4PGTA

Crystal structure of hgstp1-1[v104] complexed with the gsh conjugate of (+)-anti-bpde
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
209
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 209
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pgtA01
4MA9A 4IP6A 3L4NA 1T8EB 3IC8A 1WOUA 6GSXA 4BVYB 1F9MA 4DSSA 3A5WA 1FO5A 3CSJA 4QQ7A 4IVFA 3D0ZA 1NHYA 3VLNA 2LNTA 6GSSA 4BPYA 1AXDA 2MZCA 4NAXA 3HDCA 4V1Ag 2GGTA 3APOA 1O73A 2I9HA 1YY7A 2ON7A 1WWJA 4HJMA 4G9HA 4RQXA 5HR3A 5ECHB 5D93A 3CSHA 1G7OA 2HE3A 3FK8A 3VWXA 1E6BA 2ZCTA 3RPPA 2PGTA 5J5NA 3HHVA 2BJXA 4WR4A 1GP1A 1B48A 1GL8A 4IQ1A 3CRUA 2GZYA 4IGJA 1T4ZA 1GSSA 2C0EA 2GSRA 4WBJA 5AN1A 2FY6A 4BA7A 1GSFA 4O92A 2JSZA 3CTFA 3DMLA 2A2SA 2VM2A 4YH2A 4K1FA 2H1GA 1VF4A 3HKRA 1Z7PA 5JCUA 2GZPA 3GA4A 4HDEA 4DEJA 2K6VA 1OE7A 3CTGA 2CX4A 1X5CA 5DCHA 6GSWA 1M9BA 4GQFA 2JSYA 2IJYA 3E9JB 3IPZA 5LNKe 1URMA 4H86A 1XWCA 1AUCA 3D4MA 1JZWA 3P2AA 2XPEA 1VRSD 1FAAA 2PVQA 1MTCA 4KH7A 3EVIA 4MP4A 3C7MA 1HNBA 3FR6A 4POBA 2H6ZA 2H1AA 3UL3A 2HSMB 2OE3A 5G30A 4EF0A 2F8FA 1Z3EA 4ZL9A 4PURA 3C73A 2HYXA 1A23A 2B1KA 2E2MA 1WP0A 5J4UA 1W89A 1Q98A 4EDYA 1T3BA 5J9CA 2OA7A 4TOPA 4K8MA 3P90A 4F03A 4WBRD 4HU9A 1TDIA 3RHCA 4DSQA 2YANA 1C72A 4KGIA 3IHQA 3LXTA 2WDUA 1GSQA 3IR4A 1F37A 2DC5A 22GSA 4KF9A 4ZBDA 4POMA 1B4QA 2GDRA 3ZFLA 4HJ2A 1XPVA 2H0GA 3VK9A 5DQSA 1U3AA 2VL2C 4TXVA 5DCGA 3VI5A 1PQNA 4IELA 5ABRA 5D73A 3TKPA 2O87A 2B3SA 4XS1A 5KEJA 3C71A 4MH2A 3M1GA 3A3TA 5G2ZA 1QQ2A 5EPFA 1Z9HA 5HQPA 3W8JA 1OE8A 2WJUA 1JLWA 4TKYA 4IW9A 2HRKA 3I43A 1M9AA 4IHUA 1ERWA 5G1LA 4BVXB 4NV2A 4GSNA 2N5FA 1JFUA 1MDJA 3LSZA 1BJXA 4G0IA 3GUSA 3GTUA 3HJPA 2H0HA 4ML1A 3RAZA 3ERGA 4OFTA 2R3XA 3L9SA 2JACA 3TUEA 1YZXA 3TJJA 1WMJA 3DD3A 1TXXA 3GSTA 1TRWA 3CBUA 5IOWA 2R2JA 3FHKA 1XVQA 1ERVA 5GSTA 3TGZA 2RUFA 2GSSA 1EGOA 2C3QA 3ZMKA 2WGRA 1EEMA 2DJ0A 2H8LA 3TJKA 2FHEA 1ON4A 2LRNA 3CXGA 2E0QA 1SJZA 3JCML 4EKZA 2MMAA 2RM6A 5COHA 4PQIA 1ABAA 3FZ4A 3L9UA 5FT3A 3EC3A 3UVHA 2YJHA 1YF0A 1MD4A 11GSA 4EUYA 4XIHA 4MZWA 2LQOA 1J9BA 2HSNB 1PSQA 3M9JA 2B7JA 1YJ6A 3LQ7A 1M0UA 3WGXA 3HVVA 4PUFC 2LTKA 5IQYA 2FUG2 1GRXA 4NXIA 1YEXA 2DBCA 3GKKA 5KN1A 2MMNA 1Z5YE 1XWBA 4Z7XA 1KBNA 4CDOA 2LQQA 2L4CA 3KH9A 1NHOA 3F6DA 4EE0A 3EMXA 4XRDA 3SWLA 1U88A 5CRHA 2B5XA 1N2AA 4WEYA 1EOGA 4EXJA 4XS6A 2FA4A 2LS5A 2FGXA 2CZ2A 1E2YA 3A2WA 2VCVA 3DKSA 4HEA2 5DAKB 1XW6A 5GZZB 1K0AA 2GVPA 2MBSA 4FYBA 1PL1A 2X8HA 4TN8A 3C1SA 1FB0A 3IAM2 4CW9A 4YAPA 1EEJA 2WRTA 1T7PB 3QR6A 1TRUA 5HFGA 3F3QA 2G2QA 3LORA 4ILFA 1K0OA 4ECIA 2RUEA 3H8QA 5DALA 1SK1A 4V2LA 1RQMA 1Z7RA 2R37A 3BCKA 2J9HA 4JZQA 2F51A 4OMVA 4I5QA 3UVTA 3D5JA 2QKEA 4ACSA 1A0FA 2HZFA 3TRQA 4MABA 5IO0A 2V6KA 2YWMA 4OD7A 4IP1A 3UJ1A 5CAXA 3GKMA 1OYJA 7GSSA 4K0NA 1A0RP 3QCPA 4AJ8A 4HS1A 1JZDA 1U87A 4JE1A 3I9V2 1HD2A 5IMDA 1T1VA 4OWYA 3FYGA 4YAVA 4OO4A 10GSA 3UBKA 2KP1A 4K2DA 5F05A 2DMMA 3BD2A 1BYEA 5A5KA 5JCWA 4I2UA 4HZ2A 4KSMA 5DDLA 2I1UA 1TI1A 1V57A 1XOAA 3KMNA 4IS0A 2RLIA 1TKDB 1GSDA 1K3YA 1YKAA 2IIYA 3TRXA 1FHEA 2VM1A 1BEDA 1XFLA 2HNLA 2L4QA 4KAEA 3ZVJD 3L78A 2FWGA 2OADA 3D6IA 2CV4A 3TRPA 3KTBA 3EMPA 4IN0A 3HYPA 2VUPA 1ML6A 2IMFA 2VL9A 3IK7A 1QK8A 3FRCA 3TKSE 5DJLA 1QMVA 2QC7A 2PWJA 2H74A 2C8UA 3L9VA 1GLPA 3UIWA 2H1BA 18GSA 4I8BA 16GSA 2H76A 19GSA 1EWXA 3TKSC 3MWHA 2HQTA 3ZIJA 1ERTA 3H93A 3CRTA 4V2MA 2FWHA 1I5GA 3F6FA 3KP9A 1TK8B 3EYTA 3D21A 2AHEA 4FH8A 4NHWA 5A4VA 5KN0A 4F0CA 1GNWA 1RK4A 1EP7A 2H72A 3I6AA 4PQHA 1AW9A 2HSYA 2YZUA 1VF1A 2GSTA 1SK0A 3MAKA 3WYWA 3TJBA 2HRFA 1G0TA 2IMEA 1KNGA 1GTIA 2K9FA 4PUAA 2YV9A 1K0DA 4MZCA 2BTOT 2PVOC 4XTSA 4GTUA 1PL2A 1KTEA 3U5RE 1LBKA 3RDWA 1DE2A 3LEFA 4MH3A 3HA9A 3ZITA 1WPIA 2YWOA 2AB6A 2VL2A 4F2IA 2KHPA 6GSVA 4NHZA 4I2TA 1R26A 5IM9A 5JWRB 4HI7A 4RUVA 2VO4A 1SKRB 2C80A 1GTBA 4JR6A 3LG6A 4BWSA 1LU4A 5IMZA 4TR3A 2XBIA 2AAWA 2C3NA 3WT1A 4EO3A 4MK3A 2DMLA 5CNWA 2MBTA 1TJDA 5CRWA 5IMFA 2LJRA 1BAYA 4IKHA 3N5OA 6GSUA 4KDXA 5D8IA 1MDIA 1GUHA 2YV7A 2YWNA 4G2EA 4AGSA 3HZ8A 2A4VA 3Q6OA 2B5YA 5D9TA 5AISA 3CMIA 3TCOA 1GSYA 2XPDA 2X8CA 5DQYA 1O8WA 4GXZA 4LL1B 4E8EA 2C1YA 2HLSA 6GSTA 5G5FA 4ULXA 3M9KA 2VLVA 4AJ6A 5EVOA 1ZOFA 5IOXA 5D9XA 1G6WA 2P5RA 4GCIA 3LJRA 4IBPA 1JHBA 3VURA 1ST9A 4OCEA 2VIMA 3U6VA 2EIRA 5CRGA 2TIRA 1BG5A 1S3CA 3F8UA 2GT5A 4V1Ap 4D73A 4TXOB 2NVLA 1HYUA 4XS4A 1SJIA 1B9YC 5CP1A 1YDKA 3DVXA 3HXSA 2AJQB 3MDKA 1M2DA 1O6JA 1GUKA 1GH2A 3CSIA 2E7PA 3D22A 2WS2A 1A2LA 5CYYA 5DALB 1CQGA 4N10A 2ON5A 2IPAA 3F3RA 2TRCP 5GAND 1K3OA 2JADA 3MNGA 5IMVA 2Z9SA 3TKQA 2LJAA 1MDKA 2LUSA 1THXA 2VL3A 2D2ZA 3ZRDA 3F63A 4KDYA 5ECKB 5B7CA 2VCQA 5B6MA 3PR8A 2AV4A 3FY7A 5B8AA 3KD0A 4ZIJA 4ZB8A 4OCFA 1BX9A 2EIQA 4QL9A 4MJEA 1XWGA 2LKUA 3KIJA 4BL7B 1R5PA 2EC4A 3FR9A 2O85A 1OC9A 4MPFA 1V98A 3G9BA 1PKZA 2F8AA 1K0NA 2GLRA 2FWEA 4USSA 4X43A 3DXBA 4N0ZA 4HOJA 4JR4A 3VWVA 1Z6MA 1THOA 1OVNA 1IYIA 4TR1B 4ML6A 5JCGA 2TRXA 4BWQA 5ID2B 2M46A 4WETA 4JU5A 4ECJA 1PX6A 1G6YA 2H66A 3HD5A 4MJAA 2LEGA 2X99A 4GRFA 4KX4A 3UBLA 1SD9A 4QL7A 3PINA 3WT2A 2CVDA 2HZEA 2H30A 2OE1A 1HNCA 3H1NA 4ECBA 3J7Yb 3NZNA 3CYNA 3IXRA 2YPMA 1GWCA 4Q5NA 3FKFA 2AUVA 1TOFA 1USBA 2IWTA 5FWGA 2YNXA 5DBQA 1ZGNA 1SL2B 1TU8A 3P7XA 1UVZA 1GNEA 2O89A 2DJJA 1WJKA 2L5LA 4I97A 12GSA 1FW1A 1DBYA 3QDNA 3IV4A 1K0BA 2HRNA 4F0BA 1TW9A 4KDUA 5FHIA 2FNOA 1X9SB 3W6GA 2C3TA 2XBQA 3Q19A 1DSBA 1AQVA 4TVEA 2X64A 3ZIVA 4MMMA 1O7UA 2R4VA 2YP6A 2O7KA 2A2RA 1I9DA 3ME8A 2YWIA 1ZYQB 4MF7A 3MSZA 1XW9A 1ZZYA 2REMA 2YOIA 2J23A 2L57A 2PN8A 1FVKA 1YF1A 1ZMAA 4MCUA 1NW2A 1FVJA 1J0FA 3E3EA 2X8GA 1TK0B 4XHMA 1SD8A 1UC7A 5IMCA 4DSSB 1V2AA 5BMUA 3GL3A 1ACVA 1GTAA 3FZ5A 3TKSA 2GSQA 4JBBA 4L5OA 4LMWA 4KCEA 4MDCA 2XC2A 3LGCA 4FYUA 4JEDA 3N9JA 2PPTA 3US3A 4F9ZA 1M2BA 3C8EA 5C04A 3GYKA 2LNSA 2V6OA 3QAGA 1TU7A 5J41A 3FR3A 2L6CA 1XWAA 3GX8A 2QGVA 1GSUA 4L8EA 5E4WA 1O85A 3C1RA 5ECRB 3M3MA 2HT9A 5L71A 2HSMA 2MMZA 3GURA 3V1WA 1QXHA 4ZXGA 3APSA 5IIZA 1XVWA 4P3YB 5J9BA 3R2QA 2WULA 1K0CA 2IL3A 3GNJA 4MZBA 4L0UA 2YJ7A 3GKNA 2RIIA 3DGQA 3LXZA 1G7EA 2VCTA 2V41A 1PMTA 1H75A 3M8NA 1GULA 4IJ3A 4ISDA 3VFIA 1VF3A 3LFLA 5EY6A 2V1MA 4OO5A 4GSTA 17GSA 3PGTA 3G7YA 2MYGA 2P5QA 4WR5A 1XW5A 4EVMA 3BOAA 2YN1A 2PBJA 4FIWA 20GSA 4XRAA 2GZZA 4POKA 2H1DA 1A2MA 2LSTA 1K3LA 2JL4A 5ECPB 1B8XA 5F0GA 5C00A 1B4PA 2V32A 2IMIA 2H01A 1QFNA 5HFIA 1UN2A 1Z6NA 4HUAA 3TDGA 2K18A 4WF4A 5A4UA 3F9UA 3O3TA 3ISOA 5CRDA 2L59A 2ZUPA 4HQZA 1EZKA 4ZBAA 3VWWA 2CAQA 3H79A 4JRRA 3IC4A 4E8HA 3BCIA 1X9MB 2LV3A 4FO5A 2HRAA 3L0HA 4MPGA 2C4JA 3WGEA 2M80A 3M0FA 3KZQA 1ERUA 3VPTA 1AQXA 4PNGA 3GIXA 1GLQA 4NWYA 1A8LA 3GH9A 2VAFA 1QGVA 2FA8A 1DE1A 1SYXA 2HRKB 2H6YA 1EGRA 2XHFA 3ZVJA 4NV5A 4DVCA 2CAIA 2DJ2A 2QSIA 1ZCPA 3ME7A 1PX7A 5LCZA 3ZYWA 1S3DA 4G0LA 4TW5A 3GX0A 2KLXA 5G5EA 3AY8A 3GTUB 2MMOA 4Q5RA 2JU5A 2KUCA 1OC8A 4OFMA 1PD21 4ZL7A 3GN3A 4IQAA 5F06A 3QFBC 5D96A 1MEKA 4CHSA 2K8SA 1PRXA 4K9ZA 3ZLPA 2V2GA 3IE3A 5D9WA 2VCXA 4POLA 4ZILA 1FOVA 1O81A 1Q4JA 2C0FA 1A8YA 1B9XC 3Q74A 4LMVA 2LRCA 3KJYA 4F82A 1A2JA 3HCZA 5G1KA 1TI3A 1PKWA 3IRAA 2CVBA 1ILOA 2WFCA 1OC3A 4NPBA 5CO3A 1GTUA 3RHBA 3GHAA 1AAZA 4RI7A 4YQVA 5ECIB 5DAKA 3FEUA 3KGKA 2H70A 1XBSA 4DSRA 5DJMA 4PTSA 1XOBA 4O7HA 5GAPD 3QOUA 2I81A 4KNDA 3TKRA 2GQLA 4K7OA 3GSSA 3I69A 2ES7A 3KEBA 1PGTA 2JZTA 3GMFA 1R4WA 1AIUA 2EIOA 3D4TA 3VPQA 5J3RA 2R6KA 3KH7A 3QPMA 4NMUA 3TB2A 1TK5B 1OKDA 3KM6A 2WCIA 1EOHA 3Q18A 4ZB6A 2PMTA 4HU7A 1UA5A 1T00A 3LYPA 1SKSB 2H6XA 4RI6A 2IFQA 5B6NA 4X0XA 3PH9A 4J2FA 5LD0A 1GSEA 4I6XA 2DIYA 1XZOA 1XIYA 3E0UA 1Y6EA 4PXOA 4L0WA 2B1LA 2P31A 2B5EA 4GLTA 3LYKA 2OACA 3EE2A 5AIVA 2FWFA 4KE3A 4KCAA 2DLXA 5DVBA 4KUNA 3QMXA 2GQMA 4Q5FA 3DYRA 2GQKA 1R7HA 2H0IA 2NDOA 4GQCA 5IMAA 3A2VA 4LA1A 1XXUA 4MJBA 2WZ9A 3WD6A 3FW2A 2CZ3A 3F4RA 3TOUA 3EWLA 3NOFA 5IPGA 1VF2A 4GWRA 3ZTLA 1VGLA 2OBIA 3ED3A 1F3AA 1A24A 4KW6A 2VLUA 3EURA 4ECCA 1FG4A 3J7Yk 1HNAA 2I4AA 2GT6A 5ENUA 1TTZA 1SYRA 4L5LA 3ZMLA 2P0GA 2KOKA 5E59A 2O8VB 4N11A 4FQUA 2L5OA 9GSSA 3WGDA 1XWKA 4WF5A 5ECOB 3DWVA 3NIVA 1J08A 3KMOA 3HY2A 1QUWA 3BBYA 1TRVA 3IAS2 1SENA 5AIXA 2OJLA 1U6TA 14GSA 3PPUA 4ZBBA 1Y25A 5F07A 1WRYA 5B8BA 2VCWA 3EU4A 2GTUA 4HQSA 4O5RA 4N0VA 3TOTA 2E2GA 1RW1A 3HJOA 3ERFA 2PU9C 1YEPA 4TR0A 2F3MA 1TP9A 1BQ7A 2CT6A 5INYA 2ZNMA 2IMKA 2DSAA 2UZ8A 2HI7A 4Q5QA 4J57E 5F8BA 4PX1A 1M7TA 1H4OA 4MF5A 2OBKA 4ZB9A 1X5EA 3ZFBA 8GSSA 1R5AA 3QFAC 3KP8A 1ZYEA 1M2AA 4N30A 3P8WA 2CA8A 3R3EA 3GRXA 3LWAA 1XCCA 4BVYA 1U3IA 5HR0A 4KA0A 4AJ7A 1SL1B 1PA3A 4O32A 2LRTA 3HZ4A 5ECQB 3FZAA 3EU3A 3QAVA 2JZSA 1NSWA 1KEBA 3KTLA 5CREA 3A2XA 1SK2A 1V40A 2N5AA 2C0DA 4YQUA 1OKTA 3QAWA 1DUGA 5JWQB 2GS3A 3GL5A 4AF2A 5HFKA 3IK9A 4K7IA 2JZRA 4PNFA 5H5QA 3UEMA 1EV4A 4J56E 3ZL5A 4EDZA 4G19A 1YKCA 5ELAA 3GFKA 2LJKA 4ID0A 5ECNB 2IN3A 3F4SA 2N5BA 2H73A 3DIEA 4GSSA 2G0FA 1WIKA 4IJIA 3HVSA 2H19A 1SJ6A 5KN2A 4K7NA 5H5SA 1NM3A 2VD0A 4MJCA 1W4VA 2C0GA 3F0IA 4MF6A 3H4KA 2KP2A 2YZHA 2BMXA 3O76A 4GF0A 1T4YA 3UOMA 3GH6A 4TXOA 5KN3A 4RQRA 2FD3A 3QD9A 2WB9A 2HSHA 1F6MC 2R5GA 3ZREA 1X5DA 2CVKA 5G31A 5A4WA 2YCDA 4YQMA 1AC1A 5H5RA 1HQOA 3F4TA 1JZRA 3KCMA 3S9FA 1YQ1A 1IYHA 3OR5A 1FB6A 2VLTA 3EINA 2FCHA 4K0GA 2IFQB 4PQ1A 3HJMA 2CQ9A 5JWOB 3O6TA 4FYCA 3RPNA 4LLRA 3VWUA 4D73B 4TRXA 4XS4B 4EL1A 3ZZXA 1F2EA 2VOCA 2H71A 3GV1A 3VI7A 3UARA 1TRSA 1X9WB 1M99A 4BL7A 1CQHA 1ZL9A 1SL0B 4TR4A 3FZ9A 4ZL8A 4G10A 3IA1A 1N8JA 1EV9A 2DJKA 3APQA 1SU9A 3IDVA 2VD1A 1SKWB 2NPBA 2HXKA 3HVXA 1F3BA 3KXOA 2DJ3A 1MD3A 1JLVA 5AGYA 4BVXA 4G0KA 4TR1A 5IO2A 1LJRA 5GSSA 2PUKC 2B6MA 2OE0A 2H75A 5ID2A 2B7KA 1EP8A 1AQWA 2RM5A 3SBCA 4PGTA 4HZ4A 13GSA 1V58A 1S3AA 2OKAA 3W8SA 1OC9B 3DVWA 2PERA 2NTOA 3DEXA 4WKWA 1OAZA 3G7IA 2IMDA 3BJ5A 3GKXA 3TJFA 4MLYA 3IOSA 4OFNA 4EC0A 1GUMA 2AYTA 2NBSA 1PN9A 5EL8A 3IBHA 3RBTA 1X0RA 2I3YA 5HR2A 4XCSA 5ECSA 3UMAA 3ERWA 4KSOA 2FLSA 3TJGA 4K6XA 2DJ1A 2DIZA 4LL4B 1WE0A 3UAPA 2F9SA 5HR1A 4WXTA 2CX3A 6GSYA 5ELGA 4X1UA 4V2NA 2HFDA 2HZEB 4KB3A 3G7JA 2L6DA 5D9VA 5ECLB 1V9WA 1K0MA 2M72A 2ALBA 1JZOA 2K8VA 3DRNA 2VCZA 5ECMB 1O8XA 5IPHA 3K8NA
chains in the Genus database with same CATH superfamily
4MA9A 4IP6A 3L4NA 1T8EB 3IC8A 1WOUA 4HSCX 6GSXA 4BVYB 1F9MA 4DSSA 3A5WA 1FO5A 3CSJA 4QQ7A 4IVFA 3D0ZA 1NHYA 3VLNA 2LNTA 6GSSA 4BPYA 1AXDA 2MZCA 4NAXA 3HDCA 4V1Ag 2GGTA 2X49A 3APOA 1O73A 2I9HA 1YY7A 2ON7A 1WWJA 4HJMA 4G9HA 4RQXA 5HR3A 5ECHB 5D93A 3CSHA 1G7OA 2HE3A 3FK8A 3VWXA 1E6BA 2ZCTA 3RPPA 2EFCA 2PGTA 5J5NA 3HHVA 2BJXA 4WR4A 1GP1A 1B48A 1GL8A 4IQ1A 3CRUA 2GZYA 4IGJA 1T4ZA 1GSSA 2C0EA 2GSRA 4WBJA 5AN1A 2FY6A 4BA7A 5BMUB 1GSFA 4O92A 2JSZA 3CTFA 3DMLA 5J40A 2A2SA 2VM2A 4YH2A 4K1FA 2H1GA 1VF4A 3HKRA 1Z7PA 5JCUA 2GZPA 4AKIA 3GA4A 4HDEA 4DEJA 2K6VA 1OE7A 3CTGA 2CX4A 1X5CA 5DCHA 6GSWA 1M9BA 4GQFA 2JSYA 2IJYA 3E9JB 3IPZA 5LNKe 1URMA 4H86A 1XWCA 1AUCA 3D4MA 1JZWA 3P2AA 2XPEA 1VRSD 1FAAA 2PVQA 1MTCA 4KH7A 3EVIA 4MP4A 3C7MA 1HNBA 3FR6A 4POBA 2H6ZA 2H1AA 3UL3A 2HSMB 2OE3A 5G30A 4EF0A 2F8FA 1Z3EA 4ZL9A 4PURA 3C73A 2HYXA 1A23A 2B1KA 2E2MA 1WP0A 5J4UA 1W89A 1Q98A 4EDYA 1YEWC 1T3BA 5J9CA 2OA7A 4TOPA 4K8MA 3P90A 4F03A 4WBRD 4CY6A 4HU9A 1TDIA 3RHCA 2A4HA 4DSQA 2YANA 1C72A 4KGIA 3IHQA 3LXTA 2WDUA 1GSQA 3IR4A 1F37A 2DC5A 22GSA 4KF9A 4ZBDA 4POMA 1B4QA 2GDRA 3ZFLA 4HJ2A 1XPVA 2H0GA 3VK9A 5DQSA 1U3AA 2VL2C 4TXVA 5DCGA 3VI5A 1PQNA 4IELA 5ABRA 5D73A 3TKPA 2O87A 2B3SA 4XS1A 5KEJA 3C71A 4MH2A 3M1GA 3A3TA 5G2ZA 1QQ2A 5EPFA 1Z9HA 5HQPA 3W8JA 1OE8A 2WJUA 1JLWA 4TKYA 4AKGA 4IW9A 2HRKA 3I43A 1M9AA 4IHUA 1ERWA 5G1LA 4MNNA 4BVXB 4NV2A 4GSNA 2N5FA 1JFUA 1MDJA 3LSZA 1BJXA 4G0IA 4EIQA 3GUSA 3GTUA 3CWGA 3HJPA 2H0HA 4ML1A 3RAZA 3ERGA 4OFTA 2R3XA 3L9SA 2JACA 5KOWA 3TUEA 1YZXA 3TJJA 1SVOA 1WMJA 3DD3A 1TXXA 3GSTA 1TRWA 3CBUA 5IOWA 2R2JA 3FHKA 1XVQA 1ERVA 5GSTA 3TGZA 2RUFA 2GSSA 1EGOA 2C3QA 3ZMKA 2WGRA 1EEMA 2DJ0A 2H8LA 1SVLA 3TJKA 2FHEA 1ON4A 2LRNA 2EFHA 3CXGA 2E0QA 1SJZA 3JCML 4EKZA 2MMAA 2RM6A 5COHA 4PQIA 1ABAA 3FZ4A 3L9UA 4ICYA 5FT3A 3EC3A 3UVHA 2YJHA 1YF0A 1MD4A 11GSA 4EUYA 4XIHA 4MZWA 2LQOA 1J9BA 2HSNB 1PSQA 3M9JA 2B7JA 1YJ6A 3LQ7A 1M0UA 3WGXA 3HVVA 4PUFC 2LTKA 5IQYA 2FUG2 1GRXA 4NXIA 1YEXA 2DBCA 3GKKA 5KN1A 2WW2A 2MMNA 1Z5YE 1XWBA 4Z7XA 1KBNA 4CDOA 3TU3B 2LQQA 2L4CA 3KH9A 1NHOA 3F6DA 1FOHA 4EE0A 3EMXA 4XRDA 3SWLA 1U88A 5CRHA 2B5XA 1N2AA 4WEYA 1EOGA 4EXJA 4XS6A 2FA4A 2LS5A 2FGXA 2CZ2A 1E2YA 3A2WA 2VCVA 3DKSA 4HEA2 5DAKB 1XW6A 5GZZB 1K0AA 2GVPA 2MBSA 4FYBA 1PL1A 2X8HA 4TN8A 3C1SA 1FB0A 3IAM2 4CW9A 4YAPA 1EEJA 2WRTA 1T7PB 3QR6A 1TRUA 5HFGA 3F3QA 3MIXA 2G2QA 3LORA 4ILFA 1K0OA 4ECIA 2RUEA 3H8QA 5DALA 1PN0A 1SK1A 4V2LA 1RQMA 1Z7RA 2R37A 3BCKA 2DKIA 2J9HA 4JZQA 2F51A 4OMVA 1TXUA 4I5QA 3UVTA 4EIPA 3D5JA 2QKEA 4ACSA 1A0FA 1I1IP 2HZFA 3TRQA 4MABA 5IO0A 2V6KA 2YWMA 3CQFA 4OD7A 4IP1A 3UJ1A 5CAXA 3GKMA 1OYJA 2EFEA 7GSSA 4K0NA 1A0RP 3QCPA 4AJ8A 4HS1A 1JZDA 1U87A 4JE1A 3I9V2 1HD2A 5IMDA 1T1VA 4OWYA 3FYGA 4YAVA 4OO4A 10GSA 3UBKA 2KP1A 4K2DA 5F05A 2DMMA 3BD2A 1BYEA 5A5KA 5JCWA 4I2UA 4HZ2A 4KSMA 5DDLA 2I1UA 1TI1A 1V57A 1XOAA 3KMNA 4IS0A 2RLIA 1TKDB 1GSDA 1K3YA 1YKAA 2IIYA 3TRXA 1FHEA 2VM1A 1BEDA 1XFLA 2HNLA 2L4QA 4KAEA 3ZVJD 3L78A 2FWGA 2OADA 3D6IA 2CV4A 3TRPA 3KTBA 3EMPA 4IN0A 3HYPA 2VUPA 1ML6A 1XG8A 2IMFA 2VL9A 3IK7A 1QK8A 3FRCA 3TKSE 5DJLA 1QMVA 2QC7A 2PWJA 2H74A 2QA2A 2C8UA 3L9VA 1GLPA 3UIWA 4YKGA 2H1BA 18GSA 4I8BA 16GSA 2H76A 19GSA 1EWXA 2WVXB 3TKSC 3MWHA 2HQTA 3ZIJA 1ERTA 3H93A 3CRTA 4V2MA 2FWHA 1I5GA 3F6FA 3KP9A 1TK8B 3EYTA 3D21A 2AHEA 4FH8A 4NHWA 5A4VA 5KN0A 4F0CA 1GNWA 1RK4A 1EP7A 2H72A 3I6AA 4PQHA 1AW9A 2HSYA 2YZUA 1VF1A 2GSTA 1SK0A 3MAKA 3WYWA 3TJBA 2HRFA 1G0TA 2IMEA 1KNGA 1GTIA 2K9FA 4PUAA 2YV9A 1K0DA 4YKFA 4MZCA 2BTOT 2PVOC 4XTSA 4GTUA 1ZYPA 1PL2A 1KTEA 3U5RE 1LBKA 3RDWA 1DE2A 3LEFA 4MH3A 3HA9A 3ZITA 1WPIA 2YWOA 2AB6A 2VL2A 4F2IA 2KHPA 6GSVA 4NHZA 4I2TA 1R26A 5IM9A 5JWRB 4HI7A 4RUVA 2VO4A 1SKRB 2C80A 1GTBA 4JR6A 3LG6A 4BWSA 1LU4A 5IMZA 4TR3A 2XBIA 2AAWA 2C3NA 3WT1A 4EO3A 4MK3A 2DMLA 5CNWA 2MBTA 1TJDA 5CRWA 5IMFA 2LJRA 1BAYA 4IKHA 3N5OA 6GSUA 4KDXA 5D8IA 1MDIA 1GUHA 2YV7A 2YWNA 4G2EA 4AGSA 3HZ8A 2A4VA 5J4YA 3Q6OA 2H1LA 2B5YA 5D9TA 5AISA 3CMIA 3TCOA 4X4JA 5A5HB 1GSYA 2XPDA 2X8CA 5DQYA 1O8WA 4GXZA 4LL1B 4E8EA 2C1YA 2HLSA 6GSTA 5G5FA 4ULXA 3M9KA 2VLVA 4AJ6A 5EVOA 1ZOFA 5IOXA 5D9XA 1G6WA 2P5RA 4GCIA 3LJRA 4IBPA 1JHBA 3VURA 1ST9A 4OCEA 2VIMA 3U6VA 2EIRA 5CRGA 2TIRA 1BG5A 1S3CA 3F8UA 2GT5A 4V1Ap 4D73A 4TXOB 2NVLA 1HYUA 4XS4A 1SJIA 1B9YC 5CP1A 1YDKA 3DVXA 3HXSA 2AJQB 2O3EA 3MDKA 1M2DA 1O6JA 1GUKA 4AI6A 1GH2A 3CSIA 2E7PA 3D22A 1M3JA 2WS2A 1A2LA 5CYYA 5DALB 1CQGA 4N10A 2ON5A 2IPAA 3F3RA 2TRCP 5GAND 5A34A 1K3OA 2JADA 3MNGA 5IMVA 2Z9SA 4PHZC 3TKQA 2LJAA 1MDKA 2LUSA 1THXA 2VL3A 2D2ZA 3ZRDA 3F63A 4KDYA 5ECKB 5B7CA 2OT3A 2VCQA 5B6MA 3PR8A 2AV4A 3FY7A 5B8AA 3KD0A 4ZIJA 4ZB8A 4OCFA 1BX9A 2EIQA 4QL9A 4MJEA 1XWGA 2LKUA 3KIJA 4BL7B 1R5PA 2EC4A 3FR9A 2O85A 1OC9A 4MPFA 1V98A 3G9BA 1PKZA 2F8AA 1K0NA 2GLRA 2FWEA 4USSA 4X43A 3DXBA 4N0ZA 4HOJA 4JR4A 3VWVA 1Z6MA 1THOA 4O5UA 1OVNA 1IYIA 4TR1B 4ML6A 5JCGA 2TRXA 4BWQA 5ID2B 2M46A 4WETA 4JU5A 4ECJA 1PX6A 1G6YA 2X4AA 2H66A 3HD5A 4MJAA 2LEGA 2X99A 4GRFA 4KX4A 3UBLA 1SD9A 4QL7A 3PINA 3WT2A 2CVDA 2HZEA 2H30A 2OE1A 1HNCA 3H1NA 4ECBA 3J7Yb 2R0CA 3NZNA 3CYNA 4E68A 3IXRA 2YPMA 1GWCA 4Q5NA 3FKFA 2AUVA 1TOFA 1USBA 2IWTA 5FWGA 2YNXA 5DBQA 1ZGNA 1SL2B 1TU8A 3P7XA 1UVZA 1GNEA 2O89A 2DJJA 1WJKA 2L5LA 4I97A 12GSA 1FW1A 1DBYA 3QDNA 3IV4A 3FMWA 1K0BA 4F0BA 1TW9A 2HRNA 4KDUA 5FHIA 2WVYA 2FNOA 1X9SB 3W6GA 2C3TA 2XBQA 3Q19A 1DSBA 1AQVA 4TVEA 2X64A 3ZIVA 4MMMA 1O7UA 2R4VA 2YP6A 2O7KA 2A2RA 1I9DA 3ME8A 2YWIA 1ZYQB 2WVZA 4MF7A 3MSZA 1XW9A 1ZZYA 2REMA 2YOIA 2J23A 2L57A 2PN8A 1FVKA 1YF1A 1ZMAA 4MCUA 1NW2A 1FVJA 1J0FA 3E3EA 2X8GA 1TK0B 4XHMA 1SD8A 1UC7A 5IMCA 4DSSB 4BIKA 1V2AA 5BMUA 3GL3A 1ACVA 1GTAA 3FZ5A 3TKSA 2GSQA 4JBBA 4L5OA 2WZSA 4LMWA 4KCEA 4MDCA 2XC2A 3LGCA 4FYUA 4JEDA 3N9JA 2PPTA 3US3A 4F9ZA 1M2BA 3C8EA 5C04A 3GYKA 2LNSA 2V6OA 3QAGA 1TU7A 5J41A 3FR3A 2L6CA 1XWAA 4K2XA 3GX8A 2QGVA 1GSUA 4L8EA 5E4WA 1O85A 3C1RA 5ECRB 3M3MA 2HT9A 5L71A 4K5SA 2HSMA 2MMZA 3GURA 3V1WA 1QXHA 4ZXGA 3APSA 5IIZA 1XVWA 4P3YB 5J9BA 3R2QA 2WULA 1K0CA 2IL3A 3GNJA 4MZBA 4L0UA 2YJ7A 3GKNA 2RIIA 3DGQA 3LXZA 1G7EA 2VCTA 2V41A 1PMTA 1H75A 3M8NA 1GULA 4IJ3A 4ISDA 3VFIA 1VF3A 3LFLA 5EY6A 2V1MA 4OO5A 4GSTA 17GSA 3PGTA 3G7YA 2MYGA 2P5QA 4WR5A 1XW5A 4EVMA 3BOAA 1S3RA 2YN1A 2PBJA 4FIWA 20GSA 1M3IA 4XRAA 2GZZA 4POKA 2H1DA 1A2MA 2LSTA 1K3LA 2JL4A 5ECPB 1B8XA 5F0GA 5C00A 1B4PA 5KOXA 2V32A 2IMIA 2H01A 1QFNA 5HFIA 1UN2A 1Z6NA 4HUAA 3TDGA 2K18A 4WF4A 5A4UA 3F9UA 3O3TA 3ISOA 5CRDA 2L59A 2ZUPA 4HQZA 3RFRC 1EZKA 4ZBAA 3VWWA 2CAQA 3H79A 4JRRA 3IC4A 4E8HA 3BCIA 1X9MB 2LV3A 4CY8A 4FO5A 2HRAA 3L0HA 4MPGA 2C4JA 3WGEA 2M80A 3M0FA 3KZQA 1ERUA 3VPTA 1AQXA 4PNGA 3GIXA 1GLQA 4NWYA 1A8LA 3GH9A 2VAFA 1QGVA 2FA8A 1DE1A 1SYXA 2HRKB 2H6YA 1EGRA 2XHFA 3ZVJA 4NV5A 4DVCA 2CAIA 2DJ2A 2QSIA 1ZCPA 3ME7A 1PX7A 5LCZA 3ZYWA 1S3DA 4G0LA 4TW5A 3GX0A 2KLXA 5G5EA 3AY8A 3GTUB 2MMOA 4Q5RA 2JU5A 2KUCA 3HVNA 1OC8A 4OFMA 1PD21 4ZL7A 3GN3A 4IQAA 5F06A 3QFBC 2HSNA 1BG1A 5D96A 1MEKA 4CHSA 4PI0C 2K8SA 2R0GA 4AKHA 1PRXA 4K9ZA 3ZLPA 2V2GA 3IE3A 5D9WA 2VCXA 4POLA 4ZILA 1FOVA 4W66A 1O81A 4O5QA 1Q4JA 2C0FA 1A8YA 1B9XC 3Q74A 4LMVA 2LRCA 3KJYA 4F82A 1A2JA 1BF5A 3HCZA 5G1KA 1TI3A 1PKWA 3IRAA 2CVBA 1ILOA 2WFCA 1OC3A 4NPBA 5CO3A 1GTUA 3RHBA 3GHAA 1AAZA 5J4VA 4RI7A 4YQVA 5ECIB 5DAKA 3FEUA 3KGKA 2H70A 1XBSA 4DSRA 5DJMA 4PTSA 1XOBA 4O7HA 5GAPD 3QOUA 2I81A 4KNDA 3TKRA 2GQLA 4K7OA 3GSSA 3I69A 2ES7A 3KEBA 1PGTA 2JZTA 3GMFA 1R4WA 1AIUA 2EIOA 3D4TA 3VPQA 5J3RA 2R6KA 3KH7A 3QPMA 4NMUA 3TB2A 5BRTA 1TK5B 2WW1A 1OKDA 3KM6A 2WCIA 1EOHA 3Q18A 4ZB6A 2PMTA 4HU7A 1UA5A 1T00A 3LYPA 1SKSB 2H6XA 4RI6A 2IFQA 5B6NA 4X0XA 3PH9A 4J2FA 5LD0A 1GSEA 4I6XA 2DIYA 1XZOA 1XIYA 3E0UA 1Y6EA 4PXOA 4L0WA 2B1LA 2P31A 2B5EA 4GLTA 3LYKA 2OACA 2R0PA 3EE2A 5AIVA 2FWFA 4KE3A 4KCAA 2DLXA 5DVBA 4KUNA 4K5RA 4N3ZA 3QMXA 2GQMA 4Q5FA 3DYRA 2GQKA 1R7HA 2H0IA 2NDOA 4GQCA 5IMAA 3A2VA 4LA1A 1XXUA 4MJBA 2WZ9A 3WD6A 1N25A 3FW2A 4Z2RA 2CZ3A 3F4RA 3RGBC 3TOUA 3EWLA 3NOFA 5IPGA 5A1NA 1VF2A 4GWRA 3ZTLA 1VGLA 2OBIA 3ED3A 1F3AA 1A24A 4KW6A 2VLUA 3EURA 4ECCA 2EFDA 1FG4A 3J7Yk 1HNAA 4GDFA 2I4AA 2GT6A 5ENUA 1Y1UA 1TTZA 3MYDA 1SYRA 4L5LA 3ZMLA 2P0GA 2KOKA 4ZB7A 5E59A 2O8VB 3IHGA 4N11A 4FQUA 2L5OA 9GSSA 3WGDA 1XWKA 3CHXC 1ZYNA 4WF5A 5ECOB 3DWVA 1S4BP 3NIVA 1J08A 3KMOA 2WVXA 3HY2A 1QUWA 3BBYA 1TRVA 3IAS2 1SENA 5AIXA 2OJLA 1U6TA 14GSA 2O36A 3PPUA 4ZBBA 1Y25A 5F07A 1WRYA 5B8BA 2VCWA 3EU4A 2GTUA 4HQSA 4O5RA 4N0VA 3TOTA 2E2GA 1RW1A 3HJOA 2QA1A 3ERFA 2PU9C 1YEPA 4TR0A 2F3MA 1TP9A 1PFOA 4Z2TA 1BQ7A 2CT6A 5INYA 2ZNMA 2IMKA 2DSAA 2UZ8A 2HI7A 4Q5QA 4J57E 5F8BA 4PX1A 1M7TA 1H4OA 4MF5A 2OBKA 4ZB9A 1X5EA 3ZFBA 8GSSA 1R5AA 3QFAC 3KP8A 1ZYEA 1M2AA 4N30A 3P8WA 2CA8A 3R3EA 3GRXA 3LWAA 1XCCA 4BVYA 1U3IA 5HR0A 4KA0A 4AJ7A 1SVMA 2WW3A 1SL1B 1PA3A 4O32A 2LRTA 3HZ4A 5ECQB 3FZAA 3EU3A 4AKXB 3QAVA 2JZSA 1NSWA 1KEBA 3KTLA 5CREA 3A2XA 1SK2A 1V40A 2N5AA 2C0DA 4YQUA 1OKTA 3QAWA 1DUGA 5JWQB 2GS3A 3GL5A 4AF2A 5HFKA 3IK9A 4K7IA 2JZRA 4PNFA 5H5QA 3UEMA 1EV4A 2A2PA 4J56E 3ZL5A 4EDZA 4G19A 1YKCA 5ELAA 3GFKA 2LJKA 4ID0A 5ECNB 2IN3A 3F4SA 5A5HA 2N5BA 2H73A 3DIEA 4GSSA 4A5PA 2G0FA 1WIKA 4IJIA 3HVSA 2H19A 1SJ6A 5KN2A 4K7NA 5H5SA 1NM3A 2VD0A 4MJCA 1W4VA 2C0GA 3F0IA 4MF6A 3H4KA 2KP2A 2YZHA 4QMKA 2BMXA 3O76A 4GF0A 1T4YA 3UOMA 3GH6A 4TXOA 5KN3A 4RQRA 2FD3A 3QD9A 4FXYP 2WB9A 2HSHA 1F6MC 2R5GA 3ZREA 1X5DA 2CVKA 5G31A 3EPTA 5A4WA 2YCDA 4YQMA 1AC1A 5H5RA 1HQOA 3F4TA 1JZRA 3KCMA 3S9FA 1YQ1A 1IYHA 3OR5A 1FB6A 2VLTA 3EINA 2FCHA 4K0GA 2IFQB 4PQ1A 3HJMA 2CQ9A 5JWOB 3O6TA 4FYCA 3RPNA 4LLRA 3VWUA 4D73B 4TRXA 2DKHA 4XS4B 4EL1A 3ZZXA 1F2EA 2VOCA 2H71A 3GV1A 3VI7A 3UARA 1TRSA 4PI2C 2O5VA 1X9WB 1M99A 4BL7A 1CQHA 1ZL9A 5A34B 1SL0B 4TR4A 3FZ9A 4ZL8A 4G10A 3IA1A 1N8JA 1EV9A 2DJKA 3APQA 1SU9A 3IDVA 1YVLA 2VD1A 4G01A 1SKWB 2NPBA 2HXKA 3HVXA 5A1NB 1F3BA 3KXOA 2VKZG 2DJ3A 1MD3A 1JLVA 5AGYA 4Z2UA 4BVXA 4G0KA 4TR1A 5IO2A 1LJRA 5GSSA 2PUKC 3LW9A 2B6MA 2OE0A 2H75A 5ID2A 2B7KA 1EP8A 1AQWA 2RM5A 3SBCA 4PGTA 4HZ4A 13GSA 3HMJG 1V58A 1S3AA 2OKAA 3W8SA 1OC9B 3DVWA 2PERA 2NTOA 3DEXA 4WKWA 1OAZA 3G7IA 2IMDA 3BJ5A 2WW0A 3GKXA 3TJFA 4MLYA 3IOSA 4OFNA 4EC0A 1GUMA 2UV8G 3A5IA 2AYTA 2NBSA 1PN9A 5EL8A 3IBHA 3RBTA 1X0RA 2I3YA 5HR2A 4XCSA 5ECSA 3UMAA 3ERWA 4KSOA 2FLSA 3TJGA 4K6XA 2DJ1A 2DIZA 4LL4B 1WE0A 3UAPA 2F9SA 5HR1A 4WXTA 2CX3A 6GSYA 5ELGA 4X1UA 4V2NA 2HFDA 2HZEB 4KB3A 3G7JA 2L6DA 5D9VA 5ECLB 1V9WA 1K0MA 2M72A 2ALBA 1JZOA 2K8VA 3DRNA 5J47A 2VCZA 5ECMB 1O8XA 5IPHA 3K8NA
chains in the Genus database with same CATH topology
4MA9A 4IP6A 3L4NA 1T8EB 3IC8A 1WOUA 6GSXA 4BVYB 1F9MA 4DSSA 3A5WA 1FO5A 3CSJA 4QQ7A 4IVFA 3D0ZA 1NHYA 3VLNA 2LNTA 6GSSA 4BPYA 1AXDA 2MZCA 4NAXA 3HDCA 4V1Ag 2GGTA 2X49A 3APOA 1O73A 2I9HA 1YY7A 2ON7A 1WWJA 4HJMA 4G9HA 4RQXA 5HR3A 5ECHB 5D93A 3CSHA 1G7OA 2HE3A 3FK8A 3VWXA 1E6BA 2ZCTA 3RPPA 2EFCA 2PGTA 5J5NA 3HHVA 2BJXA 4WR4A 1GP1A 1B48A 1GL8A 4IQ1A 3CRUA 2GZYA 4IGJA 1T4ZA 1GSSA 2C0EA 2GSRA 4WBJA 5AN1A 2FY6A 4BA7A 5BMUB 1GSFA 4O92A 2JSZA 3CTFA 3DMLA 5J40A 2A2SA 2VM2A 4YH2A 4K1FA 2H1GA 1VF4A 3HKRA 1Z7PA 5JCUA 2GZPA 4AKIA 3GA4A 4HDEA 4DEJA 2K6VA 1OE7A 3CTGA 2CX4A 1X5CA 5DCHA 6GSWA 1M9BA 4GQFA 2JSYA 2IJYA 3E9JB 3IPZA 5LNKe 1URMA 4H86A 1XWCA 1AUCA 3D4MA 1JZWA 3P2AA 2XPEA 1VRSD 1FAAA 2PVQA 1MTCA 4KH7A 3EVIA 4MP4A 3C7MA 1HNBA 3FR6A 4POBA 2H6ZA 2H1AA 3UL3A 2HSMB 2OE3A 5G30A 4EF0A 2F8FA 1Z3EA 4ZL9A 4PURA 3C73A 2HYXA 1A23A 2B1KA 2E2MA 1WP0A 5J4UA 1W89A 1Q98A 4EDYA 1T3BA 5J9CA 2OA7A 4TOPA 4K8MA 3P90A 4F03A 4WBRD 4CY6A 4HU9A 1TDIA 3RHCA 2A4HA 4DSQA 2YANA 1C72A 4KGIA 3IHQA 3LXTA 2WDUA 1GSQA 3IR4A 1F37A 2DC5A 22GSA 4KF9A 4ZBDA 4POMA 1B4QA 2GDRA 3ZFLA 4HJ2A 1XPVA 2H0GA 3VK9A 5DQSA 1U3AA 2VL2C 4TXVA 5DCGA 3VI5A 1PQNA 4IELA 5ABRA 5D73A 3TKPA 2O87A 2B3SA 4XS1A 5KEJA 3C71A 4MH2A 3M1GA 3A3TA 5G2ZA 1QQ2A 5EPFA 1Z9HA 5HQPA 3W8JA 1OE8A 2WJUA 1JLWA 4TKYA 4AKGA 4IW9A 2HRKA 3I43A 1M9AA 4IHUA 1ERWA 5G1LA 4MNNA 4BVXB 4NV2A 4GSNA 2N5FA 1JFUA 1MDJA 3LSZA 1BJXA 4G0IA 4EIQA 3GUSA 3GTUA 3CWGA 3HJPA 2H0HA 4ML1A 3RAZA 3ERGA 4OFTA 2R3XA 3L9SA 2JACA 5KOWA 3TUEA 1YZXA 3TJJA 1SVOA 1WMJA 3DD3A 1TXXA 3GSTA 1TRWA 3CBUA 5IOWA 2R2JA 3FHKA 1XVQA 1ERVA 5GSTA 3TGZA 2RUFA 2GSSA 1EGOA 2C3QA 3ZMKA 2WGRA 1EEMA 2DJ0A 2H8LA 1SVLA 3TJKA 2FHEA 1ON4A 2LRNA 2EFHA 3CXGA 2E0QA 1SJZA 3JCML 4EKZA 2MMAA 2RM6A 5COHA 4PQIA 1ABAA 3FZ4A 3L9UA 4ICYA 5FT3A 3EC3A 3UVHA 2YJHA 1YF0A 1MD4A 11GSA 4EUYA 4XIHA 4MZWA 2LQOA 1J9BA 2HSNB 1PSQA 3M9JA 2B7JA 1YJ6A 3LQ7A 1M0UA 3WGXA 3HVVA 4PUFC 2LTKA 5IQYA 2FUG2 1GRXA 4NXIA 1YEXA 2DBCA 3GKKA 5KN1A 2MMNA 1Z5YE 1XWBA 4Z7XA 1KBNA 4CDOA 3TU3B 2LQQA 2L4CA 3KH9A 1NHOA 3F6DA 1FOHA 4EE0A 3EMXA 4XRDA 3SWLA 1U88A 5CRHA 2B5XA 1N2AA 4WEYA 1EOGA 4EXJA 4XS6A 2FA4A 2LS5A 2FGXA 2CZ2A 1E2YA 3A2WA 2VCVA 3DKSA 4HEA2 5DAKB 1XW6A 5GZZB 1K0AA 2GVPA 2MBSA 4FYBA 1PL1A 2X8HA 4TN8A 3C1SA 1FB0A 3IAM2 4CW9A 4YAPA 1EEJA 2WRTA 1T7PB 3QR6A 1TRUA 5HFGA 3F3QA 3MIXA 2G2QA 3LORA 4ILFA 1K0OA 4ECIA 2RUEA 3H8QA 5DALA 1PN0A 1SK1A 4V2LA 1RQMA 1Z7RA 2R37A 3BCKA 2DKIA 2J9HA 4JZQA 2F51A 4OMVA 1TXUA 4I5QA 3UVTA 4EIPA 3D5JA 2QKEA 4ACSA 1A0FA 2HZFA 3TRQA 4MABA 5IO0A 2V6KA 2YWMA 4OD7A 4IP1A 3UJ1A 5CAXA 3GKMA 1OYJA 2EFEA 7GSSA 4K0NA 1A0RP 3QCPA 4AJ8A 4HS1A 1JZDA 1U87A 4JE1A 3I9V2 1HD2A 5IMDA 1T1VA 4OWYA 3FYGA 4YAVA 4OO4A 10GSA 3UBKA 2KP1A 4K2DA 5F05A 2DMMA 3BD2A 1BYEA 5A5KA 5JCWA 4I2UA 4HZ2A 4KSMA 5DDLA 2I1UA 1TI1A 1V57A 1XOAA 3KMNA 4IS0A 2RLIA 1TKDB 1GSDA 1K3YA 1YKAA 2IIYA 3TRXA 1FHEA 2VM1A 1BEDA 1XFLA 2HNLA 2L4QA 4KAEA 3ZVJD 3L78A 2FWGA 2OADA 3D6IA 2CV4A 3TRPA 3KTBA 3EMPA 4IN0A 3HYPA 2VUPA 1ML6A 2IMFA 2VL9A 3IK7A 1QK8A 3FRCA 3TKSE 5DJLA 1QMVA 2QC7A 2PWJA 2H74A 2QA2A 2C8UA 3L9VA 1GLPA 3UIWA 4YKGA 2H1BA 18GSA 4I8BA 16GSA 2H76A 19GSA 1EWXA 3TKSC 3MWHA 2HQTA 3ZIJA 1ERTA 3H93A 3CRTA 4V2MA 2FWHA 1I5GA 3F6FA 3KP9A 1TK8B 3EYTA 3D21A 2AHEA 4FH8A 4NHWA 5A4VA 5KN0A 4F0CA 1GNWA 1RK4A 1EP7A 2H72A 3I6AA 4PQHA 1AW9A 2HSYA 2YZUA 1VF1A 2GSTA 1SK0A 3MAKA 3WYWA 3TJBA 2HRFA 1G0TA 2IMEA 1KNGA 1GTIA 2K9FA 4PUAA 2YV9A 1K0DA 4YKFA 4MZCA 2BTOT 2PVOC 4XTSA 4GTUA 1ZYPA 1PL2A 1KTEA 3U5RE 1LBKA 3RDWA 1DE2A 3LEFA 4MH3A 3HA9A 3ZITA 1WPIA 2YWOA 2AB6A 2VL2A 4F2IA 2KHPA 6GSVA 4NHZA 4I2TA 1R26A 5IM9A 5JWRB 4HI7A 4RUVA 2VO4A 1SKRB 2C80A 1GTBA 4JR6A 3LG6A 4BWSA 1LU4A 5IMZA 4TR3A 2XBIA 2AAWA 2C3NA 3WT1A 4EO3A 4MK3A 2DMLA 5CNWA 2MBTA 1TJDA 5CRWA 5IMFA 2LJRA 1BAYA 4IKHA 3N5OA 6GSUA 4KDXA 5D8IA 1MDIA 1GUHA 2YV7A 2YWNA 4G2EA 4AGSA 3HZ8A 2A4VA 5J4YA 3Q6OA 2H1LA 2B5YA 5D9TA 5AISA 3CMIA 3TCOA 4X4JA 5A5HB 1GSYA 2XPDA 2X8CA 5DQYA 1O8WA 4GXZA 4LL1B 4E8EA 2C1YA 2HLSA 6GSTA 5G5FA 4ULXA 3M9KA 2VLVA 4AJ6A 5EVOA 1ZOFA 5IOXA 5D9XA 1G6WA 2P5RA 4GCIA 3LJRA 4IBPA 1JHBA 3VURA 1ST9A 4OCEA 2VIMA 3U6VA 2EIRA 5CRGA 2TIRA 1BG5A 1S3CA 3F8UA 2GT5A 4V1Ap 4D73A 4TXOB 2NVLA 1HYUA 4XS4A 1SJIA 1B9YC 5CP1A 1YDKA 3DVXA 3HXSA 2AJQB 3MDKA 1M2DA 1O6JA 1GUKA 4AI6A 1GH2A 3CSIA 2E7PA 3D22A 2WS2A 1A2LA 5CYYA 5DALB 1CQGA 4N10A 2ON5A 2IPAA 3F3RA 2TRCP 5GAND 5A34A 1K3OA 2JADA 3MNGA 5IMVA 2Z9SA 3TKQA 2LJAA 1MDKA 2LUSA 1THXA 2VL3A 2D2ZA 3ZRDA 3F63A 4KDYA 5ECKB 5B7CA 2OT3A 2VCQA 5B6MA 3PR8A 2AV4A 3FY7A 5B8AA 3KD0A 4ZIJA 4ZB8A 4OCFA 1BX9A 2EIQA 4QL9A 4MJEA 1XWGA 2LKUA 3KIJA 4BL7B 1R5PA 2EC4A 3FR9A 2O85A 1OC9A 4MPFA 1V98A 3G9BA 1PKZA 2F8AA 1K0NA 2GLRA 2FWEA 4USSA 4X43A 3DXBA 4N0ZA 4HOJA 4JR4A 3VWVA 1Z6MA 1THOA 4O5UA 1OVNA 1IYIA 4TR1B 4ML6A 5JCGA 2TRXA 4BWQA 5ID2B 2M46A 4WETA 4JU5A 4ECJA 1PX6A 1G6YA 2X4AA 2H66A 3HD5A 4MJAA 2LEGA 2X99A 4GRFA 4KX4A 3UBLA 1SD9A 4QL7A 3PINA 3WT2A 2CVDA 2HZEA 2H30A 2OE1A 1HNCA 3H1NA 4ECBA 3J7Yb 2R0CA 3NZNA 3CYNA 4E68A 3IXRA 2YPMA 1GWCA 4Q5NA 3FKFA 2AUVA 1TOFA 1USBA 2IWTA 5FWGA 2YNXA 5DBQA 1ZGNA 1SL2B 1TU8A 3P7XA 1UVZA 1GNEA 2O89A 2DJJA 1WJKA 2L5LA 4I97A 12GSA 1FW1A 1DBYA 3QDNA 3IV4A 1K0BA 2HRNA 4F0BA 1TW9A 3FMWA 4KDUA 5FHIA 2FNOA 1X9SB 3W6GA 2C3TA 2XBQA 3Q19A 1DSBA 1AQVA 4TVEA 2X64A 3ZIVA 4MMMA 1O7UA 2R4VA 2YP6A 2O7KA 2A2RA 1I9DA 3ME8A 2YWIA 1ZYQB 4MF7A 3MSZA 1XW9A 1ZZYA 2REMA 2YOIA 2J23A 2L57A 2PN8A 1FVKA 1YF1A 1ZMAA 4MCUA 1NW2A 1FVJA 1J0FA 3E3EA 2X8GA 1TK0B 4XHMA 1SD8A 1UC7A 5IMCA 4DSSB 1V2AA 5BMUA 3GL3A 1ACVA 1GTAA 3FZ5A 3TKSA 2GSQA 4JBBA 4L5OA 4LMWA 4KCEA 4MDCA 2XC2A 3LGCA 4FYUA 4JEDA 3N9JA 2PPTA 3US3A 4F9ZA 1M2BA 3C8EA 5C04A 3GYKA 2LNSA 2V6OA 3QAGA 1TU7A 5J41A 3FR3A 2L6CA 1XWAA 4K2XA 3GX8A 2QGVA 1GSUA 4L8EA 5E4WA 1O85A 3C1RA 5ECRB 3M3MA 2HT9A 5L71A 4K5SA 2HSMA 2MMZA 3GURA 3V1WA 1QXHA 4ZXGA 3APSA 5IIZA 1XVWA 4P3YB 5J9BA 3R2QA 2WULA 1K0CA 2IL3A 3GNJA 4MZBA 4L0UA 2YJ7A 3GKNA 2RIIA 3DGQA 3LXZA 1G7EA 2VCTA 2V41A 1PMTA 1H75A 3M8NA 1GULA 4IJ3A 4ISDA 3VFIA 1VF3A 3LFLA 5EY6A 2V1MA 4OO5A 4GSTA 17GSA 3PGTA 3G7YA 2MYGA 2P5QA 4WR5A 1XW5A 4EVMA 3BOAA 2YN1A 2PBJA 4FIWA 20GSA 4XRAA 2GZZA 4POKA 2H1DA 1A2MA 2LSTA 1K3LA 2JL4A 5ECPB 1B8XA 5F0GA 5C00A 1B4PA 5KOXA 2V32A 2IMIA 2H01A 1QFNA 5HFIA 1UN2A 1Z6NA 4HUAA 3TDGA 2K18A 4WF4A 5A4UA 3F9UA 3O3TA 3ISOA 5CRDA 2L59A 2ZUPA 4HQZA 1EZKA 4ZBAA 3VWWA 2CAQA 3H79A 4JRRA 3IC4A 4E8HA 3BCIA 1X9MB 2LV3A 4CY8A 4FO5A 2HRAA 3L0HA 4MPGA 2C4JA 3WGEA 2M80A 3M0FA 3KZQA 1ERUA 3VPTA 1AQXA 4PNGA 3GIXA 1GLQA 4NWYA 1A8LA 3GH9A 2VAFA 1QGVA 2FA8A 1DE1A 1SYXA 2HRKB 2H6YA 1EGRA 2XHFA 3ZVJA 4NV5A 4DVCA 2CAIA 2DJ2A 2QSIA 1ZCPA 3ME7A 1PX7A 5LCZA 3ZYWA 1S3DA 4G0LA 4TW5A 3GX0A 2KLXA 5G5EA 3AY8A 3GTUB 2MMOA 4Q5RA 2JU5A 2KUCA 1OC8A 4OFMA 1PD21 4ZL7A 3GN3A 4IQAA 5F06A 3QFBC 2HSNA 1BG1A 5D96A 1MEKA 4CHSA 2K8SA 2R0GA 4AKHA 1PRXA 4K9ZA 3ZLPA 2V2GA 3IE3A 5D9WA 2VCXA 4POLA 4ZILA 1FOVA 4W66A 1O81A 4O5QA 1Q4JA 2C0FA 1A8YA 1B9XC 3Q74A 4LMVA 2LRCA 3KJYA 4F82A 1A2JA 1BF5A 3HCZA 5G1KA 1TI3A 1PKWA 3IRAA 2CVBA 1ILOA 2WFCA 1OC3A 4NPBA 5CO3A 1GTUA 3RHBA 3GHAA 1AAZA 5J4VA 4RI7A 4YQVA 5ECIB 5DAKA 3FEUA 3KGKA 2H70A 1XBSA 4DSRA 5DJMA 4PTSA 1XOBA 4O7HA 5GAPD 3QOUA 2I81A 4KNDA 3TKRA 2GQLA 4K7OA 3GSSA 3I69A 2ES7A 3KEBA 1PGTA 2JZTA 3GMFA 1R4WA 1AIUA 2EIOA 3D4TA 3VPQA 5J3RA 2R6KA 3KH7A 3QPMA 4NMUA 3TB2A 5BRTA 1TK5B 1OKDA 3KM6A 2WCIA 1EOHA 3Q18A 4ZB6A 2PMTA 4HU7A 1UA5A 1T00A 3LYPA 1SKSB 2H6XA 4RI6A 2IFQA 5B6NA 4X0XA 3PH9A 4J2FA 5LD0A 1GSEA 4I6XA 2DIYA 1XZOA 1XIYA 3E0UA 1Y6EA 4PXOA 4L0WA 2B1LA 2P31A 2B5EA 4GLTA 3LYKA 2OACA 2R0PA 3EE2A 5AIVA 2FWFA 4KE3A 4KCAA 2DLXA 5DVBA 4KUNA 4K5RA 4N3ZA 3QMXA 2GQMA 4Q5FA 3DYRA 2GQKA 1R7HA 2H0IA 2NDOA 4GQCA 5IMAA 3A2VA 4LA1A 1XXUA 4MJBA 2WZ9A 3WD6A 1N25A 3FW2A 4Z2RA 2CZ3A 3F4RA 3NOFA 3TOUA 3EWLA 5IPGA 5A1NA 1VF2A 4GWRA 3ZTLA 1VGLA 2OBIA 3ED3A 1F3AA 1A24A 4KW6A 2VLUA 3EURA 4ECCA 2EFDA 1FG4A 3J7Yk 1HNAA 4GDFA 2I4AA 2GT6A 5ENUA 1Y1UA 1TTZA 3MYDA 1SYRA 4L5LA 3ZMLA 2P0GA 2KOKA 4ZB7A 5E59A 2O8VB 3IHGA 4N11A 4FQUA 2L5OA 9GSSA 3WGDA 1XWKA 1ZYNA 4WF5A 5ECOB 3DWVA 3NIVA 1J08A 3KMOA 3HY2A 1QUWA 3BBYA 1TRVA 3IAS2 1SENA 5AIXA 2OJLA 1U6TA 14GSA 3PPUA 4ZBBA 1Y25A 5F07A 1WRYA 5B8BA 2VCWA 3EU4A 2GTUA 4HQSA 4O5RA 4N0VA 3TOTA 2E2GA 1RW1A 3HJOA 2QA1A 3ERFA 2PU9C 1YEPA 4TR0A 2F3MA 1TP9A 4Z2TA 1BQ7A 2CT6A 5INYA 2ZNMA 2IMKA 2DSAA 2UZ8A 2HI7A 4Q5QA 4J57E 5F8BA 4PX1A 1M7TA 1H4OA 4MF5A 2OBKA 4ZB9A 1X5EA 3ZFBA 8GSSA 1R5AA 3QFAC 3KP8A 1ZYEA 1M2AA 4N30A 3P8WA 2CA8A 3R3EA 3GRXA 3LWAA 1XCCA 4BVYA 1U3IA 5HR0A 4KA0A 4AJ7A 1SVMA 1SL1B 1PA3A 4O32A 2LRTA 3HZ4A 5ECQB 3FZAA 3EU3A 4AKXB 3QAVA 2JZSA 1NSWA 1KEBA 3KTLA 5CREA 3A2XA 1SK2A 1V40A 2N5AA 2C0DA 4YQUA 1OKTA 3QAWA 1DUGA 5JWQB 2GS3A 3GL5A 4AF2A 5HFKA 3IK9A 4K7IA 2JZRA 4PNFA 5H5QA 3UEMA 1EV4A 2A2PA 4J56E 3ZL5A 4EDZA 4G19A 1YKCA 5ELAA 3GFKA 2LJKA 4ID0A 5ECNB 2IN3A 3F4SA 5A5HA 2N5BA 2H73A 3DIEA 4GSSA 4A5PA 2G0FA 1WIKA 4IJIA 3HVSA 2H19A 1SJ6A 5KN2A 4K7NA 5H5SA 1NM3A 2VD0A 4MJCA 1W4VA 2C0GA 3F0IA 4MF6A 3H4KA 2KP2A 2YZHA 4QMKA 2BMXA 3O76A 4GF0A 1T4YA 3UOMA 3GH6A 4TXOA 5KN3A 4RQRA 2FD3A 3QD9A 2WB9A 2HSHA 1F6MC 2R5GA 3ZREA 1X5DA 2CVKA 5G31A 3EPTA 5A4WA 2YCDA 4YQMA 1AC1A 5H5RA 1HQOA 3F4TA 1JZRA 3KCMA 3S9FA 1YQ1A 1IYHA 3OR5A 1FB6A 2VLTA 3EINA 2FCHA 4K0GA 2IFQB 4PQ1A 3HJMA 2CQ9A 5JWOB 3O6TA 4FYCA 3RPNA 4LLRA 3VWUA 4D73B 4TRXA 2DKHA 4XS4B 4EL1A 3ZZXA 1F2EA 2VOCA 2H71A 3GV1A 3VI7A 3UARA 1TRSA 2O5VA 1X9WB 1M99A 4BL7A 1CQHA 1ZL9A 5A34B 1SL0B 4TR4A 3FZ9A 4ZL8A 4G10A 3IA1A 1N8JA 1EV9A 2DJKA 3APQA 1SU9A 3IDVA 1YVLA 2VD1A 4G01A 1SKWB 2NPBA 2HXKA 3HVXA 5A1NB 1F3BA 3KXOA 2VKZG 2DJ3A 1MD3A 1JLVA 5AGYA 4Z2UA 4BVXA 4G0KA 4TR1A 5IO2A 1LJRA 5GSSA 2PUKC 3LW9A 2B6MA 2OE0A 2H75A 5ID2A 2B7KA 1EP8A 1AQWA 2RM5A 3SBCA 4PGTA 4HZ4A 13GSA 3HMJG 1V58A 1S3AA 2OKAA 3W8SA 1OC9B 3DVWA 2PERA 2NTOA 3DEXA 4WKWA 1OAZA 3G7IA 2IMDA 3BJ5A 3GKXA 3TJFA 4MLYA 3IOSA 4OFNA 4EC0A 1GUMA 2UV8G 3A5IA 2AYTA 2NBSA 1PN9A 5EL8A 3IBHA 3RBTA 1X0RA 2I3YA 5HR2A 4XCSA 5ECSA 3UMAA 3ERWA 4KSOA 2FLSA 3TJGA 4K6XA 2DJ1A 2DIZA 4LL4B 1WE0A 3UAPA 2F9SA 5HR1A 4WXTA 2CX3A 6GSYA 5ELGA 4X1UA 4V2NA 2HFDA 2HZEB 4KB3A 3G7JA 2L6DA 5D9VA 5ECLB 1V9WA 1K0MA 2M72A 2ALBA 1JZOA 2K8VA 3DRNA 5J47A 2VCZA 5ECMB 1O8XA 5IPHA 3K8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MA9 A;  4IP6 A;  3L4N A;  1T8E B;  3IC8 A;  1WOU A;  6GSX A;  4BVY B;  1F9M A;  4DSS A;  3A5W A;  1FO5 A;  3CSJ A;  4QQ7 A;  4IVF A;  3D0Z A;  1NHY A;  3VLN A;  2LNT A;  6GSS A;  4BPY A;  1AXD A;  2MZC A;  4NAX A;  3HDC A;  4V1A g;  2GGT A;  3APO A;  1O73 A;  2I9H A;  1YY7 A;  2ON7 A;  1WWJ A;  4HJM A;  4G9H A;  4RQX A;  5HR3 A;  5ECH B;  5D93 A;  3CSH A;  1G7O A;  2HE3 A;  3FK8 A;  3VWX A;  1E6B A;  2ZCT A;  3RPP A;  2PGT A;  5J5N A;  3HHV A;  2BJX A;  4WR4 A;  1GP1 A;  1B48 A;  1GL8 A;  4IQ1 A;  3CRU A;  2GZY A;  4IGJ A;  1T4Z A;  1GSS A;  2C0E A;  2GSR A;  4WBJ A;  5AN1 A;  2FY6 A;  4BA7 A;  1GSF A;  4O92 A;  2JSZ A;  3CTF A;  3DML A;  2A2S A;  2VM2 A;  4YH2 A;  4K1F A;  2H1G A;  1VF4 A;  3HKR A;  1Z7P A;  5JCU A;  2GZP A;  3GA4 A;  4HDE A;  4DEJ A;  2K6V A;  1OE7 A;  3CTG A;  2CX4 A;  1X5C A;  5DCH A;  6GSW A;  1M9B A;  4GQF A;  2JSY A;  2IJY A;  3E9J B;  3IPZ A;  5LNK e;  1URM A;  4H86 A;  1XWC A;  1AUC A;  3D4M A;  1JZW A;  3P2A A;  2XPE A;  1VRS D;  1FAA A;  2PVQ A;  1MTC A;  4KH7 A;  3EVI A;  4MP4 A;  3C7M A;  1HNB A;  3FR6 A;  4POB A;  2H6Z A;  2H1A A;  3UL3 A;  2HSM B;  2OE3 A;  5G30 A;  4EF0 A;  2F8F A;  1Z3E A;  4ZL9 A;  4PUR A;  3C73 A;  2HYX A;  1A23 A;  2B1K A;  2E2M A;  1WP0 A;  5J4U A;  1W89 A;  1Q98 A;  4EDY A;  1T3B A;  5J9C A;  2OA7 A;  4TOP A;  4K8M A;  3P90 A;  4F03 A;  4WBR D;  4HU9 A;  1TDI A;  3RHC A;  4DSQ A;  2YAN A;  1C72 A;  4KGI A;  3IHQ A;  3LXT A;  2WDU A;  1GSQ A;  3IR4 A;  1F37 A;  2DC5 A;  22GS A;  4KF9 A;  4ZBD A;  4POM A;  1B4Q A;  2GDR A;  3ZFL A;  4HJ2 A;  1XPV A;  2H0G A;  3VK9 A;  5DQS A;  1U3A A;  2VL2 C;  4TXV A;  5DCG A;  3VI5 A;  1PQN A;  4IEL A;  5ABR A;  5D73 A;  3TKP A;  2O87 A;  2B3S A;  4XS1 A;  5KEJ A;  3C71 A;  4MH2 A;  3M1G A;  3A3T A;  5G2Z A;  1QQ2 A;  5EPF A;  1Z9H A;  5HQP A;  3W8J A;  1OE8 A;  2WJU A;  1JLW A;  4TKY A;  4IW9 A;  2HRK A;  3I43 A;  1M9A A;  4IHU A;  1ERW A;  5G1L A;  4BVX B;  4NV2 A;  4GSN A;  2N5F A;  1JFU A;  1MDJ A;  3LSZ A;  1BJX A;  4G0I A;  3GUS A;  3GTU A;  3HJP A;  2H0H A;  4ML1 A;  3RAZ A;  3ERG A;  4OFT A;  2R3X A;  3L9S A;  2JAC A;  3TUE A;  1YZX A;  3TJJ A;  1WMJ A;  3DD3 A;  1TXX A;  3GST A;  1TRW A;  3CBU A;  5IOW A;  2R2J A;  3FHK A;  1XVQ A;  1ERV A;  5GST A;  3TGZ A;  2RUF A;  2GSS A;  1EGO A;  2C3Q A;  3ZMK A;  2WGR A;  1EEM A;  2DJ0 A;  2H8L A;  3TJK A;  2FHE A;  1ON4 A;  2LRN A;  3CXG A;  2E0Q A;  1SJZ A;  3JCM L;  4EKZ A;  2MMA A;  2RM6 A;  5COH A;  4PQI A;  1ABA A;  3FZ4 A;  3L9U A;  5FT3 A;  3EC3 A;  3UVH A;  2YJH A;  1YF0 A;  1MD4 A;  11GS A;  4EUY A;  4XIH A;  4MZW A;  2LQO A;  1J9B A;  2HSN B;  1PSQ A;  3M9J A;  2B7J A;  1YJ6 A;  3LQ7 A;  1M0U A;  3WGX A;  3HVV A;  4PUF C;  2LTK A;  5IQY A;  2FUG 2;  1GRX A;  4NXI A;  1YEX A;  2DBC A;  3GKK A;  5KN1 A;  2MMN A;  1Z5Y E;  1XWB A;  4Z7X A;  1KBN A;  4CDO A;  2LQQ A;  2L4C A;  3KH9 A;  1NHO A;  3F6D A;  4EE0 A;  3EMX A;  4XRD A;  3SWL A;  1U88 A;  5CRH A;  2B5X A;  1N2A A;  4WEY A;  1EOG A;  4EXJ A;  4XS6 A;  2FA4 A;  2LS5 A;  2FGX A;  2CZ2 A;  1E2Y A;  3A2W A;  2VCV A;  3DKS A;  4HEA 2;  5DAK B;  1XW6 A;  5GZZ B;  1K0A A;  2GVP A;  2MBS A;  4FYB A;  1PL1 A;  2X8H A;  4TN8 A;  3C1S A;  1FB0 A;  3IAM 2;  4CW9 A;  4YAP A;  1EEJ A;  2WRT A;  1T7P B;  3QR6 A;  1TRU A;  5HFG A;  3F3Q A;  2G2Q A;  3LOR A;  4ILF A;  1K0O A;  4ECI A;  2RUE A;  3H8Q A;  5DAL A;  1SK1 A;  4V2L A;  1RQM A;  1Z7R A;  2R37 A;  3BCK A;  2J9H A;  4JZQ A;  2F51 A;  4OMV A;  4I5Q A;  3UVT A;  3D5J A;  2QKE A;  4ACS A;  1A0F A;  2HZF A;  3TRQ A;  4MAB A;  5IO0 A;  2V6K A;  2YWM A;  4OD7 A;  4IP1 A;  3UJ1 A;  5CAX A;  3GKM A;  1OYJ A;  7GSS A;  4K0N A;  1A0R P;  3QCP A;  4AJ8 A;  4HS1 A;  1JZD A;  1U87 A;  4JE1 A;  3I9V 2;  1HD2 A;  5IMD A;  1T1V A;  4OWY A;  3FYG A;  4YAV A;  4OO4 A;  10GS A;  3UBK A;  2KP1 A;  4K2D A;  5F05 A;  2DMM A;  3BD2 A;  1BYE A;  5A5K A;  5JCW A;  4I2U A;  4HZ2 A;  4KSM A;  5DDL A;  2I1U A;  1TI1 A;  1V57 A;  1XOA A;  3KMN A;  4IS0 A;  2RLI A;  1TKD B;  1GSD A;  1K3Y A;  1YKA A;  2IIY A;  3TRX A;  1FHE A;  2VM1 A;  1BED A;  1XFL A;  2HNL A;  2L4Q A;  4KAE A;  3ZVJ D;  3L78 A;  2FWG A;  2OAD A;  3D6I A;  2CV4 A;  3TRP A;  3KTB A;  3EMP A;  4IN0 A;  3HYP A;  2VUP A;  1ML6 A;  2IMF A;  2VL9 A;  3IK7 A;  1QK8 A;  3FRC A;  3TKS E;  5DJL A;  1QMV A;  2QC7 A;  2PWJ A;  2H74 A;  2C8U A;  3L9V A;  1GLP A;  3UIW A;  2H1B A;  18GS A;  4I8B A;  16GS A;  2H76 A;  19GS A;  1EWX A;  3TKS C;  3MWH A;  2HQT A;  3ZIJ A;  1ERT A;  3H93 A;  3CRT A;  4V2M A;  2FWH A;  1I5G A;  3F6F A;  3KP9 A;  1TK8 B;  3EYT A;  3D21 A;  2AHE A;  4FH8 A;  4NHW A;  5A4V A;  5KN0 A;  4F0C A;  1GNW A;  1RK4 A;  1EP7 A;  2H72 A;  3I6A A;  4PQH A;  1AW9 A;  2HSY A;  2YZU A;  1VF1 A;  2GST A;  1SK0 A;  3MAK A;  3WYW A;  3TJB A;  2HRF A;  1G0T A;  2IME A;  1KNG A;  1GTI A;  2K9F A;  4PUA A;  2YV9 A;  1K0D A;  4MZC A;  2BTO T;  2PVO C;  4XTS A;  4GTU A;  1PL2 A;  1KTE A;  3U5R E;  1LBK A;  3RDW A;  1DE2 A;  3LEF A;  4MH3 A;  3HA9 A;  3ZIT A;  1WPI A;  2YWO A;  2AB6 A;  2VL2 A;  4F2I A;  2KHP A;  6GSV A;  4NHZ A;  4I2T A;  1R26 A;  5IM9 A;  5JWR B;  4HI7 A;  4RUV A;  2VO4 A;  1SKR B;  2C80 A;  1GTB A;  4JR6 A;  3LG6 A;  4BWS A;  1LU4 A;  5IMZ A;  4TR3 A;  2XBI A;  2AAW A;  2C3N A;  3WT1 A;  4EO3 A;  4MK3 A;  2DML A;  5CNW A;  2MBT A;  1TJD A;  5CRW A;  5IMF A;  2LJR A;  1BAY A;  4IKH A;  3N5O A;  6GSU A;  4KDX A;  5D8I A;  1MDI A;  1GUH A;  2YV7 A;  2YWN A;  4G2E A;  4AGS A;  3HZ8 A;  2A4V A;  3Q6O A;  2B5Y A;  5D9T A;  5AIS A;  3CMI A;  3TCO A;  1GSY A;  2XPD A;  2X8C A;  5DQY A;  1O8W A;  4GXZ A;  4LL1 B;  4E8E A;  2C1Y A;  2HLS A;  6GST A;  5G5F A;  4ULX A;  3M9K A;  2VLV A;  4AJ6 A;  5EVO A;  1ZOF A;  5IOX A;  5D9X A;  1G6W A;  2P5R A;  4GCI A;  3LJR A;  4IBP A;  1JHB A;  3VUR A;  1ST9 A;  4OCE A;  2VIM A;  3U6V A;  2EIR A;  5CRG A;  2TIR A;  1BG5 A;  1S3C A;  3F8U A;  2GT5 A;  4V1A p;  4D73 A;  4TXO B;  2NVL A;  1HYU A;  4XS4 A;  1SJI A;  1B9Y C;  5CP1 A;  1YDK A;  3DVX A;  3HXS A;  2AJQ B;  3MDK A;  1M2D A;  1O6J A;  1GUK A;  1GH2 A;  3CSI A;  2E7P A;  3D22 A;  2WS2 A;  1A2L A;  5CYY A;  5DAL B;  1CQG A;  4N10 A;  2ON5 A;  2IPA A;  3F3R A;  2TRC P;  5GAN D;  1K3O A;  2JAD A;  3MNG A;  5IMV A;  2Z9S A;  3TKQ A;  2LJA A;  1MDK A;  2LUS A;  1THX A;  2VL3 A;  2D2Z A;  3ZRD A;  3F63 A;  4KDY A;  5ECK B;  5B7C A;  2VCQ A;  5B6M A;  3PR8 A;  2AV4 A;  3FY7 A;  5B8A A;  3KD0 A;  4ZIJ A;  4ZB8 A;  4OCF A;  1BX9 A;  2EIQ A;  4QL9 A;  4MJE A;  1XWG A;  2LKU A;  3KIJ A;  4BL7 B;  1R5P A;  2EC4 A;  3FR9 A;  2O85 A;  1OC9 A;  4MPF A;  1V98 A;  3G9B A;  1PKZ A;  2F8A A;  1K0N A;  2GLR A;  2FWE A;  4USS A;  4X43 A;  3DXB A;  4N0Z A;  4HOJ A;  4JR4 A;  3VWV A;  1Z6M A;  1THO A;  1OVN A;  1IYI A;  4TR1 B;  4ML6 A;  5JCG A;  2TRX A;  4BWQ A;  5ID2 B;  2M46 A;  4WET A;  4JU5 A;  4ECJ A;  1PX6 A;  1G6Y A;  2H66 A;  3HD5 A;  4MJA A;  2LEG A;  2X99 A;  4GRF A;  4KX4 A;  3UBL A;  1SD9 A;  4QL7 A;  3PIN A;  3WT2 A;  2CVD A;  2HZE A;  2H30 A;  2OE1 A;  1HNC A;  3H1N A;  4ECB A;  3J7Y b;  3NZN A;  3CYN A;  3IXR A;  2YPM A;  1GWC A;  4Q5N A;  3FKF A;  2AUV A;  1TOF A;  1USB A;  2IWT A;  5FWG A;  2YNX A;  5DBQ A;  1ZGN A;  1SL2 B;  1TU8 A;  3P7X A;  1UVZ A;  1GNE A;  2O89 A;  2DJJ A;  1WJK A;  2L5L A;  4I97 A;  12GS A;  1FW1 A;  1DBY A;  3QDN A;  3IV4 A;  1K0B A;  2HRN A;  4F0B A;  1TW9 A;  4KDU A;  5FHI A;  2FNO A;  1X9S B;  3W6G A;  2C3T A;  2XBQ A;  3Q19 A;  1DSB A;  1AQV A;  4TVE A;  2X64 A;  3ZIV A;  4MMM A;  1O7U A;  2R4V A;  2YP6 A;  2O7K A;  2A2R A;  1I9D A;  3ME8 A;  2YWI A;  1ZYQ B;  4MF7 A;  3MSZ A;  1XW9 A;  1ZZY A;  2REM A;  2YOI A;  2J23 A;  2L57 A;  2PN8 A;  1FVK A;  1YF1 A;  1ZMA A;  4MCU A;  1NW2 A;  1FVJ A;  1J0F A;  3E3E A;  2X8G A;  1TK0 B;  4XHM A;  1SD8 A;  1UC7 A;  5IMC A;  4DSS B;  1V2A A;  5BMU A;  3GL3 A;  1ACV A;  1GTA A;  3FZ5 A;  3TKS A;  2GSQ A;  4JBB A;  4L5O A;  4LMW A;  4KCE A;  4MDC A;  2XC2 A;  3LGC A;  4FYU A;  4JED A;  3N9J A;  2PPT A;  3US3 A;  4F9Z A;  1M2B A;  3C8E A;  5C04 A;  3GYK A;  2LNS A;  2V6O A;  3QAG A;  1TU7 A;  5J41 A;  3FR3 A;  2L6C A;  1XWA A;  3GX8 A;  2QGV A;  1GSU A;  4L8E A;  5E4W A;  1O85 A;  3C1R A;  5ECR B;  3M3M A;  2HT9 A;  5L71 A;  2HSM A;  2MMZ A;  3GUR A;  3V1W A;  1QXH A;  4ZXG A;  3APS A;  5IIZ A;  1XVW A;  4P3Y B;  5J9B A;  3R2Q A;  2WUL A;  1K0C A;  2IL3 A;  3GNJ A;  4MZB A;  4L0U A;  2YJ7 A;  3GKN A;  2RII A;  3DGQ A;  3LXZ A;  1G7E A;  2VCT A;  2V41 A;  1PMT A;  1H75 A;  3M8N A;  1GUL A;  4IJ3 A;  4ISD A;  3VFI A;  1VF3 A;  3LFL A;  5EY6 A;  2V1M A;  4OO5 A;  4GST A;  17GS A;  3PGT A;  3G7Y A;  2MYG A;  2P5Q A;  4WR5 A;  1XW5 A;  4EVM A;  3BOA A;  2YN1 A;  2PBJ A;  4FIW A;  20GS A;  4XRA A;  2GZZ A;  4POK A;  2H1D A;  1A2M A;  2LST A;  1K3L A;  2JL4 A;  5ECP B;  1B8X A;  5F0G A;  5C00 A;  1B4P A;  2V32 A;  2IMI A;  2H01 A;  1QFN A;  5HFI A;  1UN2 A;  1Z6N A;  4HUA A;  3TDG A;  2K18 A;  4WF4 A;  5A4U A;  3F9U A;  3O3T A;  3ISO A;  5CRD A;  2L59 A;  2ZUP A;  4HQZ A;  1EZK A;  4ZBA A;  3VWW A;  2CAQ A;  3H79 A;  4JRR A;  3IC4 A;  4E8H A;  3BCI A;  1X9M B;  2LV3 A;  4FO5 A;  2HRA A;  3L0H A;  4MPG A;  2C4J A;  3WGE A;  2M80 A;  3M0F A;  3KZQ A;  1ERU A;  3VPT A;  1AQX A;  4PNG A;  3GIX A;  1GLQ A;  4NWY A;  1A8L A;  3GH9 A;  2VAF A;  1QGV A;  2FA8 A;  1DE1 A;  1SYX A;  2HRK B;  2H6Y A;  1EGR A;  2XHF A;  3ZVJ A;  4NV5 A;  4DVC A;  2CAI A;  2DJ2 A;  2QSI A;  1ZCP A;  3ME7 A;  1PX7 A;  5LCZ A;  3ZYW A;  1S3D A;  4G0L A;  4TW5 A;  3GX0 A;  2KLX A;  5G5E A;  3AY8 A;  3GTU B;  2MMO A;  4Q5R A;  2JU5 A;  2KUC A;  1OC8 A;  4OFM A;  1PD2 1;  4ZL7 A;  3GN3 A;  4IQA A;  5F06 A;  3QFB C;  5D96 A;  1MEK A;  4CHS A;  2K8S A;  1PRX A;  4K9Z A;  3ZLP A;  2V2G A;  3IE3 A;  5D9W A;  2VCX A;  4POL A;  4ZIL A;  1FOV A;  1O81 A;  1Q4J A;  2C0F A;  1A8Y A;  1B9X C;  3Q74 A;  4LMV A;  2LRC A;  3KJY A;  4F82 A;  1A2J A;  3HCZ A;  5G1K A;  1TI3 A;  1PKW A;  3IRA A;  2CVB A;  1ILO A;  2WFC A;  1OC3 A;  4NPB A;  5CO3 A;  1GTU A;  3RHB A;  3GHA A;  1AAZ A;  4RI7 A;  4YQV A;  5ECI B;  5DAK A;  3FEU A;  3KGK A;  2H70 A;  1XBS A;  4DSR A;  5DJM A;  4PTS A;  1XOB A;  4O7H A;  5GAP D;  3QOU A;  2I81 A;  4KND A;  3TKR A;  2GQL A;  4K7O A;  3GSS A;  3I69 A;  2ES7 A;  3KEB A;  1PGT A;  2JZT A;  3GMF A;  1R4W A;  1AIU A;  2EIO A;  3D4T A;  3VPQ A;  5J3R A;  2R6K A;  3KH7 A;  3QPM A;  4NMU A;  3TB2 A;  1TK5 B;  1OKD A;  3KM6 A;  2WCI A;  1EOH A;  3Q18 A;  4ZB6 A;  2PMT A;  4HU7 A;  1UA5 A;  1T00 A;  3LYP A;  1SKS B;  2H6X A;  4RI6 A;  2IFQ A;  5B6N A;  4X0X A;  3PH9 A;  4J2F A;  5LD0 A;  1GSE A;  4I6X A;  2DIY A;  1XZO A;  1XIY A;  3E0U A;  1Y6E A;  4PXO A;  4L0W A;  2B1L A;  2P31 A;  2B5E A;  4GLT A;  3LYK A;  2OAC A;  3EE2 A;  5AIV A;  2FWF A;  4KE3 A;  4KCA A;  2DLX A;  5DVB A;  4KUN A;  3QMX A;  2GQM A;  4Q5F A;  3DYR A;  2GQK A;  1R7H A;  2H0I A;  2NDO A;  4GQC A;  5IMA A;  3A2V A;  4LA1 A;  1XXU A;  4MJB A;  2WZ9 A;  3WD6 A;  3FW2 A;  2CZ3 A;  3F4R A;  3TOU A;  3EWL A;  3NOF A;  5IPG A;  1VF2 A;  4GWR A;  3ZTL A;  1VGL A;  2OBI A;  3ED3 A;  1F3A A;  1A24 A;  4KW6 A;  2VLU A;  3EUR A;  4ECC A;  1FG4 A;  3J7Y k;  1HNA A;  2I4A A;  2GT6 A;  5ENU A;  1TTZ A;  1SYR A;  4L5L A;  3ZML A;  2P0G A;  2KOK A;  5E59 A;  2O8V B;  4N11 A;  4FQU A;  2L5O A;  9GSS A;  3WGD A;  1XWK A;  4WF5 A;  5ECO B;  3DWV A;  3NIV A;  1J08 A;  3KMO A;  3HY2 A;  1QUW A;  3BBY A;  1TRV A;  3IAS 2;  1SEN A;  5AIX A;  2OJL A;  1U6T A;  14GS A;  3PPU A;  4ZBB A;  1Y25 A;  5F07 A;  1WRY A;  5B8B A;  2VCW A;  3EU4 A;  2GTU A;  4HQS A;  4O5R A;  4N0V A;  3TOT A;  2E2G A;  1RW1 A;  3HJO A;  3ERF A;  2PU9 C;  1YEP A;  4TR0 A;  2F3M A;  1TP9 A;  1BQ7 A;  2CT6 A;  5INY A;  2ZNM A;  2IMK A;  2DSA A;  2UZ8 A;  2HI7 A;  4Q5Q A;  4J57 E;  5F8B A;  4PX1 A;  1M7T A;  1H4O A;  4MF5 A;  2OBK A;  4ZB9 A;  1X5E A;  3ZFB A;  8GSS A;  1R5A A;  3QFA C;  3KP8 A;  1ZYE A;  1M2A A;  4N30 A;  3P8W A;  2CA8 A;  3R3E A;  3GRX A;  3LWA A;  1XCC A;  4BVY A;  1U3I A;  5HR0 A;  4KA0 A;  4AJ7 A;  1SL1 B;  1PA3 A;  4O32 A;  2LRT A;  3HZ4 A;  5ECQ B;  3FZA A;  3EU3 A;  3QAV A;  2JZS A;  1NSW A;  1KEB A;  3KTL A;  5CRE A;  3A2X A;  1SK2 A;  1V40 A;  2N5A A;  2C0D A;  4YQU A;  1OKT A;  3QAW A;  1DUG A;  5JWQ B;  2GS3 A;  3GL5 A;  4AF2 A;  5HFK A;  3IK9 A;  4K7I A;  2JZR A;  4PNF A;  5H5Q A;  3UEM A;  1EV4 A;  4J56 E;  3ZL5 A;  4EDZ A;  4G19 A;  1YKC A;  5ELA A;  3GFK A;  2LJK A;  4ID0 A;  5ECN B;  2IN3 A;  3F4S A;  2N5B A;  2H73 A;  3DIE A;  4GSS A;  2G0F A;  1WIK A;  4IJI A;  3HVS A;  2H19 A;  1SJ6 A;  5KN2 A;  4K7N A;  5H5S A;  1NM3 A;  2VD0 A;  4MJC A;  1W4V A;  2C0G A;  3F0I A;  4MF6 A;  3H4K A;  2KP2 A;  2YZH A;  2BMX A;  3O76 A;  4GF0 A;  1T4Y A;  3UOM A;  3GH6 A;  4TXO A;  5KN3 A;  4RQR A;  2FD3 A;  3QD9 A;  2WB9 A;  2HSH A;  1F6M C;  2R5G A;  3ZRE A;  1X5D A;  2CVK A;  5G31 A;  5A4W A;  2YCD A;  4YQM A;  1AC1 A;  5H5R A;  1HQO A;  3F4T A;  1JZR A;  3KCM A;  3S9F A;  1YQ1 A;  1IYH A;  3OR5 A;  1FB6 A;  2VLT A;  3EIN A;  2FCH A;  4K0G A;  2IFQ B;  4PQ1 A;  3HJM A;  2CQ9 A;  5JWO B;  3O6T A;  4FYC A;  3RPN A;  4LLR A;  3VWU A;  4D73 B;  4TRX A;  4XS4 B;  4EL1 A;  3ZZX A;  1F2E A;  2VOC A;  2H71 A;  3GV1 A;  3VI7 A;  3UAR A;  1TRS A;  1X9W B;  1M99 A;  4BL7 A;  1CQH A;  1ZL9 A;  1SL0 B;  4TR4 A;  3FZ9 A;  4ZL8 A;  4G10 A;  3IA1 A;  1N8J A;  1EV9 A;  2DJK A;  3APQ A;  1SU9 A;  3IDV A;  2VD1 A;  1SKW B;  2NPB A;  2HXK A;  3HVX A;  1F3B A;  3KXO A;  2DJ3 A;  1MD3 A;  1JLV A;  5AGY A;  4BVX A;  4G0K A;  4TR1 A;  5IO2 A;  1LJR A;  5GSS A;  2PUK C;  2B6M A;  2OE0 A;  2H75 A;  5ID2 A;  2B7K A;  1EP8 A;  1AQW A;  2RM5 A;  3SBC A;  4PGT A;  4HZ4 A;  13GS A;  1V58 A;  1S3A A;  2OKA A;  3W8S A;  1OC9 B;  3DVW A;  2PER A;  2NTO A;  3DEX A;  4WKW A;  1OAZ A;  3G7I A;  2IMD A;  3BJ5 A;  3GKX A;  3TJF A;  4MLY A;  3IOS A;  4OFN A;  4EC0 A;  1GUM A;  2AYT A;  2NBS A;  1PN9 A;  5EL8 A;  3IBH A;  3RBT A;  1X0R A;  2I3Y A;  5HR2 A;  4XCS A;  5ECS A;  3UMA A;  3ERW A;  4KSO A;  2FLS A;  3TJG A;  4K6X A;  2DJ1 A;  2DIZ A;  4LL4 B;  1WE0 A;  3UAP A;  2F9S A;  5HR1 A;  4WXT A;  2CX3 A;  6GSY A;  5ELG A;  4X1U A;  4V2N A;  2HFD A;  2HZE B;  4KB3 A;  3G7J A;  2L6D A;  5D9V A;  5ECL B;  1V9W A;  1K0M A;  2M72 A;  2ALB A;  1JZO A;  2K8V A;  3DRN A;  2VCZ A;  5ECM B;  1O8X A;  5IPH A;  3K8N A; 
#chains in the Genus database with same CATH topology
 4MA9 A;  4IP6 A;  3L4N A;  1T8E B;  3IC8 A;  1WOU A;  4HSC X;  6GSX A;  4BVY B;  1F9M A;  4DSS A;  3A5W A;  1FO5 A;  3CSJ A;  4QQ7 A;  4IVF A;  3D0Z A;  1NHY A;  3VLN A;  2LNT A;  6GSS A;  4BPY A;  1AXD A;  2MZC A;  4NAX A;  3HDC A;  4V1A g;  2GGT A;  2X49 A;  3APO A;  1O73 A;  2I9H A;  1YY7 A;  2ON7 A;  1WWJ A;  4HJM A;  4G9H A;  4RQX A;  5HR3 A;  5ECH B;  5D93 A;  3CSH A;  1G7O A;  2HE3 A;  3FK8 A;  3VWX A;  1E6B A;  2ZCT A;  3RPP A;  2EFC A;  2PGT A;  5J5N A;  3HHV A;  2BJX A;  4WR4 A;  1GP1 A;  1B48 A;  1GL8 A;  4IQ1 A;  3CRU A;  2GZY A;  4IGJ A;  1T4Z A;  1GSS A;  2C0E A;  2GSR A;  4WBJ A;  5AN1 A;  2FY6 A;  4BA7 A;  5BMU B;  1GSF A;  4O92 A;  2JSZ A;  3CTF A;  3DML A;  5J40 A;  2A2S A;  2VM2 A;  4YH2 A;  4K1F A;  2H1G A;  1VF4 A;  3HKR A;  1Z7P A;  5JCU A;  2GZP A;  4AKI A;  3GA4 A;  4HDE A;  4DEJ A;  2K6V A;  1OE7 A;  3CTG A;  2CX4 A;  1X5C A;  5DCH A;  6GSW A;  1M9B A;  4GQF A;  2JSY A;  2IJY A;  3E9J B;  3IPZ A;  5LNK e;  1URM A;  4H86 A;  1XWC A;  1AUC A;  3D4M A;  1JZW A;  3P2A A;  2XPE A;  1VRS D;  1FAA A;  2PVQ A;  1MTC A;  4KH7 A;  3EVI A;  4MP4 A;  3C7M A;  1HNB A;  3FR6 A;  4POB A;  2H6Z A;  2H1A A;  3UL3 A;  2HSM B;  2OE3 A;  5G30 A;  4EF0 A;  2F8F A;  1Z3E A;  4ZL9 A;  4PUR A;  3C73 A;  2HYX A;  1A23 A;  2B1K A;  2E2M A;  1WP0 A;  5J4U A;  1W89 A;  1Q98 A;  4EDY A;  1YEW C;  1T3B A;  5J9C A;  2OA7 A;  4TOP A;  4K8M A;  3P90 A;  4F03 A;  4WBR D;  4CY6 A;  4HU9 A;  1TDI A;  3RHC A;  2A4H A;  4DSQ A;  2YAN A;  1C72 A;  4KGI A;  3IHQ A;  3LXT A;  2WDU A;  1GSQ A;  3IR4 A;  1F37 A;  2DC5 A;  22GS A;  4KF9 A;  4ZBD A;  4POM A;  1B4Q A;  2GDR A;  3ZFL A;  4HJ2 A;  1XPV A;  2H0G A;  3VK9 A;  5DQS A;  1U3A A;  2VL2 C;  4TXV A;  5DCG A;  3VI5 A;  1PQN A;  4IEL A;  5ABR A;  5D73 A;  3TKP A;  2O87 A;  2B3S A;  4XS1 A;  5KEJ A;  3C71 A;  4MH2 A;  3M1G A;  3A3T A;  5G2Z A;  1QQ2 A;  5EPF A;  1Z9H A;  5HQP A;  3W8J A;  1OE8 A;  2WJU A;  1JLW A;  4TKY A;  4AKG A;  4IW9 A;  2HRK A;  3I43 A;  1M9A A;  4IHU A;  1ERW A;  5G1L A;  4MNN A;  4BVX B;  4NV2 A;  4GSN A;  2N5F A;  1JFU A;  1MDJ A;  3LSZ A;  1BJX A;  4G0I A;  4EIQ A;  3GUS A;  3GTU A;  3CWG A;  3HJP A;  2H0H A;  4ML1 A;  3RAZ A;  3ERG A;  4OFT A;  2R3X A;  3L9S A;  2JAC A;  5KOW A;  3TUE A;  1YZX A;  3TJJ A;  1SVO A;  1WMJ A;  3DD3 A;  1TXX A;  3GST A;  1TRW A;  3CBU A;  5IOW A;  2R2J A;  3FHK A;  1XVQ A;  1ERV A;  5GST A;  3TGZ A;  2RUF A;  2GSS A;  1EGO A;  2C3Q A;  3ZMK A;  2WGR A;  1EEM A;  2DJ0 A;  2H8L A;  1SVL A;  3TJK A;  2FHE A;  1ON4 A;  2LRN A;  2EFH A;  3CXG A;  2E0Q A;  1SJZ A;  3JCM L;  4EKZ A;  2MMA A;  2RM6 A;  5COH A;  4PQI A;  1ABA A;  3FZ4 A;  3L9U A;  4ICY A;  5FT3 A;  3EC3 A;  3UVH A;  2YJH A;  1YF0 A;  1MD4 A;  11GS A;  4EUY A;  4XIH A;  4MZW A;  2LQO A;  1J9B A;  2HSN B;  1PSQ A;  3M9J A;  2B7J A;  1YJ6 A;  3LQ7 A;  1M0U A;  3WGX A;  3HVV A;  4PUF C;  2LTK A;  5IQY A;  2FUG 2;  1GRX A;  4NXI A;  1YEX A;  2DBC A;  3GKK A;  5KN1 A;  2WW2 A;  2MMN A;  1Z5Y E;  1XWB A;  4Z7X A;  1KBN A;  4CDO A;  3TU3 B;  2LQQ A;  2L4C A;  3KH9 A;  1NHO A;  3F6D A;  1FOH A;  4EE0 A;  3EMX A;  4XRD A;  3SWL A;  1U88 A;  5CRH A;  2B5X A;  1N2A A;  4WEY A;  1EOG A;  4EXJ A;  4XS6 A;  2FA4 A;  2LS5 A;  2FGX A;  2CZ2 A;  1E2Y A;  3A2W A;  2VCV A;  3DKS A;  4HEA 2;  5DAK B;  1XW6 A;  5GZZ B;  1K0A A;  2GVP A;  2MBS A;  4FYB A;  1PL1 A;  2X8H A;  4TN8 A;  3C1S A;  1FB0 A;  3IAM 2;  4CW9 A;  4YAP A;  1EEJ A;  2WRT A;  1T7P B;  3QR6 A;  1TRU A;  5HFG A;  3F3Q A;  3MIX A;  2G2Q A;  3LOR A;  4ILF A;  1K0O A;  4ECI A;  2RUE A;  3H8Q A;  5DAL A;  1PN0 A;  1SK1 A;  4V2L A;  1RQM A;  1Z7R A;  2R37 A;  3BCK A;  2DKI A;  2J9H A;  4JZQ A;  2F51 A;  4OMV A;  1TXU A;  4I5Q A;  3UVT A;  4EIP A;  3D5J A;  2QKE A;  4ACS A;  1A0F A;  1I1I P;  2HZF A;  3TRQ A;  4MAB A;  5IO0 A;  2V6K A;  2YWM A;  3CQF A;  4OD7 A;  4IP1 A;  3UJ1 A;  5CAX A;  3GKM A;  1OYJ A;  2EFE A;  7GSS A;  4K0N A;  1A0R P;  3QCP A;  4AJ8 A;  4HS1 A;  1JZD A;  1U87 A;  4JE1 A;  3I9V 2;  1HD2 A;  5IMD A;  1T1V A;  4OWY A;  3FYG A;  4YAV A;  4OO4 A;  10GS A;  3UBK A;  2KP1 A;  4K2D A;  5F05 A;  2DMM A;  3BD2 A;  1BYE A;  5A5K A;  5JCW A;  4I2U A;  4HZ2 A;  4KSM A;  5DDL A;  2I1U A;  1TI1 A;  1V57 A;  1XOA A;  3KMN A;  4IS0 A;  2RLI A;  1TKD B;  1GSD A;  1K3Y A;  1YKA A;  2IIY A;  3TRX A;  1FHE A;  2VM1 A;  1BED A;  1XFL A;  2HNL A;  2L4Q A;  4KAE A;  3ZVJ D;  3L78 A;  2FWG A;  2OAD A;  3D6I A;  2CV4 A;  3TRP A;  3KTB A;  3EMP A;  4IN0 A;  3HYP A;  2VUP A;  1ML6 A;  1XG8 A;  2IMF A;  2VL9 A;  3IK7 A;  1QK8 A;  3FRC A;  3TKS E;  5DJL A;  1QMV A;  2QC7 A;  2PWJ A;  2H74 A;  2QA2 A;  2C8U A;  3L9V A;  1GLP A;  3UIW A;  4YKG A;  2H1B A;  18GS A;  4I8B A;  16GS A;  2H76 A;  19GS A;  1EWX A;  2WVX B;  3TKS C;  3MWH A;  2HQT A;  3ZIJ A;  1ERT A;  3H93 A;  3CRT A;  4V2M A;  2FWH A;  1I5G A;  3F6F A;  3KP9 A;  1TK8 B;  3EYT A;  3D21 A;  2AHE A;  4FH8 A;  4NHW A;  5A4V A;  5KN0 A;  4F0C A;  1GNW A;  1RK4 A;  1EP7 A;  2H72 A;  3I6A A;  4PQH A;  1AW9 A;  2HSY A;  2YZU A;  1VF1 A;  2GST A;  1SK0 A;  3MAK A;  3WYW A;  3TJB A;  2HRF A;  1G0T A;  2IME A;  1KNG A;  1GTI A;  2K9F A;  4PUA A;  2YV9 A;  1K0D A;  4YKF A;  4MZC A;  2BTO T;  2PVO C;  4XTS A;  4GTU A;  1ZYP A;  1PL2 A;  1KTE A;  3U5R E;  1LBK A;  3RDW A;  1DE2 A;  3LEF A;  4MH3 A;  3HA9 A;  3ZIT A;  1WPI A;  2YWO A;  2AB6 A;  2VL2 A;  4F2I A;  2KHP A;  6GSV A;  4NHZ A;  4I2T A;  1R26 A;  5IM9 A;  5JWR B;  4HI7 A;  4RUV A;  2VO4 A;  1SKR B;  2C80 A;  1GTB A;  4JR6 A;  3LG6 A;  4BWS A;  1LU4 A;  5IMZ A;  4TR3 A;  2XBI A;  2AAW A;  2C3N A;  3WT1 A;  4EO3 A;  4MK3 A;  2DML A;  5CNW A;  2MBT A;  1TJD A;  5CRW A;  5IMF A;  2LJR A;  1BAY A;  4IKH A;  3N5O A;  6GSU A;  4KDX A;  5D8I A;  1MDI A;  1GUH A;  2YV7 A;  2YWN A;  4G2E A;  4AGS A;  3HZ8 A;  2A4V A;  5J4Y A;  3Q6O A;  2H1L A;  2B5Y A;  5D9T A;  5AIS A;  3CMI A;  3TCO A;  4X4J A;  5A5H B;  1GSY A;  2XPD A;  2X8C A;  5DQY A;  1O8W A;  4GXZ A;  4LL1 B;  4E8E A;  2C1Y A;  2HLS A;  6GST A;  5G5F A;  4ULX A;  3M9K A;  2VLV A;  4AJ6 A;  5EVO A;  1ZOF A;  5IOX A;  5D9X A;  1G6W A;  2P5R A;  4GCI A;  3LJR A;  4IBP A;  1JHB A;  3VUR A;  1ST9 A;  4OCE A;  2VIM A;  3U6V A;  2EIR A;  5CRG A;  2TIR A;  1BG5 A;  1S3C A;  3F8U A;  2GT5 A;  4V1A p;  4D73 A;  4TXO B;  2NVL A;  1HYU A;  4XS4 A;  1SJI A;  1B9Y C;  5CP1 A;  1YDK A;  3DVX A;  3HXS A;  2AJQ B;  2O3E A;  3MDK A;  1M2D A;  1O6J A;  1GUK A;  4AI6 A;  1GH2 A;  3CSI A;  2E7P A;  3D22 A;  1M3J A;  2WS2 A;  1A2L A;  5CYY A;  5DAL B;  1CQG A;  4N10 A;  2ON5 A;  2IPA A;  3F3R A;  2TRC P;  5GAN D;  5A34 A;  1K3O A;  2JAD A;  3MNG A;  5IMV A;  2Z9S A;  4PHZ C;  3TKQ A;  2LJA A;  1MDK A;  2LUS A;  1THX A;  2VL3 A;  2D2Z A;  3ZRD A;  3F63 A;  4KDY A;  5ECK B;  5B7C A;  2OT3 A;  2VCQ A;  5B6M A;  3PR8 A;  2AV4 A;  3FY7 A;  5B8A A;  3KD0 A;  4ZIJ A;  4ZB8 A;  4OCF A;  1BX9 A;  2EIQ A;  4QL9 A;  4MJE A;  1XWG A;  2LKU A;  3KIJ A;  4BL7 B;  1R5P A;  2EC4 A;  3FR9 A;  2O85 A;  1OC9 A;  4MPF A;  1V98 A;  3G9B A;  1PKZ A;  2F8A A;  1K0N A;  2GLR A;  2FWE A;  4USS A;  4X43 A;  3DXB A;  4N0Z A;  4HOJ A;  4JR4 A;  3VWV A;  1Z6M A;  1THO A;  4O5U A;  1OVN A;  1IYI A;  4TR1 B;  4ML6 A;  5JCG A;  2TRX A;  4BWQ A;  5ID2 B;  2M46 A;  4WET A;  4JU5 A;  4ECJ A;  1PX6 A;  1G6Y A;  2X4A A;  2H66 A;  3HD5 A;  4MJA A;  2LEG A;  2X99 A;  4GRF A;  4KX4 A;  3UBL A;  1SD9 A;  4QL7 A;  3PIN A;  3WT2 A;  2CVD A;  2HZE A;  2H30 A;  2OE1 A;  1HNC A;  3H1N A;  4ECB A;  3J7Y b;  2R0C A;  3NZN A;  3CYN A;  4E68 A;  3IXR A;  2YPM A;  1GWC A;  4Q5N A;  3FKF A;  2AUV A;  1TOF A;  1USB A;  2IWT A;  5FWG A;  2YNX A;  5DBQ A;  1ZGN A;  1SL2 B;  1TU8 A;  3P7X A;  1UVZ A;  1GNE A;  2O89 A;  2DJJ A;  1WJK A;  2L5L A;  4I97 A;  12GS A;  1FW1 A;  1DBY A;  3QDN A;  3IV4 A;  3FMW A;  1K0B A;  4F0B A;  1TW9 A;  2HRN A;  4KDU A;  5FHI A;  2WVY A;  2FNO A;  1X9S B;  3W6G A;  2C3T A;  2XBQ A;  3Q19 A;  1DSB A;  1AQV A;  4TVE A;  2X64 A;  3ZIV A;  4MMM A;  1O7U A;  2R4V A;  2YP6 A;  2O7K A;  2A2R A;  1I9D A;  3ME8 A;  2YWI A;  1ZYQ B;  2WVZ A;  4MF7 A;  3MSZ A;  1XW9 A;  1ZZY A;  2REM A;  2YOI A;  2J23 A;  2L57 A;  2PN8 A;  1FVK A;  1YF1 A;  1ZMA A;  4MCU A;  1NW2 A;  1FVJ A;  1J0F A;  3E3E A;  2X8G A;  1TK0 B;  4XHM A;  1SD8 A;  1UC7 A;  5IMC A;  4DSS B;  4BIK A;  1V2A A;  5BMU A;  3GL3 A;  1ACV A;  1GTA A;  3FZ5 A;  3TKS A;  2GSQ A;  4JBB A;  4L5O A;  2WZS A;  4LMW A;  4KCE A;  4MDC A;  2XC2 A;  3LGC A;  4FYU A;  4JED A;  3N9J A;  2PPT A;  3US3 A;  4F9Z A;  1M2B A;  3C8E A;  5C04 A;  3GYK A;  2LNS A;  2V6O A;  3QAG A;  1TU7 A;  5J41 A;  3FR3 A;  2L6C A;  1XWA A;  4K2X A;  3GX8 A;  2QGV A;  1GSU A;  4L8E A;  5E4W A;  1O85 A;  3C1R A;  5ECR B;  3M3M A;  2HT9 A;  5L71 A;  4K5S A;  2HSM A;  2MMZ A;  3GUR A;  3V1W A;  1QXH A;  4ZXG A;  3APS A;  5IIZ A;  1XVW A;  4P3Y B;  5J9B A;  3R2Q A;  2WUL A;  1K0C A;  2IL3 A;  3GNJ A;  4MZB A;  4L0U A;  2YJ7 A;  3GKN A;  2RII A;  3DGQ A;  3LXZ A;  1G7E A;  2VCT A;  2V41 A;  1PMT A;  1H75 A;  3M8N A;  1GUL A;  4IJ3 A;  4ISD A;  3VFI A;  1VF3 A;  3LFL A;  5EY6 A;  2V1M A;  4OO5 A;  4GST A;  17GS A;  3PGT A;  3G7Y A;  2MYG A;  2P5Q A;  4WR5 A;  1XW5 A;  4EVM A;  3BOA A;  1S3R A;  2YN1 A;  2PBJ A;  4FIW A;  20GS A;  1M3I A;  4XRA A;  2GZZ A;  4POK A;  2H1D A;  1A2M A;  2LST A;  1K3L A;  2JL4 A;  5ECP B;  1B8X A;  5F0G A;  5C00 A;  1B4P A;  5KOX A;  2V32 A;  2IMI A;  2H01 A;  1QFN A;  5HFI A;  1UN2 A;  1Z6N A;  4HUA A;  3TDG A;  2K18 A;  4WF4 A;  5A4U A;  3F9U A;  3O3T A;  3ISO A;  5CRD A;  2L59 A;  2ZUP A;  4HQZ A;  3RFR C;  1EZK A;  4ZBA A;  3VWW A;  2CAQ A;  3H79 A;  4JRR A;  3IC4 A;  4E8H A;  3BCI A;  1X9M B;  2LV3 A;  4CY8 A;  4FO5 A;  2HRA A;  3L0H A;  4MPG A;  2C4J A;  3WGE A;  2M80 A;  3M0F A;  3KZQ A;  1ERU A;  3VPT A;  1AQX A;  4PNG A;  3GIX A;  1GLQ A;  4NWY A;  1A8L A;  3GH9 A;  2VAF A;  1QGV A;  2FA8 A;  1DE1 A;  1SYX A;  2HRK B;  2H6Y A;  1EGR A;  2XHF A;  3ZVJ A;  4NV5 A;  4DVC A;  2CAI A;  2DJ2 A;  2QSI A;  1ZCP A;  3ME7 A;  1PX7 A;  5LCZ A;  3ZYW A;  1S3D A;  4G0L A;  4TW5 A;  3GX0 A;  2KLX A;  5G5E A;  3AY8 A;  3GTU B;  2MMO A;  4Q5R A;  2JU5 A;  2KUC A;  3HVN A;  1OC8 A;  4OFM A;  1PD2 1;  4ZL7 A;  3GN3 A;  4IQA A;  5F06 A;  3QFB C;  2HSN A;  1BG1 A;  5D96 A;  1MEK A;  4CHS A;  4PI0 C;  2K8S A;  2R0G A;  4AKH A;  1PRX A;  4K9Z A;  3ZLP A;  2V2G A;  3IE3 A;  5D9W A;  2VCX A;  4POL A;  4ZIL A;  1FOV A;  4W66 A;  1O81 A;  4O5Q A;  1Q4J A;  2C0F A;  1A8Y A;  1B9X C;  3Q74 A;  4LMV A;  2LRC A;  3KJY A;  4F82 A;  1A2J A;  1BF5 A;  3HCZ A;  5G1K A;  1TI3 A;  1PKW A;  3IRA A;  2CVB A;  1ILO A;  2WFC A;  1OC3 A;  4NPB A;  5CO3 A;  1GTU A;  3RHB A;  3GHA A;  1AAZ A;  5J4V A;  4RI7 A;  4YQV A;  5ECI B;  5DAK A;  3FEU A;  3KGK A;  2H70 A;  1XBS A;  4DSR A;  5DJM A;  4PTS A;  1XOB A;  4O7H A;  5GAP D;  3QOU A;  2I81 A;  4KND A;  3TKR A;  2GQL A;  4K7O A;  3GSS A;  3I69 A;  2ES7 A;  3KEB A;  1PGT A;  2JZT A;  3GMF A;  1R4W A;  1AIU A;  2EIO A;  3D4T A;  3VPQ A;  5J3R A;  2R6K A;  3KH7 A;  3QPM A;  4NMU A;  3TB2 A;  5BRT A;  1TK5 B;  2WW1 A;  1OKD A;  3KM6 A;  2WCI A;  1EOH A;  3Q18 A;  4ZB6 A;  2PMT A;  4HU7 A;  1UA5 A;  1T00 A;  3LYP A;  1SKS B;  2H6X A;  4RI6 A;  2IFQ A;  5B6N A;  4X0X A;  3PH9 A;  4J2F A;  5LD0 A;  1GSE A;  4I6X A;  2DIY A;  1XZO A;  1XIY A;  3E0U A;  1Y6E A;  4PXO A;  4L0W A;  2B1L A;  2P31 A;  2B5E A;  4GLT A;  3LYK A;  2OAC A;  2R0P A;  3EE2 A;  5AIV A;  2FWF A;  4KE3 A;  4KCA A;  2DLX A;  5DVB A;  4KUN A;  4K5R A;  4N3Z A;  3QMX A;  2GQM A;  4Q5F A;  3DYR A;  2GQK A;  1R7H A;  2H0I A;  2NDO A;  4GQC A;  5IMA A;  3A2V A;  4LA1 A;  1XXU A;  4MJB A;  2WZ9 A;  3WD6 A;  1N25 A;  3FW2 A;  4Z2R A;  2CZ3 A;  3F4R A;  3RGB C;  3TOU A;  3EWL A;  3NOF A;  5IPG A;  5A1N A;  1VF2 A;  4GWR A;  3ZTL A;  1VGL A;  2OBI A;  3ED3 A;  1F3A A;  1A24 A;  4KW6 A;  2VLU A;  3EUR A;  4ECC A;  2EFD A;  1FG4 A;  3J7Y k;  1HNA A;  4GDF A;  2I4A A;  2GT6 A;  5ENU A;  1Y1U A;  1TTZ A;  3MYD A;  1SYR A;  4L5L A;  3ZML A;  2P0G A;  2KOK A;  4ZB7 A;  5E59 A;  2O8V B;  3IHG A;  4N11 A;  4FQU A;  2L5O A;  9GSS A;  3WGD A;  1XWK A;  3CHX C;  1ZYN A;  4WF5 A;  5ECO B;  3DWV A;  1S4B P;  3NIV A;  1J08 A;  3KMO A;  2WVX A;  3HY2 A;  1QUW A;  3BBY A;  1TRV A;  3IAS 2;  1SEN A;  5AIX A;  2OJL A;  1U6T A;  14GS A;  2O36 A;  3PPU A;  4ZBB A;  1Y25 A;  5F07 A;  1WRY A;  5B8B A;  2VCW A;  3EU4 A;  2GTU A;  4HQS A;  4O5R A;  4N0V A;  3TOT A;  2E2G A;  1RW1 A;  3HJO A;  2QA1 A;  3ERF A;  2PU9 C;  1YEP A;  4TR0 A;  2F3M A;  1TP9 A;  1PFO A;  4Z2T A;  1BQ7 A;  2CT6 A;  5INY A;  2ZNM A;  2IMK A;  2DSA A;  2UZ8 A;  2HI7 A;  4Q5Q A;  4J57 E;  5F8B A;  4PX1 A;  1M7T A;  1H4O A;  4MF5 A;  2OBK A;  4ZB9 A;  1X5E A;  3ZFB A;  8GSS A;  1R5A A;  3QFA C;  3KP8 A;  1ZYE A;  1M2A A;  4N30 A;  3P8W A;  2CA8 A;  3R3E A;  3GRX A;  3LWA A;  1XCC A;  4BVY A;  1U3I A;  5HR0 A;  4KA0 A;  4AJ7 A;  1SVM A;  2WW3 A;  1SL1 B;  1PA3 A;  4O32 A;  2LRT A;  3HZ4 A;  5ECQ B;  3FZA A;  3EU3 A;  4AKX B;  3QAV A;  2JZS A;  1NSW A;  1KEB A;  3KTL A;  5CRE A;  3A2X A;  1SK2 A;  1V40 A;  2N5A A;  2C0D A;  4YQU A;  1OKT A;  3QAW A;  1DUG A;  5JWQ B;  2GS3 A;  3GL5 A;  4AF2 A;  5HFK A;  3IK9 A;  4K7I A;  2JZR A;  4PNF A;  5H5Q A;  3UEM A;  1EV4 A;  2A2P A;  4J56 E;  3ZL5 A;  4EDZ A;  4G19 A;  1YKC A;  5ELA A;  3GFK A;  2LJK A;  4ID0 A;  5ECN B;  2IN3 A;  3F4S A;  5A5H A;  2N5B A;  2H73 A;  3DIE A;  4GSS A;  4A5P A;  2G0F A;  1WIK A;  4IJI A;  3HVS A;  2H19 A;  1SJ6 A;  5KN2 A;  4K7N A;  5H5S A;  1NM3 A;  2VD0 A;  4MJC A;  1W4V A;  2C0G A;  3F0I A;  4MF6 A;  3H4K A;  2KP2 A;  2YZH A;  4QMK A;  2BMX A;  3O76 A;  4GF0 A;  1T4Y A;  3UOM A;  3GH6 A;  4TXO A;  5KN3 A;  4RQR A;  2FD3 A;  3QD9 A;  4FXY P;  2WB9 A;  2HSH A;  1F6M C;  2R5G A;  3ZRE A;  1X5D A;  2CVK A;  5G31 A;  3EPT A;  5A4W A;  2YCD A;  4YQM A;  1AC1 A;  5H5R A;  1HQO A;  3F4T A;  1JZR A;  3KCM A;  3S9F A;  1YQ1 A;  1IYH A;  3OR5 A;  1FB6 A;  2VLT A;  3EIN A;  2FCH A;  4K0G A;  2IFQ B;  4PQ1 A;  3HJM A;  2CQ9 A;  5JWO B;  3O6T A;  4FYC A;  3RPN A;  4LLR A;  3VWU A;  4D73 B;  4TRX A;  2DKH A;  4XS4 B;  4EL1 A;  3ZZX A;  1F2E A;  2VOC A;  2H71 A;  3GV1 A;  3VI7 A;  3UAR A;  1TRS A;  4PI2 C;  2O5V A;  1X9W B;  1M99 A;  4BL7 A;  1CQH A;  1ZL9 A;  5A34 B;  1SL0 B;  4TR4 A;  3FZ9 A;  4ZL8 A;  4G10 A;  3IA1 A;  1N8J A;  1EV9 A;  2DJK A;  3APQ A;  1SU9 A;  3IDV A;  1YVL A;  2VD1 A;  4G01 A;  1SKW B;  2NPB A;  2HXK A;  3HVX A;  5A1N B;  1F3B A;  3KXO A;  2VKZ G;  2DJ3 A;  1MD3 A;  1JLV A;  5AGY A;  4Z2U A;  4BVX A;  4G0K A;  4TR1 A;  5IO2 A;  1LJR A;  5GSS A;  2PUK C;  3LW9 A;  2B6M A;  2OE0 A;  2H75 A;  5ID2 A;  2B7K A;  1EP8 A;  1AQW A;  2RM5 A;  3SBC A;  4PGT A;  4HZ4 A;  13GS A;  3HMJ G;  1V58 A;  1S3A A;  2OKA A;  3W8S A;  1OC9 B;  3DVW A;  2PER A;  2NTO A;  3DEX A;  4WKW A;  1OAZ A;  3G7I A;  2IMD A;  3BJ5 A;  2WW0 A;  3GKX A;  3TJF A;  4MLY A;  3IOS A;  4OFN A;  4EC0 A;  1GUM A;  2UV8 G;  3A5I A;  2AYT A;  2NBS A;  1PN9 A;  5EL8 A;  3IBH A;  3RBT A;  1X0R A;  2I3Y A;  5HR2 A;  4XCS A;  5ECS A;  3UMA A;  3ERW A;  4KSO A;  2FLS A;  3TJG A;  4K6X A;  2DJ1 A;  2DIZ A;  4LL4 B;  1WE0 A;  3UAP A;  2F9S A;  5HR1 A;  4WXT A;  2CX3 A;  6GSY A;  5ELG A;  4X1U A;  4V2N A;  2HFD A;  2HZE B;  4KB3 A;  3G7J A;  2L6D A;  5D9V A;  5ECL B;  1V9W A;  1K0M A;  2M72 A;  2ALB A;  1JZO A;  2K8V A;  3DRN A;  5J47 A;  2VCZ A;  5ECM B;  1O8X A;  5IPH A;  3K8N A; 
#chains in the Genus database with same CATH homology
 4MA9 A;  4IP6 A;  3L4N A;  1T8E B;  3IC8 A;  1WOU A;  6GSX A;  4BVY B;  1F9M A;  4DSS A;  3A5W A;  1FO5 A;  3CSJ A;  4QQ7 A;  4IVF A;  3D0Z A;  1NHY A;  3VLN A;  2LNT A;  6GSS A;  4BPY A;  1AXD A;  2MZC A;  4NAX A;  3HDC A;  4V1A g;  2GGT A;  2X49 A;  3APO A;  1O73 A;  2I9H A;  1YY7 A;  2ON7 A;  1WWJ A;  4HJM A;  4G9H A;  4RQX A;  5HR3 A;  5ECH B;  5D93 A;  3CSH A;  1G7O A;  2HE3 A;  3FK8 A;  3VWX A;  1E6B A;  2ZCT A;  3RPP A;  2EFC A;  2PGT A;  5J5N A;  3HHV A;  2BJX A;  4WR4 A;  1GP1 A;  1B48 A;  1GL8 A;  4IQ1 A;  3CRU A;  2GZY A;  4IGJ A;  1T4Z A;  1GSS A;  2C0E A;  2GSR A;  4WBJ A;  5AN1 A;  2FY6 A;  4BA7 A;  5BMU B;  1GSF A;  4O92 A;  2JSZ A;  3CTF A;  3DML A;  5J40 A;  2A2S A;  2VM2 A;  4YH2 A;  4K1F A;  2H1G A;  1VF4 A;  3HKR A;  1Z7P A;  5JCU A;  2GZP A;  4AKI A;  3GA4 A;  4HDE A;  4DEJ A;  2K6V A;  1OE7 A;  3CTG A;  2CX4 A;  1X5C A;  5DCH A;  6GSW A;  1M9B A;  4GQF A;  2JSY A;  2IJY A;  3E9J B;  3IPZ A;  5LNK e;  1URM A;  4H86 A;  1XWC A;  1AUC A;  3D4M A;  1JZW A;  3P2A A;  2XPE A;  1VRS D;  1FAA A;  2PVQ A;  1MTC A;  4KH7 A;  3EVI A;  4MP4 A;  3C7M A;  1HNB A;  3FR6 A;  4POB A;  2H6Z A;  2H1A A;  3UL3 A;  2HSM B;  2OE3 A;  5G30 A;  4EF0 A;  2F8F A;  1Z3E A;  4ZL9 A;  4PUR A;  3C73 A;  2HYX A;  1A23 A;  2B1K A;  2E2M A;  1WP0 A;  5J4U A;  1W89 A;  1Q98 A;  4EDY A;  1T3B A;  5J9C A;  2OA7 A;  4TOP A;  4K8M A;  3P90 A;  4F03 A;  4WBR D;  4CY6 A;  4HU9 A;  1TDI A;  3RHC A;  2A4H A;  4DSQ A;  2YAN A;  1C72 A;  4KGI A;  3IHQ A;  3LXT A;  2WDU A;  1GSQ A;  3IR4 A;  1F37 A;  2DC5 A;  22GS A;  4KF9 A;  4ZBD A;  4POM A;  1B4Q A;  2GDR A;  3ZFL A;  4HJ2 A;  1XPV A;  2H0G A;  3VK9 A;  5DQS A;  1U3A A;  2VL2 C;  4TXV A;  5DCG A;  3VI5 A;  1PQN A;  4IEL A;  5ABR A;  5D73 A;  3TKP A;  2O87 A;  2B3S A;  4XS1 A;  5KEJ A;  3C71 A;  4MH2 A;  3M1G A;  3A3T A;  5G2Z A;  1QQ2 A;  5EPF A;  1Z9H A;  5HQP A;  3W8J A;  1OE8 A;  2WJU A;  1JLW A;  4TKY A;  4AKG A;  4IW9 A;  2HRK A;  3I43 A;  1M9A A;  4IHU A;  1ERW A;  5G1L A;  4MNN A;  4BVX B;  4NV2 A;  4GSN A;  2N5F A;  1JFU A;  1MDJ A;  3LSZ A;  1BJX A;  4G0I A;  4EIQ A;  3GUS A;  3GTU A;  3CWG A;  3HJP A;  2H0H A;  4ML1 A;  3RAZ A;  3ERG A;  4OFT A;  2R3X A;  3L9S A;  2JAC A;  5KOW A;  3TUE A;  1YZX A;  3TJJ A;  1SVO A;  1WMJ A;  3DD3 A;  1TXX A;  3GST A;  1TRW A;  3CBU A;  5IOW A;  2R2J A;  3FHK A;  1XVQ A;  1ERV A;  5GST A;  3TGZ A;  2RUF A;  2GSS A;  1EGO A;  2C3Q A;  3ZMK A;  2WGR A;  1EEM A;  2DJ0 A;  2H8L A;  1SVL A;  3TJK A;  2FHE A;  1ON4 A;  2LRN A;  2EFH A;  3CXG A;  2E0Q A;  1SJZ A;  3JCM L;  4EKZ A;  2MMA A;  2RM6 A;  5COH A;  4PQI A;  1ABA A;  3FZ4 A;  3L9U A;  4ICY A;  5FT3 A;  3EC3 A;  3UVH A;  2YJH A;  1YF0 A;  1MD4 A;  11GS A;  4EUY A;  4XIH A;  4MZW A;  2LQO A;  1J9B A;  2HSN B;  1PSQ A;  3M9J A;  2B7J A;  1YJ6 A;  3LQ7 A;  1M0U A;  3WGX A;  3HVV A;  4PUF C;  2LTK A;  5IQY A;  2FUG 2;  1GRX A;  4NXI A;  1YEX A;  2DBC A;  3GKK A;  5KN1 A;  2MMN A;  1Z5Y E;  1XWB A;  4Z7X A;  1KBN A;  4CDO A;  3TU3 B;  2LQQ A;  2L4C A;  3KH9 A;  1NHO A;  3F6D A;  1FOH A;  4EE0 A;  3EMX A;  4XRD A;  3SWL A;  1U88 A;  5CRH A;  2B5X A;  1N2A A;  4WEY A;  1EOG A;  4EXJ A;  4XS6 A;  2FA4 A;  2LS5 A;  2FGX A;  2CZ2 A;  1E2Y A;  3A2W A;  2VCV A;  3DKS A;  4HEA 2;  5DAK B;  1XW6 A;  5GZZ B;  1K0A A;  2GVP A;  2MBS A;  4FYB A;  1PL1 A;  2X8H A;  4TN8 A;  3C1S A;  1FB0 A;  3IAM 2;  4CW9 A;  4YAP A;  1EEJ A;  2WRT A;  1T7P B;  3QR6 A;  1TRU A;  5HFG A;  3F3Q A;  3MIX A;  2G2Q A;  3LOR A;  4ILF A;  1K0O A;  4ECI A;  2RUE A;  3H8Q A;  5DAL A;  1PN0 A;  1SK1 A;  4V2L A;  1RQM A;  1Z7R A;  2R37 A;  3BCK A;  2DKI A;  2J9H A;  4JZQ A;  2F51 A;  4OMV A;  1TXU A;  4I5Q A;  3UVT A;  4EIP A;  3D5J A;  2QKE A;  4ACS A;  1A0F A;  2HZF A;  3TRQ A;  4MAB A;  5IO0 A;  2V6K A;  2YWM A;  4OD7 A;  4IP1 A;  3UJ1 A;  5CAX A;  3GKM A;  1OYJ A;  2EFE A;  7GSS A;  4K0N A;  1A0R P;  3QCP A;  4AJ8 A;  4HS1 A;  1JZD A;  1U87 A;  4JE1 A;  3I9V 2;  1HD2 A;  5IMD A;  1T1V A;  4OWY A;  3FYG A;  4YAV A;  4OO4 A;  10GS A;  3UBK A;  2KP1 A;  4K2D A;  5F05 A;  2DMM A;  3BD2 A;  1BYE A;  5A5K A;  5JCW A;  4I2U A;  4HZ2 A;  4KSM A;  5DDL A;  2I1U A;  1TI1 A;  1V57 A;  1XOA A;  3KMN A;  4IS0 A;  2RLI A;  1TKD B;  1GSD A;  1K3Y A;  1YKA A;  2IIY A;  3TRX A;  1FHE A;  2VM1 A;  1BED A;  1XFL A;  2HNL A;  2L4Q A;  4KAE A;  3ZVJ D;  3L78 A;  2FWG A;  2OAD A;  3D6I A;  2CV4 A;  3TRP A;  3KTB A;  3EMP A;  4IN0 A;  3HYP A;  2VUP A;  1ML6 A;  2IMF A;  2VL9 A;  3IK7 A;  1QK8 A;  3FRC A;  3TKS E;  5DJL A;  1QMV A;  2QC7 A;  2PWJ A;  2H74 A;  2QA2 A;  2C8U A;  3L9V A;  1GLP A;  3UIW A;  4YKG A;  2H1B A;  18GS A;  4I8B A;  16GS A;  2H76 A;  19GS A;  1EWX A;  3TKS C;  3MWH A;  2HQT A;  3ZIJ A;  1ERT A;  3H93 A;  3CRT A;  4V2M A;  2FWH A;  1I5G A;  3F6F A;  3KP9 A;  1TK8 B;  3EYT A;  3D21 A;  2AHE A;  4FH8 A;  4NHW A;  5A4V A;  5KN0 A;  4F0C A;  1GNW A;  1RK4 A;  1EP7 A;  2H72 A;  3I6A A;  4PQH A;  1AW9 A;  2HSY A;  2YZU A;  1VF1 A;  2GST A;  1SK0 A;  3MAK A;  3WYW A;  3TJB A;  2HRF A;  1G0T A;  2IME A;  1KNG A;  1GTI A;  2K9F A;  4PUA A;  2YV9 A;  1K0D A;  4YKF A;  4MZC A;  2BTO T;  2PVO C;  4XTS A;  4GTU A;  1ZYP A;  1PL2 A;  1KTE A;  3U5R E;  1LBK A;  3RDW A;  1DE2 A;  3LEF A;  4MH3 A;  3HA9 A;  3ZIT A;  1WPI A;  2YWO A;  2AB6 A;  2VL2 A;  4F2I A;  2KHP A;  6GSV A;  4NHZ A;  4I2T A;  1R26 A;  5IM9 A;  5JWR B;  4HI7 A;  4RUV A;  2VO4 A;  1SKR B;  2C80 A;  1GTB A;  4JR6 A;  3LG6 A;  4BWS A;  1LU4 A;  5IMZ A;  4TR3 A;  2XBI A;  2AAW A;  2C3N A;  3WT1 A;  4EO3 A;  4MK3 A;  2DML A;  5CNW A;  2MBT A;  1TJD A;  5CRW A;  5IMF A;  2LJR A;  1BAY A;  4IKH A;  3N5O A;  6GSU A;  4KDX A;  5D8I A;  1MDI A;  1GUH A;  2YV7 A;  2YWN A;  4G2E A;  4AGS A;  3HZ8 A;  2A4V A;  5J4Y A;  3Q6O A;  2H1L A;  2B5Y A;  5D9T A;  5AIS A;  3CMI A;  3TCO A;  4X4J A;  5A5H B;  1GSY A;  2XPD A;  2X8C A;  5DQY A;  1O8W A;  4GXZ A;  4LL1 B;  4E8E A;  2C1Y A;  2HLS A;  6GST A;  5G5F A;  4ULX A;  3M9K A;  2VLV A;  4AJ6 A;  5EVO A;  1ZOF A;  5IOX A;  5D9X A;  1G6W A;  2P5R A;  4GCI A;  3LJR A;  4IBP A;  1JHB A;  3VUR A;  1ST9 A;  4OCE A;  2VIM A;  3U6V A;  2EIR A;  5CRG A;  2TIR A;  1BG5 A;  1S3C A;  3F8U A;  2GT5 A;  4V1A p;  4D73 A;  4TXO B;  2NVL A;  1HYU A;  4XS4 A;  1SJI A;  1B9Y C;  5CP1 A;  1YDK A;  3DVX A;  3HXS A;  2AJQ B;  3MDK A;  1M2D A;  1O6J A;  1GUK A;  4AI6 A;  1GH2 A;  3CSI A;  2E7P A;  3D22 A;  2WS2 A;  1A2L A;  5CYY A;  5DAL B;  1CQG A;  4N10 A;  2ON5 A;  2IPA A;  3F3R A;  2TRC P;  5GAN D;  5A34 A;  1K3O A;  2JAD A;  3MNG A;  5IMV A;  2Z9S A;  3TKQ A;  2LJA A;  1MDK A;  2LUS A;  1THX A;  2VL3 A;  2D2Z A;  3ZRD A;  3F63 A;  4KDY A;  5ECK B;  5B7C A;  2OT3 A;  2VCQ A;  5B6M A;  3PR8 A;  2AV4 A;  3FY7 A;  5B8A A;  3KD0 A;  4ZIJ A;  4ZB8 A;  4OCF A;  1BX9 A;  2EIQ A;  4QL9 A;  4MJE A;  1XWG A;  2LKU A;  3KIJ A;  4BL7 B;  1R5P A;  2EC4 A;  3FR9 A;  2O85 A;  1OC9 A;  4MPF A;  1V98 A;  3G9B A;  1PKZ A;  2F8A A;  1K0N A;  2GLR A;  2FWE A;  4USS A;  4X43 A;  3DXB A;  4N0Z A;  4HOJ A;  4JR4 A;  3VWV A;  1Z6M A;  1THO A;  4O5U A;  1OVN A;  1IYI A;  4TR1 B;  4ML6 A;  5JCG A;  2TRX A;  4BWQ A;  5ID2 B;  2M46 A;  4WET A;  4JU5 A;  4ECJ A;  1PX6 A;  1G6Y A;  2X4A A;  2H66 A;  3HD5 A;  4MJA A;  2LEG A;  2X99 A;  4GRF A;  4KX4 A;  3UBL A;  1SD9 A;  4QL7 A;  3PIN A;  3WT2 A;  2CVD A;  2HZE A;  2H30 A;  2OE1 A;  1HNC A;  3H1N A;  4ECB A;  3J7Y b;  2R0C A;  3NZN A;  3CYN A;  4E68 A;  3IXR A;  2YPM A;  1GWC A;  4Q5N A;  3FKF A;  2AUV A;  1TOF A;  1USB A;  2IWT A;  5FWG A;  2YNX A;  5DBQ A;  1ZGN A;  1SL2 B;  1TU8 A;  3P7X A;  1UVZ A;  1GNE A;  2O89 A;  2DJJ A;  1WJK A;  2L5L A;  4I97 A;  12GS A;  1FW1 A;  1DBY A;  3QDN A;  3IV4 A;  1K0B A;  2HRN A;  4F0B A;  1TW9 A;  3FMW A;  4KDU A;  5FHI A;  2FNO A;  1X9S B;  3W6G A;  2C3T A;  2XBQ A;  3Q19 A;  1DSB A;  1AQV A;  4TVE A;  2X64 A;  3ZIV A;  4MMM A;  1O7U A;  2R4V A;  2YP6 A;  2O7K A;  2A2R A;  1I9D A;  3ME8 A;  2YWI A;  1ZYQ B;  4MF7 A;  3MSZ A;  1XW9 A;  1ZZY A;  2REM A;  2YOI A;  2J23 A;  2L57 A;  2PN8 A;  1FVK A;  1YF1 A;  1ZMA A;  4MCU A;  1NW2 A;  1FVJ A;  1J0F A;  3E3E A;  2X8G A;  1TK0 B;  4XHM A;  1SD8 A;  1UC7 A;  5IMC A;  4DSS B;  1V2A A;  5BMU A;  3GL3 A;  1ACV A;  1GTA A;  3FZ5 A;  3TKS A;  2GSQ A;  4JBB A;  4L5O A;  4LMW A;  4KCE A;  4MDC A;  2XC2 A;  3LGC A;  4FYU A;  4JED A;  3N9J A;  2PPT A;  3US3 A;  4F9Z A;  1M2B A;  3C8E A;  5C04 A;  3GYK A;  2LNS A;  2V6O A;  3QAG A;  1TU7 A;  5J41 A;  3FR3 A;  2L6C A;  1XWA A;  4K2X A;  3GX8 A;  2QGV A;  1GSU A;  4L8E A;  5E4W A;  1O85 A;  3C1R A;  5ECR B;  3M3M A;  2HT9 A;  5L71 A;  4K5S A;  2HSM A;  2MMZ A;  3GUR A;  3V1W A;  1QXH A;  4ZXG A;  3APS A;  5IIZ A;  1XVW A;  4P3Y B;  5J9B A;  3R2Q A;  2WUL A;  1K0C A;  2IL3 A;  3GNJ A;  4MZB A;  4L0U A;  2YJ7 A;  3GKN A;  2RII A;  3DGQ A;  3LXZ A;  1G7E A;  2VCT A;  2V41 A;  1PMT A;  1H75 A;  3M8N A;  1GUL A;  4IJ3 A;  4ISD A;  3VFI A;  1VF3 A;  3LFL A;  5EY6 A;  2V1M A;  4OO5 A;  4GST A;  17GS A;  3PGT A;  3G7Y A;  2MYG A;  2P5Q A;  4WR5 A;  1XW5 A;  4EVM A;  3BOA A;  2YN1 A;  2PBJ A;  4FIW A;  20GS A;  4XRA A;  2GZZ A;  4POK A;  2H1D A;  1A2M A;  2LST A;  1K3L A;  2JL4 A;  5ECP B;  1B8X A;  5F0G A;  5C00 A;  1B4P A;  5KOX A;  2V32 A;  2IMI A;  2H01 A;  1QFN A;  5HFI A;  1UN2 A;  1Z6N A;  4HUA A;  3TDG A;  2K18 A;  4WF4 A;  5A4U A;  3F9U A;  3O3T A;  3ISO A;  5CRD A;  2L59 A;  2ZUP A;  4HQZ A;  1EZK A;  4ZBA A;  3VWW A;  2CAQ A;  3H79 A;  4JRR A;  3IC4 A;  4E8H A;  3BCI A;  1X9M B;  2LV3 A;  4CY8 A;  4FO5 A;  2HRA A;  3L0H A;  4MPG A;  2C4J A;  3WGE A;  2M80 A;  3M0F A;  3KZQ A;  1ERU A;  3VPT A;  1AQX A;  4PNG A;  3GIX A;  1GLQ A;  4NWY A;  1A8L A;  3GH9 A;  2VAF A;  1QGV A;  2FA8 A;  1DE1 A;  1SYX A;  2HRK B;  2H6Y A;  1EGR A;  2XHF A;  3ZVJ A;  4NV5 A;  4DVC A;  2CAI A;  2DJ2 A;  2QSI A;  1ZCP A;  3ME7 A;  1PX7 A;  5LCZ A;  3ZYW A;  1S3D A;  4G0L A;  4TW5 A;  3GX0 A;  2KLX A;  5G5E A;  3AY8 A;  3GTU B;  2MMO A;  4Q5R A;  2JU5 A;  2KUC A;  1OC8 A;  4OFM A;  1PD2 1;  4ZL7 A;  3GN3 A;  4IQA A;  5F06 A;  3QFB C;  2HSN A;  1BG1 A;  5D96 A;  1MEK A;  4CHS A;  2K8S A;  2R0G A;  4AKH A;  1PRX A;  4K9Z A;  3ZLP A;  2V2G A;  3IE3 A;  5D9W A;  2VCX A;  4POL A;  4ZIL A;  1FOV A;  4W66 A;  1O81 A;  4O5Q A;  1Q4J A;  2C0F A;  1A8Y A;  1B9X C;  3Q74 A;  4LMV A;  2LRC A;  3KJY A;  4F82 A;  1A2J A;  1BF5 A;  3HCZ A;  5G1K A;  1TI3 A;  1PKW A;  3IRA A;  2CVB A;  1ILO A;  2WFC A;  1OC3 A;  4NPB A;  5CO3 A;  1GTU A;  3RHB A;  3GHA A;  1AAZ A;  5J4V A;  4RI7 A;  4YQV A;  5ECI B;  5DAK A;  3FEU A;  3KGK A;  2H70 A;  1XBS A;  4DSR A;  5DJM A;  4PTS A;  1XOB A;  4O7H A;  5GAP D;  3QOU A;  2I81 A;  4KND A;  3TKR A;  2GQL A;  4K7O A;  3GSS A;  3I69 A;  2ES7 A;  3KEB A;  1PGT A;  2JZT A;  3GMF A;  1R4W A;  1AIU A;  2EIO A;  3D4T A;  3VPQ A;  5J3R A;  2R6K A;  3KH7 A;  3QPM A;  4NMU A;  3TB2 A;  5BRT A;  1TK5 B;  1OKD A;  3KM6 A;  2WCI A;  1EOH A;  3Q18 A;  4ZB6 A;  2PMT A;  4HU7 A;  1UA5 A;  1T00 A;  3LYP A;  1SKS B;  2H6X A;  4RI6 A;  2IFQ A;  5B6N A;  4X0X A;  3PH9 A;  4J2F A;  5LD0 A;  1GSE A;  4I6X A;  2DIY A;  1XZO A;  1XIY A;  3E0U A;  1Y6E A;  4PXO A;  4L0W A;  2B1L A;  2P31 A;  2B5E A;  4GLT A;  3LYK A;  2OAC A;  2R0P A;  3EE2 A;  5AIV A;  2FWF A;  4KE3 A;  4KCA A;  2DLX A;  5DVB A;  4KUN A;  4K5R A;  4N3Z A;  3QMX A;  2GQM A;  4Q5F A;  3DYR A;  2GQK A;  1R7H A;  2H0I A;  2NDO A;  4GQC A;  5IMA A;  3A2V A;  4LA1 A;  1XXU A;  4MJB A;  2WZ9 A;  3WD6 A;  1N25 A;  3FW2 A;  4Z2R A;  2CZ3 A;  3F4R A;  3NOF A;  3TOU A;  3EWL A;  5IPG A;  5A1N A;  1VF2 A;  4GWR A;  3ZTL A;  1VGL A;  2OBI A;  3ED3 A;  1F3A A;  1A24 A;  4KW6 A;  2VLU A;  3EUR A;  4ECC A;  2EFD A;  1FG4 A;  3J7Y k;  1HNA A;  4GDF A;  2I4A A;  2GT6 A;  5ENU A;  1Y1U A;  1TTZ A;  3MYD A;  1SYR A;  4L5L A;  3ZML A;  2P0G A;  2KOK A;  4ZB7 A;  5E59 A;  2O8V B;  3IHG A;  4N11 A;  4FQU A;  2L5O A;  9GSS A;  3WGD A;  1XWK A;  1ZYN A;  4WF5 A;  5ECO B;  3DWV A;  3NIV A;  1J08 A;  3KMO A;  3HY2 A;  1QUW A;  3BBY A;  1TRV A;  3IAS 2;  1SEN A;  5AIX A;  2OJL A;  1U6T A;  14GS A;  3PPU A;  4ZBB A;  1Y25 A;  5F07 A;  1WRY A;  5B8B A;  2VCW A;  3EU4 A;  2GTU A;  4HQS A;  4O5R A;  4N0V A;  3TOT A;  2E2G A;  1RW1 A;  3HJO A;  2QA1 A;  3ERF A;  2PU9 C;  1YEP A;  4TR0 A;  2F3M A;  1TP9 A;  4Z2T A;  1BQ7 A;  2CT6 A;  5INY A;  2ZNM A;  2IMK A;  2DSA A;  2UZ8 A;  2HI7 A;  4Q5Q A;  4J57 E;  5F8B A;  4PX1 A;  1M7T A;  1H4O A;  4MF5 A;  2OBK A;  4ZB9 A;  1X5E A;  3ZFB A;  8GSS A;  1R5A A;  3QFA C;  3KP8 A;  1ZYE A;  1M2A A;  4N30 A;  3P8W A;  2CA8 A;  3R3E A;  3GRX A;  3LWA A;  1XCC A;  4BVY A;  1U3I A;  5HR0 A;  4KA0 A;  4AJ7 A;  1SVM A;  1SL1 B;  1PA3 A;  4O32 A;  2LRT A;  3HZ4 A;  5ECQ B;  3FZA A;  3EU3 A;  4AKX B;  3QAV A;  2JZS A;  1NSW A;  1KEB A;  3KTL A;  5CRE A;  3A2X A;  1SK2 A;  1V40 A;  2N5A A;  2C0D A;  4YQU A;  1OKT A;  3QAW A;  1DUG A;  5JWQ B;  2GS3 A;  3GL5 A;  4AF2 A;  5HFK A;  3IK9 A;  4K7I A;  2JZR A;  4PNF A;  5H5Q A;  3UEM A;  1EV4 A;  2A2P A;  4J56 E;  3ZL5 A;  4EDZ A;  4G19 A;  1YKC A;  5ELA A;  3GFK A;  2LJK A;  4ID0 A;  5ECN B;  2IN3 A;  3F4S A;  5A5H A;  2N5B A;  2H73 A;  3DIE A;  4GSS A;  4A5P A;  2G0F A;  1WIK A;  4IJI A;  3HVS A;  2H19 A;  1SJ6 A;  5KN2 A;  4K7N A;  5H5S A;  1NM3 A;  2VD0 A;  4MJC A;  1W4V A;  2C0G A;  3F0I A;  4MF6 A;  3H4K A;  2KP2 A;  2YZH A;  4QMK A;  2BMX A;  3O76 A;  4GF0 A;  1T4Y A;  3UOM A;  3GH6 A;  4TXO A;  5KN3 A;  4RQR A;  2FD3 A;  3QD9 A;  2WB9 A;  2HSH A;  1F6M C;  2R5G A;  3ZRE A;  1X5D A;  2CVK A;  5G31 A;  3EPT A;  5A4W A;  2YCD A;  4YQM A;  1AC1 A;  5H5R A;  1HQO A;  3F4T A;  1JZR A;  3KCM A;  3S9F A;  1YQ1 A;  1IYH A;  3OR5 A;  1FB6 A;  2VLT A;  3EIN A;  2FCH A;  4K0G A;  2IFQ B;  4PQ1 A;  3HJM A;  2CQ9 A;  5JWO B;  3O6T A;  4FYC A;  3RPN A;  4LLR A;  3VWU A;  4D73 B;  4TRX A;  2DKH A;  4XS4 B;  4EL1 A;  3ZZX A;  1F2E A;  2VOC A;  2H71 A;  3GV1 A;  3VI7 A;  3UAR A;  1TRS A;  2O5V A;  1X9W B;  1M99 A;  4BL7 A;  1CQH A;  1ZL9 A;  5A34 B;  1SL0 B;  4TR4 A;  3FZ9 A;  4ZL8 A;  4G10 A;  3IA1 A;  1N8J A;  1EV9 A;  2DJK A;  3APQ A;  1SU9 A;  3IDV A;  1YVL A;  2VD1 A;  4G01 A;  1SKW B;  2NPB A;  2HXK A;  3HVX A;  5A1N B;  1F3B A;  3KXO A;  2VKZ G;  2DJ3 A;  1MD3 A;  1JLV A;  5AGY A;  4Z2U A;  4BVX A;  4G0K A;  4TR1 A;  5IO2 A;  1LJR A;  5GSS A;  2PUK C;  3LW9 A;  2B6M A;  2OE0 A;  2H75 A;  5ID2 A;  2B7K A;  1EP8 A;  1AQW A;  2RM5 A;  3SBC A;  4PGT A;  4HZ4 A;  13GS A;  3HMJ G;  1V58 A;  1S3A A;  2OKA A;  3W8S A;  1OC9 B;  3DVW A;  2PER A;  2NTO A;  3DEX A;  4WKW A;  1OAZ A;  3G7I A;  2IMD A;  3BJ5 A;  3GKX A;  3TJF A;  4MLY A;  3IOS A;  4OFN A;  4EC0 A;  1GUM A;  2UV8 G;  3A5I A;  2AYT A;  2NBS A;  1PN9 A;  5EL8 A;  3IBH A;  3RBT A;  1X0R A;  2I3Y A;  5HR2 A;  4XCS A;  5ECS A;  3UMA A;  3ERW A;  4KSO A;  2FLS A;  3TJG A;  4K6X A;  2DJ1 A;  2DIZ A;  4LL4 B;  1WE0 A;  3UAP A;  2F9S A;  5HR1 A;  4WXT A;  2CX3 A;  6GSY A;  5ELG A;  4X1U A;  4V2N A;  2HFD A;  2HZE B;  4KB3 A;  3G7J A;  2L6D A;  5D9V A;  5ECL B;  1V9W A;  1K0M A;  2M72 A;  2ALB A;  1JZO A;  2K8V A;  3DRN A;  5J47 A;  2VCZ A;  5ECM B;  1O8X A;  5IPH A;  3K8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...