3CSIA

Crystal structure of the glutathione transferase pi allelic variant*c, i104v/a113v, in complex with the chlorambucil-glutathione conjugate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEVGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title The anti-cancer drug chlorambucil as a substrate for the human polymorphic enzyme glutathione transferase P1-1: kinetic properties and crystallographic characterisation of allelic variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3csiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3csiA01
3EYTA 5HR1A 4D73B 5F8BA 3N9JA 4POMA 2CAIA 2DIZA 2HRFA 2H72A 1Z7RA 2MMZA 2GTUA 1GSDA 3UMAA 2XC2A 3IK9A 5ECRB 3DIEA 3GTUA 3KJYA 3S9FA 3BBYA 1A0RP 4X43A 3L9UA 22GSA 4OO4A 4HUAA 5HR2A 3TB2A 4ZBDA 4K0NA 4AF2A 2HI7A 3F3QA 4DSRA 1F3BA 5A4UA 3TUEA 3DVWA 5LD0A 4ML1A 1SKRB 5AIVA 1SK2A 3EC3A 1O6JA 2FY6A 2FWGA 3D22A 1GUHA 1ZMAA 5GAND 1U3IA 3QOUA 1VF1A 3L9SA 4GRFA 1MDJA 1WP0A 2FLSA 5G1KA 1XZOA 2I1UA 3SWLA 1TRVA 2HZFA 2PWJA 2EIRA 5G30A 5D9WA 1AC1A 1YQ1A 2E2MA 4KH7A 1ERTA 4XRDA 3FHKA 1OC9A 1XOAA 4GXZA 1R4WA 3GIXA 3Q19A 4XHMA 4TR0A 3I43A 1F9MA 2H71A 4EDZA 4P3YB 2R5GA 2GT6A 2ON5A 2PVQA 4MPGA 2NBSA 2HSNB 1V57A 4KGIA 2P0GA 4DSQA 4JBBA 2H1AA 3IAS2 5GSSA 1GSYA 5H5RA 1JLVA 1X5CA 2FA4A 2VD1A 3V1WA 2C3QA 2HSHA 5IPHA 2BMXA 3L4NA 5J41A 5ECKB 4YAPA 1GH2A 5KN1A 3LYKA 5ABRA 1TI1A 3D0ZA 3BOAA 2M46A 2EC4A 1NSWA 3FZAA 4L5LA 3GKXA 2H01A 2VL2A 4IW9A 4KSOA 2XHFA 3F4RA 1T7PB 2H6ZA 1OYJA 4KCEA 5D9XA 2DC5A 1YJ6A 2B7KA 1V58A 3VWWA 3CSJA 2B5YA 1TXXA 2YN1A 4I6XA 4KW6A 4IQAA 2WB9A 1SL0B 4V1Ag 1EEMA 1JZDA 3I9V2 1AQVA 1MD3A 3KMNA 4PURA 3H4KA 10GSA 2HSYA 4NPBA 3VLNA 4DEJA 1GRXA 4BA7A 3HKRA 3GA4A 4X0XA 2GZZA 2RM6A 4GSSA 1A8LA 1GTUA 5ECQB 2EIQA 1M99A 2VUPA 3JCML 5JCWA 5B6MA 3RAZA 4RI7A 1O8WA 1DE1A 5C04A 4FYBA 5CRWA 2OE0A 4OWYA 3UEMA 8GSSA 3PINA 5A5KA 1UC7A 2JSZA 2PMTA 1W89A 3ERFA 5DVBA 4FQUA 1PKZA 4QQ7A 2LJKA 1EEJA 3UIWA 1SU9A 4Q5FA 1ACVA 3EU4A 4MZWA 1XWKA 3FZ5A 2DJ3A 4TVEA 2LRNA 3KM6A 2C1YA 4TR1B 3G7YA 1U6TA 4XTSA 5DAKA 3H79A 1TRSA 4WETA 2YZHA 1WIKA 1ML6A 3HJOA 5E4WA 2C0GA 1GNWA 1MEKA 3M9JA 2C0DA 5IMCA 2IFQA 1G7OA 4OFTA 4L5OA 5JCUA 3GURA 6GSSA 4ILFA 2H1BA 1B9YC 4YH2A 5D93A 1OE8A 1TK8B 4WKWA 4LL1B 3IC8A 1MTCA 2V32A 2IL3A 3ZIJA 1FO5A 3UARA 1GUKA 3VFIA 2H6YA 2DJ1A 1X5EA 3GKMA 5B8BA 4G0LA 2VCXA 1A23A 2TIRA 1FB6A 2DJ0A 3QPMA 1YEXA 1SKWB 5FT3A 1T00A 4WXTA 2LSTA 3IK7A 3HVVA 4N0ZA 3UOMA 2GSQA 1N2AA 4PUFC 1YEPA 1FVKA 3CRTA 1S3CA 4TR3A 4IGJA 1E2YA 1CQGA 3ZMLA 3VWXA 2DSAA 4J57E 2GLRA 1JLWA 2H0HA 1K0CA 5DJLA 2HZEA 5B6NA 2K18A 1GLPA 4BVXA 2RIIA 4BWSA 5IPGA 3KZQA 4KAEA 1A2LA 3GSTA 2LRCA 4HEA2 2ZCTA 4F82A 1QGVA 2NDOA 3I69A 2H76A 2RLIA 2KP1A 2K6VA 3P90A 1BAYA 1GL8A 1UVZA 1TDIA 5CP1A 2FNOA 3H93A 2ZNMA 3HD5A 4WBRD 4EUYA 1PRXA 1T4ZA 4TXVA 2DBCA 16GSA 1KBNA 3GMFA 4EXJA 3EVIA 1XCCA 3TKPA 2BTOT 5JCGA 2L59A 2OBKA 1F37A 3CYNA 2P31A 3D4MA 2O87A 1J9BA 2B3SA 3U6VA 3CRUA 2VLVA 4TXOA 4MH3A 3NZNA 5ECPB 5IQYA 3EURA 3IPZA 1AXDA 2N5BA 5DALA 2NVLA 4HJMA 4K6XA 1UA5A 4DSSA 1OC3A 2VD0A 2VIMA 1ON4A 4HI7A 1UN2A 5KN0A 4LL4B 4F0CA 4O7HA 3ME8A 1XW5A 1FOVA 1BJXA 2YJHA 5D73A 2TRCP 4IP6A 4KB3A 3NIVA 20GSA 2YZUA 3FKFA 2A2RA 4JR4A 1SENA 1XFLA 3KEBA 2VOCA 1DBYA 2JL4A 4JRRA 1AAZA 5H5SA 4K7OA 1PD21 4G10A 4NHZA 3AY8A 2KP2A 5IMZA 1Z9HA 3GRXA 2VM2A 3F4SA 3CBUA 1YZXA 1GSQA 1ABAA 4FYCA 1XWCA 3ERWA 2VL3A 5F05A 2HXKA 2R3XA 1ZOFA 3PPUA 1B48A 2GSTA 3LG6A 2J9HA 1T8EB 2LJRA 2PU9C 2LEGA 1HNBA 3PGTA 4MA9A 1JHBA 2RM5A 3IR4A 3MSZA 1PSQA 5ECMB 2GQLA 4KCAA 1PGTA 3HY2A 4TOPA 4GSTA 5IMVA 2MMNA 2H0GA 2LRTA 2OA7A 4IQ1A 5ELAA 5ID2B 3C73A 1B4PA 4F03A 3GHAA 2C3NA 5ECIB 2QGVA 3WT2A 1USBA 1K3LA 1XPVA 2WULA 2YP6A 2VL9A 3CSIA 2NPBA 3KMOA 5A4WA 4G19A 3WYWA 4MZBA 4F0BA 5J4UA 2WJUA 4GTUA 5HR3A 3APQA 1PL1A 3UBLA 3IBHA 2C0FA 4F2IA 1BEDA 2V6KA 3GX8A 2IFQB 2KOKA 4ID0A 1RQMA 2MMOA 4OO5A 1XWGA 5KEJA 1KEBA 4N0VA 4FO5A 2AAWA 2XBQA 6GSXA 3LORA 4USSA 3HVXA 4QL9A 1SYRA 4WEYA 1Y25A 1QXHA 1KNGA 5EY6A 2I81A 1NW2A 4PUAA 3O6TA 1N8JA 2AJQB 4MPFA 2B1LA 1RW1A 4LMWA 5AIXA 3KP9A 2LV3A 4ECCA 3ZTLA 4MH2A 5C00A 4BL7B 3IHQA 4GLTA 3HHVA 2CX3A 6GSUA 3TCOA 2RUFA 2HZEB 2HSMA 5HFIA 4BVXB 4XRAA 1M2AA 2YWIA 1XVQA 4WR5A 3N5OA 3ZMKA 1A2JA 1TKDB 2DJ2A 1VGLA 5ELGA 14GSA 2X8CA 2LS5A 1FB0A 1ST9A 2GGTA 5ECSA 2YWNA 3A2VA 1TU7A 3ERGA 2BJXA 1S3DA 1EGOA 5G2ZA 2VCQA 1QUWA 3VURA 3KTLA 4ZB8A 2OKAA 1O7UA 5D9VA 1YKAA 5L71A 4HU7A 3FY7A 4O92A 1GSUA 1ZYQB 3HYPA 2WGRA 3TRQA 5D9TA 4CW9A 2YPMA 4EF0A 5CAXA 2L4QA 2PERA 1TI3A 2XPDA 1THOA 2WFCA 3BCKA 5A4VA 4MDCA 4HS1A 1XXUA 2H1GA 3CXGA 3HZ4A 7GSSA 4IBPA 2IMEA 5EL8A 2O85A 4MABA 3QDNA 2YV7A 3APSA 2GZPA 4AJ7A 2AYTA 3G7JA 2L57A 4L0WA 4WBJA 3E3EA 3TJKA 6GSTA 5ECLB 4LMVA 3DMLA 1PX7A 3TJBA 5D8IA 4ZBBA 3D21A 2A2SA 4HJ2A 4TXOB 3F3RA 4NMUA 1J08A 1THXA 2YV9A 4MJEA 5DALB 3TJJA 4WR4A 4IELA 1EV4A 4KDYA 4RI6A 2HRNA 2JZTA 4HZ2A 2VL2C 2HRKA 1WOUA 4OFNA 2K8VA 1OKTA 2OACA 1IYIA 1FAAA 2LTKA 4DSSB 3ZLPA 3VWVA 4CDOA 1EP8A 4JR6A 3C7MA 3HZ8A 3OR5A 1T3BA 1SJIA 4ZB6A 5F07A 2P5QA 1BQ7A 3M3MA 4PTSA 1TK0B 3ZFLA 2AUVA 2WDUA 2X8HA 3A2XA 3F4TA 1AUCA 1DE2A 1LJRA 4GQCA 4X1UA 4XCSA 5DCHA 5JWQB 1GTIA 4YQUA 1DSBA 4EDYA 2LJAA 3HDCA 4PQHA 3GL5A 5DBQA 3UJ1A 2H19A 2XPEA 3QR6A 5IMDA 3CTGA 1X5DA 3EE2A 2LQOA 5G31A 1AIUA 1K0MA 4ECIA 2DJJA 3GN3A 2ZUPA 2C3TA 3DXBA 3SBCA 3LFLA 3DD3A 2L5OA 1K3OA 4ZL9A 3FR3A 2GSRA 3IA1A 1PQNA 5IMAA 3TRXA 1TRWA 3LWAA 3FZ9A 4V2LA 1ILOA 5DJMA 3QAGA 2V1MA 3LXZA 1LU4A 2FWHA 4IS0A 4K8MA 1GULA 1EV9A 4OCEA 1BX9A 1OE7A 2FHEA 3D6IA 2G2QA 4K7NA 1NHYA 1I5GA 4KNDA 1O73A 2HT9A 1Z3EA 1PX6A 4TKYA 2O89A 3LEFA 2GSSA 5CYYA 1PA3A 4RQXA 3ZZXA 2H8LA 3QAWA 3A2WA 3APOA 1KTEA 2YWMA 4KF9A 4WF5A 4K7IA 5EVOA 2LQQA 2YNXA 2PN8A 4PQIA 2DMMA 1IYHA 2HYXA 1A8YA 5INYA 2OADA 2C4JA 5LNKe 3ZL5A 3GTUB 3TKSA 1B9XC 3DRNA 3F0IA 1SJ6A 2R4VA 3GH6A 17GSA 2FUG2 2CVDA 5AISA 3R2QA 3ME7A 1XW6A 2VAFA 3WT1A 3EMPA 1TW9A 5F06A 2IIYA 2N5FA 1Z7PA 6GSWA 4TR4A 4L8EA 1G0TA 3ZVJD 2E0QA 3J7Yk 3CMIA 3J7Yb 5CRDA 2B5XA 1OVNA 1G6WA 2IMDA 3VK9A 2HE3A 4ZILA 1EZKA 4HQZA 2JZRA 2REMA 2R2JA 1SD8A 3IRAA 2ON7A 3ZYWA 2H73A 4YAVA 4EC0A 1XIYA 1BG5A 1OC9B 3DVXA 5HR0A 4PX1A 1GSSA 2HSMB 4V2NA 4MLYA 6GSVA 5G1LA 3GNJA 2OE3A 4OFMA 4NHWA 2IMFA 5G5FA 1M9BA 2HFDA 3IAM2 2JSYA 3UL3A 3U5RE 4YQVA 4OMVA 3Q18A 5DQSA 3TRPA 1Y6EA 3EINA 4G2EA 3FZ4A 1DUGA 5CRGA 4ISDA 4PNFA 5D96A 3MNGA 1ZCPA 4Z7XA 2H0IA 3FW2A 1VRSD 2VLUA 3US3A 4BPYA 5B7CA 5IO0A 2IPAA 2B5EA 4MF5A 3HJPA 1PL2A 3BCIA 5JWRB 2C8UA 5ENUA 3GUSA 4O5RA 3VPQA 1JZRA 4K9ZA 4FYUA 3HXSA 1B8XA 2K8SA 3IDVA 2IJYA 1K0BA 1SD9A 3KTBA 3IE3A 4MK3A 3DWVA 6GSYA 4ZB9A 3ED3A 2VCVA 2H74A 2V41A 1R5AA 4PNGA 3CTFA 1O8XA 1ZL9A 2QC7A 4J56E 2N5AA 3KIJA 3W8JA 2MZCA 1GUMA 2PGTA 4Q5RA 3W8SA 1V98A 3DGQA 5CNWA 4XS1A 1GSFA 5HFKA 4NXIA 2H6XA 2F8FA 2HRKB 1M2DA 4BVYA 3K8NA 4ML6A 4HU9A 4KDUA 1GSEA 1HD2A 1HNAA 1SK1A 2MYGA 4NAXA 12GSA 2D2ZA 4IVFA 2F9SA 1URMA 5DCGA 2VO4A 2O8VB 4KSMA 1M2BA 4AGSA 1WE0A 1ERUA 11GSA 2F51A 1YKCA 2HLSA 2GVPA 1PN9A 1CQHA 1M9AA 2QSIA 1C72A 2AB6A 4CHSA 3UVTA 3RPPA 1O85A 4O32A 2JU5A 1SJZA 2G0FA 5H5QA 2HRAA 2IMIA 2GQMA 5EPFA 2JACA 1R26A 4EL1A 1NHOA 3GFKA 2M72A 2LNSA 3QD9A 5DAKB 3I6AA 5G5EA 2PUKC 4K1FA 1M7TA 4IJ3A 3ZRDA 4F9ZA 1ERWA 2ES7A 3F63A 4IHUA 2WS2A 4GCIA 1EP7A 1U87A 4AJ8A 1MDKA 1QQ2A 1TTZA 5J9BA 1NM3A 1TK5B 2HNLA 3GSSA 4Q5QA 2Z9SA 4FH8A 1ZGNA 1B4QA 2MMAA 4GSNA 3RDWA 3MAKA 4AJ6A 1F3AA 4POKA 4K2DA 2I3YA 4HZ4A 1I9DA 3QCPA 3UVHA 3IC4A 1R5PA 3TJGA 2HQTA 2MBSA 2X8GA 1JZWA 3M0FA 1VF3A 5GZZB 3ZIVA 3GKKA 3DEXA 3ZFBA 4WF4A 1TRUA 2DIYA 2CT6A 1H4OA 1Q4JA 5E59A 4FIWA 2IMKA 3RPNA 2CV4A 3LSZA 3PR8A 4ACSA 3BD2A 3FYGA 1PMTA 3Q6OA 1HYUA 2CVKA 3HCZA 5DDLA 1EGRA 1SL1B 1M0UA 3QFAC 1BYEA 4HDEA 1K0DA 3P8WA 5LCZA 3IV4A 3A3TA 5FWGA 4EE0A 4IP1A 1WJKA 2V2GA 1MDIA 3KD0A 3RHCA 1K0AA 3LYPA 1SKSB 1GTAA 2KHPA 5KN3A 4EO3A 3GYKA 4ECJA 4NWYA 2XBIA 2FGXA 1AQWA 4EKZA 2P5RA 4PGTA 3ZVJA 5KN2A 1XW9A 5IMFA 4JEDA 1HNCA 2NTOA 5FHIA 3R3EA 3TKSE 3F8UA 2IWTA 2VCWA 1O81A 4JZQA 1K0NA 4XS4A 1W4VA 2OJLA 3FEUA 2JADA 1HQOA 2B7JA 2CZ3A 5COHA 13GSA 2YANA 4NV2A 5BMUA 4ZBAA 3FK8A 1XOBA 1E6BA 4DVCA 2H30A 2GQKA 2A4VA 3G7IA 2YJ7A 5IO2A 1XBSA 2WZ9A 5AN1A 4TRXA 3E0UA 2UZ8A 3RBTA 4MJBA 2X64A 1J0FA 5IM9A 4NV5A 3KXOA 1FHEA 1Z5YE 3IOSA 2I9HA 2H70A 1YF1A 2AV4A 4ZL7A 3C8EA 2GT5A 5ECHB 2L6CA 3TJFA 2KLXA 4J2FA 1JZOA 4PXOA 2DJKA 1FG4A 1QFNA 1TP9A 2DLXA 2WCIA 3ZITA 4LA1A 2L4CA 1WWJA 2TRXA 2CQ9A 4ECBA 4EVMA 4MJAA 1R7HA 1FW1A 4TW5A 2ALBA 1WPIA 5J3RA 5ID2A 3KH7A 4GQFA 3ISOA 4D73A 4MF6A 1WRYA 2DMLA 4PQ1A 3D5JA 1PKWA 3WGEA 2O7KA 5CREA 1ZZYA 4YQMA 3WGDA 1F6MC 1WMJA 3VI7A 2VCZA 3QAVA 3DYRA 4ZXGA 1OC8A 1LBKA 2FCHA 4HOJA 1A24A 2AHEA 4MMMA 1XWAA 1QMVA 3KCMA 2LUSA 3C1RA 2PBJA 2CVBA 3Q74A 2V6OA 2QKEA 1S3AA 2GDRA 3TKQA 3RHBA 3P2AA 4BVYB 1Z6NA 1ZYEA 1GWCA 19GSA 2MBTA 3HVSA 4Q5NA 1ERVA 2B1KA 3LGCA 4V1Ap 4MP4A 3M9KA 4KX4A 1X9SB 2PPTA 3GV1A 1V9WA 3P7XA 5JWOB 5IOXA 5CO3A 1GP1A 1OAZA 2K9FA 2EIOA 2VM1A 1AQXA 3C1SA 5HFGA 3A5WA 2B6MA 1X9WB 1F2EA 3EU3A 3HA9A 3E9JB 3FR9A 5GAPD 5ECOB 4BL7A 4JE1A 4I2UA 3FR6A 4I8BA 1MD4A 2WRTA 3QFBC 4IN0A 1EOHA 4OCFA 4ZIJA 5GSTA 1YY7A 4H86A 5J5NA 1K3YA 4MF7A 2GZYA 3GX0A 3H8QA 1H75A 2H1DA 4QL7A 3W6GA 2M80A 2F8AA 4L0UA 3UAPA 3EMXA 3VPTA 4N10A 18GSA 5IIZA 3LXTA 1JFUA 1Z6MA 2F3MA 1Q98A 3CSHA 1SL2B 3O76A 2FWFA 1A2MA 1G6YA 3F6DA 1EWXA 4POBA 3DKSA 3TKSC 1EOGA 3MDKA 3WD6A 4G0IA 1SYXA 3GH9A 1YDKA 1T4YA 4V2MA 2LNTA 3HJMA 3TDGA 3D4TA 4I2TA 2J23A 3VWUA 4JU5A 3VI5A 2I4AA 1U88A 4KUNA 1TOFA 4KA0A 5AGYA 3TKRA 3ZREA 1A0FA 2OBIA 2PVOC 4MCUA 4I97A 1X9MB 4G0KA 3KH9A 5CRHA 4GWRA 2LKUA 4N11A 2CZ2A 1YF0A 1FVJA 4XIHA 2H66A 4G9HA 4N30A 4I5QA 5ECNB 5J9CA 4KDXA 5DQYA 3L78A 2R6KA 3TGZA 2OE1A 3LJRA 1RK4A 4GF0A 3GKNA 3LQ7A 3QMXA 4BWQA 1TJDA 4ULXA 3L9VA 3G9BA 3H1NA 3F9UA 3M1GA 2E7PA 5B8AA 3FRCA 4LLRA 2YOIA 2H75A 2YCDA 4XS6A 4MJCA 3EWLA 3TOTA 3KP8A 3F6FA 4E8HA 4HQSA 1U3AA 2KUCA 1X0RA 2C80A 3M8NA 4MZCA 1QK8A 3PH9A 1OKDA 2IN3A 3TOUA 5IOWA 3UBKA 3C71A 2GS3A 1XWBA 4TN8A 3IXRA 3L0HA 4XS4B 3NOFA 1V40A 4IKHA 4TR1A 1GNEA 4RQRA 1G7EA 1GLQA 4OD7A 2VLTA 3GL3A 3O3TA 5F0GA 1T1VA 2X99A 4ZL8A 2FA8A 2CAQA 2L5LA 3KGKA 2CA8A 2FD3A 2L6DA 4IJIA 1AW9A 1VF4A 1K0OA 4RUVA 1VF2A 4K0GA 2RUEA 9GSSA 1SK0A 3BJ5A 3MWHA 2VCTA 4POLA 5HQPA 3WGXA 1TU8A 1XVWA 2E2GA 1GTBA 1V2AA 2R37A 2YWOA 2C0EA 2JZSA 4KE3A 4E8EA 2CX4A 2FWEA
chains in the Genus database with same CATH superfamily
3EYTA 5HR1A 4D73B 5F8BA 3N9JA 4POMA 2CAIA 2DIZA 2HRFA 1XG8A 2H72A 1Z7RA 2MMZA 2GTUA 1GSDA 3UMAA 2XC2A 5A1NB 3IK9A 5ECRB 3DIEA 3GTUA 3KJYA 1YVLA 3S9FA 3BBYA 1A0RP 4X43A 3L9UA 22GSA 4OO4A 4HUAA 5HR2A 3TB2A 4ZBDA 4K0NA 4AF2A 2HI7A 3F3QA 4DSRA 1F3BA 5A4UA 3TUEA 3DVWA 5LD0A 4ML1A 1SKRB 5AIVA 1SK2A 3EC3A 1O6JA 2FY6A 2FWGA 3D22A 1GUHA 1ZMAA 5GAND 1U3IA 3QOUA 1VF1A 3L9SA 4GRFA 1MDJA 1WP0A 2FLSA 5G1KA 1XZOA 2I1UA 3SWLA 1TRVA 2HZFA 2PWJA 2EIRA 5G30A 5D9WA 1AC1A 1YQ1A 2E2MA 4KH7A 1ERTA 4XRDA 3FHKA 1OC9A 1XOAA 4GXZA 1R4WA 3GIXA 3Q19A 4XHMA 4TR0A 3I43A 1F9MA 2H71A 4EDZA 4P3YB 2R5GA 2GT6A 2ON5A 2PVQA 4W66A 4MPGA 2NBSA 2HSNB 1V57A 4KGIA 2P0GA 4DSQA 4JBBA 2H1AA 2R0CA 3IAS2 5GSSA 1GSYA 5H5RA 2X4AA 1JLVA 1X5CA 2FA4A 2VD1A 3V1WA 2C3QA 2HSHA 5IPHA 2BMXA 3L4NA 5J41A 3LW9A 5ECKB 4YAPA 1GH2A 5KN1A 3LYKA 5ABRA 1TI1A 3D0ZA 3BOAA 2M46A 2EC4A 1NSWA 1BF5A 4L5LA 3FZAA 2H01A 3GKXA 2VL2A 4IW9A 4KSOA 2XHFA 3F4RA 1T7PB 2H6ZA 1OYJA 4KCEA 5D9XA 2DC5A 1YJ6A 2B7KA 2O3EA 1V58A 3VWWA 3CSJA 2B5YA 1TXXA 2YN1A 4I6XA 4K2XA 4KW6A 4EIQA 4IQAA 2WW1A 2WB9A 1SL0B 4V1Ag 1EEMA 1JZDA 3I9V2 1AQVA 1MD3A 3KMNA 4PURA 3H4KA 10GSA 2HSYA 4NPBA 3VLNA 4DEJA 1GRXA 4BA7A 3HKRA 3GA4A 4X0XA 2GZZA 2RM6A 4GSSA 1A8LA 1GTUA 5ECQB 2EIQA 1M99A 2VUPA 3JCML 5JCWA 5B6MA 3RAZA 4RI7A 1O8WA 1DE1A 5C04A 4FYBA 5CRWA 2OE0A 4OWYA 3UEMA 8GSSA 3PINA 5A5KA 1UC7A 2JSZA 2PMTA 1W89A 3ERFA 5DVBA 4FQUA 1PKZA 4QQ7A 2LJKA 1EEJA 3UIWA 1SU9A 4Q5FA 1ACVA 3EU4A 4MZWA 1XWKA 3FZ5A 2DJ3A 4TVEA 2LRNA 3KM6A 2C1YA 4TR1B 3G7YA 1U6TA 2QA1A 1FOHA 4XTSA 5DAKA 3H79A 1TRSA 4WETA 2YZHA 1WIKA 1ML6A 4O5UA 3HJOA 2WVXB 4EIPA 5E4WA 2C0GA 1GNWA 1MEKA 3M9JA 2C0DA 5IMCA 2IFQA 1G7OA 4OFTA 4L5OA 5JCUA 3GURA 6GSSA 4ILFA 2H1BA 1B9YC 4YH2A 5D93A 1OE8A 1TK8B 4WKWA 4LL1B 1PFOA 3IC8A 1MTCA 2V32A 2IL3A 3ZIJA 1FO5A 3UARA 1GUKA 3VFIA 2H6YA 2DJ1A 1X5EA 5A5HA 3GKMA 5B8BA 4G0LA 2VCXA 3MIXA 1A23A 2TIRA 1FB6A 2DJ0A 3QPMA 1YEXA 4BIKA 1SKWB 5FT3A 1T00A 4WXTA 2LSTA 3IK7A 3HVVA 4N0ZA 3UOMA 2GSQA 5KOWA 1N2AA 4PUFC 1YEPA 1FVKA 3CRTA 1S3CA 4TR3A 4IGJA 1E2YA 1CQGA 3ZMLA 3VWXA 2DSAA 4J57E 2GLRA 1JLWA 2H0HA 1K0CA 5DJLA 2HZEA 5B6NA 2K18A 1GLPA 4BVXA 2RIIA 4BWSA 5IPGA 3KZQA 4KAEA 1A2LA 3GSTA 2LRCA 4HEA2 2ZCTA 4F82A 1QGVA 2NDOA 3I69A 2H76A 2RLIA 2KP1A 2K6VA 3P90A 1BAYA 1GL8A 1UVZA 1TDIA 5CP1A 2FNOA 3H93A 2ZNMA 3HD5A 4WBRD 4EUYA 1PRXA 1T4ZA 2DKIA 4K5RA 4TXVA 2DBCA 16GSA 1KBNA 4CY8A 3GMFA 4EXJA 3EVIA 1XCCA 3TKPA 2BTOT 5JCGA 2L59A 2OBKA 1F37A 4YKGA 3CYNA 2P31A 3D4MA 2O87A 1J9BA 2B3SA 3U6VA 3CRUA 2VLVA 4FXYP 4TXOA 4MH3A 3FMWA 3NZNA 5ECPB 5IQYA 3EURA 3IPZA 1AXDA 2N5BA 5DALA 2NVLA 4HJMA 4K6XA 1UA5A 4DSSA 1OC3A 2VD0A 2VIMA 1ON4A 4HI7A 5J40A 1UN2A 5KN0A 4LL4B 4F0CA 4O7HA 3ME8A 4E68A 1XW5A 4ZB7A 1FOVA 1BJXA 2YJHA 5D73A 2TRCP 5KOXA 4IP6A 4KB3A 3NIVA 20GSA 2YZUA 3FKFA 2A2RA 4JR4A 1SENA 1XFLA 3KEBA 2VOCA 1DBYA 2JL4A 4JRRA 1AAZA 5H5SA 4K7OA 1PD21 4G10A 4NHZA 3AY8A 2KP2A 5BMUB 5IMZA 1Z9HA 3GRXA 2VM2A 4PHZC 3F4SA 3CBUA 1YZXA 1GSQA 1ABAA 4FYCA 1XWCA 3ERWA 2VL3A 5F05A 2HXKA 2R3XA 1ZOFA 3PPUA 1B48A 2GSTA 3LG6A 2J9HA 1T8EB 2LJRA 2PU9C 2LEGA 1HNBA 3PGTA 4MA9A 1JHBA 2RM5A 3IR4A 3MSZA 1PSQA 5ECMB 2GQLA 4KCAA 1PGTA 2DKHA 3HY2A 4TOPA 4GSTA 5IMVA 2MMNA 2H0GA 2LRTA 2OA7A 4IQ1A 5ELAA 5ID2B 3C73A 1B4PA 4F03A 3GHAA 2C3NA 5ECIB 2QGVA 3WT2A 1USBA 1K3LA 1XPVA 2WULA 4X4JA 2YP6A 2VL9A 3CSIA 2NPBA 3KMOA 5A4WA 4G19A 3WYWA 4MZBA 4F0BA 5J4UA 2WJUA 4GTUA 5HR3A 3APQA 1PL1A 3UBLA 3IBHA 2C0FA 4F2IA 1BEDA 2V6KA 3GX8A 2IFQB 2KOKA 4ID0A 1RQMA 2MMOA 4OO5A 1XWGA 5KEJA 1KEBA 4N0VA 4FO5A 2AAWA 2XBQA 6GSXA 3LORA 4USSA 3HVXA 4QL9A 1SYRA 4WEYA 1Y25A 1QXHA 3HVNA 5A5HB 1KNGA 5EY6A 2I81A 1NW2A 4PUAA 3O6TA 1N8JA 2AJQB 4MPFA 2B1LA 1RW1A 4LMWA 5AIXA 3KP9A 2LV3A 4ECCA 3ZTLA 4MH2A 5C00A 4BL7B 3IHQA 4GLTA 3HHVA 2CX3A 6GSUA 3TCOA 2RUFA 2HZEB 2HSMA 5HFIA 4BVXB 4XRAA 2EFCA 1M2AA 2YWIA 1XVQA 4WR5A 2A2PA 3N5OA 3ZMKA 1A2JA 1TKDB 2DJ2A 1VGLA 5ELGA 14GSA 2X8CA 2LS5A 1FB0A 1ST9A 2GGTA 5ECSA 2YWNA 3A2VA 1TU7A 3ERGA 2BJXA 1S3DA 1EGOA 5G2ZA 2VCQA 1QUWA 3VURA 3KTLA 4ZB8A 2OKAA 1O7UA 5D9VA 1YKAA 5L71A 4HU7A 4AKIA 3FY7A 4O92A 1GSUA 1ZYQB 3HYPA 2WGRA 3TRQA 5D9TA 4CW9A 2YPMA 4EF0A 5CAXA 2L4QA 2PERA 1TI3A 2XPDA 1THOA 2WFCA 3BCKA 5A4VA 4MDCA 3HMJG 4K5SA 1XXUA 4HS1A 2H1GA 3CXGA 3HZ4A 7GSSA 4IBPA 2IMEA 5EL8A 4PI0C 4AI6A 2O85A 4MABA 3QDNA 2YV7A 3APSA 2GZPA 4AJ7A 2AYTA 3G7JA 2L57A 4L0WA 4WBJA 3E3EA 3TJKA 6GSTA 2R0GA 5ECLB 4LMVA 3DMLA 1PX7A 3TJBA 5D8IA 4ZBBA 3D21A 2A2SA 4HJ2A 4TXOB 3F3RA 4NMUA 1J08A 2EFHA 1THXA 2YV9A 4MJEA 5DALB 3TJJA 4WR4A 4IELA 1EV4A 2UV8G 4KDYA 4RI6A 2HRNA 2JZTA 4HZ2A 2VL2C 2HRKA 1WOUA 4OFNA 2K8VA 2R0PA 1OKTA 2OACA 1IYIA 1FAAA 2LTKA 4DSSB 3ZLPA 2WW2A 3VWVA 4CDOA 1EP8A 4JR6A 3C7MA 3HZ8A 3OR5A 1T3BA 1SJIA 4ZB6A 5F07A 2P5QA 1BQ7A 3M3MA 4PTSA 1TK0B 3ZFLA 2AUVA 2WDUA 2X8HA 3A2XA 3F4TA 1AUCA 1DE2A 1LJRA 4GQCA 4X1UA 4XCSA 5DCHA 5JWQB 1GTIA 4YQUA 1DSBA 4EDYA 2LJAA 3HDCA 4PQHA 3GL5A 5DBQA 3UJ1A 2H19A 2XPEA 3QR6A 5IMDA 3CTGA 1X5DA 3EE2A 3TU3B 4ICYA 2LQOA 5G31A 1AIUA 1K0MA 4ECIA 2DJJA 3GN3A 2ZUPA 2C3TA 3DXBA 3SBCA 3LFLA 3DD3A 2L5OA 1K3OA 4ZL9A 5A1NA 3FR3A 2GSRA 3IA1A 1PQNA 5IMAA 3TRXA 4Z2RA 1TRWA 3LWAA 3FZ9A 4V2LA 1ILOA 5DJMA 3QAGA 2V1MA 3LXZA 1LU4A 2FWHA 4IS0A 4K8MA 1GULA 1EV9A 4OCEA 1BX9A 1OE7A 2FHEA 4AKHA 3D6IA 2G2QA 4K7NA 1NHYA 1I5GA 4KNDA 1O73A 2HT9A 1Z3EA 1PX6A 4TKYA 2O89A 3LEFA 2GSSA 5CYYA 1PA3A 4RQXA 3ZZXA 2H8LA 3QAWA 3A2WA 3APOA 1KTEA 2YWMA 4KF9A 4WF5A 4K7IA 5EVOA 2LQQA 2WVYA 2YNXA 2PN8A 4PQIA 2DMMA 4CY6A 1IYHA 2HYXA 1A8YA 5INYA 2OADA 2C4JA 5LNKe 3ZL5A 3GTUB 3TKSA 1B9XC 3DRNA 3F0IA 1SJ6A 2R4VA 3GH6A 17GSA 2FUG2 2CVDA 5AISA 1N25A 3R2QA 3ME7A 1XW6A 2HSNA 2VAFA 3WT1A 3EMPA 1TW9A 5F06A 2IIYA 2N5FA 1Z7PA 6GSWA 4TR4A 4L8EA 1G0TA 3ZVJD 2E0QA 3J7Yk 3CMIA 3J7Yb 5CRDA 2B5XA 1OVNA 1G6WA 2IMDA 3VK9A 2HE3A 4ZILA 1EZKA 4HQZA 2WVZA 2JZRA 2REMA 2R2JA 1SD8A 3IRAA 2ON7A 3ZYWA 2H73A 4YAVA 4EC0A 1XIYA 1BG5A 1OC9B 3DVXA 4PI2C 5HR0A 4PX1A 1GSSA 2HSMB 4V2NA 4MLYA 6GSVA 5G1LA 3GNJA 2OE3A 4OFMA 4NHWA 2IMFA 5G5FA 4GDFA 1M9BA 2HFDA 3IAM2 2JSYA 3UL3A 3U5RE 4Z2TA 2H1LA 4YQVA 4OMVA 3Q18A 5DQSA 3TRPA 1Y6EA 3EINA 1I1IP 4G2EA 3FZ4A 1DUGA 5CRGA 4ISDA 4PNFA 5D96A 3MNGA 1ZCPA 4Z7XA 2H0IA 3FW2A 1VRSD 2VLUA 3US3A 4BPYA 5B7CA 5IO0A 1Y1UA 2IPAA 2B5EA 4MF5A 3HJPA 1PL2A 3BCIA 5JWRB 2C8UA 5ENUA 3GUSA 4O5RA 3VPQA 1JZRA 4K9ZA 4FYUA 3IHGA 1ZYPA 3HXSA 1B8XA 2K8SA 3IDVA 2IJYA 1K0BA 1SD9A 3KTBA 3IE3A 4MK3A 3DWVA 6GSYA 4ZB9A 3ED3A 2VCVA 2H74A 2V41A 1R5AA 4PNGA 3CTFA 1O8XA 1ZL9A 2QC7A 4J56E 2N5AA 3KIJA 4YKFA 3W8JA 2MZCA 1GUMA 2PGTA 4Q5RA 3W8SA 1V98A 3DGQA 5CNWA 4XS1A 1GSFA 5HFKA 4NXIA 2H6XA 2F8FA 2HRKB 1M2DA 4BVYA 2O5VA 3K8NA 4ML6A 4HU9A 4KDUA 1GSEA 1HD2A 1YEWC 1HNAA 1SK1A 2MYGA 4NAXA 12GSA 2D2ZA 4IVFA 2F9SA 1URMA 5DCGA 2VO4A 2O8VB 1SVOA 4KSMA 1M2BA 4AGSA 1WE0A 1ERUA 11GSA 2F51A 1YKCA 2HLSA 2GVPA 1PN9A 1CQHA 1M9AA 2QSIA 1C72A 2AB6A 4CHSA 3UVTA 3RPPA 4HSCX 1O85A 4O32A 2JU5A 1SJZA 2G0FA 5H5QA 2HRAA 3CWGA 2IMIA 2GQMA 5EPFA 2JACA 1R26A 4EL1A 1NHOA 3GFKA 2M72A 2LNSA 3QD9A 5DAKB 3I6AA 5G5EA 2PUKC 4K1FA 1M7TA 4IJ3A 3ZRDA 4F9ZA 1ERWA 2ES7A 3F63A 4IHUA 2WS2A 4GCIA 1EP7A 1U87A 4AJ8A 1MDKA 1QQ2A 1TTZA 5J9BA 1NM3A 1TK5B 2HNLA 3GSSA 4Q5QA 2Z9SA 4FH8A 1ZGNA 1B4QA 2MMAA 2OT3A 4G01A 4GSNA 3RDWA 3MAKA 4AJ6A 1F3AA 4POKA 4K2DA 2I3YA 4HZ4A 1I9DA 3QCPA 5J4VA 3RGBC 3UVHA 3IC4A 1R5PA 3MYDA 4AKXB 2WW0A 3TJGA 2HQTA 2MBSA 2X8GA 1JZWA 3M0FA 1VF3A 5GZZB 3ZIVA 3GKKA 3DEXA 3ZFBA 4WF4A 1TRUA 2DIYA 2CT6A 1H4OA 1Q4JA 5E59A 4FIWA 2IMKA 3RPNA 2CV4A 3LSZA 3PR8A 4ACSA 3BD2A 3FYGA 1PMTA 3Q6OA 1HYUA 2CVKA 3HCZA 5DDLA 1EGRA 1SL1B 1M0UA 3QFAC 1BYEA 4HDEA 1K0DA 3P8WA 2QA2A 5LCZA 2WZSA 3IV4A 3A3TA 5FWGA 4EE0A 1WJKA 4IP1A 2V2GA 1MDIA 3KD0A 3RHCA 1K0AA 3LYPA 1SKSB 1GTAA 2KHPA 5KN3A 4EO3A 3GYKA 4ECJA 4NWYA 2XBIA 2FGXA 1AQWA 4EKZA 2P5RA 4PGTA 3ZVJA 5KN2A 1XW9A 5IMFA 4JEDA 1HNCA 2NTOA 5FHIA 3RFRC 3R3EA 3TKSE 3F8UA 2IWTA 2VCWA 1O81A 4JZQA 1K0NA 4XS4A 1W4VA 1ZYNA 2OJLA 3FEUA 2JADA 1HQOA 2B7JA 2CZ3A 5COHA 13GSA 2YANA 4NV2A 5BMUA 4O5QA 4ZBAA 3FK8A 1XOBA 1E6BA 4DVCA 2H30A 2GQKA 2A4VA 3G7IA 2YJ7A 5IO2A 1XBSA 2WZ9A 5AN1A 4TRXA 3E0UA 2UZ8A 3RBTA 4MJBA 2X64A 1J0FA 5IM9A 4NV5A 3KXOA 2EFEA 1FHEA 1Z5YE 3IOSA 2I9HA 5A34A 2H70A 1YF1A 2AV4A 4ZL7A 3C8EA 2GT5A 5ECHB 2L6CA 2WW3A 3TJFA 2KLXA 4J2FA 1JZOA 4PXOA 2DJKA 1FG4A 4MNNA 1QFNA 1TP9A 2DLXA 1M3IA 2WCIA 3ZITA 4LA1A 2L4CA 1WWJA 2TRXA 2CQ9A 4ECBA 4EVMA 4MJAA 1R7HA 1FW1A 4TW5A 2ALBA 1WPIA 5J3RA 5ID2A 3KH7A 4GQFA 3ISOA 4D73A 4MF6A 1WRYA 1M3JA 2DMLA 4PQ1A 3D5JA 1PKWA 3WGEA 2O7KA 5CREA 1ZZYA 4YQMA 3WGDA 1F6MC 1WMJA 3VI7A 2VCZA 3QAVA 3DYRA 4ZXGA 1OC8A 1LBKA 2FCHA 4HOJA 1A24A 2AHEA 4MMMA 5J47A 1XWAA 1QMVA 3KCMA 2LUSA 3C1RA 2PBJA 2CVBA 3Q74A 2V6OA 2QKEA 1S3AA 2GDRA 3TKQA 3RHBA 3P2AA 4BVYB 4N3ZA 1Z6NA 1ZYEA 1GWCA 19GSA 2MBTA 3HVSA 4Q5NA 1ERVA 2B1KA 3LGCA 4V1Ap 4MP4A 3M9KA 4KX4A 1X9SB 2PPTA 3GV1A 1V9WA 3CHXC 3P7XA 5JWOB 5IOXA 5CO3A 1GP1A 1OAZA 2K9FA 2EIOA 2VM1A 1AQXA 3C1SA 5HFGA 3A5WA 2B6MA 1X9WB 1F2EA 3EU3A 3HA9A 3E9JB 3FR9A 5GAPD 1SVMA 1TXUA 5ECOB 4BL7A 4JE1A 4I2UA 3FR6A 4I8BA 1MD4A 2WRTA 3QFBC 4IN0A 1EOHA 4OCFA 4ZIJA 5GSTA 1YY7A 4H86A 5J5NA 4QMKA 1K3YA 4MF7A 2GZYA 3GX0A 3H8QA 1H75A 4AKGA 2H1DA 4QL7A 2A4HA 3W6GA 2M80A 2F8AA 4L0UA 3UAPA 3EMXA 3VPTA 4N10A 18GSA 5IIZA 3LXTA 5BRTA 1JFUA 1Z6MA 2F3MA 1Q98A 3CSHA 1SL2B 3O76A 2FWFA 1A2MA 1G6YA 3F6DA 1EWXA 4POBA 3DKSA 3TKSC 1EOGA 3MDKA 3WD6A 4G0IA 1SYXA 3GH9A 1YDKA 1T4YA 4V2MA 2LNTA 3HJMA 3TDGA 3D4TA 4I2TA 2J23A 3VWUA 4JU5A 3VI5A 2I4AA 1U88A 4KUNA 1TOFA 4KA0A 5AGYA 3TKRA 3ZREA 1A0FA 2OBIA 2PVOC 4MCUA 4I97A 1X9MB 1S4BP 4G0KA 3KH9A 5CRHA 4GWRA 1SVLA 2X49A 2LKUA 3CQFA 4N11A 4Z2UA 2CZ2A 1YF0A 2VKZG 1FVJA 2EFDA 4XIHA 2H66A 4G9HA 4N30A 1BG1A 4I5QA 5ECNB 5J9CA 4KDXA 5DQYA 3L78A 2R6KA 3TGZA 2OE1A 3LJRA 1RK4A 3GKNA 4GF0A 3LQ7A 3QMXA 4BWQA 1TJDA 4ULXA 3G9BA 3L9VA 3H1NA 3F9UA 3M1GA 2E7PA 5B8AA 3FRCA 4LLRA 2YOIA 2H75A 2YCDA 4XS6A 4MJCA 3EWLA 3TOTA 3KP8A 3F6FA 4E8HA 4HQSA 1S3RA 3A5IA 1U3AA 2KUCA 1X0RA 2C80A 3M8NA 4MZCA 1QK8A 3PH9A 4A5PA 1OKDA 2IN3A 3TOUA 5IOWA 3UBKA 3C71A 2GS3A 1XWBA 4TN8A 3IXRA 3L0HA 4XS4B 3NOFA 1V40A 1PN0A 4IKHA 4TR1A 1GNEA 4RQRA 1G7EA 1GLQA 4OD7A 3EPTA 2VLTA 3GL3A 3O3TA 5F0GA 1T1VA 2X99A 4ZL8A 2FA8A 2CAQA 2WVXA 2L5LA 3KGKA 2CA8A 2FD3A 2L6DA 4IJIA 1AW9A 1VF4A 5A34B 1K0OA 4RUVA 1VF2A 4K0GA 2RUEA 9GSSA 1SK0A 3BJ5A 3MWHA 2VCTA 4POLA 5HQPA 3WGXA 1TU8A 1XVWA 2E2GA 1GTBA 1V2AA 2R37A 2YWOA 2C0EA 2JZSA 5J4YA 4KE3A 4E8EA 2O36A 2CX4A 2FWEA
chains in the Genus database with same CATH topology
3EYTA 5HR1A 4D73B 5F8BA 3N9JA 4POMA 2CAIA 2DIZA 2HRFA 2H72A 1Z7RA 2MMZA 2GTUA 1GSDA 3UMAA 2XC2A 5A1NB 3IK9A 5ECRB 3DIEA 3GTUA 3KJYA 1YVLA 3S9FA 3BBYA 1A0RP 4X43A 3L9UA 22GSA 4OO4A 4HUAA 5HR2A 3TB2A 4ZBDA 4K0NA 4AF2A 2HI7A 3F3QA 4DSRA 1F3BA 5A4UA 3TUEA 3DVWA 5LD0A 4ML1A 1SKRB 5AIVA 1SK2A 3EC3A 1O6JA 2FY6A 2FWGA 3D22A 1GUHA 1ZMAA 5GAND 1U3IA 3QOUA 1VF1A 3L9SA 4GRFA 1MDJA 1WP0A 2FLSA 5G1KA 1XZOA 2I1UA 3SWLA 1TRVA 2HZFA 2PWJA 2EIRA 5G30A 5D9WA 1AC1A 1YQ1A 2E2MA 4KH7A 1ERTA 4XRDA 3FHKA 1OC9A 1XOAA 4GXZA 1R4WA 3GIXA 3Q19A 4XHMA 4TR0A 3I43A 1F9MA 2H71A 4EDZA 4P3YB 2R5GA 2GT6A 2ON5A 2PVQA 4W66A 4MPGA 2NBSA 2HSNB 1V57A 4KGIA 2P0GA 4DSQA 4JBBA 2H1AA 2R0CA 3IAS2 5GSSA 1GSYA 5H5RA 2X4AA 1JLVA 1X5CA 2FA4A 2VD1A 3V1WA 2C3QA 2HSHA 5IPHA 2BMXA 3L4NA 5J41A 3LW9A 5ECKB 4YAPA 1GH2A 5KN1A 3LYKA 5ABRA 1TI1A 3D0ZA 3BOAA 2M46A 2EC4A 1NSWA 1BF5A 4L5LA 3FZAA 2H01A 3GKXA 2VL2A 4IW9A 4KSOA 2XHFA 3F4RA 1T7PB 2H6ZA 1OYJA 4KCEA 5D9XA 2DC5A 1YJ6A 2B7KA 1V58A 3VWWA 3CSJA 2B5YA 1TXXA 2YN1A 4I6XA 4K2XA 4KW6A 4EIQA 4IQAA 2WB9A 1SL0B 4V1Ag 1EEMA 1JZDA 3I9V2 1AQVA 1MD3A 3KMNA 4PURA 3H4KA 10GSA 2HSYA 4NPBA 3VLNA 4DEJA 1GRXA 4BA7A 3HKRA 3GA4A 4X0XA 2GZZA 2RM6A 4GSSA 1A8LA 1GTUA 5ECQB 2EIQA 1M99A 2VUPA 3JCML 5JCWA 5B6MA 3RAZA 4RI7A 1O8WA 1DE1A 5C04A 4FYBA 5CRWA 2OE0A 4OWYA 3UEMA 8GSSA 3PINA 5A5KA 1UC7A 2JSZA 2PMTA 1W89A 3ERFA 5DVBA 4FQUA 1PKZA 4QQ7A 2LJKA 1EEJA 3UIWA 1SU9A 4Q5FA 1ACVA 3EU4A 4MZWA 1XWKA 3FZ5A 2DJ3A 4TVEA 2LRNA 3KM6A 2C1YA 4TR1B 3G7YA 1U6TA 2QA1A 1FOHA 4XTSA 5DAKA 3H79A 1TRSA 4WETA 2YZHA 1WIKA 1ML6A 4O5UA 3HJOA 4EIPA 5E4WA 2C0GA 1GNWA 1MEKA 3M9JA 2C0DA 5IMCA 2IFQA 1G7OA 4OFTA 4L5OA 5JCUA 3GURA 6GSSA 4ILFA 2H1BA 1B9YC 4YH2A 5D93A 1OE8A 1TK8B 4WKWA 4LL1B 3IC8A 1MTCA 2V32A 2IL3A 3ZIJA 1FO5A 3UARA 1GUKA 3VFIA 2H6YA 2DJ1A 1X5EA 5A5HA 3GKMA 5B8BA 4G0LA 2VCXA 3MIXA 1A23A 2TIRA 1FB6A 2DJ0A 3QPMA 1YEXA 1SKWB 5FT3A 1T00A 4WXTA 2LSTA 3IK7A 3HVVA 4N0ZA 3UOMA 2GSQA 5KOWA 1N2AA 4PUFC 1YEPA 1FVKA 3CRTA 1S3CA 4TR3A 4IGJA 1E2YA 1CQGA 3ZMLA 3VWXA 2DSAA 4J57E 2GLRA 1JLWA 2H0HA 1K0CA 5DJLA 2HZEA 5B6NA 2K18A 1GLPA 4BVXA 2RIIA 4BWSA 5IPGA 3KZQA 4KAEA 1A2LA 3GSTA 2LRCA 4HEA2 2ZCTA 4F82A 1QGVA 2NDOA 3I69A 2H76A 2RLIA 2KP1A 2K6VA 3P90A 1BAYA 1GL8A 1UVZA 1TDIA 5CP1A 2FNOA 3H93A 2ZNMA 3HD5A 4WBRD 4EUYA 1PRXA 1T4ZA 2DKIA 4K5RA 4TXVA 2DBCA 16GSA 1KBNA 4CY8A 3GMFA 4EXJA 3EVIA 1XCCA 3TKPA 2BTOT 5JCGA 2L59A 2OBKA 1F37A 4YKGA 3CYNA 2P31A 3D4MA 2O87A 1J9BA 2B3SA 3U6VA 3CRUA 2VLVA 4TXOA 4MH3A 3FMWA 3NZNA 5ECPB 5IQYA 3EURA 3IPZA 1AXDA 2N5BA 5DALA 2NVLA 4HJMA 4K6XA 1UA5A 4DSSA 1OC3A 2VD0A 2VIMA 1ON4A 4HI7A 5J40A 1UN2A 5KN0A 4LL4B 4F0CA 4O7HA 3ME8A 4E68A 1XW5A 4ZB7A 1FOVA 1BJXA 2YJHA 5D73A 2TRCP 5KOXA 4IP6A 4KB3A 3NIVA 20GSA 2YZUA 3FKFA 2A2RA 4JR4A 1SENA 1XFLA 3KEBA 2VOCA 1DBYA 2JL4A 4JRRA 1AAZA 5H5SA 4K7OA 1PD21 4G10A 4NHZA 3AY8A 2KP2A 5BMUB 5IMZA 1Z9HA 3GRXA 2VM2A 3F4SA 3CBUA 1YZXA 1GSQA 1ABAA 4FYCA 1XWCA 3ERWA 2VL3A 5F05A 2HXKA 2R3XA 1ZOFA 3PPUA 1B48A 2GSTA 3LG6A 2J9HA 1T8EB 2LJRA 2PU9C 2LEGA 1HNBA 3PGTA 4MA9A 1JHBA 2RM5A 3IR4A 3MSZA 1PSQA 5ECMB 2GQLA 4KCAA 1PGTA 2DKHA 3HY2A 4TOPA 4GSTA 5IMVA 2MMNA 2H0GA 2LRTA 2OA7A 4IQ1A 5ELAA 5ID2B 3C73A 1B4PA 4F03A 3GHAA 2C3NA 5ECIB 2QGVA 3WT2A 1USBA 1K3LA 1XPVA 2WULA 4X4JA 2YP6A 2VL9A 3CSIA 2NPBA 3KMOA 5A4WA 4G19A 3WYWA 4MZBA 4F0BA 5J4UA 2WJUA 4GTUA 5HR3A 3APQA 1PL1A 3UBLA 3IBHA 2C0FA 4F2IA 1BEDA 2V6KA 3GX8A 2IFQB 2KOKA 4ID0A 1RQMA 2MMOA 4OO5A 1XWGA 5KEJA 1KEBA 4N0VA 4FO5A 2AAWA 2XBQA 6GSXA 3LORA 4USSA 3HVXA 4QL9A 1SYRA 4WEYA 1Y25A 1QXHA 5A5HB 1KNGA 5EY6A 2I81A 1NW2A 4PUAA 3O6TA 1N8JA 2AJQB 4MPFA 2B1LA 1RW1A 4LMWA 5AIXA 3KP9A 2LV3A 4ECCA 3ZTLA 4MH2A 5C00A 4BL7B 3IHQA 4GLTA 3HHVA 2CX3A 6GSUA 3TCOA 2RUFA 2HZEB 2HSMA 5HFIA 4BVXB 4XRAA 2EFCA 1M2AA 2YWIA 1XVQA 4WR5A 2A2PA 3N5OA 3ZMKA 1A2JA 1TKDB 2DJ2A 1VGLA 5ELGA 14GSA 2X8CA 2LS5A 1FB0A 1ST9A 2GGTA 5ECSA 2YWNA 3A2VA 1TU7A 3ERGA 2BJXA 1S3DA 1EGOA 5G2ZA 2VCQA 1QUWA 3VURA 3KTLA 4ZB8A 2OKAA 1O7UA 5D9VA 1YKAA 5L71A 4HU7A 4AKIA 3FY7A 4O92A 1GSUA 1ZYQB 3HYPA 2WGRA 3TRQA 5D9TA 4CW9A 2YPMA 4EF0A 5CAXA 2L4QA 2PERA 1TI3A 2XPDA 1THOA 2WFCA 3BCKA 5A4VA 4MDCA 3HMJG 4K5SA 1XXUA 4HS1A 2H1GA 3CXGA 3HZ4A 7GSSA 4IBPA 2IMEA 5EL8A 4AI6A 2O85A 4MABA 3QDNA 2YV7A 3APSA 2GZPA 4AJ7A 2AYTA 3G7JA 2L57A 4L0WA 4WBJA 3E3EA 3TJKA 6GSTA 2R0GA 5ECLB 4LMVA 3DMLA 1PX7A 3TJBA 5D8IA 4ZBBA 3D21A 2A2SA 4HJ2A 4TXOB 3F3RA 4NMUA 1J08A 2EFHA 1THXA 2YV9A 4MJEA 5DALB 3TJJA 4WR4A 4IELA 1EV4A 2UV8G 4KDYA 4RI6A 2HRNA 2JZTA 4HZ2A 2VL2C 2HRKA 1WOUA 4OFNA 2K8VA 2R0PA 1OKTA 2OACA 1IYIA 1FAAA 2LTKA 4DSSB 3ZLPA 3VWVA 4CDOA 1EP8A 4JR6A 3C7MA 3HZ8A 3OR5A 1T3BA 1SJIA 4ZB6A 5F07A 2P5QA 1BQ7A 3M3MA 4PTSA 1TK0B 3ZFLA 2AUVA 2WDUA 2X8HA 3A2XA 3F4TA 1AUCA 1DE2A 1LJRA 4GQCA 4X1UA 4XCSA 5DCHA 5JWQB 1GTIA 4YQUA 1DSBA 4EDYA 2LJAA 3HDCA 4PQHA 3GL5A 5DBQA 3UJ1A 2H19A 2XPEA 3QR6A 5IMDA 3CTGA 1X5DA 3EE2A 3TU3B 4ICYA 2LQOA 5G31A 1AIUA 1K0MA 4ECIA 2DJJA 3GN3A 2ZUPA 2C3TA 3DXBA 3SBCA 3LFLA 3DD3A 2L5OA 1K3OA 4ZL9A 5A1NA 3FR3A 2GSRA 3IA1A 1PQNA 5IMAA 3TRXA 4Z2RA 1TRWA 3LWAA 3FZ9A 4V2LA 1ILOA 5DJMA 3QAGA 2V1MA 3LXZA 1LU4A 2FWHA 4IS0A 4K8MA 1GULA 1EV9A 4OCEA 1BX9A 1OE7A 2FHEA 4AKHA 3D6IA 2G2QA 4K7NA 1NHYA 1I5GA 4KNDA 1O73A 2HT9A 1Z3EA 1PX6A 4TKYA 2O89A 3LEFA 2GSSA 5CYYA 1PA3A 4RQXA 3ZZXA 2H8LA 3QAWA 3A2WA 3APOA 1KTEA 2YWMA 4KF9A 4WF5A 4K7IA 5EVOA 2LQQA 2YNXA 2PN8A 4PQIA 2DMMA 4CY6A 1IYHA 2HYXA 1A8YA 5INYA 2OADA 2C4JA 5LNKe 3ZL5A 3GTUB 3TKSA 1B9XC 3DRNA 3F0IA 1SJ6A 2R4VA 3GH6A 17GSA 2FUG2 2CVDA 5AISA 1N25A 3R2QA 3ME7A 1XW6A 2HSNA 2VAFA 3WT1A 3EMPA 1TW9A 5F06A 2IIYA 2N5FA 1Z7PA 6GSWA 4TR4A 4L8EA 1G0TA 3ZVJD 2E0QA 3J7Yk 3CMIA 3J7Yb 5CRDA 2B5XA 1OVNA 1G6WA 2IMDA 3VK9A 2HE3A 4ZILA 1EZKA 4HQZA 2JZRA 2REMA 2R2JA 1SD8A 3IRAA 2ON7A 3ZYWA 2H73A 4YAVA 4EC0A 1XIYA 1BG5A 1OC9B 3DVXA 5HR0A 4PX1A 1GSSA 2HSMB 4V2NA 4MLYA 6GSVA 5G1LA 3GNJA 2OE3A 4OFMA 4NHWA 2IMFA 5G5FA 4GDFA 1M9BA 2HFDA 3IAM2 2JSYA 3UL3A 3U5RE 4Z2TA 2H1LA 4YQVA 4OMVA 3Q18A 5DQSA 3TRPA 1Y6EA 3EINA 4G2EA 3FZ4A 1DUGA 5CRGA 4ISDA 4PNFA 5D96A 3MNGA 1ZCPA 4Z7XA 2H0IA 3FW2A 1VRSD 2VLUA 3US3A 4BPYA 5B7CA 5IO0A 1Y1UA 2IPAA 2B5EA 4MF5A 3HJPA 1PL2A 3BCIA 5JWRB 2C8UA 5ENUA 3GUSA 4O5RA 3VPQA 1JZRA 4K9ZA 4FYUA 3IHGA 1ZYPA 3HXSA 1B8XA 2K8SA 3IDVA 2IJYA 1K0BA 1SD9A 3KTBA 3IE3A 4MK3A 3DWVA 6GSYA 4ZB9A 3ED3A 2VCVA 2H74A 2V41A 1R5AA 4PNGA 3CTFA 1O8XA 1ZL9A 2QC7A 4J56E 2N5AA 3KIJA 4YKFA 3W8JA 2MZCA 1GUMA 2PGTA 4Q5RA 3W8SA 1V98A 3DGQA 5CNWA 4XS1A 1GSFA 5HFKA 4NXIA 2H6XA 2F8FA 2HRKB 1M2DA 4BVYA 2O5VA 3K8NA 4ML6A 4HU9A 4KDUA 1GSEA 1HD2A 1HNAA 1SK1A 2MYGA 4NAXA 12GSA 2D2ZA 4IVFA 2F9SA 1URMA 5DCGA 2VO4A 2O8VB 1SVOA 4KSMA 1M2BA 4AGSA 1WE0A 1ERUA 11GSA 2F51A 1YKCA 2HLSA 2GVPA 1PN9A 1CQHA 1M9AA 2QSIA 1C72A 2AB6A 4CHSA 3UVTA 3RPPA 1O85A 4O32A 2JU5A 1SJZA 2G0FA 5H5QA 2HRAA 3CWGA 2IMIA 2GQMA 5EPFA 2JACA 1R26A 4EL1A 1NHOA 3GFKA 2M72A 2LNSA 3QD9A 5DAKB 3I6AA 5G5EA 2PUKC 4K1FA 1M7TA 4IJ3A 3ZRDA 4F9ZA 1ERWA 2ES7A 3F63A 4IHUA 2WS2A 4GCIA 1EP7A 1U87A 4AJ8A 1MDKA 1QQ2A 1TTZA 5J9BA 1NM3A 1TK5B 2HNLA 3GSSA 4Q5QA 2Z9SA 4FH8A 1ZGNA 1B4QA 2MMAA 2OT3A 4G01A 4GSNA 3RDWA 3MAKA 4AJ6A 1F3AA 4POKA 4K2DA 2I3YA 4HZ4A 1I9DA 3QCPA 5J4VA 3UVHA 3IC4A 1R5PA 3MYDA 4AKXB 3TJGA 2HQTA 2MBSA 2X8GA 1JZWA 3M0FA 1VF3A 5GZZB 3ZIVA 3GKKA 3DEXA 3ZFBA 4WF4A 1TRUA 2DIYA 2CT6A 1H4OA 1Q4JA 5E59A 4FIWA 2IMKA 3RPNA 2CV4A 3LSZA 3PR8A 4ACSA 3BD2A 3FYGA 1PMTA 3Q6OA 1HYUA 2CVKA 3HCZA 5DDLA 1EGRA 1SL1B 1M0UA 3QFAC 1BYEA 4HDEA 1K0DA 3P8WA 2QA2A 5LCZA 3IV4A 3A3TA 5FWGA 4EE0A 1WJKA 4IP1A 2V2GA 1MDIA 3KD0A 3RHCA 1K0AA 3LYPA 1SKSB 1GTAA 2KHPA 5KN3A 4EO3A 3GYKA 4ECJA 4NWYA 2XBIA 2FGXA 1AQWA 4EKZA 2P5RA 4PGTA 3ZVJA 5KN2A 1XW9A 5IMFA 4JEDA 1HNCA 2NTOA 5FHIA 3R3EA 3TKSE 3F8UA 2IWTA 2VCWA 1O81A 4JZQA 1K0NA 4XS4A 1W4VA 1ZYNA 2OJLA 3FEUA 2JADA 1HQOA 2B7JA 2CZ3A 5COHA 13GSA 2YANA 4NV2A 5BMUA 4O5QA 4ZBAA 3FK8A 1XOBA 1E6BA 4DVCA 2H30A 2GQKA 2A4VA 3G7IA 2YJ7A 5IO2A 1XBSA 2WZ9A 5AN1A 4TRXA 3E0UA 2UZ8A 3RBTA 4MJBA 2X64A 1J0FA 5IM9A 4NV5A 3KXOA 2EFEA 1FHEA 1Z5YE 3IOSA 2I9HA 5A34A 2H70A 1YF1A 2AV4A 4ZL7A 3C8EA 2GT5A 5ECHB 2L6CA 3TJFA 2KLXA 4J2FA 1JZOA 4PXOA 2DJKA 1FG4A 4MNNA 1QFNA 1TP9A 2DLXA 2WCIA 3ZITA 4LA1A 2L4CA 1WWJA 2TRXA 2CQ9A 4ECBA 4EVMA 4MJAA 1R7HA 1FW1A 4TW5A 2ALBA 1WPIA 5J3RA 5ID2A 3KH7A 4GQFA 3ISOA 4D73A 4MF6A 1WRYA 2DMLA 4PQ1A 3D5JA 1PKWA 3WGEA 2O7KA 5CREA 1ZZYA 4YQMA 3WGDA 1F6MC 1WMJA 3VI7A 2VCZA 3QAVA 3DYRA 4ZXGA 1OC8A 1LBKA 2FCHA 4HOJA 1A24A 2AHEA 4MMMA 5J47A 1XWAA 1QMVA 3KCMA 2LUSA 3C1RA 2PBJA 2CVBA 3Q74A 2V6OA 2QKEA 1S3AA 2GDRA 3TKQA 3RHBA 3P2AA 4BVYB 4N3ZA 1Z6NA 1ZYEA 1GWCA 19GSA 2MBTA 3HVSA 4Q5NA 1ERVA 2B1KA 3LGCA 4V1Ap 4MP4A 3M9KA 4KX4A 1X9SB 2PPTA 3GV1A 1V9WA 3P7XA 5JWOB 5IOXA 5CO3A 1GP1A 1OAZA 2K9FA 2EIOA 2VM1A 1AQXA 3C1SA 5HFGA 3A5WA 2B6MA 1X9WB 1F2EA 3EU3A 3HA9A 3E9JB 3FR9A 5GAPD 1SVMA 1TXUA 5ECOB 4BL7A 4JE1A 4I2UA 3FR6A 4I8BA 1MD4A 2WRTA 3QFBC 4IN0A 1EOHA 4OCFA 4ZIJA 5GSTA 1YY7A 4H86A 5J5NA 4QMKA 1K3YA 4MF7A 2GZYA 3GX0A 3H8QA 1H75A 4AKGA 2H1DA 4QL7A 2A4HA 3W6GA 2M80A 2F8AA 4L0UA 3UAPA 3EMXA 3VPTA 4N10A 18GSA 5IIZA 3LXTA 5BRTA 1JFUA 1Z6MA 2F3MA 1Q98A 3CSHA 1SL2B 3O76A 2FWFA 1A2MA 1G6YA 3F6DA 1EWXA 4POBA 3DKSA 3TKSC 1EOGA 3MDKA 3WD6A 4G0IA 1SYXA 3GH9A 1YDKA 1T4YA 4V2MA 2LNTA 3HJMA 3TDGA 3D4TA 4I2TA 2J23A 3VWUA 4JU5A 3VI5A 2I4AA 1U88A 4KUNA 1TOFA 4KA0A 5AGYA 3TKRA 3ZREA 1A0FA 2OBIA 2PVOC 4MCUA 4I97A 1X9MB 4G0KA 3KH9A 5CRHA 4GWRA 1SVLA 2X49A 2LKUA 4N11A 4Z2UA 2CZ2A 1YF0A 2VKZG 1FVJA 2EFDA 4XIHA 2H66A 4G9HA 4N30A 1BG1A 4I5QA 5ECNB 5J9CA 4KDXA 5DQYA 3L78A 2R6KA 3TGZA 2OE1A 3LJRA 1RK4A 3GKNA 4GF0A 3LQ7A 3QMXA 4BWQA 1TJDA 4ULXA 3L9VA 3G9BA 3H1NA 3F9UA 3M1GA 2E7PA 5B8AA 3FRCA 4LLRA 2YOIA 2H75A 2YCDA 4XS6A 4MJCA 3EWLA 3TOTA 3KP8A 3F6FA 4E8HA 4HQSA 3A5IA 1U3AA 2KUCA 1X0RA 2C80A 3M8NA 4MZCA 1QK8A 3PH9A 4A5PA 1OKDA 2IN3A 3TOUA 5IOWA 3UBKA 3C71A 2GS3A 1XWBA 4TN8A 3IXRA 3L0HA 4XS4B 3NOFA 1V40A 1PN0A 4IKHA 4TR1A 1GNEA 4RQRA 1G7EA 1GLQA 4OD7A 3EPTA 2VLTA 3GL3A 3O3TA 5F0GA 1T1VA 2X99A 4ZL8A 2FA8A 2CAQA 2L5LA 3KGKA 2CA8A 2FD3A 2L6DA 4IJIA 1AW9A 1VF4A 5A34B 1K0OA 4RUVA 1VF2A 4K0GA 2RUEA 9GSSA 1SK0A 3BJ5A 3MWHA 2VCTA 4POLA 5HQPA 3WGXA 1TU8A 1XVWA 2E2GA 1GTBA 1V2AA 2R37A 2YWOA 2C0EA 2JZSA 5J4YA 4KE3A 4E8EA 2CX4A 2FWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYT A;  5HR1 A;  4D73 B;  5F8B A;  3N9J A;  4POM A;  2CAI A;  2DIZ A;  2HRF A;  2H72 A;  1Z7R A;  2MMZ A;  2GTU A;  1GSD A;  3UMA A;  2XC2 A;  3IK9 A;  5ECR B;  3DIE A;  3GTU A;  3KJY A;  3S9F A;  3BBY A;  1A0R P;  4X43 A;  3L9U A;  22GS A;  4OO4 A;  4HUA A;  5HR2 A;  3TB2 A;  4ZBD A;  4K0N A;  4AF2 A;  2HI7 A;  3F3Q A;  4DSR A;  1F3B A;  5A4U A;  3TUE A;  3DVW A;  5LD0 A;  4ML1 A;  1SKR B;  5AIV A;  1SK2 A;  3EC3 A;  1O6J A;  2FY6 A;  2FWG A;  3D22 A;  1GUH A;  1ZMA A;  5GAN D;  1U3I A;  3QOU A;  1VF1 A;  3L9S A;  4GRF A;  1MDJ A;  1WP0 A;  2FLS A;  5G1K A;  1XZO A;  2I1U A;  3SWL A;  1TRV A;  2HZF A;  2PWJ A;  2EIR A;  5G30 A;  5D9W A;  1AC1 A;  1YQ1 A;  2E2M A;  4KH7 A;  1ERT A;  4XRD A;  3FHK A;  1OC9 A;  1XOA A;  4GXZ A;  1R4W A;  3GIX A;  3Q19 A;  4XHM A;  4TR0 A;  3I43 A;  1F9M A;  2H71 A;  4EDZ A;  4P3Y B;  2R5G A;  2GT6 A;  2ON5 A;  2PVQ A;  4MPG A;  2NBS A;  2HSN B;  1V57 A;  4KGI A;  2P0G A;  4DSQ A;  4JBB A;  2H1A A;  3IAS 2;  5GSS A;  1GSY A;  5H5R A;  1JLV A;  1X5C A;  2FA4 A;  2VD1 A;  3V1W A;  2C3Q A;  2HSH A;  5IPH A;  2BMX A;  3L4N A;  5J41 A;  5ECK B;  4YAP A;  1GH2 A;  5KN1 A;  3LYK A;  5ABR A;  1TI1 A;  3D0Z A;  3BOA A;  2M46 A;  2EC4 A;  1NSW A;  3FZA A;  4L5L A;  3GKX A;  2H01 A;  2VL2 A;  4IW9 A;  4KSO A;  2XHF A;  3F4R A;  1T7P B;  2H6Z A;  1OYJ A;  4KCE A;  5D9X A;  2DC5 A;  1YJ6 A;  2B7K A;  1V58 A;  3VWW A;  3CSJ A;  2B5Y A;  1TXX A;  2YN1 A;  4I6X A;  4KW6 A;  4IQA A;  2WB9 A;  1SL0 B;  4V1A g;  1EEM A;  1JZD A;  3I9V 2;  1AQV A;  1MD3 A;  3KMN A;  4PUR A;  3H4K A;  10GS A;  2HSY A;  4NPB A;  3VLN A;  4DEJ A;  1GRX A;  4BA7 A;  3HKR A;  3GA4 A;  4X0X A;  2GZZ A;  2RM6 A;  4GSS A;  1A8L A;  1GTU A;  5ECQ B;  2EIQ A;  1M99 A;  2VUP A;  3JCM L;  5JCW A;  5B6M A;  3RAZ A;  4RI7 A;  1O8W A;  1DE1 A;  5C04 A;  4FYB A;  5CRW A;  2OE0 A;  4OWY A;  3UEM A;  8GSS A;  3PIN A;  5A5K A;  1UC7 A;  2JSZ A;  2PMT A;  1W89 A;  3ERF A;  5DVB A;  4FQU A;  1PKZ A;  4QQ7 A;  2LJK A;  1EEJ A;  3UIW A;  1SU9 A;  4Q5F A;  1ACV A;  3EU4 A;  4MZW A;  1XWK A;  3FZ5 A;  2DJ3 A;  4TVE A;  2LRN A;  3KM6 A;  2C1Y A;  4TR1 B;  3G7Y A;  1U6T A;  4XTS A;  5DAK A;  3H79 A;  1TRS A;  4WET A;  2YZH A;  1WIK A;  1ML6 A;  3HJO A;  5E4W A;  2C0G A;  1GNW A;  1MEK A;  3M9J A;  2C0D A;  5IMC A;  2IFQ A;  1G7O A;  4OFT A;  4L5O A;  5JCU A;  3GUR A;  6GSS A;  4ILF A;  2H1B A;  1B9Y C;  4YH2 A;  5D93 A;  1OE8 A;  1TK8 B;  4WKW A;  4LL1 B;  3IC8 A;  1MTC A;  2V32 A;  2IL3 A;  3ZIJ A;  1FO5 A;  3UAR A;  1GUK A;  3VFI A;  2H6Y A;  2DJ1 A;  1X5E A;  3GKM A;  5B8B A;  4G0L A;  2VCX A;  1A23 A;  2TIR A;  1FB6 A;  2DJ0 A;  3QPM A;  1YEX A;  1SKW B;  5FT3 A;  1T00 A;  4WXT A;  2LST A;  3IK7 A;  3HVV A;  4N0Z A;  3UOM A;  2GSQ A;  1N2A A;  4PUF C;  1YEP A;  1FVK A;  3CRT A;  1S3C A;  4TR3 A;  4IGJ A;  1E2Y A;  1CQG A;  3ZML A;  3VWX A;  2DSA A;  4J57 E;  2GLR A;  1JLW A;  2H0H A;  1K0C A;  5DJL A;  2HZE A;  5B6N A;  2K18 A;  1GLP A;  4BVX A;  2RII A;  4BWS A;  5IPG A;  3KZQ A;  4KAE A;  1A2L A;  3GST A;  2LRC A;  4HEA 2;  2ZCT A;  4F82 A;  1QGV A;  2NDO A;  3I69 A;  2H76 A;  2RLI A;  2KP1 A;  2K6V A;  3P90 A;  1BAY A;  1GL8 A;  1UVZ A;  1TDI A;  5CP1 A;  2FNO A;  3H93 A;  2ZNM A;  3HD5 A;  4WBR D;  4EUY A;  1PRX A;  1T4Z A;  4TXV A;  2DBC A;  16GS A;  1KBN A;  3GMF A;  4EXJ A;  3EVI A;  1XCC A;  3TKP A;  2BTO T;  5JCG A;  2L59 A;  2OBK A;  1F37 A;  3CYN A;  2P31 A;  3D4M A;  2O87 A;  1J9B A;  2B3S A;  3U6V A;  3CRU A;  2VLV A;  4TXO A;  4MH3 A;  3NZN A;  5ECP B;  5IQY A;  3EUR A;  3IPZ A;  1AXD A;  2N5B A;  5DAL A;  2NVL A;  4HJM A;  4K6X A;  1UA5 A;  4DSS A;  1OC3 A;  2VD0 A;  2VIM A;  1ON4 A;  4HI7 A;  1UN2 A;  5KN0 A;  4LL4 B;  4F0C A;  4O7H A;  3ME8 A;  1XW5 A;  1FOV A;  1BJX A;  2YJH A;  5D73 A;  2TRC P;  4IP6 A;  4KB3 A;  3NIV A;  20GS A;  2YZU A;  3FKF A;  2A2R A;  4JR4 A;  1SEN A;  1XFL A;  3KEB A;  2VOC A;  1DBY A;  2JL4 A;  4JRR A;  1AAZ A;  5H5S A;  4K7O A;  1PD2 1;  4G10 A;  4NHZ A;  3AY8 A;  2KP2 A;  5IMZ A;  1Z9H A;  3GRX A;  2VM2 A;  3F4S A;  3CBU A;  1YZX A;  1GSQ A;  1ABA A;  4FYC A;  1XWC A;  3ERW A;  2VL3 A;  5F05 A;  2HXK A;  2R3X A;  1ZOF A;  3PPU A;  1B48 A;  2GST A;  3LG6 A;  2J9H A;  1T8E B;  2LJR A;  2PU9 C;  2LEG A;  1HNB A;  3PGT A;  4MA9 A;  1JHB A;  2RM5 A;  3IR4 A;  3MSZ A;  1PSQ A;  5ECM B;  2GQL A;  4KCA A;  1PGT A;  3HY2 A;  4TOP A;  4GST A;  5IMV A;  2MMN A;  2H0G A;  2LRT A;  2OA7 A;  4IQ1 A;  5ELA A;  5ID2 B;  3C73 A;  1B4P A;  4F03 A;  3GHA A;  2C3N A;  5ECI B;  2QGV A;  3WT2 A;  1USB A;  1K3L A;  1XPV A;  2WUL A;  2YP6 A;  2VL9 A;  3CSI A;  2NPB A;  3KMO A;  5A4W A;  4G19 A;  3WYW A;  4MZB A;  4F0B A;  5J4U A;  2WJU A;  4GTU A;  5HR3 A;  3APQ A;  1PL1 A;  3UBL A;  3IBH A;  2C0F A;  4F2I A;  1BED A;  2V6K A;  3GX8 A;  2IFQ B;  2KOK A;  4ID0 A;  1RQM A;  2MMO A;  4OO5 A;  1XWG A;  5KEJ A;  1KEB A;  4N0V A;  4FO5 A;  2AAW A;  2XBQ A;  6GSX A;  3LOR A;  4USS A;  3HVX A;  4QL9 A;  1SYR A;  4WEY A;  1Y25 A;  1QXH A;  1KNG A;  5EY6 A;  2I81 A;  1NW2 A;  4PUA A;  3O6T A;  1N8J A;  2AJQ B;  4MPF A;  2B1L A;  1RW1 A;  4LMW A;  5AIX A;  3KP9 A;  2LV3 A;  4ECC A;  3ZTL A;  4MH2 A;  5C00 A;  4BL7 B;  3IHQ A;  4GLT A;  3HHV A;  2CX3 A;  6GSU A;  3TCO A;  2RUF A;  2HZE B;  2HSM A;  5HFI A;  4BVX B;  4XRA A;  1M2A A;  2YWI A;  1XVQ A;  4WR5 A;  3N5O A;  3ZMK A;  1A2J A;  1TKD B;  2DJ2 A;  1VGL A;  5ELG A;  14GS A;  2X8C A;  2LS5 A;  1FB0 A;  1ST9 A;  2GGT A;  5ECS A;  2YWN A;  3A2V A;  1TU7 A;  3ERG A;  2BJX A;  1S3D A;  1EGO A;  5G2Z A;  2VCQ A;  1QUW A;  3VUR A;  3KTL A;  4ZB8 A;  2OKA A;  1O7U A;  5D9V A;  1YKA A;  5L71 A;  4HU7 A;  3FY7 A;  4O92 A;  1GSU A;  1ZYQ B;  3HYP A;  2WGR A;  3TRQ A;  5D9T A;  4CW9 A;  2YPM A;  4EF0 A;  5CAX A;  2L4Q A;  2PER A;  1TI3 A;  2XPD A;  1THO A;  2WFC A;  3BCK A;  5A4V A;  4MDC A;  4HS1 A;  1XXU A;  2H1G A;  3CXG A;  3HZ4 A;  7GSS A;  4IBP A;  2IME A;  5EL8 A;  2O85 A;  4MAB A;  3QDN A;  2YV7 A;  3APS A;  2GZP A;  4AJ7 A;  2AYT A;  3G7J A;  2L57 A;  4L0W A;  4WBJ A;  3E3E A;  3TJK A;  6GST A;  5ECL B;  4LMV A;  3DML A;  1PX7 A;  3TJB A;  5D8I A;  4ZBB A;  3D21 A;  2A2S A;  4HJ2 A;  4TXO B;  3F3R A;  4NMU A;  1J08 A;  1THX A;  2YV9 A;  4MJE A;  5DAL B;  3TJJ A;  4WR4 A;  4IEL A;  1EV4 A;  4KDY A;  4RI6 A;  2HRN A;  2JZT A;  4HZ2 A;  2VL2 C;  2HRK A;  1WOU A;  4OFN A;  2K8V A;  1OKT A;  2OAC A;  1IYI A;  1FAA A;  2LTK A;  4DSS B;  3ZLP A;  3VWV A;  4CDO A;  1EP8 A;  4JR6 A;  3C7M A;  3HZ8 A;  3OR5 A;  1T3B A;  1SJI A;  4ZB6 A;  5F07 A;  2P5Q A;  1BQ7 A;  3M3M A;  4PTS A;  1TK0 B;  3ZFL A;  2AUV A;  2WDU A;  2X8H A;  3A2X A;  3F4T A;  1AUC A;  1DE2 A;  1LJR A;  4GQC A;  4X1U A;  4XCS A;  5DCH A;  5JWQ B;  1GTI A;  4YQU A;  1DSB A;  4EDY A;  2LJA A;  3HDC A;  4PQH A;  3GL5 A;  5DBQ A;  3UJ1 A;  2H19 A;  2XPE A;  3QR6 A;  5IMD A;  3CTG A;  1X5D A;  3EE2 A;  2LQO A;  5G31 A;  1AIU A;  1K0M A;  4ECI A;  2DJJ A;  3GN3 A;  2ZUP A;  2C3T A;  3DXB A;  3SBC A;  3LFL A;  3DD3 A;  2L5O A;  1K3O A;  4ZL9 A;  3FR3 A;  2GSR A;  3IA1 A;  1PQN A;  5IMA A;  3TRX A;  1TRW A;  3LWA A;  3FZ9 A;  4V2L A;  1ILO A;  5DJM A;  3QAG A;  2V1M A;  3LXZ A;  1LU4 A;  2FWH A;  4IS0 A;  4K8M A;  1GUL A;  1EV9 A;  4OCE A;  1BX9 A;  1OE7 A;  2FHE A;  3D6I A;  2G2Q A;  4K7N A;  1NHY A;  1I5G A;  4KND A;  1O73 A;  2HT9 A;  1Z3E A;  1PX6 A;  4TKY A;  2O89 A;  3LEF A;  2GSS A;  5CYY A;  1PA3 A;  4RQX A;  3ZZX A;  2H8L A;  3QAW A;  3A2W A;  3APO A;  1KTE A;  2YWM A;  4KF9 A;  4WF5 A;  4K7I A;  5EVO A;  2LQQ A;  2YNX A;  2PN8 A;  4PQI A;  2DMM A;  1IYH A;  2HYX A;  1A8Y A;  5INY A;  2OAD A;  2C4J A;  5LNK e;  3ZL5 A;  3GTU B;  3TKS A;  1B9X C;  3DRN A;  3F0I A;  1SJ6 A;  2R4V A;  3GH6 A;  17GS A;  2FUG 2;  2CVD A;  5AIS A;  3R2Q A;  3ME7 A;  1XW6 A;  2VAF A;  3WT1 A;  3EMP A;  1TW9 A;  5F06 A;  2IIY A;  2N5F A;  1Z7P A;  6GSW A;  4TR4 A;  4L8E A;  1G0T A;  3ZVJ D;  2E0Q A;  3J7Y k;  3CMI A;  3J7Y b;  5CRD A;  2B5X A;  1OVN A;  1G6W A;  2IMD A;  3VK9 A;  2HE3 A;  4ZIL A;  1EZK A;  4HQZ A;  2JZR A;  2REM A;  2R2J A;  1SD8 A;  3IRA A;  2ON7 A;  3ZYW A;  2H73 A;  4YAV A;  4EC0 A;  1XIY A;  1BG5 A;  1OC9 B;  3DVX A;  5HR0 A;  4PX1 A;  1GSS A;  2HSM B;  4V2N A;  4MLY A;  6GSV A;  5G1L A;  3GNJ A;  2OE3 A;  4OFM A;  4NHW A;  2IMF A;  5G5F A;  1M9B A;  2HFD A;  3IAM 2;  2JSY A;  3UL3 A;  3U5R E;  4YQV A;  4OMV A;  3Q18 A;  5DQS A;  3TRP A;  1Y6E A;  3EIN A;  4G2E A;  3FZ4 A;  1DUG A;  5CRG A;  4ISD A;  4PNF A;  5D96 A;  3MNG A;  1ZCP A;  4Z7X A;  2H0I A;  3FW2 A;  1VRS D;  2VLU A;  3US3 A;  4BPY A;  5B7C A;  5IO0 A;  2IPA A;  2B5E A;  4MF5 A;  3HJP A;  1PL2 A;  3BCI A;  5JWR B;  2C8U A;  5ENU A;  3GUS A;  4O5R A;  3VPQ A;  1JZR A;  4K9Z A;  4FYU A;  3HXS A;  1B8X A;  2K8S A;  3IDV A;  2IJY A;  1K0B A;  1SD9 A;  3KTB A;  3IE3 A;  4MK3 A;  3DWV A;  6GSY A;  4ZB9 A;  3ED3 A;  2VCV A;  2H74 A;  2V41 A;  1R5A A;  4PNG A;  3CTF A;  1O8X A;  1ZL9 A;  2QC7 A;  4J56 E;  2N5A A;  3KIJ A;  3W8J A;  2MZC A;  1GUM A;  2PGT A;  4Q5R A;  3W8S A;  1V98 A;  3DGQ A;  5CNW A;  4XS1 A;  1GSF A;  5HFK A;  4NXI A;  2H6X A;  2F8F A;  2HRK B;  1M2D A;  4BVY A;  3K8N A;  4ML6 A;  4HU9 A;  4KDU A;  1GSE A;  1HD2 A;  1HNA A;  1SK1 A;  2MYG A;  4NAX A;  12GS A;  2D2Z A;  4IVF A;  2F9S A;  1URM A;  5DCG A;  2VO4 A;  2O8V B;  4KSM A;  1M2B A;  4AGS A;  1WE0 A;  1ERU A;  11GS A;  2F51 A;  1YKC A;  2HLS A;  2GVP A;  1PN9 A;  1CQH A;  1M9A A;  2QSI A;  1C72 A;  2AB6 A;  4CHS A;  3UVT A;  3RPP A;  1O85 A;  4O32 A;  2JU5 A;  1SJZ A;  2G0F A;  5H5Q A;  2HRA A;  2IMI A;  2GQM A;  5EPF A;  2JAC A;  1R26 A;  4EL1 A;  1NHO A;  3GFK A;  2M72 A;  2LNS A;  3QD9 A;  5DAK B;  3I6A A;  5G5E A;  2PUK C;  4K1F A;  1M7T A;  4IJ3 A;  3ZRD A;  4F9Z A;  1ERW A;  2ES7 A;  3F63 A;  4IHU A;  2WS2 A;  4GCI A;  1EP7 A;  1U87 A;  4AJ8 A;  1MDK A;  1QQ2 A;  1TTZ A;  5J9B A;  1NM3 A;  1TK5 B;  2HNL A;  3GSS A;  4Q5Q A;  2Z9S A;  4FH8 A;  1ZGN A;  1B4Q A;  2MMA A;  4GSN A;  3RDW A;  3MAK A;  4AJ6 A;  1F3A A;  4POK A;  4K2D A;  2I3Y A;  4HZ4 A;  1I9D A;  3QCP A;  3UVH A;  3IC4 A;  1R5P A;  3TJG A;  2HQT A;  2MBS A;  2X8G A;  1JZW A;  3M0F A;  1VF3 A;  5GZZ B;  3ZIV A;  3GKK A;  3DEX A;  3ZFB A;  4WF4 A;  1TRU A;  2DIY A;  2CT6 A;  1H4O A;  1Q4J A;  5E59 A;  4FIW A;  2IMK A;  3RPN A;  2CV4 A;  3LSZ A;  3PR8 A;  4ACS A;  3BD2 A;  3FYG A;  1PMT A;  3Q6O A;  1HYU A;  2CVK A;  3HCZ A;  5DDL A;  1EGR A;  1SL1 B;  1M0U A;  3QFA C;  1BYE A;  4HDE A;  1K0D A;  3P8W A;  5LCZ A;  3IV4 A;  3A3T A;  5FWG A;  4EE0 A;  4IP1 A;  1WJK A;  2V2G A;  1MDI A;  3KD0 A;  3RHC A;  1K0A A;  3LYP A;  1SKS B;  1GTA A;  2KHP A;  5KN3 A;  4EO3 A;  3GYK A;  4ECJ A;  4NWY A;  2XBI A;  2FGX A;  1AQW A;  4EKZ A;  2P5R A;  4PGT A;  3ZVJ A;  5KN2 A;  1XW9 A;  5IMF A;  4JED A;  1HNC A;  2NTO A;  5FHI A;  3R3E A;  3TKS E;  3F8U A;  2IWT A;  2VCW A;  1O81 A;  4JZQ A;  1K0N A;  4XS4 A;  1W4V A;  2OJL A;  3FEU A;  2JAD A;  1HQO A;  2B7J A;  2CZ3 A;  5COH A;  13GS A;  2YAN A;  4NV2 A;  5BMU A;  4ZBA A;  3FK8 A;  1XOB A;  1E6B A;  4DVC A;  2H30 A;  2GQK A;  2A4V A;  3G7I A;  2YJ7 A;  5IO2 A;  1XBS A;  2WZ9 A;  5AN1 A;  4TRX A;  3E0U A;  2UZ8 A;  3RBT A;  4MJB A;  2X64 A;  1J0F A;  5IM9 A;  4NV5 A;  3KXO A;  1FHE A;  1Z5Y E;  3IOS A;  2I9H A;  2H70 A;  1YF1 A;  2AV4 A;  4ZL7 A;  3C8E A;  2GT5 A;  5ECH B;  2L6C A;  3TJF A;  2KLX A;  4J2F A;  1JZO A;  4PXO A;  2DJK A;  1FG4 A;  1QFN A;  1TP9 A;  2DLX A;  2WCI A;  3ZIT A;  4LA1 A;  2L4C A;  1WWJ A;  2TRX A;  2CQ9 A;  4ECB A;  4EVM A;  4MJA A;  1R7H A;  1FW1 A;  4TW5 A;  2ALB A;  1WPI A;  5J3R A;  5ID2 A;  3KH7 A;  4GQF A;  3ISO A;  4D73 A;  4MF6 A;  1WRY A;  2DML A;  4PQ1 A;  3D5J A;  1PKW A;  3WGE A;  2O7K A;  5CRE A;  1ZZY A;  4YQM A;  3WGD A;  1F6M C;  1WMJ A;  3VI7 A;  2VCZ A;  3QAV A;  3DYR A;  4ZXG A;  1OC8 A;  1LBK A;  2FCH A;  4HOJ A;  1A24 A;  2AHE A;  4MMM A;  1XWA A;  1QMV A;  3KCM A;  2LUS A;  3C1R A;  2PBJ A;  2CVB A;  3Q74 A;  2V6O A;  2QKE A;  1S3A A;  2GDR A;  3TKQ A;  3RHB A;  3P2A A;  4BVY B;  1Z6N A;  1ZYE A;  1GWC A;  19GS A;  2MBT A;  3HVS A;  4Q5N A;  1ERV A;  2B1K A;  3LGC A;  4V1A p;  4MP4 A;  3M9K A;  4KX4 A;  1X9S B;  2PPT A;  3GV1 A;  1V9W A;  3P7X A;  5JWO B;  5IOX A;  5CO3 A;  1GP1 A;  1OAZ A;  2K9F A;  2EIO A;  2VM1 A;  1AQX A;  3C1S A;  5HFG A;  3A5W A;  2B6M A;  1X9W B;  1F2E A;  3EU3 A;  3HA9 A;  3E9J B;  3FR9 A;  5GAP D;  5ECO B;  4BL7 A;  4JE1 A;  4I2U A;  3FR6 A;  4I8B A;  1MD4 A;  2WRT A;  3QFB C;  4IN0 A;  1EOH A;  4OCF A;  4ZIJ A;  5GST A;  1YY7 A;  4H86 A;  5J5N A;  1K3Y A;  4MF7 A;  2GZY A;  3GX0 A;  3H8Q A;  1H75 A;  2H1D A;  4QL7 A;  3W6G A;  2M80 A;  2F8A A;  4L0U A;  3UAP A;  3EMX A;  3VPT A;  4N10 A;  18GS A;  5IIZ A;  3LXT A;  1JFU A;  1Z6M A;  2F3M A;  1Q98 A;  3CSH A;  1SL2 B;  3O76 A;  2FWF A;  1A2M A;  1G6Y A;  3F6D A;  1EWX A;  4POB A;  3DKS A;  3TKS C;  1EOG A;  3MDK A;  3WD6 A;  4G0I A;  1SYX A;  3GH9 A;  1YDK A;  1T4Y A;  4V2M A;  2LNT A;  3HJM A;  3TDG A;  3D4T A;  4I2T A;  2J23 A;  3VWU A;  4JU5 A;  3VI5 A;  2I4A A;  1U88 A;  4KUN A;  1TOF A;  4KA0 A;  5AGY A;  3TKR A;  3ZRE A;  1A0F A;  2OBI A;  2PVO C;  4MCU A;  4I97 A;  1X9M B;  4G0K A;  3KH9 A;  5CRH A;  4GWR A;  2LKU A;  4N11 A;  2CZ2 A;  1YF0 A;  1FVJ A;  4XIH A;  2H66 A;  4G9H A;  4N30 A;  4I5Q A;  5ECN B;  5J9C A;  4KDX A;  5DQY A;  3L78 A;  2R6K A;  3TGZ A;  2OE1 A;  3LJR A;  1RK4 A;  4GF0 A;  3GKN A;  3LQ7 A;  3QMX A;  4BWQ A;  1TJD A;  4ULX A;  3L9V A;  3G9B A;  3H1N A;  3F9U A;  3M1G A;  2E7P A;  5B8A A;  3FRC A;  4LLR A;  2YOI A;  2H75 A;  2YCD A;  4XS6 A;  4MJC A;  3EWL A;  3TOT A;  3KP8 A;  3F6F A;  4E8H A;  4HQS A;  1U3A A;  2KUC A;  1X0R A;  2C80 A;  3M8N A;  4MZC A;  1QK8 A;  3PH9 A;  1OKD A;  2IN3 A;  3TOU A;  5IOW A;  3UBK A;  3C71 A;  2GS3 A;  1XWB A;  4TN8 A;  3IXR A;  3L0H A;  4XS4 B;  3NOF A;  1V40 A;  4IKH A;  4TR1 A;  1GNE A;  4RQR A;  1G7E A;  1GLQ A;  4OD7 A;  2VLT A;  3GL3 A;  3O3T A;  5F0G A;  1T1V A;  2X99 A;  4ZL8 A;  2FA8 A;  2CAQ A;  2L5L A;  3KGK A;  2CA8 A;  2FD3 A;  2L6D A;  4IJI A;  1AW9 A;  1VF4 A;  1K0O A;  4RUV A;  1VF2 A;  4K0G A;  2RUE A;  9GSS A;  1SK0 A;  3BJ5 A;  3MWH A;  2VCT A;  4POL A;  5HQP A;  3WGX A;  1TU8 A;  1XVW A;  2E2G A;  1GTB A;  1V2A A;  2R37 A;  2YWO A;  2C0E A;  2JZS A;  4KE3 A;  4E8E A;  2CX4 A;  2FWE A; 
#chains in the Genus database with same CATH topology
 3EYT A;  5HR1 A;  4D73 B;  5F8B A;  3N9J A;  4POM A;  2CAI A;  2DIZ A;  2HRF A;  1XG8 A;  2H72 A;  1Z7R A;  2MMZ A;  2GTU A;  1GSD A;  3UMA A;  2XC2 A;  5A1N B;  3IK9 A;  5ECR B;  3DIE A;  3GTU A;  3KJY A;  1YVL A;  3S9F A;  3BBY A;  1A0R P;  4X43 A;  3L9U A;  22GS A;  4OO4 A;  4HUA A;  5HR2 A;  3TB2 A;  4ZBD A;  4K0N A;  4AF2 A;  2HI7 A;  3F3Q A;  4DSR A;  1F3B A;  5A4U A;  3TUE A;  3DVW A;  5LD0 A;  4ML1 A;  1SKR B;  5AIV A;  1SK2 A;  3EC3 A;  1O6J A;  2FY6 A;  2FWG A;  3D22 A;  1GUH A;  1ZMA A;  5GAN D;  1U3I A;  3QOU A;  1VF1 A;  3L9S A;  4GRF A;  1MDJ A;  1WP0 A;  2FLS A;  5G1K A;  1XZO A;  2I1U A;  3SWL A;  1TRV A;  2HZF A;  2PWJ A;  2EIR A;  5G30 A;  5D9W A;  1AC1 A;  1YQ1 A;  2E2M A;  4KH7 A;  1ERT A;  4XRD A;  3FHK A;  1OC9 A;  1XOA A;  4GXZ A;  1R4W A;  3GIX A;  3Q19 A;  4XHM A;  4TR0 A;  3I43 A;  1F9M A;  2H71 A;  4EDZ A;  4P3Y B;  2R5G A;  2GT6 A;  2ON5 A;  2PVQ A;  4W66 A;  4MPG A;  2NBS A;  2HSN B;  1V57 A;  4KGI A;  2P0G A;  4DSQ A;  4JBB A;  2H1A A;  2R0C A;  3IAS 2;  5GSS A;  1GSY A;  5H5R A;  2X4A A;  1JLV A;  1X5C A;  2FA4 A;  2VD1 A;  3V1W A;  2C3Q A;  2HSH A;  5IPH A;  2BMX A;  3L4N A;  5J41 A;  3LW9 A;  5ECK B;  4YAP A;  1GH2 A;  5KN1 A;  3LYK A;  5ABR A;  1TI1 A;  3D0Z A;  3BOA A;  2M46 A;  2EC4 A;  1NSW A;  1BF5 A;  4L5L A;  3FZA A;  2H01 A;  3GKX A;  2VL2 A;  4IW9 A;  4KSO A;  2XHF A;  3F4R A;  1T7P B;  2H6Z A;  1OYJ A;  4KCE A;  5D9X A;  2DC5 A;  1YJ6 A;  2B7K A;  2O3E A;  1V58 A;  3VWW A;  3CSJ A;  2B5Y A;  1TXX A;  2YN1 A;  4I6X A;  4K2X A;  4KW6 A;  4EIQ A;  4IQA A;  2WW1 A;  2WB9 A;  1SL0 B;  4V1A g;  1EEM A;  1JZD A;  3I9V 2;  1AQV A;  1MD3 A;  3KMN A;  4PUR A;  3H4K A;  10GS A;  2HSY A;  4NPB A;  3VLN A;  4DEJ A;  1GRX A;  4BA7 A;  3HKR A;  3GA4 A;  4X0X A;  2GZZ A;  2RM6 A;  4GSS A;  1A8L A;  1GTU A;  5ECQ B;  2EIQ A;  1M99 A;  2VUP A;  3JCM L;  5JCW A;  5B6M A;  3RAZ A;  4RI7 A;  1O8W A;  1DE1 A;  5C04 A;  4FYB A;  5CRW A;  2OE0 A;  4OWY A;  3UEM A;  8GSS A;  3PIN A;  5A5K A;  1UC7 A;  2JSZ A;  2PMT A;  1W89 A;  3ERF A;  5DVB A;  4FQU A;  1PKZ A;  4QQ7 A;  2LJK A;  1EEJ A;  3UIW A;  1SU9 A;  4Q5F A;  1ACV A;  3EU4 A;  4MZW A;  1XWK A;  3FZ5 A;  2DJ3 A;  4TVE A;  2LRN A;  3KM6 A;  2C1Y A;  4TR1 B;  3G7Y A;  1U6T A;  2QA1 A;  1FOH A;  4XTS A;  5DAK A;  3H79 A;  1TRS A;  4WET A;  2YZH A;  1WIK A;  1ML6 A;  4O5U A;  3HJO A;  2WVX B;  4EIP A;  5E4W A;  2C0G A;  1GNW A;  1MEK A;  3M9J A;  2C0D A;  5IMC A;  2IFQ A;  1G7O A;  4OFT A;  4L5O A;  5JCU A;  3GUR A;  6GSS A;  4ILF A;  2H1B A;  1B9Y C;  4YH2 A;  5D93 A;  1OE8 A;  1TK8 B;  4WKW A;  4LL1 B;  1PFO A;  3IC8 A;  1MTC A;  2V32 A;  2IL3 A;  3ZIJ A;  1FO5 A;  3UAR A;  1GUK A;  3VFI A;  2H6Y A;  2DJ1 A;  1X5E A;  5A5H A;  3GKM A;  5B8B A;  4G0L A;  2VCX A;  3MIX A;  1A23 A;  2TIR A;  1FB6 A;  2DJ0 A;  3QPM A;  1YEX A;  4BIK A;  1SKW B;  5FT3 A;  1T00 A;  4WXT A;  2LST A;  3IK7 A;  3HVV A;  4N0Z A;  3UOM A;  2GSQ A;  5KOW A;  1N2A A;  4PUF C;  1YEP A;  1FVK A;  3CRT A;  1S3C A;  4TR3 A;  4IGJ A;  1E2Y A;  1CQG A;  3ZML A;  3VWX A;  2DSA A;  4J57 E;  2GLR A;  1JLW A;  2H0H A;  1K0C A;  5DJL A;  2HZE A;  5B6N A;  2K18 A;  1GLP A;  4BVX A;  2RII A;  4BWS A;  5IPG A;  3KZQ A;  4KAE A;  1A2L A;  3GST A;  2LRC A;  4HEA 2;  2ZCT A;  4F82 A;  1QGV A;  2NDO A;  3I69 A;  2H76 A;  2RLI A;  2KP1 A;  2K6V A;  3P90 A;  1BAY A;  1GL8 A;  1UVZ A;  1TDI A;  5CP1 A;  2FNO A;  3H93 A;  2ZNM A;  3HD5 A;  4WBR D;  4EUY A;  1PRX A;  1T4Z A;  2DKI A;  4K5R A;  4TXV A;  2DBC A;  16GS A;  1KBN A;  4CY8 A;  3GMF A;  4EXJ A;  3EVI A;  1XCC A;  3TKP A;  2BTO T;  5JCG A;  2L59 A;  2OBK A;  1F37 A;  4YKG A;  3CYN A;  2P31 A;  3D4M A;  2O87 A;  1J9B A;  2B3S A;  3U6V A;  3CRU A;  2VLV A;  4FXY P;  4TXO A;  4MH3 A;  3FMW A;  3NZN A;  5ECP B;  5IQY A;  3EUR A;  3IPZ A;  1AXD A;  2N5B A;  5DAL A;  2NVL A;  4HJM A;  4K6X A;  1UA5 A;  4DSS A;  1OC3 A;  2VD0 A;  2VIM A;  1ON4 A;  4HI7 A;  5J40 A;  1UN2 A;  5KN0 A;  4LL4 B;  4F0C A;  4O7H A;  3ME8 A;  4E68 A;  1XW5 A;  4ZB7 A;  1FOV A;  1BJX A;  2YJH A;  5D73 A;  2TRC P;  5KOX A;  4IP6 A;  4KB3 A;  3NIV A;  20GS A;  2YZU A;  3FKF A;  2A2R A;  4JR4 A;  1SEN A;  1XFL A;  3KEB A;  2VOC A;  1DBY A;  2JL4 A;  4JRR A;  1AAZ A;  5H5S A;  4K7O A;  1PD2 1;  4G10 A;  4NHZ A;  3AY8 A;  2KP2 A;  5BMU B;  5IMZ A;  1Z9H A;  3GRX A;  2VM2 A;  4PHZ C;  3F4S A;  3CBU A;  1YZX A;  1GSQ A;  1ABA A;  4FYC A;  1XWC A;  3ERW A;  2VL3 A;  5F05 A;  2HXK A;  2R3X A;  1ZOF A;  3PPU A;  1B48 A;  2GST A;  3LG6 A;  2J9H A;  1T8E B;  2LJR A;  2PU9 C;  2LEG A;  1HNB A;  3PGT A;  4MA9 A;  1JHB A;  2RM5 A;  3IR4 A;  3MSZ A;  1PSQ A;  5ECM B;  2GQL A;  4KCA A;  1PGT A;  2DKH A;  3HY2 A;  4TOP A;  4GST A;  5IMV A;  2MMN A;  2H0G A;  2LRT A;  2OA7 A;  4IQ1 A;  5ELA A;  5ID2 B;  3C73 A;  1B4P A;  4F03 A;  3GHA A;  2C3N A;  5ECI B;  2QGV A;  3WT2 A;  1USB A;  1K3L A;  1XPV A;  2WUL A;  4X4J A;  2YP6 A;  2VL9 A;  3CSI A;  2NPB A;  3KMO A;  5A4W A;  4G19 A;  3WYW A;  4MZB A;  4F0B A;  5J4U A;  2WJU A;  4GTU A;  5HR3 A;  3APQ A;  1PL1 A;  3UBL A;  3IBH A;  2C0F A;  4F2I A;  1BED A;  2V6K A;  3GX8 A;  2IFQ B;  2KOK A;  4ID0 A;  1RQM A;  2MMO A;  4OO5 A;  1XWG A;  5KEJ A;  1KEB A;  4N0V A;  4FO5 A;  2AAW A;  2XBQ A;  6GSX A;  3LOR A;  4USS A;  3HVX A;  4QL9 A;  1SYR A;  4WEY A;  1Y25 A;  1QXH A;  3HVN A;  5A5H B;  1KNG A;  5EY6 A;  2I81 A;  1NW2 A;  4PUA A;  3O6T A;  1N8J A;  2AJQ B;  4MPF A;  2B1L A;  1RW1 A;  4LMW A;  5AIX A;  3KP9 A;  2LV3 A;  4ECC A;  3ZTL A;  4MH2 A;  5C00 A;  4BL7 B;  3IHQ A;  4GLT A;  3HHV A;  2CX3 A;  6GSU A;  3TCO A;  2RUF A;  2HZE B;  2HSM A;  5HFI A;  4BVX B;  4XRA A;  2EFC A;  1M2A A;  2YWI A;  1XVQ A;  4WR5 A;  2A2P A;  3N5O A;  3ZMK A;  1A2J A;  1TKD B;  2DJ2 A;  1VGL A;  5ELG A;  14GS A;  2X8C A;  2LS5 A;  1FB0 A;  1ST9 A;  2GGT A;  5ECS A;  2YWN A;  3A2V A;  1TU7 A;  3ERG A;  2BJX A;  1S3D A;  1EGO A;  5G2Z A;  2VCQ A;  1QUW A;  3VUR A;  3KTL A;  4ZB8 A;  2OKA A;  1O7U A;  5D9V A;  1YKA A;  5L71 A;  4HU7 A;  4AKI A;  3FY7 A;  4O92 A;  1GSU A;  1ZYQ B;  3HYP A;  2WGR A;  3TRQ A;  5D9T A;  4CW9 A;  2YPM A;  4EF0 A;  5CAX A;  2L4Q A;  2PER A;  1TI3 A;  2XPD A;  1THO A;  2WFC A;  3BCK A;  5A4V A;  4MDC A;  3HMJ G;  4K5S A;  1XXU A;  4HS1 A;  2H1G A;  3CXG A;  3HZ4 A;  7GSS A;  4IBP A;  2IME A;  5EL8 A;  4PI0 C;  4AI6 A;  2O85 A;  4MAB A;  3QDN A;  2YV7 A;  3APS A;  2GZP A;  4AJ7 A;  2AYT A;  3G7J A;  2L57 A;  4L0W A;  4WBJ A;  3E3E A;  3TJK A;  6GST A;  2R0G A;  5ECL B;  4LMV A;  3DML A;  1PX7 A;  3TJB A;  5D8I A;  4ZBB A;  3D21 A;  2A2S A;  4HJ2 A;  4TXO B;  3F3R A;  4NMU A;  1J08 A;  2EFH A;  1THX A;  2YV9 A;  4MJE A;  5DAL B;  3TJJ A;  4WR4 A;  4IEL A;  1EV4 A;  2UV8 G;  4KDY A;  4RI6 A;  2HRN A;  2JZT A;  4HZ2 A;  2VL2 C;  2HRK A;  1WOU A;  4OFN A;  2K8V A;  2R0P A;  1OKT A;  2OAC A;  1IYI A;  1FAA A;  2LTK A;  4DSS B;  3ZLP A;  2WW2 A;  3VWV A;  4CDO A;  1EP8 A;  4JR6 A;  3C7M A;  3HZ8 A;  3OR5 A;  1T3B A;  1SJI A;  4ZB6 A;  5F07 A;  2P5Q A;  1BQ7 A;  3M3M A;  4PTS A;  1TK0 B;  3ZFL A;  2AUV A;  2WDU A;  2X8H A;  3A2X A;  3F4T A;  1AUC A;  1DE2 A;  1LJR A;  4GQC A;  4X1U A;  4XCS A;  5DCH A;  5JWQ B;  1GTI A;  4YQU A;  1DSB A;  4EDY A;  2LJA A;  3HDC A;  4PQH A;  3GL5 A;  5DBQ A;  3UJ1 A;  2H19 A;  2XPE A;  3QR6 A;  5IMD A;  3CTG A;  1X5D A;  3EE2 A;  3TU3 B;  4ICY A;  2LQO A;  5G31 A;  1AIU A;  1K0M A;  4ECI A;  2DJJ A;  3GN3 A;  2ZUP A;  2C3T A;  3DXB A;  3SBC A;  3LFL A;  3DD3 A;  2L5O A;  1K3O A;  4ZL9 A;  5A1N A;  3FR3 A;  2GSR A;  3IA1 A;  1PQN A;  5IMA A;  3TRX A;  4Z2R A;  1TRW A;  3LWA A;  3FZ9 A;  4V2L A;  1ILO A;  5DJM A;  3QAG A;  2V1M A;  3LXZ A;  1LU4 A;  2FWH A;  4IS0 A;  4K8M A;  1GUL A;  1EV9 A;  4OCE A;  1BX9 A;  1OE7 A;  2FHE A;  4AKH A;  3D6I A;  2G2Q A;  4K7N A;  1NHY A;  1I5G A;  4KND A;  1O73 A;  2HT9 A;  1Z3E A;  1PX6 A;  4TKY A;  2O89 A;  3LEF A;  2GSS A;  5CYY A;  1PA3 A;  4RQX A;  3ZZX A;  2H8L A;  3QAW A;  3A2W A;  3APO A;  1KTE A;  2YWM A;  4KF9 A;  4WF5 A;  4K7I A;  5EVO A;  2LQQ A;  2WVY A;  2YNX A;  2PN8 A;  4PQI A;  2DMM A;  4CY6 A;  1IYH A;  2HYX A;  1A8Y A;  5INY A;  2OAD A;  2C4J A;  5LNK e;  3ZL5 A;  3GTU B;  3TKS A;  1B9X C;  3DRN A;  3F0I A;  1SJ6 A;  2R4V A;  3GH6 A;  17GS A;  2FUG 2;  2CVD A;  5AIS A;  1N25 A;  3R2Q A;  3ME7 A;  1XW6 A;  2HSN A;  2VAF A;  3WT1 A;  3EMP A;  1TW9 A;  5F06 A;  2IIY A;  2N5F A;  1Z7P A;  6GSW A;  4TR4 A;  4L8E A;  1G0T A;  3ZVJ D;  2E0Q A;  3J7Y k;  3CMI A;  3J7Y b;  5CRD A;  2B5X A;  1OVN A;  1G6W A;  2IMD A;  3VK9 A;  2HE3 A;  4ZIL A;  1EZK A;  4HQZ A;  2WVZ A;  2JZR A;  2REM A;  2R2J A;  1SD8 A;  3IRA A;  2ON7 A;  3ZYW A;  2H73 A;  4YAV A;  4EC0 A;  1XIY A;  1BG5 A;  1OC9 B;  3DVX A;  4PI2 C;  5HR0 A;  4PX1 A;  1GSS A;  2HSM B;  4V2N A;  4MLY A;  6GSV A;  5G1L A;  3GNJ A;  2OE3 A;  4OFM A;  4NHW A;  2IMF A;  5G5F A;  4GDF A;  1M9B A;  2HFD A;  3IAM 2;  2JSY A;  3UL3 A;  3U5R E;  4Z2T A;  2H1L A;  4YQV A;  4OMV A;  3Q18 A;  5DQS A;  3TRP A;  1Y6E A;  3EIN A;  1I1I P;  4G2E A;  3FZ4 A;  1DUG A;  5CRG A;  4ISD A;  4PNF A;  5D96 A;  3MNG A;  1ZCP A;  4Z7X A;  2H0I A;  3FW2 A;  1VRS D;  2VLU A;  3US3 A;  4BPY A;  5B7C A;  5IO0 A;  1Y1U A;  2IPA A;  2B5E A;  4MF5 A;  3HJP A;  1PL2 A;  3BCI A;  5JWR B;  2C8U A;  5ENU A;  3GUS A;  4O5R A;  3VPQ A;  1JZR A;  4K9Z A;  4FYU A;  3IHG A;  1ZYP A;  3HXS A;  1B8X A;  2K8S A;  3IDV A;  2IJY A;  1K0B A;  1SD9 A;  3KTB A;  3IE3 A;  4MK3 A;  3DWV A;  6GSY A;  4ZB9 A;  3ED3 A;  2VCV A;  2H74 A;  2V41 A;  1R5A A;  4PNG A;  3CTF A;  1O8X A;  1ZL9 A;  2QC7 A;  4J56 E;  2N5A A;  3KIJ A;  4YKF A;  3W8J A;  2MZC A;  1GUM A;  2PGT A;  4Q5R A;  3W8S A;  1V98 A;  3DGQ A;  5CNW A;  4XS1 A;  1GSF A;  5HFK A;  4NXI A;  2H6X A;  2F8F A;  2HRK B;  1M2D A;  4BVY A;  2O5V A;  3K8N A;  4ML6 A;  4HU9 A;  4KDU A;  1GSE A;  1HD2 A;  1YEW C;  1HNA A;  1SK1 A;  2MYG A;  4NAX A;  12GS A;  2D2Z A;  4IVF A;  2F9S A;  1URM A;  5DCG A;  2VO4 A;  2O8V B;  1SVO A;  4KSM A;  1M2B A;  4AGS A;  1WE0 A;  1ERU A;  11GS A;  2F51 A;  1YKC A;  2HLS A;  2GVP A;  1PN9 A;  1CQH A;  1M9A A;  2QSI A;  1C72 A;  2AB6 A;  4CHS A;  3UVT A;  3RPP A;  4HSC X;  1O85 A;  4O32 A;  2JU5 A;  1SJZ A;  2G0F A;  5H5Q A;  2HRA A;  3CWG A;  2IMI A;  2GQM A;  5EPF A;  2JAC A;  1R26 A;  4EL1 A;  1NHO A;  3GFK A;  2M72 A;  2LNS A;  3QD9 A;  5DAK B;  3I6A A;  5G5E A;  2PUK C;  4K1F A;  1M7T A;  4IJ3 A;  3ZRD A;  4F9Z A;  1ERW A;  2ES7 A;  3F63 A;  4IHU A;  2WS2 A;  4GCI A;  1EP7 A;  1U87 A;  4AJ8 A;  1MDK A;  1QQ2 A;  1TTZ A;  5J9B A;  1NM3 A;  1TK5 B;  2HNL A;  3GSS A;  4Q5Q A;  2Z9S A;  4FH8 A;  1ZGN A;  1B4Q A;  2MMA A;  2OT3 A;  4G01 A;  4GSN A;  3RDW A;  3MAK A;  4AJ6 A;  1F3A A;  4POK A;  4K2D A;  2I3Y A;  4HZ4 A;  1I9D A;  3QCP A;  5J4V A;  3RGB C;  3UVH A;  3IC4 A;  1R5P A;  3MYD A;  4AKX B;  2WW0 A;  3TJG A;  2HQT A;  2MBS A;  2X8G A;  1JZW A;  3M0F A;  1VF3 A;  5GZZ B;  3ZIV A;  3GKK A;  3DEX A;  3ZFB A;  4WF4 A;  1TRU A;  2DIY A;  2CT6 A;  1H4O A;  1Q4J A;  5E59 A;  4FIW A;  2IMK A;  3RPN A;  2CV4 A;  3LSZ A;  3PR8 A;  4ACS A;  3BD2 A;  3FYG A;  1PMT A;  3Q6O A;  1HYU A;  2CVK A;  3HCZ A;  5DDL A;  1EGR A;  1SL1 B;  1M0U A;  3QFA C;  1BYE A;  4HDE A;  1K0D A;  3P8W A;  2QA2 A;  5LCZ A;  2WZS A;  3IV4 A;  3A3T A;  5FWG A;  4EE0 A;  1WJK A;  4IP1 A;  2V2G A;  1MDI A;  3KD0 A;  3RHC A;  1K0A A;  3LYP A;  1SKS B;  1GTA A;  2KHP A;  5KN3 A;  4EO3 A;  3GYK A;  4ECJ A;  4NWY A;  2XBI A;  2FGX A;  1AQW A;  4EKZ A;  2P5R A;  4PGT A;  3ZVJ A;  5KN2 A;  1XW9 A;  5IMF A;  4JED A;  1HNC A;  2NTO A;  5FHI A;  3RFR C;  3R3E A;  3TKS E;  3F8U A;  2IWT A;  2VCW A;  1O81 A;  4JZQ A;  1K0N A;  4XS4 A;  1W4V A;  1ZYN A;  2OJL A;  3FEU A;  2JAD A;  1HQO A;  2B7J A;  2CZ3 A;  5COH A;  13GS A;  2YAN A;  4NV2 A;  5BMU A;  4O5Q A;  4ZBA A;  3FK8 A;  1XOB A;  1E6B A;  4DVC A;  2H30 A;  2GQK A;  2A4V A;  3G7I A;  2YJ7 A;  5IO2 A;  1XBS A;  2WZ9 A;  5AN1 A;  4TRX A;  3E0U A;  2UZ8 A;  3RBT A;  4MJB A;  2X64 A;  1J0F A;  5IM9 A;  4NV5 A;  3KXO A;  2EFE A;  1FHE A;  1Z5Y E;  3IOS A;  2I9H A;  5A34 A;  2H70 A;  1YF1 A;  2AV4 A;  4ZL7 A;  3C8E A;  2GT5 A;  5ECH B;  2L6C A;  2WW3 A;  3TJF A;  2KLX A;  4J2F A;  1JZO A;  4PXO A;  2DJK A;  1FG4 A;  4MNN A;  1QFN A;  1TP9 A;  2DLX A;  1M3I A;  2WCI A;  3ZIT A;  4LA1 A;  2L4C A;  1WWJ A;  2TRX A;  2CQ9 A;  4ECB A;  4EVM A;  4MJA A;  1R7H A;  1FW1 A;  4TW5 A;  2ALB A;  1WPI A;  5J3R A;  5ID2 A;  3KH7 A;  4GQF A;  3ISO A;  4D73 A;  4MF6 A;  1WRY A;  1M3J A;  2DML A;  4PQ1 A;  3D5J A;  1PKW A;  3WGE A;  2O7K A;  5CRE A;  1ZZY A;  4YQM A;  3WGD A;  1F6M C;  1WMJ A;  3VI7 A;  2VCZ A;  3QAV A;  3DYR A;  4ZXG A;  1OC8 A;  1LBK A;  2FCH A;  4HOJ A;  1A24 A;  2AHE A;  4MMM A;  5J47 A;  1XWA A;  1QMV A;  3KCM A;  2LUS A;  3C1R A;  2PBJ A;  2CVB A;  3Q74 A;  2V6O A;  2QKE A;  1S3A A;  2GDR A;  3TKQ A;  3RHB A;  3P2A A;  4BVY B;  4N3Z A;  1Z6N A;  1ZYE A;  1GWC A;  19GS A;  2MBT A;  3HVS A;  4Q5N A;  1ERV A;  2B1K A;  3LGC A;  4V1A p;  4MP4 A;  3M9K A;  4KX4 A;  1X9S B;  2PPT A;  3GV1 A;  1V9W A;  3CHX C;  3P7X A;  5JWO B;  5IOX A;  5CO3 A;  1GP1 A;  1OAZ A;  2K9F A;  2EIO A;  2VM1 A;  1AQX A;  3C1S A;  5HFG A;  3A5W A;  2B6M A;  1X9W B;  1F2E A;  3EU3 A;  3HA9 A;  3E9J B;  3FR9 A;  5GAP D;  1SVM A;  1TXU A;  5ECO B;  4BL7 A;  4JE1 A;  4I2U A;  3FR6 A;  4I8B A;  1MD4 A;  2WRT A;  3QFB C;  4IN0 A;  1EOH A;  4OCF A;  4ZIJ A;  5GST A;  1YY7 A;  4H86 A;  5J5N A;  4QMK A;  1K3Y A;  4MF7 A;  2GZY A;  3GX0 A;  3H8Q A;  1H75 A;  4AKG A;  2H1D A;  4QL7 A;  2A4H A;  3W6G A;  2M80 A;  2F8A A;  4L0U A;  3UAP A;  3EMX A;  3VPT A;  4N10 A;  18GS A;  5IIZ A;  3LXT A;  5BRT A;  1JFU A;  1Z6M A;  2F3M A;  1Q98 A;  3CSH A;  1SL2 B;  3O76 A;  2FWF A;  1A2M A;  1G6Y A;  3F6D A;  1EWX A;  4POB A;  3DKS A;  3TKS C;  1EOG A;  3MDK A;  3WD6 A;  4G0I A;  1SYX A;  3GH9 A;  1YDK A;  1T4Y A;  4V2M A;  2LNT A;  3HJM A;  3TDG A;  3D4T A;  4I2T A;  2J23 A;  3VWU A;  4JU5 A;  3VI5 A;  2I4A A;  1U88 A;  4KUN A;  1TOF A;  4KA0 A;  5AGY A;  3TKR A;  3ZRE A;  1A0F A;  2OBI A;  2PVO C;  4MCU A;  4I97 A;  1X9M B;  1S4B P;  4G0K A;  3KH9 A;  5CRH A;  4GWR A;  1SVL A;  2X49 A;  2LKU A;  3CQF A;  4N11 A;  4Z2U A;  2CZ2 A;  1YF0 A;  2VKZ G;  1FVJ A;  2EFD A;  4XIH A;  2H66 A;  4G9H A;  4N30 A;  1BG1 A;  4I5Q A;  5ECN B;  5J9C A;  4KDX A;  5DQY A;  3L78 A;  2R6K A;  3TGZ A;  2OE1 A;  3LJR A;  1RK4 A;  3GKN A;  4GF0 A;  3LQ7 A;  3QMX A;  4BWQ A;  1TJD A;  4ULX A;  3G9B A;  3L9V A;  3H1N A;  3F9U A;  3M1G A;  2E7P A;  5B8A A;  3FRC A;  4LLR A;  2YOI A;  2H75 A;  2YCD A;  4XS6 A;  4MJC A;  3EWL A;  3TOT A;  3KP8 A;  3F6F A;  4E8H A;  4HQS A;  1S3R A;  3A5I A;  1U3A A;  2KUC A;  1X0R A;  2C80 A;  3M8N A;  4MZC A;  1QK8 A;  3PH9 A;  4A5P A;  1OKD A;  2IN3 A;  3TOU A;  5IOW A;  3UBK A;  3C71 A;  2GS3 A;  1XWB A;  4TN8 A;  3IXR A;  3L0H A;  4XS4 B;  3NOF A;  1V40 A;  1PN0 A;  4IKH A;  4TR1 A;  1GNE A;  4RQR A;  1G7E A;  1GLQ A;  4OD7 A;  3EPT A;  2VLT A;  3GL3 A;  3O3T A;  5F0G A;  1T1V A;  2X99 A;  4ZL8 A;  2FA8 A;  2CAQ A;  2WVX A;  2L5L A;  3KGK A;  2CA8 A;  2FD3 A;  2L6D A;  4IJI A;  1AW9 A;  1VF4 A;  5A34 B;  1K0O A;  4RUV A;  1VF2 A;  4K0G A;  2RUE A;  9GSS A;  1SK0 A;  3BJ5 A;  3MWH A;  2VCT A;  4POL A;  5HQP A;  3WGX A;  1TU8 A;  1XVW A;  2E2G A;  1GTB A;  1V2A A;  2R37 A;  2YWO A;  2C0E A;  2JZS A;  5J4Y A;  4KE3 A;  4E8E A;  2O36 A;  2CX4 A;  2FWE A; 
#chains in the Genus database with same CATH homology
 3EYT A;  5HR1 A;  4D73 B;  5F8B A;  3N9J A;  4POM A;  2CAI A;  2DIZ A;  2HRF A;  2H72 A;  1Z7R A;  2MMZ A;  2GTU A;  1GSD A;  3UMA A;  2XC2 A;  5A1N B;  3IK9 A;  5ECR B;  3DIE A;  3GTU A;  3KJY A;  1YVL A;  3S9F A;  3BBY A;  1A0R P;  4X43 A;  3L9U A;  22GS A;  4OO4 A;  4HUA A;  5HR2 A;  3TB2 A;  4ZBD A;  4K0N A;  4AF2 A;  2HI7 A;  3F3Q A;  4DSR A;  1F3B A;  5A4U A;  3TUE A;  3DVW A;  5LD0 A;  4ML1 A;  1SKR B;  5AIV A;  1SK2 A;  3EC3 A;  1O6J A;  2FY6 A;  2FWG A;  3D22 A;  1GUH A;  1ZMA A;  5GAN D;  1U3I A;  3QOU A;  1VF1 A;  3L9S A;  4GRF A;  1MDJ A;  1WP0 A;  2FLS A;  5G1K A;  1XZO A;  2I1U A;  3SWL A;  1TRV A;  2HZF A;  2PWJ A;  2EIR A;  5G30 A;  5D9W A;  1AC1 A;  1YQ1 A;  2E2M A;  4KH7 A;  1ERT A;  4XRD A;  3FHK A;  1OC9 A;  1XOA A;  4GXZ A;  1R4W A;  3GIX A;  3Q19 A;  4XHM A;  4TR0 A;  3I43 A;  1F9M A;  2H71 A;  4EDZ A;  4P3Y B;  2R5G A;  2GT6 A;  2ON5 A;  2PVQ A;  4W66 A;  4MPG A;  2NBS A;  2HSN B;  1V57 A;  4KGI A;  2P0G A;  4DSQ A;  4JBB A;  2H1A A;  2R0C A;  3IAS 2;  5GSS A;  1GSY A;  5H5R A;  2X4A A;  1JLV A;  1X5C A;  2FA4 A;  2VD1 A;  3V1W A;  2C3Q A;  2HSH A;  5IPH A;  2BMX A;  3L4N A;  5J41 A;  3LW9 A;  5ECK B;  4YAP A;  1GH2 A;  5KN1 A;  3LYK A;  5ABR A;  1TI1 A;  3D0Z A;  3BOA A;  2M46 A;  2EC4 A;  1NSW A;  1BF5 A;  4L5L A;  3FZA A;  2H01 A;  3GKX A;  2VL2 A;  4IW9 A;  4KSO A;  2XHF A;  3F4R A;  1T7P B;  2H6Z A;  1OYJ A;  4KCE A;  5D9X A;  2DC5 A;  1YJ6 A;  2B7K A;  1V58 A;  3VWW A;  3CSJ A;  2B5Y A;  1TXX A;  2YN1 A;  4I6X A;  4K2X A;  4KW6 A;  4EIQ A;  4IQA A;  2WB9 A;  1SL0 B;  4V1A g;  1EEM A;  1JZD A;  3I9V 2;  1AQV A;  1MD3 A;  3KMN A;  4PUR A;  3H4K A;  10GS A;  2HSY A;  4NPB A;  3VLN A;  4DEJ A;  1GRX A;  4BA7 A;  3HKR A;  3GA4 A;  4X0X A;  2GZZ A;  2RM6 A;  4GSS A;  1A8L A;  1GTU A;  5ECQ B;  2EIQ A;  1M99 A;  2VUP A;  3JCM L;  5JCW A;  5B6M A;  3RAZ A;  4RI7 A;  1O8W A;  1DE1 A;  5C04 A;  4FYB A;  5CRW A;  2OE0 A;  4OWY A;  3UEM A;  8GSS A;  3PIN A;  5A5K A;  1UC7 A;  2JSZ A;  2PMT A;  1W89 A;  3ERF A;  5DVB A;  4FQU A;  1PKZ A;  4QQ7 A;  2LJK A;  1EEJ A;  3UIW A;  1SU9 A;  4Q5F A;  1ACV A;  3EU4 A;  4MZW A;  1XWK A;  3FZ5 A;  2DJ3 A;  4TVE A;  2LRN A;  3KM6 A;  2C1Y A;  4TR1 B;  3G7Y A;  1U6T A;  2QA1 A;  1FOH A;  4XTS A;  5DAK A;  3H79 A;  1TRS A;  4WET A;  2YZH A;  1WIK A;  1ML6 A;  4O5U A;  3HJO A;  4EIP A;  5E4W A;  2C0G A;  1GNW A;  1MEK A;  3M9J A;  2C0D A;  5IMC A;  2IFQ A;  1G7O A;  4OFT A;  4L5O A;  5JCU A;  3GUR A;  6GSS A;  4ILF A;  2H1B A;  1B9Y C;  4YH2 A;  5D93 A;  1OE8 A;  1TK8 B;  4WKW A;  4LL1 B;  3IC8 A;  1MTC A;  2V32 A;  2IL3 A;  3ZIJ A;  1FO5 A;  3UAR A;  1GUK A;  3VFI A;  2H6Y A;  2DJ1 A;  1X5E A;  5A5H A;  3GKM A;  5B8B A;  4G0L A;  2VCX A;  3MIX A;  1A23 A;  2TIR A;  1FB6 A;  2DJ0 A;  3QPM A;  1YEX A;  1SKW B;  5FT3 A;  1T00 A;  4WXT A;  2LST A;  3IK7 A;  3HVV A;  4N0Z A;  3UOM A;  2GSQ A;  5KOW A;  1N2A A;  4PUF C;  1YEP A;  1FVK A;  3CRT A;  1S3C A;  4TR3 A;  4IGJ A;  1E2Y A;  1CQG A;  3ZML A;  3VWX A;  2DSA A;  4J57 E;  2GLR A;  1JLW A;  2H0H A;  1K0C A;  5DJL A;  2HZE A;  5B6N A;  2K18 A;  1GLP A;  4BVX A;  2RII A;  4BWS A;  5IPG A;  3KZQ A;  4KAE A;  1A2L A;  3GST A;  2LRC A;  4HEA 2;  2ZCT A;  4F82 A;  1QGV A;  2NDO A;  3I69 A;  2H76 A;  2RLI A;  2KP1 A;  2K6V A;  3P90 A;  1BAY A;  1GL8 A;  1UVZ A;  1TDI A;  5CP1 A;  2FNO A;  3H93 A;  2ZNM A;  3HD5 A;  4WBR D;  4EUY A;  1PRX A;  1T4Z A;  2DKI A;  4K5R A;  4TXV A;  2DBC A;  16GS A;  1KBN A;  4CY8 A;  3GMF A;  4EXJ A;  3EVI A;  1XCC A;  3TKP A;  2BTO T;  5JCG A;  2L59 A;  2OBK A;  1F37 A;  4YKG A;  3CYN A;  2P31 A;  3D4M A;  2O87 A;  1J9B A;  2B3S A;  3U6V A;  3CRU A;  2VLV A;  4TXO A;  4MH3 A;  3FMW A;  3NZN A;  5ECP B;  5IQY A;  3EUR A;  3IPZ A;  1AXD A;  2N5B A;  5DAL A;  2NVL A;  4HJM A;  4K6X A;  1UA5 A;  4DSS A;  1OC3 A;  2VD0 A;  2VIM A;  1ON4 A;  4HI7 A;  5J40 A;  1UN2 A;  5KN0 A;  4LL4 B;  4F0C A;  4O7H A;  3ME8 A;  4E68 A;  1XW5 A;  4ZB7 A;  1FOV A;  1BJX A;  2YJH A;  5D73 A;  2TRC P;  5KOX A;  4IP6 A;  4KB3 A;  3NIV A;  20GS A;  2YZU A;  3FKF A;  2A2R A;  4JR4 A;  1SEN A;  1XFL A;  3KEB A;  2VOC A;  1DBY A;  2JL4 A;  4JRR A;  1AAZ A;  5H5S A;  4K7O A;  1PD2 1;  4G10 A;  4NHZ A;  3AY8 A;  2KP2 A;  5BMU B;  5IMZ A;  1Z9H A;  3GRX A;  2VM2 A;  3F4S A;  3CBU A;  1YZX A;  1GSQ A;  1ABA A;  4FYC A;  1XWC A;  3ERW A;  2VL3 A;  5F05 A;  2HXK A;  2R3X A;  1ZOF A;  3PPU A;  1B48 A;  2GST A;  3LG6 A;  2J9H A;  1T8E B;  2LJR A;  2PU9 C;  2LEG A;  1HNB A;  3PGT A;  4MA9 A;  1JHB A;  2RM5 A;  3IR4 A;  3MSZ A;  1PSQ A;  5ECM B;  2GQL A;  4KCA A;  1PGT A;  2DKH A;  3HY2 A;  4TOP A;  4GST A;  5IMV A;  2MMN A;  2H0G A;  2LRT A;  2OA7 A;  4IQ1 A;  5ELA A;  5ID2 B;  3C73 A;  1B4P A;  4F03 A;  3GHA A;  2C3N A;  5ECI B;  2QGV A;  3WT2 A;  1USB A;  1K3L A;  1XPV A;  2WUL A;  4X4J A;  2YP6 A;  2VL9 A;  3CSI A;  2NPB A;  3KMO A;  5A4W A;  4G19 A;  3WYW A;  4MZB A;  4F0B A;  5J4U A;  2WJU A;  4GTU A;  5HR3 A;  3APQ A;  1PL1 A;  3UBL A;  3IBH A;  2C0F A;  4F2I A;  1BED A;  2V6K A;  3GX8 A;  2IFQ B;  2KOK A;  4ID0 A;  1RQM A;  2MMO A;  4OO5 A;  1XWG A;  5KEJ A;  1KEB A;  4N0V A;  4FO5 A;  2AAW A;  2XBQ A;  6GSX A;  3LOR A;  4USS A;  3HVX A;  4QL9 A;  1SYR A;  4WEY A;  1Y25 A;  1QXH A;  5A5H B;  1KNG A;  5EY6 A;  2I81 A;  1NW2 A;  4PUA A;  3O6T A;  1N8J A;  2AJQ B;  4MPF A;  2B1L A;  1RW1 A;  4LMW A;  5AIX A;  3KP9 A;  2LV3 A;  4ECC A;  3ZTL A;  4MH2 A;  5C00 A;  4BL7 B;  3IHQ A;  4GLT A;  3HHV A;  2CX3 A;  6GSU A;  3TCO A;  2RUF A;  2HZE B;  2HSM A;  5HFI A;  4BVX B;  4XRA A;  2EFC A;  1M2A A;  2YWI A;  1XVQ A;  4WR5 A;  2A2P A;  3N5O A;  3ZMK A;  1A2J A;  1TKD B;  2DJ2 A;  1VGL A;  5ELG A;  14GS A;  2X8C A;  2LS5 A;  1FB0 A;  1ST9 A;  2GGT A;  5ECS A;  2YWN A;  3A2V A;  1TU7 A;  3ERG A;  2BJX A;  1S3D A;  1EGO A;  5G2Z A;  2VCQ A;  1QUW A;  3VUR A;  3KTL A;  4ZB8 A;  2OKA A;  1O7U A;  5D9V A;  1YKA A;  5L71 A;  4HU7 A;  4AKI A;  3FY7 A;  4O92 A;  1GSU A;  1ZYQ B;  3HYP A;  2WGR A;  3TRQ A;  5D9T A;  4CW9 A;  2YPM A;  4EF0 A;  5CAX A;  2L4Q A;  2PER A;  1TI3 A;  2XPD A;  1THO A;  2WFC A;  3BCK A;  5A4V A;  4MDC A;  3HMJ G;  4K5S A;  1XXU A;  4HS1 A;  2H1G A;  3CXG A;  3HZ4 A;  7GSS A;  4IBP A;  2IME A;  5EL8 A;  4AI6 A;  2O85 A;  4MAB A;  3QDN A;  2YV7 A;  3APS A;  2GZP A;  4AJ7 A;  2AYT A;  3G7J A;  2L57 A;  4L0W A;  4WBJ A;  3E3E A;  3TJK A;  6GST A;  2R0G A;  5ECL B;  4LMV A;  3DML A;  1PX7 A;  3TJB A;  5D8I A;  4ZBB A;  3D21 A;  2A2S A;  4HJ2 A;  4TXO B;  3F3R A;  4NMU A;  1J08 A;  2EFH A;  1THX A;  2YV9 A;  4MJE A;  5DAL B;  3TJJ A;  4WR4 A;  4IEL A;  1EV4 A;  2UV8 G;  4KDY A;  4RI6 A;  2HRN A;  2JZT A;  4HZ2 A;  2VL2 C;  2HRK A;  1WOU A;  4OFN A;  2K8V A;  2R0P A;  1OKT A;  2OAC A;  1IYI A;  1FAA A;  2LTK A;  4DSS B;  3ZLP A;  3VWV A;  4CDO A;  1EP8 A;  4JR6 A;  3C7M A;  3HZ8 A;  3OR5 A;  1T3B A;  1SJI A;  4ZB6 A;  5F07 A;  2P5Q A;  1BQ7 A;  3M3M A;  4PTS A;  1TK0 B;  3ZFL A;  2AUV A;  2WDU A;  2X8H A;  3A2X A;  3F4T A;  1AUC A;  1DE2 A;  1LJR A;  4GQC A;  4X1U A;  4XCS A;  5DCH A;  5JWQ B;  1GTI A;  4YQU A;  1DSB A;  4EDY A;  2LJA A;  3HDC A;  4PQH A;  3GL5 A;  5DBQ A;  3UJ1 A;  2H19 A;  2XPE A;  3QR6 A;  5IMD A;  3CTG A;  1X5D A;  3EE2 A;  3TU3 B;  4ICY A;  2LQO A;  5G31 A;  1AIU A;  1K0M A;  4ECI A;  2DJJ A;  3GN3 A;  2ZUP A;  2C3T A;  3DXB A;  3SBC A;  3LFL A;  3DD3 A;  2L5O A;  1K3O A;  4ZL9 A;  5A1N A;  3FR3 A;  2GSR A;  3IA1 A;  1PQN A;  5IMA A;  3TRX A;  4Z2R A;  1TRW A;  3LWA A;  3FZ9 A;  4V2L A;  1ILO A;  5DJM A;  3QAG A;  2V1M A;  3LXZ A;  1LU4 A;  2FWH A;  4IS0 A;  4K8M A;  1GUL A;  1EV9 A;  4OCE A;  1BX9 A;  1OE7 A;  2FHE A;  4AKH A;  3D6I A;  2G2Q A;  4K7N A;  1NHY A;  1I5G A;  4KND A;  1O73 A;  2HT9 A;  1Z3E A;  1PX6 A;  4TKY A;  2O89 A;  3LEF A;  2GSS A;  5CYY A;  1PA3 A;  4RQX A;  3ZZX A;  2H8L A;  3QAW A;  3A2W A;  3APO A;  1KTE A;  2YWM A;  4KF9 A;  4WF5 A;  4K7I A;  5EVO A;  2LQQ A;  2YNX A;  2PN8 A;  4PQI A;  2DMM A;  4CY6 A;  1IYH A;  2HYX A;  1A8Y A;  5INY A;  2OAD A;  2C4J A;  5LNK e;  3ZL5 A;  3GTU B;  3TKS A;  1B9X C;  3DRN A;  3F0I A;  1SJ6 A;  2R4V A;  3GH6 A;  17GS A;  2FUG 2;  2CVD A;  5AIS A;  1N25 A;  3R2Q A;  3ME7 A;  1XW6 A;  2HSN A;  2VAF A;  3WT1 A;  3EMP A;  1TW9 A;  5F06 A;  2IIY A;  2N5F A;  1Z7P A;  6GSW A;  4TR4 A;  4L8E A;  1G0T A;  3ZVJ D;  2E0Q A;  3J7Y k;  3CMI A;  3J7Y b;  5CRD A;  2B5X A;  1OVN A;  1G6W A;  2IMD A;  3VK9 A;  2HE3 A;  4ZIL A;  1EZK A;  4HQZ A;  2JZR A;  2REM A;  2R2J A;  1SD8 A;  3IRA A;  2ON7 A;  3ZYW A;  2H73 A;  4YAV A;  4EC0 A;  1XIY A;  1BG5 A;  1OC9 B;  3DVX A;  5HR0 A;  4PX1 A;  1GSS A;  2HSM B;  4V2N A;  4MLY A;  6GSV A;  5G1L A;  3GNJ A;  2OE3 A;  4OFM A;  4NHW A;  2IMF A;  5G5F A;  4GDF A;  1M9B A;  2HFD A;  3IAM 2;  2JSY A;  3UL3 A;  3U5R E;  4Z2T A;  2H1L A;  4YQV A;  4OMV A;  3Q18 A;  5DQS A;  3TRP A;  1Y6E A;  3EIN A;  4G2E A;  3FZ4 A;  1DUG A;  5CRG A;  4ISD A;  4PNF A;  5D96 A;  3MNG A;  1ZCP A;  4Z7X A;  2H0I A;  3FW2 A;  1VRS D;  2VLU A;  3US3 A;  4BPY A;  5B7C A;  5IO0 A;  1Y1U A;  2IPA A;  2B5E A;  4MF5 A;  3HJP A;  1PL2 A;  3BCI A;  5JWR B;  2C8U A;  5ENU A;  3GUS A;  4O5R A;  3VPQ A;  1JZR A;  4K9Z A;  4FYU A;  3IHG A;  1ZYP A;  3HXS A;  1B8X A;  2K8S A;  3IDV A;  2IJY A;  1K0B A;  1SD9 A;  3KTB A;  3IE3 A;  4MK3 A;  3DWV A;  6GSY A;  4ZB9 A;  3ED3 A;  2VCV A;  2H74 A;  2V41 A;  1R5A A;  4PNG A;  3CTF A;  1O8X A;  1ZL9 A;  2QC7 A;  4J56 E;  2N5A A;  3KIJ A;  4YKF A;  3W8J A;  2MZC A;  1GUM A;  2PGT A;  4Q5R A;  3W8S A;  1V98 A;  3DGQ A;  5CNW A;  4XS1 A;  1GSF A;  5HFK A;  4NXI A;  2H6X A;  2F8F A;  2HRK B;  1M2D A;  4BVY A;  2O5V A;  3K8N A;  4ML6 A;  4HU9 A;  4KDU A;  1GSE A;  1HD2 A;  1HNA A;  1SK1 A;  2MYG A;  4NAX A;  12GS A;  2D2Z A;  4IVF A;  2F9S A;  1URM A;  5DCG A;  2VO4 A;  2O8V B;  1SVO A;  4KSM A;  1M2B A;  4AGS A;  1WE0 A;  1ERU A;  11GS A;  2F51 A;  1YKC A;  2HLS A;  2GVP A;  1PN9 A;  1CQH A;  1M9A A;  2QSI A;  1C72 A;  2AB6 A;  4CHS A;  3UVT A;  3RPP A;  1O85 A;  4O32 A;  2JU5 A;  1SJZ A;  2G0F A;  5H5Q A;  2HRA A;  3CWG A;  2IMI A;  2GQM A;  5EPF A;  2JAC A;  1R26 A;  4EL1 A;  1NHO A;  3GFK A;  2M72 A;  2LNS A;  3QD9 A;  5DAK B;  3I6A A;  5G5E A;  2PUK C;  4K1F A;  1M7T A;  4IJ3 A;  3ZRD A;  4F9Z A;  1ERW A;  2ES7 A;  3F63 A;  4IHU A;  2WS2 A;  4GCI A;  1EP7 A;  1U87 A;  4AJ8 A;  1MDK A;  1QQ2 A;  1TTZ A;  5J9B A;  1NM3 A;  1TK5 B;  2HNL A;  3GSS A;  4Q5Q A;  2Z9S A;  4FH8 A;  1ZGN A;  1B4Q A;  2MMA A;  2OT3 A;  4G01 A;  4GSN A;  3RDW A;  3MAK A;  4AJ6 A;  1F3A A;  4POK A;  4K2D A;  2I3Y A;  4HZ4 A;  1I9D A;  3QCP A;  5J4V A;  3UVH A;  3IC4 A;  1R5P A;  3MYD A;  4AKX B;  3TJG A;  2HQT A;  2MBS A;  2X8G A;  1JZW A;  3M0F A;  1VF3 A;  5GZZ B;  3ZIV A;  3GKK A;  3DEX A;  3ZFB A;  4WF4 A;  1TRU A;  2DIY A;  2CT6 A;  1H4O A;  1Q4J A;  5E59 A;  4FIW A;  2IMK A;  3RPN A;  2CV4 A;  3LSZ A;  3PR8 A;  4ACS A;  3BD2 A;  3FYG A;  1PMT A;  3Q6O A;  1HYU A;  2CVK A;  3HCZ A;  5DDL A;  1EGR A;  1SL1 B;  1M0U A;  3QFA C;  1BYE A;  4HDE A;  1K0D A;  3P8W A;  2QA2 A;  5LCZ A;  3IV4 A;  3A3T A;  5FWG A;  4EE0 A;  1WJK A;  4IP1 A;  2V2G A;  1MDI A;  3KD0 A;  3RHC A;  1K0A A;  3LYP A;  1SKS B;  1GTA A;  2KHP A;  5KN3 A;  4EO3 A;  3GYK A;  4ECJ A;  4NWY A;  2XBI A;  2FGX A;  1AQW A;  4EKZ A;  2P5R A;  4PGT A;  3ZVJ A;  5KN2 A;  1XW9 A;  5IMF A;  4JED A;  1HNC A;  2NTO A;  5FHI A;  3R3E A;  3TKS E;  3F8U A;  2IWT A;  2VCW A;  1O81 A;  4JZQ A;  1K0N A;  4XS4 A;  1W4V A;  1ZYN A;  2OJL A;  3FEU A;  2JAD A;  1HQO A;  2B7J A;  2CZ3 A;  5COH A;  13GS A;  2YAN A;  4NV2 A;  5BMU A;  4O5Q A;  4ZBA A;  3FK8 A;  1XOB A;  1E6B A;  4DVC A;  2H30 A;  2GQK A;  2A4V A;  3G7I A;  2YJ7 A;  5IO2 A;  1XBS A;  2WZ9 A;  5AN1 A;  4TRX A;  3E0U A;  2UZ8 A;  3RBT A;  4MJB A;  2X64 A;  1J0F A;  5IM9 A;  4NV5 A;  3KXO A;  2EFE A;  1FHE A;  1Z5Y E;  3IOS A;  2I9H A;  5A34 A;  2H70 A;  1YF1 A;  2AV4 A;  4ZL7 A;  3C8E A;  2GT5 A;  5ECH B;  2L6C A;  3TJF A;  2KLX A;  4J2F A;  1JZO A;  4PXO A;  2DJK A;  1FG4 A;  4MNN A;  1QFN A;  1TP9 A;  2DLX A;  2WCI A;  3ZIT A;  4LA1 A;  2L4C A;  1WWJ A;  2TRX A;  2CQ9 A;  4ECB A;  4EVM A;  4MJA A;  1R7H A;  1FW1 A;  4TW5 A;  2ALB A;  1WPI A;  5J3R A;  5ID2 A;  3KH7 A;  4GQF A;  3ISO A;  4D73 A;  4MF6 A;  1WRY A;  2DML A;  4PQ1 A;  3D5J A;  1PKW A;  3WGE A;  2O7K A;  5CRE A;  1ZZY A;  4YQM A;  3WGD A;  1F6M C;  1WMJ A;  3VI7 A;  2VCZ A;  3QAV A;  3DYR A;  4ZXG A;  1OC8 A;  1LBK A;  2FCH A;  4HOJ A;  1A24 A;  2AHE A;  4MMM A;  5J47 A;  1XWA A;  1QMV A;  3KCM A;  2LUS A;  3C1R A;  2PBJ A;  2CVB A;  3Q74 A;  2V6O A;  2QKE A;  1S3A A;  2GDR A;  3TKQ A;  3RHB A;  3P2A A;  4BVY B;  4N3Z A;  1Z6N A;  1ZYE A;  1GWC A;  19GS A;  2MBT A;  3HVS A;  4Q5N A;  1ERV A;  2B1K A;  3LGC A;  4V1A p;  4MP4 A;  3M9K A;  4KX4 A;  1X9S B;  2PPT A;  3GV1 A;  1V9W A;  3P7X A;  5JWO B;  5IOX A;  5CO3 A;  1GP1 A;  1OAZ A;  2K9F A;  2EIO A;  2VM1 A;  1AQX A;  3C1S A;  5HFG A;  3A5W A;  2B6M A;  1X9W B;  1F2E A;  3EU3 A;  3HA9 A;  3E9J B;  3FR9 A;  5GAP D;  1SVM A;  1TXU A;  5ECO B;  4BL7 A;  4JE1 A;  4I2U A;  3FR6 A;  4I8B A;  1MD4 A;  2WRT A;  3QFB C;  4IN0 A;  1EOH A;  4OCF A;  4ZIJ A;  5GST A;  1YY7 A;  4H86 A;  5J5N A;  4QMK A;  1K3Y A;  4MF7 A;  2GZY A;  3GX0 A;  3H8Q A;  1H75 A;  4AKG A;  2H1D A;  4QL7 A;  2A4H A;  3W6G A;  2M80 A;  2F8A A;  4L0U A;  3UAP A;  3EMX A;  3VPT A;  4N10 A;  18GS A;  5IIZ A;  3LXT A;  5BRT A;  1JFU A;  1Z6M A;  2F3M A;  1Q98 A;  3CSH A;  1SL2 B;  3O76 A;  2FWF A;  1A2M A;  1G6Y A;  3F6D A;  1EWX A;  4POB A;  3DKS A;  3TKS C;  1EOG A;  3MDK A;  3WD6 A;  4G0I A;  1SYX A;  3GH9 A;  1YDK A;  1T4Y A;  4V2M A;  2LNT A;  3HJM A;  3TDG A;  3D4T A;  4I2T A;  2J23 A;  3VWU A;  4JU5 A;  3VI5 A;  2I4A A;  1U88 A;  4KUN A;  1TOF A;  4KA0 A;  5AGY A;  3TKR A;  3ZRE A;  1A0F A;  2OBI A;  2PVO C;  4MCU A;  4I97 A;  1X9M B;  4G0K A;  3KH9 A;  5CRH A;  4GWR A;  1SVL A;  2X49 A;  2LKU A;  4N11 A;  4Z2U A;  2CZ2 A;  1YF0 A;  2VKZ G;  1FVJ A;  2EFD A;  4XIH A;  2H66 A;  4G9H A;  4N30 A;  1BG1 A;  4I5Q A;  5ECN B;  5J9C A;  4KDX A;  5DQY A;  3L78 A;  2R6K A;  3TGZ A;  2OE1 A;  3LJR A;  1RK4 A;  3GKN A;  4GF0 A;  3LQ7 A;  3QMX A;  4BWQ A;  1TJD A;  4ULX A;  3L9V A;  3G9B A;  3H1N A;  3F9U A;  3M1G A;  2E7P A;  5B8A A;  3FRC A;  4LLR A;  2YOI A;  2H75 A;  2YCD A;  4XS6 A;  4MJC A;  3EWL A;  3TOT A;  3KP8 A;  3F6F A;  4E8H A;  4HQS A;  3A5I A;  1U3A A;  2KUC A;  1X0R A;  2C80 A;  3M8N A;  4MZC A;  1QK8 A;  3PH9 A;  4A5P A;  1OKD A;  2IN3 A;  3TOU A;  5IOW A;  3UBK A;  3C71 A;  2GS3 A;  1XWB A;  4TN8 A;  3IXR A;  3L0H A;  4XS4 B;  3NOF A;  1V40 A;  1PN0 A;  4IKH A;  4TR1 A;  1GNE A;  4RQR A;  1G7E A;  1GLQ A;  4OD7 A;  3EPT A;  2VLT A;  3GL3 A;  3O3T A;  5F0G A;  1T1V A;  2X99 A;  4ZL8 A;  2FA8 A;  2CAQ A;  2L5L A;  3KGK A;  2CA8 A;  2FD3 A;  2L6D A;  4IJI A;  1AW9 A;  1VF4 A;  5A34 B;  1K0O A;  4RUV A;  1VF2 A;  4K0G A;  2RUE A;  9GSS A;  1SK0 A;  3BJ5 A;  3MWH A;  2VCT A;  4POL A;  5HQP A;  3WGX A;  1TU8 A;  1XVW A;  2E2G A;  1GTB A;  1V2A A;  2R37 A;  2YWO A;  2C0E A;  2JZS A;  5J4Y A;  4KE3 A;  4E8E A;  2CX4 A;  2FWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...