1VF4A

Cgsta1-1 apo form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
227
structure length
227
Chain Sequence
AAKPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 81
structure length 227
sequence length 227
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf4A01
2LRCA 1YKAA 1R4WA 4MABA 1JLVA 3VURA 2RIIA 3DMLA 1B9XC 3C7MA 2DMLA 2HE3A 3F4TA 1G6WA 1WPIA 1B48A 2VCQA 1PA3A 1XCCA 3ZREA 5DAKA 1AUCA 3VK9A 1XZOA 4NV5A 2VCZA 2F8FA 2JZTA 4IW9A 2HSYA 3CSHA 4E8EA 1U3IA 1V9WA 2LQQA 1JZDA 2QGVA 3KTLA 2I1UA 1Z7PA 3LXTA 1RQMA 4JE1A 1TKDB 5D9TA 1XVWA 1AQWA 4HQSA 1WMJA 1SL1B 3GKMA 5JWQB 5DALA 4V2NA 4NAXA 4MF7A 1XOAA 2HRNA 2FCHA 1EV9A 3C73A 6GSYA 4BWQA 2R2JA 1N2AA 2KP2A 5IM9A 3LFLA 4EVMA 2VM2A 5F0GA 2YN1A 5ECRB 1MDIA 6GSVA 5KN3A 2GQLA 1S3DA 5A4VA 4GSSA 3QPMA 2HNLA 5INYA 2HRAA 1ERUA 5D9WA 2L4CA 3BJ5A 4X43A 4CHSA 3EINA 3ERWA 4ACSA 1PL1A 5CO3A 3ZITA 2YPMA 4ECIA 4MCUA 4KUNA 4O5RA 3GX0A 3U6VA 5JCGA 2XPDA 1YQ1A 2LUSA 4MH3A 1TJDA 1XWAA 1XPVA 4MZBA 5IPGA 2CAQA 1BEDA 1HQOA 2I9HA 2GDRA 2YCDA 2H75A 5CRGA 1A8LA 5ECMB 2X64A 4QQ7A 2DJKA 1BYEA 4F0CA 2H6XA 3GIXA 3TRXA 1PQNA 4RI7A 3APQA 10GSA 3HVVA 4KW6A 2R37A 5B7CA 2LKUA 2VCTA 4IGJA 1GLQA 3WT1A 4XS4B 2E2MA 2NVLA 1I5GA 1FVKA 2GZYA 1GTIA 2PGTA 3P2AA 4I5QA 3Q74A 2H19A 3O76A 5FT3A 4XRAA 1PX7A 4XS1A 3TKPA 4EL1A 1SD9A 4HUAA 2TRCP 2BMXA 2AV4A 1H4OA 3QMXA 1ZMAA 3I9V2 3V1WA 1AXDA 2HYXA 4MF5A 5HFIA 5IPHA 4G0KA 3VI7A 4GQFA 4J56E 5CRDA 1GNWA 3QR6A 3N5OA 2VL2C 4GCIA 3GHAA 4K1FA 4IJ3A 4L5LA 1Y6EA 4MZWA 2OBKA 2O85A 2X8CA 2ZNMA 5DQSA 2YV9A 2DC5A 2K8SA 4TW5A 4KDXA 1ZGNA 3O6TA 2DJJA 4KDYA 4FO5A 2R6KA 2L59A 3QFBC 1OE8A 4F0BA 5HR0A 1V57A 2ALBA 2H1DA 3VI5A 2V1MA 4OMVA 4DVCA 1XFLA 3D0ZA 1HNCA 2VL2A 3ZRDA 5IMAA 1E2YA 2L5OA 3W8SA 1FHEA 2IN3A 4LL1B 5J3RA 5IOWA 2TIRA 5KN2A 5L71A 4YAVA 3UARA 2FNOA 4HI7A 2LJAA 1SK1A 1XBSA 1AAZA 2HSHA 3IXRA 4F82A 3RPNA 1LJRA 1GSSA 2B5YA 2FGXA 1A8YA 2IFQA 4MDCA 1FB6A 1S3AA 4YQVA 5A4UA 2IIYA 1OE7A 4MJAA 3WD6A 2JZRA 3KMNA 2EC4A 1TW9A 4GTUA 4PX1A 5A5KA 1YY7A 1ZCPA 2FD3A 3KH7A 1AC1A 2F51A 1GH2A 2RUFA 4XIHA 3TRPA 1TK5B 4PTSA 4YQUA 4AJ6A 3F3QA 2PMTA 4ID0A 1K3YA 1AQVA 1RW1A 4WKWA 3IK9A 1U3AA 3ZIVA 1TK8B 3PPUA 3GUSA 4MZCA 4L0WA 2OJLA 5J4UA 1A2JA 5FHIA 5G1LA 4EDYA 1MD4A 5B8BA 1UVZA 4KH7A 1WRYA 1NM3A 4MH2A 3KXOA 3D21A 1VGLA 2P5RA 3OR5A 3KMOA 3KD0A 3IBHA 3A5WA 1JZRA 1JFUA 20GSA 2H01A 1TRSA 3LEFA 4KCAA 3ZIJA 1OC9A 2KP1A 1XWBA 4K2DA 4ZBDA 3CRTA 1ST9A 2DSAA 4PXOA 5H5QA 1ILOA 4D73A 2F9SA 4K8MA 4IQ1A 3FHKA 1O85A 4IELA 4Q5NA 1PGTA 5ECLB 1C72A 3L9VA 5B6NA 2ZUPA 1HYUA 2GS3A 4OFTA 4JU5A 4ECJA 2H1AA 5C04A 1GSEA 1GP1A 3TJGA 3RHCA 5ECSA 2VIMA 1X5CA 2YJHA 3AY8A 2B7JA 4NHZA 4BWSA 2P0GA 4POMA 3VLNA 2NTOA 1GTBA 5HQPA 3GTUA 5EPFA 3H93A 3I6AA 2DJ0A 4HOJA 3HVSA 4LLRA 1NHYA 3KIJA 1F2EA 4JZQA 1ERVA 3GURA 2IL3A 5G1KA 1M99A 2E2GA 2QC7A 3E3EA 4OO4A 4L0UA 3J7Yb 1M7TA 4TRXA 4ULXA 4ZXGA 1PN9A 1QMVA 4ML6A 1CQHA 4F03A 1A0FA 3QOUA 4KDUA 2VCWA 1X9WB 2JACA 3TCOA 3QFAC 2GSSA 2M80A 2PN8A 5KEJA 1SJIA 2YANA 1N8JA 1OKTA 3EMPA 1T1VA 2JU5A 1K0MA 2F3MA 4MPGA 1ERTA 2FHEA 3GKXA 3GH6A 1T4ZA 5JCWA 2OE1A 4ML1A 4HJMA 3CXGA 1SENA 4PNGA 2C1YA 3RHBA 3GN3A 2NPBA 3TUEA 3L0HA 3D6IA 2IJYA 5FWGA 3HA9A 5CNWA 4BL7B 1WWJA 1FW1A 5J5NA 1SJZA 4HZ4A 2JSYA 4OFNA 3LJRA 4POLA 2C0GA 4X0XA 1YF1A 1SYRA 2X8GA 1AQXA 3GKNA 4HDEA 1AIUA 4OD7A 1OKDA 3VWWA 2CT6A 3KP9A 1K0OA 2CA8A 2AUVA 1EGOA 2IMFA 1MD3A 4WXTA 5CRWA 3DEXA 4X1UA 2VL3A 3HZ4A 1SJ6A 3IAS2 4Q5RA 1R5AA 2XHFA 5D93A 2VO4A 3CYNA 5KN1A 2HZEB 3BOAA 7GSSA 1GSQA 4NHWA 3FEUA 3UVHA 4WEYA 4AF2A 3RBTA 1BAYA 4K7IA 5CRHA 4EDZA 4DSSA 4ECCA 2CAIA 5ELGA 3L4NA 3CMIA 4GXZA 1K0CA 1U6TA 2MZCA 1TDIA 2H71A 3GYKA 4N0ZA 5B6MA 4I2TA 4O92A 3FRCA 4F9ZA 4NPBA 3ZYWA 3PR8A 2B1KA 1XXUA 1VRSD 3PINA 2DJ2A 2CZ3A 1JHBA 4IP1A 3IPZA 4OCEA 5D9XA 1URMA 4QL9A 4TOPA 4Q5QA 5AGYA 2GTUA 5ID2B 5F06A 4GSNA 2WJUA 3FZ9A 1X0RA 1QFNA 2V6KA 1A2MA 1IYIA 1ZZYA 5AIXA 4HQZA 2DMMA 1K3LA 5D8IA 5IMDA 4AJ8A 1F3AA 5E4WA 1SKSB 3HCZA 4J57E 4RI6A 1OAZA 4BVXB 2MMAA 3DRNA 1QXHA 1PRXA 2CQ9A 1FG4A 5ABRA 4IP6A 2DIYA 1FVJA 1B9YC 3HYPA 4H86A 2H1BA 3US3A 3EURA 2RLIA 5IOXA 3CSIA 2KHPA 1VF2A 1VF3A 1EEMA 5CREA 4V1Ap 2YZHA 3NIVA 1B8XA 3F3RA 4TXVA 4EKZA 5H5SA 3IRAA 3IV4A 2H70A 5IO2A 1YDKA 4TR1A 3ZFBA 4JR6A 2HRKB 1M2BA 1SL2B 3IR4A 3ZL5A 2C0EA 3VPTA 1Z7RA 2LTKA 4HU7A 1TXXA 2FWGA 1F6MC 4LMWA 2Z9SA 4KE3A 2PUKC 3HJOA 2XPEA 2C3TA 4OO5A 3NZNA 3QDNA 1V98A 1DUGA 3WYWA 3KGKA 3UAPA 1M2DA 2JADA 5DJLA 2L5LA 4HS1A 5LCZA 1GUHA 2GT6A 3VFIA 1YJ6A 3FZAA 6GSWA 4BVYA 1EOGA 5DAKB 1TRUA 1JLWA 5HR3A 2A2RA 2HI7A 1K0NA 3I43A 1KBNA 3F4SA 4G2EA 4OCFA 2WCIA 2EIOA 3DVXA 4POBA 1WOUA 2MMNA 1ACVA 5GSSA 3BD2A 2VD1A 2GQKA 5HR1A 3GL5A 3G9BA 5AISA 5ECHB 2RUEA 3M9JA 5J9BA 5DALB 4RQRA 5ECQB 5D96A 2YWIA 2LJKA 3K8NA 3ZZXA 1ML6A 1F3BA 1GNEA 3F63A 2VD0A 4PUAA 1HD2A 3GSSA 2LNTA 3BBYA 4GRFA 1MDKA 2LV3A 1KNGA 3KZQA 3TKSC 3IOSA 1THXA 2R4VA 3CSJA 2F8AA 3APSA 2HQTA 3QD9A 3KH9A 2YZUA 1GUKA 2V2GA 2YWNA 3O3TA 2CVDA 2C8UA 1V40A 1TTZA 4J2FA 4LL4B 2WRTA 2HLSA 2IWTA 4TR0A 9GSSA 5E59A 1Z9HA 1TRVA 4F2IA 3HJPA 1F9MA 3KJYA 4KF9A 3BCKA 4LA1A 1USBA 1MEKA 3EC3A 1HNBA 2FY6A 2AHEA 2H6YA 3TKSA 4FH8A 1SU9A 4IN0A 2M46A 3DGQA 4GSTA 1FAAA 4USSA 3C1SA 2L6CA 2JSZA 4PGTA 3U5RE 2I4AA 4KGIA 5JWOB 2LRNA 1R7HA 5AN1A 1TK0B 1SYXA 2N5BA 5B8AA 3D5JA 3SWLA 2FWEA 1KTEA 1YKCA 3LSZA 2H8LA 2AJQB 4I8BA 2EIRA 4EXJA 3GMFA 3E0UA 1BG5A 5DQYA 2MBTA 4FYBA 2DJ1A 5LD0A 2A2SA 1O7UA 2MMZA 3IC4A 3MWHA 5D9VA 4TVEA 5G5EA 3UMAA 17GSA 1WE0A 3HKRA 1AW9A 2H1GA 4IHUA 3PH9A 1XW5A 3BCIA 4TR3A 2YWOA 1M9BA 4DSQA 1KEBA 3N9JA 4PQHA 1GTAA 5G5FA 4WF5A 2N5FA 5GZZB 2B3SA 5F8BA 4HZ2A 6GSSA 3A2WA 3DIEA 4MF6A 18GSA 2H66A 4MLYA 2WB9A 1QK8A 3UJ1A 4CDOA 1TP9A 2C0DA 2QKEA 3ZMLA 4K0NA 1TI1A 4ZL9A 2PVQA 3HDCA 4JRRA 2VLUA 1YEPA 4YAPA 4I6XA 1FO5A 4TXOA 1A0RP 3UOMA 2HSMA 3FR3A 5KN0A 2GZPA 1XWCA 2LRTA 4Q5FA 2GLRA 5EY6A 4AGSA 3HD5A 1NHOA 4MA9A 2MBSA 5EVOA 2FA4A 3L9UA 2IFQB 1B4QA 5AIVA 1TI3A 3IHQA 2C3QA 4EE0A 4KNDA 1XWGA 4MJEA 3TOUA 3F6DA 2H72A 2GSQA 4KA0A 2GVPA 4IBPA 5BMUA 1WIKA 2OE3A 2B7KA 4BA7A 2WGRA 2P31A 3M1GA 2JZSA 2X8HA 4ZL8A 3C1RA 3TKSE 4ZIJA 1XVQA 2PWJA 1TOFA 4JEDA 2FA8A 4L8EA 2H6ZA 4ISDA 4OWYA 1Z3EA 3M3MA 3IK7A 4K0GA 4XCSA 2H0IA 2WFCA 1K0BA 3RPPA 13GSA 3F9UA 3ZLPA 4EUYA 4G10A 4AJ7A 1A23A 3GNJA 5DJMA 1BX9A 3ERGA 3H1NA 3UBLA 2XBQA 1GSDA 1CQGA 4NV2A 1EV4A 1SKWB 3CTGA 5IQYA 3M8NA 4OFMA 1OC9B 1X5EA 5ECNB 4PUFC 5F05A 1Q98A 3WGEA 4PURA 4ZBAA 1SKRB 1ZL9A 5HFGA 4D73B 2O89A 3EU4A 2HFDA 4WBJA 4KB3A 2YWMA 2J9HA 2WZ9A 2VAFA 1FB0A 1EWXA 3TB2A 2HSNB 4IVFA 1K0AA 5GAND 3VPQA 2YP6A 2IMKA 1OYJA 4EC0A 3HZ8A 1PSQA 2NBSA 2CX4A 3G7YA 4TR4A 5HR2A 2VCXA 4N10A 2VL9A 1WP0A 3GTUB 4G9HA 3TKRA 2P5QA 3UEMA 5ECIB 3QAWA 3LGCA 14GSA 1U87A 3GV1A 1ABAA 1FOVA 2C3NA 1DBYA 3UIWA 4XS4A 3GSTA 1K3OA 1MDJA 2B5XA 1TRWA 4IS0A 5DVBA 2RM5A 2DBCA 4I97A 3P7XA 5A4WA 3ZMKA 3EWLA 3C71A 2KLXA 4V1Ag 5HFKA 5J9CA 1GTUA 1THOA 3HXSA 4HJ2A 3DWVA 6GSXA 2HXKA 3ERFA 1ERWA 1NW2A 2I81A 3VWVA 3KEBA 5DBQA 2TRXA 4NWYA 3TKQA 4XTSA 4MJBA 4IQAA 2IPAA 5ENUA 2H76A 1T3BA 1O73A 3IE3A 2VCVA 2ON7A 5DCGA 4PNFA 1G6YA 3A2VA 1ZYQB 4IKHA 5ELAA 3WGXA 1O81A 3P90A 3ED3A 3ZVJA 2QSIA 1O8XA 1S3CA 3LYPA 5IO0A 2R5GA 1PD21 4NMUA 1EOHA 2IMEA 1VF4A 4ZL7A 1LU4A 2E0QA 4RQXA 4TN8A 1M2AA 2YOIA 4BPYA 1F37A 16GSA 1PX6A 1GL8A 3RAZA 2GT5A 3H8QA 1QUWA 5ECOB 2H73A 3GKKA 1BQ7A 4K9ZA 4O32A 1VF1A 1E6BA 3EMXA 4GF0A 1K0DA 3LORA 3APOA 1OVNA 3KP8A 5IMCA 3H4KA 1PMTA 4EO3A 2B1LA 3DD3A 2LSTA 4G19A 1M9AA 3FW2A 4PQIA 11GSA 1UC7A 1R26A 1EGRA 1MTCA 2L6DA 4DSSB 2H74A 2ES7A 2O8VB 2FUG2 3C8EA 1RK4A 4MJCA 5F07A 3LYKA 2HT9A 1O6JA 1OC3A 4LMVA 1ZOFA 2B6MA 5J41A 3GA4A 1XIYA 2UZ8A 2L57A 4JBBA 1NSWA 3GFKA 1B4PA 1A24A 4N0VA 1DE1A 1T7PB 3TGZA 3ME7A 4KSOA 4K6XA 2LJRA 4KSMA 4POKA 2LQOA 3FY7A 3HJMA 2JL4A 2CV4A 3LWAA 1PL2A 4KX4A 4HEA2 1T8EB 5IMVA 3LXZA 3HHVA 2GGTA 5COHA 4Z7XA 1G0TA 3GX8A 3FKFA 4GLTA 2K18A 3MDKA 22GSA 5C00A 2A4VA 4ZB6A 2YJ7A 2PERA 3R2QA 2L4QA 2VOCA 3QAVA 2DLXA 2OADA 3ZFLA 3KM6A 3IAM2 4FYCA 3FZ4A 2CVKA 3A3TA 2DIZA 3FR6A 1LBKA 2GSTA 3Q19A 3KTBA 5H5RA 3M0FA 2LNSA 4G0LA 4WBRD 1YF0A 3GH9A 1GULA 3GRXA 3S9FA 3IC8A 3JCML 1J08A 2VUPA 2V32A 3L78A 3VWUA 2CZ2A 5G2ZA 1EEJA 3TJBA 4KCEA 2M72A 1PKWA 6GSTA 2V6OA 4MP4A 3G7IA 5ECKB 1UN2A 2VLTA 2XBIA 5JCUA 2RM6A 3TJKA 4YH2A 2OE0A 1O8WA 3CBUA 1U88A 4TR1B 2KOKA 1TU7A 1X5DA 12GSA 3D4MA 4DEJA 4G0IA 3VWXA 4GWRA 2E7PA 1ON4A 2VM1A 2H30A 1YEXA 2MYGA 2CVBA 2AYTA 3UVTA 2G2QA 5IMZA 5LNKe 1X9SB 1W4VA 3W8JA 1GWCA 3HY2A 4WR4A 2C4JA 1GSFA 1R5PA 3ZTLA 2C80A 2O7KA 3D4TA 1A2LA 3W6GA 2K6VA 3QAGA 2C0FA 2OACA 3DKSA 4BVYB 4KAEA 2B5EA 3MSZA 4JR4A 3ZVJD 3UBKA 3DVWA 3F0IA 1QGVA 3TRQA 2G0FA 3DYRA 4FIWA 2WULA 2K9FA 2IMDA 1V58A 3LQ7A 4K7NA 1IYHA 3G7JA 5GSTA 1GRXA 5IIZA 4I2UA 2ZCTA 4O7HA 4K7OA 1XW9A 1J0FA 3TJJA 3IA1A 1JZOA 3FYGA 2J23A 4YQMA 4BL7A 4ECBA 1EP8A 1GLPA 2ON5A 3L9SA 3MAKA 3EVIA 3RDWA 4ILFA 3TOTA 3EE2A 2PBJA 2LS5A 2IMIA 3WT2A 3SBCA 4FQUA 1PKZA 5DCHA 2YNXA 2EIQA 8GSSA 3H79A 2OA7A 3E9JB 1Q4JA 1EP7A 4FYUA 1HNAA 3QCPA 4HU9A 4WETA 4TKYA 2AB6A 3EYTA 1Z6MA 2AAWA 5EL8A 2OKAA 3KCMA 6GSUA 1Z5YE 5G31A 2YV7A 2I3YA 3TJFA 1WJKA 3Q6OA 3UL3A 2KUCA 2GSRA 3P8WA 2PU9C 4MPFA 1I9DA 1DSBA 2HZEA 1GSUA 1G7EA 5CYYA 2GZZA 3GL3A 1Y25A 1XWKA 3ISOA 5D73A 1T4YA 3J7Yk 1JZWA 4MK3A 2HZFA 3F8UA 3CRUA 3LG6A 1DE2A 1GSYA 1UA5A 1EZKA 4WF4A 3NOFA 2X99A 2REMA 1H75A 2VLVA 2BTOT 4PQ1A 3D22A 2V41A 4CW9A 1XOBA 2MMOA 3HVXA 1BJXA 4ZB9A 2XC2A 1W89A 4ZBBA 4WR5A 5IMFA 3F4RA 4XHMA 4N30A 4ZB8A 3ME8A 4GQCA 2HRFA 1SK0A 4P3YB 4XS6A 2WS2A 4V2MA 5JWRB 1G7OA 3F6FA 1T00A 2K8VA 2NDOA 2WDUA 2N5AA 2CX3A 5ECPB 1SK2A 4N11A 3M9KA 4ZILA 5ID2A 2OBIA 3MNGA 2FWFA 3IDVA 1TU8A 5CP1A 5G30A 3A2XA 3WGDA 19GSA 5GAPD 2D2ZA 1OC8A 1X9MB 3FR9A 2PVOC 3FK8A 4BVXA 3Q18A 4IJIA 3CTFA 2O87A 5CAXA 4E8HA 2PPTA 3DXBA 2FLSA 1XW6A 4XRDA 1SD8A 2GQMA 3EU3A 2R3XA 4DSRA 2H0HA 2DJ3A 1QQ2A 1J9BA 2BJXA 2LEGA 4MMMA 1GUMA 1V2AA 3FZ5A 1Z6NA 2H0GA 2FWHA 4V2LA 3TDGA 1ZYEA 4RUVA 4EF0A 4TXOB 4NXIA 1SL0B 2HSMB 3PGTA 2HRKA 3R3EA 1M0UA 1YZXA 3I69A 4QL7A 5DDLA 4L5OA
chains in the Genus database with same CATH superfamily
2LRCA 1YKAA 1R4WA 4MABA 1JLVA 3VURA 2RIIA 3DMLA 1B9XC 3C7MA 2DMLA 2HE3A 3F4TA 1G6WA 2EFEA 1WPIA 1B48A 2VCQA 1PA3A 1YVLA 1XCCA 3ZREA 5DAKA 1AUCA 3VK9A 5BMUB 1XZOA 4NV5A 4BIKA 2VCZA 2F8FA 4AI6A 2JZTA 4IW9A 2HSYA 3CSHA 4G01A 4E8EA 1U3IA 1V9WA 2LQQA 1JZDA 2QGVA 3KTLA 2I1UA 1Z7PA 3LXTA 1RQMA 4JE1A 1TKDB 2OT3A 5D9TA 1XVWA 1AQWA 4HQSA 1WMJA 1SL1B 3GKMA 5JWQB 5DALA 4V2NA 4NAXA 4MF7A 1XOAA 2HRNA 2FCHA 1EV9A 3C73A 4A5PA 6GSYA 4BWQA 2R2JA 1N2AA 2KP2A 5IM9A 3LFLA 4EVMA 2VM2A 5F0GA 2YN1A 5ECRB 1MDIA 6GSVA 5KN3A 2GQLA 1S3DA 5A4VA 4GSSA 3QPMA 2HNLA 5INYA 2HRAA 1ERUA 5D9WA 2L4CA 5KOXA 3BJ5A 4X43A 4CHSA 3EINA 3ERWA 4MNNA 4ACSA 1PL1A 5CO3A 3ZITA 2YPMA 4ECIA 4MCUA 4KUNA 4O5RA 3GX0A 3U6VA 5JCGA 2XPDA 1YQ1A 2LUSA 4MH3A 1TJDA 1XWAA 1XPVA 4MZBA 5IPGA 2CAQA 1BEDA 1HQOA 2I9HA 2GDRA 2YCDA 2H75A 5CRGA 1A8LA 2A2PA 5ECMB 2X64A 4QQ7A 2DJKA 1BYEA 4F0CA 2WVXB 2H6XA 3GIXA 3TRXA 1PQNA 4RI7A 2O36A 3APQA 10GSA 3HVVA 4KW6A 2R37A 4PI2C 5B7CA 2LKUA 2VCTA 4IGJA 1GLQA 3WT1A 4XS4B 2E2MA 2NVLA 1I5GA 1FVKA 2GZYA 1GTIA 2PGTA 3P2AA 4I5QA 3Q74A 2H19A 3O76A 5FT3A 4XRAA 1PX7A 4XS1A 3TKPA 4EL1A 1SD9A 4HUAA 2TRCP 2BMXA 2AV4A 1H4OA 3QMXA 1ZMAA 3I9V2 3V1WA 1AXDA 2HYXA 4MF5A 5HFIA 5IPHA 4G0KA 3VI7A 4GQFA 4J56E 5CRDA 1GNWA 3QR6A 3N5OA 2EFDA 4GCIA 2VL2C 3GHAA 4K1FA 2R0PA 4IJ3A 4L5LA 1Y6EA 4MZWA 2OBKA 2O85A 2X8CA 3HMJG 2ZNMA 5DQSA 2YV9A 2DC5A 2K8SA 4TW5A 4KDXA 1ZGNA 3O6TA 2DJJA 4KDYA 4FO5A 2R6KA 2L59A 3QFBC 1OE8A 4F0BA 5HR0A 1V57A 2ALBA 2H1DA 3VI5A 2V1MA 4OMVA 4DVCA 1XFLA 3D0ZA 1HNCA 2VL2A 3ZRDA 2O5VA 5IMAA 1E2YA 2L5OA 3W8SA 1FHEA 2IN3A 4LL1B 5J3RA 5IOWA 2TIRA 5KN2A 5L71A 4YAVA 3UARA 2FNOA 4HI7A 2LJAA 1SK1A 1XBSA 1AAZA 3IXRA 2HSHA 4F82A 3RPNA 1LJRA 3RFRC 1GSSA 2B5YA 2FGXA 1A8YA 2IFQA 4MDCA 1FB6A 1S3AA 4CY8A 4YQVA 5A4UA 2IIYA 1OE7A 4MJAA 3WD6A 2JZRA 3KMNA 2EC4A 1TW9A 4GTUA 4PX1A 5A5KA 1M3IA 1YY7A 1ZCPA 2FD3A 3KH7A 1AC1A 2F51A 1GH2A 2RUFA 4XIHA 3TRPA 5BRTA 1TK5B 4PTSA 4YQUA 4AJ6A 3F3QA 2PMTA 4ID0A 1K3YA 1AQVA 1RW1A 4WKWA 3IK9A 1U3AA 3ZIVA 1TK8B 3PPUA 3GUSA 4MZCA 4L0WA 3FMWA 2OJLA 5J4UA 1A2JA 5FHIA 5G1LA 4EDYA 1MD4A 5B8BA 1UVZA 4KH7A 5J40A 1WRYA 1NM3A 4MH2A 4YKGA 3KXOA 3D21A 1VGLA 2P5RA 3OR5A 3KMOA 3KD0A 3IBHA 3A5WA 1JZRA 1JFUA 2X49A 20GSA 2H01A 1TRSA 3LEFA 4KCAA 3ZIJA 1S3RA 4W66A 1OC9A 2KP1A 1XWBA 4K2DA 4ZBDA 3CRTA 1ST9A 2DSAA 4PXOA 5H5QA 1ILOA 4D73A 2F9SA 4K8MA 4IQ1A 3FHKA 1O85A 4IELA 4FXYP 4Q5NA 1PGTA 5ECLB 1C72A 1M3JA 3L9VA 5B6NA 2ZUPA 1HYUA 2GS3A 4OFTA 4JU5A 4ECJA 1XG8A 2H1AA 2HSNA 5C04A 1GSEA 1GP1A 3TJGA 3RHCA 5ECSA 2VIMA 1X5CA 2YJHA 3AY8A 2B7JA 4NHZA 4BWSA 2P0GA 4POMA 3VLNA 2NTOA 1GTBA 5HQPA 3GTUA 5EPFA 3H93A 1TXUA 2A4HA 3I6AA 2DJ0A 4HOJA 3HVSA 4LLRA 1NHYA 3KIJA 1F2EA 4JZQA 1SVLA 1ERVA 3GURA 2IL3A 5G1KA 1M99A 2E2GA 2QC7A 3E3EA 4OO4A 4L0UA 3J7Yb 1M7TA 4TRXA 4ULXA 4ZXGA 1PN9A 1QMVA 4ML6A 1CQHA 4F03A 1A0FA 3QOUA 4KDUA 2X4AA 2VCWA 1X9WB 2JACA 3TCOA 3QFAC 2EFCA 2GSSA 2M80A 2PN8A 5KEJA 1SJIA 2YANA 1N8JA 1OKTA 1BG1A 3EMPA 3TU3B 1T1VA 2JU5A 1K0MA 2F3MA 4MPGA 1ERTA 2FHEA 3GKXA 3GH6A 1T4ZA 5JCWA 2OE1A 4ML1A 4HJMA 3CXGA 1SENA 4PNGA 2C1YA 3RHBA 3GN3A 2NPBA 3TUEA 3L0HA 3D6IA 2IJYA 5FWGA 3HA9A 5CNWA 4BL7B 1WWJA 1FW1A 5J5NA 1SJZA 4ZB7A 4HZ4A 2JSYA 4OFNA 3LJRA 4POLA 4EIPA 2C0GA 4X0XA 1YF1A 1SYRA 2X8GA 1AQXA 3GKNA 4HDEA 1AIUA 4OD7A 1OKDA 3VWWA 2CT6A 3KP9A 1K0OA 2CA8A 2AUVA 1EGOA 2IMFA 1MD3A 4WXTA 5CRWA 2WZSA 3DEXA 4X1UA 2VL3A 3HZ4A 1SJ6A 3IAS2 2WVYA 4Q5RA 1R5AA 2XHFA 5D93A 2VO4A 3CYNA 5KN1A 2HZEB 3BOAA 7GSSA 1GSQA 4NHWA 3FEUA 3UVHA 4WEYA 4AF2A 4O5QA 3RBTA 1BAYA 4K7IA 5CRHA 4EDZA 4DSSA 4ECCA 2CAIA 5ELGA 3L4NA 3CMIA 4GXZA 1K0CA 1U6TA 2UV8G 2MZCA 1TDIA 2H71A 3GYKA 4N0ZA 5B6MA 4I2TA 4O92A 3FRCA 4AKIA 4F9ZA 4NPBA 3ZYWA 3PR8A 2B1KA 1XXUA 1VRSD 3PINA 2DJ2A 2CZ3A 1JHBA 4IP1A 3IPZA 1I1IP 4OCEA 5D9XA 1URMA 2EFHA 4QL9A 4TOPA 4Q5QA 5AGYA 2GTUA 5ID2B 5F06A 4GSNA 2WJUA 4CY6A 3FZ9A 1X0RA 1QFNA 2V6KA 1A2MA 1IYIA 1ZZYA 5AIXA 4HQZA 2DMMA 1K3LA 5D8IA 5IMDA 4AJ8A 1F3AA 5E4WA 1SKSB 3HCZA 4J57E 4RI6A 1OAZA 4BVXB 2MMAA 3DRNA 1QXHA 1PRXA 2CQ9A 1FG4A 1PFOA 5ABRA 4IP6A 2DIYA 1FVJA 1B9YC 3HYPA 4H86A 2H1BA 3US3A 3EURA 2RLIA 5IOXA 3CSIA 2KHPA 1VF2A 1VF3A 1EEMA 5CREA 4V1Ap 2YZHA 3NIVA 1B8XA 3MYDA 1SVMA 3F3RA 4TXVA 4EKZA 5H5SA 3IRAA 3CHXC 3IV4A 2H70A 5IO2A 1YDKA 4TR1A 3ZFBA 4JR6A 2HRKB 1M2BA 1SL2B 3IR4A 3ZL5A 2C0EA 3VPTA 1Z7RA 3CQFA 2LTKA 4HU7A 1TXXA 2FWGA 1F6MC 4Z2TA 4LMWA 2Z9SA 4KE3A 2PUKC 3HJOA 2XPEA 2C3TA 4OO5A 3NZNA 3QDNA 1V98A 1DUGA 3WYWA 3KGKA 3UAPA 1M2DA 2JADA 5DJLA 2L5LA 4HS1A 5LCZA 1GUHA 3LW9A 4EIQA 2GT6A 3VFIA 1YJ6A 3FZAA 6GSWA 4BVYA 1EOGA 5DAKB 1PN0A 1TRUA 1JLWA 5A1NA 5HR3A 1BF5A 2A2RA 2HI7A 1K0NA 3I43A 1KBNA 4Z2RA 3F4SA 4G2EA 4OCFA 2WCIA 2EIOA 3DVXA 4POBA 1WOUA 2MMNA 1ACVA 5GSSA 3BD2A 2VD1A 2GQKA 5HR1A 3GL5A 3G9BA 5AISA 5ECHB 2RUEA 3M9JA 5J9BA 5DALB 4RQRA 5ECQB 5D96A 2YWIA 2LJKA 3K8NA 3ZZXA 1ML6A 1F3BA 1GNEA 3F63A 2VD0A 4PUAA 1HD2A 3GSSA 2LNTA 3BBYA 4GRFA 1MDKA 2LV3A 1KNGA 3KZQA 3TKSC 5J4YA 3IOSA 1THXA 2R4VA 3CSJA 2F8AA 3APSA 2HQTA 3QD9A 3KH9A 2YZUA 1GUKA 2V2GA 2YWNA 3O3TA 2CVDA 2C8UA 1V40A 1TTZA 4J2FA 4LL4B 2WRTA 2HLSA 2IWTA 4TR0A 9GSSA 5E59A 1Z9HA 1TRVA 5A34A 4F2IA 3HJPA 1F9MA 3KJYA 4KF9A 3BCKA 4LA1A 1USBA 1MEKA 3EC3A 1HNBA 2FY6A 2AHEA 2WVZA 2H6YA 3TKSA 4FH8A 2WW2A 1SU9A 4IN0A 2M46A 3DGQA 4GSTA 1FAAA 4USSA 3C1SA 2L6CA 2JSZA 4PGTA 3U5RE 2I4AA 4KGIA 5JWOB 2LRNA 1R7HA 5AN1A 1TK0B 1SYXA 2N5BA 5B8AA 3D5JA 3SWLA 2FWEA 1KTEA 1YKCA 3LSZA 2H8LA 4PHZC 2AJQB 4I8BA 2EIRA 4EXJA 3GMFA 3E0UA 1BG5A 5DQYA 2MBTA 4FYBA 2DJ1A 5LD0A 2A2SA 1O7UA 2MMZA 3IC4A 3MWHA 5D9VA 4TVEA 5G5EA 3UMAA 17GSA 3IHGA 1WE0A 3HKRA 1AW9A 2H1GA 1FOHA 4IHUA 3PH9A 1XW5A 3BCIA 4TR3A 2YWOA 1M9BA 4DSQA 1KEBA 3N9JA 1YEWC 4PQHA 1GTAA 5G5FA 4WF5A 2N5FA 5GZZB 2B3SA 5F8BA 4HZ2A 6GSSA 3A2WA 4ICYA 3DIEA 4MF6A 18GSA 3EPTA 2H66A 4MLYA 2WB9A 1QK8A 3UJ1A 4CDOA 2WW0A 1TP9A 2C0DA 2QKEA 3ZMLA 4K0NA 1TI1A 4ZL9A 2PVQA 3HDCA 4JRRA 2VLUA 1YEPA 4YAPA 4I6XA 1FO5A 4TXOA 1A0RP 3UOMA 2HSMA 3FR3A 5KN0A 2GZPA 1XWCA 2LRTA 4Q5FA 2QA2A 2GLRA 5EY6A 4AGSA 3HD5A 1NHOA 4MA9A 2MBSA 5EVOA 2FA4A 3L9UA 2IFQB 1B4QA 5AIVA 1TI3A 3IHQA 2C3QA 4EE0A 4KNDA 1XWGA 4MJEA 3TOUA 3F6DA 2H72A 4K2XA 2GSQA 2H1LA 4KA0A 2GVPA 4IBPA 5BMUA 1WIKA 2OE3A 2B7KA 4BA7A 2WGRA 2P31A 3M1GA 2JZSA 2X8HA 4ZL8A 3C1RA 3TKSE 2WW3A 4ZIJA 1XVQA 2PWJA 1TOFA 4JEDA 3A5IA 2FA8A 4L8EA 2H6ZA 4ISDA 4OWYA 1Z3EA 3M3MA 3IK7A 4K0GA 4XCSA 2H0IA 2WFCA 1K0BA 3RPPA 13GSA 3F9UA 3ZLPA 4EUYA 4G10A 4AJ7A 1A23A 3GNJA 5DJMA 1BX9A 3ERGA 3H1NA 3MIXA 3UBLA 2XBQA 1GSDA 1CQGA 4NV2A 1EV4A 1SKWB 3CTGA 5IQYA 3M8NA 4OFMA 1OC9B 1X5EA 5ECNB 4PUFC 5F05A 1Q98A 3WGEA 4PURA 4ZBAA 1SKRB 4N3ZA 1ZL9A 5HFGA 4D73B 2O89A 3EU4A 2HFDA 4WBJA 4KB3A 2YWMA 2J9HA 2WZ9A 2VAFA 1FB0A 1EWXA 3TB2A 2HSNB 4IVFA 4X4JA 1K0AA 5GAND 3VPQA 2YP6A 2IMKA 1OYJA 4EC0A 3HZ8A 1PSQA 2NBSA 2CX4A 3G7YA 4TR4A 5HR2A 2VCXA 4N10A 4GDFA 2VL9A 1WP0A 3GTUB 4G9HA 3TKRA 2P5QA 3UEMA 5ECIB 3QAWA 3LGCA 14GSA 1U87A 2WVXA 3GV1A 1ABAA 4E68A 1FOVA 1SVOA 2C3NA 1DBYA 3UIWA 5J4VA 4XS4A 3GSTA 1K3OA 1MDJA 2B5XA 1TRWA 4IS0A 5DVBA 2RM5A 2DBCA 4I97A 1N25A 3P7XA 1ZYNA 5A4WA 3ZMKA 3EWLA 4O5UA 3C71A 2KLXA 4V1Ag 5HFKA 5J9CA 1GTUA 1THOA 3HXSA 4HJ2A 3DWVA 4PI0C 6GSXA 2HXKA 3ERFA 1ERWA 1NW2A 2I81A 3VWVA 3KEBA 5DBQA 2TRXA 4NWYA 3TKQA 4XTSA 4MJBA 4IQAA 2IPAA 5ENUA 2H76A 1T3BA 1O73A 3IE3A 2VCVA 2ON7A 5DCGA 4PNFA 1G6YA 4AKXB 3A2VA 1ZYQB 4IKHA 5ELAA 3WGXA 1O81A 3P90A 3ED3A 3ZVJA 2QSIA 1O8XA 1S3CA 3LYPA 2R0CA 5IO0A 2R5GA 1PD21 4NMUA 1EOHA 2IMEA 1VF4A 4ZL7A 1LU4A 2E0QA 4RQXA 2O3EA 4TN8A 1M2AA 2YOIA 4BPYA 1F37A 16GSA 1PX6A 1GL8A 3RAZA 2GT5A 1Y1UA 3H8QA 1QUWA 5ECOB 2H73A 3GKKA 1BQ7A 4K9ZA 4O32A 1VF1A 1E6BA 3EMXA 4GF0A 1K0DA 3LORA 3APOA 1OVNA 3KP8A 5IMCA 3H4KA 1PMTA 4EO3A 2B1LA 3DD3A 2LSTA 4G19A 1M9AA 3FW2A 4PQIA 11GSA 1UC7A 1R26A 1EGRA 1MTCA 2L6DA 4DSSB 2H74A 2ES7A 2O8VB 2FUG2 3C8EA 1RK4A 4MJCA 5F07A 3LYKA 2HT9A 1O6JA 1OC3A 4LMVA 1ZOFA 2B6MA 5J41A 3GA4A 1XIYA 2UZ8A 2L57A 4JBBA 2QA1A 1NSWA 3GFKA 1B4PA 1A24A 4N0VA 1DE1A 1T7PB 3TGZA 3ME7A 4KSOA 4K6XA 2LJRA 4KSMA 4POKA 2LQOA 3FY7A 3HJMA 2JL4A 2CV4A 3LWAA 1PL2A 4KX4A 4HEA2 1T8EB 5IMVA 3LXZA 3HHVA 2GGTA 5COHA 4Z7XA 1G0TA 3GX8A 3FKFA 4GLTA 2DKHA 2K18A 3MDKA 22GSA 5C00A 2A4VA 4ZB6A 2YJ7A 2PERA 3R2QA 2L4QA 2VOCA 3QAVA 2DLXA 2OADA 3ZFLA 3KM6A 3IAM2 4FYCA 3FZ4A 2CVKA 3A3TA 2DIZA 3FR6A 1LBKA 2GSTA 3Q19A 3KTBA 5H5RA 3M0FA 2LNSA 4G0LA 4WBRD 1YF0A 3GH9A 1GULA 1S4BP 3GRXA 3S9FA 3IC8A 3JCML 1J08A 2VUPA 2V32A 3L78A 3VWUA 2CZ2A 5G2ZA 1EEJA 3TJBA 4KCEA 2M72A 1PKWA 6GSTA 2V6OA 4MP4A 3G7IA 5ECKB 1UN2A 2VLTA 2XBIA 5JCUA 2RM6A 3TJKA 4YH2A 2OE0A 4K5RA 1O8WA 3CBUA 1U88A 4TR1B 2KOKA 1TU7A 1X5DA 12GSA 3D4MA 3RGBC 4DEJA 4G0IA 2DKIA 3VWXA 4GWRA 2E7PA 1ON4A 2VM1A 2H30A 1YEXA 2MYGA 2CVBA 2AYTA 3UVTA 2G2QA 2R0GA 5IMZA 5LNKe 1X9SB 1W4VA 3W8JA 1GWCA 3HY2A 4WR4A 2C4JA 1GSFA 1R5PA 3ZTLA 2C80A 2O7KA 3D4TA 1A2LA 3W6GA 2K6VA 3QAGA 2C0FA 2OACA 3DKSA 4BVYB 4KAEA 2B5EA 3MSZA 4JR4A 3ZVJD 3UBKA 3DVWA 3F0IA 5A1NB 1QGVA 3TRQA 2G0FA 3DYRA 4FIWA 2WULA 2K9FA 2IMDA 1V58A 3LQ7A 4K7NA 1IYHA 3G7JA 5GSTA 1GRXA 5IIZA 4I2UA 2ZCTA 4O7HA 4K7OA 1XW9A 1J0FA 3TJJA 3IA1A 1JZOA 3FYGA 2J23A 4YQMA 4BL7A 4ECBA 1EP8A 1GLPA 2ON5A 3L9SA 3MAKA 4K5SA 3EVIA 3RDWA 4ILFA 3TOTA 3EE2A 2PBJA 2LS5A 4HSCX 2IMIA 3WT2A 3SBCA 4FQUA 1PKZA 5A5HA 5DCHA 2YNXA 2EIQA 8GSSA 3H79A 2OA7A 3E9JB 1Q4JA 1EP7A 4FYUA 1HNAA 3QCPA 4HU9A 4WETA 4TKYA 2AB6A 3EYTA 1Z6MA 2AAWA 5EL8A 2OKAA 3KCMA 6GSUA 1Z5YE 4AKHA 5G31A 2VKZG 2YV7A 2I3YA 3TJFA 1WJKA 3Q6OA 3UL3A 2KUCA 2GSRA 3P8WA 2PU9C 4MPFA 1I9DA 1DSBA 2HZEA 1GSUA 5A34B 1G7EA 5CYYA 2GZZA 3GL3A 1Y25A 1XWKA 3ISOA 5D73A 1T4YA 4QMKA 3J7Yk 1JZWA 4MK3A 2HZFA 3F8UA 3CRUA 3LG6A 1DE2A 1GSYA 1UA5A 1EZKA 4WF4A 3NOFA 2X99A 2REMA 1H75A 2VLVA 4AKGA 2BTOT 4PQ1A 3D22A 5J47A 2V41A 4CW9A 1XOBA 2WW1A 2MMOA 3HVXA 1BJXA 4ZB9A 2XC2A 1W89A 4ZBBA 4WR5A 5IMFA 3F4RA 4XHMA 4N30A 4ZB8A 3ME8A 4GQCA 2HRFA 1SK0A 4P3YB 4XS6A 2WS2A 4V2MA 5JWRB 1G7OA 3F6FA 1T00A 2K8VA 2NDOA 2WDUA 2N5AA 2CX3A 5ECPB 1SK2A 4N11A 3M9KA 4ZILA 5ID2A 2OBIA 3MNGA 2FWFA 1ZYPA 3IDVA 1TU8A 5CP1A 5G30A 3HVNA 3A2XA 3WGDA 19GSA 5GAPD 2D2ZA 1OC8A 1X9MB 3FR9A 2PVOC 3FK8A 4BVXA 3Q18A 4IJIA 3CTFA 2O87A 5CAXA 4E8HA 2PPTA 3DXBA 2FLSA 1XW6A 4XRDA 1SD8A 2GQMA 3EU3A 2R3XA 4DSRA 2H0HA 4YKFA 2DJ3A 1QQ2A 1J9BA 2BJXA 2LEGA 5A5HB 4MMMA 1GUMA 1V2AA 3FZ5A 1Z6NA 2H0GA 2FWHA 4V2LA 3TDGA 1ZYEA 5KOWA 4RUVA 3CWGA 4EF0A 4TXOB 4NXIA 1SL0B 2HSMB 3PGTA 2HRKA 4Z2UA 3R3EA 1M0UA 1YZXA 3I69A 4QL7A 5DDLA 4L5OA
chains in the Genus database with same CATH topology
2LRCA 1YKAA 1R4WA 4MABA 1JLVA 3VURA 2RIIA 3DMLA 1B9XC 3C7MA 2DMLA 2HE3A 3F4TA 1G6WA 2EFEA 1WPIA 1B48A 2VCQA 1PA3A 1YVLA 1XCCA 3ZREA 5DAKA 1AUCA 3VK9A 5BMUB 1XZOA 4NV5A 2VCZA 2F8FA 4AI6A 2JZTA 4IW9A 2HSYA 3CSHA 4G01A 4E8EA 1U3IA 1V9WA 2LQQA 1JZDA 2QGVA 3KTLA 2I1UA 1Z7PA 3LXTA 1RQMA 4JE1A 1TKDB 2OT3A 5D9TA 1XVWA 1AQWA 4HQSA 1WMJA 1SL1B 3GKMA 5JWQB 5DALA 4V2NA 4NAXA 4MF7A 1XOAA 2HRNA 2FCHA 1EV9A 3C73A 4A5PA 6GSYA 4BWQA 2R2JA 1N2AA 2KP2A 5IM9A 3LFLA 4EVMA 2VM2A 5F0GA 2YN1A 5ECRB 1MDIA 6GSVA 5KN3A 2GQLA 1S3DA 5A4VA 4GSSA 3QPMA 2HNLA 5INYA 2HRAA 1ERUA 5D9WA 2L4CA 5KOXA 3BJ5A 4X43A 4CHSA 3EINA 3ERWA 4MNNA 4ACSA 1PL1A 5CO3A 3ZITA 2YPMA 4ECIA 4MCUA 4KUNA 4O5RA 3GX0A 3U6VA 5JCGA 2XPDA 1YQ1A 2LUSA 4MH3A 1TJDA 1XWAA 1XPVA 4MZBA 5IPGA 2CAQA 1BEDA 1HQOA 2I9HA 2GDRA 2YCDA 2H75A 5CRGA 1A8LA 2A2PA 5ECMB 2X64A 4QQ7A 2DJKA 1BYEA 4F0CA 2H6XA 3GIXA 3TRXA 1PQNA 4RI7A 3APQA 10GSA 3HVVA 4KW6A 2R37A 5B7CA 2LKUA 2VCTA 4IGJA 1GLQA 3WT1A 4XS4B 2E2MA 2NVLA 1I5GA 1FVKA 2GZYA 1GTIA 2PGTA 3P2AA 4I5QA 3Q74A 2H19A 3O76A 5FT3A 4XRAA 1PX7A 4XS1A 3TKPA 4EL1A 1SD9A 4HUAA 2TRCP 2BMXA 2AV4A 1H4OA 3QMXA 1ZMAA 3I9V2 3V1WA 1AXDA 2HYXA 4MF5A 5HFIA 5IPHA 4G0KA 3VI7A 4GQFA 4J56E 5CRDA 1GNWA 3QR6A 3N5OA 2EFDA 4GCIA 2VL2C 3GHAA 4K1FA 2R0PA 4IJ3A 4L5LA 1Y6EA 4MZWA 2OBKA 2O85A 2X8CA 3HMJG 2ZNMA 5DQSA 2YV9A 2DC5A 2K8SA 4TW5A 4KDXA 1ZGNA 3O6TA 2DJJA 4KDYA 4FO5A 2R6KA 2L59A 3QFBC 1OE8A 4F0BA 5HR0A 1V57A 2ALBA 2H1DA 3VI5A 2V1MA 4OMVA 4DVCA 1XFLA 3D0ZA 1HNCA 2VL2A 3ZRDA 2O5VA 5IMAA 1E2YA 2L5OA 3W8SA 1FHEA 2IN3A 4LL1B 5J3RA 5IOWA 2TIRA 5KN2A 5L71A 4YAVA 3UARA 2FNOA 4HI7A 2LJAA 1SK1A 1XBSA 1AAZA 3IXRA 2HSHA 4F82A 3RPNA 1LJRA 1GSSA 2B5YA 2FGXA 1A8YA 2IFQA 4MDCA 1FB6A 1S3AA 4CY8A 4YQVA 5A4UA 2IIYA 1OE7A 4MJAA 3WD6A 2JZRA 3KMNA 2EC4A 1TW9A 4GTUA 4PX1A 5A5KA 1YY7A 1ZCPA 2FD3A 3KH7A 1AC1A 2F51A 1GH2A 2RUFA 4XIHA 3TRPA 5BRTA 1TK5B 4PTSA 4YQUA 4AJ6A 3F3QA 2PMTA 4ID0A 1K3YA 1AQVA 1RW1A 4WKWA 3IK9A 1U3AA 3ZIVA 1TK8B 3PPUA 3GUSA 4MZCA 4L0WA 3FMWA 2OJLA 5J4UA 1A2JA 5FHIA 5G1LA 4EDYA 1MD4A 5B8BA 1UVZA 4KH7A 5J40A 1WRYA 1NM3A 4MH2A 4YKGA 3KXOA 3D21A 1VGLA 2P5RA 3OR5A 3KMOA 3KD0A 3IBHA 3A5WA 1JZRA 1JFUA 2X49A 20GSA 2H01A 1TRSA 3LEFA 4KCAA 3ZIJA 4W66A 1OC9A 2KP1A 1XWBA 4K2DA 4ZBDA 3CRTA 1ST9A 2DSAA 4PXOA 5H5QA 1ILOA 4D73A 2F9SA 4K8MA 4IQ1A 3FHKA 1O85A 4IELA 4Q5NA 1PGTA 5ECLB 1C72A 3L9VA 5B6NA 2ZUPA 1HYUA 2GS3A 4OFTA 4JU5A 4ECJA 2H1AA 2HSNA 5C04A 1GSEA 1GP1A 3TJGA 3RHCA 5ECSA 2VIMA 1X5CA 2YJHA 3AY8A 2B7JA 4NHZA 4BWSA 2P0GA 4POMA 3VLNA 2NTOA 1GTBA 5HQPA 3GTUA 5EPFA 3H93A 1TXUA 2A4HA 3I6AA 2DJ0A 4HOJA 3HVSA 4LLRA 1NHYA 3KIJA 1F2EA 4JZQA 1SVLA 1ERVA 3GURA 2IL3A 5G1KA 1M99A 2E2GA 2QC7A 3E3EA 4OO4A 4L0UA 3J7Yb 1M7TA 4TRXA 4ULXA 4ZXGA 1PN9A 1QMVA 4ML6A 1CQHA 4F03A 1A0FA 3QOUA 4KDUA 2X4AA 2VCWA 1X9WB 2JACA 3TCOA 3QFAC 2EFCA 2GSSA 2M80A 2PN8A 5KEJA 1SJIA 2YANA 1N8JA 1OKTA 1BG1A 3EMPA 3TU3B 1T1VA 2JU5A 1K0MA 2F3MA 4MPGA 1ERTA 2FHEA 3GKXA 3GH6A 1T4ZA 5JCWA 2OE1A 4ML1A 4HJMA 3CXGA 1SENA 4PNGA 2C1YA 3RHBA 3GN3A 2NPBA 3TUEA 3L0HA 3D6IA 2IJYA 5FWGA 3HA9A 5CNWA 4BL7B 1WWJA 1FW1A 5J5NA 1SJZA 4ZB7A 4HZ4A 2JSYA 4OFNA 3LJRA 4POLA 4EIPA 2C0GA 4X0XA 1YF1A 1SYRA 2X8GA 1AQXA 3GKNA 4HDEA 1AIUA 4OD7A 1OKDA 3VWWA 2CT6A 3KP9A 1K0OA 2CA8A 2AUVA 1EGOA 2IMFA 1MD3A 4WXTA 5CRWA 3DEXA 4X1UA 2VL3A 3HZ4A 1SJ6A 3IAS2 4Q5RA 1R5AA 2XHFA 5D93A 2VO4A 3CYNA 5KN1A 2HZEB 3BOAA 7GSSA 1GSQA 4NHWA 3FEUA 3UVHA 4WEYA 4AF2A 4O5QA 3RBTA 1BAYA 4K7IA 5CRHA 4EDZA 4DSSA 4ECCA 2CAIA 5ELGA 3L4NA 3CMIA 4GXZA 1K0CA 1U6TA 2UV8G 2MZCA 1TDIA 2H71A 3GYKA 4N0ZA 5B6MA 4I2TA 4O92A 3FRCA 4AKIA 4F9ZA 4NPBA 3ZYWA 3PR8A 2B1KA 1XXUA 1VRSD 3PINA 2DJ2A 2CZ3A 1JHBA 4IP1A 3IPZA 4OCEA 5D9XA 1URMA 2EFHA 4QL9A 4TOPA 4Q5QA 5AGYA 2GTUA 5ID2B 5F06A 4GSNA 2WJUA 4CY6A 3FZ9A 1X0RA 1QFNA 2V6KA 1A2MA 1IYIA 1ZZYA 5AIXA 4HQZA 2DMMA 1K3LA 5D8IA 5IMDA 4AJ8A 1F3AA 5E4WA 1SKSB 3HCZA 4J57E 4RI6A 1OAZA 4BVXB 2MMAA 3DRNA 1QXHA 1PRXA 2CQ9A 1FG4A 5ABRA 4IP6A 2DIYA 1FVJA 1B9YC 3HYPA 4H86A 2H1BA 3US3A 3EURA 2RLIA 5IOXA 3CSIA 2KHPA 1VF2A 1VF3A 1EEMA 5CREA 4V1Ap 2YZHA 3NIVA 1B8XA 3MYDA 1SVMA 3F3RA 4TXVA 4EKZA 5H5SA 3IRAA 3IV4A 2H70A 5IO2A 1YDKA 4TR1A 3ZFBA 4JR6A 2HRKB 1M2BA 1SL2B 3IR4A 3ZL5A 2C0EA 3VPTA 1Z7RA 2LTKA 4HU7A 1TXXA 2FWGA 1F6MC 4Z2TA 4LMWA 2Z9SA 4KE3A 2PUKC 3HJOA 2XPEA 2C3TA 4OO5A 3NZNA 3QDNA 1V98A 1DUGA 3WYWA 3KGKA 3UAPA 1M2DA 2JADA 5DJLA 2L5LA 4HS1A 5LCZA 1GUHA 3LW9A 4EIQA 2GT6A 3VFIA 1YJ6A 3FZAA 6GSWA 4BVYA 1EOGA 5DAKB 1PN0A 1TRUA 1JLWA 5A1NA 5HR3A 1BF5A 2A2RA 2HI7A 1K0NA 3I43A 1KBNA 4Z2RA 3F4SA 4G2EA 4OCFA 2WCIA 2EIOA 3DVXA 4POBA 1WOUA 2MMNA 1ACVA 5GSSA 3BD2A 2VD1A 2GQKA 5HR1A 3GL5A 3G9BA 5AISA 5ECHB 2RUEA 3M9JA 5J9BA 5DALB 4RQRA 5ECQB 5D96A 2YWIA 2LJKA 3K8NA 3ZZXA 1ML6A 1F3BA 1GNEA 3F63A 2VD0A 4PUAA 1HD2A 3GSSA 2LNTA 3BBYA 4GRFA 1MDKA 2LV3A 1KNGA 3KZQA 3TKSC 5J4YA 3IOSA 1THXA 2R4VA 3CSJA 2F8AA 3APSA 2HQTA 3QD9A 3KH9A 2YZUA 1GUKA 2V2GA 2YWNA 3O3TA 2CVDA 2C8UA 1V40A 1TTZA 4J2FA 4LL4B 2WRTA 2HLSA 2IWTA 4TR0A 9GSSA 5E59A 1Z9HA 1TRVA 5A34A 4F2IA 3HJPA 1F9MA 3KJYA 4KF9A 3BCKA 4LA1A 1USBA 1MEKA 3EC3A 1HNBA 2FY6A 2AHEA 2H6YA 3TKSA 4FH8A 1SU9A 4IN0A 2M46A 3DGQA 4GSTA 1FAAA 4USSA 3C1SA 2L6CA 2JSZA 4PGTA 3U5RE 2I4AA 4KGIA 5JWOB 2LRNA 1R7HA 5AN1A 1TK0B 1SYXA 2N5BA 5B8AA 3D5JA 3SWLA 2FWEA 1KTEA 1YKCA 3LSZA 2H8LA 2AJQB 4I8BA 2EIRA 4EXJA 3GMFA 3E0UA 1BG5A 5DQYA 2MBTA 4FYBA 2DJ1A 5LD0A 2A2SA 1O7UA 2MMZA 3IC4A 3MWHA 5D9VA 4TVEA 5G5EA 3UMAA 17GSA 3IHGA 1WE0A 3HKRA 1AW9A 2H1GA 1FOHA 4IHUA 3PH9A 1XW5A 3BCIA 4TR3A 2YWOA 1M9BA 4DSQA 1KEBA 3N9JA 4PQHA 1GTAA 5G5FA 4WF5A 2N5FA 5GZZB 2B3SA 5F8BA 4HZ2A 6GSSA 3A2WA 4ICYA 3DIEA 4MF6A 18GSA 3EPTA 2H66A 4MLYA 2WB9A 1QK8A 3UJ1A 4CDOA 1TP9A 2C0DA 2QKEA 3ZMLA 4K0NA 1TI1A 4ZL9A 2PVQA 3HDCA 4JRRA 2VLUA 1YEPA 4YAPA 4I6XA 1FO5A 4TXOA 1A0RP 3UOMA 2HSMA 3FR3A 5KN0A 2GZPA 1XWCA 2LRTA 4Q5FA 2QA2A 2GLRA 5EY6A 4AGSA 3HD5A 1NHOA 4MA9A 2MBSA 5EVOA 2FA4A 3L9UA 2IFQB 1B4QA 5AIVA 1TI3A 3IHQA 2C3QA 4EE0A 4KNDA 1XWGA 4MJEA 3TOUA 3F6DA 2H72A 4K2XA 2GSQA 2H1LA 4KA0A 2GVPA 4IBPA 5BMUA 1WIKA 2OE3A 2B7KA 4BA7A 2WGRA 2P31A 3M1GA 2JZSA 2X8HA 4ZL8A 3C1RA 3TKSE 4ZIJA 1XVQA 2PWJA 1TOFA 4JEDA 3A5IA 2FA8A 4L8EA 2H6ZA 4ISDA 4OWYA 1Z3EA 3M3MA 3IK7A 4K0GA 4XCSA 2H0IA 2WFCA 1K0BA 3RPPA 13GSA 3F9UA 3ZLPA 4EUYA 4G10A 4AJ7A 1A23A 3GNJA 5DJMA 1BX9A 3ERGA 3H1NA 3MIXA 3UBLA 2XBQA 1GSDA 1CQGA 4NV2A 1EV4A 1SKWB 3CTGA 5IQYA 3M8NA 4OFMA 1OC9B 1X5EA 5ECNB 4PUFC 5F05A 1Q98A 3WGEA 4PURA 4ZBAA 1SKRB 4N3ZA 1ZL9A 5HFGA 4D73B 2O89A 3EU4A 2HFDA 4WBJA 4KB3A 2YWMA 2J9HA 2WZ9A 2VAFA 1FB0A 1EWXA 3TB2A 2HSNB 4IVFA 4X4JA 1K0AA 5GAND 3VPQA 2YP6A 2IMKA 1OYJA 4EC0A 3HZ8A 1PSQA 2NBSA 2CX4A 3G7YA 4TR4A 5HR2A 2VCXA 4N10A 4GDFA 2VL9A 1WP0A 3GTUB 4G9HA 3TKRA 2P5QA 3UEMA 5ECIB 3QAWA 3LGCA 14GSA 1U87A 3GV1A 1ABAA 4E68A 1FOVA 1SVOA 2C3NA 1DBYA 3UIWA 5J4VA 4XS4A 3GSTA 1K3OA 1MDJA 2B5XA 1TRWA 4IS0A 5DVBA 2RM5A 2DBCA 4I97A 1N25A 3P7XA 1ZYNA 5A4WA 3ZMKA 3EWLA 4O5UA 3C71A 2KLXA 4V1Ag 5HFKA 5J9CA 1GTUA 1THOA 3HXSA 4HJ2A 3DWVA 6GSXA 2HXKA 3ERFA 1ERWA 1NW2A 2I81A 3VWVA 3KEBA 5DBQA 2TRXA 4NWYA 3TKQA 4XTSA 4MJBA 4IQAA 2IPAA 5ENUA 2H76A 1T3BA 1O73A 3IE3A 2VCVA 2ON7A 5DCGA 4PNFA 1G6YA 4AKXB 3A2VA 1ZYQB 4IKHA 5ELAA 3WGXA 1O81A 3P90A 3ED3A 3ZVJA 2QSIA 1O8XA 1S3CA 3LYPA 2R0CA 5IO0A 2R5GA 1PD21 4NMUA 1EOHA 2IMEA 1VF4A 4ZL7A 1LU4A 2E0QA 4RQXA 4TN8A 1M2AA 2YOIA 4BPYA 1F37A 16GSA 1PX6A 1GL8A 3RAZA 2GT5A 1Y1UA 3H8QA 1QUWA 5ECOB 2H73A 3GKKA 1BQ7A 4K9ZA 4O32A 1VF1A 1E6BA 3EMXA 4GF0A 1K0DA 3LORA 3APOA 1OVNA 3KP8A 5IMCA 3H4KA 1PMTA 4EO3A 2B1LA 3DD3A 2LSTA 4G19A 1M9AA 3FW2A 4PQIA 11GSA 1UC7A 1R26A 1EGRA 1MTCA 2L6DA 4DSSB 2H74A 2ES7A 2O8VB 2FUG2 3C8EA 1RK4A 4MJCA 5F07A 3LYKA 2HT9A 1O6JA 1OC3A 4LMVA 1ZOFA 2B6MA 5J41A 3GA4A 1XIYA 2UZ8A 2L57A 4JBBA 2QA1A 1NSWA 3GFKA 1B4PA 1A24A 4N0VA 1DE1A 1T7PB 3TGZA 3ME7A 4KSOA 4K6XA 2LJRA 4KSMA 4POKA 2LQOA 3FY7A 3HJMA 2JL4A 2CV4A 3LWAA 1PL2A 4KX4A 4HEA2 1T8EB 5IMVA 3LXZA 3HHVA 2GGTA 5COHA 4Z7XA 1G0TA 3GX8A 3FKFA 4GLTA 2DKHA 2K18A 3MDKA 22GSA 5C00A 2A4VA 4ZB6A 2YJ7A 2PERA 3R2QA 2L4QA 2VOCA 3QAVA 2DLXA 2OADA 3ZFLA 3KM6A 3IAM2 4FYCA 3FZ4A 2CVKA 3A3TA 2DIZA 3FR6A 1LBKA 2GSTA 3Q19A 3KTBA 5H5RA 3M0FA 2LNSA 4G0LA 4WBRD 1YF0A 3GH9A 1GULA 3GRXA 3S9FA 3IC8A 3JCML 1J08A 2VUPA 2V32A 3L78A 3VWUA 2CZ2A 5G2ZA 1EEJA 3TJBA 4KCEA 2M72A 1PKWA 6GSTA 2V6OA 4MP4A 3G7IA 5ECKB 1UN2A 2VLTA 2XBIA 5JCUA 2RM6A 3TJKA 4YH2A 2OE0A 4K5RA 1O8WA 3CBUA 1U88A 4TR1B 2KOKA 1TU7A 1X5DA 12GSA 3D4MA 4DEJA 4G0IA 2DKIA 3VWXA 4GWRA 2E7PA 1ON4A 2VM1A 2H30A 1YEXA 2MYGA 2CVBA 2AYTA 3UVTA 2G2QA 2R0GA 5IMZA 5LNKe 1X9SB 1W4VA 3W8JA 1GWCA 3HY2A 4WR4A 2C4JA 1GSFA 1R5PA 3ZTLA 2C80A 2O7KA 3D4TA 1A2LA 3W6GA 2K6VA 3QAGA 2C0FA 2OACA 3DKSA 4BVYB 4KAEA 2B5EA 3MSZA 4JR4A 3ZVJD 3UBKA 3DVWA 3F0IA 5A1NB 1QGVA 3TRQA 2G0FA 3DYRA 4FIWA 2WULA 2K9FA 2IMDA 1V58A 3LQ7A 4K7NA 1IYHA 3G7JA 5GSTA 1GRXA 5IIZA 4I2UA 2ZCTA 4O7HA 4K7OA 1XW9A 1J0FA 3TJJA 3IA1A 1JZOA 3FYGA 2J23A 4YQMA 4BL7A 4ECBA 1EP8A 1GLPA 2ON5A 3L9SA 3MAKA 4K5SA 3EVIA 3RDWA 4ILFA 3TOTA 3EE2A 2PBJA 2LS5A 2IMIA 3WT2A 3SBCA 4FQUA 1PKZA 5A5HA 5DCHA 2YNXA 2EIQA 8GSSA 3H79A 2OA7A 3E9JB 1Q4JA 1EP7A 4FYUA 1HNAA 3QCPA 4HU9A 4WETA 4TKYA 2AB6A 3EYTA 1Z6MA 2AAWA 5EL8A 2OKAA 3KCMA 6GSUA 1Z5YE 4AKHA 5G31A 2VKZG 2YV7A 2I3YA 3TJFA 1WJKA 3Q6OA 3UL3A 2KUCA 2GSRA 3P8WA 2PU9C 4MPFA 1I9DA 1DSBA 2HZEA 1GSUA 5A34B 1G7EA 5CYYA 2GZZA 3GL3A 1Y25A 1XWKA 3ISOA 5D73A 1T4YA 4QMKA 3J7Yk 1JZWA 4MK3A 2HZFA 3F8UA 3CRUA 3LG6A 1DE2A 1GSYA 1UA5A 1EZKA 4WF4A 3NOFA 2X99A 2REMA 1H75A 2VLVA 4AKGA 2BTOT 4PQ1A 3D22A 5J47A 2V41A 4CW9A 1XOBA 2MMOA 3HVXA 1BJXA 4ZB9A 2XC2A 1W89A 4ZBBA 4WR5A 5IMFA 3F4RA 4XHMA 4N30A 4ZB8A 3ME8A 4GQCA 2HRFA 1SK0A 4P3YB 4XS6A 2WS2A 4V2MA 5JWRB 1G7OA 3F6FA 1T00A 2K8VA 2NDOA 2WDUA 2N5AA 2CX3A 5ECPB 1SK2A 4N11A 3M9KA 4ZILA 5ID2A 2OBIA 3MNGA 2FWFA 1ZYPA 3IDVA 1TU8A 5CP1A 5G30A 3A2XA 3WGDA 19GSA 5GAPD 2D2ZA 1OC8A 1X9MB 3FR9A 2PVOC 3FK8A 4BVXA 3Q18A 4IJIA 3CTFA 2O87A 5CAXA 4E8HA 2PPTA 3DXBA 2FLSA 1XW6A 4XRDA 1SD8A 2GQMA 3EU3A 2R3XA 4DSRA 2H0HA 4YKFA 2DJ3A 1QQ2A 1J9BA 2BJXA 2LEGA 5A5HB 4MMMA 1GUMA 1V2AA 3FZ5A 1Z6NA 2H0GA 2FWHA 4V2LA 3TDGA 1ZYEA 5KOWA 4RUVA 3CWGA 4EF0A 4TXOB 4NXIA 1SL0B 2HSMB 3PGTA 2HRKA 4Z2UA 3R3EA 1M0UA 1YZXA 3I69A 4QL7A 5DDLA 4L5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRC A;  1YKA A;  1R4W A;  4MAB A;  1JLV A;  3VUR A;  2RII A;  3DML A;  1B9X C;  3C7M A;  2DML A;  2HE3 A;  3F4T A;  1G6W A;  1WPI A;  1B48 A;  2VCQ A;  1PA3 A;  1XCC A;  3ZRE A;  5DAK A;  1AUC A;  3VK9 A;  1XZO A;  4NV5 A;  2VCZ A;  2F8F A;  2JZT A;  4IW9 A;  2HSY A;  3CSH A;  4E8E A;  1U3I A;  1V9W A;  2LQQ A;  1JZD A;  2QGV A;  3KTL A;  2I1U A;  1Z7P A;  3LXT A;  1RQM A;  4JE1 A;  1TKD B;  5D9T A;  1XVW A;  1AQW A;  4HQS A;  1WMJ A;  1SL1 B;  3GKM A;  5JWQ B;  5DAL A;  4V2N A;  4NAX A;  4MF7 A;  1XOA A;  2HRN A;  2FCH A;  1EV9 A;  3C73 A;  6GSY A;  4BWQ A;  2R2J A;  1N2A A;  2KP2 A;  5IM9 A;  3LFL A;  4EVM A;  2VM2 A;  5F0G A;  2YN1 A;  5ECR B;  1MDI A;  6GSV A;  5KN3 A;  2GQL A;  1S3D A;  5A4V A;  4GSS A;  3QPM A;  2HNL A;  5INY A;  2HRA A;  1ERU A;  5D9W A;  2L4C A;  3BJ5 A;  4X43 A;  4CHS A;  3EIN A;  3ERW A;  4ACS A;  1PL1 A;  5CO3 A;  3ZIT A;  2YPM A;  4ECI A;  4MCU A;  4KUN A;  4O5R A;  3GX0 A;  3U6V A;  5JCG A;  2XPD A;  1YQ1 A;  2LUS A;  4MH3 A;  1TJD A;  1XWA A;  1XPV A;  4MZB A;  5IPG A;  2CAQ A;  1BED A;  1HQO A;  2I9H A;  2GDR A;  2YCD A;  2H75 A;  5CRG A;  1A8L A;  5ECM B;  2X64 A;  4QQ7 A;  2DJK A;  1BYE A;  4F0C A;  2H6X A;  3GIX A;  3TRX A;  1PQN A;  4RI7 A;  3APQ A;  10GS A;  3HVV A;  4KW6 A;  2R37 A;  5B7C A;  2LKU A;  2VCT A;  4IGJ A;  1GLQ A;  3WT1 A;  4XS4 B;  2E2M A;  2NVL A;  1I5G A;  1FVK A;  2GZY A;  1GTI A;  2PGT A;  3P2A A;  4I5Q A;  3Q74 A;  2H19 A;  3O76 A;  5FT3 A;  4XRA A;  1PX7 A;  4XS1 A;  3TKP A;  4EL1 A;  1SD9 A;  4HUA A;  2TRC P;  2BMX A;  2AV4 A;  1H4O A;  3QMX A;  1ZMA A;  3I9V 2;  3V1W A;  1AXD A;  2HYX A;  4MF5 A;  5HFI A;  5IPH A;  4G0K A;  3VI7 A;  4GQF A;  4J56 E;  5CRD A;  1GNW A;  3QR6 A;  3N5O A;  2VL2 C;  4GCI A;  3GHA A;  4K1F A;  4IJ3 A;  4L5L A;  1Y6E A;  4MZW A;  2OBK A;  2O85 A;  2X8C A;  2ZNM A;  5DQS A;  2YV9 A;  2DC5 A;  2K8S A;  4TW5 A;  4KDX A;  1ZGN A;  3O6T A;  2DJJ A;  4KDY A;  4FO5 A;  2R6K A;  2L59 A;  3QFB C;  1OE8 A;  4F0B A;  5HR0 A;  1V57 A;  2ALB A;  2H1D A;  3VI5 A;  2V1M A;  4OMV A;  4DVC A;  1XFL A;  3D0Z A;  1HNC A;  2VL2 A;  3ZRD A;  5IMA A;  1E2Y A;  2L5O A;  3W8S A;  1FHE A;  2IN3 A;  4LL1 B;  5J3R A;  5IOW A;  2TIR A;  5KN2 A;  5L71 A;  4YAV A;  3UAR A;  2FNO A;  4HI7 A;  2LJA A;  1SK1 A;  1XBS A;  1AAZ A;  2HSH A;  3IXR A;  4F82 A;  3RPN A;  1LJR A;  1GSS A;  2B5Y A;  2FGX A;  1A8Y A;  2IFQ A;  4MDC A;  1FB6 A;  1S3A A;  4YQV A;  5A4U A;  2IIY A;  1OE7 A;  4MJA A;  3WD6 A;  2JZR A;  3KMN A;  2EC4 A;  1TW9 A;  4GTU A;  4PX1 A;  5A5K A;  1YY7 A;  1ZCP A;  2FD3 A;  3KH7 A;  1AC1 A;  2F51 A;  1GH2 A;  2RUF A;  4XIH A;  3TRP A;  1TK5 B;  4PTS A;  4YQU A;  4AJ6 A;  3F3Q A;  2PMT A;  4ID0 A;  1K3Y A;  1AQV A;  1RW1 A;  4WKW A;  3IK9 A;  1U3A A;  3ZIV A;  1TK8 B;  3PPU A;  3GUS A;  4MZC A;  4L0W A;  2OJL A;  5J4U A;  1A2J A;  5FHI A;  5G1L A;  4EDY A;  1MD4 A;  5B8B A;  1UVZ A;  4KH7 A;  1WRY A;  1NM3 A;  4MH2 A;  3KXO A;  3D21 A;  1VGL A;  2P5R A;  3OR5 A;  3KMO A;  3KD0 A;  3IBH A;  3A5W A;  1JZR A;  1JFU A;  20GS A;  2H01 A;  1TRS A;  3LEF A;  4KCA A;  3ZIJ A;  1OC9 A;  2KP1 A;  1XWB A;  4K2D A;  4ZBD A;  3CRT A;  1ST9 A;  2DSA A;  4PXO A;  5H5Q A;  1ILO A;  4D73 A;  2F9S A;  4K8M A;  4IQ1 A;  3FHK A;  1O85 A;  4IEL A;  4Q5N A;  1PGT A;  5ECL B;  1C72 A;  3L9V A;  5B6N A;  2ZUP A;  1HYU A;  2GS3 A;  4OFT A;  4JU5 A;  4ECJ A;  2H1A A;  5C04 A;  1GSE A;  1GP1 A;  3TJG A;  3RHC A;  5ECS A;  2VIM A;  1X5C A;  2YJH A;  3AY8 A;  2B7J A;  4NHZ A;  4BWS A;  2P0G A;  4POM A;  3VLN A;  2NTO A;  1GTB A;  5HQP A;  3GTU A;  5EPF A;  3H93 A;  3I6A A;  2DJ0 A;  4HOJ A;  3HVS A;  4LLR A;  1NHY A;  3KIJ A;  1F2E A;  4JZQ A;  1ERV A;  3GUR A;  2IL3 A;  5G1K A;  1M99 A;  2E2G A;  2QC7 A;  3E3E A;  4OO4 A;  4L0U A;  3J7Y b;  1M7T A;  4TRX A;  4ULX A;  4ZXG A;  1PN9 A;  1QMV A;  4ML6 A;  1CQH A;  4F03 A;  1A0F A;  3QOU A;  4KDU A;  2VCW A;  1X9W B;  2JAC A;  3TCO A;  3QFA C;  2GSS A;  2M80 A;  2PN8 A;  5KEJ A;  1SJI A;  2YAN A;  1N8J A;  1OKT A;  3EMP A;  1T1V A;  2JU5 A;  1K0M A;  2F3M A;  4MPG A;  1ERT A;  2FHE A;  3GKX A;  3GH6 A;  1T4Z A;  5JCW A;  2OE1 A;  4ML1 A;  4HJM A;  3CXG A;  1SEN A;  4PNG A;  2C1Y A;  3RHB A;  3GN3 A;  2NPB A;  3TUE A;  3L0H A;  3D6I A;  2IJY A;  5FWG A;  3HA9 A;  5CNW A;  4BL7 B;  1WWJ A;  1FW1 A;  5J5N A;  1SJZ A;  4HZ4 A;  2JSY A;  4OFN A;  3LJR A;  4POL A;  2C0G A;  4X0X A;  1YF1 A;  1SYR A;  2X8G A;  1AQX A;  3GKN A;  4HDE A;  1AIU A;  4OD7 A;  1OKD A;  3VWW A;  2CT6 A;  3KP9 A;  1K0O A;  2CA8 A;  2AUV A;  1EGO A;  2IMF A;  1MD3 A;  4WXT A;  5CRW A;  3DEX A;  4X1U A;  2VL3 A;  3HZ4 A;  1SJ6 A;  3IAS 2;  4Q5R A;  1R5A A;  2XHF A;  5D93 A;  2VO4 A;  3CYN A;  5KN1 A;  2HZE B;  3BOA A;  7GSS A;  1GSQ A;  4NHW A;  3FEU A;  3UVH A;  4WEY A;  4AF2 A;  3RBT A;  1BAY A;  4K7I A;  5CRH A;  4EDZ A;  4DSS A;  4ECC A;  2CAI A;  5ELG A;  3L4N A;  3CMI A;  4GXZ A;  1K0C A;  1U6T A;  2MZC A;  1TDI A;  2H71 A;  3GYK A;  4N0Z A;  5B6M A;  4I2T A;  4O92 A;  3FRC A;  4F9Z A;  4NPB A;  3ZYW A;  3PR8 A;  2B1K A;  1XXU A;  1VRS D;  3PIN A;  2DJ2 A;  2CZ3 A;  1JHB A;  4IP1 A;  3IPZ A;  4OCE A;  5D9X A;  1URM A;  4QL9 A;  4TOP A;  4Q5Q A;  5AGY A;  2GTU A;  5ID2 B;  5F06 A;  4GSN A;  2WJU A;  3FZ9 A;  1X0R A;  1QFN A;  2V6K A;  1A2M A;  1IYI A;  1ZZY A;  5AIX A;  4HQZ A;  2DMM A;  1K3L A;  5D8I A;  5IMD A;  4AJ8 A;  1F3A A;  5E4W A;  1SKS B;  3HCZ A;  4J57 E;  4RI6 A;  1OAZ A;  4BVX B;  2MMA A;  3DRN A;  1QXH A;  1PRX A;  2CQ9 A;  1FG4 A;  5ABR A;  4IP6 A;  2DIY A;  1FVJ A;  1B9Y C;  3HYP A;  4H86 A;  2H1B A;  3US3 A;  3EUR A;  2RLI A;  5IOX A;  3CSI A;  2KHP A;  1VF2 A;  1VF3 A;  1EEM A;  5CRE A;  4V1A p;  2YZH A;  3NIV A;  1B8X A;  3F3R A;  4TXV A;  4EKZ A;  5H5S A;  3IRA A;  3IV4 A;  2H70 A;  5IO2 A;  1YDK A;  4TR1 A;  3ZFB A;  4JR6 A;  2HRK B;  1M2B A;  1SL2 B;  3IR4 A;  3ZL5 A;  2C0E A;  3VPT A;  1Z7R A;  2LTK A;  4HU7 A;  1TXX A;  2FWG A;  1F6M C;  4LMW A;  2Z9S A;  4KE3 A;  2PUK C;  3HJO A;  2XPE A;  2C3T A;  4OO5 A;  3NZN A;  3QDN A;  1V98 A;  1DUG A;  3WYW A;  3KGK A;  3UAP A;  1M2D A;  2JAD A;  5DJL A;  2L5L A;  4HS1 A;  5LCZ A;  1GUH A;  2GT6 A;  3VFI A;  1YJ6 A;  3FZA A;  6GSW A;  4BVY A;  1EOG A;  5DAK B;  1TRU A;  1JLW A;  5HR3 A;  2A2R A;  2HI7 A;  1K0N A;  3I43 A;  1KBN A;  3F4S A;  4G2E A;  4OCF A;  2WCI A;  2EIO A;  3DVX A;  4POB A;  1WOU A;  2MMN A;  1ACV A;  5GSS A;  3BD2 A;  2VD1 A;  2GQK A;  5HR1 A;  3GL5 A;  3G9B A;  5AIS A;  5ECH B;  2RUE A;  3M9J A;  5J9B A;  5DAL B;  4RQR A;  5ECQ B;  5D96 A;  2YWI A;  2LJK A;  3K8N A;  3ZZX A;  1ML6 A;  1F3B A;  1GNE A;  3F63 A;  2VD0 A;  4PUA A;  1HD2 A;  3GSS A;  2LNT A;  3BBY A;  4GRF A;  1MDK A;  2LV3 A;  1KNG A;  3KZQ A;  3TKS C;  3IOS A;  1THX A;  2R4V A;  3CSJ A;  2F8A A;  3APS A;  2HQT A;  3QD9 A;  3KH9 A;  2YZU A;  1GUK A;  2V2G A;  2YWN A;  3O3T A;  2CVD A;  2C8U A;  1V40 A;  1TTZ A;  4J2F A;  4LL4 B;  2WRT A;  2HLS A;  2IWT A;  4TR0 A;  9GSS A;  5E59 A;  1Z9H A;  1TRV A;  4F2I A;  3HJP A;  1F9M A;  3KJY A;  4KF9 A;  3BCK A;  4LA1 A;  1USB A;  1MEK A;  3EC3 A;  1HNB A;  2FY6 A;  2AHE A;  2H6Y A;  3TKS A;  4FH8 A;  1SU9 A;  4IN0 A;  2M46 A;  3DGQ A;  4GST A;  1FAA A;  4USS A;  3C1S A;  2L6C A;  2JSZ A;  4PGT A;  3U5R E;  2I4A A;  4KGI A;  5JWO B;  2LRN A;  1R7H A;  5AN1 A;  1TK0 B;  1SYX A;  2N5B A;  5B8A A;  3D5J A;  3SWL A;  2FWE A;  1KTE A;  1YKC A;  3LSZ A;  2H8L A;  2AJQ B;  4I8B A;  2EIR A;  4EXJ A;  3GMF A;  3E0U A;  1BG5 A;  5DQY A;  2MBT A;  4FYB A;  2DJ1 A;  5LD0 A;  2A2S A;  1O7U A;  2MMZ A;  3IC4 A;  3MWH A;  5D9V A;  4TVE A;  5G5E A;  3UMA A;  17GS A;  1WE0 A;  3HKR A;  1AW9 A;  2H1G A;  4IHU A;  3PH9 A;  1XW5 A;  3BCI A;  4TR3 A;  2YWO A;  1M9B A;  4DSQ A;  1KEB A;  3N9J A;  4PQH A;  1GTA A;  5G5F A;  4WF5 A;  2N5F A;  5GZZ B;  2B3S A;  5F8B A;  4HZ2 A;  6GSS A;  3A2W A;  3DIE A;  4MF6 A;  18GS A;  2H66 A;  4MLY A;  2WB9 A;  1QK8 A;  3UJ1 A;  4CDO A;  1TP9 A;  2C0D A;  2QKE A;  3ZML A;  4K0N A;  1TI1 A;  4ZL9 A;  2PVQ A;  3HDC A;  4JRR A;  2VLU A;  1YEP A;  4YAP A;  4I6X A;  1FO5 A;  4TXO A;  1A0R P;  3UOM A;  2HSM A;  3FR3 A;  5KN0 A;  2GZP A;  1XWC A;  2LRT A;  4Q5F A;  2GLR A;  5EY6 A;  4AGS A;  3HD5 A;  1NHO A;  4MA9 A;  2MBS A;  5EVO A;  2FA4 A;  3L9U A;  2IFQ B;  1B4Q A;  5AIV A;  1TI3 A;  3IHQ A;  2C3Q A;  4EE0 A;  4KND A;  1XWG A;  4MJE A;  3TOU A;  3F6D A;  2H72 A;  2GSQ A;  4KA0 A;  2GVP A;  4IBP A;  5BMU A;  1WIK A;  2OE3 A;  2B7K A;  4BA7 A;  2WGR A;  2P31 A;  3M1G A;  2JZS A;  2X8H A;  4ZL8 A;  3C1R A;  3TKS E;  4ZIJ A;  1XVQ A;  2PWJ A;  1TOF A;  4JED A;  2FA8 A;  4L8E A;  2H6Z A;  4ISD A;  4OWY A;  1Z3E A;  3M3M A;  3IK7 A;  4K0G A;  4XCS A;  2H0I A;  2WFC A;  1K0B A;  3RPP A;  13GS A;  3F9U A;  3ZLP A;  4EUY A;  4G10 A;  4AJ7 A;  1A23 A;  3GNJ A;  5DJM A;  1BX9 A;  3ERG A;  3H1N A;  3UBL A;  2XBQ A;  1GSD A;  1CQG A;  4NV2 A;  1EV4 A;  1SKW B;  3CTG A;  5IQY A;  3M8N A;  4OFM A;  1OC9 B;  1X5E A;  5ECN B;  4PUF C;  5F05 A;  1Q98 A;  3WGE A;  4PUR A;  4ZBA A;  1SKR B;  1ZL9 A;  5HFG A;  4D73 B;  2O89 A;  3EU4 A;  2HFD A;  4WBJ A;  4KB3 A;  2YWM A;  2J9H A;  2WZ9 A;  2VAF A;  1FB0 A;  1EWX A;  3TB2 A;  2HSN B;  4IVF A;  1K0A A;  5GAN D;  3VPQ A;  2YP6 A;  2IMK A;  1OYJ A;  4EC0 A;  3HZ8 A;  1PSQ A;  2NBS A;  2CX4 A;  3G7Y A;  4TR4 A;  5HR2 A;  2VCX A;  4N10 A;  2VL9 A;  1WP0 A;  3GTU B;  4G9H A;  3TKR A;  2P5Q A;  3UEM A;  5ECI B;  3QAW A;  3LGC A;  14GS A;  1U87 A;  3GV1 A;  1ABA A;  1FOV A;  2C3N A;  1DBY A;  3UIW A;  4XS4 A;  3GST A;  1K3O A;  1MDJ A;  2B5X A;  1TRW A;  4IS0 A;  5DVB A;  2RM5 A;  2DBC A;  4I97 A;  3P7X A;  5A4W A;  3ZMK A;  3EWL A;  3C71 A;  2KLX A;  4V1A g;  5HFK A;  5J9C A;  1GTU A;  1THO A;  3HXS A;  4HJ2 A;  3DWV A;  6GSX A;  2HXK A;  3ERF A;  1ERW A;  1NW2 A;  2I81 A;  3VWV A;  3KEB A;  5DBQ A;  2TRX A;  4NWY A;  3TKQ A;  4XTS A;  4MJB A;  4IQA A;  2IPA A;  5ENU A;  2H76 A;  1T3B A;  1O73 A;  3IE3 A;  2VCV A;  2ON7 A;  5DCG A;  4PNF A;  1G6Y A;  3A2V A;  1ZYQ B;  4IKH A;  5ELA A;  3WGX A;  1O81 A;  3P90 A;  3ED3 A;  3ZVJ A;  2QSI A;  1O8X A;  1S3C A;  3LYP A;  5IO0 A;  2R5G A;  1PD2 1;  4NMU A;  1EOH A;  2IME A;  1VF4 A;  4ZL7 A;  1LU4 A;  2E0Q A;  4RQX A;  4TN8 A;  1M2A A;  2YOI A;  4BPY A;  1F37 A;  16GS A;  1PX6 A;  1GL8 A;  3RAZ A;  2GT5 A;  3H8Q A;  1QUW A;  5ECO B;  2H73 A;  3GKK A;  1BQ7 A;  4K9Z A;  4O32 A;  1VF1 A;  1E6B A;  3EMX A;  4GF0 A;  1K0D A;  3LOR A;  3APO A;  1OVN A;  3KP8 A;  5IMC A;  3H4K A;  1PMT A;  4EO3 A;  2B1L A;  3DD3 A;  2LST A;  4G19 A;  1M9A A;  3FW2 A;  4PQI A;  11GS A;  1UC7 A;  1R26 A;  1EGR A;  1MTC A;  2L6D A;  4DSS B;  2H74 A;  2ES7 A;  2O8V B;  2FUG 2;  3C8E A;  1RK4 A;  4MJC A;  5F07 A;  3LYK A;  2HT9 A;  1O6J A;  1OC3 A;  4LMV A;  1ZOF A;  2B6M A;  5J41 A;  3GA4 A;  1XIY A;  2UZ8 A;  2L57 A;  4JBB A;  1NSW A;  3GFK A;  1B4P A;  1A24 A;  4N0V A;  1DE1 A;  1T7P B;  3TGZ A;  3ME7 A;  4KSO A;  4K6X A;  2LJR A;  4KSM A;  4POK A;  2LQO A;  3FY7 A;  3HJM A;  2JL4 A;  2CV4 A;  3LWA A;  1PL2 A;  4KX4 A;  4HEA 2;  1T8E B;  5IMV A;  3LXZ A;  3HHV A;  2GGT A;  5COH A;  4Z7X A;  1G0T A;  3GX8 A;  3FKF A;  4GLT A;  2K18 A;  3MDK A;  22GS A;  5C00 A;  2A4V A;  4ZB6 A;  2YJ7 A;  2PER A;  3R2Q A;  2L4Q A;  2VOC A;  3QAV A;  2DLX A;  2OAD A;  3ZFL A;  3KM6 A;  3IAM 2;  4FYC A;  3FZ4 A;  2CVK A;  3A3T A;  2DIZ A;  3FR6 A;  1LBK A;  2GST A;  3Q19 A;  3KTB A;  5H5R A;  3M0F A;  2LNS A;  4G0L A;  4WBR D;  1YF0 A;  3GH9 A;  1GUL A;  3GRX A;  3S9F A;  3IC8 A;  3JCM L;  1J08 A;  2VUP A;  2V32 A;  3L78 A;  3VWU A;  2CZ2 A;  5G2Z A;  1EEJ A;  3TJB A;  4KCE A;  2M72 A;  1PKW A;  6GST A;  2V6O A;  4MP4 A;  3G7I A;  5ECK B;  1UN2 A;  2VLT A;  2XBI A;  5JCU A;  2RM6 A;  3TJK A;  4YH2 A;  2OE0 A;  1O8W A;  3CBU A;  1U88 A;  4TR1 B;  2KOK A;  1TU7 A;  1X5D A;  12GS A;  3D4M A;  4DEJ A;  4G0I A;  3VWX A;  4GWR A;  2E7P A;  1ON4 A;  2VM1 A;  2H30 A;  1YEX A;  2MYG A;  2CVB A;  2AYT A;  3UVT A;  2G2Q A;  5IMZ A;  5LNK e;  1X9S B;  1W4V A;  3W8J A;  1GWC A;  3HY2 A;  4WR4 A;  2C4J A;  1GSF A;  1R5P A;  3ZTL A;  2C80 A;  2O7K A;  3D4T A;  1A2L A;  3W6G A;  2K6V A;  3QAG A;  2C0F A;  2OAC A;  3DKS A;  4BVY B;  4KAE A;  2B5E A;  3MSZ A;  4JR4 A;  3ZVJ D;  3UBK A;  3DVW A;  3F0I A;  1QGV A;  3TRQ A;  2G0F A;  3DYR A;  4FIW A;  2WUL A;  2K9F A;  2IMD A;  1V58 A;  3LQ7 A;  4K7N A;  1IYH A;  3G7J A;  5GST A;  1GRX A;  5IIZ A;  4I2U A;  2ZCT A;  4O7H A;  4K7O A;  1XW9 A;  1J0F A;  3TJJ A;  3IA1 A;  1JZO A;  3FYG A;  2J23 A;  4YQM A;  4BL7 A;  4ECB A;  1EP8 A;  1GLP A;  2ON5 A;  3L9S A;  3MAK A;  3EVI A;  3RDW A;  4ILF A;  3TOT A;  3EE2 A;  2PBJ A;  2LS5 A;  2IMI A;  3WT2 A;  3SBC A;  4FQU A;  1PKZ A;  5DCH A;  2YNX A;  2EIQ A;  8GSS A;  3H79 A;  2OA7 A;  3E9J B;  1Q4J A;  1EP7 A;  4FYU A;  1HNA A;  3QCP A;  4HU9 A;  4WET A;  4TKY A;  2AB6 A;  3EYT A;  1Z6M A;  2AAW A;  5EL8 A;  2OKA A;  3KCM A;  6GSU A;  1Z5Y E;  5G31 A;  2YV7 A;  2I3Y A;  3TJF A;  1WJK A;  3Q6O A;  3UL3 A;  2KUC A;  2GSR A;  3P8W A;  2PU9 C;  4MPF A;  1I9D A;  1DSB A;  2HZE A;  1GSU A;  1G7E A;  5CYY A;  2GZZ A;  3GL3 A;  1Y25 A;  1XWK A;  3ISO A;  5D73 A;  1T4Y A;  3J7Y k;  1JZW A;  4MK3 A;  2HZF A;  3F8U A;  3CRU A;  3LG6 A;  1DE2 A;  1GSY A;  1UA5 A;  1EZK A;  4WF4 A;  3NOF A;  2X99 A;  2REM A;  1H75 A;  2VLV A;  2BTO T;  4PQ1 A;  3D22 A;  2V41 A;  4CW9 A;  1XOB A;  2MMO A;  3HVX A;  1BJX A;  4ZB9 A;  2XC2 A;  1W89 A;  4ZBB A;  4WR5 A;  5IMF A;  3F4R A;  4XHM A;  4N30 A;  4ZB8 A;  3ME8 A;  4GQC A;  2HRF A;  1SK0 A;  4P3Y B;  4XS6 A;  2WS2 A;  4V2M A;  5JWR B;  1G7O A;  3F6F A;  1T00 A;  2K8V A;  2NDO A;  2WDU A;  2N5A A;  2CX3 A;  5ECP B;  1SK2 A;  4N11 A;  3M9K A;  4ZIL A;  5ID2 A;  2OBI A;  3MNG A;  2FWF A;  3IDV A;  1TU8 A;  5CP1 A;  5G30 A;  3A2X A;  3WGD A;  19GS A;  5GAP D;  2D2Z A;  1OC8 A;  1X9M B;  3FR9 A;  2PVO C;  3FK8 A;  4BVX A;  3Q18 A;  4IJI A;  3CTF A;  2O87 A;  5CAX A;  4E8H A;  2PPT A;  3DXB A;  2FLS A;  1XW6 A;  4XRD A;  1SD8 A;  2GQM A;  3EU3 A;  2R3X A;  4DSR A;  2H0H A;  2DJ3 A;  1QQ2 A;  1J9B A;  2BJX A;  2LEG A;  4MMM A;  1GUM A;  1V2A A;  3FZ5 A;  1Z6N A;  2H0G A;  2FWH A;  4V2L A;  3TDG A;  1ZYE A;  4RUV A;  4EF0 A;  4TXO B;  4NXI A;  1SL0 B;  2HSM B;  3PGT A;  2HRK A;  3R3E A;  1M0U A;  1YZX A;  3I69 A;  4QL7 A;  5DDL A;  4L5O A; 
#chains in the Genus database with same CATH topology
 2LRC A;  1YKA A;  1R4W A;  4MAB A;  1JLV A;  3VUR A;  2RII A;  3DML A;  1B9X C;  3C7M A;  2DML A;  2HE3 A;  3F4T A;  1G6W A;  2EFE A;  1WPI A;  1B48 A;  2VCQ A;  1PA3 A;  1YVL A;  1XCC A;  3ZRE A;  5DAK A;  1AUC A;  3VK9 A;  5BMU B;  1XZO A;  4NV5 A;  4BIK A;  2VCZ A;  2F8F A;  4AI6 A;  2JZT A;  4IW9 A;  2HSY A;  3CSH A;  4G01 A;  4E8E A;  1U3I A;  1V9W A;  2LQQ A;  1JZD A;  2QGV A;  3KTL A;  2I1U A;  1Z7P A;  3LXT A;  1RQM A;  4JE1 A;  1TKD B;  2OT3 A;  5D9T A;  1XVW A;  1AQW A;  4HQS A;  1WMJ A;  1SL1 B;  3GKM A;  5JWQ B;  5DAL A;  4V2N A;  4NAX A;  4MF7 A;  1XOA A;  2HRN A;  2FCH A;  1EV9 A;  3C73 A;  4A5P A;  6GSY A;  4BWQ A;  2R2J A;  1N2A A;  2KP2 A;  5IM9 A;  3LFL A;  4EVM A;  2VM2 A;  5F0G A;  2YN1 A;  5ECR B;  1MDI A;  6GSV A;  5KN3 A;  2GQL A;  1S3D A;  5A4V A;  4GSS A;  3QPM A;  2HNL A;  5INY A;  2HRA A;  1ERU A;  5D9W A;  2L4C A;  5KOX A;  3BJ5 A;  4X43 A;  4CHS A;  3EIN A;  3ERW A;  4MNN A;  4ACS A;  1PL1 A;  5CO3 A;  3ZIT A;  2YPM A;  4ECI A;  4MCU A;  4KUN A;  4O5R A;  3GX0 A;  3U6V A;  5JCG A;  2XPD A;  1YQ1 A;  2LUS A;  4MH3 A;  1TJD A;  1XWA A;  1XPV A;  4MZB A;  5IPG A;  2CAQ A;  1BED A;  1HQO A;  2I9H A;  2GDR A;  2YCD A;  2H75 A;  5CRG A;  1A8L A;  2A2P A;  5ECM B;  2X64 A;  4QQ7 A;  2DJK A;  1BYE A;  4F0C A;  2WVX B;  2H6X A;  3GIX A;  3TRX A;  1PQN A;  4RI7 A;  2O36 A;  3APQ A;  10GS A;  3HVV A;  4KW6 A;  2R37 A;  4PI2 C;  5B7C A;  2LKU A;  2VCT A;  4IGJ A;  1GLQ A;  3WT1 A;  4XS4 B;  2E2M A;  2NVL A;  1I5G A;  1FVK A;  2GZY A;  1GTI A;  2PGT A;  3P2A A;  4I5Q A;  3Q74 A;  2H19 A;  3O76 A;  5FT3 A;  4XRA A;  1PX7 A;  4XS1 A;  3TKP A;  4EL1 A;  1SD9 A;  4HUA A;  2TRC P;  2BMX A;  2AV4 A;  1H4O A;  3QMX A;  1ZMA A;  3I9V 2;  3V1W A;  1AXD A;  2HYX A;  4MF5 A;  5HFI A;  5IPH A;  4G0K A;  3VI7 A;  4GQF A;  4J56 E;  5CRD A;  1GNW A;  3QR6 A;  3N5O A;  2EFD A;  4GCI A;  2VL2 C;  3GHA A;  4K1F A;  2R0P A;  4IJ3 A;  4L5L A;  1Y6E A;  4MZW A;  2OBK A;  2O85 A;  2X8C A;  3HMJ G;  2ZNM A;  5DQS A;  2YV9 A;  2DC5 A;  2K8S A;  4TW5 A;  4KDX A;  1ZGN A;  3O6T A;  2DJJ A;  4KDY A;  4FO5 A;  2R6K A;  2L59 A;  3QFB C;  1OE8 A;  4F0B A;  5HR0 A;  1V57 A;  2ALB A;  2H1D A;  3VI5 A;  2V1M A;  4OMV A;  4DVC A;  1XFL A;  3D0Z A;  1HNC A;  2VL2 A;  3ZRD A;  2O5V A;  5IMA A;  1E2Y A;  2L5O A;  3W8S A;  1FHE A;  2IN3 A;  4LL1 B;  5J3R A;  5IOW A;  2TIR A;  5KN2 A;  5L71 A;  4YAV A;  3UAR A;  2FNO A;  4HI7 A;  2LJA A;  1SK1 A;  1XBS A;  1AAZ A;  3IXR A;  2HSH A;  4F82 A;  3RPN A;  1LJR A;  3RFR C;  1GSS A;  2B5Y A;  2FGX A;  1A8Y A;  2IFQ A;  4MDC A;  1FB6 A;  1S3A A;  4CY8 A;  4YQV A;  5A4U A;  2IIY A;  1OE7 A;  4MJA A;  3WD6 A;  2JZR A;  3KMN A;  2EC4 A;  1TW9 A;  4GTU A;  4PX1 A;  5A5K A;  1M3I A;  1YY7 A;  1ZCP A;  2FD3 A;  3KH7 A;  1AC1 A;  2F51 A;  1GH2 A;  2RUF A;  4XIH A;  3TRP A;  5BRT A;  1TK5 B;  4PTS A;  4YQU A;  4AJ6 A;  3F3Q A;  2PMT A;  4ID0 A;  1K3Y A;  1AQV A;  1RW1 A;  4WKW A;  3IK9 A;  1U3A A;  3ZIV A;  1TK8 B;  3PPU A;  3GUS A;  4MZC A;  4L0W A;  3FMW A;  2OJL A;  5J4U A;  1A2J A;  5FHI A;  5G1L A;  4EDY A;  1MD4 A;  5B8B A;  1UVZ A;  4KH7 A;  5J40 A;  1WRY A;  1NM3 A;  4MH2 A;  4YKG A;  3KXO A;  3D21 A;  1VGL A;  2P5R A;  3OR5 A;  3KMO A;  3KD0 A;  3IBH A;  3A5W A;  1JZR A;  1JFU A;  2X49 A;  20GS A;  2H01 A;  1TRS A;  3LEF A;  4KCA A;  3ZIJ A;  1S3R A;  4W66 A;  1OC9 A;  2KP1 A;  1XWB A;  4K2D A;  4ZBD A;  3CRT A;  1ST9 A;  2DSA A;  4PXO A;  5H5Q A;  1ILO A;  4D73 A;  2F9S A;  4K8M A;  4IQ1 A;  3FHK A;  1O85 A;  4IEL A;  4FXY P;  4Q5N A;  1PGT A;  5ECL B;  1C72 A;  1M3J A;  3L9V A;  5B6N A;  2ZUP A;  1HYU A;  2GS3 A;  4OFT A;  4JU5 A;  4ECJ A;  1XG8 A;  2H1A A;  2HSN A;  5C04 A;  1GSE A;  1GP1 A;  3TJG A;  3RHC A;  5ECS A;  2VIM A;  1X5C A;  2YJH A;  3AY8 A;  2B7J A;  4NHZ A;  4BWS A;  2P0G A;  4POM A;  3VLN A;  2NTO A;  1GTB A;  5HQP A;  3GTU A;  5EPF A;  3H93 A;  1TXU A;  2A4H A;  3I6A A;  2DJ0 A;  4HOJ A;  3HVS A;  4LLR A;  1NHY A;  3KIJ A;  1F2E A;  4JZQ A;  1SVL A;  1ERV A;  3GUR A;  2IL3 A;  5G1K A;  1M99 A;  2E2G A;  2QC7 A;  3E3E A;  4OO4 A;  4L0U A;  3J7Y b;  1M7T A;  4TRX A;  4ULX A;  4ZXG A;  1PN9 A;  1QMV A;  4ML6 A;  1CQH A;  4F03 A;  1A0F A;  3QOU A;  4KDU A;  2X4A A;  2VCW A;  1X9W B;  2JAC A;  3TCO A;  3QFA C;  2EFC A;  2GSS A;  2M80 A;  2PN8 A;  5KEJ A;  1SJI A;  2YAN A;  1N8J A;  1OKT A;  1BG1 A;  3EMP A;  3TU3 B;  1T1V A;  2JU5 A;  1K0M A;  2F3M A;  4MPG A;  1ERT A;  2FHE A;  3GKX A;  3GH6 A;  1T4Z A;  5JCW A;  2OE1 A;  4ML1 A;  4HJM A;  3CXG A;  1SEN A;  4PNG A;  2C1Y A;  3RHB A;  3GN3 A;  2NPB A;  3TUE A;  3L0H A;  3D6I A;  2IJY A;  5FWG A;  3HA9 A;  5CNW A;  4BL7 B;  1WWJ A;  1FW1 A;  5J5N A;  1SJZ A;  4ZB7 A;  4HZ4 A;  2JSY A;  4OFN A;  3LJR A;  4POL A;  4EIP A;  2C0G A;  4X0X A;  1YF1 A;  1SYR A;  2X8G A;  1AQX A;  3GKN A;  4HDE A;  1AIU A;  4OD7 A;  1OKD A;  3VWW A;  2CT6 A;  3KP9 A;  1K0O A;  2CA8 A;  2AUV A;  1EGO A;  2IMF A;  1MD3 A;  4WXT A;  5CRW A;  2WZS A;  3DEX A;  4X1U A;  2VL3 A;  3HZ4 A;  1SJ6 A;  3IAS 2;  2WVY A;  4Q5R A;  1R5A A;  2XHF A;  5D93 A;  2VO4 A;  3CYN A;  5KN1 A;  2HZE B;  3BOA A;  7GSS A;  1GSQ A;  4NHW A;  3FEU A;  3UVH A;  4WEY A;  4AF2 A;  4O5Q A;  3RBT A;  1BAY A;  4K7I A;  5CRH A;  4EDZ A;  4DSS A;  4ECC A;  2CAI A;  5ELG A;  3L4N A;  3CMI A;  4GXZ A;  1K0C A;  1U6T A;  2UV8 G;  2MZC A;  1TDI A;  2H71 A;  3GYK A;  4N0Z A;  5B6M A;  4I2T A;  4O92 A;  3FRC A;  4AKI A;  4F9Z A;  4NPB A;  3ZYW A;  3PR8 A;  2B1K A;  1XXU A;  1VRS D;  3PIN A;  2DJ2 A;  2CZ3 A;  1JHB A;  4IP1 A;  3IPZ A;  1I1I P;  4OCE A;  5D9X A;  1URM A;  2EFH A;  4QL9 A;  4TOP A;  4Q5Q A;  5AGY A;  2GTU A;  5ID2 B;  5F06 A;  4GSN A;  2WJU A;  4CY6 A;  3FZ9 A;  1X0R A;  1QFN A;  2V6K A;  1A2M A;  1IYI A;  1ZZY A;  5AIX A;  4HQZ A;  2DMM A;  1K3L A;  5D8I A;  5IMD A;  4AJ8 A;  1F3A A;  5E4W A;  1SKS B;  3HCZ A;  4J57 E;  4RI6 A;  1OAZ A;  4BVX B;  2MMA A;  3DRN A;  1QXH A;  1PRX A;  2CQ9 A;  1FG4 A;  1PFO A;  5ABR A;  4IP6 A;  2DIY A;  1FVJ A;  1B9Y C;  3HYP A;  4H86 A;  2H1B A;  3US3 A;  3EUR A;  2RLI A;  5IOX A;  3CSI A;  2KHP A;  1VF2 A;  1VF3 A;  1EEM A;  5CRE A;  4V1A p;  2YZH A;  3NIV A;  1B8X A;  3MYD A;  1SVM A;  3F3R A;  4TXV A;  4EKZ A;  5H5S A;  3IRA A;  3CHX C;  3IV4 A;  2H70 A;  5IO2 A;  1YDK A;  4TR1 A;  3ZFB A;  4JR6 A;  2HRK B;  1M2B A;  1SL2 B;  3IR4 A;  3ZL5 A;  2C0E A;  3VPT A;  1Z7R A;  3CQF A;  2LTK A;  4HU7 A;  1TXX A;  2FWG A;  1F6M C;  4Z2T A;  4LMW A;  2Z9S A;  4KE3 A;  2PUK C;  3HJO A;  2XPE A;  2C3T A;  4OO5 A;  3NZN A;  3QDN A;  1V98 A;  1DUG A;  3WYW A;  3KGK A;  3UAP A;  1M2D A;  2JAD A;  5DJL A;  2L5L A;  4HS1 A;  5LCZ A;  1GUH A;  3LW9 A;  4EIQ A;  2GT6 A;  3VFI A;  1YJ6 A;  3FZA A;  6GSW A;  4BVY A;  1EOG A;  5DAK B;  1PN0 A;  1TRU A;  1JLW A;  5A1N A;  5HR3 A;  1BF5 A;  2A2R A;  2HI7 A;  1K0N A;  3I43 A;  1KBN A;  4Z2R A;  3F4S A;  4G2E A;  4OCF A;  2WCI A;  2EIO A;  3DVX A;  4POB A;  1WOU A;  2MMN A;  1ACV A;  5GSS A;  3BD2 A;  2VD1 A;  2GQK A;  5HR1 A;  3GL5 A;  3G9B A;  5AIS A;  5ECH B;  2RUE A;  3M9J A;  5J9B A;  5DAL B;  4RQR A;  5ECQ B;  5D96 A;  2YWI A;  2LJK A;  3K8N A;  3ZZX A;  1ML6 A;  1F3B A;  1GNE A;  3F63 A;  2VD0 A;  4PUA A;  1HD2 A;  3GSS A;  2LNT A;  3BBY A;  4GRF A;  1MDK A;  2LV3 A;  1KNG A;  3KZQ A;  3TKS C;  5J4Y A;  3IOS A;  1THX A;  2R4V A;  3CSJ A;  2F8A A;  3APS A;  2HQT A;  3QD9 A;  3KH9 A;  2YZU A;  1GUK A;  2V2G A;  2YWN A;  3O3T A;  2CVD A;  2C8U A;  1V40 A;  1TTZ A;  4J2F A;  4LL4 B;  2WRT A;  2HLS A;  2IWT A;  4TR0 A;  9GSS A;  5E59 A;  1Z9H A;  1TRV A;  5A34 A;  4F2I A;  3HJP A;  1F9M A;  3KJY A;  4KF9 A;  3BCK A;  4LA1 A;  1USB A;  1MEK A;  3EC3 A;  1HNB A;  2FY6 A;  2AHE A;  2WVZ A;  2H6Y A;  3TKS A;  4FH8 A;  2WW2 A;  1SU9 A;  4IN0 A;  2M46 A;  3DGQ A;  4GST A;  1FAA A;  4USS A;  3C1S A;  2L6C A;  2JSZ A;  4PGT A;  3U5R E;  2I4A A;  4KGI A;  5JWO B;  2LRN A;  1R7H A;  5AN1 A;  1TK0 B;  1SYX A;  2N5B A;  5B8A A;  3D5J A;  3SWL A;  2FWE A;  1KTE A;  1YKC A;  3LSZ A;  2H8L A;  4PHZ C;  2AJQ B;  4I8B A;  2EIR A;  4EXJ A;  3GMF A;  3E0U A;  1BG5 A;  5DQY A;  2MBT A;  4FYB A;  2DJ1 A;  5LD0 A;  2A2S A;  1O7U A;  2MMZ A;  3IC4 A;  3MWH A;  5D9V A;  4TVE A;  5G5E A;  3UMA A;  17GS A;  3IHG A;  1WE0 A;  3HKR A;  1AW9 A;  2H1G A;  1FOH A;  4IHU A;  3PH9 A;  1XW5 A;  3BCI A;  4TR3 A;  2YWO A;  1M9B A;  4DSQ A;  1KEB A;  3N9J A;  1YEW C;  4PQH A;  1GTA A;  5G5F A;  4WF5 A;  2N5F A;  5GZZ B;  2B3S A;  5F8B A;  4HZ2 A;  6GSS A;  3A2W A;  4ICY A;  3DIE A;  4MF6 A;  18GS A;  3EPT A;  2H66 A;  4MLY A;  2WB9 A;  1QK8 A;  3UJ1 A;  4CDO A;  2WW0 A;  1TP9 A;  2C0D A;  2QKE A;  3ZML A;  4K0N A;  1TI1 A;  4ZL9 A;  2PVQ A;  3HDC A;  4JRR A;  2VLU A;  1YEP A;  4YAP A;  4I6X A;  1FO5 A;  4TXO A;  1A0R P;  3UOM A;  2HSM A;  3FR3 A;  5KN0 A;  2GZP A;  1XWC A;  2LRT A;  4Q5F A;  2QA2 A;  2GLR A;  5EY6 A;  4AGS A;  3HD5 A;  1NHO A;  4MA9 A;  2MBS A;  5EVO A;  2FA4 A;  3L9U A;  2IFQ B;  1B4Q A;  5AIV A;  1TI3 A;  3IHQ A;  2C3Q A;  4EE0 A;  4KND A;  1XWG A;  4MJE A;  3TOU A;  3F6D A;  2H72 A;  4K2X A;  2GSQ A;  2H1L A;  4KA0 A;  2GVP A;  4IBP A;  5BMU A;  1WIK A;  2OE3 A;  2B7K A;  4BA7 A;  2WGR A;  2P31 A;  3M1G A;  2JZS A;  2X8H A;  4ZL8 A;  3C1R A;  3TKS E;  2WW3 A;  4ZIJ A;  1XVQ A;  2PWJ A;  1TOF A;  4JED A;  3A5I A;  2FA8 A;  4L8E A;  2H6Z A;  4ISD A;  4OWY A;  1Z3E A;  3M3M A;  3IK7 A;  4K0G A;  4XCS A;  2H0I A;  2WFC A;  1K0B A;  3RPP A;  13GS A;  3F9U A;  3ZLP A;  4EUY A;  4G10 A;  4AJ7 A;  1A23 A;  3GNJ A;  5DJM A;  1BX9 A;  3ERG A;  3H1N A;  3MIX A;  3UBL A;  2XBQ A;  1GSD A;  1CQG A;  4NV2 A;  1EV4 A;  1SKW B;  3CTG A;  5IQY A;  3M8N A;  4OFM A;  1OC9 B;  1X5E A;  5ECN B;  4PUF C;  5F05 A;  1Q98 A;  3WGE A;  4PUR A;  4ZBA A;  1SKR B;  4N3Z A;  1ZL9 A;  5HFG A;  4D73 B;  2O89 A;  3EU4 A;  2HFD A;  4WBJ A;  4KB3 A;  2YWM A;  2J9H A;  2WZ9 A;  2VAF A;  1FB0 A;  1EWX A;  3TB2 A;  2HSN B;  4IVF A;  4X4J A;  1K0A A;  5GAN D;  3VPQ A;  2YP6 A;  2IMK A;  1OYJ A;  4EC0 A;  3HZ8 A;  1PSQ A;  2NBS A;  2CX4 A;  3G7Y A;  4TR4 A;  5HR2 A;  2VCX A;  4N10 A;  4GDF A;  2VL9 A;  1WP0 A;  3GTU B;  4G9H A;  3TKR A;  2P5Q A;  3UEM A;  5ECI B;  3QAW A;  3LGC A;  14GS A;  1U87 A;  2WVX A;  3GV1 A;  1ABA A;  4E68 A;  1FOV A;  1SVO A;  2C3N A;  1DBY A;  3UIW A;  5J4V A;  4XS4 A;  3GST A;  1K3O A;  1MDJ A;  2B5X A;  1TRW A;  4IS0 A;  5DVB A;  2RM5 A;  2DBC A;  4I97 A;  1N25 A;  3P7X A;  1ZYN A;  5A4W A;  3ZMK A;  3EWL A;  4O5U A;  3C71 A;  2KLX A;  4V1A g;  5HFK A;  5J9C A;  1GTU A;  1THO A;  3HXS A;  4HJ2 A;  3DWV A;  4PI0 C;  6GSX A;  2HXK A;  3ERF A;  1ERW A;  1NW2 A;  2I81 A;  3VWV A;  3KEB A;  5DBQ A;  2TRX A;  4NWY A;  3TKQ A;  4XTS A;  4MJB A;  4IQA A;  2IPA A;  5ENU A;  2H76 A;  1T3B A;  1O73 A;  3IE3 A;  2VCV A;  2ON7 A;  5DCG A;  4PNF A;  1G6Y A;  4AKX B;  3A2V A;  1ZYQ B;  4IKH A;  5ELA A;  3WGX A;  1O81 A;  3P90 A;  3ED3 A;  3ZVJ A;  2QSI A;  1O8X A;  1S3C A;  3LYP A;  2R0C A;  5IO0 A;  2R5G A;  1PD2 1;  4NMU A;  1EOH A;  2IME A;  1VF4 A;  4ZL7 A;  1LU4 A;  2E0Q A;  4RQX A;  2O3E A;  4TN8 A;  1M2A A;  2YOI A;  4BPY A;  1F37 A;  16GS A;  1PX6 A;  1GL8 A;  3RAZ A;  2GT5 A;  1Y1U A;  3H8Q A;  1QUW A;  5ECO B;  2H73 A;  3GKK A;  1BQ7 A;  4K9Z A;  4O32 A;  1VF1 A;  1E6B A;  3EMX A;  4GF0 A;  1K0D A;  3LOR A;  3APO A;  1OVN A;  3KP8 A;  5IMC A;  3H4K A;  1PMT A;  4EO3 A;  2B1L A;  3DD3 A;  2LST A;  4G19 A;  1M9A A;  3FW2 A;  4PQI A;  11GS A;  1UC7 A;  1R26 A;  1EGR A;  1MTC A;  2L6D A;  4DSS B;  2H74 A;  2ES7 A;  2O8V B;  2FUG 2;  3C8E A;  1RK4 A;  4MJC A;  5F07 A;  3LYK A;  2HT9 A;  1O6J A;  1OC3 A;  4LMV A;  1ZOF A;  2B6M A;  5J41 A;  3GA4 A;  1XIY A;  2UZ8 A;  2L57 A;  4JBB A;  2QA1 A;  1NSW A;  3GFK A;  1B4P A;  1A24 A;  4N0V A;  1DE1 A;  1T7P B;  3TGZ A;  3ME7 A;  4KSO A;  4K6X A;  2LJR A;  4KSM A;  4POK A;  2LQO A;  3FY7 A;  3HJM A;  2JL4 A;  2CV4 A;  3LWA A;  1PL2 A;  4KX4 A;  4HEA 2;  1T8E B;  5IMV A;  3LXZ A;  3HHV A;  2GGT A;  5COH A;  4Z7X A;  1G0T A;  3GX8 A;  3FKF A;  4GLT A;  2DKH A;  2K18 A;  3MDK A;  22GS A;  5C00 A;  2A4V A;  4ZB6 A;  2YJ7 A;  2PER A;  3R2Q A;  2L4Q A;  2VOC A;  3QAV A;  2DLX A;  2OAD A;  3ZFL A;  3KM6 A;  3IAM 2;  4FYC A;  3FZ4 A;  2CVK A;  3A3T A;  2DIZ A;  3FR6 A;  1LBK A;  2GST A;  3Q19 A;  3KTB A;  5H5R A;  3M0F A;  2LNS A;  4G0L A;  4WBR D;  1YF0 A;  3GH9 A;  1GUL A;  1S4B P;  3GRX A;  3S9F A;  3IC8 A;  3JCM L;  1J08 A;  2VUP A;  2V32 A;  3L78 A;  3VWU A;  2CZ2 A;  5G2Z A;  1EEJ A;  3TJB A;  4KCE A;  2M72 A;  1PKW A;  6GST A;  2V6O A;  4MP4 A;  3G7I A;  5ECK B;  1UN2 A;  2VLT A;  2XBI A;  5JCU A;  2RM6 A;  3TJK A;  4YH2 A;  2OE0 A;  4K5R A;  1O8W A;  3CBU A;  1U88 A;  4TR1 B;  2KOK A;  1TU7 A;  1X5D A;  12GS A;  3D4M A;  3RGB C;  4DEJ A;  4G0I A;  2DKI A;  3VWX A;  4GWR A;  2E7P A;  1ON4 A;  2VM1 A;  2H30 A;  1YEX A;  2MYG A;  2CVB A;  2AYT A;  3UVT A;  2G2Q A;  2R0G A;  5IMZ A;  5LNK e;  1X9S B;  1W4V A;  3W8J A;  1GWC A;  3HY2 A;  4WR4 A;  2C4J A;  1GSF A;  1R5P A;  3ZTL A;  2C80 A;  2O7K A;  3D4T A;  1A2L A;  3W6G A;  2K6V A;  3QAG A;  2C0F A;  2OAC A;  3DKS A;  4BVY B;  4KAE A;  2B5E A;  3MSZ A;  4JR4 A;  3ZVJ D;  3UBK A;  3DVW A;  3F0I A;  5A1N B;  1QGV A;  3TRQ A;  2G0F A;  3DYR A;  4FIW A;  2WUL A;  2K9F A;  2IMD A;  1V58 A;  3LQ7 A;  4K7N A;  1IYH A;  3G7J A;  5GST A;  1GRX A;  5IIZ A;  4I2U A;  2ZCT A;  4O7H A;  4K7O A;  1XW9 A;  1J0F A;  3TJJ A;  3IA1 A;  1JZO A;  3FYG A;  2J23 A;  4YQM A;  4BL7 A;  4ECB A;  1EP8 A;  1GLP A;  2ON5 A;  3L9S A;  3MAK A;  4K5S A;  3EVI A;  3RDW A;  4ILF A;  3TOT A;  3EE2 A;  2PBJ A;  2LS5 A;  4HSC X;  2IMI A;  3WT2 A;  3SBC A;  4FQU A;  1PKZ A;  5A5H A;  5DCH A;  2YNX A;  2EIQ A;  8GSS A;  3H79 A;  2OA7 A;  3E9J B;  1Q4J A;  1EP7 A;  4FYU A;  1HNA A;  3QCP A;  4HU9 A;  4WET A;  4TKY A;  2AB6 A;  3EYT A;  1Z6M A;  2AAW A;  5EL8 A;  2OKA A;  3KCM A;  6GSU A;  1Z5Y E;  4AKH A;  5G31 A;  2VKZ G;  2YV7 A;  2I3Y A;  3TJF A;  1WJK A;  3Q6O A;  3UL3 A;  2KUC A;  2GSR A;  3P8W A;  2PU9 C;  4MPF A;  1I9D A;  1DSB A;  2HZE A;  1GSU A;  5A34 B;  1G7E A;  5CYY A;  2GZZ A;  3GL3 A;  1Y25 A;  1XWK A;  3ISO A;  5D73 A;  1T4Y A;  4QMK A;  3J7Y k;  1JZW A;  4MK3 A;  2HZF A;  3F8U A;  3CRU A;  3LG6 A;  1DE2 A;  1GSY A;  1UA5 A;  1EZK A;  4WF4 A;  3NOF A;  2X99 A;  2REM A;  1H75 A;  2VLV A;  4AKG A;  2BTO T;  4PQ1 A;  3D22 A;  5J47 A;  2V41 A;  4CW9 A;  1XOB A;  2WW1 A;  2MMO A;  3HVX A;  1BJX A;  4ZB9 A;  2XC2 A;  1W89 A;  4ZBB A;  4WR5 A;  5IMF A;  3F4R A;  4XHM A;  4N30 A;  4ZB8 A;  3ME8 A;  4GQC A;  2HRF A;  1SK0 A;  4P3Y B;  4XS6 A;  2WS2 A;  4V2M A;  5JWR B;  1G7O A;  3F6F A;  1T00 A;  2K8V A;  2NDO A;  2WDU A;  2N5A A;  2CX3 A;  5ECP B;  1SK2 A;  4N11 A;  3M9K A;  4ZIL A;  5ID2 A;  2OBI A;  3MNG A;  2FWF A;  1ZYP A;  3IDV A;  1TU8 A;  5CP1 A;  5G30 A;  3HVN A;  3A2X A;  3WGD A;  19GS A;  5GAP D;  2D2Z A;  1OC8 A;  1X9M B;  3FR9 A;  2PVO C;  3FK8 A;  4BVX A;  3Q18 A;  4IJI A;  3CTF A;  2O87 A;  5CAX A;  4E8H A;  2PPT A;  3DXB A;  2FLS A;  1XW6 A;  4XRD A;  1SD8 A;  2GQM A;  3EU3 A;  2R3X A;  4DSR A;  2H0H A;  4YKF A;  2DJ3 A;  1QQ2 A;  1J9B A;  2BJX A;  2LEG A;  5A5H B;  4MMM A;  1GUM A;  1V2A A;  3FZ5 A;  1Z6N A;  2H0G A;  2FWH A;  4V2L A;  3TDG A;  1ZYE A;  5KOW A;  4RUV A;  3CWG A;  4EF0 A;  4TXO B;  4NXI A;  1SL0 B;  2HSM B;  3PGT A;  2HRK A;  4Z2U A;  3R3E A;  1M0U A;  1YZX A;  3I69 A;  4QL7 A;  5DDL A;  4L5O A; 
#chains in the Genus database with same CATH homology
 2LRC A;  1YKA A;  1R4W A;  4MAB A;  1JLV A;  3VUR A;  2RII A;  3DML A;  1B9X C;  3C7M A;  2DML A;  2HE3 A;  3F4T A;  1G6W A;  2EFE A;  1WPI A;  1B48 A;  2VCQ A;  1PA3 A;  1YVL A;  1XCC A;  3ZRE A;  5DAK A;  1AUC A;  3VK9 A;  5BMU B;  1XZO A;  4NV5 A;  2VCZ A;  2F8F A;  4AI6 A;  2JZT A;  4IW9 A;  2HSY A;  3CSH A;  4G01 A;  4E8E A;  1U3I A;  1V9W A;  2LQQ A;  1JZD A;  2QGV A;  3KTL A;  2I1U A;  1Z7P A;  3LXT A;  1RQM A;  4JE1 A;  1TKD B;  2OT3 A;  5D9T A;  1XVW A;  1AQW A;  4HQS A;  1WMJ A;  1SL1 B;  3GKM A;  5JWQ B;  5DAL A;  4V2N A;  4NAX A;  4MF7 A;  1XOA A;  2HRN A;  2FCH A;  1EV9 A;  3C73 A;  4A5P A;  6GSY A;  4BWQ A;  2R2J A;  1N2A A;  2KP2 A;  5IM9 A;  3LFL A;  4EVM A;  2VM2 A;  5F0G A;  2YN1 A;  5ECR B;  1MDI A;  6GSV A;  5KN3 A;  2GQL A;  1S3D A;  5A4V A;  4GSS A;  3QPM A;  2HNL A;  5INY A;  2HRA A;  1ERU A;  5D9W A;  2L4C A;  5KOX A;  3BJ5 A;  4X43 A;  4CHS A;  3EIN A;  3ERW A;  4MNN A;  4ACS A;  1PL1 A;  5CO3 A;  3ZIT A;  2YPM A;  4ECI A;  4MCU A;  4KUN A;  4O5R A;  3GX0 A;  3U6V A;  5JCG A;  2XPD A;  1YQ1 A;  2LUS A;  4MH3 A;  1TJD A;  1XWA A;  1XPV A;  4MZB A;  5IPG A;  2CAQ A;  1BED A;  1HQO A;  2I9H A;  2GDR A;  2YCD A;  2H75 A;  5CRG A;  1A8L A;  2A2P A;  5ECM B;  2X64 A;  4QQ7 A;  2DJK A;  1BYE A;  4F0C A;  2H6X A;  3GIX A;  3TRX A;  1PQN A;  4RI7 A;  3APQ A;  10GS A;  3HVV A;  4KW6 A;  2R37 A;  5B7C A;  2LKU A;  2VCT A;  4IGJ A;  1GLQ A;  3WT1 A;  4XS4 B;  2E2M A;  2NVL A;  1I5G A;  1FVK A;  2GZY A;  1GTI A;  2PGT A;  3P2A A;  4I5Q A;  3Q74 A;  2H19 A;  3O76 A;  5FT3 A;  4XRA A;  1PX7 A;  4XS1 A;  3TKP A;  4EL1 A;  1SD9 A;  4HUA A;  2TRC P;  2BMX A;  2AV4 A;  1H4O A;  3QMX A;  1ZMA A;  3I9V 2;  3V1W A;  1AXD A;  2HYX A;  4MF5 A;  5HFI A;  5IPH A;  4G0K A;  3VI7 A;  4GQF A;  4J56 E;  5CRD A;  1GNW A;  3QR6 A;  3N5O A;  2EFD A;  4GCI A;  2VL2 C;  3GHA A;  4K1F A;  2R0P A;  4IJ3 A;  4L5L A;  1Y6E A;  4MZW A;  2OBK A;  2O85 A;  2X8C A;  3HMJ G;  2ZNM A;  5DQS A;  2YV9 A;  2DC5 A;  2K8S A;  4TW5 A;  4KDX A;  1ZGN A;  3O6T A;  2DJJ A;  4KDY A;  4FO5 A;  2R6K A;  2L59 A;  3QFB C;  1OE8 A;  4F0B A;  5HR0 A;  1V57 A;  2ALB A;  2H1D A;  3VI5 A;  2V1M A;  4OMV A;  4DVC A;  1XFL A;  3D0Z A;  1HNC A;  2VL2 A;  3ZRD A;  2O5V A;  5IMA A;  1E2Y A;  2L5O A;  3W8S A;  1FHE A;  2IN3 A;  4LL1 B;  5J3R A;  5IOW A;  2TIR A;  5KN2 A;  5L71 A;  4YAV A;  3UAR A;  2FNO A;  4HI7 A;  2LJA A;  1SK1 A;  1XBS A;  1AAZ A;  3IXR A;  2HSH A;  4F82 A;  3RPN A;  1LJR A;  1GSS A;  2B5Y A;  2FGX A;  1A8Y A;  2IFQ A;  4MDC A;  1FB6 A;  1S3A A;  4CY8 A;  4YQV A;  5A4U A;  2IIY A;  1OE7 A;  4MJA A;  3WD6 A;  2JZR A;  3KMN A;  2EC4 A;  1TW9 A;  4GTU A;  4PX1 A;  5A5K A;  1YY7 A;  1ZCP A;  2FD3 A;  3KH7 A;  1AC1 A;  2F51 A;  1GH2 A;  2RUF A;  4XIH A;  3TRP A;  5BRT A;  1TK5 B;  4PTS A;  4YQU A;  4AJ6 A;  3F3Q A;  2PMT A;  4ID0 A;  1K3Y A;  1AQV A;  1RW1 A;  4WKW A;  3IK9 A;  1U3A A;  3ZIV A;  1TK8 B;  3PPU A;  3GUS A;  4MZC A;  4L0W A;  3FMW A;  2OJL A;  5J4U A;  1A2J A;  5FHI A;  5G1L A;  4EDY A;  1MD4 A;  5B8B A;  1UVZ A;  4KH7 A;  5J40 A;  1WRY A;  1NM3 A;  4MH2 A;  4YKG A;  3KXO A;  3D21 A;  1VGL A;  2P5R A;  3OR5 A;  3KMO A;  3KD0 A;  3IBH A;  3A5W A;  1JZR A;  1JFU A;  2X49 A;  20GS A;  2H01 A;  1TRS A;  3LEF A;  4KCA A;  3ZIJ A;  4W66 A;  1OC9 A;  2KP1 A;  1XWB A;  4K2D A;  4ZBD A;  3CRT A;  1ST9 A;  2DSA A;  4PXO A;  5H5Q A;  1ILO A;  4D73 A;  2F9S A;  4K8M A;  4IQ1 A;  3FHK A;  1O85 A;  4IEL A;  4Q5N A;  1PGT A;  5ECL B;  1C72 A;  3L9V A;  5B6N A;  2ZUP A;  1HYU A;  2GS3 A;  4OFT A;  4JU5 A;  4ECJ A;  2H1A A;  2HSN A;  5C04 A;  1GSE A;  1GP1 A;  3TJG A;  3RHC A;  5ECS A;  2VIM A;  1X5C A;  2YJH A;  3AY8 A;  2B7J A;  4NHZ A;  4BWS A;  2P0G A;  4POM A;  3VLN A;  2NTO A;  1GTB A;  5HQP A;  3GTU A;  5EPF A;  3H93 A;  1TXU A;  2A4H A;  3I6A A;  2DJ0 A;  4HOJ A;  3HVS A;  4LLR A;  1NHY A;  3KIJ A;  1F2E A;  4JZQ A;  1SVL A;  1ERV A;  3GUR A;  2IL3 A;  5G1K A;  1M99 A;  2E2G A;  2QC7 A;  3E3E A;  4OO4 A;  4L0U A;  3J7Y b;  1M7T A;  4TRX A;  4ULX A;  4ZXG A;  1PN9 A;  1QMV A;  4ML6 A;  1CQH A;  4F03 A;  1A0F A;  3QOU A;  4KDU A;  2X4A A;  2VCW A;  1X9W B;  2JAC A;  3TCO A;  3QFA C;  2EFC A;  2GSS A;  2M80 A;  2PN8 A;  5KEJ A;  1SJI A;  2YAN A;  1N8J A;  1OKT A;  1BG1 A;  3EMP A;  3TU3 B;  1T1V A;  2JU5 A;  1K0M A;  2F3M A;  4MPG A;  1ERT A;  2FHE A;  3GKX A;  3GH6 A;  1T4Z A;  5JCW A;  2OE1 A;  4ML1 A;  4HJM A;  3CXG A;  1SEN A;  4PNG A;  2C1Y A;  3RHB A;  3GN3 A;  2NPB A;  3TUE A;  3L0H A;  3D6I A;  2IJY A;  5FWG A;  3HA9 A;  5CNW A;  4BL7 B;  1WWJ A;  1FW1 A;  5J5N A;  1SJZ A;  4ZB7 A;  4HZ4 A;  2JSY A;  4OFN A;  3LJR A;  4POL A;  4EIP A;  2C0G A;  4X0X A;  1YF1 A;  1SYR A;  2X8G A;  1AQX A;  3GKN A;  4HDE A;  1AIU A;  4OD7 A;  1OKD A;  3VWW A;  2CT6 A;  3KP9 A;  1K0O A;  2CA8 A;  2AUV A;  1EGO A;  2IMF A;  1MD3 A;  4WXT A;  5CRW A;  3DEX A;  4X1U A;  2VL3 A;  3HZ4 A;  1SJ6 A;  3IAS 2;  4Q5R A;  1R5A A;  2XHF A;  5D93 A;  2VO4 A;  3CYN A;  5KN1 A;  2HZE B;  3BOA A;  7GSS A;  1GSQ A;  4NHW A;  3FEU A;  3UVH A;  4WEY A;  4AF2 A;  4O5Q A;  3RBT A;  1BAY A;  4K7I A;  5CRH A;  4EDZ A;  4DSS A;  4ECC A;  2CAI A;  5ELG A;  3L4N A;  3CMI A;  4GXZ A;  1K0C A;  1U6T A;  2UV8 G;  2MZC A;  1TDI A;  2H71 A;  3GYK A;  4N0Z A;  5B6M A;  4I2T A;  4O92 A;  3FRC A;  4AKI A;  4F9Z A;  4NPB A;  3ZYW A;  3PR8 A;  2B1K A;  1XXU A;  1VRS D;  3PIN A;  2DJ2 A;  2CZ3 A;  1JHB A;  4IP1 A;  3IPZ A;  4OCE A;  5D9X A;  1URM A;  2EFH A;  4QL9 A;  4TOP A;  4Q5Q A;  5AGY A;  2GTU A;  5ID2 B;  5F06 A;  4GSN A;  2WJU A;  4CY6 A;  3FZ9 A;  1X0R A;  1QFN A;  2V6K A;  1A2M A;  1IYI A;  1ZZY A;  5AIX A;  4HQZ A;  2DMM A;  1K3L A;  5D8I A;  5IMD A;  4AJ8 A;  1F3A A;  5E4W A;  1SKS B;  3HCZ A;  4J57 E;  4RI6 A;  1OAZ A;  4BVX B;  2MMA A;  3DRN A;  1QXH A;  1PRX A;  2CQ9 A;  1FG4 A;  5ABR A;  4IP6 A;  2DIY A;  1FVJ A;  1B9Y C;  3HYP A;  4H86 A;  2H1B A;  3US3 A;  3EUR A;  2RLI A;  5IOX A;  3CSI A;  2KHP A;  1VF2 A;  1VF3 A;  1EEM A;  5CRE A;  4V1A p;  2YZH A;  3NIV A;  1B8X A;  3MYD A;  1SVM A;  3F3R A;  4TXV A;  4EKZ A;  5H5S A;  3IRA A;  3IV4 A;  2H70 A;  5IO2 A;  1YDK A;  4TR1 A;  3ZFB A;  4JR6 A;  2HRK B;  1M2B A;  1SL2 B;  3IR4 A;  3ZL5 A;  2C0E A;  3VPT A;  1Z7R A;  2LTK A;  4HU7 A;  1TXX A;  2FWG A;  1F6M C;  4Z2T A;  4LMW A;  2Z9S A;  4KE3 A;  2PUK C;  3HJO A;  2XPE A;  2C3T A;  4OO5 A;  3NZN A;  3QDN A;  1V98 A;  1DUG A;  3WYW A;  3KGK A;  3UAP A;  1M2D A;  2JAD A;  5DJL A;  2L5L A;  4HS1 A;  5LCZ A;  1GUH A;  3LW9 A;  4EIQ A;  2GT6 A;  3VFI A;  1YJ6 A;  3FZA A;  6GSW A;  4BVY A;  1EOG A;  5DAK B;  1PN0 A;  1TRU A;  1JLW A;  5A1N A;  5HR3 A;  1BF5 A;  2A2R A;  2HI7 A;  1K0N A;  3I43 A;  1KBN A;  4Z2R A;  3F4S A;  4G2E A;  4OCF A;  2WCI A;  2EIO A;  3DVX A;  4POB A;  1WOU A;  2MMN A;  1ACV A;  5GSS A;  3BD2 A;  2VD1 A;  2GQK A;  5HR1 A;  3GL5 A;  3G9B A;  5AIS A;  5ECH B;  2RUE A;  3M9J A;  5J9B A;  5DAL B;  4RQR A;  5ECQ B;  5D96 A;  2YWI A;  2LJK A;  3K8N A;  3ZZX A;  1ML6 A;  1F3B A;  1GNE A;  3F63 A;  2VD0 A;  4PUA A;  1HD2 A;  3GSS A;  2LNT A;  3BBY A;  4GRF A;  1MDK A;  2LV3 A;  1KNG A;  3KZQ A;  3TKS C;  5J4Y A;  3IOS A;  1THX A;  2R4V A;  3CSJ A;  2F8A A;  3APS A;  2HQT A;  3QD9 A;  3KH9 A;  2YZU A;  1GUK A;  2V2G A;  2YWN A;  3O3T A;  2CVD A;  2C8U A;  1V40 A;  1TTZ A;  4J2F A;  4LL4 B;  2WRT A;  2HLS A;  2IWT A;  4TR0 A;  9GSS A;  5E59 A;  1Z9H A;  1TRV A;  5A34 A;  4F2I A;  3HJP A;  1F9M A;  3KJY A;  4KF9 A;  3BCK A;  4LA1 A;  1USB A;  1MEK A;  3EC3 A;  1HNB A;  2FY6 A;  2AHE A;  2H6Y A;  3TKS A;  4FH8 A;  1SU9 A;  4IN0 A;  2M46 A;  3DGQ A;  4GST A;  1FAA A;  4USS A;  3C1S A;  2L6C A;  2JSZ A;  4PGT A;  3U5R E;  2I4A A;  4KGI A;  5JWO B;  2LRN A;  1R7H A;  5AN1 A;  1TK0 B;  1SYX A;  2N5B A;  5B8A A;  3D5J A;  3SWL A;  2FWE A;  1KTE A;  1YKC A;  3LSZ A;  2H8L A;  2AJQ B;  4I8B A;  2EIR A;  4EXJ A;  3GMF A;  3E0U A;  1BG5 A;  5DQY A;  2MBT A;  4FYB A;  2DJ1 A;  5LD0 A;  2A2S A;  1O7U A;  2MMZ A;  3IC4 A;  3MWH A;  5D9V A;  4TVE A;  5G5E A;  3UMA A;  17GS A;  3IHG A;  1WE0 A;  3HKR A;  1AW9 A;  2H1G A;  1FOH A;  4IHU A;  3PH9 A;  1XW5 A;  3BCI A;  4TR3 A;  2YWO A;  1M9B A;  4DSQ A;  1KEB A;  3N9J A;  4PQH A;  1GTA A;  5G5F A;  4WF5 A;  2N5F A;  5GZZ B;  2B3S A;  5F8B A;  4HZ2 A;  6GSS A;  3A2W A;  4ICY A;  3DIE A;  4MF6 A;  18GS A;  3EPT A;  2H66 A;  4MLY A;  2WB9 A;  1QK8 A;  3UJ1 A;  4CDO A;  1TP9 A;  2C0D A;  2QKE A;  3ZML A;  4K0N A;  1TI1 A;  4ZL9 A;  2PVQ A;  3HDC A;  4JRR A;  2VLU A;  1YEP A;  4YAP A;  4I6X A;  1FO5 A;  4TXO A;  1A0R P;  3UOM A;  2HSM A;  3FR3 A;  5KN0 A;  2GZP A;  1XWC A;  2LRT A;  4Q5F A;  2QA2 A;  2GLR A;  5EY6 A;  4AGS A;  3HD5 A;  1NHO A;  4MA9 A;  2MBS A;  5EVO A;  2FA4 A;  3L9U A;  2IFQ B;  1B4Q A;  5AIV A;  1TI3 A;  3IHQ A;  2C3Q A;  4EE0 A;  4KND A;  1XWG A;  4MJE A;  3TOU A;  3F6D A;  2H72 A;  4K2X A;  2GSQ A;  2H1L A;  4KA0 A;  2GVP A;  4IBP A;  5BMU A;  1WIK A;  2OE3 A;  2B7K A;  4BA7 A;  2WGR A;  2P31 A;  3M1G A;  2JZS A;  2X8H A;  4ZL8 A;  3C1R A;  3TKS E;  4ZIJ A;  1XVQ A;  2PWJ A;  1TOF A;  4JED A;  3A5I A;  2FA8 A;  4L8E A;  2H6Z A;  4ISD A;  4OWY A;  1Z3E A;  3M3M A;  3IK7 A;  4K0G A;  4XCS A;  2H0I A;  2WFC A;  1K0B A;  3RPP A;  13GS A;  3F9U A;  3ZLP A;  4EUY A;  4G10 A;  4AJ7 A;  1A23 A;  3GNJ A;  5DJM A;  1BX9 A;  3ERG A;  3H1N A;  3MIX A;  3UBL A;  2XBQ A;  1GSD A;  1CQG A;  4NV2 A;  1EV4 A;  1SKW B;  3CTG A;  5IQY A;  3M8N A;  4OFM A;  1OC9 B;  1X5E A;  5ECN B;  4PUF C;  5F05 A;  1Q98 A;  3WGE A;  4PUR A;  4ZBA A;  1SKR B;  4N3Z A;  1ZL9 A;  5HFG A;  4D73 B;  2O89 A;  3EU4 A;  2HFD A;  4WBJ A;  4KB3 A;  2YWM A;  2J9H A;  2WZ9 A;  2VAF A;  1FB0 A;  1EWX A;  3TB2 A;  2HSN B;  4IVF A;  4X4J A;  1K0A A;  5GAN D;  3VPQ A;  2YP6 A;  2IMK A;  1OYJ A;  4EC0 A;  3HZ8 A;  1PSQ A;  2NBS A;  2CX4 A;  3G7Y A;  4TR4 A;  5HR2 A;  2VCX A;  4N10 A;  4GDF A;  2VL9 A;  1WP0 A;  3GTU B;  4G9H A;  3TKR A;  2P5Q A;  3UEM A;  5ECI B;  3QAW A;  3LGC A;  14GS A;  1U87 A;  3GV1 A;  1ABA A;  4E68 A;  1FOV A;  1SVO A;  2C3N A;  1DBY A;  3UIW A;  5J4V A;  4XS4 A;  3GST A;  1K3O A;  1MDJ A;  2B5X A;  1TRW A;  4IS0 A;  5DVB A;  2RM5 A;  2DBC A;  4I97 A;  1N25 A;  3P7X A;  1ZYN A;  5A4W A;  3ZMK A;  3EWL A;  4O5U A;  3C71 A;  2KLX A;  4V1A g;  5HFK A;  5J9C A;  1GTU A;  1THO A;  3HXS A;  4HJ2 A;  3DWV A;  6GSX A;  2HXK A;  3ERF A;  1ERW A;  1NW2 A;  2I81 A;  3VWV A;  3KEB A;  5DBQ A;  2TRX A;  4NWY A;  3TKQ A;  4XTS A;  4MJB A;  4IQA A;  2IPA A;  5ENU A;  2H76 A;  1T3B A;  1O73 A;  3IE3 A;  2VCV A;  2ON7 A;  5DCG A;  4PNF A;  1G6Y A;  4AKX B;  3A2V A;  1ZYQ B;  4IKH A;  5ELA A;  3WGX A;  1O81 A;  3P90 A;  3ED3 A;  3ZVJ A;  2QSI A;  1O8X A;  1S3C A;  3LYP A;  2R0C A;  5IO0 A;  2R5G A;  1PD2 1;  4NMU A;  1EOH A;  2IME A;  1VF4 A;  4ZL7 A;  1LU4 A;  2E0Q A;  4RQX A;  4TN8 A;  1M2A A;  2YOI A;  4BPY A;  1F37 A;  16GS A;  1PX6 A;  1GL8 A;  3RAZ A;  2GT5 A;  1Y1U A;  3H8Q A;  1QUW A;  5ECO B;  2H73 A;  3GKK A;  1BQ7 A;  4K9Z A;  4O32 A;  1VF1 A;  1E6B A;  3EMX A;  4GF0 A;  1K0D A;  3LOR A;  3APO A;  1OVN A;  3KP8 A;  5IMC A;  3H4K A;  1PMT A;  4EO3 A;  2B1L A;  3DD3 A;  2LST A;  4G19 A;  1M9A A;  3FW2 A;  4PQI A;  11GS A;  1UC7 A;  1R26 A;  1EGR A;  1MTC A;  2L6D A;  4DSS B;  2H74 A;  2ES7 A;  2O8V B;  2FUG 2;  3C8E A;  1RK4 A;  4MJC A;  5F07 A;  3LYK A;  2HT9 A;  1O6J A;  1OC3 A;  4LMV A;  1ZOF A;  2B6M A;  5J41 A;  3GA4 A;  1XIY A;  2UZ8 A;  2L57 A;  4JBB A;  2QA1 A;  1NSW A;  3GFK A;  1B4P A;  1A24 A;  4N0V A;  1DE1 A;  1T7P B;  3TGZ A;  3ME7 A;  4KSO A;  4K6X A;  2LJR A;  4KSM A;  4POK A;  2LQO A;  3FY7 A;  3HJM A;  2JL4 A;  2CV4 A;  3LWA A;  1PL2 A;  4KX4 A;  4HEA 2;  1T8E B;  5IMV A;  3LXZ A;  3HHV A;  2GGT A;  5COH A;  4Z7X A;  1G0T A;  3GX8 A;  3FKF A;  4GLT A;  2DKH A;  2K18 A;  3MDK A;  22GS A;  5C00 A;  2A4V A;  4ZB6 A;  2YJ7 A;  2PER A;  3R2Q A;  2L4Q A;  2VOC A;  3QAV A;  2DLX A;  2OAD A;  3ZFL A;  3KM6 A;  3IAM 2;  4FYC A;  3FZ4 A;  2CVK A;  3A3T A;  2DIZ A;  3FR6 A;  1LBK A;  2GST A;  3Q19 A;  3KTB A;  5H5R A;  3M0F A;  2LNS A;  4G0L A;  4WBR D;  1YF0 A;  3GH9 A;  1GUL A;  3GRX A;  3S9F A;  3IC8 A;  3JCM L;  1J08 A;  2VUP A;  2V32 A;  3L78 A;  3VWU A;  2CZ2 A;  5G2Z A;  1EEJ A;  3TJB A;  4KCE A;  2M72 A;  1PKW A;  6GST A;  2V6O A;  4MP4 A;  3G7I A;  5ECK B;  1UN2 A;  2VLT A;  2XBI A;  5JCU A;  2RM6 A;  3TJK A;  4YH2 A;  2OE0 A;  4K5R A;  1O8W A;  3CBU A;  1U88 A;  4TR1 B;  2KOK A;  1TU7 A;  1X5D A;  12GS A;  3D4M A;  4DEJ A;  4G0I A;  2DKI A;  3VWX A;  4GWR A;  2E7P A;  1ON4 A;  2VM1 A;  2H30 A;  1YEX A;  2MYG A;  2CVB A;  2AYT A;  3UVT A;  2G2Q A;  2R0G A;  5IMZ A;  5LNK e;  1X9S B;  1W4V A;  3W8J A;  1GWC A;  3HY2 A;  4WR4 A;  2C4J A;  1GSF A;  1R5P A;  3ZTL A;  2C80 A;  2O7K A;  3D4T A;  1A2L A;  3W6G A;  2K6V A;  3QAG A;  2C0F A;  2OAC A;  3DKS A;  4BVY B;  4KAE A;  2B5E A;  3MSZ A;  4JR4 A;  3ZVJ D;  3UBK A;  3DVW A;  3F0I A;  5A1N B;  1QGV A;  3TRQ A;  2G0F A;  3DYR A;  4FIW A;  2WUL A;  2K9F A;  2IMD A;  1V58 A;  3LQ7 A;  4K7N A;  1IYH A;  3G7J A;  5GST A;  1GRX A;  5IIZ A;  4I2U A;  2ZCT A;  4O7H A;  4K7O A;  1XW9 A;  1J0F A;  3TJJ A;  3IA1 A;  1JZO A;  3FYG A;  2J23 A;  4YQM A;  4BL7 A;  4ECB A;  1EP8 A;  1GLP A;  2ON5 A;  3L9S A;  3MAK A;  4K5S A;  3EVI A;  3RDW A;  4ILF A;  3TOT A;  3EE2 A;  2PBJ A;  2LS5 A;  2IMI A;  3WT2 A;  3SBC A;  4FQU A;  1PKZ A;  5A5H A;  5DCH A;  2YNX A;  2EIQ A;  8GSS A;  3H79 A;  2OA7 A;  3E9J B;  1Q4J A;  1EP7 A;  4FYU A;  1HNA A;  3QCP A;  4HU9 A;  4WET A;  4TKY A;  2AB6 A;  3EYT A;  1Z6M A;  2AAW A;  5EL8 A;  2OKA A;  3KCM A;  6GSU A;  1Z5Y E;  4AKH A;  5G31 A;  2VKZ G;  2YV7 A;  2I3Y A;  3TJF A;  1WJK A;  3Q6O A;  3UL3 A;  2KUC A;  2GSR A;  3P8W A;  2PU9 C;  4MPF A;  1I9D A;  1DSB A;  2HZE A;  1GSU A;  5A34 B;  1G7E A;  5CYY A;  2GZZ A;  3GL3 A;  1Y25 A;  1XWK A;  3ISO A;  5D73 A;  1T4Y A;  4QMK A;  3J7Y k;  1JZW A;  4MK3 A;  2HZF A;  3F8U A;  3CRU A;  3LG6 A;  1DE2 A;  1GSY A;  1UA5 A;  1EZK A;  4WF4 A;  3NOF A;  2X99 A;  2REM A;  1H75 A;  2VLV A;  4AKG A;  2BTO T;  4PQ1 A;  3D22 A;  5J47 A;  2V41 A;  4CW9 A;  1XOB A;  2MMO A;  3HVX A;  1BJX A;  4ZB9 A;  2XC2 A;  1W89 A;  4ZBB A;  4WR5 A;  5IMF A;  3F4R A;  4XHM A;  4N30 A;  4ZB8 A;  3ME8 A;  4GQC A;  2HRF A;  1SK0 A;  4P3Y B;  4XS6 A;  2WS2 A;  4V2M A;  5JWR B;  1G7O A;  3F6F A;  1T00 A;  2K8V A;  2NDO A;  2WDU A;  2N5A A;  2CX3 A;  5ECP B;  1SK2 A;  4N11 A;  3M9K A;  4ZIL A;  5ID2 A;  2OBI A;  3MNG A;  2FWF A;  1ZYP A;  3IDV A;  1TU8 A;  5CP1 A;  5G30 A;  3A2X A;  3WGD A;  19GS A;  5GAP D;  2D2Z A;  1OC8 A;  1X9M B;  3FR9 A;  2PVO C;  3FK8 A;  4BVX A;  3Q18 A;  4IJI A;  3CTF A;  2O87 A;  5CAX A;  4E8H A;  2PPT A;  3DXB A;  2FLS A;  1XW6 A;  4XRD A;  1SD8 A;  2GQM A;  3EU3 A;  2R3X A;  4DSR A;  2H0H A;  4YKF A;  2DJ3 A;  1QQ2 A;  1J9B A;  2BJX A;  2LEG A;  5A5H B;  4MMM A;  1GUM A;  1V2A A;  3FZ5 A;  1Z6N A;  2H0G A;  2FWH A;  4V2L A;  3TDG A;  1ZYE A;  5KOW A;  4RUV A;  3CWG A;  4EF0 A;  4TXO B;  4NXI A;  1SL0 B;  2HSM B;  3PGT A;  2HRK A;  4Z2U A;  3R3E A;  1M0U A;  1YZX A;  3I69 A;  4QL7 A;  5DDL A;  4L5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...