3CSIA

Crystal structure of the glutathione transferase pi allelic variant*c, i104v/a113v, in complex with the chlorambucil-glutathione conjugate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEVGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title The anti-cancer drug chlorambucil as a substrate for the human polymorphic enzyme glutathione transferase P1-1: kinetic properties and crystallographic characterisation of allelic variants.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3csiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3csiA01
4MPFA 3IDVA 4PNGA 1K3LA 2P5QA 3D21A 5ECQB 2FUG2 11GSA 2AV4A 4DSSA 1O73A 3CBUA 2ZCTA 2QKEA 4L5LA 4WR4A 2AHEA 3M3MA 2MBSA 6GSSA 3DMLA 1F2EA 4I8BA 3HCZA 4EXJA 2WRTA 2GQKA 4CW9A 6GSXA 5FHIA 4XRDA 1A23A 3MNGA 5HR2A 1QFNA 1TU7A 3CTGA 2O85A 1K3YA 3G7JA 3W8SA 3DKSA 3ZLPA 3ZVJA 5F06A 2LSTA 4IP6A 3M1GA 2XBIA 1SL2B 2YWIA 2LJKA 1XVQA 1K0AA 3TKSA 2YN1A 5J41A 1GSQA 1ZMAA 5DAKB 3P7XA 4TXOB 1T4ZA 4NHWA 1G7OA 1XW6A 4F03A 5IMVA 1V9WA 1Q98A 4JU5A 1A24A 3KH9A 2DJ1A 4TRXA 4NXIA 4YAPA 1UVZA 3CMIA 4O32A 2PMTA 3JCML 3GKMA 2FWGA 3GKXA 1BAYA 3LQ7A 1FVKA 5ELGA 3DXBA 4FYBA 3ZITA 1A2MA 5J9BA 2AJQB 2VLTA 5G30A 5BMUA 2CAQA 2MMAA 3ZYWA 1GUMA 3IA1A 2NPBA 3M8NA 2OE1A 1K3OA 4ZBDA 4L0UA 4BL7A 1YKAA 4BVXA 2GT6A 4K9ZA 4WBRD 3LORA 3GTUA 4IJIA 1GSEA 1M99A 4MJAA 2HSYA 3E9JB 4ML1A 1F3BA 4ZBBA 2WS2A 1Y6EA 1TK8B 5IMFA 4KUNA 5GAND 1IYHA 2LNTA 3CSJA 2FGXA 4WF5A 5IOWA 5J9CA 1OC9B 4JEDA 3GFKA 2EIQA 2BTOT 1THOA 4E8HA 1TI1A 4RQRA 1ZCPA 2VCTA 4YAVA 2AYTA 4PGTA 1YF0A 4NAXA 1K0NA 2OJLA 3FZAA 4WR5A 3QAGA 1I9DA 1S3AA 2H70A 2C80A 1FVJA 3UIWA 2RM5A 4KH7A 5CRWA 1PL2A 1GNEA 1WWJA 5INYA 4I2UA 4ZL7A 4NHZA 2L4CA 4LL4B 2H72A 1GUKA 1OKDA 1K0DA 5CNWA 4IQ1A 4F9ZA 4ID0A 1ACVA 3MAKA 4IHUA 3VPTA 1Z7PA 6GSWA 3GYKA 5ECLB 1MD4A 4XCSA 3GHAA 2TIRA 4ACSA 3UJ1A 4GQCA 2IFQB 2V2GA 2YANA 1YQ1A 4ECIA 4XRAA 8GSSA 3IR4A 3E0UA 3EURA 4CHSA 3G7IA 1JZOA 2JSYA 5D96A 1ST9A 2L6DA 1G7EA 1V58A 1OKTA 3I9V2 1OE8A 3IAM2 1SYXA 4G9HA 1Z9HA 1HQOA 2OBKA 3C8EA 4ECBA 2L57A 1GUHA 3QR6A 3RAZA 4POBA 3HHVA 3FY7A 5J3RA 3CTFA 4BWQA 3PR8A 2VCWA 3VFIA 4GF0A 2YZUA 4V1Ag 1YKCA 4MF5A 4ECCA 2I4AA 2B1LA 2YV7A 1TK0B 3P8WA 3FZ4A 3KCMA 5CAXA 3D6IA 2JZSA 4MJCA 4KE3A 1ZOFA 5A4WA 1T00A 2PWJA 2A2SA 4KDYA 1R26A 1TOFA 1YEXA 3SWLA 3HVVA 1BEDA 4AJ8A 1PD21 4G2EA 2VLUA 4MMMA 4V2NA 1B8XA 4PQIA 3F6FA 5F07A 4PUAA 3NOFA 1S3DA 4GRFA 2Z9SA 5KN2A 5IMZA 2G2QA 4TVEA 1T1VA 3KGKA 2DJJA 3IC8A 1M9BA 3UAPA 1V2AA 4EKZA 2OKAA 2H76A 3PGTA 2REMA 2HRAA 2CVKA 4OFMA 3FW2A 1RW1A 2IMEA 1PRXA 1AUCA 4N30A 1XCCA 1S3CA 1QGVA 4POKA 4QQ7A 5IM9A 1EWXA 3HVSA 3TKSE 3VWWA 4G10A 2OACA 5IMDA 3M9KA 2NVLA 1TRSA 4K1FA 3A5WA 1G6WA 1VF2A 4OMVA 1QMVA 3EINA 3TUEA 3U6VA 4KA0A 1QK8A 1WMJA 4FYUA 2LJAA 18GSA 4OO5A 2GSRA 4PXOA 3F4RA 1R5AA 1T7PB 1RQMA 2MZCA 4HJMA 2YV9A 1UC7A 2J9HA 4D73B 3WD6A 3VWUA 3C7MA 1OYJA 2IL3A 5D9XA 3EE2A 1USBA 4L8EA 2F51A 2GZPA 2H6YA 1TDIA 2XPDA 1GSDA 5C04A 4YQVA 6GSYA 5IPHA 4ZB9A 1NSWA 2GSQA 4HZ2A 3TJKA 2IWTA 7GSSA 3QD9A 2LNSA 4TR3A 2OA7A 2CX4A 3ZZXA 4NV5A 4KX4A 3IRAA 2FA8A 3RHCA 3KTLA 2H19A 3I43A 2F9SA 1FB0A 2IIYA 5ABRA 3ZTLA 4IN0A 3TJGA 3WT2A 3CRTA 2V1MA 5ECRB 4MF7A 1FHEA 4FH8A 3UVTA 3VWXA 4V2LA 3FR9A 1B4PA 1WPIA 1EGRA 3F63A 2VOCA 2B6MA 2HQTA 3DVWA 4V2MA 1J08A 2VCQA 2LUSA 1GSSA 5A5KA 1R4WA 2B5YA 2I9HA 3E3EA 3LXTA 5C00A 5G5EA 2B7JA 2N5FA 4PURA 1NW2A 2DSAA 5IIZA 3L78A 4TR1A 1VF4A 2OADA 4KCAA 2C3QA 1X9WB 5F0GA 3LWAA 2CQ9A 2B3SA 1B4QA 3KMOA 2GDRA 2JADA 4TR0A 1XW9A 2E7PA 2HFDA 3L4NA 5IO0A 2QC7A 1O81A 3LG6A 1GP1A 4CDOA 2LJRA 3TJBA 4K6XA 3IXRA 1B9XC 2VCZA 3BBYA 1SJ6A 3GKKA 3WGXA 1X5CA 2XC2A 4HDEA 4TKYA 4MLYA 4QL7A 1TRVA 5CRGA 4Q5RA 3GMFA 3IPZA 1HNCA 1ZYEA 1WRYA 2HRKA 2GZZA 3GSSA 2GTUA 2IMIA 2YZHA 3G7YA 2GGTA 1TRUA 4K0GA 2XPEA 2LTKA 4OCFA 1X9SB 3LEFA 5D9WA 4L0WA 2P5RA 5H5RA 4N0ZA 4MF6A 1QUWA 10GSA 3HYPA 2GLRA 5H5SA 1ZYQB 5AIXA 3ERWA 5COHA 5B8BA 4KW6A 3L9VA 5B6MA 3QCPA 1MDIA 4Q5FA 1A8YA 3SBCA 1Y25A 2X8HA 4TR4A 5D9VA 1JZWA 1OAZA 4JBBA 3QAVA 4EVMA 2YJ7A 4G0KA 1FOVA 2VL3A 5DVBA 5CYYA 3VURA 2YPMA 1K0OA 17GSA 2M46A 1ZL9A 4KNDA 4N0VA 1SKSB 2D2ZA 2H0HA 3TB2A 4DEJA 19GSA 2CVDA 1DE2A 4TN8A 3ME7A 4HQSA 4TXVA 5CREA 3TRPA 2DJ0A 1E6BA 4MZBA 1G6YA 4AGSA 2X8CA 5ID2B 2E0QA 5ECSA 3CSHA 1TW9A 2VM1A 1XVWA 1BG5A 3TOUA 5GAPD 1VF1A 3A2WA 3UBLA 1PN9A 4KCEA 2PUKC 4BPYA 1QQ2A 2RUFA 2G0FA 2DIYA 4AJ7A 1KBNA 5J5NA 2DIZA 3F8UA 2FD3A 2BMXA 2YOIA 3DVXA 4QL9A 3FRCA 2WFCA 1XWGA 1XOBA 1WE0A 5HR1A 3CXGA 4PNFA 3W6GA 5GSTA 3GV1A 1OC8A 5LCZA 1XPVA 5HFGA 1SYRA 4IS0A 5A4VA 1GTUA 2J23A 3LSZA 4BVYA 4GSTA 3KD0A 2PVQA 4Q5QA 3A2VA 1HNBA 2H30A 2AAWA 3M0FA 4HOJA 2NDOA 5ENUA 3TGZA 2C1YA 1TRWA 2DMMA 2YNXA 1U87A 2I81A 2PERA 2CZ2A 1XIYA 1R5PA 2PN8A 2CVBA 2VO4A 4KB3A 3FZ5A 2GSTA 1VRSD 4OFTA 3DIEA 5JWOB 3BD2A 4HJ2A 5D9TA 2MMZA 3H79A 2NTOA 3KIJA 4GSNA 4TW5A 4ZB6A 2VUPA 1B48A 2VIMA 4O92A 5B6NA 2EIRA 2PVOC 1AW9A 3QPMA 1WJKA 4WF4A 3EWLA 2L6CA 2C3NA 2V41A 2O7KA 3U5RE 3FYGA 5D8IA 2WDUA 3O6TA 1TJDA 4F82A 1T3BA 2CA8A 4F0CA 5JWQB 2VLVA 2F8AA 1K0MA 2WZ9A 5IMAA 1DBYA 4KSMA 4ZL9A 4HI7A 3TKSC 1JLVA 4G0IA 2FY6A 1AQXA 2FCHA 4Z7XA 3H8QA 1KEBA 2I3YA 2GS3A 1AXDA 1A2JA 2H1BA 4X1UA 3RPPA 3PINA 3FK8A 4JZQA 4NV2A 1DUGA 1CQGA 2H75A 3QOUA 3APSA 2HSNB 1T4YA 5DQYA 2H0GA 5DALB 2FLSA 2HZEA 1YJ6A 2K9FA 2B5XA 2C0DA 3KZQA 3EU4A 5G5FA 4PQHA 3IAS2 3M9JA 3IK7A 4POLA 4DSSB 4LMWA 3VI5A 3DWVA 1A0FA 3F4TA 2B5EA 4HEA2 4WETA 1ZGNA 2H71A 4O5RA 4USSA 4EUYA 5DCHA 1KNGA 6GSVA 4ML6A 3EU3A 4EF0A 2AUVA 2ZNMA 4N11A 4EO3A 4WBJA 4WEYA 1EZKA 5ECKB 3EMXA 4J2FA 1ERUA 4F0BA 2KUCA 3N5OA 5ELAA 3PH9A 2LRCA 1SD9A 5L71A 2DBCA 3IK9A 1EP7A 2H6ZA 4MPGA 1FAAA 2YWNA 1V57A 4X0XA 2VCXA 1U6TA 1XXUA 3F9UA 2QGVA 1V98A 5KN3A 2DLXA 4HU9A 3R3EA 4G0LA 1TI3A 1XWBA 4J56E 3UOMA 1ERTA 5EPFA 9GSSA 4MP4A 4LL1B 3VPQA 2P0GA 3F6DA 3HJOA 3ED3A 2BJXA 4MK3A 4FYCA 4IVFA 5ECMB 1GLPA 4BL7B 4NWYA 13GSA 4BVXB 4RI6A 1XWKA 1PQNA 1BQ7A 3US3A 3GTUB 2H0IA 3S9FA 1X9MB 5AIVA 5DAKA 1M2BA 1JHBA 1GSYA 4KAEA 3ZMKA 2L59A 5HFKA 4TXOA 3O76A 2PPTA 3TKQA 5G1KA 4WKWA 2IMFA 3G9BA 5HFIA 1IYIA 2KOKA 4HQZA 1WOUA 3MDKA 3ZL5A 2C0EA 4MH2A 4BA7A 3GH9A 1Z6NA 5KEJA 5AN1A 1O85A 3GL3A 3Q6OA 5A4UA 2CX3A 3A2XA 4I2TA 3C73A 4DSQA 3APOA 1PSQA 4ZIJA 3F3RA 1AQWA 2R37A 1AIUA 5DCGA 2O89A 2V6OA 2L5LA 3BJ5A 1XOAA 2UZ8A 4Q5NA 4PTSA 2JSZA 1G0TA 1RK4A 1YZXA 1MD3A 5ECOB 1U3IA 3FKFA 4NPBA 1OC9A 4K7NA 3V1WA 1EV4A 4XHMA 3MWHA 2I1UA 3WGEA 4MJBA 2H73A 2ZUPA 1SJIA 4ULXA 4AF2A 3RDWA 3Q18A 2DJ3A 4ZB8A 4H86A 1J9BA 2L5OA 4WXTA 4DSRA 2A2RA 1XFLA 1YF1A 2K8VA 2R2JA 5IPGA 1GTIA 1FO5A 1EGOA 3GX0A 1N8JA 2VAFA 4GQFA 3TOTA 2GQMA 1BX9A 1OVNA 3R2QA 5G31A 2JACA 1LU4A 1MDJA 3EMPA 2HXKA 3DYRA 2YJHA 2YWOA 1M2DA 1SL0B 3GN3A 2PGTA 2MMOA 6GSUA 4MDCA 4LLRA 3FR3A 5FWGA 4ZL8A 2GT5A 2K8SA 1MTCA 2F3MA 3ZIJA 4G19A 1J0FA 1U3AA 1E2YA 2H8LA 2IFQA 3F4SA 2LKUA 1VF3A 3F3QA 5DBQA 2IJYA 3KP9A 1MDKA 1M7TA 2KP1A 3TKPA 2JZRA 4K7IA 4X43A 5HR0A 3N9JA 4RI7A 4YH2A 3IBHA 5DDLA 3ISOA 1PKWA 2DJ2A 3RPNA 1SD8A 4K2DA 1AAZA 2RUEA 5DJMA 4HZ4A 3P90A 3WGDA 1QXHA 1SK0A 2LQQA 5E59A 5D73A 1BJXA 2HYXA 5D93A 1O6JA 4L5OA 1H4OA 5CP1A 2B1KA 3D22A 4EDYA 2FA4A 4DVCA 1NHYA 5B8AA 1TXXA 2VD1A 5AISA 2WB9A 4IP1A 3GUSA 3ZREA 1JZRA 2OBIA 3GA4A 4MZWA 3LFLA 2FNOA 3VK9A 2DMLA 1T8EB 1GTBA 2ALBA 5KN1A 2O87A 2WJUA 1WP0A 1LBKA 5IO2A 3HA9A 1JZDA 2HT9A 1TKDB 3HJMA 1JLWA 1I5GA 3UBKA 4XS6A 3OR5A 3D4MA 1VGLA 2EC4A 1XWAA 2E2GA 2VD0A 1W4VA 3HZ4A 5IOXA 4LMVA 3I6AA 5EVOA 2R4VA 1GLQA 1PMTA 4AJ6A 14GSA 3A3TA 1X0RA 1XWCA 3KEBA 1R7HA 5CRHA 1Q4JA 2HNLA 1MEKA 2MBTA 4K0NA 3VWVA 3TRQA 4PUFC 1XZOA 2C3TA 3UMAA 5EY6A 2A4VA 2IMDA 5JCWA 2K6VA 4XTSA 5DJLA 4ILFA 3J7Yk 3GX8A 16GSA 1A2LA 5B7CA 5LD0A 1M0UA 3J7Yb 3CSIA 2FWFA 1EV9A 1M2AA 3O3TA 2VM2A 1SK2A 3P2AA 3EVIA 2LV3A 2C0FA 2VCVA 1YY7A 4D73A 1SENA 3IHQA 1TK5B 2K18A 1OE7A 2LEGA 3ERFA 1O8XA 3QDNA 3ZRDA 1GH2A 2XBQA 3KH7A 2O8VB 4MABA 3W8JA 1TP9A 3IE3A 4XS4B 2N5BA 3IV4A 4GTUA 2MMNA 2JZTA 2R6KA 1TTZA 2GSSA 3NZNA 1KTEA 4TR1B 4KGIA 3GNJA 3QMXA 3LYPA 5LNKe 2CT6A 4GLTA 2HSMB 3UEMA 4BWSA 4RQXA 3FR6A 3HY2A 1X5EA 3HJPA 1EP8A 2IMKA 1GNWA 1O7UA 5H5QA 3KP8A 4I5QA 3GRXA 1U88A 5JWRB 2X64A 3L9UA 4XS1A 2HRFA 5GZZB 2HLSA 1NM3A 4FQUA 1TU8A 3ERGA 5FT3A 5J4UA 5CRDA 3LYKA 1GWCA 2FHEA 2C0GA 2TRXA 4TOPA 3C1SA 2ON7A 2FWHA 2R5GA 1Z6MA 3IOSA 3KMNA 4OWYA 3GURA 1SKRB 2HRKB 1AQVA 4PQ1A 1EOGA 4K7OA 5ECHB 1FB6A 3ZIVA 5ECNB 4FIWA 1K0CA 3FZ9A 2OE3A 2VL9A 3KM6A 4OD7A 3HD5A 4HU7A 4YQUA 3TJFA 1ON4A 2H1GA 5G1LA 5DQSA 5F8BA 4EE0A 1F6MC 3GKNA 4IELA 2IPAA 4IKHA 1LJRA 4MCUA 2HZFA 4ZILA 1W89A 2TRCP 3TKRA 1GSUA 2YP6A 3RBTA 2DJKA 2WGRA 4KF9A 2HI7A 4I6XA 2HE3A 2HRNA 3DEXA 1ML6A 4KDXA 3ZVJD 4I97A 2AB6A 4OO4A 3TCOA 4F2IA 5HR3A 3BOAA 3D4TA 2ON5A 3PPUA 2DC5A 4POMA 3L0HA 4ISDA 4KSOA 1PL1A 2GZYA 4OCEA 2XHFA 3FEUA 3AY8A 1URMA 3HZ8A 1C72A 3MSZA 4LA1A 4HS1A 1F3AA 2RIIA 5IMCA 5KN0A 1XBSA 5G2ZA 3VI7A 1DSBA 2E2MA 2PU9C 3VLNA 4IGJA 1ZZYA 3H4KA 4KDUA 6GSTA 2ES7A 2IN3A 3TJJA 3WYWA 1UN2A 3C71A 3QAWA 2N5AA 4E8EA 2EIOA 1WIKA 2GQLA 3EC3A 4EC0A 4OFNA 22GSA 1NHOA 1HYUA 3DD3A 5GSSA 4ZBAA 2F8FA 3D5JA 3QFBC 3KXOA 1K0BA 4JR4A 1THXA 5JCGA 4MA9A 3ZFBA 3Q19A 2H1AA 2RM6A 1X5DA 1FW1A 4GSSA 4EL1A 4J57E 4BVYB 1CQHA 1EEMA 2KHPA 1ILOA 3GIXA 2CAIA 3HDCA 2H66A 4EDZA 1SK1A 4PX1A 2YWMA 2HSHA 2L4QA 3DGQA 1GL8A 5ID2A 2JL4A 5ECPB 3KJYA 5JCUA 3GSTA 3BCIA 3L9SA 1GSFA 3CYNA 4NMUA 2FWEA 2M80A 2VL2A 3K8NA 2CZ3A 3I69A 1SKWB 4MZCA 2RLIA 1AC1A 5F05A 1JFUA 2H1DA 1HD2A 3WT1A 1A0RP 5E4WA 2GVPA 3GH6A 3CRUA 3LJRA 4RUVA 1ERWA 1Z5YE 1PX7A 3UARA 3Q74A 2LQOA 3F0IA 3ZFLA 4O7HA 1YDKA 1OC3A 3D0ZA 3QFAC 2OE0A 1DE1A 2YCDA 4ECJA 1FG4A 3GL5A 4N10A 3RHBA 3FHKA 2R3XA 2H74A 2C4JA 2LRTA 3ZMLA 2C8UA 5ECIB 3BCKA 2V32A 3HVXA 1GTAA 3H1NA 4IBPA 4K8MA 3C1RA 2H01A 4GCIA 2X99A 1M9AA 3TDGA 2H6XA 5HQPA 1PKZA 20GSA 4HUAA 3HXSA 1Z3EA 4XS4A 2NBSA 2CV4A 4GWRA 1V40A 2PBJA 4IJ3A 2KP2A 1H75A 1GULA 5IQYA 3UL3A 3KTBA 2LRNA 2HZEB 1GRXA 1UA5A 1PX6A 1Z7RA 4JRRA 2HSMA 4YQMA 1ABAA 2V6KA 1ERVA 2JU5A 4MH3A 2B7KA 3IC4A 2MYGA 1F37A 3LGCA 3H93A 4JE1A 2M72A 1BYEA 2KLXA 1O8WA 4ZXGA 3EYTA 1SJZA 2P31A 1EOHA 1B9YC 5CO3A 4JR6A 1SU9A 3ME8A 4MJEA 3DRNA 4FO5A 3UVHA 4IQAA 4IW9A 2WCIA 4P3YB 1YEPA 1N2AA 3HKRA 2QSIA 4XIHA 3TRXA 1F9MA 1SL1B 3LXZA 4GXZA 5AGYA 2LS5A 12GSA 2WULA 1HNAA 1PGTA 2VL2C 5EL8A 2X8GA 1PA3A 5DALA 1A8LA 4V1Ap 1EEJA 3APQA 1XW5A 3NIVA
chains in the Genus database with same CATH superfamily
4MPFA 4CY6A 3IDVA 4PNGA 1K3LA 2P5QA 3D21A 5ECQB 2FUG2 11GSA 2AV4A 4DSSA 1O73A 3CBUA 2ZCTA 2QKEA 4L5LA 4WR4A 2AHEA 3M3MA 2MBSA 6GSSA 3DMLA 1F2EA 4I8BA 3HCZA 4EXJA 2WRTA 2GQKA 4CW9A 6GSXA 1SVOA 5FHIA 4XRDA 1A23A 3MNGA 5HR2A 1QFNA 1TU7A 3CTGA 2O85A 3A5IA 1K3YA 3G7JA 3W8SA 2A4HA 3DKSA 3ZLPA 3ZVJA 5F06A 2LSTA 4IP6A 3M1GA 2XBIA 1SL2B 3HMJG 2YWIA 2LJKA 1XVQA 1K0AA 3TKSA 2YN1A 5J41A 1GSQA 1ZMAA 5DAKB 3P7XA 4TXOB 1T4ZA 4NHWA 1G7OA 1XW6A 4F03A 5IMVA 1V9WA 1Q98A 4JU5A 1A24A 3KH9A 2O36A 2DJ1A 4TRXA 4NXIA 4YAPA 1UVZA 3CMIA 4O32A 2PMTA 3JCML 3GKMA 2FWGA 4N3ZA 3GKXA 1BAYA 3LQ7A 1FVKA 5ELGA 1SVLA 3DXBA 4FYBA 3ZITA 1A2MA 5J9BA 2AJQB 2VLTA 5G30A 5BMUA 2CAQA 2MMAA 3ZYWA 1GUMA 3IA1A 2NPBA 3M8NA 2OE1A 1K3OA 4ZBDA 4L0UA 4BL7A 1YKAA 4BVXA 2GT6A 4K9ZA 4WBRD 4BIKA 3LORA 3GTUA 4IJIA 1GSEA 1M99A 4MJAA 2HSYA 3E9JB 4ML1A 1F3BA 4ZBBA 2WS2A 1Y6EA 1TK8B 5IMFA 4KUNA 2X4AA 5GAND 1IYHA 2LNTA 3CSJA 2FGXA 1PFOA 4WF5A 5IOWA 4PHZC 5J9CA 1OC9B 4PI2C 4JEDA 3GFKA 2EIQA 2BTOT 1THOA 4E8HA 1TI1A 4RQRA 1ZCPA 2VCTA 4YAVA 2AYTA 4PGTA 1YF0A 4NAXA 1K0NA 2OJLA 3FZAA 4WR5A 3QAGA 1I9DA 1S3AA 2H70A 2C80A 1FVJA 3UIWA 2RM5A 4KH7A 5CRWA 1PL2A 1GNEA 1WWJA 5INYA 4I2UA 4ZL7A 4NHZA 2L4CA 4LL4B 4O5QA 2H72A 1GUKA 1OKDA 1K0DA 5CNWA 4IQ1A 4F9ZA 4ID0A 4AKXB 1ACVA 3MAKA 4IHUA 3VPTA 2H1LA 1Z7PA 6GSWA 3GYKA 5ECLB 1MD4A 4XCSA 4EIQA 3GHAA 2TIRA 4ACSA 3UJ1A 4GQCA 2IFQB 2V2GA 2YANA 1YQ1A 4ECIA 4XRAA 8GSSA 3IR4A 3E0UA 3EURA 4CHSA 3G7IA 1JZOA 2JSYA 5D96A 1ST9A 2L6DA 1G7EA 1V58A 1OKTA 3I9V2 1OE8A 3IAM2 1SYXA 4G9HA 1Z9HA 4QMKA 1HQOA 2OBKA 3C8EA 4ECBA 2L57A 1GUHA 3QR6A 3RAZA 4POBA 3IHGA 3HHVA 3FY7A 5J3RA 3CTFA 4BWQA 3PR8A 2VCWA 4AKIA 3VFIA 4GF0A 2YZUA 4V1Ag 1YKCA 4MF5A 4ECCA 2I4AA 2B1LA 2YV7A 5KOXA 1TK0B 3P8WA 3FZ4A 3KCMA 5CAXA 4EIPA 3D6IA 2JZSA 4MJCA 4KE3A 1ZOFA 5A4WA 1T00A 2PWJA 2A2SA 4KDYA 1R26A 1TOFA 1YEXA 3SWLA 3HVVA 1BEDA 4AJ8A 1PD21 4G2EA 2VLUA 4MNNA 4MMMA 4V2NA 1B8XA 4PQIA 3F6FA 5F07A 4PUAA 3NOFA 1S3DA 4GRFA 2Z9SA 5KN2A 5IMZA 2G2QA 4TVEA 1T1VA 3KGKA 2DJJA 3IC8A 1M9BA 3UAPA 4E68A 1V2AA 4EKZA 2OKAA 2H76A 3PGTA 2REMA 2HRAA 2CVKA 4OFMA 3FW2A 1RW1A 2IMEA 1PRXA 1AUCA 4N30A 1XCCA 1YVLA 1S3CA 1QGVA 4POKA 4QQ7A 5IM9A 1EWXA 3HVSA 3TKSE 3VWWA 4G10A 2OACA 5IMDA 3M9KA 2NVLA 1TRSA 4K1FA 3A5WA 1G6WA 1VF2A 4OMVA 1QMVA 3EINA 3TUEA 3U6VA 4KA0A 1QK8A 1WMJA 2LJAA 18GSA 4FYUA 4OO5A 2GSRA 4PXOA 3F4RA 1R5AA 1T7PB 1RQMA 2MZCA 4HJMA 2YV9A 1UC7A 2J9HA 4D73B 3WD6A 2WVYA 3VWUA 3C7MA 1OYJA 2IL3A 5D9XA 3EE2A 1USBA 4L8EA 2F51A 2GZPA 2H6YA 1TDIA 2XPDA 1GSDA 5C04A 4YQVA 6GSYA 5IPHA 4ZB9A 1NSWA 2GSQA 4HZ2A 3TJKA 2IWTA 7GSSA 3QD9A 2LNSA 4TR3A 2OA7A 2CX4A 3ZZXA 4NV5A 4KX4A 1YEWC 3IRAA 2FA8A 3RHCA 3KTLA 2H19A 3I43A 2F9SA 1FB0A 2IIYA 5ABRA 3ZTLA 4IN0A 3TJGA 3WT2A 3CRTA 2V1MA 5ECRB 4MF7A 1FHEA 4FH8A 3UVTA 3VWXA 4V2LA 3FR9A 1B4PA 1WPIA 1EGRA 3F63A 2VOCA 2B6MA 2HQTA 2O3EA 3DVWA 4V2MA 1J08A 2VCQA 2LUSA 1GSSA 5A5KA 1R4WA 2B5YA 2I9HA 3E3EA 3LXTA 5C00A 5G5EA 2B7JA 2N5FA 4PURA 1NW2A 2DSAA 5IIZA 3L78A 4TR1A 1VF4A 2OADA 4KCAA 2C3QA 1X9WB 5F0GA 3LWAA 5A34B 2CQ9A 2B3SA 1B4QA 3KMOA 2GDRA 2JADA 4TR0A 1XW9A 2E7PA 5A1NA 2HFDA 3L4NA 5IO0A 2QC7A 1O81A 3LG6A 1GP1A 4CDOA 2LJRA 3TJBA 4K6XA 3IXRA 1B9XC 2VCZA 3BBYA 1SJ6A 2DKHA 3GKKA 3WGXA 1X5CA 2XC2A 4HDEA 4TKYA 4MLYA 4QL7A 1TRVA 5CRGA 4Q5RA 3GMFA 3IPZA 1HNCA 1ZYEA 1WRYA 2HRKA 2GZZA 3GSSA 2GTUA 2IMIA 2YZHA 3G7YA 2GGTA 1TRUA 4G01A 4K0GA 2XPEA 2LTKA 4OCFA 1X9SB 3LEFA 5D9WA 4L0WA 2P5RA 5H5RA 2DKIA 4N0ZA 4MF6A 1QUWA 10GSA 3HYPA 2GLRA 5H5SA 1ZYQB 5AIXA 3ERWA 5COHA 5B8BA 4KW6A 1M3JA 3L9VA 5B6MA 3QCPA 1MDIA 4Q5FA 1A8YA 3SBCA 1Y25A 2X8HA 4TR4A 5D9VA 1JZWA 1TXUA 1OAZA 4JBBA 3QAVA 4EVMA 2YJ7A 4G0KA 4PI0C 1FOVA 2VL3A 5DVBA 5CYYA 3VURA 2YPMA 1K0OA 17GSA 2M46A 1ZL9A 4KNDA 4N0VA 1SKSB 2D2ZA 2H0HA 3TB2A 4DEJA 19GSA 2CVDA 1DE2A 4TN8A 4Z2UA 3ME7A 2O5VA 4HQSA 4TXVA 5CREA 3TRPA 2DJ0A 4O5UA 1E6BA 4MZBA 1G6YA 4AGSA 2X8CA 5ID2B 2E0QA 5ECSA 3CSHA 1TW9A 2VM1A 1XVWA 1BG5A 3TOUA 3CWGA 5GAPD 1VF1A 3A2WA 3UBLA 1PN9A 4KCEA 3TU3B 2PUKC 4BPYA 1QQ2A 2RUFA 2G0FA 2DIYA 4AJ7A 1KBNA 5J5NA 2DIZA 3F8UA 2FD3A 2BMXA 2YOIA 3DVXA 4QL9A 3FRCA 2WFCA 1XWGA 1XOBA 1WE0A 5HR1A 3CXGA 4PNFA 3W6GA 5GSTA 3GV1A 1OC8A 5LCZA 1XPVA 5HFGA 1SYRA 4IS0A 5A4VA 1GTUA 2J23A 3LSZA 4BVYA 4GSTA 3KD0A 2PVQA 4Q5QA 3A2VA 1HNBA 2H30A 2AAWA 3CQFA 3M0FA 4HOJA 2NDOA 5ENUA 3TGZA 2C1YA 1TRWA 2DMMA 2YNXA 1U87A 2I81A 2PERA 2CZ2A 1XIYA 1R5PA 2PN8A 2CVBA 2VO4A 4KB3A 3FZ5A 2GSTA 1VRSD 4OFTA 3DIEA 5JWOB 3BD2A 4HJ2A 5D9TA 2MMZA 3H79A 2NTOA 3KIJA 4GSNA 4TW5A 4ZB6A 2VUPA 1BG1A 1B48A 2VIMA 4O92A 5B6NA 2EIRA 2PVOC 1AW9A 3QPMA 1WJKA 4WF4A 3EWLA 2L6CA 2C3NA 2V41A 2O7KA 3U5RE 3FYGA 5D8IA 2WDUA 3O6TA 1TJDA 4F82A 1T3BA 2CA8A 4F0CA 5JWQB 2VLVA 2F8AA 1K0MA 2WZ9A 5IMAA 1DBYA 4KSMA 4ZL9A 4HI7A 3TKSC 1JLVA 4G0IA 2FY6A 1AQXA 2FCHA 2QA2A 4Z7XA 3H8QA 1KEBA 2I3YA 2GS3A 1AXDA 1A2JA 2H1BA 4X1UA 3RPPA 4YKGA 3PINA 3FK8A 4JZQA 4NV2A 1DUGA 1CQGA 2H75A 3QOUA 2WZSA 3APSA 2HSNB 1T4YA 5DQYA 2H0GA 5DALB 5J4YA 2FLSA 2R0GA 2HZEA 1YJ6A 2K9FA 2B5XA 2C0DA 2WVXA 1S4BP 3KZQA 3EU4A 4AI6A 5G5FA 4PQHA 3IAS2 3M9JA 3IK7A 4POLA 1FOHA 4DSSB 4LMWA 3VI5A 3DWVA 1BF5A 1A0FA 3F4TA 2B5EA 4HEA2 4WETA 1ZGNA 2H71A 4O5RA 4USSA 4EUYA 5DCHA 1KNGA 6GSVA 4ML6A 3EU3A 4EF0A 2AUVA 2ZNMA 4N11A 3RGBC 4EO3A 4WBJA 4WEYA 1EZKA 5ECKB 3EMXA 5J4VA 4J2FA 1ERUA 4F0BA 2KUCA 3N5OA 5ELAA 3PH9A 2LRCA 1SD9A 5L71A 2DBCA 3IK9A 1EP7A 5KOWA 2H6ZA 4MPGA 1XG8A 1FAAA 2YWNA 1V57A 4X0XA 2VCXA 1U6TA 1XXUA 3F9UA 4K5RA 2QGVA 4YKFA 1V98A 5KN3A 2DLXA 4HU9A 3R3EA 4G0LA 1TI3A 1XWBA 4J56E 1ZYNA 3UOMA 4FXYP 1ERTA 5EPFA 9GSSA 4MP4A 4LL1B 3VPQA 2P0GA 3F6DA 5BMUB 3HJOA 3ED3A 2BJXA 4MK3A 4FYCA 4IVFA 5ECMB 1GLPA 4BL7B 4NWYA 13GSA 4BVXB 4RI6A 1XWKA 1PQNA 1BQ7A 3US3A 3GTUB 2H0IA 3S9FA 1X9MB 5AIVA 5DAKA 1I1IP 1M2BA 1JHBA 1GSYA 4KAEA 3ZMKA 2L59A 5HFKA 4TXOA 3O76A 2PPTA 3TKQA 5G1KA 4WKWA 2IMFA 3G9BA 5HFIA 1IYIA 2KOKA 4HQZA 1WOUA 4ZB7A 3MDKA 3ZL5A 2C0EA 4MH2A 4BA7A 3GH9A 1Z6NA 5KEJA 5AN1A 1N25A 1O85A 3GL3A 3Q6OA 5A4UA 2CX3A 3A2XA 4I2TA 3C73A 4DSQA 3APOA 1PSQA 4ZIJA 3F3RA 1AQWA 2WW3A 2R37A 1AIUA 5DCGA 2O89A 2V6OA 2L5LA 3BJ5A 1XOAA 2UZ8A 4Q5NA 4PTSA 2JSZA 1G0TA 1RK4A 1YZXA 1MD3A 5ECOB 1U3IA 3FKFA 4NPBA 1OC9A 4K7NA 3V1WA 1EV4A 4XHMA 3MWHA 2I1UA 3WGEA 4MJBA 2H73A 2ZUPA 1SJIA 4ULXA 4AF2A 3RDWA 3Q18A 2DJ3A 4ZB8A 4H86A 1J9BA 2L5OA 4WXTA 4DSRA 2A2RA 1XFLA 1YF1A 2K8VA 2R2JA 5IPGA 1GTIA 4HSCX 1FO5A 1EGOA 3GX0A 1N8JA 2VAFA 4GQFA 3TOTA 2GQMA 1BX9A 1OVNA 3R2QA 5G31A 2JACA 1LU4A 4AKGA 1MDJA 3EMPA 2HXKA 3DYRA 2YJHA 2YWOA 1M2DA 1SL0B 3GN3A 1Y1UA 2PGTA 2MMOA 6GSUA 4MDCA 4LLRA 3FR3A 5FWGA 4ZL8A 2GT5A 2K8SA 1MTCA 2F3MA 3ZIJA 4G19A 1J0FA 1U3AA 1E2YA 2H8LA 1ZYPA 2IFQA 3F4SA 2LKUA 1VF3A 2R0PA 3F3QA 5DBQA 2IJYA 3KP9A 1MDKA 1M7TA 2KP1A 4X4JA 3TKPA 2JZRA 4K7IA 4X43A 5HR0A 3N9JA 4RI7A 4YH2A 3IBHA 5DDLA 3ISOA 1PKWA 2DJ2A 3RPNA 1SD8A 4K2DA 3FMWA 1AAZA 2RUEA 5DJMA 4HZ4A 3P90A 3WGDA 1QXHA 2A2PA 1SK0A 2LQQA 5E59A 5D73A 1BJXA 2HYXA 5D93A 1O6JA 4L5OA 1H4OA 5CP1A 2B1KA 3D22A 4EDYA 2FA4A 4DVCA 1NHYA 5B8AA 1TXXA 2VD1A 5AISA 2WB9A 4IP1A 3GUSA 3ZREA 1JZRA 2OBIA 3GA4A 4MZWA 3LFLA 2FNOA 3VK9A 2DMLA 1T8EB 3HVNA 1GTBA 2ALBA 5KN1A 2O87A 2WJUA 1WP0A 1LBKA 5IO2A 3HA9A 1JZDA 2WW1A 2HT9A 1TKDB 3HJMA 1JLWA 1I5GA 3UBKA 4XS6A 3OR5A 3D4MA 4A5PA 1VGLA 2EC4A 1XWAA 1PN0A 2WW2A 2WW0A 2E2GA 2VD0A 1W4VA 3HZ4A 5IOXA 4LMVA 4K2XA 3I6AA 5EVOA 2R4VA 1GLQA 1PMTA 4AJ6A 14GSA 3A3TA 1X0RA 1XWCA 3KEBA 1R7HA 5CRHA 1Q4JA 2HNLA 1MEKA 2MBTA 4K0NA 3VWVA 3TRQA 4PUFC 1XZOA 2C3TA 3UMAA 5EY6A 2A4VA 2IMDA 5JCWA 2K6VA 4XTSA 5DJLA 4ILFA 3J7Yk 3GX8A 16GSA 1A2LA 2QA1A 5B7CA 5LD0A 1M0UA 3J7Yb 3CSIA 2FWFA 1EV9A 1M2AA 3MYDA 3O3TA 2VM2A 1SK2A 3P2AA 3EVIA 2LV3A 2C0FA 2VCVA 1YY7A 4D73A 1SENA 3IHQA 1TK5B 2K18A 1OE7A 2LEGA 3ERFA 1O8XA 3QDNA 3ZRDA 1GH2A 2XBQA 3KH7A 2O8VB 4MABA 3W8JA 1TP9A 3IE3A 4XS4B 4W66A 2N5BA 3IV4A 4GTUA 2EFHA 2MMNA 2JZTA 2R6KA 1TTZA 2GSSA 3NZNA 1KTEA 4TR1B 4KGIA 3GNJA 3QMXA 3LYPA 5LNKe 2CT6A 4GLTA 2HSMB 3UEMA 4BWSA 4RQXA 3FR6A 3HY2A 1X5EA 3HJPA 1EP8A 2IMKA 1GNWA 1O7UA 5H5QA 3KP8A 4I5QA 3GRXA 1U88A 5A1NB 5JWRB 2X64A 3L9UA 4XS1A 2HRFA 5GZZB 2HLSA 1NM3A 4FQUA 1TU8A 3ERGA 5FT3A 5J4UA 5CRDA 3LYKA 1GWCA 2FHEA 2C0GA 5A5HB 2TRXA 2R0CA 4TOPA 3C1SA 2ON7A 2FWHA 2R5GA 2VKZG 1Z6MA 3IOSA 3KMNA 4OWYA 3GURA 1SKRB 2HRKB 1AQVA 4PQ1A 1EOGA 4K7OA 5ECHB 5BRTA 1FB6A 3ZIVA 2EFDA 5ECNB 4FIWA 1K0CA 3FZ9A 2OE3A 2VL9A 3KM6A 1S3RA 5A34A 4OD7A 4K5SA 3HD5A 4HU7A 4YQUA 3TJFA 1ON4A 2H1GA 5G1LA 5DQSA 4ICYA 5F8BA 5J47A 4EE0A 4GDFA 4CY8A 1F6MC 3GKNA 4IELA 2IPAA 4IKHA 1LJRA 4MCUA 2HZFA 4ZILA 1W89A 2TRCP 3TKRA 1GSUA 2YP6A 3RBTA 2DJKA 2WGRA 4KF9A 2HI7A 4I6XA 2HE3A 2HRNA 3DEXA 1ML6A 4KDXA 3ZVJD 4I97A 2AB6A 4OO4A 3TCOA 4F2IA 5HR3A 3BOAA 3D4TA 2ON5A 3PPUA 2DC5A 4POMA 3L0HA 4ISDA 4KSOA 1PL1A 2GZYA 4OCEA 2XHFA 3FEUA 3AY8A 1URMA 3HZ8A 1C72A 3MSZA 4LA1A 4HS1A 1F3AA 2RIIA 5IMCA 5KN0A 1XBSA 5G2ZA 3VI7A 1DSBA 2E2MA 2PU9C 3VLNA 4IGJA 1ZZYA 3H4KA 4KDUA 6GSTA 2ES7A 2IN3A 3TJJA 3WYWA 1UN2A 3C71A 3QAWA 2N5AA 4E8EA 2EIOA 1WIKA 2GQLA 3EC3A 4EC0A 4OFNA 22GSA 1NHOA 1HYUA 3DD3A 5GSSA 4ZBAA 2F8FA 3D5JA 3QFBC 3KXOA 1K0BA 4JR4A 1THXA 5JCGA 4MA9A 3ZFBA 3Q19A 2H1AA 2RM6A 2WVZA 1X5DA 3LW9A 1FW1A 4GSSA 4EL1A 4J57E 4BVYB 1CQHA 1EEMA 2KHPA 1ILOA 3GIXA 2CAIA 3HDCA 2H66A 4EDZA 1SK1A 4PX1A 2YWMA 2HSHA 2L4QA 3DGQA 1GL8A 5ID2A 2JL4A 5ECPB 3KJYA 5JCUA 3GSTA 3BCIA 3L9SA 1GSFA 3CYNA 4NMUA 1SVMA 2FWEA 2M80A 2VL2A 3K8NA 2CZ3A 3I69A 1SKWB 4MZCA 2RLIA 1AC1A 1M3IA 5F05A 1JFUA 2H1DA 1HD2A 3WT1A 1A0RP 5E4WA 2X49A 4Z2RA 2GVPA 3GH6A 3CRUA 3LJRA 4RUVA 1ERWA 1Z5YE 1PX7A 3UARA 3Q74A 2LQOA 3F0IA 3ZFLA 2EFEA 4O7HA 1YDKA 1OC3A 3EPTA 3D0ZA 3QFAC 2OE0A 1DE1A 2YCDA 4AKHA 4ECJA 1FG4A 3GL5A 4N10A 3RHBA 3FHKA 2R3XA 2H74A 2C4JA 2LRTA 3ZMLA 2C8UA 5ECIB 3BCKA 2V32A 3HVXA 1GTAA 3H1NA 2UV8G 4IBPA 4K8MA 3C1RA 2H01A 4GCIA 2X99A 1M9AA 3TDGA 2H6XA 5HQPA 1PKZA 20GSA 4HUAA 3HXSA 1Z3EA 4XS4A 2NBSA 2CV4A 4GWRA 1V40A 2PBJA 4IJ3A 2KP2A 3RFRC 4Z2TA 1H75A 1GULA 5IQYA 3UL3A 3KTBA 2LRNA 2HZEB 1GRXA 1UA5A 2WVXB 5J40A 1PX6A 1Z7RA 4JRRA 2HSMA 4YQMA 1ABAA 2V6KA 1ERVA 2JU5A 4MH3A 2B7KA 3IC4A 2MYGA 1F37A 2EFCA 3LGCA 3H93A 4JE1A 3MIXA 2M72A 1BYEA 2KLXA 1O8WA 4ZXGA 3EYTA 1SJZA 2P31A 1EOHA 2OT3A 1B9YC 5CO3A 4JR6A 1SU9A 3ME8A 4MJEA 5A5HA 3DRNA 4FO5A 3UVHA 4IQAA 4IW9A 2WCIA 4P3YB 3CHXC 1YEPA 1N2AA 3HKRA 2QSIA 4XIHA 3TRXA 1F9MA 1SL1B 3LXZA 4GXZA 5AGYA 2LS5A 12GSA 2WULA 1HNAA 2HSNA 1PGTA 2VL2C 5EL8A 2X8GA 1PA3A 5DALA 1A8LA 4V1Ap 1EEJA 3APQA 1XW5A 3NIVA
chains in the Genus database with same CATH topology
4MPFA 4CY6A 3IDVA 4PNGA 1K3LA 2P5QA 3D21A 5ECQB 2FUG2 11GSA 2AV4A 4DSSA 1O73A 3CBUA 2ZCTA 2QKEA 4L5LA 4WR4A 2AHEA 3M3MA 2MBSA 6GSSA 3DMLA 1F2EA 4I8BA 3HCZA 4EXJA 2WRTA 2GQKA 4CW9A 6GSXA 1SVOA 5FHIA 4XRDA 1A23A 3MNGA 5HR2A 1QFNA 1TU7A 3CTGA 2O85A 3A5IA 1K3YA 3G7JA 3W8SA 2A4HA 3DKSA 3ZLPA 3ZVJA 5F06A 2LSTA 4IP6A 3M1GA 2XBIA 1SL2B 3HMJG 2YWIA 2LJKA 1XVQA 1K0AA 3TKSA 2YN1A 5J41A 1GSQA 1ZMAA 5DAKB 3P7XA 4TXOB 1T4ZA 4NHWA 1G7OA 1XW6A 4F03A 5IMVA 1V9WA 1Q98A 4JU5A 1A24A 3KH9A 2DJ1A 4TRXA 4NXIA 4YAPA 1UVZA 3CMIA 4O32A 2PMTA 3JCML 3GKMA 2FWGA 4N3ZA 3GKXA 1BAYA 3LQ7A 1FVKA 5ELGA 1SVLA 3DXBA 4FYBA 3ZITA 1A2MA 5J9BA 2AJQB 2VLTA 5G30A 5BMUA 2CAQA 2MMAA 3ZYWA 1GUMA 3IA1A 2NPBA 3M8NA 2OE1A 1K3OA 4ZBDA 4L0UA 4BL7A 1YKAA 4BVXA 2GT6A 4K9ZA 4WBRD 3LORA 3GTUA 4IJIA 1GSEA 1M99A 4MJAA 2HSYA 3E9JB 4ML1A 1F3BA 4ZBBA 2WS2A 1Y6EA 1TK8B 5IMFA 4KUNA 2X4AA 5GAND 1IYHA 2LNTA 3CSJA 2FGXA 4WF5A 5IOWA 5J9CA 1OC9B 4JEDA 3GFKA 2EIQA 2BTOT 1THOA 4E8HA 1TI1A 4RQRA 1ZCPA 2VCTA 4YAVA 2AYTA 4PGTA 1YF0A 4NAXA 1K0NA 2OJLA 3FZAA 4WR5A 3QAGA 1I9DA 1S3AA 2H70A 2C80A 1FVJA 3UIWA 2RM5A 4KH7A 5CRWA 1PL2A 1GNEA 1WWJA 5INYA 4I2UA 4ZL7A 4NHZA 2L4CA 4LL4B 4O5QA 2H72A 1GUKA 1OKDA 1K0DA 5CNWA 4IQ1A 4F9ZA 4ID0A 4AKXB 1ACVA 3MAKA 4IHUA 3VPTA 2H1LA 1Z7PA 6GSWA 3GYKA 5ECLB 1MD4A 4XCSA 4EIQA 3GHAA 2TIRA 4ACSA 3UJ1A 4GQCA 2IFQB 2V2GA 2YANA 1YQ1A 4ECIA 4XRAA 8GSSA 3IR4A 3E0UA 3EURA 4CHSA 3G7IA 1JZOA 2JSYA 5D96A 1ST9A 2L6DA 1G7EA 1V58A 1OKTA 3I9V2 1OE8A 3IAM2 1SYXA 4G9HA 1Z9HA 4QMKA 1HQOA 2OBKA 3C8EA 4ECBA 2L57A 1GUHA 3QR6A 3RAZA 4POBA 3IHGA 3HHVA 3FY7A 5J3RA 3CTFA 4BWQA 3PR8A 2VCWA 4AKIA 3VFIA 4GF0A 2YZUA 4V1Ag 1YKCA 4MF5A 4ECCA 2I4AA 2B1LA 2YV7A 5KOXA 1TK0B 3P8WA 3FZ4A 3KCMA 5CAXA 4EIPA 3D6IA 2JZSA 4MJCA 4KE3A 1ZOFA 5A4WA 1T00A 2PWJA 2A2SA 4KDYA 1R26A 1TOFA 1YEXA 3SWLA 3HVVA 1BEDA 4AJ8A 1PD21 4G2EA 2VLUA 4MNNA 4MMMA 4V2NA 1B8XA 4PQIA 3F6FA 5F07A 4PUAA 3NOFA 1S3DA 4GRFA 2Z9SA 5KN2A 5IMZA 2G2QA 4TVEA 1T1VA 3KGKA 2DJJA 3IC8A 1M9BA 3UAPA 4E68A 1V2AA 4EKZA 2OKAA 2H76A 3PGTA 2REMA 2HRAA 2CVKA 4OFMA 3FW2A 1RW1A 2IMEA 1PRXA 1AUCA 4N30A 1XCCA 1YVLA 1S3CA 1QGVA 4POKA 4QQ7A 5IM9A 1EWXA 3HVSA 3TKSE 3VWWA 4G10A 2OACA 5IMDA 3M9KA 2NVLA 1TRSA 4K1FA 3A5WA 1G6WA 1VF2A 4OMVA 1QMVA 3EINA 3TUEA 3U6VA 4KA0A 1QK8A 1WMJA 2LJAA 18GSA 4FYUA 4OO5A 2GSRA 4PXOA 3F4RA 1R5AA 1T7PB 1RQMA 2MZCA 4HJMA 2YV9A 1UC7A 2J9HA 4D73B 3WD6A 3VWUA 3C7MA 1OYJA 2IL3A 5D9XA 3EE2A 1USBA 4L8EA 2F51A 2GZPA 2H6YA 1TDIA 2XPDA 1GSDA 5C04A 4YQVA 6GSYA 5IPHA 4ZB9A 1NSWA 2GSQA 4HZ2A 3TJKA 2IWTA 7GSSA 3QD9A 2LNSA 4TR3A 2OA7A 2CX4A 3ZZXA 4NV5A 4KX4A 3IRAA 2FA8A 3RHCA 3KTLA 2H19A 3I43A 2F9SA 1FB0A 2IIYA 5ABRA 3ZTLA 4IN0A 3TJGA 3WT2A 3CRTA 2V1MA 5ECRB 4MF7A 1FHEA 4FH8A 3UVTA 3VWXA 4V2LA 3FR9A 1B4PA 1WPIA 1EGRA 3F63A 2VOCA 2B6MA 2HQTA 3DVWA 4V2MA 1J08A 2VCQA 2LUSA 1GSSA 5A5KA 1R4WA 2B5YA 2I9HA 3E3EA 3LXTA 5C00A 5G5EA 2B7JA 2N5FA 4PURA 1NW2A 2DSAA 5IIZA 3L78A 4TR1A 1VF4A 2OADA 4KCAA 2C3QA 1X9WB 5F0GA 3LWAA 5A34B 2CQ9A 2B3SA 1B4QA 3KMOA 2GDRA 2JADA 4TR0A 1XW9A 2E7PA 5A1NA 2HFDA 3L4NA 5IO0A 2QC7A 1O81A 3LG6A 1GP1A 4CDOA 2LJRA 3TJBA 4K6XA 3IXRA 1B9XC 2VCZA 3BBYA 1SJ6A 2DKHA 3GKKA 3WGXA 1X5CA 2XC2A 4HDEA 4TKYA 4MLYA 4QL7A 1TRVA 5CRGA 4Q5RA 3GMFA 3IPZA 1HNCA 1ZYEA 1WRYA 2HRKA 2GZZA 3GSSA 2GTUA 2IMIA 2YZHA 3G7YA 2GGTA 1TRUA 4G01A 4K0GA 2XPEA 2LTKA 4OCFA 1X9SB 3LEFA 5D9WA 4L0WA 2P5RA 5H5RA 2DKIA 4N0ZA 4MF6A 1QUWA 10GSA 3HYPA 2GLRA 5H5SA 1ZYQB 5AIXA 3ERWA 5COHA 5B8BA 4KW6A 3L9VA 5B6MA 3QCPA 1MDIA 4Q5FA 1A8YA 3SBCA 1Y25A 2X8HA 4TR4A 5D9VA 1JZWA 1TXUA 1OAZA 4JBBA 3QAVA 4EVMA 2YJ7A 4G0KA 1FOVA 2VL3A 5DVBA 5CYYA 3VURA 2YPMA 1K0OA 17GSA 2M46A 1ZL9A 4KNDA 4N0VA 1SKSB 2D2ZA 2H0HA 3TB2A 4DEJA 19GSA 2CVDA 1DE2A 4TN8A 4Z2UA 3ME7A 2O5VA 4HQSA 4TXVA 5CREA 3TRPA 2DJ0A 4O5UA 1E6BA 4MZBA 1G6YA 4AGSA 2X8CA 5ID2B 2E0QA 5ECSA 3CSHA 1TW9A 2VM1A 1XVWA 1BG5A 3TOUA 3CWGA 5GAPD 1VF1A 3A2WA 3UBLA 1PN9A 4KCEA 3TU3B 2PUKC 4BPYA 1QQ2A 2RUFA 2G0FA 2DIYA 4AJ7A 1KBNA 5J5NA 2DIZA 3F8UA 2FD3A 2BMXA 2YOIA 3DVXA 4QL9A 3FRCA 2WFCA 1XWGA 1XOBA 1WE0A 5HR1A 3CXGA 4PNFA 3W6GA 5GSTA 3GV1A 1OC8A 5LCZA 1XPVA 5HFGA 1SYRA 4IS0A 5A4VA 1GTUA 2J23A 3LSZA 4BVYA 4GSTA 3KD0A 2PVQA 4Q5QA 3A2VA 1HNBA 2H30A 2AAWA 3M0FA 4HOJA 2NDOA 5ENUA 3TGZA 2C1YA 1TRWA 2DMMA 2YNXA 1U87A 2I81A 2PERA 2CZ2A 1XIYA 1R5PA 2PN8A 2CVBA 2VO4A 4KB3A 3FZ5A 2GSTA 1VRSD 4OFTA 3DIEA 5JWOB 3BD2A 4HJ2A 5D9TA 2MMZA 3H79A 2NTOA 3KIJA 4GSNA 4TW5A 4ZB6A 2VUPA 1BG1A 1B48A 2VIMA 4O92A 5B6NA 2EIRA 2PVOC 1AW9A 3QPMA 1WJKA 4WF4A 3EWLA 2L6CA 2C3NA 2V41A 2O7KA 3U5RE 3FYGA 5D8IA 2WDUA 3O6TA 1TJDA 4F82A 1T3BA 2CA8A 4F0CA 5JWQB 2VLVA 2F8AA 1K0MA 2WZ9A 5IMAA 1DBYA 4KSMA 4ZL9A 4HI7A 3TKSC 1JLVA 4G0IA 2FY6A 1AQXA 2FCHA 2QA2A 4Z7XA 3H8QA 1KEBA 2I3YA 2GS3A 1AXDA 1A2JA 2H1BA 4X1UA 3RPPA 4YKGA 3PINA 3FK8A 4JZQA 4NV2A 1DUGA 1CQGA 2H75A 3QOUA 3APSA 2HSNB 1T4YA 5DQYA 2H0GA 5DALB 5J4YA 2FLSA 2R0GA 2HZEA 1YJ6A 2K9FA 2B5XA 2C0DA 3KZQA 3EU4A 4AI6A 5G5FA 4PQHA 3IAS2 3M9JA 3IK7A 4POLA 1FOHA 4DSSB 4LMWA 3VI5A 3DWVA 1BF5A 1A0FA 3F4TA 2B5EA 4HEA2 4WETA 1ZGNA 2H71A 4O5RA 4USSA 4EUYA 5DCHA 1KNGA 6GSVA 4ML6A 3EU3A 4EF0A 2AUVA 2ZNMA 4N11A 4EO3A 4WBJA 4WEYA 1EZKA 5ECKB 3EMXA 5J4VA 4J2FA 1ERUA 4F0BA 2KUCA 3N5OA 5ELAA 3PH9A 2LRCA 1SD9A 5L71A 2DBCA 3IK9A 1EP7A 5KOWA 2H6ZA 4MPGA 1FAAA 2YWNA 1V57A 4X0XA 2VCXA 1U6TA 1XXUA 3F9UA 4K5RA 2QGVA 4YKFA 1V98A 5KN3A 2DLXA 4HU9A 3R3EA 4G0LA 1TI3A 1XWBA 4J56E 1ZYNA 3UOMA 1ERTA 5EPFA 9GSSA 4MP4A 4LL1B 3VPQA 2P0GA 3F6DA 5BMUB 3HJOA 3ED3A 2BJXA 4MK3A 4FYCA 4IVFA 5ECMB 1GLPA 4BL7B 4NWYA 13GSA 4BVXB 4RI6A 1XWKA 1PQNA 1BQ7A 3US3A 3GTUB 2H0IA 3S9FA 1X9MB 5AIVA 5DAKA 1M2BA 1JHBA 1GSYA 4KAEA 3ZMKA 2L59A 5HFKA 4TXOA 3O76A 2PPTA 3TKQA 5G1KA 4WKWA 2IMFA 3G9BA 5HFIA 1IYIA 2KOKA 4HQZA 1WOUA 4ZB7A 3MDKA 3ZL5A 2C0EA 4MH2A 4BA7A 3GH9A 1Z6NA 5KEJA 5AN1A 1N25A 1O85A 3GL3A 3Q6OA 5A4UA 2CX3A 3A2XA 4I2TA 3C73A 4DSQA 3APOA 1PSQA 4ZIJA 3F3RA 1AQWA 2R37A 1AIUA 5DCGA 2O89A 2V6OA 2L5LA 3BJ5A 1XOAA 2UZ8A 4Q5NA 4PTSA 2JSZA 1G0TA 1RK4A 1YZXA 1MD3A 5ECOB 1U3IA 3FKFA 4NPBA 1OC9A 4K7NA 3V1WA 1EV4A 4XHMA 3MWHA 2I1UA 3WGEA 4MJBA 2H73A 2ZUPA 1SJIA 4ULXA 4AF2A 3RDWA 3Q18A 2DJ3A 4ZB8A 4H86A 1J9BA 2L5OA 4WXTA 4DSRA 2A2RA 1XFLA 1YF1A 2K8VA 2R2JA 5IPGA 1GTIA 1FO5A 1EGOA 3GX0A 1N8JA 2VAFA 4GQFA 3TOTA 2GQMA 1BX9A 1OVNA 3R2QA 5G31A 2JACA 1LU4A 4AKGA 1MDJA 3EMPA 2HXKA 3DYRA 2YJHA 2YWOA 1M2DA 1SL0B 3GN3A 1Y1UA 2PGTA 2MMOA 6GSUA 4MDCA 4LLRA 3FR3A 5FWGA 4ZL8A 2GT5A 2K8SA 1MTCA 2F3MA 3ZIJA 4G19A 1J0FA 1U3AA 1E2YA 2H8LA 1ZYPA 2IFQA 3F4SA 2LKUA 1VF3A 2R0PA 3F3QA 5DBQA 2IJYA 3KP9A 1MDKA 1M7TA 2KP1A 4X4JA 3TKPA 2JZRA 4K7IA 4X43A 5HR0A 3N9JA 4RI7A 4YH2A 3IBHA 5DDLA 3ISOA 1PKWA 2DJ2A 3RPNA 1SD8A 4K2DA 3FMWA 1AAZA 2RUEA 5DJMA 4HZ4A 3P90A 3WGDA 1QXHA 2A2PA 1SK0A 2LQQA 5E59A 5D73A 1BJXA 2HYXA 5D93A 1O6JA 4L5OA 1H4OA 5CP1A 2B1KA 3D22A 4EDYA 2FA4A 4DVCA 1NHYA 5B8AA 1TXXA 2VD1A 5AISA 2WB9A 4IP1A 3GUSA 3ZREA 1JZRA 2OBIA 3GA4A 4MZWA 3LFLA 2FNOA 3VK9A 2DMLA 1T8EB 1GTBA 2ALBA 5KN1A 2O87A 2WJUA 1WP0A 1LBKA 5IO2A 3HA9A 1JZDA 2HT9A 1TKDB 3HJMA 1JLWA 1I5GA 3UBKA 4XS6A 3OR5A 3D4MA 4A5PA 1VGLA 2EC4A 1XWAA 1PN0A 2E2GA 2VD0A 1W4VA 3HZ4A 5IOXA 4LMVA 4K2XA 3I6AA 5EVOA 2R4VA 1GLQA 1PMTA 4AJ6A 14GSA 3A3TA 1X0RA 1XWCA 3KEBA 1R7HA 5CRHA 1Q4JA 2HNLA 1MEKA 2MBTA 4K0NA 3VWVA 3TRQA 4PUFC 1XZOA 2C3TA 3UMAA 5EY6A 2A4VA 2IMDA 5JCWA 2K6VA 4XTSA 5DJLA 4ILFA 3J7Yk 3GX8A 16GSA 1A2LA 2QA1A 5B7CA 5LD0A 1M0UA 3J7Yb 3CSIA 2FWFA 1EV9A 1M2AA 3MYDA 3O3TA 2VM2A 1SK2A 3P2AA 3EVIA 2LV3A 2C0FA 2VCVA 1YY7A 4D73A 1SENA 3IHQA 1TK5B 2K18A 1OE7A 2LEGA 3ERFA 1O8XA 3QDNA 3ZRDA 1GH2A 2XBQA 3KH7A 2O8VB 4MABA 3W8JA 1TP9A 3IE3A 4XS4B 4W66A 2N5BA 3IV4A 4GTUA 2EFHA 2MMNA 2JZTA 2R6KA 1TTZA 2GSSA 3NZNA 1KTEA 4TR1B 4KGIA 3GNJA 3QMXA 3LYPA 5LNKe 2CT6A 4GLTA 2HSMB 3UEMA 4BWSA 4RQXA 3FR6A 3HY2A 1X5EA 3HJPA 1EP8A 2IMKA 1GNWA 1O7UA 5H5QA 3KP8A 4I5QA 3GRXA 1U88A 5A1NB 5JWRB 2X64A 3L9UA 4XS1A 2HRFA 5GZZB 2HLSA 1NM3A 4FQUA 1TU8A 3ERGA 5FT3A 5J4UA 5CRDA 3LYKA 1GWCA 2FHEA 2C0GA 5A5HB 2TRXA 2R0CA 4TOPA 3C1SA 2ON7A 2FWHA 2R5GA 2VKZG 1Z6MA 3IOSA 3KMNA 4OWYA 3GURA 1SKRB 2HRKB 1AQVA 4PQ1A 1EOGA 4K7OA 5ECHB 5BRTA 1FB6A 3ZIVA 2EFDA 5ECNB 4FIWA 1K0CA 3FZ9A 2OE3A 2VL9A 3KM6A 5A34A 4OD7A 4K5SA 3HD5A 4HU7A 4YQUA 3TJFA 1ON4A 2H1GA 5G1LA 5DQSA 4ICYA 5F8BA 5J47A 4EE0A 4GDFA 4CY8A 1F6MC 3GKNA 4IELA 2IPAA 4IKHA 1LJRA 4MCUA 2HZFA 4ZILA 1W89A 2TRCP 3TKRA 1GSUA 2YP6A 3RBTA 2DJKA 2WGRA 4KF9A 2HI7A 4I6XA 2HE3A 2HRNA 3DEXA 1ML6A 4KDXA 3ZVJD 4I97A 2AB6A 4OO4A 3TCOA 4F2IA 5HR3A 3BOAA 3D4TA 2ON5A 3PPUA 2DC5A 4POMA 3L0HA 4ISDA 4KSOA 1PL1A 2GZYA 4OCEA 2XHFA 3FEUA 3AY8A 1URMA 3HZ8A 1C72A 3MSZA 4LA1A 4HS1A 1F3AA 2RIIA 5IMCA 5KN0A 1XBSA 5G2ZA 3VI7A 1DSBA 2E2MA 2PU9C 3VLNA 4IGJA 1ZZYA 3H4KA 4KDUA 6GSTA 2ES7A 2IN3A 3TJJA 3WYWA 1UN2A 3C71A 3QAWA 2N5AA 4E8EA 2EIOA 1WIKA 2GQLA 3EC3A 4EC0A 4OFNA 22GSA 1NHOA 1HYUA 3DD3A 5GSSA 4ZBAA 2F8FA 3D5JA 3QFBC 3KXOA 1K0BA 4JR4A 1THXA 5JCGA 4MA9A 3ZFBA 3Q19A 2H1AA 2RM6A 1X5DA 3LW9A 1FW1A 4GSSA 4EL1A 4J57E 4BVYB 1CQHA 1EEMA 2KHPA 1ILOA 3GIXA 2CAIA 3HDCA 2H66A 4EDZA 1SK1A 4PX1A 2YWMA 2HSHA 2L4QA 3DGQA 1GL8A 5ID2A 2JL4A 5ECPB 3KJYA 5JCUA 3GSTA 3BCIA 3L9SA 1GSFA 3CYNA 4NMUA 1SVMA 2FWEA 2M80A 2VL2A 3K8NA 2CZ3A 3I69A 1SKWB 4MZCA 2RLIA 1AC1A 5F05A 1JFUA 2H1DA 1HD2A 3WT1A 1A0RP 5E4WA 2X49A 4Z2RA 2GVPA 3GH6A 3CRUA 3LJRA 4RUVA 1ERWA 1Z5YE 1PX7A 3UARA 3Q74A 2LQOA 3F0IA 3ZFLA 2EFEA 4O7HA 1YDKA 1OC3A 3EPTA 3D0ZA 3QFAC 2OE0A 1DE1A 2YCDA 4AKHA 4ECJA 1FG4A 3GL5A 4N10A 3RHBA 3FHKA 2R3XA 2H74A 2C4JA 2LRTA 3ZMLA 2C8UA 5ECIB 3BCKA 2V32A 3HVXA 1GTAA 3H1NA 2UV8G 4IBPA 4K8MA 3C1RA 2H01A 4GCIA 2X99A 1M9AA 3TDGA 2H6XA 5HQPA 1PKZA 20GSA 4HUAA 3HXSA 1Z3EA 4XS4A 2NBSA 2CV4A 4GWRA 1V40A 2PBJA 4IJ3A 2KP2A 4Z2TA 1H75A 1GULA 5IQYA 3UL3A 3KTBA 2LRNA 2HZEB 1GRXA 1UA5A 5J40A 1PX6A 1Z7RA 4JRRA 2HSMA 4YQMA 1ABAA 2V6KA 1ERVA 2JU5A 4MH3A 2B7KA 3IC4A 2MYGA 1F37A 2EFCA 3LGCA 3H93A 4JE1A 3MIXA 2M72A 1BYEA 2KLXA 1O8WA 4ZXGA 3EYTA 1SJZA 2P31A 1EOHA 2OT3A 1B9YC 5CO3A 4JR6A 1SU9A 3ME8A 4MJEA 5A5HA 3DRNA 4FO5A 3UVHA 4IQAA 4IW9A 2WCIA 4P3YB 1YEPA 1N2AA 3HKRA 2QSIA 4XIHA 3TRXA 1F9MA 1SL1B 3LXZA 4GXZA 5AGYA 2LS5A 12GSA 2WULA 1HNAA 2HSNA 1PGTA 2VL2C 5EL8A 2X8GA 1PA3A 5DALA 1A8LA 4V1Ap 1EEJA 3APQA 1XW5A 3NIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPF A;  3IDV A;  4PNG A;  1K3L A;  2P5Q A;  3D21 A;  5ECQ B;  2FUG 2;  11GS A;  2AV4 A;  4DSS A;  1O73 A;  3CBU A;  2ZCT A;  2QKE A;  4L5L A;  4WR4 A;  2AHE A;  3M3M A;  2MBS A;  6GSS A;  3DML A;  1F2E A;  4I8B A;  3HCZ A;  4EXJ A;  2WRT A;  2GQK A;  4CW9 A;  6GSX A;  5FHI A;  4XRD A;  1A23 A;  3MNG A;  5HR2 A;  1QFN A;  1TU7 A;  3CTG A;  2O85 A;  1K3Y A;  3G7J A;  3W8S A;  3DKS A;  3ZLP A;  3ZVJ A;  5F06 A;  2LST A;  4IP6 A;  3M1G A;  2XBI A;  1SL2 B;  2YWI A;  2LJK A;  1XVQ A;  1K0A A;  3TKS A;  2YN1 A;  5J41 A;  1GSQ A;  1ZMA A;  5DAK B;  3P7X A;  4TXO B;  1T4Z A;  4NHW A;  1G7O A;  1XW6 A;  4F03 A;  5IMV A;  1V9W A;  1Q98 A;  4JU5 A;  1A24 A;  3KH9 A;  2DJ1 A;  4TRX A;  4NXI A;  4YAP A;  1UVZ A;  3CMI A;  4O32 A;  2PMT A;  3JCM L;  3GKM A;  2FWG A;  3GKX A;  1BAY A;  3LQ7 A;  1FVK A;  5ELG A;  3DXB A;  4FYB A;  3ZIT A;  1A2M A;  5J9B A;  2AJQ B;  2VLT A;  5G30 A;  5BMU A;  2CAQ A;  2MMA A;  3ZYW A;  1GUM A;  3IA1 A;  2NPB A;  3M8N A;  2OE1 A;  1K3O A;  4ZBD A;  4L0U A;  4BL7 A;  1YKA A;  4BVX A;  2GT6 A;  4K9Z A;  4WBR D;  3LOR A;  3GTU A;  4IJI A;  1GSE A;  1M99 A;  4MJA A;  2HSY A;  3E9J B;  4ML1 A;  1F3B A;  4ZBB A;  2WS2 A;  1Y6E A;  1TK8 B;  5IMF A;  4KUN A;  5GAN D;  1IYH A;  2LNT A;  3CSJ A;  2FGX A;  4WF5 A;  5IOW A;  5J9C A;  1OC9 B;  4JED A;  3GFK A;  2EIQ A;  2BTO T;  1THO A;  4E8H A;  1TI1 A;  4RQR A;  1ZCP A;  2VCT A;  4YAV A;  2AYT A;  4PGT A;  1YF0 A;  4NAX A;  1K0N A;  2OJL A;  3FZA A;  4WR5 A;  3QAG A;  1I9D A;  1S3A A;  2H70 A;  2C80 A;  1FVJ A;  3UIW A;  2RM5 A;  4KH7 A;  5CRW A;  1PL2 A;  1GNE A;  1WWJ A;  5INY A;  4I2U A;  4ZL7 A;  4NHZ A;  2L4C A;  4LL4 B;  2H72 A;  1GUK A;  1OKD A;  1K0D A;  5CNW A;  4IQ1 A;  4F9Z A;  4ID0 A;  1ACV A;  3MAK A;  4IHU A;  3VPT A;  1Z7P A;  6GSW A;  3GYK A;  5ECL B;  1MD4 A;  4XCS A;  3GHA A;  2TIR A;  4ACS A;  3UJ1 A;  4GQC A;  2IFQ B;  2V2G A;  2YAN A;  1YQ1 A;  4ECI A;  4XRA A;  8GSS A;  3IR4 A;  3E0U A;  3EUR A;  4CHS A;  3G7I A;  1JZO A;  2JSY A;  5D96 A;  1ST9 A;  2L6D A;  1G7E A;  1V58 A;  1OKT A;  3I9V 2;  1OE8 A;  3IAM 2;  1SYX A;  4G9H A;  1Z9H A;  1HQO A;  2OBK A;  3C8E A;  4ECB A;  2L57 A;  1GUH A;  3QR6 A;  3RAZ A;  4POB A;  3HHV A;  3FY7 A;  5J3R A;  3CTF A;  4BWQ A;  3PR8 A;  2VCW A;  3VFI A;  4GF0 A;  2YZU A;  4V1A g;  1YKC A;  4MF5 A;  4ECC A;  2I4A A;  2B1L A;  2YV7 A;  1TK0 B;  3P8W A;  3FZ4 A;  3KCM A;  5CAX A;  3D6I A;  2JZS A;  4MJC A;  4KE3 A;  1ZOF A;  5A4W A;  1T00 A;  2PWJ A;  2A2S A;  4KDY A;  1R26 A;  1TOF A;  1YEX A;  3SWL A;  3HVV A;  1BED A;  4AJ8 A;  1PD2 1;  4G2E A;  2VLU A;  4MMM A;  4V2N A;  1B8X A;  4PQI A;  3F6F A;  5F07 A;  4PUA A;  3NOF A;  1S3D A;  4GRF A;  2Z9S A;  5KN2 A;  5IMZ A;  2G2Q A;  4TVE A;  1T1V A;  3KGK A;  2DJJ A;  3IC8 A;  1M9B A;  3UAP A;  1V2A A;  4EKZ A;  2OKA A;  2H76 A;  3PGT A;  2REM A;  2HRA A;  2CVK A;  4OFM A;  3FW2 A;  1RW1 A;  2IME A;  1PRX A;  1AUC A;  4N30 A;  1XCC A;  1S3C A;  1QGV A;  4POK A;  4QQ7 A;  5IM9 A;  1EWX A;  3HVS A;  3TKS E;  3VWW A;  4G10 A;  2OAC A;  5IMD A;  3M9K A;  2NVL A;  1TRS A;  4K1F A;  3A5W A;  1G6W A;  1VF2 A;  4OMV A;  1QMV A;  3EIN A;  3TUE A;  3U6V A;  4KA0 A;  1QK8 A;  1WMJ A;  4FYU A;  2LJA A;  18GS A;  4OO5 A;  2GSR A;  4PXO A;  3F4R A;  1R5A A;  1T7P B;  1RQM A;  2MZC A;  4HJM A;  2YV9 A;  1UC7 A;  2J9H A;  4D73 B;  3WD6 A;  3VWU A;  3C7M A;  1OYJ A;  2IL3 A;  5D9X A;  3EE2 A;  1USB A;  4L8E A;  2F51 A;  2GZP A;  2H6Y A;  1TDI A;  2XPD A;  1GSD A;  5C04 A;  4YQV A;  6GSY A;  5IPH A;  4ZB9 A;  1NSW A;  2GSQ A;  4HZ2 A;  3TJK A;  2IWT A;  7GSS A;  3QD9 A;  2LNS A;  4TR3 A;  2OA7 A;  2CX4 A;  3ZZX A;  4NV5 A;  4KX4 A;  3IRA A;  2FA8 A;  3RHC A;  3KTL A;  2H19 A;  3I43 A;  2F9S A;  1FB0 A;  2IIY A;  5ABR A;  3ZTL A;  4IN0 A;  3TJG A;  3WT2 A;  3CRT A;  2V1M A;  5ECR B;  4MF7 A;  1FHE A;  4FH8 A;  3UVT A;  3VWX A;  4V2L A;  3FR9 A;  1B4P A;  1WPI A;  1EGR A;  3F63 A;  2VOC A;  2B6M A;  2HQT A;  3DVW A;  4V2M A;  1J08 A;  2VCQ A;  2LUS A;  1GSS A;  5A5K A;  1R4W A;  2B5Y A;  2I9H A;  3E3E A;  3LXT A;  5C00 A;  5G5E A;  2B7J A;  2N5F A;  4PUR A;  1NW2 A;  2DSA A;  5IIZ A;  3L78 A;  4TR1 A;  1VF4 A;  2OAD A;  4KCA A;  2C3Q A;  1X9W B;  5F0G A;  3LWA A;  2CQ9 A;  2B3S A;  1B4Q A;  3KMO A;  2GDR A;  2JAD A;  4TR0 A;  1XW9 A;  2E7P A;  2HFD A;  3L4N A;  5IO0 A;  2QC7 A;  1O81 A;  3LG6 A;  1GP1 A;  4CDO A;  2LJR A;  3TJB A;  4K6X A;  3IXR A;  1B9X C;  2VCZ A;  3BBY A;  1SJ6 A;  3GKK A;  3WGX A;  1X5C A;  2XC2 A;  4HDE A;  4TKY A;  4MLY A;  4QL7 A;  1TRV A;  5CRG A;  4Q5R A;  3GMF A;  3IPZ A;  1HNC A;  1ZYE A;  1WRY A;  2HRK A;  2GZZ A;  3GSS A;  2GTU A;  2IMI A;  2YZH A;  3G7Y A;  2GGT A;  1TRU A;  4K0G A;  2XPE A;  2LTK A;  4OCF A;  1X9S B;  3LEF A;  5D9W A;  4L0W A;  2P5R A;  5H5R A;  4N0Z A;  4MF6 A;  1QUW A;  10GS A;  3HYP A;  2GLR A;  5H5S A;  1ZYQ B;  5AIX A;  3ERW A;  5COH A;  5B8B A;  4KW6 A;  3L9V A;  5B6M A;  3QCP A;  1MDI A;  4Q5F A;  1A8Y A;  3SBC A;  1Y25 A;  2X8H A;  4TR4 A;  5D9V A;  1JZW A;  1OAZ A;  4JBB A;  3QAV A;  4EVM A;  2YJ7 A;  4G0K A;  1FOV A;  2VL3 A;  5DVB A;  5CYY A;  3VUR A;  2YPM A;  1K0O A;  17GS A;  2M46 A;  1ZL9 A;  4KND A;  4N0V A;  1SKS B;  2D2Z A;  2H0H A;  3TB2 A;  4DEJ A;  19GS A;  2CVD A;  1DE2 A;  4TN8 A;  3ME7 A;  4HQS A;  4TXV A;  5CRE A;  3TRP A;  2DJ0 A;  1E6B A;  4MZB A;  1G6Y A;  4AGS A;  2X8C A;  5ID2 B;  2E0Q A;  5ECS A;  3CSH A;  1TW9 A;  2VM1 A;  1XVW A;  1BG5 A;  3TOU A;  5GAP D;  1VF1 A;  3A2W A;  3UBL A;  1PN9 A;  4KCE A;  2PUK C;  4BPY A;  1QQ2 A;  2RUF A;  2G0F A;  2DIY A;  4AJ7 A;  1KBN A;  5J5N A;  2DIZ A;  3F8U A;  2FD3 A;  2BMX A;  2YOI A;  3DVX A;  4QL9 A;  3FRC A;  2WFC A;  1XWG A;  1XOB A;  1WE0 A;  5HR1 A;  3CXG A;  4PNF A;  3W6G A;  5GST A;  3GV1 A;  1OC8 A;  5LCZ A;  1XPV A;  5HFG A;  1SYR A;  4IS0 A;  5A4V A;  1GTU A;  2J23 A;  3LSZ A;  4BVY A;  4GST A;  3KD0 A;  2PVQ A;  4Q5Q A;  3A2V A;  1HNB A;  2H30 A;  2AAW A;  3M0F A;  4HOJ A;  2NDO A;  5ENU A;  3TGZ A;  2C1Y A;  1TRW A;  2DMM A;  2YNX A;  1U87 A;  2I81 A;  2PER A;  2CZ2 A;  1XIY A;  1R5P A;  2PN8 A;  2CVB A;  2VO4 A;  4KB3 A;  3FZ5 A;  2GST A;  1VRS D;  4OFT A;  3DIE A;  5JWO B;  3BD2 A;  4HJ2 A;  5D9T A;  2MMZ A;  3H79 A;  2NTO A;  3KIJ A;  4GSN A;  4TW5 A;  4ZB6 A;  2VUP A;  1B48 A;  2VIM A;  4O92 A;  5B6N A;  2EIR A;  2PVO C;  1AW9 A;  3QPM A;  1WJK A;  4WF4 A;  3EWL A;  2L6C A;  2C3N A;  2V41 A;  2O7K A;  3U5R E;  3FYG A;  5D8I A;  2WDU A;  3O6T A;  1TJD A;  4F82 A;  1T3B A;  2CA8 A;  4F0C A;  5JWQ B;  2VLV A;  2F8A A;  1K0M A;  2WZ9 A;  5IMA A;  1DBY A;  4KSM A;  4ZL9 A;  4HI7 A;  3TKS C;  1JLV A;  4G0I A;  2FY6 A;  1AQX A;  2FCH A;  4Z7X A;  3H8Q A;  1KEB A;  2I3Y A;  2GS3 A;  1AXD A;  1A2J A;  2H1B A;  4X1U A;  3RPP A;  3PIN A;  3FK8 A;  4JZQ A;  4NV2 A;  1DUG A;  1CQG A;  2H75 A;  3QOU A;  3APS A;  2HSN B;  1T4Y A;  5DQY A;  2H0G A;  5DAL B;  2FLS A;  2HZE A;  1YJ6 A;  2K9F A;  2B5X A;  2C0D A;  3KZQ A;  3EU4 A;  5G5F A;  4PQH A;  3IAS 2;  3M9J A;  3IK7 A;  4POL A;  4DSS B;  4LMW A;  3VI5 A;  3DWV A;  1A0F A;  3F4T A;  2B5E A;  4HEA 2;  4WET A;  1ZGN A;  2H71 A;  4O5R A;  4USS A;  4EUY A;  5DCH A;  1KNG A;  6GSV A;  4ML6 A;  3EU3 A;  4EF0 A;  2AUV A;  2ZNM A;  4N11 A;  4EO3 A;  4WBJ A;  4WEY A;  1EZK A;  5ECK B;  3EMX A;  4J2F A;  1ERU A;  4F0B A;  2KUC A;  3N5O A;  5ELA A;  3PH9 A;  2LRC A;  1SD9 A;  5L71 A;  2DBC A;  3IK9 A;  1EP7 A;  2H6Z A;  4MPG A;  1FAA A;  2YWN A;  1V57 A;  4X0X A;  2VCX A;  1U6T A;  1XXU A;  3F9U A;  2QGV A;  1V98 A;  5KN3 A;  2DLX A;  4HU9 A;  3R3E A;  4G0L A;  1TI3 A;  1XWB A;  4J56 E;  3UOM A;  1ERT A;  5EPF A;  9GSS A;  4MP4 A;  4LL1 B;  3VPQ A;  2P0G A;  3F6D A;  3HJO A;  3ED3 A;  2BJX A;  4MK3 A;  4FYC A;  4IVF A;  5ECM B;  1GLP A;  4BL7 B;  4NWY A;  13GS A;  4BVX B;  4RI6 A;  1XWK A;  1PQN A;  1BQ7 A;  3US3 A;  3GTU B;  2H0I A;  3S9F A;  1X9M B;  5AIV A;  5DAK A;  1M2B A;  1JHB A;  1GSY A;  4KAE A;  3ZMK A;  2L59 A;  5HFK A;  4TXO A;  3O76 A;  2PPT A;  3TKQ A;  5G1K A;  4WKW A;  2IMF A;  3G9B A;  5HFI A;  1IYI A;  2KOK A;  4HQZ A;  1WOU A;  3MDK A;  3ZL5 A;  2C0E A;  4MH2 A;  4BA7 A;  3GH9 A;  1Z6N A;  5KEJ A;  5AN1 A;  1O85 A;  3GL3 A;  3Q6O A;  5A4U A;  2CX3 A;  3A2X A;  4I2T A;  3C73 A;  4DSQ A;  3APO A;  1PSQ A;  4ZIJ A;  3F3R A;  1AQW A;  2R37 A;  1AIU A;  5DCG A;  2O89 A;  2V6O A;  2L5L A;  3BJ5 A;  1XOA A;  2UZ8 A;  4Q5N A;  4PTS A;  2JSZ A;  1G0T A;  1RK4 A;  1YZX A;  1MD3 A;  5ECO B;  1U3I A;  3FKF A;  4NPB A;  1OC9 A;  4K7N A;  3V1W A;  1EV4 A;  4XHM A;  3MWH A;  2I1U A;  3WGE A;  4MJB A;  2H73 A;  2ZUP A;  1SJI A;  4ULX A;  4AF2 A;  3RDW A;  3Q18 A;  2DJ3 A;  4ZB8 A;  4H86 A;  1J9B A;  2L5O A;  4WXT A;  4DSR A;  2A2R A;  1XFL A;  1YF1 A;  2K8V A;  2R2J A;  5IPG A;  1GTI A;  1FO5 A;  1EGO A;  3GX0 A;  1N8J A;  2VAF A;  4GQF A;  3TOT A;  2GQM A;  1BX9 A;  1OVN A;  3R2Q A;  5G31 A;  2JAC A;  1LU4 A;  1MDJ A;  3EMP A;  2HXK A;  3DYR A;  2YJH A;  2YWO A;  1M2D A;  1SL0 B;  3GN3 A;  2PGT A;  2MMO A;  6GSU A;  4MDC A;  4LLR A;  3FR3 A;  5FWG A;  4ZL8 A;  2GT5 A;  2K8S A;  1MTC A;  2F3M A;  3ZIJ A;  4G19 A;  1J0F A;  1U3A A;  1E2Y A;  2H8L A;  2IFQ A;  3F4S A;  2LKU A;  1VF3 A;  3F3Q A;  5DBQ A;  2IJY A;  3KP9 A;  1MDK A;  1M7T A;  2KP1 A;  3TKP A;  2JZR A;  4K7I A;  4X43 A;  5HR0 A;  3N9J A;  4RI7 A;  4YH2 A;  3IBH A;  5DDL A;  3ISO A;  1PKW A;  2DJ2 A;  3RPN A;  1SD8 A;  4K2D A;  1AAZ A;  2RUE A;  5DJM A;  4HZ4 A;  3P90 A;  3WGD A;  1QXH A;  1SK0 A;  2LQQ A;  5E59 A;  5D73 A;  1BJX A;  2HYX A;  5D93 A;  1O6J A;  4L5O A;  1H4O A;  5CP1 A;  2B1K A;  3D22 A;  4EDY A;  2FA4 A;  4DVC A;  1NHY A;  5B8A A;  1TXX A;  2VD1 A;  5AIS A;  2WB9 A;  4IP1 A;  3GUS A;  3ZRE A;  1JZR A;  2OBI A;  3GA4 A;  4MZW A;  3LFL A;  2FNO A;  3VK9 A;  2DML A;  1T8E B;  1GTB A;  2ALB A;  5KN1 A;  2O87 A;  2WJU A;  1WP0 A;  1LBK A;  5IO2 A;  3HA9 A;  1JZD A;  2HT9 A;  1TKD B;  3HJM A;  1JLW A;  1I5G A;  3UBK A;  4XS6 A;  3OR5 A;  3D4M A;  1VGL A;  2EC4 A;  1XWA A;  2E2G A;  2VD0 A;  1W4V A;  3HZ4 A;  5IOX A;  4LMV A;  3I6A A;  5EVO A;  2R4V A;  1GLQ A;  1PMT A;  4AJ6 A;  14GS A;  3A3T A;  1X0R A;  1XWC A;  3KEB A;  1R7H A;  5CRH A;  1Q4J A;  2HNL A;  1MEK A;  2MBT A;  4K0N A;  3VWV A;  3TRQ A;  4PUF C;  1XZO A;  2C3T A;  3UMA A;  5EY6 A;  2A4V A;  2IMD A;  5JCW A;  2K6V A;  4XTS A;  5DJL A;  4ILF A;  3J7Y k;  3GX8 A;  16GS A;  1A2L A;  5B7C A;  5LD0 A;  1M0U A;  3J7Y b;  3CSI A;  2FWF A;  1EV9 A;  1M2A A;  3O3T A;  2VM2 A;  1SK2 A;  3P2A A;  3EVI A;  2LV3 A;  2C0F A;  2VCV A;  1YY7 A;  4D73 A;  1SEN A;  3IHQ A;  1TK5 B;  2K18 A;  1OE7 A;  2LEG A;  3ERF A;  1O8X A;  3QDN A;  3ZRD A;  1GH2 A;  2XBQ A;  3KH7 A;  2O8V B;  4MAB A;  3W8J A;  1TP9 A;  3IE3 A;  4XS4 B;  2N5B A;  3IV4 A;  4GTU A;  2MMN A;  2JZT A;  2R6K A;  1TTZ A;  2GSS A;  3NZN A;  1KTE A;  4TR1 B;  4KGI A;  3GNJ A;  3QMX A;  3LYP A;  5LNK e;  2CT6 A;  4GLT A;  2HSM B;  3UEM A;  4BWS A;  4RQX A;  3FR6 A;  3HY2 A;  1X5E A;  3HJP A;  1EP8 A;  2IMK A;  1GNW A;  1O7U A;  5H5Q A;  3KP8 A;  4I5Q A;  3GRX A;  1U88 A;  5JWR B;  2X64 A;  3L9U A;  4XS1 A;  2HRF A;  5GZZ B;  2HLS A;  1NM3 A;  4FQU A;  1TU8 A;  3ERG A;  5FT3 A;  5J4U A;  5CRD A;  3LYK A;  1GWC A;  2FHE A;  2C0G A;  2TRX A;  4TOP A;  3C1S A;  2ON7 A;  2FWH A;  2R5G A;  1Z6M A;  3IOS A;  3KMN A;  4OWY A;  3GUR A;  1SKR B;  2HRK B;  1AQV A;  4PQ1 A;  1EOG A;  4K7O A;  5ECH B;  1FB6 A;  3ZIV A;  5ECN B;  4FIW A;  1K0C A;  3FZ9 A;  2OE3 A;  2VL9 A;  3KM6 A;  4OD7 A;  3HD5 A;  4HU7 A;  4YQU A;  3TJF A;  1ON4 A;  2H1G A;  5G1L A;  5DQS A;  5F8B A;  4EE0 A;  1F6M C;  3GKN A;  4IEL A;  2IPA A;  4IKH A;  1LJR A;  4MCU A;  2HZF A;  4ZIL A;  1W89 A;  2TRC P;  3TKR A;  1GSU A;  2YP6 A;  3RBT A;  2DJK A;  2WGR A;  4KF9 A;  2HI7 A;  4I6X A;  2HE3 A;  2HRN A;  3DEX A;  1ML6 A;  4KDX A;  3ZVJ D;  4I97 A;  2AB6 A;  4OO4 A;  3TCO A;  4F2I A;  5HR3 A;  3BOA A;  3D4T A;  2ON5 A;  3PPU A;  2DC5 A;  4POM A;  3L0H A;  4ISD A;  4KSO A;  1PL1 A;  2GZY A;  4OCE A;  2XHF A;  3FEU A;  3AY8 A;  1URM A;  3HZ8 A;  1C72 A;  3MSZ A;  4LA1 A;  4HS1 A;  1F3A A;  2RII A;  5IMC A;  5KN0 A;  1XBS A;  5G2Z A;  3VI7 A;  1DSB A;  2E2M A;  2PU9 C;  3VLN A;  4IGJ A;  1ZZY A;  3H4K A;  4KDU A;  6GST A;  2ES7 A;  2IN3 A;  3TJJ A;  3WYW A;  1UN2 A;  3C71 A;  3QAW A;  2N5A A;  4E8E A;  2EIO A;  1WIK A;  2GQL A;  3EC3 A;  4EC0 A;  4OFN A;  22GS A;  1NHO A;  1HYU A;  3DD3 A;  5GSS A;  4ZBA A;  2F8F A;  3D5J A;  3QFB C;  3KXO A;  1K0B A;  4JR4 A;  1THX A;  5JCG A;  4MA9 A;  3ZFB A;  3Q19 A;  2H1A A;  2RM6 A;  1X5D A;  1FW1 A;  4GSS A;  4EL1 A;  4J57 E;  4BVY B;  1CQH A;  1EEM A;  2KHP A;  1ILO A;  3GIX A;  2CAI A;  3HDC A;  2H66 A;  4EDZ A;  1SK1 A;  4PX1 A;  2YWM A;  2HSH A;  2L4Q A;  3DGQ A;  1GL8 A;  5ID2 A;  2JL4 A;  5ECP B;  3KJY A;  5JCU A;  3GST A;  3BCI A;  3L9S A;  1GSF A;  3CYN A;  4NMU A;  2FWE A;  2M80 A;  2VL2 A;  3K8N A;  2CZ3 A;  3I69 A;  1SKW B;  4MZC A;  2RLI A;  1AC1 A;  5F05 A;  1JFU A;  2H1D A;  1HD2 A;  3WT1 A;  1A0R P;  5E4W A;  2GVP A;  3GH6 A;  3CRU A;  3LJR A;  4RUV A;  1ERW A;  1Z5Y E;  1PX7 A;  3UAR A;  3Q74 A;  2LQO A;  3F0I A;  3ZFL A;  4O7H A;  1YDK A;  1OC3 A;  3D0Z A;  3QFA C;  2OE0 A;  1DE1 A;  2YCD A;  4ECJ A;  1FG4 A;  3GL5 A;  4N10 A;  3RHB A;  3FHK A;  2R3X A;  2H74 A;  2C4J A;  2LRT A;  3ZML A;  2C8U A;  5ECI B;  3BCK A;  2V32 A;  3HVX A;  1GTA A;  3H1N A;  4IBP A;  4K8M A;  3C1R A;  2H01 A;  4GCI A;  2X99 A;  1M9A A;  3TDG A;  2H6X A;  5HQP A;  1PKZ A;  20GS A;  4HUA A;  3HXS A;  1Z3E A;  4XS4 A;  2NBS A;  2CV4 A;  4GWR A;  1V40 A;  2PBJ A;  4IJ3 A;  2KP2 A;  1H75 A;  1GUL A;  5IQY A;  3UL3 A;  3KTB A;  2LRN A;  2HZE B;  1GRX A;  1UA5 A;  1PX6 A;  1Z7R A;  4JRR A;  2HSM A;  4YQM A;  1ABA A;  2V6K A;  1ERV A;  2JU5 A;  4MH3 A;  2B7K A;  3IC4 A;  2MYG A;  1F37 A;  3LGC A;  3H93 A;  4JE1 A;  2M72 A;  1BYE A;  2KLX A;  1O8W A;  4ZXG A;  3EYT A;  1SJZ A;  2P31 A;  1EOH A;  1B9Y C;  5CO3 A;  4JR6 A;  1SU9 A;  3ME8 A;  4MJE A;  3DRN A;  4FO5 A;  3UVH A;  4IQA A;  4IW9 A;  2WCI A;  4P3Y B;  1YEP A;  1N2A A;  3HKR A;  2QSI A;  4XIH A;  3TRX A;  1F9M A;  1SL1 B;  3LXZ A;  4GXZ A;  5AGY A;  2LS5 A;  12GS A;  2WUL A;  1HNA A;  1PGT A;  2VL2 C;  5EL8 A;  2X8G A;  1PA3 A;  5DAL A;  1A8L A;  4V1A p;  1EEJ A;  3APQ A;  1XW5 A;  3NIV A; 
#chains in the Genus database with same CATH topology
 4MPF A;  4CY6 A;  3IDV A;  4PNG A;  1K3L A;  2P5Q A;  3D21 A;  5ECQ B;  2FUG 2;  11GS A;  2AV4 A;  4DSS A;  1O73 A;  3CBU A;  2ZCT A;  2QKE A;  4L5L A;  4WR4 A;  2AHE A;  3M3M A;  2MBS A;  6GSS A;  3DML A;  1F2E A;  4I8B A;  3HCZ A;  4EXJ A;  2WRT A;  2GQK A;  4CW9 A;  6GSX A;  1SVO A;  5FHI A;  4XRD A;  1A23 A;  3MNG A;  5HR2 A;  1QFN A;  1TU7 A;  3CTG A;  2O85 A;  3A5I A;  1K3Y A;  3G7J A;  3W8S A;  2A4H A;  3DKS A;  3ZLP A;  3ZVJ A;  5F06 A;  2LST A;  4IP6 A;  3M1G A;  2XBI A;  1SL2 B;  3HMJ G;  2YWI A;  2LJK A;  1XVQ A;  1K0A A;  3TKS A;  2YN1 A;  5J41 A;  1GSQ A;  1ZMA A;  5DAK B;  3P7X A;  4TXO B;  1T4Z A;  4NHW A;  1G7O A;  1XW6 A;  4F03 A;  5IMV A;  1V9W A;  1Q98 A;  4JU5 A;  1A24 A;  3KH9 A;  2O36 A;  2DJ1 A;  4TRX A;  4NXI A;  4YAP A;  1UVZ A;  3CMI A;  4O32 A;  2PMT A;  3JCM L;  3GKM A;  2FWG A;  4N3Z A;  3GKX A;  1BAY A;  3LQ7 A;  1FVK A;  5ELG A;  1SVL A;  3DXB A;  4FYB A;  3ZIT A;  1A2M A;  5J9B A;  2AJQ B;  2VLT A;  5G30 A;  5BMU A;  2CAQ A;  2MMA A;  3ZYW A;  1GUM A;  3IA1 A;  2NPB A;  3M8N A;  2OE1 A;  1K3O A;  4ZBD A;  4L0U A;  4BL7 A;  1YKA A;  4BVX A;  2GT6 A;  4K9Z A;  4WBR D;  4BIK A;  3LOR A;  3GTU A;  4IJI A;  1GSE A;  1M99 A;  4MJA A;  2HSY A;  3E9J B;  4ML1 A;  1F3B A;  4ZBB A;  2WS2 A;  1Y6E A;  1TK8 B;  5IMF A;  4KUN A;  2X4A A;  5GAN D;  1IYH A;  2LNT A;  3CSJ A;  2FGX A;  1PFO A;  4WF5 A;  5IOW A;  4PHZ C;  5J9C A;  1OC9 B;  4PI2 C;  4JED A;  3GFK A;  2EIQ A;  2BTO T;  1THO A;  4E8H A;  1TI1 A;  4RQR A;  1ZCP A;  2VCT A;  4YAV A;  2AYT A;  4PGT A;  1YF0 A;  4NAX A;  1K0N A;  2OJL A;  3FZA A;  4WR5 A;  3QAG A;  1I9D A;  1S3A A;  2H70 A;  2C80 A;  1FVJ A;  3UIW A;  2RM5 A;  4KH7 A;  5CRW A;  1PL2 A;  1GNE A;  1WWJ A;  5INY A;  4I2U A;  4ZL7 A;  4NHZ A;  2L4C A;  4LL4 B;  4O5Q A;  2H72 A;  1GUK A;  1OKD A;  1K0D A;  5CNW A;  4IQ1 A;  4F9Z A;  4ID0 A;  4AKX B;  1ACV A;  3MAK A;  4IHU A;  3VPT A;  2H1L A;  1Z7P A;  6GSW A;  3GYK A;  5ECL B;  1MD4 A;  4XCS A;  4EIQ A;  3GHA A;  2TIR A;  4ACS A;  3UJ1 A;  4GQC A;  2IFQ B;  2V2G A;  2YAN A;  1YQ1 A;  4ECI A;  4XRA A;  8GSS A;  3IR4 A;  3E0U A;  3EUR A;  4CHS A;  3G7I A;  1JZO A;  2JSY A;  5D96 A;  1ST9 A;  2L6D A;  1G7E A;  1V58 A;  1OKT A;  3I9V 2;  1OE8 A;  3IAM 2;  1SYX A;  4G9H A;  1Z9H A;  4QMK A;  1HQO A;  2OBK A;  3C8E A;  4ECB A;  2L57 A;  1GUH A;  3QR6 A;  3RAZ A;  4POB A;  3IHG A;  3HHV A;  3FY7 A;  5J3R A;  3CTF A;  4BWQ A;  3PR8 A;  2VCW A;  4AKI A;  3VFI A;  4GF0 A;  2YZU A;  4V1A g;  1YKC A;  4MF5 A;  4ECC A;  2I4A A;  2B1L A;  2YV7 A;  5KOX A;  1TK0 B;  3P8W A;  3FZ4 A;  3KCM A;  5CAX A;  4EIP A;  3D6I A;  2JZS A;  4MJC A;  4KE3 A;  1ZOF A;  5A4W A;  1T00 A;  2PWJ A;  2A2S A;  4KDY A;  1R26 A;  1TOF A;  1YEX A;  3SWL A;  3HVV A;  1BED A;  4AJ8 A;  1PD2 1;  4G2E A;  2VLU A;  4MNN A;  4MMM A;  4V2N A;  1B8X A;  4PQI A;  3F6F A;  5F07 A;  4PUA A;  3NOF A;  1S3D A;  4GRF A;  2Z9S A;  5KN2 A;  5IMZ A;  2G2Q A;  4TVE A;  1T1V A;  3KGK A;  2DJJ A;  3IC8 A;  1M9B A;  3UAP A;  4E68 A;  1V2A A;  4EKZ A;  2OKA A;  2H76 A;  3PGT A;  2REM A;  2HRA A;  2CVK A;  4OFM A;  3FW2 A;  1RW1 A;  2IME A;  1PRX A;  1AUC A;  4N30 A;  1XCC A;  1YVL A;  1S3C A;  1QGV A;  4POK A;  4QQ7 A;  5IM9 A;  1EWX A;  3HVS A;  3TKS E;  3VWW A;  4G10 A;  2OAC A;  5IMD A;  3M9K A;  2NVL A;  1TRS A;  4K1F A;  3A5W A;  1G6W A;  1VF2 A;  4OMV A;  1QMV A;  3EIN A;  3TUE A;  3U6V A;  4KA0 A;  1QK8 A;  1WMJ A;  2LJA A;  18GS A;  4FYU A;  4OO5 A;  2GSR A;  4PXO A;  3F4R A;  1R5A A;  1T7P B;  1RQM A;  2MZC A;  4HJM A;  2YV9 A;  1UC7 A;  2J9H A;  4D73 B;  3WD6 A;  2WVY A;  3VWU A;  3C7M A;  1OYJ A;  2IL3 A;  5D9X A;  3EE2 A;  1USB A;  4L8E A;  2F51 A;  2GZP A;  2H6Y A;  1TDI A;  2XPD A;  1GSD A;  5C04 A;  4YQV A;  6GSY A;  5IPH A;  4ZB9 A;  1NSW A;  2GSQ A;  4HZ2 A;  3TJK A;  2IWT A;  7GSS A;  3QD9 A;  2LNS A;  4TR3 A;  2OA7 A;  2CX4 A;  3ZZX A;  4NV5 A;  4KX4 A;  1YEW C;  3IRA A;  2FA8 A;  3RHC A;  3KTL A;  2H19 A;  3I43 A;  2F9S A;  1FB0 A;  2IIY A;  5ABR A;  3ZTL A;  4IN0 A;  3TJG A;  3WT2 A;  3CRT A;  2V1M A;  5ECR B;  4MF7 A;  1FHE A;  4FH8 A;  3UVT A;  3VWX A;  4V2L A;  3FR9 A;  1B4P A;  1WPI A;  1EGR A;  3F63 A;  2VOC A;  2B6M A;  2HQT A;  2O3E A;  3DVW A;  4V2M A;  1J08 A;  2VCQ A;  2LUS A;  1GSS A;  5A5K A;  1R4W A;  2B5Y A;  2I9H A;  3E3E A;  3LXT A;  5C00 A;  5G5E A;  2B7J A;  2N5F A;  4PUR A;  1NW2 A;  2DSA A;  5IIZ A;  3L78 A;  4TR1 A;  1VF4 A;  2OAD A;  4KCA A;  2C3Q A;  1X9W B;  5F0G A;  3LWA A;  5A34 B;  2CQ9 A;  2B3S A;  1B4Q A;  3KMO A;  2GDR A;  2JAD A;  4TR0 A;  1XW9 A;  2E7P A;  5A1N A;  2HFD A;  3L4N A;  5IO0 A;  2QC7 A;  1O81 A;  3LG6 A;  1GP1 A;  4CDO A;  2LJR A;  3TJB A;  4K6X A;  3IXR A;  1B9X C;  2VCZ A;  3BBY A;  1SJ6 A;  2DKH A;  3GKK A;  3WGX A;  1X5C A;  2XC2 A;  4HDE A;  4TKY A;  4MLY A;  4QL7 A;  1TRV A;  5CRG A;  4Q5R A;  3GMF A;  3IPZ A;  1HNC A;  1ZYE A;  1WRY A;  2HRK A;  2GZZ A;  3GSS A;  2GTU A;  2IMI A;  2YZH A;  3G7Y A;  2GGT A;  1TRU A;  4G01 A;  4K0G A;  2XPE A;  2LTK A;  4OCF A;  1X9S B;  3LEF A;  5D9W A;  4L0W A;  2P5R A;  5H5R A;  2DKI A;  4N0Z A;  4MF6 A;  1QUW A;  10GS A;  3HYP A;  2GLR A;  5H5S A;  1ZYQ B;  5AIX A;  3ERW A;  5COH A;  5B8B A;  4KW6 A;  1M3J A;  3L9V A;  5B6M A;  3QCP A;  1MDI A;  4Q5F A;  1A8Y A;  3SBC A;  1Y25 A;  2X8H A;  4TR4 A;  5D9V A;  1JZW A;  1TXU A;  1OAZ A;  4JBB A;  3QAV A;  4EVM A;  2YJ7 A;  4G0K A;  4PI0 C;  1FOV A;  2VL3 A;  5DVB A;  5CYY A;  3VUR A;  2YPM A;  1K0O A;  17GS A;  2M46 A;  1ZL9 A;  4KND A;  4N0V A;  1SKS B;  2D2Z A;  2H0H A;  3TB2 A;  4DEJ A;  19GS A;  2CVD A;  1DE2 A;  4TN8 A;  4Z2U A;  3ME7 A;  2O5V A;  4HQS A;  4TXV A;  5CRE A;  3TRP A;  2DJ0 A;  4O5U A;  1E6B A;  4MZB A;  1G6Y A;  4AGS A;  2X8C A;  5ID2 B;  2E0Q A;  5ECS A;  3CSH A;  1TW9 A;  2VM1 A;  1XVW A;  1BG5 A;  3TOU A;  3CWG A;  5GAP D;  1VF1 A;  3A2W A;  3UBL A;  1PN9 A;  4KCE A;  3TU3 B;  2PUK C;  4BPY A;  1QQ2 A;  2RUF A;  2G0F A;  2DIY A;  4AJ7 A;  1KBN A;  5J5N A;  2DIZ A;  3F8U A;  2FD3 A;  2BMX A;  2YOI A;  3DVX A;  4QL9 A;  3FRC A;  2WFC A;  1XWG A;  1XOB A;  1WE0 A;  5HR1 A;  3CXG A;  4PNF A;  3W6G A;  5GST A;  3GV1 A;  1OC8 A;  5LCZ A;  1XPV A;  5HFG A;  1SYR A;  4IS0 A;  5A4V A;  1GTU A;  2J23 A;  3LSZ A;  4BVY A;  4GST A;  3KD0 A;  2PVQ A;  4Q5Q A;  3A2V A;  1HNB A;  2H30 A;  2AAW A;  3CQF A;  3M0F A;  4HOJ A;  2NDO A;  5ENU A;  3TGZ A;  2C1Y A;  1TRW A;  2DMM A;  2YNX A;  1U87 A;  2I81 A;  2PER A;  2CZ2 A;  1XIY A;  1R5P A;  2PN8 A;  2CVB A;  2VO4 A;  4KB3 A;  3FZ5 A;  2GST A;  1VRS D;  4OFT A;  3DIE A;  5JWO B;  3BD2 A;  4HJ2 A;  5D9T A;  2MMZ A;  3H79 A;  2NTO A;  3KIJ A;  4GSN A;  4TW5 A;  4ZB6 A;  2VUP A;  1BG1 A;  1B48 A;  2VIM A;  4O92 A;  5B6N A;  2EIR A;  2PVO C;  1AW9 A;  3QPM A;  1WJK A;  4WF4 A;  3EWL A;  2L6C A;  2C3N A;  2V41 A;  2O7K A;  3U5R E;  3FYG A;  5D8I A;  2WDU A;  3O6T A;  1TJD A;  4F82 A;  1T3B A;  2CA8 A;  4F0C A;  5JWQ B;  2VLV A;  2F8A A;  1K0M A;  2WZ9 A;  5IMA A;  1DBY A;  4KSM A;  4ZL9 A;  4HI7 A;  3TKS C;  1JLV A;  4G0I A;  2FY6 A;  1AQX A;  2FCH A;  2QA2 A;  4Z7X A;  3H8Q A;  1KEB A;  2I3Y A;  2GS3 A;  1AXD A;  1A2J A;  2H1B A;  4X1U A;  3RPP A;  4YKG A;  3PIN A;  3FK8 A;  4JZQ A;  4NV2 A;  1DUG A;  1CQG A;  2H75 A;  3QOU A;  2WZS A;  3APS A;  2HSN B;  1T4Y A;  5DQY A;  2H0G A;  5DAL B;  5J4Y A;  2FLS A;  2R0G A;  2HZE A;  1YJ6 A;  2K9F A;  2B5X A;  2C0D A;  2WVX A;  1S4B P;  3KZQ A;  3EU4 A;  4AI6 A;  5G5F A;  4PQH A;  3IAS 2;  3M9J A;  3IK7 A;  4POL A;  1FOH A;  4DSS B;  4LMW A;  3VI5 A;  3DWV A;  1BF5 A;  1A0F A;  3F4T A;  2B5E A;  4HEA 2;  4WET A;  1ZGN A;  2H71 A;  4O5R A;  4USS A;  4EUY A;  5DCH A;  1KNG A;  6GSV A;  4ML6 A;  3EU3 A;  4EF0 A;  2AUV A;  2ZNM A;  4N11 A;  3RGB C;  4EO3 A;  4WBJ A;  4WEY A;  1EZK A;  5ECK B;  3EMX A;  5J4V A;  4J2F A;  1ERU A;  4F0B A;  2KUC A;  3N5O A;  5ELA A;  3PH9 A;  2LRC A;  1SD9 A;  5L71 A;  2DBC A;  3IK9 A;  1EP7 A;  5KOW A;  2H6Z A;  4MPG A;  1XG8 A;  1FAA A;  2YWN A;  1V57 A;  4X0X A;  2VCX A;  1U6T A;  1XXU A;  3F9U A;  4K5R A;  2QGV A;  4YKF A;  1V98 A;  5KN3 A;  2DLX A;  4HU9 A;  3R3E A;  4G0L A;  1TI3 A;  1XWB A;  4J56 E;  1ZYN A;  3UOM A;  4FXY P;  1ERT A;  5EPF A;  9GSS A;  4MP4 A;  4LL1 B;  3VPQ A;  2P0G A;  3F6D A;  5BMU B;  3HJO A;  3ED3 A;  2BJX A;  4MK3 A;  4FYC A;  4IVF A;  5ECM B;  1GLP A;  4BL7 B;  4NWY A;  13GS A;  4BVX B;  4RI6 A;  1XWK A;  1PQN A;  1BQ7 A;  3US3 A;  3GTU B;  2H0I A;  3S9F A;  1X9M B;  5AIV A;  5DAK A;  1I1I P;  1M2B A;  1JHB A;  1GSY A;  4KAE A;  3ZMK A;  2L59 A;  5HFK A;  4TXO A;  3O76 A;  2PPT A;  3TKQ A;  5G1K A;  4WKW A;  2IMF A;  3G9B A;  5HFI A;  1IYI A;  2KOK A;  4HQZ A;  1WOU A;  4ZB7 A;  3MDK A;  3ZL5 A;  2C0E A;  4MH2 A;  4BA7 A;  3GH9 A;  1Z6N A;  5KEJ A;  5AN1 A;  1N25 A;  1O85 A;  3GL3 A;  3Q6O A;  5A4U A;  2CX3 A;  3A2X A;  4I2T A;  3C73 A;  4DSQ A;  3APO A;  1PSQ A;  4ZIJ A;  3F3R A;  1AQW A;  2WW3 A;  2R37 A;  1AIU A;  5DCG A;  2O89 A;  2V6O A;  2L5L A;  3BJ5 A;  1XOA A;  2UZ8 A;  4Q5N A;  4PTS A;  2JSZ A;  1G0T A;  1RK4 A;  1YZX A;  1MD3 A;  5ECO B;  1U3I A;  3FKF A;  4NPB A;  1OC9 A;  4K7N A;  3V1W A;  1EV4 A;  4XHM A;  3MWH A;  2I1U A;  3WGE A;  4MJB A;  2H73 A;  2ZUP A;  1SJI A;  4ULX A;  4AF2 A;  3RDW A;  3Q18 A;  2DJ3 A;  4ZB8 A;  4H86 A;  1J9B A;  2L5O A;  4WXT A;  4DSR A;  2A2R A;  1XFL A;  1YF1 A;  2K8V A;  2R2J A;  5IPG A;  1GTI A;  4HSC X;  1FO5 A;  1EGO A;  3GX0 A;  1N8J A;  2VAF A;  4GQF A;  3TOT A;  2GQM A;  1BX9 A;  1OVN A;  3R2Q A;  5G31 A;  2JAC A;  1LU4 A;  4AKG A;  1MDJ A;  3EMP A;  2HXK A;  3DYR A;  2YJH A;  2YWO A;  1M2D A;  1SL0 B;  3GN3 A;  1Y1U A;  2PGT A;  2MMO A;  6GSU A;  4MDC A;  4LLR A;  3FR3 A;  5FWG A;  4ZL8 A;  2GT5 A;  2K8S A;  1MTC A;  2F3M A;  3ZIJ A;  4G19 A;  1J0F A;  1U3A A;  1E2Y A;  2H8L A;  1ZYP A;  2IFQ A;  3F4S A;  2LKU A;  1VF3 A;  2R0P A;  3F3Q A;  5DBQ A;  2IJY A;  3KP9 A;  1MDK A;  1M7T A;  2KP1 A;  4X4J A;  3TKP A;  2JZR A;  4K7I A;  4X43 A;  5HR0 A;  3N9J A;  4RI7 A;  4YH2 A;  3IBH A;  5DDL A;  3ISO A;  1PKW A;  2DJ2 A;  3RPN A;  1SD8 A;  4K2D A;  3FMW A;  1AAZ A;  2RUE A;  5DJM A;  4HZ4 A;  3P90 A;  3WGD A;  1QXH A;  2A2P A;  1SK0 A;  2LQQ A;  5E59 A;  5D73 A;  1BJX A;  2HYX A;  5D93 A;  1O6J A;  4L5O A;  1H4O A;  5CP1 A;  2B1K A;  3D22 A;  4EDY A;  2FA4 A;  4DVC A;  1NHY A;  5B8A A;  1TXX A;  2VD1 A;  5AIS A;  2WB9 A;  4IP1 A;  3GUS A;  3ZRE A;  1JZR A;  2OBI A;  3GA4 A;  4MZW A;  3LFL A;  2FNO A;  3VK9 A;  2DML A;  1T8E B;  3HVN A;  1GTB A;  2ALB A;  5KN1 A;  2O87 A;  2WJU A;  1WP0 A;  1LBK A;  5IO2 A;  3HA9 A;  1JZD A;  2WW1 A;  2HT9 A;  1TKD B;  3HJM A;  1JLW A;  1I5G A;  3UBK A;  4XS6 A;  3OR5 A;  3D4M A;  4A5P A;  1VGL A;  2EC4 A;  1XWA A;  1PN0 A;  2WW2 A;  2WW0 A;  2E2G A;  2VD0 A;  1W4V A;  3HZ4 A;  5IOX A;  4LMV A;  4K2X A;  3I6A A;  5EVO A;  2R4V A;  1GLQ A;  1PMT A;  4AJ6 A;  14GS A;  3A3T A;  1X0R A;  1XWC A;  3KEB A;  1R7H A;  5CRH A;  1Q4J A;  2HNL A;  1MEK A;  2MBT A;  4K0N A;  3VWV A;  3TRQ A;  4PUF C;  1XZO A;  2C3T A;  3UMA A;  5EY6 A;  2A4V A;  2IMD A;  5JCW A;  2K6V A;  4XTS A;  5DJL A;  4ILF A;  3J7Y k;  3GX8 A;  16GS A;  1A2L A;  2QA1 A;  5B7C A;  5LD0 A;  1M0U A;  3J7Y b;  3CSI A;  2FWF A;  1EV9 A;  1M2A A;  3MYD A;  3O3T A;  2VM2 A;  1SK2 A;  3P2A A;  3EVI A;  2LV3 A;  2C0F A;  2VCV A;  1YY7 A;  4D73 A;  1SEN A;  3IHQ A;  1TK5 B;  2K18 A;  1OE7 A;  2LEG A;  3ERF A;  1O8X A;  3QDN A;  3ZRD A;  1GH2 A;  2XBQ A;  3KH7 A;  2O8V B;  4MAB A;  3W8J A;  1TP9 A;  3IE3 A;  4XS4 B;  4W66 A;  2N5B A;  3IV4 A;  4GTU A;  2EFH A;  2MMN A;  2JZT A;  2R6K A;  1TTZ A;  2GSS A;  3NZN A;  1KTE A;  4TR1 B;  4KGI A;  3GNJ A;  3QMX A;  3LYP A;  5LNK e;  2CT6 A;  4GLT A;  2HSM B;  3UEM A;  4BWS A;  4RQX A;  3FR6 A;  3HY2 A;  1X5E A;  3HJP A;  1EP8 A;  2IMK A;  1GNW A;  1O7U A;  5H5Q A;  3KP8 A;  4I5Q A;  3GRX A;  1U88 A;  5A1N B;  5JWR B;  2X64 A;  3L9U A;  4XS1 A;  2HRF A;  5GZZ B;  2HLS A;  1NM3 A;  4FQU A;  1TU8 A;  3ERG A;  5FT3 A;  5J4U A;  5CRD A;  3LYK A;  1GWC A;  2FHE A;  2C0G A;  5A5H B;  2TRX A;  2R0C A;  4TOP A;  3C1S A;  2ON7 A;  2FWH A;  2R5G A;  2VKZ G;  1Z6M A;  3IOS A;  3KMN A;  4OWY A;  3GUR A;  1SKR B;  2HRK B;  1AQV A;  4PQ1 A;  1EOG A;  4K7O A;  5ECH B;  5BRT A;  1FB6 A;  3ZIV A;  2EFD A;  5ECN B;  4FIW A;  1K0C A;  3FZ9 A;  2OE3 A;  2VL9 A;  3KM6 A;  1S3R A;  5A34 A;  4OD7 A;  4K5S A;  3HD5 A;  4HU7 A;  4YQU A;  3TJF A;  1ON4 A;  2H1G A;  5G1L A;  5DQS A;  4ICY A;  5F8B A;  5J47 A;  4EE0 A;  4GDF A;  4CY8 A;  1F6M C;  3GKN A;  4IEL A;  2IPA A;  4IKH A;  1LJR A;  4MCU A;  2HZF A;  4ZIL A;  1W89 A;  2TRC P;  3TKR A;  1GSU A;  2YP6 A;  3RBT A;  2DJK A;  2WGR A;  4KF9 A;  2HI7 A;  4I6X A;  2HE3 A;  2HRN A;  3DEX A;  1ML6 A;  4KDX A;  3ZVJ D;  4I97 A;  2AB6 A;  4OO4 A;  3TCO A;  4F2I A;  5HR3 A;  3BOA A;  3D4T A;  2ON5 A;  3PPU A;  2DC5 A;  4POM A;  3L0H A;  4ISD A;  4KSO A;  1PL1 A;  2GZY A;  4OCE A;  2XHF A;  3FEU A;  3AY8 A;  1URM A;  3HZ8 A;  1C72 A;  3MSZ A;  4LA1 A;  4HS1 A;  1F3A A;  2RII A;  5IMC A;  5KN0 A;  1XBS A;  5G2Z A;  3VI7 A;  1DSB A;  2E2M A;  2PU9 C;  3VLN A;  4IGJ A;  1ZZY A;  3H4K A;  4KDU A;  6GST A;  2ES7 A;  2IN3 A;  3TJJ A;  3WYW A;  1UN2 A;  3C71 A;  3QAW A;  2N5A A;  4E8E A;  2EIO A;  1WIK A;  2GQL A;  3EC3 A;  4EC0 A;  4OFN A;  22GS A;  1NHO A;  1HYU A;  3DD3 A;  5GSS A;  4ZBA A;  2F8F A;  3D5J A;  3QFB C;  3KXO A;  1K0B A;  4JR4 A;  1THX A;  5JCG A;  4MA9 A;  3ZFB A;  3Q19 A;  2H1A A;  2RM6 A;  2WVZ A;  1X5D A;  3LW9 A;  1FW1 A;  4GSS A;  4EL1 A;  4J57 E;  4BVY B;  1CQH A;  1EEM A;  2KHP A;  1ILO A;  3GIX A;  2CAI A;  3HDC A;  2H66 A;  4EDZ A;  1SK1 A;  4PX1 A;  2YWM A;  2HSH A;  2L4Q A;  3DGQ A;  1GL8 A;  5ID2 A;  2JL4 A;  5ECP B;  3KJY A;  5JCU A;  3GST A;  3BCI A;  3L9S A;  1GSF A;  3CYN A;  4NMU A;  1SVM A;  2FWE A;  2M80 A;  2VL2 A;  3K8N A;  2CZ3 A;  3I69 A;  1SKW B;  4MZC A;  2RLI A;  1AC1 A;  1M3I A;  5F05 A;  1JFU A;  2H1D A;  1HD2 A;  3WT1 A;  1A0R P;  5E4W A;  2X49 A;  4Z2R A;  2GVP A;  3GH6 A;  3CRU A;  3LJR A;  4RUV A;  1ERW A;  1Z5Y E;  1PX7 A;  3UAR A;  3Q74 A;  2LQO A;  3F0I A;  3ZFL A;  2EFE A;  4O7H A;  1YDK A;  1OC3 A;  3EPT A;  3D0Z A;  3QFA C;  2OE0 A;  1DE1 A;  2YCD A;  4AKH A;  4ECJ A;  1FG4 A;  3GL5 A;  4N10 A;  3RHB A;  3FHK A;  2R3X A;  2H74 A;  2C4J A;  2LRT A;  3ZML A;  2C8U A;  5ECI B;  3BCK A;  2V32 A;  3HVX A;  1GTA A;  3H1N A;  2UV8 G;  4IBP A;  4K8M A;  3C1R A;  2H01 A;  4GCI A;  2X99 A;  1M9A A;  3TDG A;  2H6X A;  5HQP A;  1PKZ A;  20GS A;  4HUA A;  3HXS A;  1Z3E A;  4XS4 A;  2NBS A;  2CV4 A;  4GWR A;  1V40 A;  2PBJ A;  4IJ3 A;  2KP2 A;  3RFR C;  4Z2T A;  1H75 A;  1GUL A;  5IQY A;  3UL3 A;  3KTB A;  2LRN A;  2HZE B;  1GRX A;  1UA5 A;  2WVX B;  5J40 A;  1PX6 A;  1Z7R A;  4JRR A;  2HSM A;  4YQM A;  1ABA A;  2V6K A;  1ERV A;  2JU5 A;  4MH3 A;  2B7K A;  3IC4 A;  2MYG A;  1F37 A;  2EFC A;  3LGC A;  3H93 A;  4JE1 A;  3MIX A;  2M72 A;  1BYE A;  2KLX A;  1O8W A;  4ZXG A;  3EYT A;  1SJZ A;  2P31 A;  1EOH A;  2OT3 A;  1B9Y C;  5CO3 A;  4JR6 A;  1SU9 A;  3ME8 A;  4MJE A;  5A5H A;  3DRN A;  4FO5 A;  3UVH A;  4IQA A;  4IW9 A;  2WCI A;  4P3Y B;  3CHX C;  1YEP A;  1N2A A;  3HKR A;  2QSI A;  4XIH A;  3TRX A;  1F9M A;  1SL1 B;  3LXZ A;  4GXZ A;  5AGY A;  2LS5 A;  12GS A;  2WUL A;  1HNA A;  2HSN A;  1PGT A;  2VL2 C;  5EL8 A;  2X8G A;  1PA3 A;  5DAL A;  1A8L A;  4V1A p;  1EEJ A;  3APQ A;  1XW5 A;  3NIV A; 
#chains in the Genus database with same CATH homology
 4MPF A;  4CY6 A;  3IDV A;  4PNG A;  1K3L A;  2P5Q A;  3D21 A;  5ECQ B;  2FUG 2;  11GS A;  2AV4 A;  4DSS A;  1O73 A;  3CBU A;  2ZCT A;  2QKE A;  4L5L A;  4WR4 A;  2AHE A;  3M3M A;  2MBS A;  6GSS A;  3DML A;  1F2E A;  4I8B A;  3HCZ A;  4EXJ A;  2WRT A;  2GQK A;  4CW9 A;  6GSX A;  1SVO A;  5FHI A;  4XRD A;  1A23 A;  3MNG A;  5HR2 A;  1QFN A;  1TU7 A;  3CTG A;  2O85 A;  3A5I A;  1K3Y A;  3G7J A;  3W8S A;  2A4H A;  3DKS A;  3ZLP A;  3ZVJ A;  5F06 A;  2LST A;  4IP6 A;  3M1G A;  2XBI A;  1SL2 B;  3HMJ G;  2YWI A;  2LJK A;  1XVQ A;  1K0A A;  3TKS A;  2YN1 A;  5J41 A;  1GSQ A;  1ZMA A;  5DAK B;  3P7X A;  4TXO B;  1T4Z A;  4NHW A;  1G7O A;  1XW6 A;  4F03 A;  5IMV A;  1V9W A;  1Q98 A;  4JU5 A;  1A24 A;  3KH9 A;  2DJ1 A;  4TRX A;  4NXI A;  4YAP A;  1UVZ A;  3CMI A;  4O32 A;  2PMT A;  3JCM L;  3GKM A;  2FWG A;  4N3Z A;  3GKX A;  1BAY A;  3LQ7 A;  1FVK A;  5ELG A;  1SVL A;  3DXB A;  4FYB A;  3ZIT A;  1A2M A;  5J9B A;  2AJQ B;  2VLT A;  5G30 A;  5BMU A;  2CAQ A;  2MMA A;  3ZYW A;  1GUM A;  3IA1 A;  2NPB A;  3M8N A;  2OE1 A;  1K3O A;  4ZBD A;  4L0U A;  4BL7 A;  1YKA A;  4BVX A;  2GT6 A;  4K9Z A;  4WBR D;  3LOR A;  3GTU A;  4IJI A;  1GSE A;  1M99 A;  4MJA A;  2HSY A;  3E9J B;  4ML1 A;  1F3B A;  4ZBB A;  2WS2 A;  1Y6E A;  1TK8 B;  5IMF A;  4KUN A;  2X4A A;  5GAN D;  1IYH A;  2LNT A;  3CSJ A;  2FGX A;  4WF5 A;  5IOW A;  5J9C A;  1OC9 B;  4JED A;  3GFK A;  2EIQ A;  2BTO T;  1THO A;  4E8H A;  1TI1 A;  4RQR A;  1ZCP A;  2VCT A;  4YAV A;  2AYT A;  4PGT A;  1YF0 A;  4NAX A;  1K0N A;  2OJL A;  3FZA A;  4WR5 A;  3QAG A;  1I9D A;  1S3A A;  2H70 A;  2C80 A;  1FVJ A;  3UIW A;  2RM5 A;  4KH7 A;  5CRW A;  1PL2 A;  1GNE A;  1WWJ A;  5INY A;  4I2U A;  4ZL7 A;  4NHZ A;  2L4C A;  4LL4 B;  4O5Q A;  2H72 A;  1GUK A;  1OKD A;  1K0D A;  5CNW A;  4IQ1 A;  4F9Z A;  4ID0 A;  4AKX B;  1ACV A;  3MAK A;  4IHU A;  3VPT A;  2H1L A;  1Z7P A;  6GSW A;  3GYK A;  5ECL B;  1MD4 A;  4XCS A;  4EIQ A;  3GHA A;  2TIR A;  4ACS A;  3UJ1 A;  4GQC A;  2IFQ B;  2V2G A;  2YAN A;  1YQ1 A;  4ECI A;  4XRA A;  8GSS A;  3IR4 A;  3E0U A;  3EUR A;  4CHS A;  3G7I A;  1JZO A;  2JSY A;  5D96 A;  1ST9 A;  2L6D A;  1G7E A;  1V58 A;  1OKT A;  3I9V 2;  1OE8 A;  3IAM 2;  1SYX A;  4G9H A;  1Z9H A;  4QMK A;  1HQO A;  2OBK A;  3C8E A;  4ECB A;  2L57 A;  1GUH A;  3QR6 A;  3RAZ A;  4POB A;  3IHG A;  3HHV A;  3FY7 A;  5J3R A;  3CTF A;  4BWQ A;  3PR8 A;  2VCW A;  4AKI A;  3VFI A;  4GF0 A;  2YZU A;  4V1A g;  1YKC A;  4MF5 A;  4ECC A;  2I4A A;  2B1L A;  2YV7 A;  5KOX A;  1TK0 B;  3P8W A;  3FZ4 A;  3KCM A;  5CAX A;  4EIP A;  3D6I A;  2JZS A;  4MJC A;  4KE3 A;  1ZOF A;  5A4W A;  1T00 A;  2PWJ A;  2A2S A;  4KDY A;  1R26 A;  1TOF A;  1YEX A;  3SWL A;  3HVV A;  1BED A;  4AJ8 A;  1PD2 1;  4G2E A;  2VLU A;  4MNN A;  4MMM A;  4V2N A;  1B8X A;  4PQI A;  3F6F A;  5F07 A;  4PUA A;  3NOF A;  1S3D A;  4GRF A;  2Z9S A;  5KN2 A;  5IMZ A;  2G2Q A;  4TVE A;  1T1V A;  3KGK A;  2DJJ A;  3IC8 A;  1M9B A;  3UAP A;  4E68 A;  1V2A A;  4EKZ A;  2OKA A;  2H76 A;  3PGT A;  2REM A;  2HRA A;  2CVK A;  4OFM A;  3FW2 A;  1RW1 A;  2IME A;  1PRX A;  1AUC A;  4N30 A;  1XCC A;  1YVL A;  1S3C A;  1QGV A;  4POK A;  4QQ7 A;  5IM9 A;  1EWX A;  3HVS A;  3TKS E;  3VWW A;  4G10 A;  2OAC A;  5IMD A;  3M9K A;  2NVL A;  1TRS A;  4K1F A;  3A5W A;  1G6W A;  1VF2 A;  4OMV A;  1QMV A;  3EIN A;  3TUE A;  3U6V A;  4KA0 A;  1QK8 A;  1WMJ A;  2LJA A;  18GS A;  4FYU A;  4OO5 A;  2GSR A;  4PXO A;  3F4R A;  1R5A A;  1T7P B;  1RQM A;  2MZC A;  4HJM A;  2YV9 A;  1UC7 A;  2J9H A;  4D73 B;  3WD6 A;  3VWU A;  3C7M A;  1OYJ A;  2IL3 A;  5D9X A;  3EE2 A;  1USB A;  4L8E A;  2F51 A;  2GZP A;  2H6Y A;  1TDI A;  2XPD A;  1GSD A;  5C04 A;  4YQV A;  6GSY A;  5IPH A;  4ZB9 A;  1NSW A;  2GSQ A;  4HZ2 A;  3TJK A;  2IWT A;  7GSS A;  3QD9 A;  2LNS A;  4TR3 A;  2OA7 A;  2CX4 A;  3ZZX A;  4NV5 A;  4KX4 A;  3IRA A;  2FA8 A;  3RHC A;  3KTL A;  2H19 A;  3I43 A;  2F9S A;  1FB0 A;  2IIY A;  5ABR A;  3ZTL A;  4IN0 A;  3TJG A;  3WT2 A;  3CRT A;  2V1M A;  5ECR B;  4MF7 A;  1FHE A;  4FH8 A;  3UVT A;  3VWX A;  4V2L A;  3FR9 A;  1B4P A;  1WPI A;  1EGR A;  3F63 A;  2VOC A;  2B6M A;  2HQT A;  3DVW A;  4V2M A;  1J08 A;  2VCQ A;  2LUS A;  1GSS A;  5A5K A;  1R4W A;  2B5Y A;  2I9H A;  3E3E A;  3LXT A;  5C00 A;  5G5E A;  2B7J A;  2N5F A;  4PUR A;  1NW2 A;  2DSA A;  5IIZ A;  3L78 A;  4TR1 A;  1VF4 A;  2OAD A;  4KCA A;  2C3Q A;  1X9W B;  5F0G A;  3LWA A;  5A34 B;  2CQ9 A;  2B3S A;  1B4Q A;  3KMO A;  2GDR A;  2JAD A;  4TR0 A;  1XW9 A;  2E7P A;  5A1N A;  2HFD A;  3L4N A;  5IO0 A;  2QC7 A;  1O81 A;  3LG6 A;  1GP1 A;  4CDO A;  2LJR A;  3TJB A;  4K6X A;  3IXR A;  1B9X C;  2VCZ A;  3BBY A;  1SJ6 A;  2DKH A;  3GKK A;  3WGX A;  1X5C A;  2XC2 A;  4HDE A;  4TKY A;  4MLY A;  4QL7 A;  1TRV A;  5CRG A;  4Q5R A;  3GMF A;  3IPZ A;  1HNC A;  1ZYE A;  1WRY A;  2HRK A;  2GZZ A;  3GSS A;  2GTU A;  2IMI A;  2YZH A;  3G7Y A;  2GGT A;  1TRU A;  4G01 A;  4K0G A;  2XPE A;  2LTK A;  4OCF A;  1X9S B;  3LEF A;  5D9W A;  4L0W A;  2P5R A;  5H5R A;  2DKI A;  4N0Z A;  4MF6 A;  1QUW A;  10GS A;  3HYP A;  2GLR A;  5H5S A;  1ZYQ B;  5AIX A;  3ERW A;  5COH A;  5B8B A;  4KW6 A;  3L9V A;  5B6M A;  3QCP A;  1MDI A;  4Q5F A;  1A8Y A;  3SBC A;  1Y25 A;  2X8H A;  4TR4 A;  5D9V A;  1JZW A;  1TXU A;  1OAZ A;  4JBB A;  3QAV A;  4EVM A;  2YJ7 A;  4G0K A;  1FOV A;  2VL3 A;  5DVB A;  5CYY A;  3VUR A;  2YPM A;  1K0O A;  17GS A;  2M46 A;  1ZL9 A;  4KND A;  4N0V A;  1SKS B;  2D2Z A;  2H0H A;  3TB2 A;  4DEJ A;  19GS A;  2CVD A;  1DE2 A;  4TN8 A;  4Z2U A;  3ME7 A;  2O5V A;  4HQS A;  4TXV A;  5CRE A;  3TRP A;  2DJ0 A;  4O5U A;  1E6B A;  4MZB A;  1G6Y A;  4AGS A;  2X8C A;  5ID2 B;  2E0Q A;  5ECS A;  3CSH A;  1TW9 A;  2VM1 A;  1XVW A;  1BG5 A;  3TOU A;  3CWG A;  5GAP D;  1VF1 A;  3A2W A;  3UBL A;  1PN9 A;  4KCE A;  3TU3 B;  2PUK C;  4BPY A;  1QQ2 A;  2RUF A;  2G0F A;  2DIY A;  4AJ7 A;  1KBN A;  5J5N A;  2DIZ A;  3F8U A;  2FD3 A;  2BMX A;  2YOI A;  3DVX A;  4QL9 A;  3FRC A;  2WFC A;  1XWG A;  1XOB A;  1WE0 A;  5HR1 A;  3CXG A;  4PNF A;  3W6G A;  5GST A;  3GV1 A;  1OC8 A;  5LCZ A;  1XPV A;  5HFG A;  1SYR A;  4IS0 A;  5A4V A;  1GTU A;  2J23 A;  3LSZ A;  4BVY A;  4GST A;  3KD0 A;  2PVQ A;  4Q5Q A;  3A2V A;  1HNB A;  2H30 A;  2AAW A;  3M0F A;  4HOJ A;  2NDO A;  5ENU A;  3TGZ A;  2C1Y A;  1TRW A;  2DMM A;  2YNX A;  1U87 A;  2I81 A;  2PER A;  2CZ2 A;  1XIY A;  1R5P A;  2PN8 A;  2CVB A;  2VO4 A;  4KB3 A;  3FZ5 A;  2GST A;  1VRS D;  4OFT A;  3DIE A;  5JWO B;  3BD2 A;  4HJ2 A;  5D9T A;  2MMZ A;  3H79 A;  2NTO A;  3KIJ A;  4GSN A;  4TW5 A;  4ZB6 A;  2VUP A;  1BG1 A;  1B48 A;  2VIM A;  4O92 A;  5B6N A;  2EIR A;  2PVO C;  1AW9 A;  3QPM A;  1WJK A;  4WF4 A;  3EWL A;  2L6C A;  2C3N A;  2V41 A;  2O7K A;  3U5R E;  3FYG A;  5D8I A;  2WDU A;  3O6T A;  1TJD A;  4F82 A;  1T3B A;  2CA8 A;  4F0C A;  5JWQ B;  2VLV A;  2F8A A;  1K0M A;  2WZ9 A;  5IMA A;  1DBY A;  4KSM A;  4ZL9 A;  4HI7 A;  3TKS C;  1JLV A;  4G0I A;  2FY6 A;  1AQX A;  2FCH A;  2QA2 A;  4Z7X A;  3H8Q A;  1KEB A;  2I3Y A;  2GS3 A;  1AXD A;  1A2J A;  2H1B A;  4X1U A;  3RPP A;  4YKG A;  3PIN A;  3FK8 A;  4JZQ A;  4NV2 A;  1DUG A;  1CQG A;  2H75 A;  3QOU A;  3APS A;  2HSN B;  1T4Y A;  5DQY A;  2H0G A;  5DAL B;  5J4Y A;  2FLS A;  2R0G A;  2HZE A;  1YJ6 A;  2K9F A;  2B5X A;  2C0D A;  3KZQ A;  3EU4 A;  4AI6 A;  5G5F A;  4PQH A;  3IAS 2;  3M9J A;  3IK7 A;  4POL A;  1FOH A;  4DSS B;  4LMW A;  3VI5 A;  3DWV A;  1BF5 A;  1A0F A;  3F4T A;  2B5E A;  4HEA 2;  4WET A;  1ZGN A;  2H71 A;  4O5R A;  4USS A;  4EUY A;  5DCH A;  1KNG A;  6GSV A;  4ML6 A;  3EU3 A;  4EF0 A;  2AUV A;  2ZNM A;  4N11 A;  4EO3 A;  4WBJ A;  4WEY A;  1EZK A;  5ECK B;  3EMX A;  5J4V A;  4J2F A;  1ERU A;  4F0B A;  2KUC A;  3N5O A;  5ELA A;  3PH9 A;  2LRC A;  1SD9 A;  5L71 A;  2DBC A;  3IK9 A;  1EP7 A;  5KOW A;  2H6Z A;  4MPG A;  1FAA A;  2YWN A;  1V57 A;  4X0X A;  2VCX A;  1U6T A;  1XXU A;  3F9U A;  4K5R A;  2QGV A;  4YKF A;  1V98 A;  5KN3 A;  2DLX A;  4HU9 A;  3R3E A;  4G0L A;  1TI3 A;  1XWB A;  4J56 E;  1ZYN A;  3UOM A;  1ERT A;  5EPF A;  9GSS A;  4MP4 A;  4LL1 B;  3VPQ A;  2P0G A;  3F6D A;  5BMU B;  3HJO A;  3ED3 A;  2BJX A;  4MK3 A;  4FYC A;  4IVF A;  5ECM B;  1GLP A;  4BL7 B;  4NWY A;  13GS A;  4BVX B;  4RI6 A;  1XWK A;  1PQN A;  1BQ7 A;  3US3 A;  3GTU B;  2H0I A;  3S9F A;  1X9M B;  5AIV A;  5DAK A;  1M2B A;  1JHB A;  1GSY A;  4KAE A;  3ZMK A;  2L59 A;  5HFK A;  4TXO A;  3O76 A;  2PPT A;  3TKQ A;  5G1K A;  4WKW A;  2IMF A;  3G9B A;  5HFI A;  1IYI A;  2KOK A;  4HQZ A;  1WOU A;  4ZB7 A;  3MDK A;  3ZL5 A;  2C0E A;  4MH2 A;  4BA7 A;  3GH9 A;  1Z6N A;  5KEJ A;  5AN1 A;  1N25 A;  1O85 A;  3GL3 A;  3Q6O A;  5A4U A;  2CX3 A;  3A2X A;  4I2T A;  3C73 A;  4DSQ A;  3APO A;  1PSQ A;  4ZIJ A;  3F3R A;  1AQW A;  2R37 A;  1AIU A;  5DCG A;  2O89 A;  2V6O A;  2L5L A;  3BJ5 A;  1XOA A;  2UZ8 A;  4Q5N A;  4PTS A;  2JSZ A;  1G0T A;  1RK4 A;  1YZX A;  1MD3 A;  5ECO B;  1U3I A;  3FKF A;  4NPB A;  1OC9 A;  4K7N A;  3V1W A;  1EV4 A;  4XHM A;  3MWH A;  2I1U A;  3WGE A;  4MJB A;  2H73 A;  2ZUP A;  1SJI A;  4ULX A;  4AF2 A;  3RDW A;  3Q18 A;  2DJ3 A;  4ZB8 A;  4H86 A;  1J9B A;  2L5O A;  4WXT A;  4DSR A;  2A2R A;  1XFL A;  1YF1 A;  2K8V A;  2R2J A;  5IPG A;  1GTI A;  1FO5 A;  1EGO A;  3GX0 A;  1N8J A;  2VAF A;  4GQF A;  3TOT A;  2GQM A;  1BX9 A;  1OVN A;  3R2Q A;  5G31 A;  2JAC A;  1LU4 A;  4AKG A;  1MDJ A;  3EMP A;  2HXK A;  3DYR A;  2YJH A;  2YWO A;  1M2D A;  1SL0 B;  3GN3 A;  1Y1U A;  2PGT A;  2MMO A;  6GSU A;  4MDC A;  4LLR A;  3FR3 A;  5FWG A;  4ZL8 A;  2GT5 A;  2K8S A;  1MTC A;  2F3M A;  3ZIJ A;  4G19 A;  1J0F A;  1U3A A;  1E2Y A;  2H8L A;  1ZYP A;  2IFQ A;  3F4S A;  2LKU A;  1VF3 A;  2R0P A;  3F3Q A;  5DBQ A;  2IJY A;  3KP9 A;  1MDK A;  1M7T A;  2KP1 A;  4X4J A;  3TKP A;  2JZR A;  4K7I A;  4X43 A;  5HR0 A;  3N9J A;  4RI7 A;  4YH2 A;  3IBH A;  5DDL A;  3ISO A;  1PKW A;  2DJ2 A;  3RPN A;  1SD8 A;  4K2D A;  3FMW A;  1AAZ A;  2RUE A;  5DJM A;  4HZ4 A;  3P90 A;  3WGD A;  1QXH A;  2A2P A;  1SK0 A;  2LQQ A;  5E59 A;  5D73 A;  1BJX A;  2HYX A;  5D93 A;  1O6J A;  4L5O A;  1H4O A;  5CP1 A;  2B1K A;  3D22 A;  4EDY A;  2FA4 A;  4DVC A;  1NHY A;  5B8A A;  1TXX A;  2VD1 A;  5AIS A;  2WB9 A;  4IP1 A;  3GUS A;  3ZRE A;  1JZR A;  2OBI A;  3GA4 A;  4MZW A;  3LFL A;  2FNO A;  3VK9 A;  2DML A;  1T8E B;  1GTB A;  2ALB A;  5KN1 A;  2O87 A;  2WJU A;  1WP0 A;  1LBK A;  5IO2 A;  3HA9 A;  1JZD A;  2HT9 A;  1TKD B;  3HJM A;  1JLW A;  1I5G A;  3UBK A;  4XS6 A;  3OR5 A;  3D4M A;  4A5P A;  1VGL A;  2EC4 A;  1XWA A;  1PN0 A;  2E2G A;  2VD0 A;  1W4V A;  3HZ4 A;  5IOX A;  4LMV A;  4K2X A;  3I6A A;  5EVO A;  2R4V A;  1GLQ A;  1PMT A;  4AJ6 A;  14GS A;  3A3T A;  1X0R A;  1XWC A;  3KEB A;  1R7H A;  5CRH A;  1Q4J A;  2HNL A;  1MEK A;  2MBT A;  4K0N A;  3VWV A;  3TRQ A;  4PUF C;  1XZO A;  2C3T A;  3UMA A;  5EY6 A;  2A4V A;  2IMD A;  5JCW A;  2K6V A;  4XTS A;  5DJL A;  4ILF A;  3J7Y k;  3GX8 A;  16GS A;  1A2L A;  2QA1 A;  5B7C A;  5LD0 A;  1M0U A;  3J7Y b;  3CSI A;  2FWF A;  1EV9 A;  1M2A A;  3MYD A;  3O3T A;  2VM2 A;  1SK2 A;  3P2A A;  3EVI A;  2LV3 A;  2C0F A;  2VCV A;  1YY7 A;  4D73 A;  1SEN A;  3IHQ A;  1TK5 B;  2K18 A;  1OE7 A;  2LEG A;  3ERF A;  1O8X A;  3QDN A;  3ZRD A;  1GH2 A;  2XBQ A;  3KH7 A;  2O8V B;  4MAB A;  3W8J A;  1TP9 A;  3IE3 A;  4XS4 B;  4W66 A;  2N5B A;  3IV4 A;  4GTU A;  2EFH A;  2MMN A;  2JZT A;  2R6K A;  1TTZ A;  2GSS A;  3NZN A;  1KTE A;  4TR1 B;  4KGI A;  3GNJ A;  3QMX A;  3LYP A;  5LNK e;  2CT6 A;  4GLT A;  2HSM B;  3UEM A;  4BWS A;  4RQX A;  3FR6 A;  3HY2 A;  1X5E A;  3HJP A;  1EP8 A;  2IMK A;  1GNW A;  1O7U A;  5H5Q A;  3KP8 A;  4I5Q A;  3GRX A;  1U88 A;  5A1N B;  5JWR B;  2X64 A;  3L9U A;  4XS1 A;  2HRF A;  5GZZ B;  2HLS A;  1NM3 A;  4FQU A;  1TU8 A;  3ERG A;  5FT3 A;  5J4U A;  5CRD A;  3LYK A;  1GWC A;  2FHE A;  2C0G A;  5A5H B;  2TRX A;  2R0C A;  4TOP A;  3C1S A;  2ON7 A;  2FWH A;  2R5G A;  2VKZ G;  1Z6M A;  3IOS A;  3KMN A;  4OWY A;  3GUR A;  1SKR B;  2HRK B;  1AQV A;  4PQ1 A;  1EOG A;  4K7O A;  5ECH B;  5BRT A;  1FB6 A;  3ZIV A;  2EFD A;  5ECN B;  4FIW A;  1K0C A;  3FZ9 A;  2OE3 A;  2VL9 A;  3KM6 A;  5A34 A;  4OD7 A;  4K5S A;  3HD5 A;  4HU7 A;  4YQU A;  3TJF A;  1ON4 A;  2H1G A;  5G1L A;  5DQS A;  4ICY A;  5F8B A;  5J47 A;  4EE0 A;  4GDF A;  4CY8 A;  1F6M C;  3GKN A;  4IEL A;  2IPA A;  4IKH A;  1LJR A;  4MCU A;  2HZF A;  4ZIL A;  1W89 A;  2TRC P;  3TKR A;  1GSU A;  2YP6 A;  3RBT A;  2DJK A;  2WGR A;  4KF9 A;  2HI7 A;  4I6X A;  2HE3 A;  2HRN A;  3DEX A;  1ML6 A;  4KDX A;  3ZVJ D;  4I97 A;  2AB6 A;  4OO4 A;  3TCO A;  4F2I A;  5HR3 A;  3BOA A;  3D4T A;  2ON5 A;  3PPU A;  2DC5 A;  4POM A;  3L0H A;  4ISD A;  4KSO A;  1PL1 A;  2GZY A;  4OCE A;  2XHF A;  3FEU A;  3AY8 A;  1URM A;  3HZ8 A;  1C72 A;  3MSZ A;  4LA1 A;  4HS1 A;  1F3A A;  2RII A;  5IMC A;  5KN0 A;  1XBS A;  5G2Z A;  3VI7 A;  1DSB A;  2E2M A;  2PU9 C;  3VLN A;  4IGJ A;  1ZZY A;  3H4K A;  4KDU A;  6GST A;  2ES7 A;  2IN3 A;  3TJJ A;  3WYW A;  1UN2 A;  3C71 A;  3QAW A;  2N5A A;  4E8E A;  2EIO A;  1WIK A;  2GQL A;  3EC3 A;  4EC0 A;  4OFN A;  22GS A;  1NHO A;  1HYU A;  3DD3 A;  5GSS A;  4ZBA A;  2F8F A;  3D5J A;  3QFB C;  3KXO A;  1K0B A;  4JR4 A;  1THX A;  5JCG A;  4MA9 A;  3ZFB A;  3Q19 A;  2H1A A;  2RM6 A;  1X5D A;  3LW9 A;  1FW1 A;  4GSS A;  4EL1 A;  4J57 E;  4BVY B;  1CQH A;  1EEM A;  2KHP A;  1ILO A;  3GIX A;  2CAI A;  3HDC A;  2H66 A;  4EDZ A;  1SK1 A;  4PX1 A;  2YWM A;  2HSH A;  2L4Q A;  3DGQ A;  1GL8 A;  5ID2 A;  2JL4 A;  5ECP B;  3KJY A;  5JCU A;  3GST A;  3BCI A;  3L9S A;  1GSF A;  3CYN A;  4NMU A;  1SVM A;  2FWE A;  2M80 A;  2VL2 A;  3K8N A;  2CZ3 A;  3I69 A;  1SKW B;  4MZC A;  2RLI A;  1AC1 A;  5F05 A;  1JFU A;  2H1D A;  1HD2 A;  3WT1 A;  1A0R P;  5E4W A;  2X49 A;  4Z2R A;  2GVP A;  3GH6 A;  3CRU A;  3LJR A;  4RUV A;  1ERW A;  1Z5Y E;  1PX7 A;  3UAR A;  3Q74 A;  2LQO A;  3F0I A;  3ZFL A;  2EFE A;  4O7H A;  1YDK A;  1OC3 A;  3EPT A;  3D0Z A;  3QFA C;  2OE0 A;  1DE1 A;  2YCD A;  4AKH A;  4ECJ A;  1FG4 A;  3GL5 A;  4N10 A;  3RHB A;  3FHK A;  2R3X A;  2H74 A;  2C4J A;  2LRT A;  3ZML A;  2C8U A;  5ECI B;  3BCK A;  2V32 A;  3HVX A;  1GTA A;  3H1N A;  2UV8 G;  4IBP A;  4K8M A;  3C1R A;  2H01 A;  4GCI A;  2X99 A;  1M9A A;  3TDG A;  2H6X A;  5HQP A;  1PKZ A;  20GS A;  4HUA A;  3HXS A;  1Z3E A;  4XS4 A;  2NBS A;  2CV4 A;  4GWR A;  1V40 A;  2PBJ A;  4IJ3 A;  2KP2 A;  4Z2T A;  1H75 A;  1GUL A;  5IQY A;  3UL3 A;  3KTB A;  2LRN A;  2HZE B;  1GRX A;  1UA5 A;  5J40 A;  1PX6 A;  1Z7R A;  4JRR A;  2HSM A;  4YQM A;  1ABA A;  2V6K A;  1ERV A;  2JU5 A;  4MH3 A;  2B7K A;  3IC4 A;  2MYG A;  1F37 A;  2EFC A;  3LGC A;  3H93 A;  4JE1 A;  3MIX A;  2M72 A;  1BYE A;  2KLX A;  1O8W A;  4ZXG A;  3EYT A;  1SJZ A;  2P31 A;  1EOH A;  2OT3 A;  1B9Y C;  5CO3 A;  4JR6 A;  1SU9 A;  3ME8 A;  4MJE A;  5A5H A;  3DRN A;  4FO5 A;  3UVH A;  4IQA A;  4IW9 A;  2WCI A;  4P3Y B;  1YEP A;  1N2A A;  3HKR A;  2QSI A;  4XIH A;  3TRX A;  1F9M A;  1SL1 B;  3LXZ A;  4GXZ A;  5AGY A;  2LS5 A;  12GS A;  2WUL A;  1HNA A;  2HSN A;  1PGT A;  2VL2 C;  5EL8 A;  2X8G A;  1PA3 A;  5DAL A;  1A8L A;  4V1A p;  1EEJ A;  3APQ A;  1XW5 A;  3NIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...