5EL8A

The structure of dhar1 from arabidopsis thaliana
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
ALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase DHAR1, mitochondrial
publication title Arabidopsis thaliana DHAR1 apo structure
rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 59
structure length 213
sequence length 213
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5el8A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5el8A01
5DAKA 3GH6A 1MD4A 4ZBAA 1M7TA 3W8JA 3EVIA 4OFNA 4TXOB 1VF3A 2K6VA 3HDCA 2WS2A 4KX4A 3IXRA 3I6AA 1XCCA 2KP2A 3ZYWA 3I69A 3D6IA 3GUSA 2GQLA 5CNWA 2LV3A 1RK4A 1SU9A 3H4KA 1XWGA 4PGTA 2PUKC 4MH3A 3FZ9A 4HQSA 2AUVA 5CRWA 2DBCA 2ZCTA 2I3YA 4GRFA 1ZGNA 4F0CA 1TP9A 8GSSA 3D5JA 3GKKA 1TK8B 1A8YA 2VCQA 5D9XA 2IMIA 2C0GA 2OE0A 2H1DA 4OFMA 4JE1A 3EWLA 2GGTA 5HFIA 4P3YB 1C72A 1PMTA 4YQMA 3O6TA 2IMEA 2HRFA 4XTSA 4FH8A 3PR8A 3FK8A 1F2EA 5GZZB 2WZ9A 1HD2A 1M2DA 4O92A 3LG6A 2I4AA 3DMLA 5ID2A 2XBQA 1GP1A 2OA7A 4IKHA 4IHUA 2PPTA 1UA5A 3P7XA 2YWOA 3P8WA 3UBLA 1N8JA 4EO3A 2PWJA 3GH9A 3F0IA 4NPBA 5IO0A 2HZFA 2KOKA 2RIIA 18GSA 1DBYA 1SJ6A 1F9MA 4BWSA 4MF6A 1AQWA 1A8LA 3WD6A 2L4CA 4IN0A 4K7NA 5F07A 3GN3A 1Z6NA 2X99A 3HZ4A 2GLRA 2YNXA 4GSSA 3EYTA 4LMWA 3KXOA 3HY2A 4J57E 2FGXA 2C3QA 3APQA 4FYUA 3M9JA 1V9WA 1K0DA 2C8UA 3KD0A 3ZVJD 3UBKA 2I1UA 3RAZA 3QPMA 4NXIA 3DXBA 2V41A 3GIXA 2IMDA 1NSWA 1TRUA 4G0KA 5L71A 2VCVA 4MK3A 4X1UA 4ID0A 4WBRD 4G10A 4TXOA 3ZTLA 2Z9SA 4XCSA 5CRGA 1WP0A 3ERWA 3KEBA 5IMZA 3LGCA 3L4NA 3TKPA 1BG5A 5J5NA 3H1NA 1TK0B 16GSA 2E2MA 4D73B 4EC0A 2MYGA 5HFGA 5B8AA 3IV4A 4X43A 1GULA 2REMA 1EZKA 4DVCA 3APOA 1T1VA 2PBJA 2G0FA 2LQOA 5G2ZA 4IP6A 4HS1A 5DBQA 3VWVA 5ELAA 3A3TA 3CSJA 1GWCA 1PN9A 1H4OA 4FYCA 4IW9A 2LEGA 2VLUA 3FR3A 3HJMA 3HYPA 4MMMA 2GZZA 2X8GA 3W6GA 2OBKA 1TOFA 3UOMA 2MMNA 1K0MA 1Z6MA 2L6CA 5D93A 4N30A 3RPPA 2HYXA 1RQMA 2RUEA 2IWTA 2N5AA 4GF0A 3DEXA 3CRUA 1X5EA 2VAFA 3ERGA 4TR4A 6GSSA 1TU8A 1ZMAA 1VF4A 2FHEA 4PUAA 3QOUA 1GSQA 4KDUA 4NAXA 3HCZA 4AJ7A 5J3RA 4DSSB 1JZDA 3F4SA 1XVWA 11GSA 3QR6A 4OD7A 1GNEA 2YN1A 5LNKe 1OE7A 4JBBA 1ST9A 2PN8A 2WULA 1MDIA 2LRNA 4MJAA 1MDKA 2IL3A 3RPNA 5IIZA 2HXKA 3G7JA 2JSZA 3A2WA 5G5EA 3BBYA 4KDYA 3WGEA 2KHPA 4MPFA 1OC8A 4LL4B 5IMAA 1V2AA 3TUEA 2LTKA 2YOIA 5JWQB 2X64A 1DUGA 1YDKA 5DDLA 4TR0A 1SL2B 4HJ2A 4BWQA 4USSA 2B6MA 4K7IA 1AIUA 5CRHA 4KCEA 4GLTA 3BJ5A 3BOAA 1R26A 2F51A 4TR1B 3P2AA 2H19A 2JSYA 2DSAA 3UEMA 1YKCA 3ZMKA 1S3AA 5J4UA 3PPUA 1FB0A 4XRAA 5JCGA 1XZOA 3G9BA 1TRVA 3QAWA 3GURA 1ERWA 2YV9A 3QCPA 2VLTA 3EU3A 2VL9A 2GZYA 2VCTA 4EL1A 3A2VA 4IQAA 4HZ4A 4J56E 3FZ4A 3UIWA 3GV1A 1XWKA 4MZCA 3KMNA 2P0GA 4AGSA 1M2BA 2H66A 5IMVA 5A5KA 2LJKA 2E7PA 5ENUA 4N10A 2H70A 4HU9A 5HQPA 4TW5A 1PL2A 4YAVA 5A4WA 1KEBA 2GT6A 2YANA 2H1AA 3VWXA 1A23A 2CVDA 5G1KA 2IPAA 2VL2C 2P5RA 2RM5A 1BJXA 1SK2A 5CYYA 4EDYA 1XWAA 4HEA2 1F37A 4DSSA 2DC5A 2FD3A 5C04A 1URMA 2CV4A 2DJKA 2I9HA 4ZXGA 5IM9A 1S3DA 2ZUPA 2H01A 4JR4A 3VFIA 1M99A 3UARA 1X5CA 2YWIA 2C3NA 4PX1A 1GUMA 2E2GA 1OC3A 5B6MA 2L4QA 3KIJA 3FRCA 1TTZA 3PH9A 2IFQB 2YJHA 4ZBDA 5D9TA 3IAM2 1Z9HA 12GSA 1KNGA 2QGVA 1DSBA 1I5GA 3VWWA 3TJKA 2VIMA 3MWHA 4IBPA 2O7KA 4PNFA 4KNDA 4K8MA 3ISOA 2HZEB 14GSA 4HU7A 1XFLA 3GTUB 2H6XA 1XWCA 3FR9A 4TR1A 4GTUA 2LNTA 4AJ8A 2AAWA 1HQOA 5B6NA 2P5QA 3Q19A 2HRKA 3TCOA 1VF1A 4RUVA 4POKA 1ABAA 1SD9A 2LJRA 1JZRA 4BVXB 4BA7A 3M1GA 2GSRA 2N5FA 4IJ3A 2FWHA 2IJYA 2XPEA 3TDGA 3D4TA 5A4UA 2H6YA 2OE3A 3CBUA 3KTLA 4MDCA 1GLQA 3UVTA 3IA1A 1K0OA 6GSUA 2CT6A 1SYRA 2IN3A 1UVZA 1PD21 3VWUA 5GSSA 1AXDA 1WMJA 3ZL5A 5D73A 2H8LA 3ZIVA 4MP4A 2WCIA 4TOPA 3IC4A 2YJ7A 3OR5A 1T8EB 2N5BA 4OCFA 5FWGA 3PINA 5J9BA 1YEXA 2AYTA 2RUFA 1TI3A 4HZ2A 1GTBA 1YF0A 4GQFA 1TDIA 1A0FA 2L5OA 2IIYA 4G19A 1X9MB 2YP6A 4DSRA 3ED3A 2DJ1A 5E4WA 1Y25A 3F4RA 4CW9A 1AAZA 2WRTA 3D22A 1TK5B 4BVYB 4RQRA 2H0HA 6GSWA 4ILFA 2NVLA 1HNAA 2VCXA 1XVQA 3ME7A 1QK8A 1PA3A 3BCKA 3HVXA 2IFQA 3D4MA 4V1Ap 3CTFA 2XHFA 2JZSA 3CTGA 3I9V2 3Q18A 1G7EA 3IRAA 2QKEA 2GT5A 2O89A 1FO5A 3WYWA 1ACVA 2GQMA 3I43A 2GSTA 2H71A 2WB9A 4IGJA 4EXJA 2LS5A 4HDEA 4XHMA 1SD8A 3N9JA 5G5FA 1EWXA 3O3TA 4XS1A 2L6DA 1ZYQB 3CRTA 2HZEA 3GTUA 5IPGA 3LORA 3TKSC 3GX0A 1S3CA 4KW6A 4FIWA 1O6JA 4MCUA 2FA8A 3HXSA 4WR5A 3HHVA 3TKQA 3GSTA 5IQYA 1U3AA 4G2EA 3LYKA 1WRYA 4V2MA 2B5YA 1T3BA 1M9AA 1T7PB 4K1FA 1YEPA 4J2FA 1FW1A 2BJXA 2CZ2A 4WF5A 2OE1A 5ECNB 3C1SA 3CXGA 3Q74A 2K18A 5HFKA 3FR6A 3TB2A 3IDVA 5GAND 5GAPD 1JFUA 5F05A 1ERTA 1H75A 1F3AA 1XPVA 1M0UA 3H79A 3GKMA 9GSSA 3RBTA 3KCMA 7GSSA 2A4VA 5KN2A 2LUSA 1Y6EA 2XPDA 1K3YA 3QFBC 2B1LA 5HR1A 3IPZA 1USBA 1WPIA 5AISA 4GQCA 1VRSD 3M3MA 2M80A 4WXTA 2OADA 3TOUA 3QDNA 2R3XA 3P90A 5GSTA 4TN8A 2B3SA 4HOJA 1CQGA 2VOCA 3ZLPA 4TVEA 4KDXA 3D0ZA 4BVYA 3HJOA 3CYNA 2F8FA 2K8SA 1OKTA 3BCIA 1EOHA 3HA9A 1SENA 5D9VA 4I2TA 2YZHA 5IO2A 1U88A 4HQZA 2NTOA 4KH7A 2DIYA 4ECBA 4Q5NA 4GXZA 2WJUA 4WETA 5KN0A 4MJBA 4BL7B 2VL2A 2F3MA 2C4JA 3LQ7A 3F9UA 3LEFA 4MF7A 5F06A 4LLRA 3CSIA 2HNLA 3GRXA 1AQXA 3UL3A 5COHA 2GDRA 1YJ6A 5JCWA 2RM6A 2X8HA 4E8EA 2AJQB 3FHKA 1W89A 2CVBA 2OBIA 1SL1B 1F6MC 4X0XA 2YWMA 4MA9A 4Q5FA 2J23A 4TXVA 1YY7A 2EC4A 1FVJA 2L5LA 1OE8A 3TJJA 2OJLA 3VK9A 4MH2A 2VD1A 2WGRA 1GSDA 3GL3A 1X9WB 5IOXA 4IP1A 2D2ZA 2HQTA 3J7Yk 2MMZA 1LU4A 1OAZA 5EPFA 5AN1A 4MLYA 5BMUA 1EP7A 4GCIA 1JZOA 1QXHA 3FKFA 2CAQA 2JACA 1PL1A 3GA4A 3EE2A 2BTOT 5CRDA 3MNGA 4V1Ag 5DVBA 3DYRA 2OKAA 1K3LA 2CQ9A 4ZL9A 4I2UA 4QL7A 3DVXA 1U3IA 1ML6A 1ERUA 5ECPB 2X8CA 2O87A 2YZUA 2HSMB 5ECSA 3K8NA 4KE3A 1SKSB 4OWYA 4WR4A 2R2JA 4V2LA 1TJDA 4ECCA 4OO5A 4MABA 3RDWA 3FEUA 1A0RP 5KN3A 4D73A 3DKSA 4KUNA 2JL4A 2TRCP 1MTCA 2FY6A 1O8WA 1SKRB 1VF2A 1YZXA 2ALBA 2H1BA 5ECOB 2UZ8A 1EV4A 5HR0A 3DWVA 5CP1A 4EE0A 4FQUA 1G0TA 2LRTA 4BL7A 1M2AA 3KP8A 4Z7XA 3R2QA 3JCML 6GSXA 4I5QA 1PKWA 3F4TA 2FA4A 4OO4A 3GMFA 2B1KA 3UVHA 5J9CA 2P31A 3IHQA 3GHAA 3KTBA 3VLNA 1B4PA 4E8HA 1MDJA 4ZILA 3CMIA 3WGDA 1EGRA 1U87A 1XXUA 3C8EA 1QFNA 4DEJA 1EV9A 4KF9A 2C1YA 1WJKA 2H74A 5ECMB 1ZL9A 2C0EA 2VCWA 1GSYA 3KGKA 1AQVA 1SYXA 2FNOA 2H6ZA 3Q6OA 2R6KA 2C3TA 4XRDA 2NPBA 1ERVA 5LCZA 1SK1A 3LSZA 4NV2A 6GSYA 4HUAA 5CO3A 3C7MA 3ZVJA 4EUYA 1V57A 2CX3A 3VI7A 1Z5YE 2PERA 4WF4A 1GSFA 2M72A 1YKAA 4ZL7A 3WT1A 3N5OA 2TIRA 5INYA 4KA0A 5G30A 1O8XA 2LQQA 3DRNA 1TXXA 2RLIA 2JU5A 4MPGA 2DMLA 2VLVA 1VGLA 3TKSA 2MMOA 3TKRA 1SKWB 1QMVA 1TW9A 1FAAA 5ECLB 1V40A 4EDZA 2DJJA 4N0VA 1ZCPA 3IAS2 4XS6A 4ISDA 4KAEA 1TRSA 3PGTA 1R5PA 3LXTA 2DJ0A 4H86A 1PKZA 3M8NA 1HNBA 5DCHA 1AW9A 2V6KA 3UJ1A 2ON7A 2VCZA 2FWGA 1JHBA 4NHWA 2IMFA 2V32A 4F03A 3HZ8A 1EGOA 2VM1A 2PU9C 4K9ZA 1M9BA 4KGIA 1GNWA 5JCUA 4OFTA 3GKNA 1AUCA 2WFCA 4K6XA 2WDUA 3EMXA 3J7Yb 1J0FA 1TRWA 3DVWA 3L9UA 1O7UA 4Q5QA 1OKDA 1XW5A 5DCGA 5ID2B 4NWYA 1UN2A 1J9BA 1K3OA 22GSA 3LXZA 3A5WA 2MZCA 2PVOC 1B8XA 5IMCA 1R5AA 3FZ5A 3DD3A 2GSQA 6GSTA 4TRXA 4ZL8A 4F0BA 2MMAA 1QGVA 3A2XA 4FO5A 2QSIA 2HI7A 4YH2A 3RHCA 3LWAA 17GSA 1LBKA 1YQ1A 5ECIB 4YQUA 4NMUA 3TJBA 3WT2A 2YPMA 4EVMA 3NOFA 2LRCA 5ECRB 4MF5A 2LNSA 3GFKA 1Q98A 4POLA 1GSUA 3S9FA 3ZZXA 1ON4A 3TRPA 2GS3A 4G0IA 2QC7A 3EMPA 3MSZA 4IJIA 2FUG2 1ZZYA 4KSOA 4LMVA 3HD5A 1XW6A 4PQIA 3LYPA 3RHBA 2GQKA 2HSNB 2CA8A 3GKXA 2H72A 4EKZA 3F3RA 5EY6A 3TGZA 1PQNA 3F63A 4POMA 1WIKA 2DLXA 2AB6A 4QQ7A 3MAKA 1PRXA 2O8VB 4HJMA 3VPQA 1CQHA 3TJGA 2VD0A 2TRXA 2H0GA 3EURA 4WBJA 4RI6A 3L9SA 4PQ1A 1X5DA 3ME8A 1HNCA 2VUPA 1G6YA 1PSQA 4F2IA 2HRNA 1EEJA 3U5RE 1NM3A 5J41A 1GL8A 1E2YA 1GSSA 4G9HA 1XOAA 1O85A 2HLSA 3KMOA 2AHEA 2J9HA 1HYUA 4BVXA 2ES7A 4PNGA 1XW9A 5CAXA 5FHIA 3IK9A 2CVKA 3ZRDA 3GSSA 5ABRA 2LKUA 2H73A 5DJLA 4L8EA 4PTSA 4XIHA 2L57A 2YCDA 3GL5A 3E9JB 5D8IA 2B5EA 2C80A 4JU5A 3FY7A 1THXA 2JADA 4K7OA 1T00A 2EIRA 1BQ7A 1BYEA 1FOVA 1G6WA 4O32A 2IMKA 3US3A 1JLWA 2YWNA 4N0ZA 2NBSA 4AJ6A 5CREA 2M46A 4I97A 4PXOA 4Q5RA 1B48A 5G1LA 4N11A 5JWRB 4ML1A 4MJCA 1I9DA 3FZAA 3ZFLA 2GVPA 1FVKA 4CHSA 3IOSA 4MJEA 2OACA 2B7JA 4GWRA 1R7HA 2VO4A 3EU4A 1K0AA 2CX4A 2H76A 1KTEA 3EINA 4V2NA 4IQ1A 4EF0A 1O73A 2FCHA 1N2AA 1NW2A 3L9VA 2YV7A 1U6TA 3IK7A 3F3QA 3TRQA 5ECHB 2DMMA 1A2JA 3H93A 3VI5A 3G7YA 2HFDA 4JEDA 4NV5A 3IC8A 1KBNA 3EC3A 3VURA 4WKWA 5LD0A 5HR3A 3WGXA 2NDOA 2MBSA 1OC9B 1GTUA 2B5XA 2H1GA 3GNJA 3ZREA 4OMVA 1F3BA 2H75A 1V58A 4YQVA 3ZIJA 1BAYA 4ECIA 1B4QA 3KZQA 2EIQA 1UC7A 4NHZA 4HI7A 5D96A 4F9ZA 1GLPA 2DJ3A 2L59A 1IYIA 2FWEA 2DJ2A 3ZFBA 2VM2A 4RI7A 2ZNMA 5IMDA 3UAPA 4TR3A 1FHEA 1OYJA 4K2DA 4WEYA 3DGQA 5DALB 3H8QA 1GUHA 4IVFA 2LSTA 5H5RA 2HE3A 1OVNA 3U6VA 5B8BA 5E59A 3AY8A 2I81A 5FT3A 1EOGA 4IELA 4MZWA 1FG4A 4G0LA 1SJZA 4K0GA 3HVVA 1K0BA 2R37A 2KP1A 3O76A 4KCAA 1XWBA 3KJYA 5HR2A 4ZBBA 2XC2A 2LJAA 1XOBA 1ZYEA 3TJFA 3TRXA 6GSVA 1YF1A 2JZRA 3G7IA 1NHOA 5DJMA 3IBHA 2K9FA 4POBA 4MZBA 2AV4A 4LL1B 3APSA 5KEJA 4I6XA 4PQHA 1JZWA 2GSSA 1Z3EA 1AC1A 4YAPA 2DIZA 4IS0A 3E3EA 5JWOB 4ZB8A 2K8VA 4RQXA 1Z7RA 3NZNA 1K0CA 3L78A 3IR4A 1K0NA 4GSNA 3HKRA 1THOA 2VL3A 3KP9A 2V2GA 5AGYA 5IPHA 1B9YC 1XBSA 1WWJA 1GH2A 3SBCA 4XS4B 2HRKB 4BPYA 1ZOFA 3GYKA 3QAGA 1OC9A 5AIVA 1T4ZA 2PGTA 4DSQA 4K0NA 1SK0A 3ZMLA 3GX8A 2CAIA 4KB3A 4ACSA 2GTUA 5H5SA 3VPTA 4ULXA 1NHYA 5AIXA 2FLSA 2HT9A 3F6DA 3M0FA 5C00A 3QAVA 1PX6A 2PVQA 3FYGA 1GRXA 4KSMA 20GSA 1MEKA 3TOTA 3HJPA 1O81A 2HRAA 4L0UA 4ML6A 2V1MA 1A2LA 3W8SA 2HSHA 1J08A 3QFAC 2F9SA 1T4YA 1R4WA 10GSA 1W4VA 1LJRA 5DALA 1EEMA 1PGTA 2H0IA 2E0QA 5EL8A 4L0WA 3D21A 4L5LA 1X0RA 5B7CA 3SWLA 3ERFA 5DAKB 1TI1A 4AF2A 1QUWA 4I8BA 3UMAA 3KH7A 4F82A 1ILOA 3C71A 3FW2A 4O5RA 4QL9A 1SJIA 1XIYA 1DE2A 4PURA 3IE3A 3L0HA 2PMTA 2HSMA 2A2RA 1PX7A 3TKSE 2C0FA 2G2QA 4PUFC 3E0UA 1G7OA 3QD9A 5A4VA 2H30A 2V6OA 2KLXA 3C1RA 1QQ2A 5F0GA 3F8UA 1A2MA 1WOUA 1E6BA 2EIOA 2R5GA 3M9KA 1GTIA 1MD3A 5H5QA 1SL0B 5F8BA 5G31A 1Z7PA 3C73A 1IYHA 1FB6A 5IMFA 3LFLA 2F8AA 2XBIA 3F6FA 2JZTA 4CDOA 2O85A 1GTAA 1RW1A 2GZPA 2ON5A 13GSA 1TU7A 5ECQB 3LJRA 5DQSA 4JRRA 4ZIJA 3MDKA 4O7HA 3KH9A 5DQYA 1A24A 4XS4A 4ZB9A 5IOWA 4FYBA 19GSA 3BD2A 4ZB6A 1DE1A 2B7KA 3CSHA 3R3EA 1JLVA 2R4VA 1X9SB 1GUKA 2CZ3A 3NIVA 3HVSA 2C0DA 1WE0A 4GSTA 3KM6A 3QMXA 2BMXA 1BEDA 5KN1A 2FWFA 3V1WA 5EVOA 4LA1A 1TKDB 2MBTA 1B9XC 1V98A 2HSYA 1GSEA 2A2SA 4OCEA 2KUCA 5ELGA 1Q4JA 4TKYA 3ZITA 1EP8A 4JR6A 1BX9A 3DIEA 4L5OA 4JZQA 4ECJA 5ECKB 5D9WA
chains in the Genus database with same CATH superfamily
1XG8A 5DAKA 3GH6A 1MD4A 4ZBAA 1M7TA 3W8JA 3EVIA 4OFNA 4TXOB 1S4BP 1VF3A 2K6VA 3HDCA 2EFDA 2WS2A 4KX4A 3IXRA 3I6AA 1XCCA 2KP2A 3ZYWA 3I69A 3D6IA 3GUSA 2GQLA 5CNWA 1ZYPA 2LV3A 1RK4A 1SU9A 3H4KA 1XWGA 4PGTA 2PUKC 4MH3A 3FZ9A 4HQSA 2AUVA 5CRWA 2DBCA 2ZCTA 2I3YA 4GRFA 1ZGNA 4F0CA 1TP9A 8GSSA 3D5JA 3GKKA 1TK8B 1A8YA 3RFRC 2VCQA 5D9XA 2IMIA 2C0GA 2OE0A 2H1DA 4OFMA 4JE1A 3EWLA 2GGTA 5HFIA 4P3YB 1C72A 1PMTA 4YQMA 3O6TA 4HSCX 2IMEA 2HRFA 4XTSA 4FH8A 3PR8A 3FK8A 1Y1UA 1F2EA 5GZZB 2WZ9A 1HD2A 1M2DA 4O92A 3LG6A 2I4AA 3DMLA 5ID2A 2XBQA 1GP1A 2OA7A 4IKHA 4IHUA 2PPTA 1UA5A 2X4AA 3P7XA 2YWOA 3P8WA 3UBLA 1N8JA 4EO3A 2PWJA 3GH9A 3F0IA 4NPBA 5IO0A 2HZFA 2KOKA 2RIIA 18GSA 1DBYA 1SJ6A 1F9MA 3FMWA 4BWSA 4MF6A 1AQWA 1A8LA 3WD6A 2L4CA 4IN0A 4K7NA 5F07A 3GN3A 1Z6NA 2X99A 3HZ4A 2GLRA 2YNXA 4GSSA 3EYTA 4LMWA 3KXOA 3HY2A 4J57E 2FGXA 2C3QA 3APQA 4FYUA 3M9JA 1V9WA 1K0DA 2C8UA 3KD0A 3ZVJD 3UBKA 2I1UA 3RAZA 3QPMA 4NXIA 3DXBA 2V41A 3GIXA 2IMDA 1NSWA 1TRUA 4G0KA 5L71A 2VCVA 2HSNA 2WW1A 4MK3A 4X1UA 4ID0A 4WBRD 4G10A 4TXOA 3ZTLA 2Z9SA 4XCSA 5CRGA 1WP0A 3ERWA 3KEBA 5IMZA 3LGCA 4GDFA 3L4NA 3TKPA 1BG5A 5J5NA 3H1NA 1TK0B 16GSA 2E2MA 4D73B 4EC0A 2MYGA 5HFGA 5B8AA 3IV4A 4X43A 1GULA 2REMA 1EZKA 4DVCA 5KOXA 3APOA 1T1VA 2PBJA 2G0FA 2LQOA 5G2ZA 4IP6A 4HS1A 5DBQA 3VWVA 5ELAA 3A3TA 4ICYA 3CSJA 1GWCA 1PN9A 1H4OA 4FYCA 4IW9A 2LEGA 2VLUA 3FR3A 3HJMA 3HYPA 4MMMA 2GZZA 2X8GA 3W6GA 2OBKA 1TOFA 3UOMA 2MMNA 1K0MA 1Z6MA 2L6CA 5D93A 4N30A 3RPPA 2HYXA 1RQMA 2RUEA 2IWTA 2N5AA 4GF0A 3DEXA 3CRUA 2WVZA 4W66A 1X5EA 2VAFA 3ERGA 4TR4A 6GSSA 1TU8A 1ZMAA 1VF4A 2FHEA 4PUAA 3QOUA 1GSQA 4KDUA 2H1LA 4NAXA 3HCZA 4AJ7A 5J3RA 4DSSB 1JZDA 3F4SA 1XVWA 11GSA 3QR6A 4OD7A 1GNEA 2YN1A 5LNKe 1OE7A 4JBBA 1ST9A 2PN8A 2WULA 2WVXA 1MDIA 2LRNA 4MJAA 1MDKA 2IL3A 3RPNA 5IIZA 2HXKA 3G7JA 2JSZA 5J40A 3A2WA 5G5EA 3BBYA 4KDYA 3WGEA 2KHPA 4MPFA 1OC8A 4LL4B 5IMAA 1V2AA 3TUEA 2LTKA 2YOIA 5JWQB 2X64A 1DUGA 1YDKA 5DDLA 4TR0A 1SL2B 3CWGA 4HJ2A 4BWQA 4USSA 2B6MA 4K7IA 1AIUA 5CRHA 2R0CA 4KCEA 4GLTA 4X4JA 3BJ5A 3BOAA 1R26A 2F51A 2WW2A 4TR1B 3P2AA 2H19A 2JSYA 2DSAA 3UEMA 1YKCA 3ZMKA 1S3AA 5J4UA 3PPUA 1FB0A 4XRAA 5JCGA 1XZOA 3G9BA 1TRVA 3QAWA 3GURA 1ERWA 2YV9A 3QCPA 2VLTA 3EU3A 4AI6A 2VL9A 2GZYA 2VCTA 4EL1A 3A2VA 4IQAA 1YEWC 4HZ4A 4J56E 3TU3B 3FZ4A 3UIWA 3GV1A 1XWKA 4MZCA 3KMNA 2P0GA 4AGSA 1M2BA 2H66A 5IMVA 5A5KA 2LJKA 2E7PA 5ENUA 4N10A 2H70A 4HU9A 5HQPA 4TW5A 1PL2A 4YAVA 2A2PA 5A4WA 1KEBA 2GT6A 1M3IA 2YANA 2H1AA 3VWXA 1A23A 2CVDA 5G1KA 2IPAA 2VL2C 2P5RA 2RM5A 1BJXA 1SK2A 5CYYA 4EDYA 1XWAA 4HEA2 1F37A 2R0GA 4DSSA 2DC5A 2FD3A 5C04A 1URMA 2CV4A 2DJKA 2I9HA 4ZXGA 5IM9A 1S3DA 2ZUPA 2H01A 4JR4A 3VFIA 1M99A 3UARA 1X5CA 2YWIA 2C3NA 4PX1A 1GUMA 1TXUA 2E2GA 1OC3A 5B6MA 2L4QA 2WVYA 3KIJA 3FRCA 1PN0A 1TTZA 4N3ZA 3PH9A 2IFQB 2YJHA 4ZBDA 5D9TA 4YKGA 4CY8A 3IAM2 1Z9HA 12GSA 1KNGA 2QGVA 1DSBA 1I5GA 3VWWA 3TJKA 2VIMA 3MWHA 4IBPA 2O7KA 4PNFA 4KNDA 4K8MA 3ISOA 2HZEB 14GSA 4HU7A 4AKIA 1XFLA 3GTUB 2H6XA 1XWCA 3FR9A 4TR1A 4GTUA 2LNTA 4AJ8A 2AAWA 1HQOA 5B6NA 2P5QA 3Q19A 3CHXC 2HRKA 3TCOA 1VF1A 4RUVA 4POKA 1ABAA 1SD9A 2LJRA 1JZRA 4BVXB 4BA7A 3M1GA 2GSRA 2N5FA 4IJ3A 2FWHA 2IJYA 2XPEA 3TDGA 3D4TA 5A4UA 2H6YA 2OE3A 3CBUA 3KTLA 4MDCA 1GLQA 3UVTA 4PHZC 3IA1A 1K0OA 6GSUA 2CT6A 1SYRA 2IN3A 1UVZA 1PD21 3VWUA 5GSSA 1AXDA 1WMJA 3ZL5A 5D73A 2H8LA 3ZIVA 4MP4A 2WCIA 4TOPA 3IC4A 2YJ7A 3OR5A 1T8EB 2N5BA 4OCFA 5FWGA 3PINA 1BF5A 5J9BA 1YEXA 2AYTA 2RUFA 1TI3A 4HZ2A 1GTBA 1YF0A 4GQFA 1TDIA 1A0FA 2L5OA 2IIYA 4G19A 1X9MB 2YP6A 4DSRA 3ED3A 2DJ1A 5E4WA 1Y25A 3F4RA 4CW9A 1AAZA 2WRTA 3D22A 1TK5B 4BVYB 1N25A 4RQRA 2H0HA 6GSWA 4ILFA 2NVLA 1HNAA 2VCXA 1XVQA 3ME7A 1QK8A 1PA3A 3BCKA 3HVXA 2IFQA 3D4MA 4V1Ap 3CTFA 2XHFA 3EPTA 2JZSA 3CTGA 3Q18A 3I9V2 1G7EA 3IRAA 2QKEA 2GT5A 2O89A 1FO5A 3WYWA 1ACVA 2GQMA 3I43A 2GSTA 2H71A 2WB9A 4IGJA 4EXJA 2LS5A 4HDEA 4XHMA 1SD8A 3N9JA 5G5FA 1EWXA 3O3TA 4XS1A 2L6DA 1ZYQB 3CRTA 2HZEA 3GTUA 5IPGA 3LORA 3TKSC 3GX0A 1S3CA 4KW6A 4FIWA 1O6JA 4MCUA 2FA8A 3HXSA 4WR5A 3HHVA 3TKQA 3GSTA 5IQYA 1U3AA 4G2EA 3LYKA 1WRYA 4V2MA 2B5YA 1T3BA 1M9AA 1T7PB 4K1FA 1YEPA 4J2FA 1FW1A 2BJXA 2CZ2A 4WF5A 2OE1A 5ECNB 3C1SA 3CXGA 3Q74A 2K18A 2OT3A 5HFKA 3FR6A 4K2XA 3TB2A 3IDVA 5GAND 5BMUB 5GAPD 1JFUA 5F05A 1ERTA 1H75A 1F3AA 1XPVA 1M0UA 3H79A 3GKMA 9GSSA 4E68A 3RBTA 3KCMA 7GSSA 2A4VA 5KN2A 2LUSA 1Y6EA 2XPDA 1K3YA 3QFBC 2B1LA 5HR1A 3IPZA 1USBA 1WPIA 5A5HB 5AISA 4GQCA 2X49A 1VRSD 3M3MA 2M80A 4WXTA 2OADA 3TOUA 3QDNA 2R3XA 3P90A 5GSTA 4TN8A 2B3SA 4HOJA 1CQGA 2VOCA 3ZLPA 4TVEA 4KDXA 3D0ZA 4BVYA 3HJOA 3CYNA 2F8FA 2K8SA 1OKTA 3BCIA 1EOHA 3HA9A 1SENA 5D9VA 4I2TA 2YZHA 5IO2A 1U88A 4HQZA 3RGBC 2NTOA 1ZYNA 4KH7A 2DIYA 5KOWA 4ECBA 4Q5NA 4GXZA 2WJUA 4WETA 5KN0A 4MJBA 4BL7B 2VL2A 2F3MA 2C4JA 3LQ7A 3F9UA 3LEFA 4MF7A 5F06A 4LLRA 3CSIA 2HNLA 3GRXA 1AQXA 3UL3A 5COHA 2GDRA 1YJ6A 5JCWA 2RM6A 2X8HA 4E8EA 2AJQB 3FHKA 1W89A 2CVBA 2OBIA 1SL1B 1F6MC 4X0XA 2YWMA 4MA9A 4Q5FA 2J23A 4TXVA 1YY7A 2EC4A 1FVJA 2L5LA 2EFHA 1OE8A 3TJJA 2OJLA 3VK9A 4MH2A 2VD1A 2WGRA 1GSDA 3GL3A 1X9WB 5IOXA 4MNNA 4IP1A 2D2ZA 2HQTA 3J7Yk 2MMZA 1LU4A 1OAZA 5EPFA 5AN1A 4MLYA 5BMUA 1EP7A 4GCIA 1JZOA 1QXHA 3FKFA 2CAQA 2JACA 1PL1A 3GA4A 3EE2A 5A34B 2BTOT 5CRDA 3MNGA 4V1Ag 5DVBA 3DYRA 2VKZG 2OKAA 1K3LA 2CQ9A 4ZL9A 4I2UA 4QL7A 1S3RA 3DVXA 1U3IA 1ML6A 5A5HA 1ERUA 5ECPB 2X8CA 2O87A 3HMJG 2YZUA 2HSMB 5ECSA 3K8NA 4KE3A 2O36A 1SKSB 4OWYA 4WR4A 2R2JA 4V2LA 4AKXB 1TJDA 4ECCA 4OO5A 4MABA 3RDWA 3FEUA 1A0RP 5KN3A 4D73A 3DKSA 4KUNA 2JL4A 2TRCP 1MTCA 2FY6A 1O8WA 4O5QA 1SKRB 1VF2A 1YZXA 2ALBA 2H1BA 5ECOB 2UZ8A 1EV4A 5HR0A 3DWVA 5CP1A 4EE0A 4FQUA 1G0TA 2LRTA 4BL7A 1M2AA 3KP8A 2WW3A 4Z7XA 3R2QA 3JCML 6GSXA 4I5QA 1PKWA 3F4TA 2FA4A 4OO4A 3GMFA 2B1KA 3UVHA 5J9CA 2P31A 3IHQA 3GHAA 3KTBA 3VLNA 1B4PA 4E8HA 1MDJA 4ZILA 3CMIA 3WGDA 1FOHA 1EGRA 1U87A 1XXUA 3C8EA 1QFNA 4DEJA 1EV9A 4KF9A 2C1YA 1WJKA 2H74A 5ECMB 1ZL9A 2C0EA 2VCWA 1GSYA 2WZSA 3KGKA 1AQVA 1SYXA 2FNOA 2H6ZA 3Q6OA 2R6KA 2C3TA 4XRDA 2NPBA 1ERVA 5LCZA 1SK1A 3LSZA 4NV2A 6GSYA 4HUAA 5CO3A 3C7MA 3ZVJA 4EUYA 1V57A 2CX3A 3VI7A 1Z5YE 2PERA 4WF4A 1GSFA 2M72A 1YKAA 4ZL7A 3WT1A 3N5OA 2TIRA 5INYA 4KA0A 5G30A 4O5UA 1O8XA 2LQQA 3DRNA 1TXXA 5A34A 2RLIA 2JU5A 4MPGA 2DMLA 2VLVA 1VGLA 3TKSA 2MMOA 3TKRA 1SKWB 1QMVA 5J47A 1TW9A 1FAAA 5ECLB 1V40A 4EDZA 2DJJA 4N0VA 1ZCPA 3IAS2 4Z2RA 4XS6A 4ISDA 4KAEA 1TRSA 3PGTA 1R5PA 3LXTA 2DJ0A 2EFCA 1SVOA 4H86A 1PKZA 3M8NA 1HNBA 5DCHA 1AW9A 2V6KA 3UJ1A 2ON7A 2VCZA 4PI2C 2FWGA 1JHBA 4NHWA 2IMFA 2V32A 4F03A 3HZ8A 1EGOA 2VM1A 2PU9C 4K9ZA 1M9BA 4KGIA 1GNWA 5JCUA 4OFTA 4Z2TA 3GKNA 1AUCA 2WFCA 4K6XA 2WDUA 3EMXA 3J7Yb 1J0FA 1TRWA 3DVWA 3L9UA 1O7UA 2QA2A 4Q5QA 1OKDA 1XW5A 5DCGA 5ID2B 4NWYA 1UN2A 1J9BA 4A5PA 1K3OA 22GSA 3LXZA 3A5WA 2MZCA 2PVOC 1B8XA 5IMCA 1M3JA 1R5AA 3FZ5A 3DD3A 2GSQA 6GSTA 4TRXA 4ZL8A 4F0BA 2MMAA 1QGVA 3A2XA 4FO5A 5A1NB 2QSIA 2HI7A 4YH2A 3RHCA 3LWAA 17GSA 1LBKA 1YQ1A 5ECIB 4YQUA 4NMUA 3TJBA 3WT2A 2YPMA 4EVMA 3NOFA 2LRCA 5ECRB 4MF5A 4AKHA 2A4HA 2LNSA 3GFKA 1Q98A 4POLA 1GSUA 3S9FA 3ZZXA 1ON4A 3TRPA 4FXYP 2GS3A 4G0IA 2QC7A 3EMPA 3MSZA 4IJIA 2FUG2 1ZZYA 4KSOA 5J4YA 4LMVA 3HD5A 1XW6A 3MIXA 4PQIA 3IHGA 3LYPA 3RHBA 2GQKA 2HSNB 2CA8A 3GKXA 2H72A 4EKZA 3F3RA 5EY6A 5J4VA 3CQFA 3TGZA 1PQNA 3F63A 4POMA 1WIKA 2DLXA 2AB6A 4QQ7A 3MAKA 1PRXA 2O8VB 4HJMA 2R0PA 3VPQA 1CQHA 3LW9A 3TJGA 2VD0A 2TRXA 2H0GA 3EURA 4WBJA 4RI6A 3L9SA 4PQ1A 1X5DA 3ME8A 1HNCA 2VUPA 1G6YA 1PSQA 4F2IA 2HRNA 1EEJA 3U5RE 1NM3A 5J41A 1GL8A 1E2YA 4K5SA 1GSSA 4G9HA 1XOAA 1O85A 2HLSA 3KMOA 2AHEA 2J9HA 1HYUA 4BVXA 2ES7A 4PNGA 1XW9A 5CAXA 5FHIA 3IK9A 2CVKA 3ZRDA 3MYDA 3GSSA 5ABRA 2LKUA 2H73A 5DJLA 4L8EA 4PTSA 4XIHA 2L57A 3GL5A 2YCDA 3E9JB 5D8IA 2B5EA 2C80A 4JU5A 3FY7A 1THXA 2JADA 4K7OA 1T00A 5BRTA 2O5VA 2EIRA 1BQ7A 1BYEA 1FOVA 1G6WA 5A1NA 4O32A 2IMKA 3US3A 1JLWA 2WVXB 2YWNA 4N0ZA 2NBSA 4AJ6A 5CREA 2M46A 4I97A 4PXOA 4Q5RA 4QMKA 1B48A 5G1LA 4N11A 5JWRB 4ML1A 4MJCA 1I9DA 3FZAA 3ZFLA 2GVPA 1FVKA 4CHSA 3IOSA 4MJEA 2OACA 2B7JA 4GWRA 1R7HA 2VO4A 3EU4A 1K0AA 2CX4A 2H76A 1KTEA 4EIPA 3EINA 4V2NA 4IQ1A 4EF0A 1O73A 2FCHA 1N2AA 1NW2A 3L9VA 2YV7A 1U6TA 3IK7A 3F3QA 3TRQA 5ECHB 2DMMA 1A2JA 3H93A 3VI5A 3G7YA 2HFDA 4JEDA 4NV5A 3IC8A 1KBNA 3EC3A 3VURA 4WKWA 5LD0A 5HR3A 3WGXA 2NDOA 2EFEA 2MBSA 1OC9B 1GTUA 2B5XA 2H1GA 3GNJA 3ZREA 4OMVA 1F3BA 2H75A 1V58A 4YQVA 3ZIJA 1BAYA 4ECIA 1B4QA 3KZQA 2EIQA 1UC7A 4NHZA 4HI7A 5D96A 4AKGA 4F9ZA 1GLPA 2DJ3A 2L59A 1IYIA 2FWEA 2DJ2A 3ZFBA 2VM2A 4RI7A 2ZNMA 5IMDA 3UAPA 4TR3A 1FHEA 1OYJA 4K2DA 4WEYA 3DGQA 5DALB 3H8QA 1GUHA 4IVFA 2LSTA 4PI0C 5H5RA 2HE3A 1OVNA 3U6VA 5B8BA 5E59A 3AY8A 2I81A 5FT3A 1EOGA 4IELA 4MZWA 1FG4A 4G0LA 1SJZA 2UV8G 4K0GA 2QA1A 3HVVA 1K0BA 2R37A 2KP1A 3O76A 4KCAA 1XWBA 4EIQA 3KJYA 5HR2A 4ZBBA 2XC2A 2LJAA 1XOBA 1ZYEA 3TJFA 3TRXA 6GSVA 1YF1A 2JZRA 3G7IA 1NHOA 5DJMA 3IBHA 2O3EA 2K9FA 4POBA 4MZBA 2AV4A 4LL1B 3APSA 5KEJA 4I6XA 4PQHA 1JZWA 2GSSA 1Z3EA 4YKFA 1AC1A 4YAPA 2DIZA 4IS0A 3E3EA 5JWOB 1I1IP 4ZB8A 2K8VA 4RQXA 1Z7RA 3NZNA 1K0CA 3L78A 3IR4A 1K0NA 4Z2UA 4GSNA 3HKRA 1THOA 2VL3A 3KP9A 2V2GA 5AGYA 5IPHA 1B9YC 1XBSA 1WWJA 1GH2A 3SBCA 4K5RA 4XS4B 2HRKB 4BPYA 1PFOA 1ZOFA 3GYKA 3QAGA 1OC9A 5AIVA 2DKHA 1T4ZA 2PGTA 4DSQA 4K0NA 1SK0A 3ZMLA 3HVNA 3GX8A 2CAIA 4KB3A 4ACSA 2GTUA 5H5SA 3VPTA 1BG1A 3A5IA 4ULXA 1NHYA 5AIXA 2FLSA 2HT9A 3F6DA 3M0FA 5C00A 3QAVA 1PX6A 2PVQA 3FYGA 1GRXA 4KSMA 20GSA 1MEKA 3TOTA 1SVLA 3HJPA 1O81A 2HRAA 4L0UA 4ML6A 2V1MA 1A2LA 3W8SA 2HSHA 1J08A 3QFAC 2F9SA 1T4YA 1R4WA 10GSA 1W4VA 1LJRA 5DALA 1EEMA 1PGTA 2H0IA 2E0QA 5EL8A 4L0WA 3D21A 4L5LA 1YVLA 1X0RA 5B7CA 3SWLA 3ERFA 5DAKB 1TI1A 4AF2A 1QUWA 4I8BA 3UMAA 3KH7A 4F82A 1ILOA 3C71A 3FW2A 4O5RA 4QL9A 1SJIA 1XIYA 1DE2A 4PURA 3IE3A 3L0HA 2PMTA 2HSMA 2A2RA 1PX7A 3TKSE 2C0FA 2G2QA 4PUFC 3E0UA 1G7OA 3QD9A 5A4VA 2H30A 2V6OA 2KLXA 3C1RA 1QQ2A 5F0GA 3F8UA 1A2MA 1WOUA 1E6BA 2EIOA 2R5GA 3M9KA 1GTIA 1MD3A 5H5QA 1SL0B 5F8BA 5G31A 1Z7PA 3C73A 1IYHA 1FB6A 5IMFA 3LFLA 2F8AA 2XBIA 3F6FA 2JZTA 4CDOA 2O85A 1GTAA 2DKIA 1RW1A 2GZPA 2ON5A 1SVMA 13GSA 1TU7A 5ECQB 3LJRA 5DQSA 4JRRA 4ZIJA 3MDKA 2WW0A 4G01A 4O7HA 3KH9A 5DQYA 1A24A 4XS4A 4ZB9A 5IOWA 4FYBA 19GSA 3BD2A 4ZB6A 1DE1A 2B7KA 3CSHA 3R3EA 1JLVA 2R4VA 1X9SB 1GUKA 2CZ3A 3NIVA 3HVSA 2C0DA 1WE0A 4GSTA 3KM6A 3QMXA 2BMXA 4CY6A 1BEDA 5KN1A 2FWFA 3V1WA 4ZB7A 5EVOA 4LA1A 1TKDB 2MBTA 1B9XC 1V98A 2HSYA 1GSEA 2A2SA 4OCEA 2KUCA 5ELGA 4BIKA 1Q4JA 4TKYA 3ZITA 1EP8A 4JR6A 1BX9A 3DIEA 4L5OA 4JZQA 4ECJA 5ECKB 5D9WA
chains in the Genus database with same CATH topology
5DAKA 3GH6A 1MD4A 4ZBAA 1M7TA 3W8JA 3EVIA 4OFNA 4TXOB 1VF3A 2K6VA 3HDCA 2EFDA 2WS2A 4KX4A 3IXRA 3I6AA 1XCCA 2KP2A 3ZYWA 3I69A 3D6IA 3GUSA 2GQLA 5CNWA 1ZYPA 2LV3A 1RK4A 1SU9A 3H4KA 1XWGA 4PGTA 2PUKC 4MH3A 3FZ9A 4HQSA 2AUVA 5CRWA 2DBCA 2ZCTA 2I3YA 4GRFA 1ZGNA 4F0CA 1TP9A 8GSSA 3D5JA 3GKKA 1TK8B 1A8YA 2VCQA 5D9XA 2IMIA 2C0GA 2OE0A 2H1DA 4OFMA 4JE1A 3EWLA 2GGTA 5HFIA 4P3YB 1C72A 1PMTA 4YQMA 3O6TA 2IMEA 2HRFA 4XTSA 4FH8A 3PR8A 3FK8A 1Y1UA 1F2EA 5GZZB 2WZ9A 1HD2A 1M2DA 4O92A 3LG6A 2I4AA 3DMLA 5ID2A 2XBQA 1GP1A 2OA7A 4IKHA 4IHUA 2PPTA 1UA5A 2X4AA 3P7XA 2YWOA 3P8WA 3UBLA 1N8JA 4EO3A 2PWJA 3GH9A 3F0IA 4NPBA 5IO0A 2HZFA 2KOKA 2RIIA 18GSA 1DBYA 1SJ6A 1F9MA 3FMWA 4BWSA 4MF6A 1AQWA 1A8LA 3WD6A 2L4CA 4IN0A 4K7NA 5F07A 3GN3A 1Z6NA 2X99A 3HZ4A 2GLRA 2YNXA 4GSSA 3EYTA 4LMWA 3KXOA 3HY2A 4J57E 2FGXA 2C3QA 3APQA 4FYUA 3M9JA 1V9WA 1K0DA 2C8UA 3KD0A 3ZVJD 3UBKA 2I1UA 3RAZA 3QPMA 4NXIA 3DXBA 2V41A 3GIXA 2IMDA 1NSWA 1TRUA 4G0KA 5L71A 2VCVA 2HSNA 4MK3A 4X1UA 4ID0A 4WBRD 4G10A 4TXOA 3ZTLA 2Z9SA 4XCSA 5CRGA 1WP0A 3ERWA 3KEBA 5IMZA 3LGCA 4GDFA 3L4NA 3TKPA 1BG5A 5J5NA 3H1NA 1TK0B 16GSA 2E2MA 4D73B 4EC0A 2MYGA 5HFGA 5B8AA 3IV4A 4X43A 1GULA 2REMA 1EZKA 4DVCA 5KOXA 3APOA 1T1VA 2PBJA 2G0FA 2LQOA 5G2ZA 4IP6A 4HS1A 5DBQA 3VWVA 5ELAA 3A3TA 4ICYA 3CSJA 1GWCA 1PN9A 1H4OA 4FYCA 4IW9A 2LEGA 2VLUA 3FR3A 3HJMA 3HYPA 4MMMA 2GZZA 2X8GA 3W6GA 2OBKA 1TOFA 3UOMA 2MMNA 1K0MA 1Z6MA 2L6CA 5D93A 4N30A 3RPPA 2HYXA 1RQMA 2RUEA 2IWTA 2N5AA 4GF0A 3DEXA 3CRUA 4W66A 1X5EA 2VAFA 3ERGA 4TR4A 6GSSA 1TU8A 1ZMAA 1VF4A 2FHEA 4PUAA 3QOUA 1GSQA 4KDUA 2H1LA 4NAXA 3HCZA 4AJ7A 5J3RA 4DSSB 1JZDA 3F4SA 1XVWA 11GSA 3QR6A 4OD7A 1GNEA 2YN1A 5LNKe 1OE7A 4JBBA 1ST9A 2PN8A 2WULA 1MDIA 2LRNA 4MJAA 1MDKA 2IL3A 3RPNA 5IIZA 2HXKA 3G7JA 2JSZA 5J40A 3A2WA 5G5EA 3BBYA 4KDYA 3WGEA 2KHPA 4MPFA 1OC8A 4LL4B 5IMAA 1V2AA 3TUEA 2LTKA 2YOIA 5JWQB 2X64A 1DUGA 1YDKA 5DDLA 4TR0A 1SL2B 3CWGA 4HJ2A 4BWQA 4USSA 2B6MA 4K7IA 1AIUA 5CRHA 2R0CA 4KCEA 4GLTA 4X4JA 3BJ5A 3BOAA 1R26A 2F51A 4TR1B 3P2AA 2H19A 2JSYA 2DSAA 3UEMA 1YKCA 3ZMKA 1S3AA 5J4UA 3PPUA 1FB0A 4XRAA 5JCGA 1XZOA 3G9BA 1TRVA 3QAWA 3GURA 1ERWA 2YV9A 3QCPA 2VLTA 3EU3A 4AI6A 2VL9A 2GZYA 2VCTA 4EL1A 3A2VA 4IQAA 4HZ4A 4J56E 3TU3B 3FZ4A 3UIWA 3GV1A 1XWKA 4MZCA 3KMNA 2P0GA 4AGSA 1M2BA 2H66A 5IMVA 5A5KA 2LJKA 2E7PA 5ENUA 4N10A 2H70A 4HU9A 5HQPA 4TW5A 1PL2A 4YAVA 2A2PA 5A4WA 1KEBA 2GT6A 2YANA 2H1AA 3VWXA 1A23A 2CVDA 5G1KA 2IPAA 2VL2C 2P5RA 2RM5A 1BJXA 1SK2A 5CYYA 4EDYA 1XWAA 4HEA2 1F37A 2R0GA 4DSSA 2DC5A 2FD3A 5C04A 1URMA 2CV4A 2DJKA 2I9HA 4ZXGA 5IM9A 1S3DA 2ZUPA 2H01A 4JR4A 3VFIA 1M99A 3UARA 1X5CA 2YWIA 2C3NA 4PX1A 1GUMA 1TXUA 2E2GA 1OC3A 5B6MA 2L4QA 3KIJA 3FRCA 1PN0A 1TTZA 4N3ZA 3PH9A 2IFQB 2YJHA 4ZBDA 5D9TA 4YKGA 4CY8A 3IAM2 1Z9HA 12GSA 1KNGA 2QGVA 1DSBA 1I5GA 3VWWA 3TJKA 2VIMA 3MWHA 4IBPA 2O7KA 4PNFA 4KNDA 4K8MA 3ISOA 2HZEB 14GSA 4HU7A 4AKIA 1XFLA 3GTUB 2H6XA 1XWCA 3FR9A 4TR1A 4GTUA 2LNTA 4AJ8A 2AAWA 1HQOA 5B6NA 2P5QA 3Q19A 2HRKA 3TCOA 1VF1A 4RUVA 4POKA 1ABAA 1SD9A 2LJRA 1JZRA 4BVXB 4BA7A 3M1GA 2GSRA 2N5FA 4IJ3A 2FWHA 2IJYA 2XPEA 3TDGA 3D4TA 5A4UA 2H6YA 2OE3A 3CBUA 3KTLA 4MDCA 1GLQA 3UVTA 3IA1A 1K0OA 6GSUA 2CT6A 1SYRA 2IN3A 1UVZA 1PD21 3VWUA 5GSSA 1AXDA 1WMJA 3ZL5A 5D73A 2H8LA 3ZIVA 4MP4A 2WCIA 4TOPA 3IC4A 2YJ7A 3OR5A 1T8EB 2N5BA 4OCFA 5FWGA 3PINA 1BF5A 5J9BA 1YEXA 2AYTA 2RUFA 1TI3A 4HZ2A 1GTBA 1YF0A 4GQFA 1TDIA 1A0FA 2L5OA 2IIYA 4G19A 1X9MB 2YP6A 4DSRA 3ED3A 2DJ1A 5E4WA 1Y25A 3F4RA 4CW9A 1AAZA 2WRTA 3D22A 1TK5B 4BVYB 1N25A 4RQRA 2H0HA 6GSWA 4ILFA 2NVLA 1HNAA 2VCXA 1XVQA 3ME7A 1QK8A 1PA3A 3BCKA 3HVXA 2IFQA 3D4MA 4V1Ap 3CTFA 2XHFA 2JZSA 3CTGA 3EPTA 3Q18A 3I9V2 1G7EA 3IRAA 2QKEA 2GT5A 2O89A 1FO5A 3WYWA 1ACVA 2GQMA 3I43A 2GSTA 2H71A 2WB9A 4IGJA 4EXJA 2LS5A 4HDEA 4XHMA 1SD8A 3N9JA 5G5FA 1EWXA 3O3TA 4XS1A 2L6DA 1ZYQB 3CRTA 2HZEA 3GTUA 5IPGA 3LORA 3TKSC 3GX0A 1S3CA 4KW6A 4FIWA 1O6JA 4MCUA 2FA8A 3HXSA 4WR5A 3HHVA 3TKQA 3GSTA 5IQYA 1U3AA 4G2EA 3LYKA 1WRYA 4V2MA 2B5YA 1T3BA 1M9AA 1T7PB 4K1FA 1YEPA 4J2FA 1FW1A 2BJXA 2CZ2A 4WF5A 2OE1A 5ECNB 3C1SA 3CXGA 3Q74A 2K18A 2OT3A 5HFKA 3FR6A 4K2XA 3TB2A 3IDVA 5GAND 5BMUB 5GAPD 1JFUA 5F05A 1ERTA 1H75A 1F3AA 1XPVA 1M0UA 3H79A 3GKMA 9GSSA 4E68A 3RBTA 3KCMA 7GSSA 2A4VA 5KN2A 2LUSA 1Y6EA 2XPDA 1K3YA 3QFBC 2B1LA 5HR1A 3IPZA 1USBA 1WPIA 5A5HB 5AISA 4GQCA 2X49A 1VRSD 3M3MA 2M80A 4WXTA 2OADA 3TOUA 3QDNA 2R3XA 3P90A 5GSTA 4TN8A 2B3SA 4HOJA 1CQGA 2VOCA 3ZLPA 4TVEA 4KDXA 3D0ZA 4BVYA 3HJOA 3CYNA 2F8FA 2K8SA 1OKTA 3BCIA 1EOHA 3HA9A 1SENA 5D9VA 4I2TA 2YZHA 5IO2A 1U88A 4HQZA 2NTOA 1ZYNA 4KH7A 2DIYA 5KOWA 4ECBA 4Q5NA 4GXZA 2WJUA 4WETA 5KN0A 4MJBA 4BL7B 2VL2A 2F3MA 2C4JA 3LQ7A 3F9UA 3LEFA 4MF7A 5F06A 4LLRA 3CSIA 2HNLA 3GRXA 1AQXA 3UL3A 5COHA 2GDRA 1YJ6A 5JCWA 2RM6A 2X8HA 4E8EA 2AJQB 3FHKA 1W89A 2CVBA 2OBIA 1SL1B 1F6MC 4X0XA 2YWMA 4MA9A 4Q5FA 2J23A 4TXVA 1YY7A 2EC4A 1FVJA 2L5LA 2EFHA 1OE8A 3TJJA 2OJLA 3VK9A 4MH2A 2VD1A 2WGRA 1GSDA 3GL3A 1X9WB 5IOXA 4MNNA 4IP1A 2D2ZA 2HQTA 3J7Yk 2MMZA 1LU4A 1OAZA 5EPFA 5AN1A 4MLYA 5BMUA 1EP7A 4GCIA 1JZOA 1QXHA 3FKFA 2CAQA 2JACA 1PL1A 3GA4A 3EE2A 5A34B 2BTOT 5CRDA 3MNGA 4V1Ag 5DVBA 3DYRA 2VKZG 2OKAA 1K3LA 2CQ9A 4ZL9A 4I2UA 4QL7A 3DVXA 1U3IA 1ML6A 5A5HA 1ERUA 5ECPB 2X8CA 2O87A 3HMJG 2YZUA 2HSMB 5ECSA 3K8NA 4KE3A 1SKSB 4OWYA 4WR4A 2R2JA 4V2LA 4AKXB 1TJDA 4ECCA 4OO5A 4MABA 3RDWA 3FEUA 1A0RP 5KN3A 4D73A 3DKSA 4KUNA 2JL4A 2TRCP 1MTCA 2FY6A 1O8WA 4O5QA 1SKRB 1VF2A 1YZXA 2ALBA 2H1BA 5ECOB 2UZ8A 1EV4A 5HR0A 3DWVA 5CP1A 4EE0A 4FQUA 1G0TA 2LRTA 4BL7A 1M2AA 3KP8A 4Z7XA 3R2QA 3JCML 6GSXA 4I5QA 1PKWA 3F4TA 2FA4A 4OO4A 3GMFA 2B1KA 3UVHA 5J9CA 2P31A 3IHQA 3GHAA 3KTBA 3VLNA 1B4PA 4E8HA 1MDJA 4ZILA 3CMIA 3WGDA 1FOHA 1EGRA 1U87A 1XXUA 3C8EA 1QFNA 4DEJA 1EV9A 4KF9A 2C1YA 1WJKA 2H74A 5ECMB 1ZL9A 2C0EA 2VCWA 1GSYA 3KGKA 1AQVA 1SYXA 2FNOA 2H6ZA 3Q6OA 2R6KA 2C3TA 4XRDA 2NPBA 1ERVA 5LCZA 1SK1A 3LSZA 4NV2A 6GSYA 4HUAA 5CO3A 3C7MA 3ZVJA 4EUYA 1V57A 2CX3A 3VI7A 1Z5YE 2PERA 4WF4A 1GSFA 2M72A 1YKAA 4ZL7A 3WT1A 3N5OA 2TIRA 5INYA 4KA0A 5G30A 4O5UA 1O8XA 2LQQA 3DRNA 1TXXA 5A34A 2RLIA 2JU5A 4MPGA 2DMLA 2VLVA 1VGLA 3TKSA 2MMOA 3TKRA 1SKWB 1QMVA 5J47A 1TW9A 1FAAA 5ECLB 1V40A 4EDZA 2DJJA 4N0VA 1ZCPA 3IAS2 4Z2RA 4XS6A 4ISDA 4KAEA 1TRSA 3PGTA 1R5PA 3LXTA 2DJ0A 2EFCA 1SVOA 4H86A 1PKZA 3M8NA 1HNBA 5DCHA 1AW9A 2V6KA 3UJ1A 2ON7A 2VCZA 2FWGA 1JHBA 4NHWA 2IMFA 2V32A 4F03A 3HZ8A 1EGOA 2VM1A 2PU9C 4K9ZA 1M9BA 4KGIA 1GNWA 5JCUA 4OFTA 4Z2TA 3GKNA 1AUCA 2WFCA 4K6XA 2WDUA 3EMXA 3J7Yb 1J0FA 1TRWA 3DVWA 3L9UA 1O7UA 2QA2A 4Q5QA 1OKDA 1XW5A 5DCGA 5ID2B 4NWYA 1UN2A 1J9BA 4A5PA 1K3OA 22GSA 3LXZA 3A5WA 2MZCA 2PVOC 1B8XA 5IMCA 1R5AA 3FZ5A 3DD3A 2GSQA 6GSTA 4TRXA 4ZL8A 4F0BA 2MMAA 1QGVA 3A2XA 4FO5A 5A1NB 2QSIA 2HI7A 4YH2A 3RHCA 3LWAA 17GSA 1LBKA 1YQ1A 5ECIB 4YQUA 4NMUA 3TJBA 3WT2A 2YPMA 4EVMA 3NOFA 2LRCA 5ECRB 4MF5A 4AKHA 2A4HA 2LNSA 3GFKA 1Q98A 4POLA 1GSUA 3S9FA 3ZZXA 1ON4A 3TRPA 2GS3A 4G0IA 2QC7A 3EMPA 3MSZA 4IJIA 2FUG2 1ZZYA 4KSOA 5J4YA 4LMVA 3HD5A 1XW6A 3MIXA 4PQIA 3IHGA 3LYPA 3RHBA 2GQKA 2HSNB 2CA8A 3GKXA 2H72A 4EKZA 3F3RA 5EY6A 5J4VA 3TGZA 1PQNA 3F63A 4POMA 1WIKA 2DLXA 2AB6A 4QQ7A 3MAKA 1PRXA 2O8VB 4HJMA 2R0PA 3VPQA 1CQHA 3LW9A 3TJGA 2VD0A 2TRXA 2H0GA 3EURA 4WBJA 4RI6A 3L9SA 4PQ1A 1X5DA 3ME8A 1HNCA 2VUPA 1G6YA 1PSQA 4F2IA 2HRNA 1EEJA 3U5RE 1NM3A 5J41A 1GL8A 1E2YA 4K5SA 1GSSA 4G9HA 1XOAA 1O85A 2HLSA 3KMOA 2AHEA 2J9HA 1HYUA 4BVXA 2ES7A 4PNGA 1XW9A 5CAXA 5FHIA 3IK9A 2CVKA 3ZRDA 3MYDA 3GSSA 5ABRA 2LKUA 2H73A 5DJLA 4L8EA 4PTSA 4XIHA 2L57A 2YCDA 3GL5A 3E9JB 5D8IA 2B5EA 2C80A 4JU5A 3FY7A 1THXA 2JADA 4K7OA 1T00A 5BRTA 2O5VA 2EIRA 1BQ7A 1BYEA 1FOVA 1G6WA 5A1NA 4O32A 2IMKA 3US3A 1JLWA 2YWNA 4N0ZA 2NBSA 4AJ6A 5CREA 2M46A 4I97A 4PXOA 4Q5RA 4QMKA 1B48A 5G1LA 4N11A 5JWRB 4ML1A 4MJCA 1I9DA 3FZAA 3ZFLA 2GVPA 1FVKA 4CHSA 3IOSA 4MJEA 2OACA 2B7JA 4GWRA 1R7HA 2VO4A 3EU4A 1K0AA 2CX4A 2H76A 1KTEA 4EIPA 3EINA 4V2NA 4IQ1A 4EF0A 1O73A 2FCHA 1N2AA 1NW2A 3L9VA 2YV7A 1U6TA 3IK7A 3F3QA 3TRQA 5ECHB 2DMMA 1A2JA 3H93A 3VI5A 3G7YA 2HFDA 4JEDA 4NV5A 3IC8A 1KBNA 3EC3A 3VURA 4WKWA 5LD0A 5HR3A 3WGXA 2NDOA 2EFEA 2MBSA 1OC9B 1GTUA 2B5XA 2H1GA 3GNJA 3ZREA 4OMVA 1F3BA 2H75A 1V58A 4YQVA 3ZIJA 1BAYA 4ECIA 1B4QA 3KZQA 2EIQA 1UC7A 4NHZA 4HI7A 5D96A 4AKGA 4F9ZA 1GLPA 2DJ3A 2L59A 1IYIA 2FWEA 2DJ2A 3ZFBA 2VM2A 4RI7A 2ZNMA 5IMDA 3UAPA 4TR3A 1FHEA 1OYJA 4K2DA 4WEYA 3DGQA 5DALB 3H8QA 1GUHA 4IVFA 2LSTA 5H5RA 2HE3A 1OVNA 3U6VA 5B8BA 5E59A 3AY8A 2I81A 5FT3A 1EOGA 4IELA 4MZWA 1FG4A 4G0LA 1SJZA 2UV8G 4K0GA 2QA1A 3HVVA 1K0BA 2R37A 2KP1A 3O76A 4KCAA 1XWBA 4EIQA 3KJYA 5HR2A 4ZBBA 2XC2A 2LJAA 1XOBA 1ZYEA 3TJFA 3TRXA 6GSVA 1YF1A 2JZRA 3G7IA 1NHOA 5DJMA 3IBHA 2K9FA 4POBA 4MZBA 2AV4A 4LL1B 3APSA 5KEJA 4I6XA 4PQHA 1JZWA 2GSSA 1Z3EA 4YKFA 1AC1A 4YAPA 2DIZA 4IS0A 3E3EA 5JWOB 4ZB8A 2K8VA 4RQXA 1Z7RA 3NZNA 1K0CA 3L78A 3IR4A 1K0NA 4Z2UA 4GSNA 3HKRA 1THOA 2VL3A 3KP9A 2V2GA 5AGYA 5IPHA 1B9YC 1XBSA 1WWJA 1GH2A 3SBCA 4K5RA 4XS4B 2HRKB 4BPYA 1ZOFA 3GYKA 3QAGA 1OC9A 5AIVA 2DKHA 1T4ZA 2PGTA 4DSQA 4K0NA 1SK0A 3ZMLA 3GX8A 2CAIA 4KB3A 4ACSA 2GTUA 5H5SA 3VPTA 1BG1A 3A5IA 4ULXA 1NHYA 5AIXA 2FLSA 2HT9A 3F6DA 3M0FA 5C00A 3QAVA 1PX6A 2PVQA 3FYGA 1GRXA 4KSMA 20GSA 1MEKA 3TOTA 1SVLA 3HJPA 1O81A 2HRAA 4L0UA 4ML6A 2V1MA 1A2LA 3W8SA 2HSHA 1J08A 3QFAC 2F9SA 1T4YA 1R4WA 10GSA 1W4VA 1LJRA 5DALA 1EEMA 1PGTA 2H0IA 2E0QA 5EL8A 4L0WA 3D21A 4L5LA 1YVLA 1X0RA 5B7CA 3SWLA 3ERFA 5DAKB 1TI1A 4AF2A 1QUWA 4I8BA 3UMAA 3KH7A 4F82A 1ILOA 3C71A 3FW2A 4O5RA 4QL9A 1SJIA 1XIYA 1DE2A 4PURA 3IE3A 3L0HA 2PMTA 2HSMA 2A2RA 1PX7A 3TKSE 2C0FA 2G2QA 4PUFC 3E0UA 1G7OA 3QD9A 5A4VA 2H30A 2V6OA 2KLXA 3C1RA 1QQ2A 5F0GA 3F8UA 1A2MA 1WOUA 1E6BA 2EIOA 2R5GA 3M9KA 1GTIA 1MD3A 5H5QA 1SL0B 5F8BA 5G31A 1Z7PA 3C73A 1IYHA 1FB6A 5IMFA 3LFLA 2F8AA 2XBIA 3F6FA 2JZTA 4CDOA 2O85A 1GTAA 2DKIA 1RW1A 2GZPA 2ON5A 1SVMA 13GSA 1TU7A 5ECQB 3LJRA 5DQSA 4JRRA 4ZIJA 3MDKA 4O7HA 4G01A 3KH9A 5DQYA 1A24A 4XS4A 4ZB9A 5IOWA 4FYBA 19GSA 3BD2A 4ZB6A 1DE1A 2B7KA 3CSHA 3R3EA 1JLVA 2R4VA 1X9SB 1GUKA 2CZ3A 3NIVA 3HVSA 2C0DA 1WE0A 4GSTA 3KM6A 3QMXA 2BMXA 4CY6A 1BEDA 5KN1A 2FWFA 3V1WA 4ZB7A 5EVOA 4LA1A 1TKDB 2MBTA 1B9XC 1V98A 2HSYA 1GSEA 2A2SA 4OCEA 2KUCA 5ELGA 1Q4JA 4TKYA 3ZITA 1EP8A 4JR6A 1BX9A 3DIEA 4L5OA 4JZQA 4ECJA 5ECKB 5D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAK A;  3GH6 A;  1MD4 A;  4ZBA A;  1M7T A;  3W8J A;  3EVI A;  4OFN A;  4TXO B;  1VF3 A;  2K6V A;  3HDC A;  2WS2 A;  4KX4 A;  3IXR A;  3I6A A;  1XCC A;  2KP2 A;  3ZYW A;  3I69 A;  3D6I A;  3GUS A;  2GQL A;  5CNW A;  2LV3 A;  1RK4 A;  1SU9 A;  3H4K A;  1XWG A;  4PGT A;  2PUK C;  4MH3 A;  3FZ9 A;  4HQS A;  2AUV A;  5CRW A;  2DBC A;  2ZCT A;  2I3Y A;  4GRF A;  1ZGN A;  4F0C A;  1TP9 A;  8GSS A;  3D5J A;  3GKK A;  1TK8 B;  1A8Y A;  2VCQ A;  5D9X A;  2IMI A;  2C0G A;  2OE0 A;  2H1D A;  4OFM A;  4JE1 A;  3EWL A;  2GGT A;  5HFI A;  4P3Y B;  1C72 A;  1PMT A;  4YQM A;  3O6T A;  2IME A;  2HRF A;  4XTS A;  4FH8 A;  3PR8 A;  3FK8 A;  1F2E A;  5GZZ B;  2WZ9 A;  1HD2 A;  1M2D A;  4O92 A;  3LG6 A;  2I4A A;  3DML A;  5ID2 A;  2XBQ A;  1GP1 A;  2OA7 A;  4IKH A;  4IHU A;  2PPT A;  1UA5 A;  3P7X A;  2YWO A;  3P8W A;  3UBL A;  1N8J A;  4EO3 A;  2PWJ A;  3GH9 A;  3F0I A;  4NPB A;  5IO0 A;  2HZF A;  2KOK A;  2RII A;  18GS A;  1DBY A;  1SJ6 A;  1F9M A;  4BWS A;  4MF6 A;  1AQW A;  1A8L A;  3WD6 A;  2L4C A;  4IN0 A;  4K7N A;  5F07 A;  3GN3 A;  1Z6N A;  2X99 A;  3HZ4 A;  2GLR A;  2YNX A;  4GSS A;  3EYT A;  4LMW A;  3KXO A;  3HY2 A;  4J57 E;  2FGX A;  2C3Q A;  3APQ A;  4FYU A;  3M9J A;  1V9W A;  1K0D A;  2C8U A;  3KD0 A;  3ZVJ D;  3UBK A;  2I1U A;  3RAZ A;  3QPM A;  4NXI A;  3DXB A;  2V41 A;  3GIX A;  2IMD A;  1NSW A;  1TRU A;  4G0K A;  5L71 A;  2VCV A;  4MK3 A;  4X1U A;  4ID0 A;  4WBR D;  4G10 A;  4TXO A;  3ZTL A;  2Z9S A;  4XCS A;  5CRG A;  1WP0 A;  3ERW A;  3KEB A;  5IMZ A;  3LGC A;  3L4N A;  3TKP A;  1BG5 A;  5J5N A;  3H1N A;  1TK0 B;  16GS A;  2E2M A;  4D73 B;  4EC0 A;  2MYG A;  5HFG A;  5B8A A;  3IV4 A;  4X43 A;  1GUL A;  2REM A;  1EZK A;  4DVC A;  3APO A;  1T1V A;  2PBJ A;  2G0F A;  2LQO A;  5G2Z A;  4IP6 A;  4HS1 A;  5DBQ A;  3VWV A;  5ELA A;  3A3T A;  3CSJ A;  1GWC A;  1PN9 A;  1H4O A;  4FYC A;  4IW9 A;  2LEG A;  2VLU A;  3FR3 A;  3HJM A;  3HYP A;  4MMM A;  2GZZ A;  2X8G A;  3W6G A;  2OBK A;  1TOF A;  3UOM A;  2MMN A;  1K0M A;  1Z6M A;  2L6C A;  5D93 A;  4N30 A;  3RPP A;  2HYX A;  1RQM A;  2RUE A;  2IWT A;  2N5A A;  4GF0 A;  3DEX A;  3CRU A;  1X5E A;  2VAF A;  3ERG A;  4TR4 A;  6GSS A;  1TU8 A;  1ZMA A;  1VF4 A;  2FHE A;  4PUA A;  3QOU A;  1GSQ A;  4KDU A;  4NAX A;  3HCZ A;  4AJ7 A;  5J3R A;  4DSS B;  1JZD A;  3F4S A;  1XVW A;  11GS A;  3QR6 A;  4OD7 A;  1GNE A;  2YN1 A;  5LNK e;  1OE7 A;  4JBB A;  1ST9 A;  2PN8 A;  2WUL A;  1MDI A;  2LRN A;  4MJA A;  1MDK A;  2IL3 A;  3RPN A;  5IIZ A;  2HXK A;  3G7J A;  2JSZ A;  3A2W A;  5G5E A;  3BBY A;  4KDY A;  3WGE A;  2KHP A;  4MPF A;  1OC8 A;  4LL4 B;  5IMA A;  1V2A A;  3TUE A;  2LTK A;  2YOI A;  5JWQ B;  2X64 A;  1DUG A;  1YDK A;  5DDL A;  4TR0 A;  1SL2 B;  4HJ2 A;  4BWQ A;  4USS A;  2B6M A;  4K7I A;  1AIU A;  5CRH A;  4KCE A;  4GLT A;  3BJ5 A;  3BOA A;  1R26 A;  2F51 A;  4TR1 B;  3P2A A;  2H19 A;  2JSY A;  2DSA A;  3UEM A;  1YKC A;  3ZMK A;  1S3A A;  5J4U A;  3PPU A;  1FB0 A;  4XRA A;  5JCG A;  1XZO A;  3G9B A;  1TRV A;  3QAW A;  3GUR A;  1ERW A;  2YV9 A;  3QCP A;  2VLT A;  3EU3 A;  2VL9 A;  2GZY A;  2VCT A;  4EL1 A;  3A2V A;  4IQA A;  4HZ4 A;  4J56 E;  3FZ4 A;  3UIW A;  3GV1 A;  1XWK A;  4MZC A;  3KMN A;  2P0G A;  4AGS A;  1M2B A;  2H66 A;  5IMV A;  5A5K A;  2LJK A;  2E7P A;  5ENU A;  4N10 A;  2H70 A;  4HU9 A;  5HQP A;  4TW5 A;  1PL2 A;  4YAV A;  5A4W A;  1KEB A;  2GT6 A;  2YAN A;  2H1A A;  3VWX A;  1A23 A;  2CVD A;  5G1K A;  2IPA A;  2VL2 C;  2P5R A;  2RM5 A;  1BJX A;  1SK2 A;  5CYY A;  4EDY A;  1XWA A;  4HEA 2;  1F37 A;  4DSS A;  2DC5 A;  2FD3 A;  5C04 A;  1URM A;  2CV4 A;  2DJK A;  2I9H A;  4ZXG A;  5IM9 A;  1S3D A;  2ZUP A;  2H01 A;  4JR4 A;  3VFI A;  1M99 A;  3UAR A;  1X5C A;  2YWI A;  2C3N A;  4PX1 A;  1GUM A;  2E2G A;  1OC3 A;  5B6M A;  2L4Q A;  3KIJ A;  3FRC A;  1TTZ A;  3PH9 A;  2IFQ B;  2YJH A;  4ZBD A;  5D9T A;  3IAM 2;  1Z9H A;  12GS A;  1KNG A;  2QGV A;  1DSB A;  1I5G A;  3VWW A;  3TJK A;  2VIM A;  3MWH A;  4IBP A;  2O7K A;  4PNF A;  4KND A;  4K8M A;  3ISO A;  2HZE B;  14GS A;  4HU7 A;  1XFL A;  3GTU B;  2H6X A;  1XWC A;  3FR9 A;  4TR1 A;  4GTU A;  2LNT A;  4AJ8 A;  2AAW A;  1HQO A;  5B6N A;  2P5Q A;  3Q19 A;  2HRK A;  3TCO A;  1VF1 A;  4RUV A;  4POK A;  1ABA A;  1SD9 A;  2LJR A;  1JZR A;  4BVX B;  4BA7 A;  3M1G A;  2GSR A;  2N5F A;  4IJ3 A;  2FWH A;  2IJY A;  2XPE A;  3TDG A;  3D4T A;  5A4U A;  2H6Y A;  2OE3 A;  3CBU A;  3KTL A;  4MDC A;  1GLQ A;  3UVT A;  3IA1 A;  1K0O A;  6GSU A;  2CT6 A;  1SYR A;  2IN3 A;  1UVZ A;  1PD2 1;  3VWU A;  5GSS A;  1AXD A;  1WMJ A;  3ZL5 A;  5D73 A;  2H8L A;  3ZIV A;  4MP4 A;  2WCI A;  4TOP A;  3IC4 A;  2YJ7 A;  3OR5 A;  1T8E B;  2N5B A;  4OCF A;  5FWG A;  3PIN A;  5J9B A;  1YEX A;  2AYT A;  2RUF A;  1TI3 A;  4HZ2 A;  1GTB A;  1YF0 A;  4GQF A;  1TDI A;  1A0F A;  2L5O A;  2IIY A;  4G19 A;  1X9M B;  2YP6 A;  4DSR A;  3ED3 A;  2DJ1 A;  5E4W A;  1Y25 A;  3F4R A;  4CW9 A;  1AAZ A;  2WRT A;  3D22 A;  1TK5 B;  4BVY B;  4RQR A;  2H0H A;  6GSW A;  4ILF A;  2NVL A;  1HNA A;  2VCX A;  1XVQ A;  3ME7 A;  1QK8 A;  1PA3 A;  3BCK A;  3HVX A;  2IFQ A;  3D4M A;  4V1A p;  3CTF A;  2XHF A;  2JZS A;  3CTG A;  3I9V 2;  3Q18 A;  1G7E A;  3IRA A;  2QKE A;  2GT5 A;  2O89 A;  1FO5 A;  3WYW A;  1ACV A;  2GQM A;  3I43 A;  2GST A;  2H71 A;  2WB9 A;  4IGJ A;  4EXJ A;  2LS5 A;  4HDE A;  4XHM A;  1SD8 A;  3N9J A;  5G5F A;  1EWX A;  3O3T A;  4XS1 A;  2L6D A;  1ZYQ B;  3CRT A;  2HZE A;  3GTU A;  5IPG A;  3LOR A;  3TKS C;  3GX0 A;  1S3C A;  4KW6 A;  4FIW A;  1O6J A;  4MCU A;  2FA8 A;  3HXS A;  4WR5 A;  3HHV A;  3TKQ A;  3GST A;  5IQY A;  1U3A A;  4G2E A;  3LYK A;  1WRY A;  4V2M A;  2B5Y A;  1T3B A;  1M9A A;  1T7P B;  4K1F A;  1YEP A;  4J2F A;  1FW1 A;  2BJX A;  2CZ2 A;  4WF5 A;  2OE1 A;  5ECN B;  3C1S A;  3CXG A;  3Q74 A;  2K18 A;  5HFK A;  3FR6 A;  3TB2 A;  3IDV A;  5GAN D;  5GAP D;  1JFU A;  5F05 A;  1ERT A;  1H75 A;  1F3A A;  1XPV A;  1M0U A;  3H79 A;  3GKM A;  9GSS A;  3RBT A;  3KCM A;  7GSS A;  2A4V A;  5KN2 A;  2LUS A;  1Y6E A;  2XPD A;  1K3Y A;  3QFB C;  2B1L A;  5HR1 A;  3IPZ A;  1USB A;  1WPI A;  5AIS A;  4GQC A;  1VRS D;  3M3M A;  2M80 A;  4WXT A;  2OAD A;  3TOU A;  3QDN A;  2R3X A;  3P90 A;  5GST A;  4TN8 A;  2B3S A;  4HOJ A;  1CQG A;  2VOC A;  3ZLP A;  4TVE A;  4KDX A;  3D0Z A;  4BVY A;  3HJO A;  3CYN A;  2F8F A;  2K8S A;  1OKT A;  3BCI A;  1EOH A;  3HA9 A;  1SEN A;  5D9V A;  4I2T A;  2YZH A;  5IO2 A;  1U88 A;  4HQZ A;  2NTO A;  4KH7 A;  2DIY A;  4ECB A;  4Q5N A;  4GXZ A;  2WJU A;  4WET A;  5KN0 A;  4MJB A;  4BL7 B;  2VL2 A;  2F3M A;  2C4J A;  3LQ7 A;  3F9U A;  3LEF A;  4MF7 A;  5F06 A;  4LLR A;  3CSI A;  2HNL A;  3GRX A;  1AQX A;  3UL3 A;  5COH A;  2GDR A;  1YJ6 A;  5JCW A;  2RM6 A;  2X8H A;  4E8E A;  2AJQ B;  3FHK A;  1W89 A;  2CVB A;  2OBI A;  1SL1 B;  1F6M C;  4X0X A;  2YWM A;  4MA9 A;  4Q5F A;  2J23 A;  4TXV A;  1YY7 A;  2EC4 A;  1FVJ A;  2L5L A;  1OE8 A;  3TJJ A;  2OJL A;  3VK9 A;  4MH2 A;  2VD1 A;  2WGR A;  1GSD A;  3GL3 A;  1X9W B;  5IOX A;  4IP1 A;  2D2Z A;  2HQT A;  3J7Y k;  2MMZ A;  1LU4 A;  1OAZ A;  5EPF A;  5AN1 A;  4MLY A;  5BMU A;  1EP7 A;  4GCI A;  1JZO A;  1QXH A;  3FKF A;  2CAQ A;  2JAC A;  1PL1 A;  3GA4 A;  3EE2 A;  2BTO T;  5CRD A;  3MNG A;  4V1A g;  5DVB A;  3DYR A;  2OKA A;  1K3L A;  2CQ9 A;  4ZL9 A;  4I2U A;  4QL7 A;  3DVX A;  1U3I A;  1ML6 A;  1ERU A;  5ECP B;  2X8C A;  2O87 A;  2YZU A;  2HSM B;  5ECS A;  3K8N A;  4KE3 A;  1SKS B;  4OWY A;  4WR4 A;  2R2J A;  4V2L A;  1TJD A;  4ECC A;  4OO5 A;  4MAB A;  3RDW A;  3FEU A;  1A0R P;  5KN3 A;  4D73 A;  3DKS A;  4KUN A;  2JL4 A;  2TRC P;  1MTC A;  2FY6 A;  1O8W A;  1SKR B;  1VF2 A;  1YZX A;  2ALB A;  2H1B A;  5ECO B;  2UZ8 A;  1EV4 A;  5HR0 A;  3DWV A;  5CP1 A;  4EE0 A;  4FQU A;  1G0T A;  2LRT A;  4BL7 A;  1M2A A;  3KP8 A;  4Z7X A;  3R2Q A;  3JCM L;  6GSX A;  4I5Q A;  1PKW A;  3F4T A;  2FA4 A;  4OO4 A;  3GMF A;  2B1K A;  3UVH A;  5J9C A;  2P31 A;  3IHQ A;  3GHA A;  3KTB A;  3VLN A;  1B4P A;  4E8H A;  1MDJ A;  4ZIL A;  3CMI A;  3WGD A;  1EGR A;  1U87 A;  1XXU A;  3C8E A;  1QFN A;  4DEJ A;  1EV9 A;  4KF9 A;  2C1Y A;  1WJK A;  2H74 A;  5ECM B;  1ZL9 A;  2C0E A;  2VCW A;  1GSY A;  3KGK A;  1AQV A;  1SYX A;  2FNO A;  2H6Z A;  3Q6O A;  2R6K A;  2C3T A;  4XRD A;  2NPB A;  1ERV A;  5LCZ A;  1SK1 A;  3LSZ A;  4NV2 A;  6GSY A;  4HUA A;  5CO3 A;  3C7M A;  3ZVJ A;  4EUY A;  1V57 A;  2CX3 A;  3VI7 A;  1Z5Y E;  2PER A;  4WF4 A;  1GSF A;  2M72 A;  1YKA A;  4ZL7 A;  3WT1 A;  3N5O A;  2TIR A;  5INY A;  4KA0 A;  5G30 A;  1O8X A;  2LQQ A;  3DRN A;  1TXX A;  2RLI A;  2JU5 A;  4MPG A;  2DML A;  2VLV A;  1VGL A;  3TKS A;  2MMO A;  3TKR A;  1SKW B;  1QMV A;  1TW9 A;  1FAA A;  5ECL B;  1V40 A;  4EDZ A;  2DJJ A;  4N0V A;  1ZCP A;  3IAS 2;  4XS6 A;  4ISD A;  4KAE A;  1TRS A;  3PGT A;  1R5P A;  3LXT A;  2DJ0 A;  4H86 A;  1PKZ A;  3M8N A;  1HNB A;  5DCH A;  1AW9 A;  2V6K A;  3UJ1 A;  2ON7 A;  2VCZ A;  2FWG A;  1JHB A;  4NHW A;  2IMF A;  2V32 A;  4F03 A;  3HZ8 A;  1EGO A;  2VM1 A;  2PU9 C;  4K9Z A;  1M9B A;  4KGI A;  1GNW A;  5JCU A;  4OFT A;  3GKN A;  1AUC A;  2WFC A;  4K6X A;  2WDU A;  3EMX A;  3J7Y b;  1J0F A;  1TRW A;  3DVW A;  3L9U A;  1O7U A;  4Q5Q A;  1OKD A;  1XW5 A;  5DCG A;  5ID2 B;  4NWY A;  1UN2 A;  1J9B A;  1K3O A;  22GS A;  3LXZ A;  3A5W A;  2MZC A;  2PVO C;  1B8X A;  5IMC A;  1R5A A;  3FZ5 A;  3DD3 A;  2GSQ A;  6GST A;  4TRX A;  4ZL8 A;  4F0B A;  2MMA A;  1QGV A;  3A2X A;  4FO5 A;  2QSI A;  2HI7 A;  4YH2 A;  3RHC A;  3LWA A;  17GS A;  1LBK A;  1YQ1 A;  5ECI B;  4YQU A;  4NMU A;  3TJB A;  3WT2 A;  2YPM A;  4EVM A;  3NOF A;  2LRC A;  5ECR B;  4MF5 A;  2LNS A;  3GFK A;  1Q98 A;  4POL A;  1GSU A;  3S9F A;  3ZZX A;  1ON4 A;  3TRP A;  2GS3 A;  4G0I A;  2QC7 A;  3EMP A;  3MSZ A;  4IJI A;  2FUG 2;  1ZZY A;  4KSO A;  4LMV A;  3HD5 A;  1XW6 A;  4PQI A;  3LYP A;  3RHB A;  2GQK A;  2HSN B;  2CA8 A;  3GKX A;  2H72 A;  4EKZ A;  3F3R A;  5EY6 A;  3TGZ A;  1PQN A;  3F63 A;  4POM A;  1WIK A;  2DLX A;  2AB6 A;  4QQ7 A;  3MAK A;  1PRX A;  2O8V B;  4HJM A;  3VPQ A;  1CQH A;  3TJG A;  2VD0 A;  2TRX A;  2H0G A;  3EUR A;  4WBJ A;  4RI6 A;  3L9S A;  4PQ1 A;  1X5D A;  3ME8 A;  1HNC A;  2VUP A;  1G6Y A;  1PSQ A;  4F2I A;  2HRN A;  1EEJ A;  3U5R E;  1NM3 A;  5J41 A;  1GL8 A;  1E2Y A;  1GSS A;  4G9H A;  1XOA A;  1O85 A;  2HLS A;  3KMO A;  2AHE A;  2J9H A;  1HYU A;  4BVX A;  2ES7 A;  4PNG A;  1XW9 A;  5CAX A;  5FHI A;  3IK9 A;  2CVK A;  3ZRD A;  3GSS A;  5ABR A;  2LKU A;  2H73 A;  5DJL A;  4L8E A;  4PTS A;  4XIH A;  2L57 A;  2YCD A;  3GL5 A;  3E9J B;  5D8I A;  2B5E A;  2C80 A;  4JU5 A;  3FY7 A;  1THX A;  2JAD A;  4K7O A;  1T00 A;  2EIR A;  1BQ7 A;  1BYE A;  1FOV A;  1G6W A;  4O32 A;  2IMK A;  3US3 A;  1JLW A;  2YWN A;  4N0Z A;  2NBS A;  4AJ6 A;  5CRE A;  2M46 A;  4I97 A;  4PXO A;  4Q5R A;  1B48 A;  5G1L A;  4N11 A;  5JWR B;  4ML1 A;  4MJC A;  1I9D A;  3FZA A;  3ZFL A;  2GVP A;  1FVK A;  4CHS A;  3IOS A;  4MJE A;  2OAC A;  2B7J A;  4GWR A;  1R7H A;  2VO4 A;  3EU4 A;  1K0A A;  2CX4 A;  2H76 A;  1KTE A;  3EIN A;  4V2N A;  4IQ1 A;  4EF0 A;  1O73 A;  2FCH A;  1N2A A;  1NW2 A;  3L9V A;  2YV7 A;  1U6T A;  3IK7 A;  3F3Q A;  3TRQ A;  5ECH B;  2DMM A;  1A2J A;  3H93 A;  3VI5 A;  3G7Y A;  2HFD A;  4JED A;  4NV5 A;  3IC8 A;  1KBN A;  3EC3 A;  3VUR A;  4WKW A;  5LD0 A;  5HR3 A;  3WGX A;  2NDO A;  2MBS A;  1OC9 B;  1GTU A;  2B5X A;  2H1G A;  3GNJ A;  3ZRE A;  4OMV A;  1F3B A;  2H75 A;  1V58 A;  4YQV A;  3ZIJ A;  1BAY A;  4ECI A;  1B4Q A;  3KZQ A;  2EIQ A;  1UC7 A;  4NHZ A;  4HI7 A;  5D96 A;  4F9Z A;  1GLP A;  2DJ3 A;  2L59 A;  1IYI A;  2FWE A;  2DJ2 A;  3ZFB A;  2VM2 A;  4RI7 A;  2ZNM A;  5IMD A;  3UAP A;  4TR3 A;  1FHE A;  1OYJ A;  4K2D A;  4WEY A;  3DGQ A;  5DAL B;  3H8Q A;  1GUH A;  4IVF A;  2LST A;  5H5R A;  2HE3 A;  1OVN A;  3U6V A;  5B8B A;  5E59 A;  3AY8 A;  2I81 A;  5FT3 A;  1EOG A;  4IEL A;  4MZW A;  1FG4 A;  4G0L A;  1SJZ A;  4K0G A;  3HVV A;  1K0B A;  2R37 A;  2KP1 A;  3O76 A;  4KCA A;  1XWB A;  3KJY A;  5HR2 A;  4ZBB A;  2XC2 A;  2LJA A;  1XOB A;  1ZYE A;  3TJF A;  3TRX A;  6GSV A;  1YF1 A;  2JZR A;  3G7I A;  1NHO A;  5DJM A;  3IBH A;  2K9F A;  4POB A;  4MZB A;  2AV4 A;  4LL1 B;  3APS A;  5KEJ A;  4I6X A;  4PQH A;  1JZW A;  2GSS A;  1Z3E A;  1AC1 A;  4YAP A;  2DIZ A;  4IS0 A;  3E3E A;  5JWO B;  4ZB8 A;  2K8V A;  4RQX A;  1Z7R A;  3NZN A;  1K0C A;  3L78 A;  3IR4 A;  1K0N A;  4GSN A;  3HKR A;  1THO A;  2VL3 A;  3KP9 A;  2V2G A;  5AGY A;  5IPH A;  1B9Y C;  1XBS A;  1WWJ A;  1GH2 A;  3SBC A;  4XS4 B;  2HRK B;  4BPY A;  1ZOF A;  3GYK A;  3QAG A;  1OC9 A;  5AIV A;  1T4Z A;  2PGT A;  4DSQ A;  4K0N A;  1SK0 A;  3ZML A;  3GX8 A;  2CAI A;  4KB3 A;  4ACS A;  2GTU A;  5H5S A;  3VPT A;  4ULX A;  1NHY A;  5AIX A;  2FLS A;  2HT9 A;  3F6D A;  3M0F A;  5C00 A;  3QAV A;  1PX6 A;  2PVQ A;  3FYG A;  1GRX A;  4KSM A;  20GS A;  1MEK A;  3TOT A;  3HJP A;  1O81 A;  2HRA A;  4L0U A;  4ML6 A;  2V1M A;  1A2L A;  3W8S A;  2HSH A;  1J08 A;  3QFA C;  2F9S A;  1T4Y A;  1R4W A;  10GS A;  1W4V A;  1LJR A;  5DAL A;  1EEM A;  1PGT A;  2H0I A;  2E0Q A;  5EL8 A;  4L0W A;  3D21 A;  4L5L A;  1X0R A;  5B7C A;  3SWL A;  3ERF A;  5DAK B;  1TI1 A;  4AF2 A;  1QUW A;  4I8B A;  3UMA A;  3KH7 A;  4F82 A;  1ILO A;  3C71 A;  3FW2 A;  4O5R A;  4QL9 A;  1SJI A;  1XIY A;  1DE2 A;  4PUR A;  3IE3 A;  3L0H A;  2PMT A;  2HSM A;  2A2R A;  1PX7 A;  3TKS E;  2C0F A;  2G2Q A;  4PUF C;  3E0U A;  1G7O A;  3QD9 A;  5A4V A;  2H30 A;  2V6O A;  2KLX A;  3C1R A;  1QQ2 A;  5F0G A;  3F8U A;  1A2M A;  1WOU A;  1E6B A;  2EIO A;  2R5G A;  3M9K A;  1GTI A;  1MD3 A;  5H5Q A;  1SL0 B;  5F8B A;  5G31 A;  1Z7P A;  3C73 A;  1IYH A;  1FB6 A;  5IMF A;  3LFL A;  2F8A A;  2XBI A;  3F6F A;  2JZT A;  4CDO A;  2O85 A;  1GTA A;  1RW1 A;  2GZP A;  2ON5 A;  13GS A;  1TU7 A;  5ECQ B;  3LJR A;  5DQS A;  4JRR A;  4ZIJ A;  3MDK A;  4O7H A;  3KH9 A;  5DQY A;  1A24 A;  4XS4 A;  4ZB9 A;  5IOW A;  4FYB A;  19GS A;  3BD2 A;  4ZB6 A;  1DE1 A;  2B7K A;  3CSH A;  3R3E A;  1JLV A;  2R4V A;  1X9S B;  1GUK A;  2CZ3 A;  3NIV A;  3HVS A;  2C0D A;  1WE0 A;  4GST A;  3KM6 A;  3QMX A;  2BMX A;  1BED A;  5KN1 A;  2FWF A;  3V1W A;  5EVO A;  4LA1 A;  1TKD B;  2MBT A;  1B9X C;  1V98 A;  2HSY A;  1GSE A;  2A2S A;  4OCE A;  2KUC A;  5ELG A;  1Q4J A;  4TKY A;  3ZIT A;  1EP8 A;  4JR6 A;  1BX9 A;  3DIE A;  4L5O A;  4JZQ A;  4ECJ A;  5ECK B;  5D9W A; 
#chains in the Genus database with same CATH topology
 1XG8 A;  5DAK A;  3GH6 A;  1MD4 A;  4ZBA A;  1M7T A;  3W8J A;  3EVI A;  4OFN A;  4TXO B;  1S4B P;  1VF3 A;  2K6V A;  3HDC A;  2EFD A;  2WS2 A;  4KX4 A;  3IXR A;  3I6A A;  1XCC A;  2KP2 A;  3ZYW A;  3I69 A;  3D6I A;  3GUS A;  2GQL A;  5CNW A;  1ZYP A;  2LV3 A;  1RK4 A;  1SU9 A;  3H4K A;  1XWG A;  4PGT A;  2PUK C;  4MH3 A;  3FZ9 A;  4HQS A;  2AUV A;  5CRW A;  2DBC A;  2ZCT A;  2I3Y A;  4GRF A;  1ZGN A;  4F0C A;  1TP9 A;  8GSS A;  3D5J A;  3GKK A;  1TK8 B;  1A8Y A;  3RFR C;  2VCQ A;  5D9X A;  2IMI A;  2C0G A;  2OE0 A;  2H1D A;  4OFM A;  4JE1 A;  3EWL A;  2GGT A;  5HFI A;  4P3Y B;  1C72 A;  1PMT A;  4YQM A;  3O6T A;  4HSC X;  2IME A;  2HRF A;  4XTS A;  4FH8 A;  3PR8 A;  3FK8 A;  1Y1U A;  1F2E A;  5GZZ B;  2WZ9 A;  1HD2 A;  1M2D A;  4O92 A;  3LG6 A;  2I4A A;  3DML A;  5ID2 A;  2XBQ A;  1GP1 A;  2OA7 A;  4IKH A;  4IHU A;  2PPT A;  1UA5 A;  2X4A A;  3P7X A;  2YWO A;  3P8W A;  3UBL A;  1N8J A;  4EO3 A;  2PWJ A;  3GH9 A;  3F0I A;  4NPB A;  5IO0 A;  2HZF A;  2KOK A;  2RII A;  18GS A;  1DBY A;  1SJ6 A;  1F9M A;  3FMW A;  4BWS A;  4MF6 A;  1AQW A;  1A8L A;  3WD6 A;  2L4C A;  4IN0 A;  4K7N A;  5F07 A;  3GN3 A;  1Z6N A;  2X99 A;  3HZ4 A;  2GLR A;  2YNX A;  4GSS A;  3EYT A;  4LMW A;  3KXO A;  3HY2 A;  4J57 E;  2FGX A;  2C3Q A;  3APQ A;  4FYU A;  3M9J A;  1V9W A;  1K0D A;  2C8U A;  3KD0 A;  3ZVJ D;  3UBK A;  2I1U A;  3RAZ A;  3QPM A;  4NXI A;  3DXB A;  2V41 A;  3GIX A;  2IMD A;  1NSW A;  1TRU A;  4G0K A;  5L71 A;  2VCV A;  2HSN A;  2WW1 A;  4MK3 A;  4X1U A;  4ID0 A;  4WBR D;  4G10 A;  4TXO A;  3ZTL A;  2Z9S A;  4XCS A;  5CRG A;  1WP0 A;  3ERW A;  3KEB A;  5IMZ A;  3LGC A;  4GDF A;  3L4N A;  3TKP A;  1BG5 A;  5J5N A;  3H1N A;  1TK0 B;  16GS A;  2E2M A;  4D73 B;  4EC0 A;  2MYG A;  5HFG A;  5B8A A;  3IV4 A;  4X43 A;  1GUL A;  2REM A;  1EZK A;  4DVC A;  5KOX A;  3APO A;  1T1V A;  2PBJ A;  2G0F A;  2LQO A;  5G2Z A;  4IP6 A;  4HS1 A;  5DBQ A;  3VWV A;  5ELA A;  3A3T A;  4ICY A;  3CSJ A;  1GWC A;  1PN9 A;  1H4O A;  4FYC A;  4IW9 A;  2LEG A;  2VLU A;  3FR3 A;  3HJM A;  3HYP A;  4MMM A;  2GZZ A;  2X8G A;  3W6G A;  2OBK A;  1TOF A;  3UOM A;  2MMN A;  1K0M A;  1Z6M A;  2L6C A;  5D93 A;  4N30 A;  3RPP A;  2HYX A;  1RQM A;  2RUE A;  2IWT A;  2N5A A;  4GF0 A;  3DEX A;  3CRU A;  2WVZ A;  4W66 A;  1X5E A;  2VAF A;  3ERG A;  4TR4 A;  6GSS A;  1TU8 A;  1ZMA A;  1VF4 A;  2FHE A;  4PUA A;  3QOU A;  1GSQ A;  4KDU A;  2H1L A;  4NAX A;  3HCZ A;  4AJ7 A;  5J3R A;  4DSS B;  1JZD A;  3F4S A;  1XVW A;  11GS A;  3QR6 A;  4OD7 A;  1GNE A;  2YN1 A;  5LNK e;  1OE7 A;  4JBB A;  1ST9 A;  2PN8 A;  2WUL A;  2WVX A;  1MDI A;  2LRN A;  4MJA A;  1MDK A;  2IL3 A;  3RPN A;  5IIZ A;  2HXK A;  3G7J A;  2JSZ A;  5J40 A;  3A2W A;  5G5E A;  3BBY A;  4KDY A;  3WGE A;  2KHP A;  4MPF A;  1OC8 A;  4LL4 B;  5IMA A;  1V2A A;  3TUE A;  2LTK A;  2YOI A;  5JWQ B;  2X64 A;  1DUG A;  1YDK A;  5DDL A;  4TR0 A;  1SL2 B;  3CWG A;  4HJ2 A;  4BWQ A;  4USS A;  2B6M A;  4K7I A;  1AIU A;  5CRH A;  2R0C A;  4KCE A;  4GLT A;  4X4J A;  3BJ5 A;  3BOA A;  1R26 A;  2F51 A;  2WW2 A;  4TR1 B;  3P2A A;  2H19 A;  2JSY A;  2DSA A;  3UEM A;  1YKC A;  3ZMK A;  1S3A A;  5J4U A;  3PPU A;  1FB0 A;  4XRA A;  5JCG A;  1XZO A;  3G9B A;  1TRV A;  3QAW A;  3GUR A;  1ERW A;  2YV9 A;  3QCP A;  2VLT A;  3EU3 A;  4AI6 A;  2VL9 A;  2GZY A;  2VCT A;  4EL1 A;  3A2V A;  4IQA A;  1YEW C;  4HZ4 A;  4J56 E;  3TU3 B;  3FZ4 A;  3UIW A;  3GV1 A;  1XWK A;  4MZC A;  3KMN A;  2P0G A;  4AGS A;  1M2B A;  2H66 A;  5IMV A;  5A5K A;  2LJK A;  2E7P A;  5ENU A;  4N10 A;  2H70 A;  4HU9 A;  5HQP A;  4TW5 A;  1PL2 A;  4YAV A;  2A2P A;  5A4W A;  1KEB A;  2GT6 A;  1M3I A;  2YAN A;  2H1A A;  3VWX A;  1A23 A;  2CVD A;  5G1K A;  2IPA A;  2VL2 C;  2P5R A;  2RM5 A;  1BJX A;  1SK2 A;  5CYY A;  4EDY A;  1XWA A;  4HEA 2;  1F37 A;  2R0G A;  4DSS A;  2DC5 A;  2FD3 A;  5C04 A;  1URM A;  2CV4 A;  2DJK A;  2I9H A;  4ZXG A;  5IM9 A;  1S3D A;  2ZUP A;  2H01 A;  4JR4 A;  3VFI A;  1M99 A;  3UAR A;  1X5C A;  2YWI A;  2C3N A;  4PX1 A;  1GUM A;  1TXU A;  2E2G A;  1OC3 A;  5B6M A;  2L4Q A;  2WVY A;  3KIJ A;  3FRC A;  1PN0 A;  1TTZ A;  4N3Z A;  3PH9 A;  2IFQ B;  2YJH A;  4ZBD A;  5D9T A;  4YKG A;  4CY8 A;  3IAM 2;  1Z9H A;  12GS A;  1KNG A;  2QGV A;  1DSB A;  1I5G A;  3VWW A;  3TJK A;  2VIM A;  3MWH A;  4IBP A;  2O7K A;  4PNF A;  4KND A;  4K8M A;  3ISO A;  2HZE B;  14GS A;  4HU7 A;  4AKI A;  1XFL A;  3GTU B;  2H6X A;  1XWC A;  3FR9 A;  4TR1 A;  4GTU A;  2LNT A;  4AJ8 A;  2AAW A;  1HQO A;  5B6N A;  2P5Q A;  3Q19 A;  3CHX C;  2HRK A;  3TCO A;  1VF1 A;  4RUV A;  4POK A;  1ABA A;  1SD9 A;  2LJR A;  1JZR A;  4BVX B;  4BA7 A;  3M1G A;  2GSR A;  2N5F A;  4IJ3 A;  2FWH A;  2IJY A;  2XPE A;  3TDG A;  3D4T A;  5A4U A;  2H6Y A;  2OE3 A;  3CBU A;  3KTL A;  4MDC A;  1GLQ A;  3UVT A;  4PHZ C;  3IA1 A;  1K0O A;  6GSU A;  2CT6 A;  1SYR A;  2IN3 A;  1UVZ A;  1PD2 1;  3VWU A;  5GSS A;  1AXD A;  1WMJ A;  3ZL5 A;  5D73 A;  2H8L A;  3ZIV A;  4MP4 A;  2WCI A;  4TOP A;  3IC4 A;  2YJ7 A;  3OR5 A;  1T8E B;  2N5B A;  4OCF A;  5FWG A;  3PIN A;  1BF5 A;  5J9B A;  1YEX A;  2AYT A;  2RUF A;  1TI3 A;  4HZ2 A;  1GTB A;  1YF0 A;  4GQF A;  1TDI A;  1A0F A;  2L5O A;  2IIY A;  4G19 A;  1X9M B;  2YP6 A;  4DSR A;  3ED3 A;  2DJ1 A;  5E4W A;  1Y25 A;  3F4R A;  4CW9 A;  1AAZ A;  2WRT A;  3D22 A;  1TK5 B;  4BVY B;  1N25 A;  4RQR A;  2H0H A;  6GSW A;  4ILF A;  2NVL A;  1HNA A;  2VCX A;  1XVQ A;  3ME7 A;  1QK8 A;  1PA3 A;  3BCK A;  3HVX A;  2IFQ A;  3D4M A;  4V1A p;  3CTF A;  2XHF A;  3EPT A;  2JZS A;  3CTG A;  3Q18 A;  3I9V 2;  1G7E A;  3IRA A;  2QKE A;  2GT5 A;  2O89 A;  1FO5 A;  3WYW A;  1ACV A;  2GQM A;  3I43 A;  2GST A;  2H71 A;  2WB9 A;  4IGJ A;  4EXJ A;  2LS5 A;  4HDE A;  4XHM A;  1SD8 A;  3N9J A;  5G5F A;  1EWX A;  3O3T A;  4XS1 A;  2L6D A;  1ZYQ B;  3CRT A;  2HZE A;  3GTU A;  5IPG A;  3LOR A;  3TKS C;  3GX0 A;  1S3C A;  4KW6 A;  4FIW A;  1O6J A;  4MCU A;  2FA8 A;  3HXS A;  4WR5 A;  3HHV A;  3TKQ A;  3GST A;  5IQY A;  1U3A A;  4G2E A;  3LYK A;  1WRY A;  4V2M A;  2B5Y A;  1T3B A;  1M9A A;  1T7P B;  4K1F A;  1YEP A;  4J2F A;  1FW1 A;  2BJX A;  2CZ2 A;  4WF5 A;  2OE1 A;  5ECN B;  3C1S A;  3CXG A;  3Q74 A;  2K18 A;  2OT3 A;  5HFK A;  3FR6 A;  4K2X A;  3TB2 A;  3IDV A;  5GAN D;  5BMU B;  5GAP D;  1JFU A;  5F05 A;  1ERT A;  1H75 A;  1F3A A;  1XPV A;  1M0U A;  3H79 A;  3GKM A;  9GSS A;  4E68 A;  3RBT A;  3KCM A;  7GSS A;  2A4V A;  5KN2 A;  2LUS A;  1Y6E A;  2XPD A;  1K3Y A;  3QFB C;  2B1L A;  5HR1 A;  3IPZ A;  1USB A;  1WPI A;  5A5H B;  5AIS A;  4GQC A;  2X49 A;  1VRS D;  3M3M A;  2M80 A;  4WXT A;  2OAD A;  3TOU A;  3QDN A;  2R3X A;  3P90 A;  5GST A;  4TN8 A;  2B3S A;  4HOJ A;  1CQG A;  2VOC A;  3ZLP A;  4TVE A;  4KDX A;  3D0Z A;  4BVY A;  3HJO A;  3CYN A;  2F8F A;  2K8S A;  1OKT A;  3BCI A;  1EOH A;  3HA9 A;  1SEN A;  5D9V A;  4I2T A;  2YZH A;  5IO2 A;  1U88 A;  4HQZ A;  3RGB C;  2NTO A;  1ZYN A;  4KH7 A;  2DIY A;  5KOW A;  4ECB A;  4Q5N A;  4GXZ A;  2WJU A;  4WET A;  5KN0 A;  4MJB A;  4BL7 B;  2VL2 A;  2F3M A;  2C4J A;  3LQ7 A;  3F9U A;  3LEF A;  4MF7 A;  5F06 A;  4LLR A;  3CSI A;  2HNL A;  3GRX A;  1AQX A;  3UL3 A;  5COH A;  2GDR A;  1YJ6 A;  5JCW A;  2RM6 A;  2X8H A;  4E8E A;  2AJQ B;  3FHK A;  1W89 A;  2CVB A;  2OBI A;  1SL1 B;  1F6M C;  4X0X A;  2YWM A;  4MA9 A;  4Q5F A;  2J23 A;  4TXV A;  1YY7 A;  2EC4 A;  1FVJ A;  2L5L A;  2EFH A;  1OE8 A;  3TJJ A;  2OJL A;  3VK9 A;  4MH2 A;  2VD1 A;  2WGR A;  1GSD A;  3GL3 A;  1X9W B;  5IOX A;  4MNN A;  4IP1 A;  2D2Z A;  2HQT A;  3J7Y k;  2MMZ A;  1LU4 A;  1OAZ A;  5EPF A;  5AN1 A;  4MLY A;  5BMU A;  1EP7 A;  4GCI A;  1JZO A;  1QXH A;  3FKF A;  2CAQ A;  2JAC A;  1PL1 A;  3GA4 A;  3EE2 A;  5A34 B;  2BTO T;  5CRD A;  3MNG A;  4V1A g;  5DVB A;  3DYR A;  2VKZ G;  2OKA A;  1K3L A;  2CQ9 A;  4ZL9 A;  4I2U A;  4QL7 A;  1S3R A;  3DVX A;  1U3I A;  1ML6 A;  5A5H A;  1ERU A;  5ECP B;  2X8C A;  2O87 A;  3HMJ G;  2YZU A;  2HSM B;  5ECS A;  3K8N A;  4KE3 A;  2O36 A;  1SKS B;  4OWY A;  4WR4 A;  2R2J A;  4V2L A;  4AKX B;  1TJD A;  4ECC A;  4OO5 A;  4MAB A;  3RDW A;  3FEU A;  1A0R P;  5KN3 A;  4D73 A;  3DKS A;  4KUN A;  2JL4 A;  2TRC P;  1MTC A;  2FY6 A;  1O8W A;  4O5Q A;  1SKR B;  1VF2 A;  1YZX A;  2ALB A;  2H1B A;  5ECO B;  2UZ8 A;  1EV4 A;  5HR0 A;  3DWV A;  5CP1 A;  4EE0 A;  4FQU A;  1G0T A;  2LRT A;  4BL7 A;  1M2A A;  3KP8 A;  2WW3 A;  4Z7X A;  3R2Q A;  3JCM L;  6GSX A;  4I5Q A;  1PKW A;  3F4T A;  2FA4 A;  4OO4 A;  3GMF A;  2B1K A;  3UVH A;  5J9C A;  2P31 A;  3IHQ A;  3GHA A;  3KTB A;  3VLN A;  1B4P A;  4E8H A;  1MDJ A;  4ZIL A;  3CMI A;  3WGD A;  1FOH A;  1EGR A;  1U87 A;  1XXU A;  3C8E A;  1QFN A;  4DEJ A;  1EV9 A;  4KF9 A;  2C1Y A;  1WJK A;  2H74 A;  5ECM B;  1ZL9 A;  2C0E A;  2VCW A;  1GSY A;  2WZS A;  3KGK A;  1AQV A;  1SYX A;  2FNO A;  2H6Z A;  3Q6O A;  2R6K A;  2C3T A;  4XRD A;  2NPB A;  1ERV A;  5LCZ A;  1SK1 A;  3LSZ A;  4NV2 A;  6GSY A;  4HUA A;  5CO3 A;  3C7M A;  3ZVJ A;  4EUY A;  1V57 A;  2CX3 A;  3VI7 A;  1Z5Y E;  2PER A;  4WF4 A;  1GSF A;  2M72 A;  1YKA A;  4ZL7 A;  3WT1 A;  3N5O A;  2TIR A;  5INY A;  4KA0 A;  5G30 A;  4O5U A;  1O8X A;  2LQQ A;  3DRN A;  1TXX A;  5A34 A;  2RLI A;  2JU5 A;  4MPG A;  2DML A;  2VLV A;  1VGL A;  3TKS A;  2MMO A;  3TKR A;  1SKW B;  1QMV A;  5J47 A;  1TW9 A;  1FAA A;  5ECL B;  1V40 A;  4EDZ A;  2DJJ A;  4N0V A;  1ZCP A;  3IAS 2;  4Z2R A;  4XS6 A;  4ISD A;  4KAE A;  1TRS A;  3PGT A;  1R5P A;  3LXT A;  2DJ0 A;  2EFC A;  1SVO A;  4H86 A;  1PKZ A;  3M8N A;  1HNB A;  5DCH A;  1AW9 A;  2V6K A;  3UJ1 A;  2ON7 A;  2VCZ A;  4PI2 C;  2FWG A;  1JHB A;  4NHW A;  2IMF A;  2V32 A;  4F03 A;  3HZ8 A;  1EGO A;  2VM1 A;  2PU9 C;  4K9Z A;  1M9B A;  4KGI A;  1GNW A;  5JCU A;  4OFT A;  4Z2T A;  3GKN A;  1AUC A;  2WFC A;  4K6X A;  2WDU A;  3EMX A;  3J7Y b;  1J0F A;  1TRW A;  3DVW A;  3L9U A;  1O7U A;  2QA2 A;  4Q5Q A;  1OKD A;  1XW5 A;  5DCG A;  5ID2 B;  4NWY A;  1UN2 A;  1J9B A;  4A5P A;  1K3O A;  22GS A;  3LXZ A;  3A5W A;  2MZC A;  2PVO C;  1B8X A;  5IMC A;  1M3J A;  1R5A A;  3FZ5 A;  3DD3 A;  2GSQ A;  6GST A;  4TRX A;  4ZL8 A;  4F0B A;  2MMA A;  1QGV A;  3A2X A;  4FO5 A;  5A1N B;  2QSI A;  2HI7 A;  4YH2 A;  3RHC A;  3LWA A;  17GS A;  1LBK A;  1YQ1 A;  5ECI B;  4YQU A;  4NMU A;  3TJB A;  3WT2 A;  2YPM A;  4EVM A;  3NOF A;  2LRC A;  5ECR B;  4MF5 A;  4AKH A;  2A4H A;  2LNS A;  3GFK A;  1Q98 A;  4POL A;  1GSU A;  3S9F A;  3ZZX A;  1ON4 A;  3TRP A;  4FXY P;  2GS3 A;  4G0I A;  2QC7 A;  3EMP A;  3MSZ A;  4IJI A;  2FUG 2;  1ZZY A;  4KSO A;  5J4Y A;  4LMV A;  3HD5 A;  1XW6 A;  3MIX A;  4PQI A;  3IHG A;  3LYP A;  3RHB A;  2GQK A;  2HSN B;  2CA8 A;  3GKX A;  2H72 A;  4EKZ A;  3F3R A;  5EY6 A;  5J4V A;  3CQF A;  3TGZ A;  1PQN A;  3F63 A;  4POM A;  1WIK A;  2DLX A;  2AB6 A;  4QQ7 A;  3MAK A;  1PRX A;  2O8V B;  4HJM A;  2R0P A;  3VPQ A;  1CQH A;  3LW9 A;  3TJG A;  2VD0 A;  2TRX A;  2H0G A;  3EUR A;  4WBJ A;  4RI6 A;  3L9S A;  4PQ1 A;  1X5D A;  3ME8 A;  1HNC A;  2VUP A;  1G6Y A;  1PSQ A;  4F2I A;  2HRN A;  1EEJ A;  3U5R E;  1NM3 A;  5J41 A;  1GL8 A;  1E2Y A;  4K5S A;  1GSS A;  4G9H A;  1XOA A;  1O85 A;  2HLS A;  3KMO A;  2AHE A;  2J9H A;  1HYU A;  4BVX A;  2ES7 A;  4PNG A;  1XW9 A;  5CAX A;  5FHI A;  3IK9 A;  2CVK A;  3ZRD A;  3MYD A;  3GSS A;  5ABR A;  2LKU A;  2H73 A;  5DJL A;  4L8E A;  4PTS A;  4XIH A;  2L57 A;  3GL5 A;  2YCD A;  3E9J B;  5D8I A;  2B5E A;  2C80 A;  4JU5 A;  3FY7 A;  1THX A;  2JAD A;  4K7O A;  1T00 A;  5BRT A;  2O5V A;  2EIR A;  1BQ7 A;  1BYE A;  1FOV A;  1G6W A;  5A1N A;  4O32 A;  2IMK A;  3US3 A;  1JLW A;  2WVX B;  2YWN A;  4N0Z A;  2NBS A;  4AJ6 A;  5CRE A;  2M46 A;  4I97 A;  4PXO A;  4Q5R A;  4QMK A;  1B48 A;  5G1L A;  4N11 A;  5JWR B;  4ML1 A;  4MJC A;  1I9D A;  3FZA A;  3ZFL A;  2GVP A;  1FVK A;  4CHS A;  3IOS A;  4MJE A;  2OAC A;  2B7J A;  4GWR A;  1R7H A;  2VO4 A;  3EU4 A;  1K0A A;  2CX4 A;  2H76 A;  1KTE A;  4EIP A;  3EIN A;  4V2N A;  4IQ1 A;  4EF0 A;  1O73 A;  2FCH A;  1N2A A;  1NW2 A;  3L9V A;  2YV7 A;  1U6T A;  3IK7 A;  3F3Q A;  3TRQ A;  5ECH B;  2DMM A;  1A2J A;  3H93 A;  3VI5 A;  3G7Y A;  2HFD A;  4JED A;  4NV5 A;  3IC8 A;  1KBN A;  3EC3 A;  3VUR A;  4WKW A;  5LD0 A;  5HR3 A;  3WGX A;  2NDO A;  2EFE A;  2MBS A;  1OC9 B;  1GTU A;  2B5X A;  2H1G A;  3GNJ A;  3ZRE A;  4OMV A;  1F3B A;  2H75 A;  1V58 A;  4YQV A;  3ZIJ A;  1BAY A;  4ECI A;  1B4Q A;  3KZQ A;  2EIQ A;  1UC7 A;  4NHZ A;  4HI7 A;  5D96 A;  4AKG A;  4F9Z A;  1GLP A;  2DJ3 A;  2L59 A;  1IYI A;  2FWE A;  2DJ2 A;  3ZFB A;  2VM2 A;  4RI7 A;  2ZNM A;  5IMD A;  3UAP A;  4TR3 A;  1FHE A;  1OYJ A;  4K2D A;  4WEY A;  3DGQ A;  5DAL B;  3H8Q A;  1GUH A;  4IVF A;  2LST A;  4PI0 C;  5H5R A;  2HE3 A;  1OVN A;  3U6V A;  5B8B A;  5E59 A;  3AY8 A;  2I81 A;  5FT3 A;  1EOG A;  4IEL A;  4MZW A;  1FG4 A;  4G0L A;  1SJZ A;  2UV8 G;  4K0G A;  2QA1 A;  3HVV A;  1K0B A;  2R37 A;  2KP1 A;  3O76 A;  4KCA A;  1XWB A;  4EIQ A;  3KJY A;  5HR2 A;  4ZBB A;  2XC2 A;  2LJA A;  1XOB A;  1ZYE A;  3TJF A;  3TRX A;  6GSV A;  1YF1 A;  2JZR A;  3G7I A;  1NHO A;  5DJM A;  3IBH A;  2O3E A;  2K9F A;  4POB A;  4MZB A;  2AV4 A;  4LL1 B;  3APS A;  5KEJ A;  4I6X A;  4PQH A;  1JZW A;  2GSS A;  1Z3E A;  4YKF A;  1AC1 A;  4YAP A;  2DIZ A;  4IS0 A;  3E3E A;  5JWO B;  1I1I P;  4ZB8 A;  2K8V A;  4RQX A;  1Z7R A;  3NZN A;  1K0C A;  3L78 A;  3IR4 A;  1K0N A;  4Z2U A;  4GSN A;  3HKR A;  1THO A;  2VL3 A;  3KP9 A;  2V2G A;  5AGY A;  5IPH A;  1B9Y C;  1XBS A;  1WWJ A;  1GH2 A;  3SBC A;  4K5R A;  4XS4 B;  2HRK B;  4BPY A;  1PFO A;  1ZOF A;  3GYK A;  3QAG A;  1OC9 A;  5AIV A;  2DKH A;  1T4Z A;  2PGT A;  4DSQ A;  4K0N A;  1SK0 A;  3ZML A;  3HVN A;  3GX8 A;  2CAI A;  4KB3 A;  4ACS A;  2GTU A;  5H5S A;  3VPT A;  1BG1 A;  3A5I A;  4ULX A;  1NHY A;  5AIX A;  2FLS A;  2HT9 A;  3F6D A;  3M0F A;  5C00 A;  3QAV A;  1PX6 A;  2PVQ A;  3FYG A;  1GRX A;  4KSM A;  20GS A;  1MEK A;  3TOT A;  1SVL A;  3HJP A;  1O81 A;  2HRA A;  4L0U A;  4ML6 A;  2V1M A;  1A2L A;  3W8S A;  2HSH A;  1J08 A;  3QFA C;  2F9S A;  1T4Y A;  1R4W A;  10GS A;  1W4V A;  1LJR A;  5DAL A;  1EEM A;  1PGT A;  2H0I A;  2E0Q A;  5EL8 A;  4L0W A;  3D21 A;  4L5L A;  1YVL A;  1X0R A;  5B7C A;  3SWL A;  3ERF A;  5DAK B;  1TI1 A;  4AF2 A;  1QUW A;  4I8B A;  3UMA A;  3KH7 A;  4F82 A;  1ILO A;  3C71 A;  3FW2 A;  4O5R A;  4QL9 A;  1SJI A;  1XIY A;  1DE2 A;  4PUR A;  3IE3 A;  3L0H A;  2PMT A;  2HSM A;  2A2R A;  1PX7 A;  3TKS E;  2C0F A;  2G2Q A;  4PUF C;  3E0U A;  1G7O A;  3QD9 A;  5A4V A;  2H30 A;  2V6O A;  2KLX A;  3C1R A;  1QQ2 A;  5F0G A;  3F8U A;  1A2M A;  1WOU A;  1E6B A;  2EIO A;  2R5G A;  3M9K A;  1GTI A;  1MD3 A;  5H5Q A;  1SL0 B;  5F8B A;  5G31 A;  1Z7P A;  3C73 A;  1IYH A;  1FB6 A;  5IMF A;  3LFL A;  2F8A A;  2XBI A;  3F6F A;  2JZT A;  4CDO A;  2O85 A;  1GTA A;  2DKI A;  1RW1 A;  2GZP A;  2ON5 A;  1SVM A;  13GS A;  1TU7 A;  5ECQ B;  3LJR A;  5DQS A;  4JRR A;  4ZIJ A;  3MDK A;  2WW0 A;  4G01 A;  4O7H A;  3KH9 A;  5DQY A;  1A24 A;  4XS4 A;  4ZB9 A;  5IOW A;  4FYB A;  19GS A;  3BD2 A;  4ZB6 A;  1DE1 A;  2B7K A;  3CSH A;  3R3E A;  1JLV A;  2R4V A;  1X9S B;  1GUK A;  2CZ3 A;  3NIV A;  3HVS A;  2C0D A;  1WE0 A;  4GST A;  3KM6 A;  3QMX A;  2BMX A;  4CY6 A;  1BED A;  5KN1 A;  2FWF A;  3V1W A;  4ZB7 A;  5EVO A;  4LA1 A;  1TKD B;  2MBT A;  1B9X C;  1V98 A;  2HSY A;  1GSE A;  2A2S A;  4OCE A;  2KUC A;  5ELG A;  4BIK A;  1Q4J A;  4TKY A;  3ZIT A;  1EP8 A;  4JR6 A;  1BX9 A;  3DIE A;  4L5O A;  4JZQ A;  4ECJ A;  5ECK B;  5D9W A; 
#chains in the Genus database with same CATH homology
 5DAK A;  3GH6 A;  1MD4 A;  4ZBA A;  1M7T A;  3W8J A;  3EVI A;  4OFN A;  4TXO B;  1VF3 A;  2K6V A;  3HDC A;  2EFD A;  2WS2 A;  4KX4 A;  3IXR A;  3I6A A;  1XCC A;  2KP2 A;  3ZYW A;  3I69 A;  3D6I A;  3GUS A;  2GQL A;  5CNW A;  1ZYP A;  2LV3 A;  1RK4 A;  1SU9 A;  3H4K A;  1XWG A;  4PGT A;  2PUK C;  4MH3 A;  3FZ9 A;  4HQS A;  2AUV A;  5CRW A;  2DBC A;  2ZCT A;  2I3Y A;  4GRF A;  1ZGN A;  4F0C A;  1TP9 A;  8GSS A;  3D5J A;  3GKK A;  1TK8 B;  1A8Y A;  2VCQ A;  5D9X A;  2IMI A;  2C0G A;  2OE0 A;  2H1D A;  4OFM A;  4JE1 A;  3EWL A;  2GGT A;  5HFI A;  4P3Y B;  1C72 A;  1PMT A;  4YQM A;  3O6T A;  2IME A;  2HRF A;  4XTS A;  4FH8 A;  3PR8 A;  3FK8 A;  1Y1U A;  1F2E A;  5GZZ B;  2WZ9 A;  1HD2 A;  1M2D A;  4O92 A;  3LG6 A;  2I4A A;  3DML A;  5ID2 A;  2XBQ A;  1GP1 A;  2OA7 A;  4IKH A;  4IHU A;  2PPT A;  1UA5 A;  2X4A A;  3P7X A;  2YWO A;  3P8W A;  3UBL A;  1N8J A;  4EO3 A;  2PWJ A;  3GH9 A;  3F0I A;  4NPB A;  5IO0 A;  2HZF A;  2KOK A;  2RII A;  18GS A;  1DBY A;  1SJ6 A;  1F9M A;  3FMW A;  4BWS A;  4MF6 A;  1AQW A;  1A8L A;  3WD6 A;  2L4C A;  4IN0 A;  4K7N A;  5F07 A;  3GN3 A;  1Z6N A;  2X99 A;  3HZ4 A;  2GLR A;  2YNX A;  4GSS A;  3EYT A;  4LMW A;  3KXO A;  3HY2 A;  4J57 E;  2FGX A;  2C3Q A;  3APQ A;  4FYU A;  3M9J A;  1V9W A;  1K0D A;  2C8U A;  3KD0 A;  3ZVJ D;  3UBK A;  2I1U A;  3RAZ A;  3QPM A;  4NXI A;  3DXB A;  2V41 A;  3GIX A;  2IMD A;  1NSW A;  1TRU A;  4G0K A;  5L71 A;  2VCV A;  2HSN A;  4MK3 A;  4X1U A;  4ID0 A;  4WBR D;  4G10 A;  4TXO A;  3ZTL A;  2Z9S A;  4XCS A;  5CRG A;  1WP0 A;  3ERW A;  3KEB A;  5IMZ A;  3LGC A;  4GDF A;  3L4N A;  3TKP A;  1BG5 A;  5J5N A;  3H1N A;  1TK0 B;  16GS A;  2E2M A;  4D73 B;  4EC0 A;  2MYG A;  5HFG A;  5B8A A;  3IV4 A;  4X43 A;  1GUL A;  2REM A;  1EZK A;  4DVC A;  5KOX A;  3APO A;  1T1V A;  2PBJ A;  2G0F A;  2LQO A;  5G2Z A;  4IP6 A;  4HS1 A;  5DBQ A;  3VWV A;  5ELA A;  3A3T A;  4ICY A;  3CSJ A;  1GWC A;  1PN9 A;  1H4O A;  4FYC A;  4IW9 A;  2LEG A;  2VLU A;  3FR3 A;  3HJM A;  3HYP A;  4MMM A;  2GZZ A;  2X8G A;  3W6G A;  2OBK A;  1TOF A;  3UOM A;  2MMN A;  1K0M A;  1Z6M A;  2L6C A;  5D93 A;  4N30 A;  3RPP A;  2HYX A;  1RQM A;  2RUE A;  2IWT A;  2N5A A;  4GF0 A;  3DEX A;  3CRU A;  4W66 A;  1X5E A;  2VAF A;  3ERG A;  4TR4 A;  6GSS A;  1TU8 A;  1ZMA A;  1VF4 A;  2FHE A;  4PUA A;  3QOU A;  1GSQ A;  4KDU A;  2H1L A;  4NAX A;  3HCZ A;  4AJ7 A;  5J3R A;  4DSS B;  1JZD A;  3F4S A;  1XVW A;  11GS A;  3QR6 A;  4OD7 A;  1GNE A;  2YN1 A;  5LNK e;  1OE7 A;  4JBB A;  1ST9 A;  2PN8 A;  2WUL A;  1MDI A;  2LRN A;  4MJA A;  1MDK A;  2IL3 A;  3RPN A;  5IIZ A;  2HXK A;  3G7J A;  2JSZ A;  5J40 A;  3A2W A;  5G5E A;  3BBY A;  4KDY A;  3WGE A;  2KHP A;  4MPF A;  1OC8 A;  4LL4 B;  5IMA A;  1V2A A;  3TUE A;  2LTK A;  2YOI A;  5JWQ B;  2X64 A;  1DUG A;  1YDK A;  5DDL A;  4TR0 A;  1SL2 B;  3CWG A;  4HJ2 A;  4BWQ A;  4USS A;  2B6M A;  4K7I A;  1AIU A;  5CRH A;  2R0C A;  4KCE A;  4GLT A;  4X4J A;  3BJ5 A;  3BOA A;  1R26 A;  2F51 A;  4TR1 B;  3P2A A;  2H19 A;  2JSY A;  2DSA A;  3UEM A;  1YKC A;  3ZMK A;  1S3A A;  5J4U A;  3PPU A;  1FB0 A;  4XRA A;  5JCG A;  1XZO A;  3G9B A;  1TRV A;  3QAW A;  3GUR A;  1ERW A;  2YV9 A;  3QCP A;  2VLT A;  3EU3 A;  4AI6 A;  2VL9 A;  2GZY A;  2VCT A;  4EL1 A;  3A2V A;  4IQA A;  4HZ4 A;  4J56 E;  3TU3 B;  3FZ4 A;  3UIW A;  3GV1 A;  1XWK A;  4MZC A;  3KMN A;  2P0G A;  4AGS A;  1M2B A;  2H66 A;  5IMV A;  5A5K A;  2LJK A;  2E7P A;  5ENU A;  4N10 A;  2H70 A;  4HU9 A;  5HQP A;  4TW5 A;  1PL2 A;  4YAV A;  2A2P A;  5A4W A;  1KEB A;  2GT6 A;  2YAN A;  2H1A A;  3VWX A;  1A23 A;  2CVD A;  5G1K A;  2IPA A;  2VL2 C;  2P5R A;  2RM5 A;  1BJX A;  1SK2 A;  5CYY A;  4EDY A;  1XWA A;  4HEA 2;  1F37 A;  2R0G A;  4DSS A;  2DC5 A;  2FD3 A;  5C04 A;  1URM A;  2CV4 A;  2DJK A;  2I9H A;  4ZXG A;  5IM9 A;  1S3D A;  2ZUP A;  2H01 A;  4JR4 A;  3VFI A;  1M99 A;  3UAR A;  1X5C A;  2YWI A;  2C3N A;  4PX1 A;  1GUM A;  1TXU A;  2E2G A;  1OC3 A;  5B6M A;  2L4Q A;  3KIJ A;  3FRC A;  1PN0 A;  1TTZ A;  4N3Z A;  3PH9 A;  2IFQ B;  2YJH A;  4ZBD A;  5D9T A;  4YKG A;  4CY8 A;  3IAM 2;  1Z9H A;  12GS A;  1KNG A;  2QGV A;  1DSB A;  1I5G A;  3VWW A;  3TJK A;  2VIM A;  3MWH A;  4IBP A;  2O7K A;  4PNF A;  4KND A;  4K8M A;  3ISO A;  2HZE B;  14GS A;  4HU7 A;  4AKI A;  1XFL A;  3GTU B;  2H6X A;  1XWC A;  3FR9 A;  4TR1 A;  4GTU A;  2LNT A;  4AJ8 A;  2AAW A;  1HQO A;  5B6N A;  2P5Q A;  3Q19 A;  2HRK A;  3TCO A;  1VF1 A;  4RUV A;  4POK A;  1ABA A;  1SD9 A;  2LJR A;  1JZR A;  4BVX B;  4BA7 A;  3M1G A;  2GSR A;  2N5F A;  4IJ3 A;  2FWH A;  2IJY A;  2XPE A;  3TDG A;  3D4T A;  5A4U A;  2H6Y A;  2OE3 A;  3CBU A;  3KTL A;  4MDC A;  1GLQ A;  3UVT A;  3IA1 A;  1K0O A;  6GSU A;  2CT6 A;  1SYR A;  2IN3 A;  1UVZ A;  1PD2 1;  3VWU A;  5GSS A;  1AXD A;  1WMJ A;  3ZL5 A;  5D73 A;  2H8L A;  3ZIV A;  4MP4 A;  2WCI A;  4TOP A;  3IC4 A;  2YJ7 A;  3OR5 A;  1T8E B;  2N5B A;  4OCF A;  5FWG A;  3PIN A;  1BF5 A;  5J9B A;  1YEX A;  2AYT A;  2RUF A;  1TI3 A;  4HZ2 A;  1GTB A;  1YF0 A;  4GQF A;  1TDI A;  1A0F A;  2L5O A;  2IIY A;  4G19 A;  1X9M B;  2YP6 A;  4DSR A;  3ED3 A;  2DJ1 A;  5E4W A;  1Y25 A;  3F4R A;  4CW9 A;  1AAZ A;  2WRT A;  3D22 A;  1TK5 B;  4BVY B;  1N25 A;  4RQR A;  2H0H A;  6GSW A;  4ILF A;  2NVL A;  1HNA A;  2VCX A;  1XVQ A;  3ME7 A;  1QK8 A;  1PA3 A;  3BCK A;  3HVX A;  2IFQ A;  3D4M A;  4V1A p;  3CTF A;  2XHF A;  2JZS A;  3CTG A;  3EPT A;  3Q18 A;  3I9V 2;  1G7E A;  3IRA A;  2QKE A;  2GT5 A;  2O89 A;  1FO5 A;  3WYW A;  1ACV A;  2GQM A;  3I43 A;  2GST A;  2H71 A;  2WB9 A;  4IGJ A;  4EXJ A;  2LS5 A;  4HDE A;  4XHM A;  1SD8 A;  3N9J A;  5G5F A;  1EWX A;  3O3T A;  4XS1 A;  2L6D A;  1ZYQ B;  3CRT A;  2HZE A;  3GTU A;  5IPG A;  3LOR A;  3TKS C;  3GX0 A;  1S3C A;  4KW6 A;  4FIW A;  1O6J A;  4MCU A;  2FA8 A;  3HXS A;  4WR5 A;  3HHV A;  3TKQ A;  3GST A;  5IQY A;  1U3A A;  4G2E A;  3LYK A;  1WRY A;  4V2M A;  2B5Y A;  1T3B A;  1M9A A;  1T7P B;  4K1F A;  1YEP A;  4J2F A;  1FW1 A;  2BJX A;  2CZ2 A;  4WF5 A;  2OE1 A;  5ECN B;  3C1S A;  3CXG A;  3Q74 A;  2K18 A;  2OT3 A;  5HFK A;  3FR6 A;  4K2X A;  3TB2 A;  3IDV A;  5GAN D;  5BMU B;  5GAP D;  1JFU A;  5F05 A;  1ERT A;  1H75 A;  1F3A A;  1XPV A;  1M0U A;  3H79 A;  3GKM A;  9GSS A;  4E68 A;  3RBT A;  3KCM A;  7GSS A;  2A4V A;  5KN2 A;  2LUS A;  1Y6E A;  2XPD A;  1K3Y A;  3QFB C;  2B1L A;  5HR1 A;  3IPZ A;  1USB A;  1WPI A;  5A5H B;  5AIS A;  4GQC A;  2X49 A;  1VRS D;  3M3M A;  2M80 A;  4WXT A;  2OAD A;  3TOU A;  3QDN A;  2R3X A;  3P90 A;  5GST A;  4TN8 A;  2B3S A;  4HOJ A;  1CQG A;  2VOC A;  3ZLP A;  4TVE A;  4KDX A;  3D0Z A;  4BVY A;  3HJO A;  3CYN A;  2F8F A;  2K8S A;  1OKT A;  3BCI A;  1EOH A;  3HA9 A;  1SEN A;  5D9V A;  4I2T A;  2YZH A;  5IO2 A;  1U88 A;  4HQZ A;  2NTO A;  1ZYN A;  4KH7 A;  2DIY A;  5KOW A;  4ECB A;  4Q5N A;  4GXZ A;  2WJU A;  4WET A;  5KN0 A;  4MJB A;  4BL7 B;  2VL2 A;  2F3M A;  2C4J A;  3LQ7 A;  3F9U A;  3LEF A;  4MF7 A;  5F06 A;  4LLR A;  3CSI A;  2HNL A;  3GRX A;  1AQX A;  3UL3 A;  5COH A;  2GDR A;  1YJ6 A;  5JCW A;  2RM6 A;  2X8H A;  4E8E A;  2AJQ B;  3FHK A;  1W89 A;  2CVB A;  2OBI A;  1SL1 B;  1F6M C;  4X0X A;  2YWM A;  4MA9 A;  4Q5F A;  2J23 A;  4TXV A;  1YY7 A;  2EC4 A;  1FVJ A;  2L5L A;  2EFH A;  1OE8 A;  3TJJ A;  2OJL A;  3VK9 A;  4MH2 A;  2VD1 A;  2WGR A;  1GSD A;  3GL3 A;  1X9W B;  5IOX A;  4MNN A;  4IP1 A;  2D2Z A;  2HQT A;  3J7Y k;  2MMZ A;  1LU4 A;  1OAZ A;  5EPF A;  5AN1 A;  4MLY A;  5BMU A;  1EP7 A;  4GCI A;  1JZO A;  1QXH A;  3FKF A;  2CAQ A;  2JAC A;  1PL1 A;  3GA4 A;  3EE2 A;  5A34 B;  2BTO T;  5CRD A;  3MNG A;  4V1A g;  5DVB A;  3DYR A;  2VKZ G;  2OKA A;  1K3L A;  2CQ9 A;  4ZL9 A;  4I2U A;  4QL7 A;  3DVX A;  1U3I A;  1ML6 A;  5A5H A;  1ERU A;  5ECP B;  2X8C A;  2O87 A;  3HMJ G;  2YZU A;  2HSM B;  5ECS A;  3K8N A;  4KE3 A;  1SKS B;  4OWY A;  4WR4 A;  2R2J A;  4V2L A;  4AKX B;  1TJD A;  4ECC A;  4OO5 A;  4MAB A;  3RDW A;  3FEU A;  1A0R P;  5KN3 A;  4D73 A;  3DKS A;  4KUN A;  2JL4 A;  2TRC P;  1MTC A;  2FY6 A;  1O8W A;  4O5Q A;  1SKR B;  1VF2 A;  1YZX A;  2ALB A;  2H1B A;  5ECO B;  2UZ8 A;  1EV4 A;  5HR0 A;  3DWV A;  5CP1 A;  4EE0 A;  4FQU A;  1G0T A;  2LRT A;  4BL7 A;  1M2A A;  3KP8 A;  4Z7X A;  3R2Q A;  3JCM L;  6GSX A;  4I5Q A;  1PKW A;  3F4T A;  2FA4 A;  4OO4 A;  3GMF A;  2B1K A;  3UVH A;  5J9C A;  2P31 A;  3IHQ A;  3GHA A;  3KTB A;  3VLN A;  1B4P A;  4E8H A;  1MDJ A;  4ZIL A;  3CMI A;  3WGD A;  1FOH A;  1EGR A;  1U87 A;  1XXU A;  3C8E A;  1QFN A;  4DEJ A;  1EV9 A;  4KF9 A;  2C1Y A;  1WJK A;  2H74 A;  5ECM B;  1ZL9 A;  2C0E A;  2VCW A;  1GSY A;  3KGK A;  1AQV A;  1SYX A;  2FNO A;  2H6Z A;  3Q6O A;  2R6K A;  2C3T A;  4XRD A;  2NPB A;  1ERV A;  5LCZ A;  1SK1 A;  3LSZ A;  4NV2 A;  6GSY A;  4HUA A;  5CO3 A;  3C7M A;  3ZVJ A;  4EUY A;  1V57 A;  2CX3 A;  3VI7 A;  1Z5Y E;  2PER A;  4WF4 A;  1GSF A;  2M72 A;  1YKA A;  4ZL7 A;  3WT1 A;  3N5O A;  2TIR A;  5INY A;  4KA0 A;  5G30 A;  4O5U A;  1O8X A;  2LQQ A;  3DRN A;  1TXX A;  5A34 A;  2RLI A;  2JU5 A;  4MPG A;  2DML A;  2VLV A;  1VGL A;  3TKS A;  2MMO A;  3TKR A;  1SKW B;  1QMV A;  5J47 A;  1TW9 A;  1FAA A;  5ECL B;  1V40 A;  4EDZ A;  2DJJ A;  4N0V A;  1ZCP A;  3IAS 2;  4Z2R A;  4XS6 A;  4ISD A;  4KAE A;  1TRS A;  3PGT A;  1R5P A;  3LXT A;  2DJ0 A;  2EFC A;  1SVO A;  4H86 A;  1PKZ A;  3M8N A;  1HNB A;  5DCH A;  1AW9 A;  2V6K A;  3UJ1 A;  2ON7 A;  2VCZ A;  2FWG A;  1JHB A;  4NHW A;  2IMF A;  2V32 A;  4F03 A;  3HZ8 A;  1EGO A;  2VM1 A;  2PU9 C;  4K9Z A;  1M9B A;  4KGI A;  1GNW A;  5JCU A;  4OFT A;  4Z2T A;  3GKN A;  1AUC A;  2WFC A;  4K6X A;  2WDU A;  3EMX A;  3J7Y b;  1J0F A;  1TRW A;  3DVW A;  3L9U A;  1O7U A;  2QA2 A;  4Q5Q A;  1OKD A;  1XW5 A;  5DCG A;  5ID2 B;  4NWY A;  1UN2 A;  1J9B A;  4A5P A;  1K3O A;  22GS A;  3LXZ A;  3A5W A;  2MZC A;  2PVO C;  1B8X A;  5IMC A;  1R5A A;  3FZ5 A;  3DD3 A;  2GSQ A;  6GST A;  4TRX A;  4ZL8 A;  4F0B A;  2MMA A;  1QGV A;  3A2X A;  4FO5 A;  5A1N B;  2QSI A;  2HI7 A;  4YH2 A;  3RHC A;  3LWA A;  17GS A;  1LBK A;  1YQ1 A;  5ECI B;  4YQU A;  4NMU A;  3TJB A;  3WT2 A;  2YPM A;  4EVM A;  3NOF A;  2LRC A;  5ECR B;  4MF5 A;  4AKH A;  2A4H A;  2LNS A;  3GFK A;  1Q98 A;  4POL A;  1GSU A;  3S9F A;  3ZZX A;  1ON4 A;  3TRP A;  2GS3 A;  4G0I A;  2QC7 A;  3EMP A;  3MSZ A;  4IJI A;  2FUG 2;  1ZZY A;  4KSO A;  5J4Y A;  4LMV A;  3HD5 A;  1XW6 A;  3MIX A;  4PQI A;  3IHG A;  3LYP A;  3RHB A;  2GQK A;  2HSN B;  2CA8 A;  3GKX A;  2H72 A;  4EKZ A;  3F3R A;  5EY6 A;  5J4V A;  3TGZ A;  1PQN A;  3F63 A;  4POM A;  1WIK A;  2DLX A;  2AB6 A;  4QQ7 A;  3MAK A;  1PRX A;  2O8V B;  4HJM A;  2R0P A;  3VPQ A;  1CQH A;  3LW9 A;  3TJG A;  2VD0 A;  2TRX A;  2H0G A;  3EUR A;  4WBJ A;  4RI6 A;  3L9S A;  4PQ1 A;  1X5D A;  3ME8 A;  1HNC A;  2VUP A;  1G6Y A;  1PSQ A;  4F2I A;  2HRN A;  1EEJ A;  3U5R E;  1NM3 A;  5J41 A;  1GL8 A;  1E2Y A;  4K5S A;  1GSS A;  4G9H A;  1XOA A;  1O85 A;  2HLS A;  3KMO A;  2AHE A;  2J9H A;  1HYU A;  4BVX A;  2ES7 A;  4PNG A;  1XW9 A;  5CAX A;  5FHI A;  3IK9 A;  2CVK A;  3ZRD A;  3MYD A;  3GSS A;  5ABR A;  2LKU A;  2H73 A;  5DJL A;  4L8E A;  4PTS A;  4XIH A;  2L57 A;  2YCD A;  3GL5 A;  3E9J B;  5D8I A;  2B5E A;  2C80 A;  4JU5 A;  3FY7 A;  1THX A;  2JAD A;  4K7O A;  1T00 A;  5BRT A;  2O5V A;  2EIR A;  1BQ7 A;  1BYE A;  1FOV A;  1G6W A;  5A1N A;  4O32 A;  2IMK A;  3US3 A;  1JLW A;  2YWN A;  4N0Z A;  2NBS A;  4AJ6 A;  5CRE A;  2M46 A;  4I97 A;  4PXO A;  4Q5R A;  4QMK A;  1B48 A;  5G1L A;  4N11 A;  5JWR B;  4ML1 A;  4MJC A;  1I9D A;  3FZA A;  3ZFL A;  2GVP A;  1FVK A;  4CHS A;  3IOS A;  4MJE A;  2OAC A;  2B7J A;  4GWR A;  1R7H A;  2VO4 A;  3EU4 A;  1K0A A;  2CX4 A;  2H76 A;  1KTE A;  4EIP A;  3EIN A;  4V2N A;  4IQ1 A;  4EF0 A;  1O73 A;  2FCH A;  1N2A A;  1NW2 A;  3L9V A;  2YV7 A;  1U6T A;  3IK7 A;  3F3Q A;  3TRQ A;  5ECH B;  2DMM A;  1A2J A;  3H93 A;  3VI5 A;  3G7Y A;  2HFD A;  4JED A;  4NV5 A;  3IC8 A;  1KBN A;  3EC3 A;  3VUR A;  4WKW A;  5LD0 A;  5HR3 A;  3WGX A;  2NDO A;  2EFE A;  2MBS A;  1OC9 B;  1GTU A;  2B5X A;  2H1G A;  3GNJ A;  3ZRE A;  4OMV A;  1F3B A;  2H75 A;  1V58 A;  4YQV A;  3ZIJ A;  1BAY A;  4ECI A;  1B4Q A;  3KZQ A;  2EIQ A;  1UC7 A;  4NHZ A;  4HI7 A;  5D96 A;  4AKG A;  4F9Z A;  1GLP A;  2DJ3 A;  2L59 A;  1IYI A;  2FWE A;  2DJ2 A;  3ZFB A;  2VM2 A;  4RI7 A;  2ZNM A;  5IMD A;  3UAP A;  4TR3 A;  1FHE A;  1OYJ A;  4K2D A;  4WEY A;  3DGQ A;  5DAL B;  3H8Q A;  1GUH A;  4IVF A;  2LST A;  5H5R A;  2HE3 A;  1OVN A;  3U6V A;  5B8B A;  5E59 A;  3AY8 A;  2I81 A;  5FT3 A;  1EOG A;  4IEL A;  4MZW A;  1FG4 A;  4G0L A;  1SJZ A;  2UV8 G;  4K0G A;  2QA1 A;  3HVV A;  1K0B A;  2R37 A;  2KP1 A;  3O76 A;  4KCA A;  1XWB A;  4EIQ A;  3KJY A;  5HR2 A;  4ZBB A;  2XC2 A;  2LJA A;  1XOB A;  1ZYE A;  3TJF A;  3TRX A;  6GSV A;  1YF1 A;  2JZR A;  3G7I A;  1NHO A;  5DJM A;  3IBH A;  2K9F A;  4POB A;  4MZB A;  2AV4 A;  4LL1 B;  3APS A;  5KEJ A;  4I6X A;  4PQH A;  1JZW A;  2GSS A;  1Z3E A;  4YKF A;  1AC1 A;  4YAP A;  2DIZ A;  4IS0 A;  3E3E A;  5JWO B;  4ZB8 A;  2K8V A;  4RQX A;  1Z7R A;  3NZN A;  1K0C A;  3L78 A;  3IR4 A;  1K0N A;  4Z2U A;  4GSN A;  3HKR A;  1THO A;  2VL3 A;  3KP9 A;  2V2G A;  5AGY A;  5IPH A;  1B9Y C;  1XBS A;  1WWJ A;  1GH2 A;  3SBC A;  4K5R A;  4XS4 B;  2HRK B;  4BPY A;  1ZOF A;  3GYK A;  3QAG A;  1OC9 A;  5AIV A;  2DKH A;  1T4Z A;  2PGT A;  4DSQ A;  4K0N A;  1SK0 A;  3ZML A;  3GX8 A;  2CAI A;  4KB3 A;  4ACS A;  2GTU A;  5H5S A;  3VPT A;  1BG1 A;  3A5I A;  4ULX A;  1NHY A;  5AIX A;  2FLS A;  2HT9 A;  3F6D A;  3M0F A;  5C00 A;  3QAV A;  1PX6 A;  2PVQ A;  3FYG A;  1GRX A;  4KSM A;  20GS A;  1MEK A;  3TOT A;  1SVL A;  3HJP A;  1O81 A;  2HRA A;  4L0U A;  4ML6 A;  2V1M A;  1A2L A;  3W8S A;  2HSH A;  1J08 A;  3QFA C;  2F9S A;  1T4Y A;  1R4W A;  10GS A;  1W4V A;  1LJR A;  5DAL A;  1EEM A;  1PGT A;  2H0I A;  2E0Q A;  5EL8 A;  4L0W A;  3D21 A;  4L5L A;  1YVL A;  1X0R A;  5B7C A;  3SWL A;  3ERF A;  5DAK B;  1TI1 A;  4AF2 A;  1QUW A;  4I8B A;  3UMA A;  3KH7 A;  4F82 A;  1ILO A;  3C71 A;  3FW2 A;  4O5R A;  4QL9 A;  1SJI A;  1XIY A;  1DE2 A;  4PUR A;  3IE3 A;  3L0H A;  2PMT A;  2HSM A;  2A2R A;  1PX7 A;  3TKS E;  2C0F A;  2G2Q A;  4PUF C;  3E0U A;  1G7O A;  3QD9 A;  5A4V A;  2H30 A;  2V6O A;  2KLX A;  3C1R A;  1QQ2 A;  5F0G A;  3F8U A;  1A2M A;  1WOU A;  1E6B A;  2EIO A;  2R5G A;  3M9K A;  1GTI A;  1MD3 A;  5H5Q A;  1SL0 B;  5F8B A;  5G31 A;  1Z7P A;  3C73 A;  1IYH A;  1FB6 A;  5IMF A;  3LFL A;  2F8A A;  2XBI A;  3F6F A;  2JZT A;  4CDO A;  2O85 A;  1GTA A;  2DKI A;  1RW1 A;  2GZP A;  2ON5 A;  1SVM A;  13GS A;  1TU7 A;  5ECQ B;  3LJR A;  5DQS A;  4JRR A;  4ZIJ A;  3MDK A;  4O7H A;  4G01 A;  3KH9 A;  5DQY A;  1A24 A;  4XS4 A;  4ZB9 A;  5IOW A;  4FYB A;  19GS A;  3BD2 A;  4ZB6 A;  1DE1 A;  2B7K A;  3CSH A;  3R3E A;  1JLV A;  2R4V A;  1X9S B;  1GUK A;  2CZ3 A;  3NIV A;  3HVS A;  2C0D A;  1WE0 A;  4GST A;  3KM6 A;  3QMX A;  2BMX A;  4CY6 A;  1BED A;  5KN1 A;  2FWF A;  3V1W A;  4ZB7 A;  5EVO A;  4LA1 A;  1TKD B;  2MBT A;  1B9X C;  1V98 A;  2HSY A;  1GSE A;  2A2S A;  4OCE A;  2KUC A;  5ELG A;  1Q4J A;  4TKY A;  3ZIT A;  1EP8 A;  4JR6 A;  1BX9 A;  3DIE A;  4L5O A;  4JZQ A;  4ECJ A;  5ECK B;  5D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...