1GSSA

Three-dimensional structure of class pi glutathione s-transferase from human placenta in complex with s-hexylglutathione at 2.8 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure of class pi glutathione S-transferase from human placenta in complex with S-hexylglutathione at 2.8 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1992-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gssA01
1DBYA 3IOSA 2MYGA 2FWGA 2HSYA 2IWTA 4F9ZA 3FW2A 3ZREA 2YWOA 1XWAA 1X9SB 3UBKA 1T8EB 2RUFA 2FA4A 3F9UA 4XTSA 1F9MA 2MBSA 3TKPA 1A8LA 3ZMKA 2VUPA 5IM9A 4NMUA 3MDKA 3US3A 1R4WA 2C3QA 3TJBA 3PPUA 1BX9A 3H93A 2L59A 1HNBA 2DJJA 2YN1A 4OFNA 1KBNA 1X9MB 2C3TA 4IP6A 2PVQA 4XS4A 4ISDA 2B5XA 5F06A 3DD3A 2YWMA 2RLIA 4Q5NA 2CV4A 4ECIA 1GSYA 1ZYQB 4I2UA 4G19A 3GA4A 4NV5A 1TK8B 4YH2A 3APSA 3GFKA 2OE1A 3ZIVA 4V1Ag 2EIOA 2G2QA 2P31A 3ZVJD 1YEXA 5IOWA 1HYUA 3GKMA 3ZYWA 4DSRA 4J56E 2CT6A 2HZEA 5CRDA 5D93A 1E6BA 2I9HA 2C0GA 4ZXGA 5ELGA 3E0UA 2HT9A 4NHZA 3I69A 3EU3A 1VF1A 4I6XA 5EVOA 2LRNA 5J9CA 3HXSA 3LXTA 5DJLA 1TRWA 3V1WA 1I9DA 3EMXA 5FT3A 2O85A 1PX7A 3IAM2 4RUVA 4GF0A 3DMLA 3TKSE 3IK7A 1ZZYA 2GGTA 1ERTA 3KTBA 1FG4A 3FEUA 2CQ9A 3H4KA 4BVYA 3DYRA 3N9JA 3UOMA 1U6TA 4EDZA 1EP7A 1HQOA 3IAS2 4MJAA 5F8BA 4IBPA 4WBJA 2L57A 2H8LA 2NPBA 2XHFA 1F2EA 2GTUA 2HQTA 4YAVA 1RW1A 2AUVA 4JE1A 1SJ6A 3EE2A 2LRCA 2LV3A 5ECKB 3UMAA 4NHWA 2VIMA 5IOXA 2LTKA 5J3RA 2LSTA 3CRTA 2PWJA 2O89A 2WULA 1ST9A 2OKAA 1JZDA 3SWLA 5LCZA 1X5EA 2YCDA 2P5QA 1R5PA 2MZCA 4WF5A 3CTGA 3GUSA 18GSA 3F8UA 5CREA 3ED3A 4N0VA 4ILFA 2UZ8A 3HJPA 2ON7A 1TU8A 3PGTA 4HS1A 4L0WA 5B6NA 1BEDA 2OBKA 4QL9A 5IO0A 3VWXA 4BL7B 1ERWA 3E3EA 4J2FA 4BVXA 3VWVA 3WYWA 5AIVA 1BG5A 3QMXA 2DLXA 1Z5YE 3FR6A 3G9BA 1ACVA 4USSA 2H01A 2B1KA 3P90A 5CRWA 14GSA 2BTOT 2LJKA 2A2SA 5ECNB 4MPFA 1YKAA 3WT2A 3IA1A 5KEJA 1FB6A 1ZL9A 2B3SA 1XVQA 4TXVA 3PINA 2F8AA 3FZ4A 3TJGA 1PL2A 17GSA 3GH6A 3P8WA 6GSWA 2X99A 1M9BA 4GSSA 3TCOA 2E2MA 3QDNA 5ECSA 2F8FA 3LFLA 3VWWA 1AAZA 5HQPA 2DJ3A 5GZZB 3ZITA 4TXOB 1SU9A 3EWLA 1QMVA 11GSA 2B7KA 5G5FA 5C04A 5IO2A 5D9WA 5DQSA 1J0FA 2CAIA 2KP2A 1SYXA 5H5SA 2GSQA 4PX1A 1YKCA 1PQNA 1G7EA 2C0EA 3M0FA 3DGQA 1TDIA 1GUHA 2TIRA 3EURA 2L5LA 2M72A 2FWEA 3UBLA 2ZUPA 2H6ZA 2VM1A 3H79A 2VCVA 4RI7A 1G7OA 4MA9A 5DJMA 3ME8A 5JCGA 3RHCA 3LQ7A 1PX6A 3HVSA 3ZL5A 3QOUA 2PGTA 5C00A 2GVPA 1F37A 1SK2A 10GSA 1O85A 2N5AA 4K6XA 5JCWA 3FR3A 4O7HA 1TOFA 1SK0A 3BCKA 2REMA 2FWFA 2FLSA 1USBA 2ON5A 1QGVA 2DSAA 3IE3A 1J9BA 2QC7A 1XXUA 3ZRDA 2C0FA 4G0LA 1F3AA 4LMWA 2CA8A 3L9SA 3GKNA 5G2ZA 4PURA 2GQMA 2L6DA 5CYYA 4ACSA 1MDJA 1A24A 1B4PA 2C4JA 1ILOA 1N8JA 1SL1B 5A4UA 2V32A 3ISOA 1JHBA 2AYTA 3IRAA 3CMIA 4KB3A 4HI7A 1FOVA 1XOAA 5DQYA 2NTOA 6GSSA 1JZRA 1OAZA 5B8AA 3TRXA 4ZBBA 1SENA 5AIXA 4EL1A 3CXGA 2P0GA 3UVHA 3C8EA 1EGRA 1Z3EA 2MMAA 5KN2A 1JLVA 5ECMB 2HLSA 4PGTA 2HRKB 4N10A 4GTUA 2DJ2A 4F03A 1ERUA 1SL0B 2PVOC 2PN8A 1XWCA 3HDCA 4MJEA 5HR0A 1JFUA 2E2GA 4TR1A 2RM5A 3H8QA 1GTBA 1UC7A 1GSSA 1OE8A 3BJ5A 4P3YB 1K0NA 4HJ2A 5DALA 4RQXA 2X8GA 13GSA 4ZB8A 4KAEA 4POBA 2E7PA 3FK8A 1EOGA 4GRFA 2VL2A 1PL1A 3FZAA 4NWYA 3W8SA 2OE0A 2YWNA 5DCHA 1H75A 1K0MA 3HCZA 5IPHA 1YQ1A 4EUYA 4ULXA 1F3BA 5HFIA 4LMVA 2PU9C 3A5WA 1WMJA 2YP6A 4K7OA 2HE3A 4Q5FA 4XS1A 1SKRB 3LWAA 2H1GA 5IIZA 1EWXA 2LUSA 2K8SA 2H1BA 1FVJA 1FAAA 2DIZA 3F4TA 1AC1A 3J7Yb 1YF1A 3IC4A 3WGEA 1ZOFA 4K8MA 2LNTA 1JZOA 3UEMA 2YZHA 2A4VA 4MZWA 3APOA 1XFLA 1Z6MA 3WT1A 4Q5RA 3UIWA 5EL8A 1TRVA 3QAWA 4TVEA 3QR6A 1XWKA 4IJ3A 3GN3A 4KSOA 2ALBA 2VL3A 3Q19A 2HSNB 5IMCA 2E0QA 3ZFBA 1JZWA 4AJ8A 1FVKA 1SD8A 3CTFA 1BQ7A 5ECOB 5D9TA 2HSMB 3MSZA 5IMDA 2DMMA 5JWQB 1GP1A 3QFBC 4CW9A 3ZVJA 4K7IA 1UVZA 1GH2A 2F3MA 4JR4A 3E9JB 3F4RA 3QPMA 5FWGA 3LG6A 1ON4A 3A2XA 3KTLA 5DAKA 1OYJA 1GNWA 3IPZA 4K0GA 2IMFA 2IPAA 2VCWA 1A0FA 4YQMA 2FUG2 5CNWA 4HEA2 3D4TA 2K9FA 5J5NA 3TKRA 1K0BA 2YANA 1Z7RA 1XOBA 1W4VA 2HXKA 1GL8A 5CO3A 3DIEA 4I5QA 2R3XA 3HJOA 2FWHA 5G1KA 1WJKA 3R3EA 3VK9A 5F0GA 2GSRA 3GURA 2VAFA 2VO4A 4F2IA 1MD4A 4FYCA 1R26A 2V1MA 4WF4A 3KZQA 3GH9A 3G7IA 2I81A 5D8IA 4AGSA 3GRXA 1E2YA 1FHEA 2ES7A 3CRUA 4KCAA 4BA7A 3IV4A 2EC4A 3TOUA 1TXXA 2B6MA 1M9AA 1OE7A 1M2DA 3F4SA 2GQKA 2BMXA 3TJKA 5ABRA 2DBCA 1C72A 1URMA 3P2AA 1A2LA 5AN1A 3FY7A 3UAPA 1Z7PA 4TOPA 3GL3A 4POLA 3KEBA 2YNXA 2I3YA 2LS5A 2YOIA 4BL7A 2JU5A 4GWRA 1ZYEA 1DSBA 1GSDA 1K0DA 3R2QA 2R6KA 1FW1A 2RIIA 2WFCA 3FYGA 1SKWB 2HYXA 1T1VA 2OBIA 3D0ZA 3C73A 1GSEA 1GNEA 4MPGA 4GQFA 4HQSA 4XS4B 4F82A 4G10A 1SK1A 4XHMA 4E8HA 3D6IA 4FQUA 3DRNA 4AJ6A 1GTUA 2DMLA 6GSTA 4IKHA 2YWIA 1X9WB 4IW9A 3PH9A 1T7PB 3BBYA 1XBSA 2IJYA 5E4WA 5HR3A 3U5RE 1LU4A 1MDIA 1O8XA 5HR1A 4KE3A 1GSUA 4V2NA 2VLVA 1OKDA 3KD0A 3KP8A 2ZNMA 4PUFC 3QAVA 3KJYA 2P5RA 4L5OA 1Z6NA 4O92A 4TXOA 3VWUA 3HYPA 4L0UA 3HVVA 2HZEB 3M8NA 3VI7A 1XWGA 1SL2B 1FB0A 4L5LA 3GX8A 3HZ4A 3FKFA 3TKSA 4NXIA 3M3MA 3BOAA 1U3AA 1VRSD 4AJ7A 3DEXA 1Q4JA 3H1NA 1XW5A 5IMFA 3F0IA 2QSIA 1G6WA 1V2AA 1RQMA 1WPIA 1XZOA 3QCPA 1GLPA 4GSNA 1QFNA 3EU4A 4ZILA 4D73A 5JWRB 1GLQA 3EMPA 1V40A 1TP9A 4K7NA 3WD6A 4WR5A 4FH8A 1EEJA 2K6VA 5AISA 3GTUB 4EXJA 3IHQA 1PKWA 4EDYA 4QQ7A 4K0NA 4GXZA 4FO5A 2GT5A 3ZFLA 2F9SA 3GSTA 4IHUA 3RPPA 4MLYA 1B8XA 3ERGA 5DBQA 5GAPD 6GSXA 2GT6A 1S3CA 3ME7A 3ZZXA 2D2ZA 4IP1A 4EF0A 2H73A 2DC5A 3F6DA 3CYNA 2OJLA 1Q98A 1QK8A 2NVLA 4KDYA 2JZRA 8GSSA 2H72A 4HU9A 3IXRA 5CRHA 1A8YA 4OCFA 2H30A 4JR6A 1RK4A 2PUKC 4OMVA 3L9UA 6GSVA 1H4OA 1OC9A 1MTCA 2GDRA 5G31A 3TRPA 3DWVA 4PXOA 4G2EA 4MJBA 3GKXA 2V2GA 2WB9A 3EC3A 5LNKe 4X43A 4KUNA 2V6KA 3GKKA 1MDKA 4QL7A 1GTAA 3KP9A 2JSZA 5G1LA 5A5KA 5COHA 4BVXB 1EGOA 4WBRD 4WETA 1YF0A 20GSA 1JLWA 1R7HA 4BPYA 2HRKA 6GSYA 2LRTA 3GIXA 5LD0A 2HI7A 5DVBA 4F0CA 3WGDA 1K0OA 3G7YA 4ZB6A 3GMFA 5D96A 2LQOA 1TRUA 1TI1A 2VLUA 2MMZA 2L5OA 2XPEA 5B6MA 4IS0A 1PKZA 2X64A 1OKTA 1ZCPA 1LJRA 4IN0A 4XS6A 4DVCA 4I97A 3LYKA 4GQCA 4JU5A 4N0ZA 5EY6A 2GSTA 2GZZA 3LYPA 4EC0A 4MCUA 2L6CA 2QKEA 1TTZA 3C7MA 2FNOA 1XWBA 1XPVA 4OO4A 2CX4A 1AIUA 1X5CA 1U87A 2M80A 4WXTA 4KF9A 5HR2A 2M46A 5ID2A 4ZL9A 4MZCA 3KMOA 4HZ4A 1R5AA 1BJXA 4KX4A 3D22A 1EP8A 4MF6A 2C80A 3I9V2 2YJ7A 3CSIA 3GYKA 2MBTA 2B5EA 3DVWA 4FIWA 2KP1A 2VCQA 5J9BA 2CVKA 4EE0A 5H5QA 1WE0A 3A2WA 5CAXA 1THOA 4DSSA 1PA3A 2RM6A 1CQGA 4Z7XA 1BYEA 4J57E 3LXZA 2EIRA 4N30A 4XCSA 3F3QA 1XIYA 4TN8A 1EOHA 3LORA 3CSJA 2IFQA 5BMUA 3TRQA 3RPNA 2HSMA 1XW9A 3TOTA 2QGVA 2VL9A 2VCTA 2Z9SA 4ID0A 3IBHA 3QD9A 4ZIJA 2OADA 3BD2A 2X8CA 4OFTA 5G5EA 2LJRA 1AUCA 4V2MA 1XVWA 4POKA 5F07A 4WR4A 2I4AA 2CZ3A 1ZMAA 1TI3A 2L4QA 4ZL7A 5ELAA 2K8VA 4OD7A 2AAWA 3RHBA 2WS2A 2IIYA 2JSYA 2B7JA 4EKZA 2IMDA 1BAYA 3NOFA 4NPBA 19GSA 5B8BA 2KUCA 2J9HA 3LSZA 5GAND 2HFDA 3TJJA 2VCXA 1A2MA 4GCIA 5J4UA 2KLXA 1O7UA 3KH7A 4X1UA 3GHAA 1V58A 4KGIA 3LJRA 5D73A 3EYTA 1O73A 3TB2A 4XRAA 4RQRA 2VCZA 5INYA 4K9ZA 2YJHA 1PN9A 1GSFA 1T00A 2IL3A 4MABA 1YEPA 4X0XA 2XBIA 1NW2A 1K3LA 1PRXA 3ZIJA 3L4NA 1ZGNA 4PQHA 4ZBDA 2PMTA 2DJKA 1MEKA 1O6JA 4IJIA 2C1YA 4TR1B 5A4VA 2PERA 3ERFA 4PQIA 5G30A 2DIYA 3A2VA 2AHEA 1MD3A 3TKQA 2CVDA 5DALB 1T4ZA 3HKRA 3DKSA 2H19A 3HA9A 4LA1A 1EV4A 4O32A 4OFMA 3M9KA 4MJCA 3C71A 7GSSA 3FR9A 2I1UA 1O8WA 4AF2A 1X0RA 3CSHA 4KA0A 2NBSA 2R2JA 4MP4A 2R5GA 2VL2C 2A2RA 1B9XC 4TR4A 1KTEA 4KDUA 3DVXA 1FO5A 3GSSA 2NDOA 3Q74A 2FD3A 3CBUA 5GSSA 2L4CA 3KH9A 22GSA 2CZ2A 3EINA 5ENUA 2B5YA 1B48A 1VF2A 3TUEA 1XW6A 4MH2A 1X5DA 1AW9A 2OA7A 2WCIA 3RAZA 12GSA 5ECHB 1WWJA 1LBKA 4KCEA 2CX3A 5ECQB 2GQLA 2H74A 1VGLA 4I2TA 3D4MA 4IQ1A 2GS3A 4V2LA 1WP0A 1DE2A 1PMTA 2VM2A 3ZTLA 4FYUA 5CP1A 2O8VB 4ECJA 4K2DA 3KCMA 5IMVA 1DE1A 4MK3A 2H71A 4GSTA 3ZLPA 2PPTA 3GX0A 4F0BA 4TW5A 4OWYA 2PBJA 4L8EA 2TRCP 2XPDA 3VI5A 3M1GA 1GWCA 4DEJA 3KMNA 2IN3A 4N11A 4O5RA 3FZ5A 2XC2A 1GUKA 2H76A 1NHYA 2YV7A 2H70A 1G0TA 3W6GA 2RUEA 5DAKB 4JRRA 3I43A 1THXA 3AY8A 4HZ2A 5KN3A 2IMKA 1I5GA 5HFKA 2LKUA 3SBCA 5ECIB 3GTUA 1M99A 3HJMA 3L0HA 1AQVA 1YJ6A 4TR3A 5IPGA 2YZUA 2DJ0A 3C1SA 9GSSA 4WKWA 4KSMA 2H0IA 1EZKA 2HNLA 1T3BA 1O81A 3IDVA 4HDEA 3IK9A 1S3AA 4WEYA 3JCML 1KEBA 1TK0B 4MDCA 1Y25A 1K0CA 4ML1A 1IYIA 3APQA 2H0HA 4MZBA 4KNDA 1K3YA 3N5OA 4HOJA 3L9VA 3PR8A 1TW9A 2JZSA 5IMAA 3O76A 2H6YA 2C8UA 4OCEA 5KN0A 1YY7A 2AJQB 5JCUA 2KOKA 3FHKA 1OVNA 4DSQA 2WRTA 4MF5A 2VOCA 5JWOB 2LNSA 1TK5B 4G0KA 1J08A 1QUWA 1VF4A 2LJAA 2HRFA 4HQZA 3VLNA 1AXDA 3HD5A 1HD2A 4MF7A 4KH7A 4HJMA 5D9XA 3GNJA 4ECBA 4IGJA 4BVYB 2MMOA 2HSHA 2JADA 1XCCA 1K3OA 2FY6A 1NM3A 3HVXA 1PD21 5ECPB 5DCGA 2EIQA 2FGXA 4PNGA 3HHVA 1TU7A 1M0UA 3DXBA 1EEMA 3UVTA 4KW6A 4TR0A 4ML6A 5GSTA 3O6TA 5A4WA 5H5RA 4V1Ap 3Q6OA 1KNGA 3L78A 4PQ1A 1VF3A 1SJZA 3F63A 4BWSA 1YDKA 2H66A 2GZYA 1K0AA 3IC8A 2VLTA 4BWQA 1AQXA 2H0GA 3KGKA 4E8EA 2O7KA 1M2AA 1PSQA 1N2AA 3G7JA 2HRNA 5IMZA 1OC8A 2WDUA 4IVFA 4ZL8A 2G0FA 3C1RA 3VPTA 2N5FA 4LLRA 3QFAC 2DJ1A 3M9JA 4H86A 3MAKA 2V41A 3LGCA 4KDXA 5J41A 4I8BA 1ERVA 2R37A 3TKSC 4D73B 5IQYA 2VD0A 4LL1B 1M2BA 3VURA 2YPMA 4IQAA 2O87A 1QXHA 1WIKA 3J7Yk 2CAQA 3BCIA 4YAPA 4GLTA 2GSSA 4CDOA 4ECCA 3U6VA 1V98A 4G9HA 1GSQA 5L71A 5FHIA 2AB6A 3LEFA 1WOUA 2GZPA 2BJXA 3VPQA 1NHOA 2B1LA 1Z9HA 3KM6A 3EVIA 5ECLB 5KN1A 3P7XA 3O3TA 5D9VA 2OE3A 2X8HA 3S9FA 3QAGA 1OC9B 2WGRA 1ABAA 2C0DA 1OC3A 3TDGA 1DUGA 3KXOA 1WRYA 2H1AA 2LEGA 2H1DA 4EVMA 2K18A 3MNGA 1UA5A 2ZCTA 4PUAA 2LQQA 1GRXA 3NIVA 2YV9A 3K8NA 4XIHA 1B9YC 1TKDB 4JBBA 1GTIA 2R4VA 1IYHA 4POMA 5B7CA 1GULA 4G0IA 3TJFA 4EO3A 3I6AA 3OR5A 1SKSB 1SD9A 2J23A 5HFGA 3FRCA 3ERWA 3ZMLA 3RDWA 3NZNA 3FZ9A 3UARA 3GV1A 4LL4B 3KIJA 1U88A 4JZQA 2FA8A 4FYBA 5E59A 3F6FA 3UL3A 4TKYA 2CVBA 1PGTA 3WGXA 2IMIA 3F3RA 4PNFA 2XBQA 2GLRA 3IR4A 2F51A 1G6YA 1EV9A 1AQWA 2H6XA 2OACA 2JZTA 1ML6A 1Y6EA 1SYRA 16GSA 1B4QA 3Q18A 2JL4A 3RBTA 6GSUA 5F05A 1HNAA 4MH3A 3VFIA 2HZFA 4TRXA 4CHSA 5CRGA 2V6OA 1TJDA 1V57A 3UJ1A 5EPFA 4MMMA 4YQUA 5ID2B 3A3TA 2FHEA 4PTSA 2AV4A 2C3NA 5AGYA 4ZBAA 1HNCA 2FCHA 3MWHA 4HU7A 3TGZA 4NV2A 1U3IA 1M7TA 1S3DA 2HRAA 1SJIA 4ZB9A 1A23A 1A2JA 3GL5A 5DDLA 2H75A 1TRSA 4NAXA 1CQHA 1V9WA 4XRDA 2IMEA 5ECRB 4HUAA 2VD1A 2WZ9A 3HY2A 4K1FA 1GUMA 3HZ8A 1A0RP 2TRXA 2MMNA 2N5BA 4Q5QA 4DSSB 4YQVA 3W8JA 1QQ2A 3D21A 2WJUA 1W89A 3D5JA 4JEDA 1NSWA 1UN2A 4RI6A 4IELA 1F6MC 4OO5A 1T4YA 2IFQB 2KHPA 2JACA 1YZXA
chains in the Genus database with same CATH superfamily
1DBYA 3IOSA 2MYGA 2FWGA 2HSYA 2IWTA 4F9ZA 3FW2A 3ZREA 2YWOA 1XWAA 1X9SB 3UBKA 1T8EB 2RUFA 2FA4A 3F9UA 4XTSA 1F9MA 4PI0C 2MBSA 3TKPA 1A8LA 3ZMKA 4K5SA 1SVMA 2VUPA 5IM9A 4NMUA 3MDKA 3US3A 1R4WA 2C3QA 3TJBA 3PPUA 1BX9A 3H93A 2L59A 1HNBA 2DJJA 2YN1A 5KOXA 2VKZG 4OFNA 1KBNA 1X9MB 2C3TA 2PVQA 4IP6A 4XS4A 4ISDA 2B5XA 5F06A 2DKHA 3DD3A 2YWMA 2RLIA 4Q5NA 2CV4A 4ECIA 1GSYA 1ZYQB 4I2UA 4G19A 3GA4A 4NV5A 1TK8B 3HMJG 4YH2A 3APSA 3GFKA 2OE1A 3ZIVA 4V1Ag 2EIOA 2G2QA 2P31A 2O5VA 3ZVJD 1YEXA 5IOWA 1HYUA 3GKMA 3ZYWA 4DSRA 4J56E 2CT6A 2HZEA 5CRDA 5D93A 1E6BA 2I9HA 2C0GA 4ZXGA 5ELGA 3E0UA 2HT9A 4NHZA 3I69A 3EU3A 1VF1A 4I6XA 5EVOA 5A5HA 2LRNA 5J9CA 4PHZC 1XG8A 3HXSA 3LXTA 5DJLA 1TRWA 4EIPA 3V1WA 1I9DA 3EMXA 5FT3A 2O85A 1PX7A 3IAM2 4RUVA 4GF0A 3DMLA 3TKSE 3IK7A 1ZZYA 2GGTA 1ERTA 3KTBA 1FG4A 3FEUA 2CQ9A 3H4KA 4BVYA 3DYRA 3N9JA 3UOMA 1U6TA 4EDZA 1EP7A 1HQOA 3IAS2 4MJAA 5F8BA 4IBPA 4WBJA 2L57A 2H8LA 1ZYPA 2NPBA 2XHFA 1F2EA 2GTUA 2HQTA 4YAVA 1RW1A 2AUVA 4JE1A 4GDFA 1SJ6A 3EE2A 2LRCA 2LV3A 5ECKB 3UMAA 5KOWA 4NHWA 2VIMA 5IOXA 2LTKA 5J3RA 2LSTA 3CRTA 2PWJA 2QA1A 2O89A 2WULA 1ST9A 2OKAA 1JZDA 4CY6A 3SWLA 5LCZA 1X5EA 2YCDA 2P5QA 1R5PA 2MZCA 4WF5A 3CTGA 3GUSA 18GSA 3F8UA 5CREA 3ED3A 4N0VA 4ILFA 2UZ8A 3HJPA 2ON7A 1TU8A 3PGTA 4HS1A 4AKIA 4K2XA 4L0WA 5B6NA 1BEDA 2OBKA 4QL9A 5IO0A 3VWXA 4BL7B 1ERWA 3E3EA 4J2FA 4BVXA 3VWVA 3WYWA 5AIVA 1BG5A 3QMXA 2DLXA 2EFDA 1Z5YE 3FR6A 3G9BA 1ACVA 4USSA 2H01A 2B1KA 3P90A 5CRWA 14GSA 2BTOT 2LJKA 2A2SA 5ECNB 4MPFA 1YKAA 3WT2A 3IA1A 5KEJA 1FB6A 1ZL9A 2B3SA 1XVQA 4TXVA 2WW2A 3PINA 2F8AA 3FZ4A 3TJGA 1PL2A 17GSA 3GH6A 3P8WA 6GSWA 2X99A 1M9BA 4GSSA 3TCOA 2E2MA 3QDNA 5ECSA 2F8FA 3LFLA 1M3JA 3VWWA 1AAZA 5HQPA 2DJ3A 5GZZB 3ZITA 4TXOB 1SU9A 3EWLA 1QMVA 11GSA 2B7KA 5G5FA 5C04A 5IO2A 5D9WA 5DQSA 1J0FA 2CAIA 2KP2A 1SYXA 5H5SA 2GSQA 4PX1A 1YKCA 1PQNA 1G7EA 2C0EA 3M0FA 4HSCX 3DGQA 1TDIA 1GUHA 2TIRA 3EURA 2L5LA 2M72A 2FWEA 3UBLA 2ZUPA 2H6ZA 2VM1A 3H79A 2VCVA 4RI7A 1G7OA 4MA9A 5DJMA 3ME8A 5JCGA 3RHCA 3LQ7A 1PX6A 3HVSA 3ZL5A 2PGTA 3QOUA 5C00A 2GVPA 1F37A 1SK2A 10GSA 1O85A 2N5AA 4K6XA 5JCWA 3FR3A 4O7HA 1TOFA 1SK0A 3BCKA 2REMA 2R0GA 2FWFA 2FLSA 1USBA 2ON5A 1QGVA 2DSAA 3IE3A 1J9BA 5BRTA 2QC7A 1XXUA 3ZRDA 2C0FA 4G0LA 1F3AA 4LMWA 2A4HA 2CA8A 3L9SA 3GKNA 5G2ZA 4PURA 4W66A 2GQMA 2L6DA 5CYYA 4ACSA 1MDJA 1A24A 1B4PA 2C4JA 1ILOA 5J47A 1N8JA 1SL1B 5A4UA 2V32A 3ISOA 1JHBA 2AYTA 3IRAA 3CMIA 4KB3A 4HI7A 1FOVA 1XOAA 5DQYA 2NTOA 6GSSA 1JZRA 1OAZA 2EFHA 5B8AA 3TRXA 4ZBBA 1SENA 5AIXA 4EL1A 2WW3A 3CXGA 2P0GA 3UVHA 3C8EA 4X4JA 1EGRA 1Z3EA 2MMAA 5KN2A 1JLVA 5ECMB 2HLSA 4PGTA 2HRKB 4N10A 4GTUA 2DJ2A 4F03A 1ERUA 1SL0B 2PVOC 2PN8A 1XWCA 3HDCA 4MJEA 5HR0A 1JFUA 2E2GA 4TR1A 2RM5A 3H8QA 1GTBA 1UC7A 1GSSA 1OE8A 4AKXB 3BJ5A 1K0NA 4HJ2A 5DALA 4P3YB 4RQXA 2X8GA 13GSA 4ZB8A 4KAEA 4POBA 2E7PA 3FK8A 1EOGA 4GRFA 2VL2A 1PL1A 3FZAA 4NWYA 3W8SA 2OE0A 2YWNA 5DCHA 1H75A 1K0MA 3HCZA 5IPHA 1YQ1A 4EUYA 4ULXA 1F3BA 5HFIA 4LMVA 2PU9C 3A5WA 1WMJA 2YP6A 4K7OA 2HE3A 4Q5FA 4XS1A 1SKRB 3LWAA 2H1GA 5IIZA 1EWXA 2LUSA 2K8SA 2H1BA 3TU3B 1FVJA 1FAAA 2DIZA 3F4TA 1AC1A 3J7Yb 1YF1A 3IC4A 3WGEA 1ZOFA 4K8MA 2LNTA 1JZOA 3UEMA 2YZHA 2A4VA 4MZWA 3APOA 1XFLA 1Z6MA 3WT1A 4Q5RA 3UIWA 5EL8A 1TRVA 3QAWA 4TVEA 3QR6A 1XWKA 4IJ3A 3GN3A 4KSOA 2ALBA 4O5UA 2VL3A 3Q19A 2HSNB 3RFRC 5IMCA 2E0QA 4ICYA 3ZFBA 1JZWA 4AJ8A 1FVKA 1SD8A 3CTFA 1BQ7A 5ECOB 5D9TA 2HSMB 2WVXA 3MSZA 5IMDA 2DMMA 5JWQB 1GP1A 3QFBC 4CW9A 3ZVJA 4K7IA 1UVZA 1GH2A 2F3MA 4JR4A 3E9JB 3F4RA 3QPMA 5FWGA 3LG6A 1ON4A 3A2XA 3KTLA 3FMWA 5DAKA 1OYJA 5A1NA 1GNWA 3IPZA 4K0GA 2IMFA 2IPAA 2VCWA 1A0FA 4YQMA 1I1IP 2FUG2 5CNWA 4HEA2 5A34A 3D4TA 2K9FA 5J5NA 3TKRA 1K0BA 2YANA 1Z7RA 1XOBA 1W4VA 2HXKA 1GL8A 5CO3A 3DIEA 4I5QA 2R3XA 3HJOA 2FWHA 5G1KA 1YVLA 1WJKA 3R3EA 3VK9A 5F0GA 2GSRA 3GURA 2VAFA 2VO4A 4F2IA 1MD4A 4FYCA 1R26A 2V1MA 4WF4A 3KZQA 3GH9A 3G7IA 2I81A 5D8IA 4AGSA 3GRXA 1E2YA 1FHEA 2ES7A 3CRUA 4KCAA 4BA7A 3IV4A 3MIXA 2EC4A 3TOUA 1TXXA 2B6MA 1M9AA 1TXUA 1OE7A 1M2DA 3F4SA 2GQKA 2BMXA 3TJKA 5ABRA 2DBCA 4CY8A 1C72A 1URMA 3P2AA 1A2LA 5AN1A 3FY7A 3UAPA 1Z7PA 4TOPA 3GL3A 4POLA 3KEBA 2YNXA 2I3YA 3CWGA 1SVOA 2LS5A 2YOIA 4BL7A 2JU5A 4GWRA 1ZYEA 1DSBA 1GSDA 1K0DA 3R2QA 2R6KA 1FW1A 2RIIA 2WFCA 3FYGA 1SKWB 2HYXA 1T1VA 2R0PA 2OBIA 3D0ZA 3C73A 1GSEA 1GNEA 4MPGA 4GQFA 4HQSA 4XS4B 4F82A 4G10A 1SK1A 4XHMA 4E8HA 3D6IA 4FQUA 3DRNA 4AJ6A 1GTUA 1N25A 2DMLA 6GSTA 4IKHA 2YWIA 1X9WB 4IW9A 3PH9A 1T7PB 3BBYA 1XBSA 2IJYA 5E4WA 5HR3A 4AI6A 3U5RE 1LU4A 1MDIA 1O8XA 5HR1A 4KE3A 1GSUA 4V2NA 2VLVA 1OKDA 3KD0A 3KP8A 2ZNMA 4PUFC 3LW9A 3QAVA 3KJYA 2P5RA 4L5OA 1Z6NA 4O92A 4TXOA 3VWUA 3HYPA 4L0UA 2WW1A 3HVVA 2HZEB 3M8NA 3VI7A 1XWGA 1SL2B 1FB0A 4L5LA 3GX8A 3HZ4A 3FKFA 3TKSA 4NXIA 1VRSD 3BOAA 3M3MA 1U3AA 5A5HB 4AJ7A 3DEXA 1Q4JA 3H1NA 1XW5A 5IMFA 3F0IA 2QSIA 1G6WA 1V2AA 1RQMA 1WPIA 1XZOA 4YKFA 3QCPA 1GLPA 4GSNA 1QFNA 3EU4A 4ZILA 4D73A 5JWRB 1GLQA 3EMPA 1V40A 1TP9A 4K7NA 3WD6A 4WR5A 4FH8A 1EEJA 2K6VA 5AISA 3GTUB 4EXJA 3IHQA 1PKWA 4EDYA 4QQ7A 4K0NA 4Z2TA 4GXZA 4O5QA 4FO5A 2GT5A 3ZFLA 4PI2C 2F9SA 3GSTA 4IHUA 3RPPA 4MLYA 1B8XA 3ERGA 5DBQA 5GAPD 6GSXA 2GT6A 1S3CA 5J40A 3ME7A 3ZZXA 2D2ZA 4IP1A 4EF0A 2H73A 2DC5A 3F6DA 3CYNA 2OJLA 1Q98A 1QK8A 2NVLA 4KDYA 2JZRA 8GSSA 4A5PA 2H72A 4HU9A 3IXRA 1BF5A 5CRHA 1A8YA 4OCFA 2H30A 2UV8G 1RK4A 4JR6A 2PUKC 4OMVA 3L9UA 6GSVA 2OT3A 1H4OA 1OC9A 1MTCA 1FOHA 2GDRA 5G31A 3TRPA 3DWVA 4PXOA 4G2EA 4MJBA 3GKXA 2V2GA 4Z2UA 2WB9A 3EC3A 5LNKe 4X43A 4KUNA 2V6KA 3GKKA 4MNNA 1MDKA 4QL7A 1GTAA 3KP9A 2JSZA 5G1LA 5A5KA 4ZB7A 3CQFA 5COHA 4BVXB 1EGOA 4WBRD 4WETA 1YF0A 20GSA 1JLWA 1R7HA 4BPYA 2HRKA 6GSYA 2LRTA 3GIXA 5LD0A 2HI7A 5DVBA 4F0CA 3WGDA 1K0OA 2EFEA 3G7YA 4ZB6A 3GMFA 5D96A 2LQOA 1TRUA 1TI1A 2VLUA 2MMZA 2L5OA 2XPEA 5B6MA 4IS0A 1PKZA 2X64A 1OKTA 1ZCPA 1LJRA 4IN0A 4XS6A 4DVCA 4I97A 3LYKA 4GQCA 4JU5A 4N0ZA 5EY6A 2GSTA 2GZZA 3LYPA 4EC0A 4MCUA 2L6CA 2QKEA 1TTZA 3C7MA 2FNOA 1XWBA 1XPVA 4OO4A 2CX4A 1AIUA 1X5CA 1U87A 2M80A 4WXTA 4KF9A 5HR2A 2M46A 5ID2A 4ZL9A 4MZCA 3KMOA 4HZ4A 1R5AA 1BJXA 4KX4A 3D22A 1EP8A 4MF6A 2C80A 3I9V2 2YJ7A 3CSIA 3GYKA 2MBTA 2B5EA 4BIKA 3DVWA 4FIWA 2KP1A 2VCQA 5J9BA 2CVKA 4EE0A 5H5QA 5J4YA 1WE0A 3A2WA 5CAXA 1THOA 4DSSA 1PA3A 2RM6A 1CQGA 4Z7XA 1BYEA 4J57E 2HSNA 3LXZA 2EIRA 4N30A 4XCSA 3F3QA 1XIYA 4TN8A 1EOHA 3LORA 3CSJA 2IFQA 5BMUA 3TRQA 3RPNA 2HSMA 1XW9A 3TOTA 2QGVA 2VL9A 2VCTA 2Z9SA 4ID0A 3IBHA 3QD9A 4ZIJA 3BD2A 2OADA 2X8CA 4OFTA 5G5EA 2LJRA 1AUCA 4V2MA 4AKGA 1XVWA 4POKA 5F07A 4WR4A 2I4AA 4Z2RA 2CZ3A 1ZMAA 4G01A 1TI3A 2L4QA 4ZL7A 5ELAA 2K8VA 4OD7A 2AAWA 3RHBA 2WS2A 2IIYA 2JSYA 2B7JA 4EKZA 2IMDA 1BAYA 3NOFA 4NPBA 19GSA 5B8BA 2KUCA 2J9HA 3LSZA 5GAND 2HFDA 3TJJA 2VCXA 1A2MA 4GCIA 5J4UA 2KLXA 1O7UA 3KH7A 4X1UA 3GHAA 1V58A 4KGIA 3LJRA 5D73A 3EYTA 1O73A 4E68A 3TB2A 4XRAA 4RQRA 2VCZA 5INYA 4K9ZA 2YJHA 1PN9A 1GSFA 1T00A 3RGBC 2IL3A 4MABA 1YEPA 4X0XA 2XBIA 1NW2A 1K3LA 1PRXA 3ZIJA 3L4NA 1ZGNA 4PQHA 4ZBDA 2PMTA 2DJKA 1MEKA 1O6JA 4IJIA 2C1YA 4TR1B 5A4VA 2PERA 3ERFA 4PQIA 5G30A 2DIYA 3A2VA 2AHEA 1MD3A 3TKQA 2CVDA 5DALB 1T4ZA 3HKRA 3DKSA 2H19A 3HA9A 4LA1A 1EV4A 4O32A 4OFMA 3M9KA 4MJCA 3C71A 7GSSA 3FR9A 2I1UA 1O8WA 4AF2A 1X0RA 3CSHA 4KA0A 2NBSA 2R2JA 4MP4A 2R5GA 2VL2C 2A2RA 1B9XC 4TR4A 2WW0A 1KTEA 4KDUA 3DVXA 2WVZA 1FO5A 3GSSA 3IHGA 2NDOA 3Q74A 2FD3A 3CBUA 5GSSA 2L4CA 3KH9A 22GSA 2CZ2A 3EINA 5ENUA 2B5YA 1B48A 1VF2A 3TUEA 1XW6A 4MH2A 1X5DA 1AW9A 2OA7A 1S3RA 2WCIA 3RAZA 12GSA 5ECHB 1WWJA 1LBKA 2CX3A 4KCEA 5ECQB 2GQLA 2H74A 1VGLA 4I2TA 3D4MA 4IQ1A 2GS3A 4V2LA 1WP0A 1DE2A 1PMTA 2VM2A 3ZTLA 4FYUA 5CP1A 2O8VB 4ECJA 4K2DA 3KCMA 2O3EA 5IMVA 1DE1A 4MK3A 2H71A 4GSTA 3ZLPA 2WVXB 2X49A 2PPTA 3GX0A 4F0BA 4TW5A 4OWYA 2PBJA 4L8EA 2TRCP 2XPDA 3VI5A 3M1GA 1GWCA 4DEJA 3KMNA 2IN3A 4N11A 4O5RA 3FZ5A 2XC2A 1GUKA 2H76A 1NHYA 2YV7A 2H70A 1G0TA 3W6GA 2RUEA 5DAKB 4JRRA 3I43A 5A1NB 1THXA 3AY8A 4HZ2A 4N3ZA 5KN3A 2IMKA 1I5GA 5HFKA 2LKUA 3SBCA 5ECIB 1YEWC 1M99A 3GTUA 5A34B 3HJMA 3L0HA 1AQVA 1YJ6A 4TR3A 5IPGA 2YZUA 2DJ0A 4FXYP 3C1SA 9GSSA 4WKWA 4KSMA 2H0IA 1EZKA 2HNLA 1T3BA 4AKHA 1O81A 3IDVA 4HDEA 3IK9A 2QA2A 1S3AA 4WEYA 3JCML 1KEBA 1TK0B 4MDCA 1Y25A 1K0CA 3HVNA 4ML1A 1IYIA 3APQA 2H0HA 4MZBA 4KNDA 1K3YA 3N5OA 4HOJA 3L9VA 3A5IA 3PR8A 1TW9A 1PFOA 2JZSA 5IMAA 3O76A 2H6YA 2EFCA 2C8UA 2DKIA 4OCEA 5KN0A 1YY7A 2AJQB 5JCUA 2KOKA 3FHKA 1OVNA 4DSQA 2WRTA 4MF5A 2VOCA 5JWOB 2LNSA 1TK5B 4G0KA 1J08A 1QUWA 1VF4A 2LJAA 2HRFA 4HQZA 3VLNA 1AXDA 3HD5A 5J4VA 1HD2A 4MF7A 4KH7A 4HJMA 5D9XA 3GNJA 4ECBA 4IGJA 4BVYB 2MMOA 2HSHA 2JADA 1XCCA 1K3OA 2FY6A 1M3IA 1NM3A 3HVXA 1PD21 5ECPB 4K5RA 5DCGA 2EIQA 2FGXA 4PNGA 3HHVA 1TU7A 1M0UA 3DXBA 1EEMA 3UVTA 4KW6A 4TR0A 4ML6A 5GSTA 3O6TA 5A4WA 5H5RA 4V1Ap 3Q6OA 1KNGA 3L78A 4PQ1A 1VF3A 1SJZA 3F63A 4BWSA 1YDKA 2H66A 2GZYA 1K0AA 3IC8A 2VLTA 4BWQA 1AQXA 2H0GA 3KGKA 4E8EA 2O7KA 1M2AA 2O36A 1N2AA 1PSQA 3G7JA 2HRNA 5IMZA 1OC8A 2WDUA 4IVFA 4ZL8A 4EIQA 2G0FA 3C1RA 3VPTA 2N5FA 4LLRA 3QFAC 2DJ1A 3M9JA 4H86A 2WZSA 2X4AA 3MAKA 2V41A 3LGCA 4KDXA 5J41A 4I8BA 1PN0A 1ERVA 2R37A 3TKSC 4D73B 5IQYA 2VD0A 4LL1B 1M2BA 3VURA 2YPMA 4IQAA 2O87A 1QXHA 1WIKA 3J7Yk 2R0CA 2CAQA 3BCIA 4YAPA 4GLTA 2GSSA 4CDOA 4YKGA 4ECCA 3U6VA 1V98A 3CHXC 4G9HA 1GSQA 5L71A 5FHIA 2AB6A 3LEFA 1WOUA 2GZPA 2BJXA 3VPQA 1NHOA 2B1LA 1Z9HA 3KM6A 3EVIA 5ECLB 5KN1A 3P7XA 3O3TA 5D9VA 2OE3A 2X8HA 3S9FA 3QAGA 1OC9B 2WGRA 1ABAA 2C0DA 1OC3A 3TDGA 1DUGA 3KXOA 1WRYA 2H1AA 2LEGA 2H1DA 4EVMA 2K18A 4QMKA 3MNGA 1UA5A 2ZCTA 4PUAA 2LQQA 1GRXA 3NIVA 2YV9A 3K8NA 4XIHA 1B9YC 1TKDB 4JBBA 1GTIA 2R4VA 1IYHA 4POMA 5B7CA 3MYDA 1GULA 3EPTA 4G0IA 3TJFA 4EO3A 3I6AA 3OR5A 1SKSB 1SD9A 2J23A 5HFGA 3FRCA 3ERWA 3ZMLA 3RDWA 3NZNA 3FZ9A 3UARA 3GV1A 4LL4B 3KIJA 1U88A 4JZQA 2FA8A 4FYBA 5E59A 3F6FA 3UL3A 4TKYA 2CVBA 1PGTA 3WGXA 2IMIA 3F3RA 1S4BP 4PNFA 2XBQA 2GLRA 3IR4A 2F51A 1G6YA 1EV9A 1AQWA 2H6XA 2OACA 2JZTA 1ML6A 1Y6EA 1SYRA 16GSA 1B4QA 3Q18A 2JL4A 3RBTA 6GSUA 5F05A 1HNAA 4MH3A 1BG1A 3VFIA 2HZFA 4TRXA 4CHSA 5CRGA 2V6OA 1TJDA 1V57A 3UJ1A 5EPFA 4MMMA 4YQUA 5ID2B 3A3TA 2FHEA 2H1LA 4PTSA 2AV4A 2C3NA 1Y1UA 1SVLA 5AGYA 2A2PA 4ZBAA 1HNCA 2FCHA 3MWHA 4HU7A 3TGZA 4NV2A 1U3IA 1M7TA 1S3DA 2HRAA 1SJIA 4ZB9A 1A23A 1A2JA 3GL5A 5DDLA 2H75A 1TRSA 4NAXA 1CQHA 1V9WA 4XRDA 2IMEA 5ECRB 2WVYA 4HUAA 2VD1A 2WZ9A 3HY2A 4K1FA 1GUMA 3HZ8A 1A0RP 2TRXA 2MMNA 2N5BA 4Q5QA 4DSSB 4YQVA 3W8JA 1QQ2A 3D21A 2WJUA 1W89A 3D5JA 4JEDA 1NSWA 1UN2A 4RI6A 4IELA 1F6MC 4OO5A 1T4YA 2IFQB 5BMUB 2KHPA 2JACA 1ZYNA 1YZXA
chains in the Genus database with same CATH topology
1DBYA 3IOSA 2MYGA 2FWGA 2HSYA 2IWTA 4F9ZA 3FW2A 3ZREA 2YWOA 1XWAA 1X9SB 3UBKA 1T8EB 2RUFA 2FA4A 3F9UA 4XTSA 1F9MA 2MBSA 3TKPA 1A8LA 3ZMKA 4K5SA 1SVMA 2VUPA 5IM9A 4NMUA 3MDKA 3US3A 1R4WA 2C3QA 3TJBA 3PPUA 1BX9A 3H93A 2L59A 1HNBA 2DJJA 2YN1A 5KOXA 2VKZG 4OFNA 1KBNA 1X9MB 2C3TA 2PVQA 4IP6A 4XS4A 4ISDA 2B5XA 5F06A 2DKHA 3DD3A 2YWMA 2RLIA 4Q5NA 2CV4A 4ECIA 1GSYA 1ZYQB 4I2UA 4G19A 3GA4A 4NV5A 1TK8B 3HMJG 4YH2A 3APSA 3GFKA 2OE1A 3ZIVA 4V1Ag 2EIOA 2G2QA 2P31A 2O5VA 3ZVJD 1YEXA 5IOWA 1HYUA 3GKMA 3ZYWA 4DSRA 4J56E 2CT6A 2HZEA 5CRDA 5D93A 1E6BA 2I9HA 2C0GA 4ZXGA 5ELGA 3E0UA 2HT9A 4NHZA 3I69A 3EU3A 1VF1A 4I6XA 5EVOA 5A5HA 2LRNA 5J9CA 3HXSA 3LXTA 5DJLA 1TRWA 4EIPA 3V1WA 1I9DA 3EMXA 5FT3A 2O85A 1PX7A 3IAM2 4RUVA 4GF0A 3DMLA 3TKSE 3IK7A 1ZZYA 2GGTA 1ERTA 3KTBA 1FG4A 3FEUA 2CQ9A 3H4KA 4BVYA 3DYRA 3N9JA 3UOMA 1U6TA 4EDZA 1EP7A 1HQOA 3IAS2 4MJAA 5F8BA 4IBPA 4WBJA 2L57A 2H8LA 1ZYPA 2NPBA 2XHFA 1F2EA 2GTUA 2HQTA 4YAVA 1RW1A 2AUVA 4JE1A 4GDFA 1SJ6A 3EE2A 2LRCA 2LV3A 5ECKB 3UMAA 5KOWA 4NHWA 2VIMA 5IOXA 2LTKA 5J3RA 2LSTA 3CRTA 2PWJA 2QA1A 2O89A 2WULA 1ST9A 2OKAA 1JZDA 4CY6A 3SWLA 5LCZA 1X5EA 2YCDA 2P5QA 1R5PA 2MZCA 4WF5A 3CTGA 3GUSA 18GSA 3F8UA 5CREA 3ED3A 4N0VA 4ILFA 2UZ8A 3HJPA 2ON7A 1TU8A 3PGTA 4HS1A 4AKIA 4K2XA 4L0WA 5B6NA 1BEDA 2OBKA 4QL9A 5IO0A 3VWXA 4BL7B 1ERWA 3E3EA 4J2FA 4BVXA 3VWVA 3WYWA 5AIVA 1BG5A 3QMXA 2DLXA 2EFDA 1Z5YE 3FR6A 3G9BA 1ACVA 4USSA 2H01A 2B1KA 3P90A 5CRWA 14GSA 2BTOT 2LJKA 2A2SA 5ECNB 4MPFA 1YKAA 3WT2A 3IA1A 5KEJA 1FB6A 1ZL9A 2B3SA 1XVQA 4TXVA 3PINA 2F8AA 3FZ4A 3TJGA 1PL2A 17GSA 3GH6A 3P8WA 6GSWA 2X99A 1M9BA 4GSSA 3TCOA 2E2MA 3QDNA 5ECSA 2F8FA 3LFLA 3VWWA 1AAZA 5HQPA 2DJ3A 5GZZB 3ZITA 4TXOB 1SU9A 3EWLA 1QMVA 11GSA 2B7KA 5G5FA 5C04A 5IO2A 5D9WA 5DQSA 1J0FA 2CAIA 2KP2A 1SYXA 5H5SA 2GSQA 4PX1A 1YKCA 1PQNA 1G7EA 2C0EA 3M0FA 3DGQA 1TDIA 1GUHA 2TIRA 3EURA 2L5LA 2M72A 2FWEA 3UBLA 2ZUPA 2H6ZA 2VM1A 3H79A 2VCVA 4RI7A 1G7OA 4MA9A 5DJMA 3ME8A 5JCGA 3RHCA 3LQ7A 1PX6A 3HVSA 3ZL5A 2PGTA 3QOUA 5C00A 2GVPA 1F37A 1SK2A 10GSA 1O85A 2N5AA 4K6XA 5JCWA 3FR3A 4O7HA 1TOFA 1SK0A 3BCKA 2REMA 2R0GA 2FWFA 2FLSA 1USBA 2ON5A 1QGVA 2DSAA 3IE3A 1J9BA 5BRTA 2QC7A 1XXUA 3ZRDA 2C0FA 4G0LA 1F3AA 4LMWA 2A4HA 2CA8A 3L9SA 3GKNA 5G2ZA 4PURA 4W66A 2GQMA 2L6DA 5CYYA 4ACSA 1MDJA 1A24A 1B4PA 2C4JA 1ILOA 5J47A 1N8JA 1SL1B 5A4UA 2V32A 3ISOA 1JHBA 2AYTA 3IRAA 3CMIA 4KB3A 4HI7A 1FOVA 1XOAA 5DQYA 2NTOA 6GSSA 1JZRA 1OAZA 2EFHA 5B8AA 3TRXA 4ZBBA 1SENA 5AIXA 4EL1A 3CXGA 2P0GA 3UVHA 3C8EA 4X4JA 1EGRA 1Z3EA 2MMAA 5KN2A 1JLVA 5ECMB 2HLSA 4PGTA 2HRKB 4N10A 4GTUA 2DJ2A 4F03A 1ERUA 1SL0B 2PVOC 2PN8A 1XWCA 3HDCA 4MJEA 5HR0A 1JFUA 2E2GA 4TR1A 2RM5A 3H8QA 1GTBA 1UC7A 1GSSA 1OE8A 4AKXB 3BJ5A 1K0NA 4HJ2A 5DALA 4P3YB 4RQXA 2X8GA 13GSA 4ZB8A 4KAEA 4POBA 2E7PA 3FK8A 1EOGA 4GRFA 2VL2A 1PL1A 3FZAA 4NWYA 3W8SA 2OE0A 2YWNA 5DCHA 1H75A 1K0MA 3HCZA 5IPHA 1YQ1A 4EUYA 4ULXA 1F3BA 5HFIA 4LMVA 2PU9C 3A5WA 1WMJA 2YP6A 4K7OA 2HE3A 4Q5FA 4XS1A 1SKRB 3LWAA 2H1GA 5IIZA 1EWXA 2LUSA 2K8SA 2H1BA 3TU3B 1FVJA 1FAAA 2DIZA 3F4TA 1AC1A 3J7Yb 1YF1A 3IC4A 3WGEA 1ZOFA 4K8MA 2LNTA 1JZOA 3UEMA 2YZHA 2A4VA 4MZWA 3APOA 1XFLA 1Z6MA 3WT1A 4Q5RA 3UIWA 5EL8A 1TRVA 3QAWA 4TVEA 3QR6A 1XWKA 4IJ3A 3GN3A 4KSOA 2ALBA 4O5UA 2VL3A 3Q19A 2HSNB 5IMCA 2E0QA 4ICYA 3ZFBA 1JZWA 4AJ8A 1FVKA 1SD8A 3CTFA 1BQ7A 5ECOB 5D9TA 2HSMB 3MSZA 5IMDA 2DMMA 5JWQB 1GP1A 3QFBC 4CW9A 3ZVJA 4K7IA 1UVZA 1GH2A 2F3MA 4JR4A 3E9JB 3F4RA 3QPMA 5FWGA 3LG6A 1ON4A 3A2XA 3KTLA 3FMWA 5DAKA 1OYJA 5A1NA 1GNWA 3IPZA 4K0GA 2IMFA 2IPAA 2VCWA 1A0FA 4YQMA 2FUG2 5CNWA 4HEA2 5A34A 3D4TA 2K9FA 5J5NA 3TKRA 1K0BA 2YANA 1Z7RA 1XOBA 1W4VA 2HXKA 1GL8A 5CO3A 3DIEA 4I5QA 2R3XA 3HJOA 2FWHA 5G1KA 1YVLA 1WJKA 3R3EA 3VK9A 5F0GA 2GSRA 3GURA 2VAFA 2VO4A 4F2IA 1MD4A 4FYCA 1R26A 2V1MA 4WF4A 3KZQA 3GH9A 3G7IA 2I81A 5D8IA 4AGSA 3GRXA 1E2YA 1FHEA 2ES7A 3CRUA 4KCAA 4BA7A 3IV4A 3MIXA 2EC4A 3TOUA 1TXXA 2B6MA 1M9AA 1TXUA 1OE7A 1M2DA 3F4SA 2GQKA 2BMXA 3TJKA 5ABRA 2DBCA 4CY8A 1C72A 1URMA 3P2AA 1A2LA 5AN1A 3FY7A 3UAPA 1Z7PA 4TOPA 3GL3A 4POLA 3KEBA 2YNXA 2I3YA 3CWGA 1SVOA 2LS5A 2YOIA 4BL7A 2JU5A 4GWRA 1ZYEA 1DSBA 1GSDA 1K0DA 3R2QA 2R6KA 1FW1A 2RIIA 2WFCA 3FYGA 1SKWB 2HYXA 1T1VA 2R0PA 2OBIA 3D0ZA 3C73A 1GSEA 1GNEA 4MPGA 4GQFA 4HQSA 4XS4B 4F82A 4G10A 1SK1A 4XHMA 4E8HA 3D6IA 4FQUA 3DRNA 4AJ6A 1GTUA 1N25A 2DMLA 6GSTA 4IKHA 2YWIA 1X9WB 4IW9A 3PH9A 1T7PB 3BBYA 1XBSA 2IJYA 5E4WA 5HR3A 4AI6A 3U5RE 1LU4A 1MDIA 1O8XA 5HR1A 4KE3A 1GSUA 4V2NA 2VLVA 1OKDA 3KD0A 3KP8A 2ZNMA 4PUFC 3LW9A 3QAVA 3KJYA 2P5RA 4L5OA 1Z6NA 4O92A 4TXOA 3VWUA 3HYPA 4L0UA 3HVVA 2HZEB 3M8NA 3VI7A 1XWGA 1SL2B 1FB0A 4L5LA 3GX8A 3HZ4A 3FKFA 3TKSA 4NXIA 1VRSD 3BOAA 3M3MA 1U3AA 5A5HB 4AJ7A 3DEXA 1Q4JA 3H1NA 1XW5A 5IMFA 3F0IA 2QSIA 1G6WA 1V2AA 1RQMA 1WPIA 1XZOA 4YKFA 3QCPA 1GLPA 4GSNA 1QFNA 3EU4A 4ZILA 4D73A 5JWRB 1GLQA 3EMPA 1V40A 1TP9A 4K7NA 3WD6A 4WR5A 4FH8A 1EEJA 2K6VA 5AISA 3GTUB 4EXJA 3IHQA 1PKWA 4EDYA 4QQ7A 4K0NA 4Z2TA 4GXZA 4O5QA 4FO5A 2GT5A 3ZFLA 2F9SA 3GSTA 4IHUA 3RPPA 4MLYA 1B8XA 3ERGA 5DBQA 5GAPD 6GSXA 2GT6A 1S3CA 5J40A 3ME7A 3ZZXA 2D2ZA 4IP1A 4EF0A 2H73A 2DC5A 3F6DA 3CYNA 2OJLA 1Q98A 1QK8A 2NVLA 4KDYA 2JZRA 8GSSA 4A5PA 2H72A 4HU9A 3IXRA 1BF5A 5CRHA 1A8YA 4OCFA 2H30A 2UV8G 1RK4A 4JR6A 2PUKC 4OMVA 3L9UA 6GSVA 2OT3A 1H4OA 1OC9A 1MTCA 1FOHA 2GDRA 5G31A 3TRPA 3DWVA 4PXOA 4G2EA 4MJBA 3GKXA 2V2GA 4Z2UA 2WB9A 3EC3A 5LNKe 4X43A 4KUNA 2V6KA 3GKKA 4MNNA 1MDKA 4QL7A 1GTAA 3KP9A 2JSZA 5G1LA 5A5KA 4ZB7A 5COHA 4BVXB 1EGOA 4WBRD 4WETA 1YF0A 20GSA 1JLWA 1R7HA 4BPYA 2HRKA 6GSYA 2LRTA 3GIXA 5LD0A 2HI7A 5DVBA 4F0CA 3WGDA 1K0OA 2EFEA 3G7YA 4ZB6A 3GMFA 5D96A 2LQOA 1TRUA 1TI1A 2VLUA 2MMZA 2L5OA 2XPEA 5B6MA 4IS0A 1PKZA 2X64A 1OKTA 1ZCPA 1LJRA 4IN0A 4XS6A 4DVCA 4I97A 3LYKA 4GQCA 4JU5A 4N0ZA 5EY6A 2GSTA 2GZZA 3LYPA 4EC0A 4MCUA 2L6CA 2QKEA 1TTZA 3C7MA 2FNOA 1XWBA 1XPVA 4OO4A 2CX4A 1AIUA 1X5CA 1U87A 2M80A 4WXTA 4KF9A 5HR2A 2M46A 5ID2A 4ZL9A 4MZCA 3KMOA 4HZ4A 1R5AA 1BJXA 4KX4A 3D22A 1EP8A 4MF6A 2C80A 3I9V2 2YJ7A 3CSIA 3GYKA 2MBTA 2B5EA 3DVWA 4FIWA 2KP1A 2VCQA 5J9BA 2CVKA 4EE0A 5H5QA 5J4YA 1WE0A 3A2WA 5CAXA 1THOA 4DSSA 1PA3A 2RM6A 1CQGA 4Z7XA 1BYEA 4J57E 2HSNA 3LXZA 2EIRA 4N30A 4XCSA 3F3QA 1XIYA 4TN8A 1EOHA 3LORA 3CSJA 2IFQA 5BMUA 3TRQA 3RPNA 2HSMA 1XW9A 3TOTA 2QGVA 2VL9A 2VCTA 2Z9SA 4ID0A 3IBHA 3QD9A 4ZIJA 3BD2A 2OADA 2X8CA 4OFTA 5G5EA 2LJRA 1AUCA 4V2MA 4AKGA 1XVWA 4POKA 5F07A 4WR4A 2I4AA 4Z2RA 2CZ3A 1ZMAA 4G01A 1TI3A 2L4QA 4ZL7A 5ELAA 2K8VA 4OD7A 2AAWA 3RHBA 2WS2A 2IIYA 2JSYA 2B7JA 4EKZA 2IMDA 1BAYA 3NOFA 4NPBA 19GSA 5B8BA 2KUCA 2J9HA 3LSZA 5GAND 2HFDA 3TJJA 2VCXA 1A2MA 4GCIA 5J4UA 2KLXA 1O7UA 3KH7A 4X1UA 3GHAA 1V58A 4KGIA 3LJRA 5D73A 3EYTA 1O73A 4E68A 3TB2A 4XRAA 4RQRA 2VCZA 5INYA 4K9ZA 2YJHA 1PN9A 1GSFA 1T00A 2IL3A 4MABA 1YEPA 4X0XA 2XBIA 1NW2A 1K3LA 1PRXA 3ZIJA 3L4NA 1ZGNA 4PQHA 4ZBDA 2PMTA 2DJKA 1MEKA 1O6JA 4IJIA 2C1YA 4TR1B 5A4VA 2PERA 3ERFA 4PQIA 5G30A 2DIYA 3A2VA 2AHEA 1MD3A 3TKQA 2CVDA 5DALB 1T4ZA 3HKRA 3DKSA 2H19A 3HA9A 4LA1A 1EV4A 4O32A 4OFMA 3M9KA 4MJCA 3C71A 7GSSA 3FR9A 2I1UA 1O8WA 4AF2A 1X0RA 3CSHA 4KA0A 2NBSA 2R2JA 4MP4A 2R5GA 2VL2C 2A2RA 1B9XC 4TR4A 1KTEA 4KDUA 3DVXA 1FO5A 3GSSA 3IHGA 2NDOA 3Q74A 2FD3A 3CBUA 5GSSA 2L4CA 3KH9A 22GSA 2CZ2A 3EINA 5ENUA 2B5YA 1B48A 1VF2A 3TUEA 1XW6A 4MH2A 1X5DA 1AW9A 2OA7A 2WCIA 3RAZA 12GSA 5ECHB 1WWJA 1LBKA 2CX3A 4KCEA 5ECQB 2GQLA 2H74A 1VGLA 4I2TA 3D4MA 4IQ1A 2GS3A 4V2LA 1WP0A 1DE2A 1PMTA 2VM2A 3ZTLA 4FYUA 5CP1A 2O8VB 4ECJA 4K2DA 3KCMA 5IMVA 1DE1A 4MK3A 2H71A 4GSTA 3ZLPA 2X49A 2PPTA 3GX0A 4F0BA 4TW5A 4OWYA 2PBJA 4L8EA 2TRCP 2XPDA 3VI5A 3M1GA 1GWCA 4DEJA 3KMNA 2IN3A 4N11A 4O5RA 3FZ5A 2XC2A 1GUKA 2H76A 1NHYA 2YV7A 2H70A 1G0TA 3W6GA 2RUEA 5DAKB 4JRRA 3I43A 5A1NB 1THXA 3AY8A 4HZ2A 4N3ZA 5KN3A 2IMKA 1I5GA 5HFKA 2LKUA 3SBCA 5ECIB 3GTUA 1M99A 5A34B 3HJMA 3L0HA 1AQVA 1YJ6A 4TR3A 5IPGA 2YZUA 2DJ0A 3C1SA 9GSSA 4WKWA 4KSMA 2H0IA 1EZKA 2HNLA 1T3BA 4AKHA 1O81A 3IDVA 4HDEA 3IK9A 2QA2A 1S3AA 4WEYA 3JCML 1KEBA 1TK0B 4MDCA 1Y25A 1K0CA 4ML1A 1IYIA 3APQA 2H0HA 4MZBA 4KNDA 1K3YA 3N5OA 4HOJA 3L9VA 3A5IA 3PR8A 1TW9A 2JZSA 5IMAA 3O76A 2H6YA 2EFCA 2C8UA 2DKIA 4OCEA 5KN0A 1YY7A 2AJQB 5JCUA 2KOKA 3FHKA 1OVNA 4DSQA 2WRTA 4MF5A 2VOCA 5JWOB 2LNSA 1TK5B 4G0KA 1J08A 1QUWA 1VF4A 2LJAA 2HRFA 4HQZA 3VLNA 1AXDA 3HD5A 5J4VA 1HD2A 4MF7A 4KH7A 4HJMA 5D9XA 3GNJA 4ECBA 4IGJA 4BVYB 2MMOA 2HSHA 2JADA 1XCCA 1K3OA 2FY6A 1NM3A 3HVXA 1PD21 5ECPB 4K5RA 5DCGA 2EIQA 2FGXA 4PNGA 3HHVA 1TU7A 1M0UA 3DXBA 1EEMA 3UVTA 4KW6A 4TR0A 4ML6A 5GSTA 3O6TA 5A4WA 5H5RA 4V1Ap 3Q6OA 1KNGA 3L78A 4PQ1A 1VF3A 1SJZA 3F63A 4BWSA 1YDKA 2H66A 2GZYA 1K0AA 3IC8A 2VLTA 4BWQA 1AQXA 2H0GA 3KGKA 4E8EA 2O7KA 1M2AA 1PSQA 1N2AA 3G7JA 2HRNA 5IMZA 1OC8A 2WDUA 4IVFA 4ZL8A 4EIQA 2G0FA 3C1RA 3VPTA 2N5FA 4LLRA 3QFAC 2DJ1A 3M9JA 4H86A 2X4AA 3MAKA 2V41A 3LGCA 4KDXA 5J41A 4I8BA 1PN0A 1ERVA 2R37A 3TKSC 4D73B 5IQYA 2VD0A 4LL1B 1M2BA 3VURA 2YPMA 4IQAA 2O87A 1QXHA 1WIKA 3J7Yk 2R0CA 2CAQA 3BCIA 4YAPA 4GLTA 2GSSA 4CDOA 4YKGA 4ECCA 3U6VA 1V98A 4G9HA 1GSQA 5L71A 5FHIA 2AB6A 3LEFA 1WOUA 2GZPA 2BJXA 3VPQA 1NHOA 2B1LA 1Z9HA 3KM6A 3EVIA 5ECLB 5KN1A 3P7XA 3O3TA 5D9VA 2OE3A 2X8HA 3S9FA 3QAGA 1OC9B 2WGRA 1ABAA 2C0DA 1OC3A 3TDGA 1DUGA 3KXOA 1WRYA 2H1AA 2LEGA 2H1DA 4EVMA 2K18A 4QMKA 3MNGA 1UA5A 2ZCTA 4PUAA 2LQQA 1GRXA 3NIVA 2YV9A 3K8NA 4XIHA 1B9YC 1TKDB 4JBBA 1GTIA 2R4VA 1IYHA 4POMA 5B7CA 3MYDA 1GULA 3EPTA 4G0IA 3TJFA 4EO3A 3I6AA 3OR5A 1SKSB 1SD9A 2J23A 5HFGA 3FRCA 3ERWA 3ZMLA 3RDWA 3NZNA 3FZ9A 3UARA 3GV1A 4LL4B 3KIJA 1U88A 4JZQA 2FA8A 4FYBA 5E59A 3F6FA 3UL3A 4TKYA 2CVBA 1PGTA 3WGXA 2IMIA 3F3RA 4PNFA 2XBQA 2GLRA 3IR4A 2F51A 1G6YA 1EV9A 1AQWA 2H6XA 2OACA 2JZTA 1ML6A 1Y6EA 1SYRA 16GSA 1B4QA 3Q18A 2JL4A 3RBTA 6GSUA 5F05A 1HNAA 4MH3A 1BG1A 3VFIA 2HZFA 4TRXA 4CHSA 5CRGA 2V6OA 1TJDA 1V57A 3UJ1A 5EPFA 4MMMA 4YQUA 5ID2B 3A3TA 2FHEA 2H1LA 4PTSA 2AV4A 2C3NA 1Y1UA 1SVLA 5AGYA 2A2PA 4ZBAA 1HNCA 2FCHA 3MWHA 4HU7A 3TGZA 4NV2A 1U3IA 1M7TA 1S3DA 2HRAA 1SJIA 4ZB9A 1A23A 1A2JA 3GL5A 5DDLA 2H75A 1TRSA 4NAXA 1CQHA 1V9WA 4XRDA 2IMEA 5ECRB 4HUAA 2VD1A 2WZ9A 3HY2A 4K1FA 1GUMA 3HZ8A 1A0RP 2TRXA 2MMNA 2N5BA 4Q5QA 4DSSB 4YQVA 3W8JA 1QQ2A 3D21A 2WJUA 1W89A 3D5JA 4JEDA 1NSWA 1UN2A 4RI6A 4IELA 1F6MC 4OO5A 1T4YA 2IFQB 5BMUB 2KHPA 2JACA 1ZYNA 1YZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBY A;  3IOS A;  2MYG A;  2FWG A;  2HSY A;  2IWT A;  4F9Z A;  3FW2 A;  3ZRE A;  2YWO A;  1XWA A;  1X9S B;  3UBK A;  1T8E B;  2RUF A;  2FA4 A;  3F9U A;  4XTS A;  1F9M A;  2MBS A;  3TKP A;  1A8L A;  3ZMK A;  2VUP A;  5IM9 A;  4NMU A;  3MDK A;  3US3 A;  1R4W A;  2C3Q A;  3TJB A;  3PPU A;  1BX9 A;  3H93 A;  2L59 A;  1HNB A;  2DJJ A;  2YN1 A;  4OFN A;  1KBN A;  1X9M B;  2C3T A;  4IP6 A;  2PVQ A;  4XS4 A;  4ISD A;  2B5X A;  5F06 A;  3DD3 A;  2YWM A;  2RLI A;  4Q5N A;  2CV4 A;  4ECI A;  1GSY A;  1ZYQ B;  4I2U A;  4G19 A;  3GA4 A;  4NV5 A;  1TK8 B;  4YH2 A;  3APS A;  3GFK A;  2OE1 A;  3ZIV A;  4V1A g;  2EIO A;  2G2Q A;  2P31 A;  3ZVJ D;  1YEX A;  5IOW A;  1HYU A;  3GKM A;  3ZYW A;  4DSR A;  4J56 E;  2CT6 A;  2HZE A;  5CRD A;  5D93 A;  1E6B A;  2I9H A;  2C0G A;  4ZXG A;  5ELG A;  3E0U A;  2HT9 A;  4NHZ A;  3I69 A;  3EU3 A;  1VF1 A;  4I6X A;  5EVO A;  2LRN A;  5J9C A;  3HXS A;  3LXT A;  5DJL A;  1TRW A;  3V1W A;  1I9D A;  3EMX A;  5FT3 A;  2O85 A;  1PX7 A;  3IAM 2;  4RUV A;  4GF0 A;  3DML A;  3TKS E;  3IK7 A;  1ZZY A;  2GGT A;  1ERT A;  3KTB A;  1FG4 A;  3FEU A;  2CQ9 A;  3H4K A;  4BVY A;  3DYR A;  3N9J A;  3UOM A;  1U6T A;  4EDZ A;  1EP7 A;  1HQO A;  3IAS 2;  4MJA A;  5F8B A;  4IBP A;  4WBJ A;  2L57 A;  2H8L A;  2NPB A;  2XHF A;  1F2E A;  2GTU A;  2HQT A;  4YAV A;  1RW1 A;  2AUV A;  4JE1 A;  1SJ6 A;  3EE2 A;  2LRC A;  2LV3 A;  5ECK B;  3UMA A;  4NHW A;  2VIM A;  5IOX A;  2LTK A;  5J3R A;  2LST A;  3CRT A;  2PWJ A;  2O89 A;  2WUL A;  1ST9 A;  2OKA A;  1JZD A;  3SWL A;  5LCZ A;  1X5E A;  2YCD A;  2P5Q A;  1R5P A;  2MZC A;  4WF5 A;  3CTG A;  3GUS A;  18GS A;  3F8U A;  5CRE A;  3ED3 A;  4N0V A;  4ILF A;  2UZ8 A;  3HJP A;  2ON7 A;  1TU8 A;  3PGT A;  4HS1 A;  4L0W A;  5B6N A;  1BED A;  2OBK A;  4QL9 A;  5IO0 A;  3VWX A;  4BL7 B;  1ERW A;  3E3E A;  4J2F A;  4BVX A;  3VWV A;  3WYW A;  5AIV A;  1BG5 A;  3QMX A;  2DLX A;  1Z5Y E;  3FR6 A;  3G9B A;  1ACV A;  4USS A;  2H01 A;  2B1K A;  3P90 A;  5CRW A;  14GS A;  2BTO T;  2LJK A;  2A2S A;  5ECN B;  4MPF A;  1YKA A;  3WT2 A;  3IA1 A;  5KEJ A;  1FB6 A;  1ZL9 A;  2B3S A;  1XVQ A;  4TXV A;  3PIN A;  2F8A A;  3FZ4 A;  3TJG A;  1PL2 A;  17GS A;  3GH6 A;  3P8W A;  6GSW A;  2X99 A;  1M9B A;  4GSS A;  3TCO A;  2E2M A;  3QDN A;  5ECS A;  2F8F A;  3LFL A;  3VWW A;  1AAZ A;  5HQP A;  2DJ3 A;  5GZZ B;  3ZIT A;  4TXO B;  1SU9 A;  3EWL A;  1QMV A;  11GS A;  2B7K A;  5G5F A;  5C04 A;  5IO2 A;  5D9W A;  5DQS A;  1J0F A;  2CAI A;  2KP2 A;  1SYX A;  5H5S A;  2GSQ A;  4PX1 A;  1YKC A;  1PQN A;  1G7E A;  2C0E A;  3M0F A;  3DGQ A;  1TDI A;  1GUH A;  2TIR A;  3EUR A;  2L5L A;  2M72 A;  2FWE A;  3UBL A;  2ZUP A;  2H6Z A;  2VM1 A;  3H79 A;  2VCV A;  4RI7 A;  1G7O A;  4MA9 A;  5DJM A;  3ME8 A;  5JCG A;  3RHC A;  3LQ7 A;  1PX6 A;  3HVS A;  3ZL5 A;  3QOU A;  2PGT A;  5C00 A;  2GVP A;  1F37 A;  1SK2 A;  10GS A;  1O85 A;  2N5A A;  4K6X A;  5JCW A;  3FR3 A;  4O7H A;  1TOF A;  1SK0 A;  3BCK A;  2REM A;  2FWF A;  2FLS A;  1USB A;  2ON5 A;  1QGV A;  2DSA A;  3IE3 A;  1J9B A;  2QC7 A;  1XXU A;  3ZRD A;  2C0F A;  4G0L A;  1F3A A;  4LMW A;  2CA8 A;  3L9S A;  3GKN A;  5G2Z A;  4PUR A;  2GQM A;  2L6D A;  5CYY A;  4ACS A;  1MDJ A;  1A24 A;  1B4P A;  2C4J A;  1ILO A;  1N8J A;  1SL1 B;  5A4U A;  2V32 A;  3ISO A;  1JHB A;  2AYT A;  3IRA A;  3CMI A;  4KB3 A;  4HI7 A;  1FOV A;  1XOA A;  5DQY A;  2NTO A;  6GSS A;  1JZR A;  1OAZ A;  5B8A A;  3TRX A;  4ZBB A;  1SEN A;  5AIX A;  4EL1 A;  3CXG A;  2P0G A;  3UVH A;  3C8E A;  1EGR A;  1Z3E A;  2MMA A;  5KN2 A;  1JLV A;  5ECM B;  2HLS A;  4PGT A;  2HRK B;  4N10 A;  4GTU A;  2DJ2 A;  4F03 A;  1ERU A;  1SL0 B;  2PVO C;  2PN8 A;  1XWC A;  3HDC A;  4MJE A;  5HR0 A;  1JFU A;  2E2G A;  4TR1 A;  2RM5 A;  3H8Q A;  1GTB A;  1UC7 A;  1GSS A;  1OE8 A;  3BJ5 A;  4P3Y B;  1K0N A;  4HJ2 A;  5DAL A;  4RQX A;  2X8G A;  13GS A;  4ZB8 A;  4KAE A;  4POB A;  2E7P A;  3FK8 A;  1EOG A;  4GRF A;  2VL2 A;  1PL1 A;  3FZA A;  4NWY A;  3W8S A;  2OE0 A;  2YWN A;  5DCH A;  1H75 A;  1K0M A;  3HCZ A;  5IPH A;  1YQ1 A;  4EUY A;  4ULX A;  1F3B A;  5HFI A;  4LMV A;  2PU9 C;  3A5W A;  1WMJ A;  2YP6 A;  4K7O A;  2HE3 A;  4Q5F A;  4XS1 A;  1SKR B;  3LWA A;  2H1G A;  5IIZ A;  1EWX A;  2LUS A;  2K8S A;  2H1B A;  1FVJ A;  1FAA A;  2DIZ A;  3F4T A;  1AC1 A;  3J7Y b;  1YF1 A;  3IC4 A;  3WGE A;  1ZOF A;  4K8M A;  2LNT A;  1JZO A;  3UEM A;  2YZH A;  2A4V A;  4MZW A;  3APO A;  1XFL A;  1Z6M A;  3WT1 A;  4Q5R A;  3UIW A;  5EL8 A;  1TRV A;  3QAW A;  4TVE A;  3QR6 A;  1XWK A;  4IJ3 A;  3GN3 A;  4KSO A;  2ALB A;  2VL3 A;  3Q19 A;  2HSN B;  5IMC A;  2E0Q A;  3ZFB A;  1JZW A;  4AJ8 A;  1FVK A;  1SD8 A;  3CTF A;  1BQ7 A;  5ECO B;  5D9T A;  2HSM B;  3MSZ A;  5IMD A;  2DMM A;  5JWQ B;  1GP1 A;  3QFB C;  4CW9 A;  3ZVJ A;  4K7I A;  1UVZ A;  1GH2 A;  2F3M A;  4JR4 A;  3E9J B;  3F4R A;  3QPM A;  5FWG A;  3LG6 A;  1ON4 A;  3A2X A;  3KTL A;  5DAK A;  1OYJ A;  1GNW A;  3IPZ A;  4K0G A;  2IMF A;  2IPA A;  2VCW A;  1A0F A;  4YQM A;  2FUG 2;  5CNW A;  4HEA 2;  3D4T A;  2K9F A;  5J5N A;  3TKR A;  1K0B A;  2YAN A;  1Z7R A;  1XOB A;  1W4V A;  2HXK A;  1GL8 A;  5CO3 A;  3DIE A;  4I5Q A;  2R3X A;  3HJO A;  2FWH A;  5G1K A;  1WJK A;  3R3E A;  3VK9 A;  5F0G A;  2GSR A;  3GUR A;  2VAF A;  2VO4 A;  4F2I A;  1MD4 A;  4FYC A;  1R26 A;  2V1M A;  4WF4 A;  3KZQ A;  3GH9 A;  3G7I A;  2I81 A;  5D8I A;  4AGS A;  3GRX A;  1E2Y A;  1FHE A;  2ES7 A;  3CRU A;  4KCA A;  4BA7 A;  3IV4 A;  2EC4 A;  3TOU A;  1TXX A;  2B6M A;  1M9A A;  1OE7 A;  1M2D A;  3F4S A;  2GQK A;  2BMX A;  3TJK A;  5ABR A;  2DBC A;  1C72 A;  1URM A;  3P2A A;  1A2L A;  5AN1 A;  3FY7 A;  3UAP A;  1Z7P A;  4TOP A;  3GL3 A;  4POL A;  3KEB A;  2YNX A;  2I3Y A;  2LS5 A;  2YOI A;  4BL7 A;  2JU5 A;  4GWR A;  1ZYE A;  1DSB A;  1GSD A;  1K0D A;  3R2Q A;  2R6K A;  1FW1 A;  2RII A;  2WFC A;  3FYG A;  1SKW B;  2HYX A;  1T1V A;  2OBI A;  3D0Z A;  3C73 A;  1GSE A;  1GNE A;  4MPG A;  4GQF A;  4HQS A;  4XS4 B;  4F82 A;  4G10 A;  1SK1 A;  4XHM A;  4E8H A;  3D6I A;  4FQU A;  3DRN A;  4AJ6 A;  1GTU A;  2DML A;  6GST A;  4IKH A;  2YWI A;  1X9W B;  4IW9 A;  3PH9 A;  1T7P B;  3BBY A;  1XBS A;  2IJY A;  5E4W A;  5HR3 A;  3U5R E;  1LU4 A;  1MDI A;  1O8X A;  5HR1 A;  4KE3 A;  1GSU A;  4V2N A;  2VLV A;  1OKD A;  3KD0 A;  3KP8 A;  2ZNM A;  4PUF C;  3QAV A;  3KJY A;  2P5R A;  4L5O A;  1Z6N A;  4O92 A;  4TXO A;  3VWU A;  3HYP A;  4L0U A;  3HVV A;  2HZE B;  3M8N A;  3VI7 A;  1XWG A;  1SL2 B;  1FB0 A;  4L5L A;  3GX8 A;  3HZ4 A;  3FKF A;  3TKS A;  4NXI A;  3M3M A;  3BOA A;  1U3A A;  1VRS D;  4AJ7 A;  3DEX A;  1Q4J A;  3H1N A;  1XW5 A;  5IMF A;  3F0I A;  2QSI A;  1G6W A;  1V2A A;  1RQM A;  1WPI A;  1XZO A;  3QCP A;  1GLP A;  4GSN A;  1QFN A;  3EU4 A;  4ZIL A;  4D73 A;  5JWR B;  1GLQ A;  3EMP A;  1V40 A;  1TP9 A;  4K7N A;  3WD6 A;  4WR5 A;  4FH8 A;  1EEJ A;  2K6V A;  5AIS A;  3GTU B;  4EXJ A;  3IHQ A;  1PKW A;  4EDY A;  4QQ7 A;  4K0N A;  4GXZ A;  4FO5 A;  2GT5 A;  3ZFL A;  2F9S A;  3GST A;  4IHU A;  3RPP A;  4MLY A;  1B8X A;  3ERG A;  5DBQ A;  5GAP D;  6GSX A;  2GT6 A;  1S3C A;  3ME7 A;  3ZZX A;  2D2Z A;  4IP1 A;  4EF0 A;  2H73 A;  2DC5 A;  3F6D A;  3CYN A;  2OJL A;  1Q98 A;  1QK8 A;  2NVL A;  4KDY A;  2JZR A;  8GSS A;  2H72 A;  4HU9 A;  3IXR A;  5CRH A;  1A8Y A;  4OCF A;  2H30 A;  4JR6 A;  1RK4 A;  2PUK C;  4OMV A;  3L9U A;  6GSV A;  1H4O A;  1OC9 A;  1MTC A;  2GDR A;  5G31 A;  3TRP A;  3DWV A;  4PXO A;  4G2E A;  4MJB A;  3GKX A;  2V2G A;  2WB9 A;  3EC3 A;  5LNK e;  4X43 A;  4KUN A;  2V6K A;  3GKK A;  1MDK A;  4QL7 A;  1GTA A;  3KP9 A;  2JSZ A;  5G1L A;  5A5K A;  5COH A;  4BVX B;  1EGO A;  4WBR D;  4WET A;  1YF0 A;  20GS A;  1JLW A;  1R7H A;  4BPY A;  2HRK A;  6GSY A;  2LRT A;  3GIX A;  5LD0 A;  2HI7 A;  5DVB A;  4F0C A;  3WGD A;  1K0O A;  3G7Y A;  4ZB6 A;  3GMF A;  5D96 A;  2LQO A;  1TRU A;  1TI1 A;  2VLU A;  2MMZ A;  2L5O A;  2XPE A;  5B6M A;  4IS0 A;  1PKZ A;  2X64 A;  1OKT A;  1ZCP A;  1LJR A;  4IN0 A;  4XS6 A;  4DVC A;  4I97 A;  3LYK A;  4GQC A;  4JU5 A;  4N0Z A;  5EY6 A;  2GST A;  2GZZ A;  3LYP A;  4EC0 A;  4MCU A;  2L6C A;  2QKE A;  1TTZ A;  3C7M A;  2FNO A;  1XWB A;  1XPV A;  4OO4 A;  2CX4 A;  1AIU A;  1X5C A;  1U87 A;  2M80 A;  4WXT A;  4KF9 A;  5HR2 A;  2M46 A;  5ID2 A;  4ZL9 A;  4MZC A;  3KMO A;  4HZ4 A;  1R5A A;  1BJX A;  4KX4 A;  3D22 A;  1EP8 A;  4MF6 A;  2C80 A;  3I9V 2;  2YJ7 A;  3CSI A;  3GYK A;  2MBT A;  2B5E A;  3DVW A;  4FIW A;  2KP1 A;  2VCQ A;  5J9B A;  2CVK A;  4EE0 A;  5H5Q A;  1WE0 A;  3A2W A;  5CAX A;  1THO A;  4DSS A;  1PA3 A;  2RM6 A;  1CQG A;  4Z7X A;  1BYE A;  4J57 E;  3LXZ A;  2EIR A;  4N30 A;  4XCS A;  3F3Q A;  1XIY A;  4TN8 A;  1EOH A;  3LOR A;  3CSJ A;  2IFQ A;  5BMU A;  3TRQ A;  3RPN A;  2HSM A;  1XW9 A;  3TOT A;  2QGV A;  2VL9 A;  2VCT A;  2Z9S A;  4ID0 A;  3IBH A;  3QD9 A;  4ZIJ A;  2OAD A;  3BD2 A;  2X8C A;  4OFT A;  5G5E A;  2LJR A;  1AUC A;  4V2M A;  1XVW A;  4POK A;  5F07 A;  4WR4 A;  2I4A A;  2CZ3 A;  1ZMA A;  1TI3 A;  2L4Q A;  4ZL7 A;  5ELA A;  2K8V A;  4OD7 A;  2AAW A;  3RHB A;  2WS2 A;  2IIY A;  2JSY A;  2B7J A;  4EKZ A;  2IMD A;  1BAY A;  3NOF A;  4NPB A;  19GS A;  5B8B A;  2KUC A;  2J9H A;  3LSZ A;  5GAN D;  2HFD A;  3TJJ A;  2VCX A;  1A2M A;  4GCI A;  5J4U A;  2KLX A;  1O7U A;  3KH7 A;  4X1U A;  3GHA A;  1V58 A;  4KGI A;  3LJR A;  5D73 A;  3EYT A;  1O73 A;  3TB2 A;  4XRA A;  4RQR A;  2VCZ A;  5INY A;  4K9Z A;  2YJH A;  1PN9 A;  1GSF A;  1T00 A;  2IL3 A;  4MAB A;  1YEP A;  4X0X A;  2XBI A;  1NW2 A;  1K3L A;  1PRX A;  3ZIJ A;  3L4N A;  1ZGN A;  4PQH A;  4ZBD A;  2PMT A;  2DJK A;  1MEK A;  1O6J A;  4IJI A;  2C1Y A;  4TR1 B;  5A4V A;  2PER A;  3ERF A;  4PQI A;  5G30 A;  2DIY A;  3A2V A;  2AHE A;  1MD3 A;  3TKQ A;  2CVD A;  5DAL B;  1T4Z A;  3HKR A;  3DKS A;  2H19 A;  3HA9 A;  4LA1 A;  1EV4 A;  4O32 A;  4OFM A;  3M9K A;  4MJC A;  3C71 A;  7GSS A;  3FR9 A;  2I1U A;  1O8W A;  4AF2 A;  1X0R A;  3CSH A;  4KA0 A;  2NBS A;  2R2J A;  4MP4 A;  2R5G A;  2VL2 C;  2A2R A;  1B9X C;  4TR4 A;  1KTE A;  4KDU A;  3DVX A;  1FO5 A;  3GSS A;  2NDO A;  3Q74 A;  2FD3 A;  3CBU A;  5GSS A;  2L4C A;  3KH9 A;  22GS A;  2CZ2 A;  3EIN A;  5ENU A;  2B5Y A;  1B48 A;  1VF2 A;  3TUE A;  1XW6 A;  4MH2 A;  1X5D A;  1AW9 A;  2OA7 A;  2WCI A;  3RAZ A;  12GS A;  5ECH B;  1WWJ A;  1LBK A;  4KCE A;  2CX3 A;  5ECQ B;  2GQL A;  2H74 A;  1VGL A;  4I2T A;  3D4M A;  4IQ1 A;  2GS3 A;  4V2L A;  1WP0 A;  1DE2 A;  1PMT A;  2VM2 A;  3ZTL A;  4FYU A;  5CP1 A;  2O8V B;  4ECJ A;  4K2D A;  3KCM A;  5IMV A;  1DE1 A;  4MK3 A;  2H71 A;  4GST A;  3ZLP A;  2PPT A;  3GX0 A;  4F0B A;  4TW5 A;  4OWY A;  2PBJ A;  4L8E A;  2TRC P;  2XPD A;  3VI5 A;  3M1G A;  1GWC A;  4DEJ A;  3KMN A;  2IN3 A;  4N11 A;  4O5R A;  3FZ5 A;  2XC2 A;  1GUK A;  2H76 A;  1NHY A;  2YV7 A;  2H70 A;  1G0T A;  3W6G A;  2RUE A;  5DAK B;  4JRR A;  3I43 A;  1THX A;  3AY8 A;  4HZ2 A;  5KN3 A;  2IMK A;  1I5G A;  5HFK A;  2LKU A;  3SBC A;  5ECI B;  3GTU A;  1M99 A;  3HJM A;  3L0H A;  1AQV A;  1YJ6 A;  4TR3 A;  5IPG A;  2YZU A;  2DJ0 A;  3C1S A;  9GSS A;  4WKW A;  4KSM A;  2H0I A;  1EZK A;  2HNL A;  1T3B A;  1O81 A;  3IDV A;  4HDE A;  3IK9 A;  1S3A A;  4WEY A;  3JCM L;  1KEB A;  1TK0 B;  4MDC A;  1Y25 A;  1K0C A;  4ML1 A;  1IYI A;  3APQ A;  2H0H A;  4MZB A;  4KND A;  1K3Y A;  3N5O A;  4HOJ A;  3L9V A;  3PR8 A;  1TW9 A;  2JZS A;  5IMA A;  3O76 A;  2H6Y A;  2C8U A;  4OCE A;  5KN0 A;  1YY7 A;  2AJQ B;  5JCU A;  2KOK A;  3FHK A;  1OVN A;  4DSQ A;  2WRT A;  4MF5 A;  2VOC A;  5JWO B;  2LNS A;  1TK5 B;  4G0K A;  1J08 A;  1QUW A;  1VF4 A;  2LJA A;  2HRF A;  4HQZ A;  3VLN A;  1AXD A;  3HD5 A;  1HD2 A;  4MF7 A;  4KH7 A;  4HJM A;  5D9X A;  3GNJ A;  4ECB A;  4IGJ A;  4BVY B;  2MMO A;  2HSH A;  2JAD A;  1XCC A;  1K3O A;  2FY6 A;  1NM3 A;  3HVX A;  1PD2 1;  5ECP B;  5DCG A;  2EIQ A;  2FGX A;  4PNG A;  3HHV A;  1TU7 A;  1M0U A;  3DXB A;  1EEM A;  3UVT A;  4KW6 A;  4TR0 A;  4ML6 A;  5GST A;  3O6T A;  5A4W A;  5H5R A;  4V1A p;  3Q6O A;  1KNG A;  3L78 A;  4PQ1 A;  1VF3 A;  1SJZ A;  3F63 A;  4BWS A;  1YDK A;  2H66 A;  2GZY A;  1K0A A;  3IC8 A;  2VLT A;  4BWQ A;  1AQX A;  2H0G A;  3KGK A;  4E8E A;  2O7K A;  1M2A A;  1PSQ A;  1N2A A;  3G7J A;  2HRN A;  5IMZ A;  1OC8 A;  2WDU A;  4IVF A;  4ZL8 A;  2G0F A;  3C1R A;  3VPT A;  2N5F A;  4LLR A;  3QFA C;  2DJ1 A;  3M9J A;  4H86 A;  3MAK A;  2V41 A;  3LGC A;  4KDX A;  5J41 A;  4I8B A;  1ERV A;  2R37 A;  3TKS C;  4D73 B;  5IQY A;  2VD0 A;  4LL1 B;  1M2B A;  3VUR A;  2YPM A;  4IQA A;  2O87 A;  1QXH A;  1WIK A;  3J7Y k;  2CAQ A;  3BCI A;  4YAP A;  4GLT A;  2GSS A;  4CDO A;  4ECC A;  3U6V A;  1V98 A;  4G9H A;  1GSQ A;  5L71 A;  5FHI A;  2AB6 A;  3LEF A;  1WOU A;  2GZP A;  2BJX A;  3VPQ A;  1NHO A;  2B1L A;  1Z9H A;  3KM6 A;  3EVI A;  5ECL B;  5KN1 A;  3P7X A;  3O3T A;  5D9V A;  2OE3 A;  2X8H A;  3S9F A;  3QAG A;  1OC9 B;  2WGR A;  1ABA A;  2C0D A;  1OC3 A;  3TDG A;  1DUG A;  3KXO A;  1WRY A;  2H1A A;  2LEG A;  2H1D A;  4EVM A;  2K18 A;  3MNG A;  1UA5 A;  2ZCT A;  4PUA A;  2LQQ A;  1GRX A;  3NIV A;  2YV9 A;  3K8N A;  4XIH A;  1B9Y C;  1TKD B;  4JBB A;  1GTI A;  2R4V A;  1IYH A;  4POM A;  5B7C A;  1GUL A;  4G0I A;  3TJF A;  4EO3 A;  3I6A A;  3OR5 A;  1SKS B;  1SD9 A;  2J23 A;  5HFG A;  3FRC A;  3ERW A;  3ZML A;  3RDW A;  3NZN A;  3FZ9 A;  3UAR A;  3GV1 A;  4LL4 B;  3KIJ A;  1U88 A;  4JZQ A;  2FA8 A;  4FYB A;  5E59 A;  3F6F A;  3UL3 A;  4TKY A;  2CVB A;  1PGT A;  3WGX A;  2IMI A;  3F3R A;  4PNF A;  2XBQ A;  2GLR A;  3IR4 A;  2F51 A;  1G6Y A;  1EV9 A;  1AQW A;  2H6X A;  2OAC A;  2JZT A;  1ML6 A;  1Y6E A;  1SYR A;  16GS A;  1B4Q A;  3Q18 A;  2JL4 A;  3RBT A;  6GSU A;  5F05 A;  1HNA A;  4MH3 A;  3VFI A;  2HZF A;  4TRX A;  4CHS A;  5CRG A;  2V6O A;  1TJD A;  1V57 A;  3UJ1 A;  5EPF A;  4MMM A;  4YQU A;  5ID2 B;  3A3T A;  2FHE A;  4PTS A;  2AV4 A;  2C3N A;  5AGY A;  4ZBA A;  1HNC A;  2FCH A;  3MWH A;  4HU7 A;  3TGZ A;  4NV2 A;  1U3I A;  1M7T A;  1S3D A;  2HRA A;  1SJI A;  4ZB9 A;  1A23 A;  1A2J A;  3GL5 A;  5DDL A;  2H75 A;  1TRS A;  4NAX A;  1CQH A;  1V9W A;  4XRD A;  2IME A;  5ECR B;  4HUA A;  2VD1 A;  2WZ9 A;  3HY2 A;  4K1F A;  1GUM A;  3HZ8 A;  1A0R P;  2TRX A;  2MMN A;  2N5B A;  4Q5Q A;  4DSS B;  4YQV A;  3W8J A;  1QQ2 A;  3D21 A;  2WJU A;  1W89 A;  3D5J A;  4JED A;  1NSW A;  1UN2 A;  4RI6 A;  4IEL A;  1F6M C;  4OO5 A;  1T4Y A;  2IFQ B;  2KHP A;  2JAC A;  1YZX A; 
#chains in the Genus database with same CATH topology
 1DBY A;  3IOS A;  2MYG A;  2FWG A;  2HSY A;  2IWT A;  4F9Z A;  3FW2 A;  3ZRE A;  2YWO A;  1XWA A;  1X9S B;  3UBK A;  1T8E B;  2RUF A;  2FA4 A;  3F9U A;  4XTS A;  1F9M A;  4PI0 C;  2MBS A;  3TKP A;  1A8L A;  3ZMK A;  4K5S A;  1SVM A;  2VUP A;  5IM9 A;  4NMU A;  3MDK A;  3US3 A;  1R4W A;  2C3Q A;  3TJB A;  3PPU A;  1BX9 A;  3H93 A;  2L59 A;  1HNB A;  2DJJ A;  2YN1 A;  5KOX A;  2VKZ G;  4OFN A;  1KBN A;  1X9M B;  2C3T A;  2PVQ A;  4IP6 A;  4XS4 A;  4ISD A;  2B5X A;  5F06 A;  2DKH A;  3DD3 A;  2YWM A;  2RLI A;  4Q5N A;  2CV4 A;  4ECI A;  1GSY A;  1ZYQ B;  4I2U A;  4G19 A;  3GA4 A;  4NV5 A;  1TK8 B;  3HMJ G;  4YH2 A;  3APS A;  3GFK A;  2OE1 A;  3ZIV A;  4V1A g;  2EIO A;  2G2Q A;  2P31 A;  2O5V A;  3ZVJ D;  1YEX A;  5IOW A;  1HYU A;  3GKM A;  3ZYW A;  4DSR A;  4J56 E;  2CT6 A;  2HZE A;  5CRD A;  5D93 A;  1E6B A;  2I9H A;  2C0G A;  4ZXG A;  5ELG A;  3E0U A;  2HT9 A;  4NHZ A;  3I69 A;  3EU3 A;  1VF1 A;  4I6X A;  5EVO A;  5A5H A;  2LRN A;  5J9C A;  4PHZ C;  1XG8 A;  3HXS A;  3LXT A;  5DJL A;  1TRW A;  4EIP A;  3V1W A;  1I9D A;  3EMX A;  5FT3 A;  2O85 A;  1PX7 A;  3IAM 2;  4RUV A;  4GF0 A;  3DML A;  3TKS E;  3IK7 A;  1ZZY A;  2GGT A;  1ERT A;  3KTB A;  1FG4 A;  3FEU A;  2CQ9 A;  3H4K A;  4BVY A;  3DYR A;  3N9J A;  3UOM A;  1U6T A;  4EDZ A;  1EP7 A;  1HQO A;  3IAS 2;  4MJA A;  5F8B A;  4IBP A;  4WBJ A;  2L57 A;  2H8L A;  1ZYP A;  2NPB A;  2XHF A;  1F2E A;  2GTU A;  2HQT A;  4YAV A;  1RW1 A;  2AUV A;  4JE1 A;  4GDF A;  1SJ6 A;  3EE2 A;  2LRC A;  2LV3 A;  5ECK B;  3UMA A;  5KOW A;  4NHW A;  2VIM A;  5IOX A;  2LTK A;  5J3R A;  2LST A;  3CRT A;  2PWJ A;  2QA1 A;  2O89 A;  2WUL A;  1ST9 A;  2OKA A;  1JZD A;  4CY6 A;  3SWL A;  5LCZ A;  1X5E A;  2YCD A;  2P5Q A;  1R5P A;  2MZC A;  4WF5 A;  3CTG A;  3GUS A;  18GS A;  3F8U A;  5CRE A;  3ED3 A;  4N0V A;  4ILF A;  2UZ8 A;  3HJP A;  2ON7 A;  1TU8 A;  3PGT A;  4HS1 A;  4AKI A;  4K2X A;  4L0W A;  5B6N A;  1BED A;  2OBK A;  4QL9 A;  5IO0 A;  3VWX A;  4BL7 B;  1ERW A;  3E3E A;  4J2F A;  4BVX A;  3VWV A;  3WYW A;  5AIV A;  1BG5 A;  3QMX A;  2DLX A;  2EFD A;  1Z5Y E;  3FR6 A;  3G9B A;  1ACV A;  4USS A;  2H01 A;  2B1K A;  3P90 A;  5CRW A;  14GS A;  2BTO T;  2LJK A;  2A2S A;  5ECN B;  4MPF A;  1YKA A;  3WT2 A;  3IA1 A;  5KEJ A;  1FB6 A;  1ZL9 A;  2B3S A;  1XVQ A;  4TXV A;  2WW2 A;  3PIN A;  2F8A A;  3FZ4 A;  3TJG A;  1PL2 A;  17GS A;  3GH6 A;  3P8W A;  6GSW A;  2X99 A;  1M9B A;  4GSS A;  3TCO A;  2E2M A;  3QDN A;  5ECS A;  2F8F A;  3LFL A;  1M3J A;  3VWW A;  1AAZ A;  5HQP A;  2DJ3 A;  5GZZ B;  3ZIT A;  4TXO B;  1SU9 A;  3EWL A;  1QMV A;  11GS A;  2B7K A;  5G5F A;  5C04 A;  5IO2 A;  5D9W A;  5DQS A;  1J0F A;  2CAI A;  2KP2 A;  1SYX A;  5H5S A;  2GSQ A;  4PX1 A;  1YKC A;  1PQN A;  1G7E A;  2C0E A;  3M0F A;  4HSC X;  3DGQ A;  1TDI A;  1GUH A;  2TIR A;  3EUR A;  2L5L A;  2M72 A;  2FWE A;  3UBL A;  2ZUP A;  2H6Z A;  2VM1 A;  3H79 A;  2VCV A;  4RI7 A;  1G7O A;  4MA9 A;  5DJM A;  3ME8 A;  5JCG A;  3RHC A;  3LQ7 A;  1PX6 A;  3HVS A;  3ZL5 A;  2PGT A;  3QOU A;  5C00 A;  2GVP A;  1F37 A;  1SK2 A;  10GS A;  1O85 A;  2N5A A;  4K6X A;  5JCW A;  3FR3 A;  4O7H A;  1TOF A;  1SK0 A;  3BCK A;  2REM A;  2R0G A;  2FWF A;  2FLS A;  1USB A;  2ON5 A;  1QGV A;  2DSA A;  3IE3 A;  1J9B A;  5BRT A;  2QC7 A;  1XXU A;  3ZRD A;  2C0F A;  4G0L A;  1F3A A;  4LMW A;  2A4H A;  2CA8 A;  3L9S A;  3GKN A;  5G2Z A;  4PUR A;  4W66 A;  2GQM A;  2L6D A;  5CYY A;  4ACS A;  1MDJ A;  1A24 A;  1B4P A;  2C4J A;  1ILO A;  5J47 A;  1N8J A;  1SL1 B;  5A4U A;  2V32 A;  3ISO A;  1JHB A;  2AYT A;  3IRA A;  3CMI A;  4KB3 A;  4HI7 A;  1FOV A;  1XOA A;  5DQY A;  2NTO A;  6GSS A;  1JZR A;  1OAZ A;  2EFH A;  5B8A A;  3TRX A;  4ZBB A;  1SEN A;  5AIX A;  4EL1 A;  2WW3 A;  3CXG A;  2P0G A;  3UVH A;  3C8E A;  4X4J A;  1EGR A;  1Z3E A;  2MMA A;  5KN2 A;  1JLV A;  5ECM B;  2HLS A;  4PGT A;  2HRK B;  4N10 A;  4GTU A;  2DJ2 A;  4F03 A;  1ERU A;  1SL0 B;  2PVO C;  2PN8 A;  1XWC A;  3HDC A;  4MJE A;  5HR0 A;  1JFU A;  2E2G A;  4TR1 A;  2RM5 A;  3H8Q A;  1GTB A;  1UC7 A;  1GSS A;  1OE8 A;  4AKX B;  3BJ5 A;  1K0N A;  4HJ2 A;  5DAL A;  4P3Y B;  4RQX A;  2X8G A;  13GS A;  4ZB8 A;  4KAE A;  4POB A;  2E7P A;  3FK8 A;  1EOG A;  4GRF A;  2VL2 A;  1PL1 A;  3FZA A;  4NWY A;  3W8S A;  2OE0 A;  2YWN A;  5DCH A;  1H75 A;  1K0M A;  3HCZ A;  5IPH A;  1YQ1 A;  4EUY A;  4ULX A;  1F3B A;  5HFI A;  4LMV A;  2PU9 C;  3A5W A;  1WMJ A;  2YP6 A;  4K7O A;  2HE3 A;  4Q5F A;  4XS1 A;  1SKR B;  3LWA A;  2H1G A;  5IIZ A;  1EWX A;  2LUS A;  2K8S A;  2H1B A;  3TU3 B;  1FVJ A;  1FAA A;  2DIZ A;  3F4T A;  1AC1 A;  3J7Y b;  1YF1 A;  3IC4 A;  3WGE A;  1ZOF A;  4K8M A;  2LNT A;  1JZO A;  3UEM A;  2YZH A;  2A4V A;  4MZW A;  3APO A;  1XFL A;  1Z6M A;  3WT1 A;  4Q5R A;  3UIW A;  5EL8 A;  1TRV A;  3QAW A;  4TVE A;  3QR6 A;  1XWK A;  4IJ3 A;  3GN3 A;  4KSO A;  2ALB A;  4O5U A;  2VL3 A;  3Q19 A;  2HSN B;  3RFR C;  5IMC A;  2E0Q A;  4ICY A;  3ZFB A;  1JZW A;  4AJ8 A;  1FVK A;  1SD8 A;  3CTF A;  1BQ7 A;  5ECO B;  5D9T A;  2HSM B;  2WVX A;  3MSZ A;  5IMD A;  2DMM A;  5JWQ B;  1GP1 A;  3QFB C;  4CW9 A;  3ZVJ A;  4K7I A;  1UVZ A;  1GH2 A;  2F3M A;  4JR4 A;  3E9J B;  3F4R A;  3QPM A;  5FWG A;  3LG6 A;  1ON4 A;  3A2X A;  3KTL A;  3FMW A;  5DAK A;  1OYJ A;  5A1N A;  1GNW A;  3IPZ A;  4K0G A;  2IMF A;  2IPA A;  2VCW A;  1A0F A;  4YQM A;  1I1I P;  2FUG 2;  5CNW A;  4HEA 2;  5A34 A;  3D4T A;  2K9F A;  5J5N A;  3TKR A;  1K0B A;  2YAN A;  1Z7R A;  1XOB A;  1W4V A;  2HXK A;  1GL8 A;  5CO3 A;  3DIE A;  4I5Q A;  2R3X A;  3HJO A;  2FWH A;  5G1K A;  1YVL A;  1WJK A;  3R3E A;  3VK9 A;  5F0G A;  2GSR A;  3GUR A;  2VAF A;  2VO4 A;  4F2I A;  1MD4 A;  4FYC A;  1R26 A;  2V1M A;  4WF4 A;  3KZQ A;  3GH9 A;  3G7I A;  2I81 A;  5D8I A;  4AGS A;  3GRX A;  1E2Y A;  1FHE A;  2ES7 A;  3CRU A;  4KCA A;  4BA7 A;  3IV4 A;  3MIX A;  2EC4 A;  3TOU A;  1TXX A;  2B6M A;  1M9A A;  1TXU A;  1OE7 A;  1M2D A;  3F4S A;  2GQK A;  2BMX A;  3TJK A;  5ABR A;  2DBC A;  4CY8 A;  1C72 A;  1URM A;  3P2A A;  1A2L A;  5AN1 A;  3FY7 A;  3UAP A;  1Z7P A;  4TOP A;  3GL3 A;  4POL A;  3KEB A;  2YNX A;  2I3Y A;  3CWG A;  1SVO A;  2LS5 A;  2YOI A;  4BL7 A;  2JU5 A;  4GWR A;  1ZYE A;  1DSB A;  1GSD A;  1K0D A;  3R2Q A;  2R6K A;  1FW1 A;  2RII A;  2WFC A;  3FYG A;  1SKW B;  2HYX A;  1T1V A;  2R0P A;  2OBI A;  3D0Z A;  3C73 A;  1GSE A;  1GNE A;  4MPG A;  4GQF A;  4HQS A;  4XS4 B;  4F82 A;  4G10 A;  1SK1 A;  4XHM A;  4E8H A;  3D6I A;  4FQU A;  3DRN A;  4AJ6 A;  1GTU A;  1N25 A;  2DML A;  6GST A;  4IKH A;  2YWI A;  1X9W B;  4IW9 A;  3PH9 A;  1T7P B;  3BBY A;  1XBS A;  2IJY A;  5E4W A;  5HR3 A;  4AI6 A;  3U5R E;  1LU4 A;  1MDI A;  1O8X A;  5HR1 A;  4KE3 A;  1GSU A;  4V2N A;  2VLV A;  1OKD A;  3KD0 A;  3KP8 A;  2ZNM A;  4PUF C;  3LW9 A;  3QAV A;  3KJY A;  2P5R A;  4L5O A;  1Z6N A;  4O92 A;  4TXO A;  3VWU A;  3HYP A;  4L0U A;  2WW1 A;  3HVV A;  2HZE B;  3M8N A;  3VI7 A;  1XWG A;  1SL2 B;  1FB0 A;  4L5L A;  3GX8 A;  3HZ4 A;  3FKF A;  3TKS A;  4NXI A;  1VRS D;  3BOA A;  3M3M A;  1U3A A;  5A5H B;  4AJ7 A;  3DEX A;  1Q4J A;  3H1N A;  1XW5 A;  5IMF A;  3F0I A;  2QSI A;  1G6W A;  1V2A A;  1RQM A;  1WPI A;  1XZO A;  4YKF A;  3QCP A;  1GLP A;  4GSN A;  1QFN A;  3EU4 A;  4ZIL A;  4D73 A;  5JWR B;  1GLQ A;  3EMP A;  1V40 A;  1TP9 A;  4K7N A;  3WD6 A;  4WR5 A;  4FH8 A;  1EEJ A;  2K6V A;  5AIS A;  3GTU B;  4EXJ A;  3IHQ A;  1PKW A;  4EDY A;  4QQ7 A;  4K0N A;  4Z2T A;  4GXZ A;  4O5Q A;  4FO5 A;  2GT5 A;  3ZFL A;  4PI2 C;  2F9S A;  3GST A;  4IHU A;  3RPP A;  4MLY A;  1B8X A;  3ERG A;  5DBQ A;  5GAP D;  6GSX A;  2GT6 A;  1S3C A;  5J40 A;  3ME7 A;  3ZZX A;  2D2Z A;  4IP1 A;  4EF0 A;  2H73 A;  2DC5 A;  3F6D A;  3CYN A;  2OJL A;  1Q98 A;  1QK8 A;  2NVL A;  4KDY A;  2JZR A;  8GSS A;  4A5P A;  2H72 A;  4HU9 A;  3IXR A;  1BF5 A;  5CRH A;  1A8Y A;  4OCF A;  2H30 A;  2UV8 G;  1RK4 A;  4JR6 A;  2PUK C;  4OMV A;  3L9U A;  6GSV A;  2OT3 A;  1H4O A;  1OC9 A;  1MTC A;  1FOH A;  2GDR A;  5G31 A;  3TRP A;  3DWV A;  4PXO A;  4G2E A;  4MJB A;  3GKX A;  2V2G A;  4Z2U A;  2WB9 A;  3EC3 A;  5LNK e;  4X43 A;  4KUN A;  2V6K A;  3GKK A;  4MNN A;  1MDK A;  4QL7 A;  1GTA A;  3KP9 A;  2JSZ A;  5G1L A;  5A5K A;  4ZB7 A;  3CQF A;  5COH A;  4BVX B;  1EGO A;  4WBR D;  4WET A;  1YF0 A;  20GS A;  1JLW A;  1R7H A;  4BPY A;  2HRK A;  6GSY A;  2LRT A;  3GIX A;  5LD0 A;  2HI7 A;  5DVB A;  4F0C A;  3WGD A;  1K0O A;  2EFE A;  3G7Y A;  4ZB6 A;  3GMF A;  5D96 A;  2LQO A;  1TRU A;  1TI1 A;  2VLU A;  2MMZ A;  2L5O A;  2XPE A;  5B6M A;  4IS0 A;  1PKZ A;  2X64 A;  1OKT A;  1ZCP A;  1LJR A;  4IN0 A;  4XS6 A;  4DVC A;  4I97 A;  3LYK A;  4GQC A;  4JU5 A;  4N0Z A;  5EY6 A;  2GST A;  2GZZ A;  3LYP A;  4EC0 A;  4MCU A;  2L6C A;  2QKE A;  1TTZ A;  3C7M A;  2FNO A;  1XWB A;  1XPV A;  4OO4 A;  2CX4 A;  1AIU A;  1X5C A;  1U87 A;  2M80 A;  4WXT A;  4KF9 A;  5HR2 A;  2M46 A;  5ID2 A;  4ZL9 A;  4MZC A;  3KMO A;  4HZ4 A;  1R5A A;  1BJX A;  4KX4 A;  3D22 A;  1EP8 A;  4MF6 A;  2C80 A;  3I9V 2;  2YJ7 A;  3CSI A;  3GYK A;  2MBT A;  2B5E A;  4BIK A;  3DVW A;  4FIW A;  2KP1 A;  2VCQ A;  5J9B A;  2CVK A;  4EE0 A;  5H5Q A;  5J4Y A;  1WE0 A;  3A2W A;  5CAX A;  1THO A;  4DSS A;  1PA3 A;  2RM6 A;  1CQG A;  4Z7X A;  1BYE A;  4J57 E;  2HSN A;  3LXZ A;  2EIR A;  4N30 A;  4XCS A;  3F3Q A;  1XIY A;  4TN8 A;  1EOH A;  3LOR A;  3CSJ A;  2IFQ A;  5BMU A;  3TRQ A;  3RPN A;  2HSM A;  1XW9 A;  3TOT A;  2QGV A;  2VL9 A;  2VCT A;  2Z9S A;  4ID0 A;  3IBH A;  3QD9 A;  4ZIJ A;  3BD2 A;  2OAD A;  2X8C A;  4OFT A;  5G5E A;  2LJR A;  1AUC A;  4V2M A;  4AKG A;  1XVW A;  4POK A;  5F07 A;  4WR4 A;  2I4A A;  4Z2R A;  2CZ3 A;  1ZMA A;  4G01 A;  1TI3 A;  2L4Q A;  4ZL7 A;  5ELA A;  2K8V A;  4OD7 A;  2AAW A;  3RHB A;  2WS2 A;  2IIY A;  2JSY A;  2B7J A;  4EKZ A;  2IMD A;  1BAY A;  3NOF A;  4NPB A;  19GS A;  5B8B A;  2KUC A;  2J9H A;  3LSZ A;  5GAN D;  2HFD A;  3TJJ A;  2VCX A;  1A2M A;  4GCI A;  5J4U A;  2KLX A;  1O7U A;  3KH7 A;  4X1U A;  3GHA A;  1V58 A;  4KGI A;  3LJR A;  5D73 A;  3EYT A;  1O73 A;  4E68 A;  3TB2 A;  4XRA A;  4RQR A;  2VCZ A;  5INY A;  4K9Z A;  2YJH A;  1PN9 A;  1GSF A;  1T00 A;  3RGB C;  2IL3 A;  4MAB A;  1YEP A;  4X0X A;  2XBI A;  1NW2 A;  1K3L A;  1PRX A;  3ZIJ A;  3L4N A;  1ZGN A;  4PQH A;  4ZBD A;  2PMT A;  2DJK A;  1MEK A;  1O6J A;  4IJI A;  2C1Y A;  4TR1 B;  5A4V A;  2PER A;  3ERF A;  4PQI A;  5G30 A;  2DIY A;  3A2V A;  2AHE A;  1MD3 A;  3TKQ A;  2CVD A;  5DAL B;  1T4Z A;  3HKR A;  3DKS A;  2H19 A;  3HA9 A;  4LA1 A;  1EV4 A;  4O32 A;  4OFM A;  3M9K A;  4MJC A;  3C71 A;  7GSS A;  3FR9 A;  2I1U A;  1O8W A;  4AF2 A;  1X0R A;  3CSH A;  4KA0 A;  2NBS A;  2R2J A;  4MP4 A;  2R5G A;  2VL2 C;  2A2R A;  1B9X C;  4TR4 A;  2WW0 A;  1KTE A;  4KDU A;  3DVX A;  2WVZ A;  1FO5 A;  3GSS A;  3IHG A;  2NDO A;  3Q74 A;  2FD3 A;  3CBU A;  5GSS A;  2L4C A;  3KH9 A;  22GS A;  2CZ2 A;  3EIN A;  5ENU A;  2B5Y A;  1B48 A;  1VF2 A;  3TUE A;  1XW6 A;  4MH2 A;  1X5D A;  1AW9 A;  2OA7 A;  1S3R A;  2WCI A;  3RAZ A;  12GS A;  5ECH B;  1WWJ A;  1LBK A;  2CX3 A;  4KCE A;  5ECQ B;  2GQL A;  2H74 A;  1VGL A;  4I2T A;  3D4M A;  4IQ1 A;  2GS3 A;  4V2L A;  1WP0 A;  1DE2 A;  1PMT A;  2VM2 A;  3ZTL A;  4FYU A;  5CP1 A;  2O8V B;  4ECJ A;  4K2D A;  3KCM A;  2O3E A;  5IMV A;  1DE1 A;  4MK3 A;  2H71 A;  4GST A;  3ZLP A;  2WVX B;  2X49 A;  2PPT A;  3GX0 A;  4F0B A;  4TW5 A;  4OWY A;  2PBJ A;  4L8E A;  2TRC P;  2XPD A;  3VI5 A;  3M1G A;  1GWC A;  4DEJ A;  3KMN A;  2IN3 A;  4N11 A;  4O5R A;  3FZ5 A;  2XC2 A;  1GUK A;  2H76 A;  1NHY A;  2YV7 A;  2H70 A;  1G0T A;  3W6G A;  2RUE A;  5DAK B;  4JRR A;  3I43 A;  5A1N B;  1THX A;  3AY8 A;  4HZ2 A;  4N3Z A;  5KN3 A;  2IMK A;  1I5G A;  5HFK A;  2LKU A;  3SBC A;  5ECI B;  1YEW C;  1M99 A;  3GTU A;  5A34 B;  3HJM A;  3L0H A;  1AQV A;  1YJ6 A;  4TR3 A;  5IPG A;  2YZU A;  2DJ0 A;  4FXY P;  3C1S A;  9GSS A;  4WKW A;  4KSM A;  2H0I A;  1EZK A;  2HNL A;  1T3B A;  4AKH A;  1O81 A;  3IDV A;  4HDE A;  3IK9 A;  2QA2 A;  1S3A A;  4WEY A;  3JCM L;  1KEB A;  1TK0 B;  4MDC A;  1Y25 A;  1K0C A;  3HVN A;  4ML1 A;  1IYI A;  3APQ A;  2H0H A;  4MZB A;  4KND A;  1K3Y A;  3N5O A;  4HOJ A;  3L9V A;  3A5I A;  3PR8 A;  1TW9 A;  1PFO A;  2JZS A;  5IMA A;  3O76 A;  2H6Y A;  2EFC A;  2C8U A;  2DKI A;  4OCE A;  5KN0 A;  1YY7 A;  2AJQ B;  5JCU A;  2KOK A;  3FHK A;  1OVN A;  4DSQ A;  2WRT A;  4MF5 A;  2VOC A;  5JWO B;  2LNS A;  1TK5 B;  4G0K A;  1J08 A;  1QUW A;  1VF4 A;  2LJA A;  2HRF A;  4HQZ A;  3VLN A;  1AXD A;  3HD5 A;  5J4V A;  1HD2 A;  4MF7 A;  4KH7 A;  4HJM A;  5D9X A;  3GNJ A;  4ECB A;  4IGJ A;  4BVY B;  2MMO A;  2HSH A;  2JAD A;  1XCC A;  1K3O A;  2FY6 A;  1M3I A;  1NM3 A;  3HVX A;  1PD2 1;  5ECP B;  4K5R A;  5DCG A;  2EIQ A;  2FGX A;  4PNG A;  3HHV A;  1TU7 A;  1M0U A;  3DXB A;  1EEM A;  3UVT A;  4KW6 A;  4TR0 A;  4ML6 A;  5GST A;  3O6T A;  5A4W A;  5H5R A;  4V1A p;  3Q6O A;  1KNG A;  3L78 A;  4PQ1 A;  1VF3 A;  1SJZ A;  3F63 A;  4BWS A;  1YDK A;  2H66 A;  2GZY A;  1K0A A;  3IC8 A;  2VLT A;  4BWQ A;  1AQX A;  2H0G A;  3KGK A;  4E8E A;  2O7K A;  1M2A A;  2O36 A;  1N2A A;  1PSQ A;  3G7J A;  2HRN A;  5IMZ A;  1OC8 A;  2WDU A;  4IVF A;  4ZL8 A;  4EIQ A;  2G0F A;  3C1R A;  3VPT A;  2N5F A;  4LLR A;  3QFA C;  2DJ1 A;  3M9J A;  4H86 A;  2WZS A;  2X4A A;  3MAK A;  2V41 A;  3LGC A;  4KDX A;  5J41 A;  4I8B A;  1PN0 A;  1ERV A;  2R37 A;  3TKS C;  4D73 B;  5IQY A;  2VD0 A;  4LL1 B;  1M2B A;  3VUR A;  2YPM A;  4IQA A;  2O87 A;  1QXH A;  1WIK A;  3J7Y k;  2R0C A;  2CAQ A;  3BCI A;  4YAP A;  4GLT A;  2GSS A;  4CDO A;  4YKG A;  4ECC A;  3U6V A;  1V98 A;  3CHX C;  4G9H A;  1GSQ A;  5L71 A;  5FHI A;  2AB6 A;  3LEF A;  1WOU A;  2GZP A;  2BJX A;  3VPQ A;  1NHO A;  2B1L A;  1Z9H A;  3KM6 A;  3EVI A;  5ECL B;  5KN1 A;  3P7X A;  3O3T A;  5D9V A;  2OE3 A;  2X8H A;  3S9F A;  3QAG A;  1OC9 B;  2WGR A;  1ABA A;  2C0D A;  1OC3 A;  3TDG A;  1DUG A;  3KXO A;  1WRY A;  2H1A A;  2LEG A;  2H1D A;  4EVM A;  2K18 A;  4QMK A;  3MNG A;  1UA5 A;  2ZCT A;  4PUA A;  2LQQ A;  1GRX A;  3NIV A;  2YV9 A;  3K8N A;  4XIH A;  1B9Y C;  1TKD B;  4JBB A;  1GTI A;  2R4V A;  1IYH A;  4POM A;  5B7C A;  3MYD A;  1GUL A;  3EPT A;  4G0I A;  3TJF A;  4EO3 A;  3I6A A;  3OR5 A;  1SKS B;  1SD9 A;  2J23 A;  5HFG A;  3FRC A;  3ERW A;  3ZML A;  3RDW A;  3NZN A;  3FZ9 A;  3UAR A;  3GV1 A;  4LL4 B;  3KIJ A;  1U88 A;  4JZQ A;  2FA8 A;  4FYB A;  5E59 A;  3F6F A;  3UL3 A;  4TKY A;  2CVB A;  1PGT A;  3WGX A;  2IMI A;  3F3R A;  1S4B P;  4PNF A;  2XBQ A;  2GLR A;  3IR4 A;  2F51 A;  1G6Y A;  1EV9 A;  1AQW A;  2H6X A;  2OAC A;  2JZT A;  1ML6 A;  1Y6E A;  1SYR A;  16GS A;  1B4Q A;  3Q18 A;  2JL4 A;  3RBT A;  6GSU A;  5F05 A;  1HNA A;  4MH3 A;  1BG1 A;  3VFI A;  2HZF A;  4TRX A;  4CHS A;  5CRG A;  2V6O A;  1TJD A;  1V57 A;  3UJ1 A;  5EPF A;  4MMM A;  4YQU A;  5ID2 B;  3A3T A;  2FHE A;  2H1L A;  4PTS A;  2AV4 A;  2C3N A;  1Y1U A;  1SVL A;  5AGY A;  2A2P A;  4ZBA A;  1HNC A;  2FCH A;  3MWH A;  4HU7 A;  3TGZ A;  4NV2 A;  1U3I A;  1M7T A;  1S3D A;  2HRA A;  1SJI A;  4ZB9 A;  1A23 A;  1A2J A;  3GL5 A;  5DDL A;  2H75 A;  1TRS A;  4NAX A;  1CQH A;  1V9W A;  4XRD A;  2IME A;  5ECR B;  2WVY A;  4HUA A;  2VD1 A;  2WZ9 A;  3HY2 A;  4K1F A;  1GUM A;  3HZ8 A;  1A0R P;  2TRX A;  2MMN A;  2N5B A;  4Q5Q A;  4DSS B;  4YQV A;  3W8J A;  1QQ2 A;  3D21 A;  2WJU A;  1W89 A;  3D5J A;  4JED A;  1NSW A;  1UN2 A;  4RI6 A;  4IEL A;  1F6M C;  4OO5 A;  1T4Y A;  2IFQ B;  5BMU B;  2KHP A;  2JAC A;  1ZYN A;  1YZX A; 
#chains in the Genus database with same CATH homology
 1DBY A;  3IOS A;  2MYG A;  2FWG A;  2HSY A;  2IWT A;  4F9Z A;  3FW2 A;  3ZRE A;  2YWO A;  1XWA A;  1X9S B;  3UBK A;  1T8E B;  2RUF A;  2FA4 A;  3F9U A;  4XTS A;  1F9M A;  2MBS A;  3TKP A;  1A8L A;  3ZMK A;  4K5S A;  1SVM A;  2VUP A;  5IM9 A;  4NMU A;  3MDK A;  3US3 A;  1R4W A;  2C3Q A;  3TJB A;  3PPU A;  1BX9 A;  3H93 A;  2L59 A;  1HNB A;  2DJJ A;  2YN1 A;  5KOX A;  2VKZ G;  4OFN A;  1KBN A;  1X9M B;  2C3T A;  2PVQ A;  4IP6 A;  4XS4 A;  4ISD A;  2B5X A;  5F06 A;  2DKH A;  3DD3 A;  2YWM A;  2RLI A;  4Q5N A;  2CV4 A;  4ECI A;  1GSY A;  1ZYQ B;  4I2U A;  4G19 A;  3GA4 A;  4NV5 A;  1TK8 B;  3HMJ G;  4YH2 A;  3APS A;  3GFK A;  2OE1 A;  3ZIV A;  4V1A g;  2EIO A;  2G2Q A;  2P31 A;  2O5V A;  3ZVJ D;  1YEX A;  5IOW A;  1HYU A;  3GKM A;  3ZYW A;  4DSR A;  4J56 E;  2CT6 A;  2HZE A;  5CRD A;  5D93 A;  1E6B A;  2I9H A;  2C0G A;  4ZXG A;  5ELG A;  3E0U A;  2HT9 A;  4NHZ A;  3I69 A;  3EU3 A;  1VF1 A;  4I6X A;  5EVO A;  5A5H A;  2LRN A;  5J9C A;  3HXS A;  3LXT A;  5DJL A;  1TRW A;  4EIP A;  3V1W A;  1I9D A;  3EMX A;  5FT3 A;  2O85 A;  1PX7 A;  3IAM 2;  4RUV A;  4GF0 A;  3DML A;  3TKS E;  3IK7 A;  1ZZY A;  2GGT A;  1ERT A;  3KTB A;  1FG4 A;  3FEU A;  2CQ9 A;  3H4K A;  4BVY A;  3DYR A;  3N9J A;  3UOM A;  1U6T A;  4EDZ A;  1EP7 A;  1HQO A;  3IAS 2;  4MJA A;  5F8B A;  4IBP A;  4WBJ A;  2L57 A;  2H8L A;  1ZYP A;  2NPB A;  2XHF A;  1F2E A;  2GTU A;  2HQT A;  4YAV A;  1RW1 A;  2AUV A;  4JE1 A;  4GDF A;  1SJ6 A;  3EE2 A;  2LRC A;  2LV3 A;  5ECK B;  3UMA A;  5KOW A;  4NHW A;  2VIM A;  5IOX A;  2LTK A;  5J3R A;  2LST A;  3CRT A;  2PWJ A;  2QA1 A;  2O89 A;  2WUL A;  1ST9 A;  2OKA A;  1JZD A;  4CY6 A;  3SWL A;  5LCZ A;  1X5E A;  2YCD A;  2P5Q A;  1R5P A;  2MZC A;  4WF5 A;  3CTG A;  3GUS A;  18GS A;  3F8U A;  5CRE A;  3ED3 A;  4N0V A;  4ILF A;  2UZ8 A;  3HJP A;  2ON7 A;  1TU8 A;  3PGT A;  4HS1 A;  4AKI A;  4K2X A;  4L0W A;  5B6N A;  1BED A;  2OBK A;  4QL9 A;  5IO0 A;  3VWX A;  4BL7 B;  1ERW A;  3E3E A;  4J2F A;  4BVX A;  3VWV A;  3WYW A;  5AIV A;  1BG5 A;  3QMX A;  2DLX A;  2EFD A;  1Z5Y E;  3FR6 A;  3G9B A;  1ACV A;  4USS A;  2H01 A;  2B1K A;  3P90 A;  5CRW A;  14GS A;  2BTO T;  2LJK A;  2A2S A;  5ECN B;  4MPF A;  1YKA A;  3WT2 A;  3IA1 A;  5KEJ A;  1FB6 A;  1ZL9 A;  2B3S A;  1XVQ A;  4TXV A;  3PIN A;  2F8A A;  3FZ4 A;  3TJG A;  1PL2 A;  17GS A;  3GH6 A;  3P8W A;  6GSW A;  2X99 A;  1M9B A;  4GSS A;  3TCO A;  2E2M A;  3QDN A;  5ECS A;  2F8F A;  3LFL A;  3VWW A;  1AAZ A;  5HQP A;  2DJ3 A;  5GZZ B;  3ZIT A;  4TXO B;  1SU9 A;  3EWL A;  1QMV A;  11GS A;  2B7K A;  5G5F A;  5C04 A;  5IO2 A;  5D9W A;  5DQS A;  1J0F A;  2CAI A;  2KP2 A;  1SYX A;  5H5S A;  2GSQ A;  4PX1 A;  1YKC A;  1PQN A;  1G7E A;  2C0E A;  3M0F A;  3DGQ A;  1TDI A;  1GUH A;  2TIR A;  3EUR A;  2L5L A;  2M72 A;  2FWE A;  3UBL A;  2ZUP A;  2H6Z A;  2VM1 A;  3H79 A;  2VCV A;  4RI7 A;  1G7O A;  4MA9 A;  5DJM A;  3ME8 A;  5JCG A;  3RHC A;  3LQ7 A;  1PX6 A;  3HVS A;  3ZL5 A;  2PGT A;  3QOU A;  5C00 A;  2GVP A;  1F37 A;  1SK2 A;  10GS A;  1O85 A;  2N5A A;  4K6X A;  5JCW A;  3FR3 A;  4O7H A;  1TOF A;  1SK0 A;  3BCK A;  2REM A;  2R0G A;  2FWF A;  2FLS A;  1USB A;  2ON5 A;  1QGV A;  2DSA A;  3IE3 A;  1J9B A;  5BRT A;  2QC7 A;  1XXU A;  3ZRD A;  2C0F A;  4G0L A;  1F3A A;  4LMW A;  2A4H A;  2CA8 A;  3L9S A;  3GKN A;  5G2Z A;  4PUR A;  4W66 A;  2GQM A;  2L6D A;  5CYY A;  4ACS A;  1MDJ A;  1A24 A;  1B4P A;  2C4J A;  1ILO A;  5J47 A;  1N8J A;  1SL1 B;  5A4U A;  2V32 A;  3ISO A;  1JHB A;  2AYT A;  3IRA A;  3CMI A;  4KB3 A;  4HI7 A;  1FOV A;  1XOA A;  5DQY A;  2NTO A;  6GSS A;  1JZR A;  1OAZ A;  2EFH A;  5B8A A;  3TRX A;  4ZBB A;  1SEN A;  5AIX A;  4EL1 A;  3CXG A;  2P0G A;  3UVH A;  3C8E A;  4X4J A;  1EGR A;  1Z3E A;  2MMA A;  5KN2 A;  1JLV A;  5ECM B;  2HLS A;  4PGT A;  2HRK B;  4N10 A;  4GTU A;  2DJ2 A;  4F03 A;  1ERU A;  1SL0 B;  2PVO C;  2PN8 A;  1XWC A;  3HDC A;  4MJE A;  5HR0 A;  1JFU A;  2E2G A;  4TR1 A;  2RM5 A;  3H8Q A;  1GTB A;  1UC7 A;  1GSS A;  1OE8 A;  4AKX B;  3BJ5 A;  1K0N A;  4HJ2 A;  5DAL A;  4P3Y B;  4RQX A;  2X8G A;  13GS A;  4ZB8 A;  4KAE A;  4POB A;  2E7P A;  3FK8 A;  1EOG A;  4GRF A;  2VL2 A;  1PL1 A;  3FZA A;  4NWY A;  3W8S A;  2OE0 A;  2YWN A;  5DCH A;  1H75 A;  1K0M A;  3HCZ A;  5IPH A;  1YQ1 A;  4EUY A;  4ULX A;  1F3B A;  5HFI A;  4LMV A;  2PU9 C;  3A5W A;  1WMJ A;  2YP6 A;  4K7O A;  2HE3 A;  4Q5F A;  4XS1 A;  1SKR B;  3LWA A;  2H1G A;  5IIZ A;  1EWX A;  2LUS A;  2K8S A;  2H1B A;  3TU3 B;  1FVJ A;  1FAA A;  2DIZ A;  3F4T A;  1AC1 A;  3J7Y b;  1YF1 A;  3IC4 A;  3WGE A;  1ZOF A;  4K8M A;  2LNT A;  1JZO A;  3UEM A;  2YZH A;  2A4V A;  4MZW A;  3APO A;  1XFL A;  1Z6M A;  3WT1 A;  4Q5R A;  3UIW A;  5EL8 A;  1TRV A;  3QAW A;  4TVE A;  3QR6 A;  1XWK A;  4IJ3 A;  3GN3 A;  4KSO A;  2ALB A;  4O5U A;  2VL3 A;  3Q19 A;  2HSN B;  5IMC A;  2E0Q A;  4ICY A;  3ZFB A;  1JZW A;  4AJ8 A;  1FVK A;  1SD8 A;  3CTF A;  1BQ7 A;  5ECO B;  5D9T A;  2HSM B;  3MSZ A;  5IMD A;  2DMM A;  5JWQ B;  1GP1 A;  3QFB C;  4CW9 A;  3ZVJ A;  4K7I A;  1UVZ A;  1GH2 A;  2F3M A;  4JR4 A;  3E9J B;  3F4R A;  3QPM A;  5FWG A;  3LG6 A;  1ON4 A;  3A2X A;  3KTL A;  3FMW A;  5DAK A;  1OYJ A;  5A1N A;  1GNW A;  3IPZ A;  4K0G A;  2IMF A;  2IPA A;  2VCW A;  1A0F A;  4YQM A;  2FUG 2;  5CNW A;  4HEA 2;  5A34 A;  3D4T A;  2K9F A;  5J5N A;  3TKR A;  1K0B A;  2YAN A;  1Z7R A;  1XOB A;  1W4V A;  2HXK A;  1GL8 A;  5CO3 A;  3DIE A;  4I5Q A;  2R3X A;  3HJO A;  2FWH A;  5G1K A;  1YVL A;  1WJK A;  3R3E A;  3VK9 A;  5F0G A;  2GSR A;  3GUR A;  2VAF A;  2VO4 A;  4F2I A;  1MD4 A;  4FYC A;  1R26 A;  2V1M A;  4WF4 A;  3KZQ A;  3GH9 A;  3G7I A;  2I81 A;  5D8I A;  4AGS A;  3GRX A;  1E2Y A;  1FHE A;  2ES7 A;  3CRU A;  4KCA A;  4BA7 A;  3IV4 A;  3MIX A;  2EC4 A;  3TOU A;  1TXX A;  2B6M A;  1M9A A;  1TXU A;  1OE7 A;  1M2D A;  3F4S A;  2GQK A;  2BMX A;  3TJK A;  5ABR A;  2DBC A;  4CY8 A;  1C72 A;  1URM A;  3P2A A;  1A2L A;  5AN1 A;  3FY7 A;  3UAP A;  1Z7P A;  4TOP A;  3GL3 A;  4POL A;  3KEB A;  2YNX A;  2I3Y A;  3CWG A;  1SVO A;  2LS5 A;  2YOI A;  4BL7 A;  2JU5 A;  4GWR A;  1ZYE A;  1DSB A;  1GSD A;  1K0D A;  3R2Q A;  2R6K A;  1FW1 A;  2RII A;  2WFC A;  3FYG A;  1SKW B;  2HYX A;  1T1V A;  2R0P A;  2OBI A;  3D0Z A;  3C73 A;  1GSE A;  1GNE A;  4MPG A;  4GQF A;  4HQS A;  4XS4 B;  4F82 A;  4G10 A;  1SK1 A;  4XHM A;  4E8H A;  3D6I A;  4FQU A;  3DRN A;  4AJ6 A;  1GTU A;  1N25 A;  2DML A;  6GST A;  4IKH A;  2YWI A;  1X9W B;  4IW9 A;  3PH9 A;  1T7P B;  3BBY A;  1XBS A;  2IJY A;  5E4W A;  5HR3 A;  4AI6 A;  3U5R E;  1LU4 A;  1MDI A;  1O8X A;  5HR1 A;  4KE3 A;  1GSU A;  4V2N A;  2VLV A;  1OKD A;  3KD0 A;  3KP8 A;  2ZNM A;  4PUF C;  3LW9 A;  3QAV A;  3KJY A;  2P5R A;  4L5O A;  1Z6N A;  4O92 A;  4TXO A;  3VWU A;  3HYP A;  4L0U A;  3HVV A;  2HZE B;  3M8N A;  3VI7 A;  1XWG A;  1SL2 B;  1FB0 A;  4L5L A;  3GX8 A;  3HZ4 A;  3FKF A;  3TKS A;  4NXI A;  1VRS D;  3BOA A;  3M3M A;  1U3A A;  5A5H B;  4AJ7 A;  3DEX A;  1Q4J A;  3H1N A;  1XW5 A;  5IMF A;  3F0I A;  2QSI A;  1G6W A;  1V2A A;  1RQM A;  1WPI A;  1XZO A;  4YKF A;  3QCP A;  1GLP A;  4GSN A;  1QFN A;  3EU4 A;  4ZIL A;  4D73 A;  5JWR B;  1GLQ A;  3EMP A;  1V40 A;  1TP9 A;  4K7N A;  3WD6 A;  4WR5 A;  4FH8 A;  1EEJ A;  2K6V A;  5AIS A;  3GTU B;  4EXJ A;  3IHQ A;  1PKW A;  4EDY A;  4QQ7 A;  4K0N A;  4Z2T A;  4GXZ A;  4O5Q A;  4FO5 A;  2GT5 A;  3ZFL A;  2F9S A;  3GST A;  4IHU A;  3RPP A;  4MLY A;  1B8X A;  3ERG A;  5DBQ A;  5GAP D;  6GSX A;  2GT6 A;  1S3C A;  5J40 A;  3ME7 A;  3ZZX A;  2D2Z A;  4IP1 A;  4EF0 A;  2H73 A;  2DC5 A;  3F6D A;  3CYN A;  2OJL A;  1Q98 A;  1QK8 A;  2NVL A;  4KDY A;  2JZR A;  8GSS A;  4A5P A;  2H72 A;  4HU9 A;  3IXR A;  1BF5 A;  5CRH A;  1A8Y A;  4OCF A;  2H30 A;  2UV8 G;  1RK4 A;  4JR6 A;  2PUK C;  4OMV A;  3L9U A;  6GSV A;  2OT3 A;  1H4O A;  1OC9 A;  1MTC A;  1FOH A;  2GDR A;  5G31 A;  3TRP A;  3DWV A;  4PXO A;  4G2E A;  4MJB A;  3GKX A;  2V2G A;  4Z2U A;  2WB9 A;  3EC3 A;  5LNK e;  4X43 A;  4KUN A;  2V6K A;  3GKK A;  4MNN A;  1MDK A;  4QL7 A;  1GTA A;  3KP9 A;  2JSZ A;  5G1L A;  5A5K A;  4ZB7 A;  5COH A;  4BVX B;  1EGO A;  4WBR D;  4WET A;  1YF0 A;  20GS A;  1JLW A;  1R7H A;  4BPY A;  2HRK A;  6GSY A;  2LRT A;  3GIX A;  5LD0 A;  2HI7 A;  5DVB A;  4F0C A;  3WGD A;  1K0O A;  2EFE A;  3G7Y A;  4ZB6 A;  3GMF A;  5D96 A;  2LQO A;  1TRU A;  1TI1 A;  2VLU A;  2MMZ A;  2L5O A;  2XPE A;  5B6M A;  4IS0 A;  1PKZ A;  2X64 A;  1OKT A;  1ZCP A;  1LJR A;  4IN0 A;  4XS6 A;  4DVC A;  4I97 A;  3LYK A;  4GQC A;  4JU5 A;  4N0Z A;  5EY6 A;  2GST A;  2GZZ A;  3LYP A;  4EC0 A;  4MCU A;  2L6C A;  2QKE A;  1TTZ A;  3C7M A;  2FNO A;  1XWB A;  1XPV A;  4OO4 A;  2CX4 A;  1AIU A;  1X5C A;  1U87 A;  2M80 A;  4WXT A;  4KF9 A;  5HR2 A;  2M46 A;  5ID2 A;  4ZL9 A;  4MZC A;  3KMO A;  4HZ4 A;  1R5A A;  1BJX A;  4KX4 A;  3D22 A;  1EP8 A;  4MF6 A;  2C80 A;  3I9V 2;  2YJ7 A;  3CSI A;  3GYK A;  2MBT A;  2B5E A;  3DVW A;  4FIW A;  2KP1 A;  2VCQ A;  5J9B A;  2CVK A;  4EE0 A;  5H5Q A;  5J4Y A;  1WE0 A;  3A2W A;  5CAX A;  1THO A;  4DSS A;  1PA3 A;  2RM6 A;  1CQG A;  4Z7X A;  1BYE A;  4J57 E;  2HSN A;  3LXZ A;  2EIR A;  4N30 A;  4XCS A;  3F3Q A;  1XIY A;  4TN8 A;  1EOH A;  3LOR A;  3CSJ A;  2IFQ A;  5BMU A;  3TRQ A;  3RPN A;  2HSM A;  1XW9 A;  3TOT A;  2QGV A;  2VL9 A;  2VCT A;  2Z9S A;  4ID0 A;  3IBH A;  3QD9 A;  4ZIJ A;  3BD2 A;  2OAD A;  2X8C A;  4OFT A;  5G5E A;  2LJR A;  1AUC A;  4V2M A;  4AKG A;  1XVW A;  4POK A;  5F07 A;  4WR4 A;  2I4A A;  4Z2R A;  2CZ3 A;  1ZMA A;  4G01 A;  1TI3 A;  2L4Q A;  4ZL7 A;  5ELA A;  2K8V A;  4OD7 A;  2AAW A;  3RHB A;  2WS2 A;  2IIY A;  2JSY A;  2B7J A;  4EKZ A;  2IMD A;  1BAY A;  3NOF A;  4NPB A;  19GS A;  5B8B A;  2KUC A;  2J9H A;  3LSZ A;  5GAN D;  2HFD A;  3TJJ A;  2VCX A;  1A2M A;  4GCI A;  5J4U A;  2KLX A;  1O7U A;  3KH7 A;  4X1U A;  3GHA A;  1V58 A;  4KGI A;  3LJR A;  5D73 A;  3EYT A;  1O73 A;  4E68 A;  3TB2 A;  4XRA A;  4RQR A;  2VCZ A;  5INY A;  4K9Z A;  2YJH A;  1PN9 A;  1GSF A;  1T00 A;  2IL3 A;  4MAB A;  1YEP A;  4X0X A;  2XBI A;  1NW2 A;  1K3L A;  1PRX A;  3ZIJ A;  3L4N A;  1ZGN A;  4PQH A;  4ZBD A;  2PMT A;  2DJK A;  1MEK A;  1O6J A;  4IJI A;  2C1Y A;  4TR1 B;  5A4V A;  2PER A;  3ERF A;  4PQI A;  5G30 A;  2DIY A;  3A2V A;  2AHE A;  1MD3 A;  3TKQ A;  2CVD A;  5DAL B;  1T4Z A;  3HKR A;  3DKS A;  2H19 A;  3HA9 A;  4LA1 A;  1EV4 A;  4O32 A;  4OFM A;  3M9K A;  4MJC A;  3C71 A;  7GSS A;  3FR9 A;  2I1U A;  1O8W A;  4AF2 A;  1X0R A;  3CSH A;  4KA0 A;  2NBS A;  2R2J A;  4MP4 A;  2R5G A;  2VL2 C;  2A2R A;  1B9X C;  4TR4 A;  1KTE A;  4KDU A;  3DVX A;  1FO5 A;  3GSS A;  3IHG A;  2NDO A;  3Q74 A;  2FD3 A;  3CBU A;  5GSS A;  2L4C A;  3KH9 A;  22GS A;  2CZ2 A;  3EIN A;  5ENU A;  2B5Y A;  1B48 A;  1VF2 A;  3TUE A;  1XW6 A;  4MH2 A;  1X5D A;  1AW9 A;  2OA7 A;  2WCI A;  3RAZ A;  12GS A;  5ECH B;  1WWJ A;  1LBK A;  2CX3 A;  4KCE A;  5ECQ B;  2GQL A;  2H74 A;  1VGL A;  4I2T A;  3D4M A;  4IQ1 A;  2GS3 A;  4V2L A;  1WP0 A;  1DE2 A;  1PMT A;  2VM2 A;  3ZTL A;  4FYU A;  5CP1 A;  2O8V B;  4ECJ A;  4K2D A;  3KCM A;  5IMV A;  1DE1 A;  4MK3 A;  2H71 A;  4GST A;  3ZLP A;  2X49 A;  2PPT A;  3GX0 A;  4F0B A;  4TW5 A;  4OWY A;  2PBJ A;  4L8E A;  2TRC P;  2XPD A;  3VI5 A;  3M1G A;  1GWC A;  4DEJ A;  3KMN A;  2IN3 A;  4N11 A;  4O5R A;  3FZ5 A;  2XC2 A;  1GUK A;  2H76 A;  1NHY A;  2YV7 A;  2H70 A;  1G0T A;  3W6G A;  2RUE A;  5DAK B;  4JRR A;  3I43 A;  5A1N B;  1THX A;  3AY8 A;  4HZ2 A;  4N3Z A;  5KN3 A;  2IMK A;  1I5G A;  5HFK A;  2LKU A;  3SBC A;  5ECI B;  3GTU A;  1M99 A;  5A34 B;  3HJM A;  3L0H A;  1AQV A;  1YJ6 A;  4TR3 A;  5IPG A;  2YZU A;  2DJ0 A;  3C1S A;  9GSS A;  4WKW A;  4KSM A;  2H0I A;  1EZK A;  2HNL A;  1T3B A;  4AKH A;  1O81 A;  3IDV A;  4HDE A;  3IK9 A;  2QA2 A;  1S3A A;  4WEY A;  3JCM L;  1KEB A;  1TK0 B;  4MDC A;  1Y25 A;  1K0C A;  4ML1 A;  1IYI A;  3APQ A;  2H0H A;  4MZB A;  4KND A;  1K3Y A;  3N5O A;  4HOJ A;  3L9V A;  3A5I A;  3PR8 A;  1TW9 A;  2JZS A;  5IMA A;  3O76 A;  2H6Y A;  2EFC A;  2C8U A;  2DKI A;  4OCE A;  5KN0 A;  1YY7 A;  2AJQ B;  5JCU A;  2KOK A;  3FHK A;  1OVN A;  4DSQ A;  2WRT A;  4MF5 A;  2VOC A;  5JWO B;  2LNS A;  1TK5 B;  4G0K A;  1J08 A;  1QUW A;  1VF4 A;  2LJA A;  2HRF A;  4HQZ A;  3VLN A;  1AXD A;  3HD5 A;  5J4V A;  1HD2 A;  4MF7 A;  4KH7 A;  4HJM A;  5D9X A;  3GNJ A;  4ECB A;  4IGJ A;  4BVY B;  2MMO A;  2HSH A;  2JAD A;  1XCC A;  1K3O A;  2FY6 A;  1NM3 A;  3HVX A;  1PD2 1;  5ECP B;  4K5R A;  5DCG A;  2EIQ A;  2FGX A;  4PNG A;  3HHV A;  1TU7 A;  1M0U A;  3DXB A;  1EEM A;  3UVT A;  4KW6 A;  4TR0 A;  4ML6 A;  5GST A;  3O6T A;  5A4W A;  5H5R A;  4V1A p;  3Q6O A;  1KNG A;  3L78 A;  4PQ1 A;  1VF3 A;  1SJZ A;  3F63 A;  4BWS A;  1YDK A;  2H66 A;  2GZY A;  1K0A A;  3IC8 A;  2VLT A;  4BWQ A;  1AQX A;  2H0G A;  3KGK A;  4E8E A;  2O7K A;  1M2A A;  1PSQ A;  1N2A A;  3G7J A;  2HRN A;  5IMZ A;  1OC8 A;  2WDU A;  4IVF A;  4ZL8 A;  4EIQ A;  2G0F A;  3C1R A;  3VPT A;  2N5F A;  4LLR A;  3QFA C;  2DJ1 A;  3M9J A;  4H86 A;  2X4A A;  3MAK A;  2V41 A;  3LGC A;  4KDX A;  5J41 A;  4I8B A;  1PN0 A;  1ERV A;  2R37 A;  3TKS C;  4D73 B;  5IQY A;  2VD0 A;  4LL1 B;  1M2B A;  3VUR A;  2YPM A;  4IQA A;  2O87 A;  1QXH A;  1WIK A;  3J7Y k;  2R0C A;  2CAQ A;  3BCI A;  4YAP A;  4GLT A;  2GSS A;  4CDO A;  4YKG A;  4ECC A;  3U6V A;  1V98 A;  4G9H A;  1GSQ A;  5L71 A;  5FHI A;  2AB6 A;  3LEF A;  1WOU A;  2GZP A;  2BJX A;  3VPQ A;  1NHO A;  2B1L A;  1Z9H A;  3KM6 A;  3EVI A;  5ECL B;  5KN1 A;  3P7X A;  3O3T A;  5D9V A;  2OE3 A;  2X8H A;  3S9F A;  3QAG A;  1OC9 B;  2WGR A;  1ABA A;  2C0D A;  1OC3 A;  3TDG A;  1DUG A;  3KXO A;  1WRY A;  2H1A A;  2LEG A;  2H1D A;  4EVM A;  2K18 A;  4QMK A;  3MNG A;  1UA5 A;  2ZCT A;  4PUA A;  2LQQ A;  1GRX A;  3NIV A;  2YV9 A;  3K8N A;  4XIH A;  1B9Y C;  1TKD B;  4JBB A;  1GTI A;  2R4V A;  1IYH A;  4POM A;  5B7C A;  3MYD A;  1GUL A;  3EPT A;  4G0I A;  3TJF A;  4EO3 A;  3I6A A;  3OR5 A;  1SKS B;  1SD9 A;  2J23 A;  5HFG A;  3FRC A;  3ERW A;  3ZML A;  3RDW A;  3NZN A;  3FZ9 A;  3UAR A;  3GV1 A;  4LL4 B;  3KIJ A;  1U88 A;  4JZQ A;  2FA8 A;  4FYB A;  5E59 A;  3F6F A;  3UL3 A;  4TKY A;  2CVB A;  1PGT A;  3WGX A;  2IMI A;  3F3R A;  4PNF A;  2XBQ A;  2GLR A;  3IR4 A;  2F51 A;  1G6Y A;  1EV9 A;  1AQW A;  2H6X A;  2OAC A;  2JZT A;  1ML6 A;  1Y6E A;  1SYR A;  16GS A;  1B4Q A;  3Q18 A;  2JL4 A;  3RBT A;  6GSU A;  5F05 A;  1HNA A;  4MH3 A;  1BG1 A;  3VFI A;  2HZF A;  4TRX A;  4CHS A;  5CRG A;  2V6O A;  1TJD A;  1V57 A;  3UJ1 A;  5EPF A;  4MMM A;  4YQU A;  5ID2 B;  3A3T A;  2FHE A;  2H1L A;  4PTS A;  2AV4 A;  2C3N A;  1Y1U A;  1SVL A;  5AGY A;  2A2P A;  4ZBA A;  1HNC A;  2FCH A;  3MWH A;  4HU7 A;  3TGZ A;  4NV2 A;  1U3I A;  1M7T A;  1S3D A;  2HRA A;  1SJI A;  4ZB9 A;  1A23 A;  1A2J A;  3GL5 A;  5DDL A;  2H75 A;  1TRS A;  4NAX A;  1CQH A;  1V9W A;  4XRD A;  2IME A;  5ECR B;  4HUA A;  2VD1 A;  2WZ9 A;  3HY2 A;  4K1F A;  1GUM A;  3HZ8 A;  1A0R P;  2TRX A;  2MMN A;  2N5B A;  4Q5Q A;  4DSS B;  4YQV A;  3W8J A;  1QQ2 A;  3D21 A;  2WJU A;  1W89 A;  3D5J A;  4JED A;  1NSW A;  1UN2 A;  4RI6 A;  4IEL A;  1F6M C;  4OO5 A;  1T4Y A;  2IFQ B;  5BMU B;  2KHP A;  2JAC A;  1ZYN A;  1YZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...