1B48A

Crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
b'AAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRIVLKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Crystal structure of a murine glutathione S-transferase in complex with a glutathione conjugate of 4-hydroxynon-2-enal in one subunit and glutathione in the other: evidence of signaling across the dimer interface.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 74
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1b48A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b48A01
1FVJA 2VCWA 1R7HA 3FW2A 3KP9A 1OVNA 2TRCP 4ZL7A 1YDKA 4NPBA 2OE1A 4KDYA 5DBQA 5HR2A 3HJOA 3TJGA 1H75A 2O85A 3NZNA 4N0ZA 3RHCA 3IAS2 5DCHA 6GSUA 1QFNA 2ZNMA 2C0DA 1PX6A 1ERWA 3CMIA 5DALA 4MF6A 2P31A 1G7EA 1YZXA 2JZRA 2IMDA 4OMVA 5BMUA 3HKRA 3H79A 3DRNA 3ZVJD 3FEUA 3IAM2 1ON4A 3KCMA 4IW9A 3HVXA 2YCDA 1U88A 3RAZA 2GSQA 4IQ1A 4MH2A 4FQUA 4F0CA 2PPTA 2MBSA 2H66A 2A2RA 1V40A 2WCIA 4NXIA 1Z9HA 1ZYEA 4ZXGA 4BPYA 3J7Yb 3IK7A 2C0EA 2VLUA 1TP9A 2G2QA 2L4QA 2DJ1A 3KMOA 5KN0A 3KZQA 3LFLA 2FUG2 2H75A 1ZYQB 2K18A 1G6YA 1WJKA 3VPQA 1SJZA 2F51A 4HU7A 2H72A 1SK0A 2YN1A 2CX4A 1X0RA 3GH6A 5ECNB 2L6CA 4DSRA 3LQ7A 1T7PB 2HRKB 3D21A 2O8VB 4ML6A 6GSYA 2PVOC 3C1RA 3EMPA 1SK2A 1V57A 3TJKA 4ZL8A 1T3BA 2JACA 4EDYA 3ME8A 4AGSA 3ZIJA 3GV1A 2FGXA 4K6XA 3TKSE 1WIKA 3VLNA 3MAKA 1SU9A 1X5EA 4FH8A 5IM9A 1PKZA 4AF2A 4KA0A 1GH2A 1YKCA 3H8QA 4KUNA 3M3MA 2PBJA 2VCTA 2LQQA 4USSA 4EE0A 2GZZA 3W8JA 2HSHA 3I6AA 1H4OA 2LJRA 2WFCA 1TKDB 2YNXA 4GSNA 4POKA 1ERVA 5CRDA 1N8JA 2BTOT 5IMZA 2VL3A 3D4TA 5AISA 3D4MA 3LYKA 3UL3A 3DXBA 3APOA 4Q5RA 4P3YB 5JCUA 1G7OA 1ILOA 4DSSB 5ECSA 3PH9A 1ACVA 2CVKA 1F3AA 2V6OA 3VWVA 4ID0A 5A4VA 1GUMA 2NVLA 1Y25A 2MMNA 3GMFA 2IFQA 3DVXA 1X5DA 4HUAA 2I4AA 3IHQA 1OC3A 3GX8A 4IVFA 3F6DA 1ZCPA 4EKZA 2KP2A 1PL2A 1XVWA 6GSXA 1NHYA 2GGTA 2PMTA 3TKQA 5F06A 2VCXA 2ON5A 1O8WA 4ULXA 4XS6A 2YWNA 4IHUA 5FT3A 1GTIA 4G2EA 2VD0A 1BG5A 5CRWA 3GKKA 2X8GA 1NSWA 22GSA 3CSIA 5LNKe 2KOKA 2IN3A 1S3AA 4LL1B 4J56E 1V2AA 2DIZA 4EUYA 2FWGA 3AY8A 4K0NA 3D5JA 4LMWA 1OE8A 5ECRB 4KDUA 5IOWA 2H73A 1KEBA 5G31A 3QCPA 1FG4A 1GP1A 1B8XA 1B48A 1T4YA 4G19A 3QMXA 1GNWA 2V41A 3ME7A 2RM5A 4PUFC 1TI1A 4BWSA 2VLTA 3KD0A 4G0LA 4BL7B 3ZTLA 2WULA 1R5PA 2PVQA 1Z5YE 6GSSA 1MDIA 4CHSA 3G7IA 5ECQB 2F8FA 1FVKA 1YF0A 5G5EA 3HDCA 3KIJA 2VOCA 4Q5FA 1K3YA 2H6YA 2MMAA 3KXOA 1M9BA 4IJ3A 3MSZA 2YJ7A 3S9FA 4HZ2A 1KNGA 1X9MB 1ZOFA 3HY2A 2B1LA 4F82A 1UN2A 2HRKA 1PD21 4D73B 1SL2B 2GS3A 4RI7A 3NIVA 4KAEA 5LD0A 1EEJA 3UVHA 3TGZA 2PERA 3QR6A 4KCAA 3O76A 3APSA 3LYPA 1T4ZA 2FWEA 4ZBDA 5GSSA 1GUKA 4I97A 3C1SA 2WRTA 3VI5A 3RPPA 3CBUA 4HI7A 1O73A 4FIWA 5A4UA 1EOHA 2DC5A 1JHBA 1NM3A 1ZGNA 4MCUA 3L9SA 3NOFA 4WF5A 3PR8A 2G0FA 2VUPA 4POBA 1XWBA 4G0IA 1HNAA 18GSA 1GULA 2N5FA 1QMVA 3HZ4A 1ABAA 4EF0A 1O6JA 4GQCA 2HRNA 1FAAA 1R4WA 2H01A 2IPAA 1F2EA 1JZDA 3TUEA 1PA3A 1OKTA 2REMA 1Z6MA 2H1BA 5GZZB 3E0UA 3DGQA 3H1NA 1KBNA 1PRXA 3D0ZA 4HDEA 1BX9A 1A2LA 2C3TA 2L5LA 2P5QA 1VF4A 3HCZA 5B8BA 4MK3A 1M7TA 2GVPA 5DDLA 2GDRA 4F03A 2LQOA 4ZILA 3M1GA 4Q5NA 1WP0A 3ERFA 4X1UA 2K6VA 4J2FA 2H30A 20GSA 2V32A 3IRAA 2L5OA 3KMNA 3UBLA 1HD2A 1ERTA 1YY7A 2L6DA 4KW6A 2I81A 5IMFA 5JCWA 4XTSA 4K2DA 4CDOA 2IMKA 5LCZA 2CQ9A 1OC8A 2OE3A 4KGIA 2OA7A 5A5KA 5KN3A 1SJ6A 5KN2A 2UZ8A 2I3YA 3GX0A 2WB9A 2H0IA 1Q98A 2LRCA 2B1KA 5D9WA 5CRHA 3U5RE 1OC9A 1IYIA 1J9BA 4PQHA 2ON7A 5B6NA 4ECBA 2HLSA 1SJIA 2JU5A 4G9HA 4GF0A 4HZ4A 4O92A 4XRDA 3I9V2 4XHMA 2AJQB 2K9FA 3IPZA 3M0FA 4JE1A 1XW5A 5IIZA 1IYHA 1SKSB 5IOXA 4PQIA 3GSTA 3EINA 3L78A 2GTUA 3ERGA 2MYGA 5L71A 4MJAA 3TB2A 4GWRA 3DKSA 3RHBA 3F63A 4FYBA 3IDVA 1V98A 5IMAA 1G0TA 2L4CA 2JZTA 3EVIA 2TIRA 2LNSA 1FHEA 4QL7A 3PINA 5ENUA 2B7KA 3U6VA 2CAQA 4JEDA 3FY7A 3RDWA 1GL8A 4D73A 3TRQA 1GSFA 5F0GA 1SD8A 3IK9A 4OFTA 2QKEA 3WT2A 1Z6NA 2FD3A 2X99A 2YZUA 2DMLA 2LNTA 5IQYA 3F9UA 1A0RP 1EV9A 2PN8A 2HQTA 1BQ7A 2XBIA 1AUCA 5G30A 4TW5A 4K0GA 1TK5B 3GA4A 2P5RA 16GSA 2AUVA 3J7Yk 3IE3A 2M46A 3G9BA 1FB0A 2F9SA 2A4VA 1TU7A 3ZZXA 2YOIA 2WZ9A 4I2TA 4GXZA 4ZB6A 3CSJA 1YQ1A 5E4WA 1GTAA 2QC7A 2VAFA 4AJ7A 2IL3A 2RM6A 3D6IA 2H1GA 4V2NA 2XPEA 3ZRDA 3P2AA 4O5RA 2PU9C 1PX7A 4K7NA 1X5CA 1F37A 5DVBA 4L0UA 1NHOA 5AN1A 2H8LA 3A2VA 2OBIA 2HFDA 2RLIA 4N11A 4XS4B 4WR5A 1TW9A 2R4VA 4MZCA 1X9SB 4EDZA 4EC0A 4KNDA 5FWGA 7GSSA 2VCQA 1OKDA 1PL1A 4OFMA 1XOAA 3TJFA 5DJLA 1M2BA 2X64A 1ST9A 2YANA 2AB6A 2R5GA 3KH9A 4FO5A 2O87A 3WD6A 1TRSA 4POMA 4DVCA 3HVVA 2EIRA 3DIEA 3QDNA 1PSQA 3LORA 4TOPA 4DEJA 3N9JA 4MPGA 1K3LA 3G7YA 1Z7PA 2IIYA 1JZOA 1O85A 3IA1A 3CSHA 3GH9A 2HZEA 5J3RA 4YQVA 1QK8A 2LV3A 3GTUA 5H5QA 2IMEA 1GSYA 1AXDA 3US3A 1YKAA 3F4SA 5C04A 2NBSA 2KUCA 4GQFA 4KH7A 2DJ0A 4NWYA 2HRAA 3LWAA 2C8UA 3P8WA 3FZ9A 3LG6A 4O32A 3GKMA 2MZCA 4MJEA 3CXGA 5D8IA 1A2MA 2KP1A 3LXZA 2LJAA 4ZL9A 4LMVA 4JBBA 1EV4A 5DAKB 4WEYA 3DMLA 3GUSA 1EZKA 5ELAA 2HE3A 4EVMA 1AIUA 1YF1A 3CYNA 4TVEA 2GSTA 1SKRB 1FO5A 3F3RA 1J0FA 5GSTA 2GQKA 4N30A 2B5YA 2O89A 4HU9A 1AQVA 2X8CA 1XOBA 1URMA 2LUSA 5B6MA 3I43A 2OBKA 2L57A 2WS2A 2H76A 4K9ZA 3QAWA 4L8EA 1BAYA 1LBKA 3VWUA 1MD3A 3M8NA 4ZB8A 1UC7A 1GTUA 4HQZA 2LTKA 1S3DA 3KM6A 12GSA 3EMXA 3ZMLA 2DMMA 1DUGA 6GSWA 1EGOA 4OFNA 2FA8A 3KEBA 4I6XA 3HHVA 4HS1A 5HR3A 4IS0A 1QXHA 1DE2A 2GZPA 2VL9A 1WRYA 2ZUPA 13GSA 1ML6A 3W6GA 2VM1A 2HRFA 3ERWA 3VI7A 4BVXB 4MH3A 3FR9A 3QAGA 3R2QA 1Z3EA 4YQUA 4MZWA 4WETA 1TK8B 1OC9B 4JU5A 1MEKA 4JR4A 4N10A 1MDKA 1I9DA 1YJ6A 1F6MC 1X9WB 4PXOA 2H19A 3MNGA 4KSMA 3R3EA 3KP8A 4XS4A 4PUAA 4JZQA 4PTSA 1XWGA 2H0GA 1DBYA 1THOA 3C71A 4HOJA 2LRTA 3FRCA 3WGEA 3GL3A 3HJMA 4RQRA 2FHEA 1WE0A 4KX4A 2XHFA 2R3XA 1RK4A 4F0BA 1K0BA 3FHKA 4NHZA 4GSSA 2H6XA 2EC4A 3LSZA 3FR6A 5INYA 4MABA 4PX1A 2K8SA 3UBKA 1NW2A 1XBSA 4PGTA 2FNOA 3GURA 3CRUA 3WGXA 2HSYA 2IMIA 4Z7XA 1B9XC 1W89A 3GL5A 5ID2A 1XPVA 3L4NA 4MP4A 2AYTA 4K7OA 4MJCA 5D93A 2XPDA 4EXJA 3IXRA 1AQWA 1XCCA 2F8AA 3QFAC 3SBCA 2RIIA 3C8EA 5D9VA 4ZBAA 1PQNA 2HZFA 2I1UA 4X43A 4AJ8A 1B4QA 1N2AA 1QUWA 3A3TA 1O7UA 6GSTA 2E7PA 1JLVA 4TXOB 2LJKA 4NHWA 3KJYA 2F3MA 3Q19A 2Z9SA 2C80A 3VURA 5DAKA 3DWVA 3HZ8A 1K0CA 2B7JA 1ERUA 2B5XA 4F2IA 1SD9A 2CA8A 1LJRA 1R26A 4PNFA 4GSTA 5FHIA 4E8HA 1BYEA 2I9HA 4BWQA 4YAPA 1T00A 3ZMKA 3C7MA 4AJ6A 5DJMA 2AAWA 2WJUA 4IGJA 1FB6A 6GSVA 2KHPA 5HFGA 3MDKA 3F8UA 1THXA 4V1Ap 3PGTA 4OO4A 4K1FA 1GRXA 1A0FA 5D96A 5IO0A 3GHAA 1TU8A 17GSA 1K0DA 1A8LA 1F9MA 3BD2A 2YV7A 1ZZYA 4ECCA 3DVWA 2VM2A 1UVZA 1FW1A 3IV4A 2GT6A 3V1WA 4L5LA 3KGKA 3QD9A 2VCVA 2PGTA 5G1LA 2HYXA 3M9KA 3IR4A 2DJKA 2D2ZA 5AGYA 5ECLB 1AC1A 4WF4A 3APQA 2C1YA 2GT5A 5F05A 3GRXA 4OCEA 1TRWA 2DJ2A 4N0VA 1E6BA 3M9JA 4IELA 3TKSC 2C3NA 3UIWA 4BVXA 3C73A 4WBRD 4TR0A 1KTEA 2CVDA 3LEFA 3P90A 2HZEB 2JL4A 2CV4A 2OJLA 3GTUB 3HYPA 3EU3A 3CRTA 2O7KA 1U3IA 4HJMA 3VPTA 2N5BA 3FZ5A 3TKSA 1ZMAA 5HQPA 1SL0B 3F6FA 1EWXA 4POLA 3ED3A 1A2JA 1XZOA 3A2XA 1TXXA 3TKPA 1GTBA 4TKYA 2X8HA 4HEA2 5JWOB 4KB3A 3QPMA 1OE7A 2JSYA 4ZIJA 5F07A 2DBCA 1XWAA 4V1Ag 2GQMA 1JZRA 2GQLA 3BCIA 1MTCA 1M99A 4KF9A 3F0IA 1AW9A 1HQOA 1M2DA 3SWLA 5AIVA 2KLXA 2BMXA 3E3EA 3GKNA 3GN3A 2YWOA 2ALBA 5JCGA 5D9XA 2E2GA 4H86A 1CQHA 2OE0A 4MF5A 3QFBC 1T1VA 5JWQB 2B6MA 4GLTA 5CO3A 4TR4A 4TR1A 4I8BA 2ZCTA 4I2UA 3ZLPA 4XS1A 9GSSA 3VK9A 4RI6A 2NTOA 5IMVA 3D22A 4TXOA 5IMDA 2DIYA 5ABRA 2WDUA 1Z7RA 1GSDA 2FY6A 1PKWA 3VWWA 2M72A 4BA7A 3H93A 2MMZA 3FZ4A 3A2WA 3Q6OA 3RBTA 2R6KA 1VRSD 1C72A 2LRNA 1PN9A 2VIMA 2VLVA 4JR6A 5EVOA 1AAZA 3EWLA 5D9TA 2C0FA 4RQXA 4G0KA 4EL1A 2V2GA 4HQSA 5J5NA 4LLRA 1SL1B 5DQYA 5KEJA 3FYGA 1GLPA 1VF2A 5G1KA 1TK0B 5D73A 1R5AA 3EU4A 1BEDA 4WBJA 4K7IA 2XC2A 2GSSA 1B4PA 5J41A 5HFIA 4O7HA 2VL2C 2AHEA 3HJPA 1BJXA 2J9HA 1RQMA 4LL4B 1SKWB 5ECIB 2QGVA 2XBQA 5ID2B 3UJ1A 3PPUA 3EC3A 4FYUA 4ECJA 4IBPA 2JZSA 4YH2A 3TOTA 3H4KA 3LGCA 5G5FA 2EIQA 1DE1A 2VL2A 1FOVA 1OAZA 1GWCA 3QAVA 5J9CA 1EGRA 1Q4JA 3K8NA 1PGTA 3RPNA 3HA9A 3P7XA 5CYYA 3O3TA 2DJ3A 8GSSA 2YWMA 1T8EB 4LA1A 1GSUA 4IP6A 4KE3A 4QQ7A 2AV4A 4IQAA 3UMAA 4F9ZA 3LXTA 4MLYA 2HSMA 4MZBA 3L9VA 4FYCA 4OO5A 2RUEA 1XXUA 3TOUA 1PMTA 2MBTA 1TRUA 1MDJA 1A23A 2HI7A 2IJYA 3FKFA 4E8EA 5HFKA 2CZ3A 1XW9A 1TDIA 1W4VA 2CX3A 4BVYA 2YPMA 2OADA 1GSQA 3WYWA 3GNJA 1WOUA 2VD1A 4IJIA 1EP8A 2WGRA 5IMCA 1TOFA 2H1DA 4J57E 4L0WA 2GLRA 2K8VA 4ZB9A 2H71A 5IPHA 2N5AA 4NV2A 3WT1A 1K3OA 2HT9A 3GKXA 2C3QA 4MDCA 1LU4A 3DEXA 3FR3A 1JZWA 2FLSA 2YV9A 4I5QA 5J9BA 4IN0A 3ZFBA 4PQ1A 4ZBBA 2DLXA 4PURA 2NDOA 3BJ5A 1QGVA 3UOMA 3IC4A 4V2LA 2EIOA 3ZFLA 1YEXA 1S3CA 4MMMA 1VF3A 3UEMA 3ZYWA 2B5EA 2BJXA 1EEMA 1SK1A 1SYXA 1ZL9A 1GSSA 3I69A 5CNWA 5G2ZA 2MMOA 5C00A 4V2MA 5EY6A 1WMJA 3ISOA 1U6TA 4GTUA 4MJBA 3GIXA 2CVBA 3TJJA 5J4UA 1AQXA 4PNGA 2C4JA 5GAPD 5CAXA 1U87A 2TRXA 1E2YA 3A5WA 4MA9A 2RUFA 3Q18A 5HR0A 2YJHA 3TDGA 4TR3A 11GSA 4ECIA 4YAVA 2FWFA 2LKUA 2PWJA 5JWRB 3HD5A 3GYKA 2GZYA 3UAPA 4WR4A 3ZITA 1B9YC 3KTBA 3ZVJA 1EOGA 2M80A 4WXTA 3TKRA 3FK8A 2E2MA 4KDXA 2FA4A 3L9UA 4TXVA 5ECPB 1A8YA 2IWTA 3FZAA 14GSA 4YQMA 4ACSA 10GSA 1QQ2A 1YEPA 1HYUA 19GSA 4TR1B 1TI3A 3F3QA 1EP7A 4JRRA 2FCHA 3TJBA 1K0MA 2R2JA 4EO3A 4GRFA 4RUVA 4ILFA 3KH7A 5EL8A 1HNBA 4OD7A 4KCEA 1XW6A 2H1AA 4TN8A 3O6TA 4OWYA 2E0QA 1K0AA 2DJJA 1DSBA 1OYJA 1WPIA 2H74A 2OKAA 3EE2A 3WGDA 4XIHA 2GSRA 5ECKB 4NMUA 1SENA 2ES7A 1V58A 4MF7A 4OCFA 3JCML 2A2SA 1O8XA 1VF1A 3UARA 5DALB 2H6ZA 3QOUA 5KN1A 1M2AA 1GUHA 1USBA 1K0NA 5IO2A 5DQSA 1GNEA 3L0HA 3W8SA 4NV5A 1K0OA 4GCIA 3MWHA 3CTGA 4DSSA 2L59A 2HSNB 3IBHA 1Y6EA 1TJDA 2VCZA 3BOAA 4Q5QA 2DSAA 5B7CA 1J08A 4ML1A 2OACA 2J23A 3TRXA 4DSQA 3HXSA 2YWIA 4WKWA 3OR5A 1SYRA 2LSTA 3F4TA 2JADA 1GSEA 5ECHB 3BBYA 1M9AA 3Q74A 2PUKC 5H5SA 1G6WA 2CZ2A 2CAIA 2LEGA 5A4WA 5H5RA 4L5OA 1M0UA 5F8BA 4NAXA 2FWHA 2V6KA 3TRPA 5CREA 2P0GA 5ELGA 1O81A 5DCGA 1TTZA 2IMFA 5E59A 3E9JB 2QSIA 2LS5A 3DD3A 4K8MA 3EURA 5HR1A 5B8AA 2H70A 2HNLA 5COHA 4KSOA 2HXKA 1RW1A 1V9WA 3EYTA 1XIYA 3LJRA 4HJ2A 1JLWA 4XCSA 1XFLA 1U3AA 2HSMB 4QL9A 3DYRA 3TCOA 5AIXA 3ZREA 4X0XA 1XWKA 3IOSA 2YZHA 5ECMB 4ISDA 3UVTA 4BL7A 2CT6A 1A24A 3N5OA 1XWCA 3CTFA 5ECOB 5GAND 4MPFA 5EPFA 1TRVA 4IP1A 3ZIVA 3GSSA 3GFKA 5IPGA 2YP6A 4BVYB 2JSZA 4TRXA 3IC8A 1WWJA 3BCKA 1HNCA 1MD4A 1VGLA 3HVSA 3VWXA 1CQGA 2NPBA 2R37A 1I5GA 2B3SA 1GLQA 4G10A 3F4RA 2VO4A 1JFUA 2C0GA 3VFIA 2H0HA 4XRAA 5CP1A 4CW9A 1XVQA 3ZL5A 3KTLA 4IKHA 2IFQB 3G7JA 2V1MA 1F3BA 5CRGA 1UA5A
chains in the Genus database with same CATH superfamily
1FVJA 2VCWA 1R7HA 3FW2A 3KP9A 1OVNA 4MNNA 2TRCP 4ZL7A 1YDKA 4NPBA 2OE1A 4KDYA 5DBQA 5HR2A 3HJOA 3TJGA 1H75A 2O85A 3NZNA 4N0ZA 3RHCA 3IAS2 5DCHA 6GSUA 1QFNA 2ZNMA 2C0DA 1PX6A 1ERWA 3CMIA 5DALA 4MF6A 2P31A 1G7EA 1YZXA 2JZRA 2IMDA 4OMVA 5BMUA 3HKRA 3H79A 3DRNA 3ZVJD 3FEUA 3IAM2 1ON4A 3KCMA 4IW9A 3HVXA 2YCDA 1U88A 2HSNA 3RAZA 2GSQA 4IQ1A 4MH2A 4FQUA 4F0CA 2PPTA 2MBSA 2H66A 2A2RA 1V40A 2WCIA 4NXIA 1Z9HA 1ZYEA 4ZXGA 4BPYA 3J7Yb 3IK7A 2C0EA 2VLUA 1TP9A 2DKHA 2G2QA 1YEWC 2L4QA 2DJ1A 3KMOA 5KN0A 3KZQA 3LFLA 2FUG2 2H75A 1ZYQB 2K18A 1G6YA 1WJKA 3VPQA 1SJZA 2F51A 4HU7A 2H72A 1SK0A 2YN1A 2CX4A 2H1LA 1X0RA 3GH6A 5ECNB 2L6CA 4ICYA 4DSRA 3LQ7A 1T7PB 2HRKB 3D21A 2O8VB 4ML6A 6GSYA 2PVOC 3C1RA 3EMPA 1SK2A 1V57A 3TJKA 4ZL8A 1YVLA 1T3BA 2JACA 2WVYA 4PI2C 4EDYA 3ME8A 4AGSA 3ZIJA 3GV1A 2FGXA 4K6XA 3TKSE 1WIKA 3VLNA 3MAKA 1SU9A 1X5EA 4FH8A 5IM9A 1PKZA 4AF2A 4KA0A 1GH2A 1YKCA 5J4YA 3H8QA 4KUNA 3M3MA 2PBJA 2VCTA 2EFHA 2LQQA 4USSA 4EE0A 2GZZA 3W8JA 2HSHA 3I6AA 1H4OA 2LJRA 2WFCA 1TKDB 2YNXA 4GSNA 2X4AA 4POKA 1ERVA 4Z2TA 5CRDA 1N8JA 2BTOT 5IMZA 2VL3A 3D4TA 5AISA 3D4MA 3LYKA 3UL3A 3DXBA 3APOA 4Q5RA 4P3YB 5JCUA 1G7OA 1ILOA 4DSSB 5ECSA 3PH9A 1ACVA 2CVKA 1F3AA 2V6OA 3VWVA 4ID0A 5A4VA 1GUMA 2NVLA 1Y25A 2MMNA 3GMFA 2IFQA 3DVXA 1X5DA 4HUAA 2I4AA 3IHQA 1OC3A 3GX8A 4IVFA 3F6DA 1ZCPA 4EKZA 2WZSA 2KP2A 1PL2A 1XVWA 1ZYNA 6GSXA 1NHYA 2GGTA 2PMTA 3TKQA 5F06A 2VCXA 2ON5A 1O8WA 4ULXA 4XS6A 2YWNA 3MIXA 4IHUA 5FT3A 2A4HA 1GTIA 4G2EA 2VD0A 1BG5A 5CRWA 2WW1A 3GKKA 2X8GA 1NSWA 22GSA 3CSIA 5LNKe 2KOKA 2IN3A 1S3AA 4W66A 4LL1B 4J56E 1V2AA 5KOXA 2DIZA 4EUYA 2FWGA 3AY8A 4K0NA 3D5JA 4LMWA 1OE8A 5ECRB 4KDUA 5IOWA 2H73A 1KEBA 5G31A 3QCPA 1FG4A 1GP1A 1B8XA 1B48A 1T4YA 4G19A 1GNWA 2V41A 3QMXA 3ME7A 2RM5A 4PUFC 1TI1A 4BWSA 2VLTA 3KD0A 4G0LA 4BL7B 3ZTLA 2WULA 1R5PA 2PVQA 1Z5YE 6GSSA 1MDIA 4CHSA 3G7IA 5ECQB 2F8FA 1FVKA 1YF0A 5G5EA 3HDCA 3KIJA 2VOCA 4Q5FA 1K3YA 4K2XA 2H6YA 2MMAA 3KXOA 1M9BA 4IJ3A 3MSZA 2YJ7A 3S9FA 4HZ2A 1S4BP 1KNGA 1X9MB 1ZOFA 3HY2A 2B1LA 4F82A 1UN2A 2HRKA 1PD21 4D73B 1SL2B 2GS3A 4RI7A 3NIVA 1S3RA 4KAEA 5LD0A 1EEJA 3UVHA 3TGZA 1M3JA 2PERA 3QR6A 4KCAA 3O76A 3APSA 3LYPA 1T4ZA 4N3ZA 2FWEA 4ZBDA 5GSSA 1GUKA 4I97A 3C1SA 2WRTA 3VI5A 3RPPA 3CBUA 4HI7A 1O73A 4FIWA 5A4UA 1EOHA 2DC5A 1JHBA 1NM3A 1ZGNA 4MCUA 3L9SA 3RFRC 3NOFA 4WF5A 4HSCX 3PR8A 2G0FA 2VUPA 4POBA 1XWBA 4G0IA 1HNAA 18GSA 1GULA 2N5FA 1QMVA 3HZ4A 1ABAA 4EF0A 1O6JA 4GQCA 2HRNA 1FAAA 1R4WA 1SVOA 2H01A 2IPAA 1F2EA 1JZDA 3TUEA 1PA3A 1OKTA 2REMA 1Z6MA 2H1BA 5GZZB 3E0UA 3DGQA 3H1NA 4E68A 1KBNA 1PRXA 3D0ZA 5BMUB 4HDEA 2QA2A 1BX9A 2P5QA 2C3TA 1A2LA 2L5LA 1VF4A 3HCZA 5B8BA 4MK3A 1M7TA 2GVPA 5DDLA 2GDRA 4F03A 2LQOA 4ZILA 3M1GA 4Q5NA 1WP0A 3ERFA 4X1UA 2K6VA 4J2FA 2H30A 20GSA 2V32A 3IRAA 2L5OA 3KMNA 3UBLA 1HD2A 1ERTA 1YY7A 2L6DA 4KW6A 2I81A 5IMFA 4PI0C 5JCWA 2O5VA 4XTSA 4K2DA 4CDOA 2IMKA 5LCZA 2CQ9A 1OC8A 2OE3A 4KGIA 2OA7A 5A5KA 5KN3A 1SJ6A 5KN2A 2UZ8A 2I3YA 3GX0A 2WB9A 2H0IA 2WW3A 5J40A 1Q98A 2LRCA 2B1KA 5D9WA 1PN0A 5CRHA 3U5RE 1OC9A 1IYIA 1J9BA 4PQHA 2ON7A 5B6NA 4ECBA 2HLSA 1SJIA 2JU5A 4G9HA 4GF0A 4HZ4A 4O92A 4XRDA 3I9V2 3CQFA 4XHMA 2AJQB 1TXUA 2K9FA 3IPZA 3M0FA 4JE1A 1XW5A 5IIZA 1IYHA 1SKSB 5IOXA 4PQIA 3GSTA 3EINA 4YKFA 3L78A 2GTUA 4AI6A 3ERGA 2MYGA 5L71A 4MJAA 3TB2A 4GWRA 3DKSA 3RHBA 3F63A 4FYBA 3IDVA 1V98A 5IMAA 1G0TA 2L4CA 2JZTA 3EVIA 2TIRA 2LNSA 1FHEA 4QL7A 3PINA 3LW9A 5ENUA 2B7KA 3U6VA 2CAQA 4JEDA 3FY7A 3RDWA 1GL8A 4D73A 3TRQA 4A5PA 1GSFA 5F0GA 1SD8A 3IK9A 4OFTA 2O36A 2QKEA 3WT2A 1Z6NA 2FD3A 2X99A 2YZUA 1FOHA 2DMLA 2LNTA 5IQYA 3F9UA 1A0RP 1EV9A 2PN8A 2HQTA 1BQ7A 2XBIA 1AUCA 5G30A 4TW5A 4K0GA 1TK5B 3GA4A 2P5RA 16GSA 2AUVA 3J7Yk 3IE3A 2M46A 3G9BA 1FB0A 2F9SA 2A4VA 1TU7A 3ZZXA 2YOIA 2WZ9A 4I2TA 4GXZA 4ZB6A 3CSJA 1YQ1A 5E4WA 1GTAA 2QC7A 2VAFA 4AJ7A 2IL3A 2RM6A 3D6IA 2H1GA 4V2NA 2DKIA 4YKGA 2XPEA 3ZRDA 3P2AA 4O5RA 2PU9C 1PX7A 4K7NA 3CHXC 1X5CA 1F37A 5DVBA 4L0UA 1NHOA 5AN1A 2H8LA 2O3EA 3A2VA 2OBIA 2EFDA 2HFDA 2RLIA 4N11A 4XS4B 4WR5A 1TW9A 2R4VA 4MZCA 1X9SB 4EDZA 4EC0A 4KNDA 5FWGA 7GSSA 2VCQA 1OKDA 1PL1A 4OFMA 1XOAA 3TJFA 5DJLA 1M2BA 2X64A 1ST9A 2YANA 2AB6A 2R5GA 3KH9A 4FO5A 2O87A 3WD6A 1TRSA 4POMA 4DVCA 3HVVA 2A2PA 2EIRA 3DIEA 3QDNA 1PSQA 3LORA 4TOPA 4DEJA 5J47A 3N9JA 4MPGA 1K3LA 4AKXB 5BRTA 3G7YA 1Z7PA 2IIYA 1JZOA 1O85A 3IA1A 3CSHA 3GH9A 2HZEA 5J3RA 4YQVA 1QK8A 2LV3A 3GTUA 1N25A 5H5QA 2IMEA 1GSYA 1AXDA 3US3A 1YKAA 3F4SA 5C04A 2NBSA 2KUCA 4GQFA 4KH7A 2DJ0A 4NWYA 2HRAA 3LWAA 2C8UA 3P8WA 2X49A 3FZ9A 3LG6A 4O32A 3GKMA 2MZCA 4MJEA 3CXGA 5D8IA 1A2MA 2KP1A 3LXZA 2LJAA 4ZL9A 4LMVA 4JBBA 1EV4A 5DAKB 4WEYA 3DMLA 3GUSA 1EZKA 5ELAA 2HE3A 4EVMA 1AIUA 1YF1A 3CYNA 5KOWA 4TVEA 2GSTA 2WW0A 1SKRB 1FO5A 3F3RA 1SVMA 3TU3B 1J0FA 5GSTA 2GQKA 4N30A 2B5YA 2O89A 4HU9A 1AQVA 2X8CA 1XOBA 1URMA 2LUSA 5B6MA 3I43A 2OBKA 2L57A 2WS2A 2H76A 4K9ZA 3QAWA 4L8EA 1BAYA 1LBKA 3VWUA 1MD3A 3M8NA 4ZB8A 1UC7A 1GTUA 4HQZA 1XG8A 2LTKA 1S3DA 3KM6A 12GSA 3EMXA 3ZMLA 2DMMA 1DUGA 6GSWA 1EGOA 4OFNA 2FA8A 3KEBA 4I6XA 3HHVA 4HS1A 5HR3A 2WW2A 4IS0A 1QXHA 1DE2A 2GZPA 2VL9A 1WRYA 2ZUPA 13GSA 1ML6A 3W6GA 2VM1A 2HRFA 3ERWA 3VI7A 2WVZA 4BVXB 4MH3A 3FR9A 3QAGA 3R2QA 1Z3EA 4YQUA 4MZWA 4WETA 1TK8B 1OC9B 4JU5A 1MEKA 2R0PA 4JR4A 4N10A 1MDKA 1I9DA 1YJ6A 1F6MC 1X9WB 4FXYP 4PXOA 2H19A 3MNGA 4KSMA 3R3EA 3KP8A 4XS4A 5A5HB 4PUAA 4JZQA 4PTSA 1XWGA 2H0GA 1DBYA 1THOA 3C71A 4HOJA 2LRTA 3FRCA 3WGEA 3GL3A 3HJMA 4Z2RA 4RQRA 2FHEA 1WE0A 4KX4A 1ZYPA 2XHFA 2R3XA 1RK4A 4F0BA 1K0BA 3FHKA 4NHZA 4GSSA 2H6XA 2EC4A 3LSZA 3FR6A 5INYA 4MABA 4G01A 4PX1A 2K8SA 3UBKA 1NW2A 1XBSA 4PGTA 2FNOA 3GURA 3CRUA 3WGXA 2HSYA 2IMIA 4Z7XA 1B9XC 1W89A 3GL5A 5ID2A 1XPVA 1I1IP 3L4NA 2R0GA 4AKHA 4MP4A 2AYTA 4K7OA 4MJCA 5D93A 2XPDA 4EXJA 2EFEA 3IXRA 1AQWA 1XCCA 2F8AA 3QFAC 3SBCA 2RIIA 3C8EA 5D9VA 4ZBAA 1PQNA 2HZFA 2I1UA 4X43A 4AJ8A 1B4QA 1N2AA 3HMJG 1QUWA 3A3TA 1O7UA 6GSTA 2E7PA 1JLVA 4TXOB 2LJKA 4NHWA 3KJYA 2F3MA 3Q19A 2Z9SA 2C80A 3VURA 5DAKA 3DWVA 3HZ8A 1K0CA 2B7JA 4O5UA 1ERUA 2B5XA 4F2IA 1SD9A 2CA8A 1LJRA 1R26A 4CY6A 4PNFA 4GSTA 1Y1UA 5FHIA 4E8HA 1BYEA 2I9HA 4BWQA 4YAPA 1T00A 3ZMKA 3C7MA 4AJ6A 5DJMA 2AAWA 2WJUA 4IGJA 1FB6A 6GSVA 2KHPA 5HFGA 3MDKA 3F8UA 1THXA 4V1Ap 3PGTA 4OO4A 4K1FA 1GRXA 1A0FA 5D96A 5IO0A 4AKGA 3GHAA 1TU8A 17GSA 1K0DA 1A8LA 1F9MA 3BD2A 2YV7A 1ZZYA 4ECCA 3DVWA 2VM2A 1UVZA 1FW1A 3IV4A 2GT6A 3V1WA 4L5LA 3KGKA 3QD9A 2VCVA 4X4JA 2PGTA 5G1LA 2HYXA 4ZB7A 3M9KA 3IR4A 2DJKA 2D2ZA 5AGYA 5ECLB 1AC1A 4WF4A 3APQA 2C1YA 2GT5A 5F05A 3GRXA 4OCEA 1TRWA 2DJ2A 4N0VA 1E6BA 3M9JA 4IELA 3TKSC 2C3NA 3UIWA 4BVXA 3C73A 4WBRD 4TR0A 1KTEA 2CVDA 3LEFA 3P90A 2HZEB 2JL4A 2CV4A 2OJLA 3GTUB 3HYPA 3EU3A 3CRTA 2O7KA 1U3IA 4HJMA 3VPTA 2N5BA 3FZ5A 3TKSA 1ZMAA 5HQPA 1SL0B 3F6FA 1EWXA 5A5HA 4POLA 3ED3A 1A2JA 1XZOA 3A2XA 1TXXA 2OT3A 3TKPA 1GTBA 4TKYA 2X8HA 4HEA2 5JWOB 4KB3A 3QPMA 1OE7A 2JSYA 4ZIJA 5F07A 2DBCA 1XWAA 4V1Ag 2GQMA 1JZRA 2GQLA 3BCIA 1MTCA 1M99A 4KF9A 3F0IA 1AW9A 1HQOA 1M2DA 3SWLA 5AIVA 2KLXA 2BMXA 4K5RA 3E3EA 3GKNA 3GN3A 2YWOA 2ALBA 5JCGA 5D9XA 2E2GA 4H86A 1CQHA 2OE0A 4MF5A 2EFCA 3QFBC 1T1VA 5JWQB 2B6MA 4GLTA 5CO3A 4TR4A 4TR1A 4I8BA 2ZCTA 4I2UA 3ZLPA 4XS1A 9GSSA 3VK9A 3MYDA 4RI6A 2NTOA 5IMVA 3D22A 4TXOA 5IMDA 2DIYA 5ABRA 2WDUA 1Z7RA 1GSDA 2FY6A 3IHGA 1PKWA 3VWWA 2M72A 3HVNA 4BA7A 3H93A 2WVXA 2MMZA 3FZ4A 3A2WA 3Q6OA 3RBTA 2R6KA 1VRSD 1C72A 2LRNA 1PN9A 2VIMA 3A5IA 2VLVA 4JR6A 5EVOA 1AAZA 3EWLA 5D9TA 2C0FA 4RQXA 4G0KA 4EL1A 2V2GA 4HQSA 5J5NA 4LLRA 1SL1B 5DQYA 5KEJA 3FYGA 1GLPA 1VF2A 5G1KA 1TK0B 5D73A 1R5AA 3EU4A 1BEDA 5J4VA 4WBJA 4K7IA 4K5SA 2XC2A 2GSSA 1B4PA 5J41A 5HFIA 4O7HA 2VL2C 2AHEA 3HJPA 1BJXA 2J9HA 1RQMA 4LL4B 1SKWB 5ECIB 2QGVA 2XBQA 5ID2B 3UJ1A 3PPUA 3EC3A 4FYUA 4ECJA 4IBPA 2JZSA 4YH2A 4BIKA 3TOTA 3H4KA 3LGCA 5G5FA 2EIQA 1DE1A 2VL2A 1FOVA 1OAZA 1GWCA 3QAVA 5J9CA 1EGRA 1Q4JA 1PFOA 3K8NA 1PGTA 4GDFA 3RPNA 3HA9A 3P7XA 5CYYA 3O3TA 2DJ3A 8GSSA 2YWMA 1T8EB 4LA1A 1GSUA 4IP6A 4KE3A 4QQ7A 2AV4A 4IQAA 3UMAA 4F9ZA 3LXTA 4MLYA 2HSMA 3CWGA 4MZBA 4CY8A 3L9VA 4FYCA 4OO5A 2RUEA 1XXUA 3TOUA 1PMTA 2MBTA 1TRUA 1MDJA 1A23A 2HI7A 2IJYA 3FKFA 4E8EA 5HFKA 2CZ3A 1XW9A 1TDIA 1W4VA 2CX3A 4BVYA 2YPMA 2OADA 1GSQA 3WYWA 3GNJA 1WOUA 2VD1A 4IJIA 1EP8A 2WGRA 5IMCA 1TOFA 2H1DA 3FMWA 4J57E 4L0WA 1BG1A 2GLRA 2K8VA 3RGBC 4ZB9A 2H71A 5IPHA 2N5AA 4NV2A 3WT1A 1K3OA 2HT9A 3GKXA 2C3QA 4MDCA 1LU4A 3DEXA 3FR3A 1JZWA 2FLSA 2YV9A 4I5QA 5J9BA 4IN0A 3ZFBA 4PQ1A 4ZBBA 2DLXA 4PURA 2NDOA 3BJ5A 1QGVA 3UOMA 3IC4A 4EIPA 4V2LA 2EIOA 3ZFLA 1YEXA 5A34B 1S3CA 4MMMA 1VF3A 3UEMA 3ZYWA 2B5EA 2BJXA 1EEMA 1SK1A 1SYXA 1ZL9A 1GSSA 3I69A 5CNWA 5G2ZA 2MMOA 5C00A 4V2MA 5EY6A 1WMJA 5A1NB 3ISOA 1U6TA 4GTUA 4MJBA 3GIXA 2CVBA 3TJJA 5J4UA 1AQXA 4PNGA 2C4JA 5GAPD 5CAXA 1U87A 2TRXA 1E2YA 3A5WA 4MA9A 2RUFA 3Q18A 5HR0A 2YJHA 3TDGA 4TR3A 11GSA 4ECIA 4YAVA 2FWFA 2LKUA 2PWJA 5JWRB 3HD5A 3GYKA 2R0CA 2GZYA 3UAPA 4WR4A 3ZITA 1B9YC 3KTBA 3ZVJA 1EOGA 2M80A 4WXTA 3TKRA 2QA1A 3FK8A 2E2MA 4KDXA 2FA4A 3L9UA 4TXVA 5ECPB 1A8YA 2IWTA 3FZAA 14GSA 4YQMA 4ACSA 10GSA 3EPTA 1QQ2A 1YEPA 1HYUA 19GSA 4TR1B 1TI3A 3F3QA 1EP7A 2VKZG 4O5QA 4JRRA 2FCHA 3TJBA 1K0MA 2R2JA 4EO3A 4GRFA 4RUVA 4ILFA 3KH7A 5EL8A 1HNBA 4OD7A 4KCEA 1XW6A 1SVLA 2H1AA 4TN8A 3O6TA 4OWYA 2E0QA 1K0AA 2DJJA 1DSBA 2WVXB 1OYJA 1WPIA 2H74A 2OKAA 3EE2A 3WGDA 4XIHA 2GSRA 5ECKB 4NMUA 1SENA 2ES7A 1V58A 4MF7A 4OCFA 3JCML 2A2SA 1O8XA 1VF1A 3UARA 5DALB 2H6ZA 3QOUA 5KN1A 1M2AA 1GUHA 1USBA 1K0NA 5IO2A 5DQSA 1GNEA 3L0HA 3W8SA 4NV5A 1K0OA 4GCIA 3MWHA 3CTGA 4DSSA 2L59A 2HSNB 3IBHA 1Y6EA 1TJDA 2VCZA 1BF5A 3BOAA 4Q5QA 2DSAA 5B7CA 1J08A 4ML1A 2OACA 2J23A 3TRXA 4DSQA 3HXSA 2YWIA 4WKWA 3OR5A 1SYRA 2LSTA 3F4TA 2JADA 4PHZC 1GSEA 5ECHB 3BBYA 1M9AA 3Q74A 2PUKC 5H5SA 1G6WA 2CZ2A 2CAIA 2LEGA 5A4WA 5H5RA 4AKIA 4L5OA 1M0UA 5F8BA 4NAXA 2FWHA 5A34A 2V6KA 3TRPA 5CREA 2P0GA 5ELGA 1O81A 5DCGA 1TTZA 2IMFA 5E59A 3E9JB 2QSIA 2LS5A 3DD3A 5A1NA 4K8MA 3EURA 5HR1A 5B8AA 2H70A 2HNLA 5COHA 4KSOA 2HXKA 1RW1A 1V9WA 3EYTA 1XIYA 3LJRA 4HJ2A 1JLWA 4XCSA 1XFLA 1U3AA 2HSMB 4QL9A 3DYRA 3TCOA 1M3IA 5AIXA 3ZREA 4X0XA 1XWKA 3IOSA 2YZHA 5ECMB 4ISDA 3UVTA 4BL7A 2CT6A 1A24A 3N5OA 1XWCA 3CTFA 5ECOB 5GAND 4MPFA 5EPFA 1TRVA 4IP1A 3ZIVA 3GSSA 3GFKA 5IPGA 2YP6A 4BVYB 2JSZA 4TRXA 3IC8A 1WWJA 3BCKA 1HNCA 1MD4A 4QMKA 1VGLA 3HVSA 2UV8G 4Z2UA 3VWXA 1CQGA 2NPBA 2R37A 1I5GA 2B3SA 1GLQA 4G10A 4EIQA 3F4RA 2VO4A 1JFUA 2C0GA 3VFIA 2H0HA 4XRAA 5CP1A 4CW9A 1XVQA 3ZL5A 3KTLA 4IKHA 2IFQB 3G7JA 2V1MA 1F3BA 5CRGA 1UA5A
chains in the Genus database with same CATH topology
1FVJA 2VCWA 1R7HA 3FW2A 3KP9A 1OVNA 4MNNA 2TRCP 4ZL7A 1YDKA 4NPBA 2OE1A 4KDYA 5DBQA 5HR2A 3HJOA 3TJGA 1H75A 2O85A 3NZNA 4N0ZA 3RHCA 3IAS2 5DCHA 6GSUA 1QFNA 2ZNMA 2C0DA 1PX6A 1ERWA 3CMIA 5DALA 4MF6A 2P31A 1G7EA 1YZXA 2JZRA 2IMDA 4OMVA 5BMUA 3HKRA 3H79A 3DRNA 3ZVJD 3FEUA 3IAM2 1ON4A 3KCMA 4IW9A 3HVXA 2YCDA 1U88A 2HSNA 3RAZA 2GSQA 4IQ1A 4MH2A 4FQUA 4F0CA 2PPTA 2MBSA 2H66A 2A2RA 1V40A 2WCIA 4NXIA 1Z9HA 1ZYEA 4ZXGA 4BPYA 3J7Yb 3IK7A 2C0EA 2VLUA 1TP9A 2DKHA 2G2QA 2L4QA 2DJ1A 3KMOA 5KN0A 3KZQA 3LFLA 2FUG2 2H75A 1ZYQB 2K18A 1G6YA 1WJKA 3VPQA 1SJZA 2F51A 4HU7A 2H72A 1SK0A 2YN1A 2CX4A 2H1LA 1X0RA 3GH6A 5ECNB 2L6CA 4ICYA 4DSRA 3LQ7A 1T7PB 2HRKB 3D21A 2O8VB 4ML6A 6GSYA 2PVOC 3C1RA 3EMPA 1SK2A 1V57A 3TJKA 4ZL8A 1YVLA 1T3BA 2JACA 4EDYA 3ME8A 4AGSA 3ZIJA 3GV1A 2FGXA 4K6XA 3TKSE 1WIKA 3VLNA 3MAKA 1SU9A 1X5EA 4FH8A 5IM9A 1PKZA 4AF2A 4KA0A 1GH2A 1YKCA 5J4YA 3H8QA 4KUNA 3M3MA 2PBJA 2VCTA 2EFHA 2LQQA 4USSA 4EE0A 2GZZA 3W8JA 2HSHA 3I6AA 1H4OA 2LJRA 2WFCA 1TKDB 2YNXA 4GSNA 2X4AA 4POKA 1ERVA 4Z2TA 5CRDA 1N8JA 2BTOT 5IMZA 2VL3A 3D4TA 5AISA 3D4MA 3LYKA 3UL3A 3DXBA 3APOA 4Q5RA 4P3YB 5JCUA 1G7OA 1ILOA 4DSSB 5ECSA 3PH9A 1ACVA 2CVKA 1F3AA 2V6OA 3VWVA 4ID0A 5A4VA 1GUMA 2NVLA 1Y25A 2MMNA 3GMFA 2IFQA 3DVXA 1X5DA 4HUAA 2I4AA 3IHQA 1OC3A 3GX8A 4IVFA 3F6DA 1ZCPA 4EKZA 2KP2A 1PL2A 1XVWA 1ZYNA 6GSXA 1NHYA 2GGTA 2PMTA 3TKQA 5F06A 2VCXA 2ON5A 1O8WA 4ULXA 4XS6A 2YWNA 3MIXA 4IHUA 5FT3A 2A4HA 1GTIA 4G2EA 2VD0A 1BG5A 5CRWA 3GKKA 2X8GA 1NSWA 22GSA 3CSIA 5LNKe 2KOKA 2IN3A 1S3AA 4W66A 4LL1B 4J56E 1V2AA 5KOXA 2DIZA 4EUYA 2FWGA 3AY8A 4K0NA 3D5JA 4LMWA 1OE8A 5ECRB 4KDUA 5IOWA 2H73A 1KEBA 5G31A 3QCPA 1FG4A 1GP1A 1B8XA 1B48A 1T4YA 4G19A 1GNWA 2V41A 3QMXA 3ME7A 2RM5A 4PUFC 1TI1A 4BWSA 2VLTA 3KD0A 4G0LA 4BL7B 3ZTLA 2WULA 1R5PA 2PVQA 1Z5YE 6GSSA 1MDIA 4CHSA 3G7IA 5ECQB 2F8FA 1FVKA 1YF0A 5G5EA 3HDCA 3KIJA 2VOCA 4Q5FA 1K3YA 4K2XA 2H6YA 2MMAA 3KXOA 1M9BA 4IJ3A 3MSZA 2YJ7A 3S9FA 4HZ2A 1KNGA 1X9MB 1ZOFA 3HY2A 2B1LA 4F82A 1UN2A 2HRKA 1PD21 4D73B 1SL2B 2GS3A 4RI7A 3NIVA 4KAEA 5LD0A 1EEJA 3UVHA 3TGZA 2PERA 3QR6A 4KCAA 3O76A 3APSA 3LYPA 1T4ZA 4N3ZA 2FWEA 4ZBDA 5GSSA 1GUKA 4I97A 3C1SA 2WRTA 3VI5A 3RPPA 3CBUA 4HI7A 1O73A 4FIWA 5A4UA 1EOHA 2DC5A 1JHBA 1NM3A 1ZGNA 4MCUA 3L9SA 3NOFA 4WF5A 3PR8A 2G0FA 2VUPA 4POBA 1XWBA 4G0IA 1HNAA 18GSA 1GULA 2N5FA 1QMVA 3HZ4A 1ABAA 4EF0A 1O6JA 4GQCA 2HRNA 1FAAA 1R4WA 1SVOA 2H01A 2IPAA 1F2EA 1JZDA 3TUEA 1PA3A 1OKTA 2REMA 1Z6MA 2H1BA 5GZZB 3E0UA 3DGQA 3H1NA 4E68A 1KBNA 1PRXA 3D0ZA 5BMUB 4HDEA 2QA2A 1BX9A 1A2LA 2C3TA 2L5LA 2P5QA 1VF4A 3HCZA 5B8BA 4MK3A 1M7TA 2GVPA 5DDLA 2GDRA 4F03A 2LQOA 4ZILA 3M1GA 4Q5NA 1WP0A 3ERFA 4X1UA 2K6VA 4J2FA 2H30A 20GSA 2V32A 3IRAA 2L5OA 3KMNA 3UBLA 1HD2A 1ERTA 1YY7A 2L6DA 4KW6A 2I81A 5IMFA 5JCWA 2O5VA 4XTSA 4K2DA 4CDOA 2IMKA 5LCZA 2CQ9A 1OC8A 2OE3A 4KGIA 2OA7A 5A5KA 5KN3A 1SJ6A 5KN2A 2UZ8A 2I3YA 3GX0A 2WB9A 2H0IA 5J40A 1Q98A 2LRCA 2B1KA 5D9WA 1PN0A 5CRHA 3U5RE 1OC9A 1IYIA 1J9BA 4PQHA 2ON7A 5B6NA 4ECBA 2HLSA 1SJIA 2JU5A 4G9HA 4GF0A 4HZ4A 4O92A 4XRDA 3I9V2 4XHMA 2AJQB 1TXUA 2K9FA 3IPZA 3M0FA 4JE1A 1XW5A 5IIZA 1IYHA 1SKSB 5IOXA 4PQIA 3GSTA 3EINA 4YKFA 3L78A 2GTUA 4AI6A 3ERGA 2MYGA 5L71A 4MJAA 3TB2A 4GWRA 3DKSA 3RHBA 3F63A 4FYBA 3IDVA 1V98A 5IMAA 1G0TA 2L4CA 2JZTA 3EVIA 2TIRA 2LNSA 1FHEA 4QL7A 3PINA 3LW9A 5ENUA 2B7KA 3U6VA 2CAQA 4JEDA 3FY7A 3RDWA 1GL8A 4D73A 3TRQA 4A5PA 1GSFA 5F0GA 1SD8A 3IK9A 4OFTA 2QKEA 3WT2A 1Z6NA 2FD3A 2X99A 2YZUA 1FOHA 2DMLA 2LNTA 5IQYA 3F9UA 1A0RP 1EV9A 2PN8A 2HQTA 1BQ7A 2XBIA 1AUCA 5G30A 4TW5A 4K0GA 1TK5B 3GA4A 2P5RA 16GSA 2AUVA 3J7Yk 3IE3A 2M46A 3G9BA 1FB0A 2F9SA 2A4VA 1TU7A 3ZZXA 2YOIA 2WZ9A 4I2TA 4GXZA 4ZB6A 3CSJA 1YQ1A 5E4WA 1GTAA 2QC7A 2VAFA 4AJ7A 2IL3A 2RM6A 3D6IA 2H1GA 4V2NA 2DKIA 4YKGA 2XPEA 3ZRDA 3P2AA 4O5RA 2PU9C 1PX7A 4K7NA 1X5CA 1F37A 5DVBA 4L0UA 1NHOA 5AN1A 2H8LA 3A2VA 2OBIA 2EFDA 2HFDA 2RLIA 4N11A 4XS4B 4WR5A 1TW9A 2R4VA 4MZCA 1X9SB 4EDZA 4EC0A 4KNDA 5FWGA 7GSSA 2VCQA 1OKDA 1PL1A 4OFMA 1XOAA 3TJFA 5DJLA 1M2BA 2X64A 1ST9A 2YANA 2AB6A 2R5GA 3KH9A 4FO5A 2O87A 3WD6A 1TRSA 4POMA 4DVCA 3HVVA 2A2PA 2EIRA 3DIEA 3QDNA 1PSQA 3LORA 4TOPA 4DEJA 5J47A 3N9JA 4MPGA 1K3LA 4AKXB 5BRTA 3G7YA 1Z7PA 2IIYA 1JZOA 1O85A 3IA1A 3CSHA 3GH9A 2HZEA 5J3RA 4YQVA 1QK8A 2LV3A 3GTUA 1N25A 5H5QA 2IMEA 1GSYA 1AXDA 3US3A 1YKAA 3F4SA 5C04A 2NBSA 2KUCA 4GQFA 4KH7A 2DJ0A 4NWYA 2HRAA 3LWAA 2C8UA 3P8WA 2X49A 3FZ9A 3LG6A 4O32A 3GKMA 2MZCA 4MJEA 3CXGA 5D8IA 1A2MA 2KP1A 3LXZA 2LJAA 4ZL9A 4LMVA 4JBBA 1EV4A 5DAKB 4WEYA 3DMLA 3GUSA 1EZKA 5ELAA 2HE3A 4EVMA 1AIUA 1YF1A 3CYNA 5KOWA 4TVEA 2GSTA 1SKRB 1FO5A 3F3RA 1SVMA 3TU3B 1J0FA 5GSTA 2GQKA 4N30A 2B5YA 2O89A 4HU9A 1AQVA 2X8CA 1XOBA 1URMA 2LUSA 5B6MA 3I43A 2OBKA 2L57A 2WS2A 2H76A 4K9ZA 3QAWA 4L8EA 1BAYA 1LBKA 3VWUA 1MD3A 3M8NA 4ZB8A 1UC7A 1GTUA 4HQZA 2LTKA 1S3DA 3KM6A 12GSA 3EMXA 3ZMLA 2DMMA 1DUGA 6GSWA 1EGOA 4OFNA 2FA8A 3KEBA 4I6XA 3HHVA 4HS1A 5HR3A 4IS0A 1QXHA 1DE2A 2GZPA 2VL9A 1WRYA 2ZUPA 13GSA 1ML6A 3W6GA 2VM1A 2HRFA 3ERWA 3VI7A 4BVXB 4MH3A 3FR9A 3QAGA 3R2QA 1Z3EA 4YQUA 4MZWA 4WETA 1TK8B 1OC9B 4JU5A 1MEKA 2R0PA 4JR4A 4N10A 1MDKA 1I9DA 1YJ6A 1F6MC 1X9WB 4PXOA 2H19A 3MNGA 4KSMA 3R3EA 3KP8A 4XS4A 5A5HB 4PUAA 4JZQA 4PTSA 1XWGA 2H0GA 1DBYA 1THOA 3C71A 4HOJA 2LRTA 3FRCA 3WGEA 3GL3A 3HJMA 4Z2RA 4RQRA 2FHEA 1WE0A 4KX4A 1ZYPA 2XHFA 2R3XA 1RK4A 4F0BA 1K0BA 3FHKA 4NHZA 4GSSA 2H6XA 2EC4A 3LSZA 3FR6A 5INYA 4MABA 4G01A 4PX1A 2K8SA 3UBKA 1NW2A 1XBSA 4PGTA 2FNOA 3GURA 3CRUA 3WGXA 2HSYA 2IMIA 4Z7XA 1B9XC 1W89A 3GL5A 5ID2A 1XPVA 3L4NA 2R0GA 4AKHA 4MP4A 2AYTA 4K7OA 4MJCA 5D93A 2XPDA 4EXJA 2EFEA 3IXRA 1AQWA 1XCCA 2F8AA 3QFAC 3SBCA 2RIIA 3C8EA 5D9VA 4ZBAA 1PQNA 2HZFA 2I1UA 4X43A 4AJ8A 1B4QA 1N2AA 3HMJG 1QUWA 3A3TA 1O7UA 6GSTA 2E7PA 1JLVA 4TXOB 2LJKA 4NHWA 3KJYA 2F3MA 3Q19A 2Z9SA 2C80A 3VURA 5DAKA 3DWVA 3HZ8A 1K0CA 2B7JA 4O5UA 1ERUA 2B5XA 4F2IA 1SD9A 2CA8A 1LJRA 1R26A 4CY6A 4PNFA 4GSTA 1Y1UA 5FHIA 4E8HA 1BYEA 2I9HA 4BWQA 4YAPA 1T00A 3ZMKA 3C7MA 4AJ6A 5DJMA 2AAWA 2WJUA 4IGJA 1FB6A 6GSVA 2KHPA 5HFGA 3MDKA 3F8UA 1THXA 4V1Ap 3PGTA 4OO4A 4K1FA 1GRXA 1A0FA 5D96A 5IO0A 4AKGA 3GHAA 1TU8A 17GSA 1K0DA 1A8LA 1F9MA 3BD2A 2YV7A 1ZZYA 4ECCA 3DVWA 2VM2A 1UVZA 1FW1A 3IV4A 2GT6A 3V1WA 4L5LA 3KGKA 3QD9A 2VCVA 4X4JA 2PGTA 5G1LA 2HYXA 4ZB7A 3M9KA 3IR4A 2DJKA 2D2ZA 5AGYA 5ECLB 1AC1A 4WF4A 3APQA 2C1YA 2GT5A 5F05A 3GRXA 4OCEA 1TRWA 2DJ2A 4N0VA 1E6BA 3M9JA 4IELA 3TKSC 2C3NA 3UIWA 4BVXA 3C73A 4WBRD 4TR0A 1KTEA 2CVDA 3LEFA 3P90A 2HZEB 2JL4A 2CV4A 2OJLA 3GTUB 3HYPA 3EU3A 3CRTA 2O7KA 1U3IA 4HJMA 3VPTA 2N5BA 3FZ5A 3TKSA 1ZMAA 5HQPA 1SL0B 3F6FA 1EWXA 5A5HA 4POLA 3ED3A 1A2JA 1XZOA 3A2XA 1TXXA 2OT3A 3TKPA 1GTBA 4TKYA 2X8HA 4HEA2 5JWOB 4KB3A 3QPMA 1OE7A 2JSYA 4ZIJA 5F07A 2DBCA 1XWAA 4V1Ag 2GQMA 1JZRA 2GQLA 3BCIA 1MTCA 1M99A 4KF9A 3F0IA 1AW9A 1HQOA 1M2DA 3SWLA 5AIVA 2KLXA 2BMXA 4K5RA 3E3EA 3GKNA 3GN3A 2YWOA 2ALBA 5JCGA 5D9XA 2E2GA 4H86A 1CQHA 2OE0A 4MF5A 2EFCA 3QFBC 1T1VA 5JWQB 2B6MA 4GLTA 5CO3A 4TR4A 4TR1A 4I8BA 2ZCTA 4I2UA 3ZLPA 4XS1A 9GSSA 3VK9A 3MYDA 4RI6A 2NTOA 5IMVA 3D22A 4TXOA 5IMDA 2DIYA 5ABRA 2WDUA 1Z7RA 1GSDA 2FY6A 3IHGA 1PKWA 3VWWA 2M72A 4BA7A 3H93A 2MMZA 3FZ4A 3A2WA 3Q6OA 3RBTA 2R6KA 1VRSD 1C72A 2LRNA 1PN9A 2VIMA 3A5IA 2VLVA 4JR6A 5EVOA 1AAZA 3EWLA 5D9TA 2C0FA 4RQXA 4G0KA 4EL1A 2V2GA 4HQSA 5J5NA 4LLRA 1SL1B 5DQYA 5KEJA 3FYGA 1GLPA 1VF2A 5G1KA 1TK0B 5D73A 1R5AA 3EU4A 1BEDA 5J4VA 4WBJA 4K7IA 4K5SA 2XC2A 2GSSA 1B4PA 5J41A 5HFIA 4O7HA 2VL2C 2AHEA 3HJPA 1BJXA 2J9HA 1RQMA 4LL4B 1SKWB 5ECIB 2QGVA 2XBQA 5ID2B 3UJ1A 3PPUA 3EC3A 4FYUA 4ECJA 4IBPA 2JZSA 4YH2A 3TOTA 3H4KA 3LGCA 5G5FA 2EIQA 1DE1A 2VL2A 1FOVA 1OAZA 1GWCA 3QAVA 5J9CA 1EGRA 1Q4JA 3K8NA 1PGTA 4GDFA 3RPNA 3HA9A 3P7XA 5CYYA 3O3TA 2DJ3A 8GSSA 2YWMA 1T8EB 4LA1A 1GSUA 4IP6A 4KE3A 4QQ7A 2AV4A 4IQAA 3UMAA 4F9ZA 3LXTA 4MLYA 2HSMA 3CWGA 4MZBA 4CY8A 3L9VA 4FYCA 4OO5A 2RUEA 1XXUA 3TOUA 1PMTA 2MBTA 1TRUA 1MDJA 1A23A 2HI7A 2IJYA 3FKFA 4E8EA 5HFKA 2CZ3A 1XW9A 1TDIA 1W4VA 2CX3A 4BVYA 2YPMA 2OADA 1GSQA 3WYWA 3GNJA 1WOUA 2VD1A 4IJIA 1EP8A 2WGRA 5IMCA 1TOFA 2H1DA 3FMWA 4J57E 4L0WA 1BG1A 2GLRA 2K8VA 4ZB9A 2H71A 5IPHA 2N5AA 4NV2A 3WT1A 1K3OA 2HT9A 3GKXA 2C3QA 4MDCA 1LU4A 3DEXA 3FR3A 1JZWA 2FLSA 2YV9A 4I5QA 5J9BA 4IN0A 3ZFBA 4PQ1A 4ZBBA 2DLXA 4PURA 2NDOA 3BJ5A 1QGVA 3UOMA 3IC4A 4EIPA 4V2LA 2EIOA 3ZFLA 1YEXA 5A34B 1S3CA 4MMMA 1VF3A 3UEMA 3ZYWA 2B5EA 2BJXA 1EEMA 1SK1A 1SYXA 1ZL9A 1GSSA 3I69A 5CNWA 5G2ZA 2MMOA 5C00A 4V2MA 5EY6A 1WMJA 5A1NB 3ISOA 1U6TA 4GTUA 4MJBA 3GIXA 2CVBA 3TJJA 5J4UA 1AQXA 4PNGA 2C4JA 5GAPD 5CAXA 1U87A 2TRXA 1E2YA 3A5WA 4MA9A 2RUFA 3Q18A 5HR0A 2YJHA 3TDGA 4TR3A 11GSA 4ECIA 4YAVA 2FWFA 2LKUA 2PWJA 5JWRB 3HD5A 3GYKA 2R0CA 2GZYA 3UAPA 4WR4A 3ZITA 1B9YC 3KTBA 3ZVJA 1EOGA 2M80A 4WXTA 3TKRA 2QA1A 3FK8A 2E2MA 4KDXA 2FA4A 3L9UA 4TXVA 5ECPB 1A8YA 2IWTA 3FZAA 14GSA 4YQMA 4ACSA 10GSA 3EPTA 1QQ2A 1YEPA 1HYUA 19GSA 4TR1B 1TI3A 3F3QA 1EP7A 2VKZG 4O5QA 4JRRA 2FCHA 3TJBA 1K0MA 2R2JA 4EO3A 4GRFA 4RUVA 4ILFA 3KH7A 5EL8A 1HNBA 4OD7A 4KCEA 1XW6A 1SVLA 2H1AA 4TN8A 3O6TA 4OWYA 2E0QA 1K0AA 2DJJA 1DSBA 1OYJA 1WPIA 2H74A 2OKAA 3EE2A 3WGDA 4XIHA 2GSRA 5ECKB 4NMUA 1SENA 2ES7A 1V58A 4MF7A 4OCFA 3JCML 2A2SA 1O8XA 1VF1A 3UARA 5DALB 2H6ZA 3QOUA 5KN1A 1M2AA 1GUHA 1USBA 1K0NA 5IO2A 5DQSA 1GNEA 3L0HA 3W8SA 4NV5A 1K0OA 4GCIA 3MWHA 3CTGA 4DSSA 2L59A 2HSNB 3IBHA 1Y6EA 1TJDA 2VCZA 1BF5A 3BOAA 4Q5QA 2DSAA 5B7CA 1J08A 4ML1A 2OACA 2J23A 3TRXA 4DSQA 3HXSA 2YWIA 4WKWA 3OR5A 1SYRA 2LSTA 3F4TA 2JADA 1GSEA 5ECHB 3BBYA 1M9AA 3Q74A 2PUKC 5H5SA 1G6WA 2CZ2A 2CAIA 2LEGA 5A4WA 5H5RA 4AKIA 4L5OA 1M0UA 5F8BA 4NAXA 2FWHA 5A34A 2V6KA 3TRPA 5CREA 2P0GA 5ELGA 1O81A 5DCGA 1TTZA 2IMFA 5E59A 3E9JB 2QSIA 2LS5A 3DD3A 5A1NA 4K8MA 3EURA 5HR1A 5B8AA 2H70A 2HNLA 5COHA 4KSOA 2HXKA 1RW1A 1V9WA 3EYTA 1XIYA 3LJRA 4HJ2A 1JLWA 4XCSA 1XFLA 1U3AA 2HSMB 4QL9A 3DYRA 3TCOA 5AIXA 3ZREA 4X0XA 1XWKA 3IOSA 2YZHA 5ECMB 4ISDA 3UVTA 4BL7A 2CT6A 1A24A 3N5OA 1XWCA 3CTFA 5ECOB 5GAND 4MPFA 5EPFA 1TRVA 4IP1A 3ZIVA 3GSSA 3GFKA 5IPGA 2YP6A 4BVYB 2JSZA 4TRXA 3IC8A 1WWJA 3BCKA 1HNCA 1MD4A 4QMKA 1VGLA 3HVSA 2UV8G 4Z2UA 3VWXA 1CQGA 2NPBA 2R37A 1I5GA 2B3SA 1GLQA 4G10A 4EIQA 3F4RA 2VO4A 1JFUA 2C0GA 3VFIA 2H0HA 4XRAA 5CP1A 4CW9A 1XVQA 3ZL5A 3KTLA 4IKHA 2IFQB 3G7JA 2V1MA 1F3BA 5CRGA 1UA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FVJ A;  2VCW A;  1R7H A;  3FW2 A;  3KP9 A;  1OVN A;  2TRC P;  4ZL7 A;  1YDK A;  4NPB A;  2OE1 A;  4KDY A;  5DBQ A;  5HR2 A;  3HJO A;  3TJG A;  1H75 A;  2O85 A;  3NZN A;  4N0Z A;  3RHC A;  3IAS 2;  5DCH A;  6GSU A;  1QFN A;  2ZNM A;  2C0D A;  1PX6 A;  1ERW A;  3CMI A;  5DAL A;  4MF6 A;  2P31 A;  1G7E A;  1YZX A;  2JZR A;  2IMD A;  4OMV A;  5BMU A;  3HKR A;  3H79 A;  3DRN A;  3ZVJ D;  3FEU A;  3IAM 2;  1ON4 A;  3KCM A;  4IW9 A;  3HVX A;  2YCD A;  1U88 A;  3RAZ A;  2GSQ A;  4IQ1 A;  4MH2 A;  4FQU A;  4F0C A;  2PPT A;  2MBS A;  2H66 A;  2A2R A;  1V40 A;  2WCI A;  4NXI A;  1Z9H A;  1ZYE A;  4ZXG A;  4BPY A;  3J7Y b;  3IK7 A;  2C0E A;  2VLU A;  1TP9 A;  2G2Q A;  2L4Q A;  2DJ1 A;  3KMO A;  5KN0 A;  3KZQ A;  3LFL A;  2FUG 2;  2H75 A;  1ZYQ B;  2K18 A;  1G6Y A;  1WJK A;  3VPQ A;  1SJZ A;  2F51 A;  4HU7 A;  2H72 A;  1SK0 A;  2YN1 A;  2CX4 A;  1X0R A;  3GH6 A;  5ECN B;  2L6C A;  4DSR A;  3LQ7 A;  1T7P B;  2HRK B;  3D21 A;  2O8V B;  4ML6 A;  6GSY A;  2PVO C;  3C1R A;  3EMP A;  1SK2 A;  1V57 A;  3TJK A;  4ZL8 A;  1T3B A;  2JAC A;  4EDY A;  3ME8 A;  4AGS A;  3ZIJ A;  3GV1 A;  2FGX A;  4K6X A;  3TKS E;  1WIK A;  3VLN A;  3MAK A;  1SU9 A;  1X5E A;  4FH8 A;  5IM9 A;  1PKZ A;  4AF2 A;  4KA0 A;  1GH2 A;  1YKC A;  3H8Q A;  4KUN A;  3M3M A;  2PBJ A;  2VCT A;  2LQQ A;  4USS A;  4EE0 A;  2GZZ A;  3W8J A;  2HSH A;  3I6A A;  1H4O A;  2LJR A;  2WFC A;  1TKD B;  2YNX A;  4GSN A;  4POK A;  1ERV A;  5CRD A;  1N8J A;  2BTO T;  5IMZ A;  2VL3 A;  3D4T A;  5AIS A;  3D4M A;  3LYK A;  3UL3 A;  3DXB A;  3APO A;  4Q5R A;  4P3Y B;  5JCU A;  1G7O A;  1ILO A;  4DSS B;  5ECS A;  3PH9 A;  1ACV A;  2CVK A;  1F3A A;  2V6O A;  3VWV A;  4ID0 A;  5A4V A;  1GUM A;  2NVL A;  1Y25 A;  2MMN A;  3GMF A;  2IFQ A;  3DVX A;  1X5D A;  4HUA A;  2I4A A;  3IHQ A;  1OC3 A;  3GX8 A;  4IVF A;  3F6D A;  1ZCP A;  4EKZ A;  2KP2 A;  1PL2 A;  1XVW A;  6GSX A;  1NHY A;  2GGT A;  2PMT A;  3TKQ A;  5F06 A;  2VCX A;  2ON5 A;  1O8W A;  4ULX A;  4XS6 A;  2YWN A;  4IHU A;  5FT3 A;  1GTI A;  4G2E A;  2VD0 A;  1BG5 A;  5CRW A;  3GKK A;  2X8G A;  1NSW A;  22GS A;  3CSI A;  5LNK e;  2KOK A;  2IN3 A;  1S3A A;  4LL1 B;  4J56 E;  1V2A A;  2DIZ A;  4EUY A;  2FWG A;  3AY8 A;  4K0N A;  3D5J A;  4LMW A;  1OE8 A;  5ECR B;  4KDU A;  5IOW A;  2H73 A;  1KEB A;  5G31 A;  3QCP A;  1FG4 A;  1GP1 A;  1B8X A;  1B48 A;  1T4Y A;  4G19 A;  3QMX A;  1GNW A;  2V41 A;  3ME7 A;  2RM5 A;  4PUF C;  1TI1 A;  4BWS A;  2VLT A;  3KD0 A;  4G0L A;  4BL7 B;  3ZTL A;  2WUL A;  1R5P A;  2PVQ A;  1Z5Y E;  6GSS A;  1MDI A;  4CHS A;  3G7I A;  5ECQ B;  2F8F A;  1FVK A;  1YF0 A;  5G5E A;  3HDC A;  3KIJ A;  2VOC A;  4Q5F A;  1K3Y A;  2H6Y A;  2MMA A;  3KXO A;  1M9B A;  4IJ3 A;  3MSZ A;  2YJ7 A;  3S9F A;  4HZ2 A;  1KNG A;  1X9M B;  1ZOF A;  3HY2 A;  2B1L A;  4F82 A;  1UN2 A;  2HRK A;  1PD2 1;  4D73 B;  1SL2 B;  2GS3 A;  4RI7 A;  3NIV A;  4KAE A;  5LD0 A;  1EEJ A;  3UVH A;  3TGZ A;  2PER A;  3QR6 A;  4KCA A;  3O76 A;  3APS A;  3LYP A;  1T4Z A;  2FWE A;  4ZBD A;  5GSS A;  1GUK A;  4I97 A;  3C1S A;  2WRT A;  3VI5 A;  3RPP A;  3CBU A;  4HI7 A;  1O73 A;  4FIW A;  5A4U A;  1EOH A;  2DC5 A;  1JHB A;  1NM3 A;  1ZGN A;  4MCU A;  3L9S A;  3NOF A;  4WF5 A;  3PR8 A;  2G0F A;  2VUP A;  4POB A;  1XWB A;  4G0I A;  1HNA A;  18GS A;  1GUL A;  2N5F A;  1QMV A;  3HZ4 A;  1ABA A;  4EF0 A;  1O6J A;  4GQC A;  2HRN A;  1FAA A;  1R4W A;  2H01 A;  2IPA A;  1F2E A;  1JZD A;  3TUE A;  1PA3 A;  1OKT A;  2REM A;  1Z6M A;  2H1B A;  5GZZ B;  3E0U A;  3DGQ A;  3H1N A;  1KBN A;  1PRX A;  3D0Z A;  4HDE A;  1BX9 A;  1A2L A;  2C3T A;  2L5L A;  2P5Q A;  1VF4 A;  3HCZ A;  5B8B A;  4MK3 A;  1M7T A;  2GVP A;  5DDL A;  2GDR A;  4F03 A;  2LQO A;  4ZIL A;  3M1G A;  4Q5N A;  1WP0 A;  3ERF A;  4X1U A;  2K6V A;  4J2F A;  2H30 A;  20GS A;  2V32 A;  3IRA A;  2L5O A;  3KMN A;  3UBL A;  1HD2 A;  1ERT A;  1YY7 A;  2L6D A;  4KW6 A;  2I81 A;  5IMF A;  5JCW A;  4XTS A;  4K2D A;  4CDO A;  2IMK A;  5LCZ A;  2CQ9 A;  1OC8 A;  2OE3 A;  4KGI A;  2OA7 A;  5A5K A;  5KN3 A;  1SJ6 A;  5KN2 A;  2UZ8 A;  2I3Y A;  3GX0 A;  2WB9 A;  2H0I A;  1Q98 A;  2LRC A;  2B1K A;  5D9W A;  5CRH A;  3U5R E;  1OC9 A;  1IYI A;  1J9B A;  4PQH A;  2ON7 A;  5B6N A;  4ECB A;  2HLS A;  1SJI A;  2JU5 A;  4G9H A;  4GF0 A;  4HZ4 A;  4O92 A;  4XRD A;  3I9V 2;  4XHM A;  2AJQ B;  2K9F A;  3IPZ A;  3M0F A;  4JE1 A;  1XW5 A;  5IIZ A;  1IYH A;  1SKS B;  5IOX A;  4PQI A;  3GST A;  3EIN A;  3L78 A;  2GTU A;  3ERG A;  2MYG A;  5L71 A;  4MJA A;  3TB2 A;  4GWR A;  3DKS A;  3RHB A;  3F63 A;  4FYB A;  3IDV A;  1V98 A;  5IMA A;  1G0T A;  2L4C A;  2JZT A;  3EVI A;  2TIR A;  2LNS A;  1FHE A;  4QL7 A;  3PIN A;  5ENU A;  2B7K A;  3U6V A;  2CAQ A;  4JED A;  3FY7 A;  3RDW A;  1GL8 A;  4D73 A;  3TRQ A;  1GSF A;  5F0G A;  1SD8 A;  3IK9 A;  4OFT A;  2QKE A;  3WT2 A;  1Z6N A;  2FD3 A;  2X99 A;  2YZU A;  2DML A;  2LNT A;  5IQY A;  3F9U A;  1A0R P;  1EV9 A;  2PN8 A;  2HQT A;  1BQ7 A;  2XBI A;  1AUC A;  5G30 A;  4TW5 A;  4K0G A;  1TK5 B;  3GA4 A;  2P5R A;  16GS A;  2AUV A;  3J7Y k;  3IE3 A;  2M46 A;  3G9B A;  1FB0 A;  2F9S A;  2A4V A;  1TU7 A;  3ZZX A;  2YOI A;  2WZ9 A;  4I2T A;  4GXZ A;  4ZB6 A;  3CSJ A;  1YQ1 A;  5E4W A;  1GTA A;  2QC7 A;  2VAF A;  4AJ7 A;  2IL3 A;  2RM6 A;  3D6I A;  2H1G A;  4V2N A;  2XPE A;  3ZRD A;  3P2A A;  4O5R A;  2PU9 C;  1PX7 A;  4K7N A;  1X5C A;  1F37 A;  5DVB A;  4L0U A;  1NHO A;  5AN1 A;  2H8L A;  3A2V A;  2OBI A;  2HFD A;  2RLI A;  4N11 A;  4XS4 B;  4WR5 A;  1TW9 A;  2R4V A;  4MZC A;  1X9S B;  4EDZ A;  4EC0 A;  4KND A;  5FWG A;  7GSS A;  2VCQ A;  1OKD A;  1PL1 A;  4OFM A;  1XOA A;  3TJF A;  5DJL A;  1M2B A;  2X64 A;  1ST9 A;  2YAN A;  2AB6 A;  2R5G A;  3KH9 A;  4FO5 A;  2O87 A;  3WD6 A;  1TRS A;  4POM A;  4DVC A;  3HVV A;  2EIR A;  3DIE A;  3QDN A;  1PSQ A;  3LOR A;  4TOP A;  4DEJ A;  3N9J A;  4MPG A;  1K3L A;  3G7Y A;  1Z7P A;  2IIY A;  1JZO A;  1O85 A;  3IA1 A;  3CSH A;  3GH9 A;  2HZE A;  5J3R A;  4YQV A;  1QK8 A;  2LV3 A;  3GTU A;  5H5Q A;  2IME A;  1GSY A;  1AXD A;  3US3 A;  1YKA A;  3F4S A;  5C04 A;  2NBS A;  2KUC A;  4GQF A;  4KH7 A;  2DJ0 A;  4NWY A;  2HRA A;  3LWA A;  2C8U A;  3P8W A;  3FZ9 A;  3LG6 A;  4O32 A;  3GKM A;  2MZC A;  4MJE A;  3CXG A;  5D8I A;  1A2M A;  2KP1 A;  3LXZ A;  2LJA A;  4ZL9 A;  4LMV A;  4JBB A;  1EV4 A;  5DAK B;  4WEY A;  3DML A;  3GUS A;  1EZK A;  5ELA A;  2HE3 A;  4EVM A;  1AIU A;  1YF1 A;  3CYN A;  4TVE A;  2GST A;  1SKR B;  1FO5 A;  3F3R A;  1J0F A;  5GST A;  2GQK A;  4N30 A;  2B5Y A;  2O89 A;  4HU9 A;  1AQV A;  2X8C A;  1XOB A;  1URM A;  2LUS A;  5B6M A;  3I43 A;  2OBK A;  2L57 A;  2WS2 A;  2H76 A;  4K9Z A;  3QAW A;  4L8E A;  1BAY A;  1LBK A;  3VWU A;  1MD3 A;  3M8N A;  4ZB8 A;  1UC7 A;  1GTU A;  4HQZ A;  2LTK A;  1S3D A;  3KM6 A;  12GS A;  3EMX A;  3ZML A;  2DMM A;  1DUG A;  6GSW A;  1EGO A;  4OFN A;  2FA8 A;  3KEB A;  4I6X A;  3HHV A;  4HS1 A;  5HR3 A;  4IS0 A;  1QXH A;  1DE2 A;  2GZP A;  2VL9 A;  1WRY A;  2ZUP A;  13GS A;  1ML6 A;  3W6G A;  2VM1 A;  2HRF A;  3ERW A;  3VI7 A;  4BVX B;  4MH3 A;  3FR9 A;  3QAG A;  3R2Q A;  1Z3E A;  4YQU A;  4MZW A;  4WET A;  1TK8 B;  1OC9 B;  4JU5 A;  1MEK A;  4JR4 A;  4N10 A;  1MDK A;  1I9D A;  1YJ6 A;  1F6M C;  1X9W B;  4PXO A;  2H19 A;  3MNG A;  4KSM A;  3R3E A;  3KP8 A;  4XS4 A;  4PUA A;  4JZQ A;  4PTS A;  1XWG A;  2H0G A;  1DBY A;  1THO A;  3C71 A;  4HOJ A;  2LRT A;  3FRC A;  3WGE A;  3GL3 A;  3HJM A;  4RQR A;  2FHE A;  1WE0 A;  4KX4 A;  2XHF A;  2R3X A;  1RK4 A;  4F0B A;  1K0B A;  3FHK A;  4NHZ A;  4GSS A;  2H6X A;  2EC4 A;  3LSZ A;  3FR6 A;  5INY A;  4MAB A;  4PX1 A;  2K8S A;  3UBK A;  1NW2 A;  1XBS A;  4PGT A;  2FNO A;  3GUR A;  3CRU A;  3WGX A;  2HSY A;  2IMI A;  4Z7X A;  1B9X C;  1W89 A;  3GL5 A;  5ID2 A;  1XPV A;  3L4N A;  4MP4 A;  2AYT A;  4K7O A;  4MJC A;  5D93 A;  2XPD A;  4EXJ A;  3IXR A;  1AQW A;  1XCC A;  2F8A A;  3QFA C;  3SBC A;  2RII A;  3C8E A;  5D9V A;  4ZBA A;  1PQN A;  2HZF A;  2I1U A;  4X43 A;  4AJ8 A;  1B4Q A;  1N2A A;  1QUW A;  3A3T A;  1O7U A;  6GST A;  2E7P A;  1JLV A;  4TXO B;  2LJK A;  4NHW A;  3KJY A;  2F3M A;  3Q19 A;  2Z9S A;  2C80 A;  3VUR A;  5DAK A;  3DWV A;  3HZ8 A;  1K0C A;  2B7J A;  1ERU A;  2B5X A;  4F2I A;  1SD9 A;  2CA8 A;  1LJR A;  1R26 A;  4PNF A;  4GST A;  5FHI A;  4E8H A;  1BYE A;  2I9H A;  4BWQ A;  4YAP A;  1T00 A;  3ZMK A;  3C7M A;  4AJ6 A;  5DJM A;  2AAW A;  2WJU A;  4IGJ A;  1FB6 A;  6GSV A;  2KHP A;  5HFG A;  3MDK A;  3F8U A;  1THX A;  4V1A p;  3PGT A;  4OO4 A;  4K1F A;  1GRX A;  1A0F A;  5D96 A;  5IO0 A;  3GHA A;  1TU8 A;  17GS A;  1K0D A;  1A8L A;  1F9M A;  3BD2 A;  2YV7 A;  1ZZY A;  4ECC A;  3DVW A;  2VM2 A;  1UVZ A;  1FW1 A;  3IV4 A;  2GT6 A;  3V1W A;  4L5L A;  3KGK A;  3QD9 A;  2VCV A;  2PGT A;  5G1L A;  2HYX A;  3M9K A;  3IR4 A;  2DJK A;  2D2Z A;  5AGY A;  5ECL B;  1AC1 A;  4WF4 A;  3APQ A;  2C1Y A;  2GT5 A;  5F05 A;  3GRX A;  4OCE A;  1TRW A;  2DJ2 A;  4N0V A;  1E6B A;  3M9J A;  4IEL A;  3TKS C;  2C3N A;  3UIW A;  4BVX A;  3C73 A;  4WBR D;  4TR0 A;  1KTE A;  2CVD A;  3LEF A;  3P90 A;  2HZE B;  2JL4 A;  2CV4 A;  2OJL A;  3GTU B;  3HYP A;  3EU3 A;  3CRT A;  2O7K A;  1U3I A;  4HJM A;  3VPT A;  2N5B A;  3FZ5 A;  3TKS A;  1ZMA A;  5HQP A;  1SL0 B;  3F6F A;  1EWX A;  4POL A;  3ED3 A;  1A2J A;  1XZO A;  3A2X A;  1TXX A;  3TKP A;  1GTB A;  4TKY A;  2X8H A;  4HEA 2;  5JWO B;  4KB3 A;  3QPM A;  1OE7 A;  2JSY A;  4ZIJ A;  5F07 A;  2DBC A;  1XWA A;  4V1A g;  2GQM A;  1JZR A;  2GQL A;  3BCI A;  1MTC A;  1M99 A;  4KF9 A;  3F0I A;  1AW9 A;  1HQO A;  1M2D A;  3SWL A;  5AIV A;  2KLX A;  2BMX A;  3E3E A;  3GKN A;  3GN3 A;  2YWO A;  2ALB A;  5JCG A;  5D9X A;  2E2G A;  4H86 A;  1CQH A;  2OE0 A;  4MF5 A;  3QFB C;  1T1V A;  5JWQ B;  2B6M A;  4GLT A;  5CO3 A;  4TR4 A;  4TR1 A;  4I8B A;  2ZCT A;  4I2U A;  3ZLP A;  4XS1 A;  9GSS A;  3VK9 A;  4RI6 A;  2NTO A;  5IMV A;  3D22 A;  4TXO A;  5IMD A;  2DIY A;  5ABR A;  2WDU A;  1Z7R A;  1GSD A;  2FY6 A;  1PKW A;  3VWW A;  2M72 A;  4BA7 A;  3H93 A;  2MMZ A;  3FZ4 A;  3A2W A;  3Q6O A;  3RBT A;  2R6K A;  1VRS D;  1C72 A;  2LRN A;  1PN9 A;  2VIM A;  2VLV A;  4JR6 A;  5EVO A;  1AAZ A;  3EWL A;  5D9T A;  2C0F A;  4RQX A;  4G0K A;  4EL1 A;  2V2G A;  4HQS A;  5J5N A;  4LLR A;  1SL1 B;  5DQY A;  5KEJ A;  3FYG A;  1GLP A;  1VF2 A;  5G1K A;  1TK0 B;  5D73 A;  1R5A A;  3EU4 A;  1BED A;  4WBJ A;  4K7I A;  2XC2 A;  2GSS A;  1B4P A;  5J41 A;  5HFI A;  4O7H A;  2VL2 C;  2AHE A;  3HJP A;  1BJX A;  2J9H A;  1RQM A;  4LL4 B;  1SKW B;  5ECI B;  2QGV A;  2XBQ A;  5ID2 B;  3UJ1 A;  3PPU A;  3EC3 A;  4FYU A;  4ECJ A;  4IBP A;  2JZS A;  4YH2 A;  3TOT A;  3H4K A;  3LGC A;  5G5F A;  2EIQ A;  1DE1 A;  2VL2 A;  1FOV A;  1OAZ A;  1GWC A;  3QAV A;  5J9C A;  1EGR A;  1Q4J A;  3K8N A;  1PGT A;  3RPN A;  3HA9 A;  3P7X A;  5CYY A;  3O3T A;  2DJ3 A;  8GSS A;  2YWM A;  1T8E B;  4LA1 A;  1GSU A;  4IP6 A;  4KE3 A;  4QQ7 A;  2AV4 A;  4IQA A;  3UMA A;  4F9Z A;  3LXT A;  4MLY A;  2HSM A;  4MZB A;  3L9V A;  4FYC A;  4OO5 A;  2RUE A;  1XXU A;  3TOU A;  1PMT A;  2MBT A;  1TRU A;  1MDJ A;  1A23 A;  2HI7 A;  2IJY A;  3FKF A;  4E8E A;  5HFK A;  2CZ3 A;  1XW9 A;  1TDI A;  1W4V A;  2CX3 A;  4BVY A;  2YPM A;  2OAD A;  1GSQ A;  3WYW A;  3GNJ A;  1WOU A;  2VD1 A;  4IJI A;  1EP8 A;  2WGR A;  5IMC A;  1TOF A;  2H1D A;  4J57 E;  4L0W A;  2GLR A;  2K8V A;  4ZB9 A;  2H71 A;  5IPH A;  2N5A A;  4NV2 A;  3WT1 A;  1K3O A;  2HT9 A;  3GKX A;  2C3Q A;  4MDC A;  1LU4 A;  3DEX A;  3FR3 A;  1JZW A;  2FLS A;  2YV9 A;  4I5Q A;  5J9B A;  4IN0 A;  3ZFB A;  4PQ1 A;  4ZBB A;  2DLX A;  4PUR A;  2NDO A;  3BJ5 A;  1QGV A;  3UOM A;  3IC4 A;  4V2L A;  2EIO A;  3ZFL A;  1YEX A;  1S3C A;  4MMM A;  1VF3 A;  3UEM A;  3ZYW A;  2B5E A;  2BJX A;  1EEM A;  1SK1 A;  1SYX A;  1ZL9 A;  1GSS A;  3I69 A;  5CNW A;  5G2Z A;  2MMO A;  5C00 A;  4V2M A;  5EY6 A;  1WMJ A;  3ISO A;  1U6T A;  4GTU A;  4MJB A;  3GIX A;  2CVB A;  3TJJ A;  5J4U A;  1AQX A;  4PNG A;  2C4J A;  5GAP D;  5CAX A;  1U87 A;  2TRX A;  1E2Y A;  3A5W A;  4MA9 A;  2RUF A;  3Q18 A;  5HR0 A;  2YJH A;  3TDG A;  4TR3 A;  11GS A;  4ECI A;  4YAV A;  2FWF A;  2LKU A;  2PWJ A;  5JWR B;  3HD5 A;  3GYK A;  2GZY A;  3UAP A;  4WR4 A;  3ZIT A;  1B9Y C;  3KTB A;  3ZVJ A;  1EOG A;  2M80 A;  4WXT A;  3TKR A;  3FK8 A;  2E2M A;  4KDX A;  2FA4 A;  3L9U A;  4TXV A;  5ECP B;  1A8Y A;  2IWT A;  3FZA A;  14GS A;  4YQM A;  4ACS A;  10GS A;  1QQ2 A;  1YEP A;  1HYU A;  19GS A;  4TR1 B;  1TI3 A;  3F3Q A;  1EP7 A;  4JRR A;  2FCH A;  3TJB A;  1K0M A;  2R2J A;  4EO3 A;  4GRF A;  4RUV A;  4ILF A;  3KH7 A;  5EL8 A;  1HNB A;  4OD7 A;  4KCE A;  1XW6 A;  2H1A A;  4TN8 A;  3O6T A;  4OWY A;  2E0Q A;  1K0A A;  2DJJ A;  1DSB A;  1OYJ A;  1WPI A;  2H74 A;  2OKA A;  3EE2 A;  3WGD A;  4XIH A;  2GSR A;  5ECK B;  4NMU A;  1SEN A;  2ES7 A;  1V58 A;  4MF7 A;  4OCF A;  3JCM L;  2A2S A;  1O8X A;  1VF1 A;  3UAR A;  5DAL B;  2H6Z A;  3QOU A;  5KN1 A;  1M2A A;  1GUH A;  1USB A;  1K0N A;  5IO2 A;  5DQS A;  1GNE A;  3L0H A;  3W8S A;  4NV5 A;  1K0O A;  4GCI A;  3MWH A;  3CTG A;  4DSS A;  2L59 A;  2HSN B;  3IBH A;  1Y6E A;  1TJD A;  2VCZ A;  3BOA A;  4Q5Q A;  2DSA A;  5B7C A;  1J08 A;  4ML1 A;  2OAC A;  2J23 A;  3TRX A;  4DSQ A;  3HXS A;  2YWI A;  4WKW A;  3OR5 A;  1SYR A;  2LST A;  3F4T A;  2JAD A;  1GSE A;  5ECH B;  3BBY A;  1M9A A;  3Q74 A;  2PUK C;  5H5S A;  1G6W A;  2CZ2 A;  2CAI A;  2LEG A;  5A4W A;  5H5R A;  4L5O A;  1M0U A;  5F8B A;  4NAX A;  2FWH A;  2V6K A;  3TRP A;  5CRE A;  2P0G A;  5ELG A;  1O81 A;  5DCG A;  1TTZ A;  2IMF A;  5E59 A;  3E9J B;  2QSI A;  2LS5 A;  3DD3 A;  4K8M A;  3EUR A;  5HR1 A;  5B8A A;  2H70 A;  2HNL A;  5COH A;  4KSO A;  2HXK A;  1RW1 A;  1V9W A;  3EYT A;  1XIY A;  3LJR A;  4HJ2 A;  1JLW A;  4XCS A;  1XFL A;  1U3A A;  2HSM B;  4QL9 A;  3DYR A;  3TCO A;  5AIX A;  3ZRE A;  4X0X A;  1XWK A;  3IOS A;  2YZH A;  5ECM B;  4ISD A;  3UVT A;  4BL7 A;  2CT6 A;  1A24 A;  3N5O A;  1XWC A;  3CTF A;  5ECO B;  5GAN D;  4MPF A;  5EPF A;  1TRV A;  4IP1 A;  3ZIV A;  3GSS A;  3GFK A;  5IPG A;  2YP6 A;  4BVY B;  2JSZ A;  4TRX A;  3IC8 A;  1WWJ A;  3BCK A;  1HNC A;  1MD4 A;  1VGL A;  3HVS A;  3VWX A;  1CQG A;  2NPB A;  2R37 A;  1I5G A;  2B3S A;  1GLQ A;  4G10 A;  3F4R A;  2VO4 A;  1JFU A;  2C0G A;  3VFI A;  2H0H A;  4XRA A;  5CP1 A;  4CW9 A;  1XVQ A;  3ZL5 A;  3KTL A;  4IKH A;  2IFQ B;  3G7J A;  2V1M A;  1F3B A;  5CRG A;  1UA5 A; 
#chains in the Genus database with same CATH topology
 1FVJ A;  2VCW A;  1R7H A;  3FW2 A;  3KP9 A;  1OVN A;  4MNN A;  2TRC P;  4ZL7 A;  1YDK A;  4NPB A;  2OE1 A;  4KDY A;  5DBQ A;  5HR2 A;  3HJO A;  3TJG A;  1H75 A;  2O85 A;  3NZN A;  4N0Z A;  3RHC A;  3IAS 2;  5DCH A;  6GSU A;  1QFN A;  2ZNM A;  2C0D A;  1PX6 A;  1ERW A;  3CMI A;  5DAL A;  4MF6 A;  2P31 A;  1G7E A;  1YZX A;  2JZR A;  2IMD A;  4OMV A;  5BMU A;  3HKR A;  3H79 A;  3DRN A;  3ZVJ D;  3FEU A;  3IAM 2;  1ON4 A;  3KCM A;  4IW9 A;  3HVX A;  2YCD A;  1U88 A;  2HSN A;  3RAZ A;  2GSQ A;  4IQ1 A;  4MH2 A;  4FQU A;  4F0C A;  2PPT A;  2MBS A;  2H66 A;  2A2R A;  1V40 A;  2WCI A;  4NXI A;  1Z9H A;  1ZYE A;  4ZXG A;  4BPY A;  3J7Y b;  3IK7 A;  2C0E A;  2VLU A;  1TP9 A;  2DKH A;  2G2Q A;  1YEW C;  2L4Q A;  2DJ1 A;  3KMO A;  5KN0 A;  3KZQ A;  3LFL A;  2FUG 2;  2H75 A;  1ZYQ B;  2K18 A;  1G6Y A;  1WJK A;  3VPQ A;  1SJZ A;  2F51 A;  4HU7 A;  2H72 A;  1SK0 A;  2YN1 A;  2CX4 A;  2H1L A;  1X0R A;  3GH6 A;  5ECN B;  2L6C A;  4ICY A;  4DSR A;  3LQ7 A;  1T7P B;  2HRK B;  3D21 A;  2O8V B;  4ML6 A;  6GSY A;  2PVO C;  3C1R A;  3EMP A;  1SK2 A;  1V57 A;  3TJK A;  4ZL8 A;  1YVL A;  1T3B A;  2JAC A;  2WVY A;  4PI2 C;  4EDY A;  3ME8 A;  4AGS A;  3ZIJ A;  3GV1 A;  2FGX A;  4K6X A;  3TKS E;  1WIK A;  3VLN A;  3MAK A;  1SU9 A;  1X5E A;  4FH8 A;  5IM9 A;  1PKZ A;  4AF2 A;  4KA0 A;  1GH2 A;  1YKC A;  5J4Y A;  3H8Q A;  4KUN A;  3M3M A;  2PBJ A;  2VCT A;  2EFH A;  2LQQ A;  4USS A;  4EE0 A;  2GZZ A;  3W8J A;  2HSH A;  3I6A A;  1H4O A;  2LJR A;  2WFC A;  1TKD B;  2YNX A;  4GSN A;  2X4A A;  4POK A;  1ERV A;  4Z2T A;  5CRD A;  1N8J A;  2BTO T;  5IMZ A;  2VL3 A;  3D4T A;  5AIS A;  3D4M A;  3LYK A;  3UL3 A;  3DXB A;  3APO A;  4Q5R A;  4P3Y B;  5JCU A;  1G7O A;  1ILO A;  4DSS B;  5ECS A;  3PH9 A;  1ACV A;  2CVK A;  1F3A A;  2V6O A;  3VWV A;  4ID0 A;  5A4V A;  1GUM A;  2NVL A;  1Y25 A;  2MMN A;  3GMF A;  2IFQ A;  3DVX A;  1X5D A;  4HUA A;  2I4A A;  3IHQ A;  1OC3 A;  3GX8 A;  4IVF A;  3F6D A;  1ZCP A;  4EKZ A;  2WZS A;  2KP2 A;  1PL2 A;  1XVW A;  1ZYN A;  6GSX A;  1NHY A;  2GGT A;  2PMT A;  3TKQ A;  5F06 A;  2VCX A;  2ON5 A;  1O8W A;  4ULX A;  4XS6 A;  2YWN A;  3MIX A;  4IHU A;  5FT3 A;  2A4H A;  1GTI A;  4G2E A;  2VD0 A;  1BG5 A;  5CRW A;  2WW1 A;  3GKK A;  2X8G A;  1NSW A;  22GS A;  3CSI A;  5LNK e;  2KOK A;  2IN3 A;  1S3A A;  4W66 A;  4LL1 B;  4J56 E;  1V2A A;  5KOX A;  2DIZ A;  4EUY A;  2FWG A;  3AY8 A;  4K0N A;  3D5J A;  4LMW A;  1OE8 A;  5ECR B;  4KDU A;  5IOW A;  2H73 A;  1KEB A;  5G31 A;  3QCP A;  1FG4 A;  1GP1 A;  1B8X A;  1B48 A;  1T4Y A;  4G19 A;  1GNW A;  2V41 A;  3QMX A;  3ME7 A;  2RM5 A;  4PUF C;  1TI1 A;  4BWS A;  2VLT A;  3KD0 A;  4G0L A;  4BL7 B;  3ZTL A;  2WUL A;  1R5P A;  2PVQ A;  1Z5Y E;  6GSS A;  1MDI A;  4CHS A;  3G7I A;  5ECQ B;  2F8F A;  1FVK A;  1YF0 A;  5G5E A;  3HDC A;  3KIJ A;  2VOC A;  4Q5F A;  1K3Y A;  4K2X A;  2H6Y A;  2MMA A;  3KXO A;  1M9B A;  4IJ3 A;  3MSZ A;  2YJ7 A;  3S9F A;  4HZ2 A;  1S4B P;  1KNG A;  1X9M B;  1ZOF A;  3HY2 A;  2B1L A;  4F82 A;  1UN2 A;  2HRK A;  1PD2 1;  4D73 B;  1SL2 B;  2GS3 A;  4RI7 A;  3NIV A;  1S3R A;  4KAE A;  5LD0 A;  1EEJ A;  3UVH A;  3TGZ A;  1M3J A;  2PER A;  3QR6 A;  4KCA A;  3O76 A;  3APS A;  3LYP A;  1T4Z A;  4N3Z A;  2FWE A;  4ZBD A;  5GSS A;  1GUK A;  4I97 A;  3C1S A;  2WRT A;  3VI5 A;  3RPP A;  3CBU A;  4HI7 A;  1O73 A;  4FIW A;  5A4U A;  1EOH A;  2DC5 A;  1JHB A;  1NM3 A;  1ZGN A;  4MCU A;  3L9S A;  3RFR C;  3NOF A;  4WF5 A;  4HSC X;  3PR8 A;  2G0F A;  2VUP A;  4POB A;  1XWB A;  4G0I A;  1HNA A;  18GS A;  1GUL A;  2N5F A;  1QMV A;  3HZ4 A;  1ABA A;  4EF0 A;  1O6J A;  4GQC A;  2HRN A;  1FAA A;  1R4W A;  1SVO A;  2H01 A;  2IPA A;  1F2E A;  1JZD A;  3TUE A;  1PA3 A;  1OKT A;  2REM A;  1Z6M A;  2H1B A;  5GZZ B;  3E0U A;  3DGQ A;  3H1N A;  4E68 A;  1KBN A;  1PRX A;  3D0Z A;  5BMU B;  4HDE A;  2QA2 A;  1BX9 A;  2P5Q A;  2C3T A;  1A2L A;  2L5L A;  1VF4 A;  3HCZ A;  5B8B A;  4MK3 A;  1M7T A;  2GVP A;  5DDL A;  2GDR A;  4F03 A;  2LQO A;  4ZIL A;  3M1G A;  4Q5N A;  1WP0 A;  3ERF A;  4X1U A;  2K6V A;  4J2F A;  2H30 A;  20GS A;  2V32 A;  3IRA A;  2L5O A;  3KMN A;  3UBL A;  1HD2 A;  1ERT A;  1YY7 A;  2L6D A;  4KW6 A;  2I81 A;  5IMF A;  4PI0 C;  5JCW A;  2O5V A;  4XTS A;  4K2D A;  4CDO A;  2IMK A;  5LCZ A;  2CQ9 A;  1OC8 A;  2OE3 A;  4KGI A;  2OA7 A;  5A5K A;  5KN3 A;  1SJ6 A;  5KN2 A;  2UZ8 A;  2I3Y A;  3GX0 A;  2WB9 A;  2H0I A;  2WW3 A;  5J40 A;  1Q98 A;  2LRC A;  2B1K A;  5D9W A;  1PN0 A;  5CRH A;  3U5R E;  1OC9 A;  1IYI A;  1J9B A;  4PQH A;  2ON7 A;  5B6N A;  4ECB A;  2HLS A;  1SJI A;  2JU5 A;  4G9H A;  4GF0 A;  4HZ4 A;  4O92 A;  4XRD A;  3I9V 2;  3CQF A;  4XHM A;  2AJQ B;  1TXU A;  2K9F A;  3IPZ A;  3M0F A;  4JE1 A;  1XW5 A;  5IIZ A;  1IYH A;  1SKS B;  5IOX A;  4PQI A;  3GST A;  3EIN A;  4YKF A;  3L78 A;  2GTU A;  4AI6 A;  3ERG A;  2MYG A;  5L71 A;  4MJA A;  3TB2 A;  4GWR A;  3DKS A;  3RHB A;  3F63 A;  4FYB A;  3IDV A;  1V98 A;  5IMA A;  1G0T A;  2L4C A;  2JZT A;  3EVI A;  2TIR A;  2LNS A;  1FHE A;  4QL7 A;  3PIN A;  3LW9 A;  5ENU A;  2B7K A;  3U6V A;  2CAQ A;  4JED A;  3FY7 A;  3RDW A;  1GL8 A;  4D73 A;  3TRQ A;  4A5P A;  1GSF A;  5F0G A;  1SD8 A;  3IK9 A;  4OFT A;  2O36 A;  2QKE A;  3WT2 A;  1Z6N A;  2FD3 A;  2X99 A;  2YZU A;  1FOH A;  2DML A;  2LNT A;  5IQY A;  3F9U A;  1A0R P;  1EV9 A;  2PN8 A;  2HQT A;  1BQ7 A;  2XBI A;  1AUC A;  5G30 A;  4TW5 A;  4K0G A;  1TK5 B;  3GA4 A;  2P5R A;  16GS A;  2AUV A;  3J7Y k;  3IE3 A;  2M46 A;  3G9B A;  1FB0 A;  2F9S A;  2A4V A;  1TU7 A;  3ZZX A;  2YOI A;  2WZ9 A;  4I2T A;  4GXZ A;  4ZB6 A;  3CSJ A;  1YQ1 A;  5E4W A;  1GTA A;  2QC7 A;  2VAF A;  4AJ7 A;  2IL3 A;  2RM6 A;  3D6I A;  2H1G A;  4V2N A;  2DKI A;  4YKG A;  2XPE A;  3ZRD A;  3P2A A;  4O5R A;  2PU9 C;  1PX7 A;  4K7N A;  3CHX C;  1X5C A;  1F37 A;  5DVB A;  4L0U A;  1NHO A;  5AN1 A;  2H8L A;  2O3E A;  3A2V A;  2OBI A;  2EFD A;  2HFD A;  2RLI A;  4N11 A;  4XS4 B;  4WR5 A;  1TW9 A;  2R4V A;  4MZC A;  1X9S B;  4EDZ A;  4EC0 A;  4KND A;  5FWG A;  7GSS A;  2VCQ A;  1OKD A;  1PL1 A;  4OFM A;  1XOA A;  3TJF A;  5DJL A;  1M2B A;  2X64 A;  1ST9 A;  2YAN A;  2AB6 A;  2R5G A;  3KH9 A;  4FO5 A;  2O87 A;  3WD6 A;  1TRS A;  4POM A;  4DVC A;  3HVV A;  2A2P A;  2EIR A;  3DIE A;  3QDN A;  1PSQ A;  3LOR A;  4TOP A;  4DEJ A;  5J47 A;  3N9J A;  4MPG A;  1K3L A;  4AKX B;  5BRT A;  3G7Y A;  1Z7P A;  2IIY A;  1JZO A;  1O85 A;  3IA1 A;  3CSH A;  3GH9 A;  2HZE A;  5J3R A;  4YQV A;  1QK8 A;  2LV3 A;  3GTU A;  1N25 A;  5H5Q A;  2IME A;  1GSY A;  1AXD A;  3US3 A;  1YKA A;  3F4S A;  5C04 A;  2NBS A;  2KUC A;  4GQF A;  4KH7 A;  2DJ0 A;  4NWY A;  2HRA A;  3LWA A;  2C8U A;  3P8W A;  2X49 A;  3FZ9 A;  3LG6 A;  4O32 A;  3GKM A;  2MZC A;  4MJE A;  3CXG A;  5D8I A;  1A2M A;  2KP1 A;  3LXZ A;  2LJA A;  4ZL9 A;  4LMV A;  4JBB A;  1EV4 A;  5DAK B;  4WEY A;  3DML A;  3GUS A;  1EZK A;  5ELA A;  2HE3 A;  4EVM A;  1AIU A;  1YF1 A;  3CYN A;  5KOW A;  4TVE A;  2GST A;  2WW0 A;  1SKR B;  1FO5 A;  3F3R A;  1SVM A;  3TU3 B;  1J0F A;  5GST A;  2GQK A;  4N30 A;  2B5Y A;  2O89 A;  4HU9 A;  1AQV A;  2X8C A;  1XOB A;  1URM A;  2LUS A;  5B6M A;  3I43 A;  2OBK A;  2L57 A;  2WS2 A;  2H76 A;  4K9Z A;  3QAW A;  4L8E A;  1BAY A;  1LBK A;  3VWU A;  1MD3 A;  3M8N A;  4ZB8 A;  1UC7 A;  1GTU A;  4HQZ A;  1XG8 A;  2LTK A;  1S3D A;  3KM6 A;  12GS A;  3EMX A;  3ZML A;  2DMM A;  1DUG A;  6GSW A;  1EGO A;  4OFN A;  2FA8 A;  3KEB A;  4I6X A;  3HHV A;  4HS1 A;  5HR3 A;  2WW2 A;  4IS0 A;  1QXH A;  1DE2 A;  2GZP A;  2VL9 A;  1WRY A;  2ZUP A;  13GS A;  1ML6 A;  3W6G A;  2VM1 A;  2HRF A;  3ERW A;  3VI7 A;  2WVZ A;  4BVX B;  4MH3 A;  3FR9 A;  3QAG A;  3R2Q A;  1Z3E A;  4YQU A;  4MZW A;  4WET A;  1TK8 B;  1OC9 B;  4JU5 A;  1MEK A;  2R0P A;  4JR4 A;  4N10 A;  1MDK A;  1I9D A;  1YJ6 A;  1F6M C;  1X9W B;  4FXY P;  4PXO A;  2H19 A;  3MNG A;  4KSM A;  3R3E A;  3KP8 A;  4XS4 A;  5A5H B;  4PUA A;  4JZQ A;  4PTS A;  1XWG A;  2H0G A;  1DBY A;  1THO A;  3C71 A;  4HOJ A;  2LRT A;  3FRC A;  3WGE A;  3GL3 A;  3HJM A;  4Z2R A;  4RQR A;  2FHE A;  1WE0 A;  4KX4 A;  1ZYP A;  2XHF A;  2R3X A;  1RK4 A;  4F0B A;  1K0B A;  3FHK A;  4NHZ A;  4GSS A;  2H6X A;  2EC4 A;  3LSZ A;  3FR6 A;  5INY A;  4MAB A;  4G01 A;  4PX1 A;  2K8S A;  3UBK A;  1NW2 A;  1XBS A;  4PGT A;  2FNO A;  3GUR A;  3CRU A;  3WGX A;  2HSY A;  2IMI A;  4Z7X A;  1B9X C;  1W89 A;  3GL5 A;  5ID2 A;  1XPV A;  1I1I P;  3L4N A;  2R0G A;  4AKH A;  4MP4 A;  2AYT A;  4K7O A;  4MJC A;  5D93 A;  2XPD A;  4EXJ A;  2EFE A;  3IXR A;  1AQW A;  1XCC A;  2F8A A;  3QFA C;  3SBC A;  2RII A;  3C8E A;  5D9V A;  4ZBA A;  1PQN A;  2HZF A;  2I1U A;  4X43 A;  4AJ8 A;  1B4Q A;  1N2A A;  3HMJ G;  1QUW A;  3A3T A;  1O7U A;  6GST A;  2E7P A;  1JLV A;  4TXO B;  2LJK A;  4NHW A;  3KJY A;  2F3M A;  3Q19 A;  2Z9S A;  2C80 A;  3VUR A;  5DAK A;  3DWV A;  3HZ8 A;  1K0C A;  2B7J A;  4O5U A;  1ERU A;  2B5X A;  4F2I A;  1SD9 A;  2CA8 A;  1LJR A;  1R26 A;  4CY6 A;  4PNF A;  4GST A;  1Y1U A;  5FHI A;  4E8H A;  1BYE A;  2I9H A;  4BWQ A;  4YAP A;  1T00 A;  3ZMK A;  3C7M A;  4AJ6 A;  5DJM A;  2AAW A;  2WJU A;  4IGJ A;  1FB6 A;  6GSV A;  2KHP A;  5HFG A;  3MDK A;  3F8U A;  1THX A;  4V1A p;  3PGT A;  4OO4 A;  4K1F A;  1GRX A;  1A0F A;  5D96 A;  5IO0 A;  4AKG A;  3GHA A;  1TU8 A;  17GS A;  1K0D A;  1A8L A;  1F9M A;  3BD2 A;  2YV7 A;  1ZZY A;  4ECC A;  3DVW A;  2VM2 A;  1UVZ A;  1FW1 A;  3IV4 A;  2GT6 A;  3V1W A;  4L5L A;  3KGK A;  3QD9 A;  2VCV A;  4X4J A;  2PGT A;  5G1L A;  2HYX A;  4ZB7 A;  3M9K A;  3IR4 A;  2DJK A;  2D2Z A;  5AGY A;  5ECL B;  1AC1 A;  4WF4 A;  3APQ A;  2C1Y A;  2GT5 A;  5F05 A;  3GRX A;  4OCE A;  1TRW A;  2DJ2 A;  4N0V A;  1E6B A;  3M9J A;  4IEL A;  3TKS C;  2C3N A;  3UIW A;  4BVX A;  3C73 A;  4WBR D;  4TR0 A;  1KTE A;  2CVD A;  3LEF A;  3P90 A;  2HZE B;  2JL4 A;  2CV4 A;  2OJL A;  3GTU B;  3HYP A;  3EU3 A;  3CRT A;  2O7K A;  1U3I A;  4HJM A;  3VPT A;  2N5B A;  3FZ5 A;  3TKS A;  1ZMA A;  5HQP A;  1SL0 B;  3F6F A;  1EWX A;  5A5H A;  4POL A;  3ED3 A;  1A2J A;  1XZO A;  3A2X A;  1TXX A;  2OT3 A;  3TKP A;  1GTB A;  4TKY A;  2X8H A;  4HEA 2;  5JWO B;  4KB3 A;  3QPM A;  1OE7 A;  2JSY A;  4ZIJ A;  5F07 A;  2DBC A;  1XWA A;  4V1A g;  2GQM A;  1JZR A;  2GQL A;  3BCI A;  1MTC A;  1M99 A;  4KF9 A;  3F0I A;  1AW9 A;  1HQO A;  1M2D A;  3SWL A;  5AIV A;  2KLX A;  2BMX A;  4K5R A;  3E3E A;  3GKN A;  3GN3 A;  2YWO A;  2ALB A;  5JCG A;  5D9X A;  2E2G A;  4H86 A;  1CQH A;  2OE0 A;  4MF5 A;  2EFC A;  3QFB C;  1T1V A;  5JWQ B;  2B6M A;  4GLT A;  5CO3 A;  4TR4 A;  4TR1 A;  4I8B A;  2ZCT A;  4I2U A;  3ZLP A;  4XS1 A;  9GSS A;  3VK9 A;  3MYD A;  4RI6 A;  2NTO A;  5IMV A;  3D22 A;  4TXO A;  5IMD A;  2DIY A;  5ABR A;  2WDU A;  1Z7R A;  1GSD A;  2FY6 A;  3IHG A;  1PKW A;  3VWW A;  2M72 A;  3HVN A;  4BA7 A;  3H93 A;  2WVX A;  2MMZ A;  3FZ4 A;  3A2W A;  3Q6O A;  3RBT A;  2R6K A;  1VRS D;  1C72 A;  2LRN A;  1PN9 A;  2VIM A;  3A5I A;  2VLV A;  4JR6 A;  5EVO A;  1AAZ A;  3EWL A;  5D9T A;  2C0F A;  4RQX A;  4G0K A;  4EL1 A;  2V2G A;  4HQS A;  5J5N A;  4LLR A;  1SL1 B;  5DQY A;  5KEJ A;  3FYG A;  1GLP A;  1VF2 A;  5G1K A;  1TK0 B;  5D73 A;  1R5A A;  3EU4 A;  1BED A;  5J4V A;  4WBJ A;  4K7I A;  4K5S A;  2XC2 A;  2GSS A;  1B4P A;  5J41 A;  5HFI A;  4O7H A;  2VL2 C;  2AHE A;  3HJP A;  1BJX A;  2J9H A;  1RQM A;  4LL4 B;  1SKW B;  5ECI B;  2QGV A;  2XBQ A;  5ID2 B;  3UJ1 A;  3PPU A;  3EC3 A;  4FYU A;  4ECJ A;  4IBP A;  2JZS A;  4YH2 A;  4BIK A;  3TOT A;  3H4K A;  3LGC A;  5G5F A;  2EIQ A;  1DE1 A;  2VL2 A;  1FOV A;  1OAZ A;  1GWC A;  3QAV A;  5J9C A;  1EGR A;  1Q4J A;  1PFO A;  3K8N A;  1PGT A;  4GDF A;  3RPN A;  3HA9 A;  3P7X A;  5CYY A;  3O3T A;  2DJ3 A;  8GSS A;  2YWM A;  1T8E B;  4LA1 A;  1GSU A;  4IP6 A;  4KE3 A;  4QQ7 A;  2AV4 A;  4IQA A;  3UMA A;  4F9Z A;  3LXT A;  4MLY A;  2HSM A;  3CWG A;  4MZB A;  4CY8 A;  3L9V A;  4FYC A;  4OO5 A;  2RUE A;  1XXU A;  3TOU A;  1PMT A;  2MBT A;  1TRU A;  1MDJ A;  1A23 A;  2HI7 A;  2IJY A;  3FKF A;  4E8E A;  5HFK A;  2CZ3 A;  1XW9 A;  1TDI A;  1W4V A;  2CX3 A;  4BVY A;  2YPM A;  2OAD A;  1GSQ A;  3WYW A;  3GNJ A;  1WOU A;  2VD1 A;  4IJI A;  1EP8 A;  2WGR A;  5IMC A;  1TOF A;  2H1D A;  3FMW A;  4J57 E;  4L0W A;  1BG1 A;  2GLR A;  2K8V A;  3RGB C;  4ZB9 A;  2H71 A;  5IPH A;  2N5A A;  4NV2 A;  3WT1 A;  1K3O A;  2HT9 A;  3GKX A;  2C3Q A;  4MDC A;  1LU4 A;  3DEX A;  3FR3 A;  1JZW A;  2FLS A;  2YV9 A;  4I5Q A;  5J9B A;  4IN0 A;  3ZFB A;  4PQ1 A;  4ZBB A;  2DLX A;  4PUR A;  2NDO A;  3BJ5 A;  1QGV A;  3UOM A;  3IC4 A;  4EIP A;  4V2L A;  2EIO A;  3ZFL A;  1YEX A;  5A34 B;  1S3C A;  4MMM A;  1VF3 A;  3UEM A;  3ZYW A;  2B5E A;  2BJX A;  1EEM A;  1SK1 A;  1SYX A;  1ZL9 A;  1GSS A;  3I69 A;  5CNW A;  5G2Z A;  2MMO A;  5C00 A;  4V2M A;  5EY6 A;  1WMJ A;  5A1N B;  3ISO A;  1U6T A;  4GTU A;  4MJB A;  3GIX A;  2CVB A;  3TJJ A;  5J4U A;  1AQX A;  4PNG A;  2C4J A;  5GAP D;  5CAX A;  1U87 A;  2TRX A;  1E2Y A;  3A5W A;  4MA9 A;  2RUF A;  3Q18 A;  5HR0 A;  2YJH A;  3TDG A;  4TR3 A;  11GS A;  4ECI A;  4YAV A;  2FWF A;  2LKU A;  2PWJ A;  5JWR B;  3HD5 A;  3GYK A;  2R0C A;  2GZY A;  3UAP A;  4WR4 A;  3ZIT A;  1B9Y C;  3KTB A;  3ZVJ A;  1EOG A;  2M80 A;  4WXT A;  3TKR A;  2QA1 A;  3FK8 A;  2E2M A;  4KDX A;  2FA4 A;  3L9U A;  4TXV A;  5ECP B;  1A8Y A;  2IWT A;  3FZA A;  14GS A;  4YQM A;  4ACS A;  10GS A;  3EPT A;  1QQ2 A;  1YEP A;  1HYU A;  19GS A;  4TR1 B;  1TI3 A;  3F3Q A;  1EP7 A;  2VKZ G;  4O5Q A;  4JRR A;  2FCH A;  3TJB A;  1K0M A;  2R2J A;  4EO3 A;  4GRF A;  4RUV A;  4ILF A;  3KH7 A;  5EL8 A;  1HNB A;  4OD7 A;  4KCE A;  1XW6 A;  1SVL A;  2H1A A;  4TN8 A;  3O6T A;  4OWY A;  2E0Q A;  1K0A A;  2DJJ A;  1DSB A;  2WVX B;  1OYJ A;  1WPI A;  2H74 A;  2OKA A;  3EE2 A;  3WGD A;  4XIH A;  2GSR A;  5ECK B;  4NMU A;  1SEN A;  2ES7 A;  1V58 A;  4MF7 A;  4OCF A;  3JCM L;  2A2S A;  1O8X A;  1VF1 A;  3UAR A;  5DAL B;  2H6Z A;  3QOU A;  5KN1 A;  1M2A A;  1GUH A;  1USB A;  1K0N A;  5IO2 A;  5DQS A;  1GNE A;  3L0H A;  3W8S A;  4NV5 A;  1K0O A;  4GCI A;  3MWH A;  3CTG A;  4DSS A;  2L59 A;  2HSN B;  3IBH A;  1Y6E A;  1TJD A;  2VCZ A;  1BF5 A;  3BOA A;  4Q5Q A;  2DSA A;  5B7C A;  1J08 A;  4ML1 A;  2OAC A;  2J23 A;  3TRX A;  4DSQ A;  3HXS A;  2YWI A;  4WKW A;  3OR5 A;  1SYR A;  2LST A;  3F4T A;  2JAD A;  4PHZ C;  1GSE A;  5ECH B;  3BBY A;  1M9A A;  3Q74 A;  2PUK C;  5H5S A;  1G6W A;  2CZ2 A;  2CAI A;  2LEG A;  5A4W A;  5H5R A;  4AKI A;  4L5O A;  1M0U A;  5F8B A;  4NAX A;  2FWH A;  5A34 A;  2V6K A;  3TRP A;  5CRE A;  2P0G A;  5ELG A;  1O81 A;  5DCG A;  1TTZ A;  2IMF A;  5E59 A;  3E9J B;  2QSI A;  2LS5 A;  3DD3 A;  5A1N A;  4K8M A;  3EUR A;  5HR1 A;  5B8A A;  2H70 A;  2HNL A;  5COH A;  4KSO A;  2HXK A;  1RW1 A;  1V9W A;  3EYT A;  1XIY A;  3LJR A;  4HJ2 A;  1JLW A;  4XCS A;  1XFL A;  1U3A A;  2HSM B;  4QL9 A;  3DYR A;  3TCO A;  1M3I A;  5AIX A;  3ZRE A;  4X0X A;  1XWK A;  3IOS A;  2YZH A;  5ECM B;  4ISD A;  3UVT A;  4BL7 A;  2CT6 A;  1A24 A;  3N5O A;  1XWC A;  3CTF A;  5ECO B;  5GAN D;  4MPF A;  5EPF A;  1TRV A;  4IP1 A;  3ZIV A;  3GSS A;  3GFK A;  5IPG A;  2YP6 A;  4BVY B;  2JSZ A;  4TRX A;  3IC8 A;  1WWJ A;  3BCK A;  1HNC A;  1MD4 A;  4QMK A;  1VGL A;  3HVS A;  2UV8 G;  4Z2U A;  3VWX A;  1CQG A;  2NPB A;  2R37 A;  1I5G A;  2B3S A;  1GLQ A;  4G10 A;  4EIQ A;  3F4R A;  2VO4 A;  1JFU A;  2C0G A;  3VFI A;  2H0H A;  4XRA A;  5CP1 A;  4CW9 A;  1XVQ A;  3ZL5 A;  3KTL A;  4IKH A;  2IFQ B;  3G7J A;  2V1M A;  1F3B A;  5CRG A;  1UA5 A; 
#chains in the Genus database with same CATH homology
 1FVJ A;  2VCW A;  1R7H A;  3FW2 A;  3KP9 A;  1OVN A;  4MNN A;  2TRC P;  4ZL7 A;  1YDK A;  4NPB A;  2OE1 A;  4KDY A;  5DBQ A;  5HR2 A;  3HJO A;  3TJG A;  1H75 A;  2O85 A;  3NZN A;  4N0Z A;  3RHC A;  3IAS 2;  5DCH A;  6GSU A;  1QFN A;  2ZNM A;  2C0D A;  1PX6 A;  1ERW A;  3CMI A;  5DAL A;  4MF6 A;  2P31 A;  1G7E A;  1YZX A;  2JZR A;  2IMD A;  4OMV A;  5BMU A;  3HKR A;  3H79 A;  3DRN A;  3ZVJ D;  3FEU A;  3IAM 2;  1ON4 A;  3KCM A;  4IW9 A;  3HVX A;  2YCD A;  1U88 A;  2HSN A;  3RAZ A;  2GSQ A;  4IQ1 A;  4MH2 A;  4FQU A;  4F0C A;  2PPT A;  2MBS A;  2H66 A;  2A2R A;  1V40 A;  2WCI A;  4NXI A;  1Z9H A;  1ZYE A;  4ZXG A;  4BPY A;  3J7Y b;  3IK7 A;  2C0E A;  2VLU A;  1TP9 A;  2DKH A;  2G2Q A;  2L4Q A;  2DJ1 A;  3KMO A;  5KN0 A;  3KZQ A;  3LFL A;  2FUG 2;  2H75 A;  1ZYQ B;  2K18 A;  1G6Y A;  1WJK A;  3VPQ A;  1SJZ A;  2F51 A;  4HU7 A;  2H72 A;  1SK0 A;  2YN1 A;  2CX4 A;  2H1L A;  1X0R A;  3GH6 A;  5ECN B;  2L6C A;  4ICY A;  4DSR A;  3LQ7 A;  1T7P B;  2HRK B;  3D21 A;  2O8V B;  4ML6 A;  6GSY A;  2PVO C;  3C1R A;  3EMP A;  1SK2 A;  1V57 A;  3TJK A;  4ZL8 A;  1YVL A;  1T3B A;  2JAC A;  4EDY A;  3ME8 A;  4AGS A;  3ZIJ A;  3GV1 A;  2FGX A;  4K6X A;  3TKS E;  1WIK A;  3VLN A;  3MAK A;  1SU9 A;  1X5E A;  4FH8 A;  5IM9 A;  1PKZ A;  4AF2 A;  4KA0 A;  1GH2 A;  1YKC A;  5J4Y A;  3H8Q A;  4KUN A;  3M3M A;  2PBJ A;  2VCT A;  2EFH A;  2LQQ A;  4USS A;  4EE0 A;  2GZZ A;  3W8J A;  2HSH A;  3I6A A;  1H4O A;  2LJR A;  2WFC A;  1TKD B;  2YNX A;  4GSN A;  2X4A A;  4POK A;  1ERV A;  4Z2T A;  5CRD A;  1N8J A;  2BTO T;  5IMZ A;  2VL3 A;  3D4T A;  5AIS A;  3D4M A;  3LYK A;  3UL3 A;  3DXB A;  3APO A;  4Q5R A;  4P3Y B;  5JCU A;  1G7O A;  1ILO A;  4DSS B;  5ECS A;  3PH9 A;  1ACV A;  2CVK A;  1F3A A;  2V6O A;  3VWV A;  4ID0 A;  5A4V A;  1GUM A;  2NVL A;  1Y25 A;  2MMN A;  3GMF A;  2IFQ A;  3DVX A;  1X5D A;  4HUA A;  2I4A A;  3IHQ A;  1OC3 A;  3GX8 A;  4IVF A;  3F6D A;  1ZCP A;  4EKZ A;  2KP2 A;  1PL2 A;  1XVW A;  1ZYN A;  6GSX A;  1NHY A;  2GGT A;  2PMT A;  3TKQ A;  5F06 A;  2VCX A;  2ON5 A;  1O8W A;  4ULX A;  4XS6 A;  2YWN A;  3MIX A;  4IHU A;  5FT3 A;  2A4H A;  1GTI A;  4G2E A;  2VD0 A;  1BG5 A;  5CRW A;  3GKK A;  2X8G A;  1NSW A;  22GS A;  3CSI A;  5LNK e;  2KOK A;  2IN3 A;  1S3A A;  4W66 A;  4LL1 B;  4J56 E;  1V2A A;  5KOX A;  2DIZ A;  4EUY A;  2FWG A;  3AY8 A;  4K0N A;  3D5J A;  4LMW A;  1OE8 A;  5ECR B;  4KDU A;  5IOW A;  2H73 A;  1KEB A;  5G31 A;  3QCP A;  1FG4 A;  1GP1 A;  1B8X A;  1B48 A;  1T4Y A;  4G19 A;  1GNW A;  2V41 A;  3QMX A;  3ME7 A;  2RM5 A;  4PUF C;  1TI1 A;  4BWS A;  2VLT A;  3KD0 A;  4G0L A;  4BL7 B;  3ZTL A;  2WUL A;  1R5P A;  2PVQ A;  1Z5Y E;  6GSS A;  1MDI A;  4CHS A;  3G7I A;  5ECQ B;  2F8F A;  1FVK A;  1YF0 A;  5G5E A;  3HDC A;  3KIJ A;  2VOC A;  4Q5F A;  1K3Y A;  4K2X A;  2H6Y A;  2MMA A;  3KXO A;  1M9B A;  4IJ3 A;  3MSZ A;  2YJ7 A;  3S9F A;  4HZ2 A;  1KNG A;  1X9M B;  1ZOF A;  3HY2 A;  2B1L A;  4F82 A;  1UN2 A;  2HRK A;  1PD2 1;  4D73 B;  1SL2 B;  2GS3 A;  4RI7 A;  3NIV A;  4KAE A;  5LD0 A;  1EEJ A;  3UVH A;  3TGZ A;  2PER A;  3QR6 A;  4KCA A;  3O76 A;  3APS A;  3LYP A;  1T4Z A;  4N3Z A;  2FWE A;  4ZBD A;  5GSS A;  1GUK A;  4I97 A;  3C1S A;  2WRT A;  3VI5 A;  3RPP A;  3CBU A;  4HI7 A;  1O73 A;  4FIW A;  5A4U A;  1EOH A;  2DC5 A;  1JHB A;  1NM3 A;  1ZGN A;  4MCU A;  3L9S A;  3NOF A;  4WF5 A;  3PR8 A;  2G0F A;  2VUP A;  4POB A;  1XWB A;  4G0I A;  1HNA A;  18GS A;  1GUL A;  2N5F A;  1QMV A;  3HZ4 A;  1ABA A;  4EF0 A;  1O6J A;  4GQC A;  2HRN A;  1FAA A;  1R4W A;  1SVO A;  2H01 A;  2IPA A;  1F2E A;  1JZD A;  3TUE A;  1PA3 A;  1OKT A;  2REM A;  1Z6M A;  2H1B A;  5GZZ B;  3E0U A;  3DGQ A;  3H1N A;  4E68 A;  1KBN A;  1PRX A;  3D0Z A;  5BMU B;  4HDE A;  2QA2 A;  1BX9 A;  1A2L A;  2C3T A;  2L5L A;  2P5Q A;  1VF4 A;  3HCZ A;  5B8B A;  4MK3 A;  1M7T A;  2GVP A;  5DDL A;  2GDR A;  4F03 A;  2LQO A;  4ZIL A;  3M1G A;  4Q5N A;  1WP0 A;  3ERF A;  4X1U A;  2K6V A;  4J2F A;  2H30 A;  20GS A;  2V32 A;  3IRA A;  2L5O A;  3KMN A;  3UBL A;  1HD2 A;  1ERT A;  1YY7 A;  2L6D A;  4KW6 A;  2I81 A;  5IMF A;  5JCW A;  2O5V A;  4XTS A;  4K2D A;  4CDO A;  2IMK A;  5LCZ A;  2CQ9 A;  1OC8 A;  2OE3 A;  4KGI A;  2OA7 A;  5A5K A;  5KN3 A;  1SJ6 A;  5KN2 A;  2UZ8 A;  2I3Y A;  3GX0 A;  2WB9 A;  2H0I A;  5J40 A;  1Q98 A;  2LRC A;  2B1K A;  5D9W A;  1PN0 A;  5CRH A;  3U5R E;  1OC9 A;  1IYI A;  1J9B A;  4PQH A;  2ON7 A;  5B6N A;  4ECB A;  2HLS A;  1SJI A;  2JU5 A;  4G9H A;  4GF0 A;  4HZ4 A;  4O92 A;  4XRD A;  3I9V 2;  4XHM A;  2AJQ B;  1TXU A;  2K9F A;  3IPZ A;  3M0F A;  4JE1 A;  1XW5 A;  5IIZ A;  1IYH A;  1SKS B;  5IOX A;  4PQI A;  3GST A;  3EIN A;  4YKF A;  3L78 A;  2GTU A;  4AI6 A;  3ERG A;  2MYG A;  5L71 A;  4MJA A;  3TB2 A;  4GWR A;  3DKS A;  3RHB A;  3F63 A;  4FYB A;  3IDV A;  1V98 A;  5IMA A;  1G0T A;  2L4C A;  2JZT A;  3EVI A;  2TIR A;  2LNS A;  1FHE A;  4QL7 A;  3PIN A;  3LW9 A;  5ENU A;  2B7K A;  3U6V A;  2CAQ A;  4JED A;  3FY7 A;  3RDW A;  1GL8 A;  4D73 A;  3TRQ A;  4A5P A;  1GSF A;  5F0G A;  1SD8 A;  3IK9 A;  4OFT A;  2QKE A;  3WT2 A;  1Z6N A;  2FD3 A;  2X99 A;  2YZU A;  1FOH A;  2DML A;  2LNT A;  5IQY A;  3F9U A;  1A0R P;  1EV9 A;  2PN8 A;  2HQT A;  1BQ7 A;  2XBI A;  1AUC A;  5G30 A;  4TW5 A;  4K0G A;  1TK5 B;  3GA4 A;  2P5R A;  16GS A;  2AUV A;  3J7Y k;  3IE3 A;  2M46 A;  3G9B A;  1FB0 A;  2F9S A;  2A4V A;  1TU7 A;  3ZZX A;  2YOI A;  2WZ9 A;  4I2T A;  4GXZ A;  4ZB6 A;  3CSJ A;  1YQ1 A;  5E4W A;  1GTA A;  2QC7 A;  2VAF A;  4AJ7 A;  2IL3 A;  2RM6 A;  3D6I A;  2H1G A;  4V2N A;  2DKI A;  4YKG A;  2XPE A;  3ZRD A;  3P2A A;  4O5R A;  2PU9 C;  1PX7 A;  4K7N A;  1X5C A;  1F37 A;  5DVB A;  4L0U A;  1NHO A;  5AN1 A;  2H8L A;  3A2V A;  2OBI A;  2EFD A;  2HFD A;  2RLI A;  4N11 A;  4XS4 B;  4WR5 A;  1TW9 A;  2R4V A;  4MZC A;  1X9S B;  4EDZ A;  4EC0 A;  4KND A;  5FWG A;  7GSS A;  2VCQ A;  1OKD A;  1PL1 A;  4OFM A;  1XOA A;  3TJF A;  5DJL A;  1M2B A;  2X64 A;  1ST9 A;  2YAN A;  2AB6 A;  2R5G A;  3KH9 A;  4FO5 A;  2O87 A;  3WD6 A;  1TRS A;  4POM A;  4DVC A;  3HVV A;  2A2P A;  2EIR A;  3DIE A;  3QDN A;  1PSQ A;  3LOR A;  4TOP A;  4DEJ A;  5J47 A;  3N9J A;  4MPG A;  1K3L A;  4AKX B;  5BRT A;  3G7Y A;  1Z7P A;  2IIY A;  1JZO A;  1O85 A;  3IA1 A;  3CSH A;  3GH9 A;  2HZE A;  5J3R A;  4YQV A;  1QK8 A;  2LV3 A;  3GTU A;  1N25 A;  5H5Q A;  2IME A;  1GSY A;  1AXD A;  3US3 A;  1YKA A;  3F4S A;  5C04 A;  2NBS A;  2KUC A;  4GQF A;  4KH7 A;  2DJ0 A;  4NWY A;  2HRA A;  3LWA A;  2C8U A;  3P8W A;  2X49 A;  3FZ9 A;  3LG6 A;  4O32 A;  3GKM A;  2MZC A;  4MJE A;  3CXG A;  5D8I A;  1A2M A;  2KP1 A;  3LXZ A;  2LJA A;  4ZL9 A;  4LMV A;  4JBB A;  1EV4 A;  5DAK B;  4WEY A;  3DML A;  3GUS A;  1EZK A;  5ELA A;  2HE3 A;  4EVM A;  1AIU A;  1YF1 A;  3CYN A;  5KOW A;  4TVE A;  2GST A;  1SKR B;  1FO5 A;  3F3R A;  1SVM A;  3TU3 B;  1J0F A;  5GST A;  2GQK A;  4N30 A;  2B5Y A;  2O89 A;  4HU9 A;  1AQV A;  2X8C A;  1XOB A;  1URM A;  2LUS A;  5B6M A;  3I43 A;  2OBK A;  2L57 A;  2WS2 A;  2H76 A;  4K9Z A;  3QAW A;  4L8E A;  1BAY A;  1LBK A;  3VWU A;  1MD3 A;  3M8N A;  4ZB8 A;  1UC7 A;  1GTU A;  4HQZ A;  2LTK A;  1S3D A;  3KM6 A;  12GS A;  3EMX A;  3ZML A;  2DMM A;  1DUG A;  6GSW A;  1EGO A;  4OFN A;  2FA8 A;  3KEB A;  4I6X A;  3HHV A;  4HS1 A;  5HR3 A;  4IS0 A;  1QXH A;  1DE2 A;  2GZP A;  2VL9 A;  1WRY A;  2ZUP A;  13GS A;  1ML6 A;  3W6G A;  2VM1 A;  2HRF A;  3ERW A;  3VI7 A;  4BVX B;  4MH3 A;  3FR9 A;  3QAG A;  3R2Q A;  1Z3E A;  4YQU A;  4MZW A;  4WET A;  1TK8 B;  1OC9 B;  4JU5 A;  1MEK A;  2R0P A;  4JR4 A;  4N10 A;  1MDK A;  1I9D A;  1YJ6 A;  1F6M C;  1X9W B;  4PXO A;  2H19 A;  3MNG A;  4KSM A;  3R3E A;  3KP8 A;  4XS4 A;  5A5H B;  4PUA A;  4JZQ A;  4PTS A;  1XWG A;  2H0G A;  1DBY A;  1THO A;  3C71 A;  4HOJ A;  2LRT A;  3FRC A;  3WGE A;  3GL3 A;  3HJM A;  4Z2R A;  4RQR A;  2FHE A;  1WE0 A;  4KX4 A;  1ZYP A;  2XHF A;  2R3X A;  1RK4 A;  4F0B A;  1K0B A;  3FHK A;  4NHZ A;  4GSS A;  2H6X A;  2EC4 A;  3LSZ A;  3FR6 A;  5INY A;  4MAB A;  4G01 A;  4PX1 A;  2K8S A;  3UBK A;  1NW2 A;  1XBS A;  4PGT A;  2FNO A;  3GUR A;  3CRU A;  3WGX A;  2HSY A;  2IMI A;  4Z7X A;  1B9X C;  1W89 A;  3GL5 A;  5ID2 A;  1XPV A;  3L4N A;  2R0G A;  4AKH A;  4MP4 A;  2AYT A;  4K7O A;  4MJC A;  5D93 A;  2XPD A;  4EXJ A;  2EFE A;  3IXR A;  1AQW A;  1XCC A;  2F8A A;  3QFA C;  3SBC A;  2RII A;  3C8E A;  5D9V A;  4ZBA A;  1PQN A;  2HZF A;  2I1U A;  4X43 A;  4AJ8 A;  1B4Q A;  1N2A A;  3HMJ G;  1QUW A;  3A3T A;  1O7U A;  6GST A;  2E7P A;  1JLV A;  4TXO B;  2LJK A;  4NHW A;  3KJY A;  2F3M A;  3Q19 A;  2Z9S A;  2C80 A;  3VUR A;  5DAK A;  3DWV A;  3HZ8 A;  1K0C A;  2B7J A;  4O5U A;  1ERU A;  2B5X A;  4F2I A;  1SD9 A;  2CA8 A;  1LJR A;  1R26 A;  4CY6 A;  4PNF A;  4GST A;  1Y1U A;  5FHI A;  4E8H A;  1BYE A;  2I9H A;  4BWQ A;  4YAP A;  1T00 A;  3ZMK A;  3C7M A;  4AJ6 A;  5DJM A;  2AAW A;  2WJU A;  4IGJ A;  1FB6 A;  6GSV A;  2KHP A;  5HFG A;  3MDK A;  3F8U A;  1THX A;  4V1A p;  3PGT A;  4OO4 A;  4K1F A;  1GRX A;  1A0F A;  5D96 A;  5IO0 A;  4AKG A;  3GHA A;  1TU8 A;  17GS A;  1K0D A;  1A8L A;  1F9M A;  3BD2 A;  2YV7 A;  1ZZY A;  4ECC A;  3DVW A;  2VM2 A;  1UVZ A;  1FW1 A;  3IV4 A;  2GT6 A;  3V1W A;  4L5L A;  3KGK A;  3QD9 A;  2VCV A;  4X4J A;  2PGT A;  5G1L A;  2HYX A;  4ZB7 A;  3M9K A;  3IR4 A;  2DJK A;  2D2Z A;  5AGY A;  5ECL B;  1AC1 A;  4WF4 A;  3APQ A;  2C1Y A;  2GT5 A;  5F05 A;  3GRX A;  4OCE A;  1TRW A;  2DJ2 A;  4N0V A;  1E6B A;  3M9J A;  4IEL A;  3TKS C;  2C3N A;  3UIW A;  4BVX A;  3C73 A;  4WBR D;  4TR0 A;  1KTE A;  2CVD A;  3LEF A;  3P90 A;  2HZE B;  2JL4 A;  2CV4 A;  2OJL A;  3GTU B;  3HYP A;  3EU3 A;  3CRT A;  2O7K A;  1U3I A;  4HJM A;  3VPT A;  2N5B A;  3FZ5 A;  3TKS A;  1ZMA A;  5HQP A;  1SL0 B;  3F6F A;  1EWX A;  5A5H A;  4POL A;  3ED3 A;  1A2J A;  1XZO A;  3A2X A;  1TXX A;  2OT3 A;  3TKP A;  1GTB A;  4TKY A;  2X8H A;  4HEA 2;  5JWO B;  4KB3 A;  3QPM A;  1OE7 A;  2JSY A;  4ZIJ A;  5F07 A;  2DBC A;  1XWA A;  4V1A g;  2GQM A;  1JZR A;  2GQL A;  3BCI A;  1MTC A;  1M99 A;  4KF9 A;  3F0I A;  1AW9 A;  1HQO A;  1M2D A;  3SWL A;  5AIV A;  2KLX A;  2BMX A;  4K5R A;  3E3E A;  3GKN A;  3GN3 A;  2YWO A;  2ALB A;  5JCG A;  5D9X A;  2E2G A;  4H86 A;  1CQH A;  2OE0 A;  4MF5 A;  2EFC A;  3QFB C;  1T1V A;  5JWQ B;  2B6M A;  4GLT A;  5CO3 A;  4TR4 A;  4TR1 A;  4I8B A;  2ZCT A;  4I2U A;  3ZLP A;  4XS1 A;  9GSS A;  3VK9 A;  3MYD A;  4RI6 A;  2NTO A;  5IMV A;  3D22 A;  4TXO A;  5IMD A;  2DIY A;  5ABR A;  2WDU A;  1Z7R A;  1GSD A;  2FY6 A;  3IHG A;  1PKW A;  3VWW A;  2M72 A;  4BA7 A;  3H93 A;  2MMZ A;  3FZ4 A;  3A2W A;  3Q6O A;  3RBT A;  2R6K A;  1VRS D;  1C72 A;  2LRN A;  1PN9 A;  2VIM A;  3A5I A;  2VLV A;  4JR6 A;  5EVO A;  1AAZ A;  3EWL A;  5D9T A;  2C0F A;  4RQX A;  4G0K A;  4EL1 A;  2V2G A;  4HQS A;  5J5N A;  4LLR A;  1SL1 B;  5DQY A;  5KEJ A;  3FYG A;  1GLP A;  1VF2 A;  5G1K A;  1TK0 B;  5D73 A;  1R5A A;  3EU4 A;  1BED A;  5J4V A;  4WBJ A;  4K7I A;  4K5S A;  2XC2 A;  2GSS A;  1B4P A;  5J41 A;  5HFI A;  4O7H A;  2VL2 C;  2AHE A;  3HJP A;  1BJX A;  2J9H A;  1RQM A;  4LL4 B;  1SKW B;  5ECI B;  2QGV A;  2XBQ A;  5ID2 B;  3UJ1 A;  3PPU A;  3EC3 A;  4FYU A;  4ECJ A;  4IBP A;  2JZS A;  4YH2 A;  3TOT A;  3H4K A;  3LGC A;  5G5F A;  2EIQ A;  1DE1 A;  2VL2 A;  1FOV A;  1OAZ A;  1GWC A;  3QAV A;  5J9C A;  1EGR A;  1Q4J A;  3K8N A;  1PGT A;  4GDF A;  3RPN A;  3HA9 A;  3P7X A;  5CYY A;  3O3T A;  2DJ3 A;  8GSS A;  2YWM A;  1T8E B;  4LA1 A;  1GSU A;  4IP6 A;  4KE3 A;  4QQ7 A;  2AV4 A;  4IQA A;  3UMA A;  4F9Z A;  3LXT A;  4MLY A;  2HSM A;  3CWG A;  4MZB A;  4CY8 A;  3L9V A;  4FYC A;  4OO5 A;  2RUE A;  1XXU A;  3TOU A;  1PMT A;  2MBT A;  1TRU A;  1MDJ A;  1A23 A;  2HI7 A;  2IJY A;  3FKF A;  4E8E A;  5HFK A;  2CZ3 A;  1XW9 A;  1TDI A;  1W4V A;  2CX3 A;  4BVY A;  2YPM A;  2OAD A;  1GSQ A;  3WYW A;  3GNJ A;  1WOU A;  2VD1 A;  4IJI A;  1EP8 A;  2WGR A;  5IMC A;  1TOF A;  2H1D A;  3FMW A;  4J57 E;  4L0W A;  1BG1 A;  2GLR A;  2K8V A;  4ZB9 A;  2H71 A;  5IPH A;  2N5A A;  4NV2 A;  3WT1 A;  1K3O A;  2HT9 A;  3GKX A;  2C3Q A;  4MDC A;  1LU4 A;  3DEX A;  3FR3 A;  1JZW A;  2FLS A;  2YV9 A;  4I5Q A;  5J9B A;  4IN0 A;  3ZFB A;  4PQ1 A;  4ZBB A;  2DLX A;  4PUR A;  2NDO A;  3BJ5 A;  1QGV A;  3UOM A;  3IC4 A;  4EIP A;  4V2L A;  2EIO A;  3ZFL A;  1YEX A;  5A34 B;  1S3C A;  4MMM A;  1VF3 A;  3UEM A;  3ZYW A;  2B5E A;  2BJX A;  1EEM A;  1SK1 A;  1SYX A;  1ZL9 A;  1GSS A;  3I69 A;  5CNW A;  5G2Z A;  2MMO A;  5C00 A;  4V2M A;  5EY6 A;  1WMJ A;  5A1N B;  3ISO A;  1U6T A;  4GTU A;  4MJB A;  3GIX A;  2CVB A;  3TJJ A;  5J4U A;  1AQX A;  4PNG A;  2C4J A;  5GAP D;  5CAX A;  1U87 A;  2TRX A;  1E2Y A;  3A5W A;  4MA9 A;  2RUF A;  3Q18 A;  5HR0 A;  2YJH A;  3TDG A;  4TR3 A;  11GS A;  4ECI A;  4YAV A;  2FWF A;  2LKU A;  2PWJ A;  5JWR B;  3HD5 A;  3GYK A;  2R0C A;  2GZY A;  3UAP A;  4WR4 A;  3ZIT A;  1B9Y C;  3KTB A;  3ZVJ A;  1EOG A;  2M80 A;  4WXT A;  3TKR A;  2QA1 A;  3FK8 A;  2E2M A;  4KDX A;  2FA4 A;  3L9U A;  4TXV A;  5ECP B;  1A8Y A;  2IWT A;  3FZA A;  14GS A;  4YQM A;  4ACS A;  10GS A;  3EPT A;  1QQ2 A;  1YEP A;  1HYU A;  19GS A;  4TR1 B;  1TI3 A;  3F3Q A;  1EP7 A;  2VKZ G;  4O5Q A;  4JRR A;  2FCH A;  3TJB A;  1K0M A;  2R2J A;  4EO3 A;  4GRF A;  4RUV A;  4ILF A;  3KH7 A;  5EL8 A;  1HNB A;  4OD7 A;  4KCE A;  1XW6 A;  1SVL A;  2H1A A;  4TN8 A;  3O6T A;  4OWY A;  2E0Q A;  1K0A A;  2DJJ A;  1DSB A;  1OYJ A;  1WPI A;  2H74 A;  2OKA A;  3EE2 A;  3WGD A;  4XIH A;  2GSR A;  5ECK B;  4NMU A;  1SEN A;  2ES7 A;  1V58 A;  4MF7 A;  4OCF A;  3JCM L;  2A2S A;  1O8X A;  1VF1 A;  3UAR A;  5DAL B;  2H6Z A;  3QOU A;  5KN1 A;  1M2A A;  1GUH A;  1USB A;  1K0N A;  5IO2 A;  5DQS A;  1GNE A;  3L0H A;  3W8S A;  4NV5 A;  1K0O A;  4GCI A;  3MWH A;  3CTG A;  4DSS A;  2L59 A;  2HSN B;  3IBH A;  1Y6E A;  1TJD A;  2VCZ A;  1BF5 A;  3BOA A;  4Q5Q A;  2DSA A;  5B7C A;  1J08 A;  4ML1 A;  2OAC A;  2J23 A;  3TRX A;  4DSQ A;  3HXS A;  2YWI A;  4WKW A;  3OR5 A;  1SYR A;  2LST A;  3F4T A;  2JAD A;  1GSE A;  5ECH B;  3BBY A;  1M9A A;  3Q74 A;  2PUK C;  5H5S A;  1G6W A;  2CZ2 A;  2CAI A;  2LEG A;  5A4W A;  5H5R A;  4AKI A;  4L5O A;  1M0U A;  5F8B A;  4NAX A;  2FWH A;  5A34 A;  2V6K A;  3TRP A;  5CRE A;  2P0G A;  5ELG A;  1O81 A;  5DCG A;  1TTZ A;  2IMF A;  5E59 A;  3E9J B;  2QSI A;  2LS5 A;  3DD3 A;  5A1N A;  4K8M A;  3EUR A;  5HR1 A;  5B8A A;  2H70 A;  2HNL A;  5COH A;  4KSO A;  2HXK A;  1RW1 A;  1V9W A;  3EYT A;  1XIY A;  3LJR A;  4HJ2 A;  1JLW A;  4XCS A;  1XFL A;  1U3A A;  2HSM B;  4QL9 A;  3DYR A;  3TCO A;  5AIX A;  3ZRE A;  4X0X A;  1XWK A;  3IOS A;  2YZH A;  5ECM B;  4ISD A;  3UVT A;  4BL7 A;  2CT6 A;  1A24 A;  3N5O A;  1XWC A;  3CTF A;  5ECO B;  5GAN D;  4MPF A;  5EPF A;  1TRV A;  4IP1 A;  3ZIV A;  3GSS A;  3GFK A;  5IPG A;  2YP6 A;  4BVY B;  2JSZ A;  4TRX A;  3IC8 A;  1WWJ A;  3BCK A;  1HNC A;  1MD4 A;  4QMK A;  1VGL A;  3HVS A;  2UV8 G;  4Z2U A;  3VWX A;  1CQG A;  2NPB A;  2R37 A;  1I5G A;  2B3S A;  1GLQ A;  4G10 A;  4EIQ A;  3F4R A;  2VO4 A;  1JFU A;  2C0G A;  3VFI A;  2H0H A;  4XRA A;  5CP1 A;  4CW9 A;  1XVQ A;  3ZL5 A;  3KTL A;  4IKH A;  2IFQ B;  3G7J A;  2V1M A;  1F3B A;  5CRG A;  1UA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...