5ECLB

Crystal structure of fin219-fip1 complex with ja, ile and mg
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transferase
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 63
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5eclB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5eclB01
3IAS2 1YQ1A 4IJ3A 1GP1A 5DBQA 3V1WA 5CYYA 5CRWA 4ML6A 1F37A 4YQVA 1O73A 3LG6A 2C0FA 3WYWA 5DJMA 1OC8A 3TUEA 2ALBA 4KB3A 3N9JA 5D96A 1XWBA 4TR1A 1TRUA 2C1YA 1B8XA 2O85A 1M9AA 2JACA 3HVSA 1H4OA 1K0NA 4OMVA 1T00A 5DAKA 3ZFBA 2C8UA 3KZQA 4TKYA 1O81A 1E2YA 1YY7A 3D5JA 3L4NA 4MF5A 2OBKA 1BAYA 2B5YA 2K9FA 4TXOB 2IN3A 1LJRA 2DJ2A 1YF0A 1GSFA 1TOFA 5FWGA 5ECMB 1I9DA 3NZNA 2YPMA 1A24A 2GT5A 1F2EA 3M8NA 4YAPA 1FG4A 1WPIA 4NMUA 2AV4A 3DD3A 1VGLA 2YV7A 2LJKA 1ERVA 4I2UA 3QAGA 4BVYB 3ZVJA 4GTUA 4KH7A 2VM1A 3FR3A 1EOGA 1GSUA 3TCOA 1TK0B 1EV9A 3GH9A 5CAXA 1G0TA 3U5RE 17GSA 2YJHA 3QMXA 3GV1A 5ENUA 2FLSA 4TR0A 3L78A 1GLQA 1EP7A 5ECHB 2H72A 1MDIA 1GSEA 2C80A 2XPDA 2VD1A 1WIKA 2L4QA 4MH3A 2GSRA 1SD8A 4K0NA 3DGQA 2R4VA 1T7PB 2V32A 4ECIA 4HQZA 2HE3A 2AB6A 1GNWA 1F3AA 1XVQA 4AJ6A 1ILOA 1TRWA 3HCZA 1FB6A 1XPVA 4ZL8A 2G0FA 2PUKC 1GL8A 5HFKA 1I5GA 2CT6A 3O6TA 1TRSA 4YH2A 1R4WA 1OKDA 3KD0A 3HXSA 3GTUB 1SL0B 1N2AA 5DCGA 5H5RA 3SWLA 2LQQA 1FVKA 1KBNA 2E2MA 2PU9C 4RQRA 2CA8A 4KA0A 2H6XA 3HZ4A 4YAVA 3TKSA 4RI7A 4EO3A 1SL1B 3VFIA 2VLUA 4MMMA 1LU4A 4EE0A 1PKZA 4XS1A 5A5KA 4PTSA 2HRKB 2VIMA 4EL1A 1K0AA 4IP1A 1OYJA 1X9MB 5ECOB 4OCEA 5AGYA 5IMAA 5B6MA 2E2GA 4HUAA 5DVBA 3HVXA 1T4YA 3BD2A 4G2EA 3QDNA 1OC3A 5KN3A 5HR1A 2NBSA 5EL8A 3O76A 2HSMA 4HOJA 2F9SA 2L5LA 2XPEA 2N5AA 3ME8A 3TOUA 5KN1A 1QGVA 3P2AA 3TJBA 2IWTA 3IV4A 1XXUA 2MMAA 3UBKA 3IHQA 1X9WB 2FY6A 2H66A 3H8QA 3CXGA 3IOSA 3LSZA 1PGTA 4K7NA 3IBHA 4KGIA 2N5FA 4PURA 2OE3A 5JWRB 2VM2A 4TN8A 2V41A 1VRSD 2H0HA 2REMA 1QQ2A 4IP6A 2ZUPA 3UEMA 1GH2A 14GSA 3JCML 4K0GA 2PGTA 5ELGA 18GSA 1THOA 3DWVA 2GZPA 1TKDB 1EGRA 4DVCA 2WRTA 3CBUA 2H19A 1NHYA 1SK1A 3RHCA 3U6VA 6GSVA 2GQLA 5IQYA 4OFMA 4ULXA 5IO0A 3UVTA 3RAZA 4WF4A 4MPGA 1PRXA 2FA4A 4PX1A 4F0BA 2I3YA 1PSQA 3MWHA 3PH9A 2GLRA 1SK2A 5B7CA 2R5GA 2J23A 1T3BA 4NPBA 1Z7RA 5D9XA 3IXRA 4RQXA 3KJYA 1KEBA 3J7Yk 3PINA 4GCIA 2WZ9A 5H5QA 2P5RA 4MABA 2ZNMA 3ZRDA 1JZOA 1BJXA 4IHUA 2LRNA 1XVWA 5IM9A 1X9SB 2KP1A 5GZZB 1ACVA 2DLXA 4ZB9A 1TXXA 1GTBA 4GF0A 4JR4A 5G1LA 3UIWA 1TP9A 2XBIA 4PUFC 1G6YA 2O8VB 4TOPA 4FYCA 1VF4A 1SKSB 2NTOA 1Z6NA 3TB2A 3FZ5A 5E4WA 5DALA 1KNGA 4KW6A 1CQHA 4K2DA 5ECIB 2LNTA 3E3EA 2K8VA 1AAZA 3WGXA 4LA1A 1Y6EA 4KE3A 3CTGA 3QCPA 4N0VA 1SD9A 1PQNA 5G1KA 1XW6A 4ZBDA 1EEJA 3WT2A 2GZYA 3KMOA 1Y25A 3KIJA 1K3OA 4KDXA 2LV3A 4V2NA 2VD0A 3E0UA 3FHKA 1X5EA 4YQUA 2DJ0A 4WXTA 4G0KA 4IVFA 4K8MA 1F3BA 5G2ZA 2YOIA 1X5DA 4HJMA 4GXZA 4WF5A 5JCUA 1OE8A 3QOUA 1WE0A 4J56E 1RQMA 4WR4A 1ERTA 4Q5RA 2WS2A 4EUYA 3GFKA 2H30A 5HR3A 2H6YA 2DSAA 4N0ZA 4F0CA 4POLA 4PNFA 2HRKA 4O92A 5GSSA 2VL3A 1ML6A 1AIUA 4EDYA 2HRNA 2KUCA 1JZRA 2B1LA 4O32A 4POMA 2L6CA 1OKTA 1U3IA 3UMAA 5F0GA 3RDWA 1ST9A 5J41A 3ERWA 1M99A 2LNSA 3M0FA 3ZFLA 1XW5A 3FW2A 5ID2B 2IFQA 1M2DA 2JSZA 2H8LA 1ZZYA 3CRTA 4F9ZA 3GH6A 3CMIA 2WJUA 5DQYA 2L6DA 1B9XC 2H76A 4HU7A 3QPMA 4NAXA 3PR8A 1XBSA 1DSBA 4J2FA 3G7JA 1GUKA 2V6KA 4NV2A 2CX4A 4WKWA 2LJRA 1XZOA 3VPTA 3VWUA 3WD6A 2RM5A 5D93A 3LJRA 2CV4A 1JLWA 2VCZA 2VCQA 5E59A 3FR9A 4G10A 2CVDA 1ERUA 1T1VA 4KDYA 3IC8A 4F03A 2WCIA 3EMPA 4JE1A 4JEDA 1K3YA 3DVWA 2BMXA 1OVNA 6GSSA 5C04A 2LRTA 3HY2A 4OCFA 1YZXA 5IMZA 4BPYA 1ON4A 4L8EA 4HJ2A 3H79A 2E0QA 3A5WA 1HNAA 3TKRA 3HZ8A 3EVIA 2KOKA 3K8NA 4DSSB 5J9CA 2RUEA 2PERA 2M72A 1BEDA 4ZB8A 1M2AA 4EKZA 2WGRA 4X0XA 1RK4A 1SYXA 5JWOB 2GSSA 2O7KA 2HSYA 2VLVA 2C0GA 2HNLA 4BL7B 3MDKA 3TJJA 4BWQA 4IW9A 6GSYA 3ZVJD 1EP8A 3GKNA 3EINA 3L9VA 2F51A 5KN2A 3GKXA 2H1GA 2LEGA 2DC5A 3FZAA 4ILFA 1GTIA 5AISA 2B7JA 1Z9HA 4WBJA 1E6BA 4V1Ag 3W8JA 3F4SA 1TW9A 3C73A 4CW9A 2IMIA 2P31A 1NW2A 2B1KA 1GTAA 4XRAA 5ELAA 4JU5A 4BVXA 5G31A 2H75A 3QAVA 4GSNA 3R2QA 5AIXA 2VCTA 4ECCA 2IMKA 3DXBA 3FKFA 2IIYA 2MZCA 9GSSA 1VF2A 3Q18A 4XRDA 3CRUA 5DDLA 3ZREA 3Q6OA 3ZIVA 4FO5A 5HQPA 3DMLA 4KCEA 2OACA 1BQ7A 3KP8A 4USSA 2CAQA 3KTBA 1S3AA 4MZCA 2JL4A 4OWYA 4JRRA 1X5CA 4XS4B 1AQVA 1MDKA 1C72A 2HFDA 2MMZA 2KHPA 2NVLA 4IS0A 1R26A 5J4UA 3FR6A 4I8BA 5ECNB 1GULA 3DYRA 6GSUA 2AJQB 3M1GA 1EEMA 2X8CA 3FK8A 4NWYA 4IGJA 2WFCA 3ERFA 3ZL5A 1SJ6A 2DJJA 2VL9A 2MBSA 3EURA 4GQFA 3ZTLA 4HZ2A 1MD3A 4TW5A 2HT9A 2CZ2A 2O89A 3TRPA 3TJKA 3F4RA 5H5SA 2RUFA 2L57A 4XTSA 3VK9A 4TRXA 1EV4A 3CTFA 2G2QA 4N11A 1G7EA 1JZDA 5AIVA 3DIEA 5J3RA 1OC9A 3IPZA 3ERGA 2GTUA 1FO5A 4OFTA 4ZL9A 5CRGA 4LMVA 1PD21 3F6DA 1AW9A 3HKRA 4O7HA 5F07A 3APOA 2LS5A 5A4WA 3LEFA 2JADA 1XW9A 1SJZA 1XFLA 4D73B 1DBYA 5L71A 4ZXGA 3ZMLA 2I9HA 5ECSA 2C0EA 3DEXA 4RUVA 3TKQA 2HZEB 2E7PA 5LCZA 3QFBC 2X99A 5GAND 1BG5A 4XCSA 2IMFA 2HYXA 1AC1A 5CP1A 5EVOA 3E9JB 3ZIJA 3LGCA 2PBJA 2PVQA 1TI3A 1AXDA 4PUAA 5J9BA 5B8BA 5KEJA 5ECLB 1F9MA 4XIHA 1A0RP 2YWNA 3RPNA 4AJ7A 4BWSA 1XWCA 1K0MA 1FOVA 2QGVA 3ZITA 2YJ7A 1BYEA 1HD2A 3UOMA 2TRXA 2GDRA 3HYPA 4L0WA 3TOTA 4TXOA 1T8EB 2VLTA 2CVBA 1GLPA 4TR3A 1M2BA 3RPPA 1PN9A 1HQOA 1GUHA 2AAWA 4ZBAA 2EC4A 1PL1A 4E8HA 1S3CA 2AYTA 5F8BA 4KF9A 3ZMKA 1O7UA 1V98A 3LORA 1TK5B 2R6KA 4BVYA 5IPHA 4ZB6A 3C1RA 4TR1B 4G0LA 3IC4A 1GRXA 3G9BA 3IRAA 1V9WA 4F82A 1B4QA 1NM3A 2H01A 5DAKB 4KAEA 3VI5A 3HDCA 1YF1A 4MJEA 1YJ6A 5B6NA 4E8EA 1A8LA 4OO4A 3D22A 1DUGA 3CSIA 2X8HA 4POKA 5JCGA 4LL4B 2B6MA 4FH8A 1V58A 1HYUA 2AUVA 1SKRB 2C3NA 2IMEA 2F8FA 3GA4A 1GNEA 2FD3A 3I43A 4I2TA 5LD0A 5GAPD 1FB0A 20GSA 2L4CA 4ECBA 2PPTA 2CAIA 4X43A 3APSA 2P0GA 2XHFA 4MH2A 22GSA 1Q98A 2PMTA 3KGKA 2LUSA 5ECPB 5IIZA 4HEA2 1W4VA 3TKSE 2VL2C 1ERWA 1A2MA 5A4UA 3VWXA 1Q4JA 3UVHA 1GSDA 1PA3A 5G30A 2ON7A 3P90A 3GMFA 2A2SA 2C3TA 2CVKA 1KTEA 2OE1A 2V1MA 2B5EA 3GTUA 5FHIA 4CDOA 1Z5YE 2LKUA 3HJMA 2A2RA 2M46A 4AGSA 4PNGA 4G0IA 3GIXA 2L5OA 3GKKA 1YDKA 3D6IA 1EWXA 3A2XA 3GHAA 1DE2A 2O87A 2HSNB 3EE2A 4QL7A 1K3LA 4KSMA 1IYIA 2JZRA 1XWKA 4WETA 5ECRB 3TRXA 3HA9A 1VF1A 4ECJA 1HNBA 2YWMA 2C0DA 3P7XA 3VURA 3CSJA 3FY7A 1NSWA 4MJCA 3MNGA 1MD4A 2PVOC 3KTLA 1M0UA 3HVVA 4HS1A 4AF2A 1EGOA 2JU5A 4LMWA 3A2WA 3HD5A 2OKAA 2GT6A 2CQ9A 2YCDA 1O8XA 4KNDA 1QUWA 1XOAA 1R5AA 2HQTA 1X0RA 3CYNA 3O3TA 1XIYA 3MAKA 2R2JA 5JWQB 4V2MA 2QSIA 3NIVA 1AQXA 1UC7A 1LBKA 1VF3A 5D8IA 3TJGA 4L5OA 5LNKe 4ID0A 4LLRA 4TXVA 1QMVA 2YANA 5IPGA 1ZGNA 1M9BA 2LTKA 2L59A 3ZYWA 4HU9A 1WWJA 2M80A 4Q5FA 1XWGA 3M9JA 3KH9A 1MEKA 4GSSA 2HSMB 1WJKA 3BOAA 1R7HA 2KP2A 2MYGA 1U6TA 4GSTA 3BJ5A 5D73A 4HZ4A 3N5OA 1K0OA 2H1BA 2DJKA 2RLIA 5CO3A 1JZWA 4FQUA 6GSXA 4N30A 1J9BA 2YN1A 4POBA 3M3MA 3H93A 3FYGA 4HDEA 3IAM2 3FEUA 3GKMA 4QQ7A 2N5BA 2B7KA 3TJFA 2XC2A 2HXKA 2YV9A 3CSHA 2LJAA 5AN1A 5IMVA 3H4KA 1UN2A 6GSTA 2VAFA 3PGTA 1V57A 3LWAA 3F9UA 5FT3A 3BCKA 1TTZA 12GSA 5IMFA 3C1SA 1A2JA 3TKPA 1S3DA 2ON5A 3G7IA 1O85A 1A2LA 1T4ZA 3HJPA 1FW1A 5GSTA 1DE1A 4F2IA 3IDVA 4IJIA 2FWHA 1N8JA 3TGZA 5HFIA 2X8GA 2NDOA 5ECKB 1M7TA 1ABAA 5IOXA 3BCIA 3GX8A 3GUSA 4V2LA 1G6WA 4RI6A 2IPAA 4IBPA 2GS3A 3I9V2 2V6OA 4PQ1A 4L0UA 3WGEA 3GSTA 5C00A 4GRFA 4JR6A 4CHSA 4P3YB 5IMDA 1R5PA 2GSQA 2OJLA 3I69A 2HLSA 2FUG2 2H74A 5F05A 1Z7PA 3OR5A 1USBA 2VO4A 3C7MA 1HNCA 1GUMA 4GWRA 4L5LA 2BTOT 4TR4A 1TI1A 2GGTA 1XWAA 1GSYA 1NHOA 4NXIA 4DEJA 2OADA 1PL2A 2GSTA 3RHBA 1W89A 2DMLA 5INYA 4PXOA 3WGDA 1U3AA 3UARA 5DJLA 3QD9A 4BA7A 5ECQB 2LSTA 7GSSA 2DMMA 5DALB 1SK0A 1ZYQB 1QK8A 3FRCA 4NV5A 4K7OA 2DIYA 4I97A 3LYPA 3S9FA 5G5EA 4LL1B 1SKWB 3DKSA 1PX6A 4ACSA 4KSOA 2V2GA 1A0FA 4WBRD 1CQGA 1TRVA 3ED3A 2K18A 2YP6A 4KDUA 3R3EA 2HI7A 1EOHA 3M9KA 2KLXA 1SYRA 1MDJA 3KMNA 2JSYA 2OA7A 1H75A 3IA1A 1GTUA 1ZOFA 5D9WA 1O8WA 4MDCA 2PWJA 1YEPA 3DRNA 3GURA 1UVZA 19GSA 3LYKA 2OE0A 3ZZXA 3QFAC 5ID2A 4PGTA 2K6VA 3EMXA 3I6AA 3VPQA 1Z3EA 2WB9A 1J0FA 2K8SA 4FYBA 5HR0A 3MSZA 5D9VA 3Q74A 4G9HA 2FA8A 2H70A 2XBQA 2OBIA 3GN3A 4GQCA 3C71A 4ZIJA 1A8YA 3US3A 3KEBA 4AJ8A 4NHZA 2VCXA 2AHEA 2H71A 13GSA 4MCUA 5HR2A 1F6MC 2H73A 4HI7A 4IELA 4MZBA 5DQSA 2YWIA 2IFQB 3L9UA 4MPFA 3LQ7A 4TVEA 3LXZA 3GSSA 2Z9SA 3ME7A 4IN0A 3PPUA 2VL2A 3UAPA 3D4TA 1THXA 2QKEA 2FWGA 1PKWA 4ZBBA 3EC3A 10GSA 2GQMA 5BMUA 2DIZA 2IL3A 2R37A 1SJIA 2MBTA 3KP9A 1ZL9A 3BBYA 3F8UA 2MMNA 1Z6MA 2WDUA 3L0HA 1O6JA 4MP4A 4K7IA 11GSA 4FIWA 4WR5A 5EY6A 1ZYEA 1K0DA 4DSSA 8GSSA 2C4JA 3VWVA 1AQWA 1UA5A 5F06A 1TJDA 4IQAA 4EVMA 2FNOA 1SL2B 2P5QA 2FGXA 3F6FA 4JBBA 2B3SA 4N10A 2H0IA 3KXOA 1GWCA 5CNWA 4BL7A 2TIRA 2H1AA 16GSA 2DJ1A 2VCWA 2J9HA 4EDZA 2VCVA 2GZZA 3F3RA 5D9TA 3GYKA 3UL3A 4XS6A 1SENA 4XHMA 3VLNA 3HJOA 3UJ1A 2BJXA 2PN8A 4H86A 3G7YA 5IO2A 5IOWA 5CRHA 2RM6A 2A4VA 4OO5A 3A2VA 1GSQA 3TKSC 4I6XA 3VWWA 1JLVA 2B5XA 4NHWA 3RBTA 1OAZA 2VOCA 1RW1A 2FHEA 3SBCA 3EWLA 4MF6A 4MJBA 2EIQA 2F8AA 3EYTA 1FHEA 4MJAA 2H1DA 1AUCA 4ISDA 2I1UA 2NPBA 2IJYA 4KCAA 1TK8B 2R3XA 2EIOA 4Q5NA 3GL3A 3F0IA 4I5QA 4J57E 2YZUA 3UBLA 2C3QA 4ZILA 4EF0A 3VI7A 2IMDA 3ZLPA 3GNJA 2H6ZA 1TDIA 5ABRA 4XS4A 4FYUA 1XOBA 2LQOA 2WULA 2YNXA 4BVXB 5CRDA 1PMTA 1A23A 2I4AA 2H0GA 1WP0A 4EXJA 5COHA 1YEXA 5G5FA 3F3QA 3KM6A 1SU9A 2X64A 2DBCA 5A4VA 5CREA 1ZMAA 4IKHA 4QL9A 3LXTA 3LFLA 1MTCA 4V1Ap 1K0BA 4Z7XA 3QAWA 1G7OA 1JFUA 3IR4A 4EC0A 2TRCP 1GSSA 4K1FA 3GX0A 3FZ4A 3J7Yb 2HSHA 1XCCA 3D21A 3GL5A 2YWOA 3QR6A 2CZ3A 4K9ZA 3NOFA 2CX3A 2VUPA 3W6GA 3A3TA 4GLTA 2DJ3A 3L9SA 4KX4A 3F4TA 4OFNA 4MA9A 1PX7A 2ZCTA 4MLYA 4PQIA 4JZQA 3TDGA 1B48A 1BX9A 5EPFA 1YKCA 2EIRA 3Q19A 3P8WA 5JCWA 3AY8A 2QC7A 3APQA 3FZ9A 2I81A 5IMCA 3KCMA 3W8SA 2F3MA 4ZL7A 4MK3A 3H1NA 2UZ8A 3HHVA 1TU8A 3IE3A 4ML1A 3EU4A 3TRQA 3C8EA 2FCHA 4D73A 1WMJA 2JZTA 4K6XA 1U88A 1YKAA 2FWFA 2HZEA 4MZWA 1ZCPA 4O5RA 1V2AA 5B8AA 4G19A 1FVJA 2HRAA 1K0CA 2GQKA 1URMA 4KUNA 3ISOA 3DVXA 3GRXA 1QXHA 1OE7A 3EU3A 1OC9B 2ES7A 4Q5QA 4WEYA 5KN0A 1FAAA 4DSRA 1TU7A 2HRFA 5HFGA 3F63A 1WRYA 2LRCA 1QFNA 5DCHA 6GSWA 4IQ1A 3D4MA 4DSQA 2YZHA 4MF7A 2HZFA 1WOUA 1U87A 2MMOA 1J08A 3D0ZA 3WT1A 1V40A 5J5NA 1IYHA 1JHBA 3KH7A 1B4PA 3IK9A 4YQMA 2GVPA 2D2ZA 4PQHA 1EZKA 2FWEA 4OD7A 4X1UA 2RIIA 4HQSA 3IK7A 2JZSA 1B9YC
chains in the Genus database with same CATH superfamily
3IAS2 1YQ1A 4IJ3A 1GP1A 5DBQA 3V1WA 5CYYA 5CRWA 4ML6A 1F37A 4YQVA 1SVLA 3LG6A 1O73A 2EFEA 2C0FA 3WYWA 5DJMA 1OC8A 4QMKA 3TUEA 2ALBA 4KB3A 3N9JA 5D96A 1XWBA 4TR1A 1TRUA 2C1YA 1B8XA 2O85A 1SVOA 1M9AA 2JACA 3HVSA 2DKHA 1H4OA 5BRTA 1K0NA 4OMVA 1T00A 5DAKA 3ZFBA 2C8UA 3KZQA 4TKYA 1O81A 1E2YA 1YY7A 3D5JA 3L4NA 4MF5A 2OBKA 1ZYNA 1BAYA 2B5YA 2K9FA 4TXOB 2IN3A 1LJRA 2DJ2A 1YF0A 1GSFA 3IHGA 1TOFA 5FWGA 5ECMB 1I9DA 3NZNA 2YPMA 1A24A 2GT5A 2A4HA 1F2EA 3M8NA 4YAPA 1FG4A 1WPIA 4NMUA 2AV4A 3DD3A 1VGLA 2R0CA 2YV7A 2LJKA 1ERVA 4I2UA 3QAGA 4BVYB 3ZVJA 4GTUA 4KH7A 2VM1A 3FR3A 1EOGA 1GSUA 3TCOA 3FMWA 1TK0B 1EV9A 3GH9A 5CAXA 1G0TA 4CY6A 3U5RE 17GSA 2YJHA 3QMXA 3GV1A 5ENUA 2FLSA 4TR0A 3L78A 1GLQA 1EP7A 5ECHB 2H72A 5A5HA 1MDIA 1GSEA 2C80A 2XPDA 2VD1A 1WIKA 2L4QA 4MH3A 2GSRA 1SD8A 4K0NA 3DGQA 2R4VA 1T7PB 2HSNA 2V32A 4ECIA 4HQZA 2HE3A 2AB6A 4MNNA 1GNWA 1F3AA 1SVMA 1XVQA 4AJ6A 1ILOA 1TRWA 3HCZA 1FB6A 1XPVA 4ZL8A 2G0FA 2PUKC 1GL8A 5HFKA 1I5GA 2CT6A 3O6TA 1TRSA 4YH2A 1R4WA 1OKDA 3KD0A 3HXSA 3GTUB 1SL0B 1N2AA 5DCGA 5H5RA 3SWLA 2LQQA 1FVKA 1KBNA 2E2MA 3A5IA 2PU9C 4RQRA 2CA8A 4KA0A 2H6XA 3HZ4A 4YAVA 3TKSA 4RI7A 4EO3A 1SL1B 3VFIA 2VLUA 4MMMA 1LU4A 4EE0A 1PKZA 4XS1A 5A5KA 4PTSA 2HRKB 2VIMA 4EL1A 1K0AA 4IP1A 1OYJA 1X9MB 5ECOB 4OCEA 5AGYA 5IMAA 5B6MA 2E2GA 4HUAA 5DVBA 3HVXA 1T4YA 3BD2A 4Z2UA 4G2EA 3QDNA 1OC3A 5KN3A 5HR1A 2NBSA 5EL8A 3O76A 2HSMA 2EFHA 4HOJA 2F9SA 2L5LA 2XPEA 2N5AA 2EFCA 3ME8A 2A2PA 3TOUA 4E68A 1PN0A 5KN1A 1QGVA 3P2AA 3TJBA 2IWTA 3IV4A 1XXUA 2MMAA 3UBKA 3IHQA 1X9WB 2FY6A 2H66A 3H8QA 4FXYP 3CXGA 3IOSA 3LSZA 1PGTA 4K7NA 2O5VA 3IBHA 4KGIA 2N5FA 4PURA 2OE3A 5JWRB 2VM2A 4TN8A 2V41A 1VRSD 2H0HA 2REMA 1QQ2A 4IP6A 2ZUPA 3UEMA 1GH2A 14GSA 3JCML 4K0GA 2PGTA 5ELGA 18GSA 1THOA 3DWVA 2GZPA 1TKDB 1EGRA 4DVCA 2WRTA 3RFRC 3CBUA 2H19A 1NHYA 1SK1A 3RHCA 3U6VA 6GSVA 2GQLA 5IQYA 4OFMA 4ULXA 5IO0A 3UVTA 3RAZA 4WF4A 4MPGA 1PRXA 5A34B 2FA4A 5KOXA 4PX1A 4F0BA 2I3YA 1PSQA 3MWHA 3PH9A 2GLRA 1SK2A 5B7CA 2R5GA 2J23A 1T3BA 4NPBA 1Z7RA 5D9XA 3IXRA 4RQXA 3KJYA 1KEBA 3J7Yk 3PINA 4GCIA 2WZ9A 5H5QA 2P5RA 4MABA 2ZNMA 3ZRDA 1JZOA 1BJXA 4IHUA 2LRNA 1XVWA 5IM9A 1X9SB 2KP1A 5GZZB 1ACVA 2DLXA 4ZB9A 1TXXA 1GTBA 4GF0A 4JR4A 5G1LA 3UIWA 1TP9A 2XBIA 4PUFC 1G6YA 2O8VB 4TOPA 5J40A 4FYCA 1VF4A 1SKSB 2NTOA 1Z6NA 3TB2A 3FZ5A 3MIXA 1ZYPA 5E4WA 5DALA 1KNGA 4KW6A 2WVXB 1CQHA 4K2DA 5ECIB 2LNTA 3E3EA 2K8VA 1AAZA 3WGXA 4LA1A 1Y6EA 4KE3A 3CTGA 3QCPA 4N0VA 1SD9A 1PQNA 5G1KA 1XW6A 4ZBDA 1EEJA 3WT2A 2GZYA 3KMOA 1Y25A 3EPTA 3KIJA 1K3OA 4KDXA 2LV3A 4V2NA 2VD0A 3E0UA 3FHKA 1BF5A 1X5EA 4YQUA 2DJ0A 4WXTA 4G0KA 4IVFA 4K8MA 1F3BA 5G2ZA 2YOIA 1X5DA 2QA1A 4HJMA 4GXZA 4WF5A 5JCUA 1OE8A 3QOUA 1WE0A 4J56E 1RQMA 4WR4A 1ERTA 2R0GA 4Q5RA 2WS2A 4EUYA 3GFKA 2H30A 5HR3A 2H6YA 2DSAA 4N0ZA 4F0CA 4POLA 4PNFA 2HRKA 4O92A 5GSSA 2VL3A 1ML6A 1AIUA 4EDYA 2HRNA 2KUCA 1JZRA 2B1LA 4O32A 4POMA 2L6CA 1OKTA 1U3IA 3UMAA 5F0GA 3RDWA 1ST9A 5J41A 3ERWA 1M99A 2LNSA 3M0FA 3ZFLA 1XW5A 3FW2A 5ID2B 2IFQA 1M2DA 2JSZA 2H8LA 1ZZYA 3CRTA 4F9ZA 1PFOA 3GH6A 4ICYA 3CMIA 2WJUA 4X4JA 5DQYA 2L6DA 1B9XC 2VKZG 2H76A 4HU7A 3QPMA 4NAXA 2EFDA 3PR8A 1XBSA 1DSBA 4J2FA 3G7JA 1GUKA 2V6KA 4NV2A 2WW2A 2CX4A 4WKWA 2LJRA 1XZOA 4Z2RA 3VPTA 3VWUA 3WD6A 2RM5A 1S3RA 5D93A 3LJRA 5J47A 2CV4A 1JLWA 2H1LA 2VCZA 2VCQA 5E59A 3FR9A 4EIQA 4G10A 2CVDA 1ERUA 1T1VA 2WW1A 4KDYA 3IC8A 4F03A 2WCIA 3EMPA 4JE1A 4JEDA 1K3YA 5BMUB 4PI2C 3DVWA 2BMXA 1OVNA 6GSSA 5C04A 2LRTA 3HY2A 2O36A 4OCFA 1YZXA 5IMZA 4BPYA 1ON4A 4L8EA 4HJ2A 3H79A 2E0QA 3A5WA 1HNAA 3TKRA 3HZ8A 3EVIA 2KOKA 3K8NA 4DSSB 5J9CA 2RUEA 2PERA 2M72A 1BEDA 4ZB8A 1M2AA 4EKZA 2WGRA 4X0XA 3HVNA 1RK4A 1SYXA 5JWOB 2GSSA 2O7KA 2HSYA 2VLVA 2C0GA 2HNLA 4BL7B 4K5RA 2WW0A 3MDKA 3TJJA 4BWQA 4IW9A 6GSYA 3ZVJD 1EP8A 3GKNA 3EINA 3L9VA 2F51A 5KN2A 3GKXA 2H1GA 2LEGA 2DC5A 3FZAA 4ILFA 1GTIA 5AISA 2B7JA 1Z9HA 4WBJA 1E6BA 4V1Ag 3W8JA 3F4SA 1TW9A 3C73A 4CW9A 2IMIA 2P31A 1NW2A 2B1KA 1GTAA 4XRAA 5ELAA 4BVXA 4JU5A 5G31A 2H75A 3QAVA 4GSNA 3R2QA 4K5SA 5AIXA 2VCTA 4ECCA 3RGBC 2IMKA 3DXBA 3FKFA 2IIYA 1S4BP 2MZCA 9GSSA 2OT3A 1VF2A 3Q18A 4XRDA 3CRUA 5DDLA 3ZREA 3Q6OA 3ZIVA 4FO5A 5HQPA 3DMLA 4KCEA 2OACA 1BQ7A 3KP8A 4USSA 2CAQA 3KTBA 1S3AA 4MZCA 2JL4A 4OWYA 4JRRA 1X5CA 4XS4B 1AQVA 2QA2A 4CY8A 1MDKA 1C72A 2HFDA 2MMZA 2KHPA 2NVLA 4IS0A 1R26A 5J4UA 3FR6A 4I8BA 5ECNB 1GULA 3DYRA 6GSUA 2AJQB 3M1GA 1EEMA 2X8CA 3FK8A 4NWYA 4IGJA 2WFCA 3ERFA 3ZL5A 1SJ6A 2DJJA 2VL9A 3LW9A 2MBSA 3EURA 4GQFA 3ZTLA 4HZ2A 1MD3A 4TW5A 2HT9A 2CZ2A 2O89A 3TRPA 3TJKA 3F4RA 5H5SA 2RUFA 2L57A 4XTSA 3VK9A 4TRXA 1EV4A 3CTFA 2X49A 2G2QA 4N11A 1G7EA 1JZDA 5AIVA 3DIEA 5J3RA 1OC9A 3IPZA 3ERGA 2GTUA 1FO5A 4OFTA 4ZL9A 5CRGA 4LMVA 1PD21 3F6DA 1AW9A 3HKRA 4AKIA 4O7HA 5F07A 3APOA 2LS5A 5A4WA 3LEFA 2JADA 1XW9A 5KOWA 1SJZA 1XFLA 4D73B 1DBYA 5L71A 4ZXGA 3ZMLA 2I9HA 5ECSA 2C0EA 3DEXA 4RUVA 3TKQA 2HZEB 2E7PA 5LCZA 3QFBC 2X99A 5GAND 1BG5A 4XCSA 2IMFA 2HYXA 1AC1A 5CP1A 5EVOA 3E9JB 3ZIJA 3LGCA 2PBJA 2PVQA 1TI3A 2DKIA 1AXDA 4PUAA 5J9BA 5B8BA 5KEJA 5ECLB 1F9MA 4XIHA 1A0RP 2YWNA 3RPNA 4AJ7A 4BWSA 1XWCA 1K0MA 1FOVA 2QGVA 3ZITA 2YJ7A 1BYEA 1HD2A 3UOMA 2TRXA 5A1NB 2GDRA 3HYPA 4L0WA 3TOTA 4TXOA 1T8EB 2VLTA 2CVBA 1GLPA 4TR3A 1M2BA 3RPPA 1PN9A 1HQOA 1GUHA 2AAWA 4ZBAA 2EC4A 1PL1A 4E8HA 4O5QA 1S3CA 2AYTA 5F8BA 4KF9A 3ZMKA 1O7UA 1V98A 3LORA 1TK5B 2R6KA 4BVYA 5IPHA 4ZB6A 3C1RA 4TR1B 4G0LA 3IC4A 1GRXA 3G9BA 3IRAA 1V9WA 4F82A 1B4QA 1NM3A 2H01A 5DAKB 4KAEA 3VI5A 3HDCA 1YF1A 4MJEA 1YJ6A 5B6NA 4E8EA 4A5PA 1A8LA 4OO4A 3D22A 1DUGA 3CSIA 2X8HA 3CQFA 4POKA 5JCGA 4LL4B 2B6MA 4FH8A 1V58A 1HYUA 2AUVA 4ZB7A 1SKRB 2C3NA 2IMEA 2F8FA 3GA4A 1GNEA 2FD3A 3I43A 4I2TA 5LD0A 5GAPD 1FB0A 20GSA 2L4CA 4ECBA 2PPTA 2CAIA 4X43A 4BIKA 3APSA 2P0GA 2XHFA 4MH2A 22GSA 1Y1UA 2PMTA 1Q98A 4YKGA 3KGKA 2LUSA 5ECPB 5IIZA 4HEA2 1W4VA 3TKSE 2VL2C 1ERWA 1A2MA 5A4UA 3VWXA 1Q4JA 3UVHA 1GSDA 1PA3A 5G30A 2ON7A 3P90A 3GMFA 2A2SA 2C3TA 2CVKA 1KTEA 2OE1A 2V1MA 2B5EA 3GTUA 5FHIA 4CDOA 5A5HB 1Z5YE 2LKUA 3HJMA 2A2RA 2M46A 4AGSA 4PNGA 4G0IA 3GIXA 2L5OA 3GKKA 1YDKA 3D6IA 1EWXA 1TXUA 3A2XA 3GHAA 1DE2A 2O87A 2HSNB 3EE2A 4QL7A 1K3LA 4KSMA 1IYIA 4EIPA 2JZRA 1XWKA 4WETA 5ECRB 3TRXA 3HA9A 1VF1A 4ECJA 1HNBA 2YWMA 2C0DA 3P7XA 3VURA 3CSJA 3FY7A 1NSWA 4MJCA 4N3ZA 3MNGA 1MD4A 2PVOC 4Z2TA 3KTLA 1M0UA 3HVVA 4HS1A 4AF2A 1EGOA 2JU5A 4LMWA 3A2WA 3HD5A 1M3JA 2OKAA 2GT6A 2CQ9A 2YCDA 1O8XA 4KNDA 1QUWA 1XOAA 1R5AA 2HQTA 1X0RA 3CYNA 3O3TA 1XIYA 3MAKA 2R2JA 5JWQB 4V2MA 2QSIA 3NIVA 1AQXA 1UC7A 1LBKA 1VF3A 5D8IA 3TJGA 4L5OA 5LNKe 4ID0A 4LLRA 4TXVA 1QMVA 2YANA 5IPGA 1ZGNA 1M9BA 2LTKA 2L59A 3ZYWA 4HU9A 1WWJA 2M80A 4Q5FA 1XWGA 3M9JA 3KH9A 1MEKA 4GSSA 2HSMB 1WJKA 3BOAA 1R7HA 2KP2A 2MYGA 1U6TA 4GSTA 4GDFA 3BJ5A 5D73A 4HZ4A 3N5OA 1K0OA 2H1BA 2DJKA 2RLIA 5CO3A 1JZWA 4FQUA 6GSXA 4N30A 1J9BA 2YN1A 4POBA 3M3MA 3H93A 3FYGA 4HDEA 3IAM2 3FEUA 3GKMA 4QQ7A 2N5BA 2B7KA 3TJFA 2XC2A 5A34A 2HXKA 2YV9A 3CSHA 2LJAA 5AN1A 5IMVA 3H4KA 1UN2A 6GSTA 2VAFA 3PGTA 1V57A 3LWAA 3F9UA 5FT3A 3BCKA 1TTZA 12GSA 5IMFA 3C1SA 1A2JA 3TKPA 1S3DA 2ON5A 3G7IA 1O85A 1A2LA 4W66A 1T4ZA 3HJPA 1FW1A 5GSTA 1DE1A 4F2IA 3IDVA 4IJIA 2FWHA 1N8JA 3TGZA 5HFIA 2X8GA 2NDOA 5ECKB 1M7TA 1ABAA 1I1IP 3BCIA 5IOXA 3GX8A 3GUSA 4V2LA 1G6WA 4RI6A 5J4VA 2IPAA 4IBPA 2GS3A 3I9V2 1YEWC 2V6OA 4PQ1A 2WW3A 4L0UA 3WGEA 3GSTA 5C00A 4GRFA 3TU3B 4JR6A 2WVXA 4CHSA 4P3YB 5IMDA 1R5PA 2GSQA 2OJLA 3I69A 2HLSA 2FUG2 4HSCX 2H74A 5F05A 1Z7PA 3OR5A 4YKFA 1USBA 2VO4A 3C7MA 4G01A 1HNCA 1GUMA 4GWRA 4L5LA 2BTOT 4TR4A 1TI1A 2GGTA 1XWAA 1GSYA 1NHOA 4NXIA 4DEJA 2OADA 1PL2A 2GSTA 3RHBA 1W89A 2DMLA 5INYA 4PXOA 3WGDA 1U3AA 3UARA 5DJLA 3QD9A 4BA7A 5ECQB 2LSTA 7GSSA 2DMMA 5DALB 1SK0A 1ZYQB 1QK8A 3FRCA 4NV5A 4K7OA 2DIYA 4I97A 3LYPA 3S9FA 5G5EA 4LL1B 1SKWB 3DKSA 1PX6A 4ACSA 4KSOA 2V2GA 1A0FA 4WBRD 1CQGA 1TRVA 3CHXC 3ED3A 2K18A 2YP6A 4KDUA 4PI0C 3R3EA 2HI7A 1EOHA 3M9KA 2KLXA 1SYRA 1MDJA 3KMNA 2JSYA 2OA7A 1H75A 3IA1A 1GTUA 1ZOFA 5D9WA 1O8WA 2WZSA 4MDCA 2PWJA 1YEPA 3DRNA 3GURA 4K2XA 1UVZA 19GSA 3LYKA 2OE0A 3ZZXA 3QFAC 4AKGA 5ID2A 4PGTA 2K6VA 3EMXA 1FOHA 3I6AA 3VPQA 1Z3EA 2WB9A 1J0FA 2K8SA 4FYBA 5HR0A 3MSZA 5D9VA 3Q74A 4G9HA 2FA8A 2H70A 2XBQA 2OBIA 3GN3A 4GQCA 3C71A 4ZIJA 1A8YA 3US3A 3KEBA 4AJ8A 4NHZA 2VCXA 2AHEA 2H71A 13GSA 4MCUA 5HR2A 1F6MC 2H73A 4HI7A 4IELA 4MZBA 5DQSA 2YWIA 2IFQB 3L9UA 4MPFA 3LQ7A 4TVEA 3LXZA 3GSSA 2Z9SA 3ME7A 4IN0A 3PPUA 2VL2A 3UAPA 3D4TA 1THXA 2O3EA 2QKEA 2FWGA 4AI6A 1PKWA 4ZBBA 3EC3A 4AKXB 10GSA 2GQMA 5BMUA 2DIZA 2IL3A 2R37A 1SJIA 2MBTA 3KP9A 1N25A 1ZL9A 3BBYA 2UV8G 3F8UA 2MMNA 1XG8A 1Z6MA 2WDUA 3L0HA 1O6JA 4MP4A 4K7IA 11GSA 4FIWA 4WR5A 5EY6A 1ZYEA 1K0DA 4DSSA 8GSSA 2C4JA 3VWVA 1AQWA 1UA5A 5F06A 1TJDA 4IQAA 4EVMA 2FNOA 1SL2B 2P5QA 2FGXA 3F6FA 4JBBA 2B3SA 4N10A 2H0IA 3KXOA 1GWCA 5CNWA 4PHZC 4BL7A 2TIRA 2H1AA 16GSA 2DJ1A 2VCWA 2J9HA 4EDZA 2VCVA 2GZZA 3F3RA 5D9TA 3GYKA 3UL3A 4XS6A 1SENA 4XHMA 3VLNA 3HJOA 3UJ1A 2BJXA 2PN8A 4H86A 3G7YA 5IO2A 5IOWA 5CRHA 2RM6A 2WVZA 2A4VA 2X4AA 4OO5A 3A2VA 1GSQA 2WVYA 3TKSC 4I6XA 3VWWA 1JLVA 2B5XA 4NHWA 3RBTA 1OAZA 2VOCA 1RW1A 2FHEA 3SBCA 3EWLA 4MF6A 4MJBA 2EIQA 2F8AA 3EYTA 1FHEA 4MJAA 2H1DA 1AUCA 4ISDA 2I1UA 3HMJG 2NPBA 2IJYA 4KCAA 1TK8B 2R3XA 2EIOA 4Q5NA 3GL3A 3F0IA 4I5QA 4J57E 3CWGA 2YZUA 3UBLA 2C3QA 4ZILA 4EF0A 3VI7A 2IMDA 3ZLPA 3GNJA 2H6ZA 1TDIA 5ABRA 4XS4A 4FYUA 4AKHA 1XOBA 2LQOA 2WULA 2YNXA 4BVXB 5CRDA 1PMTA 1A23A 2I4AA 2H0GA 1WP0A 4EXJA 5COHA 1YEXA 5G5FA 3F3QA 3KM6A 1SU9A 1YVLA 3MYDA 2X64A 2DBCA 5A4VA 5CREA 1ZMAA 4IKHA 4QL9A 2R0PA 3LXTA 3LFLA 1MTCA 4V1Ap 1K0BA 4Z7XA 3QAWA 1G7OA 1JFUA 3IR4A 4EC0A 2TRCP 1GSSA 4K1FA 3GX0A 3FZ4A 3J7Yb 2HSHA 1XCCA 3D21A 3GL5A 2YWOA 3QR6A 2CZ3A 4K9ZA 3NOFA 2CX3A 2VUPA 3W6GA 3A3TA 4GLTA 2DJ3A 3L9SA 4KX4A 3F4TA 4OFNA 4MA9A 1PX7A 2ZCTA 4MLYA 4PQIA 4JZQA 3TDGA 1B48A 1BX9A 5EPFA 1YKCA 2EIRA 3Q19A 3P8WA 5JCWA 3AY8A 2QC7A 3APQA 3FZ9A 2I81A 5IMCA 3KCMA 3W8SA 2F3MA 4ZL7A 4MK3A 3H1NA 2UZ8A 3HHVA 1TU8A 3IE3A 4ML1A 3EU4A 5J4YA 3TRQA 3C8EA 2FCHA 4D73A 1WMJA 2JZTA 4K6XA 1U88A 1YKAA 2FWFA 2HZEA 4MZWA 1M3IA 1ZCPA 4O5RA 1V2AA 5B8AA 4G19A 1FVJA 2HRAA 1K0CA 2GQKA 1URMA 4KUNA 3ISOA 3DVXA 3GRXA 1QXHA 1OE7A 3EU3A 1OC9B 2ES7A 4Q5QA 4WEYA 5KN0A 1FAAA 4DSRA 1TU7A 2HRFA 5HFGA 3F63A 1WRYA 2LRCA 1QFNA 5DCHA 6GSWA 4IQ1A 3D4MA 4DSQA 2YZHA 4MF7A 2HZFA 1WOUA 1U87A 2MMOA 1J08A 3D0ZA 3WT1A 1V40A 5J5NA 1IYHA 1JHBA 3KH7A 1B4PA 3IK9A 4YQMA 2GVPA 4O5UA 2D2ZA 1BG1A 4PQHA 1EZKA 2FWEA 4OD7A 4X1UA 5A1NA 2RIIA 4HQSA 3IK7A 2JZSA 1B9YC
chains in the Genus database with same CATH topology
3IAS2 1YQ1A 4IJ3A 1GP1A 5DBQA 3V1WA 5CYYA 5CRWA 4ML6A 1F37A 4YQVA 1SVLA 3LG6A 1O73A 2EFEA 2C0FA 3WYWA 5DJMA 1OC8A 4QMKA 3TUEA 2ALBA 4KB3A 3N9JA 5D96A 1XWBA 4TR1A 1TRUA 2C1YA 1B8XA 2O85A 1SVOA 1M9AA 2JACA 3HVSA 2DKHA 1H4OA 5BRTA 1K0NA 4OMVA 1T00A 5DAKA 3ZFBA 2C8UA 3KZQA 4TKYA 1O81A 1E2YA 1YY7A 3D5JA 3L4NA 4MF5A 2OBKA 1ZYNA 1BAYA 2B5YA 2K9FA 4TXOB 2IN3A 1LJRA 2DJ2A 1YF0A 1GSFA 3IHGA 1TOFA 5FWGA 5ECMB 1I9DA 3NZNA 2YPMA 1A24A 2GT5A 2A4HA 1F2EA 3M8NA 4YAPA 1FG4A 1WPIA 4NMUA 2AV4A 3DD3A 1VGLA 2R0CA 2YV7A 2LJKA 1ERVA 4I2UA 3QAGA 4BVYB 3ZVJA 4GTUA 4KH7A 2VM1A 3FR3A 1EOGA 1GSUA 3TCOA 3FMWA 1TK0B 1EV9A 3GH9A 5CAXA 1G0TA 4CY6A 3U5RE 17GSA 2YJHA 3QMXA 3GV1A 5ENUA 2FLSA 4TR0A 3L78A 1GLQA 1EP7A 5ECHB 2H72A 5A5HA 1MDIA 1GSEA 2C80A 2XPDA 2VD1A 1WIKA 2L4QA 4MH3A 2GSRA 1SD8A 4K0NA 3DGQA 2R4VA 1T7PB 2HSNA 2V32A 4ECIA 4HQZA 2HE3A 2AB6A 4MNNA 1GNWA 1F3AA 1SVMA 1XVQA 4AJ6A 1ILOA 1TRWA 3HCZA 1FB6A 1XPVA 4ZL8A 2G0FA 2PUKC 1GL8A 5HFKA 1I5GA 2CT6A 3O6TA 1TRSA 4YH2A 1R4WA 1OKDA 3KD0A 3HXSA 3GTUB 1SL0B 1N2AA 5DCGA 5H5RA 3SWLA 2LQQA 1FVKA 1KBNA 2E2MA 3A5IA 2PU9C 4RQRA 2CA8A 4KA0A 2H6XA 3HZ4A 4YAVA 3TKSA 4RI7A 4EO3A 1SL1B 3VFIA 2VLUA 4MMMA 1LU4A 4EE0A 1PKZA 4XS1A 5A5KA 4PTSA 2HRKB 2VIMA 4EL1A 1K0AA 4IP1A 1OYJA 1X9MB 5ECOB 4OCEA 5AGYA 5IMAA 5B6MA 2E2GA 4HUAA 5DVBA 3HVXA 1T4YA 3BD2A 4Z2UA 4G2EA 3QDNA 1OC3A 5KN3A 5HR1A 2NBSA 5EL8A 3O76A 2HSMA 2EFHA 4HOJA 2F9SA 2L5LA 2XPEA 2N5AA 2EFCA 3ME8A 2A2PA 3TOUA 4E68A 1PN0A 5KN1A 1QGVA 3P2AA 3TJBA 2IWTA 3IV4A 1XXUA 2MMAA 3UBKA 3IHQA 1X9WB 2FY6A 2H66A 3H8QA 3CXGA 3IOSA 3LSZA 1PGTA 4K7NA 2O5VA 3IBHA 4KGIA 2N5FA 4PURA 2OE3A 5JWRB 2VM2A 4TN8A 2V41A 1VRSD 2H0HA 2REMA 1QQ2A 4IP6A 2ZUPA 3UEMA 1GH2A 14GSA 3JCML 4K0GA 2PGTA 5ELGA 18GSA 1THOA 3DWVA 2GZPA 1TKDB 1EGRA 4DVCA 2WRTA 3CBUA 2H19A 1NHYA 1SK1A 3RHCA 3U6VA 6GSVA 2GQLA 5IQYA 4OFMA 4ULXA 5IO0A 3UVTA 3RAZA 4WF4A 4MPGA 1PRXA 5A34B 2FA4A 5KOXA 4PX1A 4F0BA 2I3YA 1PSQA 3MWHA 3PH9A 2GLRA 1SK2A 5B7CA 2R5GA 2J23A 1T3BA 4NPBA 1Z7RA 5D9XA 3IXRA 4RQXA 3KJYA 1KEBA 3J7Yk 3PINA 4GCIA 2WZ9A 5H5QA 2P5RA 4MABA 2ZNMA 3ZRDA 1JZOA 1BJXA 4IHUA 2LRNA 1XVWA 5IM9A 1X9SB 2KP1A 5GZZB 1ACVA 2DLXA 4ZB9A 1TXXA 1GTBA 4GF0A 4JR4A 5G1LA 3UIWA 1TP9A 2XBIA 4PUFC 1G6YA 2O8VB 4TOPA 5J40A 4FYCA 1VF4A 1SKSB 2NTOA 1Z6NA 3TB2A 3FZ5A 3MIXA 1ZYPA 5E4WA 5DALA 1KNGA 4KW6A 1CQHA 4K2DA 5ECIB 2LNTA 3E3EA 2K8VA 1AAZA 3WGXA 4LA1A 1Y6EA 4KE3A 3CTGA 3QCPA 4N0VA 1SD9A 1PQNA 5G1KA 1XW6A 4ZBDA 1EEJA 3WT2A 2GZYA 3KMOA 1Y25A 3EPTA 3KIJA 1K3OA 4KDXA 2LV3A 4V2NA 2VD0A 3E0UA 3FHKA 1BF5A 1X5EA 4YQUA 2DJ0A 4WXTA 4G0KA 4IVFA 4K8MA 1F3BA 5G2ZA 2YOIA 1X5DA 2QA1A 4HJMA 4GXZA 4WF5A 5JCUA 1OE8A 3QOUA 1WE0A 4J56E 1RQMA 4WR4A 1ERTA 2R0GA 4Q5RA 2WS2A 4EUYA 3GFKA 2H30A 5HR3A 2H6YA 2DSAA 4N0ZA 4F0CA 4POLA 4PNFA 2HRKA 4O92A 5GSSA 2VL3A 1ML6A 1AIUA 4EDYA 2HRNA 2KUCA 1JZRA 2B1LA 4O32A 4POMA 2L6CA 1OKTA 1U3IA 3UMAA 5F0GA 3RDWA 1ST9A 5J41A 3ERWA 1M99A 2LNSA 3M0FA 3ZFLA 1XW5A 3FW2A 5ID2B 2IFQA 1M2DA 2JSZA 2H8LA 1ZZYA 3CRTA 4F9ZA 3GH6A 4ICYA 3CMIA 2WJUA 4X4JA 5DQYA 2L6DA 1B9XC 2VKZG 2H76A 4HU7A 3QPMA 4NAXA 2EFDA 3PR8A 1XBSA 1DSBA 4J2FA 3G7JA 1GUKA 2V6KA 4NV2A 2CX4A 4WKWA 2LJRA 1XZOA 4Z2RA 3VPTA 3VWUA 3WD6A 2RM5A 5D93A 3LJRA 5J47A 2CV4A 1JLWA 2H1LA 2VCZA 2VCQA 5E59A 3FR9A 4EIQA 4G10A 2CVDA 1ERUA 1T1VA 4KDYA 3IC8A 4F03A 2WCIA 3EMPA 4JE1A 4JEDA 1K3YA 5BMUB 3DVWA 2BMXA 1OVNA 6GSSA 5C04A 2LRTA 3HY2A 4OCFA 1YZXA 5IMZA 4BPYA 1ON4A 4L8EA 4HJ2A 3H79A 2E0QA 3A5WA 1HNAA 3TKRA 3HZ8A 3EVIA 2KOKA 3K8NA 4DSSB 5J9CA 2RUEA 2PERA 2M72A 1BEDA 4ZB8A 1M2AA 4EKZA 2WGRA 4X0XA 1RK4A 1SYXA 5JWOB 2GSSA 2O7KA 2HSYA 2VLVA 2C0GA 2HNLA 4BL7B 4K5RA 3MDKA 3TJJA 4BWQA 4IW9A 6GSYA 3ZVJD 1EP8A 3GKNA 3EINA 3L9VA 2F51A 5KN2A 3GKXA 2H1GA 2LEGA 2DC5A 3FZAA 4ILFA 1GTIA 5AISA 2B7JA 1Z9HA 4WBJA 1E6BA 4V1Ag 3W8JA 3F4SA 1TW9A 3C73A 4CW9A 2IMIA 2P31A 1NW2A 2B1KA 1GTAA 4XRAA 5ELAA 4BVXA 4JU5A 5G31A 2H75A 3QAVA 4GSNA 3R2QA 4K5SA 5AIXA 2VCTA 4ECCA 2IMKA 3DXBA 3FKFA 2IIYA 2MZCA 9GSSA 2OT3A 1VF2A 3Q18A 4XRDA 3CRUA 5DDLA 3ZREA 3Q6OA 3ZIVA 4FO5A 5HQPA 3DMLA 4KCEA 2OACA 1BQ7A 3KP8A 4USSA 2CAQA 3KTBA 1S3AA 4MZCA 2JL4A 4OWYA 4JRRA 1X5CA 4XS4B 1AQVA 2QA2A 4CY8A 1MDKA 1C72A 2HFDA 2MMZA 2KHPA 2NVLA 4IS0A 1R26A 5J4UA 3FR6A 4I8BA 5ECNB 1GULA 3DYRA 6GSUA 2AJQB 3M1GA 1EEMA 2X8CA 3FK8A 4NWYA 4IGJA 2WFCA 3ERFA 3ZL5A 1SJ6A 2DJJA 2VL9A 3LW9A 2MBSA 3EURA 4GQFA 3ZTLA 4HZ2A 1MD3A 4TW5A 2HT9A 2CZ2A 2O89A 3TRPA 3TJKA 3F4RA 5H5SA 2RUFA 2L57A 4XTSA 3VK9A 4TRXA 1EV4A 3CTFA 2X49A 2G2QA 4N11A 1G7EA 1JZDA 5AIVA 3DIEA 5J3RA 1OC9A 3IPZA 3ERGA 2GTUA 1FO5A 4OFTA 4ZL9A 5CRGA 4LMVA 1PD21 3F6DA 1AW9A 3HKRA 4AKIA 4O7HA 5F07A 3APOA 2LS5A 5A4WA 3LEFA 2JADA 1XW9A 5KOWA 1SJZA 1XFLA 4D73B 1DBYA 5L71A 4ZXGA 3ZMLA 2I9HA 5ECSA 2C0EA 3DEXA 4RUVA 3TKQA 2HZEB 2E7PA 5LCZA 3QFBC 2X99A 5GAND 1BG5A 4XCSA 2IMFA 2HYXA 1AC1A 5CP1A 5EVOA 3E9JB 3ZIJA 3LGCA 2PBJA 2PVQA 1TI3A 2DKIA 1AXDA 4PUAA 5J9BA 5B8BA 5KEJA 5ECLB 1F9MA 4XIHA 1A0RP 2YWNA 3RPNA 4AJ7A 4BWSA 1XWCA 1K0MA 1FOVA 2QGVA 3ZITA 2YJ7A 1BYEA 1HD2A 3UOMA 2TRXA 5A1NB 2GDRA 3HYPA 4L0WA 3TOTA 4TXOA 1T8EB 2VLTA 2CVBA 1GLPA 4TR3A 1M2BA 3RPPA 1PN9A 1HQOA 1GUHA 2AAWA 4ZBAA 2EC4A 1PL1A 4E8HA 4O5QA 1S3CA 2AYTA 5F8BA 4KF9A 3ZMKA 1O7UA 1V98A 3LORA 1TK5B 2R6KA 4BVYA 5IPHA 4ZB6A 3C1RA 4TR1B 4G0LA 3IC4A 1GRXA 3G9BA 3IRAA 1V9WA 4F82A 1B4QA 1NM3A 2H01A 5DAKB 4KAEA 3VI5A 3HDCA 1YF1A 4MJEA 1YJ6A 5B6NA 4E8EA 4A5PA 1A8LA 4OO4A 3D22A 1DUGA 3CSIA 2X8HA 4POKA 5JCGA 4LL4B 2B6MA 4FH8A 1V58A 1HYUA 2AUVA 4ZB7A 1SKRB 2C3NA 2IMEA 2F8FA 3GA4A 1GNEA 2FD3A 3I43A 4I2TA 5LD0A 5GAPD 1FB0A 20GSA 2L4CA 4ECBA 2PPTA 2CAIA 4X43A 3APSA 2P0GA 2XHFA 4MH2A 22GSA 1Y1UA 2PMTA 1Q98A 4YKGA 3KGKA 2LUSA 5ECPB 5IIZA 4HEA2 1W4VA 3TKSE 2VL2C 1ERWA 1A2MA 5A4UA 3VWXA 1Q4JA 3UVHA 1GSDA 1PA3A 5G30A 2ON7A 3P90A 3GMFA 2A2SA 2C3TA 2CVKA 1KTEA 2OE1A 2V1MA 2B5EA 3GTUA 5FHIA 4CDOA 5A5HB 1Z5YE 2LKUA 3HJMA 2A2RA 2M46A 4AGSA 4PNGA 4G0IA 3GIXA 2L5OA 3GKKA 1YDKA 3D6IA 1EWXA 1TXUA 3A2XA 3GHAA 1DE2A 2O87A 2HSNB 3EE2A 4QL7A 1K3LA 4KSMA 1IYIA 4EIPA 2JZRA 1XWKA 4WETA 5ECRB 3TRXA 3HA9A 1VF1A 4ECJA 1HNBA 2YWMA 2C0DA 3P7XA 3VURA 3CSJA 3FY7A 1NSWA 4MJCA 4N3ZA 3MNGA 1MD4A 2PVOC 4Z2TA 3KTLA 1M0UA 3HVVA 4HS1A 4AF2A 1EGOA 2JU5A 4LMWA 3A2WA 3HD5A 2OKAA 2GT6A 2CQ9A 2YCDA 1O8XA 4KNDA 1QUWA 1XOAA 1R5AA 2HQTA 1X0RA 3CYNA 3O3TA 1XIYA 3MAKA 2R2JA 5JWQB 4V2MA 2QSIA 3NIVA 1AQXA 1UC7A 1LBKA 1VF3A 5D8IA 3TJGA 4L5OA 5LNKe 4ID0A 4LLRA 4TXVA 1QMVA 2YANA 5IPGA 1ZGNA 1M9BA 2LTKA 2L59A 3ZYWA 4HU9A 1WWJA 2M80A 4Q5FA 1XWGA 3M9JA 3KH9A 1MEKA 4GSSA 2HSMB 1WJKA 3BOAA 1R7HA 2KP2A 2MYGA 1U6TA 4GSTA 4GDFA 3BJ5A 5D73A 4HZ4A 3N5OA 1K0OA 2H1BA 2DJKA 2RLIA 5CO3A 1JZWA 4FQUA 6GSXA 4N30A 1J9BA 2YN1A 4POBA 3M3MA 3H93A 3FYGA 4HDEA 3IAM2 3FEUA 3GKMA 4QQ7A 2N5BA 2B7KA 3TJFA 2XC2A 5A34A 2HXKA 2YV9A 3CSHA 2LJAA 5AN1A 5IMVA 3H4KA 1UN2A 6GSTA 2VAFA 3PGTA 1V57A 3LWAA 3F9UA 5FT3A 3BCKA 1TTZA 12GSA 5IMFA 3C1SA 1A2JA 3TKPA 1S3DA 2ON5A 3G7IA 1O85A 1A2LA 4W66A 1T4ZA 3HJPA 1FW1A 5GSTA 1DE1A 4F2IA 3IDVA 4IJIA 2FWHA 1N8JA 3TGZA 5HFIA 2X8GA 2NDOA 5ECKB 1M7TA 1ABAA 5IOXA 3BCIA 3GX8A 3GUSA 4V2LA 1G6WA 4RI6A 5J4VA 2IPAA 4IBPA 2GS3A 3I9V2 2V6OA 4PQ1A 4L0UA 3WGEA 3GSTA 5C00A 4GRFA 3TU3B 4JR6A 4CHSA 4P3YB 5IMDA 1R5PA 2GSQA 2OJLA 3I69A 2HLSA 2FUG2 2H74A 5F05A 1Z7PA 3OR5A 4YKFA 1USBA 2VO4A 3C7MA 4G01A 1HNCA 1GUMA 4GWRA 4L5LA 2BTOT 4TR4A 1TI1A 2GGTA 1XWAA 1GSYA 1NHOA 4NXIA 4DEJA 2OADA 1PL2A 2GSTA 3RHBA 1W89A 2DMLA 5INYA 4PXOA 3WGDA 1U3AA 3UARA 5DJLA 3QD9A 4BA7A 5ECQB 2LSTA 7GSSA 2DMMA 5DALB 1SK0A 1ZYQB 1QK8A 3FRCA 4NV5A 4K7OA 2DIYA 4I97A 3LYPA 3S9FA 5G5EA 4LL1B 1SKWB 3DKSA 1PX6A 4ACSA 4KSOA 2V2GA 1A0FA 4WBRD 1CQGA 1TRVA 3ED3A 2K18A 2YP6A 4KDUA 3R3EA 2HI7A 1EOHA 3M9KA 2KLXA 1SYRA 1MDJA 3KMNA 2JSYA 2OA7A 1H75A 3IA1A 1GTUA 1ZOFA 5D9WA 1O8WA 4MDCA 2PWJA 1YEPA 3DRNA 3GURA 4K2XA 1UVZA 19GSA 3LYKA 2OE0A 3ZZXA 3QFAC 4AKGA 5ID2A 4PGTA 2K6VA 3EMXA 1FOHA 3I6AA 3VPQA 1Z3EA 2WB9A 1J0FA 2K8SA 4FYBA 5HR0A 3MSZA 5D9VA 3Q74A 4G9HA 2FA8A 2H70A 2XBQA 2OBIA 3GN3A 4GQCA 3C71A 4ZIJA 1A8YA 3US3A 3KEBA 4AJ8A 4NHZA 2VCXA 2AHEA 2H71A 13GSA 4MCUA 5HR2A 1F6MC 2H73A 4HI7A 4IELA 4MZBA 5DQSA 2YWIA 2IFQB 3L9UA 4MPFA 3LQ7A 4TVEA 3LXZA 3GSSA 2Z9SA 3ME7A 4IN0A 3PPUA 2VL2A 3UAPA 3D4TA 1THXA 2QKEA 2FWGA 4AI6A 1PKWA 4ZBBA 3EC3A 4AKXB 10GSA 2GQMA 5BMUA 2DIZA 2IL3A 2R37A 1SJIA 2MBTA 3KP9A 1N25A 1ZL9A 3BBYA 2UV8G 3F8UA 2MMNA 1Z6MA 2WDUA 3L0HA 1O6JA 4MP4A 4K7IA 11GSA 4FIWA 4WR5A 5EY6A 1ZYEA 1K0DA 4DSSA 8GSSA 2C4JA 3VWVA 1AQWA 1UA5A 5F06A 1TJDA 4IQAA 4EVMA 2FNOA 1SL2B 2P5QA 2FGXA 3F6FA 4JBBA 2B3SA 4N10A 2H0IA 3KXOA 1GWCA 5CNWA 4BL7A 2TIRA 2H1AA 16GSA 2DJ1A 2VCWA 2J9HA 4EDZA 2VCVA 2GZZA 3F3RA 5D9TA 3GYKA 3UL3A 4XS6A 1SENA 4XHMA 3VLNA 3HJOA 3UJ1A 2BJXA 2PN8A 4H86A 3G7YA 5IO2A 5IOWA 5CRHA 2RM6A 2A4VA 2X4AA 4OO5A 3A2VA 1GSQA 3TKSC 4I6XA 3VWWA 1JLVA 2B5XA 4NHWA 3RBTA 1OAZA 2VOCA 1RW1A 2FHEA 3SBCA 3EWLA 4MF6A 4MJBA 2EIQA 2F8AA 3EYTA 1FHEA 4MJAA 2H1DA 1AUCA 4ISDA 2I1UA 3HMJG 2NPBA 2IJYA 4KCAA 1TK8B 2R3XA 2EIOA 4Q5NA 3GL3A 3F0IA 4I5QA 4J57E 3CWGA 2YZUA 3UBLA 2C3QA 4ZILA 4EF0A 3VI7A 2IMDA 3ZLPA 3GNJA 2H6ZA 1TDIA 5ABRA 4XS4A 4FYUA 4AKHA 1XOBA 2LQOA 2WULA 2YNXA 4BVXB 5CRDA 1PMTA 1A23A 2I4AA 2H0GA 1WP0A 4EXJA 5COHA 1YEXA 5G5FA 3F3QA 3KM6A 1SU9A 1YVLA 3MYDA 2X64A 2DBCA 5A4VA 5CREA 1ZMAA 4IKHA 4QL9A 2R0PA 3LXTA 3LFLA 1MTCA 4V1Ap 1K0BA 4Z7XA 3QAWA 1G7OA 1JFUA 3IR4A 4EC0A 2TRCP 1GSSA 4K1FA 3GX0A 3FZ4A 3J7Yb 2HSHA 1XCCA 3D21A 3GL5A 2YWOA 3QR6A 2CZ3A 4K9ZA 3NOFA 2CX3A 2VUPA 3W6GA 3A3TA 4GLTA 2DJ3A 3L9SA 4KX4A 3F4TA 4OFNA 4MA9A 1PX7A 2ZCTA 4MLYA 4PQIA 4JZQA 3TDGA 1B48A 1BX9A 5EPFA 1YKCA 2EIRA 3Q19A 3P8WA 5JCWA 3AY8A 2QC7A 3APQA 3FZ9A 2I81A 5IMCA 3KCMA 3W8SA 2F3MA 4ZL7A 4MK3A 3H1NA 2UZ8A 3HHVA 1TU8A 3IE3A 4ML1A 3EU4A 5J4YA 3TRQA 3C8EA 2FCHA 4D73A 1WMJA 2JZTA 4K6XA 1U88A 1YKAA 2FWFA 2HZEA 4MZWA 1ZCPA 4O5RA 1V2AA 5B8AA 4G19A 1FVJA 2HRAA 1K0CA 2GQKA 1URMA 4KUNA 3ISOA 3DVXA 3GRXA 1QXHA 1OE7A 3EU3A 1OC9B 2ES7A 4Q5QA 4WEYA 5KN0A 1FAAA 4DSRA 1TU7A 2HRFA 5HFGA 3F63A 1WRYA 2LRCA 1QFNA 5DCHA 6GSWA 4IQ1A 3D4MA 4DSQA 2YZHA 4MF7A 2HZFA 1WOUA 1U87A 2MMOA 1J08A 3D0ZA 3WT1A 1V40A 5J5NA 1IYHA 1JHBA 3KH7A 1B4PA 3IK9A 4YQMA 2GVPA 4O5UA 2D2ZA 1BG1A 4PQHA 1EZKA 2FWEA 4OD7A 4X1UA 5A1NA 2RIIA 4HQSA 3IK7A 2JZSA 1B9YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAS 2;  1YQ1 A;  4IJ3 A;  1GP1 A;  5DBQ A;  3V1W A;  5CYY A;  5CRW A;  4ML6 A;  1F37 A;  4YQV A;  1O73 A;  3LG6 A;  2C0F A;  3WYW A;  5DJM A;  1OC8 A;  3TUE A;  2ALB A;  4KB3 A;  3N9J A;  5D96 A;  1XWB A;  4TR1 A;  1TRU A;  2C1Y A;  1B8X A;  2O85 A;  1M9A A;  2JAC A;  3HVS A;  1H4O A;  1K0N A;  4OMV A;  1T00 A;  5DAK A;  3ZFB A;  2C8U A;  3KZQ A;  4TKY A;  1O81 A;  1E2Y A;  1YY7 A;  3D5J A;  3L4N A;  4MF5 A;  2OBK A;  1BAY A;  2B5Y A;  2K9F A;  4TXO B;  2IN3 A;  1LJR A;  2DJ2 A;  1YF0 A;  1GSF A;  1TOF A;  5FWG A;  5ECM B;  1I9D A;  3NZN A;  2YPM A;  1A24 A;  2GT5 A;  1F2E A;  3M8N A;  4YAP A;  1FG4 A;  1WPI A;  4NMU A;  2AV4 A;  3DD3 A;  1VGL A;  2YV7 A;  2LJK A;  1ERV A;  4I2U A;  3QAG A;  4BVY B;  3ZVJ A;  4GTU A;  4KH7 A;  2VM1 A;  3FR3 A;  1EOG A;  1GSU A;  3TCO A;  1TK0 B;  1EV9 A;  3GH9 A;  5CAX A;  1G0T A;  3U5R E;  17GS A;  2YJH A;  3QMX A;  3GV1 A;  5ENU A;  2FLS A;  4TR0 A;  3L78 A;  1GLQ A;  1EP7 A;  5ECH B;  2H72 A;  1MDI A;  1GSE A;  2C80 A;  2XPD A;  2VD1 A;  1WIK A;  2L4Q A;  4MH3 A;  2GSR A;  1SD8 A;  4K0N A;  3DGQ A;  2R4V A;  1T7P B;  2V32 A;  4ECI A;  4HQZ A;  2HE3 A;  2AB6 A;  1GNW A;  1F3A A;  1XVQ A;  4AJ6 A;  1ILO A;  1TRW A;  3HCZ A;  1FB6 A;  1XPV A;  4ZL8 A;  2G0F A;  2PUK C;  1GL8 A;  5HFK A;  1I5G A;  2CT6 A;  3O6T A;  1TRS A;  4YH2 A;  1R4W A;  1OKD A;  3KD0 A;  3HXS A;  3GTU B;  1SL0 B;  1N2A A;  5DCG A;  5H5R A;  3SWL A;  2LQQ A;  1FVK A;  1KBN A;  2E2M A;  2PU9 C;  4RQR A;  2CA8 A;  4KA0 A;  2H6X A;  3HZ4 A;  4YAV A;  3TKS A;  4RI7 A;  4EO3 A;  1SL1 B;  3VFI A;  2VLU A;  4MMM A;  1LU4 A;  4EE0 A;  1PKZ A;  4XS1 A;  5A5K A;  4PTS A;  2HRK B;  2VIM A;  4EL1 A;  1K0A A;  4IP1 A;  1OYJ A;  1X9M B;  5ECO B;  4OCE A;  5AGY A;  5IMA A;  5B6M A;  2E2G A;  4HUA A;  5DVB A;  3HVX A;  1T4Y A;  3BD2 A;  4G2E A;  3QDN A;  1OC3 A;  5KN3 A;  5HR1 A;  2NBS A;  5EL8 A;  3O76 A;  2HSM A;  4HOJ A;  2F9S A;  2L5L A;  2XPE A;  2N5A A;  3ME8 A;  3TOU A;  5KN1 A;  1QGV A;  3P2A A;  3TJB A;  2IWT A;  3IV4 A;  1XXU A;  2MMA A;  3UBK A;  3IHQ A;  1X9W B;  2FY6 A;  2H66 A;  3H8Q A;  3CXG A;  3IOS A;  3LSZ A;  1PGT A;  4K7N A;  3IBH A;  4KGI A;  2N5F A;  4PUR A;  2OE3 A;  5JWR B;  2VM2 A;  4TN8 A;  2V41 A;  1VRS D;  2H0H A;  2REM A;  1QQ2 A;  4IP6 A;  2ZUP A;  3UEM A;  1GH2 A;  14GS A;  3JCM L;  4K0G A;  2PGT A;  5ELG A;  18GS A;  1THO A;  3DWV A;  2GZP A;  1TKD B;  1EGR A;  4DVC A;  2WRT A;  3CBU A;  2H19 A;  1NHY A;  1SK1 A;  3RHC A;  3U6V A;  6GSV A;  2GQL A;  5IQY A;  4OFM A;  4ULX A;  5IO0 A;  3UVT A;  3RAZ A;  4WF4 A;  4MPG A;  1PRX A;  2FA4 A;  4PX1 A;  4F0B A;  2I3Y A;  1PSQ A;  3MWH A;  3PH9 A;  2GLR A;  1SK2 A;  5B7C A;  2R5G A;  2J23 A;  1T3B A;  4NPB A;  1Z7R A;  5D9X A;  3IXR A;  4RQX A;  3KJY A;  1KEB A;  3J7Y k;  3PIN A;  4GCI A;  2WZ9 A;  5H5Q A;  2P5R A;  4MAB A;  2ZNM A;  3ZRD A;  1JZO A;  1BJX A;  4IHU A;  2LRN A;  1XVW A;  5IM9 A;  1X9S B;  2KP1 A;  5GZZ B;  1ACV A;  2DLX A;  4ZB9 A;  1TXX A;  1GTB A;  4GF0 A;  4JR4 A;  5G1L A;  3UIW A;  1TP9 A;  2XBI A;  4PUF C;  1G6Y A;  2O8V B;  4TOP A;  4FYC A;  1VF4 A;  1SKS B;  2NTO A;  1Z6N A;  3TB2 A;  3FZ5 A;  5E4W A;  5DAL A;  1KNG A;  4KW6 A;  1CQH A;  4K2D A;  5ECI B;  2LNT A;  3E3E A;  2K8V A;  1AAZ A;  3WGX A;  4LA1 A;  1Y6E A;  4KE3 A;  3CTG A;  3QCP A;  4N0V A;  1SD9 A;  1PQN A;  5G1K A;  1XW6 A;  4ZBD A;  1EEJ A;  3WT2 A;  2GZY A;  3KMO A;  1Y25 A;  3KIJ A;  1K3O A;  4KDX A;  2LV3 A;  4V2N A;  2VD0 A;  3E0U A;  3FHK A;  1X5E A;  4YQU A;  2DJ0 A;  4WXT A;  4G0K A;  4IVF A;  4K8M A;  1F3B A;  5G2Z A;  2YOI A;  1X5D A;  4HJM A;  4GXZ A;  4WF5 A;  5JCU A;  1OE8 A;  3QOU A;  1WE0 A;  4J56 E;  1RQM A;  4WR4 A;  1ERT A;  4Q5R A;  2WS2 A;  4EUY A;  3GFK A;  2H30 A;  5HR3 A;  2H6Y A;  2DSA A;  4N0Z A;  4F0C A;  4POL A;  4PNF A;  2HRK A;  4O92 A;  5GSS A;  2VL3 A;  1ML6 A;  1AIU A;  4EDY A;  2HRN A;  2KUC A;  1JZR A;  2B1L A;  4O32 A;  4POM A;  2L6C A;  1OKT A;  1U3I A;  3UMA A;  5F0G A;  3RDW A;  1ST9 A;  5J41 A;  3ERW A;  1M99 A;  2LNS A;  3M0F A;  3ZFL A;  1XW5 A;  3FW2 A;  5ID2 B;  2IFQ A;  1M2D A;  2JSZ A;  2H8L A;  1ZZY A;  3CRT A;  4F9Z A;  3GH6 A;  3CMI A;  2WJU A;  5DQY A;  2L6D A;  1B9X C;  2H76 A;  4HU7 A;  3QPM A;  4NAX A;  3PR8 A;  1XBS A;  1DSB A;  4J2F A;  3G7J A;  1GUK A;  2V6K A;  4NV2 A;  2CX4 A;  4WKW A;  2LJR A;  1XZO A;  3VPT A;  3VWU A;  3WD6 A;  2RM5 A;  5D93 A;  3LJR A;  2CV4 A;  1JLW A;  2VCZ A;  2VCQ A;  5E59 A;  3FR9 A;  4G10 A;  2CVD A;  1ERU A;  1T1V A;  4KDY A;  3IC8 A;  4F03 A;  2WCI A;  3EMP A;  4JE1 A;  4JED A;  1K3Y A;  3DVW A;  2BMX A;  1OVN A;  6GSS A;  5C04 A;  2LRT A;  3HY2 A;  4OCF A;  1YZX A;  5IMZ A;  4BPY A;  1ON4 A;  4L8E A;  4HJ2 A;  3H79 A;  2E0Q A;  3A5W A;  1HNA A;  3TKR A;  3HZ8 A;  3EVI A;  2KOK A;  3K8N A;  4DSS B;  5J9C A;  2RUE A;  2PER A;  2M72 A;  1BED A;  4ZB8 A;  1M2A A;  4EKZ A;  2WGR A;  4X0X A;  1RK4 A;  1SYX A;  5JWO B;  2GSS A;  2O7K A;  2HSY A;  2VLV A;  2C0G A;  2HNL A;  4BL7 B;  3MDK A;  3TJJ A;  4BWQ A;  4IW9 A;  6GSY A;  3ZVJ D;  1EP8 A;  3GKN A;  3EIN A;  3L9V A;  2F51 A;  5KN2 A;  3GKX A;  2H1G A;  2LEG A;  2DC5 A;  3FZA A;  4ILF A;  1GTI A;  5AIS A;  2B7J A;  1Z9H A;  4WBJ A;  1E6B A;  4V1A g;  3W8J A;  3F4S A;  1TW9 A;  3C73 A;  4CW9 A;  2IMI A;  2P31 A;  1NW2 A;  2B1K A;  1GTA A;  4XRA A;  5ELA A;  4JU5 A;  4BVX A;  5G31 A;  2H75 A;  3QAV A;  4GSN A;  3R2Q A;  5AIX A;  2VCT A;  4ECC A;  2IMK A;  3DXB A;  3FKF A;  2IIY A;  2MZC A;  9GSS A;  1VF2 A;  3Q18 A;  4XRD A;  3CRU A;  5DDL A;  3ZRE A;  3Q6O A;  3ZIV A;  4FO5 A;  5HQP A;  3DML A;  4KCE A;  2OAC A;  1BQ7 A;  3KP8 A;  4USS A;  2CAQ A;  3KTB A;  1S3A A;  4MZC A;  2JL4 A;  4OWY A;  4JRR A;  1X5C A;  4XS4 B;  1AQV A;  1MDK A;  1C72 A;  2HFD A;  2MMZ A;  2KHP A;  2NVL A;  4IS0 A;  1R26 A;  5J4U A;  3FR6 A;  4I8B A;  5ECN B;  1GUL A;  3DYR A;  6GSU A;  2AJQ B;  3M1G A;  1EEM A;  2X8C A;  3FK8 A;  4NWY A;  4IGJ A;  2WFC A;  3ERF A;  3ZL5 A;  1SJ6 A;  2DJJ A;  2VL9 A;  2MBS A;  3EUR A;  4GQF A;  3ZTL A;  4HZ2 A;  1MD3 A;  4TW5 A;  2HT9 A;  2CZ2 A;  2O89 A;  3TRP A;  3TJK A;  3F4R A;  5H5S A;  2RUF A;  2L57 A;  4XTS A;  3VK9 A;  4TRX A;  1EV4 A;  3CTF A;  2G2Q A;  4N11 A;  1G7E A;  1JZD A;  5AIV A;  3DIE A;  5J3R A;  1OC9 A;  3IPZ A;  3ERG A;  2GTU A;  1FO5 A;  4OFT A;  4ZL9 A;  5CRG A;  4LMV A;  1PD2 1;  3F6D A;  1AW9 A;  3HKR A;  4O7H A;  5F07 A;  3APO A;  2LS5 A;  5A4W A;  3LEF A;  2JAD A;  1XW9 A;  1SJZ A;  1XFL A;  4D73 B;  1DBY A;  5L71 A;  4ZXG A;  3ZML A;  2I9H A;  5ECS A;  2C0E A;  3DEX A;  4RUV A;  3TKQ A;  2HZE B;  2E7P A;  5LCZ A;  3QFB C;  2X99 A;  5GAN D;  1BG5 A;  4XCS A;  2IMF A;  2HYX A;  1AC1 A;  5CP1 A;  5EVO A;  3E9J B;  3ZIJ A;  3LGC A;  2PBJ A;  2PVQ A;  1TI3 A;  1AXD A;  4PUA A;  5J9B A;  5B8B A;  5KEJ A;  5ECL B;  1F9M A;  4XIH A;  1A0R P;  2YWN A;  3RPN A;  4AJ7 A;  4BWS A;  1XWC A;  1K0M A;  1FOV A;  2QGV A;  3ZIT A;  2YJ7 A;  1BYE A;  1HD2 A;  3UOM A;  2TRX A;  2GDR A;  3HYP A;  4L0W A;  3TOT A;  4TXO A;  1T8E B;  2VLT A;  2CVB A;  1GLP A;  4TR3 A;  1M2B A;  3RPP A;  1PN9 A;  1HQO A;  1GUH A;  2AAW A;  4ZBA A;  2EC4 A;  1PL1 A;  4E8H A;  1S3C A;  2AYT A;  5F8B A;  4KF9 A;  3ZMK A;  1O7U A;  1V98 A;  3LOR A;  1TK5 B;  2R6K A;  4BVY A;  5IPH A;  4ZB6 A;  3C1R A;  4TR1 B;  4G0L A;  3IC4 A;  1GRX A;  3G9B A;  3IRA A;  1V9W A;  4F82 A;  1B4Q A;  1NM3 A;  2H01 A;  5DAK B;  4KAE A;  3VI5 A;  3HDC A;  1YF1 A;  4MJE A;  1YJ6 A;  5B6N A;  4E8E A;  1A8L A;  4OO4 A;  3D22 A;  1DUG A;  3CSI A;  2X8H A;  4POK A;  5JCG A;  4LL4 B;  2B6M A;  4FH8 A;  1V58 A;  1HYU A;  2AUV A;  1SKR B;  2C3N A;  2IME A;  2F8F A;  3GA4 A;  1GNE A;  2FD3 A;  3I43 A;  4I2T A;  5LD0 A;  5GAP D;  1FB0 A;  20GS A;  2L4C A;  4ECB A;  2PPT A;  2CAI A;  4X43 A;  3APS A;  2P0G A;  2XHF A;  4MH2 A;  22GS A;  1Q98 A;  2PMT A;  3KGK A;  2LUS A;  5ECP B;  5IIZ A;  4HEA 2;  1W4V A;  3TKS E;  2VL2 C;  1ERW A;  1A2M A;  5A4U A;  3VWX A;  1Q4J A;  3UVH A;  1GSD A;  1PA3 A;  5G30 A;  2ON7 A;  3P90 A;  3GMF A;  2A2S A;  2C3T A;  2CVK A;  1KTE A;  2OE1 A;  2V1M A;  2B5E A;  3GTU A;  5FHI A;  4CDO A;  1Z5Y E;  2LKU A;  3HJM A;  2A2R A;  2M46 A;  4AGS A;  4PNG A;  4G0I A;  3GIX A;  2L5O A;  3GKK A;  1YDK A;  3D6I A;  1EWX A;  3A2X A;  3GHA A;  1DE2 A;  2O87 A;  2HSN B;  3EE2 A;  4QL7 A;  1K3L A;  4KSM A;  1IYI A;  2JZR A;  1XWK A;  4WET A;  5ECR B;  3TRX A;  3HA9 A;  1VF1 A;  4ECJ A;  1HNB A;  2YWM A;  2C0D A;  3P7X A;  3VUR A;  3CSJ A;  3FY7 A;  1NSW A;  4MJC A;  3MNG A;  1MD4 A;  2PVO C;  3KTL A;  1M0U A;  3HVV A;  4HS1 A;  4AF2 A;  1EGO A;  2JU5 A;  4LMW A;  3A2W A;  3HD5 A;  2OKA A;  2GT6 A;  2CQ9 A;  2YCD A;  1O8X A;  4KND A;  1QUW A;  1XOA A;  1R5A A;  2HQT A;  1X0R A;  3CYN A;  3O3T A;  1XIY A;  3MAK A;  2R2J A;  5JWQ B;  4V2M A;  2QSI A;  3NIV A;  1AQX A;  1UC7 A;  1LBK A;  1VF3 A;  5D8I A;  3TJG A;  4L5O A;  5LNK e;  4ID0 A;  4LLR A;  4TXV A;  1QMV A;  2YAN A;  5IPG A;  1ZGN A;  1M9B A;  2LTK A;  2L59 A;  3ZYW A;  4HU9 A;  1WWJ A;  2M80 A;  4Q5F A;  1XWG A;  3M9J A;  3KH9 A;  1MEK A;  4GSS A;  2HSM B;  1WJK A;  3BOA A;  1R7H A;  2KP2 A;  2MYG A;  1U6T A;  4GST A;  3BJ5 A;  5D73 A;  4HZ4 A;  3N5O A;  1K0O A;  2H1B A;  2DJK A;  2RLI A;  5CO3 A;  1JZW A;  4FQU A;  6GSX A;  4N30 A;  1J9B A;  2YN1 A;  4POB A;  3M3M A;  3H93 A;  3FYG A;  4HDE A;  3IAM 2;  3FEU A;  3GKM A;  4QQ7 A;  2N5B A;  2B7K A;  3TJF A;  2XC2 A;  2HXK A;  2YV9 A;  3CSH A;  2LJA A;  5AN1 A;  5IMV A;  3H4K A;  1UN2 A;  6GST A;  2VAF A;  3PGT A;  1V57 A;  3LWA A;  3F9U A;  5FT3 A;  3BCK A;  1TTZ A;  12GS A;  5IMF A;  3C1S A;  1A2J A;  3TKP A;  1S3D A;  2ON5 A;  3G7I A;  1O85 A;  1A2L A;  1T4Z A;  3HJP A;  1FW1 A;  5GST A;  1DE1 A;  4F2I A;  3IDV A;  4IJI A;  2FWH A;  1N8J A;  3TGZ A;  5HFI A;  2X8G A;  2NDO A;  5ECK B;  1M7T A;  1ABA A;  5IOX A;  3BCI A;  3GX8 A;  3GUS A;  4V2L A;  1G6W A;  4RI6 A;  2IPA A;  4IBP A;  2GS3 A;  3I9V 2;  2V6O A;  4PQ1 A;  4L0U A;  3WGE A;  3GST A;  5C00 A;  4GRF A;  4JR6 A;  4CHS A;  4P3Y B;  5IMD A;  1R5P A;  2GSQ A;  2OJL A;  3I69 A;  2HLS A;  2FUG 2;  2H74 A;  5F05 A;  1Z7P A;  3OR5 A;  1USB A;  2VO4 A;  3C7M A;  1HNC A;  1GUM A;  4GWR A;  4L5L A;  2BTO T;  4TR4 A;  1TI1 A;  2GGT A;  1XWA A;  1GSY A;  1NHO A;  4NXI A;  4DEJ A;  2OAD A;  1PL2 A;  2GST A;  3RHB A;  1W89 A;  2DML A;  5INY A;  4PXO A;  3WGD A;  1U3A A;  3UAR A;  5DJL A;  3QD9 A;  4BA7 A;  5ECQ B;  2LST A;  7GSS A;  2DMM A;  5DAL B;  1SK0 A;  1ZYQ B;  1QK8 A;  3FRC A;  4NV5 A;  4K7O A;  2DIY A;  4I97 A;  3LYP A;  3S9F A;  5G5E A;  4LL1 B;  1SKW B;  3DKS A;  1PX6 A;  4ACS A;  4KSO A;  2V2G A;  1A0F A;  4WBR D;  1CQG A;  1TRV A;  3ED3 A;  2K18 A;  2YP6 A;  4KDU A;  3R3E A;  2HI7 A;  1EOH A;  3M9K A;  2KLX A;  1SYR A;  1MDJ A;  3KMN A;  2JSY A;  2OA7 A;  1H75 A;  3IA1 A;  1GTU A;  1ZOF A;  5D9W A;  1O8W A;  4MDC A;  2PWJ A;  1YEP A;  3DRN A;  3GUR A;  1UVZ A;  19GS A;  3LYK A;  2OE0 A;  3ZZX A;  3QFA C;  5ID2 A;  4PGT A;  2K6V A;  3EMX A;  3I6A A;  3VPQ A;  1Z3E A;  2WB9 A;  1J0F A;  2K8S A;  4FYB A;  5HR0 A;  3MSZ A;  5D9V A;  3Q74 A;  4G9H A;  2FA8 A;  2H70 A;  2XBQ A;  2OBI A;  3GN3 A;  4GQC A;  3C71 A;  4ZIJ A;  1A8Y A;  3US3 A;  3KEB A;  4AJ8 A;  4NHZ A;  2VCX A;  2AHE A;  2H71 A;  13GS A;  4MCU A;  5HR2 A;  1F6M C;  2H73 A;  4HI7 A;  4IEL A;  4MZB A;  5DQS A;  2YWI A;  2IFQ B;  3L9U A;  4MPF A;  3LQ7 A;  4TVE A;  3LXZ A;  3GSS A;  2Z9S A;  3ME7 A;  4IN0 A;  3PPU A;  2VL2 A;  3UAP A;  3D4T A;  1THX A;  2QKE A;  2FWG A;  1PKW A;  4ZBB A;  3EC3 A;  10GS A;  2GQM A;  5BMU A;  2DIZ A;  2IL3 A;  2R37 A;  1SJI A;  2MBT A;  3KP9 A;  1ZL9 A;  3BBY A;  3F8U A;  2MMN A;  1Z6M A;  2WDU A;  3L0H A;  1O6J A;  4MP4 A;  4K7I A;  11GS A;  4FIW A;  4WR5 A;  5EY6 A;  1ZYE A;  1K0D A;  4DSS A;  8GSS A;  2C4J A;  3VWV A;  1AQW A;  1UA5 A;  5F06 A;  1TJD A;  4IQA A;  4EVM A;  2FNO A;  1SL2 B;  2P5Q A;  2FGX A;  3F6F A;  4JBB A;  2B3S A;  4N10 A;  2H0I A;  3KXO A;  1GWC A;  5CNW A;  4BL7 A;  2TIR A;  2H1A A;  16GS A;  2DJ1 A;  2VCW A;  2J9H A;  4EDZ A;  2VCV A;  2GZZ A;  3F3R A;  5D9T A;  3GYK A;  3UL3 A;  4XS6 A;  1SEN A;  4XHM A;  3VLN A;  3HJO A;  3UJ1 A;  2BJX A;  2PN8 A;  4H86 A;  3G7Y A;  5IO2 A;  5IOW A;  5CRH A;  2RM6 A;  2A4V A;  4OO5 A;  3A2V A;  1GSQ A;  3TKS C;  4I6X A;  3VWW A;  1JLV A;  2B5X A;  4NHW A;  3RBT A;  1OAZ A;  2VOC A;  1RW1 A;  2FHE A;  3SBC A;  3EWL A;  4MF6 A;  4MJB A;  2EIQ A;  2F8A A;  3EYT A;  1FHE A;  4MJA A;  2H1D A;  1AUC A;  4ISD A;  2I1U A;  2NPB A;  2IJY A;  4KCA A;  1TK8 B;  2R3X A;  2EIO A;  4Q5N A;  3GL3 A;  3F0I A;  4I5Q A;  4J57 E;  2YZU A;  3UBL A;  2C3Q A;  4ZIL A;  4EF0 A;  3VI7 A;  2IMD A;  3ZLP A;  3GNJ A;  2H6Z A;  1TDI A;  5ABR A;  4XS4 A;  4FYU A;  1XOB A;  2LQO A;  2WUL A;  2YNX A;  4BVX B;  5CRD A;  1PMT A;  1A23 A;  2I4A A;  2H0G A;  1WP0 A;  4EXJ A;  5COH A;  1YEX A;  5G5F A;  3F3Q A;  3KM6 A;  1SU9 A;  2X64 A;  2DBC A;  5A4V A;  5CRE A;  1ZMA A;  4IKH A;  4QL9 A;  3LXT A;  3LFL A;  1MTC A;  4V1A p;  1K0B A;  4Z7X A;  3QAW A;  1G7O A;  1JFU A;  3IR4 A;  4EC0 A;  2TRC P;  1GSS A;  4K1F A;  3GX0 A;  3FZ4 A;  3J7Y b;  2HSH A;  1XCC A;  3D21 A;  3GL5 A;  2YWO A;  3QR6 A;  2CZ3 A;  4K9Z A;  3NOF A;  2CX3 A;  2VUP A;  3W6G A;  3A3T A;  4GLT A;  2DJ3 A;  3L9S A;  4KX4 A;  3F4T A;  4OFN A;  4MA9 A;  1PX7 A;  2ZCT A;  4MLY A;  4PQI A;  4JZQ A;  3TDG A;  1B48 A;  1BX9 A;  5EPF A;  1YKC A;  2EIR A;  3Q19 A;  3P8W A;  5JCW A;  3AY8 A;  2QC7 A;  3APQ A;  3FZ9 A;  2I81 A;  5IMC A;  3KCM A;  3W8S A;  2F3M A;  4ZL7 A;  4MK3 A;  3H1N A;  2UZ8 A;  3HHV A;  1TU8 A;  3IE3 A;  4ML1 A;  3EU4 A;  3TRQ A;  3C8E A;  2FCH A;  4D73 A;  1WMJ A;  2JZT A;  4K6X A;  1U88 A;  1YKA A;  2FWF A;  2HZE A;  4MZW A;  1ZCP A;  4O5R A;  1V2A A;  5B8A A;  4G19 A;  1FVJ A;  2HRA A;  1K0C A;  2GQK A;  1URM A;  4KUN A;  3ISO A;  3DVX A;  3GRX A;  1QXH A;  1OE7 A;  3EU3 A;  1OC9 B;  2ES7 A;  4Q5Q A;  4WEY A;  5KN0 A;  1FAA A;  4DSR A;  1TU7 A;  2HRF A;  5HFG A;  3F63 A;  1WRY A;  2LRC A;  1QFN A;  5DCH A;  6GSW A;  4IQ1 A;  3D4M A;  4DSQ A;  2YZH A;  4MF7 A;  2HZF A;  1WOU A;  1U87 A;  2MMO A;  1J08 A;  3D0Z A;  3WT1 A;  1V40 A;  5J5N A;  1IYH A;  1JHB A;  3KH7 A;  1B4P A;  3IK9 A;  4YQM A;  2GVP A;  2D2Z A;  4PQH A;  1EZK A;  2FWE A;  4OD7 A;  4X1U A;  2RII A;  4HQS A;  3IK7 A;  2JZS A;  1B9Y C; 
#chains in the Genus database with same CATH topology
 3IAS 2;  1YQ1 A;  4IJ3 A;  1GP1 A;  5DBQ A;  3V1W A;  5CYY A;  5CRW A;  4ML6 A;  1F37 A;  4YQV A;  1SVL A;  3LG6 A;  1O73 A;  2EFE A;  2C0F A;  3WYW A;  5DJM A;  1OC8 A;  4QMK A;  3TUE A;  2ALB A;  4KB3 A;  3N9J A;  5D96 A;  1XWB A;  4TR1 A;  1TRU A;  2C1Y A;  1B8X A;  2O85 A;  1SVO A;  1M9A A;  2JAC A;  3HVS A;  2DKH A;  1H4O A;  5BRT A;  1K0N A;  4OMV A;  1T00 A;  5DAK A;  3ZFB A;  2C8U A;  3KZQ A;  4TKY A;  1O81 A;  1E2Y A;  1YY7 A;  3D5J A;  3L4N A;  4MF5 A;  2OBK A;  1ZYN A;  1BAY A;  2B5Y A;  2K9F A;  4TXO B;  2IN3 A;  1LJR A;  2DJ2 A;  1YF0 A;  1GSF A;  3IHG A;  1TOF A;  5FWG A;  5ECM B;  1I9D A;  3NZN A;  2YPM A;  1A24 A;  2GT5 A;  2A4H A;  1F2E A;  3M8N A;  4YAP A;  1FG4 A;  1WPI A;  4NMU A;  2AV4 A;  3DD3 A;  1VGL A;  2R0C A;  2YV7 A;  2LJK A;  1ERV A;  4I2U A;  3QAG A;  4BVY B;  3ZVJ A;  4GTU A;  4KH7 A;  2VM1 A;  3FR3 A;  1EOG A;  1GSU A;  3TCO A;  3FMW A;  1TK0 B;  1EV9 A;  3GH9 A;  5CAX A;  1G0T A;  4CY6 A;  3U5R E;  17GS A;  2YJH A;  3QMX A;  3GV1 A;  5ENU A;  2FLS A;  4TR0 A;  3L78 A;  1GLQ A;  1EP7 A;  5ECH B;  2H72 A;  5A5H A;  1MDI A;  1GSE A;  2C80 A;  2XPD A;  2VD1 A;  1WIK A;  2L4Q A;  4MH3 A;  2GSR A;  1SD8 A;  4K0N A;  3DGQ A;  2R4V A;  1T7P B;  2HSN A;  2V32 A;  4ECI A;  4HQZ A;  2HE3 A;  2AB6 A;  4MNN A;  1GNW A;  1F3A A;  1SVM A;  1XVQ A;  4AJ6 A;  1ILO A;  1TRW A;  3HCZ A;  1FB6 A;  1XPV A;  4ZL8 A;  2G0F A;  2PUK C;  1GL8 A;  5HFK A;  1I5G A;  2CT6 A;  3O6T A;  1TRS A;  4YH2 A;  1R4W A;  1OKD A;  3KD0 A;  3HXS A;  3GTU B;  1SL0 B;  1N2A A;  5DCG A;  5H5R A;  3SWL A;  2LQQ A;  1FVK A;  1KBN A;  2E2M A;  3A5I A;  2PU9 C;  4RQR A;  2CA8 A;  4KA0 A;  2H6X A;  3HZ4 A;  4YAV A;  3TKS A;  4RI7 A;  4EO3 A;  1SL1 B;  3VFI A;  2VLU A;  4MMM A;  1LU4 A;  4EE0 A;  1PKZ A;  4XS1 A;  5A5K A;  4PTS A;  2HRK B;  2VIM A;  4EL1 A;  1K0A A;  4IP1 A;  1OYJ A;  1X9M B;  5ECO B;  4OCE A;  5AGY A;  5IMA A;  5B6M A;  2E2G A;  4HUA A;  5DVB A;  3HVX A;  1T4Y A;  3BD2 A;  4Z2U A;  4G2E A;  3QDN A;  1OC3 A;  5KN3 A;  5HR1 A;  2NBS A;  5EL8 A;  3O76 A;  2HSM A;  2EFH A;  4HOJ A;  2F9S A;  2L5L A;  2XPE A;  2N5A A;  2EFC A;  3ME8 A;  2A2P A;  3TOU A;  4E68 A;  1PN0 A;  5KN1 A;  1QGV A;  3P2A A;  3TJB A;  2IWT A;  3IV4 A;  1XXU A;  2MMA A;  3UBK A;  3IHQ A;  1X9W B;  2FY6 A;  2H66 A;  3H8Q A;  4FXY P;  3CXG A;  3IOS A;  3LSZ A;  1PGT A;  4K7N A;  2O5V A;  3IBH A;  4KGI A;  2N5F A;  4PUR A;  2OE3 A;  5JWR B;  2VM2 A;  4TN8 A;  2V41 A;  1VRS D;  2H0H A;  2REM A;  1QQ2 A;  4IP6 A;  2ZUP A;  3UEM A;  1GH2 A;  14GS A;  3JCM L;  4K0G A;  2PGT A;  5ELG A;  18GS A;  1THO A;  3DWV A;  2GZP A;  1TKD B;  1EGR A;  4DVC A;  2WRT A;  3RFR C;  3CBU A;  2H19 A;  1NHY A;  1SK1 A;  3RHC A;  3U6V A;  6GSV A;  2GQL A;  5IQY A;  4OFM A;  4ULX A;  5IO0 A;  3UVT A;  3RAZ A;  4WF4 A;  4MPG A;  1PRX A;  5A34 B;  2FA4 A;  5KOX A;  4PX1 A;  4F0B A;  2I3Y A;  1PSQ A;  3MWH A;  3PH9 A;  2GLR A;  1SK2 A;  5B7C A;  2R5G A;  2J23 A;  1T3B A;  4NPB A;  1Z7R A;  5D9X A;  3IXR A;  4RQX A;  3KJY A;  1KEB A;  3J7Y k;  3PIN A;  4GCI A;  2WZ9 A;  5H5Q A;  2P5R A;  4MAB A;  2ZNM A;  3ZRD A;  1JZO A;  1BJX A;  4IHU A;  2LRN A;  1XVW A;  5IM9 A;  1X9S B;  2KP1 A;  5GZZ B;  1ACV A;  2DLX A;  4ZB9 A;  1TXX A;  1GTB A;  4GF0 A;  4JR4 A;  5G1L A;  3UIW A;  1TP9 A;  2XBI A;  4PUF C;  1G6Y A;  2O8V B;  4TOP A;  5J40 A;  4FYC A;  1VF4 A;  1SKS B;  2NTO A;  1Z6N A;  3TB2 A;  3FZ5 A;  3MIX A;  1ZYP A;  5E4W A;  5DAL A;  1KNG A;  4KW6 A;  2WVX B;  1CQH A;  4K2D A;  5ECI B;  2LNT A;  3E3E A;  2K8V A;  1AAZ A;  3WGX A;  4LA1 A;  1Y6E A;  4KE3 A;  3CTG A;  3QCP A;  4N0V A;  1SD9 A;  1PQN A;  5G1K A;  1XW6 A;  4ZBD A;  1EEJ A;  3WT2 A;  2GZY A;  3KMO A;  1Y25 A;  3EPT A;  3KIJ A;  1K3O A;  4KDX A;  2LV3 A;  4V2N A;  2VD0 A;  3E0U A;  3FHK A;  1BF5 A;  1X5E A;  4YQU A;  2DJ0 A;  4WXT A;  4G0K A;  4IVF A;  4K8M A;  1F3B A;  5G2Z A;  2YOI A;  1X5D A;  2QA1 A;  4HJM A;  4GXZ A;  4WF5 A;  5JCU A;  1OE8 A;  3QOU A;  1WE0 A;  4J56 E;  1RQM A;  4WR4 A;  1ERT A;  2R0G A;  4Q5R A;  2WS2 A;  4EUY A;  3GFK A;  2H30 A;  5HR3 A;  2H6Y A;  2DSA A;  4N0Z A;  4F0C A;  4POL A;  4PNF A;  2HRK A;  4O92 A;  5GSS A;  2VL3 A;  1ML6 A;  1AIU A;  4EDY A;  2HRN A;  2KUC A;  1JZR A;  2B1L A;  4O32 A;  4POM A;  2L6C A;  1OKT A;  1U3I A;  3UMA A;  5F0G A;  3RDW A;  1ST9 A;  5J41 A;  3ERW A;  1M99 A;  2LNS A;  3M0F A;  3ZFL A;  1XW5 A;  3FW2 A;  5ID2 B;  2IFQ A;  1M2D A;  2JSZ A;  2H8L A;  1ZZY A;  3CRT A;  4F9Z A;  1PFO A;  3GH6 A;  4ICY A;  3CMI A;  2WJU A;  4X4J A;  5DQY A;  2L6D A;  1B9X C;  2VKZ G;  2H76 A;  4HU7 A;  3QPM A;  4NAX A;  2EFD A;  3PR8 A;  1XBS A;  1DSB A;  4J2F A;  3G7J A;  1GUK A;  2V6K A;  4NV2 A;  2WW2 A;  2CX4 A;  4WKW A;  2LJR A;  1XZO A;  4Z2R A;  3VPT A;  3VWU A;  3WD6 A;  2RM5 A;  1S3R A;  5D93 A;  3LJR A;  5J47 A;  2CV4 A;  1JLW A;  2H1L A;  2VCZ A;  2VCQ A;  5E59 A;  3FR9 A;  4EIQ A;  4G10 A;  2CVD A;  1ERU A;  1T1V A;  2WW1 A;  4KDY A;  3IC8 A;  4F03 A;  2WCI A;  3EMP A;  4JE1 A;  4JED A;  1K3Y A;  5BMU B;  4PI2 C;  3DVW A;  2BMX A;  1OVN A;  6GSS A;  5C04 A;  2LRT A;  3HY2 A;  2O36 A;  4OCF A;  1YZX A;  5IMZ A;  4BPY A;  1ON4 A;  4L8E A;  4HJ2 A;  3H79 A;  2E0Q A;  3A5W A;  1HNA A;  3TKR A;  3HZ8 A;  3EVI A;  2KOK A;  3K8N A;  4DSS B;  5J9C A;  2RUE A;  2PER A;  2M72 A;  1BED A;  4ZB8 A;  1M2A A;  4EKZ A;  2WGR A;  4X0X A;  3HVN A;  1RK4 A;  1SYX A;  5JWO B;  2GSS A;  2O7K A;  2HSY A;  2VLV A;  2C0G A;  2HNL A;  4BL7 B;  4K5R A;  2WW0 A;  3MDK A;  3TJJ A;  4BWQ A;  4IW9 A;  6GSY A;  3ZVJ D;  1EP8 A;  3GKN A;  3EIN A;  3L9V A;  2F51 A;  5KN2 A;  3GKX A;  2H1G A;  2LEG A;  2DC5 A;  3FZA A;  4ILF A;  1GTI A;  5AIS A;  2B7J A;  1Z9H A;  4WBJ A;  1E6B A;  4V1A g;  3W8J A;  3F4S A;  1TW9 A;  3C73 A;  4CW9 A;  2IMI A;  2P31 A;  1NW2 A;  2B1K A;  1GTA A;  4XRA A;  5ELA A;  4BVX A;  4JU5 A;  5G31 A;  2H75 A;  3QAV A;  4GSN A;  3R2Q A;  4K5S A;  5AIX A;  2VCT A;  4ECC A;  3RGB C;  2IMK A;  3DXB A;  3FKF A;  2IIY A;  1S4B P;  2MZC A;  9GSS A;  2OT3 A;  1VF2 A;  3Q18 A;  4XRD A;  3CRU A;  5DDL A;  3ZRE A;  3Q6O A;  3ZIV A;  4FO5 A;  5HQP A;  3DML A;  4KCE A;  2OAC A;  1BQ7 A;  3KP8 A;  4USS A;  2CAQ A;  3KTB A;  1S3A A;  4MZC A;  2JL4 A;  4OWY A;  4JRR A;  1X5C A;  4XS4 B;  1AQV A;  2QA2 A;  4CY8 A;  1MDK A;  1C72 A;  2HFD A;  2MMZ A;  2KHP A;  2NVL A;  4IS0 A;  1R26 A;  5J4U A;  3FR6 A;  4I8B A;  5ECN B;  1GUL A;  3DYR A;  6GSU A;  2AJQ B;  3M1G A;  1EEM A;  2X8C A;  3FK8 A;  4NWY A;  4IGJ A;  2WFC A;  3ERF A;  3ZL5 A;  1SJ6 A;  2DJJ A;  2VL9 A;  3LW9 A;  2MBS A;  3EUR A;  4GQF A;  3ZTL A;  4HZ2 A;  1MD3 A;  4TW5 A;  2HT9 A;  2CZ2 A;  2O89 A;  3TRP A;  3TJK A;  3F4R A;  5H5S A;  2RUF A;  2L57 A;  4XTS A;  3VK9 A;  4TRX A;  1EV4 A;  3CTF A;  2X49 A;  2G2Q A;  4N11 A;  1G7E A;  1JZD A;  5AIV A;  3DIE A;  5J3R A;  1OC9 A;  3IPZ A;  3ERG A;  2GTU A;  1FO5 A;  4OFT A;  4ZL9 A;  5CRG A;  4LMV A;  1PD2 1;  3F6D A;  1AW9 A;  3HKR A;  4AKI A;  4O7H A;  5F07 A;  3APO A;  2LS5 A;  5A4W A;  3LEF A;  2JAD A;  1XW9 A;  5KOW A;  1SJZ A;  1XFL A;  4D73 B;  1DBY A;  5L71 A;  4ZXG A;  3ZML A;  2I9H A;  5ECS A;  2C0E A;  3DEX A;  4RUV A;  3TKQ A;  2HZE B;  2E7P A;  5LCZ A;  3QFB C;  2X99 A;  5GAN D;  1BG5 A;  4XCS A;  2IMF A;  2HYX A;  1AC1 A;  5CP1 A;  5EVO A;  3E9J B;  3ZIJ A;  3LGC A;  2PBJ A;  2PVQ A;  1TI3 A;  2DKI A;  1AXD A;  4PUA A;  5J9B A;  5B8B A;  5KEJ A;  5ECL B;  1F9M A;  4XIH A;  1A0R P;  2YWN A;  3RPN A;  4AJ7 A;  4BWS A;  1XWC A;  1K0M A;  1FOV A;  2QGV A;  3ZIT A;  2YJ7 A;  1BYE A;  1HD2 A;  3UOM A;  2TRX A;  5A1N B;  2GDR A;  3HYP A;  4L0W A;  3TOT A;  4TXO A;  1T8E B;  2VLT A;  2CVB A;  1GLP A;  4TR3 A;  1M2B A;  3RPP A;  1PN9 A;  1HQO A;  1GUH A;  2AAW A;  4ZBA A;  2EC4 A;  1PL1 A;  4E8H A;  4O5Q A;  1S3C A;  2AYT A;  5F8B A;  4KF9 A;  3ZMK A;  1O7U A;  1V98 A;  3LOR A;  1TK5 B;  2R6K A;  4BVY A;  5IPH A;  4ZB6 A;  3C1R A;  4TR1 B;  4G0L A;  3IC4 A;  1GRX A;  3G9B A;  3IRA A;  1V9W A;  4F82 A;  1B4Q A;  1NM3 A;  2H01 A;  5DAK B;  4KAE A;  3VI5 A;  3HDC A;  1YF1 A;  4MJE A;  1YJ6 A;  5B6N A;  4E8E A;  4A5P A;  1A8L A;  4OO4 A;  3D22 A;  1DUG A;  3CSI A;  2X8H A;  3CQF A;  4POK A;  5JCG A;  4LL4 B;  2B6M A;  4FH8 A;  1V58 A;  1HYU A;  2AUV A;  4ZB7 A;  1SKR B;  2C3N A;  2IME A;  2F8F A;  3GA4 A;  1GNE A;  2FD3 A;  3I43 A;  4I2T A;  5LD0 A;  5GAP D;  1FB0 A;  20GS A;  2L4C A;  4ECB A;  2PPT A;  2CAI A;  4X43 A;  4BIK A;  3APS A;  2P0G A;  2XHF A;  4MH2 A;  22GS A;  1Y1U A;  2PMT A;  1Q98 A;  4YKG A;  3KGK A;  2LUS A;  5ECP B;  5IIZ A;  4HEA 2;  1W4V A;  3TKS E;  2VL2 C;  1ERW A;  1A2M A;  5A4U A;  3VWX A;  1Q4J A;  3UVH A;  1GSD A;  1PA3 A;  5G30 A;  2ON7 A;  3P90 A;  3GMF A;  2A2S A;  2C3T A;  2CVK A;  1KTE A;  2OE1 A;  2V1M A;  2B5E A;  3GTU A;  5FHI A;  4CDO A;  5A5H B;  1Z5Y E;  2LKU A;  3HJM A;  2A2R A;  2M46 A;  4AGS A;  4PNG A;  4G0I A;  3GIX A;  2L5O A;  3GKK A;  1YDK A;  3D6I A;  1EWX A;  1TXU A;  3A2X A;  3GHA A;  1DE2 A;  2O87 A;  2HSN B;  3EE2 A;  4QL7 A;  1K3L A;  4KSM A;  1IYI A;  4EIP A;  2JZR A;  1XWK A;  4WET A;  5ECR B;  3TRX A;  3HA9 A;  1VF1 A;  4ECJ A;  1HNB A;  2YWM A;  2C0D A;  3P7X A;  3VUR A;  3CSJ A;  3FY7 A;  1NSW A;  4MJC A;  4N3Z A;  3MNG A;  1MD4 A;  2PVO C;  4Z2T A;  3KTL A;  1M0U A;  3HVV A;  4HS1 A;  4AF2 A;  1EGO A;  2JU5 A;  4LMW A;  3A2W A;  3HD5 A;  1M3J A;  2OKA A;  2GT6 A;  2CQ9 A;  2YCD A;  1O8X A;  4KND A;  1QUW A;  1XOA A;  1R5A A;  2HQT A;  1X0R A;  3CYN A;  3O3T A;  1XIY A;  3MAK A;  2R2J A;  5JWQ B;  4V2M A;  2QSI A;  3NIV A;  1AQX A;  1UC7 A;  1LBK A;  1VF3 A;  5D8I A;  3TJG A;  4L5O A;  5LNK e;  4ID0 A;  4LLR A;  4TXV A;  1QMV A;  2YAN A;  5IPG A;  1ZGN A;  1M9B A;  2LTK A;  2L59 A;  3ZYW A;  4HU9 A;  1WWJ A;  2M80 A;  4Q5F A;  1XWG A;  3M9J A;  3KH9 A;  1MEK A;  4GSS A;  2HSM B;  1WJK A;  3BOA A;  1R7H A;  2KP2 A;  2MYG A;  1U6T A;  4GST A;  4GDF A;  3BJ5 A;  5D73 A;  4HZ4 A;  3N5O A;  1K0O A;  2H1B A;  2DJK A;  2RLI A;  5CO3 A;  1JZW A;  4FQU A;  6GSX A;  4N30 A;  1J9B A;  2YN1 A;  4POB A;  3M3M A;  3H93 A;  3FYG A;  4HDE A;  3IAM 2;  3FEU A;  3GKM A;  4QQ7 A;  2N5B A;  2B7K A;  3TJF A;  2XC2 A;  5A34 A;  2HXK A;  2YV9 A;  3CSH A;  2LJA A;  5AN1 A;  5IMV A;  3H4K A;  1UN2 A;  6GST A;  2VAF A;  3PGT A;  1V57 A;  3LWA A;  3F9U A;  5FT3 A;  3BCK A;  1TTZ A;  12GS A;  5IMF A;  3C1S A;  1A2J A;  3TKP A;  1S3D A;  2ON5 A;  3G7I A;  1O85 A;  1A2L A;  4W66 A;  1T4Z A;  3HJP A;  1FW1 A;  5GST A;  1DE1 A;  4F2I A;  3IDV A;  4IJI A;  2FWH A;  1N8J A;  3TGZ A;  5HFI A;  2X8G A;  2NDO A;  5ECK B;  1M7T A;  1ABA A;  1I1I P;  3BCI A;  5IOX A;  3GX8 A;  3GUS A;  4V2L A;  1G6W A;  4RI6 A;  5J4V A;  2IPA A;  4IBP A;  2GS3 A;  3I9V 2;  1YEW C;  2V6O A;  4PQ1 A;  2WW3 A;  4L0U A;  3WGE A;  3GST A;  5C00 A;  4GRF A;  3TU3 B;  4JR6 A;  2WVX A;  4CHS A;  4P3Y B;  5IMD A;  1R5P A;  2GSQ A;  2OJL A;  3I69 A;  2HLS A;  2FUG 2;  4HSC X;  2H74 A;  5F05 A;  1Z7P A;  3OR5 A;  4YKF A;  1USB A;  2VO4 A;  3C7M A;  4G01 A;  1HNC A;  1GUM A;  4GWR A;  4L5L A;  2BTO T;  4TR4 A;  1TI1 A;  2GGT A;  1XWA A;  1GSY A;  1NHO A;  4NXI A;  4DEJ A;  2OAD A;  1PL2 A;  2GST A;  3RHB A;  1W89 A;  2DML A;  5INY A;  4PXO A;  3WGD A;  1U3A A;  3UAR A;  5DJL A;  3QD9 A;  4BA7 A;  5ECQ B;  2LST A;  7GSS A;  2DMM A;  5DAL B;  1SK0 A;  1ZYQ B;  1QK8 A;  3FRC A;  4NV5 A;  4K7O A;  2DIY A;  4I97 A;  3LYP A;  3S9F A;  5G5E A;  4LL1 B;  1SKW B;  3DKS A;  1PX6 A;  4ACS A;  4KSO A;  2V2G A;  1A0F A;  4WBR D;  1CQG A;  1TRV A;  3CHX C;  3ED3 A;  2K18 A;  2YP6 A;  4KDU A;  4PI0 C;  3R3E A;  2HI7 A;  1EOH A;  3M9K A;  2KLX A;  1SYR A;  1MDJ A;  3KMN A;  2JSY A;  2OA7 A;  1H75 A;  3IA1 A;  1GTU A;  1ZOF A;  5D9W A;  1O8W A;  2WZS A;  4MDC A;  2PWJ A;  1YEP A;  3DRN A;  3GUR A;  4K2X A;  1UVZ A;  19GS A;  3LYK A;  2OE0 A;  3ZZX A;  3QFA C;  4AKG A;  5ID2 A;  4PGT A;  2K6V A;  3EMX A;  1FOH A;  3I6A A;  3VPQ A;  1Z3E A;  2WB9 A;  1J0F A;  2K8S A;  4FYB A;  5HR0 A;  3MSZ A;  5D9V A;  3Q74 A;  4G9H A;  2FA8 A;  2H70 A;  2XBQ A;  2OBI A;  3GN3 A;  4GQC A;  3C71 A;  4ZIJ A;  1A8Y A;  3US3 A;  3KEB A;  4AJ8 A;  4NHZ A;  2VCX A;  2AHE A;  2H71 A;  13GS A;  4MCU A;  5HR2 A;  1F6M C;  2H73 A;  4HI7 A;  4IEL A;  4MZB A;  5DQS A;  2YWI A;  2IFQ B;  3L9U A;  4MPF A;  3LQ7 A;  4TVE A;  3LXZ A;  3GSS A;  2Z9S A;  3ME7 A;  4IN0 A;  3PPU A;  2VL2 A;  3UAP A;  3D4T A;  1THX A;  2O3E A;  2QKE A;  2FWG A;  4AI6 A;  1PKW A;  4ZBB A;  3EC3 A;  4AKX B;  10GS A;  2GQM A;  5BMU A;  2DIZ A;  2IL3 A;  2R37 A;  1SJI A;  2MBT A;  3KP9 A;  1N25 A;  1ZL9 A;  3BBY A;  2UV8 G;  3F8U A;  2MMN A;  1XG8 A;  1Z6M A;  2WDU A;  3L0H A;  1O6J A;  4MP4 A;  4K7I A;  11GS A;  4FIW A;  4WR5 A;  5EY6 A;  1ZYE A;  1K0D A;  4DSS A;  8GSS A;  2C4J A;  3VWV A;  1AQW A;  1UA5 A;  5F06 A;  1TJD A;  4IQA A;  4EVM A;  2FNO A;  1SL2 B;  2P5Q A;  2FGX A;  3F6F A;  4JBB A;  2B3S A;  4N10 A;  2H0I A;  3KXO A;  1GWC A;  5CNW A;  4PHZ C;  4BL7 A;  2TIR A;  2H1A A;  16GS A;  2DJ1 A;  2VCW A;  2J9H A;  4EDZ A;  2VCV A;  2GZZ A;  3F3R A;  5D9T A;  3GYK A;  3UL3 A;  4XS6 A;  1SEN A;  4XHM A;  3VLN A;  3HJO A;  3UJ1 A;  2BJX A;  2PN8 A;  4H86 A;  3G7Y A;  5IO2 A;  5IOW A;  5CRH A;  2RM6 A;  2WVZ A;  2A4V A;  2X4A A;  4OO5 A;  3A2V A;  1GSQ A;  2WVY A;  3TKS C;  4I6X A;  3VWW A;  1JLV A;  2B5X A;  4NHW A;  3RBT A;  1OAZ A;  2VOC A;  1RW1 A;  2FHE A;  3SBC A;  3EWL A;  4MF6 A;  4MJB A;  2EIQ A;  2F8A A;  3EYT A;  1FHE A;  4MJA A;  2H1D A;  1AUC A;  4ISD A;  2I1U A;  3HMJ G;  2NPB A;  2IJY A;  4KCA A;  1TK8 B;  2R3X A;  2EIO A;  4Q5N A;  3GL3 A;  3F0I A;  4I5Q A;  4J57 E;  3CWG A;  2YZU A;  3UBL A;  2C3Q A;  4ZIL A;  4EF0 A;  3VI7 A;  2IMD A;  3ZLP A;  3GNJ A;  2H6Z A;  1TDI A;  5ABR A;  4XS4 A;  4FYU A;  4AKH A;  1XOB A;  2LQO A;  2WUL A;  2YNX A;  4BVX B;  5CRD A;  1PMT A;  1A23 A;  2I4A A;  2H0G A;  1WP0 A;  4EXJ A;  5COH A;  1YEX A;  5G5F A;  3F3Q A;  3KM6 A;  1SU9 A;  1YVL A;  3MYD A;  2X64 A;  2DBC A;  5A4V A;  5CRE A;  1ZMA A;  4IKH A;  4QL9 A;  2R0P A;  3LXT A;  3LFL A;  1MTC A;  4V1A p;  1K0B A;  4Z7X A;  3QAW A;  1G7O A;  1JFU A;  3IR4 A;  4EC0 A;  2TRC P;  1GSS A;  4K1F A;  3GX0 A;  3FZ4 A;  3J7Y b;  2HSH A;  1XCC A;  3D21 A;  3GL5 A;  2YWO A;  3QR6 A;  2CZ3 A;  4K9Z A;  3NOF A;  2CX3 A;  2VUP A;  3W6G A;  3A3T A;  4GLT A;  2DJ3 A;  3L9S A;  4KX4 A;  3F4T A;  4OFN A;  4MA9 A;  1PX7 A;  2ZCT A;  4MLY A;  4PQI A;  4JZQ A;  3TDG A;  1B48 A;  1BX9 A;  5EPF A;  1YKC A;  2EIR A;  3Q19 A;  3P8W A;  5JCW A;  3AY8 A;  2QC7 A;  3APQ A;  3FZ9 A;  2I81 A;  5IMC A;  3KCM A;  3W8S A;  2F3M A;  4ZL7 A;  4MK3 A;  3H1N A;  2UZ8 A;  3HHV A;  1TU8 A;  3IE3 A;  4ML1 A;  3EU4 A;  5J4Y A;  3TRQ A;  3C8E A;  2FCH A;  4D73 A;  1WMJ A;  2JZT A;  4K6X A;  1U88 A;  1YKA A;  2FWF A;  2HZE A;  4MZW A;  1M3I A;  1ZCP A;  4O5R A;  1V2A A;  5B8A A;  4G19 A;  1FVJ A;  2HRA A;  1K0C A;  2GQK A;  1URM A;  4KUN A;  3ISO A;  3DVX A;  3GRX A;  1QXH A;  1OE7 A;  3EU3 A;  1OC9 B;  2ES7 A;  4Q5Q A;  4WEY A;  5KN0 A;  1FAA A;  4DSR A;  1TU7 A;  2HRF A;  5HFG A;  3F63 A;  1WRY A;  2LRC A;  1QFN A;  5DCH A;  6GSW A;  4IQ1 A;  3D4M A;  4DSQ A;  2YZH A;  4MF7 A;  2HZF A;  1WOU A;  1U87 A;  2MMO A;  1J08 A;  3D0Z A;  3WT1 A;  1V40 A;  5J5N A;  1IYH A;  1JHB A;  3KH7 A;  1B4P A;  3IK9 A;  4YQM A;  2GVP A;  4O5U A;  2D2Z A;  1BG1 A;  4PQH A;  1EZK A;  2FWE A;  4OD7 A;  4X1U A;  5A1N A;  2RII A;  4HQS A;  3IK7 A;  2JZS A;  1B9Y C; 
#chains in the Genus database with same CATH homology
 3IAS 2;  1YQ1 A;  4IJ3 A;  1GP1 A;  5DBQ A;  3V1W A;  5CYY A;  5CRW A;  4ML6 A;  1F37 A;  4YQV A;  1SVL A;  3LG6 A;  1O73 A;  2EFE A;  2C0F A;  3WYW A;  5DJM A;  1OC8 A;  4QMK A;  3TUE A;  2ALB A;  4KB3 A;  3N9J A;  5D96 A;  1XWB A;  4TR1 A;  1TRU A;  2C1Y A;  1B8X A;  2O85 A;  1SVO A;  1M9A A;  2JAC A;  3HVS A;  2DKH A;  1H4O A;  5BRT A;  1K0N A;  4OMV A;  1T00 A;  5DAK A;  3ZFB A;  2C8U A;  3KZQ A;  4TKY A;  1O81 A;  1E2Y A;  1YY7 A;  3D5J A;  3L4N A;  4MF5 A;  2OBK A;  1ZYN A;  1BAY A;  2B5Y A;  2K9F A;  4TXO B;  2IN3 A;  1LJR A;  2DJ2 A;  1YF0 A;  1GSF A;  3IHG A;  1TOF A;  5FWG A;  5ECM B;  1I9D A;  3NZN A;  2YPM A;  1A24 A;  2GT5 A;  2A4H A;  1F2E A;  3M8N A;  4YAP A;  1FG4 A;  1WPI A;  4NMU A;  2AV4 A;  3DD3 A;  1VGL A;  2R0C A;  2YV7 A;  2LJK A;  1ERV A;  4I2U A;  3QAG A;  4BVY B;  3ZVJ A;  4GTU A;  4KH7 A;  2VM1 A;  3FR3 A;  1EOG A;  1GSU A;  3TCO A;  3FMW A;  1TK0 B;  1EV9 A;  3GH9 A;  5CAX A;  1G0T A;  4CY6 A;  3U5R E;  17GS A;  2YJH A;  3QMX A;  3GV1 A;  5ENU A;  2FLS A;  4TR0 A;  3L78 A;  1GLQ A;  1EP7 A;  5ECH B;  2H72 A;  5A5H A;  1MDI A;  1GSE A;  2C80 A;  2XPD A;  2VD1 A;  1WIK A;  2L4Q A;  4MH3 A;  2GSR A;  1SD8 A;  4K0N A;  3DGQ A;  2R4V A;  1T7P B;  2HSN A;  2V32 A;  4ECI A;  4HQZ A;  2HE3 A;  2AB6 A;  4MNN A;  1GNW A;  1F3A A;  1SVM A;  1XVQ A;  4AJ6 A;  1ILO A;  1TRW A;  3HCZ A;  1FB6 A;  1XPV A;  4ZL8 A;  2G0F A;  2PUK C;  1GL8 A;  5HFK A;  1I5G A;  2CT6 A;  3O6T A;  1TRS A;  4YH2 A;  1R4W A;  1OKD A;  3KD0 A;  3HXS A;  3GTU B;  1SL0 B;  1N2A A;  5DCG A;  5H5R A;  3SWL A;  2LQQ A;  1FVK A;  1KBN A;  2E2M A;  3A5I A;  2PU9 C;  4RQR A;  2CA8 A;  4KA0 A;  2H6X A;  3HZ4 A;  4YAV A;  3TKS A;  4RI7 A;  4EO3 A;  1SL1 B;  3VFI A;  2VLU A;  4MMM A;  1LU4 A;  4EE0 A;  1PKZ A;  4XS1 A;  5A5K A;  4PTS A;  2HRK B;  2VIM A;  4EL1 A;  1K0A A;  4IP1 A;  1OYJ A;  1X9M B;  5ECO B;  4OCE A;  5AGY A;  5IMA A;  5B6M A;  2E2G A;  4HUA A;  5DVB A;  3HVX A;  1T4Y A;  3BD2 A;  4Z2U A;  4G2E A;  3QDN A;  1OC3 A;  5KN3 A;  5HR1 A;  2NBS A;  5EL8 A;  3O76 A;  2HSM A;  2EFH A;  4HOJ A;  2F9S A;  2L5L A;  2XPE A;  2N5A A;  2EFC A;  3ME8 A;  2A2P A;  3TOU A;  4E68 A;  1PN0 A;  5KN1 A;  1QGV A;  3P2A A;  3TJB A;  2IWT A;  3IV4 A;  1XXU A;  2MMA A;  3UBK A;  3IHQ A;  1X9W B;  2FY6 A;  2H66 A;  3H8Q A;  3CXG A;  3IOS A;  3LSZ A;  1PGT A;  4K7N A;  2O5V A;  3IBH A;  4KGI A;  2N5F A;  4PUR A;  2OE3 A;  5JWR B;  2VM2 A;  4TN8 A;  2V41 A;  1VRS D;  2H0H A;  2REM A;  1QQ2 A;  4IP6 A;  2ZUP A;  3UEM A;  1GH2 A;  14GS A;  3JCM L;  4K0G A;  2PGT A;  5ELG A;  18GS A;  1THO A;  3DWV A;  2GZP A;  1TKD B;  1EGR A;  4DVC A;  2WRT A;  3CBU A;  2H19 A;  1NHY A;  1SK1 A;  3RHC A;  3U6V A;  6GSV A;  2GQL A;  5IQY A;  4OFM A;  4ULX A;  5IO0 A;  3UVT A;  3RAZ A;  4WF4 A;  4MPG A;  1PRX A;  5A34 B;  2FA4 A;  5KOX A;  4PX1 A;  4F0B A;  2I3Y A;  1PSQ A;  3MWH A;  3PH9 A;  2GLR A;  1SK2 A;  5B7C A;  2R5G A;  2J23 A;  1T3B A;  4NPB A;  1Z7R A;  5D9X A;  3IXR A;  4RQX A;  3KJY A;  1KEB A;  3J7Y k;  3PIN A;  4GCI A;  2WZ9 A;  5H5Q A;  2P5R A;  4MAB A;  2ZNM A;  3ZRD A;  1JZO A;  1BJX A;  4IHU A;  2LRN A;  1XVW A;  5IM9 A;  1X9S B;  2KP1 A;  5GZZ B;  1ACV A;  2DLX A;  4ZB9 A;  1TXX A;  1GTB A;  4GF0 A;  4JR4 A;  5G1L A;  3UIW A;  1TP9 A;  2XBI A;  4PUF C;  1G6Y A;  2O8V B;  4TOP A;  5J40 A;  4FYC A;  1VF4 A;  1SKS B;  2NTO A;  1Z6N A;  3TB2 A;  3FZ5 A;  3MIX A;  1ZYP A;  5E4W A;  5DAL A;  1KNG A;  4KW6 A;  1CQH A;  4K2D A;  5ECI B;  2LNT A;  3E3E A;  2K8V A;  1AAZ A;  3WGX A;  4LA1 A;  1Y6E A;  4KE3 A;  3CTG A;  3QCP A;  4N0V A;  1SD9 A;  1PQN A;  5G1K A;  1XW6 A;  4ZBD A;  1EEJ A;  3WT2 A;  2GZY A;  3KMO A;  1Y25 A;  3EPT A;  3KIJ A;  1K3O A;  4KDX A;  2LV3 A;  4V2N A;  2VD0 A;  3E0U A;  3FHK A;  1BF5 A;  1X5E A;  4YQU A;  2DJ0 A;  4WXT A;  4G0K A;  4IVF A;  4K8M A;  1F3B A;  5G2Z A;  2YOI A;  1X5D A;  2QA1 A;  4HJM A;  4GXZ A;  4WF5 A;  5JCU A;  1OE8 A;  3QOU A;  1WE0 A;  4J56 E;  1RQM A;  4WR4 A;  1ERT A;  2R0G A;  4Q5R A;  2WS2 A;  4EUY A;  3GFK A;  2H30 A;  5HR3 A;  2H6Y A;  2DSA A;  4N0Z A;  4F0C A;  4POL A;  4PNF A;  2HRK A;  4O92 A;  5GSS A;  2VL3 A;  1ML6 A;  1AIU A;  4EDY A;  2HRN A;  2KUC A;  1JZR A;  2B1L A;  4O32 A;  4POM A;  2L6C A;  1OKT A;  1U3I A;  3UMA A;  5F0G A;  3RDW A;  1ST9 A;  5J41 A;  3ERW A;  1M99 A;  2LNS A;  3M0F A;  3ZFL A;  1XW5 A;  3FW2 A;  5ID2 B;  2IFQ A;  1M2D A;  2JSZ A;  2H8L A;  1ZZY A;  3CRT A;  4F9Z A;  3GH6 A;  4ICY A;  3CMI A;  2WJU A;  4X4J A;  5DQY A;  2L6D A;  1B9X C;  2VKZ G;  2H76 A;  4HU7 A;  3QPM A;  4NAX A;  2EFD A;  3PR8 A;  1XBS A;  1DSB A;  4J2F A;  3G7J A;  1GUK A;  2V6K A;  4NV2 A;  2CX4 A;  4WKW A;  2LJR A;  1XZO A;  4Z2R A;  3VPT A;  3VWU A;  3WD6 A;  2RM5 A;  5D93 A;  3LJR A;  5J47 A;  2CV4 A;  1JLW A;  2H1L A;  2VCZ A;  2VCQ A;  5E59 A;  3FR9 A;  4EIQ A;  4G10 A;  2CVD A;  1ERU A;  1T1V A;  4KDY A;  3IC8 A;  4F03 A;  2WCI A;  3EMP A;  4JE1 A;  4JED A;  1K3Y A;  5BMU B;  3DVW A;  2BMX A;  1OVN A;  6GSS A;  5C04 A;  2LRT A;  3HY2 A;  4OCF A;  1YZX A;  5IMZ A;  4BPY A;  1ON4 A;  4L8E A;  4HJ2 A;  3H79 A;  2E0Q A;  3A5W A;  1HNA A;  3TKR A;  3HZ8 A;  3EVI A;  2KOK A;  3K8N A;  4DSS B;  5J9C A;  2RUE A;  2PER A;  2M72 A;  1BED A;  4ZB8 A;  1M2A A;  4EKZ A;  2WGR A;  4X0X A;  1RK4 A;  1SYX A;  5JWO B;  2GSS A;  2O7K A;  2HSY A;  2VLV A;  2C0G A;  2HNL A;  4BL7 B;  4K5R A;  3MDK A;  3TJJ A;  4BWQ A;  4IW9 A;  6GSY A;  3ZVJ D;  1EP8 A;  3GKN A;  3EIN A;  3L9V A;  2F51 A;  5KN2 A;  3GKX A;  2H1G A;  2LEG A;  2DC5 A;  3FZA A;  4ILF A;  1GTI A;  5AIS A;  2B7J A;  1Z9H A;  4WBJ A;  1E6B A;  4V1A g;  3W8J A;  3F4S A;  1TW9 A;  3C73 A;  4CW9 A;  2IMI A;  2P31 A;  1NW2 A;  2B1K A;  1GTA A;  4XRA A;  5ELA A;  4BVX A;  4JU5 A;  5G31 A;  2H75 A;  3QAV A;  4GSN A;  3R2Q A;  4K5S A;  5AIX A;  2VCT A;  4ECC A;  2IMK A;  3DXB A;  3FKF A;  2IIY A;  2MZC A;  9GSS A;  2OT3 A;  1VF2 A;  3Q18 A;  4XRD A;  3CRU A;  5DDL A;  3ZRE A;  3Q6O A;  3ZIV A;  4FO5 A;  5HQP A;  3DML A;  4KCE A;  2OAC A;  1BQ7 A;  3KP8 A;  4USS A;  2CAQ A;  3KTB A;  1S3A A;  4MZC A;  2JL4 A;  4OWY A;  4JRR A;  1X5C A;  4XS4 B;  1AQV A;  2QA2 A;  4CY8 A;  1MDK A;  1C72 A;  2HFD A;  2MMZ A;  2KHP A;  2NVL A;  4IS0 A;  1R26 A;  5J4U A;  3FR6 A;  4I8B A;  5ECN B;  1GUL A;  3DYR A;  6GSU A;  2AJQ B;  3M1G A;  1EEM A;  2X8C A;  3FK8 A;  4NWY A;  4IGJ A;  2WFC A;  3ERF A;  3ZL5 A;  1SJ6 A;  2DJJ A;  2VL9 A;  3LW9 A;  2MBS A;  3EUR A;  4GQF A;  3ZTL A;  4HZ2 A;  1MD3 A;  4TW5 A;  2HT9 A;  2CZ2 A;  2O89 A;  3TRP A;  3TJK A;  3F4R A;  5H5S A;  2RUF A;  2L57 A;  4XTS A;  3VK9 A;  4TRX A;  1EV4 A;  3CTF A;  2X49 A;  2G2Q A;  4N11 A;  1G7E A;  1JZD A;  5AIV A;  3DIE A;  5J3R A;  1OC9 A;  3IPZ A;  3ERG A;  2GTU A;  1FO5 A;  4OFT A;  4ZL9 A;  5CRG A;  4LMV A;  1PD2 1;  3F6D A;  1AW9 A;  3HKR A;  4AKI A;  4O7H A;  5F07 A;  3APO A;  2LS5 A;  5A4W A;  3LEF A;  2JAD A;  1XW9 A;  5KOW A;  1SJZ A;  1XFL A;  4D73 B;  1DBY A;  5L71 A;  4ZXG A;  3ZML A;  2I9H A;  5ECS A;  2C0E A;  3DEX A;  4RUV A;  3TKQ A;  2HZE B;  2E7P A;  5LCZ A;  3QFB C;  2X99 A;  5GAN D;  1BG5 A;  4XCS A;  2IMF A;  2HYX A;  1AC1 A;  5CP1 A;  5EVO A;  3E9J B;  3ZIJ A;  3LGC A;  2PBJ A;  2PVQ A;  1TI3 A;  2DKI A;  1AXD A;  4PUA A;  5J9B A;  5B8B A;  5KEJ A;  5ECL B;  1F9M A;  4XIH A;  1A0R P;  2YWN A;  3RPN A;  4AJ7 A;  4BWS A;  1XWC A;  1K0M A;  1FOV A;  2QGV A;  3ZIT A;  2YJ7 A;  1BYE A;  1HD2 A;  3UOM A;  2TRX A;  5A1N B;  2GDR A;  3HYP A;  4L0W A;  3TOT A;  4TXO A;  1T8E B;  2VLT A;  2CVB A;  1GLP A;  4TR3 A;  1M2B A;  3RPP A;  1PN9 A;  1HQO A;  1GUH A;  2AAW A;  4ZBA A;  2EC4 A;  1PL1 A;  4E8H A;  4O5Q A;  1S3C A;  2AYT A;  5F8B A;  4KF9 A;  3ZMK A;  1O7U A;  1V98 A;  3LOR A;  1TK5 B;  2R6K A;  4BVY A;  5IPH A;  4ZB6 A;  3C1R A;  4TR1 B;  4G0L A;  3IC4 A;  1GRX A;  3G9B A;  3IRA A;  1V9W A;  4F82 A;  1B4Q A;  1NM3 A;  2H01 A;  5DAK B;  4KAE A;  3VI5 A;  3HDC A;  1YF1 A;  4MJE A;  1YJ6 A;  5B6N A;  4E8E A;  4A5P A;  1A8L A;  4OO4 A;  3D22 A;  1DUG A;  3CSI A;  2X8H A;  4POK A;  5JCG A;  4LL4 B;  2B6M A;  4FH8 A;  1V58 A;  1HYU A;  2AUV A;  4ZB7 A;  1SKR B;  2C3N A;  2IME A;  2F8F A;  3GA4 A;  1GNE A;  2FD3 A;  3I43 A;  4I2T A;  5LD0 A;  5GAP D;  1FB0 A;  20GS A;  2L4C A;  4ECB A;  2PPT A;  2CAI A;  4X43 A;  3APS A;  2P0G A;  2XHF A;  4MH2 A;  22GS A;  1Y1U A;  2PMT A;  1Q98 A;  4YKG A;  3KGK A;  2LUS A;  5ECP B;  5IIZ A;  4HEA 2;  1W4V A;  3TKS E;  2VL2 C;  1ERW A;  1A2M A;  5A4U A;  3VWX A;  1Q4J A;  3UVH A;  1GSD A;  1PA3 A;  5G30 A;  2ON7 A;  3P90 A;  3GMF A;  2A2S A;  2C3T A;  2CVK A;  1KTE A;  2OE1 A;  2V1M A;  2B5E A;  3GTU A;  5FHI A;  4CDO A;  5A5H B;  1Z5Y E;  2LKU A;  3HJM A;  2A2R A;  2M46 A;  4AGS A;  4PNG A;  4G0I A;  3GIX A;  2L5O A;  3GKK A;  1YDK A;  3D6I A;  1EWX A;  1TXU A;  3A2X A;  3GHA A;  1DE2 A;  2O87 A;  2HSN B;  3EE2 A;  4QL7 A;  1K3L A;  4KSM A;  1IYI A;  4EIP A;  2JZR A;  1XWK A;  4WET A;  5ECR B;  3TRX A;  3HA9 A;  1VF1 A;  4ECJ A;  1HNB A;  2YWM A;  2C0D A;  3P7X A;  3VUR A;  3CSJ A;  3FY7 A;  1NSW A;  4MJC A;  4N3Z A;  3MNG A;  1MD4 A;  2PVO C;  4Z2T A;  3KTL A;  1M0U A;  3HVV A;  4HS1 A;  4AF2 A;  1EGO A;  2JU5 A;  4LMW A;  3A2W A;  3HD5 A;  2OKA A;  2GT6 A;  2CQ9 A;  2YCD A;  1O8X A;  4KND A;  1QUW A;  1XOA A;  1R5A A;  2HQT A;  1X0R A;  3CYN A;  3O3T A;  1XIY A;  3MAK A;  2R2J A;  5JWQ B;  4V2M A;  2QSI A;  3NIV A;  1AQX A;  1UC7 A;  1LBK A;  1VF3 A;  5D8I A;  3TJG A;  4L5O A;  5LNK e;  4ID0 A;  4LLR A;  4TXV A;  1QMV A;  2YAN A;  5IPG A;  1ZGN A;  1M9B A;  2LTK A;  2L59 A;  3ZYW A;  4HU9 A;  1WWJ A;  2M80 A;  4Q5F A;  1XWG A;  3M9J A;  3KH9 A;  1MEK A;  4GSS A;  2HSM B;  1WJK A;  3BOA A;  1R7H A;  2KP2 A;  2MYG A;  1U6T A;  4GST A;  4GDF A;  3BJ5 A;  5D73 A;  4HZ4 A;  3N5O A;  1K0O A;  2H1B A;  2DJK A;  2RLI A;  5CO3 A;  1JZW A;  4FQU A;  6GSX A;  4N30 A;  1J9B A;  2YN1 A;  4POB A;  3M3M A;  3H93 A;  3FYG A;  4HDE A;  3IAM 2;  3FEU A;  3GKM A;  4QQ7 A;  2N5B A;  2B7K A;  3TJF A;  2XC2 A;  5A34 A;  2HXK A;  2YV9 A;  3CSH A;  2LJA A;  5AN1 A;  5IMV A;  3H4K A;  1UN2 A;  6GST A;  2VAF A;  3PGT A;  1V57 A;  3LWA A;  3F9U A;  5FT3 A;  3BCK A;  1TTZ A;  12GS A;  5IMF A;  3C1S A;  1A2J A;  3TKP A;  1S3D A;  2ON5 A;  3G7I A;  1O85 A;  1A2L A;  4W66 A;  1T4Z A;  3HJP A;  1FW1 A;  5GST A;  1DE1 A;  4F2I A;  3IDV A;  4IJI A;  2FWH A;  1N8J A;  3TGZ A;  5HFI A;  2X8G A;  2NDO A;  5ECK B;  1M7T A;  1ABA A;  5IOX A;  3BCI A;  3GX8 A;  3GUS A;  4V2L A;  1G6W A;  4RI6 A;  5J4V A;  2IPA A;  4IBP A;  2GS3 A;  3I9V 2;  2V6O A;  4PQ1 A;  4L0U A;  3WGE A;  3GST A;  5C00 A;  4GRF A;  3TU3 B;  4JR6 A;  4CHS A;  4P3Y B;  5IMD A;  1R5P A;  2GSQ A;  2OJL A;  3I69 A;  2HLS A;  2FUG 2;  2H74 A;  5F05 A;  1Z7P A;  3OR5 A;  4YKF A;  1USB A;  2VO4 A;  3C7M A;  4G01 A;  1HNC A;  1GUM A;  4GWR A;  4L5L A;  2BTO T;  4TR4 A;  1TI1 A;  2GGT A;  1XWA A;  1GSY A;  1NHO A;  4NXI A;  4DEJ A;  2OAD A;  1PL2 A;  2GST A;  3RHB A;  1W89 A;  2DML A;  5INY A;  4PXO A;  3WGD A;  1U3A A;  3UAR A;  5DJL A;  3QD9 A;  4BA7 A;  5ECQ B;  2LST A;  7GSS A;  2DMM A;  5DAL B;  1SK0 A;  1ZYQ B;  1QK8 A;  3FRC A;  4NV5 A;  4K7O A;  2DIY A;  4I97 A;  3LYP A;  3S9F A;  5G5E A;  4LL1 B;  1SKW B;  3DKS A;  1PX6 A;  4ACS A;  4KSO A;  2V2G A;  1A0F A;  4WBR D;  1CQG A;  1TRV A;  3ED3 A;  2K18 A;  2YP6 A;  4KDU A;  3R3E A;  2HI7 A;  1EOH A;  3M9K A;  2KLX A;  1SYR A;  1MDJ A;  3KMN A;  2JSY A;  2OA7 A;  1H75 A;  3IA1 A;  1GTU A;  1ZOF A;  5D9W A;  1O8W A;  4MDC A;  2PWJ A;  1YEP A;  3DRN A;  3GUR A;  4K2X A;  1UVZ A;  19GS A;  3LYK A;  2OE0 A;  3ZZX A;  3QFA C;  4AKG A;  5ID2 A;  4PGT A;  2K6V A;  3EMX A;  1FOH A;  3I6A A;  3VPQ A;  1Z3E A;  2WB9 A;  1J0F A;  2K8S A;  4FYB A;  5HR0 A;  3MSZ A;  5D9V A;  3Q74 A;  4G9H A;  2FA8 A;  2H70 A;  2XBQ A;  2OBI A;  3GN3 A;  4GQC A;  3C71 A;  4ZIJ A;  1A8Y A;  3US3 A;  3KEB A;  4AJ8 A;  4NHZ A;  2VCX A;  2AHE A;  2H71 A;  13GS A;  4MCU A;  5HR2 A;  1F6M C;  2H73 A;  4HI7 A;  4IEL A;  4MZB A;  5DQS A;  2YWI A;  2IFQ B;  3L9U A;  4MPF A;  3LQ7 A;  4TVE A;  3LXZ A;  3GSS A;  2Z9S A;  3ME7 A;  4IN0 A;  3PPU A;  2VL2 A;  3UAP A;  3D4T A;  1THX A;  2QKE A;  2FWG A;  4AI6 A;  1PKW A;  4ZBB A;  3EC3 A;  4AKX B;  10GS A;  2GQM A;  5BMU A;  2DIZ A;  2IL3 A;  2R37 A;  1SJI A;  2MBT A;  3KP9 A;  1N25 A;  1ZL9 A;  3BBY A;  2UV8 G;  3F8U A;  2MMN A;  1Z6M A;  2WDU A;  3L0H A;  1O6J A;  4MP4 A;  4K7I A;  11GS A;  4FIW A;  4WR5 A;  5EY6 A;  1ZYE A;  1K0D A;  4DSS A;  8GSS A;  2C4J A;  3VWV A;  1AQW A;  1UA5 A;  5F06 A;  1TJD A;  4IQA A;  4EVM A;  2FNO A;  1SL2 B;  2P5Q A;  2FGX A;  3F6F A;  4JBB A;  2B3S A;  4N10 A;  2H0I A;  3KXO A;  1GWC A;  5CNW A;  4BL7 A;  2TIR A;  2H1A A;  16GS A;  2DJ1 A;  2VCW A;  2J9H A;  4EDZ A;  2VCV A;  2GZZ A;  3F3R A;  5D9T A;  3GYK A;  3UL3 A;  4XS6 A;  1SEN A;  4XHM A;  3VLN A;  3HJO A;  3UJ1 A;  2BJX A;  2PN8 A;  4H86 A;  3G7Y A;  5IO2 A;  5IOW A;  5CRH A;  2RM6 A;  2A4V A;  2X4A A;  4OO5 A;  3A2V A;  1GSQ A;  3TKS C;  4I6X A;  3VWW A;  1JLV A;  2B5X A;  4NHW A;  3RBT A;  1OAZ A;  2VOC A;  1RW1 A;  2FHE A;  3SBC A;  3EWL A;  4MF6 A;  4MJB A;  2EIQ A;  2F8A A;  3EYT A;  1FHE A;  4MJA A;  2H1D A;  1AUC A;  4ISD A;  2I1U A;  3HMJ G;  2NPB A;  2IJY A;  4KCA A;  1TK8 B;  2R3X A;  2EIO A;  4Q5N A;  3GL3 A;  3F0I A;  4I5Q A;  4J57 E;  3CWG A;  2YZU A;  3UBL A;  2C3Q A;  4ZIL A;  4EF0 A;  3VI7 A;  2IMD A;  3ZLP A;  3GNJ A;  2H6Z A;  1TDI A;  5ABR A;  4XS4 A;  4FYU A;  4AKH A;  1XOB A;  2LQO A;  2WUL A;  2YNX A;  4BVX B;  5CRD A;  1PMT A;  1A23 A;  2I4A A;  2H0G A;  1WP0 A;  4EXJ A;  5COH A;  1YEX A;  5G5F A;  3F3Q A;  3KM6 A;  1SU9 A;  1YVL A;  3MYD A;  2X64 A;  2DBC A;  5A4V A;  5CRE A;  1ZMA A;  4IKH A;  4QL9 A;  2R0P A;  3LXT A;  3LFL A;  1MTC A;  4V1A p;  1K0B A;  4Z7X A;  3QAW A;  1G7O A;  1JFU A;  3IR4 A;  4EC0 A;  2TRC P;  1GSS A;  4K1F A;  3GX0 A;  3FZ4 A;  3J7Y b;  2HSH A;  1XCC A;  3D21 A;  3GL5 A;  2YWO A;  3QR6 A;  2CZ3 A;  4K9Z A;  3NOF A;  2CX3 A;  2VUP A;  3W6G A;  3A3T A;  4GLT A;  2DJ3 A;  3L9S A;  4KX4 A;  3F4T A;  4OFN A;  4MA9 A;  1PX7 A;  2ZCT A;  4MLY A;  4PQI A;  4JZQ A;  3TDG A;  1B48 A;  1BX9 A;  5EPF A;  1YKC A;  2EIR A;  3Q19 A;  3P8W A;  5JCW A;  3AY8 A;  2QC7 A;  3APQ A;  3FZ9 A;  2I81 A;  5IMC A;  3KCM A;  3W8S A;  2F3M A;  4ZL7 A;  4MK3 A;  3H1N A;  2UZ8 A;  3HHV A;  1TU8 A;  3IE3 A;  4ML1 A;  3EU4 A;  5J4Y A;  3TRQ A;  3C8E A;  2FCH A;  4D73 A;  1WMJ A;  2JZT A;  4K6X A;  1U88 A;  1YKA A;  2FWF A;  2HZE A;  4MZW A;  1ZCP A;  4O5R A;  1V2A A;  5B8A A;  4G19 A;  1FVJ A;  2HRA A;  1K0C A;  2GQK A;  1URM A;  4KUN A;  3ISO A;  3DVX A;  3GRX A;  1QXH A;  1OE7 A;  3EU3 A;  1OC9 B;  2ES7 A;  4Q5Q A;  4WEY A;  5KN0 A;  1FAA A;  4DSR A;  1TU7 A;  2HRF A;  5HFG A;  3F63 A;  1WRY A;  2LRC A;  1QFN A;  5DCH A;  6GSW A;  4IQ1 A;  3D4M A;  4DSQ A;  2YZH A;  4MF7 A;  2HZF A;  1WOU A;  1U87 A;  2MMO A;  1J08 A;  3D0Z A;  3WT1 A;  1V40 A;  5J5N A;  1IYH A;  1JHB A;  3KH7 A;  1B4P A;  3IK9 A;  4YQM A;  2GVP A;  4O5U A;  2D2Z A;  1BG1 A;  4PQH A;  1EZK A;  2FWE A;  4OD7 A;  4X1U A;  5A1N A;  2RII A;  4HQS A;  3IK7 A;  2JZS A;  1B9Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...