4PGTA

Crystal structure of hgstp1-1[v104] complexed with the gsh conjugate of (+)-anti-bpde
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
209
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 209
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pgtA01
1T4YA 2JZRA 4BWQA 4F2IA 1MDJA 1GSQA 4YQUA 4WR4A 2IWTA 4KW6A 4GXZA 6GSSA 4OO4A 4EVMA 1OVNA 3TCOA 1E6BA 1Y25A 2IMEA 4ML1A 4Z7XA 2ALBA 4MJCA 1YY7A 2B1LA 1JHBA 1MDKA 3BD2A 3R2QA 4TR4A 2NDOA 2YPMA 2GT5A 1XW5A 5ID2A 1GSFA 3KJYA 1WPIA 2B1KA 3GH9A 3RHBA 3APSA 5CAXA 3VPQA 5CO3A 1M9AA 2XPEA 3L9SA 2IL3A 5IO0A 5DDLA 1LBKA 3GURA 3KMOA 2EIOA 3BCKA 1BQ7A 4HJ2A 2AUVA 5D9XA 4O32A 2M72A 3G9BA 3QMXA 4ZB9A 2OE3A 2RM5A 4YQVA 5DJMA 4YH2A 4GSNA 4KH7A 1R5PA 4YAPA 2LV3A 2LRCA 2FA4A 2DC5A 1U3AA 4PQ1A 4POLA 5J41A 3KH9A 2VUPA 1VRSD 1M2DA 3NOFA 2G2QA 1XWCA 4GQCA 1GNEA 2PWJA 2H70A 5ELGA 2VL9A 2WJUA 3ZIJA 1X5CA 4Q5RA 2EIRA 4KF9A 2R37A 1V58A 4Q5QA 1SD9A 2HFDA 1EGOA 3A2XA 2MMOA 1XVQA 5CP1A 3KXOA 3I6AA 2H0IA 4BL7B 2ZUPA 2VLVA 5JCUA 16GSA 2YWIA 1BG5A 2K8SA 1T4ZA 3H4KA 5G5FA 3HJMA 3KP9A 6GSVA 5H5SA 1OC8A 1K0CA 1YEPA 1JLVA 3GIXA 1XWKA 1ABAA 4HEA2 3ZLPA 1ERVA 1F3AA 3MSZA 3BCIA 4BL7A 1PD21 1GTAA 17GSA 2A2SA 1WWJA 2DLXA 5KN3A 3VI5A 1THXA 3DWVA 1M0UA 2DIZA 4ECCA 4X43A 4X1UA 4PQIA 5LD0A 2H74A 4N30A 1FVKA 2GQKA 3ZL5A 2WZ9A 4XCSA 1FW1A 2WULA 4HS1A 2EIQA 3DVXA 3M1GA 4FYUA 4O5RA 4NV5A 2YWOA 3FY7A 1TI3A 2DJ3A 2YCDA 1PA3A 4Q5NA 1YKCA 4XS4B 3JCML 1MDIA 4XTSA 4TXOB 1Z7RA 1VF4A 3CTGA 4JRRA 1BX9A 1S3DA 1TDIA 10GSA 5AIXA 1WOUA 1SL2B 5CRHA 1EWXA 1MEKA 4HOJA 2TRCP 1O8WA 4XS4A 1TJDA 4IJ3A 2FY6A 3VK9A 3V1WA 5F06A 1X5EA 5ECIB 4HJMA 2V1MA 3HCZA 1N2AA 1Y6EA 2YZHA 1VF2A 1JLWA 4ISDA 5JCGA 1OE8A 3DD3A 5GZZB 4HZ4A 4EL1A 5LCZA 1C72A 4IVFA 1OAZA 2F9SA 2FHEA 4IN0A 1Z5YE 2X8HA 1TKDB 4CDOA 5AGYA 1G0TA 1OYJA 2TIRA 2RM6A 13GSA 3EINA 2G0FA 4IQ1A 2VO4A 5DCHA 1AIUA 3UIWA 2H6ZA 2VM2A 2IMDA 1ZYEA 2DJJA 4K2DA 4KNDA 2MMZA 1TOFA 1QFNA 4GSTA 19GSA 3TRPA 2V41A 4ECBA 1BJXA 2FGXA 1A2JA 3UJ1A 1GSEA 2OE0A 3BJ5A 4ACSA 5FT3A 3ZFLA 1SYXA 5F07A 3H1NA 4WF4A 1A0FA 4J57E 4J2FA 1HNCA 2I4AA 5ECPB 3Q18A 1SENA 3IK9A 4KCEA 3D22A 4O92A 5DQYA 2PPTA 1K0MA 1SKWB 1VF3A 3F63A 2B5EA 4PUFC 1ERTA 1OC3A 3M0FA 2CAIA 2H19A 1TU8A 1DBYA 4MA9A 2YP6A 2H72A 4F0BA 1AW9A 4MZCA 1SKSB 2XC2A 3ISOA 1U6TA 4WR5A 4NV2A 3P8WA 1K0NA 1ILOA 3PGTA 1GWCA 2FUG2 2MMAA 1ERWA 4OMVA 5FHIA 2VCTA 3GL3A 2IIYA 3QD9A 3KTBA 4IJIA 4IS0A 1KEBA 4EKZA 1JZOA 18GSA 1R5AA 4H86A 2R2JA 1H75A 3IC4A 1A8YA 2C80A 3KMNA 1J0FA 2DJKA 3LXTA 1GLPA 4TR1B 2HNLA 1TXXA 1K0DA 4TKYA 5H5QA 1E2YA 4ML6A 3DRNA 3NZNA 5DALA 2LNSA 1A2LA 3PR8A 3QDNA 3EYTA 3O6TA 4ZL9A 5H5RA 1TRWA 3RBTA 3H8QA 2KHPA 2B7JA 3F6DA 2FWGA 3I69A 4I5QA 2OE1A 4GSSA 2LTKA 5JWOB 1OKDA 4FYCA 3LYKA 2IMIA 4TR1A 2LSTA 2IPAA 2GDRA 2VIMA 4KUNA 2M46A 4ZILA 2R3XA 2XHFA 5IPHA 3EMPA 1TRVA 2VCQA 4D73B 3IHQA 1IYHA 1VF1A 2VCZA 3ZTLA 3PH9A 1GTBA 1OC9A 4PNGA 3D5JA 3UBLA 4XHMA 3FR3A 1A24A 3KM6A 2HRAA 4JU5A 3HKRA 3A5WA 2GSRA 1JZDA 4F03A 3EU4A 4BVXA 5G1LA 1HQOA 2LJRA 5HFIA 5J9CA 4TOPA 3D4TA 3PPUA 4OWYA 3I9V2 4TR3A 1USBA 3TJKA 4P3YB 1NM3A 1K3LA 2HSYA 1A23A 1U88A 4D73A 3ERFA 3WGDA 4MF6A 2CVKA 4BVYB 3LGCA 3MNGA 1PQNA 4L0WA 1HYUA 5ECHB 2MMNA 3Q74A 3W8JA 3FKFA 4KE3A 4GRFA 1MTCA 4IP6A 1QGVA 1ML6A 4EDZA 2OACA 14GSA 5CNWA 2LJAA 3K8NA 4V1Ag 2JL4A 5IIZA 4BVYA 1O73A 4EUYA 5HR0A 1X5DA 2O85A 3HZ8A 2PVQA 4WXTA 4JBBA 1W89A 3GKNA 2CV4A 3F4SA 3QAGA 5G1KA 5INYA 11GSA 1V2AA 3ZFBA 4RI7A 3QAWA 3P90A 5IMZA 2HSMB 1F9MA 3C1RA 5ECNB 3GSSA 5AIVA 2HZEA 3BOAA 1YDKA 3FZ5A 2V6KA 1BEDA 2MBSA 1SYRA 3ERWA 3GFKA 5CRDA 3CRUA 3SBCA 2LJKA 3IR4A 1XFLA 5CRWA 2IMKA 2TRXA 6GSWA 2CZ3A 4G0LA 3TB2A 20GSA 2BMXA 3F8UA 2OJLA 2O7KA 2HSMA 2FWFA 3U6VA 1Z6MA 4F0CA 1TI1A 2DJ0A 2O87A 2K8VA 2JSZA 1TK8B 2YWMA 1PN9A 4OFMA 2ES7A 5ECKB 2C8UA 1B48A 3GUSA 2GZZA 2F3MA 3P2AA 4ZB6A 3FRCA 1GTIA 1B8XA 2AYTA 2C0DA 3ME8A 3UEMA 3UBKA 1F6MC 5D9WA 1GLQA 4V2LA 4KB3A 1Z9HA 4EE0A 4L5OA 4K8MA 1PX6A 2NPBA 3TKQA 2WFCA 3TRQA 3IC8A 1THOA 3TKSC 2RIIA 1UC7A 1GNWA 2H73A 4IELA 1M2BA 4KGIA 4FIWA 3LWAA 1ERUA 3TKRA 4ZBBA 1WP0A 5GAND 2PBJA 4LMWA 2WS2A 2WRTA 4MH2A 4K7IA 1B9XC 3QFBC 4G10A 3GNJA 2R5GA 3IOSA 1URMA 4I6XA 1GSDA 1DSBA 4MJBA 2OKAA 1SL0B 5ECQB 2IN3A 2R6KA 2YZUA 2QGVA 2VLTA 1XWAA 3M3MA 5B8BA 1QQ2A 2QKEA 1XCCA 4OFNA 1XOAA 3C73A 5D93A 3HA9A 3GMFA 3L78A 2WB9A 4FQUA 2ON7A 2KP2A 1B4PA 1XVWA 5HQPA 2FWHA 3F6FA 1U87A 5HR3A 2C0GA 1V98A 2BJXA 2DBCA 2CT6A 4K0NA 4WKWA 4HU9A 5ECSA 2CAQA 1GRXA 4IGJA 5GSSA 4MK3A 5DCGA 1SK2A 3UARA 3E0UA 4N0ZA 4KSMA 3IV4A 3BBYA 5F8BA 2H1DA 3TUEA 2GS3A 3CYNA 1JZWA 1QMVA 4WETA 1XW9A 1F37A 2DIYA 2GTUA 2CZ2A 2YOIA 3QCPA 3P7XA 3VWXA 3TJFA 5B6MA 4MP4A 5CYYA 1W4VA 4TXOA 4K7NA 4POBA 3J7Yb 4L5LA 2KP1A 4OFTA 2H30A 4DSRA 1GSUA 1PGTA 4MMMA 2JZTA 3EE2A 3FZAA 5IOXA 3RAZA 1YKAA 4FH8A 4DSSB 3FR6A 1ON4A 3UMAA 3ZIVA 2LQQA 1EGRA 2N5AA 1M7TA 4WBRD 3DYRA 3Q6OA 2EC4A 2V6OA 1SKRB 3LSZA 5JWRB 2ZCTA 4X0XA 2D2ZA 4QQ7A 5ECOB 3DIEA 2NTOA 3TJBA 1WJKA 2DMMA 3GH6A 5L71A 3EMXA 5B6NA 5E59A 4EXJA 4GLTA 3DGQA 3GYKA 4G2EA 2WCIA 1Z7PA 4XIHA 5IMAA 2NVLA 4MZWA 5FWGA 4XRAA 1YF1A 2B5XA 4MLYA 1Z6NA 5DAKB 3DVWA 1T7PB 2LKUA 4NMUA 4XRDA 3C71A 2VL2C 3LFLA 2C4JA 3TKSE 1XW6A 1TRSA 2LEGA 5C00A 3TKSA 4E8HA 4MF5A 4POKA 5F05A 2GSQA 1ZGNA 2CX4A 4BA7A 2E2GA 3FZ4A 3C7MA 5HR1A 1IYIA 4KDUA 4ZL7A 1K3YA 1LU4A 4TR0A 1R26A 2RUFA 3HZ4A 3HVXA 3EU3A 1GSYA 2GLRA 1M99A 1A8LA 3ZREA 1GP1A 1K0BA 4BPYA 4PQHA 1FB6A 2PUKC 1ZOFA 2HZFA 1I9DA 1G7OA 1EEJA 4K9ZA 4N0VA 3VURA 4ZL8A 3W8SA 3HJPA 3A2WA 2O89A 1DE2A 3L9UA 4LA1A 2E7PA 5D9VA 2VCXA 3D6IA 3I43A 1ST9A 4N10A 3ED3A 5KN0A 5G2ZA 3L0HA 4KDXA 3DKSA 2B7KA 1RK4A 3CMIA 1B4QA 1MD4A 1V40A 2LRNA 5LNKe 1YF0A 2VM1A 4AGSA 4MH3A 1UA5A 1XXUA 1A0RP 4MJEA 5CRGA 2F8AA 1RW1A 3M9KA 2OBKA 2FCHA 1TW9A 4ZXGA 3GX0A 4WBJA 1FG4A 3N9JA 3R3EA 2QC7A 2VD0A 4PNFA 4KSOA 2M80A 1XIYA 2JACA 2L6CA 2H66A 4NHZA 4ULXA 1AC1A 4RQXA 3ZYWA 1FO5A 4KX4A 2HRKB 6GSTA 2IJYA 2J23A 4IP1A 2MBTA 3TKPA 1QUWA 2HYXA 4NPBA 2IMFA 5IPGA 2PN8A 5G30A 3ZVJD 4RQRA 3PINA 3RDWA 3HVVA 2PVOC 5B7CA 3HXSA 2C3QA 3HD5A 1B9YC 2UZ8A 5AISA 3IAS2 5A5KA 2CVDA 1F2EA 1YJ6A 2JU5A 2N5FA 2HRNA 5EY6A 3IRAA 4PURA 1M2AA 3G7IA 2GZYA 1G6WA 3F3RA 2HXKA 1TRUA 4RI6A 1R7HA 5DQSA 1X9WB 4MDCA 2E0QA 3GN3A 2VCWA 3GKMA 3DEXA 1PSQA 4PX1A 2YJHA 2IFQB 4LLRA 1NHYA 4MABA 3EURA 3U5RE 3CXGA 4IBPA 1SD8A 1O85A 2YV9A 2CVBA 1OKTA 4V2MA 2C3NA 1NHOA 5A4VA 3H93A 4GQFA 3HVSA 1UVZA 3AY8A 5KEJA 5IMVA 3CRTA 2L57A 1EV4A 4HQZA 1YZXA 3E3EA 2I3YA 5IMDA 2BTOT 1PMTA 2HLSA 2IFQA 3A2VA 2HSHA 3TJGA 3FR9A 5DJLA 2YANA 3KIJA 4TN8A 1Q98A 1EEMA 3TJJA 3G7YA 1Z3EA 4DVCA 4ID0A 2VL2A 4I2TA 5GSTA 3IK7A 1WE0A 3WT1A 4MJAA 5ID2B 3LG6A 2L4CA 5KN1A 3LXZA 1HNBA 4O7HA 3WGEA 1T8EB 1GUKA 4PTSA 4HZ2A 1KBNA 3FW2A 3MDKA 4GCIA 5EVOA 1GUMA 2P5QA 1ZCPA 5ABRA 3GL5A 1TK5B 2GQMA 4EO3A 1GULA 4K7OA 5GAPD 1WIKA 2H1GA 2OBIA 4NXIA 3QPMA 1FOVA 4LL1B 2C0FA 1F3BA 2AB6A 1TP9A 2GGTA 2H1AA 3VI7A 4CHSA 3TOTA 2CQ9A 3MAKA 2H1BA 1ZZYA 1X9SB 2CX3A 3F0IA 4KCAA 1SK1A 1XWGA 1YQ1A 2YV7A 2V2GA 3KGKA 4LMVA 5G5EA 4GF0A 4CW9A 3LQ7A 3QR6A 1GL8A 1T3BA 1M9BA 3GKKA 2PU9C 5IMCA 2GZPA 3CSIA 1Q4JA 4FO5A 4GTUA 4G9HA 3VWUA 2YWNA 3QFAC 2VOCA 2GSTA 3VLNA 4USSA 4LL4B 3VWWA 2LNTA 1JZRA 2GT6A 5ECMB 4IW9A 4IHUA 2LS5A 2B6MA 2NBSA 2HSNB 4G0IA 5EPFA 4JE1A 1H4OA 2KOKA 3S9FA 3NIVA 2VL3A 4PUAA 1PKZA 3WT2A 1TU7A 4IKHA 1GUHA 5COHA 1NW2A 2ZNMA 3D4MA 1V9WA 2AHEA 5JCWA 1O81A 4MZBA 4QL7A 2JSYA 3FK8A 2OA7A 3C8EA 3ZMKA 3N5OA 2HQTA 4K0GA 3CSJA 4Q5FA 5IM9A 3GX8A 1AUCA 2PGTA 5IQYA 3F4TA 1EV9A 5J4UA 5J5NA 2X64A 1AXDA 2O8VB 5IMFA 2I9HA 3ZITA 2L5OA 3H79A 2C3TA 4HU7A 4V2NA 2VCVA 4MPFA 2VAFA 2JADA 3UVTA 2MZCA 4OO5A 1V57A 3EVIA 2FNOA 12GSA 1XPVA 1QXHA 4HQSA 4NAXA 3WD6A 2HE3A 1R4WA 3APQA 3DMLA 4TXVA 2AAWA 3MWHA 5DVBA 1DE1A 2A2RA 1GSSA 4ECJA 2JZSA 4AJ7A 4MF7A 5D9TA 3IXRA 2LUSA 1VGLA 4FYBA 3C1SA 2KLXA 5J3RA 1K0OA 2ON5A 4PGTA 1XBSA 3ERGA 4N11A 3GRXA 4I2UA 4V1Ap 2R4VA 3RPNA 2MYGA 5DBQA 2L4QA 5ECLB 3Q19A 1NSWA 2B5YA 2GQLA 3GA4A 3GV1A 4F9ZA 2X8CA 1XZOA 5HFGA 8GSSA 2LQOA 3KZQA 1EZKA 3ZVJA 3RPPA 1EP7A 3E9JB 1X9MB 3SWLA 1GH2A 1T00A 4GWRA 4DSQA 1YEXA 2C0EA 2XPDA 2H0GA 4NWYA 3F3QA 4TW5A 3HY2A 5D73A 4I8BA 3TDGA 1PL1A 4KA0A 4EDYA 4I97A 3O76A 1FHEA 2LRTA 3APOA 3OR5A 1K0AA 4IQAA 1WRYA 5E4WA 2YJ7A 3WYWA 4OCFA 2CA8A 3KP8A 1MD3A 4ZB8A 1FAAA 4TRXA 4DSSA 1J9BA 3ZRDA 2P0GA 2H6YA 9GSSA 2FA8A 1WMJA 2PERA 5HR2A 5HFKA 2AJQB 4OCEA 4JR4A 3A3TA 1PKWA 1A2MA 2WGRA 1XWBA 3GHAA 2N5BA 4JZQA 2FWEA 2YNXA 2DSAA 3ZZXA 2L5LA 3TOUA 3QOUA 5G31A 3W6GA 1EOHA 1BYEA 1J08A 2V32A 1QK8A 2I1UA 3FHKA 1G6YA 2HI7A 4EC0A 4KAEA 2L6DA 3ZMLA 4MCUA 2HRFA 4DEJA 1DUGA 5EL8A 1ACVA 2QSIA 5ECRB 2P31A 1G7EA 3O3TA 5DAKA 2K18A 3IPZA 2Z9SA 4F82A 1ZYQB 1TTZA 2H71A 4AJ8A 2DMLA 2PMTA 1SJZA 4XS6A 3HDCA 2X8GA 4YAVA 2B3SA 22GSA 4PXOA 3UVHA 1HD2A 2H76A 1O8XA 1TK0B 5IOWA 3LYPA 2H75A 2DJ2A 1SL1B 2AV4A 2FLSA 1ZL9A 3FZ9A 2XBQA 5D96A 3HHVA 1UN2A 3GSTA 4KDYA 5C04A 3L9VA 4OD7A 3M9JA 4G19A 4WF5A 3L4NA 1K3OA 1OE7A 1KTEA 1CQGA 5DALB 5JWQB 3HJOA 4MPGA 2WDUA 3CBUA 1SJ6A 1XOBA 4TVEA 2I81A 3WGXA 5ELAA 2K6VA 4J56E 5BMUA 5IO2A 4L8EA 4L0UA 3FEUA 4RUVA 4E8EA 2REMA 3ME7A 2KUCA 4POMA 2XBIA 2FD3A 1RQMA 4AF2A 2H0HA 3IA1A 3QAVA 1LJRA 1HNAA 1OC9B 1PRXA 1S3AA 1SK0A 3IE3A 4BWSA 1N8JA 4JR6A 2L59A 2H8LA 2A4VA 4NHWA 4QL9A 4BVXB 3EC3A 5AN1A 3F9UA 5KN2A 3VWVA 2H6XA 2OADA 2P5RA 4YQMA 3GKXA 1KNGA 2HRKA 2GVPA 2GSSA 4HDEA 1AQVA 1PX7A 4EF0A 4ZBAA 5B8AA 3UAPA 4G0KA 3FYGA 3KEBA 5A4UA 5J9BA 3KH7A 1FB0A 2K9FA 1EOGA 1PL2A 3F4RA 3EWLA 1T1VA 2X99A 3RHCA 3LORA 3VFIA 3GTUB 4ZIJA 1U3IA 3US3A 7GSSA 3LEFA 1X0RA 6GSYA 3KTLA 3HYPA 4AJ6A 4HI7A 3UOMA 1AQXA 1I5GA 1AAZA 3LJRA 1AQWA 4K6XA 4ILFA 3CTFA 3KD0A 2F51A 4XS1A 3KCMA 3J7Yk 1ZMAA 3UL3A 6GSUA 5D8IA 2HT9A 6GSXA 2F8FA 2H01A 3GTUA 1BAYA 1SJIA 5F0GA 1SU9A 3DXBA 4ZBDA 2HZEB 1EP8A 4ECIA 1FVJA 3M8NA 3TGZA 2VLUA 1S3CA 1JFUA 1O6JA 4WEYA 2C1YA 3IBHA 1O7UA 3CSHA 3TRXA 4HUAA 1GTUA 5ENUA 3D0ZA 2YN1A 2RUEA 2J9HA 3IDVA 2DJ1A 1CQHA 3VPTA 5CREA 5A4WA 4K1FA 4JEDA 3IAM2 2RLIA 3D21A 2E2MA 3G7JA 2VD1A
chains in the Genus database with same CATH superfamily
1T4YA 2JZRA 4BWQA 4F2IA 1MDJA 1GSQA 4YQUA 4WR4A 2IWTA 4KW6A 4GXZA 6GSSA 4OO4A 4EVMA 1OVNA 3TCOA 1E6BA 1Y25A 2IMEA 4ML1A 4Z7XA 2ALBA 4MJCA 1YY7A 2B1LA 1JHBA 1MDKA 3BD2A 3R2QA 4TR4A 2NDOA 2YPMA 2GT5A 1XW5A 5ID2A 1GSFA 3KJYA 1WPIA 2B1KA 3GH9A 3RHBA 3APSA 5CAXA 3VPQA 5CO3A 1M9AA 4Z2RA 2XPEA 3L9SA 2IL3A 2OT3A 5IO0A 5DDLA 1LBKA 2WVXB 3GURA 3KMOA 2EIOA 3BCKA 2UV8G 1BQ7A 4HJ2A 2AUVA 5D9XA 4O32A 2M72A 3G9BA 3QMXA 4ZB9A 2OE3A 2RM5A 4YQVA 5DJMA 4YH2A 4GSNA 4KH7A 1R5PA 4YAPA 2LV3A 4PI2C 2LRCA 2FA4A 2DC5A 1U3AA 4PQ1A 4POLA 5J41A 3KH9A 2VUPA 1VRSD 1M2DA 3NOFA 2G2QA 1XWCA 4GQCA 1GNEA 2PWJA 2H70A 5ELGA 2VL9A 2WJUA 3ZIJA 1X5CA 4Q5RA 2EIRA 4KF9A 2R37A 1V58A 4Q5QA 1SD9A 2HFDA 1EGOA 3A2XA 2MMOA 1XVQA 5CP1A 3KXOA 3I6AA 2H0IA 4BL7B 2ZUPA 2VLVA 5JCUA 16GSA 2YWIA 2VKZG 1BG5A 2K8SA 1T4ZA 3H4KA 5G5FA 3HJMA 3KP9A 6GSVA 5H5SA 1OC8A 1K0CA 1YEPA 1JLVA 3GIXA 1XWKA 1ABAA 4HEA2 3ZLPA 1ERVA 1F3AA 3MSZA 3BCIA 4BL7A 1PD21 1XG8A 1GTAA 17GSA 2A2SA 1WWJA 2DLXA 5KN3A 3VI5A 1THXA 3DWVA 1M0UA 2DIZA 4ECCA 4X43A 4X1UA 4PQIA 5LD0A 2H74A 4N30A 1FVKA 2GQKA 3ZL5A 2WZ9A 4XCSA 1FW1A 2WULA 4HS1A 2EIQA 3DVXA 3M1GA 4FYUA 4O5RA 4NV5A 2YWOA 3FY7A 2WW3A 1TI3A 2DJ3A 5A5HB 2YCDA 1PA3A 4Q5NA 1YKCA 4XS4B 3JCML 1MDIA 4XTSA 4TXOB 1Z7RA 1VF4A 3CTGA 4JRRA 1BX9A 1S3DA 1TDIA 10GSA 4ICYA 2EFHA 5AIXA 1WOUA 1SL2B 5CRHA 1EWXA 1MEKA 4HOJA 2TRCP 1O8WA 4XS4A 1TJDA 4IJ3A 2FY6A 3VK9A 3V1WA 5F06A 1X5EA 5ECIB 4HJMA 2V1MA 3HCZA 1N2AA 1Y6EA 2YZHA 1VF2A 1JLWA 4ISDA 5JCGA 1OE8A 3DD3A 5GZZB 4HZ4A 4EL1A 5LCZA 1C72A 4IVFA 1OAZA 2F9SA 2FHEA 4IN0A 1Z5YE 2X8HA 1TKDB 4CDOA 5AGYA 1G0TA 1OYJA 2TIRA 2RM6A 13GSA 3EINA 2G0FA 4IQ1A 2VO4A 5DCHA 1AIUA 3UIWA 2H6ZA 2VM2A 2IMDA 1ZYEA 2DJJA 4K2DA 4KNDA 2MMZA 5A34B 1FOHA 1TOFA 1QFNA 4GSTA 19GSA 3TRPA 2V41A 4ECBA 1BJXA 2FGXA 1A2JA 4N3ZA 3UJ1A 1GSEA 2OE0A 3BJ5A 4ACSA 5FT3A 3ZFLA 1SYXA 5F07A 3H1NA 4WF4A 1A0FA 4J57E 4J2FA 1HNCA 2I4AA 5ECPB 5A34A 3Q18A 1SENA 3IK9A 4KCEA 3D22A 4O92A 5DQYA 4CY8A 2PPTA 1K0MA 2R0GA 1SKWB 1VF3A 3F63A 2B5EA 4PUFC 1ERTA 1OC3A 3M0FA 2CAIA 2H19A 1TU8A 1DBYA 4MA9A 5J4VA 1PN0A 2YP6A 2H72A 4F0BA 1AW9A 4MZCA 1SKSB 2XC2A 3ISOA 1U6TA 4WR5A 4NV2A 3P8WA 1K0NA 1ILOA 3PGTA 1GWCA 2FUG2 2MMAA 1ERWA 4OMVA 4ZB7A 5FHIA 2VCTA 3GL3A 2IIYA 3QD9A 3KTBA 4IJIA 4IS0A 1KEBA 3FMWA 4EKZA 1JZOA 18GSA 1R5AA 4H86A 2R2JA 1H75A 3IC4A 1A8YA 2C80A 3KMNA 1J0FA 2DJKA 3LXTA 1GLPA 4TR1B 2HNLA 5J4YA 1ZYPA 1TXXA 1K0DA 3CQFA 4TKYA 3RFRC 5H5QA 1E2YA 4ML6A 3DRNA 3NZNA 5DALA 1M3IA 4PHZC 2LNSA 1A2LA 3PR8A 3QDNA 3EYTA 3O6TA 4ZL9A 5H5RA 1TRWA 3RBTA 3H8QA 2KHPA 2B7JA 3F6DA 2FWGA 3I69A 4I5QA 2OE1A 4GSSA 2LTKA 5JWOB 1OKDA 4FYCA 3LYKA 2IMIA 4TR1A 2LSTA 2IPAA 2GDRA 2VIMA 4KUNA 2H1LA 2M46A 4ZILA 2R3XA 2XHFA 5IPHA 5J47A 3EMPA 1TRVA 2VCQA 4D73B 3IHQA 5KOXA 1IYHA 1VF1A 2VCZA 3ZTLA 3PH9A 1GTBA 1OC9A 4PNGA 3RGBC 3D5JA 3UBLA 4XHMA 3FR3A 1A24A 1Y1UA 3KM6A 2HRAA 4JU5A 3HKRA 3A5WA 2GSRA 1JZDA 4F03A 3EU4A 4BVXA 5G1LA 4Z2TA 1HQOA 2LJRA 5HFIA 5J9CA 4TOPA 3D4TA 3PPUA 4OWYA 3I9V2 4TR3A 1USBA 3TJKA 4P3YB 1NM3A 1K3LA 2HSYA 1A23A 2WVYA 1U88A 4D73A 3ERFA 3WGDA 4MF6A 2CVKA 4BVYB 3LGCA 3MNGA 1PQNA 4L0WA 1HYUA 5ECHB 2MMNA 3Q74A 3W8JA 3FKFA 4KE3A 4GRFA 1MTCA 4GDFA 4IP6A 1QGVA 1ML6A 4EDZA 2OACA 14GSA 5CNWA 2LJAA 3K8NA 4V1Ag 2JL4A 1N25A 5IIZA 4BVYA 1O73A 4EUYA 5HR0A 1TXUA 1X5DA 2O85A 1ZYNA 3HZ8A 2PVQA 4WXTA 4JBBA 1W89A 3GKNA 2CV4A 3F4SA 3QAGA 5G1KA 5INYA 11GSA 1V2AA 3ZFBA 4RI7A 3QAWA 4G01A 3P90A 5IMZA 2HSMB 2X49A 1F9MA 3C1RA 5ECNB 3GSSA 5AIVA 2HZEA 3BOAA 1YDKA 3FZ5A 2V6KA 1BEDA 2MBSA 1SYRA 3ERWA 3GFKA 5CRDA 3CRUA 3SBCA 2LJKA 3IR4A 1XFLA 5CRWA 2IMKA 2TRXA 6GSWA 2CZ3A 4G0LA 3TB2A 20GSA 2BMXA 3F8UA 2OJLA 2O7KA 2HSMA 2FWFA 3U6VA 1Z6MA 4F0CA 1TI1A 2DJ0A 2O87A 2K8VA 2JSZA 1TK8B 2YWMA 1PN9A 4OFMA 2ES7A 3HVNA 5ECKB 2C8UA 1B48A 3GUSA 2GZZA 2F3MA 3P2AA 4ZB6A 3FRCA 1GTIA 1B8XA 2AYTA 2C0DA 3ME8A 3UEMA 3UBKA 1F6MC 5D9WA 1GLQA 4V2LA 4KB3A 1Z9HA 4EE0A 4L5OA 4K8MA 1PX6A 2NPBA 4X4JA 3TKQA 2WFCA 2WZSA 3TRQA 3IC8A 1THOA 3TKSC 2WVXA 2RIIA 1UC7A 1GNWA 2H73A 4IELA 1M2BA 4KGIA 4FIWA 3LWAA 4O5UA 1ERUA 3TKRA 4ZBBA 1WP0A 5GAND 2PBJA 4LMWA 2WS2A 5A1NB 2WRTA 4MH2A 4K7IA 1B9XC 3QFBC 4G10A 3GNJA 2R5GA 3IOSA 1URMA 4I6XA 4AKXB 5KOWA 1GSDA 1DSBA 4MJBA 2OKAA 1SL0B 5ECQB 2IN3A 4E68A 2R6KA 2YZUA 2QGVA 5A1NA 2VLTA 1XWAA 3M3MA 5B8BA 1QQ2A 2QKEA 1XCCA 4OFNA 1XOAA 3C73A 5D93A 3HA9A 3GMFA 3L78A 2WB9A 4FQUA 2ON7A 2WW2A 2KP2A 1B4PA 1XVWA 5HQPA 2QA2A 2FWHA 3F6FA 1U87A 5HR3A 2C0GA 1V98A 2BJXA 2DBCA 2CT6A 2WW1A 4K0NA 4WKWA 4HU9A 5ECSA 2CAQA 1GRXA 4IGJA 5GSSA 4MK3A 5DCGA 1SK2A 3UARA 3E0UA 4N0ZA 4KSMA 3IV4A 3BBYA 2EFEA 5F8BA 2H1DA 3TUEA 2GS3A 3CYNA 1JZWA 1QMVA 4WETA 1XW9A 1F37A 2DIYA 2GTUA 2CZ2A 2YOIA 3QCPA 3P7XA 3VWXA 4K5SA 3TJFA 5A5HA 5B6MA 4MP4A 5CYYA 1W4VA 4TXOA 4K7NA 4POBA 3J7Yb 4L5LA 2KP1A 4OFTA 2H30A 4DSRA 1GSUA 1PGTA 4MMMA 2JZTA 3EE2A 3FZAA 5IOXA 3RAZA 1YKAA 4FH8A 4DSSB 3FR6A 1ON4A 3UMAA 3ZIVA 2LQQA 1EGRA 2N5AA 1M7TA 4WBRD 3DYRA 3Q6OA 2EC4A 2V6OA 1SKRB 3LSZA 5JWRB 2ZCTA 2A4HA 4X0XA 2D2ZA 4QQ7A 5ECOB 3DIEA 2NTOA 3TJBA 1WJKA 2DMMA 3GH6A 5L71A 3HMJG 2A2PA 3EMXA 5B6NA 5E59A 4EXJA 4GLTA 3DGQA 3GYKA 4G2EA 2WCIA 1Z7PA 4XIHA 5IMAA 2NVLA 4MZWA 5FWGA 4XRAA 1YF1A 2B5XA 4MLYA 1Z6NA 5DAKB 3DVWA 4AKIA 4HSCX 1T7PB 2LKUA 4NMUA 4XRDA 3C71A 4FXYP 2VL2C 3LFLA 1SVLA 2C4JA 3TKSE 1XW6A 1TRSA 2LEGA 5C00A 3TKSA 4E8HA 4MF5A 4POKA 5F05A 2GSQA 1ZGNA 2CX4A 4BA7A 2X4AA 2E2GA 3FZ4A 3C7MA 5HR1A 1IYIA 4KDUA 4ZL7A 1K3YA 1LU4A 4TR0A 1R26A 2RUFA 3HZ4A 3HVXA 3EU3A 1GSYA 4K2XA 2GLRA 1M99A 1A8LA 3A5IA 3ZREA 1GP1A 1K0BA 4BPYA 4PQHA 1FB6A 2PUKC 2O5VA 1ZOFA 2HZFA 1I9DA 1G7OA 1EEJA 4K9ZA 4N0VA 3VURA 4ZL8A 3W8SA 3HJPA 3A2WA 2O89A 1DE2A 3L9UA 5BMUB 2E7PA 4LA1A 5D9VA 2VCXA 3D6IA 3I43A 1ST9A 2O3EA 4N10A 3ED3A 5KN0A 5G2ZA 3L0HA 4KDXA 3DKSA 2B7KA 1RK4A 3CMIA 1B4QA 1MD4A 1V40A 2LRNA 5LNKe 1YF0A 2EFCA 2VM1A 4AGSA 4MH3A 1UA5A 1XXUA 1A0RP 4MJEA 5CRGA 2F8AA 1RW1A 3M9KA 2OBKA 2FCHA 1TW9A 4ZXGA 3GX0A 4WBJA 4PI0C 1SVMA 1FG4A 3N9JA 3R3EA 2QC7A 2VD0A 3IHGA 4PNFA 4KSOA 2M80A 1XIYA 2JACA 2L6CA 2H66A 4NHZA 4ULXA 1AC1A 4RQXA 3ZYWA 1FO5A 4KX4A 2HRKB 6GSTA 2IJYA 2J23A 4IP1A 2MBTA 3TKPA 1QUWA 2HYXA 4NPBA 2IMFA 5IPGA 2PN8A 5G30A 3ZVJD 4RQRA 2O36A 3PINA 3RDWA 3HVVA 2PVOC 5B7CA 3HXSA 2C3QA 3HD5A 4EIQA 1B9YC 2UZ8A 5AISA 3IAS2 5A5KA 2CVDA 1F2EA 1YJ6A 2JU5A 2N5FA 2HRNA 5EY6A 3IRAA 4PURA 1M2AA 3G7IA 2GZYA 1G6WA 3F3RA 2HXKA 1TRUA 4RI6A 1R7HA 5DQSA 1X9WB 4MDCA 2E0QA 3GN3A 2VCWA 3GKMA 3DEXA 1PSQA 4PX1A 2YJHA 2IFQB 4O5QA 4LLRA 1NHYA 4MABA 3EURA 3U5RE 3CXGA 4IBPA 1SD8A 1O85A 4BIKA 2YV9A 2CVBA 1OKTA 4V2MA 2C3NA 5J40A 1NHOA 5A4VA 3H93A 4GQFA 3HVSA 1UVZA 3AY8A 5KEJA 5IMVA 3CRTA 2L57A 1EV4A 4HQZA 1YZXA 3E3EA 2I3YA 5IMDA 2BTOT 1PMTA 2HLSA 2IFQA 3A2VA 2HSHA 3TJGA 3FR9A 5DJLA 2YANA 3KIJA 1YEWC 4TN8A 1Q98A 1EEMA 3TJJA 3G7YA 1Z3EA 4DVCA 4ID0A 2VL2A 4I2TA 5GSTA 3IK7A 1WE0A 3WT1A 4MJAA 5ID2B 3LG6A 2L4CA 5KN1A 3LXZA 1HNBA 4O7HA 3WGEA 1T8EB 1GUKA 4PTSA 4HZ2A 1KBNA 3FW2A 3MDKA 4GCIA 5EVOA 1GUMA 2P5QA 1ZCPA 5ABRA 3GL5A 3MYDA 2GQMA 1TK5B 4EO3A 1GULA 4W66A 4K7OA 5GAPD 1WIKA 2H1GA 2OBIA 4NXIA 3QPMA 1FOVA 4LL1B 2C0FA 1F3BA 2AB6A 1TP9A 2GGTA 2H1AA 3VI7A 4CHSA 3TOTA 2CQ9A 3MAKA 2H1BA 1ZZYA 1X9SB 2CX3A 3F0IA 4KCAA 1SK1A 1XWGA 1YQ1A 2YV7A 1I1IP 2V2GA 3KGKA 4LMVA 5G5EA 4GF0A 4CW9A 3LQ7A 3QR6A 1GL8A 1T3BA 1M9BA 3GKKA 2PU9C 5IMCA 2GZPA 3CSIA 1Q4JA 4FO5A 4GTUA 4G9HA 3VWUA 2YWNA 3QFAC 2VOCA 2GSTA 3VLNA 4USSA 4LL4B 3VWWA 2LNTA 1JZRA 2GT6A 5ECMB 4IW9A 4IHUA 2LS5A 2B6MA 2NBSA 2HSNB 4G0IA 5EPFA 4JE1A 1H4OA 2KOKA 3S9FA 3NIVA 2R0CA 2VL3A 4PUAA 1PKZA 3WT2A 1TU7A 4IKHA 1GUHA 5COHA 1NW2A 2ZNMA 3D4MA 1V9WA 2AHEA 5JCWA 1O81A 4MZBA 4QL7A 2JSYA 3FK8A 2OA7A 3C8EA 3ZMKA 3N5OA 2HQTA 4K0GA 3CSJA 4Q5FA 2HSNA 4A5PA 4K5RA 3GX8A 5IM9A 1AUCA 2PGTA 4AI6A 4EIPA 5IQYA 3F4TA 1EV9A 5J4UA 5J5NA 2X64A 1AXDA 1BF5A 2O8VB 5IMFA 2I9HA 3ZITA 2L5OA 3H79A 2C3TA 4HU7A 4V2NA 2VCVA 4MPFA 2VAFA 2JADA 3UVTA 2MZCA 4OO5A 1V57A 3EVIA 2FNOA 12GSA 1XPVA 2EFDA 1QXHA 4HQSA 4NAXA 3WD6A 2HE3A 1R4WA 3APQA 3DMLA 4TXVA 2AAWA 3MWHA 5DVBA 3MIXA 1DE1A 2A2RA 1GSSA 4ECJA 2JZSA 4AJ7A 4MF7A 5D9TA 3IXRA 2LUSA 1VGLA 4FYBA 3C1SA 2KLXA 5J3RA 1K0OA 2ON5A 4PGTA 1XBSA 3ERGA 4N11A 3GRXA 4I2UA 4V1Ap 2R4VA 3RPNA 2MYGA 5DBQA 2L4QA 5ECLB 4Z2UA 3Q19A 1NSWA 2B5YA 2GQLA 3GA4A 3GV1A 4F9ZA 2X8CA 1XZOA 5HFGA 8GSSA 2LQOA 3KZQA 5BRTA 1EZKA 3ZVJA 3RPPA 1EP7A 3CWGA 3E9JB 1X9MB 3SWLA 1GH2A 1T00A 4GWRA 4DSQA 1YEXA 2C0EA 2XPDA 2H0GA 4NWYA 3F3QA 4TW5A 3HY2A 5D73A 4I8BA 3TDGA 1PL1A 4KA0A 4EDYA 4I97A 3O76A 3LW9A 1FHEA 2LRTA 3APOA 3OR5A 1K0AA 4IQAA 1WRYA 5E4WA 2YJ7A 3WYWA 4OCFA 4MNNA 2CA8A 4CY6A 3KP8A 3EPTA 1S3RA 1MD3A 4ZB8A 1FAAA 4TRXA 4DSSA 1J9BA 3ZRDA 2P0GA 2H6YA 9GSSA 2FA8A 1WMJA 2PERA 5HR2A 1M3JA 5HFKA 2AJQB 4OCEA 4JR4A 3A3TA 1PKWA 1A2MA 2WGRA 1XWBA 3GHAA 2N5BA 4JZQA 2FWEA 2YNXA 2DSAA 3ZZXA 2L5LA 3TOUA 3QOUA 5G31A 3W6GA 1EOHA 2WW0A 1BYEA 1J08A 2V32A 1QK8A 2I1UA 3FHKA 1G6YA 2HI7A 4EC0A 4KAEA 2L6DA 3ZMLA 4MCUA 2HRFA 4DEJA 1DUGA 5EL8A 1ACVA 2QSIA 5ECRB 2P31A 1G7EA 3O3TA 5DAKA 2K18A 3IPZA 2Z9SA 4F82A 1ZYQB 1TTZA 2H71A 4AJ8A 2DMLA 2PMTA 1SJZA 4XS6A 3HDCA 2X8GA 4YAVA 2B3SA 22GSA 4PXOA 3UVHA 1HD2A 2H76A 1O8XA 1TK0B 5IOWA 3LYPA 3TU3B 2H75A 2DJ2A 1SL1B 2AV4A 2FLSA 1ZL9A 3FZ9A 2QA1A 2XBQA 5D96A 3HHVA 1UN2A 3GSTA 4KDYA 5C04A 3L9VA 4OD7A 3M9JA 4G19A 4WF5A 3L4NA 1K3OA 1OE7A 1KTEA 1CQGA 5DALB 5JWQB 3HJOA 2R0PA 4MPGA 2WDUA 3CBUA 1SJ6A 1XOBA 4TVEA 2I81A 1YVLA 3WGXA 5ELAA 2K6VA 4J56E 5BMUA 5IO2A 1SVOA 4L8EA 4L0UA 3FEUA 4RUVA 4E8EA 2REMA 4YKFA 3ME7A 2KUCA 4POMA 2XBIA 2FD3A 1RQMA 4AF2A 2H0HA 3IA1A 4AKHA 3QAVA 1LJRA 1HNAA 1OC9B 1PRXA 2DKIA 1S3AA 1SK0A 3IE3A 4BWSA 1BG1A 1N8JA 4JR6A 2L59A 2H8LA 2A4VA 4NHWA 4QL9A 4YKGA 4BVXB 3EC3A 5AN1A 3F9UA 5KN2A 3VWVA 2H6XA 2OADA 2P5RA 4YQMA 1PFOA 3GKXA 1KNGA 2HRKA 1S4BP 2GVPA 3CHXC 2GSSA 4HDEA 1AQVA 1PX7A 4EF0A 4ZBAA 5B8AA 3UAPA 4G0KA 3FYGA 3KEBA 5A4UA 5J9BA 3KH7A 1FB0A 2K9FA 4AKGA 1EOGA 1PL2A 3F4RA 3EWLA 1T1VA 2X99A 3RHCA 3LORA 3VFIA 3GTUB 4ZIJA 1U3IA 3US3A 7GSSA 3LEFA 1X0RA 6GSYA 3KTLA 3HYPA 4AJ6A 4HI7A 3UOMA 1AQXA 1I5GA 1AAZA 3LJRA 1AQWA 4K6XA 4ILFA 3CTFA 3KD0A 2F51A 4XS1A 3KCMA 3J7Yk 1ZMAA 3UL3A 6GSUA 5D8IA 2HT9A 6GSXA 2F8FA 2H01A 3GTUA 1BAYA 1SJIA 5F0GA 1SU9A 2DKHA 2WVZA 3DXBA 4ZBDA 2HZEB 1EP8A 4ECIA 1FVJA 3M8NA 3TGZA 2VLUA 1S3CA 1JFUA 1O6JA 4WEYA 2C1YA 4QMKA 3IBHA 1O7UA 3CSHA 3TRXA 4HUAA 1GTUA 5ENUA 3D0ZA 2YN1A 2RUEA 2J9HA 3IDVA 2DJ1A 1CQHA 3VPTA 5CREA 5A4WA 4K1FA 4JEDA 3IAM2 2RLIA 3D21A 2E2MA 3G7JA 2VD1A
chains in the Genus database with same CATH topology
1T4YA 2JZRA 4BWQA 4F2IA 1MDJA 1GSQA 4YQUA 4WR4A 2IWTA 4KW6A 4GXZA 6GSSA 4OO4A 4EVMA 1OVNA 3TCOA 1E6BA 1Y25A 2IMEA 4ML1A 4Z7XA 2ALBA 4MJCA 1YY7A 2B1LA 1JHBA 1MDKA 3BD2A 3R2QA 4TR4A 2NDOA 2YPMA 2GT5A 1XW5A 5ID2A 1GSFA 3KJYA 1WPIA 2B1KA 3GH9A 3RHBA 3APSA 5CAXA 3VPQA 5CO3A 1M9AA 4Z2RA 2XPEA 3L9SA 2IL3A 2OT3A 5IO0A 5DDLA 1LBKA 3GURA 3KMOA 2EIOA 3BCKA 2UV8G 1BQ7A 4HJ2A 2AUVA 5D9XA 4O32A 2M72A 3G9BA 3QMXA 4ZB9A 2OE3A 2RM5A 4YQVA 5DJMA 4YH2A 4GSNA 4KH7A 1R5PA 4YAPA 2LV3A 2LRCA 2FA4A 2DC5A 1U3AA 4PQ1A 4POLA 5J41A 3KH9A 2VUPA 1VRSD 1M2DA 3NOFA 2G2QA 1XWCA 4GQCA 1GNEA 2PWJA 2H70A 5ELGA 2VL9A 2WJUA 3ZIJA 1X5CA 4Q5RA 2EIRA 4KF9A 2R37A 1V58A 4Q5QA 1SD9A 2HFDA 1EGOA 3A2XA 2MMOA 1XVQA 5CP1A 3KXOA 3I6AA 2H0IA 4BL7B 2ZUPA 2VLVA 5JCUA 16GSA 2YWIA 2VKZG 1BG5A 2K8SA 1T4ZA 3H4KA 5G5FA 3HJMA 3KP9A 6GSVA 5H5SA 1OC8A 1K0CA 1YEPA 1JLVA 3GIXA 1XWKA 1ABAA 4HEA2 3ZLPA 1ERVA 1F3AA 3MSZA 3BCIA 4BL7A 1PD21 1GTAA 17GSA 2A2SA 1WWJA 2DLXA 5KN3A 3VI5A 1THXA 3DWVA 1M0UA 2DIZA 4ECCA 4X43A 4X1UA 4PQIA 5LD0A 2H74A 4N30A 1FVKA 2GQKA 3ZL5A 2WZ9A 4XCSA 1FW1A 2WULA 4HS1A 2EIQA 3DVXA 3M1GA 4FYUA 4O5RA 4NV5A 2YWOA 3FY7A 1TI3A 2DJ3A 5A5HB 2YCDA 1PA3A 4Q5NA 1YKCA 4XS4B 3JCML 1MDIA 4XTSA 4TXOB 1Z7RA 1VF4A 3CTGA 4JRRA 1BX9A 1S3DA 1TDIA 10GSA 4ICYA 2EFHA 5AIXA 1WOUA 1SL2B 5CRHA 1EWXA 1MEKA 4HOJA 2TRCP 1O8WA 4XS4A 1TJDA 4IJ3A 2FY6A 3VK9A 3V1WA 5F06A 1X5EA 5ECIB 4HJMA 2V1MA 3HCZA 1N2AA 1Y6EA 2YZHA 1VF2A 1JLWA 4ISDA 5JCGA 1OE8A 3DD3A 5GZZB 4HZ4A 4EL1A 5LCZA 1C72A 4IVFA 1OAZA 2F9SA 2FHEA 4IN0A 1Z5YE 2X8HA 1TKDB 4CDOA 5AGYA 1G0TA 1OYJA 2TIRA 2RM6A 13GSA 3EINA 2G0FA 4IQ1A 2VO4A 5DCHA 1AIUA 3UIWA 2H6ZA 2VM2A 2IMDA 1ZYEA 2DJJA 4K2DA 4KNDA 2MMZA 5A34B 1FOHA 1TOFA 1QFNA 4GSTA 19GSA 3TRPA 2V41A 4ECBA 1BJXA 2FGXA 1A2JA 4N3ZA 3UJ1A 1GSEA 2OE0A 3BJ5A 4ACSA 5FT3A 3ZFLA 1SYXA 5F07A 3H1NA 4WF4A 1A0FA 4J57E 4J2FA 1HNCA 2I4AA 5ECPB 5A34A 3Q18A 1SENA 3IK9A 4KCEA 3D22A 4O92A 5DQYA 4CY8A 2PPTA 1K0MA 2R0GA 1SKWB 1VF3A 3F63A 2B5EA 4PUFC 1ERTA 1OC3A 3M0FA 2CAIA 2H19A 1TU8A 1DBYA 4MA9A 5J4VA 1PN0A 2YP6A 2H72A 4F0BA 1AW9A 4MZCA 1SKSB 2XC2A 3ISOA 1U6TA 4WR5A 4NV2A 3P8WA 1K0NA 1ILOA 3PGTA 1GWCA 2FUG2 2MMAA 1ERWA 4OMVA 4ZB7A 5FHIA 2VCTA 3GL3A 2IIYA 3QD9A 3KTBA 4IJIA 4IS0A 1KEBA 3FMWA 4EKZA 1JZOA 18GSA 1R5AA 4H86A 2R2JA 1H75A 3IC4A 1A8YA 2C80A 3KMNA 1J0FA 2DJKA 3LXTA 1GLPA 4TR1B 2HNLA 5J4YA 1ZYPA 1TXXA 1K0DA 4TKYA 5H5QA 1E2YA 4ML6A 3DRNA 3NZNA 5DALA 2LNSA 1A2LA 3PR8A 3QDNA 3EYTA 3O6TA 4ZL9A 5H5RA 1TRWA 3RBTA 3H8QA 2KHPA 2B7JA 3F6DA 2FWGA 3I69A 4I5QA 2OE1A 4GSSA 2LTKA 5JWOB 1OKDA 4FYCA 3LYKA 2IMIA 4TR1A 2LSTA 2IPAA 2GDRA 2VIMA 4KUNA 2H1LA 2M46A 4ZILA 2R3XA 2XHFA 5IPHA 5J47A 3EMPA 1TRVA 2VCQA 4D73B 3IHQA 5KOXA 1IYHA 1VF1A 2VCZA 3ZTLA 3PH9A 1GTBA 1OC9A 4PNGA 3D5JA 3UBLA 4XHMA 3FR3A 1A24A 1Y1UA 3KM6A 2HRAA 4JU5A 3HKRA 3A5WA 2GSRA 1JZDA 4F03A 3EU4A 4BVXA 5G1LA 4Z2TA 1HQOA 2LJRA 5HFIA 5J9CA 4TOPA 3D4TA 3PPUA 4OWYA 3I9V2 4TR3A 1USBA 3TJKA 4P3YB 1NM3A 1K3LA 2HSYA 1A23A 1U88A 4D73A 3ERFA 3WGDA 4MF6A 2CVKA 4BVYB 3LGCA 3MNGA 1PQNA 4L0WA 1HYUA 5ECHB 2MMNA 3Q74A 3W8JA 3FKFA 4KE3A 4GRFA 1MTCA 4GDFA 4IP6A 1QGVA 1ML6A 4EDZA 2OACA 14GSA 5CNWA 2LJAA 3K8NA 4V1Ag 2JL4A 1N25A 5IIZA 4BVYA 1O73A 4EUYA 5HR0A 1TXUA 1X5DA 2O85A 1ZYNA 3HZ8A 2PVQA 4WXTA 4JBBA 1W89A 3GKNA 2CV4A 3F4SA 3QAGA 5G1KA 5INYA 11GSA 1V2AA 3ZFBA 4RI7A 3QAWA 4G01A 3P90A 5IMZA 2HSMB 2X49A 1F9MA 3C1RA 5ECNB 3GSSA 5AIVA 2HZEA 3BOAA 1YDKA 3FZ5A 2V6KA 1BEDA 2MBSA 1SYRA 3ERWA 3GFKA 5CRDA 3CRUA 3SBCA 2LJKA 3IR4A 1XFLA 5CRWA 2IMKA 2TRXA 6GSWA 2CZ3A 4G0LA 3TB2A 20GSA 2BMXA 3F8UA 2OJLA 2O7KA 2HSMA 2FWFA 3U6VA 1Z6MA 4F0CA 1TI1A 2DJ0A 2O87A 2K8VA 2JSZA 1TK8B 2YWMA 1PN9A 4OFMA 2ES7A 5ECKB 2C8UA 1B48A 3GUSA 2GZZA 2F3MA 3P2AA 4ZB6A 3FRCA 1GTIA 1B8XA 2AYTA 2C0DA 3ME8A 3UEMA 3UBKA 1F6MC 5D9WA 1GLQA 4V2LA 4KB3A 1Z9HA 4EE0A 4L5OA 4K8MA 1PX6A 2NPBA 4X4JA 3TKQA 2WFCA 3TRQA 3IC8A 1THOA 3TKSC 2RIIA 1UC7A 1GNWA 2H73A 4IELA 1M2BA 4KGIA 4FIWA 3LWAA 4O5UA 1ERUA 3TKRA 4ZBBA 1WP0A 5GAND 2PBJA 4LMWA 2WS2A 5A1NB 2WRTA 4MH2A 4K7IA 1B9XC 3QFBC 4G10A 3GNJA 2R5GA 3IOSA 1URMA 4I6XA 4AKXB 5KOWA 1GSDA 1DSBA 4MJBA 2OKAA 1SL0B 5ECQB 2IN3A 4E68A 2R6KA 2YZUA 2QGVA 5A1NA 2VLTA 1XWAA 3M3MA 5B8BA 1QQ2A 2QKEA 1XCCA 4OFNA 1XOAA 3C73A 5D93A 3HA9A 3GMFA 3L78A 2WB9A 4FQUA 2ON7A 2KP2A 1B4PA 1XVWA 5HQPA 2QA2A 2FWHA 3F6FA 1U87A 5HR3A 2C0GA 1V98A 2BJXA 2DBCA 2CT6A 4K0NA 4WKWA 4HU9A 5ECSA 2CAQA 1GRXA 4IGJA 5GSSA 4MK3A 5DCGA 1SK2A 3UARA 3E0UA 4N0ZA 4KSMA 3IV4A 3BBYA 2EFEA 5F8BA 2H1DA 3TUEA 2GS3A 3CYNA 1JZWA 1QMVA 4WETA 1XW9A 1F37A 2DIYA 2GTUA 2CZ2A 2YOIA 3QCPA 3P7XA 3VWXA 4K5SA 3TJFA 5A5HA 5B6MA 4MP4A 5CYYA 1W4VA 4TXOA 4K7NA 4POBA 3J7Yb 4L5LA 2KP1A 4OFTA 2H30A 4DSRA 1GSUA 1PGTA 4MMMA 2JZTA 3EE2A 3FZAA 5IOXA 3RAZA 1YKAA 4FH8A 4DSSB 3FR6A 1ON4A 3UMAA 3ZIVA 2LQQA 1EGRA 2N5AA 1M7TA 4WBRD 3DYRA 3Q6OA 2EC4A 2V6OA 1SKRB 3LSZA 5JWRB 2ZCTA 2A4HA 4X0XA 2D2ZA 4QQ7A 5ECOB 3DIEA 2NTOA 3TJBA 1WJKA 2DMMA 3GH6A 5L71A 3HMJG 2A2PA 3EMXA 5B6NA 5E59A 4EXJA 4GLTA 3DGQA 3GYKA 4G2EA 2WCIA 1Z7PA 4XIHA 5IMAA 2NVLA 4MZWA 5FWGA 4XRAA 1YF1A 2B5XA 4MLYA 1Z6NA 5DAKB 3DVWA 4AKIA 1T7PB 2LKUA 4NMUA 4XRDA 3C71A 2VL2C 3LFLA 1SVLA 2C4JA 3TKSE 1XW6A 1TRSA 2LEGA 5C00A 3TKSA 4E8HA 4MF5A 4POKA 5F05A 2GSQA 1ZGNA 2CX4A 4BA7A 2X4AA 2E2GA 3FZ4A 3C7MA 5HR1A 1IYIA 4KDUA 4ZL7A 1K3YA 1LU4A 4TR0A 1R26A 2RUFA 3HZ4A 3HVXA 3EU3A 1GSYA 4K2XA 2GLRA 1M99A 1A8LA 3A5IA 3ZREA 1GP1A 1K0BA 4BPYA 4PQHA 1FB6A 2PUKC 2O5VA 1ZOFA 2HZFA 1I9DA 1G7OA 1EEJA 4K9ZA 4N0VA 3VURA 4ZL8A 3W8SA 3HJPA 3A2WA 2O89A 1DE2A 3L9UA 5BMUB 2E7PA 4LA1A 5D9VA 2VCXA 3D6IA 3I43A 1ST9A 4N10A 3ED3A 5KN0A 5G2ZA 3L0HA 4KDXA 3DKSA 2B7KA 1RK4A 3CMIA 1B4QA 1MD4A 1V40A 2LRNA 5LNKe 1YF0A 2EFCA 2VM1A 4AGSA 4MH3A 1UA5A 1XXUA 1A0RP 4MJEA 5CRGA 2F8AA 1RW1A 3M9KA 2OBKA 2FCHA 1TW9A 4ZXGA 3GX0A 4WBJA 1SVMA 1FG4A 3N9JA 3R3EA 2QC7A 2VD0A 3IHGA 4PNFA 4KSOA 2M80A 1XIYA 2JACA 2L6CA 2H66A 4NHZA 4ULXA 1AC1A 4RQXA 3ZYWA 1FO5A 4KX4A 2HRKB 6GSTA 2IJYA 2J23A 4IP1A 2MBTA 3TKPA 1QUWA 2HYXA 4NPBA 2IMFA 5IPGA 2PN8A 5G30A 3ZVJD 4RQRA 3PINA 3RDWA 3HVVA 2PVOC 5B7CA 3HXSA 2C3QA 3HD5A 4EIQA 1B9YC 2UZ8A 5AISA 3IAS2 5A5KA 2CVDA 1F2EA 1YJ6A 2JU5A 2N5FA 2HRNA 5EY6A 3IRAA 4PURA 1M2AA 3G7IA 2GZYA 1G6WA 3F3RA 2HXKA 1TRUA 4RI6A 1R7HA 5DQSA 1X9WB 4MDCA 2E0QA 3GN3A 2VCWA 3GKMA 3DEXA 1PSQA 4PX1A 2YJHA 2IFQB 4O5QA 4LLRA 1NHYA 4MABA 3EURA 3U5RE 3CXGA 4IBPA 1SD8A 1O85A 2YV9A 2CVBA 1OKTA 4V2MA 2C3NA 5J40A 1NHOA 5A4VA 3H93A 4GQFA 3HVSA 1UVZA 3AY8A 5KEJA 5IMVA 3CRTA 2L57A 1EV4A 4HQZA 1YZXA 3E3EA 2I3YA 5IMDA 2BTOT 1PMTA 2HLSA 2IFQA 3A2VA 2HSHA 3TJGA 3FR9A 5DJLA 2YANA 3KIJA 4TN8A 1Q98A 1EEMA 3TJJA 3G7YA 1Z3EA 4DVCA 4ID0A 2VL2A 4I2TA 5GSTA 3IK7A 1WE0A 3WT1A 4MJAA 5ID2B 3LG6A 2L4CA 5KN1A 3LXZA 1HNBA 4O7HA 3WGEA 1T8EB 1GUKA 4PTSA 4HZ2A 1KBNA 3FW2A 3MDKA 4GCIA 5EVOA 1GUMA 2P5QA 1ZCPA 5ABRA 3GL5A 3MYDA 2GQMA 1TK5B 4EO3A 1GULA 4W66A 4K7OA 5GAPD 1WIKA 2H1GA 2OBIA 4NXIA 3QPMA 1FOVA 4LL1B 2C0FA 1F3BA 2AB6A 1TP9A 2GGTA 2H1AA 3VI7A 4CHSA 3TOTA 2CQ9A 3MAKA 2H1BA 1ZZYA 1X9SB 2CX3A 3F0IA 4KCAA 1SK1A 1XWGA 1YQ1A 2YV7A 2V2GA 3KGKA 4LMVA 5G5EA 4GF0A 4CW9A 3LQ7A 3QR6A 1GL8A 1T3BA 1M9BA 3GKKA 2PU9C 5IMCA 2GZPA 3CSIA 1Q4JA 4FO5A 4GTUA 4G9HA 3VWUA 2YWNA 3QFAC 2VOCA 2GSTA 3VLNA 4USSA 4LL4B 3VWWA 2LNTA 1JZRA 2GT6A 5ECMB 4IW9A 4IHUA 2LS5A 2B6MA 2NBSA 2HSNB 4G0IA 5EPFA 4JE1A 1H4OA 2KOKA 3S9FA 3NIVA 2R0CA 2VL3A 4PUAA 1PKZA 3WT2A 1TU7A 4IKHA 1GUHA 5COHA 1NW2A 2ZNMA 3D4MA 1V9WA 2AHEA 5JCWA 1O81A 4MZBA 4QL7A 2JSYA 3FK8A 2OA7A 3C8EA 3ZMKA 3N5OA 2HQTA 4K0GA 3CSJA 4Q5FA 2HSNA 4A5PA 4K5RA 3GX8A 5IM9A 1AUCA 2PGTA 4AI6A 4EIPA 5IQYA 3F4TA 1EV9A 5J4UA 5J5NA 2X64A 1AXDA 1BF5A 2O8VB 5IMFA 2I9HA 3ZITA 2L5OA 3H79A 2C3TA 4HU7A 4V2NA 2VCVA 4MPFA 2VAFA 2JADA 3UVTA 2MZCA 4OO5A 1V57A 3EVIA 2FNOA 12GSA 1XPVA 2EFDA 1QXHA 4HQSA 4NAXA 3WD6A 2HE3A 1R4WA 3APQA 3DMLA 4TXVA 2AAWA 3MWHA 5DVBA 3MIXA 1DE1A 2A2RA 1GSSA 4ECJA 2JZSA 4AJ7A 4MF7A 5D9TA 3IXRA 2LUSA 1VGLA 4FYBA 3C1SA 2KLXA 5J3RA 1K0OA 2ON5A 4PGTA 1XBSA 3ERGA 4N11A 3GRXA 4I2UA 4V1Ap 2R4VA 3RPNA 2MYGA 5DBQA 2L4QA 5ECLB 4Z2UA 3Q19A 1NSWA 2B5YA 2GQLA 3GA4A 3GV1A 4F9ZA 2X8CA 1XZOA 5HFGA 8GSSA 2LQOA 3KZQA 5BRTA 1EZKA 3ZVJA 3RPPA 1EP7A 3CWGA 3E9JB 1X9MB 3SWLA 1GH2A 1T00A 4GWRA 4DSQA 1YEXA 2C0EA 2XPDA 2H0GA 4NWYA 3F3QA 4TW5A 3HY2A 5D73A 4I8BA 3TDGA 1PL1A 4KA0A 4EDYA 4I97A 3O76A 3LW9A 1FHEA 2LRTA 3APOA 3OR5A 1K0AA 4IQAA 1WRYA 5E4WA 2YJ7A 3WYWA 4OCFA 4MNNA 2CA8A 4CY6A 3KP8A 3EPTA 1MD3A 4ZB8A 1FAAA 4TRXA 4DSSA 1J9BA 3ZRDA 2P0GA 2H6YA 9GSSA 2FA8A 1WMJA 2PERA 5HR2A 5HFKA 2AJQB 4OCEA 4JR4A 3A3TA 1PKWA 1A2MA 2WGRA 1XWBA 3GHAA 2N5BA 4JZQA 2FWEA 2YNXA 2DSAA 3ZZXA 2L5LA 3TOUA 3QOUA 5G31A 3W6GA 1EOHA 1BYEA 1J08A 2V32A 1QK8A 2I1UA 3FHKA 1G6YA 2HI7A 4EC0A 4KAEA 2L6DA 3ZMLA 4MCUA 2HRFA 4DEJA 1DUGA 5EL8A 1ACVA 2QSIA 5ECRB 2P31A 1G7EA 3O3TA 5DAKA 2K18A 3IPZA 2Z9SA 4F82A 1ZYQB 1TTZA 2H71A 4AJ8A 2DMLA 2PMTA 1SJZA 4XS6A 3HDCA 2X8GA 4YAVA 2B3SA 22GSA 4PXOA 3UVHA 1HD2A 2H76A 1O8XA 1TK0B 5IOWA 3LYPA 3TU3B 2H75A 2DJ2A 1SL1B 2AV4A 2FLSA 1ZL9A 3FZ9A 2QA1A 2XBQA 5D96A 3HHVA 1UN2A 3GSTA 4KDYA 5C04A 3L9VA 4OD7A 3M9JA 4G19A 4WF5A 3L4NA 1K3OA 1OE7A 1KTEA 1CQGA 5DALB 5JWQB 3HJOA 2R0PA 4MPGA 2WDUA 3CBUA 1SJ6A 1XOBA 4TVEA 2I81A 1YVLA 3WGXA 5ELAA 2K6VA 4J56E 5BMUA 5IO2A 1SVOA 4L8EA 4L0UA 3FEUA 4RUVA 4E8EA 2REMA 4YKFA 3ME7A 2KUCA 4POMA 2XBIA 2FD3A 1RQMA 4AF2A 2H0HA 3IA1A 4AKHA 3QAVA 1LJRA 1HNAA 1OC9B 1PRXA 2DKIA 1S3AA 1SK0A 3IE3A 4BWSA 1BG1A 1N8JA 4JR6A 2L59A 2H8LA 2A4VA 4NHWA 4QL9A 4YKGA 4BVXB 3EC3A 5AN1A 3F9UA 5KN2A 3VWVA 2H6XA 2OADA 2P5RA 4YQMA 3GKXA 1KNGA 2HRKA 2GVPA 2GSSA 4HDEA 1AQVA 1PX7A 4EF0A 4ZBAA 5B8AA 3UAPA 4G0KA 3FYGA 3KEBA 5A4UA 5J9BA 3KH7A 1FB0A 2K9FA 4AKGA 1EOGA 1PL2A 3F4RA 3EWLA 1T1VA 2X99A 3RHCA 3LORA 3VFIA 3GTUB 4ZIJA 1U3IA 3US3A 7GSSA 3LEFA 1X0RA 6GSYA 3KTLA 3HYPA 4AJ6A 4HI7A 3UOMA 1AQXA 1I5GA 1AAZA 3LJRA 1AQWA 4K6XA 4ILFA 3CTFA 3KD0A 2F51A 4XS1A 3KCMA 3J7Yk 1ZMAA 3UL3A 6GSUA 5D8IA 2HT9A 6GSXA 2F8FA 2H01A 3GTUA 1BAYA 1SJIA 5F0GA 1SU9A 2DKHA 3DXBA 4ZBDA 2HZEB 1EP8A 4ECIA 1FVJA 3M8NA 3TGZA 2VLUA 1S3CA 1JFUA 1O6JA 4WEYA 2C1YA 4QMKA 3IBHA 1O7UA 3CSHA 3TRXA 4HUAA 1GTUA 5ENUA 3D0ZA 2YN1A 2RUEA 2J9HA 3IDVA 2DJ1A 1CQHA 3VPTA 5CREA 5A4WA 4K1FA 4JEDA 3IAM2 2RLIA 3D21A 2E2MA 3G7JA 2VD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4Y A;  2JZR A;  4BWQ A;  4F2I A;  1MDJ A;  1GSQ A;  4YQU A;  4WR4 A;  2IWT A;  4KW6 A;  4GXZ A;  6GSS A;  4OO4 A;  4EVM A;  1OVN A;  3TCO A;  1E6B A;  1Y25 A;  2IME A;  4ML1 A;  4Z7X A;  2ALB A;  4MJC A;  1YY7 A;  2B1L A;  1JHB A;  1MDK A;  3BD2 A;  3R2Q A;  4TR4 A;  2NDO A;  2YPM A;  2GT5 A;  1XW5 A;  5ID2 A;  1GSF A;  3KJY A;  1WPI A;  2B1K A;  3GH9 A;  3RHB A;  3APS A;  5CAX A;  3VPQ A;  5CO3 A;  1M9A A;  2XPE A;  3L9S A;  2IL3 A;  5IO0 A;  5DDL A;  1LBK A;  3GUR A;  3KMO A;  2EIO A;  3BCK A;  1BQ7 A;  4HJ2 A;  2AUV A;  5D9X A;  4O32 A;  2M72 A;  3G9B A;  3QMX A;  4ZB9 A;  2OE3 A;  2RM5 A;  4YQV A;  5DJM A;  4YH2 A;  4GSN A;  4KH7 A;  1R5P A;  4YAP A;  2LV3 A;  2LRC A;  2FA4 A;  2DC5 A;  1U3A A;  4PQ1 A;  4POL A;  5J41 A;  3KH9 A;  2VUP A;  1VRS D;  1M2D A;  3NOF A;  2G2Q A;  1XWC A;  4GQC A;  1GNE A;  2PWJ A;  2H70 A;  5ELG A;  2VL9 A;  2WJU A;  3ZIJ A;  1X5C A;  4Q5R A;  2EIR A;  4KF9 A;  2R37 A;  1V58 A;  4Q5Q A;  1SD9 A;  2HFD A;  1EGO A;  3A2X A;  2MMO A;  1XVQ A;  5CP1 A;  3KXO A;  3I6A A;  2H0I A;  4BL7 B;  2ZUP A;  2VLV A;  5JCU A;  16GS A;  2YWI A;  1BG5 A;  2K8S A;  1T4Z A;  3H4K A;  5G5F A;  3HJM A;  3KP9 A;  6GSV A;  5H5S A;  1OC8 A;  1K0C A;  1YEP A;  1JLV A;  3GIX A;  1XWK A;  1ABA A;  4HEA 2;  3ZLP A;  1ERV A;  1F3A A;  3MSZ A;  3BCI A;  4BL7 A;  1PD2 1;  1GTA A;  17GS A;  2A2S A;  1WWJ A;  2DLX A;  5KN3 A;  3VI5 A;  1THX A;  3DWV A;  1M0U A;  2DIZ A;  4ECC A;  4X43 A;  4X1U A;  4PQI A;  5LD0 A;  2H74 A;  4N30 A;  1FVK A;  2GQK A;  3ZL5 A;  2WZ9 A;  4XCS A;  1FW1 A;  2WUL A;  4HS1 A;  2EIQ A;  3DVX A;  3M1G A;  4FYU A;  4O5R A;  4NV5 A;  2YWO A;  3FY7 A;  1TI3 A;  2DJ3 A;  2YCD A;  1PA3 A;  4Q5N A;  1YKC A;  4XS4 B;  3JCM L;  1MDI A;  4XTS A;  4TXO B;  1Z7R A;  1VF4 A;  3CTG A;  4JRR A;  1BX9 A;  1S3D A;  1TDI A;  10GS A;  5AIX A;  1WOU A;  1SL2 B;  5CRH A;  1EWX A;  1MEK A;  4HOJ A;  2TRC P;  1O8W A;  4XS4 A;  1TJD A;  4IJ3 A;  2FY6 A;  3VK9 A;  3V1W A;  5F06 A;  1X5E A;  5ECI B;  4HJM A;  2V1M A;  3HCZ A;  1N2A A;  1Y6E A;  2YZH A;  1VF2 A;  1JLW A;  4ISD A;  5JCG A;  1OE8 A;  3DD3 A;  5GZZ B;  4HZ4 A;  4EL1 A;  5LCZ A;  1C72 A;  4IVF A;  1OAZ A;  2F9S A;  2FHE A;  4IN0 A;  1Z5Y E;  2X8H A;  1TKD B;  4CDO A;  5AGY A;  1G0T A;  1OYJ A;  2TIR A;  2RM6 A;  13GS A;  3EIN A;  2G0F A;  4IQ1 A;  2VO4 A;  5DCH A;  1AIU A;  3UIW A;  2H6Z A;  2VM2 A;  2IMD A;  1ZYE A;  2DJJ A;  4K2D A;  4KND A;  2MMZ A;  1TOF A;  1QFN A;  4GST A;  19GS A;  3TRP A;  2V41 A;  4ECB A;  1BJX A;  2FGX A;  1A2J A;  3UJ1 A;  1GSE A;  2OE0 A;  3BJ5 A;  4ACS A;  5FT3 A;  3ZFL A;  1SYX A;  5F07 A;  3H1N A;  4WF4 A;  1A0F A;  4J57 E;  4J2F A;  1HNC A;  2I4A A;  5ECP B;  3Q18 A;  1SEN A;  3IK9 A;  4KCE A;  3D22 A;  4O92 A;  5DQY A;  2PPT A;  1K0M A;  1SKW B;  1VF3 A;  3F63 A;  2B5E A;  4PUF C;  1ERT A;  1OC3 A;  3M0F A;  2CAI A;  2H19 A;  1TU8 A;  1DBY A;  4MA9 A;  2YP6 A;  2H72 A;  4F0B A;  1AW9 A;  4MZC A;  1SKS B;  2XC2 A;  3ISO A;  1U6T A;  4WR5 A;  4NV2 A;  3P8W A;  1K0N A;  1ILO A;  3PGT A;  1GWC A;  2FUG 2;  2MMA A;  1ERW A;  4OMV A;  5FHI A;  2VCT A;  3GL3 A;  2IIY A;  3QD9 A;  3KTB A;  4IJI A;  4IS0 A;  1KEB A;  4EKZ A;  1JZO A;  18GS A;  1R5A A;  4H86 A;  2R2J A;  1H75 A;  3IC4 A;  1A8Y A;  2C80 A;  3KMN A;  1J0F A;  2DJK A;  3LXT A;  1GLP A;  4TR1 B;  2HNL A;  1TXX A;  1K0D A;  4TKY A;  5H5Q A;  1E2Y A;  4ML6 A;  3DRN A;  3NZN A;  5DAL A;  2LNS A;  1A2L A;  3PR8 A;  3QDN A;  3EYT A;  3O6T A;  4ZL9 A;  5H5R A;  1TRW A;  3RBT A;  3H8Q A;  2KHP A;  2B7J A;  3F6D A;  2FWG A;  3I69 A;  4I5Q A;  2OE1 A;  4GSS A;  2LTK A;  5JWO B;  1OKD A;  4FYC A;  3LYK A;  2IMI A;  4TR1 A;  2LST A;  2IPA A;  2GDR A;  2VIM A;  4KUN A;  2M46 A;  4ZIL A;  2R3X A;  2XHF A;  5IPH A;  3EMP A;  1TRV A;  2VCQ A;  4D73 B;  3IHQ A;  1IYH A;  1VF1 A;  2VCZ A;  3ZTL A;  3PH9 A;  1GTB A;  1OC9 A;  4PNG A;  3D5J A;  3UBL A;  4XHM A;  3FR3 A;  1A24 A;  3KM6 A;  2HRA A;  4JU5 A;  3HKR A;  3A5W A;  2GSR A;  1JZD A;  4F03 A;  3EU4 A;  4BVX A;  5G1L A;  1HQO A;  2LJR A;  5HFI A;  5J9C A;  4TOP A;  3D4T A;  3PPU A;  4OWY A;  3I9V 2;  4TR3 A;  1USB A;  3TJK A;  4P3Y B;  1NM3 A;  1K3L A;  2HSY A;  1A23 A;  1U88 A;  4D73 A;  3ERF A;  3WGD A;  4MF6 A;  2CVK A;  4BVY B;  3LGC A;  3MNG A;  1PQN A;  4L0W A;  1HYU A;  5ECH B;  2MMN A;  3Q74 A;  3W8J A;  3FKF A;  4KE3 A;  4GRF A;  1MTC A;  4IP6 A;  1QGV A;  1ML6 A;  4EDZ A;  2OAC A;  14GS A;  5CNW A;  2LJA A;  3K8N A;  4V1A g;  2JL4 A;  5IIZ A;  4BVY A;  1O73 A;  4EUY A;  5HR0 A;  1X5D A;  2O85 A;  3HZ8 A;  2PVQ A;  4WXT A;  4JBB A;  1W89 A;  3GKN A;  2CV4 A;  3F4S A;  3QAG A;  5G1K A;  5INY A;  11GS A;  1V2A A;  3ZFB A;  4RI7 A;  3QAW A;  3P90 A;  5IMZ A;  2HSM B;  1F9M A;  3C1R A;  5ECN B;  3GSS A;  5AIV A;  2HZE A;  3BOA A;  1YDK A;  3FZ5 A;  2V6K A;  1BED A;  2MBS A;  1SYR A;  3ERW A;  3GFK A;  5CRD A;  3CRU A;  3SBC A;  2LJK A;  3IR4 A;  1XFL A;  5CRW A;  2IMK A;  2TRX A;  6GSW A;  2CZ3 A;  4G0L A;  3TB2 A;  20GS A;  2BMX A;  3F8U A;  2OJL A;  2O7K A;  2HSM A;  2FWF A;  3U6V A;  1Z6M A;  4F0C A;  1TI1 A;  2DJ0 A;  2O87 A;  2K8V A;  2JSZ A;  1TK8 B;  2YWM A;  1PN9 A;  4OFM A;  2ES7 A;  5ECK B;  2C8U A;  1B48 A;  3GUS A;  2GZZ A;  2F3M A;  3P2A A;  4ZB6 A;  3FRC A;  1GTI A;  1B8X A;  2AYT A;  2C0D A;  3ME8 A;  3UEM A;  3UBK A;  1F6M C;  5D9W A;  1GLQ A;  4V2L A;  4KB3 A;  1Z9H A;  4EE0 A;  4L5O A;  4K8M A;  1PX6 A;  2NPB A;  3TKQ A;  2WFC A;  3TRQ A;  3IC8 A;  1THO A;  3TKS C;  2RII A;  1UC7 A;  1GNW A;  2H73 A;  4IEL A;  1M2B A;  4KGI A;  4FIW A;  3LWA A;  1ERU A;  3TKR A;  4ZBB A;  1WP0 A;  5GAN D;  2PBJ A;  4LMW A;  2WS2 A;  2WRT A;  4MH2 A;  4K7I A;  1B9X C;  3QFB C;  4G10 A;  3GNJ A;  2R5G A;  3IOS A;  1URM A;  4I6X A;  1GSD A;  1DSB A;  4MJB A;  2OKA A;  1SL0 B;  5ECQ B;  2IN3 A;  2R6K A;  2YZU A;  2QGV A;  2VLT A;  1XWA A;  3M3M A;  5B8B A;  1QQ2 A;  2QKE A;  1XCC A;  4OFN A;  1XOA A;  3C73 A;  5D93 A;  3HA9 A;  3GMF A;  3L78 A;  2WB9 A;  4FQU A;  2ON7 A;  2KP2 A;  1B4P A;  1XVW A;  5HQP A;  2FWH A;  3F6F A;  1U87 A;  5HR3 A;  2C0G A;  1V98 A;  2BJX A;  2DBC A;  2CT6 A;  4K0N A;  4WKW A;  4HU9 A;  5ECS A;  2CAQ A;  1GRX A;  4IGJ A;  5GSS A;  4MK3 A;  5DCG A;  1SK2 A;  3UAR A;  3E0U A;  4N0Z A;  4KSM A;  3IV4 A;  3BBY A;  5F8B A;  2H1D A;  3TUE A;  2GS3 A;  3CYN A;  1JZW A;  1QMV A;  4WET A;  1XW9 A;  1F37 A;  2DIY A;  2GTU A;  2CZ2 A;  2YOI A;  3QCP A;  3P7X A;  3VWX A;  3TJF A;  5B6M A;  4MP4 A;  5CYY A;  1W4V A;  4TXO A;  4K7N A;  4POB A;  3J7Y b;  4L5L A;  2KP1 A;  4OFT A;  2H30 A;  4DSR A;  1GSU A;  1PGT A;  4MMM A;  2JZT A;  3EE2 A;  3FZA A;  5IOX A;  3RAZ A;  1YKA A;  4FH8 A;  4DSS B;  3FR6 A;  1ON4 A;  3UMA A;  3ZIV A;  2LQQ A;  1EGR A;  2N5A A;  1M7T A;  4WBR D;  3DYR A;  3Q6O A;  2EC4 A;  2V6O A;  1SKR B;  3LSZ A;  5JWR B;  2ZCT A;  4X0X A;  2D2Z A;  4QQ7 A;  5ECO B;  3DIE A;  2NTO A;  3TJB A;  1WJK A;  2DMM A;  3GH6 A;  5L71 A;  3EMX A;  5B6N A;  5E59 A;  4EXJ A;  4GLT A;  3DGQ A;  3GYK A;  4G2E A;  2WCI A;  1Z7P A;  4XIH A;  5IMA A;  2NVL A;  4MZW A;  5FWG A;  4XRA A;  1YF1 A;  2B5X A;  4MLY A;  1Z6N A;  5DAK B;  3DVW A;  1T7P B;  2LKU A;  4NMU A;  4XRD A;  3C71 A;  2VL2 C;  3LFL A;  2C4J A;  3TKS E;  1XW6 A;  1TRS A;  2LEG A;  5C00 A;  3TKS A;  4E8H A;  4MF5 A;  4POK A;  5F05 A;  2GSQ A;  1ZGN A;  2CX4 A;  4BA7 A;  2E2G A;  3FZ4 A;  3C7M A;  5HR1 A;  1IYI A;  4KDU A;  4ZL7 A;  1K3Y A;  1LU4 A;  4TR0 A;  1R26 A;  2RUF A;  3HZ4 A;  3HVX A;  3EU3 A;  1GSY A;  2GLR A;  1M99 A;  1A8L A;  3ZRE A;  1GP1 A;  1K0B A;  4BPY A;  4PQH A;  1FB6 A;  2PUK C;  1ZOF A;  2HZF A;  1I9D A;  1G7O A;  1EEJ A;  4K9Z A;  4N0V A;  3VUR A;  4ZL8 A;  3W8S A;  3HJP A;  3A2W A;  2O89 A;  1DE2 A;  3L9U A;  4LA1 A;  2E7P A;  5D9V A;  2VCX A;  3D6I A;  3I43 A;  1ST9 A;  4N10 A;  3ED3 A;  5KN0 A;  5G2Z A;  3L0H A;  4KDX A;  3DKS A;  2B7K A;  1RK4 A;  3CMI A;  1B4Q A;  1MD4 A;  1V40 A;  2LRN A;  5LNK e;  1YF0 A;  2VM1 A;  4AGS A;  4MH3 A;  1UA5 A;  1XXU A;  1A0R P;  4MJE A;  5CRG A;  2F8A A;  1RW1 A;  3M9K A;  2OBK A;  2FCH A;  1TW9 A;  4ZXG A;  3GX0 A;  4WBJ A;  1FG4 A;  3N9J A;  3R3E A;  2QC7 A;  2VD0 A;  4PNF A;  4KSO A;  2M80 A;  1XIY A;  2JAC A;  2L6C A;  2H66 A;  4NHZ A;  4ULX A;  1AC1 A;  4RQX A;  3ZYW A;  1FO5 A;  4KX4 A;  2HRK B;  6GST A;  2IJY A;  2J23 A;  4IP1 A;  2MBT A;  3TKP A;  1QUW A;  2HYX A;  4NPB A;  2IMF A;  5IPG A;  2PN8 A;  5G30 A;  3ZVJ D;  4RQR A;  3PIN A;  3RDW A;  3HVV A;  2PVO C;  5B7C A;  3HXS A;  2C3Q A;  3HD5 A;  1B9Y C;  2UZ8 A;  5AIS A;  3IAS 2;  5A5K A;  2CVD A;  1F2E A;  1YJ6 A;  2JU5 A;  2N5F A;  2HRN A;  5EY6 A;  3IRA A;  4PUR A;  1M2A A;  3G7I A;  2GZY A;  1G6W A;  3F3R A;  2HXK A;  1TRU A;  4RI6 A;  1R7H A;  5DQS A;  1X9W B;  4MDC A;  2E0Q A;  3GN3 A;  2VCW A;  3GKM A;  3DEX A;  1PSQ A;  4PX1 A;  2YJH A;  2IFQ B;  4LLR A;  1NHY A;  4MAB A;  3EUR A;  3U5R E;  3CXG A;  4IBP A;  1SD8 A;  1O85 A;  2YV9 A;  2CVB A;  1OKT A;  4V2M A;  2C3N A;  1NHO A;  5A4V A;  3H93 A;  4GQF A;  3HVS A;  1UVZ A;  3AY8 A;  5KEJ A;  5IMV A;  3CRT A;  2L57 A;  1EV4 A;  4HQZ A;  1YZX A;  3E3E A;  2I3Y A;  5IMD A;  2BTO T;  1PMT A;  2HLS A;  2IFQ A;  3A2V A;  2HSH A;  3TJG A;  3FR9 A;  5DJL A;  2YAN A;  3KIJ A;  4TN8 A;  1Q98 A;  1EEM A;  3TJJ A;  3G7Y A;  1Z3E A;  4DVC A;  4ID0 A;  2VL2 A;  4I2T A;  5GST A;  3IK7 A;  1WE0 A;  3WT1 A;  4MJA A;  5ID2 B;  3LG6 A;  2L4C A;  5KN1 A;  3LXZ A;  1HNB A;  4O7H A;  3WGE A;  1T8E B;  1GUK A;  4PTS A;  4HZ2 A;  1KBN A;  3FW2 A;  3MDK A;  4GCI A;  5EVO A;  1GUM A;  2P5Q A;  1ZCP A;  5ABR A;  3GL5 A;  1TK5 B;  2GQM A;  4EO3 A;  1GUL A;  4K7O A;  5GAP D;  1WIK A;  2H1G A;  2OBI A;  4NXI A;  3QPM A;  1FOV A;  4LL1 B;  2C0F A;  1F3B A;  2AB6 A;  1TP9 A;  2GGT A;  2H1A A;  3VI7 A;  4CHS A;  3TOT A;  2CQ9 A;  3MAK A;  2H1B A;  1ZZY A;  1X9S B;  2CX3 A;  3F0I A;  4KCA A;  1SK1 A;  1XWG A;  1YQ1 A;  2YV7 A;  2V2G A;  3KGK A;  4LMV A;  5G5E A;  4GF0 A;  4CW9 A;  3LQ7 A;  3QR6 A;  1GL8 A;  1T3B A;  1M9B A;  3GKK A;  2PU9 C;  5IMC A;  2GZP A;  3CSI A;  1Q4J A;  4FO5 A;  4GTU A;  4G9H A;  3VWU A;  2YWN A;  3QFA C;  2VOC A;  2GST A;  3VLN A;  4USS A;  4LL4 B;  3VWW A;  2LNT A;  1JZR A;  2GT6 A;  5ECM B;  4IW9 A;  4IHU A;  2LS5 A;  2B6M A;  2NBS A;  2HSN B;  4G0I A;  5EPF A;  4JE1 A;  1H4O A;  2KOK A;  3S9F A;  3NIV A;  2VL3 A;  4PUA A;  1PKZ A;  3WT2 A;  1TU7 A;  4IKH A;  1GUH A;  5COH A;  1NW2 A;  2ZNM A;  3D4M A;  1V9W A;  2AHE A;  5JCW A;  1O81 A;  4MZB A;  4QL7 A;  2JSY A;  3FK8 A;  2OA7 A;  3C8E A;  3ZMK A;  3N5O A;  2HQT A;  4K0G A;  3CSJ A;  4Q5F A;  5IM9 A;  3GX8 A;  1AUC A;  2PGT A;  5IQY A;  3F4T A;  1EV9 A;  5J4U A;  5J5N A;  2X64 A;  1AXD A;  2O8V B;  5IMF A;  2I9H A;  3ZIT A;  2L5O A;  3H79 A;  2C3T A;  4HU7 A;  4V2N A;  2VCV A;  4MPF A;  2VAF A;  2JAD A;  3UVT A;  2MZC A;  4OO5 A;  1V57 A;  3EVI A;  2FNO A;  12GS A;  1XPV A;  1QXH A;  4HQS A;  4NAX A;  3WD6 A;  2HE3 A;  1R4W A;  3APQ A;  3DML A;  4TXV A;  2AAW A;  3MWH A;  5DVB A;  1DE1 A;  2A2R A;  1GSS A;  4ECJ A;  2JZS A;  4AJ7 A;  4MF7 A;  5D9T A;  3IXR A;  2LUS A;  1VGL A;  4FYB A;  3C1S A;  2KLX A;  5J3R A;  1K0O A;  2ON5 A;  4PGT A;  1XBS A;  3ERG A;  4N11 A;  3GRX A;  4I2U A;  4V1A p;  2R4V A;  3RPN A;  2MYG A;  5DBQ A;  2L4Q A;  5ECL B;  3Q19 A;  1NSW A;  2B5Y A;  2GQL A;  3GA4 A;  3GV1 A;  4F9Z A;  2X8C A;  1XZO A;  5HFG A;  8GSS A;  2LQO A;  3KZQ A;  1EZK A;  3ZVJ A;  3RPP A;  1EP7 A;  3E9J B;  1X9M B;  3SWL A;  1GH2 A;  1T00 A;  4GWR A;  4DSQ A;  1YEX A;  2C0E A;  2XPD A;  2H0G A;  4NWY A;  3F3Q A;  4TW5 A;  3HY2 A;  5D73 A;  4I8B A;  3TDG A;  1PL1 A;  4KA0 A;  4EDY A;  4I97 A;  3O76 A;  1FHE A;  2LRT A;  3APO A;  3OR5 A;  1K0A A;  4IQA A;  1WRY A;  5E4W A;  2YJ7 A;  3WYW A;  4OCF A;  2CA8 A;  3KP8 A;  1MD3 A;  4ZB8 A;  1FAA A;  4TRX A;  4DSS A;  1J9B A;  3ZRD A;  2P0G A;  2H6Y A;  9GSS A;  2FA8 A;  1WMJ A;  2PER A;  5HR2 A;  5HFK A;  2AJQ B;  4OCE A;  4JR4 A;  3A3T A;  1PKW A;  1A2M A;  2WGR A;  1XWB A;  3GHA A;  2N5B A;  4JZQ A;  2FWE A;  2YNX A;  2DSA A;  3ZZX A;  2L5L A;  3TOU A;  3QOU A;  5G31 A;  3W6G A;  1EOH A;  1BYE A;  1J08 A;  2V32 A;  1QK8 A;  2I1U A;  3FHK A;  1G6Y A;  2HI7 A;  4EC0 A;  4KAE A;  2L6D A;  3ZML A;  4MCU A;  2HRF A;  4DEJ A;  1DUG A;  5EL8 A;  1ACV A;  2QSI A;  5ECR B;  2P31 A;  1G7E A;  3O3T A;  5DAK A;  2K18 A;  3IPZ A;  2Z9S A;  4F82 A;  1ZYQ B;  1TTZ A;  2H71 A;  4AJ8 A;  2DML A;  2PMT A;  1SJZ A;  4XS6 A;  3HDC A;  2X8G A;  4YAV A;  2B3S A;  22GS A;  4PXO A;  3UVH A;  1HD2 A;  2H76 A;  1O8X A;  1TK0 B;  5IOW A;  3LYP A;  2H75 A;  2DJ2 A;  1SL1 B;  2AV4 A;  2FLS A;  1ZL9 A;  3FZ9 A;  2XBQ A;  5D96 A;  3HHV A;  1UN2 A;  3GST A;  4KDY A;  5C04 A;  3L9V A;  4OD7 A;  3M9J A;  4G19 A;  4WF5 A;  3L4N A;  1K3O A;  1OE7 A;  1KTE A;  1CQG A;  5DAL B;  5JWQ B;  3HJO A;  4MPG A;  2WDU A;  3CBU A;  1SJ6 A;  1XOB A;  4TVE A;  2I81 A;  3WGX A;  5ELA A;  2K6V A;  4J56 E;  5BMU A;  5IO2 A;  4L8E A;  4L0U A;  3FEU A;  4RUV A;  4E8E A;  2REM A;  3ME7 A;  2KUC A;  4POM A;  2XBI A;  2FD3 A;  1RQM A;  4AF2 A;  2H0H A;  3IA1 A;  3QAV A;  1LJR A;  1HNA A;  1OC9 B;  1PRX A;  1S3A A;  1SK0 A;  3IE3 A;  4BWS A;  1N8J A;  4JR6 A;  2L59 A;  2H8L A;  2A4V A;  4NHW A;  4QL9 A;  4BVX B;  3EC3 A;  5AN1 A;  3F9U A;  5KN2 A;  3VWV A;  2H6X A;  2OAD A;  2P5R A;  4YQM A;  3GKX A;  1KNG A;  2HRK A;  2GVP A;  2GSS A;  4HDE A;  1AQV A;  1PX7 A;  4EF0 A;  4ZBA A;  5B8A A;  3UAP A;  4G0K A;  3FYG A;  3KEB A;  5A4U A;  5J9B A;  3KH7 A;  1FB0 A;  2K9F A;  1EOG A;  1PL2 A;  3F4R A;  3EWL A;  1T1V A;  2X99 A;  3RHC A;  3LOR A;  3VFI A;  3GTU B;  4ZIJ A;  1U3I A;  3US3 A;  7GSS A;  3LEF A;  1X0R A;  6GSY A;  3KTL A;  3HYP A;  4AJ6 A;  4HI7 A;  3UOM A;  1AQX A;  1I5G A;  1AAZ A;  3LJR A;  1AQW A;  4K6X A;  4ILF A;  3CTF A;  3KD0 A;  2F51 A;  4XS1 A;  3KCM A;  3J7Y k;  1ZMA A;  3UL3 A;  6GSU A;  5D8I A;  2HT9 A;  6GSX A;  2F8F A;  2H01 A;  3GTU A;  1BAY A;  1SJI A;  5F0G A;  1SU9 A;  3DXB A;  4ZBD A;  2HZE B;  1EP8 A;  4ECI A;  1FVJ A;  3M8N A;  3TGZ A;  2VLU A;  1S3C A;  1JFU A;  1O6J A;  4WEY A;  2C1Y A;  3IBH A;  1O7U A;  3CSH A;  3TRX A;  4HUA A;  1GTU A;  5ENU A;  3D0Z A;  2YN1 A;  2RUE A;  2J9H A;  3IDV A;  2DJ1 A;  1CQH A;  3VPT A;  5CRE A;  5A4W A;  4K1F A;  4JED A;  3IAM 2;  2RLI A;  3D21 A;  2E2M A;  3G7J A;  2VD1 A; 
#chains in the Genus database with same CATH topology
 1T4Y A;  2JZR A;  4BWQ A;  4F2I A;  1MDJ A;  1GSQ A;  4YQU A;  4WR4 A;  2IWT A;  4KW6 A;  4GXZ A;  6GSS A;  4OO4 A;  4EVM A;  1OVN A;  3TCO A;  1E6B A;  1Y25 A;  2IME A;  4ML1 A;  4Z7X A;  2ALB A;  4MJC A;  1YY7 A;  2B1L A;  1JHB A;  1MDK A;  3BD2 A;  3R2Q A;  4TR4 A;  2NDO A;  2YPM A;  2GT5 A;  1XW5 A;  5ID2 A;  1GSF A;  3KJY A;  1WPI A;  2B1K A;  3GH9 A;  3RHB A;  3APS A;  5CAX A;  3VPQ A;  5CO3 A;  1M9A A;  4Z2R A;  2XPE A;  3L9S A;  2IL3 A;  2OT3 A;  5IO0 A;  5DDL A;  1LBK A;  2WVX B;  3GUR A;  3KMO A;  2EIO A;  3BCK A;  2UV8 G;  1BQ7 A;  4HJ2 A;  2AUV A;  5D9X A;  4O32 A;  2M72 A;  3G9B A;  3QMX A;  4ZB9 A;  2OE3 A;  2RM5 A;  4YQV A;  5DJM A;  4YH2 A;  4GSN A;  4KH7 A;  1R5P A;  4YAP A;  2LV3 A;  4PI2 C;  2LRC A;  2FA4 A;  2DC5 A;  1U3A A;  4PQ1 A;  4POL A;  5J41 A;  3KH9 A;  2VUP A;  1VRS D;  1M2D A;  3NOF A;  2G2Q A;  1XWC A;  4GQC A;  1GNE A;  2PWJ A;  2H70 A;  5ELG A;  2VL9 A;  2WJU A;  3ZIJ A;  1X5C A;  4Q5R A;  2EIR A;  4KF9 A;  2R37 A;  1V58 A;  4Q5Q A;  1SD9 A;  2HFD A;  1EGO A;  3A2X A;  2MMO A;  1XVQ A;  5CP1 A;  3KXO A;  3I6A A;  2H0I A;  4BL7 B;  2ZUP A;  2VLV A;  5JCU A;  16GS A;  2YWI A;  2VKZ G;  1BG5 A;  2K8S A;  1T4Z A;  3H4K A;  5G5F A;  3HJM A;  3KP9 A;  6GSV A;  5H5S A;  1OC8 A;  1K0C A;  1YEP A;  1JLV A;  3GIX A;  1XWK A;  1ABA A;  4HEA 2;  3ZLP A;  1ERV A;  1F3A A;  3MSZ A;  3BCI A;  4BL7 A;  1PD2 1;  1XG8 A;  1GTA A;  17GS A;  2A2S A;  1WWJ A;  2DLX A;  5KN3 A;  3VI5 A;  1THX A;  3DWV A;  1M0U A;  2DIZ A;  4ECC A;  4X43 A;  4X1U A;  4PQI A;  5LD0 A;  2H74 A;  4N30 A;  1FVK A;  2GQK A;  3ZL5 A;  2WZ9 A;  4XCS A;  1FW1 A;  2WUL A;  4HS1 A;  2EIQ A;  3DVX A;  3M1G A;  4FYU A;  4O5R A;  4NV5 A;  2YWO A;  3FY7 A;  2WW3 A;  1TI3 A;  2DJ3 A;  5A5H B;  2YCD A;  1PA3 A;  4Q5N A;  1YKC A;  4XS4 B;  3JCM L;  1MDI A;  4XTS A;  4TXO B;  1Z7R A;  1VF4 A;  3CTG A;  4JRR A;  1BX9 A;  1S3D A;  1TDI A;  10GS A;  4ICY A;  2EFH A;  5AIX A;  1WOU A;  1SL2 B;  5CRH A;  1EWX A;  1MEK A;  4HOJ A;  2TRC P;  1O8W A;  4XS4 A;  1TJD A;  4IJ3 A;  2FY6 A;  3VK9 A;  3V1W A;  5F06 A;  1X5E A;  5ECI B;  4HJM A;  2V1M A;  3HCZ A;  1N2A A;  1Y6E A;  2YZH A;  1VF2 A;  1JLW A;  4ISD A;  5JCG A;  1OE8 A;  3DD3 A;  5GZZ B;  4HZ4 A;  4EL1 A;  5LCZ A;  1C72 A;  4IVF A;  1OAZ A;  2F9S A;  2FHE A;  4IN0 A;  1Z5Y E;  2X8H A;  1TKD B;  4CDO A;  5AGY A;  1G0T A;  1OYJ A;  2TIR A;  2RM6 A;  13GS A;  3EIN A;  2G0F A;  4IQ1 A;  2VO4 A;  5DCH A;  1AIU A;  3UIW A;  2H6Z A;  2VM2 A;  2IMD A;  1ZYE A;  2DJJ A;  4K2D A;  4KND A;  2MMZ A;  5A34 B;  1FOH A;  1TOF A;  1QFN A;  4GST A;  19GS A;  3TRP A;  2V41 A;  4ECB A;  1BJX A;  2FGX A;  1A2J A;  4N3Z A;  3UJ1 A;  1GSE A;  2OE0 A;  3BJ5 A;  4ACS A;  5FT3 A;  3ZFL A;  1SYX A;  5F07 A;  3H1N A;  4WF4 A;  1A0F A;  4J57 E;  4J2F A;  1HNC A;  2I4A A;  5ECP B;  5A34 A;  3Q18 A;  1SEN A;  3IK9 A;  4KCE A;  3D22 A;  4O92 A;  5DQY A;  4CY8 A;  2PPT A;  1K0M A;  2R0G A;  1SKW B;  1VF3 A;  3F63 A;  2B5E A;  4PUF C;  1ERT A;  1OC3 A;  3M0F A;  2CAI A;  2H19 A;  1TU8 A;  1DBY A;  4MA9 A;  5J4V A;  1PN0 A;  2YP6 A;  2H72 A;  4F0B A;  1AW9 A;  4MZC A;  1SKS B;  2XC2 A;  3ISO A;  1U6T A;  4WR5 A;  4NV2 A;  3P8W A;  1K0N A;  1ILO A;  3PGT A;  1GWC A;  2FUG 2;  2MMA A;  1ERW A;  4OMV A;  4ZB7 A;  5FHI A;  2VCT A;  3GL3 A;  2IIY A;  3QD9 A;  3KTB A;  4IJI A;  4IS0 A;  1KEB A;  3FMW A;  4EKZ A;  1JZO A;  18GS A;  1R5A A;  4H86 A;  2R2J A;  1H75 A;  3IC4 A;  1A8Y A;  2C80 A;  3KMN A;  1J0F A;  2DJK A;  3LXT A;  1GLP A;  4TR1 B;  2HNL A;  5J4Y A;  1ZYP A;  1TXX A;  1K0D A;  3CQF A;  4TKY A;  3RFR C;  5H5Q A;  1E2Y A;  4ML6 A;  3DRN A;  3NZN A;  5DAL A;  1M3I A;  4PHZ C;  2LNS A;  1A2L A;  3PR8 A;  3QDN A;  3EYT A;  3O6T A;  4ZL9 A;  5H5R A;  1TRW A;  3RBT A;  3H8Q A;  2KHP A;  2B7J A;  3F6D A;  2FWG A;  3I69 A;  4I5Q A;  2OE1 A;  4GSS A;  2LTK A;  5JWO B;  1OKD A;  4FYC A;  3LYK A;  2IMI A;  4TR1 A;  2LST A;  2IPA A;  2GDR A;  2VIM A;  4KUN A;  2H1L A;  2M46 A;  4ZIL A;  2R3X A;  2XHF A;  5IPH A;  5J47 A;  3EMP A;  1TRV A;  2VCQ A;  4D73 B;  3IHQ A;  5KOX A;  1IYH A;  1VF1 A;  2VCZ A;  3ZTL A;  3PH9 A;  1GTB A;  1OC9 A;  4PNG A;  3RGB C;  3D5J A;  3UBL A;  4XHM A;  3FR3 A;  1A24 A;  1Y1U A;  3KM6 A;  2HRA A;  4JU5 A;  3HKR A;  3A5W A;  2GSR A;  1JZD A;  4F03 A;  3EU4 A;  4BVX A;  5G1L A;  4Z2T A;  1HQO A;  2LJR A;  5HFI A;  5J9C A;  4TOP A;  3D4T A;  3PPU A;  4OWY A;  3I9V 2;  4TR3 A;  1USB A;  3TJK A;  4P3Y B;  1NM3 A;  1K3L A;  2HSY A;  1A23 A;  2WVY A;  1U88 A;  4D73 A;  3ERF A;  3WGD A;  4MF6 A;  2CVK A;  4BVY B;  3LGC A;  3MNG A;  1PQN A;  4L0W A;  1HYU A;  5ECH B;  2MMN A;  3Q74 A;  3W8J A;  3FKF A;  4KE3 A;  4GRF A;  1MTC A;  4GDF A;  4IP6 A;  1QGV A;  1ML6 A;  4EDZ A;  2OAC A;  14GS A;  5CNW A;  2LJA A;  3K8N A;  4V1A g;  2JL4 A;  1N25 A;  5IIZ A;  4BVY A;  1O73 A;  4EUY A;  5HR0 A;  1TXU A;  1X5D A;  2O85 A;  1ZYN A;  3HZ8 A;  2PVQ A;  4WXT A;  4JBB A;  1W89 A;  3GKN A;  2CV4 A;  3F4S A;  3QAG A;  5G1K A;  5INY A;  11GS A;  1V2A A;  3ZFB A;  4RI7 A;  3QAW A;  4G01 A;  3P90 A;  5IMZ A;  2HSM B;  2X49 A;  1F9M A;  3C1R A;  5ECN B;  3GSS A;  5AIV A;  2HZE A;  3BOA A;  1YDK A;  3FZ5 A;  2V6K A;  1BED A;  2MBS A;  1SYR A;  3ERW A;  3GFK A;  5CRD A;  3CRU A;  3SBC A;  2LJK A;  3IR4 A;  1XFL A;  5CRW A;  2IMK A;  2TRX A;  6GSW A;  2CZ3 A;  4G0L A;  3TB2 A;  20GS A;  2BMX A;  3F8U A;  2OJL A;  2O7K A;  2HSM A;  2FWF A;  3U6V A;  1Z6M A;  4F0C A;  1TI1 A;  2DJ0 A;  2O87 A;  2K8V A;  2JSZ A;  1TK8 B;  2YWM A;  1PN9 A;  4OFM A;  2ES7 A;  3HVN A;  5ECK B;  2C8U A;  1B48 A;  3GUS A;  2GZZ A;  2F3M A;  3P2A A;  4ZB6 A;  3FRC A;  1GTI A;  1B8X A;  2AYT A;  2C0D A;  3ME8 A;  3UEM A;  3UBK A;  1F6M C;  5D9W A;  1GLQ A;  4V2L A;  4KB3 A;  1Z9H A;  4EE0 A;  4L5O A;  4K8M A;  1PX6 A;  2NPB A;  4X4J A;  3TKQ A;  2WFC A;  2WZS A;  3TRQ A;  3IC8 A;  1THO A;  3TKS C;  2WVX A;  2RII A;  1UC7 A;  1GNW A;  2H73 A;  4IEL A;  1M2B A;  4KGI A;  4FIW A;  3LWA A;  4O5U A;  1ERU A;  3TKR A;  4ZBB A;  1WP0 A;  5GAN D;  2PBJ A;  4LMW A;  2WS2 A;  5A1N B;  2WRT A;  4MH2 A;  4K7I A;  1B9X C;  3QFB C;  4G10 A;  3GNJ A;  2R5G A;  3IOS A;  1URM A;  4I6X A;  4AKX B;  5KOW A;  1GSD A;  1DSB A;  4MJB A;  2OKA A;  1SL0 B;  5ECQ B;  2IN3 A;  4E68 A;  2R6K A;  2YZU A;  2QGV A;  5A1N A;  2VLT A;  1XWA A;  3M3M A;  5B8B A;  1QQ2 A;  2QKE A;  1XCC A;  4OFN A;  1XOA A;  3C73 A;  5D93 A;  3HA9 A;  3GMF A;  3L78 A;  2WB9 A;  4FQU A;  2ON7 A;  2WW2 A;  2KP2 A;  1B4P A;  1XVW A;  5HQP A;  2QA2 A;  2FWH A;  3F6F A;  1U87 A;  5HR3 A;  2C0G A;  1V98 A;  2BJX A;  2DBC A;  2CT6 A;  2WW1 A;  4K0N A;  4WKW A;  4HU9 A;  5ECS A;  2CAQ A;  1GRX A;  4IGJ A;  5GSS A;  4MK3 A;  5DCG A;  1SK2 A;  3UAR A;  3E0U A;  4N0Z A;  4KSM A;  3IV4 A;  3BBY A;  2EFE A;  5F8B A;  2H1D A;  3TUE A;  2GS3 A;  3CYN A;  1JZW A;  1QMV A;  4WET A;  1XW9 A;  1F37 A;  2DIY A;  2GTU A;  2CZ2 A;  2YOI A;  3QCP A;  3P7X A;  3VWX A;  4K5S A;  3TJF A;  5A5H A;  5B6M A;  4MP4 A;  5CYY A;  1W4V A;  4TXO A;  4K7N A;  4POB A;  3J7Y b;  4L5L A;  2KP1 A;  4OFT A;  2H30 A;  4DSR A;  1GSU A;  1PGT A;  4MMM A;  2JZT A;  3EE2 A;  3FZA A;  5IOX A;  3RAZ A;  1YKA A;  4FH8 A;  4DSS B;  3FR6 A;  1ON4 A;  3UMA A;  3ZIV A;  2LQQ A;  1EGR A;  2N5A A;  1M7T A;  4WBR D;  3DYR A;  3Q6O A;  2EC4 A;  2V6O A;  1SKR B;  3LSZ A;  5JWR B;  2ZCT A;  2A4H A;  4X0X A;  2D2Z A;  4QQ7 A;  5ECO B;  3DIE A;  2NTO A;  3TJB A;  1WJK A;  2DMM A;  3GH6 A;  5L71 A;  3HMJ G;  2A2P A;  3EMX A;  5B6N A;  5E59 A;  4EXJ A;  4GLT A;  3DGQ A;  3GYK A;  4G2E A;  2WCI A;  1Z7P A;  4XIH A;  5IMA A;  2NVL A;  4MZW A;  5FWG A;  4XRA A;  1YF1 A;  2B5X A;  4MLY A;  1Z6N A;  5DAK B;  3DVW A;  4AKI A;  4HSC X;  1T7P B;  2LKU A;  4NMU A;  4XRD A;  3C71 A;  4FXY P;  2VL2 C;  3LFL A;  1SVL A;  2C4J A;  3TKS E;  1XW6 A;  1TRS A;  2LEG A;  5C00 A;  3TKS A;  4E8H A;  4MF5 A;  4POK A;  5F05 A;  2GSQ A;  1ZGN A;  2CX4 A;  4BA7 A;  2X4A A;  2E2G A;  3FZ4 A;  3C7M A;  5HR1 A;  1IYI A;  4KDU A;  4ZL7 A;  1K3Y A;  1LU4 A;  4TR0 A;  1R26 A;  2RUF A;  3HZ4 A;  3HVX A;  3EU3 A;  1GSY A;  4K2X A;  2GLR A;  1M99 A;  1A8L A;  3A5I A;  3ZRE A;  1GP1 A;  1K0B A;  4BPY A;  4PQH A;  1FB6 A;  2PUK C;  2O5V A;  1ZOF A;  2HZF A;  1I9D A;  1G7O A;  1EEJ A;  4K9Z A;  4N0V A;  3VUR A;  4ZL8 A;  3W8S A;  3HJP A;  3A2W A;  2O89 A;  1DE2 A;  3L9U A;  5BMU B;  2E7P A;  4LA1 A;  5D9V A;  2VCX A;  3D6I A;  3I43 A;  1ST9 A;  2O3E A;  4N10 A;  3ED3 A;  5KN0 A;  5G2Z A;  3L0H A;  4KDX A;  3DKS A;  2B7K A;  1RK4 A;  3CMI A;  1B4Q A;  1MD4 A;  1V40 A;  2LRN A;  5LNK e;  1YF0 A;  2EFC A;  2VM1 A;  4AGS A;  4MH3 A;  1UA5 A;  1XXU A;  1A0R P;  4MJE A;  5CRG A;  2F8A A;  1RW1 A;  3M9K A;  2OBK A;  2FCH A;  1TW9 A;  4ZXG A;  3GX0 A;  4WBJ A;  4PI0 C;  1SVM A;  1FG4 A;  3N9J A;  3R3E A;  2QC7 A;  2VD0 A;  3IHG A;  4PNF A;  4KSO A;  2M80 A;  1XIY A;  2JAC A;  2L6C A;  2H66 A;  4NHZ A;  4ULX A;  1AC1 A;  4RQX A;  3ZYW A;  1FO5 A;  4KX4 A;  2HRK B;  6GST A;  2IJY A;  2J23 A;  4IP1 A;  2MBT A;  3TKP A;  1QUW A;  2HYX A;  4NPB A;  2IMF A;  5IPG A;  2PN8 A;  5G30 A;  3ZVJ D;  4RQR A;  2O36 A;  3PIN A;  3RDW A;  3HVV A;  2PVO C;  5B7C A;  3HXS A;  2C3Q A;  3HD5 A;  4EIQ A;  1B9Y C;  2UZ8 A;  5AIS A;  3IAS 2;  5A5K A;  2CVD A;  1F2E A;  1YJ6 A;  2JU5 A;  2N5F A;  2HRN A;  5EY6 A;  3IRA A;  4PUR A;  1M2A A;  3G7I A;  2GZY A;  1G6W A;  3F3R A;  2HXK A;  1TRU A;  4RI6 A;  1R7H A;  5DQS A;  1X9W B;  4MDC A;  2E0Q A;  3GN3 A;  2VCW A;  3GKM A;  3DEX A;  1PSQ A;  4PX1 A;  2YJH A;  2IFQ B;  4O5Q A;  4LLR A;  1NHY A;  4MAB A;  3EUR A;  3U5R E;  3CXG A;  4IBP A;  1SD8 A;  1O85 A;  4BIK A;  2YV9 A;  2CVB A;  1OKT A;  4V2M A;  2C3N A;  5J40 A;  1NHO A;  5A4V A;  3H93 A;  4GQF A;  3HVS A;  1UVZ A;  3AY8 A;  5KEJ A;  5IMV A;  3CRT A;  2L57 A;  1EV4 A;  4HQZ A;  1YZX A;  3E3E A;  2I3Y A;  5IMD A;  2BTO T;  1PMT A;  2HLS A;  2IFQ A;  3A2V A;  2HSH A;  3TJG A;  3FR9 A;  5DJL A;  2YAN A;  3KIJ A;  1YEW C;  4TN8 A;  1Q98 A;  1EEM A;  3TJJ A;  3G7Y A;  1Z3E A;  4DVC A;  4ID0 A;  2VL2 A;  4I2T A;  5GST A;  3IK7 A;  1WE0 A;  3WT1 A;  4MJA A;  5ID2 B;  3LG6 A;  2L4C A;  5KN1 A;  3LXZ A;  1HNB A;  4O7H A;  3WGE A;  1T8E B;  1GUK A;  4PTS A;  4HZ2 A;  1KBN A;  3FW2 A;  3MDK A;  4GCI A;  5EVO A;  1GUM A;  2P5Q A;  1ZCP A;  5ABR A;  3GL5 A;  3MYD A;  2GQM A;  1TK5 B;  4EO3 A;  1GUL A;  4W66 A;  4K7O A;  5GAP D;  1WIK A;  2H1G A;  2OBI A;  4NXI A;  3QPM A;  1FOV A;  4LL1 B;  2C0F A;  1F3B A;  2AB6 A;  1TP9 A;  2GGT A;  2H1A A;  3VI7 A;  4CHS A;  3TOT A;  2CQ9 A;  3MAK A;  2H1B A;  1ZZY A;  1X9S B;  2CX3 A;  3F0I A;  4KCA A;  1SK1 A;  1XWG A;  1YQ1 A;  2YV7 A;  1I1I P;  2V2G A;  3KGK A;  4LMV A;  5G5E A;  4GF0 A;  4CW9 A;  3LQ7 A;  3QR6 A;  1GL8 A;  1T3B A;  1M9B A;  3GKK A;  2PU9 C;  5IMC A;  2GZP A;  3CSI A;  1Q4J A;  4FO5 A;  4GTU A;  4G9H A;  3VWU A;  2YWN A;  3QFA C;  2VOC A;  2GST A;  3VLN A;  4USS A;  4LL4 B;  3VWW A;  2LNT A;  1JZR A;  2GT6 A;  5ECM B;  4IW9 A;  4IHU A;  2LS5 A;  2B6M A;  2NBS A;  2HSN B;  4G0I A;  5EPF A;  4JE1 A;  1H4O A;  2KOK A;  3S9F A;  3NIV A;  2R0C A;  2VL3 A;  4PUA A;  1PKZ A;  3WT2 A;  1TU7 A;  4IKH A;  1GUH A;  5COH A;  1NW2 A;  2ZNM A;  3D4M A;  1V9W A;  2AHE A;  5JCW A;  1O81 A;  4MZB A;  4QL7 A;  2JSY A;  3FK8 A;  2OA7 A;  3C8E A;  3ZMK A;  3N5O A;  2HQT A;  4K0G A;  3CSJ A;  4Q5F A;  2HSN A;  4A5P A;  4K5R A;  3GX8 A;  5IM9 A;  1AUC A;  2PGT A;  4AI6 A;  4EIP A;  5IQY A;  3F4T A;  1EV9 A;  5J4U A;  5J5N A;  2X64 A;  1AXD A;  1BF5 A;  2O8V B;  5IMF A;  2I9H A;  3ZIT A;  2L5O A;  3H79 A;  2C3T A;  4HU7 A;  4V2N A;  2VCV A;  4MPF A;  2VAF A;  2JAD A;  3UVT A;  2MZC A;  4OO5 A;  1V57 A;  3EVI A;  2FNO A;  12GS A;  1XPV A;  2EFD A;  1QXH A;  4HQS A;  4NAX A;  3WD6 A;  2HE3 A;  1R4W A;  3APQ A;  3DML A;  4TXV A;  2AAW A;  3MWH A;  5DVB A;  3MIX A;  1DE1 A;  2A2R A;  1GSS A;  4ECJ A;  2JZS A;  4AJ7 A;  4MF7 A;  5D9T A;  3IXR A;  2LUS A;  1VGL A;  4FYB A;  3C1S A;  2KLX A;  5J3R A;  1K0O A;  2ON5 A;  4PGT A;  1XBS A;  3ERG A;  4N11 A;  3GRX A;  4I2U A;  4V1A p;  2R4V A;  3RPN A;  2MYG A;  5DBQ A;  2L4Q A;  5ECL B;  4Z2U A;  3Q19 A;  1NSW A;  2B5Y A;  2GQL A;  3GA4 A;  3GV1 A;  4F9Z A;  2X8C A;  1XZO A;  5HFG A;  8GSS A;  2LQO A;  3KZQ A;  5BRT A;  1EZK A;  3ZVJ A;  3RPP A;  1EP7 A;  3CWG A;  3E9J B;  1X9M B;  3SWL A;  1GH2 A;  1T00 A;  4GWR A;  4DSQ A;  1YEX A;  2C0E A;  2XPD A;  2H0G A;  4NWY A;  3F3Q A;  4TW5 A;  3HY2 A;  5D73 A;  4I8B A;  3TDG A;  1PL1 A;  4KA0 A;  4EDY A;  4I97 A;  3O76 A;  3LW9 A;  1FHE A;  2LRT A;  3APO A;  3OR5 A;  1K0A A;  4IQA A;  1WRY A;  5E4W A;  2YJ7 A;  3WYW A;  4OCF A;  4MNN A;  2CA8 A;  4CY6 A;  3KP8 A;  3EPT A;  1S3R A;  1MD3 A;  4ZB8 A;  1FAA A;  4TRX A;  4DSS A;  1J9B A;  3ZRD A;  2P0G A;  2H6Y A;  9GSS A;  2FA8 A;  1WMJ A;  2PER A;  5HR2 A;  1M3J A;  5HFK A;  2AJQ B;  4OCE A;  4JR4 A;  3A3T A;  1PKW A;  1A2M A;  2WGR A;  1XWB A;  3GHA A;  2N5B A;  4JZQ A;  2FWE A;  2YNX A;  2DSA A;  3ZZX A;  2L5L A;  3TOU A;  3QOU A;  5G31 A;  3W6G A;  1EOH A;  2WW0 A;  1BYE A;  1J08 A;  2V32 A;  1QK8 A;  2I1U A;  3FHK A;  1G6Y A;  2HI7 A;  4EC0 A;  4KAE A;  2L6D A;  3ZML A;  4MCU A;  2HRF A;  4DEJ A;  1DUG A;  5EL8 A;  1ACV A;  2QSI A;  5ECR B;  2P31 A;  1G7E A;  3O3T A;  5DAK A;  2K18 A;  3IPZ A;  2Z9S A;  4F82 A;  1ZYQ B;  1TTZ A;  2H71 A;  4AJ8 A;  2DML A;  2PMT A;  1SJZ A;  4XS6 A;  3HDC A;  2X8G A;  4YAV A;  2B3S A;  22GS A;  4PXO A;  3UVH A;  1HD2 A;  2H76 A;  1O8X A;  1TK0 B;  5IOW A;  3LYP A;  3TU3 B;  2H75 A;  2DJ2 A;  1SL1 B;  2AV4 A;  2FLS A;  1ZL9 A;  3FZ9 A;  2QA1 A;  2XBQ A;  5D96 A;  3HHV A;  1UN2 A;  3GST A;  4KDY A;  5C04 A;  3L9V A;  4OD7 A;  3M9J A;  4G19 A;  4WF5 A;  3L4N A;  1K3O A;  1OE7 A;  1KTE A;  1CQG A;  5DAL B;  5JWQ B;  3HJO A;  2R0P A;  4MPG A;  2WDU A;  3CBU A;  1SJ6 A;  1XOB A;  4TVE A;  2I81 A;  1YVL A;  3WGX A;  5ELA A;  2K6V A;  4J56 E;  5BMU A;  5IO2 A;  1SVO A;  4L8E A;  4L0U A;  3FEU A;  4RUV A;  4E8E A;  2REM A;  4YKF A;  3ME7 A;  2KUC A;  4POM A;  2XBI A;  2FD3 A;  1RQM A;  4AF2 A;  2H0H A;  3IA1 A;  4AKH A;  3QAV A;  1LJR A;  1HNA A;  1OC9 B;  1PRX A;  2DKI A;  1S3A A;  1SK0 A;  3IE3 A;  4BWS A;  1BG1 A;  1N8J A;  4JR6 A;  2L59 A;  2H8L A;  2A4V A;  4NHW A;  4QL9 A;  4YKG A;  4BVX B;  3EC3 A;  5AN1 A;  3F9U A;  5KN2 A;  3VWV A;  2H6X A;  2OAD A;  2P5R A;  4YQM A;  1PFO A;  3GKX A;  1KNG A;  2HRK A;  1S4B P;  2GVP A;  3CHX C;  2GSS A;  4HDE A;  1AQV A;  1PX7 A;  4EF0 A;  4ZBA A;  5B8A A;  3UAP A;  4G0K A;  3FYG A;  3KEB A;  5A4U A;  5J9B A;  3KH7 A;  1FB0 A;  2K9F A;  4AKG A;  1EOG A;  1PL2 A;  3F4R A;  3EWL A;  1T1V A;  2X99 A;  3RHC A;  3LOR A;  3VFI A;  3GTU B;  4ZIJ A;  1U3I A;  3US3 A;  7GSS A;  3LEF A;  1X0R A;  6GSY A;  3KTL A;  3HYP A;  4AJ6 A;  4HI7 A;  3UOM A;  1AQX A;  1I5G A;  1AAZ A;  3LJR A;  1AQW A;  4K6X A;  4ILF A;  3CTF A;  3KD0 A;  2F51 A;  4XS1 A;  3KCM A;  3J7Y k;  1ZMA A;  3UL3 A;  6GSU A;  5D8I A;  2HT9 A;  6GSX A;  2F8F A;  2H01 A;  3GTU A;  1BAY A;  1SJI A;  5F0G A;  1SU9 A;  2DKH A;  2WVZ A;  3DXB A;  4ZBD A;  2HZE B;  1EP8 A;  4ECI A;  1FVJ A;  3M8N A;  3TGZ A;  2VLU A;  1S3C A;  1JFU A;  1O6J A;  4WEY A;  2C1Y A;  4QMK A;  3IBH A;  1O7U A;  3CSH A;  3TRX A;  4HUA A;  1GTU A;  5ENU A;  3D0Z A;  2YN1 A;  2RUE A;  2J9H A;  3IDV A;  2DJ1 A;  1CQH A;  3VPT A;  5CRE A;  5A4W A;  4K1F A;  4JED A;  3IAM 2;  2RLI A;  3D21 A;  2E2M A;  3G7J A;  2VD1 A; 
#chains in the Genus database with same CATH homology
 1T4Y A;  2JZR A;  4BWQ A;  4F2I A;  1MDJ A;  1GSQ A;  4YQU A;  4WR4 A;  2IWT A;  4KW6 A;  4GXZ A;  6GSS A;  4OO4 A;  4EVM A;  1OVN A;  3TCO A;  1E6B A;  1Y25 A;  2IME A;  4ML1 A;  4Z7X A;  2ALB A;  4MJC A;  1YY7 A;  2B1L A;  1JHB A;  1MDK A;  3BD2 A;  3R2Q A;  4TR4 A;  2NDO A;  2YPM A;  2GT5 A;  1XW5 A;  5ID2 A;  1GSF A;  3KJY A;  1WPI A;  2B1K A;  3GH9 A;  3RHB A;  3APS A;  5CAX A;  3VPQ A;  5CO3 A;  1M9A A;  4Z2R A;  2XPE A;  3L9S A;  2IL3 A;  2OT3 A;  5IO0 A;  5DDL A;  1LBK A;  3GUR A;  3KMO A;  2EIO A;  3BCK A;  2UV8 G;  1BQ7 A;  4HJ2 A;  2AUV A;  5D9X A;  4O32 A;  2M72 A;  3G9B A;  3QMX A;  4ZB9 A;  2OE3 A;  2RM5 A;  4YQV A;  5DJM A;  4YH2 A;  4GSN A;  4KH7 A;  1R5P A;  4YAP A;  2LV3 A;  2LRC A;  2FA4 A;  2DC5 A;  1U3A A;  4PQ1 A;  4POL A;  5J41 A;  3KH9 A;  2VUP A;  1VRS D;  1M2D A;  3NOF A;  2G2Q A;  1XWC A;  4GQC A;  1GNE A;  2PWJ A;  2H70 A;  5ELG A;  2VL9 A;  2WJU A;  3ZIJ A;  1X5C A;  4Q5R A;  2EIR A;  4KF9 A;  2R37 A;  1V58 A;  4Q5Q A;  1SD9 A;  2HFD A;  1EGO A;  3A2X A;  2MMO A;  1XVQ A;  5CP1 A;  3KXO A;  3I6A A;  2H0I A;  4BL7 B;  2ZUP A;  2VLV A;  5JCU A;  16GS A;  2YWI A;  2VKZ G;  1BG5 A;  2K8S A;  1T4Z A;  3H4K A;  5G5F A;  3HJM A;  3KP9 A;  6GSV A;  5H5S A;  1OC8 A;  1K0C A;  1YEP A;  1JLV A;  3GIX A;  1XWK A;  1ABA A;  4HEA 2;  3ZLP A;  1ERV A;  1F3A A;  3MSZ A;  3BCI A;  4BL7 A;  1PD2 1;  1GTA A;  17GS A;  2A2S A;  1WWJ A;  2DLX A;  5KN3 A;  3VI5 A;  1THX A;  3DWV A;  1M0U A;  2DIZ A;  4ECC A;  4X43 A;  4X1U A;  4PQI A;  5LD0 A;  2H74 A;  4N30 A;  1FVK A;  2GQK A;  3ZL5 A;  2WZ9 A;  4XCS A;  1FW1 A;  2WUL A;  4HS1 A;  2EIQ A;  3DVX A;  3M1G A;  4FYU A;  4O5R A;  4NV5 A;  2YWO A;  3FY7 A;  1TI3 A;  2DJ3 A;  5A5H B;  2YCD A;  1PA3 A;  4Q5N A;  1YKC A;  4XS4 B;  3JCM L;  1MDI A;  4XTS A;  4TXO B;  1Z7R A;  1VF4 A;  3CTG A;  4JRR A;  1BX9 A;  1S3D A;  1TDI A;  10GS A;  4ICY A;  2EFH A;  5AIX A;  1WOU A;  1SL2 B;  5CRH A;  1EWX A;  1MEK A;  4HOJ A;  2TRC P;  1O8W A;  4XS4 A;  1TJD A;  4IJ3 A;  2FY6 A;  3VK9 A;  3V1W A;  5F06 A;  1X5E A;  5ECI B;  4HJM A;  2V1M A;  3HCZ A;  1N2A A;  1Y6E A;  2YZH A;  1VF2 A;  1JLW A;  4ISD A;  5JCG A;  1OE8 A;  3DD3 A;  5GZZ B;  4HZ4 A;  4EL1 A;  5LCZ A;  1C72 A;  4IVF A;  1OAZ A;  2F9S A;  2FHE A;  4IN0 A;  1Z5Y E;  2X8H A;  1TKD B;  4CDO A;  5AGY A;  1G0T A;  1OYJ A;  2TIR A;  2RM6 A;  13GS A;  3EIN A;  2G0F A;  4IQ1 A;  2VO4 A;  5DCH A;  1AIU A;  3UIW A;  2H6Z A;  2VM2 A;  2IMD A;  1ZYE A;  2DJJ A;  4K2D A;  4KND A;  2MMZ A;  5A34 B;  1FOH A;  1TOF A;  1QFN A;  4GST A;  19GS A;  3TRP A;  2V41 A;  4ECB A;  1BJX A;  2FGX A;  1A2J A;  4N3Z A;  3UJ1 A;  1GSE A;  2OE0 A;  3BJ5 A;  4ACS A;  5FT3 A;  3ZFL A;  1SYX A;  5F07 A;  3H1N A;  4WF4 A;  1A0F A;  4J57 E;  4J2F A;  1HNC A;  2I4A A;  5ECP B;  5A34 A;  3Q18 A;  1SEN A;  3IK9 A;  4KCE A;  3D22 A;  4O92 A;  5DQY A;  4CY8 A;  2PPT A;  1K0M A;  2R0G A;  1SKW B;  1VF3 A;  3F63 A;  2B5E A;  4PUF C;  1ERT A;  1OC3 A;  3M0F A;  2CAI A;  2H19 A;  1TU8 A;  1DBY A;  4MA9 A;  5J4V A;  1PN0 A;  2YP6 A;  2H72 A;  4F0B A;  1AW9 A;  4MZC A;  1SKS B;  2XC2 A;  3ISO A;  1U6T A;  4WR5 A;  4NV2 A;  3P8W A;  1K0N A;  1ILO A;  3PGT A;  1GWC A;  2FUG 2;  2MMA A;  1ERW A;  4OMV A;  4ZB7 A;  5FHI A;  2VCT A;  3GL3 A;  2IIY A;  3QD9 A;  3KTB A;  4IJI A;  4IS0 A;  1KEB A;  3FMW A;  4EKZ A;  1JZO A;  18GS A;  1R5A A;  4H86 A;  2R2J A;  1H75 A;  3IC4 A;  1A8Y A;  2C80 A;  3KMN A;  1J0F A;  2DJK A;  3LXT A;  1GLP A;  4TR1 B;  2HNL A;  5J4Y A;  1ZYP A;  1TXX A;  1K0D A;  4TKY A;  5H5Q A;  1E2Y A;  4ML6 A;  3DRN A;  3NZN A;  5DAL A;  2LNS A;  1A2L A;  3PR8 A;  3QDN A;  3EYT A;  3O6T A;  4ZL9 A;  5H5R A;  1TRW A;  3RBT A;  3H8Q A;  2KHP A;  2B7J A;  3F6D A;  2FWG A;  3I69 A;  4I5Q A;  2OE1 A;  4GSS A;  2LTK A;  5JWO B;  1OKD A;  4FYC A;  3LYK A;  2IMI A;  4TR1 A;  2LST A;  2IPA A;  2GDR A;  2VIM A;  4KUN A;  2H1L A;  2M46 A;  4ZIL A;  2R3X A;  2XHF A;  5IPH A;  5J47 A;  3EMP A;  1TRV A;  2VCQ A;  4D73 B;  3IHQ A;  5KOX A;  1IYH A;  1VF1 A;  2VCZ A;  3ZTL A;  3PH9 A;  1GTB A;  1OC9 A;  4PNG A;  3D5J A;  3UBL A;  4XHM A;  3FR3 A;  1A24 A;  1Y1U A;  3KM6 A;  2HRA A;  4JU5 A;  3HKR A;  3A5W A;  2GSR A;  1JZD A;  4F03 A;  3EU4 A;  4BVX A;  5G1L A;  4Z2T A;  1HQO A;  2LJR A;  5HFI A;  5J9C A;  4TOP A;  3D4T A;  3PPU A;  4OWY A;  3I9V 2;  4TR3 A;  1USB A;  3TJK A;  4P3Y B;  1NM3 A;  1K3L A;  2HSY A;  1A23 A;  1U88 A;  4D73 A;  3ERF A;  3WGD A;  4MF6 A;  2CVK A;  4BVY B;  3LGC A;  3MNG A;  1PQN A;  4L0W A;  1HYU A;  5ECH B;  2MMN A;  3Q74 A;  3W8J A;  3FKF A;  4KE3 A;  4GRF A;  1MTC A;  4GDF A;  4IP6 A;  1QGV A;  1ML6 A;  4EDZ A;  2OAC A;  14GS A;  5CNW A;  2LJA A;  3K8N A;  4V1A g;  2JL4 A;  1N25 A;  5IIZ A;  4BVY A;  1O73 A;  4EUY A;  5HR0 A;  1TXU A;  1X5D A;  2O85 A;  1ZYN A;  3HZ8 A;  2PVQ A;  4WXT A;  4JBB A;  1W89 A;  3GKN A;  2CV4 A;  3F4S A;  3QAG A;  5G1K A;  5INY A;  11GS A;  1V2A A;  3ZFB A;  4RI7 A;  3QAW A;  4G01 A;  3P90 A;  5IMZ A;  2HSM B;  2X49 A;  1F9M A;  3C1R A;  5ECN B;  3GSS A;  5AIV A;  2HZE A;  3BOA A;  1YDK A;  3FZ5 A;  2V6K A;  1BED A;  2MBS A;  1SYR A;  3ERW A;  3GFK A;  5CRD A;  3CRU A;  3SBC A;  2LJK A;  3IR4 A;  1XFL A;  5CRW A;  2IMK A;  2TRX A;  6GSW A;  2CZ3 A;  4G0L A;  3TB2 A;  20GS A;  2BMX A;  3F8U A;  2OJL A;  2O7K A;  2HSM A;  2FWF A;  3U6V A;  1Z6M A;  4F0C A;  1TI1 A;  2DJ0 A;  2O87 A;  2K8V A;  2JSZ A;  1TK8 B;  2YWM A;  1PN9 A;  4OFM A;  2ES7 A;  5ECK B;  2C8U A;  1B48 A;  3GUS A;  2GZZ A;  2F3M A;  3P2A A;  4ZB6 A;  3FRC A;  1GTI A;  1B8X A;  2AYT A;  2C0D A;  3ME8 A;  3UEM A;  3UBK A;  1F6M C;  5D9W A;  1GLQ A;  4V2L A;  4KB3 A;  1Z9H A;  4EE0 A;  4L5O A;  4K8M A;  1PX6 A;  2NPB A;  4X4J A;  3TKQ A;  2WFC A;  3TRQ A;  3IC8 A;  1THO A;  3TKS C;  2RII A;  1UC7 A;  1GNW A;  2H73 A;  4IEL A;  1M2B A;  4KGI A;  4FIW A;  3LWA A;  4O5U A;  1ERU A;  3TKR A;  4ZBB A;  1WP0 A;  5GAN D;  2PBJ A;  4LMW A;  2WS2 A;  5A1N B;  2WRT A;  4MH2 A;  4K7I A;  1B9X C;  3QFB C;  4G10 A;  3GNJ A;  2R5G A;  3IOS A;  1URM A;  4I6X A;  4AKX B;  5KOW A;  1GSD A;  1DSB A;  4MJB A;  2OKA A;  1SL0 B;  5ECQ B;  2IN3 A;  4E68 A;  2R6K A;  2YZU A;  2QGV A;  5A1N A;  2VLT A;  1XWA A;  3M3M A;  5B8B A;  1QQ2 A;  2QKE A;  1XCC A;  4OFN A;  1XOA A;  3C73 A;  5D93 A;  3HA9 A;  3GMF A;  3L78 A;  2WB9 A;  4FQU A;  2ON7 A;  2KP2 A;  1B4P A;  1XVW A;  5HQP A;  2QA2 A;  2FWH A;  3F6F A;  1U87 A;  5HR3 A;  2C0G A;  1V98 A;  2BJX A;  2DBC A;  2CT6 A;  4K0N A;  4WKW A;  4HU9 A;  5ECS A;  2CAQ A;  1GRX A;  4IGJ A;  5GSS A;  4MK3 A;  5DCG A;  1SK2 A;  3UAR A;  3E0U A;  4N0Z A;  4KSM A;  3IV4 A;  3BBY A;  2EFE A;  5F8B A;  2H1D A;  3TUE A;  2GS3 A;  3CYN A;  1JZW A;  1QMV A;  4WET A;  1XW9 A;  1F37 A;  2DIY A;  2GTU A;  2CZ2 A;  2YOI A;  3QCP A;  3P7X A;  3VWX A;  4K5S A;  3TJF A;  5A5H A;  5B6M A;  4MP4 A;  5CYY A;  1W4V A;  4TXO A;  4K7N A;  4POB A;  3J7Y b;  4L5L A;  2KP1 A;  4OFT A;  2H30 A;  4DSR A;  1GSU A;  1PGT A;  4MMM A;  2JZT A;  3EE2 A;  3FZA A;  5IOX A;  3RAZ A;  1YKA A;  4FH8 A;  4DSS B;  3FR6 A;  1ON4 A;  3UMA A;  3ZIV A;  2LQQ A;  1EGR A;  2N5A A;  1M7T A;  4WBR D;  3DYR A;  3Q6O A;  2EC4 A;  2V6O A;  1SKR B;  3LSZ A;  5JWR B;  2ZCT A;  2A4H A;  4X0X A;  2D2Z A;  4QQ7 A;  5ECO B;  3DIE A;  2NTO A;  3TJB A;  1WJK A;  2DMM A;  3GH6 A;  5L71 A;  3HMJ G;  2A2P A;  3EMX A;  5B6N A;  5E59 A;  4EXJ A;  4GLT A;  3DGQ A;  3GYK A;  4G2E A;  2WCI A;  1Z7P A;  4XIH A;  5IMA A;  2NVL A;  4MZW A;  5FWG A;  4XRA A;  1YF1 A;  2B5X A;  4MLY A;  1Z6N A;  5DAK B;  3DVW A;  4AKI A;  1T7P B;  2LKU A;  4NMU A;  4XRD A;  3C71 A;  2VL2 C;  3LFL A;  1SVL A;  2C4J A;  3TKS E;  1XW6 A;  1TRS A;  2LEG A;  5C00 A;  3TKS A;  4E8H A;  4MF5 A;  4POK A;  5F05 A;  2GSQ A;  1ZGN A;  2CX4 A;  4BA7 A;  2X4A A;  2E2G A;  3FZ4 A;  3C7M A;  5HR1 A;  1IYI A;  4KDU A;  4ZL7 A;  1K3Y A;  1LU4 A;  4TR0 A;  1R26 A;  2RUF A;  3HZ4 A;  3HVX A;  3EU3 A;  1GSY A;  4K2X A;  2GLR A;  1M99 A;  1A8L A;  3A5I A;  3ZRE A;  1GP1 A;  1K0B A;  4BPY A;  4PQH A;  1FB6 A;  2PUK C;  2O5V A;  1ZOF A;  2HZF A;  1I9D A;  1G7O A;  1EEJ A;  4K9Z A;  4N0V A;  3VUR A;  4ZL8 A;  3W8S A;  3HJP A;  3A2W A;  2O89 A;  1DE2 A;  3L9U A;  5BMU B;  2E7P A;  4LA1 A;  5D9V A;  2VCX A;  3D6I A;  3I43 A;  1ST9 A;  4N10 A;  3ED3 A;  5KN0 A;  5G2Z A;  3L0H A;  4KDX A;  3DKS A;  2B7K A;  1RK4 A;  3CMI A;  1B4Q A;  1MD4 A;  1V40 A;  2LRN A;  5LNK e;  1YF0 A;  2EFC A;  2VM1 A;  4AGS A;  4MH3 A;  1UA5 A;  1XXU A;  1A0R P;  4MJE A;  5CRG A;  2F8A A;  1RW1 A;  3M9K A;  2OBK A;  2FCH A;  1TW9 A;  4ZXG A;  3GX0 A;  4WBJ A;  1SVM A;  1FG4 A;  3N9J A;  3R3E A;  2QC7 A;  2VD0 A;  3IHG A;  4PNF A;  4KSO A;  2M80 A;  1XIY A;  2JAC A;  2L6C A;  2H66 A;  4NHZ A;  4ULX A;  1AC1 A;  4RQX A;  3ZYW A;  1FO5 A;  4KX4 A;  2HRK B;  6GST A;  2IJY A;  2J23 A;  4IP1 A;  2MBT A;  3TKP A;  1QUW A;  2HYX A;  4NPB A;  2IMF A;  5IPG A;  2PN8 A;  5G30 A;  3ZVJ D;  4RQR A;  3PIN A;  3RDW A;  3HVV A;  2PVO C;  5B7C A;  3HXS A;  2C3Q A;  3HD5 A;  4EIQ A;  1B9Y C;  2UZ8 A;  5AIS A;  3IAS 2;  5A5K A;  2CVD A;  1F2E A;  1YJ6 A;  2JU5 A;  2N5F A;  2HRN A;  5EY6 A;  3IRA A;  4PUR A;  1M2A A;  3G7I A;  2GZY A;  1G6W A;  3F3R A;  2HXK A;  1TRU A;  4RI6 A;  1R7H A;  5DQS A;  1X9W B;  4MDC A;  2E0Q A;  3GN3 A;  2VCW A;  3GKM A;  3DEX A;  1PSQ A;  4PX1 A;  2YJH A;  2IFQ B;  4O5Q A;  4LLR A;  1NHY A;  4MAB A;  3EUR A;  3U5R E;  3CXG A;  4IBP A;  1SD8 A;  1O85 A;  2YV9 A;  2CVB A;  1OKT A;  4V2M A;  2C3N A;  5J40 A;  1NHO A;  5A4V A;  3H93 A;  4GQF A;  3HVS A;  1UVZ A;  3AY8 A;  5KEJ A;  5IMV A;  3CRT A;  2L57 A;  1EV4 A;  4HQZ A;  1YZX A;  3E3E A;  2I3Y A;  5IMD A;  2BTO T;  1PMT A;  2HLS A;  2IFQ A;  3A2V A;  2HSH A;  3TJG A;  3FR9 A;  5DJL A;  2YAN A;  3KIJ A;  4TN8 A;  1Q98 A;  1EEM A;  3TJJ A;  3G7Y A;  1Z3E A;  4DVC A;  4ID0 A;  2VL2 A;  4I2T A;  5GST A;  3IK7 A;  1WE0 A;  3WT1 A;  4MJA A;  5ID2 B;  3LG6 A;  2L4C A;  5KN1 A;  3LXZ A;  1HNB A;  4O7H A;  3WGE A;  1T8E B;  1GUK A;  4PTS A;  4HZ2 A;  1KBN A;  3FW2 A;  3MDK A;  4GCI A;  5EVO A;  1GUM A;  2P5Q A;  1ZCP A;  5ABR A;  3GL5 A;  3MYD A;  2GQM A;  1TK5 B;  4EO3 A;  1GUL A;  4W66 A;  4K7O A;  5GAP D;  1WIK A;  2H1G A;  2OBI A;  4NXI A;  3QPM A;  1FOV A;  4LL1 B;  2C0F A;  1F3B A;  2AB6 A;  1TP9 A;  2GGT A;  2H1A A;  3VI7 A;  4CHS A;  3TOT A;  2CQ9 A;  3MAK A;  2H1B A;  1ZZY A;  1X9S B;  2CX3 A;  3F0I A;  4KCA A;  1SK1 A;  1XWG A;  1YQ1 A;  2YV7 A;  2V2G A;  3KGK A;  4LMV A;  5G5E A;  4GF0 A;  4CW9 A;  3LQ7 A;  3QR6 A;  1GL8 A;  1T3B A;  1M9B A;  3GKK A;  2PU9 C;  5IMC A;  2GZP A;  3CSI A;  1Q4J A;  4FO5 A;  4GTU A;  4G9H A;  3VWU A;  2YWN A;  3QFA C;  2VOC A;  2GST A;  3VLN A;  4USS A;  4LL4 B;  3VWW A;  2LNT A;  1JZR A;  2GT6 A;  5ECM B;  4IW9 A;  4IHU A;  2LS5 A;  2B6M A;  2NBS A;  2HSN B;  4G0I A;  5EPF A;  4JE1 A;  1H4O A;  2KOK A;  3S9F A;  3NIV A;  2R0C A;  2VL3 A;  4PUA A;  1PKZ A;  3WT2 A;  1TU7 A;  4IKH A;  1GUH A;  5COH A;  1NW2 A;  2ZNM A;  3D4M A;  1V9W A;  2AHE A;  5JCW A;  1O81 A;  4MZB A;  4QL7 A;  2JSY A;  3FK8 A;  2OA7 A;  3C8E A;  3ZMK A;  3N5O A;  2HQT A;  4K0G A;  3CSJ A;  4Q5F A;  2HSN A;  4A5P A;  4K5R A;  3GX8 A;  5IM9 A;  1AUC A;  2PGT A;  4AI6 A;  4EIP A;  5IQY A;  3F4T A;  1EV9 A;  5J4U A;  5J5N A;  2X64 A;  1AXD A;  1BF5 A;  2O8V B;  5IMF A;  2I9H A;  3ZIT A;  2L5O A;  3H79 A;  2C3T A;  4HU7 A;  4V2N A;  2VCV A;  4MPF A;  2VAF A;  2JAD A;  3UVT A;  2MZC A;  4OO5 A;  1V57 A;  3EVI A;  2FNO A;  12GS A;  1XPV A;  2EFD A;  1QXH A;  4HQS A;  4NAX A;  3WD6 A;  2HE3 A;  1R4W A;  3APQ A;  3DML A;  4TXV A;  2AAW A;  3MWH A;  5DVB A;  3MIX A;  1DE1 A;  2A2R A;  1GSS A;  4ECJ A;  2JZS A;  4AJ7 A;  4MF7 A;  5D9T A;  3IXR A;  2LUS A;  1VGL A;  4FYB A;  3C1S A;  2KLX A;  5J3R A;  1K0O A;  2ON5 A;  4PGT A;  1XBS A;  3ERG A;  4N11 A;  3GRX A;  4I2U A;  4V1A p;  2R4V A;  3RPN A;  2MYG A;  5DBQ A;  2L4Q A;  5ECL B;  4Z2U A;  3Q19 A;  1NSW A;  2B5Y A;  2GQL A;  3GA4 A;  3GV1 A;  4F9Z A;  2X8C A;  1XZO A;  5HFG A;  8GSS A;  2LQO A;  3KZQ A;  5BRT A;  1EZK A;  3ZVJ A;  3RPP A;  1EP7 A;  3CWG A;  3E9J B;  1X9M B;  3SWL A;  1GH2 A;  1T00 A;  4GWR A;  4DSQ A;  1YEX A;  2C0E A;  2XPD A;  2H0G A;  4NWY A;  3F3Q A;  4TW5 A;  3HY2 A;  5D73 A;  4I8B A;  3TDG A;  1PL1 A;  4KA0 A;  4EDY A;  4I97 A;  3O76 A;  3LW9 A;  1FHE A;  2LRT A;  3APO A;  3OR5 A;  1K0A A;  4IQA A;  1WRY A;  5E4W A;  2YJ7 A;  3WYW A;  4OCF A;  4MNN A;  2CA8 A;  4CY6 A;  3KP8 A;  3EPT A;  1MD3 A;  4ZB8 A;  1FAA A;  4TRX A;  4DSS A;  1J9B A;  3ZRD A;  2P0G A;  2H6Y A;  9GSS A;  2FA8 A;  1WMJ A;  2PER A;  5HR2 A;  5HFK A;  2AJQ B;  4OCE A;  4JR4 A;  3A3T A;  1PKW A;  1A2M A;  2WGR A;  1XWB A;  3GHA A;  2N5B A;  4JZQ A;  2FWE A;  2YNX A;  2DSA A;  3ZZX A;  2L5L A;  3TOU A;  3QOU A;  5G31 A;  3W6G A;  1EOH A;  1BYE A;  1J08 A;  2V32 A;  1QK8 A;  2I1U A;  3FHK A;  1G6Y A;  2HI7 A;  4EC0 A;  4KAE A;  2L6D A;  3ZML A;  4MCU A;  2HRF A;  4DEJ A;  1DUG A;  5EL8 A;  1ACV A;  2QSI A;  5ECR B;  2P31 A;  1G7E A;  3O3T A;  5DAK A;  2K18 A;  3IPZ A;  2Z9S A;  4F82 A;  1ZYQ B;  1TTZ A;  2H71 A;  4AJ8 A;  2DML A;  2PMT A;  1SJZ A;  4XS6 A;  3HDC A;  2X8G A;  4YAV A;  2B3S A;  22GS A;  4PXO A;  3UVH A;  1HD2 A;  2H76 A;  1O8X A;  1TK0 B;  5IOW A;  3LYP A;  3TU3 B;  2H75 A;  2DJ2 A;  1SL1 B;  2AV4 A;  2FLS A;  1ZL9 A;  3FZ9 A;  2QA1 A;  2XBQ A;  5D96 A;  3HHV A;  1UN2 A;  3GST A;  4KDY A;  5C04 A;  3L9V A;  4OD7 A;  3M9J A;  4G19 A;  4WF5 A;  3L4N A;  1K3O A;  1OE7 A;  1KTE A;  1CQG A;  5DAL B;  5JWQ B;  3HJO A;  2R0P A;  4MPG A;  2WDU A;  3CBU A;  1SJ6 A;  1XOB A;  4TVE A;  2I81 A;  1YVL A;  3WGX A;  5ELA A;  2K6V A;  4J56 E;  5BMU A;  5IO2 A;  1SVO A;  4L8E A;  4L0U A;  3FEU A;  4RUV A;  4E8E A;  2REM A;  4YKF A;  3ME7 A;  2KUC A;  4POM A;  2XBI A;  2FD3 A;  1RQM A;  4AF2 A;  2H0H A;  3IA1 A;  4AKH A;  3QAV A;  1LJR A;  1HNA A;  1OC9 B;  1PRX A;  2DKI A;  1S3A A;  1SK0 A;  3IE3 A;  4BWS A;  1BG1 A;  1N8J A;  4JR6 A;  2L59 A;  2H8L A;  2A4V A;  4NHW A;  4QL9 A;  4YKG A;  4BVX B;  3EC3 A;  5AN1 A;  3F9U A;  5KN2 A;  3VWV A;  2H6X A;  2OAD A;  2P5R A;  4YQM A;  3GKX A;  1KNG A;  2HRK A;  2GVP A;  2GSS A;  4HDE A;  1AQV A;  1PX7 A;  4EF0 A;  4ZBA A;  5B8A A;  3UAP A;  4G0K A;  3FYG A;  3KEB A;  5A4U A;  5J9B A;  3KH7 A;  1FB0 A;  2K9F A;  4AKG A;  1EOG A;  1PL2 A;  3F4R A;  3EWL A;  1T1V A;  2X99 A;  3RHC A;  3LOR A;  3VFI A;  3GTU B;  4ZIJ A;  1U3I A;  3US3 A;  7GSS A;  3LEF A;  1X0R A;  6GSY A;  3KTL A;  3HYP A;  4AJ6 A;  4HI7 A;  3UOM A;  1AQX A;  1I5G A;  1AAZ A;  3LJR A;  1AQW A;  4K6X A;  4ILF A;  3CTF A;  3KD0 A;  2F51 A;  4XS1 A;  3KCM A;  3J7Y k;  1ZMA A;  3UL3 A;  6GSU A;  5D8I A;  2HT9 A;  6GSX A;  2F8F A;  2H01 A;  3GTU A;  1BAY A;  1SJI A;  5F0G A;  1SU9 A;  2DKH A;  3DXB A;  4ZBD A;  2HZE B;  1EP8 A;  4ECI A;  1FVJ A;  3M8N A;  3TGZ A;  2VLU A;  1S3C A;  1JFU A;  1O6J A;  4WEY A;  2C1Y A;  4QMK A;  3IBH A;  1O7U A;  3CSH A;  3TRX A;  4HUA A;  1GTU A;  5ENU A;  3D0Z A;  2YN1 A;  2RUE A;  2J9H A;  3IDV A;  2DJ1 A;  1CQH A;  3VPT A;  5CRE A;  5A4W A;  4K1F A;  4JED A;  3IAM 2;  2RLI A;  3D21 A;  2E2M A;  3G7J A;  2VD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...