5EL8A

The structure of dhar1 from arabidopsis thaliana
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
ALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase DHAR1, mitochondrial
publication title Arabidopsis thaliana DHAR1 apo structure
rcsb
source organism Arabidopsis thaliana
total genus 59
structure length 213
sequence length 213
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5el8A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5el8A01
4FYUA 4GSNA 1ZZYA 4TR3A 3RPNA 5DBQA 1U3AA 3EURA 2LEGA 4LMVA 3KH9A 5J9CA 3KZQA 1BQ7A 2B5EA 4TXVA 5A4WA 2MYGA 1JZWA 3ZZXA 2VL9A 2NVLA 1WWJA 1GLQA 2H1AA 1N8JA 5JCWA 4EXJA 3TGZA 1ZL9A 4KB3A 3A3TA 4NHWA 5JCUA 4EC0A 1UVZA 2FWGA 4GQCA 5IMDA 3IC8A 3F9UA 2FA8A 2PVOC 1HNAA 3GKKA 2F8AA 2LJRA 1ERTA 1AUCA 4PGTA 2E0QA 2I3YA 2RIIA 4HOJA 4YH2A 4MF5A 1BJXA 3TB2A 3I69A 3C8EA 2FWHA 3CTGA 4G10A 3ZFBA 1ML6A 1TI1A 3CRTA 1SL2B 3MWHA 4MABA 4GSSA 2CZ3A 1GSDA 2FWEA 5J4UA 5FT3A 2IMKA 3GUSA 3PINA 3WD6A 4ULXA 2C0GA 2IFQB 2B5XA 12GSA 4J57E 2O8VB 2TRXA 3GHAA 3DVXA 1LBKA 1JZRA 2WULA 4ZIJA 1Z3EA 3TJBA 4MJAA 3LGCA 2VLVA 4FQUA 1E2YA 5CRGA 5E59A 2GQKA 2XC2A 4WXTA 5IO2A 6GSWA 4LA1A 1PKWA 4J2FA 4IS0A 3LG6A 1THOA 1GSYA 1FVJA 1QUWA 1M9AA 1EOHA 2DIYA 2GT6A 3ZITA 1HYUA 2LUSA 1TJDA 4TR0A 3IAM2 3TCOA 2EIQA 3P8WA 5AGYA 1ERWA 2HRFA 3IE3A 4OO5A 3HVSA 1Z9HA 2IPAA 3D4TA 2VOCA 4GF0A 4KSOA 2WDUA 4KUNA 3GMFA 5GAPD 5JWRB 2QKEA 2LS5A 2I1UA 4MZBA 1USBA 4X1UA 3ME7A 1PX6A 5HR3A 1A2JA 1XWKA 2ALBA 2H8LA 3DXBA 1T7PB 4Q5QA 1XPVA 2X8CA 1TRVA 1JLVA 1VF4A 3FR6A 3APQA 3FR9A 2YWMA 3V1WA 5BMUA 1Y25A 2LRTA 2YPMA 1QQ2A 1X9SB 2CVDA 2CQ9A 4P3YB 1XVQA 1F3BA 1ZMAA 4G9HA 1K3YA 2CVKA 1SK2A 2C1YA 3GKNA 3NZNA 2DJ0A 1PGTA 4V1Ap 4RI7A 3LXZA 4PUAA 3EINA 2OBIA 6GSTA 5IO0A 4H86A 1F2EA 1R5AA 4IHUA 1XBSA 2M46A 5CREA 3U5RE 1J08A 2E2GA 1W89A 5ECKB 5ECPB 4KH7A 2CX3A 1GSFA 3DKSA 3UIWA 3QDNA 2O85A 1W4VA 2B1KA 1UA5A 3TKRA 4EVMA 2GZYA 3F3RA 2GS3A 3ZTLA 1TU8A 5CRWA 3UL3A 1GSSA 3ZVJA 1X0RA 2B6MA 3HXSA 4XS4B 5J3RA 1O7UA 5DCHA 1FHEA 1SKSB 2HRKA 1TU7A 3L9UA 3TKSC 3W8JA 1R4WA 1Z6NA 3ERFA 5INYA 1OC9A 2LJAA 1FB6A 4ZILA 2CAQA 2G2QA 5G1LA 3ZFLA 3UVTA 2PERA 5G30A 1AQVA 1EV4A 2AAWA 1NM3A 3H4KA 4NWYA 1B48A 5D9XA 3DRNA 5B8AA 3IXRA 1NHOA 2KOKA 5B7CA 3HJPA 3BOAA 2N5BA 5HQPA 3F6DA 4MF6A 3ME8A 3EMPA 5F8BA 3EYTA 2HRKB 3PH9A 3UMAA 5A4UA 11GSA 1F3AA 5HFKA 1O73A 3IAS2 1TRSA 3FYGA 1NW2A 1OC9B 1TRUA 1Q98A 1GULA 1VF3A 2NBSA 1FG4A 1U87A 1AQWA 3A5WA 3F4TA 1JFUA 5HR1A 1R5PA 2K8SA 1FOVA 1YDKA 4XS1A 2OE0A 3HCZA 4ZL9A 3C71A 3P2AA 3KEBA 5ELAA 4IN0A 1OC3A 4TXOA 1DBYA 3ZL5A 3P90A 1SYRA 1EZKA 13GSA 2AUVA 1TP9A 4MJEA 4IJIA 2FY6A 4K2DA 5GZZB 2HSMA 1JZOA 2JZSA 3HJOA 4BVYA 4X43A 4IW9A 5H5QA 2PGTA 4N10A 4MZCA 4NV2A 5ABRA 4IVFA 1MEKA 3P7XA 3IR4A 1X5DA 1GTUA 2FLSA 19GSA 2DBCA 4G0KA 4IELA 2N5FA 3F4SA 2N5AA 1BYEA 4CW9A 1K0MA 4ECIA 3HVXA 2HSMB 1ZOFA 5IOWA 3KM6A 3TKPA 4BL7A 5L71A 2OJLA 2FCHA 1XWCA 3GH6A 2DLXA 2VD0A 4E8HA 2E7PA 3TJJA 5ECSA 3CBUA 3VWXA 1H4OA 2IIYA 5HR2A 3E3EA 1YQ1A 4L5LA 5AIVA 4K7OA 1X5EA 2HZEA 2KHPA 1M0UA 2YV7A 2C0DA 4JR6A 3IRAA 3L4NA 1O8XA 5F05A 2AJQB 3US3A 4I97A 2UZ8A 3N5OA 4GCIA 2VL2C 3IDVA 3VLNA 4HEA2 5G5FA 3HY2A 1BG5A 4WBJA 3UVHA 4BL7B 1BEDA 2ES7A 1K3LA 3GL3A 5KN2A 1PQNA 1TK8B 2MMZA 3FZ9A 2YV9A 2F3MA 4BVXA 4ID0A 5D93A 4MH2A 3HHVA 3N9JA 5IMAA 2YJ7A 2FD3A 1ST9A 3H93A 2HZEB 1K3OA 1EV9A 1E6BA 3IBHA 2L59A 4DVCA 4KNDA 4PNFA 3VFIA 2J23A 4MH3A 1XZOA 3GKMA 1M2AA 4OCFA 4LL1B 5ECNB 2LNTA 4K0GA 1RQMA 2LV3A 4N30A 2VL3A 3G9BA 3APSA 2C3NA 2K6VA 4LLRA 2XPDA 4BWSA 4XS6A 4FYCA 4POBA 4JU5A 1TXXA 2I9HA 3J7Yk 2YP6A 3TOUA 2PUKC 2V2GA 2H19A 1B9YC 3GURA 14GSA 1GUHA 2TIRA 2L4QA 2C3TA 1QK8A 4KE3A 3ZVJD 4NMUA 1XW5A 3ZIVA 2C0EA 3L0HA 1Q4JA 2R37A 1K0AA 4I5QA 4G2EA 4KDXA 2QGVA 2VCZA 2WRTA 4ZB6A 5AN1A 3H8QA 2C80A 4OO4A 3A2XA 1GUKA 3F3QA 3GSSA 1TKDB 3LFLA 5H5SA 1B9XC 1S3DA 3EWLA 5IPGA 1DE2A 4JEDA 8GSSA 4YQVA 5G31A 5IM9A 2I4AA 3KIJA 3VPQA 1TRWA 4TOPA 5KN0A 2IFQA 4TRXA 3O3TA 4MMMA 3RPPA 5ECQB 4BWQA 3TJKA 4MK3A 2RLIA 1V57A 5IPHA 3UEMA 4TN8A 3VURA 2JU5A 2X64A 3I6AA 4K0NA 4IGJA 4GWRA 1G6WA 3VI5A 4ML6A 4WETA 1RK4A 3FEUA 2WS2A 3IHQA 2RUEA 2B5YA 3HVVA 1NHYA 4YAVA 2LJKA 1VF1A 2DMLA 4L0UA 2BTOT 3UOMA 1G7EA 1AW9A 4F9ZA 5HFGA 2VUPA 2V32A 1SU9A 2FHEA 2KP2A 3ZMKA 1T8EB 6GSYA 2P5QA 2WFCA 4WF4A 2VAFA 2DJ2A 2L5LA 1V58A 1SKRB 5D9VA 3WT1A 3M1GA 1B8XA 1SJZA 3OR5A 2B7KA 3C1RA 1FB0A 2L6CA 4IP6A 1V2AA 5CO3A 5FWGA 2GSQA 5EL8A 2OKAA 5GSSA 1YZXA 3HYPA 1TDIA 3LYPA 2TRCP 2LSTA 3DGQA 3GNJA 3Q18A 1K0BA 2MBSA 1TI3A 2HSNB 2MMNA 3GTUA 2HXKA 2KLXA 3QMXA 1SYXA 4KDUA 5ECRB 4Q5FA 2BMXA 5D9WA 4EE0A 2YWOA 4ECBA 3KCMA 5J5NA 4V1Ag 2P5RA 4MA9A 22GSA 1XCCA 3FHKA 3GSTA 1A8LA 2HLSA 5ECLB 1UC7A 1G6YA 1KNGA 3AY8A 4OFNA 5HFIA 2HSYA 4ZBAA 4PQIA 1Z5YE 1GH2A 4ZBBA 4PUFC 4EDYA 2IJYA 1XW9A 4XS4A 6GSVA 2LQOA 3GTUB 1JHBA 1QXHA 4OFTA 3KD0A 1OAZA 2OA7A 3ED3A 3LQ7A 4LL4B 2C3QA 2E2MA 2MMAA 4NHZA 2HQTA 4ILFA 2OBKA 4GXZA 4HU9A 4RI6A 2YZHA 3KP8A 2BJXA 3KP9A 4G0LA 1OC8A 3LYKA 3HZ8A 3TKSA 3EMXA 1OYJA 3W6GA 2B3SA 2O89A 4PXOA 2NPBA 4MCUA 3C73A 3D6IA 4TKYA 3RHBA 2WGRA 4WBRD 5J9BA 2MMOA 4IQAA 4HDEA 4POMA 1HD2A 3RDWA 4GSTA 3MAKA 3L78A 2VCVA 1T00A 2AHEA 4KW6A 3VWUA 4OFMA 1YKCA 3WGEA 2H73A 1AAZA 4O5RA 3C1SA 3KMOA 5C04A 3HKRA 2IMFA 2ZNMA 3VWVA 2NTOA 4GLTA 3VI7A 1ACVA 5ELGA 20GSA 4XCSA 1XW6A 3Q74A 2VM2A 5B8BA 2O7KA 5CRHA 1IYIA 4JE1A 1MTCA 3F6FA 1BX9A 4ZB8A 1GNEA 6GSUA 3C7MA 2CA8A 1WPIA 2YCDA 3EU3A 3GRXA 2YZUA 3WGDA 5B6MA 3IK7A 2HI7A 2DJKA 2H66A 1CQHA 3QPMA 3IPZA 2FGXA 1WOUA 4ML1A 3J7Yb 1A0RP 4V2NA 18GSA 3O6TA 1OE7A 4AJ8A 2V41A 2V6OA 3MDKA 3ISOA 2ZUPA 5DAKA 3QFBC 3ZLPA 4F2IA 1Z7PA 4G0IA 4MPGA 1WIKA 4XTSA 4HQSA 4RQXA 1K0OA 5F07A 1H75A 1EP8A 3M0FA 2AV4A 2YOIA 2GQMA 5J41A 4QL9A 4MP4A 2XBIA 1XOBA 4JRRA 3EVIA 1G0TA 3K8NA 2F9SA 2VLUA 3LORA 3BJ5A 2R5GA 1BAYA 3KGKA 1EOGA 4HJMA 5JWOB 1RW1A 4Z7XA 2H30A 3KH7A 1I5GA 4MLYA 2H0GA 5DAKB 1GSQA 1K0NA 3HZ4A 1F6MC 1Z7RA 7GSSA 3LEFA 3IOSA 4ISDA 3GV1A 1WJKA 5A5KA 1SKWB 3KTBA 4K7IA 5CAXA 1R7HA 1SENA 3LWAA 1ERUA 2VL2A 1TW9A 3QAVA 4IQ1A 4KCEA 4MJCA 2FA4A 1A2LA 2IL3A 4IJ3A 1B4PA 5IMZA 3EU4A 2IMEA 3VWWA 4OCEA 4YQMA 4CDOA 3G7JA 4MDCA 1ZYEA 3IK9A 2F51A 4POLA 1A24A 4AJ6A 2ON7A 4RUVA 4XRAA 4X0XA 4G19A 1Z6MA 2O87A 1HNCA 4F0CA 3M3MA 4KX4A 1S3CA 3BBYA 3HDCA 4DSSA 4ZL8A 1KBNA 3RAZA 2I81A 5F06A 1JLWA 2B1LA 2HRAA 3F8UA 4KA0A 3FY7A 5DQSA 3QOUA 4FYBA 2AB6A 3F4RA 3BCIA 5C00A 1HNBA 2JSYA 5DVBA 3GFKA 4TR1B 2V6KA 3HJMA 2C0FA 2WJUA 3CTFA 2A2SA 1SL0B 5D9TA 1B4QA 3WYWA 4RQRA 1KTEA 3DIEA 1SJIA 3FW2A 5IMVA 1MD3A 3NIVA 1S3AA 4XHMA 2NDOA 3I43A 2GSSA 2A2RA 5IOXA 4DSSB 3QD9A 1XFLA 3HD5A 10GSA 4AJ7A 2EIRA 2VIMA 2H71A 1HQOA 4POKA 2CT6A 2XHFA 3ZYWA 1NSWA 1U3IA 2D2ZA 2GQLA 1J0FA 4PURA 3GX8A 1SD8A 2JZRA 4KF9A 2JACA 1M2DA 1F37A 2EC4A 2H1DA 2YWIA 4I2TA 4TR4A 1EGOA 4TW5A 5LD0A 5DQYA 5IIZA 1WMJA 3D21A 4K9ZA 2H74A 1XVWA 2IWTA 1DE1A 4L8EA 5F0GA 2H6ZA 1OKTA 2DSAA 4FH8A 4E8EA 4I6XA 1YF0A 2L5OA 2PMTA 1DSBA 4K6XA 2PN8A 4IP1A 4TVEA 2C8UA 1ZCPA 5JWQB 2M80A 2H76A 2RUFA 2G0FA 4YAPA 5D8IA 6GSXA 1V98A 4O7HA 3DYRA 2IN3A 5HR0A 1XWAA 2H1BA 2GZZA 2VM1A 1AIUA 5FHIA 4HU7A 5DCGA 5CRDA 1ERVA 1X9MB 3H79A 3APOA 1UN2A 2PPTA 4HQZA 1SL1B 2CVBA 1YKAA 3ZREA 4GRFA 1YF1A 2VD1A 3CSIA 2YJHA 1Y6EA 1O6JA 2H0HA 4KAEA 1PSQA 3DVWA 2HYXA 2OE1A 1M7TA 1K0DA 5ECIB 3G7IA 2Z9SA 4F0BA 1PRXA 3GN3A 2H75A 3GYKA 2LRCA 5LCZA 3M9JA 2HRNA 3A2WA 4PQHA 4EO3A 5GSTA 4L0WA 1OKDA 1XWBA 1ZGNA 1GSUA 5IMFA 1DUGA 4K7NA 4YQUA 4BA7A 4HS1A 1I9DA 3LSZA 1GTBA 2R2JA 3TJFA 5DJLA 3UJ1A 3TRXA 4NXIA 2REMA 1XXUA 3IA1A 3RHCA 3DWVA 3QAWA 3RBTA 4PQ1A 2LRNA 1ABAA 2JADA 4AF2A 5A4VA 4OWYA 3KMNA 4OD7A 4JZQA 5GAND 1U6TA 1K0CA 3GX0A 4I8BA 3I9V2 1MDJA 4HZ4A 2LNSA 2K8VA 5ENUA 1T4YA 2H1GA 1T4ZA 2YANA 1PA3A 4PTSA 5CP1A 3D4MA 1OVNA 3ERWA 2ON5A 1M99A 3FZ5A 3H1NA 4Q5NA 1QGVA 2CZ2A 1WP0A 17GSA 3D22A 1X5CA 3JCML 2H01A 1XWGA 1V40A 3PR8A 2X99A 4EDZA 2K18A 4NAXA 4ECCA 1J9BA 1TOFA 6GSSA 3CYNA 3L9VA 1ON4A 5G5EA 2C4JA 2CV4A 1EWXA 5CNWA 1A2MA 3VPTA 5EPFA 3F63A 4NV5A 1PKZA 3CSJA 4EUYA 1G7OA 3G7YA 4MJBA 2H0IA 3R2QA 9GSSA 1F9MA 3BD2A 2L6DA 1SK0A 4K1FA 3Q19A 4I2UA 1GTAA 4N11A 1PD21 4EF0A 4BPYA 3GIXA 3E9JB 5IQYA 4LMWA 5E4WA 5AIXA 4WKWA 5ECOB 4DEJA 3FKFA 2L4CA 3M8NA 2L57A 2R3XA 1XIYA 2H72A 3MSZA 1URMA 5DALA 2H6XA 2IMDA 1SD9A 3UAPA 3SBCA 3GKXA 3TKQA 2GLRA 2CAIA 3DD3A 1M2BA 2DMMA 2GTUA 4JBBA 3FRCA 4USSA 2H6YA 2HFDA 1FVKA 5D73A 3HA9A 3CSHA 3QAGA 1PL2A 3TOTA 1QMVA 2AYTA 5KEJA 2HSHA 3TJGA 1MD4A 4FIWA 3FZAA 3D0ZA 2QC7A 3TKSE 3PPUA 4F82A 4HUAA 2VCWA 1AXDA 1FO5A 3IV4A 4JR4A 5DALB 4OMVA 1ILOA 1VF2A 1PL1A 5LNKe 5H5RA 2K9FA 3DMLA 2R6KA 3UBLA 2LTKA 2DC5A 1TTZA 2B7JA 5G1KA 4N0VA 3DEXA 3EC3A 4KDYA 4IKHA 1O81A 2DJJA 4HZ2A 4EKZA 2HE3A 2PBJA 4O92A 1N2AA 2QSIA 3GL5A 4ZB9A 3NOFA 4ZXGA 5DDLA 3U6VA 3QR6A 1JZDA 4WEYA 4FO5A 1EEMA 4PX1A 1X9WB 2HNLA 3SWLA 5IMCA 4KSMA 2FUG2 2PWJA 2VO4A 3D5JA 1ZYQB 4IBPA 3F0IA 2YWNA 4KCAA 1YEPA 2LKUA 1R26A 1WE0A 1MDIA 2VCQA 3TRQA 3L9SA 4PNGA 3A2VA 4L5OA 1M9BA 3ERGA 1MDKA 2FWFA 1SJ6A 2J9HA 1YY7A 3PGTA 2VLTA 4EL1A 4NPBA 2H70A 2OE3A 4HI7A 4XRDA 1GTIA 2R4VA 3IC4A 4V2LA 3CXGA 2GGTA 4MF7A 2OACA 5KN3A 2F8FA 1KEBA 4ACSA 4CHSA 3LXTA 2OADA 5AISA 3O76A 3TRPA 1OE8A 3FZ4A 1EGRA 2VCXA 1C72A 3WGXA 1U88A 4ZBDA 1GNWA 3VK9A 5KN1A 4ECJA 1XOAA 1T1VA 4MZWA 3KXOA 2JL4A 5D96A 3KTLA 1LU4A 1FW1A 4V2MA 4TXOB 2WZ9A 1V9WA 2ZCTA 2M72A 1GWCA 5EY6A 2A4VA 5DJMA 1GLPA 2GVPA 2P0GA 5ECHB 5ID2A 3EE2A 4O32A 4Q5RA 4WR5A 4BVYB 2RM6A 4K8MA 3S9FA 3FK8A 1GRXA 1EP7A 3E0UA 3ZMLA 4TR1A 4D73A 2CX4A 5COHA 3TDGA 4GQFA 5CYYA 1GL8A 5EVOA 1SK1A 4KGIA 2HT9A 1PX7A 3Q6OA 4MPFA 1A23A 1GP1A 1CQGA 3UBKA 5ECMB 2GZPA 1A0FA 2WB9A 2JZTA 3UARA 2DJ3A 5ID2B 2X8HA 2EIOA 4DSQA 2GDRA 1T3BA 3QFAC 1GSEA 4J56E 3W8SA 1VGLA 2GT5A 3GA4A 2PU9C 1IYHA 2FNOA 1AC1A 3KJYA 4D73B 4HJ2A 2DJ1A 2XPEA 1WRYA 4ZL7A 3LJRA 2P31A 3WT2A 2GSTA 16GSA 3TUEA 1AQXA 2IMIA 3ZRDA 2KUCA 5G2ZA 2YNXA 3R3EA 2RM5A 1VRSD 1TK5B 1EEJA 2LQQA 1YEXA 1YJ6A 2MZCA 1TK0B 4QQ7A 1A8YA 1GUMA 2V1MA 4QL7A 4N0ZA 2XBQA 2GSRA 2VCTA 1O8WA 2KP1A 4BVXB 5B6NA 3M9KA 1PN9A 1THXA 2DIZA 1O85A 1FAAA 4F03A 3GH9A 5JCGA 2X8GA 4XIHA 3CMIA 2PVQA 3FR3A 4AGSA 2YN1A 2HZFA 2WCIA 4WF5A 3CRUA 1QFNA 4GTUA 4DSRA 2JSZA 2MBTA 4WR4A 3QCPA 3MNGA 3BCKA 3ZIJA 1PMTA 1LJRA
chains in the Genus database with same CATH superfamily
4FYUA 4GSNA 1ZZYA 4TR3A 3RPNA 5DBQA 1U3AA 3EURA 2LEGA 4LMVA 3KH9A 5J9CA 3KZQA 1BQ7A 2B5EA 4TXVA 5A4WA 2MYGA 1JZWA 3ZZXA 2VL9A 2NVLA 1WWJA 1GLQA 2H1AA 1N8JA 5JCWA 4EXJA 3TGZA 1ZL9A 4KB3A 3A3TA 4NHWA 5JCUA 4EC0A 1UVZA 2FWGA 4GQCA 5IMDA 3IC8A 3F9UA 2FA8A 2PVOC 1HNAA 3GKKA 2F8AA 2LJRA 1ERTA 1AUCA 4PGTA 2E0QA 2I3YA 2RIIA 2EFHA 4HOJA 4YH2A 4MF5A 1BJXA 3TB2A 3I69A 3C8EA 2FWHA 3CTGA 4G10A 3ZFBA 1ML6A 1TI1A 5J4VA 3CRTA 1SL2B 3MWHA 4MABA 4GSSA 2CZ3A 1GSDA 2FWEA 5J4UA 5FT3A 2IMKA 2WW0A 3GUSA 3PINA 3WD6A 4ULXA 2C0GA 2IFQB 2B5XA 2WW2A 12GSA 4J57E 2O8VB 2TRXA 3GHAA 3DVXA 1LBKA 1JZRA 2WULA 4ZIJA 1Z3EA 3TJBA 4MJAA 3LGCA 2VLVA 4FQUA 1E2YA 5CRGA 5E59A 2GQKA 2XC2A 4WXTA 5IO2A 6GSWA 4LA1A 1PKWA 4J2FA 4IS0A 3LG6A 1THOA 1Y1UA 1GSYA 1FVJA 1QUWA 1M9AA 1EOHA 2DIYA 2GT6A 3ZITA 1HYUA 2LUSA 1TJDA 4TR0A 3IAM2 4O5UA 4EIPA 3TCOA 2EIQA 3P8WA 5AGYA 1ERWA 2HRFA 3IE3A 4OO5A 3HVSA 1Z9HA 2IPAA 3D4TA 2VOCA 1YVLA 4GF0A 4KSOA 2WDUA 4KUNA 3GMFA 5GAPD 5JWRB 2QKEA 2LS5A 2I1UA 4MZBA 1USBA 4X1UA 3ME7A 1PX6A 5HR3A 1A2JA 1XWKA 2ALBA 2H8LA 3DXBA 1T7PB 4Q5QA 1XPVA 2X8CA 1TRVA 1JLVA 1VF4A 4PI0C 3FR6A 3APQA 3FR9A 2YWMA 3V1WA 5BMUA 1Y25A 2LRTA 2YPMA 1QQ2A 1X9SB 2CVDA 2CQ9A 4P3YB 1XVQA 1F3BA 1ZMAA 4G9HA 1K3YA 2UV8G 2CVKA 1SK2A 2C1YA 3GKNA 3NZNA 2DJ0A 1PGTA 4V1Ap 4RI7A 3LXZA 4PUAA 3EINA 5J40A 2OBIA 6GSTA 5IO0A 4H86A 1F2EA 1R5AA 4IHUA 1XBSA 2M46A 5CREA 3U5RE 1J08A 2E2GA 1W89A 5ECKB 5ECPB 4KH7A 2CX3A 1GSFA 3DKSA 3UIWA 4EIQA 3QDNA 2O85A 1W4VA 2B1KA 1UA5A 3TKRA 4EVMA 2GZYA 3F3RA 2GS3A 3ZTLA 1TU8A 5CRWA 3UL3A 1GSSA 3ZVJA 1X0RA 2B6MA 3HXSA 4XS4B 5J3RA 1O7UA 5DCHA 1FHEA 1SKSB 2HRKA 1TU7A 3L9UA 3TKSC 3W8JA 1R4WA 4YKFA 1Z6NA 3ERFA 5INYA 1OC9A 2LJAA 5A34A 1FB6A 4ZILA 2CAQA 2G2QA 5G1LA 3ZFLA 3UVTA 2PERA 5G30A 1AQVA 1EV4A 2AAWA 4PHZC 1NM3A 1XG8A 3H4KA 4NWYA 1B48A 5D9XA 3DRNA 5B8AA 3IXRA 1NHOA 2KOKA 5B7CA 3HJPA 3BOAA 2N5BA 5HQPA 4AI6A 3F6DA 4MF6A 3ME8A 3EMPA 5F8BA 3EYTA 2HRKB 2A4HA 3PH9A 3UMAA 5A4UA 11GSA 1F3AA 5HFKA 1O73A 3IAS2 1TRSA 3FYGA 1NW2A 1OC9B 1M3IA 1TRUA 1Q98A 1GULA 1VF3A 2NBSA 1FG4A 1U87A 1AQWA 3A5WA 3F4TA 1JFUA 5HR1A 4Z2TA 4HSCX 1R5PA 2K8SA 1FOVA 1YDKA 1PFOA 4XS1A 2H1LA 2OE0A 2QA2A 3HCZA 4ZL9A 3C71A 3P2AA 3KEBA 5ELAA 4IN0A 1OC3A 4TXOA 1DBYA 3ZL5A 3P90A 1SYRA 1EZKA 13GSA 2AUVA 1TP9A 4MJEA 4IJIA 2FY6A 4K2DA 5GZZB 2HSMA 1JZOA 2JZSA 3HJOA 4BVYA 4X43A 4IW9A 5H5QA 2PGTA 4N10A 4MZCA 4NV2A 5ABRA 4IVFA 1MEKA 3P7XA 3IR4A 1X5DA 1GTUA 2FLSA 19GSA 2DBCA 4G0KA 4IELA 2N5FA 3F4SA 2N5AA 1BYEA 4CW9A 1K0MA 4ECIA 3HVXA 2HSMB 1ZOFA 5IOWA 3KM6A 3TKPA 4BL7A 5L71A 2OJLA 2FCHA 1XWCA 3GH6A 2DLXA 2VD0A 4E8HA 2E7PA 3TJJA 5ECSA 3CBUA 3VWXA 1H4OA 2R0CA 2IIYA 5HR2A 3E3EA 5A5HA 1YQ1A 4L5LA 4A5PA 5AIVA 4K7OA 2O3EA 1X5EA 2HZEA 2KHPA 1M0UA 2YV7A 2C0DA 4JR6A 5J4YA 3IRAA 3L4NA 1O8XA 5F05A 2AJQB 3US3A 4I97A 2UZ8A 3N5OA 4GCIA 2VL2C 3IDVA 3VLNA 4HEA2 5G5FA 3HY2A 1BG5A 4WBJA 3UVHA 4BL7B 1BEDA 2ES7A 1K3LA 3GL3A 5KN2A 1PQNA 1TXUA 1TK8B 2MMZA 3FZ9A 2YV9A 2F3MA 4BVXA 4ID0A 5D93A 4MH2A 3HHVA 5A5HB 3N9JA 5IMAA 2YJ7A 2FD3A 1ST9A 3H93A 2HZEB 1K3OA 1EV9A 1E6BA 3IBHA 2L59A 4DVCA 4KNDA 2WVYA 4PNFA 3VFIA 2J23A 1SVMA 3CWGA 4MH3A 1XZOA 3GKMA 1M2AA 4ICYA 4OCFA 4LL1B 5ECNB 2LNTA 4K0GA 1RQMA 2LV3A 4N30A 2VL3A 3G9BA 3APSA 2C3NA 2K6VA 4LLRA 2XPDA 4BWSA 2O5VA 4XS6A 4FYCA 4POBA 4JU5A 1TXXA 2I9HA 3J7Yk 2YP6A 3TOUA 2PUKC 2V2GA 2H19A 1B9YC 3GURA 14GSA 1GUHA 2TIRA 2L4QA 2C3TA 1QK8A 4KE3A 3ZVJD 4NMUA 2WVZA 1XW5A 3ZIVA 2C0EA 3L0HA 1Q4JA 2R37A 1K0AA 4I5QA 4G2EA 4KDXA 2QGVA 2VCZA 2WRTA 4ZB6A 5AN1A 3H8QA 2C80A 4OO4A 3A2XA 1GUKA 3F3QA 3GSSA 1TKDB 3LFLA 5H5SA 1B9XC 1S3DA 3EWLA 5IPGA 1DE2A 4JEDA 8GSSA 4YQVA 5G31A 5IM9A 2I4AA 3KIJA 3VPQA 1TRWA 4TOPA 5KN0A 2IFQA 4TRXA 3O3TA 4MMMA 3RPPA 5ECQB 4BWQA 3TJKA 4MK3A 2RLIA 1V57A 5IPHA 3UEMA 4TN8A 3VURA 2JU5A 2X64A 2EFCA 3I6AA 4K0NA 4IGJA 4GWRA 1G6WA 3VI5A 4MNNA 4ML6A 4WETA 1RK4A 3FEUA 2WS2A 3IHQA 1BF5A 2RUEA 2B5YA 3HVVA 1NHYA 4YAVA 2LJKA 1VF1A 2DMLA 4L0UA 2BTOT 3UOMA 1G7EA 1AW9A 4F9ZA 5HFGA 2VUPA 2V32A 1BG1A 1SU9A 2FHEA 2KP2A 4G01A 3ZMKA 1T8EB 6GSYA 2P5QA 2WFCA 4WF4A 2VAFA 2DJ2A 2L5LA 1V58A 1SKRB 2HSNA 5D9VA 3WT1A 3M1GA 1B8XA 1SJZA 3OR5A 2B7KA 3C1RA 1FB0A 2L6CA 4IP6A 1V2AA 4CY6A 5CO3A 5FWGA 2GSQA 5EL8A 2EFDA 2OKAA 5GSSA 4BIKA 1YZXA 3HYPA 1TDIA 3LYPA 2TRCP 2LSTA 3DGQA 3GNJA 3Q18A 1K0BA 2MBSA 2WW1A 1TI3A 2HSNB 4K2XA 2MMNA 3GTUA 2HXKA 2KLXA 3QMXA 1SYXA 4KDUA 5ECRB 4K5SA 4Q5FA 2BMXA 5D9WA 4EE0A 2YWOA 4ECBA 3KCMA 5J5NA 4V1Ag 2P5RA 4MA9A 22GSA 1XCCA 3FHKA 3GSTA 1A8LA 2HLSA 5ECLB 1UC7A 1G6YA 1KNGA 3AY8A 4OFNA 5HFIA 2HSYA 4ZBAA 4PQIA 1Z5YE 1GH2A 4ZBBA 4PUFC 4EDYA 2IJYA 1XW9A 4XS4A 6GSVA 1ZYPA 2LQOA 3GTUB 1JHBA 1QXHA 4OFTA 3KD0A 1OAZA 2OA7A 3HMJG 3ED3A 3LQ7A 4LL4B 2C3QA 2E2MA 2MMAA 4NHZA 2HQTA 2A2PA 4ILFA 2OBKA 4GXZA 4HU9A 4RI6A 2YZHA 3KP8A 2BJXA 3KP9A 4G0LA 3TU3B 1OC8A 3LYKA 2DKIA 3HZ8A 3TKSA 3EMXA 1OYJA 3W6GA 2B3SA 4YKGA 2O89A 4PXOA 2NPBA 4MCUA 3C73A 3D6IA 4TKYA 3RHBA 4QMKA 2WGRA 4WBRD 5J9BA 2MMOA 4AKGA 4IQAA 4HDEA 4POMA 1HD2A 3RDWA 4GSTA 3MAKA 3L78A 2VCVA 1T00A 2AHEA 4AKIA 4KW6A 3VWUA 4OFMA 1YKCA 3WGEA 2H73A 1AAZA 4O5RA 3C1SA 3KMOA 5C04A 3HKRA 2IMFA 2ZNMA 3VWVA 2NTOA 4GLTA 3VI7A 3FMWA 1ACVA 5ELGA 20GSA 4XCSA 1XW6A 3Q74A 2VM2A 5B8BA 2O7KA 5CRHA 1IYIA 4JE1A 1MTCA 3F6FA 1BX9A 4ZB8A 1S4BP 1GNEA 6GSUA 3C7MA 5KOXA 3A5IA 2CA8A 1WPIA 2YCDA 3EU3A 3GRXA 2YZUA 3WGDA 5B6MA 3IK7A 2HI7A 2DJKA 2H66A 1CQHA 3QPMA 3IPZA 2FGXA 1WOUA 4ML1A 4PI2C 3J7Yb 1A0RP 4V2NA 18GSA 3O6TA 1OE7A 4AJ8A 2V41A 2V6OA 3MDKA 3ISOA 2ZUPA 5DAKA 3QFBC 3ZLPA 4F2IA 1Z7PA 4G0IA 4MPGA 1WIKA 1FOHA 4XTSA 4HQSA 4RQXA 1K0OA 5F07A 1H75A 1EP8A 3M0FA 2AV4A 2YOIA 2GQMA 5J41A 4QL9A 4MP4A 2XBIA 1XOBA 4JRRA 3EVIA 1G0TA 3K8NA 2F9SA 2VLUA 3LORA 3BJ5A 2R5GA 1BAYA 1SVLA 3KGKA 1EOGA 4HJMA 5JWOB 1RW1A 4Z7XA 2H30A 3KH7A 1I5GA 4MLYA 2H0GA 5DAKB 1GSQA 1K0NA 3HZ4A 1F6MC 1S3RA 1Z7RA 7GSSA 3LEFA 3IOSA 4ISDA 3GV1A 4W66A 1WJKA 2OT3A 5A5KA 1SKWB 3KTBA 4O5QA 4K7IA 5CAXA 1R7HA 1SENA 3LWAA 1ERUA 2VL2A 4CY8A 1TW9A 3QAVA 4IQ1A 4KCEA 4MJCA 2FA4A 1A2LA 2IL3A 4IJ3A 1B4PA 5IMZA 3EU4A 2IMEA 3VWWA 4OCEA 4YQMA 4CDOA 3G7JA 4MDCA 1ZYEA 3IK9A 2F51A 4POLA 1A24A 4AJ6A 4AKHA 2ON7A 4RUVA 4XRAA 4X0XA 4G19A 5A1NA 1Z6MA 2O87A 1HNCA 4F0CA 3M3MA 4KX4A 1S3CA 3BBYA 3HDCA 4DSSA 4ZL8A 1KBNA 3RAZA 2I81A 5F06A 1JLWA 2B1LA 2HRAA 3F8UA 4KA0A 3FY7A 5DQSA 3QOUA 4FYBA 2AB6A 3F4RA 3BCIA 5C00A 1HNBA 2JSYA 5DVBA 3GFKA 4TR1B 2V6KA 3HJMA 2C0FA 2WJUA 3CTFA 2A2SA 1SL0B 5D9TA 1B4QA 3WYWA 4RQRA 1KTEA 3DIEA 1SJIA 3FW2A 5IMVA 1MD3A 5A1NB 3NIVA 1S3AA 4XHMA 2NDOA 3I43A 2GSSA 2A2RA 5IOXA 4DSSB 3QD9A 1XFLA 3HD5A 10GSA 4AJ7A 2EIRA 2VIMA 2H71A 1HQOA 4POKA 2CT6A 2XHFA 3ZYWA 1NSWA 1U3IA 2D2ZA 2GQLA 1J0FA 4PURA 3GX8A 1SD8A 2JZRA 4KF9A 4E68A 3MYDA 2JACA 1M2DA 1F37A 2EC4A 2H1DA 2YWIA 4I2TA 4TR4A 1EGOA 4TW5A 5LD0A 5DQYA 5IIZA 1WMJA 3D21A 4K9ZA 2H74A 1XVWA 2IWTA 1DE1A 4L8EA 5F0GA 2H6ZA 1OKTA 2DSAA 4FH8A 4E8EA 4I6XA 1YF0A 2L5OA 2PMTA 1DSBA 4K6XA 2PN8A 4IP1A 4TVEA 2C8UA 4FXYP 1ZCPA 5JWQB 2M80A 2H76A 2RUFA 2G0FA 4YAPA 5D8IA 6GSXA 1V98A 4O7HA 3DYRA 2IN3A 5HR0A 1XWAA 2H1BA 4AKXB 2GZZA 2VM1A 1AIUA 5FHIA 1ZYNA 4HU7A 5DCGA 5CRDA 1ERVA 1X9MB 3H79A 2X4AA 3APOA 1UN2A 2PPTA 4HQZA 1SL1B 2CVBA 1YKAA 3ZREA 4GRFA 1YF1A 2VD1A 3CSIA 2YJHA 1Y6EA 2WVXA 1O6JA 2H0HA 4KAEA 1PSQA 3DVWA 2HYXA 2OE1A 1M7TA 1K0DA 5ECIB 3G7IA 2Z9SA 4F0BA 1PRXA 3GN3A 2H75A 3GYKA 2LRCA 5LCZA 3M9JA 2HRNA 3A2WA 4PQHA 4EO3A 5GSTA 4L0WA 1OKDA 1XWBA 1ZGNA 1GSUA 5IMFA 1DUGA 3RGBC 4K7NA 4YQUA 4BA7A 4HS1A 1I9DA 3LSZA 1GTBA 2R2JA 4N3ZA 3TJFA 5DJLA 3UJ1A 2WVXB 3TRXA 4NXIA 2REMA 1XXUA 3IA1A 3RHCA 3DWVA 3MIXA 3QAWA 3RBTA 4PQ1A 2LRNA 1ABAA 2JADA 4AF2A 5A4VA 4OWYA 3KMNA 4OD7A 4JZQA 5GAND 1U6TA 1K0CA 3GX0A 4I8BA 3I9V2 3CHXC 1MDJA 4HZ4A 2LNSA 2K8VA 5ENUA 1T4YA 2H1GA 1T4ZA 2YANA 1PA3A 4PTSA 5CP1A 3D4MA 1OVNA 3ERWA 2ON5A 1M99A 3FZ5A 3H1NA 4Q5NA 1QGVA 2CZ2A 1N25A 1WP0A 17GSA 3D22A 1X5CA 3JCML 2H01A 5J47A 1XWGA 1V40A 3PR8A 2X99A 4EDZA 2K18A 4NAXA 4ECCA 1J9BA 1TOFA 6GSSA 3CYNA 3L9VA 1ON4A 5G5EA 2C4JA 2CV4A 1EWXA 5CNWA 1A2MA 3VPTA 5EPFA 3F63A 4NV5A 1PKZA 3CSJA 4EUYA 1G7OA 2QA1A 3G7YA 4MJBA 2H0IA 3R2QA 9GSSA 1F9MA 3BD2A 2L6DA 1SK0A 4K1FA 3Q19A 2O36A 4I2UA 1GTAA 4N11A 1PD21 4EF0A 4BPYA 3GIXA 3E9JB 5IQYA 4LMWA 5E4WA 5AIXA 4WKWA 5ECOB 4DEJA 3FKFA 2L4CA 5BMUB 3HVNA 3M8NA 2L57A 2R3XA 1XIYA 2H72A 3MSZA 1URMA 5DALA 1I1IP 2H6XA 1M3JA 2IMDA 1SVOA 2VKZG 1SD9A 3UAPA 3SBCA 3CQFA 3GKXA 3TKQA 2GLRA 2CAIA 3DD3A 1M2BA 2DMMA 2GTUA 4JBBA 3FRCA 4USSA 2H6YA 2HFDA 1FVKA 5D73A 3HA9A 3CSHA 3QAGA 1PL2A 3TOTA 1QMVA 2AYTA 5KEJA 2HSHA 3TJGA 1MD4A 4FIWA 2WW3A 3FZAA 3D0ZA 2QC7A 3TKSE 3PPUA 4F82A 4HUAA 2VCWA 1AXDA 1FO5A 4ZB7A 3IV4A 4JR4A 5DALB 4OMVA 1ILOA 1VF2A 1PL1A 5LNKe 5H5RA 2K9FA 3DMLA 2R6KA 3UBLA 2LTKA 4K5RA 2DC5A 1TTZA 2B7JA 2EFEA 5G1KA 4N0VA 3RFRC 3DEXA 3EC3A 5BRTA 4KDYA 4IKHA 1O81A 2DJJA 4HZ2A 4EKZA 2HE3A 2PBJA 4O92A 1N2AA 2QSIA 3GL5A 4ZB9A 2X49A 3NOFA 4ZXGA 5DDLA 3U6VA 3QR6A 1YEWC 1JZDA 4WEYA 4FO5A 1EEMA 4PX1A 1X9WB 2HNLA 3SWLA 5IMCA 4KSMA 2FUG2 5A34B 2PWJA 2VO4A 3D5JA 4X4JA 1ZYQB 2R0PA 4IBPA 3F0IA 2YWNA 4KCAA 1YEPA 2LKUA 1R26A 1WE0A 1MDIA 2VCQA 3TRQA 3L9SA 4PNGA 3LW9A 3A2VA 4L5OA 1M9BA 3ERGA 1MDKA 4Z2UA 2FWFA 1SJ6A 2J9HA 1YY7A 3PGTA 2VLTA 4EL1A 4NPBA 2H70A 2OE3A 4HI7A 4XRDA 1PN0A 2R0GA 1GTIA 2R4VA 3IC4A 4V2LA 3CXGA 2GGTA 4MF7A 2OACA 5KN3A 2F8FA 1KEBA 4ACSA 4CHSA 3LXTA 2OADA 5AISA 3O76A 3TRPA 1OE8A 3FZ4A 1EGRA 2VCXA 1C72A 3WGXA 1U88A 4ZBDA 1GNWA 3VK9A 5KN1A 4ECJA 1XOAA 1T1VA 4MZWA 3KXOA 2JL4A 5D96A 3KTLA 1LU4A 1FW1A 4V2MA 4TXOB 2WZ9A 1V9WA 2ZCTA 2M72A 1GWCA 5EY6A 2A4VA 5DJMA 1GLPA 2GVPA 2P0GA 5ECHB 5ID2A 3EE2A 4O32A 4Q5RA 4WR5A 4BVYB 2RM6A 4K8MA 3S9FA 3FK8A 1GRXA 1EP7A 3E0UA 3ZMLA 4TR1A 4D73A 2CX4A 5COHA 3TDGA 4GQFA 5CYYA 1GL8A 5EVOA 1SK1A 4KGIA 2HT9A 1PX7A 3Q6OA 4MPFA 1A23A 3EPTA 1GP1A 4Z2RA 1CQGA 3UBKA 5ECMB 2GZPA 1A0FA 2WB9A 2DKHA 2JZTA 3UARA 2DJ3A 5ID2B 2X8HA 2EIOA 4DSQA 2GDRA 1T3BA 3QFAC 1GSEA 4J56E 3W8SA 1VGLA 2GT5A 3GA4A 2PU9C 1IYHA 2FNOA 1AC1A 3KJYA 4D73B 4HJ2A 2DJ1A 2XPEA 1WRYA 4ZL7A 3LJRA 2P31A 3WT2A 2GSTA 16GSA 3TUEA 1AQXA 2IMIA 3ZRDA 2KUCA 5G2ZA 2YNXA 3R3EA 2RM5A 1VRSD 1TK5B 1EEJA 2LQQA 1YEXA 1YJ6A 2MZCA 3IHGA 1TK0B 4QQ7A 1A8YA 1GUMA 2V1MA 4QL7A 4N0ZA 2XBQA 2GSRA 2VCTA 1O8WA 2KP1A 4BVXB 5B6NA 3M9KA 1PN9A 1THXA 2DIZA 1O85A 1FAAA 4F03A 3GH9A 5JCGA 2X8GA 4XIHA 5KOWA 2WZSA 3CMIA 2PVQA 3FR3A 4AGSA 2YN1A 2HZFA 4GDFA 2WCIA 4WF5A 3CRUA 1QFNA 4GTUA 4DSRA 2JSZA 2MBTA 4WR4A 3QCPA 3MNGA 3BCKA 3ZIJA 1PMTA 1LJRA
chains in the Genus database with same CATH topology
4FYUA 4GSNA 1ZZYA 4TR3A 3RPNA 5DBQA 1U3AA 3EURA 2LEGA 4LMVA 3KH9A 5J9CA 3KZQA 1BQ7A 2B5EA 4TXVA 5A4WA 2MYGA 1JZWA 3ZZXA 2VL9A 2NVLA 1WWJA 1GLQA 2H1AA 1N8JA 5JCWA 4EXJA 3TGZA 1ZL9A 4KB3A 3A3TA 4NHWA 5JCUA 4EC0A 1UVZA 2FWGA 4GQCA 5IMDA 3IC8A 3F9UA 2FA8A 2PVOC 1HNAA 3GKKA 2F8AA 2LJRA 1ERTA 1AUCA 4PGTA 2E0QA 2I3YA 2RIIA 2EFHA 4HOJA 4YH2A 4MF5A 1BJXA 3TB2A 3I69A 3C8EA 2FWHA 3CTGA 4G10A 3ZFBA 1ML6A 1TI1A 5J4VA 3CRTA 1SL2B 3MWHA 4MABA 4GSSA 2CZ3A 1GSDA 2FWEA 5J4UA 5FT3A 2IMKA 3GUSA 3PINA 3WD6A 4ULXA 2C0GA 2IFQB 2B5XA 12GSA 4J57E 2O8VB 2TRXA 3GHAA 3DVXA 1LBKA 1JZRA 2WULA 4ZIJA 1Z3EA 3TJBA 4MJAA 3LGCA 2VLVA 4FQUA 1E2YA 5CRGA 5E59A 2GQKA 2XC2A 4WXTA 5IO2A 6GSWA 4LA1A 1PKWA 4J2FA 4IS0A 3LG6A 1THOA 1Y1UA 1GSYA 1FVJA 1QUWA 1M9AA 1EOHA 2DIYA 2GT6A 3ZITA 1HYUA 2LUSA 1TJDA 4TR0A 3IAM2 4O5UA 4EIPA 3TCOA 2EIQA 3P8WA 5AGYA 1ERWA 2HRFA 3IE3A 4OO5A 3HVSA 1Z9HA 2IPAA 3D4TA 2VOCA 1YVLA 4GF0A 4KSOA 2WDUA 4KUNA 3GMFA 5GAPD 5JWRB 2QKEA 2LS5A 2I1UA 4MZBA 1USBA 4X1UA 3ME7A 1PX6A 5HR3A 1A2JA 1XWKA 2ALBA 2H8LA 3DXBA 1T7PB 4Q5QA 1XPVA 2X8CA 1TRVA 1JLVA 1VF4A 3FR6A 3APQA 3FR9A 2YWMA 3V1WA 5BMUA 1Y25A 2LRTA 2YPMA 1QQ2A 1X9SB 2CVDA 2CQ9A 4P3YB 1XVQA 1F3BA 1ZMAA 4G9HA 1K3YA 2UV8G 2CVKA 1SK2A 2C1YA 3GKNA 3NZNA 2DJ0A 1PGTA 4V1Ap 4RI7A 3LXZA 4PUAA 3EINA 5J40A 2OBIA 6GSTA 5IO0A 4H86A 1F2EA 1R5AA 4IHUA 1XBSA 2M46A 5CREA 3U5RE 1J08A 2E2GA 1W89A 5ECKB 5ECPB 4KH7A 2CX3A 1GSFA 3DKSA 3UIWA 4EIQA 3QDNA 2O85A 1W4VA 2B1KA 1UA5A 3TKRA 4EVMA 2GZYA 3F3RA 2GS3A 3ZTLA 1TU8A 5CRWA 3UL3A 1GSSA 3ZVJA 1X0RA 2B6MA 3HXSA 4XS4B 5J3RA 1O7UA 5DCHA 1FHEA 1SKSB 2HRKA 1TU7A 3L9UA 3TKSC 3W8JA 1R4WA 4YKFA 1Z6NA 3ERFA 5INYA 1OC9A 2LJAA 5A34A 1FB6A 4ZILA 2CAQA 2G2QA 5G1LA 3ZFLA 3UVTA 2PERA 5G30A 1AQVA 1EV4A 2AAWA 1NM3A 3H4KA 4NWYA 1B48A 5D9XA 3DRNA 5B8AA 3IXRA 1NHOA 2KOKA 5B7CA 3HJPA 3BOAA 2N5BA 5HQPA 4AI6A 3F6DA 4MF6A 3ME8A 3EMPA 5F8BA 3EYTA 2HRKB 2A4HA 3PH9A 3UMAA 5A4UA 11GSA 1F3AA 5HFKA 1O73A 3IAS2 1TRSA 3FYGA 1NW2A 1OC9B 1TRUA 1Q98A 1GULA 1VF3A 2NBSA 1FG4A 1U87A 1AQWA 3A5WA 3F4TA 1JFUA 5HR1A 4Z2TA 1R5PA 2K8SA 1FOVA 1YDKA 4XS1A 2H1LA 2OE0A 2QA2A 3HCZA 4ZL9A 3C71A 3P2AA 3KEBA 5ELAA 4IN0A 1OC3A 4TXOA 1DBYA 3ZL5A 3P90A 1SYRA 1EZKA 13GSA 2AUVA 1TP9A 4MJEA 4IJIA 2FY6A 4K2DA 5GZZB 2HSMA 1JZOA 2JZSA 3HJOA 4BVYA 4X43A 4IW9A 5H5QA 2PGTA 4N10A 4MZCA 4NV2A 5ABRA 4IVFA 1MEKA 3P7XA 3IR4A 1X5DA 1GTUA 2FLSA 19GSA 2DBCA 4G0KA 4IELA 2N5FA 3F4SA 2N5AA 1BYEA 4CW9A 1K0MA 4ECIA 3HVXA 2HSMB 1ZOFA 5IOWA 3KM6A 3TKPA 4BL7A 5L71A 2OJLA 2FCHA 1XWCA 3GH6A 2DLXA 2VD0A 4E8HA 2E7PA 3TJJA 5ECSA 3CBUA 3VWXA 1H4OA 2R0CA 2IIYA 5HR2A 3E3EA 5A5HA 1YQ1A 4L5LA 4A5PA 5AIVA 4K7OA 1X5EA 2HZEA 2KHPA 1M0UA 2YV7A 2C0DA 4JR6A 5J4YA 3IRAA 3L4NA 1O8XA 5F05A 2AJQB 3US3A 4I97A 2UZ8A 3N5OA 4GCIA 2VL2C 3IDVA 3VLNA 4HEA2 5G5FA 3HY2A 1BG5A 4WBJA 3UVHA 4BL7B 1BEDA 2ES7A 1K3LA 3GL3A 5KN2A 1PQNA 1TXUA 1TK8B 2MMZA 3FZ9A 2YV9A 2F3MA 4BVXA 4ID0A 5D93A 4MH2A 3HHVA 5A5HB 3N9JA 5IMAA 2YJ7A 2FD3A 1ST9A 3H93A 2HZEB 1K3OA 1EV9A 1E6BA 3IBHA 2L59A 4DVCA 4KNDA 4PNFA 3VFIA 2J23A 1SVMA 3CWGA 4MH3A 1XZOA 3GKMA 1M2AA 4ICYA 4OCFA 4LL1B 5ECNB 2LNTA 4K0GA 1RQMA 2LV3A 4N30A 2VL3A 3G9BA 3APSA 2C3NA 2K6VA 4LLRA 2XPDA 4BWSA 2O5VA 4XS6A 4FYCA 4POBA 4JU5A 1TXXA 2I9HA 3J7Yk 2YP6A 3TOUA 2PUKC 2V2GA 2H19A 1B9YC 3GURA 14GSA 1GUHA 2TIRA 2L4QA 2C3TA 1QK8A 4KE3A 3ZVJD 4NMUA 1XW5A 3ZIVA 2C0EA 3L0HA 1Q4JA 2R37A 1K0AA 4I5QA 4G2EA 4KDXA 2QGVA 2VCZA 2WRTA 4ZB6A 5AN1A 3H8QA 2C80A 4OO4A 3A2XA 1GUKA 3F3QA 3GSSA 1TKDB 3LFLA 5H5SA 1B9XC 1S3DA 3EWLA 5IPGA 1DE2A 4JEDA 8GSSA 4YQVA 5G31A 5IM9A 2I4AA 3KIJA 3VPQA 1TRWA 4TOPA 5KN0A 2IFQA 4TRXA 3O3TA 4MMMA 3RPPA 5ECQB 4BWQA 3TJKA 4MK3A 2RLIA 1V57A 5IPHA 3UEMA 4TN8A 3VURA 2JU5A 2X64A 2EFCA 3I6AA 4K0NA 4IGJA 4GWRA 1G6WA 3VI5A 4MNNA 4ML6A 4WETA 1RK4A 3FEUA 2WS2A 3IHQA 1BF5A 2RUEA 2B5YA 3HVVA 1NHYA 4YAVA 2LJKA 1VF1A 2DMLA 4L0UA 2BTOT 3UOMA 1G7EA 1AW9A 4F9ZA 5HFGA 2VUPA 2V32A 1BG1A 1SU9A 2FHEA 2KP2A 4G01A 3ZMKA 1T8EB 6GSYA 2P5QA 2WFCA 4WF4A 2VAFA 2DJ2A 2L5LA 1V58A 1SKRB 2HSNA 5D9VA 3WT1A 3M1GA 1B8XA 1SJZA 3OR5A 2B7KA 3C1RA 1FB0A 2L6CA 4IP6A 1V2AA 4CY6A 5CO3A 5FWGA 2GSQA 5EL8A 2EFDA 2OKAA 5GSSA 1YZXA 3HYPA 1TDIA 3LYPA 2TRCP 2LSTA 3DGQA 3GNJA 3Q18A 1K0BA 2MBSA 1TI3A 2HSNB 4K2XA 2MMNA 3GTUA 2HXKA 2KLXA 3QMXA 1SYXA 4KDUA 5ECRB 4K5SA 4Q5FA 2BMXA 5D9WA 4EE0A 2YWOA 4ECBA 3KCMA 5J5NA 4V1Ag 2P5RA 4MA9A 22GSA 1XCCA 3FHKA 3GSTA 1A8LA 2HLSA 5ECLB 1UC7A 1G6YA 1KNGA 3AY8A 4OFNA 5HFIA 2HSYA 4ZBAA 4PQIA 1Z5YE 1GH2A 4ZBBA 4PUFC 4EDYA 2IJYA 1XW9A 4XS4A 6GSVA 1ZYPA 2LQOA 3GTUB 1JHBA 1QXHA 4OFTA 3KD0A 1OAZA 2OA7A 3HMJG 3ED3A 3LQ7A 4LL4B 2C3QA 2E2MA 2MMAA 4NHZA 2HQTA 2A2PA 4ILFA 2OBKA 4GXZA 4HU9A 4RI6A 2YZHA 3KP8A 2BJXA 3KP9A 4G0LA 3TU3B 1OC8A 3LYKA 2DKIA 3HZ8A 3TKSA 3EMXA 1OYJA 3W6GA 2B3SA 4YKGA 2O89A 4PXOA 2NPBA 4MCUA 3C73A 3D6IA 4TKYA 3RHBA 4QMKA 2WGRA 4WBRD 5J9BA 2MMOA 4AKGA 4IQAA 4HDEA 4POMA 1HD2A 3RDWA 4GSTA 3MAKA 3L78A 2VCVA 1T00A 2AHEA 4AKIA 4KW6A 3VWUA 4OFMA 1YKCA 3WGEA 2H73A 1AAZA 4O5RA 3C1SA 3KMOA 5C04A 3HKRA 2IMFA 2ZNMA 3VWVA 2NTOA 4GLTA 3VI7A 3FMWA 1ACVA 5ELGA 20GSA 4XCSA 1XW6A 3Q74A 2VM2A 5B8BA 2O7KA 5CRHA 1IYIA 4JE1A 1MTCA 3F6FA 1BX9A 4ZB8A 1GNEA 6GSUA 3C7MA 5KOXA 3A5IA 2CA8A 1WPIA 2YCDA 3EU3A 3GRXA 2YZUA 3WGDA 5B6MA 3IK7A 2HI7A 2DJKA 2H66A 1CQHA 3QPMA 3IPZA 2FGXA 1WOUA 4ML1A 3J7Yb 1A0RP 4V2NA 18GSA 3O6TA 1OE7A 4AJ8A 2V41A 2V6OA 3MDKA 3ISOA 2ZUPA 5DAKA 3QFBC 3ZLPA 4F2IA 1Z7PA 4G0IA 4MPGA 1WIKA 1FOHA 4XTSA 4HQSA 4RQXA 1K0OA 5F07A 1H75A 1EP8A 3M0FA 2AV4A 2YOIA 2GQMA 5J41A 4QL9A 4MP4A 2XBIA 1XOBA 4JRRA 3EVIA 1G0TA 3K8NA 2F9SA 2VLUA 3LORA 3BJ5A 2R5GA 1BAYA 1SVLA 3KGKA 1EOGA 4HJMA 5JWOB 1RW1A 4Z7XA 2H30A 3KH7A 1I5GA 4MLYA 2H0GA 5DAKB 1GSQA 1K0NA 3HZ4A 1F6MC 1Z7RA 7GSSA 3LEFA 3IOSA 4ISDA 3GV1A 4W66A 1WJKA 2OT3A 5A5KA 1SKWB 3KTBA 4O5QA 4K7IA 5CAXA 1R7HA 1SENA 3LWAA 1ERUA 2VL2A 4CY8A 1TW9A 3QAVA 4IQ1A 4KCEA 4MJCA 2FA4A 1A2LA 2IL3A 4IJ3A 1B4PA 5IMZA 3EU4A 2IMEA 3VWWA 4OCEA 4YQMA 4CDOA 3G7JA 4MDCA 1ZYEA 3IK9A 2F51A 4POLA 1A24A 4AJ6A 4AKHA 2ON7A 4RUVA 4XRAA 4X0XA 4G19A 5A1NA 1Z6MA 2O87A 1HNCA 4F0CA 3M3MA 4KX4A 1S3CA 3BBYA 3HDCA 4DSSA 4ZL8A 1KBNA 3RAZA 2I81A 5F06A 1JLWA 2B1LA 2HRAA 3F8UA 4KA0A 3FY7A 5DQSA 3QOUA 4FYBA 2AB6A 3F4RA 3BCIA 5C00A 1HNBA 2JSYA 5DVBA 3GFKA 4TR1B 2V6KA 3HJMA 2C0FA 2WJUA 3CTFA 2A2SA 1SL0B 5D9TA 1B4QA 3WYWA 4RQRA 1KTEA 3DIEA 1SJIA 3FW2A 5IMVA 1MD3A 5A1NB 3NIVA 1S3AA 4XHMA 2NDOA 3I43A 2GSSA 2A2RA 5IOXA 4DSSB 3QD9A 1XFLA 3HD5A 10GSA 4AJ7A 2EIRA 2VIMA 2H71A 1HQOA 4POKA 2CT6A 2XHFA 3ZYWA 1NSWA 1U3IA 2D2ZA 2GQLA 1J0FA 4PURA 3GX8A 1SD8A 2JZRA 4KF9A 4E68A 3MYDA 2JACA 1M2DA 1F37A 2EC4A 2H1DA 2YWIA 4I2TA 4TR4A 1EGOA 4TW5A 5LD0A 5DQYA 5IIZA 1WMJA 3D21A 4K9ZA 2H74A 1XVWA 2IWTA 1DE1A 4L8EA 5F0GA 2H6ZA 1OKTA 2DSAA 4FH8A 4E8EA 4I6XA 1YF0A 2L5OA 2PMTA 1DSBA 4K6XA 2PN8A 4IP1A 4TVEA 2C8UA 1ZCPA 5JWQB 2M80A 2H76A 2RUFA 2G0FA 4YAPA 5D8IA 6GSXA 1V98A 4O7HA 3DYRA 2IN3A 5HR0A 1XWAA 2H1BA 4AKXB 2GZZA 2VM1A 1AIUA 5FHIA 1ZYNA 4HU7A 5DCGA 5CRDA 1ERVA 1X9MB 3H79A 2X4AA 3APOA 1UN2A 2PPTA 4HQZA 1SL1B 2CVBA 1YKAA 3ZREA 4GRFA 1YF1A 2VD1A 3CSIA 2YJHA 1Y6EA 1O6JA 2H0HA 4KAEA 1PSQA 3DVWA 2HYXA 2OE1A 1M7TA 1K0DA 5ECIB 3G7IA 2Z9SA 4F0BA 1PRXA 3GN3A 2H75A 3GYKA 2LRCA 5LCZA 3M9JA 2HRNA 3A2WA 4PQHA 4EO3A 5GSTA 4L0WA 1OKDA 1XWBA 1ZGNA 1GSUA 5IMFA 1DUGA 4K7NA 4YQUA 4BA7A 4HS1A 1I9DA 3LSZA 1GTBA 2R2JA 4N3ZA 3TJFA 5DJLA 3UJ1A 3TRXA 4NXIA 2REMA 1XXUA 3IA1A 3RHCA 3DWVA 3MIXA 3QAWA 3RBTA 4PQ1A 2LRNA 1ABAA 2JADA 4AF2A 5A4VA 4OWYA 3KMNA 4OD7A 4JZQA 5GAND 1U6TA 1K0CA 3GX0A 4I8BA 3I9V2 1MDJA 4HZ4A 2LNSA 2K8VA 5ENUA 1T4YA 2H1GA 1T4ZA 2YANA 1PA3A 4PTSA 5CP1A 3D4MA 1OVNA 3ERWA 2ON5A 1M99A 3FZ5A 3H1NA 4Q5NA 1QGVA 2CZ2A 1N25A 1WP0A 17GSA 3D22A 1X5CA 3JCML 2H01A 5J47A 1XWGA 1V40A 3PR8A 2X99A 4EDZA 2K18A 4NAXA 4ECCA 1J9BA 1TOFA 6GSSA 3CYNA 3L9VA 1ON4A 5G5EA 2C4JA 2CV4A 1EWXA 5CNWA 1A2MA 3VPTA 5EPFA 3F63A 4NV5A 1PKZA 3CSJA 4EUYA 1G7OA 2QA1A 3G7YA 4MJBA 2H0IA 3R2QA 9GSSA 1F9MA 3BD2A 2L6DA 1SK0A 4K1FA 3Q19A 4I2UA 1GTAA 4N11A 1PD21 4EF0A 4BPYA 3GIXA 3E9JB 5IQYA 4LMWA 5E4WA 5AIXA 4WKWA 5ECOB 4DEJA 3FKFA 2L4CA 5BMUB 3M8NA 2L57A 2R3XA 1XIYA 2H72A 3MSZA 1URMA 5DALA 2H6XA 2IMDA 1SVOA 2VKZG 1SD9A 3UAPA 3SBCA 3GKXA 3TKQA 2GLRA 2CAIA 3DD3A 1M2BA 2DMMA 2GTUA 4JBBA 3FRCA 4USSA 2H6YA 2HFDA 1FVKA 5D73A 3HA9A 3CSHA 3QAGA 1PL2A 3TOTA 1QMVA 2AYTA 5KEJA 2HSHA 3TJGA 1MD4A 4FIWA 3FZAA 3D0ZA 2QC7A 3TKSE 3PPUA 4F82A 4HUAA 2VCWA 1AXDA 1FO5A 4ZB7A 3IV4A 4JR4A 5DALB 4OMVA 1ILOA 1VF2A 1PL1A 5LNKe 5H5RA 2K9FA 3DMLA 2R6KA 3UBLA 2LTKA 4K5RA 2DC5A 1TTZA 2B7JA 2EFEA 5G1KA 4N0VA 3DEXA 3EC3A 5BRTA 4KDYA 4IKHA 1O81A 2DJJA 4HZ2A 4EKZA 2HE3A 2PBJA 4O92A 1N2AA 2QSIA 3GL5A 4ZB9A 2X49A 3NOFA 4ZXGA 5DDLA 3U6VA 3QR6A 1JZDA 4WEYA 4FO5A 1EEMA 4PX1A 1X9WB 2HNLA 3SWLA 5IMCA 4KSMA 2FUG2 5A34B 2PWJA 2VO4A 3D5JA 4X4JA 1ZYQB 2R0PA 4IBPA 3F0IA 2YWNA 4KCAA 1YEPA 2LKUA 1R26A 1WE0A 1MDIA 2VCQA 3TRQA 3L9SA 4PNGA 3LW9A 3A2VA 4L5OA 1M9BA 3ERGA 1MDKA 4Z2UA 2FWFA 1SJ6A 2J9HA 1YY7A 3PGTA 2VLTA 4EL1A 4NPBA 2H70A 2OE3A 4HI7A 4XRDA 1PN0A 2R0GA 1GTIA 2R4VA 3IC4A 4V2LA 3CXGA 2GGTA 4MF7A 2OACA 5KN3A 2F8FA 1KEBA 4ACSA 4CHSA 3LXTA 2OADA 5AISA 3O76A 3TRPA 1OE8A 3FZ4A 1EGRA 2VCXA 1C72A 3WGXA 1U88A 4ZBDA 1GNWA 3VK9A 5KN1A 4ECJA 1XOAA 1T1VA 4MZWA 3KXOA 2JL4A 5D96A 3KTLA 1LU4A 1FW1A 4V2MA 4TXOB 2WZ9A 1V9WA 2ZCTA 2M72A 1GWCA 5EY6A 2A4VA 5DJMA 1GLPA 2GVPA 2P0GA 5ECHB 5ID2A 3EE2A 4O32A 4Q5RA 4WR5A 4BVYB 2RM6A 4K8MA 3S9FA 3FK8A 1GRXA 1EP7A 3E0UA 3ZMLA 4TR1A 4D73A 2CX4A 5COHA 3TDGA 4GQFA 5CYYA 1GL8A 5EVOA 1SK1A 4KGIA 2HT9A 1PX7A 3Q6OA 4MPFA 1A23A 3EPTA 1GP1A 4Z2RA 1CQGA 3UBKA 5ECMB 2GZPA 1A0FA 2WB9A 2DKHA 2JZTA 3UARA 2DJ3A 5ID2B 2X8HA 2EIOA 4DSQA 2GDRA 1T3BA 3QFAC 1GSEA 4J56E 3W8SA 1VGLA 2GT5A 3GA4A 2PU9C 1IYHA 2FNOA 1AC1A 3KJYA 4D73B 4HJ2A 2DJ1A 2XPEA 1WRYA 4ZL7A 3LJRA 2P31A 3WT2A 2GSTA 16GSA 3TUEA 1AQXA 2IMIA 3ZRDA 2KUCA 5G2ZA 2YNXA 3R3EA 2RM5A 1VRSD 1TK5B 1EEJA 2LQQA 1YEXA 1YJ6A 2MZCA 3IHGA 1TK0B 4QQ7A 1A8YA 1GUMA 2V1MA 4QL7A 4N0ZA 2XBQA 2GSRA 2VCTA 1O8WA 2KP1A 4BVXB 5B6NA 3M9KA 1PN9A 1THXA 2DIZA 1O85A 1FAAA 4F03A 3GH9A 5JCGA 2X8GA 4XIHA 5KOWA 3CMIA 2PVQA 3FR3A 4AGSA 2YN1A 2HZFA 4GDFA 2WCIA 4WF5A 3CRUA 1QFNA 4GTUA 4DSRA 2JSZA 2MBTA 4WR4A 3QCPA 3MNGA 3BCKA 3ZIJA 1PMTA 1LJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FYU A;  4GSN A;  1ZZY A;  4TR3 A;  3RPN A;  5DBQ A;  1U3A A;  3EUR A;  2LEG A;  4LMV A;  3KH9 A;  5J9C A;  3KZQ A;  1BQ7 A;  2B5E A;  4TXV A;  5A4W A;  2MYG A;  1JZW A;  3ZZX A;  2VL9 A;  2NVL A;  1WWJ A;  1GLQ A;  2H1A A;  1N8J A;  5JCW A;  4EXJ A;  3TGZ A;  1ZL9 A;  4KB3 A;  3A3T A;  4NHW A;  5JCU A;  4EC0 A;  1UVZ A;  2FWG A;  4GQC A;  5IMD A;  3IC8 A;  3F9U A;  2FA8 A;  2PVO C;  1HNA A;  3GKK A;  2F8A A;  2LJR A;  1ERT A;  1AUC A;  4PGT A;  2E0Q A;  2I3Y A;  2RII A;  4HOJ A;  4YH2 A;  4MF5 A;  1BJX A;  3TB2 A;  3I69 A;  3C8E A;  2FWH A;  3CTG A;  4G10 A;  3ZFB A;  1ML6 A;  1TI1 A;  3CRT A;  1SL2 B;  3MWH A;  4MAB A;  4GSS A;  2CZ3 A;  1GSD A;  2FWE A;  5J4U A;  5FT3 A;  2IMK A;  3GUS A;  3PIN A;  3WD6 A;  4ULX A;  2C0G A;  2IFQ B;  2B5X A;  12GS A;  4J57 E;  2O8V B;  2TRX A;  3GHA A;  3DVX A;  1LBK A;  1JZR A;  2WUL A;  4ZIJ A;  1Z3E A;  3TJB A;  4MJA A;  3LGC A;  2VLV A;  4FQU A;  1E2Y A;  5CRG A;  5E59 A;  2GQK A;  2XC2 A;  4WXT A;  5IO2 A;  6GSW A;  4LA1 A;  1PKW A;  4J2F A;  4IS0 A;  3LG6 A;  1THO A;  1GSY A;  1FVJ A;  1QUW A;  1M9A A;  1EOH A;  2DIY A;  2GT6 A;  3ZIT A;  1HYU A;  2LUS A;  1TJD A;  4TR0 A;  3IAM 2;  3TCO A;  2EIQ A;  3P8W A;  5AGY A;  1ERW A;  2HRF A;  3IE3 A;  4OO5 A;  3HVS A;  1Z9H A;  2IPA A;  3D4T A;  2VOC A;  4GF0 A;  4KSO A;  2WDU A;  4KUN A;  3GMF A;  5GAP D;  5JWR B;  2QKE A;  2LS5 A;  2I1U A;  4MZB A;  1USB A;  4X1U A;  3ME7 A;  1PX6 A;  5HR3 A;  1A2J A;  1XWK A;  2ALB A;  2H8L A;  3DXB A;  1T7P B;  4Q5Q A;  1XPV A;  2X8C A;  1TRV A;  1JLV A;  1VF4 A;  3FR6 A;  3APQ A;  3FR9 A;  2YWM A;  3V1W A;  5BMU A;  1Y25 A;  2LRT A;  2YPM A;  1QQ2 A;  1X9S B;  2CVD A;  2CQ9 A;  4P3Y B;  1XVQ A;  1F3B A;  1ZMA A;  4G9H A;  1K3Y A;  2CVK A;  1SK2 A;  2C1Y A;  3GKN A;  3NZN A;  2DJ0 A;  1PGT A;  4V1A p;  4RI7 A;  3LXZ A;  4PUA A;  3EIN A;  2OBI A;  6GST A;  5IO0 A;  4H86 A;  1F2E A;  1R5A A;  4IHU A;  1XBS A;  2M46 A;  5CRE A;  3U5R E;  1J08 A;  2E2G A;  1W89 A;  5ECK B;  5ECP B;  4KH7 A;  2CX3 A;  1GSF A;  3DKS A;  3UIW A;  3QDN A;  2O85 A;  1W4V A;  2B1K A;  1UA5 A;  3TKR A;  4EVM A;  2GZY A;  3F3R A;  2GS3 A;  3ZTL A;  1TU8 A;  5CRW A;  3UL3 A;  1GSS A;  3ZVJ A;  1X0R A;  2B6M A;  3HXS A;  4XS4 B;  5J3R A;  1O7U A;  5DCH A;  1FHE A;  1SKS B;  2HRK A;  1TU7 A;  3L9U A;  3TKS C;  3W8J A;  1R4W A;  1Z6N A;  3ERF A;  5INY A;  1OC9 A;  2LJA A;  1FB6 A;  4ZIL A;  2CAQ A;  2G2Q A;  5G1L A;  3ZFL A;  3UVT A;  2PER A;  5G30 A;  1AQV A;  1EV4 A;  2AAW A;  1NM3 A;  3H4K A;  4NWY A;  1B48 A;  5D9X A;  3DRN A;  5B8A A;  3IXR A;  1NHO A;  2KOK A;  5B7C A;  3HJP A;  3BOA A;  2N5B A;  5HQP A;  3F6D A;  4MF6 A;  3ME8 A;  3EMP A;  5F8B A;  3EYT A;  2HRK B;  3PH9 A;  3UMA A;  5A4U A;  11GS A;  1F3A A;  5HFK A;  1O73 A;  3IAS 2;  1TRS A;  3FYG A;  1NW2 A;  1OC9 B;  1TRU A;  1Q98 A;  1GUL A;  1VF3 A;  2NBS A;  1FG4 A;  1U87 A;  1AQW A;  3A5W A;  3F4T A;  1JFU A;  5HR1 A;  1R5P A;  2K8S A;  1FOV A;  1YDK A;  4XS1 A;  2OE0 A;  3HCZ A;  4ZL9 A;  3C71 A;  3P2A A;  3KEB A;  5ELA A;  4IN0 A;  1OC3 A;  4TXO A;  1DBY A;  3ZL5 A;  3P90 A;  1SYR A;  1EZK A;  13GS A;  2AUV A;  1TP9 A;  4MJE A;  4IJI A;  2FY6 A;  4K2D A;  5GZZ B;  2HSM A;  1JZO A;  2JZS A;  3HJO A;  4BVY A;  4X43 A;  4IW9 A;  5H5Q A;  2PGT A;  4N10 A;  4MZC A;  4NV2 A;  5ABR A;  4IVF A;  1MEK A;  3P7X A;  3IR4 A;  1X5D A;  1GTU A;  2FLS A;  19GS A;  2DBC A;  4G0K A;  4IEL A;  2N5F A;  3F4S A;  2N5A A;  1BYE A;  4CW9 A;  1K0M A;  4ECI A;  3HVX A;  2HSM B;  1ZOF A;  5IOW A;  3KM6 A;  3TKP A;  4BL7 A;  5L71 A;  2OJL A;  2FCH A;  1XWC A;  3GH6 A;  2DLX A;  2VD0 A;  4E8H A;  2E7P A;  3TJJ A;  5ECS A;  3CBU A;  3VWX A;  1H4O A;  2IIY A;  5HR2 A;  3E3E A;  1YQ1 A;  4L5L A;  5AIV A;  4K7O A;  1X5E A;  2HZE A;  2KHP A;  1M0U A;  2YV7 A;  2C0D A;  4JR6 A;  3IRA A;  3L4N A;  1O8X A;  5F05 A;  2AJQ B;  3US3 A;  4I97 A;  2UZ8 A;  3N5O A;  4GCI A;  2VL2 C;  3IDV A;  3VLN A;  4HEA 2;  5G5F A;  3HY2 A;  1BG5 A;  4WBJ A;  3UVH A;  4BL7 B;  1BED A;  2ES7 A;  1K3L A;  3GL3 A;  5KN2 A;  1PQN A;  1TK8 B;  2MMZ A;  3FZ9 A;  2YV9 A;  2F3M A;  4BVX A;  4ID0 A;  5D93 A;  4MH2 A;  3HHV A;  3N9J A;  5IMA A;  2YJ7 A;  2FD3 A;  1ST9 A;  3H93 A;  2HZE B;  1K3O A;  1EV9 A;  1E6B A;  3IBH A;  2L59 A;  4DVC A;  4KND A;  4PNF A;  3VFI A;  2J23 A;  4MH3 A;  1XZO A;  3GKM A;  1M2A A;  4OCF A;  4LL1 B;  5ECN B;  2LNT A;  4K0G A;  1RQM A;  2LV3 A;  4N30 A;  2VL3 A;  3G9B A;  3APS A;  2C3N A;  2K6V A;  4LLR A;  2XPD A;  4BWS A;  4XS6 A;  4FYC A;  4POB A;  4JU5 A;  1TXX A;  2I9H A;  3J7Y k;  2YP6 A;  3TOU A;  2PUK C;  2V2G A;  2H19 A;  1B9Y C;  3GUR A;  14GS A;  1GUH A;  2TIR A;  2L4Q A;  2C3T A;  1QK8 A;  4KE3 A;  3ZVJ D;  4NMU A;  1XW5 A;  3ZIV A;  2C0E A;  3L0H A;  1Q4J A;  2R37 A;  1K0A A;  4I5Q A;  4G2E A;  4KDX A;  2QGV A;  2VCZ A;  2WRT A;  4ZB6 A;  5AN1 A;  3H8Q A;  2C80 A;  4OO4 A;  3A2X A;  1GUK A;  3F3Q A;  3GSS A;  1TKD B;  3LFL A;  5H5S A;  1B9X C;  1S3D A;  3EWL A;  5IPG A;  1DE2 A;  4JED A;  8GSS A;  4YQV A;  5G31 A;  5IM9 A;  2I4A A;  3KIJ A;  3VPQ A;  1TRW A;  4TOP A;  5KN0 A;  2IFQ A;  4TRX A;  3O3T A;  4MMM A;  3RPP A;  5ECQ B;  4BWQ A;  3TJK A;  4MK3 A;  2RLI A;  1V57 A;  5IPH A;  3UEM A;  4TN8 A;  3VUR A;  2JU5 A;  2X64 A;  3I6A A;  4K0N A;  4IGJ A;  4GWR A;  1G6W A;  3VI5 A;  4ML6 A;  4WET A;  1RK4 A;  3FEU A;  2WS2 A;  3IHQ A;  2RUE A;  2B5Y A;  3HVV A;  1NHY A;  4YAV A;  2LJK A;  1VF1 A;  2DML A;  4L0U A;  2BTO T;  3UOM A;  1G7E A;  1AW9 A;  4F9Z A;  5HFG A;  2VUP A;  2V32 A;  1SU9 A;  2FHE A;  2KP2 A;  3ZMK A;  1T8E B;  6GSY A;  2P5Q A;  2WFC A;  4WF4 A;  2VAF A;  2DJ2 A;  2L5L A;  1V58 A;  1SKR B;  5D9V A;  3WT1 A;  3M1G A;  1B8X A;  1SJZ A;  3OR5 A;  2B7K A;  3C1R A;  1FB0 A;  2L6C A;  4IP6 A;  1V2A A;  5CO3 A;  5FWG A;  2GSQ A;  5EL8 A;  2OKA A;  5GSS A;  1YZX A;  3HYP A;  1TDI A;  3LYP A;  2TRC P;  2LST A;  3DGQ A;  3GNJ A;  3Q18 A;  1K0B A;  2MBS A;  1TI3 A;  2HSN B;  2MMN A;  3GTU A;  2HXK A;  2KLX A;  3QMX A;  1SYX A;  4KDU A;  5ECR B;  4Q5F A;  2BMX A;  5D9W A;  4EE0 A;  2YWO A;  4ECB A;  3KCM A;  5J5N A;  4V1A g;  2P5R A;  4MA9 A;  22GS A;  1XCC A;  3FHK A;  3GST A;  1A8L A;  2HLS A;  5ECL B;  1UC7 A;  1G6Y A;  1KNG A;  3AY8 A;  4OFN A;  5HFI A;  2HSY A;  4ZBA A;  4PQI A;  1Z5Y E;  1GH2 A;  4ZBB A;  4PUF C;  4EDY A;  2IJY A;  1XW9 A;  4XS4 A;  6GSV A;  2LQO A;  3GTU B;  1JHB A;  1QXH A;  4OFT A;  3KD0 A;  1OAZ A;  2OA7 A;  3ED3 A;  3LQ7 A;  4LL4 B;  2C3Q A;  2E2M A;  2MMA A;  4NHZ A;  2HQT A;  4ILF A;  2OBK A;  4GXZ A;  4HU9 A;  4RI6 A;  2YZH A;  3KP8 A;  2BJX A;  3KP9 A;  4G0L A;  1OC8 A;  3LYK A;  3HZ8 A;  3TKS A;  3EMX A;  1OYJ A;  3W6G A;  2B3S A;  2O89 A;  4PXO A;  2NPB A;  4MCU A;  3C73 A;  3D6I A;  4TKY A;  3RHB A;  2WGR A;  4WBR D;  5J9B A;  2MMO A;  4IQA A;  4HDE A;  4POM A;  1HD2 A;  3RDW A;  4GST A;  3MAK A;  3L78 A;  2VCV A;  1T00 A;  2AHE A;  4KW6 A;  3VWU A;  4OFM A;  1YKC A;  3WGE A;  2H73 A;  1AAZ A;  4O5R A;  3C1S A;  3KMO A;  5C04 A;  3HKR A;  2IMF A;  2ZNM A;  3VWV A;  2NTO A;  4GLT A;  3VI7 A;  1ACV A;  5ELG A;  20GS A;  4XCS A;  1XW6 A;  3Q74 A;  2VM2 A;  5B8B A;  2O7K A;  5CRH A;  1IYI A;  4JE1 A;  1MTC A;  3F6F A;  1BX9 A;  4ZB8 A;  1GNE A;  6GSU A;  3C7M A;  2CA8 A;  1WPI A;  2YCD A;  3EU3 A;  3GRX A;  2YZU A;  3WGD A;  5B6M A;  3IK7 A;  2HI7 A;  2DJK A;  2H66 A;  1CQH A;  3QPM A;  3IPZ A;  2FGX A;  1WOU A;  4ML1 A;  3J7Y b;  1A0R P;  4V2N A;  18GS A;  3O6T A;  1OE7 A;  4AJ8 A;  2V41 A;  2V6O A;  3MDK A;  3ISO A;  2ZUP A;  5DAK A;  3QFB C;  3ZLP A;  4F2I A;  1Z7P A;  4G0I A;  4MPG A;  1WIK A;  4XTS A;  4HQS A;  4RQX A;  1K0O A;  5F07 A;  1H75 A;  1EP8 A;  3M0F A;  2AV4 A;  2YOI A;  2GQM A;  5J41 A;  4QL9 A;  4MP4 A;  2XBI A;  1XOB A;  4JRR A;  3EVI A;  1G0T A;  3K8N A;  2F9S A;  2VLU A;  3LOR A;  3BJ5 A;  2R5G A;  1BAY A;  3KGK A;  1EOG A;  4HJM A;  5JWO B;  1RW1 A;  4Z7X A;  2H30 A;  3KH7 A;  1I5G A;  4MLY A;  2H0G A;  5DAK B;  1GSQ A;  1K0N A;  3HZ4 A;  1F6M C;  1Z7R A;  7GSS A;  3LEF A;  3IOS A;  4ISD A;  3GV1 A;  1WJK A;  5A5K A;  1SKW B;  3KTB A;  4K7I A;  5CAX A;  1R7H A;  1SEN A;  3LWA A;  1ERU A;  2VL2 A;  1TW9 A;  3QAV A;  4IQ1 A;  4KCE A;  4MJC A;  2FA4 A;  1A2L A;  2IL3 A;  4IJ3 A;  1B4P A;  5IMZ A;  3EU4 A;  2IME A;  3VWW A;  4OCE A;  4YQM A;  4CDO A;  3G7J A;  4MDC A;  1ZYE A;  3IK9 A;  2F51 A;  4POL A;  1A24 A;  4AJ6 A;  2ON7 A;  4RUV A;  4XRA A;  4X0X A;  4G19 A;  1Z6M A;  2O87 A;  1HNC A;  4F0C A;  3M3M A;  4KX4 A;  1S3C A;  3BBY A;  3HDC A;  4DSS A;  4ZL8 A;  1KBN A;  3RAZ A;  2I81 A;  5F06 A;  1JLW A;  2B1L A;  2HRA A;  3F8U A;  4KA0 A;  3FY7 A;  5DQS A;  3QOU A;  4FYB A;  2AB6 A;  3F4R A;  3BCI A;  5C00 A;  1HNB A;  2JSY A;  5DVB A;  3GFK A;  4TR1 B;  2V6K A;  3HJM A;  2C0F A;  2WJU A;  3CTF A;  2A2S A;  1SL0 B;  5D9T A;  1B4Q A;  3WYW A;  4RQR A;  1KTE A;  3DIE A;  1SJI A;  3FW2 A;  5IMV A;  1MD3 A;  3NIV A;  1S3A A;  4XHM A;  2NDO A;  3I43 A;  2GSS A;  2A2R A;  5IOX A;  4DSS B;  3QD9 A;  1XFL A;  3HD5 A;  10GS A;  4AJ7 A;  2EIR A;  2VIM A;  2H71 A;  1HQO A;  4POK A;  2CT6 A;  2XHF A;  3ZYW A;  1NSW A;  1U3I A;  2D2Z A;  2GQL A;  1J0F A;  4PUR A;  3GX8 A;  1SD8 A;  2JZR A;  4KF9 A;  2JAC A;  1M2D A;  1F37 A;  2EC4 A;  2H1D A;  2YWI A;  4I2T A;  4TR4 A;  1EGO A;  4TW5 A;  5LD0 A;  5DQY A;  5IIZ A;  1WMJ A;  3D21 A;  4K9Z A;  2H74 A;  1XVW A;  2IWT A;  1DE1 A;  4L8E A;  5F0G A;  2H6Z A;  1OKT A;  2DSA A;  4FH8 A;  4E8E A;  4I6X A;  1YF0 A;  2L5O A;  2PMT A;  1DSB A;  4K6X A;  2PN8 A;  4IP1 A;  4TVE A;  2C8U A;  1ZCP A;  5JWQ B;  2M80 A;  2H76 A;  2RUF A;  2G0F A;  4YAP A;  5D8I A;  6GSX A;  1V98 A;  4O7H A;  3DYR A;  2IN3 A;  5HR0 A;  1XWA A;  2H1B A;  2GZZ A;  2VM1 A;  1AIU A;  5FHI A;  4HU7 A;  5DCG A;  5CRD A;  1ERV A;  1X9M B;  3H79 A;  3APO A;  1UN2 A;  2PPT A;  4HQZ A;  1SL1 B;  2CVB A;  1YKA A;  3ZRE A;  4GRF A;  1YF1 A;  2VD1 A;  3CSI A;  2YJH A;  1Y6E A;  1O6J A;  2H0H A;  4KAE A;  1PSQ A;  3DVW A;  2HYX A;  2OE1 A;  1M7T A;  1K0D A;  5ECI B;  3G7I A;  2Z9S A;  4F0B A;  1PRX A;  3GN3 A;  2H75 A;  3GYK A;  2LRC A;  5LCZ A;  3M9J A;  2HRN A;  3A2W A;  4PQH A;  4EO3 A;  5GST A;  4L0W A;  1OKD A;  1XWB A;  1ZGN A;  1GSU A;  5IMF A;  1DUG A;  4K7N A;  4YQU A;  4BA7 A;  4HS1 A;  1I9D A;  3LSZ A;  1GTB A;  2R2J A;  3TJF A;  5DJL A;  3UJ1 A;  3TRX A;  4NXI A;  2REM A;  1XXU A;  3IA1 A;  3RHC A;  3DWV A;  3QAW A;  3RBT A;  4PQ1 A;  2LRN A;  1ABA A;  2JAD A;  4AF2 A;  5A4V A;  4OWY A;  3KMN A;  4OD7 A;  4JZQ A;  5GAN D;  1U6T A;  1K0C A;  3GX0 A;  4I8B A;  3I9V 2;  1MDJ A;  4HZ4 A;  2LNS A;  2K8V A;  5ENU A;  1T4Y A;  2H1G A;  1T4Z A;  2YAN A;  1PA3 A;  4PTS A;  5CP1 A;  3D4M A;  1OVN A;  3ERW A;  2ON5 A;  1M99 A;  3FZ5 A;  3H1N A;  4Q5N A;  1QGV A;  2CZ2 A;  1WP0 A;  17GS A;  3D22 A;  1X5C A;  3JCM L;  2H01 A;  1XWG A;  1V40 A;  3PR8 A;  2X99 A;  4EDZ A;  2K18 A;  4NAX A;  4ECC A;  1J9B A;  1TOF A;  6GSS A;  3CYN A;  3L9V A;  1ON4 A;  5G5E A;  2C4J A;  2CV4 A;  1EWX A;  5CNW A;  1A2M A;  3VPT A;  5EPF A;  3F63 A;  4NV5 A;  1PKZ A;  3CSJ A;  4EUY A;  1G7O A;  3G7Y A;  4MJB A;  2H0I A;  3R2Q A;  9GSS A;  1F9M A;  3BD2 A;  2L6D A;  1SK0 A;  4K1F A;  3Q19 A;  4I2U A;  1GTA A;  4N11 A;  1PD2 1;  4EF0 A;  4BPY A;  3GIX A;  3E9J B;  5IQY A;  4LMW A;  5E4W A;  5AIX A;  4WKW A;  5ECO B;  4DEJ A;  3FKF A;  2L4C A;  3M8N A;  2L57 A;  2R3X A;  1XIY A;  2H72 A;  3MSZ A;  1URM A;  5DAL A;  2H6X A;  2IMD A;  1SD9 A;  3UAP A;  3SBC A;  3GKX A;  3TKQ A;  2GLR A;  2CAI A;  3DD3 A;  1M2B A;  2DMM A;  2GTU A;  4JBB A;  3FRC A;  4USS A;  2H6Y A;  2HFD A;  1FVK A;  5D73 A;  3HA9 A;  3CSH A;  3QAG A;  1PL2 A;  3TOT A;  1QMV A;  2AYT A;  5KEJ A;  2HSH A;  3TJG A;  1MD4 A;  4FIW A;  3FZA A;  3D0Z A;  2QC7 A;  3TKS E;  3PPU A;  4F82 A;  4HUA A;  2VCW A;  1AXD A;  1FO5 A;  3IV4 A;  4JR4 A;  5DAL B;  4OMV A;  1ILO A;  1VF2 A;  1PL1 A;  5LNK e;  5H5R A;  2K9F A;  3DML A;  2R6K A;  3UBL A;  2LTK A;  2DC5 A;  1TTZ A;  2B7J A;  5G1K A;  4N0V A;  3DEX A;  3EC3 A;  4KDY A;  4IKH A;  1O81 A;  2DJJ A;  4HZ2 A;  4EKZ A;  2HE3 A;  2PBJ A;  4O92 A;  1N2A A;  2QSI A;  3GL5 A;  4ZB9 A;  3NOF A;  4ZXG A;  5DDL A;  3U6V A;  3QR6 A;  1JZD A;  4WEY A;  4FO5 A;  1EEM A;  4PX1 A;  1X9W B;  2HNL A;  3SWL A;  5IMC A;  4KSM A;  2FUG 2;  2PWJ A;  2VO4 A;  3D5J A;  1ZYQ B;  4IBP A;  3F0I A;  2YWN A;  4KCA A;  1YEP A;  2LKU A;  1R26 A;  1WE0 A;  1MDI A;  2VCQ A;  3TRQ A;  3L9S A;  4PNG A;  3A2V A;  4L5O A;  1M9B A;  3ERG A;  1MDK A;  2FWF A;  1SJ6 A;  2J9H A;  1YY7 A;  3PGT A;  2VLT A;  4EL1 A;  4NPB A;  2H70 A;  2OE3 A;  4HI7 A;  4XRD A;  1GTI A;  2R4V A;  3IC4 A;  4V2L A;  3CXG A;  2GGT A;  4MF7 A;  2OAC A;  5KN3 A;  2F8F A;  1KEB A;  4ACS A;  4CHS A;  3LXT A;  2OAD A;  5AIS A;  3O76 A;  3TRP A;  1OE8 A;  3FZ4 A;  1EGR A;  2VCX A;  1C72 A;  3WGX A;  1U88 A;  4ZBD A;  1GNW A;  3VK9 A;  5KN1 A;  4ECJ A;  1XOA A;  1T1V A;  4MZW A;  3KXO A;  2JL4 A;  5D96 A;  3KTL A;  1LU4 A;  1FW1 A;  4V2M A;  4TXO B;  2WZ9 A;  1V9W A;  2ZCT A;  2M72 A;  1GWC A;  5EY6 A;  2A4V A;  5DJM A;  1GLP A;  2GVP A;  2P0G A;  5ECH B;  5ID2 A;  3EE2 A;  4O32 A;  4Q5R A;  4WR5 A;  4BVY B;  2RM6 A;  4K8M A;  3S9F A;  3FK8 A;  1GRX A;  1EP7 A;  3E0U A;  3ZML A;  4TR1 A;  4D73 A;  2CX4 A;  5COH A;  3TDG A;  4GQF A;  5CYY A;  1GL8 A;  5EVO A;  1SK1 A;  4KGI A;  2HT9 A;  1PX7 A;  3Q6O A;  4MPF A;  1A23 A;  1GP1 A;  1CQG A;  3UBK A;  5ECM B;  2GZP A;  1A0F A;  2WB9 A;  2JZT A;  3UAR A;  2DJ3 A;  5ID2 B;  2X8H A;  2EIO A;  4DSQ A;  2GDR A;  1T3B A;  3QFA C;  1GSE A;  4J56 E;  3W8S A;  1VGL A;  2GT5 A;  3GA4 A;  2PU9 C;  1IYH A;  2FNO A;  1AC1 A;  3KJY A;  4D73 B;  4HJ2 A;  2DJ1 A;  2XPE A;  1WRY A;  4ZL7 A;  3LJR A;  2P31 A;  3WT2 A;  2GST A;  16GS A;  3TUE A;  1AQX A;  2IMI A;  3ZRD A;  2KUC A;  5G2Z A;  2YNX A;  3R3E A;  2RM5 A;  1VRS D;  1TK5 B;  1EEJ A;  2LQQ A;  1YEX A;  1YJ6 A;  2MZC A;  1TK0 B;  4QQ7 A;  1A8Y A;  1GUM A;  2V1M A;  4QL7 A;  4N0Z A;  2XBQ A;  2GSR A;  2VCT A;  1O8W A;  2KP1 A;  4BVX B;  5B6N A;  3M9K A;  1PN9 A;  1THX A;  2DIZ A;  1O85 A;  1FAA A;  4F03 A;  3GH9 A;  5JCG A;  2X8G A;  4XIH A;  3CMI A;  2PVQ A;  3FR3 A;  4AGS A;  2YN1 A;  2HZF A;  2WCI A;  4WF5 A;  3CRU A;  1QFN A;  4GTU A;  4DSR A;  2JSZ A;  2MBT A;  4WR4 A;  3QCP A;  3MNG A;  3BCK A;  3ZIJ A;  1PMT A;  1LJR A; 
#chains in the Genus database with same CATH topology
 4FYU A;  4GSN A;  1ZZY A;  4TR3 A;  3RPN A;  5DBQ A;  1U3A A;  3EUR A;  2LEG A;  4LMV A;  3KH9 A;  5J9C A;  3KZQ A;  1BQ7 A;  2B5E A;  4TXV A;  5A4W A;  2MYG A;  1JZW A;  3ZZX A;  2VL9 A;  2NVL A;  1WWJ A;  1GLQ A;  2H1A A;  1N8J A;  5JCW A;  4EXJ A;  3TGZ A;  1ZL9 A;  4KB3 A;  3A3T A;  4NHW A;  5JCU A;  4EC0 A;  1UVZ A;  2FWG A;  4GQC A;  5IMD A;  3IC8 A;  3F9U A;  2FA8 A;  2PVO C;  1HNA A;  3GKK A;  2F8A A;  2LJR A;  1ERT A;  1AUC A;  4PGT A;  2E0Q A;  2I3Y A;  2RII A;  2EFH A;  4HOJ A;  4YH2 A;  4MF5 A;  1BJX A;  3TB2 A;  3I69 A;  3C8E A;  2FWH A;  3CTG A;  4G10 A;  3ZFB A;  1ML6 A;  1TI1 A;  5J4V A;  3CRT A;  1SL2 B;  3MWH A;  4MAB A;  4GSS A;  2CZ3 A;  1GSD A;  2FWE A;  5J4U A;  5FT3 A;  2IMK A;  2WW0 A;  3GUS A;  3PIN A;  3WD6 A;  4ULX A;  2C0G A;  2IFQ B;  2B5X A;  2WW2 A;  12GS A;  4J57 E;  2O8V B;  2TRX A;  3GHA A;  3DVX A;  1LBK A;  1JZR A;  2WUL A;  4ZIJ A;  1Z3E A;  3TJB A;  4MJA A;  3LGC A;  2VLV A;  4FQU A;  1E2Y A;  5CRG A;  5E59 A;  2GQK A;  2XC2 A;  4WXT A;  5IO2 A;  6GSW A;  4LA1 A;  1PKW A;  4J2F A;  4IS0 A;  3LG6 A;  1THO A;  1Y1U A;  1GSY A;  1FVJ A;  1QUW A;  1M9A A;  1EOH A;  2DIY A;  2GT6 A;  3ZIT A;  1HYU A;  2LUS A;  1TJD A;  4TR0 A;  3IAM 2;  4O5U A;  4EIP A;  3TCO A;  2EIQ A;  3P8W A;  5AGY A;  1ERW A;  2HRF A;  3IE3 A;  4OO5 A;  3HVS A;  1Z9H A;  2IPA A;  3D4T A;  2VOC A;  1YVL A;  4GF0 A;  4KSO A;  2WDU A;  4KUN A;  3GMF A;  5GAP D;  5JWR B;  2QKE A;  2LS5 A;  2I1U A;  4MZB A;  1USB A;  4X1U A;  3ME7 A;  1PX6 A;  5HR3 A;  1A2J A;  1XWK A;  2ALB A;  2H8L A;  3DXB A;  1T7P B;  4Q5Q A;  1XPV A;  2X8C A;  1TRV A;  1JLV A;  1VF4 A;  4PI0 C;  3FR6 A;  3APQ A;  3FR9 A;  2YWM A;  3V1W A;  5BMU A;  1Y25 A;  2LRT A;  2YPM A;  1QQ2 A;  1X9S B;  2CVD A;  2CQ9 A;  4P3Y B;  1XVQ A;  1F3B A;  1ZMA A;  4G9H A;  1K3Y A;  2UV8 G;  2CVK A;  1SK2 A;  2C1Y A;  3GKN A;  3NZN A;  2DJ0 A;  1PGT A;  4V1A p;  4RI7 A;  3LXZ A;  4PUA A;  3EIN A;  5J40 A;  2OBI A;  6GST A;  5IO0 A;  4H86 A;  1F2E A;  1R5A A;  4IHU A;  1XBS A;  2M46 A;  5CRE A;  3U5R E;  1J08 A;  2E2G A;  1W89 A;  5ECK B;  5ECP B;  4KH7 A;  2CX3 A;  1GSF A;  3DKS A;  3UIW A;  4EIQ A;  3QDN A;  2O85 A;  1W4V A;  2B1K A;  1UA5 A;  3TKR A;  4EVM A;  2GZY A;  3F3R A;  2GS3 A;  3ZTL A;  1TU8 A;  5CRW A;  3UL3 A;  1GSS A;  3ZVJ A;  1X0R A;  2B6M A;  3HXS A;  4XS4 B;  5J3R A;  1O7U A;  5DCH A;  1FHE A;  1SKS B;  2HRK A;  1TU7 A;  3L9U A;  3TKS C;  3W8J A;  1R4W A;  4YKF A;  1Z6N A;  3ERF A;  5INY A;  1OC9 A;  2LJA A;  5A34 A;  1FB6 A;  4ZIL A;  2CAQ A;  2G2Q A;  5G1L A;  3ZFL A;  3UVT A;  2PER A;  5G30 A;  1AQV A;  1EV4 A;  2AAW A;  4PHZ C;  1NM3 A;  1XG8 A;  3H4K A;  4NWY A;  1B48 A;  5D9X A;  3DRN A;  5B8A A;  3IXR A;  1NHO A;  2KOK A;  5B7C A;  3HJP A;  3BOA A;  2N5B A;  5HQP A;  4AI6 A;  3F6D A;  4MF6 A;  3ME8 A;  3EMP A;  5F8B A;  3EYT A;  2HRK B;  2A4H A;  3PH9 A;  3UMA A;  5A4U A;  11GS A;  1F3A A;  5HFK A;  1O73 A;  3IAS 2;  1TRS A;  3FYG A;  1NW2 A;  1OC9 B;  1M3I A;  1TRU A;  1Q98 A;  1GUL A;  1VF3 A;  2NBS A;  1FG4 A;  1U87 A;  1AQW A;  3A5W A;  3F4T A;  1JFU A;  5HR1 A;  4Z2T A;  4HSC X;  1R5P A;  2K8S A;  1FOV A;  1YDK A;  1PFO A;  4XS1 A;  2H1L A;  2OE0 A;  2QA2 A;  3HCZ A;  4ZL9 A;  3C71 A;  3P2A A;  3KEB A;  5ELA A;  4IN0 A;  1OC3 A;  4TXO A;  1DBY A;  3ZL5 A;  3P90 A;  1SYR A;  1EZK A;  13GS A;  2AUV A;  1TP9 A;  4MJE A;  4IJI A;  2FY6 A;  4K2D A;  5GZZ B;  2HSM A;  1JZO A;  2JZS A;  3HJO A;  4BVY A;  4X43 A;  4IW9 A;  5H5Q A;  2PGT A;  4N10 A;  4MZC A;  4NV2 A;  5ABR A;  4IVF A;  1MEK A;  3P7X A;  3IR4 A;  1X5D A;  1GTU A;  2FLS A;  19GS A;  2DBC A;  4G0K A;  4IEL A;  2N5F A;  3F4S A;  2N5A A;  1BYE A;  4CW9 A;  1K0M A;  4ECI A;  3HVX A;  2HSM B;  1ZOF A;  5IOW A;  3KM6 A;  3TKP A;  4BL7 A;  5L71 A;  2OJL A;  2FCH A;  1XWC A;  3GH6 A;  2DLX A;  2VD0 A;  4E8H A;  2E7P A;  3TJJ A;  5ECS A;  3CBU A;  3VWX A;  1H4O A;  2R0C A;  2IIY A;  5HR2 A;  3E3E A;  5A5H A;  1YQ1 A;  4L5L A;  4A5P A;  5AIV A;  4K7O A;  2O3E A;  1X5E A;  2HZE A;  2KHP A;  1M0U A;  2YV7 A;  2C0D A;  4JR6 A;  5J4Y A;  3IRA A;  3L4N A;  1O8X A;  5F05 A;  2AJQ B;  3US3 A;  4I97 A;  2UZ8 A;  3N5O A;  4GCI A;  2VL2 C;  3IDV A;  3VLN A;  4HEA 2;  5G5F A;  3HY2 A;  1BG5 A;  4WBJ A;  3UVH A;  4BL7 B;  1BED A;  2ES7 A;  1K3L A;  3GL3 A;  5KN2 A;  1PQN A;  1TXU A;  1TK8 B;  2MMZ A;  3FZ9 A;  2YV9 A;  2F3M A;  4BVX A;  4ID0 A;  5D93 A;  4MH2 A;  3HHV A;  5A5H B;  3N9J A;  5IMA A;  2YJ7 A;  2FD3 A;  1ST9 A;  3H93 A;  2HZE B;  1K3O A;  1EV9 A;  1E6B A;  3IBH A;  2L59 A;  4DVC A;  4KND A;  2WVY A;  4PNF A;  3VFI A;  2J23 A;  1SVM A;  3CWG A;  4MH3 A;  1XZO A;  3GKM A;  1M2A A;  4ICY A;  4OCF A;  4LL1 B;  5ECN B;  2LNT A;  4K0G A;  1RQM A;  2LV3 A;  4N30 A;  2VL3 A;  3G9B A;  3APS A;  2C3N A;  2K6V A;  4LLR A;  2XPD A;  4BWS A;  2O5V A;  4XS6 A;  4FYC A;  4POB A;  4JU5 A;  1TXX A;  2I9H A;  3J7Y k;  2YP6 A;  3TOU A;  2PUK C;  2V2G A;  2H19 A;  1B9Y C;  3GUR A;  14GS A;  1GUH A;  2TIR A;  2L4Q A;  2C3T A;  1QK8 A;  4KE3 A;  3ZVJ D;  4NMU A;  2WVZ A;  1XW5 A;  3ZIV A;  2C0E A;  3L0H A;  1Q4J A;  2R37 A;  1K0A A;  4I5Q A;  4G2E A;  4KDX A;  2QGV A;  2VCZ A;  2WRT A;  4ZB6 A;  5AN1 A;  3H8Q A;  2C80 A;  4OO4 A;  3A2X A;  1GUK A;  3F3Q A;  3GSS A;  1TKD B;  3LFL A;  5H5S A;  1B9X C;  1S3D A;  3EWL A;  5IPG A;  1DE2 A;  4JED A;  8GSS A;  4YQV A;  5G31 A;  5IM9 A;  2I4A A;  3KIJ A;  3VPQ A;  1TRW A;  4TOP A;  5KN0 A;  2IFQ A;  4TRX A;  3O3T A;  4MMM A;  3RPP A;  5ECQ B;  4BWQ A;  3TJK A;  4MK3 A;  2RLI A;  1V57 A;  5IPH A;  3UEM A;  4TN8 A;  3VUR A;  2JU5 A;  2X64 A;  2EFC A;  3I6A A;  4K0N A;  4IGJ A;  4GWR A;  1G6W A;  3VI5 A;  4MNN A;  4ML6 A;  4WET A;  1RK4 A;  3FEU A;  2WS2 A;  3IHQ A;  1BF5 A;  2RUE A;  2B5Y A;  3HVV A;  1NHY A;  4YAV A;  2LJK A;  1VF1 A;  2DML A;  4L0U A;  2BTO T;  3UOM A;  1G7E A;  1AW9 A;  4F9Z A;  5HFG A;  2VUP A;  2V32 A;  1BG1 A;  1SU9 A;  2FHE A;  2KP2 A;  4G01 A;  3ZMK A;  1T8E B;  6GSY A;  2P5Q A;  2WFC A;  4WF4 A;  2VAF A;  2DJ2 A;  2L5L A;  1V58 A;  1SKR B;  2HSN A;  5D9V A;  3WT1 A;  3M1G A;  1B8X A;  1SJZ A;  3OR5 A;  2B7K A;  3C1R A;  1FB0 A;  2L6C A;  4IP6 A;  1V2A A;  4CY6 A;  5CO3 A;  5FWG A;  2GSQ A;  5EL8 A;  2EFD A;  2OKA A;  5GSS A;  4BIK A;  1YZX A;  3HYP A;  1TDI A;  3LYP A;  2TRC P;  2LST A;  3DGQ A;  3GNJ A;  3Q18 A;  1K0B A;  2MBS A;  2WW1 A;  1TI3 A;  2HSN B;  4K2X A;  2MMN A;  3GTU A;  2HXK A;  2KLX A;  3QMX A;  1SYX A;  4KDU A;  5ECR B;  4K5S A;  4Q5F A;  2BMX A;  5D9W A;  4EE0 A;  2YWO A;  4ECB A;  3KCM A;  5J5N A;  4V1A g;  2P5R A;  4MA9 A;  22GS A;  1XCC A;  3FHK A;  3GST A;  1A8L A;  2HLS A;  5ECL B;  1UC7 A;  1G6Y A;  1KNG A;  3AY8 A;  4OFN A;  5HFI A;  2HSY A;  4ZBA A;  4PQI A;  1Z5Y E;  1GH2 A;  4ZBB A;  4PUF C;  4EDY A;  2IJY A;  1XW9 A;  4XS4 A;  6GSV A;  1ZYP A;  2LQO A;  3GTU B;  1JHB A;  1QXH A;  4OFT A;  3KD0 A;  1OAZ A;  2OA7 A;  3HMJ G;  3ED3 A;  3LQ7 A;  4LL4 B;  2C3Q A;  2E2M A;  2MMA A;  4NHZ A;  2HQT A;  2A2P A;  4ILF A;  2OBK A;  4GXZ A;  4HU9 A;  4RI6 A;  2YZH A;  3KP8 A;  2BJX A;  3KP9 A;  4G0L A;  3TU3 B;  1OC8 A;  3LYK A;  2DKI A;  3HZ8 A;  3TKS A;  3EMX A;  1OYJ A;  3W6G A;  2B3S A;  4YKG A;  2O89 A;  4PXO A;  2NPB A;  4MCU A;  3C73 A;  3D6I A;  4TKY A;  3RHB A;  4QMK A;  2WGR A;  4WBR D;  5J9B A;  2MMO A;  4AKG A;  4IQA A;  4HDE A;  4POM A;  1HD2 A;  3RDW A;  4GST A;  3MAK A;  3L78 A;  2VCV A;  1T00 A;  2AHE A;  4AKI A;  4KW6 A;  3VWU A;  4OFM A;  1YKC A;  3WGE A;  2H73 A;  1AAZ A;  4O5R A;  3C1S A;  3KMO A;  5C04 A;  3HKR A;  2IMF A;  2ZNM A;  3VWV A;  2NTO A;  4GLT A;  3VI7 A;  3FMW A;  1ACV A;  5ELG A;  20GS A;  4XCS A;  1XW6 A;  3Q74 A;  2VM2 A;  5B8B A;  2O7K A;  5CRH A;  1IYI A;  4JE1 A;  1MTC A;  3F6F A;  1BX9 A;  4ZB8 A;  1S4B P;  1GNE A;  6GSU A;  3C7M A;  5KOX A;  3A5I A;  2CA8 A;  1WPI A;  2YCD A;  3EU3 A;  3GRX A;  2YZU A;  3WGD A;  5B6M A;  3IK7 A;  2HI7 A;  2DJK A;  2H66 A;  1CQH A;  3QPM A;  3IPZ A;  2FGX A;  1WOU A;  4ML1 A;  4PI2 C;  3J7Y b;  1A0R P;  4V2N A;  18GS A;  3O6T A;  1OE7 A;  4AJ8 A;  2V41 A;  2V6O A;  3MDK A;  3ISO A;  2ZUP A;  5DAK A;  3QFB C;  3ZLP A;  4F2I A;  1Z7P A;  4G0I A;  4MPG A;  1WIK A;  1FOH A;  4XTS A;  4HQS A;  4RQX A;  1K0O A;  5F07 A;  1H75 A;  1EP8 A;  3M0F A;  2AV4 A;  2YOI A;  2GQM A;  5J41 A;  4QL9 A;  4MP4 A;  2XBI A;  1XOB A;  4JRR A;  3EVI A;  1G0T A;  3K8N A;  2F9S A;  2VLU A;  3LOR A;  3BJ5 A;  2R5G A;  1BAY A;  1SVL A;  3KGK A;  1EOG A;  4HJM A;  5JWO B;  1RW1 A;  4Z7X A;  2H30 A;  3KH7 A;  1I5G A;  4MLY A;  2H0G A;  5DAK B;  1GSQ A;  1K0N A;  3HZ4 A;  1F6M C;  1S3R A;  1Z7R A;  7GSS A;  3LEF A;  3IOS A;  4ISD A;  3GV1 A;  4W66 A;  1WJK A;  2OT3 A;  5A5K A;  1SKW B;  3KTB A;  4O5Q A;  4K7I A;  5CAX A;  1R7H A;  1SEN A;  3LWA A;  1ERU A;  2VL2 A;  4CY8 A;  1TW9 A;  3QAV A;  4IQ1 A;  4KCE A;  4MJC A;  2FA4 A;  1A2L A;  2IL3 A;  4IJ3 A;  1B4P A;  5IMZ A;  3EU4 A;  2IME A;  3VWW A;  4OCE A;  4YQM A;  4CDO A;  3G7J A;  4MDC A;  1ZYE A;  3IK9 A;  2F51 A;  4POL A;  1A24 A;  4AJ6 A;  4AKH A;  2ON7 A;  4RUV A;  4XRA A;  4X0X A;  4G19 A;  5A1N A;  1Z6M A;  2O87 A;  1HNC A;  4F0C A;  3M3M A;  4KX4 A;  1S3C A;  3BBY A;  3HDC A;  4DSS A;  4ZL8 A;  1KBN A;  3RAZ A;  2I81 A;  5F06 A;  1JLW A;  2B1L A;  2HRA A;  3F8U A;  4KA0 A;  3FY7 A;  5DQS A;  3QOU A;  4FYB A;  2AB6 A;  3F4R A;  3BCI A;  5C00 A;  1HNB A;  2JSY A;  5DVB A;  3GFK A;  4TR1 B;  2V6K A;  3HJM A;  2C0F A;  2WJU A;  3CTF A;  2A2S A;  1SL0 B;  5D9T A;  1B4Q A;  3WYW A;  4RQR A;  1KTE A;  3DIE A;  1SJI A;  3FW2 A;  5IMV A;  1MD3 A;  5A1N B;  3NIV A;  1S3A A;  4XHM A;  2NDO A;  3I43 A;  2GSS A;  2A2R A;  5IOX A;  4DSS B;  3QD9 A;  1XFL A;  3HD5 A;  10GS A;  4AJ7 A;  2EIR A;  2VIM A;  2H71 A;  1HQO A;  4POK A;  2CT6 A;  2XHF A;  3ZYW A;  1NSW A;  1U3I A;  2D2Z A;  2GQL A;  1J0F A;  4PUR A;  3GX8 A;  1SD8 A;  2JZR A;  4KF9 A;  4E68 A;  3MYD A;  2JAC A;  1M2D A;  1F37 A;  2EC4 A;  2H1D A;  2YWI A;  4I2T A;  4TR4 A;  1EGO A;  4TW5 A;  5LD0 A;  5DQY A;  5IIZ A;  1WMJ A;  3D21 A;  4K9Z A;  2H74 A;  1XVW A;  2IWT A;  1DE1 A;  4L8E A;  5F0G A;  2H6Z A;  1OKT A;  2DSA A;  4FH8 A;  4E8E A;  4I6X A;  1YF0 A;  2L5O A;  2PMT A;  1DSB A;  4K6X A;  2PN8 A;  4IP1 A;  4TVE A;  2C8U A;  4FXY P;  1ZCP A;  5JWQ B;  2M80 A;  2H76 A;  2RUF A;  2G0F A;  4YAP A;  5D8I A;  6GSX A;  1V98 A;  4O7H A;  3DYR A;  2IN3 A;  5HR0 A;  1XWA A;  2H1B A;  4AKX B;  2GZZ A;  2VM1 A;  1AIU A;  5FHI A;  1ZYN A;  4HU7 A;  5DCG A;  5CRD A;  1ERV A;  1X9M B;  3H79 A;  2X4A A;  3APO A;  1UN2 A;  2PPT A;  4HQZ A;  1SL1 B;  2CVB A;  1YKA A;  3ZRE A;  4GRF A;  1YF1 A;  2VD1 A;  3CSI A;  2YJH A;  1Y6E A;  2WVX A;  1O6J A;  2H0H A;  4KAE A;  1PSQ A;  3DVW A;  2HYX A;  2OE1 A;  1M7T A;  1K0D A;  5ECI B;  3G7I A;  2Z9S A;  4F0B A;  1PRX A;  3GN3 A;  2H75 A;  3GYK A;  2LRC A;  5LCZ A;  3M9J A;  2HRN A;  3A2W A;  4PQH A;  4EO3 A;  5GST A;  4L0W A;  1OKD A;  1XWB A;  1ZGN A;  1GSU A;  5IMF A;  1DUG A;  3RGB C;  4K7N A;  4YQU A;  4BA7 A;  4HS1 A;  1I9D A;  3LSZ A;  1GTB A;  2R2J A;  4N3Z A;  3TJF A;  5DJL A;  3UJ1 A;  2WVX B;  3TRX A;  4NXI A;  2REM A;  1XXU A;  3IA1 A;  3RHC A;  3DWV A;  3MIX A;  3QAW A;  3RBT A;  4PQ1 A;  2LRN A;  1ABA A;  2JAD A;  4AF2 A;  5A4V A;  4OWY A;  3KMN A;  4OD7 A;  4JZQ A;  5GAN D;  1U6T A;  1K0C A;  3GX0 A;  4I8B A;  3I9V 2;  3CHX C;  1MDJ A;  4HZ4 A;  2LNS A;  2K8V A;  5ENU A;  1T4Y A;  2H1G A;  1T4Z A;  2YAN A;  1PA3 A;  4PTS A;  5CP1 A;  3D4M A;  1OVN A;  3ERW A;  2ON5 A;  1M99 A;  3FZ5 A;  3H1N A;  4Q5N A;  1QGV A;  2CZ2 A;  1N25 A;  1WP0 A;  17GS A;  3D22 A;  1X5C A;  3JCM L;  2H01 A;  5J47 A;  1XWG A;  1V40 A;  3PR8 A;  2X99 A;  4EDZ A;  2K18 A;  4NAX A;  4ECC A;  1J9B A;  1TOF A;  6GSS A;  3CYN A;  3L9V A;  1ON4 A;  5G5E A;  2C4J A;  2CV4 A;  1EWX A;  5CNW A;  1A2M A;  3VPT A;  5EPF A;  3F63 A;  4NV5 A;  1PKZ A;  3CSJ A;  4EUY A;  1G7O A;  2QA1 A;  3G7Y A;  4MJB A;  2H0I A;  3R2Q A;  9GSS A;  1F9M A;  3BD2 A;  2L6D A;  1SK0 A;  4K1F A;  3Q19 A;  2O36 A;  4I2U A;  1GTA A;  4N11 A;  1PD2 1;  4EF0 A;  4BPY A;  3GIX A;  3E9J B;  5IQY A;  4LMW A;  5E4W A;  5AIX A;  4WKW A;  5ECO B;  4DEJ A;  3FKF A;  2L4C A;  5BMU B;  3HVN A;  3M8N A;  2L57 A;  2R3X A;  1XIY A;  2H72 A;  3MSZ A;  1URM A;  5DAL A;  1I1I P;  2H6X A;  1M3J A;  2IMD A;  1SVO A;  2VKZ G;  1SD9 A;  3UAP A;  3SBC A;  3CQF A;  3GKX A;  3TKQ A;  2GLR A;  2CAI A;  3DD3 A;  1M2B A;  2DMM A;  2GTU A;  4JBB A;  3FRC A;  4USS A;  2H6Y A;  2HFD A;  1FVK A;  5D73 A;  3HA9 A;  3CSH A;  3QAG A;  1PL2 A;  3TOT A;  1QMV A;  2AYT A;  5KEJ A;  2HSH A;  3TJG A;  1MD4 A;  4FIW A;  2WW3 A;  3FZA A;  3D0Z A;  2QC7 A;  3TKS E;  3PPU A;  4F82 A;  4HUA A;  2VCW A;  1AXD A;  1FO5 A;  4ZB7 A;  3IV4 A;  4JR4 A;  5DAL B;  4OMV A;  1ILO A;  1VF2 A;  1PL1 A;  5LNK e;  5H5R A;  2K9F A;  3DML A;  2R6K A;  3UBL A;  2LTK A;  4K5R A;  2DC5 A;  1TTZ A;  2B7J A;  2EFE A;  5G1K A;  4N0V A;  3RFR C;  3DEX A;  3EC3 A;  5BRT A;  4KDY A;  4IKH A;  1O81 A;  2DJJ A;  4HZ2 A;  4EKZ A;  2HE3 A;  2PBJ A;  4O92 A;  1N2A A;  2QSI A;  3GL5 A;  4ZB9 A;  2X49 A;  3NOF A;  4ZXG A;  5DDL A;  3U6V A;  3QR6 A;  1YEW C;  1JZD A;  4WEY A;  4FO5 A;  1EEM A;  4PX1 A;  1X9W B;  2HNL A;  3SWL A;  5IMC A;  4KSM A;  2FUG 2;  5A34 B;  2PWJ A;  2VO4 A;  3D5J A;  4X4J A;  1ZYQ B;  2R0P A;  4IBP A;  3F0I A;  2YWN A;  4KCA A;  1YEP A;  2LKU A;  1R26 A;  1WE0 A;  1MDI A;  2VCQ A;  3TRQ A;  3L9S A;  4PNG A;  3LW9 A;  3A2V A;  4L5O A;  1M9B A;  3ERG A;  1MDK A;  4Z2U A;  2FWF A;  1SJ6 A;  2J9H A;  1YY7 A;  3PGT A;  2VLT A;  4EL1 A;  4NPB A;  2H70 A;  2OE3 A;  4HI7 A;  4XRD A;  1PN0 A;  2R0G A;  1GTI A;  2R4V A;  3IC4 A;  4V2L A;  3CXG A;  2GGT A;  4MF7 A;  2OAC A;  5KN3 A;  2F8F A;  1KEB A;  4ACS A;  4CHS A;  3LXT A;  2OAD A;  5AIS A;  3O76 A;  3TRP A;  1OE8 A;  3FZ4 A;  1EGR A;  2VCX A;  1C72 A;  3WGX A;  1U88 A;  4ZBD A;  1GNW A;  3VK9 A;  5KN1 A;  4ECJ A;  1XOA A;  1T1V A;  4MZW A;  3KXO A;  2JL4 A;  5D96 A;  3KTL A;  1LU4 A;  1FW1 A;  4V2M A;  4TXO B;  2WZ9 A;  1V9W A;  2ZCT A;  2M72 A;  1GWC A;  5EY6 A;  2A4V A;  5DJM A;  1GLP A;  2GVP A;  2P0G A;  5ECH B;  5ID2 A;  3EE2 A;  4O32 A;  4Q5R A;  4WR5 A;  4BVY B;  2RM6 A;  4K8M A;  3S9F A;  3FK8 A;  1GRX A;  1EP7 A;  3E0U A;  3ZML A;  4TR1 A;  4D73 A;  2CX4 A;  5COH A;  3TDG A;  4GQF A;  5CYY A;  1GL8 A;  5EVO A;  1SK1 A;  4KGI A;  2HT9 A;  1PX7 A;  3Q6O A;  4MPF A;  1A23 A;  3EPT A;  1GP1 A;  4Z2R A;  1CQG A;  3UBK A;  5ECM B;  2GZP A;  1A0F A;  2WB9 A;  2DKH A;  2JZT A;  3UAR A;  2DJ3 A;  5ID2 B;  2X8H A;  2EIO A;  4DSQ A;  2GDR A;  1T3B A;  3QFA C;  1GSE A;  4J56 E;  3W8S A;  1VGL A;  2GT5 A;  3GA4 A;  2PU9 C;  1IYH A;  2FNO A;  1AC1 A;  3KJY A;  4D73 B;  4HJ2 A;  2DJ1 A;  2XPE A;  1WRY A;  4ZL7 A;  3LJR A;  2P31 A;  3WT2 A;  2GST A;  16GS A;  3TUE A;  1AQX A;  2IMI A;  3ZRD A;  2KUC A;  5G2Z A;  2YNX A;  3R3E A;  2RM5 A;  1VRS D;  1TK5 B;  1EEJ A;  2LQQ A;  1YEX A;  1YJ6 A;  2MZC A;  3IHG A;  1TK0 B;  4QQ7 A;  1A8Y A;  1GUM A;  2V1M A;  4QL7 A;  4N0Z A;  2XBQ A;  2GSR A;  2VCT A;  1O8W A;  2KP1 A;  4BVX B;  5B6N A;  3M9K A;  1PN9 A;  1THX A;  2DIZ A;  1O85 A;  1FAA A;  4F03 A;  3GH9 A;  5JCG A;  2X8G A;  4XIH A;  5KOW A;  2WZS A;  3CMI A;  2PVQ A;  3FR3 A;  4AGS A;  2YN1 A;  2HZF A;  4GDF A;  2WCI A;  4WF5 A;  3CRU A;  1QFN A;  4GTU A;  4DSR A;  2JSZ A;  2MBT A;  4WR4 A;  3QCP A;  3MNG A;  3BCK A;  3ZIJ A;  1PMT A;  1LJR A; 
#chains in the Genus database with same CATH homology
 4FYU A;  4GSN A;  1ZZY A;  4TR3 A;  3RPN A;  5DBQ A;  1U3A A;  3EUR A;  2LEG A;  4LMV A;  3KH9 A;  5J9C A;  3KZQ A;  1BQ7 A;  2B5E A;  4TXV A;  5A4W A;  2MYG A;  1JZW A;  3ZZX A;  2VL9 A;  2NVL A;  1WWJ A;  1GLQ A;  2H1A A;  1N8J A;  5JCW A;  4EXJ A;  3TGZ A;  1ZL9 A;  4KB3 A;  3A3T A;  4NHW A;  5JCU A;  4EC0 A;  1UVZ A;  2FWG A;  4GQC A;  5IMD A;  3IC8 A;  3F9U A;  2FA8 A;  2PVO C;  1HNA A;  3GKK A;  2F8A A;  2LJR A;  1ERT A;  1AUC A;  4PGT A;  2E0Q A;  2I3Y A;  2RII A;  2EFH A;  4HOJ A;  4YH2 A;  4MF5 A;  1BJX A;  3TB2 A;  3I69 A;  3C8E A;  2FWH A;  3CTG A;  4G10 A;  3ZFB A;  1ML6 A;  1TI1 A;  5J4V A;  3CRT A;  1SL2 B;  3MWH A;  4MAB A;  4GSS A;  2CZ3 A;  1GSD A;  2FWE A;  5J4U A;  5FT3 A;  2IMK A;  3GUS A;  3PIN A;  3WD6 A;  4ULX A;  2C0G A;  2IFQ B;  2B5X A;  12GS A;  4J57 E;  2O8V B;  2TRX A;  3GHA A;  3DVX A;  1LBK A;  1JZR A;  2WUL A;  4ZIJ A;  1Z3E A;  3TJB A;  4MJA A;  3LGC A;  2VLV A;  4FQU A;  1E2Y A;  5CRG A;  5E59 A;  2GQK A;  2XC2 A;  4WXT A;  5IO2 A;  6GSW A;  4LA1 A;  1PKW A;  4J2F A;  4IS0 A;  3LG6 A;  1THO A;  1Y1U A;  1GSY A;  1FVJ A;  1QUW A;  1M9A A;  1EOH A;  2DIY A;  2GT6 A;  3ZIT A;  1HYU A;  2LUS A;  1TJD A;  4TR0 A;  3IAM 2;  4O5U A;  4EIP A;  3TCO A;  2EIQ A;  3P8W A;  5AGY A;  1ERW A;  2HRF A;  3IE3 A;  4OO5 A;  3HVS A;  1Z9H A;  2IPA A;  3D4T A;  2VOC A;  1YVL A;  4GF0 A;  4KSO A;  2WDU A;  4KUN A;  3GMF A;  5GAP D;  5JWR B;  2QKE A;  2LS5 A;  2I1U A;  4MZB A;  1USB A;  4X1U A;  3ME7 A;  1PX6 A;  5HR3 A;  1A2J A;  1XWK A;  2ALB A;  2H8L A;  3DXB A;  1T7P B;  4Q5Q A;  1XPV A;  2X8C A;  1TRV A;  1JLV A;  1VF4 A;  3FR6 A;  3APQ A;  3FR9 A;  2YWM A;  3V1W A;  5BMU A;  1Y25 A;  2LRT A;  2YPM A;  1QQ2 A;  1X9S B;  2CVD A;  2CQ9 A;  4P3Y B;  1XVQ A;  1F3B A;  1ZMA A;  4G9H A;  1K3Y A;  2UV8 G;  2CVK A;  1SK2 A;  2C1Y A;  3GKN A;  3NZN A;  2DJ0 A;  1PGT A;  4V1A p;  4RI7 A;  3LXZ A;  4PUA A;  3EIN A;  5J40 A;  2OBI A;  6GST A;  5IO0 A;  4H86 A;  1F2E A;  1R5A A;  4IHU A;  1XBS A;  2M46 A;  5CRE A;  3U5R E;  1J08 A;  2E2G A;  1W89 A;  5ECK B;  5ECP B;  4KH7 A;  2CX3 A;  1GSF A;  3DKS A;  3UIW A;  4EIQ A;  3QDN A;  2O85 A;  1W4V A;  2B1K A;  1UA5 A;  3TKR A;  4EVM A;  2GZY A;  3F3R A;  2GS3 A;  3ZTL A;  1TU8 A;  5CRW A;  3UL3 A;  1GSS A;  3ZVJ A;  1X0R A;  2B6M A;  3HXS A;  4XS4 B;  5J3R A;  1O7U A;  5DCH A;  1FHE A;  1SKS B;  2HRK A;  1TU7 A;  3L9U A;  3TKS C;  3W8J A;  1R4W A;  4YKF A;  1Z6N A;  3ERF A;  5INY A;  1OC9 A;  2LJA A;  5A34 A;  1FB6 A;  4ZIL A;  2CAQ A;  2G2Q A;  5G1L A;  3ZFL A;  3UVT A;  2PER A;  5G30 A;  1AQV A;  1EV4 A;  2AAW A;  1NM3 A;  3H4K A;  4NWY A;  1B48 A;  5D9X A;  3DRN A;  5B8A A;  3IXR A;  1NHO A;  2KOK A;  5B7C A;  3HJP A;  3BOA A;  2N5B A;  5HQP A;  4AI6 A;  3F6D A;  4MF6 A;  3ME8 A;  3EMP A;  5F8B A;  3EYT A;  2HRK B;  2A4H A;  3PH9 A;  3UMA A;  5A4U A;  11GS A;  1F3A A;  5HFK A;  1O73 A;  3IAS 2;  1TRS A;  3FYG A;  1NW2 A;  1OC9 B;  1TRU A;  1Q98 A;  1GUL A;  1VF3 A;  2NBS A;  1FG4 A;  1U87 A;  1AQW A;  3A5W A;  3F4T A;  1JFU A;  5HR1 A;  4Z2T A;  1R5P A;  2K8S A;  1FOV A;  1YDK A;  4XS1 A;  2H1L A;  2OE0 A;  2QA2 A;  3HCZ A;  4ZL9 A;  3C71 A;  3P2A A;  3KEB A;  5ELA A;  4IN0 A;  1OC3 A;  4TXO A;  1DBY A;  3ZL5 A;  3P90 A;  1SYR A;  1EZK A;  13GS A;  2AUV A;  1TP9 A;  4MJE A;  4IJI A;  2FY6 A;  4K2D A;  5GZZ B;  2HSM A;  1JZO A;  2JZS A;  3HJO A;  4BVY A;  4X43 A;  4IW9 A;  5H5Q A;  2PGT A;  4N10 A;  4MZC A;  4NV2 A;  5ABR A;  4IVF A;  1MEK A;  3P7X A;  3IR4 A;  1X5D A;  1GTU A;  2FLS A;  19GS A;  2DBC A;  4G0K A;  4IEL A;  2N5F A;  3F4S A;  2N5A A;  1BYE A;  4CW9 A;  1K0M A;  4ECI A;  3HVX A;  2HSM B;  1ZOF A;  5IOW A;  3KM6 A;  3TKP A;  4BL7 A;  5L71 A;  2OJL A;  2FCH A;  1XWC A;  3GH6 A;  2DLX A;  2VD0 A;  4E8H A;  2E7P A;  3TJJ A;  5ECS A;  3CBU A;  3VWX A;  1H4O A;  2R0C A;  2IIY A;  5HR2 A;  3E3E A;  5A5H A;  1YQ1 A;  4L5L A;  4A5P A;  5AIV A;  4K7O A;  1X5E A;  2HZE A;  2KHP A;  1M0U A;  2YV7 A;  2C0D A;  4JR6 A;  5J4Y A;  3IRA A;  3L4N A;  1O8X A;  5F05 A;  2AJQ B;  3US3 A;  4I97 A;  2UZ8 A;  3N5O A;  4GCI A;  2VL2 C;  3IDV A;  3VLN A;  4HEA 2;  5G5F A;  3HY2 A;  1BG5 A;  4WBJ A;  3UVH A;  4BL7 B;  1BED A;  2ES7 A;  1K3L A;  3GL3 A;  5KN2 A;  1PQN A;  1TXU A;  1TK8 B;  2MMZ A;  3FZ9 A;  2YV9 A;  2F3M A;  4BVX A;  4ID0 A;  5D93 A;  4MH2 A;  3HHV A;  5A5H B;  3N9J A;  5IMA A;  2YJ7 A;  2FD3 A;  1ST9 A;  3H93 A;  2HZE B;  1K3O A;  1EV9 A;  1E6B A;  3IBH A;  2L59 A;  4DVC A;  4KND A;  4PNF A;  3VFI A;  2J23 A;  1SVM A;  3CWG A;  4MH3 A;  1XZO A;  3GKM A;  1M2A A;  4ICY A;  4OCF A;  4LL1 B;  5ECN B;  2LNT A;  4K0G A;  1RQM A;  2LV3 A;  4N30 A;  2VL3 A;  3G9B A;  3APS A;  2C3N A;  2K6V A;  4LLR A;  2XPD A;  4BWS A;  2O5V A;  4XS6 A;  4FYC A;  4POB A;  4JU5 A;  1TXX A;  2I9H A;  3J7Y k;  2YP6 A;  3TOU A;  2PUK C;  2V2G A;  2H19 A;  1B9Y C;  3GUR A;  14GS A;  1GUH A;  2TIR A;  2L4Q A;  2C3T A;  1QK8 A;  4KE3 A;  3ZVJ D;  4NMU A;  1XW5 A;  3ZIV A;  2C0E A;  3L0H A;  1Q4J A;  2R37 A;  1K0A A;  4I5Q A;  4G2E A;  4KDX A;  2QGV A;  2VCZ A;  2WRT A;  4ZB6 A;  5AN1 A;  3H8Q A;  2C80 A;  4OO4 A;  3A2X A;  1GUK A;  3F3Q A;  3GSS A;  1TKD B;  3LFL A;  5H5S A;  1B9X C;  1S3D A;  3EWL A;  5IPG A;  1DE2 A;  4JED A;  8GSS A;  4YQV A;  5G31 A;  5IM9 A;  2I4A A;  3KIJ A;  3VPQ A;  1TRW A;  4TOP A;  5KN0 A;  2IFQ A;  4TRX A;  3O3T A;  4MMM A;  3RPP A;  5ECQ B;  4BWQ A;  3TJK A;  4MK3 A;  2RLI A;  1V57 A;  5IPH A;  3UEM A;  4TN8 A;  3VUR A;  2JU5 A;  2X64 A;  2EFC A;  3I6A A;  4K0N A;  4IGJ A;  4GWR A;  1G6W A;  3VI5 A;  4MNN A;  4ML6 A;  4WET A;  1RK4 A;  3FEU A;  2WS2 A;  3IHQ A;  1BF5 A;  2RUE A;  2B5Y A;  3HVV A;  1NHY A;  4YAV A;  2LJK A;  1VF1 A;  2DML A;  4L0U A;  2BTO T;  3UOM A;  1G7E A;  1AW9 A;  4F9Z A;  5HFG A;  2VUP A;  2V32 A;  1BG1 A;  1SU9 A;  2FHE A;  2KP2 A;  4G01 A;  3ZMK A;  1T8E B;  6GSY A;  2P5Q A;  2WFC A;  4WF4 A;  2VAF A;  2DJ2 A;  2L5L A;  1V58 A;  1SKR B;  2HSN A;  5D9V A;  3WT1 A;  3M1G A;  1B8X A;  1SJZ A;  3OR5 A;  2B7K A;  3C1R A;  1FB0 A;  2L6C A;  4IP6 A;  1V2A A;  4CY6 A;  5CO3 A;  5FWG A;  2GSQ A;  5EL8 A;  2EFD A;  2OKA A;  5GSS A;  1YZX A;  3HYP A;  1TDI A;  3LYP A;  2TRC P;  2LST A;  3DGQ A;  3GNJ A;  3Q18 A;  1K0B A;  2MBS A;  1TI3 A;  2HSN B;  4K2X A;  2MMN A;  3GTU A;  2HXK A;  2KLX A;  3QMX A;  1SYX A;  4KDU A;  5ECR B;  4K5S A;  4Q5F A;  2BMX A;  5D9W A;  4EE0 A;  2YWO A;  4ECB A;  3KCM A;  5J5N A;  4V1A g;  2P5R A;  4MA9 A;  22GS A;  1XCC A;  3FHK A;  3GST A;  1A8L A;  2HLS A;  5ECL B;  1UC7 A;  1G6Y A;  1KNG A;  3AY8 A;  4OFN A;  5HFI A;  2HSY A;  4ZBA A;  4PQI A;  1Z5Y E;  1GH2 A;  4ZBB A;  4PUF C;  4EDY A;  2IJY A;  1XW9 A;  4XS4 A;  6GSV A;  1ZYP A;  2LQO A;  3GTU B;  1JHB A;  1QXH A;  4OFT A;  3KD0 A;  1OAZ A;  2OA7 A;  3HMJ G;  3ED3 A;  3LQ7 A;  4LL4 B;  2C3Q A;  2E2M A;  2MMA A;  4NHZ A;  2HQT A;  2A2P A;  4ILF A;  2OBK A;  4GXZ A;  4HU9 A;  4RI6 A;  2YZH A;  3KP8 A;  2BJX A;  3KP9 A;  4G0L A;  3TU3 B;  1OC8 A;  3LYK A;  2DKI A;  3HZ8 A;  3TKS A;  3EMX A;  1OYJ A;  3W6G A;  2B3S A;  4YKG A;  2O89 A;  4PXO A;  2NPB A;  4MCU A;  3C73 A;  3D6I A;  4TKY A;  3RHB A;  4QMK A;  2WGR A;  4WBR D;  5J9B A;  2MMO A;  4AKG A;  4IQA A;  4HDE A;  4POM A;  1HD2 A;  3RDW A;  4GST A;  3MAK A;  3L78 A;  2VCV A;  1T00 A;  2AHE A;  4AKI A;  4KW6 A;  3VWU A;  4OFM A;  1YKC A;  3WGE A;  2H73 A;  1AAZ A;  4O5R A;  3C1S A;  3KMO A;  5C04 A;  3HKR A;  2IMF A;  2ZNM A;  3VWV A;  2NTO A;  4GLT A;  3VI7 A;  3FMW A;  1ACV A;  5ELG A;  20GS A;  4XCS A;  1XW6 A;  3Q74 A;  2VM2 A;  5B8B A;  2O7K A;  5CRH A;  1IYI A;  4JE1 A;  1MTC A;  3F6F A;  1BX9 A;  4ZB8 A;  1GNE A;  6GSU A;  3C7M A;  5KOX A;  3A5I A;  2CA8 A;  1WPI A;  2YCD A;  3EU3 A;  3GRX A;  2YZU A;  3WGD A;  5B6M A;  3IK7 A;  2HI7 A;  2DJK A;  2H66 A;  1CQH A;  3QPM A;  3IPZ A;  2FGX A;  1WOU A;  4ML1 A;  3J7Y b;  1A0R P;  4V2N A;  18GS A;  3O6T A;  1OE7 A;  4AJ8 A;  2V41 A;  2V6O A;  3MDK A;  3ISO A;  2ZUP A;  5DAK A;  3QFB C;  3ZLP A;  4F2I A;  1Z7P A;  4G0I A;  4MPG A;  1WIK A;  1FOH A;  4XTS A;  4HQS A;  4RQX A;  1K0O A;  5F07 A;  1H75 A;  1EP8 A;  3M0F A;  2AV4 A;  2YOI A;  2GQM A;  5J41 A;  4QL9 A;  4MP4 A;  2XBI A;  1XOB A;  4JRR A;  3EVI A;  1G0T A;  3K8N A;  2F9S A;  2VLU A;  3LOR A;  3BJ5 A;  2R5G A;  1BAY A;  1SVL A;  3KGK A;  1EOG A;  4HJM A;  5JWO B;  1RW1 A;  4Z7X A;  2H30 A;  3KH7 A;  1I5G A;  4MLY A;  2H0G A;  5DAK B;  1GSQ A;  1K0N A;  3HZ4 A;  1F6M C;  1Z7R A;  7GSS A;  3LEF A;  3IOS A;  4ISD A;  3GV1 A;  4W66 A;  1WJK A;  2OT3 A;  5A5K A;  1SKW B;  3KTB A;  4O5Q A;  4K7I A;  5CAX A;  1R7H A;  1SEN A;  3LWA A;  1ERU A;  2VL2 A;  4CY8 A;  1TW9 A;  3QAV A;  4IQ1 A;  4KCE A;  4MJC A;  2FA4 A;  1A2L A;  2IL3 A;  4IJ3 A;  1B4P A;  5IMZ A;  3EU4 A;  2IME A;  3VWW A;  4OCE A;  4YQM A;  4CDO A;  3G7J A;  4MDC A;  1ZYE A;  3IK9 A;  2F51 A;  4POL A;  1A24 A;  4AJ6 A;  4AKH A;  2ON7 A;  4RUV A;  4XRA A;  4X0X A;  4G19 A;  5A1N A;  1Z6M A;  2O87 A;  1HNC A;  4F0C A;  3M3M A;  4KX4 A;  1S3C A;  3BBY A;  3HDC A;  4DSS A;  4ZL8 A;  1KBN A;  3RAZ A;  2I81 A;  5F06 A;  1JLW A;  2B1L A;  2HRA A;  3F8U A;  4KA0 A;  3FY7 A;  5DQS A;  3QOU A;  4FYB A;  2AB6 A;  3F4R A;  3BCI A;  5C00 A;  1HNB A;  2JSY A;  5DVB A;  3GFK A;  4TR1 B;  2V6K A;  3HJM A;  2C0F A;  2WJU A;  3CTF A;  2A2S A;  1SL0 B;  5D9T A;  1B4Q A;  3WYW A;  4RQR A;  1KTE A;  3DIE A;  1SJI A;  3FW2 A;  5IMV A;  1MD3 A;  5A1N B;  3NIV A;  1S3A A;  4XHM A;  2NDO A;  3I43 A;  2GSS A;  2A2R A;  5IOX A;  4DSS B;  3QD9 A;  1XFL A;  3HD5 A;  10GS A;  4AJ7 A;  2EIR A;  2VIM A;  2H71 A;  1HQO A;  4POK A;  2CT6 A;  2XHF A;  3ZYW A;  1NSW A;  1U3I A;  2D2Z A;  2GQL A;  1J0F A;  4PUR A;  3GX8 A;  1SD8 A;  2JZR A;  4KF9 A;  4E68 A;  3MYD A;  2JAC A;  1M2D A;  1F37 A;  2EC4 A;  2H1D A;  2YWI A;  4I2T A;  4TR4 A;  1EGO A;  4TW5 A;  5LD0 A;  5DQY A;  5IIZ A;  1WMJ A;  3D21 A;  4K9Z A;  2H74 A;  1XVW A;  2IWT A;  1DE1 A;  4L8E A;  5F0G A;  2H6Z A;  1OKT A;  2DSA A;  4FH8 A;  4E8E A;  4I6X A;  1YF0 A;  2L5O A;  2PMT A;  1DSB A;  4K6X A;  2PN8 A;  4IP1 A;  4TVE A;  2C8U A;  1ZCP A;  5JWQ B;  2M80 A;  2H76 A;  2RUF A;  2G0F A;  4YAP A;  5D8I A;  6GSX A;  1V98 A;  4O7H A;  3DYR A;  2IN3 A;  5HR0 A;  1XWA A;  2H1B A;  4AKX B;  2GZZ A;  2VM1 A;  1AIU A;  5FHI A;  1ZYN A;  4HU7 A;  5DCG A;  5CRD A;  1ERV A;  1X9M B;  3H79 A;  2X4A A;  3APO A;  1UN2 A;  2PPT A;  4HQZ A;  1SL1 B;  2CVB A;  1YKA A;  3ZRE A;  4GRF A;  1YF1 A;  2VD1 A;  3CSI A;  2YJH A;  1Y6E A;  1O6J A;  2H0H A;  4KAE A;  1PSQ A;  3DVW A;  2HYX A;  2OE1 A;  1M7T A;  1K0D A;  5ECI B;  3G7I A;  2Z9S A;  4F0B A;  1PRX A;  3GN3 A;  2H75 A;  3GYK A;  2LRC A;  5LCZ A;  3M9J A;  2HRN A;  3A2W A;  4PQH A;  4EO3 A;  5GST A;  4L0W A;  1OKD A;  1XWB A;  1ZGN A;  1GSU A;  5IMF A;  1DUG A;  4K7N A;  4YQU A;  4BA7 A;  4HS1 A;  1I9D A;  3LSZ A;  1GTB A;  2R2J A;  4N3Z A;  3TJF A;  5DJL A;  3UJ1 A;  3TRX A;  4NXI A;  2REM A;  1XXU A;  3IA1 A;  3RHC A;  3DWV A;  3MIX A;  3QAW A;  3RBT A;  4PQ1 A;  2LRN A;  1ABA A;  2JAD A;  4AF2 A;  5A4V A;  4OWY A;  3KMN A;  4OD7 A;  4JZQ A;  5GAN D;  1U6T A;  1K0C A;  3GX0 A;  4I8B A;  3I9V 2;  1MDJ A;  4HZ4 A;  2LNS A;  2K8V A;  5ENU A;  1T4Y A;  2H1G A;  1T4Z A;  2YAN A;  1PA3 A;  4PTS A;  5CP1 A;  3D4M A;  1OVN A;  3ERW A;  2ON5 A;  1M99 A;  3FZ5 A;  3H1N A;  4Q5N A;  1QGV A;  2CZ2 A;  1N25 A;  1WP0 A;  17GS A;  3D22 A;  1X5C A;  3JCM L;  2H01 A;  5J47 A;  1XWG A;  1V40 A;  3PR8 A;  2X99 A;  4EDZ A;  2K18 A;  4NAX A;  4ECC A;  1J9B A;  1TOF A;  6GSS A;  3CYN A;  3L9V A;  1ON4 A;  5G5E A;  2C4J A;  2CV4 A;  1EWX A;  5CNW A;  1A2M A;  3VPT A;  5EPF A;  3F63 A;  4NV5 A;  1PKZ A;  3CSJ A;  4EUY A;  1G7O A;  2QA1 A;  3G7Y A;  4MJB A;  2H0I A;  3R2Q A;  9GSS A;  1F9M A;  3BD2 A;  2L6D A;  1SK0 A;  4K1F A;  3Q19 A;  4I2U A;  1GTA A;  4N11 A;  1PD2 1;  4EF0 A;  4BPY A;  3GIX A;  3E9J B;  5IQY A;  4LMW A;  5E4W A;  5AIX A;  4WKW A;  5ECO B;  4DEJ A;  3FKF A;  2L4C A;  5BMU B;  3M8N A;  2L57 A;  2R3X A;  1XIY A;  2H72 A;  3MSZ A;  1URM A;  5DAL A;  2H6X A;  2IMD A;  1SVO A;  2VKZ G;  1SD9 A;  3UAP A;  3SBC A;  3GKX A;  3TKQ A;  2GLR A;  2CAI A;  3DD3 A;  1M2B A;  2DMM A;  2GTU A;  4JBB A;  3FRC A;  4USS A;  2H6Y A;  2HFD A;  1FVK A;  5D73 A;  3HA9 A;  3CSH A;  3QAG A;  1PL2 A;  3TOT A;  1QMV A;  2AYT A;  5KEJ A;  2HSH A;  3TJG A;  1MD4 A;  4FIW A;  3FZA A;  3D0Z A;  2QC7 A;  3TKS E;  3PPU A;  4F82 A;  4HUA A;  2VCW A;  1AXD A;  1FO5 A;  4ZB7 A;  3IV4 A;  4JR4 A;  5DAL B;  4OMV A;  1ILO A;  1VF2 A;  1PL1 A;  5LNK e;  5H5R A;  2K9F A;  3DML A;  2R6K A;  3UBL A;  2LTK A;  4K5R A;  2DC5 A;  1TTZ A;  2B7J A;  2EFE A;  5G1K A;  4N0V A;  3DEX A;  3EC3 A;  5BRT A;  4KDY A;  4IKH A;  1O81 A;  2DJJ A;  4HZ2 A;  4EKZ A;  2HE3 A;  2PBJ A;  4O92 A;  1N2A A;  2QSI A;  3GL5 A;  4ZB9 A;  2X49 A;  3NOF A;  4ZXG A;  5DDL A;  3U6V A;  3QR6 A;  1JZD A;  4WEY A;  4FO5 A;  1EEM A;  4PX1 A;  1X9W B;  2HNL A;  3SWL A;  5IMC A;  4KSM A;  2FUG 2;  5A34 B;  2PWJ A;  2VO4 A;  3D5J A;  4X4J A;  1ZYQ B;  2R0P A;  4IBP A;  3F0I A;  2YWN A;  4KCA A;  1YEP A;  2LKU A;  1R26 A;  1WE0 A;  1MDI A;  2VCQ A;  3TRQ A;  3L9S A;  4PNG A;  3LW9 A;  3A2V A;  4L5O A;  1M9B A;  3ERG A;  1MDK A;  4Z2U A;  2FWF A;  1SJ6 A;  2J9H A;  1YY7 A;  3PGT A;  2VLT A;  4EL1 A;  4NPB A;  2H70 A;  2OE3 A;  4HI7 A;  4XRD A;  1PN0 A;  2R0G A;  1GTI A;  2R4V A;  3IC4 A;  4V2L A;  3CXG A;  2GGT A;  4MF7 A;  2OAC A;  5KN3 A;  2F8F A;  1KEB A;  4ACS A;  4CHS A;  3LXT A;  2OAD A;  5AIS A;  3O76 A;  3TRP A;  1OE8 A;  3FZ4 A;  1EGR A;  2VCX A;  1C72 A;  3WGX A;  1U88 A;  4ZBD A;  1GNW A;  3VK9 A;  5KN1 A;  4ECJ A;  1XOA A;  1T1V A;  4MZW A;  3KXO A;  2JL4 A;  5D96 A;  3KTL A;  1LU4 A;  1FW1 A;  4V2M A;  4TXO B;  2WZ9 A;  1V9W A;  2ZCT A;  2M72 A;  1GWC A;  5EY6 A;  2A4V A;  5DJM A;  1GLP A;  2GVP A;  2P0G A;  5ECH B;  5ID2 A;  3EE2 A;  4O32 A;  4Q5R A;  4WR5 A;  4BVY B;  2RM6 A;  4K8M A;  3S9F A;  3FK8 A;  1GRX A;  1EP7 A;  3E0U A;  3ZML A;  4TR1 A;  4D73 A;  2CX4 A;  5COH A;  3TDG A;  4GQF A;  5CYY A;  1GL8 A;  5EVO A;  1SK1 A;  4KGI A;  2HT9 A;  1PX7 A;  3Q6O A;  4MPF A;  1A23 A;  3EPT A;  1GP1 A;  4Z2R A;  1CQG A;  3UBK A;  5ECM B;  2GZP A;  1A0F A;  2WB9 A;  2DKH A;  2JZT A;  3UAR A;  2DJ3 A;  5ID2 B;  2X8H A;  2EIO A;  4DSQ A;  2GDR A;  1T3B A;  3QFA C;  1GSE A;  4J56 E;  3W8S A;  1VGL A;  2GT5 A;  3GA4 A;  2PU9 C;  1IYH A;  2FNO A;  1AC1 A;  3KJY A;  4D73 B;  4HJ2 A;  2DJ1 A;  2XPE A;  1WRY A;  4ZL7 A;  3LJR A;  2P31 A;  3WT2 A;  2GST A;  16GS A;  3TUE A;  1AQX A;  2IMI A;  3ZRD A;  2KUC A;  5G2Z A;  2YNX A;  3R3E A;  2RM5 A;  1VRS D;  1TK5 B;  1EEJ A;  2LQQ A;  1YEX A;  1YJ6 A;  2MZC A;  3IHG A;  1TK0 B;  4QQ7 A;  1A8Y A;  1GUM A;  2V1M A;  4QL7 A;  4N0Z A;  2XBQ A;  2GSR A;  2VCT A;  1O8W A;  2KP1 A;  4BVX B;  5B6N A;  3M9K A;  1PN9 A;  1THX A;  2DIZ A;  1O85 A;  1FAA A;  4F03 A;  3GH9 A;  5JCG A;  2X8G A;  4XIH A;  5KOW A;  3CMI A;  2PVQ A;  3FR3 A;  4AGS A;  2YN1 A;  2HZF A;  4GDF A;  2WCI A;  4WF5 A;  3CRU A;  1QFN A;  4GTU A;  4DSR A;  2JSZ A;  2MBT A;  4WR4 A;  3QCP A;  3MNG A;  3BCK A;  3ZIJ A;  1PMT A;  1LJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...