1VF4A

Cgsta1-1 apo form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
227
structure length
227
Chain Sequence
AAKPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
total genus 81
structure length 227
sequence length 227
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf4A01
5IIZA 4ISDA 4RI6A 3CSHA 5GAPD 2H0GA 2H72A 3IXRA 4XS4A 3DKSA 3D0ZA 3VK9A 4POMA 3DVXA 1VRSD 4MMMA 1GWCA 2R37A 4YAVA 2EIOA 4OD7A 3UEMA 5CAXA 5J41A 1M2BA 3WYWA 4K7IA 3D4MA 4MLYA 5AISA 4WF5A 3LXZA 3PINA 5AIXA 1F37A 3HJOA 3VWVA 3MSZA 4J2FA 1ZZYA 3I9V2 5CRHA 4BPYA 2WULA 1Z5YE 1A0FA 2K8SA 2VLUA 2HYXA 3LFLA 1V40A 1TDIA 2OACA 1OC8A 4HOJA 4BWQA 1ML6A 2MMZA 5DCHA 3I43A 3UL3A 1GUMA 1DSBA 3UBLA 5F07A 1DE1A 1PGTA 4ULXA 3FZ4A 2OE0A 3KTBA 3ERGA 5IO0A 3D21A 4BA7A 2JL4A 3F0IA 5IOXA 5HFKA 5GSTA 4KNDA 2PU9C 3DD3A 4HDEA 2YPMA 3F3QA 4USSA 5A4WA 4J56E 4RI7A 1XIYA 4FH8A 2HSHA 2HE3A 4KGIA 2AAWA 5ECRB 3VI5A 4TR1B 3Q74A 2H0IA 1YKCA 2XBIA 2IFQB 1Z9HA 5ECLB 4RQRA 3GURA 2GTUA 5H5SA 4DSQA 3GL3A 3CYNA 2BTOT 5J9BA 2REMA 1TKDB 5D96A 4L5LA 2K18A 4WR4A 5IPGA 3KGKA 2VM2A 1S3CA 4MPFA 2HZFA 2FWGA 2CZ2A 4DSSB 4JRRA 2X8CA 4WBRD 2IJYA 2NBSA 2FUG2 1QXHA 1X5DA 3KJYA 2HI7A 3GSSA 3J7Yb 3BJ5A 1WRYA 2I81A 1M0UA 1Q98A 2WJUA 5G1KA 2RUEA 2MMNA 4K9ZA 1YY7A 2B7KA 3GNJA 1KNGA 1ZYQB 5HR2A 1SKWB 2PN8A 4MJEA 3TRXA 2H30A 2HSMB 2VLTA 3GIXA 3TKSA 2DIYA 1VGLA 5ENUA 2WDUA 2HSNB 4LL1B 3FYGA 4X1UA 3WGEA 2NVLA 1UC7A 4AGSA 1XCCA 4GQCA 1R4WA 5ABRA 1GTBA 3F63A 2HXKA 1AAZA 13GSA 1WJKA 5KN2A 1V9WA 4TR3A 4EUYA 3LQ7A 2KP1A 2JU5A 2C4JA 1VF3A 4K8MA 2DJ1A 2AB6A 2TRXA 2LNTA 3N9JA 1JZOA 3UMAA 2R2JA 1NM3A 1G6YA 2A2RA 3CRUA 1PN9A 2DC5A 1B4QA 2ALBA 2X99A 1NHYA 5DBQA 1PMTA 1GUKA 2CX3A 1Y25A 2YWNA 4ZXGA 2YOIA 1QQ2A 3IE3A 3DYRA 1GULA 3WGDA 1EEJA 2RM5A 3G7IA 1OAZA 1TK8B 1ON4A 4ILFA 3ZITA 6GSSA 1FB6A 4HZ2A 5D93A 6GSYA 4QL9A 1ST9A 3C1SA 5H5QA 1PX6A 3CMIA 4LLRA 12GSA 1XWAA 3VLNA 1F6MC 3QPMA 5IMFA 1TI1A 3FZ5A 3FR6A 3RPNA 1A23A 1UA5A 4ACSA 3F9UA 1A2LA 1EOGA 4YQUA 2I1UA 2HSMA 1RW1A 1GH2A 3U5RE 3KH7A 5A5KA 4GLTA 1YQ1A 1V58A 5ECMB 2LV3A 1GSUA 3EU3A 4IN0A 4HQSA 2PGTA 3LYKA 1T7PB 3GX0A 1Z7PA 2PVQA 1MDIA 4KDXA 5DALA 5ID2B 2KUCA 2PUKC 1O73A 2KP2A 1YEPA 1Z6NA 2CAQA 3EC3A 1N2AA 4BVYB 3KIJA 1XFLA 1GNEA 2UZ8A 1NW2A 2CX4A 2L4CA 14GSA 3DVWA 3S9FA 3UOMA 5DAKB 1ZYEA 2VL2C 2VD0A 5EL8A 2HRFA 4H86A 3VWWA 1X9MB 2ZUPA 1HQOA 5IO2A 1ILOA 3GTUB 3L78A 4OMVA 2RM6A 3GMFA 2OADA 2P5QA 2B5EA 2ES7A 3AY8A 3APSA 3IV4A 3TDGA 5CRGA 5DDLA 2C0GA 5AIVA 4OFMA 4MCUA 4LL4B 3GYKA 1ACVA 3RAZA 3ZYWA 2LRCA 3G9BA 1TI3A 2DSAA 2L4QA 2YV9A 5ECQB 4POLA 4OFTA 3U6VA 4N0ZA 3ZMLA 1ERWA 1MEKA 5EY6A 2QGVA 4ZB9A 4K1FA 2HRKA 4NPBA 2HZEA 3Q19A 2A4VA 3RPPA 5B8AA 1O8WA 1JFUA 5D9WA 3ZL5A 2DLXA 2TIRA 5ELAA 4NV2A 2DMLA 3UAPA 2IMDA 3P2AA 5F0GA 1EGOA 3GN3A 2H1GA 1JZRA 1ZGNA 4BVYA 3DEXA 2CAIA 3UIWA 1G6WA 1J08A 2LJKA 3ZRDA 2WS2A 3GSTA 2H70A 1QFNA 4IP6A 4K7NA 4TR0A 4V2MA 5D73A 2YCDA 4MDCA 3TOTA 2ON5A 3GTUA 4AJ8A 1JZDA 1G0TA 3GKKA 9GSSA 4XS4B 2KHPA 5FT3A 1B8XA 2OJLA 3F4SA 2GZYA 1JHBA 1A2JA 2FA4A 2AHEA 3SBCA 3GH6A 2OKAA 3EMPA 3QAVA 3ZVJA 2LJRA 4BL7A 2R6KA 4DVCA 2GSRA 1SJIA 1X5CA 4PQHA 1USBA 2V1MA 3BOAA 4EL1A 1E6BA 4MZCA 1B48A 1IYHA 2GQLA 1T3BA 4NAXA 2E7PA 2PVOC 2FWEA 3MNGA 3QAGA 2A2SA 1T4ZA 1YZXA 2MMOA 1GRXA 1KEBA 2L5OA 4FO5A 3ERWA 1ABAA 4KDUA 2LTKA 2MYGA 4ZBBA 5CP1A 11GSA 1SJZA 1AQXA 1Y6EA 5DQSA 3FZ9A 2LRTA 4NHWA 5IOWA 5C04A 2H6ZA 1SD9A 5ECKB 3TKQA 1K0AA 2X64A 3GKMA 4PURA 2JACA 17GSA 4NV5A 3KD0A 2VL2A 2NTOA 2V32A 4WEYA 3G7YA 5G2ZA 1YKAA 3FY7A 5KN1A 2CZ3A 1M7TA 3F3RA 3GFKA 2JZSA 2IL3A 3C8EA 3FR3A 4EDYA 4G9HA 3VWUA 5IQYA 5CRWA 4ZBDA 2K6VA 2WFCA 4MA9A 2C0FA 3RHBA 4TN8A 22GSA 2B7JA 1EOHA 2VAFA 4RQXA 5HR0A 2X8HA 1VF2A 2DIZA 4GRFA 5HFGA 1PKWA 1XZOA 3QCPA 4OWYA 1XVWA 3A5WA 4L0UA 4Q5FA 4MF5A 3HXSA 5G1LA 3QOUA 4PTSA 3KZQA 3RDWA 1U3IA 4NWYA 4N0VA 2RUFA 3ZREA 5E4WA 1SKRB 3DXBA 2P0GA 3UARA 1ZL9A 5IMZA 2H74A 1GTAA 3EINA 1Z6MA 1XW9A 4KCAA 4XS6A 4V2LA 4PNGA 2YJ7A 1M2AA 3LJRA 1O6JA 3CSJA 5IMDA 3IC8A 2DJKA 1AW9A 3K8NA 2B5YA 5DJMA 3F4RA 1OKDA 4YH2A 4ZL9A 1YF0A 3RHCA 1PSQA 1TP9A 1SENA 2NPBA 2BMXA 1HYUA 2MMAA 4O32A 2DJ3A 4Q5RA 3TRPA 2FHEA 5GSSA 1TU8A 3TKPA 4QQ7A 5D9TA 5G5EA 4WF4A 2WCIA 4LA1A 3MWHA 1YDKA 3IOSA 5D9VA 1NHOA 3FKFA 3LWAA 2OBKA 1SL2B 2V2GA 3JCML 4L5OA 1G7OA 4IS0A 4KH7A 4I2TA 4ZL8A 2VL3A 3UVHA 4HJ2A 1XWCA 4L8EA 2VO4A 5LD0A 4HEA2 4TXVA 3HDCA 4HJMA 4POKA 3GHAA 1F3BA 1X0RA 1V2AA 5A4UA 2WB9A 4EDZA 4JZQA 4XCSA 1IYIA 1BX9A 1MD3A 1WOUA 1LU4A 2GS3A 1JLWA 3MAKA 3ZFLA 2EIRA 5BMUA 3HVXA 1R5AA 1XW5A 3GUSA 2GSQA 3QFAC 4X0XA 3KMNA 2GT5A 5JWQB 2EC4A 4TOPA 2VOCA 1TRUA 2LUSA 3IRAA 2DJJA 2JSYA 4LMWA 3QMXA 4KCEA 3CBUA 3LORA 2YZUA 5DALB 2V6OA 4ZIJA 4IQAA 4I8BA 1TK0B 1M9AA 3HCZA 3LGCA 1B9YC 2ON7A 2H6YA 1PL2A 3C1RA 1K0BA 3MDKA 3O6TA 2FWHA 4G0KA 3VFIA 4FQUA 2E2GA 2AYTA 3L9SA 2DMMA 3QAWA 3I69A 2H66A 3HA9A 3TKRA 5LNKe 2LQQA 4K7OA 2FWFA 1O85A 2VLVA 5G31A 3UBKA 1WPIA 3TJBA 3VWXA 4V2NA 3DGQA 4KF9A 2H01A 2I3YA 2L57A 2JADA 4IELA 2IWTA 4WR5A 2CQ9A 3F6FA 4KSMA 2O89A 4I97A 4D73A 2YNXA 1OE7A 2VCWA 1ZCPA 1FHEA 5E59A 5KN0A 3EWLA 2H75A 4WETA 1AXDA 4X43A 1WE0A 3G7JA 4ML6A 2LEGA 3DIEA 3H79A 3BCIA 2XHFA 1EV4A 4HZ4A 3LXTA 4MF6A 3N5OA 2HRKB 1GNWA 2HZEB 3VPTA 4IW9A 1KBNA 3R3EA 1FG4A 4XRAA 1EWXA 3WD6A 1B9XC 1J9BA 4I5QA 4POBA 2MBTA 1A8LA 3APOA 4IKHA 4GXZA 1A24A 2OBIA 5JCUA 3VURA 2YWMA 1U87A 3CTGA 18GSA 2B3SA 4DSRA 2GQMA 3NZNA 3HVSA 7GSSA 2L59A 3FEUA 1NSWA 1OKTA 1CQHA 1EP7A 2O8VB 2YJHA 4ECIA 3CTFA 3ZMKA 1MDKA 5J9CA 1X9SB 3KCMA 2PWJA 2CT6A 1K0NA 4MZBA 5D8IA 4DEJA 3WGXA 2IMFA 2X8GA 4WKWA 3IC4A 3EVIA 1GP1A 3H8QA 5HR1A 5C00A 2R5GA 2GZZA 2QC7A 4MJBA 2H6XA 4F0CA 1SL0B 4F2IA 1K0OA 3ZTLA 8GSSA 3W6GA 1AQWA 2CVDA 3Q6OA 4MABA 4BL7B 1BYEA 4GCIA 2PBJA 3VI7A 2IPAA 4P3YB 5CYYA 1A8YA 2B1KA 4OFNA 1SKSB 5B6NA 3M9JA 3EU4A 2C8UA 1SK2A 3ZIJA 1W89A 3HVVA 1HNBA 3VPQA 3FHKA 3TRQA 6GSWA 2F9SA 3UJ1A 2ZCTA 4TXOA 1GSEA 1BAYA 3QFBC 2VCXA 1O8XA 5B7CA 1TRWA 3IK7A 3TJKA 1PA3A 2EIQA 3KEBA 2FLSA 4PXOA 3TCOA 5IMVA 3HJPA 4AF2A 2LS5A 1SK0A 1LJRA 4KAEA 3L0HA 4ECBA 1YEXA 3IAS2 1RK4A 2O85A 1M99A 3GV1A 1F9MA 3GX8A 5JCWA 4MH2A 4YQMA 2CA8A 3FK8A 4MPGA 2E0QA 3LYPA 3L9VA 4WXTA 2RLIA 1H75A 2GQKA 4O5RA 3L4NA 4G19A 4WBJA 1UN2A 5DVBA 4BWSA 3D4TA 5CO3A 3LG6A 6GSXA 2H1DA 1DBYA 5EVOA 2PMTA 1N8JA 6GSTA 2I9HA 3DWVA 2C3TA 1H4OA 3HJMA 3M1GA 1SK1A 4ML1A 3P8WA 4E8EA 4HU7A 1C72A 5ECIB 3FR9A 4MH3A 1T8EB 1XWBA 2C0EA 4K6XA 3TOUA 3EE2A 2WGRA 1FVKA 4EE0A 2VCVA 4CDOA 1UVZA 1PD21 1HNCA 1TOFA 4F03A 2CV4A 2GSTA 4F82A 2YV7A 4Q5QA 2XPEA 2IN3A 2VIMA 1THOA 3H4KA 3KMOA 2N5FA 4ZB6A 4ZILA 5J3RA 1FVJA 5GAND 4GSSA 1WMJA 2YP6A 4PQIA 3FW2A 2GZPA 1ZOFA 3QDNA 1FW1A 3J7Yk 4CHSA 2J23A 3TKSE 5ECSA 3FRCA 1BQ7A 2VM1A 4JE1A 2G0FA 1BJXA 1TJDA 2H71A 5EPFA 1AUCA 1ERTA 3ZFBA 5ECOB 1OE8A 5ECPB 4K0GA 3LSZA 3IBHA 1VF4A 4N10A 1OC9A 4TVEA 1VF1A 4PX1A 2M72A 1XPVA 1K3LA 1ERVA 1U3AA 4KDYA 3E3EA 4XIHA 3IAM2 2BJXA 4K2DA 3KP9A 2PERA 4FYCA 4KW6A 2HRAA 4Q5NA 2H19A 2YZHA 2KLXA 5JCGA 6GSVA 2XBQA 2MBSA 3KXOA 4IHUA 4EVMA 2L5LA 4OO4A 3HYPA 3QD9A 5JWOB 4BVXA 2V41A 1EGRA 3OR5A 1TK5B 5D9XA 2HQTA 2GDRA 3PH9A 2N5AA 2AUVA 2L6DA 4JEDA 3HHVA 2H73A 2B6MA 2JZTA 2NDOA 4N30A 5J4UA 5HQPA 2HT9A 1O7UA 5B8BA 3KTLA 5LCZA 1K0DA 2DJ0A 3ED3A 1XXUA 1GUHA 1DE2A 4HU9A 1K3YA 3ISOA 3R2QA 1R26A 2IMEA 2FA8A 4KE3A 1TTZA 2JSZA 2IMKA 3IR4A 1T00A 4AJ7A 4O92A 3I6AA 4ZB8A 4IJIA 1K0MA 3M3MA 5CREA 4JR6A 3W8JA 4KX4A 4EKZA 1U6TA 2WZ9A 5ECNB 2JZRA 3H1NA 3ERFA 4V1Ap 4JR4A 4ECCA 4NHZA 4JBBA 2LQOA 2C3QA 3P90A 5JWRB 1BEDA 1HNAA 1A0RP 1R5PA 3E0UA 3ZLPA 1DUGA 2H76A 3HY2A 1PKZA 5FHIA 3GH9A 2YANA 5F05A 1Z7RA 4D73B 2IIYA 3TUEA 4EC0A 3QR6A 2V6KA 3DRNA 5ECHB 4KSOA 2I4AA 1ERUA 1GSFA 3ME7A 4FIWA 3ZZXA 2H1AA 1GSDA 4MK3A 4ZBAA 1O81A 2VD1A 1M9BA 2O7KA 1PQNA 4Z7XA 3WT1A 5CRDA 2GLRA 3PPUA 1SD8A 4TKYA 3NOFA 1WWJA 2FCHA 4XRDA 4KA0A 4E8HA 2K8VA 3O3TA 3IPZA 2RIIA 1SU9A 4ZL7A 2XC2A 4IJ3A 2AJQB 4K0NA 2M46A 3ZIVA 2GVPA 4OO5A 3GKXA 3A2WA 3EYTA 2C80A 1SJ6A 1QGVA 1V57A 2WRTA 4MP4A 5F06A 3ZVJD 3HD5A 3BD2A 3GKNA 1V98A 5L71A 1FB0A 4TR4A 2QKEA 3GA4A 2F8AA 1GTUA 1GSYA 3DMLA 1GL8A 1F3AA 4GTUA 4NXIA 4TR1A 1TW9A 2LRNA 4ECJA 3NIVA 4HI7A 2IFQA 1K0CA 1X5EA 2CVKA 2LKUA 1JLVA 2N5BA 4KUNA 1TRSA 2FNOA 6GSUA 3BBYA 2QSIA 1K3OA 4XHMA 3C7MA 4EO3A 3TGZA 3SWLA 5AN1A 3A3TA 2K9FA 4DSSA 1EEMA 1YJ6A 2HNLA 1XOAA 4G2EA 20GSA 2AV4A 3H93A 2D2ZA 1MTCA 4NMUA 1MD4A 3IDVA 4MZWA 1XVQA 1FAAA 2J9HA 2B1LA 1PRXA 2YWOA 3E9JB 4I2UA 1SL1B 4V1Ag 3W8SA 1OC3A 1PX7A 4IVFA 2CVBA 4TXOB 1Z3EA 1OVNA 5HFIA 5COHA 1GLPA 1XBSA 3ME8A 1GSSA 2OE3A 3HZ4A 4OCFA 2LSTA 1A2MA 2PPTA 3P7XA 2DJ2A 4YAPA 2ZNMA 4KB3A 1SYRA 2GGTA 1M2DA 1WP0A 4OCEA 3GL5A 1BG5A 2GT6A 4MJCA 2LNSA 1J0FA 4XS1A 3UVTA 1CQGA 4ID0A 1R7HA 2M80A 3KM6A 4HUAA 3D22A 2H8LA 2B5XA 1XWGA 2F3MA 1TU7A 2O87A 2H0HA 1ZMAA 5KEJA 4PGTA 4HS1A 5INYA 4PNFA 3HKRA 1GLQA 5B6MA 3TJFA 1T1VA 4AJ6A 5IMAA 1YF1A 2MZCA 2IMIA 1I5GA 3Q18A 1B4PA 5CNWA 3CSIA 5KN3A 3PGTA 4MF7A 2P5RA 1W4VA 4GSNA 1S3AA 1HD2A 5DQYA 4LMVA 5H5RA 1QMVA 1AC1A 3C73A 5IPHA 3M0FA 3EURA 2HRNA 1EV9A 1OYJA 4F0BA 3GRXA 4HQZA 2P31A 1EZKA 1U88A 2DBCA 1XW6A 4CW9A 2OE1A 3V1WA 4FYBA 4EXJA 1TRVA 2VUPA 2XPDA 4PQ1A 2F51A 2HSYA 2F8FA 1FO5A 4IP1A 3CXGA 1GTIA 3RBTA 3IA1A 2C0DA 2R4VA 1SYXA 5ID2A 4TRXA 3A2XA 1E2YA 2TRCP 3L9UA 4N11A 1LBKA 5G5FA 3D6IA 1OC9B 1URMA 3F6DA 4TW5A 5DAKA 3TB2A 1WIKA 2C3NA 3US3A 2R3XA 2C1YA 4YQVA 2GSSA 3M8NA 1FOVA 5DCGA 1JZWA 5ELGA 2VCZA 3IK9A 1KTEA 5AGYA 4EF0A 3HZ8A 1EP8A 1X9WB 3FZAA 3A2VA 2E2MA 5IM9A 4XTSA 1F2EA 2VL9A 4BVXB 1XOBA 3C71A 2Z9SA 1Q4JA 3F8UA 2FD3A 1QK8A 5DJLA 1THXA 3PR8A 4RUVA 5G30A 1AQVA 2HLSA 4IQ1A 3F4TA 1RQMA 5IMCA 1G7EA 5FWGA 4MJAA 2VCTA 3BCKA 4PUFC 2H1BA 1I9DA 2FY6A 3APQA 5HR3A 1QUWA 3EMXA 2L6CA 4I6XA 3O76A 4G0LA 4PUAA 16GSA 1AIUA 3TJJA 2VCQA 1PL1A 4G0IA 3KH9A 3CRTA 3TKSC 1MDJA 4QL7A 4GF0A 4L0WA 3IHQA 2YWIA 1XWKA 3D5JA 5A4VA 2HFDA 2LJAA 2G2QA 2OA7A 4J57E 4IGJA 4GSTA 3TJGA 3KP8A 3M9KA 10GSA 2KOKA 4IBPA 19GSA 4O7HA 1T4YA 1GSQA 1S3DA 5F8BA 4FYUA 4F9ZA 4GQFA 5GZZB 3WT2A 2FGXA 4JU5A 2YN1A 5J5NA 4GWRA 3LEFA 4G10A 1TXXA
chains in the Genus database with same CATH superfamily
5IIZA 4AKHA 4ISDA 4RI6A 3CSHA 5GAPD 2H0GA 2H72A 3IXRA 4XS4A 3DKSA 4EIQA 3D0ZA 3VK9A 4POMA 3DVXA 1VRSD 4MMMA 1GWCA 2R37A 4YAVA 2EIOA 4OD7A 3UEMA 5CAXA 5J41A 1M2BA 3WYWA 4K7IA 3D4MA 4MLYA 1BF5A 5AISA 4WF5A 3LXZA 3PINA 5AIXA 1F37A 3HJOA 3VWVA 3MSZA 4J2FA 1ZZYA 3I9V2 5CRHA 4BPYA 2WULA 1Z5YE 1A0FA 2K8SA 2VLUA 2HYXA 3LFLA 1V40A 1TDIA 2OACA 1OC8A 4HOJA 4EIPA 4BWQA 1ML6A 2MMZA 5DCHA 3I43A 3UL3A 1GUMA 1DSBA 3UBLA 5F07A 1DE1A 1PGTA 4ULXA 3FZ4A 2OE0A 3KTBA 3ERGA 5IO0A 3D21A 4BA7A 2JL4A 3F0IA 5IOXA 5HFKA 5GSTA 4KNDA 2PU9C 3DD3A 4HDEA 2YPMA 3F3QA 4USSA 5A4WA 4J56E 4RI7A 4FXYP 1XIYA 3CQFA 4FH8A 2HSHA 2HE3A 4KGIA 2AAWA 5ECRB 3VI5A 4TR1B 3Q74A 2H0IA 1YKCA 2XBIA 2IFQB 1Z9HA 5ECLB 4RQRA 3GURA 2GTUA 5H5SA 4DSQA 4MNNA 3GL3A 3CYNA 2BTOT 5J9BA 2REMA 1TKDB 5D96A 4L5LA 2K18A 4WR4A 5IPGA 3KGKA 2VM2A 1S3CA 4MPFA 2HZFA 2FWGA 2QA2A 2EFEA 4BIKA 2CZ2A 4DSSB 4JRRA 2X8CA 4WBRD 2IJYA 2NBSA 2FUG2 1QXHA 1X5DA 3KJYA 2HI7A 3GSSA 3J7Yb 3BJ5A 1WRYA 2I81A 1M0UA 1Q98A 2WJUA 5G1KA 2RUEA 2MMNA 4K9ZA 1YY7A 2B7KA 3GNJA 1KNGA 1ZYQB 5HR2A 1SKWB 2VKZG 2PN8A 4MJEA 3TRXA 2H30A 2HSMB 2VLTA 3GIXA 3TKSA 2DIYA 1VGLA 5ENUA 2WDUA 2HSNB 4LL1B 3FYGA 4X1UA 3WGEA 2NVLA 1UC7A 4AGSA 1XCCA 4GQCA 1R4WA 5ABRA 1GTBA 3F63A 2HXKA 5J47A 1AAZA 13GSA 1WJKA 5KN2A 1V9WA 4TR3A 4EUYA 3LQ7A 2KP1A 2JU5A 2C4JA 1VF3A 4K8MA 2DJ1A 2AB6A 2TRXA 2LNTA 3N9JA 1JZOA 3UMAA 2R2JA 1NM3A 1G6YA 2A2RA 3CRUA 1PN9A 2DC5A 1B4QA 2ALBA 3IHGA 2X99A 1NHYA 5DBQA 1PMTA 1GUKA 2CX3A 1Y25A 2YWNA 3HVNA 4ZXGA 2YOIA 1QQ2A 2EFDA 3IE3A 3DYRA 1GULA 3WGDA 1EEJA 2RM5A 3G7IA 1OAZA 1TK8B 1ON4A 4ILFA 3ZITA 6GSSA 1FB6A 4HZ2A 5D93A 6GSYA 4QL9A 1ST9A 3C1SA 5H5QA 1PX6A 3CMIA 4LLRA 12GSA 1XWAA 3VLNA 1F6MC 3QPMA 5IMFA 1TI1A 3FZ5A 3FR6A 3RPNA 1A23A 1UA5A 4ACSA 1XG8A 3F9UA 1A2LA 1EOGA 4YQUA 2I1UA 2HSMA 1RW1A 1GH2A 3U5RE 3KH7A 5A5KA 4GLTA 1YQ1A 1V58A 5ECMB 2LV3A 1GSUA 4ZB7A 3EU3A 4IN0A 4HQSA 2PGTA 3LYKA 4AKXB 1T7PB 3GX0A 1Z7PA 2DKHA 2PVQA 1MDIA 4KDXA 5DALA 5ID2B 2KUCA 2PUKC 1O73A 5A5HB 2KP2A 1YEPA 1Z6NA 2CAQA 3EC3A 1S4BP 1N2AA 4BVYB 3KIJA 1XFLA 1GNEA 2UZ8A 1NW2A 2CX4A 2L4CA 14GSA 3DVWA 3S9FA 3UOMA 5DAKB 1ZYEA 2VL2C 2VD0A 5EL8A 2HRFA 4H86A 3VWWA 1X9MB 2ZUPA 1HQOA 5IO2A 1ILOA 3GTUB 3L78A 4OMVA 2RM6A 3GMFA 2OADA 2P5QA 2B5EA 2ES7A 3AY8A 3APSA 3IV4A 3TDGA 5CRGA 5DDLA 2C0GA 5AIVA 4OFMA 4MCUA 4ICYA 4LL4B 3GYKA 1ACVA 3RAZA 3ZYWA 2LRCA 3G9BA 1TI3A 2DSAA 2L4QA 2YV9A 5ECQB 4POLA 4OFTA 3U6VA 4N0ZA 3ZMLA 1ERWA 1MEKA 3CWGA 5EY6A 2QGVA 4ZB9A 4K1FA 2HRKA 4NPBA 2HZEA 3Q19A 2A4VA 3RPPA 5B8AA 1M3JA 1O8WA 1JFUA 3EPTA 5D9WA 3MIXA 3ZL5A 2DLXA 2TIRA 5ELAA 4NV2A 2DMLA 4AKIA 3UAPA 2IMDA 3P2AA 5F0GA 1EGOA 3GN3A 2H1GA 1JZRA 1ZGNA 4BVYA 3DEXA 2CAIA 3UIWA 1G6WA 1J08A 2LJKA 3ZRDA 2WS2A 3GSTA 4E68A 2H70A 4YKFA 1QFNA 4IP6A 4K7NA 4TR0A 4V2MA 5D73A 2YCDA 4MDCA 3TOTA 2ON5A 3GTUA 4AJ8A 1JZDA 1G0TA 3GKKA 9GSSA 4XS4B 2R0GA 2KHPA 5FT3A 1B8XA 2OJLA 3F4SA 2GZYA 1JHBA 1A2JA 2FA4A 2AHEA 3SBCA 3GH6A 2OKAA 3EMPA 3QAVA 3ZVJA 2LJRA 4BL7A 2R6KA 4DVCA 2GSRA 1SJIA 3RFRC 1X5CA 4PQHA 1USBA 2V1MA 3BOAA 4K5SA 1E6BA 4MZCA 1B48A 4EL1A 1IYHA 2GQLA 1T3BA 4NAXA 2E7PA 2PVOC 2FWEA 3MNGA 3QAGA 2A2SA 1T4ZA 1YZXA 2MMOA 1GRXA 1KEBA 2L5OA 4FO5A 3ERWA 1YVLA 2O36A 1ABAA 4KDUA 4Z2RA 2LTKA 2MYGA 4ZBBA 1M3IA 5CP1A 11GSA 5A34A 1SJZA 1AQXA 1Y6EA 5DQSA 3FZ9A 2WW0A 2LRTA 4NHWA 2WW1A 5IOWA 5C04A 2H6ZA 1SD9A 5ECKB 3TKQA 1K0AA 2X64A 3GKMA 4PURA 2JACA 17GSA 4NV5A 3KD0A 2VL2A 4K2XA 2NTOA 2V32A 4CY6A 4WEYA 3G7YA 2EFCA 5G2ZA 1YKAA 3FY7A 5KN1A 2CZ3A 1M7TA 3F3RA 3GFKA 2JZSA 2IL3A 3C8EA 3FR3A 4EDYA 4G9HA 3VWUA 5IQYA 5CRWA 4ZBDA 2K6VA 2WFCA 4MA9A 2C0FA 1N25A 3LW9A 3RHBA 2X49A 4TN8A 22GSA 2B7JA 1EOHA 2VAFA 4RQXA 5HR0A 5KOXA 2X8HA 1VF2A 1S3RA 2DIZA 4GRFA 5HFGA 1PKWA 1XZOA 3QCPA 4OWYA 1XVWA 3A5WA 4L0UA 1ZYNA 4Q5FA 4MF5A 3HXSA 5G1LA 3QOUA 4PTSA 3KZQA 3RDWA 1U3IA 4NWYA 4N0VA 2RUFA 3ZREA 5E4WA 1SKRB 3DXBA 2P0GA 3UARA 1ZL9A 5IMZA 2H74A 2A4HA 1GTAA 3EINA 1Z6MA 1XW9A 4KCAA 4XS6A 4V2LA 4PNGA 2YJ7A 1M2AA 3LJRA 1YEWC 1O6JA 3CSJA 5IMDA 3IC8A 2DJKA 1AW9A 3K8NA 2B5YA 5DJMA 3F4RA 2O5VA 1OKDA 4YH2A 4ZL9A 1YF0A 4O5QA 3RHCA 1PSQA 1TP9A 1SENA 2NPBA 2BMXA 1HYUA 2MMAA 4O32A 2DJ3A 4Q5RA 3TRPA 2FHEA 5GSSA 3MYDA 1TU8A 3TKPA 4QQ7A 5D9TA 5G5EA 4WF4A 2WCIA 4LA1A 3MWHA 1YDKA 3IOSA 5D9VA 1NHOA 3FKFA 3LWAA 2OBKA 1SL2B 2V2GA 3JCML 4L5OA 1G7OA 4IS0A 4KH7A 4I2TA 4ZL8A 2VL3A 3UVHA 4HJ2A 1XWCA 4L8EA 2VO4A 5LD0A 4HEA2 4TXVA 3HDCA 4HJMA 4POKA 3GHAA 1F3BA 1X0RA 1V2AA 5A4UA 2WB9A 4EDZA 4JZQA 4XCSA 1IYIA 1BX9A 1MD3A 1WOUA 1LU4A 2GS3A 1JLWA 3MAKA 3ZFLA 2EIRA 5BMUA 3HVXA 1R5AA 1XW5A 3GUSA 2GSQA 3QFAC 4X0XA 2GT5A 3KMNA 5JWQB 2EC4A 4TOPA 2VOCA 1TRUA 2LUSA 3IRAA 2DJJA 2JSYA 4LMWA 3QMXA 4KCEA 3CBUA 3LORA 2YZUA 5DALB 2V6OA 4ZIJA 4IQAA 4I8BA 1TK0B 1M9AA 3HCZA 3LGCA 1B9YC 2ON7A 2H6YA 1PL2A 3C1RA 1K0BA 3MDKA 3O6TA 2FWHA 4G0KA 3VFIA 4FQUA 2E2GA 2AYTA 3L9SA 2DMMA 3QAWA 3I69A 2H66A 3HA9A 3TKRA 5LNKe 2LQQA 4K7OA 2FWFA 2QA1A 1O85A 2VLVA 5G31A 3UBKA 1WPIA 3TJBA 3VWXA 4V2NA 4O5UA 3DGQA 4KF9A 2H01A 2I3YA 2L57A 2JADA 4IELA 2IWTA 4WR5A 2CQ9A 3F6FA 4KSMA 2O89A 4I97A 4D73A 2YNXA 1OE7A 2VCWA 1ZCPA 1FHEA 5E59A 5KN0A 3EWLA 2H75A 4WETA 1AXDA 4X43A 1WE0A 3G7JA 4ML6A 2LEGA 3DIEA 1Y1UA 3H79A 3BCIA 2XHFA 1EV4A 4HZ4A 3LXTA 4MF6A 3N5OA 2HRKB 1GNWA 2HZEB 3VPTA 4IW9A 1KBNA 3R3EA 1FG4A 4XRAA 1EWXA 3WD6A 1B9XC 1J9BA 4I5QA 4POBA 2MBTA 1A8LA 3APOA 4IKHA 4GXZA 1A24A 2OBIA 5JCUA 3VURA 2YWMA 1U87A 3CTGA 18GSA 2B3SA 4DSRA 2GQMA 3NZNA 3HVSA 7GSSA 2L59A 3FEUA 1NSWA 1OKTA 1CQHA 1EP7A 2O8VB 2YJHA 4ECIA 3CTFA 3ZMKA 1MDKA 5J9CA 1X9SB 3KCMA 2PWJA 4QMKA 2CT6A 1K0NA 4MZBA 5D8IA 4DEJA 3WGXA 2IMFA 2X8GA 4WKWA 3IC4A 3EVIA 1GP1A 3H8QA 5HR1A 5C00A 2R5GA 2GZZA 2QC7A 4MJBA 2H6XA 4F0CA 1SL0B 4F2IA 1K0OA 3ZTLA 8GSSA 3W6GA 1AQWA 2CVDA 3Q6OA 4MABA 4BL7B 1BYEA 4GCIA 2PBJA 5BRTA 3VI7A 2IPAA 4P3YB 5CYYA 1A8YA 5A1NA 2B1KA 4OFNA 2O3EA 5B6NA 1SKSB 3M9JA 3EU4A 2C8UA 1SK2A 3ZIJA 1W89A 3HVVA 1HNBA 3VPQA 3FHKA 3TRQA 6GSWA 1I1IP 2F9SA 3UJ1A 2ZCTA 4TXOA 1GSEA 1BAYA 3QFBC 5A34B 2VCXA 1O8XA 5B7CA 1TRWA 3IK7A 3TJKA 1PA3A 2EIQA 3KEBA 2FLSA 4PXOA 3TCOA 5IMVA 3HJPA 4AF2A 2LS5A 1SK0A 1LJRA 1SVOA 4KAEA 3L0HA 4ECBA 1YEXA 3IAS2 1RK4A 2O85A 1M99A 3GV1A 1F9MA 3GX8A 5JCWA 4MH2A 4YQMA 2CA8A 3FK8A 4MPGA 2E0QA 3LYPA 3L9VA 4WXTA 2RLIA 1H75A 2GQKA 4O5RA 3L4NA 4G19A 4WBJA 1SVMA 1UN2A 5DVBA 4BWSA 3D4TA 5CO3A 3LG6A 6GSXA 2H1DA 1DBYA 5EVOA 2PMTA 1N8JA 6GSTA 2I9HA 3DWVA 2C3TA 1H4OA 3HJMA 3M1GA 1SK1A 4ML1A 2A2PA 3P8WA 4E8EA 4HU7A 1C72A 5ECIB 3FR9A 4MH3A 1T8EB 4PI0C 1XWBA 3A5IA 2C0EA 4YKGA 4K6XA 3TOUA 3EE2A 2WGRA 1FVKA 4EE0A 2VCVA 4CDOA 1UVZA 1PD21 1HNCA 1TOFA 4F03A 5KOWA 2CV4A 2GSTA 4F82A 2YV7A 4Q5QA 2XPEA 2IN3A 2VIMA 1THOA 3H4KA 3KMOA 2N5FA 4ZB6A 4ZILA 5J3RA 1FVJA 5GAND 4GSSA 2R0PA 1WMJA 2YP6A 4PQIA 3CHXC 3FW2A 2GZPA 1ZOFA 3QDNA 1FW1A 3J7Yk 4CHSA 2J23A 3TKSE 5ECSA 3FRCA 1BQ7A 2VM1A 4JE1A 2G0FA 1BJXA 1TJDA 2H71A 5EPFA 1AUCA 1ERTA 3ZFBA 5ECOB 1OE8A 5ECPB 4K0GA 3LSZA 3IBHA 1VF4A 4N10A 1OC9A 4TVEA 1VF1A 4PX1A 2M72A 1XPVA 1K3LA 1ERVA 1U3AA 4KDYA 3TU3B 3E3EA 2UV8G 4XIHA 3IAM2 2BJXA 4K2DA 3KP9A 2PERA 4FYCA 4KW6A 2HRAA 4Q5NA 2H19A 2YZHA 4CY8A 2KLXA 5JCGA 6GSVA 2XBQA 2MBSA 3KXOA 4IHUA 4EVMA 2L5LA 4OO4A 3HYPA 3QD9A 5JWOB 4BVXA 2V41A 1EGRA 3OR5A 1ZYPA 1TK5B 5D9XA 4AI6A 2HQTA 2GDRA 3PH9A 2N5AA 2AUVA 2L6DA 4JEDA 3HHVA 2H73A 2B6MA 2JZTA 2NDOA 4N30A 5J4UA 5HQPA 2HT9A 1O7UA 5B8BA 3KTLA 5LCZA 1K0DA 2DJ0A 3ED3A 1XXUA 1GUHA 1DE2A 5BMUB 4HU9A 1K3YA 2WW3A 3ISOA 3R2QA 1R26A 2IMEA 2FA8A 4KE3A 1TTZA 2JSZA 2IMKA 3IR4A 1T00A 4AJ7A 4O92A 3I6AA 4ZB8A 4IJIA 1K0MA 3M3MA 5CREA 4JR6A 3W8JA 4GDFA 4KX4A 4EKZA 1U6TA 2WZ9A 5ECNB 2JZRA 3H1NA 3ERFA 4V1Ap 4JR4A 4ECCA 4NHZA 2X4AA 4JBBA 2LQOA 2C3QA 3P90A 5JWRB 1BEDA 1HNAA 1A0RP 1R5PA 3E0UA 3ZLPA 1DUGA 2H76A 3HY2A 1PKZA 5FHIA 3GH9A 2YANA 1PN0A 5F05A 1Z7RA 4D73B 2IIYA 3TUEA 4EC0A 3QR6A 2V6KA 3DRNA 5ECHB 4KSOA 2I4AA 1ERUA 1GSFA 3ME7A 4FIWA 3ZZXA 2H1AA 1GSDA 4MK3A 4ZBAA 1O81A 2VD1A 1M9BA 2O7KA 1PQNA 4Z7XA 3WT1A 5CRDA 2GLRA 3PPUA 1SD8A 4TKYA 3NOFA 1WWJA 2FCHA 4XRDA 4KA0A 4E8HA 2K8VA 3O3TA 3IPZA 2RIIA 1SU9A 4ZL7A 2XC2A 4IJ3A 2AJQB 4K0NA 2M46A 3ZIVA 5J40A 2WZSA 2GVPA 4OO5A 3GKXA 4G01A 3A2WA 3EYTA 2C80A 1SJ6A 1QGVA 1V57A 2WRTA 4MP4A 5F06A 2R0CA 3ZVJD 3HD5A 3BD2A 3GKNA 4Z2TA 1V98A 5L71A 1FB0A 4TR4A 2QKEA 3GA4A 2F8AA 1GTUA 1GSYA 3DMLA 2DKIA 1GL8A 3RGBC 1F3AA 4GTUA 4NXIA 4TR1A 1TW9A 2LRNA 4ECJA 3NIVA 4HI7A 2IFQA 4PHZC 1K0CA 2OT3A 1X5EA 2CVKA 2LKUA 1JLVA 2N5BA 4KUNA 1FOHA 1TRSA 2FNOA 6GSUA 3BBYA 2QSIA 1K3OA 4XHMA 3C7MA 4EO3A 3TGZA 3SWLA 5AN1A 3A3TA 2K9FA 4DSSA 1EEMA 1YJ6A 2HNLA 1XOAA 4G2EA 4X4JA 5A1NB 20GSA 2AV4A 3H93A 2D2ZA 1MTCA 4NMUA 1MD4A 3IDVA 4MZWA 1XVQA 1FAAA 2J9HA 2B1LA 1PRXA 2YWOA 3E9JB 4I2UA 1SL1B 4V1Ag 3W8SA 1OC3A 1PX7A 4IVFA 2CVBA 4TXOB 4HSCX 3FMWA 1Z3EA 1OVNA 5HFIA 5COHA 1GLPA 1XBSA 2EFHA 3ME8A 1GSSA 2OE3A 3HZ4A 4OCFA 2LSTA 1A2MA 2PPTA 2HSNA 2DJ2A 3P7XA 4YAPA 2ZNMA 4KB3A 1SYRA 2GGTA 1M2DA 1WP0A 4OCEA 3GL5A 1BG5A 2GT6A 4MJCA 2LNSA 1J0FA 4XS1A 3UVTA 1CQGA 4ID0A 1R7HA 2M80A 3KM6A 4HUAA 3D22A 2H8LA 2B5XA 1TXUA 1PFOA 1XWGA 2F3MA 1TU7A 2H1LA 2O87A 2H0HA 1ZMAA 3HMJG 5KEJA 4PGTA 4HS1A 5INYA 4PNFA 3HKRA 1GLQA 5B6MA 3TJFA 1T1VA 4AJ6A 5IMAA 1YF1A 2MZCA 2IMIA 1I5GA 3Q18A 1B4PA 4AKGA 5CNWA 3CSIA 5KN3A 3PGTA 4MF7A 2P5RA 1W4VA 4GSNA 1S3AA 1HD2A 5DQYA 4LMVA 5H5RA 1QMVA 1AC1A 3C73A 5IPHA 3M0FA 3EURA 2HRNA 1EV9A 1OYJA 4F0BA 3GRXA 4HQZA 2P31A 1EZKA 1U88A 2DBCA 1XW6A 4CW9A 2OE1A 3V1WA 4FYBA 4EXJA 1TRVA 2VUPA 2WVXB 2XPDA 4PQ1A 2F51A 2HSYA 4PI2C 2F8FA 1FO5A 4IP1A 3CXGA 1GTIA 3RBTA 3IA1A 4A5PA 2C0DA 2R4VA 1SYXA 5ID2A 4TRXA 3A2XA 1E2YA 4K5RA 2TRCP 5A5HA 3L9UA 4N11A 1LBKA 4W66A 5G5FA 3D6IA 1OC9B 1URMA 5J4YA 3F6DA 4N3ZA 4TW5A 5DAKA 3TB2A 1WIKA 2C3NA 3US3A 2R3XA 2C1YA 4YQVA 2WVZA 2GSSA 3M8NA 1FOVA 5DCGA 1JZWA 5ELGA 2VCZA 3IK9A 1KTEA 5AGYA 4EF0A 3HZ8A 1EP8A 1X9WB 3FZAA 3A2VA 2E2MA 5IM9A 4XTSA 2WVYA 1F2EA 2VL9A 4BVXB 1SVLA 1XOBA 3C71A 2Z9SA 1Q4JA 3F8UA 2FD3A 1QK8A 5DJLA 1THXA 3PR8A 4RUVA 5G30A 1AQVA 2HLSA 4IQ1A 3F4TA 1RQMA 5IMCA 4Z2UA 1G7EA 5FWGA 4MJAA 2VCTA 3BCKA 4PUFC 2H1BA 1I9DA 2FY6A 3APQA 5HR3A 1QUWA 2WVXA 3EMXA 2L6CA 4I6XA 3O76A 4G0LA 4PUAA 16GSA 1AIUA 3TJJA 2VCQA 1PL1A 4G0IA 3KH9A 3CRTA 3TKSC 5J4VA 1MDJA 4QL7A 4GF0A 4L0WA 3IHQA 2YWIA 1XWKA 3D5JA 5A4VA 2HFDA 2LJAA 2G2QA 2OA7A 4J57E 4IGJA 4GSTA 3TJGA 2WW2A 3KP8A 3M9KA 10GSA 2KOKA 4IBPA 19GSA 4O7HA 1T4YA 1GSQA 1S3DA 1BG1A 5F8BA 4FYUA 4F9ZA 4GQFA 5GZZB 3WT2A 2FGXA 4JU5A 2YN1A 5J5NA 4GWRA 3LEFA 4G10A 1TXXA
chains in the Genus database with same CATH topology
5IIZA 4AKHA 4ISDA 4RI6A 3CSHA 5GAPD 2H0GA 2H72A 3IXRA 4XS4A 3DKSA 4EIQA 3D0ZA 3VK9A 4POMA 3DVXA 1VRSD 4MMMA 1GWCA 2R37A 4YAVA 2EIOA 4OD7A 3UEMA 5CAXA 5J41A 1M2BA 3WYWA 4K7IA 3D4MA 4MLYA 1BF5A 5AISA 4WF5A 3LXZA 3PINA 5AIXA 1F37A 3HJOA 3VWVA 3MSZA 4J2FA 1ZZYA 3I9V2 5CRHA 4BPYA 2WULA 1Z5YE 1A0FA 2K8SA 2VLUA 2HYXA 3LFLA 1V40A 1TDIA 2OACA 1OC8A 4HOJA 4EIPA 4BWQA 1ML6A 2MMZA 5DCHA 3I43A 3UL3A 1GUMA 1DSBA 3UBLA 5F07A 1DE1A 1PGTA 4ULXA 3FZ4A 2OE0A 3KTBA 3ERGA 5IO0A 3D21A 4BA7A 2JL4A 3F0IA 5IOXA 5HFKA 5GSTA 4KNDA 2PU9C 3DD3A 4HDEA 2YPMA 3F3QA 4USSA 5A4WA 4J56E 4RI7A 1XIYA 4FH8A 2HSHA 2HE3A 4KGIA 2AAWA 5ECRB 3VI5A 4TR1B 3Q74A 2H0IA 1YKCA 2XBIA 2IFQB 1Z9HA 5ECLB 4RQRA 3GURA 2GTUA 5H5SA 4DSQA 4MNNA 3GL3A 3CYNA 2BTOT 5J9BA 2REMA 1TKDB 5D96A 4L5LA 2K18A 4WR4A 5IPGA 3KGKA 2VM2A 1S3CA 4MPFA 2HZFA 2FWGA 2QA2A 2EFEA 2CZ2A 4DSSB 4JRRA 2X8CA 4WBRD 2IJYA 2NBSA 2FUG2 1QXHA 1X5DA 3KJYA 2HI7A 3GSSA 3J7Yb 3BJ5A 1WRYA 2I81A 1M0UA 1Q98A 2WJUA 5G1KA 2RUEA 2MMNA 4K9ZA 1YY7A 2B7KA 3GNJA 1KNGA 1ZYQB 5HR2A 1SKWB 2VKZG 2PN8A 4MJEA 3TRXA 2H30A 2HSMB 2VLTA 3GIXA 3TKSA 2DIYA 1VGLA 5ENUA 2WDUA 2HSNB 4LL1B 3FYGA 4X1UA 3WGEA 2NVLA 1UC7A 4AGSA 1XCCA 4GQCA 1R4WA 5ABRA 1GTBA 3F63A 2HXKA 5J47A 1AAZA 13GSA 1WJKA 5KN2A 1V9WA 4TR3A 4EUYA 3LQ7A 2KP1A 2JU5A 2C4JA 1VF3A 4K8MA 2DJ1A 2AB6A 2TRXA 2LNTA 3N9JA 1JZOA 3UMAA 2R2JA 1NM3A 1G6YA 2A2RA 3CRUA 1PN9A 2DC5A 1B4QA 2ALBA 3IHGA 2X99A 1NHYA 5DBQA 1PMTA 1GUKA 2CX3A 1Y25A 2YWNA 4ZXGA 2YOIA 1QQ2A 2EFDA 3IE3A 3DYRA 1GULA 3WGDA 1EEJA 2RM5A 3G7IA 1OAZA 1TK8B 1ON4A 4ILFA 3ZITA 6GSSA 1FB6A 4HZ2A 5D93A 6GSYA 4QL9A 1ST9A 3C1SA 5H5QA 1PX6A 3CMIA 4LLRA 12GSA 1XWAA 3VLNA 1F6MC 3QPMA 5IMFA 1TI1A 3FZ5A 3FR6A 3RPNA 1A23A 1UA5A 4ACSA 3F9UA 1A2LA 1EOGA 4YQUA 2I1UA 2HSMA 1RW1A 1GH2A 3U5RE 3KH7A 5A5KA 4GLTA 1YQ1A 1V58A 5ECMB 2LV3A 1GSUA 4ZB7A 3EU3A 4IN0A 4HQSA 2PGTA 3LYKA 4AKXB 1T7PB 3GX0A 1Z7PA 2DKHA 2PVQA 1MDIA 4KDXA 5DALA 5ID2B 2KUCA 2PUKC 1O73A 5A5HB 2KP2A 1YEPA 1Z6NA 2CAQA 3EC3A 1N2AA 4BVYB 3KIJA 1XFLA 1GNEA 2UZ8A 1NW2A 2CX4A 2L4CA 14GSA 3DVWA 3S9FA 3UOMA 5DAKB 1ZYEA 2VL2C 2VD0A 5EL8A 2HRFA 4H86A 3VWWA 1X9MB 2ZUPA 1HQOA 5IO2A 1ILOA 3GTUB 3L78A 4OMVA 2RM6A 3GMFA 2OADA 2P5QA 2B5EA 2ES7A 3AY8A 3APSA 3IV4A 3TDGA 5CRGA 5DDLA 2C0GA 5AIVA 4OFMA 4MCUA 4ICYA 4LL4B 3GYKA 1ACVA 3RAZA 3ZYWA 2LRCA 3G9BA 1TI3A 2DSAA 2L4QA 2YV9A 5ECQB 4POLA 4OFTA 3U6VA 4N0ZA 3ZMLA 1ERWA 1MEKA 3CWGA 5EY6A 2QGVA 4ZB9A 4K1FA 2HRKA 4NPBA 2HZEA 3Q19A 2A4VA 3RPPA 5B8AA 1O8WA 1JFUA 3EPTA 5D9WA 3MIXA 3ZL5A 2DLXA 2TIRA 5ELAA 4NV2A 2DMLA 4AKIA 3UAPA 2IMDA 3P2AA 5F0GA 1EGOA 3GN3A 2H1GA 1JZRA 1ZGNA 4BVYA 3DEXA 2CAIA 3UIWA 1G6WA 1J08A 2LJKA 3ZRDA 2WS2A 3GSTA 4E68A 2H70A 4YKFA 1QFNA 4IP6A 4K7NA 4TR0A 4V2MA 5D73A 2YCDA 4MDCA 3TOTA 2ON5A 3GTUA 4AJ8A 1JZDA 1G0TA 3GKKA 9GSSA 4XS4B 2R0GA 2KHPA 5FT3A 1B8XA 2OJLA 3F4SA 2GZYA 1JHBA 1A2JA 2FA4A 2AHEA 3SBCA 3GH6A 2OKAA 3EMPA 3QAVA 3ZVJA 2LJRA 4BL7A 2R6KA 4DVCA 2GSRA 1SJIA 1X5CA 4PQHA 1USBA 2V1MA 3BOAA 4K5SA 1E6BA 4MZCA 1B48A 4EL1A 1IYHA 2GQLA 1T3BA 4NAXA 2E7PA 2PVOC 2FWEA 3MNGA 3QAGA 2A2SA 1T4ZA 1YZXA 2MMOA 1GRXA 1KEBA 2L5OA 4FO5A 3ERWA 1YVLA 1ABAA 4KDUA 4Z2RA 2LTKA 2MYGA 4ZBBA 5CP1A 11GSA 5A34A 1SJZA 1AQXA 1Y6EA 5DQSA 3FZ9A 2LRTA 4NHWA 5IOWA 5C04A 2H6ZA 1SD9A 5ECKB 3TKQA 1K0AA 2X64A 3GKMA 4PURA 2JACA 17GSA 4NV5A 3KD0A 2VL2A 4K2XA 2NTOA 2V32A 4CY6A 4WEYA 3G7YA 2EFCA 5G2ZA 1YKAA 3FY7A 5KN1A 2CZ3A 1M7TA 3F3RA 3GFKA 2JZSA 2IL3A 3C8EA 3FR3A 4EDYA 4G9HA 3VWUA 5IQYA 5CRWA 4ZBDA 2K6VA 2WFCA 4MA9A 2C0FA 1N25A 3LW9A 3RHBA 2X49A 4TN8A 22GSA 2B7JA 1EOHA 2VAFA 4RQXA 5HR0A 5KOXA 2X8HA 1VF2A 2DIZA 4GRFA 5HFGA 1PKWA 1XZOA 3QCPA 4OWYA 1XVWA 3A5WA 4L0UA 1ZYNA 4Q5FA 4MF5A 3HXSA 5G1LA 3QOUA 4PTSA 3KZQA 3RDWA 1U3IA 4NWYA 4N0VA 2RUFA 3ZREA 5E4WA 1SKRB 3DXBA 2P0GA 3UARA 1ZL9A 5IMZA 2H74A 2A4HA 1GTAA 3EINA 1Z6MA 1XW9A 4KCAA 4XS6A 4V2LA 4PNGA 2YJ7A 1M2AA 3LJRA 1O6JA 3CSJA 5IMDA 3IC8A 2DJKA 1AW9A 3K8NA 2B5YA 5DJMA 3F4RA 2O5VA 1OKDA 4YH2A 4ZL9A 1YF0A 4O5QA 3RHCA 1PSQA 1TP9A 1SENA 2NPBA 2BMXA 1HYUA 2MMAA 4O32A 2DJ3A 4Q5RA 3TRPA 2FHEA 5GSSA 3MYDA 1TU8A 3TKPA 4QQ7A 5D9TA 5G5EA 4WF4A 2WCIA 4LA1A 3MWHA 1YDKA 3IOSA 5D9VA 1NHOA 3FKFA 3LWAA 2OBKA 1SL2B 2V2GA 3JCML 4L5OA 1G7OA 4IS0A 4KH7A 4I2TA 4ZL8A 2VL3A 3UVHA 4HJ2A 1XWCA 4L8EA 2VO4A 5LD0A 4HEA2 4TXVA 3HDCA 4HJMA 4POKA 3GHAA 1F3BA 1X0RA 1V2AA 5A4UA 2WB9A 4EDZA 4JZQA 4XCSA 1IYIA 1BX9A 1MD3A 1WOUA 1LU4A 2GS3A 1JLWA 3MAKA 3ZFLA 2EIRA 5BMUA 3HVXA 1R5AA 1XW5A 3GUSA 2GSQA 3QFAC 4X0XA 3KMNA 2GT5A 5JWQB 2EC4A 4TOPA 2VOCA 1TRUA 2LUSA 3IRAA 2DJJA 2JSYA 4LMWA 3QMXA 4KCEA 3CBUA 3LORA 2YZUA 5DALB 2V6OA 4ZIJA 4IQAA 4I8BA 1TK0B 1M9AA 3HCZA 3LGCA 1B9YC 2ON7A 2H6YA 1PL2A 3C1RA 1K0BA 3MDKA 3O6TA 2FWHA 4G0KA 3VFIA 4FQUA 2E2GA 2AYTA 3L9SA 2DMMA 3QAWA 3I69A 2H66A 3HA9A 3TKRA 5LNKe 2LQQA 4K7OA 2FWFA 2QA1A 1O85A 2VLVA 5G31A 3UBKA 1WPIA 3TJBA 3VWXA 4V2NA 4O5UA 3DGQA 4KF9A 2H01A 2I3YA 2L57A 2JADA 4IELA 2IWTA 4WR5A 2CQ9A 3F6FA 4KSMA 2O89A 4I97A 4D73A 2YNXA 1OE7A 2VCWA 1ZCPA 1FHEA 5E59A 5KN0A 3EWLA 2H75A 4WETA 1AXDA 4X43A 1WE0A 3G7JA 4ML6A 2LEGA 3DIEA 1Y1UA 3H79A 3BCIA 2XHFA 1EV4A 4HZ4A 3LXTA 4MF6A 3N5OA 2HRKB 1GNWA 2HZEB 3VPTA 4IW9A 1KBNA 3R3EA 1FG4A 4XRAA 1EWXA 3WD6A 1B9XC 1J9BA 4I5QA 4POBA 2MBTA 1A8LA 3APOA 4IKHA 4GXZA 1A24A 2OBIA 5JCUA 3VURA 2YWMA 1U87A 3CTGA 18GSA 2B3SA 4DSRA 2GQMA 3NZNA 3HVSA 7GSSA 2L59A 3FEUA 1NSWA 1OKTA 1CQHA 1EP7A 2O8VB 2YJHA 4ECIA 3CTFA 3ZMKA 1MDKA 5J9CA 1X9SB 3KCMA 2PWJA 4QMKA 2CT6A 1K0NA 4MZBA 5D8IA 4DEJA 3WGXA 2IMFA 2X8GA 4WKWA 3IC4A 3EVIA 1GP1A 3H8QA 5HR1A 5C00A 2R5GA 2GZZA 2QC7A 4MJBA 2H6XA 4F0CA 1SL0B 4F2IA 1K0OA 3ZTLA 8GSSA 3W6GA 1AQWA 2CVDA 3Q6OA 4MABA 4BL7B 1BYEA 4GCIA 2PBJA 5BRTA 3VI7A 2IPAA 4P3YB 5CYYA 1A8YA 5A1NA 2B1KA 4OFNA 1SKSB 5B6NA 3M9JA 3EU4A 2C8UA 1SK2A 3ZIJA 1W89A 3HVVA 1HNBA 3VPQA 3FHKA 3TRQA 6GSWA 2F9SA 3UJ1A 2ZCTA 4TXOA 1GSEA 1BAYA 3QFBC 5A34B 2VCXA 1O8XA 5B7CA 1TRWA 3IK7A 3TJKA 1PA3A 2EIQA 3KEBA 2FLSA 4PXOA 3TCOA 5IMVA 3HJPA 4AF2A 2LS5A 1SK0A 1LJRA 1SVOA 4KAEA 3L0HA 4ECBA 1YEXA 3IAS2 1RK4A 2O85A 1M99A 3GV1A 1F9MA 3GX8A 5JCWA 4MH2A 4YQMA 2CA8A 3FK8A 4MPGA 2E0QA 3LYPA 3L9VA 4WXTA 2RLIA 1H75A 2GQKA 4O5RA 3L4NA 4G19A 4WBJA 1SVMA 1UN2A 5DVBA 4BWSA 3D4TA 5CO3A 3LG6A 6GSXA 2H1DA 1DBYA 5EVOA 2PMTA 1N8JA 6GSTA 2I9HA 3DWVA 2C3TA 1H4OA 3HJMA 3M1GA 1SK1A 4ML1A 2A2PA 3P8WA 4E8EA 4HU7A 1C72A 5ECIB 3FR9A 4MH3A 1T8EB 1XWBA 3A5IA 2C0EA 4YKGA 4K6XA 3TOUA 3EE2A 2WGRA 1FVKA 4EE0A 2VCVA 4CDOA 1UVZA 1PD21 1HNCA 1TOFA 4F03A 5KOWA 2CV4A 2GSTA 4F82A 2YV7A 4Q5QA 2XPEA 2IN3A 2VIMA 1THOA 3H4KA 3KMOA 2N5FA 4ZB6A 4ZILA 5J3RA 1FVJA 5GAND 4GSSA 2R0PA 1WMJA 2YP6A 4PQIA 3FW2A 2GZPA 1ZOFA 3QDNA 1FW1A 3J7Yk 4CHSA 2J23A 3TKSE 5ECSA 3FRCA 1BQ7A 2VM1A 4JE1A 2G0FA 1BJXA 1TJDA 2H71A 5EPFA 1AUCA 1ERTA 3ZFBA 5ECOB 1OE8A 5ECPB 4K0GA 3LSZA 3IBHA 1VF4A 4N10A 1OC9A 4TVEA 1VF1A 4PX1A 2M72A 1XPVA 1K3LA 1ERVA 1U3AA 4KDYA 3TU3B 3E3EA 2UV8G 4XIHA 3IAM2 2BJXA 4K2DA 3KP9A 2PERA 4FYCA 4KW6A 2HRAA 4Q5NA 2H19A 2YZHA 4CY8A 2KLXA 5JCGA 6GSVA 2XBQA 2MBSA 3KXOA 4IHUA 4EVMA 2L5LA 4OO4A 3HYPA 3QD9A 5JWOB 4BVXA 2V41A 1EGRA 3OR5A 1ZYPA 1TK5B 5D9XA 4AI6A 2HQTA 2GDRA 3PH9A 2N5AA 2AUVA 2L6DA 4JEDA 3HHVA 2H73A 2B6MA 2JZTA 2NDOA 4N30A 5J4UA 5HQPA 2HT9A 1O7UA 5B8BA 3KTLA 5LCZA 1K0DA 2DJ0A 3ED3A 1XXUA 1GUHA 1DE2A 5BMUB 4HU9A 1K3YA 3ISOA 3R2QA 1R26A 2IMEA 2FA8A 4KE3A 1TTZA 2JSZA 2IMKA 3IR4A 1T00A 4AJ7A 4O92A 3I6AA 4ZB8A 4IJIA 1K0MA 3M3MA 5CREA 4JR6A 3W8JA 4GDFA 4KX4A 4EKZA 1U6TA 2WZ9A 5ECNB 2JZRA 3H1NA 3ERFA 4V1Ap 4JR4A 4ECCA 4NHZA 2X4AA 4JBBA 2LQOA 2C3QA 3P90A 5JWRB 1BEDA 1HNAA 1A0RP 1R5PA 3E0UA 3ZLPA 1DUGA 2H76A 3HY2A 1PKZA 5FHIA 3GH9A 2YANA 1PN0A 5F05A 1Z7RA 4D73B 2IIYA 3TUEA 4EC0A 3QR6A 2V6KA 3DRNA 5ECHB 4KSOA 2I4AA 1ERUA 1GSFA 3ME7A 4FIWA 3ZZXA 2H1AA 1GSDA 4MK3A 4ZBAA 1O81A 2VD1A 1M9BA 2O7KA 1PQNA 4Z7XA 3WT1A 5CRDA 2GLRA 3PPUA 1SD8A 4TKYA 3NOFA 1WWJA 2FCHA 4XRDA 4KA0A 4E8HA 2K8VA 3O3TA 3IPZA 2RIIA 1SU9A 4ZL7A 2XC2A 4IJ3A 2AJQB 4K0NA 2M46A 3ZIVA 5J40A 2GVPA 4OO5A 3GKXA 4G01A 3A2WA 3EYTA 2C80A 1SJ6A 1QGVA 1V57A 2WRTA 4MP4A 5F06A 2R0CA 3ZVJD 3HD5A 3BD2A 3GKNA 4Z2TA 1V98A 5L71A 1FB0A 4TR4A 2QKEA 3GA4A 2F8AA 1GTUA 1GSYA 3DMLA 2DKIA 1GL8A 1F3AA 4GTUA 4NXIA 4TR1A 1TW9A 2LRNA 4ECJA 3NIVA 4HI7A 2IFQA 1K0CA 2OT3A 1X5EA 2CVKA 2LKUA 1JLVA 2N5BA 4KUNA 1FOHA 1TRSA 2FNOA 6GSUA 3BBYA 2QSIA 1K3OA 4XHMA 3C7MA 4EO3A 3TGZA 3SWLA 5AN1A 3A3TA 2K9FA 4DSSA 1EEMA 1YJ6A 2HNLA 1XOAA 4G2EA 4X4JA 5A1NB 20GSA 2AV4A 3H93A 2D2ZA 1MTCA 4NMUA 1MD4A 3IDVA 4MZWA 1XVQA 1FAAA 2J9HA 2B1LA 1PRXA 2YWOA 3E9JB 4I2UA 1SL1B 4V1Ag 3W8SA 1OC3A 1PX7A 4IVFA 2CVBA 4TXOB 3FMWA 1Z3EA 1OVNA 5HFIA 5COHA 1GLPA 1XBSA 2EFHA 3ME8A 1GSSA 2OE3A 3HZ4A 4OCFA 2LSTA 1A2MA 2PPTA 2HSNA 2DJ2A 3P7XA 4YAPA 2ZNMA 4KB3A 1SYRA 2GGTA 1M2DA 1WP0A 4OCEA 3GL5A 1BG5A 2GT6A 4MJCA 2LNSA 1J0FA 4XS1A 3UVTA 1CQGA 4ID0A 1R7HA 2M80A 3KM6A 4HUAA 3D22A 2H8LA 2B5XA 1TXUA 1XWGA 2F3MA 1TU7A 2H1LA 2O87A 2H0HA 1ZMAA 3HMJG 5KEJA 4PGTA 4HS1A 5INYA 4PNFA 3HKRA 1GLQA 5B6MA 3TJFA 1T1VA 4AJ6A 5IMAA 1YF1A 2MZCA 2IMIA 1I5GA 3Q18A 1B4PA 4AKGA 5CNWA 3CSIA 5KN3A 3PGTA 4MF7A 2P5RA 1W4VA 4GSNA 1S3AA 1HD2A 5DQYA 4LMVA 5H5RA 1QMVA 1AC1A 3C73A 5IPHA 3M0FA 3EURA 2HRNA 1EV9A 1OYJA 4F0BA 3GRXA 4HQZA 2P31A 1EZKA 1U88A 2DBCA 1XW6A 4CW9A 2OE1A 3V1WA 4FYBA 4EXJA 1TRVA 2VUPA 2XPDA 4PQ1A 2F51A 2HSYA 2F8FA 1FO5A 4IP1A 3CXGA 1GTIA 3RBTA 3IA1A 4A5PA 2C0DA 2R4VA 1SYXA 5ID2A 4TRXA 3A2XA 1E2YA 4K5RA 2TRCP 5A5HA 3L9UA 4N11A 1LBKA 4W66A 5G5FA 3D6IA 1OC9B 1URMA 5J4YA 3F6DA 4N3ZA 4TW5A 5DAKA 3TB2A 1WIKA 2C3NA 3US3A 2R3XA 2C1YA 4YQVA 2GSSA 3M8NA 1FOVA 5DCGA 1JZWA 5ELGA 2VCZA 3IK9A 1KTEA 5AGYA 4EF0A 3HZ8A 1EP8A 1X9WB 3FZAA 3A2VA 2E2MA 5IM9A 4XTSA 1F2EA 2VL9A 4BVXB 1SVLA 1XOBA 3C71A 2Z9SA 1Q4JA 3F8UA 2FD3A 1QK8A 5DJLA 1THXA 3PR8A 4RUVA 5G30A 1AQVA 2HLSA 4IQ1A 3F4TA 1RQMA 5IMCA 4Z2UA 1G7EA 5FWGA 4MJAA 2VCTA 3BCKA 4PUFC 2H1BA 1I9DA 2FY6A 3APQA 5HR3A 1QUWA 3EMXA 2L6CA 4I6XA 3O76A 4G0LA 4PUAA 16GSA 1AIUA 3TJJA 2VCQA 1PL1A 4G0IA 3KH9A 3CRTA 3TKSC 5J4VA 1MDJA 4QL7A 4GF0A 4L0WA 3IHQA 2YWIA 1XWKA 3D5JA 5A4VA 2HFDA 2LJAA 2G2QA 2OA7A 4J57E 4IGJA 4GSTA 3TJGA 3KP8A 3M9KA 10GSA 2KOKA 4IBPA 19GSA 4O7HA 1T4YA 1GSQA 1S3DA 1BG1A 5F8BA 4FYUA 4F9ZA 4GQFA 5GZZB 3WT2A 2FGXA 4JU5A 2YN1A 5J5NA 4GWRA 3LEFA 4G10A 1TXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIZ A;  4ISD A;  4RI6 A;  3CSH A;  5GAP D;  2H0G A;  2H72 A;  3IXR A;  4XS4 A;  3DKS A;  3D0Z A;  3VK9 A;  4POM A;  3DVX A;  1VRS D;  4MMM A;  1GWC A;  2R37 A;  4YAV A;  2EIO A;  4OD7 A;  3UEM A;  5CAX A;  5J41 A;  1M2B A;  3WYW A;  4K7I A;  3D4M A;  4MLY A;  5AIS A;  4WF5 A;  3LXZ A;  3PIN A;  5AIX A;  1F37 A;  3HJO A;  3VWV A;  3MSZ A;  4J2F A;  1ZZY A;  3I9V 2;  5CRH A;  4BPY A;  2WUL A;  1Z5Y E;  1A0F A;  2K8S A;  2VLU A;  2HYX A;  3LFL A;  1V40 A;  1TDI A;  2OAC A;  1OC8 A;  4HOJ A;  4BWQ A;  1ML6 A;  2MMZ A;  5DCH A;  3I43 A;  3UL3 A;  1GUM A;  1DSB A;  3UBL A;  5F07 A;  1DE1 A;  1PGT A;  4ULX A;  3FZ4 A;  2OE0 A;  3KTB A;  3ERG A;  5IO0 A;  3D21 A;  4BA7 A;  2JL4 A;  3F0I A;  5IOX A;  5HFK A;  5GST A;  4KND A;  2PU9 C;  3DD3 A;  4HDE A;  2YPM A;  3F3Q A;  4USS A;  5A4W A;  4J56 E;  4RI7 A;  1XIY A;  4FH8 A;  2HSH A;  2HE3 A;  4KGI A;  2AAW A;  5ECR B;  3VI5 A;  4TR1 B;  3Q74 A;  2H0I A;  1YKC A;  2XBI A;  2IFQ B;  1Z9H A;  5ECL B;  4RQR A;  3GUR A;  2GTU A;  5H5S A;  4DSQ A;  3GL3 A;  3CYN A;  2BTO T;  5J9B A;  2REM A;  1TKD B;  5D96 A;  4L5L A;  2K18 A;  4WR4 A;  5IPG A;  3KGK A;  2VM2 A;  1S3C A;  4MPF A;  2HZF A;  2FWG A;  2CZ2 A;  4DSS B;  4JRR A;  2X8C A;  4WBR D;  2IJY A;  2NBS A;  2FUG 2;  1QXH A;  1X5D A;  3KJY A;  2HI7 A;  3GSS A;  3J7Y b;  3BJ5 A;  1WRY A;  2I81 A;  1M0U A;  1Q98 A;  2WJU A;  5G1K A;  2RUE A;  2MMN A;  4K9Z A;  1YY7 A;  2B7K A;  3GNJ A;  1KNG A;  1ZYQ B;  5HR2 A;  1SKW B;  2PN8 A;  4MJE A;  3TRX A;  2H30 A;  2HSM B;  2VLT A;  3GIX A;  3TKS A;  2DIY A;  1VGL A;  5ENU A;  2WDU A;  2HSN B;  4LL1 B;  3FYG A;  4X1U A;  3WGE A;  2NVL A;  1UC7 A;  4AGS A;  1XCC A;  4GQC A;  1R4W A;  5ABR A;  1GTB A;  3F63 A;  2HXK A;  1AAZ A;  13GS A;  1WJK A;  5KN2 A;  1V9W A;  4TR3 A;  4EUY A;  3LQ7 A;  2KP1 A;  2JU5 A;  2C4J A;  1VF3 A;  4K8M A;  2DJ1 A;  2AB6 A;  2TRX A;  2LNT A;  3N9J A;  1JZO A;  3UMA A;  2R2J A;  1NM3 A;  1G6Y A;  2A2R A;  3CRU A;  1PN9 A;  2DC5 A;  1B4Q A;  2ALB A;  2X99 A;  1NHY A;  5DBQ A;  1PMT A;  1GUK A;  2CX3 A;  1Y25 A;  2YWN A;  4ZXG A;  2YOI A;  1QQ2 A;  3IE3 A;  3DYR A;  1GUL A;  3WGD A;  1EEJ A;  2RM5 A;  3G7I A;  1OAZ A;  1TK8 B;  1ON4 A;  4ILF A;  3ZIT A;  6GSS A;  1FB6 A;  4HZ2 A;  5D93 A;  6GSY A;  4QL9 A;  1ST9 A;  3C1S A;  5H5Q A;  1PX6 A;  3CMI A;  4LLR A;  12GS A;  1XWA A;  3VLN A;  1F6M C;  3QPM A;  5IMF A;  1TI1 A;  3FZ5 A;  3FR6 A;  3RPN A;  1A23 A;  1UA5 A;  4ACS A;  3F9U A;  1A2L A;  1EOG A;  4YQU A;  2I1U A;  2HSM A;  1RW1 A;  1GH2 A;  3U5R E;  3KH7 A;  5A5K A;  4GLT A;  1YQ1 A;  1V58 A;  5ECM B;  2LV3 A;  1GSU A;  3EU3 A;  4IN0 A;  4HQS A;  2PGT A;  3LYK A;  1T7P B;  3GX0 A;  1Z7P A;  2PVQ A;  1MDI A;  4KDX A;  5DAL A;  5ID2 B;  2KUC A;  2PUK C;  1O73 A;  2KP2 A;  1YEP A;  1Z6N A;  2CAQ A;  3EC3 A;  1N2A A;  4BVY B;  3KIJ A;  1XFL A;  1GNE A;  2UZ8 A;  1NW2 A;  2CX4 A;  2L4C A;  14GS A;  3DVW A;  3S9F A;  3UOM A;  5DAK B;  1ZYE A;  2VL2 C;  2VD0 A;  5EL8 A;  2HRF A;  4H86 A;  3VWW A;  1X9M B;  2ZUP A;  1HQO A;  5IO2 A;  1ILO A;  3GTU B;  3L78 A;  4OMV A;  2RM6 A;  3GMF A;  2OAD A;  2P5Q A;  2B5E A;  2ES7 A;  3AY8 A;  3APS A;  3IV4 A;  3TDG A;  5CRG A;  5DDL A;  2C0G A;  5AIV A;  4OFM A;  4MCU A;  4LL4 B;  3GYK A;  1ACV A;  3RAZ A;  3ZYW A;  2LRC A;  3G9B A;  1TI3 A;  2DSA A;  2L4Q A;  2YV9 A;  5ECQ B;  4POL A;  4OFT A;  3U6V A;  4N0Z A;  3ZML A;  1ERW A;  1MEK A;  5EY6 A;  2QGV A;  4ZB9 A;  4K1F A;  2HRK A;  4NPB A;  2HZE A;  3Q19 A;  2A4V A;  3RPP A;  5B8A A;  1O8W A;  1JFU A;  5D9W A;  3ZL5 A;  2DLX A;  2TIR A;  5ELA A;  4NV2 A;  2DML A;  3UAP A;  2IMD A;  3P2A A;  5F0G A;  1EGO A;  3GN3 A;  2H1G A;  1JZR A;  1ZGN A;  4BVY A;  3DEX A;  2CAI A;  3UIW A;  1G6W A;  1J08 A;  2LJK A;  3ZRD A;  2WS2 A;  3GST A;  2H70 A;  1QFN A;  4IP6 A;  4K7N A;  4TR0 A;  4V2M A;  5D73 A;  2YCD A;  4MDC A;  3TOT A;  2ON5 A;  3GTU A;  4AJ8 A;  1JZD A;  1G0T A;  3GKK A;  9GSS A;  4XS4 B;  2KHP A;  5FT3 A;  1B8X A;  2OJL A;  3F4S A;  2GZY A;  1JHB A;  1A2J A;  2FA4 A;  2AHE A;  3SBC A;  3GH6 A;  2OKA A;  3EMP A;  3QAV A;  3ZVJ A;  2LJR A;  4BL7 A;  2R6K A;  4DVC A;  2GSR A;  1SJI A;  1X5C A;  4PQH A;  1USB A;  2V1M A;  3BOA A;  4EL1 A;  1E6B A;  4MZC A;  1B48 A;  1IYH A;  2GQL A;  1T3B A;  4NAX A;  2E7P A;  2PVO C;  2FWE A;  3MNG A;  3QAG A;  2A2S A;  1T4Z A;  1YZX A;  2MMO A;  1GRX A;  1KEB A;  2L5O A;  4FO5 A;  3ERW A;  1ABA A;  4KDU A;  2LTK A;  2MYG A;  4ZBB A;  5CP1 A;  11GS A;  1SJZ A;  1AQX A;  1Y6E A;  5DQS A;  3FZ9 A;  2LRT A;  4NHW A;  5IOW A;  5C04 A;  2H6Z A;  1SD9 A;  5ECK B;  3TKQ A;  1K0A A;  2X64 A;  3GKM A;  4PUR A;  2JAC A;  17GS A;  4NV5 A;  3KD0 A;  2VL2 A;  2NTO A;  2V32 A;  4WEY A;  3G7Y A;  5G2Z A;  1YKA A;  3FY7 A;  5KN1 A;  2CZ3 A;  1M7T A;  3F3R A;  3GFK A;  2JZS A;  2IL3 A;  3C8E A;  3FR3 A;  4EDY A;  4G9H A;  3VWU A;  5IQY A;  5CRW A;  4ZBD A;  2K6V A;  2WFC A;  4MA9 A;  2C0F A;  3RHB A;  4TN8 A;  22GS A;  2B7J A;  1EOH A;  2VAF A;  4RQX A;  5HR0 A;  2X8H A;  1VF2 A;  2DIZ A;  4GRF A;  5HFG A;  1PKW A;  1XZO A;  3QCP A;  4OWY A;  1XVW A;  3A5W A;  4L0U A;  4Q5F A;  4MF5 A;  3HXS A;  5G1L A;  3QOU A;  4PTS A;  3KZQ A;  3RDW A;  1U3I A;  4NWY A;  4N0V A;  2RUF A;  3ZRE A;  5E4W A;  1SKR B;  3DXB A;  2P0G A;  3UAR A;  1ZL9 A;  5IMZ A;  2H74 A;  1GTA A;  3EIN A;  1Z6M A;  1XW9 A;  4KCA A;  4XS6 A;  4V2L A;  4PNG A;  2YJ7 A;  1M2A A;  3LJR A;  1O6J A;  3CSJ A;  5IMD A;  3IC8 A;  2DJK A;  1AW9 A;  3K8N A;  2B5Y A;  5DJM A;  3F4R A;  1OKD A;  4YH2 A;  4ZL9 A;  1YF0 A;  3RHC A;  1PSQ A;  1TP9 A;  1SEN A;  2NPB A;  2BMX A;  1HYU A;  2MMA A;  4O32 A;  2DJ3 A;  4Q5R A;  3TRP A;  2FHE A;  5GSS A;  1TU8 A;  3TKP A;  4QQ7 A;  5D9T A;  5G5E A;  4WF4 A;  2WCI A;  4LA1 A;  3MWH A;  1YDK A;  3IOS A;  5D9V A;  1NHO A;  3FKF A;  3LWA A;  2OBK A;  1SL2 B;  2V2G A;  3JCM L;  4L5O A;  1G7O A;  4IS0 A;  4KH7 A;  4I2T A;  4ZL8 A;  2VL3 A;  3UVH A;  4HJ2 A;  1XWC A;  4L8E A;  2VO4 A;  5LD0 A;  4HEA 2;  4TXV A;  3HDC A;  4HJM A;  4POK A;  3GHA A;  1F3B A;  1X0R A;  1V2A A;  5A4U A;  2WB9 A;  4EDZ A;  4JZQ A;  4XCS A;  1IYI A;  1BX9 A;  1MD3 A;  1WOU A;  1LU4 A;  2GS3 A;  1JLW A;  3MAK A;  3ZFL A;  2EIR A;  5BMU A;  3HVX A;  1R5A A;  1XW5 A;  3GUS A;  2GSQ A;  3QFA C;  4X0X A;  3KMN A;  2GT5 A;  5JWQ B;  2EC4 A;  4TOP A;  2VOC A;  1TRU A;  2LUS A;  3IRA A;  2DJJ A;  2JSY A;  4LMW A;  3QMX A;  4KCE A;  3CBU A;  3LOR A;  2YZU A;  5DAL B;  2V6O A;  4ZIJ A;  4IQA A;  4I8B A;  1TK0 B;  1M9A A;  3HCZ A;  3LGC A;  1B9Y C;  2ON7 A;  2H6Y A;  1PL2 A;  3C1R A;  1K0B A;  3MDK A;  3O6T A;  2FWH A;  4G0K A;  3VFI A;  4FQU A;  2E2G A;  2AYT A;  3L9S A;  2DMM A;  3QAW A;  3I69 A;  2H66 A;  3HA9 A;  3TKR A;  5LNK e;  2LQQ A;  4K7O A;  2FWF A;  1O85 A;  2VLV A;  5G31 A;  3UBK A;  1WPI A;  3TJB A;  3VWX A;  4V2N A;  3DGQ A;  4KF9 A;  2H01 A;  2I3Y A;  2L57 A;  2JAD A;  4IEL A;  2IWT A;  4WR5 A;  2CQ9 A;  3F6F A;  4KSM A;  2O89 A;  4I97 A;  4D73 A;  2YNX A;  1OE7 A;  2VCW A;  1ZCP A;  1FHE A;  5E59 A;  5KN0 A;  3EWL A;  2H75 A;  4WET A;  1AXD A;  4X43 A;  1WE0 A;  3G7J A;  4ML6 A;  2LEG A;  3DIE A;  3H79 A;  3BCI A;  2XHF A;  1EV4 A;  4HZ4 A;  3LXT A;  4MF6 A;  3N5O A;  2HRK B;  1GNW A;  2HZE B;  3VPT A;  4IW9 A;  1KBN A;  3R3E A;  1FG4 A;  4XRA A;  1EWX A;  3WD6 A;  1B9X C;  1J9B A;  4I5Q A;  4POB A;  2MBT A;  1A8L A;  3APO A;  4IKH A;  4GXZ A;  1A24 A;  2OBI A;  5JCU A;  3VUR A;  2YWM A;  1U87 A;  3CTG A;  18GS A;  2B3S A;  4DSR A;  2GQM A;  3NZN A;  3HVS A;  7GSS A;  2L59 A;  3FEU A;  1NSW A;  1OKT A;  1CQH A;  1EP7 A;  2O8V B;  2YJH A;  4ECI A;  3CTF A;  3ZMK A;  1MDK A;  5J9C A;  1X9S B;  3KCM A;  2PWJ A;  2CT6 A;  1K0N A;  4MZB A;  5D8I A;  4DEJ A;  3WGX A;  2IMF A;  2X8G A;  4WKW A;  3IC4 A;  3EVI A;  1GP1 A;  3H8Q A;  5HR1 A;  5C00 A;  2R5G A;  2GZZ A;  2QC7 A;  4MJB A;  2H6X A;  4F0C A;  1SL0 B;  4F2I A;  1K0O A;  3ZTL A;  8GSS A;  3W6G A;  1AQW A;  2CVD A;  3Q6O A;  4MAB A;  4BL7 B;  1BYE A;  4GCI A;  2PBJ A;  3VI7 A;  2IPA A;  4P3Y B;  5CYY A;  1A8Y A;  2B1K A;  4OFN A;  1SKS B;  5B6N A;  3M9J A;  3EU4 A;  2C8U A;  1SK2 A;  3ZIJ A;  1W89 A;  3HVV A;  1HNB A;  3VPQ A;  3FHK A;  3TRQ A;  6GSW A;  2F9S A;  3UJ1 A;  2ZCT A;  4TXO A;  1GSE A;  1BAY A;  3QFB C;  2VCX A;  1O8X A;  5B7C A;  1TRW A;  3IK7 A;  3TJK A;  1PA3 A;  2EIQ A;  3KEB A;  2FLS A;  4PXO A;  3TCO A;  5IMV A;  3HJP A;  4AF2 A;  2LS5 A;  1SK0 A;  1LJR A;  4KAE A;  3L0H A;  4ECB A;  1YEX A;  3IAS 2;  1RK4 A;  2O85 A;  1M99 A;  3GV1 A;  1F9M A;  3GX8 A;  5JCW A;  4MH2 A;  4YQM A;  2CA8 A;  3FK8 A;  4MPG A;  2E0Q A;  3LYP A;  3L9V A;  4WXT A;  2RLI A;  1H75 A;  2GQK A;  4O5R A;  3L4N A;  4G19 A;  4WBJ A;  1UN2 A;  5DVB A;  4BWS A;  3D4T A;  5CO3 A;  3LG6 A;  6GSX A;  2H1D A;  1DBY A;  5EVO A;  2PMT A;  1N8J A;  6GST A;  2I9H A;  3DWV A;  2C3T A;  1H4O A;  3HJM A;  3M1G A;  1SK1 A;  4ML1 A;  3P8W A;  4E8E A;  4HU7 A;  1C72 A;  5ECI B;  3FR9 A;  4MH3 A;  1T8E B;  1XWB A;  2C0E A;  4K6X A;  3TOU A;  3EE2 A;  2WGR A;  1FVK A;  4EE0 A;  2VCV A;  4CDO A;  1UVZ A;  1PD2 1;  1HNC A;  1TOF A;  4F03 A;  2CV4 A;  2GST A;  4F82 A;  2YV7 A;  4Q5Q A;  2XPE A;  2IN3 A;  2VIM A;  1THO A;  3H4K A;  3KMO A;  2N5F A;  4ZB6 A;  4ZIL A;  5J3R A;  1FVJ A;  5GAN D;  4GSS A;  1WMJ A;  2YP6 A;  4PQI A;  3FW2 A;  2GZP A;  1ZOF A;  3QDN A;  1FW1 A;  3J7Y k;  4CHS A;  2J23 A;  3TKS E;  5ECS A;  3FRC A;  1BQ7 A;  2VM1 A;  4JE1 A;  2G0F A;  1BJX A;  1TJD A;  2H71 A;  5EPF A;  1AUC A;  1ERT A;  3ZFB A;  5ECO B;  1OE8 A;  5ECP B;  4K0G A;  3LSZ A;  3IBH A;  1VF4 A;  4N10 A;  1OC9 A;  4TVE A;  1VF1 A;  4PX1 A;  2M72 A;  1XPV A;  1K3L A;  1ERV A;  1U3A A;  4KDY A;  3E3E A;  4XIH A;  3IAM 2;  2BJX A;  4K2D A;  3KP9 A;  2PER A;  4FYC A;  4KW6 A;  2HRA A;  4Q5N A;  2H19 A;  2YZH A;  2KLX A;  5JCG A;  6GSV A;  2XBQ A;  2MBS A;  3KXO A;  4IHU A;  4EVM A;  2L5L A;  4OO4 A;  3HYP A;  3QD9 A;  5JWO B;  4BVX A;  2V41 A;  1EGR A;  3OR5 A;  1TK5 B;  5D9X A;  2HQT A;  2GDR A;  3PH9 A;  2N5A A;  2AUV A;  2L6D A;  4JED A;  3HHV A;  2H73 A;  2B6M A;  2JZT A;  2NDO A;  4N30 A;  5J4U A;  5HQP A;  2HT9 A;  1O7U A;  5B8B A;  3KTL A;  5LCZ A;  1K0D A;  2DJ0 A;  3ED3 A;  1XXU A;  1GUH A;  1DE2 A;  4HU9 A;  1K3Y A;  3ISO A;  3R2Q A;  1R26 A;  2IME A;  2FA8 A;  4KE3 A;  1TTZ A;  2JSZ A;  2IMK A;  3IR4 A;  1T00 A;  4AJ7 A;  4O92 A;  3I6A A;  4ZB8 A;  4IJI A;  1K0M A;  3M3M A;  5CRE A;  4JR6 A;  3W8J A;  4KX4 A;  4EKZ A;  1U6T A;  2WZ9 A;  5ECN B;  2JZR A;  3H1N A;  3ERF A;  4V1A p;  4JR4 A;  4ECC A;  4NHZ A;  4JBB A;  2LQO A;  2C3Q A;  3P90 A;  5JWR B;  1BED A;  1HNA A;  1A0R P;  1R5P A;  3E0U A;  3ZLP A;  1DUG A;  2H76 A;  3HY2 A;  1PKZ A;  5FHI A;  3GH9 A;  2YAN A;  5F05 A;  1Z7R A;  4D73 B;  2IIY A;  3TUE A;  4EC0 A;  3QR6 A;  2V6K A;  3DRN A;  5ECH B;  4KSO A;  2I4A A;  1ERU A;  1GSF A;  3ME7 A;  4FIW A;  3ZZX A;  2H1A A;  1GSD A;  4MK3 A;  4ZBA A;  1O81 A;  2VD1 A;  1M9B A;  2O7K A;  1PQN A;  4Z7X A;  3WT1 A;  5CRD A;  2GLR A;  3PPU A;  1SD8 A;  4TKY A;  3NOF A;  1WWJ A;  2FCH A;  4XRD A;  4KA0 A;  4E8H A;  2K8V A;  3O3T A;  3IPZ A;  2RII A;  1SU9 A;  4ZL7 A;  2XC2 A;  4IJ3 A;  2AJQ B;  4K0N A;  2M46 A;  3ZIV A;  2GVP A;  4OO5 A;  3GKX A;  3A2W A;  3EYT A;  2C80 A;  1SJ6 A;  1QGV A;  1V57 A;  2WRT A;  4MP4 A;  5F06 A;  3ZVJ D;  3HD5 A;  3BD2 A;  3GKN A;  1V98 A;  5L71 A;  1FB0 A;  4TR4 A;  2QKE A;  3GA4 A;  2F8A A;  1GTU A;  1GSY A;  3DML A;  1GL8 A;  1F3A A;  4GTU A;  4NXI A;  4TR1 A;  1TW9 A;  2LRN A;  4ECJ A;  3NIV A;  4HI7 A;  2IFQ A;  1K0C A;  1X5E A;  2CVK A;  2LKU A;  1JLV A;  2N5B A;  4KUN A;  1TRS A;  2FNO A;  6GSU A;  3BBY A;  2QSI A;  1K3O A;  4XHM A;  3C7M A;  4EO3 A;  3TGZ A;  3SWL A;  5AN1 A;  3A3T A;  2K9F A;  4DSS A;  1EEM A;  1YJ6 A;  2HNL A;  1XOA A;  4G2E A;  20GS A;  2AV4 A;  3H93 A;  2D2Z A;  1MTC A;  4NMU A;  1MD4 A;  3IDV A;  4MZW A;  1XVQ A;  1FAA A;  2J9H A;  2B1L A;  1PRX A;  2YWO A;  3E9J B;  4I2U A;  1SL1 B;  4V1A g;  3W8S A;  1OC3 A;  1PX7 A;  4IVF A;  2CVB A;  4TXO B;  1Z3E A;  1OVN A;  5HFI A;  5COH A;  1GLP A;  1XBS A;  3ME8 A;  1GSS A;  2OE3 A;  3HZ4 A;  4OCF A;  2LST A;  1A2M A;  2PPT A;  3P7X A;  2DJ2 A;  4YAP A;  2ZNM A;  4KB3 A;  1SYR A;  2GGT A;  1M2D A;  1WP0 A;  4OCE A;  3GL5 A;  1BG5 A;  2GT6 A;  4MJC A;  2LNS A;  1J0F A;  4XS1 A;  3UVT A;  1CQG A;  4ID0 A;  1R7H A;  2M80 A;  3KM6 A;  4HUA A;  3D22 A;  2H8L A;  2B5X A;  1XWG A;  2F3M A;  1TU7 A;  2O87 A;  2H0H A;  1ZMA A;  5KEJ A;  4PGT A;  4HS1 A;  5INY A;  4PNF A;  3HKR A;  1GLQ A;  5B6M A;  3TJF A;  1T1V A;  4AJ6 A;  5IMA A;  1YF1 A;  2MZC A;  2IMI A;  1I5G A;  3Q18 A;  1B4P A;  5CNW A;  3CSI A;  5KN3 A;  3PGT A;  4MF7 A;  2P5R A;  1W4V A;  4GSN A;  1S3A A;  1HD2 A;  5DQY A;  4LMV A;  5H5R A;  1QMV A;  1AC1 A;  3C73 A;  5IPH A;  3M0F A;  3EUR A;  2HRN A;  1EV9 A;  1OYJ A;  4F0B A;  3GRX A;  4HQZ A;  2P31 A;  1EZK A;  1U88 A;  2DBC A;  1XW6 A;  4CW9 A;  2OE1 A;  3V1W A;  4FYB A;  4EXJ A;  1TRV A;  2VUP A;  2XPD A;  4PQ1 A;  2F51 A;  2HSY A;  2F8F A;  1FO5 A;  4IP1 A;  3CXG A;  1GTI A;  3RBT A;  3IA1 A;  2C0D A;  2R4V A;  1SYX A;  5ID2 A;  4TRX A;  3A2X A;  1E2Y A;  2TRC P;  3L9U A;  4N11 A;  1LBK A;  5G5F A;  3D6I A;  1OC9 B;  1URM A;  3F6D A;  4TW5 A;  5DAK A;  3TB2 A;  1WIK A;  2C3N A;  3US3 A;  2R3X A;  2C1Y A;  4YQV A;  2GSS A;  3M8N A;  1FOV A;  5DCG A;  1JZW A;  5ELG A;  2VCZ A;  3IK9 A;  1KTE A;  5AGY A;  4EF0 A;  3HZ8 A;  1EP8 A;  1X9W B;  3FZA A;  3A2V A;  2E2M A;  5IM9 A;  4XTS A;  1F2E A;  2VL9 A;  4BVX B;  1XOB A;  3C71 A;  2Z9S A;  1Q4J A;  3F8U A;  2FD3 A;  1QK8 A;  5DJL A;  1THX A;  3PR8 A;  4RUV A;  5G30 A;  1AQV A;  2HLS A;  4IQ1 A;  3F4T A;  1RQM A;  5IMC A;  1G7E A;  5FWG A;  4MJA A;  2VCT A;  3BCK A;  4PUF C;  2H1B A;  1I9D A;  2FY6 A;  3APQ A;  5HR3 A;  1QUW A;  3EMX A;  2L6C A;  4I6X A;  3O76 A;  4G0L A;  4PUA A;  16GS A;  1AIU A;  3TJJ A;  2VCQ A;  1PL1 A;  4G0I A;  3KH9 A;  3CRT A;  3TKS C;  1MDJ A;  4QL7 A;  4GF0 A;  4L0W A;  3IHQ A;  2YWI A;  1XWK A;  3D5J A;  5A4V A;  2HFD A;  2LJA A;  2G2Q A;  2OA7 A;  4J57 E;  4IGJ A;  4GST A;  3TJG A;  3KP8 A;  3M9K A;  10GS A;  2KOK A;  4IBP A;  19GS A;  4O7H A;  1T4Y A;  1GSQ A;  1S3D A;  5F8B A;  4FYU A;  4F9Z A;  4GQF A;  5GZZ B;  3WT2 A;  2FGX A;  4JU5 A;  2YN1 A;  5J5N A;  4GWR A;  3LEF A;  4G10 A;  1TXX A; 
#chains in the Genus database with same CATH topology
 5IIZ A;  4AKH A;  4ISD A;  4RI6 A;  3CSH A;  5GAP D;  2H0G A;  2H72 A;  3IXR A;  4XS4 A;  3DKS A;  4EIQ A;  3D0Z A;  3VK9 A;  4POM A;  3DVX A;  1VRS D;  4MMM A;  1GWC A;  2R37 A;  4YAV A;  2EIO A;  4OD7 A;  3UEM A;  5CAX A;  5J41 A;  1M2B A;  3WYW A;  4K7I A;  3D4M A;  4MLY A;  1BF5 A;  5AIS A;  4WF5 A;  3LXZ A;  3PIN A;  5AIX A;  1F37 A;  3HJO A;  3VWV A;  3MSZ A;  4J2F A;  1ZZY A;  3I9V 2;  5CRH A;  4BPY A;  2WUL A;  1Z5Y E;  1A0F A;  2K8S A;  2VLU A;  2HYX A;  3LFL A;  1V40 A;  1TDI A;  2OAC A;  1OC8 A;  4HOJ A;  4EIP A;  4BWQ A;  1ML6 A;  2MMZ A;  5DCH A;  3I43 A;  3UL3 A;  1GUM A;  1DSB A;  3UBL A;  5F07 A;  1DE1 A;  1PGT A;  4ULX A;  3FZ4 A;  2OE0 A;  3KTB A;  3ERG A;  5IO0 A;  3D21 A;  4BA7 A;  2JL4 A;  3F0I A;  5IOX A;  5HFK A;  5GST A;  4KND A;  2PU9 C;  3DD3 A;  4HDE A;  2YPM A;  3F3Q A;  4USS A;  5A4W A;  4J56 E;  4RI7 A;  4FXY P;  1XIY A;  3CQF A;  4FH8 A;  2HSH A;  2HE3 A;  4KGI A;  2AAW A;  5ECR B;  3VI5 A;  4TR1 B;  3Q74 A;  2H0I A;  1YKC A;  2XBI A;  2IFQ B;  1Z9H A;  5ECL B;  4RQR A;  3GUR A;  2GTU A;  5H5S A;  4DSQ A;  4MNN A;  3GL3 A;  3CYN A;  2BTO T;  5J9B A;  2REM A;  1TKD B;  5D96 A;  4L5L A;  2K18 A;  4WR4 A;  5IPG A;  3KGK A;  2VM2 A;  1S3C A;  4MPF A;  2HZF A;  2FWG A;  2QA2 A;  2EFE A;  4BIK A;  2CZ2 A;  4DSS B;  4JRR A;  2X8C A;  4WBR D;  2IJY A;  2NBS A;  2FUG 2;  1QXH A;  1X5D A;  3KJY A;  2HI7 A;  3GSS A;  3J7Y b;  3BJ5 A;  1WRY A;  2I81 A;  1M0U A;  1Q98 A;  2WJU A;  5G1K A;  2RUE A;  2MMN A;  4K9Z A;  1YY7 A;  2B7K A;  3GNJ A;  1KNG A;  1ZYQ B;  5HR2 A;  1SKW B;  2VKZ G;  2PN8 A;  4MJE A;  3TRX A;  2H30 A;  2HSM B;  2VLT A;  3GIX A;  3TKS A;  2DIY A;  1VGL A;  5ENU A;  2WDU A;  2HSN B;  4LL1 B;  3FYG A;  4X1U A;  3WGE A;  2NVL A;  1UC7 A;  4AGS A;  1XCC A;  4GQC A;  1R4W A;  5ABR A;  1GTB A;  3F63 A;  2HXK A;  5J47 A;  1AAZ A;  13GS A;  1WJK A;  5KN2 A;  1V9W A;  4TR3 A;  4EUY A;  3LQ7 A;  2KP1 A;  2JU5 A;  2C4J A;  1VF3 A;  4K8M A;  2DJ1 A;  2AB6 A;  2TRX A;  2LNT A;  3N9J A;  1JZO A;  3UMA A;  2R2J A;  1NM3 A;  1G6Y A;  2A2R A;  3CRU A;  1PN9 A;  2DC5 A;  1B4Q A;  2ALB A;  3IHG A;  2X99 A;  1NHY A;  5DBQ A;  1PMT A;  1GUK A;  2CX3 A;  1Y25 A;  2YWN A;  3HVN A;  4ZXG A;  2YOI A;  1QQ2 A;  2EFD A;  3IE3 A;  3DYR A;  1GUL A;  3WGD A;  1EEJ A;  2RM5 A;  3G7I A;  1OAZ A;  1TK8 B;  1ON4 A;  4ILF A;  3ZIT A;  6GSS A;  1FB6 A;  4HZ2 A;  5D93 A;  6GSY A;  4QL9 A;  1ST9 A;  3C1S A;  5H5Q A;  1PX6 A;  3CMI A;  4LLR A;  12GS A;  1XWA A;  3VLN A;  1F6M C;  3QPM A;  5IMF A;  1TI1 A;  3FZ5 A;  3FR6 A;  3RPN A;  1A23 A;  1UA5 A;  4ACS A;  1XG8 A;  3F9U A;  1A2L A;  1EOG A;  4YQU A;  2I1U A;  2HSM A;  1RW1 A;  1GH2 A;  3U5R E;  3KH7 A;  5A5K A;  4GLT A;  1YQ1 A;  1V58 A;  5ECM B;  2LV3 A;  1GSU A;  4ZB7 A;  3EU3 A;  4IN0 A;  4HQS A;  2PGT A;  3LYK A;  4AKX B;  1T7P B;  3GX0 A;  1Z7P A;  2DKH A;  2PVQ A;  1MDI A;  4KDX A;  5DAL A;  5ID2 B;  2KUC A;  2PUK C;  1O73 A;  5A5H B;  2KP2 A;  1YEP A;  1Z6N A;  2CAQ A;  3EC3 A;  1S4B P;  1N2A A;  4BVY B;  3KIJ A;  1XFL A;  1GNE A;  2UZ8 A;  1NW2 A;  2CX4 A;  2L4C A;  14GS A;  3DVW A;  3S9F A;  3UOM A;  5DAK B;  1ZYE A;  2VL2 C;  2VD0 A;  5EL8 A;  2HRF A;  4H86 A;  3VWW A;  1X9M B;  2ZUP A;  1HQO A;  5IO2 A;  1ILO A;  3GTU B;  3L78 A;  4OMV A;  2RM6 A;  3GMF A;  2OAD A;  2P5Q A;  2B5E A;  2ES7 A;  3AY8 A;  3APS A;  3IV4 A;  3TDG A;  5CRG A;  5DDL A;  2C0G A;  5AIV A;  4OFM A;  4MCU A;  4ICY A;  4LL4 B;  3GYK A;  1ACV A;  3RAZ A;  3ZYW A;  2LRC A;  3G9B A;  1TI3 A;  2DSA A;  2L4Q A;  2YV9 A;  5ECQ B;  4POL A;  4OFT A;  3U6V A;  4N0Z A;  3ZML A;  1ERW A;  1MEK A;  3CWG A;  5EY6 A;  2QGV A;  4ZB9 A;  4K1F A;  2HRK A;  4NPB A;  2HZE A;  3Q19 A;  2A4V A;  3RPP A;  5B8A A;  1M3J A;  1O8W A;  1JFU A;  3EPT A;  5D9W A;  3MIX A;  3ZL5 A;  2DLX A;  2TIR A;  5ELA A;  4NV2 A;  2DML A;  4AKI A;  3UAP A;  2IMD A;  3P2A A;  5F0G A;  1EGO A;  3GN3 A;  2H1G A;  1JZR A;  1ZGN A;  4BVY A;  3DEX A;  2CAI A;  3UIW A;  1G6W A;  1J08 A;  2LJK A;  3ZRD A;  2WS2 A;  3GST A;  4E68 A;  2H70 A;  4YKF A;  1QFN A;  4IP6 A;  4K7N A;  4TR0 A;  4V2M A;  5D73 A;  2YCD A;  4MDC A;  3TOT A;  2ON5 A;  3GTU A;  4AJ8 A;  1JZD A;  1G0T A;  3GKK A;  9GSS A;  4XS4 B;  2R0G A;  2KHP A;  5FT3 A;  1B8X A;  2OJL A;  3F4S A;  2GZY A;  1JHB A;  1A2J A;  2FA4 A;  2AHE A;  3SBC A;  3GH6 A;  2OKA A;  3EMP A;  3QAV A;  3ZVJ A;  2LJR A;  4BL7 A;  2R6K A;  4DVC A;  2GSR A;  1SJI A;  3RFR C;  1X5C A;  4PQH A;  1USB A;  2V1M A;  3BOA A;  4K5S A;  1E6B A;  4MZC A;  1B48 A;  4EL1 A;  1IYH A;  2GQL A;  1T3B A;  4NAX A;  2E7P A;  2PVO C;  2FWE A;  3MNG A;  3QAG A;  2A2S A;  1T4Z A;  1YZX A;  2MMO A;  1GRX A;  1KEB A;  2L5O A;  4FO5 A;  3ERW A;  1YVL A;  2O36 A;  1ABA A;  4KDU A;  4Z2R A;  2LTK A;  2MYG A;  4ZBB A;  1M3I A;  5CP1 A;  11GS A;  5A34 A;  1SJZ A;  1AQX A;  1Y6E A;  5DQS A;  3FZ9 A;  2WW0 A;  2LRT A;  4NHW A;  2WW1 A;  5IOW A;  5C04 A;  2H6Z A;  1SD9 A;  5ECK B;  3TKQ A;  1K0A A;  2X64 A;  3GKM A;  4PUR A;  2JAC A;  17GS A;  4NV5 A;  3KD0 A;  2VL2 A;  4K2X A;  2NTO A;  2V32 A;  4CY6 A;  4WEY A;  3G7Y A;  2EFC A;  5G2Z A;  1YKA A;  3FY7 A;  5KN1 A;  2CZ3 A;  1M7T A;  3F3R A;  3GFK A;  2JZS A;  2IL3 A;  3C8E A;  3FR3 A;  4EDY A;  4G9H A;  3VWU A;  5IQY A;  5CRW A;  4ZBD A;  2K6V A;  2WFC A;  4MA9 A;  2C0F A;  1N25 A;  3LW9 A;  3RHB A;  2X49 A;  4TN8 A;  22GS A;  2B7J A;  1EOH A;  2VAF A;  4RQX A;  5HR0 A;  5KOX A;  2X8H A;  1VF2 A;  1S3R A;  2DIZ A;  4GRF A;  5HFG A;  1PKW A;  1XZO A;  3QCP A;  4OWY A;  1XVW A;  3A5W A;  4L0U A;  1ZYN A;  4Q5F A;  4MF5 A;  3HXS A;  5G1L A;  3QOU A;  4PTS A;  3KZQ A;  3RDW A;  1U3I A;  4NWY A;  4N0V A;  2RUF A;  3ZRE A;  5E4W A;  1SKR B;  3DXB A;  2P0G A;  3UAR A;  1ZL9 A;  5IMZ A;  2H74 A;  2A4H A;  1GTA A;  3EIN A;  1Z6M A;  1XW9 A;  4KCA A;  4XS6 A;  4V2L A;  4PNG A;  2YJ7 A;  1M2A A;  3LJR A;  1YEW C;  1O6J A;  3CSJ A;  5IMD A;  3IC8 A;  2DJK A;  1AW9 A;  3K8N A;  2B5Y A;  5DJM A;  3F4R A;  2O5V A;  1OKD A;  4YH2 A;  4ZL9 A;  1YF0 A;  4O5Q A;  3RHC A;  1PSQ A;  1TP9 A;  1SEN A;  2NPB A;  2BMX A;  1HYU A;  2MMA A;  4O32 A;  2DJ3 A;  4Q5R A;  3TRP A;  2FHE A;  5GSS A;  3MYD A;  1TU8 A;  3TKP A;  4QQ7 A;  5D9T A;  5G5E A;  4WF4 A;  2WCI A;  4LA1 A;  3MWH A;  1YDK A;  3IOS A;  5D9V A;  1NHO A;  3FKF A;  3LWA A;  2OBK A;  1SL2 B;  2V2G A;  3JCM L;  4L5O A;  1G7O A;  4IS0 A;  4KH7 A;  4I2T A;  4ZL8 A;  2VL3 A;  3UVH A;  4HJ2 A;  1XWC A;  4L8E A;  2VO4 A;  5LD0 A;  4HEA 2;  4TXV A;  3HDC A;  4HJM A;  4POK A;  3GHA A;  1F3B A;  1X0R A;  1V2A A;  5A4U A;  2WB9 A;  4EDZ A;  4JZQ A;  4XCS A;  1IYI A;  1BX9 A;  1MD3 A;  1WOU A;  1LU4 A;  2GS3 A;  1JLW A;  3MAK A;  3ZFL A;  2EIR A;  5BMU A;  3HVX A;  1R5A A;  1XW5 A;  3GUS A;  2GSQ A;  3QFA C;  4X0X A;  2GT5 A;  3KMN A;  5JWQ B;  2EC4 A;  4TOP A;  2VOC A;  1TRU A;  2LUS A;  3IRA A;  2DJJ A;  2JSY A;  4LMW A;  3QMX A;  4KCE A;  3CBU A;  3LOR A;  2YZU A;  5DAL B;  2V6O A;  4ZIJ A;  4IQA A;  4I8B A;  1TK0 B;  1M9A A;  3HCZ A;  3LGC A;  1B9Y C;  2ON7 A;  2H6Y A;  1PL2 A;  3C1R A;  1K0B A;  3MDK A;  3O6T A;  2FWH A;  4G0K A;  3VFI A;  4FQU A;  2E2G A;  2AYT A;  3L9S A;  2DMM A;  3QAW A;  3I69 A;  2H66 A;  3HA9 A;  3TKR A;  5LNK e;  2LQQ A;  4K7O A;  2FWF A;  2QA1 A;  1O85 A;  2VLV A;  5G31 A;  3UBK A;  1WPI A;  3TJB A;  3VWX A;  4V2N A;  4O5U A;  3DGQ A;  4KF9 A;  2H01 A;  2I3Y A;  2L57 A;  2JAD A;  4IEL A;  2IWT A;  4WR5 A;  2CQ9 A;  3F6F A;  4KSM A;  2O89 A;  4I97 A;  4D73 A;  2YNX A;  1OE7 A;  2VCW A;  1ZCP A;  1FHE A;  5E59 A;  5KN0 A;  3EWL A;  2H75 A;  4WET A;  1AXD A;  4X43 A;  1WE0 A;  3G7J A;  4ML6 A;  2LEG A;  3DIE A;  1Y1U A;  3H79 A;  3BCI A;  2XHF A;  1EV4 A;  4HZ4 A;  3LXT A;  4MF6 A;  3N5O A;  2HRK B;  1GNW A;  2HZE B;  3VPT A;  4IW9 A;  1KBN A;  3R3E A;  1FG4 A;  4XRA A;  1EWX A;  3WD6 A;  1B9X C;  1J9B A;  4I5Q A;  4POB A;  2MBT A;  1A8L A;  3APO A;  4IKH A;  4GXZ A;  1A24 A;  2OBI A;  5JCU A;  3VUR A;  2YWM A;  1U87 A;  3CTG A;  18GS A;  2B3S A;  4DSR A;  2GQM A;  3NZN A;  3HVS A;  7GSS A;  2L59 A;  3FEU A;  1NSW A;  1OKT A;  1CQH A;  1EP7 A;  2O8V B;  2YJH A;  4ECI A;  3CTF A;  3ZMK A;  1MDK A;  5J9C A;  1X9S B;  3KCM A;  2PWJ A;  4QMK A;  2CT6 A;  1K0N A;  4MZB A;  5D8I A;  4DEJ A;  3WGX A;  2IMF A;  2X8G A;  4WKW A;  3IC4 A;  3EVI A;  1GP1 A;  3H8Q A;  5HR1 A;  5C00 A;  2R5G A;  2GZZ A;  2QC7 A;  4MJB A;  2H6X A;  4F0C A;  1SL0 B;  4F2I A;  1K0O A;  3ZTL A;  8GSS A;  3W6G A;  1AQW A;  2CVD A;  3Q6O A;  4MAB A;  4BL7 B;  1BYE A;  4GCI A;  2PBJ A;  5BRT A;  3VI7 A;  2IPA A;  4P3Y B;  5CYY A;  1A8Y A;  5A1N A;  2B1K A;  4OFN A;  2O3E A;  5B6N A;  1SKS B;  3M9J A;  3EU4 A;  2C8U A;  1SK2 A;  3ZIJ A;  1W89 A;  3HVV A;  1HNB A;  3VPQ A;  3FHK A;  3TRQ A;  6GSW A;  1I1I P;  2F9S A;  3UJ1 A;  2ZCT A;  4TXO A;  1GSE A;  1BAY A;  3QFB C;  5A34 B;  2VCX A;  1O8X A;  5B7C A;  1TRW A;  3IK7 A;  3TJK A;  1PA3 A;  2EIQ A;  3KEB A;  2FLS A;  4PXO A;  3TCO A;  5IMV A;  3HJP A;  4AF2 A;  2LS5 A;  1SK0 A;  1LJR A;  1SVO A;  4KAE A;  3L0H A;  4ECB A;  1YEX A;  3IAS 2;  1RK4 A;  2O85 A;  1M99 A;  3GV1 A;  1F9M A;  3GX8 A;  5JCW A;  4MH2 A;  4YQM A;  2CA8 A;  3FK8 A;  4MPG A;  2E0Q A;  3LYP A;  3L9V A;  4WXT A;  2RLI A;  1H75 A;  2GQK A;  4O5R A;  3L4N A;  4G19 A;  4WBJ A;  1SVM A;  1UN2 A;  5DVB A;  4BWS A;  3D4T A;  5CO3 A;  3LG6 A;  6GSX A;  2H1D A;  1DBY A;  5EVO A;  2PMT A;  1N8J A;  6GST A;  2I9H A;  3DWV A;  2C3T A;  1H4O A;  3HJM A;  3M1G A;  1SK1 A;  4ML1 A;  2A2P A;  3P8W A;  4E8E A;  4HU7 A;  1C72 A;  5ECI B;  3FR9 A;  4MH3 A;  1T8E B;  4PI0 C;  1XWB A;  3A5I A;  2C0E A;  4YKG A;  4K6X A;  3TOU A;  3EE2 A;  2WGR A;  1FVK A;  4EE0 A;  2VCV A;  4CDO A;  1UVZ A;  1PD2 1;  1HNC A;  1TOF A;  4F03 A;  5KOW A;  2CV4 A;  2GST A;  4F82 A;  2YV7 A;  4Q5Q A;  2XPE A;  2IN3 A;  2VIM A;  1THO A;  3H4K A;  3KMO A;  2N5F A;  4ZB6 A;  4ZIL A;  5J3R A;  1FVJ A;  5GAN D;  4GSS A;  2R0P A;  1WMJ A;  2YP6 A;  4PQI A;  3CHX C;  3FW2 A;  2GZP A;  1ZOF A;  3QDN A;  1FW1 A;  3J7Y k;  4CHS A;  2J23 A;  3TKS E;  5ECS A;  3FRC A;  1BQ7 A;  2VM1 A;  4JE1 A;  2G0F A;  1BJX A;  1TJD A;  2H71 A;  5EPF A;  1AUC A;  1ERT A;  3ZFB A;  5ECO B;  1OE8 A;  5ECP B;  4K0G A;  3LSZ A;  3IBH A;  1VF4 A;  4N10 A;  1OC9 A;  4TVE A;  1VF1 A;  4PX1 A;  2M72 A;  1XPV A;  1K3L A;  1ERV A;  1U3A A;  4KDY A;  3TU3 B;  3E3E A;  2UV8 G;  4XIH A;  3IAM 2;  2BJX A;  4K2D A;  3KP9 A;  2PER A;  4FYC A;  4KW6 A;  2HRA A;  4Q5N A;  2H19 A;  2YZH A;  4CY8 A;  2KLX A;  5JCG A;  6GSV A;  2XBQ A;  2MBS A;  3KXO A;  4IHU A;  4EVM A;  2L5L A;  4OO4 A;  3HYP A;  3QD9 A;  5JWO B;  4BVX A;  2V41 A;  1EGR A;  3OR5 A;  1ZYP A;  1TK5 B;  5D9X A;  4AI6 A;  2HQT A;  2GDR A;  3PH9 A;  2N5A A;  2AUV A;  2L6D A;  4JED A;  3HHV A;  2H73 A;  2B6M A;  2JZT A;  2NDO A;  4N30 A;  5J4U A;  5HQP A;  2HT9 A;  1O7U A;  5B8B A;  3KTL A;  5LCZ A;  1K0D A;  2DJ0 A;  3ED3 A;  1XXU A;  1GUH A;  1DE2 A;  5BMU B;  4HU9 A;  1K3Y A;  2WW3 A;  3ISO A;  3R2Q A;  1R26 A;  2IME A;  2FA8 A;  4KE3 A;  1TTZ A;  2JSZ A;  2IMK A;  3IR4 A;  1T00 A;  4AJ7 A;  4O92 A;  3I6A A;  4ZB8 A;  4IJI A;  1K0M A;  3M3M A;  5CRE A;  4JR6 A;  3W8J A;  4GDF A;  4KX4 A;  4EKZ A;  1U6T A;  2WZ9 A;  5ECN B;  2JZR A;  3H1N A;  3ERF A;  4V1A p;  4JR4 A;  4ECC A;  4NHZ A;  2X4A A;  4JBB A;  2LQO A;  2C3Q A;  3P90 A;  5JWR B;  1BED A;  1HNA A;  1A0R P;  1R5P A;  3E0U A;  3ZLP A;  1DUG A;  2H76 A;  3HY2 A;  1PKZ A;  5FHI A;  3GH9 A;  2YAN A;  1PN0 A;  5F05 A;  1Z7R A;  4D73 B;  2IIY A;  3TUE A;  4EC0 A;  3QR6 A;  2V6K A;  3DRN A;  5ECH B;  4KSO A;  2I4A A;  1ERU A;  1GSF A;  3ME7 A;  4FIW A;  3ZZX A;  2H1A A;  1GSD A;  4MK3 A;  4ZBA A;  1O81 A;  2VD1 A;  1M9B A;  2O7K A;  1PQN A;  4Z7X A;  3WT1 A;  5CRD A;  2GLR A;  3PPU A;  1SD8 A;  4TKY A;  3NOF A;  1WWJ A;  2FCH A;  4XRD A;  4KA0 A;  4E8H A;  2K8V A;  3O3T A;  3IPZ A;  2RII A;  1SU9 A;  4ZL7 A;  2XC2 A;  4IJ3 A;  2AJQ B;  4K0N A;  2M46 A;  3ZIV A;  5J40 A;  2WZS A;  2GVP A;  4OO5 A;  3GKX A;  4G01 A;  3A2W A;  3EYT A;  2C80 A;  1SJ6 A;  1QGV A;  1V57 A;  2WRT A;  4MP4 A;  5F06 A;  2R0C A;  3ZVJ D;  3HD5 A;  3BD2 A;  3GKN A;  4Z2T A;  1V98 A;  5L71 A;  1FB0 A;  4TR4 A;  2QKE A;  3GA4 A;  2F8A A;  1GTU A;  1GSY A;  3DML A;  2DKI A;  1GL8 A;  3RGB C;  1F3A A;  4GTU A;  4NXI A;  4TR1 A;  1TW9 A;  2LRN A;  4ECJ A;  3NIV A;  4HI7 A;  2IFQ A;  4PHZ C;  1K0C A;  2OT3 A;  1X5E A;  2CVK A;  2LKU A;  1JLV A;  2N5B A;  4KUN A;  1FOH A;  1TRS A;  2FNO A;  6GSU A;  3BBY A;  2QSI A;  1K3O A;  4XHM A;  3C7M A;  4EO3 A;  3TGZ A;  3SWL A;  5AN1 A;  3A3T A;  2K9F A;  4DSS A;  1EEM A;  1YJ6 A;  2HNL A;  1XOA A;  4G2E A;  4X4J A;  5A1N B;  20GS A;  2AV4 A;  3H93 A;  2D2Z A;  1MTC A;  4NMU A;  1MD4 A;  3IDV A;  4MZW A;  1XVQ A;  1FAA A;  2J9H A;  2B1L A;  1PRX A;  2YWO A;  3E9J B;  4I2U A;  1SL1 B;  4V1A g;  3W8S A;  1OC3 A;  1PX7 A;  4IVF A;  2CVB A;  4TXO B;  4HSC X;  3FMW A;  1Z3E A;  1OVN A;  5HFI A;  5COH A;  1GLP A;  1XBS A;  2EFH A;  3ME8 A;  1GSS A;  2OE3 A;  3HZ4 A;  4OCF A;  2LST A;  1A2M A;  2PPT A;  2HSN A;  2DJ2 A;  3P7X A;  4YAP A;  2ZNM A;  4KB3 A;  1SYR A;  2GGT A;  1M2D A;  1WP0 A;  4OCE A;  3GL5 A;  1BG5 A;  2GT6 A;  4MJC A;  2LNS A;  1J0F A;  4XS1 A;  3UVT A;  1CQG A;  4ID0 A;  1R7H A;  2M80 A;  3KM6 A;  4HUA A;  3D22 A;  2H8L A;  2B5X A;  1TXU A;  1PFO A;  1XWG A;  2F3M A;  1TU7 A;  2H1L A;  2O87 A;  2H0H A;  1ZMA A;  3HMJ G;  5KEJ A;  4PGT A;  4HS1 A;  5INY A;  4PNF A;  3HKR A;  1GLQ A;  5B6M A;  3TJF A;  1T1V A;  4AJ6 A;  5IMA A;  1YF1 A;  2MZC A;  2IMI A;  1I5G A;  3Q18 A;  1B4P A;  4AKG A;  5CNW A;  3CSI A;  5KN3 A;  3PGT A;  4MF7 A;  2P5R A;  1W4V A;  4GSN A;  1S3A A;  1HD2 A;  5DQY A;  4LMV A;  5H5R A;  1QMV A;  1AC1 A;  3C73 A;  5IPH A;  3M0F A;  3EUR A;  2HRN A;  1EV9 A;  1OYJ A;  4F0B A;  3GRX A;  4HQZ A;  2P31 A;  1EZK A;  1U88 A;  2DBC A;  1XW6 A;  4CW9 A;  2OE1 A;  3V1W A;  4FYB A;  4EXJ A;  1TRV A;  2VUP A;  2WVX B;  2XPD A;  4PQ1 A;  2F51 A;  2HSY A;  4PI2 C;  2F8F A;  1FO5 A;  4IP1 A;  3CXG A;  1GTI A;  3RBT A;  3IA1 A;  4A5P A;  2C0D A;  2R4V A;  1SYX A;  5ID2 A;  4TRX A;  3A2X A;  1E2Y A;  4K5R A;  2TRC P;  5A5H A;  3L9U A;  4N11 A;  1LBK A;  4W66 A;  5G5F A;  3D6I A;  1OC9 B;  1URM A;  5J4Y A;  3F6D A;  4N3Z A;  4TW5 A;  5DAK A;  3TB2 A;  1WIK A;  2C3N A;  3US3 A;  2R3X A;  2C1Y A;  4YQV A;  2WVZ A;  2GSS A;  3M8N A;  1FOV A;  5DCG A;  1JZW A;  5ELG A;  2VCZ A;  3IK9 A;  1KTE A;  5AGY A;  4EF0 A;  3HZ8 A;  1EP8 A;  1X9W B;  3FZA A;  3A2V A;  2E2M A;  5IM9 A;  4XTS A;  2WVY A;  1F2E A;  2VL9 A;  4BVX B;  1SVL A;  1XOB A;  3C71 A;  2Z9S A;  1Q4J A;  3F8U A;  2FD3 A;  1QK8 A;  5DJL A;  1THX A;  3PR8 A;  4RUV A;  5G30 A;  1AQV A;  2HLS A;  4IQ1 A;  3F4T A;  1RQM A;  5IMC A;  4Z2U A;  1G7E A;  5FWG A;  4MJA A;  2VCT A;  3BCK A;  4PUF C;  2H1B A;  1I9D A;  2FY6 A;  3APQ A;  5HR3 A;  1QUW A;  2WVX A;  3EMX A;  2L6C A;  4I6X A;  3O76 A;  4G0L A;  4PUA A;  16GS A;  1AIU A;  3TJJ A;  2VCQ A;  1PL1 A;  4G0I A;  3KH9 A;  3CRT A;  3TKS C;  5J4V A;  1MDJ A;  4QL7 A;  4GF0 A;  4L0W A;  3IHQ A;  2YWI A;  1XWK A;  3D5J A;  5A4V A;  2HFD A;  2LJA A;  2G2Q A;  2OA7 A;  4J57 E;  4IGJ A;  4GST A;  3TJG A;  2WW2 A;  3KP8 A;  3M9K A;  10GS A;  2KOK A;  4IBP A;  19GS A;  4O7H A;  1T4Y A;  1GSQ A;  1S3D A;  1BG1 A;  5F8B A;  4FYU A;  4F9Z A;  4GQF A;  5GZZ B;  3WT2 A;  2FGX A;  4JU5 A;  2YN1 A;  5J5N A;  4GWR A;  3LEF A;  4G10 A;  1TXX A; 
#chains in the Genus database with same CATH homology
 5IIZ A;  4AKH A;  4ISD A;  4RI6 A;  3CSH A;  5GAP D;  2H0G A;  2H72 A;  3IXR A;  4XS4 A;  3DKS A;  4EIQ A;  3D0Z A;  3VK9 A;  4POM A;  3DVX A;  1VRS D;  4MMM A;  1GWC A;  2R37 A;  4YAV A;  2EIO A;  4OD7 A;  3UEM A;  5CAX A;  5J41 A;  1M2B A;  3WYW A;  4K7I A;  3D4M A;  4MLY A;  1BF5 A;  5AIS A;  4WF5 A;  3LXZ A;  3PIN A;  5AIX A;  1F37 A;  3HJO A;  3VWV A;  3MSZ A;  4J2F A;  1ZZY A;  3I9V 2;  5CRH A;  4BPY A;  2WUL A;  1Z5Y E;  1A0F A;  2K8S A;  2VLU A;  2HYX A;  3LFL A;  1V40 A;  1TDI A;  2OAC A;  1OC8 A;  4HOJ A;  4EIP A;  4BWQ A;  1ML6 A;  2MMZ A;  5DCH A;  3I43 A;  3UL3 A;  1GUM A;  1DSB A;  3UBL A;  5F07 A;  1DE1 A;  1PGT A;  4ULX A;  3FZ4 A;  2OE0 A;  3KTB A;  3ERG A;  5IO0 A;  3D21 A;  4BA7 A;  2JL4 A;  3F0I A;  5IOX A;  5HFK A;  5GST A;  4KND A;  2PU9 C;  3DD3 A;  4HDE A;  2YPM A;  3F3Q A;  4USS A;  5A4W A;  4J56 E;  4RI7 A;  1XIY A;  4FH8 A;  2HSH A;  2HE3 A;  4KGI A;  2AAW A;  5ECR B;  3VI5 A;  4TR1 B;  3Q74 A;  2H0I A;  1YKC A;  2XBI A;  2IFQ B;  1Z9H A;  5ECL B;  4RQR A;  3GUR A;  2GTU A;  5H5S A;  4DSQ A;  4MNN A;  3GL3 A;  3CYN A;  2BTO T;  5J9B A;  2REM A;  1TKD B;  5D96 A;  4L5L A;  2K18 A;  4WR4 A;  5IPG A;  3KGK A;  2VM2 A;  1S3C A;  4MPF A;  2HZF A;  2FWG A;  2QA2 A;  2EFE A;  2CZ2 A;  4DSS B;  4JRR A;  2X8C A;  4WBR D;  2IJY A;  2NBS A;  2FUG 2;  1QXH A;  1X5D A;  3KJY A;  2HI7 A;  3GSS A;  3J7Y b;  3BJ5 A;  1WRY A;  2I81 A;  1M0U A;  1Q98 A;  2WJU A;  5G1K A;  2RUE A;  2MMN A;  4K9Z A;  1YY7 A;  2B7K A;  3GNJ A;  1KNG A;  1ZYQ B;  5HR2 A;  1SKW B;  2VKZ G;  2PN8 A;  4MJE A;  3TRX A;  2H30 A;  2HSM B;  2VLT A;  3GIX A;  3TKS A;  2DIY A;  1VGL A;  5ENU A;  2WDU A;  2HSN B;  4LL1 B;  3FYG A;  4X1U A;  3WGE A;  2NVL A;  1UC7 A;  4AGS A;  1XCC A;  4GQC A;  1R4W A;  5ABR A;  1GTB A;  3F63 A;  2HXK A;  5J47 A;  1AAZ A;  13GS A;  1WJK A;  5KN2 A;  1V9W A;  4TR3 A;  4EUY A;  3LQ7 A;  2KP1 A;  2JU5 A;  2C4J A;  1VF3 A;  4K8M A;  2DJ1 A;  2AB6 A;  2TRX A;  2LNT A;  3N9J A;  1JZO A;  3UMA A;  2R2J A;  1NM3 A;  1G6Y A;  2A2R A;  3CRU A;  1PN9 A;  2DC5 A;  1B4Q A;  2ALB A;  3IHG A;  2X99 A;  1NHY A;  5DBQ A;  1PMT A;  1GUK A;  2CX3 A;  1Y25 A;  2YWN A;  4ZXG A;  2YOI A;  1QQ2 A;  2EFD A;  3IE3 A;  3DYR A;  1GUL A;  3WGD A;  1EEJ A;  2RM5 A;  3G7I A;  1OAZ A;  1TK8 B;  1ON4 A;  4ILF A;  3ZIT A;  6GSS A;  1FB6 A;  4HZ2 A;  5D93 A;  6GSY A;  4QL9 A;  1ST9 A;  3C1S A;  5H5Q A;  1PX6 A;  3CMI A;  4LLR A;  12GS A;  1XWA A;  3VLN A;  1F6M C;  3QPM A;  5IMF A;  1TI1 A;  3FZ5 A;  3FR6 A;  3RPN A;  1A23 A;  1UA5 A;  4ACS A;  3F9U A;  1A2L A;  1EOG A;  4YQU A;  2I1U A;  2HSM A;  1RW1 A;  1GH2 A;  3U5R E;  3KH7 A;  5A5K A;  4GLT A;  1YQ1 A;  1V58 A;  5ECM B;  2LV3 A;  1GSU A;  4ZB7 A;  3EU3 A;  4IN0 A;  4HQS A;  2PGT A;  3LYK A;  4AKX B;  1T7P B;  3GX0 A;  1Z7P A;  2DKH A;  2PVQ A;  1MDI A;  4KDX A;  5DAL A;  5ID2 B;  2KUC A;  2PUK C;  1O73 A;  5A5H B;  2KP2 A;  1YEP A;  1Z6N A;  2CAQ A;  3EC3 A;  1N2A A;  4BVY B;  3KIJ A;  1XFL A;  1GNE A;  2UZ8 A;  1NW2 A;  2CX4 A;  2L4C A;  14GS A;  3DVW A;  3S9F A;  3UOM A;  5DAK B;  1ZYE A;  2VL2 C;  2VD0 A;  5EL8 A;  2HRF A;  4H86 A;  3VWW A;  1X9M B;  2ZUP A;  1HQO A;  5IO2 A;  1ILO A;  3GTU B;  3L78 A;  4OMV A;  2RM6 A;  3GMF A;  2OAD A;  2P5Q A;  2B5E A;  2ES7 A;  3AY8 A;  3APS A;  3IV4 A;  3TDG A;  5CRG A;  5DDL A;  2C0G A;  5AIV A;  4OFM A;  4MCU A;  4ICY A;  4LL4 B;  3GYK A;  1ACV A;  3RAZ A;  3ZYW A;  2LRC A;  3G9B A;  1TI3 A;  2DSA A;  2L4Q A;  2YV9 A;  5ECQ B;  4POL A;  4OFT A;  3U6V A;  4N0Z A;  3ZML A;  1ERW A;  1MEK A;  3CWG A;  5EY6 A;  2QGV A;  4ZB9 A;  4K1F A;  2HRK A;  4NPB A;  2HZE A;  3Q19 A;  2A4V A;  3RPP A;  5B8A A;  1O8W A;  1JFU A;  3EPT A;  5D9W A;  3MIX A;  3ZL5 A;  2DLX A;  2TIR A;  5ELA A;  4NV2 A;  2DML A;  4AKI A;  3UAP A;  2IMD A;  3P2A A;  5F0G A;  1EGO A;  3GN3 A;  2H1G A;  1JZR A;  1ZGN A;  4BVY A;  3DEX A;  2CAI A;  3UIW A;  1G6W A;  1J08 A;  2LJK A;  3ZRD A;  2WS2 A;  3GST A;  4E68 A;  2H70 A;  4YKF A;  1QFN A;  4IP6 A;  4K7N A;  4TR0 A;  4V2M A;  5D73 A;  2YCD A;  4MDC A;  3TOT A;  2ON5 A;  3GTU A;  4AJ8 A;  1JZD A;  1G0T A;  3GKK A;  9GSS A;  4XS4 B;  2R0G A;  2KHP A;  5FT3 A;  1B8X A;  2OJL A;  3F4S A;  2GZY A;  1JHB A;  1A2J A;  2FA4 A;  2AHE A;  3SBC A;  3GH6 A;  2OKA A;  3EMP A;  3QAV A;  3ZVJ A;  2LJR A;  4BL7 A;  2R6K A;  4DVC A;  2GSR A;  1SJI A;  1X5C A;  4PQH A;  1USB A;  2V1M A;  3BOA A;  4K5S A;  1E6B A;  4MZC A;  1B48 A;  4EL1 A;  1IYH A;  2GQL A;  1T3B A;  4NAX A;  2E7P A;  2PVO C;  2FWE A;  3MNG A;  3QAG A;  2A2S A;  1T4Z A;  1YZX A;  2MMO A;  1GRX A;  1KEB A;  2L5O A;  4FO5 A;  3ERW A;  1YVL A;  1ABA A;  4KDU A;  4Z2R A;  2LTK A;  2MYG A;  4ZBB A;  5CP1 A;  11GS A;  5A34 A;  1SJZ A;  1AQX A;  1Y6E A;  5DQS A;  3FZ9 A;  2LRT A;  4NHW A;  5IOW A;  5C04 A;  2H6Z A;  1SD9 A;  5ECK B;  3TKQ A;  1K0A A;  2X64 A;  3GKM A;  4PUR A;  2JAC A;  17GS A;  4NV5 A;  3KD0 A;  2VL2 A;  4K2X A;  2NTO A;  2V32 A;  4CY6 A;  4WEY A;  3G7Y A;  2EFC A;  5G2Z A;  1YKA A;  3FY7 A;  5KN1 A;  2CZ3 A;  1M7T A;  3F3R A;  3GFK A;  2JZS A;  2IL3 A;  3C8E A;  3FR3 A;  4EDY A;  4G9H A;  3VWU A;  5IQY A;  5CRW A;  4ZBD A;  2K6V A;  2WFC A;  4MA9 A;  2C0F A;  1N25 A;  3LW9 A;  3RHB A;  2X49 A;  4TN8 A;  22GS A;  2B7J A;  1EOH A;  2VAF A;  4RQX A;  5HR0 A;  5KOX A;  2X8H A;  1VF2 A;  2DIZ A;  4GRF A;  5HFG A;  1PKW A;  1XZO A;  3QCP A;  4OWY A;  1XVW A;  3A5W A;  4L0U A;  1ZYN A;  4Q5F A;  4MF5 A;  3HXS A;  5G1L A;  3QOU A;  4PTS A;  3KZQ A;  3RDW A;  1U3I A;  4NWY A;  4N0V A;  2RUF A;  3ZRE A;  5E4W A;  1SKR B;  3DXB A;  2P0G A;  3UAR A;  1ZL9 A;  5IMZ A;  2H74 A;  2A4H A;  1GTA A;  3EIN A;  1Z6M A;  1XW9 A;  4KCA A;  4XS6 A;  4V2L A;  4PNG A;  2YJ7 A;  1M2A A;  3LJR A;  1O6J A;  3CSJ A;  5IMD A;  3IC8 A;  2DJK A;  1AW9 A;  3K8N A;  2B5Y A;  5DJM A;  3F4R A;  2O5V A;  1OKD A;  4YH2 A;  4ZL9 A;  1YF0 A;  4O5Q A;  3RHC A;  1PSQ A;  1TP9 A;  1SEN A;  2NPB A;  2BMX A;  1HYU A;  2MMA A;  4O32 A;  2DJ3 A;  4Q5R A;  3TRP A;  2FHE A;  5GSS A;  3MYD A;  1TU8 A;  3TKP A;  4QQ7 A;  5D9T A;  5G5E A;  4WF4 A;  2WCI A;  4LA1 A;  3MWH A;  1YDK A;  3IOS A;  5D9V A;  1NHO A;  3FKF A;  3LWA A;  2OBK A;  1SL2 B;  2V2G A;  3JCM L;  4L5O A;  1G7O A;  4IS0 A;  4KH7 A;  4I2T A;  4ZL8 A;  2VL3 A;  3UVH A;  4HJ2 A;  1XWC A;  4L8E A;  2VO4 A;  5LD0 A;  4HEA 2;  4TXV A;  3HDC A;  4HJM A;  4POK A;  3GHA A;  1F3B A;  1X0R A;  1V2A A;  5A4U A;  2WB9 A;  4EDZ A;  4JZQ A;  4XCS A;  1IYI A;  1BX9 A;  1MD3 A;  1WOU A;  1LU4 A;  2GS3 A;  1JLW A;  3MAK A;  3ZFL A;  2EIR A;  5BMU A;  3HVX A;  1R5A A;  1XW5 A;  3GUS A;  2GSQ A;  3QFA C;  4X0X A;  3KMN A;  2GT5 A;  5JWQ B;  2EC4 A;  4TOP A;  2VOC A;  1TRU A;  2LUS A;  3IRA A;  2DJJ A;  2JSY A;  4LMW A;  3QMX A;  4KCE A;  3CBU A;  3LOR A;  2YZU A;  5DAL B;  2V6O A;  4ZIJ A;  4IQA A;  4I8B A;  1TK0 B;  1M9A A;  3HCZ A;  3LGC A;  1B9Y C;  2ON7 A;  2H6Y A;  1PL2 A;  3C1R A;  1K0B A;  3MDK A;  3O6T A;  2FWH A;  4G0K A;  3VFI A;  4FQU A;  2E2G A;  2AYT A;  3L9S A;  2DMM A;  3QAW A;  3I69 A;  2H66 A;  3HA9 A;  3TKR A;  5LNK e;  2LQQ A;  4K7O A;  2FWF A;  2QA1 A;  1O85 A;  2VLV A;  5G31 A;  3UBK A;  1WPI A;  3TJB A;  3VWX A;  4V2N A;  4O5U A;  3DGQ A;  4KF9 A;  2H01 A;  2I3Y A;  2L57 A;  2JAD A;  4IEL A;  2IWT A;  4WR5 A;  2CQ9 A;  3F6F A;  4KSM A;  2O89 A;  4I97 A;  4D73 A;  2YNX A;  1OE7 A;  2VCW A;  1ZCP A;  1FHE A;  5E59 A;  5KN0 A;  3EWL A;  2H75 A;  4WET A;  1AXD A;  4X43 A;  1WE0 A;  3G7J A;  4ML6 A;  2LEG A;  3DIE A;  1Y1U A;  3H79 A;  3BCI A;  2XHF A;  1EV4 A;  4HZ4 A;  3LXT A;  4MF6 A;  3N5O A;  2HRK B;  1GNW A;  2HZE B;  3VPT A;  4IW9 A;  1KBN A;  3R3E A;  1FG4 A;  4XRA A;  1EWX A;  3WD6 A;  1B9X C;  1J9B A;  4I5Q A;  4POB A;  2MBT A;  1A8L A;  3APO A;  4IKH A;  4GXZ A;  1A24 A;  2OBI A;  5JCU A;  3VUR A;  2YWM A;  1U87 A;  3CTG A;  18GS A;  2B3S A;  4DSR A;  2GQM A;  3NZN A;  3HVS A;  7GSS A;  2L59 A;  3FEU A;  1NSW A;  1OKT A;  1CQH A;  1EP7 A;  2O8V B;  2YJH A;  4ECI A;  3CTF A;  3ZMK A;  1MDK A;  5J9C A;  1X9S B;  3KCM A;  2PWJ A;  4QMK A;  2CT6 A;  1K0N A;  4MZB A;  5D8I A;  4DEJ A;  3WGX A;  2IMF A;  2X8G A;  4WKW A;  3IC4 A;  3EVI A;  1GP1 A;  3H8Q A;  5HR1 A;  5C00 A;  2R5G A;  2GZZ A;  2QC7 A;  4MJB A;  2H6X A;  4F0C A;  1SL0 B;  4F2I A;  1K0O A;  3ZTL A;  8GSS A;  3W6G A;  1AQW A;  2CVD A;  3Q6O A;  4MAB A;  4BL7 B;  1BYE A;  4GCI A;  2PBJ A;  5BRT A;  3VI7 A;  2IPA A;  4P3Y B;  5CYY A;  1A8Y A;  5A1N A;  2B1K A;  4OFN A;  1SKS B;  5B6N A;  3M9J A;  3EU4 A;  2C8U A;  1SK2 A;  3ZIJ A;  1W89 A;  3HVV A;  1HNB A;  3VPQ A;  3FHK A;  3TRQ A;  6GSW A;  2F9S A;  3UJ1 A;  2ZCT A;  4TXO A;  1GSE A;  1BAY A;  3QFB C;  5A34 B;  2VCX A;  1O8X A;  5B7C A;  1TRW A;  3IK7 A;  3TJK A;  1PA3 A;  2EIQ A;  3KEB A;  2FLS A;  4PXO A;  3TCO A;  5IMV A;  3HJP A;  4AF2 A;  2LS5 A;  1SK0 A;  1LJR A;  1SVO A;  4KAE A;  3L0H A;  4ECB A;  1YEX A;  3IAS 2;  1RK4 A;  2O85 A;  1M99 A;  3GV1 A;  1F9M A;  3GX8 A;  5JCW A;  4MH2 A;  4YQM A;  2CA8 A;  3FK8 A;  4MPG A;  2E0Q A;  3LYP A;  3L9V A;  4WXT A;  2RLI A;  1H75 A;  2GQK A;  4O5R A;  3L4N A;  4G19 A;  4WBJ A;  1SVM A;  1UN2 A;  5DVB A;  4BWS A;  3D4T A;  5CO3 A;  3LG6 A;  6GSX A;  2H1D A;  1DBY A;  5EVO A;  2PMT A;  1N8J A;  6GST A;  2I9H A;  3DWV A;  2C3T A;  1H4O A;  3HJM A;  3M1G A;  1SK1 A;  4ML1 A;  2A2P A;  3P8W A;  4E8E A;  4HU7 A;  1C72 A;  5ECI B;  3FR9 A;  4MH3 A;  1T8E B;  1XWB A;  3A5I A;  2C0E A;  4YKG A;  4K6X A;  3TOU A;  3EE2 A;  2WGR A;  1FVK A;  4EE0 A;  2VCV A;  4CDO A;  1UVZ A;  1PD2 1;  1HNC A;  1TOF A;  4F03 A;  5KOW A;  2CV4 A;  2GST A;  4F82 A;  2YV7 A;  4Q5Q A;  2XPE A;  2IN3 A;  2VIM A;  1THO A;  3H4K A;  3KMO A;  2N5F A;  4ZB6 A;  4ZIL A;  5J3R A;  1FVJ A;  5GAN D;  4GSS A;  2R0P A;  1WMJ A;  2YP6 A;  4PQI A;  3FW2 A;  2GZP A;  1ZOF A;  3QDN A;  1FW1 A;  3J7Y k;  4CHS A;  2J23 A;  3TKS E;  5ECS A;  3FRC A;  1BQ7 A;  2VM1 A;  4JE1 A;  2G0F A;  1BJX A;  1TJD A;  2H71 A;  5EPF A;  1AUC A;  1ERT A;  3ZFB A;  5ECO B;  1OE8 A;  5ECP B;  4K0G A;  3LSZ A;  3IBH A;  1VF4 A;  4N10 A;  1OC9 A;  4TVE A;  1VF1 A;  4PX1 A;  2M72 A;  1XPV A;  1K3L A;  1ERV A;  1U3A A;  4KDY A;  3TU3 B;  3E3E A;  2UV8 G;  4XIH A;  3IAM 2;  2BJX A;  4K2D A;  3KP9 A;  2PER A;  4FYC A;  4KW6 A;  2HRA A;  4Q5N A;  2H19 A;  2YZH A;  4CY8 A;  2KLX A;  5JCG A;  6GSV A;  2XBQ A;  2MBS A;  3KXO A;  4IHU A;  4EVM A;  2L5L A;  4OO4 A;  3HYP A;  3QD9 A;  5JWO B;  4BVX A;  2V41 A;  1EGR A;  3OR5 A;  1ZYP A;  1TK5 B;  5D9X A;  4AI6 A;  2HQT A;  2GDR A;  3PH9 A;  2N5A A;  2AUV A;  2L6D A;  4JED A;  3HHV A;  2H73 A;  2B6M A;  2JZT A;  2NDO A;  4N30 A;  5J4U A;  5HQP A;  2HT9 A;  1O7U A;  5B8B A;  3KTL A;  5LCZ A;  1K0D A;  2DJ0 A;  3ED3 A;  1XXU A;  1GUH A;  1DE2 A;  5BMU B;  4HU9 A;  1K3Y A;  3ISO A;  3R2Q A;  1R26 A;  2IME A;  2FA8 A;  4KE3 A;  1TTZ A;  2JSZ A;  2IMK A;  3IR4 A;  1T00 A;  4AJ7 A;  4O92 A;  3I6A A;  4ZB8 A;  4IJI A;  1K0M A;  3M3M A;  5CRE A;  4JR6 A;  3W8J A;  4GDF A;  4KX4 A;  4EKZ A;  1U6T A;  2WZ9 A;  5ECN B;  2JZR A;  3H1N A;  3ERF A;  4V1A p;  4JR4 A;  4ECC A;  4NHZ A;  2X4A A;  4JBB A;  2LQO A;  2C3Q A;  3P90 A;  5JWR B;  1BED A;  1HNA A;  1A0R P;  1R5P A;  3E0U A;  3ZLP A;  1DUG A;  2H76 A;  3HY2 A;  1PKZ A;  5FHI A;  3GH9 A;  2YAN A;  1PN0 A;  5F05 A;  1Z7R A;  4D73 B;  2IIY A;  3TUE A;  4EC0 A;  3QR6 A;  2V6K A;  3DRN A;  5ECH B;  4KSO A;  2I4A A;  1ERU A;  1GSF A;  3ME7 A;  4FIW A;  3ZZX A;  2H1A A;  1GSD A;  4MK3 A;  4ZBA A;  1O81 A;  2VD1 A;  1M9B A;  2O7K A;  1PQN A;  4Z7X A;  3WT1 A;  5CRD A;  2GLR A;  3PPU A;  1SD8 A;  4TKY A;  3NOF A;  1WWJ A;  2FCH A;  4XRD A;  4KA0 A;  4E8H A;  2K8V A;  3O3T A;  3IPZ A;  2RII A;  1SU9 A;  4ZL7 A;  2XC2 A;  4IJ3 A;  2AJQ B;  4K0N A;  2M46 A;  3ZIV A;  5J40 A;  2GVP A;  4OO5 A;  3GKX A;  4G01 A;  3A2W A;  3EYT A;  2C80 A;  1SJ6 A;  1QGV A;  1V57 A;  2WRT A;  4MP4 A;  5F06 A;  2R0C A;  3ZVJ D;  3HD5 A;  3BD2 A;  3GKN A;  4Z2T A;  1V98 A;  5L71 A;  1FB0 A;  4TR4 A;  2QKE A;  3GA4 A;  2F8A A;  1GTU A;  1GSY A;  3DML A;  2DKI A;  1GL8 A;  1F3A A;  4GTU A;  4NXI A;  4TR1 A;  1TW9 A;  2LRN A;  4ECJ A;  3NIV A;  4HI7 A;  2IFQ A;  1K0C A;  2OT3 A;  1X5E A;  2CVK A;  2LKU A;  1JLV A;  2N5B A;  4KUN A;  1FOH A;  1TRS A;  2FNO A;  6GSU A;  3BBY A;  2QSI A;  1K3O A;  4XHM A;  3C7M A;  4EO3 A;  3TGZ A;  3SWL A;  5AN1 A;  3A3T A;  2K9F A;  4DSS A;  1EEM A;  1YJ6 A;  2HNL A;  1XOA A;  4G2E A;  4X4J A;  5A1N B;  20GS A;  2AV4 A;  3H93 A;  2D2Z A;  1MTC A;  4NMU A;  1MD4 A;  3IDV A;  4MZW A;  1XVQ A;  1FAA A;  2J9H A;  2B1L A;  1PRX A;  2YWO A;  3E9J B;  4I2U A;  1SL1 B;  4V1A g;  3W8S A;  1OC3 A;  1PX7 A;  4IVF A;  2CVB A;  4TXO B;  3FMW A;  1Z3E A;  1OVN A;  5HFI A;  5COH A;  1GLP A;  1XBS A;  2EFH A;  3ME8 A;  1GSS A;  2OE3 A;  3HZ4 A;  4OCF A;  2LST A;  1A2M A;  2PPT A;  2HSN A;  2DJ2 A;  3P7X A;  4YAP A;  2ZNM A;  4KB3 A;  1SYR A;  2GGT A;  1M2D A;  1WP0 A;  4OCE A;  3GL5 A;  1BG5 A;  2GT6 A;  4MJC A;  2LNS A;  1J0F A;  4XS1 A;  3UVT A;  1CQG A;  4ID0 A;  1R7H A;  2M80 A;  3KM6 A;  4HUA A;  3D22 A;  2H8L A;  2B5X A;  1TXU A;  1XWG A;  2F3M A;  1TU7 A;  2H1L A;  2O87 A;  2H0H A;  1ZMA A;  3HMJ G;  5KEJ A;  4PGT A;  4HS1 A;  5INY A;  4PNF A;  3HKR A;  1GLQ A;  5B6M A;  3TJF A;  1T1V A;  4AJ6 A;  5IMA A;  1YF1 A;  2MZC A;  2IMI A;  1I5G A;  3Q18 A;  1B4P A;  4AKG A;  5CNW A;  3CSI A;  5KN3 A;  3PGT A;  4MF7 A;  2P5R A;  1W4V A;  4GSN A;  1S3A A;  1HD2 A;  5DQY A;  4LMV A;  5H5R A;  1QMV A;  1AC1 A;  3C73 A;  5IPH A;  3M0F A;  3EUR A;  2HRN A;  1EV9 A;  1OYJ A;  4F0B A;  3GRX A;  4HQZ A;  2P31 A;  1EZK A;  1U88 A;  2DBC A;  1XW6 A;  4CW9 A;  2OE1 A;  3V1W A;  4FYB A;  4EXJ A;  1TRV A;  2VUP A;  2XPD A;  4PQ1 A;  2F51 A;  2HSY A;  2F8F A;  1FO5 A;  4IP1 A;  3CXG A;  1GTI A;  3RBT A;  3IA1 A;  4A5P A;  2C0D A;  2R4V A;  1SYX A;  5ID2 A;  4TRX A;  3A2X A;  1E2Y A;  4K5R A;  2TRC P;  5A5H A;  3L9U A;  4N11 A;  1LBK A;  4W66 A;  5G5F A;  3D6I A;  1OC9 B;  1URM A;  5J4Y A;  3F6D A;  4N3Z A;  4TW5 A;  5DAK A;  3TB2 A;  1WIK A;  2C3N A;  3US3 A;  2R3X A;  2C1Y A;  4YQV A;  2GSS A;  3M8N A;  1FOV A;  5DCG A;  1JZW A;  5ELG A;  2VCZ A;  3IK9 A;  1KTE A;  5AGY A;  4EF0 A;  3HZ8 A;  1EP8 A;  1X9W B;  3FZA A;  3A2V A;  2E2M A;  5IM9 A;  4XTS A;  1F2E A;  2VL9 A;  4BVX B;  1SVL A;  1XOB A;  3C71 A;  2Z9S A;  1Q4J A;  3F8U A;  2FD3 A;  1QK8 A;  5DJL A;  1THX A;  3PR8 A;  4RUV A;  5G30 A;  1AQV A;  2HLS A;  4IQ1 A;  3F4T A;  1RQM A;  5IMC A;  4Z2U A;  1G7E A;  5FWG A;  4MJA A;  2VCT A;  3BCK A;  4PUF C;  2H1B A;  1I9D A;  2FY6 A;  3APQ A;  5HR3 A;  1QUW A;  3EMX A;  2L6C A;  4I6X A;  3O76 A;  4G0L A;  4PUA A;  16GS A;  1AIU A;  3TJJ A;  2VCQ A;  1PL1 A;  4G0I A;  3KH9 A;  3CRT A;  3TKS C;  5J4V A;  1MDJ A;  4QL7 A;  4GF0 A;  4L0W A;  3IHQ A;  2YWI A;  1XWK A;  3D5J A;  5A4V A;  2HFD A;  2LJA A;  2G2Q A;  2OA7 A;  4J57 E;  4IGJ A;  4GST A;  3TJG A;  3KP8 A;  3M9K A;  10GS A;  2KOK A;  4IBP A;  19GS A;  4O7H A;  1T4Y A;  1GSQ A;  1S3D A;  1BG1 A;  5F8B A;  4FYU A;  4F9Z A;  4GQF A;  5GZZ B;  3WT2 A;  2FGX A;  4JU5 A;  2YN1 A;  5J5N A;  4GWR A;  3LEF A;  4G10 A;  1TXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...