5BMUA

The crystal structure of the gst-like domains complex of aimp3-eprs mutant c92sc105sc123s
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
165
Chain Sequence
HMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/ligase
molecule keywords Eukaryotic translation elongation factor 1 epsilon-1
publication title Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 165
sequence length 168
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5bmuA02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5bmuA01
4ECCA 1DUGA 1YY7A 3P8WA 2CZ2A 2GSSA 3DD3A 5AN1A 3WYWA 2GSTA 4ECBA 4PX1A 1XW6A 4PURA 5IQYA 3WD6A 1JZRA 4MF7A 6GSYA 3R3EA 1K3LA 4IKHA 4ECIA 1M9AA 3LFLA 3F6FA 3KTLA 3VURA 5D9VA 4KX4A 2CAIA 2FHEA 11GSA 4I97A 1UA5A 3KMNA 4HOJA 3LXZA 2X64A 4KSMA 2HSMA 4IQAA 2VCXA 4G0KA 4IJIA 4HZ2A 4OFMA 5ECHB 2F8FA 5F07A 2IMIA 18GSA 1F3BA 4PXOA 1GUKA 4WR5A 1USBA 4KGIA 4PQHA 3O3TA 5ECMB 3UVHA 2C3QA 1PL1A 1ZL9A 3G7JA 3FYGA 4OFTA 12GSA 1HNAA 1GSDA 2VCQA 1V40A 20GSA 3M0FA 3Q74A 3FR3A 5AIXA 1AQVA 2C8UA 3IK9A 3D0ZA 4L8EA 5AIVA 5EVOA 3LYPA 2FNOA 3H1NA 3ERGA 1PKZA 5JCUA 1PN9A 1TU8A 17GSA 1PX6A 2GTUA 3CBUA 5ECRB 1ZGNA 4GTUA 2A2RA 4G0IA 1GWCA 7GSSA 1OYJA 2VO4A 1BX9A 4MDCA 3TOTA 5ECQB 2IL3A 3G7IA 3RBTA 6GSUA 3UBKA 2N5FA 5A4VA 4BVXB 5HFKA 5ECPB 3HKRA 3UBLA 1HNBA 1YKCA 4PTSA 1AW9A 4IS0A 3GH6A 1KBNA 3QR6A 1VF4A 5D9WA 3GX0A 16GSA 4K0NA 4G19A 2A2SA 2PERA 4ZB9A 3M3MA 3N5OA 2D2ZA 1GSYA 2PMTA 4CHSA 4EXJA 3DGQA 3IR4A 1Q4JA 4L5OA 5J41A 1B8XA 4NAXA 4O7HA 4F0CA 5KEJA 2R5GA 4N0VA 1TU7A 1XWGA 2GDRA 1F3AA 3CSJA 3CRTA 1XW5A 4PNFA 3VLNA 1MD3A 2JL4A 3ISOA 2YCDA 3R2QA 3ZMLA 4KH7A 4ACSA 4JBBA 2UZ8A 2OADA 5ELGA 1E6BA 4Q5NA 1AQXA 1OE8A 5GSTA 1XWKA 4TOPA 3L0HA 1BAYA 2OACA 2HSMB 1GNEA 5ECSA 3I69A 2CVDA 4ZB6A 2WS2A 4GLTA 5F05A 4E8HA 3MDKA 4MF5A 1EV4A 9GSSA 2DC5A 5BMUA 4GSSA 6GSVA 1FHEA 3GUSA 1BG5A 2OA7A 2C3NA 5A5KA 10GSA 3LSZA 1GTAA 1K0OA 4JEDA 5DDLA 5J4UA 3CSIA 2R4VA 4ZBDA 4KDXA 4O92A 4FQUA 3CSHA 3N9JA 4MP4A 5DCGA 4GF0A 3ZFLA 3FRCA 3PPUA 2CAQA 4EC0A 5LCZA 4QQ7A 1VF2A 4OFNA 2CA8A 1RK4A 1M0UA 3KMOA 2DSAA 4GCIA 2HSNB 3O76A 3LYKA 1GTUA 4GSTA 3U6VA 2GSRA 4KE3A 4USSA 3TGZA 2LJRA 5DJMA 3VWXA 5EY6A 5ECOB 3IE3A 5G5FA 2AAWA 2GLRA 3GURA 2R6KA 1GLPA 4Q5QA 3TOUA 3M1GA 5FT3A 3AY8A 1MD4A 6GSTA 1AQWA 3QAGA 4ZBBA 4BVYB 4EDZA 1K3OA 2YV7A 1K3YA 5F0GA 2YV9A 4MK3A 4KF9A 4YQVA 1A0FA 1K0CA 14GSA 4ISDA 1OKTA 1M9BA 1B4PA 1PX7A 2AHEA 1GSQA 3P90A 1NHYA 4IVFA 1AXDA 4K0GA 3GTUB 1N2AA 5G5EA 1GLQA 3CRUA 6GSWA 4BVYA 3VI7A 4KDYA 2ON7A 1GUMA 1B48A 3Q19A 5ECNB 3VPTA 4PNGA 6GSXA 2VCZA 1PA3A 1FW1A 3I6AA 3GTUA 22GSA 8GSSA 2VD0A 2AB6A 1K0BA 4PUAA 6GSSA 3LG6A 5DAKA 3IC8A 2NTOA 3GSSA 2C80A 4Q5FA 4GSNA 19GSA 1K0DA 3EINA 3QAWA 4HI7A 4KAEA 2VD1A 1IYIA 4YQUA 1EOGA 1PD21 5DALB 1OE7A 1TW9A 5J5NA 3VK9A 4G9HA 3NIVA 3W8SA 3IBHA 3HJMA 4F03A 1MTCA 3SWLA 4KDUA 4RI6A 2CZ3A 1K0NA 1VF1A 2VCVA 1LBKA 4ZXGA 3F6DA 3BBYA 4HJ2A 2V6KA 1IYHA 5DALA 1U3IA 3LJRA 5A4WA 4EDYA 3FR9A 4PGTA 1PL2A 3F63A 2VCTA 4BL7B 1GTIA 3PR8A 5GSSA 1EEMA 5D9TA 5AISA 2VCWA 4LMVA 3VI5A 4NHWA 3UARA 4ECJA 3IK7A 4E8EA 1U88A 3ERFA 3EE2A 1GSFA 5F8BA 1F2EA 2J9HA 3VPQA 5A4UA 2C3TA 4BL7A 1ML6A 4ZB8A 3ZMKA 1EOHA 3FR6A 4IQ1A 5D9XA 1JLVA 3M8NA 2PBJA 4IW9A 4YQMA 5ECIB 3LXTA 2F3MA 3HJOA 1M99A 5AGYA 2WRTA 4IELA 1GSSA 1HQOA 4DEJA 1GTBA 2R3XA 1BYEA 1YJ6A 2HQTA 3LQ7A 2GSQA 4MPFA 4IBPA 2PVQA 2C4JA 1G7OA 2WDUA 2PGTA 13GSA 2IMKA 5ECLB 3KJYA 2HRAA 1VF3A 1YQ1A 3ZFBA 3KXOA 5F06A 5FWGA 4AGSA 2WJUA 3MAKA 4ID0A 4WR4A 4PQIA 5FHIA 4NHZA 1LJRA 5ECKB 5DAKB 3Q18A 4F0BA 1V2AA 1YDKA 1GNWA 4YAPA 1GULA 1GSUA 1G6WA 3PGTA 1PKWA 1JLWA 2HNLA 2ON5A 4YAVA 5JCWA 2HRKB 1G6YA 1Z9HA 1TDIA 4G0LA 3FY7A 4G10A 4Q5RA 4ZBAA 3C8EA 4MF6A 4YH2A 5ELAA 4JZQA 1U87A 4IGJA 5D73A 5DQSA 1HNCA 4BVXA 5LD0A 2WB9A 1PMTA 4MZWA 4OMVA 3GSTA 4MPGA 5DJLA 5GZZB 1EV9A 2HRKA 5B7CA 3UAPA 4HZ4A 1K0AA 4J2FA 1K0MA 1C72A 4EE0A 1GSEA 1GUHA 1PGTA 4LMWA 5EL8A 4L5LA 3QAVA 1R5AA 4RI7A 1Y6EA 3KM6A
chains in the Genus database with same CATH superfamily
2XC2A 3P8WA 2WW2A 2LS5A 4ECBA 4Z2TA 2OBKA 1K3LA 1O85A 1JZOA 3EC3A 3LFLA 2E0QA 3VURA 2WVZA 3RPPA 11GSA 4HOJA 4XS1A 2NDOA 3D21A 2X64A 2LTKA 4ZB7A 4KSMA 4PI0C 2LEGA 3C1RA 4JE1A 4HZ2A 1SD8A 1QQ2A 4TKYA 2XHFA 5ECHB 5F07A 3QFBC 2IMIA 1FG4A 1TRUA 4PQHA 1PRXA 4XS4A 1XBSA 1LU4A 1HYUA 20GSA 5AIXA 2C8UA 1F37A 3GNJA 3ERWA 3J7Yk 2H19A 3LYPA 2FNOA 2VM2A 3GL5A 4GTUA 3OR5A 2IIYA 4RQRA 2WVXA 5ECQB 2CX4A 1EP7A 1XG8A 3UBKA 1CQHA 4BVXB 3WGXA 5ECPB 1HNBA 4AKGA 3CYNA 2E2MA 1AW9A 5D9WA 3GX0A 16GSA 1ZYNA 2O7KA 1YEWC 1PFOA 2CT6A 1FAAA 2JSYA 2PMTA 1ERTA 3ZYWA 3HMJG 5HFGA 3E0UA 3QOUA 4TN8A 4F0CA 1Z5YE 4X4JA 1TU7A 3CRTA 2YCDA 2BMXA 1YF1A 3UMAA 4JBBA 2OADA 4QL9A 2MZCA 5GSTA 1BAYA 2IMEA 5ECSA 4L0UA 4WKWA 4IJ3A 2L5OA 1UVZA 4ZB6A 3HYPA 3A3TA 1SVMA 2ALBA 1S3RA 2DC5A 2B1LA 2UV8G 1FHEA 3UVTA 2FWGA 3FEUA 2C3NA 10GSA 2FY6A 2V2GA 1GTAA 4XS4B 5J4UA 3CSIA 1BF5A 2FLSA 2DKHA 2YOIA 4GF0A 3FRCA 5LCZA 1SKWB 4OFNA 2CA8A 1RK4A 1SYRA 2DSAA 2F9SA 2HSNB 3O76A 2JZSA 1EWXA 4N11A 1GTUA 4GSTA 2YWNA 2GSRA 3E3EA 2WZ9A 3TGZA 1X9MB 4PHZC 3GYKA 2WVXB 5A1NA 3APQA 3FMWA 3GURA 2HSYA 2YANA 3TOUA 3IC4A 1G7EA 5KOWA 4JR6A 1AQWA 3VWVA 4BVYB 1K3OA 2LNSA 2XBIA 2I1UA 4YQVA 4HU9A 1K0CA 4IHUA 3LGCA 3TUEA 3ZRDA 2ZUPA 1TK5B 2K18A 2LNTA 2K6VA 1B4PA 3GN3A 2F8AA 3P90A 3TU3B 1KNGA 5DCHA 3GKKA 2B5EA 3DXBA 4HUAA 2DMMA 2G2QA 3FZAA 1GUMA 1T4YA 1FW1A 1AC1A 3FKFA 4GQFA 3TJBA 1VRSD 3TJJA 4ML6A 3BCIA 5DAKA 3WT2A 4Q5FA 4GSNA 4FIWA 4I2TA 1QK8A 5H5RA 1RQMA 1SVOA 4AKIA 3QAWA 1JFUA 2VD1A 4YQUA 1M3IA 4MJBA 4HDEA 2H1LA 2YP6A 2DKIA 2JZTA 3HJMA 3IV4A 3EU4A 4KDUA 1VF1A 4HJ2A 2V6KA 5DALA 4GDFA 2N5BA 3UIWA 4PGTA 5HR2A 2VCTA 3DMLA 4YKFA 4BL7B 2GT6A 3HVNA 4N3ZA 3MIXA 5D9TA 2VCWA 3VI5A 3HJPA 1S3DA 2V1MA 4ECJA 4E8EA 1U88A 1SD9A 3VPQA 3H4KA 2HRNA 2X49A 1ML6A 3KTBA 1A8LA 1EOHA 2B3SA 1YF0A 3M8NA 2B7JA 4YQMA 3LXTA 3C1SA 2ES7A 1GSSA 3WT1A 1BYEA 3LQ7A 2L59A 4K7NA 4TW5A 1S4BP 2X8HA 4KB3A 3KJYA 1A8YA 1TTZA 2YZUA 3C73A 4FYUA 4E68A 4FO5A 3KXOA 5FWGA 2EFDA 2YWMA 4MCUA 4WR4A 4PQIA 2LJKA 4EIPA 4J56E 5IO2A 5DAKB 1SJIA 4N0ZA 3Q18A 3RGBC 2L6CA 5A5HB 3DWVA 2H1GA 4YAPA 1GULA 1GSUA 1FVJA 1PKWA 3TRPA 4TXVA 5HR0A 2HNLA 5JCWA 2QGVA 1G6YA 4XCSA 4Q5RA 1EEJA 4ZBAA 4YH2A 4JZQA 1GP1A 4IGJA 4X1UA 1JZDA 4XHMA 1HNCA 4ZL7A 2C0EA 2VLUA 5CREA 2GQKA 5DJLA 5GZZB 4J2FA 2XBQA 4DSRA 2K9FA 3TDGA 4JU5A 1PGTA 4LMWA 3K8NA 1V57A 2PPTA 4JR4A 1YEPA 5J47A 1R5AA 4XRDA 5E4WA 2GQLA 2CZ2A 2GSSA 1TRWA 3ZLPA 3WYWA 2GSTA 4PX1A 1S3AA 2PWJA 4IKHA 4ECIA 3KTLA 4K6XA 5D9VA 4KX4A 2FHEA 4DSSA 3KMNA 4IP6A 3LXZA 2MYGA 4OD7A 2HSMA 3KGKA 4IQAA 2VCXA 2LRNA 4G0KA 2H0GA 2C0FA 4MJCA 1MDJA 4MZCA 1O6JA 5KN1A 2IMDA 5JCGA 2DJ2A 1CQGA 3DYRA 5ENUA 3ZTLA 4NPBA 4WR5A 2GZZA 4GQCA 3O3TA 3UVHA 2K8VA 2C3QA 3NOFA 5IPHA 3FYGA 4OFTA 2HZFA 12GSA 1GSDA 5G30A 3FR3A 2M72A 4OO4A 3TKSE 1X9SB 4KW6A 5J9CA 4NV5A 5EVOA 4AKXB 5IOXA 3H1NA 3ERGA 3CTFA 1PKZA 5JCUA 1PN9A 1TU8A 2YN1A 17GSA 1FO5A 3CBUA 5ECRB 3V1WA 1GL8A 1TKDB 2A2RA 5KN3A 3H93A 1FVKA 1GWCA 1OKDA 4MDCA 3RFRC 5DBQA 5C00A 3G7IA 1KEBA 4WBJA 2CQ9A 1X9WB 2H74A 4CY8A 2N5FA 5A4VA 1XCCA 3HKRA 3GFKA 4PTSA 3APOA 3TCOA 3GH6A 1KBNA 4K0NA 2O87A 5CAXA 3M3MA 2O85A 2D2ZA 3N5OA 2H75A 3TJKA 3DGQA 4L5OA 5J41A 2DJ1A 2L6DA 5KEJA 4N0VA 2GDRA 1XW5A 3VLNA 5IO0A 2JL4A 3R2QA 2EFCA 2OJLA 2IFQA 4QMKA 1AQXA 2OACA 2HSMB 1GNEA 1XIYA 4Z2UA 3MNGA 3I69A 2P31A 2FWHA 1DE1A 4GLTA 4CW9A 3MDKA 3LWAA 4G2EA 4OCFA 2DJ0A 3GUSA 5DDLA 2XPDA 2H1AA 4MH2A 1QUWA 2LUSA 5BRTA 4FQUA 4WETA 4Z7XA 4ZL9A 3F4SA 3PPUA 4QQ7A 1KTEA 3TJGA 4KNDA 2K8SA 1Z6MA 2O5VA 2NBSA 1QXHA 2OT3A 4USSA 2LJRA 4AI6A 5DJMA 4WF4A 5EY6A 5G1LA 5ECOB 1A2LA 2AAWA 4D73A 4O5RA 2BJXA 2R6KA 3KH9A 5B6NA 2HSNA 2IN3A 1TRSA 4QL7A 6GSTA 1OC9A 3QAGA 4ZBBA 2YV9A 2HLSA 14GSA 4ISDA 1O81A 2GT5A 3UOMA 3ME8A 3IXRA 4TXOB 5B6MA 4AKHA 1AXDA 4MA9A 4K0GA 2X8CA 4L0WA 5HR1A 4BVYA 2HFDA 3VI7A 2YZHA 3F3RA 1XZOA 1DBYA 3M9JA 1SL2B 3VPTA 1ILOA 2VCZA 3I6AA 2IFQB 5CNWA 1WWJA 22GSA 4PUAA 1PQNA 5IM9A 1NW2A 2NTOA 2C80A 1X5DA 3GIXA 19GSA 1K0DA 3HVVA 2YWIA 2HZEA 2KUCA 3IHQA 4KAEA 2OE3A 1EOGA 3E9JB 5GAPD 1ABAA 1XXUA 1SYXA 5J5NA 3A2XA 2DJJA 2HT9A 3TJFA 3CTGA 3KEBA 4YKGA 4PUFC 5EPFA 1XVWA 1MTCA 4O5UA 4V2MA 2CZ3A 2VCVA 3F6DA 3KP8A 1IYHA 4MZBA 3LJRA 1FOHA 5D96A 2DMLA 3F63A 3F8UA 3HZ8A 3PR8A 1I5GA 1U6TA 1N25A 4P3YB 5GSSA 4LMVA 2VL3A 4V1Ap 3GMFA 4D73B 3M9KA 1A2MA 4BL7A 1OC9B 2H71A 3O6TA 5JWQB 3ZMKA 2IPAA 4LA1A 1E2YA 4A5PA 1AUCA 1XW9A 2JADA 4X0XA 2IMFA 3FZ5A 2F3MA 3F3QA 1HQOA 4BIKA 2R3XA 4MPFA 4RUVA 2H72A 2C4JA 2LRCA 1G7OA 3P7XA 13GSA 4HU7A 4FYCA 2WZSA 1MDKA 1VF3A 1OVNA 5F06A 1B9YC 3TKSC 4ID0A 2H30A 4RQXA 4WF5A 5ECKB 2MMNA 4ZL8A 2VL2A 2HZEB 3WGDA 4F0BA 3W8JA 1GNWA 1G6WA 2QC7A 1JLWA 2ON5A 4YAVA 1M3JA 2HRKB 2C0DA 1GRXA 4EIQA 1ZZYA 1DSBA 2GVPA 2MBTA 5A5HA 4OCEA 2R0GA 5J3RA 1PMTA 3GSTA 1XWCA 1A0RP 4MNNA 5CP1A 2MBSA 1EV9A 5B7CA 4K8MA 4HZ4A 3IA1A 2GGTA 4EE0A 3CXGA 1GSEA 1XWAA 3GRXA 5EL8A 4L5LA 4POBA 5DQYA 1U3AA 4KDYA 1Y6EA 2WULA 4ECCA 4POLA 3IRAA 5AN1A 4W66A 4PURA 5IQYA 3WD6A 1WOUA 4MF7A 3IHGA 2LQOA 2IJYA 3F6FA 3G9BA 4WXTA 2PU9C 2VL9A 1V58A 4K2DA 2R2JA 3SBCA 1A2JA 1A23A 2M46A 3PINA 2N5AA 3EMPA 5A34B 3F0IA 1ACVA 1XFLA 1ERWA 4PI2C 1YZXA 1XPVA 1SVLA 1F3BA 1GUKA 1V9WA 1USBA 4KGIA 2B5XA 5ECMB 3CQFA 3MYDA 2MMAA 3GA4A 1PL1A 1ZL9A 3G7JA 2HXKA 2VCQA 1MDIA 1V40A 1J0FA 4BWQA 4BPYA 3M0FA 3KH7A 4DSQA 1S3CA 1HD2A 1AQVA 2VLVA 3D0ZA 1R5PA 5AIVA 1WPIA 3GL3A 2X99A 5JWOB 1PX6A 2GTUA 1NM3A 4WEYA 3D6IA 4G0IA 2G0FA 5GAND 1OYJA 1BX9A 3TOTA 4EL1A 3D22A 1QFNA 2DBCA 2DJ3A 3VWUA 3UEMA 3WGEA 3FW2A 4XS6A 1M2BA 3W6GA 1VF4A 4GWRA 4ZB9A 2PERA 3BJ5A 4PQ1A 2R0CA 2PVOC 3IR4A 2CV4A 1I9DA 1B8XA 4NAXA 4O7HA 2R5GA 2AV4A 1XWGA 1F3AA 3CSJA 2O36A 4PNFA 1ZYEA 3LORA 2FWEA 2HE3A 1A24A 3ZMLA 4ACSA 5D93A 2VM1A 2UZ8A 1E6BA 4Q5NA 5BMUB 2C1YA 1OE8A 3L0HA 4N10A 3GV1A 3P2AA 2GS3A 4POMA 4F2IA 2WS2A 5F05A 1OC3A 5DVBA 1J08A 4NV2A 1TP9A 6GSVA 3Q6OA 2O89A 4HQSA 1WIKA 2DIYA 4ZIJA 4HEA2 3H8QA 3F4RA 4JEDA 3F9UA 4ZBDA 4O92A 4FYBA 2A4HA 4MP4A 5DCGA 4AF2A 1J9BA 1SKRB 2MMZA 3DEXA 4EC0A 1M0UA 5L71A 4K7OA 2V6OA 2O3EA 4GCIA 3BD2A 3DVXA 1ERUA 2CX3A 2EIOA 4Z2RA 3U6VA 3KD0A 2H0HA 4KE3A 3L9SA 3S9FA 5G5FA 1H75A 3BOAA 2GLRA 1GLPA 4V2LA 1W89A 3EVIA 4TR1A 3M1GA 1ZMAA 2CVKA 5FT3A 4EF0A 1F9MA 2RLIA 3AY8A 1OC8A 3ED3A 2YV7A 1K3YA 4IP1A 4O5QA 2H6XA 4F82A 1THXA 1OKTA 1N8JA 2B7KA 1ST9A 5J4VA 1PX7A 2AHEA 1GSQA 1NHYA 2B6MA 3HVXA 3GTUB 4CY6A 2V41A 5G5EA 1GLQA 6GSWA 5IPGA 3C7MA 3IPZA 2ON7A 5G2ZA 5HFIA 3TB2A 3KIJA 3QDNA 4TXOA 4K7IA 1NHOA 2I81A 3IAM2 8GSSA 2VD0A 1SU9A 2YJ7A 4O32A 3QD9A 1SENA 4K2XA 1R4WA 3GSSA 2BTOT 2H6ZA 1EGRA 4MH3A 1OAZA 2TRXA 4GRFA 1IYIA 1PD21 1OE7A 1FB0A 3VK9A 3GH9A 4G9HA 3NIVA 2OE0A 3W8SA 3GKXA 2I4AA 1TI3A 2JU5A 3D5JA 3ZITA 4F03A 5C04A 3SWLA 4RI6A 1K0NA 2GQMA 4EVMA 1LBKA 2P5RA 4ZXGA 3RDWA 2EC4A 1XOAA 1U3IA 4EDYA 2O8VB 3FR9A 5JWRB 3MSZA 1PL2A 3CWGA 2E7PA 3MWHA 1I1IP 1T3BA 3C71A 1EEMA 5AISA 4NHWA 1B9XC 3UARA 5KOXA 1Z7RA 2VIMA 3ERFA 1GSFA 2XPEA 3RHCA 4TR1B 2FCHA 4JRRA 4K5SA 3HY2A 2C3TA 1EZKA 4ZB8A 4H86A 4NWYA 4NXIA 3IOSA 2LQQA 4IQ1A 4MLYA 5ABRA 5D9XA 1JLVA 2PBJA 4IW9A 1ZOFA 3DVWA 4X43A 5ECIB 1EGOA 5AGYA 2PN8A 5G31A 1O73A 1TK8B 2YWOA 4DEJA 1GTBA 1JHBA 1YJ6A 2A2PA 2GSQA 1F6MC 2L4QA 2VKZG 2WDUA 2LKUA 3EWLA 2FGXA 2KHPA 3NZNA 2EIRA 1FB6A 2HRAA 1YQ1A 3J7Yb 3HCZA 4AGSA 2L5LA 2WW0A 2FUG2 5FHIA 1LJRA 2JZRA 1BJXA 1TK0B 3I9V2 3FZ4A 2FWFA 1V2AA 4BA7A 1YDKA 1PN0A 2E2GA 2KOKA 3PGTA 1TRVA 1M2AA 2RIIA 5G1KA 3HVSA 4KCAA 3GKNA 4K5RA 2WFCA 4G0LA 1YKAA 4CDOA 1BQ7A 3UJ1A 5IMFA 1EP8A 4MF6A 1WRYA 5H5QA 4FXYP 2I9HA 4MJAA 5KN2A 3F4TA 2WW3A 5LD0A 3QCPA 3TRQA 5J9BA 2VLTA 3CMIA 4MPGA 4MJEA 1UN2A 1SKSB 2HRKA 3KCMA 4ILFA 5D8IA 1K0MA 3ZL5A 1MEKA 3EYTA 3A5WA 2WVYA 3QAVA 4I2UA 1AIUA 3KM6A 1W4VA 1DUGA 1R7HA 1YY7A 2HRFA 3DD3A 2X4AA 3L4NA 1XW6A 1GH2A 1SK0A 1TI1A 1JZRA 4K1FA 6GSYA 3R3EA 3QFAC 2NVLA 1FOVA 1WE0A 3EURA 1M9AA 5J40A 2MMOA 2M80A 2CAIA 2KLXA 4I97A 1UA5A 2H6YA 2L57A 1O7UA 2YJHA 5CRGA 3FK8A 3TKQA 2DJKA 1M2DA 4IN0A 4IJIA 4I6XA 2H70A 3DRNA 4I5QA 3G7YA 4OFMA 2J23A 2F8FA 18GSA 1T8EB 2LSTA 4PXOA 1YEXA 3HD5A 2FA4A 2EIQA 3L9UA 2P5QA 1HNAA 1WMJA 2ZNMA 2RUFA 1SK1A 3TRXA 3Q74A 1ON4A 5A34A 5H5SA 3IK9A 1XOBA 4L8EA 4AJ8A 1T00A 1TOFA 2EFEA 3RPNA 2GZPA 1ZCPA 1ZGNA 2F51A 3ZIVA 3TKRA 7GSSA 4GXZA 1WJKA 2VO4A 5B8AA 2IL3A 3RBTA 2H66A 3FZ9A 5IOWA 2B1KA 6GSUA 4WBRD 3A5IA 5HFKA 5CRWA 3UBLA 3VFIA 2RM5A 1YKCA 1R26A 2GZYA 1PSQA 4IS0A 3DKSA 3QR6A 1ZYPA 4EKZA 2R0PA 4G19A 2A2SA 2HYXA 3JCML 1Z6NA 1GSYA 4CHSA 4EXJA 3BCKA 2H1BA 2JACA 1Q4JA 4ULXA 3ZZXA 3VWWA 2OKAA 2V32A 3RAZA 2H8LA 1XVQA 1MD3A 3ISOA 2AUVA 5E59A 4KH7A 1BEDA 2TRCP 1M7TA 5ELGA 4EUYA 1ERVA 3D4MA 2YPMA 1XWKA 4TOPA 1SJ6A 2FD3A 1AAZA 2QSIA 2H1DA 3HA9A 3ME7A 5CO3A 5HR3A 2CVDA 2AJQB 1Y25A 2AYTA 4E8HA 1X0RA 3IAS2 4XRAA 1EV4A 9GSSA 4ICYA 5BMUA 4GSSA 3A2WA 1BG5A 2OA7A 5A5KA 4AJ6A 2X8GA 5HQPA 3LSZA 1K0OA 4POKA 4N30A 3UL3A 2R4VA 1X5EA 1H4OA 4KDXA 3CSHA 3N9JA 5A1NB 5IMZA 3ZFLA 2CAQA 1VF2A 3ZIJA 3KMOA 4F9ZA 2I3YA 3LYKA 4TVEA 5CRHA 1URMA 3GX8A 2HSHA 3APSA 3VWXA 4DVCA 3IE3A 5J4YA 2OBIA 4Q5QA 1Z7PA 2REMA 2LRTA 1MD4A 2NPBA 3HXSA 4EDZA 4XIHA 5F0GA 2QKEA 1B4QA 2WGRA 1WP0A 2VAFA 4MK3A 4KF9A 1A0FA 3HZ4A 5IMAA 3A2VA 1TJDA 1V98A 1VGLA 4I8BA 3EPTA 1M9BA 3TKPA 3HHVA 2A4VA 1SJZA 4IVFA 3DIEA 1N2AA 3CRUA 2RM6A 3H79A 4KCEA 4HS1A 5ID2A 1B48A 1SL1B 2Z9SA 3Q19A 5ECNB 4HQZA 4PNGA 6GSXA 3KP9A 5INYA 1PA3A 1T4ZA 3GTUA 2AB6A 5IMCA 1K0BA 3GKMA 2VUPA 3ZVJA 4MABA 6GSSA 3LG6A 1SK2A 2WW1A 4EO3A 3IC8A 3ZVJD 2OE1A 2LV3A 3EINA 1O8WA 4HI7A 4OO5A 5CYYA 1THOA 5DALB 1TW9A 3L78A 2DIZA 4LL4B 5IMDA 2JSZA 3IBHA 2KP1A 4OWYA 3EMXA 1DE2A 1TXUA 2KP2A 1T7PB 4G01A 3BBYA 1T1VA 3I43A 5A4WA 4HSCX 4K9ZA 3QMXA 1O8XA 4ML1A 4V2NA 2QA2A 4HJMA 1GTIA 3GHAA 1G0TA 4TR4A 3IK7A 3EE2A 1X5CA 5F8BA 1F2EA 2L4CA 4XTSA 2J9HA 5A4UA 4LL1B 2EFHA 3QPMA 2VOCA 2H76A 2ZCTA 3D4TA 4KA0A 3FR6A 2H73A 3PH9A 2B5YA 4AJ7A 2QA1A 3HJOA 1M99A 2WRTA 4IELA 4MMMA 4KSOA 1QGVA 1NSWA 2CVBA 1Z3EA 2HQTA 3KZQA 1TXXA 4IBPA 5ID2B 2PVQA 3ZREA 3CHXC 5KN0A 1JZWA 3EU3A 2PGTA 2IMKA 5ECLB 5IIZA 1UC7A 3ZFBA 3RHBA 1BG1A 2VL2C 3L9VA 2WJUA 3MAKA 2FA8A 4NHZA 1XWBA 2PUKC 1YVLA 2WCIA 5CRDA 4BWSA 3US3A 4LLRA 1Y1UA 3TKSA 2H01A 3LEFA 4V1Ag 5B8BA 2TIRA 4J57E 5COHA 5IMVA 1Z9HA 1SL0B 4TR0A 1TDIA 3FY7A 4G10A 2C0GA 3FHKA 1ZYQB 2RUEA 3C8EA 5ELAA 1U87A 5D73A 5DQSA 1RW1A 4KUNA 2DLXA 4BVXA 5LNKe 2WB9A 4MZWA 4OMVA 4FH8A 2YNXA 3UAPA 1Q98A 2P0GA 3U5RE 1K0AA 2HI7A 1C72A 4TR3A 2R37A 2H0IA 1GUHA 2LJAA 3IDVA 1QMVA 4NMUA 3LW9A 4ZILA 4TRXA 4RI7A 3HDCA 2IWTA 4MF5A 4DSSB
chains in the Genus database with same CATH topology
2XC2A 3P8WA 2LS5A 4ECBA 4Z2TA 2OBKA 1K3LA 1O85A 1JZOA 3EC3A 3LFLA 2E0QA 3VURA 3RPPA 11GSA 4HOJA 4XS1A 2NDOA 3D21A 2X64A 2LTKA 4ZB7A 4KSMA 2LEGA 3C1RA 4JE1A 4HZ2A 1SD8A 1QQ2A 4TKYA 2XHFA 5ECHB 5F07A 3QFBC 2IMIA 1FG4A 1TRUA 4PQHA 1PRXA 4XS4A 1XBSA 1LU4A 1HYUA 20GSA 5AIXA 2C8UA 1F37A 3GNJA 3ERWA 3J7Yk 2H19A 3LYPA 2FNOA 2VM2A 3GL5A 4GTUA 3OR5A 2IIYA 4RQRA 5ECQB 2CX4A 1EP7A 3UBKA 1CQHA 4BVXB 3WGXA 5ECPB 1HNBA 4AKGA 3CYNA 2E2MA 1AW9A 5D9WA 3GX0A 16GSA 1ZYNA 2O7KA 2CT6A 1FAAA 2JSYA 2PMTA 1ERTA 3ZYWA 3HMJG 5HFGA 3E0UA 3QOUA 4TN8A 4F0CA 1Z5YE 4X4JA 1TU7A 3CRTA 2YCDA 2BMXA 1YF1A 3UMAA 4JBBA 2OADA 4QL9A 2MZCA 5GSTA 1BAYA 2IMEA 5ECSA 4L0UA 4WKWA 4IJ3A 2L5OA 1UVZA 4ZB6A 3HYPA 3A3TA 1SVMA 2ALBA 2B1LA 2DC5A 2UV8G 1FHEA 3UVTA 2FWGA 3FEUA 2C3NA 10GSA 2FY6A 2V2GA 1GTAA 4XS4B 5J4UA 3CSIA 1BF5A 2FLSA 2DKHA 2YOIA 4GF0A 3FRCA 5LCZA 1SKWB 4OFNA 2CA8A 1RK4A 1SYRA 2DSAA 2F9SA 2HSNB 3O76A 2JZSA 1EWXA 4N11A 1GTUA 4GSTA 2YWNA 2GSRA 3E3EA 2WZ9A 3TGZA 1X9MB 3GYKA 5A1NA 3APQA 3FMWA 3GURA 2HSYA 2YANA 3TOUA 3IC4A 1G7EA 5KOWA 4JR6A 1AQWA 3VWVA 4BVYB 1K3OA 2LNSA 2XBIA 2I1UA 4YQVA 4HU9A 1K0CA 4IHUA 3LGCA 3TUEA 3ZRDA 2ZUPA 1TK5B 2K18A 2LNTA 2K6VA 1B4PA 3GN3A 2F8AA 3P90A 3TU3B 1KNGA 5DCHA 3GKKA 2B5EA 3DXBA 4HUAA 2DMMA 2G2QA 3FZAA 1GUMA 1T4YA 1FW1A 1AC1A 3FKFA 4GQFA 3TJBA 1VRSD 3TJJA 4ML6A 3BCIA 5DAKA 3WT2A 4Q5FA 4GSNA 4FIWA 4I2TA 1QK8A 5H5RA 1RQMA 1SVOA 4AKIA 3QAWA 1JFUA 2VD1A 4YQUA 4MJBA 4HDEA 2H1LA 2YP6A 2DKIA 2JZTA 3HJMA 3IV4A 3EU4A 4KDUA 1VF1A 4HJ2A 2V6KA 5DALA 4GDFA 2N5BA 3UIWA 4PGTA 5HR2A 2VCTA 3DMLA 4YKFA 4BL7B 2GT6A 4N3ZA 3MIXA 5D9TA 2VCWA 3VI5A 3HJPA 1S3DA 2V1MA 4ECJA 4E8EA 1U88A 1SD9A 3VPQA 3H4KA 2HRNA 2X49A 1ML6A 3KTBA 1A8LA 1EOHA 2B3SA 1YF0A 3M8NA 2B7JA 4YQMA 3LXTA 3C1SA 2ES7A 1GSSA 3WT1A 1BYEA 3LQ7A 2L59A 4K7NA 4TW5A 2X8HA 4KB3A 3KJYA 1A8YA 1TTZA 2YZUA 3C73A 4FYUA 4E68A 4FO5A 3KXOA 5FWGA 2EFDA 2YWMA 4MCUA 4WR4A 4PQIA 2LJKA 4EIPA 4J56E 5IO2A 5DAKB 1SJIA 4N0ZA 3Q18A 2L6CA 5A5HB 3DWVA 2H1GA 4YAPA 1GULA 1GSUA 1FVJA 1PKWA 3TRPA 4TXVA 5HR0A 2HNLA 5JCWA 2QGVA 1G6YA 4XCSA 4Q5RA 1EEJA 4ZBAA 4YH2A 4JZQA 1GP1A 4IGJA 4X1UA 1JZDA 4XHMA 1HNCA 4ZL7A 2C0EA 2VLUA 5CREA 2GQKA 5DJLA 5GZZB 4J2FA 2XBQA 4DSRA 2K9FA 3TDGA 4JU5A 1PGTA 4LMWA 3K8NA 1V57A 2PPTA 4JR4A 1YEPA 5J47A 1R5AA 4XRDA 5E4WA 2GQLA 2CZ2A 2GSSA 1TRWA 3ZLPA 3WYWA 2GSTA 4PX1A 1S3AA 2PWJA 4IKHA 4ECIA 3KTLA 4K6XA 5D9VA 4KX4A 2FHEA 4DSSA 3KMNA 4IP6A 3LXZA 2MYGA 4OD7A 2HSMA 3KGKA 4IQAA 2VCXA 2LRNA 4G0KA 2H0GA 2C0FA 4MJCA 1MDJA 4MZCA 1O6JA 5KN1A 2IMDA 5JCGA 2DJ2A 1CQGA 3DYRA 5ENUA 3ZTLA 4NPBA 4WR5A 2GZZA 4GQCA 3O3TA 3UVHA 2K8VA 2C3QA 3NOFA 5IPHA 3FYGA 4OFTA 2HZFA 12GSA 1GSDA 5G30A 3FR3A 2M72A 4OO4A 3TKSE 1X9SB 4KW6A 5J9CA 4NV5A 5EVOA 4AKXB 5IOXA 3H1NA 3ERGA 3CTFA 1PKZA 5JCUA 1PN9A 1TU8A 2YN1A 17GSA 1FO5A 3CBUA 5ECRB 3V1WA 1GL8A 1TKDB 2A2RA 5KN3A 3H93A 1FVKA 1GWCA 1OKDA 4MDCA 5DBQA 5C00A 3G7IA 1KEBA 4WBJA 2CQ9A 1X9WB 2H74A 4CY8A 2N5FA 5A4VA 1XCCA 3HKRA 3GFKA 4PTSA 3APOA 3TCOA 3GH6A 1KBNA 4K0NA 2O87A 5CAXA 3M3MA 2O85A 3N5OA 2D2ZA 2H75A 3TJKA 3DGQA 4L5OA 5J41A 2DJ1A 2L6DA 5KEJA 4N0VA 2GDRA 1XW5A 3VLNA 5IO0A 2JL4A 3R2QA 2EFCA 2OJLA 2IFQA 4QMKA 1AQXA 2OACA 2HSMB 1GNEA 1XIYA 4Z2UA 3MNGA 3I69A 2P31A 2FWHA 1DE1A 4GLTA 4CW9A 3MDKA 3LWAA 4G2EA 4OCFA 2DJ0A 3GUSA 5DDLA 2XPDA 2H1AA 4MH2A 1QUWA 2LUSA 5BRTA 4FQUA 4WETA 4Z7XA 4ZL9A 3F4SA 3PPUA 4QQ7A 1KTEA 3TJGA 4KNDA 2K8SA 1Z6MA 2O5VA 2NBSA 1QXHA 2OT3A 4USSA 2LJRA 4AI6A 5DJMA 4WF4A 5EY6A 5G1LA 5ECOB 1A2LA 2AAWA 4D73A 4O5RA 2BJXA 2R6KA 3KH9A 5B6NA 2HSNA 2IN3A 1TRSA 4QL7A 6GSTA 1OC9A 3QAGA 4ZBBA 2YV9A 2HLSA 14GSA 4ISDA 1O81A 2GT5A 3UOMA 3ME8A 3IXRA 4TXOB 5B6MA 4AKHA 1AXDA 4MA9A 4K0GA 2X8CA 4L0WA 5HR1A 4BVYA 2HFDA 3VI7A 2YZHA 3F3RA 1XZOA 1DBYA 3M9JA 1SL2B 3VPTA 1ILOA 2VCZA 3I6AA 2IFQB 5CNWA 1WWJA 22GSA 4PUAA 1PQNA 5IM9A 1NW2A 2NTOA 2C80A 1X5DA 3GIXA 19GSA 1K0DA 3HVVA 2YWIA 2HZEA 2KUCA 3IHQA 4KAEA 2OE3A 1EOGA 3E9JB 5GAPD 1ABAA 1XXUA 1SYXA 5J5NA 3A2XA 2DJJA 2HT9A 3TJFA 3CTGA 3KEBA 4YKGA 4PUFC 5EPFA 1XVWA 1MTCA 4O5UA 4V2MA 2CZ3A 2VCVA 3F6DA 3KP8A 1IYHA 4MZBA 3LJRA 1FOHA 5D96A 2DMLA 3F63A 3F8UA 3HZ8A 3PR8A 1I5GA 1U6TA 1N25A 4P3YB 5GSSA 4LMVA 2VL3A 4V1Ap 3GMFA 4D73B 3M9KA 1A2MA 4BL7A 1OC9B 2H71A 3O6TA 5JWQB 3ZMKA 2IPAA 4LA1A 1E2YA 4A5PA 1AUCA 1XW9A 2JADA 4X0XA 2IMFA 3FZ5A 2F3MA 3F3QA 1HQOA 2R3XA 4MPFA 4RUVA 2H72A 2C4JA 2LRCA 1G7OA 3P7XA 13GSA 4HU7A 4FYCA 1MDKA 1VF3A 1OVNA 5F06A 1B9YC 3TKSC 4ID0A 2H30A 4RQXA 4WF5A 5ECKB 2MMNA 4ZL8A 2VL2A 2HZEB 3WGDA 4F0BA 3W8JA 1GNWA 1G6WA 2QC7A 1JLWA 2ON5A 4YAVA 2HRKB 2C0DA 1GRXA 4EIQA 1ZZYA 1DSBA 2GVPA 2MBTA 5A5HA 4OCEA 2R0GA 5J3RA 1PMTA 3GSTA 1XWCA 1A0RP 4MNNA 5CP1A 2MBSA 1EV9A 5B7CA 4K8MA 4HZ4A 3IA1A 2GGTA 4EE0A 3CXGA 1GSEA 1XWAA 3GRXA 5EL8A 4L5LA 4POBA 5DQYA 1U3AA 4KDYA 1Y6EA 2WULA 4ECCA 4POLA 3IRAA 5AN1A 4W66A 4PURA 5IQYA 3WD6A 1WOUA 4MF7A 3IHGA 2LQOA 2IJYA 3F6FA 3G9BA 4WXTA 2PU9C 2VL9A 1V58A 4K2DA 2R2JA 3SBCA 1A2JA 1A23A 2M46A 3PINA 2N5AA 3EMPA 5A34B 3F0IA 1ACVA 1XFLA 1ERWA 1YZXA 1XPVA 1SVLA 1F3BA 1GUKA 1V9WA 1USBA 4KGIA 2B5XA 5ECMB 3MYDA 2MMAA 3GA4A 1PL1A 1ZL9A 3G7JA 2HXKA 2VCQA 1MDIA 1V40A 1J0FA 4BWQA 4BPYA 3M0FA 3KH7A 4DSQA 1S3CA 1HD2A 1AQVA 2VLVA 3D0ZA 1R5PA 5AIVA 1WPIA 3GL3A 2X99A 5JWOB 1PX6A 2GTUA 1NM3A 4WEYA 3D6IA 4G0IA 2G0FA 5GAND 1OYJA 1BX9A 3TOTA 4EL1A 3D22A 1QFNA 2DBCA 2DJ3A 3VWUA 3UEMA 3WGEA 3FW2A 4XS6A 1M2BA 3W6GA 1VF4A 4GWRA 4ZB9A 2PERA 3BJ5A 4PQ1A 2R0CA 2PVOC 3IR4A 2CV4A 1I9DA 1B8XA 4NAXA 4O7HA 2R5GA 2AV4A 1XWGA 1F3AA 3CSJA 4PNFA 1ZYEA 3LORA 2FWEA 2HE3A 1A24A 3ZMLA 4ACSA 5D93A 2VM1A 2UZ8A 1E6BA 4Q5NA 5BMUB 2C1YA 1OE8A 3L0HA 4N10A 3GV1A 3P2AA 2GS3A 4POMA 4F2IA 2WS2A 5F05A 1OC3A 5DVBA 1J08A 4NV2A 1TP9A 6GSVA 3Q6OA 2O89A 4HQSA 1WIKA 2DIYA 4ZIJA 4HEA2 3H8QA 3F4RA 4JEDA 3F9UA 4ZBDA 4O92A 4FYBA 2A4HA 4MP4A 5DCGA 4AF2A 1J9BA 1SKRB 2MMZA 3DEXA 4EC0A 1M0UA 5L71A 4K7OA 2V6OA 4GCIA 3BD2A 3DVXA 1ERUA 2CX3A 2EIOA 4Z2RA 3U6VA 3KD0A 2H0HA 4KE3A 3L9SA 3S9FA 5G5FA 1H75A 3BOAA 2GLRA 1GLPA 4V2LA 1W89A 3EVIA 4TR1A 3M1GA 1ZMAA 2CVKA 5FT3A 4EF0A 1F9MA 2RLIA 3AY8A 1OC8A 3ED3A 2YV7A 1K3YA 4IP1A 4O5QA 2H6XA 4F82A 1THXA 1OKTA 1N8JA 2B7KA 1ST9A 5J4VA 1PX7A 2AHEA 1GSQA 1NHYA 2B6MA 3HVXA 3GTUB 4CY6A 2V41A 5G5EA 1GLQA 6GSWA 5IPGA 3C7MA 3IPZA 2ON7A 5G2ZA 5HFIA 3TB2A 3KIJA 3QDNA 4TXOA 4K7IA 1NHOA 2I81A 3IAM2 8GSSA 2VD0A 1SU9A 2YJ7A 4O32A 3QD9A 1SENA 4K2XA 1R4WA 3GSSA 2BTOT 2H6ZA 1EGRA 4MH3A 1OAZA 2TRXA 4GRFA 1IYIA 1PD21 1OE7A 1FB0A 3VK9A 3GH9A 4G9HA 3NIVA 2OE0A 3W8SA 3GKXA 2I4AA 1TI3A 2JU5A 3D5JA 3ZITA 4F03A 5C04A 3SWLA 4RI6A 1K0NA 2GQMA 4EVMA 1LBKA 2P5RA 4ZXGA 3RDWA 2EC4A 1XOAA 1U3IA 4EDYA 2O8VB 3FR9A 5JWRB 3MSZA 1PL2A 3CWGA 2E7PA 3MWHA 1T3BA 3C71A 1EEMA 5AISA 4NHWA 1B9XC 3UARA 5KOXA 1Z7RA 2VIMA 3ERFA 1GSFA 2XPEA 3RHCA 4TR1B 2FCHA 4JRRA 4K5SA 3HY2A 2C3TA 1EZKA 4ZB8A 4H86A 4NWYA 4NXIA 3IOSA 2LQQA 4IQ1A 4MLYA 5ABRA 5D9XA 1JLVA 2PBJA 4IW9A 1ZOFA 3DVWA 4X43A 5ECIB 1EGOA 5AGYA 2PN8A 5G31A 1O73A 1TK8B 2YWOA 4DEJA 1GTBA 1JHBA 1YJ6A 2A2PA 2GSQA 1F6MC 2L4QA 2VKZG 2WDUA 2LKUA 3EWLA 2FGXA 2KHPA 3NZNA 2EIRA 1FB6A 2HRAA 1YQ1A 3J7Yb 3HCZA 4AGSA 2L5LA 2FUG2 5FHIA 1LJRA 2JZRA 1BJXA 1TK0B 3I9V2 3FZ4A 2FWFA 1V2AA 4BA7A 1YDKA 1PN0A 2E2GA 2KOKA 3PGTA 1TRVA 1M2AA 2RIIA 5G1KA 3HVSA 4KCAA 3GKNA 4K5RA 2WFCA 4G0LA 1YKAA 4CDOA 1BQ7A 3UJ1A 5IMFA 1EP8A 4MF6A 1WRYA 5H5QA 2I9HA 4MJAA 5KN2A 3F4TA 5LD0A 3QCPA 3TRQA 5J9BA 2VLTA 3CMIA 4MPGA 4MJEA 1UN2A 1SKSB 2HRKA 3KCMA 4ILFA 5D8IA 1K0MA 3ZL5A 1MEKA 3EYTA 3A5WA 3QAVA 4I2UA 1AIUA 3KM6A 1W4VA 1DUGA 1R7HA 1YY7A 2HRFA 3DD3A 2X4AA 3L4NA 1XW6A 1GH2A 1SK0A 1TI1A 1JZRA 4K1FA 6GSYA 3R3EA 3QFAC 2NVLA 1FOVA 1WE0A 3EURA 1M9AA 5J40A 2MMOA 2M80A 2CAIA 2KLXA 4I97A 1UA5A 2H6YA 2L57A 1O7UA 2YJHA 5CRGA 3FK8A 3TKQA 2DJKA 1M2DA 4IN0A 4IJIA 4I6XA 2H70A 3DRNA 4I5QA 3G7YA 4OFMA 2J23A 2F8FA 18GSA 1T8EB 2LSTA 4PXOA 1YEXA 3HD5A 2FA4A 2EIQA 3L9UA 2P5QA 1HNAA 1WMJA 2ZNMA 2RUFA 1SK1A 3TRXA 3Q74A 1ON4A 5A34A 5H5SA 3IK9A 1XOBA 4L8EA 4AJ8A 1T00A 1TOFA 2EFEA 3RPNA 2GZPA 1ZCPA 1ZGNA 2F51A 3ZIVA 3TKRA 7GSSA 4GXZA 1WJKA 2VO4A 5B8AA 2IL3A 3RBTA 2H66A 3FZ9A 5IOWA 2B1KA 6GSUA 4WBRD 3A5IA 5HFKA 5CRWA 3UBLA 3VFIA 2RM5A 1YKCA 1R26A 2GZYA 1PSQA 4IS0A 3DKSA 3QR6A 1ZYPA 4EKZA 2R0PA 4G19A 2A2SA 2HYXA 3JCML 1Z6NA 1GSYA 4CHSA 4EXJA 3BCKA 2H1BA 2JACA 1Q4JA 4ULXA 3ZZXA 3VWWA 2OKAA 2V32A 3RAZA 2H8LA 1XVQA 1MD3A 3ISOA 2AUVA 5E59A 4KH7A 1BEDA 2TRCP 1M7TA 5ELGA 4EUYA 1ERVA 3D4MA 2YPMA 1XWKA 4TOPA 1SJ6A 2FD3A 1AAZA 2QSIA 2H1DA 3HA9A 3ME7A 5CO3A 5HR3A 2CVDA 2AJQB 1Y25A 2AYTA 4E8HA 1X0RA 3IAS2 4XRAA 1EV4A 9GSSA 4ICYA 5BMUA 4GSSA 3A2WA 1BG5A 2OA7A 5A5KA 4AJ6A 2X8GA 5HQPA 3LSZA 1K0OA 4POKA 4N30A 3UL3A 2R4VA 1X5EA 1H4OA 4KDXA 3CSHA 3N9JA 5A1NB 5IMZA 3ZFLA 2CAQA 1VF2A 3ZIJA 3KMOA 4F9ZA 2I3YA 3LYKA 4TVEA 5CRHA 1URMA 3GX8A 2HSHA 3APSA 3VWXA 4DVCA 3IE3A 5J4YA 2OBIA 4Q5QA 1Z7PA 2REMA 2LRTA 1MD4A 2NPBA 3HXSA 4EDZA 4XIHA 5F0GA 2QKEA 1B4QA 2WGRA 1WP0A 2VAFA 4MK3A 4KF9A 1A0FA 3HZ4A 5IMAA 3A2VA 1TJDA 1V98A 1VGLA 4I8BA 3EPTA 1M9BA 3TKPA 3HHVA 2A4VA 1SJZA 4IVFA 3DIEA 1N2AA 3CRUA 2RM6A 3H79A 4KCEA 4HS1A 5ID2A 1B48A 1SL1B 2Z9SA 3Q19A 5ECNB 4HQZA 4PNGA 6GSXA 3KP9A 5INYA 1PA3A 1T4ZA 3GTUA 2AB6A 5IMCA 1K0BA 3GKMA 2VUPA 3ZVJA 4MABA 6GSSA 3LG6A 1SK2A 4EO3A 3IC8A 3ZVJD 2OE1A 2LV3A 3EINA 1O8WA 4HI7A 4OO5A 5CYYA 1THOA 5DALB 1TW9A 3L78A 2DIZA 4LL4B 5IMDA 2JSZA 3IBHA 2KP1A 4OWYA 3EMXA 1DE2A 1TXUA 2KP2A 1T7PB 4G01A 3BBYA 1T1VA 3I43A 5A4WA 4K9ZA 3QMXA 1O8XA 4ML1A 4V2NA 2QA2A 4HJMA 1GTIA 3GHAA 1G0TA 4TR4A 3IK7A 3EE2A 1X5CA 5F8BA 1F2EA 2L4CA 4XTSA 2J9HA 5A4UA 4LL1B 2EFHA 3QPMA 2VOCA 2H76A 2ZCTA 3D4TA 4KA0A 3FR6A 2H73A 3PH9A 2B5YA 4AJ7A 2QA1A 3HJOA 1M99A 2WRTA 4IELA 4MMMA 4KSOA 1QGVA 1NSWA 2CVBA 1Z3EA 2HQTA 3KZQA 1TXXA 4IBPA 5ID2B 2PVQA 3ZREA 5KN0A 1JZWA 3EU3A 2PGTA 2IMKA 5ECLB 5IIZA 1UC7A 3ZFBA 3RHBA 1BG1A 2VL2C 3L9VA 2WJUA 3MAKA 2FA8A 4NHZA 1XWBA 2PUKC 1YVLA 2WCIA 5CRDA 4BWSA 3US3A 4LLRA 1Y1UA 3TKSA 2H01A 3LEFA 4V1Ag 5B8BA 2TIRA 4J57E 5COHA 5IMVA 1Z9HA 1SL0B 4TR0A 1TDIA 3FY7A 4G10A 2C0GA 3FHKA 1ZYQB 2RUEA 3C8EA 5ELAA 1U87A 5D73A 5DQSA 1RW1A 4KUNA 2DLXA 4BVXA 5LNKe 2WB9A 4MZWA 4OMVA 4FH8A 2YNXA 3UAPA 1Q98A 2P0GA 3U5RE 1K0AA 2HI7A 1C72A 4TR3A 2R37A 2H0IA 1GUHA 2LJAA 3IDVA 1QMVA 4NMUA 3LW9A 4ZILA 4TRXA 4RI7A 3HDCA 2IWTA 4MF5A 4DSSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECC A;  1DUG A;  1YY7 A;  3P8W A;  2CZ2 A;  2GSS A;  3DD3 A;  5AN1 A;  3WYW A;  2GST A;  4ECB A;  4PX1 A;  1XW6 A;  4PUR A;  5IQY A;  3WD6 A;  1JZR A;  4MF7 A;  6GSY A;  3R3E A;  1K3L A;  4IKH A;  4ECI A;  1M9A A;  3LFL A;  3F6F A;  3KTL A;  3VUR A;  5D9V A;  4KX4 A;  2CAI A;  2FHE A;  11GS A;  4I97 A;  1UA5 A;  3KMN A;  4HOJ A;  3LXZ A;  2X64 A;  4KSM A;  2HSM A;  4IQA A;  2VCX A;  4G0K A;  4IJI A;  4HZ2 A;  4OFM A;  5ECH B;  2F8F A;  5F07 A;  2IMI A;  18GS A;  1F3B A;  4PXO A;  1GUK A;  4WR5 A;  1USB A;  4KGI A;  4PQH A;  3O3T A;  5ECM B;  3UVH A;  2C3Q A;  1PL1 A;  1ZL9 A;  3G7J A;  3FYG A;  4OFT A;  12GS A;  1HNA A;  1GSD A;  2VCQ A;  1V40 A;  20GS A;  3M0F A;  3Q74 A;  3FR3 A;  5AIX A;  1AQV A;  2C8U A;  3IK9 A;  3D0Z A;  4L8E A;  5AIV A;  5EVO A;  3LYP A;  2FNO A;  3H1N A;  3ERG A;  1PKZ A;  5JCU A;  1PN9 A;  1TU8 A;  17GS A;  1PX6 A;  2GTU A;  3CBU A;  5ECR B;  1ZGN A;  4GTU A;  2A2R A;  4G0I A;  1GWC A;  7GSS A;  1OYJ A;  2VO4 A;  1BX9 A;  4MDC A;  3TOT A;  5ECQ B;  2IL3 A;  3G7I A;  3RBT A;  6GSU A;  3UBK A;  2N5F A;  5A4V A;  4BVX B;  5HFK A;  5ECP B;  3HKR A;  3UBL A;  1HNB A;  1YKC A;  4PTS A;  1AW9 A;  4IS0 A;  3GH6 A;  1KBN A;  3QR6 A;  1VF4 A;  5D9W A;  3GX0 A;  16GS A;  4K0N A;  4G19 A;  2A2S A;  2PER A;  4ZB9 A;  3M3M A;  3N5O A;  2D2Z A;  1GSY A;  2PMT A;  4CHS A;  4EXJ A;  3DGQ A;  3IR4 A;  1Q4J A;  4L5O A;  5J41 A;  1B8X A;  4NAX A;  4O7H A;  4F0C A;  5KEJ A;  2R5G A;  4N0V A;  1TU7 A;  1XWG A;  2GDR A;  1F3A A;  3CSJ A;  3CRT A;  1XW5 A;  4PNF A;  3VLN A;  1MD3 A;  2JL4 A;  3ISO A;  2YCD A;  3R2Q A;  3ZML A;  4KH7 A;  4ACS A;  4JBB A;  2UZ8 A;  2OAD A;  5ELG A;  1E6B A;  4Q5N A;  1AQX A;  1OE8 A;  5GST A;  1XWK A;  4TOP A;  3L0H A;  1BAY A;  2OAC A;  2HSM B;  1GNE A;  5ECS A;  3I69 A;  2CVD A;  4ZB6 A;  2WS2 A;  4GLT A;  5F05 A;  4E8H A;  3MDK A;  4MF5 A;  1EV4 A;  9GSS A;  2DC5 A;  5BMU A;  4GSS A;  6GSV A;  1FHE A;  3GUS A;  1BG5 A;  2OA7 A;  2C3N A;  5A5K A;  10GS A;  3LSZ A;  1GTA A;  1K0O A;  4JED A;  5DDL A;  5J4U A;  3CSI A;  2R4V A;  4ZBD A;  4KDX A;  4O92 A;  4FQU A;  3CSH A;  3N9J A;  4MP4 A;  5DCG A;  4GF0 A;  3ZFL A;  3FRC A;  3PPU A;  2CAQ A;  4EC0 A;  5LCZ A;  4QQ7 A;  1VF2 A;  4OFN A;  2CA8 A;  1RK4 A;  1M0U A;  3KMO A;  2DSA A;  4GCI A;  2HSN B;  3O76 A;  3LYK A;  1GTU A;  4GST A;  3U6V A;  2GSR A;  4KE3 A;  4USS A;  3TGZ A;  2LJR A;  5DJM A;  3VWX A;  5EY6 A;  5ECO B;  3IE3 A;  5G5F A;  2AAW A;  2GLR A;  3GUR A;  2R6K A;  1GLP A;  4Q5Q A;  3TOU A;  3M1G A;  5FT3 A;  3AY8 A;  1MD4 A;  6GST A;  1AQW A;  3QAG A;  4ZBB A;  4BVY B;  4EDZ A;  1K3O A;  2YV7 A;  1K3Y A;  5F0G A;  2YV9 A;  4MK3 A;  4KF9 A;  4YQV A;  1A0F A;  1K0C A;  14GS A;  4ISD A;  1OKT A;  1M9B A;  1B4P A;  1PX7 A;  2AHE A;  1GSQ A;  3P90 A;  1NHY A;  4IVF A;  1AXD A;  4K0G A;  3GTU B;  1N2A A;  5G5E A;  1GLQ A;  3CRU A;  6GSW A;  4BVY A;  3VI7 A;  4KDY A;  2ON7 A;  1GUM A;  1B48 A;  3Q19 A;  5ECN B;  3VPT A;  4PNG A;  6GSX A;  2VCZ A;  1PA3 A;  1FW1 A;  3I6A A;  3GTU A;  22GS A;  8GSS A;  2VD0 A;  2AB6 A;  1K0B A;  4PUA A;  6GSS A;  3LG6 A;  5DAK A;  3IC8 A;  2NTO A;  3GSS A;  2C80 A;  4Q5F A;  4GSN A;  19GS A;  1K0D A;  3EIN A;  3QAW A;  4HI7 A;  4KAE A;  2VD1 A;  1IYI A;  4YQU A;  1EOG A;  1PD2 1;  5DAL B;  1OE7 A;  1TW9 A;  5J5N A;  3VK9 A;  4G9H A;  3NIV A;  3W8S A;  3IBH A;  3HJM A;  4F03 A;  1MTC A;  3SWL A;  4KDU A;  4RI6 A;  2CZ3 A;  1K0N A;  1VF1 A;  2VCV A;  1LBK A;  4ZXG A;  3F6D A;  3BBY A;  4HJ2 A;  2V6K A;  1IYH A;  5DAL A;  1U3I A;  3LJR A;  5A4W A;  4EDY A;  3FR9 A;  4PGT A;  1PL2 A;  3F63 A;  2VCT A;  4BL7 B;  1GTI A;  3PR8 A;  5GSS A;  1EEM A;  5D9T A;  5AIS A;  2VCW A;  4LMV A;  3VI5 A;  4NHW A;  3UAR A;  4ECJ A;  3IK7 A;  4E8E A;  1U88 A;  3ERF A;  3EE2 A;  1GSF A;  5F8B A;  1F2E A;  2J9H A;  3VPQ A;  5A4U A;  2C3T A;  4BL7 A;  1ML6 A;  4ZB8 A;  3ZMK A;  1EOH A;  3FR6 A;  4IQ1 A;  5D9X A;  1JLV A;  3M8N A;  2PBJ A;  4IW9 A;  4YQM A;  5ECI B;  3LXT A;  2F3M A;  3HJO A;  1M99 A;  5AGY A;  2WRT A;  4IEL A;  1GSS A;  1HQO A;  4DEJ A;  1GTB A;  2R3X A;  1BYE A;  1YJ6 A;  2HQT A;  3LQ7 A;  2GSQ A;  4MPF A;  4IBP A;  2PVQ A;  2C4J A;  1G7O A;  2WDU A;  2PGT A;  13GS A;  2IMK A;  5ECL B;  3KJY A;  2HRA A;  1VF3 A;  1YQ1 A;  3ZFB A;  3KXO A;  5F06 A;  5FWG A;  4AGS A;  2WJU A;  3MAK A;  4ID0 A;  4WR4 A;  4PQI A;  5FHI A;  4NHZ A;  1LJR A;  5ECK B;  5DAK B;  3Q18 A;  4F0B A;  1V2A A;  1YDK A;  1GNW A;  4YAP A;  1GUL A;  1GSU A;  1G6W A;  3PGT A;  1PKW A;  1JLW A;  2HNL A;  2ON5 A;  4YAV A;  5JCW A;  2HRK B;  1G6Y A;  1Z9H A;  1TDI A;  4G0L A;  3FY7 A;  4G10 A;  4Q5R A;  4ZBA A;  3C8E A;  4MF6 A;  4YH2 A;  5ELA A;  4JZQ A;  1U87 A;  4IGJ A;  5D73 A;  5DQS A;  1HNC A;  4BVX A;  5LD0 A;  2WB9 A;  1PMT A;  4MZW A;  4OMV A;  3GST A;  4MPG A;  5DJL A;  5GZZ B;  1EV9 A;  2HRK A;  5B7C A;  3UAP A;  4HZ4 A;  1K0A A;  4J2F A;  1K0M A;  1C72 A;  4EE0 A;  1GSE A;  1GUH A;  1PGT A;  4LMW A;  5EL8 A;  4L5L A;  3QAV A;  1R5A A;  4RI7 A;  1Y6E A;  3KM6 A; 
#chains in the Genus database with same CATH topology
 2XC2 A;  3P8W A;  2WW2 A;  2LS5 A;  4ECB A;  4Z2T A;  2OBK A;  1K3L A;  1O85 A;  1JZO A;  3EC3 A;  3LFL A;  2E0Q A;  3VUR A;  2WVZ A;  3RPP A;  11GS A;  4HOJ A;  4XS1 A;  2NDO A;  3D21 A;  2X64 A;  2LTK A;  4ZB7 A;  4KSM A;  4PI0 C;  2LEG A;  3C1R A;  4JE1 A;  4HZ2 A;  1SD8 A;  1QQ2 A;  4TKY A;  2XHF A;  5ECH B;  5F07 A;  3QFB C;  2IMI A;  1FG4 A;  1TRU A;  4PQH A;  1PRX A;  4XS4 A;  1XBS A;  1LU4 A;  1HYU A;  20GS A;  5AIX A;  2C8U A;  1F37 A;  3GNJ A;  3ERW A;  3J7Y k;  2H19 A;  3LYP A;  2FNO A;  2VM2 A;  3GL5 A;  4GTU A;  3OR5 A;  2IIY A;  4RQR A;  2WVX A;  5ECQ B;  2CX4 A;  1EP7 A;  1XG8 A;  3UBK A;  1CQH A;  4BVX B;  3WGX A;  5ECP B;  1HNB A;  4AKG A;  3CYN A;  2E2M A;  1AW9 A;  5D9W A;  3GX0 A;  16GS A;  1ZYN A;  2O7K A;  1YEW C;  1PFO A;  2CT6 A;  1FAA A;  2JSY A;  2PMT A;  1ERT A;  3ZYW A;  3HMJ G;  5HFG A;  3E0U A;  3QOU A;  4TN8 A;  4F0C A;  1Z5Y E;  4X4J A;  1TU7 A;  3CRT A;  2YCD A;  2BMX A;  1YF1 A;  3UMA A;  4JBB A;  2OAD A;  4QL9 A;  2MZC A;  5GST A;  1BAY A;  2IME A;  5ECS A;  4L0U A;  4WKW A;  4IJ3 A;  2L5O A;  1UVZ A;  4ZB6 A;  3HYP A;  3A3T A;  1SVM A;  2ALB A;  1S3R A;  2DC5 A;  2B1L A;  2UV8 G;  1FHE A;  3UVT A;  2FWG A;  3FEU A;  2C3N A;  10GS A;  2FY6 A;  2V2G A;  1GTA A;  4XS4 B;  5J4U A;  3CSI A;  1BF5 A;  2FLS A;  2DKH A;  2YOI A;  4GF0 A;  3FRC A;  5LCZ A;  1SKW B;  4OFN A;  2CA8 A;  1RK4 A;  1SYR A;  2DSA A;  2F9S A;  2HSN B;  3O76 A;  2JZS A;  1EWX A;  4N11 A;  1GTU A;  4GST A;  2YWN A;  2GSR A;  3E3E A;  2WZ9 A;  3TGZ A;  1X9M B;  4PHZ C;  3GYK A;  2WVX B;  5A1N A;  3APQ A;  3FMW A;  3GUR A;  2HSY A;  2YAN A;  3TOU A;  3IC4 A;  1G7E A;  5KOW A;  4JR6 A;  1AQW A;  3VWV A;  4BVY B;  1K3O A;  2LNS A;  2XBI A;  2I1U A;  4YQV A;  4HU9 A;  1K0C A;  4IHU A;  3LGC A;  3TUE A;  3ZRD A;  2ZUP A;  1TK5 B;  2K18 A;  2LNT A;  2K6V A;  1B4P A;  3GN3 A;  2F8A A;  3P90 A;  3TU3 B;  1KNG A;  5DCH A;  3GKK A;  2B5E A;  3DXB A;  4HUA A;  2DMM A;  2G2Q A;  3FZA A;  1GUM A;  1T4Y A;  1FW1 A;  1AC1 A;  3FKF A;  4GQF A;  3TJB A;  1VRS D;  3TJJ A;  4ML6 A;  3BCI A;  5DAK A;  3WT2 A;  4Q5F A;  4GSN A;  4FIW A;  4I2T A;  1QK8 A;  5H5R A;  1RQM A;  1SVO A;  4AKI A;  3QAW A;  1JFU A;  2VD1 A;  4YQU A;  1M3I A;  4MJB A;  4HDE A;  2H1L A;  2YP6 A;  2DKI A;  2JZT A;  3HJM A;  3IV4 A;  3EU4 A;  4KDU A;  1VF1 A;  4HJ2 A;  2V6K A;  5DAL A;  4GDF A;  2N5B A;  3UIW A;  4PGT A;  5HR2 A;  2VCT A;  3DML A;  4YKF A;  4BL7 B;  2GT6 A;  3HVN A;  4N3Z A;  3MIX A;  5D9T A;  2VCW A;  3VI5 A;  3HJP A;  1S3D A;  2V1M A;  4ECJ A;  4E8E A;  1U88 A;  1SD9 A;  3VPQ A;  3H4K A;  2HRN A;  2X49 A;  1ML6 A;  3KTB A;  1A8L A;  1EOH A;  2B3S A;  1YF0 A;  3M8N A;  2B7J A;  4YQM A;  3LXT A;  3C1S A;  2ES7 A;  1GSS A;  3WT1 A;  1BYE A;  3LQ7 A;  2L59 A;  4K7N A;  4TW5 A;  1S4B P;  2X8H A;  4KB3 A;  3KJY A;  1A8Y A;  1TTZ A;  2YZU A;  3C73 A;  4FYU A;  4E68 A;  4FO5 A;  3KXO A;  5FWG A;  2EFD A;  2YWM A;  4MCU A;  4WR4 A;  4PQI A;  2LJK A;  4EIP A;  4J56 E;  5IO2 A;  5DAK B;  1SJI A;  4N0Z A;  3Q18 A;  3RGB C;  2L6C A;  5A5H B;  3DWV A;  2H1G A;  4YAP A;  1GUL A;  1GSU A;  1FVJ A;  1PKW A;  3TRP A;  4TXV A;  5HR0 A;  2HNL A;  5JCW A;  2QGV A;  1G6Y A;  4XCS A;  4Q5R A;  1EEJ A;  4ZBA A;  4YH2 A;  4JZQ A;  1GP1 A;  4IGJ A;  4X1U A;  1JZD A;  4XHM A;  1HNC A;  4ZL7 A;  2C0E A;  2VLU A;  5CRE A;  2GQK A;  5DJL A;  5GZZ B;  4J2F A;  2XBQ A;  4DSR A;  2K9F A;  3TDG A;  4JU5 A;  1PGT A;  4LMW A;  3K8N A;  1V57 A;  2PPT A;  4JR4 A;  1YEP A;  5J47 A;  1R5A A;  4XRD A;  5E4W A;  2GQL A;  2CZ2 A;  2GSS A;  1TRW A;  3ZLP A;  3WYW A;  2GST A;  4PX1 A;  1S3A A;  2PWJ A;  4IKH A;  4ECI A;  3KTL A;  4K6X A;  5D9V A;  4KX4 A;  2FHE A;  4DSS A;  3KMN A;  4IP6 A;  3LXZ A;  2MYG A;  4OD7 A;  2HSM A;  3KGK A;  4IQA A;  2VCX A;  2LRN A;  4G0K A;  2H0G A;  2C0F A;  4MJC A;  1MDJ A;  4MZC A;  1O6J A;  5KN1 A;  2IMD A;  5JCG A;  2DJ2 A;  1CQG A;  3DYR A;  5ENU A;  3ZTL A;  4NPB A;  4WR5 A;  2GZZ A;  4GQC A;  3O3T A;  3UVH A;  2K8V A;  2C3Q A;  3NOF A;  5IPH A;  3FYG A;  4OFT A;  2HZF A;  12GS A;  1GSD A;  5G30 A;  3FR3 A;  2M72 A;  4OO4 A;  3TKS E;  1X9S B;  4KW6 A;  5J9C A;  4NV5 A;  5EVO A;  4AKX B;  5IOX A;  3H1N A;  3ERG A;  3CTF A;  1PKZ A;  5JCU A;  1PN9 A;  1TU8 A;  2YN1 A;  17GS A;  1FO5 A;  3CBU A;  5ECR B;  3V1W A;  1GL8 A;  1TKD B;  2A2R A;  5KN3 A;  3H93 A;  1FVK A;  1GWC A;  1OKD A;  4MDC A;  3RFR C;  5DBQ A;  5C00 A;  3G7I A;  1KEB A;  4WBJ A;  2CQ9 A;  1X9W B;  2H74 A;  4CY8 A;  2N5F A;  5A4V A;  1XCC A;  3HKR A;  3GFK A;  4PTS A;  3APO A;  3TCO A;  3GH6 A;  1KBN A;  4K0N A;  2O87 A;  5CAX A;  3M3M A;  2O85 A;  2D2Z A;  3N5O A;  2H75 A;  3TJK A;  3DGQ A;  4L5O A;  5J41 A;  2DJ1 A;  2L6D A;  5KEJ A;  4N0V A;  2GDR A;  1XW5 A;  3VLN A;  5IO0 A;  2JL4 A;  3R2Q A;  2EFC A;  2OJL A;  2IFQ A;  4QMK A;  1AQX A;  2OAC A;  2HSM B;  1GNE A;  1XIY A;  4Z2U A;  3MNG A;  3I69 A;  2P31 A;  2FWH A;  1DE1 A;  4GLT A;  4CW9 A;  3MDK A;  3LWA A;  4G2E A;  4OCF A;  2DJ0 A;  3GUS A;  5DDL A;  2XPD A;  2H1A A;  4MH2 A;  1QUW A;  2LUS A;  5BRT A;  4FQU A;  4WET A;  4Z7X A;  4ZL9 A;  3F4S A;  3PPU A;  4QQ7 A;  1KTE A;  3TJG A;  4KND A;  2K8S A;  1Z6M A;  2O5V A;  2NBS A;  1QXH A;  2OT3 A;  4USS A;  2LJR A;  4AI6 A;  5DJM A;  4WF4 A;  5EY6 A;  5G1L A;  5ECO B;  1A2L A;  2AAW A;  4D73 A;  4O5R A;  2BJX A;  2R6K A;  3KH9 A;  5B6N A;  2HSN A;  2IN3 A;  1TRS A;  4QL7 A;  6GST A;  1OC9 A;  3QAG A;  4ZBB A;  2YV9 A;  2HLS A;  14GS A;  4ISD A;  1O81 A;  2GT5 A;  3UOM A;  3ME8 A;  3IXR A;  4TXO B;  5B6M A;  4AKH A;  1AXD A;  4MA9 A;  4K0G A;  2X8C A;  4L0W A;  5HR1 A;  4BVY A;  2HFD A;  3VI7 A;  2YZH A;  3F3R A;  1XZO A;  1DBY A;  3M9J A;  1SL2 B;  3VPT A;  1ILO A;  2VCZ A;  3I6A A;  2IFQ B;  5CNW A;  1WWJ A;  22GS A;  4PUA A;  1PQN A;  5IM9 A;  1NW2 A;  2NTO A;  2C80 A;  1X5D A;  3GIX A;  19GS A;  1K0D A;  3HVV A;  2YWI A;  2HZE A;  2KUC A;  3IHQ A;  4KAE A;  2OE3 A;  1EOG A;  3E9J B;  5GAP D;  1ABA A;  1XXU A;  1SYX A;  5J5N A;  3A2X A;  2DJJ A;  2HT9 A;  3TJF A;  3CTG A;  3KEB A;  4YKG A;  4PUF C;  5EPF A;  1XVW A;  1MTC A;  4O5U A;  4V2M A;  2CZ3 A;  2VCV A;  3F6D A;  3KP8 A;  1IYH A;  4MZB A;  3LJR A;  1FOH A;  5D96 A;  2DML A;  3F63 A;  3F8U A;  3HZ8 A;  3PR8 A;  1I5G A;  1U6T A;  1N25 A;  4P3Y B;  5GSS A;  4LMV A;  2VL3 A;  4V1A p;  3GMF A;  4D73 B;  3M9K A;  1A2M A;  4BL7 A;  1OC9 B;  2H71 A;  3O6T A;  5JWQ B;  3ZMK A;  2IPA A;  4LA1 A;  1E2Y A;  4A5P A;  1AUC A;  1XW9 A;  2JAD A;  4X0X A;  2IMF A;  3FZ5 A;  2F3M A;  3F3Q A;  1HQO A;  4BIK A;  2R3X A;  4MPF A;  4RUV A;  2H72 A;  2C4J A;  2LRC A;  1G7O A;  3P7X A;  13GS A;  4HU7 A;  4FYC A;  2WZS A;  1MDK A;  1VF3 A;  1OVN A;  5F06 A;  1B9Y C;  3TKS C;  4ID0 A;  2H30 A;  4RQX A;  4WF5 A;  5ECK B;  2MMN A;  4ZL8 A;  2VL2 A;  2HZE B;  3WGD A;  4F0B A;  3W8J A;  1GNW A;  1G6W A;  2QC7 A;  1JLW A;  2ON5 A;  4YAV A;  1M3J A;  2HRK B;  2C0D A;  1GRX A;  4EIQ A;  1ZZY A;  1DSB A;  2GVP A;  2MBT A;  5A5H A;  4OCE A;  2R0G A;  5J3R A;  1PMT A;  3GST A;  1XWC A;  1A0R P;  4MNN A;  5CP1 A;  2MBS A;  1EV9 A;  5B7C A;  4K8M A;  4HZ4 A;  3IA1 A;  2GGT A;  4EE0 A;  3CXG A;  1GSE A;  1XWA A;  3GRX A;  5EL8 A;  4L5L A;  4POB A;  5DQY A;  1U3A A;  4KDY A;  1Y6E A;  2WUL A;  4ECC A;  4POL A;  3IRA A;  5AN1 A;  4W66 A;  4PUR A;  5IQY A;  3WD6 A;  1WOU A;  4MF7 A;  3IHG A;  2LQO A;  2IJY A;  3F6F A;  3G9B A;  4WXT A;  2PU9 C;  2VL9 A;  1V58 A;  4K2D A;  2R2J A;  3SBC A;  1A2J A;  1A23 A;  2M46 A;  3PIN A;  2N5A A;  3EMP A;  5A34 B;  3F0I A;  1ACV A;  1XFL A;  1ERW A;  4PI2 C;  1YZX A;  1XPV A;  1SVL A;  1F3B A;  1GUK A;  1V9W A;  1USB A;  4KGI A;  2B5X A;  5ECM B;  3CQF A;  3MYD A;  2MMA A;  3GA4 A;  1PL1 A;  1ZL9 A;  3G7J A;  2HXK A;  2VCQ A;  1MDI A;  1V40 A;  1J0F A;  4BWQ A;  4BPY A;  3M0F A;  3KH7 A;  4DSQ A;  1S3C A;  1HD2 A;  1AQV A;  2VLV A;  3D0Z A;  1R5P A;  5AIV A;  1WPI A;  3GL3 A;  2X99 A;  5JWO B;  1PX6 A;  2GTU A;  1NM3 A;  4WEY A;  3D6I A;  4G0I A;  2G0F A;  5GAN D;  1OYJ A;  1BX9 A;  3TOT A;  4EL1 A;  3D22 A;  1QFN A;  2DBC A;  2DJ3 A;  3VWU A;  3UEM A;  3WGE A;  3FW2 A;  4XS6 A;  1M2B A;  3W6G A;  1VF4 A;  4GWR A;  4ZB9 A;  2PER A;  3BJ5 A;  4PQ1 A;  2R0C A;  2PVO C;  3IR4 A;  2CV4 A;  1I9D A;  1B8X A;  4NAX A;  4O7H A;  2R5G A;  2AV4 A;  1XWG A;  1F3A A;  3CSJ A;  2O36 A;  4PNF A;  1ZYE A;  3LOR A;  2FWE A;  2HE3 A;  1A24 A;  3ZML A;  4ACS A;  5D93 A;  2VM1 A;  2UZ8 A;  1E6B A;  4Q5N A;  5BMU B;  2C1Y A;  1OE8 A;  3L0H A;  4N10 A;  3GV1 A;  3P2A A;  2GS3 A;  4POM A;  4F2I A;  2WS2 A;  5F05 A;  1OC3 A;  5DVB A;  1J08 A;  4NV2 A;  1TP9 A;  6GSV A;  3Q6O A;  2O89 A;  4HQS A;  1WIK A;  2DIY A;  4ZIJ A;  4HEA 2;  3H8Q A;  3F4R A;  4JED A;  3F9U A;  4ZBD A;  4O92 A;  4FYB A;  2A4H A;  4MP4 A;  5DCG A;  4AF2 A;  1J9B A;  1SKR B;  2MMZ A;  3DEX A;  4EC0 A;  1M0U A;  5L71 A;  4K7O A;  2V6O A;  2O3E A;  4GCI A;  3BD2 A;  3DVX A;  1ERU A;  2CX3 A;  2EIO A;  4Z2R A;  3U6V A;  3KD0 A;  2H0H A;  4KE3 A;  3L9S A;  3S9F A;  5G5F A;  1H75 A;  3BOA A;  2GLR A;  1GLP A;  4V2L A;  1W89 A;  3EVI A;  4TR1 A;  3M1G A;  1ZMA A;  2CVK A;  5FT3 A;  4EF0 A;  1F9M A;  2RLI A;  3AY8 A;  1OC8 A;  3ED3 A;  2YV7 A;  1K3Y A;  4IP1 A;  4O5Q A;  2H6X A;  4F82 A;  1THX A;  1OKT A;  1N8J A;  2B7K A;  1ST9 A;  5J4V A;  1PX7 A;  2AHE A;  1GSQ A;  1NHY A;  2B6M A;  3HVX A;  3GTU B;  4CY6 A;  2V41 A;  5G5E A;  1GLQ A;  6GSW A;  5IPG A;  3C7M A;  3IPZ A;  2ON7 A;  5G2Z A;  5HFI A;  3TB2 A;  3KIJ A;  3QDN A;  4TXO A;  4K7I A;  1NHO A;  2I81 A;  3IAM 2;  8GSS A;  2VD0 A;  1SU9 A;  2YJ7 A;  4O32 A;  3QD9 A;  1SEN A;  4K2X A;  1R4W A;  3GSS A;  2BTO T;  2H6Z A;  1EGR A;  4MH3 A;  1OAZ A;  2TRX A;  4GRF A;  1IYI A;  1PD2 1;  1OE7 A;  1FB0 A;  3VK9 A;  3GH9 A;  4G9H A;  3NIV A;  2OE0 A;  3W8S A;  3GKX A;  2I4A A;  1TI3 A;  2JU5 A;  3D5J A;  3ZIT A;  4F03 A;  5C04 A;  3SWL A;  4RI6 A;  1K0N A;  2GQM A;  4EVM A;  1LBK A;  2P5R A;  4ZXG A;  3RDW A;  2EC4 A;  1XOA A;  1U3I A;  4EDY A;  2O8V B;  3FR9 A;  5JWR B;  3MSZ A;  1PL2 A;  3CWG A;  2E7P A;  3MWH A;  1I1I P;  1T3B A;  3C71 A;  1EEM A;  5AIS A;  4NHW A;  1B9X C;  3UAR A;  5KOX A;  1Z7R A;  2VIM A;  3ERF A;  1GSF A;  2XPE A;  3RHC A;  4TR1 B;  2FCH A;  4JRR A;  4K5S A;  3HY2 A;  2C3T A;  1EZK A;  4ZB8 A;  4H86 A;  4NWY A;  4NXI A;  3IOS A;  2LQQ A;  4IQ1 A;  4MLY A;  5ABR A;  5D9X A;  1JLV A;  2PBJ A;  4IW9 A;  1ZOF A;  3DVW A;  4X43 A;  5ECI B;  1EGO A;  5AGY A;  2PN8 A;  5G31 A;  1O73 A;  1TK8 B;  2YWO A;  4DEJ A;  1GTB A;  1JHB A;  1YJ6 A;  2A2P A;  2GSQ A;  1F6M C;  2L4Q A;  2VKZ G;  2WDU A;  2LKU A;  3EWL A;  2FGX A;  2KHP A;  3NZN A;  2EIR A;  1FB6 A;  2HRA A;  1YQ1 A;  3J7Y b;  3HCZ A;  4AGS A;  2L5L A;  2WW0 A;  2FUG 2;  5FHI A;  1LJR A;  2JZR A;  1BJX A;  1TK0 B;  3I9V 2;  3FZ4 A;  2FWF A;  1V2A A;  4BA7 A;  1YDK A;  1PN0 A;  2E2G A;  2KOK A;  3PGT A;  1TRV A;  1M2A A;  2RII A;  5G1K A;  3HVS A;  4KCA A;  3GKN A;  4K5R A;  2WFC A;  4G0L A;  1YKA A;  4CDO A;  1BQ7 A;  3UJ1 A;  5IMF A;  1EP8 A;  4MF6 A;  1WRY A;  5H5Q A;  4FXY P;  2I9H A;  4MJA A;  5KN2 A;  3F4T A;  2WW3 A;  5LD0 A;  3QCP A;  3TRQ A;  5J9B A;  2VLT A;  3CMI A;  4MPG A;  4MJE A;  1UN2 A;  1SKS B;  2HRK A;  3KCM A;  4ILF A;  5D8I A;  1K0M A;  3ZL5 A;  1MEK A;  3EYT A;  3A5W A;  2WVY A;  3QAV A;  4I2U A;  1AIU A;  3KM6 A;  1W4V A;  1DUG A;  1R7H A;  1YY7 A;  2HRF A;  3DD3 A;  2X4A A;  3L4N A;  1XW6 A;  1GH2 A;  1SK0 A;  1TI1 A;  1JZR A;  4K1F A;  6GSY A;  3R3E A;  3QFA C;  2NVL A;  1FOV A;  1WE0 A;  3EUR A;  1M9A A;  5J40 A;  2MMO A;  2M80 A;  2CAI A;  2KLX A;  4I97 A;  1UA5 A;  2H6Y A;  2L57 A;  1O7U A;  2YJH A;  5CRG A;  3FK8 A;  3TKQ A;  2DJK A;  1M2D A;  4IN0 A;  4IJI A;  4I6X A;  2H70 A;  3DRN A;  4I5Q A;  3G7Y A;  4OFM A;  2J23 A;  2F8F A;  18GS A;  1T8E B;  2LST A;  4PXO A;  1YEX A;  3HD5 A;  2FA4 A;  2EIQ A;  3L9U A;  2P5Q A;  1HNA A;  1WMJ A;  2ZNM A;  2RUF A;  1SK1 A;  3TRX A;  3Q74 A;  1ON4 A;  5A34 A;  5H5S A;  3IK9 A;  1XOB A;  4L8E A;  4AJ8 A;  1T00 A;  1TOF A;  2EFE A;  3RPN A;  2GZP A;  1ZCP A;  1ZGN A;  2F51 A;  3ZIV A;  3TKR A;  7GSS A;  4GXZ A;  1WJK A;  2VO4 A;  5B8A A;  2IL3 A;  3RBT A;  2H66 A;  3FZ9 A;  5IOW A;  2B1K A;  6GSU A;  4WBR D;  3A5I A;  5HFK A;  5CRW A;  3UBL A;  3VFI A;  2RM5 A;  1YKC A;  1R26 A;  2GZY A;  1PSQ A;  4IS0 A;  3DKS A;  3QR6 A;  1ZYP A;  4EKZ A;  2R0P A;  4G19 A;  2A2S A;  2HYX A;  3JCM L;  1Z6N A;  1GSY A;  4CHS A;  4EXJ A;  3BCK A;  2H1B A;  2JAC A;  1Q4J A;  4ULX A;  3ZZX A;  3VWW A;  2OKA A;  2V32 A;  3RAZ A;  2H8L A;  1XVQ A;  1MD3 A;  3ISO A;  2AUV A;  5E59 A;  4KH7 A;  1BED A;  2TRC P;  1M7T A;  5ELG A;  4EUY A;  1ERV A;  3D4M A;  2YPM A;  1XWK A;  4TOP A;  1SJ6 A;  2FD3 A;  1AAZ A;  2QSI A;  2H1D A;  3HA9 A;  3ME7 A;  5CO3 A;  5HR3 A;  2CVD A;  2AJQ B;  1Y25 A;  2AYT A;  4E8H A;  1X0R A;  3IAS 2;  4XRA A;  1EV4 A;  9GSS A;  4ICY A;  5BMU A;  4GSS A;  3A2W A;  1BG5 A;  2OA7 A;  5A5K A;  4AJ6 A;  2X8G A;  5HQP A;  3LSZ A;  1K0O A;  4POK A;  4N30 A;  3UL3 A;  2R4V A;  1X5E A;  1H4O A;  4KDX A;  3CSH A;  3N9J A;  5A1N B;  5IMZ A;  3ZFL A;  2CAQ A;  1VF2 A;  3ZIJ A;  3KMO A;  4F9Z A;  2I3Y A;  3LYK A;  4TVE A;  5CRH A;  1URM A;  3GX8 A;  2HSH A;  3APS A;  3VWX A;  4DVC A;  3IE3 A;  5J4Y A;  2OBI A;  4Q5Q A;  1Z7P A;  2REM A;  2LRT A;  1MD4 A;  2NPB A;  3HXS A;  4EDZ A;  4XIH A;  5F0G A;  2QKE A;  1B4Q A;  2WGR A;  1WP0 A;  2VAF A;  4MK3 A;  4KF9 A;  1A0F A;  3HZ4 A;  5IMA A;  3A2V A;  1TJD A;  1V98 A;  1VGL A;  4I8B A;  3EPT A;  1M9B A;  3TKP A;  3HHV A;  2A4V A;  1SJZ A;  4IVF A;  3DIE A;  1N2A A;  3CRU A;  2RM6 A;  3H79 A;  4KCE A;  4HS1 A;  5ID2 A;  1B48 A;  1SL1 B;  2Z9S A;  3Q19 A;  5ECN B;  4HQZ A;  4PNG A;  6GSX A;  3KP9 A;  5INY A;  1PA3 A;  1T4Z A;  3GTU A;  2AB6 A;  5IMC A;  1K0B A;  3GKM A;  2VUP A;  3ZVJ A;  4MAB A;  6GSS A;  3LG6 A;  1SK2 A;  2WW1 A;  4EO3 A;  3IC8 A;  3ZVJ D;  2OE1 A;  2LV3 A;  3EIN A;  1O8W A;  4HI7 A;  4OO5 A;  5CYY A;  1THO A;  5DAL B;  1TW9 A;  3L78 A;  2DIZ A;  4LL4 B;  5IMD A;  2JSZ A;  3IBH A;  2KP1 A;  4OWY A;  3EMX A;  1DE2 A;  1TXU A;  2KP2 A;  1T7P B;  4G01 A;  3BBY A;  1T1V A;  3I43 A;  5A4W A;  4HSC X;  4K9Z A;  3QMX A;  1O8X A;  4ML1 A;  4V2N A;  2QA2 A;  4HJM A;  1GTI A;  3GHA A;  1G0T A;  4TR4 A;  3IK7 A;  3EE2 A;  1X5C A;  5F8B A;  1F2E A;  2L4C A;  4XTS A;  2J9H A;  5A4U A;  4LL1 B;  2EFH A;  3QPM A;  2VOC A;  2H76 A;  2ZCT A;  3D4T A;  4KA0 A;  3FR6 A;  2H73 A;  3PH9 A;  2B5Y A;  4AJ7 A;  2QA1 A;  3HJO A;  1M99 A;  2WRT A;  4IEL A;  4MMM A;  4KSO A;  1QGV A;  1NSW A;  2CVB A;  1Z3E A;  2HQT A;  3KZQ A;  1TXX A;  4IBP A;  5ID2 B;  2PVQ A;  3ZRE A;  3CHX C;  5KN0 A;  1JZW A;  3EU3 A;  2PGT A;  2IMK A;  5ECL B;  5IIZ A;  1UC7 A;  3ZFB A;  3RHB A;  1BG1 A;  2VL2 C;  3L9V A;  2WJU A;  3MAK A;  2FA8 A;  4NHZ A;  1XWB A;  2PUK C;  1YVL A;  2WCI A;  5CRD A;  4BWS A;  3US3 A;  4LLR A;  1Y1U A;  3TKS A;  2H01 A;  3LEF A;  4V1A g;  5B8B A;  2TIR A;  4J57 E;  5COH A;  5IMV A;  1Z9H A;  1SL0 B;  4TR0 A;  1TDI A;  3FY7 A;  4G10 A;  2C0G A;  3FHK A;  1ZYQ B;  2RUE A;  3C8E A;  5ELA A;  1U87 A;  5D73 A;  5DQS A;  1RW1 A;  4KUN A;  2DLX A;  4BVX A;  5LNK e;  2WB9 A;  4MZW A;  4OMV A;  4FH8 A;  2YNX A;  3UAP A;  1Q98 A;  2P0G A;  3U5R E;  1K0A A;  2HI7 A;  1C72 A;  4TR3 A;  2R37 A;  2H0I A;  1GUH A;  2LJA A;  3IDV A;  1QMV A;  4NMU A;  3LW9 A;  4ZIL A;  4TRX A;  4RI7 A;  3HDC A;  2IWT A;  4MF5 A;  4DSS B; 
#chains in the Genus database with same CATH homology
 2XC2 A;  3P8W A;  2LS5 A;  4ECB A;  4Z2T A;  2OBK A;  1K3L A;  1O85 A;  1JZO A;  3EC3 A;  3LFL A;  2E0Q A;  3VUR A;  3RPP A;  11GS A;  4HOJ A;  4XS1 A;  2NDO A;  3D21 A;  2X64 A;  2LTK A;  4ZB7 A;  4KSM A;  2LEG A;  3C1R A;  4JE1 A;  4HZ2 A;  1SD8 A;  1QQ2 A;  4TKY A;  2XHF A;  5ECH B;  5F07 A;  3QFB C;  2IMI A;  1FG4 A;  1TRU A;  4PQH A;  1PRX A;  4XS4 A;  1XBS A;  1LU4 A;  1HYU A;  20GS A;  5AIX A;  2C8U A;  1F37 A;  3GNJ A;  3ERW A;  3J7Y k;  2H19 A;  3LYP A;  2FNO A;  2VM2 A;  3GL5 A;  4GTU A;  3OR5 A;  2IIY A;  4RQR A;  5ECQ B;  2CX4 A;  1EP7 A;  3UBK A;  1CQH A;  4BVX B;  3WGX A;  5ECP B;  1HNB A;  4AKG A;  3CYN A;  2E2M A;  1AW9 A;  5D9W A;  3GX0 A;  16GS A;  1ZYN A;  2O7K A;  2CT6 A;  1FAA A;  2JSY A;  2PMT A;  1ERT A;  3ZYW A;  3HMJ G;  5HFG A;  3E0U A;  3QOU A;  4TN8 A;  4F0C A;  1Z5Y E;  4X4J A;  1TU7 A;  3CRT A;  2YCD A;  2BMX A;  1YF1 A;  3UMA A;  4JBB A;  2OAD A;  4QL9 A;  2MZC A;  5GST A;  1BAY A;  2IME A;  5ECS A;  4L0U A;  4WKW A;  4IJ3 A;  2L5O A;  1UVZ A;  4ZB6 A;  3HYP A;  3A3T A;  1SVM A;  2ALB A;  2B1L A;  2DC5 A;  2UV8 G;  1FHE A;  3UVT A;  2FWG A;  3FEU A;  2C3N A;  10GS A;  2FY6 A;  2V2G A;  1GTA A;  4XS4 B;  5J4U A;  3CSI A;  1BF5 A;  2FLS A;  2DKH A;  2YOI A;  4GF0 A;  3FRC A;  5LCZ A;  1SKW B;  4OFN A;  2CA8 A;  1RK4 A;  1SYR A;  2DSA A;  2F9S A;  2HSN B;  3O76 A;  2JZS A;  1EWX A;  4N11 A;  1GTU A;  4GST A;  2YWN A;  2GSR A;  3E3E A;  2WZ9 A;  3TGZ A;  1X9M B;  3GYK A;  5A1N A;  3APQ A;  3FMW A;  3GUR A;  2HSY A;  2YAN A;  3TOU A;  3IC4 A;  1G7E A;  5KOW A;  4JR6 A;  1AQW A;  3VWV A;  4BVY B;  1K3O A;  2LNS A;  2XBI A;  2I1U A;  4YQV A;  4HU9 A;  1K0C A;  4IHU A;  3LGC A;  3TUE A;  3ZRD A;  2ZUP A;  1TK5 B;  2K18 A;  2LNT A;  2K6V A;  1B4P A;  3GN3 A;  2F8A A;  3P90 A;  3TU3 B;  1KNG A;  5DCH A;  3GKK A;  2B5E A;  3DXB A;  4HUA A;  2DMM A;  2G2Q A;  3FZA A;  1GUM A;  1T4Y A;  1FW1 A;  1AC1 A;  3FKF A;  4GQF A;  3TJB A;  1VRS D;  3TJJ A;  4ML6 A;  3BCI A;  5DAK A;  3WT2 A;  4Q5F A;  4GSN A;  4FIW A;  4I2T A;  1QK8 A;  5H5R A;  1RQM A;  1SVO A;  4AKI A;  3QAW A;  1JFU A;  2VD1 A;  4YQU A;  4MJB A;  4HDE A;  2H1L A;  2YP6 A;  2DKI A;  2JZT A;  3HJM A;  3IV4 A;  3EU4 A;  4KDU A;  1VF1 A;  4HJ2 A;  2V6K A;  5DAL A;  4GDF A;  2N5B A;  3UIW A;  4PGT A;  5HR2 A;  2VCT A;  3DML A;  4YKF A;  4BL7 B;  2GT6 A;  4N3Z A;  3MIX A;  5D9T A;  2VCW A;  3VI5 A;  3HJP A;  1S3D A;  2V1M A;  4ECJ A;  4E8E A;  1U88 A;  1SD9 A;  3VPQ A;  3H4K A;  2HRN A;  2X49 A;  1ML6 A;  3KTB A;  1A8L A;  1EOH A;  2B3S A;  1YF0 A;  3M8N A;  2B7J A;  4YQM A;  3LXT A;  3C1S A;  2ES7 A;  1GSS A;  3WT1 A;  1BYE A;  3LQ7 A;  2L59 A;  4K7N A;  4TW5 A;  2X8H A;  4KB3 A;  3KJY A;  1A8Y A;  1TTZ A;  2YZU A;  3C73 A;  4FYU A;  4E68 A;  4FO5 A;  3KXO A;  5FWG A;  2EFD A;  2YWM A;  4MCU A;  4WR4 A;  4PQI A;  2LJK A;  4EIP A;  4J56 E;  5IO2 A;  5DAK B;  1SJI A;  4N0Z A;  3Q18 A;  2L6C A;  5A5H B;  3DWV A;  2H1G A;  4YAP A;  1GUL A;  1GSU A;  1FVJ A;  1PKW A;  3TRP A;  4TXV A;  5HR0 A;  2HNL A;  5JCW A;  2QGV A;  1G6Y A;  4XCS A;  4Q5R A;  1EEJ A;  4ZBA A;  4YH2 A;  4JZQ A;  1GP1 A;  4IGJ A;  4X1U A;  1JZD A;  4XHM A;  1HNC A;  4ZL7 A;  2C0E A;  2VLU A;  5CRE A;  2GQK A;  5DJL A;  5GZZ B;  4J2F A;  2XBQ A;  4DSR A;  2K9F A;  3TDG A;  4JU5 A;  1PGT A;  4LMW A;  3K8N A;  1V57 A;  2PPT A;  4JR4 A;  1YEP A;  5J47 A;  1R5A A;  4XRD A;  5E4W A;  2GQL A;  2CZ2 A;  2GSS A;  1TRW A;  3ZLP A;  3WYW A;  2GST A;  4PX1 A;  1S3A A;  2PWJ A;  4IKH A;  4ECI A;  3KTL A;  4K6X A;  5D9V A;  4KX4 A;  2FHE A;  4DSS A;  3KMN A;  4IP6 A;  3LXZ A;  2MYG A;  4OD7 A;  2HSM A;  3KGK A;  4IQA A;  2VCX A;  2LRN A;  4G0K A;  2H0G A;  2C0F A;  4MJC A;  1MDJ A;  4MZC A;  1O6J A;  5KN1 A;  2IMD A;  5JCG A;  2DJ2 A;  1CQG A;  3DYR A;  5ENU A;  3ZTL A;  4NPB A;  4WR5 A;  2GZZ A;  4GQC A;  3O3T A;  3UVH A;  2K8V A;  2C3Q A;  3NOF A;  5IPH A;  3FYG A;  4OFT A;  2HZF A;  12GS A;  1GSD A;  5G30 A;  3FR3 A;  2M72 A;  4OO4 A;  3TKS E;  1X9S B;  4KW6 A;  5J9C A;  4NV5 A;  5EVO A;  4AKX B;  5IOX A;  3H1N A;  3ERG A;  3CTF A;  1PKZ A;  5JCU A;  1PN9 A;  1TU8 A;  2YN1 A;  17GS A;  1FO5 A;  3CBU A;  5ECR B;  3V1W A;  1GL8 A;  1TKD B;  2A2R A;  5KN3 A;  3H93 A;  1FVK A;  1GWC A;  1OKD A;  4MDC A;  5DBQ A;  5C00 A;  3G7I A;  1KEB A;  4WBJ A;  2CQ9 A;  1X9W B;  2H74 A;  4CY8 A;  2N5F A;  5A4V A;  1XCC A;  3HKR A;  3GFK A;  4PTS A;  3APO A;  3TCO A;  3GH6 A;  1KBN A;  4K0N A;  2O87 A;  5CAX A;  3M3M A;  2O85 A;  3N5O A;  2D2Z A;  2H75 A;  3TJK A;  3DGQ A;  4L5O A;  5J41 A;  2DJ1 A;  2L6D A;  5KEJ A;  4N0V A;  2GDR A;  1XW5 A;  3VLN A;  5IO0 A;  2JL4 A;  3R2Q A;  2EFC A;  2OJL A;  2IFQ A;  4QMK A;  1AQX A;  2OAC A;  2HSM B;  1GNE A;  1XIY A;  4Z2U A;  3MNG A;  3I69 A;  2P31 A;  2FWH A;  1DE1 A;  4GLT A;  4CW9 A;  3MDK A;  3LWA A;  4G2E A;  4OCF A;  2DJ0 A;  3GUS A;  5DDL A;  2XPD A;  2H1A A;  4MH2 A;  1QUW A;  2LUS A;  5BRT A;  4FQU A;  4WET A;  4Z7X A;  4ZL9 A;  3F4S A;  3PPU A;  4QQ7 A;  1KTE A;  3TJG A;  4KND A;  2K8S A;  1Z6M A;  2O5V A;  2NBS A;  1QXH A;  2OT3 A;  4USS A;  2LJR A;  4AI6 A;  5DJM A;  4WF4 A;  5EY6 A;  5G1L A;  5ECO B;  1A2L A;  2AAW A;  4D73 A;  4O5R A;  2BJX A;  2R6K A;  3KH9 A;  5B6N A;  2HSN A;  2IN3 A;  1TRS A;  4QL7 A;  6GST A;  1OC9 A;  3QAG A;  4ZBB A;  2YV9 A;  2HLS A;  14GS A;  4ISD A;  1O81 A;  2GT5 A;  3UOM A;  3ME8 A;  3IXR A;  4TXO B;  5B6M A;  4AKH A;  1AXD A;  4MA9 A;  4K0G A;  2X8C A;  4L0W A;  5HR1 A;  4BVY A;  2HFD A;  3VI7 A;  2YZH A;  3F3R A;  1XZO A;  1DBY A;  3M9J A;  1SL2 B;  3VPT A;  1ILO A;  2VCZ A;  3I6A A;  2IFQ B;  5CNW A;  1WWJ A;  22GS A;  4PUA A;  1PQN A;  5IM9 A;  1NW2 A;  2NTO A;  2C80 A;  1X5D A;  3GIX A;  19GS A;  1K0D A;  3HVV A;  2YWI A;  2HZE A;  2KUC A;  3IHQ A;  4KAE A;  2OE3 A;  1EOG A;  3E9J B;  5GAP D;  1ABA A;  1XXU A;  1SYX A;  5J5N A;  3A2X A;  2DJJ A;  2HT9 A;  3TJF A;  3CTG A;  3KEB A;  4YKG A;  4PUF C;  5EPF A;  1XVW A;  1MTC A;  4O5U A;  4V2M A;  2CZ3 A;  2VCV A;  3F6D A;  3KP8 A;  1IYH A;  4MZB A;  3LJR A;  1FOH A;  5D96 A;  2DML A;  3F63 A;  3F8U A;  3HZ8 A;  3PR8 A;  1I5G A;  1U6T A;  1N25 A;  4P3Y B;  5GSS A;  4LMV A;  2VL3 A;  4V1A p;  3GMF A;  4D73 B;  3M9K A;  1A2M A;  4BL7 A;  1OC9 B;  2H71 A;  3O6T A;  5JWQ B;  3ZMK A;  2IPA A;  4LA1 A;  1E2Y A;  4A5P A;  1AUC A;  1XW9 A;  2JAD A;  4X0X A;  2IMF A;  3FZ5 A;  2F3M A;  3F3Q A;  1HQO A;  2R3X A;  4MPF A;  4RUV A;  2H72 A;  2C4J A;  2LRC A;  1G7O A;  3P7X A;  13GS A;  4HU7 A;  4FYC A;  1MDK A;  1VF3 A;  1OVN A;  5F06 A;  1B9Y C;  3TKS C;  4ID0 A;  2H30 A;  4RQX A;  4WF5 A;  5ECK B;  2MMN A;  4ZL8 A;  2VL2 A;  2HZE B;  3WGD A;  4F0B A;  3W8J A;  1GNW A;  1G6W A;  2QC7 A;  1JLW A;  2ON5 A;  4YAV A;  2HRK B;  2C0D A;  1GRX A;  4EIQ A;  1ZZY A;  1DSB A;  2GVP A;  2MBT A;  5A5H A;  4OCE A;  2R0G A;  5J3R A;  1PMT A;  3GST A;  1XWC A;  1A0R P;  4MNN A;  5CP1 A;  2MBS A;  1EV9 A;  5B7C A;  4K8M A;  4HZ4 A;  3IA1 A;  2GGT A;  4EE0 A;  3CXG A;  1GSE A;  1XWA A;  3GRX A;  5EL8 A;  4L5L A;  4POB A;  5DQY A;  1U3A A;  4KDY A;  1Y6E A;  2WUL A;  4ECC A;  4POL A;  3IRA A;  5AN1 A;  4W66 A;  4PUR A;  5IQY A;  3WD6 A;  1WOU A;  4MF7 A;  3IHG A;  2LQO A;  2IJY A;  3F6F A;  3G9B A;  4WXT A;  2PU9 C;  2VL9 A;  1V58 A;  4K2D A;  2R2J A;  3SBC A;  1A2J A;  1A23 A;  2M46 A;  3PIN A;  2N5A A;  3EMP A;  5A34 B;  3F0I A;  1ACV A;  1XFL A;  1ERW A;  1YZX A;  1XPV A;  1SVL A;  1F3B A;  1GUK A;  1V9W A;  1USB A;  4KGI A;  2B5X A;  5ECM B;  3MYD A;  2MMA A;  3GA4 A;  1PL1 A;  1ZL9 A;  3G7J A;  2HXK A;  2VCQ A;  1MDI A;  1V40 A;  1J0F A;  4BWQ A;  4BPY A;  3M0F A;  3KH7 A;  4DSQ A;  1S3C A;  1HD2 A;  1AQV A;  2VLV A;  3D0Z A;  1R5P A;  5AIV A;  1WPI A;  3GL3 A;  2X99 A;  5JWO B;  1PX6 A;  2GTU A;  1NM3 A;  4WEY A;  3D6I A;  4G0I A;  2G0F A;  5GAN D;  1OYJ A;  1BX9 A;  3TOT A;  4EL1 A;  3D22 A;  1QFN A;  2DBC A;  2DJ3 A;  3VWU A;  3UEM A;  3WGE A;  3FW2 A;  4XS6 A;  1M2B A;  3W6G A;  1VF4 A;  4GWR A;  4ZB9 A;  2PER A;  3BJ5 A;  4PQ1 A;  2R0C A;  2PVO C;  3IR4 A;  2CV4 A;  1I9D A;  1B8X A;  4NAX A;  4O7H A;  2R5G A;  2AV4 A;  1XWG A;  1F3A A;  3CSJ A;  4PNF A;  1ZYE A;  3LOR A;  2FWE A;  2HE3 A;  1A24 A;  3ZML A;  4ACS A;  5D93 A;  2VM1 A;  2UZ8 A;  1E6B A;  4Q5N A;  5BMU B;  2C1Y A;  1OE8 A;  3L0H A;  4N10 A;  3GV1 A;  3P2A A;  2GS3 A;  4POM A;  4F2I A;  2WS2 A;  5F05 A;  1OC3 A;  5DVB A;  1J08 A;  4NV2 A;  1TP9 A;  6GSV A;  3Q6O A;  2O89 A;  4HQS A;  1WIK A;  2DIY A;  4ZIJ A;  4HEA 2;  3H8Q A;  3F4R A;  4JED A;  3F9U A;  4ZBD A;  4O92 A;  4FYB A;  2A4H A;  4MP4 A;  5DCG A;  4AF2 A;  1J9B A;  1SKR B;  2MMZ A;  3DEX A;  4EC0 A;  1M0U A;  5L71 A;  4K7O A;  2V6O A;  4GCI A;  3BD2 A;  3DVX A;  1ERU A;  2CX3 A;  2EIO A;  4Z2R A;  3U6V A;  3KD0 A;  2H0H A;  4KE3 A;  3L9S A;  3S9F A;  5G5F A;  1H75 A;  3BOA A;  2GLR A;  1GLP A;  4V2L A;  1W89 A;  3EVI A;  4TR1 A;  3M1G A;  1ZMA A;  2CVK A;  5FT3 A;  4EF0 A;  1F9M A;  2RLI A;  3AY8 A;  1OC8 A;  3ED3 A;  2YV7 A;  1K3Y A;  4IP1 A;  4O5Q A;  2H6X A;  4F82 A;  1THX A;  1OKT A;  1N8J A;  2B7K A;  1ST9 A;  5J4V A;  1PX7 A;  2AHE A;  1GSQ A;  1NHY A;  2B6M A;  3HVX A;  3GTU B;  4CY6 A;  2V41 A;  5G5E A;  1GLQ A;  6GSW A;  5IPG A;  3C7M A;  3IPZ A;  2ON7 A;  5G2Z A;  5HFI A;  3TB2 A;  3KIJ A;  3QDN A;  4TXO A;  4K7I A;  1NHO A;  2I81 A;  3IAM 2;  8GSS A;  2VD0 A;  1SU9 A;  2YJ7 A;  4O32 A;  3QD9 A;  1SEN A;  4K2X A;  1R4W A;  3GSS A;  2BTO T;  2H6Z A;  1EGR A;  4MH3 A;  1OAZ A;  2TRX A;  4GRF A;  1IYI A;  1PD2 1;  1OE7 A;  1FB0 A;  3VK9 A;  3GH9 A;  4G9H A;  3NIV A;  2OE0 A;  3W8S A;  3GKX A;  2I4A A;  1TI3 A;  2JU5 A;  3D5J A;  3ZIT A;  4F03 A;  5C04 A;  3SWL A;  4RI6 A;  1K0N A;  2GQM A;  4EVM A;  1LBK A;  2P5R A;  4ZXG A;  3RDW A;  2EC4 A;  1XOA A;  1U3I A;  4EDY A;  2O8V B;  3FR9 A;  5JWR B;  3MSZ A;  1PL2 A;  3CWG A;  2E7P A;  3MWH A;  1T3B A;  3C71 A;  1EEM A;  5AIS A;  4NHW A;  1B9X C;  3UAR A;  5KOX A;  1Z7R A;  2VIM A;  3ERF A;  1GSF A;  2XPE A;  3RHC A;  4TR1 B;  2FCH A;  4JRR A;  4K5S A;  3HY2 A;  2C3T A;  1EZK A;  4ZB8 A;  4H86 A;  4NWY A;  4NXI A;  3IOS A;  2LQQ A;  4IQ1 A;  4MLY A;  5ABR A;  5D9X A;  1JLV A;  2PBJ A;  4IW9 A;  1ZOF A;  3DVW A;  4X43 A;  5ECI B;  1EGO A;  5AGY A;  2PN8 A;  5G31 A;  1O73 A;  1TK8 B;  2YWO A;  4DEJ A;  1GTB A;  1JHB A;  1YJ6 A;  2A2P A;  2GSQ A;  1F6M C;  2L4Q A;  2VKZ G;  2WDU A;  2LKU A;  3EWL A;  2FGX A;  2KHP A;  3NZN A;  2EIR A;  1FB6 A;  2HRA A;  1YQ1 A;  3J7Y b;  3HCZ A;  4AGS A;  2L5L A;  2FUG 2;  5FHI A;  1LJR A;  2JZR A;  1BJX A;  1TK0 B;  3I9V 2;  3FZ4 A;  2FWF A;  1V2A A;  4BA7 A;  1YDK A;  1PN0 A;  2E2G A;  2KOK A;  3PGT A;  1TRV A;  1M2A A;  2RII A;  5G1K A;  3HVS A;  4KCA A;  3GKN A;  4K5R A;  2WFC A;  4G0L A;  1YKA A;  4CDO A;  1BQ7 A;  3UJ1 A;  5IMF A;  1EP8 A;  4MF6 A;  1WRY A;  5H5Q A;  2I9H A;  4MJA A;  5KN2 A;  3F4T A;  5LD0 A;  3QCP A;  3TRQ A;  5J9B A;  2VLT A;  3CMI A;  4MPG A;  4MJE A;  1UN2 A;  1SKS B;  2HRK A;  3KCM A;  4ILF A;  5D8I A;  1K0M A;  3ZL5 A;  1MEK A;  3EYT A;  3A5W A;  3QAV A;  4I2U A;  1AIU A;  3KM6 A;  1W4V A;  1DUG A;  1R7H A;  1YY7 A;  2HRF A;  3DD3 A;  2X4A A;  3L4N A;  1XW6 A;  1GH2 A;  1SK0 A;  1TI1 A;  1JZR A;  4K1F A;  6GSY A;  3R3E A;  3QFA C;  2NVL A;  1FOV A;  1WE0 A;  3EUR A;  1M9A A;  5J40 A;  2MMO A;  2M80 A;  2CAI A;  2KLX A;  4I97 A;  1UA5 A;  2H6Y A;  2L57 A;  1O7U A;  2YJH A;  5CRG A;  3FK8 A;  3TKQ A;  2DJK A;  1M2D A;  4IN0 A;  4IJI A;  4I6X A;  2H70 A;  3DRN A;  4I5Q A;  3G7Y A;  4OFM A;  2J23 A;  2F8F A;  18GS A;  1T8E B;  2LST A;  4PXO A;  1YEX A;  3HD5 A;  2FA4 A;  2EIQ A;  3L9U A;  2P5Q A;  1HNA A;  1WMJ A;  2ZNM A;  2RUF A;  1SK1 A;  3TRX A;  3Q74 A;  1ON4 A;  5A34 A;  5H5S A;  3IK9 A;  1XOB A;  4L8E A;  4AJ8 A;  1T00 A;  1TOF A;  2EFE A;  3RPN A;  2GZP A;  1ZCP A;  1ZGN A;  2F51 A;  3ZIV A;  3TKR A;  7GSS A;  4GXZ A;  1WJK A;  2VO4 A;  5B8A A;  2IL3 A;  3RBT A;  2H66 A;  3FZ9 A;  5IOW A;  2B1K A;  6GSU A;  4WBR D;  3A5I A;  5HFK A;  5CRW A;  3UBL A;  3VFI A;  2RM5 A;  1YKC A;  1R26 A;  2GZY A;  1PSQ A;  4IS0 A;  3DKS A;  3QR6 A;  1ZYP A;  4EKZ A;  2R0P A;  4G19 A;  2A2S A;  2HYX A;  3JCM L;  1Z6N A;  1GSY A;  4CHS A;  4EXJ A;  3BCK A;  2H1B A;  2JAC A;  1Q4J A;  4ULX A;  3ZZX A;  3VWW A;  2OKA A;  2V32 A;  3RAZ A;  2H8L A;  1XVQ A;  1MD3 A;  3ISO A;  2AUV A;  5E59 A;  4KH7 A;  1BED A;  2TRC P;  1M7T A;  5ELG A;  4EUY A;  1ERV A;  3D4M A;  2YPM A;  1XWK A;  4TOP A;  1SJ6 A;  2FD3 A;  1AAZ A;  2QSI A;  2H1D A;  3HA9 A;  3ME7 A;  5CO3 A;  5HR3 A;  2CVD A;  2AJQ B;  1Y25 A;  2AYT A;  4E8H A;  1X0R A;  3IAS 2;  4XRA A;  1EV4 A;  9GSS A;  4ICY A;  5BMU A;  4GSS A;  3A2W A;  1BG5 A;  2OA7 A;  5A5K A;  4AJ6 A;  2X8G A;  5HQP A;  3LSZ A;  1K0O A;  4POK A;  4N30 A;  3UL3 A;  2R4V A;  1X5E A;  1H4O A;  4KDX A;  3CSH A;  3N9J A;  5A1N B;  5IMZ A;  3ZFL A;  2CAQ A;  1VF2 A;  3ZIJ A;  3KMO A;  4F9Z A;  2I3Y A;  3LYK A;  4TVE A;  5CRH A;  1URM A;  3GX8 A;  2HSH A;  3APS A;  3VWX A;  4DVC A;  3IE3 A;  5J4Y A;  2OBI A;  4Q5Q A;  1Z7P A;  2REM A;  2LRT A;  1MD4 A;  2NPB A;  3HXS A;  4EDZ A;  4XIH A;  5F0G A;  2QKE A;  1B4Q A;  2WGR A;  1WP0 A;  2VAF A;  4MK3 A;  4KF9 A;  1A0F A;  3HZ4 A;  5IMA A;  3A2V A;  1TJD A;  1V98 A;  1VGL A;  4I8B A;  3EPT A;  1M9B A;  3TKP A;  3HHV A;  2A4V A;  1SJZ A;  4IVF A;  3DIE A;  1N2A A;  3CRU A;  2RM6 A;  3H79 A;  4KCE A;  4HS1 A;  5ID2 A;  1B48 A;  1SL1 B;  2Z9S A;  3Q19 A;  5ECN B;  4HQZ A;  4PNG A;  6GSX A;  3KP9 A;  5INY A;  1PA3 A;  1T4Z A;  3GTU A;  2AB6 A;  5IMC A;  1K0B A;  3GKM A;  2VUP A;  3ZVJ A;  4MAB A;  6GSS A;  3LG6 A;  1SK2 A;  4EO3 A;  3IC8 A;  3ZVJ D;  2OE1 A;  2LV3 A;  3EIN A;  1O8W A;  4HI7 A;  4OO5 A;  5CYY A;  1THO A;  5DAL B;  1TW9 A;  3L78 A;  2DIZ A;  4LL4 B;  5IMD A;  2JSZ A;  3IBH A;  2KP1 A;  4OWY A;  3EMX A;  1DE2 A;  1TXU A;  2KP2 A;  1T7P B;  4G01 A;  3BBY A;  1T1V A;  3I43 A;  5A4W A;  4K9Z A;  3QMX A;  1O8X A;  4ML1 A;  4V2N A;  2QA2 A;  4HJM A;  1GTI A;  3GHA A;  1G0T A;  4TR4 A;  3IK7 A;  3EE2 A;  1X5C A;  5F8B A;  1F2E A;  2L4C A;  4XTS A;  2J9H A;  5A4U A;  4LL1 B;  2EFH A;  3QPM A;  2VOC A;  2H76 A;  2ZCT A;  3D4T A;  4KA0 A;  3FR6 A;  2H73 A;  3PH9 A;  2B5Y A;  4AJ7 A;  2QA1 A;  3HJO A;  1M99 A;  2WRT A;  4IEL A;  4MMM A;  4KSO A;  1QGV A;  1NSW A;  2CVB A;  1Z3E A;  2HQT A;  3KZQ A;  1TXX A;  4IBP A;  5ID2 B;  2PVQ A;  3ZRE A;  5KN0 A;  1JZW A;  3EU3 A;  2PGT A;  2IMK A;  5ECL B;  5IIZ A;  1UC7 A;  3ZFB A;  3RHB A;  1BG1 A;  2VL2 C;  3L9V A;  2WJU A;  3MAK A;  2FA8 A;  4NHZ A;  1XWB A;  2PUK C;  1YVL A;  2WCI A;  5CRD A;  4BWS A;  3US3 A;  4LLR A;  1Y1U A;  3TKS A;  2H01 A;  3LEF A;  4V1A g;  5B8B A;  2TIR A;  4J57 E;  5COH A;  5IMV A;  1Z9H A;  1SL0 B;  4TR0 A;  1TDI A;  3FY7 A;  4G10 A;  2C0G A;  3FHK A;  1ZYQ B;  2RUE A;  3C8E A;  5ELA A;  1U87 A;  5D73 A;  5DQS A;  1RW1 A;  4KUN A;  2DLX A;  4BVX A;  5LNK e;  2WB9 A;  4MZW A;  4OMV A;  4FH8 A;  2YNX A;  3UAP A;  1Q98 A;  2P0G A;  3U5R E;  1K0A A;  2HI7 A;  1C72 A;  4TR3 A;  2R37 A;  2H0I A;  1GUH A;  2LJA A;  3IDV A;  1QMV A;  4NMU A;  3LW9 A;  4ZIL A;  4TRX A;  4RI7 A;  3HDC A;  2IWT A;  4MF5 A;  4DSS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...