5BMUA

The crystal structure of the gst-like domains complex of aimp3-eprs mutant c92sc105sc123s
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
165
Chain Sequence
HMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation elongation factor 1 epsilon-1
publication title Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/ligase
total genus 50
structure length 165
sequence length 168
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5bmuA02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5bmuA01
1PD21 3F6FA 4O92A 10GSA 1IYHA 5ELAA 19GSA 1B8XA 3F6DA 20GSA 2YV9A 4KDXA 6GSUA 3LSZA 3MAKA 2JL4A 4JBBA 3CSIA 2HRKA 3ZMKA 4QQ7A 3RBTA 1GNWA 3R3EA 4JEDA 3FRCA 4MF5A 5D73A 2J9HA 3R2QA 4LMWA 3M1GA 1TDIA 1YQ1A 4YAPA 4LMVA 1Q4JA 3UBKA 1AQXA 5F8BA 1K3OA 3DGQA 3QAWA 2WJUA 4G0IA 5EVOA 2C3NA 1YY7A 3AY8A 2FHEA 2VCQA 4USSA 1OE8A 3P90A 6GSXA 3PPUA 4PQHA 3GTUA 2D2ZA 6GSSA 2N5FA 6GSWA 1HNCA 4KE3A 1IYIA 4K0GA 4I97A 1B4PA 5A4WA 2DSAA 5ECNB 4PQIA 5AIVA 4N0VA 3FR3A 4ZBAA 1JZRA 1YJ6A 2PGTA 2GDRA 4IVFA 4IQAA 3Q19A 16GSA 1GSYA 1M9AA 4ECIA 4ZXGA 11GSA 2A2RA 4TOPA 4EC0A 4HZ2A 1GSUA 3KJYA 4PGTA 3HJMA 5ECQB 2GLRA 5D9TA 4IBPA 1TU7A 1UA5A 4ZB8A 4BVYA 2HSMB 1AXDA 2AAWA 1GLPA 2VO4A 1BAYA 1JLVA 4Q5RA 2R3XA 4GSTA 2VCWA 1GLQA 4KX4A 4GLTA 1ML6A 2OADA 3ZMLA 8GSSA 3Q18A 5G5FA 4DEJA 3O76A 4ECJA 2YCDA 4PTSA 5ECRB 1AQVA 1PGTA 2CVDA 1K0MA 3FY7A 1GUKA 1USBA 4WR4A 4ECCA 5FT3A 3WYWA 5GZZB 4GSNA 1PA3A 3M0FA 4IGJA 4KDYA 1XW6A 3TOTA 1YKCA 1GSEA 3G7IA 1M9BA 2OA7A 2C80A 4RI7A 1PX7A 1MD3A 4L5LA 1GTAA 1OKTA 3KTLA 5JCWA 4BVXA 2R5GA 4Q5FA 4IQ1A 1GUMA 5ECIB 1EV4A 2C3QA 4YAVA 4J2FA 5JCUA 4KAEA 2F3MA 3ERGA 18GSA 3VWXA 1XWKA 3NIVA 3GX0A 4BL7B 3LJRA 1K0AA 2HSMA 2YV7A 1RK4A 4ACSA 3FR9A 4PNGA 4KH7A 1DUGA 1E6BA 1EV9A 1BX9A 6GSTA 4BVYB 2CZ2A 5ECSA 2PBJA 4ZBDA 3IE3A 1LBKA 1NHYA 1OE7A 1M0UA 4YH2A 3CRUA 5F0GA 5IQYA 5F07A 5DAKA 3CSJA 4CHSA 4JZQA 4ZB6A 4EE0A 1C72A 4GSSA 3IK9A 4ZBBA 2WRTA 2C4JA 3VI5A 1HNBA 1XW5A 3G7JA 3LYKA 4OFNA 22GSA 2GSSA 4IKHA 4YQMA 2ON7A 4G0KA 5DALA 1R5AA 4HZ4A 5F06A 2WDUA 12GSA 1VF1A 1ZGNA 4BVXB 4MF7A 4OFMA 5D9XA 1MTCA 5D9VA 1U87A 2DC5A 1K0CA 6GSVA 4BL7A 5GSTA 1F3BA 3QAVA 1GSFA 4KF9A 13GSA 2FNOA 1PN9A 2WS2A 5DJMA 5EY6A 1LJRA 5GSSA 5DCGA 3LXZA 1PX6A 4MK3A 3TGZA 14GSA 3QAGA 1GSQA 4MP4A 2GSQA 1GTUA 5B7CA 5F05A 1YDKA 1FHEA 1K0BA 4GTUA 5J5NA 4PURA 2HNLA 1HQOA 3UVHA 1BG5A 5G5EA 1V2AA 4HJ2A 1M99A 5DAKB 4MZWA 1GUHA 3VPQA 3VK9A 4MPFA 2X64A 2PERA 3ISOA 2PMTA 5ECHB 3P8WA 3IC8A 5D9WA 5A5KA 3GSSA 1VF2A 4KDUA 1MD4A 1G6WA 4OFTA 1G7OA 1PL1A 3IBHA 5EL8A 4IW9A 3CRTA 3UAPA 2ON5A 1K0OA 5ELGA 2IMIA 1GULA 5DALB 3LG6A 4WR5A 3I69A 4PUAA 17GSA 4E8HA 4G10A 5AGYA 1FW1A 1ZL9A 1AW9A 4E8EA 4OMVA 1K0NA 1AQWA 2HQTA 4EXJA 4ZB9A 4F0CA 2C8UA 2R4VA 5FWGA 4NHZA 1K0DA 4Q5NA 3ERFA 1EOHA 4Q5QA 4YQUA 5AN1A 3GSTA 1BYEA 4L5OA 5FHIA 4NHWA 1K3LA 2VCXA 3WD6A 5BMUA 3VI7A 4HI7A 2UZ8A 1V40A 1VF4A 3EE2A 3PR8A 7GSSA 2GTUA 4F0BA 3KXOA 4EDZA 2VD0A 1A0FA 4KSMA 3Q74A 3M8NA 2VCVA 3LXTA 4FQUA 1TW9A 5A4UA 3SWLA 5HFKA 4PNFA 5ECKB 2IL3A 3M3MA 1KBNA 4NAXA 3GH6A 5LCZA 3GURA 2HSNB 1N2AA 3KMOA 5J41A 4GF0A 4G0LA 1K3YA 2OACA 1F3AA 3F63A 3LFLA 1U3IA 1G6YA 6GSYA 1GWCA 5A4VA 4RI6A 4IELA 4PXOA 4IJIA 2VD1A 3N5OA 3ZFLA 4GCIA 2IMKA 5KEJA 3KM6A 3L0HA 5LD0A 1GTIA 4HOJA 5ECPB 1VF3A 1HNAA 3ZFBA 4ISDA 2LJRA 4K0NA 2AB6A 3LYPA 3FYGA 1GTBA 3UBLA 3CBUA 3D0ZA 4AGSA 1U88A 5DDLA 3C8EA 1EOGA 3HJOA 5ECMB 1GNEA 1PL2A 3VLNA 5DJLA 2HRAA 2V6KA 5DQSA 2R6KA 5AISA 3BBYA 4O7HA 9GSSA 3KMNA 1B48A 2HRKB 1Y6EA 1GSSA 5ECLB 2VCZA 1F2EA 2F8FA 2GSTA 3W8SA 2WB9A 3CSHA 3N9JA 1EEMA 2A2SA 3U6VA 2CAIA 5J4UA 4F03A 4KGIA 1XWGA 3GUSA 1PMTA 5AIXA 1PKWA 3VURA 4L8EA 1Z9HA 2AHEA 3DD3A 3I6AA 4ID0A 2GSRA 4G19A 3GTUB 3O3TA 3VPTA 2NTOA 4YQVA 3UARA 4MPGA 4MDCA 2CA8A 4EDYA 4ECBA 3EINA 4G9HA 5ECOB 2CZ3A 4MF6A 2VCTA 3TOUA 2CAQA 1PKZA 1OYJA 1GSDA 3PGTA 3QR6A 3FR6A 2PVQA 4PX1A 3IR4A 4IS0A 3IK7A 1TU8A 3LQ7A 3HKRA 1JLWA 2C3TA 3H1NA 3MDKA
chains in the Genus database with same CATH superfamily
1SD9A 2WZSA 1TI3A 3GIXA 2YZUA 5JCGA 3F6DA 5IPGA 3BD2A 6GSUA 3MAKA 2JL4A 4JBBA 3TJGA 1N25A 3HA9A 4FYUA 3R3EA 4JEDA 3FRCA 1TRUA 1T8EB 2H66A 4PHZC 3R2QA 3ZVJA 4LMWA 3M1GA 2K6VA 4LMVA 1Q4JA 4X4JA 5F8BA 1NM3A 3QAWA 1PRXA 2WJUA 1X5CA 3IDVA 4TVEA 1OE8A 3KH7A 4PQHA 3GTUA 2DMMA 2IFQB 2X99A 5A4WA 5AIVA 5BRTA 4GDFA 4ZBAA 3GN3A 3DRNA 4ILFA 2GDRA 5ABRA 4AJ7A 2MMZA 4DSQA 3LW9A 3HVXA 4KW6A 3DIEA 1OVNA 1JZDA 1THXA 11GSA 2FGXA 4DSSB 4HZ2A 2XBIA 3IAS2 4HEA2 3KJYA 3CTFA 3ED3A 4PGTA 1GRXA 1TI1A 5CAXA 4BVYA 2A2PA 4ML6A 4MNNA 3C7MA 4HS1A 1BAYA 2EIRA 2R3XA 3H79A 2KUCA 5CRWA 2X4AA 2HI7A 5A5HB 1X9MB 4HU9A 3C71A 1XXUA 1NW2A 1XVQA 5ECRB 5H5QA 1SJIA 1PGTA 1QXHA 4AKHA 2LSTA 3FY7A 1USBA 2IFQA 4ECCA 4V2LA 5B8BA 5GZZB 4RUVA 1S3CA 3TOTA 1XW6A 1M3IA 3HXSA 2MBSA 3TDGA 2H71A 3ERWA 1GSEA 3G7IA 1RQMA 2DIZA 2QA2A 2PWJA 2OA7A 1Z5YE 3RPNA 1GTAA 1A2JA 1KNGA 4L0UA 4BVXA 5CREA 1GUMA 3A2WA 4GRFA 1U3AA 3GH9A 4IJ3A 4KA0A 5JCUA 3VWXA 2QKEA 3NIVA 4BL7B 3FR9A 3ZVJD 1EWXA 6GSTA 1THOA 5KOWA 1R7HA 4YKGA 2TRCP 5ECSA 1NHYA 2I1UA 1OC9B 4MMMA 3CHXC 5KN3A 1F6MC 2WZ9A 3TKSA 4BWSA 5DAKA 2LV3A 3HDCA 4WETA 1C72A 4POKA 3P7XA 1HNBA 3A2XA 1TK5B 5GAND 1Z6MA 3TKQA 3FK8A 3NZNA 2ON7A 2HZEA 2YWNA 1Y1UA 5F06A 3CQFA 2WDUA 12GSA 5DVBA 4IP6A 4MF7A 4OFMA 1O85A 3APQA 4BL7A 2LNTA 2AYTA 1F3BA 2QGVA 2GGTA 3A5WA 2FWGA 4W66A 2FNOA 4WXTA 2IMFA 1LJRA 2DJ3A 5GSSA 3LXZA 2O7KA 3C1SA 1RW1A 4K9ZA 1OC9A 1T4ZA 3QAGA 2K8VA 2GSQA 1K0BA 4XCSA 1ZMAA 4CY8A 1YEWC 4WBJA 5JWRB 1GUHA 2O36A 3HVSA 2PERA 3ISOA 1T1VA 2PMTA 1ERWA 2AUVA 4QL9A 5IOWA 5A5KA 2P31A 3HYPA 1WRYA 1G7OA 2HSNA 3CRTA 3UAPA 2ON5A 3L4NA 4MA9A 5DALB 3HY2A 1XVWA 3TKSC 3LG6A 4WR5A 2L59A 2K18A 3V1WA 2O89A 3BCKA 3F3RA 1N8JA 2LTKA 1WJKA 2R0PA 1ZL9A 2C0FA 3O6TA 4E8EA 1AC1A 1J9BA 1H75A 1FOHA 3W8JA 2PPTA 2LUSA 5ID2A 2YPMA 2V1MA 4RQRA 3C73A 4NHZA 3H8QA 1SD8A 1GH2A 1K0DA 1EOHA 2FUG2 2I4AA 1X9WB 3GSTA 2V41A 4EO3A 4NHWA 2JSYA 4JRRA 5IPHA 2DBCA 3PR8A 3EE2A 2GTUA 2FLSA 1A0FA 4KSMA 4HQSA 3Q74A 1S3DA 4NPBA 2YP6A 2VCVA 2FD3A 4WEYA 2H01A 2TIRA 1OC8A 3SWLA 4TW5A 4TR4A 4XS6A 4PNFA 3APSA 2IL3A 3F4RA 4LL4B 4GF0A 2GVPA 2MMAA 2N5BA 5JWQB 3KH9A 1K3YA 2XBQA 1F3AA 2YANA 3QD9A 1TXXA 4KCEA 2L4CA 2G0FA 1GWCA 5A4VA 3N5OA 4NV2A 2HYXA 4GCIA 1A2LA 3FZAA 1XOBA 3ZFBA 4WF5A 3BJ5A 1LU4A 2GZPA 3UBLA 3CBUA 2WCIA 1DE2A 3C8EA 4MZCA 4F2IA 2L6CA 3GRXA 3TJJA 1S3RA 5BMUB 3SBCA 2I81A 2R6KA 4EKZA 1WIKA 3BBYA 2WW1A 2HRKB 1Y6EA 4XRAA 2VCZA 4OO4A 2GZZA 2ZNMA 2CX3A 2DIYA 3WGEA 1Z6NA 1EEMA 2IPAA 1M7TA 3DMLA 2H1DA 3TRQA 3G7YA 2MYGA 1PMTA 5AIXA 4XS4A 3HVNA 4G19A 2C0DA 4MCUA 3UARA 4V1Ap 1I1IP 1YEPA 4G9HA 3EWLA 4HU7A 1WOUA 2VCTA 3TOUA 4AKIA 4PQ1A 2CAQA 1OYJA 4D73B 3PGTA 4H86A 3APOA 1QGVA 1B9XC 3IK7A 1TU8A 4JR4A 2LRCA 2C3TA 4TR1A 4I5QA 1XW9A 4O92A 5ELAA 3D5JA 1B8XA 4KDXA 3GL5A 4AJ6A 1YZXA 1XIYA 4I2TA 4JE1A 3FZ4A 2HRKA 4QQ7A 3K8NA 1ERTA 3FZ9A 1X0RA 1ERUA 4YAPA 3UBKA 1AQXA 1FB6A 3F9UA 2EFEA 2C3NA 2WVZA 1QMVA 1WMJA 2H19A 1Z7PA 3ZL5A 3PPUA 2N5FA 2RUEA 3QCPA 2HLSA 3HZ8A 4KE3A 1IYIA 1B4PA 3IAM2 2OE0A 4N0VA 3VWVA 2PGTA 4D73A 1ZYPA 2OE3A 1TP9A 1GSYA 4ECIA 2RLIA 4TOPA 2IIYA 4MJEA 1B4QA 5CRGA 3HJMA 2GLRA 5D9TA 2DLXA 2FWHA 2B1LA 1UA5A 2J23A 2AAWA 1DE1A 4GSTA 1GLQA 4KX4A 2WW3A 2K8SA 2EC4A 4O5UA 3TRPA 2PUKC 3ZMLA 5G5FA 4DEJA 2YCDA 2E0QA 3GNJA 1EP8A 2FA4A 3EU3A 2H30A 4NWYA 3DVWA 3ZIVA 1G0TA 2H8LA 4J57E 2M46A 4IGJA 4KDYA 2KLXA 3TJBA 1MDKA 4K2DA 2OT3A 2WW2A 3TU3B 2XPEA 1OKTA 5CRHA 2KP2A 2C3QA 4J2FA 2JACA 4K7IA 2F3MA 18GSA 4BPYA 3VWUA 2HRFA 2H0GA 3LJRA 4K8MA 4KNDA 5KN2A 4PNGA 1E6BA 2LKUA 2GT6A 4NMUA 2VL3A 1A24A 2H70A 4BVYB 2CZ2A 4MLYA 1TK0B 2H72A 3IE3A 5A34A 5IQYA 4EIPA 5KOXA 3CSJA 4MJAA 2Z9SA 4A5PA 1NSWA 2VAFA 4ZB6A 4EE0A 2XHFA 3IK9A 2B7KA 4BIKA 2WRTA 2C4JA 2DKIA 5ENUA 1XW5A 1T7PB 3G7JA 1SVLA 1PSQA 2REMA 2LJKA 1GP1A 1FO5A 1MDIA 4N30A 22GSA 2GSSA 4YQMA 3RHBA 2B5XA 3KGKA 3M9JA 1Y25A 2FWEA 1R5AA 4F9ZA 2VOCA 2HSYA 3UMAA 4I8BA 1V98A 3UOMA 1VF1A 2WW0A 4BVXB 5CO3A 1PFOA 2P0GA 4N11A 2B5YA 3QAVA 1GSFA 1SK0A 2KP1A 13GSA 1PN9A 2V2GA 1SYXA 1ZCPA 1PX6A 4AF2A 1FVKA 3GKMA 4MJCA 1TRWA 4MP4A 5B7CA 3GMFA 2LEGA 1HQOA 1ZYNA 2XPDA 5CP1A 4HJ2A 1M99A 5DAKB 5C04A 2HE3A 5D96A 4I6XA 3IC4A 3GSSA 4N10A 3TJKA 1VF2A 3EU4A 1MD4A 2IJYA 4IW9A 4POMA 1SL2B 4WF4A 5IMVA 2C1YA 3KP8A 1BEDA 5ELGA 4K1FA 2RIIA 1A2MA 2HZEB 2YWOA 3TUEA 3I69A 1TJDA 3RFRC 2IWTA 17GSA 3F8UA 4K5RA 1K0NA 1TXUA 4O32A 2HQTA 2H6ZA 1WP0A 4F0CA 1M2DA 5C00A 5IMFA 4Z2TA 3QDNA 1X9SB 1UC7A 1CQGA 2VL2A 4ZL7A 1BYEA 2DJ1A 2LRNA 5COHA 3EMPA 4V2MA 4JR6A 1K3LA 1Z7RA 2H75A 2EFCA 1YF0A 2I9HA 3TJFA 5B6MA 3MYDA 1TK8B 3KD0A 4ZL9A 4AKXB 3KXOA 4EDZA 2B1KA 3A5IA 1TW9A 5A4UA 3F4TA 3M3MA 4NAXA 2K9FA 3GURA 2HSNB 2IMEA 4DSRA 4FYBA 2OACA 3H93A 2GQKA 2EFHA 2JZSA 4O5RA 1U3IA 1G6YA 6GSYA 1DSBA 3BOAA 5J4VA 4OCEA 3KP9A 1R4WA 4XIHA 2CX4A 4TR0A 5IMZA 2RM6A 3U5RE 1A8LA 1SJ6A 5KEJA 1GTIA 5ID2B 1VF3A 2VUPA 3EPTA 4ISDA 4OWYA 2HSHA 1GTBA 2QSIA 2N5AA 3D0ZA 5B8AA 1U88A 2PU9C 4FH8A 1VGLA 1GNEA 1SK1A 2V6KA 3CXGA 2AJQB 3WGDA 4O7HA 1PN0A 3D4MA 2M72A 2OE1A 1GSSA 1XWAA 2GT5A 4KSOA 2F8FA 3W8SA 3N9JA 2VL2C 2A2SA 2YWMA 2IN3A 4F03A 1XWGA 4MZBA 4ULXA 2HZFA 3DD3A 3US3A 2NTOA 4YQVA 4MPGA 4EDYA 1T00A 3EINA 2VKZG 1M2BA 1XCCA 4Z2UA 1PKZA 1SYRA 1GSDA 1MDJA 2PVQA 4PX1A 4KCAA 4IS0A 1FOVA 1AUCA 3HKRA 1JLWA 3ME7A 1FG4A 2H74A 3MDKA 1JFUA 10GSA 2C0EA 1IYHA 3DVXA 2E2MA 19GSA 20GSA 3ZMKA 3RBTA 1GNWA 2VIMA 5KN1A 3RHCA 2J9HA 1SKWB 1TDIA 1YQ1A 1V58A 4HSCX 1K3OA 3DGQA 1SU9A 3F0IA 5IO0A 1DBYA 2DKHA 5EVOA 2LQQA 1TKDB 1YY7A 3AY8A 2VCQA 2WVYA 2NDOA 5A1NB 2D2ZA 4XS1A 1OC3A 3DXBA 3ZZXA 6GSWA 1QQ2A 4XS4B 1ZYEA 4K0GA 4I97A 1XWCA 5ECNB 4PQIA 2UV8G 3FR3A 3VWWA 2HXKA 1JZRA 2YN1A 5G1LA 3GX8A 1XFLA 4IQAA 1JZOA 3QPMA 3Q19A 2FWFA 2R2JA 4ZXGA 3ZREA 4OO5A 2MBTA 1GSUA 1FVJA 4G2EA 2F51A 4TR1B 4IBPA 1HYUA 2H1BA 3MSZA 2HSMB 1AXDA 2GZYA 1GLPA 2VO4A 2ZCTA 4N3ZA 2H1AA 3FEUA 5HQPA 4GLTA 3QMXA 2YWIA 2QC7A 1ML6A 2OADA 8GSSA 3Q18A 5DBQA 4ZB7A 4ECJA 4PTSA 3UJ1A 1AQVA 5HR0A 3HZ4A 1K0MA 1GUKA 4WR4A 5A1NA 5FT3A 5E59A 2YJHA 3WYWA 2WVXB 1EGOA 1SENA 1PA3A 3M0FA 1YKCA 2EFDA 5E4WA 1QUWA 2OBKA 1PX7A 4L5LA 5JCWA 1E2YA 1XG8A 2R5GA 3C1RA 4Q5FA 4RQXA 2WGRA 1SVOA 4YAVA 4PUFC 4KAEA 4NXIA 3ERGA 1XWBA 4OD7A 1XWKA 2YZHA 3GX0A 4Z2RA 1K0AA 2HSMA 3LORA 4AJ8A 4FXYP 2DMLA 3L9UA 2DJ0A 1HD2A 1SL1B 3E9JB 1LBKA 2VLVA 3CRUA 3D21A 5F07A 2LJAA 5DQYA 5H5RA 3WGXA 2OBIA 4CHSA 3EC3A 4CW9A 4MJBA 2NVLA 2WVXA 4ZBBA 2JU5A 3GA4A 3DYRA 5J9CA 2YOIA 1XBSA 3GKXA 4I2UA 4O5QA 4TN8A 3E0UA 3H4KA 4EUYA 2R0CA 1YVLA 4G0KA 2O85A 4HZ4A 3KCMA 1BF5A 4QMKA 2X49A 4ZL8A 4X1UA 4TR3A 1ZGNA 1MTCA 5D9VA 1U87A 1O8WA 2B3SA 3TRXA 5GSTA 5G2ZA 1QK8A 4G01A 4KF9A 5J9BA 5EY6A 2EIOA 3GV1A 3CTGA 3TGZA 4FYCA 14GSA 1GSQA 1FHEA 5J5NA 1WWJA 4X0XA 3UVHA 2X8CA 5A34B 5G5EA 4MZWA 1W4VA 3VPQA 3VK9A 4DVCA 1UN2A 2F8AA 5ECHB 3P8WA 5IM9A 4TXOA 2LS5A 3IC8A 5D9WA 4BA7A 4KDUA 1G6WA 2O8VB 4OFTA 1PL1A 3IBHA 1KEBA 3PH9A 1B9YC 2IMIA 3S9FA 3TCOA 2M80A 1FAAA 1WPIA 3A3TA 1TRSA 4ZILA 3ZIJA 5J47A 3IV4A 1XOAA 4E8HA 5AGYA 1M2AA 1AW9A 2L5OA 2X8GA 4EXJA 3F4SA 1O7UA 5FWGA 1URMA 4KUNA 4YQUA 4POBA 5AN1A 4BWQA 2HT9A 5G31A 2VL9A 1PQNA 3WD6A 3WT1A 3VI7A 4NV5A 1T3BA 2FY6A 3UEMA 1V40A 1VF4A 4E68A 1A0RP 3GYKA 1M3JA 2H0HA 1ZOFA 2YJ7A 3ME8A 4FQUA 1H4OA 3GH6A 5LCZA 3TB2A 1N2AA 5J41A 3IOSA 2PN8A 4Z7XA 4G0LA 1TTZA 1R5PA 3F63A 4AKGA 3LFLA 5CNWA 3ZLPA 2PVOC 4TKYA 3ZITA 4AI6A 1X5EA 4IELA 4PXOA 1U6TA 3ZFLA 2JADA 4ICYA 1Z3EA 1GL8A 5LD0A 5ECPB 3J7Yb 2H0IA 3LYPA 3FYGA 5JWOB 3MWHA 4AGSA 2G2QA 4OCFA 3HJOA 5ECMB 1I9DA 3RDWA 2JZRA 3VLNA 2HRAA 3F3QA 2GQMA 2BTOT 5DQSA 2ALBA 4EIQA 5AISA 1G7EA 4K5SA 3KMNA 4GWRA 1B48A 2R37A 5ECLB 3MNGA 1F2EA 2GSTA 1XPVA 2NBSA 2CAIA 3GUSA 3W6GA 3VURA 3QFAC 5HFGA 2AHEA 4ID0A 4KB3A 3VPTA 3EMXA 1EGRA 3KTBA 4ECBA 3D22A 5ECOB 2NPBA 1BG1A 3Q6OA 4LLRA 2ES7A 2H6XA 2VLUA 1V9WA 3WT2A 3QR6A 4DSSA 4TXVA 2B5EA 2HFDA 3LQ7A 4EVMA 4GXZA 3H1NA 5D93A 2C0GA 1PD21 3F6FA 1I5GA 4GQCA 4V2NA 2RUFA 3I9V2 2YV9A 3I43A 2VM2A 2L6DA 3HVVA 3LSZA 2GQLA 2KHPA 2L57A 3CSIA 5A5HA 3FKFA 1A23A 1FB0A 4MF5A 5D73A 3IHGA 2FA8A 1O6JA 2HRNA 2R0GA 1SL0B 4G0IA 5KN0A 5CRDA 2FHEA 2TRXA 3UVTA 4USSA 3D6IA 3P90A 6GSXA 6GSSA 5HR2A 1HNCA 5J4YA 3IPZA 1WE0A 3GL3A 2DSAA 1EP7A 3RGBC 4HUAA 3L9VA 1YF1A 5EPFA 1YJ6A 3DEXA 5H5SA 4IVFA 1ILOA 1ZYQB 2H1LA 16GSA 1M9AA 3NOFA 1AIUA 2A2RA 4EC0A 3EYTA 1F37A 5CYYA 5ECQB 1ABAA 1TU7A 4ZB8A 3LGCA 3EURA 2H73A 1JLVA 3KIJA 4Q5RA 1EEJA 2IMDA 3TKRA 2VCWA 3EVIA 2L5LA 3HJPA 3FHKA 3O76A 3G9BA 4YKFA 2CVDA 2MMNA 3TKSE 1JZWA 2CQ9A 3FMWA 3UIWA 4GSNA 2OJLA 2JZTA 1YKAA 1YEXA 1F9MA 2CV4A 1V57A 3MIXA 3IRAA 1M9BA 4EF0A 2WULA 2C80A 4RI7A 2F9SA 1MD3A 3KTLA 4HQZA 1J08A 1UVZA 4IN0A 4IQ1A 5ECIB 1SJZA 1EV4A 3TKPA 2GS3A 1O81A 3GFKA 3FW2A 4V1Ag 3KEBA 2YV7A 1RK4A 4ACSA 3DWVA 4KH7A 1DUGA 1EV9A 1QFNA 1BX9A 4IHUA 3PINA 2P5QA 5INYA 5IMCA 3JCML 3HD5A 2H1GA 4XHMA 2PBJA 4ZBDA 2QA1A 1OE7A 1M0UA 4YH2A 2JSZA 2FCHA 5F0GA 4ZIJA 1A8YA 2E7PA 1ON4A 4XRDA 2O3EA 4JZQA 3D4TA 3HHVA 4GSSA 3VI5A 4HJMA 3LYKA 4N0ZA 4OFNA 4LA1A 2I3YA 4IKHA 2WFCA 2CVKA 4FIWA 5DALA 4MH2A 1EZKA 4K7NA 1JHBA 1O73A 3ZTLA 1MEKA 2DJ2A 2BMXA 5D9XA 1SVMA 2DC5A 3IHQA 1K0CA 6GSVA 3CMIA 1O8XA 5B6NA 5D8IA 4MH3A 2VM1A 1NHOA 2WS2A 5DJMA 5DCGA 4MK3A 1OAZA 1TOFA 4L0WA 5IOXA 1OKDA 2XC2A 1GTUA 5F05A 1YDKA 4GTUA 2B6MA 4PURA 2HNLA 1BG5A 3GHAA 4XTSA 1V2AA 1Q98A 2V32A 3VFIA 2O87A 2DJKA 4MPFA 2DJJA 2X64A 3RPPA 3FZ5A 2EIQA 3GKNA 3IA1A 1ST9A 5DCHA 2LRTA 1SKSB 1ERVA 5EL8A 4CY6A 1K0OA 1VRSD 1GULA 5HR1A 2L4QA 1X5DA 2VLTA 4MABA 2P5RA 3DKSA 4JU5A 4PUAA 1SKRB 4G10A 5IMAA 1FW1A 4CDOA 3CYNA 3ZYWA 5G30A 4OMVA 2X8HA 3QFBC 1AQWA 1W89A 1CQHA 5IIZA 4ZB9A 2C8UA 1J0FA 2R4VA 5J3RA 4Q5NA 3ERFA 5IO2A 4Q5QA 5GAPD 1KTEA 3HMJG 1ZZYA 4GQFA 2LNSA 5HR3A 4L5OA 5FHIA 5LNKe 3BCIA 2VCXA 5BMUA 3OR5A 4P3YB 1SK2A 3P2AA 2OKAA 4HI7A 3UL3A 2O5VA 2UZ8A 7GSSA 4F0BA 2CT6A 1S4BP 2VD0A 4TXOB 4K2XA 1R26A 4TRXA 3M8NA 3LXTA 4IP1A 3ZRDA 5HFKA 5ECKB 1BJXA 1KBNA 5L71A 2V6OA 3KMOA 3IXRA 3RAZA 1XZOA 3QOUA 4QL7A 3GKKA 3J7Yk 4K7OA 4F82A 5G1KA 3E3EA 2YNXA 4RI6A 3LEFA 4IJIA 2RM5A 4PI2C 2VD1A 1TRVA 3LWAA 2IMKA 3KM6A 3L0HA 3HCZA 4ML1A 4HOJA 3L78A 1HNAA 2LJRA 4K0NA 2AB6A 5DDLA 1EOGA 1S3AA 4X43A 2AV4A 5J40A 1PL2A 5DJLA 4LL1B 5HFIA 3CWGA 2A4VA 2ZUPA 9GSSA 2CVBA 1AAZA 4HDEA 2WB9A 3CSHA 3M9KA 3U6VA 1T4YA 5J4UA 4KGIA 1PKWA 2H6YA 2BJXA 2E2GA 4WBRD 4L8EA 4WKWA 1Z9HA 3I6AA 4FO5A 4J56E 3L9SA 2GSRA 3GTUB 3O3TA 2MZCA 4EL1A 4MDCA 2CA8A 4POLA 1BQ7A 2B7JA 2CZ3A 3KZQA 4MF6A 2MMOA 2H76A 2LQOA 3FR6A 4K6XA 5IMDA 3A2VA 3IR4A 2A4HA 4PI0C 1ACVA 2KOKA
chains in the Genus database with same CATH topology
1SD9A 1TI3A 3GIXA 2YZUA 5JCGA 3F6DA 5IPGA 3BD2A 6GSUA 3MAKA 2JL4A 4JBBA 3TJGA 1N25A 3HA9A 4FYUA 3R3EA 4JEDA 3FRCA 1TRUA 1T8EB 2H66A 3R2QA 3ZVJA 4LMWA 3M1GA 2K6VA 4LMVA 1Q4JA 4X4JA 5F8BA 1NM3A 3QAWA 1PRXA 2WJUA 1X5CA 3IDVA 4TVEA 1OE8A 3KH7A 4PQHA 3GTUA 2DMMA 2IFQB 2X99A 5A4WA 5AIVA 5BRTA 4GDFA 4ZBAA 3GN3A 3DRNA 4ILFA 2GDRA 5ABRA 4AJ7A 2MMZA 4DSQA 3LW9A 3HVXA 4KW6A 3DIEA 1OVNA 1JZDA 1THXA 11GSA 2FGXA 4DSSB 4HZ2A 2XBIA 3IAS2 4HEA2 3KJYA 3CTFA 3ED3A 4PGTA 1GRXA 1TI1A 5CAXA 4BVYA 2A2PA 4ML6A 4MNNA 3C7MA 4HS1A 1BAYA 2EIRA 2R3XA 3H79A 2KUCA 5CRWA 2X4AA 2HI7A 5A5HB 1X9MB 4HU9A 3C71A 1XXUA 1NW2A 1XVQA 5ECRB 5H5QA 1SJIA 1PGTA 1QXHA 4AKHA 2LSTA 3FY7A 1USBA 2IFQA 4ECCA 4V2LA 5B8BA 5GZZB 4RUVA 1S3CA 3TOTA 1XW6A 3HXSA 2MBSA 3TDGA 2H71A 3ERWA 1GSEA 3G7IA 1RQMA 2DIZA 2QA2A 2PWJA 2OA7A 1Z5YE 3RPNA 1GTAA 1A2JA 1KNGA 4L0UA 4BVXA 5CREA 1GUMA 3A2WA 4GRFA 1U3AA 3GH9A 4IJ3A 4KA0A 5JCUA 3VWXA 2QKEA 3NIVA 4BL7B 3FR9A 3ZVJD 1EWXA 6GSTA 1THOA 5KOWA 1R7HA 4YKGA 2TRCP 5ECSA 1NHYA 2I1UA 1OC9B 4MMMA 5KN3A 1F6MC 2WZ9A 3TKSA 4BWSA 5DAKA 2LV3A 3HDCA 4WETA 1C72A 4POKA 3P7XA 1HNBA 3A2XA 1TK5B 5GAND 1Z6MA 3TKQA 3FK8A 3NZNA 2ON7A 2HZEA 2YWNA 1Y1UA 5F06A 2WDUA 12GSA 5DVBA 4IP6A 4MF7A 4OFMA 1O85A 3APQA 4BL7A 2LNTA 2AYTA 1F3BA 2QGVA 2GGTA 3A5WA 2FWGA 4W66A 2FNOA 4WXTA 2IMFA 1LJRA 2DJ3A 5GSSA 3LXZA 2O7KA 3C1SA 1RW1A 4K9ZA 1OC9A 1T4ZA 3QAGA 2K8VA 2GSQA 1K0BA 4XCSA 1ZMAA 4CY8A 4WBJA 5JWRB 1GUHA 3HVSA 2PERA 3ISOA 1T1VA 2PMTA 1ERWA 2AUVA 4QL9A 5IOWA 5A5KA 2P31A 3HYPA 1WRYA 1G7OA 2HSNA 3CRTA 3UAPA 2ON5A 3L4NA 4MA9A 5DALB 3HY2A 1XVWA 3TKSC 3LG6A 4WR5A 2L59A 2K18A 3V1WA 2O89A 3BCKA 3F3RA 1N8JA 2LTKA 1WJKA 2R0PA 1ZL9A 2C0FA 3O6TA 4E8EA 1AC1A 1J9BA 1H75A 1FOHA 3W8JA 2PPTA 2LUSA 5ID2A 2YPMA 2V1MA 4RQRA 3C73A 4NHZA 3H8QA 1SD8A 1GH2A 1K0DA 1EOHA 2FUG2 2I4AA 1X9WB 3GSTA 2V41A 4EO3A 4NHWA 2JSYA 4JRRA 5IPHA 2DBCA 3PR8A 3EE2A 2GTUA 2FLSA 1A0FA 4KSMA 4HQSA 3Q74A 1S3DA 4NPBA 2YP6A 2VCVA 2FD3A 4WEYA 2H01A 2TIRA 1OC8A 3SWLA 4TW5A 4TR4A 4XS6A 4PNFA 3APSA 2IL3A 3F4RA 4LL4B 4GF0A 2GVPA 2MMAA 2N5BA 5JWQB 3KH9A 1K3YA 2XBQA 1F3AA 2YANA 3QD9A 1TXXA 4KCEA 2L4CA 2G0FA 1GWCA 5A4VA 3N5OA 4NV2A 2HYXA 4GCIA 1A2LA 3FZAA 1XOBA 3ZFBA 4WF5A 3BJ5A 1LU4A 2GZPA 3UBLA 3CBUA 2WCIA 1DE2A 3C8EA 4MZCA 4F2IA 2L6CA 3GRXA 3TJJA 5BMUB 3SBCA 2I81A 2R6KA 4EKZA 1WIKA 3BBYA 2HRKB 1Y6EA 4XRAA 2VCZA 4OO4A 2GZZA 2ZNMA 2CX3A 2DIYA 3WGEA 1Z6NA 1EEMA 2IPAA 1M7TA 3DMLA 2H1DA 3TRQA 3G7YA 2MYGA 1PMTA 5AIXA 4XS4A 4G19A 2C0DA 4MCUA 3UARA 4V1Ap 1YEPA 4G9HA 3EWLA 4HU7A 1WOUA 2VCTA 3TOUA 4AKIA 4PQ1A 2CAQA 1OYJA 4D73B 3PGTA 4H86A 3APOA 1QGVA 1B9XC 3IK7A 1TU8A 4JR4A 2LRCA 2C3TA 4TR1A 4I5QA 1XW9A 4O92A 5ELAA 3D5JA 1B8XA 4KDXA 3GL5A 4AJ6A 1YZXA 1XIYA 4I2TA 4JE1A 3FZ4A 2HRKA 4QQ7A 3K8NA 1ERTA 3FZ9A 1X0RA 1ERUA 4YAPA 3UBKA 1AQXA 1FB6A 3F9UA 2EFEA 2C3NA 1QMVA 1WMJA 2H19A 1Z7PA 3ZL5A 3PPUA 2N5FA 2RUEA 3QCPA 2HLSA 3HZ8A 4KE3A 1IYIA 1B4PA 3IAM2 2OE0A 4N0VA 3VWVA 2PGTA 4D73A 1ZYPA 2OE3A 1TP9A 1GSYA 4ECIA 2RLIA 4TOPA 2IIYA 4MJEA 1B4QA 5CRGA 3HJMA 2GLRA 5D9TA 2DLXA 2FWHA 2B1LA 1UA5A 2J23A 2AAWA 1DE1A 4GSTA 1GLQA 4KX4A 2K8SA 2EC4A 4O5UA 3TRPA 2PUKC 3ZMLA 5G5FA 4DEJA 2YCDA 2E0QA 3GNJA 1EP8A 2FA4A 3EU3A 2H30A 4NWYA 3DVWA 3ZIVA 1G0TA 2H8LA 4J57E 2M46A 4IGJA 4KDYA 2KLXA 3TJBA 1MDKA 4K2DA 2OT3A 3TU3B 2XPEA 1OKTA 5CRHA 2KP2A 2C3QA 4J2FA 2JACA 4K7IA 2F3MA 18GSA 4BPYA 3VWUA 2HRFA 2H0GA 3LJRA 4K8MA 4KNDA 5KN2A 4PNGA 1E6BA 2LKUA 2GT6A 4NMUA 2VL3A 1A24A 2H70A 4BVYB 2CZ2A 4MLYA 1TK0B 2H72A 3IE3A 5A34A 5IQYA 4EIPA 5KOXA 3CSJA 4MJAA 2Z9SA 4A5PA 1NSWA 2VAFA 4ZB6A 4EE0A 2XHFA 3IK9A 2B7KA 2WRTA 2C4JA 2DKIA 5ENUA 1XW5A 1T7PB 3G7JA 1SVLA 1PSQA 2REMA 2LJKA 1GP1A 1FO5A 1MDIA 4N30A 22GSA 2GSSA 4YQMA 3RHBA 2B5XA 3KGKA 3M9JA 1Y25A 2FWEA 1R5AA 4F9ZA 2VOCA 2HSYA 3UMAA 4I8BA 1V98A 3UOMA 1VF1A 4BVXB 5CO3A 2P0GA 4N11A 2B5YA 3QAVA 1GSFA 1SK0A 2KP1A 13GSA 1PN9A 2V2GA 1SYXA 1ZCPA 1PX6A 4AF2A 1FVKA 3GKMA 4MJCA 1TRWA 4MP4A 5B7CA 3GMFA 2LEGA 1HQOA 1ZYNA 2XPDA 5CP1A 4HJ2A 1M99A 5DAKB 5C04A 2HE3A 5D96A 4I6XA 3IC4A 3GSSA 4N10A 3TJKA 1VF2A 3EU4A 1MD4A 2IJYA 4IW9A 4POMA 1SL2B 4WF4A 5IMVA 2C1YA 3KP8A 1BEDA 5ELGA 4K1FA 2RIIA 1A2MA 2HZEB 2YWOA 3TUEA 3I69A 1TJDA 2IWTA 17GSA 3F8UA 4K5RA 1K0NA 1TXUA 4O32A 2HQTA 2H6ZA 1WP0A 4F0CA 1M2DA 5C00A 5IMFA 4Z2TA 3QDNA 1X9SB 1UC7A 1CQGA 2VL2A 4ZL7A 1BYEA 2DJ1A 2LRNA 5COHA 3EMPA 4V2MA 4JR6A 1K3LA 1Z7RA 2H75A 2EFCA 1YF0A 2I9HA 3TJFA 5B6MA 3MYDA 1TK8B 3KD0A 4ZL9A 4AKXB 3KXOA 4EDZA 2B1KA 3A5IA 1TW9A 5A4UA 3F4TA 3M3MA 4NAXA 2K9FA 3GURA 2HSNB 2IMEA 4DSRA 4FYBA 2OACA 3H93A 2GQKA 2EFHA 2JZSA 4O5RA 1U3IA 1G6YA 6GSYA 1DSBA 3BOAA 5J4VA 4OCEA 3KP9A 1R4WA 4XIHA 2CX4A 4TR0A 5IMZA 2RM6A 3U5RE 1A8LA 1SJ6A 5KEJA 1GTIA 5ID2B 1VF3A 2VUPA 3EPTA 4ISDA 4OWYA 2HSHA 1GTBA 2QSIA 2N5AA 3D0ZA 5B8AA 1U88A 2PU9C 4FH8A 1VGLA 1GNEA 1SK1A 2V6KA 3CXGA 2AJQB 3WGDA 4O7HA 1PN0A 3D4MA 2M72A 2OE1A 1GSSA 1XWAA 2GT5A 4KSOA 2F8FA 3W8SA 3N9JA 2VL2C 2A2SA 2YWMA 2IN3A 4F03A 1XWGA 4MZBA 4ULXA 2HZFA 3DD3A 3US3A 2NTOA 4YQVA 4MPGA 4EDYA 1T00A 3EINA 2VKZG 1M2BA 1XCCA 4Z2UA 1PKZA 1SYRA 1GSDA 1MDJA 2PVQA 4PX1A 4KCAA 4IS0A 1FOVA 1AUCA 3HKRA 1JLWA 3ME7A 1FG4A 2H74A 3MDKA 1JFUA 10GSA 2C0EA 1IYHA 3DVXA 2E2MA 19GSA 20GSA 3ZMKA 3RBTA 1GNWA 2VIMA 5KN1A 3RHCA 2J9HA 1SKWB 1TDIA 1YQ1A 1V58A 1K3OA 3DGQA 1SU9A 3F0IA 5IO0A 1DBYA 2DKHA 5EVOA 2LQQA 1TKDB 1YY7A 3AY8A 2VCQA 2NDOA 5A1NB 2D2ZA 4XS1A 1OC3A 3DXBA 3ZZXA 6GSWA 1QQ2A 4XS4B 1ZYEA 4K0GA 4I97A 1XWCA 5ECNB 4PQIA 2UV8G 3FR3A 3VWWA 2HXKA 1JZRA 2YN1A 5G1LA 3GX8A 1XFLA 4IQAA 1JZOA 3QPMA 3Q19A 2FWFA 2R2JA 4ZXGA 3ZREA 4OO5A 2MBTA 1GSUA 1FVJA 4G2EA 2F51A 4TR1B 4IBPA 3MSZA 1HYUA 2H1BA 2HSMB 1AXDA 2GZYA 1GLPA 2VO4A 2ZCTA 4N3ZA 2H1AA 3FEUA 5HQPA 4GLTA 3QMXA 2YWIA 2QC7A 1ML6A 2OADA 8GSSA 3Q18A 5DBQA 4ZB7A 4ECJA 4PTSA 3UJ1A 1AQVA 5HR0A 3HZ4A 1K0MA 1GUKA 4WR4A 5A1NA 5FT3A 5E59A 2YJHA 3WYWA 1EGOA 1SENA 1PA3A 3M0FA 1YKCA 2EFDA 5E4WA 1QUWA 2OBKA 1PX7A 4L5LA 5JCWA 1E2YA 2R5GA 3C1RA 4Q5FA 4RQXA 2WGRA 1SVOA 4YAVA 4PUFC 4KAEA 4NXIA 3ERGA 1XWBA 4OD7A 1XWKA 2YZHA 3GX0A 4Z2RA 1K0AA 2HSMA 3LORA 4AJ8A 2DMLA 3L9UA 2DJ0A 1HD2A 1SL1B 3E9JB 1LBKA 2VLVA 3CRUA 3D21A 5F07A 2LJAA 5DQYA 5H5RA 3WGXA 2OBIA 4CHSA 3EC3A 4CW9A 4MJBA 2NVLA 4ZBBA 2JU5A 3GA4A 3DYRA 5J9CA 2YOIA 1XBSA 3GKXA 4I2UA 4O5QA 4TN8A 3E0UA 3H4KA 4EUYA 2R0CA 1YVLA 4G0KA 2O85A 4HZ4A 3KCMA 1BF5A 4QMKA 2X49A 4ZL8A 4X1UA 4TR3A 1ZGNA 1MTCA 5D9VA 1U87A 1O8WA 2B3SA 3TRXA 5GSTA 5G2ZA 1QK8A 4G01A 4KF9A 5J9BA 5EY6A 2EIOA 3GV1A 3CTGA 3TGZA 4FYCA 14GSA 1GSQA 1FHEA 5J5NA 1WWJA 4X0XA 3UVHA 2X8CA 5A34B 5G5EA 4MZWA 1W4VA 3VPQA 3VK9A 4DVCA 1UN2A 2F8AA 5ECHB 3P8WA 5IM9A 4TXOA 2LS5A 3IC8A 5D9WA 4BA7A 4KDUA 1G6WA 2O8VB 4OFTA 1PL1A 3IBHA 1KEBA 3PH9A 1B9YC 2IMIA 3S9FA 3TCOA 2M80A 1FAAA 1WPIA 3A3TA 1TRSA 4ZILA 3ZIJA 5J47A 3IV4A 1XOAA 4E8HA 5AGYA 1M2AA 1AW9A 2L5OA 2X8GA 4EXJA 3F4SA 1O7UA 5FWGA 1URMA 4KUNA 4YQUA 4POBA 5AN1A 4BWQA 2HT9A 5G31A 2VL9A 1PQNA 3WD6A 3WT1A 3VI7A 4NV5A 1T3BA 2FY6A 3UEMA 1V40A 1VF4A 4E68A 1A0RP 3GYKA 2H0HA 1ZOFA 2YJ7A 3ME8A 4FQUA 1H4OA 3GH6A 5LCZA 3TB2A 1N2AA 5J41A 3IOSA 2PN8A 4Z7XA 4G0LA 1TTZA 1R5PA 3F63A 4AKGA 3LFLA 5CNWA 3ZLPA 2PVOC 4TKYA 3ZITA 4AI6A 1X5EA 4IELA 4PXOA 1U6TA 3ZFLA 2JADA 4ICYA 1Z3EA 1GL8A 5LD0A 5ECPB 3J7Yb 2H0IA 3LYPA 3FYGA 5JWOB 3MWHA 4AGSA 2G2QA 4OCFA 3HJOA 5ECMB 1I9DA 3RDWA 2JZRA 3VLNA 2HRAA 3F3QA 2GQMA 2BTOT 5DQSA 2ALBA 4EIQA 5AISA 1G7EA 4K5SA 3KMNA 4GWRA 1B48A 2R37A 5ECLB 3MNGA 1F2EA 2GSTA 1XPVA 2NBSA 2CAIA 3GUSA 3W6GA 3VURA 3QFAC 5HFGA 2AHEA 4ID0A 4KB3A 3VPTA 3EMXA 1EGRA 3KTBA 4ECBA 3D22A 5ECOB 2NPBA 1BG1A 3Q6OA 4LLRA 2ES7A 2H6XA 2VLUA 1V9WA 3WT2A 3QR6A 4DSSA 4TXVA 2B5EA 2HFDA 3LQ7A 4EVMA 4GXZA 3H1NA 5D93A 2C0GA 1PD21 3F6FA 1I5GA 4GQCA 4V2NA 2RUFA 3I9V2 2YV9A 3I43A 2VM2A 2L6DA 3HVVA 3LSZA 2GQLA 2KHPA 2L57A 3CSIA 5A5HA 3FKFA 1A23A 1FB0A 4MF5A 5D73A 3IHGA 2FA8A 1O6JA 2HRNA 2R0GA 1SL0B 4G0IA 5KN0A 5CRDA 2FHEA 2TRXA 3UVTA 4USSA 3D6IA 3P90A 6GSXA 6GSSA 5HR2A 1HNCA 5J4YA 3IPZA 1WE0A 3GL3A 2DSAA 1EP7A 4HUAA 3L9VA 1YF1A 5EPFA 1YJ6A 3DEXA 5H5SA 4IVFA 1ILOA 1ZYQB 2H1LA 16GSA 1M9AA 3NOFA 1AIUA 2A2RA 4EC0A 3EYTA 1F37A 5CYYA 5ECQB 1ABAA 1TU7A 4ZB8A 3LGCA 3EURA 2H73A 1JLVA 3KIJA 4Q5RA 1EEJA 2IMDA 3TKRA 2VCWA 3EVIA 2L5LA 3HJPA 3FHKA 3O76A 3G9BA 4YKFA 2CVDA 2MMNA 3TKSE 1JZWA 2CQ9A 3FMWA 3UIWA 4GSNA 2OJLA 2JZTA 1YKAA 1YEXA 1F9MA 2CV4A 1V57A 3MIXA 3IRAA 1M9BA 4EF0A 2WULA 2C80A 4RI7A 2F9SA 1MD3A 3KTLA 4HQZA 1J08A 1UVZA 4IN0A 4IQ1A 5ECIB 1SJZA 1EV4A 3TKPA 2GS3A 1O81A 3GFKA 3FW2A 4V1Ag 3KEBA 2YV7A 1RK4A 4ACSA 3DWVA 4KH7A 1DUGA 1EV9A 1QFNA 1BX9A 4IHUA 3PINA 2P5QA 5INYA 5IMCA 3JCML 3HD5A 2H1GA 4XHMA 2PBJA 4ZBDA 2QA1A 1OE7A 1M0UA 4YH2A 2JSZA 2FCHA 5F0GA 4ZIJA 1A8YA 2E7PA 1ON4A 4XRDA 4JZQA 3D4TA 3HHVA 4GSSA 3VI5A 4HJMA 3LYKA 4N0ZA 4OFNA 4LA1A 2I3YA 4IKHA 2WFCA 2CVKA 4FIWA 5DALA 4MH2A 1EZKA 4K7NA 1JHBA 1O73A 3ZTLA 1MEKA 2DJ2A 2BMXA 5D9XA 1SVMA 2DC5A 3IHQA 1K0CA 6GSVA 3CMIA 1O8XA 5B6NA 5D8IA 4MH3A 2VM1A 1NHOA 2WS2A 5DJMA 5DCGA 4MK3A 1OAZA 1TOFA 4L0WA 5IOXA 1OKDA 2XC2A 1GTUA 5F05A 1YDKA 4GTUA 2B6MA 4PURA 2HNLA 1BG5A 3GHAA 4XTSA 1V2AA 1Q98A 2V32A 3VFIA 2O87A 2DJKA 4MPFA 2DJJA 2X64A 3RPPA 3FZ5A 2EIQA 3GKNA 3IA1A 1ST9A 5DCHA 2LRTA 1SKSB 1ERVA 5EL8A 4CY6A 1K0OA 1VRSD 1GULA 5HR1A 2L4QA 1X5DA 2VLTA 4MABA 2P5RA 3DKSA 4JU5A 4PUAA 1SKRB 4G10A 5IMAA 1FW1A 4CDOA 3CYNA 3ZYWA 5G30A 4OMVA 2X8HA 3QFBC 1AQWA 1W89A 1CQHA 5IIZA 4ZB9A 2C8UA 1J0FA 2R4VA 5J3RA 4Q5NA 3ERFA 5IO2A 4Q5QA 5GAPD 1KTEA 3HMJG 1ZZYA 4GQFA 2LNSA 5HR3A 4L5OA 5FHIA 5LNKe 3BCIA 2VCXA 5BMUA 3OR5A 4P3YB 1SK2A 3P2AA 2OKAA 4HI7A 3UL3A 2O5VA 2UZ8A 7GSSA 4F0BA 2CT6A 2VD0A 4TXOB 4K2XA 1R26A 4TRXA 3M8NA 3LXTA 4IP1A 3ZRDA 5HFKA 5ECKB 1BJXA 1KBNA 5L71A 2V6OA 3KMOA 3IXRA 3RAZA 1XZOA 3QOUA 4QL7A 3GKKA 3J7Yk 4K7OA 4F82A 5G1KA 3E3EA 2YNXA 4RI6A 3LEFA 4IJIA 2RM5A 2VD1A 1TRVA 3LWAA 2IMKA 3KM6A 3L0HA 3HCZA 4ML1A 4HOJA 3L78A 1HNAA 2LJRA 4K0NA 2AB6A 5DDLA 1EOGA 1S3AA 4X43A 2AV4A 5J40A 1PL2A 5DJLA 4LL1B 5HFIA 3CWGA 2A4VA 2ZUPA 9GSSA 2CVBA 1AAZA 4HDEA 2WB9A 3CSHA 3M9KA 3U6VA 1T4YA 5J4UA 4KGIA 1PKWA 2H6YA 2BJXA 2E2GA 4WBRD 4L8EA 4WKWA 1Z9HA 3I6AA 4FO5A 4J56E 3L9SA 2GSRA 3GTUB 3O3TA 2MZCA 4EL1A 4MDCA 2CA8A 4POLA 1BQ7A 2B7JA 2CZ3A 3KZQA 4MF6A 2MMOA 2H76A 2LQOA 3FR6A 4K6XA 5IMDA 3A2VA 3IR4A 2A4HA 1ACVA 2KOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD2 1;  3F6F A;  4O92 A;  10GS A;  1IYH A;  5ELA A;  19GS A;  1B8X A;  3F6D A;  20GS A;  2YV9 A;  4KDX A;  6GSU A;  3LSZ A;  3MAK A;  2JL4 A;  4JBB A;  3CSI A;  2HRK A;  3ZMK A;  4QQ7 A;  3RBT A;  1GNW A;  3R3E A;  4JED A;  3FRC A;  4MF5 A;  5D73 A;  2J9H A;  3R2Q A;  4LMW A;  3M1G A;  1TDI A;  1YQ1 A;  4YAP A;  4LMV A;  1Q4J A;  3UBK A;  1AQX A;  5F8B A;  1K3O A;  3DGQ A;  3QAW A;  2WJU A;  4G0I A;  5EVO A;  2C3N A;  1YY7 A;  3AY8 A;  2FHE A;  2VCQ A;  4USS A;  1OE8 A;  3P90 A;  6GSX A;  3PPU A;  4PQH A;  3GTU A;  2D2Z A;  6GSS A;  2N5F A;  6GSW A;  1HNC A;  4KE3 A;  1IYI A;  4K0G A;  4I97 A;  1B4P A;  5A4W A;  2DSA A;  5ECN B;  4PQI A;  5AIV A;  4N0V A;  3FR3 A;  4ZBA A;  1JZR A;  1YJ6 A;  2PGT A;  2GDR A;  4IVF A;  4IQA A;  3Q19 A;  16GS A;  1GSY A;  1M9A A;  4ECI A;  4ZXG A;  11GS A;  2A2R A;  4TOP A;  4EC0 A;  4HZ2 A;  1GSU A;  3KJY A;  4PGT A;  3HJM A;  5ECQ B;  2GLR A;  5D9T A;  4IBP A;  1TU7 A;  1UA5 A;  4ZB8 A;  4BVY A;  2HSM B;  1AXD A;  2AAW A;  1GLP A;  2VO4 A;  1BAY A;  1JLV A;  4Q5R A;  2R3X A;  4GST A;  2VCW A;  1GLQ A;  4KX4 A;  4GLT A;  1ML6 A;  2OAD A;  3ZML A;  8GSS A;  3Q18 A;  5G5F A;  4DEJ A;  3O76 A;  4ECJ A;  2YCD A;  4PTS A;  5ECR B;  1AQV A;  1PGT A;  2CVD A;  1K0M A;  3FY7 A;  1GUK A;  1USB A;  4WR4 A;  4ECC A;  5FT3 A;  3WYW A;  5GZZ B;  4GSN A;  1PA3 A;  3M0F A;  4IGJ A;  4KDY A;  1XW6 A;  3TOT A;  1YKC A;  1GSE A;  3G7I A;  1M9B A;  2OA7 A;  2C80 A;  4RI7 A;  1PX7 A;  1MD3 A;  4L5L A;  1GTA A;  1OKT A;  3KTL A;  5JCW A;  4BVX A;  2R5G A;  4Q5F A;  4IQ1 A;  1GUM A;  5ECI B;  1EV4 A;  2C3Q A;  4YAV A;  4J2F A;  5JCU A;  4KAE A;  2F3M A;  3ERG A;  18GS A;  3VWX A;  1XWK A;  3NIV A;  3GX0 A;  4BL7 B;  3LJR A;  1K0A A;  2HSM A;  2YV7 A;  1RK4 A;  4ACS A;  3FR9 A;  4PNG A;  4KH7 A;  1DUG A;  1E6B A;  1EV9 A;  1BX9 A;  6GST A;  4BVY B;  2CZ2 A;  5ECS A;  2PBJ A;  4ZBD A;  3IE3 A;  1LBK A;  1NHY A;  1OE7 A;  1M0U A;  4YH2 A;  3CRU A;  5F0G A;  5IQY A;  5F07 A;  5DAK A;  3CSJ A;  4CHS A;  4JZQ A;  4ZB6 A;  4EE0 A;  1C72 A;  4GSS A;  3IK9 A;  4ZBB A;  2WRT A;  2C4J A;  3VI5 A;  1HNB A;  1XW5 A;  3G7J A;  3LYK A;  4OFN A;  22GS A;  2GSS A;  4IKH A;  4YQM A;  2ON7 A;  4G0K A;  5DAL A;  1R5A A;  4HZ4 A;  5F06 A;  2WDU A;  12GS A;  1VF1 A;  1ZGN A;  4BVX B;  4MF7 A;  4OFM A;  5D9X A;  1MTC A;  5D9V A;  1U87 A;  2DC5 A;  1K0C A;  6GSV A;  4BL7 A;  5GST A;  1F3B A;  3QAV A;  1GSF A;  4KF9 A;  13GS A;  2FNO A;  1PN9 A;  2WS2 A;  5DJM A;  5EY6 A;  1LJR A;  5GSS A;  5DCG A;  3LXZ A;  1PX6 A;  4MK3 A;  3TGZ A;  14GS A;  3QAG A;  1GSQ A;  4MP4 A;  2GSQ A;  1GTU A;  5B7C A;  5F05 A;  1YDK A;  1FHE A;  1K0B A;  4GTU A;  5J5N A;  4PUR A;  2HNL A;  1HQO A;  3UVH A;  1BG5 A;  5G5E A;  1V2A A;  4HJ2 A;  1M99 A;  5DAK B;  4MZW A;  1GUH A;  3VPQ A;  3VK9 A;  4MPF A;  2X64 A;  2PER A;  3ISO A;  2PMT A;  5ECH B;  3P8W A;  3IC8 A;  5D9W A;  5A5K A;  3GSS A;  1VF2 A;  4KDU A;  1MD4 A;  1G6W A;  4OFT A;  1G7O A;  1PL1 A;  3IBH A;  5EL8 A;  4IW9 A;  3CRT A;  3UAP A;  2ON5 A;  1K0O A;  5ELG A;  2IMI A;  1GUL A;  5DAL B;  3LG6 A;  4WR5 A;  3I69 A;  4PUA A;  17GS A;  4E8H A;  4G10 A;  5AGY A;  1FW1 A;  1ZL9 A;  1AW9 A;  4E8E A;  4OMV A;  1K0N A;  1AQW A;  2HQT A;  4EXJ A;  4ZB9 A;  4F0C A;  2C8U A;  2R4V A;  5FWG A;  4NHZ A;  1K0D A;  4Q5N A;  3ERF A;  1EOH A;  4Q5Q A;  4YQU A;  5AN1 A;  3GST A;  1BYE A;  4L5O A;  5FHI A;  4NHW A;  1K3L A;  2VCX A;  3WD6 A;  5BMU A;  3VI7 A;  4HI7 A;  2UZ8 A;  1V40 A;  1VF4 A;  3EE2 A;  3PR8 A;  7GSS A;  2GTU A;  4F0B A;  3KXO A;  4EDZ A;  2VD0 A;  1A0F A;  4KSM A;  3Q74 A;  3M8N A;  2VCV A;  3LXT A;  4FQU A;  1TW9 A;  5A4U A;  3SWL A;  5HFK A;  4PNF A;  5ECK B;  2IL3 A;  3M3M A;  1KBN A;  4NAX A;  3GH6 A;  5LCZ A;  3GUR A;  2HSN B;  1N2A A;  3KMO A;  5J41 A;  4GF0 A;  4G0L A;  1K3Y A;  2OAC A;  1F3A A;  3F63 A;  3LFL A;  1U3I A;  1G6Y A;  6GSY A;  1GWC A;  5A4V A;  4RI6 A;  4IEL A;  4PXO A;  4IJI A;  2VD1 A;  3N5O A;  3ZFL A;  4GCI A;  2IMK A;  5KEJ A;  3KM6 A;  3L0H A;  5LD0 A;  1GTI A;  4HOJ A;  5ECP B;  1VF3 A;  1HNA A;  3ZFB A;  4ISD A;  2LJR A;  4K0N A;  2AB6 A;  3LYP A;  3FYG A;  1GTB A;  3UBL A;  3CBU A;  3D0Z A;  4AGS A;  1U88 A;  5DDL A;  3C8E A;  1EOG A;  3HJO A;  5ECM B;  1GNE A;  1PL2 A;  3VLN A;  5DJL A;  2HRA A;  2V6K A;  5DQS A;  2R6K A;  5AIS A;  3BBY A;  4O7H A;  9GSS A;  3KMN A;  1B48 A;  2HRK B;  1Y6E A;  1GSS A;  5ECL B;  2VCZ A;  1F2E A;  2F8F A;  2GST A;  3W8S A;  2WB9 A;  3CSH A;  3N9J A;  1EEM A;  2A2S A;  3U6V A;  2CAI A;  5J4U A;  4F03 A;  4KGI A;  1XWG A;  3GUS A;  1PMT A;  5AIX A;  1PKW A;  3VUR A;  4L8E A;  1Z9H A;  2AHE A;  3DD3 A;  3I6A A;  4ID0 A;  2GSR A;  4G19 A;  3GTU B;  3O3T A;  3VPT A;  2NTO A;  4YQV A;  3UAR A;  4MPG A;  4MDC A;  2CA8 A;  4EDY A;  4ECB A;  3EIN A;  4G9H A;  5ECO B;  2CZ3 A;  4MF6 A;  2VCT A;  3TOU A;  2CAQ A;  1PKZ A;  1OYJ A;  1GSD A;  3PGT A;  3QR6 A;  3FR6 A;  2PVQ A;  4PX1 A;  3IR4 A;  4IS0 A;  3IK7 A;  1TU8 A;  3LQ7 A;  3HKR A;  1JLW A;  2C3T A;  3H1N A;  3MDK A; 
#chains in the Genus database with same CATH topology
 1SD9 A;  2WZS A;  1TI3 A;  3GIX A;  2YZU A;  5JCG A;  3F6D A;  5IPG A;  3BD2 A;  6GSU A;  3MAK A;  2JL4 A;  4JBB A;  3TJG A;  1N25 A;  3HA9 A;  4FYU A;  3R3E A;  4JED A;  3FRC A;  1TRU A;  1T8E B;  2H66 A;  4PHZ C;  3R2Q A;  3ZVJ A;  4LMW A;  3M1G A;  2K6V A;  4LMV A;  1Q4J A;  4X4J A;  5F8B A;  1NM3 A;  3QAW A;  1PRX A;  2WJU A;  1X5C A;  3IDV A;  4TVE A;  1OE8 A;  3KH7 A;  4PQH A;  3GTU A;  2DMM A;  2IFQ B;  2X99 A;  5A4W A;  5AIV A;  5BRT A;  4GDF A;  4ZBA A;  3GN3 A;  3DRN A;  4ILF A;  2GDR A;  5ABR A;  4AJ7 A;  2MMZ A;  4DSQ A;  3LW9 A;  3HVX A;  4KW6 A;  3DIE A;  1OVN A;  1JZD A;  1THX A;  11GS A;  2FGX A;  4DSS B;  4HZ2 A;  2XBI A;  3IAS 2;  4HEA 2;  3KJY A;  3CTF A;  3ED3 A;  4PGT A;  1GRX A;  1TI1 A;  5CAX A;  4BVY A;  2A2P A;  4ML6 A;  4MNN A;  3C7M A;  4HS1 A;  1BAY A;  2EIR A;  2R3X A;  3H79 A;  2KUC A;  5CRW A;  2X4A A;  2HI7 A;  5A5H B;  1X9M B;  4HU9 A;  3C71 A;  1XXU A;  1NW2 A;  1XVQ A;  5ECR B;  5H5Q A;  1SJI A;  1PGT A;  1QXH A;  4AKH A;  2LST A;  3FY7 A;  1USB A;  2IFQ A;  4ECC A;  4V2L A;  5B8B A;  5GZZ B;  4RUV A;  1S3C A;  3TOT A;  1XW6 A;  1M3I A;  3HXS A;  2MBS A;  3TDG A;  2H71 A;  3ERW A;  1GSE A;  3G7I A;  1RQM A;  2DIZ A;  2QA2 A;  2PWJ A;  2OA7 A;  1Z5Y E;  3RPN A;  1GTA A;  1A2J A;  1KNG A;  4L0U A;  4BVX A;  5CRE A;  1GUM A;  3A2W A;  4GRF A;  1U3A A;  3GH9 A;  4IJ3 A;  4KA0 A;  5JCU A;  3VWX A;  2QKE A;  3NIV A;  4BL7 B;  3FR9 A;  3ZVJ D;  1EWX A;  6GST A;  1THO A;  5KOW A;  1R7H A;  4YKG A;  2TRC P;  5ECS A;  1NHY A;  2I1U A;  1OC9 B;  4MMM A;  3CHX C;  5KN3 A;  1F6M C;  2WZ9 A;  3TKS A;  4BWS A;  5DAK A;  2LV3 A;  3HDC A;  4WET A;  1C72 A;  4POK A;  3P7X A;  1HNB A;  3A2X A;  1TK5 B;  5GAN D;  1Z6M A;  3TKQ A;  3FK8 A;  3NZN A;  2ON7 A;  2HZE A;  2YWN A;  1Y1U A;  5F06 A;  3CQF A;  2WDU A;  12GS A;  5DVB A;  4IP6 A;  4MF7 A;  4OFM A;  1O85 A;  3APQ A;  4BL7 A;  2LNT A;  2AYT A;  1F3B A;  2QGV A;  2GGT A;  3A5W A;  2FWG A;  4W66 A;  2FNO A;  4WXT A;  2IMF A;  1LJR A;  2DJ3 A;  5GSS A;  3LXZ A;  2O7K A;  3C1S A;  1RW1 A;  4K9Z A;  1OC9 A;  1T4Z A;  3QAG A;  2K8V A;  2GSQ A;  1K0B A;  4XCS A;  1ZMA A;  4CY8 A;  1YEW C;  4WBJ A;  5JWR B;  1GUH A;  2O36 A;  3HVS A;  2PER A;  3ISO A;  1T1V A;  2PMT A;  1ERW A;  2AUV A;  4QL9 A;  5IOW A;  5A5K A;  2P31 A;  3HYP A;  1WRY A;  1G7O A;  2HSN A;  3CRT A;  3UAP A;  2ON5 A;  3L4N A;  4MA9 A;  5DAL B;  3HY2 A;  1XVW A;  3TKS C;  3LG6 A;  4WR5 A;  2L59 A;  2K18 A;  3V1W A;  2O89 A;  3BCK A;  3F3R A;  1N8J A;  2LTK A;  1WJK A;  2R0P A;  1ZL9 A;  2C0F A;  3O6T A;  4E8E A;  1AC1 A;  1J9B A;  1H75 A;  1FOH A;  3W8J A;  2PPT A;  2LUS A;  5ID2 A;  2YPM A;  2V1M A;  4RQR A;  3C73 A;  4NHZ A;  3H8Q A;  1SD8 A;  1GH2 A;  1K0D A;  1EOH A;  2FUG 2;  2I4A A;  1X9W B;  3GST A;  2V41 A;  4EO3 A;  4NHW A;  2JSY A;  4JRR A;  5IPH A;  2DBC A;  3PR8 A;  3EE2 A;  2GTU A;  2FLS A;  1A0F A;  4KSM A;  4HQS A;  3Q74 A;  1S3D A;  4NPB A;  2YP6 A;  2VCV A;  2FD3 A;  4WEY A;  2H01 A;  2TIR A;  1OC8 A;  3SWL A;  4TW5 A;  4TR4 A;  4XS6 A;  4PNF A;  3APS A;  2IL3 A;  3F4R A;  4LL4 B;  4GF0 A;  2GVP A;  2MMA A;  2N5B A;  5JWQ B;  3KH9 A;  1K3Y A;  2XBQ A;  1F3A A;  2YAN A;  3QD9 A;  1TXX A;  4KCE A;  2L4C A;  2G0F A;  1GWC A;  5A4V A;  3N5O A;  4NV2 A;  2HYX A;  4GCI A;  1A2L A;  3FZA A;  1XOB A;  3ZFB A;  4WF5 A;  3BJ5 A;  1LU4 A;  2GZP A;  3UBL A;  3CBU A;  2WCI A;  1DE2 A;  3C8E A;  4MZC A;  4F2I A;  2L6C A;  3GRX A;  3TJJ A;  1S3R A;  5BMU B;  3SBC A;  2I81 A;  2R6K A;  4EKZ A;  1WIK A;  3BBY A;  2WW1 A;  2HRK B;  1Y6E A;  4XRA A;  2VCZ A;  4OO4 A;  2GZZ A;  2ZNM A;  2CX3 A;  2DIY A;  3WGE A;  1Z6N A;  1EEM A;  2IPA A;  1M7T A;  3DML A;  2H1D A;  3TRQ A;  3G7Y A;  2MYG A;  1PMT A;  5AIX A;  4XS4 A;  3HVN A;  4G19 A;  2C0D A;  4MCU A;  3UAR A;  4V1A p;  1I1I P;  1YEP A;  4G9H A;  3EWL A;  4HU7 A;  1WOU A;  2VCT A;  3TOU A;  4AKI A;  4PQ1 A;  2CAQ A;  1OYJ A;  4D73 B;  3PGT A;  4H86 A;  3APO A;  1QGV A;  1B9X C;  3IK7 A;  1TU8 A;  4JR4 A;  2LRC A;  2C3T A;  4TR1 A;  4I5Q A;  1XW9 A;  4O92 A;  5ELA A;  3D5J A;  1B8X A;  4KDX A;  3GL5 A;  4AJ6 A;  1YZX A;  1XIY A;  4I2T A;  4JE1 A;  3FZ4 A;  2HRK A;  4QQ7 A;  3K8N A;  1ERT A;  3FZ9 A;  1X0R A;  1ERU A;  4YAP A;  3UBK A;  1AQX A;  1FB6 A;  3F9U A;  2EFE A;  2C3N A;  2WVZ A;  1QMV A;  1WMJ A;  2H19 A;  1Z7P A;  3ZL5 A;  3PPU A;  2N5F A;  2RUE A;  3QCP A;  2HLS A;  3HZ8 A;  4KE3 A;  1IYI A;  1B4P A;  3IAM 2;  2OE0 A;  4N0V A;  3VWV A;  2PGT A;  4D73 A;  1ZYP A;  2OE3 A;  1TP9 A;  1GSY A;  4ECI A;  2RLI A;  4TOP A;  2IIY A;  4MJE A;  1B4Q A;  5CRG A;  3HJM A;  2GLR A;  5D9T A;  2DLX A;  2FWH A;  2B1L A;  1UA5 A;  2J23 A;  2AAW A;  1DE1 A;  4GST A;  1GLQ A;  4KX4 A;  2WW3 A;  2K8S A;  2EC4 A;  4O5U A;  3TRP A;  2PUK C;  3ZML A;  5G5F A;  4DEJ A;  2YCD A;  2E0Q A;  3GNJ A;  1EP8 A;  2FA4 A;  3EU3 A;  2H30 A;  4NWY A;  3DVW A;  3ZIV A;  1G0T A;  2H8L A;  4J57 E;  2M46 A;  4IGJ A;  4KDY A;  2KLX A;  3TJB A;  1MDK A;  4K2D A;  2OT3 A;  2WW2 A;  3TU3 B;  2XPE A;  1OKT A;  5CRH A;  2KP2 A;  2C3Q A;  4J2F A;  2JAC A;  4K7I A;  2F3M A;  18GS A;  4BPY A;  3VWU A;  2HRF A;  2H0G A;  3LJR A;  4K8M A;  4KND A;  5KN2 A;  4PNG A;  1E6B A;  2LKU A;  2GT6 A;  4NMU A;  2VL3 A;  1A24 A;  2H70 A;  4BVY B;  2CZ2 A;  4MLY A;  1TK0 B;  2H72 A;  3IE3 A;  5A34 A;  5IQY A;  4EIP A;  5KOX A;  3CSJ A;  4MJA A;  2Z9S A;  4A5P A;  1NSW A;  2VAF A;  4ZB6 A;  4EE0 A;  2XHF A;  3IK9 A;  2B7K A;  4BIK A;  2WRT A;  2C4J A;  2DKI A;  5ENU A;  1XW5 A;  1T7P B;  3G7J A;  1SVL A;  1PSQ A;  2REM A;  2LJK A;  1GP1 A;  1FO5 A;  1MDI A;  4N30 A;  22GS A;  2GSS A;  4YQM A;  3RHB A;  2B5X A;  3KGK A;  3M9J A;  1Y25 A;  2FWE A;  1R5A A;  4F9Z A;  2VOC A;  2HSY A;  3UMA A;  4I8B A;  1V98 A;  3UOM A;  1VF1 A;  2WW0 A;  4BVX B;  5CO3 A;  1PFO A;  2P0G A;  4N11 A;  2B5Y A;  3QAV A;  1GSF A;  1SK0 A;  2KP1 A;  13GS A;  1PN9 A;  2V2G A;  1SYX A;  1ZCP A;  1PX6 A;  4AF2 A;  1FVK A;  3GKM A;  4MJC A;  1TRW A;  4MP4 A;  5B7C A;  3GMF A;  2LEG A;  1HQO A;  1ZYN A;  2XPD A;  5CP1 A;  4HJ2 A;  1M99 A;  5DAK B;  5C04 A;  2HE3 A;  5D96 A;  4I6X A;  3IC4 A;  3GSS A;  4N10 A;  3TJK A;  1VF2 A;  3EU4 A;  1MD4 A;  2IJY A;  4IW9 A;  4POM A;  1SL2 B;  4WF4 A;  5IMV A;  2C1Y A;  3KP8 A;  1BED A;  5ELG A;  4K1F A;  2RII A;  1A2M A;  2HZE B;  2YWO A;  3TUE A;  3I69 A;  1TJD A;  3RFR C;  2IWT A;  17GS A;  3F8U A;  4K5R A;  1K0N A;  1TXU A;  4O32 A;  2HQT A;  2H6Z A;  1WP0 A;  4F0C A;  1M2D A;  5C00 A;  5IMF A;  4Z2T A;  3QDN A;  1X9S B;  1UC7 A;  1CQG A;  2VL2 A;  4ZL7 A;  1BYE A;  2DJ1 A;  2LRN A;  5COH A;  3EMP A;  4V2M A;  4JR6 A;  1K3L A;  1Z7R A;  2H75 A;  2EFC A;  1YF0 A;  2I9H A;  3TJF A;  5B6M A;  3MYD A;  1TK8 B;  3KD0 A;  4ZL9 A;  4AKX B;  3KXO A;  4EDZ A;  2B1K A;  3A5I A;  1TW9 A;  5A4U A;  3F4T A;  3M3M A;  4NAX A;  2K9F A;  3GUR A;  2HSN B;  2IME A;  4DSR A;  4FYB A;  2OAC A;  3H93 A;  2GQK A;  2EFH A;  2JZS A;  4O5R A;  1U3I A;  1G6Y A;  6GSY A;  1DSB A;  3BOA A;  5J4V A;  4OCE A;  3KP9 A;  1R4W A;  4XIH A;  2CX4 A;  4TR0 A;  5IMZ A;  2RM6 A;  3U5R E;  1A8L A;  1SJ6 A;  5KEJ A;  1GTI A;  5ID2 B;  1VF3 A;  2VUP A;  3EPT A;  4ISD A;  4OWY A;  2HSH A;  1GTB A;  2QSI A;  2N5A A;  3D0Z A;  5B8A A;  1U88 A;  2PU9 C;  4FH8 A;  1VGL A;  1GNE A;  1SK1 A;  2V6K A;  3CXG A;  2AJQ B;  3WGD A;  4O7H A;  1PN0 A;  3D4M A;  2M72 A;  2OE1 A;  1GSS A;  1XWA A;  2GT5 A;  4KSO A;  2F8F A;  3W8S A;  3N9J A;  2VL2 C;  2A2S A;  2YWM A;  2IN3 A;  4F03 A;  1XWG A;  4MZB A;  4ULX A;  2HZF A;  3DD3 A;  3US3 A;  2NTO A;  4YQV A;  4MPG A;  4EDY A;  1T00 A;  3EIN A;  2VKZ G;  1M2B A;  1XCC A;  4Z2U A;  1PKZ A;  1SYR A;  1GSD A;  1MDJ A;  2PVQ A;  4PX1 A;  4KCA A;  4IS0 A;  1FOV A;  1AUC A;  3HKR A;  1JLW A;  3ME7 A;  1FG4 A;  2H74 A;  3MDK A;  1JFU A;  10GS A;  2C0E A;  1IYH A;  3DVX A;  2E2M A;  19GS A;  20GS A;  3ZMK A;  3RBT A;  1GNW A;  2VIM A;  5KN1 A;  3RHC A;  2J9H A;  1SKW B;  1TDI A;  1YQ1 A;  1V58 A;  4HSC X;  1K3O A;  3DGQ A;  1SU9 A;  3F0I A;  5IO0 A;  1DBY A;  2DKH A;  5EVO A;  2LQQ A;  1TKD B;  1YY7 A;  3AY8 A;  2VCQ A;  2WVY A;  2NDO A;  5A1N B;  2D2Z A;  4XS1 A;  1OC3 A;  3DXB A;  3ZZX A;  6GSW A;  1QQ2 A;  4XS4 B;  1ZYE A;  4K0G A;  4I97 A;  1XWC A;  5ECN B;  4PQI A;  2UV8 G;  3FR3 A;  3VWW A;  2HXK A;  1JZR A;  2YN1 A;  5G1L A;  3GX8 A;  1XFL A;  4IQA A;  1JZO A;  3QPM A;  3Q19 A;  2FWF A;  2R2J A;  4ZXG A;  3ZRE A;  4OO5 A;  2MBT A;  1GSU A;  1FVJ A;  4G2E A;  2F51 A;  4TR1 B;  4IBP A;  1HYU A;  2H1B A;  3MSZ A;  2HSM B;  1AXD A;  2GZY A;  1GLP A;  2VO4 A;  2ZCT A;  4N3Z A;  2H1A A;  3FEU A;  5HQP A;  4GLT A;  3QMX A;  2YWI A;  2QC7 A;  1ML6 A;  2OAD A;  8GSS A;  3Q18 A;  5DBQ A;  4ZB7 A;  4ECJ A;  4PTS A;  3UJ1 A;  1AQV A;  5HR0 A;  3HZ4 A;  1K0M A;  1GUK A;  4WR4 A;  5A1N A;  5FT3 A;  5E59 A;  2YJH A;  3WYW A;  2WVX B;  1EGO A;  1SEN A;  1PA3 A;  3M0F A;  1YKC A;  2EFD A;  5E4W A;  1QUW A;  2OBK A;  1PX7 A;  4L5L A;  5JCW A;  1E2Y A;  1XG8 A;  2R5G A;  3C1R A;  4Q5F A;  4RQX A;  2WGR A;  1SVO A;  4YAV A;  4PUF C;  4KAE A;  4NXI A;  3ERG A;  1XWB A;  4OD7 A;  1XWK A;  2YZH A;  3GX0 A;  4Z2R A;  1K0A A;  2HSM A;  3LOR A;  4AJ8 A;  4FXY P;  2DML A;  3L9U A;  2DJ0 A;  1HD2 A;  1SL1 B;  3E9J B;  1LBK A;  2VLV A;  3CRU A;  3D21 A;  5F07 A;  2LJA A;  5DQY A;  5H5R A;  3WGX A;  2OBI A;  4CHS A;  3EC3 A;  4CW9 A;  4MJB A;  2NVL A;  2WVX A;  4ZBB A;  2JU5 A;  3GA4 A;  3DYR A;  5J9C A;  2YOI A;  1XBS A;  3GKX A;  4I2U A;  4O5Q A;  4TN8 A;  3E0U A;  3H4K A;  4EUY A;  2R0C A;  1YVL A;  4G0K A;  2O85 A;  4HZ4 A;  3KCM A;  1BF5 A;  4QMK A;  2X49 A;  4ZL8 A;  4X1U A;  4TR3 A;  1ZGN A;  1MTC A;  5D9V A;  1U87 A;  1O8W A;  2B3S A;  3TRX A;  5GST A;  5G2Z A;  1QK8 A;  4G01 A;  4KF9 A;  5J9B A;  5EY6 A;  2EIO A;  3GV1 A;  3CTG A;  3TGZ A;  4FYC A;  14GS A;  1GSQ A;  1FHE A;  5J5N A;  1WWJ A;  4X0X A;  3UVH A;  2X8C A;  5A34 B;  5G5E A;  4MZW A;  1W4V A;  3VPQ A;  3VK9 A;  4DVC A;  1UN2 A;  2F8A A;  5ECH B;  3P8W A;  5IM9 A;  4TXO A;  2LS5 A;  3IC8 A;  5D9W A;  4BA7 A;  4KDU A;  1G6W A;  2O8V B;  4OFT A;  1PL1 A;  3IBH A;  1KEB A;  3PH9 A;  1B9Y C;  2IMI A;  3S9F A;  3TCO A;  2M80 A;  1FAA A;  1WPI A;  3A3T A;  1TRS A;  4ZIL A;  3ZIJ A;  5J47 A;  3IV4 A;  1XOA A;  4E8H A;  5AGY A;  1M2A A;  1AW9 A;  2L5O A;  2X8G A;  4EXJ A;  3F4S A;  1O7U A;  5FWG A;  1URM A;  4KUN A;  4YQU A;  4POB A;  5AN1 A;  4BWQ A;  2HT9 A;  5G31 A;  2VL9 A;  1PQN A;  3WD6 A;  3WT1 A;  3VI7 A;  4NV5 A;  1T3B A;  2FY6 A;  3UEM A;  1V40 A;  1VF4 A;  4E68 A;  1A0R P;  3GYK A;  1M3J A;  2H0H A;  1ZOF A;  2YJ7 A;  3ME8 A;  4FQU A;  1H4O A;  3GH6 A;  5LCZ A;  3TB2 A;  1N2A A;  5J41 A;  3IOS A;  2PN8 A;  4Z7X A;  4G0L A;  1TTZ A;  1R5P A;  3F63 A;  4AKG A;  3LFL A;  5CNW A;  3ZLP A;  2PVO C;  4TKY A;  3ZIT A;  4AI6 A;  1X5E A;  4IEL A;  4PXO A;  1U6T A;  3ZFL A;  2JAD A;  4ICY A;  1Z3E A;  1GL8 A;  5LD0 A;  5ECP B;  3J7Y b;  2H0I A;  3LYP A;  3FYG A;  5JWO B;  3MWH A;  4AGS A;  2G2Q A;  4OCF A;  3HJO A;  5ECM B;  1I9D A;  3RDW A;  2JZR A;  3VLN A;  2HRA A;  3F3Q A;  2GQM A;  2BTO T;  5DQS A;  2ALB A;  4EIQ A;  5AIS A;  1G7E A;  4K5S A;  3KMN A;  4GWR A;  1B48 A;  2R37 A;  5ECL B;  3MNG A;  1F2E A;  2GST A;  1XPV A;  2NBS A;  2CAI A;  3GUS A;  3W6G A;  3VUR A;  3QFA C;  5HFG A;  2AHE A;  4ID0 A;  4KB3 A;  3VPT A;  3EMX A;  1EGR A;  3KTB A;  4ECB A;  3D22 A;  5ECO B;  2NPB A;  1BG1 A;  3Q6O A;  4LLR A;  2ES7 A;  2H6X A;  2VLU A;  1V9W A;  3WT2 A;  3QR6 A;  4DSS A;  4TXV A;  2B5E A;  2HFD A;  3LQ7 A;  4EVM A;  4GXZ A;  3H1N A;  5D93 A;  2C0G A;  1PD2 1;  3F6F A;  1I5G A;  4GQC A;  4V2N A;  2RUF A;  3I9V 2;  2YV9 A;  3I43 A;  2VM2 A;  2L6D A;  3HVV A;  3LSZ A;  2GQL A;  2KHP A;  2L57 A;  3CSI A;  5A5H A;  3FKF A;  1A23 A;  1FB0 A;  4MF5 A;  5D73 A;  3IHG A;  2FA8 A;  1O6J A;  2HRN A;  2R0G A;  1SL0 B;  4G0I A;  5KN0 A;  5CRD A;  2FHE A;  2TRX A;  3UVT A;  4USS A;  3D6I A;  3P90 A;  6GSX A;  6GSS A;  5HR2 A;  1HNC A;  5J4Y A;  3IPZ A;  1WE0 A;  3GL3 A;  2DSA A;  1EP7 A;  3RGB C;  4HUA A;  3L9V A;  1YF1 A;  5EPF A;  1YJ6 A;  3DEX A;  5H5S A;  4IVF A;  1ILO A;  1ZYQ B;  2H1L A;  16GS A;  1M9A A;  3NOF A;  1AIU A;  2A2R A;  4EC0 A;  3EYT A;  1F37 A;  5CYY A;  5ECQ B;  1ABA A;  1TU7 A;  4ZB8 A;  3LGC A;  3EUR A;  2H73 A;  1JLV A;  3KIJ A;  4Q5R A;  1EEJ A;  2IMD A;  3TKR A;  2VCW A;  3EVI A;  2L5L A;  3HJP A;  3FHK A;  3O76 A;  3G9B A;  4YKF A;  2CVD A;  2MMN A;  3TKS E;  1JZW A;  2CQ9 A;  3FMW A;  3UIW A;  4GSN A;  2OJL A;  2JZT A;  1YKA A;  1YEX A;  1F9M A;  2CV4 A;  1V57 A;  3MIX A;  3IRA A;  1M9B A;  4EF0 A;  2WUL A;  2C80 A;  4RI7 A;  2F9S A;  1MD3 A;  3KTL A;  4HQZ A;  1J08 A;  1UVZ A;  4IN0 A;  4IQ1 A;  5ECI B;  1SJZ A;  1EV4 A;  3TKP A;  2GS3 A;  1O81 A;  3GFK A;  3FW2 A;  4V1A g;  3KEB A;  2YV7 A;  1RK4 A;  4ACS A;  3DWV A;  4KH7 A;  1DUG A;  1EV9 A;  1QFN A;  1BX9 A;  4IHU A;  3PIN A;  2P5Q A;  5INY A;  5IMC A;  3JCM L;  3HD5 A;  2H1G A;  4XHM A;  2PBJ A;  4ZBD A;  2QA1 A;  1OE7 A;  1M0U A;  4YH2 A;  2JSZ A;  2FCH A;  5F0G A;  4ZIJ A;  1A8Y A;  2E7P A;  1ON4 A;  4XRD A;  2O3E A;  4JZQ A;  3D4T A;  3HHV A;  4GSS A;  3VI5 A;  4HJM A;  3LYK A;  4N0Z A;  4OFN A;  4LA1 A;  2I3Y A;  4IKH A;  2WFC A;  2CVK A;  4FIW A;  5DAL A;  4MH2 A;  1EZK A;  4K7N A;  1JHB A;  1O73 A;  3ZTL A;  1MEK A;  2DJ2 A;  2BMX A;  5D9X A;  1SVM A;  2DC5 A;  3IHQ A;  1K0C A;  6GSV A;  3CMI A;  1O8X A;  5B6N A;  5D8I A;  4MH3 A;  2VM1 A;  1NHO A;  2WS2 A;  5DJM A;  5DCG A;  4MK3 A;  1OAZ A;  1TOF A;  4L0W A;  5IOX A;  1OKD A;  2XC2 A;  1GTU A;  5F05 A;  1YDK A;  4GTU A;  2B6M A;  4PUR A;  2HNL A;  1BG5 A;  3GHA A;  4XTS A;  1V2A A;  1Q98 A;  2V32 A;  3VFI A;  2O87 A;  2DJK A;  4MPF A;  2DJJ A;  2X64 A;  3RPP A;  3FZ5 A;  2EIQ A;  3GKN A;  3IA1 A;  1ST9 A;  5DCH A;  2LRT A;  1SKS B;  1ERV A;  5EL8 A;  4CY6 A;  1K0O A;  1VRS D;  1GUL A;  5HR1 A;  2L4Q A;  1X5D A;  2VLT A;  4MAB A;  2P5R A;  3DKS A;  4JU5 A;  4PUA A;  1SKR B;  4G10 A;  5IMA A;  1FW1 A;  4CDO A;  3CYN A;  3ZYW A;  5G30 A;  4OMV A;  2X8H A;  3QFB C;  1AQW A;  1W89 A;  1CQH A;  5IIZ A;  4ZB9 A;  2C8U A;  1J0F A;  2R4V A;  5J3R A;  4Q5N A;  3ERF A;  5IO2 A;  4Q5Q A;  5GAP D;  1KTE A;  3HMJ G;  1ZZY A;  4GQF A;  2LNS A;  5HR3 A;  4L5O A;  5FHI A;  5LNK e;  3BCI A;  2VCX A;  5BMU A;  3OR5 A;  4P3Y B;  1SK2 A;  3P2A A;  2OKA A;  4HI7 A;  3UL3 A;  2O5V A;  2UZ8 A;  7GSS A;  4F0B A;  2CT6 A;  1S4B P;  2VD0 A;  4TXO B;  4K2X A;  1R26 A;  4TRX A;  3M8N A;  3LXT A;  4IP1 A;  3ZRD A;  5HFK A;  5ECK B;  1BJX A;  1KBN A;  5L71 A;  2V6O A;  3KMO A;  3IXR A;  3RAZ A;  1XZO A;  3QOU A;  4QL7 A;  3GKK A;  3J7Y k;  4K7O A;  4F82 A;  5G1K A;  3E3E A;  2YNX A;  4RI6 A;  3LEF A;  4IJI A;  2RM5 A;  4PI2 C;  2VD1 A;  1TRV A;  3LWA A;  2IMK A;  3KM6 A;  3L0H A;  3HCZ A;  4ML1 A;  4HOJ A;  3L78 A;  1HNA A;  2LJR A;  4K0N A;  2AB6 A;  5DDL A;  1EOG A;  1S3A A;  4X43 A;  2AV4 A;  5J40 A;  1PL2 A;  5DJL A;  4LL1 B;  5HFI A;  3CWG A;  2A4V A;  2ZUP A;  9GSS A;  2CVB A;  1AAZ A;  4HDE A;  2WB9 A;  3CSH A;  3M9K A;  3U6V A;  1T4Y A;  5J4U A;  4KGI A;  1PKW A;  2H6Y A;  2BJX A;  2E2G A;  4WBR D;  4L8E A;  4WKW A;  1Z9H A;  3I6A A;  4FO5 A;  4J56 E;  3L9S A;  2GSR A;  3GTU B;  3O3T A;  2MZC A;  4EL1 A;  4MDC A;  2CA8 A;  4POL A;  1BQ7 A;  2B7J A;  2CZ3 A;  3KZQ A;  4MF6 A;  2MMO A;  2H76 A;  2LQO A;  3FR6 A;  4K6X A;  5IMD A;  3A2V A;  3IR4 A;  2A4H A;  4PI0 C;  1ACV A;  2KOK A; 
#chains in the Genus database with same CATH homology
 1SD9 A;  1TI3 A;  3GIX A;  2YZU A;  5JCG A;  3F6D A;  5IPG A;  3BD2 A;  6GSU A;  3MAK A;  2JL4 A;  4JBB A;  3TJG A;  1N25 A;  3HA9 A;  4FYU A;  3R3E A;  4JED A;  3FRC A;  1TRU A;  1T8E B;  2H66 A;  3R2Q A;  3ZVJ A;  4LMW A;  3M1G A;  2K6V A;  4LMV A;  1Q4J A;  4X4J A;  5F8B A;  1NM3 A;  3QAW A;  1PRX A;  2WJU A;  1X5C A;  3IDV A;  4TVE A;  1OE8 A;  3KH7 A;  4PQH A;  3GTU A;  2DMM A;  2IFQ B;  2X99 A;  5A4W A;  5AIV A;  5BRT A;  4GDF A;  4ZBA A;  3GN3 A;  3DRN A;  4ILF A;  2GDR A;  5ABR A;  4AJ7 A;  2MMZ A;  4DSQ A;  3LW9 A;  3HVX A;  4KW6 A;  3DIE A;  1OVN A;  1JZD A;  1THX A;  11GS A;  2FGX A;  4DSS B;  4HZ2 A;  2XBI A;  3IAS 2;  4HEA 2;  3KJY A;  3CTF A;  3ED3 A;  4PGT A;  1GRX A;  1TI1 A;  5CAX A;  4BVY A;  2A2P A;  4ML6 A;  4MNN A;  3C7M A;  4HS1 A;  1BAY A;  2EIR A;  2R3X A;  3H79 A;  2KUC A;  5CRW A;  2X4A A;  2HI7 A;  5A5H B;  1X9M B;  4HU9 A;  3C71 A;  1XXU A;  1NW2 A;  1XVQ A;  5ECR B;  5H5Q A;  1SJI A;  1PGT A;  1QXH A;  4AKH A;  2LST A;  3FY7 A;  1USB A;  2IFQ A;  4ECC A;  4V2L A;  5B8B A;  5GZZ B;  4RUV A;  1S3C A;  3TOT A;  1XW6 A;  3HXS A;  2MBS A;  3TDG A;  2H71 A;  3ERW A;  1GSE A;  3G7I A;  1RQM A;  2DIZ A;  2QA2 A;  2PWJ A;  2OA7 A;  1Z5Y E;  3RPN A;  1GTA A;  1A2J A;  1KNG A;  4L0U A;  4BVX A;  5CRE A;  1GUM A;  3A2W A;  4GRF A;  1U3A A;  3GH9 A;  4IJ3 A;  4KA0 A;  5JCU A;  3VWX A;  2QKE A;  3NIV A;  4BL7 B;  3FR9 A;  3ZVJ D;  1EWX A;  6GST A;  1THO A;  5KOW A;  1R7H A;  4YKG A;  2TRC P;  5ECS A;  1NHY A;  2I1U A;  1OC9 B;  4MMM A;  5KN3 A;  1F6M C;  2WZ9 A;  3TKS A;  4BWS A;  5DAK A;  2LV3 A;  3HDC A;  4WET A;  1C72 A;  4POK A;  3P7X A;  1HNB A;  3A2X A;  1TK5 B;  5GAN D;  1Z6M A;  3TKQ A;  3FK8 A;  3NZN A;  2ON7 A;  2HZE A;  2YWN A;  1Y1U A;  5F06 A;  2WDU A;  12GS A;  5DVB A;  4IP6 A;  4MF7 A;  4OFM A;  1O85 A;  3APQ A;  4BL7 A;  2LNT A;  2AYT A;  1F3B A;  2QGV A;  2GGT A;  3A5W A;  2FWG A;  4W66 A;  2FNO A;  4WXT A;  2IMF A;  1LJR A;  2DJ3 A;  5GSS A;  3LXZ A;  2O7K A;  3C1S A;  1RW1 A;  4K9Z A;  1OC9 A;  1T4Z A;  3QAG A;  2K8V A;  2GSQ A;  1K0B A;  4XCS A;  1ZMA A;  4CY8 A;  4WBJ A;  5JWR B;  1GUH A;  3HVS A;  2PER A;  3ISO A;  1T1V A;  2PMT A;  1ERW A;  2AUV A;  4QL9 A;  5IOW A;  5A5K A;  2P31 A;  3HYP A;  1WRY A;  1G7O A;  2HSN A;  3CRT A;  3UAP A;  2ON5 A;  3L4N A;  4MA9 A;  5DAL B;  3HY2 A;  1XVW A;  3TKS C;  3LG6 A;  4WR5 A;  2L59 A;  2K18 A;  3V1W A;  2O89 A;  3BCK A;  3F3R A;  1N8J A;  2LTK A;  1WJK A;  2R0P A;  1ZL9 A;  2C0F A;  3O6T A;  4E8E A;  1AC1 A;  1J9B A;  1H75 A;  1FOH A;  3W8J A;  2PPT A;  2LUS A;  5ID2 A;  2YPM A;  2V1M A;  4RQR A;  3C73 A;  4NHZ A;  3H8Q A;  1SD8 A;  1GH2 A;  1K0D A;  1EOH A;  2FUG 2;  2I4A A;  1X9W B;  3GST A;  2V41 A;  4EO3 A;  4NHW A;  2JSY A;  4JRR A;  5IPH A;  2DBC A;  3PR8 A;  3EE2 A;  2GTU A;  2FLS A;  1A0F A;  4KSM A;  4HQS A;  3Q74 A;  1S3D A;  4NPB A;  2YP6 A;  2VCV A;  2FD3 A;  4WEY A;  2H01 A;  2TIR A;  1OC8 A;  3SWL A;  4TW5 A;  4TR4 A;  4XS6 A;  4PNF A;  3APS A;  2IL3 A;  3F4R A;  4LL4 B;  4GF0 A;  2GVP A;  2MMA A;  2N5B A;  5JWQ B;  3KH9 A;  1K3Y A;  2XBQ A;  1F3A A;  2YAN A;  3QD9 A;  1TXX A;  4KCE A;  2L4C A;  2G0F A;  1GWC A;  5A4V A;  3N5O A;  4NV2 A;  2HYX A;  4GCI A;  1A2L A;  3FZA A;  1XOB A;  3ZFB A;  4WF5 A;  3BJ5 A;  1LU4 A;  2GZP A;  3UBL A;  3CBU A;  2WCI A;  1DE2 A;  3C8E A;  4MZC A;  4F2I A;  2L6C A;  3GRX A;  3TJJ A;  5BMU B;  3SBC A;  2I81 A;  2R6K A;  4EKZ A;  1WIK A;  3BBY A;  2HRK B;  1Y6E A;  4XRA A;  2VCZ A;  4OO4 A;  2GZZ A;  2ZNM A;  2CX3 A;  2DIY A;  3WGE A;  1Z6N A;  1EEM A;  2IPA A;  1M7T A;  3DML A;  2H1D A;  3TRQ A;  3G7Y A;  2MYG A;  1PMT A;  5AIX A;  4XS4 A;  4G19 A;  2C0D A;  4MCU A;  3UAR A;  4V1A p;  1YEP A;  4G9H A;  3EWL A;  4HU7 A;  1WOU A;  2VCT A;  3TOU A;  4AKI A;  4PQ1 A;  2CAQ A;  1OYJ A;  4D73 B;  3PGT A;  4H86 A;  3APO A;  1QGV A;  1B9X C;  3IK7 A;  1TU8 A;  4JR4 A;  2LRC A;  2C3T A;  4TR1 A;  4I5Q A;  1XW9 A;  4O92 A;  5ELA A;  3D5J A;  1B8X A;  4KDX A;  3GL5 A;  4AJ6 A;  1YZX A;  1XIY A;  4I2T A;  4JE1 A;  3FZ4 A;  2HRK A;  4QQ7 A;  3K8N A;  1ERT A;  3FZ9 A;  1X0R A;  1ERU A;  4YAP A;  3UBK A;  1AQX A;  1FB6 A;  3F9U A;  2EFE A;  2C3N A;  1QMV A;  1WMJ A;  2H19 A;  1Z7P A;  3ZL5 A;  3PPU A;  2N5F A;  2RUE A;  3QCP A;  2HLS A;  3HZ8 A;  4KE3 A;  1IYI A;  1B4P A;  3IAM 2;  2OE0 A;  4N0V A;  3VWV A;  2PGT A;  4D73 A;  1ZYP A;  2OE3 A;  1TP9 A;  1GSY A;  4ECI A;  2RLI A;  4TOP A;  2IIY A;  4MJE A;  1B4Q A;  5CRG A;  3HJM A;  2GLR A;  5D9T A;  2DLX A;  2FWH A;  2B1L A;  1UA5 A;  2J23 A;  2AAW A;  1DE1 A;  4GST A;  1GLQ A;  4KX4 A;  2K8S A;  2EC4 A;  4O5U A;  3TRP A;  2PUK C;  3ZML A;  5G5F A;  4DEJ A;  2YCD A;  2E0Q A;  3GNJ A;  1EP8 A;  2FA4 A;  3EU3 A;  2H30 A;  4NWY A;  3DVW A;  3ZIV A;  1G0T A;  2H8L A;  4J57 E;  2M46 A;  4IGJ A;  4KDY A;  2KLX A;  3TJB A;  1MDK A;  4K2D A;  2OT3 A;  3TU3 B;  2XPE A;  1OKT A;  5CRH A;  2KP2 A;  2C3Q A;  4J2F A;  2JAC A;  4K7I A;  2F3M A;  18GS A;  4BPY A;  3VWU A;  2HRF A;  2H0G A;  3LJR A;  4K8M A;  4KND A;  5KN2 A;  4PNG A;  1E6B A;  2LKU A;  2GT6 A;  4NMU A;  2VL3 A;  1A24 A;  2H70 A;  4BVY B;  2CZ2 A;  4MLY A;  1TK0 B;  2H72 A;  3IE3 A;  5A34 A;  5IQY A;  4EIP A;  5KOX A;  3CSJ A;  4MJA A;  2Z9S A;  4A5P A;  1NSW A;  2VAF A;  4ZB6 A;  4EE0 A;  2XHF A;  3IK9 A;  2B7K A;  2WRT A;  2C4J A;  2DKI A;  5ENU A;  1XW5 A;  1T7P B;  3G7J A;  1SVL A;  1PSQ A;  2REM A;  2LJK A;  1GP1 A;  1FO5 A;  1MDI A;  4N30 A;  22GS A;  2GSS A;  4YQM A;  3RHB A;  2B5X A;  3KGK A;  3M9J A;  1Y25 A;  2FWE A;  1R5A A;  4F9Z A;  2VOC A;  2HSY A;  3UMA A;  4I8B A;  1V98 A;  3UOM A;  1VF1 A;  4BVX B;  5CO3 A;  2P0G A;  4N11 A;  2B5Y A;  3QAV A;  1GSF A;  1SK0 A;  2KP1 A;  13GS A;  1PN9 A;  2V2G A;  1SYX A;  1ZCP A;  1PX6 A;  4AF2 A;  1FVK A;  3GKM A;  4MJC A;  1TRW A;  4MP4 A;  5B7C A;  3GMF A;  2LEG A;  1HQO A;  1ZYN A;  2XPD A;  5CP1 A;  4HJ2 A;  1M99 A;  5DAK B;  5C04 A;  2HE3 A;  5D96 A;  4I6X A;  3IC4 A;  3GSS A;  4N10 A;  3TJK A;  1VF2 A;  3EU4 A;  1MD4 A;  2IJY A;  4IW9 A;  4POM A;  1SL2 B;  4WF4 A;  5IMV A;  2C1Y A;  3KP8 A;  1BED A;  5ELG A;  4K1F A;  2RII A;  1A2M A;  2HZE B;  2YWO A;  3TUE A;  3I69 A;  1TJD A;  2IWT A;  17GS A;  3F8U A;  4K5R A;  1K0N A;  1TXU A;  4O32 A;  2HQT A;  2H6Z A;  1WP0 A;  4F0C A;  1M2D A;  5C00 A;  5IMF A;  4Z2T A;  3QDN A;  1X9S B;  1UC7 A;  1CQG A;  2VL2 A;  4ZL7 A;  1BYE A;  2DJ1 A;  2LRN A;  5COH A;  3EMP A;  4V2M A;  4JR6 A;  1K3L A;  1Z7R A;  2H75 A;  2EFC A;  1YF0 A;  2I9H A;  3TJF A;  5B6M A;  3MYD A;  1TK8 B;  3KD0 A;  4ZL9 A;  4AKX B;  3KXO A;  4EDZ A;  2B1K A;  3A5I A;  1TW9 A;  5A4U A;  3F4T A;  3M3M A;  4NAX A;  2K9F A;  3GUR A;  2HSN B;  2IME A;  4DSR A;  4FYB A;  2OAC A;  3H93 A;  2GQK A;  2EFH A;  2JZS A;  4O5R A;  1U3I A;  1G6Y A;  6GSY A;  1DSB A;  3BOA A;  5J4V A;  4OCE A;  3KP9 A;  1R4W A;  4XIH A;  2CX4 A;  4TR0 A;  5IMZ A;  2RM6 A;  3U5R E;  1A8L A;  1SJ6 A;  5KEJ A;  1GTI A;  5ID2 B;  1VF3 A;  2VUP A;  3EPT A;  4ISD A;  4OWY A;  2HSH A;  1GTB A;  2QSI A;  2N5A A;  3D0Z A;  5B8A A;  1U88 A;  2PU9 C;  4FH8 A;  1VGL A;  1GNE A;  1SK1 A;  2V6K A;  3CXG A;  2AJQ B;  3WGD A;  4O7H A;  1PN0 A;  3D4M A;  2M72 A;  2OE1 A;  1GSS A;  1XWA A;  2GT5 A;  4KSO A;  2F8F A;  3W8S A;  3N9J A;  2VL2 C;  2A2S A;  2YWM A;  2IN3 A;  4F03 A;  1XWG A;  4MZB A;  4ULX A;  2HZF A;  3DD3 A;  3US3 A;  2NTO A;  4YQV A;  4MPG A;  4EDY A;  1T00 A;  3EIN A;  2VKZ G;  1M2B A;  1XCC A;  4Z2U A;  1PKZ A;  1SYR A;  1GSD A;  1MDJ A;  2PVQ A;  4PX1 A;  4KCA A;  4IS0 A;  1FOV A;  1AUC A;  3HKR A;  1JLW A;  3ME7 A;  1FG4 A;  2H74 A;  3MDK A;  1JFU A;  10GS A;  2C0E A;  1IYH A;  3DVX A;  2E2M A;  19GS A;  20GS A;  3ZMK A;  3RBT A;  1GNW A;  2VIM A;  5KN1 A;  3RHC A;  2J9H A;  1SKW B;  1TDI A;  1YQ1 A;  1V58 A;  1K3O A;  3DGQ A;  1SU9 A;  3F0I A;  5IO0 A;  1DBY A;  2DKH A;  5EVO A;  2LQQ A;  1TKD B;  1YY7 A;  3AY8 A;  2VCQ A;  2NDO A;  5A1N B;  2D2Z A;  4XS1 A;  1OC3 A;  3DXB A;  3ZZX A;  6GSW A;  1QQ2 A;  4XS4 B;  1ZYE A;  4K0G A;  4I97 A;  1XWC A;  5ECN B;  4PQI A;  2UV8 G;  3FR3 A;  3VWW A;  2HXK A;  1JZR A;  2YN1 A;  5G1L A;  3GX8 A;  1XFL A;  4IQA A;  1JZO A;  3QPM A;  3Q19 A;  2FWF A;  2R2J A;  4ZXG A;  3ZRE A;  4OO5 A;  2MBT A;  1GSU A;  1FVJ A;  4G2E A;  2F51 A;  4TR1 B;  4IBP A;  3MSZ A;  1HYU A;  2H1B A;  2HSM B;  1AXD A;  2GZY A;  1GLP A;  2VO4 A;  2ZCT A;  4N3Z A;  2H1A A;  3FEU A;  5HQP A;  4GLT A;  3QMX A;  2YWI A;  2QC7 A;  1ML6 A;  2OAD A;  8GSS A;  3Q18 A;  5DBQ A;  4ZB7 A;  4ECJ A;  4PTS A;  3UJ1 A;  1AQV A;  5HR0 A;  3HZ4 A;  1K0M A;  1GUK A;  4WR4 A;  5A1N A;  5FT3 A;  5E59 A;  2YJH A;  3WYW A;  1EGO A;  1SEN A;  1PA3 A;  3M0F A;  1YKC A;  2EFD A;  5E4W A;  1QUW A;  2OBK A;  1PX7 A;  4L5L A;  5JCW A;  1E2Y A;  2R5G A;  3C1R A;  4Q5F A;  4RQX A;  2WGR A;  1SVO A;  4YAV A;  4PUF C;  4KAE A;  4NXI A;  3ERG A;  1XWB A;  4OD7 A;  1XWK A;  2YZH A;  3GX0 A;  4Z2R A;  1K0A A;  2HSM A;  3LOR A;  4AJ8 A;  2DML A;  3L9U A;  2DJ0 A;  1HD2 A;  1SL1 B;  3E9J B;  1LBK A;  2VLV A;  3CRU A;  3D21 A;  5F07 A;  2LJA A;  5DQY A;  5H5R A;  3WGX A;  2OBI A;  4CHS A;  3EC3 A;  4CW9 A;  4MJB A;  2NVL A;  4ZBB A;  2JU5 A;  3GA4 A;  3DYR A;  5J9C A;  2YOI A;  1XBS A;  3GKX A;  4I2U A;  4O5Q A;  4TN8 A;  3E0U A;  3H4K A;  4EUY A;  2R0C A;  1YVL A;  4G0K A;  2O85 A;  4HZ4 A;  3KCM A;  1BF5 A;  4QMK A;  2X49 A;  4ZL8 A;  4X1U A;  4TR3 A;  1ZGN A;  1MTC A;  5D9V A;  1U87 A;  1O8W A;  2B3S A;  3TRX A;  5GST A;  5G2Z A;  1QK8 A;  4G01 A;  4KF9 A;  5J9B A;  5EY6 A;  2EIO A;  3GV1 A;  3CTG A;  3TGZ A;  4FYC A;  14GS A;  1GSQ A;  1FHE A;  5J5N A;  1WWJ A;  4X0X A;  3UVH A;  2X8C A;  5A34 B;  5G5E A;  4MZW A;  1W4V A;  3VPQ A;  3VK9 A;  4DVC A;  1UN2 A;  2F8A A;  5ECH B;  3P8W A;  5IM9 A;  4TXO A;  2LS5 A;  3IC8 A;  5D9W A;  4BA7 A;  4KDU A;  1G6W A;  2O8V B;  4OFT A;  1PL1 A;  3IBH A;  1KEB A;  3PH9 A;  1B9Y C;  2IMI A;  3S9F A;  3TCO A;  2M80 A;  1FAA A;  1WPI A;  3A3T A;  1TRS A;  4ZIL A;  3ZIJ A;  5J47 A;  3IV4 A;  1XOA A;  4E8H A;  5AGY A;  1M2A A;  1AW9 A;  2L5O A;  2X8G A;  4EXJ A;  3F4S A;  1O7U A;  5FWG A;  1URM A;  4KUN A;  4YQU A;  4POB A;  5AN1 A;  4BWQ A;  2HT9 A;  5G31 A;  2VL9 A;  1PQN A;  3WD6 A;  3WT1 A;  3VI7 A;  4NV5 A;  1T3B A;  2FY6 A;  3UEM A;  1V40 A;  1VF4 A;  4E68 A;  1A0R P;  3GYK A;  2H0H A;  1ZOF A;  2YJ7 A;  3ME8 A;  4FQU A;  1H4O A;  3GH6 A;  5LCZ A;  3TB2 A;  1N2A A;  5J41 A;  3IOS A;  2PN8 A;  4Z7X A;  4G0L A;  1TTZ A;  1R5P A;  3F63 A;  4AKG A;  3LFL A;  5CNW A;  3ZLP A;  2PVO C;  4TKY A;  3ZIT A;  4AI6 A;  1X5E A;  4IEL A;  4PXO A;  1U6T A;  3ZFL A;  2JAD A;  4ICY A;  1Z3E A;  1GL8 A;  5LD0 A;  5ECP B;  3J7Y b;  2H0I A;  3LYP A;  3FYG A;  5JWO B;  3MWH A;  4AGS A;  2G2Q A;  4OCF A;  3HJO A;  5ECM B;  1I9D A;  3RDW A;  2JZR A;  3VLN A;  2HRA A;  3F3Q A;  2GQM A;  2BTO T;  5DQS A;  2ALB A;  4EIQ A;  5AIS A;  1G7E A;  4K5S A;  3KMN A;  4GWR A;  1B48 A;  2R37 A;  5ECL B;  3MNG A;  1F2E A;  2GST A;  1XPV A;  2NBS A;  2CAI A;  3GUS A;  3W6G A;  3VUR A;  3QFA C;  5HFG A;  2AHE A;  4ID0 A;  4KB3 A;  3VPT A;  3EMX A;  1EGR A;  3KTB A;  4ECB A;  3D22 A;  5ECO B;  2NPB A;  1BG1 A;  3Q6O A;  4LLR A;  2ES7 A;  2H6X A;  2VLU A;  1V9W A;  3WT2 A;  3QR6 A;  4DSS A;  4TXV A;  2B5E A;  2HFD A;  3LQ7 A;  4EVM A;  4GXZ A;  3H1N A;  5D93 A;  2C0G A;  1PD2 1;  3F6F A;  1I5G A;  4GQC A;  4V2N A;  2RUF A;  3I9V 2;  2YV9 A;  3I43 A;  2VM2 A;  2L6D A;  3HVV A;  3LSZ A;  2GQL A;  2KHP A;  2L57 A;  3CSI A;  5A5H A;  3FKF A;  1A23 A;  1FB0 A;  4MF5 A;  5D73 A;  3IHG A;  2FA8 A;  1O6J A;  2HRN A;  2R0G A;  1SL0 B;  4G0I A;  5KN0 A;  5CRD A;  2FHE A;  2TRX A;  3UVT A;  4USS A;  3D6I A;  3P90 A;  6GSX A;  6GSS A;  5HR2 A;  1HNC A;  5J4Y A;  3IPZ A;  1WE0 A;  3GL3 A;  2DSA A;  1EP7 A;  4HUA A;  3L9V A;  1YF1 A;  5EPF A;  1YJ6 A;  3DEX A;  5H5S A;  4IVF A;  1ILO A;  1ZYQ B;  2H1L A;  16GS A;  1M9A A;  3NOF A;  1AIU A;  2A2R A;  4EC0 A;  3EYT A;  1F37 A;  5CYY A;  5ECQ B;  1ABA A;  1TU7 A;  4ZB8 A;  3LGC A;  3EUR A;  2H73 A;  1JLV A;  3KIJ A;  4Q5R A;  1EEJ A;  2IMD A;  3TKR A;  2VCW A;  3EVI A;  2L5L A;  3HJP A;  3FHK A;  3O76 A;  3G9B A;  4YKF A;  2CVD A;  2MMN A;  3TKS E;  1JZW A;  2CQ9 A;  3FMW A;  3UIW A;  4GSN A;  2OJL A;  2JZT A;  1YKA A;  1YEX A;  1F9M A;  2CV4 A;  1V57 A;  3MIX A;  3IRA A;  1M9B A;  4EF0 A;  2WUL A;  2C80 A;  4RI7 A;  2F9S A;  1MD3 A;  3KTL A;  4HQZ A;  1J08 A;  1UVZ A;  4IN0 A;  4IQ1 A;  5ECI B;  1SJZ A;  1EV4 A;  3TKP A;  2GS3 A;  1O81 A;  3GFK A;  3FW2 A;  4V1A g;  3KEB A;  2YV7 A;  1RK4 A;  4ACS A;  3DWV A;  4KH7 A;  1DUG A;  1EV9 A;  1QFN A;  1BX9 A;  4IHU A;  3PIN A;  2P5Q A;  5INY A;  5IMC A;  3JCM L;  3HD5 A;  2H1G A;  4XHM A;  2PBJ A;  4ZBD A;  2QA1 A;  1OE7 A;  1M0U A;  4YH2 A;  2JSZ A;  2FCH A;  5F0G A;  4ZIJ A;  1A8Y A;  2E7P A;  1ON4 A;  4XRD A;  4JZQ A;  3D4T A;  3HHV A;  4GSS A;  3VI5 A;  4HJM A;  3LYK A;  4N0Z A;  4OFN A;  4LA1 A;  2I3Y A;  4IKH A;  2WFC A;  2CVK A;  4FIW A;  5DAL A;  4MH2 A;  1EZK A;  4K7N A;  1JHB A;  1O73 A;  3ZTL A;  1MEK A;  2DJ2 A;  2BMX A;  5D9X A;  1SVM A;  2DC5 A;  3IHQ A;  1K0C A;  6GSV A;  3CMI A;  1O8X A;  5B6N A;  5D8I A;  4MH3 A;  2VM1 A;  1NHO A;  2WS2 A;  5DJM A;  5DCG A;  4MK3 A;  1OAZ A;  1TOF A;  4L0W A;  5IOX A;  1OKD A;  2XC2 A;  1GTU A;  5F05 A;  1YDK A;  4GTU A;  2B6M A;  4PUR A;  2HNL A;  1BG5 A;  3GHA A;  4XTS A;  1V2A A;  1Q98 A;  2V32 A;  3VFI A;  2O87 A;  2DJK A;  4MPF A;  2DJJ A;  2X64 A;  3RPP A;  3FZ5 A;  2EIQ A;  3GKN A;  3IA1 A;  1ST9 A;  5DCH A;  2LRT A;  1SKS B;  1ERV A;  5EL8 A;  4CY6 A;  1K0O A;  1VRS D;  1GUL A;  5HR1 A;  2L4Q A;  1X5D A;  2VLT A;  4MAB A;  2P5R A;  3DKS A;  4JU5 A;  4PUA A;  1SKR B;  4G10 A;  5IMA A;  1FW1 A;  4CDO A;  3CYN A;  3ZYW A;  5G30 A;  4OMV A;  2X8H A;  3QFB C;  1AQW A;  1W89 A;  1CQH A;  5IIZ A;  4ZB9 A;  2C8U A;  1J0F A;  2R4V A;  5J3R A;  4Q5N A;  3ERF A;  5IO2 A;  4Q5Q A;  5GAP D;  1KTE A;  3HMJ G;  1ZZY A;  4GQF A;  2LNS A;  5HR3 A;  4L5O A;  5FHI A;  5LNK e;  3BCI A;  2VCX A;  5BMU A;  3OR5 A;  4P3Y B;  1SK2 A;  3P2A A;  2OKA A;  4HI7 A;  3UL3 A;  2O5V A;  2UZ8 A;  7GSS A;  4F0B A;  2CT6 A;  2VD0 A;  4TXO B;  4K2X A;  1R26 A;  4TRX A;  3M8N A;  3LXT A;  4IP1 A;  3ZRD A;  5HFK A;  5ECK B;  1BJX A;  1KBN A;  5L71 A;  2V6O A;  3KMO A;  3IXR A;  3RAZ A;  1XZO A;  3QOU A;  4QL7 A;  3GKK A;  3J7Y k;  4K7O A;  4F82 A;  5G1K A;  3E3E A;  2YNX A;  4RI6 A;  3LEF A;  4IJI A;  2RM5 A;  2VD1 A;  1TRV A;  3LWA A;  2IMK A;  3KM6 A;  3L0H A;  3HCZ A;  4ML1 A;  4HOJ A;  3L78 A;  1HNA A;  2LJR A;  4K0N A;  2AB6 A;  5DDL A;  1EOG A;  1S3A A;  4X43 A;  2AV4 A;  5J40 A;  1PL2 A;  5DJL A;  4LL1 B;  5HFI A;  3CWG A;  2A4V A;  2ZUP A;  9GSS A;  2CVB A;  1AAZ A;  4HDE A;  2WB9 A;  3CSH A;  3M9K A;  3U6V A;  1T4Y A;  5J4U A;  4KGI A;  1PKW A;  2H6Y A;  2BJX A;  2E2G A;  4WBR D;  4L8E A;  4WKW A;  1Z9H A;  3I6A A;  4FO5 A;  4J56 E;  3L9S A;  2GSR A;  3GTU B;  3O3T A;  2MZC A;  4EL1 A;  4MDC A;  2CA8 A;  4POL A;  1BQ7 A;  2B7J A;  2CZ3 A;  3KZQ A;  4MF6 A;  2MMO A;  2H76 A;  2LQO A;  3FR6 A;  4K6X A;  5IMD A;  3A2V A;  3IR4 A;  2A4H A;  1ACV A;  2KOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...