1GSSA

Three-dimensional structure of class pi glutathione s-transferase from human placenta in complex with s-hexylglutathione at 2.8 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure of class pi glutathione S-transferase from human placenta in complex with S-hexylglutathione at 2.8 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 66
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1992-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gssA01
3TCOA 4FYBA 2H30A 3HZ4A 1XIYA 5J41A 3HCZA 3HVVA 2WDUA 2V6OA 3TJBA 1H4OA 2JZTA 3WGEA 1Z9HA 4ZB8A 3F4TA 1XWKA 2H66A 2QSIA 2VL2A 2YJHA 4K0GA 3APQA 3I69A 2P5RA 1CQGA 1ML6A 3GKNA 2VLUA 5IO2A 4OCFA 1WE0A 3IK9A 3RHCA 1GLQA 4DVCA 2P0GA 4QL9A 1GUMA 3QAGA 3O3TA 4MABA 3UBLA 4F9ZA 4TR0A 4XCSA 2GZYA 5IMZA 3PR8A 2Z9SA 1YF0A 5F07A 3TUEA 1A2LA 4LLRA 1VRSD 4GLTA 4HZ4A 1B9XC 2AHEA 5IMFA 4FYUA 3GSTA 2OACA 3W8SA 4IW9A 4GRFA 1VF2A 2JSZA 2B6MA 5IMVA 6GSVA 3FYGA 2WFCA 2V1MA 1TDIA 2YJ7A 2FA8A 3LWAA 4G2EA 3C1SA 2YP6A 3QR6A 6GSTA 3GKXA 1OE7A 4G0IA 4OCEA 3ZVJD 1M2BA 2FWHA 5DBQA 5F06A 2FWGA 4BVYB 2JSYA 3TJJA 4HQSA 1R4WA 2BTOT 3ZYWA 2VL9A 5ABRA 1PMTA 3GKKA 5JCGA 2HI7A 3GURA 4I6XA 2HFDA 2IMKA 4RI7A 2VOCA 2C0EA 2B1LA 1IYIA 3O76A 1HNCA 3GL5A 1OAZA 3GIXA 2H76A 2H73A 5ECMB 5IIZA 3J7Yb 5AGYA 1ERVA 2GSRA 3M9KA 1U6TA 2HYXA 2L5OA 4BPYA 2F3MA 4I2UA 2F9SA 2FNOA 3H1NA 3A2VA 2IMEA 3EWLA 2O89A 2L4QA 3C73A 5DCGA 3LFLA 4IVFA 4L5OA 4CW9A 3F3QA 4IJ3A 2C8UA 3ERWA 4OWYA 5G31A 2H72A 1O81A 3RDWA 5DDLA 3FEUA 3D21A 3KJYA 1V40A 4YAPA 1M2DA 3KH7A 3UEMA 3WT2A 1YEPA 5AN1A 3EU4A 1TRVA 3ZIJA 1AQVA 2H01A 4EF0A 1AIUA 3IC4A 2FWEA 2H0GA 1XPVA 3KZQA 4K8MA 12GSA 2IL3A 1M2AA 3KTBA 4IBPA 2XBQA 3KGKA 1MDJA 5ELGA 2DJ0A 3DGQA 1G7EA 1SL1B 1GSYA 4Q5FA 1GP1A 2VL3A 1EV4A 5IOWA 4MJCA 1EEJA 3GNJA 3EU3A 4KB3A 1GTAA 2HE3A 4GCIA 4KDYA 2I4AA 4AF2A 2NBSA 4MH2A 4JEDA 2QKEA 1O73A 2FGXA 4NHWA 4OO4A 3D0ZA 2V2GA 4D73A 1R5AA 1XWGA 1G7OA 2HLSA 1THXA 2R4VA 4FQUA 3HVSA 1TTZA 3IR4A 1XWAA 4TRXA 4POLA 2G2QA 2LEGA 1ERTA 3A3TA 3UL3A 5CYYA 4Q5QA 5E59A 1PL2A 2HSMA 5FHIA 1O8WA 1ZZYA 5EPFA 2O87A 4POBA 3CSHA 4L0UA 3HJOA 3IK7A 3ZLPA 3UBKA 4WBJA 3TGZA 4YQVA 1SK1A 3IRAA 5IPHA 1R7HA 2R5GA 1X5DA 3G9BA 2E0QA 3I6AA 2CA8A 2AB6A 1QMVA 1N2AA 2B7JA 4NWYA 1VGLA 1A2JA 5HFGA 4N0VA 1JHBA 1X9SB 3KEBA 4O32A 3M3MA 2VAFA 5DQSA 1QUWA 1OC9B 4KE3A 1TI3A 1X9WB 5ECSA 1M9BA 2DMLA 4NMUA 4EL1A 1QK8A 3ZMKA 2OA7A 5J3RA 4O5RA 2AAWA 3KH9A 4TR1B 3G7JA 2GQMA 2PMTA 2HSNB 3DRNA 4LMVA 5ECRB 1NW2A 1AQXA 3GMFA 1XFLA 4G9HA 1EP7A 1EGRA 1VF1A 1PRXA 5GAPD 2CX4A 3D22A 2LRTA 3TRXA 2DJ1A 3WGXA 5CRDA 5CRWA 3QMXA 1DSBA 1B4PA 1SK2A 1O8XA 3PINA 4JE1A 2I81A 2BJXA 3PH9A 4D73B 4BVXA 3TJGA 3FRCA 1U88A 2YOIA 5D8IA 3VFIA 5H5RA 3Q18A 5DCHA 2CZ2A 4MF6A 4KW6A 1K0BA 4IP6A 2DJKA 1TRWA 2FWFA 2UZ8A 2HZEA 3BJ5A 1GH2A 1G6WA 4FIWA 4GQCA 2VL2C 2HSMB 4NPBA 5ECLB 1YDKA 2PWJA 1GSQA 2F8AA 2L6CA 5CP1A 3FR9A 2VUPA 5G1LA 2XBIA 1TP9A 4IKHA 3IXRA 1QFNA 1DBYA 1FB0A 4ZXGA 1Q4JA 1HQOA 3RBTA 2C4JA 3KP8A 4MK3A 2C80A 4USSA 4XRAA 1DUGA 3NOFA 1ILOA 3FKFA 5CO3A 4ID0A 2E7PA 4EUYA 2VO4A 1SKWB 2VD1A 4F82A 4V1Ap 4X0XA 2X99A 2R2JA 2GZZA 2PVOC 2VM1A 5IQYA 1UA5A 2VCVA 2QC7A 3CBUA 2CAQA 5KN3A 1DE2A 1MTCA 1XW9A 1PKWA 1GSSA 3ISOA 1ZCPA 4OFTA 2VD0A 3IAM2 2B1KA 3NIVA 1Z6MA 4KX4A 2HT9A 1F3BA 1A23A 4GQFA 1KBNA 2YZHA 4ZL9A 5C00A 3L0HA 1PL1A 1E6BA 4RQXA 1ERWA 4NHZA 4WR4A 4KGIA 5GSSA 4ILFA 5EY6A 2YPMA 1GSEA 2ON5A 2VM2A 5A4WA 4GTUA 4TKYA 3R2QA 1A2MA 3F4RA 4I8BA 3IHQA 2ON7A 4XS4B 3HA9A 2H1BA 1K3YA 1ERUA 2KOKA 3M0FA 1GSFA 2FY6A 3VWWA 4BVXB 3WGDA 3QAWA 4ACSA 2FHEA 4WF5A 4DSSB 2CVDA 4MH3A 1AUCA 4YQMA 1Q98A 2P5QA 1ZL9A 3FZ4A 2NVLA 1BG5A 2MMZA 2HZEB 2JZSA 1GL8A 3NZNA 1WPIA 1B4QA 1PA3A 3GFKA 3EMPA 1SJIA 1W4VA 3TRQA 1JZWA 2LJRA 3IE3A 4HDEA 4ML6A 5HQPA 1A8YA 4K7OA 2V32A 4MP4A 5A4UA 2L5LA 2P31A 4AGSA 5G2ZA 2OJLA 3HKRA 4Q5RA 1I9DA 5FT3A 1K0DA 2J9HA 4G19A 4F03A 4PQ1A 1JFUA 4E8EA 1S3AA 4HUAA 1MEKA 4RQRA 3UJ1A 2KP2A 1RW1A 2H70A 2I9HA 2GQKA 2EC4A 5IMAA 5EVOA 6GSSA 2A4VA 2YN1A 3JCML 3TKSE 1TW9A 1FAAA 3GYKA 4H86A 2K6VA 2XC2A 2A2RA 1TOFA 10GSA 1K0NA 3IOSA 2WJUA 1PQNA 1T7PB 3SBCA 5ECQB 4I5QA 2WS2A 1F37A 3S9FA 5HR2A 4MA9A 3LXZA 5F05A 1YKCA 1EZKA 2GT6A 2RIIA 3C1RA 3LGCA 3D6IA 2HZFA 3TOTA 2WGRA 5B8AA 5KN0A 1J08A 1B9YC 2JACA 2B7KA 1V58A 3GN3A 2ZUPA 2HRFA 2LJKA 5CNWA 5D73A 1O7UA 2O7KA 1XW6A 4K1FA 4N30A 4Q5NA 5D9VA 1J0FA 4L5LA 4GWRA 2IMFA 4CDOA 5JWRB 2GT5A 4MZWA 2AYTA 3QPMA 5B6NA 5ECHB 2EIOA 5HFKA 4MJBA 3MWHA 1V57A 1G6YA 2L57A 2QGVA 2YWOA 3QAVA 2YWNA 1FW1A 4ZL8A 3VPTA 5COHA 3TKRA 3UIWA 5F0GA 2MYGA 1SL2B 3CRUA 1HNAA 3AY8A 3UOMA 2A2SA 1ST9A 2DSAA 1EP8A 4X1UA 2REMA 2C3TA 1EEMA 3FZ5A 3LJRA 3DVWA 3A5WA 2GZPA 1BQ7A 2B3SA 4PURA 1GWCA 1Z5YE 1VF4A 4HU9A 3G7IA 3ERGA 2GLRA 4EC0A 2ZNMA 4WXTA 3KIJA 1JZRA 2MBTA 3L9SA 2FCHA 2YNXA 2VCTA 4L0WA 3H93A 1SU9A 2F51A 2O8VB 1OC9A 3ME7A 4PTSA 4AJ8A 1OC3A 1LU4A 1QQ2A 3ME8A 4HJMA 3QFAC 4WKWA 2TRCP 4IQAA 1YKAA 4OFNA 1V2AA 1XWBA 4QL7A 4TR1A 5IMCA 1FOVA 2H1GA 5GZZB 3C71A 5BMUA 4KNDA 3GHAA 2KHPA 4K7NA 1ABAA 3APSA 1FVJA 3D5JA 1UC7A 1UVZA 1BYEA 1B8XA 2RLIA 4XTSA 4GSTA 4HQZA 2MMOA 1A0FA 3DMLA 1K3LA 2WB9A 4EO3A 1WIKA 4ECJA 4HOJA 1K0CA 3UARA 2CVKA 1UN2A 2IWTA 2DMMA 1EGOA 2YV9A 1OKDA 2IN3A 4MZBA 4WF4A 1TJDA 5CRGA 2OBKA 5G30A 3CSJA 4MF5A 1WOUA 4DEJA 3F9UA 3SWLA 5C04A 4KDXA 3MAKA 4K2DA 4HI7A 4MZCA 2GSQA 3GSSA 4WBRD 5E4WA 3UMAA 1KTEA 1OYJA 3TKPA 5IPGA 1WRYA 3ZVJA 4EKZA 3BOAA 2OE3A 2LV3A 2CV4A 3KTLA 1Y6EA 3HJMA 2LKUA 3C8EA 3TJKA 4GSNA 2C0FA 4HEA2 2VCXA 3RHBA 3D4TA 1PX7A 3UAPA 4BL7B 4AJ7A 1T00A 4O7HA 1OKTA 1JLVA 1GTUA 3VI5A 1YJ6A 4P3YB 4JR6A 4TW5A 4IGJA 1K3OA 4KSMA 4RI6A 4J57E 5G5FA 5HFIA 2LRCA 4EE0A 3DWVA 1TU8A 4PQHA 4PNFA 2K8VA 1R5PA 2WZ9A 3M9JA 5JCUA 1USBA 5H5QA 3GH9A 4EXJA 2KP1A 4IN0A 3EINA 4ZIJA 3CXGA 3HY2A 1WMJA 3ED3A 1TRUA 3TDGA 4POMA 4KCAA 2R37A 2LNSA 5ELAA 1AC1A 1PN9A 1XVWA 2GSSA 2LTKA 2X64A 3EMXA 2OADA 1SD9A 2GTUA 1XOBA 3BCKA 4MPGA 4TXVA 3HD5A 2IIYA 3QDNA 2HRAA 2GVPA 1XBSA 4YH2A 2YZUA 1T4YA 4AJ6A 3APOA 2FUG2 2KUCA 3GTUA 3RPNA 1FHEA 2E2GA 2WULA 5JCWA 3G7YA 4XS4A 3L9UA 18GSA 5JWQB 1LBKA 6GSWA 5J9CA 4V2LA 2JL4A 3GRXA 1JZDA 5ENUA 2M80A 2C3QA 5HR0A 1V98A 4DSSA 5D9WA 1S3CA 1RK4A 4XRDA 5F8BA 3FZ9A 2CAIA 3F8UA 4BA7A 2MBSA 5AIXA 1M9AA 4OFMA 4HJ2A 2TRXA 3UVHA 5DALA 3DXBA 3IPZA 2H6ZA 3E3EA 1X5CA 1GTIA 3A2WA 4JU5A 2DJ2A 3ZREA 3P2AA 5ECNB 2PN8A 1SYRA 1O85A 4N11A 1TRSA 2MMNA 4TXOB 2O85A 5AIVA 2H1AA 4MF7A 3DKSA 4MMMA 4OD7A 2YANA 4DSQA 1JLWA 2C3NA 2CT6A 1GTBA 1KNGA 4MJEA 3D4MA 1EOHA 3FK8A 4PGTA 2FD3A 1LJRA 2WRTA 2RM6A 3HXSA 2C1YA 1XZOA 2K18A 3VK9A 2OE1A 5LD0A 1PKZA 5IM9A 1G0TA 1ON4A 5DAKA 2WCIA 4EDYA 2KLXA 5LNKe 4MDCA 4IP1A 3CMIA 3FHKA 3R3EA 3H79A 1EWXA 4I2TA 3LORA 19GSA 3DIEA 1TK8B 3RAZA 2H6XA 4HZ2A 6GSUA 2H19A 4XHMA 1H75A 3F6DA 2H74A 4MCUA 5HR1A 1RQMA 1EOGA 3GTUB 4PQIA 4QQ7A 2DJ3A 3FR6A 4ZB9A 5INYA 3EE2A 4V2NA 5GAND 3CTGA 3HJPA 3TOUA 3US3A 1T1VA 1M99A 3GX8A 4PUFC 4KSOA 4RUVA 1GNEA 2L6DA 2CZ3A 3KMNA 1SKSB 4IJIA 2RUEA 1FG4A 4IELA 1Z7RA 3GX0A 3K8NA 2VCZA 1NHOA 2AUVA 4ML1A 4MJAA 5DALB 1F2EA 2B5EA 3KCMA 20GSA 2ZCTA 3KMOA 1F3AA 2X8CA 2CX3A 3IAS2 1MDIA 4KUNA 1HD2A 2YWIA 3TRPA 1FO5A 4KH7A 2CQ9A 3L78A 1GULA 4N0ZA 2C0GA 2LJAA 4GSSA 3LG6A 3GL3A 2LRNA 2H75A 2VCQA 2XPDA 5JWOB 3TKSA 2M72A 3QFBC 2PVQA 4V2MA 2AV4A 3H8QA 2FA4A 3BBYA 2H1DA 1XW5A 2VLVA 5B6MA 1THOA 3VLNA 1NM3A 2DLXA 5DAKB 5ECPB 1J9BA 4BWSA 1QGVA 2NDOA 4J56E 4N10A 4F2IA 5HR3A 3EURA 1WJKA 1KEBA 5DJMA 2OE0A 2PGTA 4K7IA 1T8EB 4PUAA 3E0UA 3TJFA 5KN2A 1X9MB 4G10A 3U5RE 3VWVA 3LSZA 3V1WA 2F8FA 3F3RA 2FLSA 1TK0B 3DVXA 16GSA 1Z7PA 1O6JA 1K0MA 5ECKB 1VF3A 4OMVA 1TXXA 1E2YA 1MD3A 1URMA 4CHSA 3W8JA 2PERA 3GH6A 4TN8A 5G5EA 5KEJA 2IPAA 2RUFA 1DE1A 3A2XA 4MPFA 2HXKA 3P7XA 2R3XA 2I1UA 2JU5A 1XXUA 1BJXA 2X8HA 3DYRA 3Q6OA 1AXDA 5D9XA 1ZMAA 3P8WA 2B5YA 1XWCA 4YQUA 2BMXA 4POKA 3GUSA 2N5AA 3OR5A 1PX6A 5B7CA 1GNWA 4FYCA 5EL8A 3Q19A 2VIMA 1Y25A 4ULXA 1U87A 1YEXA 4BL7A 4K6XA 4WETA 2N5BA 3FR3A 3IBHA 4NXIA 1K0OA 2HQTA 1S3DA 1NHYA 2C0DA 1Z3EA 5AISA 7GSSA 4IQ1A 1ZGNA 4MLYA 3QOUA 1AQWA 5A4VA 4K9ZA 4NV5A 3L4NA 2PPTA 3J7Yk 2MMAA 3UVTA 1I5GA 1Z6NA 4KAEA 3F63A 4KCEA 1EV9A 2K8SA 2GSTA 5IOXA 1GUKA 3ERFA 4BWQA 17GSA 2L59A 4XIHA 5D9TA 4PNGA 4FH8A 4LMWA 1M0UA 3BCIA 4F0BA 2G0FA 1X0RA 6GSXA 1TU7A 3KXOA 2HSHA 2VLTA 1R26A 4L8EA 3DEXA 2YWMA 22GSA 1XOAA 2M46A 2V41A 2LUSA 5DJLA 3WT1A 1MDKA 3LYPA 4NAXA 4ECBA 2HRKA 5G1KA 3HHVA 2IMDA 1SKRB 2V6KA 1OVNA 2XHFA 1AW9A 2EIQA 1ZYQB 1AAZA 2YCDA 1T4ZA 5H5SA 4ZILA 4HU7A 2MZCA 3RPPA 2GS3A 13GSA 5J5NA 1OE8A 4JRRA 4WEYA 3ZL5A 2JADA 1GSDA 1YQ1A 4F0CA 4LL4B 8GSSA 1V9WA 3LEFA 4IHUA 2H0HA 3MDKA 5D93A 3BD2A 3N9JA 3EC3A 4V1Ag 2H8LA 4O92A 5CREA 2NPBA 5A5KA 3P90A 3ZIVA 1F6MC 2NTOA 4Z7XA 2PBJA 2DIZA 4TXOA 2IFQA 4I97A 4YAVA 4NV2A 5ID2A 1TKDB 1W89A 3M8NA 5J4UA 3VWUA 1A8LA 4ECCA 1SENA 2GGTA 3FZAA 4JBBA 3TKQA 5ECIB 1PD21 1A0RP 3ZFLA 5LCZA 5ECOB 2CVBA 1MD4A 14GSA 2LSTA 4J2FA 2OKAA 1HYUA 4TOPA 4ZBBA 4PXOA 2B5XA 1U3AA 2I3YA 3L9VA 2HSYA 1C72A 2IJYA 3KD0A 3ZITA 3Q74A 4ISDA 4ZBDA 2L4CA 3GKMA 4ZB6A 3DD3A 3VWXA 3IDVA 4G0KA 1WWJA 1ACVA 3VI7A 1YF1A 3ZTLA 2HRKB 3IC8A 2D2ZA 4JR4A 2HNLA 1ZYEA 3EVIA 5CRHA 1PSQA 2ES7A 3QCPA 3WYWA 2LNTA 4PX1A 2GDRA 1JZOA 2DC5A 5GSTA 1YZXA 3HYPA 1A24A 4K0NA 1SYXA 4KF9A 3LXTA 2VCWA 6GSYA 2PUKC 4OO5A 3FY7A 1GRXA 5CAXA 1X5EA 2ALBA 3W6GA 2N5FA 2AJQB 1SD8A 5B8BA 4GF0A 1BEDA 1FVKA 3EYTA 3GV1A 1M7TA 1NSWA 3N5OA 3M1GA 5J9BA 2HRNA 4EVMA 1HNBA 5KN1A 3ZZXA 5ID2B 2IFQB 3C7MA 3CRTA 2EIRA 2JZRA 1K0AA 1OC8A 3HVXA 4ZBAA 4IS0A 4XS1A 1F9MA 3TKSC 4TR4A 4JZQA 1T3BA 3GA4A 2RM5A 3IA1A 3I9V2 2J23A 3KM6A 1SJ6A 4G0LA 4TR3A 1TK5B 2GQLA 2IMIA 1XVQA 1SK0A 4DSRA 2R6KA 9GSSA 2H0IA 5IMDA 2H6YA 2YV7A 3F6FA 2LS5A 3MNGA 3MSZA 4LL1B 1SL0B 3WD6A 3H4KA 2LQQA 3ZMLA 1SJZA 5DVBA 4GXZA 3FW2A 4X43A 3PGTA 2E2MA 3LYKA 4HS1A 1QXHA 1GUHA 1N8JA 4E8HA 1BX9A 2PU9C 1B48A 1U3IA 2OBIA 1FB6A 2LQOA 3U6VA 3E9JB 2K9FA 3CYNA 5FWGA 5L71A 4FO5A 4XS6A 3I43A 4KA0A 3PPUA 2H71A 4KDUA 5DQYA 2XPEA 3F4SA 3ZRDA 2DIYA 4EDZA 2TIRA 5IO0A 2X8GA 1PGTA 1TI1A 3F0IA 1IYHA 4ECIA 3HZ8A 1XCCA 2DBCA 3TB2A 1GLPA 5D96A 1CQHA 4WR5A 4LA1A 4TVEA 4BVYA 3IV4A 2DJJA 1BAYA 11GSA 1GSUA 3HDCA 3LQ7A 4ZL7A 3O6TA 1WP0A 3CSIA 3KP9A 3VPQA 3ZFBA 3VURA 3QD9A 1ZOFA 3CTFA 1YY7A
chains in the Genus database with same CATH superfamily
3TCOA 4FYBA 2H30A 3HZ4A 1XIYA 5J41A 3HCZA 3HVVA 2WDUA 2V6OA 3TJBA 1H4OA 2JZTA 3WGEA 1Z9HA 4ZB8A 3TU3B 3F4TA 1XWKA 2H66A 2QSIA 4EIPA 2VL2A 2YJHA 4K0GA 3APQA 3I69A 2P5RA 1CQGA 1ML6A 3GKNA 2VLUA 5IO2A 4OCFA 1WE0A 3IK9A 3RHCA 1GLQA 4DVCA 2P0GA 4QL9A 1GUMA 3QAGA 3O3TA 4MABA 3UBLA 3CHXC 4F9ZA 4TR0A 4XCSA 2GZYA 5IMZA 3PR8A 2Z9SA 1YF0A 5F07A 3TUEA 1A2LA 4LLRA 4AI6A 1VRSD 4GLTA 4HZ4A 1B9XC 2AHEA 5IMFA 4FYUA 3GSTA 2OACA 3W8SA 1SVLA 4IW9A 4GRFA 1VF2A 1N25A 2WW2A 2JSZA 2B6MA 5J4YA 5IMVA 6GSVA 3FYGA 1S4BP 2WFCA 2V1MA 1TDIA 2YJ7A 2FA8A 3LWAA 4G2EA 3C1SA 4AKHA 2YP6A 3QR6A 6GSTA 3GKXA 1OE7A 4G0IA 4OCEA 3ZVJD 1M2BA 2FWHA 5DBQA 5F06A 4N3ZA 2FWGA 4BVYB 2JSYA 3TJJA 4HQSA 1R4WA 2BTOT 3ZYWA 2VL9A 5ABRA 1PMTA 3GKKA 5JCGA 2HI7A 3GURA 4I6XA 2HFDA 2IMKA 4RI7A 2VOCA 2C0EA 2B1LA 1IYIA 3O76A 1HNCA 3GL5A 1OAZA 3GIXA 2H76A 2A2PA 2H73A 5ECMB 5IIZA 3J7Yb 5AGYA 1ERVA 2GSRA 3M9KA 1U6TA 2HYXA 2L5OA 4BPYA 2F3MA 4I2UA 2F9SA 2FNOA 3H1NA 3A2VA 2IMEA 3EWLA 2O89A 2L4QA 3C73A 4GDFA 5DCGA 3LFLA 4IVFA 4L5OA 4CW9A 3F3QA 4IJ3A 2C8UA 3ERWA 4OWYA 5G31A 2H72A 1O81A 3RDWA 1SVMA 5DDLA 3FEUA 3D21A 3KJYA 1V40A 4YAPA 1M2DA 3KH7A 3UEMA 3WT2A 1YEPA 5AN1A 3EU4A 1TRVA 3ZIJA 1AQVA 2H01A 4EF0A 1AIUA 3IC4A 2FWEA 2H0GA 1XPVA 3KZQA 4K8MA 12GSA 2IL3A 1M2AA 3KTBA 2HSNA 4IBPA 2XBQA 3KGKA 1MDJA 5ELGA 2DJ0A 3DGQA 1G7EA 1SL1B 1GSYA 4Q5FA 1GP1A 2VL3A 5BRTA 1EV4A 5IOWA 4MJCA 1EEJA 3GNJA 3EU3A 4KB3A 1GTAA 2HE3A 4GCIA 4KDYA 2I4AA 4AF2A 2NBSA 4MH2A 4JEDA 2QKEA 1O73A 2FGXA 4NHWA 4OO4A 3D0ZA 2V2GA 4D73A 1R5AA 1XWGA 1G7OA 2HLSA 1THXA 2R4VA 4FQUA 3HVSA 1TTZA 3IR4A 1XWAA 4TRXA 4POLA 2G2QA 2LEGA 1ERTA 3A3TA 3UL3A 5CYYA 4Q5QA 5E59A 1PL2A 2HSMA 5FHIA 1O8WA 1ZZYA 5EPFA 2O87A 4POBA 3CSHA 4L0UA 1I1IP 3HJOA 3IK7A 3ZLPA 4YKFA 3UBKA 4WBJA 3TGZA 4YQVA 1SK1A 3IRAA 5IPHA 1R7HA 2R5GA 1BG1A 1X5DA 3G9BA 2E0QA 3I6AA 2CA8A 2AB6A 1QMVA 1N2AA 2B7JA 4NWYA 1VGLA 4K2XA 1A2JA 5HFGA 4N0VA 1JHBA 1X9SB 3KEBA 4O32A 3M3MA 2VAFA 5DQSA 1QUWA 1OC9B 4KE3A 1TI3A 1X9WB 5ECSA 4PI0C 1M9BA 2DMLA 4NMUA 4EL1A 1QK8A 2R0CA 2WVZA 3ZMKA 2OA7A 2WW1A 5J3RA 5A1NA 4O5RA 2AAWA 3KH9A 4TR1B 3G7JA 2GQMA 2PMTA 2HSNB 3DRNA 5BMUB 4LMVA 5ECRB 1NW2A 1AQXA 1BF5A 3GMFA 1XFLA 3EPTA 4G9HA 1EP7A 1EGRA 1VF1A 1PRXA 5GAPD 2CX4A 3D22A 2LRTA 3TRXA 2DJ1A 3WGXA 5CRDA 5CRWA 3QMXA 1DSBA 1B4PA 1SK2A 1O8XA 3PINA 4JE1A 2I81A 2BJXA 3PH9A 4D73B 4BVXA 3TJGA 3FRCA 1U88A 2YOIA 5D8IA 3VFIA 5H5RA 3Q18A 5DCHA 2CZ2A 4MF6A 4KW6A 1K0BA 4IP6A 2DJKA 1TRWA 2FWFA 2UZ8A 2HZEA 3BJ5A 1GH2A 1G6WA 4FIWA 4GQCA 5KOWA 2VL2C 2HSMB 4NPBA 5ECLB 1YDKA 2PWJA 1GSQA 2F8AA 2L6CA 5CP1A 3FR9A 2VUPA 5G1LA 2XBIA 2WW0A 1TP9A 4IKHA 3IXRA 1QFNA 1DBYA 2EFHA 1FB0A 4ZXGA 1Q4JA 2O3EA 1HQOA 3RBTA 2C4JA 3KP8A 4MK3A 2C80A 4USSA 4W66A 4XRAA 1DUGA 3NOFA 1ILOA 3FKFA 5CO3A 1SVOA 4ID0A 2E7PA 4EUYA 2VO4A 1SKWB 2VD1A 4F82A 4V1Ap 4X0XA 2X99A 4Z2UA 2R2JA 2GZZA 2PVOC 2VM1A 5IQYA 1UA5A 2VCVA 2QC7A 4O5UA 3CBUA 2CAQA 5KN3A 1DE2A 1MTCA 1XW9A 1PKWA 5A1NB 1GSSA 3ISOA 1ZCPA 4OFTA 2VD0A 3IAM2 4YKGA 2B1KA 3NIVA 1Z6MA 4KX4A 1ZYPA 2HT9A 1F3BA 1A23A 4GQFA 1KBNA 1M3IA 2YZHA 4ZL9A 5C00A 3L0HA 1PL1A 1E6BA 4RQXA 1ERWA 2A4HA 4NHZA 4WR4A 4KGIA 5GSSA 4ILFA 5EY6A 2YPMA 1GSEA 2ON5A 2VM2A 5A4WA 4GTUA 4TKYA 3R2QA 1A2MA 3F4RA 4I8BA 2X4AA 3IHQA 2ON7A 4XS4B 3HA9A 2H1BA 1K3YA 1ERUA 2KOKA 3M0FA 1GSFA 2FY6A 3VWWA 4BVXB 3WGDA 3QAWA 4ACSA 2FHEA 4WF5A 4DSSB 2CVDA 4MH3A 1AUCA 2WVYA 4YQMA 1Q98A 2P5QA 1ZL9A 3FZ4A 2NVLA 1BG5A 2MMZA 2HZEB 2JZSA 1GL8A 5J4VA 3NZNA 1WPIA 1B4QA 1PA3A 3GFKA 3EMPA 1SJIA 1W4VA 3TRQA 1JZWA 2LJRA 3IE3A 4HDEA 4ML6A 5HQPA 1A8YA 2EFEA 4K7OA 2V32A 4MP4A 5A4UA 2L5LA 2P31A 4AGSA 5G2ZA 2OJLA 3HKRA 4Q5RA 1I9DA 5FT3A 1K0DA 5KOXA 2J9HA 4G19A 4F03A 4PQ1A 1JFUA 4E8EA 1S3AA 4HUAA 1MEKA 4RQRA 3UJ1A 2KP2A 1RW1A 2H70A 2I9HA 2GQKA 2EC4A 5IMAA 4AKIA 5EVOA 6GSSA 2A4VA 2YN1A 3JCML 3TKSE 1TW9A 1FAAA 3GYKA 4H86A 2K6VA 2XC2A 2A2RA 1TOFA 10GSA 1K0NA 3IOSA 2WJUA 1PQNA 3HMJG 1T7PB 3SBCA 5ECQB 4I5QA 2WS2A 1F37A 3S9FA 1FOHA 5HR2A 4MA9A 3LXZA 5F05A 1YKCA 1EZKA 2GT6A 2RIIA 3C1RA 3LGCA 3D6IA 2HZFA 3TOTA 2DKIA 2WGRA 5B8AA 5KN0A 1J08A 1B9YC 2JACA 5J40A 2B7KA 1V58A 3GN3A 2ZUPA 2WVXB 2HRFA 1YVLA 2LJKA 5CNWA 5D73A 1O7UA 2O7KA 1XW6A 4K1FA 4N30A 4Q5NA 5D9VA 1J0FA 4L5LA 4GWRA 2IMFA 4CDOA 5JWRB 2GT5A 4MZWA 2WW3A 2AYTA 3QPMA 5B6NA 5ECHB 2EIOA 5HFKA 4MJBA 3MWHA 1V57A 1G6YA 3LW9A 2L57A 2QGVA 2YWOA 3QAVA 2YWNA 1FW1A 4ZL8A 3VPTA 5COHA 3TKRA 3UIWA 5F0GA 2MYGA 1SL2B 3CRUA 1HNAA 3AY8A 3UOMA 2A2SA 1ST9A 2DSAA 1EP8A 5J47A 4X1UA 2REMA 2C3TA 1EEMA 3FZ5A 3LJRA 3DVWA 5A5HA 3A5WA 2GZPA 1BQ7A 2B3SA 4PURA 1GWCA 1Z5YE 2O36A 1VF4A 4HU9A 3G7IA 3ERGA 2GLRA 4EC0A 2ZNMA 4WXTA 3KIJA 1JZRA 2MBTA 3L9SA 2FCHA 2YNXA 2VCTA 4L0WA 3H93A 1SU9A 2F51A 2O8VB 1OC9A 3ME7A 4PTSA 4AJ8A 4QMKA 1OC3A 1LU4A 1QQ2A 3ME8A 4HJMA 3QFAC 4WKWA 2TRCP 4IQAA 1YKAA 4OFNA 1V2AA 1XWBA 4QL7A 4TR1A 5IMCA 1FOVA 2H1GA 5GZZB 3C71A 5BMUA 4KNDA 3GHAA 2KHPA 4K7NA 1ABAA 3APSA 1FVJA 3D5JA 1UC7A 1UVZA 1BYEA 1B8XA 2RLIA 4XTSA 4GSTA 4HQZA 2MMOA 1A0FA 3DMLA 1K3LA 2WB9A 4EO3A 1WIKA 4ECJA 4HOJA 1K0CA 3UARA 2CVKA 1UN2A 2IWTA 2DMMA 1EGOA 2YV9A 1OKDA 2IN3A 4MZBA 4WF4A 1TJDA 5CRGA 1S3RA 2OBKA 5G30A 3CSJA 4MF5A 1WOUA 4DEJA 3F9UA 3SWLA 5C04A 4KDXA 3MAKA 4K2DA 4HI7A 4MZCA 2GSQA 3GSSA 4WBRD 5E4WA 3UMAA 1KTEA 1OYJA 3TKPA 5IPGA 1WRYA 3ZVJA 4EKZA 3BOAA 2OE3A 2LV3A 2EFCA 4PI2C 2CV4A 3A5IA 3KTLA 1Y6EA 3HJMA 2LKUA 3C8EA 3TJKA 4GSNA 2C0FA 4HEA2 2VCXA 3RHBA 3D4TA 1PX7A 3UAPA 4BL7B 3IHGA 1T00A 4AJ7A 5A5HB 4O7HA 3RFRC 1OKTA 1JLVA 1GTUA 3VI5A 1YJ6A 4P3YB 4JR6A 4TW5A 4IGJA 1K3OA 4KSMA 4RI6A 4J57E 5G5FA 5HFIA 2LRCA 4EE0A 3DWVA 1TU8A 4PQHA 4PNFA 2K8VA 1R5PA 2WZ9A 3M9JA 5JCUA 1USBA 4Z2TA 5H5QA 3GH9A 4EXJA 4HSCX 2KP1A 4IN0A 3EINA 4ZIJA 3CXGA 3HY2A 1WMJA 3ED3A 1TRUA 3TDGA 4POMA 4AKXB 4KCAA 2R37A 2LNSA 5ELAA 1AC1A 1PN9A 1XVWA 2GSSA 2LTKA 2X64A 3EMXA 2OADA 1SD9A 2GTUA 1XOBA 3BCKA 4MPGA 4TXVA 3HD5A 2IIYA 3QDNA 2HRAA 2GVPA 1XBSA 4YH2A 2YZUA 1T4YA 4AJ6A 3APOA 2FUG2 2KUCA 3GTUA 3RPNA 1FHEA 4AKGA 2E2GA 2WULA 3G7YA 5JCWA 4XS4A 3L9UA 18GSA 5JWQB 1LBKA 6GSWA 5J9CA 4V2LA 2JL4A 3GRXA 1JZDA 5ENUA 2M80A 2C3QA 5HR0A 1V98A 4DSSA 5D9WA 1S3CA 1RK4A 4XRDA 5F8BA 3FZ9A 2CAIA 3F8UA 4BA7A 1ZYNA 4ICYA 5AIXA 2MBSA 1M9AA 4OFMA 4HJ2A 2TRXA 3UVHA 5DALA 3DXBA 3IPZA 2H6ZA 3E3EA 1X5CA 1GTIA 3A2WA 4JU5A 2DJ2A 3ZREA 1YEWC 3P2AA 5ECNB 2PN8A 1SYRA 4MNNA 1O85A 4N11A 1TRSA 2MMNA 4TXOB 2O85A 2X49A 5AIVA 2H1AA 4MF7A 3DKSA 4MMMA 4OD7A 2YANA 4DSQA 1JLWA 2C3NA 2CT6A 1GTBA 1KNGA 4MJEA 3D4MA 1EOHA 3FK8A 4PGTA 2FD3A 1LJRA 2WRTA 2RM6A 3HXSA 2C1YA 1XZOA 2K18A 3VK9A 2OE1A 5LD0A 1PKZA 5IM9A 1G0TA 1ON4A 5DAKA 2WCIA 4X4JA 4EDYA 2KLXA 5LNKe 4MDCA 4IP1A 3CMIA 3FHKA 3R3EA 3H79A 1EWXA 4I2TA 3LORA 2WZSA 19GSA 3DIEA 1TK8B 3RAZA 2H6XA 4HZ2A 6GSUA 2H19A 4XHMA 1H75A 3F6DA 2H74A 4MCUA 2R0PA 5HR1A 1RQMA 1EOGA 3GTUB 4PQIA 4QQ7A 2DJ3A 2WVXA 3CWGA 3FR6A 4ZB9A 5INYA 3EE2A 4V2NA 5GAND 3CTGA 3MYDA 3HJPA 3TOUA 5A34B 3US3A 1T1VA 1M99A 3GX8A 4PUFC 4KSOA 4RUVA 1GNEA 2L6DA 2CZ3A 3KMNA 1SKSB 4IJIA 2RUEA 1FG4A 4IELA 1Z7RA 3GX0A 3K8NA 2VCZA 1NHOA 2AUVA 4ML1A 4MJAA 5DALB 1F2EA 2B5EA 2EFDA 3KCMA 4BIKA 20GSA 2ZCTA 3KMOA 1F3AA 2X8CA 2CX3A 3IAS2 1MDIA 4KUNA 1HD2A 2YWIA 3TRPA 1FO5A 4KH7A 2CQ9A 3L78A 1GULA 4N0ZA 2C0GA 2LJAA 4GSSA 3LG6A 3GL3A 2LRNA 2H75A 2VCQA 2XPDA 5JWOB 3TKSA 2M72A 3QFBC 2PVQA 4V2MA 2AV4A 3H8QA 2FA4A 3BBYA 2H1DA 1XW5A 2VLVA 5B6MA 4K5RA 1THOA 3VLNA 1NM3A 4E68A 2DLXA 5DAKB 5ECPB 1J9BA 4BWSA 1QGVA 2NDOA 4J56E 4N10A 4F2IA 5HR3A 3EURA 1WJKA 1KEBA 5DJMA 2OE0A 2PGTA 4K7IA 1T8EB 4PUAA 3E0UA 3TJFA 5KN2A 1X9MB 4G10A 3U5RE 3VWVA 3LSZA 3V1WA 2F8FA 3F3RA 2FLSA 1TK0B 3DVXA 16GSA 1Z7PA 1O6JA 1K0MA 5ECKB 1VF3A 4OMVA 1TXXA 1E2YA 1MD3A 1URMA 4CHSA 3W8JA 2PERA 3GH6A 4TN8A 5G5EA 5KEJA 2IPAA 2RUFA 1DE1A 4CY8A 3A2XA 4MPFA 2HXKA 3P7XA 2R3XA 2I1UA 2JU5A 1XXUA 2QA2A 1BJXA 2X8HA 3DYRA 3Q6OA 1AXDA 5D9XA 1ZMAA 3P8WA 2B5YA 1XWCA 4YQUA 2BMXA 4POKA 3GUSA 2N5AA 3OR5A 1PX6A 5B7CA 1GNWA 4FYCA 5EL8A 4G01A 3Q19A 2VIMA 2OT3A 1Y25A 4ULXA 1U87A 1YEXA 4BL7A 4K6XA 4WETA 2N5BA 3FR3A 3IBHA 4NXIA 1K0OA 2HQTA 1S3DA 1NHYA 2C0DA 1Z3EA 5AISA 4FXYP 7GSSA 4IQ1A 1ZGNA 4MLYA 3QOUA 1AQWA 5A4VA 4K9ZA 4NV5A 3L4NA 3RGBC 2PPTA 3J7Yk 2MMAA 3UVTA 1I5GA 1Z6NA 4KAEA 3F63A 4KCEA 1EV9A 2K8SA 2GSTA 5IOXA 1GUKA 3ERFA 4BWQA 17GSA 2L59A 4XIHA 2QA1A 5D9TA 1Y1UA 4PNGA 4FH8A 4CY6A 4LMWA 2VKZG 1M0UA 3BCIA 1XG8A 4F0BA 2G0FA 1X0RA 6GSXA 1TU7A 3KXOA 2HSHA 2VLTA 1R26A 4L8EA 3DEXA 2YWMA 22GSA 1XOAA 2M46A 2V41A 2LUSA 5DJLA 3WT1A 1MDKA 3LYPA 2UV8G 4NAXA 4ECBA 2HRKA 5G1KA 3HHVA 2IMDA 1SKRB 2R0GA 2V6KA 3FMWA 1OVNA 2XHFA 1AW9A 2EIQA 1ZYQB 1AAZA 2YCDA 1T4ZA 5H5SA 4ZILA 4HU7A 2MZCA 3RPPA 2GS3A 13GSA 5J5NA 1OE8A 4JRRA 2O5VA 4WEYA 3ZL5A 2JADA 1GSDA 1YQ1A 4F0CA 4LL4B 8GSSA 1V9WA 3LEFA 1M3JA 4IHUA 3MIXA 2H0HA 3MDKA 5D93A 3BD2A 3N9JA 3EC3A 4V1Ag 2H8LA 4O92A 5CREA 2NPBA 5A5KA 3P90A 3ZIVA 1F6MC 2NTOA 4Z7XA 2PBJA 2DIZA 4TXOA 2IFQA 4I97A 4YAVA 4NV2A 5ID2A 1TKDB 1W89A 3M8NA 5J4UA 3VWUA 1A8LA 4ECCA 1SENA 2GGTA 3FZAA 4JBBA 3TKQA 4EIQA 5ECIB 1PD21 1A0RP 3ZFLA 5LCZA 5ECOB 2CVBA 1MD4A 14GSA 2LSTA 4J2FA 2OKAA 1HYUA 4TOPA 4ZBBA 4PXOA 2B5XA 1U3AA 2I3YA 3L9VA 4A5PA 2HSYA 1C72A 2IJYA 3KD0A 3ZITA 3Q74A 4ISDA 4ZBDA 2L4CA 3GKMA 4ZB6A 3DD3A 3VWXA 3IDVA 4G0KA 1WWJA 1ACVA 3VI7A 1YF1A 3ZTLA 2HRKB 3IC8A 2D2ZA 4JR4A 2HNLA 1ZYEA 3EVIA 5CRHA 1PSQA 2ES7A 3QCPA 3WYWA 2LNTA 4PX1A 2GDRA 1JZOA 2DC5A 2H1LA 5GSTA 1YZXA 3HYPA 1A24A 4K0NA 1PFOA 1SYXA 5A34A 4KF9A 3LXTA 2VCWA 6GSYA 2PUKC 4OO5A 3FY7A 1GRXA 5CAXA 1X5EA 2ALBA 3W6GA 2N5FA 2AJQB 1SD8A 5B8BA 4GF0A 1BEDA 1FVKA 3EYTA 3GV1A 3HVNA 1M7TA 1NSWA 3N5OA 3M1GA 5J9BA 2HRNA 4EVMA 1HNBA 5KN1A 3ZZXA 5ID2B 2IFQB 3C7MA 3CRTA 2EIRA 2JZRA 1K0AA 1OC8A 3HVXA 4ZBAA 4IS0A 4XS1A 1F9MA 3TKSC 4TR4A 4JZQA 1T3BA 3GA4A 2RM5A 3IA1A 3CQFA 3I9V2 2J23A 3KM6A 1SJ6A 4G0LA 4TR3A 1TK5B 2GQLA 2IMIA 1XVQA 1SK0A 1TXUA 4DSRA 2R6KA 4ZB7A 9GSSA 2H0IA 5IMDA 4Z2RA 2H6YA 2YV7A 3F6FA 2LS5A 3MNGA 3MSZA 4LL1B 1SL0B 3WD6A 3H4KA 2LQQA 3ZMLA 1SJZA 5DVBA 4GXZA 3FW2A 4X43A 3PGTA 2E2MA 3LYKA 4HS1A 1QXHA 1GUHA 1N8JA 4E8HA 1BX9A 2PU9C 1B48A 1U3IA 2OBIA 1FB6A 2LQOA 3U6VA 3E9JB 4O5QA 2K9FA 3CYNA 5FWGA 5L71A 2DKHA 4FO5A 4XS6A 3I43A 4KA0A 3PPUA 2H71A 4PHZC 4KDUA 5DQYA 2XPEA 3F4SA 3ZRDA 2DIYA 4EDZA 2TIRA 5IO0A 2X8GA 1PGTA 1TI1A 3F0IA 1IYHA 4ECIA 3HZ8A 1XCCA 2DBCA 3TB2A 1GLPA 5D96A 1CQHA 4WR5A 4LA1A 4TVEA 4K5SA 4BVYA 3IV4A 2DJJA 1BAYA 11GSA 1GSUA 3HDCA 3LQ7A 4ZL7A 3O6TA 1WP0A 3CSIA 3KP9A 3VPQA 3ZFBA 3VURA 3QD9A 1ZOFA 3CTFA 1YY7A 1PN0A
chains in the Genus database with same CATH topology
3TCOA 4FYBA 2H30A 3HZ4A 1XIYA 5J41A 3HCZA 3HVVA 2WDUA 2V6OA 3TJBA 1H4OA 2JZTA 3WGEA 1Z9HA 4ZB8A 3TU3B 3F4TA 1XWKA 2H66A 2QSIA 4EIPA 2VL2A 2YJHA 4K0GA 3APQA 3I69A 2P5RA 1CQGA 1ML6A 3GKNA 2VLUA 5IO2A 4OCFA 1WE0A 3IK9A 3RHCA 1GLQA 4DVCA 2P0GA 4QL9A 1GUMA 3QAGA 3O3TA 4MABA 3UBLA 4F9ZA 4TR0A 4XCSA 2GZYA 5IMZA 3PR8A 2Z9SA 1YF0A 5F07A 3TUEA 1A2LA 4LLRA 4AI6A 1VRSD 4GLTA 4HZ4A 1B9XC 2AHEA 5IMFA 4FYUA 3GSTA 2OACA 3W8SA 1SVLA 4IW9A 4GRFA 1VF2A 1N25A 2JSZA 2B6MA 5J4YA 5IMVA 6GSVA 3FYGA 2WFCA 2V1MA 1TDIA 2YJ7A 2FA8A 3LWAA 4G2EA 3C1SA 4AKHA 2YP6A 3QR6A 6GSTA 3GKXA 1OE7A 4G0IA 4OCEA 3ZVJD 1M2BA 2FWHA 5DBQA 5F06A 4N3ZA 2FWGA 4BVYB 2JSYA 3TJJA 4HQSA 1R4WA 2BTOT 3ZYWA 2VL9A 5ABRA 1PMTA 3GKKA 5JCGA 2HI7A 3GURA 4I6XA 2HFDA 2IMKA 4RI7A 2VOCA 2C0EA 2B1LA 1IYIA 3O76A 1HNCA 3GL5A 1OAZA 3GIXA 2H76A 2A2PA 2H73A 5ECMB 5IIZA 3J7Yb 5AGYA 1ERVA 2GSRA 3M9KA 1U6TA 2HYXA 2L5OA 4BPYA 2F3MA 4I2UA 2F9SA 2FNOA 3H1NA 3A2VA 2IMEA 3EWLA 2O89A 2L4QA 3C73A 4GDFA 5DCGA 3LFLA 4IVFA 4L5OA 4CW9A 3F3QA 4IJ3A 2C8UA 3ERWA 4OWYA 5G31A 2H72A 1O81A 3RDWA 1SVMA 5DDLA 3FEUA 3D21A 3KJYA 1V40A 4YAPA 1M2DA 3KH7A 3UEMA 3WT2A 1YEPA 5AN1A 3EU4A 1TRVA 3ZIJA 1AQVA 2H01A 4EF0A 1AIUA 3IC4A 2FWEA 2H0GA 1XPVA 3KZQA 4K8MA 12GSA 2IL3A 1M2AA 3KTBA 2HSNA 4IBPA 2XBQA 3KGKA 1MDJA 5ELGA 2DJ0A 3DGQA 1G7EA 1SL1B 1GSYA 4Q5FA 1GP1A 2VL3A 5BRTA 1EV4A 5IOWA 4MJCA 1EEJA 3GNJA 3EU3A 4KB3A 1GTAA 2HE3A 4GCIA 4KDYA 2I4AA 4AF2A 2NBSA 4MH2A 4JEDA 2QKEA 1O73A 2FGXA 4NHWA 4OO4A 3D0ZA 2V2GA 4D73A 1R5AA 1XWGA 1G7OA 2HLSA 1THXA 2R4VA 4FQUA 3HVSA 1TTZA 3IR4A 1XWAA 4TRXA 4POLA 2G2QA 2LEGA 1ERTA 3A3TA 3UL3A 5CYYA 4Q5QA 5E59A 1PL2A 2HSMA 5FHIA 1O8WA 1ZZYA 5EPFA 2O87A 4POBA 3CSHA 4L0UA 3HJOA 3IK7A 3ZLPA 4YKFA 3UBKA 4WBJA 3TGZA 4YQVA 1SK1A 3IRAA 5IPHA 1R7HA 2R5GA 1BG1A 1X5DA 3G9BA 2E0QA 3I6AA 2CA8A 2AB6A 1QMVA 1N2AA 2B7JA 4NWYA 1VGLA 4K2XA 1A2JA 5HFGA 4N0VA 1JHBA 1X9SB 3KEBA 4O32A 3M3MA 2VAFA 5DQSA 1QUWA 1OC9B 4KE3A 1TI3A 1X9WB 5ECSA 1M9BA 2DMLA 4NMUA 4EL1A 1QK8A 2R0CA 3ZMKA 2OA7A 5J3RA 5A1NA 4O5RA 2AAWA 3KH9A 4TR1B 3G7JA 2GQMA 2PMTA 2HSNB 3DRNA 5BMUB 4LMVA 5ECRB 1NW2A 1AQXA 1BF5A 3GMFA 1XFLA 3EPTA 4G9HA 1EP7A 1EGRA 1VF1A 1PRXA 5GAPD 2CX4A 3D22A 2LRTA 3TRXA 2DJ1A 3WGXA 5CRDA 5CRWA 3QMXA 1DSBA 1B4PA 1SK2A 1O8XA 3PINA 4JE1A 2I81A 2BJXA 3PH9A 4D73B 4BVXA 3TJGA 3FRCA 1U88A 2YOIA 5D8IA 3VFIA 5H5RA 3Q18A 5DCHA 2CZ2A 4MF6A 4KW6A 1K0BA 4IP6A 2DJKA 1TRWA 2FWFA 2UZ8A 2HZEA 3BJ5A 1GH2A 1G6WA 4FIWA 4GQCA 5KOWA 2VL2C 2HSMB 4NPBA 5ECLB 1YDKA 2PWJA 1GSQA 2F8AA 2L6CA 5CP1A 3FR9A 2VUPA 5G1LA 2XBIA 1TP9A 4IKHA 3IXRA 1QFNA 1DBYA 2EFHA 1FB0A 4ZXGA 1Q4JA 1HQOA 3RBTA 2C4JA 3KP8A 4MK3A 2C80A 4USSA 4W66A 4XRAA 1DUGA 3NOFA 1ILOA 3FKFA 5CO3A 1SVOA 4ID0A 2E7PA 4EUYA 2VO4A 1SKWB 2VD1A 4F82A 4V1Ap 4X0XA 2X99A 4Z2UA 2R2JA 2GZZA 2PVOC 2VM1A 5IQYA 1UA5A 2VCVA 2QC7A 4O5UA 3CBUA 2CAQA 5KN3A 1DE2A 1MTCA 1XW9A 1PKWA 5A1NB 1GSSA 3ISOA 1ZCPA 4OFTA 2VD0A 3IAM2 4YKGA 2B1KA 3NIVA 1Z6MA 4KX4A 1ZYPA 2HT9A 1F3BA 1A23A 4GQFA 1KBNA 2YZHA 4ZL9A 5C00A 3L0HA 1PL1A 1E6BA 4RQXA 1ERWA 2A4HA 4NHZA 4WR4A 4KGIA 5GSSA 4ILFA 5EY6A 2YPMA 1GSEA 2ON5A 2VM2A 5A4WA 4GTUA 4TKYA 3R2QA 1A2MA 3F4RA 4I8BA 2X4AA 3IHQA 2ON7A 4XS4B 3HA9A 2H1BA 1K3YA 1ERUA 2KOKA 3M0FA 1GSFA 2FY6A 3VWWA 4BVXB 3WGDA 3QAWA 4ACSA 2FHEA 4WF5A 4DSSB 2CVDA 4MH3A 1AUCA 4YQMA 1Q98A 2P5QA 1ZL9A 3FZ4A 2NVLA 1BG5A 2MMZA 2HZEB 2JZSA 1GL8A 5J4VA 3NZNA 1WPIA 1B4QA 1PA3A 3GFKA 3EMPA 1SJIA 1W4VA 3TRQA 1JZWA 2LJRA 3IE3A 4HDEA 4ML6A 5HQPA 1A8YA 2EFEA 4K7OA 2V32A 4MP4A 5A4UA 2L5LA 2P31A 4AGSA 5G2ZA 2OJLA 3HKRA 4Q5RA 1I9DA 5FT3A 1K0DA 5KOXA 2J9HA 4G19A 4F03A 4PQ1A 1JFUA 4E8EA 1S3AA 4HUAA 1MEKA 4RQRA 3UJ1A 2KP2A 1RW1A 2H70A 2I9HA 2GQKA 2EC4A 5IMAA 4AKIA 5EVOA 6GSSA 2A4VA 2YN1A 3JCML 3TKSE 1TW9A 1FAAA 3GYKA 4H86A 2K6VA 2XC2A 2A2RA 1TOFA 10GSA 1K0NA 3IOSA 2WJUA 1PQNA 3HMJG 1T7PB 3SBCA 5ECQB 4I5QA 2WS2A 1F37A 3S9FA 1FOHA 5HR2A 4MA9A 3LXZA 5F05A 1YKCA 1EZKA 2GT6A 2RIIA 3C1RA 3LGCA 3D6IA 2HZFA 3TOTA 2DKIA 2WGRA 5B8AA 5KN0A 1J08A 1B9YC 2JACA 5J40A 2B7KA 1V58A 3GN3A 2ZUPA 2HRFA 1YVLA 2LJKA 5CNWA 5D73A 1O7UA 2O7KA 1XW6A 4K1FA 4N30A 4Q5NA 5D9VA 1J0FA 4L5LA 4GWRA 2IMFA 4CDOA 5JWRB 2GT5A 4MZWA 2AYTA 3QPMA 5B6NA 5ECHB 2EIOA 5HFKA 4MJBA 3MWHA 1V57A 1G6YA 3LW9A 2L57A 2QGVA 2YWOA 3QAVA 2YWNA 1FW1A 4ZL8A 3VPTA 5COHA 3TKRA 3UIWA 5F0GA 2MYGA 1SL2B 3CRUA 1HNAA 3AY8A 3UOMA 2A2SA 1ST9A 2DSAA 1EP8A 5J47A 4X1UA 2REMA 2C3TA 1EEMA 3FZ5A 3LJRA 3DVWA 5A5HA 3A5WA 2GZPA 1BQ7A 2B3SA 4PURA 1GWCA 1Z5YE 1VF4A 4HU9A 3G7IA 3ERGA 2GLRA 4EC0A 2ZNMA 4WXTA 3KIJA 1JZRA 2MBTA 3L9SA 2FCHA 2YNXA 2VCTA 4L0WA 3H93A 1SU9A 2F51A 2O8VB 1OC9A 3ME7A 4PTSA 4AJ8A 4QMKA 1OC3A 1LU4A 1QQ2A 3ME8A 4HJMA 3QFAC 4WKWA 2TRCP 4IQAA 1YKAA 4OFNA 1V2AA 1XWBA 4QL7A 4TR1A 5IMCA 1FOVA 2H1GA 5GZZB 3C71A 5BMUA 4KNDA 3GHAA 2KHPA 4K7NA 1ABAA 3APSA 1FVJA 3D5JA 1UC7A 1UVZA 1BYEA 1B8XA 2RLIA 4XTSA 4GSTA 4HQZA 2MMOA 1A0FA 3DMLA 1K3LA 2WB9A 4EO3A 1WIKA 4ECJA 4HOJA 1K0CA 3UARA 2CVKA 1UN2A 2IWTA 2DMMA 1EGOA 2YV9A 1OKDA 2IN3A 4MZBA 4WF4A 1TJDA 5CRGA 2OBKA 5G30A 3CSJA 4MF5A 1WOUA 4DEJA 3F9UA 3SWLA 5C04A 4KDXA 3MAKA 4K2DA 4HI7A 4MZCA 2GSQA 3GSSA 4WBRD 5E4WA 3UMAA 1KTEA 1OYJA 3TKPA 5IPGA 1WRYA 3ZVJA 4EKZA 3BOAA 2OE3A 2LV3A 2EFCA 2CV4A 3A5IA 3KTLA 1Y6EA 3HJMA 2LKUA 3C8EA 3TJKA 4GSNA 2C0FA 4HEA2 2VCXA 3RHBA 3D4TA 1PX7A 3UAPA 4BL7B 3IHGA 1T00A 4AJ7A 5A5HB 4O7HA 1OKTA 1JLVA 1GTUA 3VI5A 1YJ6A 4P3YB 4JR6A 4TW5A 4IGJA 1K3OA 4KSMA 4RI6A 4J57E 5G5FA 5HFIA 2LRCA 4EE0A 3DWVA 1TU8A 4PQHA 4PNFA 2K8VA 1R5PA 2WZ9A 3M9JA 5JCUA 1USBA 4Z2TA 5H5QA 3GH9A 4EXJA 2KP1A 4IN0A 3EINA 4ZIJA 3CXGA 3HY2A 1WMJA 3ED3A 1TRUA 3TDGA 4POMA 4AKXB 4KCAA 2R37A 2LNSA 5ELAA 1AC1A 1PN9A 1XVWA 2GSSA 2LTKA 2X64A 3EMXA 2OADA 1SD9A 2GTUA 1XOBA 3BCKA 4MPGA 4TXVA 3HD5A 2IIYA 3QDNA 2HRAA 2GVPA 1XBSA 4YH2A 2YZUA 1T4YA 4AJ6A 3APOA 2FUG2 2KUCA 3GTUA 3RPNA 1FHEA 4AKGA 2E2GA 2WULA 3G7YA 5JCWA 4XS4A 3L9UA 18GSA 5JWQB 1LBKA 6GSWA 5J9CA 4V2LA 2JL4A 3GRXA 1JZDA 5ENUA 2M80A 2C3QA 5HR0A 1V98A 4DSSA 5D9WA 1S3CA 1RK4A 4XRDA 5F8BA 3FZ9A 2CAIA 3F8UA 4BA7A 1ZYNA 4ICYA 5AIXA 2MBSA 1M9AA 4OFMA 4HJ2A 2TRXA 3UVHA 5DALA 3DXBA 3IPZA 2H6ZA 3E3EA 1X5CA 1GTIA 3A2WA 4JU5A 2DJ2A 3ZREA 3P2AA 5ECNB 2PN8A 1SYRA 4MNNA 1O85A 4N11A 1TRSA 2MMNA 4TXOB 2O85A 2X49A 5AIVA 2H1AA 4MF7A 3DKSA 4MMMA 4OD7A 2YANA 4DSQA 1JLWA 2C3NA 2CT6A 1GTBA 1KNGA 4MJEA 3D4MA 1EOHA 3FK8A 4PGTA 2FD3A 1LJRA 2WRTA 2RM6A 3HXSA 2C1YA 1XZOA 2K18A 3VK9A 2OE1A 5LD0A 1PKZA 5IM9A 1G0TA 1ON4A 5DAKA 2WCIA 4X4JA 4EDYA 2KLXA 5LNKe 4MDCA 4IP1A 3CMIA 3FHKA 3R3EA 3H79A 1EWXA 4I2TA 3LORA 19GSA 3DIEA 1TK8B 3RAZA 2H6XA 4HZ2A 6GSUA 2H19A 4XHMA 1H75A 3F6DA 2H74A 4MCUA 2R0PA 5HR1A 1RQMA 1EOGA 3GTUB 4PQIA 4QQ7A 2DJ3A 3CWGA 3FR6A 4ZB9A 5INYA 3EE2A 4V2NA 5GAND 3CTGA 3MYDA 3HJPA 3TOUA 5A34B 3US3A 1T1VA 1M99A 3GX8A 4PUFC 4KSOA 4RUVA 1GNEA 2L6DA 2CZ3A 3KMNA 1SKSB 4IJIA 2RUEA 1FG4A 4IELA 1Z7RA 3GX0A 3K8NA 2VCZA 1NHOA 2AUVA 4ML1A 4MJAA 5DALB 1F2EA 2B5EA 2EFDA 3KCMA 20GSA 2ZCTA 3KMOA 1F3AA 2X8CA 2CX3A 3IAS2 1MDIA 4KUNA 1HD2A 2YWIA 3TRPA 1FO5A 4KH7A 2CQ9A 3L78A 1GULA 4N0ZA 2C0GA 2LJAA 4GSSA 3LG6A 3GL3A 2LRNA 2H75A 2VCQA 2XPDA 5JWOB 3TKSA 2M72A 3QFBC 2PVQA 4V2MA 2AV4A 3H8QA 2FA4A 3BBYA 2H1DA 1XW5A 2VLVA 5B6MA 4K5RA 1THOA 3VLNA 1NM3A 4E68A 2DLXA 5DAKB 5ECPB 1J9BA 4BWSA 1QGVA 2NDOA 4J56E 4N10A 4F2IA 5HR3A 3EURA 1WJKA 1KEBA 5DJMA 2OE0A 2PGTA 4K7IA 1T8EB 4PUAA 3E0UA 3TJFA 5KN2A 1X9MB 4G10A 3U5RE 3VWVA 3LSZA 3V1WA 2F8FA 3F3RA 2FLSA 1TK0B 3DVXA 16GSA 1Z7PA 1O6JA 1K0MA 5ECKB 1VF3A 4OMVA 1TXXA 1E2YA 1MD3A 1URMA 4CHSA 3W8JA 2PERA 3GH6A 4TN8A 5G5EA 5KEJA 2IPAA 2RUFA 1DE1A 4CY8A 3A2XA 4MPFA 2HXKA 3P7XA 2R3XA 2I1UA 2JU5A 1XXUA 2QA2A 1BJXA 2X8HA 3DYRA 3Q6OA 1AXDA 5D9XA 1ZMAA 3P8WA 2B5YA 1XWCA 4YQUA 2BMXA 4POKA 3GUSA 2N5AA 3OR5A 1PX6A 5B7CA 1GNWA 4FYCA 5EL8A 4G01A 3Q19A 2VIMA 2OT3A 1Y25A 4ULXA 1U87A 1YEXA 4BL7A 4K6XA 4WETA 2N5BA 3FR3A 3IBHA 4NXIA 1K0OA 2HQTA 1S3DA 1NHYA 2C0DA 1Z3EA 5AISA 7GSSA 4IQ1A 1ZGNA 4MLYA 3QOUA 1AQWA 5A4VA 4K9ZA 4NV5A 3L4NA 2PPTA 3J7Yk 2MMAA 3UVTA 1I5GA 1Z6NA 4KAEA 3F63A 4KCEA 1EV9A 2K8SA 2GSTA 5IOXA 1GUKA 3ERFA 4BWQA 17GSA 2L59A 4XIHA 2QA1A 5D9TA 1Y1UA 4PNGA 4FH8A 4CY6A 4LMWA 2VKZG 1M0UA 3BCIA 4F0BA 2G0FA 1X0RA 6GSXA 1TU7A 3KXOA 2HSHA 2VLTA 1R26A 4L8EA 3DEXA 2YWMA 22GSA 1XOAA 2M46A 2V41A 2LUSA 5DJLA 3WT1A 1MDKA 3LYPA 2UV8G 4NAXA 4ECBA 2HRKA 5G1KA 3HHVA 2IMDA 1SKRB 2R0GA 2V6KA 3FMWA 1OVNA 2XHFA 1AW9A 2EIQA 1ZYQB 1AAZA 2YCDA 1T4ZA 5H5SA 4ZILA 4HU7A 2MZCA 3RPPA 2GS3A 13GSA 5J5NA 1OE8A 4JRRA 2O5VA 4WEYA 3ZL5A 2JADA 1GSDA 1YQ1A 4F0CA 4LL4B 8GSSA 1V9WA 3LEFA 4IHUA 3MIXA 2H0HA 3MDKA 5D93A 3BD2A 3N9JA 3EC3A 4V1Ag 2H8LA 4O92A 5CREA 2NPBA 5A5KA 3P90A 3ZIVA 1F6MC 2NTOA 4Z7XA 2PBJA 2DIZA 4TXOA 2IFQA 4I97A 4YAVA 4NV2A 5ID2A 1TKDB 1W89A 3M8NA 5J4UA 3VWUA 1A8LA 4ECCA 1SENA 2GGTA 3FZAA 4JBBA 3TKQA 4EIQA 5ECIB 1PD21 1A0RP 3ZFLA 5LCZA 5ECOB 2CVBA 1MD4A 14GSA 2LSTA 4J2FA 2OKAA 1HYUA 4TOPA 4ZBBA 4PXOA 2B5XA 1U3AA 2I3YA 3L9VA 4A5PA 2HSYA 1C72A 2IJYA 3KD0A 3ZITA 3Q74A 4ISDA 4ZBDA 2L4CA 3GKMA 4ZB6A 3DD3A 3VWXA 3IDVA 4G0KA 1WWJA 1ACVA 3VI7A 1YF1A 3ZTLA 2HRKB 3IC8A 2D2ZA 4JR4A 2HNLA 1ZYEA 3EVIA 5CRHA 1PSQA 2ES7A 3QCPA 3WYWA 2LNTA 4PX1A 2GDRA 1JZOA 2DC5A 2H1LA 5GSTA 1YZXA 3HYPA 1A24A 4K0NA 1SYXA 5A34A 4KF9A 3LXTA 2VCWA 6GSYA 2PUKC 4OO5A 3FY7A 1GRXA 5CAXA 1X5EA 2ALBA 3W6GA 2N5FA 2AJQB 1SD8A 5B8BA 4GF0A 1BEDA 1FVKA 3EYTA 3GV1A 1M7TA 1NSWA 3N5OA 3M1GA 5J9BA 2HRNA 4EVMA 1HNBA 5KN1A 3ZZXA 5ID2B 2IFQB 3C7MA 3CRTA 2EIRA 2JZRA 1K0AA 1OC8A 3HVXA 4ZBAA 4IS0A 4XS1A 1F9MA 3TKSC 4TR4A 4JZQA 1T3BA 3GA4A 2RM5A 3IA1A 3I9V2 2J23A 3KM6A 1SJ6A 4G0LA 4TR3A 1TK5B 2GQLA 2IMIA 1XVQA 1SK0A 1TXUA 4DSRA 2R6KA 4ZB7A 9GSSA 2H0IA 5IMDA 4Z2RA 2H6YA 2YV7A 3F6FA 2LS5A 3MNGA 3MSZA 4LL1B 1SL0B 3WD6A 3H4KA 2LQQA 3ZMLA 1SJZA 5DVBA 4GXZA 3FW2A 4X43A 3PGTA 2E2MA 3LYKA 4HS1A 1QXHA 1GUHA 1N8JA 4E8HA 1BX9A 2PU9C 1B48A 1U3IA 2OBIA 1FB6A 2LQOA 3U6VA 3E9JB 4O5QA 2K9FA 3CYNA 5FWGA 5L71A 2DKHA 4FO5A 4XS6A 3I43A 4KA0A 3PPUA 2H71A 4KDUA 5DQYA 2XPEA 3F4SA 3ZRDA 2DIYA 4EDZA 2TIRA 5IO0A 2X8GA 1PGTA 1TI1A 3F0IA 1IYHA 4ECIA 3HZ8A 1XCCA 2DBCA 3TB2A 1GLPA 5D96A 1CQHA 4WR5A 4LA1A 4TVEA 4K5SA 4BVYA 3IV4A 2DJJA 1BAYA 11GSA 1GSUA 3HDCA 3LQ7A 4ZL7A 3O6TA 1WP0A 3CSIA 3KP9A 3VPQA 3ZFBA 3VURA 3QD9A 1ZOFA 3CTFA 1YY7A 1PN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCO A;  4FYB A;  2H30 A;  3HZ4 A;  1XIY A;  5J41 A;  3HCZ A;  3HVV A;  2WDU A;  2V6O A;  3TJB A;  1H4O A;  2JZT A;  3WGE A;  1Z9H A;  4ZB8 A;  3F4T A;  1XWK A;  2H66 A;  2QSI A;  2VL2 A;  2YJH A;  4K0G A;  3APQ A;  3I69 A;  2P5R A;  1CQG A;  1ML6 A;  3GKN A;  2VLU A;  5IO2 A;  4OCF A;  1WE0 A;  3IK9 A;  3RHC A;  1GLQ A;  4DVC A;  2P0G A;  4QL9 A;  1GUM A;  3QAG A;  3O3T A;  4MAB A;  3UBL A;  4F9Z A;  4TR0 A;  4XCS A;  2GZY A;  5IMZ A;  3PR8 A;  2Z9S A;  1YF0 A;  5F07 A;  3TUE A;  1A2L A;  4LLR A;  1VRS D;  4GLT A;  4HZ4 A;  1B9X C;  2AHE A;  5IMF A;  4FYU A;  3GST A;  2OAC A;  3W8S A;  4IW9 A;  4GRF A;  1VF2 A;  2JSZ A;  2B6M A;  5IMV A;  6GSV A;  3FYG A;  2WFC A;  2V1M A;  1TDI A;  2YJ7 A;  2FA8 A;  3LWA A;  4G2E A;  3C1S A;  2YP6 A;  3QR6 A;  6GST A;  3GKX A;  1OE7 A;  4G0I A;  4OCE A;  3ZVJ D;  1M2B A;  2FWH A;  5DBQ A;  5F06 A;  2FWG A;  4BVY B;  2JSY A;  3TJJ A;  4HQS A;  1R4W A;  2BTO T;  3ZYW A;  2VL9 A;  5ABR A;  1PMT A;  3GKK A;  5JCG A;  2HI7 A;  3GUR A;  4I6X A;  2HFD A;  2IMK A;  4RI7 A;  2VOC A;  2C0E A;  2B1L A;  1IYI A;  3O76 A;  1HNC A;  3GL5 A;  1OAZ A;  3GIX A;  2H76 A;  2H73 A;  5ECM B;  5IIZ A;  3J7Y b;  5AGY A;  1ERV A;  2GSR A;  3M9K A;  1U6T A;  2HYX A;  2L5O A;  4BPY A;  2F3M A;  4I2U A;  2F9S A;  2FNO A;  3H1N A;  3A2V A;  2IME A;  3EWL A;  2O89 A;  2L4Q A;  3C73 A;  5DCG A;  3LFL A;  4IVF A;  4L5O A;  4CW9 A;  3F3Q A;  4IJ3 A;  2C8U A;  3ERW A;  4OWY A;  5G31 A;  2H72 A;  1O81 A;  3RDW A;  5DDL A;  3FEU A;  3D21 A;  3KJY A;  1V40 A;  4YAP A;  1M2D A;  3KH7 A;  3UEM A;  3WT2 A;  1YEP A;  5AN1 A;  3EU4 A;  1TRV A;  3ZIJ A;  1AQV A;  2H01 A;  4EF0 A;  1AIU A;  3IC4 A;  2FWE A;  2H0G A;  1XPV A;  3KZQ A;  4K8M A;  12GS A;  2IL3 A;  1M2A A;  3KTB A;  4IBP A;  2XBQ A;  3KGK A;  1MDJ A;  5ELG A;  2DJ0 A;  3DGQ A;  1G7E A;  1SL1 B;  1GSY A;  4Q5F A;  1GP1 A;  2VL3 A;  1EV4 A;  5IOW A;  4MJC A;  1EEJ A;  3GNJ A;  3EU3 A;  4KB3 A;  1GTA A;  2HE3 A;  4GCI A;  4KDY A;  2I4A A;  4AF2 A;  2NBS A;  4MH2 A;  4JED A;  2QKE A;  1O73 A;  2FGX A;  4NHW A;  4OO4 A;  3D0Z A;  2V2G A;  4D73 A;  1R5A A;  1XWG A;  1G7O A;  2HLS A;  1THX A;  2R4V A;  4FQU A;  3HVS A;  1TTZ A;  3IR4 A;  1XWA A;  4TRX A;  4POL A;  2G2Q A;  2LEG A;  1ERT A;  3A3T A;  3UL3 A;  5CYY A;  4Q5Q A;  5E59 A;  1PL2 A;  2HSM A;  5FHI A;  1O8W A;  1ZZY A;  5EPF A;  2O87 A;  4POB A;  3CSH A;  4L0U A;  3HJO A;  3IK7 A;  3ZLP A;  3UBK A;  4WBJ A;  3TGZ A;  4YQV A;  1SK1 A;  3IRA A;  5IPH A;  1R7H A;  2R5G A;  1X5D A;  3G9B A;  2E0Q A;  3I6A A;  2CA8 A;  2AB6 A;  1QMV A;  1N2A A;  2B7J A;  4NWY A;  1VGL A;  1A2J A;  5HFG A;  4N0V A;  1JHB A;  1X9S B;  3KEB A;  4O32 A;  3M3M A;  2VAF A;  5DQS A;  1QUW A;  1OC9 B;  4KE3 A;  1TI3 A;  1X9W B;  5ECS A;  1M9B A;  2DML A;  4NMU A;  4EL1 A;  1QK8 A;  3ZMK A;  2OA7 A;  5J3R A;  4O5R A;  2AAW A;  3KH9 A;  4TR1 B;  3G7J A;  2GQM A;  2PMT A;  2HSN B;  3DRN A;  4LMV A;  5ECR B;  1NW2 A;  1AQX A;  3GMF A;  1XFL A;  4G9H A;  1EP7 A;  1EGR A;  1VF1 A;  1PRX A;  5GAP D;  2CX4 A;  3D22 A;  2LRT A;  3TRX A;  2DJ1 A;  3WGX A;  5CRD A;  5CRW A;  3QMX A;  1DSB A;  1B4P A;  1SK2 A;  1O8X A;  3PIN A;  4JE1 A;  2I81 A;  2BJX A;  3PH9 A;  4D73 B;  4BVX A;  3TJG A;  3FRC A;  1U88 A;  2YOI A;  5D8I A;  3VFI A;  5H5R A;  3Q18 A;  5DCH A;  2CZ2 A;  4MF6 A;  4KW6 A;  1K0B A;  4IP6 A;  2DJK A;  1TRW A;  2FWF A;  2UZ8 A;  2HZE A;  3BJ5 A;  1GH2 A;  1G6W A;  4FIW A;  4GQC A;  2VL2 C;  2HSM B;  4NPB A;  5ECL B;  1YDK A;  2PWJ A;  1GSQ A;  2F8A A;  2L6C A;  5CP1 A;  3FR9 A;  2VUP A;  5G1L A;  2XBI A;  1TP9 A;  4IKH A;  3IXR A;  1QFN A;  1DBY A;  1FB0 A;  4ZXG A;  1Q4J A;  1HQO A;  3RBT A;  2C4J A;  3KP8 A;  4MK3 A;  2C80 A;  4USS A;  4XRA A;  1DUG A;  3NOF A;  1ILO A;  3FKF A;  5CO3 A;  4ID0 A;  2E7P A;  4EUY A;  2VO4 A;  1SKW B;  2VD1 A;  4F82 A;  4V1A p;  4X0X A;  2X99 A;  2R2J A;  2GZZ A;  2PVO C;  2VM1 A;  5IQY A;  1UA5 A;  2VCV A;  2QC7 A;  3CBU A;  2CAQ A;  5KN3 A;  1DE2 A;  1MTC A;  1XW9 A;  1PKW A;  1GSS A;  3ISO A;  1ZCP A;  4OFT A;  2VD0 A;  3IAM 2;  2B1K A;  3NIV A;  1Z6M A;  4KX4 A;  2HT9 A;  1F3B A;  1A23 A;  4GQF A;  1KBN A;  2YZH A;  4ZL9 A;  5C00 A;  3L0H A;  1PL1 A;  1E6B A;  4RQX A;  1ERW A;  4NHZ A;  4WR4 A;  4KGI A;  5GSS A;  4ILF A;  5EY6 A;  2YPM A;  1GSE A;  2ON5 A;  2VM2 A;  5A4W A;  4GTU A;  4TKY A;  3R2Q A;  1A2M A;  3F4R A;  4I8B A;  3IHQ A;  2ON7 A;  4XS4 B;  3HA9 A;  2H1B A;  1K3Y A;  1ERU A;  2KOK A;  3M0F A;  1GSF A;  2FY6 A;  3VWW A;  4BVX B;  3WGD A;  3QAW A;  4ACS A;  2FHE A;  4WF5 A;  4DSS B;  2CVD A;  4MH3 A;  1AUC A;  4YQM A;  1Q98 A;  2P5Q A;  1ZL9 A;  3FZ4 A;  2NVL A;  1BG5 A;  2MMZ A;  2HZE B;  2JZS A;  1GL8 A;  3NZN A;  1WPI A;  1B4Q A;  1PA3 A;  3GFK A;  3EMP A;  1SJI A;  1W4V A;  3TRQ A;  1JZW A;  2LJR A;  3IE3 A;  4HDE A;  4ML6 A;  5HQP A;  1A8Y A;  4K7O A;  2V32 A;  4MP4 A;  5A4U A;  2L5L A;  2P31 A;  4AGS A;  5G2Z A;  2OJL A;  3HKR A;  4Q5R A;  1I9D A;  5FT3 A;  1K0D A;  2J9H A;  4G19 A;  4F03 A;  4PQ1 A;  1JFU A;  4E8E A;  1S3A A;  4HUA A;  1MEK A;  4RQR A;  3UJ1 A;  2KP2 A;  1RW1 A;  2H70 A;  2I9H A;  2GQK A;  2EC4 A;  5IMA A;  5EVO A;  6GSS A;  2A4V A;  2YN1 A;  3JCM L;  3TKS E;  1TW9 A;  1FAA A;  3GYK A;  4H86 A;  2K6V A;  2XC2 A;  2A2R A;  1TOF A;  10GS A;  1K0N A;  3IOS A;  2WJU A;  1PQN A;  1T7P B;  3SBC A;  5ECQ B;  4I5Q A;  2WS2 A;  1F37 A;  3S9F A;  5HR2 A;  4MA9 A;  3LXZ A;  5F05 A;  1YKC A;  1EZK A;  2GT6 A;  2RII A;  3C1R A;  3LGC A;  3D6I A;  2HZF A;  3TOT A;  2WGR A;  5B8A A;  5KN0 A;  1J08 A;  1B9Y C;  2JAC A;  2B7K A;  1V58 A;  3GN3 A;  2ZUP A;  2HRF A;  2LJK A;  5CNW A;  5D73 A;  1O7U A;  2O7K A;  1XW6 A;  4K1F A;  4N30 A;  4Q5N A;  5D9V A;  1J0F A;  4L5L A;  4GWR A;  2IMF A;  4CDO A;  5JWR B;  2GT5 A;  4MZW A;  2AYT A;  3QPM A;  5B6N A;  5ECH B;  2EIO A;  5HFK A;  4MJB A;  3MWH A;  1V57 A;  1G6Y A;  2L57 A;  2QGV A;  2YWO A;  3QAV A;  2YWN A;  1FW1 A;  4ZL8 A;  3VPT A;  5COH A;  3TKR A;  3UIW A;  5F0G A;  2MYG A;  1SL2 B;  3CRU A;  1HNA A;  3AY8 A;  3UOM A;  2A2S A;  1ST9 A;  2DSA A;  1EP8 A;  4X1U A;  2REM A;  2C3T A;  1EEM A;  3FZ5 A;  3LJR A;  3DVW A;  3A5W A;  2GZP A;  1BQ7 A;  2B3S A;  4PUR A;  1GWC A;  1Z5Y E;  1VF4 A;  4HU9 A;  3G7I A;  3ERG A;  2GLR A;  4EC0 A;  2ZNM A;  4WXT A;  3KIJ A;  1JZR A;  2MBT A;  3L9S A;  2FCH A;  2YNX A;  2VCT A;  4L0W A;  3H93 A;  1SU9 A;  2F51 A;  2O8V B;  1OC9 A;  3ME7 A;  4PTS A;  4AJ8 A;  1OC3 A;  1LU4 A;  1QQ2 A;  3ME8 A;  4HJM A;  3QFA C;  4WKW A;  2TRC P;  4IQA A;  1YKA A;  4OFN A;  1V2A A;  1XWB A;  4QL7 A;  4TR1 A;  5IMC A;  1FOV A;  2H1G A;  5GZZ B;  3C71 A;  5BMU A;  4KND A;  3GHA A;  2KHP A;  4K7N A;  1ABA A;  3APS A;  1FVJ A;  3D5J A;  1UC7 A;  1UVZ A;  1BYE A;  1B8X A;  2RLI A;  4XTS A;  4GST A;  4HQZ A;  2MMO A;  1A0F A;  3DML A;  1K3L A;  2WB9 A;  4EO3 A;  1WIK A;  4ECJ A;  4HOJ A;  1K0C A;  3UAR A;  2CVK A;  1UN2 A;  2IWT A;  2DMM A;  1EGO A;  2YV9 A;  1OKD A;  2IN3 A;  4MZB A;  4WF4 A;  1TJD A;  5CRG A;  2OBK A;  5G30 A;  3CSJ A;  4MF5 A;  1WOU A;  4DEJ A;  3F9U A;  3SWL A;  5C04 A;  4KDX A;  3MAK A;  4K2D A;  4HI7 A;  4MZC A;  2GSQ A;  3GSS A;  4WBR D;  5E4W A;  3UMA A;  1KTE A;  1OYJ A;  3TKP A;  5IPG A;  1WRY A;  3ZVJ A;  4EKZ A;  3BOA A;  2OE3 A;  2LV3 A;  2CV4 A;  3KTL A;  1Y6E A;  3HJM A;  2LKU A;  3C8E A;  3TJK A;  4GSN A;  2C0F A;  4HEA 2;  2VCX A;  3RHB A;  3D4T A;  1PX7 A;  3UAP A;  4BL7 B;  4AJ7 A;  1T00 A;  4O7H A;  1OKT A;  1JLV A;  1GTU A;  3VI5 A;  1YJ6 A;  4P3Y B;  4JR6 A;  4TW5 A;  4IGJ A;  1K3O A;  4KSM A;  4RI6 A;  4J57 E;  5G5F A;  5HFI A;  2LRC A;  4EE0 A;  3DWV A;  1TU8 A;  4PQH A;  4PNF A;  2K8V A;  1R5P A;  2WZ9 A;  3M9J A;  5JCU A;  1USB A;  5H5Q A;  3GH9 A;  4EXJ A;  2KP1 A;  4IN0 A;  3EIN A;  4ZIJ A;  3CXG A;  3HY2 A;  1WMJ A;  3ED3 A;  1TRU A;  3TDG A;  4POM A;  4KCA A;  2R37 A;  2LNS A;  5ELA A;  1AC1 A;  1PN9 A;  1XVW A;  2GSS A;  2LTK A;  2X64 A;  3EMX A;  2OAD A;  1SD9 A;  2GTU A;  1XOB A;  3BCK A;  4MPG A;  4TXV A;  3HD5 A;  2IIY A;  3QDN A;  2HRA A;  2GVP A;  1XBS A;  4YH2 A;  2YZU A;  1T4Y A;  4AJ6 A;  3APO A;  2FUG 2;  2KUC A;  3GTU A;  3RPN A;  1FHE A;  2E2G A;  2WUL A;  5JCW A;  3G7Y A;  4XS4 A;  3L9U A;  18GS A;  5JWQ B;  1LBK A;  6GSW A;  5J9C A;  4V2L A;  2JL4 A;  3GRX A;  1JZD A;  5ENU A;  2M80 A;  2C3Q A;  5HR0 A;  1V98 A;  4DSS A;  5D9W A;  1S3C A;  1RK4 A;  4XRD A;  5F8B A;  3FZ9 A;  2CAI A;  3F8U A;  4BA7 A;  2MBS A;  5AIX A;  1M9A A;  4OFM A;  4HJ2 A;  2TRX A;  3UVH A;  5DAL A;  3DXB A;  3IPZ A;  2H6Z A;  3E3E A;  1X5C A;  1GTI A;  3A2W A;  4JU5 A;  2DJ2 A;  3ZRE A;  3P2A A;  5ECN B;  2PN8 A;  1SYR A;  1O85 A;  4N11 A;  1TRS A;  2MMN A;  4TXO B;  2O85 A;  5AIV A;  2H1A A;  4MF7 A;  3DKS A;  4MMM A;  4OD7 A;  2YAN A;  4DSQ A;  1JLW A;  2C3N A;  2CT6 A;  1GTB A;  1KNG A;  4MJE A;  3D4M A;  1EOH A;  3FK8 A;  4PGT A;  2FD3 A;  1LJR A;  2WRT A;  2RM6 A;  3HXS A;  2C1Y A;  1XZO A;  2K18 A;  3VK9 A;  2OE1 A;  5LD0 A;  1PKZ A;  5IM9 A;  1G0T A;  1ON4 A;  5DAK A;  2WCI A;  4EDY A;  2KLX A;  5LNK e;  4MDC A;  4IP1 A;  3CMI A;  3FHK A;  3R3E A;  3H79 A;  1EWX A;  4I2T A;  3LOR A;  19GS A;  3DIE A;  1TK8 B;  3RAZ A;  2H6X A;  4HZ2 A;  6GSU A;  2H19 A;  4XHM A;  1H75 A;  3F6D A;  2H74 A;  4MCU A;  5HR1 A;  1RQM A;  1EOG A;  3GTU B;  4PQI A;  4QQ7 A;  2DJ3 A;  3FR6 A;  4ZB9 A;  5INY A;  3EE2 A;  4V2N A;  5GAN D;  3CTG A;  3HJP A;  3TOU A;  3US3 A;  1T1V A;  1M99 A;  3GX8 A;  4PUF C;  4KSO A;  4RUV A;  1GNE A;  2L6D A;  2CZ3 A;  3KMN A;  1SKS B;  4IJI A;  2RUE A;  1FG4 A;  4IEL A;  1Z7R A;  3GX0 A;  3K8N A;  2VCZ A;  1NHO A;  2AUV A;  4ML1 A;  4MJA A;  5DAL B;  1F2E A;  2B5E A;  3KCM A;  20GS A;  2ZCT A;  3KMO A;  1F3A A;  2X8C A;  2CX3 A;  3IAS 2;  1MDI A;  4KUN A;  1HD2 A;  2YWI A;  3TRP A;  1FO5 A;  4KH7 A;  2CQ9 A;  3L78 A;  1GUL A;  4N0Z A;  2C0G A;  2LJA A;  4GSS A;  3LG6 A;  3GL3 A;  2LRN A;  2H75 A;  2VCQ A;  2XPD A;  5JWO B;  3TKS A;  2M72 A;  3QFB C;  2PVQ A;  4V2M A;  2AV4 A;  3H8Q A;  2FA4 A;  3BBY A;  2H1D A;  1XW5 A;  2VLV A;  5B6M A;  1THO A;  3VLN A;  1NM3 A;  2DLX A;  5DAK B;  5ECP B;  1J9B A;  4BWS A;  1QGV A;  2NDO A;  4J56 E;  4N10 A;  4F2I A;  5HR3 A;  3EUR A;  1WJK A;  1KEB A;  5DJM A;  2OE0 A;  2PGT A;  4K7I A;  1T8E B;  4PUA A;  3E0U A;  3TJF A;  5KN2 A;  1X9M B;  4G10 A;  3U5R E;  3VWV A;  3LSZ A;  3V1W A;  2F8F A;  3F3R A;  2FLS A;  1TK0 B;  3DVX A;  16GS A;  1Z7P A;  1O6J A;  1K0M A;  5ECK B;  1VF3 A;  4OMV A;  1TXX A;  1E2Y A;  1MD3 A;  1URM A;  4CHS A;  3W8J A;  2PER A;  3GH6 A;  4TN8 A;  5G5E A;  5KEJ A;  2IPA A;  2RUF A;  1DE1 A;  3A2X A;  4MPF A;  2HXK A;  3P7X A;  2R3X A;  2I1U A;  2JU5 A;  1XXU A;  1BJX A;  2X8H A;  3DYR A;  3Q6O A;  1AXD A;  5D9X A;  1ZMA A;  3P8W A;  2B5Y A;  1XWC A;  4YQU A;  2BMX A;  4POK A;  3GUS A;  2N5A A;  3OR5 A;  1PX6 A;  5B7C A;  1GNW A;  4FYC A;  5EL8 A;  3Q19 A;  2VIM A;  1Y25 A;  4ULX A;  1U87 A;  1YEX A;  4BL7 A;  4K6X A;  4WET A;  2N5B A;  3FR3 A;  3IBH A;  4NXI A;  1K0O A;  2HQT A;  1S3D A;  1NHY A;  2C0D A;  1Z3E A;  5AIS A;  7GSS A;  4IQ1 A;  1ZGN A;  4MLY A;  3QOU A;  1AQW A;  5A4V A;  4K9Z A;  4NV5 A;  3L4N A;  2PPT A;  3J7Y k;  2MMA A;  3UVT A;  1I5G A;  1Z6N A;  4KAE A;  3F63 A;  4KCE A;  1EV9 A;  2K8S A;  2GST A;  5IOX A;  1GUK A;  3ERF A;  4BWQ A;  17GS A;  2L59 A;  4XIH A;  5D9T A;  4PNG A;  4FH8 A;  4LMW A;  1M0U A;  3BCI A;  4F0B A;  2G0F A;  1X0R A;  6GSX A;  1TU7 A;  3KXO A;  2HSH A;  2VLT A;  1R26 A;  4L8E A;  3DEX A;  2YWM A;  22GS A;  1XOA A;  2M46 A;  2V41 A;  2LUS A;  5DJL A;  3WT1 A;  1MDK A;  3LYP A;  4NAX A;  4ECB A;  2HRK A;  5G1K A;  3HHV A;  2IMD A;  1SKR B;  2V6K A;  1OVN A;  2XHF A;  1AW9 A;  2EIQ A;  1ZYQ B;  1AAZ A;  2YCD A;  1T4Z A;  5H5S A;  4ZIL A;  4HU7 A;  2MZC A;  3RPP A;  2GS3 A;  13GS A;  5J5N A;  1OE8 A;  4JRR A;  4WEY A;  3ZL5 A;  2JAD A;  1GSD A;  1YQ1 A;  4F0C A;  4LL4 B;  8GSS A;  1V9W A;  3LEF A;  4IHU A;  2H0H A;  3MDK A;  5D93 A;  3BD2 A;  3N9J A;  3EC3 A;  4V1A g;  2H8L A;  4O92 A;  5CRE A;  2NPB A;  5A5K A;  3P90 A;  3ZIV A;  1F6M C;  2NTO A;  4Z7X A;  2PBJ A;  2DIZ A;  4TXO A;  2IFQ A;  4I97 A;  4YAV A;  4NV2 A;  5ID2 A;  1TKD B;  1W89 A;  3M8N A;  5J4U A;  3VWU A;  1A8L A;  4ECC A;  1SEN A;  2GGT A;  3FZA A;  4JBB A;  3TKQ A;  5ECI B;  1PD2 1;  1A0R P;  3ZFL A;  5LCZ A;  5ECO B;  2CVB A;  1MD4 A;  14GS A;  2LST A;  4J2F A;  2OKA A;  1HYU A;  4TOP A;  4ZBB A;  4PXO A;  2B5X A;  1U3A A;  2I3Y A;  3L9V A;  2HSY A;  1C72 A;  2IJY A;  3KD0 A;  3ZIT A;  3Q74 A;  4ISD A;  4ZBD A;  2L4C A;  3GKM A;  4ZB6 A;  3DD3 A;  3VWX A;  3IDV A;  4G0K A;  1WWJ A;  1ACV A;  3VI7 A;  1YF1 A;  3ZTL A;  2HRK B;  3IC8 A;  2D2Z A;  4JR4 A;  2HNL A;  1ZYE A;  3EVI A;  5CRH A;  1PSQ A;  2ES7 A;  3QCP A;  3WYW A;  2LNT A;  4PX1 A;  2GDR A;  1JZO A;  2DC5 A;  5GST A;  1YZX A;  3HYP A;  1A24 A;  4K0N A;  1SYX A;  4KF9 A;  3LXT A;  2VCW A;  6GSY A;  2PUK C;  4OO5 A;  3FY7 A;  1GRX A;  5CAX A;  1X5E A;  2ALB A;  3W6G A;  2N5F A;  2AJQ B;  1SD8 A;  5B8B A;  4GF0 A;  1BED A;  1FVK A;  3EYT A;  3GV1 A;  1M7T A;  1NSW A;  3N5O A;  3M1G A;  5J9B A;  2HRN A;  4EVM A;  1HNB A;  5KN1 A;  3ZZX A;  5ID2 B;  2IFQ B;  3C7M A;  3CRT A;  2EIR A;  2JZR A;  1K0A A;  1OC8 A;  3HVX A;  4ZBA A;  4IS0 A;  4XS1 A;  1F9M A;  3TKS C;  4TR4 A;  4JZQ A;  1T3B A;  3GA4 A;  2RM5 A;  3IA1 A;  3I9V 2;  2J23 A;  3KM6 A;  1SJ6 A;  4G0L A;  4TR3 A;  1TK5 B;  2GQL A;  2IMI A;  1XVQ A;  1SK0 A;  4DSR A;  2R6K A;  9GSS A;  2H0I A;  5IMD A;  2H6Y A;  2YV7 A;  3F6F A;  2LS5 A;  3MNG A;  3MSZ A;  4LL1 B;  1SL0 B;  3WD6 A;  3H4K A;  2LQQ A;  3ZML A;  1SJZ A;  5DVB A;  4GXZ A;  3FW2 A;  4X43 A;  3PGT A;  2E2M A;  3LYK A;  4HS1 A;  1QXH A;  1GUH A;  1N8J A;  4E8H A;  1BX9 A;  2PU9 C;  1B48 A;  1U3I A;  2OBI A;  1FB6 A;  2LQO A;  3U6V A;  3E9J B;  2K9F A;  3CYN A;  5FWG A;  5L71 A;  4FO5 A;  4XS6 A;  3I43 A;  4KA0 A;  3PPU A;  2H71 A;  4KDU A;  5DQY A;  2XPE A;  3F4S A;  3ZRD A;  2DIY A;  4EDZ A;  2TIR A;  5IO0 A;  2X8G A;  1PGT A;  1TI1 A;  3F0I A;  1IYH A;  4ECI A;  3HZ8 A;  1XCC A;  2DBC A;  3TB2 A;  1GLP A;  5D96 A;  1CQH A;  4WR5 A;  4LA1 A;  4TVE A;  4BVY A;  3IV4 A;  2DJJ A;  1BAY A;  11GS A;  1GSU A;  3HDC A;  3LQ7 A;  4ZL7 A;  3O6T A;  1WP0 A;  3CSI A;  3KP9 A;  3VPQ A;  3ZFB A;  3VUR A;  3QD9 A;  1ZOF A;  3CTF A;  1YY7 A; 
#chains in the Genus database with same CATH topology
 3TCO A;  4FYB A;  2H30 A;  3HZ4 A;  1XIY A;  5J41 A;  3HCZ A;  3HVV A;  2WDU A;  2V6O A;  3TJB A;  1H4O A;  2JZT A;  3WGE A;  1Z9H A;  4ZB8 A;  3TU3 B;  3F4T A;  1XWK A;  2H66 A;  2QSI A;  4EIP A;  2VL2 A;  2YJH A;  4K0G A;  3APQ A;  3I69 A;  2P5R A;  1CQG A;  1ML6 A;  3GKN A;  2VLU A;  5IO2 A;  4OCF A;  1WE0 A;  3IK9 A;  3RHC A;  1GLQ A;  4DVC A;  2P0G A;  4QL9 A;  1GUM A;  3QAG A;  3O3T A;  4MAB A;  3UBL A;  3CHX C;  4F9Z A;  4TR0 A;  4XCS A;  2GZY A;  5IMZ A;  3PR8 A;  2Z9S A;  1YF0 A;  5F07 A;  3TUE A;  1A2L A;  4LLR A;  4AI6 A;  1VRS D;  4GLT A;  4HZ4 A;  1B9X C;  2AHE A;  5IMF A;  4FYU A;  3GST A;  2OAC A;  3W8S A;  1SVL A;  4IW9 A;  4GRF A;  1VF2 A;  1N25 A;  2WW2 A;  2JSZ A;  2B6M A;  5J4Y A;  5IMV A;  6GSV A;  3FYG A;  1S4B P;  2WFC A;  2V1M A;  1TDI A;  2YJ7 A;  2FA8 A;  3LWA A;  4G2E A;  3C1S A;  4AKH A;  2YP6 A;  3QR6 A;  6GST A;  3GKX A;  1OE7 A;  4G0I A;  4OCE A;  3ZVJ D;  1M2B A;  2FWH A;  5DBQ A;  5F06 A;  4N3Z A;  2FWG A;  4BVY B;  2JSY A;  3TJJ A;  4HQS A;  1R4W A;  2BTO T;  3ZYW A;  2VL9 A;  5ABR A;  1PMT A;  3GKK A;  5JCG A;  2HI7 A;  3GUR A;  4I6X A;  2HFD A;  2IMK A;  4RI7 A;  2VOC A;  2C0E A;  2B1L A;  1IYI A;  3O76 A;  1HNC A;  3GL5 A;  1OAZ A;  3GIX A;  2H76 A;  2A2P A;  2H73 A;  5ECM B;  5IIZ A;  3J7Y b;  5AGY A;  1ERV A;  2GSR A;  3M9K A;  1U6T A;  2HYX A;  2L5O A;  4BPY A;  2F3M A;  4I2U A;  2F9S A;  2FNO A;  3H1N A;  3A2V A;  2IME A;  3EWL A;  2O89 A;  2L4Q A;  3C73 A;  4GDF A;  5DCG A;  3LFL A;  4IVF A;  4L5O A;  4CW9 A;  3F3Q A;  4IJ3 A;  2C8U A;  3ERW A;  4OWY A;  5G31 A;  2H72 A;  1O81 A;  3RDW A;  1SVM A;  5DDL A;  3FEU A;  3D21 A;  3KJY A;  1V40 A;  4YAP A;  1M2D A;  3KH7 A;  3UEM A;  3WT2 A;  1YEP A;  5AN1 A;  3EU4 A;  1TRV A;  3ZIJ A;  1AQV A;  2H01 A;  4EF0 A;  1AIU A;  3IC4 A;  2FWE A;  2H0G A;  1XPV A;  3KZQ A;  4K8M A;  12GS A;  2IL3 A;  1M2A A;  3KTB A;  2HSN A;  4IBP A;  2XBQ A;  3KGK A;  1MDJ A;  5ELG A;  2DJ0 A;  3DGQ A;  1G7E A;  1SL1 B;  1GSY A;  4Q5F A;  1GP1 A;  2VL3 A;  5BRT A;  1EV4 A;  5IOW A;  4MJC A;  1EEJ A;  3GNJ A;  3EU3 A;  4KB3 A;  1GTA A;  2HE3 A;  4GCI A;  4KDY A;  2I4A A;  4AF2 A;  2NBS A;  4MH2 A;  4JED A;  2QKE A;  1O73 A;  2FGX A;  4NHW A;  4OO4 A;  3D0Z A;  2V2G A;  4D73 A;  1R5A A;  1XWG A;  1G7O A;  2HLS A;  1THX A;  2R4V A;  4FQU A;  3HVS A;  1TTZ A;  3IR4 A;  1XWA A;  4TRX A;  4POL A;  2G2Q A;  2LEG A;  1ERT A;  3A3T A;  3UL3 A;  5CYY A;  4Q5Q A;  5E59 A;  1PL2 A;  2HSM A;  5FHI A;  1O8W A;  1ZZY A;  5EPF A;  2O87 A;  4POB A;  3CSH A;  4L0U A;  1I1I P;  3HJO A;  3IK7 A;  3ZLP A;  4YKF A;  3UBK A;  4WBJ A;  3TGZ A;  4YQV A;  1SK1 A;  3IRA A;  5IPH A;  1R7H A;  2R5G A;  1BG1 A;  1X5D A;  3G9B A;  2E0Q A;  3I6A A;  2CA8 A;  2AB6 A;  1QMV A;  1N2A A;  2B7J A;  4NWY A;  1VGL A;  4K2X A;  1A2J A;  5HFG A;  4N0V A;  1JHB A;  1X9S B;  3KEB A;  4O32 A;  3M3M A;  2VAF A;  5DQS A;  1QUW A;  1OC9 B;  4KE3 A;  1TI3 A;  1X9W B;  5ECS A;  4PI0 C;  1M9B A;  2DML A;  4NMU A;  4EL1 A;  1QK8 A;  2R0C A;  2WVZ A;  3ZMK A;  2OA7 A;  2WW1 A;  5J3R A;  5A1N A;  4O5R A;  2AAW A;  3KH9 A;  4TR1 B;  3G7J A;  2GQM A;  2PMT A;  2HSN B;  3DRN A;  5BMU B;  4LMV A;  5ECR B;  1NW2 A;  1AQX A;  1BF5 A;  3GMF A;  1XFL A;  3EPT A;  4G9H A;  1EP7 A;  1EGR A;  1VF1 A;  1PRX A;  5GAP D;  2CX4 A;  3D22 A;  2LRT A;  3TRX A;  2DJ1 A;  3WGX A;  5CRD A;  5CRW A;  3QMX A;  1DSB A;  1B4P A;  1SK2 A;  1O8X A;  3PIN A;  4JE1 A;  2I81 A;  2BJX A;  3PH9 A;  4D73 B;  4BVX A;  3TJG A;  3FRC A;  1U88 A;  2YOI A;  5D8I A;  3VFI A;  5H5R A;  3Q18 A;  5DCH A;  2CZ2 A;  4MF6 A;  4KW6 A;  1K0B A;  4IP6 A;  2DJK A;  1TRW A;  2FWF A;  2UZ8 A;  2HZE A;  3BJ5 A;  1GH2 A;  1G6W A;  4FIW A;  4GQC A;  5KOW A;  2VL2 C;  2HSM B;  4NPB A;  5ECL B;  1YDK A;  2PWJ A;  1GSQ A;  2F8A A;  2L6C A;  5CP1 A;  3FR9 A;  2VUP A;  5G1L A;  2XBI A;  2WW0 A;  1TP9 A;  4IKH A;  3IXR A;  1QFN A;  1DBY A;  2EFH A;  1FB0 A;  4ZXG A;  1Q4J A;  2O3E A;  1HQO A;  3RBT A;  2C4J A;  3KP8 A;  4MK3 A;  2C80 A;  4USS A;  4W66 A;  4XRA A;  1DUG A;  3NOF A;  1ILO A;  3FKF A;  5CO3 A;  1SVO A;  4ID0 A;  2E7P A;  4EUY A;  2VO4 A;  1SKW B;  2VD1 A;  4F82 A;  4V1A p;  4X0X A;  2X99 A;  4Z2U A;  2R2J A;  2GZZ A;  2PVO C;  2VM1 A;  5IQY A;  1UA5 A;  2VCV A;  2QC7 A;  4O5U A;  3CBU A;  2CAQ A;  5KN3 A;  1DE2 A;  1MTC A;  1XW9 A;  1PKW A;  5A1N B;  1GSS A;  3ISO A;  1ZCP A;  4OFT A;  2VD0 A;  3IAM 2;  4YKG A;  2B1K A;  3NIV A;  1Z6M A;  4KX4 A;  1ZYP A;  2HT9 A;  1F3B A;  1A23 A;  4GQF A;  1KBN A;  1M3I A;  2YZH A;  4ZL9 A;  5C00 A;  3L0H A;  1PL1 A;  1E6B A;  4RQX A;  1ERW A;  2A4H A;  4NHZ A;  4WR4 A;  4KGI A;  5GSS A;  4ILF A;  5EY6 A;  2YPM A;  1GSE A;  2ON5 A;  2VM2 A;  5A4W A;  4GTU A;  4TKY A;  3R2Q A;  1A2M A;  3F4R A;  4I8B A;  2X4A A;  3IHQ A;  2ON7 A;  4XS4 B;  3HA9 A;  2H1B A;  1K3Y A;  1ERU A;  2KOK A;  3M0F A;  1GSF A;  2FY6 A;  3VWW A;  4BVX B;  3WGD A;  3QAW A;  4ACS A;  2FHE A;  4WF5 A;  4DSS B;  2CVD A;  4MH3 A;  1AUC A;  2WVY A;  4YQM A;  1Q98 A;  2P5Q A;  1ZL9 A;  3FZ4 A;  2NVL A;  1BG5 A;  2MMZ A;  2HZE B;  2JZS A;  1GL8 A;  5J4V A;  3NZN A;  1WPI A;  1B4Q A;  1PA3 A;  3GFK A;  3EMP A;  1SJI A;  1W4V A;  3TRQ A;  1JZW A;  2LJR A;  3IE3 A;  4HDE A;  4ML6 A;  5HQP A;  1A8Y A;  2EFE A;  4K7O A;  2V32 A;  4MP4 A;  5A4U A;  2L5L A;  2P31 A;  4AGS A;  5G2Z A;  2OJL A;  3HKR A;  4Q5R A;  1I9D A;  5FT3 A;  1K0D A;  5KOX A;  2J9H A;  4G19 A;  4F03 A;  4PQ1 A;  1JFU A;  4E8E A;  1S3A A;  4HUA A;  1MEK A;  4RQR A;  3UJ1 A;  2KP2 A;  1RW1 A;  2H70 A;  2I9H A;  2GQK A;  2EC4 A;  5IMA A;  4AKI A;  5EVO A;  6GSS A;  2A4V A;  2YN1 A;  3JCM L;  3TKS E;  1TW9 A;  1FAA A;  3GYK A;  4H86 A;  2K6V A;  2XC2 A;  2A2R A;  1TOF A;  10GS A;  1K0N A;  3IOS A;  2WJU A;  1PQN A;  3HMJ G;  1T7P B;  3SBC A;  5ECQ B;  4I5Q A;  2WS2 A;  1F37 A;  3S9F A;  1FOH A;  5HR2 A;  4MA9 A;  3LXZ A;  5F05 A;  1YKC A;  1EZK A;  2GT6 A;  2RII A;  3C1R A;  3LGC A;  3D6I A;  2HZF A;  3TOT A;  2DKI A;  2WGR A;  5B8A A;  5KN0 A;  1J08 A;  1B9Y C;  2JAC A;  5J40 A;  2B7K A;  1V58 A;  3GN3 A;  2ZUP A;  2WVX B;  2HRF A;  1YVL A;  2LJK A;  5CNW A;  5D73 A;  1O7U A;  2O7K A;  1XW6 A;  4K1F A;  4N30 A;  4Q5N A;  5D9V A;  1J0F A;  4L5L A;  4GWR A;  2IMF A;  4CDO A;  5JWR B;  2GT5 A;  4MZW A;  2WW3 A;  2AYT A;  3QPM A;  5B6N A;  5ECH B;  2EIO A;  5HFK A;  4MJB A;  3MWH A;  1V57 A;  1G6Y A;  3LW9 A;  2L57 A;  2QGV A;  2YWO A;  3QAV A;  2YWN A;  1FW1 A;  4ZL8 A;  3VPT A;  5COH A;  3TKR A;  3UIW A;  5F0G A;  2MYG A;  1SL2 B;  3CRU A;  1HNA A;  3AY8 A;  3UOM A;  2A2S A;  1ST9 A;  2DSA A;  1EP8 A;  5J47 A;  4X1U A;  2REM A;  2C3T A;  1EEM A;  3FZ5 A;  3LJR A;  3DVW A;  5A5H A;  3A5W A;  2GZP A;  1BQ7 A;  2B3S A;  4PUR A;  1GWC A;  1Z5Y E;  2O36 A;  1VF4 A;  4HU9 A;  3G7I A;  3ERG A;  2GLR A;  4EC0 A;  2ZNM A;  4WXT A;  3KIJ A;  1JZR A;  2MBT A;  3L9S A;  2FCH A;  2YNX A;  2VCT A;  4L0W A;  3H93 A;  1SU9 A;  2F51 A;  2O8V B;  1OC9 A;  3ME7 A;  4PTS A;  4AJ8 A;  4QMK A;  1OC3 A;  1LU4 A;  1QQ2 A;  3ME8 A;  4HJM A;  3QFA C;  4WKW A;  2TRC P;  4IQA A;  1YKA A;  4OFN A;  1V2A A;  1XWB A;  4QL7 A;  4TR1 A;  5IMC A;  1FOV A;  2H1G A;  5GZZ B;  3C71 A;  5BMU A;  4KND A;  3GHA A;  2KHP A;  4K7N A;  1ABA A;  3APS A;  1FVJ A;  3D5J A;  1UC7 A;  1UVZ A;  1BYE A;  1B8X A;  2RLI A;  4XTS A;  4GST A;  4HQZ A;  2MMO A;  1A0F A;  3DML A;  1K3L A;  2WB9 A;  4EO3 A;  1WIK A;  4ECJ A;  4HOJ A;  1K0C A;  3UAR A;  2CVK A;  1UN2 A;  2IWT A;  2DMM A;  1EGO A;  2YV9 A;  1OKD A;  2IN3 A;  4MZB A;  4WF4 A;  1TJD A;  5CRG A;  1S3R A;  2OBK A;  5G30 A;  3CSJ A;  4MF5 A;  1WOU A;  4DEJ A;  3F9U A;  3SWL A;  5C04 A;  4KDX A;  3MAK A;  4K2D A;  4HI7 A;  4MZC A;  2GSQ A;  3GSS A;  4WBR D;  5E4W A;  3UMA A;  1KTE A;  1OYJ A;  3TKP A;  5IPG A;  1WRY A;  3ZVJ A;  4EKZ A;  3BOA A;  2OE3 A;  2LV3 A;  2EFC A;  4PI2 C;  2CV4 A;  3A5I A;  3KTL A;  1Y6E A;  3HJM A;  2LKU A;  3C8E A;  3TJK A;  4GSN A;  2C0F A;  4HEA 2;  2VCX A;  3RHB A;  3D4T A;  1PX7 A;  3UAP A;  4BL7 B;  3IHG A;  1T00 A;  4AJ7 A;  5A5H B;  4O7H A;  3RFR C;  1OKT A;  1JLV A;  1GTU A;  3VI5 A;  1YJ6 A;  4P3Y B;  4JR6 A;  4TW5 A;  4IGJ A;  1K3O A;  4KSM A;  4RI6 A;  4J57 E;  5G5F A;  5HFI A;  2LRC A;  4EE0 A;  3DWV A;  1TU8 A;  4PQH A;  4PNF A;  2K8V A;  1R5P A;  2WZ9 A;  3M9J A;  5JCU A;  1USB A;  4Z2T A;  5H5Q A;  3GH9 A;  4EXJ A;  4HSC X;  2KP1 A;  4IN0 A;  3EIN A;  4ZIJ A;  3CXG A;  3HY2 A;  1WMJ A;  3ED3 A;  1TRU A;  3TDG A;  4POM A;  4AKX B;  4KCA A;  2R37 A;  2LNS A;  5ELA A;  1AC1 A;  1PN9 A;  1XVW A;  2GSS A;  2LTK A;  2X64 A;  3EMX A;  2OAD A;  1SD9 A;  2GTU A;  1XOB A;  3BCK A;  4MPG A;  4TXV A;  3HD5 A;  2IIY A;  3QDN A;  2HRA A;  2GVP A;  1XBS A;  4YH2 A;  2YZU A;  1T4Y A;  4AJ6 A;  3APO A;  2FUG 2;  2KUC A;  3GTU A;  3RPN A;  1FHE A;  4AKG A;  2E2G A;  2WUL A;  3G7Y A;  5JCW A;  4XS4 A;  3L9U A;  18GS A;  5JWQ B;  1LBK A;  6GSW A;  5J9C A;  4V2L A;  2JL4 A;  3GRX A;  1JZD A;  5ENU A;  2M80 A;  2C3Q A;  5HR0 A;  1V98 A;  4DSS A;  5D9W A;  1S3C A;  1RK4 A;  4XRD A;  5F8B A;  3FZ9 A;  2CAI A;  3F8U A;  4BA7 A;  1ZYN A;  4ICY A;  5AIX A;  2MBS A;  1M9A A;  4OFM A;  4HJ2 A;  2TRX A;  3UVH A;  5DAL A;  3DXB A;  3IPZ A;  2H6Z A;  3E3E A;  1X5C A;  1GTI A;  3A2W A;  4JU5 A;  2DJ2 A;  3ZRE A;  1YEW C;  3P2A A;  5ECN B;  2PN8 A;  1SYR A;  4MNN A;  1O85 A;  4N11 A;  1TRS A;  2MMN A;  4TXO B;  2O85 A;  2X49 A;  5AIV A;  2H1A A;  4MF7 A;  3DKS A;  4MMM A;  4OD7 A;  2YAN A;  4DSQ A;  1JLW A;  2C3N A;  2CT6 A;  1GTB A;  1KNG A;  4MJE A;  3D4M A;  1EOH A;  3FK8 A;  4PGT A;  2FD3 A;  1LJR A;  2WRT A;  2RM6 A;  3HXS A;  2C1Y A;  1XZO A;  2K18 A;  3VK9 A;  2OE1 A;  5LD0 A;  1PKZ A;  5IM9 A;  1G0T A;  1ON4 A;  5DAK A;  2WCI A;  4X4J A;  4EDY A;  2KLX A;  5LNK e;  4MDC A;  4IP1 A;  3CMI A;  3FHK A;  3R3E A;  3H79 A;  1EWX A;  4I2T A;  3LOR A;  2WZS A;  19GS A;  3DIE A;  1TK8 B;  3RAZ A;  2H6X A;  4HZ2 A;  6GSU A;  2H19 A;  4XHM A;  1H75 A;  3F6D A;  2H74 A;  4MCU A;  2R0P A;  5HR1 A;  1RQM A;  1EOG A;  3GTU B;  4PQI A;  4QQ7 A;  2DJ3 A;  2WVX A;  3CWG A;  3FR6 A;  4ZB9 A;  5INY A;  3EE2 A;  4V2N A;  5GAN D;  3CTG A;  3MYD A;  3HJP A;  3TOU A;  5A34 B;  3US3 A;  1T1V A;  1M99 A;  3GX8 A;  4PUF C;  4KSO A;  4RUV A;  1GNE A;  2L6D A;  2CZ3 A;  3KMN A;  1SKS B;  4IJI A;  2RUE A;  1FG4 A;  4IEL A;  1Z7R A;  3GX0 A;  3K8N A;  2VCZ A;  1NHO A;  2AUV A;  4ML1 A;  4MJA A;  5DAL B;  1F2E A;  2B5E A;  2EFD A;  3KCM A;  4BIK A;  20GS A;  2ZCT A;  3KMO A;  1F3A A;  2X8C A;  2CX3 A;  3IAS 2;  1MDI A;  4KUN A;  1HD2 A;  2YWI A;  3TRP A;  1FO5 A;  4KH7 A;  2CQ9 A;  3L78 A;  1GUL A;  4N0Z A;  2C0G A;  2LJA A;  4GSS A;  3LG6 A;  3GL3 A;  2LRN A;  2H75 A;  2VCQ A;  2XPD A;  5JWO B;  3TKS A;  2M72 A;  3QFB C;  2PVQ A;  4V2M A;  2AV4 A;  3H8Q A;  2FA4 A;  3BBY A;  2H1D A;  1XW5 A;  2VLV A;  5B6M A;  4K5R A;  1THO A;  3VLN A;  1NM3 A;  4E68 A;  2DLX A;  5DAK B;  5ECP B;  1J9B A;  4BWS A;  1QGV A;  2NDO A;  4J56 E;  4N10 A;  4F2I A;  5HR3 A;  3EUR A;  1WJK A;  1KEB A;  5DJM A;  2OE0 A;  2PGT A;  4K7I A;  1T8E B;  4PUA A;  3E0U A;  3TJF A;  5KN2 A;  1X9M B;  4G10 A;  3U5R E;  3VWV A;  3LSZ A;  3V1W A;  2F8F A;  3F3R A;  2FLS A;  1TK0 B;  3DVX A;  16GS A;  1Z7P A;  1O6J A;  1K0M A;  5ECK B;  1VF3 A;  4OMV A;  1TXX A;  1E2Y A;  1MD3 A;  1URM A;  4CHS A;  3W8J A;  2PER A;  3GH6 A;  4TN8 A;  5G5E A;  5KEJ A;  2IPA A;  2RUF A;  1DE1 A;  4CY8 A;  3A2X A;  4MPF A;  2HXK A;  3P7X A;  2R3X A;  2I1U A;  2JU5 A;  1XXU A;  2QA2 A;  1BJX A;  2X8H A;  3DYR A;  3Q6O A;  1AXD A;  5D9X A;  1ZMA A;  3P8W A;  2B5Y A;  1XWC A;  4YQU A;  2BMX A;  4POK A;  3GUS A;  2N5A A;  3OR5 A;  1PX6 A;  5B7C A;  1GNW A;  4FYC A;  5EL8 A;  4G01 A;  3Q19 A;  2VIM A;  2OT3 A;  1Y25 A;  4ULX A;  1U87 A;  1YEX A;  4BL7 A;  4K6X A;  4WET A;  2N5B A;  3FR3 A;  3IBH A;  4NXI A;  1K0O A;  2HQT A;  1S3D A;  1NHY A;  2C0D A;  1Z3E A;  5AIS A;  4FXY P;  7GSS A;  4IQ1 A;  1ZGN A;  4MLY A;  3QOU A;  1AQW A;  5A4V A;  4K9Z A;  4NV5 A;  3L4N A;  3RGB C;  2PPT A;  3J7Y k;  2MMA A;  3UVT A;  1I5G A;  1Z6N A;  4KAE A;  3F63 A;  4KCE A;  1EV9 A;  2K8S A;  2GST A;  5IOX A;  1GUK A;  3ERF A;  4BWQ A;  17GS A;  2L59 A;  4XIH A;  2QA1 A;  5D9T A;  1Y1U A;  4PNG A;  4FH8 A;  4CY6 A;  4LMW A;  2VKZ G;  1M0U A;  3BCI A;  1XG8 A;  4F0B A;  2G0F A;  1X0R A;  6GSX A;  1TU7 A;  3KXO A;  2HSH A;  2VLT A;  1R26 A;  4L8E A;  3DEX A;  2YWM A;  22GS A;  1XOA A;  2M46 A;  2V41 A;  2LUS A;  5DJL A;  3WT1 A;  1MDK A;  3LYP A;  2UV8 G;  4NAX A;  4ECB A;  2HRK A;  5G1K A;  3HHV A;  2IMD A;  1SKR B;  2R0G A;  2V6K A;  3FMW A;  1OVN A;  2XHF A;  1AW9 A;  2EIQ A;  1ZYQ B;  1AAZ A;  2YCD A;  1T4Z A;  5H5S A;  4ZIL A;  4HU7 A;  2MZC A;  3RPP A;  2GS3 A;  13GS A;  5J5N A;  1OE8 A;  4JRR A;  2O5V A;  4WEY A;  3ZL5 A;  2JAD A;  1GSD A;  1YQ1 A;  4F0C A;  4LL4 B;  8GSS A;  1V9W A;  3LEF A;  1M3J A;  4IHU A;  3MIX A;  2H0H A;  3MDK A;  5D93 A;  3BD2 A;  3N9J A;  3EC3 A;  4V1A g;  2H8L A;  4O92 A;  5CRE A;  2NPB A;  5A5K A;  3P90 A;  3ZIV A;  1F6M C;  2NTO A;  4Z7X A;  2PBJ A;  2DIZ A;  4TXO A;  2IFQ A;  4I97 A;  4YAV A;  4NV2 A;  5ID2 A;  1TKD B;  1W89 A;  3M8N A;  5J4U A;  3VWU A;  1A8L A;  4ECC A;  1SEN A;  2GGT A;  3FZA A;  4JBB A;  3TKQ A;  4EIQ A;  5ECI B;  1PD2 1;  1A0R P;  3ZFL A;  5LCZ A;  5ECO B;  2CVB A;  1MD4 A;  14GS A;  2LST A;  4J2F A;  2OKA A;  1HYU A;  4TOP A;  4ZBB A;  4PXO A;  2B5X A;  1U3A A;  2I3Y A;  3L9V A;  4A5P A;  2HSY A;  1C72 A;  2IJY A;  3KD0 A;  3ZIT A;  3Q74 A;  4ISD A;  4ZBD A;  2L4C A;  3GKM A;  4ZB6 A;  3DD3 A;  3VWX A;  3IDV A;  4G0K A;  1WWJ A;  1ACV A;  3VI7 A;  1YF1 A;  3ZTL A;  2HRK B;  3IC8 A;  2D2Z A;  4JR4 A;  2HNL A;  1ZYE A;  3EVI A;  5CRH A;  1PSQ A;  2ES7 A;  3QCP A;  3WYW A;  2LNT A;  4PX1 A;  2GDR A;  1JZO A;  2DC5 A;  2H1L A;  5GST A;  1YZX A;  3HYP A;  1A24 A;  4K0N A;  1PFO A;  1SYX A;  5A34 A;  4KF9 A;  3LXT A;  2VCW A;  6GSY A;  2PUK C;  4OO5 A;  3FY7 A;  1GRX A;  5CAX A;  1X5E A;  2ALB A;  3W6G A;  2N5F A;  2AJQ B;  1SD8 A;  5B8B A;  4GF0 A;  1BED A;  1FVK A;  3EYT A;  3GV1 A;  3HVN A;  1M7T A;  1NSW A;  3N5O A;  3M1G A;  5J9B A;  2HRN A;  4EVM A;  1HNB A;  5KN1 A;  3ZZX A;  5ID2 B;  2IFQ B;  3C7M A;  3CRT A;  2EIR A;  2JZR A;  1K0A A;  1OC8 A;  3HVX A;  4ZBA A;  4IS0 A;  4XS1 A;  1F9M A;  3TKS C;  4TR4 A;  4JZQ A;  1T3B A;  3GA4 A;  2RM5 A;  3IA1 A;  3CQF A;  3I9V 2;  2J23 A;  3KM6 A;  1SJ6 A;  4G0L A;  4TR3 A;  1TK5 B;  2GQL A;  2IMI A;  1XVQ A;  1SK0 A;  1TXU A;  4DSR A;  2R6K A;  4ZB7 A;  9GSS A;  2H0I A;  5IMD A;  4Z2R A;  2H6Y A;  2YV7 A;  3F6F A;  2LS5 A;  3MNG A;  3MSZ A;  4LL1 B;  1SL0 B;  3WD6 A;  3H4K A;  2LQQ A;  3ZML A;  1SJZ A;  5DVB A;  4GXZ A;  3FW2 A;  4X43 A;  3PGT A;  2E2M A;  3LYK A;  4HS1 A;  1QXH A;  1GUH A;  1N8J A;  4E8H A;  1BX9 A;  2PU9 C;  1B48 A;  1U3I A;  2OBI A;  1FB6 A;  2LQO A;  3U6V A;  3E9J B;  4O5Q A;  2K9F A;  3CYN A;  5FWG A;  5L71 A;  2DKH A;  4FO5 A;  4XS6 A;  3I43 A;  4KA0 A;  3PPU A;  2H71 A;  4PHZ C;  4KDU A;  5DQY A;  2XPE A;  3F4S A;  3ZRD A;  2DIY A;  4EDZ A;  2TIR A;  5IO0 A;  2X8G A;  1PGT A;  1TI1 A;  3F0I A;  1IYH A;  4ECI A;  3HZ8 A;  1XCC A;  2DBC A;  3TB2 A;  1GLP A;  5D96 A;  1CQH A;  4WR5 A;  4LA1 A;  4TVE A;  4K5S A;  4BVY A;  3IV4 A;  2DJJ A;  1BAY A;  11GS A;  1GSU A;  3HDC A;  3LQ7 A;  4ZL7 A;  3O6T A;  1WP0 A;  3CSI A;  3KP9 A;  3VPQ A;  3ZFB A;  3VUR A;  3QD9 A;  1ZOF A;  3CTF A;  1YY7 A;  1PN0 A; 
#chains in the Genus database with same CATH homology
 3TCO A;  4FYB A;  2H30 A;  3HZ4 A;  1XIY A;  5J41 A;  3HCZ A;  3HVV A;  2WDU A;  2V6O A;  3TJB A;  1H4O A;  2JZT A;  3WGE A;  1Z9H A;  4ZB8 A;  3TU3 B;  3F4T A;  1XWK A;  2H66 A;  2QSI A;  4EIP A;  2VL2 A;  2YJH A;  4K0G A;  3APQ A;  3I69 A;  2P5R A;  1CQG A;  1ML6 A;  3GKN A;  2VLU A;  5IO2 A;  4OCF A;  1WE0 A;  3IK9 A;  3RHC A;  1GLQ A;  4DVC A;  2P0G A;  4QL9 A;  1GUM A;  3QAG A;  3O3T A;  4MAB A;  3UBL A;  4F9Z A;  4TR0 A;  4XCS A;  2GZY A;  5IMZ A;  3PR8 A;  2Z9S A;  1YF0 A;  5F07 A;  3TUE A;  1A2L A;  4LLR A;  4AI6 A;  1VRS D;  4GLT A;  4HZ4 A;  1B9X C;  2AHE A;  5IMF A;  4FYU A;  3GST A;  2OAC A;  3W8S A;  1SVL A;  4IW9 A;  4GRF A;  1VF2 A;  1N25 A;  2JSZ A;  2B6M A;  5J4Y A;  5IMV A;  6GSV A;  3FYG A;  2WFC A;  2V1M A;  1TDI A;  2YJ7 A;  2FA8 A;  3LWA A;  4G2E A;  3C1S A;  4AKH A;  2YP6 A;  3QR6 A;  6GST A;  3GKX A;  1OE7 A;  4G0I A;  4OCE A;  3ZVJ D;  1M2B A;  2FWH A;  5DBQ A;  5F06 A;  4N3Z A;  2FWG A;  4BVY B;  2JSY A;  3TJJ A;  4HQS A;  1R4W A;  2BTO T;  3ZYW A;  2VL9 A;  5ABR A;  1PMT A;  3GKK A;  5JCG A;  2HI7 A;  3GUR A;  4I6X A;  2HFD A;  2IMK A;  4RI7 A;  2VOC A;  2C0E A;  2B1L A;  1IYI A;  3O76 A;  1HNC A;  3GL5 A;  1OAZ A;  3GIX A;  2H76 A;  2A2P A;  2H73 A;  5ECM B;  5IIZ A;  3J7Y b;  5AGY A;  1ERV A;  2GSR A;  3M9K A;  1U6T A;  2HYX A;  2L5O A;  4BPY A;  2F3M A;  4I2U A;  2F9S A;  2FNO A;  3H1N A;  3A2V A;  2IME A;  3EWL A;  2O89 A;  2L4Q A;  3C73 A;  4GDF A;  5DCG A;  3LFL A;  4IVF A;  4L5O A;  4CW9 A;  3F3Q A;  4IJ3 A;  2C8U A;  3ERW A;  4OWY A;  5G31 A;  2H72 A;  1O81 A;  3RDW A;  1SVM A;  5DDL A;  3FEU A;  3D21 A;  3KJY A;  1V40 A;  4YAP A;  1M2D A;  3KH7 A;  3UEM A;  3WT2 A;  1YEP A;  5AN1 A;  3EU4 A;  1TRV A;  3ZIJ A;  1AQV A;  2H01 A;  4EF0 A;  1AIU A;  3IC4 A;  2FWE A;  2H0G A;  1XPV A;  3KZQ A;  4K8M A;  12GS A;  2IL3 A;  1M2A A;  3KTB A;  2HSN A;  4IBP A;  2XBQ A;  3KGK A;  1MDJ A;  5ELG A;  2DJ0 A;  3DGQ A;  1G7E A;  1SL1 B;  1GSY A;  4Q5F A;  1GP1 A;  2VL3 A;  5BRT A;  1EV4 A;  5IOW A;  4MJC A;  1EEJ A;  3GNJ A;  3EU3 A;  4KB3 A;  1GTA A;  2HE3 A;  4GCI A;  4KDY A;  2I4A A;  4AF2 A;  2NBS A;  4MH2 A;  4JED A;  2QKE A;  1O73 A;  2FGX A;  4NHW A;  4OO4 A;  3D0Z A;  2V2G A;  4D73 A;  1R5A A;  1XWG A;  1G7O A;  2HLS A;  1THX A;  2R4V A;  4FQU A;  3HVS A;  1TTZ A;  3IR4 A;  1XWA A;  4TRX A;  4POL A;  2G2Q A;  2LEG A;  1ERT A;  3A3T A;  3UL3 A;  5CYY A;  4Q5Q A;  5E59 A;  1PL2 A;  2HSM A;  5FHI A;  1O8W A;  1ZZY A;  5EPF A;  2O87 A;  4POB A;  3CSH A;  4L0U A;  3HJO A;  3IK7 A;  3ZLP A;  4YKF A;  3UBK A;  4WBJ A;  3TGZ A;  4YQV A;  1SK1 A;  3IRA A;  5IPH A;  1R7H A;  2R5G A;  1BG1 A;  1X5D A;  3G9B A;  2E0Q A;  3I6A A;  2CA8 A;  2AB6 A;  1QMV A;  1N2A A;  2B7J A;  4NWY A;  1VGL A;  4K2X A;  1A2J A;  5HFG A;  4N0V A;  1JHB A;  1X9S B;  3KEB A;  4O32 A;  3M3M A;  2VAF A;  5DQS A;  1QUW A;  1OC9 B;  4KE3 A;  1TI3 A;  1X9W B;  5ECS A;  1M9B A;  2DML A;  4NMU A;  4EL1 A;  1QK8 A;  2R0C A;  3ZMK A;  2OA7 A;  5J3R A;  5A1N A;  4O5R A;  2AAW A;  3KH9 A;  4TR1 B;  3G7J A;  2GQM A;  2PMT A;  2HSN B;  3DRN A;  5BMU B;  4LMV A;  5ECR B;  1NW2 A;  1AQX A;  1BF5 A;  3GMF A;  1XFL A;  3EPT A;  4G9H A;  1EP7 A;  1EGR A;  1VF1 A;  1PRX A;  5GAP D;  2CX4 A;  3D22 A;  2LRT A;  3TRX A;  2DJ1 A;  3WGX A;  5CRD A;  5CRW A;  3QMX A;  1DSB A;  1B4P A;  1SK2 A;  1O8X A;  3PIN A;  4JE1 A;  2I81 A;  2BJX A;  3PH9 A;  4D73 B;  4BVX A;  3TJG A;  3FRC A;  1U88 A;  2YOI A;  5D8I A;  3VFI A;  5H5R A;  3Q18 A;  5DCH A;  2CZ2 A;  4MF6 A;  4KW6 A;  1K0B A;  4IP6 A;  2DJK A;  1TRW A;  2FWF A;  2UZ8 A;  2HZE A;  3BJ5 A;  1GH2 A;  1G6W A;  4FIW A;  4GQC A;  5KOW A;  2VL2 C;  2HSM B;  4NPB A;  5ECL B;  1YDK A;  2PWJ A;  1GSQ A;  2F8A A;  2L6C A;  5CP1 A;  3FR9 A;  2VUP A;  5G1L A;  2XBI A;  1TP9 A;  4IKH A;  3IXR A;  1QFN A;  1DBY A;  2EFH A;  1FB0 A;  4ZXG A;  1Q4J A;  1HQO A;  3RBT A;  2C4J A;  3KP8 A;  4MK3 A;  2C80 A;  4USS A;  4W66 A;  4XRA A;  1DUG A;  3NOF A;  1ILO A;  3FKF A;  5CO3 A;  1SVO A;  4ID0 A;  2E7P A;  4EUY A;  2VO4 A;  1SKW B;  2VD1 A;  4F82 A;  4V1A p;  4X0X A;  2X99 A;  4Z2U A;  2R2J A;  2GZZ A;  2PVO C;  2VM1 A;  5IQY A;  1UA5 A;  2VCV A;  2QC7 A;  4O5U A;  3CBU A;  2CAQ A;  5KN3 A;  1DE2 A;  1MTC A;  1XW9 A;  1PKW A;  5A1N B;  1GSS A;  3ISO A;  1ZCP A;  4OFT A;  2VD0 A;  3IAM 2;  4YKG A;  2B1K A;  3NIV A;  1Z6M A;  4KX4 A;  1ZYP A;  2HT9 A;  1F3B A;  1A23 A;  4GQF A;  1KBN A;  2YZH A;  4ZL9 A;  5C00 A;  3L0H A;  1PL1 A;  1E6B A;  4RQX A;  1ERW A;  2A4H A;  4NHZ A;  4WR4 A;  4KGI A;  5GSS A;  4ILF A;  5EY6 A;  2YPM A;  1GSE A;  2ON5 A;  2VM2 A;  5A4W A;  4GTU A;  4TKY A;  3R2Q A;  1A2M A;  3F4R A;  4I8B A;  2X4A A;  3IHQ A;  2ON7 A;  4XS4 B;  3HA9 A;  2H1B A;  1K3Y A;  1ERU A;  2KOK A;  3M0F A;  1GSF A;  2FY6 A;  3VWW A;  4BVX B;  3WGD A;  3QAW A;  4ACS A;  2FHE A;  4WF5 A;  4DSS B;  2CVD A;  4MH3 A;  1AUC A;  4YQM A;  1Q98 A;  2P5Q A;  1ZL9 A;  3FZ4 A;  2NVL A;  1BG5 A;  2MMZ A;  2HZE B;  2JZS A;  1GL8 A;  5J4V A;  3NZN A;  1WPI A;  1B4Q A;  1PA3 A;  3GFK A;  3EMP A;  1SJI A;  1W4V A;  3TRQ A;  1JZW A;  2LJR A;  3IE3 A;  4HDE A;  4ML6 A;  5HQP A;  1A8Y A;  2EFE A;  4K7O A;  2V32 A;  4MP4 A;  5A4U A;  2L5L A;  2P31 A;  4AGS A;  5G2Z A;  2OJL A;  3HKR A;  4Q5R A;  1I9D A;  5FT3 A;  1K0D A;  5KOX A;  2J9H A;  4G19 A;  4F03 A;  4PQ1 A;  1JFU A;  4E8E A;  1S3A A;  4HUA A;  1MEK A;  4RQR A;  3UJ1 A;  2KP2 A;  1RW1 A;  2H70 A;  2I9H A;  2GQK A;  2EC4 A;  5IMA A;  4AKI A;  5EVO A;  6GSS A;  2A4V A;  2YN1 A;  3JCM L;  3TKS E;  1TW9 A;  1FAA A;  3GYK A;  4H86 A;  2K6V A;  2XC2 A;  2A2R A;  1TOF A;  10GS A;  1K0N A;  3IOS A;  2WJU A;  1PQN A;  3HMJ G;  1T7P B;  3SBC A;  5ECQ B;  4I5Q A;  2WS2 A;  1F37 A;  3S9F A;  1FOH A;  5HR2 A;  4MA9 A;  3LXZ A;  5F05 A;  1YKC A;  1EZK A;  2GT6 A;  2RII A;  3C1R A;  3LGC A;  3D6I A;  2HZF A;  3TOT A;  2DKI A;  2WGR A;  5B8A A;  5KN0 A;  1J08 A;  1B9Y C;  2JAC A;  5J40 A;  2B7K A;  1V58 A;  3GN3 A;  2ZUP A;  2HRF A;  1YVL A;  2LJK A;  5CNW A;  5D73 A;  1O7U A;  2O7K A;  1XW6 A;  4K1F A;  4N30 A;  4Q5N A;  5D9V A;  1J0F A;  4L5L A;  4GWR A;  2IMF A;  4CDO A;  5JWR B;  2GT5 A;  4MZW A;  2AYT A;  3QPM A;  5B6N A;  5ECH B;  2EIO A;  5HFK A;  4MJB A;  3MWH A;  1V57 A;  1G6Y A;  3LW9 A;  2L57 A;  2QGV A;  2YWO A;  3QAV A;  2YWN A;  1FW1 A;  4ZL8 A;  3VPT A;  5COH A;  3TKR A;  3UIW A;  5F0G A;  2MYG A;  1SL2 B;  3CRU A;  1HNA A;  3AY8 A;  3UOM A;  2A2S A;  1ST9 A;  2DSA A;  1EP8 A;  5J47 A;  4X1U A;  2REM A;  2C3T A;  1EEM A;  3FZ5 A;  3LJR A;  3DVW A;  5A5H A;  3A5W A;  2GZP A;  1BQ7 A;  2B3S A;  4PUR A;  1GWC A;  1Z5Y E;  1VF4 A;  4HU9 A;  3G7I A;  3ERG A;  2GLR A;  4EC0 A;  2ZNM A;  4WXT A;  3KIJ A;  1JZR A;  2MBT A;  3L9S A;  2FCH A;  2YNX A;  2VCT A;  4L0W A;  3H93 A;  1SU9 A;  2F51 A;  2O8V B;  1OC9 A;  3ME7 A;  4PTS A;  4AJ8 A;  4QMK A;  1OC3 A;  1LU4 A;  1QQ2 A;  3ME8 A;  4HJM A;  3QFA C;  4WKW A;  2TRC P;  4IQA A;  1YKA A;  4OFN A;  1V2A A;  1XWB A;  4QL7 A;  4TR1 A;  5IMC A;  1FOV A;  2H1G A;  5GZZ B;  3C71 A;  5BMU A;  4KND A;  3GHA A;  2KHP A;  4K7N A;  1ABA A;  3APS A;  1FVJ A;  3D5J A;  1UC7 A;  1UVZ A;  1BYE A;  1B8X A;  2RLI A;  4XTS A;  4GST A;  4HQZ A;  2MMO A;  1A0F A;  3DML A;  1K3L A;  2WB9 A;  4EO3 A;  1WIK A;  4ECJ A;  4HOJ A;  1K0C A;  3UAR A;  2CVK A;  1UN2 A;  2IWT A;  2DMM A;  1EGO A;  2YV9 A;  1OKD A;  2IN3 A;  4MZB A;  4WF4 A;  1TJD A;  5CRG A;  2OBK A;  5G30 A;  3CSJ A;  4MF5 A;  1WOU A;  4DEJ A;  3F9U A;  3SWL A;  5C04 A;  4KDX A;  3MAK A;  4K2D A;  4HI7 A;  4MZC A;  2GSQ A;  3GSS A;  4WBR D;  5E4W A;  3UMA A;  1KTE A;  1OYJ A;  3TKP A;  5IPG A;  1WRY A;  3ZVJ A;  4EKZ A;  3BOA A;  2OE3 A;  2LV3 A;  2EFC A;  2CV4 A;  3A5I A;  3KTL A;  1Y6E A;  3HJM A;  2LKU A;  3C8E A;  3TJK A;  4GSN A;  2C0F A;  4HEA 2;  2VCX A;  3RHB A;  3D4T A;  1PX7 A;  3UAP A;  4BL7 B;  3IHG A;  1T00 A;  4AJ7 A;  5A5H B;  4O7H A;  1OKT A;  1JLV A;  1GTU A;  3VI5 A;  1YJ6 A;  4P3Y B;  4JR6 A;  4TW5 A;  4IGJ A;  1K3O A;  4KSM A;  4RI6 A;  4J57 E;  5G5F A;  5HFI A;  2LRC A;  4EE0 A;  3DWV A;  1TU8 A;  4PQH A;  4PNF A;  2K8V A;  1R5P A;  2WZ9 A;  3M9J A;  5JCU A;  1USB A;  4Z2T A;  5H5Q A;  3GH9 A;  4EXJ A;  2KP1 A;  4IN0 A;  3EIN A;  4ZIJ A;  3CXG A;  3HY2 A;  1WMJ A;  3ED3 A;  1TRU A;  3TDG A;  4POM A;  4AKX B;  4KCA A;  2R37 A;  2LNS A;  5ELA A;  1AC1 A;  1PN9 A;  1XVW A;  2GSS A;  2LTK A;  2X64 A;  3EMX A;  2OAD A;  1SD9 A;  2GTU A;  1XOB A;  3BCK A;  4MPG A;  4TXV A;  3HD5 A;  2IIY A;  3QDN A;  2HRA A;  2GVP A;  1XBS A;  4YH2 A;  2YZU A;  1T4Y A;  4AJ6 A;  3APO A;  2FUG 2;  2KUC A;  3GTU A;  3RPN A;  1FHE A;  4AKG A;  2E2G A;  2WUL A;  3G7Y A;  5JCW A;  4XS4 A;  3L9U A;  18GS A;  5JWQ B;  1LBK A;  6GSW A;  5J9C A;  4V2L A;  2JL4 A;  3GRX A;  1JZD A;  5ENU A;  2M80 A;  2C3Q A;  5HR0 A;  1V98 A;  4DSS A;  5D9W A;  1S3C A;  1RK4 A;  4XRD A;  5F8B A;  3FZ9 A;  2CAI A;  3F8U A;  4BA7 A;  1ZYN A;  4ICY A;  5AIX A;  2MBS A;  1M9A A;  4OFM A;  4HJ2 A;  2TRX A;  3UVH A;  5DAL A;  3DXB A;  3IPZ A;  2H6Z A;  3E3E A;  1X5C A;  1GTI A;  3A2W A;  4JU5 A;  2DJ2 A;  3ZRE A;  3P2A A;  5ECN B;  2PN8 A;  1SYR A;  4MNN A;  1O85 A;  4N11 A;  1TRS A;  2MMN A;  4TXO B;  2O85 A;  2X49 A;  5AIV A;  2H1A A;  4MF7 A;  3DKS A;  4MMM A;  4OD7 A;  2YAN A;  4DSQ A;  1JLW A;  2C3N A;  2CT6 A;  1GTB A;  1KNG A;  4MJE A;  3D4M A;  1EOH A;  3FK8 A;  4PGT A;  2FD3 A;  1LJR A;  2WRT A;  2RM6 A;  3HXS A;  2C1Y A;  1XZO A;  2K18 A;  3VK9 A;  2OE1 A;  5LD0 A;  1PKZ A;  5IM9 A;  1G0T A;  1ON4 A;  5DAK A;  2WCI A;  4X4J A;  4EDY A;  2KLX A;  5LNK e;  4MDC A;  4IP1 A;  3CMI A;  3FHK A;  3R3E A;  3H79 A;  1EWX A;  4I2T A;  3LOR A;  19GS A;  3DIE A;  1TK8 B;  3RAZ A;  2H6X A;  4HZ2 A;  6GSU A;  2H19 A;  4XHM A;  1H75 A;  3F6D A;  2H74 A;  4MCU A;  2R0P A;  5HR1 A;  1RQM A;  1EOG A;  3GTU B;  4PQI A;  4QQ7 A;  2DJ3 A;  3CWG A;  3FR6 A;  4ZB9 A;  5INY A;  3EE2 A;  4V2N A;  5GAN D;  3CTG A;  3MYD A;  3HJP A;  3TOU A;  5A34 B;  3US3 A;  1T1V A;  1M99 A;  3GX8 A;  4PUF C;  4KSO A;  4RUV A;  1GNE A;  2L6D A;  2CZ3 A;  3KMN A;  1SKS B;  4IJI A;  2RUE A;  1FG4 A;  4IEL A;  1Z7R A;  3GX0 A;  3K8N A;  2VCZ A;  1NHO A;  2AUV A;  4ML1 A;  4MJA A;  5DAL B;  1F2E A;  2B5E A;  2EFD A;  3KCM A;  20GS A;  2ZCT A;  3KMO A;  1F3A A;  2X8C A;  2CX3 A;  3IAS 2;  1MDI A;  4KUN A;  1HD2 A;  2YWI A;  3TRP A;  1FO5 A;  4KH7 A;  2CQ9 A;  3L78 A;  1GUL A;  4N0Z A;  2C0G A;  2LJA A;  4GSS A;  3LG6 A;  3GL3 A;  2LRN A;  2H75 A;  2VCQ A;  2XPD A;  5JWO B;  3TKS A;  2M72 A;  3QFB C;  2PVQ A;  4V2M A;  2AV4 A;  3H8Q A;  2FA4 A;  3BBY A;  2H1D A;  1XW5 A;  2VLV A;  5B6M A;  4K5R A;  1THO A;  3VLN A;  1NM3 A;  4E68 A;  2DLX A;  5DAK B;  5ECP B;  1J9B A;  4BWS A;  1QGV A;  2NDO A;  4J56 E;  4N10 A;  4F2I A;  5HR3 A;  3EUR A;  1WJK A;  1KEB A;  5DJM A;  2OE0 A;  2PGT A;  4K7I A;  1T8E B;  4PUA A;  3E0U A;  3TJF A;  5KN2 A;  1X9M B;  4G10 A;  3U5R E;  3VWV A;  3LSZ A;  3V1W A;  2F8F A;  3F3R A;  2FLS A;  1TK0 B;  3DVX A;  16GS A;  1Z7P A;  1O6J A;  1K0M A;  5ECK B;  1VF3 A;  4OMV A;  1TXX A;  1E2Y A;  1MD3 A;  1URM A;  4CHS A;  3W8J A;  2PER A;  3GH6 A;  4TN8 A;  5G5E A;  5KEJ A;  2IPA A;  2RUF A;  1DE1 A;  4CY8 A;  3A2X A;  4MPF A;  2HXK A;  3P7X A;  2R3X A;  2I1U A;  2JU5 A;  1XXU A;  2QA2 A;  1BJX A;  2X8H A;  3DYR A;  3Q6O A;  1AXD A;  5D9X A;  1ZMA A;  3P8W A;  2B5Y A;  1XWC A;  4YQU A;  2BMX A;  4POK A;  3GUS A;  2N5A A;  3OR5 A;  1PX6 A;  5B7C A;  1GNW A;  4FYC A;  5EL8 A;  4G01 A;  3Q19 A;  2VIM A;  2OT3 A;  1Y25 A;  4ULX A;  1U87 A;  1YEX A;  4BL7 A;  4K6X A;  4WET A;  2N5B A;  3FR3 A;  3IBH A;  4NXI A;  1K0O A;  2HQT A;  1S3D A;  1NHY A;  2C0D A;  1Z3E A;  5AIS A;  7GSS A;  4IQ1 A;  1ZGN A;  4MLY A;  3QOU A;  1AQW A;  5A4V A;  4K9Z A;  4NV5 A;  3L4N A;  2PPT A;  3J7Y k;  2MMA A;  3UVT A;  1I5G A;  1Z6N A;  4KAE A;  3F63 A;  4KCE A;  1EV9 A;  2K8S A;  2GST A;  5IOX A;  1GUK A;  3ERF A;  4BWQ A;  17GS A;  2L59 A;  4XIH A;  2QA1 A;  5D9T A;  1Y1U A;  4PNG A;  4FH8 A;  4CY6 A;  4LMW A;  2VKZ G;  1M0U A;  3BCI A;  4F0B A;  2G0F A;  1X0R A;  6GSX A;  1TU7 A;  3KXO A;  2HSH A;  2VLT A;  1R26 A;  4L8E A;  3DEX A;  2YWM A;  22GS A;  1XOA A;  2M46 A;  2V41 A;  2LUS A;  5DJL A;  3WT1 A;  1MDK A;  3LYP A;  2UV8 G;  4NAX A;  4ECB A;  2HRK A;  5G1K A;  3HHV A;  2IMD A;  1SKR B;  2R0G A;  2V6K A;  3FMW A;  1OVN A;  2XHF A;  1AW9 A;  2EIQ A;  1ZYQ B;  1AAZ A;  2YCD A;  1T4Z A;  5H5S A;  4ZIL A;  4HU7 A;  2MZC A;  3RPP A;  2GS3 A;  13GS A;  5J5N A;  1OE8 A;  4JRR A;  2O5V A;  4WEY A;  3ZL5 A;  2JAD A;  1GSD A;  1YQ1 A;  4F0C A;  4LL4 B;  8GSS A;  1V9W A;  3LEF A;  4IHU A;  3MIX A;  2H0H A;  3MDK A;  5D93 A;  3BD2 A;  3N9J A;  3EC3 A;  4V1A g;  2H8L A;  4O92 A;  5CRE A;  2NPB A;  5A5K A;  3P90 A;  3ZIV A;  1F6M C;  2NTO A;  4Z7X A;  2PBJ A;  2DIZ A;  4TXO A;  2IFQ A;  4I97 A;  4YAV A;  4NV2 A;  5ID2 A;  1TKD B;  1W89 A;  3M8N A;  5J4U A;  3VWU A;  1A8L A;  4ECC A;  1SEN A;  2GGT A;  3FZA A;  4JBB A;  3TKQ A;  4EIQ A;  5ECI B;  1PD2 1;  1A0R P;  3ZFL A;  5LCZ A;  5ECO B;  2CVB A;  1MD4 A;  14GS A;  2LST A;  4J2F A;  2OKA A;  1HYU A;  4TOP A;  4ZBB A;  4PXO A;  2B5X A;  1U3A A;  2I3Y A;  3L9V A;  4A5P A;  2HSY A;  1C72 A;  2IJY A;  3KD0 A;  3ZIT A;  3Q74 A;  4ISD A;  4ZBD A;  2L4C A;  3GKM A;  4ZB6 A;  3DD3 A;  3VWX A;  3IDV A;  4G0K A;  1WWJ A;  1ACV A;  3VI7 A;  1YF1 A;  3ZTL A;  2HRK B;  3IC8 A;  2D2Z A;  4JR4 A;  2HNL A;  1ZYE A;  3EVI A;  5CRH A;  1PSQ A;  2ES7 A;  3QCP A;  3WYW A;  2LNT A;  4PX1 A;  2GDR A;  1JZO A;  2DC5 A;  2H1L A;  5GST A;  1YZX A;  3HYP A;  1A24 A;  4K0N A;  1SYX A;  5A34 A;  4KF9 A;  3LXT A;  2VCW A;  6GSY A;  2PUK C;  4OO5 A;  3FY7 A;  1GRX A;  5CAX A;  1X5E A;  2ALB A;  3W6G A;  2N5F A;  2AJQ B;  1SD8 A;  5B8B A;  4GF0 A;  1BED A;  1FVK A;  3EYT A;  3GV1 A;  1M7T A;  1NSW A;  3N5O A;  3M1G A;  5J9B A;  2HRN A;  4EVM A;  1HNB A;  5KN1 A;  3ZZX A;  5ID2 B;  2IFQ B;  3C7M A;  3CRT A;  2EIR A;  2JZR A;  1K0A A;  1OC8 A;  3HVX A;  4ZBA A;  4IS0 A;  4XS1 A;  1F9M A;  3TKS C;  4TR4 A;  4JZQ A;  1T3B A;  3GA4 A;  2RM5 A;  3IA1 A;  3I9V 2;  2J23 A;  3KM6 A;  1SJ6 A;  4G0L A;  4TR3 A;  1TK5 B;  2GQL A;  2IMI A;  1XVQ A;  1SK0 A;  1TXU A;  4DSR A;  2R6K A;  4ZB7 A;  9GSS A;  2H0I A;  5IMD A;  4Z2R A;  2H6Y A;  2YV7 A;  3F6F A;  2LS5 A;  3MNG A;  3MSZ A;  4LL1 B;  1SL0 B;  3WD6 A;  3H4K A;  2LQQ A;  3ZML A;  1SJZ A;  5DVB A;  4GXZ A;  3FW2 A;  4X43 A;  3PGT A;  2E2M A;  3LYK A;  4HS1 A;  1QXH A;  1GUH A;  1N8J A;  4E8H A;  1BX9 A;  2PU9 C;  1B48 A;  1U3I A;  2OBI A;  1FB6 A;  2LQO A;  3U6V A;  3E9J B;  4O5Q A;  2K9F A;  3CYN A;  5FWG A;  5L71 A;  2DKH A;  4FO5 A;  4XS6 A;  3I43 A;  4KA0 A;  3PPU A;  2H71 A;  4KDU A;  5DQY A;  2XPE A;  3F4S A;  3ZRD A;  2DIY A;  4EDZ A;  2TIR A;  5IO0 A;  2X8G A;  1PGT A;  1TI1 A;  3F0I A;  1IYH A;  4ECI A;  3HZ8 A;  1XCC A;  2DBC A;  3TB2 A;  1GLP A;  5D96 A;  1CQH A;  4WR5 A;  4LA1 A;  4TVE A;  4K5S A;  4BVY A;  3IV4 A;  2DJJ A;  1BAY A;  11GS A;  1GSU A;  3HDC A;  3LQ7 A;  4ZL7 A;  3O6T A;  1WP0 A;  3CSI A;  3KP9 A;  3VPQ A;  3ZFB A;  3VUR A;  3QD9 A;  1ZOF A;  3CTF A;  1YY7 A;  1PN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...