3LJRA

Glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
244
Chain Sequence
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ljrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ljrA01
4N0VA 3EU3A 4NHWA 4YAPA 3TOUA 3FEUA 1FAAA 2HT9A 5LD0A 1SYRA 2LNSA 3D6IA 4POKA 5EL8A 1SL2B 1X5EA 2XHFA 2B6MA 1AUCA 1SKSB 3GSTA 18GSA 2HRFA 4L8EA 2B7KA 2H1DA 5IMFA 3D22A 2F9SA 4Q5RA 1OC9A 4BA7A 5LNKe 2RM6A 3QAWA 3KD0A 4ILFA 3FZ9A 1A8YA 4MDCA 4GXZA 1MDKA 5GSTA 1YY7A 2GSRA 3EVIA 3DMLA 3RHBA 4MZBA 3ZFBA 4POMA 4MJEA 5EY6A 2TRXA 2C0DA 3L0HA 2O8VB 2D2ZA 1BX9A 1Z9HA 1ACVA 1MDIA 1PL1A 1XXUA 3N5OA 4J57E 2XC2A 2H0GA 3ISOA 3J7Yb 1HNBA 2I9HA 2C4JA 5IO0A 2GZYA 4KAEA 3ZYWA 1NM3A 4JZQA 1GSDA 3HJMA 1VF3A 3IK9A 3M3MA 1ZYQB 4TXOA 4IHUA 3CRTA 1UN2A 3TB2A 3F0IA 2KP1A 4WBJA 1AW9A 2FWFA 4GCIA 2JZRA 5B8AA 1K0CA 1MDJA 2R2JA 5CREA 1TK8B 3CRUA 3GTUA 2DC5A 1TOFA 2MMAA 3F3RA 4MF6A 3ZVJD 3KGKA 5E59A 3KH9A 3PR8A 2EIQA 2R6KA 5HFIA 3GA4A 5CRDA 3FR6A 3C1RA 4JE1A 4KGIA 4ZB6A 3FRCA 4ECJA 4EF0A 1GRXA 1S3AA 4AJ6A 2JACA 3CMIA 1TK5B 3DWVA 1Z6NA 3HVSA 2B1LA 4PX1A 3MWHA 4EL1A 3GNJA 2VCQA 3F6DA 1JHBA 1O73A 4N11A 3ZMKA 2FD3A 4TR0A 1GULA 4L0UA 1PX7A 3P7XA 4O32A 4LMVA 2N5FA 2LUSA 5JWQB 1SL1B 1TU8A 1JZWA 3HKRA 1F6MC 2LSTA 5IMAA 3ZL5A 3APQA 1GNEA 3V1WA 4PNFA 3GUSA 5ECPB 3QMXA 2CQ9A 3UIWA 5ECLB 1GSQA 1TXXA 4F2IA 5D73A 3LSZA 5CAXA 5CRWA 4KH7A 2GDRA 2IMIA 1M2DA 4IQ1A 2I3YA 2GSSA 3C8EA 1NHOA 5JWRB 1K3YA 4WETA 2P0GA 2GS3A 2O85A 3FHKA 2OJLA 4QQ7A 1EOHA 3F9UA 5CYYA 3H93A 2L57A 5CP1A 2TIRA 5IPHA 2YJ7A 3Q74A 3FK8A 3D21A 4ZL9A 2YPMA 1A2MA 1TI1A 2H71A 1KEBA 4IELA 4EE0A 1T4ZA 3BCIA 5DQYA 1I9DA 3CBUA 2RLIA 1JFUA 1GSFA 5J5NA 4L0WA 5G2ZA 5KN1A 1Z3EA 2LTKA 1U6TA 3LEFA 2LRTA 2YP6A 1Z5YE 5H5SA 5ECKB 2HRNA 3Q6OA 2HXKA 2PVQA 1TRWA 4RQXA 2ON7A 1SL0B 3OR5A 4MZCA 2X64A 4G0LA 2GSTA 4YQMA 1FVKA 3DKSA 4F9ZA 1G7OA 3H4KA 2NTOA 1TI3A 1M0UA 1YZXA 4FYCA 2OE0A 2FA4A 1XVQA 3IOSA 1XWGA 1NHYA 1AXDA 1Y6EA 4XS4B 5GSSA 1BEDA 4XRDA 1ERWA 1URMA 3GYKA 1ML6A 1GSUA 1XOAA 5AISA 4WF5A 3FYGA 1OC8A 5HR3A 3KIJA 1SK1A 5G1KA 4IJIA 1TW9A 2FHEA 3U6VA 1X0RA 3DYRA 3FZAA 4E8HA 2DJKA 3O3TA 3CTFA 1G6WA 1IYHA 4BL7A 1NSWA 3TOTA 2O87A 2CVKA 2H30A 1TK0B 4X0XA 3F4RA 2CT6A 3ZTLA 3KZQA 1H75A 3BOAA 1EOGA 5ECSA 1GTIA 5IQYA 2J23A 2I81A 1U3IA 4Q5FA 2CVDA 5G31A 4PURA 3VPTA 2AAWA 3UVHA 3TKSC 2PU9C 3TJFA 19GSA 2AUVA 4KX4A 3H1NA 5G5EA 2PVOC 3ZLPA 2WGRA 5HR0A 4WBRD 3UJ1A 4MPFA 6GSVA 4GLTA 1T00A 4POBA 1FO5A 1QMVA 1PMTA 1B8XA 5DAKB 2TRCP 2H8LA 1B9XC 4P3YB 2YZUA 3D5JA 4ZL8A 3GIXA 2C3NA 3L4NA 1PRXA 2LQOA 4JR6A 4TXVA 2GQKA 3LJRA 3QOUA 3LORA 1MEKA 1AQXA 2PERA 3UVTA 4F0BA 1MTCA 3WGDA 2AJQB 4G0KA 4MF7A 2IJYA 13GSA 2CVBA 1EV9A 4KE3A 1EGRA 2BJXA 4IP1A 2Z9SA 1ERTA 2UZ8A 3ZRDA 1OKDA 3HJOA 1MD3A 2N5BA 3F8UA 4YAVA 4PQHA 2AHEA 1ZCPA 1HQOA 1YJ6A 3E9JB 3FY7A 2FNOA 2MBTA 4QL7A 2H1BA 5IM9A 2K6VA 2ZCTA 5ECOB 4BVXA 3IA1A 2ALBA 4FH8A 4IVFA 2J9HA 3VWXA 3VLNA 5A4WA 1G6YA 1FB0A 3QFAC 1M7TA 1HNCA 4KSMA 1TRVA 1AQWA 1X9MB 3A2WA 2HI7A 3TJBA 3C7MA 2L4CA 1W4VA 2H70A 5DALA 3ME8A 4V2LA 3MDKA 4KDYA 2V6OA 2H74A 4BL7B 3TKSE 4HU7A 3HA9A 1XWBA 1SJZA 2BTOT 3TRXA 1O85A 5C00A 3CSJA 1LBKA 5HFKA 4KB3A 1LJRA 2X99A 5J4UA 4IBPA 5AGYA 3I6AA 3UBLA 3QCPA 1GTUA 2WRTA 1Z7PA 2YCDA 4TR3A 1QFNA 4BVYB 3R2QA 4HZ2A 2XPEA 5ELAA 2B7JA 3KM6A 4HDEA 1SENA 3IAM2 1JZOA 2PN8A 2H6ZA 4TR1A 3KP9A 2L4QA 4HUAA 4KDUA 5EVOA 2VCTA 2IMFA 4KUNA 4XS1A 4EO3A 1K3OA 4EKZA 5DVBA 1OYJA 5E4WA 2L6DA 5F0GA 2WZ9A 5FHIA 3ZREA 2GT6A 1C72A 1GLPA 3K8NA 2I1UA 2DMMA 3VURA 4FO5A 1X9WB 1PA3A 3EMPA 4MMMA 3GH6A 2HSHA 2IMEA 4PQIA 2GZZA 3EURA 1CQHA 1YKCA 1YF0A 1GNWA 1AAZA 1G0TA 4PUAA 1THXA 4O7HA 2DIZA 5DDLA 4XRAA 1V2AA 2R4VA 1PQNA 3TRPA 3F4TA 2IFQB 4G10A 3RDWA 2VIMA 4H86A 1YDKA 5DJMA 4JR4A 5DQSA 3A2VA 3IHQA 5INYA 4POLA 4BPYA 4K6XA 3IBHA 1UVZA 2E2GA 3ZVJA 2HZEB 3HZ8A 1JLWA 3VWUA 3TJJA 4FYUA 4IW9A 3L9SA 2YWIA 3M0FA 2FUG2 5HR2A 3C1SA 1TRUA 1HD2A 4KW6A 4GRFA 3UMAA 1X9SB 2MMNA 5CRGA 2JSYA 5IOWA 4XCSA 4FQUA 3DRNA 2NVLA 5IMZA 3H8QA 4JBBA 3ZIVA 3G7IA 2HQTA 6GSWA 4K1FA 3DD3A 3NOFA 1T4YA 3GKXA 3CSHA 1AIUA 1A0FA 3SWLA 3LG6A 5DALB 1BAYA 5B6MA 4V1Ag 5J9CA 1T7PB 4DSSA 1GTBA 1K0DA 1SJIA 5A4UA 4NV2A 1F9MA 3GKMA 3ERWA 4KF9A 3D0ZA 4GF0A 2OE1A 2O89A 2OA7A 4OCFA 1OKTA 4XIHA 5GAPD 4TVEA 3BBYA 2GQLA 4MLYA 2HLSA 1X5DA 4OFTA 3GH9A 4RUVA 3M1GA 2AYTA 5J3RA 4TR1B 4NAXA 5ELGA 4ZBAA 4XHMA 1V57A 5KEJA 1WPIA 2LJRA 4OO4A 4V1Ap 2IIYA 1O8WA 4MJAA 1WIKA 3F3QA 2WCIA 2ZNMA 1B4QA 3L9VA 5KN0A 2GLRA 1WJKA 5IMCA 5HR1A 2PGTA 4CDOA 3WT1A 3P8WA 1V58A 3BJ5A 3TDGA 5IPGA 2C80A 1OC9B 4JRRA 2M72A 2OKAA 11GSA 4TW5A 1GWCA 2M46A 1SJ6A 1B48A 1DBYA 3L78A 3W8JA 4O92A 2REMA 2OADA 1K3LA 1N8JA 3HZ4A 4I8BA 2B5XA 2VOCA 2O7KA 2P5RA 2MMOA 3UOMA 2R37A 2VUPA 1SYXA 3ZIJA 4HOJA 3IXRA 3KMOA 2GSQA 1X5CA 4E8EA 12GSA 4FIWA 1PD21 4GTUA 1M9AA 4D73A 1ERVA 1RW1A 4TXOB 1SD8A 1OC3A 1VRSD 2C3TA 2R3XA 2L5OA 2FGXA 1O6JA 2H6XA 5D9XA 4DEJA 1GSSA 3GURA 2IN3A 5CRHA 4EUYA 1M99A 2A2RA 3GKNA 2V41A 3DVWA 3ZMLA 3VK9A 4ML1A 1VGLA 3GTUB 3QFBC 1K0OA 1B4PA 4TOPA 1THOA 1WE0A 3ZITA 3GSSA 5DCGA 3QDNA 4DSSB 1KTEA 4N0ZA 2GQMA 3MNGA 5EPFA 5HQPA 3KH7A 2H0HA 1TTZA 2P31A 1YF1A 1GP1A 4BWSA 5D9TA 3FR3A 4MABA 4OO5A 1GL8A 1XBSA 2FA8A 5F06A 5BMUA 1NW2A 3G7JA 1GH2A 5ID2A 4ECCA 2JADA 6GSXA 4GQFA 1K0BA 4OFMA 3PH9A 2OACA 2VD0A 2WDUA 2HSMA 1E2YA 3IDVA 1B9YC 3FZ4A 4CW9A 2VO4A 2JU5A 2PWJA 1F3AA 1J08A 1VF4A 2DJ1A 5GAND 2JZSA 5ECRB 2GZPA 4X1UA 5JCUA 2FLSA 4HS1A 1R5PA 2CAIA 1DUGA 1EWXA 2RUEA 1GUMA 3W8SA 3LYKA 1XW9A 2WB9A 1FW1A 4F0CA 4YQUA 4HEA2 2PUKC 4ECIA 2VM2A 5AIVA 1V9WA 1EZKA 2DSAA 4OD7A 1GSYA 2JL4A 4I2UA 3RPNA 1XW5A 4RI6A 2YJHA 3UARA 2KLXA 2YN1A 1SD9A 4PTSA 2MMZA 1Z7RA 5HFGA 2C1YA 4G19A 3EU4A 4J56E 3CYNA 2V6KA 3Q19A 2VCWA 4ZXGA 2VL2A 2YV7A 2F8AA 3G9BA 4ACSA 2LQQA 1PGTA 4O5RA 14GSA 5D96A 3ZZXA 3H79A 1XCCA 5GZZB 1I5GA 5IIZA 4MK3A 10GSA 4MCUA 3C73A 2R5GA 1ILOA 3HYPA 3O76A 1A0RP 2AB6A 4ECBA 3KEBA 3F4SA 5DBQA 3LQ7A 1BYEA 5AN1A 3EWLA 3QPMA 4ML6A 5D93A 3I43A 3APSA 4KSOA 6GSUA 7GSSA 3IV4A 16GSA 2A2SA 3QD9A 2BMXA 2VD1A 3FR9A 3F6FA 4LL1B 2MYGA 5ECHB 2DJ2A 1YEPA 4TN8A 5A5KA 4TR4A 5CO3A 3ERFA 2DLXA 2VCXA 5CNWA 3EYTA 5H5QA 5JCGA 2DBCA 3TRQA 1V98A 2FWEA 5FWGA 4GQCA 2KOKA 4ULXA 4WR5A 1GLQA 3GKKA 2FCHA 1XWCA 5L71A 6GSTA 2H75A 1ZGNA 5LCZA 1XVWA 1A24A 5D9WA 4GSNA 2H0IA 1QK8A 2YWOA 4KDXA 4AGSA 4AJ8A 1A8LA 1EP8A 1SK0A 1YKAA 3LYPA 4IJ3A 1TU7A 2WULA 2CAQA 3VPQA 1QQ2A 4PQ1A 6GSYA 4HQZA 4EDYA 4HI7A 5ECNB 4EDZA 1TDIA 2OBKA 1ERUA 1K0AA 2L6CA 3IE3A 1GUHA 3TKRA 3US3A 4NWYA 4K0GA 4I5QA 1USBA 3DIEA 1AQVA 3WT2A 2LS5A 1ZMAA 1KBNA 2G0FA 3IAS2 2EIRA 3I69A 1K0MA 20GSA 3UBKA 3MAKA 4L5LA 2HSNB 1O7UA 3KMNA 1YEXA 4NPBA 1H4OA 1WMJA 2FWHA 2CA8A 1PSQA 3VWVA 1A2JA 4ZBDA 1WRYA 4PGTA 3DXBA 5D9VA 3KCMA 3CTGA 3GV1A 2KP2A 4AJ7A 1HYUA 5B6NA 5AIXA 5H5RA 1DE1A 4KCEA 4HJ2A 4F82A 3BD2A 1U3AA 4RI7A 3WGEA 1A2LA 3HD5A 2X8GA 3J7Yk 3E3EA 3M9KA 2IMDA 4K0NA 1R5AA 1M2BA 2OE3A 3EINA 4JU5A 2X8HA 2IWTA 4GSSA 4XS6A 4BVXB 5COHA 3C71A 4F03A 1FOVA 3GFKA 3GL3A 1FHEA 4XTSA 1QGVA 3IPZA 1G7EA 2QSIA 2CX3A 1ZYEA 2JSZA 3WGXA 1XW6A 2K8VA 1F3BA 1TP9A 1XPVA 2H6YA 4WXTA 3LWAA 1S3DA 3VFIA 2F3MA 2FY6A 1ZOFA 1GUKA 4X43A 1XWKA 2C0EA 2DIYA 2GTUA 1BG5A 4V2MA 4DSRA 1O8XA 4MH3A 1GSEA 3N9JA 3QR6A 1KNGA 1F2EA 2RM5A 3NIVA 3ED3A 1EGOA 2V2GA 4XS4A 2VLVA 2HSYA 1ZZYA 2L5LA 2LRCA 3UAPA 1U88A 2C3QA 4PXOA 5J9BA 4IP6A 2RIIA 3D4MA 5G1LA 3D4TA 3KP8A 1ST9A 2MZCA 4NV5A 4QL9A 2LRNA 2EC4A 1DSBA 3RAZA 1LU4A 1R7HA 3R3EA 1EEMA 4ZIJA 3HHVA 1E6BA 4J2FA 3UEMA 4IKHA 1MD4A 4IS0A 3GL5A 1FB6A 2IPAA 3GHAA 4MPGA 1XWAA 4HU9A 3M8NA 3HJPA 4K2DA 2H72A 1R4WA 2ZUPA 3ME7A 3FW2A 4KNDA 1Y25A 1U87A 2VL9A 1EEJA 3QAGA 3IRAA 2G2QA 1XIYA 2VAFA 2ON5A 2VLUA 4HJMA 3HY2A 5C04A 3PPUA 2WJUA 5ENUA 2WS2A 4JEDA 2HE3A 2V1MA 4I97A 8GSSA 2YWNA 1J9BA 4OCEA 4K8MA 3EMXA 4HZ4A 9GSSA 5B8BA 5ECQB 3PINA 5IMDA 2DJ0A 3TKPA 2YV9A 2VL2C 5F8BA 3TKQA 5DAKA 1UC7A 1IYIA 4USSA 2QKEA 3Q18A 3IK7A 5FT3A 3LXTA 3WYWA 3I9V2 4IGJA 4WKWA 4I2TA 3KJYA 1PN9A 3TCOA 3RHCA 2PPTA 3O6TA 2H1GA 1HNAA 2XBQA 5F07A 1N2AA 3LFLA 2YOIA 4MF5A 1OE7A 1T8EB 3WD6A 3A2XA 4NMUA 4OFNA 2B5YA 2LNTA 2NBSA 1SU9A 3IR4A 1BQ7A 1OAZA 1QXHA 4ZB8A 3S9FA 1EV4A 2MBSA 1JZRA 3TGZA 3ZFLA 1WOUA 4OWYA 4CHSA 3M9JA 1JLVA 4Q5QA 3DEXA 1ON4A 4K7IA 3IC4A 1M2AA 1TJDA 3GRXA 4MJCA 2CV4A 5F05A 3JCML 2K9FA 2H1AA 2PMTA 4EXJA 5A4VA 2H73A 1DE2A 4L5OA 4FYBA 5G30A 1FVJA 3P2AA 4K9ZA 2KHPA 2OBIA 1TKDB 4K7NA 4ZL7A 3DVXA 5JWOB 1K0NA 2B5EA 1UA5A 1T1VA 3VWWA 2IMKA 3RPPA 2C0GA 1RK4A 2N5AA 1XOBA 3KTLA 4MP4A 2PBJA 1BJXA 5IO2A 2HRKA 2HNLA 1OVNA 2FWGA 1Q4JA 2VL3A 5D8IA 2IL3A 2VM1A 2B1KA 1XZOA 2F51A 1EP7A 4KA0A 3SBCA 4G2EA 2XBIA 3GMFA 1S3CA 1PKWA 3NZNA 4KCAA 3HVXA 1VF1A 5ECIB 2H76A 3A5WA 2A4VA 3FKFA 3LXZA 1Z6MA 3IC8A 5B7CA 22GSA 3BCKA 4GSTA 4BVYA 3QAVA 1RQMA 2E7PA 2QGVA 4YQVA 5J41A 3DGQA 2H01A 3U5RE 4NXIA 1SKWB 4V2NA 1YQ1A 4WEYA 2B3SA 2AV4A 5G5FA 2LV3A 1F37A 4BWQA 2F8FA 4NHZA 3E0UA 2NDOA 4DSQA 2CZ3A 2RUFA 4WF4A 3GN3A 4G0IA 3VI5A 3RBTA 4LL4B 1AC1A 2HRAA 2LJAA 3HVVA 4MZWA 3EE2A 2M80A 1WP0A 2GVPA 4EVMA 4MH2A 3UL3A 1GTAA 1SKRB 1FG4A 6GSSA 3MSZA 2YZHA 4I6XA 1T3BA 4MJBA 1ABAA 4IN0A 5ECMB 5JCWA 2I4AA 1PX6A 3L9UA 1SK2A 4PNGA 1TRSA 3P90A 2DMLA 2HYXA 2YANA 4D73B 1PKZA 5DCHA 3A3TA 4PUFC 3LGCA 4K7OA 1VF2A 2IFQA 2VCVA 1W89A 4LA1A 4GWRA 4DVCA 3AY8A 4LMWA 1R26A 2KUCA 2GGTA 3GX0A 2LKUA 2H66A 3F63A 3TJGA 1Q98A 2YNXA 2E0QA 3FZ5A 1WWJA 4AF2A 2X8CA 2HZEA 3TUEA 1CQGA 2DJ3A 3KTBA 17GSA 2ES7A 3G7YA 2CZ2A 3ERGA 2LEGA 4ZILA 1ZL9A 2V32A 4N30A 4EC0A 1O81A 2VLTA 2EIOA 2CX4A 3W6GA 4ZBBA 3HXSA 3APOA 1M9BA 3TJKA 1A23A 2HZFA 1PL2A 5IMVA 3CXGA 1QUWA 2VCZA 4ZB9A 4TRXA 1XFLA 3EC3A 5ID2B 3HCZA 5DJLA 4OMVA 5KN3A 4G9HA 4MA9A 2K18A 2GT5A 2HSMB 2L59A 2HRKB 4Z7XA 3HDCA 3VI7A 2P5QA 3PGTA 5ABRA 1J0FA 2XPDA 4Q5NA 1OE8A 2NPBA 2QC7A 3KXOA 4HQSA 5KN2A 1V40A 4WR4A 5IOXA 2YWMA 2DJJA 4YH2A 2C8UA 2H19A 2E2MA 4LLRA 2C0FA 1JZDA 2JZTA 4IQAA 2K8SA 4ISDA 3GX8A 3TKSA 2HFDA 2LJKA 2WFCA 4ID0A 4N10A 4RQRA 4TKYA 3CSIA
chains in the Genus database with same CATH superfamily
4N0VA 3EU3A 4NHWA 4YAPA 3TOUA 3FEUA 1FAAA 2HT9A 1N25A 5LD0A 1SYRA 2LNSA 3D6IA 4POKA 5EL8A 1SL2B 1X5EA 2XHFA 2B6MA 1AUCA 1SKSB 3GSTA 18GSA 2HRFA 4L8EA 2B7KA 3A5IA 2H1DA 5IMFA 3D22A 2F9SA 4Q5RA 1OC9A 4BA7A 5LNKe 2RM6A 3QAWA 3KD0A 4ILFA 3FZ9A 1A8YA 1BG1A 4MDCA 4GXZA 1MDKA 5GSTA 1YY7A 2GSRA 3EVIA 3DMLA 3RHBA 4MZBA 3ZFBA 4POMA 4MJEA 3CWGA 5EY6A 2TRXA 2C0DA 1SVLA 3L0HA 2O8VB 2D2ZA 1BX9A 1Z9HA 1ACVA 1MDIA 1PL1A 1XXUA 3N5OA 4J57E 2XC2A 2H0GA 3ISOA 3J7Yb 2WVZA 1HNBA 2I9HA 2C4JA 5IO0A 2GZYA 3HVNA 4KAEA 3ZYWA 1NM3A 4JZQA 1GSDA 3HJMA 1VF3A 3IK9A 3M3MA 1ZYQB 4TXOA 4IHUA 3CRTA 5A34A 1UN2A 3TB2A 3F0IA 2KP1A 4WBJA 1AW9A 2FWFA 4GCIA 2JZRA 5B8AA 1K0CA 1MDJA 2R2JA 5CREA 1TK8B 3CRUA 3GTUA 2DC5A 1TOFA 2MMAA 3F3RA 4MF6A 3ZVJD 3KGKA 5E59A 3PR8A 3KH9A 2EIQA 2R6KA 5HFIA 2X4AA 3GA4A 5CRDA 3FR6A 3C1RA 4JE1A 4KGIA 4ZB6A 3FRCA 4ECJA 4EF0A 1GRXA 1S3AA 4AJ6A 2JACA 3CMIA 1TK5B 3DWVA 1Z6NA 3HVSA 2B1LA 4PX1A 3MWHA 4EL1A 1Y1UA 3GNJA 2VCQA 3F6DA 1JHBA 1O73A 2EFCA 4N11A 3ZMKA 2FD3A 4TR0A 1GULA 4L0UA 1PX7A 5BRTA 3P7XA 4O32A 4LMVA 2N5FA 2LUSA 5JWQB 1SL1B 1TU8A 1JZWA 3HKRA 1F6MC 2LSTA 5IMAA 3ZL5A 3APQA 1GNEA 3V1WA 4PNFA 3GUSA 5ECPB 3QMXA 2CQ9A 3UIWA 5ECLB 1GSQA 1TXXA 4F2IA 5D73A 3LSZA 5CAXA 5CRWA 4KH7A 2GDRA 2IMIA 1M2DA 4IQ1A 2I3YA 2GSSA 3C8EA 1NHOA 5JWRB 3HMJG 1K3YA 4WETA 1ZYNA 2P0GA 2GS3A 2O85A 3FHKA 2OJLA 4QQ7A 1EOHA 3F9UA 5CYYA 3H93A 2L57A 5CP1A 2TIRA 5IPHA 2YJ7A 3Q74A 3FK8A 3D21A 4ZL9A 2YPMA 1A2MA 1TI1A 2H71A 1KEBA 4IELA 4EE0A 1T4ZA 3BCIA 5DQYA 1I9DA 3CBUA 4EIQA 2RLIA 1JFUA 1GSFA 5J5NA 2EFEA 4L0WA 5G2ZA 5KN1A 1Z3EA 2LTKA 1U6TA 5A1NA 3LEFA 2LRTA 2YP6A 1Z5YE 5H5SA 5ECKB 2HRNA 3Q6OA 2HXKA 2PVQA 1TRWA 4RQXA 2ON7A 1SL0B 4BIKA 3OR5A 4MZCA 4AKGA 2H1LA 5A34B 2X64A 4G0LA 2GSTA 4YQMA 1FVKA 3DKSA 4F9ZA 1G7OA 3H4KA 2NTOA 1TI3A 1M0UA 1YZXA 5KOWA 4FYCA 2OE0A 4AI6A 2FA4A 1XVQA 3IOSA 1XWGA 1NHYA 1AXDA 1Y6EA 4XS4B 5GSSA 1BEDA 4CY6A 4XRDA 1ERWA 1URMA 3GYKA 1ML6A 1GSUA 1XOAA 5AISA 4WF5A 3FYGA 1OC8A 5HR3A 3KIJA 1SK1A 5G1KA 4IJIA 1TW9A 2FHEA 3U6VA 1X0RA 3DYRA 3FZAA 4E8HA 2DJKA 3O3TA 3CTFA 1G6WA 1IYHA 4BL7A 1NSWA 3TOTA 2O87A 2CVKA 2H30A 1TK0B 4X0XA 3F4RA 2CT6A 3ZTLA 3KZQA 1H75A 3BOAA 1EOGA 5ECSA 1GTIA 5IQYA 2J23A 2I81A 1U3IA 4Q5FA 2CVDA 5G31A 4PURA 3VPTA 2AAWA 3UVHA 3TKSC 2PU9C 3TJFA 19GSA 2AUVA 4KX4A 3H1NA 5G5EA 2PVOC 3ZLPA 2WGRA 5HR0A 4WBRD 3UJ1A 4MPFA 6GSVA 4GLTA 1T00A 4POBA 1FO5A 3MIXA 1QMVA 1PMTA 1B8XA 5DAKB 4O5QA 2TRCP 2H8LA 1B9XC 4P3YB 2YZUA 3D5JA 4ZL8A 3GIXA 2C3NA 3L4NA 1PRXA 2LQOA 1ZYPA 4JR6A 4TXVA 2GQKA 3LJRA 3QOUA 3LORA 4Z2RA 1MEKA 1AQXA 2PERA 3UVTA 4F0BA 1MTCA 2WW2A 3WGDA 2AJQB 4G0KA 4MF7A 2IJYA 13GSA 2CVBA 1EV9A 4KE3A 1EGRA 2BJXA 4IP1A 2Z9SA 1ERTA 2UZ8A 3ZRDA 1OKDA 3HJOA 1MD3A 2N5BA 3F8UA 4YAVA 4PQHA 2AHEA 1ZCPA 5A1NB 1HQOA 1YJ6A 3E9JB 3FY7A 2FNOA 2MBTA 4QL7A 2H1BA 5IM9A 2K6VA 2ZCTA 5ECOB 4BVXA 3IA1A 2ALBA 4FH8A 4IVFA 2J9HA 3VWXA 3VLNA 5A4WA 1G6YA 1FB0A 3QFAC 1M7TA 1HNCA 2WW3A 4KSMA 1TRVA 1AQWA 4K5SA 1X9MB 3A2WA 2HI7A 3TJBA 3C7MA 2L4CA 1W4VA 2H70A 5DALA 3ME8A 4O5UA 2WW1A 4V2LA 3MDKA 3MYDA 4KDYA 2V6OA 2H74A 4BL7B 3TKSE 4HU7A 3HA9A 1XWBA 1SJZA 2BTOT 3TRXA 1O85A 5C00A 3CSJA 1LBKA 5HFKA 4KB3A 1LJRA 2X99A 5J4UA 4IBPA 5AGYA 5A5HA 3I6AA 3UBLA 4K5RA 3QCPA 1GTUA 5J4YA 2WRTA 1Z7PA 2YCDA 4TR3A 1QFNA 4BVYB 3R2QA 4HZ2A 2XPEA 5ELAA 2B7JA 3KM6A 4HDEA 1SENA 3IAM2 1JZOA 2PN8A 2H6ZA 4TR1A 3KP9A 2L4QA 4HUAA 4KDUA 5EVOA 2VCTA 2IMFA 4KUNA 4XS1A 4EO3A 1K3OA 4EKZA 5DVBA 1OYJA 5E4WA 2L6DA 1TXUA 5F0GA 2WZ9A 5FHIA 3ZREA 2GT6A 1C72A 1GLPA 3K8NA 2I1UA 2DMMA 3VURA 4FO5A 1X9WB 4QMKA 1PA3A 3EMPA 4MMMA 3GH6A 2HSHA 2IMEA 4PQIA 2GZZA 3EURA 1CQHA 1YKCA 1YF0A 1GNWA 1AAZA 1G0TA 4PUAA 1THXA 4O7HA 2DIZA 5DDLA 4XRAA 1V2AA 2R4VA 1PQNA 3TRPA 3F4TA 3RGBC 2IFQB 4G10A 3RDWA 2VIMA 4H86A 1YDKA 5DJMA 4JR4A 5DQSA 3A2VA 3IHQA 5INYA 4POLA 4BPYA 4K6XA 3IBHA 1UVZA 2E2GA 3ZVJA 2HZEB 3HZ8A 1JLWA 3VWUA 3TJJA 4FYUA 4IW9A 3L9SA 2YWIA 3M0FA 2FUG2 5HR2A 3C1SA 1TRUA 1HD2A 4KW6A 4GRFA 4AKIA 3UMAA 1X9SB 2MMNA 5CRGA 2JSYA 5IOWA 4XCSA 4FQUA 3DRNA 2NVLA 5IMZA 3H8QA 4JBBA 3ZIVA 3G7IA 2HQTA 6GSWA 4K1FA 3DD3A 3NOFA 1T4YA 2R0PA 3GKXA 3CSHA 1AIUA 1A0FA 3SWLA 3LG6A 5DALB 1BAYA 5B6MA 4V1Ag 5J9CA 1T7PB 4DSSA 1GTBA 1K0DA 1SJIA 5A4UA 4NV2A 1F9MA 3GKMA 3ERWA 4KF9A 4HSCX 3D0ZA 4GF0A 2OE1A 5A5HB 2O89A 2OA7A 4OCFA 1OKTA 4XIHA 5GAPD 4TVEA 3BBYA 2GQLA 4MLYA 2HLSA 1X5DA 4OFTA 3GH9A 4RUVA 3M1GA 2AYTA 5J3RA 4TR1B 4NAXA 5ELGA 4ZBAA 4XHMA 1V57A 5KEJA 4X4JA 1WPIA 4PI0C 4YKGA 2LJRA 4OO4A 4V1Ap 2IIYA 1O8WA 4MJAA 1WIKA 3F3QA 2WCIA 2ZNMA 1B4QA 3L9VA 5KN0A 2GLRA 1WJKA 5IMCA 5HR1A 2PGTA 4CDOA 3WT1A 3P8WA 1V58A 3BJ5A 3TDGA 5IPGA 4Z2UA 2C80A 1OC9B 4JRRA 2M72A 1PFOA 2OKAA 11GSA 4TW5A 1GWCA 2M46A 1SJ6A 1B48A 1I1IP 1DBYA 3L78A 3W8JA 4O92A 4ZB7A 2REMA 2R0CA 2QA1A 2OADA 1K3LA 1N8JA 3HZ4A 4I8BA 2B5XA 2VOCA 2O7KA 2P5RA 2MMOA 3UOMA 2R37A 2VUPA 1SYXA 3ZIJA 4HOJA 3IXRA 3KMOA 4G01A 2GSQA 1X5CA 4E8EA 12GSA 4FIWA 1PD21 4GTUA 1M9AA 4D73A 1ERVA 1RW1A 4MNNA 4TXOB 3CHXC 1SD8A 1OC3A 1VRSD 2C3TA 2R3XA 2L5OA 2FGXA 1O6JA 1S3RA 2H6XA 5D9XA 4DEJA 1GSSA 3GURA 4GDFA 2IN3A 5CRHA 4CY8A 4EUYA 1M99A 2A2RA 3GKNA 2V41A 3DVWA 3ZMLA 3VK9A 4ML1A 1VGLA 3GTUB 3QFBC 1K0OA 4K2XA 1B4PA 4TOPA 1THOA 1WE0A 3ZITA 3GSSA 5DCGA 3QDNA 4EIPA 4DSSB 1KTEA 4N0ZA 2WVYA 2GQMA 3MNGA 5EPFA 5HQPA 3KH7A 2H0HA 1TTZA 2P31A 1YF1A 1GP1A 4BWSA 5D9TA 3FR3A 4MABA 4OO5A 1GL8A 1XBSA 2FA8A 5F06A 5BMUA 1NW2A 3G7JA 1GH2A 5ID2A 4ECCA 2JADA 6GSXA 4GQFA 1K0BA 4OFMA 3PH9A 2OACA 2VD0A 1SVMA 2WDUA 2HSMA 1E2YA 3IDVA 1B9YC 3FZ4A 4CW9A 2VO4A 2JU5A 2PWJA 1F3AA 1J08A 1VF4A 2DJ1A 5GAND 2JZSA 5ECRB 2GZPA 4X1UA 5JCUA 2FLSA 4HS1A 1R5PA 2CAIA 1DUGA 1EWXA 2EFDA 2RUEA 1GUMA 3W8SA 3LYKA 1XW9A 2WB9A 1FW1A 4F0CA 4YQUA 4HEA2 2PUKC 4ECIA 2VM2A 5AIVA 1V9WA 1EZKA 3TU3B 2DSAA 4OD7A 1GSYA 2JL4A 4I2UA 3RPNA 4E68A 1PN0A 1XW5A 4RI6A 2HSNA 2YJHA 1M3IA 3UARA 2KLXA 2YN1A 1SD9A 4PTSA 2MMZA 1Z7RA 5HFGA 2C1YA 4G19A 3EU4A 4J56E 3CYNA 2V6KA 3Q19A 2VCWA 4ZXGA 2VL2A 2YV7A 2F8AA 3G9BA 4ACSA 2LQQA 1PGTA 4O5RA 14GSA 5D96A 3ZZXA 3H79A 1XCCA 5GZZB 1I5GA 5IIZA 4MK3A 10GSA 4MCUA 3C73A 2R5GA 1ILOA 3HYPA 3O76A 4A5PA 1A0RP 2AB6A 4ECBA 3KEBA 3F4SA 5DBQA 3LQ7A 1BYEA 5AN1A 3EWLA 2VKZG 3QPMA 4ML6A 5D93A 3I43A 3APSA 4KSOA 6GSUA 7GSSA 3IV4A 1FOHA 16GSA 2A2SA 3QD9A 2BMXA 2VD1A 3FR9A 3F6FA 4LL1B 2MYGA 5ECHB 2DJ2A 1YEPA 4TN8A 5A5KA 4TR4A 5CO3A 3ERFA 2DLXA 2VCXA 5CNWA 3EYTA 5H5QA 5JCGA 2DBCA 3TRQA 1V98A 2FWEA 5FWGA 4GQCA 2KOKA 4ULXA 5BMUB 4WR5A 1GLQA 3GKKA 2FCHA 1XWCA 5L71A 6GSTA 2H75A 1ZGNA 5LCZA 1XVWA 1A24A 5D9WA 5KOXA 4GSNA 2H0IA 1QK8A 2YWOA 4KDXA 4AGSA 4AJ8A 1A8LA 1EP8A 1SK0A 1YKAA 3LYPA 4IJ3A 1TU7A 2WVXA 2WULA 2CAQA 3VPQA 1QQ2A 4PQ1A 6GSYA 4HQZA 4EDYA 4HI7A 5ECNB 4EDZA 1TDIA 2OBKA 1ERUA 1K0AA 2L6CA 3IE3A 1GUHA 3TKRA 3US3A 4NWYA 4K0GA 4I5QA 1USBA 3DIEA 1AQVA 3WT2A 2LS5A 1ZMAA 1KBNA 4PHZC 2G0FA 2OT3A 2EIRA 3IAS2 3I69A 1K0MA 20GSA 3UBKA 1YVLA 3MAKA 4L5LA 1S4BP 2HSNB 1O7UA 3KMNA 1YEXA 4NPBA 1H4OA 1WMJA 2FWHA 2CA8A 1PSQA 3VWVA 5J47A 1A2JA 4ZBDA 1WRYA 4PGTA 3DXBA 5D9VA 3KCMA 3CTGA 3GV1A 2KP2A 4AJ7A 1HYUA 5B6NA 5AIXA 5H5RA 1DE1A 4KCEA 4HJ2A 4F82A 3BD2A 1U3AA 4RI7A 3WGEA 1A2LA 3HD5A 2X8GA 3J7Yk 3E3EA 3M9KA 2IMDA 4K0NA 1R5AA 1M2BA 2OE3A 3EINA 4JU5A 2X8HA 2IWTA 4GSSA 4XS6A 4BVXB 5COHA 3C71A 4F03A 1FOVA 3GFKA 3GL3A 4PI2C 1FHEA 4XTSA 1QGVA 3IPZA 1G7EA 2QSIA 2CX3A 1ZYEA 2JSZA 3WGXA 1XW6A 2K8VA 1F3BA 1TP9A 1XPVA 2H6YA 4WXTA 3LWAA 1S3DA 3VFIA 2F3MA 2FY6A 1ZOFA 1GUKA 4X43A 1XWKA 2C0EA 2DIYA 2GTUA 1BG5A 4V2MA 4DSRA 1O8XA 4MH3A 1GSEA 3N9JA 4YKFA 4ICYA 3QR6A 1KNGA 1F2EA 2RM5A 3NIVA 3ED3A 1EGOA 2V2GA 4XS4A 2VLVA 2HSYA 1ZZYA 2L5LA 2LRCA 3UAPA 1U88A 2C3QA 4PXOA 5J9BA 4IP6A 2RIIA 3D4MA 2WW0A 5G1LA 3D4TA 3KP8A 1ST9A 2MZCA 4NV5A 4QL9A 2LRNA 2EC4A 1DSBA 2WVXB 3RAZA 1LU4A 1R7HA 3R3EA 1EEMA 4ZIJA 3HHVA 1E6BA 4J2FA 3UEMA 4IKHA 1MD4A 4IS0A 4Z2TA 3GL5A 1FB6A 2IPAA 3GHAA 4MPGA 1XWAA 4HU9A 2O36A 3M8NA 3HJPA 4K2DA 2H72A 1R4WA 2ZUPA 3ME7A 3FW2A 4KNDA 1Y25A 1U87A 2VL9A 1EEJA 3QAGA 3IRAA 2G2QA 1XIYA 2VAFA 2ON5A 2VLUA 4HJMA 2WZSA 3HY2A 5C04A 3PPUA 2WJUA 5ENUA 2WS2A 4JEDA 2HE3A 2V1MA 4I97A 8GSSA 2YWNA 5J40A 2DKHA 1J9BA 4OCEA 4K8MA 3EMXA 4HZ4A 9GSSA 5B8BA 5ECQB 3EPTA 3PINA 5IMDA 2DJ0A 3TKPA 2YV9A 2VL2C 5F8BA 4AKHA 3TKQA 5DAKA 1UC7A 1IYIA 4USSA 2QKEA 3IK7A 3Q18A 5FT3A 3LXTA 3WYWA 3I9V2 4IGJA 4WKWA 4I2TA 3KJYA 1PN9A 3TCOA 3RHCA 2PPTA 3O6TA 2H1GA 1HNAA 1M3JA 2XBQA 4AKXB 5F07A 1N2AA 3LFLA 2A4HA 2YOIA 4MF5A 1OE7A 1T8EB 3WD6A 3A2XA 4NMUA 4OFNA 2B5YA 2LNTA 2NBSA 1SU9A 3IR4A 1BQ7A 1OAZA 1QXHA 4ZB8A 3S9FA 1EV4A 2MBSA 1JZRA 3TGZA 3ZFLA 1WOUA 4OWYA 4CHSA 3M9JA 1JLVA 4Q5QA 3DEXA 1ON4A 4K7IA 3IC4A 1M2AA 1TJDA 3GRXA 4MJCA 2CV4A 5F05A 3JCML 2K9FA 2X49A 2H1AA 2PMTA 4EXJA 5A4VA 2H73A 1DE2A 4L5OA 4FYBA 5G30A 3FMWA 1FVJA 3P2AA 4K9ZA 2DKIA 2KHPA 2OBIA 1TKDB 4K7NA 4ZL7A 3DVXA 5JWOB 1K0NA 2B5EA 1UA5A 1T1VA 3VWWA 2IMKA 3RPPA 2C0GA 1RK4A 2N5AA 1XOBA 3KTLA 4MP4A 2PBJA 1BJXA 5IO2A 2HRKA 2HNLA 1OVNA 2FWGA 1Q4JA 2VL3A 5D8IA 2IL3A 2VM1A 2UV8G 2B1KA 1XZOA 2F51A 1EP7A 4KA0A 3SBCA 4G2EA 2XBIA 3GMFA 4W66A 1S3CA 1PKWA 3NZNA 4KCAA 3HVXA 1VF1A 5ECIB 2H76A 3A5WA 2A4VA 3FKFA 3LXZA 1Z6MA 3IC8A 5B7CA 22GSA 3BCKA 4GSTA 4BVYA 3QAVA 1RQMA 2E7PA 2QGVA 4YQVA 5J41A 3DGQA 2H01A 3U5RE 4NXIA 1SKWB 4V2NA 1YQ1A 4WEYA 2B3SA 2AV4A 5G5FA 2LV3A 1F37A 4BWQA 2F8FA 2EFHA 4NHZA 3E0UA 2NDOA 4DSQA 2CZ3A 2RUFA 3IHGA 4WF4A 3GN3A 4G0IA 3VI5A 3RBTA 4LL4B 1AC1A 2HRAA 2LJAA 3HVVA 4MZWA 3EE2A 2M80A 1WP0A 2GVPA 4EVMA 4MH2A 3UL3A 1GTAA 1SKRB 1FG4A 6GSSA 2A2PA 3MSZA 2YZHA 4I6XA 1T3BA 4MJBA 1ABAA 4IN0A 5ECMB 5JCWA 2I4AA 1PX6A 3L9UA 1SK2A 4PNGA 1TRSA 3P90A 2DMLA 2HYXA 2YANA 4D73B 1PKZA 5DCHA 3A3TA 4PUFC 3LGCA 4K7OA 1VF2A 2IFQA 2VCVA 1W89A 4LA1A 4GWRA 4DVCA 3AY8A 4LMWA 1R26A 1XG8A 2KUCA 2GGTA 3GX0A 2LKUA 2H66A 3F63A 3TJGA 1Q98A 2YNXA 2E0QA 2O3EA 3FZ5A 1WWJA 4AF2A 2X8CA 2HZEA 3TUEA 1CQGA 2DJ3A 3KTBA 17GSA 2ES7A 3G7YA 2CZ2A 3ERGA 2LEGA 4ZILA 1ZL9A 2V32A 4N30A 4EC0A 1O81A 2VLTA 2EIOA 2CX4A 3W6GA 2O5VA 4ZBBA 3HXSA 4N3ZA 3APOA 1M9BA 3TJKA 1A23A 2HZFA 1PL2A 5IMVA 3CXGA 1SVOA 1QUWA 2VCZA 4ZB9A 4TRXA 1XFLA 3EC3A 5ID2B 3HCZA 5DJLA 4OMVA 5KN3A 4G9HA 4MA9A 3CQFA 2K18A 2GT5A 2HSMB 2QA2A 2L59A 2HRKB 4Z7XA 3HDCA 3VI7A 2P5QA 3PGTA 1BF5A 5ABRA 1J0FA 2XPDA 4Q5NA 1OE8A 3RFRC 2NPBA 2QC7A 3KXOA 4HQSA 5KN2A 1V40A 4WR4A 5IOXA 3LW9A 2YWMA 2DJJA 4YH2A 2R0GA 5J4VA 2C8UA 2H19A 2E2MA 4LLRA 4FXYP 2C0FA 1JZDA 2JZTA 4IQAA 2K8SA 4ISDA 3GX8A 3TKSA 1YEWC 2HFDA 2LJKA 2WFCA 4ID0A 4N10A 4RQRA 4TKYA 3CSIA
chains in the Genus database with same CATH topology
4N0VA 3EU3A 4NHWA 4YAPA 3TOUA 3FEUA 1FAAA 2HT9A 1N25A 5LD0A 1SYRA 2LNSA 3D6IA 4POKA 5EL8A 1SL2B 1X5EA 2XHFA 2B6MA 1AUCA 1SKSB 3GSTA 18GSA 2HRFA 4L8EA 2B7KA 3A5IA 2H1DA 5IMFA 3D22A 2F9SA 4Q5RA 1OC9A 4BA7A 5LNKe 2RM6A 3QAWA 3KD0A 4ILFA 3FZ9A 1A8YA 1BG1A 4MDCA 4GXZA 1MDKA 5GSTA 1YY7A 2GSRA 3EVIA 3DMLA 3RHBA 4MZBA 3ZFBA 4POMA 4MJEA 3CWGA 5EY6A 2TRXA 2C0DA 1SVLA 3L0HA 2O8VB 2D2ZA 1BX9A 1Z9HA 1ACVA 1MDIA 1PL1A 1XXUA 3N5OA 4J57E 2XC2A 2H0GA 3ISOA 3J7Yb 1HNBA 2I9HA 2C4JA 5IO0A 2GZYA 4KAEA 3ZYWA 1NM3A 4JZQA 1GSDA 3HJMA 1VF3A 3IK9A 3M3MA 1ZYQB 4TXOA 4IHUA 3CRTA 5A34A 1UN2A 3TB2A 3F0IA 2KP1A 4WBJA 1AW9A 2FWFA 4GCIA 2JZRA 5B8AA 1K0CA 1MDJA 2R2JA 5CREA 1TK8B 3CRUA 3GTUA 2DC5A 1TOFA 2MMAA 3F3RA 4MF6A 3ZVJD 3KGKA 5E59A 3KH9A 3PR8A 2EIQA 2R6KA 5HFIA 2X4AA 3GA4A 5CRDA 3FR6A 3C1RA 4JE1A 4KGIA 4ZB6A 3FRCA 4ECJA 4EF0A 1GRXA 1S3AA 4AJ6A 2JACA 3CMIA 1TK5B 3DWVA 1Z6NA 3HVSA 2B1LA 4PX1A 3MWHA 4EL1A 1Y1UA 3GNJA 2VCQA 3F6DA 1JHBA 1O73A 2EFCA 4N11A 3ZMKA 2FD3A 4TR0A 1GULA 4L0UA 1PX7A 5BRTA 3P7XA 4O32A 4LMVA 2N5FA 2LUSA 5JWQB 1SL1B 1TU8A 1JZWA 3HKRA 1F6MC 2LSTA 5IMAA 3ZL5A 3APQA 1GNEA 3V1WA 4PNFA 3GUSA 5ECPB 3QMXA 2CQ9A 3UIWA 5ECLB 1GSQA 1TXXA 4F2IA 5D73A 3LSZA 5CAXA 5CRWA 4KH7A 2GDRA 2IMIA 1M2DA 4IQ1A 2I3YA 2GSSA 3C8EA 1NHOA 5JWRB 3HMJG 1K3YA 4WETA 1ZYNA 2P0GA 2GS3A 2O85A 3FHKA 2OJLA 4QQ7A 1EOHA 3F9UA 5CYYA 3H93A 2L57A 5CP1A 2TIRA 5IPHA 2YJ7A 3Q74A 3FK8A 3D21A 4ZL9A 2YPMA 1A2MA 1TI1A 2H71A 1KEBA 4IELA 4EE0A 1T4ZA 3BCIA 5DQYA 1I9DA 3CBUA 4EIQA 2RLIA 1JFUA 1GSFA 5J5NA 2EFEA 4L0WA 5G2ZA 5KN1A 1Z3EA 2LTKA 1U6TA 5A1NA 3LEFA 2LRTA 2YP6A 1Z5YE 5H5SA 5ECKB 2HRNA 3Q6OA 2HXKA 2PVQA 1TRWA 4RQXA 2ON7A 1SL0B 3OR5A 4MZCA 4AKGA 2H1LA 5A34B 2X64A 4G0LA 2GSTA 4YQMA 1FVKA 3DKSA 4F9ZA 1G7OA 3H4KA 2NTOA 1TI3A 1M0UA 1YZXA 5KOWA 4FYCA 2OE0A 4AI6A 2FA4A 1XVQA 3IOSA 1XWGA 1NHYA 1AXDA 1Y6EA 4XS4B 5GSSA 1BEDA 4CY6A 4XRDA 1ERWA 1URMA 3GYKA 1ML6A 1GSUA 1XOAA 5AISA 4WF5A 3FYGA 1OC8A 5HR3A 3KIJA 1SK1A 5G1KA 4IJIA 1TW9A 2FHEA 3U6VA 1X0RA 3DYRA 3FZAA 4E8HA 2DJKA 3O3TA 3CTFA 1G6WA 1IYHA 4BL7A 1NSWA 3TOTA 2O87A 2CVKA 2H30A 1TK0B 4X0XA 3F4RA 2CT6A 3ZTLA 3KZQA 1H75A 3BOAA 1EOGA 5ECSA 1GTIA 5IQYA 2J23A 2I81A 1U3IA 4Q5FA 2CVDA 5G31A 4PURA 3VPTA 2AAWA 3UVHA 3TKSC 2PU9C 3TJFA 19GSA 2AUVA 4KX4A 3H1NA 5G5EA 2PVOC 3ZLPA 2WGRA 5HR0A 4WBRD 3UJ1A 4MPFA 6GSVA 4GLTA 1T00A 4POBA 1FO5A 3MIXA 1QMVA 1PMTA 1B8XA 5DAKB 4O5QA 2TRCP 2H8LA 1B9XC 4P3YB 2YZUA 3D5JA 4ZL8A 3GIXA 2C3NA 3L4NA 1PRXA 2LQOA 1ZYPA 4JR6A 4TXVA 2GQKA 3LJRA 3QOUA 3LORA 4Z2RA 1MEKA 1AQXA 2PERA 3UVTA 4F0BA 1MTCA 3WGDA 2AJQB 4G0KA 4MF7A 2IJYA 13GSA 2CVBA 1EV9A 4KE3A 1EGRA 2BJXA 4IP1A 2Z9SA 1ERTA 2UZ8A 3ZRDA 1OKDA 3HJOA 1MD3A 2N5BA 3F8UA 4YAVA 4PQHA 2AHEA 1ZCPA 5A1NB 1HQOA 1YJ6A 3E9JB 3FY7A 2FNOA 2MBTA 4QL7A 2H1BA 5IM9A 2K6VA 2ZCTA 5ECOB 4BVXA 3IA1A 2ALBA 4FH8A 4IVFA 2J9HA 3VWXA 3VLNA 5A4WA 1G6YA 1FB0A 3QFAC 1M7TA 1HNCA 4KSMA 1TRVA 1AQWA 4K5SA 1X9MB 3A2WA 2HI7A 3TJBA 3C7MA 2L4CA 1W4VA 2H70A 5DALA 3ME8A 4O5UA 4V2LA 3MDKA 3MYDA 4KDYA 2V6OA 2H74A 4BL7B 3TKSE 4HU7A 3HA9A 1XWBA 1SJZA 2BTOT 3TRXA 1O85A 5C00A 3CSJA 1LBKA 5HFKA 4KB3A 1LJRA 2X99A 5J4UA 4IBPA 5AGYA 5A5HA 3I6AA 3UBLA 4K5RA 3QCPA 1GTUA 5J4YA 2WRTA 1Z7PA 2YCDA 4TR3A 1QFNA 4BVYB 3R2QA 4HZ2A 2XPEA 5ELAA 2B7JA 3KM6A 4HDEA 1SENA 3IAM2 1JZOA 2PN8A 2H6ZA 4TR1A 3KP9A 2L4QA 4HUAA 4KDUA 5EVOA 2VCTA 2IMFA 4KUNA 4XS1A 4EO3A 1K3OA 4EKZA 5DVBA 1OYJA 5E4WA 2L6DA 1TXUA 5F0GA 2WZ9A 5FHIA 3ZREA 2GT6A 1C72A 1GLPA 3K8NA 2I1UA 2DMMA 3VURA 4FO5A 1X9WB 4QMKA 1PA3A 3EMPA 4MMMA 3GH6A 2HSHA 2IMEA 4PQIA 2GZZA 3EURA 1CQHA 1YKCA 1YF0A 1GNWA 1AAZA 1G0TA 4PUAA 1THXA 4O7HA 2DIZA 5DDLA 4XRAA 1V2AA 2R4VA 1PQNA 3TRPA 3F4TA 2IFQB 4G10A 3RDWA 2VIMA 4H86A 1YDKA 5DJMA 4JR4A 5DQSA 3A2VA 3IHQA 5INYA 4POLA 4BPYA 4K6XA 3IBHA 1UVZA 2E2GA 3ZVJA 2HZEB 3HZ8A 1JLWA 3VWUA 3TJJA 4FYUA 4IW9A 3L9SA 2YWIA 3M0FA 2FUG2 5HR2A 3C1SA 1TRUA 1HD2A 4KW6A 4GRFA 4AKIA 3UMAA 1X9SB 2MMNA 5CRGA 2JSYA 5IOWA 4XCSA 4FQUA 3DRNA 2NVLA 5IMZA 3H8QA 4JBBA 3ZIVA 3G7IA 2HQTA 6GSWA 4K1FA 3DD3A 3NOFA 1T4YA 2R0PA 3GKXA 3CSHA 1AIUA 1A0FA 3SWLA 3LG6A 5DALB 1BAYA 5B6MA 4V1Ag 5J9CA 1T7PB 4DSSA 1GTBA 1K0DA 1SJIA 5A4UA 4NV2A 1F9MA 3GKMA 3ERWA 4KF9A 3D0ZA 4GF0A 2OE1A 5A5HB 2O89A 2OA7A 4OCFA 1OKTA 4XIHA 5GAPD 4TVEA 3BBYA 2GQLA 4MLYA 2HLSA 1X5DA 4OFTA 3GH9A 4RUVA 3M1GA 2AYTA 5J3RA 4TR1B 4NAXA 5ELGA 4ZBAA 4XHMA 1V57A 5KEJA 4X4JA 1WPIA 4YKGA 2LJRA 4OO4A 4V1Ap 2IIYA 1O8WA 4MJAA 1WIKA 3F3QA 2WCIA 2ZNMA 1B4QA 3L9VA 5KN0A 2GLRA 1WJKA 5IMCA 5HR1A 2PGTA 4CDOA 3WT1A 3P8WA 1V58A 3BJ5A 3TDGA 5IPGA 4Z2UA 2C80A 1OC9B 4JRRA 2M72A 2OKAA 11GSA 4TW5A 1GWCA 2M46A 1SJ6A 1B48A 1DBYA 3L78A 3W8JA 4O92A 4ZB7A 2REMA 2R0CA 2QA1A 2OADA 1K3LA 1N8JA 3HZ4A 4I8BA 2B5XA 2VOCA 2O7KA 2P5RA 2MMOA 3UOMA 2R37A 2VUPA 1SYXA 3ZIJA 4HOJA 3IXRA 3KMOA 4G01A 2GSQA 1X5CA 4E8EA 12GSA 4FIWA 1PD21 4GTUA 1M9AA 4D73A 1ERVA 1RW1A 4MNNA 4TXOB 1SD8A 1OC3A 1VRSD 2C3TA 2R3XA 2L5OA 2FGXA 1O6JA 2H6XA 5D9XA 4DEJA 1GSSA 3GURA 4GDFA 2IN3A 5CRHA 4CY8A 4EUYA 1M99A 2A2RA 3GKNA 2V41A 3DVWA 3ZMLA 3VK9A 4ML1A 1VGLA 3GTUB 3QFBC 1K0OA 4K2XA 1B4PA 4TOPA 1THOA 1WE0A 3ZITA 3GSSA 5DCGA 3QDNA 4EIPA 4DSSB 1KTEA 4N0ZA 2GQMA 3MNGA 5EPFA 5HQPA 3KH7A 2H0HA 1TTZA 2P31A 1YF1A 1GP1A 4BWSA 5D9TA 3FR3A 4MABA 4OO5A 1GL8A 1XBSA 2FA8A 5F06A 5BMUA 1NW2A 3G7JA 1GH2A 5ID2A 4ECCA 2JADA 6GSXA 4GQFA 1K0BA 4OFMA 3PH9A 2OACA 2VD0A 1SVMA 2WDUA 2HSMA 1E2YA 3IDVA 1B9YC 3FZ4A 4CW9A 2VO4A 2JU5A 2PWJA 1F3AA 1J08A 1VF4A 2DJ1A 5GAND 2JZSA 5ECRB 2GZPA 4X1UA 5JCUA 2FLSA 4HS1A 1R5PA 2CAIA 1DUGA 1EWXA 2EFDA 2RUEA 1GUMA 3W8SA 3LYKA 1XW9A 2WB9A 1FW1A 4F0CA 4YQUA 4HEA2 2PUKC 4ECIA 2VM2A 5AIVA 1V9WA 1EZKA 3TU3B 2DSAA 4OD7A 1GSYA 2JL4A 4I2UA 3RPNA 4E68A 1PN0A 1XW5A 4RI6A 2HSNA 2YJHA 3UARA 2KLXA 2YN1A 1SD9A 4PTSA 2MMZA 1Z7RA 5HFGA 2C1YA 4G19A 3EU4A 4J56E 3CYNA 2V6KA 3Q19A 2VCWA 4ZXGA 2VL2A 2YV7A 2F8AA 3G9BA 4ACSA 2LQQA 1PGTA 4O5RA 14GSA 5D96A 3ZZXA 3H79A 1XCCA 5GZZB 1I5GA 5IIZA 4MK3A 10GSA 4MCUA 3C73A 2R5GA 1ILOA 3HYPA 3O76A 4A5PA 1A0RP 2AB6A 4ECBA 3KEBA 3F4SA 5DBQA 3LQ7A 1BYEA 5AN1A 3EWLA 2VKZG 3QPMA 4ML6A 5D93A 3I43A 3APSA 4KSOA 6GSUA 7GSSA 3IV4A 1FOHA 16GSA 2A2SA 3QD9A 2BMXA 2VD1A 3FR9A 3F6FA 4LL1B 2MYGA 5ECHB 2DJ2A 1YEPA 4TN8A 5A5KA 4TR4A 5CO3A 3ERFA 2DLXA 2VCXA 5CNWA 3EYTA 5H5QA 5JCGA 2DBCA 3TRQA 1V98A 2FWEA 5FWGA 4GQCA 2KOKA 4ULXA 5BMUB 4WR5A 1GLQA 3GKKA 2FCHA 1XWCA 5L71A 6GSTA 2H75A 1ZGNA 5LCZA 1XVWA 1A24A 5D9WA 5KOXA 4GSNA 2H0IA 1QK8A 2YWOA 4KDXA 4AGSA 4AJ8A 1A8LA 1EP8A 1SK0A 1YKAA 3LYPA 4IJ3A 1TU7A 2WULA 2CAQA 3VPQA 1QQ2A 4PQ1A 6GSYA 4HQZA 4EDYA 4HI7A 5ECNB 4EDZA 1TDIA 2OBKA 1ERUA 1K0AA 2L6CA 3IE3A 1GUHA 3TKRA 3US3A 4NWYA 4K0GA 4I5QA 1USBA 3DIEA 1AQVA 3WT2A 2LS5A 1ZMAA 1KBNA 2G0FA 2OT3A 2EIRA 3IAS2 3I69A 1K0MA 20GSA 3UBKA 1YVLA 3MAKA 4L5LA 2HSNB 1O7UA 3KMNA 1YEXA 4NPBA 1H4OA 1WMJA 2FWHA 2CA8A 1PSQA 3VWVA 5J47A 1A2JA 4ZBDA 1WRYA 4PGTA 3DXBA 5D9VA 3KCMA 3CTGA 3GV1A 2KP2A 4AJ7A 1HYUA 5B6NA 5AIXA 5H5RA 1DE1A 4KCEA 4HJ2A 4F82A 3BD2A 1U3AA 4RI7A 3WGEA 1A2LA 3HD5A 2X8GA 3J7Yk 3E3EA 3M9KA 2IMDA 4K0NA 1R5AA 1M2BA 2OE3A 3EINA 4JU5A 2X8HA 2IWTA 4GSSA 4XS6A 4BVXB 5COHA 3C71A 4F03A 1FOVA 3GFKA 3GL3A 1FHEA 4XTSA 1QGVA 3IPZA 1G7EA 2QSIA 2CX3A 1ZYEA 2JSZA 3WGXA 1XW6A 2K8VA 1F3BA 1TP9A 1XPVA 2H6YA 4WXTA 3LWAA 1S3DA 3VFIA 2F3MA 2FY6A 1ZOFA 1GUKA 4X43A 1XWKA 2C0EA 2DIYA 2GTUA 1BG5A 4V2MA 4DSRA 1O8XA 4MH3A 1GSEA 3N9JA 4YKFA 4ICYA 3QR6A 1KNGA 1F2EA 2RM5A 3NIVA 3ED3A 1EGOA 2V2GA 4XS4A 2VLVA 2HSYA 1ZZYA 2L5LA 2LRCA 3UAPA 1U88A 2C3QA 4PXOA 5J9BA 4IP6A 2RIIA 3D4MA 5G1LA 3D4TA 3KP8A 1ST9A 2MZCA 4NV5A 4QL9A 2LRNA 2EC4A 1DSBA 3RAZA 1LU4A 1R7HA 3R3EA 1EEMA 4ZIJA 3HHVA 1E6BA 4J2FA 3UEMA 4IKHA 1MD4A 4IS0A 4Z2TA 3GL5A 1FB6A 2IPAA 3GHAA 4MPGA 1XWAA 4HU9A 3M8NA 3HJPA 4K2DA 2H72A 1R4WA 2ZUPA 3ME7A 3FW2A 4KNDA 1Y25A 1U87A 2VL9A 1EEJA 3QAGA 3IRAA 2G2QA 1XIYA 2VAFA 2ON5A 2VLUA 4HJMA 3HY2A 5C04A 3PPUA 2WJUA 5ENUA 2WS2A 4JEDA 2HE3A 2V1MA 4I97A 8GSSA 2YWNA 5J40A 2DKHA 1J9BA 4OCEA 4K8MA 3EMXA 4HZ4A 9GSSA 5B8BA 5ECQB 3EPTA 3PINA 5IMDA 2DJ0A 3TKPA 2YV9A 2VL2C 5F8BA 4AKHA 3TKQA 5DAKA 1UC7A 1IYIA 4USSA 2QKEA 3IK7A 3Q18A 5FT3A 3LXTA 3WYWA 3I9V2 4IGJA 4WKWA 4I2TA 3KJYA 1PN9A 3TCOA 3RHCA 2PPTA 3O6TA 2H1GA 1HNAA 2XBQA 4AKXB 5F07A 1N2AA 3LFLA 2A4HA 2YOIA 4MF5A 1OE7A 1T8EB 3WD6A 3A2XA 4NMUA 4OFNA 2B5YA 2LNTA 2NBSA 1SU9A 3IR4A 1BQ7A 1OAZA 1QXHA 4ZB8A 3S9FA 1EV4A 2MBSA 1JZRA 3TGZA 3ZFLA 1WOUA 4OWYA 4CHSA 3M9JA 1JLVA 4Q5QA 3DEXA 1ON4A 4K7IA 3IC4A 1M2AA 1TJDA 3GRXA 4MJCA 2CV4A 5F05A 3JCML 2K9FA 2X49A 2H1AA 2PMTA 4EXJA 5A4VA 2H73A 1DE2A 4L5OA 4FYBA 5G30A 3FMWA 1FVJA 3P2AA 4K9ZA 2DKIA 2KHPA 2OBIA 1TKDB 4K7NA 4ZL7A 3DVXA 5JWOB 1K0NA 2B5EA 1UA5A 1T1VA 3VWWA 2IMKA 3RPPA 2C0GA 1RK4A 2N5AA 1XOBA 3KTLA 4MP4A 2PBJA 1BJXA 5IO2A 2HRKA 2HNLA 1OVNA 2FWGA 1Q4JA 2VL3A 5D8IA 2IL3A 2VM1A 2UV8G 2B1KA 1XZOA 2F51A 1EP7A 4KA0A 3SBCA 4G2EA 2XBIA 3GMFA 4W66A 1S3CA 1PKWA 3NZNA 4KCAA 3HVXA 1VF1A 5ECIB 2H76A 3A5WA 2A4VA 3FKFA 3LXZA 1Z6MA 3IC8A 5B7CA 22GSA 3BCKA 4GSTA 4BVYA 3QAVA 1RQMA 2E7PA 2QGVA 4YQVA 5J41A 3DGQA 2H01A 3U5RE 4NXIA 1SKWB 4V2NA 1YQ1A 4WEYA 2B3SA 2AV4A 5G5FA 2LV3A 1F37A 4BWQA 2F8FA 2EFHA 4NHZA 3E0UA 2NDOA 4DSQA 2CZ3A 2RUFA 3IHGA 4WF4A 3GN3A 4G0IA 3VI5A 3RBTA 4LL4B 1AC1A 2HRAA 2LJAA 3HVVA 4MZWA 3EE2A 2M80A 1WP0A 2GVPA 4EVMA 4MH2A 3UL3A 1GTAA 1SKRB 1FG4A 6GSSA 2A2PA 3MSZA 2YZHA 4I6XA 1T3BA 4MJBA 1ABAA 4IN0A 5ECMB 5JCWA 2I4AA 1PX6A 3L9UA 1SK2A 4PNGA 1TRSA 3P90A 2DMLA 2HYXA 2YANA 4D73B 1PKZA 5DCHA 3A3TA 4PUFC 3LGCA 4K7OA 1VF2A 2IFQA 2VCVA 1W89A 4LA1A 4GWRA 4DVCA 3AY8A 4LMWA 1R26A 2KUCA 2GGTA 3GX0A 2LKUA 2H66A 3F63A 3TJGA 1Q98A 2YNXA 2E0QA 3FZ5A 1WWJA 4AF2A 2X8CA 2HZEA 3TUEA 1CQGA 2DJ3A 3KTBA 17GSA 2ES7A 3G7YA 2CZ2A 3ERGA 2LEGA 4ZILA 1ZL9A 2V32A 4N30A 4EC0A 1O81A 2VLTA 2EIOA 2CX4A 3W6GA 2O5VA 4ZBBA 3HXSA 4N3ZA 3APOA 1M9BA 3TJKA 1A23A 2HZFA 1PL2A 5IMVA 3CXGA 1SVOA 1QUWA 2VCZA 4ZB9A 4TRXA 1XFLA 3EC3A 5ID2B 3HCZA 5DJLA 4OMVA 5KN3A 4G9HA 4MA9A 2K18A 2GT5A 2HSMB 2QA2A 2L59A 2HRKB 4Z7XA 3HDCA 3VI7A 2P5QA 3PGTA 1BF5A 5ABRA 1J0FA 2XPDA 4Q5NA 1OE8A 2NPBA 2QC7A 3KXOA 4HQSA 5KN2A 1V40A 4WR4A 5IOXA 3LW9A 2YWMA 2DJJA 4YH2A 2R0GA 5J4VA 2C8UA 2H19A 2E2MA 4LLRA 2C0FA 1JZDA 2JZTA 4IQAA 2K8SA 4ISDA 3GX8A 3TKSA 2HFDA 2LJKA 2WFCA 4ID0A 4N10A 4RQRA 4TKYA 3CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N0V A;  3EU3 A;  4NHW A;  4YAP A;  3TOU A;  3FEU A;  1FAA A;  2HT9 A;  5LD0 A;  1SYR A;  2LNS A;  3D6I A;  4POK A;  5EL8 A;  1SL2 B;  1X5E A;  2XHF A;  2B6M A;  1AUC A;  1SKS B;  3GST A;  18GS A;  2HRF A;  4L8E A;  2B7K A;  2H1D A;  5IMF A;  3D22 A;  2F9S A;  4Q5R A;  1OC9 A;  4BA7 A;  5LNK e;  2RM6 A;  3QAW A;  3KD0 A;  4ILF A;  3FZ9 A;  1A8Y A;  4MDC A;  4GXZ A;  1MDK A;  5GST A;  1YY7 A;  2GSR A;  3EVI A;  3DML A;  3RHB A;  4MZB A;  3ZFB A;  4POM A;  4MJE A;  5EY6 A;  2TRX A;  2C0D A;  3L0H A;  2O8V B;  2D2Z A;  1BX9 A;  1Z9H A;  1ACV A;  1MDI A;  1PL1 A;  1XXU A;  3N5O A;  4J57 E;  2XC2 A;  2H0G A;  3ISO A;  3J7Y b;  1HNB A;  2I9H A;  2C4J A;  5IO0 A;  2GZY A;  4KAE A;  3ZYW A;  1NM3 A;  4JZQ A;  1GSD A;  3HJM A;  1VF3 A;  3IK9 A;  3M3M A;  1ZYQ B;  4TXO A;  4IHU A;  3CRT A;  1UN2 A;  3TB2 A;  3F0I A;  2KP1 A;  4WBJ A;  1AW9 A;  2FWF A;  4GCI A;  2JZR A;  5B8A A;  1K0C A;  1MDJ A;  2R2J A;  5CRE A;  1TK8 B;  3CRU A;  3GTU A;  2DC5 A;  1TOF A;  2MMA A;  3F3R A;  4MF6 A;  3ZVJ D;  3KGK A;  5E59 A;  3KH9 A;  3PR8 A;  2EIQ A;  2R6K A;  5HFI A;  3GA4 A;  5CRD A;  3FR6 A;  3C1R A;  4JE1 A;  4KGI A;  4ZB6 A;  3FRC A;  4ECJ A;  4EF0 A;  1GRX A;  1S3A A;  4AJ6 A;  2JAC A;  3CMI A;  1TK5 B;  3DWV A;  1Z6N A;  3HVS A;  2B1L A;  4PX1 A;  3MWH A;  4EL1 A;  3GNJ A;  2VCQ A;  3F6D A;  1JHB A;  1O73 A;  4N11 A;  3ZMK A;  2FD3 A;  4TR0 A;  1GUL A;  4L0U A;  1PX7 A;  3P7X A;  4O32 A;  4LMV A;  2N5F A;  2LUS A;  5JWQ B;  1SL1 B;  1TU8 A;  1JZW A;  3HKR A;  1F6M C;  2LST A;  5IMA A;  3ZL5 A;  3APQ A;  1GNE A;  3V1W A;  4PNF A;  3GUS A;  5ECP B;  3QMX A;  2CQ9 A;  3UIW A;  5ECL B;  1GSQ A;  1TXX A;  4F2I A;  5D73 A;  3LSZ A;  5CAX A;  5CRW A;  4KH7 A;  2GDR A;  2IMI A;  1M2D A;  4IQ1 A;  2I3Y A;  2GSS A;  3C8E A;  1NHO A;  5JWR B;  1K3Y A;  4WET A;  2P0G A;  2GS3 A;  2O85 A;  3FHK A;  2OJL A;  4QQ7 A;  1EOH A;  3F9U A;  5CYY A;  3H93 A;  2L57 A;  5CP1 A;  2TIR A;  5IPH A;  2YJ7 A;  3Q74 A;  3FK8 A;  3D21 A;  4ZL9 A;  2YPM A;  1A2M A;  1TI1 A;  2H71 A;  1KEB A;  4IEL A;  4EE0 A;  1T4Z A;  3BCI A;  5DQY A;  1I9D A;  3CBU A;  2RLI A;  1JFU A;  1GSF A;  5J5N A;  4L0W A;  5G2Z A;  5KN1 A;  1Z3E A;  2LTK A;  1U6T A;  3LEF A;  2LRT A;  2YP6 A;  1Z5Y E;  5H5S A;  5ECK B;  2HRN A;  3Q6O A;  2HXK A;  2PVQ A;  1TRW A;  4RQX A;  2ON7 A;  1SL0 B;  3OR5 A;  4MZC A;  2X64 A;  4G0L A;  2GST A;  4YQM A;  1FVK A;  3DKS A;  4F9Z A;  1G7O A;  3H4K A;  2NTO A;  1TI3 A;  1M0U A;  1YZX A;  4FYC A;  2OE0 A;  2FA4 A;  1XVQ A;  3IOS A;  1XWG A;  1NHY A;  1AXD A;  1Y6E A;  4XS4 B;  5GSS A;  1BED A;  4XRD A;  1ERW A;  1URM A;  3GYK A;  1ML6 A;  1GSU A;  1XOA A;  5AIS A;  4WF5 A;  3FYG A;  1OC8 A;  5HR3 A;  3KIJ A;  1SK1 A;  5G1K A;  4IJI A;  1TW9 A;  2FHE A;  3U6V A;  1X0R A;  3DYR A;  3FZA A;  4E8H A;  2DJK A;  3O3T A;  3CTF A;  1G6W A;  1IYH A;  4BL7 A;  1NSW A;  3TOT A;  2O87 A;  2CVK A;  2H30 A;  1TK0 B;  4X0X A;  3F4R A;  2CT6 A;  3ZTL A;  3KZQ A;  1H75 A;  3BOA A;  1EOG A;  5ECS A;  1GTI A;  5IQY A;  2J23 A;  2I81 A;  1U3I A;  4Q5F A;  2CVD A;  5G31 A;  4PUR A;  3VPT A;  2AAW A;  3UVH A;  3TKS C;  2PU9 C;  3TJF A;  19GS A;  2AUV A;  4KX4 A;  3H1N A;  5G5E A;  2PVO C;  3ZLP A;  2WGR A;  5HR0 A;  4WBR D;  3UJ1 A;  4MPF A;  6GSV A;  4GLT A;  1T00 A;  4POB A;  1FO5 A;  1QMV A;  1PMT A;  1B8X A;  5DAK B;  2TRC P;  2H8L A;  1B9X C;  4P3Y B;  2YZU A;  3D5J A;  4ZL8 A;  3GIX A;  2C3N A;  3L4N A;  1PRX A;  2LQO A;  4JR6 A;  4TXV A;  2GQK A;  3LJR A;  3QOU A;  3LOR A;  1MEK A;  1AQX A;  2PER A;  3UVT A;  4F0B A;  1MTC A;  3WGD A;  2AJQ B;  4G0K A;  4MF7 A;  2IJY A;  13GS A;  2CVB A;  1EV9 A;  4KE3 A;  1EGR A;  2BJX A;  4IP1 A;  2Z9S A;  1ERT A;  2UZ8 A;  3ZRD A;  1OKD A;  3HJO A;  1MD3 A;  2N5B A;  3F8U A;  4YAV A;  4PQH A;  2AHE A;  1ZCP A;  1HQO A;  1YJ6 A;  3E9J B;  3FY7 A;  2FNO A;  2MBT A;  4QL7 A;  2H1B A;  5IM9 A;  2K6V A;  2ZCT A;  5ECO B;  4BVX A;  3IA1 A;  2ALB A;  4FH8 A;  4IVF A;  2J9H A;  3VWX A;  3VLN A;  5A4W A;  1G6Y A;  1FB0 A;  3QFA C;  1M7T A;  1HNC A;  4KSM A;  1TRV A;  1AQW A;  1X9M B;  3A2W A;  2HI7 A;  3TJB A;  3C7M A;  2L4C A;  1W4V A;  2H70 A;  5DAL A;  3ME8 A;  4V2L A;  3MDK A;  4KDY A;  2V6O A;  2H74 A;  4BL7 B;  3TKS E;  4HU7 A;  3HA9 A;  1XWB A;  1SJZ A;  2BTO T;  3TRX A;  1O85 A;  5C00 A;  3CSJ A;  1LBK A;  5HFK A;  4KB3 A;  1LJR A;  2X99 A;  5J4U A;  4IBP A;  5AGY A;  3I6A A;  3UBL A;  3QCP A;  1GTU A;  2WRT A;  1Z7P A;  2YCD A;  4TR3 A;  1QFN A;  4BVY B;  3R2Q A;  4HZ2 A;  2XPE A;  5ELA A;  2B7J A;  3KM6 A;  4HDE A;  1SEN A;  3IAM 2;  1JZO A;  2PN8 A;  2H6Z A;  4TR1 A;  3KP9 A;  2L4Q A;  4HUA A;  4KDU A;  5EVO A;  2VCT A;  2IMF A;  4KUN A;  4XS1 A;  4EO3 A;  1K3O A;  4EKZ A;  5DVB A;  1OYJ A;  5E4W A;  2L6D A;  5F0G A;  2WZ9 A;  5FHI A;  3ZRE A;  2GT6 A;  1C72 A;  1GLP A;  3K8N A;  2I1U A;  2DMM A;  3VUR A;  4FO5 A;  1X9W B;  1PA3 A;  3EMP A;  4MMM A;  3GH6 A;  2HSH A;  2IME A;  4PQI A;  2GZZ A;  3EUR A;  1CQH A;  1YKC A;  1YF0 A;  1GNW A;  1AAZ A;  1G0T A;  4PUA A;  1THX A;  4O7H A;  2DIZ A;  5DDL A;  4XRA A;  1V2A A;  2R4V A;  1PQN A;  3TRP A;  3F4T A;  2IFQ B;  4G10 A;  3RDW A;  2VIM A;  4H86 A;  1YDK A;  5DJM A;  4JR4 A;  5DQS A;  3A2V A;  3IHQ A;  5INY A;  4POL A;  4BPY A;  4K6X A;  3IBH A;  1UVZ A;  2E2G A;  3ZVJ A;  2HZE B;  3HZ8 A;  1JLW A;  3VWU A;  3TJJ A;  4FYU A;  4IW9 A;  3L9S A;  2YWI A;  3M0F A;  2FUG 2;  5HR2 A;  3C1S A;  1TRU A;  1HD2 A;  4KW6 A;  4GRF A;  3UMA A;  1X9S B;  2MMN A;  5CRG A;  2JSY A;  5IOW A;  4XCS A;  4FQU A;  3DRN A;  2NVL A;  5IMZ A;  3H8Q A;  4JBB A;  3ZIV A;  3G7I A;  2HQT A;  6GSW A;  4K1F A;  3DD3 A;  3NOF A;  1T4Y A;  3GKX A;  3CSH A;  1AIU A;  1A0F A;  3SWL A;  3LG6 A;  5DAL B;  1BAY A;  5B6M A;  4V1A g;  5J9C A;  1T7P B;  4DSS A;  1GTB A;  1K0D A;  1SJI A;  5A4U A;  4NV2 A;  1F9M A;  3GKM A;  3ERW A;  4KF9 A;  3D0Z A;  4GF0 A;  2OE1 A;  2O89 A;  2OA7 A;  4OCF A;  1OKT A;  4XIH A;  5GAP D;  4TVE A;  3BBY A;  2GQL A;  4MLY A;  2HLS A;  1X5D A;  4OFT A;  3GH9 A;  4RUV A;  3M1G A;  2AYT A;  5J3R A;  4TR1 B;  4NAX A;  5ELG A;  4ZBA A;  4XHM A;  1V57 A;  5KEJ A;  1WPI A;  2LJR A;  4OO4 A;  4V1A p;  2IIY A;  1O8W A;  4MJA A;  1WIK A;  3F3Q A;  2WCI A;  2ZNM A;  1B4Q A;  3L9V A;  5KN0 A;  2GLR A;  1WJK A;  5IMC A;  5HR1 A;  2PGT A;  4CDO A;  3WT1 A;  3P8W A;  1V58 A;  3BJ5 A;  3TDG A;  5IPG A;  2C80 A;  1OC9 B;  4JRR A;  2M72 A;  2OKA A;  11GS A;  4TW5 A;  1GWC A;  2M46 A;  1SJ6 A;  1B48 A;  1DBY A;  3L78 A;  3W8J A;  4O92 A;  2REM A;  2OAD A;  1K3L A;  1N8J A;  3HZ4 A;  4I8B A;  2B5X A;  2VOC A;  2O7K A;  2P5R A;  2MMO A;  3UOM A;  2R37 A;  2VUP A;  1SYX A;  3ZIJ A;  4HOJ A;  3IXR A;  3KMO A;  2GSQ A;  1X5C A;  4E8E A;  12GS A;  4FIW A;  1PD2 1;  4GTU A;  1M9A A;  4D73 A;  1ERV A;  1RW1 A;  4TXO B;  1SD8 A;  1OC3 A;  1VRS D;  2C3T A;  2R3X A;  2L5O A;  2FGX A;  1O6J A;  2H6X A;  5D9X A;  4DEJ A;  1GSS A;  3GUR A;  2IN3 A;  5CRH A;  4EUY A;  1M99 A;  2A2R A;  3GKN A;  2V41 A;  3DVW A;  3ZML A;  3VK9 A;  4ML1 A;  1VGL A;  3GTU B;  3QFB C;  1K0O A;  1B4P A;  4TOP A;  1THO A;  1WE0 A;  3ZIT A;  3GSS A;  5DCG A;  3QDN A;  4DSS B;  1KTE A;  4N0Z A;  2GQM A;  3MNG A;  5EPF A;  5HQP A;  3KH7 A;  2H0H A;  1TTZ A;  2P31 A;  1YF1 A;  1GP1 A;  4BWS A;  5D9T A;  3FR3 A;  4MAB A;  4OO5 A;  1GL8 A;  1XBS A;  2FA8 A;  5F06 A;  5BMU A;  1NW2 A;  3G7J A;  1GH2 A;  5ID2 A;  4ECC A;  2JAD A;  6GSX A;  4GQF A;  1K0B A;  4OFM A;  3PH9 A;  2OAC A;  2VD0 A;  2WDU A;  2HSM A;  1E2Y A;  3IDV A;  1B9Y C;  3FZ4 A;  4CW9 A;  2VO4 A;  2JU5 A;  2PWJ A;  1F3A A;  1J08 A;  1VF4 A;  2DJ1 A;  5GAN D;  2JZS A;  5ECR B;  2GZP A;  4X1U A;  5JCU A;  2FLS A;  4HS1 A;  1R5P A;  2CAI A;  1DUG A;  1EWX A;  2RUE A;  1GUM A;  3W8S A;  3LYK A;  1XW9 A;  2WB9 A;  1FW1 A;  4F0C A;  4YQU A;  4HEA 2;  2PUK C;  4ECI A;  2VM2 A;  5AIV A;  1V9W A;  1EZK A;  2DSA A;  4OD7 A;  1GSY A;  2JL4 A;  4I2U A;  3RPN A;  1XW5 A;  4RI6 A;  2YJH A;  3UAR A;  2KLX A;  2YN1 A;  1SD9 A;  4PTS A;  2MMZ A;  1Z7R A;  5HFG A;  2C1Y A;  4G19 A;  3EU4 A;  4J56 E;  3CYN A;  2V6K A;  3Q19 A;  2VCW A;  4ZXG A;  2VL2 A;  2YV7 A;  2F8A A;  3G9B A;  4ACS A;  2LQQ A;  1PGT A;  4O5R A;  14GS A;  5D96 A;  3ZZX A;  3H79 A;  1XCC A;  5GZZ B;  1I5G A;  5IIZ A;  4MK3 A;  10GS A;  4MCU A;  3C73 A;  2R5G A;  1ILO A;  3HYP A;  3O76 A;  1A0R P;  2AB6 A;  4ECB A;  3KEB A;  3F4S A;  5DBQ A;  3LQ7 A;  1BYE A;  5AN1 A;  3EWL A;  3QPM A;  4ML6 A;  5D93 A;  3I43 A;  3APS A;  4KSO A;  6GSU A;  7GSS A;  3IV4 A;  16GS A;  2A2S A;  3QD9 A;  2BMX A;  2VD1 A;  3FR9 A;  3F6F A;  4LL1 B;  2MYG A;  5ECH B;  2DJ2 A;  1YEP A;  4TN8 A;  5A5K A;  4TR4 A;  5CO3 A;  3ERF A;  2DLX A;  2VCX A;  5CNW A;  3EYT A;  5H5Q A;  5JCG A;  2DBC A;  3TRQ A;  1V98 A;  2FWE A;  5FWG A;  4GQC A;  2KOK A;  4ULX A;  4WR5 A;  1GLQ A;  3GKK A;  2FCH A;  1XWC A;  5L71 A;  6GST A;  2H75 A;  1ZGN A;  5LCZ A;  1XVW A;  1A24 A;  5D9W A;  4GSN A;  2H0I A;  1QK8 A;  2YWO A;  4KDX A;  4AGS A;  4AJ8 A;  1A8L A;  1EP8 A;  1SK0 A;  1YKA A;  3LYP A;  4IJ3 A;  1TU7 A;  2WUL A;  2CAQ A;  3VPQ A;  1QQ2 A;  4PQ1 A;  6GSY A;  4HQZ A;  4EDY A;  4HI7 A;  5ECN B;  4EDZ A;  1TDI A;  2OBK A;  1ERU A;  1K0A A;  2L6C A;  3IE3 A;  1GUH A;  3TKR A;  3US3 A;  4NWY A;  4K0G A;  4I5Q A;  1USB A;  3DIE A;  1AQV A;  3WT2 A;  2LS5 A;  1ZMA A;  1KBN A;  2G0F A;  3IAS 2;  2EIR A;  3I69 A;  1K0M A;  20GS A;  3UBK A;  3MAK A;  4L5L A;  2HSN B;  1O7U A;  3KMN A;  1YEX A;  4NPB A;  1H4O A;  1WMJ A;  2FWH A;  2CA8 A;  1PSQ A;  3VWV A;  1A2J A;  4ZBD A;  1WRY A;  4PGT A;  3DXB A;  5D9V A;  3KCM A;  3CTG A;  3GV1 A;  2KP2 A;  4AJ7 A;  1HYU A;  5B6N A;  5AIX A;  5H5R A;  1DE1 A;  4KCE A;  4HJ2 A;  4F82 A;  3BD2 A;  1U3A A;  4RI7 A;  3WGE A;  1A2L A;  3HD5 A;  2X8G A;  3J7Y k;  3E3E A;  3M9K A;  2IMD A;  4K0N A;  1R5A A;  1M2B A;  2OE3 A;  3EIN A;  4JU5 A;  2X8H A;  2IWT A;  4GSS A;  4XS6 A;  4BVX B;  5COH A;  3C71 A;  4F03 A;  1FOV A;  3GFK A;  3GL3 A;  1FHE A;  4XTS A;  1QGV A;  3IPZ A;  1G7E A;  2QSI A;  2CX3 A;  1ZYE A;  2JSZ A;  3WGX A;  1XW6 A;  2K8V A;  1F3B A;  1TP9 A;  1XPV A;  2H6Y A;  4WXT A;  3LWA A;  1S3D A;  3VFI A;  2F3M A;  2FY6 A;  1ZOF A;  1GUK A;  4X43 A;  1XWK A;  2C0E A;  2DIY A;  2GTU A;  1BG5 A;  4V2M A;  4DSR A;  1O8X A;  4MH3 A;  1GSE A;  3N9J A;  3QR6 A;  1KNG A;  1F2E A;  2RM5 A;  3NIV A;  3ED3 A;  1EGO A;  2V2G A;  4XS4 A;  2VLV A;  2HSY A;  1ZZY A;  2L5L A;  2LRC A;  3UAP A;  1U88 A;  2C3Q A;  4PXO A;  5J9B A;  4IP6 A;  2RII A;  3D4M A;  5G1L A;  3D4T A;  3KP8 A;  1ST9 A;  2MZC A;  4NV5 A;  4QL9 A;  2LRN A;  2EC4 A;  1DSB A;  3RAZ A;  1LU4 A;  1R7H A;  3R3E A;  1EEM A;  4ZIJ A;  3HHV A;  1E6B A;  4J2F A;  3UEM A;  4IKH A;  1MD4 A;  4IS0 A;  3GL5 A;  1FB6 A;  2IPA A;  3GHA A;  4MPG A;  1XWA A;  4HU9 A;  3M8N A;  3HJP A;  4K2D A;  2H72 A;  1R4W A;  2ZUP A;  3ME7 A;  3FW2 A;  4KND A;  1Y25 A;  1U87 A;  2VL9 A;  1EEJ A;  3QAG A;  3IRA A;  2G2Q A;  1XIY A;  2VAF A;  2ON5 A;  2VLU A;  4HJM A;  3HY2 A;  5C04 A;  3PPU A;  2WJU A;  5ENU A;  2WS2 A;  4JED A;  2HE3 A;  2V1M A;  4I97 A;  8GSS A;  2YWN A;  1J9B A;  4OCE A;  4K8M A;  3EMX A;  4HZ4 A;  9GSS A;  5B8B A;  5ECQ B;  3PIN A;  5IMD A;  2DJ0 A;  3TKP A;  2YV9 A;  2VL2 C;  5F8B A;  3TKQ A;  5DAK A;  1UC7 A;  1IYI A;  4USS A;  2QKE A;  3Q18 A;  3IK7 A;  5FT3 A;  3LXT A;  3WYW A;  3I9V 2;  4IGJ A;  4WKW A;  4I2T A;  3KJY A;  1PN9 A;  3TCO A;  3RHC A;  2PPT A;  3O6T A;  2H1G A;  1HNA A;  2XBQ A;  5F07 A;  1N2A A;  3LFL A;  2YOI A;  4MF5 A;  1OE7 A;  1T8E B;  3WD6 A;  3A2X A;  4NMU A;  4OFN A;  2B5Y A;  2LNT A;  2NBS A;  1SU9 A;  3IR4 A;  1BQ7 A;  1OAZ A;  1QXH A;  4ZB8 A;  3S9F A;  1EV4 A;  2MBS A;  1JZR A;  3TGZ A;  3ZFL A;  1WOU A;  4OWY A;  4CHS A;  3M9J A;  1JLV A;  4Q5Q A;  3DEX A;  1ON4 A;  4K7I A;  3IC4 A;  1M2A A;  1TJD A;  3GRX A;  4MJC A;  2CV4 A;  5F05 A;  3JCM L;  2K9F A;  2H1A A;  2PMT A;  4EXJ A;  5A4V A;  2H73 A;  1DE2 A;  4L5O A;  4FYB A;  5G30 A;  1FVJ A;  3P2A A;  4K9Z A;  2KHP A;  2OBI A;  1TKD B;  4K7N A;  4ZL7 A;  3DVX A;  5JWO B;  1K0N A;  2B5E A;  1UA5 A;  1T1V A;  3VWW A;  2IMK A;  3RPP A;  2C0G A;  1RK4 A;  2N5A A;  1XOB A;  3KTL A;  4MP4 A;  2PBJ A;  1BJX A;  5IO2 A;  2HRK A;  2HNL A;  1OVN A;  2FWG A;  1Q4J A;  2VL3 A;  5D8I A;  2IL3 A;  2VM1 A;  2B1K A;  1XZO A;  2F51 A;  1EP7 A;  4KA0 A;  3SBC A;  4G2E A;  2XBI A;  3GMF A;  1S3C A;  1PKW A;  3NZN A;  4KCA A;  3HVX A;  1VF1 A;  5ECI B;  2H76 A;  3A5W A;  2A4V A;  3FKF A;  3LXZ A;  1Z6M A;  3IC8 A;  5B7C A;  22GS A;  3BCK A;  4GST A;  4BVY A;  3QAV A;  1RQM A;  2E7P A;  2QGV A;  4YQV A;  5J41 A;  3DGQ A;  2H01 A;  3U5R E;  4NXI A;  1SKW B;  4V2N A;  1YQ1 A;  4WEY A;  2B3S A;  2AV4 A;  5G5F A;  2LV3 A;  1F37 A;  4BWQ A;  2F8F A;  4NHZ A;  3E0U A;  2NDO A;  4DSQ A;  2CZ3 A;  2RUF A;  4WF4 A;  3GN3 A;  4G0I A;  3VI5 A;  3RBT A;  4LL4 B;  1AC1 A;  2HRA A;  2LJA A;  3HVV A;  4MZW A;  3EE2 A;  2M80 A;  1WP0 A;  2GVP A;  4EVM A;  4MH2 A;  3UL3 A;  1GTA A;  1SKR B;  1FG4 A;  6GSS A;  3MSZ A;  2YZH A;  4I6X A;  1T3B A;  4MJB A;  1ABA A;  4IN0 A;  5ECM B;  5JCW A;  2I4A A;  1PX6 A;  3L9U A;  1SK2 A;  4PNG A;  1TRS A;  3P90 A;  2DML A;  2HYX A;  2YAN A;  4D73 B;  1PKZ A;  5DCH A;  3A3T A;  4PUF C;  3LGC A;  4K7O A;  1VF2 A;  2IFQ A;  2VCV A;  1W89 A;  4LA1 A;  4GWR A;  4DVC A;  3AY8 A;  4LMW A;  1R26 A;  2KUC A;  2GGT A;  3GX0 A;  2LKU A;  2H66 A;  3F63 A;  3TJG A;  1Q98 A;  2YNX A;  2E0Q A;  3FZ5 A;  1WWJ A;  4AF2 A;  2X8C A;  2HZE A;  3TUE A;  1CQG A;  2DJ3 A;  3KTB A;  17GS A;  2ES7 A;  3G7Y A;  2CZ2 A;  3ERG A;  2LEG A;  4ZIL A;  1ZL9 A;  2V32 A;  4N30 A;  4EC0 A;  1O81 A;  2VLT A;  2EIO A;  2CX4 A;  3W6G A;  4ZBB A;  3HXS A;  3APO A;  1M9B A;  3TJK A;  1A23 A;  2HZF A;  1PL2 A;  5IMV A;  3CXG A;  1QUW A;  2VCZ A;  4ZB9 A;  4TRX A;  1XFL A;  3EC3 A;  5ID2 B;  3HCZ A;  5DJL A;  4OMV A;  5KN3 A;  4G9H A;  4MA9 A;  2K18 A;  2GT5 A;  2HSM B;  2L59 A;  2HRK B;  4Z7X A;  3HDC A;  3VI7 A;  2P5Q A;  3PGT A;  5ABR A;  1J0F A;  2XPD A;  4Q5N A;  1OE8 A;  2NPB A;  2QC7 A;  3KXO A;  4HQS A;  5KN2 A;  1V40 A;  4WR4 A;  5IOX A;  2YWM A;  2DJJ A;  4YH2 A;  2C8U A;  2H19 A;  2E2M A;  4LLR A;  2C0F A;  1JZD A;  2JZT A;  4IQA A;  2K8S A;  4ISD A;  3GX8 A;  3TKS A;  2HFD A;  2LJK A;  2WFC A;  4ID0 A;  4N10 A;  4RQR A;  4TKY A;  3CSI A; 
#chains in the Genus database with same CATH topology
 4N0V A;  3EU3 A;  4NHW A;  4YAP A;  3TOU A;  3FEU A;  1FAA A;  2HT9 A;  1N25 A;  5LD0 A;  1SYR A;  2LNS A;  3D6I A;  4POK A;  5EL8 A;  1SL2 B;  1X5E A;  2XHF A;  2B6M A;  1AUC A;  1SKS B;  3GST A;  18GS A;  2HRF A;  4L8E A;  2B7K A;  3A5I A;  2H1D A;  5IMF A;  3D22 A;  2F9S A;  4Q5R A;  1OC9 A;  4BA7 A;  5LNK e;  2RM6 A;  3QAW A;  3KD0 A;  4ILF A;  3FZ9 A;  1A8Y A;  1BG1 A;  4MDC A;  4GXZ A;  1MDK A;  5GST A;  1YY7 A;  2GSR A;  3EVI A;  3DML A;  3RHB A;  4MZB A;  3ZFB A;  4POM A;  4MJE A;  3CWG A;  5EY6 A;  2TRX A;  2C0D A;  1SVL A;  3L0H A;  2O8V B;  2D2Z A;  1BX9 A;  1Z9H A;  1ACV A;  1MDI A;  1PL1 A;  1XXU A;  3N5O A;  4J57 E;  2XC2 A;  2H0G A;  3ISO A;  3J7Y b;  2WVZ A;  1HNB A;  2I9H A;  2C4J A;  5IO0 A;  2GZY A;  3HVN A;  4KAE A;  3ZYW A;  1NM3 A;  4JZQ A;  1GSD A;  3HJM A;  1VF3 A;  3IK9 A;  3M3M A;  1ZYQ B;  4TXO A;  4IHU A;  3CRT A;  5A34 A;  1UN2 A;  3TB2 A;  3F0I A;  2KP1 A;  4WBJ A;  1AW9 A;  2FWF A;  4GCI A;  2JZR A;  5B8A A;  1K0C A;  1MDJ A;  2R2J A;  5CRE A;  1TK8 B;  3CRU A;  3GTU A;  2DC5 A;  1TOF A;  2MMA A;  3F3R A;  4MF6 A;  3ZVJ D;  3KGK A;  5E59 A;  3PR8 A;  3KH9 A;  2EIQ A;  2R6K A;  5HFI A;  2X4A A;  3GA4 A;  5CRD A;  3FR6 A;  3C1R A;  4JE1 A;  4KGI A;  4ZB6 A;  3FRC A;  4ECJ A;  4EF0 A;  1GRX A;  1S3A A;  4AJ6 A;  2JAC A;  3CMI A;  1TK5 B;  3DWV A;  1Z6N A;  3HVS A;  2B1L A;  4PX1 A;  3MWH A;  4EL1 A;  1Y1U A;  3GNJ A;  2VCQ A;  3F6D A;  1JHB A;  1O73 A;  2EFC A;  4N11 A;  3ZMK A;  2FD3 A;  4TR0 A;  1GUL A;  4L0U A;  1PX7 A;  5BRT A;  3P7X A;  4O32 A;  4LMV A;  2N5F A;  2LUS A;  5JWQ B;  1SL1 B;  1TU8 A;  1JZW A;  3HKR A;  1F6M C;  2LST A;  5IMA A;  3ZL5 A;  3APQ A;  1GNE A;  3V1W A;  4PNF A;  3GUS A;  5ECP B;  3QMX A;  2CQ9 A;  3UIW A;  5ECL B;  1GSQ A;  1TXX A;  4F2I A;  5D73 A;  3LSZ A;  5CAX A;  5CRW A;  4KH7 A;  2GDR A;  2IMI A;  1M2D A;  4IQ1 A;  2I3Y A;  2GSS A;  3C8E A;  1NHO A;  5JWR B;  3HMJ G;  1K3Y A;  4WET A;  1ZYN A;  2P0G A;  2GS3 A;  2O85 A;  3FHK A;  2OJL A;  4QQ7 A;  1EOH A;  3F9U A;  5CYY A;  3H93 A;  2L57 A;  5CP1 A;  2TIR A;  5IPH A;  2YJ7 A;  3Q74 A;  3FK8 A;  3D21 A;  4ZL9 A;  2YPM A;  1A2M A;  1TI1 A;  2H71 A;  1KEB A;  4IEL A;  4EE0 A;  1T4Z A;  3BCI A;  5DQY A;  1I9D A;  3CBU A;  4EIQ A;  2RLI A;  1JFU A;  1GSF A;  5J5N A;  2EFE A;  4L0W A;  5G2Z A;  5KN1 A;  1Z3E A;  2LTK A;  1U6T A;  5A1N A;  3LEF A;  2LRT A;  2YP6 A;  1Z5Y E;  5H5S A;  5ECK B;  2HRN A;  3Q6O A;  2HXK A;  2PVQ A;  1TRW A;  4RQX A;  2ON7 A;  1SL0 B;  4BIK A;  3OR5 A;  4MZC A;  4AKG A;  2H1L A;  5A34 B;  2X64 A;  4G0L A;  2GST A;  4YQM A;  1FVK A;  3DKS A;  4F9Z A;  1G7O A;  3H4K A;  2NTO A;  1TI3 A;  1M0U A;  1YZX A;  5KOW A;  4FYC A;  2OE0 A;  4AI6 A;  2FA4 A;  1XVQ A;  3IOS A;  1XWG A;  1NHY A;  1AXD A;  1Y6E A;  4XS4 B;  5GSS A;  1BED A;  4CY6 A;  4XRD A;  1ERW A;  1URM A;  3GYK A;  1ML6 A;  1GSU A;  1XOA A;  5AIS A;  4WF5 A;  3FYG A;  1OC8 A;  5HR3 A;  3KIJ A;  1SK1 A;  5G1K A;  4IJI A;  1TW9 A;  2FHE A;  3U6V A;  1X0R A;  3DYR A;  3FZA A;  4E8H A;  2DJK A;  3O3T A;  3CTF A;  1G6W A;  1IYH A;  4BL7 A;  1NSW A;  3TOT A;  2O87 A;  2CVK A;  2H30 A;  1TK0 B;  4X0X A;  3F4R A;  2CT6 A;  3ZTL A;  3KZQ A;  1H75 A;  3BOA A;  1EOG A;  5ECS A;  1GTI A;  5IQY A;  2J23 A;  2I81 A;  1U3I A;  4Q5F A;  2CVD A;  5G31 A;  4PUR A;  3VPT A;  2AAW A;  3UVH A;  3TKS C;  2PU9 C;  3TJF A;  19GS A;  2AUV A;  4KX4 A;  3H1N A;  5G5E A;  2PVO C;  3ZLP A;  2WGR A;  5HR0 A;  4WBR D;  3UJ1 A;  4MPF A;  6GSV A;  4GLT A;  1T00 A;  4POB A;  1FO5 A;  3MIX A;  1QMV A;  1PMT A;  1B8X A;  5DAK B;  4O5Q A;  2TRC P;  2H8L A;  1B9X C;  4P3Y B;  2YZU A;  3D5J A;  4ZL8 A;  3GIX A;  2C3N A;  3L4N A;  1PRX A;  2LQO A;  1ZYP A;  4JR6 A;  4TXV A;  2GQK A;  3LJR A;  3QOU A;  3LOR A;  4Z2R A;  1MEK A;  1AQX A;  2PER A;  3UVT A;  4F0B A;  1MTC A;  2WW2 A;  3WGD A;  2AJQ B;  4G0K A;  4MF7 A;  2IJY A;  13GS A;  2CVB A;  1EV9 A;  4KE3 A;  1EGR A;  2BJX A;  4IP1 A;  2Z9S A;  1ERT A;  2UZ8 A;  3ZRD A;  1OKD A;  3HJO A;  1MD3 A;  2N5B A;  3F8U A;  4YAV A;  4PQH A;  2AHE A;  1ZCP A;  5A1N B;  1HQO A;  1YJ6 A;  3E9J B;  3FY7 A;  2FNO A;  2MBT A;  4QL7 A;  2H1B A;  5IM9 A;  2K6V A;  2ZCT A;  5ECO B;  4BVX A;  3IA1 A;  2ALB A;  4FH8 A;  4IVF A;  2J9H A;  3VWX A;  3VLN A;  5A4W A;  1G6Y A;  1FB0 A;  3QFA C;  1M7T A;  1HNC A;  2WW3 A;  4KSM A;  1TRV A;  1AQW A;  4K5S A;  1X9M B;  3A2W A;  2HI7 A;  3TJB A;  3C7M A;  2L4C A;  1W4V A;  2H70 A;  5DAL A;  3ME8 A;  4O5U A;  2WW1 A;  4V2L A;  3MDK A;  3MYD A;  4KDY A;  2V6O A;  2H74 A;  4BL7 B;  3TKS E;  4HU7 A;  3HA9 A;  1XWB A;  1SJZ A;  2BTO T;  3TRX A;  1O85 A;  5C00 A;  3CSJ A;  1LBK A;  5HFK A;  4KB3 A;  1LJR A;  2X99 A;  5J4U A;  4IBP A;  5AGY A;  5A5H A;  3I6A A;  3UBL A;  4K5R A;  3QCP A;  1GTU A;  5J4Y A;  2WRT A;  1Z7P A;  2YCD A;  4TR3 A;  1QFN A;  4BVY B;  3R2Q A;  4HZ2 A;  2XPE A;  5ELA A;  2B7J A;  3KM6 A;  4HDE A;  1SEN A;  3IAM 2;  1JZO A;  2PN8 A;  2H6Z A;  4TR1 A;  3KP9 A;  2L4Q A;  4HUA A;  4KDU A;  5EVO A;  2VCT A;  2IMF A;  4KUN A;  4XS1 A;  4EO3 A;  1K3O A;  4EKZ A;  5DVB A;  1OYJ A;  5E4W A;  2L6D A;  1TXU A;  5F0G A;  2WZ9 A;  5FHI A;  3ZRE A;  2GT6 A;  1C72 A;  1GLP A;  3K8N A;  2I1U A;  2DMM A;  3VUR A;  4FO5 A;  1X9W B;  4QMK A;  1PA3 A;  3EMP A;  4MMM A;  3GH6 A;  2HSH A;  2IME A;  4PQI A;  2GZZ A;  3EUR A;  1CQH A;  1YKC A;  1YF0 A;  1GNW A;  1AAZ A;  1G0T A;  4PUA A;  1THX A;  4O7H A;  2DIZ A;  5DDL A;  4XRA A;  1V2A A;  2R4V A;  1PQN A;  3TRP A;  3F4T A;  3RGB C;  2IFQ B;  4G10 A;  3RDW A;  2VIM A;  4H86 A;  1YDK A;  5DJM A;  4JR4 A;  5DQS A;  3A2V A;  3IHQ A;  5INY A;  4POL A;  4BPY A;  4K6X A;  3IBH A;  1UVZ A;  2E2G A;  3ZVJ A;  2HZE B;  3HZ8 A;  1JLW A;  3VWU A;  3TJJ A;  4FYU A;  4IW9 A;  3L9S A;  2YWI A;  3M0F A;  2FUG 2;  5HR2 A;  3C1S A;  1TRU A;  1HD2 A;  4KW6 A;  4GRF A;  4AKI A;  3UMA A;  1X9S B;  2MMN A;  5CRG A;  2JSY A;  5IOW A;  4XCS A;  4FQU A;  3DRN A;  2NVL A;  5IMZ A;  3H8Q A;  4JBB A;  3ZIV A;  3G7I A;  2HQT A;  6GSW A;  4K1F A;  3DD3 A;  3NOF A;  1T4Y A;  2R0P A;  3GKX A;  3CSH A;  1AIU A;  1A0F A;  3SWL A;  3LG6 A;  5DAL B;  1BAY A;  5B6M A;  4V1A g;  5J9C A;  1T7P B;  4DSS A;  1GTB A;  1K0D A;  1SJI A;  5A4U A;  4NV2 A;  1F9M A;  3GKM A;  3ERW A;  4KF9 A;  4HSC X;  3D0Z A;  4GF0 A;  2OE1 A;  5A5H B;  2O89 A;  2OA7 A;  4OCF A;  1OKT A;  4XIH A;  5GAP D;  4TVE A;  3BBY A;  2GQL A;  4MLY A;  2HLS A;  1X5D A;  4OFT A;  3GH9 A;  4RUV A;  3M1G A;  2AYT A;  5J3R A;  4TR1 B;  4NAX A;  5ELG A;  4ZBA A;  4XHM A;  1V57 A;  5KEJ A;  4X4J A;  1WPI A;  4PI0 C;  4YKG A;  2LJR A;  4OO4 A;  4V1A p;  2IIY A;  1O8W A;  4MJA A;  1WIK A;  3F3Q A;  2WCI A;  2ZNM A;  1B4Q A;  3L9V A;  5KN0 A;  2GLR A;  1WJK A;  5IMC A;  5HR1 A;  2PGT A;  4CDO A;  3WT1 A;  3P8W A;  1V58 A;  3BJ5 A;  3TDG A;  5IPG A;  4Z2U A;  2C80 A;  1OC9 B;  4JRR A;  2M72 A;  1PFO A;  2OKA A;  11GS A;  4TW5 A;  1GWC A;  2M46 A;  1SJ6 A;  1B48 A;  1I1I P;  1DBY A;  3L78 A;  3W8J A;  4O92 A;  4ZB7 A;  2REM A;  2R0C A;  2QA1 A;  2OAD A;  1K3L A;  1N8J A;  3HZ4 A;  4I8B A;  2B5X A;  2VOC A;  2O7K A;  2P5R A;  2MMO A;  3UOM A;  2R37 A;  2VUP A;  1SYX A;  3ZIJ A;  4HOJ A;  3IXR A;  3KMO A;  4G01 A;  2GSQ A;  1X5C A;  4E8E A;  12GS A;  4FIW A;  1PD2 1;  4GTU A;  1M9A A;  4D73 A;  1ERV A;  1RW1 A;  4MNN A;  4TXO B;  3CHX C;  1SD8 A;  1OC3 A;  1VRS D;  2C3T A;  2R3X A;  2L5O A;  2FGX A;  1O6J A;  1S3R A;  2H6X A;  5D9X A;  4DEJ A;  1GSS A;  3GUR A;  4GDF A;  2IN3 A;  5CRH A;  4CY8 A;  4EUY A;  1M99 A;  2A2R A;  3GKN A;  2V41 A;  3DVW A;  3ZML A;  3VK9 A;  4ML1 A;  1VGL A;  3GTU B;  3QFB C;  1K0O A;  4K2X A;  1B4P A;  4TOP A;  1THO A;  1WE0 A;  3ZIT A;  3GSS A;  5DCG A;  3QDN A;  4EIP A;  4DSS B;  1KTE A;  4N0Z A;  2WVY A;  2GQM A;  3MNG A;  5EPF A;  5HQP A;  3KH7 A;  2H0H A;  1TTZ A;  2P31 A;  1YF1 A;  1GP1 A;  4BWS A;  5D9T A;  3FR3 A;  4MAB A;  4OO5 A;  1GL8 A;  1XBS A;  2FA8 A;  5F06 A;  5BMU A;  1NW2 A;  3G7J A;  1GH2 A;  5ID2 A;  4ECC A;  2JAD A;  6GSX A;  4GQF A;  1K0B A;  4OFM A;  3PH9 A;  2OAC A;  2VD0 A;  1SVM A;  2WDU A;  2HSM A;  1E2Y A;  3IDV A;  1B9Y C;  3FZ4 A;  4CW9 A;  2VO4 A;  2JU5 A;  2PWJ A;  1F3A A;  1J08 A;  1VF4 A;  2DJ1 A;  5GAN D;  2JZS A;  5ECR B;  2GZP A;  4X1U A;  5JCU A;  2FLS A;  4HS1 A;  1R5P A;  2CAI A;  1DUG A;  1EWX A;  2EFD A;  2RUE A;  1GUM A;  3W8S A;  3LYK A;  1XW9 A;  2WB9 A;  1FW1 A;  4F0C A;  4YQU A;  4HEA 2;  2PUK C;  4ECI A;  2VM2 A;  5AIV A;  1V9W A;  1EZK A;  3TU3 B;  2DSA A;  4OD7 A;  1GSY A;  2JL4 A;  4I2U A;  3RPN A;  4E68 A;  1PN0 A;  1XW5 A;  4RI6 A;  2HSN A;  2YJH A;  1M3I A;  3UAR A;  2KLX A;  2YN1 A;  1SD9 A;  4PTS A;  2MMZ A;  1Z7R A;  5HFG A;  2C1Y A;  4G19 A;  3EU4 A;  4J56 E;  3CYN A;  2V6K A;  3Q19 A;  2VCW A;  4ZXG A;  2VL2 A;  2YV7 A;  2F8A A;  3G9B A;  4ACS A;  2LQQ A;  1PGT A;  4O5R A;  14GS A;  5D96 A;  3ZZX A;  3H79 A;  1XCC A;  5GZZ B;  1I5G A;  5IIZ A;  4MK3 A;  10GS A;  4MCU A;  3C73 A;  2R5G A;  1ILO A;  3HYP A;  3O76 A;  4A5P A;  1A0R P;  2AB6 A;  4ECB A;  3KEB A;  3F4S A;  5DBQ A;  3LQ7 A;  1BYE A;  5AN1 A;  3EWL A;  2VKZ G;  3QPM A;  4ML6 A;  5D93 A;  3I43 A;  3APS A;  4KSO A;  6GSU A;  7GSS A;  3IV4 A;  1FOH A;  16GS A;  2A2S A;  3QD9 A;  2BMX A;  2VD1 A;  3FR9 A;  3F6F A;  4LL1 B;  2MYG A;  5ECH B;  2DJ2 A;  1YEP A;  4TN8 A;  5A5K A;  4TR4 A;  5CO3 A;  3ERF A;  2DLX A;  2VCX A;  5CNW A;  3EYT A;  5H5Q A;  5JCG A;  2DBC A;  3TRQ A;  1V98 A;  2FWE A;  5FWG A;  4GQC A;  2KOK A;  4ULX A;  5BMU B;  4WR5 A;  1GLQ A;  3GKK A;  2FCH A;  1XWC A;  5L71 A;  6GST A;  2H75 A;  1ZGN A;  5LCZ A;  1XVW A;  1A24 A;  5D9W A;  5KOX A;  4GSN A;  2H0I A;  1QK8 A;  2YWO A;  4KDX A;  4AGS A;  4AJ8 A;  1A8L A;  1EP8 A;  1SK0 A;  1YKA A;  3LYP A;  4IJ3 A;  1TU7 A;  2WVX A;  2WUL A;  2CAQ A;  3VPQ A;  1QQ2 A;  4PQ1 A;  6GSY A;  4HQZ A;  4EDY A;  4HI7 A;  5ECN B;  4EDZ A;  1TDI A;  2OBK A;  1ERU A;  1K0A A;  2L6C A;  3IE3 A;  1GUH A;  3TKR A;  3US3 A;  4NWY A;  4K0G A;  4I5Q A;  1USB A;  3DIE A;  1AQV A;  3WT2 A;  2LS5 A;  1ZMA A;  1KBN A;  4PHZ C;  2G0F A;  2OT3 A;  2EIR A;  3IAS 2;  3I69 A;  1K0M A;  20GS A;  3UBK A;  1YVL A;  3MAK A;  4L5L A;  1S4B P;  2HSN B;  1O7U A;  3KMN A;  1YEX A;  4NPB A;  1H4O A;  1WMJ A;  2FWH A;  2CA8 A;  1PSQ A;  3VWV A;  5J47 A;  1A2J A;  4ZBD A;  1WRY A;  4PGT A;  3DXB A;  5D9V A;  3KCM A;  3CTG A;  3GV1 A;  2KP2 A;  4AJ7 A;  1HYU A;  5B6N A;  5AIX A;  5H5R A;  1DE1 A;  4KCE A;  4HJ2 A;  4F82 A;  3BD2 A;  1U3A A;  4RI7 A;  3WGE A;  1A2L A;  3HD5 A;  2X8G A;  3J7Y k;  3E3E A;  3M9K A;  2IMD A;  4K0N A;  1R5A A;  1M2B A;  2OE3 A;  3EIN A;  4JU5 A;  2X8H A;  2IWT A;  4GSS A;  4XS6 A;  4BVX B;  5COH A;  3C71 A;  4F03 A;  1FOV A;  3GFK A;  3GL3 A;  4PI2 C;  1FHE A;  4XTS A;  1QGV A;  3IPZ A;  1G7E A;  2QSI A;  2CX3 A;  1ZYE A;  2JSZ A;  3WGX A;  1XW6 A;  2K8V A;  1F3B A;  1TP9 A;  1XPV A;  2H6Y A;  4WXT A;  3LWA A;  1S3D A;  3VFI A;  2F3M A;  2FY6 A;  1ZOF A;  1GUK A;  4X43 A;  1XWK A;  2C0E A;  2DIY A;  2GTU A;  1BG5 A;  4V2M A;  4DSR A;  1O8X A;  4MH3 A;  1GSE A;  3N9J A;  4YKF A;  4ICY A;  3QR6 A;  1KNG A;  1F2E A;  2RM5 A;  3NIV A;  3ED3 A;  1EGO A;  2V2G A;  4XS4 A;  2VLV A;  2HSY A;  1ZZY A;  2L5L A;  2LRC A;  3UAP A;  1U88 A;  2C3Q A;  4PXO A;  5J9B A;  4IP6 A;  2RII A;  3D4M A;  2WW0 A;  5G1L A;  3D4T A;  3KP8 A;  1ST9 A;  2MZC A;  4NV5 A;  4QL9 A;  2LRN A;  2EC4 A;  1DSB A;  2WVX B;  3RAZ A;  1LU4 A;  1R7H A;  3R3E A;  1EEM A;  4ZIJ A;  3HHV A;  1E6B A;  4J2F A;  3UEM A;  4IKH A;  1MD4 A;  4IS0 A;  4Z2T A;  3GL5 A;  1FB6 A;  2IPA A;  3GHA A;  4MPG A;  1XWA A;  4HU9 A;  2O36 A;  3M8N A;  3HJP A;  4K2D A;  2H72 A;  1R4W A;  2ZUP A;  3ME7 A;  3FW2 A;  4KND A;  1Y25 A;  1U87 A;  2VL9 A;  1EEJ A;  3QAG A;  3IRA A;  2G2Q A;  1XIY A;  2VAF A;  2ON5 A;  2VLU A;  4HJM A;  2WZS A;  3HY2 A;  5C04 A;  3PPU A;  2WJU A;  5ENU A;  2WS2 A;  4JED A;  2HE3 A;  2V1M A;  4I97 A;  8GSS A;  2YWN A;  5J40 A;  2DKH A;  1J9B A;  4OCE A;  4K8M A;  3EMX A;  4HZ4 A;  9GSS A;  5B8B A;  5ECQ B;  3EPT A;  3PIN A;  5IMD A;  2DJ0 A;  3TKP A;  2YV9 A;  2VL2 C;  5F8B A;  4AKH A;  3TKQ A;  5DAK A;  1UC7 A;  1IYI A;  4USS A;  2QKE A;  3IK7 A;  3Q18 A;  5FT3 A;  3LXT A;  3WYW A;  3I9V 2;  4IGJ A;  4WKW A;  4I2T A;  3KJY A;  1PN9 A;  3TCO A;  3RHC A;  2PPT A;  3O6T A;  2H1G A;  1HNA A;  1M3J A;  2XBQ A;  4AKX B;  5F07 A;  1N2A A;  3LFL A;  2A4H A;  2YOI A;  4MF5 A;  1OE7 A;  1T8E B;  3WD6 A;  3A2X A;  4NMU A;  4OFN A;  2B5Y A;  2LNT A;  2NBS A;  1SU9 A;  3IR4 A;  1BQ7 A;  1OAZ A;  1QXH A;  4ZB8 A;  3S9F A;  1EV4 A;  2MBS A;  1JZR A;  3TGZ A;  3ZFL A;  1WOU A;  4OWY A;  4CHS A;  3M9J A;  1JLV A;  4Q5Q A;  3DEX A;  1ON4 A;  4K7I A;  3IC4 A;  1M2A A;  1TJD A;  3GRX A;  4MJC A;  2CV4 A;  5F05 A;  3JCM L;  2K9F A;  2X49 A;  2H1A A;  2PMT A;  4EXJ A;  5A4V A;  2H73 A;  1DE2 A;  4L5O A;  4FYB A;  5G30 A;  3FMW A;  1FVJ A;  3P2A A;  4K9Z A;  2DKI A;  2KHP A;  2OBI A;  1TKD B;  4K7N A;  4ZL7 A;  3DVX A;  5JWO B;  1K0N A;  2B5E A;  1UA5 A;  1T1V A;  3VWW A;  2IMK A;  3RPP A;  2C0G A;  1RK4 A;  2N5A A;  1XOB A;  3KTL A;  4MP4 A;  2PBJ A;  1BJX A;  5IO2 A;  2HRK A;  2HNL A;  1OVN A;  2FWG A;  1Q4J A;  2VL3 A;  5D8I A;  2IL3 A;  2VM1 A;  2UV8 G;  2B1K A;  1XZO A;  2F51 A;  1EP7 A;  4KA0 A;  3SBC A;  4G2E A;  2XBI A;  3GMF A;  4W66 A;  1S3C A;  1PKW A;  3NZN A;  4KCA A;  3HVX A;  1VF1 A;  5ECI B;  2H76 A;  3A5W A;  2A4V A;  3FKF A;  3LXZ A;  1Z6M A;  3IC8 A;  5B7C A;  22GS A;  3BCK A;  4GST A;  4BVY A;  3QAV A;  1RQM A;  2E7P A;  2QGV A;  4YQV A;  5J41 A;  3DGQ A;  2H01 A;  3U5R E;  4NXI A;  1SKW B;  4V2N A;  1YQ1 A;  4WEY A;  2B3S A;  2AV4 A;  5G5F A;  2LV3 A;  1F37 A;  4BWQ A;  2F8F A;  2EFH A;  4NHZ A;  3E0U A;  2NDO A;  4DSQ A;  2CZ3 A;  2RUF A;  3IHG A;  4WF4 A;  3GN3 A;  4G0I A;  3VI5 A;  3RBT A;  4LL4 B;  1AC1 A;  2HRA A;  2LJA A;  3HVV A;  4MZW A;  3EE2 A;  2M80 A;  1WP0 A;  2GVP A;  4EVM A;  4MH2 A;  3UL3 A;  1GTA A;  1SKR B;  1FG4 A;  6GSS A;  2A2P A;  3MSZ A;  2YZH A;  4I6X A;  1T3B A;  4MJB A;  1ABA A;  4IN0 A;  5ECM B;  5JCW A;  2I4A A;  1PX6 A;  3L9U A;  1SK2 A;  4PNG A;  1TRS A;  3P90 A;  2DML A;  2HYX A;  2YAN A;  4D73 B;  1PKZ A;  5DCH A;  3A3T A;  4PUF C;  3LGC A;  4K7O A;  1VF2 A;  2IFQ A;  2VCV A;  1W89 A;  4LA1 A;  4GWR A;  4DVC A;  3AY8 A;  4LMW A;  1R26 A;  1XG8 A;  2KUC A;  2GGT A;  3GX0 A;  2LKU A;  2H66 A;  3F63 A;  3TJG A;  1Q98 A;  2YNX A;  2E0Q A;  2O3E A;  3FZ5 A;  1WWJ A;  4AF2 A;  2X8C A;  2HZE A;  3TUE A;  1CQG A;  2DJ3 A;  3KTB A;  17GS A;  2ES7 A;  3G7Y A;  2CZ2 A;  3ERG A;  2LEG A;  4ZIL A;  1ZL9 A;  2V32 A;  4N30 A;  4EC0 A;  1O81 A;  2VLT A;  2EIO A;  2CX4 A;  3W6G A;  2O5V A;  4ZBB A;  3HXS A;  4N3Z A;  3APO A;  1M9B A;  3TJK A;  1A23 A;  2HZF A;  1PL2 A;  5IMV A;  3CXG A;  1SVO A;  1QUW A;  2VCZ A;  4ZB9 A;  4TRX A;  1XFL A;  3EC3 A;  5ID2 B;  3HCZ A;  5DJL A;  4OMV A;  5KN3 A;  4G9H A;  4MA9 A;  3CQF A;  2K18 A;  2GT5 A;  2HSM B;  2QA2 A;  2L59 A;  2HRK B;  4Z7X A;  3HDC A;  3VI7 A;  2P5Q A;  3PGT A;  1BF5 A;  5ABR A;  1J0F A;  2XPD A;  4Q5N A;  1OE8 A;  3RFR C;  2NPB A;  2QC7 A;  3KXO A;  4HQS A;  5KN2 A;  1V40 A;  4WR4 A;  5IOX A;  3LW9 A;  2YWM A;  2DJJ A;  4YH2 A;  2R0G A;  5J4V A;  2C8U A;  2H19 A;  2E2M A;  4LLR A;  4FXY P;  2C0F A;  1JZD A;  2JZT A;  4IQA A;  2K8S A;  4ISD A;  3GX8 A;  3TKS A;  1YEW C;  2HFD A;  2LJK A;  2WFC A;  4ID0 A;  4N10 A;  4RQR A;  4TKY A;  3CSI A; 
#chains in the Genus database with same CATH homology
 4N0V A;  3EU3 A;  4NHW A;  4YAP A;  3TOU A;  3FEU A;  1FAA A;  2HT9 A;  1N25 A;  5LD0 A;  1SYR A;  2LNS A;  3D6I A;  4POK A;  5EL8 A;  1SL2 B;  1X5E A;  2XHF A;  2B6M A;  1AUC A;  1SKS B;  3GST A;  18GS A;  2HRF A;  4L8E A;  2B7K A;  3A5I A;  2H1D A;  5IMF A;  3D22 A;  2F9S A;  4Q5R A;  1OC9 A;  4BA7 A;  5LNK e;  2RM6 A;  3QAW A;  3KD0 A;  4ILF A;  3FZ9 A;  1A8Y A;  1BG1 A;  4MDC A;  4GXZ A;  1MDK A;  5GST A;  1YY7 A;  2GSR A;  3EVI A;  3DML A;  3RHB A;  4MZB A;  3ZFB A;  4POM A;  4MJE A;  3CWG A;  5EY6 A;  2TRX A;  2C0D A;  1SVL A;  3L0H A;  2O8V B;  2D2Z A;  1BX9 A;  1Z9H A;  1ACV A;  1MDI A;  1PL1 A;  1XXU A;  3N5O A;  4J57 E;  2XC2 A;  2H0G A;  3ISO A;  3J7Y b;  1HNB A;  2I9H A;  2C4J A;  5IO0 A;  2GZY A;  4KAE A;  3ZYW A;  1NM3 A;  4JZQ A;  1GSD A;  3HJM A;  1VF3 A;  3IK9 A;  3M3M A;  1ZYQ B;  4TXO A;  4IHU A;  3CRT A;  5A34 A;  1UN2 A;  3TB2 A;  3F0I A;  2KP1 A;  4WBJ A;  1AW9 A;  2FWF A;  4GCI A;  2JZR A;  5B8A A;  1K0C A;  1MDJ A;  2R2J A;  5CRE A;  1TK8 B;  3CRU A;  3GTU A;  2DC5 A;  1TOF A;  2MMA A;  3F3R A;  4MF6 A;  3ZVJ D;  3KGK A;  5E59 A;  3KH9 A;  3PR8 A;  2EIQ A;  2R6K A;  5HFI A;  2X4A A;  3GA4 A;  5CRD A;  3FR6 A;  3C1R A;  4JE1 A;  4KGI A;  4ZB6 A;  3FRC A;  4ECJ A;  4EF0 A;  1GRX A;  1S3A A;  4AJ6 A;  2JAC A;  3CMI A;  1TK5 B;  3DWV A;  1Z6N A;  3HVS A;  2B1L A;  4PX1 A;  3MWH A;  4EL1 A;  1Y1U A;  3GNJ A;  2VCQ A;  3F6D A;  1JHB A;  1O73 A;  2EFC A;  4N11 A;  3ZMK A;  2FD3 A;  4TR0 A;  1GUL A;  4L0U A;  1PX7 A;  5BRT A;  3P7X A;  4O32 A;  4LMV A;  2N5F A;  2LUS A;  5JWQ B;  1SL1 B;  1TU8 A;  1JZW A;  3HKR A;  1F6M C;  2LST A;  5IMA A;  3ZL5 A;  3APQ A;  1GNE A;  3V1W A;  4PNF A;  3GUS A;  5ECP B;  3QMX A;  2CQ9 A;  3UIW A;  5ECL B;  1GSQ A;  1TXX A;  4F2I A;  5D73 A;  3LSZ A;  5CAX A;  5CRW A;  4KH7 A;  2GDR A;  2IMI A;  1M2D A;  4IQ1 A;  2I3Y A;  2GSS A;  3C8E A;  1NHO A;  5JWR B;  3HMJ G;  1K3Y A;  4WET A;  1ZYN A;  2P0G A;  2GS3 A;  2O85 A;  3FHK A;  2OJL A;  4QQ7 A;  1EOH A;  3F9U A;  5CYY A;  3H93 A;  2L57 A;  5CP1 A;  2TIR A;  5IPH A;  2YJ7 A;  3Q74 A;  3FK8 A;  3D21 A;  4ZL9 A;  2YPM A;  1A2M A;  1TI1 A;  2H71 A;  1KEB A;  4IEL A;  4EE0 A;  1T4Z A;  3BCI A;  5DQY A;  1I9D A;  3CBU A;  4EIQ A;  2RLI A;  1JFU A;  1GSF A;  5J5N A;  2EFE A;  4L0W A;  5G2Z A;  5KN1 A;  1Z3E A;  2LTK A;  1U6T A;  5A1N A;  3LEF A;  2LRT A;  2YP6 A;  1Z5Y E;  5H5S A;  5ECK B;  2HRN A;  3Q6O A;  2HXK A;  2PVQ A;  1TRW A;  4RQX A;  2ON7 A;  1SL0 B;  3OR5 A;  4MZC A;  4AKG A;  2H1L A;  5A34 B;  2X64 A;  4G0L A;  2GST A;  4YQM A;  1FVK A;  3DKS A;  4F9Z A;  1G7O A;  3H4K A;  2NTO A;  1TI3 A;  1M0U A;  1YZX A;  5KOW A;  4FYC A;  2OE0 A;  4AI6 A;  2FA4 A;  1XVQ A;  3IOS A;  1XWG A;  1NHY A;  1AXD A;  1Y6E A;  4XS4 B;  5GSS A;  1BED A;  4CY6 A;  4XRD A;  1ERW A;  1URM A;  3GYK A;  1ML6 A;  1GSU A;  1XOA A;  5AIS A;  4WF5 A;  3FYG A;  1OC8 A;  5HR3 A;  3KIJ A;  1SK1 A;  5G1K A;  4IJI A;  1TW9 A;  2FHE A;  3U6V A;  1X0R A;  3DYR A;  3FZA A;  4E8H A;  2DJK A;  3O3T A;  3CTF A;  1G6W A;  1IYH A;  4BL7 A;  1NSW A;  3TOT A;  2O87 A;  2CVK A;  2H30 A;  1TK0 B;  4X0X A;  3F4R A;  2CT6 A;  3ZTL A;  3KZQ A;  1H75 A;  3BOA A;  1EOG A;  5ECS A;  1GTI A;  5IQY A;  2J23 A;  2I81 A;  1U3I A;  4Q5F A;  2CVD A;  5G31 A;  4PUR A;  3VPT A;  2AAW A;  3UVH A;  3TKS C;  2PU9 C;  3TJF A;  19GS A;  2AUV A;  4KX4 A;  3H1N A;  5G5E A;  2PVO C;  3ZLP A;  2WGR A;  5HR0 A;  4WBR D;  3UJ1 A;  4MPF A;  6GSV A;  4GLT A;  1T00 A;  4POB A;  1FO5 A;  3MIX A;  1QMV A;  1PMT A;  1B8X A;  5DAK B;  4O5Q A;  2TRC P;  2H8L A;  1B9X C;  4P3Y B;  2YZU A;  3D5J A;  4ZL8 A;  3GIX A;  2C3N A;  3L4N A;  1PRX A;  2LQO A;  1ZYP A;  4JR6 A;  4TXV A;  2GQK A;  3LJR A;  3QOU A;  3LOR A;  4Z2R A;  1MEK A;  1AQX A;  2PER A;  3UVT A;  4F0B A;  1MTC A;  3WGD A;  2AJQ B;  4G0K A;  4MF7 A;  2IJY A;  13GS A;  2CVB A;  1EV9 A;  4KE3 A;  1EGR A;  2BJX A;  4IP1 A;  2Z9S A;  1ERT A;  2UZ8 A;  3ZRD A;  1OKD A;  3HJO A;  1MD3 A;  2N5B A;  3F8U A;  4YAV A;  4PQH A;  2AHE A;  1ZCP A;  5A1N B;  1HQO A;  1YJ6 A;  3E9J B;  3FY7 A;  2FNO A;  2MBT A;  4QL7 A;  2H1B A;  5IM9 A;  2K6V A;  2ZCT A;  5ECO B;  4BVX A;  3IA1 A;  2ALB A;  4FH8 A;  4IVF A;  2J9H A;  3VWX A;  3VLN A;  5A4W A;  1G6Y A;  1FB0 A;  3QFA C;  1M7T A;  1HNC A;  4KSM A;  1TRV A;  1AQW A;  4K5S A;  1X9M B;  3A2W A;  2HI7 A;  3TJB A;  3C7M A;  2L4C A;  1W4V A;  2H70 A;  5DAL A;  3ME8 A;  4O5U A;  4V2L A;  3MDK A;  3MYD A;  4KDY A;  2V6O A;  2H74 A;  4BL7 B;  3TKS E;  4HU7 A;  3HA9 A;  1XWB A;  1SJZ A;  2BTO T;  3TRX A;  1O85 A;  5C00 A;  3CSJ A;  1LBK A;  5HFK A;  4KB3 A;  1LJR A;  2X99 A;  5J4U A;  4IBP A;  5AGY A;  5A5H A;  3I6A A;  3UBL A;  4K5R A;  3QCP A;  1GTU A;  5J4Y A;  2WRT A;  1Z7P A;  2YCD A;  4TR3 A;  1QFN A;  4BVY B;  3R2Q A;  4HZ2 A;  2XPE A;  5ELA A;  2B7J A;  3KM6 A;  4HDE A;  1SEN A;  3IAM 2;  1JZO A;  2PN8 A;  2H6Z A;  4TR1 A;  3KP9 A;  2L4Q A;  4HUA A;  4KDU A;  5EVO A;  2VCT A;  2IMF A;  4KUN A;  4XS1 A;  4EO3 A;  1K3O A;  4EKZ A;  5DVB A;  1OYJ A;  5E4W A;  2L6D A;  1TXU A;  5F0G A;  2WZ9 A;  5FHI A;  3ZRE A;  2GT6 A;  1C72 A;  1GLP A;  3K8N A;  2I1U A;  2DMM A;  3VUR A;  4FO5 A;  1X9W B;  4QMK A;  1PA3 A;  3EMP A;  4MMM A;  3GH6 A;  2HSH A;  2IME A;  4PQI A;  2GZZ A;  3EUR A;  1CQH A;  1YKC A;  1YF0 A;  1GNW A;  1AAZ A;  1G0T A;  4PUA A;  1THX A;  4O7H A;  2DIZ A;  5DDL A;  4XRA A;  1V2A A;  2R4V A;  1PQN A;  3TRP A;  3F4T A;  2IFQ B;  4G10 A;  3RDW A;  2VIM A;  4H86 A;  1YDK A;  5DJM A;  4JR4 A;  5DQS A;  3A2V A;  3IHQ A;  5INY A;  4POL A;  4BPY A;  4K6X A;  3IBH A;  1UVZ A;  2E2G A;  3ZVJ A;  2HZE B;  3HZ8 A;  1JLW A;  3VWU A;  3TJJ A;  4FYU A;  4IW9 A;  3L9S A;  2YWI A;  3M0F A;  2FUG 2;  5HR2 A;  3C1S A;  1TRU A;  1HD2 A;  4KW6 A;  4GRF A;  4AKI A;  3UMA A;  1X9S B;  2MMN A;  5CRG A;  2JSY A;  5IOW A;  4XCS A;  4FQU A;  3DRN A;  2NVL A;  5IMZ A;  3H8Q A;  4JBB A;  3ZIV A;  3G7I A;  2HQT A;  6GSW A;  4K1F A;  3DD3 A;  3NOF A;  1T4Y A;  2R0P A;  3GKX A;  3CSH A;  1AIU A;  1A0F A;  3SWL A;  3LG6 A;  5DAL B;  1BAY A;  5B6M A;  4V1A g;  5J9C A;  1T7P B;  4DSS A;  1GTB A;  1K0D A;  1SJI A;  5A4U A;  4NV2 A;  1F9M A;  3GKM A;  3ERW A;  4KF9 A;  3D0Z A;  4GF0 A;  2OE1 A;  5A5H B;  2O89 A;  2OA7 A;  4OCF A;  1OKT A;  4XIH A;  5GAP D;  4TVE A;  3BBY A;  2GQL A;  4MLY A;  2HLS A;  1X5D A;  4OFT A;  3GH9 A;  4RUV A;  3M1G A;  2AYT A;  5J3R A;  4TR1 B;  4NAX A;  5ELG A;  4ZBA A;  4XHM A;  1V57 A;  5KEJ A;  4X4J A;  1WPI A;  4YKG A;  2LJR A;  4OO4 A;  4V1A p;  2IIY A;  1O8W A;  4MJA A;  1WIK A;  3F3Q A;  2WCI A;  2ZNM A;  1B4Q A;  3L9V A;  5KN0 A;  2GLR A;  1WJK A;  5IMC A;  5HR1 A;  2PGT A;  4CDO A;  3WT1 A;  3P8W A;  1V58 A;  3BJ5 A;  3TDG A;  5IPG A;  4Z2U A;  2C80 A;  1OC9 B;  4JRR A;  2M72 A;  2OKA A;  11GS A;  4TW5 A;  1GWC A;  2M46 A;  1SJ6 A;  1B48 A;  1DBY A;  3L78 A;  3W8J A;  4O92 A;  4ZB7 A;  2REM A;  2R0C A;  2QA1 A;  2OAD A;  1K3L A;  1N8J A;  3HZ4 A;  4I8B A;  2B5X A;  2VOC A;  2O7K A;  2P5R A;  2MMO A;  3UOM A;  2R37 A;  2VUP A;  1SYX A;  3ZIJ A;  4HOJ A;  3IXR A;  3KMO A;  4G01 A;  2GSQ A;  1X5C A;  4E8E A;  12GS A;  4FIW A;  1PD2 1;  4GTU A;  1M9A A;  4D73 A;  1ERV A;  1RW1 A;  4MNN A;  4TXO B;  1SD8 A;  1OC3 A;  1VRS D;  2C3T A;  2R3X A;  2L5O A;  2FGX A;  1O6J A;  2H6X A;  5D9X A;  4DEJ A;  1GSS A;  3GUR A;  4GDF A;  2IN3 A;  5CRH A;  4CY8 A;  4EUY A;  1M99 A;  2A2R A;  3GKN A;  2V41 A;  3DVW A;  3ZML A;  3VK9 A;  4ML1 A;  1VGL A;  3GTU B;  3QFB C;  1K0O A;  4K2X A;  1B4P A;  4TOP A;  1THO A;  1WE0 A;  3ZIT A;  3GSS A;  5DCG A;  3QDN A;  4EIP A;  4DSS B;  1KTE A;  4N0Z A;  2GQM A;  3MNG A;  5EPF A;  5HQP A;  3KH7 A;  2H0H A;  1TTZ A;  2P31 A;  1YF1 A;  1GP1 A;  4BWS A;  5D9T A;  3FR3 A;  4MAB A;  4OO5 A;  1GL8 A;  1XBS A;  2FA8 A;  5F06 A;  5BMU A;  1NW2 A;  3G7J A;  1GH2 A;  5ID2 A;  4ECC A;  2JAD A;  6GSX A;  4GQF A;  1K0B A;  4OFM A;  3PH9 A;  2OAC A;  2VD0 A;  1SVM A;  2WDU A;  2HSM A;  1E2Y A;  3IDV A;  1B9Y C;  3FZ4 A;  4CW9 A;  2VO4 A;  2JU5 A;  2PWJ A;  1F3A A;  1J08 A;  1VF4 A;  2DJ1 A;  5GAN D;  2JZS A;  5ECR B;  2GZP A;  4X1U A;  5JCU A;  2FLS A;  4HS1 A;  1R5P A;  2CAI A;  1DUG A;  1EWX A;  2EFD A;  2RUE A;  1GUM A;  3W8S A;  3LYK A;  1XW9 A;  2WB9 A;  1FW1 A;  4F0C A;  4YQU A;  4HEA 2;  2PUK C;  4ECI A;  2VM2 A;  5AIV A;  1V9W A;  1EZK A;  3TU3 B;  2DSA A;  4OD7 A;  1GSY A;  2JL4 A;  4I2U A;  3RPN A;  4E68 A;  1PN0 A;  1XW5 A;  4RI6 A;  2HSN A;  2YJH A;  3UAR A;  2KLX A;  2YN1 A;  1SD9 A;  4PTS A;  2MMZ A;  1Z7R A;  5HFG A;  2C1Y A;  4G19 A;  3EU4 A;  4J56 E;  3CYN A;  2V6K A;  3Q19 A;  2VCW A;  4ZXG A;  2VL2 A;  2YV7 A;  2F8A A;  3G9B A;  4ACS A;  2LQQ A;  1PGT A;  4O5R A;  14GS A;  5D96 A;  3ZZX A;  3H79 A;  1XCC A;  5GZZ B;  1I5G A;  5IIZ A;  4MK3 A;  10GS A;  4MCU A;  3C73 A;  2R5G A;  1ILO A;  3HYP A;  3O76 A;  4A5P A;  1A0R P;  2AB6 A;  4ECB A;  3KEB A;  3F4S A;  5DBQ A;  3LQ7 A;  1BYE A;  5AN1 A;  3EWL A;  2VKZ G;  3QPM A;  4ML6 A;  5D93 A;  3I43 A;  3APS A;  4KSO A;  6GSU A;  7GSS A;  3IV4 A;  1FOH A;  16GS A;  2A2S A;  3QD9 A;  2BMX A;  2VD1 A;  3FR9 A;  3F6F A;  4LL1 B;  2MYG A;  5ECH B;  2DJ2 A;  1YEP A;  4TN8 A;  5A5K A;  4TR4 A;  5CO3 A;  3ERF A;  2DLX A;  2VCX A;  5CNW A;  3EYT A;  5H5Q A;  5JCG A;  2DBC A;  3TRQ A;  1V98 A;  2FWE A;  5FWG A;  4GQC A;  2KOK A;  4ULX A;  5BMU B;  4WR5 A;  1GLQ A;  3GKK A;  2FCH A;  1XWC A;  5L71 A;  6GST A;  2H75 A;  1ZGN A;  5LCZ A;  1XVW A;  1A24 A;  5D9W A;  5KOX A;  4GSN A;  2H0I A;  1QK8 A;  2YWO A;  4KDX A;  4AGS A;  4AJ8 A;  1A8L A;  1EP8 A;  1SK0 A;  1YKA A;  3LYP A;  4IJ3 A;  1TU7 A;  2WUL A;  2CAQ A;  3VPQ A;  1QQ2 A;  4PQ1 A;  6GSY A;  4HQZ A;  4EDY A;  4HI7 A;  5ECN B;  4EDZ A;  1TDI A;  2OBK A;  1ERU A;  1K0A A;  2L6C A;  3IE3 A;  1GUH A;  3TKR A;  3US3 A;  4NWY A;  4K0G A;  4I5Q A;  1USB A;  3DIE A;  1AQV A;  3WT2 A;  2LS5 A;  1ZMA A;  1KBN A;  2G0F A;  2OT3 A;  2EIR A;  3IAS 2;  3I69 A;  1K0M A;  20GS A;  3UBK A;  1YVL A;  3MAK A;  4L5L A;  2HSN B;  1O7U A;  3KMN A;  1YEX A;  4NPB A;  1H4O A;  1WMJ A;  2FWH A;  2CA8 A;  1PSQ A;  3VWV A;  5J47 A;  1A2J A;  4ZBD A;  1WRY A;  4PGT A;  3DXB A;  5D9V A;  3KCM A;  3CTG A;  3GV1 A;  2KP2 A;  4AJ7 A;  1HYU A;  5B6N A;  5AIX A;  5H5R A;  1DE1 A;  4KCE A;  4HJ2 A;  4F82 A;  3BD2 A;  1U3A A;  4RI7 A;  3WGE A;  1A2L A;  3HD5 A;  2X8G A;  3J7Y k;  3E3E A;  3M9K A;  2IMD A;  4K0N A;  1R5A A;  1M2B A;  2OE3 A;  3EIN A;  4JU5 A;  2X8H A;  2IWT A;  4GSS A;  4XS6 A;  4BVX B;  5COH A;  3C71 A;  4F03 A;  1FOV A;  3GFK A;  3GL3 A;  1FHE A;  4XTS A;  1QGV A;  3IPZ A;  1G7E A;  2QSI A;  2CX3 A;  1ZYE A;  2JSZ A;  3WGX A;  1XW6 A;  2K8V A;  1F3B A;  1TP9 A;  1XPV A;  2H6Y A;  4WXT A;  3LWA A;  1S3D A;  3VFI A;  2F3M A;  2FY6 A;  1ZOF A;  1GUK A;  4X43 A;  1XWK A;  2C0E A;  2DIY A;  2GTU A;  1BG5 A;  4V2M A;  4DSR A;  1O8X A;  4MH3 A;  1GSE A;  3N9J A;  4YKF A;  4ICY A;  3QR6 A;  1KNG A;  1F2E A;  2RM5 A;  3NIV A;  3ED3 A;  1EGO A;  2V2G A;  4XS4 A;  2VLV A;  2HSY A;  1ZZY A;  2L5L A;  2LRC A;  3UAP A;  1U88 A;  2C3Q A;  4PXO A;  5J9B A;  4IP6 A;  2RII A;  3D4M A;  5G1L A;  3D4T A;  3KP8 A;  1ST9 A;  2MZC A;  4NV5 A;  4QL9 A;  2LRN A;  2EC4 A;  1DSB A;  3RAZ A;  1LU4 A;  1R7H A;  3R3E A;  1EEM A;  4ZIJ A;  3HHV A;  1E6B A;  4J2F A;  3UEM A;  4IKH A;  1MD4 A;  4IS0 A;  4Z2T A;  3GL5 A;  1FB6 A;  2IPA A;  3GHA A;  4MPG A;  1XWA A;  4HU9 A;  3M8N A;  3HJP A;  4K2D A;  2H72 A;  1R4W A;  2ZUP A;  3ME7 A;  3FW2 A;  4KND A;  1Y25 A;  1U87 A;  2VL9 A;  1EEJ A;  3QAG A;  3IRA A;  2G2Q A;  1XIY A;  2VAF A;  2ON5 A;  2VLU A;  4HJM A;  3HY2 A;  5C04 A;  3PPU A;  2WJU A;  5ENU A;  2WS2 A;  4JED A;  2HE3 A;  2V1M A;  4I97 A;  8GSS A;  2YWN A;  5J40 A;  2DKH A;  1J9B A;  4OCE A;  4K8M A;  3EMX A;  4HZ4 A;  9GSS A;  5B8B A;  5ECQ B;  3EPT A;  3PIN A;  5IMD A;  2DJ0 A;  3TKP A;  2YV9 A;  2VL2 C;  5F8B A;  4AKH A;  3TKQ A;  5DAK A;  1UC7 A;  1IYI A;  4USS A;  2QKE A;  3IK7 A;  3Q18 A;  5FT3 A;  3LXT A;  3WYW A;  3I9V 2;  4IGJ A;  4WKW A;  4I2T A;  3KJY A;  1PN9 A;  3TCO A;  3RHC A;  2PPT A;  3O6T A;  2H1G A;  1HNA A;  2XBQ A;  4AKX B;  5F07 A;  1N2A A;  3LFL A;  2A4H A;  2YOI A;  4MF5 A;  1OE7 A;  1T8E B;  3WD6 A;  3A2X A;  4NMU A;  4OFN A;  2B5Y A;  2LNT A;  2NBS A;  1SU9 A;  3IR4 A;  1BQ7 A;  1OAZ A;  1QXH A;  4ZB8 A;  3S9F A;  1EV4 A;  2MBS A;  1JZR A;  3TGZ A;  3ZFL A;  1WOU A;  4OWY A;  4CHS A;  3M9J A;  1JLV A;  4Q5Q A;  3DEX A;  1ON4 A;  4K7I A;  3IC4 A;  1M2A A;  1TJD A;  3GRX A;  4MJC A;  2CV4 A;  5F05 A;  3JCM L;  2K9F A;  2X49 A;  2H1A A;  2PMT A;  4EXJ A;  5A4V A;  2H73 A;  1DE2 A;  4L5O A;  4FYB A;  5G30 A;  3FMW A;  1FVJ A;  3P2A A;  4K9Z A;  2DKI A;  2KHP A;  2OBI A;  1TKD B;  4K7N A;  4ZL7 A;  3DVX A;  5JWO B;  1K0N A;  2B5E A;  1UA5 A;  1T1V A;  3VWW A;  2IMK A;  3RPP A;  2C0G A;  1RK4 A;  2N5A A;  1XOB A;  3KTL A;  4MP4 A;  2PBJ A;  1BJX A;  5IO2 A;  2HRK A;  2HNL A;  1OVN A;  2FWG A;  1Q4J A;  2VL3 A;  5D8I A;  2IL3 A;  2VM1 A;  2UV8 G;  2B1K A;  1XZO A;  2F51 A;  1EP7 A;  4KA0 A;  3SBC A;  4G2E A;  2XBI A;  3GMF A;  4W66 A;  1S3C A;  1PKW A;  3NZN A;  4KCA A;  3HVX A;  1VF1 A;  5ECI B;  2H76 A;  3A5W A;  2A4V A;  3FKF A;  3LXZ A;  1Z6M A;  3IC8 A;  5B7C A;  22GS A;  3BCK A;  4GST A;  4BVY A;  3QAV A;  1RQM A;  2E7P A;  2QGV A;  4YQV A;  5J41 A;  3DGQ A;  2H01 A;  3U5R E;  4NXI A;  1SKW B;  4V2N A;  1YQ1 A;  4WEY A;  2B3S A;  2AV4 A;  5G5F A;  2LV3 A;  1F37 A;  4BWQ A;  2F8F A;  2EFH A;  4NHZ A;  3E0U A;  2NDO A;  4DSQ A;  2CZ3 A;  2RUF A;  3IHG A;  4WF4 A;  3GN3 A;  4G0I A;  3VI5 A;  3RBT A;  4LL4 B;  1AC1 A;  2HRA A;  2LJA A;  3HVV A;  4MZW A;  3EE2 A;  2M80 A;  1WP0 A;  2GVP A;  4EVM A;  4MH2 A;  3UL3 A;  1GTA A;  1SKR B;  1FG4 A;  6GSS A;  2A2P A;  3MSZ A;  2YZH A;  4I6X A;  1T3B A;  4MJB A;  1ABA A;  4IN0 A;  5ECM B;  5JCW A;  2I4A A;  1PX6 A;  3L9U A;  1SK2 A;  4PNG A;  1TRS A;  3P90 A;  2DML A;  2HYX A;  2YAN A;  4D73 B;  1PKZ A;  5DCH A;  3A3T A;  4PUF C;  3LGC A;  4K7O A;  1VF2 A;  2IFQ A;  2VCV A;  1W89 A;  4LA1 A;  4GWR A;  4DVC A;  3AY8 A;  4LMW A;  1R26 A;  2KUC A;  2GGT A;  3GX0 A;  2LKU A;  2H66 A;  3F63 A;  3TJG A;  1Q98 A;  2YNX A;  2E0Q A;  3FZ5 A;  1WWJ A;  4AF2 A;  2X8C A;  2HZE A;  3TUE A;  1CQG A;  2DJ3 A;  3KTB A;  17GS A;  2ES7 A;  3G7Y A;  2CZ2 A;  3ERG A;  2LEG A;  4ZIL A;  1ZL9 A;  2V32 A;  4N30 A;  4EC0 A;  1O81 A;  2VLT A;  2EIO A;  2CX4 A;  3W6G A;  2O5V A;  4ZBB A;  3HXS A;  4N3Z A;  3APO A;  1M9B A;  3TJK A;  1A23 A;  2HZF A;  1PL2 A;  5IMV A;  3CXG A;  1SVO A;  1QUW A;  2VCZ A;  4ZB9 A;  4TRX A;  1XFL A;  3EC3 A;  5ID2 B;  3HCZ A;  5DJL A;  4OMV A;  5KN3 A;  4G9H A;  4MA9 A;  2K18 A;  2GT5 A;  2HSM B;  2QA2 A;  2L59 A;  2HRK B;  4Z7X A;  3HDC A;  3VI7 A;  2P5Q A;  3PGT A;  1BF5 A;  5ABR A;  1J0F A;  2XPD A;  4Q5N A;  1OE8 A;  2NPB A;  2QC7 A;  3KXO A;  4HQS A;  5KN2 A;  1V40 A;  4WR4 A;  5IOX A;  3LW9 A;  2YWM A;  2DJJ A;  4YH2 A;  2R0G A;  5J4V A;  2C8U A;  2H19 A;  2E2M A;  4LLR A;  2C0F A;  1JZD A;  2JZT A;  4IQA A;  2K8S A;  4ISD A;  3GX8 A;  3TKS A;  2HFD A;  2LJK A;  2WFC A;  4ID0 A;  4N10 A;  4RQR A;  4TKY A;  3CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...