5BMUA

The crystal structure of the gst-like domains complex of aimp3-eprs mutant c92sc105sc123s
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
165
Chain Sequence
HMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation elongation factor 1 epsilon-1
publication title Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/ligase
total genus 50
structure length 165
sequence length 168
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5bmuA02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5bmuA01
1FW1A 4EDZA 1FHEA 1TDIA 4IQAA 1BYEA 1Q4JA 3C8EA 5F8BA 2YCDA 2AAWA 4QQ7A 5J41A 5A4WA 3GUSA 1YDKA 2WB9A 1IYHA 4EC0A 3Q74A 3F6FA 3CRTA 1JZRA 3QAWA 1OE7A 4MF6A 1K0MA 5G5FA 3GX0A 3N9JA 3F63A 2VCZA 2OADA 4HOJA 13GSA 2FNOA 1K0OA 3KMNA 3ZFBA 3R2QA 5ECHB 1A0FA 4F03A 4PXOA 4NHWA 5GSTA 1V40A 4KDXA 4E8EA 3GURA 2VCXA 4ID0A 2CAQA 4USSA 4G10A 1XW6A 1GUKA 2F3MA 5HFKA 4E8HA 4NAXA 4IJIA 4WR4A 1MD4A 1YJ6A 2IMIA 3H1NA 5AIXA 1GSFA 4YAVA 4IBPA 2HRKA 1GTBA 2HSMA 5KEJA 4CHSA 5ECLB 1GSSA 4IKHA 1MTCA 2VCTA 3L0HA 4Q5QA 2IMKA 5D9TA 1EOGA 4MP4A 1TW9A 3VK9A 1XW5A 4RI6A 5DDLA 10GSA 6GSVA 1B8XA 1NHYA 4OFNA 4ZB6A 1K0DA 4HZ2A 4RI7A 2R6KA 2C8UA 2WRTA 3P90A 1TU7A 1Z9HA 1OYJA 4JEDA 4FQUA 2R4VA 3D0ZA 3WD6A 4KH7A 1GTUA 2GSSA 1JLVA 2F8FA 3O3TA 3F6DA 1F3AA 4GLTA 4Q5RA 4YAPA 4ZB8A 1R5AA 4TOPA 3N5OA 4KSMA 3GTUA 3DD3A 1HNBA 3M0FA 3MDKA 3IE3A 1ZL9A 4PNFA 1K0BA 4BVXA 3GH6A 1F3BA 3VI7A 1PMTA 4NHZA 5ECOB 2VCWA 3AY8A 3TOTA 2PMTA 1U87A 1GNEA 3G7IA 4I97A 4IGJA 3IC8A 1AQWA 5B7CA 1M9AA 4ECCA 1AQVA 3KJYA 2GSQA 1EV9A 2VD1A 4KX4A 2CAIA 1YKCA 4KDYA 4BL7B 4EDYA 4Q5NA 3MAKA 2OA7A 2CZ2A 1AW9A 1XWGA 3PGTA 3WYWA 16GSA 5J4UA 4GF0A 4ZB9A 4MF5A 3LSZA 4YQUA 2JL4A 1MD3A 3LYKA 3M8NA 4O7HA 3LFLA 1GSDA 1Y6EA 3GSTA 6GSXA 4ZXGA 19GSA 2VD0A 4G19A 1G6YA 3UBLA 3M3MA 3LYPA 12GSA 4OFMA 4ACSA 4ZBAA 5A4VA 1K3LA 4KGIA 4L5LA 5D73A 1PGTA 3FR3A 1BX9A 4JZQA 3HJMA 5AN1A 4ZBBA 3U6VA 3KMOA 1V2AA 1PL1A 1BG5A 1PX6A 4O92A 5G5EA 4BVYA 4KE3A 5FT3A 4KAEA 5ECSA 3VURA 5EVOA 2DC5A 3EE2A 1C72A 2GLRA 1VF3A 4PURA 5GSSA 2HQTA 3Q19A 1LJRA 5AISA 4GCIA 3FR6A 4KF9A 3ISOA 1GTIA 6GSUA 3FYGA 4ISDA 4YQVA 4PUAA 20GSA 3PR8A 5A4UA 6GSSA 2OACA 3ERFA 5DJMA 3GSSA 3VPTA 3NIVA 5DALA 3FR9A 1PKWA 2HNLA 4GTUA 1GSYA 2J9HA 5ECKB 3KXOA 1HNAA 3UAPA 1PA3A 1PD21 5EL8A 5LD0A 4OFTA 5DAKA 3LXTA 3UBKA 5AIVA 4MPFA 1KBNA 5ELGA 1IYIA 5D9VA 2C80A 1GLPA 1GNWA 2D2ZA 5DCGA 4HJ2A 3UVHA 4PQHA 2WS2A 2HSNB 4Q5FA 2ON5A 2PVQA 4L8EA 2A2RA 2PERA 3CSJA 2C3NA 3UARA 3CSIA 2C3QA 2GSRA 2HRKB 4G0KA 1YY7A 1HQOA 2HSMB 1K0CA 1B4PA 4PGTA 4F0BA 4LMWA 2HRAA 2GDRA 5F06A 4PNGA 3CSHA 4IQ1A 4K0NA 5ECMB 4PTSA 3Q18A 3IK9A 2VCVA 5BMUA 4OMVA 4GSTA 5ECRB 1M99A 3IBHA 1OKTA 5D9XA 1F2EA 5ECIB 2PGTA 1G7OA 4PX1A 2WJUA 1TU8A 2YV9A 4K0GA 5FWGA 1K3YA 3P8WA 4YH2A 3CBUA 1YQ1A 4G0LA 1EV4A 1XWKA 3LQ7A 4MDCA 3VPQA 1U88A 3GTUB 3I69A 6GSWA 5ECQB 4IELA 4EE0A 4BVXB 3CRUA 1BAYA 3VLNA 2A2SA 1EOHA 3DGQA 14GSA 1LBKA 1ZGNA 3KM6A 4G9HA 5ECNB 2R5GA 4PQIA 3HJOA 1OE8A 4MZWA 1PX7A 3M1GA 2ON7A 8GSSA 1EEMA 1K0NA 3EINA 1JLWA 1PN9A 2V6KA 3IK7A 3ZFLA 4JBBA 5GZZB 3FRCA 1M9BA 1AQXA 4J2FA 4MF7A 3ZMLA 1B48A 2YV7A 3VI5A 4LMVA 1M0UA 3PPUA 3ERGA 1ML6A 5JCWA 6GSTA 1K0AA 1GUHA 1E6BA 4IS0A 1G6WA 3LG6A 3QAGA 5J5NA 1UA5A 3TOUA 4ECJA 3R3EA 1GTAA 4HI7A 4HZ4A 1GSEA 2FHEA 2X64A 2R3XA 3TGZA 1VF2A 2IL3A 2N5FA 5F07A 3FY7A 2LJRA 2GTUA 4WR5A 1GSUA 3SWLA 4MK3A 3IR4A 1HNCA 4BVYB 2C3TA 4ECIA 1GULA 2AB6A 2GSTA 3VWXA 2CVDA 4KDUA 4MPGA 5A5KA 4YQMA 4AGSA 1GWCA 5ECPB 6GSYA 4IVFA 3HKRA 4BL7A 1DUGA 3ZMKA 3QAVA 4N0VA 4G0IA 5DJLA 5DALB 1U3IA 3I6AA 3QR6A 1USBA 5JCUA 1VF1A 1GUMA 2NTOA 4GSSA 3RBTA 5LCZA 1PL2A 3LXZA 5D9WA 5DQSA 2AHEA 5AGYA 4GSNA 2CA8A 4DEJA 5DAKB 11GSA 4L5OA 1VF4A 22GSA 2C4JA 1RK4A 2VO4A 5FHIA 5ELAA 4ECBA 3KTLA 3W8SA 1AXDA 7GSSA 2PBJA 5F05A 5F0GA 2WDUA 4EXJA 2VCQA 1K3OA 1N2AA 1PKZA 3G7JA 4IW9A 1GLQA 2CZ3A 1GSQA 4F0CA 17GSA 9GSSA 2DSAA 3LJRA 5IQYA 3O76A 4ZBDA 2UZ8A 5EY6A 18GSA 3BBYA
chains in the Genus database with same CATH superfamily
4IQAA 1FOVA 4XRDA 2X99A 4CW9A 4GWRA 4QQ7A 3F9UA 3LGCA 4EC0A 3Q74A 4KB3A 3F6FA 1TTZA 1SU9A 3CRTA 3FZ4A 2XC2A 4TR0A 2V2GA 1K0MA 3N9JA 2A4HA 2H74A 3F63A 2E2GA 2OADA 5G31A 3VWUA 2FNOA 1K0OA 1SD9A 1UVZA 1A0FA 3CXGA 4PXOA 4KDXA 3GURA 3TCOA 4LLRA 3KCMA 4G10A 2FUG2 3FZ9A 2QKEA 2VLTA 3CTGA 3OR5A 1VGLA 2R37A 1XOBA 4IBPA 2HRKA 2M80A 3FK8A 5IMCA 1Z7RA 2WW2A 1MDKA 4CHSA 5ECLB 1ILOA 4QL9A 1GSSA 4IKHA 2FY6A 4RQXA 4I6XA 5D9TA 2H70A 4H86A 4HQSA 1DE2A 4MP4A 1TW9A 1Z3EA 10GSA 5JWQB 1NHYA 4ZB6A 3DWVA 2YP6A 4FXYP 2H19A 5ID2A 3QFAC 1UN2A 1TU7A 2LKUA 4XS1A 2LRTA 4KH7A 3WGDA 1JLVA 3QOUA 3F6DA 5JWRB 4EO3A 3KIJA 4GLTA 2O36A 1SVOA 4Q5RA 4YAPA 4ZB8A 4PQ1A 3J7Yb 2IMFA 3IE3A 3RDWA 5E59A 3VI7A 3TOTA 3AY8A 2PMTA 3IV4A 4I97A 3IC8A 2L4QA 4GQFA 2A4VA 2C0GA 4FO5A 5B7CA 1M9AA 4ECCA 2H0GA 3GKMA 3HYPA 1YKCA 2KHPA 2L57A 2JADA 4EDYA 3MAKA 2HI7A 2GT6A 4N11A 1AW9A 1X9SB 2WULA 4HU7A 2DMLA 1MD3A 3LYKA 1SYXA 3LFLA 2O89A 1O6JA 1Y6EA 3GSTA 3UBLA 2X8GA 1SL2B 5A4VA 2QA2A 4TXVA 4RUVA 3C7MA 4L5LA 1ABAA 2QSIA 4P3YB 1PGTA 3FR3A 3KMOA 5IMVA 1BG5A 5G5EA 2AJQB 3KP8A 4DSQA 4K2XA 3VURA 2LS5A 3EE2A 1C72A 2E2MA 5A1NB 4GCIA 2O85A 5B8AA 3L78A 1XWAA 3IOSA 1NSWA 4L0WA 3IC4A 2YANA 4PUAA 5A4UA 3PR8A 2G2QA 4PI0C 3TKPA 3ERFA 5DJMA 3NIVA 2YN1A 4G2EA 4HUAA 5HQPA 4IP1A 4MH2A 3QCPA 2YWOA 5EL8A 2L59A 4ML6A 4OFTA 4TR1B 4NV5A 2DBCA 2PVOC 4V2NA 2KUCA 3D22A 2L5OA 1DSBA 2WVXB 1JFUA 1M3JA 4K6XA 2TIRA 3M9JA 1QXHA 4L8EA 2VLVA 2PERA 2H6XA 2C3NA 3NOFA 3IRAA 3FZ5A 5DBQA 2MMZA 2ALBA 2VOCA 1BG1A 4I2UA 4EIQA 3C71A 2HSMB 2LEGA 4PGTA 3GKNA 4LMWA 3HVXA 2HRAA 1N8JA 4V1Ag 1R5PA 3Q6OA 4IQ1A 4PTSA 3Q18A 4MZBA 4OMVA 3GX8A 3HY2A 3F4TA 1M99A 3RGBC 3IBHA 3TKQA 1KNGA 4WF5A 2WJUA 3FZAA 5FWGA 3GL3A 1K3YA 4YH2A 3IHGA 4PUFC 4QMKA 3CBUA 5COHA 1YQ1A 3DIEA 4G0LA 2FWGA 1XWKA 2VM1A 3VPQA 1T7PB 1T1VA 1QQ2A 5CRDA 4BVXB 1BF5A 3MIXA 2YWNA 4FIWA 2H76A 5IPHA 4KNDA 4L0UA 1ZGNA 1Y1UA 2OE1A 2HRNA 1SVLA 1PX7A 8GSSA 5CRGA 1EEMA 1K0NA 1JLWA 5IPGA 2DMMA 1SJZA 3WT1A 1AQXA 3ZMLA 1XBSA 1B48A 4LMVA 2GVPA 3PPUA 1XG8A 3ERGA 6GSTA 4IS0A 1E6BA 2KLXA 2M72A 5J5NA 1ZYPA 1UA5A 2YZHA 3TOUA 3KP9A 4MABA 4HZ4A 2R3XA 1I9DA 1JZDA 1T3BA 1SJ6A 1YKAA 2YJ7A 4GDFA 2LJRA 4ZL9A 2KP1A 4WR5A 1GSUA 3IR4A 3CMIA 1HNCA 1YEWC 1H4OA 4BVYB 2H6YA 2H8LA 4ECIA 3EU4A 3GA4A 1T4ZA 1ERTA 4WKWA 1GL8A 4YQMA 2HZFA 4ULXA 3QAVA 5DALB 1TRUA 4PHZC 1O81A 1GUMA 2HXKA 3RBTA 5LCZA 2V32A 4K2DA 5HR3A 2E7PA 5D9WA 5DQSA 2VM2A 4MLYA 2CX3A 4N30A 2AHEA 3M9KA 1X5EA 4AJ6A 4N3ZA 5ELAA 4ECBA 1V57A 4OCFA 2WDUA 2VCQA 1QFNA 1K3OA 4F0CA 4WEYA 17GSA 4POBA 3LJRA 4ZBDA 4F2IA 5A1NA 1S3AA 4CY6A 4AJ8A 3ZLPA 2VLUA 3H93A 3ZIJA 3KH9A 1BYEA 2EFDA 5J4YA 1ON4A 5F8BA 2C0EA 5A34B 2DIYA 3QD9A 1OKDA 1JZRA 1OE7A 4TR1A 2IN3A 1JZOA 5G5FA 3FHKA 1YEPA 2VCZA 1YF1A 2WVXA 2BMXA 4EF0A 2O87A 5G30A 2XBQA 5ECHB 1O85A 1V40A 4E8EA 2REMA 4ID0A 2CAQA 4USSA 1GP1A 4X43A 1XW6A 2F3MA 5HFKA 2NDOA 1DE1A 3A2WA 1ST9A 1MD4A 2X49A 3O6TA 1GSFA 2K8SA 2HSMA 2MMOA 3UEMA 3QMXA 2IMKA 1XW5A 2FLSA 5DDLA 5HR1A 3ZL5A 2C0DA 4HZ2A 1OC8A 3H8QA 5CAXA 4FYCA 3F0IA 2WRTA 2N5AA 3P90A 1MDIA 2H71A 2FWFA 2R4VA 3D0ZA 4FQUA 3WD6A 2GSSA 2F8FA 3HVNA 4NV2A 3HDCA 4ILFA 4NWYA 1R5AA 3N5OA 2VAFA 3BCIA 3M0FA 1S3DA 1FVKA 3CQFA 2H01A 4PNFA 1K0BA 4BVXA 3GH6A 2P5RA 3JCML 2VCWA 4WXTA 1XWCA 1GNEA 3G7IA 4IGJA 4JRRA 1TI1A 3WGEA 2WGRA 2L5LA 2H1AA 2FA4A 4ZILA 4KCAA 3CTFA 1G0TA 2GSQA 5HR0A 3WGXA 2OBKA 2CAIA 1JZWA 2L6CA 4W66A 2MMNA 4BL7B 2LNSA 2CZ2A 4POMA 3LW9A 3PGTA 16GSA 3VFIA 4GF0A 2JZTA 5IMZA 4MF5A 5CRWA 2JL4A 4DSRA 3TJFA 1ERVA 4I2TA 4TKYA 5D8IA 3APOA 6GSXA 5G2ZA 2B5EA 4G19A 2H0IA 3M3MA 1B9XC 3GV1A 4ZBAA 5KOXA 4MMMA 4MZCA 4YKGA 4AF2A 1WRYA 1A23A 4KGIA 4JZQA 1J08A 2FGXA 1WJKA 3H4KA 1PX6A 4O92A 4BVYA 4NMUA 2G0FA 3CYNA 2DC5A 2IFQB 3KEBA 1TXUA 2GLRA 5J40A 1VF3A 5GSSA 1FO5A 3Q19A 2O5VA 4AKXB 2FD3A 2H1BA 3GL5A 3ISOA 2H30A 4KA0A 3FYGA 4ISDA 4YQVA 20GSA 4XRAA 4K5SA 2B3SA 5DALA 3FR9A 3TJKA 2HNLA 1FB6A 3VWVA 2J9HA 3KXOA 3P2AA 2R0CA 4AKHA 1EP7A 3GHAA 4EL1A 1NW2A 3BJ5A 3LXTA 1TK5B 3UBKA 2HLSA 3U5RE 2C80A 1GLPA 3BOAA 3LWAA 4EVMA 2EFHA 2WS2A 1XWBA 2HSNB 1XCCA 4Q5FA 2PVQA 1EWXA 2AV4A 2LNTA 5IMAA 1WOUA 3CSJA 3UARA 3A5WA 1ACVA 1RW1A 4FH8A 2QGVA 2NBSA 2K9FA 4LL4B 4G0KA 1YY7A 2JSYA 2MMAA 3ZITA 1XIYA 1HQOA 3KZQA 1SK0A 2GDRA 2VKZG 3TRXA 3K8NA 5A34A 2IJYA 1XVWA 4PNGA 4MNNA 2V1MA 2HE3A 3WT2A 3IK9A 2VL3A 2VCVA 5H5SA 4GSTA 3EWLA 4O5RA 1X0RA 2CVKA 5ECRB 4FYUA 1OKTA 1F2EA 5ECIB 4EKZA 5CRHA 2PUKC 1TU8A 2OBIA 1V98A 2B1KA 3D6IA 3P8WA 4O5QA 2IPAA 4K9ZA 3GN3A 2VUPA 1ZZYA 4A5PA 2FA8A 3UOMA 4MDCA 1SL0B 3L9UA 1MEKA 4N0ZA 4XTSA 4EE0A 3UVTA 3F3RA 1Q98A 3VLNA 1R4WA 2VIMA 4KCEA 1ZYNA 1F9MA 1O8XA 3KM6A 2P5QA 4G9HA 5ECNB 2R5GA 2FCHA 3D5JA 5J9BA 2IMEA 3HJOA 4IP6A 1A8YA 2NPBA 4MZWA 3M1GA 2WW3A 5GZZB 3HHVA 4TN8A 2H75A 5H5RA 1M9BA 1RQMA 3F4SA 1QK8A 1M0UA 3EPTA 5HFIA 5JCWA 5IMFA 1XPVA 1K0AA 1GUHA 3ZVJD 4NPBA 3LG6A 3QAGA 2GQMA 3ED3A 2LV3A 1ZYQB 3R3EA 2R0PA 1HD2A 4TXOB 1WP0A 3GMFA 1VF2A 4I5QA 1OAZA 1TI3A 4O5UA 1QUWA 1WWJA 4MH3A 1O8WA 5BRTA 5E4WA 2VL2A 4TVEA 2H1LA 3I43A 3HMJG 3ZREA 4OO5A 1M2DA 3IHQA 2RM5A 1THOA 4BL7A 4DSSB 2MBSA 4N0VA 2YWIA 4WBJA 4GRFA 4G0IA 1TK0B 3I6AA 3QR6A 2OE0A 2WW0A 5JCUA 4K7IA 2DJ1A 1PL2A 3LXZA 3BCKA 2DJKA 4GSNA 4DEJA 1B4QA 3RHCA 3S9FA 1VF4A 3CHXC 2C4JA 5IM9A 2VO4A 3NZNA 3KTLA 2A2PA 3W8SA 3EURA 4F9ZA 3ZVJA 2PBJA 1XW9A 5F05A 1N2AA 1PKZA 3G7JA 2IFQA 1BQ7A 3MSZA 4BPYA 2ES7A 1FHEA 1TDIA 2E0QA 1THXA 3IAM2 5CP1A 1LU4A 1A8LA 5IOXA 4BWSA 3IXRA 3W6GA 3C8EA 5KN2A 1KTEA 4Z7XA 1T00A 3GUSA 2WB9A 2GGTA 1S3RA 4HSCX 3HVVA 3QAWA 5BMUB 5CO3A 4MF6A 3GX0A 2HSHA 3RAZA 2L4CA 5IIZA 4HOJA 4IN0A 3RPPA 1FOHA 2MYGA 2HSNA 3KMNA 3ZFBA 3R2QA 3HD5A 4F03A 4MCUA 5CREA 3BD2A 5GSTA 1ZYEA 3HXSA 4OWYA 2V41A 4IJIA 1W4VA 2LUSA 4WR4A 2IMIA 3H1NA 4YAVA 1GTBA 3MYDA 2GQLA 4JE1A 3A5IA 1ERUA 5ENUA 5G1LA 1EZKA 2VCTA 1FG4A 2OKAA 4Q5QA 1EOGA 3VK9A 1T8EB 2DJ0A 4RI6A 3UJ1A 1B8XA 4MA9A 1SKSB 2TRCP 4OFNA 2H1GA 1O73A 2I9HA 2OE3A 2C0FA 1G7EA 4JEDA 1GTUA 1J9BA 1DBYA 2ZNMA 1M2BA 4TOPA 1NM3A 4YKFA 2H0HA 2XHFA 3V1WA 3TDGA 2YZUA 5D96A 2J23A 1URMA 1F3BA 1PMTA 2LJAA 3A3TA 2QA1A 2JZSA 4J57E 1U87A 1W89A 2EFCA 2LRNA 5HR2A 2GZPA 1OC3A 5DCHA 4Z2TA 2H66A 1AQWA 3E9JB 2EFEA 3P7XA 1EV9A 2RM6A 2LTKA 2WZ9A 3PINA 1NHOA 2I4AA 1GRXA 5CYYA 2OA7A 3WYWA 4GXZA 5J4UA 1A24A 2F9SA 4OO4A 3LSZA 2EIRA 1PSQA 1WIKA 1PQNA 3D4TA 4TXOA 1O7UA 1BEDA 2VD0A 1G6YA 12GSA 4OFMA 4ACSA 1K3LA 5D73A 3IA1A 2YJHA 1TOFA 2RUEA 3U6VA 3HZ8A 3UL3A 4GQCA 5FT3A 4KUNA 3CWGA 5AISA 4V2MA 3FR6A 2RIIA 4KF9A 4IJ3A 4XIHA 5J4VA 3HCZA 2K18A 1U6TA 5KN0A 4DSSA 3KGKA 4MJCA 2RUFA 2OACA 2HZEB 3VPTA 1PKWA 4GTUA 2K6VA 2R0GA 1HNAA 5IMDA 2I81A 1TK8B 1PA3A 2KP2A 1PD21 5LD0A 1Z6NA 3GKXA 2O7KA 5AIVA 5ELGA 2TRXA 3ME8A 1IYIA 3HA9A 3GNJA 5D93A 2EIQA 4HJ2A 3UVHA 1F6MC 2PWJA 2HFDA 4HQZA 2ON5A 2I3YA 1XVQA 2HYXA 2A2RA 2FWHA 3E3EA 3DEXA 2VL9A 2XBIA 3C1RA 3TRQA 4KW6A 3F8UA 3APSA 2P0GA 1UC7A 5J47A 1K0CA 2XPDA 3TKRA 3C1SA 4ZIJA 3EYTA 2WW1A 1JHBA 1TRVA 4CY8A 2GZZA 5ECMB 4EIPA 2ZUPA 1M2AA 2L6DA 5BMUA 5D9XA 1TKDB 3VWWA 1G7OA 4K0GA 1S3CA 1FAAA 5L71A 2IIYA 4K5RA 1SYRA 1EV4A 2GT5A 4MJBA 3TKSC 3GTUB 6GSWA 4XHMA 2H1DA 3F3QA 3CRUA 2F8AA 2B7JA 1EGOA 1EOHA 3DGQA 1LBKA 3FEUA 5H5QA 3TKSE 2B1LA 2B6MA 3EINA 5LNKe 3ZYWA 1AUCA 3ZFLA 3W8JA 3FRCA 3TJGA 4JU5A 2O3EA 2HSYA 2ZCTA 1G6WA 3IAS2 4XS6A 4CDOA 1TRSA 4HI7A 1GTAA 3RFRC 1GSEA 2FHEA 4HDEA 2JSZA 3TGZA 1KEBA 1EGRA 1I5GA 3PH9A 2OJLA 3KD0A 2IL3A 2N5FA 4J56E 3UMAA 2P31A 3IPZA 3SWLA 3FKFA 2C3TA 2H73A 5IO0A 2XPEA 3APQA 1Y25A 3EMPA 2AB6A 2GSTA 2CVDA 4KDUA 4MPGA 5A5KA 4OD7A 3TJJA 1OVNA 4AGSA 1GWCA 1V58A 2WVZA 3ZMKA 5DVBA 3HVSA 1U3IA 5J9CA 2DJ3A 1USBA 2Z9SA 4NXIA 2NTOA 5B6MA 5ABRA 5AGYA 5DAKB 11GSA 4L5OA 1SENA 22GSA 1B9YC 3TUEA 3I9V2 5HFGA 5FHIA 4E68A 4I8BA 2EC4A 4F82A 5JCGA 4X4JA 4EXJA 2N5BA 4IW9A 1GLQA 3ZRDA 9GSSA 2DSAA 5IQYA 3O76A 2DKHA 3BBYA 1FW1A 4EDZA 2PPTA 1YZXA 3FW2A 1Q4JA 2HZEA 3TJBA 3DRNA 3ZTLA 2YCDA 2AAWA 3ME7A 5J41A 2PN8A 5A4WA 2C1YA 1YDKA 1IYHA 3US3A 2DKIA 4G01A 4AI6A 3LORA 3TU3B 1A0RP 1YEXA 1Z5YE 4V1Ap 3KH7A 2IMDA 5GAPD 13GSA 2X4AA 2AUVA 3LEFA 1CQGA 1AC1A 4NHWA 2VCXA 4ML1A 2DIZA 1XOAA 1GUKA 3RHBA 4E8HA 1R26A 4NAXA 2CT6A 3G7YA 1YJ6A 5AIXA 5DQYA 1FB0A 5KEJA 2JZRA 3C73A 1MTCA 4K7NA 2I1UA 3L0HA 5KN1A 1ZCPA 2UV8G 6GSVA 1AAZA 1K0DA 4HJMA 4RI7A 1A2LA 4HU9A 2R6KA 2C8UA 1A2MA 3DXBA 1EEJA 2GS3A 2B7KA 5C04A 1Z9HA 1OYJA 1ERWA 3A2VA 2FWEA 1TRWA 3O3TA 2WZSA 4WBRD 1F3AA 1VRSD 2LQQA 2RLIA 1PN0A 4K7OA 3EMXA 4KSMA 4PI2C 4O32A 3GTUA 3DD3A 1HNBA 1GH2A 3MDKA 1XFLA 1ZL9A 4N10A 1TXXA 4NHZA 2CV4A 5ECOB 1M3IA 3MWHA 4XS4B 2GZYA 4HS1A 3TB2A 3DKSA 1SK2A 2X8CA 3TKSA 3GKKA 4Z2RA 1AQVA 3QPMA 2YNXA 3KJYA 2VD1A 4KX4A 5GAND 4BIKA 4KDYA 2MZCA 5G1KA 4TR3A 4Q5NA 4POLA 1OC9B 1XWGA 1BJXA 3MNGA 4ZB9A 3J7Yk 4YQUA 4BA7A 4O7HA 3M8NA 2PU9C 4AKGA 1ZMAA 1GSDA 2B5YA 2LQOA 2MBTA 2KOKA 2LSTA 3SBCA 5A5HB 1AIUA 4ZXGA 19GSA 3QDNA 3GFKA 3LYPA 1N25A 3L4NA 2BTOT 3ERWA 1BX9A 5AN1A 3HJMA 1SK1A 4ZBBA 4JR4A 1V2AA 1PL1A 1YVLA 1WPIA 4KE3A 4KAEA 5ECSA 4D73B 5EVOA 2H6ZA 4Z2UA 4PURA 1X5DA 2HQTA 4X0XA 1LJRA 3E0UA 1A2JA 5IO2A 1GTIA 6GSUA 2QC7A 2CVBA 1PFOA 2EIOA 4DVCA 6GSSA 4XCSA 1J0FA 3GSSA 2LRCA 5IOWA 1Z7PA 1GSYA 3FMWA 5ECKB 3UAPA 1HYUA 2K8VA 1QMVA 5DAKA 4MPFA 1X9MB 1KBNA 4IHUA 5D9VA 4WETA 2HT9A 2IWTA 1GNWA 2D2ZA 4X1UA 5DCGA 4PQHA 1T4YA 5INYA 1S4BP 1ZOFA 4KSOA 4K1FA 2DJJA 4AJ7A 1SKRB 2H72A 4EUYA 3HJPA 3CSIA 4RQRA 4ZB7A 2C3QA 4WF4A 1V9WA 4ICYA 3GYKA 2LJKA 2GSRA 2AYTA 2HRKB 3L9SA 2B5XA 1B4PA 3F4RA 4F0BA 2WFCA 2OT3A 5F06A 5EPFA 5C00A 3CSHA 4K0NA 1SVMA 4TRXA 2PGTA 5ID2B 4PX1A 1QGVA 1U3AA 3GRXA 2YV9A 4JR6A 1I1IP 5KN3A 4ZL8A 1FVJA 3LQ7A 1U88A 5KOWA 3I69A 5ECQB 4IELA 5JWOB 2HRFA 1BAYA 3H79A 2A2SA 1SKWB 4ZL7A 14GSA 3GIXA 1PRXA 2F51A 1CQHA 1SL1B 4PQIA 1XXUA 4POKA 1OE8A 2ON7A 3ZZXA 4LA1A 2V6KA 1PN9A 3IK7A 4TW5A 3UIWA 4JBBA 5B8BA 3A2XA 4J2FA 2JACA 4TR4A 4MF7A 2YV7A 3VI5A 1TP9A 1YF0A 5CNWA 1ML6A 2M46A 3DYRA 3L9VA 4ECJA 1Z6MA 1TJDA 4OCEA 1SJIA 2X64A 3HZ4A 2R2JA 4LL1B 4QL7A 2V6OA 5F07A 3FY7A 4BWQA 2GTUA 3RPNA 2CQ9A 4MJAA 2DLXA 4XS4A 4MK3A 2GQKA 1R7HA 4MJEA 1M7TA 2X8HA 1SD8A 1GULA 2WCIA 3DVWA 3VWXA 2BJXA 2YPMA 5J3RA 5ECPB 6GSYA 4IVFA 4K8MA 3HKRA 1MDJA 1DUGA 2WVYA 5DJLA 2NVLA 1OC9A 2O8VB 5B6NA 1VF1A 3D21A 3QFBC 4GSSA 2VL2C 3D4MA 2DJ2A 4V2LA 1F37A 1EP8A 2CX4A 2CA8A 1X9WB 3DVXA 3EVIA 5A5HA 1E2YA 1WE0A 1RK4A 3TRPA 3EU3A 1AXDA 1WMJA 7GSSA 5F0GA 3ZIVA 1X5CA 2JU5A 4AKIA 3EC3A 2YWMA 2CZ3A 1GSQA 4FYBA 4D73A 4HEA2 3GH9A 3IDVA 1H75A 3KTBA 2YOIA 2UZ8A 1XZOA 5EY6A 3DMLA 18GSA 3G9BA
chains in the Genus database with same CATH topology
4IQAA 1FOVA 4XRDA 2X99A 4CW9A 4GWRA 4QQ7A 3F9UA 3LGCA 4EC0A 3Q74A 4KB3A 3F6FA 1TTZA 1SU9A 3CRTA 3FZ4A 2XC2A 4TR0A 2V2GA 1K0MA 3N9JA 2A4HA 2H74A 3F63A 2E2GA 2OADA 5G31A 3VWUA 2FNOA 1K0OA 1SD9A 1UVZA 1A0FA 3CXGA 4PXOA 4KDXA 3GURA 3TCOA 4LLRA 3KCMA 4G10A 2FUG2 3FZ9A 2QKEA 2VLTA 3CTGA 3OR5A 1VGLA 2R37A 1XOBA 4IBPA 2HRKA 2M80A 3FK8A 5IMCA 1Z7RA 1MDKA 4CHSA 5ECLB 1ILOA 4QL9A 1GSSA 4IKHA 2FY6A 4RQXA 4I6XA 5D9TA 2H70A 4H86A 4HQSA 1DE2A 4MP4A 1TW9A 1Z3EA 10GSA 5JWQB 1NHYA 4ZB6A 3DWVA 2YP6A 2H19A 5ID2A 3QFAC 1UN2A 1TU7A 2LKUA 4XS1A 2LRTA 4KH7A 3WGDA 1JLVA 3QOUA 3F6DA 5JWRB 4EO3A 3KIJA 4GLTA 1SVOA 4Q5RA 4YAPA 4ZB8A 4PQ1A 3J7Yb 2IMFA 3IE3A 3RDWA 5E59A 3VI7A 3TOTA 3AY8A 2PMTA 3IV4A 4I97A 3IC8A 2L4QA 4GQFA 2A4VA 2C0GA 4FO5A 5B7CA 1M9AA 4ECCA 2H0GA 3GKMA 3HYPA 1YKCA 2KHPA 2L57A 2JADA 4EDYA 3MAKA 2HI7A 2GT6A 4N11A 1AW9A 1X9SB 2WULA 4HU7A 2DMLA 1MD3A 3LYKA 1SYXA 3LFLA 2O89A 1O6JA 1Y6EA 3GSTA 3UBLA 2X8GA 1SL2B 5A4VA 2QA2A 4TXVA 4RUVA 3C7MA 4L5LA 1ABAA 2QSIA 4P3YB 1PGTA 3FR3A 3KMOA 5IMVA 1BG5A 5G5EA 2AJQB 3KP8A 4DSQA 4K2XA 3VURA 2LS5A 3EE2A 1C72A 2E2MA 5A1NB 4GCIA 2O85A 5B8AA 3L78A 1XWAA 3IOSA 1NSWA 4L0WA 3IC4A 2YANA 4PUAA 5A4UA 3PR8A 2G2QA 3TKPA 3ERFA 5DJMA 3NIVA 2YN1A 4G2EA 4HUAA 5HQPA 4IP1A 4MH2A 3QCPA 2YWOA 5EL8A 2L59A 4ML6A 4OFTA 4TR1B 4NV5A 2DBCA 2PVOC 4V2NA 2KUCA 3D22A 2L5OA 1DSBA 1JFUA 4K6XA 2TIRA 3M9JA 1QXHA 4L8EA 2VLVA 2PERA 2H6XA 2C3NA 3NOFA 3IRAA 3FZ5A 5DBQA 2MMZA 2ALBA 2VOCA 1BG1A 4I2UA 4EIQA 3C71A 2HSMB 2LEGA 4PGTA 3GKNA 4LMWA 3HVXA 2HRAA 1N8JA 4V1Ag 1R5PA 3Q6OA 4IQ1A 4PTSA 3Q18A 4MZBA 4OMVA 3GX8A 3HY2A 3F4TA 1M99A 3IBHA 3TKQA 1KNGA 4WF5A 2WJUA 3FZAA 5FWGA 3GL3A 1K3YA 4YH2A 3IHGA 4PUFC 4QMKA 3CBUA 5COHA 1YQ1A 3DIEA 4G0LA 2FWGA 1XWKA 2VM1A 3VPQA 1T7PB 1T1VA 1QQ2A 5CRDA 4BVXB 1BF5A 3MIXA 2YWNA 4FIWA 2H76A 5IPHA 4KNDA 4L0UA 1ZGNA 1Y1UA 2OE1A 2HRNA 1SVLA 1PX7A 8GSSA 5CRGA 1EEMA 1K0NA 1JLWA 5IPGA 2DMMA 1SJZA 3WT1A 1AQXA 3ZMLA 1XBSA 1B48A 4LMVA 2GVPA 3PPUA 3ERGA 6GSTA 4IS0A 1E6BA 2KLXA 2M72A 5J5NA 1ZYPA 1UA5A 2YZHA 3TOUA 3KP9A 4MABA 4HZ4A 2R3XA 1I9DA 1JZDA 1T3BA 1SJ6A 1YKAA 2YJ7A 4GDFA 2LJRA 4ZL9A 2KP1A 4WR5A 1GSUA 3IR4A 3CMIA 1HNCA 1H4OA 4BVYB 2H6YA 2H8LA 4ECIA 3EU4A 3GA4A 1T4ZA 1ERTA 4WKWA 1GL8A 4YQMA 2HZFA 4ULXA 3QAVA 5DALB 1TRUA 1O81A 1GUMA 2HXKA 3RBTA 5LCZA 2V32A 4K2DA 5HR3A 2E7PA 5D9WA 5DQSA 2VM2A 4MLYA 2CX3A 4N30A 2AHEA 3M9KA 1X5EA 4AJ6A 4N3ZA 5ELAA 4ECBA 1V57A 4OCFA 2WDUA 2VCQA 1QFNA 1K3OA 4F0CA 4WEYA 17GSA 4POBA 3LJRA 4ZBDA 4F2IA 5A1NA 1S3AA 4CY6A 4AJ8A 3ZLPA 2VLUA 3H93A 3ZIJA 3KH9A 1BYEA 2EFDA 5J4YA 1ON4A 5F8BA 2C0EA 5A34B 2DIYA 3QD9A 1OKDA 1JZRA 1OE7A 4TR1A 2IN3A 1JZOA 5G5FA 3FHKA 1YEPA 2VCZA 1YF1A 2BMXA 4EF0A 2O87A 5G30A 2XBQA 5ECHB 1O85A 1V40A 4E8EA 2REMA 4ID0A 2CAQA 4USSA 1GP1A 4X43A 1XW6A 2F3MA 5HFKA 2NDOA 1DE1A 3A2WA 1ST9A 1MD4A 2X49A 3O6TA 1GSFA 2K8SA 2HSMA 2MMOA 3UEMA 3QMXA 2IMKA 1XW5A 2FLSA 5DDLA 5HR1A 3ZL5A 2C0DA 4HZ2A 1OC8A 3H8QA 5CAXA 4FYCA 3F0IA 2WRTA 2N5AA 3P90A 1MDIA 2H71A 2FWFA 2R4VA 3D0ZA 4FQUA 3WD6A 2GSSA 2F8FA 4NV2A 3HDCA 4ILFA 4NWYA 1R5AA 3N5OA 2VAFA 3BCIA 3M0FA 1S3DA 1FVKA 2H01A 4PNFA 1K0BA 4BVXA 3GH6A 2P5RA 3JCML 2VCWA 4WXTA 1XWCA 1GNEA 3G7IA 4IGJA 4JRRA 1TI1A 3WGEA 2WGRA 2L5LA 2H1AA 2FA4A 4ZILA 4KCAA 3CTFA 1G0TA 2GSQA 5HR0A 3WGXA 2OBKA 2CAIA 1JZWA 2L6CA 4W66A 2MMNA 4BL7B 2LNSA 2CZ2A 4POMA 3LW9A 3PGTA 16GSA 3VFIA 4GF0A 2JZTA 5IMZA 4MF5A 5CRWA 2JL4A 4DSRA 3TJFA 1ERVA 4I2TA 4TKYA 5D8IA 3APOA 6GSXA 5G2ZA 2B5EA 4G19A 2H0IA 3M3MA 1B9XC 3GV1A 4ZBAA 5KOXA 4MMMA 4MZCA 4YKGA 4AF2A 1WRYA 1A23A 4KGIA 4JZQA 1J08A 2FGXA 1WJKA 3H4KA 1PX6A 4O92A 4BVYA 4NMUA 2G0FA 3CYNA 2DC5A 2IFQB 3KEBA 1TXUA 2GLRA 5J40A 1VF3A 5GSSA 1FO5A 3Q19A 2O5VA 4AKXB 2FD3A 2H1BA 3GL5A 3ISOA 2H30A 4KA0A 3FYGA 4ISDA 4YQVA 20GSA 4XRAA 4K5SA 2B3SA 5DALA 3FR9A 3TJKA 2HNLA 1FB6A 3VWVA 2J9HA 3KXOA 3P2AA 2R0CA 4AKHA 1EP7A 3GHAA 4EL1A 1NW2A 3BJ5A 3LXTA 1TK5B 3UBKA 2HLSA 3U5RE 2C80A 1GLPA 3BOAA 3LWAA 4EVMA 2EFHA 2WS2A 1XWBA 2HSNB 1XCCA 4Q5FA 2PVQA 1EWXA 2AV4A 2LNTA 5IMAA 1WOUA 3CSJA 3UARA 3A5WA 1ACVA 1RW1A 4FH8A 2QGVA 2NBSA 2K9FA 4LL4B 4G0KA 1YY7A 2JSYA 2MMAA 3ZITA 1XIYA 1HQOA 3KZQA 1SK0A 2GDRA 2VKZG 3TRXA 3K8NA 5A34A 2IJYA 1XVWA 4PNGA 4MNNA 2V1MA 2HE3A 3WT2A 3IK9A 2VL3A 2VCVA 5H5SA 4GSTA 3EWLA 4O5RA 1X0RA 2CVKA 5ECRB 4FYUA 1OKTA 1F2EA 5ECIB 4EKZA 5CRHA 2PUKC 1TU8A 2OBIA 1V98A 2B1KA 3D6IA 3P8WA 4O5QA 2IPAA 4K9ZA 3GN3A 2VUPA 1ZZYA 4A5PA 2FA8A 3UOMA 4MDCA 1SL0B 3L9UA 1MEKA 4N0ZA 4XTSA 4EE0A 3UVTA 3F3RA 1Q98A 3VLNA 1R4WA 2VIMA 4KCEA 1ZYNA 1F9MA 1O8XA 3KM6A 2P5QA 4G9HA 5ECNB 2R5GA 2FCHA 3D5JA 5J9BA 2IMEA 3HJOA 4IP6A 1A8YA 2NPBA 4MZWA 3M1GA 5GZZB 3HHVA 4TN8A 2H75A 5H5RA 1M9BA 1RQMA 3F4SA 1QK8A 1M0UA 3EPTA 5HFIA 5JCWA 5IMFA 1XPVA 1K0AA 1GUHA 3ZVJD 4NPBA 3LG6A 3QAGA 2GQMA 3ED3A 2LV3A 1ZYQB 3R3EA 2R0PA 1HD2A 4TXOB 1WP0A 3GMFA 1VF2A 4I5QA 1OAZA 1TI3A 4O5UA 1QUWA 1WWJA 4MH3A 1O8WA 5BRTA 5E4WA 2VL2A 4TVEA 2H1LA 3I43A 3HMJG 3ZREA 4OO5A 1M2DA 3IHQA 2RM5A 1THOA 4BL7A 4DSSB 2MBSA 4N0VA 2YWIA 4WBJA 4GRFA 4G0IA 1TK0B 3I6AA 3QR6A 2OE0A 5JCUA 4K7IA 2DJ1A 1PL2A 3LXZA 3BCKA 2DJKA 4GSNA 4DEJA 1B4QA 3RHCA 3S9FA 1VF4A 2C4JA 5IM9A 2VO4A 3NZNA 3KTLA 2A2PA 3W8SA 3EURA 4F9ZA 3ZVJA 2PBJA 1XW9A 5F05A 1N2AA 1PKZA 3G7JA 2IFQA 1BQ7A 3MSZA 4BPYA 2ES7A 1FHEA 1TDIA 2E0QA 1THXA 3IAM2 5CP1A 1LU4A 1A8LA 5IOXA 4BWSA 3IXRA 3W6GA 3C8EA 5KN2A 1KTEA 4Z7XA 1T00A 3GUSA 2WB9A 2GGTA 3HVVA 3QAWA 5BMUB 5CO3A 4MF6A 3GX0A 2HSHA 3RAZA 2L4CA 5IIZA 4HOJA 4IN0A 3RPPA 1FOHA 2MYGA 2HSNA 3KMNA 3ZFBA 3R2QA 3HD5A 4F03A 4MCUA 5CREA 3BD2A 5GSTA 1ZYEA 3HXSA 4OWYA 2V41A 4IJIA 1W4VA 2LUSA 4WR4A 2IMIA 3H1NA 4YAVA 1GTBA 3MYDA 2GQLA 4JE1A 3A5IA 1ERUA 5ENUA 5G1LA 1EZKA 2VCTA 1FG4A 2OKAA 4Q5QA 1EOGA 3VK9A 1T8EB 2DJ0A 4RI6A 3UJ1A 1B8XA 4MA9A 1SKSB 2TRCP 4OFNA 2H1GA 1O73A 2I9HA 2OE3A 2C0FA 1G7EA 4JEDA 1GTUA 1J9BA 1DBYA 2ZNMA 1M2BA 4TOPA 1NM3A 4YKFA 2H0HA 2XHFA 3V1WA 3TDGA 2YZUA 5D96A 2J23A 1URMA 1F3BA 1PMTA 2LJAA 3A3TA 2QA1A 2JZSA 4J57E 1U87A 1W89A 2EFCA 2LRNA 5HR2A 2GZPA 1OC3A 5DCHA 4Z2TA 2H66A 1AQWA 3E9JB 2EFEA 3P7XA 1EV9A 2RM6A 2LTKA 2WZ9A 3PINA 1NHOA 2I4AA 1GRXA 5CYYA 2OA7A 3WYWA 4GXZA 5J4UA 1A24A 2F9SA 4OO4A 3LSZA 2EIRA 1PSQA 1WIKA 1PQNA 3D4TA 4TXOA 1O7UA 1BEDA 2VD0A 1G6YA 12GSA 4OFMA 4ACSA 1K3LA 5D73A 3IA1A 2YJHA 1TOFA 2RUEA 3U6VA 3HZ8A 3UL3A 4GQCA 5FT3A 4KUNA 3CWGA 5AISA 4V2MA 3FR6A 2RIIA 4KF9A 4IJ3A 4XIHA 5J4VA 3HCZA 2K18A 1U6TA 5KN0A 4DSSA 3KGKA 4MJCA 2RUFA 2OACA 2HZEB 3VPTA 1PKWA 4GTUA 2K6VA 2R0GA 1HNAA 5IMDA 2I81A 1TK8B 1PA3A 2KP2A 1PD21 5LD0A 1Z6NA 3GKXA 2O7KA 5AIVA 5ELGA 2TRXA 3ME8A 1IYIA 3HA9A 3GNJA 5D93A 2EIQA 4HJ2A 3UVHA 1F6MC 2PWJA 2HFDA 4HQZA 2ON5A 2I3YA 1XVQA 2HYXA 2A2RA 2FWHA 3E3EA 3DEXA 2VL9A 2XBIA 3C1RA 3TRQA 4KW6A 3F8UA 3APSA 2P0GA 1UC7A 5J47A 1K0CA 2XPDA 3TKRA 3C1SA 4ZIJA 3EYTA 1JHBA 1TRVA 4CY8A 2GZZA 5ECMB 4EIPA 2ZUPA 1M2AA 2L6DA 5BMUA 5D9XA 1TKDB 3VWWA 1G7OA 4K0GA 1S3CA 1FAAA 5L71A 2IIYA 4K5RA 1SYRA 1EV4A 2GT5A 4MJBA 3TKSC 3GTUB 6GSWA 4XHMA 2H1DA 3F3QA 3CRUA 2F8AA 2B7JA 1EGOA 1EOHA 3DGQA 1LBKA 3FEUA 5H5QA 3TKSE 2B1LA 2B6MA 3EINA 5LNKe 3ZYWA 1AUCA 3ZFLA 3W8JA 3FRCA 3TJGA 4JU5A 2HSYA 2ZCTA 1G6WA 3IAS2 4XS6A 4CDOA 1TRSA 4HI7A 1GTAA 1GSEA 2FHEA 4HDEA 2JSZA 3TGZA 1KEBA 1EGRA 1I5GA 3PH9A 2OJLA 3KD0A 2IL3A 2N5FA 4J56E 3UMAA 2P31A 3IPZA 3SWLA 3FKFA 2C3TA 2H73A 5IO0A 2XPEA 3APQA 1Y25A 3EMPA 2AB6A 2GSTA 2CVDA 4KDUA 4MPGA 5A5KA 4OD7A 3TJJA 1OVNA 4AGSA 1GWCA 1V58A 3ZMKA 5DVBA 3HVSA 1U3IA 5J9CA 2DJ3A 1USBA 2Z9SA 4NXIA 2NTOA 5B6MA 5ABRA 5AGYA 5DAKB 11GSA 4L5OA 1SENA 22GSA 1B9YC 3TUEA 3I9V2 5HFGA 5FHIA 4E68A 4I8BA 2EC4A 4F82A 5JCGA 4X4JA 4EXJA 2N5BA 4IW9A 1GLQA 3ZRDA 9GSSA 2DSAA 5IQYA 3O76A 2DKHA 3BBYA 1FW1A 4EDZA 2PPTA 1YZXA 3FW2A 1Q4JA 2HZEA 3TJBA 3DRNA 3ZTLA 2YCDA 2AAWA 3ME7A 5J41A 2PN8A 5A4WA 2C1YA 1YDKA 1IYHA 3US3A 2DKIA 4G01A 4AI6A 3LORA 3TU3B 1A0RP 1YEXA 1Z5YE 4V1Ap 3KH7A 2IMDA 5GAPD 13GSA 2X4AA 2AUVA 3LEFA 1CQGA 1AC1A 4NHWA 2VCXA 4ML1A 2DIZA 1XOAA 1GUKA 3RHBA 4E8HA 1R26A 4NAXA 2CT6A 3G7YA 1YJ6A 5AIXA 5DQYA 1FB0A 5KEJA 2JZRA 3C73A 1MTCA 4K7NA 2I1UA 3L0HA 5KN1A 1ZCPA 2UV8G 6GSVA 1AAZA 1K0DA 4HJMA 4RI7A 1A2LA 4HU9A 2R6KA 2C8UA 1A2MA 3DXBA 1EEJA 2GS3A 2B7KA 5C04A 1Z9HA 1OYJA 1ERWA 3A2VA 2FWEA 1TRWA 3O3TA 4WBRD 1F3AA 1VRSD 2LQQA 2RLIA 1PN0A 4K7OA 3EMXA 4KSMA 4O32A 3GTUA 3DD3A 1HNBA 1GH2A 3MDKA 1XFLA 1ZL9A 4N10A 1TXXA 4NHZA 2CV4A 5ECOB 3MWHA 4XS4B 2GZYA 4HS1A 3TB2A 3DKSA 1SK2A 2X8CA 3TKSA 3GKKA 4Z2RA 1AQVA 3QPMA 2YNXA 3KJYA 2VD1A 4KX4A 5GAND 4KDYA 2MZCA 5G1KA 4TR3A 4Q5NA 4POLA 1OC9B 1XWGA 1BJXA 3MNGA 4ZB9A 3J7Yk 4YQUA 4BA7A 4O7HA 3M8NA 2PU9C 4AKGA 1ZMAA 1GSDA 2B5YA 2LQOA 2MBTA 2KOKA 2LSTA 3SBCA 5A5HB 1AIUA 4ZXGA 19GSA 3QDNA 3GFKA 3LYPA 1N25A 3L4NA 2BTOT 3ERWA 1BX9A 5AN1A 3HJMA 1SK1A 4ZBBA 4JR4A 1V2AA 1PL1A 1YVLA 1WPIA 4KE3A 4KAEA 5ECSA 4D73B 5EVOA 2H6ZA 4Z2UA 4PURA 1X5DA 2HQTA 4X0XA 1LJRA 3E0UA 1A2JA 5IO2A 1GTIA 6GSUA 2QC7A 2CVBA 2EIOA 4DVCA 6GSSA 4XCSA 1J0FA 3GSSA 2LRCA 5IOWA 1Z7PA 1GSYA 3FMWA 5ECKB 3UAPA 1HYUA 2K8VA 1QMVA 5DAKA 4MPFA 1X9MB 1KBNA 4IHUA 5D9VA 4WETA 2HT9A 2IWTA 1GNWA 2D2ZA 4X1UA 5DCGA 4PQHA 1T4YA 5INYA 1ZOFA 4KSOA 4K1FA 2DJJA 4AJ7A 1SKRB 2H72A 4EUYA 3HJPA 3CSIA 4RQRA 4ZB7A 2C3QA 4WF4A 1V9WA 4ICYA 3GYKA 2LJKA 2GSRA 2AYTA 2HRKB 3L9SA 2B5XA 1B4PA 3F4RA 4F0BA 2WFCA 2OT3A 5F06A 5EPFA 5C00A 3CSHA 4K0NA 1SVMA 4TRXA 2PGTA 5ID2B 4PX1A 1QGVA 1U3AA 3GRXA 2YV9A 4JR6A 5KN3A 4ZL8A 1FVJA 3LQ7A 1U88A 5KOWA 3I69A 5ECQB 4IELA 5JWOB 2HRFA 1BAYA 3H79A 2A2SA 1SKWB 4ZL7A 14GSA 3GIXA 1PRXA 2F51A 1CQHA 1SL1B 4PQIA 1XXUA 4POKA 1OE8A 2ON7A 3ZZXA 4LA1A 2V6KA 1PN9A 3IK7A 4TW5A 3UIWA 4JBBA 5B8BA 3A2XA 4J2FA 2JACA 4TR4A 4MF7A 2YV7A 3VI5A 1TP9A 1YF0A 5CNWA 1ML6A 2M46A 3DYRA 3L9VA 4ECJA 1Z6MA 1TJDA 4OCEA 1SJIA 2X64A 3HZ4A 2R2JA 4LL1B 4QL7A 2V6OA 5F07A 3FY7A 4BWQA 2GTUA 3RPNA 2CQ9A 4MJAA 2DLXA 4XS4A 4MK3A 2GQKA 1R7HA 4MJEA 1M7TA 2X8HA 1SD8A 1GULA 2WCIA 3DVWA 3VWXA 2BJXA 2YPMA 5J3RA 5ECPB 6GSYA 4IVFA 4K8MA 3HKRA 1MDJA 1DUGA 5DJLA 2NVLA 1OC9A 2O8VB 5B6NA 1VF1A 3D21A 3QFBC 4GSSA 2VL2C 3D4MA 2DJ2A 4V2LA 1F37A 1EP8A 2CX4A 2CA8A 1X9WB 3DVXA 3EVIA 5A5HA 1E2YA 1WE0A 1RK4A 3TRPA 3EU3A 1AXDA 1WMJA 7GSSA 5F0GA 3ZIVA 1X5CA 2JU5A 4AKIA 3EC3A 2YWMA 2CZ3A 1GSQA 4FYBA 4D73A 4HEA2 3GH9A 3IDVA 1H75A 3KTBA 2YOIA 2UZ8A 1XZOA 5EY6A 3DMLA 18GSA 3G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW1 A;  4EDZ A;  1FHE A;  1TDI A;  4IQA A;  1BYE A;  1Q4J A;  3C8E A;  5F8B A;  2YCD A;  2AAW A;  4QQ7 A;  5J41 A;  5A4W A;  3GUS A;  1YDK A;  2WB9 A;  1IYH A;  4EC0 A;  3Q74 A;  3F6F A;  3CRT A;  1JZR A;  3QAW A;  1OE7 A;  4MF6 A;  1K0M A;  5G5F A;  3GX0 A;  3N9J A;  3F63 A;  2VCZ A;  2OAD A;  4HOJ A;  13GS A;  2FNO A;  1K0O A;  3KMN A;  3ZFB A;  3R2Q A;  5ECH B;  1A0F A;  4F03 A;  4PXO A;  4NHW A;  5GST A;  1V40 A;  4KDX A;  4E8E A;  3GUR A;  2VCX A;  4ID0 A;  2CAQ A;  4USS A;  4G10 A;  1XW6 A;  1GUK A;  2F3M A;  5HFK A;  4E8H A;  4NAX A;  4IJI A;  4WR4 A;  1MD4 A;  1YJ6 A;  2IMI A;  3H1N A;  5AIX A;  1GSF A;  4YAV A;  4IBP A;  2HRK A;  1GTB A;  2HSM A;  5KEJ A;  4CHS A;  5ECL B;  1GSS A;  4IKH A;  1MTC A;  2VCT A;  3L0H A;  4Q5Q A;  2IMK A;  5D9T A;  1EOG A;  4MP4 A;  1TW9 A;  3VK9 A;  1XW5 A;  4RI6 A;  5DDL A;  10GS A;  6GSV A;  1B8X A;  1NHY A;  4OFN A;  4ZB6 A;  1K0D A;  4HZ2 A;  4RI7 A;  2R6K A;  2C8U A;  2WRT A;  3P90 A;  1TU7 A;  1Z9H A;  1OYJ A;  4JED A;  4FQU A;  2R4V A;  3D0Z A;  3WD6 A;  4KH7 A;  1GTU A;  2GSS A;  1JLV A;  2F8F A;  3O3T A;  3F6D A;  1F3A A;  4GLT A;  4Q5R A;  4YAP A;  4ZB8 A;  1R5A A;  4TOP A;  3N5O A;  4KSM A;  3GTU A;  3DD3 A;  1HNB A;  3M0F A;  3MDK A;  3IE3 A;  1ZL9 A;  4PNF A;  1K0B A;  4BVX A;  3GH6 A;  1F3B A;  3VI7 A;  1PMT A;  4NHZ A;  5ECO B;  2VCW A;  3AY8 A;  3TOT A;  2PMT A;  1U87 A;  1GNE A;  3G7I A;  4I97 A;  4IGJ A;  3IC8 A;  1AQW A;  5B7C A;  1M9A A;  4ECC A;  1AQV A;  3KJY A;  2GSQ A;  1EV9 A;  2VD1 A;  4KX4 A;  2CAI A;  1YKC A;  4KDY A;  4BL7 B;  4EDY A;  4Q5N A;  3MAK A;  2OA7 A;  2CZ2 A;  1AW9 A;  1XWG A;  3PGT A;  3WYW A;  16GS A;  5J4U A;  4GF0 A;  4ZB9 A;  4MF5 A;  3LSZ A;  4YQU A;  2JL4 A;  1MD3 A;  3LYK A;  3M8N A;  4O7H A;  3LFL A;  1GSD A;  1Y6E A;  3GST A;  6GSX A;  4ZXG A;  19GS A;  2VD0 A;  4G19 A;  1G6Y A;  3UBL A;  3M3M A;  3LYP A;  12GS A;  4OFM A;  4ACS A;  4ZBA A;  5A4V A;  1K3L A;  4KGI A;  4L5L A;  5D73 A;  1PGT A;  3FR3 A;  1BX9 A;  4JZQ A;  3HJM A;  5AN1 A;  4ZBB A;  3U6V A;  3KMO A;  1V2A A;  1PL1 A;  1BG5 A;  1PX6 A;  4O92 A;  5G5E A;  4BVY A;  4KE3 A;  5FT3 A;  4KAE A;  5ECS A;  3VUR A;  5EVO A;  2DC5 A;  3EE2 A;  1C72 A;  2GLR A;  1VF3 A;  4PUR A;  5GSS A;  2HQT A;  3Q19 A;  1LJR A;  5AIS A;  4GCI A;  3FR6 A;  4KF9 A;  3ISO A;  1GTI A;  6GSU A;  3FYG A;  4ISD A;  4YQV A;  4PUA A;  20GS A;  3PR8 A;  5A4U A;  6GSS A;  2OAC A;  3ERF A;  5DJM A;  3GSS A;  3VPT A;  3NIV A;  5DAL A;  3FR9 A;  1PKW A;  2HNL A;  4GTU A;  1GSY A;  2J9H A;  5ECK B;  3KXO A;  1HNA A;  3UAP A;  1PA3 A;  1PD2 1;  5EL8 A;  5LD0 A;  4OFT A;  5DAK A;  3LXT A;  3UBK A;  5AIV A;  4MPF A;  1KBN A;  5ELG A;  1IYI A;  5D9V A;  2C80 A;  1GLP A;  1GNW A;  2D2Z A;  5DCG A;  4HJ2 A;  3UVH A;  4PQH A;  2WS2 A;  2HSN B;  4Q5F A;  2ON5 A;  2PVQ A;  4L8E A;  2A2R A;  2PER A;  3CSJ A;  2C3N A;  3UAR A;  3CSI A;  2C3Q A;  2GSR A;  2HRK B;  4G0K A;  1YY7 A;  1HQO A;  2HSM B;  1K0C A;  1B4P A;  4PGT A;  4F0B A;  4LMW A;  2HRA A;  2GDR A;  5F06 A;  4PNG A;  3CSH A;  4IQ1 A;  4K0N A;  5ECM B;  4PTS A;  3Q18 A;  3IK9 A;  2VCV A;  5BMU A;  4OMV A;  4GST A;  5ECR B;  1M99 A;  3IBH A;  1OKT A;  5D9X A;  1F2E A;  5ECI B;  2PGT A;  1G7O A;  4PX1 A;  2WJU A;  1TU8 A;  2YV9 A;  4K0G A;  5FWG A;  1K3Y A;  3P8W A;  4YH2 A;  3CBU A;  1YQ1 A;  4G0L A;  1EV4 A;  1XWK A;  3LQ7 A;  4MDC A;  3VPQ A;  1U88 A;  3GTU B;  3I69 A;  6GSW A;  5ECQ B;  4IEL A;  4EE0 A;  4BVX B;  3CRU A;  1BAY A;  3VLN A;  2A2S A;  1EOH A;  3DGQ A;  14GS A;  1LBK A;  1ZGN A;  3KM6 A;  4G9H A;  5ECN B;  2R5G A;  4PQI A;  3HJO A;  1OE8 A;  4MZW A;  1PX7 A;  3M1G A;  2ON7 A;  8GSS A;  1EEM A;  1K0N A;  3EIN A;  1JLW A;  1PN9 A;  2V6K A;  3IK7 A;  3ZFL A;  4JBB A;  5GZZ B;  3FRC A;  1M9B A;  1AQX A;  4J2F A;  4MF7 A;  3ZML A;  1B48 A;  2YV7 A;  3VI5 A;  4LMV A;  1M0U A;  3PPU A;  3ERG A;  1ML6 A;  5JCW A;  6GST A;  1K0A A;  1GUH A;  1E6B A;  4IS0 A;  1G6W A;  3LG6 A;  3QAG A;  5J5N A;  1UA5 A;  3TOU A;  4ECJ A;  3R3E A;  1GTA A;  4HI7 A;  4HZ4 A;  1GSE A;  2FHE A;  2X64 A;  2R3X A;  3TGZ A;  1VF2 A;  2IL3 A;  2N5F A;  5F07 A;  3FY7 A;  2LJR A;  2GTU A;  4WR5 A;  1GSU A;  3SWL A;  4MK3 A;  3IR4 A;  1HNC A;  4BVY B;  2C3T A;  4ECI A;  1GUL A;  2AB6 A;  2GST A;  3VWX A;  2CVD A;  4KDU A;  4MPG A;  5A5K A;  4YQM A;  4AGS A;  1GWC A;  5ECP B;  6GSY A;  4IVF A;  3HKR A;  4BL7 A;  1DUG A;  3ZMK A;  3QAV A;  4N0V A;  4G0I A;  5DJL A;  5DAL B;  1U3I A;  3I6A A;  3QR6 A;  1USB A;  5JCU A;  1VF1 A;  1GUM A;  2NTO A;  4GSS A;  3RBT A;  5LCZ A;  1PL2 A;  3LXZ A;  5D9W A;  5DQS A;  2AHE A;  5AGY A;  4GSN A;  2CA8 A;  4DEJ A;  5DAK B;  11GS A;  4L5O A;  1VF4 A;  22GS A;  2C4J A;  1RK4 A;  2VO4 A;  5FHI A;  5ELA A;  4ECB A;  3KTL A;  3W8S A;  1AXD A;  7GSS A;  2PBJ A;  5F05 A;  5F0G A;  2WDU A;  4EXJ A;  2VCQ A;  1K3O A;  1N2A A;  1PKZ A;  3G7J A;  4IW9 A;  1GLQ A;  2CZ3 A;  1GSQ A;  4F0C A;  17GS A;  9GSS A;  2DSA A;  3LJR A;  5IQY A;  3O76 A;  4ZBD A;  2UZ8 A;  5EY6 A;  18GS A;  3BBY A; 
#chains in the Genus database with same CATH topology
 4IQA A;  1FOV A;  4XRD A;  2X99 A;  4CW9 A;  4GWR A;  4QQ7 A;  3F9U A;  3LGC A;  4EC0 A;  3Q74 A;  4KB3 A;  3F6F A;  1TTZ A;  1SU9 A;  3CRT A;  3FZ4 A;  2XC2 A;  4TR0 A;  2V2G A;  1K0M A;  3N9J A;  2A4H A;  2H74 A;  3F63 A;  2E2G A;  2OAD A;  5G31 A;  3VWU A;  2FNO A;  1K0O A;  1SD9 A;  1UVZ A;  1A0F A;  3CXG A;  4PXO A;  4KDX A;  3GUR A;  3TCO A;  4LLR A;  3KCM A;  4G10 A;  2FUG 2;  3FZ9 A;  2QKE A;  2VLT A;  3CTG A;  3OR5 A;  1VGL A;  2R37 A;  1XOB A;  4IBP A;  2HRK A;  2M80 A;  3FK8 A;  5IMC A;  1Z7R A;  2WW2 A;  1MDK A;  4CHS A;  5ECL B;  1ILO A;  4QL9 A;  1GSS A;  4IKH A;  2FY6 A;  4RQX A;  4I6X A;  5D9T A;  2H70 A;  4H86 A;  4HQS A;  1DE2 A;  4MP4 A;  1TW9 A;  1Z3E A;  10GS A;  5JWQ B;  1NHY A;  4ZB6 A;  3DWV A;  2YP6 A;  4FXY P;  2H19 A;  5ID2 A;  3QFA C;  1UN2 A;  1TU7 A;  2LKU A;  4XS1 A;  2LRT A;  4KH7 A;  3WGD A;  1JLV A;  3QOU A;  3F6D A;  5JWR B;  4EO3 A;  3KIJ A;  4GLT A;  2O36 A;  1SVO A;  4Q5R A;  4YAP A;  4ZB8 A;  4PQ1 A;  3J7Y b;  2IMF A;  3IE3 A;  3RDW A;  5E59 A;  3VI7 A;  3TOT A;  3AY8 A;  2PMT A;  3IV4 A;  4I97 A;  3IC8 A;  2L4Q A;  4GQF A;  2A4V A;  2C0G A;  4FO5 A;  5B7C A;  1M9A A;  4ECC A;  2H0G A;  3GKM A;  3HYP A;  1YKC A;  2KHP A;  2L57 A;  2JAD A;  4EDY A;  3MAK A;  2HI7 A;  2GT6 A;  4N11 A;  1AW9 A;  1X9S B;  2WUL A;  4HU7 A;  2DML A;  1MD3 A;  3LYK A;  1SYX A;  3LFL A;  2O89 A;  1O6J A;  1Y6E A;  3GST A;  3UBL A;  2X8G A;  1SL2 B;  5A4V A;  2QA2 A;  4TXV A;  4RUV A;  3C7M A;  4L5L A;  1ABA A;  2QSI A;  4P3Y B;  1PGT A;  3FR3 A;  3KMO A;  5IMV A;  1BG5 A;  5G5E A;  2AJQ B;  3KP8 A;  4DSQ A;  4K2X A;  3VUR A;  2LS5 A;  3EE2 A;  1C72 A;  2E2M A;  5A1N B;  4GCI A;  2O85 A;  5B8A A;  3L78 A;  1XWA A;  3IOS A;  1NSW A;  4L0W A;  3IC4 A;  2YAN A;  4PUA A;  5A4U A;  3PR8 A;  2G2Q A;  4PI0 C;  3TKP A;  3ERF A;  5DJM A;  3NIV A;  2YN1 A;  4G2E A;  4HUA A;  5HQP A;  4IP1 A;  4MH2 A;  3QCP A;  2YWO A;  5EL8 A;  2L59 A;  4ML6 A;  4OFT A;  4TR1 B;  4NV5 A;  2DBC A;  2PVO C;  4V2N A;  2KUC A;  3D22 A;  2L5O A;  1DSB A;  2WVX B;  1JFU A;  1M3J A;  4K6X A;  2TIR A;  3M9J A;  1QXH A;  4L8E A;  2VLV A;  2PER A;  2H6X A;  2C3N A;  3NOF A;  3IRA A;  3FZ5 A;  5DBQ A;  2MMZ A;  2ALB A;  2VOC A;  1BG1 A;  4I2U A;  4EIQ A;  3C71 A;  2HSM B;  2LEG A;  4PGT A;  3GKN A;  4LMW A;  3HVX A;  2HRA A;  1N8J A;  4V1A g;  1R5P A;  3Q6O A;  4IQ1 A;  4PTS A;  3Q18 A;  4MZB A;  4OMV A;  3GX8 A;  3HY2 A;  3F4T A;  1M99 A;  3RGB C;  3IBH A;  3TKQ A;  1KNG A;  4WF5 A;  2WJU A;  3FZA A;  5FWG A;  3GL3 A;  1K3Y A;  4YH2 A;  3IHG A;  4PUF C;  4QMK A;  3CBU A;  5COH A;  1YQ1 A;  3DIE A;  4G0L A;  2FWG A;  1XWK A;  2VM1 A;  3VPQ A;  1T7P B;  1T1V A;  1QQ2 A;  5CRD A;  4BVX B;  1BF5 A;  3MIX A;  2YWN A;  4FIW A;  2H76 A;  5IPH A;  4KND A;  4L0U A;  1ZGN A;  1Y1U A;  2OE1 A;  2HRN A;  1SVL A;  1PX7 A;  8GSS A;  5CRG A;  1EEM A;  1K0N A;  1JLW A;  5IPG A;  2DMM A;  1SJZ A;  3WT1 A;  1AQX A;  3ZML A;  1XBS A;  1B48 A;  4LMV A;  2GVP A;  3PPU A;  1XG8 A;  3ERG A;  6GST A;  4IS0 A;  1E6B A;  2KLX A;  2M72 A;  5J5N A;  1ZYP A;  1UA5 A;  2YZH A;  3TOU A;  3KP9 A;  4MAB A;  4HZ4 A;  2R3X A;  1I9D A;  1JZD A;  1T3B A;  1SJ6 A;  1YKA A;  2YJ7 A;  4GDF A;  2LJR A;  4ZL9 A;  2KP1 A;  4WR5 A;  1GSU A;  3IR4 A;  3CMI A;  1HNC A;  1YEW C;  1H4O A;  4BVY B;  2H6Y A;  2H8L A;  4ECI A;  3EU4 A;  3GA4 A;  1T4Z A;  1ERT A;  4WKW A;  1GL8 A;  4YQM A;  2HZF A;  4ULX A;  3QAV A;  5DAL B;  1TRU A;  4PHZ C;  1O81 A;  1GUM A;  2HXK A;  3RBT A;  5LCZ A;  2V32 A;  4K2D A;  5HR3 A;  2E7P A;  5D9W A;  5DQS A;  2VM2 A;  4MLY A;  2CX3 A;  4N30 A;  2AHE A;  3M9K A;  1X5E A;  4AJ6 A;  4N3Z A;  5ELA A;  4ECB A;  1V57 A;  4OCF A;  2WDU A;  2VCQ A;  1QFN A;  1K3O A;  4F0C A;  4WEY A;  17GS A;  4POB A;  3LJR A;  4ZBD A;  4F2I A;  5A1N A;  1S3A A;  4CY6 A;  4AJ8 A;  3ZLP A;  2VLU A;  3H93 A;  3ZIJ A;  3KH9 A;  1BYE A;  2EFD A;  5J4Y A;  1ON4 A;  5F8B A;  2C0E A;  5A34 B;  2DIY A;  3QD9 A;  1OKD A;  1JZR A;  1OE7 A;  4TR1 A;  2IN3 A;  1JZO A;  5G5F A;  3FHK A;  1YEP A;  2VCZ A;  1YF1 A;  2WVX A;  2BMX A;  4EF0 A;  2O87 A;  5G30 A;  2XBQ A;  5ECH B;  1O85 A;  1V40 A;  4E8E A;  2REM A;  4ID0 A;  2CAQ A;  4USS A;  1GP1 A;  4X43 A;  1XW6 A;  2F3M A;  5HFK A;  2NDO A;  1DE1 A;  3A2W A;  1ST9 A;  1MD4 A;  2X49 A;  3O6T A;  1GSF A;  2K8S A;  2HSM A;  2MMO A;  3UEM A;  3QMX A;  2IMK A;  1XW5 A;  2FLS A;  5DDL A;  5HR1 A;  3ZL5 A;  2C0D A;  4HZ2 A;  1OC8 A;  3H8Q A;  5CAX A;  4FYC A;  3F0I A;  2WRT A;  2N5A A;  3P90 A;  1MDI A;  2H71 A;  2FWF A;  2R4V A;  3D0Z A;  4FQU A;  3WD6 A;  2GSS A;  2F8F A;  3HVN A;  4NV2 A;  3HDC A;  4ILF A;  4NWY A;  1R5A A;  3N5O A;  2VAF A;  3BCI A;  3M0F A;  1S3D A;  1FVK A;  3CQF A;  2H01 A;  4PNF A;  1K0B A;  4BVX A;  3GH6 A;  2P5R A;  3JCM L;  2VCW A;  4WXT A;  1XWC A;  1GNE A;  3G7I A;  4IGJ A;  4JRR A;  1TI1 A;  3WGE A;  2WGR A;  2L5L A;  2H1A A;  2FA4 A;  4ZIL A;  4KCA A;  3CTF A;  1G0T A;  2GSQ A;  5HR0 A;  3WGX A;  2OBK A;  2CAI A;  1JZW A;  2L6C A;  4W66 A;  2MMN A;  4BL7 B;  2LNS A;  2CZ2 A;  4POM A;  3LW9 A;  3PGT A;  16GS A;  3VFI A;  4GF0 A;  2JZT A;  5IMZ A;  4MF5 A;  5CRW A;  2JL4 A;  4DSR A;  3TJF A;  1ERV A;  4I2T A;  4TKY A;  5D8I A;  3APO A;  6GSX A;  5G2Z A;  2B5E A;  4G19 A;  2H0I A;  3M3M A;  1B9X C;  3GV1 A;  4ZBA A;  5KOX A;  4MMM A;  4MZC A;  4YKG A;  4AF2 A;  1WRY A;  1A23 A;  4KGI A;  4JZQ A;  1J08 A;  2FGX A;  1WJK A;  3H4K A;  1PX6 A;  4O92 A;  4BVY A;  4NMU A;  2G0F A;  3CYN A;  2DC5 A;  2IFQ B;  3KEB A;  1TXU A;  2GLR A;  5J40 A;  1VF3 A;  5GSS A;  1FO5 A;  3Q19 A;  2O5V A;  4AKX B;  2FD3 A;  2H1B A;  3GL5 A;  3ISO A;  2H30 A;  4KA0 A;  3FYG A;  4ISD A;  4YQV A;  20GS A;  4XRA A;  4K5S A;  2B3S A;  5DAL A;  3FR9 A;  3TJK A;  2HNL A;  1FB6 A;  3VWV A;  2J9H A;  3KXO A;  3P2A A;  2R0C A;  4AKH A;  1EP7 A;  3GHA A;  4EL1 A;  1NW2 A;  3BJ5 A;  3LXT A;  1TK5 B;  3UBK A;  2HLS A;  3U5R E;  2C80 A;  1GLP A;  3BOA A;  3LWA A;  4EVM A;  2EFH A;  2WS2 A;  1XWB A;  2HSN B;  1XCC A;  4Q5F A;  2PVQ A;  1EWX A;  2AV4 A;  2LNT A;  5IMA A;  1WOU A;  3CSJ A;  3UAR A;  3A5W A;  1ACV A;  1RW1 A;  4FH8 A;  2QGV A;  2NBS A;  2K9F A;  4LL4 B;  4G0K A;  1YY7 A;  2JSY A;  2MMA A;  3ZIT A;  1XIY A;  1HQO A;  3KZQ A;  1SK0 A;  2GDR A;  2VKZ G;  3TRX A;  3K8N A;  5A34 A;  2IJY A;  1XVW A;  4PNG A;  4MNN A;  2V1M A;  2HE3 A;  3WT2 A;  3IK9 A;  2VL3 A;  2VCV A;  5H5S A;  4GST A;  3EWL A;  4O5R A;  1X0R A;  2CVK A;  5ECR B;  4FYU A;  1OKT A;  1F2E A;  5ECI B;  4EKZ A;  5CRH A;  2PUK C;  1TU8 A;  2OBI A;  1V98 A;  2B1K A;  3D6I A;  3P8W A;  4O5Q A;  2IPA A;  4K9Z A;  3GN3 A;  2VUP A;  1ZZY A;  4A5P A;  2FA8 A;  3UOM A;  4MDC A;  1SL0 B;  3L9U A;  1MEK A;  4N0Z A;  4XTS A;  4EE0 A;  3UVT A;  3F3R A;  1Q98 A;  3VLN A;  1R4W A;  2VIM A;  4KCE A;  1ZYN A;  1F9M A;  1O8X A;  3KM6 A;  2P5Q A;  4G9H A;  5ECN B;  2R5G A;  2FCH A;  3D5J A;  5J9B A;  2IME A;  3HJO A;  4IP6 A;  1A8Y A;  2NPB A;  4MZW A;  3M1G A;  2WW3 A;  5GZZ B;  3HHV A;  4TN8 A;  2H75 A;  5H5R A;  1M9B A;  1RQM A;  3F4S A;  1QK8 A;  1M0U A;  3EPT A;  5HFI A;  5JCW A;  5IMF A;  1XPV A;  1K0A A;  1GUH A;  3ZVJ D;  4NPB A;  3LG6 A;  3QAG A;  2GQM A;  3ED3 A;  2LV3 A;  1ZYQ B;  3R3E A;  2R0P A;  1HD2 A;  4TXO B;  1WP0 A;  3GMF A;  1VF2 A;  4I5Q A;  1OAZ A;  1TI3 A;  4O5U A;  1QUW A;  1WWJ A;  4MH3 A;  1O8W A;  5BRT A;  5E4W A;  2VL2 A;  4TVE A;  2H1L A;  3I43 A;  3HMJ G;  3ZRE A;  4OO5 A;  1M2D A;  3IHQ A;  2RM5 A;  1THO A;  4BL7 A;  4DSS B;  2MBS A;  4N0V A;  2YWI A;  4WBJ A;  4GRF A;  4G0I A;  1TK0 B;  3I6A A;  3QR6 A;  2OE0 A;  2WW0 A;  5JCU A;  4K7I A;  2DJ1 A;  1PL2 A;  3LXZ A;  3BCK A;  2DJK A;  4GSN A;  4DEJ A;  1B4Q A;  3RHC A;  3S9F A;  1VF4 A;  3CHX C;  2C4J A;  5IM9 A;  2VO4 A;  3NZN A;  3KTL A;  2A2P A;  3W8S A;  3EUR A;  4F9Z A;  3ZVJ A;  2PBJ A;  1XW9 A;  5F05 A;  1N2A A;  1PKZ A;  3G7J A;  2IFQ A;  1BQ7 A;  3MSZ A;  4BPY A;  2ES7 A;  1FHE A;  1TDI A;  2E0Q A;  1THX A;  3IAM 2;  5CP1 A;  1LU4 A;  1A8L A;  5IOX A;  4BWS A;  3IXR A;  3W6G A;  3C8E A;  5KN2 A;  1KTE A;  4Z7X A;  1T00 A;  3GUS A;  2WB9 A;  2GGT A;  1S3R A;  4HSC X;  3HVV A;  3QAW A;  5BMU B;  5CO3 A;  4MF6 A;  3GX0 A;  2HSH A;  3RAZ A;  2L4C A;  5IIZ A;  4HOJ A;  4IN0 A;  3RPP A;  1FOH A;  2MYG A;  2HSN A;  3KMN A;  3ZFB A;  3R2Q A;  3HD5 A;  4F03 A;  4MCU A;  5CRE A;  3BD2 A;  5GST A;  1ZYE A;  3HXS A;  4OWY A;  2V41 A;  4IJI A;  1W4V A;  2LUS A;  4WR4 A;  2IMI A;  3H1N A;  4YAV A;  1GTB A;  3MYD A;  2GQL A;  4JE1 A;  3A5I A;  1ERU A;  5ENU A;  5G1L A;  1EZK A;  2VCT A;  1FG4 A;  2OKA A;  4Q5Q A;  1EOG A;  3VK9 A;  1T8E B;  2DJ0 A;  4RI6 A;  3UJ1 A;  1B8X A;  4MA9 A;  1SKS B;  2TRC P;  4OFN A;  2H1G A;  1O73 A;  2I9H A;  2OE3 A;  2C0F A;  1G7E A;  4JED A;  1GTU A;  1J9B A;  1DBY A;  2ZNM A;  1M2B A;  4TOP A;  1NM3 A;  4YKF A;  2H0H A;  2XHF A;  3V1W A;  3TDG A;  2YZU A;  5D96 A;  2J23 A;  1URM A;  1F3B A;  1PMT A;  2LJA A;  3A3T A;  2QA1 A;  2JZS A;  4J57 E;  1U87 A;  1W89 A;  2EFC A;  2LRN A;  5HR2 A;  2GZP A;  1OC3 A;  5DCH A;  4Z2T A;  2H66 A;  1AQW A;  3E9J B;  2EFE A;  3P7X A;  1EV9 A;  2RM6 A;  2LTK A;  2WZ9 A;  3PIN A;  1NHO A;  2I4A A;  1GRX A;  5CYY A;  2OA7 A;  3WYW A;  4GXZ A;  5J4U A;  1A24 A;  2F9S A;  4OO4 A;  3LSZ A;  2EIR A;  1PSQ A;  1WIK A;  1PQN A;  3D4T A;  4TXO A;  1O7U A;  1BED A;  2VD0 A;  1G6Y A;  12GS A;  4OFM A;  4ACS A;  1K3L A;  5D73 A;  3IA1 A;  2YJH A;  1TOF A;  2RUE A;  3U6V A;  3HZ8 A;  3UL3 A;  4GQC A;  5FT3 A;  4KUN A;  3CWG A;  5AIS A;  4V2M A;  3FR6 A;  2RII A;  4KF9 A;  4IJ3 A;  4XIH A;  5J4V A;  3HCZ A;  2K18 A;  1U6T A;  5KN0 A;  4DSS A;  3KGK A;  4MJC A;  2RUF A;  2OAC A;  2HZE B;  3VPT A;  1PKW A;  4GTU A;  2K6V A;  2R0G A;  1HNA A;  5IMD A;  2I81 A;  1TK8 B;  1PA3 A;  2KP2 A;  1PD2 1;  5LD0 A;  1Z6N A;  3GKX A;  2O7K A;  5AIV A;  5ELG A;  2TRX A;  3ME8 A;  1IYI A;  3HA9 A;  3GNJ A;  5D93 A;  2EIQ A;  4HJ2 A;  3UVH A;  1F6M C;  2PWJ A;  2HFD A;  4HQZ A;  2ON5 A;  2I3Y A;  1XVQ A;  2HYX A;  2A2R A;  2FWH A;  3E3E A;  3DEX A;  2VL9 A;  2XBI A;  3C1R A;  3TRQ A;  4KW6 A;  3F8U A;  3APS A;  2P0G A;  1UC7 A;  5J47 A;  1K0C A;  2XPD A;  3TKR A;  3C1S A;  4ZIJ A;  3EYT A;  2WW1 A;  1JHB A;  1TRV A;  4CY8 A;  2GZZ A;  5ECM B;  4EIP A;  2ZUP A;  1M2A A;  2L6D A;  5BMU A;  5D9X A;  1TKD B;  3VWW A;  1G7O A;  4K0G A;  1S3C A;  1FAA A;  5L71 A;  2IIY A;  4K5R A;  1SYR A;  1EV4 A;  2GT5 A;  4MJB A;  3TKS C;  3GTU B;  6GSW A;  4XHM A;  2H1D A;  3F3Q A;  3CRU A;  2F8A A;  2B7J A;  1EGO A;  1EOH A;  3DGQ A;  1LBK A;  3FEU A;  5H5Q A;  3TKS E;  2B1L A;  2B6M A;  3EIN A;  5LNK e;  3ZYW A;  1AUC A;  3ZFL A;  3W8J A;  3FRC A;  3TJG A;  4JU5 A;  2O3E A;  2HSY A;  2ZCT A;  1G6W A;  3IAS 2;  4XS6 A;  4CDO A;  1TRS A;  4HI7 A;  1GTA A;  3RFR C;  1GSE A;  2FHE A;  4HDE A;  2JSZ A;  3TGZ A;  1KEB A;  1EGR A;  1I5G A;  3PH9 A;  2OJL A;  3KD0 A;  2IL3 A;  2N5F A;  4J56 E;  3UMA A;  2P31 A;  3IPZ A;  3SWL A;  3FKF A;  2C3T A;  2H73 A;  5IO0 A;  2XPE A;  3APQ A;  1Y25 A;  3EMP A;  2AB6 A;  2GST A;  2CVD A;  4KDU A;  4MPG A;  5A5K A;  4OD7 A;  3TJJ A;  1OVN A;  4AGS A;  1GWC A;  1V58 A;  2WVZ A;  3ZMK A;  5DVB A;  3HVS A;  1U3I A;  5J9C A;  2DJ3 A;  1USB A;  2Z9S A;  4NXI A;  2NTO A;  5B6M A;  5ABR A;  5AGY A;  5DAK B;  11GS A;  4L5O A;  1SEN A;  22GS A;  1B9Y C;  3TUE A;  3I9V 2;  5HFG A;  5FHI A;  4E68 A;  4I8B A;  2EC4 A;  4F82 A;  5JCG A;  4X4J A;  4EXJ A;  2N5B A;  4IW9 A;  1GLQ A;  3ZRD A;  9GSS A;  2DSA A;  5IQY A;  3O76 A;  2DKH A;  3BBY A;  1FW1 A;  4EDZ A;  2PPT A;  1YZX A;  3FW2 A;  1Q4J A;  2HZE A;  3TJB A;  3DRN A;  3ZTL A;  2YCD A;  2AAW A;  3ME7 A;  5J41 A;  2PN8 A;  5A4W A;  2C1Y A;  1YDK A;  1IYH A;  3US3 A;  2DKI A;  4G01 A;  4AI6 A;  3LOR A;  3TU3 B;  1A0R P;  1YEX A;  1Z5Y E;  4V1A p;  3KH7 A;  2IMD A;  5GAP D;  13GS A;  2X4A A;  2AUV A;  3LEF A;  1CQG A;  1AC1 A;  4NHW A;  2VCX A;  4ML1 A;  2DIZ A;  1XOA A;  1GUK A;  3RHB A;  4E8H A;  1R26 A;  4NAX A;  2CT6 A;  3G7Y A;  1YJ6 A;  5AIX A;  5DQY A;  1FB0 A;  5KEJ A;  2JZR A;  3C73 A;  1MTC A;  4K7N A;  2I1U A;  3L0H A;  5KN1 A;  1ZCP A;  2UV8 G;  6GSV A;  1AAZ A;  1K0D A;  4HJM A;  4RI7 A;  1A2L A;  4HU9 A;  2R6K A;  2C8U A;  1A2M A;  3DXB A;  1EEJ A;  2GS3 A;  2B7K A;  5C04 A;  1Z9H A;  1OYJ A;  1ERW A;  3A2V A;  2FWE A;  1TRW A;  3O3T A;  2WZS A;  4WBR D;  1F3A A;  1VRS D;  2LQQ A;  2RLI A;  1PN0 A;  4K7O A;  3EMX A;  4KSM A;  4PI2 C;  4O32 A;  3GTU A;  3DD3 A;  1HNB A;  1GH2 A;  3MDK A;  1XFL A;  1ZL9 A;  4N10 A;  1TXX A;  4NHZ A;  2CV4 A;  5ECO B;  1M3I A;  3MWH A;  4XS4 B;  2GZY A;  4HS1 A;  3TB2 A;  3DKS A;  1SK2 A;  2X8C A;  3TKS A;  3GKK A;  4Z2R A;  1AQV A;  3QPM A;  2YNX A;  3KJY A;  2VD1 A;  4KX4 A;  5GAN D;  4BIK A;  4KDY A;  2MZC A;  5G1K A;  4TR3 A;  4Q5N A;  4POL A;  1OC9 B;  1XWG A;  1BJX A;  3MNG A;  4ZB9 A;  3J7Y k;  4YQU A;  4BA7 A;  4O7H A;  3M8N A;  2PU9 C;  4AKG A;  1ZMA A;  1GSD A;  2B5Y A;  2LQO A;  2MBT A;  2KOK A;  2LST A;  3SBC A;  5A5H B;  1AIU A;  4ZXG A;  19GS A;  3QDN A;  3GFK A;  3LYP A;  1N25 A;  3L4N A;  2BTO T;  3ERW A;  1BX9 A;  5AN1 A;  3HJM A;  1SK1 A;  4ZBB A;  4JR4 A;  1V2A A;  1PL1 A;  1YVL A;  1WPI A;  4KE3 A;  4KAE A;  5ECS A;  4D73 B;  5EVO A;  2H6Z A;  4Z2U A;  4PUR A;  1X5D A;  2HQT A;  4X0X A;  1LJR A;  3E0U A;  1A2J A;  5IO2 A;  1GTI A;  6GSU A;  2QC7 A;  2CVB A;  1PFO A;  2EIO A;  4DVC A;  6GSS A;  4XCS A;  1J0F A;  3GSS A;  2LRC A;  5IOW A;  1Z7P A;  1GSY A;  3FMW A;  5ECK B;  3UAP A;  1HYU A;  2K8V A;  1QMV A;  5DAK A;  4MPF A;  1X9M B;  1KBN A;  4IHU A;  5D9V A;  4WET A;  2HT9 A;  2IWT A;  1GNW A;  2D2Z A;  4X1U A;  5DCG A;  4PQH A;  1T4Y A;  5INY A;  1S4B P;  1ZOF A;  4KSO A;  4K1F A;  2DJJ A;  4AJ7 A;  1SKR B;  2H72 A;  4EUY A;  3HJP A;  3CSI A;  4RQR A;  4ZB7 A;  2C3Q A;  4WF4 A;  1V9W A;  4ICY A;  3GYK A;  2LJK A;  2GSR A;  2AYT A;  2HRK B;  3L9S A;  2B5X A;  1B4P A;  3F4R A;  4F0B A;  2WFC A;  2OT3 A;  5F06 A;  5EPF A;  5C00 A;  3CSH A;  4K0N A;  1SVM A;  4TRX A;  2PGT A;  5ID2 B;  4PX1 A;  1QGV A;  1U3A A;  3GRX A;  2YV9 A;  4JR6 A;  1I1I P;  5KN3 A;  4ZL8 A;  1FVJ A;  3LQ7 A;  1U88 A;  5KOW A;  3I69 A;  5ECQ B;  4IEL A;  5JWO B;  2HRF A;  1BAY A;  3H79 A;  2A2S A;  1SKW B;  4ZL7 A;  14GS A;  3GIX A;  1PRX A;  2F51 A;  1CQH A;  1SL1 B;  4PQI A;  1XXU A;  4POK A;  1OE8 A;  2ON7 A;  3ZZX A;  4LA1 A;  2V6K A;  1PN9 A;  3IK7 A;  4TW5 A;  3UIW A;  4JBB A;  5B8B A;  3A2X A;  4J2F A;  2JAC A;  4TR4 A;  4MF7 A;  2YV7 A;  3VI5 A;  1TP9 A;  1YF0 A;  5CNW A;  1ML6 A;  2M46 A;  3DYR A;  3L9V A;  4ECJ A;  1Z6M A;  1TJD A;  4OCE A;  1SJI A;  2X64 A;  3HZ4 A;  2R2J A;  4LL1 B;  4QL7 A;  2V6O A;  5F07 A;  3FY7 A;  4BWQ A;  2GTU A;  3RPN A;  2CQ9 A;  4MJA A;  2DLX A;  4XS4 A;  4MK3 A;  2GQK A;  1R7H A;  4MJE A;  1M7T A;  2X8H A;  1SD8 A;  1GUL A;  2WCI A;  3DVW A;  3VWX A;  2BJX A;  2YPM A;  5J3R A;  5ECP B;  6GSY A;  4IVF A;  4K8M A;  3HKR A;  1MDJ A;  1DUG A;  2WVY A;  5DJL A;  2NVL A;  1OC9 A;  2O8V B;  5B6N A;  1VF1 A;  3D21 A;  3QFB C;  4GSS A;  2VL2 C;  3D4M A;  2DJ2 A;  4V2L A;  1F37 A;  1EP8 A;  2CX4 A;  2CA8 A;  1X9W B;  3DVX A;  3EVI A;  5A5H A;  1E2Y A;  1WE0 A;  1RK4 A;  3TRP A;  3EU3 A;  1AXD A;  1WMJ A;  7GSS A;  5F0G A;  3ZIV A;  1X5C A;  2JU5 A;  4AKI A;  3EC3 A;  2YWM A;  2CZ3 A;  1GSQ A;  4FYB A;  4D73 A;  4HEA 2;  3GH9 A;  3IDV A;  1H75 A;  3KTB A;  2YOI A;  2UZ8 A;  1XZO A;  5EY6 A;  3DML A;  18GS A;  3G9B A; 
#chains in the Genus database with same CATH homology
 4IQA A;  1FOV A;  4XRD A;  2X99 A;  4CW9 A;  4GWR A;  4QQ7 A;  3F9U A;  3LGC A;  4EC0 A;  3Q74 A;  4KB3 A;  3F6F A;  1TTZ A;  1SU9 A;  3CRT A;  3FZ4 A;  2XC2 A;  4TR0 A;  2V2G A;  1K0M A;  3N9J A;  2A4H A;  2H74 A;  3F63 A;  2E2G A;  2OAD A;  5G31 A;  3VWU A;  2FNO A;  1K0O A;  1SD9 A;  1UVZ A;  1A0F A;  3CXG A;  4PXO A;  4KDX A;  3GUR A;  3TCO A;  4LLR A;  3KCM A;  4G10 A;  2FUG 2;  3FZ9 A;  2QKE A;  2VLT A;  3CTG A;  3OR5 A;  1VGL A;  2R37 A;  1XOB A;  4IBP A;  2HRK A;  2M80 A;  3FK8 A;  5IMC A;  1Z7R A;  1MDK A;  4CHS A;  5ECL B;  1ILO A;  4QL9 A;  1GSS A;  4IKH A;  2FY6 A;  4RQX A;  4I6X A;  5D9T A;  2H70 A;  4H86 A;  4HQS A;  1DE2 A;  4MP4 A;  1TW9 A;  1Z3E A;  10GS A;  5JWQ B;  1NHY A;  4ZB6 A;  3DWV A;  2YP6 A;  2H19 A;  5ID2 A;  3QFA C;  1UN2 A;  1TU7 A;  2LKU A;  4XS1 A;  2LRT A;  4KH7 A;  3WGD A;  1JLV A;  3QOU A;  3F6D A;  5JWR B;  4EO3 A;  3KIJ A;  4GLT A;  1SVO A;  4Q5R A;  4YAP A;  4ZB8 A;  4PQ1 A;  3J7Y b;  2IMF A;  3IE3 A;  3RDW A;  5E59 A;  3VI7 A;  3TOT A;  3AY8 A;  2PMT A;  3IV4 A;  4I97 A;  3IC8 A;  2L4Q A;  4GQF A;  2A4V A;  2C0G A;  4FO5 A;  5B7C A;  1M9A A;  4ECC A;  2H0G A;  3GKM A;  3HYP A;  1YKC A;  2KHP A;  2L57 A;  2JAD A;  4EDY A;  3MAK A;  2HI7 A;  2GT6 A;  4N11 A;  1AW9 A;  1X9S B;  2WUL A;  4HU7 A;  2DML A;  1MD3 A;  3LYK A;  1SYX A;  3LFL A;  2O89 A;  1O6J A;  1Y6E A;  3GST A;  3UBL A;  2X8G A;  1SL2 B;  5A4V A;  2QA2 A;  4TXV A;  4RUV A;  3C7M A;  4L5L A;  1ABA A;  2QSI A;  4P3Y B;  1PGT A;  3FR3 A;  3KMO A;  5IMV A;  1BG5 A;  5G5E A;  2AJQ B;  3KP8 A;  4DSQ A;  4K2X A;  3VUR A;  2LS5 A;  3EE2 A;  1C72 A;  2E2M A;  5A1N B;  4GCI A;  2O85 A;  5B8A A;  3L78 A;  1XWA A;  3IOS A;  1NSW A;  4L0W A;  3IC4 A;  2YAN A;  4PUA A;  5A4U A;  3PR8 A;  2G2Q A;  3TKP A;  3ERF A;  5DJM A;  3NIV A;  2YN1 A;  4G2E A;  4HUA A;  5HQP A;  4IP1 A;  4MH2 A;  3QCP A;  2YWO A;  5EL8 A;  2L59 A;  4ML6 A;  4OFT A;  4TR1 B;  4NV5 A;  2DBC A;  2PVO C;  4V2N A;  2KUC A;  3D22 A;  2L5O A;  1DSB A;  1JFU A;  4K6X A;  2TIR A;  3M9J A;  1QXH A;  4L8E A;  2VLV A;  2PER A;  2H6X A;  2C3N A;  3NOF A;  3IRA A;  3FZ5 A;  5DBQ A;  2MMZ A;  2ALB A;  2VOC A;  1BG1 A;  4I2U A;  4EIQ A;  3C71 A;  2HSM B;  2LEG A;  4PGT A;  3GKN A;  4LMW A;  3HVX A;  2HRA A;  1N8J A;  4V1A g;  1R5P A;  3Q6O A;  4IQ1 A;  4PTS A;  3Q18 A;  4MZB A;  4OMV A;  3GX8 A;  3HY2 A;  3F4T A;  1M99 A;  3IBH A;  3TKQ A;  1KNG A;  4WF5 A;  2WJU A;  3FZA A;  5FWG A;  3GL3 A;  1K3Y A;  4YH2 A;  3IHG A;  4PUF C;  4QMK A;  3CBU A;  5COH A;  1YQ1 A;  3DIE A;  4G0L A;  2FWG A;  1XWK A;  2VM1 A;  3VPQ A;  1T7P B;  1T1V A;  1QQ2 A;  5CRD A;  4BVX B;  1BF5 A;  3MIX A;  2YWN A;  4FIW A;  2H76 A;  5IPH A;  4KND A;  4L0U A;  1ZGN A;  1Y1U A;  2OE1 A;  2HRN A;  1SVL A;  1PX7 A;  8GSS A;  5CRG A;  1EEM A;  1K0N A;  1JLW A;  5IPG A;  2DMM A;  1SJZ A;  3WT1 A;  1AQX A;  3ZML A;  1XBS A;  1B48 A;  4LMV A;  2GVP A;  3PPU A;  3ERG A;  6GST A;  4IS0 A;  1E6B A;  2KLX A;  2M72 A;  5J5N A;  1ZYP A;  1UA5 A;  2YZH A;  3TOU A;  3KP9 A;  4MAB A;  4HZ4 A;  2R3X A;  1I9D A;  1JZD A;  1T3B A;  1SJ6 A;  1YKA A;  2YJ7 A;  4GDF A;  2LJR A;  4ZL9 A;  2KP1 A;  4WR5 A;  1GSU A;  3IR4 A;  3CMI A;  1HNC A;  1H4O A;  4BVY B;  2H6Y A;  2H8L A;  4ECI A;  3EU4 A;  3GA4 A;  1T4Z A;  1ERT A;  4WKW A;  1GL8 A;  4YQM A;  2HZF A;  4ULX A;  3QAV A;  5DAL B;  1TRU A;  1O81 A;  1GUM A;  2HXK A;  3RBT A;  5LCZ A;  2V32 A;  4K2D A;  5HR3 A;  2E7P A;  5D9W A;  5DQS A;  2VM2 A;  4MLY A;  2CX3 A;  4N30 A;  2AHE A;  3M9K A;  1X5E A;  4AJ6 A;  4N3Z A;  5ELA A;  4ECB A;  1V57 A;  4OCF A;  2WDU A;  2VCQ A;  1QFN A;  1K3O A;  4F0C A;  4WEY A;  17GS A;  4POB A;  3LJR A;  4ZBD A;  4F2I A;  5A1N A;  1S3A A;  4CY6 A;  4AJ8 A;  3ZLP A;  2VLU A;  3H93 A;  3ZIJ A;  3KH9 A;  1BYE A;  2EFD A;  5J4Y A;  1ON4 A;  5F8B A;  2C0E A;  5A34 B;  2DIY A;  3QD9 A;  1OKD A;  1JZR A;  1OE7 A;  4TR1 A;  2IN3 A;  1JZO A;  5G5F A;  3FHK A;  1YEP A;  2VCZ A;  1YF1 A;  2BMX A;  4EF0 A;  2O87 A;  5G30 A;  2XBQ A;  5ECH B;  1O85 A;  1V40 A;  4E8E A;  2REM A;  4ID0 A;  2CAQ A;  4USS A;  1GP1 A;  4X43 A;  1XW6 A;  2F3M A;  5HFK A;  2NDO A;  1DE1 A;  3A2W A;  1ST9 A;  1MD4 A;  2X49 A;  3O6T A;  1GSF A;  2K8S A;  2HSM A;  2MMO A;  3UEM A;  3QMX A;  2IMK A;  1XW5 A;  2FLS A;  5DDL A;  5HR1 A;  3ZL5 A;  2C0D A;  4HZ2 A;  1OC8 A;  3H8Q A;  5CAX A;  4FYC A;  3F0I A;  2WRT A;  2N5A A;  3P90 A;  1MDI A;  2H71 A;  2FWF A;  2R4V A;  3D0Z A;  4FQU A;  3WD6 A;  2GSS A;  2F8F A;  4NV2 A;  3HDC A;  4ILF A;  4NWY A;  1R5A A;  3N5O A;  2VAF A;  3BCI A;  3M0F A;  1S3D A;  1FVK A;  2H01 A;  4PNF A;  1K0B A;  4BVX A;  3GH6 A;  2P5R A;  3JCM L;  2VCW A;  4WXT A;  1XWC A;  1GNE A;  3G7I A;  4IGJ A;  4JRR A;  1TI1 A;  3WGE A;  2WGR A;  2L5L A;  2H1A A;  2FA4 A;  4ZIL A;  4KCA A;  3CTF A;  1G0T A;  2GSQ A;  5HR0 A;  3WGX A;  2OBK A;  2CAI A;  1JZW A;  2L6C A;  4W66 A;  2MMN A;  4BL7 B;  2LNS A;  2CZ2 A;  4POM A;  3LW9 A;  3PGT A;  16GS A;  3VFI A;  4GF0 A;  2JZT A;  5IMZ A;  4MF5 A;  5CRW A;  2JL4 A;  4DSR A;  3TJF A;  1ERV A;  4I2T A;  4TKY A;  5D8I A;  3APO A;  6GSX A;  5G2Z A;  2B5E A;  4G19 A;  2H0I A;  3M3M A;  1B9X C;  3GV1 A;  4ZBA A;  5KOX A;  4MMM A;  4MZC A;  4YKG A;  4AF2 A;  1WRY A;  1A23 A;  4KGI A;  4JZQ A;  1J08 A;  2FGX A;  1WJK A;  3H4K A;  1PX6 A;  4O92 A;  4BVY A;  4NMU A;  2G0F A;  3CYN A;  2DC5 A;  2IFQ B;  3KEB A;  1TXU A;  2GLR A;  5J40 A;  1VF3 A;  5GSS A;  1FO5 A;  3Q19 A;  2O5V A;  4AKX B;  2FD3 A;  2H1B A;  3GL5 A;  3ISO A;  2H30 A;  4KA0 A;  3FYG A;  4ISD A;  4YQV A;  20GS A;  4XRA A;  4K5S A;  2B3S A;  5DAL A;  3FR9 A;  3TJK A;  2HNL A;  1FB6 A;  3VWV A;  2J9H A;  3KXO A;  3P2A A;  2R0C A;  4AKH A;  1EP7 A;  3GHA A;  4EL1 A;  1NW2 A;  3BJ5 A;  3LXT A;  1TK5 B;  3UBK A;  2HLS A;  3U5R E;  2C80 A;  1GLP A;  3BOA A;  3LWA A;  4EVM A;  2EFH A;  2WS2 A;  1XWB A;  2HSN B;  1XCC A;  4Q5F A;  2PVQ A;  1EWX A;  2AV4 A;  2LNT A;  5IMA A;  1WOU A;  3CSJ A;  3UAR A;  3A5W A;  1ACV A;  1RW1 A;  4FH8 A;  2QGV A;  2NBS A;  2K9F A;  4LL4 B;  4G0K A;  1YY7 A;  2JSY A;  2MMA A;  3ZIT A;  1XIY A;  1HQO A;  3KZQ A;  1SK0 A;  2GDR A;  2VKZ G;  3TRX A;  3K8N A;  5A34 A;  2IJY A;  1XVW A;  4PNG A;  4MNN A;  2V1M A;  2HE3 A;  3WT2 A;  3IK9 A;  2VL3 A;  2VCV A;  5H5S A;  4GST A;  3EWL A;  4O5R A;  1X0R A;  2CVK A;  5ECR B;  4FYU A;  1OKT A;  1F2E A;  5ECI B;  4EKZ A;  5CRH A;  2PUK C;  1TU8 A;  2OBI A;  1V98 A;  2B1K A;  3D6I A;  3P8W A;  4O5Q A;  2IPA A;  4K9Z A;  3GN3 A;  2VUP A;  1ZZY A;  4A5P A;  2FA8 A;  3UOM A;  4MDC A;  1SL0 B;  3L9U A;  1MEK A;  4N0Z A;  4XTS A;  4EE0 A;  3UVT A;  3F3R A;  1Q98 A;  3VLN A;  1R4W A;  2VIM A;  4KCE A;  1ZYN A;  1F9M A;  1O8X A;  3KM6 A;  2P5Q A;  4G9H A;  5ECN B;  2R5G A;  2FCH A;  3D5J A;  5J9B A;  2IME A;  3HJO A;  4IP6 A;  1A8Y A;  2NPB A;  4MZW A;  3M1G A;  5GZZ B;  3HHV A;  4TN8 A;  2H75 A;  5H5R A;  1M9B A;  1RQM A;  3F4S A;  1QK8 A;  1M0U A;  3EPT A;  5HFI A;  5JCW A;  5IMF A;  1XPV A;  1K0A A;  1GUH A;  3ZVJ D;  4NPB A;  3LG6 A;  3QAG A;  2GQM A;  3ED3 A;  2LV3 A;  1ZYQ B;  3R3E A;  2R0P A;  1HD2 A;  4TXO B;  1WP0 A;  3GMF A;  1VF2 A;  4I5Q A;  1OAZ A;  1TI3 A;  4O5U A;  1QUW A;  1WWJ A;  4MH3 A;  1O8W A;  5BRT A;  5E4W A;  2VL2 A;  4TVE A;  2H1L A;  3I43 A;  3HMJ G;  3ZRE A;  4OO5 A;  1M2D A;  3IHQ A;  2RM5 A;  1THO A;  4BL7 A;  4DSS B;  2MBS A;  4N0V A;  2YWI A;  4WBJ A;  4GRF A;  4G0I A;  1TK0 B;  3I6A A;  3QR6 A;  2OE0 A;  5JCU A;  4K7I A;  2DJ1 A;  1PL2 A;  3LXZ A;  3BCK A;  2DJK A;  4GSN A;  4DEJ A;  1B4Q A;  3RHC A;  3S9F A;  1VF4 A;  2C4J A;  5IM9 A;  2VO4 A;  3NZN A;  3KTL A;  2A2P A;  3W8S A;  3EUR A;  4F9Z A;  3ZVJ A;  2PBJ A;  1XW9 A;  5F05 A;  1N2A A;  1PKZ A;  3G7J A;  2IFQ A;  1BQ7 A;  3MSZ A;  4BPY A;  2ES7 A;  1FHE A;  1TDI A;  2E0Q A;  1THX A;  3IAM 2;  5CP1 A;  1LU4 A;  1A8L A;  5IOX A;  4BWS A;  3IXR A;  3W6G A;  3C8E A;  5KN2 A;  1KTE A;  4Z7X A;  1T00 A;  3GUS A;  2WB9 A;  2GGT A;  3HVV A;  3QAW A;  5BMU B;  5CO3 A;  4MF6 A;  3GX0 A;  2HSH A;  3RAZ A;  2L4C A;  5IIZ A;  4HOJ A;  4IN0 A;  3RPP A;  1FOH A;  2MYG A;  2HSN A;  3KMN A;  3ZFB A;  3R2Q A;  3HD5 A;  4F03 A;  4MCU A;  5CRE A;  3BD2 A;  5GST A;  1ZYE A;  3HXS A;  4OWY A;  2V41 A;  4IJI A;  1W4V A;  2LUS A;  4WR4 A;  2IMI A;  3H1N A;  4YAV A;  1GTB A;  3MYD A;  2GQL A;  4JE1 A;  3A5I A;  1ERU A;  5ENU A;  5G1L A;  1EZK A;  2VCT A;  1FG4 A;  2OKA A;  4Q5Q A;  1EOG A;  3VK9 A;  1T8E B;  2DJ0 A;  4RI6 A;  3UJ1 A;  1B8X A;  4MA9 A;  1SKS B;  2TRC P;  4OFN A;  2H1G A;  1O73 A;  2I9H A;  2OE3 A;  2C0F A;  1G7E A;  4JED A;  1GTU A;  1J9B A;  1DBY A;  2ZNM A;  1M2B A;  4TOP A;  1NM3 A;  4YKF A;  2H0H A;  2XHF A;  3V1W A;  3TDG A;  2YZU A;  5D96 A;  2J23 A;  1URM A;  1F3B A;  1PMT A;  2LJA A;  3A3T A;  2QA1 A;  2JZS A;  4J57 E;  1U87 A;  1W89 A;  2EFC A;  2LRN A;  5HR2 A;  2GZP A;  1OC3 A;  5DCH A;  4Z2T A;  2H66 A;  1AQW A;  3E9J B;  2EFE A;  3P7X A;  1EV9 A;  2RM6 A;  2LTK A;  2WZ9 A;  3PIN A;  1NHO A;  2I4A A;  1GRX A;  5CYY A;  2OA7 A;  3WYW A;  4GXZ A;  5J4U A;  1A24 A;  2F9S A;  4OO4 A;  3LSZ A;  2EIR A;  1PSQ A;  1WIK A;  1PQN A;  3D4T A;  4TXO A;  1O7U A;  1BED A;  2VD0 A;  1G6Y A;  12GS A;  4OFM A;  4ACS A;  1K3L A;  5D73 A;  3IA1 A;  2YJH A;  1TOF A;  2RUE A;  3U6V A;  3HZ8 A;  3UL3 A;  4GQC A;  5FT3 A;  4KUN A;  3CWG A;  5AIS A;  4V2M A;  3FR6 A;  2RII A;  4KF9 A;  4IJ3 A;  4XIH A;  5J4V A;  3HCZ A;  2K18 A;  1U6T A;  5KN0 A;  4DSS A;  3KGK A;  4MJC A;  2RUF A;  2OAC A;  2HZE B;  3VPT A;  1PKW A;  4GTU A;  2K6V A;  2R0G A;  1HNA A;  5IMD A;  2I81 A;  1TK8 B;  1PA3 A;  2KP2 A;  1PD2 1;  5LD0 A;  1Z6N A;  3GKX A;  2O7K A;  5AIV A;  5ELG A;  2TRX A;  3ME8 A;  1IYI A;  3HA9 A;  3GNJ A;  5D93 A;  2EIQ A;  4HJ2 A;  3UVH A;  1F6M C;  2PWJ A;  2HFD A;  4HQZ A;  2ON5 A;  2I3Y A;  1XVQ A;  2HYX A;  2A2R A;  2FWH A;  3E3E A;  3DEX A;  2VL9 A;  2XBI A;  3C1R A;  3TRQ A;  4KW6 A;  3F8U A;  3APS A;  2P0G A;  1UC7 A;  5J47 A;  1K0C A;  2XPD A;  3TKR A;  3C1S A;  4ZIJ A;  3EYT A;  1JHB A;  1TRV A;  4CY8 A;  2GZZ A;  5ECM B;  4EIP A;  2ZUP A;  1M2A A;  2L6D A;  5BMU A;  5D9X A;  1TKD B;  3VWW A;  1G7O A;  4K0G A;  1S3C A;  1FAA A;  5L71 A;  2IIY A;  4K5R A;  1SYR A;  1EV4 A;  2GT5 A;  4MJB A;  3TKS C;  3GTU B;  6GSW A;  4XHM A;  2H1D A;  3F3Q A;  3CRU A;  2F8A A;  2B7J A;  1EGO A;  1EOH A;  3DGQ A;  1LBK A;  3FEU A;  5H5Q A;  3TKS E;  2B1L A;  2B6M A;  3EIN A;  5LNK e;  3ZYW A;  1AUC A;  3ZFL A;  3W8J A;  3FRC A;  3TJG A;  4JU5 A;  2HSY A;  2ZCT A;  1G6W A;  3IAS 2;  4XS6 A;  4CDO A;  1TRS A;  4HI7 A;  1GTA A;  1GSE A;  2FHE A;  4HDE A;  2JSZ A;  3TGZ A;  1KEB A;  1EGR A;  1I5G A;  3PH9 A;  2OJL A;  3KD0 A;  2IL3 A;  2N5F A;  4J56 E;  3UMA A;  2P31 A;  3IPZ A;  3SWL A;  3FKF A;  2C3T A;  2H73 A;  5IO0 A;  2XPE A;  3APQ A;  1Y25 A;  3EMP A;  2AB6 A;  2GST A;  2CVD A;  4KDU A;  4MPG A;  5A5K A;  4OD7 A;  3TJJ A;  1OVN A;  4AGS A;  1GWC A;  1V58 A;  3ZMK A;  5DVB A;  3HVS A;  1U3I A;  5J9C A;  2DJ3 A;  1USB A;  2Z9S A;  4NXI A;  2NTO A;  5B6M A;  5ABR A;  5AGY A;  5DAK B;  11GS A;  4L5O A;  1SEN A;  22GS A;  1B9Y C;  3TUE A;  3I9V 2;  5HFG A;  5FHI A;  4E68 A;  4I8B A;  2EC4 A;  4F82 A;  5JCG A;  4X4J A;  4EXJ A;  2N5B A;  4IW9 A;  1GLQ A;  3ZRD A;  9GSS A;  2DSA A;  5IQY A;  3O76 A;  2DKH A;  3BBY A;  1FW1 A;  4EDZ A;  2PPT A;  1YZX A;  3FW2 A;  1Q4J A;  2HZE A;  3TJB A;  3DRN A;  3ZTL A;  2YCD A;  2AAW A;  3ME7 A;  5J41 A;  2PN8 A;  5A4W A;  2C1Y A;  1YDK A;  1IYH A;  3US3 A;  2DKI A;  4G01 A;  4AI6 A;  3LOR A;  3TU3 B;  1A0R P;  1YEX A;  1Z5Y E;  4V1A p;  3KH7 A;  2IMD A;  5GAP D;  13GS A;  2X4A A;  2AUV A;  3LEF A;  1CQG A;  1AC1 A;  4NHW A;  2VCX A;  4ML1 A;  2DIZ A;  1XOA A;  1GUK A;  3RHB A;  4E8H A;  1R26 A;  4NAX A;  2CT6 A;  3G7Y A;  1YJ6 A;  5AIX A;  5DQY A;  1FB0 A;  5KEJ A;  2JZR A;  3C73 A;  1MTC A;  4K7N A;  2I1U A;  3L0H A;  5KN1 A;  1ZCP A;  2UV8 G;  6GSV A;  1AAZ A;  1K0D A;  4HJM A;  4RI7 A;  1A2L A;  4HU9 A;  2R6K A;  2C8U A;  1A2M A;  3DXB A;  1EEJ A;  2GS3 A;  2B7K A;  5C04 A;  1Z9H A;  1OYJ A;  1ERW A;  3A2V A;  2FWE A;  1TRW A;  3O3T A;  4WBR D;  1F3A A;  1VRS D;  2LQQ A;  2RLI A;  1PN0 A;  4K7O A;  3EMX A;  4KSM A;  4O32 A;  3GTU A;  3DD3 A;  1HNB A;  1GH2 A;  3MDK A;  1XFL A;  1ZL9 A;  4N10 A;  1TXX A;  4NHZ A;  2CV4 A;  5ECO B;  3MWH A;  4XS4 B;  2GZY A;  4HS1 A;  3TB2 A;  3DKS A;  1SK2 A;  2X8C A;  3TKS A;  3GKK A;  4Z2R A;  1AQV A;  3QPM A;  2YNX A;  3KJY A;  2VD1 A;  4KX4 A;  5GAN D;  4KDY A;  2MZC A;  5G1K A;  4TR3 A;  4Q5N A;  4POL A;  1OC9 B;  1XWG A;  1BJX A;  3MNG A;  4ZB9 A;  3J7Y k;  4YQU A;  4BA7 A;  4O7H A;  3M8N A;  2PU9 C;  4AKG A;  1ZMA A;  1GSD A;  2B5Y A;  2LQO A;  2MBT A;  2KOK A;  2LST A;  3SBC A;  5A5H B;  1AIU A;  4ZXG A;  19GS A;  3QDN A;  3GFK A;  3LYP A;  1N25 A;  3L4N A;  2BTO T;  3ERW A;  1BX9 A;  5AN1 A;  3HJM A;  1SK1 A;  4ZBB A;  4JR4 A;  1V2A A;  1PL1 A;  1YVL A;  1WPI A;  4KE3 A;  4KAE A;  5ECS A;  4D73 B;  5EVO A;  2H6Z A;  4Z2U A;  4PUR A;  1X5D A;  2HQT A;  4X0X A;  1LJR A;  3E0U A;  1A2J A;  5IO2 A;  1GTI A;  6GSU A;  2QC7 A;  2CVB A;  2EIO A;  4DVC A;  6GSS A;  4XCS A;  1J0F A;  3GSS A;  2LRC A;  5IOW A;  1Z7P A;  1GSY A;  3FMW A;  5ECK B;  3UAP A;  1HYU A;  2K8V A;  1QMV A;  5DAK A;  4MPF A;  1X9M B;  1KBN A;  4IHU A;  5D9V A;  4WET A;  2HT9 A;  2IWT A;  1GNW A;  2D2Z A;  4X1U A;  5DCG A;  4PQH A;  1T4Y A;  5INY A;  1ZOF A;  4KSO A;  4K1F A;  2DJJ A;  4AJ7 A;  1SKR B;  2H72 A;  4EUY A;  3HJP A;  3CSI A;  4RQR A;  4ZB7 A;  2C3Q A;  4WF4 A;  1V9W A;  4ICY A;  3GYK A;  2LJK A;  2GSR A;  2AYT A;  2HRK B;  3L9S A;  2B5X A;  1B4P A;  3F4R A;  4F0B A;  2WFC A;  2OT3 A;  5F06 A;  5EPF A;  5C00 A;  3CSH A;  4K0N A;  1SVM A;  4TRX A;  2PGT A;  5ID2 B;  4PX1 A;  1QGV A;  1U3A A;  3GRX A;  2YV9 A;  4JR6 A;  5KN3 A;  4ZL8 A;  1FVJ A;  3LQ7 A;  1U88 A;  5KOW A;  3I69 A;  5ECQ B;  4IEL A;  5JWO B;  2HRF A;  1BAY A;  3H79 A;  2A2S A;  1SKW B;  4ZL7 A;  14GS A;  3GIX A;  1PRX A;  2F51 A;  1CQH A;  1SL1 B;  4PQI A;  1XXU A;  4POK A;  1OE8 A;  2ON7 A;  3ZZX A;  4LA1 A;  2V6K A;  1PN9 A;  3IK7 A;  4TW5 A;  3UIW A;  4JBB A;  5B8B A;  3A2X A;  4J2F A;  2JAC A;  4TR4 A;  4MF7 A;  2YV7 A;  3VI5 A;  1TP9 A;  1YF0 A;  5CNW A;  1ML6 A;  2M46 A;  3DYR A;  3L9V A;  4ECJ A;  1Z6M A;  1TJD A;  4OCE A;  1SJI A;  2X64 A;  3HZ4 A;  2R2J A;  4LL1 B;  4QL7 A;  2V6O A;  5F07 A;  3FY7 A;  4BWQ A;  2GTU A;  3RPN A;  2CQ9 A;  4MJA A;  2DLX A;  4XS4 A;  4MK3 A;  2GQK A;  1R7H A;  4MJE A;  1M7T A;  2X8H A;  1SD8 A;  1GUL A;  2WCI A;  3DVW A;  3VWX A;  2BJX A;  2YPM A;  5J3R A;  5ECP B;  6GSY A;  4IVF A;  4K8M A;  3HKR A;  1MDJ A;  1DUG A;  5DJL A;  2NVL A;  1OC9 A;  2O8V B;  5B6N A;  1VF1 A;  3D21 A;  3QFB C;  4GSS A;  2VL2 C;  3D4M A;  2DJ2 A;  4V2L A;  1F37 A;  1EP8 A;  2CX4 A;  2CA8 A;  1X9W B;  3DVX A;  3EVI A;  5A5H A;  1E2Y A;  1WE0 A;  1RK4 A;  3TRP A;  3EU3 A;  1AXD A;  1WMJ A;  7GSS A;  5F0G A;  3ZIV A;  1X5C A;  2JU5 A;  4AKI A;  3EC3 A;  2YWM A;  2CZ3 A;  1GSQ A;  4FYB A;  4D73 A;  4HEA 2;  3GH9 A;  3IDV A;  1H75 A;  3KTB A;  2YOI A;  2UZ8 A;  1XZO A;  5EY6 A;  3DML A;  18GS A;  3G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...