5ECRB

Crystal structure of fin219-fip1 complex with ja, val and mg
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 63
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecrB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecrB01
2LSTA 3PGTA 2I1UA 5IMVA 2MBTA 1M2AA 4G9HA 5F05A 2WGRA 4POKA 4O32A 5JCUA 1VF2A 2FHEA 5B8AA 1LJRA 3EURA 4ULXA 2LQOA 2PBJA 5G1KA 1EEMA 3LGCA 3TB2A 1MEKA 5HR2A 2GVPA 2H30A 2LS5A 4MCUA 1K0OA 4YH2A 3J7Yk 4MJBA 4KE3A 3MSZA 1PKZA 4MK3A 1B4QA 1S3CA 5IM9A 4PTSA 3QMXA 1ZZYA 2QSIA 1Y6EA 1GTAA 4IHUA 4N11A 1SJIA 4L5LA 4MF6A 2C0DA 3ZFLA 1SL0B 3CTFA 1FB6A 2GDRA 2VCTA 1SYRA 1XFLA 4HQZA 13GSA 2YOIA 1XVQA 4K0GA 3GHAA 1EP8A 3I69A 12GSA 5EY6A 4EE0A 3A2XA 1YDKA 2VCWA 2WS2A 2VM2A 1PX6A 1RK4A 3IPZA 2YZUA 2LUSA 3HZ8A 1WJKA 1UN2A 2C3TA 3FZ5A 4QQ7A 5DQYA 3ZTLA 3N5OA 1QXHA 3HDCA 2YV9A 1TRSA 4N0VA 3VPQA 3F6FA 4TR0A 3VWWA 3GSSA 2VCQA 1OAZA 3TRXA 1K0DA 2XBQA 4WXTA 2M80A 1HD2A 2D2ZA 2ZUPA 1ZYEA 2RM5A 2O8VB 1GLPA 1M2DA 1Q4JA 4IW9A 5LNKe 1JFUA 2DJKA 3CSHA 3QR6A 2IJYA 4MF5A 3ERGA 2PVQA 2V2GA 2VLUA 1I5GA 5IQYA 1QQ2A 1I9DA 2I3YA 4ECJA 1TXXA 4KH7A 3C7MA 2YZHA 3CTGA 2MMNA 3GN3A 5D73A 1ERTA 1GUHA 1YY7A 3CSJA 4KW6A 5E4WA 5HFKA 1FO5A 3UVHA 2WULA 3C1RA 3FR3A 3UOMA 3CBUA 2NBSA 4NHWA 2H01A 1J9BA 3HXSA 4ECBA 5EVOA 2EIOA 2PGTA 2K8VA 2V6OA 2FWGA 2AYTA 4Q5FA 5DAKA 2IMEA 5D8IA 5G5EA 3WYWA 1EOGA 3GL3A 2OADA 3WT2A 2C0EA 4GCIA 3DGQA 2LRCA 3QD9A 4TR1B 3MAKA 3EVIA 4YQMA 3KH9A 4OCFA 4GSSA 1TKDB 3M9KA 2H1DA 2V1MA 3P90A 1QK8A 3ZIJA 2HZEB 1JZDA 2C8UA 3UJ1A 4O92A 1WMJA 1B9YC 7GSSA 1M99A 2DJ1A 3JCML 1PKWA 4PNFA 3GH9A 1ABAA 4IELA 2B3SA 5A4VA 4MLYA 4F2IA 3ISOA 3GX8A 1AXDA 1G6YA 2F8AA 3Q74A 1F3AA 4ZBDA 3R2QA 3UEMA 4KDXA 1AW9A 2QKEA 1MTCA 4AJ7A 3KIJA 1W89A 2CA8A 2LJAA 5BMUA 5DCHA 3DEXA 4OO5A 3TCOA 4XRDA 8GSSA 2J23A 4D73B 1URMA 5CRHA 2MZCA 3VURA 5G31A 3EWLA 2BJXA 4OD7A 3FW2A 3NZNA 5IOXA 20GSA 3FR9A 3BBYA 4KF9A 5A4UA 5ENUA 2P5QA 5F0GA 4EKZA 2CVKA 3APSA 1HNCA 2R4VA 4PNGA 4KAEA 3N9JA 1GSFA 2FLSA 2VLTA 1UVZA 2JU5A 3D0ZA 3RPNA 1FG4A 3D4TA 1GLQA 2FD3A 1VGLA 3M8NA 1QUWA 3UBLA 1GSQA 2HSHA 1PL1A 1TOFA 3LXTA 4CHSA 2VL9A 1WE0A 1XOAA 1UC7A 3EU3A 4MH3A 1GNEA 4POMA 1XOBA 2MMAA 2C4JA 2DIYA 4JZQA 5HQPA 5ECHB 4RI6A 2HZEA 3HVSA 5DCGA 1FB0A 4ACSA 5H5QA 3ERWA 4K7IA 1PN9A 1K0AA 1TU7A 2X99A 4CDOA 3O76A 3SWLA 2CVDA 1TJDA 3ME8A 3EU4A 2IFQA 4LMVA 1M2BA 4FH8A 4OO4A 5J41A 4XHMA 3TUEA 3UL3A 2EIQA 4KB3A 1WOUA 1QGVA 2L5LA 4F0CA 5IMCA 2AHEA 2HSMB 1W4VA 2QC7A 2B7KA 3P2AA 3H93A 1JLWA 4EL1A 3QAWA 4J57E 3GH6A 2FUG2 4WEYA 4HU9A 3APOA 3QFBC 2OA7A 3MNGA 3APQA 3K8NA 3UMAA 4KCAA 2KOKA 4DSSA 2YCDA 2HYXA 3ZMKA 3FZAA 5D96A 18GSA 1M7TA 1B4PA 4PUAA 2WDUA 1GSUA 3KMOA 5LD0A 4WR5A 2ES7A 2R2JA 2YJHA 2H1GA 4PX1A 1X9MB 1TW9A 5G30A 3HD5A 3KXOA 4NV5A 3GFKA 3W6GA 1K3OA 4NPBA 1BX9A 2B5EA 1BG5A 1ZYQB 2IPAA 4G0KA 5HFIA 2B1LA 4K8MA 3KEBA 4QL7A 2H6XA 2VM1A 1U3AA 4CW9A 2FWEA 3D22A 4NHZA 2IMDA 6GSXA 3TJJA 5IMFA 5DJMA 3F4SA 4FO5A 2JZRA 1Z6MA 3TKRA 2MYGA 2H0IA 2B1KA 2B5XA 5ECMB 4IJ3A 4E8EA 4LL1B 2XPEA 3KMNA 3TRPA 4HDEA 3WGXA 4X43A 5EPFA 2R6KA 3EMPA 2RLIA 4IVFA 4X0XA 2H70A 1VF1A 2R37A 4L0WA 2BTOT 3DVWA 3DRNA 4P3YB 1JZWA 2I4AA 2XC2A 2WB9A 4GXZA 3HJMA 4AF2A 1RQMA 6GSSA 3A5WA 3U5RE 1T4ZA 3DYRA 2JZSA 5GAND 2HE3A 1V58A 2HSMA 3W8JA 4Q5QA 1B9XC 3FR6A 2LRTA 2F51A 3G9BA 2VOCA 1GSYA 4I97A 1BEDA 2C0FA 3RAZA 1SL2B 3VWUA 4ZB8A 2HRNA 3H4KA 5IMZA 3WD6A 4TXVA 3F63A 4ZL9A 2YWIA 2LEGA 4HJ2A 2TRXA 1O85A 2DJ0A 3KP8A 5D9TA 4V1Ap 5J5NA 2H1AA 3CYNA 1X9WB 3ZYWA 3GIXA 4FYCA 1EOHA 3IV4A 1YJ6A 4KDYA 1A8LA 5AISA 5ECNB 1C72A 2ZNMA 4TR3A 1T00A 4FYBA 2JSYA 2CQ9A 3I43A 3VLNA 2MMOA 4GF0A 1SK0A 1AQXA 2KUCA 5IMDA 1TDIA 1FAAA 4GSTA 2KHPA 2HLSA 3TKSC 4NAXA 4RQXA 5IPHA 4ZXGA 2NDOA 1MD4A 1Q98A 1YZXA 3F3RA 1FVJA 1O73A 3OR5A 5CRWA 1PMTA 3F8UA 3E0UA 1A0RP 1V57A 1J0FA 1OKTA 3RPPA 2FY6A 2REMA 3I6AA 1VF4A 1XIYA 4N10A 1XWGA 5DAKB 1YEXA 4K7OA 2GSRA 1G6WA 6GSWA 1EP7A 2A4VA 2BMXA 3RHCA 3M0FA 2OKAA 3IR4A 1GUKA 3DWVA 1EWXA 3F0IA 2F8FA 1A2MA 2VCVA 2VL2C 2EC4A 3FKFA 4FQUA 1S3DA 2CAQA 1T3BA 4PQ1A 2IMIA 1V40A 1AAZA 2H1BA 2F9SA 4GWRA 5ABRA 1OE7A 4RI7A 2X8GA 2YWNA 1SD8A 1SJZA 1O8XA 5IPGA 3HHVA 2FGXA 4MMMA 1VF3A 3HZ4A 2B5YA 2PU9C 3CXGA 3GNJA 2L5OA 5B7CA 2H0HA 2O89A 1Z3EA 5G2ZA 3U6VA 3PINA 2LKUA 1A23A 4G2EA 3A2WA 5G1LA 1XW5A 3VWXA 2RIIA 2A2RA 1PQNA 3IHQA 4XTSA 5LCZA 1U88A 3A2VA 1E6BA 1U87A 5CYYA 1J08A 2X64A 1X0RA 2CX3A 4O5RA 2IMKA 5ECOB 4TKYA 2AJQB 1YQ1A 4OFTA 3WGDA 4EVMA 4DSRA 1ERWA 4OCEA 1EEJA 6GSTA 5CRGA 1F37A 1GTUA 2L57A 2KP1A 5J3RA 1AC1A 2H19A 4KA0A 4HS1A 1PGTA 3ZIVA 2OE1A 2V41A 3GYKA 2GQMA 1ON4A 3L78A 4KCEA 3HYPA 3QAVA 2JZTA 1K3YA 2C1YA 1ZMAA 2FA4A 2DMMA 3IXRA 4GSNA 1HQOA 2LJRA 1THOA 5HR0A 1SKRB 1B8XA 4TN8A 2GTUA 2H6YA 2AB6A 4HU7A 1NW2A 3IAS2 5JCWA 3UBKA 3GSTA 4IP6A 1TRVA 1FOVA 4ML6A 4YAVA 3ZLPA 1GL8A 2EIRA 3P7XA 1PA3A 2Z9SA 1GNWA 4ECIA 2N5AA 3VFIA 1MD3A 3F6DA 1R7HA 4EF0A 2NPBA 3C8EA 5ID2B 1ERVA 1OE8A 2H71A 5KEJA 1Z7RA 2GZYA 2IFQB 5J9CA 2FWFA 5ECKB 1DSBA 3GRXA 1V2AA 1TRWA 4K2DA 1V9WA 5AIXA 1TI3A 5JCGA 1OYJA 3HVVA 2F3MA 1A2LA 2XPDA 1BQ7A 2VLVA 3VK9A 1T7PB 5IO0A 3VWVA 4I6XA 3F4TA 5C00A 1IYHA 3ZFBA 2KP2A 5CO3A 5GAPD 3QAGA 1QMVA 3TDGA 2LV3A 2H66A 1H4OA 5DJLA 4XRAA 3EMXA 4DSSB 3VPTA 2GT5A 2H75A 2FCHA 2O85A 2FA8A 3LJRA 3EC3A 4ISDA 2WZ9A 2RUFA 4EO3A 3TJFA 4TXOA 4IQ1A 4YQVA 2HXKA 5B6NA 3F4RA 3TKSA 1KTEA 1MDJA 4MPGA 2VIMA 4OFMA 5ECIB 3F9UA 4GRFA 1GSSA 2OBIA 1JHBA 4KSMA 1R5PA 1JLVA 3KH7A 3D21A 2WFCA 3KM6A 4XIHA 1XW9A 4IN0A 1ZOFA 4GQCA 2VD0A 1V98A 1JZOA 1FW1A 3BOAA 1A8YA 3QPMA 5IMAA 1UA5A 4MDCA 2GT6A 3KCMA 3GX0A 5ID2A 2K18A 5GSSA 1USBA 4MPFA 5L71A 1YKCA 4F0BA 2VL2A 3KD0A 4BVYA 2XHFA 4ZL8A 4PGTA 2CT6A 4GLTA 3GV1A 3IDVA 1GULA 1TI1A 2IN3A 4G0LA 2RM6A 1OKDA 4WBJA 3L9VA 1JZRA 5DALA 5ELGA 3TKSE 3PH9A 5KN3A 4H86A 3QDNA 1XWCA 2O7KA 1XXUA 4MJCA 2X8CA 1YF0A 2ZCTA 5A5KA 1NHYA 3QFAC 3RBTA 1OC9B 3FZ9A 5J4UA 2OACA 2GGTA 4BVXB 3IRAA 3KZQA 4WETA 5C04A 4ZB9A 4Q5RA 2DSAA 4O7HA 2G0FA 4NV2A 2OE3A 9GSSA 2HRAA 4L0UA 1LU4A 1TRUA 1TU8A 5B6MA 2ON5A 2H0GA 2C80A 1A0FA 1X5CA 3WT1A 4K6XA 2PPTA 2PMTA 4K7NA 2CV4A 2XBIA 1R5AA 1ZCPA 3M3MA 4F82A 3TRQA 3TKQA 5A4WA 1GH2A 2HQTA 5COHA 2YJ7A 1ZL9A 2PN8A 1F2EA 2VCXA 3GTUB 1SENA 3ZVJA 4TOPA 3H8QA 17GSA 2C0GA 4ZL7A 2K6VA 4HJMA 4AJ8A 1G0TA 3L9SA 3L0HA 2MMZA 1BJXA 3BCKA 4V2NA 3KJYA 3RDWA 4LMWA 2WCIA 5HR1A 3LFLA 3LG6A 5IO2A 3KP9A 1X9SB 1HNBA 1WRYA 4OWYA 3UIWA 2E7PA 5G5FA 3CMIA 2IL3A 4LLRA 3UAPA 2DJ2A 2YWOA 2GZZA 2VCZA 3ED3A 4JR6A 5ECQB 1OC9A 1SD9A 4KDUA 4BVXA 3LXZA 2L4QA 5H5SA 4XS4A 2C3NA 3IOSA 3TOUA 2JADA 4RUVA 1B48A 4X1UA 5JWRB 3DD3A 3TKPA 5CAXA 1T4YA 1EV4A 3FRCA 4DEJA 1U3IA 3IC8A 5KN2A 1S3AA 4BPYA 4QL9A 1TTZA 3DVXA 4J2FA 1VRSD 3D6IA 1X5DA 3LQ7A 1TP9A 1NHOA 5EL8A 3ZREA 5ELAA 4L5OA 5CP1A 2P5RA 1GSDA 4JEDA 1DE1A 2LTKA 4WKWA 4PURA 4BL7A 1U6TA 3GTUA 2G2QA 4KX4A 5GZZB 3WGEA 2VAFA 4J56E 3GA4A 3ZITA 2ON7A 3LEFA 5GSTA 5B8BA 5FWGA 3CRTA 2VO4A 2UZ8A 4MABA 4KSOA 1Z9HA 4WF5A 3LORA 1T1VA 4GQFA 3Q19A 2JACA 1QFNA 3IA1A 3HA9A 2IIYA 1ERUA 5F8BA 1XZOA 1IYIA 3FZ4A 2RUEA 5HFGA 3QCPA 4Q5NA 3CRUA 1YF1A 3G7JA 4DVCA 1ML6A 1GWCA 4E8HA 1ST9A 3E9JB 3O3TA 4ML1A 3HJPA 1HNAA 1SKWB 1MDIA 1EV9A 2DBCA 2YNXA 3LWAA 1AQWA 5JWQB 1PD21 5KN0A 3BD2A 4NMUA 4HZ2A 2YWMA 5DQSA 3ZZXA 16GSA 2WJUA 5INYA 3KTLA 4I5QA 3IBHA 4IS0A 4HOJA 3H1NA 4AGSA 4F03A 2N5FA 4L8EA 3C71A 1Y25A 2PUKC 1GTBA 1GRXA 6GSVA 3KTBA 2WRTA 1Z5YE 4G19A 3GMFA 4XS6A 2GLRA 2PVOC 2X8HA 2LNTA 4IGJA 2LRNA 3VI5A 2C3QA 1OC8A 2TRCP 1XVWA 2HRKB 4MF7A 1PRXA 4V2LA 4EXJA 2I9HA 3L9UA 2P0GA 4TW5A 5KN1A 4PQIA 4ZB6A 2HRFA 1EZKA 2YV7A 2K8SA 4I2TA 4ZBAA 1O81A 2HSNB 4PQHA 3MWHA 2DMLA 1EGRA 3PR8A 1WPIA 2MBSA 5IIZA 2N5BA 4JR4A 5ECPB 3HVXA 1XCCA 2OJLA 4ZIJA 1OVNA 2HFDA 4TXOB 2E2MA 2HZFA 22GSA 4EUYA 1F3BA 1Z6NA 3M9JA 2HSYA 3A3TA 1M0UA 3IE3A 1FVKA 2YN1A 4ZILA 2M46A 1TK8B 1ACVA 4FIWA 2IMFA 3CSIA 1RW1A 2K9FA 1BAYA 3IK7A 3Q18A 1TK0B 3IAM2 1K0BA 4EDYA 3HJOA 4G0IA 1MDKA 2JSZA 3FHKA 4XCSA 2ALBA 5DDLA 4YAPA 3DKSA 2CVBA 1N8JA 5AGYA 4I2UA 2GQKA 3SBCA 1NM3A 1DUGA 2R5GA 4MH2A 5DBQA 4BA7A 1O8WA 1OC3A 1AUCA 1XWAA 4BVYB 1SK1A 2GSQA 3P8WA 1AIUA 3DXBA 4EDZA 2AV4A 5D9VA 4V2MA 3GL5A 5DALB 1R26A 3C73A 4ID0A 5D93A 3AY8A 3E3EA 1G7EA 3IK9A 2E2GA 5ECSA 3GKXA 3GKMA 2HNLA 4K0NA 3EYTA 2B6MA 1PL2A 2H8LA 2NTOA 2HRKA 2AAWA 2TIRA 3EINA 3TJKA 3ZL5A 1FHEA 4HUAA 1O6JA 3NIVA 2CAIA 3PPUA 2PERA 1M9BA 4IBPA 4LL4B 3NOFA 1F6MC 4ILFA 1G7OA 1SKSB 4HEA2 4BWQA 2VUPA 4MP4A 5J9BA 1YEPA 6GSYA 3DIEA 1WWJA 1TK5B 4N0ZA 4V1Ag 2YPMA 3TJGA 2H74A 5CRDA 2LNSA 4FYUA 1XWKA 4JE1A 1R4WA 4NWYA 3I9V2 1K0MA 2V32A 1Z7PA 2L6CA 3ZMLA 1BYEA 1A24A 3Q6OA 2E0QA 2CX4A 4POBA 3EE2A 2M72A 3S9FA 4I8BA 5HR3A 4KNDA 4OFNA 1SK2A 2R3XA 3MDKA 2DC5A 4AJ6A 2OBKA 2GS3A 2YANA 1XPVA 2HI7A 2B7JA 4NXIA 1EGOA 3GURA 4TR1A 2FWHA 4KGIA 2PWJA 3KGKA 5AIVA 3US3A 5DVBA 2J9HA 4MJEA 1O7UA 2O87A 2H6ZA 5CNWA 3HCZA 1GSEA 4TRXA 4IKHA 19GSA 4IJIA 1X5EA 1XBSA 3C1SA 4F9ZA 1DBYA 2DJ3A 3TGZA 1KBNA 2GSSA 4GTUA 1F9MA 1NSWA 3FYGA 1XW6A 2L4CA 3FY7A 2LQQA 2NVLA 4OMVA 4JRRA 1AQVA 4XS4B 4LA1A 3D4MA 3BJ5A 1CQHA 1HYUA 4MZBA 2H72A 1ZGNA 2JL4A 3LSZA 4WBRD 1ILOA 1LBKA 3LYKA 3UARA 1KEBA 3GUSA 3ERFA 4Z7XA 2FNOA 2A2SA 4D73A 2V6KA 4YQUA 3GKKA 2DLXA 3FK8A 2QGVA 4JU5A 3L4NA 4PUFC 2AUVA 4BWSA 2H76A 3V1WA 1WP0A 2OE0A 1PSQA 1SL1B 1DE2A 10GSA 4XS1A 3DMLA 1E2YA 2CZ3A 2GQLA 6GSUA 3HY2A 4IQAA 4BL7B 3TJBA 4IP1A 3ZVJD 1KNGA 1M9AA 5H5RA 4JBBA 5IOWA 5FHIA 2LJKA 1K0NA 4USSA 3F3QA 1YKAA 3G7IA 4RQRA 2GZPA 1T8EB 1K3LA 3O6TA 2GSTA 3ME7A 5F07A 4POLA 4EC0A 1XWBA 4MZCA 3HKRA 4N30A 4TR4A 3J7Yb 11GSA 1GP1A 5AN1A 3G7YA 1CQGA 2L59A 4ECCA 4MA9A 5ECRB 2CZ2A 3D5JA 5JWOB 5D9WA 5FT3A 4WR4A 4K9ZA 2DIZA 5F06A 3GKNA 4DSQA 3UVTA 3LYPA 5E59A 5CREA 2DJJA 2HT9A 4WF4A 14GSA 2KLXA 4KUNA 3W8SA 4G10A 1N2AA 3QOUA 2IWTA 3ZRDA 4TVEA 4HQSA 1H75A 1A2JA 1SYXA 3VI7A 2VL3A 3TOTA 3H79A 1SU9A 1GTIA 3RHBA 4HI7A 3FEUA 2YP6A 1K0CA 4MZWA 3IC4A 4K1FA 3BCIA 2I81A 1GUMA 5D9XA 4MJAA 4ZBBA 5ECLB 3R3EA 2P31A 4PXOA 4HZ4A 2H73A 2VD1A 1SJ6A 1PX7A 3M1GA 1WIKA 2L6DA 1THXA
chains in the Genus database with same CATH superfamily
2LSTA 3PGTA 2I1UA 5IMVA 2MBTA 1M2AA 4G9HA 5F05A 2WGRA 4POKA 4O32A 5JCUA 4GDFA 1VF2A 2FHEA 5B8AA 1LJRA 3EURA 4ULXA 2LQOA 2PBJA 5G1KA 1EEMA 2UV8G 3A5IA 3LGCA 3TB2A 1MEKA 5HR2A 2GVPA 2H30A 2LS5A 4MCUA 1K0OA 4YH2A 3J7Yk 4MJBA 4KE3A 3MSZA 3CHXC 1PKZA 4MK3A 1B4QA 1S3CA 5IM9A 4PTSA 3QMXA 1ZZYA 2QSIA 1Y6EA 1GTAA 4IHUA 4N11A 1SJIA 4L5LA 4MF6A 2C0DA 3ZFLA 1SL0B 3CTFA 1FB6A 2GDRA 2VCTA 1SYRA 1XFLA 4HQZA 13GSA 2YOIA 1XVQA 4K0GA 3GHAA 1EP8A 3I69A 12GSA 5EY6A 4EE0A 3A2XA 1YDKA 2VCWA 2WS2A 2VM2A 1PX6A 1RK4A 3IPZA 2YZUA 2LUSA 3HZ8A 1WJKA 1UN2A 2C3TA 3FZ5A 4QQ7A 5DQYA 3ZTLA 3N5OA 1QXHA 3HDCA 2YV9A 1TRSA 4N0VA 3VPQA 3F6FA 4TR0A 3VWWA 3GSSA 2VCQA 1OAZA 3TRXA 1K0DA 2XBQA 4WXTA 2M80A 1HD2A 2D2ZA 2ZUPA 1ZYEA 2RM5A 2O8VB 1GLPA 1M2DA 1Q4JA 4IW9A 5LNKe 1SVMA 1JFUA 2DJKA 3CSHA 3QR6A 2IJYA 4MF5A 3ERGA 1PN0A 2PVQA 2V2GA 2VLUA 1I5GA 5IQYA 1QQ2A 1I9DA 2I3YA 4ECJA 1TXXA 4KH7A 3C7MA 5BMUB 2YZHA 3CTGA 2MMNA 3GN3A 5D73A 1ERTA 1GUHA 1YY7A 3CSJA 4KW6A 5E4WA 5HFKA 1FO5A 3UVHA 2WULA 3C1RA 3FR3A 3UOMA 3CBUA 1SVLA 2NBSA 4NHWA 2H01A 1J9BA 3HXSA 4ECBA 5EVOA 2EIOA 2PGTA 2K8VA 2V6OA 2FWGA 2AYTA 4Q5FA 5DAKA 2IMEA 5D8IA 5G5EA 3WYWA 1EOGA 3GL3A 2OADA 3WT2A 2C0EA 4GCIA 3DGQA 2LRCA 3QD9A 4TR1B 3MAKA 3HMJG 3EVIA 4YQMA 2DKHA 4AI6A 3KH9A 4OCFA 4GSSA 1TKDB 3M9KA 4E68A 2H1DA 2V1MA 3P90A 1QK8A 3ZIJA 2HZEB 1JZDA 2C8UA 3UJ1A 4O92A 1WMJA 1B9YC 7GSSA 1M99A 2DJ1A 3JCML 1PKWA 4PNFA 3GH9A 2OT3A 1ABAA 4IELA 2B3SA 5A4VA 4MLYA 4F2IA 3ISOA 3GX8A 1AXDA 1G6YA 2F8AA 3Q74A 1F3AA 4ZBDA 3R2QA 3UEMA 4KDXA 1AW9A 2QKEA 1MTCA 4AJ7A 3KIJA 1W89A 1N25A 2CA8A 2LJAA 5BMUA 5BRTA 5DCHA 1FOHA 3DEXA 4OO5A 3TCOA 4XRDA 8GSSA 2J23A 4D73B 1URMA 5CRHA 2MZCA 3VURA 5G31A 3EWLA 2BJXA 4OD7A 3FW2A 3NZNA 5IOXA 20GSA 3FR9A 3BBYA 4KF9A 5A4UA 5ENUA 2P5QA 5F0GA 4EKZA 2CVKA 3APSA 1HNCA 2R4VA 4PNGA 4KAEA 3N9JA 1GSFA 2FLSA 2VLTA 1UVZA 2JU5A 3D0ZA 3RPNA 1FG4A 2WVYA 4Z2UA 3D4TA 1GLQA 2FD3A 1VGLA 3M8NA 1QUWA 3UBLA 1GSQA 2HSHA 1PL1A 1TOFA 3LXTA 4CHSA 2VL9A 1WE0A 1XOAA 1UC7A 3EU3A 3MYDA 4MH3A 1GNEA 4POMA 1XOBA 2MMAA 2C4JA 2DIYA 4JZQA 5HQPA 5ECHB 4RI6A 5J47A 2HZEA 3HVSA 5DCGA 3RGBC 1FB0A 4ACSA 5H5QA 1ZYPA 3ERWA 4K7IA 1PN9A 1K0AA 1TU7A 2X99A 4CDOA 3O76A 3SWLA 2CVDA 1TJDA 3ME8A 4O5UA 3EU4A 2IFQA 4LMVA 1M2BA 4FH8A 4OO4A 4CY8A 5J41A 4XHMA 3TUEA 3UL3A 2EIQA 4KB3A 1WOUA 1QGVA 2L5LA 4F0CA 5IMCA 2AHEA 2HSMB 1W4VA 2QC7A 2B7KA 3P2AA 3H93A 1JLWA 4EL1A 3QAWA 4J57E 3GH6A 2FUG2 4WEYA 4HU9A 3APOA 3QFBC 2OA7A 3MNGA 3APQA 3K8NA 3UMAA 4KCAA 2KOKA 4DSSA 2YCDA 2HYXA 3ZMKA 3FZAA 5D96A 18GSA 1M7TA 1B4PA 4PUAA 2WDUA 1GSUA 3KMOA 5LD0A 4WR5A 2ES7A 2R2JA 2YJHA 2H1GA 4PX1A 1X9MB 1TW9A 5G30A 3HD5A 3KXOA 4NV5A 3GFKA 3W6GA 1K3OA 4NPBA 1BX9A 2B5EA 1BG5A 1ZYQB 2IPAA 4G0KA 5HFIA 2B1LA 4K8MA 3KEBA 4QL7A 2H6XA 2VM1A 1U3AA 4CW9A 2FWEA 3D22A 4NHZA 2IMDA 6GSXA 3TJJA 5IMFA 5DJMA 3F4SA 4FO5A 2JZRA 4AKIA 1Z6MA 2O36A 3TKRA 2MYGA 2H0IA 2B1KA 4A5PA 2B5XA 5ECMB 4IJ3A 2EFEA 4E8EA 4LL1B 2XPEA 2A2PA 3KMNA 3TRPA 4HDEA 3WGXA 4X43A 5EPFA 2WW1A 2R0CA 1XG8A 2R6KA 3EMPA 2RLIA 4IVFA 4X0XA 2H70A 1VF1A 2R37A 4L0WA 2BTOT 3DVWA 2X49A 3DRNA 4P3YB 1JZWA 2I4AA 2XC2A 2WB9A 4GXZA 3HJMA 4AF2A 1RQMA 6GSSA 4O5QA 3A5WA 3U5RE 1T4ZA 3DYRA 2JZSA 5GAND 2HE3A 1V58A 2HSMA 3W8JA 4Q5QA 1B9XC 3FR6A 2LRTA 2F51A 3G9BA 2VOCA 4K2XA 1GSYA 4I97A 1BEDA 2C0FA 3RAZA 1SL2B 3VWUA 4ZB8A 2HRNA 3H4KA 5IMZA 3WD6A 4TXVA 3F63A 4ZL9A 2YWIA 2LEGA 4HJ2A 2TRXA 1O85A 2DJ0A 3KP8A 5D9TA 4V1Ap 5J5NA 2H1AA 3CYNA 1X9WB 3ZYWA 3GIXA 4FYCA 1EOHA 3IV4A 1YJ6A 4KDYA 1A8LA 5AISA 5ECNB 1C72A 2ZNMA 4TR3A 1T00A 4FYBA 1S3RA 2JSYA 2CQ9A 3I43A 3VLNA 2MMOA 4GF0A 1SK0A 1AQXA 2KUCA 5IMDA 1TDIA 1FAAA 4GSTA 2KHPA 2HLSA 3TKSC 4NAXA 4RQXA 5IPHA 4ZXGA 2NDOA 1MD4A 1Q98A 1YZXA 3F3RA 1FVJA 1O73A 3OR5A 5CRWA 1PMTA 3F8UA 3E0UA 4MNNA 1A0RP 1V57A 1J0FA 1OKTA 3RPPA 2FY6A 2REMA 3I6AA 1VF4A 1XIYA 4N10A 1XWGA 5DAKB 5KOWA 1YEXA 4K7OA 5KOXA 2GSRA 1G6WA 5J4YA 4HSCX 6GSWA 1EP7A 2A4VA 2BMXA 2H1LA 2WW3A 3RHCA 3M0FA 2OKAA 3IR4A 1GUKA 1ZYNA 3DWVA 1EWXA 3F0IA 2F8FA 1A2MA 2VCVA 2VL2C 2EC4A 3FKFA 4FQUA 1S3DA 2CAQA 1T3BA 4PQ1A 2IMIA 1YVLA 1V40A 1AAZA 2H1BA 2F9SA 4GWRA 5ABRA 1OE7A 4RI7A 2X8GA 2YWNA 1SD8A 1SJZA 1O8XA 5IPGA 3HHVA 2FGXA 4MMMA 1VF3A 3HZ4A 2B5YA 2PU9C 3CXGA 3GNJA 2L5OA 5B7CA 2H0HA 2O89A 1Z3EA 5G2ZA 3U6VA 4K5SA 3PINA 2LKUA 1A23A 4G2EA 3A2WA 5G1LA 2QA2A 1XW5A 3VWXA 2RIIA 2A2RA 1PQNA 3IHQA 4XTSA 5LCZA 1U88A 3A2VA 1E6BA 1U87A 3TU3B 5CYYA 1J08A 2X64A 1X0RA 2CX3A 4O5RA 2IMKA 5ECOB 4TKYA 2AJQB 1YQ1A 4OFTA 3WGDA 4EVMA 4DSRA 1ERWA 4OCEA 2WZSA 1EEJA 4Z2TA 6GSTA 5CRGA 1F37A 1GTUA 2L57A 2KP1A 5J3RA 1AC1A 2H19A 4KA0A 4HS1A 1PGTA 3ZIVA 2OE1A 2V41A 3GYKA 2GQMA 1ON4A 3L78A 4KCEA 3HYPA 3QAVA 2JZTA 1K3YA 2C1YA 1ZMAA 2FA4A 2DMMA 3IXRA 4GSNA 1HQOA 2LJRA 1THOA 5HR0A 1SKRB 1B8XA 4TN8A 2GTUA 2H6YA 2AB6A 4HU7A 1NW2A 3IAS2 5JCWA 3UBKA 3GSTA 4IP6A 1TRVA 3FMWA 1FOVA 4ML6A 4YAVA 1M3JA 3ZLPA 1GL8A 2EIRA 4ZB7A 3P7XA 1PA3A 2Z9SA 1GNWA 1Y1UA 4ECIA 2N5AA 4AKXB 3VFIA 1MD3A 3F6DA 1R7HA 3CQFA 2NPBA 4EF0A 2WVXA 3C8EA 5ID2B 1ERVA 1OE8A 2H71A 5KEJA 1Z7RA 2GZYA 2IFQB 5J9CA 4PI2C 2FWFA 2O5VA 5ECKB 1DSBA 3GRXA 1V2AA 1TRWA 4K2DA 1V9WA 5AIXA 1TI3A 5JCGA 1OYJA 3HVVA 2F3MA 1A2LA 2XPDA 1BQ7A 2VLVA 3VK9A 1T7PB 5IO0A 3VWVA 4I6XA 3F4TA 5C00A 1IYHA 3ZFBA 5J4VA 2KP2A 5CO3A 5GAPD 3QAGA 1QMVA 3TDGA 2LV3A 2H66A 1H4OA 5DJLA 4XRAA 3EMXA 4DSSB 3VPTA 2GT5A 2H75A 2FCHA 2WVZA 2O85A 2FA8A 3LJRA 3EC3A 4ISDA 2WZ9A 2RUFA 4EO3A 3TJFA 4TXOA 4YKFA 3EPTA 4IQ1A 4YQVA 2HXKA 5B6NA 3F4RA 3TKSA 1KTEA 1MDJA 4MPGA 2VIMA 4OFMA 5ECIB 3F9UA 4GRFA 1GSSA 2OBIA 1I1IP 1JHBA 4W66A 4KSMA 1R5PA 1JLVA 3KH7A 3D21A 2WFCA 3KM6A 4XIHA 1XW9A 4IN0A 1ZOFA 4GQCA 2VD0A 1V98A 4QMKA 1JZOA 1FW1A 3BOAA 1A8YA 3QPMA 1YEWC 1UA5A 5IMAA 4MDCA 2GT6A 3KCMA 3GX0A 5ID2A 2K18A 5GSSA 1USBA 4MPFA 5L71A 1YKCA 4F0BA 4ICYA 2VL2A 3KD0A 4BVYA 2XHFA 4ZL8A 4PGTA 2CT6A 4GLTA 3GV1A 3IDVA 1GULA 1TI1A 2IN3A 4G0LA 2RM6A 1OKDA 4WBJA 3L9VA 1JZRA 5DALA 5ELGA 3TKSE 3PH9A 5KN3A 2EFHA 4H86A 3HVNA 3QDNA 1XWCA 2O7KA 1XXUA 4MJCA 2X8CA 1YF0A 2ZCTA 5A5KA 2VKZG 1NHYA 3QFAC 3RBTA 1OC9B 3FZ9A 5J4UA 2WW2A 2OACA 2GGTA 4BVXB 3IRAA 3KZQA 4WETA 5C04A 4ZB9A 4Q5RA 2DSAA 4O7HA 2G0FA 4NV2A 2OE3A 9GSSA 2HRAA 4L0UA 1LU4A 1TRUA 1TU8A 5B6MA 2ON5A 2H0GA 2C80A 1A0FA 1X5CA 3WT1A 4K6XA 3IHGA 2PPTA 2PMTA 4K7NA 2CV4A 2XBIA 1R5AA 1ZCPA 3M3MA 4F82A 5A5HA 3TRQA 3TKQA 5A4WA 1GH2A 2HQTA 5COHA 2YJ7A 1ZL9A 2PN8A 1F2EA 2VCXA 3GTUB 1SENA 1PFOA 3ZVJA 4TOPA 3H8QA 17GSA 2C0GA 4ZL7A 2K6VA 4HJMA 4AJ8A 1G0TA 3L9SA 3L0HA 2MMZA 1BJXA 2EFDA 3BCKA 4V2NA 3KJYA 3RDWA 4LMWA 2WCIA 5HR1A 2DKIA 3LFLA 3LG6A 5IO2A 3KP9A 1X9SB 1HNBA 1WRYA 4OWYA 3UIWA 2E7PA 5G5FA 1BG1A 3CMIA 2IL3A 4LLRA 3UAPA 2DJ2A 2YWOA 2GZZA 2VCZA 3ED3A 3MIXA 4JR6A 5ECQB 1OC9A 1SD9A 4KDUA 4BVXA 3LXZA 4EIQA 2L4QA 1BF5A 5H5SA 4XS4A 2C3NA 3IOSA 3TOUA 2JADA 4RUVA 1B48A 4X1UA 5JWRB 3DD3A 3TKPA 5CAXA 1T4YA 1EV4A 3FRCA 4DEJA 1U3IA 3IC8A 5KN2A 1S3AA 4BPYA 4QL9A 1TTZA 3DVXA 4J2FA 1VRSD 3D6IA 2QA1A 1X5DA 3LQ7A 1TP9A 1NHOA 5EL8A 3ZREA 2EFCA 2WW0A 5ELAA 4L5OA 5CP1A 2P5RA 1GSDA 4JEDA 1DE1A 2LTKA 4WKWA 4PURA 4BL7A 1U6TA 3GTUA 2G2QA 4KX4A 4N3ZA 5GZZB 3WGEA 2VAFA 4J56E 3GA4A 3ZITA 5J40A 2ON7A 3LEFA 5GSTA 4AKGA 5B8BA 5FWGA 3CRTA 2VO4A 2UZ8A 4MABA 4KSOA 1Z9HA 4WF5A 1SVOA 3LORA 1T1VA 4GQFA 3Q19A 2JACA 1QFNA 3IA1A 3HA9A 2IIYA 1ERUA 5F8BA 1XZOA 1IYIA 3FZ4A 2RUEA 5HFGA 3QCPA 4Q5NA 3CRUA 1YF1A 4X4JA 3G7JA 4DVCA 1ML6A 1GWCA 4E8HA 1ST9A 3E9JB 3O3TA 4ML1A 3HJPA 1HNAA 1SKWB 1MDIA 1EV9A 2DBCA 2YNXA 3LWAA 1AQWA 5JWQB 1PD21 5KN0A 3BD2A 4NMUA 4HZ2A 2WVXB 2YWMA 5DQSA 3ZZXA 16GSA 2WJUA 5A1NB 5INYA 3KTLA 4I5QA 3IBHA 4IS0A 4HOJA 3H1NA 4AGSA 4F03A 2N5FA 4L8EA 3C71A 1Y25A 2PUKC 1GTBA 1GRXA 3RFRC 6GSVA 3KTBA 2WRTA 1Z5YE 4G19A 3GMFA 4XS6A 2GLRA 2PVOC 2X8HA 2LNTA 4IGJA 2LRNA 3VI5A 2C3QA 1OC8A 2TRCP 1XVWA 2HRKB 4MF7A 1PRXA 4V2LA 2A4HA 4EXJA 2I9HA 3L9UA 4EIPA 2P0GA 4TW5A 5KN1A 1TXUA 4PQIA 4ZB6A 2HRFA 1EZKA 2YV7A 2K8SA 4I2TA 4ZBAA 1O81A 2HSNB 4PQHA 3MWHA 2DMLA 1EGRA 3PR8A 1WPIA 2MBSA 5IIZA 2N5BA 4JR4A 5ECPB 3HVXA 1XCCA 2OJLA 4ZIJA 1OVNA 2HFDA 4TXOB 2E2MA 2HZFA 22GSA 4EUYA 1F3BA 1Z6NA 3M9JA 2HSYA 3A3TA 1M0UA 3IE3A 1FVKA 5A34B 2YN1A 4ZILA 2M46A 1TK8B 1ACVA 4FIWA 2IMFA 3CSIA 4AKHA 1RW1A 2K9FA 1BAYA 3IK7A 3Q18A 1TK0B 3IAM2 1K0BA 4EDYA 3HJOA 4G0IA 1MDKA 2JSZA 3FHKA 4XCSA 2ALBA 5DDLA 4YAPA 3DKSA 2CVBA 1N8JA 5AGYA 4I2UA 2GQKA 3SBCA 1NM3A 1DUGA 2R5GA 4MH2A 5DBQA 4BA7A 1O8WA 5A1NA 1OC3A 1AUCA 1XWAA 4BVYB 1SK1A 2GSQA 3P8WA 1AIUA 3DXBA 4EDZA 4YKGA 2AV4A 5D9VA 4V2MA 3GL5A 5DALB 1R26A 3C73A 4ID0A 5D93A 3AY8A 3E3EA 1G7EA 3IK9A 2E2GA 5ECSA 4PI0C 3GKXA 3GKMA 2HNLA 4K0NA 3EYTA 2B6MA 1PL2A 2H8LA 2NTOA 2HRKA 2AAWA 2TIRA 3EINA 3TJKA 3ZL5A 1FHEA 4HUAA 1O6JA 3NIVA 2CAIA 3PPUA 2HSNA 2PERA 1M9BA 4IBPA 4LL4B 3NOFA 1F6MC 4ILFA 1G7OA 1SKSB 4G01A 4HEA2 4BWQA 2VUPA 4MP4A 5J9BA 1YEPA 6GSYA 3DIEA 1WWJA 1M3IA 1TK5B 4N0ZA 4V1Ag 2YPMA 3TJGA 2H74A 5CRDA 2LNSA 4FYUA 1XWKA 4JE1A 5A34A 5A5HB 1R4WA 4NWYA 3CWGA 3I9V2 1K0MA 2V32A 1Z7PA 2L6CA 3ZMLA 1BYEA 1A24A 3Q6OA 2E0QA 2CX4A 4POBA 3EE2A 2M72A 3S9FA 3LW9A 4I8BA 5HR3A 4KNDA 4OFNA 1SK2A 2R3XA 3MDKA 2DC5A 4AJ6A 2OBKA 2GS3A 2YANA 1XPVA 2HI7A 2B7JA 4NXIA 1EGOA 3GURA 4TR1A 2FWHA 4KGIA 2PWJA 3KGKA 5AIVA 3US3A 5DVBA 4K5RA 2J9HA 4MJEA 1O7UA 2O87A 2H6ZA 5CNWA 3HCZA 1GSEA 4TRXA 4IKHA 19GSA 4IJIA 1X5EA 1XBSA 3C1SA 4F9ZA 1DBYA 2DJ3A 3TGZA 1KBNA 2GSSA 4GTUA 4PHZC 1F9MA 1NSWA 3FYGA 1XW6A 2L4CA 3FY7A 2LQQA 2NVLA 4OMVA 4JRRA 4FXYP 1AQVA 2O3EA 4XS4B 4LA1A 3D4MA 3BJ5A 1CQHA 1HYUA 4MZBA 2H72A 4CY6A 4Z2RA 1ZGNA 2JL4A 3LSZA 4WBRD 4BIKA 1ILOA 1LBKA 3LYKA 2R0GA 3UARA 1KEBA 3GUSA 3ERFA 4Z7XA 2FNOA 2A2SA 4D73A 2V6KA 4YQUA 3GKKA 2R0PA 2DLXA 3FK8A 2QGVA 4JU5A 3L4NA 4PUFC 2AUVA 4BWSA 2H76A 3V1WA 1WP0A 2OE0A 1PSQA 1SL1B 1DE2A 10GSA 4XS1A 3DMLA 1E2YA 2CZ3A 2GQLA 6GSUA 3HY2A 4IQAA 4BL7B 3TJBA 4IP1A 3ZVJD 1KNGA 1M9AA 5H5RA 4JBBA 5IOWA 5FHIA 2LJKA 1K0NA 4USSA 3F3QA 1YKAA 3G7IA 4RQRA 2GZPA 1T8EB 1K3LA 3O6TA 2GSTA 3ME7A 5F07A 4POLA 4EC0A 1XWBA 4MZCA 3HKRA 4N30A 4TR4A 3J7Yb 11GSA 1GP1A 5AN1A 3G7YA 1CQGA 2L59A 4ECCA 4MA9A 5ECRB 2CZ2A 3D5JA 5JWOB 5D9WA 5FT3A 4WR4A 4K9ZA 2DIZA 5F06A 3GKNA 4DSQA 3UVTA 3LYPA 5E59A 5CREA 2DJJA 2HT9A 4WF4A 14GSA 2KLXA 4KUNA 3W8SA 4G10A 1N2AA 3QOUA 2IWTA 3ZRDA 4TVEA 4HQSA 2X4AA 1H75A 1A2JA 1SYXA 3VI7A 2VL3A 3TOTA 1S4BP 3H79A 1SU9A 1GTIA 3RHBA 4HI7A 3FEUA 2YP6A 1K0CA 4MZWA 3IC4A 3BCIA 4K1FA 2I81A 1GUMA 5D9XA 4MJAA 4ZBBA 5ECLB 3R3EA 2P31A 4PXOA 4HZ4A 2H73A 2VD1A 1SJ6A 1PX7A 3M1GA 1WIKA 2L6DA 1THXA
chains in the Genus database with same CATH topology
2LSTA 3PGTA 2I1UA 5IMVA 2MBTA 1M2AA 4G9HA 5F05A 2WGRA 4POKA 4O32A 5JCUA 4GDFA 1VF2A 2FHEA 5B8AA 1LJRA 3EURA 4ULXA 2LQOA 2PBJA 5G1KA 1EEMA 2UV8G 3A5IA 3LGCA 3TB2A 1MEKA 5HR2A 2GVPA 2H30A 2LS5A 4MCUA 1K0OA 4YH2A 3J7Yk 4MJBA 4KE3A 3MSZA 1PKZA 4MK3A 1B4QA 1S3CA 5IM9A 4PTSA 3QMXA 1ZZYA 2QSIA 1Y6EA 1GTAA 4IHUA 4N11A 1SJIA 4L5LA 4MF6A 2C0DA 3ZFLA 1SL0B 3CTFA 1FB6A 2GDRA 2VCTA 1SYRA 1XFLA 4HQZA 13GSA 2YOIA 1XVQA 4K0GA 3GHAA 1EP8A 3I69A 12GSA 5EY6A 4EE0A 3A2XA 1YDKA 2VCWA 2WS2A 2VM2A 1PX6A 1RK4A 3IPZA 2YZUA 2LUSA 3HZ8A 1WJKA 1UN2A 2C3TA 3FZ5A 4QQ7A 5DQYA 3ZTLA 3N5OA 1QXHA 3HDCA 2YV9A 1TRSA 4N0VA 3VPQA 3F6FA 4TR0A 3VWWA 3GSSA 2VCQA 1OAZA 3TRXA 1K0DA 2XBQA 4WXTA 2M80A 1HD2A 2D2ZA 2ZUPA 1ZYEA 2RM5A 2O8VB 1GLPA 1M2DA 1Q4JA 4IW9A 5LNKe 1SVMA 1JFUA 2DJKA 3CSHA 3QR6A 2IJYA 4MF5A 3ERGA 1PN0A 2PVQA 2V2GA 2VLUA 1I5GA 5IQYA 1QQ2A 1I9DA 2I3YA 4ECJA 1TXXA 4KH7A 3C7MA 5BMUB 2YZHA 3CTGA 2MMNA 3GN3A 5D73A 1ERTA 1GUHA 1YY7A 3CSJA 4KW6A 5E4WA 5HFKA 1FO5A 3UVHA 2WULA 3C1RA 3FR3A 3UOMA 3CBUA 1SVLA 2NBSA 4NHWA 2H01A 1J9BA 3HXSA 4ECBA 5EVOA 2EIOA 2PGTA 2K8VA 2V6OA 2FWGA 2AYTA 4Q5FA 5DAKA 2IMEA 5D8IA 5G5EA 3WYWA 1EOGA 3GL3A 2OADA 3WT2A 2C0EA 4GCIA 3DGQA 2LRCA 3QD9A 4TR1B 3MAKA 3HMJG 3EVIA 4YQMA 2DKHA 4AI6A 3KH9A 4OCFA 4GSSA 1TKDB 3M9KA 4E68A 2H1DA 2V1MA 3P90A 1QK8A 3ZIJA 2HZEB 1JZDA 2C8UA 3UJ1A 4O92A 1WMJA 1B9YC 7GSSA 1M99A 2DJ1A 3JCML 1PKWA 4PNFA 3GH9A 2OT3A 1ABAA 4IELA 2B3SA 5A4VA 4MLYA 4F2IA 3ISOA 3GX8A 1AXDA 1G6YA 2F8AA 3Q74A 1F3AA 4ZBDA 3R2QA 3UEMA 4KDXA 1AW9A 2QKEA 1MTCA 4AJ7A 3KIJA 1W89A 1N25A 2CA8A 2LJAA 5BMUA 5BRTA 5DCHA 1FOHA 3DEXA 4OO5A 3TCOA 4XRDA 8GSSA 2J23A 4D73B 1URMA 5CRHA 2MZCA 3VURA 5G31A 3EWLA 2BJXA 4OD7A 3FW2A 3NZNA 5IOXA 20GSA 3FR9A 3BBYA 4KF9A 5A4UA 5ENUA 2P5QA 5F0GA 4EKZA 2CVKA 3APSA 1HNCA 2R4VA 4PNGA 4KAEA 3N9JA 1GSFA 2FLSA 2VLTA 1UVZA 2JU5A 3D0ZA 3RPNA 1FG4A 4Z2UA 3D4TA 1GLQA 2FD3A 1VGLA 3M8NA 1QUWA 3UBLA 1GSQA 2HSHA 1PL1A 1TOFA 3LXTA 4CHSA 2VL9A 1WE0A 1XOAA 1UC7A 3EU3A 3MYDA 4MH3A 1GNEA 4POMA 1XOBA 2MMAA 2C4JA 2DIYA 4JZQA 5HQPA 5ECHB 4RI6A 5J47A 2HZEA 3HVSA 5DCGA 1FB0A 4ACSA 5H5QA 1ZYPA 3ERWA 4K7IA 1PN9A 1K0AA 1TU7A 2X99A 4CDOA 3O76A 3SWLA 2CVDA 1TJDA 3ME8A 4O5UA 3EU4A 2IFQA 4LMVA 1M2BA 4FH8A 4OO4A 4CY8A 5J41A 4XHMA 3TUEA 3UL3A 2EIQA 4KB3A 1WOUA 1QGVA 2L5LA 4F0CA 5IMCA 2AHEA 2HSMB 1W4VA 2QC7A 2B7KA 3P2AA 3H93A 1JLWA 4EL1A 3QAWA 4J57E 3GH6A 2FUG2 4WEYA 4HU9A 3APOA 3QFBC 2OA7A 3MNGA 3APQA 3K8NA 3UMAA 4KCAA 2KOKA 4DSSA 2YCDA 2HYXA 3ZMKA 3FZAA 5D96A 18GSA 1M7TA 1B4PA 4PUAA 2WDUA 1GSUA 3KMOA 5LD0A 4WR5A 2ES7A 2R2JA 2YJHA 2H1GA 4PX1A 1X9MB 1TW9A 5G30A 3HD5A 3KXOA 4NV5A 3GFKA 3W6GA 1K3OA 4NPBA 1BX9A 2B5EA 1BG5A 1ZYQB 2IPAA 4G0KA 5HFIA 2B1LA 4K8MA 3KEBA 4QL7A 2H6XA 2VM1A 1U3AA 4CW9A 2FWEA 3D22A 4NHZA 2IMDA 6GSXA 3TJJA 5IMFA 5DJMA 3F4SA 4FO5A 2JZRA 4AKIA 1Z6MA 3TKRA 2MYGA 2H0IA 2B1KA 4A5PA 2B5XA 5ECMB 4IJ3A 2EFEA 4E8EA 4LL1B 2XPEA 2A2PA 3KMNA 3TRPA 4HDEA 3WGXA 4X43A 5EPFA 2R0CA 2R6KA 3EMPA 2RLIA 4IVFA 4X0XA 2H70A 1VF1A 2R37A 4L0WA 2BTOT 3DVWA 2X49A 3DRNA 4P3YB 1JZWA 2I4AA 2XC2A 2WB9A 4GXZA 3HJMA 4AF2A 1RQMA 6GSSA 4O5QA 3A5WA 3U5RE 1T4ZA 3DYRA 2JZSA 5GAND 2HE3A 1V58A 2HSMA 3W8JA 4Q5QA 1B9XC 3FR6A 2LRTA 2F51A 3G9BA 2VOCA 4K2XA 1GSYA 4I97A 1BEDA 2C0FA 3RAZA 1SL2B 3VWUA 4ZB8A 2HRNA 3H4KA 5IMZA 3WD6A 4TXVA 3F63A 4ZL9A 2YWIA 2LEGA 4HJ2A 2TRXA 1O85A 2DJ0A 3KP8A 5D9TA 4V1Ap 5J5NA 2H1AA 3CYNA 1X9WB 3ZYWA 3GIXA 4FYCA 1EOHA 3IV4A 1YJ6A 4KDYA 1A8LA 5AISA 5ECNB 1C72A 2ZNMA 4TR3A 1T00A 4FYBA 2JSYA 2CQ9A 3I43A 3VLNA 2MMOA 4GF0A 1SK0A 1AQXA 2KUCA 5IMDA 1TDIA 1FAAA 4GSTA 2KHPA 2HLSA 3TKSC 4NAXA 4RQXA 5IPHA 4ZXGA 2NDOA 1MD4A 1Q98A 1YZXA 3F3RA 1FVJA 1O73A 3OR5A 5CRWA 1PMTA 3F8UA 3E0UA 4MNNA 1A0RP 1V57A 1J0FA 1OKTA 3RPPA 2FY6A 2REMA 3I6AA 1VF4A 1XIYA 4N10A 1XWGA 5DAKB 5KOWA 1YEXA 4K7OA 5KOXA 2GSRA 1G6WA 5J4YA 6GSWA 1EP7A 2A4VA 2BMXA 2H1LA 3RHCA 3M0FA 2OKAA 3IR4A 1GUKA 1ZYNA 3DWVA 1EWXA 3F0IA 2F8FA 1A2MA 2VCVA 2VL2C 2EC4A 3FKFA 4FQUA 1S3DA 2CAQA 1T3BA 4PQ1A 2IMIA 1YVLA 1V40A 1AAZA 2H1BA 2F9SA 4GWRA 5ABRA 1OE7A 4RI7A 2X8GA 2YWNA 1SD8A 1SJZA 1O8XA 5IPGA 3HHVA 2FGXA 4MMMA 1VF3A 3HZ4A 2B5YA 2PU9C 3CXGA 3GNJA 2L5OA 5B7CA 2H0HA 2O89A 1Z3EA 5G2ZA 3U6VA 4K5SA 3PINA 2LKUA 1A23A 4G2EA 3A2WA 5G1LA 2QA2A 1XW5A 3VWXA 2RIIA 2A2RA 1PQNA 3IHQA 4XTSA 5LCZA 1U88A 3A2VA 1E6BA 1U87A 3TU3B 5CYYA 1J08A 2X64A 1X0RA 2CX3A 4O5RA 2IMKA 5ECOB 4TKYA 2AJQB 1YQ1A 4OFTA 3WGDA 4EVMA 4DSRA 1ERWA 4OCEA 1EEJA 4Z2TA 6GSTA 5CRGA 1F37A 1GTUA 2L57A 2KP1A 5J3RA 1AC1A 2H19A 4KA0A 4HS1A 1PGTA 3ZIVA 2OE1A 2V41A 3GYKA 2GQMA 1ON4A 3L78A 4KCEA 3HYPA 3QAVA 2JZTA 1K3YA 2C1YA 1ZMAA 2FA4A 2DMMA 3IXRA 4GSNA 1HQOA 2LJRA 1THOA 5HR0A 1SKRB 1B8XA 4TN8A 2GTUA 2H6YA 2AB6A 4HU7A 1NW2A 3IAS2 5JCWA 3UBKA 3GSTA 4IP6A 1TRVA 3FMWA 1FOVA 4ML6A 4YAVA 3ZLPA 1GL8A 2EIRA 4ZB7A 3P7XA 1PA3A 2Z9SA 1GNWA 1Y1UA 4ECIA 2N5AA 4AKXB 3VFIA 1MD3A 3F6DA 1R7HA 4EF0A 2NPBA 3C8EA 5ID2B 1ERVA 1OE8A 2H71A 5KEJA 1Z7RA 2GZYA 2IFQB 5J9CA 2FWFA 2O5VA 5ECKB 1DSBA 3GRXA 1V2AA 1TRWA 4K2DA 1V9WA 5AIXA 1TI3A 5JCGA 1OYJA 3HVVA 2F3MA 1A2LA 2XPDA 1BQ7A 2VLVA 3VK9A 1T7PB 5IO0A 3VWVA 4I6XA 3F4TA 5C00A 1IYHA 3ZFBA 5J4VA 2KP2A 5CO3A 5GAPD 3QAGA 1QMVA 3TDGA 2LV3A 2H66A 1H4OA 5DJLA 4XRAA 3EMXA 4DSSB 3VPTA 2GT5A 2H75A 2FCHA 2O85A 2FA8A 3LJRA 3EC3A 4ISDA 2WZ9A 2RUFA 4EO3A 3TJFA 4TXOA 4YKFA 3EPTA 4IQ1A 4YQVA 2HXKA 5B6NA 3F4RA 3TKSA 1KTEA 1MDJA 4MPGA 2VIMA 4OFMA 5ECIB 3F9UA 4GRFA 1GSSA 2OBIA 1JHBA 4W66A 4KSMA 1R5PA 1JLVA 3KH7A 3D21A 2WFCA 3KM6A 4XIHA 1XW9A 4IN0A 1ZOFA 4GQCA 2VD0A 1V98A 4QMKA 1JZOA 1FW1A 3BOAA 1A8YA 3QPMA 5IMAA 1UA5A 4MDCA 2GT6A 3KCMA 3GX0A 5ID2A 2K18A 5GSSA 1USBA 4MPFA 5L71A 1YKCA 4F0BA 4ICYA 2VL2A 3KD0A 4BVYA 2XHFA 4ZL8A 4PGTA 2CT6A 4GLTA 3GV1A 3IDVA 1GULA 1TI1A 2IN3A 4G0LA 2RM6A 1OKDA 4WBJA 3L9VA 1JZRA 5DALA 5ELGA 3TKSE 3PH9A 5KN3A 2EFHA 4H86A 3QDNA 1XWCA 2O7KA 1XXUA 4MJCA 2X8CA 1YF0A 2ZCTA 5A5KA 2VKZG 1NHYA 3QFAC 3RBTA 1OC9B 3FZ9A 5J4UA 2OACA 2GGTA 4BVXB 3IRAA 3KZQA 4WETA 5C04A 4ZB9A 4Q5RA 2DSAA 4O7HA 2G0FA 4NV2A 2OE3A 9GSSA 2HRAA 4L0UA 1LU4A 1TRUA 1TU8A 5B6MA 2ON5A 2H0GA 2C80A 1A0FA 1X5CA 3WT1A 4K6XA 3IHGA 2PPTA 2PMTA 4K7NA 2CV4A 2XBIA 1R5AA 1ZCPA 3M3MA 4F82A 5A5HA 3TRQA 3TKQA 5A4WA 1GH2A 2HQTA 5COHA 2YJ7A 1ZL9A 2PN8A 1F2EA 2VCXA 3GTUB 1SENA 3ZVJA 4TOPA 3H8QA 17GSA 2C0GA 4ZL7A 2K6VA 4HJMA 4AJ8A 1G0TA 3L9SA 3L0HA 2MMZA 1BJXA 2EFDA 3BCKA 4V2NA 3KJYA 3RDWA 4LMWA 2WCIA 5HR1A 2DKIA 3LFLA 3LG6A 5IO2A 3KP9A 1X9SB 1HNBA 1WRYA 4OWYA 3UIWA 2E7PA 5G5FA 1BG1A 3CMIA 2IL3A 4LLRA 3UAPA 2DJ2A 2YWOA 2GZZA 2VCZA 3ED3A 3MIXA 4JR6A 5ECQB 1OC9A 1SD9A 4KDUA 4BVXA 3LXZA 4EIQA 2L4QA 1BF5A 5H5SA 4XS4A 2C3NA 3IOSA 3TOUA 2JADA 4RUVA 1B48A 4X1UA 5JWRB 3DD3A 3TKPA 5CAXA 1T4YA 1EV4A 3FRCA 4DEJA 1U3IA 3IC8A 5KN2A 1S3AA 4BPYA 4QL9A 1TTZA 3DVXA 4J2FA 1VRSD 3D6IA 2QA1A 1X5DA 3LQ7A 1TP9A 1NHOA 5EL8A 3ZREA 2EFCA 5ELAA 4L5OA 5CP1A 2P5RA 1GSDA 4JEDA 1DE1A 2LTKA 4WKWA 4PURA 4BL7A 1U6TA 3GTUA 2G2QA 4KX4A 4N3ZA 5GZZB 3WGEA 2VAFA 4J56E 3GA4A 3ZITA 5J40A 2ON7A 3LEFA 5GSTA 4AKGA 5B8BA 5FWGA 3CRTA 2VO4A 2UZ8A 4MABA 4KSOA 1Z9HA 4WF5A 1SVOA 3LORA 1T1VA 4GQFA 3Q19A 2JACA 1QFNA 3IA1A 3HA9A 2IIYA 1ERUA 5F8BA 1XZOA 1IYIA 3FZ4A 2RUEA 5HFGA 3QCPA 4Q5NA 3CRUA 1YF1A 4X4JA 3G7JA 4DVCA 1ML6A 1GWCA 4E8HA 1ST9A 3E9JB 3O3TA 4ML1A 3HJPA 1HNAA 1SKWB 1MDIA 1EV9A 2DBCA 2YNXA 3LWAA 1AQWA 5JWQB 1PD21 5KN0A 3BD2A 4NMUA 4HZ2A 2YWMA 5DQSA 3ZZXA 16GSA 2WJUA 5A1NB 5INYA 3KTLA 4I5QA 3IBHA 4IS0A 4HOJA 3H1NA 4AGSA 4F03A 2N5FA 4L8EA 3C71A 1Y25A 2PUKC 1GTBA 1GRXA 6GSVA 3KTBA 2WRTA 1Z5YE 4G19A 3GMFA 4XS6A 2GLRA 2PVOC 2X8HA 2LNTA 4IGJA 2LRNA 3VI5A 2C3QA 1OC8A 2TRCP 1XVWA 2HRKB 4MF7A 1PRXA 4V2LA 2A4HA 4EXJA 2I9HA 3L9UA 4EIPA 2P0GA 4TW5A 5KN1A 1TXUA 4PQIA 4ZB6A 2HRFA 1EZKA 2YV7A 2K8SA 4I2TA 4ZBAA 1O81A 2HSNB 4PQHA 3MWHA 2DMLA 1EGRA 3PR8A 1WPIA 2MBSA 5IIZA 2N5BA 4JR4A 5ECPB 3HVXA 1XCCA 2OJLA 4ZIJA 1OVNA 2HFDA 4TXOB 2E2MA 2HZFA 22GSA 4EUYA 1F3BA 1Z6NA 3M9JA 2HSYA 3A3TA 1M0UA 3IE3A 1FVKA 5A34B 2YN1A 4ZILA 2M46A 1TK8B 1ACVA 4FIWA 2IMFA 3CSIA 4AKHA 1RW1A 2K9FA 1BAYA 3IK7A 3Q18A 1TK0B 3IAM2 1K0BA 4EDYA 3HJOA 4G0IA 1MDKA 2JSZA 3FHKA 4XCSA 2ALBA 5DDLA 4YAPA 3DKSA 2CVBA 1N8JA 5AGYA 4I2UA 2GQKA 3SBCA 1NM3A 1DUGA 2R5GA 4MH2A 5DBQA 4BA7A 1O8WA 5A1NA 1OC3A 1AUCA 1XWAA 4BVYB 1SK1A 2GSQA 3P8WA 1AIUA 3DXBA 4EDZA 4YKGA 2AV4A 5D9VA 4V2MA 3GL5A 5DALB 1R26A 3C73A 4ID0A 5D93A 3AY8A 3E3EA 1G7EA 3IK9A 2E2GA 5ECSA 3GKXA 3GKMA 2HNLA 4K0NA 3EYTA 2B6MA 1PL2A 2H8LA 2NTOA 2HRKA 2AAWA 2TIRA 3EINA 3TJKA 3ZL5A 1FHEA 4HUAA 1O6JA 3NIVA 2CAIA 3PPUA 2HSNA 2PERA 1M9BA 4IBPA 4LL4B 3NOFA 1F6MC 4ILFA 1G7OA 1SKSB 4G01A 4HEA2 4BWQA 2VUPA 4MP4A 5J9BA 1YEPA 6GSYA 3DIEA 1WWJA 1TK5B 4N0ZA 4V1Ag 2YPMA 3TJGA 2H74A 5CRDA 2LNSA 4FYUA 1XWKA 4JE1A 5A34A 5A5HB 1R4WA 4NWYA 3CWGA 3I9V2 1K0MA 2V32A 1Z7PA 2L6CA 3ZMLA 1BYEA 1A24A 3Q6OA 2E0QA 2CX4A 4POBA 3EE2A 2M72A 3S9FA 3LW9A 4I8BA 5HR3A 4KNDA 4OFNA 1SK2A 2R3XA 3MDKA 2DC5A 4AJ6A 2OBKA 2GS3A 2YANA 1XPVA 2HI7A 2B7JA 4NXIA 1EGOA 3GURA 4TR1A 2FWHA 4KGIA 2PWJA 3KGKA 5AIVA 3US3A 5DVBA 4K5RA 2J9HA 4MJEA 1O7UA 2O87A 2H6ZA 5CNWA 3HCZA 1GSEA 4TRXA 4IKHA 19GSA 4IJIA 1X5EA 1XBSA 3C1SA 4F9ZA 1DBYA 2DJ3A 3TGZA 1KBNA 2GSSA 4GTUA 1F9MA 1NSWA 3FYGA 1XW6A 2L4CA 3FY7A 2LQQA 2NVLA 4OMVA 4JRRA 1AQVA 4XS4B 4LA1A 3D4MA 3BJ5A 1CQHA 1HYUA 4MZBA 2H72A 4CY6A 4Z2RA 1ZGNA 2JL4A 3LSZA 4WBRD 1ILOA 1LBKA 3LYKA 2R0GA 3UARA 1KEBA 3GUSA 3ERFA 4Z7XA 2FNOA 2A2SA 4D73A 2V6KA 4YQUA 3GKKA 2R0PA 2DLXA 3FK8A 2QGVA 4JU5A 3L4NA 4PUFC 2AUVA 4BWSA 2H76A 3V1WA 1WP0A 2OE0A 1PSQA 1SL1B 1DE2A 10GSA 4XS1A 3DMLA 1E2YA 2CZ3A 2GQLA 6GSUA 3HY2A 4IQAA 4BL7B 3TJBA 4IP1A 3ZVJD 1KNGA 1M9AA 5H5RA 4JBBA 5IOWA 5FHIA 2LJKA 1K0NA 4USSA 3F3QA 1YKAA 3G7IA 4RQRA 2GZPA 1T8EB 1K3LA 3O6TA 2GSTA 3ME7A 5F07A 4POLA 4EC0A 1XWBA 4MZCA 3HKRA 4N30A 4TR4A 3J7Yb 11GSA 1GP1A 5AN1A 3G7YA 1CQGA 2L59A 4ECCA 4MA9A 5ECRB 2CZ2A 3D5JA 5JWOB 5D9WA 5FT3A 4WR4A 4K9ZA 2DIZA 5F06A 3GKNA 4DSQA 3UVTA 3LYPA 5E59A 5CREA 2DJJA 2HT9A 4WF4A 14GSA 2KLXA 4KUNA 3W8SA 4G10A 1N2AA 3QOUA 2IWTA 3ZRDA 4TVEA 4HQSA 2X4AA 1H75A 1A2JA 1SYXA 3VI7A 2VL3A 3TOTA 3H79A 1SU9A 1GTIA 3RHBA 4HI7A 3FEUA 2YP6A 1K0CA 4MZWA 3IC4A 3BCIA 4K1FA 2I81A 1GUMA 5D9XA 4MJAA 4ZBBA 5ECLB 3R3EA 2P31A 4PXOA 4HZ4A 2H73A 2VD1A 1SJ6A 1PX7A 3M1GA 1WIKA 2L6DA 1THXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LST A;  3PGT A;  2I1U A;  5IMV A;  2MBT A;  1M2A A;  4G9H A;  5F05 A;  2WGR A;  4POK A;  4O32 A;  5JCU A;  1VF2 A;  2FHE A;  5B8A A;  1LJR A;  3EUR A;  4ULX A;  2LQO A;  2PBJ A;  5G1K A;  1EEM A;  3LGC A;  3TB2 A;  1MEK A;  5HR2 A;  2GVP A;  2H30 A;  2LS5 A;  4MCU A;  1K0O A;  4YH2 A;  3J7Y k;  4MJB A;  4KE3 A;  3MSZ A;  1PKZ A;  4MK3 A;  1B4Q A;  1S3C A;  5IM9 A;  4PTS A;  3QMX A;  1ZZY A;  2QSI A;  1Y6E A;  1GTA A;  4IHU A;  4N11 A;  1SJI A;  4L5L A;  4MF6 A;  2C0D A;  3ZFL A;  1SL0 B;  3CTF A;  1FB6 A;  2GDR A;  2VCT A;  1SYR A;  1XFL A;  4HQZ A;  13GS A;  2YOI A;  1XVQ A;  4K0G A;  3GHA A;  1EP8 A;  3I69 A;  12GS A;  5EY6 A;  4EE0 A;  3A2X A;  1YDK A;  2VCW A;  2WS2 A;  2VM2 A;  1PX6 A;  1RK4 A;  3IPZ A;  2YZU A;  2LUS A;  3HZ8 A;  1WJK A;  1UN2 A;  2C3T A;  3FZ5 A;  4QQ7 A;  5DQY A;  3ZTL A;  3N5O A;  1QXH A;  3HDC A;  2YV9 A;  1TRS A;  4N0V A;  3VPQ A;  3F6F A;  4TR0 A;  3VWW A;  3GSS A;  2VCQ A;  1OAZ A;  3TRX A;  1K0D A;  2XBQ A;  4WXT A;  2M80 A;  1HD2 A;  2D2Z A;  2ZUP A;  1ZYE A;  2RM5 A;  2O8V B;  1GLP A;  1M2D A;  1Q4J A;  4IW9 A;  5LNK e;  1JFU A;  2DJK A;  3CSH A;  3QR6 A;  2IJY A;  4MF5 A;  3ERG A;  2PVQ A;  2V2G A;  2VLU A;  1I5G A;  5IQY A;  1QQ2 A;  1I9D A;  2I3Y A;  4ECJ A;  1TXX A;  4KH7 A;  3C7M A;  2YZH A;  3CTG A;  2MMN A;  3GN3 A;  5D73 A;  1ERT A;  1GUH A;  1YY7 A;  3CSJ A;  4KW6 A;  5E4W A;  5HFK A;  1FO5 A;  3UVH A;  2WUL A;  3C1R A;  3FR3 A;  3UOM A;  3CBU A;  2NBS A;  4NHW A;  2H01 A;  1J9B A;  3HXS A;  4ECB A;  5EVO A;  2EIO A;  2PGT A;  2K8V A;  2V6O A;  2FWG A;  2AYT A;  4Q5F A;  5DAK A;  2IME A;  5D8I A;  5G5E A;  3WYW A;  1EOG A;  3GL3 A;  2OAD A;  3WT2 A;  2C0E A;  4GCI A;  3DGQ A;  2LRC A;  3QD9 A;  4TR1 B;  3MAK A;  3EVI A;  4YQM A;  3KH9 A;  4OCF A;  4GSS A;  1TKD B;  3M9K A;  2H1D A;  2V1M A;  3P90 A;  1QK8 A;  3ZIJ A;  2HZE B;  1JZD A;  2C8U A;  3UJ1 A;  4O92 A;  1WMJ A;  1B9Y C;  7GSS A;  1M99 A;  2DJ1 A;  3JCM L;  1PKW A;  4PNF A;  3GH9 A;  1ABA A;  4IEL A;  2B3S A;  5A4V A;  4MLY A;  4F2I A;  3ISO A;  3GX8 A;  1AXD A;  1G6Y A;  2F8A A;  3Q74 A;  1F3A A;  4ZBD A;  3R2Q A;  3UEM A;  4KDX A;  1AW9 A;  2QKE A;  1MTC A;  4AJ7 A;  3KIJ A;  1W89 A;  2CA8 A;  2LJA A;  5BMU A;  5DCH A;  3DEX A;  4OO5 A;  3TCO A;  4XRD A;  8GSS A;  2J23 A;  4D73 B;  1URM A;  5CRH A;  2MZC A;  3VUR A;  5G31 A;  3EWL A;  2BJX A;  4OD7 A;  3FW2 A;  3NZN A;  5IOX A;  20GS A;  3FR9 A;  3BBY A;  4KF9 A;  5A4U A;  5ENU A;  2P5Q A;  5F0G A;  4EKZ A;  2CVK A;  3APS A;  1HNC A;  2R4V A;  4PNG A;  4KAE A;  3N9J A;  1GSF A;  2FLS A;  2VLT A;  1UVZ A;  2JU5 A;  3D0Z A;  3RPN A;  1FG4 A;  3D4T A;  1GLQ A;  2FD3 A;  1VGL A;  3M8N A;  1QUW A;  3UBL A;  1GSQ A;  2HSH A;  1PL1 A;  1TOF A;  3LXT A;  4CHS A;  2VL9 A;  1WE0 A;  1XOA A;  1UC7 A;  3EU3 A;  4MH3 A;  1GNE A;  4POM A;  1XOB A;  2MMA A;  2C4J A;  2DIY A;  4JZQ A;  5HQP A;  5ECH B;  4RI6 A;  2HZE A;  3HVS A;  5DCG A;  1FB0 A;  4ACS A;  5H5Q A;  3ERW A;  4K7I A;  1PN9 A;  1K0A A;  1TU7 A;  2X99 A;  4CDO A;  3O76 A;  3SWL A;  2CVD A;  1TJD A;  3ME8 A;  3EU4 A;  2IFQ A;  4LMV A;  1M2B A;  4FH8 A;  4OO4 A;  5J41 A;  4XHM A;  3TUE A;  3UL3 A;  2EIQ A;  4KB3 A;  1WOU A;  1QGV A;  2L5L A;  4F0C A;  5IMC A;  2AHE A;  2HSM B;  1W4V A;  2QC7 A;  2B7K A;  3P2A A;  3H93 A;  1JLW A;  4EL1 A;  3QAW A;  4J57 E;  3GH6 A;  2FUG 2;  4WEY A;  4HU9 A;  3APO A;  3QFB C;  2OA7 A;  3MNG A;  3APQ A;  3K8N A;  3UMA A;  4KCA A;  2KOK A;  4DSS A;  2YCD A;  2HYX A;  3ZMK A;  3FZA A;  5D96 A;  18GS A;  1M7T A;  1B4P A;  4PUA A;  2WDU A;  1GSU A;  3KMO A;  5LD0 A;  4WR5 A;  2ES7 A;  2R2J A;  2YJH A;  2H1G A;  4PX1 A;  1X9M B;  1TW9 A;  5G30 A;  3HD5 A;  3KXO A;  4NV5 A;  3GFK A;  3W6G A;  1K3O A;  4NPB A;  1BX9 A;  2B5E A;  1BG5 A;  1ZYQ B;  2IPA A;  4G0K A;  5HFI A;  2B1L A;  4K8M A;  3KEB A;  4QL7 A;  2H6X A;  2VM1 A;  1U3A A;  4CW9 A;  2FWE A;  3D22 A;  4NHZ A;  2IMD A;  6GSX A;  3TJJ A;  5IMF A;  5DJM A;  3F4S A;  4FO5 A;  2JZR A;  1Z6M A;  3TKR A;  2MYG A;  2H0I A;  2B1K A;  2B5X A;  5ECM B;  4IJ3 A;  4E8E A;  4LL1 B;  2XPE A;  3KMN A;  3TRP A;  4HDE A;  3WGX A;  4X43 A;  5EPF A;  2R6K A;  3EMP A;  2RLI A;  4IVF A;  4X0X A;  2H70 A;  1VF1 A;  2R37 A;  4L0W A;  2BTO T;  3DVW A;  3DRN A;  4P3Y B;  1JZW A;  2I4A A;  2XC2 A;  2WB9 A;  4GXZ A;  3HJM A;  4AF2 A;  1RQM A;  6GSS A;  3A5W A;  3U5R E;  1T4Z A;  3DYR A;  2JZS A;  5GAN D;  2HE3 A;  1V58 A;  2HSM A;  3W8J A;  4Q5Q A;  1B9X C;  3FR6 A;  2LRT A;  2F51 A;  3G9B A;  2VOC A;  1GSY A;  4I97 A;  1BED A;  2C0F A;  3RAZ A;  1SL2 B;  3VWU A;  4ZB8 A;  2HRN A;  3H4K A;  5IMZ A;  3WD6 A;  4TXV A;  3F63 A;  4ZL9 A;  2YWI A;  2LEG A;  4HJ2 A;  2TRX A;  1O85 A;  2DJ0 A;  3KP8 A;  5D9T A;  4V1A p;  5J5N A;  2H1A A;  3CYN A;  1X9W B;  3ZYW A;  3GIX A;  4FYC A;  1EOH A;  3IV4 A;  1YJ6 A;  4KDY A;  1A8L A;  5AIS A;  5ECN B;  1C72 A;  2ZNM A;  4TR3 A;  1T00 A;  4FYB A;  2JSY A;  2CQ9 A;  3I43 A;  3VLN A;  2MMO A;  4GF0 A;  1SK0 A;  1AQX A;  2KUC A;  5IMD A;  1TDI A;  1FAA A;  4GST A;  2KHP A;  2HLS A;  3TKS C;  4NAX A;  4RQX A;  5IPH A;  4ZXG A;  2NDO A;  1MD4 A;  1Q98 A;  1YZX A;  3F3R A;  1FVJ A;  1O73 A;  3OR5 A;  5CRW A;  1PMT A;  3F8U A;  3E0U A;  1A0R P;  1V57 A;  1J0F A;  1OKT A;  3RPP A;  2FY6 A;  2REM A;  3I6A A;  1VF4 A;  1XIY A;  4N10 A;  1XWG A;  5DAK B;  1YEX A;  4K7O A;  2GSR A;  1G6W A;  6GSW A;  1EP7 A;  2A4V A;  2BMX A;  3RHC A;  3M0F A;  2OKA A;  3IR4 A;  1GUK A;  3DWV A;  1EWX A;  3F0I A;  2F8F A;  1A2M A;  2VCV A;  2VL2 C;  2EC4 A;  3FKF A;  4FQU A;  1S3D A;  2CAQ A;  1T3B A;  4PQ1 A;  2IMI A;  1V40 A;  1AAZ A;  2H1B A;  2F9S A;  4GWR A;  5ABR A;  1OE7 A;  4RI7 A;  2X8G A;  2YWN A;  1SD8 A;  1SJZ A;  1O8X A;  5IPG A;  3HHV A;  2FGX A;  4MMM A;  1VF3 A;  3HZ4 A;  2B5Y A;  2PU9 C;  3CXG A;  3GNJ A;  2L5O A;  5B7C A;  2H0H A;  2O89 A;  1Z3E A;  5G2Z A;  3U6V A;  3PIN A;  2LKU A;  1A23 A;  4G2E A;  3A2W A;  5G1L A;  1XW5 A;  3VWX A;  2RII A;  2A2R A;  1PQN A;  3IHQ A;  4XTS A;  5LCZ A;  1U88 A;  3A2V A;  1E6B A;  1U87 A;  5CYY A;  1J08 A;  2X64 A;  1X0R A;  2CX3 A;  4O5R A;  2IMK A;  5ECO B;  4TKY A;  2AJQ B;  1YQ1 A;  4OFT A;  3WGD A;  4EVM A;  4DSR A;  1ERW A;  4OCE A;  1EEJ A;  6GST A;  5CRG A;  1F37 A;  1GTU A;  2L57 A;  2KP1 A;  5J3R A;  1AC1 A;  2H19 A;  4KA0 A;  4HS1 A;  1PGT A;  3ZIV A;  2OE1 A;  2V41 A;  3GYK A;  2GQM A;  1ON4 A;  3L78 A;  4KCE A;  3HYP A;  3QAV A;  2JZT A;  1K3Y A;  2C1Y A;  1ZMA A;  2FA4 A;  2DMM A;  3IXR A;  4GSN A;  1HQO A;  2LJR A;  1THO A;  5HR0 A;  1SKR B;  1B8X A;  4TN8 A;  2GTU A;  2H6Y A;  2AB6 A;  4HU7 A;  1NW2 A;  3IAS 2;  5JCW A;  3UBK A;  3GST A;  4IP6 A;  1TRV A;  1FOV A;  4ML6 A;  4YAV A;  3ZLP A;  1GL8 A;  2EIR A;  3P7X A;  1PA3 A;  2Z9S A;  1GNW A;  4ECI A;  2N5A A;  3VFI A;  1MD3 A;  3F6D A;  1R7H A;  4EF0 A;  2NPB A;  3C8E A;  5ID2 B;  1ERV A;  1OE8 A;  2H71 A;  5KEJ A;  1Z7R A;  2GZY A;  2IFQ B;  5J9C A;  2FWF A;  5ECK B;  1DSB A;  3GRX A;  1V2A A;  1TRW A;  4K2D A;  1V9W A;  5AIX A;  1TI3 A;  5JCG A;  1OYJ A;  3HVV A;  2F3M A;  1A2L A;  2XPD A;  1BQ7 A;  2VLV A;  3VK9 A;  1T7P B;  5IO0 A;  3VWV A;  4I6X A;  3F4T A;  5C00 A;  1IYH A;  3ZFB A;  2KP2 A;  5CO3 A;  5GAP D;  3QAG A;  1QMV A;  3TDG A;  2LV3 A;  2H66 A;  1H4O A;  5DJL A;  4XRA A;  3EMX A;  4DSS B;  3VPT A;  2GT5 A;  2H75 A;  2FCH A;  2O85 A;  2FA8 A;  3LJR A;  3EC3 A;  4ISD A;  2WZ9 A;  2RUF A;  4EO3 A;  3TJF A;  4TXO A;  4IQ1 A;  4YQV A;  2HXK A;  5B6N A;  3F4R A;  3TKS A;  1KTE A;  1MDJ A;  4MPG A;  2VIM A;  4OFM A;  5ECI B;  3F9U A;  4GRF A;  1GSS A;  2OBI A;  1JHB A;  4KSM A;  1R5P A;  1JLV A;  3KH7 A;  3D21 A;  2WFC A;  3KM6 A;  4XIH A;  1XW9 A;  4IN0 A;  1ZOF A;  4GQC A;  2VD0 A;  1V98 A;  1JZO A;  1FW1 A;  3BOA A;  1A8Y A;  3QPM A;  5IMA A;  1UA5 A;  4MDC A;  2GT6 A;  3KCM A;  3GX0 A;  5ID2 A;  2K18 A;  5GSS A;  1USB A;  4MPF A;  5L71 A;  1YKC A;  4F0B A;  2VL2 A;  3KD0 A;  4BVY A;  2XHF A;  4ZL8 A;  4PGT A;  2CT6 A;  4GLT A;  3GV1 A;  3IDV A;  1GUL A;  1TI1 A;  2IN3 A;  4G0L A;  2RM6 A;  1OKD A;  4WBJ A;  3L9V A;  1JZR A;  5DAL A;  5ELG A;  3TKS E;  3PH9 A;  5KN3 A;  4H86 A;  3QDN A;  1XWC A;  2O7K A;  1XXU A;  4MJC A;  2X8C A;  1YF0 A;  2ZCT A;  5A5K A;  1NHY A;  3QFA C;  3RBT A;  1OC9 B;  3FZ9 A;  5J4U A;  2OAC A;  2GGT A;  4BVX B;  3IRA A;  3KZQ A;  4WET A;  5C04 A;  4ZB9 A;  4Q5R A;  2DSA A;  4O7H A;  2G0F A;  4NV2 A;  2OE3 A;  9GSS A;  2HRA A;  4L0U A;  1LU4 A;  1TRU A;  1TU8 A;  5B6M A;  2ON5 A;  2H0G A;  2C80 A;  1A0F A;  1X5C A;  3WT1 A;  4K6X A;  2PPT A;  2PMT A;  4K7N A;  2CV4 A;  2XBI A;  1R5A A;  1ZCP A;  3M3M A;  4F82 A;  3TRQ A;  3TKQ A;  5A4W A;  1GH2 A;  2HQT A;  5COH A;  2YJ7 A;  1ZL9 A;  2PN8 A;  1F2E A;  2VCX A;  3GTU B;  1SEN A;  3ZVJ A;  4TOP A;  3H8Q A;  17GS A;  2C0G A;  4ZL7 A;  2K6V A;  4HJM A;  4AJ8 A;  1G0T A;  3L9S A;  3L0H A;  2MMZ A;  1BJX A;  3BCK A;  4V2N A;  3KJY A;  3RDW A;  4LMW A;  2WCI A;  5HR1 A;  3LFL A;  3LG6 A;  5IO2 A;  3KP9 A;  1X9S B;  1HNB A;  1WRY A;  4OWY A;  3UIW A;  2E7P A;  5G5F A;  3CMI A;  2IL3 A;  4LLR A;  3UAP A;  2DJ2 A;  2YWO A;  2GZZ A;  2VCZ A;  3ED3 A;  4JR6 A;  5ECQ B;  1OC9 A;  1SD9 A;  4KDU A;  4BVX A;  3LXZ A;  2L4Q A;  5H5S A;  4XS4 A;  2C3N A;  3IOS A;  3TOU A;  2JAD A;  4RUV A;  1B48 A;  4X1U A;  5JWR B;  3DD3 A;  3TKP A;  5CAX A;  1T4Y A;  1EV4 A;  3FRC A;  4DEJ A;  1U3I A;  3IC8 A;  5KN2 A;  1S3A A;  4BPY A;  4QL9 A;  1TTZ A;  3DVX A;  4J2F A;  1VRS D;  3D6I A;  1X5D A;  3LQ7 A;  1TP9 A;  1NHO A;  5EL8 A;  3ZRE A;  5ELA A;  4L5O A;  5CP1 A;  2P5R A;  1GSD A;  4JED A;  1DE1 A;  2LTK A;  4WKW A;  4PUR A;  4BL7 A;  1U6T A;  3GTU A;  2G2Q A;  4KX4 A;  5GZZ B;  3WGE A;  2VAF A;  4J56 E;  3GA4 A;  3ZIT A;  2ON7 A;  3LEF A;  5GST A;  5B8B A;  5FWG A;  3CRT A;  2VO4 A;  2UZ8 A;  4MAB A;  4KSO A;  1Z9H A;  4WF5 A;  3LOR A;  1T1V A;  4GQF A;  3Q19 A;  2JAC A;  1QFN A;  3IA1 A;  3HA9 A;  2IIY A;  1ERU A;  5F8B A;  1XZO A;  1IYI A;  3FZ4 A;  2RUE A;  5HFG A;  3QCP A;  4Q5N A;  3CRU A;  1YF1 A;  3G7J A;  4DVC A;  1ML6 A;  1GWC A;  4E8H A;  1ST9 A;  3E9J B;  3O3T A;  4ML1 A;  3HJP A;  1HNA A;  1SKW B;  1MDI A;  1EV9 A;  2DBC A;  2YNX A;  3LWA A;  1AQW A;  5JWQ B;  1PD2 1;  5KN0 A;  3BD2 A;  4NMU A;  4HZ2 A;  2YWM A;  5DQS A;  3ZZX A;  16GS A;  2WJU A;  5INY A;  3KTL A;  4I5Q A;  3IBH A;  4IS0 A;  4HOJ A;  3H1N A;  4AGS A;  4F03 A;  2N5F A;  4L8E A;  3C71 A;  1Y25 A;  2PUK C;  1GTB A;  1GRX A;  6GSV A;  3KTB A;  2WRT A;  1Z5Y E;  4G19 A;  3GMF A;  4XS6 A;  2GLR A;  2PVO C;  2X8H A;  2LNT A;  4IGJ A;  2LRN A;  3VI5 A;  2C3Q A;  1OC8 A;  2TRC P;  1XVW A;  2HRK B;  4MF7 A;  1PRX A;  4V2L A;  4EXJ A;  2I9H A;  3L9U A;  2P0G A;  4TW5 A;  5KN1 A;  4PQI A;  4ZB6 A;  2HRF A;  1EZK A;  2YV7 A;  2K8S A;  4I2T A;  4ZBA A;  1O81 A;  2HSN B;  4PQH A;  3MWH A;  2DML A;  1EGR A;  3PR8 A;  1WPI A;  2MBS A;  5IIZ A;  2N5B A;  4JR4 A;  5ECP B;  3HVX A;  1XCC A;  2OJL A;  4ZIJ A;  1OVN A;  2HFD A;  4TXO B;  2E2M A;  2HZF A;  22GS A;  4EUY A;  1F3B A;  1Z6N A;  3M9J A;  2HSY A;  3A3T A;  1M0U A;  3IE3 A;  1FVK A;  2YN1 A;  4ZIL A;  2M46 A;  1TK8 B;  1ACV A;  4FIW A;  2IMF A;  3CSI A;  1RW1 A;  2K9F A;  1BAY A;  3IK7 A;  3Q18 A;  1TK0 B;  3IAM 2;  1K0B A;  4EDY A;  3HJO A;  4G0I A;  1MDK A;  2JSZ A;  3FHK A;  4XCS A;  2ALB A;  5DDL A;  4YAP A;  3DKS A;  2CVB A;  1N8J A;  5AGY A;  4I2U A;  2GQK A;  3SBC A;  1NM3 A;  1DUG A;  2R5G A;  4MH2 A;  5DBQ A;  4BA7 A;  1O8W A;  1OC3 A;  1AUC A;  1XWA A;  4BVY B;  1SK1 A;  2GSQ A;  3P8W A;  1AIU A;  3DXB A;  4EDZ A;  2AV4 A;  5D9V A;  4V2M A;  3GL5 A;  5DAL B;  1R26 A;  3C73 A;  4ID0 A;  5D93 A;  3AY8 A;  3E3E A;  1G7E A;  3IK9 A;  2E2G A;  5ECS A;  3GKX A;  3GKM A;  2HNL A;  4K0N A;  3EYT A;  2B6M A;  1PL2 A;  2H8L A;  2NTO A;  2HRK A;  2AAW A;  2TIR A;  3EIN A;  3TJK A;  3ZL5 A;  1FHE A;  4HUA A;  1O6J A;  3NIV A;  2CAI A;  3PPU A;  2PER A;  1M9B A;  4IBP A;  4LL4 B;  3NOF A;  1F6M C;  4ILF A;  1G7O A;  1SKS B;  4HEA 2;  4BWQ A;  2VUP A;  4MP4 A;  5J9B A;  1YEP A;  6GSY A;  3DIE A;  1WWJ A;  1TK5 B;  4N0Z A;  4V1A g;  2YPM A;  3TJG A;  2H74 A;  5CRD A;  2LNS A;  4FYU A;  1XWK A;  4JE1 A;  1R4W A;  4NWY A;  3I9V 2;  1K0M A;  2V32 A;  1Z7P A;  2L6C A;  3ZML A;  1BYE A;  1A24 A;  3Q6O A;  2E0Q A;  2CX4 A;  4POB A;  3EE2 A;  2M72 A;  3S9F A;  4I8B A;  5HR3 A;  4KND A;  4OFN A;  1SK2 A;  2R3X A;  3MDK A;  2DC5 A;  4AJ6 A;  2OBK A;  2GS3 A;  2YAN A;  1XPV A;  2HI7 A;  2B7J A;  4NXI A;  1EGO A;  3GUR A;  4TR1 A;  2FWH A;  4KGI A;  2PWJ A;  3KGK A;  5AIV A;  3US3 A;  5DVB A;  2J9H A;  4MJE A;  1O7U A;  2O87 A;  2H6Z A;  5CNW A;  3HCZ A;  1GSE A;  4TRX A;  4IKH A;  19GS A;  4IJI A;  1X5E A;  1XBS A;  3C1S A;  4F9Z A;  1DBY A;  2DJ3 A;  3TGZ A;  1KBN A;  2GSS A;  4GTU A;  1F9M A;  1NSW A;  3FYG A;  1XW6 A;  2L4C A;  3FY7 A;  2LQQ A;  2NVL A;  4OMV A;  4JRR A;  1AQV A;  4XS4 B;  4LA1 A;  3D4M A;  3BJ5 A;  1CQH A;  1HYU A;  4MZB A;  2H72 A;  1ZGN A;  2JL4 A;  3LSZ A;  4WBR D;  1ILO A;  1LBK A;  3LYK A;  3UAR A;  1KEB A;  3GUS A;  3ERF A;  4Z7X A;  2FNO A;  2A2S A;  4D73 A;  2V6K A;  4YQU A;  3GKK A;  2DLX A;  3FK8 A;  2QGV A;  4JU5 A;  3L4N A;  4PUF C;  2AUV A;  4BWS A;  2H76 A;  3V1W A;  1WP0 A;  2OE0 A;  1PSQ A;  1SL1 B;  1DE2 A;  10GS A;  4XS1 A;  3DML A;  1E2Y A;  2CZ3 A;  2GQL A;  6GSU A;  3HY2 A;  4IQA A;  4BL7 B;  3TJB A;  4IP1 A;  3ZVJ D;  1KNG A;  1M9A A;  5H5R A;  4JBB A;  5IOW A;  5FHI A;  2LJK A;  1K0N A;  4USS A;  3F3Q A;  1YKA A;  3G7I A;  4RQR A;  2GZP A;  1T8E B;  1K3L A;  3O6T A;  2GST A;  3ME7 A;  5F07 A;  4POL A;  4EC0 A;  1XWB A;  4MZC A;  3HKR A;  4N30 A;  4TR4 A;  3J7Y b;  11GS A;  1GP1 A;  5AN1 A;  3G7Y A;  1CQG A;  2L59 A;  4ECC A;  4MA9 A;  5ECR B;  2CZ2 A;  3D5J A;  5JWO B;  5D9W A;  5FT3 A;  4WR4 A;  4K9Z A;  2DIZ A;  5F06 A;  3GKN A;  4DSQ A;  3UVT A;  3LYP A;  5E59 A;  5CRE A;  2DJJ A;  2HT9 A;  4WF4 A;  14GS A;  2KLX A;  4KUN A;  3W8S A;  4G10 A;  1N2A A;  3QOU A;  2IWT A;  3ZRD A;  4TVE A;  4HQS A;  1H75 A;  1A2J A;  1SYX A;  3VI7 A;  2VL3 A;  3TOT A;  3H79 A;  1SU9 A;  1GTI A;  3RHB A;  4HI7 A;  3FEU A;  2YP6 A;  1K0C A;  4MZW A;  3IC4 A;  4K1F A;  3BCI A;  2I81 A;  1GUM A;  5D9X A;  4MJA A;  4ZBB A;  5ECL B;  3R3E A;  2P31 A;  4PXO A;  4HZ4 A;  2H73 A;  2VD1 A;  1SJ6 A;  1PX7 A;  3M1G A;  1WIK A;  2L6D A;  1THX A; 
#chains in the Genus database with same CATH topology
 2LST A;  3PGT A;  2I1U A;  5IMV A;  2MBT A;  1M2A A;  4G9H A;  5F05 A;  2WGR A;  4POK A;  4O32 A;  5JCU A;  4GDF A;  1VF2 A;  2FHE A;  5B8A A;  1LJR A;  3EUR A;  4ULX A;  2LQO A;  2PBJ A;  5G1K A;  1EEM A;  2UV8 G;  3A5I A;  3LGC A;  3TB2 A;  1MEK A;  5HR2 A;  2GVP A;  2H30 A;  2LS5 A;  4MCU A;  1K0O A;  4YH2 A;  3J7Y k;  4MJB A;  4KE3 A;  3MSZ A;  3CHX C;  1PKZ A;  4MK3 A;  1B4Q A;  1S3C A;  5IM9 A;  4PTS A;  3QMX A;  1ZZY A;  2QSI A;  1Y6E A;  1GTA A;  4IHU A;  4N11 A;  1SJI A;  4L5L A;  4MF6 A;  2C0D A;  3ZFL A;  1SL0 B;  3CTF A;  1FB6 A;  2GDR A;  2VCT A;  1SYR A;  1XFL A;  4HQZ A;  13GS A;  2YOI A;  1XVQ A;  4K0G A;  3GHA A;  1EP8 A;  3I69 A;  12GS A;  5EY6 A;  4EE0 A;  3A2X A;  1YDK A;  2VCW A;  2WS2 A;  2VM2 A;  1PX6 A;  1RK4 A;  3IPZ A;  2YZU A;  2LUS A;  3HZ8 A;  1WJK A;  1UN2 A;  2C3T A;  3FZ5 A;  4QQ7 A;  5DQY A;  3ZTL A;  3N5O A;  1QXH A;  3HDC A;  2YV9 A;  1TRS A;  4N0V A;  3VPQ A;  3F6F A;  4TR0 A;  3VWW A;  3GSS A;  2VCQ A;  1OAZ A;  3TRX A;  1K0D A;  2XBQ A;  4WXT A;  2M80 A;  1HD2 A;  2D2Z A;  2ZUP A;  1ZYE A;  2RM5 A;  2O8V B;  1GLP A;  1M2D A;  1Q4J A;  4IW9 A;  5LNK e;  1SVM A;  1JFU A;  2DJK A;  3CSH A;  3QR6 A;  2IJY A;  4MF5 A;  3ERG A;  1PN0 A;  2PVQ A;  2V2G A;  2VLU A;  1I5G A;  5IQY A;  1QQ2 A;  1I9D A;  2I3Y A;  4ECJ A;  1TXX A;  4KH7 A;  3C7M A;  5BMU B;  2YZH A;  3CTG A;  2MMN A;  3GN3 A;  5D73 A;  1ERT A;  1GUH A;  1YY7 A;  3CSJ A;  4KW6 A;  5E4W A;  5HFK A;  1FO5 A;  3UVH A;  2WUL A;  3C1R A;  3FR3 A;  3UOM A;  3CBU A;  1SVL A;  2NBS A;  4NHW A;  2H01 A;  1J9B A;  3HXS A;  4ECB A;  5EVO A;  2EIO A;  2PGT A;  2K8V A;  2V6O A;  2FWG A;  2AYT A;  4Q5F A;  5DAK A;  2IME A;  5D8I A;  5G5E A;  3WYW A;  1EOG A;  3GL3 A;  2OAD A;  3WT2 A;  2C0E A;  4GCI A;  3DGQ A;  2LRC A;  3QD9 A;  4TR1 B;  3MAK A;  3HMJ G;  3EVI A;  4YQM A;  2DKH A;  4AI6 A;  3KH9 A;  4OCF A;  4GSS A;  1TKD B;  3M9K A;  4E68 A;  2H1D A;  2V1M A;  3P90 A;  1QK8 A;  3ZIJ A;  2HZE B;  1JZD A;  2C8U A;  3UJ1 A;  4O92 A;  1WMJ A;  1B9Y C;  7GSS A;  1M99 A;  2DJ1 A;  3JCM L;  1PKW A;  4PNF A;  3GH9 A;  2OT3 A;  1ABA A;  4IEL A;  2B3S A;  5A4V A;  4MLY A;  4F2I A;  3ISO A;  3GX8 A;  1AXD A;  1G6Y A;  2F8A A;  3Q74 A;  1F3A A;  4ZBD A;  3R2Q A;  3UEM A;  4KDX A;  1AW9 A;  2QKE A;  1MTC A;  4AJ7 A;  3KIJ A;  1W89 A;  1N25 A;  2CA8 A;  2LJA A;  5BMU A;  5BRT A;  5DCH A;  1FOH A;  3DEX A;  4OO5 A;  3TCO A;  4XRD A;  8GSS A;  2J23 A;  4D73 B;  1URM A;  5CRH A;  2MZC A;  3VUR A;  5G31 A;  3EWL A;  2BJX A;  4OD7 A;  3FW2 A;  3NZN A;  5IOX A;  20GS A;  3FR9 A;  3BBY A;  4KF9 A;  5A4U A;  5ENU A;  2P5Q A;  5F0G A;  4EKZ A;  2CVK A;  3APS A;  1HNC A;  2R4V A;  4PNG A;  4KAE A;  3N9J A;  1GSF A;  2FLS A;  2VLT A;  1UVZ A;  2JU5 A;  3D0Z A;  3RPN A;  1FG4 A;  2WVY A;  4Z2U A;  3D4T A;  1GLQ A;  2FD3 A;  1VGL A;  3M8N A;  1QUW A;  3UBL A;  1GSQ A;  2HSH A;  1PL1 A;  1TOF A;  3LXT A;  4CHS A;  2VL9 A;  1WE0 A;  1XOA A;  1UC7 A;  3EU3 A;  3MYD A;  4MH3 A;  1GNE A;  4POM A;  1XOB A;  2MMA A;  2C4J A;  2DIY A;  4JZQ A;  5HQP A;  5ECH B;  4RI6 A;  5J47 A;  2HZE A;  3HVS A;  5DCG A;  3RGB C;  1FB0 A;  4ACS A;  5H5Q A;  1ZYP A;  3ERW A;  4K7I A;  1PN9 A;  1K0A A;  1TU7 A;  2X99 A;  4CDO A;  3O76 A;  3SWL A;  2CVD A;  1TJD A;  3ME8 A;  4O5U A;  3EU4 A;  2IFQ A;  4LMV A;  1M2B A;  4FH8 A;  4OO4 A;  4CY8 A;  5J41 A;  4XHM A;  3TUE A;  3UL3 A;  2EIQ A;  4KB3 A;  1WOU A;  1QGV A;  2L5L A;  4F0C A;  5IMC A;  2AHE A;  2HSM B;  1W4V A;  2QC7 A;  2B7K A;  3P2A A;  3H93 A;  1JLW A;  4EL1 A;  3QAW A;  4J57 E;  3GH6 A;  2FUG 2;  4WEY A;  4HU9 A;  3APO A;  3QFB C;  2OA7 A;  3MNG A;  3APQ A;  3K8N A;  3UMA A;  4KCA A;  2KOK A;  4DSS A;  2YCD A;  2HYX A;  3ZMK A;  3FZA A;  5D96 A;  18GS A;  1M7T A;  1B4P A;  4PUA A;  2WDU A;  1GSU A;  3KMO A;  5LD0 A;  4WR5 A;  2ES7 A;  2R2J A;  2YJH A;  2H1G A;  4PX1 A;  1X9M B;  1TW9 A;  5G30 A;  3HD5 A;  3KXO A;  4NV5 A;  3GFK A;  3W6G A;  1K3O A;  4NPB A;  1BX9 A;  2B5E A;  1BG5 A;  1ZYQ B;  2IPA A;  4G0K A;  5HFI A;  2B1L A;  4K8M A;  3KEB A;  4QL7 A;  2H6X A;  2VM1 A;  1U3A A;  4CW9 A;  2FWE A;  3D22 A;  4NHZ A;  2IMD A;  6GSX A;  3TJJ A;  5IMF A;  5DJM A;  3F4S A;  4FO5 A;  2JZR A;  4AKI A;  1Z6M A;  2O36 A;  3TKR A;  2MYG A;  2H0I A;  2B1K A;  4A5P A;  2B5X A;  5ECM B;  4IJ3 A;  2EFE A;  4E8E A;  4LL1 B;  2XPE A;  2A2P A;  3KMN A;  3TRP A;  4HDE A;  3WGX A;  4X43 A;  5EPF A;  2WW1 A;  2R0C A;  1XG8 A;  2R6K A;  3EMP A;  2RLI A;  4IVF A;  4X0X A;  2H70 A;  1VF1 A;  2R37 A;  4L0W A;  2BTO T;  3DVW A;  2X49 A;  3DRN A;  4P3Y B;  1JZW A;  2I4A A;  2XC2 A;  2WB9 A;  4GXZ A;  3HJM A;  4AF2 A;  1RQM A;  6GSS A;  4O5Q A;  3A5W A;  3U5R E;  1T4Z A;  3DYR A;  2JZS A;  5GAN D;  2HE3 A;  1V58 A;  2HSM A;  3W8J A;  4Q5Q A;  1B9X C;  3FR6 A;  2LRT A;  2F51 A;  3G9B A;  2VOC A;  4K2X A;  1GSY A;  4I97 A;  1BED A;  2C0F A;  3RAZ A;  1SL2 B;  3VWU A;  4ZB8 A;  2HRN A;  3H4K A;  5IMZ A;  3WD6 A;  4TXV A;  3F63 A;  4ZL9 A;  2YWI A;  2LEG A;  4HJ2 A;  2TRX A;  1O85 A;  2DJ0 A;  3KP8 A;  5D9T A;  4V1A p;  5J5N A;  2H1A A;  3CYN A;  1X9W B;  3ZYW A;  3GIX A;  4FYC A;  1EOH A;  3IV4 A;  1YJ6 A;  4KDY A;  1A8L A;  5AIS A;  5ECN B;  1C72 A;  2ZNM A;  4TR3 A;  1T00 A;  4FYB A;  1S3R A;  2JSY A;  2CQ9 A;  3I43 A;  3VLN A;  2MMO A;  4GF0 A;  1SK0 A;  1AQX A;  2KUC A;  5IMD A;  1TDI A;  1FAA A;  4GST A;  2KHP A;  2HLS A;  3TKS C;  4NAX A;  4RQX A;  5IPH A;  4ZXG A;  2NDO A;  1MD4 A;  1Q98 A;  1YZX A;  3F3R A;  1FVJ A;  1O73 A;  3OR5 A;  5CRW A;  1PMT A;  3F8U A;  3E0U A;  4MNN A;  1A0R P;  1V57 A;  1J0F A;  1OKT A;  3RPP A;  2FY6 A;  2REM A;  3I6A A;  1VF4 A;  1XIY A;  4N10 A;  1XWG A;  5DAK B;  5KOW A;  1YEX A;  4K7O A;  5KOX A;  2GSR A;  1G6W A;  5J4Y A;  4HSC X;  6GSW A;  1EP7 A;  2A4V A;  2BMX A;  2H1L A;  2WW3 A;  3RHC A;  3M0F A;  2OKA A;  3IR4 A;  1GUK A;  1ZYN A;  3DWV A;  1EWX A;  3F0I A;  2F8F A;  1A2M A;  2VCV A;  2VL2 C;  2EC4 A;  3FKF A;  4FQU A;  1S3D A;  2CAQ A;  1T3B A;  4PQ1 A;  2IMI A;  1YVL A;  1V40 A;  1AAZ A;  2H1B A;  2F9S A;  4GWR A;  5ABR A;  1OE7 A;  4RI7 A;  2X8G A;  2YWN A;  1SD8 A;  1SJZ A;  1O8X A;  5IPG A;  3HHV A;  2FGX A;  4MMM A;  1VF3 A;  3HZ4 A;  2B5Y A;  2PU9 C;  3CXG A;  3GNJ A;  2L5O A;  5B7C A;  2H0H A;  2O89 A;  1Z3E A;  5G2Z A;  3U6V A;  4K5S A;  3PIN A;  2LKU A;  1A23 A;  4G2E A;  3A2W A;  5G1L A;  2QA2 A;  1XW5 A;  3VWX A;  2RII A;  2A2R A;  1PQN A;  3IHQ A;  4XTS A;  5LCZ A;  1U88 A;  3A2V A;  1E6B A;  1U87 A;  3TU3 B;  5CYY A;  1J08 A;  2X64 A;  1X0R A;  2CX3 A;  4O5R A;  2IMK A;  5ECO B;  4TKY A;  2AJQ B;  1YQ1 A;  4OFT A;  3WGD A;  4EVM A;  4DSR A;  1ERW A;  4OCE A;  2WZS A;  1EEJ A;  4Z2T A;  6GST A;  5CRG A;  1F37 A;  1GTU A;  2L57 A;  2KP1 A;  5J3R A;  1AC1 A;  2H19 A;  4KA0 A;  4HS1 A;  1PGT A;  3ZIV A;  2OE1 A;  2V41 A;  3GYK A;  2GQM A;  1ON4 A;  3L78 A;  4KCE A;  3HYP A;  3QAV A;  2JZT A;  1K3Y A;  2C1Y A;  1ZMA A;  2FA4 A;  2DMM A;  3IXR A;  4GSN A;  1HQO A;  2LJR A;  1THO A;  5HR0 A;  1SKR B;  1B8X A;  4TN8 A;  2GTU A;  2H6Y A;  2AB6 A;  4HU7 A;  1NW2 A;  3IAS 2;  5JCW A;  3UBK A;  3GST A;  4IP6 A;  1TRV A;  3FMW A;  1FOV A;  4ML6 A;  4YAV A;  1M3J A;  3ZLP A;  1GL8 A;  2EIR A;  4ZB7 A;  3P7X A;  1PA3 A;  2Z9S A;  1GNW A;  1Y1U A;  4ECI A;  2N5A A;  4AKX B;  3VFI A;  1MD3 A;  3F6D A;  1R7H A;  3CQF A;  2NPB A;  4EF0 A;  2WVX A;  3C8E A;  5ID2 B;  1ERV A;  1OE8 A;  2H71 A;  5KEJ A;  1Z7R A;  2GZY A;  2IFQ B;  5J9C A;  4PI2 C;  2FWF A;  2O5V A;  5ECK B;  1DSB A;  3GRX A;  1V2A A;  1TRW A;  4K2D A;  1V9W A;  5AIX A;  1TI3 A;  5JCG A;  1OYJ A;  3HVV A;  2F3M A;  1A2L A;  2XPD A;  1BQ7 A;  2VLV A;  3VK9 A;  1T7P B;  5IO0 A;  3VWV A;  4I6X A;  3F4T A;  5C00 A;  1IYH A;  3ZFB A;  5J4V A;  2KP2 A;  5CO3 A;  5GAP D;  3QAG A;  1QMV A;  3TDG A;  2LV3 A;  2H66 A;  1H4O A;  5DJL A;  4XRA A;  3EMX A;  4DSS B;  3VPT A;  2GT5 A;  2H75 A;  2FCH A;  2WVZ A;  2O85 A;  2FA8 A;  3LJR A;  3EC3 A;  4ISD A;  2WZ9 A;  2RUF A;  4EO3 A;  3TJF A;  4TXO A;  4YKF A;  3EPT A;  4IQ1 A;  4YQV A;  2HXK A;  5B6N A;  3F4R A;  3TKS A;  1KTE A;  1MDJ A;  4MPG A;  2VIM A;  4OFM A;  5ECI B;  3F9U A;  4GRF A;  1GSS A;  2OBI A;  1I1I P;  1JHB A;  4W66 A;  4KSM A;  1R5P A;  1JLV A;  3KH7 A;  3D21 A;  2WFC A;  3KM6 A;  4XIH A;  1XW9 A;  4IN0 A;  1ZOF A;  4GQC A;  2VD0 A;  1V98 A;  4QMK A;  1JZO A;  1FW1 A;  3BOA A;  1A8Y A;  3QPM A;  1YEW C;  1UA5 A;  5IMA A;  4MDC A;  2GT6 A;  3KCM A;  3GX0 A;  5ID2 A;  2K18 A;  5GSS A;  1USB A;  4MPF A;  5L71 A;  1YKC A;  4F0B A;  4ICY A;  2VL2 A;  3KD0 A;  4BVY A;  2XHF A;  4ZL8 A;  4PGT A;  2CT6 A;  4GLT A;  3GV1 A;  3IDV A;  1GUL A;  1TI1 A;  2IN3 A;  4G0L A;  2RM6 A;  1OKD A;  4WBJ A;  3L9V A;  1JZR A;  5DAL A;  5ELG A;  3TKS E;  3PH9 A;  5KN3 A;  2EFH A;  4H86 A;  3HVN A;  3QDN A;  1XWC A;  2O7K A;  1XXU A;  4MJC A;  2X8C A;  1YF0 A;  2ZCT A;  5A5K A;  2VKZ G;  1NHY A;  3QFA C;  3RBT A;  1OC9 B;  3FZ9 A;  5J4U A;  2WW2 A;  2OAC A;  2GGT A;  4BVX B;  3IRA A;  3KZQ A;  4WET A;  5C04 A;  4ZB9 A;  4Q5R A;  2DSA A;  4O7H A;  2G0F A;  4NV2 A;  2OE3 A;  9GSS A;  2HRA A;  4L0U A;  1LU4 A;  1TRU A;  1TU8 A;  5B6M A;  2ON5 A;  2H0G A;  2C80 A;  1A0F A;  1X5C A;  3WT1 A;  4K6X A;  3IHG A;  2PPT A;  2PMT A;  4K7N A;  2CV4 A;  2XBI A;  1R5A A;  1ZCP A;  3M3M A;  4F82 A;  5A5H A;  3TRQ A;  3TKQ A;  5A4W A;  1GH2 A;  2HQT A;  5COH A;  2YJ7 A;  1ZL9 A;  2PN8 A;  1F2E A;  2VCX A;  3GTU B;  1SEN A;  1PFO A;  3ZVJ A;  4TOP A;  3H8Q A;  17GS A;  2C0G A;  4ZL7 A;  2K6V A;  4HJM A;  4AJ8 A;  1G0T A;  3L9S A;  3L0H A;  2MMZ A;  1BJX A;  2EFD A;  3BCK A;  4V2N A;  3KJY A;  3RDW A;  4LMW A;  2WCI A;  5HR1 A;  2DKI A;  3LFL A;  3LG6 A;  5IO2 A;  3KP9 A;  1X9S B;  1HNB A;  1WRY A;  4OWY A;  3UIW A;  2E7P A;  5G5F A;  1BG1 A;  3CMI A;  2IL3 A;  4LLR A;  3UAP A;  2DJ2 A;  2YWO A;  2GZZ A;  2VCZ A;  3ED3 A;  3MIX A;  4JR6 A;  5ECQ B;  1OC9 A;  1SD9 A;  4KDU A;  4BVX A;  3LXZ A;  4EIQ A;  2L4Q A;  1BF5 A;  5H5S A;  4XS4 A;  2C3N A;  3IOS A;  3TOU A;  2JAD A;  4RUV A;  1B48 A;  4X1U A;  5JWR B;  3DD3 A;  3TKP A;  5CAX A;  1T4Y A;  1EV4 A;  3FRC A;  4DEJ A;  1U3I A;  3IC8 A;  5KN2 A;  1S3A A;  4BPY A;  4QL9 A;  1TTZ A;  3DVX A;  4J2F A;  1VRS D;  3D6I A;  2QA1 A;  1X5D A;  3LQ7 A;  1TP9 A;  1NHO A;  5EL8 A;  3ZRE A;  2EFC A;  2WW0 A;  5ELA A;  4L5O A;  5CP1 A;  2P5R A;  1GSD A;  4JED A;  1DE1 A;  2LTK A;  4WKW A;  4PUR A;  4BL7 A;  1U6T A;  3GTU A;  2G2Q A;  4KX4 A;  4N3Z A;  5GZZ B;  3WGE A;  2VAF A;  4J56 E;  3GA4 A;  3ZIT A;  5J40 A;  2ON7 A;  3LEF A;  5GST A;  4AKG A;  5B8B A;  5FWG A;  3CRT A;  2VO4 A;  2UZ8 A;  4MAB A;  4KSO A;  1Z9H A;  4WF5 A;  1SVO A;  3LOR A;  1T1V A;  4GQF A;  3Q19 A;  2JAC A;  1QFN A;  3IA1 A;  3HA9 A;  2IIY A;  1ERU A;  5F8B A;  1XZO A;  1IYI A;  3FZ4 A;  2RUE A;  5HFG A;  3QCP A;  4Q5N A;  3CRU A;  1YF1 A;  4X4J A;  3G7J A;  4DVC A;  1ML6 A;  1GWC A;  4E8H A;  1ST9 A;  3E9J B;  3O3T A;  4ML1 A;  3HJP A;  1HNA A;  1SKW B;  1MDI A;  1EV9 A;  2DBC A;  2YNX A;  3LWA A;  1AQW A;  5JWQ B;  1PD2 1;  5KN0 A;  3BD2 A;  4NMU A;  4HZ2 A;  2WVX B;  2YWM A;  5DQS A;  3ZZX A;  16GS A;  2WJU A;  5A1N B;  5INY A;  3KTL A;  4I5Q A;  3IBH A;  4IS0 A;  4HOJ A;  3H1N A;  4AGS A;  4F03 A;  2N5F A;  4L8E A;  3C71 A;  1Y25 A;  2PUK C;  1GTB A;  1GRX A;  3RFR C;  6GSV A;  3KTB A;  2WRT A;  1Z5Y E;  4G19 A;  3GMF A;  4XS6 A;  2GLR A;  2PVO C;  2X8H A;  2LNT A;  4IGJ A;  2LRN A;  3VI5 A;  2C3Q A;  1OC8 A;  2TRC P;  1XVW A;  2HRK B;  4MF7 A;  1PRX A;  4V2L A;  2A4H A;  4EXJ A;  2I9H A;  3L9U A;  4EIP A;  2P0G A;  4TW5 A;  5KN1 A;  1TXU A;  4PQI A;  4ZB6 A;  2HRF A;  1EZK A;  2YV7 A;  2K8S A;  4I2T A;  4ZBA A;  1O81 A;  2HSN B;  4PQH A;  3MWH A;  2DML A;  1EGR A;  3PR8 A;  1WPI A;  2MBS A;  5IIZ A;  2N5B A;  4JR4 A;  5ECP B;  3HVX A;  1XCC A;  2OJL A;  4ZIJ A;  1OVN A;  2HFD A;  4TXO B;  2E2M A;  2HZF A;  22GS A;  4EUY A;  1F3B A;  1Z6N A;  3M9J A;  2HSY A;  3A3T A;  1M0U A;  3IE3 A;  1FVK A;  5A34 B;  2YN1 A;  4ZIL A;  2M46 A;  1TK8 B;  1ACV A;  4FIW A;  2IMF A;  3CSI A;  4AKH A;  1RW1 A;  2K9F A;  1BAY A;  3IK7 A;  3Q18 A;  1TK0 B;  3IAM 2;  1K0B A;  4EDY A;  3HJO A;  4G0I A;  1MDK A;  2JSZ A;  3FHK A;  4XCS A;  2ALB A;  5DDL A;  4YAP A;  3DKS A;  2CVB A;  1N8J A;  5AGY A;  4I2U A;  2GQK A;  3SBC A;  1NM3 A;  1DUG A;  2R5G A;  4MH2 A;  5DBQ A;  4BA7 A;  1O8W A;  5A1N A;  1OC3 A;  1AUC A;  1XWA A;  4BVY B;  1SK1 A;  2GSQ A;  3P8W A;  1AIU A;  3DXB A;  4EDZ A;  4YKG A;  2AV4 A;  5D9V A;  4V2M A;  3GL5 A;  5DAL B;  1R26 A;  3C73 A;  4ID0 A;  5D93 A;  3AY8 A;  3E3E A;  1G7E A;  3IK9 A;  2E2G A;  5ECS A;  4PI0 C;  3GKX A;  3GKM A;  2HNL A;  4K0N A;  3EYT A;  2B6M A;  1PL2 A;  2H8L A;  2NTO A;  2HRK A;  2AAW A;  2TIR A;  3EIN A;  3TJK A;  3ZL5 A;  1FHE A;  4HUA A;  1O6J A;  3NIV A;  2CAI A;  3PPU A;  2HSN A;  2PER A;  1M9B A;  4IBP A;  4LL4 B;  3NOF A;  1F6M C;  4ILF A;  1G7O A;  1SKS B;  4G01 A;  4HEA 2;  4BWQ A;  2VUP A;  4MP4 A;  5J9B A;  1YEP A;  6GSY A;  3DIE A;  1WWJ A;  1M3I A;  1TK5 B;  4N0Z A;  4V1A g;  2YPM A;  3TJG A;  2H74 A;  5CRD A;  2LNS A;  4FYU A;  1XWK A;  4JE1 A;  5A34 A;  5A5H B;  1R4W A;  4NWY A;  3CWG A;  3I9V 2;  1K0M A;  2V32 A;  1Z7P A;  2L6C A;  3ZML A;  1BYE A;  1A24 A;  3Q6O A;  2E0Q A;  2CX4 A;  4POB A;  3EE2 A;  2M72 A;  3S9F A;  3LW9 A;  4I8B A;  5HR3 A;  4KND A;  4OFN A;  1SK2 A;  2R3X A;  3MDK A;  2DC5 A;  4AJ6 A;  2OBK A;  2GS3 A;  2YAN A;  1XPV A;  2HI7 A;  2B7J A;  4NXI A;  1EGO A;  3GUR A;  4TR1 A;  2FWH A;  4KGI A;  2PWJ A;  3KGK A;  5AIV A;  3US3 A;  5DVB A;  4K5R A;  2J9H A;  4MJE A;  1O7U A;  2O87 A;  2H6Z A;  5CNW A;  3HCZ A;  1GSE A;  4TRX A;  4IKH A;  19GS A;  4IJI A;  1X5E A;  1XBS A;  3C1S A;  4F9Z A;  1DBY A;  2DJ3 A;  3TGZ A;  1KBN A;  2GSS A;  4GTU A;  4PHZ C;  1F9M A;  1NSW A;  3FYG A;  1XW6 A;  2L4C A;  3FY7 A;  2LQQ A;  2NVL A;  4OMV A;  4JRR A;  4FXY P;  1AQV A;  2O3E A;  4XS4 B;  4LA1 A;  3D4M A;  3BJ5 A;  1CQH A;  1HYU A;  4MZB A;  2H72 A;  4CY6 A;  4Z2R A;  1ZGN A;  2JL4 A;  3LSZ A;  4WBR D;  4BIK A;  1ILO A;  1LBK A;  3LYK A;  2R0G A;  3UAR A;  1KEB A;  3GUS A;  3ERF A;  4Z7X A;  2FNO A;  2A2S A;  4D73 A;  2V6K A;  4YQU A;  3GKK A;  2R0P A;  2DLX A;  3FK8 A;  2QGV A;  4JU5 A;  3L4N A;  4PUF C;  2AUV A;  4BWS A;  2H76 A;  3V1W A;  1WP0 A;  2OE0 A;  1PSQ A;  1SL1 B;  1DE2 A;  10GS A;  4XS1 A;  3DML A;  1E2Y A;  2CZ3 A;  2GQL A;  6GSU A;  3HY2 A;  4IQA A;  4BL7 B;  3TJB A;  4IP1 A;  3ZVJ D;  1KNG A;  1M9A A;  5H5R A;  4JBB A;  5IOW A;  5FHI A;  2LJK A;  1K0N A;  4USS A;  3F3Q A;  1YKA A;  3G7I A;  4RQR A;  2GZP A;  1T8E B;  1K3L A;  3O6T A;  2GST A;  3ME7 A;  5F07 A;  4POL A;  4EC0 A;  1XWB A;  4MZC A;  3HKR A;  4N30 A;  4TR4 A;  3J7Y b;  11GS A;  1GP1 A;  5AN1 A;  3G7Y A;  1CQG A;  2L59 A;  4ECC A;  4MA9 A;  5ECR B;  2CZ2 A;  3D5J A;  5JWO B;  5D9W A;  5FT3 A;  4WR4 A;  4K9Z A;  2DIZ A;  5F06 A;  3GKN A;  4DSQ A;  3UVT A;  3LYP A;  5E59 A;  5CRE A;  2DJJ A;  2HT9 A;  4WF4 A;  14GS A;  2KLX A;  4KUN A;  3W8S A;  4G10 A;  1N2A A;  3QOU A;  2IWT A;  3ZRD A;  4TVE A;  4HQS A;  2X4A A;  1H75 A;  1A2J A;  1SYX A;  3VI7 A;  2VL3 A;  3TOT A;  1S4B P;  3H79 A;  1SU9 A;  1GTI A;  3RHB A;  4HI7 A;  3FEU A;  2YP6 A;  1K0C A;  4MZW A;  3IC4 A;  3BCI A;  4K1F A;  2I81 A;  1GUM A;  5D9X A;  4MJA A;  4ZBB A;  5ECL B;  3R3E A;  2P31 A;  4PXO A;  4HZ4 A;  2H73 A;  2VD1 A;  1SJ6 A;  1PX7 A;  3M1G A;  1WIK A;  2L6D A;  1THX A; 
#chains in the Genus database with same CATH homology
 2LST A;  3PGT A;  2I1U A;  5IMV A;  2MBT A;  1M2A A;  4G9H A;  5F05 A;  2WGR A;  4POK A;  4O32 A;  5JCU A;  4GDF A;  1VF2 A;  2FHE A;  5B8A A;  1LJR A;  3EUR A;  4ULX A;  2LQO A;  2PBJ A;  5G1K A;  1EEM A;  2UV8 G;  3A5I A;  3LGC A;  3TB2 A;  1MEK A;  5HR2 A;  2GVP A;  2H30 A;  2LS5 A;  4MCU A;  1K0O A;  4YH2 A;  3J7Y k;  4MJB A;  4KE3 A;  3MSZ A;  1PKZ A;  4MK3 A;  1B4Q A;  1S3C A;  5IM9 A;  4PTS A;  3QMX A;  1ZZY A;  2QSI A;  1Y6E A;  1GTA A;  4IHU A;  4N11 A;  1SJI A;  4L5L A;  4MF6 A;  2C0D A;  3ZFL A;  1SL0 B;  3CTF A;  1FB6 A;  2GDR A;  2VCT A;  1SYR A;  1XFL A;  4HQZ A;  13GS A;  2YOI A;  1XVQ A;  4K0G A;  3GHA A;  1EP8 A;  3I69 A;  12GS A;  5EY6 A;  4EE0 A;  3A2X A;  1YDK A;  2VCW A;  2WS2 A;  2VM2 A;  1PX6 A;  1RK4 A;  3IPZ A;  2YZU A;  2LUS A;  3HZ8 A;  1WJK A;  1UN2 A;  2C3T A;  3FZ5 A;  4QQ7 A;  5DQY A;  3ZTL A;  3N5O A;  1QXH A;  3HDC A;  2YV9 A;  1TRS A;  4N0V A;  3VPQ A;  3F6F A;  4TR0 A;  3VWW A;  3GSS A;  2VCQ A;  1OAZ A;  3TRX A;  1K0D A;  2XBQ A;  4WXT A;  2M80 A;  1HD2 A;  2D2Z A;  2ZUP A;  1ZYE A;  2RM5 A;  2O8V B;  1GLP A;  1M2D A;  1Q4J A;  4IW9 A;  5LNK e;  1SVM A;  1JFU A;  2DJK A;  3CSH A;  3QR6 A;  2IJY A;  4MF5 A;  3ERG A;  1PN0 A;  2PVQ A;  2V2G A;  2VLU A;  1I5G A;  5IQY A;  1QQ2 A;  1I9D A;  2I3Y A;  4ECJ A;  1TXX A;  4KH7 A;  3C7M A;  5BMU B;  2YZH A;  3CTG A;  2MMN A;  3GN3 A;  5D73 A;  1ERT A;  1GUH A;  1YY7 A;  3CSJ A;  4KW6 A;  5E4W A;  5HFK A;  1FO5 A;  3UVH A;  2WUL A;  3C1R A;  3FR3 A;  3UOM A;  3CBU A;  1SVL A;  2NBS A;  4NHW A;  2H01 A;  1J9B A;  3HXS A;  4ECB A;  5EVO A;  2EIO A;  2PGT A;  2K8V A;  2V6O A;  2FWG A;  2AYT A;  4Q5F A;  5DAK A;  2IME A;  5D8I A;  5G5E A;  3WYW A;  1EOG A;  3GL3 A;  2OAD A;  3WT2 A;  2C0E A;  4GCI A;  3DGQ A;  2LRC A;  3QD9 A;  4TR1 B;  3MAK A;  3HMJ G;  3EVI A;  4YQM A;  2DKH A;  4AI6 A;  3KH9 A;  4OCF A;  4GSS A;  1TKD B;  3M9K A;  4E68 A;  2H1D A;  2V1M A;  3P90 A;  1QK8 A;  3ZIJ A;  2HZE B;  1JZD A;  2C8U A;  3UJ1 A;  4O92 A;  1WMJ A;  1B9Y C;  7GSS A;  1M99 A;  2DJ1 A;  3JCM L;  1PKW A;  4PNF A;  3GH9 A;  2OT3 A;  1ABA A;  4IEL A;  2B3S A;  5A4V A;  4MLY A;  4F2I A;  3ISO A;  3GX8 A;  1AXD A;  1G6Y A;  2F8A A;  3Q74 A;  1F3A A;  4ZBD A;  3R2Q A;  3UEM A;  4KDX A;  1AW9 A;  2QKE A;  1MTC A;  4AJ7 A;  3KIJ A;  1W89 A;  1N25 A;  2CA8 A;  2LJA A;  5BMU A;  5BRT A;  5DCH A;  1FOH A;  3DEX A;  4OO5 A;  3TCO A;  4XRD A;  8GSS A;  2J23 A;  4D73 B;  1URM A;  5CRH A;  2MZC A;  3VUR A;  5G31 A;  3EWL A;  2BJX A;  4OD7 A;  3FW2 A;  3NZN A;  5IOX A;  20GS A;  3FR9 A;  3BBY A;  4KF9 A;  5A4U A;  5ENU A;  2P5Q A;  5F0G A;  4EKZ A;  2CVK A;  3APS A;  1HNC A;  2R4V A;  4PNG A;  4KAE A;  3N9J A;  1GSF A;  2FLS A;  2VLT A;  1UVZ A;  2JU5 A;  3D0Z A;  3RPN A;  1FG4 A;  4Z2U A;  3D4T A;  1GLQ A;  2FD3 A;  1VGL A;  3M8N A;  1QUW A;  3UBL A;  1GSQ A;  2HSH A;  1PL1 A;  1TOF A;  3LXT A;  4CHS A;  2VL9 A;  1WE0 A;  1XOA A;  1UC7 A;  3EU3 A;  3MYD A;  4MH3 A;  1GNE A;  4POM A;  1XOB A;  2MMA A;  2C4J A;  2DIY A;  4JZQ A;  5HQP A;  5ECH B;  4RI6 A;  5J47 A;  2HZE A;  3HVS A;  5DCG A;  1FB0 A;  4ACS A;  5H5Q A;  1ZYP A;  3ERW A;  4K7I A;  1PN9 A;  1K0A A;  1TU7 A;  2X99 A;  4CDO A;  3O76 A;  3SWL A;  2CVD A;  1TJD A;  3ME8 A;  4O5U A;  3EU4 A;  2IFQ A;  4LMV A;  1M2B A;  4FH8 A;  4OO4 A;  4CY8 A;  5J41 A;  4XHM A;  3TUE A;  3UL3 A;  2EIQ A;  4KB3 A;  1WOU A;  1QGV A;  2L5L A;  4F0C A;  5IMC A;  2AHE A;  2HSM B;  1W4V A;  2QC7 A;  2B7K A;  3P2A A;  3H93 A;  1JLW A;  4EL1 A;  3QAW A;  4J57 E;  3GH6 A;  2FUG 2;  4WEY A;  4HU9 A;  3APO A;  3QFB C;  2OA7 A;  3MNG A;  3APQ A;  3K8N A;  3UMA A;  4KCA A;  2KOK A;  4DSS A;  2YCD A;  2HYX A;  3ZMK A;  3FZA A;  5D96 A;  18GS A;  1M7T A;  1B4P A;  4PUA A;  2WDU A;  1GSU A;  3KMO A;  5LD0 A;  4WR5 A;  2ES7 A;  2R2J A;  2YJH A;  2H1G A;  4PX1 A;  1X9M B;  1TW9 A;  5G30 A;  3HD5 A;  3KXO A;  4NV5 A;  3GFK A;  3W6G A;  1K3O A;  4NPB A;  1BX9 A;  2B5E A;  1BG5 A;  1ZYQ B;  2IPA A;  4G0K A;  5HFI A;  2B1L A;  4K8M A;  3KEB A;  4QL7 A;  2H6X A;  2VM1 A;  1U3A A;  4CW9 A;  2FWE A;  3D22 A;  4NHZ A;  2IMD A;  6GSX A;  3TJJ A;  5IMF A;  5DJM A;  3F4S A;  4FO5 A;  2JZR A;  4AKI A;  1Z6M A;  3TKR A;  2MYG A;  2H0I A;  2B1K A;  4A5P A;  2B5X A;  5ECM B;  4IJ3 A;  2EFE A;  4E8E A;  4LL1 B;  2XPE A;  2A2P A;  3KMN A;  3TRP A;  4HDE A;  3WGX A;  4X43 A;  5EPF A;  2R0C A;  2R6K A;  3EMP A;  2RLI A;  4IVF A;  4X0X A;  2H70 A;  1VF1 A;  2R37 A;  4L0W A;  2BTO T;  3DVW A;  2X49 A;  3DRN A;  4P3Y B;  1JZW A;  2I4A A;  2XC2 A;  2WB9 A;  4GXZ A;  3HJM A;  4AF2 A;  1RQM A;  6GSS A;  4O5Q A;  3A5W A;  3U5R E;  1T4Z A;  3DYR A;  2JZS A;  5GAN D;  2HE3 A;  1V58 A;  2HSM A;  3W8J A;  4Q5Q A;  1B9X C;  3FR6 A;  2LRT A;  2F51 A;  3G9B A;  2VOC A;  4K2X A;  1GSY A;  4I97 A;  1BED A;  2C0F A;  3RAZ A;  1SL2 B;  3VWU A;  4ZB8 A;  2HRN A;  3H4K A;  5IMZ A;  3WD6 A;  4TXV A;  3F63 A;  4ZL9 A;  2YWI A;  2LEG A;  4HJ2 A;  2TRX A;  1O85 A;  2DJ0 A;  3KP8 A;  5D9T A;  4V1A p;  5J5N A;  2H1A A;  3CYN A;  1X9W B;  3ZYW A;  3GIX A;  4FYC A;  1EOH A;  3IV4 A;  1YJ6 A;  4KDY A;  1A8L A;  5AIS A;  5ECN B;  1C72 A;  2ZNM A;  4TR3 A;  1T00 A;  4FYB A;  2JSY A;  2CQ9 A;  3I43 A;  3VLN A;  2MMO A;  4GF0 A;  1SK0 A;  1AQX A;  2KUC A;  5IMD A;  1TDI A;  1FAA A;  4GST A;  2KHP A;  2HLS A;  3TKS C;  4NAX A;  4RQX A;  5IPH A;  4ZXG A;  2NDO A;  1MD4 A;  1Q98 A;  1YZX A;  3F3R A;  1FVJ A;  1O73 A;  3OR5 A;  5CRW A;  1PMT A;  3F8U A;  3E0U A;  4MNN A;  1A0R P;  1V57 A;  1J0F A;  1OKT A;  3RPP A;  2FY6 A;  2REM A;  3I6A A;  1VF4 A;  1XIY A;  4N10 A;  1XWG A;  5DAK B;  5KOW A;  1YEX A;  4K7O A;  5KOX A;  2GSR A;  1G6W A;  5J4Y A;  6GSW A;  1EP7 A;  2A4V A;  2BMX A;  2H1L A;  3RHC A;  3M0F A;  2OKA A;  3IR4 A;  1GUK A;  1ZYN A;  3DWV A;  1EWX A;  3F0I A;  2F8F A;  1A2M A;  2VCV A;  2VL2 C;  2EC4 A;  3FKF A;  4FQU A;  1S3D A;  2CAQ A;  1T3B A;  4PQ1 A;  2IMI A;  1YVL A;  1V40 A;  1AAZ A;  2H1B A;  2F9S A;  4GWR A;  5ABR A;  1OE7 A;  4RI7 A;  2X8G A;  2YWN A;  1SD8 A;  1SJZ A;  1O8X A;  5IPG A;  3HHV A;  2FGX A;  4MMM A;  1VF3 A;  3HZ4 A;  2B5Y A;  2PU9 C;  3CXG A;  3GNJ A;  2L5O A;  5B7C A;  2H0H A;  2O89 A;  1Z3E A;  5G2Z A;  3U6V A;  4K5S A;  3PIN A;  2LKU A;  1A23 A;  4G2E A;  3A2W A;  5G1L A;  2QA2 A;  1XW5 A;  3VWX A;  2RII A;  2A2R A;  1PQN A;  3IHQ A;  4XTS A;  5LCZ A;  1U88 A;  3A2V A;  1E6B A;  1U87 A;  3TU3 B;  5CYY A;  1J08 A;  2X64 A;  1X0R A;  2CX3 A;  4O5R A;  2IMK A;  5ECO B;  4TKY A;  2AJQ B;  1YQ1 A;  4OFT A;  3WGD A;  4EVM A;  4DSR A;  1ERW A;  4OCE A;  1EEJ A;  4Z2T A;  6GST A;  5CRG A;  1F37 A;  1GTU A;  2L57 A;  2KP1 A;  5J3R A;  1AC1 A;  2H19 A;  4KA0 A;  4HS1 A;  1PGT A;  3ZIV A;  2OE1 A;  2V41 A;  3GYK A;  2GQM A;  1ON4 A;  3L78 A;  4KCE A;  3HYP A;  3QAV A;  2JZT A;  1K3Y A;  2C1Y A;  1ZMA A;  2FA4 A;  2DMM A;  3IXR A;  4GSN A;  1HQO A;  2LJR A;  1THO A;  5HR0 A;  1SKR B;  1B8X A;  4TN8 A;  2GTU A;  2H6Y A;  2AB6 A;  4HU7 A;  1NW2 A;  3IAS 2;  5JCW A;  3UBK A;  3GST A;  4IP6 A;  1TRV A;  3FMW A;  1FOV A;  4ML6 A;  4YAV A;  3ZLP A;  1GL8 A;  2EIR A;  4ZB7 A;  3P7X A;  1PA3 A;  2Z9S A;  1GNW A;  1Y1U A;  4ECI A;  2N5A A;  4AKX B;  3VFI A;  1MD3 A;  3F6D A;  1R7H A;  4EF0 A;  2NPB A;  3C8E A;  5ID2 B;  1ERV A;  1OE8 A;  2H71 A;  5KEJ A;  1Z7R A;  2GZY A;  2IFQ B;  5J9C A;  2FWF A;  2O5V A;  5ECK B;  1DSB A;  3GRX A;  1V2A A;  1TRW A;  4K2D A;  1V9W A;  5AIX A;  1TI3 A;  5JCG A;  1OYJ A;  3HVV A;  2F3M A;  1A2L A;  2XPD A;  1BQ7 A;  2VLV A;  3VK9 A;  1T7P B;  5IO0 A;  3VWV A;  4I6X A;  3F4T A;  5C00 A;  1IYH A;  3ZFB A;  5J4V A;  2KP2 A;  5CO3 A;  5GAP D;  3QAG A;  1QMV A;  3TDG A;  2LV3 A;  2H66 A;  1H4O A;  5DJL A;  4XRA A;  3EMX A;  4DSS B;  3VPT A;  2GT5 A;  2H75 A;  2FCH A;  2O85 A;  2FA8 A;  3LJR A;  3EC3 A;  4ISD A;  2WZ9 A;  2RUF A;  4EO3 A;  3TJF A;  4TXO A;  4YKF A;  3EPT A;  4IQ1 A;  4YQV A;  2HXK A;  5B6N A;  3F4R A;  3TKS A;  1KTE A;  1MDJ A;  4MPG A;  2VIM A;  4OFM A;  5ECI B;  3F9U A;  4GRF A;  1GSS A;  2OBI A;  1JHB A;  4W66 A;  4KSM A;  1R5P A;  1JLV A;  3KH7 A;  3D21 A;  2WFC A;  3KM6 A;  4XIH A;  1XW9 A;  4IN0 A;  1ZOF A;  4GQC A;  2VD0 A;  1V98 A;  4QMK A;  1JZO A;  1FW1 A;  3BOA A;  1A8Y A;  3QPM A;  5IMA A;  1UA5 A;  4MDC A;  2GT6 A;  3KCM A;  3GX0 A;  5ID2 A;  2K18 A;  5GSS A;  1USB A;  4MPF A;  5L71 A;  1YKC A;  4F0B A;  4ICY A;  2VL2 A;  3KD0 A;  4BVY A;  2XHF A;  4ZL8 A;  4PGT A;  2CT6 A;  4GLT A;  3GV1 A;  3IDV A;  1GUL A;  1TI1 A;  2IN3 A;  4G0L A;  2RM6 A;  1OKD A;  4WBJ A;  3L9V A;  1JZR A;  5DAL A;  5ELG A;  3TKS E;  3PH9 A;  5KN3 A;  2EFH A;  4H86 A;  3QDN A;  1XWC A;  2O7K A;  1XXU A;  4MJC A;  2X8C A;  1YF0 A;  2ZCT A;  5A5K A;  2VKZ G;  1NHY A;  3QFA C;  3RBT A;  1OC9 B;  3FZ9 A;  5J4U A;  2OAC A;  2GGT A;  4BVX B;  3IRA A;  3KZQ A;  4WET A;  5C04 A;  4ZB9 A;  4Q5R A;  2DSA A;  4O7H A;  2G0F A;  4NV2 A;  2OE3 A;  9GSS A;  2HRA A;  4L0U A;  1LU4 A;  1TRU A;  1TU8 A;  5B6M A;  2ON5 A;  2H0G A;  2C80 A;  1A0F A;  1X5C A;  3WT1 A;  4K6X A;  3IHG A;  2PPT A;  2PMT A;  4K7N A;  2CV4 A;  2XBI A;  1R5A A;  1ZCP A;  3M3M A;  4F82 A;  5A5H A;  3TRQ A;  3TKQ A;  5A4W A;  1GH2 A;  2HQT A;  5COH A;  2YJ7 A;  1ZL9 A;  2PN8 A;  1F2E A;  2VCX A;  3GTU B;  1SEN A;  3ZVJ A;  4TOP A;  3H8Q A;  17GS A;  2C0G A;  4ZL7 A;  2K6V A;  4HJM A;  4AJ8 A;  1G0T A;  3L9S A;  3L0H A;  2MMZ A;  1BJX A;  2EFD A;  3BCK A;  4V2N A;  3KJY A;  3RDW A;  4LMW A;  2WCI A;  5HR1 A;  2DKI A;  3LFL A;  3LG6 A;  5IO2 A;  3KP9 A;  1X9S B;  1HNB A;  1WRY A;  4OWY A;  3UIW A;  2E7P A;  5G5F A;  1BG1 A;  3CMI A;  2IL3 A;  4LLR A;  3UAP A;  2DJ2 A;  2YWO A;  2GZZ A;  2VCZ A;  3ED3 A;  3MIX A;  4JR6 A;  5ECQ B;  1OC9 A;  1SD9 A;  4KDU A;  4BVX A;  3LXZ A;  4EIQ A;  2L4Q A;  1BF5 A;  5H5S A;  4XS4 A;  2C3N A;  3IOS A;  3TOU A;  2JAD A;  4RUV A;  1B48 A;  4X1U A;  5JWR B;  3DD3 A;  3TKP A;  5CAX A;  1T4Y A;  1EV4 A;  3FRC A;  4DEJ A;  1U3I A;  3IC8 A;  5KN2 A;  1S3A A;  4BPY A;  4QL9 A;  1TTZ A;  3DVX A;  4J2F A;  1VRS D;  3D6I A;  2QA1 A;  1X5D A;  3LQ7 A;  1TP9 A;  1NHO A;  5EL8 A;  3ZRE A;  2EFC A;  5ELA A;  4L5O A;  5CP1 A;  2P5R A;  1GSD A;  4JED A;  1DE1 A;  2LTK A;  4WKW A;  4PUR A;  4BL7 A;  1U6T A;  3GTU A;  2G2Q A;  4KX4 A;  4N3Z A;  5GZZ B;  3WGE A;  2VAF A;  4J56 E;  3GA4 A;  3ZIT A;  5J40 A;  2ON7 A;  3LEF A;  5GST A;  4AKG A;  5B8B A;  5FWG A;  3CRT A;  2VO4 A;  2UZ8 A;  4MAB A;  4KSO A;  1Z9H A;  4WF5 A;  1SVO A;  3LOR A;  1T1V A;  4GQF A;  3Q19 A;  2JAC A;  1QFN A;  3IA1 A;  3HA9 A;  2IIY A;  1ERU A;  5F8B A;  1XZO A;  1IYI A;  3FZ4 A;  2RUE A;  5HFG A;  3QCP A;  4Q5N A;  3CRU A;  1YF1 A;  4X4J A;  3G7J A;  4DVC A;  1ML6 A;  1GWC A;  4E8H A;  1ST9 A;  3E9J B;  3O3T A;  4ML1 A;  3HJP A;  1HNA A;  1SKW B;  1MDI A;  1EV9 A;  2DBC A;  2YNX A;  3LWA A;  1AQW A;  5JWQ B;  1PD2 1;  5KN0 A;  3BD2 A;  4NMU A;  4HZ2 A;  2YWM A;  5DQS A;  3ZZX A;  16GS A;  2WJU A;  5A1N B;  5INY A;  3KTL A;  4I5Q A;  3IBH A;  4IS0 A;  4HOJ A;  3H1N A;  4AGS A;  4F03 A;  2N5F A;  4L8E A;  3C71 A;  1Y25 A;  2PUK C;  1GTB A;  1GRX A;  6GSV A;  3KTB A;  2WRT A;  1Z5Y E;  4G19 A;  3GMF A;  4XS6 A;  2GLR A;  2PVO C;  2X8H A;  2LNT A;  4IGJ A;  2LRN A;  3VI5 A;  2C3Q A;  1OC8 A;  2TRC P;  1XVW A;  2HRK B;  4MF7 A;  1PRX A;  4V2L A;  2A4H A;  4EXJ A;  2I9H A;  3L9U A;  4EIP A;  2P0G A;  4TW5 A;  5KN1 A;  1TXU A;  4PQI A;  4ZB6 A;  2HRF A;  1EZK A;  2YV7 A;  2K8S A;  4I2T A;  4ZBA A;  1O81 A;  2HSN B;  4PQH A;  3MWH A;  2DML A;  1EGR A;  3PR8 A;  1WPI A;  2MBS A;  5IIZ A;  2N5B A;  4JR4 A;  5ECP B;  3HVX A;  1XCC A;  2OJL A;  4ZIJ A;  1OVN A;  2HFD A;  4TXO B;  2E2M A;  2HZF A;  22GS A;  4EUY A;  1F3B A;  1Z6N A;  3M9J A;  2HSY A;  3A3T A;  1M0U A;  3IE3 A;  1FVK A;  5A34 B;  2YN1 A;  4ZIL A;  2M46 A;  1TK8 B;  1ACV A;  4FIW A;  2IMF A;  3CSI A;  4AKH A;  1RW1 A;  2K9F A;  1BAY A;  3IK7 A;  3Q18 A;  1TK0 B;  3IAM 2;  1K0B A;  4EDY A;  3HJO A;  4G0I A;  1MDK A;  2JSZ A;  3FHK A;  4XCS A;  2ALB A;  5DDL A;  4YAP A;  3DKS A;  2CVB A;  1N8J A;  5AGY A;  4I2U A;  2GQK A;  3SBC A;  1NM3 A;  1DUG A;  2R5G A;  4MH2 A;  5DBQ A;  4BA7 A;  1O8W A;  5A1N A;  1OC3 A;  1AUC A;  1XWA A;  4BVY B;  1SK1 A;  2GSQ A;  3P8W A;  1AIU A;  3DXB A;  4EDZ A;  4YKG A;  2AV4 A;  5D9V A;  4V2M A;  3GL5 A;  5DAL B;  1R26 A;  3C73 A;  4ID0 A;  5D93 A;  3AY8 A;  3E3E A;  1G7E A;  3IK9 A;  2E2G A;  5ECS A;  3GKX A;  3GKM A;  2HNL A;  4K0N A;  3EYT A;  2B6M A;  1PL2 A;  2H8L A;  2NTO A;  2HRK A;  2AAW A;  2TIR A;  3EIN A;  3TJK A;  3ZL5 A;  1FHE A;  4HUA A;  1O6J A;  3NIV A;  2CAI A;  3PPU A;  2HSN A;  2PER A;  1M9B A;  4IBP A;  4LL4 B;  3NOF A;  1F6M C;  4ILF A;  1G7O A;  1SKS B;  4G01 A;  4HEA 2;  4BWQ A;  2VUP A;  4MP4 A;  5J9B A;  1YEP A;  6GSY A;  3DIE A;  1WWJ A;  1TK5 B;  4N0Z A;  4V1A g;  2YPM A;  3TJG A;  2H74 A;  5CRD A;  2LNS A;  4FYU A;  1XWK A;  4JE1 A;  5A34 A;  5A5H B;  1R4W A;  4NWY A;  3CWG A;  3I9V 2;  1K0M A;  2V32 A;  1Z7P A;  2L6C A;  3ZML A;  1BYE A;  1A24 A;  3Q6O A;  2E0Q A;  2CX4 A;  4POB A;  3EE2 A;  2M72 A;  3S9F A;  3LW9 A;  4I8B A;  5HR3 A;  4KND A;  4OFN A;  1SK2 A;  2R3X A;  3MDK A;  2DC5 A;  4AJ6 A;  2OBK A;  2GS3 A;  2YAN A;  1XPV A;  2HI7 A;  2B7J A;  4NXI A;  1EGO A;  3GUR A;  4TR1 A;  2FWH A;  4KGI A;  2PWJ A;  3KGK A;  5AIV A;  3US3 A;  5DVB A;  4K5R A;  2J9H A;  4MJE A;  1O7U A;  2O87 A;  2H6Z A;  5CNW A;  3HCZ A;  1GSE A;  4TRX A;  4IKH A;  19GS A;  4IJI A;  1X5E A;  1XBS A;  3C1S A;  4F9Z A;  1DBY A;  2DJ3 A;  3TGZ A;  1KBN A;  2GSS A;  4GTU A;  1F9M A;  1NSW A;  3FYG A;  1XW6 A;  2L4C A;  3FY7 A;  2LQQ A;  2NVL A;  4OMV A;  4JRR A;  1AQV A;  4XS4 B;  4LA1 A;  3D4M A;  3BJ5 A;  1CQH A;  1HYU A;  4MZB A;  2H72 A;  4CY6 A;  4Z2R A;  1ZGN A;  2JL4 A;  3LSZ A;  4WBR D;  1ILO A;  1LBK A;  3LYK A;  2R0G A;  3UAR A;  1KEB A;  3GUS A;  3ERF A;  4Z7X A;  2FNO A;  2A2S A;  4D73 A;  2V6K A;  4YQU A;  3GKK A;  2R0P A;  2DLX A;  3FK8 A;  2QGV A;  4JU5 A;  3L4N A;  4PUF C;  2AUV A;  4BWS A;  2H76 A;  3V1W A;  1WP0 A;  2OE0 A;  1PSQ A;  1SL1 B;  1DE2 A;  10GS A;  4XS1 A;  3DML A;  1E2Y A;  2CZ3 A;  2GQL A;  6GSU A;  3HY2 A;  4IQA A;  4BL7 B;  3TJB A;  4IP1 A;  3ZVJ D;  1KNG A;  1M9A A;  5H5R A;  4JBB A;  5IOW A;  5FHI A;  2LJK A;  1K0N A;  4USS A;  3F3Q A;  1YKA A;  3G7I A;  4RQR A;  2GZP A;  1T8E B;  1K3L A;  3O6T A;  2GST A;  3ME7 A;  5F07 A;  4POL A;  4EC0 A;  1XWB A;  4MZC A;  3HKR A;  4N30 A;  4TR4 A;  3J7Y b;  11GS A;  1GP1 A;  5AN1 A;  3G7Y A;  1CQG A;  2L59 A;  4ECC A;  4MA9 A;  5ECR B;  2CZ2 A;  3D5J A;  5JWO B;  5D9W A;  5FT3 A;  4WR4 A;  4K9Z A;  2DIZ A;  5F06 A;  3GKN A;  4DSQ A;  3UVT A;  3LYP A;  5E59 A;  5CRE A;  2DJJ A;  2HT9 A;  4WF4 A;  14GS A;  2KLX A;  4KUN A;  3W8S A;  4G10 A;  1N2A A;  3QOU A;  2IWT A;  3ZRD A;  4TVE A;  4HQS A;  2X4A A;  1H75 A;  1A2J A;  1SYX A;  3VI7 A;  2VL3 A;  3TOT A;  3H79 A;  1SU9 A;  1GTI A;  3RHB A;  4HI7 A;  3FEU A;  2YP6 A;  1K0C A;  4MZW A;  3IC4 A;  3BCI A;  4K1F A;  2I81 A;  1GUM A;  5D9X A;  4MJA A;  4ZBB A;  5ECL B;  3R3E A;  2P31 A;  4PXO A;  4HZ4 A;  2H73 A;  2VD1 A;  1SJ6 A;  1PX7 A;  3M1G A;  1WIK A;  2L6D A;  1THX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...