1B48A

Crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
AAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRIVLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Crystal structure of a murine glutathione S-transferase in complex with a glutathione conjugate of 4-hydroxynon-2-enal in one subunit and glutathione in the other: evidence of signaling across the dimer interface.
pubmed doi rcsb
source organism Mus musculus
total genus 74
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1b48A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b48A01
1FAAA 4FYUA 4OCEA 1PX7A 3D4MA 4EKZA 4X1UA 4DVCA 3KZQA 1GUMA 1XWGA 2YZUA 3TJBA 4MJCA 2HT9A 1ILOA 1A23A 2H72A 2N5AA 1FVJA 1OC9A 5EPFA 6GSVA 2IFQB 3C1RA 1SK1A 4K6XA 4XS1A 2CX3A 3P8WA 1M7TA 5A4WA 3G7YA 2CAQA 2VLVA 4N0VA 3GHAA 4KGIA 2H73A 4I6XA 3QOUA 4BL7B 1EP7A 4JZQA 3LORA 2F9SA 4MF5A 1EV4A 2VM2A 2LJKA 2EIQA 2LNTA 4MF7A 2FUG2 2K8VA 2FWEA 3DWVA 2P5RA 2Z9SA 5ABRA 4ECJA 2YWMA 1AC1A 3GRXA 2I4AA 1Q4JA 2WZ9A 1WWJA 1F3AA 2X8GA 4PX1A 2E2GA 5DJLA 1UC7A 5JWRB 3LXZA 1M2AA 4IGJA 5IMAA 5ECIB 1DBYA 3ISOA 1Y25A 1JZDA 4K7OA 3VPQA 1ABAA 1GLQA 1VF4A 2VM1A 1YJ6A 4GQCA 1URMA 4NMUA 3KH7A 3TRXA 3KIJA 3TKPA 4PGTA 3W8SA 1A8YA 5IMCA 1K3LA 2PBJA 4EUYA 3F0IA 3EU4A 4OCFA 1G0TA 1XWBA 1THXA 1OC3A 1NHYA 2FY6A 3A2WA 1IYHA 1XPVA 4WR5A 2LTKA 3U6VA 3H1NA 4FQUA 4G0LA 3IC4A 4X0XA 4MDCA 1V58A 3HVXA 4F2IA 1MDJA 3TB2A 1WMJA 3L9UA 3QAGA 3HHVA 2MMAA 3KH9A 4BA7A 3HYPA 1K0CA 1TI1A 2L6CA 4JEDA 1MD4A 4MH3A 4JR4A 2WFCA 4OWYA 1EZKA 2B1KA 1M9BA 5J9BA 4KA0A 1LBKA 2JADA 2E7PA 2LRCA 18GSA 5EY6A 3GSTA 1CQHA 1H4OA 2H0IA 3IDVA 3ZFBA 1F2EA 1GUHA 4XS6A 5C00A 4OFNA 4O7HA 3ZIVA 8GSSA 3FW2A 2RUEA 2KP1A 4AJ8A 5COHA 4OO5A 2HQTA 1GSEA 4KSOA 20GSA 2PERA 1BQ7A 2ON7A 3WD6A 4IQAA 2IFQA 1VF2A 3FYGA 3JCML 2GSSA 2DJKA 4TN8A 1HNAA 5L71A 1KBNA 2NVLA 4D73B 4G9HA 5LNKe 1NW2A 2VL3A 2B5EA 1HNCA 3M9JA 3ZVJD 1BYEA 1YQ1A 3UIWA 4I8BA 3HJMA 3ZTLA 1WJKA 1HQOA 4PTSA 2C0DA 1GL8A 4MJBA 3GMFA 3NOFA 5IMDA 4XIHA 3DYRA 6GSTA 4V2MA 2YV9A 5GSTA 3HVVA 4KH7A 1PKWA 1V9WA 5KN3A 2EIRA 4HI7A 1B8XA 5ECQB 3UVHA 2JZSA 1UVZA 5A4UA 5DDLA 1OVNA 1Z9HA 1R5PA 5F06A 4ACSA 3F6FA 2OBIA 2B6MA 3P7XA 3IPZA 1ON4A 4G0KA 3RHBA 4TR0A 2V32A 2VL2A 1EOHA 1DSBA 2K9FA 2H1GA 4HZ4A 5ECRB 2GS3A 5D9TA 2PPTA 2JL4A 3MNGA 2HZFA 2TIRA 1TRUA 2REMA 4PNFA 1U87A 1GNEA 3TCOA 1AW9A 3BOAA 1SKSB 2LSTA 2H6YA 3DIEA 3SWLA 2YWOA 2O7KA 2VO4A 4H86A 1PKZA 3LJRA 3HA9A 5ECMB 1G6WA 2OE0A 4JRRA 2N5FA 1AXDA 5IO0A 2F8FA 3BCIA 1MEKA 2H01A 4FYCA 3PR8A 2H76A 1XCCA 2HRKA 2GGTA 3F8UA 3FR9A 1O85A 3CTFA 3D6IA 2O89A 3ERWA 1MD3A 4MLYA 1OKTA 3GKMA 3VI5A 3E3EA 2VUPA 2XPDA 3HZ8A 5FWGA 1T8EB 1DE1A 5DJMA 3HCZA 5JCGA 1TTZA 2J9HA 4KB3A 5IMZA 4MABA 5BMUA 2R3XA 3RAZA 1MTCA 1HD2A 2GVPA 5J5NA 3S9FA 4NAXA 2CZ3A 2VCQA 1GH2A 2HRNA 4ZB6A 22GSA 1AQWA 3QFAC 2BJXA 5KN2A 3CSJA 1OC9B 3WGEA 1TXXA 2JSZA 1KEBA 2PU9C 3FY7A 2GZYA 4GRFA 1SJIA 4NWYA 5G30A 1ST9A 1XWCA 4F0BA 2FLSA 2G0FA 3LXTA 2LQQA 3A5WA 2FGXA 1PGTA 3GX8A 2YZHA 4J2FA 3EURA 1T00A 1OE8A 1GSUA 1GSSA 5H5QA 2H6XA 2B7JA 5E4WA 1ZGNA 2CQ9A 4ISDA 3UMAA 2YWNA 2P31A 1SK2A 2C0GA 2WGRA 4L5OA 4L0WA 4WXTA 5IOWA 5ENUA 4DSSA 1K0NA 4XRAA 2QSIA 2R37A 4KF9A 4DSRA 1TU7A 2IMKA 2I81A 3A2VA 1Z7PA 1I5GA 3TKSC 2LRNA 2KLXA 3GL5A 1OC8A 2H8LA 1A0FA 3G9BA 5HR0A 2GQMA 2R2JA 1EWXA 4I2UA 1XW9A 4FO5A 3EYTA 2MBSA 4GSNA 4LMWA 4LMVA 1ZOFA 6GSXA 4YQUA 1R7HA 4YAPA 1UN2A 5HFGA 1WPIA 5GZZB 4TR3A 1W89A 2NTOA 3EMPA 2FHEA 2HSYA 4ILFA 3W8JA 4ZL8A 1RQMA 1SL2B 3HKRA 3F9UA 3FZ9A 4WR4A 1SJZA 3ZIJA 4XTSA 3VK9A 3QAVA 3EU3A 4IBPA 3Q6OA 4N11A 4POBA 3EMXA 1KTEA 2FWFA 4JR6A 2DIYA 3CYNA 5B8BA 1OE7A 3KM6A 5LD0A 3ZITA 5B8AA 2C0EA 2PWJA 2AV4A 4WBRD 2I9HA 2KHPA 3AY8A 3GUSA 1WRYA 4YAVA 2C8UA 4KW6A 1X0RA 5KN1A 4TRXA 1FG4A 2I3YA 4KSMA 2AAWA 3D0ZA 1GSFA 1SKWB 5JWQB 4DEJA 4MJAA 1ZCPA 3TJFA 1O7UA 4NPBA 2PUKC 2RM6A 1MDIA 5DAKB 3TKRA 1QFNA 4IJ3A 4ML6A 2DJ2A 4EVMA 2F3MA 5DCHA 2H30A 3GKNA 4N30A 2DMLA 1EEMA 2H71A 4AGSA 3FZ5A 1GNWA 4X43A 3DGQA 3M3MA 1TI3A 1ZYQB 2GTUA 1O81A 1BJXA 2GT5A 3KGKA 4G0IA 2G2QA 2NPBA 4K7IA 3FR6A 1XW6A 2L5LA 4O5RA 2OACA 3ZFLA 1EOGA 3GFKA 4XHMA 2FA4A 1WP0A 2PMTA 1SD9A 3GKKA 4J56E 1WIKA 1F9MA 4IHUA 4MF6A 4N0ZA 4ML1A 3RPPA 2IJYA 9GSSA 4KCAA 3LSZA 4CDOA 3CSHA 5H5SA 3TJGA 2YNXA 2OE3A 4ZB9A 3IBHA 3L4NA 4JBBA 3PPUA 4K9ZA 3TUEA 3I69A 1EGRA 5F0GA 2V41A 2J23A 2AUVA 2GQLA 1XVWA 5D73A 3DEXA 5HFIA 5IOXA 1TK5B 3HZ4A 5J4UA 1U3AA 5HFKA 6GSSA 2FD3A 5AIVA 2CX4A 2H1BA 1M9AA 3KEBA 2IPAA 4ECBA 2IIYA 2P0GA 5KN0A 5ECLB 4V2NA 1PMTA 4AF2A 4XRDA 1GTUA 1N2AA 2X8HA 3FHKA 2LRTA 2YV7A 2HRKB 1A2LA 2MYGA 2VAFA 3G7JA 2ALBA 4G10A 2A4VA 4XCSA 4V2LA 5FT3A 1PQNA 1TK0B 5CRHA 1QXHA 2RIIA 2WDUA 4USSA 1BAYA 4FYBA 2IWTA 3F63A 1T7PB 1XBSA 4EO3A 2VL2C 1C72A 2HLSA 1DUGA 2WJUA 3L0HA 5G31A 1VF1A 3APQA 3IA1A 1SKRB 1QMVA 4EC0A 5IO2A 3TOUA 3TKSE 3FRCA 3N9JA 5G2ZA 2YP6A 3WGXA 5CYYA 4WBJA 3VPTA 5JCUA 2YWIA 3GH6A 5F05A 3RBTA 1NHOA 2CAIA 4NXIA 4MPFA 3UOMA 5ECPB 1EEJA 5FHIA 1XZOA 2QC7A 4MH2A 2C4JA 3KP8A 5B7CA 5DAKA 1Q98A 4GQFA 1A0RP 2HSHA 5JWOB 2DJ1A 2L4CA 3LQ7A 2CVDA 5AIXA 1VGLA 3ZLPA 3IK7A 5CO3A 4KE3A 3D5JA 2I1UA 2CT6A 4K2DA 4WETA 1T4ZA 2DJJA 4LL4B 1YEPA 1GTAA 3ZRDA 2FWHA 3TDGA 2EIOA 4GCIA 5IMVA 1YZXA 2YOIA 5CREA 1XOAA 3V1WA 4I2TA 1EP8A 3C7MA 2R6KA 4OFMA 3LG6A 1SJ6A 2MBTA 1TOFA 1AIUA 3R2QA 4EXJA 2VLUA 4DSSB 1K0AA 4RUVA 3L78A 2H74A 1QK8A 4RQXA 2WULA 4FH8A 4PUFC 2B5XA 3A3TA 2YCDA 2LQOA 5DBQA 3F4TA 1F3BA 3KXOA 1QUWA 2VCZA 4E8HA 3QDNA 2GLRA 2DIZA 1YKCA 2YJ7A 2HI7A 4ZILA 5F07A 2L57A 4BPYA 4HUAA 2YANA 4IP6A 1DE2A 2GZPA 1JZOA 1CQGA 4KDUA 3IR4A 1ERVA 1GSQA 3QFBC 3ZYWA 2AHEA 1A2JA 2ES7A 2VD1A 4I97A 3C71A 3UJ1A 3US3A 1TRWA 3HY2A 1EGOA 4G19A 1NM3A 2A2SA 2FWGA 4GF0A 3DVWA 4Q5FA 2ZNMA 2DJ0A 3CBUA 1O8XA 1JLWA 2XPEA 4NHWA 4Q5RA 2R4VA 1V40A 1QGVA 1XIYA 1XW5A 3IK9A 5CRDA 3FKFA 1B4PA 3BBYA 4NV2A 3APSA 2HE3A 1X9MB 2OA7A 4V1Ag 5D9WA 2O85A 2XC2A 2L4QA 3KTBA 5HR3A 4L5LA 1S3AA 1TDIA 1Z6NA 3BD2A 3ZMKA 1JZRA 1GWCA 2WS2A 3ZMLA 1V57A 2V1MA 3GV1A 3GTUA 2VLTA 3KMOA 2N5BA 3GNJA 4E8EA 5HR2A 3A2XA 4IVFA 3IHQA 2O87A 3W6GA 4GLTA 4G2EA 5J41A 5ECSA 3U5RE 2H66A 2RM5A 1X9SB 3CSIA 2M72A 2JZRA 2YJHA 2VD0A 4PNGA 3I9V2 5IIZA 3GSSA 1WE0A 3BCKA 3F4SA 5LCZA 2VL9A 5INYA 1K0MA 3L9SA 3RDWA 3H93A 5AGYA 1GSDA 1PL2A 1M2DA 2EC4A 2OE1A 1TK8B 1FB0A 1ERUA 4ULXA 2IMFA 2DMMA 1O8WA 1E6BA 16GSA 5IM9A 2V6OA 1GULA 1A24A 3G7IA 1X5CA 2LKUA 1SL0B 3QD9A 2B7KA 2VCVA 4AJ7A 3TRPA 3HXSA 4EL1A 3I43A 3DRNA 3VWUA 4K0GA 3VLNA 3E0UA 3QAWA 5C04A 2LEGA 3ED3A 2MMNA 2IN3A 3F6DA 4IP1A 1E2YA 4HOJA 4KX4A 1OAZA 5CRGA 1V98A 3CTGA 1ZYEA 1PX6A 4FIWA 3LWAA 4IW9A 5H5RA 3LYKA 4LL1B 5EVOA 4O32A 1IYIA 1TRVA 3GH9A 2HYXA 1A8LA 17GSA 5G5EA 4POLA 1PN9A 1G6YA 2H0GA 1NSWA 3H8QA 4DSQA 1K0OA 4K1FA 3D22A 3SBCA 5CAXA 2CZ2A 2JU5A 1K0BA 2M80A 1B9YC 3WGDA 2DSAA 3KCMA 4OMVA 3KTLA 2H1DA 2QGVA 2HZEA 1JLVA 1FB6A 3HDCA 4L0UA 4MJEA 4RQRA 2VOCA 5HR1A 2YN1A 5DALB 1YEXA 1T4YA 2AYTA 3BJ5A 4OD7A 2WCIA 2A2RA 1WOUA 2JSYA 2L5OA 5D8IA 3PGTA 5IPHA 3J7Yb 3DD3A 3CXGA 2RLIA 3FZ4A 2LV3A 4QL7A 1T1VA 2F8AA 1GSYA 1MDKA 1M99A 5ID2B 3DXBA 2VCXA 1ERTA 2HSNB 3IV4A 2TRXA 3N5OA 3RPNA 4TR1A 2L59A 4TKYA 3OR5A 1V2AA 3J7Yk 3M8NA 4MPGA 5CNWA 5ELGA 3WT1A 3UVTA 1A2MA 3UBKA 1SD8A 2NBSA 2VIMA 2LJRA 3GL3A 3EC3A 4GSSA 3FEUA 3ZVJA 4F0CA 3VURA 1K3YA 2C1YA 2XBIA 3E9JB 5A5KA 2XBQA 4JU5A 4TXOA 3Q74A 3RHCA 2R5GA 3TKSA 3DVXA 2ZCTA 3CRTA 3LGCA 3VFIA 4HQSA 3O6TA 3IAM2 3IOSA 4PQHA 4POMA 1R4WA 1Z6MA 3QR6A 4GWRA 2IMEA 3GN3A 4IQ1A 5AISA 2H6ZA 4L8EA 3Q18A 2AB6A 10GSA 1XOBA 3CMIA 2B1LA 3MWHA 2TRCP 4KDYA 3F3QA 4KAEA 4ZBBA 2HRFA 5ECKB 3QPMA 2YPMA 4HQZA 1X5DA 3I6AA 3KP9A 3IXRA 2MZCA 2GT6A 4AJ6A 4WF5A 2LS5A 4O92A 1RW1A 1Z3EA 1J9BA 2E0QA 1BEDA 1FO5A 4TXVA 19GSA 2OADA 3EE2A 4WKWA 1FW1A 2GSTA 5ECHB 5DQYA 3VWWA 3DKSA 2L6DA 4BVYA 2BMXA 1EV9A 2CA8A 1ZL9A 4TOPA 1JZWA 2GSRA 3TJKA 2X64A 1XWKA 1HNBA 5B6NA 1GRXA 1HYUA 4K0NA 2B5YA 2M46A 2C3TA 1R26A 4EDZA 4CHSA 3M9KA 4POKA 4MP4A 4XS4B 3Q19A 2KP2A 4LLRA 3NZNA 4ZXGA 5DALA 4ZB8A 2LNSA 4RI6A 1G7OA 1TRSA 6GSYA 1SYRA 2IL3A 3HVSA 3GTUB 4PUAA 2JACA 3FZAA 3D21A 11GSA 4ZIJA 3TGZA 6GSWA 1SK0A 4F9ZA 6GSUA 5ECOB 5ID2A 2AJQB 2RUFA 1KNGA 5DVBA 14GSA 1THOA 5KEJA 5ECNB 3K8NA 5DCGA 2V6KA 2FA8A 4N10A 4HS1A 1UA5A 1Z7RA 4MMMA 3HD5A 3ME7A 1PA3A 1TKDB 4Q5NA 1PL1A 4IKHA 3VWXA 4LA1A 3VI7A 3ZZXA 2PVQA 2O8VB 4MA9A 2OKAA 5GAND 1S3DA 2H0HA 1TP9A 1GTIA 2QKEA 3UBLA 5IPGA 4EF0A 1VRSD 4HZ2A 1FHEA 1SU9A 5AN1A 1O6JA 3MAKA 3WYWA 5HQPA 4KNDA 3F4RA 1GTBA 4HEA2 1GP1A 2X8CA 2F51A 4MZCA 3R3EA 3EINA 4QQ7A 4YQVA 3C8EA 1YF1A 1XVQA 5CP1A 2PN8A 3FK8A 3H4KA 3H79A 4BL7A 4PQIA 1BG5A 4OFTA 1N8JA 2WB9A 3GKXA 5G1KA 4TW5A 1ZMAA 2IMIA 2PVOC 3ME8A 4ZL9A 1B4QA 1K3OA 3MSZA 2B3SA 1YY7A 2GZZA 2V2GA 3FR3A 1SENA 1FOVA 2P5QA 2H70A 5G1LA 1USBA 4YH2A 2C3QA 3F3RA 4KCEA 1TJDA 3IAS2 4IS0A 13GSA 2GSQA 3HJOA 3P90A 5ELAA 5J9CA 3WT2A 1T3BA 4GXZA 1R5AA 3ERGA 1H75A 2HXKA 2VCTA 4BVXB 2NDOA 5D96A 3VWVA 4BWSA 3DMLA 1S3CA 4YQMA 2HZEB 2ZUPA 1TU8A 4HJ2A 1SL1B 2PGTA 1M2BA 4TVEA 3O3TA 4BWQA 5D9XA 2GQKA 3GYKA 4HU9A 2LJAA 1AUCA 3NIVA 3UL3A 2E2MA 2C80A 3LYPA 2KUCA 2MMZA 1U88A 2D2ZA 5IQYA 4PURA 2CVKA 4XS4A 4K7NA 2GDRA 1X9WB 2JZTA 4NHZA 3C1SA 1OKDA 1X5EA 3O76A 3MDKA 2OBKA 3L9VA 4MZWA 4Q5QA 5IMFA 1AAZA 1JHBA 1YF0A 4TR1B 3PH9A 5B6MA 2HSMB 1U3IA 2ON5A 4HU7A 4I5QA 1FVKA 3GIXA 5JCWA 2BTOT 1M0UA 4K8MA 3UAPA 2VCWA 5E59A 3ZL5A 3KMNA 1F37A 3M1GA 4PXOA 3GX0A 1JFUA 2K8SA 2KOKA 4ID0A 4ECCA 4MCUA 1Y6EA 5F8BA 1AQXA 4P3YB 4IJIA 3KJYA 1ERWA 1VF3A 4TXOB 4EE0A 2MMOA 3GURA 4WEYA 4MK3A 4CW9A 3APOA 4ZL7A 5G5FA 2X99A 1GUKA 7GSSA 3TJJA 2HFDA 2LUSA 5D93A 3C73A 2FNOA 1PRXA 2DLXA 1QQ2A 3TRQA 4KUNA 4D73A 2DC5A 3IRAA 5CRWA 3HJPA 1B9XC 1SYXA 5EL8A 4KDXA 1BX9A 3CRUA 4TR4A 3ERFA 1ZZYA 1XWAA 1ML6A 1F6MC 1LJRA 2UZ8A 5GAPD 1U6TA 4QL9A 4F82A 3M0FA 1XXUA 1GLPA 5GSSA 2C3NA 2IMDA 1B48A 3TKQA 3TOTA 2FCHA 4GSTA 2XHFA 4HJMA 4BVYB 4NV5A 1O73A 4OO4A 4MZBA 2HNLA 4ECIA 3UARA 2K18A 4IELA 2CV4A 3EVIA 3PINA 1J08A 3ZREA 2CVBA 4EDYA 4ZBAA 4BVXA 4PQ1A 4HDEA 2HRAA 2H19A 4WF4A 4GTUA 2DBCA 2C0FA 1J0FA 1TW9A 1LU4A 4V1Ap 3GA4A 3QCPA 2K6VA 2WRTA 3P2AA 2OJLA 1XFLA 4J57E 5D9VA 1G7EA 3EWLA 1ACVA 1W4VA 4Z7XA 1AQVA 1PD21 12GSA 1Z5YE 3LEFA 1PSQA 4IN0A 2H1AA 3LFLA 1I9DA 3D4TA 4F03A 1RK4A 5DQSA 5A4VA 3KD0A 1K0DA 5J3RA 3UEMA 1OYJA 2HSMA 3QMXA 2DJ3A 1YDKA 4ZBDA 1YKAA 4RI7A 3IC8A 4JE1A 3IE3A 2H75A
chains in the Genus database with same CATH superfamily
1FAAA 4FYUA 4OCEA 1PX7A 3D4MA 4EKZA 4X1UA 4DVCA 3KZQA 1GUMA 1XWGA 2YZUA 3TJBA 4MJCA 2HT9A 1ILOA 1A23A 2H72A 2N5AA 2WW1A 1FVJA 1OC9A 5EPFA 6GSVA 2IFQB 3C1RA 1SK1A 4K6XA 2EFEA 4XS1A 2CX3A 3P8WA 1M7TA 5A4WA 3G7YA 2CAQA 2VLVA 4N0VA 3GHAA 4KGIA 2H73A 4I6XA 3QOUA 4BL7B 1EP7A 4JZQA 2F9SA 3LORA 4MF5A 1EV4A 2VM2A 2LJKA 2EIQA 2LNTA 4MF7A 2FUG2 2K8VA 2FWEA 3DWVA 2P5RA 2Z9SA 2WW0A 5J40A 5ABRA 4ECJA 2YWMA 1AC1A 3GRXA 2I4AA 1Q4JA 2WZ9A 1WWJA 1F3AA 2X8GA 4PX1A 2E2GA 5DJLA 1UC7A 5JWRB 3LXZA 1M2AA 4IGJA 5IMAA 5A34A 4PI2C 5ECIB 1DBYA 3ISOA 1Y25A 1JZDA 4K7OA 3VPQA 1ABAA 1GLQA 1VF4A 2VM1A 1YJ6A 4GQCA 1URMA 4NMUA 3KH7A 3TRXA 3KIJA 3TKPA 4PGTA 1BG1A 3W8SA 1A8YA 1ZYPA 5IMCA 1K3LA 2PBJA 4EUYA 3F0IA 3EU4A 4OCFA 1G0TA 1XWBA 1THXA 1OC3A 1NHYA 2FY6A 3A2WA 1IYHA 2O3EA 1XPVA 4WR5A 2LTKA 3U6VA 2O36A 3H1NA 4FQUA 4G0LA 3IC4A 4X0XA 4MDCA 1V58A 3HVXA 4F2IA 1MDJA 4AKIA 1WMJA 3L9UA 3QAGA 3TB2A 3HHVA 2MMAA 3KH9A 4Z2RA 4BA7A 3HYPA 1K0CA 4QMKA 1TI1A 2L6CA 4JEDA 1MD4A 4MH3A 4JR4A 2WFCA 4OWYA 5KOXA 1EZKA 2B1KA 1M9BA 5J9BA 4KA0A 1LBKA 2JADA 4E68A 2E7PA 2LRCA 18GSA 5EY6A 3GSTA 1CQHA 1H4OA 2H0IA 3IDVA 3ZFBA 1F2EA 1GUHA 4XS6A 5C00A 4OFNA 4O7HA 3ZIVA 4A5PA 8GSSA 3FW2A 2RUEA 2KP1A 5J47A 4AJ8A 4YKGA 5COHA 1N25A 4OO5A 2HQTA 1GSEA 4KSOA 20GSA 2PERA 1BQ7A 2ON7A 3WD6A 4IQAA 2IFQA 1VF2A 3FYGA 3JCML 3RFRC 2GSSA 2DJKA 4TN8A 4BIKA 1HNAA 5L71A 1KBNA 2NVLA 4D73B 4G9HA 5LNKe 4AKGA 1NW2A 5J4YA 2VL3A 2B5EA 1HNCA 3M9JA 3ZVJD 1BYEA 1YQ1A 3UIWA 3HJMA 4I8BA 3ZTLA 1WJKA 1HQOA 4PTSA 2C0DA 1GL8A 4MJBA 3GMFA 3NOFA 5IMDA 4XIHA 3DYRA 6GSTA 3FMWA 4V2MA 2YV9A 5GSTA 3HVVA 4KH7A 1PKWA 1V9WA 5KN3A 2EIRA 4HI7A 1B8XA 5ECQB 3UVHA 2JZSA 1UVZA 5A4UA 5DDLA 1OVNA 1Z9HA 1R5PA 5F06A 4ACSA 3F6FA 2OBIA 2B6MA 3P7XA 3IPZA 1ON4A 4G0KA 3RHBA 4TR0A 2V32A 2VL2A 1EOHA 1DSBA 2K9FA 1S3RA 2H1GA 4HZ4A 5ECRB 2GS3A 5D9TA 2PPTA 2JL4A 3MNGA 2HZFA 2TIRA 1TRUA 2REMA 4PNFA 1U87A 1GNEA 3TCOA 1AW9A 3BOAA 1SKSB 2LSTA 2H6YA 3DIEA 3SWLA 2YWOA 2O7KA 2VO4A 4H86A 1PKZA 3HA9A 3LJRA 1SVMA 5ECMB 1G6WA 2OE0A 3MIXA 4JRRA 2N5FA 1AXDA 5IO0A 2F8FA 3BCIA 1MEKA 2H01A 4FYCA 3PR8A 2H76A 1XCCA 2HRKA 2GGTA 3F8UA 3FR9A 1O85A 3CTFA 3D6IA 2O89A 3ERWA 1MD3A 4MLYA 1OKTA 3GKMA 1I1IP 2DKHA 1TXUA 3VI5A 3E3EA 2VUPA 2XPDA 2WZSA 2A2PA 2DKIA 3HZ8A 5FWGA 1T8EB 1DE1A 5DJMA 3HCZA 5A1NA 5JCGA 1TTZA 2J9HA 4KB3A 5IMZA 4MABA 5BMUA 2R3XA 3RAZA 1MTCA 1HD2A 2GVPA 5J5NA 3S9FA 4NAXA 2CZ3A 2VCQA 1GH2A 2HRNA 4ZB6A 22GSA 1AQWA 3QFAC 2BJXA 5KN2A 3CSJA 1OC9B 3WGEA 1TXXA 2JSZA 1KEBA 2PU9C 2QA2A 3FY7A 2GZYA 4GRFA 4FXYP 1SJIA 4NWYA 5G30A 1ST9A 1XWCA 4F0BA 2FLSA 2G0FA 3LXTA 2LQQA 3A5WA 2FGXA 1PGTA 3GX8A 2YZHA 3EPTA 4J2FA 3EURA 1T00A 1OE8A 1GSUA 1GSSA 5H5QA 2H6XA 2B7JA 5E4WA 1ZGNA 2CQ9A 4ISDA 3UMAA 2YWNA 2P31A 1SK2A 2C0GA 2WGRA 4L5OA 4GDFA 4L0WA 4WXTA 5IOWA 5ENUA 4DSSA 3A5IA 1K0NA 4XRAA 2QSIA 2R37A 4KF9A 4DSRA 1TU7A 2IMKA 2I81A 3A2VA 4CY8A 1Z7PA 1I5GA 3TKSC 2LRNA 2KLXA 3GL5A 1OC8A 2H8LA 1A0FA 3G9BA 5HR0A 2GQMA 2R2JA 1EWXA 4I2UA 1XW9A 4FO5A 3EYTA 2MBSA 4GSNA 4LMWA 4LMVA 1ZOFA 6GSXA 4YQUA 1R7HA 4YAPA 1UN2A 5HFGA 1WPIA 5GZZB 4TR3A 1W89A 2NTOA 3EMPA 2FHEA 2HSYA 4ILFA 3W8JA 4ZL8A 1RQMA 1SL2B 3CQFA 3HKRA 3F9UA 3FZ9A 4WR4A 1SJZA 3ZIJA 4XTSA 3VK9A 3QAVA 3EU3A 4IBPA 3Q6OA 4N11A 4POBA 3EMXA 1KTEA 2FWFA 4JR6A 2DIYA 3CYNA 5B8BA 3KM6A 1OE7A 5LD0A 3ZITA 5B8AA 4O5QA 2C0EA 2PWJA 2AV4A 4WBRD 2I9HA 2KHPA 3AY8A 3GUSA 4AI6A 1WRYA 4YAVA 4ZB7A 2C8UA 4KW6A 1X0RA 5KN1A 4TRXA 1FG4A 2I3YA 4KSMA 2AAWA 3D0ZA 1GSFA 1SKWB 5JWQB 4DEJA 4MJAA 1ZCPA 3TJFA 1O7UA 4NPBA 1S4BP 4X4JA 2PUKC 2RM6A 1MDIA 5DAKB 3TKRA 1QFNA 4IJ3A 4ML6A 2DJ2A 4EVMA 2F3MA 5DCHA 2H30A 3GKNA 5BRTA 1M3JA 4N30A 2DMLA 1EEMA 2H71A 4AGSA 3FZ5A 1GNWA 4X43A 3DGQA 3M3MA 1TI3A 1ZYQB 2GTUA 1O81A 1BJXA 2GT5A 3KGKA 4G0IA 2G2QA 2NPBA 4K7IA 3FR6A 1XW6A 2L5LA 4O5RA 2OACA 3ZFLA 1EOGA 3GFKA 4XHMA 2FA4A 1WP0A 2X49A 2PMTA 2WW2A 1YEWC 1SD9A 2EFHA 3GKKA 4J56E 1WIKA 1F9MA 4IHUA 4MF6A 4N0ZA 4ML1A 3RPPA 2IJYA 9GSSA 4KCAA 3LSZA 4CDOA 3CSHA 5H5SA 3TJGA 2YNXA 2OE3A 4ZB9A 3IBHA 3L4NA 4JBBA 3PPUA 4K9ZA 3TUEA 3I69A 1EGRA 5F0GA 2V41A 2J23A 2AUVA 2GQLA 1XVWA 5D73A 3DEXA 5HFIA 5IOXA 1TK5B 3HZ4A 5J4UA 1U3AA 5HFKA 6GSSA 2FD3A 5AIVA 2CX4A 2H1BA 1M9AA 3KEBA 2IPAA 4ECBA 2IIYA 2P0GA 5KN0A 5ECLB 4V2NA 1PMTA 4AF2A 4XRDA 1GTUA 1N2AA 2X8HA 3FHKA 2LRTA 2YV7A 5KOWA 2HRKB 4PHZC 1A2LA 2MYGA 2VAFA 3G7JA 2ALBA 4G10A 2A4VA 4XCSA 4V2LA 5FT3A 1PQNA 1TK0B 5CRHA 1QXHA 2RIIA 2WDUA 4USSA 1BAYA 4FYBA 2IWTA 3F63A 1T7PB 1XBSA 3TU3B 4EO3A 5A1NB 2VL2C 1C72A 2HLSA 1DUGA 2WJUA 3L0HA 5G31A 1VF1A 5BMUB 3APQA 3IA1A 1SKRB 1QMVA 4EC0A 5IO2A 3TOUA 3TKSE 3FRCA 3N9JA 5G2ZA 2YP6A 3WGXA 5CYYA 4WBJA 3VPTA 5JCUA 2YWIA 3GH6A 5F05A 3RBTA 1NHOA 2CAIA 4NXIA 4MPFA 3UOMA 5ECPB 1EEJA 5FHIA 1XZOA 2QC7A 4MH2A 2C4JA 3KP8A 5B7CA 5DAKA 1Q98A 4GQFA 2EFCA 1A0RP 2HSHA 5JWOB 2DJ1A 2L4CA 3LQ7A 2CVDA 5AIXA 1VGLA 3ZLPA 3IK7A 5CO3A 4KE3A 2VKZG 3D5JA 2I1UA 2CT6A 4K2DA 4WETA 1T4ZA 2DJJA 4LL4B 1YEPA 1GTAA 3ZRDA 2FWHA 3TDGA 2EIOA 4GCIA 1SVLA 5IMVA 1YZXA 2YOIA 5CREA 1XOAA 3V1WA 1EP8A 3C7MA 4I2TA 2R6KA 4OFMA 3LG6A 1SJ6A 2MBTA 1TOFA 1AIUA 3R2QA 4EXJA 2VLUA 4DSSB 1K0AA 4Z2UA 4RUVA 3L78A 2H74A 1QK8A 4RQXA 2WULA 2O5VA 4FH8A 4PUFC 2B5XA 3A3TA 2WW3A 2YCDA 2LQOA 5DBQA 3F4TA 1F3BA 3IHGA 3KXOA 1QUWA 2VCZA 4E8HA 3QDNA 2GLRA 2DIZA 1ZYNA 3RGBC 1YKCA 2YJ7A 2HI7A 4ZILA 5F07A 2L57A 4BPYA 4HUAA 2YANA 4IP6A 1DE2A 2GZPA 1JZOA 1FOHA 1CQGA 4YKFA 4KDUA 3IR4A 1ERVA 1GSQA 3QFBC 3ZYWA 2AHEA 1A2JA 2ES7A 2VD1A 4I97A 3C71A 3UJ1A 3US3A 1TRWA 3HY2A 1EGOA 4G19A 1NM3A 2A2SA 2FWGA 4GF0A 3DVWA 4Q5FA 2ZNMA 2DJ0A 3CBUA 1O8XA 1JLWA 2XPEA 4NHWA 4Q5RA 2R4VA 1V40A 1QGVA 1XIYA 1XW5A 3IK9A 5CRDA 3FKFA 1B4PA 3BBYA 4NV2A 3APSA 2HE3A 1X9MB 2OA7A 4V1Ag 5D9WA 2O85A 2XC2A 2L4QA 3KTBA 5HR3A 4L5LA 1S3AA 1TDIA 3CHXC 3CWGA 1Z6NA 3BD2A 3ZMKA 1JZRA 1GWCA 2WS2A 3ZMLA 1V57A 2V1MA 3GV1A 3GTUA 2VLTA 3KMOA 2N5BA 3GNJA 4E8EA 2WVZA 5HR2A 3A2XA 4IVFA 3IHQA 2O87A 3W6GA 4GLTA 4G2EA 5J41A 5ECSA 3U5RE 2H66A 2RM5A 1X9SB 3CSIA 2M72A 2JZRA 2YJHA 2VD0A 4PNGA 3I9V2 5IIZA 3GSSA 1WE0A 3BCKA 3F4SA 5LCZA 2VL9A 5INYA 1K0MA 3L9SA 3RDWA 3H93A 5AGYA 1GSDA 1PL2A 1M2DA 2EC4A 2OE1A 1TK8B 1FB0A 1ERUA 4ULXA 2IMFA 2DMMA 1O8WA 4K5SA 1E6BA 16GSA 5IM9A 2V6OA 1GULA 1A24A 3G7IA 1X5CA 2LKUA 1SL0B 3QD9A 2B7KA 2VCVA 4AJ7A 3TRPA 3HXSA 4EL1A 3I43A 3DRNA 3VWUA 4K0GA 3VLNA 3E0UA 3QAWA 5C04A 2LEGA 3ED3A 2MMNA 2IN3A 3F6DA 4IP1A 1E2YA 4HOJA 4KX4A 1OAZA 5CRGA 1V98A 3CTGA 1ZYEA 1PX6A 4FIWA 3LWAA 4IW9A 5H5RA 5A5HB 3LYKA 4LL1B 2EFDA 5EVOA 4O32A 1IYIA 1TRVA 3GH9A 2HYXA 1A8LA 17GSA 5G5EA 4POLA 2R0GA 1PN9A 1G6YA 2H0GA 1NSWA 3H8QA 4DSQA 1K0OA 4K1FA 3D22A 3SBCA 5CAXA 2CZ2A 2JU5A 1K0BA 2M80A 1B9YC 3WGDA 2DSAA 3KCMA 4OMVA 3KTLA 4EIQA 2H1DA 2QGVA 2HZEA 1JLVA 1Y1UA 1FB6A 3HDCA 4L0UA 4MJEA 4RQRA 2VOCA 4CY6A 5HR1A 2YN1A 5DALB 1YEXA 4K5RA 1T4YA 2AYTA 3BJ5A 4OD7A 2WCIA 2A2RA 1WOUA 2JSYA 2L5OA 5D8IA 3PGTA 5IPHA 2WVXA 3DD3A 3J7Yb 3CXGA 2RLIA 3FZ4A 2LV3A 2WVYA 4QL7A 1T1VA 2F8AA 1GSYA 1MDKA 1M99A 5ID2B 3DXBA 2VCXA 1ERTA 2HSNB 3IV4A 2TRXA 3N5OA 3RPNA 4TR1A 2L59A 4TKYA 3OR5A 1V2AA 4G01A 3J7Yk 3M8NA 4MPGA 5CNWA 5ELGA 3WT1A 3UVTA 1A2MA 3UBKA 1SD8A 2NBSA 2VIMA 2LJRA 3GL3A 3EC3A 4GSSA 3FEUA 3ZVJA 4F0CA 3VURA 1K3YA 2C1YA 2XBIA 3E9JB 5A5KA 2XBQA 4JU5A 4TXOA 3Q74A 3RHCA 2R5GA 3TKSA 3DVXA 2ZCTA 3CRTA 3LGCA 3VFIA 4HQSA 1PN0A 3O6TA 3IAM2 3IOSA 4PQHA 4POMA 1R4WA 3MYDA 1Z6MA 3QR6A 4GWRA 2IMEA 4W66A 3GN3A 4IQ1A 5AISA 2H6ZA 4L8EA 3Q18A 2AB6A 10GSA 1XOBA 3CMIA 2B1LA 3MWHA 2TRCP 4KDYA 3F3QA 4KAEA 4ZBBA 2HRFA 5ECKB 3QPMA 2A4HA 2YPMA 4HQZA 1X5DA 1XG8A 3I6AA 3KP9A 3IXRA 2MZCA 2GT6A 4AJ6A 4WF5A 2LS5A 4O92A 5A5HA 1RW1A 1Z3EA 1J9BA 2E0QA 1BEDA 1FO5A 4TXVA 19GSA 2OADA 1M3IA 3EE2A 4WKWA 1FW1A 2R0PA 2GSTA 5ECHB 5DQYA 3VWWA 3DKSA 2L6DA 4BVYA 2BMXA 2R0CA 1EV9A 2CA8A 1ZL9A 4TOPA 1JZWA 2GSRA 3TJKA 2X64A 1XWKA 1HNBA 5B6NA 1GRXA 1HYUA 4K0NA 2B5YA 2M46A 2C3TA 1R26A 4EDZA 4CHSA 3M9KA 4PI0C 4POKA 4MP4A 4XS4B 3Q19A 2KP2A 4LLRA 3NZNA 4ZXGA 5DALA 3HVNA 4ZB8A 2LNSA 4RI6A 1G7OA 1TRSA 6GSYA 1SYRA 2IL3A 3HVSA 3GTUB 4PUAA 2JACA 3HMJG 3FZAA 3D21A 11GSA 4ZIJA 3TGZA 6GSWA 1PFOA 1SK0A 4F9ZA 6GSUA 5ECOB 5ID2A 2AJQB 2RUFA 1KNGA 5DVBA 14GSA 2HSNA 1THOA 5KEJA 5ECNB 3K8NA 5DCGA 2V6KA 2FA8A 4N10A 4HS1A 1UA5A 1Z7RA 4MMMA 3HD5A 3ME7A 1PA3A 1TKDB 4Q5NA 1PL1A 4IKHA 3VWXA 2X4AA 4LA1A 3VI7A 3ZZXA 2PVQA 2O8VB 4MA9A 2OKAA 5GAND 1S3DA 2H0HA 1TP9A 1GTIA 2QKEA 3UBLA 5IPGA 4EF0A 1VRSD 4HZ2A 1FHEA 1SU9A 5AN1A 1O6JA 3MAKA 3WYWA 5HQPA 4KNDA 3F4RA 1GTBA 4HEA2 1GP1A 2X8CA 2F51A 4MZCA 3R3EA 3EINA 4QQ7A 4YQVA 3C8EA 1YF1A 1XVQA 5CP1A 2PN8A 3FK8A 3H4KA 3H79A 4BL7A 4PQIA 1BG5A 4OFTA 1N8JA 2WB9A 3GKXA 5G1KA 4TW5A 1ZMAA 2IMIA 2PVOC 3ME8A 4ZL9A 1B4QA 1K3OA 3MSZA 2B3SA 1YY7A 2GZZA 2V2GA 3FR3A 1YVLA 1SENA 1FOVA 2P5QA 2H70A 5G1LA 1USBA 4YH2A 2C3QA 3F3RA 4KCEA 1TJDA 3IAS2 4IS0A 13GSA 2GSQA 3HJOA 3P90A 5ELAA 5J9CA 3WT2A 1T3BA 4GXZA 1R5AA 3ERGA 1H75A 2HXKA 2VCTA 1BF5A 4BVXB 2NDOA 5D96A 3VWVA 4BWSA 3DMLA 1S3CA 4YQMA 2HZEB 2ZUPA 1TU8A 4HJ2A 1SL1B 2PGTA 1M2BA 4TVEA 3O3TA 4BWQA 5D9XA 4Z2TA 2GQKA 3GYKA 4HU9A 2LJAA 1AUCA 3NIVA 3UL3A 2E2MA 2C80A 3LYPA 2KUCA 2MMZA 1U88A 2D2ZA 5J4VA 5IQYA 4PURA 2CVKA 4XS4A 4K7NA 2GDRA 1X9WB 2JZTA 4NHZA 3C1SA 1OKDA 4MNNA 2WVXB 1X5EA 3O76A 4EIPA 2QA1A 3MDKA 2OBKA 3L9VA 4MZWA 4Q5QA 5IMFA 1AAZA 1JHBA 1YF0A 4TR1B 3PH9A 5B6MA 2HSMB 4O5UA 1U3IA 2ON5A 4HU7A 4I5QA 1FVKA 3GIXA 5JCWA 2BTOT 1M0UA 4K8MA 3UAPA 2VCWA 5E59A 3ZL5A 3KMNA 1F37A 3M1GA 4PXOA 3GX0A 1JFUA 2K8SA 2KOKA 4ID0A 4ECCA 4MCUA 1Y6EA 5F8BA 1AQXA 4P3YB 2UV8G 4IJIA 3KJYA 1ERWA 1VF3A 4TXOB 4EE0A 2MMOA 3GURA 4WEYA 2H1LA 4MK3A 4CW9A 3APOA 4ZL7A 5G5FA 2X99A 1GUKA 7GSSA 3TJJA 2HFDA 2LUSA 4ICYA 4HSCX 5D93A 3C73A 2FNOA 1PRXA 2DLXA 1QQ2A 3TRQA 4KUNA 4D73A 2DC5A 3IRAA 5CRWA 3HJPA 1SVOA 1B9XC 1SYXA 4AKHA 5EL8A 4KDXA 1BX9A 3CRUA 4TR4A 3ERFA 1ZZYA 3LW9A 1XWAA 1ML6A 1F6MC 1LJRA 2UZ8A 5GAPD 1U6TA 4QL9A 4F82A 3M0FA 1XXUA 1GLPA 5A34B 4N3ZA 5GSSA 2C3NA 2IMDA 4AKXB 1B48A 3TKQA 3TOTA 2FCHA 4GSTA 2XHFA 4HJMA 4BVYB 4NV5A 1O73A 4OO4A 4MZBA 2HNLA 4ECIA 3UARA 2K18A 4IELA 2CV4A 3EVIA 3PINA 1J08A 3ZREA 2CVBA 4EDYA 4ZBAA 4BVXA 4PQ1A 4HDEA 2HRAA 2H19A 4WF4A 4GTUA 2DBCA 2C0FA 1J0FA 1TW9A 1LU4A 4V1Ap 3GA4A 3QCPA 2K6VA 2WRTA 3P2AA 2OJLA 1XFLA 4J57E 5D9VA 4K2XA 1G7EA 2OT3A 3EWLA 1ACVA 1W4VA 4Z7XA 1AQVA 1PD21 12GSA 1Z5YE 3LEFA 1PSQA 4IN0A 2H1AA 3LFLA 1I9DA 3D4TA 4F03A 1RK4A 5DQSA 5A4VA 3KD0A 1K0DA 5J3RA 3UEMA 1OYJA 2HSMA 3QMXA 2DJ3A 1YDKA 4ZBDA 1YKAA 4RI7A 3IC8A 4JE1A 3IE3A 2H75A
chains in the Genus database with same CATH topology
1FAAA 4FYUA 4OCEA 1PX7A 3D4MA 4EKZA 4X1UA 4DVCA 3KZQA 1GUMA 1XWGA 2YZUA 3TJBA 4MJCA 2HT9A 1ILOA 1A23A 2H72A 2N5AA 1FVJA 1OC9A 5EPFA 6GSVA 2IFQB 3C1RA 1SK1A 4K6XA 2EFEA 4XS1A 2CX3A 3P8WA 1M7TA 5A4WA 3G7YA 2CAQA 2VLVA 4N0VA 3GHAA 4KGIA 2H73A 4I6XA 3QOUA 4BL7B 1EP7A 4JZQA 3LORA 2F9SA 4MF5A 1EV4A 2VM2A 2LJKA 2EIQA 2LNTA 4MF7A 2FUG2 2K8VA 2FWEA 3DWVA 2P5RA 2Z9SA 5J40A 5ABRA 4ECJA 2YWMA 1AC1A 3GRXA 2I4AA 1Q4JA 2WZ9A 1WWJA 1F3AA 2X8GA 4PX1A 2E2GA 5DJLA 1UC7A 5JWRB 3LXZA 1M2AA 4IGJA 5IMAA 5A34A 5ECIB 1DBYA 3ISOA 1Y25A 1JZDA 4K7OA 3VPQA 1ABAA 1GLQA 1VF4A 2VM1A 1YJ6A 4GQCA 1URMA 4NMUA 3KH7A 3TRXA 3KIJA 3TKPA 4PGTA 1BG1A 3W8SA 1A8YA 1ZYPA 5IMCA 1K3LA 2PBJA 4EUYA 3F0IA 3EU4A 4OCFA 1G0TA 1XWBA 1THXA 1OC3A 1NHYA 2FY6A 3A2WA 1IYHA 1XPVA 4WR5A 2LTKA 3U6VA 3H1NA 4FQUA 4G0LA 3IC4A 4X0XA 4MDCA 1V58A 3HVXA 4F2IA 1MDJA 4AKIA 1WMJA 3L9UA 3QAGA 3TB2A 3HHVA 2MMAA 3KH9A 4Z2RA 4BA7A 3HYPA 1K0CA 4QMKA 1TI1A 2L6CA 4JEDA 1MD4A 4MH3A 4JR4A 2WFCA 4OWYA 5KOXA 1EZKA 2B1KA 1M9BA 5J9BA 4KA0A 1LBKA 2JADA 4E68A 2E7PA 2LRCA 18GSA 5EY6A 3GSTA 1CQHA 1H4OA 2H0IA 3IDVA 3ZFBA 1F2EA 1GUHA 4XS6A 5C00A 4OFNA 4O7HA 3ZIVA 4A5PA 8GSSA 3FW2A 2RUEA 2KP1A 5J47A 4AJ8A 4YKGA 5COHA 1N25A 4OO5A 2HQTA 1GSEA 4KSOA 20GSA 2PERA 1BQ7A 2ON7A 3WD6A 4IQAA 2IFQA 1VF2A 3FYGA 3JCML 2GSSA 2DJKA 4TN8A 1HNAA 5L71A 1KBNA 2NVLA 4D73B 4G9HA 5LNKe 4AKGA 1NW2A 5J4YA 2VL3A 2B5EA 1HNCA 3M9JA 3ZVJD 1BYEA 1YQ1A 3UIWA 3HJMA 4I8BA 3ZTLA 1WJKA 1HQOA 4PTSA 2C0DA 1GL8A 4MJBA 3GMFA 3NOFA 5IMDA 4XIHA 3DYRA 6GSTA 3FMWA 4V2MA 2YV9A 5GSTA 3HVVA 4KH7A 1PKWA 1V9WA 5KN3A 2EIRA 4HI7A 1B8XA 5ECQB 3UVHA 2JZSA 1UVZA 5A4UA 5DDLA 1OVNA 1Z9HA 1R5PA 5F06A 4ACSA 3F6FA 2OBIA 2B6MA 3P7XA 3IPZA 1ON4A 4G0KA 3RHBA 4TR0A 2V32A 2VL2A 1EOHA 1DSBA 2K9FA 2H1GA 4HZ4A 5ECRB 2GS3A 5D9TA 2PPTA 2JL4A 3MNGA 2HZFA 2TIRA 1TRUA 2REMA 4PNFA 1U87A 1GNEA 3TCOA 1AW9A 3BOAA 1SKSB 2LSTA 2H6YA 3DIEA 3SWLA 2YWOA 2O7KA 2VO4A 4H86A 1PKZA 3HA9A 3LJRA 1SVMA 5ECMB 1G6WA 2OE0A 3MIXA 4JRRA 2N5FA 1AXDA 5IO0A 2F8FA 3BCIA 1MEKA 2H01A 4FYCA 3PR8A 2H76A 1XCCA 2HRKA 2GGTA 3F8UA 3FR9A 1O85A 3CTFA 3D6IA 2O89A 3ERWA 1MD3A 4MLYA 1OKTA 3GKMA 2DKHA 1TXUA 3VI5A 3E3EA 2VUPA 2XPDA 2A2PA 2DKIA 3HZ8A 5FWGA 1T8EB 1DE1A 5DJMA 3HCZA 5A1NA 5JCGA 1TTZA 2J9HA 4KB3A 5IMZA 4MABA 5BMUA 2R3XA 3RAZA 1MTCA 1HD2A 2GVPA 5J5NA 3S9FA 4NAXA 2CZ3A 2VCQA 1GH2A 2HRNA 4ZB6A 22GSA 1AQWA 3QFAC 2BJXA 5KN2A 3CSJA 1OC9B 3WGEA 1TXXA 2JSZA 1KEBA 2PU9C 2QA2A 3FY7A 2GZYA 4GRFA 1SJIA 4NWYA 5G30A 1ST9A 1XWCA 4F0BA 2FLSA 2G0FA 3LXTA 2LQQA 3A5WA 2FGXA 1PGTA 3GX8A 2YZHA 3EPTA 4J2FA 3EURA 1T00A 1OE8A 1GSUA 1GSSA 5H5QA 2H6XA 2B7JA 5E4WA 1ZGNA 2CQ9A 4ISDA 3UMAA 2YWNA 2P31A 1SK2A 2C0GA 2WGRA 4L5OA 4GDFA 4L0WA 4WXTA 5IOWA 5ENUA 4DSSA 3A5IA 1K0NA 4XRAA 2QSIA 2R37A 4KF9A 4DSRA 1TU7A 2IMKA 2I81A 3A2VA 4CY8A 1Z7PA 1I5GA 3TKSC 2LRNA 2KLXA 3GL5A 1OC8A 2H8LA 1A0FA 3G9BA 5HR0A 2GQMA 2R2JA 1EWXA 4I2UA 1XW9A 4FO5A 3EYTA 2MBSA 4GSNA 4LMWA 4LMVA 1ZOFA 6GSXA 4YQUA 1R7HA 4YAPA 1UN2A 5HFGA 1WPIA 5GZZB 4TR3A 1W89A 2NTOA 3EMPA 2FHEA 2HSYA 4ILFA 3W8JA 4ZL8A 1RQMA 1SL2B 3HKRA 3F9UA 3FZ9A 4WR4A 1SJZA 3ZIJA 4XTSA 3VK9A 3QAVA 3EU3A 4IBPA 3Q6OA 4N11A 4POBA 3EMXA 1KTEA 2FWFA 4JR6A 2DIYA 3CYNA 5B8BA 3KM6A 1OE7A 5LD0A 3ZITA 5B8AA 4O5QA 2C0EA 2PWJA 2AV4A 4WBRD 2I9HA 2KHPA 3AY8A 3GUSA 4AI6A 1WRYA 4YAVA 4ZB7A 2C8UA 4KW6A 1X0RA 5KN1A 4TRXA 1FG4A 2I3YA 4KSMA 2AAWA 3D0ZA 1GSFA 1SKWB 5JWQB 4DEJA 4MJAA 1ZCPA 3TJFA 1O7UA 4NPBA 4X4JA 2PUKC 2RM6A 1MDIA 5DAKB 3TKRA 1QFNA 4IJ3A 4ML6A 2DJ2A 4EVMA 2F3MA 5DCHA 2H30A 3GKNA 5BRTA 4N30A 2DMLA 1EEMA 2H71A 4AGSA 3FZ5A 1GNWA 4X43A 3DGQA 3M3MA 1TI3A 1ZYQB 2GTUA 1O81A 1BJXA 2GT5A 3KGKA 4G0IA 2G2QA 2NPBA 4K7IA 3FR6A 1XW6A 2L5LA 4O5RA 2OACA 3ZFLA 1EOGA 3GFKA 4XHMA 2FA4A 1WP0A 2X49A 2PMTA 1SD9A 2EFHA 3GKKA 4J56E 1WIKA 1F9MA 4IHUA 4MF6A 4N0ZA 4ML1A 3RPPA 2IJYA 9GSSA 4KCAA 3LSZA 4CDOA 3CSHA 5H5SA 3TJGA 2YNXA 2OE3A 4ZB9A 3IBHA 3L4NA 4JBBA 3PPUA 4K9ZA 3TUEA 3I69A 1EGRA 5F0GA 2V41A 2J23A 2AUVA 2GQLA 1XVWA 5D73A 3DEXA 5HFIA 5IOXA 1TK5B 3HZ4A 5J4UA 1U3AA 5HFKA 6GSSA 2FD3A 5AIVA 2CX4A 2H1BA 1M9AA 3KEBA 2IPAA 4ECBA 2IIYA 2P0GA 5KN0A 5ECLB 4V2NA 1PMTA 4AF2A 4XRDA 1GTUA 1N2AA 2X8HA 3FHKA 2LRTA 2YV7A 5KOWA 2HRKB 1A2LA 2MYGA 2VAFA 3G7JA 2ALBA 4G10A 2A4VA 4XCSA 4V2LA 5FT3A 1PQNA 1TK0B 5CRHA 1QXHA 2RIIA 2WDUA 4USSA 1BAYA 4FYBA 2IWTA 3F63A 1T7PB 1XBSA 3TU3B 4EO3A 5A1NB 2VL2C 1C72A 2HLSA 1DUGA 2WJUA 3L0HA 5G31A 1VF1A 5BMUB 3APQA 3IA1A 1SKRB 1QMVA 4EC0A 5IO2A 3TOUA 3TKSE 3FRCA 3N9JA 5G2ZA 2YP6A 3WGXA 5CYYA 4WBJA 3VPTA 5JCUA 2YWIA 3GH6A 5F05A 3RBTA 1NHOA 2CAIA 4NXIA 4MPFA 3UOMA 5ECPB 1EEJA 5FHIA 1XZOA 2QC7A 4MH2A 2C4JA 3KP8A 5B7CA 5DAKA 1Q98A 4GQFA 2EFCA 1A0RP 2HSHA 5JWOB 2DJ1A 2L4CA 3LQ7A 2CVDA 5AIXA 1VGLA 3ZLPA 3IK7A 5CO3A 4KE3A 2VKZG 3D5JA 2I1UA 2CT6A 4K2DA 4WETA 1T4ZA 2DJJA 4LL4B 1YEPA 1GTAA 3ZRDA 2FWHA 3TDGA 2EIOA 4GCIA 1SVLA 5IMVA 1YZXA 2YOIA 5CREA 1XOAA 3V1WA 1EP8A 3C7MA 4I2TA 2R6KA 4OFMA 3LG6A 1SJ6A 2MBTA 1TOFA 1AIUA 3R2QA 4EXJA 2VLUA 4DSSB 1K0AA 4Z2UA 4RUVA 3L78A 2H74A 1QK8A 4RQXA 2WULA 2O5VA 4FH8A 4PUFC 2B5XA 3A3TA 2YCDA 2LQOA 5DBQA 3F4TA 1F3BA 3IHGA 3KXOA 1QUWA 2VCZA 4E8HA 3QDNA 2GLRA 2DIZA 1ZYNA 1YKCA 2YJ7A 2HI7A 4ZILA 5F07A 2L57A 4BPYA 4HUAA 2YANA 4IP6A 1DE2A 2GZPA 1JZOA 1FOHA 1CQGA 4YKFA 4KDUA 3IR4A 1ERVA 1GSQA 3QFBC 3ZYWA 2AHEA 1A2JA 2ES7A 2VD1A 4I97A 3C71A 3UJ1A 3US3A 1TRWA 3HY2A 1EGOA 4G19A 1NM3A 2A2SA 2FWGA 4GF0A 3DVWA 4Q5FA 2ZNMA 2DJ0A 3CBUA 1O8XA 1JLWA 2XPEA 4NHWA 4Q5RA 2R4VA 1V40A 1QGVA 1XIYA 1XW5A 3IK9A 5CRDA 3FKFA 1B4PA 3BBYA 4NV2A 3APSA 2HE3A 1X9MB 2OA7A 4V1Ag 5D9WA 2O85A 2XC2A 2L4QA 3KTBA 5HR3A 4L5LA 1S3AA 1TDIA 3CWGA 1Z6NA 3BD2A 3ZMKA 1JZRA 1GWCA 2WS2A 3ZMLA 1V57A 2V1MA 3GV1A 3GTUA 2VLTA 3KMOA 2N5BA 3GNJA 4E8EA 5HR2A 3A2XA 4IVFA 3IHQA 2O87A 3W6GA 4GLTA 4G2EA 5J41A 5ECSA 3U5RE 2H66A 2RM5A 1X9SB 3CSIA 2M72A 2JZRA 2YJHA 2VD0A 4PNGA 3I9V2 5IIZA 3GSSA 1WE0A 3BCKA 3F4SA 5LCZA 2VL9A 5INYA 1K0MA 3L9SA 3RDWA 3H93A 5AGYA 1GSDA 1PL2A 1M2DA 2EC4A 2OE1A 1TK8B 1FB0A 1ERUA 4ULXA 2IMFA 2DMMA 1O8WA 4K5SA 1E6BA 16GSA 5IM9A 2V6OA 1GULA 1A24A 3G7IA 1X5CA 2LKUA 1SL0B 3QD9A 2B7KA 2VCVA 4AJ7A 3TRPA 3HXSA 4EL1A 3I43A 3DRNA 3VWUA 4K0GA 3VLNA 3E0UA 3QAWA 5C04A 2LEGA 3ED3A 2MMNA 2IN3A 3F6DA 4IP1A 1E2YA 4HOJA 4KX4A 1OAZA 5CRGA 1V98A 3CTGA 1ZYEA 1PX6A 4FIWA 3LWAA 4IW9A 5H5RA 5A5HB 3LYKA 4LL1B 2EFDA 5EVOA 4O32A 1IYIA 1TRVA 3GH9A 2HYXA 1A8LA 17GSA 5G5EA 4POLA 2R0GA 1PN9A 1G6YA 2H0GA 1NSWA 3H8QA 4DSQA 1K0OA 4K1FA 3D22A 3SBCA 5CAXA 2CZ2A 2JU5A 1K0BA 2M80A 1B9YC 3WGDA 2DSAA 3KCMA 4OMVA 3KTLA 4EIQA 2H1DA 2QGVA 2HZEA 1JLVA 1Y1UA 1FB6A 3HDCA 4L0UA 4MJEA 4RQRA 2VOCA 4CY6A 5HR1A 2YN1A 5DALB 1YEXA 4K5RA 1T4YA 2AYTA 3BJ5A 4OD7A 2WCIA 2A2RA 1WOUA 2JSYA 2L5OA 5D8IA 3PGTA 5IPHA 3J7Yb 3DD3A 3CXGA 2RLIA 3FZ4A 2LV3A 4QL7A 1T1VA 2F8AA 1GSYA 1MDKA 1M99A 5ID2B 3DXBA 2VCXA 1ERTA 2HSNB 3IV4A 2TRXA 3N5OA 3RPNA 4TR1A 2L59A 4TKYA 3OR5A 1V2AA 4G01A 3J7Yk 3M8NA 4MPGA 5CNWA 5ELGA 3WT1A 3UVTA 1A2MA 3UBKA 1SD8A 2NBSA 2VIMA 2LJRA 3GL3A 3EC3A 4GSSA 3FEUA 3ZVJA 4F0CA 3VURA 1K3YA 2C1YA 2XBIA 3E9JB 5A5KA 2XBQA 4JU5A 4TXOA 3Q74A 3RHCA 2R5GA 3TKSA 3DVXA 2ZCTA 3CRTA 3LGCA 3VFIA 4HQSA 1PN0A 3O6TA 3IAM2 3IOSA 4PQHA 4POMA 1R4WA 3MYDA 1Z6MA 3QR6A 4GWRA 2IMEA 4W66A 3GN3A 4IQ1A 5AISA 2H6ZA 4L8EA 3Q18A 2AB6A 10GSA 1XOBA 3CMIA 2B1LA 3MWHA 2TRCP 4KDYA 3F3QA 4KAEA 4ZBBA 2HRFA 5ECKB 3QPMA 2A4HA 2YPMA 4HQZA 1X5DA 3I6AA 3KP9A 3IXRA 2MZCA 2GT6A 4AJ6A 4WF5A 2LS5A 4O92A 5A5HA 1RW1A 1Z3EA 1J9BA 2E0QA 1BEDA 1FO5A 4TXVA 19GSA 2OADA 3EE2A 4WKWA 1FW1A 2R0PA 2GSTA 5ECHB 5DQYA 3VWWA 3DKSA 2L6DA 4BVYA 2BMXA 2R0CA 1EV9A 2CA8A 1ZL9A 4TOPA 1JZWA 2GSRA 3TJKA 2X64A 1XWKA 1HNBA 5B6NA 1GRXA 1HYUA 4K0NA 2B5YA 2M46A 2C3TA 1R26A 4EDZA 4CHSA 3M9KA 4POKA 4MP4A 4XS4B 3Q19A 2KP2A 4LLRA 3NZNA 4ZXGA 5DALA 4ZB8A 2LNSA 4RI6A 1G7OA 1TRSA 6GSYA 1SYRA 2IL3A 3HVSA 3GTUB 4PUAA 2JACA 3HMJG 3FZAA 3D21A 11GSA 4ZIJA 3TGZA 6GSWA 1SK0A 4F9ZA 6GSUA 5ECOB 5ID2A 2AJQB 2RUFA 1KNGA 5DVBA 14GSA 2HSNA 1THOA 5KEJA 5ECNB 3K8NA 5DCGA 2V6KA 2FA8A 4N10A 4HS1A 1UA5A 1Z7RA 4MMMA 3HD5A 3ME7A 1PA3A 1TKDB 4Q5NA 1PL1A 4IKHA 3VWXA 2X4AA 4LA1A 3VI7A 3ZZXA 2PVQA 2O8VB 4MA9A 2OKAA 5GAND 1S3DA 2H0HA 1TP9A 1GTIA 2QKEA 3UBLA 5IPGA 4EF0A 1VRSD 4HZ2A 1FHEA 1SU9A 5AN1A 1O6JA 3MAKA 3WYWA 5HQPA 4KNDA 3F4RA 1GTBA 4HEA2 1GP1A 2X8CA 2F51A 4MZCA 3R3EA 3EINA 4QQ7A 4YQVA 3C8EA 1YF1A 1XVQA 5CP1A 2PN8A 3FK8A 3H4KA 3H79A 4BL7A 4PQIA 1BG5A 4OFTA 1N8JA 2WB9A 3GKXA 5G1KA 4TW5A 1ZMAA 2IMIA 2PVOC 3ME8A 4ZL9A 1B4QA 1K3OA 3MSZA 2B3SA 1YY7A 2GZZA 2V2GA 3FR3A 1YVLA 1SENA 1FOVA 2P5QA 2H70A 5G1LA 1USBA 4YH2A 2C3QA 3F3RA 4KCEA 1TJDA 3IAS2 4IS0A 13GSA 2GSQA 3HJOA 3P90A 5ELAA 5J9CA 3WT2A 1T3BA 4GXZA 1R5AA 3ERGA 1H75A 2HXKA 2VCTA 1BF5A 4BVXB 2NDOA 5D96A 3VWVA 4BWSA 3DMLA 1S3CA 4YQMA 2HZEB 2ZUPA 1TU8A 4HJ2A 1SL1B 2PGTA 1M2BA 4TVEA 3O3TA 4BWQA 5D9XA 4Z2TA 2GQKA 3GYKA 4HU9A 2LJAA 1AUCA 3NIVA 3UL3A 2E2MA 2C80A 3LYPA 2KUCA 2MMZA 1U88A 2D2ZA 5J4VA 5IQYA 4PURA 2CVKA 4XS4A 4K7NA 2GDRA 1X9WB 2JZTA 4NHZA 3C1SA 1OKDA 4MNNA 1X5EA 3O76A 4EIPA 2QA1A 3MDKA 2OBKA 3L9VA 4MZWA 4Q5QA 5IMFA 1AAZA 1JHBA 1YF0A 4TR1B 3PH9A 5B6MA 2HSMB 4O5UA 1U3IA 2ON5A 4HU7A 4I5QA 1FVKA 3GIXA 5JCWA 2BTOT 1M0UA 4K8MA 3UAPA 2VCWA 5E59A 3ZL5A 3KMNA 1F37A 3M1GA 4PXOA 3GX0A 1JFUA 2K8SA 2KOKA 4ID0A 4ECCA 4MCUA 1Y6EA 5F8BA 1AQXA 4P3YB 2UV8G 4IJIA 3KJYA 1ERWA 1VF3A 4TXOB 4EE0A 2MMOA 3GURA 4WEYA 2H1LA 4MK3A 4CW9A 3APOA 4ZL7A 5G5FA 2X99A 1GUKA 7GSSA 3TJJA 2HFDA 2LUSA 4ICYA 5D93A 3C73A 2FNOA 1PRXA 2DLXA 1QQ2A 3TRQA 4KUNA 4D73A 2DC5A 3IRAA 5CRWA 3HJPA 1SVOA 1B9XC 1SYXA 4AKHA 5EL8A 4KDXA 1BX9A 3CRUA 4TR4A 3ERFA 1ZZYA 3LW9A 1XWAA 1ML6A 1F6MC 1LJRA 2UZ8A 5GAPD 1U6TA 4QL9A 4F82A 3M0FA 1XXUA 1GLPA 5A34B 4N3ZA 5GSSA 2C3NA 2IMDA 4AKXB 1B48A 3TKQA 3TOTA 2FCHA 4GSTA 2XHFA 4HJMA 4BVYB 4NV5A 1O73A 4OO4A 4MZBA 2HNLA 4ECIA 3UARA 2K18A 4IELA 2CV4A 3EVIA 3PINA 1J08A 3ZREA 2CVBA 4EDYA 4ZBAA 4BVXA 4PQ1A 4HDEA 2HRAA 2H19A 4WF4A 4GTUA 2DBCA 2C0FA 1J0FA 1TW9A 1LU4A 4V1Ap 3GA4A 3QCPA 2K6VA 2WRTA 3P2AA 2OJLA 1XFLA 4J57E 5D9VA 4K2XA 1G7EA 2OT3A 3EWLA 1ACVA 1W4VA 4Z7XA 1AQVA 1PD21 12GSA 1Z5YE 3LEFA 1PSQA 4IN0A 2H1AA 3LFLA 1I9DA 3D4TA 4F03A 1RK4A 5DQSA 5A4VA 3KD0A 1K0DA 5J3RA 3UEMA 1OYJA 2HSMA 3QMXA 2DJ3A 1YDKA 4ZBDA 1YKAA 4RI7A 3IC8A 4JE1A 3IE3A 2H75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAA A;  4FYU A;  4OCE A;  1PX7 A;  3D4M A;  4EKZ A;  4X1U A;  4DVC A;  3KZQ A;  1GUM A;  1XWG A;  2YZU A;  3TJB A;  4MJC A;  2HT9 A;  1ILO A;  1A23 A;  2H72 A;  2N5A A;  1FVJ A;  1OC9 A;  5EPF A;  6GSV A;  2IFQ B;  3C1R A;  1SK1 A;  4K6X A;  4XS1 A;  2CX3 A;  3P8W A;  1M7T A;  5A4W A;  3G7Y A;  2CAQ A;  2VLV A;  4N0V A;  3GHA A;  4KGI A;  2H73 A;  4I6X A;  3QOU A;  4BL7 B;  1EP7 A;  4JZQ A;  3LOR A;  2F9S A;  4MF5 A;  1EV4 A;  2VM2 A;  2LJK A;  2EIQ A;  2LNT A;  4MF7 A;  2FUG 2;  2K8V A;  2FWE A;  3DWV A;  2P5R A;  2Z9S A;  5ABR A;  4ECJ A;  2YWM A;  1AC1 A;  3GRX A;  2I4A A;  1Q4J A;  2WZ9 A;  1WWJ A;  1F3A A;  2X8G A;  4PX1 A;  2E2G A;  5DJL A;  1UC7 A;  5JWR B;  3LXZ A;  1M2A A;  4IGJ A;  5IMA A;  5ECI B;  1DBY A;  3ISO A;  1Y25 A;  1JZD A;  4K7O A;  3VPQ A;  1ABA A;  1GLQ A;  1VF4 A;  2VM1 A;  1YJ6 A;  4GQC A;  1URM A;  4NMU A;  3KH7 A;  3TRX A;  3KIJ A;  3TKP A;  4PGT A;  3W8S A;  1A8Y A;  5IMC A;  1K3L A;  2PBJ A;  4EUY A;  3F0I A;  3EU4 A;  4OCF A;  1G0T A;  1XWB A;  1THX A;  1OC3 A;  1NHY A;  2FY6 A;  3A2W A;  1IYH A;  1XPV A;  4WR5 A;  2LTK A;  3U6V A;  3H1N A;  4FQU A;  4G0L A;  3IC4 A;  4X0X A;  4MDC A;  1V58 A;  3HVX A;  4F2I A;  1MDJ A;  3TB2 A;  1WMJ A;  3L9U A;  3QAG A;  3HHV A;  2MMA A;  3KH9 A;  4BA7 A;  3HYP A;  1K0C A;  1TI1 A;  2L6C A;  4JED A;  1MD4 A;  4MH3 A;  4JR4 A;  2WFC A;  4OWY A;  1EZK A;  2B1K A;  1M9B A;  5J9B A;  4KA0 A;  1LBK A;  2JAD A;  2E7P A;  2LRC A;  18GS A;  5EY6 A;  3GST A;  1CQH A;  1H4O A;  2H0I A;  3IDV A;  3ZFB A;  1F2E A;  1GUH A;  4XS6 A;  5C00 A;  4OFN A;  4O7H A;  3ZIV A;  8GSS A;  3FW2 A;  2RUE A;  2KP1 A;  4AJ8 A;  5COH A;  4OO5 A;  2HQT A;  1GSE A;  4KSO A;  20GS A;  2PER A;  1BQ7 A;  2ON7 A;  3WD6 A;  4IQA A;  2IFQ A;  1VF2 A;  3FYG A;  3JCM L;  2GSS A;  2DJK A;  4TN8 A;  1HNA A;  5L71 A;  1KBN A;  2NVL A;  4D73 B;  4G9H A;  5LNK e;  1NW2 A;  2VL3 A;  2B5E A;  1HNC A;  3M9J A;  3ZVJ D;  1BYE A;  1YQ1 A;  3UIW A;  4I8B A;  3HJM A;  3ZTL A;  1WJK A;  1HQO A;  4PTS A;  2C0D A;  1GL8 A;  4MJB A;  3GMF A;  3NOF A;  5IMD A;  4XIH A;  3DYR A;  6GST A;  4V2M A;  2YV9 A;  5GST A;  3HVV A;  4KH7 A;  1PKW A;  1V9W A;  5KN3 A;  2EIR A;  4HI7 A;  1B8X A;  5ECQ B;  3UVH A;  2JZS A;  1UVZ A;  5A4U A;  5DDL A;  1OVN A;  1Z9H A;  1R5P A;  5F06 A;  4ACS A;  3F6F A;  2OBI A;  2B6M A;  3P7X A;  3IPZ A;  1ON4 A;  4G0K A;  3RHB A;  4TR0 A;  2V32 A;  2VL2 A;  1EOH A;  1DSB A;  2K9F A;  2H1G A;  4HZ4 A;  5ECR B;  2GS3 A;  5D9T A;  2PPT A;  2JL4 A;  3MNG A;  2HZF A;  2TIR A;  1TRU A;  2REM A;  4PNF A;  1U87 A;  1GNE A;  3TCO A;  1AW9 A;  3BOA A;  1SKS B;  2LST A;  2H6Y A;  3DIE A;  3SWL A;  2YWO A;  2O7K A;  2VO4 A;  4H86 A;  1PKZ A;  3LJR A;  3HA9 A;  5ECM B;  1G6W A;  2OE0 A;  4JRR A;  2N5F A;  1AXD A;  5IO0 A;  2F8F A;  3BCI A;  1MEK A;  2H01 A;  4FYC A;  3PR8 A;  2H76 A;  1XCC A;  2HRK A;  2GGT A;  3F8U A;  3FR9 A;  1O85 A;  3CTF A;  3D6I A;  2O89 A;  3ERW A;  1MD3 A;  4MLY A;  1OKT A;  3GKM A;  3VI5 A;  3E3E A;  2VUP A;  2XPD A;  3HZ8 A;  5FWG A;  1T8E B;  1DE1 A;  5DJM A;  3HCZ A;  5JCG A;  1TTZ A;  2J9H A;  4KB3 A;  5IMZ A;  4MAB A;  5BMU A;  2R3X A;  3RAZ A;  1MTC A;  1HD2 A;  2GVP A;  5J5N A;  3S9F A;  4NAX A;  2CZ3 A;  2VCQ A;  1GH2 A;  2HRN A;  4ZB6 A;  22GS A;  1AQW A;  3QFA C;  2BJX A;  5KN2 A;  3CSJ A;  1OC9 B;  3WGE A;  1TXX A;  2JSZ A;  1KEB A;  2PU9 C;  3FY7 A;  2GZY A;  4GRF A;  1SJI A;  4NWY A;  5G30 A;  1ST9 A;  1XWC A;  4F0B A;  2FLS A;  2G0F A;  3LXT A;  2LQQ A;  3A5W A;  2FGX A;  1PGT A;  3GX8 A;  2YZH A;  4J2F A;  3EUR A;  1T00 A;  1OE8 A;  1GSU A;  1GSS A;  5H5Q A;  2H6X A;  2B7J A;  5E4W A;  1ZGN A;  2CQ9 A;  4ISD A;  3UMA A;  2YWN A;  2P31 A;  1SK2 A;  2C0G A;  2WGR A;  4L5O A;  4L0W A;  4WXT A;  5IOW A;  5ENU A;  4DSS A;  1K0N A;  4XRA A;  2QSI A;  2R37 A;  4KF9 A;  4DSR A;  1TU7 A;  2IMK A;  2I81 A;  3A2V A;  1Z7P A;  1I5G A;  3TKS C;  2LRN A;  2KLX A;  3GL5 A;  1OC8 A;  2H8L A;  1A0F A;  3G9B A;  5HR0 A;  2GQM A;  2R2J A;  1EWX A;  4I2U A;  1XW9 A;  4FO5 A;  3EYT A;  2MBS A;  4GSN A;  4LMW A;  4LMV A;  1ZOF A;  6GSX A;  4YQU A;  1R7H A;  4YAP A;  1UN2 A;  5HFG A;  1WPI A;  5GZZ B;  4TR3 A;  1W89 A;  2NTO A;  3EMP A;  2FHE A;  2HSY A;  4ILF A;  3W8J A;  4ZL8 A;  1RQM A;  1SL2 B;  3HKR A;  3F9U A;  3FZ9 A;  4WR4 A;  1SJZ A;  3ZIJ A;  4XTS A;  3VK9 A;  3QAV A;  3EU3 A;  4IBP A;  3Q6O A;  4N11 A;  4POB A;  3EMX A;  1KTE A;  2FWF A;  4JR6 A;  2DIY A;  3CYN A;  5B8B A;  1OE7 A;  3KM6 A;  5LD0 A;  3ZIT A;  5B8A A;  2C0E A;  2PWJ A;  2AV4 A;  4WBR D;  2I9H A;  2KHP A;  3AY8 A;  3GUS A;  1WRY A;  4YAV A;  2C8U A;  4KW6 A;  1X0R A;  5KN1 A;  4TRX A;  1FG4 A;  2I3Y A;  4KSM A;  2AAW A;  3D0Z A;  1GSF A;  1SKW B;  5JWQ B;  4DEJ A;  4MJA A;  1ZCP A;  3TJF A;  1O7U A;  4NPB A;  2PUK C;  2RM6 A;  1MDI A;  5DAK B;  3TKR A;  1QFN A;  4IJ3 A;  4ML6 A;  2DJ2 A;  4EVM A;  2F3M A;  5DCH A;  2H30 A;  3GKN A;  4N30 A;  2DML A;  1EEM A;  2H71 A;  4AGS A;  3FZ5 A;  1GNW A;  4X43 A;  3DGQ A;  3M3M A;  1TI3 A;  1ZYQ B;  2GTU A;  1O81 A;  1BJX A;  2GT5 A;  3KGK A;  4G0I A;  2G2Q A;  2NPB A;  4K7I A;  3FR6 A;  1XW6 A;  2L5L A;  4O5R A;  2OAC A;  3ZFL A;  1EOG A;  3GFK A;  4XHM A;  2FA4 A;  1WP0 A;  2PMT A;  1SD9 A;  3GKK A;  4J56 E;  1WIK A;  1F9M A;  4IHU A;  4MF6 A;  4N0Z A;  4ML1 A;  3RPP A;  2IJY A;  9GSS A;  4KCA A;  3LSZ A;  4CDO A;  3CSH A;  5H5S A;  3TJG A;  2YNX A;  2OE3 A;  4ZB9 A;  3IBH A;  3L4N A;  4JBB A;  3PPU A;  4K9Z A;  3TUE A;  3I69 A;  1EGR A;  5F0G A;  2V41 A;  2J23 A;  2AUV A;  2GQL A;  1XVW A;  5D73 A;  3DEX A;  5HFI A;  5IOX A;  1TK5 B;  3HZ4 A;  5J4U A;  1U3A A;  5HFK A;  6GSS A;  2FD3 A;  5AIV A;  2CX4 A;  2H1B A;  1M9A A;  3KEB A;  2IPA A;  4ECB A;  2IIY A;  2P0G A;  5KN0 A;  5ECL B;  4V2N A;  1PMT A;  4AF2 A;  4XRD A;  1GTU A;  1N2A A;  2X8H A;  3FHK A;  2LRT A;  2YV7 A;  2HRK B;  1A2L A;  2MYG A;  2VAF A;  3G7J A;  2ALB A;  4G10 A;  2A4V A;  4XCS A;  4V2L A;  5FT3 A;  1PQN A;  1TK0 B;  5CRH A;  1QXH A;  2RII A;  2WDU A;  4USS A;  1BAY A;  4FYB A;  2IWT A;  3F63 A;  1T7P B;  1XBS A;  4EO3 A;  2VL2 C;  1C72 A;  2HLS A;  1DUG A;  2WJU A;  3L0H A;  5G31 A;  1VF1 A;  3APQ A;  3IA1 A;  1SKR B;  1QMV A;  4EC0 A;  5IO2 A;  3TOU A;  3TKS E;  3FRC A;  3N9J A;  5G2Z A;  2YP6 A;  3WGX A;  5CYY A;  4WBJ A;  3VPT A;  5JCU A;  2YWI A;  3GH6 A;  5F05 A;  3RBT A;  1NHO A;  2CAI A;  4NXI A;  4MPF A;  3UOM A;  5ECP B;  1EEJ A;  5FHI A;  1XZO A;  2QC7 A;  4MH2 A;  2C4J A;  3KP8 A;  5B7C A;  5DAK A;  1Q98 A;  4GQF A;  1A0R P;  2HSH A;  5JWO B;  2DJ1 A;  2L4C A;  3LQ7 A;  2CVD A;  5AIX A;  1VGL A;  3ZLP A;  3IK7 A;  5CO3 A;  4KE3 A;  3D5J A;  2I1U A;  2CT6 A;  4K2D A;  4WET A;  1T4Z A;  2DJJ A;  4LL4 B;  1YEP A;  1GTA A;  3ZRD A;  2FWH A;  3TDG A;  2EIO A;  4GCI A;  5IMV A;  1YZX A;  2YOI A;  5CRE A;  1XOA A;  3V1W A;  4I2T A;  1EP8 A;  3C7M A;  2R6K A;  4OFM A;  3LG6 A;  1SJ6 A;  2MBT A;  1TOF A;  1AIU A;  3R2Q A;  4EXJ A;  2VLU A;  4DSS B;  1K0A A;  4RUV A;  3L78 A;  2H74 A;  1QK8 A;  4RQX A;  2WUL A;  4FH8 A;  4PUF C;  2B5X A;  3A3T A;  2YCD A;  2LQO A;  5DBQ A;  3F4T A;  1F3B A;  3KXO A;  1QUW A;  2VCZ A;  4E8H A;  3QDN A;  2GLR A;  2DIZ A;  1YKC A;  2YJ7 A;  2HI7 A;  4ZIL A;  5F07 A;  2L57 A;  4BPY A;  4HUA A;  2YAN A;  4IP6 A;  1DE2 A;  2GZP A;  1JZO A;  1CQG A;  4KDU A;  3IR4 A;  1ERV A;  1GSQ A;  3QFB C;  3ZYW A;  2AHE A;  1A2J A;  2ES7 A;  2VD1 A;  4I97 A;  3C71 A;  3UJ1 A;  3US3 A;  1TRW A;  3HY2 A;  1EGO A;  4G19 A;  1NM3 A;  2A2S A;  2FWG A;  4GF0 A;  3DVW A;  4Q5F A;  2ZNM A;  2DJ0 A;  3CBU A;  1O8X A;  1JLW A;  2XPE A;  4NHW A;  4Q5R A;  2R4V A;  1V40 A;  1QGV A;  1XIY A;  1XW5 A;  3IK9 A;  5CRD A;  3FKF A;  1B4P A;  3BBY A;  4NV2 A;  3APS A;  2HE3 A;  1X9M B;  2OA7 A;  4V1A g;  5D9W A;  2O85 A;  2XC2 A;  2L4Q A;  3KTB A;  5HR3 A;  4L5L A;  1S3A A;  1TDI A;  1Z6N A;  3BD2 A;  3ZMK A;  1JZR A;  1GWC A;  2WS2 A;  3ZML A;  1V57 A;  2V1M A;  3GV1 A;  3GTU A;  2VLT A;  3KMO A;  2N5B A;  3GNJ A;  4E8E A;  5HR2 A;  3A2X A;  4IVF A;  3IHQ A;  2O87 A;  3W6G A;  4GLT A;  4G2E A;  5J41 A;  5ECS A;  3U5R E;  2H66 A;  2RM5 A;  1X9S B;  3CSI A;  2M72 A;  2JZR A;  2YJH A;  2VD0 A;  4PNG A;  3I9V 2;  5IIZ A;  3GSS A;  1WE0 A;  3BCK A;  3F4S A;  5LCZ A;  2VL9 A;  5INY A;  1K0M A;  3L9S A;  3RDW A;  3H93 A;  5AGY A;  1GSD A;  1PL2 A;  1M2D A;  2EC4 A;  2OE1 A;  1TK8 B;  1FB0 A;  1ERU A;  4ULX A;  2IMF A;  2DMM A;  1O8W A;  1E6B A;  16GS A;  5IM9 A;  2V6O A;  1GUL A;  1A24 A;  3G7I A;  1X5C A;  2LKU A;  1SL0 B;  3QD9 A;  2B7K A;  2VCV A;  4AJ7 A;  3TRP A;  3HXS A;  4EL1 A;  3I43 A;  3DRN A;  3VWU A;  4K0G A;  3VLN A;  3E0U A;  3QAW A;  5C04 A;  2LEG A;  3ED3 A;  2MMN A;  2IN3 A;  3F6D A;  4IP1 A;  1E2Y A;  4HOJ A;  4KX4 A;  1OAZ A;  5CRG A;  1V98 A;  3CTG A;  1ZYE A;  1PX6 A;  4FIW A;  3LWA A;  4IW9 A;  5H5R A;  3LYK A;  4LL1 B;  5EVO A;  4O32 A;  1IYI A;  1TRV A;  3GH9 A;  2HYX A;  1A8L A;  17GS A;  5G5E A;  4POL A;  1PN9 A;  1G6Y A;  2H0G A;  1NSW A;  3H8Q A;  4DSQ A;  1K0O A;  4K1F A;  3D22 A;  3SBC A;  5CAX A;  2CZ2 A;  2JU5 A;  1K0B A;  2M80 A;  1B9Y C;  3WGD A;  2DSA A;  3KCM A;  4OMV A;  3KTL A;  2H1D A;  2QGV A;  2HZE A;  1JLV A;  1FB6 A;  3HDC A;  4L0U A;  4MJE A;  4RQR A;  2VOC A;  5HR1 A;  2YN1 A;  5DAL B;  1YEX A;  1T4Y A;  2AYT A;  3BJ5 A;  4OD7 A;  2WCI A;  2A2R A;  1WOU A;  2JSY A;  2L5O A;  5D8I A;  3PGT A;  5IPH A;  3J7Y b;  3DD3 A;  3CXG A;  2RLI A;  3FZ4 A;  2LV3 A;  4QL7 A;  1T1V A;  2F8A A;  1GSY A;  1MDK A;  1M99 A;  5ID2 B;  3DXB A;  2VCX A;  1ERT A;  2HSN B;  3IV4 A;  2TRX A;  3N5O A;  3RPN A;  4TR1 A;  2L59 A;  4TKY A;  3OR5 A;  1V2A A;  3J7Y k;  3M8N A;  4MPG A;  5CNW A;  5ELG A;  3WT1 A;  3UVT A;  1A2M A;  3UBK A;  1SD8 A;  2NBS A;  2VIM A;  2LJR A;  3GL3 A;  3EC3 A;  4GSS A;  3FEU A;  3ZVJ A;  4F0C A;  3VUR A;  1K3Y A;  2C1Y A;  2XBI A;  3E9J B;  5A5K A;  2XBQ A;  4JU5 A;  4TXO A;  3Q74 A;  3RHC A;  2R5G A;  3TKS A;  3DVX A;  2ZCT A;  3CRT A;  3LGC A;  3VFI A;  4HQS A;  3O6T A;  3IAM 2;  3IOS A;  4PQH A;  4POM A;  1R4W A;  1Z6M A;  3QR6 A;  4GWR A;  2IME A;  3GN3 A;  4IQ1 A;  5AIS A;  2H6Z A;  4L8E A;  3Q18 A;  2AB6 A;  10GS A;  1XOB A;  3CMI A;  2B1L A;  3MWH A;  2TRC P;  4KDY A;  3F3Q A;  4KAE A;  4ZBB A;  2HRF A;  5ECK B;  3QPM A;  2YPM A;  4HQZ A;  1X5D A;  3I6A A;  3KP9 A;  3IXR A;  2MZC A;  2GT6 A;  4AJ6 A;  4WF5 A;  2LS5 A;  4O92 A;  1RW1 A;  1Z3E A;  1J9B A;  2E0Q A;  1BED A;  1FO5 A;  4TXV A;  19GS A;  2OAD A;  3EE2 A;  4WKW A;  1FW1 A;  2GST A;  5ECH B;  5DQY A;  3VWW A;  3DKS A;  2L6D A;  4BVY A;  2BMX A;  1EV9 A;  2CA8 A;  1ZL9 A;  4TOP A;  1JZW A;  2GSR A;  3TJK A;  2X64 A;  1XWK A;  1HNB A;  5B6N A;  1GRX A;  1HYU A;  4K0N A;  2B5Y A;  2M46 A;  2C3T A;  1R26 A;  4EDZ A;  4CHS A;  3M9K A;  4POK A;  4MP4 A;  4XS4 B;  3Q19 A;  2KP2 A;  4LLR A;  3NZN A;  4ZXG A;  5DAL A;  4ZB8 A;  2LNS A;  4RI6 A;  1G7O A;  1TRS A;  6GSY A;  1SYR A;  2IL3 A;  3HVS A;  3GTU B;  4PUA A;  2JAC A;  3FZA A;  3D21 A;  11GS A;  4ZIJ A;  3TGZ A;  6GSW A;  1SK0 A;  4F9Z A;  6GSU A;  5ECO B;  5ID2 A;  2AJQ B;  2RUF A;  1KNG A;  5DVB A;  14GS A;  1THO A;  5KEJ A;  5ECN B;  3K8N A;  5DCG A;  2V6K A;  2FA8 A;  4N10 A;  4HS1 A;  1UA5 A;  1Z7R A;  4MMM A;  3HD5 A;  3ME7 A;  1PA3 A;  1TKD B;  4Q5N A;  1PL1 A;  4IKH A;  3VWX A;  4LA1 A;  3VI7 A;  3ZZX A;  2PVQ A;  2O8V B;  4MA9 A;  2OKA A;  5GAN D;  1S3D A;  2H0H A;  1TP9 A;  1GTI A;  2QKE A;  3UBL A;  5IPG A;  4EF0 A;  1VRS D;  4HZ2 A;  1FHE A;  1SU9 A;  5AN1 A;  1O6J A;  3MAK A;  3WYW A;  5HQP A;  4KND A;  3F4R A;  1GTB A;  4HEA 2;  1GP1 A;  2X8C A;  2F51 A;  4MZC A;  3R3E A;  3EIN A;  4QQ7 A;  4YQV A;  3C8E A;  1YF1 A;  1XVQ A;  5CP1 A;  2PN8 A;  3FK8 A;  3H4K A;  3H79 A;  4BL7 A;  4PQI A;  1BG5 A;  4OFT A;  1N8J A;  2WB9 A;  3GKX A;  5G1K A;  4TW5 A;  1ZMA A;  2IMI A;  2PVO C;  3ME8 A;  4ZL9 A;  1B4Q A;  1K3O A;  3MSZ A;  2B3S A;  1YY7 A;  2GZZ A;  2V2G A;  3FR3 A;  1SEN A;  1FOV A;  2P5Q A;  2H70 A;  5G1L A;  1USB A;  4YH2 A;  2C3Q A;  3F3R A;  4KCE A;  1TJD A;  3IAS 2;  4IS0 A;  13GS A;  2GSQ A;  3HJO A;  3P90 A;  5ELA A;  5J9C A;  3WT2 A;  1T3B A;  4GXZ A;  1R5A A;  3ERG A;  1H75 A;  2HXK A;  2VCT A;  4BVX B;  2NDO A;  5D96 A;  3VWV A;  4BWS A;  3DML A;  1S3C A;  4YQM A;  2HZE B;  2ZUP A;  1TU8 A;  4HJ2 A;  1SL1 B;  2PGT A;  1M2B A;  4TVE A;  3O3T A;  4BWQ A;  5D9X A;  2GQK A;  3GYK A;  4HU9 A;  2LJA A;  1AUC A;  3NIV A;  3UL3 A;  2E2M A;  2C80 A;  3LYP A;  2KUC A;  2MMZ A;  1U88 A;  2D2Z A;  5IQY A;  4PUR A;  2CVK A;  4XS4 A;  4K7N A;  2GDR A;  1X9W B;  2JZT A;  4NHZ A;  3C1S A;  1OKD A;  1X5E A;  3O76 A;  3MDK A;  2OBK A;  3L9V A;  4MZW A;  4Q5Q A;  5IMF A;  1AAZ A;  1JHB A;  1YF0 A;  4TR1 B;  3PH9 A;  5B6M A;  2HSM B;  1U3I A;  2ON5 A;  4HU7 A;  4I5Q A;  1FVK A;  3GIX A;  5JCW A;  2BTO T;  1M0U A;  4K8M A;  3UAP A;  2VCW A;  5E59 A;  3ZL5 A;  3KMN A;  1F37 A;  3M1G A;  4PXO A;  3GX0 A;  1JFU A;  2K8S A;  2KOK A;  4ID0 A;  4ECC A;  4MCU A;  1Y6E A;  5F8B A;  1AQX A;  4P3Y B;  4IJI A;  3KJY A;  1ERW A;  1VF3 A;  4TXO B;  4EE0 A;  2MMO A;  3GUR A;  4WEY A;  4MK3 A;  4CW9 A;  3APO A;  4ZL7 A;  5G5F A;  2X99 A;  1GUK A;  7GSS A;  3TJJ A;  2HFD A;  2LUS A;  5D93 A;  3C73 A;  2FNO A;  1PRX A;  2DLX A;  1QQ2 A;  3TRQ A;  4KUN A;  4D73 A;  2DC5 A;  3IRA A;  5CRW A;  3HJP A;  1B9X C;  1SYX A;  5EL8 A;  4KDX A;  1BX9 A;  3CRU A;  4TR4 A;  3ERF A;  1ZZY A;  1XWA A;  1ML6 A;  1F6M C;  1LJR A;  2UZ8 A;  5GAP D;  1U6T A;  4QL9 A;  4F82 A;  3M0F A;  1XXU A;  1GLP A;  5GSS A;  2C3N A;  2IMD A;  1B48 A;  3TKQ A;  3TOT A;  2FCH A;  4GST A;  2XHF A;  4HJM A;  4BVY B;  4NV5 A;  1O73 A;  4OO4 A;  4MZB A;  2HNL A;  4ECI A;  3UAR A;  2K18 A;  4IEL A;  2CV4 A;  3EVI A;  3PIN A;  1J08 A;  3ZRE A;  2CVB A;  4EDY A;  4ZBA A;  4BVX A;  4PQ1 A;  4HDE A;  2HRA A;  2H19 A;  4WF4 A;  4GTU A;  2DBC A;  2C0F A;  1J0F A;  1TW9 A;  1LU4 A;  4V1A p;  3GA4 A;  3QCP A;  2K6V A;  2WRT A;  3P2A A;  2OJL A;  1XFL A;  4J57 E;  5D9V A;  1G7E A;  3EWL A;  1ACV A;  1W4V A;  4Z7X A;  1AQV A;  1PD2 1;  12GS A;  1Z5Y E;  3LEF A;  1PSQ A;  4IN0 A;  2H1A A;  3LFL A;  1I9D A;  3D4T A;  4F03 A;  1RK4 A;  5DQS A;  5A4V A;  3KD0 A;  1K0D A;  5J3R A;  3UEM A;  1OYJ A;  2HSM A;  3QMX A;  2DJ3 A;  1YDK A;  4ZBD A;  1YKA A;  4RI7 A;  3IC8 A;  4JE1 A;  3IE3 A;  2H75 A; 
#chains in the Genus database with same CATH topology
 1FAA A;  4FYU A;  4OCE A;  1PX7 A;  3D4M A;  4EKZ A;  4X1U A;  4DVC A;  3KZQ A;  1GUM A;  1XWG A;  2YZU A;  3TJB A;  4MJC A;  2HT9 A;  1ILO A;  1A23 A;  2H72 A;  2N5A A;  2WW1 A;  1FVJ A;  1OC9 A;  5EPF A;  6GSV A;  2IFQ B;  3C1R A;  1SK1 A;  4K6X A;  2EFE A;  4XS1 A;  2CX3 A;  3P8W A;  1M7T A;  5A4W A;  3G7Y A;  2CAQ A;  2VLV A;  4N0V A;  3GHA A;  4KGI A;  2H73 A;  4I6X A;  3QOU A;  4BL7 B;  1EP7 A;  4JZQ A;  2F9S A;  3LOR A;  4MF5 A;  1EV4 A;  2VM2 A;  2LJK A;  2EIQ A;  2LNT A;  4MF7 A;  2FUG 2;  2K8V A;  2FWE A;  3DWV A;  2P5R A;  2Z9S A;  2WW0 A;  5J40 A;  5ABR A;  4ECJ A;  2YWM A;  1AC1 A;  3GRX A;  2I4A A;  1Q4J A;  2WZ9 A;  1WWJ A;  1F3A A;  2X8G A;  4PX1 A;  2E2G A;  5DJL A;  1UC7 A;  5JWR B;  3LXZ A;  1M2A A;  4IGJ A;  5IMA A;  5A34 A;  4PI2 C;  5ECI B;  1DBY A;  3ISO A;  1Y25 A;  1JZD A;  4K7O A;  3VPQ A;  1ABA A;  1GLQ A;  1VF4 A;  2VM1 A;  1YJ6 A;  4GQC A;  1URM A;  4NMU A;  3KH7 A;  3TRX A;  3KIJ A;  3TKP A;  4PGT A;  1BG1 A;  3W8S A;  1A8Y A;  1ZYP A;  5IMC A;  1K3L A;  2PBJ A;  4EUY A;  3F0I A;  3EU4 A;  4OCF A;  1G0T A;  1XWB A;  1THX A;  1OC3 A;  1NHY A;  2FY6 A;  3A2W A;  1IYH A;  2O3E A;  1XPV A;  4WR5 A;  2LTK A;  3U6V A;  2O36 A;  3H1N A;  4FQU A;  4G0L A;  3IC4 A;  4X0X A;  4MDC A;  1V58 A;  3HVX A;  4F2I A;  1MDJ A;  4AKI A;  1WMJ A;  3L9U A;  3QAG A;  3TB2 A;  3HHV A;  2MMA A;  3KH9 A;  4Z2R A;  4BA7 A;  3HYP A;  1K0C A;  4QMK A;  1TI1 A;  2L6C A;  4JED A;  1MD4 A;  4MH3 A;  4JR4 A;  2WFC A;  4OWY A;  5KOX A;  1EZK A;  2B1K A;  1M9B A;  5J9B A;  4KA0 A;  1LBK A;  2JAD A;  4E68 A;  2E7P A;  2LRC A;  18GS A;  5EY6 A;  3GST A;  1CQH A;  1H4O A;  2H0I A;  3IDV A;  3ZFB A;  1F2E A;  1GUH A;  4XS6 A;  5C00 A;  4OFN A;  4O7H A;  3ZIV A;  4A5P A;  8GSS A;  3FW2 A;  2RUE A;  2KP1 A;  5J47 A;  4AJ8 A;  4YKG A;  5COH A;  1N25 A;  4OO5 A;  2HQT A;  1GSE A;  4KSO A;  20GS A;  2PER A;  1BQ7 A;  2ON7 A;  3WD6 A;  4IQA A;  2IFQ A;  1VF2 A;  3FYG A;  3JCM L;  3RFR C;  2GSS A;  2DJK A;  4TN8 A;  4BIK A;  1HNA A;  5L71 A;  1KBN A;  2NVL A;  4D73 B;  4G9H A;  5LNK e;  4AKG A;  1NW2 A;  5J4Y A;  2VL3 A;  2B5E A;  1HNC A;  3M9J A;  3ZVJ D;  1BYE A;  1YQ1 A;  3UIW A;  3HJM A;  4I8B A;  3ZTL A;  1WJK A;  1HQO A;  4PTS A;  2C0D A;  1GL8 A;  4MJB A;  3GMF A;  3NOF A;  5IMD A;  4XIH A;  3DYR A;  6GST A;  3FMW A;  4V2M A;  2YV9 A;  5GST A;  3HVV A;  4KH7 A;  1PKW A;  1V9W A;  5KN3 A;  2EIR A;  4HI7 A;  1B8X A;  5ECQ B;  3UVH A;  2JZS A;  1UVZ A;  5A4U A;  5DDL A;  1OVN A;  1Z9H A;  1R5P A;  5F06 A;  4ACS A;  3F6F A;  2OBI A;  2B6M A;  3P7X A;  3IPZ A;  1ON4 A;  4G0K A;  3RHB A;  4TR0 A;  2V32 A;  2VL2 A;  1EOH A;  1DSB A;  2K9F A;  1S3R A;  2H1G A;  4HZ4 A;  5ECR B;  2GS3 A;  5D9T A;  2PPT A;  2JL4 A;  3MNG A;  2HZF A;  2TIR A;  1TRU A;  2REM A;  4PNF A;  1U87 A;  1GNE A;  3TCO A;  1AW9 A;  3BOA A;  1SKS B;  2LST A;  2H6Y A;  3DIE A;  3SWL A;  2YWO A;  2O7K A;  2VO4 A;  4H86 A;  1PKZ A;  3HA9 A;  3LJR A;  1SVM A;  5ECM B;  1G6W A;  2OE0 A;  3MIX A;  4JRR A;  2N5F A;  1AXD A;  5IO0 A;  2F8F A;  3BCI A;  1MEK A;  2H01 A;  4FYC A;  3PR8 A;  2H76 A;  1XCC A;  2HRK A;  2GGT A;  3F8U A;  3FR9 A;  1O85 A;  3CTF A;  3D6I A;  2O89 A;  3ERW A;  1MD3 A;  4MLY A;  1OKT A;  3GKM A;  1I1I P;  2DKH A;  1TXU A;  3VI5 A;  3E3E A;  2VUP A;  2XPD A;  2WZS A;  2A2P A;  2DKI A;  3HZ8 A;  5FWG A;  1T8E B;  1DE1 A;  5DJM A;  3HCZ A;  5A1N A;  5JCG A;  1TTZ A;  2J9H A;  4KB3 A;  5IMZ A;  4MAB A;  5BMU A;  2R3X A;  3RAZ A;  1MTC A;  1HD2 A;  2GVP A;  5J5N A;  3S9F A;  4NAX A;  2CZ3 A;  2VCQ A;  1GH2 A;  2HRN A;  4ZB6 A;  22GS A;  1AQW A;  3QFA C;  2BJX A;  5KN2 A;  3CSJ A;  1OC9 B;  3WGE A;  1TXX A;  2JSZ A;  1KEB A;  2PU9 C;  2QA2 A;  3FY7 A;  2GZY A;  4GRF A;  4FXY P;  1SJI A;  4NWY A;  5G30 A;  1ST9 A;  1XWC A;  4F0B A;  2FLS A;  2G0F A;  3LXT A;  2LQQ A;  3A5W A;  2FGX A;  1PGT A;  3GX8 A;  2YZH A;  3EPT A;  4J2F A;  3EUR A;  1T00 A;  1OE8 A;  1GSU A;  1GSS A;  5H5Q A;  2H6X A;  2B7J A;  5E4W A;  1ZGN A;  2CQ9 A;  4ISD A;  3UMA A;  2YWN A;  2P31 A;  1SK2 A;  2C0G A;  2WGR A;  4L5O A;  4GDF A;  4L0W A;  4WXT A;  5IOW A;  5ENU A;  4DSS A;  3A5I A;  1K0N A;  4XRA A;  2QSI A;  2R37 A;  4KF9 A;  4DSR A;  1TU7 A;  2IMK A;  2I81 A;  3A2V A;  4CY8 A;  1Z7P A;  1I5G A;  3TKS C;  2LRN A;  2KLX A;  3GL5 A;  1OC8 A;  2H8L A;  1A0F A;  3G9B A;  5HR0 A;  2GQM A;  2R2J A;  1EWX A;  4I2U A;  1XW9 A;  4FO5 A;  3EYT A;  2MBS A;  4GSN A;  4LMW A;  4LMV A;  1ZOF A;  6GSX A;  4YQU A;  1R7H A;  4YAP A;  1UN2 A;  5HFG A;  1WPI A;  5GZZ B;  4TR3 A;  1W89 A;  2NTO A;  3EMP A;  2FHE A;  2HSY A;  4ILF A;  3W8J A;  4ZL8 A;  1RQM A;  1SL2 B;  3CQF A;  3HKR A;  3F9U A;  3FZ9 A;  4WR4 A;  1SJZ A;  3ZIJ A;  4XTS A;  3VK9 A;  3QAV A;  3EU3 A;  4IBP A;  3Q6O A;  4N11 A;  4POB A;  3EMX A;  1KTE A;  2FWF A;  4JR6 A;  2DIY A;  3CYN A;  5B8B A;  3KM6 A;  1OE7 A;  5LD0 A;  3ZIT A;  5B8A A;  4O5Q A;  2C0E A;  2PWJ A;  2AV4 A;  4WBR D;  2I9H A;  2KHP A;  3AY8 A;  3GUS A;  4AI6 A;  1WRY A;  4YAV A;  4ZB7 A;  2C8U A;  4KW6 A;  1X0R A;  5KN1 A;  4TRX A;  1FG4 A;  2I3Y A;  4KSM A;  2AAW A;  3D0Z A;  1GSF A;  1SKW B;  5JWQ B;  4DEJ A;  4MJA A;  1ZCP A;  3TJF A;  1O7U A;  4NPB A;  1S4B P;  4X4J A;  2PUK C;  2RM6 A;  1MDI A;  5DAK B;  3TKR A;  1QFN A;  4IJ3 A;  4ML6 A;  2DJ2 A;  4EVM A;  2F3M A;  5DCH A;  2H30 A;  3GKN A;  5BRT A;  1M3J A;  4N30 A;  2DML A;  1EEM A;  2H71 A;  4AGS A;  3FZ5 A;  1GNW A;  4X43 A;  3DGQ A;  3M3M A;  1TI3 A;  1ZYQ B;  2GTU A;  1O81 A;  1BJX A;  2GT5 A;  3KGK A;  4G0I A;  2G2Q A;  2NPB A;  4K7I A;  3FR6 A;  1XW6 A;  2L5L A;  4O5R A;  2OAC A;  3ZFL A;  1EOG A;  3GFK A;  4XHM A;  2FA4 A;  1WP0 A;  2X49 A;  2PMT A;  2WW2 A;  1YEW C;  1SD9 A;  2EFH A;  3GKK A;  4J56 E;  1WIK A;  1F9M A;  4IHU A;  4MF6 A;  4N0Z A;  4ML1 A;  3RPP A;  2IJY A;  9GSS A;  4KCA A;  3LSZ A;  4CDO A;  3CSH A;  5H5S A;  3TJG A;  2YNX A;  2OE3 A;  4ZB9 A;  3IBH A;  3L4N A;  4JBB A;  3PPU A;  4K9Z A;  3TUE A;  3I69 A;  1EGR A;  5F0G A;  2V41 A;  2J23 A;  2AUV A;  2GQL A;  1XVW A;  5D73 A;  3DEX A;  5HFI A;  5IOX A;  1TK5 B;  3HZ4 A;  5J4U A;  1U3A A;  5HFK A;  6GSS A;  2FD3 A;  5AIV A;  2CX4 A;  2H1B A;  1M9A A;  3KEB A;  2IPA A;  4ECB A;  2IIY A;  2P0G A;  5KN0 A;  5ECL B;  4V2N A;  1PMT A;  4AF2 A;  4XRD A;  1GTU A;  1N2A A;  2X8H A;  3FHK A;  2LRT A;  2YV7 A;  5KOW A;  2HRK B;  4PHZ C;  1A2L A;  2MYG A;  2VAF A;  3G7J A;  2ALB A;  4G10 A;  2A4V A;  4XCS A;  4V2L A;  5FT3 A;  1PQN A;  1TK0 B;  5CRH A;  1QXH A;  2RII A;  2WDU A;  4USS A;  1BAY A;  4FYB A;  2IWT A;  3F63 A;  1T7P B;  1XBS A;  3TU3 B;  4EO3 A;  5A1N B;  2VL2 C;  1C72 A;  2HLS A;  1DUG A;  2WJU A;  3L0H A;  5G31 A;  1VF1 A;  5BMU B;  3APQ A;  3IA1 A;  1SKR B;  1QMV A;  4EC0 A;  5IO2 A;  3TOU A;  3TKS E;  3FRC A;  3N9J A;  5G2Z A;  2YP6 A;  3WGX A;  5CYY A;  4WBJ A;  3VPT A;  5JCU A;  2YWI A;  3GH6 A;  5F05 A;  3RBT A;  1NHO A;  2CAI A;  4NXI A;  4MPF A;  3UOM A;  5ECP B;  1EEJ A;  5FHI A;  1XZO A;  2QC7 A;  4MH2 A;  2C4J A;  3KP8 A;  5B7C A;  5DAK A;  1Q98 A;  4GQF A;  2EFC A;  1A0R P;  2HSH A;  5JWO B;  2DJ1 A;  2L4C A;  3LQ7 A;  2CVD A;  5AIX A;  1VGL A;  3ZLP A;  3IK7 A;  5CO3 A;  4KE3 A;  2VKZ G;  3D5J A;  2I1U A;  2CT6 A;  4K2D A;  4WET A;  1T4Z A;  2DJJ A;  4LL4 B;  1YEP A;  1GTA A;  3ZRD A;  2FWH A;  3TDG A;  2EIO A;  4GCI A;  1SVL A;  5IMV A;  1YZX A;  2YOI A;  5CRE A;  1XOA A;  3V1W A;  1EP8 A;  3C7M A;  4I2T A;  2R6K A;  4OFM A;  3LG6 A;  1SJ6 A;  2MBT A;  1TOF A;  1AIU A;  3R2Q A;  4EXJ A;  2VLU A;  4DSS B;  1K0A A;  4Z2U A;  4RUV A;  3L78 A;  2H74 A;  1QK8 A;  4RQX A;  2WUL A;  2O5V A;  4FH8 A;  4PUF C;  2B5X A;  3A3T A;  2WW3 A;  2YCD A;  2LQO A;  5DBQ A;  3F4T A;  1F3B A;  3IHG A;  3KXO A;  1QUW A;  2VCZ A;  4E8H A;  3QDN A;  2GLR A;  2DIZ A;  1ZYN A;  3RGB C;  1YKC A;  2YJ7 A;  2HI7 A;  4ZIL A;  5F07 A;  2L57 A;  4BPY A;  4HUA A;  2YAN A;  4IP6 A;  1DE2 A;  2GZP A;  1JZO A;  1FOH A;  1CQG A;  4YKF A;  4KDU A;  3IR4 A;  1ERV A;  1GSQ A;  3QFB C;  3ZYW A;  2AHE A;  1A2J A;  2ES7 A;  2VD1 A;  4I97 A;  3C71 A;  3UJ1 A;  3US3 A;  1TRW A;  3HY2 A;  1EGO A;  4G19 A;  1NM3 A;  2A2S A;  2FWG A;  4GF0 A;  3DVW A;  4Q5F A;  2ZNM A;  2DJ0 A;  3CBU A;  1O8X A;  1JLW A;  2XPE A;  4NHW A;  4Q5R A;  2R4V A;  1V40 A;  1QGV A;  1XIY A;  1XW5 A;  3IK9 A;  5CRD A;  3FKF A;  1B4P A;  3BBY A;  4NV2 A;  3APS A;  2HE3 A;  1X9M B;  2OA7 A;  4V1A g;  5D9W A;  2O85 A;  2XC2 A;  2L4Q A;  3KTB A;  5HR3 A;  4L5L A;  1S3A A;  1TDI A;  3CHX C;  3CWG A;  1Z6N A;  3BD2 A;  3ZMK A;  1JZR A;  1GWC A;  2WS2 A;  3ZML A;  1V57 A;  2V1M A;  3GV1 A;  3GTU A;  2VLT A;  3KMO A;  2N5B A;  3GNJ A;  4E8E A;  2WVZ A;  5HR2 A;  3A2X A;  4IVF A;  3IHQ A;  2O87 A;  3W6G A;  4GLT A;  4G2E A;  5J41 A;  5ECS A;  3U5R E;  2H66 A;  2RM5 A;  1X9S B;  3CSI A;  2M72 A;  2JZR A;  2YJH A;  2VD0 A;  4PNG A;  3I9V 2;  5IIZ A;  3GSS A;  1WE0 A;  3BCK A;  3F4S A;  5LCZ A;  2VL9 A;  5INY A;  1K0M A;  3L9S A;  3RDW A;  3H93 A;  5AGY A;  1GSD A;  1PL2 A;  1M2D A;  2EC4 A;  2OE1 A;  1TK8 B;  1FB0 A;  1ERU A;  4ULX A;  2IMF A;  2DMM A;  1O8W A;  4K5S A;  1E6B A;  16GS A;  5IM9 A;  2V6O A;  1GUL A;  1A24 A;  3G7I A;  1X5C A;  2LKU A;  1SL0 B;  3QD9 A;  2B7K A;  2VCV A;  4AJ7 A;  3TRP A;  3HXS A;  4EL1 A;  3I43 A;  3DRN A;  3VWU A;  4K0G A;  3VLN A;  3E0U A;  3QAW A;  5C04 A;  2LEG A;  3ED3 A;  2MMN A;  2IN3 A;  3F6D A;  4IP1 A;  1E2Y A;  4HOJ A;  4KX4 A;  1OAZ A;  5CRG A;  1V98 A;  3CTG A;  1ZYE A;  1PX6 A;  4FIW A;  3LWA A;  4IW9 A;  5H5R A;  5A5H B;  3LYK A;  4LL1 B;  2EFD A;  5EVO A;  4O32 A;  1IYI A;  1TRV A;  3GH9 A;  2HYX A;  1A8L A;  17GS A;  5G5E A;  4POL A;  2R0G A;  1PN9 A;  1G6Y A;  2H0G A;  1NSW A;  3H8Q A;  4DSQ A;  1K0O A;  4K1F A;  3D22 A;  3SBC A;  5CAX A;  2CZ2 A;  2JU5 A;  1K0B A;  2M80 A;  1B9Y C;  3WGD A;  2DSA A;  3KCM A;  4OMV A;  3KTL A;  4EIQ A;  2H1D A;  2QGV A;  2HZE A;  1JLV A;  1Y1U A;  1FB6 A;  3HDC A;  4L0U A;  4MJE A;  4RQR A;  2VOC A;  4CY6 A;  5HR1 A;  2YN1 A;  5DAL B;  1YEX A;  4K5R A;  1T4Y A;  2AYT A;  3BJ5 A;  4OD7 A;  2WCI A;  2A2R A;  1WOU A;  2JSY A;  2L5O A;  5D8I A;  3PGT A;  5IPH A;  2WVX A;  3DD3 A;  3J7Y b;  3CXG A;  2RLI A;  3FZ4 A;  2LV3 A;  2WVY A;  4QL7 A;  1T1V A;  2F8A A;  1GSY A;  1MDK A;  1M99 A;  5ID2 B;  3DXB A;  2VCX A;  1ERT A;  2HSN B;  3IV4 A;  2TRX A;  3N5O A;  3RPN A;  4TR1 A;  2L59 A;  4TKY A;  3OR5 A;  1V2A A;  4G01 A;  3J7Y k;  3M8N A;  4MPG A;  5CNW A;  5ELG A;  3WT1 A;  3UVT A;  1A2M A;  3UBK A;  1SD8 A;  2NBS A;  2VIM A;  2LJR A;  3GL3 A;  3EC3 A;  4GSS A;  3FEU A;  3ZVJ A;  4F0C A;  3VUR A;  1K3Y A;  2C1Y A;  2XBI A;  3E9J B;  5A5K A;  2XBQ A;  4JU5 A;  4TXO A;  3Q74 A;  3RHC A;  2R5G A;  3TKS A;  3DVX A;  2ZCT A;  3CRT A;  3LGC A;  3VFI A;  4HQS A;  1PN0 A;  3O6T A;  3IAM 2;  3IOS A;  4PQH A;  4POM A;  1R4W A;  3MYD A;  1Z6M A;  3QR6 A;  4GWR A;  2IME A;  4W66 A;  3GN3 A;  4IQ1 A;  5AIS A;  2H6Z A;  4L8E A;  3Q18 A;  2AB6 A;  10GS A;  1XOB A;  3CMI A;  2B1L A;  3MWH A;  2TRC P;  4KDY A;  3F3Q A;  4KAE A;  4ZBB A;  2HRF A;  5ECK B;  3QPM A;  2A4H A;  2YPM A;  4HQZ A;  1X5D A;  1XG8 A;  3I6A A;  3KP9 A;  3IXR A;  2MZC A;  2GT6 A;  4AJ6 A;  4WF5 A;  2LS5 A;  4O92 A;  5A5H A;  1RW1 A;  1Z3E A;  1J9B A;  2E0Q A;  1BED A;  1FO5 A;  4TXV A;  19GS A;  2OAD A;  1M3I A;  3EE2 A;  4WKW A;  1FW1 A;  2R0P A;  2GST A;  5ECH B;  5DQY A;  3VWW A;  3DKS A;  2L6D A;  4BVY A;  2BMX A;  2R0C A;  1EV9 A;  2CA8 A;  1ZL9 A;  4TOP A;  1JZW A;  2GSR A;  3TJK A;  2X64 A;  1XWK A;  1HNB A;  5B6N A;  1GRX A;  1HYU A;  4K0N A;  2B5Y A;  2M46 A;  2C3T A;  1R26 A;  4EDZ A;  4CHS A;  3M9K A;  4PI0 C;  4POK A;  4MP4 A;  4XS4 B;  3Q19 A;  2KP2 A;  4LLR A;  3NZN A;  4ZXG A;  5DAL A;  3HVN A;  4ZB8 A;  2LNS A;  4RI6 A;  1G7O A;  1TRS A;  6GSY A;  1SYR A;  2IL3 A;  3HVS A;  3GTU B;  4PUA A;  2JAC A;  3HMJ G;  3FZA A;  3D21 A;  11GS A;  4ZIJ A;  3TGZ A;  6GSW A;  1PFO A;  1SK0 A;  4F9Z A;  6GSU A;  5ECO B;  5ID2 A;  2AJQ B;  2RUF A;  1KNG A;  5DVB A;  14GS A;  2HSN A;  1THO A;  5KEJ A;  5ECN B;  3K8N A;  5DCG A;  2V6K A;  2FA8 A;  4N10 A;  4HS1 A;  1UA5 A;  1Z7R A;  4MMM A;  3HD5 A;  3ME7 A;  1PA3 A;  1TKD B;  4Q5N A;  1PL1 A;  4IKH A;  3VWX A;  2X4A A;  4LA1 A;  3VI7 A;  3ZZX A;  2PVQ A;  2O8V B;  4MA9 A;  2OKA A;  5GAN D;  1S3D A;  2H0H A;  1TP9 A;  1GTI A;  2QKE A;  3UBL A;  5IPG A;  4EF0 A;  1VRS D;  4HZ2 A;  1FHE A;  1SU9 A;  5AN1 A;  1O6J A;  3MAK A;  3WYW A;  5HQP A;  4KND A;  3F4R A;  1GTB A;  4HEA 2;  1GP1 A;  2X8C A;  2F51 A;  4MZC A;  3R3E A;  3EIN A;  4QQ7 A;  4YQV A;  3C8E A;  1YF1 A;  1XVQ A;  5CP1 A;  2PN8 A;  3FK8 A;  3H4K A;  3H79 A;  4BL7 A;  4PQI A;  1BG5 A;  4OFT A;  1N8J A;  2WB9 A;  3GKX A;  5G1K A;  4TW5 A;  1ZMA A;  2IMI A;  2PVO C;  3ME8 A;  4ZL9 A;  1B4Q A;  1K3O A;  3MSZ A;  2B3S A;  1YY7 A;  2GZZ A;  2V2G A;  3FR3 A;  1YVL A;  1SEN A;  1FOV A;  2P5Q A;  2H70 A;  5G1L A;  1USB A;  4YH2 A;  2C3Q A;  3F3R A;  4KCE A;  1TJD A;  3IAS 2;  4IS0 A;  13GS A;  2GSQ A;  3HJO A;  3P90 A;  5ELA A;  5J9C A;  3WT2 A;  1T3B A;  4GXZ A;  1R5A A;  3ERG A;  1H75 A;  2HXK A;  2VCT A;  1BF5 A;  4BVX B;  2NDO A;  5D96 A;  3VWV A;  4BWS A;  3DML A;  1S3C A;  4YQM A;  2HZE B;  2ZUP A;  1TU8 A;  4HJ2 A;  1SL1 B;  2PGT A;  1M2B A;  4TVE A;  3O3T A;  4BWQ A;  5D9X A;  4Z2T A;  2GQK A;  3GYK A;  4HU9 A;  2LJA A;  1AUC A;  3NIV A;  3UL3 A;  2E2M A;  2C80 A;  3LYP A;  2KUC A;  2MMZ A;  1U88 A;  2D2Z A;  5J4V A;  5IQY A;  4PUR A;  2CVK A;  4XS4 A;  4K7N A;  2GDR A;  1X9W B;  2JZT A;  4NHZ A;  3C1S A;  1OKD A;  4MNN A;  2WVX B;  1X5E A;  3O76 A;  4EIP A;  2QA1 A;  3MDK A;  2OBK A;  3L9V A;  4MZW A;  4Q5Q A;  5IMF A;  1AAZ A;  1JHB A;  1YF0 A;  4TR1 B;  3PH9 A;  5B6M A;  2HSM B;  4O5U A;  1U3I A;  2ON5 A;  4HU7 A;  4I5Q A;  1FVK A;  3GIX A;  5JCW A;  2BTO T;  1M0U A;  4K8M A;  3UAP A;  2VCW A;  5E59 A;  3ZL5 A;  3KMN A;  1F37 A;  3M1G A;  4PXO A;  3GX0 A;  1JFU A;  2K8S A;  2KOK A;  4ID0 A;  4ECC A;  4MCU A;  1Y6E A;  5F8B A;  1AQX A;  4P3Y B;  2UV8 G;  4IJI A;  3KJY A;  1ERW A;  1VF3 A;  4TXO B;  4EE0 A;  2MMO A;  3GUR A;  4WEY A;  2H1L A;  4MK3 A;  4CW9 A;  3APO A;  4ZL7 A;  5G5F A;  2X99 A;  1GUK A;  7GSS A;  3TJJ A;  2HFD A;  2LUS A;  4ICY A;  4HSC X;  5D93 A;  3C73 A;  2FNO A;  1PRX A;  2DLX A;  1QQ2 A;  3TRQ A;  4KUN A;  4D73 A;  2DC5 A;  3IRA A;  5CRW A;  3HJP A;  1SVO A;  1B9X C;  1SYX A;  4AKH A;  5EL8 A;  4KDX A;  1BX9 A;  3CRU A;  4TR4 A;  3ERF A;  1ZZY A;  3LW9 A;  1XWA A;  1ML6 A;  1F6M C;  1LJR A;  2UZ8 A;  5GAP D;  1U6T A;  4QL9 A;  4F82 A;  3M0F A;  1XXU A;  1GLP A;  5A34 B;  4N3Z A;  5GSS A;  2C3N A;  2IMD A;  4AKX B;  1B48 A;  3TKQ A;  3TOT A;  2FCH A;  4GST A;  2XHF A;  4HJM A;  4BVY B;  4NV5 A;  1O73 A;  4OO4 A;  4MZB A;  2HNL A;  4ECI A;  3UAR A;  2K18 A;  4IEL A;  2CV4 A;  3EVI A;  3PIN A;  1J08 A;  3ZRE A;  2CVB A;  4EDY A;  4ZBA A;  4BVX A;  4PQ1 A;  4HDE A;  2HRA A;  2H19 A;  4WF4 A;  4GTU A;  2DBC A;  2C0F A;  1J0F A;  1TW9 A;  1LU4 A;  4V1A p;  3GA4 A;  3QCP A;  2K6V A;  2WRT A;  3P2A A;  2OJL A;  1XFL A;  4J57 E;  5D9V A;  4K2X A;  1G7E A;  2OT3 A;  3EWL A;  1ACV A;  1W4V A;  4Z7X A;  1AQV A;  1PD2 1;  12GS A;  1Z5Y E;  3LEF A;  1PSQ A;  4IN0 A;  2H1A A;  3LFL A;  1I9D A;  3D4T A;  4F03 A;  1RK4 A;  5DQS A;  5A4V A;  3KD0 A;  1K0D A;  5J3R A;  3UEM A;  1OYJ A;  2HSM A;  3QMX A;  2DJ3 A;  1YDK A;  4ZBD A;  1YKA A;  4RI7 A;  3IC8 A;  4JE1 A;  3IE3 A;  2H75 A; 
#chains in the Genus database with same CATH homology
 1FAA A;  4FYU A;  4OCE A;  1PX7 A;  3D4M A;  4EKZ A;  4X1U A;  4DVC A;  3KZQ A;  1GUM A;  1XWG A;  2YZU A;  3TJB A;  4MJC A;  2HT9 A;  1ILO A;  1A23 A;  2H72 A;  2N5A A;  1FVJ A;  1OC9 A;  5EPF A;  6GSV A;  2IFQ B;  3C1R A;  1SK1 A;  4K6X A;  2EFE A;  4XS1 A;  2CX3 A;  3P8W A;  1M7T A;  5A4W A;  3G7Y A;  2CAQ A;  2VLV A;  4N0V A;  3GHA A;  4KGI A;  2H73 A;  4I6X A;  3QOU A;  4BL7 B;  1EP7 A;  4JZQ A;  3LOR A;  2F9S A;  4MF5 A;  1EV4 A;  2VM2 A;  2LJK A;  2EIQ A;  2LNT A;  4MF7 A;  2FUG 2;  2K8V A;  2FWE A;  3DWV A;  2P5R A;  2Z9S A;  5J40 A;  5ABR A;  4ECJ A;  2YWM A;  1AC1 A;  3GRX A;  2I4A A;  1Q4J A;  2WZ9 A;  1WWJ A;  1F3A A;  2X8G A;  4PX1 A;  2E2G A;  5DJL A;  1UC7 A;  5JWR B;  3LXZ A;  1M2A A;  4IGJ A;  5IMA A;  5A34 A;  5ECI B;  1DBY A;  3ISO A;  1Y25 A;  1JZD A;  4K7O A;  3VPQ A;  1ABA A;  1GLQ A;  1VF4 A;  2VM1 A;  1YJ6 A;  4GQC A;  1URM A;  4NMU A;  3KH7 A;  3TRX A;  3KIJ A;  3TKP A;  4PGT A;  1BG1 A;  3W8S A;  1A8Y A;  1ZYP A;  5IMC A;  1K3L A;  2PBJ A;  4EUY A;  3F0I A;  3EU4 A;  4OCF A;  1G0T A;  1XWB A;  1THX A;  1OC3 A;  1NHY A;  2FY6 A;  3A2W A;  1IYH A;  1XPV A;  4WR5 A;  2LTK A;  3U6V A;  3H1N A;  4FQU A;  4G0L A;  3IC4 A;  4X0X A;  4MDC A;  1V58 A;  3HVX A;  4F2I A;  1MDJ A;  4AKI A;  1WMJ A;  3L9U A;  3QAG A;  3TB2 A;  3HHV A;  2MMA A;  3KH9 A;  4Z2R A;  4BA7 A;  3HYP A;  1K0C A;  4QMK A;  1TI1 A;  2L6C A;  4JED A;  1MD4 A;  4MH3 A;  4JR4 A;  2WFC A;  4OWY A;  5KOX A;  1EZK A;  2B1K A;  1M9B A;  5J9B A;  4KA0 A;  1LBK A;  2JAD A;  4E68 A;  2E7P A;  2LRC A;  18GS A;  5EY6 A;  3GST A;  1CQH A;  1H4O A;  2H0I A;  3IDV A;  3ZFB A;  1F2E A;  1GUH A;  4XS6 A;  5C00 A;  4OFN A;  4O7H A;  3ZIV A;  4A5P A;  8GSS A;  3FW2 A;  2RUE A;  2KP1 A;  5J47 A;  4AJ8 A;  4YKG A;  5COH A;  1N25 A;  4OO5 A;  2HQT A;  1GSE A;  4KSO A;  20GS A;  2PER A;  1BQ7 A;  2ON7 A;  3WD6 A;  4IQA A;  2IFQ A;  1VF2 A;  3FYG A;  3JCM L;  2GSS A;  2DJK A;  4TN8 A;  1HNA A;  5L71 A;  1KBN A;  2NVL A;  4D73 B;  4G9H A;  5LNK e;  4AKG A;  1NW2 A;  5J4Y A;  2VL3 A;  2B5E A;  1HNC A;  3M9J A;  3ZVJ D;  1BYE A;  1YQ1 A;  3UIW A;  3HJM A;  4I8B A;  3ZTL A;  1WJK A;  1HQO A;  4PTS A;  2C0D A;  1GL8 A;  4MJB A;  3GMF A;  3NOF A;  5IMD A;  4XIH A;  3DYR A;  6GST A;  3FMW A;  4V2M A;  2YV9 A;  5GST A;  3HVV A;  4KH7 A;  1PKW A;  1V9W A;  5KN3 A;  2EIR A;  4HI7 A;  1B8X A;  5ECQ B;  3UVH A;  2JZS A;  1UVZ A;  5A4U A;  5DDL A;  1OVN A;  1Z9H A;  1R5P A;  5F06 A;  4ACS A;  3F6F A;  2OBI A;  2B6M A;  3P7X A;  3IPZ A;  1ON4 A;  4G0K A;  3RHB A;  4TR0 A;  2V32 A;  2VL2 A;  1EOH A;  1DSB A;  2K9F A;  2H1G A;  4HZ4 A;  5ECR B;  2GS3 A;  5D9T A;  2PPT A;  2JL4 A;  3MNG A;  2HZF A;  2TIR A;  1TRU A;  2REM A;  4PNF A;  1U87 A;  1GNE A;  3TCO A;  1AW9 A;  3BOA A;  1SKS B;  2LST A;  2H6Y A;  3DIE A;  3SWL A;  2YWO A;  2O7K A;  2VO4 A;  4H86 A;  1PKZ A;  3HA9 A;  3LJR A;  1SVM A;  5ECM B;  1G6W A;  2OE0 A;  3MIX A;  4JRR A;  2N5F A;  1AXD A;  5IO0 A;  2F8F A;  3BCI A;  1MEK A;  2H01 A;  4FYC A;  3PR8 A;  2H76 A;  1XCC A;  2HRK A;  2GGT A;  3F8U A;  3FR9 A;  1O85 A;  3CTF A;  3D6I A;  2O89 A;  3ERW A;  1MD3 A;  4MLY A;  1OKT A;  3GKM A;  2DKH A;  1TXU A;  3VI5 A;  3E3E A;  2VUP A;  2XPD A;  2A2P A;  2DKI A;  3HZ8 A;  5FWG A;  1T8E B;  1DE1 A;  5DJM A;  3HCZ A;  5A1N A;  5JCG A;  1TTZ A;  2J9H A;  4KB3 A;  5IMZ A;  4MAB A;  5BMU A;  2R3X A;  3RAZ A;  1MTC A;  1HD2 A;  2GVP A;  5J5N A;  3S9F A;  4NAX A;  2CZ3 A;  2VCQ A;  1GH2 A;  2HRN A;  4ZB6 A;  22GS A;  1AQW A;  3QFA C;  2BJX A;  5KN2 A;  3CSJ A;  1OC9 B;  3WGE A;  1TXX A;  2JSZ A;  1KEB A;  2PU9 C;  2QA2 A;  3FY7 A;  2GZY A;  4GRF A;  1SJI A;  4NWY A;  5G30 A;  1ST9 A;  1XWC A;  4F0B A;  2FLS A;  2G0F A;  3LXT A;  2LQQ A;  3A5W A;  2FGX A;  1PGT A;  3GX8 A;  2YZH A;  3EPT A;  4J2F A;  3EUR A;  1T00 A;  1OE8 A;  1GSU A;  1GSS A;  5H5Q A;  2H6X A;  2B7J A;  5E4W A;  1ZGN A;  2CQ9 A;  4ISD A;  3UMA A;  2YWN A;  2P31 A;  1SK2 A;  2C0G A;  2WGR A;  4L5O A;  4GDF A;  4L0W A;  4WXT A;  5IOW A;  5ENU A;  4DSS A;  3A5I A;  1K0N A;  4XRA A;  2QSI A;  2R37 A;  4KF9 A;  4DSR A;  1TU7 A;  2IMK A;  2I81 A;  3A2V A;  4CY8 A;  1Z7P A;  1I5G A;  3TKS C;  2LRN A;  2KLX A;  3GL5 A;  1OC8 A;  2H8L A;  1A0F A;  3G9B A;  5HR0 A;  2GQM A;  2R2J A;  1EWX A;  4I2U A;  1XW9 A;  4FO5 A;  3EYT A;  2MBS A;  4GSN A;  4LMW A;  4LMV A;  1ZOF A;  6GSX A;  4YQU A;  1R7H A;  4YAP A;  1UN2 A;  5HFG A;  1WPI A;  5GZZ B;  4TR3 A;  1W89 A;  2NTO A;  3EMP A;  2FHE A;  2HSY A;  4ILF A;  3W8J A;  4ZL8 A;  1RQM A;  1SL2 B;  3HKR A;  3F9U A;  3FZ9 A;  4WR4 A;  1SJZ A;  3ZIJ A;  4XTS A;  3VK9 A;  3QAV A;  3EU3 A;  4IBP A;  3Q6O A;  4N11 A;  4POB A;  3EMX A;  1KTE A;  2FWF A;  4JR6 A;  2DIY A;  3CYN A;  5B8B A;  3KM6 A;  1OE7 A;  5LD0 A;  3ZIT A;  5B8A A;  4O5Q A;  2C0E A;  2PWJ A;  2AV4 A;  4WBR D;  2I9H A;  2KHP A;  3AY8 A;  3GUS A;  4AI6 A;  1WRY A;  4YAV A;  4ZB7 A;  2C8U A;  4KW6 A;  1X0R A;  5KN1 A;  4TRX A;  1FG4 A;  2I3Y A;  4KSM A;  2AAW A;  3D0Z A;  1GSF A;  1SKW B;  5JWQ B;  4DEJ A;  4MJA A;  1ZCP A;  3TJF A;  1O7U A;  4NPB A;  4X4J A;  2PUK C;  2RM6 A;  1MDI A;  5DAK B;  3TKR A;  1QFN A;  4IJ3 A;  4ML6 A;  2DJ2 A;  4EVM A;  2F3M A;  5DCH A;  2H30 A;  3GKN A;  5BRT A;  4N30 A;  2DML A;  1EEM A;  2H71 A;  4AGS A;  3FZ5 A;  1GNW A;  4X43 A;  3DGQ A;  3M3M A;  1TI3 A;  1ZYQ B;  2GTU A;  1O81 A;  1BJX A;  2GT5 A;  3KGK A;  4G0I A;  2G2Q A;  2NPB A;  4K7I A;  3FR6 A;  1XW6 A;  2L5L A;  4O5R A;  2OAC A;  3ZFL A;  1EOG A;  3GFK A;  4XHM A;  2FA4 A;  1WP0 A;  2X49 A;  2PMT A;  1SD9 A;  2EFH A;  3GKK A;  4J56 E;  1WIK A;  1F9M A;  4IHU A;  4MF6 A;  4N0Z A;  4ML1 A;  3RPP A;  2IJY A;  9GSS A;  4KCA A;  3LSZ A;  4CDO A;  3CSH A;  5H5S A;  3TJG A;  2YNX A;  2OE3 A;  4ZB9 A;  3IBH A;  3L4N A;  4JBB A;  3PPU A;  4K9Z A;  3TUE A;  3I69 A;  1EGR A;  5F0G A;  2V41 A;  2J23 A;  2AUV A;  2GQL A;  1XVW A;  5D73 A;  3DEX A;  5HFI A;  5IOX A;  1TK5 B;  3HZ4 A;  5J4U A;  1U3A A;  5HFK A;  6GSS A;  2FD3 A;  5AIV A;  2CX4 A;  2H1B A;  1M9A A;  3KEB A;  2IPA A;  4ECB A;  2IIY A;  2P0G A;  5KN0 A;  5ECL B;  4V2N A;  1PMT A;  4AF2 A;  4XRD A;  1GTU A;  1N2A A;  2X8H A;  3FHK A;  2LRT A;  2YV7 A;  5KOW A;  2HRK B;  1A2L A;  2MYG A;  2VAF A;  3G7J A;  2ALB A;  4G10 A;  2A4V A;  4XCS A;  4V2L A;  5FT3 A;  1PQN A;  1TK0 B;  5CRH A;  1QXH A;  2RII A;  2WDU A;  4USS A;  1BAY A;  4FYB A;  2IWT A;  3F63 A;  1T7P B;  1XBS A;  3TU3 B;  4EO3 A;  5A1N B;  2VL2 C;  1C72 A;  2HLS A;  1DUG A;  2WJU A;  3L0H A;  5G31 A;  1VF1 A;  5BMU B;  3APQ A;  3IA1 A;  1SKR B;  1QMV A;  4EC0 A;  5IO2 A;  3TOU A;  3TKS E;  3FRC A;  3N9J A;  5G2Z A;  2YP6 A;  3WGX A;  5CYY A;  4WBJ A;  3VPT A;  5JCU A;  2YWI A;  3GH6 A;  5F05 A;  3RBT A;  1NHO A;  2CAI A;  4NXI A;  4MPF A;  3UOM A;  5ECP B;  1EEJ A;  5FHI A;  1XZO A;  2QC7 A;  4MH2 A;  2C4J A;  3KP8 A;  5B7C A;  5DAK A;  1Q98 A;  4GQF A;  2EFC A;  1A0R P;  2HSH A;  5JWO B;  2DJ1 A;  2L4C A;  3LQ7 A;  2CVD A;  5AIX A;  1VGL A;  3ZLP A;  3IK7 A;  5CO3 A;  4KE3 A;  2VKZ G;  3D5J A;  2I1U A;  2CT6 A;  4K2D A;  4WET A;  1T4Z A;  2DJJ A;  4LL4 B;  1YEP A;  1GTA A;  3ZRD A;  2FWH A;  3TDG A;  2EIO A;  4GCI A;  1SVL A;  5IMV A;  1YZX A;  2YOI A;  5CRE A;  1XOA A;  3V1W A;  1EP8 A;  3C7M A;  4I2T A;  2R6K A;  4OFM A;  3LG6 A;  1SJ6 A;  2MBT A;  1TOF A;  1AIU A;  3R2Q A;  4EXJ A;  2VLU A;  4DSS B;  1K0A A;  4Z2U A;  4RUV A;  3L78 A;  2H74 A;  1QK8 A;  4RQX A;  2WUL A;  2O5V A;  4FH8 A;  4PUF C;  2B5X A;  3A3T A;  2YCD A;  2LQO A;  5DBQ A;  3F4T A;  1F3B A;  3IHG A;  3KXO A;  1QUW A;  2VCZ A;  4E8H A;  3QDN A;  2GLR A;  2DIZ A;  1ZYN A;  1YKC A;  2YJ7 A;  2HI7 A;  4ZIL A;  5F07 A;  2L57 A;  4BPY A;  4HUA A;  2YAN A;  4IP6 A;  1DE2 A;  2GZP A;  1JZO A;  1FOH A;  1CQG A;  4YKF A;  4KDU A;  3IR4 A;  1ERV A;  1GSQ A;  3QFB C;  3ZYW A;  2AHE A;  1A2J A;  2ES7 A;  2VD1 A;  4I97 A;  3C71 A;  3UJ1 A;  3US3 A;  1TRW A;  3HY2 A;  1EGO A;  4G19 A;  1NM3 A;  2A2S A;  2FWG A;  4GF0 A;  3DVW A;  4Q5F A;  2ZNM A;  2DJ0 A;  3CBU A;  1O8X A;  1JLW A;  2XPE A;  4NHW A;  4Q5R A;  2R4V A;  1V40 A;  1QGV A;  1XIY A;  1XW5 A;  3IK9 A;  5CRD A;  3FKF A;  1B4P A;  3BBY A;  4NV2 A;  3APS A;  2HE3 A;  1X9M B;  2OA7 A;  4V1A g;  5D9W A;  2O85 A;  2XC2 A;  2L4Q A;  3KTB A;  5HR3 A;  4L5L A;  1S3A A;  1TDI A;  3CWG A;  1Z6N A;  3BD2 A;  3ZMK A;  1JZR A;  1GWC A;  2WS2 A;  3ZML A;  1V57 A;  2V1M A;  3GV1 A;  3GTU A;  2VLT A;  3KMO A;  2N5B A;  3GNJ A;  4E8E A;  5HR2 A;  3A2X A;  4IVF A;  3IHQ A;  2O87 A;  3W6G A;  4GLT A;  4G2E A;  5J41 A;  5ECS A;  3U5R E;  2H66 A;  2RM5 A;  1X9S B;  3CSI A;  2M72 A;  2JZR A;  2YJH A;  2VD0 A;  4PNG A;  3I9V 2;  5IIZ A;  3GSS A;  1WE0 A;  3BCK A;  3F4S A;  5LCZ A;  2VL9 A;  5INY A;  1K0M A;  3L9S A;  3RDW A;  3H93 A;  5AGY A;  1GSD A;  1PL2 A;  1M2D A;  2EC4 A;  2OE1 A;  1TK8 B;  1FB0 A;  1ERU A;  4ULX A;  2IMF A;  2DMM A;  1O8W A;  4K5S A;  1E6B A;  16GS A;  5IM9 A;  2V6O A;  1GUL A;  1A24 A;  3G7I A;  1X5C A;  2LKU A;  1SL0 B;  3QD9 A;  2B7K A;  2VCV A;  4AJ7 A;  3TRP A;  3HXS A;  4EL1 A;  3I43 A;  3DRN A;  3VWU A;  4K0G A;  3VLN A;  3E0U A;  3QAW A;  5C04 A;  2LEG A;  3ED3 A;  2MMN A;  2IN3 A;  3F6D A;  4IP1 A;  1E2Y A;  4HOJ A;  4KX4 A;  1OAZ A;  5CRG A;  1V98 A;  3CTG A;  1ZYE A;  1PX6 A;  4FIW A;  3LWA A;  4IW9 A;  5H5R A;  5A5H B;  3LYK A;  4LL1 B;  2EFD A;  5EVO A;  4O32 A;  1IYI A;  1TRV A;  3GH9 A;  2HYX A;  1A8L A;  17GS A;  5G5E A;  4POL A;  2R0G A;  1PN9 A;  1G6Y A;  2H0G A;  1NSW A;  3H8Q A;  4DSQ A;  1K0O A;  4K1F A;  3D22 A;  3SBC A;  5CAX A;  2CZ2 A;  2JU5 A;  1K0B A;  2M80 A;  1B9Y C;  3WGD A;  2DSA A;  3KCM A;  4OMV A;  3KTL A;  4EIQ A;  2H1D A;  2QGV A;  2HZE A;  1JLV A;  1Y1U A;  1FB6 A;  3HDC A;  4L0U A;  4MJE A;  4RQR A;  2VOC A;  4CY6 A;  5HR1 A;  2YN1 A;  5DAL B;  1YEX A;  4K5R A;  1T4Y A;  2AYT A;  3BJ5 A;  4OD7 A;  2WCI A;  2A2R A;  1WOU A;  2JSY A;  2L5O A;  5D8I A;  3PGT A;  5IPH A;  3J7Y b;  3DD3 A;  3CXG A;  2RLI A;  3FZ4 A;  2LV3 A;  4QL7 A;  1T1V A;  2F8A A;  1GSY A;  1MDK A;  1M99 A;  5ID2 B;  3DXB A;  2VCX A;  1ERT A;  2HSN B;  3IV4 A;  2TRX A;  3N5O A;  3RPN A;  4TR1 A;  2L59 A;  4TKY A;  3OR5 A;  1V2A A;  4G01 A;  3J7Y k;  3M8N A;  4MPG A;  5CNW A;  5ELG A;  3WT1 A;  3UVT A;  1A2M A;  3UBK A;  1SD8 A;  2NBS A;  2VIM A;  2LJR A;  3GL3 A;  3EC3 A;  4GSS A;  3FEU A;  3ZVJ A;  4F0C A;  3VUR A;  1K3Y A;  2C1Y A;  2XBI A;  3E9J B;  5A5K A;  2XBQ A;  4JU5 A;  4TXO A;  3Q74 A;  3RHC A;  2R5G A;  3TKS A;  3DVX A;  2ZCT A;  3CRT A;  3LGC A;  3VFI A;  4HQS A;  1PN0 A;  3O6T A;  3IAM 2;  3IOS A;  4PQH A;  4POM A;  1R4W A;  3MYD A;  1Z6M A;  3QR6 A;  4GWR A;  2IME A;  4W66 A;  3GN3 A;  4IQ1 A;  5AIS A;  2H6Z A;  4L8E A;  3Q18 A;  2AB6 A;  10GS A;  1XOB A;  3CMI A;  2B1L A;  3MWH A;  2TRC P;  4KDY A;  3F3Q A;  4KAE A;  4ZBB A;  2HRF A;  5ECK B;  3QPM A;  2A4H A;  2YPM A;  4HQZ A;  1X5D A;  3I6A A;  3KP9 A;  3IXR A;  2MZC A;  2GT6 A;  4AJ6 A;  4WF5 A;  2LS5 A;  4O92 A;  5A5H A;  1RW1 A;  1Z3E A;  1J9B A;  2E0Q A;  1BED A;  1FO5 A;  4TXV A;  19GS A;  2OAD A;  3EE2 A;  4WKW A;  1FW1 A;  2R0P A;  2GST A;  5ECH B;  5DQY A;  3VWW A;  3DKS A;  2L6D A;  4BVY A;  2BMX A;  2R0C A;  1EV9 A;  2CA8 A;  1ZL9 A;  4TOP A;  1JZW A;  2GSR A;  3TJK A;  2X64 A;  1XWK A;  1HNB A;  5B6N A;  1GRX A;  1HYU A;  4K0N A;  2B5Y A;  2M46 A;  2C3T A;  1R26 A;  4EDZ A;  4CHS A;  3M9K A;  4POK A;  4MP4 A;  4XS4 B;  3Q19 A;  2KP2 A;  4LLR A;  3NZN A;  4ZXG A;  5DAL A;  4ZB8 A;  2LNS A;  4RI6 A;  1G7O A;  1TRS A;  6GSY A;  1SYR A;  2IL3 A;  3HVS A;  3GTU B;  4PUA A;  2JAC A;  3HMJ G;  3FZA A;  3D21 A;  11GS A;  4ZIJ A;  3TGZ A;  6GSW A;  1SK0 A;  4F9Z A;  6GSU A;  5ECO B;  5ID2 A;  2AJQ B;  2RUF A;  1KNG A;  5DVB A;  14GS A;  2HSN A;  1THO A;  5KEJ A;  5ECN B;  3K8N A;  5DCG A;  2V6K A;  2FA8 A;  4N10 A;  4HS1 A;  1UA5 A;  1Z7R A;  4MMM A;  3HD5 A;  3ME7 A;  1PA3 A;  1TKD B;  4Q5N A;  1PL1 A;  4IKH A;  3VWX A;  2X4A A;  4LA1 A;  3VI7 A;  3ZZX A;  2PVQ A;  2O8V B;  4MA9 A;  2OKA A;  5GAN D;  1S3D A;  2H0H A;  1TP9 A;  1GTI A;  2QKE A;  3UBL A;  5IPG A;  4EF0 A;  1VRS D;  4HZ2 A;  1FHE A;  1SU9 A;  5AN1 A;  1O6J A;  3MAK A;  3WYW A;  5HQP A;  4KND A;  3F4R A;  1GTB A;  4HEA 2;  1GP1 A;  2X8C A;  2F51 A;  4MZC A;  3R3E A;  3EIN A;  4QQ7 A;  4YQV A;  3C8E A;  1YF1 A;  1XVQ A;  5CP1 A;  2PN8 A;  3FK8 A;  3H4K A;  3H79 A;  4BL7 A;  4PQI A;  1BG5 A;  4OFT A;  1N8J A;  2WB9 A;  3GKX A;  5G1K A;  4TW5 A;  1ZMA A;  2IMI A;  2PVO C;  3ME8 A;  4ZL9 A;  1B4Q A;  1K3O A;  3MSZ A;  2B3S A;  1YY7 A;  2GZZ A;  2V2G A;  3FR3 A;  1YVL A;  1SEN A;  1FOV A;  2P5Q A;  2H70 A;  5G1L A;  1USB A;  4YH2 A;  2C3Q A;  3F3R A;  4KCE A;  1TJD A;  3IAS 2;  4IS0 A;  13GS A;  2GSQ A;  3HJO A;  3P90 A;  5ELA A;  5J9C A;  3WT2 A;  1T3B A;  4GXZ A;  1R5A A;  3ERG A;  1H75 A;  2HXK A;  2VCT A;  1BF5 A;  4BVX B;  2NDO A;  5D96 A;  3VWV A;  4BWS A;  3DML A;  1S3C A;  4YQM A;  2HZE B;  2ZUP A;  1TU8 A;  4HJ2 A;  1SL1 B;  2PGT A;  1M2B A;  4TVE A;  3O3T A;  4BWQ A;  5D9X A;  4Z2T A;  2GQK A;  3GYK A;  4HU9 A;  2LJA A;  1AUC A;  3NIV A;  3UL3 A;  2E2M A;  2C80 A;  3LYP A;  2KUC A;  2MMZ A;  1U88 A;  2D2Z A;  5J4V A;  5IQY A;  4PUR A;  2CVK A;  4XS4 A;  4K7N A;  2GDR A;  1X9W B;  2JZT A;  4NHZ A;  3C1S A;  1OKD A;  4MNN A;  1X5E A;  3O76 A;  4EIP A;  2QA1 A;  3MDK A;  2OBK A;  3L9V A;  4MZW A;  4Q5Q A;  5IMF A;  1AAZ A;  1JHB A;  1YF0 A;  4TR1 B;  3PH9 A;  5B6M A;  2HSM B;  4O5U A;  1U3I A;  2ON5 A;  4HU7 A;  4I5Q A;  1FVK A;  3GIX A;  5JCW A;  2BTO T;  1M0U A;  4K8M A;  3UAP A;  2VCW A;  5E59 A;  3ZL5 A;  3KMN A;  1F37 A;  3M1G A;  4PXO A;  3GX0 A;  1JFU A;  2K8S A;  2KOK A;  4ID0 A;  4ECC A;  4MCU A;  1Y6E A;  5F8B A;  1AQX A;  4P3Y B;  2UV8 G;  4IJI A;  3KJY A;  1ERW A;  1VF3 A;  4TXO B;  4EE0 A;  2MMO A;  3GUR A;  4WEY A;  2H1L A;  4MK3 A;  4CW9 A;  3APO A;  4ZL7 A;  5G5F A;  2X99 A;  1GUK A;  7GSS A;  3TJJ A;  2HFD A;  2LUS A;  4ICY A;  5D93 A;  3C73 A;  2FNO A;  1PRX A;  2DLX A;  1QQ2 A;  3TRQ A;  4KUN A;  4D73 A;  2DC5 A;  3IRA A;  5CRW A;  3HJP A;  1SVO A;  1B9X C;  1SYX A;  4AKH A;  5EL8 A;  4KDX A;  1BX9 A;  3CRU A;  4TR4 A;  3ERF A;  1ZZY A;  3LW9 A;  1XWA A;  1ML6 A;  1F6M C;  1LJR A;  2UZ8 A;  5GAP D;  1U6T A;  4QL9 A;  4F82 A;  3M0F A;  1XXU A;  1GLP A;  5A34 B;  4N3Z A;  5GSS A;  2C3N A;  2IMD A;  4AKX B;  1B48 A;  3TKQ A;  3TOT A;  2FCH A;  4GST A;  2XHF A;  4HJM A;  4BVY B;  4NV5 A;  1O73 A;  4OO4 A;  4MZB A;  2HNL A;  4ECI A;  3UAR A;  2K18 A;  4IEL A;  2CV4 A;  3EVI A;  3PIN A;  1J08 A;  3ZRE A;  2CVB A;  4EDY A;  4ZBA A;  4BVX A;  4PQ1 A;  4HDE A;  2HRA A;  2H19 A;  4WF4 A;  4GTU A;  2DBC A;  2C0F A;  1J0F A;  1TW9 A;  1LU4 A;  4V1A p;  3GA4 A;  3QCP A;  2K6V A;  2WRT A;  3P2A A;  2OJL A;  1XFL A;  4J57 E;  5D9V A;  4K2X A;  1G7E A;  2OT3 A;  3EWL A;  1ACV A;  1W4V A;  4Z7X A;  1AQV A;  1PD2 1;  12GS A;  1Z5Y E;  3LEF A;  1PSQ A;  4IN0 A;  2H1A A;  3LFL A;  1I9D A;  3D4T A;  4F03 A;  1RK4 A;  5DQS A;  5A4V A;  3KD0 A;  1K0D A;  5J3R A;  3UEM A;  1OYJ A;  2HSM A;  3QMX A;  2DJ3 A;  1YDK A;  4ZBD A;  1YKA A;  4RI7 A;  3IC8 A;  4JE1 A;  3IE3 A;  2H75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...