4PGTA

Crystal structure of hgstp1-1[v104] complexed with the gsh conjugate of (+)-anti-bpde
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
209
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 209
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pgtA01
1Z6NA 2QC7A 1SD9A 4AJ7A 11GSA 2GTUA 3DKSA 2KP1A 2OBKA 2EIOA 4IN0A 4TN8A 1FOVA 2HSMB 3CMIA 4NV2A 2B7JA 1N8JA 5DJLA 5IO2A 3C8EA 4ZBBA 2OE3A 1Y25A 5EY6A 3CSHA 3F6DA 1MDJA 5JWRB 1EEMA 4WXTA 3UBLA 3KGKA 2KP2A 5ECHB 2GSQA 5FWGA 4J56E 3L0HA 2GDRA 5AISA 4POKA 1ZYEA 2YOIA 1K0OA 1X9SB 4MA9A 4POBA 4L5OA 1SJ6A 1A24A 4EVMA 2B5YA 4OO4A 5DALB 3TJFA 2GZZA 5LCZA 3LXZA 4OMVA 4XIHA 2WDUA 1DSBA 2YWMA 4AJ8A 5ID2B 3LSZA 1J9BA 2HZFA 4POMA 5FT3A 3CRTA 1U3IA 2MMZA 5IQYA 2FWGA 1J0FA 4TR1B 3FKFA 4F03A 4OCEA 1DE1A 1GTAA 2BJXA 1T00A 3L4NA 2C0GA 5G5FA 2L6CA 3RBTA 1BX9A 2VLTA 1UVZA 3GL5A 4G0LA 1G7OA 3H93A 1XIYA 2LRCA 5DQSA 3EWLA 2PGTA 2GS3A 3TDGA 3IA1A 1PGTA 3P90A 2L59A 4MZCA 1URMA 2HZEB 5KN2A 2JSYA 3NIVA 1EOGA 1TU7A 1JZDA 1AQVA 4TXVA 4EO3A 3KTLA 2V2GA 2H6YA 2H74A 4TR0A 1AIUA 1XW9A 2GVPA 4K9ZA 1DE2A 3GURA 2HXKA 4FYCA 1TRVA 5HR3A 1TI1A 4EDYA 1JZWA 4ZILA 4IVFA 3KJYA 4BVXA 4QL7A 1XOAA 3EE2A 1ILOA 4NXIA 4Q5NA 2GGTA 3APOA 3MAKA 2PUKC 3GV1A 3HY2A 2F9SA 1K0DA 5ABRA 2HRNA 5DJMA 2YCDA 3UMAA 2OA7A 2K18A 2WCIA 3HXSA 2IFQB 2A2SA 3GHAA 2LKUA 3TGZA 2FA8A 3ZFBA 1K0AA 2V6KA 4MJEA 4BA7A 2O8VB 3ZTLA 1VF1A 1GULA 3A2XA 2IMKA 2NDOA 3EINA 2OBIA 4L0UA 2ZUPA 3UBKA 3HJPA 3ERGA 2C80A 1XBSA 3GMFA 4BVYB 4QL9A 5D9WA 3FZ4A 3MWHA 4MPFA 3DRNA 3E9JB 5D73A 1THOA 3TKSE 5A4VA 1ABAA 5F05A 2FD3A 1MDIA 2CX4A 1WOUA 3KEBA 3TKSC 5G1KA 3IE3A 3WGEA 3J7Yb 4EDZA 2KUCA 2FCHA 2CZ2A 2WJUA 2TRCP 5F8BA 1Z7RA 5ECPB 2HQTA 3CTGA 4X1UA 5DCGA 5H5RA 5D8IA 3IAS2 3RHBA 4JR6A 2H1BA 2A2RA 2CAQA 1YKAA 2XPDA 3KZQA 3LORA 3H79A 3ZMKA 2I81A 4HU7A 1R5PA 2GLRA 5LNKe 5A4UA 4XS6A 3ZVJD 3VPQA 4GLTA 1TJDA 1I5GA 3C7MA 1K3OA 2VL9A 3HVSA 1YDKA 3TOTA 5F06A 4JE1A 1BJXA 2R3XA 5ECOB 1M7TA 2M46A 3HZ4A 2PVOC 1SL0B 5KEJA 3TOUA 1GUMA 4HZ2A 4K7OA 4LLRA 2H75A 1EEJA 2YWNA 4ECCA 4F0BA 2RUFA 1PSQA 2LUSA 3ERWA 1B9YC 3HJMA 2RM6A 1TXXA 1SL2B 1QMVA 3HKRA 4L8EA 3EYTA 2H01A 4NPBA 5E59A 5D93A 1NHYA 3QAWA 3QD9A 2QGVA 1GTBA 1CQHA 4K0GA 4MJBA 4PUFC 1TK0B 4ID0A 4BL7A 4XS1A 4DSSB 4OFMA 3HYPA 2AV4A 4F82A 2P5RA 2C0EA 1HNAA 2FA4A 5FHIA 3IR4A 1TRUA 3L9UA 1SJIA 1GSEA 4X0XA 2MBTA 2L6DA 5L71A 4YAVA 3IXRA 4IJ3A 3D5JA 4MH2A 1SK2A 3HVXA 2JZRA 1G7EA 4N10A 2LEGA 2VL2C 3QOUA 3GYKA 1R4WA 2VM1A 2AYTA 3SWLA 4XHMA 1TKDB 2PERA 2I3YA 3FR6A 1YEPA 1X0RA 3R2QA 3Q18A 1PKWA 2R6KA 1E6BA 1JFUA 1U87A 1XCCA 4BVXB 3F0IA 2KHPA 2LQOA 1OE8A 1THXA 3PR8A 1YQ1A 4OCFA 5JCUA 1MD3A 1H75A 2LNTA 4KNDA 1GTIA 2NBSA 2DJ2A 3ZFLA 3KXOA 2WZ9A 3GNJA 3UJ1A 1TI3A 3DIEA 1GH2A 5J3RA 2VCQA 1QXHA 4OD7A 1TRSA 2KLXA 3BBYA 5AN1A 2XPEA 20GSA 1PQNA 3IC8A 3QCPA 1ZYQB 1OC8A 3WT1A 6GSVA 4I5QA 4MH3A 4DVCA 3JCML 3FZAA 2IL3A 3RHCA 1SK0A 3FRCA 3UEMA 1F9MA 4I2UA 4CW9A 2H0IA 3MSZA 2B3SA 3LFLA 1SKRB 1PKZA 5HFKA 1RQMA 1A8YA 4TKYA 3KM6A 4TR4A 2VCWA 1HD2A 1GUHA 4KH7A 4AGSA 3KIJA 2AUVA 2R2JA 2VD0A 2EIQA 4GQCA 1M2DA 4PX1A 1OKTA 7GSSA 3IRAA 2JADA 3W8SA 4IKHA 3ISOA 2VUPA 3DGQA 2JZTA 1TW9A 4E8EA 1EP7A 4MJCA 4I8BA 2IWTA 2BTOT 2WULA 2WS2A 3ERFA 2VOCA 5B8BA 2V32A 4MF6A 5ECIB 5CP1A 4O92A 1AAZA 6GSSA 1X9MB 3VWXA 3MNGA 1QK8A 2X8GA 5F07A 1SU9A 1O85A 1NHOA 1X9WB 18GSA 2HFDA 2HI7A 2CQ9A 1PMTA 1JZRA 3ZMLA 1HNCA 5G30A 4PNGA 2CV4A 4I6XA 3ZVJA 2H1DA 1WIKA 3UARA 1PX6A 2IMDA 5AIXA 1S3DA 2HNLA 3IAM2 5JWOB 2YWOA 4FQUA 1F3AA 4WF4A 2PVQA 1WWJA 4ZB9A 4GRFA 3IV4A 1GSUA 1YJ6A 2D2ZA 4K8MA 1K0CA 3GA4A 1YZXA 2M72A 3VI5A 3P7XA 4IGJA 4FYBA 3VFIA 2VCZA 5A5KA 5GAND 3CYNA 1EP8A 3W6GA 1VF3A 3QAVA 1M2AA 2OACA 2OJLA 5ELAA 1AUCA 5KN3A 2VD1A 3KH7A 1EGOA 4KDUA 4ZXGA 4ZB6A 1A23A 5B7CA 3LYKA 3M3MA 2B5XA 2K8SA 3FR9A 3G7JA 1XWCA 3L9SA 1C72A 3DVXA 4KW6A 5LD0A 4POLA 4N11A 2GSSA 4KGIA 1TK8B 4RI7A 4ML6A 2OADA 4DSRA 3ZRDA 4KDYA 2OKAA 1GSDA 3F8UA 5KN1A 3GX0A 2LS5A 4G19A 4F0CA 5CRWA 1DBYA 1EOHA 1SD8A 3RPPA 2HRKA 3Q6OA 2C8UA 1MTCA 3APSA 3HVVA 1T1VA 4WR4A 5IMZA 4ZL7A 2LQQA 6GSUA 4XCSA 3FZ9A 4WBJA 5DDLA 1ML6A 3ZREA 5G1LA 3ZZXA 2MYGA 3AY8A 3UIWA 4LA1A 3KP9A 2FGXA 2V41A 2H73A 3R3EA 2B6MA 6GSYA 2H0HA 2FWHA 3GTUA 5G2ZA 5IOWA 3F9UA 1Y6EA 1FB0A 4GSSA 2GZYA 2YNXA 5IMFA 3H4KA 1KTEA 3GH9A 3A2WA 6GSWA 1AW9A 3P8WA 3UAPA 5CNWA 3FZ5A 1B48A 1BYEA 3K8NA 3IHQA 3UVHA 4BWQA 2UZ8A 3HA9A 3QAGA 1F6MC 1QQ2A 2FUG2 9GSSA 1Z3EA 1YF1A 4WR5A 1FW1A 1Z9HA 5DCHA 4K6XA 1FVKA 2LJAA 1T7PB 4MP4A 1YEXA 2DMMA 3IK9A 4TOPA 2LJKA 1ERUA 1U6TA 2YZHA 3FYGA 3ZYWA 3DWVA 1T3BA 3J7Yk 1RW1A 2C0FA 5EVOA 3FHKA 3SBCA 1WPIA 3WYWA 4LL1B 4MDCA 2XBIA 4JRRA 2E7PA 5HQPA 4XS4A 3TUEA 4YAPA 3BJ5A 1Z6MA 4CDOA 1B8XA 2YZUA 2DJ1A 3P2AA 3KP8A 1SJZA 1AQWA 5GZZB 3IBHA 5D9XA 3HCZA 2H6ZA 2L57A 1G6WA 4EUYA 4IP1A 2JL4A 2C1YA 4ZIJA 4NWYA 4V1Ag 4JR4A 2LRTA 2RLIA 1AQXA 1OAZA 2H76A 2YJ7A 1EV9A 5IMCA 4HQZA 5E4WA 1LU4A 4XRAA 2CAIA 1Q98A 4TR3A 1ST9A 2KOKA 4HDEA 3L78A 3LYPA 4ILFA 3WD6A 1O81A 3V1WA 1GSQA 4ACSA 4XTSA 4G9HA 5DVBA 5HFIA 5C00A 4IBPA 2PMTA 1FO5A 4GCIA 1HQOA 1F37A 3EMPA 1ACVA 1ERTA 1OE7A 2OE0A 1M9BA 1QGVA 1YF0A 4PQIA 2E2MA 3Q74A 3EC3A 3CSIA 1ERWA 2FNOA 4GF0A 3IC4A 1W89A 4N0ZA 5J5NA 3CXGA 1IYHA 1X5EA 2QKEA 4D73A 5AIVA 4V2MA 4OFTA 1XXUA 1FB6A 2DC5A 2ZNMA 3F6FA 1TOFA 4PQ1A 3LGCA 1GLQA 2DJJA 3TKPA 2VLVA 2TRXA 5IOXA 1XVQA 4K2DA 1PRXA 2IJYA 3ED3A 1ZCPA 5ECKB 2GZPA 1Z5YE 3US3A 1QFNA 3WGXA 4MLYA 4ZBAA 2PWJA 4MK3A 4MF5A 5IMAA 3IDVA 4HI7A 5EL8A 1WE0A 4ECIA 2FWEA 2HYXA 2CA8A 1EZKA 1GSSA 4PXOA 2YV7A 4FO5A 1F2EA 3U6VA 1NW2A 2H19A 1TP9A 1JLWA 1Q4JA 2HSHA 2HRKB 3CTFA 3C1RA 3IPZA 4USSA 1USBA 4KAEA 2G2QA 5G31A 3GUSA 4GSNA 2H72A 3DYRA 1BEDA 10GSA 4ECJA 4KB3A 4P3YB 1A0FA 2FY6A 3QFBC 3ME7A 16GSA 4FH8A 2WRTA 2DIYA 3W8JA 2B7KA 2RIIA 4GTUA 8GSSA 5IMDA 1B4PA 3GN3A 2MMOA 2J23A 3C73A 3GTUB 2DJ3A 1XWBA 4MZBA 4ZL8A 4ML1A 2K9FA 2ALBA 4Q5RA 2NVLA 4G0KA 1M9AA 5JCWA 3LXTA 1V57A 4K7IA 3BOAA 3KH9A 1XFLA 5DALA 4MCUA 5HFGA 3GKKA 4DSQA 2JZSA 3IK7A 2L5LA 3I9V2 1JLVA 4YQVA 2CT6A 4G0IA 1XWAA 4YH2A 3PH9A 3O3TA 2VAFA 1UN2A 3M0FA 2P31A 3M1GA 3TKQA 1SK1A 4WEYA 4HJ2A 1G0TA 4HEA2 1I9DA 3O6TA 3RAZA 4JZQA 4EE0A 4KSOA 4V1Ap 2IMIA 1S3AA 1BQ7A 4LMWA 3CBUA 1K0MA 2H1AA 3NOFA 5J41A 2C4JA 3O76A 4V2LA 22GSA 4K1FA 3QMXA 5A4WA 1MDKA 2R37A 1DUGA 3FW2A 3VLNA 4PTSA 3F4TA 2I4AA 5IM9A 5J4UA 3TB2A 4O7HA 3F3RA 4OO5A 2BMXA 3BCKA 3VI7A 5BMUA 1EV4A 3GKNA 3TJJA 1LBKA 1FVJA 3ZL5A 1YY7A 2LTKA 5B6MA 2CZ3A 2AAWA 2L4CA 5J9BA 1CQGA 3QR6A 4Q5QA 2H30A 5ECMB 4EC0A 2QSIA 4IJIA 4EXJA 2YPMA 5J9CA 1OC9A 1PN9A 2LNSA 4MF7A 2N5BA 1A2JA 4JU5A 4OWYA 4KCAA 4IP6A 1V58A 1A8LA 2H0GA 4J57E 5JWQB 5IPGA 3A3TA 1OVNA 3QPMA 2L4QA 4D73B 2Z9SA 1B9XC 2K8VA 4AJ6A 1FG4A 3F4SA 1K0NA 1GSYA 4GXZA 1EWXA 2RUEA 4IW9A 5DAKA 1KNGA 4RQXA 4V2NA 2GSRA 4LMVA 5CAXA 2NTOA 1B4QA 1A0RP 2ZCTA 4MJAA 4IS0A 3ZIJA 5D96A 2CVDA 3LEFA 3LQ7A 2PPTA 4KA0A 1GNWA 5B8AA 3FK8A 3GL3A 3D22A 4ZL9A 2PBJA 2AHEA 4BL7B 1GNEA 1H4OA 4N0VA 2YP6A 3PGTA 3I69A 4IQAA 4HZ4A 1WMJA 1EGRA 2HLSA 1X5CA 5EPFA 4NAXA 3UL3A 1KBNA 3GSSA 5CRGA 1U88A 2LJRA 4PNFA 2YWIA 2I9HA 3D4MA 4G2EA 3ZIVA 3KMOA 2J9HA 4O5RA 2XBQA 2L5OA 1XVWA 1K0BA 4OFNA 3FR3A 3A5WA 3CRUA 1SKSB 2EIRA 2FHEA 1XOBA 2WGRA 3VK9A 2GQLA 1PX7A 1T8EB 5C04A 3OR5A 3D6IA 4GWRA 1V9WA 3TJBA 3I6AA 2HE3A 2HRAA 5ECQB 4IELA 2O87A 3GX8A 5GSTA 4E8HA 4X43A 3GRXA 1GL8A 4ECBA 3C71A 1VF4A 3WGDA 1HNBA 4DSSA 2GSTA 3EU4A 1XZOA 1QUWA 2VCXA 1F3BA 3CSJA 5AGYA 3IOSA 2YANA 5GSSA 3DVWA 2H66A 3EU3A 2DLXA 5IMVA 2FWFA 1NM3A 2DBCA 2IN3A 5IPHA 1UA5A 4F2IA 5ECNB 5H5SA 4HOJA 2HSYA 1SYXA 2HRFA 5F0GA 1FAAA 1UC7A 3TJGA 1O8XA 5ECSA 1V40A 2GT5A 5DQYA 1TRWA 4MABA 2XC2A 3ZITA 1GWCA 3M8NA 1VGLA 6GSTA 3TKSA 2HSNB 5JCGA 4JBBA 4FYUA 1OYJA 3QFAC 4N30A 2PN8A 1V2AA 3BCIA 1GUKA 3EVIA 2ON5A 2YJHA 2V1MA 1M0UA 1ZGNA 1O73A 2CVBA 2H8LA 3EMXA 4EF0A 5CYYA 3M9JA 1XPVA 4GSTA 1R5AA 3EURA 2HT9A 5D9TA 2C3TA 3RDWA 2P5QA 3G7IA 3QDNA 4EKZA 4AF2A 3DXBA 4L0WA 1X5DA 1M2BA 3FY7A 1ZZYA 3D4TA 1SL1B 1ZOFA 1WRYA 2H6XA 3HD5A 4IQ1A 2WB9A 4BPYA 2FLSA 2F51A 4PUAA 4ZBDA 3GKXA 1PL1A 1YKCA 5KN0A 1OC9B 1W4VA 2CVKA 3A2VA 2VO4A 3KD0A 1A2MA 2B1KA 3M9KA 1NSWA 2E0QA 3APQA 2VL3A 2H70A 4LL4B 1GP1A 2H1GA 3E3EA 2RM5A 1OC3A 3F3QA 4QQ7A 1E2YA 3GH6A 1TK5B 1ERVA 1ZMAA 1BG5A 5INYA 4TW5A 2LRNA 4KE3A 3U5RE 1BAYA 4CHSA 3VPTA 2C0DA 3NZNA 5DAKB 1PD21 1J08A 2IMFA 2C3NA 1M99A 1T4ZA 2O85A 4Z7XA 4NHWA 4XRDA 2WFCA 4KUNA 3PPUA 4TXOA 4DEJA 2NPBA 4ULXA 2YN1A 3KMNA 4HJMA 5HR0A 3UOMA 2MMAA 1OKDA 12GSA 4RI6A 2VL2A 3GKMA 1SYRA 1JHBA 2IMEA 3LJRA 1FHEA 3N5OA 3G7YA 5CREA 2ON7A 3H8QA 4PURA 1XWGA 1ZL9A 3KCMA 4Q5FA 4MPGA 1XW5A 2E2GA 3GFKA 5DBQA 5HR2A 4O32A 1SENA 2CX3A 2TIRA 4I2TA 2N5AA 2AB6A 1TU8A 2HSMA 3KTBA 2MBSA 4JEDA 2LSTA 2H71A 2MZCA 2EC4A 19GSA 4MMMA 3I43A 2DIZA 2GQMA 1GLPA 2G0FA 2O89A 5CRDA 1Z7PA 2R4VA 4KF9A 4J2FA 4I97A 4TVEA 3D0ZA 3TRQA 2P0GA 3PINA 2REMA 1GTUA 4G10A 3TJKA 3HHVA 2V6OA 4NV5A 1RK4A 4NHZA 1U3AA 2MMNA 3VWUA 5GAPD 3GSTA 4YQMA 5IIZA 3ZLPA 2PU9C 3UVTA 2F8FA 3VWWA 3G9BA 1JZOA 1O6JA 4WKWA 1WP0A 4WETA 1GSFA 3F63A 1PA3A 5G5EA 2VM2A 4H86A 2DJKA 3F4RA 1TDIA 4YQUA 4TRXA 1WJKA 3DMLA 5ID2A 2DMLA 3H1NA 1SKWB 4NMUA 4HUAA 5IO0A 3DEXA 1O7UA 4WF5A 1MEKA 4TR1A 5CO3A 4BWSA 4GQFA 2R5GA 2B5EA 2X64A 1XW6A 4HS1A 4HQSA 1N2AA 3E0UA 4KX4A 2X99A 4EL1A 4XS4B 5H5QA 2I1UA 14GSA 4FIWA 2X8CA 2HZEA 2N5FA 2OE1A 4WBRD 3GIXA 5ENUA 1VRSD 3LG6A 5D9VA 3FEUA 2ES7A 4MZWA 3S9FA 3TCOA 1XWKA 1IYIA 2IIYA 4F9ZA 5ECLB 4HU9A 3TKRA 4KCEA 1O8WA 2JSZA 2YV9A 1MD4A 1HYUA 3L9VA 5HR1A 1R26A 5ECRB 2DJ0A 2O7KA 5COHA 4IHUA 2F8AA 1S3CA 4K0NA 4L5LA 3HDCA 1K3LA 3D21A 2IPAA 3LWAA 1AXDA 1ON4A 4K7NA 3WT2A 4RQRA 5B6NA 2IFQA 5ELGA 1T4YA 3N9JA 3VWVA 4KDXA 2VLUA 3BD2A 1K3YA 3ME8A 5CRHA 2GT6A 1R7HA 17GSA 1VF2A 2M80A 2A4VA 2LV3A 4ISDA 3MDKA 2F3MA 2VIMA 1A2LA 4PQHA 4BVYA 13GSA 2K6VA 3TRPA 4TXOB 3TRXA 3HZ8A 2JACA 2XHFA 2AJQB 4KSMA 3VURA 1G6YA 4ZB8A 3HJOA 4RUVA 2VCVA 2C3QA 2VCTA 1AC1A 1LJRA 3C1SA 2GQKA 2DSAA 1GRXA 4PGTA 3Q19A 1PL2A 6GSXA 1TTZA 1V98A 2X8HA 2JU5A 3RPNA 1KEBA 2B1LA 3DD3A
chains in the Genus database with same CATH superfamily
1Z6NA 4N3ZA 2QC7A 1SD9A 4AJ7A 11GSA 2GTUA 3DKSA 2KP1A 2OBKA 2EIOA 4IN0A 4TN8A 1FOVA 2HSMB 3CMIA 4NV2A 1S4BP 2B7JA 1N8JA 5DJLA 5IO2A 3C8EA 4ZBBA 2OE3A 1Y25A 3MYDA 5EY6A 3CSHA 3F6DA 1MDJA 5JWRB 1EEMA 4WXTA 3UBLA 3KGKA 2KP2A 5ECHB 2GSQA 5FWGA 3LW9A 4J56E 3L0HA 2GDRA 5AISA 4POKA 1ZYEA 2YOIA 1K0OA 1X9SB 4MA9A 4POBA 4L5OA 1SJ6A 1A24A 1SVMA 4EVMA 2B5YA 4OO4A 5DALB 3TJFA 2GZZA 5LCZA 3LXZA 4OMVA 4XIHA 2WDUA 1DSBA 2YWMA 4AJ8A 5ID2B 3LSZA 1J9BA 2HZFA 4POMA 5FT3A 3CRTA 1U3IA 2MMZA 5IQYA 2FWGA 1J0FA 4TR1B 3FKFA 4F03A 4OCEA 1DE1A 1GTAA 2BJXA 1T00A 3L4NA 2C0GA 5G5FA 2L6CA 3RBTA 1BX9A 2VLTA 1UVZA 3GL5A 4G0LA 4YKGA 1G7OA 3H93A 1XIYA 2LRCA 5DQSA 3EWLA 2PGTA 2GS3A 3TDGA 3IA1A 1PGTA 3P90A 2L59A 4MZCA 1URMA 2HZEB 5KN2A 2JSYA 3NIVA 1S3RA 1EOGA 1TU7A 1JZDA 1AQVA 4TXVA 4EO3A 3KTLA 2V2GA 2H6YA 2H74A 4TR0A 1AIUA 1XW9A 2GVPA 4K9ZA 1DE2A 3GURA 2HXKA 4FYCA 1TRVA 5HR3A 2A2PA 2H1LA 1TI1A 4EDYA 1JZWA 4ZILA 4IVFA 3KJYA 4BVXA 5BMUB 4QL7A 1XOAA 1BG1A 3EE2A 1ILOA 4NXIA 4Q5NA 2GGTA 3APOA 3MAKA 2PUKC 3GV1A 3HY2A 2F9SA 5BRTA 1K0DA 5ABRA 2HRNA 5DJMA 2YCDA 3UMAA 2OA7A 5J40A 2K18A 2WCIA 3HXSA 2IFQB 2A2SA 3GHAA 2LKUA 3TGZA 2FA8A 3ZFBA 1K0AA 2V6KA 4MJEA 4BA7A 1YEWC 2O8VB 3ZTLA 1VF1A 1GULA 3A2XA 2O5VA 2IMKA 2NDOA 3EINA 2OBIA 4L0UA 2ZUPA 3UBKA 3HJPA 3ERGA 2C80A 1XBSA 3GMFA 4AKIA 4BVYB 4QL9A 5D9WA 3FZ4A 3MWHA 4MPFA 3DRNA 3E9JB 5D73A 1THOA 3TKSE 5A4VA 4AKGA 1ABAA 5F05A 2FD3A 1MDIA 2CX4A 1WOUA 3KEBA 3TKSC 5G1KA 3IE3A 3WGEA 3J7Yb 4Z2TA 4EDZA 2KUCA 2FCHA 2CZ2A 2WJUA 2TRCP 5A1NB 5F8BA 1Z7RA 5ECPB 2HQTA 3CTGA 4X1UA 5DCGA 5H5RA 5D8IA 3IAS2 3RHBA 4JR6A 2H1BA 2A2RA 2CAQA 1YKAA 2XPDA 3KZQA 3LORA 3H79A 3ZMKA 2I81A 4HU7A 2WW0A 1R5PA 2GLRA 5LNKe 5A4UA 4XS6A 3ZVJD 3VPQA 4W66A 4GLTA 1TJDA 1I5GA 3C7MA 1K3OA 2VL9A 3HVSA 1YDKA 3TOTA 5F06A 4JE1A 1BJXA 2R3XA 5ECOB 4AI6A 1M7TA 2M46A 3HZ4A 2PVOC 1SL0B 5KEJA 3TOUA 1GUMA 4HZ2A 4K7OA 4LLRA 2H75A 1EEJA 2YWNA 4ECCA 4F0BA 2RUFA 1PSQA 2LUSA 3ERWA 1B9YC 3HJMA 2RM6A 1TXXA 1SL2B 1QMVA 1N25A 3HKRA 4L8EA 3EYTA 2H01A 4NPBA 5E59A 5D93A 1NHYA 3QAWA 3QD9A 2QGVA 1GTBA 1CQHA 4K0GA 4MJBA 4PUFC 1TK0B 4ID0A 4BL7A 4XS1A 4DSSB 4OFMA 3HYPA 2AV4A 4F82A 2P5RA 2C0EA 1HNAA 2FA4A 5FHIA 3IR4A 2QA2A 1TRUA 3L9UA 1SJIA 1GSEA 4X0XA 2MBTA 2L6DA 5L71A 2X49A 4YAVA 3IXRA 4IJ3A 3D5JA 4MH2A 2QA1A 1SK2A 3HVXA 2JZRA 1G7EA 4N10A 2LEGA 2VL2C 3QOUA 3GYKA 1R4WA 2VM1A 2AYTA 3SWLA 4XHMA 1TKDB 2PERA 2I3YA 3FR6A 1YEPA 1X0RA 3R2QA 3Q18A 1PKWA 2R6KA 1E6BA 1JFUA 1U87A 1XCCA 4BVXB 2EFDA 3F0IA 2KHPA 2LQOA 1OE8A 1THXA 3PR8A 1YQ1A 4OCFA 5JCUA 1MD3A 1H75A 2LNTA 4KNDA 1GTIA 2NBSA 2DJ2A 3ZFLA 3KXOA 2WZ9A 3GNJA 3UJ1A 1TI3A 3DIEA 1GH2A 4QMKA 5J3RA 2VCQA 4FXYP 1QXHA 4OD7A 1TRSA 2KLXA 3BBYA 5AN1A 2XPEA 20GSA 1PQNA 3IC8A 3QCPA 1ZYQB 1OC8A 3WT1A 6GSVA 4I5QA 4MH3A 4DVCA 3JCML 3FZAA 2IL3A 3RHCA 1SK0A 3FRCA 3UEMA 1F9MA 4I2UA 4CW9A 2H0IA 3MSZA 2B3SA 3LFLA 1SKRB 1PKZA 5HFKA 1RQMA 2EFHA 1A8YA 4TKYA 4G01A 3KM6A 4TR4A 2VCWA 1HD2A 1GUHA 4KH7A 4AGSA 3KIJA 2AUVA 2R2JA 2VD0A 2EIQA 4GQCA 1M2DA 4PX1A 1OKTA 7GSSA 3IRAA 2JADA 3W8SA 4IKHA 3ISOA 2VUPA 3DGQA 2JZTA 1TW9A 4E8EA 1EP7A 4MJCA 4I8BA 3HVNA 2IWTA 2BTOT 2WULA 2WS2A 3ERFA 4GDFA 2VOCA 5B8BA 2V32A 4MF6A 5ECIB 5CP1A 4O92A 1AAZA 6GSSA 1X9MB 3VWXA 3MNGA 1QK8A 2WVYA 2X8GA 5F07A 1SU9A 1O85A 1NHOA 1X9WB 18GSA 2HFDA 2HI7A 2CQ9A 1PMTA 1JZRA 3ZMLA 1HNCA 5G30A 4PNGA 2CV4A 4PI0C 4I6XA 3ZVJA 2H1DA 1WIKA 3UARA 1PX6A 2IMDA 5AIXA 1S3DA 2HNLA 3IAM2 5JWOB 2YWOA 4FQUA 1F3AA 2WVXA 4WF4A 2PVQA 1WWJA 4ZB9A 4GRFA 3IV4A 4AKXB 1GSUA 1YJ6A 2D2ZA 4K8MA 1K0CA 3GA4A 1YZXA 2M72A 4PHZC 3VI5A 3P7XA 4IGJA 4FYBA 3VFIA 2VCZA 5A5KA 5GAND 3CYNA 1EP8A 3W6GA 1VF3A 3QAVA 1M2AA 2OACA 2OJLA 5ELAA 1AUCA 5KN3A 2VD1A 1FOHA 3KH7A 1EGOA 4KDUA 4ZXGA 4ZB6A 1A23A 5B7CA 3LYKA 3M3MA 2B5XA 2K8SA 3FR9A 5KOWA 5J4YA 3G7JA 1XWCA 1ZYPA 3L9SA 1C72A 3DVXA 4KW6A 5LD0A 4POLA 4MNNA 2UV8G 4N11A 2GSSA 4KGIA 1TK8B 4RI7A 4ML6A 2OADA 4DSRA 3ZRDA 4KDYA 2OKAA 1GSDA 3F8UA 5KN1A 3GX0A 2LS5A 4G19A 4O5UA 4F0CA 5CRWA 1DBYA 1EOHA 1SD8A 3RPPA 2HRKA 3Q6OA 2C8UA 1MTCA 3APSA 3HVVA 1T1VA 4WR4A 5IMZA 4ZL7A 2LQQA 6GSUA 4XCSA 3FZ9A 4WBJA 5DDLA 1ML6A 3ZREA 5G1LA 3ZZXA 2MYGA 3AY8A 3UIWA 4LA1A 3KP9A 2FGXA 2V41A 2H73A 3R3EA 2B6MA 6GSYA 2H0HA 2FWHA 3GTUA 5G2ZA 5IOWA 3F9UA 1Y6EA 1FB0A 4GSSA 2GZYA 2YNXA 5IMFA 3H4KA 1KTEA 3GH9A 3A2WA 6GSWA 1AW9A 3P8WA 3UAPA 5CNWA 3FZ5A 1B48A 1BYEA 3K8NA 3IHQA 3UVHA 4BWQA 2UZ8A 3HA9A 3QAGA 1F6MC 1QQ2A 2FUG2 2O3EA 9GSSA 1Z3EA 1YF1A 4WR5A 1FW1A 1Z9HA 5DCHA 4K6XA 1FVKA 2LJAA 1T7PB 4MP4A 1YEXA 2DMMA 3IK9A 4TOPA 2LJKA 1ERUA 1U6TA 2YZHA 3FYGA 3ZYWA 3DWVA 1T3BA 3J7Yk 1RW1A 2C0FA 5EVOA 3FHKA 3SBCA 1WPIA 1I1IP 3WYWA 4LL1B 4MDCA 2XBIA 1BF5A 4JRRA 2E7PA 5HQPA 4XS4A 3TUEA 4YAPA 3BJ5A 1Z6MA 4CDOA 1B8XA 2YZUA 2DJ1A 3P2AA 3KP8A 1SJZA 1AQWA 5GZZB 3IBHA 5D9XA 3HCZA 2H6ZA 2L57A 1G6WA 4EUYA 4IP1A 2JL4A 2C1YA 4ZIJA 4NWYA 4V1Ag 4JR4A 2LRTA 2RLIA 1AQXA 1OAZA 2H76A 2YJ7A 1EV9A 5IMCA 4HQZA 5E4WA 1LU4A 4Z2RA 4XRAA 2CAIA 1Q98A 4TR3A 1ST9A 5A5HA 2KOKA 4HDEA 3L78A 3LYPA 4ILFA 3WD6A 1O81A 3V1WA 1GSQA 4ACSA 4XTSA 4G9HA 5DVBA 3MIXA 5HFIA 5C00A 4IBPA 2PMTA 1FO5A 1PN0A 4GCIA 1HQOA 1F37A 3EMPA 2WVXB 1ACVA 1ERTA 1OE7A 2OE0A 1M9BA 1QGVA 1YF0A 4PQIA 2E2MA 3Q74A 3EC3A 3CSIA 1ERWA 2FNOA 4GF0A 3IC4A 1W89A 4N0ZA 5J5NA 3CXGA 1IYHA 1X5EA 2QKEA 4D73A 5AIVA 4V2MA 4OFTA 1XXUA 1FB6A 2DC5A 2ZNMA 3F6FA 1TOFA 4PQ1A 3LGCA 1GLQA 2DJJA 3TKPA 2VLVA 2TRXA 5IOXA 1XVQA 4K2DA 1PRXA 2IJYA 3ED3A 1ZCPA 5ECKB 2GZPA 5J47A 1Z5YE 1QFNA 3US3A 1YVLA 3WGXA 4MLYA 4ZBAA 2PWJA 4MK3A 4MF5A 5IMAA 3IDVA 4HI7A 5EL8A 1WE0A 4ECIA 2FWEA 2HYXA 2CA8A 1EZKA 4X4JA 1GSSA 4PXOA 2YV7A 4FO5A 1F2EA 3U6VA 1NW2A 2H19A 1TP9A 1JLWA 1Q4JA 2HSHA 2HRKB 3CTFA 3C1RA 3IPZA 4USSA 1USBA 4KAEA 2G2QA 5G31A 3GUSA 4GSNA 2H72A 3DYRA 1BEDA 10GSA 4ECJA 2A4HA 4KB3A 4P3YB 1A0FA 2FY6A 3QFBC 3ME7A 16GSA 4FH8A 2R0CA 2WRTA 2DIYA 3W8JA 4BIKA 2B7KA 2RIIA 4GTUA 8GSSA 5IMDA 1B4PA 3GN3A 2MMOA 2J23A 3TU3B 3C73A 3GTUB 2DJ3A 2WW1A 1XWBA 4MZBA 4ZL8A 4ML1A 2K9FA 2ALBA 4Q5RA 2NVLA 4G0KA 1M9AA 5JCWA 3LXTA 1V57A 4K7IA 3BOAA 2EFEA 3KH9A 1XFLA 5DALA 4EIPA 4MCUA 5HFGA 3GKKA 4DSQA 2JZSA 3IK7A 2L5LA 3I9V2 1JLVA 4YQVA 2CT6A 4G0IA 1XWAA 4YH2A 3PH9A 3O3TA 2VAFA 1UN2A 3M0FA 2P31A 3M1GA 3TKQA 1SK1A 4WEYA 4HJ2A 1G0TA 4HEA2 1I9DA 3O6TA 3RAZA 4JZQA 4EE0A 1ZYNA 4KSOA 4V1Ap 2IMIA 1S3AA 1BQ7A 4LMWA 3CBUA 1K0MA 2H1AA 3NOFA 2HSNA 5J41A 2C4JA 3O76A 4V2LA 22GSA 4K1FA 3QMXA 4E68A 5A4WA 1MDKA 2R37A 1DUGA 3FW2A 3VLNA 4PTSA 3F4TA 2I4AA 5IM9A 5J4UA 3TB2A 4O7HA 3F3RA 4OO5A 2BMXA 3BCKA 3VI7A 5BMUA 1EV4A 4CY8A 3GKNA 3TJJA 1LBKA 4HSCX 1FVJA 3ZL5A 1YY7A 2LTKA 5B6MA 1SVOA 2CZ3A 2AAWA 2L4CA 5J9BA 1CQGA 3QR6A 4Q5QA 2H30A 5ECMB 4EC0A 2QSIA 4IJIA 4EXJA 2YPMA 5J9CA 1OC9A 1PN9A 2LNSA 4MF7A 2N5BA 1A2JA 4JU5A 4OWYA 4KCAA 4IP6A 3RGBC 1V58A 1A8LA 2H0GA 4J57E 3EPTA 5JWQB 5IPGA 3A3TA 2WZSA 1OVNA 3QPMA 2L4QA 4D73B 2Z9SA 1B9XC 2K8VA 4AJ6A 1FG4A 3F4SA 1K0NA 1GSYA 4GXZA 1EWXA 2RUEA 4IW9A 5DAKA 2VKZG 1KNGA 4RQXA 4V2NA 5J4VA 2GSRA 4LMVA 5CAXA 2NTOA 1B4QA 1A0RP 2ZCTA 4MJAA 4IS0A 3ZIJA 5D96A 2CVDA 3LEFA 3LQ7A 2PPTA 4KA0A 1GNWA 5B8AA 3FK8A 3GL3A 3D22A 4ZL9A 2PBJA 4A5PA 2AHEA 4BL7B 1GNEA 1H4OA 5KOXA 4N0VA 2YP6A 3PGTA 4ZB7A 3I69A 4IQAA 4HZ4A 1WMJA 1EGRA 2HLSA 1X5CA 5EPFA 4NAXA 3UL3A 1KBNA 3GSSA 5CRGA 1U88A 2LJRA 4PNFA 2YWIA 2I9HA 3D4MA 4G2EA 3ZIVA 3KMOA 2J9HA 5A34A 4O5RA 2OT3A 2XBQA 2L5OA 1XVWA 1K0BA 4OFNA 3FR3A 3A5WA 3CRUA 1SKSB 2EIRA 2FHEA 1XOBA 2WGRA 3VK9A 2GQLA 3IHGA 1PX7A 1T8EB 5C04A 3OR5A 3D6IA 4GWRA 1V9WA 3TJBA 3I6AA 2HE3A 2HRAA 5ECQB 4IELA 2O87A 3GX8A 5GSTA 4E8HA 4X43A 3GRXA 1GL8A 4ECBA 3C71A 1VF4A 3WGDA 1HNBA 4DSSA 2GSTA 2WW2A 3EU4A 1XZOA 4K2XA 1QUWA 2VCXA 1F3BA 3CSJA 5AGYA 3IOSA 2YANA 5GSSA 3DVWA 2H66A 3EU3A 2DLXA 5IMVA 2FWFA 1NM3A 2DBCA 2IN3A 5IPHA 1UA5A 4F2IA 5ECNB 5H5SA 4HOJA 2HSYA 1SYXA 2HRFA 5F0GA 1FAAA 1UC7A 3TJGA 1O8XA 5ECSA 1V40A 2GT5A 5DQYA 1TRWA 4MABA 2XC2A 3ZITA 1GWCA 3M8NA 1VGLA 6GSTA 3TKSA 2HSNB 5JCGA 4JBBA 4FYUA 1OYJA 3QFAC 4N30A 2PN8A 1V2AA 3BCIA 1GUKA 2DKHA 3EVIA 2ON5A 2YJHA 2V1MA 1M0UA 1ZGNA 1O73A 2CVBA 2H8LA 2R0PA 3EMXA 4EF0A 5CYYA 3M9JA 1XPVA 4GSTA 1R5AA 3EURA 2HT9A 4YKFA 2WVZA 5D9TA 2C3TA 3RDWA 2P5QA 3G7IA 3QDNA 4EKZA 4AF2A 3DXBA 4L0WA 1X5DA 1M2BA 3FY7A 1ZZYA 3D4TA 1SL1B 1ZOFA 1WRYA 2H6XA 3HD5A 4IQ1A 2WB9A 4BPYA 2FLSA 2F51A 4PUAA 4ZBDA 3GKXA 1PL1A 1SVLA 1YKCA 5KN0A 1OC9B 1W4VA 2CVKA 3A2VA 2VO4A 3KD0A 1A2MA 2B1KA 3M9KA 1NSWA 2E0QA 3APQA 1Y1UA 2VL3A 2H70A 4LL4B 1GP1A 2H1GA 3E3EA 2RM5A 1OC3A 3F3QA 4QQ7A 1E2YA 3GH6A 1TK5B 1ERVA 1ZMAA 1BG5A 5INYA 4TW5A 2LRNA 4KE3A 3U5RE 4CY6A 1XG8A 3A5IA 1BAYA 4CHSA 3VPTA 2C0DA 3NZNA 5DAKB 1PD21 1J08A 2IMFA 2X4AA 2C3NA 1M99A 1T4ZA 2O85A 4Z7XA 4NHWA 4XRDA 2WFCA 4KUNA 3PPUA 4TXOA 4DEJA 1M3IA 2NPBA 4ULXA 2YN1A 3KMNA 4HJMA 5HR0A 3UOMA 2MMAA 1TXUA 1OKDA 12GSA 4RI6A 3FMWA 2VL2A 3GKMA 1SYRA 1JHBA 2IMEA 3LJRA 1FHEA 3N5OA 3G7YA 5CREA 2ON7A 3H8QA 4PURA 1XWGA 1ZL9A 3KCMA 4Q5FA 4MPGA 1XW5A 2E2GA 5A34B 3GFKA 5DBQA 5HR2A 4O32A 2O36A 3CHXC 1SENA 2CX3A 2TIRA 4I2TA 2N5AA 2AB6A 1TU8A 2HSMA 3KTBA 2MBSA 4JEDA 2LSTA 2H71A 2MZCA 2EC4A 19GSA 4MMMA 3I43A 2DIZA 2GQMA 1GLPA 2G0FA 2O89A 5CRDA 1Z7PA 2R4VA 4KF9A 4J2FA 4I97A 3HMJG 4TVEA 3D0ZA 3TRQA 2P0GA 3PINA 2REMA 1GTUA 4G10A 3TJKA 3HHVA 4PI2C 2V6OA 4NV5A 1RK4A 4NHZA 1U3AA 2MMNA 3VWUA 5GAPD 3GSTA 4YQMA 5IIZA 3ZLPA 2PU9C 4K5RA 3UVTA 2F8FA 3VWWA 3G9BA 1JZOA 1O6JA 4WKWA 1WP0A 4WETA 1GSFA 3F63A 1PA3A 5G5EA 2VM2A 4H86A 4K5SA 2DJKA 1PFOA 3F4RA 1TDIA 4YQUA 4TRXA 1WJKA 3DMLA 5ID2A 2DMLA 3H1NA 1SKWB 4NMUA 4HUAA 5IO0A 3DEXA 1O7UA 4WF5A 1MEKA 2WW3A 4TR1A 5CO3A 4BWSA 4GQFA 2R5GA 2B5EA 2X64A 1XW6A 4HS1A 4HQSA 1N2AA 4O5QA 3E0UA 4KX4A 2X99A 4EL1A 4XS4B 5H5QA 3RFRC 2I1UA 14GSA 4FIWA 2X8CA 2HZEA 2N5FA 2OE1A 4WBRD 3CQFA 2EFCA 3GIXA 5ENUA 1VRSD 3LG6A 5D9VA 3FEUA 2ES7A 4MZWA 3S9FA 3TCOA 1XWKA 1IYIA 2IIYA 4F9ZA 5ECLB 4HU9A 3TKRA 4KCEA 4Z2UA 1O8WA 2R0GA 2JSZA 2YV9A 1MD4A 1HYUA 3L9VA 5HR1A 5A5HB 1R26A 4EIQA 5ECRB 2DJ0A 2O7KA 5COHA 4IHUA 2F8AA 1S3CA 4K0NA 4L5LA 3HDCA 1K3LA 3D21A 2IPAA 3LWAA 1AXDA 1ON4A 4K7NA 3WT2A 4RQRA 5B6NA 2IFQA 5ELGA 1T4YA 3N9JA 3VWVA 4KDXA 2VLUA 3BD2A 1K3YA 3ME8A 5CRHA 2GT6A 1R7HA 3CWGA 17GSA 1VF2A 4AKHA 2M80A 2A4VA 2LV3A 4ISDA 3MDKA 2F3MA 2VIMA 1A2LA 4PQHA 4BVYA 13GSA 2K6VA 3TRPA 1M3JA 4TXOB 3TRXA 3HZ8A 2JACA 2XHFA 2AJQB 4KSMA 3VURA 1G6YA 4ZB8A 3HJOA 4RUVA 2VCVA 2C3QA 2VCTA 1AC1A 1LJRA 3C1SA 2GQKA 2DSAA 1GRXA 4PGTA 3Q19A 2DKIA 1PL2A 6GSXA 1TTZA 1V98A 4ICYA 2X8HA 2JU5A 5A1NA 3RPNA 1KEBA 2B1LA 3DD3A
chains in the Genus database with same CATH topology
1Z6NA 4N3ZA 2QC7A 1SD9A 4AJ7A 11GSA 2GTUA 3DKSA 2KP1A 2OBKA 2EIOA 4IN0A 4TN8A 1FOVA 2HSMB 3CMIA 4NV2A 2B7JA 1N8JA 5DJLA 5IO2A 3C8EA 4ZBBA 2OE3A 1Y25A 3MYDA 5EY6A 3CSHA 3F6DA 1MDJA 5JWRB 1EEMA 4WXTA 3UBLA 3KGKA 2KP2A 5ECHB 2GSQA 5FWGA 3LW9A 4J56E 3L0HA 2GDRA 5AISA 4POKA 1ZYEA 2YOIA 1K0OA 1X9SB 4MA9A 4POBA 4L5OA 1SJ6A 1A24A 1SVMA 4EVMA 2B5YA 4OO4A 5DALB 3TJFA 2GZZA 5LCZA 3LXZA 4OMVA 4XIHA 2WDUA 1DSBA 2YWMA 4AJ8A 5ID2B 3LSZA 1J9BA 2HZFA 4POMA 5FT3A 3CRTA 1U3IA 2MMZA 5IQYA 2FWGA 1J0FA 4TR1B 3FKFA 4F03A 4OCEA 1DE1A 1GTAA 2BJXA 1T00A 3L4NA 2C0GA 5G5FA 2L6CA 3RBTA 1BX9A 2VLTA 1UVZA 3GL5A 4G0LA 4YKGA 1G7OA 3H93A 1XIYA 2LRCA 5DQSA 3EWLA 2PGTA 2GS3A 3TDGA 3IA1A 1PGTA 3P90A 2L59A 4MZCA 1URMA 2HZEB 5KN2A 2JSYA 3NIVA 1EOGA 1TU7A 1JZDA 1AQVA 4TXVA 4EO3A 3KTLA 2V2GA 2H6YA 2H74A 4TR0A 1AIUA 1XW9A 2GVPA 4K9ZA 1DE2A 3GURA 2HXKA 4FYCA 1TRVA 5HR3A 2A2PA 2H1LA 1TI1A 4EDYA 1JZWA 4ZILA 4IVFA 3KJYA 4BVXA 5BMUB 4QL7A 1XOAA 1BG1A 3EE2A 1ILOA 4NXIA 4Q5NA 2GGTA 3APOA 3MAKA 2PUKC 3GV1A 3HY2A 2F9SA 5BRTA 1K0DA 5ABRA 2HRNA 5DJMA 2YCDA 3UMAA 2OA7A 5J40A 2K18A 2WCIA 3HXSA 2IFQB 2A2SA 3GHAA 2LKUA 3TGZA 2FA8A 3ZFBA 1K0AA 2V6KA 4MJEA 4BA7A 2O8VB 3ZTLA 1VF1A 1GULA 3A2XA 2O5VA 2IMKA 2NDOA 3EINA 2OBIA 4L0UA 2ZUPA 3UBKA 3HJPA 3ERGA 2C80A 1XBSA 3GMFA 4AKIA 4BVYB 4QL9A 5D9WA 3FZ4A 3MWHA 4MPFA 3DRNA 3E9JB 5D73A 1THOA 3TKSE 5A4VA 4AKGA 1ABAA 5F05A 2FD3A 1MDIA 2CX4A 1WOUA 3KEBA 3TKSC 5G1KA 3IE3A 3WGEA 3J7Yb 4Z2TA 4EDZA 2KUCA 2FCHA 2CZ2A 2WJUA 2TRCP 5A1NB 5F8BA 1Z7RA 5ECPB 2HQTA 3CTGA 4X1UA 5DCGA 5H5RA 5D8IA 3IAS2 3RHBA 4JR6A 2H1BA 2A2RA 2CAQA 1YKAA 2XPDA 3KZQA 3LORA 3H79A 3ZMKA 2I81A 4HU7A 1R5PA 2GLRA 5LNKe 5A4UA 4XS6A 3ZVJD 3VPQA 4W66A 4GLTA 1TJDA 1I5GA 3C7MA 1K3OA 2VL9A 3HVSA 1YDKA 3TOTA 5F06A 4JE1A 1BJXA 2R3XA 5ECOB 4AI6A 1M7TA 2M46A 3HZ4A 2PVOC 1SL0B 5KEJA 3TOUA 1GUMA 4HZ2A 4K7OA 4LLRA 2H75A 1EEJA 2YWNA 4ECCA 4F0BA 2RUFA 1PSQA 2LUSA 3ERWA 1B9YC 3HJMA 2RM6A 1TXXA 1SL2B 1QMVA 1N25A 3HKRA 4L8EA 3EYTA 2H01A 4NPBA 5E59A 5D93A 1NHYA 3QAWA 3QD9A 2QGVA 1GTBA 1CQHA 4K0GA 4MJBA 4PUFC 1TK0B 4ID0A 4BL7A 4XS1A 4DSSB 4OFMA 3HYPA 2AV4A 4F82A 2P5RA 2C0EA 1HNAA 2FA4A 5FHIA 3IR4A 2QA2A 1TRUA 3L9UA 1SJIA 1GSEA 4X0XA 2MBTA 2L6DA 5L71A 2X49A 4YAVA 3IXRA 4IJ3A 3D5JA 4MH2A 2QA1A 1SK2A 3HVXA 2JZRA 1G7EA 4N10A 2LEGA 2VL2C 3QOUA 3GYKA 1R4WA 2VM1A 2AYTA 3SWLA 4XHMA 1TKDB 2PERA 2I3YA 3FR6A 1YEPA 1X0RA 3R2QA 3Q18A 1PKWA 2R6KA 1E6BA 1JFUA 1U87A 1XCCA 4BVXB 2EFDA 3F0IA 2KHPA 2LQOA 1OE8A 1THXA 3PR8A 1YQ1A 4OCFA 5JCUA 1MD3A 1H75A 2LNTA 4KNDA 1GTIA 2NBSA 2DJ2A 3ZFLA 3KXOA 2WZ9A 3GNJA 3UJ1A 1TI3A 3DIEA 1GH2A 4QMKA 5J3RA 2VCQA 1QXHA 4OD7A 1TRSA 2KLXA 3BBYA 5AN1A 2XPEA 20GSA 1PQNA 3IC8A 3QCPA 1ZYQB 1OC8A 3WT1A 6GSVA 4I5QA 4MH3A 4DVCA 3JCML 3FZAA 2IL3A 3RHCA 1SK0A 3FRCA 3UEMA 1F9MA 4I2UA 4CW9A 2H0IA 3MSZA 2B3SA 3LFLA 1SKRB 1PKZA 5HFKA 1RQMA 2EFHA 1A8YA 4TKYA 4G01A 3KM6A 4TR4A 2VCWA 1HD2A 1GUHA 4KH7A 4AGSA 3KIJA 2AUVA 2R2JA 2VD0A 2EIQA 4GQCA 1M2DA 4PX1A 1OKTA 7GSSA 3IRAA 2JADA 3W8SA 4IKHA 3ISOA 2VUPA 3DGQA 2JZTA 1TW9A 4E8EA 1EP7A 4MJCA 4I8BA 2IWTA 2BTOT 2WULA 2WS2A 3ERFA 4GDFA 2VOCA 5B8BA 2V32A 4MF6A 5ECIB 5CP1A 4O92A 1AAZA 6GSSA 1X9MB 3VWXA 3MNGA 1QK8A 2X8GA 5F07A 1SU9A 1O85A 1NHOA 1X9WB 18GSA 2HFDA 2HI7A 2CQ9A 1PMTA 1JZRA 3ZMLA 1HNCA 5G30A 4PNGA 2CV4A 4I6XA 3ZVJA 2H1DA 1WIKA 3UARA 1PX6A 2IMDA 5AIXA 1S3DA 2HNLA 3IAM2 5JWOB 2YWOA 4FQUA 1F3AA 4WF4A 2PVQA 1WWJA 4ZB9A 4GRFA 3IV4A 4AKXB 1GSUA 1YJ6A 2D2ZA 4K8MA 1K0CA 3GA4A 1YZXA 2M72A 3VI5A 3P7XA 4IGJA 4FYBA 3VFIA 2VCZA 5A5KA 5GAND 3CYNA 1EP8A 3W6GA 1VF3A 3QAVA 1M2AA 2OACA 2OJLA 5ELAA 1AUCA 5KN3A 2VD1A 1FOHA 3KH7A 1EGOA 4KDUA 4ZXGA 4ZB6A 1A23A 5B7CA 3LYKA 3M3MA 2B5XA 2K8SA 3FR9A 5KOWA 5J4YA 3G7JA 1XWCA 1ZYPA 3L9SA 1C72A 3DVXA 4KW6A 5LD0A 4POLA 4MNNA 2UV8G 4N11A 2GSSA 4KGIA 1TK8B 4RI7A 4ML6A 2OADA 4DSRA 3ZRDA 4KDYA 2OKAA 1GSDA 3F8UA 5KN1A 3GX0A 2LS5A 4G19A 4O5UA 4F0CA 5CRWA 1DBYA 1EOHA 1SD8A 3RPPA 2HRKA 3Q6OA 2C8UA 1MTCA 3APSA 3HVVA 1T1VA 4WR4A 5IMZA 4ZL7A 2LQQA 6GSUA 4XCSA 3FZ9A 4WBJA 5DDLA 1ML6A 3ZREA 5G1LA 3ZZXA 2MYGA 3AY8A 3UIWA 4LA1A 3KP9A 2FGXA 2V41A 2H73A 3R3EA 2B6MA 6GSYA 2H0HA 2FWHA 3GTUA 5G2ZA 5IOWA 3F9UA 1Y6EA 1FB0A 4GSSA 2GZYA 2YNXA 5IMFA 3H4KA 1KTEA 3GH9A 3A2WA 6GSWA 1AW9A 3P8WA 3UAPA 5CNWA 3FZ5A 1B48A 1BYEA 3K8NA 3IHQA 3UVHA 4BWQA 2UZ8A 3HA9A 3QAGA 1F6MC 1QQ2A 2FUG2 9GSSA 1Z3EA 1YF1A 4WR5A 1FW1A 1Z9HA 5DCHA 4K6XA 1FVKA 2LJAA 1T7PB 4MP4A 1YEXA 2DMMA 3IK9A 4TOPA 2LJKA 1ERUA 1U6TA 2YZHA 3FYGA 3ZYWA 3DWVA 1T3BA 3J7Yk 1RW1A 2C0FA 5EVOA 3FHKA 3SBCA 1WPIA 3WYWA 4LL1B 4MDCA 2XBIA 1BF5A 4JRRA 2E7PA 5HQPA 4XS4A 3TUEA 4YAPA 3BJ5A 1Z6MA 4CDOA 1B8XA 2YZUA 2DJ1A 3P2AA 3KP8A 1SJZA 1AQWA 5GZZB 3IBHA 5D9XA 3HCZA 2H6ZA 2L57A 1G6WA 4EUYA 4IP1A 2JL4A 2C1YA 4ZIJA 4NWYA 4V1Ag 4JR4A 2LRTA 2RLIA 1AQXA 1OAZA 2H76A 2YJ7A 1EV9A 5IMCA 4HQZA 5E4WA 1LU4A 4Z2RA 4XRAA 2CAIA 1Q98A 4TR3A 1ST9A 5A5HA 2KOKA 4HDEA 3L78A 3LYPA 4ILFA 3WD6A 1O81A 3V1WA 1GSQA 4ACSA 4XTSA 4G9HA 5DVBA 3MIXA 5HFIA 5C00A 4IBPA 2PMTA 1FO5A 1PN0A 4GCIA 1HQOA 1F37A 3EMPA 1ACVA 1ERTA 1OE7A 2OE0A 1M9BA 1QGVA 1YF0A 4PQIA 2E2MA 3Q74A 3EC3A 3CSIA 1ERWA 2FNOA 4GF0A 3IC4A 1W89A 4N0ZA 5J5NA 3CXGA 1IYHA 1X5EA 2QKEA 4D73A 5AIVA 4V2MA 4OFTA 1XXUA 1FB6A 2DC5A 2ZNMA 3F6FA 1TOFA 4PQ1A 3LGCA 1GLQA 2DJJA 3TKPA 2VLVA 2TRXA 5IOXA 1XVQA 4K2DA 1PRXA 2IJYA 3ED3A 1ZCPA 5ECKB 2GZPA 5J47A 1Z5YE 1QFNA 3US3A 1YVLA 3WGXA 4MLYA 4ZBAA 2PWJA 4MK3A 4MF5A 5IMAA 3IDVA 4HI7A 5EL8A 1WE0A 4ECIA 2FWEA 2HYXA 2CA8A 1EZKA 4X4JA 1GSSA 4PXOA 2YV7A 4FO5A 1F2EA 3U6VA 1NW2A 2H19A 1TP9A 1JLWA 1Q4JA 2HSHA 2HRKB 3CTFA 3C1RA 3IPZA 4USSA 1USBA 4KAEA 2G2QA 5G31A 3GUSA 4GSNA 2H72A 3DYRA 1BEDA 10GSA 4ECJA 2A4HA 4KB3A 4P3YB 1A0FA 2FY6A 3QFBC 3ME7A 16GSA 4FH8A 2R0CA 2WRTA 2DIYA 3W8JA 2B7KA 2RIIA 4GTUA 8GSSA 5IMDA 1B4PA 3GN3A 2MMOA 2J23A 3TU3B 3C73A 3GTUB 2DJ3A 1XWBA 4MZBA 4ZL8A 4ML1A 2K9FA 2ALBA 4Q5RA 2NVLA 4G0KA 1M9AA 5JCWA 3LXTA 1V57A 4K7IA 3BOAA 2EFEA 3KH9A 1XFLA 5DALA 4EIPA 4MCUA 5HFGA 3GKKA 4DSQA 2JZSA 3IK7A 2L5LA 3I9V2 1JLVA 4YQVA 2CT6A 4G0IA 1XWAA 4YH2A 3PH9A 3O3TA 2VAFA 1UN2A 3M0FA 2P31A 3M1GA 3TKQA 1SK1A 4WEYA 4HJ2A 1G0TA 4HEA2 1I9DA 3O6TA 3RAZA 4JZQA 4EE0A 1ZYNA 4KSOA 4V1Ap 2IMIA 1S3AA 1BQ7A 4LMWA 3CBUA 1K0MA 2H1AA 3NOFA 2HSNA 5J41A 2C4JA 3O76A 4V2LA 22GSA 4K1FA 3QMXA 4E68A 5A4WA 1MDKA 2R37A 1DUGA 3FW2A 3VLNA 4PTSA 3F4TA 2I4AA 5IM9A 5J4UA 3TB2A 4O7HA 3F3RA 4OO5A 2BMXA 3BCKA 3VI7A 5BMUA 1EV4A 4CY8A 3GKNA 3TJJA 1LBKA 1FVJA 3ZL5A 1YY7A 2LTKA 5B6MA 1SVOA 2CZ3A 2AAWA 2L4CA 5J9BA 1CQGA 3QR6A 4Q5QA 2H30A 5ECMB 4EC0A 2QSIA 4IJIA 4EXJA 2YPMA 5J9CA 1OC9A 1PN9A 2LNSA 4MF7A 2N5BA 1A2JA 4JU5A 4OWYA 4KCAA 4IP6A 1V58A 1A8LA 2H0GA 4J57E 3EPTA 5JWQB 5IPGA 3A3TA 1OVNA 3QPMA 2L4QA 4D73B 2Z9SA 1B9XC 2K8VA 4AJ6A 1FG4A 3F4SA 1K0NA 1GSYA 4GXZA 1EWXA 2RUEA 4IW9A 5DAKA 2VKZG 1KNGA 4RQXA 4V2NA 5J4VA 2GSRA 4LMVA 5CAXA 2NTOA 1B4QA 1A0RP 2ZCTA 4MJAA 4IS0A 3ZIJA 5D96A 2CVDA 3LEFA 3LQ7A 2PPTA 4KA0A 1GNWA 5B8AA 3FK8A 3GL3A 3D22A 4ZL9A 2PBJA 4A5PA 2AHEA 4BL7B 1GNEA 1H4OA 5KOXA 4N0VA 2YP6A 3PGTA 4ZB7A 3I69A 4IQAA 4HZ4A 1WMJA 1EGRA 2HLSA 1X5CA 5EPFA 4NAXA 3UL3A 1KBNA 3GSSA 5CRGA 1U88A 2LJRA 4PNFA 2YWIA 2I9HA 3D4MA 4G2EA 3ZIVA 3KMOA 2J9HA 5A34A 4O5RA 2OT3A 2XBQA 2L5OA 1XVWA 1K0BA 4OFNA 3FR3A 3A5WA 3CRUA 1SKSB 2EIRA 2FHEA 1XOBA 2WGRA 3VK9A 2GQLA 3IHGA 1PX7A 1T8EB 5C04A 3OR5A 3D6IA 4GWRA 1V9WA 3TJBA 3I6AA 2HE3A 2HRAA 5ECQB 4IELA 2O87A 3GX8A 5GSTA 4E8HA 4X43A 3GRXA 1GL8A 4ECBA 3C71A 1VF4A 3WGDA 1HNBA 4DSSA 2GSTA 4K2XA 3EU4A 1XZOA 1QUWA 2VCXA 1F3BA 3CSJA 5AGYA 3IOSA 2YANA 5GSSA 3DVWA 2H66A 3EU3A 2DLXA 5IMVA 2FWFA 1NM3A 2DBCA 2IN3A 5IPHA 1UA5A 4F2IA 5ECNB 5H5SA 4HOJA 2HSYA 1SYXA 2HRFA 5F0GA 1FAAA 1UC7A 3TJGA 1O8XA 5ECSA 1V40A 2GT5A 5DQYA 1TRWA 4MABA 2XC2A 3ZITA 1GWCA 3M8NA 1VGLA 6GSTA 3TKSA 2HSNB 5JCGA 4JBBA 4FYUA 1OYJA 3QFAC 4N30A 2PN8A 1V2AA 3BCIA 1GUKA 2DKHA 3EVIA 2ON5A 2YJHA 2V1MA 1M0UA 1ZGNA 1O73A 2CVBA 2H8LA 2R0PA 3EMXA 4EF0A 5CYYA 3M9JA 1XPVA 4GSTA 1R5AA 3EURA 2HT9A 4YKFA 5D9TA 2C3TA 3RDWA 2P5QA 3G7IA 3QDNA 4EKZA 4AF2A 3DXBA 4L0WA 1X5DA 1M2BA 3FY7A 1ZZYA 3D4TA 1SL1B 1ZOFA 1WRYA 2H6XA 3HD5A 4IQ1A 2WB9A 4BPYA 2FLSA 2F51A 4PUAA 4ZBDA 3GKXA 1PL1A 1SVLA 1YKCA 5KN0A 1OC9B 1W4VA 2CVKA 3A2VA 2VO4A 3KD0A 1A2MA 2B1KA 3M9KA 1NSWA 2E0QA 3APQA 1Y1UA 2VL3A 2H70A 4LL4B 1GP1A 2H1GA 3E3EA 2RM5A 1OC3A 3F3QA 4QQ7A 1E2YA 3GH6A 1TK5B 1ERVA 1ZMAA 1BG5A 5INYA 4TW5A 2LRNA 4KE3A 3U5RE 4CY6A 3A5IA 1BAYA 4CHSA 3VPTA 2C0DA 3NZNA 5DAKB 1PD21 1J08A 2IMFA 2X4AA 2C3NA 1M99A 1T4ZA 2O85A 4Z7XA 4NHWA 4XRDA 2WFCA 4KUNA 3PPUA 4TXOA 4DEJA 2NPBA 4ULXA 2YN1A 3KMNA 4HJMA 5HR0A 3UOMA 2MMAA 1TXUA 1OKDA 12GSA 4RI6A 3FMWA 2VL2A 3GKMA 1SYRA 1JHBA 2IMEA 3LJRA 1FHEA 3N5OA 3G7YA 5CREA 2ON7A 3H8QA 4PURA 1XWGA 1ZL9A 3KCMA 4Q5FA 4MPGA 1XW5A 2E2GA 5A34B 3GFKA 5DBQA 5HR2A 4O32A 1SENA 2CX3A 2TIRA 4I2TA 2N5AA 2AB6A 1TU8A 2HSMA 3KTBA 2MBSA 4JEDA 2LSTA 2H71A 2MZCA 2EC4A 19GSA 4MMMA 3I43A 2DIZA 2GQMA 1GLPA 2G0FA 2O89A 5CRDA 1Z7PA 2R4VA 4KF9A 4J2FA 4I97A 3HMJG 4TVEA 3D0ZA 3TRQA 2P0GA 3PINA 2REMA 1GTUA 4G10A 3TJKA 3HHVA 2V6OA 4NV5A 1RK4A 4NHZA 1U3AA 2MMNA 3VWUA 5GAPD 3GSTA 4YQMA 5IIZA 3ZLPA 2PU9C 4K5RA 3UVTA 2F8FA 3VWWA 3G9BA 1JZOA 1O6JA 4WKWA 1WP0A 4WETA 1GSFA 3F63A 1PA3A 5G5EA 2VM2A 4H86A 4K5SA 2DJKA 3F4RA 1TDIA 4YQUA 4TRXA 1WJKA 3DMLA 5ID2A 2DMLA 3H1NA 1SKWB 4NMUA 4HUAA 5IO0A 3DEXA 1O7UA 4WF5A 1MEKA 4TR1A 5CO3A 4BWSA 4GQFA 2R5GA 2B5EA 2X64A 1XW6A 4HS1A 4HQSA 1N2AA 4O5QA 3E0UA 4KX4A 2X99A 4EL1A 4XS4B 5H5QA 2I1UA 14GSA 4FIWA 2X8CA 2HZEA 2N5FA 2OE1A 4WBRD 2EFCA 3GIXA 5ENUA 1VRSD 3LG6A 5D9VA 3FEUA 2ES7A 4MZWA 3S9FA 3TCOA 1XWKA 1IYIA 2IIYA 4F9ZA 5ECLB 4HU9A 3TKRA 4KCEA 4Z2UA 1O8WA 2R0GA 2JSZA 2YV9A 1MD4A 1HYUA 3L9VA 5HR1A 5A5HB 1R26A 4EIQA 5ECRB 2DJ0A 2O7KA 5COHA 4IHUA 2F8AA 1S3CA 4K0NA 4L5LA 3HDCA 1K3LA 3D21A 2IPAA 3LWAA 1AXDA 1ON4A 4K7NA 3WT2A 4RQRA 5B6NA 2IFQA 5ELGA 1T4YA 3N9JA 3VWVA 4KDXA 2VLUA 3BD2A 1K3YA 3ME8A 5CRHA 2GT6A 1R7HA 3CWGA 17GSA 1VF2A 4AKHA 2M80A 2A4VA 2LV3A 4ISDA 3MDKA 2F3MA 2VIMA 1A2LA 4PQHA 4BVYA 13GSA 2K6VA 3TRPA 4TXOB 3TRXA 3HZ8A 2JACA 2XHFA 2AJQB 4KSMA 3VURA 1G6YA 4ZB8A 3HJOA 4RUVA 2VCVA 2C3QA 2VCTA 1AC1A 1LJRA 3C1SA 2GQKA 2DSAA 1GRXA 4PGTA 3Q19A 2DKIA 1PL2A 6GSXA 1TTZA 1V98A 4ICYA 2X8HA 2JU5A 5A1NA 3RPNA 1KEBA 2B1LA 3DD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6N A;  2QC7 A;  1SD9 A;  4AJ7 A;  11GS A;  2GTU A;  3DKS A;  2KP1 A;  2OBK A;  2EIO A;  4IN0 A;  4TN8 A;  1FOV A;  2HSM B;  3CMI A;  4NV2 A;  2B7J A;  1N8J A;  5DJL A;  5IO2 A;  3C8E A;  4ZBB A;  2OE3 A;  1Y25 A;  5EY6 A;  3CSH A;  3F6D A;  1MDJ A;  5JWR B;  1EEM A;  4WXT A;  3UBL A;  3KGK A;  2KP2 A;  5ECH B;  2GSQ A;  5FWG A;  4J56 E;  3L0H A;  2GDR A;  5AIS A;  4POK A;  1ZYE A;  2YOI A;  1K0O A;  1X9S B;  4MA9 A;  4POB A;  4L5O A;  1SJ6 A;  1A24 A;  4EVM A;  2B5Y A;  4OO4 A;  5DAL B;  3TJF A;  2GZZ A;  5LCZ A;  3LXZ A;  4OMV A;  4XIH A;  2WDU A;  1DSB A;  2YWM A;  4AJ8 A;  5ID2 B;  3LSZ A;  1J9B A;  2HZF A;  4POM A;  5FT3 A;  3CRT A;  1U3I A;  2MMZ A;  5IQY A;  2FWG A;  1J0F A;  4TR1 B;  3FKF A;  4F03 A;  4OCE A;  1DE1 A;  1GTA A;  2BJX A;  1T00 A;  3L4N A;  2C0G A;  5G5F A;  2L6C A;  3RBT A;  1BX9 A;  2VLT A;  1UVZ A;  3GL5 A;  4G0L A;  1G7O A;  3H93 A;  1XIY A;  2LRC A;  5DQS A;  3EWL A;  2PGT A;  2GS3 A;  3TDG A;  3IA1 A;  1PGT A;  3P90 A;  2L59 A;  4MZC A;  1URM A;  2HZE B;  5KN2 A;  2JSY A;  3NIV A;  1EOG A;  1TU7 A;  1JZD A;  1AQV A;  4TXV A;  4EO3 A;  3KTL A;  2V2G A;  2H6Y A;  2H74 A;  4TR0 A;  1AIU A;  1XW9 A;  2GVP A;  4K9Z A;  1DE2 A;  3GUR A;  2HXK A;  4FYC A;  1TRV A;  5HR3 A;  1TI1 A;  4EDY A;  1JZW A;  4ZIL A;  4IVF A;  3KJY A;  4BVX A;  4QL7 A;  1XOA A;  3EE2 A;  1ILO A;  4NXI A;  4Q5N A;  2GGT A;  3APO A;  3MAK A;  2PUK C;  3GV1 A;  3HY2 A;  2F9S A;  1K0D A;  5ABR A;  2HRN A;  5DJM A;  2YCD A;  3UMA A;  2OA7 A;  2K18 A;  2WCI A;  3HXS A;  2IFQ B;  2A2S A;  3GHA A;  2LKU A;  3TGZ A;  2FA8 A;  3ZFB A;  1K0A A;  2V6K A;  4MJE A;  4BA7 A;  2O8V B;  3ZTL A;  1VF1 A;  1GUL A;  3A2X A;  2IMK A;  2NDO A;  3EIN A;  2OBI A;  4L0U A;  2ZUP A;  3UBK A;  3HJP A;  3ERG A;  2C80 A;  1XBS A;  3GMF A;  4BVY B;  4QL9 A;  5D9W A;  3FZ4 A;  3MWH A;  4MPF A;  3DRN A;  3E9J B;  5D73 A;  1THO A;  3TKS E;  5A4V A;  1ABA A;  5F05 A;  2FD3 A;  1MDI A;  2CX4 A;  1WOU A;  3KEB A;  3TKS C;  5G1K A;  3IE3 A;  3WGE A;  3J7Y b;  4EDZ A;  2KUC A;  2FCH A;  2CZ2 A;  2WJU A;  2TRC P;  5F8B A;  1Z7R A;  5ECP B;  2HQT A;  3CTG A;  4X1U A;  5DCG A;  5H5R A;  5D8I A;  3IAS 2;  3RHB A;  4JR6 A;  2H1B A;  2A2R A;  2CAQ A;  1YKA A;  2XPD A;  3KZQ A;  3LOR A;  3H79 A;  3ZMK A;  2I81 A;  4HU7 A;  1R5P A;  2GLR A;  5LNK e;  5A4U A;  4XS6 A;  3ZVJ D;  3VPQ A;  4GLT A;  1TJD A;  1I5G A;  3C7M A;  1K3O A;  2VL9 A;  3HVS A;  1YDK A;  3TOT A;  5F06 A;  4JE1 A;  1BJX A;  2R3X A;  5ECO B;  1M7T A;  2M46 A;  3HZ4 A;  2PVO C;  1SL0 B;  5KEJ A;  3TOU A;  1GUM A;  4HZ2 A;  4K7O A;  4LLR A;  2H75 A;  1EEJ A;  2YWN A;  4ECC A;  4F0B A;  2RUF A;  1PSQ A;  2LUS A;  3ERW A;  1B9Y C;  3HJM A;  2RM6 A;  1TXX A;  1SL2 B;  1QMV A;  3HKR A;  4L8E A;  3EYT A;  2H01 A;  4NPB A;  5E59 A;  5D93 A;  1NHY A;  3QAW A;  3QD9 A;  2QGV A;  1GTB A;  1CQH A;  4K0G A;  4MJB A;  4PUF C;  1TK0 B;  4ID0 A;  4BL7 A;  4XS1 A;  4DSS B;  4OFM A;  3HYP A;  2AV4 A;  4F82 A;  2P5R A;  2C0E A;  1HNA A;  2FA4 A;  5FHI A;  3IR4 A;  1TRU A;  3L9U A;  1SJI A;  1GSE A;  4X0X A;  2MBT A;  2L6D A;  5L71 A;  4YAV A;  3IXR A;  4IJ3 A;  3D5J A;  4MH2 A;  1SK2 A;  3HVX A;  2JZR A;  1G7E A;  4N10 A;  2LEG A;  2VL2 C;  3QOU A;  3GYK A;  1R4W A;  2VM1 A;  2AYT A;  3SWL A;  4XHM A;  1TKD B;  2PER A;  2I3Y A;  3FR6 A;  1YEP A;  1X0R A;  3R2Q A;  3Q18 A;  1PKW A;  2R6K A;  1E6B A;  1JFU A;  1U87 A;  1XCC A;  4BVX B;  3F0I A;  2KHP A;  2LQO A;  1OE8 A;  1THX A;  3PR8 A;  1YQ1 A;  4OCF A;  5JCU A;  1MD3 A;  1H75 A;  2LNT A;  4KND A;  1GTI A;  2NBS A;  2DJ2 A;  3ZFL A;  3KXO A;  2WZ9 A;  3GNJ A;  3UJ1 A;  1TI3 A;  3DIE A;  1GH2 A;  5J3R A;  2VCQ A;  1QXH A;  4OD7 A;  1TRS A;  2KLX A;  3BBY A;  5AN1 A;  2XPE A;  20GS A;  1PQN A;  3IC8 A;  3QCP A;  1ZYQ B;  1OC8 A;  3WT1 A;  6GSV A;  4I5Q A;  4MH3 A;  4DVC A;  3JCM L;  3FZA A;  2IL3 A;  3RHC A;  1SK0 A;  3FRC A;  3UEM A;  1F9M A;  4I2U A;  4CW9 A;  2H0I A;  3MSZ A;  2B3S A;  3LFL A;  1SKR B;  1PKZ A;  5HFK A;  1RQM A;  1A8Y A;  4TKY A;  3KM6 A;  4TR4 A;  2VCW A;  1HD2 A;  1GUH A;  4KH7 A;  4AGS A;  3KIJ A;  2AUV A;  2R2J A;  2VD0 A;  2EIQ A;  4GQC A;  1M2D A;  4PX1 A;  1OKT A;  7GSS A;  3IRA A;  2JAD A;  3W8S A;  4IKH A;  3ISO A;  2VUP A;  3DGQ A;  2JZT A;  1TW9 A;  4E8E A;  1EP7 A;  4MJC A;  4I8B A;  2IWT A;  2BTO T;  2WUL A;  2WS2 A;  3ERF A;  2VOC A;  5B8B A;  2V32 A;  4MF6 A;  5ECI B;  5CP1 A;  4O92 A;  1AAZ A;  6GSS A;  1X9M B;  3VWX A;  3MNG A;  1QK8 A;  2X8G A;  5F07 A;  1SU9 A;  1O85 A;  1NHO A;  1X9W B;  18GS A;  2HFD A;  2HI7 A;  2CQ9 A;  1PMT A;  1JZR A;  3ZML A;  1HNC A;  5G30 A;  4PNG A;  2CV4 A;  4I6X A;  3ZVJ A;  2H1D A;  1WIK A;  3UAR A;  1PX6 A;  2IMD A;  5AIX A;  1S3D A;  2HNL A;  3IAM 2;  5JWO B;  2YWO A;  4FQU A;  1F3A A;  4WF4 A;  2PVQ A;  1WWJ A;  4ZB9 A;  4GRF A;  3IV4 A;  1GSU A;  1YJ6 A;  2D2Z A;  4K8M A;  1K0C A;  3GA4 A;  1YZX A;  2M72 A;  3VI5 A;  3P7X A;  4IGJ A;  4FYB A;  3VFI A;  2VCZ A;  5A5K A;  5GAN D;  3CYN A;  1EP8 A;  3W6G A;  1VF3 A;  3QAV A;  1M2A A;  2OAC A;  2OJL A;  5ELA A;  1AUC A;  5KN3 A;  2VD1 A;  3KH7 A;  1EGO A;  4KDU A;  4ZXG A;  4ZB6 A;  1A23 A;  5B7C A;  3LYK A;  3M3M A;  2B5X A;  2K8S A;  3FR9 A;  3G7J A;  1XWC A;  3L9S A;  1C72 A;  3DVX A;  4KW6 A;  5LD0 A;  4POL A;  4N11 A;  2GSS A;  4KGI A;  1TK8 B;  4RI7 A;  4ML6 A;  2OAD A;  4DSR A;  3ZRD A;  4KDY A;  2OKA A;  1GSD A;  3F8U A;  5KN1 A;  3GX0 A;  2LS5 A;  4G19 A;  4F0C A;  5CRW A;  1DBY A;  1EOH A;  1SD8 A;  3RPP A;  2HRK A;  3Q6O A;  2C8U A;  1MTC A;  3APS A;  3HVV A;  1T1V A;  4WR4 A;  5IMZ A;  4ZL7 A;  2LQQ A;  6GSU A;  4XCS A;  3FZ9 A;  4WBJ A;  5DDL A;  1ML6 A;  3ZRE A;  5G1L A;  3ZZX A;  2MYG A;  3AY8 A;  3UIW A;  4LA1 A;  3KP9 A;  2FGX A;  2V41 A;  2H73 A;  3R3E A;  2B6M A;  6GSY A;  2H0H A;  2FWH A;  3GTU A;  5G2Z A;  5IOW A;  3F9U A;  1Y6E A;  1FB0 A;  4GSS A;  2GZY A;  2YNX A;  5IMF A;  3H4K A;  1KTE A;  3GH9 A;  3A2W A;  6GSW A;  1AW9 A;  3P8W A;  3UAP A;  5CNW A;  3FZ5 A;  1B48 A;  1BYE A;  3K8N A;  3IHQ A;  3UVH A;  4BWQ A;  2UZ8 A;  3HA9 A;  3QAG A;  1F6M C;  1QQ2 A;  2FUG 2;  9GSS A;  1Z3E A;  1YF1 A;  4WR5 A;  1FW1 A;  1Z9H A;  5DCH A;  4K6X A;  1FVK A;  2LJA A;  1T7P B;  4MP4 A;  1YEX A;  2DMM A;  3IK9 A;  4TOP A;  2LJK A;  1ERU A;  1U6T A;  2YZH A;  3FYG A;  3ZYW A;  3DWV A;  1T3B A;  3J7Y k;  1RW1 A;  2C0F A;  5EVO A;  3FHK A;  3SBC A;  1WPI A;  3WYW A;  4LL1 B;  4MDC A;  2XBI A;  4JRR A;  2E7P A;  5HQP A;  4XS4 A;  3TUE A;  4YAP A;  3BJ5 A;  1Z6M A;  4CDO A;  1B8X A;  2YZU A;  2DJ1 A;  3P2A A;  3KP8 A;  1SJZ A;  1AQW A;  5GZZ B;  3IBH A;  5D9X A;  3HCZ A;  2H6Z A;  2L57 A;  1G6W A;  4EUY A;  4IP1 A;  2JL4 A;  2C1Y A;  4ZIJ A;  4NWY A;  4V1A g;  4JR4 A;  2LRT A;  2RLI A;  1AQX A;  1OAZ A;  2H76 A;  2YJ7 A;  1EV9 A;  5IMC A;  4HQZ A;  5E4W A;  1LU4 A;  4XRA A;  2CAI A;  1Q98 A;  4TR3 A;  1ST9 A;  2KOK A;  4HDE A;  3L78 A;  3LYP A;  4ILF A;  3WD6 A;  1O81 A;  3V1W A;  1GSQ A;  4ACS A;  4XTS A;  4G9H A;  5DVB A;  5HFI A;  5C00 A;  4IBP A;  2PMT A;  1FO5 A;  4GCI A;  1HQO A;  1F37 A;  3EMP A;  1ACV A;  1ERT A;  1OE7 A;  2OE0 A;  1M9B A;  1QGV A;  1YF0 A;  4PQI A;  2E2M A;  3Q74 A;  3EC3 A;  3CSI A;  1ERW A;  2FNO A;  4GF0 A;  3IC4 A;  1W89 A;  4N0Z A;  5J5N A;  3CXG A;  1IYH A;  1X5E A;  2QKE A;  4D73 A;  5AIV A;  4V2M A;  4OFT A;  1XXU A;  1FB6 A;  2DC5 A;  2ZNM A;  3F6F A;  1TOF A;  4PQ1 A;  3LGC A;  1GLQ A;  2DJJ A;  3TKP A;  2VLV A;  2TRX A;  5IOX A;  1XVQ A;  4K2D A;  1PRX A;  2IJY A;  3ED3 A;  1ZCP A;  5ECK B;  2GZP A;  1Z5Y E;  3US3 A;  1QFN A;  3WGX A;  4MLY A;  4ZBA A;  2PWJ A;  4MK3 A;  4MF5 A;  5IMA A;  3IDV A;  4HI7 A;  5EL8 A;  1WE0 A;  4ECI A;  2FWE A;  2HYX A;  2CA8 A;  1EZK A;  1GSS A;  4PXO A;  2YV7 A;  4FO5 A;  1F2E A;  3U6V A;  1NW2 A;  2H19 A;  1TP9 A;  1JLW A;  1Q4J A;  2HSH A;  2HRK B;  3CTF A;  3C1R A;  3IPZ A;  4USS A;  1USB A;  4KAE A;  2G2Q A;  5G31 A;  3GUS A;  4GSN A;  2H72 A;  3DYR A;  1BED A;  10GS A;  4ECJ A;  4KB3 A;  4P3Y B;  1A0F A;  2FY6 A;  3QFB C;  3ME7 A;  16GS A;  4FH8 A;  2WRT A;  2DIY A;  3W8J A;  2B7K A;  2RII A;  4GTU A;  8GSS A;  5IMD A;  1B4P A;  3GN3 A;  2MMO A;  2J23 A;  3C73 A;  3GTU B;  2DJ3 A;  1XWB A;  4MZB A;  4ZL8 A;  4ML1 A;  2K9F A;  2ALB A;  4Q5R A;  2NVL A;  4G0K A;  1M9A A;  5JCW A;  3LXT A;  1V57 A;  4K7I A;  3BOA A;  3KH9 A;  1XFL A;  5DAL A;  4MCU A;  5HFG A;  3GKK A;  4DSQ A;  2JZS A;  3IK7 A;  2L5L A;  3I9V 2;  1JLV A;  4YQV A;  2CT6 A;  4G0I A;  1XWA A;  4YH2 A;  3PH9 A;  3O3T A;  2VAF A;  1UN2 A;  3M0F A;  2P31 A;  3M1G A;  3TKQ A;  1SK1 A;  4WEY A;  4HJ2 A;  1G0T A;  4HEA 2;  1I9D A;  3O6T A;  3RAZ A;  4JZQ A;  4EE0 A;  4KSO A;  4V1A p;  2IMI A;  1S3A A;  1BQ7 A;  4LMW A;  3CBU A;  1K0M A;  2H1A A;  3NOF A;  5J41 A;  2C4J A;  3O76 A;  4V2L A;  22GS A;  4K1F A;  3QMX A;  5A4W A;  1MDK A;  2R37 A;  1DUG A;  3FW2 A;  3VLN A;  4PTS A;  3F4T A;  2I4A A;  5IM9 A;  5J4U A;  3TB2 A;  4O7H A;  3F3R A;  4OO5 A;  2BMX A;  3BCK A;  3VI7 A;  5BMU A;  1EV4 A;  3GKN A;  3TJJ A;  1LBK A;  1FVJ A;  3ZL5 A;  1YY7 A;  2LTK A;  5B6M A;  2CZ3 A;  2AAW A;  2L4C A;  5J9B A;  1CQG A;  3QR6 A;  4Q5Q A;  2H30 A;  5ECM B;  4EC0 A;  2QSI A;  4IJI A;  4EXJ A;  2YPM A;  5J9C A;  1OC9 A;  1PN9 A;  2LNS A;  4MF7 A;  2N5B A;  1A2J A;  4JU5 A;  4OWY A;  4KCA A;  4IP6 A;  1V58 A;  1A8L A;  2H0G A;  4J57 E;  5JWQ B;  5IPG A;  3A3T A;  1OVN A;  3QPM A;  2L4Q A;  4D73 B;  2Z9S A;  1B9X C;  2K8V A;  4AJ6 A;  1FG4 A;  3F4S A;  1K0N A;  1GSY A;  4GXZ A;  1EWX A;  2RUE A;  4IW9 A;  5DAK A;  1KNG A;  4RQX A;  4V2N A;  2GSR A;  4LMV A;  5CAX A;  2NTO A;  1B4Q A;  1A0R P;  2ZCT A;  4MJA A;  4IS0 A;  3ZIJ A;  5D96 A;  2CVD A;  3LEF A;  3LQ7 A;  2PPT A;  4KA0 A;  1GNW A;  5B8A A;  3FK8 A;  3GL3 A;  3D22 A;  4ZL9 A;  2PBJ A;  2AHE A;  4BL7 B;  1GNE A;  1H4O A;  4N0V A;  2YP6 A;  3PGT A;  3I69 A;  4IQA A;  4HZ4 A;  1WMJ A;  1EGR A;  2HLS A;  1X5C A;  5EPF A;  4NAX A;  3UL3 A;  1KBN A;  3GSS A;  5CRG A;  1U88 A;  2LJR A;  4PNF A;  2YWI A;  2I9H A;  3D4M A;  4G2E A;  3ZIV A;  3KMO A;  2J9H A;  4O5R A;  2XBQ A;  2L5O A;  1XVW A;  1K0B A;  4OFN A;  3FR3 A;  3A5W A;  3CRU A;  1SKS B;  2EIR A;  2FHE A;  1XOB A;  2WGR A;  3VK9 A;  2GQL A;  1PX7 A;  1T8E B;  5C04 A;  3OR5 A;  3D6I A;  4GWR A;  1V9W A;  3TJB A;  3I6A A;  2HE3 A;  2HRA A;  5ECQ B;  4IEL A;  2O87 A;  3GX8 A;  5GST A;  4E8H A;  4X43 A;  3GRX A;  1GL8 A;  4ECB A;  3C71 A;  1VF4 A;  3WGD A;  1HNB A;  4DSS A;  2GST A;  3EU4 A;  1XZO A;  1QUW A;  2VCX A;  1F3B A;  3CSJ A;  5AGY A;  3IOS A;  2YAN A;  5GSS A;  3DVW A;  2H66 A;  3EU3 A;  2DLX A;  5IMV A;  2FWF A;  1NM3 A;  2DBC A;  2IN3 A;  5IPH A;  1UA5 A;  4F2I A;  5ECN B;  5H5S A;  4HOJ A;  2HSY A;  1SYX A;  2HRF A;  5F0G A;  1FAA A;  1UC7 A;  3TJG A;  1O8X A;  5ECS A;  1V40 A;  2GT5 A;  5DQY A;  1TRW A;  4MAB A;  2XC2 A;  3ZIT A;  1GWC A;  3M8N A;  1VGL A;  6GST A;  3TKS A;  2HSN B;  5JCG A;  4JBB A;  4FYU A;  1OYJ A;  3QFA C;  4N30 A;  2PN8 A;  1V2A A;  3BCI A;  1GUK A;  3EVI A;  2ON5 A;  2YJH A;  2V1M A;  1M0U A;  1ZGN A;  1O73 A;  2CVB A;  2H8L A;  3EMX A;  4EF0 A;  5CYY A;  3M9J A;  1XPV A;  4GST A;  1R5A A;  3EUR A;  2HT9 A;  5D9T A;  2C3T A;  3RDW A;  2P5Q A;  3G7I A;  3QDN A;  4EKZ A;  4AF2 A;  3DXB A;  4L0W A;  1X5D A;  1M2B A;  3FY7 A;  1ZZY A;  3D4T A;  1SL1 B;  1ZOF A;  1WRY A;  2H6X A;  3HD5 A;  4IQ1 A;  2WB9 A;  4BPY A;  2FLS A;  2F51 A;  4PUA A;  4ZBD A;  3GKX A;  1PL1 A;  1YKC A;  5KN0 A;  1OC9 B;  1W4V A;  2CVK A;  3A2V A;  2VO4 A;  3KD0 A;  1A2M A;  2B1K A;  3M9K A;  1NSW A;  2E0Q A;  3APQ A;  2VL3 A;  2H70 A;  4LL4 B;  1GP1 A;  2H1G A;  3E3E A;  2RM5 A;  1OC3 A;  3F3Q A;  4QQ7 A;  1E2Y A;  3GH6 A;  1TK5 B;  1ERV A;  1ZMA A;  1BG5 A;  5INY A;  4TW5 A;  2LRN A;  4KE3 A;  3U5R E;  1BAY A;  4CHS A;  3VPT A;  2C0D A;  3NZN A;  5DAK B;  1PD2 1;  1J08 A;  2IMF A;  2C3N A;  1M99 A;  1T4Z A;  2O85 A;  4Z7X A;  4NHW A;  4XRD A;  2WFC A;  4KUN A;  3PPU A;  4TXO A;  4DEJ A;  2NPB A;  4ULX A;  2YN1 A;  3KMN A;  4HJM A;  5HR0 A;  3UOM A;  2MMA A;  1OKD A;  12GS A;  4RI6 A;  2VL2 A;  3GKM A;  1SYR A;  1JHB A;  2IME A;  3LJR A;  1FHE A;  3N5O A;  3G7Y A;  5CRE A;  2ON7 A;  3H8Q A;  4PUR A;  1XWG A;  1ZL9 A;  3KCM A;  4Q5F A;  4MPG A;  1XW5 A;  2E2G A;  3GFK A;  5DBQ A;  5HR2 A;  4O32 A;  1SEN A;  2CX3 A;  2TIR A;  4I2T A;  2N5A A;  2AB6 A;  1TU8 A;  2HSM A;  3KTB A;  2MBS A;  4JED A;  2LST A;  2H71 A;  2MZC A;  2EC4 A;  19GS A;  4MMM A;  3I43 A;  2DIZ A;  2GQM A;  1GLP A;  2G0F A;  2O89 A;  5CRD A;  1Z7P A;  2R4V A;  4KF9 A;  4J2F A;  4I97 A;  4TVE A;  3D0Z A;  3TRQ A;  2P0G A;  3PIN A;  2REM A;  1GTU A;  4G10 A;  3TJK A;  3HHV A;  2V6O A;  4NV5 A;  1RK4 A;  4NHZ A;  1U3A A;  2MMN A;  3VWU A;  5GAP D;  3GST A;  4YQM A;  5IIZ A;  3ZLP A;  2PU9 C;  3UVT A;  2F8F A;  3VWW A;  3G9B A;  1JZO A;  1O6J A;  4WKW A;  1WP0 A;  4WET A;  1GSF A;  3F63 A;  1PA3 A;  5G5E A;  2VM2 A;  4H86 A;  2DJK A;  3F4R A;  1TDI A;  4YQU A;  4TRX A;  1WJK A;  3DML A;  5ID2 A;  2DML A;  3H1N A;  1SKW B;  4NMU A;  4HUA A;  5IO0 A;  3DEX A;  1O7U A;  4WF5 A;  1MEK A;  4TR1 A;  5CO3 A;  4BWS A;  4GQF A;  2R5G A;  2B5E A;  2X64 A;  1XW6 A;  4HS1 A;  4HQS A;  1N2A A;  3E0U A;  4KX4 A;  2X99 A;  4EL1 A;  4XS4 B;  5H5Q A;  2I1U A;  14GS A;  4FIW A;  2X8C A;  2HZE A;  2N5F A;  2OE1 A;  4WBR D;  3GIX A;  5ENU A;  1VRS D;  3LG6 A;  5D9V A;  3FEU A;  2ES7 A;  4MZW A;  3S9F A;  3TCO A;  1XWK A;  1IYI A;  2IIY A;  4F9Z A;  5ECL B;  4HU9 A;  3TKR A;  4KCE A;  1O8W A;  2JSZ A;  2YV9 A;  1MD4 A;  1HYU A;  3L9V A;  5HR1 A;  1R26 A;  5ECR B;  2DJ0 A;  2O7K A;  5COH A;  4IHU A;  2F8A A;  1S3C A;  4K0N A;  4L5L A;  3HDC A;  1K3L A;  3D21 A;  2IPA A;  3LWA A;  1AXD A;  1ON4 A;  4K7N A;  3WT2 A;  4RQR A;  5B6N A;  2IFQ A;  5ELG A;  1T4Y A;  3N9J A;  3VWV A;  4KDX A;  2VLU A;  3BD2 A;  1K3Y A;  3ME8 A;  5CRH A;  2GT6 A;  1R7H A;  17GS A;  1VF2 A;  2M80 A;  2A4V A;  2LV3 A;  4ISD A;  3MDK A;  2F3M A;  2VIM A;  1A2L A;  4PQH A;  4BVY A;  13GS A;  2K6V A;  3TRP A;  4TXO B;  3TRX A;  3HZ8 A;  2JAC A;  2XHF A;  2AJQ B;  4KSM A;  3VUR A;  1G6Y A;  4ZB8 A;  3HJO A;  4RUV A;  2VCV A;  2C3Q A;  2VCT A;  1AC1 A;  1LJR A;  3C1S A;  2GQK A;  2DSA A;  1GRX A;  4PGT A;  3Q19 A;  1PL2 A;  6GSX A;  1TTZ A;  1V98 A;  2X8H A;  2JU5 A;  3RPN A;  1KEB A;  2B1L A;  3DD3 A; 
#chains in the Genus database with same CATH topology
 1Z6N A;  4N3Z A;  2QC7 A;  1SD9 A;  4AJ7 A;  11GS A;  2GTU A;  3DKS A;  2KP1 A;  2OBK A;  2EIO A;  4IN0 A;  4TN8 A;  1FOV A;  2HSM B;  3CMI A;  4NV2 A;  1S4B P;  2B7J A;  1N8J A;  5DJL A;  5IO2 A;  3C8E A;  4ZBB A;  2OE3 A;  1Y25 A;  3MYD A;  5EY6 A;  3CSH A;  3F6D A;  1MDJ A;  5JWR B;  1EEM A;  4WXT A;  3UBL A;  3KGK A;  2KP2 A;  5ECH B;  2GSQ A;  5FWG A;  3LW9 A;  4J56 E;  3L0H A;  2GDR A;  5AIS A;  4POK A;  1ZYE A;  2YOI A;  1K0O A;  1X9S B;  4MA9 A;  4POB A;  4L5O A;  1SJ6 A;  1A24 A;  1SVM A;  4EVM A;  2B5Y A;  4OO4 A;  5DAL B;  3TJF A;  2GZZ A;  5LCZ A;  3LXZ A;  4OMV A;  4XIH A;  2WDU A;  1DSB A;  2YWM A;  4AJ8 A;  5ID2 B;  3LSZ A;  1J9B A;  2HZF A;  4POM A;  5FT3 A;  3CRT A;  1U3I A;  2MMZ A;  5IQY A;  2FWG A;  1J0F A;  4TR1 B;  3FKF A;  4F03 A;  4OCE A;  1DE1 A;  1GTA A;  2BJX A;  1T00 A;  3L4N A;  2C0G A;  5G5F A;  2L6C A;  3RBT A;  1BX9 A;  2VLT A;  1UVZ A;  3GL5 A;  4G0L A;  4YKG A;  1G7O A;  3H93 A;  1XIY A;  2LRC A;  5DQS A;  3EWL A;  2PGT A;  2GS3 A;  3TDG A;  3IA1 A;  1PGT A;  3P90 A;  2L59 A;  4MZC A;  1URM A;  2HZE B;  5KN2 A;  2JSY A;  3NIV A;  1S3R A;  1EOG A;  1TU7 A;  1JZD A;  1AQV A;  4TXV A;  4EO3 A;  3KTL A;  2V2G A;  2H6Y A;  2H74 A;  4TR0 A;  1AIU A;  1XW9 A;  2GVP A;  4K9Z A;  1DE2 A;  3GUR A;  2HXK A;  4FYC A;  1TRV A;  5HR3 A;  2A2P A;  2H1L A;  1TI1 A;  4EDY A;  1JZW A;  4ZIL A;  4IVF A;  3KJY A;  4BVX A;  5BMU B;  4QL7 A;  1XOA A;  1BG1 A;  3EE2 A;  1ILO A;  4NXI A;  4Q5N A;  2GGT A;  3APO A;  3MAK A;  2PUK C;  3GV1 A;  3HY2 A;  2F9S A;  5BRT A;  1K0D A;  5ABR A;  2HRN A;  5DJM A;  2YCD A;  3UMA A;  2OA7 A;  5J40 A;  2K18 A;  2WCI A;  3HXS A;  2IFQ B;  2A2S A;  3GHA A;  2LKU A;  3TGZ A;  2FA8 A;  3ZFB A;  1K0A A;  2V6K A;  4MJE A;  4BA7 A;  1YEW C;  2O8V B;  3ZTL A;  1VF1 A;  1GUL A;  3A2X A;  2O5V A;  2IMK A;  2NDO A;  3EIN A;  2OBI A;  4L0U A;  2ZUP A;  3UBK A;  3HJP A;  3ERG A;  2C80 A;  1XBS A;  3GMF A;  4AKI A;  4BVY B;  4QL9 A;  5D9W A;  3FZ4 A;  3MWH A;  4MPF A;  3DRN A;  3E9J B;  5D73 A;  1THO A;  3TKS E;  5A4V A;  4AKG A;  1ABA A;  5F05 A;  2FD3 A;  1MDI A;  2CX4 A;  1WOU A;  3KEB A;  3TKS C;  5G1K A;  3IE3 A;  3WGE A;  3J7Y b;  4Z2T A;  4EDZ A;  2KUC A;  2FCH A;  2CZ2 A;  2WJU A;  2TRC P;  5A1N B;  5F8B A;  1Z7R A;  5ECP B;  2HQT A;  3CTG A;  4X1U A;  5DCG A;  5H5R A;  5D8I A;  3IAS 2;  3RHB A;  4JR6 A;  2H1B A;  2A2R A;  2CAQ A;  1YKA A;  2XPD A;  3KZQ A;  3LOR A;  3H79 A;  3ZMK A;  2I81 A;  4HU7 A;  2WW0 A;  1R5P A;  2GLR A;  5LNK e;  5A4U A;  4XS6 A;  3ZVJ D;  3VPQ A;  4W66 A;  4GLT A;  1TJD A;  1I5G A;  3C7M A;  1K3O A;  2VL9 A;  3HVS A;  1YDK A;  3TOT A;  5F06 A;  4JE1 A;  1BJX A;  2R3X A;  5ECO B;  4AI6 A;  1M7T A;  2M46 A;  3HZ4 A;  2PVO C;  1SL0 B;  5KEJ A;  3TOU A;  1GUM A;  4HZ2 A;  4K7O A;  4LLR A;  2H75 A;  1EEJ A;  2YWN A;  4ECC A;  4F0B A;  2RUF A;  1PSQ A;  2LUS A;  3ERW A;  1B9Y C;  3HJM A;  2RM6 A;  1TXX A;  1SL2 B;  1QMV A;  1N25 A;  3HKR A;  4L8E A;  3EYT A;  2H01 A;  4NPB A;  5E59 A;  5D93 A;  1NHY A;  3QAW A;  3QD9 A;  2QGV A;  1GTB A;  1CQH A;  4K0G A;  4MJB A;  4PUF C;  1TK0 B;  4ID0 A;  4BL7 A;  4XS1 A;  4DSS B;  4OFM A;  3HYP A;  2AV4 A;  4F82 A;  2P5R A;  2C0E A;  1HNA A;  2FA4 A;  5FHI A;  3IR4 A;  2QA2 A;  1TRU A;  3L9U A;  1SJI A;  1GSE A;  4X0X A;  2MBT A;  2L6D A;  5L71 A;  2X49 A;  4YAV A;  3IXR A;  4IJ3 A;  3D5J A;  4MH2 A;  2QA1 A;  1SK2 A;  3HVX A;  2JZR A;  1G7E A;  4N10 A;  2LEG A;  2VL2 C;  3QOU A;  3GYK A;  1R4W A;  2VM1 A;  2AYT A;  3SWL A;  4XHM A;  1TKD B;  2PER A;  2I3Y A;  3FR6 A;  1YEP A;  1X0R A;  3R2Q A;  3Q18 A;  1PKW A;  2R6K A;  1E6B A;  1JFU A;  1U87 A;  1XCC A;  4BVX B;  2EFD A;  3F0I A;  2KHP A;  2LQO A;  1OE8 A;  1THX A;  3PR8 A;  1YQ1 A;  4OCF A;  5JCU A;  1MD3 A;  1H75 A;  2LNT A;  4KND A;  1GTI A;  2NBS A;  2DJ2 A;  3ZFL A;  3KXO A;  2WZ9 A;  3GNJ A;  3UJ1 A;  1TI3 A;  3DIE A;  1GH2 A;  4QMK A;  5J3R A;  2VCQ A;  4FXY P;  1QXH A;  4OD7 A;  1TRS A;  2KLX A;  3BBY A;  5AN1 A;  2XPE A;  20GS A;  1PQN A;  3IC8 A;  3QCP A;  1ZYQ B;  1OC8 A;  3WT1 A;  6GSV A;  4I5Q A;  4MH3 A;  4DVC A;  3JCM L;  3FZA A;  2IL3 A;  3RHC A;  1SK0 A;  3FRC A;  3UEM A;  1F9M A;  4I2U A;  4CW9 A;  2H0I A;  3MSZ A;  2B3S A;  3LFL A;  1SKR B;  1PKZ A;  5HFK A;  1RQM A;  2EFH A;  1A8Y A;  4TKY A;  4G01 A;  3KM6 A;  4TR4 A;  2VCW A;  1HD2 A;  1GUH A;  4KH7 A;  4AGS A;  3KIJ A;  2AUV A;  2R2J A;  2VD0 A;  2EIQ A;  4GQC A;  1M2D A;  4PX1 A;  1OKT A;  7GSS A;  3IRA A;  2JAD A;  3W8S A;  4IKH A;  3ISO A;  2VUP A;  3DGQ A;  2JZT A;  1TW9 A;  4E8E A;  1EP7 A;  4MJC A;  4I8B A;  3HVN A;  2IWT A;  2BTO T;  2WUL A;  2WS2 A;  3ERF A;  4GDF A;  2VOC A;  5B8B A;  2V32 A;  4MF6 A;  5ECI B;  5CP1 A;  4O92 A;  1AAZ A;  6GSS A;  1X9M B;  3VWX A;  3MNG A;  1QK8 A;  2WVY A;  2X8G A;  5F07 A;  1SU9 A;  1O85 A;  1NHO A;  1X9W B;  18GS A;  2HFD A;  2HI7 A;  2CQ9 A;  1PMT A;  1JZR A;  3ZML A;  1HNC A;  5G30 A;  4PNG A;  2CV4 A;  4PI0 C;  4I6X A;  3ZVJ A;  2H1D A;  1WIK A;  3UAR A;  1PX6 A;  2IMD A;  5AIX A;  1S3D A;  2HNL A;  3IAM 2;  5JWO B;  2YWO A;  4FQU A;  1F3A A;  2WVX A;  4WF4 A;  2PVQ A;  1WWJ A;  4ZB9 A;  4GRF A;  3IV4 A;  4AKX B;  1GSU A;  1YJ6 A;  2D2Z A;  4K8M A;  1K0C A;  3GA4 A;  1YZX A;  2M72 A;  4PHZ C;  3VI5 A;  3P7X A;  4IGJ A;  4FYB A;  3VFI A;  2VCZ A;  5A5K A;  5GAN D;  3CYN A;  1EP8 A;  3W6G A;  1VF3 A;  3QAV A;  1M2A A;  2OAC A;  2OJL A;  5ELA A;  1AUC A;  5KN3 A;  2VD1 A;  1FOH A;  3KH7 A;  1EGO A;  4KDU A;  4ZXG A;  4ZB6 A;  1A23 A;  5B7C A;  3LYK A;  3M3M A;  2B5X A;  2K8S A;  3FR9 A;  5KOW A;  5J4Y A;  3G7J A;  1XWC A;  1ZYP A;  3L9S A;  1C72 A;  3DVX A;  4KW6 A;  5LD0 A;  4POL A;  4MNN A;  2UV8 G;  4N11 A;  2GSS A;  4KGI A;  1TK8 B;  4RI7 A;  4ML6 A;  2OAD A;  4DSR A;  3ZRD A;  4KDY A;  2OKA A;  1GSD A;  3F8U A;  5KN1 A;  3GX0 A;  2LS5 A;  4G19 A;  4O5U A;  4F0C A;  5CRW A;  1DBY A;  1EOH A;  1SD8 A;  3RPP A;  2HRK A;  3Q6O A;  2C8U A;  1MTC A;  3APS A;  3HVV A;  1T1V A;  4WR4 A;  5IMZ A;  4ZL7 A;  2LQQ A;  6GSU A;  4XCS A;  3FZ9 A;  4WBJ A;  5DDL A;  1ML6 A;  3ZRE A;  5G1L A;  3ZZX A;  2MYG A;  3AY8 A;  3UIW A;  4LA1 A;  3KP9 A;  2FGX A;  2V41 A;  2H73 A;  3R3E A;  2B6M A;  6GSY A;  2H0H A;  2FWH A;  3GTU A;  5G2Z A;  5IOW A;  3F9U A;  1Y6E A;  1FB0 A;  4GSS A;  2GZY A;  2YNX A;  5IMF A;  3H4K A;  1KTE A;  3GH9 A;  3A2W A;  6GSW A;  1AW9 A;  3P8W A;  3UAP A;  5CNW A;  3FZ5 A;  1B48 A;  1BYE A;  3K8N A;  3IHQ A;  3UVH A;  4BWQ A;  2UZ8 A;  3HA9 A;  3QAG A;  1F6M C;  1QQ2 A;  2FUG 2;  2O3E A;  9GSS A;  1Z3E A;  1YF1 A;  4WR5 A;  1FW1 A;  1Z9H A;  5DCH A;  4K6X A;  1FVK A;  2LJA A;  1T7P B;  4MP4 A;  1YEX A;  2DMM A;  3IK9 A;  4TOP A;  2LJK A;  1ERU A;  1U6T A;  2YZH A;  3FYG A;  3ZYW A;  3DWV A;  1T3B A;  3J7Y k;  1RW1 A;  2C0F A;  5EVO A;  3FHK A;  3SBC A;  1WPI A;  1I1I P;  3WYW A;  4LL1 B;  4MDC A;  2XBI A;  1BF5 A;  4JRR A;  2E7P A;  5HQP A;  4XS4 A;  3TUE A;  4YAP A;  3BJ5 A;  1Z6M A;  4CDO A;  1B8X A;  2YZU A;  2DJ1 A;  3P2A A;  3KP8 A;  1SJZ A;  1AQW A;  5GZZ B;  3IBH A;  5D9X A;  3HCZ A;  2H6Z A;  2L57 A;  1G6W A;  4EUY A;  4IP1 A;  2JL4 A;  2C1Y A;  4ZIJ A;  4NWY A;  4V1A g;  4JR4 A;  2LRT A;  2RLI A;  1AQX A;  1OAZ A;  2H76 A;  2YJ7 A;  1EV9 A;  5IMC A;  4HQZ A;  5E4W A;  1LU4 A;  4Z2R A;  4XRA A;  2CAI A;  1Q98 A;  4TR3 A;  1ST9 A;  5A5H A;  2KOK A;  4HDE A;  3L78 A;  3LYP A;  4ILF A;  3WD6 A;  1O81 A;  3V1W A;  1GSQ A;  4ACS A;  4XTS A;  4G9H A;  5DVB A;  3MIX A;  5HFI A;  5C00 A;  4IBP A;  2PMT A;  1FO5 A;  1PN0 A;  4GCI A;  1HQO A;  1F37 A;  3EMP A;  2WVX B;  1ACV A;  1ERT A;  1OE7 A;  2OE0 A;  1M9B A;  1QGV A;  1YF0 A;  4PQI A;  2E2M A;  3Q74 A;  3EC3 A;  3CSI A;  1ERW A;  2FNO A;  4GF0 A;  3IC4 A;  1W89 A;  4N0Z A;  5J5N A;  3CXG A;  1IYH A;  1X5E A;  2QKE A;  4D73 A;  5AIV A;  4V2M A;  4OFT A;  1XXU A;  1FB6 A;  2DC5 A;  2ZNM A;  3F6F A;  1TOF A;  4PQ1 A;  3LGC A;  1GLQ A;  2DJJ A;  3TKP A;  2VLV A;  2TRX A;  5IOX A;  1XVQ A;  4K2D A;  1PRX A;  2IJY A;  3ED3 A;  1ZCP A;  5ECK B;  2GZP A;  5J47 A;  1Z5Y E;  1QFN A;  3US3 A;  1YVL A;  3WGX A;  4MLY A;  4ZBA A;  2PWJ A;  4MK3 A;  4MF5 A;  5IMA A;  3IDV A;  4HI7 A;  5EL8 A;  1WE0 A;  4ECI A;  2FWE A;  2HYX A;  2CA8 A;  1EZK A;  4X4J A;  1GSS A;  4PXO A;  2YV7 A;  4FO5 A;  1F2E A;  3U6V A;  1NW2 A;  2H19 A;  1TP9 A;  1JLW A;  1Q4J A;  2HSH A;  2HRK B;  3CTF A;  3C1R A;  3IPZ A;  4USS A;  1USB A;  4KAE A;  2G2Q A;  5G31 A;  3GUS A;  4GSN A;  2H72 A;  3DYR A;  1BED A;  10GS A;  4ECJ A;  2A4H A;  4KB3 A;  4P3Y B;  1A0F A;  2FY6 A;  3QFB C;  3ME7 A;  16GS A;  4FH8 A;  2R0C A;  2WRT A;  2DIY A;  3W8J A;  4BIK A;  2B7K A;  2RII A;  4GTU A;  8GSS A;  5IMD A;  1B4P A;  3GN3 A;  2MMO A;  2J23 A;  3TU3 B;  3C73 A;  3GTU B;  2DJ3 A;  2WW1 A;  1XWB A;  4MZB A;  4ZL8 A;  4ML1 A;  2K9F A;  2ALB A;  4Q5R A;  2NVL A;  4G0K A;  1M9A A;  5JCW A;  3LXT A;  1V57 A;  4K7I A;  3BOA A;  2EFE A;  3KH9 A;  1XFL A;  5DAL A;  4EIP A;  4MCU A;  5HFG A;  3GKK A;  4DSQ A;  2JZS A;  3IK7 A;  2L5L A;  3I9V 2;  1JLV A;  4YQV A;  2CT6 A;  4G0I A;  1XWA A;  4YH2 A;  3PH9 A;  3O3T A;  2VAF A;  1UN2 A;  3M0F A;  2P31 A;  3M1G A;  3TKQ A;  1SK1 A;  4WEY A;  4HJ2 A;  1G0T A;  4HEA 2;  1I9D A;  3O6T A;  3RAZ A;  4JZQ A;  4EE0 A;  1ZYN A;  4KSO A;  4V1A p;  2IMI A;  1S3A A;  1BQ7 A;  4LMW A;  3CBU A;  1K0M A;  2H1A A;  3NOF A;  2HSN A;  5J41 A;  2C4J A;  3O76 A;  4V2L A;  22GS A;  4K1F A;  3QMX A;  4E68 A;  5A4W A;  1MDK A;  2R37 A;  1DUG A;  3FW2 A;  3VLN A;  4PTS A;  3F4T A;  2I4A A;  5IM9 A;  5J4U A;  3TB2 A;  4O7H A;  3F3R A;  4OO5 A;  2BMX A;  3BCK A;  3VI7 A;  5BMU A;  1EV4 A;  4CY8 A;  3GKN A;  3TJJ A;  1LBK A;  4HSC X;  1FVJ A;  3ZL5 A;  1YY7 A;  2LTK A;  5B6M A;  1SVO A;  2CZ3 A;  2AAW A;  2L4C A;  5J9B A;  1CQG A;  3QR6 A;  4Q5Q A;  2H30 A;  5ECM B;  4EC0 A;  2QSI A;  4IJI A;  4EXJ A;  2YPM A;  5J9C A;  1OC9 A;  1PN9 A;  2LNS A;  4MF7 A;  2N5B A;  1A2J A;  4JU5 A;  4OWY A;  4KCA A;  4IP6 A;  3RGB C;  1V58 A;  1A8L A;  2H0G A;  4J57 E;  3EPT A;  5JWQ B;  5IPG A;  3A3T A;  2WZS A;  1OVN A;  3QPM A;  2L4Q A;  4D73 B;  2Z9S A;  1B9X C;  2K8V A;  4AJ6 A;  1FG4 A;  3F4S A;  1K0N A;  1GSY A;  4GXZ A;  1EWX A;  2RUE A;  4IW9 A;  5DAK A;  2VKZ G;  1KNG A;  4RQX A;  4V2N A;  5J4V A;  2GSR A;  4LMV A;  5CAX A;  2NTO A;  1B4Q A;  1A0R P;  2ZCT A;  4MJA A;  4IS0 A;  3ZIJ A;  5D96 A;  2CVD A;  3LEF A;  3LQ7 A;  2PPT A;  4KA0 A;  1GNW A;  5B8A A;  3FK8 A;  3GL3 A;  3D22 A;  4ZL9 A;  2PBJ A;  4A5P A;  2AHE A;  4BL7 B;  1GNE A;  1H4O A;  5KOX A;  4N0V A;  2YP6 A;  3PGT A;  4ZB7 A;  3I69 A;  4IQA A;  4HZ4 A;  1WMJ A;  1EGR A;  2HLS A;  1X5C A;  5EPF A;  4NAX A;  3UL3 A;  1KBN A;  3GSS A;  5CRG A;  1U88 A;  2LJR A;  4PNF A;  2YWI A;  2I9H A;  3D4M A;  4G2E A;  3ZIV A;  3KMO A;  2J9H A;  5A34 A;  4O5R A;  2OT3 A;  2XBQ A;  2L5O A;  1XVW A;  1K0B A;  4OFN A;  3FR3 A;  3A5W A;  3CRU A;  1SKS B;  2EIR A;  2FHE A;  1XOB A;  2WGR A;  3VK9 A;  2GQL A;  3IHG A;  1PX7 A;  1T8E B;  5C04 A;  3OR5 A;  3D6I A;  4GWR A;  1V9W A;  3TJB A;  3I6A A;  2HE3 A;  2HRA A;  5ECQ B;  4IEL A;  2O87 A;  3GX8 A;  5GST A;  4E8H A;  4X43 A;  3GRX A;  1GL8 A;  4ECB A;  3C71 A;  1VF4 A;  3WGD A;  1HNB A;  4DSS A;  2GST A;  2WW2 A;  3EU4 A;  1XZO A;  4K2X A;  1QUW A;  2VCX A;  1F3B A;  3CSJ A;  5AGY A;  3IOS A;  2YAN A;  5GSS A;  3DVW A;  2H66 A;  3EU3 A;  2DLX A;  5IMV A;  2FWF A;  1NM3 A;  2DBC A;  2IN3 A;  5IPH A;  1UA5 A;  4F2I A;  5ECN B;  5H5S A;  4HOJ A;  2HSY A;  1SYX A;  2HRF A;  5F0G A;  1FAA A;  1UC7 A;  3TJG A;  1O8X A;  5ECS A;  1V40 A;  2GT5 A;  5DQY A;  1TRW A;  4MAB A;  2XC2 A;  3ZIT A;  1GWC A;  3M8N A;  1VGL A;  6GST A;  3TKS A;  2HSN B;  5JCG A;  4JBB A;  4FYU A;  1OYJ A;  3QFA C;  4N30 A;  2PN8 A;  1V2A A;  3BCI A;  1GUK A;  2DKH A;  3EVI A;  2ON5 A;  2YJH A;  2V1M A;  1M0U A;  1ZGN A;  1O73 A;  2CVB A;  2H8L A;  2R0P A;  3EMX A;  4EF0 A;  5CYY A;  3M9J A;  1XPV A;  4GST A;  1R5A A;  3EUR A;  2HT9 A;  4YKF A;  2WVZ A;  5D9T A;  2C3T A;  3RDW A;  2P5Q A;  3G7I A;  3QDN A;  4EKZ A;  4AF2 A;  3DXB A;  4L0W A;  1X5D A;  1M2B A;  3FY7 A;  1ZZY A;  3D4T A;  1SL1 B;  1ZOF A;  1WRY A;  2H6X A;  3HD5 A;  4IQ1 A;  2WB9 A;  4BPY A;  2FLS A;  2F51 A;  4PUA A;  4ZBD A;  3GKX A;  1PL1 A;  1SVL A;  1YKC A;  5KN0 A;  1OC9 B;  1W4V A;  2CVK A;  3A2V A;  2VO4 A;  3KD0 A;  1A2M A;  2B1K A;  3M9K A;  1NSW A;  2E0Q A;  3APQ A;  1Y1U A;  2VL3 A;  2H70 A;  4LL4 B;  1GP1 A;  2H1G A;  3E3E A;  2RM5 A;  1OC3 A;  3F3Q A;  4QQ7 A;  1E2Y A;  3GH6 A;  1TK5 B;  1ERV A;  1ZMA A;  1BG5 A;  5INY A;  4TW5 A;  2LRN A;  4KE3 A;  3U5R E;  4CY6 A;  1XG8 A;  3A5I A;  1BAY A;  4CHS A;  3VPT A;  2C0D A;  3NZN A;  5DAK B;  1PD2 1;  1J08 A;  2IMF A;  2X4A A;  2C3N A;  1M99 A;  1T4Z A;  2O85 A;  4Z7X A;  4NHW A;  4XRD A;  2WFC A;  4KUN A;  3PPU A;  4TXO A;  4DEJ A;  1M3I A;  2NPB A;  4ULX A;  2YN1 A;  3KMN A;  4HJM A;  5HR0 A;  3UOM A;  2MMA A;  1TXU A;  1OKD A;  12GS A;  4RI6 A;  3FMW A;  2VL2 A;  3GKM A;  1SYR A;  1JHB A;  2IME A;  3LJR A;  1FHE A;  3N5O A;  3G7Y A;  5CRE A;  2ON7 A;  3H8Q A;  4PUR A;  1XWG A;  1ZL9 A;  3KCM A;  4Q5F A;  4MPG A;  1XW5 A;  2E2G A;  5A34 B;  3GFK A;  5DBQ A;  5HR2 A;  4O32 A;  2O36 A;  3CHX C;  1SEN A;  2CX3 A;  2TIR A;  4I2T A;  2N5A A;  2AB6 A;  1TU8 A;  2HSM A;  3KTB A;  2MBS A;  4JED A;  2LST A;  2H71 A;  2MZC A;  2EC4 A;  19GS A;  4MMM A;  3I43 A;  2DIZ A;  2GQM A;  1GLP A;  2G0F A;  2O89 A;  5CRD A;  1Z7P A;  2R4V A;  4KF9 A;  4J2F A;  4I97 A;  3HMJ G;  4TVE A;  3D0Z A;  3TRQ A;  2P0G A;  3PIN A;  2REM A;  1GTU A;  4G10 A;  3TJK A;  3HHV A;  4PI2 C;  2V6O A;  4NV5 A;  1RK4 A;  4NHZ A;  1U3A A;  2MMN A;  3VWU A;  5GAP D;  3GST A;  4YQM A;  5IIZ A;  3ZLP A;  2PU9 C;  4K5R A;  3UVT A;  2F8F A;  3VWW A;  3G9B A;  1JZO A;  1O6J A;  4WKW A;  1WP0 A;  4WET A;  1GSF A;  3F63 A;  1PA3 A;  5G5E A;  2VM2 A;  4H86 A;  4K5S A;  2DJK A;  1PFO A;  3F4R A;  1TDI A;  4YQU A;  4TRX A;  1WJK A;  3DML A;  5ID2 A;  2DML A;  3H1N A;  1SKW B;  4NMU A;  4HUA A;  5IO0 A;  3DEX A;  1O7U A;  4WF5 A;  1MEK A;  2WW3 A;  4TR1 A;  5CO3 A;  4BWS A;  4GQF A;  2R5G A;  2B5E A;  2X64 A;  1XW6 A;  4HS1 A;  4HQS A;  1N2A A;  4O5Q A;  3E0U A;  4KX4 A;  2X99 A;  4EL1 A;  4XS4 B;  5H5Q A;  3RFR C;  2I1U A;  14GS A;  4FIW A;  2X8C A;  2HZE A;  2N5F A;  2OE1 A;  4WBR D;  3CQF A;  2EFC A;  3GIX A;  5ENU A;  1VRS D;  3LG6 A;  5D9V A;  3FEU A;  2ES7 A;  4MZW A;  3S9F A;  3TCO A;  1XWK A;  1IYI A;  2IIY A;  4F9Z A;  5ECL B;  4HU9 A;  3TKR A;  4KCE A;  4Z2U A;  1O8W A;  2R0G A;  2JSZ A;  2YV9 A;  1MD4 A;  1HYU A;  3L9V A;  5HR1 A;  5A5H B;  1R26 A;  4EIQ A;  5ECR B;  2DJ0 A;  2O7K A;  5COH A;  4IHU A;  2F8A A;  1S3C A;  4K0N A;  4L5L A;  3HDC A;  1K3L A;  3D21 A;  2IPA A;  3LWA A;  1AXD A;  1ON4 A;  4K7N A;  3WT2 A;  4RQR A;  5B6N A;  2IFQ A;  5ELG A;  1T4Y A;  3N9J A;  3VWV A;  4KDX A;  2VLU A;  3BD2 A;  1K3Y A;  3ME8 A;  5CRH A;  2GT6 A;  1R7H A;  3CWG A;  17GS A;  1VF2 A;  4AKH A;  2M80 A;  2A4V A;  2LV3 A;  4ISD A;  3MDK A;  2F3M A;  2VIM A;  1A2L A;  4PQH A;  4BVY A;  13GS A;  2K6V A;  3TRP A;  1M3J A;  4TXO B;  3TRX A;  3HZ8 A;  2JAC A;  2XHF A;  2AJQ B;  4KSM A;  3VUR A;  1G6Y A;  4ZB8 A;  3HJO A;  4RUV A;  2VCV A;  2C3Q A;  2VCT A;  1AC1 A;  1LJR A;  3C1S A;  2GQK A;  2DSA A;  1GRX A;  4PGT A;  3Q19 A;  2DKI A;  1PL2 A;  6GSX A;  1TTZ A;  1V98 A;  4ICY A;  2X8H A;  2JU5 A;  5A1N A;  3RPN A;  1KEB A;  2B1L A;  3DD3 A; 
#chains in the Genus database with same CATH homology
 1Z6N A;  4N3Z A;  2QC7 A;  1SD9 A;  4AJ7 A;  11GS A;  2GTU A;  3DKS A;  2KP1 A;  2OBK A;  2EIO A;  4IN0 A;  4TN8 A;  1FOV A;  2HSM B;  3CMI A;  4NV2 A;  2B7J A;  1N8J A;  5DJL A;  5IO2 A;  3C8E A;  4ZBB A;  2OE3 A;  1Y25 A;  3MYD A;  5EY6 A;  3CSH A;  3F6D A;  1MDJ A;  5JWR B;  1EEM A;  4WXT A;  3UBL A;  3KGK A;  2KP2 A;  5ECH B;  2GSQ A;  5FWG A;  3LW9 A;  4J56 E;  3L0H A;  2GDR A;  5AIS A;  4POK A;  1ZYE A;  2YOI A;  1K0O A;  1X9S B;  4MA9 A;  4POB A;  4L5O A;  1SJ6 A;  1A24 A;  1SVM A;  4EVM A;  2B5Y A;  4OO4 A;  5DAL B;  3TJF A;  2GZZ A;  5LCZ A;  3LXZ A;  4OMV A;  4XIH A;  2WDU A;  1DSB A;  2YWM A;  4AJ8 A;  5ID2 B;  3LSZ A;  1J9B A;  2HZF A;  4POM A;  5FT3 A;  3CRT A;  1U3I A;  2MMZ A;  5IQY A;  2FWG A;  1J0F A;  4TR1 B;  3FKF A;  4F03 A;  4OCE A;  1DE1 A;  1GTA A;  2BJX A;  1T00 A;  3L4N A;  2C0G A;  5G5F A;  2L6C A;  3RBT A;  1BX9 A;  2VLT A;  1UVZ A;  3GL5 A;  4G0L A;  4YKG A;  1G7O A;  3H93 A;  1XIY A;  2LRC A;  5DQS A;  3EWL A;  2PGT A;  2GS3 A;  3TDG A;  3IA1 A;  1PGT A;  3P90 A;  2L59 A;  4MZC A;  1URM A;  2HZE B;  5KN2 A;  2JSY A;  3NIV A;  1EOG A;  1TU7 A;  1JZD A;  1AQV A;  4TXV A;  4EO3 A;  3KTL A;  2V2G A;  2H6Y A;  2H74 A;  4TR0 A;  1AIU A;  1XW9 A;  2GVP A;  4K9Z A;  1DE2 A;  3GUR A;  2HXK A;  4FYC A;  1TRV A;  5HR3 A;  2A2P A;  2H1L A;  1TI1 A;  4EDY A;  1JZW A;  4ZIL A;  4IVF A;  3KJY A;  4BVX A;  5BMU B;  4QL7 A;  1XOA A;  1BG1 A;  3EE2 A;  1ILO A;  4NXI A;  4Q5N A;  2GGT A;  3APO A;  3MAK A;  2PUK C;  3GV1 A;  3HY2 A;  2F9S A;  5BRT A;  1K0D A;  5ABR A;  2HRN A;  5DJM A;  2YCD A;  3UMA A;  2OA7 A;  5J40 A;  2K18 A;  2WCI A;  3HXS A;  2IFQ B;  2A2S A;  3GHA A;  2LKU A;  3TGZ A;  2FA8 A;  3ZFB A;  1K0A A;  2V6K A;  4MJE A;  4BA7 A;  2O8V B;  3ZTL A;  1VF1 A;  1GUL A;  3A2X A;  2O5V A;  2IMK A;  2NDO A;  3EIN A;  2OBI A;  4L0U A;  2ZUP A;  3UBK A;  3HJP A;  3ERG A;  2C80 A;  1XBS A;  3GMF A;  4AKI A;  4BVY B;  4QL9 A;  5D9W A;  3FZ4 A;  3MWH A;  4MPF A;  3DRN A;  3E9J B;  5D73 A;  1THO A;  3TKS E;  5A4V A;  4AKG A;  1ABA A;  5F05 A;  2FD3 A;  1MDI A;  2CX4 A;  1WOU A;  3KEB A;  3TKS C;  5G1K A;  3IE3 A;  3WGE A;  3J7Y b;  4Z2T A;  4EDZ A;  2KUC A;  2FCH A;  2CZ2 A;  2WJU A;  2TRC P;  5A1N B;  5F8B A;  1Z7R A;  5ECP B;  2HQT A;  3CTG A;  4X1U A;  5DCG A;  5H5R A;  5D8I A;  3IAS 2;  3RHB A;  4JR6 A;  2H1B A;  2A2R A;  2CAQ A;  1YKA A;  2XPD A;  3KZQ A;  3LOR A;  3H79 A;  3ZMK A;  2I81 A;  4HU7 A;  1R5P A;  2GLR A;  5LNK e;  5A4U A;  4XS6 A;  3ZVJ D;  3VPQ A;  4W66 A;  4GLT A;  1TJD A;  1I5G A;  3C7M A;  1K3O A;  2VL9 A;  3HVS A;  1YDK A;  3TOT A;  5F06 A;  4JE1 A;  1BJX A;  2R3X A;  5ECO B;  4AI6 A;  1M7T A;  2M46 A;  3HZ4 A;  2PVO C;  1SL0 B;  5KEJ A;  3TOU A;  1GUM A;  4HZ2 A;  4K7O A;  4LLR A;  2H75 A;  1EEJ A;  2YWN A;  4ECC A;  4F0B A;  2RUF A;  1PSQ A;  2LUS A;  3ERW A;  1B9Y C;  3HJM A;  2RM6 A;  1TXX A;  1SL2 B;  1QMV A;  1N25 A;  3HKR A;  4L8E A;  3EYT A;  2H01 A;  4NPB A;  5E59 A;  5D93 A;  1NHY A;  3QAW A;  3QD9 A;  2QGV A;  1GTB A;  1CQH A;  4K0G A;  4MJB A;  4PUF C;  1TK0 B;  4ID0 A;  4BL7 A;  4XS1 A;  4DSS B;  4OFM A;  3HYP A;  2AV4 A;  4F82 A;  2P5R A;  2C0E A;  1HNA A;  2FA4 A;  5FHI A;  3IR4 A;  2QA2 A;  1TRU A;  3L9U A;  1SJI A;  1GSE A;  4X0X A;  2MBT A;  2L6D A;  5L71 A;  2X49 A;  4YAV A;  3IXR A;  4IJ3 A;  3D5J A;  4MH2 A;  2QA1 A;  1SK2 A;  3HVX A;  2JZR A;  1G7E A;  4N10 A;  2LEG A;  2VL2 C;  3QOU A;  3GYK A;  1R4W A;  2VM1 A;  2AYT A;  3SWL A;  4XHM A;  1TKD B;  2PER A;  2I3Y A;  3FR6 A;  1YEP A;  1X0R A;  3R2Q A;  3Q18 A;  1PKW A;  2R6K A;  1E6B A;  1JFU A;  1U87 A;  1XCC A;  4BVX B;  2EFD A;  3F0I A;  2KHP A;  2LQO A;  1OE8 A;  1THX A;  3PR8 A;  1YQ1 A;  4OCF A;  5JCU A;  1MD3 A;  1H75 A;  2LNT A;  4KND A;  1GTI A;  2NBS A;  2DJ2 A;  3ZFL A;  3KXO A;  2WZ9 A;  3GNJ A;  3UJ1 A;  1TI3 A;  3DIE A;  1GH2 A;  4QMK A;  5J3R A;  2VCQ A;  1QXH A;  4OD7 A;  1TRS A;  2KLX A;  3BBY A;  5AN1 A;  2XPE A;  20GS A;  1PQN A;  3IC8 A;  3QCP A;  1ZYQ B;  1OC8 A;  3WT1 A;  6GSV A;  4I5Q A;  4MH3 A;  4DVC A;  3JCM L;  3FZA A;  2IL3 A;  3RHC A;  1SK0 A;  3FRC A;  3UEM A;  1F9M A;  4I2U A;  4CW9 A;  2H0I A;  3MSZ A;  2B3S A;  3LFL A;  1SKR B;  1PKZ A;  5HFK A;  1RQM A;  2EFH A;  1A8Y A;  4TKY A;  4G01 A;  3KM6 A;  4TR4 A;  2VCW A;  1HD2 A;  1GUH A;  4KH7 A;  4AGS A;  3KIJ A;  2AUV A;  2R2J A;  2VD0 A;  2EIQ A;  4GQC A;  1M2D A;  4PX1 A;  1OKT A;  7GSS A;  3IRA A;  2JAD A;  3W8S A;  4IKH A;  3ISO A;  2VUP A;  3DGQ A;  2JZT A;  1TW9 A;  4E8E A;  1EP7 A;  4MJC A;  4I8B A;  2IWT A;  2BTO T;  2WUL A;  2WS2 A;  3ERF A;  4GDF A;  2VOC A;  5B8B A;  2V32 A;  4MF6 A;  5ECI B;  5CP1 A;  4O92 A;  1AAZ A;  6GSS A;  1X9M B;  3VWX A;  3MNG A;  1QK8 A;  2X8G A;  5F07 A;  1SU9 A;  1O85 A;  1NHO A;  1X9W B;  18GS A;  2HFD A;  2HI7 A;  2CQ9 A;  1PMT A;  1JZR A;  3ZML A;  1HNC A;  5G30 A;  4PNG A;  2CV4 A;  4I6X A;  3ZVJ A;  2H1D A;  1WIK A;  3UAR A;  1PX6 A;  2IMD A;  5AIX A;  1S3D A;  2HNL A;  3IAM 2;  5JWO B;  2YWO A;  4FQU A;  1F3A A;  4WF4 A;  2PVQ A;  1WWJ A;  4ZB9 A;  4GRF A;  3IV4 A;  4AKX B;  1GSU A;  1YJ6 A;  2D2Z A;  4K8M A;  1K0C A;  3GA4 A;  1YZX A;  2M72 A;  3VI5 A;  3P7X A;  4IGJ A;  4FYB A;  3VFI A;  2VCZ A;  5A5K A;  5GAN D;  3CYN A;  1EP8 A;  3W6G A;  1VF3 A;  3QAV A;  1M2A A;  2OAC A;  2OJL A;  5ELA A;  1AUC A;  5KN3 A;  2VD1 A;  1FOH A;  3KH7 A;  1EGO A;  4KDU A;  4ZXG A;  4ZB6 A;  1A23 A;  5B7C A;  3LYK A;  3M3M A;  2B5X A;  2K8S A;  3FR9 A;  5KOW A;  5J4Y A;  3G7J A;  1XWC A;  1ZYP A;  3L9S A;  1C72 A;  3DVX A;  4KW6 A;  5LD0 A;  4POL A;  4MNN A;  2UV8 G;  4N11 A;  2GSS A;  4KGI A;  1TK8 B;  4RI7 A;  4ML6 A;  2OAD A;  4DSR A;  3ZRD A;  4KDY A;  2OKA A;  1GSD A;  3F8U A;  5KN1 A;  3GX0 A;  2LS5 A;  4G19 A;  4O5U A;  4F0C A;  5CRW A;  1DBY A;  1EOH A;  1SD8 A;  3RPP A;  2HRK A;  3Q6O A;  2C8U A;  1MTC A;  3APS A;  3HVV A;  1T1V A;  4WR4 A;  5IMZ A;  4ZL7 A;  2LQQ A;  6GSU A;  4XCS A;  3FZ9 A;  4WBJ A;  5DDL A;  1ML6 A;  3ZRE A;  5G1L A;  3ZZX A;  2MYG A;  3AY8 A;  3UIW A;  4LA1 A;  3KP9 A;  2FGX A;  2V41 A;  2H73 A;  3R3E A;  2B6M A;  6GSY A;  2H0H A;  2FWH A;  3GTU A;  5G2Z A;  5IOW A;  3F9U A;  1Y6E A;  1FB0 A;  4GSS A;  2GZY A;  2YNX A;  5IMF A;  3H4K A;  1KTE A;  3GH9 A;  3A2W A;  6GSW A;  1AW9 A;  3P8W A;  3UAP A;  5CNW A;  3FZ5 A;  1B48 A;  1BYE A;  3K8N A;  3IHQ A;  3UVH A;  4BWQ A;  2UZ8 A;  3HA9 A;  3QAG A;  1F6M C;  1QQ2 A;  2FUG 2;  9GSS A;  1Z3E A;  1YF1 A;  4WR5 A;  1FW1 A;  1Z9H A;  5DCH A;  4K6X A;  1FVK A;  2LJA A;  1T7P B;  4MP4 A;  1YEX A;  2DMM A;  3IK9 A;  4TOP A;  2LJK A;  1ERU A;  1U6T A;  2YZH A;  3FYG A;  3ZYW A;  3DWV A;  1T3B A;  3J7Y k;  1RW1 A;  2C0F A;  5EVO A;  3FHK A;  3SBC A;  1WPI A;  3WYW A;  4LL1 B;  4MDC A;  2XBI A;  1BF5 A;  4JRR A;  2E7P A;  5HQP A;  4XS4 A;  3TUE A;  4YAP A;  3BJ5 A;  1Z6M A;  4CDO A;  1B8X A;  2YZU A;  2DJ1 A;  3P2A A;  3KP8 A;  1SJZ A;  1AQW A;  5GZZ B;  3IBH A;  5D9X A;  3HCZ A;  2H6Z A;  2L57 A;  1G6W A;  4EUY A;  4IP1 A;  2JL4 A;  2C1Y A;  4ZIJ A;  4NWY A;  4V1A g;  4JR4 A;  2LRT A;  2RLI A;  1AQX A;  1OAZ A;  2H76 A;  2YJ7 A;  1EV9 A;  5IMC A;  4HQZ A;  5E4W A;  1LU4 A;  4Z2R A;  4XRA A;  2CAI A;  1Q98 A;  4TR3 A;  1ST9 A;  5A5H A;  2KOK A;  4HDE A;  3L78 A;  3LYP A;  4ILF A;  3WD6 A;  1O81 A;  3V1W A;  1GSQ A;  4ACS A;  4XTS A;  4G9H A;  5DVB A;  3MIX A;  5HFI A;  5C00 A;  4IBP A;  2PMT A;  1FO5 A;  1PN0 A;  4GCI A;  1HQO A;  1F37 A;  3EMP A;  1ACV A;  1ERT A;  1OE7 A;  2OE0 A;  1M9B A;  1QGV A;  1YF0 A;  4PQI A;  2E2M A;  3Q74 A;  3EC3 A;  3CSI A;  1ERW A;  2FNO A;  4GF0 A;  3IC4 A;  1W89 A;  4N0Z A;  5J5N A;  3CXG A;  1IYH A;  1X5E A;  2QKE A;  4D73 A;  5AIV A;  4V2M A;  4OFT A;  1XXU A;  1FB6 A;  2DC5 A;  2ZNM A;  3F6F A;  1TOF A;  4PQ1 A;  3LGC A;  1GLQ A;  2DJJ A;  3TKP A;  2VLV A;  2TRX A;  5IOX A;  1XVQ A;  4K2D A;  1PRX A;  2IJY A;  3ED3 A;  1ZCP A;  5ECK B;  2GZP A;  5J47 A;  1Z5Y E;  1QFN A;  3US3 A;  1YVL A;  3WGX A;  4MLY A;  4ZBA A;  2PWJ A;  4MK3 A;  4MF5 A;  5IMA A;  3IDV A;  4HI7 A;  5EL8 A;  1WE0 A;  4ECI A;  2FWE A;  2HYX A;  2CA8 A;  1EZK A;  4X4J A;  1GSS A;  4PXO A;  2YV7 A;  4FO5 A;  1F2E A;  3U6V A;  1NW2 A;  2H19 A;  1TP9 A;  1JLW A;  1Q4J A;  2HSH A;  2HRK B;  3CTF A;  3C1R A;  3IPZ A;  4USS A;  1USB A;  4KAE A;  2G2Q A;  5G31 A;  3GUS A;  4GSN A;  2H72 A;  3DYR A;  1BED A;  10GS A;  4ECJ A;  2A4H A;  4KB3 A;  4P3Y B;  1A0F A;  2FY6 A;  3QFB C;  3ME7 A;  16GS A;  4FH8 A;  2R0C A;  2WRT A;  2DIY A;  3W8J A;  2B7K A;  2RII A;  4GTU A;  8GSS A;  5IMD A;  1B4P A;  3GN3 A;  2MMO A;  2J23 A;  3TU3 B;  3C73 A;  3GTU B;  2DJ3 A;  1XWB A;  4MZB A;  4ZL8 A;  4ML1 A;  2K9F A;  2ALB A;  4Q5R A;  2NVL A;  4G0K A;  1M9A A;  5JCW A;  3LXT A;  1V57 A;  4K7I A;  3BOA A;  2EFE A;  3KH9 A;  1XFL A;  5DAL A;  4EIP A;  4MCU A;  5HFG A;  3GKK A;  4DSQ A;  2JZS A;  3IK7 A;  2L5L A;  3I9V 2;  1JLV A;  4YQV A;  2CT6 A;  4G0I A;  1XWA A;  4YH2 A;  3PH9 A;  3O3T A;  2VAF A;  1UN2 A;  3M0F A;  2P31 A;  3M1G A;  3TKQ A;  1SK1 A;  4WEY A;  4HJ2 A;  1G0T A;  4HEA 2;  1I9D A;  3O6T A;  3RAZ A;  4JZQ A;  4EE0 A;  1ZYN A;  4KSO A;  4V1A p;  2IMI A;  1S3A A;  1BQ7 A;  4LMW A;  3CBU A;  1K0M A;  2H1A A;  3NOF A;  2HSN A;  5J41 A;  2C4J A;  3O76 A;  4V2L A;  22GS A;  4K1F A;  3QMX A;  4E68 A;  5A4W A;  1MDK A;  2R37 A;  1DUG A;  3FW2 A;  3VLN A;  4PTS A;  3F4T A;  2I4A A;  5IM9 A;  5J4U A;  3TB2 A;  4O7H A;  3F3R A;  4OO5 A;  2BMX A;  3BCK A;  3VI7 A;  5BMU A;  1EV4 A;  4CY8 A;  3GKN A;  3TJJ A;  1LBK A;  1FVJ A;  3ZL5 A;  1YY7 A;  2LTK A;  5B6M A;  1SVO A;  2CZ3 A;  2AAW A;  2L4C A;  5J9B A;  1CQG A;  3QR6 A;  4Q5Q A;  2H30 A;  5ECM B;  4EC0 A;  2QSI A;  4IJI A;  4EXJ A;  2YPM A;  5J9C A;  1OC9 A;  1PN9 A;  2LNS A;  4MF7 A;  2N5B A;  1A2J A;  4JU5 A;  4OWY A;  4KCA A;  4IP6 A;  1V58 A;  1A8L A;  2H0G A;  4J57 E;  3EPT A;  5JWQ B;  5IPG A;  3A3T A;  1OVN A;  3QPM A;  2L4Q A;  4D73 B;  2Z9S A;  1B9X C;  2K8V A;  4AJ6 A;  1FG4 A;  3F4S A;  1K0N A;  1GSY A;  4GXZ A;  1EWX A;  2RUE A;  4IW9 A;  5DAK A;  2VKZ G;  1KNG A;  4RQX A;  4V2N A;  5J4V A;  2GSR A;  4LMV A;  5CAX A;  2NTO A;  1B4Q A;  1A0R P;  2ZCT A;  4MJA A;  4IS0 A;  3ZIJ A;  5D96 A;  2CVD A;  3LEF A;  3LQ7 A;  2PPT A;  4KA0 A;  1GNW A;  5B8A A;  3FK8 A;  3GL3 A;  3D22 A;  4ZL9 A;  2PBJ A;  4A5P A;  2AHE A;  4BL7 B;  1GNE A;  1H4O A;  5KOX A;  4N0V A;  2YP6 A;  3PGT A;  4ZB7 A;  3I69 A;  4IQA A;  4HZ4 A;  1WMJ A;  1EGR A;  2HLS A;  1X5C A;  5EPF A;  4NAX A;  3UL3 A;  1KBN A;  3GSS A;  5CRG A;  1U88 A;  2LJR A;  4PNF A;  2YWI A;  2I9H A;  3D4M A;  4G2E A;  3ZIV A;  3KMO A;  2J9H A;  5A34 A;  4O5R A;  2OT3 A;  2XBQ A;  2L5O A;  1XVW A;  1K0B A;  4OFN A;  3FR3 A;  3A5W A;  3CRU A;  1SKS B;  2EIR A;  2FHE A;  1XOB A;  2WGR A;  3VK9 A;  2GQL A;  3IHG A;  1PX7 A;  1T8E B;  5C04 A;  3OR5 A;  3D6I A;  4GWR A;  1V9W A;  3TJB A;  3I6A A;  2HE3 A;  2HRA A;  5ECQ B;  4IEL A;  2O87 A;  3GX8 A;  5GST A;  4E8H A;  4X43 A;  3GRX A;  1GL8 A;  4ECB A;  3C71 A;  1VF4 A;  3WGD A;  1HNB A;  4DSS A;  2GST A;  4K2X A;  3EU4 A;  1XZO A;  1QUW A;  2VCX A;  1F3B A;  3CSJ A;  5AGY A;  3IOS A;  2YAN A;  5GSS A;  3DVW A;  2H66 A;  3EU3 A;  2DLX A;  5IMV A;  2FWF A;  1NM3 A;  2DBC A;  2IN3 A;  5IPH A;  1UA5 A;  4F2I A;  5ECN B;  5H5S A;  4HOJ A;  2HSY A;  1SYX A;  2HRF A;  5F0G A;  1FAA A;  1UC7 A;  3TJG A;  1O8X A;  5ECS A;  1V40 A;  2GT5 A;  5DQY A;  1TRW A;  4MAB A;  2XC2 A;  3ZIT A;  1GWC A;  3M8N A;  1VGL A;  6GST A;  3TKS A;  2HSN B;  5JCG A;  4JBB A;  4FYU A;  1OYJ A;  3QFA C;  4N30 A;  2PN8 A;  1V2A A;  3BCI A;  1GUK A;  2DKH A;  3EVI A;  2ON5 A;  2YJH A;  2V1M A;  1M0U A;  1ZGN A;  1O73 A;  2CVB A;  2H8L A;  2R0P A;  3EMX A;  4EF0 A;  5CYY A;  3M9J A;  1XPV A;  4GST A;  1R5A A;  3EUR A;  2HT9 A;  4YKF A;  5D9T A;  2C3T A;  3RDW A;  2P5Q A;  3G7I A;  3QDN A;  4EKZ A;  4AF2 A;  3DXB A;  4L0W A;  1X5D A;  1M2B A;  3FY7 A;  1ZZY A;  3D4T A;  1SL1 B;  1ZOF A;  1WRY A;  2H6X A;  3HD5 A;  4IQ1 A;  2WB9 A;  4BPY A;  2FLS A;  2F51 A;  4PUA A;  4ZBD A;  3GKX A;  1PL1 A;  1SVL A;  1YKC A;  5KN0 A;  1OC9 B;  1W4V A;  2CVK A;  3A2V A;  2VO4 A;  3KD0 A;  1A2M A;  2B1K A;  3M9K A;  1NSW A;  2E0Q A;  3APQ A;  1Y1U A;  2VL3 A;  2H70 A;  4LL4 B;  1GP1 A;  2H1G A;  3E3E A;  2RM5 A;  1OC3 A;  3F3Q A;  4QQ7 A;  1E2Y A;  3GH6 A;  1TK5 B;  1ERV A;  1ZMA A;  1BG5 A;  5INY A;  4TW5 A;  2LRN A;  4KE3 A;  3U5R E;  4CY6 A;  3A5I A;  1BAY A;  4CHS A;  3VPT A;  2C0D A;  3NZN A;  5DAK B;  1PD2 1;  1J08 A;  2IMF A;  2X4A A;  2C3N A;  1M99 A;  1T4Z A;  2O85 A;  4Z7X A;  4NHW A;  4XRD A;  2WFC A;  4KUN A;  3PPU A;  4TXO A;  4DEJ A;  2NPB A;  4ULX A;  2YN1 A;  3KMN A;  4HJM A;  5HR0 A;  3UOM A;  2MMA A;  1TXU A;  1OKD A;  12GS A;  4RI6 A;  3FMW A;  2VL2 A;  3GKM A;  1SYR A;  1JHB A;  2IME A;  3LJR A;  1FHE A;  3N5O A;  3G7Y A;  5CRE A;  2ON7 A;  3H8Q A;  4PUR A;  1XWG A;  1ZL9 A;  3KCM A;  4Q5F A;  4MPG A;  1XW5 A;  2E2G A;  5A34 B;  3GFK A;  5DBQ A;  5HR2 A;  4O32 A;  1SEN A;  2CX3 A;  2TIR A;  4I2T A;  2N5A A;  2AB6 A;  1TU8 A;  2HSM A;  3KTB A;  2MBS A;  4JED A;  2LST A;  2H71 A;  2MZC A;  2EC4 A;  19GS A;  4MMM A;  3I43 A;  2DIZ A;  2GQM A;  1GLP A;  2G0F A;  2O89 A;  5CRD A;  1Z7P A;  2R4V A;  4KF9 A;  4J2F A;  4I97 A;  3HMJ G;  4TVE A;  3D0Z A;  3TRQ A;  2P0G A;  3PIN A;  2REM A;  1GTU A;  4G10 A;  3TJK A;  3HHV A;  2V6O A;  4NV5 A;  1RK4 A;  4NHZ A;  1U3A A;  2MMN A;  3VWU A;  5GAP D;  3GST A;  4YQM A;  5IIZ A;  3ZLP A;  2PU9 C;  4K5R A;  3UVT A;  2F8F A;  3VWW A;  3G9B A;  1JZO A;  1O6J A;  4WKW A;  1WP0 A;  4WET A;  1GSF A;  3F63 A;  1PA3 A;  5G5E A;  2VM2 A;  4H86 A;  4K5S A;  2DJK A;  3F4R A;  1TDI A;  4YQU A;  4TRX A;  1WJK A;  3DML A;  5ID2 A;  2DML A;  3H1N A;  1SKW B;  4NMU A;  4HUA A;  5IO0 A;  3DEX A;  1O7U A;  4WF5 A;  1MEK A;  4TR1 A;  5CO3 A;  4BWS A;  4GQF A;  2R5G A;  2B5E A;  2X64 A;  1XW6 A;  4HS1 A;  4HQS A;  1N2A A;  4O5Q A;  3E0U A;  4KX4 A;  2X99 A;  4EL1 A;  4XS4 B;  5H5Q A;  2I1U A;  14GS A;  4FIW A;  2X8C A;  2HZE A;  2N5F A;  2OE1 A;  4WBR D;  2EFC A;  3GIX A;  5ENU A;  1VRS D;  3LG6 A;  5D9V A;  3FEU A;  2ES7 A;  4MZW A;  3S9F A;  3TCO A;  1XWK A;  1IYI A;  2IIY A;  4F9Z A;  5ECL B;  4HU9 A;  3TKR A;  4KCE A;  4Z2U A;  1O8W A;  2R0G A;  2JSZ A;  2YV9 A;  1MD4 A;  1HYU A;  3L9V A;  5HR1 A;  5A5H B;  1R26 A;  4EIQ A;  5ECR B;  2DJ0 A;  2O7K A;  5COH A;  4IHU A;  2F8A A;  1S3C A;  4K0N A;  4L5L A;  3HDC A;  1K3L A;  3D21 A;  2IPA A;  3LWA A;  1AXD A;  1ON4 A;  4K7N A;  3WT2 A;  4RQR A;  5B6N A;  2IFQ A;  5ELG A;  1T4Y A;  3N9J A;  3VWV A;  4KDX A;  2VLU A;  3BD2 A;  1K3Y A;  3ME8 A;  5CRH A;  2GT6 A;  1R7H A;  3CWG A;  17GS A;  1VF2 A;  4AKH A;  2M80 A;  2A4V A;  2LV3 A;  4ISD A;  3MDK A;  2F3M A;  2VIM A;  1A2L A;  4PQH A;  4BVY A;  13GS A;  2K6V A;  3TRP A;  4TXO B;  3TRX A;  3HZ8 A;  2JAC A;  2XHF A;  2AJQ B;  4KSM A;  3VUR A;  1G6Y A;  4ZB8 A;  3HJO A;  4RUV A;  2VCV A;  2C3Q A;  2VCT A;  1AC1 A;  1LJR A;  3C1S A;  2GQK A;  2DSA A;  1GRX A;  4PGT A;  3Q19 A;  2DKI A;  1PL2 A;  6GSX A;  1TTZ A;  1V98 A;  4ICY A;  2X8H A;  2JU5 A;  5A1N A;  3RPN A;  1KEB A;  2B1L A;  3DD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...