D A;  5AN1 A;  1M3I A;  1MTC A;  3CXG A;  2H72 A;  3D0Z A;  2HNL A;  1SKR B;  5HQP A;  1PKW A;  2LRC A;  3UIW A;  1THO A;  2IMF A;  2YOI A;  4TOP A;  4OMV A;  6GSW A;  4O32 A;  2M72 A;  4I97 A;  1TXX A;  4MAB A;  1SK1 A;  1DSB A;  1K3O A;  2CVK A;  3DVX A;  1XW9 A;  4Q5F A;  3GNJ A;  2G0F A;  4OFN A;  2CA8 A;  20GS A;  5DQS A;  2GQM A;  1M0U A;  4ZB6 A;  2HZF A;  4X43 A;  3ZLP A;  5F06 A;  2I4A A;  2CX4 A;  2YWO A;  1PL2 A;  2QSI A;  5DAK B;  5GSS A;  1JZD A;  3QD9 A;  5IM9 A;  4ECJ A;  5B6N A;  1T3B A;  2OAD A;  3TB2 A;  4BIK A;  2JAD A;  3GUS A;  1FO5 A;  1Q98 A;  3HCZ A;  1E6B A;  3ISO A;  1NHO A;  1GSQ A;  2HRA A;  4K2X A;  1PMT A;  2NTO A;  2A4V A;  5EL8 A;  1R26 A;  5D8I A;  4GQC A;  2A2R A;  4BVX A;  3V1W A;  3EMX A;  2VL2 C;  1XWB A;  4XCS A;  1YKC A;  1XG8 A;  3FR6 A;  3VPQ A;  1MD3 A;  2JU5 A;  2LUS A;  4XRA A;  3K8N A;  3N5O A;  2VCW A;  3GST A;  1HNA A;  4RI7 A;  2FHE A;  1SYX A;  3A2X A;  2VD0 A;  3IDV A;  3TOU A;  4HU7 A;  3FY7 A;  1PX7 A;  1TTZ A;  2GTU A;  4LMV A;  2YZH A;  3QDN A;  1T4Y A;  5CP1 A;  17GS A;  1Y1U A;  5JWR B;  1HYU A;  2H74 A;  1V9W A;  3BJ5 A;  5JCG A;  1R7H A;  2H73 A;  1TRS A;  4KAE A;  2IMD A;  1JLV A;  3FZ5 A;  1XWG A;  2H6X A;  5F8B A;  2WRT A;  4BVX B;  1TRW A;  2UV8 G;  1QMV A;  1HQO A;  1SKS B;  1BF5 A;  3PPU A;  2FD3 A;  4IN0 A;  1G6Y A;  4ZL7 A;  1ZMA A;  3L0H A;  4AGS A;  3RGB C;  2TIR A;  3APO A;  1LU4 A;  1T8E B;  3A5W A;  3LEF A;  5J4V A;  4MZB A;  2FY6 A;  1YY7 A;  5B8A A;  1S3A A;  1FVJ A;  5DAL A;  4K7O A;  4ACS A;  1PFO A;  2YZU A;  2VUP A;  4ZBD A;  4XS1 A;  4IS0 A;  2HSM A;  4EDY A;  3L78 A;  2L57 A;  4Z2R A;  5DVB A;  2CQ9 A;  4JBB A;  1QK8 A;  4LMW A;  1JHB A;  3VPT A;  4MK3 A;  2V6K A;  1MD4 A;  4WBR D;  3L4N A;  4G0K A;  3A3T A;  3IK9 A;  3ZVJ A;  4HOJ A;  1ZOF A;  5LNK e;  4BA7 A;  1KTE A;  4L5L A;  1N2A A;  1PD2 1;  1U3I A;  2FGX A;  1GTU A;  4O7H A;  1SU9 A;  3ME7 A;  2MZC A;  3KJY A;  2XHF A;  1S3R A;  3RPN A;  1ST9 A;  5DAL B;  2HSM B;  4N0Z A;  6GST A;  1Z7R A;  3EIN A;  4IW9 A;  1ACV A;  2H1L A;  3KH9 A;  2JZR A;  3FMW A;  4KSM A;  1OYJ A;  10GS A;  1ABA A;  1YJ6 A;  3TDG A;  4PHZ C;  2ES7 A;  2GT6 A;  1YVL A;  4MF7 A;  2F3M A;  5KEJ A;  2I9H A;  5KN0 A;  4G19 A;  2RUE A;  4NV2 A;  4IGJ A;  2DMM A;  3CMI A;  3DRN A;  4ILF A;  3GX8 A;  5G5F A;  2GQL A;  2GZY A;  5LD0 A;  3A2W A;  3FRC A;  3H4K A;  4YQM A;  3HD5 A;  5ECL B;  1EOH A;  3KZQ A;  1YKA A;  5IPH A;  3KTL A;  2R5G A;  2YV9 A;  4X4J A;  4EIP A;  5JWO B;  4K6X A;  1NW2 A;  2P5Q A;  4WEY A;  4E68 A;  2HYX A;  4KA0 A;  5IIZ A;  1F9M A;  1I5G A;  1N25 A;  3IAS 2;  1TDI A;  4JE1 A;  1GTA A;  5LCZ A;  4HDE A;  2FNO A;  2L4C A;  1PX6 A;  3DWV A;  2DC5 A;  4GXZ A;  4G2E A;  1OE8 A;  4KCE A;  3W8S A;  1AIU A;  3Q6O A;  4POM A;  1U6T A;  1A0F A;  2GGT A;  3F6F A;  1X0R A;  2DJ1 A;  1XIY A;  2WJU A;  2R0C A;  3VWV A;  2XC2 A;  5IPG A;  2I1U A;  2H75 A;  1AQV A;  3M0F A;  2DJ3 A;  2AHE A;  3N9J A;  3UJ1 A;  2GT5 A;  4ID0 A;  3VLN A;  3NOF A;  1SL1 B;  4YAV A;  1GLP A;  2C0G A;  3HJP A;  4EO3 A;  2LQO A;  1TK8 B;  2NPB A;  2B5E A;  1GP1 A;  2VL3 A;  3KP8 A;  1UVZ A;  8GSS A;  1NSW A;  4QL9 A;  1ZYE A;  2YJ7 A;  5J4U A;  2MMA A;  4KCA A;  3R2Q A;  2PUK C;  2M46 A;  3ED3 A;  1SD9 A;  5A34 A;  4K8M A;  1Z6N A;  3TKP A;  3ZVJ D;  3HY2 A;  3E0U A;  3ZML A;  3MSZ A;  3WYW A;  3HVS A;  1EP7 A;  3LXT A;  2X49 A;  3FW2 A;  1OKD A;  4OFT A;  3LG6 A;  2CZ3 A;  2LS5 A;  4EE0 A;  4TXO A;  3GL3 A;  5D9T A;  1GRX A;  2YWM A;  3CHX C;  4ZIL A;  2L4Q A;  4I6X A;  5CRW A;  4ZB8 A;  2X8C A;  4BL7 A;  4H86 A;  2LV3 A;  1ZYQ B;  3GTU A;  4NPB A;  4Q5N A;  4MPG A;  1XXU A;  3IV4 A;  4GDF A;  4MMM A;  3LW9 A;  4GQF A;  5CRE A;  2VLU A;  1R5A A;  2BTO T;  3TKR A;  5ECS A;  2IL3 A;  2WVX A;  3FYG A;  1AQX A;  1YEP A;  2KHP A;  3TKS A;  3L9S A;  5G1K A;  1PA3 A;  4WR4 A;  3ERG A;  1XW5 A;  4V2M A;  1TKD B;  3DKS A;  2C80 A;  2JZS A;  2IPA A;  2O5V A;  4TXO B;  5KN2 A;  2AYT A;  1FOV A;  1X9S B;  2IIY A;  3H1N A;  4F0C A;  4BL7 B;  4K7N A;  6GSX A;  2OKA A;  5G30 A;  2LST A;  3VI7 A;  5H5Q A;  3GX0 A;  4FIW A;  3LOR A;  4WF5 A;  3D6I A;  4ZXG A;  4L5O A;  5BRT A;  3FK8 A;  4KSO A;  4N30 A;  2VKZ G;  4K9Z A;  2VD1 A;  2X99 A;  1V58 A;  3F3R A;  5L71 A;  2WVX B;  2VO4 A;  12GS A;  3I6A A;  2QC7 A;  3HXS A;  1DE2 A;  2R37 A;  3DEX A;  2WZ9 A;  4AKG A;  2NVL A;  3DVW A;  4KGI A;  1O73 A;  1VGL A;  1PL1 A;  1B4Q A;  4ZB7 A;  2FWH A;  2H8L A;  3EUR A;  3E3E A;  1EZK A;  3ZFL A;  3Q74 A;  1M2D A;  2WW1 A;  2VCQ A;  1B9Y C;  1ZGN A;  2DKI A;  2HZE B;  4HQZ A;  3UBK A;  2H1G A;  1GNE A;  1WP0 A;  4TXV A;  4ZBB A;  1JZO A;  1F3B A;  4EL1 A;  3TOT A;  1H75 A;  5CRH A;  5ENU A;  2H0G A;  1O85 A;  2P31 A;  2CVD A;  2DJ0 A;  3IXR A;  2H71 A;  4G0L A;  2N5A A;  1FW1 A;  2HRN A;  4LA1 A;  3UOM A;  4RUV A;  2C1Y A;  1Z3E A;  1FB0 A;  1GL8 A;  5A4V A;  4ULX A;  14GS A;  3UL3 A;  2C0E A;  4FH8 A;  1NM3 A;  3CSI A;  2DIY A;  5D9W A;  4QMK A;  5J40 A;  2WFC A;  2OAC A;  2E7P A;  1K3Y A;  2HT9 A;  1GSS A;  1SEN A;  3W8J A;  1IYI A;  2KP2 A;  4IHU A;  3LFL A;  3KGK A;  2DML A;  1G7E A;  4ML1 A;  1YZX A;  3TJK A;  5F07 A;  5ECI B;  5HR3 A;  4GST A;  4HJM A;  2WB9 A;  4WR5 A;  5GZZ B;  2PWJ A;  5IMV A;  1A2L A;  2LKU A;  4NWY A;  1FOH A;  1OKT A;  3SBC A;  2X4A A;  4KB3 A;  2C0D A;  4V1A g;  3Q18 A;  2HQT A;  2KLX A;  2EFH A;  2VOC A;  3APS A;  4JR4 A;  3D22 A;  3CQF A;  3HDC A;  1TI1 A;  4WKW A;  19GS A;  2LEG A;  2A2S A;  3J7Y k;  1ERW A;  2N5F A;  3IE3 A;  5BMU A;  2WZS A;  3TKS E;  1HNC A;  3MDK A;  2YNX A;  4TN8 A;  3LSZ A;  3ZIJ A;  3EMP A;  5B6M A;  4AJ6 A;  4MF6 A;  1GWC A;  2FUG 2;  2KP1 A;  3TUE A;  4NAX A;  2C0F A;  3Q19 A;  1SL2 B;  2PBJ A;  4DSS A;  2RUF A;  3L9U A;  3PGT A;  4EXJ A;  2TRX A;  1DE1 A;  3EC3 A;  2E0Q A;  4TW5 A;  5J3R A;  4QQ7 A;  1GSE A;  3BCK A;  2ZCT A;  3HYP A;  1PSQ A;  4O5Q A;  1MDJ A;  2CV4 A;  4MCU A;  5JWQ B;  1M9B A;  2BMX A;  3FHK A;  1Z7P A;  5BMU B;  2H6Z A;  1RK4 A;  4JRR A;  4D73 A;  3MNG A;  1O7U A;  1BED A;  3TGZ A;  4I8B A;  1B4P A;  4YKG A;  1OC8 A;  4DVC A;  3FZA A;  3WGD A;  1TU7 A;  1QUW A;  4X0X A;  2AUV A;  1U87 A;  3LJR A;  5HFG A;  4MA9 A;  3WT2 A;  3LYP A;  1OAZ A;  3D4T A;  4AJ8 A;  3F0I A;  1A8Y A;  5ECO B;  4MJB A;  2ON5 A;  2CAQ A;  2V1M A;  5ELA A;  3H8Q A;  3G7J A;  1V98 A;  5DDL A;  2GSS A;  3UEM A;  1Z5Y E;  2V2G A;  2PER A;  2N5B A;  3G7Y A;  4PQH A;  1A2J A;  3KD0 A;  5FWG A;  3U6V A;  2AJQ B;  3M9K A;  1SVM A;  5C00 A;  2R0P A;  4FYC A;  5C04 A;  3VWX A;  2P5R A;  3BOA A;  18GS A;  4NMU A;  2GLR A;  2B6M A;  2OT3 A;  3HJO A;  1URM A;  1X9W B;  2B5X A;  4MNN A;  1CQH A;  1JZW A;  2IME A;  1WPI A;  1SVL A;  2MMN A;  5F05 A;  5A1N A;  2V32 A;  5G1L A;  4F9Z A;  3IHQ A;  1WRY A;  4KX4 A;  4AKH A;  1TI3 A;  3D21 A;  11GS A;  1F3A A;  2F51 A;  1Z9H A;  1SYR A;  5J9C A;  3ZRD A;  4MJA A;  2KUC A;  16GS A;  1K3L A;  4GCI A;  2YJH A;  1XOA A;  1EP8 A;  4K1F A;  3HHV A;  3KP9 A;  3VK9 A;  3LYK A;  2LJK A;  3EE2 A;  1SJI A;  3A2V A;  3TU3 B;  5F0G A;  4OFM A;  1R5P A;  1JLW A;  5IO2 A;  1ERT A;  1BG1 A;  1YEW C;  3MAK A;  1TW9 A;  2VLT A;  2WUL A;  3GMF A;  5A1N B;  5A4W A;  4Q5R A;  3GSS A;  1QFN A;  1TXU A;  5EPF A;  2EFD A;  3IRA A;  4KF9 A;  4TR4 A;  5D96 A;  1R4W A;  2FWE A;  1QXH A;  4HZ2 A;  4TKY A;  3WD6 A;  1G6W A;  4JR6 A;  1TJD A;  2M80 A;  4TR0 A;  4IQA A;  1EGO A;  4FYU A;  4NV5 A;  3FEU A;  3HA9 A;  5GST A;  3KM6 A;  5IMD A;  2L5L A;  2L5O A;  3ZTL A;  2EIO A;  3KMO A;  3HVN A;  4F2I A;  5D9X A;  4F03 A;  4K5S A;  5E4W A;  2B1L A;  3RAZ A;  2H1B A;  5J4Y A;  1VF3 A;  4GTU A;  5KOX A;  5G5E A;  2L6D A;  2JSZ A;  4QL7 A;  4MH2 A;  1BJX A;  1ON4 A;  4IJI A;  1EV9 A;  1RW1 A;  4HQS A;  4KDY A;  2HSN A;  3A5I A;  3FKF A;  4O5R A;  2O36 A;  5CO3 A;  2MYG A;  4G0I A;  4I5Q A;  2HFD A;  1SKW B;  1KNG A;  4LL1 B;  1VF1 A;  6GSS A;  2LJA A;  4KW6 A;  4PI2 C;  5G31 A;  2IWT A;  5D73 A;  1PRX A;  3LWA A;  2HXK A;  1GTI A;  2MBS A;  3NIV A;  2H1A A;  5EY6 A;  2QKE A;  2WS2 A;  1GNW A;  2REM A;  3IPZ A;  4L0U A;  1VF4 A;  4RI6 A;  4PI0 C;  3ERF A;  9GSS A;  3L9V A;  2C4J A;  3GH9 A;  4PUR A;  2QA2 A;  1K0D A;  4JZQ A;  5INY A;  2K9F A;  2AB6 A;  1K0O A;  3ZZX A;  4PQ1 A;  1ML6 A;  3LXZ A;  2H70 A;  1A0R P;  2H0I A;  1ERV A;  2A2P A;  2HSN B;  4JED A;  5CRG A;  4ZBA A;  1B48 A;  4LLR A;  4CDO A;  5IQY A;  4HJ2 A;  3BD2 A;  1U88 A;  3VFI A;  4XRD A;  1PKZ A;  1SVO A;  4PUF C;  3EPT A;  5D9V A;  5KOW A;  1FB6 A;  4MZW A;  2VM1 A;  4EKZ A;  1JZR A;  4OO5 A;  1V40 A;  4I2T A;  4BVY A;  3P2A A;  3RPP A;  4EDZ A;  2O3E A;  5ECM B;  4O5U A;  3IAM 2;  3IHG A;  4K7I A;  2XPD A;  1N8J A;  3BCI A;  5ECQ B;  3QMX A;  2B3S A;  5HR2 A;  3CSJ A;  1VRS D;  3RDW A;  3UAR A;  4J57 E;  4G01 A;  3IR4 A;  2HRF A;  2DLX A;  5A34 B;  3HVX A;  1B9X C;  4XHM A;  2YWI A;  3HMJ G;  4YH2 A;  3DGQ A;  3D4M A;  2GQK A;  2MMZ A;  5IMC A;  2G2Q A;  1OE7 A;  1FG4 A;  3ZIV A;  4J2F A;  5AIS A;  1BG5 A;  5JCW A;  5DJL A;  3E9J B;  2H01 A;  2H76 A;  4BVY B;  1WJK A;  5H5R A;  4KE3 A;  2O85 A;  1ILO A;  1AAZ A;  1J08 A;  2K18 A;  4HI7 A;  3EVI A;  4L8E A;  4WBJ A;  2LTK A;  5B8B A;  3QR6 A;  3O3T A;  4MH3 A;  2YV7 A;  3GTU B;  5D93 A;  1CQG A;  4MPF A;  3GFK A;  2VCX A;  2H6Y A;  3HZ8 A;  1GLQ A;  4IBP A;  3UMA A;  4ZIJ A;  4O92 A;  2RM5 A;  2XBI A;  2P0G A;  3P8W A;  3DIE A;  2GS3 A;  1K0C A;  3PR8 A;  3DD3 A;  3HVV A;  4EC0 A;  4IEL A;  1SJZ A;  2QGV A;  2IN3 A;  5E59 A;  2TRC P;  1OVN A;  2YAN A;  3M3M A;  3IC8 A;  1TP9 A;  2EIQ A;  3GYK A;  1MDK A;  2PN8 A;  4K0N A;  1QGV A;  1ERU A;  4BWQ A;  3EU3 A;  3VUR A;  4A5P A;  1YF1 A;  1O8W A;  1X5C A;  2QA1 A;  1M9A A;  4ISD A;  1SK0 A;  2WVZ A;  3ZRE A;  5ECP B;  4HS1 A;  1GUH A;  3TCO A;  3FR3 A;  3KCM A;  1UN2 A;  5ELG A;  1YEX A;  5EVO A;  2JSY A;  3C8E A;  4EVM A;  3GKM A;  3GL5 A;  1W4V A;  2BJX A;  1J0F A;  2R2J A;  1THX A;  1WOU A;  2EIR A;  5JCU A;  4POL A;  5ID2 A;  4N0V A;  1SL0 B;  1K0A A;  1X9M B;  1I9D A;  1XW6 A;  2C3T A;  2HI7 A;  3GUR A;  5IO0 A;  4RQR A;  1TK0 B;  3C7M A;  2LNT A;  3QFB C;  2K8V A;  1BQ7 A;  4NXI A;  2IMI A;  2X8G A;  4KH7 A;  1ZL9 A;  3CYN A;  4KDU A;  3CTF A;  3KIJ A;  4L0W A;  5ECN B;  4OCF A;  3QOU A;  3KH7 A;  1USB A;  4EIQ A;  3QAG A;  3RBT A;  2PVQ A;  5HR0 A;  3CRU A;  3IK7 A;  5IMZ A;  1WE0 A;  4OCE A;  3NZN A;  2GDR A;  4CHS A;  3LGC A;  2OJL A;  4XS6 A;  1TOF A;  2ZNM A;  3J7Y b;  3F4S A;  5CRD A;  3UBL A;  1QQ2 A;  4OWY A;  4N10 A;  5ID2 B;  3I9V 2;  3TJJ A;  1H4O A;  2CAI A;  4Q5Q A;  1V57 A;  4CY8 A;  2NDO A;  2DBC A;  2WW3 A;  4N11 A;  3UVT A;  2FA4 A;  5DAK A;  2WW2 A;  2CX3 A;  2H1D A;  3US3 A;  1WMJ A;  3FR9 A;  3TRX A;  1K0M A;  2VIM A;  3TRQ A;  3F9U A;  2F8A A;  4YQU A;  4F0B A;  2WVY A;  2GST A;  1Q4J A;  1TK5 B;  4TR3 A;  3GHA A;  4W66 A;  2OBI A;  2GSQ A;  4E8E A;  1ZYN A;  2PVO C;  1ZYP A;  2ZUP A;  4YKF A;  2B7J A;  2CVB A;  4V1A p;  5FHI A;  2GSR A;  1FVK A;  5GAP D;  3QAW A;  5IMA A;  1AC1 A;  1O6J A;  2O8V B;  5CYY A;  2DJ2 A;  4NHZ A;  4DEJ A;  1OC3 A;  3GIX A;  2K6V A;  3RFR C;  1KEB A;  3WGX A;  3FZ9 A; 
#chains in the Genus database with same CATH homology
 4MF5 A;  1F2E A;  4CY6 A;  4FYB A;  5HFK A;  1DBY A;  1F37 A;  3G7I A;  4PQI A;  2VCT A;  5A5K A;  2E2G A;  4HEA 2;  1EV4 A;  5A5H A;  3KMN A;  1ZCP A;  1ZZY A;  2Z9S A;  4G9H A;  3I43 A;  5DCG A;  2VL2 A;  4I2U A;  4PNF A;  2YWN A;  1PGT A;  4USS A;  2YN1 A;  4DSS B;  1XPV A;  4PXO A;  4HZ4 A;  4AF2 A;  2YCD A;  2IFQ A;  4GF0 A;  5J9B A;  4ECI A;  4YAP A;  3JCM L;  2YP6 A;  4KDX A;  3VWW A;  1DUG A;  3GKN A;  2JL4 A;  1Z6M A;  2B5Y A;  3I69 A;  3ZIT A;  3ZL5 A;  1S3C A;  1GSF A;  4WET A;  1HD2 A;  1NHY A;  3RHC A;  1C72 A;  2HE3 A;  4ECC A;  4D73 B;  3TJF A;  1TRV A;  4MLY A;  1XFL A;  6GSU A;  5A5H B;  3GN3 A;  2FWF A;  2ALB A;  3UVH A;  2O89 A;  2J9H A;  4BWS A;  1GUL A;  1GH2 A;  1A24 A;  4IQ1 A;  3VWU A;  2IFQ B;  3EU4 A;  2HLS A;  4GWR A;  5ECH B;  4N3Z A;  1GTB A;  4DSR A;  2OE0 A;  4TR1 A;  2IMK A;  3MYD A;  4ZL9 A;  2B7K A;  5HFI A;  2X8H A;  1X5E A;  3BBY A;  1A8L A;  1K0N A;  1PQN A;  3C1R A;  4RQX A;  3F63 A;  2V6O A;  2RM6 A;  3GA4 A;  4POK A;  4IKH A;  1GSU A;  1X5D A;  1YF0 A;  4XS4 A;  2I3Y A;  4FO5 A;  4IJ3 A;  1M99 A;  3IA1 A;  2KOK A;  4K5R A;  3ZMK A;  2R0G A;  3DXB A;  2X64 A;  3KXO A;  6GSY A;  2FCH A;  2NBS A;  3GH6 A;  4ZL8 A;  3M8N A;  1XOB A;  1WIK A;  3TKQ A;  2JAC A;  3KEB A;  3R3E A;  7GSS A;  2DKH A;  2WDU A;  5COH A;  4AI6 A;  3RHB A;  4TR1 B;  2D2Z A;  3DML A;  3WGE A;  1EEM A;  3M1G A;  3VI5 A;  4PUA A;  1TRU A;  1IYH A;  3TRP A;  5IOW A;  1T4Z A;  1M2B A;  3CBU A;  3GKK A;  3CSH A;  1M7T A;  2O87 A;  2OA7 A;  3C73 A;  4XS4 B;  2VCV A;  1G7O A;  2HSY A;  2B1K A;  2WCI A;  1Y6E A;  3W6G A;  1GSY A;  1MDI A;  1SK2 A;  5H5S A;  4CW9 A;  2RLI A;  3MIX A;  4MZC A;  4PX1 A;  1PN0 A;  1K0B A;  2R3X A;  1T1V A;  2C8U A;  3ME8 A;  4K2D A;  3EWL A;  3CTG A;  1XZO A;  5DQY A;  3GRX A;  4AJ7 A;  2HRK A;  3ZFB A;  1G0T A;  2VLV A;  4WXT A;  1E2Y A;  5GAN D;  1B8X A;  3P90 A;  1BX9 A;  4EF0 A;  3APQ A;  2PMT A;  2XPE A;  1YQ1 A;  13GS A;  3IBH A;  1A2M A;  3DYR A;  4ECB A;  1EEJ A;  4G10 A;  1T00 A;  4K0G A;  2JZT A;  1W89 A;  1RQM A;  3O6T A;  1TU8 A;  3M9J A;  5AGY A;  1T7P B;  1BAY A;  4V2N A;  2VL9 A;  2GZP A;  3PIN A;  2DSA A;  1AW9 A;  4MDC A;  5DJM A;  2HSH A;  3QCP A;  2GZZ A;  4OO4 A;  3CRT A;  3QPM A;  1JFU A;  1EGR A;  1XWK A;  4DSQ A;  4XIH A;  5G2Z A;  4KUN A;  1EOG A;  2HRK B;  4NHW A;  5J5N A;  2FWG A;  2LNS A;  1BYE A;  5ABR A;  2DJK A;  4MJC A;  1U3A A;  4HUA A;  1SD8 A;  2I81 A;  3WT1 A;  4FQU A;  2AV4 A;  5DCH A;  2LJR A;  4IP1 A;  2RII A;  2L59 A;  3H93 A;  4TRX A;  2EFC A;  1XCC A;  2ON7 A;  2GVP A;  2F9S A;  3HJM A;  3F4R A;  2E2M A;  2LRT A;  1XWC A;  1GUK A;  4ML6 A;  4KND A;  2XBQ A;  4EUY A;  3H79 A;  4ICY A;  4MP4 A;  5DBQ A;  1XVW A;  2FA8 A;  1UA5 A;  4X1U A;  3QFA C;  1UC7 A;  4AKX B;  6GSV A;  4GSS A;  1GUM A;  4GRF A;  1WWJ A;  2MMO A;  2PPT A;  3GV1 A;  2H0H A;  2WGR A;  3EYT A;  4IVF A;  3ERW A;  2DJJ A;  3C71 A;  2K8S A;  4Z2T A;  3UAP A;  3IOS A;  4Z2U A;  1HNB A;  5J41 A;  3O76 A;  5B7C A;  1F6M C;  5KN1 A;  2A4H A;  1O8X A;  2EFE A;  2CZ2 A;  1PN9 A;  1O81 A;  3KTB A;  2F8F A;  3TKS C;  5CAX A;  3P7X A;  5HR1 A;  3TJB A;  3F3Q A;  5IOX A;  1EWX A;  2OBK A;  3MWH A;  3IC4 A;  4ZB9 A;  4IP6 A;  2FLS A;  3AY8 A;  1Y25 A;  1XVQ A;  4JU5 A;  4XTS A;  2AAW A;  3F8U A;  3HKR A;  2J23 A;  1OC9 A;  2CT6 A;  4LL4 B;  2V41 A;  2OE3 A;  1S3D A;  4P3Y B;  4WF4 A;  1FHE A;  4GSN A;  3LQ7 A;  3F4T A;  2O7K A;  4Z7X A;  2HZE A;  1SJ6 A;  2R4V A;  3OR5 A;  2OE1 A;  2VM2 A;  1A23 A;  1J9B A;  2PU9 C;  1XWA A;  3S9F A;  5AIV A;  3G9B A;  4MJE A;  5FT3 A;  1M2A A;  2VAF A;  2H66 A;  5J47 A;  5IMF A;  3ZYW A;  5A4U A;  2IJY A;  4F82 A;  1VF2 A;  4PGT A;  5ECR B;  4HU9 A;  4POB A;  1V2A A;  3D5J A;  1LBK A;  2C3Q A;  1AQW A;  3C1S A;  2YPM A;  1AUC A;  2DIZ A;  1OC9 B;  2VCZ A;  2PGT A;  2LQQ A;  5KN3 A;  2H19 A;  2MBT A;  1GSD A;  3SWL A;  4YQV A;  3CWG A;  3GKX A;  1FAA A;  1XBS A;  2LRN A;  1KBN A;  2R6K A;  22GS A;  2C3N A;  4OD7 A;  3QAV A;  2L6C A;  4BPY A;  5AIX A;  2H30 A;  4V2L A;  4PTS A;  4TVE A;  5CNW A;  2EC4 A;  2UZ8 A;  4AKI A;  3PH9 A;  4PNG A;  1AXD A;  4GLT A;  3FZ4 A;  3HZ4 A;  4J56 E;  3TJG A;  1LJR A;  1MEK A;  5ECK B;  3U5R E;  1YDK A;  4E8H A;  3F6D A;  5AN1 A;  1MTC A;  3CXG A;  2H72 A;  3D0Z A;  2HNL A;  1SKR B;  5HQP A;  1PKW A;  2LRC A;  3UIW A;  1THO A;  2IMF A;  2YOI A;  4TOP A;  4OMV A;  6GSW A;  4O32 A;  2M72 A;  4I97 A;  1TXX A;  4MAB A;  1SK1 A;  1DSB A;  1K3O A;  2CVK A;  3DVX A;  1XW9 A;  4Q5F A;  3GNJ A;  2G0F A;  4OFN A;  2CA8 A;  20GS A;  5DQS A;  2GQM A;  1M0U A;  4ZB6 A;  2HZF A;  4X43 A;  3ZLP A;  5F06 A;  2I4A A;  2CX4 A;  2YWO A;  1PL2 A;  2QSI A;  5DAK B;  5GSS A;  1JZD A;  3QD9 A;  5IM9 A;  4ECJ A;  5B6N A;  1T3B A;  2OAD A;  3TB2 A;  2JAD A;  3GUS A;  1FO5 A;  1Q98 A;  3HCZ A;  1E6B A;  3ISO A;  1NHO A;  1GSQ A;  2HRA A;  4K2X A;  1PMT A;  2NTO A;  2A4V A;  5EL8 A;  1R26 A;  5D8I A;  4GQC A;  2A2R A;  4BVX A;  3V1W A;  3EMX A;  2VL2 C;  1XWB A;  4XCS A;  1YKC A;  3FR6 A;  3VPQ A;  1MD3 A;  2JU5 A;  2LUS A;  4XRA A;  3K8N A;  3N5O A;  2VCW A;  3GST A;  1HNA A;  4RI7 A;  2FHE A;  1SYX A;  3A2X A;  2VD0 A;  3IDV A;  3TOU A;  4HU7 A;  3FY7 A;  1PX7 A;  1TTZ A;  2GTU A;  4LMV A;  2YZH A;  3QDN A;  1T4Y A;  5CP1 A;  17GS A;  1Y1U A;  5JWR B;  1HYU A;  2H74 A;  1V9W A;  3BJ5 A;  5JCG A;  1R7H A;  2H73 A;  1TRS A;  4KAE A;  2IMD A;  1JLV A;  3FZ5 A;  1XWG A;  2H6X A;  5F8B A;  2WRT A;  4BVX B;  1TRW A;  2UV8 G;  1QMV A;  1HQO A;  1SKS B;  1BF5 A;  3PPU A;  2FD3 A;  4IN0 A;  1G6Y A;  4ZL7 A;  1ZMA A;  3L0H A;  4AGS A;  2TIR A;  3APO A;  1LU4 A;  1T8E B;  3A5W A;  3LEF A;  5J4V A;  4MZB A;  2FY6 A;  1YY7 A;  5B8A A;  1S3A A;  1FVJ A;  5DAL A;  4K7O A;  4ACS A;  2YZU A;  2VUP A;  4ZBD A;  4XS1 A;  4IS0 A;  2HSM A;  4EDY A;  3L78 A;  2L57 A;  4Z2R A;  5DVB A;  2CQ9 A;  4JBB A;  1QK8 A;  4LMW A;  1JHB A;  3VPT A;  4MK3 A;  2V6K A;  1MD4 A;  4WBR D;  3L4N A;  4G0K A;  3A3T A;  3IK9 A;  3ZVJ A;  4HOJ A;  1ZOF A;  5LNK e;  4BA7 A;  1KTE A;  4L5L A;  1N2A A;  1PD2 1;  1U3I A;  2FGX A;  1GTU A;  4O7H A;  1SU9 A;  3ME7 A;  2MZC A;  3KJY A;  2XHF A;  3RPN A;  1ST9 A;  5DAL B;  2HSM B;  4N0Z A;  6GST A;  1Z7R A;  3EIN A;  4IW9 A;  1ACV A;  2H1L A;  3KH9 A;  2JZR A;  3FMW A;  4KSM A;  1OYJ A;  10GS A;  1ABA A;  1YJ6 A;  3TDG A;  2ES7 A;  2GT6 A;  1YVL A;  4MF7 A;  2F3M A;  5KEJ A;  2I9H A;  5KN0 A;  4G19 A;  2RUE A;  4NV2 A;  4IGJ A;  2DMM A;  3CMI A;  3DRN A;  4ILF A;  3GX8 A;  5G5F A;  2GQL A;  2GZY A;  5LD0 A;  3A2W A;  3FRC A;  3H4K A;  4YQM A;  3HD5 A;  5ECL B;  1EOH A;  3KZQ A;  1YKA A;  5IPH A;  3KTL A;  2R5G A;  2YV9 A;  4X4J A;  4EIP A;  5JWO B;  4K6X A;  1NW2 A;  2P5Q A;  4WEY A;  4E68 A;  2HYX A;  4KA0 A;  5IIZ A;  1F9M A;  1I5G A;  1N25 A;  3IAS 2;  1TDI A;  4JE1 A;  1GTA A;  5LCZ A;  4HDE A;  2FNO A;  2L4C A;  1PX6 A;  3DWV A;  2DC5 A;  4GXZ A;  4G2E A;  1OE8 A;  4KCE A;  3W8S A;  1AIU A;  3Q6O A;  4POM A;  1U6T A;  1A0F A;  2GGT A;  3F6F A;  1X0R A;  2DJ1 A;  1XIY A;  2WJU A;  2R0C A;  3VWV A;  2XC2 A;  5IPG A;  2I1U A;  2H75 A;  1AQV A;  3M0F A;  2DJ3 A;  2AHE A;  3N9J A;  3UJ1 A;  2GT5 A;  4ID0 A;  3VLN A;  3NOF A;  1SL1 B;  4YAV A;  1GLP A;  2C0G A;  3HJP A;  4EO3 A;  2LQO A;  1TK8 B;  2NPB A;  2B5E A;  1GP1 A;  2VL3 A;  3KP8 A;  1UVZ A;  8GSS A;  1NSW A;  4QL9 A;  1ZYE A;  2YJ7 A;  5J4U A;  2MMA A;  4KCA A;  3R2Q A;  2PUK C;  2M46 A;  3ED3 A;  1SD9 A;  5A34 A;  4K8M A;  1Z6N A;  3TKP A;  3ZVJ D;  3HY2 A;  3E0U A;  3ZML A;  3MSZ A;  3WYW A;  3HVS A;  1EP7 A;  3LXT A;  2X49 A;  3FW2 A;  1OKD A;  4OFT A;  3LG6 A;  2CZ3 A;  2LS5 A;  4EE0 A;  4TXO A;  3GL3 A;  5D9T A;  1GRX A;  2YWM A;  4ZIL A;  2L4Q A;  4I6X A;  5CRW A;  4ZB8 A;  2X8C A;  4BL7 A;  4H86 A;  2LV3 A;  1ZYQ B;  3GTU A;  4NPB A;  4Q5N A;  4MPG A;  1XXU A;  3IV4 A;  4GDF A;  4MMM A;  3LW9 A;  4GQF A;  5CRE A;  2VLU A;  1R5A A;  2BTO T;  3TKR A;  5ECS A;  2IL3 A;  3FYG A;  1AQX A;  1YEP A;  2KHP A;  3TKS A;  3L9S A;  5G1K A;  1PA3 A;  4WR4 A;  3ERG A;  1XW5 A;  4V2M A;  1TKD B;  3DKS A;  2C80 A;  2JZS A;  2IPA A;  2O5V A;  4TXO B;  5KN2 A;  2AYT A;  1FOV A;  1X9S B;  2IIY A;  3H1N A;  4F0C A;  4BL7 B;  4K7N A;  6GSX A;  2OKA A;  5G30 A;  2LST A;  3VI7 A;  5H5Q A;  3GX0 A;  4FIW A;  3LOR A;  4WF5 A;  3D6I A;  4ZXG A;  4L5O A;  5BRT A;  3FK8 A;  4KSO A;  4N30 A;  2VKZ G;  4K9Z A;  2VD1 A;  2X99 A;  1V58 A;  3F3R A;  5L71 A;  2VO4 A;  12GS A;  3I6A A;  2QC7 A;  3HXS A;  1DE2 A;  2R37 A;  3DEX A;  2WZ9 A;  4AKG A;  2NVL A;  3DVW A;  4KGI A;  1O73 A;  1VGL A;  1PL1 A;  1B4Q A;  4ZB7 A;  2FWH A;  2H8L A;  3EUR A;  3E3E A;  1EZK A;  3ZFL A;  3Q74 A;  1M2D A;  2VCQ A;  1B9Y C;  1ZGN A;  2DKI A;  2HZE B;  4HQZ A;  3UBK A;  2H1G A;  1GNE A;  1WP0 A;  4TXV A;  4ZBB A;  1JZO A;  1F3B A;  4EL1 A;  3TOT A;  1H75 A;  5CRH A;  5ENU A;  2H0G A;  1O85 A;  2P31 A;  2CVD A;  2DJ0 A;  3IXR A;  2H71 A;  4G0L A;  2N5A A;  1FW1 A;  2HRN A;  4LA1 A;  3UOM A;  4RUV A;  2C1Y A;  1Z3E A;  1FB0 A;  1GL8 A;  5A4V A;  4ULX A;  14GS A;  3UL3 A;  2C0E A;  4FH8 A;  1NM3 A;  3CSI A;  2DIY A;  5D9W A;  4QMK A;  5J40 A;  2WFC A;  2OAC A;  2E7P A;  1K3Y A;  2HT9 A;  1GSS A;  1SEN A;  3W8J A;  1IYI A;  2KP2 A;  4IHU A;  3LFL A;  3KGK A;  2DML A;  1G7E A;  4ML1 A;  1YZX A;  3TJK A;  5F07 A;  5ECI B;  5HR3 A;  4GST A;  4HJM A;  2WB9 A;  4WR5 A;  5GZZ B;  2PWJ A;  5IMV A;  1A2L A;  2LKU A;  4NWY A;  1FOH A;  1OKT A;  3SBC A;  2X4A A;  4KB3 A;  2C0D A;  4V1A g;  3Q18 A;  2HQT A;  2KLX A;  2EFH A;  2VOC A;  3APS A;  4JR4 A;  3D22 A;  3HDC A;  1TI1 A;  4WKW A;  19GS A;  2LEG A;  2A2S A;  3J7Y k;  1ERW A;  2N5F A;  3IE3 A;  5BMU A;  3TKS E;  1HNC A;  3MDK A;  2YNX A;  4TN8 A;  3LSZ A;  3ZIJ A;  3EMP A;  5B6M A;  4AJ6 A;  4MF6 A;  1GWC A;  2FUG 2;  2KP1 A;  3TUE A;  4NAX A;  2C0F A;  3Q19 A;  1SL2 B;  2PBJ A;  4DSS A;  2RUF A;  3L9U A;  3PGT A;  4EXJ A;  2TRX A;  1DE1 A;  3EC3 A;  2E0Q A;  4TW5 A;  5J3R A;  4QQ7 A;  1GSE A;  3BCK A;  2ZCT A;  3HYP A;  1PSQ A;  4O5Q A;  1MDJ A;  2CV4 A;  4MCU A;  5JWQ B;  1M9B A;  2BMX A;  3FHK A;  1Z7P A;  5BMU B;  2H6Z A;  1RK4 A;  4JRR A;  4D73 A;  3MNG A;  1O7U A;  1BED A;  3TGZ A;  4I8B A;  1B4P A;  4YKG A;  1OC8 A;  4DVC A;  3FZA A;  3WGD A;  1TU7 A;  1QUW A;  4X0X A;  2AUV A;  1U87 A;  3LJR A;  5HFG A;  4MA9 A;  3WT2 A;  3LYP A;  1OAZ A;  3D4T A;  4AJ8 A;  3F0I A;  1A8Y A;  5ECO B;  4MJB A;  2ON5 A;  2CAQ A;  2V1M A;  5ELA A;  3H8Q A;  3G7J A;  1V98 A;  5DDL A;  2GSS A;  3UEM A;  1Z5Y E;  2V2G A;  2PER A;  2N5B A;  3G7Y A;  4PQH A;  1A2J A;  3KD0 A;  5FWG A;  3U6V A;  2AJQ B;  3M9K A;  1SVM A;  5C00 A;  2R0P A;  4FYC A;  5C04 A;  3VWX A;  2P5R A;  3BOA A;  18GS A;  4NMU A;  2GLR A;  2B6M A;  2OT3 A;  3HJO A;  1URM A;  1X9W B;  2B5X A;  4MNN A;  1CQH A;  1JZW A;  2IME A;  1WPI A;  1SVL A;  2MMN A;  5F05 A;  5A1N A;  2V32 A;  5G1L A;  4F9Z A;  3IHQ A;  1WRY A;  4KX4 A;  4AKH A;  1TI3 A;  3D21 A;  11GS A;  1F3A A;  2F51 A;  1Z9H A;  1SYR A;  5J9C A;  3ZRD A;  4MJA A;  2KUC A;  16GS A;  1K3L A;  4GCI A;  2YJH A;  1XOA A;  1EP8 A;  4K1F A;  3HHV A;  3KP9 A;  3VK9 A;  3LYK A;  2LJK A;  3EE2 A;  1SJI A;  3A2V A;  3TU3 B;  5F0G A;  4OFM A;  1R5P A;  1JLW A;  5IO2 A;  1ERT A;  1BG1 A;  3MAK A;  1TW9 A;  2VLT A;  2WUL A;  3GMF A;  5A1N B;  5A4W A;  4Q5R A;  3GSS A;  1QFN A;  1TXU A;  5EPF A;  2EFD A;  3IRA A;  4KF9 A;  4TR4 A;  5D96 A;  1R4W A;  2FWE A;  1QXH A;  4HZ2 A;  4TKY A;  3WD6 A;  1G6W A;  4JR6 A;  1TJD A;  2M80 A;  4TR0 A;  4IQA A;  1EGO A;  4FYU A;  4NV5 A;  3FEU A;  3HA9 A;  5GST A;  3KM6 A;  5IMD A;  2L5L A;  2L5O A;  3ZTL A;  2EIO A;  3KMO A;  4F2I A;  5D9X A;  4F03 A;  4K5S A;  5E4W A;  2B1L A;  3RAZ A;  2H1B A;  5J4Y A;  1VF3 A;  4GTU A;  5KOX A;  5G5E A;  2L6D A;  2JSZ A;  4QL7 A;  4MH2 A;  1BJX A;  1ON4 A;  4IJI A;  1EV9 A;  1RW1 A;  4HQS A;  4KDY A;  2HSN A;  3A5I A;  3FKF A;  4O5R A;  5CO3 A;  2MYG A;  4G0I A;  4I5Q A;  2HFD A;  1SKW B;  1KNG A;  4LL1 B;  1VF1 A;  6GSS A;  2LJA A;  4KW6 A;  5G31 A;  2IWT A;  5D73 A;  1PRX A;  3LWA A;  2HXK A;  1GTI A;  2MBS A;  3NIV A;  2H1A A;  5EY6 A;  2QKE A;  2WS2 A;  1GNW A;  2REM A;  3IPZ A;  4L0U A;  1VF4 A;  4RI6 A;  3ERF A;  9GSS A;  3L9V A;  2C4J A;  3GH9 A;  4PUR A;  2QA2 A;  1K0D A;  4JZQ A;  5INY A;  2K9F A;  2AB6 A;  1K0O A;  3ZZX A;  4PQ1 A;  1ML6 A;  3LXZ A;  2H70 A;  1A0R P;  2H0I A;  1ERV A;  2A2P A;  2HSN B;  4JED A;  5CRG A;  4ZBA A;  1B48 A;  4LLR A;  4CDO A;  5IQY A;  4HJ2 A;  3BD2 A;  1U88 A;  3VFI A;  4XRD A;  1PKZ A;  1SVO A;  4PUF C;  3EPT A;  5D9V A;  5KOW A;  1FB6 A;  4MZW A;  2VM1 A;  4EKZ A;  1JZR A;  4OO5 A;  1V40 A;  4I2T A;  4BVY A;  3P2A A;  3RPP A;  4EDZ A;  5ECM B;  4O5U A;  3IAM 2;  3IHG A;  4K7I A;  2XPD A;  1N8J A;  3BCI A;  5ECQ B;  3QMX A;  2B3S A;  5HR2 A;  3CSJ A;  1VRS D;  3RDW A;  3UAR A;  4J57 E;  4G01 A;  3IR4 A;  2HRF A;  2DLX A;  5A34 B;  3HVX A;  1B9X C;  4XHM A;  2YWI A;  3HMJ G;  4YH2 A;  3DGQ A;  3D4M A;  2GQK A;  2MMZ A;  5IMC A;  2G2Q A;  1OE7 A;  1FG4 A;  3ZIV A;  4J2F A;  5AIS A;  1BG5 A;  5JCW A;  5DJL A;  3E9J B;  2H01 A;  2H76 A;  4BVY B;  1WJK A;  5H5R A;  4KE3 A;  2O85 A;  1ILO A;  1AAZ A;  1J08 A;  2K18 A;  4HI7 A;  3EVI A;  4L8E A;  4WBJ A;  2LTK A;  5B8B A;  3QR6 A;  3O3T A;  4MH3 A;  2YV7 A;  3GTU B;  5D93 A;  1CQG A;  4MPF A;  3GFK A;  2VCX A;  2H6Y A;  3HZ8 A;  1GLQ A;  4IBP A;  3UMA A;  4ZIJ A;  4O92 A;  2RM5 A;  2XBI A;  2P0G A;  3P8W A;  3DIE A;  2GS3 A;  1K0C A;  3PR8 A;  3DD3 A;  3HVV A;  4EC0 A;  4IEL A;  1SJZ A;  2QGV A;  2IN3 A;  5E59 A;  2TRC P;  1OVN A;  2YAN A;  3M3M A;  3IC8 A;  1TP9 A;  2EIQ A;  3GYK A;  1MDK A;  2PN8 A;  4K0N A;  1QGV A;  1ERU A;  4BWQ A;  3EU3 A;  3VUR A;  4A5P A;  1YF1 A;  1O8W A;  1X5C A;  2QA1 A;  1M9A A;  4ISD A;  1SK0 A;  3ZRE A;  5ECP B;  4HS1 A;  1GUH A;  3TCO A;  3FR3 A;  3KCM A;  1UN2 A;  5ELG A;  1YEX A;  5EVO A;  2JSY A;  3C8E A;  4EVM A;  3GKM A;  3GL5 A;  1W4V A;  2BJX A;  1J0F A;  2R2J A;  1THX A;  1WOU A;  2EIR A;  5JCU A;  4POL A;  5ID2 A;  4N0V A;  1SL0 B;  1K0A A;  1X9M B;  1I9D A;  1XW6 A;  2C3T A;  2HI7 A;  3GUR A;  5IO0 A;  4RQR A;  1TK0 B;  3C7M A;  2LNT A;  3QFB C;  2K8V A;  1BQ7 A;  4NXI A;  2IMI A;  2X8G A;  4KH7 A;  1ZL9 A;  3CYN A;  4KDU A;  3CTF A;  3KIJ A;  4L0W A;  5ECN B;  4OCF A;  3QOU A;  3KH7 A;  1USB A;  4EIQ A;  3QAG A;  3RBT A;  2PVQ A;  5HR0 A;  3CRU A;  3IK7 A;  5IMZ A;  1WE0 A;  4OCE A;  3NZN A;  2GDR A;  4CHS A;  3LGC A;  2OJL A;  4XS6 A;  1TOF A;  2ZNM A;  3J7Y b;  3F4S A;  5CRD A;  3UBL A;  1QQ2 A;  4OWY A;  4N10 A;  5ID2 B;  3I9V 2;  3TJJ A;  1H4O A;  2CAI A;  4Q5Q A;  1V57 A;  4CY8 A;  2NDO A;  2DBC A;  4N11 A;  3UVT A;  2FA4 A;  5DAK A;  2CX3 A;  2H1D A;  3US3 A;  1WMJ A;  3FR9 A;  3TRX A;  1K0M A;  2VIM A;  3TRQ A;  3F9U A;  2F8A A;  4YQU A;  4F0B A;  2GST A;  1Q4J A;  1TK5 B;  4TR3 A;  3GHA A;  4W66 A;  2OBI A;  2GSQ A;  4E8E A;  1ZYN A;  2PVO C;  1ZYP A;  2ZUP A;  4YKF A;  2B7J A;  2CVB A;  4V1A p;  5FHI A;  2GSR A;  1FVK A;  5GAP D;  3QAW A;  5IMA A;  1AC1 A;  1O6J A;  2O8V B;  5CYY A;  2DJ2 A;  4NHZ A;  4DEJ A;  1OC3 A;  3GIX A;  2K6V A;  3WGX A;  1KEB A;  3FZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...