1VF4A

Cgsta1-1 apo form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
227
structure length
227
Chain Sequence
AAKPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 81
structure length 227
sequence length 227
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf4A01
2K8VA 1PL2A 5HR2A 4XRDA 3TJBA 4YH2A 1X9SB 2H71A 5DVBA 3L78A 1VF4A 4WBJA 3L9SA 2HRKA 1M2BA 4MJAA 1M9AA 1R7HA 3W6GA 3IK9A 1U87A 1YY7A 2P5QA 1UA5A 2GT5A 4IN0A 2VUPA 3G9BA 3I69A 2DJ1A 5ABRA 5B8AA 4DSSB 6GSUA 3HKRA 2CVBA 2IIYA 2OBKA 4O7HA 3J7Yk 2GZPA 4K6XA 3IRAA 5IO2A 4MF6A 2DJ2A 1ZYEA 2PN8A 5CREA 4YQMA 4PX1A 4I6XA 1GRXA 5KEJA 2GS3A 5DAKA 5CAXA 4EDZA 1OE7A 3HVVA 4KUNA 3GH6A 3ZIJA 1VF3A 3D0ZA 4HZ4A 2H6XA 2CA8A 2XHFA 5ENUA 2GQLA 2C3NA 4CHSA 1MDJA 3QMXA 4ZBDA 1M2AA 3ZVJA 4TW5A 3TKSE 3GH9A 2OE0A 1XOBA 4KA0A 3GX0A 16GSA 3TKRA 4I5QA 2PERA 4KE3A 3UBLA 2XBQA 4KDYA 4OCEA 1JZDA 3W8JA 1KTEA 2LJRA 1GH2A 1TRUA 4RI6A 3CRTA 2L5OA 1O6JA 1Z9HA 2V1MA 4DEJA 2HE3A 3GHAA 3H1NA 1FO5A 2DMMA 4YQUA 4XIHA 4QQ7A 3KTBA 2BMXA 2DLXA 4TRXA 3QR6A 5D9XA 5IMFA 4K7OA 3WYWA 2H70A 2EIQA 1GTAA 2PVOC 2REMA 5J9CA 1PN9A 1AUCA 1PSQA 3TKQA 1GSQA 2WFCA 3EE2A 1EWXA 4DSSA 4ZL9A 2IL3A 2HQTA 4KB3A 4G2EA 5FWGA 1FVKA 1A0RP 1NSWA 2H6ZA 4O5RA 4ECCA 5G30A 5DQYA 1ACVA 3P2AA 3EINA 2VL3A 2GT6A 3FK8A 7GSSA 4ML1A 1G7OA 3GX8A 3F4RA 3GMFA 3TB2A 1YKAA 2VLUA 4IKHA 3VI5A 1WMJA 3HZ4A 1ERVA 2FWEA 1XCCA 4GQCA 1YJ6A 1OAZA 5D96A 3FEUA 1ZMAA 1EP7A 2HZEB 4HI7A 2D2ZA 5IMCA 2PUKC 2A2RA 4MH3A 2CVKA 5ECRB 3EVIA 3A2VA 4MLYA 3GTUA 4ZBAA 2BTOT 2P31A 2LQQA 2GLRA 4OO5A 3P8WA 2X64A 2V2GA 4BWQA 2DSAA 2C4JA 14GSA 4ILFA 4Q5RA 1E2YA 4ML6A 2R37A 3R2QA 3OR5A 1ERUA 4V1Ag 4ZB6A 5F8BA 3VWXA 5JCUA 3TDGA 3Q6OA 3FZ5A 3F4SA 4OFTA 1EEJA 2RIIA 3DXBA 4F2IA 4N10A 1DUGA 1I9DA 3FYGA 4POBA 3C1RA 2ZCTA 1XPVA 4TR0A 1R4WA 3F6DA 2VCZA 2AAWA 4IS0A 2A2SA 5J9BA 1XIYA 1C72A 6GSXA 2H01A 5ID2A 2H73A 3RHCA 3FZ4A 1N2AA 4IQAA 3DGQA 1T4YA 5CRGA 4MF7A 3RHBA 3LORA 4NAXA 3GUSA 4OFMA 2DJJA 3IDVA 2LS5A 1XW9A 4JEDA 4Q5QA 2F8FA 5JWOB 4MDCA 2YV7A 1K0AA 4G9HA 4MCUA 4OCFA 5KN2A 3DIEA 2H1GA 2LJAA 3EURA 3ZFBA 2HZEA 2H75A 4V2NA 1M99A 1YEXA 4GXZA 1K0MA 2C8UA 1TRVA 1FB0A 2K6VA 2LSTA 4X0XA 3TOUA 2LQOA 1HYUA 3KJYA 4MJCA 1SK2A 2HFDA 2O87A 1KEBA 4IW9A 2Z9SA 3E0UA 4JBBA 4GRFA 1PL1A 4N0VA 3F4TA 3ZMKA 3QOUA 3G7YA 1Z6MA 4KH7A 4EKZA 4KX4A 2QKEA 3HHVA 2C3QA 3LSZA 3IA1A 2GZYA 4ZL7A 4EDYA 2JZSA 1Q4JA 2VAFA 5CRDA 1BYEA 5IMZA 2LV3A 3BCKA 1V58A 3IHQA 4J56E 5F0GA 19GSA 1PQNA 2MBSA 4DSQA 1GUKA 1V98A 3FRCA 3MDKA 1EOGA 3KCMA 2TRXA 2NTOA 4KAEA 2YOIA 3UL3A 2NPBA 3BBYA 1KNGA 1EZKA 3FY7A 1T8EB 1PKWA 3L0HA 3IC4A 4EVMA 3CRUA 1SK0A 1PA3A 1EGOA 1OYJA 3PH9A 1PRXA 2HXKA 2F51A 4PURA 1GSFA 4L5OA 4XRAA 4IGJA 3QPMA 4WF5A 2B5XA 2ALBA 3HD5A 2YCDA 2DC5A 1W4VA 3NOFA 4K2DA 3CMIA 3FR3A 1OE8A 3O76A 4Q5FA 5G31A 4IHUA 2VCQA 4GTUA 1ON4A 1EV9A 2YPMA 5GAPD 3BD2A 1O81A 2OADA 3ZTLA 3UOMA 2L59A 2LRTA 5DCHA 1YF1A 4K7IA 4AJ7A 1OC3A 1QGVA 2OACA 4KW6A 5HR0A 3M0FA 5ECQB 1PGTA 4JRRA 1X5EA 1MD4A 3CBUA 4ZIJA 5ECIB 2C3TA 2HSYA 4OMVA 3TRXA 2B1KA 3PR8A 1K0BA 2A4VA 1V2AA 3WD6A 3UARA 4KGIA 3WT2A 2GSQA 4ECJA 2HRNA 1R26A 2WS2A 5C00A 3GRXA 5CYYA 4WETA 2AHEA 4OWYA 1ZZYA 1R5PA 3KP9A 3ME8A 4MZWA 1ERWA 4NXIA 1WIKA 3GA4A 1FB6A 3O3TA 1F3BA 4PNGA 4G0LA 3CSJA 5DJLA 3UAPA 3I9V2 4O32A 1XWKA 2HNLA 4BL7B 4TXOB 2VO4A 4TOPA 1Q98A 2RM6A 4HU9A 3UJ1A 2FHEA 4RI7A 4G10A 2ZNMA 3KGKA 1JZOA 2H1AA 4KDXA 3APQA 3ME7A 1EGRA 4HDEA 2ON7A 4MPGA 22GSA 3W8SA 1O8XA 3J7Yb 4ACSA 2V6OA 2M72A 1BAYA 2VL2C 4HS1A 2C0GA 4XHMA 4L0UA 1AIUA 4FYCA 5IOXA 3MNGA 1JLVA 1B8XA 1BX9A 2VD1A 3ZL5A 3ZREA 2I81A 3TOTA 4BPYA 1SKRB 3EU4A 3F9UA 1FW1A 1TP9A 1A2JA 5EY6A 5CNWA 4IJIA 5D73A 3MAKA 1YKCA 2GQKA 5F05A 2NVLA 2O89A 4LL4B 1J0FA 2C0DA 3E3EA 3IE3A 2XPEA 1JFUA 1TOFA 1X0RA 4MJBA 4IQ1A 2GSTA 4LL1B 5KN3A 1A23A 1K0CA 2PPTA 3UVTA 1SYXA 4YAVA 2K8SA 5ECPB 3QD9A 1K0OA 4KDUA 1A2LA 2VM1A 4WBRD 5D8IA 3R3EA 2IMKA 3KD0A 18GSA 3BJ5A 1WRYA 4KF9A 1TRWA 2G2QA 2YANA 4TXOA 2VL2A 1ZL9A 4H86A 4EUYA 1EP8A 3US3A 4MZBA 3EYTA 2IN3A 2IMFA 1YEPA 5AN1A 2CQ9A 2LNTA 2L5LA 1ABAA 1DE1A 1O73A 2B5EA 5IPHA 2HRAA 1WWJA 1VGLA 2H1DA 2H76A 3HJOA 1LJRA 1Y6EA 2PVQA 2XPDA 4WF4A 2H0IA 1QQ2A 2MMNA 4XTSA 1WJKA 2NBSA 5ECLB 8GSSA 3A2XA 1AQVA 3WGDA 5ECKB 3IPZA 4EL1A 2V6KA 1GTIA 4MF5A 4CDOA 2KP2A 2R4VA 3I43A 4PTSA 17GSA 2DJ0A 3IR4A 20GSA 2AB6A 2FCHA 4MPFA 3KMOA 3ZVJD 4PQIA 4DSRA 1AXDA 2E7PA 1QK8A 2GSRA 3U6VA 2WB9A 1F3AA 1ZGNA 1A8YA 4HQZA 2HYXA 4ZL8A 2PGTA 4WEYA 2EIOA 4IP6A 2P5RA 1SL0B 4NHZA 1LBKA 1BEDA 2LUSA 3QAWA 1HNCA 2CZ2A 1G0TA 2QSIA 1J08A 3I6AA 10GSA 2N5AA 1Z3EA 5A5KA 1ERTA 3FHKA 2H72A 5DDLA 2DJ3A 4GQFA 2X8HA 2AYTA 3O6TA 2HLSA 1MEKA 4D73B 3WT1A 3ZYWA 1AQXA 2WJUA 6GSSA 3UVHA 3GURA 3GSTA 3G7IA 2L4CA 2VL9A 1THOA 3F8UA 4G19A 3F6FA 1QXHA 1M9BA 5A4WA 5J3RA 1QUWA 2FWFA 2FA4A 3HJPA 4HU7A 2DBCA 1QMVA 4BVXB 4MH2A 4F0BA 3LGCA 1YF0A 3D22A 2H1BA 1XWGA 3MWHA 4EC0A 4XCSA 2B3SA 4V2LA 2K18A 1RK4A 2CT6A 5ECOB 3BOAA 3M1GA 4IVFA 2YZUA 2XBIA 2X99A 1R5AA 2L4QA 3F3RA 1GTBA 4TKYA 5IMDA 4WXTA 2LEGA 3TRQA 1F37A 3TJFA 2B7JA 1TU8A 5AISA 1M2DA 5JCWA 1B9YC 3EWLA 2P0GA 1SK1A 2I3YA 3P90A 3FZ9A 2BJXA 4I97A 2R5GA 2L6CA 4QL7A 2VIMA 5G2ZA 2HI7A 9GSSA 2LRNA 2TIRA 1B48A 3GKXA 4TR4A 4EE0A 1TKDB 2PWJA 4JU5A 1GSUA 3D21A 3WGXA 4X43A 3F3QA 4I2TA 4PQ1A 1WE0A 5CO3A 4IP1A 4ZXGA 2H0HA 1GNWA 4D73A 5JWRB 2H8LA 2GTUA 2DIZA 11GSA 3HVSA 6GSVA 2VLTA 5B8BA 1HD2A 4ZILA 2CVDA 1OKTA 3SBCA 4N30A 4POLA 5ELGA 4BVXA 5DALB 1UC7A 1XZOA 3K8NA 5C04A 1UVZA 2PU9C 4NV5A 1TDIA 1AW9A 1SU9A 3IAM2 1GSEA 2DIYA 4KSMA 3FR6A 5IOWA 1FVJA 2ZUPA 2OKAA 1U88A 1SJZA 4X1UA 3Q18A 1V40A 2JL4A 4ZBBA 2FWGA 1FOVA 2JZRA 1URMA 1VF1A 5ELAA 2OJLA 2WCIA 1U3AA 1GTUA 2B5YA 3ED3A 3L4NA 2O7KA 3QCPA 1G6WA 2CAQA 2VCXA 2GGTA 4KSOA 3EMPA 3KMNA 4AJ8A 2MZCA 4Q5NA 1A2MA 1TU7A 2HSMB 1LU4A 4IBPA 3L9VA 1F2EA 3PINA 1RQMA 3C73A 3GSSA 5G1KA 3ZITA 3ZLPA 2WZ9A 1XXUA 2OBIA 2FD3A 12GSA 3Q19A 4V1Ap 4E8HA 1PD21 5HR3A 3ZRDA 3S9FA 4WKWA 2KP1A 1H75A 5ECSA 2LKUA 2LTKA 3HVXA 5A4UA 2CZ3A 3G7JA 2YN1A 1TK5B 2RLIA 2VCVA 4IJ3A 3E9JB 3AY8A 2G0FA 4ID0A 1DSBA 4O92A 1XVQA 1SKSB 4PGTA 2AUVA 1M7TA 3CTFA 1T1VA 2HSNB 4YAPA 2VM2A 3GYKA 2IWTA 1XBSA 1S3AA 3L9UA 1CQGA 2HZFA 1GUHA 1USBA 3ERWA 1VRSD 5DALA 2O85A 4FIWA 2PBJA 5D9WA 3TGZA 4Z7XA 4TVEA 3PGTA 3TKSC 2CX4A 3A3TA 1JLWA 3D6IA 5F06A 5INYA 4F0CA 3EU3A 3HXSA 2X8GA 4POKA 2I9HA 2WULA 3HDCA 3NZNA 1WP0A 4V2MA 1SENA 3LYPA 2N5BA 2TRCP 1O85A 3VWUA 1AAZA 2R6KA 3GL5A 5J41A 2KUCA 3GNJA 5LNKe 1JZWA 2F9SA 3VFIA 4MZCA 3F63A 4NHWA 3WGEA 1GUMA 2GSSA 1B4PA 4OO4A 2H66A 4BVYB 4HQSA 3APOA 3LQ7A 1BJXA 2RM5A 1GLPA 2HSMA 2IJYA 4J2FA 5G5EA 5G5FA 4RUVA 3GL3A 3M8NA 2EIRA 2FUG2 3UMAA 2HT9A 3DEXA 3TCOA 3KZQA 2J23A 3NIVA 2RUEA 3V1WA 4PUAA 3BCIA 4PUFC 3KP8A 1H4OA 4F9ZA 5J4UA 2QC7A 3IBHA 4ZB8A 3FZAA 2MYGA 4L0WA 4F82A 3QFAC 4N0ZA 3TKSA 1I5GA 3IV4A 4NWYA 3RPNA 3APSA 2E2GA 4GCIA 2L6DA 1EV4A 2L57A 4JZQA 3CTGA 4JE1A 2B6MA 1F6MC 5IQYA 3MSZA 4F03A 2CAIA 2O8VB 2YZHA 3QAVA 1OVNA 3CSIA 4HEA2 3EMXA 4NV2A 1IYIA 5F07A 1Z7RA 4I8BA 1GP1A 2OA7A 2CV4A 1XVWA 3RDWA 5DBQA 3IXRA 2DMLA 5HR1A 4N11A 2UZ8A 2LNSA 1OC9B 2FA8A 3C7MA 5EL8A 1ZCPA 3H8QA 5LD0A 3KH7A 3VWVA 1DBYA 3F0IA 1UN2A 4BVYA 2NDOA 4LMWA 1XW5A 1A8LA 3A5WA 2R3XA 1SYRA 5G1LA 1TXXA 4BL7A 4BWSA 4NMUA 5CRHA 3DRNA 1PKZA 1F9MA 2ES7A 4NPBA 1CQHA 2YJ7A 5B7CA 4YQVA 3GTUB 3LJRA 2C1YA 4EF0A 4G0IA 2VLVA 5DJMA 1FG4A 3HY2A 1YZXA 1U3IA 3VK9A 1XOAA 1GSSA 3CXGA 5IMAA 3KEBA 1FAAA 3VURA 2MMAA 4RQXA 5GSSA 1SD9A 1XWBA 4OD7A 2MMZA 4AJ6A 4MA9A 3ERFA 3TJGA 5IMVA 4HUAA 2GQMA 2FGXA 2YJHA 3LXZA 1JHBA 4MK3A 1YQ1A 4GSSA 3DVWA 4TXVA 3M9JA 4KNDA 4AF2A 5AIVA 4PQHA 3HZ8A 3GFKA 5EPFA 1TW9A 4I2UA 3ZFLA 1ZYQB 1SKWB 5AGYA 1GSDA 1K3YA 5L71A 3DD3A 4MJEA 2B7KA 3DMLA 4K9ZA 1GWCA 4PXOA 3PPUA 1OC9A 1Z7PA 2N5FA 5EVOA 1PMTA 5ID2B 1GULA 3KTLA 3Q74A 1Z5YE 2AV4A 1IYHA 2H0GA 2FLSA 1NHYA 4MP4A 5COHA 3LXTA 3LG6A 1MTCA 4E8EA 1OKDA 5AIXA 3VWWA 5H5RA 3ERGA 4K1FA 1O7UA 3DWVA 3IC8A 4GF0A 4XS6A 4MABA 3ISOA 4LLRA 2FWHA 1O8WA 1EEMA 4FYBA 5HFGA 1K0DA 1W89A 5HFKA 2YWOA 3EC3A 5B6NA 5D93A 3QFBC 4GLTA 2HRFA 3JCML 3TKPA 5DCGA 3DKSA 2K9FA 1JZRA 1XWAA 3H79A 1V57A 1TI3A 4EO3A 3HCZA 1G6YA 2YWNA 1TK0B 4HOJA 2OE1A 1QFNA 2CX3A 2H19A 3H93A 2B1LA 1G7EA 3TRPA 1GL8A 3FW2A 5FT3A 3M3MA 4FYUA 2VOCA 2IMEA 3CYNA 4MMMA 1T4ZA 3ZIVA 3UEMA 2H6YA 4USSA 2LJKA 1K0NA 1OC8A 6GSTA 2KHPA 1N8JA 2I4AA 3H4KA 1XFLA 3GIXA 4LA1A 1E6BA 3N9JA 4JR6A 1HQOA 1X9MB 3D4MA 4ZB9A 3GKKA 5GSTA 5J5NA 3FKFA 4GWRA 2DJKA 2MBTA 3RBTA 4P3YB 1K3LA 3M9KA 3VPTA 3TJJA 5FHIA 3FR9A 4GSNA 1NM3A 2VD0A 5KN0A 4J57E 3VI7A 1S3CA 1PX7A 2J9HA 2E0QA 2FY6A 2IFQB 2H74A 5IPGA 1TK8B 5LCZA 2QGVA 1GLQA 1SJIA 2RUFA 1B4QA 2YWMA 1T3BA 1XW6A 2KLXA 3QDNA 2PMTA 2YV9A 3TUEA 1X9WB 1GSYA 4ISDA 2MMOA 1ST9A 5JCGA 2IMDA 4FQUA 3KH9A 2C0EA 1HNAA 1ML6A 1TTZA 4HJMA 3DVXA 3IAS2 3C1SA 1ILOA 1TJDA 2GVPA 1MDIA 2HSHA 4PNFA 2X8CA 4POMA 2ON5A 4HJ2A 3HYPA 3DYRA 3LWAA 4QL9A 3KXOA 2GZZA 5E59A 2V32A 5B6MA 1T00A 5H5QA 1THXA 2H30A 1WOUA 5JWQB 4ULXA 4G0KA 5D9TA 2KOKA 1A0FA 5IM9A 4TR1B 2JACA 2VCTA 4L5LA 5IO0A 2JU5A 3IK7A 1VF2A 4HZ2A 3KIJA 5KN1A 1MDKA 3VLNA 2VCWA 4EXJA 2YNXA 2C0FA 1U6TA 1V9WA 3RPPA 1B9XC 1BG5A 5A4VA 2I1UA 1NW2A 5ECNB 4LMVA 1A24A 2E2MA 2F8AA 1S3DA 2F3MA 4WR5A 3KM6A 1ZOFA 3LYKA 3N5OA 4XS1A 5GAND 3P7XA 1SL2B 5ECHB 4IELA 1HNBA 2IFQA 3GKMA 2GDRA 3RAZA 3GN3A 4FO5A 3D5JA 1PX6A 3GV1A 3D4TA 3IOSA 4FH8A 4XS4B 4JR4A 2JSZA 3GKNA 1GNEA 2WGRA 1M0UA 5D9VA 1TI1A 4BA7A 1J9BA 3ZZXA 2IPAA 1SJ6A 4ECIA 2HRKB 1Z6NA 3A2WA 4ECBA 5DQSA 4K7NA 4TR3A 4K8MA 2WRTA 1TRSA 2YP6A 1SL1B 6GSYA 4WR4A 4K0GA 5BMUA 2WDUA 3SWLA 4K0NA 2JZTA 1KBNA 4TR1A 3LEFA 1X5CA 3CSHA 6GSWA 1YDKA 4CW9A 2EC4A 4KCEA 3TJKA 1DE2A 2M80A 3U5RE 3UBKA 2R2JA 3HA9A 4RQRA 1MD3A 2JADA 2V41A 5CRWA 1NHOA 2OE3A 13GSA 5DAKB 3HJMA 1BQ7A 5HFIA 1K3OA 5HQPA 3UIWA 2M46A 1AQWA 3ZMLA 5CP1A 2XC2A 4KCAA 2FNOA 1T7PB 3C8EA 2LRCA 1AC1A 2JSYA 3C71A 3VPQA 4DVCA 2C80A 2IMIA 5H5SA 4OFNA 3QAGA 2AJQB 1Y25A 4AGSA 4TN8A 1FHEA 5E4WA 5GZZB 1WPIA 3LFLA 1EOHA 1SD8A 1X5DA 2YWIA 4XS4A 4L8EA 1XWCA 5IIZA 5ECMB 4GSTA 1RW1A
chains in the Genus database with same CATH superfamily
2K8VA 2HSNA 1PL2A 2R0GA 5HR2A 4XRDA 3TJBA 4YH2A 1X9SB 2H71A 5DVBA 3L78A 1VF4A 4WBJA 3L9SA 2HRKA 1M2BA 4MJAA 1M9AA 1BG1A 1R7HA 3W6GA 3IK9A 1U87A 1YY7A 2P5QA 1UA5A 2GT5A 4IN0A 2VUPA 3G9BA 3I69A 2DJ1A 5ABRA 5B8AA 4DSSB 6GSUA 3HKRA 2CVBA 2IIYA 2OBKA 4O7HA 3J7Yk 2GZPA 4K6XA 3IRAA 5IO2A 4MF6A 2DJ2A 1ZYEA 2PN8A 5CREA 4YQMA 4PX1A 4I6XA 1GRXA 5KEJA 2GS3A 5DAKA 5CAXA 4EDZA 1OE7A 3HVVA 4KUNA 3GH6A 3ZIJA 1VF3A 3D0ZA 4HZ4A 2H6XA 2CA8A 2XHFA 5ENUA 2GQLA 3FMWA 2C3NA 4CHSA 1MDJA 3QMXA 4ZBDA 1M2AA 3ZVJA 2EFDA 4TW5A 3TKSE 3GH9A 2OE0A 1XOBA 4KA0A 3GX0A 16GSA 3TKRA 4I5QA 2PERA 4KE3A 3UBLA 2XBQA 4KDYA 4OCEA 1JZDA 4CY8A 3W8JA 1KTEA 2LJRA 1GH2A 1TRUA 4RI6A 3CRTA 2L5OA 1ZYNA 5A34A 1O6JA 1Z9HA 2V1MA 4DEJA 2HE3A 3GHAA 3H1NA 1FO5A 2DMMA 4CY6A 4YQUA 4XIHA 3A5IA 4QQ7A 3KTBA 2BMXA 2DLXA 4TRXA 3QR6A 5D9XA 5IMFA 4K7OA 3WYWA 2H70A 2EIQA 3CWGA 1GTAA 4YKFA 2PVOC 3MIXA 2REMA 5J9CA 1PN9A 1AUCA 1PSQA 3TKQA 4MNNA 1GSQA 2WFCA 3EE2A 1EWXA 1BF5A 4DSSA 4ZL9A 2IL3A 2HQTA 4KB3A 4G2EA 5FWGA 1FVKA 1A0RP 1NSWA 2H6ZA 4O5RA 4ECCA 5G30A 5DQYA 1ACVA 3P2AA 3EINA 2VL3A 2GT6A 3FK8A 7GSSA 4ML1A 1G7OA 3GX8A 3F4RA 3GMFA 3TB2A 1YKAA 2VLUA 4IKHA 3VI5A 1WMJA 3HZ4A 2R0CA 1ERVA 2FWEA 1XCCA 4GQCA 1YJ6A 1OAZA 5D96A 3FEUA 1ZMAA 1EP7A 2HZEB 4HI7A 2D2ZA 5IMCA 2PUKC 2A2RA 4MH3A 2CVKA 5ECRB 3EVIA 4W66A 3A2VA 2EFCA 4MLYA 3GTUA 4ZBAA 2BTOT 2P31A 2LQQA 2GLRA 4OO5A 3P8WA 2X64A 2V2GA 4BWQA 1TXUA 2DSAA 2C4JA 14GSA 4ILFA 4Q5RA 1E2YA 4ML6A 2R37A 3R2QA 3OR5A 1ERUA 4V1Ag 4ZB6A 5F8BA 3VWXA 5JCUA 3TDGA 3Q6OA 3FZ5A 3F4SA 4OFTA 1EEJA 2RIIA 4YKGA 3DXBA 4F2IA 4K5SA 4N10A 1DUGA 1I9DA 3FYGA 4POBA 3C1RA 2ZCTA 1XPVA 4TR0A 1R4WA 3F6DA 2VCZA 2AAWA 4IS0A 4ICYA 2A2SA 5J9BA 1XIYA 1C72A 6GSXA 2H01A 5ID2A 2H73A 3RHCA 3FZ4A 1N2AA 4IQAA 3DGQA 1SVLA 1T4YA 5CRGA 4MF7A 3RHBA 3LORA 1I1IP 4NAXA 3GUSA 4OFMA 2DJJA 3IDVA 2LS5A 1XW9A 4JEDA 4Q5QA 4X4JA 2F8FA 5JWOB 4MDCA 2YV7A 1K0AA 4G9HA 4MCUA 4OCFA 5KN2A 3DIEA 2H1GA 2LJAA 3EURA 3ZFBA 2HZEA 2H75A 4V2NA 1M99A 1YEXA 4GXZA 1K0MA 2C8UA 1TRVA 1FB0A 2K6VA 2LSTA 4X0XA 3TOUA 1PFOA 2LQOA 1HYUA 1SVMA 3KJYA 4MJCA 1SK2A 2HFDA 2O87A 1KEBA 4IW9A 2Z9SA 3E0UA 4JBBA 4GRFA 1PL1A 4N0VA 3F4TA 3ZMKA 3QOUA 3LW9A 3G7YA 1Z6MA 4KH7A 4EKZA 4KX4A 3CHXC 4AKHA 2QKEA 3HHVA 2C3QA 3LSZA 3IA1A 2GZYA 4ZL7A 4EDYA 2JZSA 1Q4JA 2VAFA 5CRDA 1BYEA 5IMZA 2LV3A 3BCKA 1V58A 3IHQA 4PHZC 4J56E 5F0GA 19GSA 1PQNA 2MBSA 4DSQA 1GUKA 1V98A 3FRCA 3MDKA 1EOGA 3KCMA 2TRXA 2H1LA 2NTOA 4KAEA 2YOIA 3UL3A 2NPBA 3BBYA 1KNGA 1EZKA 3FY7A 1T8EB 1PKWA 3L0HA 3IC4A 4EVMA 3CRUA 2WW2A 1SK0A 1PA3A 1EGOA 1OYJA 3PH9A 1PRXA 2HXKA 2F51A 4PURA 1GSFA 4L5OA 4XRAA 4IGJA 3QPMA 4WF5A 2B5XA 2ALBA 3HD5A 2YCDA 2DC5A 1W4VA 3NOFA 4K2DA 3CMIA 3FR3A 1OE8A 3O76A 4Q5FA 5G31A 4IHUA 2VCQA 4GTUA 1ON4A 1EV9A 2YPMA 5GAPD 3BD2A 1O81A 2OADA 3ZTLA 3UOMA 2L59A 2LRTA 3RFRC 5DCHA 1YF1A 4K7IA 4AJ7A 1OC3A 1QGVA 2OACA 4KW6A 5HR0A 3M0FA 5ECQB 1PGTA 4JRRA 1X5EA 1MD4A 3CBUA 4ZIJA 5ECIB 2C3TA 2HSYA 4OMVA 3TRXA 2B1KA 3PR8A 1K0BA 2A4VA 1V2AA 3WD6A 3UARA 4KGIA 3WT2A 2GSQA 4ECJA 2HRNA 1R26A 2WS2A 5C00A 3GRXA 5CYYA 4WETA 2AHEA 4OWYA 1ZZYA 1R5PA 3KP9A 3ME8A 4MZWA 1ERWA 4NXIA 1WIKA 3GA4A 1FB6A 1SVOA 4ZB7A 3O3TA 1F3BA 4PNGA 4G0LA 3CSJA 5DJLA 3UAPA 3I9V2 4O32A 1XWKA 2HNLA 4BL7B 4TXOB 2VO4A 4TOPA 1Q98A 2RM6A 4HU9A 3UJ1A 2FHEA 4RI7A 2O36A 4G10A 2ZNMA 3KGKA 1JZOA 2H1AA 4KDXA 3APQA 3ME7A 1EGRA 4HDEA 2ON7A 4MPGA 22GSA 3W8SA 1O8XA 3J7Yb 4ACSA 2V6OA 2M72A 1BAYA 2VL2C 4HS1A 2C0GA 4XHMA 4L0UA 1AIUA 4FYCA 5IOXA 3MNGA 1JLVA 1B8XA 1BX9A 2VD1A 3ZL5A 3ZREA 2I81A 3TOTA 4BPYA 1SKRB 3EU4A 3F9UA 1FW1A 1TP9A 1A2JA 5EY6A 5CNWA 4IJIA 5D73A 3MAKA 1YKCA 2GQKA 5J40A 5F05A 2NVLA 2O89A 4LL4B 1J0FA 2C0DA 3E3EA 3IE3A 2XPEA 1JFUA 1TOFA 1X0RA 4MJBA 4IQ1A 2GSTA 4LL1B 5KN3A 1A23A 1K0CA 2A2PA 2PPTA 3UVTA 1SYXA 2UV8G 4YAVA 2K8SA 5ECPB 3QD9A 1K0OA 4KDUA 1A2LA 2VM1A 4WBRD 5D8IA 3R3EA 2IMKA 3KD0A 18GSA 3BJ5A 1WRYA 4KF9A 1TRWA 2G2QA 2YANA 4TXOA 2VL2A 1ZL9A 4H86A 4EUYA 1EP8A 3US3A 4MZBA 3EYTA 4N3ZA 2IN3A 2IMFA 1YEPA 5AN1A 2CQ9A 2LNTA 2L5LA 1ABAA 1DE1A 1O73A 2B5EA 5IPHA 2HRAA 1WWJA 1VGLA 2H1DA 2H76A 3HJOA 1LJRA 1Y6EA 2PVQA 2XPDA 4HSCX 4WF4A 2H0IA 1QQ2A 2MMNA 4XTSA 1WJKA 2NBSA 5ECLB 8GSSA 3A2XA 1AQVA 3WGDA 5ECKB 3IPZA 4EL1A 2V6KA 1GTIA 4MF5A 4CDOA 2KP2A 2R4VA 3I43A 4PTSA 17GSA 2DJ0A 3IR4A 20GSA 2AB6A 2FCHA 4MPFA 3KMOA 3ZVJD 4PQIA 4DSRA 1AXDA 2E7PA 1QK8A 2GSRA 3U6VA 2WB9A 1F3AA 1ZGNA 1A8YA 4HQZA 2HYXA 4ZL8A 2PGTA 4WEYA 2EIOA 4IP6A 1M3JA 2P5RA 2OT3A 1SL0B 4NHZA 1LBKA 1BEDA 5KOWA 2LUSA 3QAWA 1HNCA 2CZ2A 1G0TA 2QSIA 1J08A 3I6AA 10GSA 2N5AA 1Z3EA 5A5KA 1ERTA 1FOHA 3FHKA 2H72A 5DDLA 2DJ3A 4GQFA 2X8HA 2AYTA 2HLSA 3O6TA 1MEKA 4D73B 3WT1A 3ZYWA 1AQXA 2WJUA 6GSSA 3UVHA 3CQFA 3GURA 3GSTA 3G7IA 2L4CA 2VL9A 1THOA 3F8UA 4G19A 3F6FA 1QXHA 1M9BA 5A4WA 5J3RA 1QUWA 2FWFA 2FA4A 3HJPA 4HU7A 2DBCA 1QMVA 4BVXB 4MH2A 4F0BA 3LGCA 4GDFA 1YF0A 3D22A 2H1BA 1XWGA 3MWHA 4EC0A 4XCSA 2B3SA 4V2LA 2K18A 2QA1A 1RK4A 2CT6A 5ECOB 3BOAA 3M1GA 4IVFA 2YZUA 2XBIA 4Z2UA 2X99A 1R5AA 2L4QA 3F3RA 1GTBA 4TKYA 5IMDA 3RGBC 4WXTA 2LEGA 3TRQA 1F37A 3TJFA 2B7JA 1TU8A 5AISA 1M2DA 5JCWA 1B9YC 3EWLA 2P0GA 2X4AA 1SK1A 2I3YA 3P90A 3FZ9A 2BJXA 4I97A 2R5GA 2L6CA 4QL7A 2VIMA 5G2ZA 2HI7A 9GSSA 2LRNA 2TIRA 1B48A 3GKXA 4TR4A 4EE0A 1TKDB 2PWJA 4JU5A 1GSUA 3D21A 3WGXA 4X43A 3F3QA 4AI6A 4I2TA 4PQ1A 1WE0A 5CO3A 4IP1A 4ZXGA 2H0HA 1GNWA 4D73A 5JWRB 2H8LA 2GTUA 2DIZA 4EIPA 4PI0C 11GSA 2A4HA 3HVSA 6GSVA 2VLTA 5J4VA 5B8BA 1HD2A 4ZILA 4O5UA 2CVDA 1OKTA 3SBCA 4N30A 4POLA 5ELGA 4BVXA 5DALB 1UC7A 1XZOA 3K8NA 5C04A 1UVZA 2PU9C 4NV5A 1TDIA 1AW9A 1SU9A 3IAM2 1GSEA 2DIYA 4KSMA 3FR6A 5IOWA 1FVJA 2ZUPA 2OKAA 1U88A 1SJZA 4X1UA 3Q18A 1V40A 2JL4A 4ZBBA 2FWGA 1FOVA 2JZRA 1URMA 1VF1A 5ELAA 2OJLA 2WCIA 1U3AA 1GTUA 2B5YA 3ED3A 3L4NA 2O7KA 3QCPA 2EFEA 1G6WA 2CAQA 2VCXA 2GGTA 4KSOA 3EMPA 3KMNA 4AJ8A 2MZCA 4Q5NA 1A2MA 1TU7A 2HSMB 1LU4A 4IBPA 3L9VA 1F2EA 3PINA 1RQMA 3C73A 3GSSA 5G1KA 3ZITA 3ZLPA 2WZ9A 1XXUA 2OBIA 5A1NB 2FD3A 12GSA 5BRTA 3Q19A 4V1Ap 4E8HA 1PD21 5HR3A 3ZRDA 3S9FA 4WKWA 2KP1A 1H75A 5ECSA 2LKUA 2LTKA 3HVXA 5A4UA 2CZ3A 3G7JA 2YN1A 1TK5B 2RLIA 2VCVA 4IJ3A 1YVLA 3E9JB 3AY8A 2G0FA 4ID0A 5A5HB 1DSBA 4O92A 1XVQA 1SKSB 1XG8A 4PGTA 2AUVA 1M7TA 3CTFA 1T1VA 2HSNB 4YAPA 2VM2A 3GYKA 2IWTA 1XBSA 1S3AA 3HVNA 3L9UA 1CQGA 2HZFA 1GUHA 1USBA 3ERWA 1VRSD 2WW0A 5DALA 2O85A 4FIWA 2PBJA 5D9WA 3TGZA 4Z7XA 4TVEA 1YEWC 3PGTA 3TKSC 2CX4A 3A3TA 1JLWA 3D6IA 5F06A 5INYA 4F0CA 3EU3A 3HXSA 2X8GA 4POKA 2I9HA 2WULA 3HDCA 3NZNA 1WP0A 4V2MA 1SENA 3LYPA 2N5BA 2WW1A 2TRCP 1O85A 3VWUA 1AAZA 2R6KA 3GL5A 5J41A 2KUCA 3GNJA 5LNKe 1JZWA 2F9SA 3VFIA 4MZCA 3F63A 4NHWA 2WZSA 3WGEA 1GUMA 2GSSA 1B4PA 4OO4A 2H66A 4BVYB 4HQSA 3APOA 3LQ7A 1BJXA 2RM5A 2R0PA 1GLPA 2HSMA 2IJYA 4J2FA 5G5EA 5G5FA 4RUVA 3GL3A 3M8NA 2EIRA 2FUG2 3UMAA 2HT9A 3DEXA 3TCOA 3KZQA 2J23A 3NIVA 2RUEA 3V1WA 4PUAA 3BCIA 4PUFC 3KP8A 1H4OA 4F9ZA 5J4UA 3HMJG 2QC7A 3IBHA 4ZB8A 3FZAA 2MYGA 5A5HA 1M3IA 4L0WA 4F82A 3QFAC 4N0ZA 3TKSA 1I5GA 3IV4A 4NWYA 3RPNA 3APSA 2E2GA 4GCIA 2L6DA 1EV4A 2L57A 4JZQA 3CTGA 4JE1A 2B6MA 1F6MC 5IQYA 3MSZA 4F03A 2CAIA 2O8VB 2YZHA 3QAVA 1OVNA 4QMKA 3CSIA 4HEA2 3EMXA 4NV2A 1IYIA 5F07A 1Z7RA 4I8BA 1GP1A 2OA7A 2CV4A 1XVWA 3RDWA 5DBQA 3IXRA 2DMLA 5HR1A 4N11A 2UZ8A 2LNSA 1OC9B 2FA8A 3C7MA 5EL8A 2O5VA 1ZCPA 3H8QA 5LD0A 3KH7A 3VWVA 1DBYA 3F0IA 1UN2A 4BVYA 2NDOA 4LMWA 1XW5A 4A5PA 1A8LA 3A5WA 2R3XA 1SYRA 5G1LA 1TXXA 4BL7A 4BWSA 4NMUA 5CRHA 3DRNA 1PKZA 1F9MA 2ES7A 4NPBA 1CQHA 2YJ7A 5B7CA 4YQVA 3GTUB 3LJRA 2C1YA 4EF0A 2QA2A 4G0IA 2VLVA 5DJMA 1FG4A 3HY2A 1YZXA 1U3IA 3VK9A 1XOAA 1GSSA 3CXGA 5IMAA 3KEBA 1FAAA 2X49A 3VURA 2MMAA 4RQXA 5GSSA 3IHGA 1SD9A 1XWBA 4OD7A 2MMZA 4AJ6A 4MA9A 3ERFA 3TJGA 5IMVA 4HUAA 2GQMA 2FGXA 2YJHA 1N25A 3LXZA 2DKIA 1JHBA 4MK3A 1YQ1A 4Z2RA 4GSSA 3DVWA 4TXVA 3M9JA 1S3RA 4KNDA 4AF2A 5AIVA 4PQHA 3HZ8A 3GFKA 5EPFA 1TW9A 4I2UA 3ZFLA 1ZYQB 1SKWB 5AGYA 1GSDA 1K3YA 5L71A 3DD3A 4MJEA 2B7KA 3DMLA 4K9ZA 1GWCA 4PXOA 3PPUA 1OC9A 1Z7PA 2N5FA 5EVOA 1PMTA 5ID2B 1GULA 3KTLA 3Q74A 1Z5YE 2AV4A 5J4YA 1IYHA 2H0GA 2FLSA 1NHYA 5J47A 4MP4A 5COHA 3LXTA 3LG6A 1MTCA 4E8EA 1OKDA 5AIXA 3VWWA 5H5RA 3ERGA 4K1FA 1O7UA 3DWVA 3IC8A 4GF0A 2DKHA 4XS6A 4MABA 3ISOA 1PN0A 4LLRA 4AKIA 2FWHA 1O8WA 1EEMA 4FYBA 5HFGA 1K0DA 1W89A 5HFKA 2YWOA 3EC3A 5B6NA 5D93A 3QFBC 4GLTA 2HRFA 3JCML 3TKPA 5DCGA 3DKSA 2K9FA 1JZRA 1XWAA 3H79A 1V57A 1TI3A 4EO3A 3HCZA 1G6YA 2YWNA 4EIQA 1TK0B 4HOJA 2OE1A 1QFNA 2CX3A 2H19A 3H93A 2B1LA 1G7EA 3TRPA 1GL8A 3FW2A 5FT3A 3M3MA 4PI2C 4FYUA 2VOCA 2IMEA 3CYNA 4MMMA 1T4ZA 3ZIVA 3UEMA 1Y1UA 2H6YA 2O3EA 4USSA 2LJKA 1K0NA 2WVZA 1OC8A 6GSTA 2KHPA 1N8JA 2I4AA 3H4KA 1XFLA 3GIXA 4LA1A 1E6BA 3N9JA 4JR6A 1HQOA 1X9MB 3D4MA 4ZB9A 3GKKA 5GSTA 4K5RA 2EFHA 5J5NA 3FKFA 4GWRA 2DJKA 2MBTA 3RBTA 4P3YB 1K3LA 3M9KA 3VPTA 3TJJA 5FHIA 3FR9A 4GSNA 1NM3A 2VD0A 5KN0A 4J57E 3VI7A 1S3CA 1PX7A 2J9HA 2E0QA 2FY6A 2IFQB 2H74A 5IPGA 1TK8B 5LCZA 2QGVA 1GLQA 1SJIA 4AKXB 2RUFA 1B4QA 2YWMA 1T3BA 1XW6A 2KLXA 2PMTA 3QDNA 2WVXB 2YV9A 3TUEA 1X9WB 1GSYA 4ISDA 2MMOA 1S4BP 1ST9A 5JCGA 2IMDA 4FQUA 3KH9A 2C0EA 1HNAA 1ML6A 1TTZA 4HJMA 3DVXA 3IAS2 3C1SA 1ILOA 1TJDA 4K2XA 2GVPA 1MDIA 2HSHA 4PNFA 2X8CA 4POMA 2ON5A 4HJ2A 3HYPA 3DYRA 3LWAA 4QL9A 3KXOA 2GZZA 5E59A 4G01A 2V32A 5B6MA 1T00A 5H5QA 1THXA 2H30A 1WOUA 5JWQB 5BMUB 4ULXA 4G0KA 5D9TA 2KOKA 1A0FA 5IM9A 4BIKA 4TR1B 2JACA 2VCTA 4L5LA 5IO0A 2JU5A 3IK7A 1VF2A 4HZ2A 3KIJA 5KN1A 1MDKA 3VLNA 2VCWA 4EXJA 2YNXA 2C0FA 3MYDA 1U6TA 1V9WA 3EPTA 3RPPA 1B9XC 1BG5A 5A4VA 2I1UA 1NW2A 5ECNB 4LMVA 1A24A 2E2MA 2F8AA 1S3DA 2F3MA 4WR5A 3KM6A 1ZOFA 3LYKA 3N5OA 4XS1A 5GAND 3P7XA 1SL2B 5ECHB 4IELA 1HNBA 2IFQA 3GKMA 2GDRA 2WW3A 3RAZA 3GN3A 4FO5A 3D5JA 4E68A 1PX6A 2WVXA 3GV1A 3D4TA 3IOSA 4FH8A 4XS4B 4JR4A 2JSZA 3GKNA 1GNEA 2WGRA 4O5QA 1M0UA 5D9VA 1TI1A 4BA7A 1J9BA 3ZZXA 2IPAA 1SJ6A 4ECIA 2HRKB 1Z6NA 3A2WA 4ECBA 3TU3B 5DQSA 4K7NA 4TR3A 4K8MA 2WRTA 1ZYPA 1TRSA 2YP6A 1SL1B 6GSYA 4WR4A 4K0GA 5BMUA 2WDUA 3SWLA 4K0NA 4FXYP 2JZTA 1KBNA 5KOXA 4TR1A 3LEFA 1X5CA 3CSHA 6GSWA 2VKZG 1YDKA 4CW9A 2EC4A 4KCEA 3TJKA 1DE2A 2M80A 3U5RE 3UBKA 2R2JA 3HA9A 4RQRA 1MD3A 4AKGA 2JADA 2V41A 5CRWA 1NHOA 2OE3A 13GSA 5DAKB 3HJMA 1BQ7A 5HFIA 1K3OA 5HQPA 3UIWA 2M46A 1AQWA 3ZMLA 2WVYA 5CP1A 2XC2A 4KCAA 5A1NA 2FNOA 1T7PB 3C8EA 2LRCA 1AC1A 2JSYA 3C71A 3VPQA 4DVCA 2C80A 2IMIA 5H5SA 4OFNA 3QAGA 2AJQB 1Y25A 4AGSA 4TN8A 1FHEA 5E4WA 5GZZB 4Z2TA 1WPIA 3LFLA 1EOHA 1SD8A 2YWIA 1X5DA 4XS4A 4L8EA 5A34B 1XWCA 5IIZA 5ECMB 4GSTA 1RW1A
chains in the Genus database with same CATH topology
2K8VA 2HSNA 1PL2A 2R0GA 5HR2A 4XRDA 3TJBA 4YH2A 1X9SB 2H71A 5DVBA 3L78A 1VF4A 4WBJA 3L9SA 2HRKA 1M2BA 4MJAA 1M9AA 1BG1A 1R7HA 3W6GA 3IK9A 1U87A 1YY7A 2P5QA 1UA5A 2GT5A 4IN0A 2VUPA 3G9BA 3I69A 2DJ1A 5ABRA 5B8AA 4DSSB 6GSUA 3HKRA 2CVBA 2IIYA 2OBKA 4O7HA 3J7Yk 2GZPA 4K6XA 3IRAA 5IO2A 4MF6A 2DJ2A 1ZYEA 2PN8A 5CREA 4YQMA 4PX1A 4I6XA 1GRXA 5KEJA 2GS3A 5DAKA 5CAXA 4EDZA 1OE7A 3HVVA 4KUNA 3GH6A 3ZIJA 1VF3A 3D0ZA 4HZ4A 2H6XA 2CA8A 2XHFA 5ENUA 2GQLA 3FMWA 2C3NA 4CHSA 1MDJA 3QMXA 4ZBDA 1M2AA 3ZVJA 2EFDA 4TW5A 3TKSE 3GH9A 2OE0A 1XOBA 4KA0A 3GX0A 16GSA 3TKRA 4I5QA 2PERA 4KE3A 3UBLA 2XBQA 4KDYA 4OCEA 1JZDA 4CY8A 3W8JA 1KTEA 2LJRA 1GH2A 1TRUA 4RI6A 3CRTA 2L5OA 1ZYNA 5A34A 1O6JA 1Z9HA 2V1MA 4DEJA 2HE3A 3GHAA 3H1NA 1FO5A 2DMMA 4CY6A 4YQUA 4XIHA 3A5IA 4QQ7A 3KTBA 2BMXA 2DLXA 4TRXA 3QR6A 5D9XA 5IMFA 4K7OA 3WYWA 2H70A 2EIQA 3CWGA 1GTAA 4YKFA 2PVOC 3MIXA 2REMA 5J9CA 1PN9A 1AUCA 1PSQA 3TKQA 4MNNA 1GSQA 2WFCA 3EE2A 1EWXA 1BF5A 4DSSA 4ZL9A 2IL3A 2HQTA 4KB3A 4G2EA 5FWGA 1FVKA 1A0RP 1NSWA 2H6ZA 4O5RA 4ECCA 5G30A 5DQYA 1ACVA 3P2AA 3EINA 2VL3A 2GT6A 3FK8A 7GSSA 4ML1A 1G7OA 3GX8A 3F4RA 3GMFA 3TB2A 1YKAA 2VLUA 4IKHA 3VI5A 1WMJA 3HZ4A 2R0CA 1ERVA 2FWEA 1XCCA 4GQCA 1YJ6A 1OAZA 5D96A 3FEUA 1ZMAA 1EP7A 2HZEB 4HI7A 2D2ZA 5IMCA 2PUKC 2A2RA 4MH3A 2CVKA 5ECRB 3EVIA 4W66A 3A2VA 2EFCA 4MLYA 3GTUA 4ZBAA 2BTOT 2P31A 2LQQA 2GLRA 4OO5A 3P8WA 2X64A 2V2GA 4BWQA 1TXUA 2DSAA 2C4JA 14GSA 4ILFA 4Q5RA 1E2YA 4ML6A 2R37A 3R2QA 3OR5A 1ERUA 4V1Ag 4ZB6A 5F8BA 3VWXA 5JCUA 3TDGA 3Q6OA 3FZ5A 3F4SA 4OFTA 1EEJA 2RIIA 4YKGA 3DXBA 4F2IA 4K5SA 4N10A 1DUGA 1I9DA 3FYGA 4POBA 3C1RA 2ZCTA 1XPVA 4TR0A 1R4WA 3F6DA 2VCZA 2AAWA 4IS0A 4ICYA 2A2SA 5J9BA 1XIYA 1C72A 6GSXA 2H01A 5ID2A 2H73A 3RHCA 3FZ4A 1N2AA 4IQAA 3DGQA 1SVLA 1T4YA 5CRGA 4MF7A 3RHBA 3LORA 4NAXA 3GUSA 4OFMA 2DJJA 3IDVA 2LS5A 1XW9A 4JEDA 4Q5QA 4X4JA 2F8FA 5JWOB 4MDCA 2YV7A 1K0AA 4G9HA 4MCUA 4OCFA 5KN2A 3DIEA 2H1GA 2LJAA 3EURA 3ZFBA 2HZEA 2H75A 4V2NA 1M99A 1YEXA 4GXZA 1K0MA 2C8UA 1TRVA 1FB0A 2K6VA 2LSTA 4X0XA 3TOUA 2LQOA 1HYUA 1SVMA 3KJYA 4MJCA 1SK2A 2HFDA 2O87A 1KEBA 4IW9A 2Z9SA 3E0UA 4JBBA 4GRFA 1PL1A 4N0VA 3F4TA 3ZMKA 3QOUA 3LW9A 3G7YA 1Z6MA 4KH7A 4EKZA 4KX4A 4AKHA 2QKEA 3HHVA 2C3QA 3LSZA 3IA1A 2GZYA 4ZL7A 4EDYA 2JZSA 1Q4JA 2VAFA 5CRDA 1BYEA 5IMZA 2LV3A 3BCKA 1V58A 3IHQA 4J56E 5F0GA 19GSA 1PQNA 2MBSA 4DSQA 1GUKA 1V98A 3FRCA 3MDKA 1EOGA 3KCMA 2TRXA 2H1LA 2NTOA 4KAEA 2YOIA 3UL3A 2NPBA 3BBYA 1KNGA 1EZKA 3FY7A 1T8EB 1PKWA 3L0HA 3IC4A 4EVMA 3CRUA 1SK0A 1PA3A 1EGOA 1OYJA 3PH9A 1PRXA 2HXKA 2F51A 4PURA 1GSFA 4L5OA 4XRAA 4IGJA 3QPMA 4WF5A 2B5XA 2ALBA 3HD5A 2YCDA 2DC5A 1W4VA 3NOFA 4K2DA 3CMIA 3FR3A 1OE8A 3O76A 4Q5FA 5G31A 4IHUA 2VCQA 4GTUA 1ON4A 1EV9A 2YPMA 5GAPD 3BD2A 1O81A 2OADA 3ZTLA 3UOMA 2L59A 2LRTA 5DCHA 1YF1A 4K7IA 4AJ7A 1OC3A 1QGVA 2OACA 4KW6A 5HR0A 3M0FA 5ECQB 1PGTA 4JRRA 1X5EA 1MD4A 3CBUA 4ZIJA 5ECIB 2C3TA 2HSYA 4OMVA 3TRXA 2B1KA 3PR8A 1K0BA 2A4VA 1V2AA 3WD6A 3UARA 4KGIA 3WT2A 2GSQA 4ECJA 2HRNA 1R26A 2WS2A 5C00A 3GRXA 5CYYA 4WETA 2AHEA 4OWYA 1ZZYA 1R5PA 3KP9A 3ME8A 4MZWA 1ERWA 4NXIA 1WIKA 3GA4A 1FB6A 1SVOA 4ZB7A 3O3TA 1F3BA 4PNGA 4G0LA 3CSJA 5DJLA 3UAPA 3I9V2 4O32A 1XWKA 2HNLA 4BL7B 4TXOB 2VO4A 4TOPA 1Q98A 2RM6A 4HU9A 3UJ1A 2FHEA 4RI7A 4G10A 2ZNMA 3KGKA 1JZOA 2H1AA 4KDXA 3APQA 3ME7A 1EGRA 4HDEA 2ON7A 4MPGA 22GSA 3W8SA 1O8XA 3J7Yb 4ACSA 2V6OA 2M72A 1BAYA 2VL2C 4HS1A 2C0GA 4XHMA 4L0UA 1AIUA 4FYCA 5IOXA 3MNGA 1JLVA 1B8XA 1BX9A 2VD1A 3ZL5A 3ZREA 2I81A 3TOTA 4BPYA 1SKRB 3EU4A 3F9UA 1FW1A 1TP9A 1A2JA 5EY6A 5CNWA 4IJIA 5D73A 3MAKA 1YKCA 2GQKA 5J40A 5F05A 2NVLA 2O89A 4LL4B 1J0FA 2C0DA 3E3EA 3IE3A 2XPEA 1JFUA 1TOFA 1X0RA 4MJBA 4IQ1A 2GSTA 4LL1B 5KN3A 1A23A 1K0CA 2A2PA 2PPTA 3UVTA 1SYXA 2UV8G 4YAVA 2K8SA 5ECPB 3QD9A 1K0OA 4KDUA 1A2LA 2VM1A 4WBRD 5D8IA 3R3EA 2IMKA 3KD0A 18GSA 3BJ5A 1WRYA 4KF9A 1TRWA 2G2QA 2YANA 4TXOA 2VL2A 1ZL9A 4H86A 4EUYA 1EP8A 3US3A 4MZBA 3EYTA 4N3ZA 2IN3A 2IMFA 1YEPA 5AN1A 2CQ9A 2LNTA 2L5LA 1ABAA 1DE1A 1O73A 2B5EA 5IPHA 2HRAA 1WWJA 1VGLA 2H1DA 2H76A 3HJOA 1LJRA 1Y6EA 2PVQA 2XPDA 4WF4A 2H0IA 1QQ2A 2MMNA 4XTSA 1WJKA 2NBSA 5ECLB 8GSSA 3A2XA 1AQVA 3WGDA 5ECKB 3IPZA 4EL1A 2V6KA 1GTIA 4MF5A 4CDOA 2KP2A 2R4VA 3I43A 4PTSA 17GSA 2DJ0A 3IR4A 20GSA 2AB6A 2FCHA 4MPFA 3KMOA 3ZVJD 4PQIA 4DSRA 1AXDA 2E7PA 1QK8A 2GSRA 3U6VA 2WB9A 1F3AA 1ZGNA 1A8YA 4HQZA 2HYXA 4ZL8A 2PGTA 4WEYA 2EIOA 4IP6A 2P5RA 2OT3A 1SL0B 4NHZA 1LBKA 1BEDA 5KOWA 2LUSA 3QAWA 1HNCA 2CZ2A 1G0TA 2QSIA 1J08A 3I6AA 10GSA 2N5AA 1Z3EA 5A5KA 1ERTA 1FOHA 3FHKA 2H72A 5DDLA 2DJ3A 4GQFA 2X8HA 2AYTA 2HLSA 3O6TA 1MEKA 4D73B 3WT1A 3ZYWA 1AQXA 2WJUA 6GSSA 3UVHA 3GURA 3GSTA 3G7IA 2L4CA 2VL9A 1THOA 3F8UA 4G19A 3F6FA 1QXHA 1M9BA 5A4WA 5J3RA 1QUWA 2FWFA 2FA4A 3HJPA 4HU7A 2DBCA 1QMVA 4BVXB 4MH2A 4F0BA 3LGCA 4GDFA 1YF0A 3D22A 2H1BA 1XWGA 3MWHA 4EC0A 4XCSA 2B3SA 4V2LA 2K18A 2QA1A 1RK4A 2CT6A 5ECOB 3BOAA 3M1GA 4IVFA 2YZUA 2XBIA 4Z2UA 2X99A 1R5AA 2L4QA 3F3RA 1GTBA 4TKYA 5IMDA 4WXTA 2LEGA 3TRQA 1F37A 3TJFA 2B7JA 1TU8A 5AISA 1M2DA 5JCWA 1B9YC 3EWLA 2P0GA 2X4AA 1SK1A 2I3YA 3P90A 3FZ9A 2BJXA 4I97A 2R5GA 2L6CA 4QL7A 2VIMA 5G2ZA 2HI7A 9GSSA 2LRNA 2TIRA 1B48A 3GKXA 4TR4A 4EE0A 1TKDB 2PWJA 4JU5A 1GSUA 3D21A 3WGXA 4X43A 3F3QA 4AI6A 4I2TA 4PQ1A 1WE0A 5CO3A 4IP1A 4ZXGA 2H0HA 1GNWA 4D73A 5JWRB 2H8LA 2GTUA 2DIZA 4EIPA 11GSA 2A4HA 3HVSA 6GSVA 2VLTA 5J4VA 5B8BA 1HD2A 4ZILA 4O5UA 2CVDA 1OKTA 3SBCA 4N30A 4POLA 5ELGA 4BVXA 5DALB 1UC7A 1XZOA 3K8NA 5C04A 1UVZA 2PU9C 4NV5A 1TDIA 1AW9A 1SU9A 3IAM2 1GSEA 2DIYA 4KSMA 3FR6A 5IOWA 1FVJA 2ZUPA 2OKAA 1U88A 1SJZA 4X1UA 3Q18A 1V40A 2JL4A 4ZBBA 2FWGA 1FOVA 2JZRA 1URMA 1VF1A 5ELAA 2OJLA 2WCIA 1U3AA 1GTUA 2B5YA 3ED3A 3L4NA 2O7KA 3QCPA 2EFEA 1G6WA 2CAQA 2VCXA 2GGTA 4KSOA 3EMPA 3KMNA 4AJ8A 2MZCA 4Q5NA 1A2MA 1TU7A 2HSMB 1LU4A 4IBPA 3L9VA 1F2EA 3PINA 1RQMA 3C73A 3GSSA 5G1KA 3ZITA 3ZLPA 2WZ9A 1XXUA 2OBIA 5A1NB 2FD3A 12GSA 5BRTA 3Q19A 4V1Ap 4E8HA 1PD21 5HR3A 3ZRDA 3S9FA 4WKWA 2KP1A 1H75A 5ECSA 2LKUA 2LTKA 3HVXA 5A4UA 2CZ3A 3G7JA 2YN1A 1TK5B 2RLIA 2VCVA 4IJ3A 1YVLA 3E9JB 3AY8A 2G0FA 4ID0A 5A5HB 1DSBA 4O92A 1XVQA 1SKSB 4PGTA 2AUVA 1M7TA 3CTFA 1T1VA 2HSNB 4YAPA 2VM2A 3GYKA 2IWTA 1XBSA 1S3AA 3L9UA 1CQGA 2HZFA 1GUHA 1USBA 3ERWA 1VRSD 5DALA 2O85A 4FIWA 2PBJA 5D9WA 3TGZA 4Z7XA 4TVEA 3PGTA 3TKSC 2CX4A 3A3TA 1JLWA 3D6IA 5F06A 5INYA 4F0CA 3EU3A 3HXSA 2X8GA 4POKA 2I9HA 2WULA 3HDCA 3NZNA 1WP0A 4V2MA 1SENA 3LYPA 2N5BA 2TRCP 1O85A 3VWUA 1AAZA 2R6KA 3GL5A 5J41A 2KUCA 3GNJA 5LNKe 1JZWA 2F9SA 3VFIA 4MZCA 3F63A 4NHWA 3WGEA 1GUMA 2GSSA 1B4PA 4OO4A 2H66A 4BVYB 4HQSA 3APOA 3LQ7A 1BJXA 2RM5A 2R0PA 1GLPA 2HSMA 2IJYA 4J2FA 5G5EA 5G5FA 4RUVA 3GL3A 3M8NA 2EIRA 2FUG2 3UMAA 2HT9A 3DEXA 3TCOA 3KZQA 2J23A 3NIVA 2RUEA 3V1WA 4PUAA 3BCIA 4PUFC 3KP8A 1H4OA 4F9ZA 5J4UA 3HMJG 2QC7A 3IBHA 4ZB8A 3FZAA 2MYGA 5A5HA 4L0WA 4F82A 3QFAC 4N0ZA 3TKSA 1I5GA 3IV4A 4NWYA 3RPNA 3APSA 2E2GA 4GCIA 2L6DA 1EV4A 2L57A 4JZQA 3CTGA 4JE1A 2B6MA 1F6MC 5IQYA 3MSZA 4F03A 2CAIA 2O8VB 2YZHA 3QAVA 1OVNA 4QMKA 3CSIA 4HEA2 3EMXA 4NV2A 1IYIA 5F07A 1Z7RA 4I8BA 1GP1A 2OA7A 2CV4A 1XVWA 3RDWA 5DBQA 3IXRA 2DMLA 5HR1A 4N11A 2UZ8A 2LNSA 1OC9B 2FA8A 3C7MA 5EL8A 2O5VA 1ZCPA 3H8QA 5LD0A 3KH7A 3VWVA 1DBYA 3F0IA 1UN2A 4BVYA 2NDOA 4LMWA 1XW5A 4A5PA 1A8LA 3A5WA 2R3XA 1SYRA 5G1LA 1TXXA 4BL7A 4BWSA 4NMUA 5CRHA 3DRNA 1PKZA 1F9MA 2ES7A 4NPBA 1CQHA 2YJ7A 5B7CA 4YQVA 3GTUB 3LJRA 2C1YA 4EF0A 2QA2A 4G0IA 2VLVA 5DJMA 1FG4A 3HY2A 1YZXA 1U3IA 3VK9A 1XOAA 1GSSA 3CXGA 5IMAA 3KEBA 1FAAA 2X49A 3VURA 2MMAA 4RQXA 5GSSA 3IHGA 1SD9A 1XWBA 4OD7A 2MMZA 4AJ6A 4MA9A 3ERFA 3TJGA 5IMVA 4HUAA 2GQMA 2FGXA 2YJHA 1N25A 3LXZA 2DKIA 1JHBA 4MK3A 1YQ1A 4Z2RA 4GSSA 3DVWA 4TXVA 3M9JA 4KNDA 4AF2A 5AIVA 4PQHA 3HZ8A 3GFKA 5EPFA 1TW9A 4I2UA 3ZFLA 1ZYQB 1SKWB 5AGYA 1GSDA 1K3YA 5L71A 3DD3A 4MJEA 2B7KA 3DMLA 4K9ZA 1GWCA 4PXOA 3PPUA 1OC9A 1Z7PA 2N5FA 5EVOA 1PMTA 5ID2B 1GULA 3KTLA 3Q74A 1Z5YE 2AV4A 5J4YA 1IYHA 2H0GA 2FLSA 1NHYA 5J47A 4MP4A 5COHA 3LXTA 3LG6A 1MTCA 4E8EA 1OKDA 5AIXA 3VWWA 5H5RA 3ERGA 4K1FA 1O7UA 3DWVA 3IC8A 4GF0A 2DKHA 4XS6A 4MABA 3ISOA 1PN0A 4LLRA 4AKIA 2FWHA 1O8WA 1EEMA 4FYBA 5HFGA 1K0DA 1W89A 5HFKA 2YWOA 3EC3A 5B6NA 5D93A 3QFBC 4GLTA 2HRFA 3JCML 3TKPA 5DCGA 3DKSA 2K9FA 1JZRA 1XWAA 3H79A 1V57A 1TI3A 4EO3A 3HCZA 1G6YA 2YWNA 4EIQA 1TK0B 4HOJA 2OE1A 1QFNA 2CX3A 2H19A 3H93A 2B1LA 1G7EA 3TRPA 1GL8A 3FW2A 5FT3A 3M3MA 4FYUA 2VOCA 2IMEA 3CYNA 4MMMA 1T4ZA 3ZIVA 3UEMA 1Y1UA 2H6YA 4USSA 2LJKA 1K0NA 1OC8A 6GSTA 2KHPA 1N8JA 2I4AA 3H4KA 1XFLA 3GIXA 4LA1A 1E6BA 3N9JA 4JR6A 1HQOA 1X9MB 3D4MA 4ZB9A 3GKKA 5GSTA 4K5RA 2EFHA 5J5NA 3FKFA 4GWRA 2DJKA 2MBTA 3RBTA 4P3YB 1K3LA 3M9KA 3VPTA 3TJJA 5FHIA 3FR9A 4GSNA 1NM3A 2VD0A 5KN0A 4J57E 3VI7A 1S3CA 1PX7A 2J9HA 2E0QA 2FY6A 2IFQB 2H74A 5IPGA 1TK8B 5LCZA 2QGVA 1GLQA 1SJIA 4AKXB 2RUFA 1B4QA 2YWMA 1T3BA 1XW6A 2KLXA 2PMTA 3QDNA 2YV9A 3TUEA 1X9WB 1GSYA 4ISDA 2MMOA 1ST9A 5JCGA 2IMDA 4FQUA 3KH9A 2C0EA 1HNAA 1ML6A 1TTZA 4HJMA 3DVXA 3IAS2 3C1SA 1ILOA 1TJDA 4K2XA 2GVPA 1MDIA 2HSHA 4PNFA 2X8CA 4POMA 2ON5A 4HJ2A 3HYPA 3DYRA 3LWAA 4QL9A 3KXOA 2GZZA 5E59A 4G01A 2V32A 5B6MA 1T00A 5H5QA 1THXA 2H30A 1WOUA 5JWQB 5BMUB 4ULXA 4G0KA 5D9TA 2KOKA 1A0FA 5IM9A 4TR1B 2JACA 2VCTA 4L5LA 5IO0A 2JU5A 3IK7A 1VF2A 4HZ2A 3KIJA 5KN1A 1MDKA 3VLNA 2VCWA 4EXJA 2YNXA 2C0FA 3MYDA 1U6TA 1V9WA 3EPTA 3RPPA 1B9XC 1BG5A 5A4VA 2I1UA 1NW2A 5ECNB 4LMVA 1A24A 2E2MA 2F8AA 1S3DA 2F3MA 4WR5A 3KM6A 1ZOFA 3LYKA 3N5OA 4XS1A 5GAND 3P7XA 1SL2B 5ECHB 4IELA 1HNBA 2IFQA 3GKMA 2GDRA 3RAZA 3GN3A 4FO5A 3D5JA 4E68A 1PX6A 3GV1A 3D4TA 3IOSA 4FH8A 4XS4B 4JR4A 2JSZA 3GKNA 1GNEA 2WGRA 4O5QA 1M0UA 5D9VA 1TI1A 4BA7A 1J9BA 3ZZXA 2IPAA 1SJ6A 4ECIA 2HRKB 1Z6NA 3A2WA 4ECBA 3TU3B 5DQSA 4K7NA 4TR3A 4K8MA 2WRTA 1ZYPA 1TRSA 2YP6A 1SL1B 6GSYA 4WR4A 4K0GA 5BMUA 2WDUA 3SWLA 4K0NA 2JZTA 1KBNA 5KOXA 4TR1A 3LEFA 1X5CA 3CSHA 6GSWA 2VKZG 1YDKA 4CW9A 2EC4A 4KCEA 3TJKA 1DE2A 2M80A 3U5RE 3UBKA 2R2JA 3HA9A 4RQRA 1MD3A 4AKGA 2JADA 2V41A 5CRWA 1NHOA 2OE3A 13GSA 5DAKB 3HJMA 1BQ7A 5HFIA 1K3OA 5HQPA 3UIWA 2M46A 1AQWA 3ZMLA 5CP1A 2XC2A 4KCAA 5A1NA 2FNOA 1T7PB 3C8EA 2LRCA 1AC1A 2JSYA 3C71A 3VPQA 4DVCA 2C80A 2IMIA 5H5SA 4OFNA 3QAGA 2AJQB 1Y25A 4AGSA 4TN8A 1FHEA 5E4WA 5GZZB 4Z2TA 1WPIA 3LFLA 1EOHA 1SD8A 2YWIA 1X5DA 4XS4A 4L8EA 5A34B 1XWCA 5IIZA 5ECMB 4GSTA 1RW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8V A;  1PL2 A;  5HR2 A;  4XRD A;  3TJB A;  4YH2 A;  1X9S B;  2H71 A;  5DVB A;  3L78 A;  1VF4 A;  4WBJ A;  3L9S A;  2HRK A;  1M2B A;  4MJA A;  1M9A A;  1R7H A;  3W6G A;  3IK9 A;  1U87 A;  1YY7 A;  2P5Q A;  1UA5 A;  2GT5 A;  4IN0 A;  2VUP A;  3G9B A;  3I69 A;  2DJ1 A;  5ABR A;  5B8A A;  4DSS B;  6GSU A;  3HKR A;  2CVB A;  2IIY A;  2OBK A;  4O7H A;  3J7Y k;  2GZP A;  4K6X A;  3IRA A;  5IO2 A;  4MF6 A;  2DJ2 A;  1ZYE A;  2PN8 A;  5CRE A;  4YQM A;  4PX1 A;  4I6X A;  1GRX A;  5KEJ A;  2GS3 A;  5DAK A;  5CAX A;  4EDZ A;  1OE7 A;  3HVV A;  4KUN A;  3GH6 A;  3ZIJ A;  1VF3 A;  3D0Z A;  4HZ4 A;  2H6X A;  2CA8 A;  2XHF A;  5ENU A;  2GQL A;  2C3N A;  4CHS A;  1MDJ A;  3QMX A;  4ZBD A;  1M2A A;  3ZVJ A;  4TW5 A;  3TKS E;  3GH9 A;  2OE0 A;  1XOB A;  4KA0 A;  3GX0 A;  16GS A;  3TKR A;  4I5Q A;  2PER A;  4KE3 A;  3UBL A;  2XBQ A;  4KDY A;  4OCE A;  1JZD A;  3W8J A;  1KTE A;  2LJR A;  1GH2 A;  1TRU A;  4RI6 A;  3CRT A;  2L5O A;  1O6J A;  1Z9H A;  2V1M A;  4DEJ A;  2HE3 A;  3GHA A;  3H1N A;  1FO5 A;  2DMM A;  4YQU A;  4XIH A;  4QQ7 A;  3KTB A;  2BMX A;  2DLX A;  4TRX A;  3QR6 A;  5D9X A;  5IMF A;  4K7O A;  3WYW A;  2H70 A;  2EIQ A;  1GTA A;  2PVO C;  2REM A;  5J9C A;  1PN9 A;  1AUC A;  1PSQ A;  3TKQ A;  1GSQ A;  2WFC A;  3EE2 A;  1EWX A;  4DSS A;  4ZL9 A;  2IL3 A;  2HQT A;  4KB3 A;  4G2E A;  5FWG A;  1FVK A;  1A0R P;  1NSW A;  2H6Z A;  4O5R A;  4ECC A;  5G30 A;  5DQY A;  1ACV A;  3P2A A;  3EIN A;  2VL3 A;  2GT6 A;  3FK8 A;  7GSS A;  4ML1 A;  1G7O A;  3GX8 A;  3F4R A;  3GMF A;  3TB2 A;  1YKA A;  2VLU A;  4IKH A;  3VI5 A;  1WMJ A;  3HZ4 A;  1ERV A;  2FWE A;  1XCC A;  4GQC A;  1YJ6 A;  1OAZ A;  5D96 A;  3FEU A;  1ZMA A;  1EP7 A;  2HZE B;  4HI7 A;  2D2Z A;  5IMC A;  2PUK C;  2A2R A;  4MH3 A;  2CVK A;  5ECR B;  3EVI A;  3A2V A;  4MLY A;  3GTU A;  4ZBA A;  2BTO T;  2P31 A;  2LQQ A;  2GLR A;  4OO5 A;  3P8W A;  2X64 A;  2V2G A;  4BWQ A;  2DSA A;  2C4J A;  14GS A;  4ILF A;  4Q5R A;  1E2Y A;  4ML6 A;  2R37 A;  3R2Q A;  3OR5 A;  1ERU A;  4V1A g;  4ZB6 A;  5F8B A;  3VWX A;  5JCU A;  3TDG A;  3Q6O A;  3FZ5 A;  3F4S A;  4OFT A;  1EEJ A;  2RII A;  3DXB A;  4F2I A;  4N10 A;  1DUG A;  1I9D A;  3FYG A;  4POB A;  3C1R A;  2ZCT A;  1XPV A;  4TR0 A;  1R4W A;  3F6D A;  2VCZ A;  2AAW A;  4IS0 A;  2A2S A;  5J9B A;  1XIY A;  1C72 A;  6GSX A;  2H01 A;  5ID2 A;  2H73 A;  3RHC A;  3FZ4 A;  1N2A A;  4IQA A;  3DGQ A;  1T4Y A;  5CRG A;  4MF7 A;  3RHB A;  3LOR A;  4NAX A;  3GUS A;  4OFM A;  2DJJ A;  3IDV A;  2LS5 A;  1XW9 A;  4JED A;  4Q5Q A;  2F8F A;  5JWO B;  4MDC A;  2YV7 A;  1K0A A;  4G9H A;  4MCU A;  4OCF A;  5KN2 A;  3DIE A;  2H1G A;  2LJA A;  3EUR A;  3ZFB A;  2HZE A;  2H75 A;  4V2N A;  1M99 A;  1YEX A;  4GXZ A;  1K0M A;  2C8U A;  1TRV A;  1FB0 A;  2K6V A;  2LST A;  4X0X A;  3TOU A;  2LQO A;  1HYU A;  3KJY A;  4MJC A;  1SK2 A;  2HFD A;  2O87 A;  1KEB A;  4IW9 A;  2Z9S A;  3E0U A;  4JBB A;  4GRF A;  1PL1 A;  4N0V A;  3F4T A;  3ZMK A;  3QOU A;  3G7Y A;  1Z6M A;  4KH7 A;  4EKZ A;  4KX4 A;  2QKE A;  3HHV A;  2C3Q A;  3LSZ A;  3IA1 A;  2GZY A;  4ZL7 A;  4EDY A;  2JZS A;  1Q4J A;  2VAF A;  5CRD A;  1BYE A;  5IMZ A;  2LV3 A;  3BCK A;  1V58 A;  3IHQ A;  4J56 E;  5F0G A;  19GS A;  1PQN A;  2MBS A;  4DSQ A;  1GUK A;  1V98 A;  3FRC A;  3MDK A;  1EOG A;  3KCM A;  2TRX A;  2NTO A;  4KAE A;  2YOI A;  3UL3 A;  2NPB A;  3BBY A;  1KNG A;  1EZK A;  3FY7 A;  1T8E B;  1PKW A;  3L0H A;  3IC4 A;  4EVM A;  3CRU A;  1SK0 A;  1PA3 A;  1EGO A;  1OYJ A;  3PH9 A;  1PRX A;  2HXK A;  2F51 A;  4PUR A;  1GSF A;  4L5O A;  4XRA A;  4IGJ A;  3QPM A;  4WF5 A;  2B5X A;  2ALB A;  3HD5 A;  2YCD A;  2DC5 A;  1W4V A;  3NOF A;  4K2D A;  3CMI A;  3FR3 A;  1OE8 A;  3O76 A;  4Q5F A;  5G31 A;  4IHU A;  2VCQ A;  4GTU A;  1ON4 A;  1EV9 A;  2YPM A;  5GAP D;  3BD2 A;  1O81 A;  2OAD A;  3ZTL A;  3UOM A;  2L59 A;  2LRT A;  5DCH A;  1YF1 A;  4K7I A;  4AJ7 A;  1OC3 A;  1QGV A;  2OAC A;  4KW6 A;  5HR0 A;  3M0F A;  5ECQ B;  1PGT A;  4JRR A;  1X5E A;  1MD4 A;  3CBU A;  4ZIJ A;  5ECI B;  2C3T A;  2HSY A;  4OMV A;  3TRX A;  2B1K A;  3PR8 A;  1K0B A;  2A4V A;  1V2A A;  3WD6 A;  3UAR A;  4KGI A;  3WT2 A;  2GSQ A;  4ECJ A;  2HRN A;  1R26 A;  2WS2 A;  5C00 A;  3GRX A;  5CYY A;  4WET A;  2AHE A;  4OWY A;  1ZZY A;  1R5P A;  3KP9 A;  3ME8 A;  4MZW A;  1ERW A;  4NXI A;  1WIK A;  3GA4 A;  1FB6 A;  3O3T A;  1F3B A;  4PNG A;  4G0L A;  3CSJ A;  5DJL A;  3UAP A;  3I9V 2;  4O32 A;  1XWK A;  2HNL A;  4BL7 B;  4TXO B;  2VO4 A;  4TOP A;  1Q98 A;  2RM6 A;  4HU9 A;  3UJ1 A;  2FHE A;  4RI7 A;  4G10 A;  2ZNM A;  3KGK A;  1JZO A;  2H1A A;  4KDX A;  3APQ A;  3ME7 A;  1EGR A;  4HDE A;  2ON7 A;  4MPG A;  22GS A;  3W8S A;  1O8X A;  3J7Y b;  4ACS A;  2V6O A;  2M72 A;  1BAY A;  2VL2 C;  4HS1 A;  2C0G A;  4XHM A;  4L0U A;  1AIU A;  4FYC A;  5IOX A;  3MNG A;  1JLV A;  1B8X A;  1BX9 A;  2VD1 A;  3ZL5 A;  3ZRE A;  2I81 A;  3TOT A;  4BPY A;  1SKR B;  3EU4 A;  3F9U A;  1FW1 A;  1TP9 A;  1A2J A;  5EY6 A;  5CNW A;  4IJI A;  5D73 A;  3MAK A;  1YKC A;  2GQK A;  5F05 A;  2NVL A;  2O89 A;  4LL4 B;  1J0F A;  2C0D A;  3E3E A;  3IE3 A;  2XPE A;  1JFU A;  1TOF A;  1X0R A;  4MJB A;  4IQ1 A;  2GST A;  4LL1 B;  5KN3 A;  1A23 A;  1K0C A;  2PPT A;  3UVT A;  1SYX A;  4YAV A;  2K8S A;  5ECP B;  3QD9 A;  1K0O A;  4KDU A;  1A2L A;  2VM1 A;  4WBR D;  5D8I A;  3R3E A;  2IMK A;  3KD0 A;  18GS A;  3BJ5 A;  1WRY A;  4KF9 A;  1TRW A;  2G2Q A;  2YAN A;  4TXO A;  2VL2 A;  1ZL9 A;  4H86 A;  4EUY A;  1EP8 A;  3US3 A;  4MZB A;  3EYT A;  2IN3 A;  2IMF A;  1YEP A;  5AN1 A;  2CQ9 A;  2LNT A;  2L5L A;  1ABA A;  1DE1 A;  1O73 A;  2B5E A;  5IPH A;  2HRA A;  1WWJ A;  1VGL A;  2H1D A;  2H76 A;  3HJO A;  1LJR A;  1Y6E A;  2PVQ A;  2XPD A;  4WF4 A;  2H0I A;  1QQ2 A;  2MMN A;  4XTS A;  1WJK A;  2NBS A;  5ECL B;  8GSS A;  3A2X A;  1AQV A;  3WGD A;  5ECK B;  3IPZ A;  4EL1 A;  2V6K A;  1GTI A;  4MF5 A;  4CDO A;  2KP2 A;  2R4V A;  3I43 A;  4PTS A;  17GS A;  2DJ0 A;  3IR4 A;  20GS A;  2AB6 A;  2FCH A;  4MPF A;  3KMO A;  3ZVJ D;  4PQI A;  4DSR A;  1AXD A;  2E7P A;  1QK8 A;  2GSR A;  3U6V A;  2WB9 A;  1F3A A;  1ZGN A;  1A8Y A;  4HQZ A;  2HYX A;  4ZL8 A;  2PGT A;  4WEY A;  2EIO A;  4IP6 A;  2P5R A;  1SL0 B;  4NHZ A;  1LBK A;  1BED A;  2LUS A;  3QAW A;  1HNC A;  2CZ2 A;  1G0T A;  2QSI A;  1J08 A;  3I6A A;  10GS A;  2N5A A;  1Z3E A;  5A5K A;  1ERT A;  3FHK A;  2H72 A;  5DDL A;  2DJ3 A;  4GQF A;  2X8H A;  2AYT A;  3O6T A;  2HLS A;  1MEK A;  4D73 B;  3WT1 A;  3ZYW A;  1AQX A;  2WJU A;  6GSS A;  3UVH A;  3GUR A;  3GST A;  3G7I A;  2L4C A;  2VL9 A;  1THO A;  3F8U A;  4G19 A;  3F6F A;  1QXH A;  1M9B A;  5A4W A;  5J3R A;  1QUW A;  2FWF A;  2FA4 A;  3HJP A;  4HU7 A;  2DBC A;  1QMV A;  4BVX B;  4MH2 A;  4F0B A;  3LGC A;  1YF0 A;  3D22 A;  2H1B A;  1XWG A;  3MWH A;  4EC0 A;  4XCS A;  2B3S A;  4V2L A;  2K18 A;  1RK4 A;  2CT6 A;  5ECO B;  3BOA A;  3M1G A;  4IVF A;  2YZU A;  2XBI A;  2X99 A;  1R5A A;  2L4Q A;  3F3R A;  1GTB A;  4TKY A;  5IMD A;  4WXT A;  2LEG A;  3TRQ A;  1F37 A;  3TJF A;  2B7J A;  1TU8 A;  5AIS A;  1M2D A;  5JCW A;  1B9Y C;  3EWL A;  2P0G A;  1SK1 A;  2I3Y A;  3P90 A;  3FZ9 A;  2BJX A;  4I97 A;  2R5G A;  2L6C A;  4QL7 A;  2VIM A;  5G2Z A;  2HI7 A;  9GSS A;  2LRN A;  2TIR A;  1B48 A;  3GKX A;  4TR4 A;  4EE0 A;  1TKD B;  2PWJ A;  4JU5 A;  1GSU A;  3D21 A;  3WGX A;  4X43 A;  3F3Q A;  4I2T A;  4PQ1 A;  1WE0 A;  5CO3 A;  4IP1 A;  4ZXG A;  2H0H A;  1GNW A;  4D73 A;  5JWR B;  2H8L A;  2GTU A;  2DIZ A;  11GS A;  3HVS A;  6GSV A;  2VLT A;  5B8B A;  1HD2 A;  4ZIL A;  2CVD A;  1OKT A;  3SBC A;  4N30 A;  4POL A;  5ELG A;  4BVX A;  5DAL B;  1UC7 A;  1XZO A;  3K8N A;  5C04 A;  1UVZ A;  2PU9 C;  4NV5 A;  1TDI A;  1AW9 A;  1SU9 A;  3IAM 2;  1GSE A;  2DIY A;  4KSM A;  3FR6 A;  5IOW A;  1FVJ A;  2ZUP A;  2OKA A;  1U88 A;  1SJZ A;  4X1U A;  3Q18 A;  1V40 A;  2JL4 A;  4ZBB A;  2FWG A;  1FOV A;  2JZR A;  1URM A;  1VF1 A;  5ELA A;  2OJL A;  2WCI A;  1U3A A;  1GTU A;  2B5Y A;  3ED3 A;  3L4N A;  2O7K A;  3QCP A;  1G6W A;  2CAQ A;  2VCX A;  2GGT A;  4KSO A;  3EMP A;  3KMN A;  4AJ8 A;  2MZC A;  4Q5N A;  1A2M A;  1TU7 A;  2HSM B;  1LU4 A;  4IBP A;  3L9V A;  1F2E A;  3PIN A;  1RQM A;  3C73 A;  3GSS A;  5G1K A;  3ZIT A;  3ZLP A;  2WZ9 A;  1XXU A;  2OBI A;  2FD3 A;  12GS A;  3Q19 A;  4V1A p;  4E8H A;  1PD2 1;  5HR3 A;  3ZRD A;  3S9F A;  4WKW A;  2KP1 A;  1H75 A;  5ECS A;  2LKU A;  2LTK A;  3HVX A;  5A4U A;  2CZ3 A;  3G7J A;  2YN1 A;  1TK5 B;  2RLI A;  2VCV A;  4IJ3 A;  3E9J B;  3AY8 A;  2G0F A;  4ID0 A;  1DSB A;  4O92 A;  1XVQ A;  1SKS B;  4PGT A;  2AUV A;  1M7T A;  3CTF A;  1T1V A;  2HSN B;  4YAP A;  2VM2 A;  3GYK A;  2IWT A;  1XBS A;  1S3A A;  3L9U A;  1CQG A;  2HZF A;  1GUH A;  1USB A;  3ERW A;  1VRS D;  5DAL A;  2O85 A;  4FIW A;  2PBJ A;  5D9W A;  3TGZ A;  4Z7X A;  4TVE A;  3PGT A;  3TKS C;  2CX4 A;  3A3T A;  1JLW A;  3D6I A;  5F06 A;  5INY A;  4F0C A;  3EU3 A;  3HXS A;  2X8G A;  4POK A;  2I9H A;  2WUL A;  3HDC A;  3NZN A;  1WP0 A;  4V2M A;  1SEN A;  3LYP A;  2N5B A;  2TRC P;  1O85 A;  3VWU A;  1AAZ A;  2R6K A;  3GL5 A;  5J41 A;  2KUC A;  3GNJ A;  5LNK e;  1JZW A;  2F9S A;  3VFI A;  4MZC A;  3F63 A;  4NHW A;  3WGE A;  1GUM A;  2GSS A;  1B4P A;  4OO4 A;  2H66 A;  4BVY B;  4HQS A;  3APO A;  3LQ7 A;  1BJX A;  2RM5 A;  1GLP A;  2HSM A;  2IJY A;  4J2F A;  5G5E A;  5G5F A;  4RUV A;  3GL3 A;  3M8N A;  2EIR A;  2FUG 2;  3UMA A;  2HT9 A;  3DEX A;  3TCO A;  3KZQ A;  2J23 A;  3NIV A;  2RUE A;  3V1W A;  4PUA A;  3BCI A;  4PUF C;  3KP8 A;  1H4O A;  4F9Z A;  5J4U A;  2QC7 A;  3IBH A;  4ZB8 A;  3FZA A;  2MYG A;  4L0W A;  4F82 A;  3QFA C;  4N0Z A;  3TKS A;  1I5G A;  3IV4 A;  4NWY A;  3RPN A;  3APS A;  2E2G A;  4GCI A;  2L6D A;  1EV4 A;  2L57 A;  4JZQ A;  3CTG A;  4JE1 A;  2B6M A;  1F6M C;  5IQY A;  3MSZ A;  4F03 A;  2CAI A;  2O8V B;  2YZH A;  3QAV A;  1OVN A;  3CSI A;  4HEA 2;  3EMX A;  4NV2 A;  1IYI A;  5F07 A;  1Z7R A;  4I8B A;  1GP1 A;  2OA7 A;  2CV4 A;  1XVW A;  3RDW A;  5DBQ A;  3IXR A;  2DML A;  5HR1 A;  4N11 A;  2UZ8 A;  2LNS A;  1OC9 B;  2FA8 A;  3C7M A;  5EL8 A;  1ZCP A;  3H8Q A;  5LD0 A;  3KH7 A;  3VWV A;  1DBY A;  3F0I A;  1UN2 A;  4BVY A;  2NDO A;  4LMW A;  1XW5 A;  1A8L A;  3A5W A;  2R3X A;  1SYR A;  5G1L A;  1TXX A;  4BL7 A;  4BWS A;  4NMU A;  5CRH A;  3DRN A;  1PKZ A;  1F9M A;  2ES7 A;  4NPB A;  1CQH A;  2YJ7 A;  5B7C A;  4YQV A;  3GTU B;  3LJR A;  2C1Y A;  4EF0 A;  4G0I A;  2VLV A;  5DJM A;  1FG4 A;  3HY2 A;  1YZX A;  1U3I A;  3VK9 A;  1XOA A;  1GSS A;  3CXG A;  5IMA A;  3KEB A;  1FAA A;  3VUR A;  2MMA A;  4RQX A;  5GSS A;  1SD9 A;  1XWB A;  4OD7 A;  2MMZ A;  4AJ6 A;  4MA9 A;  3ERF A;  3TJG A;  5IMV A;  4HUA A;  2GQM A;  2FGX A;  2YJH A;  3LXZ A;  1JHB A;  4MK3 A;  1YQ1 A;  4GSS A;  3DVW A;  4TXV A;  3M9J A;  4KND A;  4AF2 A;  5AIV A;  4PQH A;  3HZ8 A;  3GFK A;  5EPF A;  1TW9 A;  4I2U A;  3ZFL A;  1ZYQ B;  1SKW B;  5AGY A;  1GSD A;  1K3Y A;  5L71 A;  3DD3 A;  4MJE A;  2B7K A;  3DML A;  4K9Z A;  1GWC A;  4PXO A;  3PPU A;  1OC9 A;  1Z7P A;  2N5F A;  5EVO A;  1PMT A;  5ID2 B;  1GUL A;  3KTL A;  3Q74 A;  1Z5Y E;  2AV4 A;  1IYH A;  2H0G A;  2FLS A;  1NHY A;  4MP4 A;  5COH A;  3LXT A;  3LG6 A;  1MTC A;  4E8E A;  1OKD A;  5AIX A;  3VWW A;  5H5R A;  3ERG A;  4K1F A;  1O7U A;  3DWV A;  3IC8 A;  4GF0 A;  4XS6 A;  4MAB A;  3ISO A;  4LLR A;  2FWH A;  1O8W A;  1EEM A;  4FYB A;  5HFG A;  1K0D A;  1W89 A;  5HFK A;  2YWO A;  3EC3 A;  5B6N A;  5D93 A;  3QFB C;  4GLT A;  2HRF A;  3JCM L;  3TKP A;  5DCG A;  3DKS A;  2K9F A;  1JZR A;  1XWA A;  3H79 A;  1V57 A;  1TI3 A;  4EO3 A;  3HCZ A;  1G6Y A;  2YWN A;  1TK0 B;  4HOJ A;  2OE1 A;  1QFN A;  2CX3 A;  2H19 A;  3H93 A;  2B1L A;  1G7E A;  3TRP A;  1GL8 A;  3FW2 A;  5FT3 A;  3M3M A;  4FYU A;  2VOC A;  2IME A;  3CYN A;  4MMM A;  1T4Z A;  3ZIV A;  3UEM A;  2H6Y A;  4USS A;  2LJK A;  1K0N A;  1OC8 A;  6GST A;  2KHP A;  1N8J A;  2I4A A;  3H4K A;  1XFL A;  3GIX A;  4LA1 A;  1E6B A;  3N9J A;  4JR6 A;  1HQO A;  1X9M B;  3D4M A;  4ZB9 A;  3GKK A;  5GST A;  5J5N A;  3FKF A;  4GWR A;  2DJK A;  2MBT A;  3RBT A;  4P3Y B;  1K3L A;  3M9K A;  3VPT A;  3TJJ A;  5FHI A;  3FR9 A;  4GSN A;  1NM3 A;  2VD0 A;  5KN0 A;  4J57 E;  3VI7 A;  1S3C A;  1PX7 A;  2J9H A;  2E0Q A;  2FY6 A;  2IFQ B;  2H74 A;  5IPG A;  1TK8 B;  5LCZ A;  2QGV A;  1GLQ A;  1SJI A;  2RUF A;  1B4Q A;  2YWM A;  1T3B A;  1XW6 A;  2KLX A;  3QDN A;  2PMT A;  2YV9 A;  3TUE A;  1X9W B;  1GSY A;  4ISD A;  2MMO A;  1ST9 A;  5JCG A;  2IMD A;  4FQU A;  3KH9 A;  2C0E A;  1HNA A;  1ML6 A;  1TTZ A;  4HJM A;  3DVX A;  3IAS 2;  3C1S A;  1ILO A;  1TJD A;  2GVP A;  1MDI A;  2HSH A;  4PNF A;  2X8C A;  4POM A;  2ON5 A;  4HJ2 A;  3HYP A;  3DYR A;  3LWA A;  4QL9 A;  3KXO A;  2GZZ A;  5E59 A;  2V32 A;  5B6M A;  1T00 A;  5H5Q A;  1THX A;  2H30 A;  1WOU A;  5JWQ B;  4ULX A;  4G0K A;  5D9T A;  2KOK A;  1A0F A;  5IM9 A;  4TR1 B;  2JAC A;  2VCT A;  4L5L A;  5IO0 A;  2JU5 A;  3IK7 A;  1VF2 A;  4HZ2 A;  3KIJ A;  5KN1 A;  1MDK A;  3VLN A;  2VCW A;  4EXJ A;  2YNX A;  2C0F A;  1U6T A;  1V9W A;  3RPP A;  1B9X C;  1BG5 A;  5A4V A;  2I1U A;  1NW2 A;  5ECN B;  4LMV A;  1A24 A;  2E2M A;  2F8A A;  1S3D A;  2F3M A;  4WR5 A;  3KM6 A;  1ZOF A;  3LYK A;  3N5O A;  4XS1 A;  5GAN D;  3P7X A;  1SL2 B;  5ECH B;  4IEL A;  1HNB A;  2IFQ A;  3GKM A;  2GDR A;  3RAZ A;  3GN3 A;  4FO5 A;  3D5J A;  1PX6 A;  3GV1 A;  3D4T A;  3IOS A;  4FH8 A;  4XS4 B;  4JR4 A;  2JSZ A;  3GKN A;  1GNE A;  2WGR A;  1M0U A;  5D9V A;  1TI1 A;  4BA7 A;  1J9B A;  3ZZX A;  2IPA A;  1SJ6 A;  4ECI A;  2HRK B;  1Z6N A;  3A2W A;  4ECB A;  5DQS A;  4K7N A;  4TR3 A;  4K8M A;  2WRT A;  1TRS A;  2YP6 A;  1SL1 B;  6GSY A;  4WR4 A;  4K0G A;  5BMU A;  2WDU A;  3SWL A;  4K0N A;  2JZT A;  1KBN A;  4TR1 A;  3LEF A;  1X5C A;  3CSH A;  6GSW A;  1YDK A;  4CW9 A;  2EC4 A;  4KCE A;  3TJK A;  1DE2 A;  2M80 A;  3U5R E;  3UBK A;  2R2J A;  3HA9 A;  4RQR A;  1MD3 A;  2JAD A;  2V41 A;  5CRW A;  1NHO A;  2OE3 A;  13GS A;  5DAK B;  3HJM A;  1BQ7 A;  5HFI A;  1K3O A;  5HQP A;  3UIW A;  2M46 A;  1AQW A;  3ZML A;  5CP1 A;  2XC2 A;  4KCA A;  2FNO A;  1T7P B;  3C8E A;  2LRC A;  1AC1 A;  2JSY A;  3C71 A;  3VPQ A;  4DVC A;  2C80 A;  2IMI A;  5H5S A;  4OFN A;  3QAG A;  2AJQ B;  1Y25 A;  4AGS A;  4TN8 A;  1FHE A;  5E4W A;  5GZZ B;  1WPI A;  3LFL A;  1EOH A;  1SD8 A;  1X5D A;  2YWI A;  4XS4 A;  4L8E A;  1XWC A;  5IIZ A;  5ECM B;  4GST A;  1RW1 A; 
#chains in the Genus database with same CATH topology
 2K8V A;  2HSN A;  1PL2 A;  2R0G A;  5HR2 A;  4XRD A;  3TJB A;  4YH2 A;  1X9S B;  2H71 A;  5DVB A;  3L78 A;  1VF4 A;  4WBJ A;  3L9S A;  2HRK A;  1M2B A;  4MJA A;  1M9A A;  1BG1 A;  1R7H A;  3W6G A;  3IK9 A;  1U87 A;  1YY7 A;  2P5Q A;  1UA5 A;  2GT5 A;  4IN0 A;  2VUP A;  3G9B A;  3I69 A;  2DJ1 A;  5ABR A;  5B8A A;  4DSS B;  6GSU A;  3HKR A;  2CVB A;  2IIY A;  2OBK A;  4O7H A;  3J7Y k;  2GZP A;  4K6X A;  3IRA A;  5IO2 A;  4MF6 A;  2DJ2 A;  1ZYE A;  2PN8 A;  5CRE A;  4YQM A;  4PX1 A;  4I6X A;  1GRX A;  5KEJ A;  2GS3 A;  5DAK A;  5CAX A;  4EDZ A;  1OE7 A;  3HVV A;  4KUN A;  3GH6 A;  3ZIJ A;  1VF3 A;  3D0Z A;  4HZ4 A;  2H6X A;  2CA8 A;  2XHF A;  5ENU A;  2GQL A;  3FMW A;  2C3N A;  4CHS A;  1MDJ A;  3QMX A;  4ZBD A;  1M2A A;  3ZVJ A;  2EFD A;  4TW5 A;  3TKS E;  3GH9 A;  2OE0 A;  1XOB A;  4KA0 A;  3GX0 A;  16GS A;  3TKR A;  4I5Q A;  2PER A;  4KE3 A;  3UBL A;  2XBQ A;  4KDY A;  4OCE A;  1JZD A;  4CY8 A;  3W8J A;  1KTE A;  2LJR A;  1GH2 A;  1TRU A;  4RI6 A;  3CRT A;  2L5O A;  1ZYN A;  5A34 A;  1O6J A;  1Z9H A;  2V1M A;  4DEJ A;  2HE3 A;  3GHA A;  3H1N A;  1FO5 A;  2DMM A;  4CY6 A;  4YQU A;  4XIH A;  3A5I A;  4QQ7 A;  3KTB A;  2BMX A;  2DLX A;  4TRX A;  3QR6 A;  5D9X A;  5IMF A;  4K7O A;  3WYW A;  2H70 A;  2EIQ A;  3CWG A;  1GTA A;  4YKF A;  2PVO C;  3MIX A;  2REM A;  5J9C A;  1PN9 A;  1AUC A;  1PSQ A;  3TKQ A;  4MNN A;  1GSQ A;  2WFC A;  3EE2 A;  1EWX A;  1BF5 A;  4DSS A;  4ZL9 A;  2IL3 A;  2HQT A;  4KB3 A;  4G2E A;  5FWG A;  1FVK A;  1A0R P;  1NSW A;  2H6Z A;  4O5R A;  4ECC A;  5G30 A;  5DQY A;  1ACV A;  3P2A A;  3EIN A;  2VL3 A;  2GT6 A;  3FK8 A;  7GSS A;  4ML1 A;  1G7O A;  3GX8 A;  3F4R A;  3GMF A;  3TB2 A;  1YKA A;  2VLU A;  4IKH A;  3VI5 A;  1WMJ A;  3HZ4 A;  2R0C A;  1ERV A;  2FWE A;  1XCC A;  4GQC A;  1YJ6 A;  1OAZ A;  5D96 A;  3FEU A;  1ZMA A;  1EP7 A;  2HZE B;  4HI7 A;  2D2Z A;  5IMC A;  2PUK C;  2A2R A;  4MH3 A;  2CVK A;  5ECR B;  3EVI A;  4W66 A;  3A2V A;  2EFC A;  4MLY A;  3GTU A;  4ZBA A;  2BTO T;  2P31 A;  2LQQ A;  2GLR A;  4OO5 A;  3P8W A;  2X64 A;  2V2G A;  4BWQ A;  1TXU A;  2DSA A;  2C4J A;  14GS A;  4ILF A;  4Q5R A;  1E2Y A;  4ML6 A;  2R37 A;  3R2Q A;  3OR5 A;  1ERU A;  4V1A g;  4ZB6 A;  5F8B A;  3VWX A;  5JCU A;  3TDG A;  3Q6O A;  3FZ5 A;  3F4S A;  4OFT A;  1EEJ A;  2RII A;  4YKG A;  3DXB A;  4F2I A;  4K5S A;  4N10 A;  1DUG A;  1I9D A;  3FYG A;  4POB A;  3C1R A;  2ZCT A;  1XPV A;  4TR0 A;  1R4W A;  3F6D A;  2VCZ A;  2AAW A;  4IS0 A;  4ICY A;  2A2S A;  5J9B A;  1XIY A;  1C72 A;  6GSX A;  2H01 A;  5ID2 A;  2H73 A;  3RHC A;  3FZ4 A;  1N2A A;  4IQA A;  3DGQ A;  1SVL A;  1T4Y A;  5CRG A;  4MF7 A;  3RHB A;  3LOR A;  1I1I P;  4NAX A;  3GUS A;  4OFM A;  2DJJ A;  3IDV A;  2LS5 A;  1XW9 A;  4JED A;  4Q5Q A;  4X4J A;  2F8F A;  5JWO B;  4MDC A;  2YV7 A;  1K0A A;  4G9H A;  4MCU A;  4OCF A;  5KN2 A;  3DIE A;  2H1G A;  2LJA A;  3EUR A;  3ZFB A;  2HZE A;  2H75 A;  4V2N A;  1M99 A;  1YEX A;  4GXZ A;  1K0M A;  2C8U A;  1TRV A;  1FB0 A;  2K6V A;  2LST A;  4X0X A;  3TOU A;  1PFO A;  2LQO A;  1HYU A;  1SVM A;  3KJY A;  4MJC A;  1SK2 A;  2HFD A;  2O87 A;  1KEB A;  4IW9 A;  2Z9S A;  3E0U A;  4JBB A;  4GRF A;  1PL1 A;  4N0V A;  3F4T A;  3ZMK A;  3QOU A;  3LW9 A;  3G7Y A;  1Z6M A;  4KH7 A;  4EKZ A;  4KX4 A;  3CHX C;  4AKH A;  2QKE A;  3HHV A;  2C3Q A;  3LSZ A;  3IA1 A;  2GZY A;  4ZL7 A;  4EDY A;  2JZS A;  1Q4J A;  2VAF A;  5CRD A;  1BYE A;  5IMZ A;  2LV3 A;  3BCK A;  1V58 A;  3IHQ A;  4PHZ C;  4J56 E;  5F0G A;  19GS A;  1PQN A;  2MBS A;  4DSQ A;  1GUK A;  1V98 A;  3FRC A;  3MDK A;  1EOG A;  3KCM A;  2TRX A;  2H1L A;  2NTO A;  4KAE A;  2YOI A;  3UL3 A;  2NPB A;  3BBY A;  1KNG A;  1EZK A;  3FY7 A;  1T8E B;  1PKW A;  3L0H A;  3IC4 A;  4EVM A;  3CRU A;  2WW2 A;  1SK0 A;  1PA3 A;  1EGO A;  1OYJ A;  3PH9 A;  1PRX A;  2HXK A;  2F51 A;  4PUR A;  1GSF A;  4L5O A;  4XRA A;  4IGJ A;  3QPM A;  4WF5 A;  2B5X A;  2ALB A;  3HD5 A;  2YCD A;  2DC5 A;  1W4V A;  3NOF A;  4K2D A;  3CMI A;  3FR3 A;  1OE8 A;  3O76 A;  4Q5F A;  5G31 A;  4IHU A;  2VCQ A;  4GTU A;  1ON4 A;  1EV9 A;  2YPM A;  5GAP D;  3BD2 A;  1O81 A;  2OAD A;  3ZTL A;  3UOM A;  2L59 A;  2LRT A;  3RFR C;  5DCH A;  1YF1 A;  4K7I A;  4AJ7 A;  1OC3 A;  1QGV A;  2OAC A;  4KW6 A;  5HR0 A;  3M0F A;  5ECQ B;  1PGT A;  4JRR A;  1X5E A;  1MD4 A;  3CBU A;  4ZIJ A;  5ECI B;  2C3T A;  2HSY A;  4OMV A;  3TRX A;  2B1K A;  3PR8 A;  1K0B A;  2A4V A;  1V2A A;  3WD6 A;  3UAR A;  4KGI A;  3WT2 A;  2GSQ A;  4ECJ A;  2HRN A;  1R26 A;  2WS2 A;  5C00 A;  3GRX A;  5CYY A;  4WET A;  2AHE A;  4OWY A;  1ZZY A;  1R5P A;  3KP9 A;  3ME8 A;  4MZW A;  1ERW A;  4NXI A;  1WIK A;  3GA4 A;  1FB6 A;  1SVO A;  4ZB7 A;  3O3T A;  1F3B A;  4PNG A;  4G0L A;  3CSJ A;  5DJL A;  3UAP A;  3I9V 2;  4O32 A;  1XWK A;  2HNL A;  4BL7 B;  4TXO B;  2VO4 A;  4TOP A;  1Q98 A;  2RM6 A;  4HU9 A;  3UJ1 A;  2FHE A;  4RI7 A;  2O36 A;  4G10 A;  2ZNM A;  3KGK A;  1JZO A;  2H1A A;  4KDX A;  3APQ A;  3ME7 A;  1EGR A;  4HDE A;  2ON7 A;  4MPG A;  22GS A;  3W8S A;  1O8X A;  3J7Y b;  4ACS A;  2V6O A;  2M72 A;  1BAY A;  2VL2 C;  4HS1 A;  2C0G A;  4XHM A;  4L0U A;  1AIU A;  4FYC A;  5IOX A;  3MNG A;  1JLV A;  1B8X A;  1BX9 A;  2VD1 A;  3ZL5 A;  3ZRE A;  2I81 A;  3TOT A;  4BPY A;  1SKR B;  3EU4 A;  3F9U A;  1FW1 A;  1TP9 A;  1A2J A;  5EY6 A;  5CNW A;  4IJI A;  5D73 A;  3MAK A;  1YKC A;  2GQK A;  5J40 A;  5F05 A;  2NVL A;  2O89 A;  4LL4 B;  1J0F A;  2C0D A;  3E3E A;  3IE3 A;  2XPE A;  1JFU A;  1TOF A;  1X0R A;  4MJB A;  4IQ1 A;  2GST A;  4LL1 B;  5KN3 A;  1A23 A;  1K0C A;  2A2P A;  2PPT A;  3UVT A;  1SYX A;  2UV8 G;  4YAV A;  2K8S A;  5ECP B;  3QD9 A;  1K0O A;  4KDU A;  1A2L A;  2VM1 A;  4WBR D;  5D8I A;  3R3E A;  2IMK A;  3KD0 A;  18GS A;  3BJ5 A;  1WRY A;  4KF9 A;  1TRW A;  2G2Q A;  2YAN A;  4TXO A;  2VL2 A;  1ZL9 A;  4H86 A;  4EUY A;  1EP8 A;  3US3 A;  4MZB A;  3EYT A;  4N3Z A;  2IN3 A;  2IMF A;  1YEP A;  5AN1 A;  2CQ9 A;  2LNT A;  2L5L A;  1ABA A;  1DE1 A;  1O73 A;  2B5E A;  5IPH A;  2HRA A;  1WWJ A;  1VGL A;  2H1D A;  2H76 A;  3HJO A;  1LJR A;  1Y6E A;  2PVQ A;  2XPD A;  4HSC X;  4WF4 A;  2H0I A;  1QQ2 A;  2MMN A;  4XTS A;  1WJK A;  2NBS A;  5ECL B;  8GSS A;  3A2X A;  1AQV A;  3WGD A;  5ECK B;  3IPZ A;  4EL1 A;  2V6K A;  1GTI A;  4MF5 A;  4CDO A;  2KP2 A;  2R4V A;  3I43 A;  4PTS A;  17GS A;  2DJ0 A;  3IR4 A;  20GS A;  2AB6 A;  2FCH A;  4MPF A;  3KMO A;  3ZVJ D;  4PQI A;  4DSR A;  1AXD A;  2E7P A;  1QK8 A;  2GSR A;  3U6V A;  2WB9 A;  1F3A A;  1ZGN A;  1A8Y A;  4HQZ A;  2HYX A;  4ZL8 A;  2PGT A;  4WEY A;  2EIO A;  4IP6 A;  1M3J A;  2P5R A;  2OT3 A;  1SL0 B;  4NHZ A;  1LBK A;  1BED A;  5KOW A;  2LUS A;  3QAW A;  1HNC A;  2CZ2 A;  1G0T A;  2QSI A;  1J08 A;  3I6A A;  10GS A;  2N5A A;  1Z3E A;  5A5K A;  1ERT A;  1FOH A;  3FHK A;  2H72 A;  5DDL A;  2DJ3 A;  4GQF A;  2X8H A;  2AYT A;  2HLS A;  3O6T A;  1MEK A;  4D73 B;  3WT1 A;  3ZYW A;  1AQX A;  2WJU A;  6GSS A;  3UVH A;  3CQF A;  3GUR A;  3GST A;  3G7I A;  2L4C A;  2VL9 A;  1THO A;  3F8U A;  4G19 A;  3F6F A;  1QXH A;  1M9B A;  5A4W A;  5J3R A;  1QUW A;  2FWF A;  2FA4 A;  3HJP A;  4HU7 A;  2DBC A;  1QMV A;  4BVX B;  4MH2 A;  4F0B A;  3LGC A;  4GDF A;  1YF0 A;  3D22 A;  2H1B A;  1XWG A;  3MWH A;  4EC0 A;  4XCS A;  2B3S A;  4V2L A;  2K18 A;  2QA1 A;  1RK4 A;  2CT6 A;  5ECO B;  3BOA A;  3M1G A;  4IVF A;  2YZU A;  2XBI A;  4Z2U A;  2X99 A;  1R5A A;  2L4Q A;  3F3R A;  1GTB A;  4TKY A;  5IMD A;  3RGB C;  4WXT A;  2LEG A;  3TRQ A;  1F37 A;  3TJF A;  2B7J A;  1TU8 A;  5AIS A;  1M2D A;  5JCW A;  1B9Y C;  3EWL A;  2P0G A;  2X4A A;  1SK1 A;  2I3Y A;  3P90 A;  3FZ9 A;  2BJX A;  4I97 A;  2R5G A;  2L6C A;  4QL7 A;  2VIM A;  5G2Z A;  2HI7 A;  9GSS A;  2LRN A;  2TIR A;  1B48 A;  3GKX A;  4TR4 A;  4EE0 A;  1TKD B;  2PWJ A;  4JU5 A;  1GSU A;  3D21 A;  3WGX A;  4X43 A;  3F3Q A;  4AI6 A;  4I2T A;  4PQ1 A;  1WE0 A;  5CO3 A;  4IP1 A;  4ZXG A;  2H0H A;  1GNW A;  4D73 A;  5JWR B;  2H8L A;  2GTU A;  2DIZ A;  4EIP A;  4PI0 C;  11GS A;  2A4H A;  3HVS A;  6GSV A;  2VLT A;  5J4V A;  5B8B A;  1HD2 A;  4ZIL A;  4O5U A;  2CVD A;  1OKT A;  3SBC A;  4N30 A;  4POL A;  5ELG A;  4BVX A;  5DAL B;  1UC7 A;  1XZO A;  3K8N A;  5C04 A;  1UVZ A;  2PU9 C;  4NV5 A;  1TDI A;  1AW9 A;  1SU9 A;  3IAM 2;  1GSE A;  2DIY A;  4KSM A;  3FR6 A;  5IOW A;  1FVJ A;  2ZUP A;  2OKA A;  1U88 A;  1SJZ A;  4X1U A;  3Q18 A;  1V40 A;  2JL4 A;  4ZBB A;  2FWG A;  1FOV A;  2JZR A;  1URM A;  1VF1 A;  5ELA A;  2OJL A;  2WCI A;  1U3A A;  1GTU A;  2B5Y A;  3ED3 A;  3L4N A;  2O7K A;  3QCP A;  2EFE A;  1G6W A;  2CAQ A;  2VCX A;  2GGT A;  4KSO A;  3EMP A;  3KMN A;  4AJ8 A;  2MZC A;  4Q5N A;  1A2M A;  1TU7 A;  2HSM B;  1LU4 A;  4IBP A;  3L9V A;  1F2E A;  3PIN A;  1RQM A;  3C73 A;  3GSS A;  5G1K A;  3ZIT A;  3ZLP A;  2WZ9 A;  1XXU A;  2OBI A;  5A1N B;  2FD3 A;  12GS A;  5BRT A;  3Q19 A;  4V1A p;  4E8H A;  1PD2 1;  5HR3 A;  3ZRD A;  3S9F A;  4WKW A;  2KP1 A;  1H75 A;  5ECS A;  2LKU A;  2LTK A;  3HVX A;  5A4U A;  2CZ3 A;  3G7J A;  2YN1 A;  1TK5 B;  2RLI A;  2VCV A;  4IJ3 A;  1YVL A;  3E9J B;  3AY8 A;  2G0F A;  4ID0 A;  5A5H B;  1DSB A;  4O92 A;  1XVQ A;  1SKS B;  1XG8 A;  4PGT A;  2AUV A;  1M7T A;  3CTF A;  1T1V A;  2HSN B;  4YAP A;  2VM2 A;  3GYK A;  2IWT A;  1XBS A;  1S3A A;  3HVN A;  3L9U A;  1CQG A;  2HZF A;  1GUH A;  1USB A;  3ERW A;  1VRS D;  2WW0 A;  5DAL A;  2O85 A;  4FIW A;  2PBJ A;  5D9W A;  3TGZ A;  4Z7X A;  4TVE A;  1YEW C;  3PGT A;  3TKS C;  2CX4 A;  3A3T A;  1JLW A;  3D6I A;  5F06 A;  5INY A;  4F0C A;  3EU3 A;  3HXS A;  2X8G A;  4POK A;  2I9H A;  2WUL A;  3HDC A;  3NZN A;  1WP0 A;  4V2M A;  1SEN A;  3LYP A;  2N5B A;  2WW1 A;  2TRC P;  1O85 A;  3VWU A;  1AAZ A;  2R6K A;  3GL5 A;  5J41 A;  2KUC A;  3GNJ A;  5LNK e;  1JZW A;  2F9S A;  3VFI A;  4MZC A;  3F63 A;  4NHW A;  2WZS A;  3WGE A;  1GUM A;  2GSS A;  1B4P A;  4OO4 A;  2H66 A;  4BVY B;  4HQS A;  3APO A;  3LQ7 A;  1BJX A;  2RM5 A;  2R0P A;  1GLP A;  2HSM A;  2IJY A;  4J2F A;  5G5E A;  5G5F A;  4RUV A;  3GL3 A;  3M8N A;  2EIR A;  2FUG 2;  3UMA A;  2HT9 A;  3DEX A;  3TCO A;  3KZQ A;  2J23 A;  3NIV A;  2RUE A;  3V1W A;  4PUA A;  3BCI A;  4PUF C;  3KP8 A;  1H4O A;  4F9Z A;  5J4U A;  3HMJ G;  2QC7 A;  3IBH A;  4ZB8 A;  3FZA A;  2MYG A;  5A5H A;  1M3I A;  4L0W A;  4F82 A;  3QFA C;  4N0Z A;  3TKS A;  1I5G A;  3IV4 A;  4NWY A;  3RPN A;  3APS A;  2E2G A;  4GCI A;  2L6D A;  1EV4 A;  2L57 A;  4JZQ A;  3CTG A;  4JE1 A;  2B6M A;  1F6M C;  5IQY A;  3MSZ A;  4F03 A;  2CAI A;  2O8V B;  2YZH A;  3QAV A;  1OVN A;  4QMK A;  3CSI A;  4HEA 2;  3EMX A;  4NV2 A;  1IYI A;  5F07 A;  1Z7R A;  4I8B A;  1GP1 A;  2OA7 A;  2CV4 A;  1XVW A;  3RDW A;  5DBQ A;  3IXR A;  2DML A;  5HR1 A;  4N11 A;  2UZ8 A;  2LNS A;  1OC9 B;  2FA8 A;  3C7M A;  5EL8 A;  2O5V A;  1ZCP A;  3H8Q A;  5LD0 A;  3KH7 A;  3VWV A;  1DBY A;  3F0I A;  1UN2 A;  4BVY A;  2NDO A;  4LMW A;  1XW5 A;  4A5P A;  1A8L A;  3A5W A;  2R3X A;  1SYR A;  5G1L A;  1TXX A;  4BL7 A;  4BWS A;  4NMU A;  5CRH A;  3DRN A;  1PKZ A;  1F9M A;  2ES7 A;  4NPB A;  1CQH A;  2YJ7 A;  5B7C A;  4YQV A;  3GTU B;  3LJR A;  2C1Y A;  4EF0 A;  2QA2 A;  4G0I A;  2VLV A;  5DJM A;  1FG4 A;  3HY2 A;  1YZX A;  1U3I A;  3VK9 A;  1XOA A;  1GSS A;  3CXG A;  5IMA A;  3KEB A;  1FAA A;  2X49 A;  3VUR A;  2MMA A;  4RQX A;  5GSS A;  3IHG A;  1SD9 A;  1XWB A;  4OD7 A;  2MMZ A;  4AJ6 A;  4MA9 A;  3ERF A;  3TJG A;  5IMV A;  4HUA A;  2GQM A;  2FGX A;  2YJH A;  1N25 A;  3LXZ A;  2DKI A;  1JHB A;  4MK3 A;  1YQ1 A;  4Z2R A;  4GSS A;  3DVW A;  4TXV A;  3M9J A;  1S3R A;  4KND A;  4AF2 A;  5AIV A;  4PQH A;  3HZ8 A;  3GFK A;  5EPF A;  1TW9 A;  4I2U A;  3ZFL A;  1ZYQ B;  1SKW B;  5AGY A;  1GSD A;  1K3Y A;  5L71 A;  3DD3 A;  4MJE A;  2B7K A;  3DML A;  4K9Z A;  1GWC A;  4PXO A;  3PPU A;  1OC9 A;  1Z7P A;  2N5F A;  5EVO A;  1PMT A;  5ID2 B;  1GUL A;  3KTL A;  3Q74 A;  1Z5Y E;  2AV4 A;  5J4Y A;  1IYH A;  2H0G A;  2FLS A;  1NHY A;  5J47 A;  4MP4 A;  5COH A;  3LXT A;  3LG6 A;  1MTC A;  4E8E A;  1OKD A;  5AIX A;  3VWW A;  5H5R A;  3ERG A;  4K1F A;  1O7U A;  3DWV A;  3IC8 A;  4GF0 A;  2DKH A;  4XS6 A;  4MAB A;  3ISO A;  1PN0 A;  4LLR A;  4AKI A;  2FWH A;  1O8W A;  1EEM A;  4FYB A;  5HFG A;  1K0D A;  1W89 A;  5HFK A;  2YWO A;  3EC3 A;  5B6N A;  5D93 A;  3QFB C;  4GLT A;  2HRF A;  3JCM L;  3TKP A;  5DCG A;  3DKS A;  2K9F A;  1JZR A;  1XWA A;  3H79 A;  1V57 A;  1TI3 A;  4EO3 A;  3HCZ A;  1G6Y A;  2YWN A;  4EIQ A;  1TK0 B;  4HOJ A;  2OE1 A;  1QFN A;  2CX3 A;  2H19 A;  3H93 A;  2B1L A;  1G7E A;  3TRP A;  1GL8 A;  3FW2 A;  5FT3 A;  3M3M A;  4PI2 C;  4FYU A;  2VOC A;  2IME A;  3CYN A;  4MMM A;  1T4Z A;  3ZIV A;  3UEM A;  1Y1U A;  2H6Y A;  2O3E A;  4USS A;  2LJK A;  1K0N A;  2WVZ A;  1OC8 A;  6GST A;  2KHP A;  1N8J A;  2I4A A;  3H4K A;  1XFL A;  3GIX A;  4LA1 A;  1E6B A;  3N9J A;  4JR6 A;  1HQO A;  1X9M B;  3D4M A;  4ZB9 A;  3GKK A;  5GST A;  4K5R A;  2EFH A;  5J5N A;  3FKF A;  4GWR A;  2DJK A;  2MBT A;  3RBT A;  4P3Y B;  1K3L A;  3M9K A;  3VPT A;  3TJJ A;  5FHI A;  3FR9 A;  4GSN A;  1NM3 A;  2VD0 A;  5KN0 A;  4J57 E;  3VI7 A;  1S3C A;  1PX7 A;  2J9H A;  2E0Q A;  2FY6 A;  2IFQ B;  2H74 A;  5IPG A;  1TK8 B;  5LCZ A;  2QGV A;  1GLQ A;  1SJI A;  4AKX B;  2RUF A;  1B4Q A;  2YWM A;  1T3B A;  1XW6 A;  2KLX A;  2PMT A;  3QDN A;  2WVX B;  2YV9 A;  3TUE A;  1X9W B;  1GSY A;  4ISD A;  2MMO A;  1S4B P;  1ST9 A;  5JCG A;  2IMD A;  4FQU A;  3KH9 A;  2C0E A;  1HNA A;  1ML6 A;  1TTZ A;  4HJM A;  3DVX A;  3IAS 2;  3C1S A;  1ILO A;  1TJD A;  4K2X A;  2GVP A;  1MDI A;  2HSH A;  4PNF A;  2X8C A;  4POM A;  2ON5 A;  4HJ2 A;  3HYP A;  3DYR A;  3LWA A;  4QL9 A;  3KXO A;  2GZZ A;  5E59 A;  4G01 A;  2V32 A;  5B6M A;  1T00 A;  5H5Q A;  1THX A;  2H30 A;  1WOU A;  5JWQ B;  5BMU B;  4ULX A;  4G0K A;  5D9T A;  2KOK A;  1A0F A;  5IM9 A;  4BIK A;  4TR1 B;  2JAC A;  2VCT A;  4L5L A;  5IO0 A;  2JU5 A;  3IK7 A;  1VF2 A;  4HZ2 A;  3KIJ A;  5KN1 A;  1MDK A;  3VLN A;  2VCW A;  4EXJ A;  2YNX A;  2C0F A;  3MYD A;  1U6T A;  1V9W A;  3EPT A;  3RPP A;  1B9X C;  1BG5 A;  5A4V A;  2I1U A;  1NW2 A;  5ECN B;  4LMV A;  1A24 A;  2E2M A;  2F8A A;  1S3D A;  2F3M A;  4WR5 A;  3KM6 A;  1ZOF A;  3LYK A;  3N5O A;  4XS1 A;  5GAN D;  3P7X A;  1SL2 B;  5ECH B;  4IEL A;  1HNB A;  2IFQ A;  3GKM A;  2GDR A;  2WW3 A;  3RAZ A;  3GN3 A;  4FO5 A;  3D5J A;  4E68 A;  1PX6 A;  2WVX A;  3GV1 A;  3D4T A;  3IOS A;  4FH8 A;  4XS4 B;  4JR4 A;  2JSZ A;  3GKN A;  1GNE A;  2WGR A;  4O5Q A;  1M0U A;  5D9V A;  1TI1 A;  4BA7 A;  1J9B A;  3ZZX A;  2IPA A;  1SJ6 A;  4ECI A;  2HRK B;  1Z6N A;  3A2W A;  4ECB A;  3TU3 B;  5DQS A;  4K7N A;  4TR3 A;  4K8M A;  2WRT A;  1ZYP A;  1TRS A;  2YP6 A;  1SL1 B;  6GSY A;  4WR4 A;  4K0G A;  5BMU A;  2WDU A;  3SWL A;  4K0N A;  4FXY P;  2JZT A;  1KBN A;  5KOX A;  4TR1 A;  3LEF A;  1X5C A;  3CSH A;  6GSW A;  2VKZ G;  1YDK A;  4CW9 A;  2EC4 A;  4KCE A;  3TJK A;  1DE2 A;  2M80 A;  3U5R E;  3UBK A;  2R2J A;  3HA9 A;  4RQR A;  1MD3 A;  4AKG A;  2JAD A;  2V41 A;  5CRW A;  1NHO A;  2OE3 A;  13GS A;  5DAK B;  3HJM A;  1BQ7 A;  5HFI A;  1K3O A;  5HQP A;  3UIW A;  2M46 A;  1AQW A;  3ZML A;  2WVY A;  5CP1 A;  2XC2 A;  4KCA A;  5A1N A;  2FNO A;  1T7P B;  3C8E A;  2LRC A;  1AC1 A;  2JSY A;  3C71 A;  3VPQ A;  4DVC A;  2C80 A;  2IMI A;  5H5S A;  4OFN A;  3QAG A;  2AJQ B;  1Y25 A;  4AGS A;  4TN8 A;  1FHE A;  5E4W A;  5GZZ B;  4Z2T A;  1WPI A;  3LFL A;  1EOH A;  1SD8 A;  2YWI A;  1X5D A;  4XS4 A;  4L8E A;  5A34 B;  1XWC A;  5IIZ A;  5ECM B;  4GST A;  1RW1 A; 
#chains in the Genus database with same CATH homology
 2K8V A;  2HSN A;  1PL2 A;  2R0G A;  5HR2 A;  4XRD A;  3TJB A;  4YH2 A;  1X9S B;  2H71 A;  5DVB A;  3L78 A;  1VF4 A;  4WBJ A;  3L9S A;  2HRK A;  1M2B A;  4MJA A;  1M9A A;  1BG1 A;  1R7H A;  3W6G A;  3IK9 A;  1U87 A;  1YY7 A;  2P5Q A;  1UA5 A;  2GT5 A;  4IN0 A;  2VUP A;  3G9B A;  3I69 A;  2DJ1 A;  5ABR A;  5B8A A;  4DSS B;  6GSU A;  3HKR A;  2CVB A;  2IIY A;  2OBK A;  4O7H A;  3J7Y k;  2GZP A;  4K6X A;  3IRA A;  5IO2 A;  4MF6 A;  2DJ2 A;  1ZYE A;  2PN8 A;  5CRE A;  4YQM A;  4PX1 A;  4I6X A;  1GRX A;  5KEJ A;  2GS3 A;  5DAK A;  5CAX A;  4EDZ A;  1OE7 A;  3HVV A;  4KUN A;  3GH6 A;  3ZIJ A;  1VF3 A;  3D0Z A;  4HZ4 A;  2H6X A;  2CA8 A;  2XHF A;  5ENU A;  2GQL A;  3FMW A;  2C3N A;  4CHS A;  1MDJ A;  3QMX A;  4ZBD A;  1M2A A;  3ZVJ A;  2EFD A;  4TW5 A;  3TKS E;  3GH9 A;  2OE0 A;  1XOB A;  4KA0 A;  3GX0 A;  16GS A;  3TKR A;  4I5Q A;  2PER A;  4KE3 A;  3UBL A;  2XBQ A;  4KDY A;  4OCE A;  1JZD A;  4CY8 A;  3W8J A;  1KTE A;  2LJR A;  1GH2 A;  1TRU A;  4RI6 A;  3CRT A;  2L5O A;  1ZYN A;  5A34 A;  1O6J A;  1Z9H A;  2V1M A;  4DEJ A;  2HE3 A;  3GHA A;  3H1N A;  1FO5 A;  2DMM A;  4CY6 A;  4YQU A;  4XIH A;  3A5I A;  4QQ7 A;  3KTB A;  2BMX A;  2DLX A;  4TRX A;  3QR6 A;  5D9X A;  5IMF A;  4K7O A;  3WYW A;  2H70 A;  2EIQ A;  3CWG A;  1GTA A;  4YKF A;  2PVO C;  3MIX A;  2REM A;  5J9C A;  1PN9 A;  1AUC A;  1PSQ A;  3TKQ A;  4MNN A;  1GSQ A;  2WFC A;  3EE2 A;  1EWX A;  1BF5 A;  4DSS A;  4ZL9 A;  2IL3 A;  2HQT A;  4KB3 A;  4G2E A;  5FWG A;  1FVK A;  1A0R P;  1NSW A;  2H6Z A;  4O5R A;  4ECC A;  5G30 A;  5DQY A;  1ACV A;  3P2A A;  3EIN A;  2VL3 A;  2GT6 A;  3FK8 A;  7GSS A;  4ML1 A;  1G7O A;  3GX8 A;  3F4R A;  3GMF A;  3TB2 A;  1YKA A;  2VLU A;  4IKH A;  3VI5 A;  1WMJ A;  3HZ4 A;  2R0C A;  1ERV A;  2FWE A;  1XCC A;  4GQC A;  1YJ6 A;  1OAZ A;  5D96 A;  3FEU A;  1ZMA A;  1EP7 A;  2HZE B;  4HI7 A;  2D2Z A;  5IMC A;  2PUK C;  2A2R A;  4MH3 A;  2CVK A;  5ECR B;  3EVI A;  4W66 A;  3A2V A;  2EFC A;  4MLY A;  3GTU A;  4ZBA A;  2BTO T;  2P31 A;  2LQQ A;  2GLR A;  4OO5 A;  3P8W A;  2X64 A;  2V2G A;  4BWQ A;  1TXU A;  2DSA A;  2C4J A;  14GS A;  4ILF A;  4Q5R A;  1E2Y A;  4ML6 A;  2R37 A;  3R2Q A;  3OR5 A;  1ERU A;  4V1A g;  4ZB6 A;  5F8B A;  3VWX A;  5JCU A;  3TDG A;  3Q6O A;  3FZ5 A;  3F4S A;  4OFT A;  1EEJ A;  2RII A;  4YKG A;  3DXB A;  4F2I A;  4K5S A;  4N10 A;  1DUG A;  1I9D A;  3FYG A;  4POB A;  3C1R A;  2ZCT A;  1XPV A;  4TR0 A;  1R4W A;  3F6D A;  2VCZ A;  2AAW A;  4IS0 A;  4ICY A;  2A2S A;  5J9B A;  1XIY A;  1C72 A;  6GSX A;  2H01 A;  5ID2 A;  2H73 A;  3RHC A;  3FZ4 A;  1N2A A;  4IQA A;  3DGQ A;  1SVL A;  1T4Y A;  5CRG A;  4MF7 A;  3RHB A;  3LOR A;  4NAX A;  3GUS A;  4OFM A;  2DJJ A;  3IDV A;  2LS5 A;  1XW9 A;  4JED A;  4Q5Q A;  4X4J A;  2F8F A;  5JWO B;  4MDC A;  2YV7 A;  1K0A A;  4G9H A;  4MCU A;  4OCF A;  5KN2 A;  3DIE A;  2H1G A;  2LJA A;  3EUR A;  3ZFB A;  2HZE A;  2H75 A;  4V2N A;  1M99 A;  1YEX A;  4GXZ A;  1K0M A;  2C8U A;  1TRV A;  1FB0 A;  2K6V A;  2LST A;  4X0X A;  3TOU A;  2LQO A;  1HYU A;  1SVM A;  3KJY A;  4MJC A;  1SK2 A;  2HFD A;  2O87 A;  1KEB A;  4IW9 A;  2Z9S A;  3E0U A;  4JBB A;  4GRF A;  1PL1 A;  4N0V A;  3F4T A;  3ZMK A;  3QOU A;  3LW9 A;  3G7Y A;  1Z6M A;  4KH7 A;  4EKZ A;  4KX4 A;  4AKH A;  2QKE A;  3HHV A;  2C3Q A;  3LSZ A;  3IA1 A;  2GZY A;  4ZL7 A;  4EDY A;  2JZS A;  1Q4J A;  2VAF A;  5CRD A;  1BYE A;  5IMZ A;  2LV3 A;  3BCK A;  1V58 A;  3IHQ A;  4J56 E;  5F0G A;  19GS A;  1PQN A;  2MBS A;  4DSQ A;  1GUK A;  1V98 A;  3FRC A;  3MDK A;  1EOG A;  3KCM A;  2TRX A;  2H1L A;  2NTO A;  4KAE A;  2YOI A;  3UL3 A;  2NPB A;  3BBY A;  1KNG A;  1EZK A;  3FY7 A;  1T8E B;  1PKW A;  3L0H A;  3IC4 A;  4EVM A;  3CRU A;  1SK0 A;  1PA3 A;  1EGO A;  1OYJ A;  3PH9 A;  1PRX A;  2HXK A;  2F51 A;  4PUR A;  1GSF A;  4L5O A;  4XRA A;  4IGJ A;  3QPM A;  4WF5 A;  2B5X A;  2ALB A;  3HD5 A;  2YCD A;  2DC5 A;  1W4V A;  3NOF A;  4K2D A;  3CMI A;  3FR3 A;  1OE8 A;  3O76 A;  4Q5F A;  5G31 A;  4IHU A;  2VCQ A;  4GTU A;  1ON4 A;  1EV9 A;  2YPM A;  5GAP D;  3BD2 A;  1O81 A;  2OAD A;  3ZTL A;  3UOM A;  2L59 A;  2LRT A;  5DCH A;  1YF1 A;  4K7I A;  4AJ7 A;  1OC3 A;  1QGV A;  2OAC A;  4KW6 A;  5HR0 A;  3M0F A;  5ECQ B;  1PGT A;  4JRR A;  1X5E A;  1MD4 A;  3CBU A;  4ZIJ A;  5ECI B;  2C3T A;  2HSY A;  4OMV A;  3TRX A;  2B1K A;  3PR8 A;  1K0B A;  2A4V A;  1V2A A;  3WD6 A;  3UAR A;  4KGI A;  3WT2 A;  2GSQ A;  4ECJ A;  2HRN A;  1R26 A;  2WS2 A;  5C00 A;  3GRX A;  5CYY A;  4WET A;  2AHE A;  4OWY A;  1ZZY A;  1R5P A;  3KP9 A;  3ME8 A;  4MZW A;  1ERW A;  4NXI A;  1WIK A;  3GA4 A;  1FB6 A;  1SVO A;  4ZB7 A;  3O3T A;  1F3B A;  4PNG A;  4G0L A;  3CSJ A;  5DJL A;  3UAP A;  3I9V 2;  4O32 A;  1XWK A;  2HNL A;  4BL7 B;  4TXO B;  2VO4 A;  4TOP A;  1Q98 A;  2RM6 A;  4HU9 A;  3UJ1 A;  2FHE A;  4RI7 A;  4G10 A;  2ZNM A;  3KGK A;  1JZO A;  2H1A A;  4KDX A;  3APQ A;  3ME7 A;  1EGR A;  4HDE A;  2ON7 A;  4MPG A;  22GS A;  3W8S A;  1O8X A;  3J7Y b;  4ACS A;  2V6O A;  2M72 A;  1BAY A;  2VL2 C;  4HS1 A;  2C0G A;  4XHM A;  4L0U A;  1AIU A;  4FYC A;  5IOX A;  3MNG A;  1JLV A;  1B8X A;  1BX9 A;  2VD1 A;  3ZL5 A;  3ZRE A;  2I81 A;  3TOT A;  4BPY A;  1SKR B;  3EU4 A;  3F9U A;  1FW1 A;  1TP9 A;  1A2J A;  5EY6 A;  5CNW A;  4IJI A;  5D73 A;  3MAK A;  1YKC A;  2GQK A;  5J40 A;  5F05 A;  2NVL A;  2O89 A;  4LL4 B;  1J0F A;  2C0D A;  3E3E A;  3IE3 A;  2XPE A;  1JFU A;  1TOF A;  1X0R A;  4MJB A;  4IQ1 A;  2GST A;  4LL1 B;  5KN3 A;  1A23 A;  1K0C A;  2A2P A;  2PPT A;  3UVT A;  1SYX A;  2UV8 G;  4YAV A;  2K8S A;  5ECP B;  3QD9 A;  1K0O A;  4KDU A;  1A2L A;  2VM1 A;  4WBR D;  5D8I A;  3R3E A;  2IMK A;  3KD0 A;  18GS A;  3BJ5 A;  1WRY A;  4KF9 A;  1TRW A;  2G2Q A;  2YAN A;  4TXO A;  2VL2 A;  1ZL9 A;  4H86 A;  4EUY A;  1EP8 A;  3US3 A;  4MZB A;  3EYT A;  4N3Z A;  2IN3 A;  2IMF A;  1YEP A;  5AN1 A;  2CQ9 A;  2LNT A;  2L5L A;  1ABA A;  1DE1 A;  1O73 A;  2B5E A;  5IPH A;  2HRA A;  1WWJ A;  1VGL A;  2H1D A;  2H76 A;  3HJO A;  1LJR A;  1Y6E A;  2PVQ A;  2XPD A;  4WF4 A;  2H0I A;  1QQ2 A;  2MMN A;  4XTS A;  1WJK A;  2NBS A;  5ECL B;  8GSS A;  3A2X A;  1AQV A;  3WGD A;  5ECK B;  3IPZ A;  4EL1 A;  2V6K A;  1GTI A;  4MF5 A;  4CDO A;  2KP2 A;  2R4V A;  3I43 A;  4PTS A;  17GS A;  2DJ0 A;  3IR4 A;  20GS A;  2AB6 A;  2FCH A;  4MPF A;  3KMO A;  3ZVJ D;  4PQI A;  4DSR A;  1AXD A;  2E7P A;  1QK8 A;  2GSR A;  3U6V A;  2WB9 A;  1F3A A;  1ZGN A;  1A8Y A;  4HQZ A;  2HYX A;  4ZL8 A;  2PGT A;  4WEY A;  2EIO A;  4IP6 A;  2P5R A;  2OT3 A;  1SL0 B;  4NHZ A;  1LBK A;  1BED A;  5KOW A;  2LUS A;  3QAW A;  1HNC A;  2CZ2 A;  1G0T A;  2QSI A;  1J08 A;  3I6A A;  10GS A;  2N5A A;  1Z3E A;  5A5K A;  1ERT A;  1FOH A;  3FHK A;  2H72 A;  5DDL A;  2DJ3 A;  4GQF A;  2X8H A;  2AYT A;  2HLS A;  3O6T A;  1MEK A;  4D73 B;  3WT1 A;  3ZYW A;  1AQX A;  2WJU A;  6GSS A;  3UVH A;  3GUR A;  3GST A;  3G7I A;  2L4C A;  2VL9 A;  1THO A;  3F8U A;  4G19 A;  3F6F A;  1QXH A;  1M9B A;  5A4W A;  5J3R A;  1QUW A;  2FWF A;  2FA4 A;  3HJP A;  4HU7 A;  2DBC A;  1QMV A;  4BVX B;  4MH2 A;  4F0B A;  3LGC A;  4GDF A;  1YF0 A;  3D22 A;  2H1B A;  1XWG A;  3MWH A;  4EC0 A;  4XCS A;  2B3S A;  4V2L A;  2K18 A;  2QA1 A;  1RK4 A;  2CT6 A;  5ECO B;  3BOA A;  3M1G A;  4IVF A;  2YZU A;  2XBI A;  4Z2U A;  2X99 A;  1R5A A;  2L4Q A;  3F3R A;  1GTB A;  4TKY A;  5IMD A;  4WXT A;  2LEG A;  3TRQ A;  1F37 A;  3TJF A;  2B7J A;  1TU8 A;  5AIS A;  1M2D A;  5JCW A;  1B9Y C;  3EWL A;  2P0G A;  2X4A A;  1SK1 A;  2I3Y A;  3P90 A;  3FZ9 A;  2BJX A;  4I97 A;  2R5G A;  2L6C A;  4QL7 A;  2VIM A;  5G2Z A;  2HI7 A;  9GSS A;  2LRN A;  2TIR A;  1B48 A;  3GKX A;  4TR4 A;  4EE0 A;  1TKD B;  2PWJ A;  4JU5 A;  1GSU A;  3D21 A;  3WGX A;  4X43 A;  3F3Q A;  4AI6 A;  4I2T A;  4PQ1 A;  1WE0 A;  5CO3 A;  4IP1 A;  4ZXG A;  2H0H A;  1GNW A;  4D73 A;  5JWR B;  2H8L A;  2GTU A;  2DIZ A;  4EIP A;  11GS A;  2A4H A;  3HVS A;  6GSV A;  2VLT A;  5J4V A;  5B8B A;  1HD2 A;  4ZIL A;  4O5U A;  2CVD A;  1OKT A;  3SBC A;  4N30 A;  4POL A;  5ELG A;  4BVX A;  5DAL B;  1UC7 A;  1XZO A;  3K8N A;  5C04 A;  1UVZ A;  2PU9 C;  4NV5 A;  1TDI A;  1AW9 A;  1SU9 A;  3IAM 2;  1GSE A;  2DIY A;  4KSM A;  3FR6 A;  5IOW A;  1FVJ A;  2ZUP A;  2OKA A;  1U88 A;  1SJZ A;  4X1U A;  3Q18 A;  1V40 A;  2JL4 A;  4ZBB A;  2FWG A;  1FOV A;  2JZR A;  1URM A;  1VF1 A;  5ELA A;  2OJL A;  2WCI A;  1U3A A;  1GTU A;  2B5Y A;  3ED3 A;  3L4N A;  2O7K A;  3QCP A;  2EFE A;  1G6W A;  2CAQ A;  2VCX A;  2GGT A;  4KSO A;  3EMP A;  3KMN A;  4AJ8 A;  2MZC A;  4Q5N A;  1A2M A;  1TU7 A;  2HSM B;  1LU4 A;  4IBP A;  3L9V A;  1F2E A;  3PIN A;  1RQM A;  3C73 A;  3GSS A;  5G1K A;  3ZIT A;  3ZLP A;  2WZ9 A;  1XXU A;  2OBI A;  5A1N B;  2FD3 A;  12GS A;  5BRT A;  3Q19 A;  4V1A p;  4E8H A;  1PD2 1;  5HR3 A;  3ZRD A;  3S9F A;  4WKW A;  2KP1 A;  1H75 A;  5ECS A;  2LKU A;  2LTK A;  3HVX A;  5A4U A;  2CZ3 A;  3G7J A;  2YN1 A;  1TK5 B;  2RLI A;  2VCV A;  4IJ3 A;  1YVL A;  3E9J B;  3AY8 A;  2G0F A;  4ID0 A;  5A5H B;  1DSB A;  4O92 A;  1XVQ A;  1SKS B;  4PGT A;  2AUV A;  1M7T A;  3CTF A;  1T1V A;  2HSN B;  4YAP A;  2VM2 A;  3GYK A;  2IWT A;  1XBS A;  1S3A A;  3L9U A;  1CQG A;  2HZF A;  1GUH A;  1USB A;  3ERW A;  1VRS D;  5DAL A;  2O85 A;  4FIW A;  2PBJ A;  5D9W A;  3TGZ A;  4Z7X A;  4TVE A;  3PGT A;  3TKS C;  2CX4 A;  3A3T A;  1JLW A;  3D6I A;  5F06 A;  5INY A;  4F0C A;  3EU3 A;  3HXS A;  2X8G A;  4POK A;  2I9H A;  2WUL A;  3HDC A;  3NZN A;  1WP0 A;  4V2M A;  1SEN A;  3LYP A;  2N5B A;  2TRC P;  1O85 A;  3VWU A;  1AAZ A;  2R6K A;  3GL5 A;  5J41 A;  2KUC A;  3GNJ A;  5LNK e;  1JZW A;  2F9S A;  3VFI A;  4MZC A;  3F63 A;  4NHW A;  3WGE A;  1GUM A;  2GSS A;  1B4P A;  4OO4 A;  2H66 A;  4BVY B;  4HQS A;  3APO A;  3LQ7 A;  1BJX A;  2RM5 A;  2R0P A;  1GLP A;  2HSM A;  2IJY A;  4J2F A;  5G5E A;  5G5F A;  4RUV A;  3GL3 A;  3M8N A;  2EIR A;  2FUG 2;  3UMA A;  2HT9 A;  3DEX A;  3TCO A;  3KZQ A;  2J23 A;  3NIV A;  2RUE A;  3V1W A;  4PUA A;  3BCI A;  4PUF C;  3KP8 A;  1H4O A;  4F9Z A;  5J4U A;  3HMJ G;  2QC7 A;  3IBH A;  4ZB8 A;  3FZA A;  2MYG A;  5A5H A;  4L0W A;  4F82 A;  3QFA C;  4N0Z A;  3TKS A;  1I5G A;  3IV4 A;  4NWY A;  3RPN A;  3APS A;  2E2G A;  4GCI A;  2L6D A;  1EV4 A;  2L57 A;  4JZQ A;  3CTG A;  4JE1 A;  2B6M A;  1F6M C;  5IQY A;  3MSZ A;  4F03 A;  2CAI A;  2O8V B;  2YZH A;  3QAV A;  1OVN A;  4QMK A;  3CSI A;  4HEA 2;  3EMX A;  4NV2 A;  1IYI A;  5F07 A;  1Z7R A;  4I8B A;  1GP1 A;  2OA7 A;  2CV4 A;  1XVW A;  3RDW A;  5DBQ A;  3IXR A;  2DML A;  5HR1 A;  4N11 A;  2UZ8 A;  2LNS A;  1OC9 B;  2FA8 A;  3C7M A;  5EL8 A;  2O5V A;  1ZCP A;  3H8Q A;  5LD0 A;  3KH7 A;  3VWV A;  1DBY A;  3F0I A;  1UN2 A;  4BVY A;  2NDO A;  4LMW A;  1XW5 A;  4A5P A;  1A8L A;  3A5W A;  2R3X A;  1SYR A;  5G1L A;  1TXX A;  4BL7 A;  4BWS A;  4NMU A;  5CRH A;  3DRN A;  1PKZ A;  1F9M A;  2ES7 A;  4NPB A;  1CQH A;  2YJ7 A;  5B7C A;  4YQV A;  3GTU B;  3LJR A;  2C1Y A;  4EF0 A;  2QA2 A;  4G0I A;  2VLV A;  5DJM A;  1FG4 A;  3HY2 A;  1YZX A;  1U3I A;  3VK9 A;  1XOA A;  1GSS A;  3CXG A;  5IMA A;  3KEB A;  1FAA A;  2X49 A;  3VUR A;  2MMA A;  4RQX A;  5GSS A;  3IHG A;  1SD9 A;  1XWB A;  4OD7 A;  2MMZ A;  4AJ6 A;  4MA9 A;  3ERF A;  3TJG A;  5IMV A;  4HUA A;  2GQM A;  2FGX A;  2YJH A;  1N25 A;  3LXZ A;  2DKI A;  1JHB A;  4MK3 A;  1YQ1 A;  4Z2R A;  4GSS A;  3DVW A;  4TXV A;  3M9J A;  4KND A;  4AF2 A;  5AIV A;  4PQH A;  3HZ8 A;  3GFK A;  5EPF A;  1TW9 A;  4I2U A;  3ZFL A;  1ZYQ B;  1SKW B;  5AGY A;  1GSD A;  1K3Y A;  5L71 A;  3DD3 A;  4MJE A;  2B7K A;  3DML A;  4K9Z A;  1GWC A;  4PXO A;  3PPU A;  1OC9 A;  1Z7P A;  2N5F A;  5EVO A;  1PMT A;  5ID2 B;  1GUL A;  3KTL A;  3Q74 A;  1Z5Y E;  2AV4 A;  5J4Y A;  1IYH A;  2H0G A;  2FLS A;  1NHY A;  5J47 A;  4MP4 A;  5COH A;  3LXT A;  3LG6 A;  1MTC A;  4E8E A;  1OKD A;  5AIX A;  3VWW A;  5H5R A;  3ERG A;  4K1F A;  1O7U A;  3DWV A;  3IC8 A;  4GF0 A;  2DKH A;  4XS6 A;  4MAB A;  3ISO A;  1PN0 A;  4LLR A;  4AKI A;  2FWH A;  1O8W A;  1EEM A;  4FYB A;  5HFG A;  1K0D A;  1W89 A;  5HFK A;  2YWO A;  3EC3 A;  5B6N A;  5D93 A;  3QFB C;  4GLT A;  2HRF A;  3JCM L;  3TKP A;  5DCG A;  3DKS A;  2K9F A;  1JZR A;  1XWA A;  3H79 A;  1V57 A;  1TI3 A;  4EO3 A;  3HCZ A;  1G6Y A;  2YWN A;  4EIQ A;  1TK0 B;  4HOJ A;  2OE1 A;  1QFN A;  2CX3 A;  2H19 A;  3H93 A;  2B1L A;  1G7E A;  3TRP A;  1GL8 A;  3FW2 A;  5FT3 A;  3M3M A;  4FYU A;  2VOC A;  2IME A;  3CYN A;  4MMM A;  1T4Z A;  3ZIV A;  3UEM A;  1Y1U A;  2H6Y A;  4USS A;  2LJK A;  1K0N A;  1OC8 A;  6GST A;  2KHP A;  1N8J A;  2I4A A;  3H4K A;  1XFL A;  3GIX A;  4LA1 A;  1E6B A;  3N9J A;  4JR6 A;  1HQO A;  1X9M B;  3D4M A;  4ZB9 A;  3GKK A;  5GST A;  4K5R A;  2EFH A;  5J5N A;  3FKF A;  4GWR A;  2DJK A;  2MBT A;  3RBT A;  4P3Y B;  1K3L A;  3M9K A;  3VPT A;  3TJJ A;  5FHI A;  3FR9 A;  4GSN A;  1NM3 A;  2VD0 A;  5KN0 A;  4J57 E;  3VI7 A;  1S3C A;  1PX7 A;  2J9H A;  2E0Q A;  2FY6 A;  2IFQ B;  2H74 A;  5IPG A;  1TK8 B;  5LCZ A;  2QGV A;  1GLQ A;  1SJI A;  4AKX B;  2RUF A;  1B4Q A;  2YWM A;  1T3B A;  1XW6 A;  2KLX A;  2PMT A;  3QDN A;  2YV9 A;  3TUE A;  1X9W B;  1GSY A;  4ISD A;  2MMO A;  1ST9 A;  5JCG A;  2IMD A;  4FQU A;  3KH9 A;  2C0E A;  1HNA A;  1ML6 A;  1TTZ A;  4HJM A;  3DVX A;  3IAS 2;  3C1S A;  1ILO A;  1TJD A;  4K2X A;  2GVP A;  1MDI A;  2HSH A;  4PNF A;  2X8C A;  4POM A;  2ON5 A;  4HJ2 A;  3HYP A;  3DYR A;  3LWA A;  4QL9 A;  3KXO A;  2GZZ A;  5E59 A;  4G01 A;  2V32 A;  5B6M A;  1T00 A;  5H5Q A;  1THX A;  2H30 A;  1WOU A;  5JWQ B;  5BMU B;  4ULX A;  4G0K A;  5D9T A;  2KOK A;  1A0F A;  5IM9 A;  4TR1 B;  2JAC A;  2VCT A;  4L5L A;  5IO0 A;  2JU5 A;  3IK7 A;  1VF2 A;  4HZ2 A;  3KIJ A;  5KN1 A;  1MDK A;  3VLN A;  2VCW A;  4EXJ A;  2YNX A;  2C0F A;  3MYD A;  1U6T A;  1V9W A;  3EPT A;  3RPP A;  1B9X C;  1BG5 A;  5A4V A;  2I1U A;  1NW2 A;  5ECN B;  4LMV A;  1A24 A;  2E2M A;  2F8A A;  1S3D A;  2F3M A;  4WR5 A;  3KM6 A;  1ZOF A;  3LYK A;  3N5O A;  4XS1 A;  5GAN D;  3P7X A;  1SL2 B;  5ECH B;  4IEL A;  1HNB A;  2IFQ A;  3GKM A;  2GDR A;  3RAZ A;  3GN3 A;  4FO5 A;  3D5J A;  4E68 A;  1PX6 A;  3GV1 A;  3D4T A;  3IOS A;  4FH8 A;  4XS4 B;  4JR4 A;  2JSZ A;  3GKN A;  1GNE A;  2WGR A;  4O5Q A;  1M0U A;  5D9V A;  1TI1 A;  4BA7 A;  1J9B A;  3ZZX A;  2IPA A;  1SJ6 A;  4ECI A;  2HRK B;  1Z6N A;  3A2W A;  4ECB A;  3TU3 B;  5DQS A;  4K7N A;  4TR3 A;  4K8M A;  2WRT A;  1ZYP A;  1TRS A;  2YP6 A;  1SL1 B;  6GSY A;  4WR4 A;  4K0G A;  5BMU A;  2WDU A;  3SWL A;  4K0N A;  2JZT A;  1KBN A;  5KOX A;  4TR1 A;  3LEF A;  1X5C A;  3CSH A;  6GSW A;  2VKZ G;  1YDK A;  4CW9 A;  2EC4 A;  4KCE A;  3TJK A;  1DE2 A;  2M80 A;  3U5R E;  3UBK A;  2R2J A;  3HA9 A;  4RQR A;  1MD3 A;  4AKG A;  2JAD A;  2V41 A;  5CRW A;  1NHO A;  2OE3 A;  13GS A;  5DAK B;  3HJM A;  1BQ7 A;  5HFI A;  1K3O A;  5HQP A;  3UIW A;  2M46 A;  1AQW A;  3ZML A;  5CP1 A;  2XC2 A;  4KCA A;  5A1N A;  2FNO A;  1T7P B;  3C8E A;  2LRC A;  1AC1 A;  2JSY A;  3C71 A;  3VPQ A;  4DVC A;  2C80 A;  2IMI A;  5H5S A;  4OFN A;  3QAG A;  2AJQ B;  1Y25 A;  4AGS A;  4TN8 A;  1FHE A;  5E4W A;  5GZZ B;  4Z2T A;  1WPI A;  3LFL A;  1EOH A;  1SD8 A;  2YWI A;  1X5D A;  4XS4 A;  4L8E A;  5A34 B;  1XWC A;  5IIZ A;  5ECM B;  4GST A;  1RW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...