5ECRB

Crystal structure of fin219-fip1 complex with ja, val and mg
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 63
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecrB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecrB01
4KDYA 4MCUA 4PUFC 1VGLA 2NDOA 4IJIA 1AQVA 2HI7A 2O87A 3EYTA 4WF5A 2LJKA 2H1DA 2FWHA 4DSQA 4KCAA 4EKZA 2P31A 5AISA 4MH2A 1M9BA 4LA1A 3KIJA 3IC8A 2WCIA 1XWAA 4FIWA 2VLTA 2GSSA 1K0AA 3I6AA 3TCOA 1HNBA 3IA1A 2CX4A 2YN1A 1XPVA 1U6TA 5AIXA 1YEPA 3VWVA 3FZ5A 2CV4A 2TRCP 4Q5RA 3E9JB 4QL9A 3QPMA 4F0CA 1SJIA 1GSSA 3APSA 5ID2A 1WRYA 4PNGA 1F9MA 6GSUA 1HD2A 4IVFA 1Z7PA 3EWLA 5A4UA 2H19A 19GSA 4ID0A 2KHPA 11GSA 3WT1A 2B1LA 4L0UA 2R3XA 2H73A 3A5WA 4QL7A 4GQFA 2B1KA 3F3QA 2X64A 1GTUA 3PPUA 4XIHA 5J9BA 2L4QA 3VURA 3ZYWA 5CNWA 13GSA 3L9VA 3N5OA 5F8BA 1MD3A 2MZCA 4GSSA 3L9SA 2VCXA 3RHCA 3IK9A 5B8AA 5CYYA 5CP1A 14GSA 2OE0A 4HQSA 1TU8A 2OBKA 3R2QA 1K0CA 1FVKA 2KLXA 2H72A 2IL3A 2C0EA 4I2UA 3WT2A 2P0GA 3ZIJA 2HE3A 1EGRA 4Z7XA 3KH9A 1A2MA 4ZBAA 6GSSA 4HJ2A 4POBA 3DVXA 2J9HA 5JCGA 3TKRA 2JZSA 2YWOA 2ZUPA 3QR6A 1ZGNA 2O8VB 4XS6A 2M46A 3KMNA 3F0IA 1XWBA 5HR3A 1YY7A 1X5DA 2A2RA 2VM2A 3IPZA 4EUYA 2H71A 3NZNA 1S3AA 5IMFA 4ECJA 5DBQA 4N10A 1XCCA 2DJ2A 4KAEA 3F9UA 4OD7A 4MP4A 1SJ6A 18GSA 4J57E 2X8HA 3MWHA 3QD9A 4NPBA 3E3EA 3EINA 1ZCPA 3ISOA 4ECBA 3GKMA 2L57A 1R26A 2QKEA 4K7NA 2YWNA 3TOUA 4KDUA 3IRAA 1PX6A 1YF1A 1X5EA 3CRTA 1RK4A 5ABRA 2GZPA 2B7KA 5ECSA 3DWVA 4K9ZA 2VM1A 2LRNA 4FQUA 4BVXA 2XHFA 4PX1A 2PN8A 3RPPA 5ECPB 1VF1A 1A8LA 3DEXA 1T3BA 1SU9A 2VO4A 1LU4A 3VWWA 5LCZA 4G0IA 4L0WA 3O3TA 2OE1A 4PTSA 3IE3A 5HR1A 3ZZXA 1GL8A 1BJXA 1XW6A 4F0BA 5EVOA 1TP9A 4N0VA 1F37A 5DAKB 1OKTA 4FYUA 1VF3A 3H1NA 2MMOA 2WGRA 3APOA 3J7Yk 3UIWA 3GSTA 3GL5A 2O7KA 1B8XA 2LRCA 3F3RA 3LYKA 2C0DA 3WGDA 2CA8A 4IP6A 5H5QA 4TOPA 3GIXA 2IFQA 4JRRA 4F82A 2JZRA 3JCML 2PVQA 4TW5A 2J23A 1Z3EA 2C0GA 3QFAC 5J4UA 1R5AA 2FLSA 4DVCA 1FO5A 1QXHA 2MYGA 3BD2A 1XWKA 1OAZA 3GA4A 2VL2A 2ALBA 4IP1A 5HQPA 2JADA 2YANA 3QAWA 1KTEA 4LMVA 1XW9A 3GH9A 1G0TA 4BL7A 5D9TA 4LL4B 2DJ1A 5DJMA 4KSMA 2P5RA 4WKWA 2F8AA 3VFIA 4ZL9A 4IN0A 2YP6A 2I4AA 3APQA 2WZ9A 4XS1A 3IC4A 4KF9A 4OFNA 1OE8A 1SK1A 3IAS2 4X43A 1T4ZA 3TDGA 1AQWA 4RQRA 3LG6A 1GTBA 2WDUA 4WF4A 5J3RA 5IMZA 1K0NA 3FR9A 3QAVA 4HJMA 2NTOA 1A8YA 2PU9C 2LV3A 5INYA 2A4VA 1BYEA 2I1UA 3QMXA 2JACA 5JCWA 1WMJA 2L6DA 4I97A 2F8FA 3ZFBA 1M99A 2OA7A 4L8EA 5FHIA 4G9HA 1GSUA 2C3NA 1XVQA 4OCEA 2H1BA 4IQ1A 6GSWA 3TKSA 5GSTA 3G7YA 1YKAA 3O6TA 5D96A 3VK9A 3TKQA 4GCIA 3F4TA 2VUPA 1WPIA 2CVKA 4WETA 3DKSA 2BJXA 1OC9B 2I81A 3LWAA 1RW1A 4K0GA 4MJCA 4PQ1A 2LKUA 1GSEA 1EGOA 5AN1A 3HJOA 4RI7A 1SKSB 5JWQB 1M7TA 3M9JA 3D21A 4EVMA 1SYXA 4BVYB 3ZFLA 4PGTA 4N30A 1V57A 1SD8A 5HFGA 2H70A 2PPTA 5DQSA 4V2NA 1X9SB 2UZ8A 4OWYA 2AYTA 2MMAA 1M2BA 1AUCA 3LFLA 1RQMA 3DYRA 3PH9A 5GAND 1OKDA 4TR1A 2E7PA 2GVPA 2H6ZA 4TVEA 4Q5QA 3VI5A 3W8SA 1YF0A 1GNWA 1TU7A 2HZEA 4K7IA 2RLIA 4TXOA 4ZB6A 1IYIA 1ZZYA 1IYHA 2X99A 4QQ7A 2CVDA 3VWXA 4EF0A 1F3BA 1GTAA 3UJ1A 1OC8A 2ZNMA 4MF5A 2JSZA 5EL8A 3TRQA 2HRAA 1B4QA 4AGSA 1U88A 4JBBA 4PXOA 2I9HA 2HRNA 2VCZA 3ED3A 5CRDA 1K3OA 3FYGA 3ZL5A 5J9CA 4MABA 3F4SA 1GTIA 1M2DA 2WB9A 1S3DA 1K3YA 4KDXA 3DGQA 4LL1B 2V1MA 1V2AA 2H66A 2B5YA 3CXGA 1O85A 3P90A 5CRHA 2H0IA 2M72A 3WYWA 2C0FA 2DJ0A 1F2EA 3ERWA 2YJ7A 5GZZB 3UEMA 5ECKB 2REMA 2H0GA 1YQ1A 6GSVA 4P3YB 3KM6A 2OBIA 1XZOA 3F8UA 4KCEA 1ON4A 1PX7A 3HJMA 5ECMB 1JZRA 5COHA 1TOFA 3FKFA 3ZMKA 2YWIA 1FVJA 3TOTA 3ZIVA 1TRUA 2RUEA 4O5RA 4EO3A 4MZWA 1R7HA 1ZL9A 1K0DA 1QK8A 2N5AA 3DRNA 4KX4A 4E8HA 4TR4A 2H74A 3C7MA 3WGEA 3ZLPA 2CVBA 1C72A 1XOBA 2GZYA 1Y6EA 4D73B 2CT6A 4F9ZA 3J7Yb 2AHEA 2GGTA 3HVVA 3TRXA 1I5GA 5IMAA 3KMOA 1GP1A 3GKNA 1DSBA 2AAWA 2OJLA 4MF6A 2XBIA 4ILFA 2R2JA 4AJ8A 1HYUA 1Z9HA 3W8JA 1MDKA 3CYNA 3GX0A 4V2MA 2PUKC 2VL9A 3M0FA 2CAQA 1WWJA 4GXZA 4IS0A 1MTCA 4XTSA 2GLRA 1ERUA 2M80A 2JL4A 4WR5A 4H86A 1U87A 1UA5A 2RM5A 1H75A 3KD0A 1YZXA 2V6KA 2CZ2A 3Q6OA 4L5OA 3EE2A 4NWYA 2K18A 2NVLA 1N8JA 3UBLA 4TXVA 2L6CA 2TIRA 4HUAA 1O6JA 6GSTA 5HFKA 5J5NA 5IM9A 2VCWA 1EEMA 1NW2A 4YH2A 5G5FA 4YQUA 5D8IA 4MZBA 4OMVA 1BX9A 8GSSA 1O8WA 4K0NA 1AC1A 3EMPA 2P5QA 3RPNA 3F6DA 1VRSD 2FWGA 3FY7A 3QFBC 3K8NA 3FZ9A 1K0OA 4O7HA 1EZKA 1EP7A 3L9UA 2YZHA 3EVIA 2DJ3A 2VIMA 2HRKB 1X9WB 2H75A 4RUVA 6GSXA 1THXA 4KA0A 3FK8A 3L4NA 1FHEA 3HJPA 2VL2C 3GKKA 4K2DA 3Q74A 2WJUA 4CW9A 2GT6A 1PA3A 4I2TA 2FA8A 3KZQA 3TKPA 4N0ZA 2H8LA 2XC2A 2HQTA 1W89A 2PWJA 3Q18A 4K1FA 1T4YA 3VWUA 2TRXA 2IJYA 3A2XA 4OO5A 3HY2A 2YOIA 4GSTA 1A0RP 3IV4A 2GQKA 4ACSA 1PRXA 2PVOC 1CQHA 5G30A 3CTGA 2O89A 1O7UA 4G0KA 3F63A 4GTUA 2EIQA 3UVHA 1ST9A 4TR3A 4XCSA 2EIOA 2GSQA 3IR4A 2QC7A 4GSNA 4BL7B 2G2QA 1YEXA 3LORA 3TJKA 3RBTA 2CZ3A 3CSJA 1HNAA 2YNXA 5KN0A 3RHBA 4I5QA 1A2LA 5F05A 4EDYA 2YZUA 4JR6A 3TKSC 1UN2A 4WR4A 3H8QA 5G5EA 5A5KA 4HS1A 4DEJA 2LRTA 2XPDA 2GT5A 1ABAA 2LTKA 5ELGA 3C8EA 4KNDA 1ZOFA 1O73A 3D6IA 4GRFA 1GSDA 4J2FA 3VPTA 3GURA 5C04A 1UC7A 5A4VA 3MNGA 2VD0A 2H1AA 5IMCA 4BWSA 2GQMA 5G1LA 1EOHA 1KNGA 2DJJA 5KN1A 5ECQB 5D9WA 4FYCA 2C3QA 5IOWA 3C1SA 2BTOT 5HR0A 1TRWA 2L5OA 3E0UA 5F0GA 2EIRA 3U6VA 4GLTA 2GDRA 1I9DA 2H30A 2MBTA 2R6KA 1GNEA 2FA4A 2AB6A 4E8EA 2HFDA 3ZRDA 1X9MB 4TN8A 3BCKA 4MF7A 2HNLA 3GFKA 2FNOA 1K3LA 2WS2A 1A0FA 1R5PA 2K8SA 3HKRA 1A23A 3IHQA 4XS4A 1J08A 5ECLB 2KUCA 4HQZA 2HRFA 2MMNA 5IMVA 4JZQA 4GQCA 3KJYA 4DSSA 2DIZA 4BPYA 4WEYA 2XPEA 3G9BA 1JHBA 2N5BA 2C1YA 5DALB 5B7CA 3GX8A 4JU5A 5KN2A 2HT9A 5CAXA 1PD21 3ZREA 5DDLA 4MZCA 1DUGA 2GSRA 1ZYEA 5IO0A 3KP8A 3LJRA 2VOCA 2LQOA 2QSIA 2V6OA 2EC4A 3ZTLA 5ECHB 1XFLA 22GSA 4RI6A 1H4OA 1YJ6A 4F03A 2HYXA 1DE2A 1PN9A 1HQOA 5CREA 3LEFA 2H0HA 1AW9A 2IWTA 2YJHA 5J41A 2AV4A 2FCHA 2NBSA 1DE1A 3QCPA 4POMA 2I3YA 1ACVA 4POKA 2X8GA 1CQGA 5ECRB 5KEJA 3GUSA 4EDZA 5KN3A 4TR1B 2HSMA 3GTUB 4CHSA 3TRPA 1FW1A 4K6XA 5E4WA 4OCFA 5E59A 4KSOA 3C1RA 3FW2A 4N11A 9GSSA 3DD3A 1EV4A 1SK0A 5JCUA 1G6YA 2DSAA 2HSYA 4MJEA 3S9FA 3ZVJA 5G1KA 2QGVA 4PNFA 2BMXA 3F6FA 1LBKA 2L59A 5CO3A 6GSYA 2GQLA 3LGCA 4OO4A 4CDOA 3IOSA 4IQAA 1NHYA 1KBNA 3AY8A 4HDEA 4YQVA 4OFTA 1SL2B 2R5GA 3C71A 1GSYA 1J9BA 1V98A 1X5CA 5AIVA 5H5SA 2DMLA 1DBYA 2ON5A 3C73A 3D4TA 3MSZA 2DJKA 4IJ3A 3NIVA 5LNKe 1R4WA 2ZCTA 4V1Ap 3HXSA 1AAZA 2E2MA 3O76A 2LJAA 1SK2A 2R4VA 5D9XA 2JSYA 1E2YA 5G31A 4G19A 1ERWA 4MPGA 2WULA 3ZVJD 2OADA 4KUNA 1QQ2A 4MJBA 4PQHA 3RDWA 4MA9A 1T7PB 1QMVA 3A2WA 4X0XA 1OE7A 2MMZA 4JE1A 1UVZA 4MLYA 2LEGA 2G0FA 5ENUA 1M0UA 5L71A 4FH8A 2LQQA 3BCIA 1GSFA 5D73A 2HSNB 3CSIA 2C8UA 2H01A 2IN3A 3GYKA 4NAXA 2B5XA 4POLA 2VL3A 2HSHA 5CRWA 1K0BA 4V1Ag 5ID2B 3ZMLA 1JFUA 3FR6A 2K6VA 4O92A 2F3MA 2K8VA 1EOGA 5FT3A 1SL0B 4HEA2 1LJRA 1Z6MA 5IPGA 4YAVA 2E2GA 5B6NA 4G0LA 1U3IA 3D5JA 5F07A 1B48A 2LNTA 1N2AA 1JLVA 3KXOA 3EURA 1PSQA 3GN3A 2V32A 3TJFA 3GL3A 4G2EA 1T00A 3HYPA 5IQYA 5DCGA 2IPAA 4FYBA 5IOXA 1G6WA 1GULA 2VLVA 4XHMA 2XBQA 3LSZA 1ML6A 2CQ9A 1NHOA 3VPQA 2D2ZA 1G7OA 2JZTA 1F3AA 4WBRD 3IBHA 3HVXA 3KGKA 3PGTA 3FEUA 1Z6NA 2ES7A 4O32A 2K9FA 1BQ7A 2H6YA 1PL1A 3VI7A 4NMUA 3IAM2 5EY6A 3BJ5A 1URMA 1X0RA 3ME8A 2O85A 3ERGA 2CX3A 3NOFA 1XWCA 2DLXA 1FOVA 2YCDA 1T1VA 7GSSA 3ME7A 2YV7A 4TKYA 3I43A 2L5LA 1AIUA 5AGYA 3WD6A 3EC3A 1GUHA 2DBCA 2FD3A 4TR0A 4IBPA 3HHVA 2C4JA 4HZ2A 1WE0A 4KE3A 3V1WA 4MPFA 4G10A 1QFNA 4WBJA 4IKHA 2KOKA 4MDCA 4ZL8A 4ULXA 3H79A 4ECCA 5FWGA 2RUFA 1GLQA 1JLWA 5ECIB 3WGXA 1V9WA 1Q4JA 1GH2A 5DQYA 3P7XA 4V2LA 3UOMA 2V41A 3L78A 3D22A 4HOJA 1GSQA 4FO5A 4ML1A 1SENA 4ZB8A 4NV2A 4D73A 1TXXA 3SWLA 3IXRA 4BWQA 2Z9SA 4BVXB 5F06A 2DMMA 4Q5NA 3M1GA 2GTUA 2L4CA 4ZXGA 3KH7A 4DSRA 3LYPA 1ERTA 4GF0A 3HDCA 1GLPA 1ZMAA 3M9KA 1FG4A 3GV1A 1TK0B 2PERA 3GSSA 1TRSA 2RIIA 3EU4A 1QUWA 2OACA 17GSA 3PR8A 4XRAA 1FB0A 2FWEA 2ON7A 2KP1A 1O8XA 1T8EB 4Q5FA 1Z5YE 2MBSA 5G2ZA 4F2IA 3M3MA 3ERFA 3HD5A 2AUVA 4ECIA 1AQXA 3KTBA 5B8BA 4NHWA 2X8CA 1OYJA 4IGJA 3GHAA 2IFQB 2DIYA 2FHEA 2GSTA 2F51A 1XOAA 5IMDA 3DVWA 2VCQA 4EC0A 4ZIJA 1M2AA 1XIYA 2VLUA 4LMWA 10GSA 3DIEA 4ML6A 1SKRB 3GNJA 3LQ7A 12GSA 3GMFA 3GKXA 2LSTA 2HLSA 3N9JA 1SL1B 16GSA 1VF2A 2HRKA 1TW9A 3MDKA 3EMXA 4EL1A 2H6XA 4MK3A 4JR4A 1BAYA 4ISDA 5BMUA 2B3SA 2DC5A 3HCZA 3IK7A 4XRDA 1OVNA 2IIYA 3TUEA 1MD4A 4XS4B 20GSA 5CRGA 1EV9A 4RQXA 4HU7A 1BEDA 5A4WA 1WP0A 1K0MA 3UARA 1U3AA 3PINA 5IO2A 2OKAA 4DSSB 4EE0A 4KGIA 3KTLA 4KW6A 3QDNA 1JZOA 1PMTA 1USBA 1G7EA 4ZBBA 2PBJA 1TDIA 1GRXA 3BOAA 5C00A 5DVBA 2B6MA 3LXTA 2GS3A 3GH6A 2FUG2 5ECOB 4K7OA 4WXTA 1OC3A 2WFCA 2VAFA 1ILOA 3UAPA 3I9V2 4BA7A 1F6MC 1V58A 2IMEA 3EU3A 3SBCA 1YDKA 3UBKA 4HU9A 5D9VA 3FHKA 2PMTA 4YAPA 5GAPD 1E6BA 2HSMB 5DAKA 5GSSA 3FRCA 4IHUA 3CMIA 4X1UA 4I8BA 1WOUA 2B5EA 1PKWA 4JEDA 1ZYQB 3G7JA 2VCVA 1WJKA 3HZ8A 2YV9A 3CBUA 4USSA 1PQNA 3M8NA 4ZB9A 2LS5A 3HA9A 3CTFA 2OE3A 1Z7RA 4J56E 2V2GA 3L0HA 1B9XC 3A3TA 3FZAA 3CSHA 1SKWB 3U5RE 1ERVA 1EWXA 3F4RA 3H93A 2HZFA 1TK5B 1JZDA 4TRXA 4AF2A 3DXBA 3KEBA 4OFMA 1SYRA 2FY6A 3DMLA 3D4MA 2IMFA 1A24A 3HZ4A 4LLRA 3TKSE 2LJRA 1SD9A 1MDJA 3OR5A 1V40A 3TJBA 3H4KA 2HZEB 3FR3A 4TXOB 4K8MA 3LXZA 1M9AA 1Q98A 2FGXA 3VLNA 1NSWA 2N5FA 3RAZA 5IPHA 4GWRA 1QGVA 3IDVA 2PGTA 2A2SA 2AJQB 3UMAA 1B4PA 4HI7A 1AXDA 1YKCA 1EEJA 4PUAA 5DALA 4I6XA 2RM6A 5LD0A 1XW5A 4AJ6A 2HXKA 1Y25A 2H76A 2C80A 2GZZA 3GRXA 4PURA 2B7JA 3W6GA 1XBSA 1O81A 2IMIA 1XWGA 3A2VA 1JZWA 1MEKA 3P2AA 2E0QA 3TGZA 1PKZA 1WIKA 2LUSA 5D93A 1B9YC 1PGTA 2FWFA 3US3A 4MJAA 3MAKA 5HR2A 4L5LA 4ZBDA 1GWCA 3BBYA 3ZITA 3QOUA 3GTUA 3Q19A 3KP9A 3CRUA 1OC9A 1S3CA 2NPBA 3UL3A 1FB6A 2F9SA 1TJDA 1TI3A 1EP8A 1BG5A 1TTZA 5ECNB 1NM3A 1FAAA 1GUKA 5JWOB 4YQMA 4MH3A 3G7IA 4BVYA 4MMMA 2IMKA 3R3EA 1TI1A 2YWMA 2CAIA 1A2JA 3D0ZA 4ZILA 3P8WA 2LNSA 1SJZA 2VCTA 4PQIA 4KH7A 2WRTA 1W4VA 1THOA 1TKDB 1KEBA 1J0FA 1GUMA 4HZ4A 1TK8B 1VF4A 1TRVA 2JU5A 5B6MA 4IW9A 4NHZA 1MDIA 5JWRB 5ELAA 2C3TA 3UVTA 4IELA 1XVWA 4KB3A 3KCMA 4NV5A 5H5RA 4ZL7A 4EXJA 2KP2A 3I69A 2VD1A 1XXUA 3HVSA 3TJJA 5EPFA 4AJ7A 2IMDA 1HNCA 5HFIA 2YPMA 3QAGA 5DCHA 3TJGA 2H1GA 5DJLA 3FZ4A 1PL2A 2R37A 4NXIA 5IIZA 3TB2A
chains in the Genus database with same CATH superfamily
4KDYA 4MCUA 4AKGA 4PUFC 1VGLA 2X49A 2NDOA 4IJIA 1AQVA 2HI7A 2O87A 3EYTA 4WF5A 2LJKA 2H1DA 2FWHA 4DSQA 4KCAA 4EKZA 2P31A 3A5IA 5AISA 4MH2A 1M9BA 4LA1A 3KIJA 3IC8A 2WCIA 4Z2TA 1XWAA 4FIWA 2VLTA 2GSSA 1K0AA 3I6AA 3TCOA 1HNBA 3IA1A 2CX4A 2YN1A 1XPVA 1SVMA 1U6TA 5AIXA 1YEPA 3VWVA 3FZ5A 4ICYA 2CV4A 2TRCP 4Q5RA 3E9JB 4QL9A 3QPMA 4F0CA 2O3EA 1SJIA 1GSSA 3APSA 5ID2A 1WRYA 4PNGA 1F9MA 6GSUA 1HD2A 4IVFA 1Z7PA 3EWLA 5A4UA 2H19A 19GSA 2QA2A 4ID0A 2KHPA 11GSA 3WT1A 2B1LA 4L0UA 2R3XA 2H73A 3A5WA 4QL7A 4X4JA 4GQFA 2B1KA 3F3QA 3EPTA 2X64A 1GTUA 3PPUA 4XIHA 5J9BA 5A34A 4K5SA 4G01A 2L4QA 3VURA 3ZYWA 2WVYA 5CNWA 13GSA 3L9VA 3FMWA 3N5OA 4MNNA 5F8BA 1MD3A 2MZCA 4GSSA 3L9SA 2VCXA 3MIXA 3RHCA 3IK9A 5B8AA 5CYYA 5CP1A 14GSA 2OE0A 4HQSA 1TU8A 2OBKA 3R2QA 1K0CA 1FVKA 2KLXA 2H72A 2IL3A 2C0EA 4I2UA 3WT2A 2P0GA 3ZIJA 2HE3A 1EGRA 4Z7XA 3KH9A 1A2MA 4ZBAA 6GSSA 4O5QA 4HJ2A 4POBA 3DVXA 2J9HA 5JCGA 3TKRA 2JZSA 2YWOA 2ZUPA 3QR6A 1ZGNA 2O8VB 4XS6A 2M46A 3KMNA 3F0IA 1XWBA 5HR3A 1YY7A 1N25A 1X5DA 2A2RA 2VM2A 3IPZA 4EUYA 2H71A 3NZNA 1S3AA 5IMFA 4ECJA 5DBQA 3MYDA 4N10A 1XCCA 5BMUB 2DJ2A 4KAEA 3F9UA 4OD7A 4MP4A 1SJ6A 18GSA 2WW0A 4J57E 2X8HA 3MWHA 3QD9A 4NPBA 3E3EA 3EINA 1ZCPA 3ISOA 4ECBA 3GKMA 2L57A 1R26A 2QKEA 4K7NA 3CHXC 2YWNA 3TOUA 4KDUA 3IRAA 1PX6A 1YF1A 1X5EA 3CRTA 1RK4A 5ABRA 2GZPA 2B7KA 5ECSA 3DWVA 4K9ZA 2VM1A 2LRNA 4FQUA 4BVXA 2XHFA 4PX1A 2PN8A 3RPPA 5ECPB 1VF1A 1A8LA 3DEXA 1T3BA 1SU9A 2VO4A 1LU4A 3VWWA 5LCZA 4G0IA 4L0WA 3O3TA 2OE1A 4PTSA 3IE3A 5HR1A 3ZZXA 1GL8A 1BJXA 1M3JA 1XW6A 4F0BA 5EVOA 5J47A 1TP9A 4N0VA 1F37A 5DAKB 1OKTA 4FYUA 1VF3A 3H1NA 2MMOA 2WGRA 3APOA 3J7Yk 3UIWA 3RGBC 3GSTA 3GL5A 2O7KA 1B8XA 2LRCA 3F3RA 3LYKA 2C0DA 3WGDA 2CA8A 4IP6A 5H5QA 4TOPA 3GIXA 4PI2C 5J4VA 2IFQA 4JRRA 4F82A 2JZRA 3JCML 2PVQA 4TW5A 2J23A 4K5RA 4YKFA 3CQFA 1Z3EA 2C0GA 3QFAC 5J4UA 1R5AA 2FLSA 4DVCA 1FO5A 1QXHA 2MYGA 2EFHA 3BD2A 1XWKA 1OAZA 3GA4A 2VL2A 2ALBA 4IP1A 5HQPA 2VKZG 2JADA 2YANA 3QAWA 1KTEA 4LMVA 1XW9A 3GH9A 1G0TA 4BL7A 5D9TA 4LL4B 2DJ1A 5DJMA 4KSMA 2P5RA 5KOXA 4WKWA 2F8AA 3VFIA 4ZL9A 4IN0A 2YP6A 2I4AA 3APQA 2WZ9A 4XS1A 3IC4A 4KF9A 4OFNA 1OE8A 1SK1A 3IAS2 2EFCA 4X43A 1T4ZA 3TDGA 1AQWA 4RQRA 3LG6A 2WW3A 1GTBA 2WDUA 4WF4A 5J3RA 5IMZA 1K0NA 3FR9A 3QAVA 4HJMA 2NTOA 1A8YA 2PU9C 2LV3A 5INYA 2A4VA 1BYEA 2I1UA 3QMXA 2JACA 5JCWA 1WMJA 2L6DA 4I97A 2F8FA 3ZFBA 1M99A 2OA7A 4L8EA 5FHIA 4G9HA 1GSUA 2C3NA 1XVQA 4OCEA 2H1BA 4IQ1A 6GSWA 3TKSA 5GSTA 3G7YA 1YKAA 3O6TA 5D96A 3VK9A 3TKQA 4CY6A 4GCIA 3F4TA 2VUPA 1WPIA 5A1NB 2WVXA 2CVKA 4WETA 3DKSA 2BJXA 1OC9B 5J40A 2I81A 3LWAA 1RW1A 4K0GA 4MJCA 4PQ1A 2LKUA 1GSEA 1EGOA 5AN1A 3HJOA 4RI7A 1SKSB 5JWQB 1M7TA 3M9JA 3D21A 4EVMA 1SYXA 4BVYB 3ZFLA 2A2PA 4PGTA 4N30A 1V57A 1SD8A 5HFGA 2H70A 2PPTA 5DQSA 4V2NA 1X9SB 2UZ8A 4OWYA 5BRTA 2AYTA 2MMAA 1M2BA 1AUCA 3LFLA 1RQMA 3DYRA 3PH9A 5GAND 1OKDA 4TR1A 2E7PA 2GVPA 2H6ZA 4TVEA 4Q5QA 3VI5A 3W8SA 1YF0A 1GNWA 1TU7A 2HZEA 4K7IA 2RLIA 4TXOA 4ZB6A 1IYIA 1ZZYA 1IYHA 2X99A 4QQ7A 2CVDA 3VWXA 4EF0A 1F3BA 1GTAA 3UJ1A 1OC8A 2ZNMA 4MF5A 2JSZA 5EL8A 3TRQA 2HRAA 1B4QA 4AGSA 1U88A 4JBBA 4PXOA 2I9HA 2HRNA 2VCZA 3ED3A 5CRDA 1K3OA 3FYGA 3ZL5A 5J9CA 4MABA 3F4SA 1GTIA 1M2DA 1PN0A 2WB9A 2R0CA 1S3DA 1K3YA 4KDXA 3HVNA 3DGQA 4LL1B 2V1MA 1V2AA 2H66A 2B5YA 3CXGA 1O85A 3P90A 5CRHA 2UV8G 2H0IA 2M72A 3WYWA 2C0FA 2DJ0A 1F2EA 3ERWA 2YJ7A 5GZZB 3UEMA 5ECKB 2REMA 2H0GA 1YQ1A 6GSVA 4P3YB 3KM6A 2OBIA 1XZOA 1YEWC 3F8UA 4KCEA 1ON4A 1PX7A 3HJMA 5ECMB 1JZRA 5COHA 1SVOA 1TOFA 3FKFA 3ZMKA 2YWIA 1FVJA 3TOTA 1PFOA 3ZIVA 1TRUA 2RUEA 4O5RA 4EO3A 4MZWA 1R7HA 1ZL9A 1K0DA 1QK8A 2N5AA 3DRNA 4KX4A 4E8HA 4TR4A 2H74A 3C7MA 2HSNA 3WGEA 3ZLPA 2WZSA 2CVBA 1C72A 1XOBA 2GZYA 1Y6EA 4D73B 2CT6A 4F9ZA 3J7Yb 2AHEA 2GGTA 3HVVA 3TRXA 4Z2RA 2X4AA 1I5GA 5IMAA 3KMOA 1GP1A 3GKNA 1DSBA 2AAWA 2OJLA 4MF6A 2XBIA 4ILFA 2R2JA 4AJ8A 1HYUA 1Z9HA 3W8JA 1MDKA 3CYNA 3GX0A 4V2MA 4O5UA 2PUKC 2VL9A 3M0FA 1I1IP 2CAQA 1WWJA 4GXZA 4IS0A 1MTCA 4XTSA 2GLRA 1ERUA 2M80A 2JL4A 4WR5A 4H86A 1U87A 1UA5A 2RM5A 1H75A 3KD0A 1YZXA 1BF5A 2V6KA 2CZ2A 3Q6OA 4L5OA 3EE2A 4NWYA 2K18A 2NVLA 1N8JA 3UBLA 4TXVA 2L6CA 2TIRA 2O5VA 4HUAA 1O6JA 6GSTA 5HFKA 5J5NA 5IM9A 2VCWA 1EEMA 1NW2A 4YH2A 5G5FA 4YQUA 5D8IA 4MZBA 4OMVA 1BX9A 8GSSA 1O8WA 4K0NA 1AC1A 3EMPA 2P5QA 3RPNA 3F6DA 1VRSD 2FWGA 3FY7A 3QFBC 3K8NA 3FZ9A 1K0OA 4O7HA 1EZKA 1EP7A 3L9UA 2YZHA 3EVIA 2DJ3A 2VIMA 2HRKB 1X9WB 2H75A 4RUVA 6GSXA 1THXA 4KA0A 4AKHA 3FK8A 3L4NA 1FHEA 3HJPA 4PHZC 2VL2C 3GKKA 4K2DA 2O36A 3Q74A 2WJUA 4CW9A 2GT6A 1PA3A 4I2TA 2FA8A 3KZQA 3TKPA 4N0ZA 2H8LA 2XC2A 2HQTA 1W89A 2PWJA 3Q18A 4K1FA 1T4YA 3VWUA 2TRXA 2IJYA 2EFEA 3A2XA 4OO5A 3HY2A 2YOIA 4GSTA 1A0RP 3IV4A 2GQKA 4ACSA 1PRXA 2PVOC 1CQHA 5G30A 3CTGA 2O89A 1O7UA 4G0KA 3F63A 4GTUA 2EIQA 3UVHA 1ST9A 4TR3A 4XCSA 2EIOA 2GSQA 3IR4A 2QC7A 4GSNA 4BL7B 2G2QA 1YEXA 3LORA 3TJKA 3RBTA 2CZ3A 3CSJA 1HNAA 2YNXA 5KN0A 3RHBA 4I5QA 1A2LA 5F05A 4EDYA 2YZUA 4JR6A 3TKSC 1UN2A 4WR4A 3H8QA 5G5EA 5A5KA 4HS1A 4DEJA 2WW2A 2LRTA 2XPDA 2GT5A 1ABAA 5KOWA 2LTKA 5ELGA 3C8EA 4KNDA 2EFDA 1ZOFA 1O73A 3D6IA 4GRFA 1GSDA 4J2FA 3VPTA 3GURA 5C04A 1UC7A 5A4VA 3MNGA 2VD0A 2H1AA 5IMCA 4BWSA 2GQMA 5G1LA 1EOHA 1KNGA 2DJJA 5KN1A 5ECQB 5D9WA 4FYCA 2C3QA 5IOWA 3C1SA 2BTOT 5HR0A 1TRWA 2L5OA 3E0UA 5F0GA 2EIRA 3U6VA 4GLTA 2GDRA 1I9DA 2H30A 2MBTA 2R6KA 1GNEA 2FA4A 2AB6A 4E8EA 2HFDA 3ZRDA 1X9MB 4TN8A 3BCKA 4MF7A 2HNLA 3GFKA 4HSCX 2FNOA 1K3LA 2WS2A 1A0FA 1R5PA 2K8SA 3HKRA 1A23A 3IHQA 4XS4A 1J08A 5ECLB 2KUCA 4HQZA 2WVXB 2HRFA 2MMNA 5IMVA 4JZQA 4GQCA 3KJYA 4DSSA 2DIZA 4BPYA 4WEYA 2XPEA 3G9BA 1JHBA 2N5BA 2C1YA 5DALB 5B7CA 3GX8A 4JU5A 5KN2A 2HT9A 5CAXA 1PD21 3ZREA 5DDLA 4MZCA 1DUGA 2GSRA 1ZYEA 5IO0A 3KP8A 3LJRA 2VOCA 2LQOA 2QSIA 2V6OA 2EC4A 3ZTLA 5ECHB 1XFLA 22GSA 4RI6A 1H4OA 1YJ6A 4F03A 2HYXA 1DE2A 1PN9A 1HQOA 4ZB7A 5CREA 3LEFA 2H0HA 1AW9A 2IWTA 2YJHA 5J41A 2AV4A 1ZYNA 2FCHA 2NBSA 1DE1A 3QCPA 4POMA 5A5HA 2I3YA 1ACVA 1SVLA 4POKA 2X8GA 1CQGA 5ECRB 5KEJA 1S4BP 5J4YA 3GUSA 4AI6A 4EDZA 5KN3A 1FOHA 4TR1B 2HSMA 3GTUB 4CHSA 3TRPA 1FW1A 4K6XA 5E4WA 4OCFA 5E59A 4KSOA 3C1RA 3FW2A 4N11A 9GSSA 3DD3A 2A4HA 1EV4A 4AKXB 1SK0A 5JCUA 1G6YA 2OT3A 2DSAA 2HSYA 4MJEA 3S9FA 3ZVJA 5G1KA 2QGVA 4PNFA 2BMXA 3F6FA 1LBKA 2L59A 5CO3A 6GSYA 2GQLA 3LGCA 4OO4A 4CDOA 3IOSA 4IQAA 1NHYA 1KBNA 3AY8A 4HDEA 4YQVA 4CY8A 4OFTA 1SL2B 2R5GA 3C71A 1GSYA 1BG1A 1J9BA 1V98A 1X5CA 5AIVA 5H5SA 2DMLA 1DBYA 2ON5A 3C73A 3D4TA 3MSZA 2DJKA 4IJ3A 3NIVA 4E68A 5LNKe 1R4WA 2ZCTA 4V1Ap 3HXSA 1AAZA 2E2MA 3O76A 2LJAA 1SK2A 2R4VA 4YKGA 5D9XA 2JSYA 3RFRC 1E2YA 5G31A 4G19A 1ERWA 4MPGA 2WULA 3ZVJD 2OADA 4KUNA 1QQ2A 4MJBA 4PQHA 3RDWA 2WW1A 4MA9A 1T7PB 1QMVA 3A2WA 4X0XA 1OE7A 2MMZA 4JE1A 1UVZA 4MLYA 2LEGA 2G0FA 1TXUA 5ENUA 1M0UA 5L71A 4FH8A 2LQQA 3BCIA 1GSFA 5D73A 2HSNB 3CSIA 2C8UA 2H01A 2IN3A 3GYKA 4NAXA 2B5XA 4POLA 2VL3A 2HSHA 5CRWA 1K0BA 4V1Ag 5ID2B 3ZMLA 1JFUA 3FR6A 2K6VA 4O92A 2F3MA 2K8VA 1EOGA 5FT3A 1SL0B 4HEA2 1LJRA 1Z6MA 5IPGA 4YAVA 2E2GA 5B6NA 1M3IA 3LW9A 4G0LA 1U3IA 3D5JA 5F07A 1S3RA 1B48A 2LNTA 1N2AA 1JLVA 3KXOA 3EURA 2DKHA 1PSQA 5A34B 3GN3A 2V32A 3TJFA 3GL3A 4G2EA 1T00A 3HYPA 5IQYA 5DCGA 2IPAA 4FYBA 5IOXA 1G6WA 1GULA 2VLVA 4XHMA 2XBQA 3LSZA 1ML6A 2CQ9A 1NHOA 3VPQA 2D2ZA 1G7OA 2JZTA 1F3AA 4WBRD 3IBHA 3HVXA 3KGKA 3PGTA 2R0GA 3FEUA 4PI0C 1Z6NA 2ES7A 4O32A 2K9FA 1BQ7A 2H6YA 1PL1A 3VI7A 2H1LA 4NMUA 3IAM2 5EY6A 1ZYPA 3BJ5A 1URMA 1X0RA 2O85A 3ERGA 3ME8A 2CX3A 3NOFA 1XWCA 2DLXA 1FOVA 2YCDA 1T1VA 7GSSA 3ME7A 2YV7A 4TKYA 3I43A 2L5LA 1AIUA 5AGYA 3WD6A 3EC3A 1GUHA 2DBCA 2FD3A 4TR0A 4IBPA 3HHVA 2C4JA 4HZ2A 1WE0A 4KE3A 3V1WA 4MPFA 4G10A 1QFNA 4WBJA 4IKHA 2KOKA 4MDCA 4ZL8A 4ULXA 3H79A 4ECCA 5FWGA 2RUFA 1GLQA 1JLWA 5ECIB 3WGXA 1V9WA 1Q4JA 1GH2A 5DQYA 3P7XA 4V2LA 3UOMA 2V41A 3L78A 3D22A 4HOJA 1GSQA 4FO5A 4ML1A 1Y1UA 1SENA 4ZB8A 4NV2A 4D73A 1TXXA 3SWLA 3IXRA 4BWQA 2Z9SA 4BVXB 5F06A 2DMMA 4Q5NA 3M1GA 2GTUA 2L4CA 4ZXGA 3KH7A 4DSRA 3LYPA 1ERTA 4GF0A 3HDCA 1GLPA 1ZMAA 3M9KA 1FG4A 2R0PA 3GV1A 1TK0B 2PERA 3GSSA 1TRSA 2RIIA 3EU4A 1QUWA 2OACA 17GSA 3PR8A 4XRAA 1FB0A 2FWEA 2ON7A 2KP1A 1O8XA 1T8EB 4Q5FA 1Z5YE 2MBSA 5G2ZA 4F2IA 3M3MA 3ERFA 3HD5A 2AUVA 4ECIA 1AQXA 3KTBA 5B8BA 4NHWA 2X8CA 1OYJA 4IGJA 3GHAA 2IFQB 2DIYA 2FHEA 2GSTA 2F51A 1XOAA 5IMDA 3DVWA 2VCQA 4EC0A 4ZIJA 1M2AA 1XIYA 2VLUA 4LMWA 10GSA 3DIEA 4ML6A 1SKRB 3GNJA 3LQ7A 12GSA 3GMFA 3GKXA 2LSTA 2HLSA 3N9JA 1SL1B 16GSA 1VF2A 2HRKA 1TW9A 3MDKA 3EMXA 4EL1A 2H6XA 4MK3A 4JR4A 1BAYA 4ISDA 5BMUA 2B3SA 2DC5A 3HCZA 3IK7A 4XRDA 1OVNA 2IIYA 3TUEA 1MD4A 4XS4B 20GSA 5CRGA 1EV9A 4RQXA 4HU7A 1BEDA 5A4WA 1WP0A 1K0MA 3UARA 4A5PA 1U3AA 3PINA 5IO2A 2OKAA 4DSSB 4EE0A 4KGIA 3KTLA 4KW6A 3QDNA 1JZOA 1PMTA 1USBA 1G7EA 4ZBBA 2PBJA 1TDIA 1GRXA 3BOAA 5C00A 5DVBA 2B6MA 3LXTA 2GS3A 3GH6A 2FUG2 4FXYP 4K2XA 5ECOB 4K7OA 4WXTA 1OC3A 2WFCA 2VAFA 1ILOA 3UAPA 3I9V2 4BA7A 1F6MC 1V58A 2IMEA 4GDFA 3EU3A 3SBCA 1YDKA 3UBKA 4HU9A 5A5HB 5D9VA 3FHKA 2PMTA 4YAPA 5GAPD 1E6BA 2DKIA 2HSMB 5DAKA 5GSSA 3FRCA 4IHUA 3CMIA 4X1UA 4I8BA 1WOUA 2B5EA 1PKWA 4JEDA 1ZYQB 3G7JA 2VCVA 1WJKA 3HZ8A 2YV9A 3CBUA 4Z2UA 4USSA 3TU3B 1PQNA 3M8NA 4ZB9A 2LS5A 3IHGA 3HA9A 3CTFA 2OE3A 1Z7RA 4J56E 2V2GA 3L0HA 1B9XC 3A3TA 3FZAA 3CSHA 1SKWB 3U5RE 1ERVA 1EWXA 3F4RA 3H93A 2HZFA 1TK5B 1JZDA 4TRXA 4AF2A 3DXBA 3KEBA 4OFMA 1SYRA 2FY6A 4N3ZA 3DMLA 3D4MA 2IMFA 1A24A 3HZ4A 4LLRA 3TKSE 2LJRA 1SD9A 1MDJA 3OR5A 1V40A 3TJBA 3H4KA 2HZEB 3FR3A 4TXOB 4K8MA 3LXZA 1M9AA 1Q98A 2FGXA 3VLNA 1NSWA 2N5FA 3RAZA 5IPHA 4GWRA 1QGVA 3IDVA 2PGTA 2A2SA 4BIKA 2AJQB 3UMAA 1B4PA 4HI7A 1AXDA 3HMJG 1YKCA 1EEJA 4PUAA 5DALA 4I6XA 2RM6A 5LD0A 1XW5A 4AJ6A 2HXKA 1Y25A 2H76A 2C80A 2GZZA 3GRXA 4PURA 2B7JA 3W6GA 1XBSA 1O81A 2IMIA 1YVLA 1XWGA 4EIQA 3A2VA 1JZWA 1MEKA 3P2AA 2E0QA 3TGZA 2QA1A 1PKZA 1WIKA 2LUSA 5D93A 1B9YC 1PGTA 2FWFA 3US3A 4MJAA 3MAKA 5HR2A 4L5LA 4ZBDA 1GWCA 3BBYA 3ZITA 3QOUA 5A1NA 3GTUA 3Q19A 3KP9A 3CRUA 1OC9A 1S3CA 2NPBA 3UL3A 1FB6A 2F9SA 1TJDA 1TI3A 1EP8A 1BG5A 1TTZA 5ECNB 1NM3A 1FAAA 1GUKA 5JWOB 4YQMA 1XG8A 4MH3A 3G7IA 4BVYA 4MMMA 2IMKA 3R3EA 1TI1A 2YWMA 2CAIA 1A2JA 3D0ZA 4ZILA 3P8WA 2LNSA 1SJZA 2VCTA 4PQIA 4KH7A 2WRTA 1W4VA 1THOA 1TKDB 1KEBA 1J0FA 1GUMA 4HZ4A 1TK8B 1VF4A 4QMKA 1TRVA 2JU5A 5B6MA 4IW9A 4NHZA 1MDIA 5JWRB 4AKIA 5ELAA 2C3TA 3UVTA 4IELA 1XVWA 4KB3A 3KCMA 4W66A 3CWGA 4NV5A 5H5RA 4ZL7A 4EXJA 2KP2A 3I69A 2VD1A 1XXUA 3HVSA 3TJJA 5EPFA 2WVZA 4AJ7A 2IMDA 1HNCA 5HFIA 2YPMA 3QAGA 5DCHA 3TJGA 2H1GA 5DJLA 3FZ4A 1PL2A 4EIPA 2R37A 4NXIA 5IIZA 3TB2A
chains in the Genus database with same CATH topology
4KDYA 4MCUA 4AKGA 4PUFC 1VGLA 2X49A 2NDOA 4IJIA 1AQVA 2HI7A 2O87A 3EYTA 4WF5A 2LJKA 2H1DA 2FWHA 4DSQA 4KCAA 4EKZA 2P31A 3A5IA 5AISA 4MH2A 1M9BA 4LA1A 3KIJA 3IC8A 2WCIA 4Z2TA 1XWAA 4FIWA 2VLTA 2GSSA 1K0AA 3I6AA 3TCOA 1HNBA 3IA1A 2CX4A 2YN1A 1XPVA 1SVMA 1U6TA 5AIXA 1YEPA 3VWVA 3FZ5A 4ICYA 2CV4A 2TRCP 4Q5RA 3E9JB 4QL9A 3QPMA 4F0CA 1SJIA 1GSSA 3APSA 5ID2A 1WRYA 4PNGA 1F9MA 6GSUA 1HD2A 4IVFA 1Z7PA 3EWLA 5A4UA 2H19A 19GSA 2QA2A 4ID0A 2KHPA 11GSA 3WT1A 2B1LA 4L0UA 2R3XA 2H73A 3A5WA 4QL7A 4X4JA 4GQFA 2B1KA 3F3QA 3EPTA 2X64A 1GTUA 3PPUA 4XIHA 5J9BA 5A34A 4K5SA 4G01A 2L4QA 3VURA 3ZYWA 5CNWA 13GSA 3L9VA 3FMWA 3N5OA 4MNNA 5F8BA 1MD3A 2MZCA 4GSSA 3L9SA 2VCXA 3MIXA 3RHCA 3IK9A 5B8AA 5CYYA 5CP1A 14GSA 2OE0A 4HQSA 1TU8A 2OBKA 3R2QA 1K0CA 1FVKA 2KLXA 2H72A 2IL3A 2C0EA 4I2UA 3WT2A 2P0GA 3ZIJA 2HE3A 1EGRA 4Z7XA 3KH9A 1A2MA 4ZBAA 6GSSA 4O5QA 4HJ2A 4POBA 3DVXA 2J9HA 5JCGA 3TKRA 2JZSA 2YWOA 2ZUPA 3QR6A 1ZGNA 2O8VB 4XS6A 2M46A 3KMNA 3F0IA 1XWBA 5HR3A 1YY7A 1N25A 1X5DA 2A2RA 2VM2A 3IPZA 4EUYA 2H71A 3NZNA 1S3AA 5IMFA 4ECJA 5DBQA 3MYDA 4N10A 1XCCA 5BMUB 2DJ2A 4KAEA 3F9UA 4OD7A 4MP4A 1SJ6A 18GSA 4J57E 2X8HA 3MWHA 3QD9A 4NPBA 3E3EA 3EINA 1ZCPA 3ISOA 4ECBA 3GKMA 2L57A 1R26A 2QKEA 4K7NA 2YWNA 3TOUA 4KDUA 3IRAA 1PX6A 1YF1A 1X5EA 3CRTA 1RK4A 5ABRA 2GZPA 2B7KA 5ECSA 3DWVA 4K9ZA 2VM1A 2LRNA 4FQUA 4BVXA 2XHFA 4PX1A 2PN8A 3RPPA 5ECPB 1VF1A 1A8LA 3DEXA 1T3BA 1SU9A 2VO4A 1LU4A 3VWWA 5LCZA 4G0IA 4L0WA 3O3TA 2OE1A 4PTSA 3IE3A 5HR1A 3ZZXA 1GL8A 1BJXA 1XW6A 4F0BA 5EVOA 5J47A 1TP9A 4N0VA 1F37A 5DAKB 1OKTA 4FYUA 1VF3A 3H1NA 2MMOA 2WGRA 3APOA 3J7Yk 3UIWA 3GSTA 3GL5A 2O7KA 1B8XA 2LRCA 3F3RA 3LYKA 2C0DA 3WGDA 2CA8A 4IP6A 5H5QA 4TOPA 3GIXA 5J4VA 2IFQA 4JRRA 4F82A 2JZRA 3JCML 2PVQA 4TW5A 2J23A 4K5RA 4YKFA 1Z3EA 2C0GA 3QFAC 5J4UA 1R5AA 2FLSA 4DVCA 1FO5A 1QXHA 2MYGA 2EFHA 3BD2A 1XWKA 1OAZA 3GA4A 2VL2A 2ALBA 4IP1A 5HQPA 2VKZG 2JADA 2YANA 3QAWA 1KTEA 4LMVA 1XW9A 3GH9A 1G0TA 4BL7A 5D9TA 4LL4B 2DJ1A 5DJMA 4KSMA 2P5RA 5KOXA 4WKWA 2F8AA 3VFIA 4ZL9A 4IN0A 2YP6A 2I4AA 3APQA 2WZ9A 4XS1A 3IC4A 4KF9A 4OFNA 1OE8A 1SK1A 3IAS2 2EFCA 4X43A 1T4ZA 3TDGA 1AQWA 4RQRA 3LG6A 1GTBA 2WDUA 4WF4A 5J3RA 5IMZA 1K0NA 3FR9A 3QAVA 4HJMA 2NTOA 1A8YA 2PU9C 2LV3A 5INYA 2A4VA 1BYEA 2I1UA 3QMXA 2JACA 5JCWA 1WMJA 2L6DA 4I97A 2F8FA 3ZFBA 1M99A 2OA7A 4L8EA 5FHIA 4G9HA 1GSUA 2C3NA 1XVQA 4OCEA 2H1BA 4IQ1A 6GSWA 3TKSA 5GSTA 3G7YA 1YKAA 3O6TA 5D96A 3VK9A 3TKQA 4CY6A 4GCIA 3F4TA 2VUPA 1WPIA 5A1NB 2CVKA 4WETA 3DKSA 2BJXA 1OC9B 5J40A 2I81A 3LWAA 1RW1A 4K0GA 4MJCA 4PQ1A 2LKUA 1GSEA 1EGOA 5AN1A 3HJOA 4RI7A 1SKSB 5JWQB 1M7TA 3M9JA 3D21A 4EVMA 1SYXA 4BVYB 3ZFLA 2A2PA 4PGTA 4N30A 1V57A 1SD8A 5HFGA 2H70A 2PPTA 5DQSA 4V2NA 1X9SB 2UZ8A 4OWYA 5BRTA 2AYTA 2MMAA 1M2BA 1AUCA 3LFLA 1RQMA 3DYRA 3PH9A 5GAND 1OKDA 4TR1A 2E7PA 2GVPA 2H6ZA 4TVEA 4Q5QA 3VI5A 3W8SA 1YF0A 1GNWA 1TU7A 2HZEA 4K7IA 2RLIA 4TXOA 4ZB6A 1IYIA 1ZZYA 1IYHA 2X99A 4QQ7A 2CVDA 3VWXA 4EF0A 1F3BA 1GTAA 3UJ1A 1OC8A 2ZNMA 4MF5A 2JSZA 5EL8A 3TRQA 2HRAA 1B4QA 4AGSA 1U88A 4JBBA 4PXOA 2I9HA 2HRNA 2VCZA 3ED3A 5CRDA 1K3OA 3FYGA 3ZL5A 5J9CA 4MABA 3F4SA 1GTIA 1M2DA 1PN0A 2WB9A 2R0CA 1S3DA 1K3YA 4KDXA 3DGQA 4LL1B 2V1MA 1V2AA 2H66A 2B5YA 3CXGA 1O85A 3P90A 5CRHA 2UV8G 2H0IA 2M72A 3WYWA 2C0FA 2DJ0A 1F2EA 3ERWA 2YJ7A 5GZZB 3UEMA 5ECKB 2REMA 2H0GA 1YQ1A 6GSVA 4P3YB 3KM6A 2OBIA 1XZOA 3F8UA 4KCEA 1ON4A 1PX7A 3HJMA 5ECMB 1JZRA 5COHA 1SVOA 1TOFA 3FKFA 3ZMKA 2YWIA 1FVJA 3TOTA 3ZIVA 1TRUA 2RUEA 4O5RA 4EO3A 4MZWA 1R7HA 1ZL9A 1K0DA 1QK8A 2N5AA 3DRNA 4KX4A 4E8HA 4TR4A 2H74A 3C7MA 2HSNA 3WGEA 3ZLPA 2CVBA 1C72A 1XOBA 2GZYA 1Y6EA 4D73B 2CT6A 4F9ZA 3J7Yb 2AHEA 2GGTA 3HVVA 3TRXA 4Z2RA 2X4AA 1I5GA 5IMAA 3KMOA 1GP1A 3GKNA 1DSBA 2AAWA 2OJLA 4MF6A 2XBIA 4ILFA 2R2JA 4AJ8A 1HYUA 1Z9HA 3W8JA 1MDKA 3CYNA 3GX0A 4V2MA 4O5UA 2PUKC 2VL9A 3M0FA 2CAQA 1WWJA 4GXZA 4IS0A 1MTCA 4XTSA 2GLRA 1ERUA 2M80A 2JL4A 4WR5A 4H86A 1U87A 1UA5A 2RM5A 1H75A 3KD0A 1YZXA 1BF5A 2V6KA 2CZ2A 3Q6OA 4L5OA 3EE2A 4NWYA 2K18A 2NVLA 1N8JA 3UBLA 4TXVA 2L6CA 2TIRA 2O5VA 4HUAA 1O6JA 6GSTA 5HFKA 5J5NA 5IM9A 2VCWA 1EEMA 1NW2A 4YH2A 5G5FA 4YQUA 5D8IA 4MZBA 4OMVA 1BX9A 8GSSA 1O8WA 4K0NA 1AC1A 3EMPA 2P5QA 3RPNA 3F6DA 1VRSD 2FWGA 3FY7A 3QFBC 3K8NA 3FZ9A 1K0OA 4O7HA 1EZKA 1EP7A 3L9UA 2YZHA 3EVIA 2DJ3A 2VIMA 2HRKB 1X9WB 2H75A 4RUVA 6GSXA 1THXA 4KA0A 4AKHA 3FK8A 3L4NA 1FHEA 3HJPA 2VL2C 3GKKA 4K2DA 3Q74A 2WJUA 4CW9A 2GT6A 1PA3A 4I2TA 2FA8A 3KZQA 3TKPA 4N0ZA 2H8LA 2XC2A 2HQTA 1W89A 2PWJA 3Q18A 4K1FA 1T4YA 3VWUA 2TRXA 2IJYA 2EFEA 3A2XA 4OO5A 3HY2A 2YOIA 4GSTA 1A0RP 3IV4A 2GQKA 4ACSA 1PRXA 2PVOC 1CQHA 5G30A 3CTGA 2O89A 1O7UA 4G0KA 3F63A 4GTUA 2EIQA 3UVHA 1ST9A 4TR3A 4XCSA 2EIOA 2GSQA 3IR4A 2QC7A 4GSNA 4BL7B 2G2QA 1YEXA 3LORA 3TJKA 3RBTA 2CZ3A 3CSJA 1HNAA 2YNXA 5KN0A 3RHBA 4I5QA 1A2LA 5F05A 4EDYA 2YZUA 4JR6A 3TKSC 1UN2A 4WR4A 3H8QA 5G5EA 5A5KA 4HS1A 4DEJA 2LRTA 2XPDA 2GT5A 1ABAA 5KOWA 2LTKA 5ELGA 3C8EA 4KNDA 2EFDA 1ZOFA 1O73A 3D6IA 4GRFA 1GSDA 4J2FA 3VPTA 3GURA 5C04A 1UC7A 5A4VA 3MNGA 2VD0A 2H1AA 5IMCA 4BWSA 2GQMA 5G1LA 1EOHA 1KNGA 2DJJA 5KN1A 5ECQB 5D9WA 4FYCA 2C3QA 5IOWA 3C1SA 2BTOT 5HR0A 1TRWA 2L5OA 3E0UA 5F0GA 2EIRA 3U6VA 4GLTA 2GDRA 1I9DA 2H30A 2MBTA 2R6KA 1GNEA 2FA4A 2AB6A 4E8EA 2HFDA 3ZRDA 1X9MB 4TN8A 3BCKA 4MF7A 2HNLA 3GFKA 2FNOA 1K3LA 2WS2A 1A0FA 1R5PA 2K8SA 3HKRA 1A23A 3IHQA 4XS4A 1J08A 5ECLB 2KUCA 4HQZA 2HRFA 2MMNA 5IMVA 4JZQA 4GQCA 3KJYA 4DSSA 2DIZA 4BPYA 4WEYA 2XPEA 3G9BA 1JHBA 2N5BA 2C1YA 5DALB 5B7CA 3GX8A 4JU5A 5KN2A 2HT9A 5CAXA 1PD21 3ZREA 5DDLA 4MZCA 1DUGA 2GSRA 1ZYEA 5IO0A 3KP8A 3LJRA 2VOCA 2LQOA 2QSIA 2V6OA 2EC4A 3ZTLA 5ECHB 1XFLA 22GSA 4RI6A 1H4OA 1YJ6A 4F03A 2HYXA 1DE2A 1PN9A 1HQOA 4ZB7A 5CREA 3LEFA 2H0HA 1AW9A 2IWTA 2YJHA 5J41A 2AV4A 1ZYNA 2FCHA 2NBSA 1DE1A 3QCPA 4POMA 5A5HA 2I3YA 1ACVA 1SVLA 4POKA 2X8GA 1CQGA 5ECRB 5KEJA 5J4YA 3GUSA 4AI6A 4EDZA 5KN3A 1FOHA 4TR1B 2HSMA 3GTUB 4CHSA 3TRPA 1FW1A 4K6XA 5E4WA 4OCFA 5E59A 4KSOA 3C1RA 3FW2A 4N11A 9GSSA 3DD3A 2A4HA 1EV4A 4AKXB 1SK0A 5JCUA 1G6YA 2OT3A 2DSAA 2HSYA 4MJEA 3S9FA 3ZVJA 5G1KA 2QGVA 4PNFA 2BMXA 3F6FA 1LBKA 2L59A 5CO3A 6GSYA 2GQLA 3LGCA 4OO4A 4CDOA 3IOSA 4IQAA 1NHYA 1KBNA 3AY8A 4HDEA 4YQVA 4CY8A 4OFTA 1SL2B 2R5GA 3C71A 1GSYA 1BG1A 1J9BA 1V98A 1X5CA 5AIVA 5H5SA 2DMLA 1DBYA 2ON5A 3C73A 3D4TA 3MSZA 2DJKA 4IJ3A 3NIVA 4E68A 5LNKe 1R4WA 2ZCTA 4V1Ap 3HXSA 1AAZA 2E2MA 3O76A 2LJAA 1SK2A 2R4VA 4YKGA 5D9XA 2JSYA 1E2YA 5G31A 4G19A 1ERWA 4MPGA 2WULA 3ZVJD 2OADA 4KUNA 1QQ2A 4MJBA 4PQHA 3RDWA 4MA9A 1T7PB 1QMVA 3A2WA 4X0XA 1OE7A 2MMZA 4JE1A 1UVZA 4MLYA 2LEGA 2G0FA 1TXUA 5ENUA 1M0UA 5L71A 4FH8A 2LQQA 3BCIA 1GSFA 5D73A 2HSNB 3CSIA 2C8UA 2H01A 2IN3A 3GYKA 4NAXA 2B5XA 4POLA 2VL3A 2HSHA 5CRWA 1K0BA 4V1Ag 5ID2B 3ZMLA 1JFUA 3FR6A 2K6VA 4O92A 2F3MA 2K8VA 1EOGA 5FT3A 1SL0B 4HEA2 1LJRA 1Z6MA 5IPGA 4YAVA 2E2GA 5B6NA 3LW9A 4G0LA 1U3IA 3D5JA 5F07A 1B48A 2LNTA 1N2AA 1JLVA 3KXOA 3EURA 2DKHA 1PSQA 5A34B 3GN3A 2V32A 3TJFA 3GL3A 4G2EA 1T00A 3HYPA 5IQYA 5DCGA 2IPAA 4FYBA 5IOXA 1G6WA 1GULA 2VLVA 4XHMA 2XBQA 3LSZA 1ML6A 2CQ9A 1NHOA 3VPQA 2D2ZA 1G7OA 2JZTA 1F3AA 4WBRD 3IBHA 3HVXA 3KGKA 3PGTA 2R0GA 3FEUA 1Z6NA 2ES7A 4O32A 2K9FA 1BQ7A 2H6YA 1PL1A 3VI7A 2H1LA 4NMUA 3IAM2 5EY6A 1ZYPA 3BJ5A 1URMA 1X0RA 3ME8A 2O85A 3ERGA 2CX3A 3NOFA 1XWCA 2DLXA 1FOVA 2YCDA 1T1VA 7GSSA 3ME7A 2YV7A 4TKYA 3I43A 2L5LA 1AIUA 5AGYA 3WD6A 3EC3A 1GUHA 2DBCA 2FD3A 4TR0A 4IBPA 3HHVA 2C4JA 4HZ2A 1WE0A 4KE3A 3V1WA 4MPFA 4G10A 1QFNA 4WBJA 4IKHA 2KOKA 4MDCA 4ZL8A 4ULXA 3H79A 4ECCA 5FWGA 2RUFA 1GLQA 1JLWA 5ECIB 3WGXA 1V9WA 1Q4JA 1GH2A 5DQYA 3P7XA 4V2LA 3UOMA 2V41A 3L78A 3D22A 4HOJA 1GSQA 4FO5A 4ML1A 1Y1UA 1SENA 4ZB8A 4NV2A 4D73A 1TXXA 3SWLA 3IXRA 4BWQA 2Z9SA 4BVXB 5F06A 2DMMA 4Q5NA 3M1GA 2GTUA 2L4CA 4ZXGA 3KH7A 4DSRA 3LYPA 1ERTA 4GF0A 3HDCA 1GLPA 1ZMAA 3M9KA 1FG4A 2R0PA 3GV1A 1TK0B 2PERA 3GSSA 1TRSA 2RIIA 3EU4A 1QUWA 2OACA 17GSA 3PR8A 4XRAA 1FB0A 2FWEA 2ON7A 2KP1A 1O8XA 1T8EB 4Q5FA 1Z5YE 2MBSA 5G2ZA 4F2IA 3M3MA 3ERFA 3HD5A 2AUVA 4ECIA 1AQXA 3KTBA 5B8BA 4NHWA 2X8CA 1OYJA 4IGJA 3GHAA 2IFQB 2DIYA 2FHEA 2GSTA 2F51A 1XOAA 5IMDA 3DVWA 2VCQA 4EC0A 4ZIJA 1M2AA 1XIYA 2VLUA 4LMWA 10GSA 3DIEA 4ML6A 1SKRB 3GNJA 3LQ7A 12GSA 3GMFA 3GKXA 2LSTA 2HLSA 3N9JA 1SL1B 16GSA 1VF2A 2HRKA 1TW9A 3MDKA 3EMXA 4EL1A 2H6XA 4MK3A 4JR4A 1BAYA 4ISDA 5BMUA 2B3SA 2DC5A 3HCZA 3IK7A 4XRDA 1OVNA 2IIYA 3TUEA 1MD4A 4XS4B 20GSA 5CRGA 1EV9A 4RQXA 4HU7A 1BEDA 5A4WA 1WP0A 1K0MA 3UARA 4A5PA 1U3AA 3PINA 5IO2A 2OKAA 4DSSB 4EE0A 4KGIA 3KTLA 4KW6A 3QDNA 1JZOA 1PMTA 1USBA 1G7EA 4ZBBA 2PBJA 1TDIA 1GRXA 3BOAA 5C00A 5DVBA 2B6MA 3LXTA 2GS3A 3GH6A 2FUG2 4K2XA 5ECOB 4K7OA 4WXTA 1OC3A 2WFCA 2VAFA 1ILOA 3UAPA 3I9V2 4BA7A 1F6MC 1V58A 2IMEA 4GDFA 3EU3A 3SBCA 1YDKA 3UBKA 4HU9A 5A5HB 5D9VA 3FHKA 2PMTA 4YAPA 5GAPD 1E6BA 2DKIA 2HSMB 5DAKA 5GSSA 3FRCA 4IHUA 3CMIA 4X1UA 4I8BA 1WOUA 2B5EA 1PKWA 4JEDA 1ZYQB 3G7JA 2VCVA 1WJKA 3HZ8A 2YV9A 3CBUA 4Z2UA 4USSA 3TU3B 1PQNA 3M8NA 4ZB9A 2LS5A 3IHGA 3HA9A 3CTFA 2OE3A 1Z7RA 4J56E 2V2GA 3L0HA 1B9XC 3A3TA 3FZAA 3CSHA 1SKWB 3U5RE 1ERVA 1EWXA 3F4RA 3H93A 2HZFA 1TK5B 1JZDA 4TRXA 4AF2A 3DXBA 3KEBA 4OFMA 1SYRA 2FY6A 4N3ZA 3DMLA 3D4MA 2IMFA 1A24A 3HZ4A 4LLRA 3TKSE 2LJRA 1SD9A 1MDJA 3OR5A 1V40A 3TJBA 3H4KA 2HZEB 3FR3A 4TXOB 4K8MA 3LXZA 1M9AA 1Q98A 2FGXA 3VLNA 1NSWA 2N5FA 3RAZA 5IPHA 4GWRA 1QGVA 3IDVA 2PGTA 2A2SA 2AJQB 3UMAA 1B4PA 4HI7A 1AXDA 3HMJG 1YKCA 1EEJA 4PUAA 5DALA 4I6XA 2RM6A 5LD0A 1XW5A 4AJ6A 2HXKA 1Y25A 2H76A 2C80A 2GZZA 3GRXA 4PURA 2B7JA 3W6GA 1XBSA 1O81A 2IMIA 1YVLA 1XWGA 4EIQA 3A2VA 1JZWA 1MEKA 3P2AA 2E0QA 3TGZA 2QA1A 1PKZA 1WIKA 2LUSA 5D93A 1B9YC 1PGTA 2FWFA 3US3A 4MJAA 3MAKA 5HR2A 4L5LA 4ZBDA 1GWCA 3BBYA 3ZITA 3QOUA 5A1NA 3GTUA 3Q19A 3KP9A 3CRUA 1OC9A 1S3CA 2NPBA 3UL3A 1FB6A 2F9SA 1TJDA 1TI3A 1EP8A 1BG5A 1TTZA 5ECNB 1NM3A 1FAAA 1GUKA 5JWOB 4YQMA 4MH3A 3G7IA 4BVYA 4MMMA 2IMKA 3R3EA 1TI1A 2YWMA 2CAIA 1A2JA 3D0ZA 4ZILA 3P8WA 2LNSA 1SJZA 2VCTA 4PQIA 4KH7A 2WRTA 1W4VA 1THOA 1TKDB 1KEBA 1J0FA 1GUMA 4HZ4A 1TK8B 1VF4A 4QMKA 1TRVA 2JU5A 5B6MA 4IW9A 4NHZA 1MDIA 5JWRB 4AKIA 5ELAA 2C3TA 3UVTA 4IELA 1XVWA 4KB3A 3KCMA 4W66A 3CWGA 4NV5A 5H5RA 4ZL7A 4EXJA 2KP2A 3I69A 2VD1A 1XXUA 3HVSA 3TJJA 5EPFA 4AJ7A 2IMDA 1HNCA 5HFIA 2YPMA 3QAGA 5DCHA 3TJGA 2H1GA 5DJLA 3FZ4A 1PL2A 4EIPA 2R37A 4NXIA 5IIZA 3TB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDY A;  4MCU A;  4PUF C;  1VGL A;  2NDO A;  4IJI A;  1AQV A;  2HI7 A;  2O87 A;  3EYT A;  4WF5 A;  2LJK A;  2H1D A;  2FWH A;  4DSQ A;  4KCA A;  4EKZ A;  2P31 A;  5AIS A;  4MH2 A;  1M9B A;  4LA1 A;  3KIJ A;  3IC8 A;  2WCI A;  1XWA A;  4FIW A;  2VLT A;  2GSS A;  1K0A A;  3I6A A;  3TCO A;  1HNB A;  3IA1 A;  2CX4 A;  2YN1 A;  1XPV A;  1U6T A;  5AIX A;  1YEP A;  3VWV A;  3FZ5 A;  2CV4 A;  2TRC P;  4Q5R A;  3E9J B;  4QL9 A;  3QPM A;  4F0C A;  1SJI A;  1GSS A;  3APS A;  5ID2 A;  1WRY A;  4PNG A;  1F9M A;  6GSU A;  1HD2 A;  4IVF A;  1Z7P A;  3EWL A;  5A4U A;  2H19 A;  19GS A;  4ID0 A;  2KHP A;  11GS A;  3WT1 A;  2B1L A;  4L0U A;  2R3X A;  2H73 A;  3A5W A;  4QL7 A;  4GQF A;  2B1K A;  3F3Q A;  2X64 A;  1GTU A;  3PPU A;  4XIH A;  5J9B A;  2L4Q A;  3VUR A;  3ZYW A;  5CNW A;  13GS A;  3L9V A;  3N5O A;  5F8B A;  1MD3 A;  2MZC A;  4GSS A;  3L9S A;  2VCX A;  3RHC A;  3IK9 A;  5B8A A;  5CYY A;  5CP1 A;  14GS A;  2OE0 A;  4HQS A;  1TU8 A;  2OBK A;  3R2Q A;  1K0C A;  1FVK A;  2KLX A;  2H72 A;  2IL3 A;  2C0E A;  4I2U A;  3WT2 A;  2P0G A;  3ZIJ A;  2HE3 A;  1EGR A;  4Z7X A;  3KH9 A;  1A2M A;  4ZBA A;  6GSS A;  4HJ2 A;  4POB A;  3DVX A;  2J9H A;  5JCG A;  3TKR A;  2JZS A;  2YWO A;  2ZUP A;  3QR6 A;  1ZGN A;  2O8V B;  4XS6 A;  2M46 A;  3KMN A;  3F0I A;  1XWB A;  5HR3 A;  1YY7 A;  1X5D A;  2A2R A;  2VM2 A;  3IPZ A;  4EUY A;  2H71 A;  3NZN A;  1S3A A;  5IMF A;  4ECJ A;  5DBQ A;  4N10 A;  1XCC A;  2DJ2 A;  4KAE A;  3F9U A;  4OD7 A;  4MP4 A;  1SJ6 A;  18GS A;  4J57 E;  2X8H A;  3MWH A;  3QD9 A;  4NPB A;  3E3E A;  3EIN A;  1ZCP A;  3ISO A;  4ECB A;  3GKM A;  2L57 A;  1R26 A;  2QKE A;  4K7N A;  2YWN A;  3TOU A;  4KDU A;  3IRA A;  1PX6 A;  1YF1 A;  1X5E A;  3CRT A;  1RK4 A;  5ABR A;  2GZP A;  2B7K A;  5ECS A;  3DWV A;  4K9Z A;  2VM1 A;  2LRN A;  4FQU A;  4BVX A;  2XHF A;  4PX1 A;  2PN8 A;  3RPP A;  5ECP B;  1VF1 A;  1A8L A;  3DEX A;  1T3B A;  1SU9 A;  2VO4 A;  1LU4 A;  3VWW A;  5LCZ A;  4G0I A;  4L0W A;  3O3T A;  2OE1 A;  4PTS A;  3IE3 A;  5HR1 A;  3ZZX A;  1GL8 A;  1BJX A;  1XW6 A;  4F0B A;  5EVO A;  1TP9 A;  4N0V A;  1F37 A;  5DAK B;  1OKT A;  4FYU A;  1VF3 A;  3H1N A;  2MMO A;  2WGR A;  3APO A;  3J7Y k;  3UIW A;  3GST A;  3GL5 A;  2O7K A;  1B8X A;  2LRC A;  3F3R A;  3LYK A;  2C0D A;  3WGD A;  2CA8 A;  4IP6 A;  5H5Q A;  4TOP A;  3GIX A;  2IFQ A;  4JRR A;  4F82 A;  2JZR A;  3JCM L;  2PVQ A;  4TW5 A;  2J23 A;  1Z3E A;  2C0G A;  3QFA C;  5J4U A;  1R5A A;  2FLS A;  4DVC A;  1FO5 A;  1QXH A;  2MYG A;  3BD2 A;  1XWK A;  1OAZ A;  3GA4 A;  2VL2 A;  2ALB A;  4IP1 A;  5HQP A;  2JAD A;  2YAN A;  3QAW A;  1KTE A;  4LMV A;  1XW9 A;  3GH9 A;  1G0T A;  4BL7 A;  5D9T A;  4LL4 B;  2DJ1 A;  5DJM A;  4KSM A;  2P5R A;  4WKW A;  2F8A A;  3VFI A;  4ZL9 A;  4IN0 A;  2YP6 A;  2I4A A;  3APQ A;  2WZ9 A;  4XS1 A;  3IC4 A;  4KF9 A;  4OFN A;  1OE8 A;  1SK1 A;  3IAS 2;  4X43 A;  1T4Z A;  3TDG A;  1AQW A;  4RQR A;  3LG6 A;  1GTB A;  2WDU A;  4WF4 A;  5J3R A;  5IMZ A;  1K0N A;  3FR9 A;  3QAV A;  4HJM A;  2NTO A;  1A8Y A;  2PU9 C;  2LV3 A;  5INY A;  2A4V A;  1BYE A;  2I1U A;  3QMX A;  2JAC A;  5JCW A;  1WMJ A;  2L6D A;  4I97 A;  2F8F A;  3ZFB A;  1M99 A;  2OA7 A;  4L8E A;  5FHI A;  4G9H A;  1GSU A;  2C3N A;  1XVQ A;  4OCE A;  2H1B A;  4IQ1 A;  6GSW A;  3TKS A;  5GST A;  3G7Y A;  1YKA A;  3O6T A;  5D96 A;  3VK9 A;  3TKQ A;  4GCI A;  3F4T A;  2VUP A;  1WPI A;  2CVK A;  4WET A;  3DKS A;  2BJX A;  1OC9 B;  2I81 A;  3LWA A;  1RW1 A;  4K0G A;  4MJC A;  4PQ1 A;  2LKU A;  1GSE A;  1EGO A;  5AN1 A;  3HJO A;  4RI7 A;  1SKS B;  5JWQ B;  1M7T A;  3M9J A;  3D21 A;  4EVM A;  1SYX A;  4BVY B;  3ZFL A;  4PGT A;  4N30 A;  1V57 A;  1SD8 A;  5HFG A;  2H70 A;  2PPT A;  5DQS A;  4V2N A;  1X9S B;  2UZ8 A;  4OWY A;  2AYT A;  2MMA A;  1M2B A;  1AUC A;  3LFL A;  1RQM A;  3DYR A;  3PH9 A;  5GAN D;  1OKD A;  4TR1 A;  2E7P A;  2GVP A;  2H6Z A;  4TVE A;  4Q5Q A;  3VI5 A;  3W8S A;  1YF0 A;  1GNW A;  1TU7 A;  2HZE A;  4K7I A;  2RLI A;  4TXO A;  4ZB6 A;  1IYI A;  1ZZY A;  1IYH A;  2X99 A;  4QQ7 A;  2CVD A;  3VWX A;  4EF0 A;  1F3B A;  1GTA A;  3UJ1 A;  1OC8 A;  2ZNM A;  4MF5 A;  2JSZ A;  5EL8 A;  3TRQ A;  2HRA A;  1B4Q A;  4AGS A;  1U88 A;  4JBB A;  4PXO A;  2I9H A;  2HRN A;  2VCZ A;  3ED3 A;  5CRD A;  1K3O A;  3FYG A;  3ZL5 A;  5J9C A;  4MAB A;  3F4S A;  1GTI A;  1M2D A;  2WB9 A;  1S3D A;  1K3Y A;  4KDX A;  3DGQ A;  4LL1 B;  2V1M A;  1V2A A;  2H66 A;  2B5Y A;  3CXG A;  1O85 A;  3P90 A;  5CRH A;  2H0I A;  2M72 A;  3WYW A;  2C0F A;  2DJ0 A;  1F2E A;  3ERW A;  2YJ7 A;  5GZZ B;  3UEM A;  5ECK B;  2REM A;  2H0G A;  1YQ1 A;  6GSV A;  4P3Y B;  3KM6 A;  2OBI A;  1XZO A;  3F8U A;  4KCE A;  1ON4 A;  1PX7 A;  3HJM A;  5ECM B;  1JZR A;  5COH A;  1TOF A;  3FKF A;  3ZMK A;  2YWI A;  1FVJ A;  3TOT A;  3ZIV A;  1TRU A;  2RUE A;  4O5R A;  4EO3 A;  4MZW A;  1R7H A;  1ZL9 A;  1K0D A;  1QK8 A;  2N5A A;  3DRN A;  4KX4 A;  4E8H A;  4TR4 A;  2H74 A;  3C7M A;  3WGE A;  3ZLP A;  2CVB A;  1C72 A;  1XOB A;  2GZY A;  1Y6E A;  4D73 B;  2CT6 A;  4F9Z A;  3J7Y b;  2AHE A;  2GGT A;  3HVV A;  3TRX A;  1I5G A;  5IMA A;  3KMO A;  1GP1 A;  3GKN A;  1DSB A;  2AAW A;  2OJL A;  4MF6 A;  2XBI A;  4ILF A;  2R2J A;  4AJ8 A;  1HYU A;  1Z9H A;  3W8J A;  1MDK A;  3CYN A;  3GX0 A;  4V2M A;  2PUK C;  2VL9 A;  3M0F A;  2CAQ A;  1WWJ A;  4GXZ A;  4IS0 A;  1MTC A;  4XTS A;  2GLR A;  1ERU A;  2M80 A;  2JL4 A;  4WR5 A;  4H86 A;  1U87 A;  1UA5 A;  2RM5 A;  1H75 A;  3KD0 A;  1YZX A;  2V6K A;  2CZ2 A;  3Q6O A;  4L5O A;  3EE2 A;  4NWY A;  2K18 A;  2NVL A;  1N8J A;  3UBL A;  4TXV A;  2L6C A;  2TIR A;  4HUA A;  1O6J A;  6GST A;  5HFK A;  5J5N A;  5IM9 A;  2VCW A;  1EEM A;  1NW2 A;  4YH2 A;  5G5F A;  4YQU A;  5D8I A;  4MZB A;  4OMV A;  1BX9 A;  8GSS A;  1O8W A;  4K0N A;  1AC1 A;  3EMP A;  2P5Q A;  3RPN A;  3F6D A;  1VRS D;  2FWG A;  3FY7 A;  3QFB C;  3K8N A;  3FZ9 A;  1K0O A;  4O7H A;  1EZK A;  1EP7 A;  3L9U A;  2YZH A;  3EVI A;  2DJ3 A;  2VIM A;  2HRK B;  1X9W B;  2H75 A;  4RUV A;  6GSX A;  1THX A;  4KA0 A;  3FK8 A;  3L4N A;  1FHE A;  3HJP A;  2VL2 C;  3GKK A;  4K2D A;  3Q74 A;  2WJU A;  4CW9 A;  2GT6 A;  1PA3 A;  4I2T A;  2FA8 A;  3KZQ A;  3TKP A;  4N0Z A;  2H8L A;  2XC2 A;  2HQT A;  1W89 A;  2PWJ A;  3Q18 A;  4K1F A;  1T4Y A;  3VWU A;  2TRX A;  2IJY A;  3A2X A;  4OO5 A;  3HY2 A;  2YOI A;  4GST A;  1A0R P;  3IV4 A;  2GQK A;  4ACS A;  1PRX A;  2PVO C;  1CQH A;  5G30 A;  3CTG A;  2O89 A;  1O7U A;  4G0K A;  3F63 A;  4GTU A;  2EIQ A;  3UVH A;  1ST9 A;  4TR3 A;  4XCS A;  2EIO A;  2GSQ A;  3IR4 A;  2QC7 A;  4GSN A;  4BL7 B;  2G2Q A;  1YEX A;  3LOR A;  3TJK A;  3RBT A;  2CZ3 A;  3CSJ A;  1HNA A;  2YNX A;  5KN0 A;  3RHB A;  4I5Q A;  1A2L A;  5F05 A;  4EDY A;  2YZU A;  4JR6 A;  3TKS C;  1UN2 A;  4WR4 A;  3H8Q A;  5G5E A;  5A5K A;  4HS1 A;  4DEJ A;  2LRT A;  2XPD A;  2GT5 A;  1ABA A;  2LTK A;  5ELG A;  3C8E A;  4KND A;  1ZOF A;  1O73 A;  3D6I A;  4GRF A;  1GSD A;  4J2F A;  3VPT A;  3GUR A;  5C04 A;  1UC7 A;  5A4V A;  3MNG A;  2VD0 A;  2H1A A;  5IMC A;  4BWS A;  2GQM A;  5G1L A;  1EOH A;  1KNG A;  2DJJ A;  5KN1 A;  5ECQ B;  5D9W A;  4FYC A;  2C3Q A;  5IOW A;  3C1S A;  2BTO T;  5HR0 A;  1TRW A;  2L5O A;  3E0U A;  5F0G A;  2EIR A;  3U6V A;  4GLT A;  2GDR A;  1I9D A;  2H30 A;  2MBT A;  2R6K A;  1GNE A;  2FA4 A;  2AB6 A;  4E8E A;  2HFD A;  3ZRD A;  1X9M B;  4TN8 A;  3BCK A;  4MF7 A;  2HNL A;  3GFK A;  2FNO A;  1K3L A;  2WS2 A;  1A0F A;  1R5P A;  2K8S A;  3HKR A;  1A23 A;  3IHQ A;  4XS4 A;  1J08 A;  5ECL B;  2KUC A;  4HQZ A;  2HRF A;  2MMN A;  5IMV A;  4JZQ A;  4GQC A;  3KJY A;  4DSS A;  2DIZ A;  4BPY A;  4WEY A;  2XPE A;  3G9B A;  1JHB A;  2N5B A;  2C1Y A;  5DAL B;  5B7C A;  3GX8 A;  4JU5 A;  5KN2 A;  2HT9 A;  5CAX A;  1PD2 1;  3ZRE A;  5DDL A;  4MZC A;  1DUG A;  2GSR A;  1ZYE A;  5IO0 A;  3KP8 A;  3LJR A;  2VOC A;  2LQO A;  2QSI A;  2V6O A;  2EC4 A;  3ZTL A;  5ECH B;  1XFL A;  22GS A;  4RI6 A;  1H4O A;  1YJ6 A;  4F03 A;  2HYX A;  1DE2 A;  1PN9 A;  1HQO A;  5CRE A;  3LEF A;  2H0H A;  1AW9 A;  2IWT A;  2YJH A;  5J41 A;  2AV4 A;  2FCH A;  2NBS A;  1DE1 A;  3QCP A;  4POM A;  2I3Y A;  1ACV A;  4POK A;  2X8G A;  1CQG A;  5ECR B;  5KEJ A;  3GUS A;  4EDZ A;  5KN3 A;  4TR1 B;  2HSM A;  3GTU B;  4CHS A;  3TRP A;  1FW1 A;  4K6X A;  5E4W A;  4OCF A;  5E59 A;  4KSO A;  3C1R A;  3FW2 A;  4N11 A;  9GSS A;  3DD3 A;  1EV4 A;  1SK0 A;  5JCU A;  1G6Y A;  2DSA A;  2HSY A;  4MJE A;  3S9F A;  3ZVJ A;  5G1K A;  2QGV A;  4PNF A;  2BMX A;  3F6F A;  1LBK A;  2L59 A;  5CO3 A;  6GSY A;  2GQL A;  3LGC A;  4OO4 A;  4CDO A;  3IOS A;  4IQA A;  1NHY A;  1KBN A;  3AY8 A;  4HDE A;  4YQV A;  4OFT A;  1SL2 B;  2R5G A;  3C71 A;  1GSY A;  1J9B A;  1V98 A;  1X5C A;  5AIV A;  5H5S A;  2DML A;  1DBY A;  2ON5 A;  3C73 A;  3D4T A;  3MSZ A;  2DJK A;  4IJ3 A;  3NIV A;  5LNK e;  1R4W A;  2ZCT A;  4V1A p;  3HXS A;  1AAZ A;  2E2M A;  3O76 A;  2LJA A;  1SK2 A;  2R4V A;  5D9X A;  2JSY A;  1E2Y A;  5G31 A;  4G19 A;  1ERW A;  4MPG A;  2WUL A;  3ZVJ D;  2OAD A;  4KUN A;  1QQ2 A;  4MJB A;  4PQH A;  3RDW A;  4MA9 A;  1T7P B;  1QMV A;  3A2W A;  4X0X A;  1OE7 A;  2MMZ A;  4JE1 A;  1UVZ A;  4MLY A;  2LEG A;  2G0F A;  5ENU A;  1M0U A;  5L71 A;  4FH8 A;  2LQQ A;  3BCI A;  1GSF A;  5D73 A;  2HSN B;  3CSI A;  2C8U A;  2H01 A;  2IN3 A;  3GYK A;  4NAX A;  2B5X A;  4POL A;  2VL3 A;  2HSH A;  5CRW A;  1K0B A;  4V1A g;  5ID2 B;  3ZML A;  1JFU A;  3FR6 A;  2K6V A;  4O92 A;  2F3M A;  2K8V A;  1EOG A;  5FT3 A;  1SL0 B;  4HEA 2;  1LJR A;  1Z6M A;  5IPG A;  4YAV A;  2E2G A;  5B6N A;  4G0L A;  1U3I A;  3D5J A;  5F07 A;  1B48 A;  2LNT A;  1N2A A;  1JLV A;  3KXO A;  3EUR A;  1PSQ A;  3GN3 A;  2V32 A;  3TJF A;  3GL3 A;  4G2E A;  1T00 A;  3HYP A;  5IQY A;  5DCG A;  2IPA A;  4FYB A;  5IOX A;  1G6W A;  1GUL A;  2VLV A;  4XHM A;  2XBQ A;  3LSZ A;  1ML6 A;  2CQ9 A;  1NHO A;  3VPQ A;  2D2Z A;  1G7O A;  2JZT A;  1F3A A;  4WBR D;  3IBH A;  3HVX A;  3KGK A;  3PGT A;  3FEU A;  1Z6N A;  2ES7 A;  4O32 A;  2K9F A;  1BQ7 A;  2H6Y A;  1PL1 A;  3VI7 A;  4NMU A;  3IAM 2;  5EY6 A;  3BJ5 A;  1URM A;  1X0R A;  3ME8 A;  2O85 A;  3ERG A;  2CX3 A;  3NOF A;  1XWC A;  2DLX A;  1FOV A;  2YCD A;  1T1V A;  7GSS A;  3ME7 A;  2YV7 A;  4TKY A;  3I43 A;  2L5L A;  1AIU A;  5AGY A;  3WD6 A;  3EC3 A;  1GUH A;  2DBC A;  2FD3 A;  4TR0 A;  4IBP A;  3HHV A;  2C4J A;  4HZ2 A;  1WE0 A;  4KE3 A;  3V1W A;  4MPF A;  4G10 A;  1QFN A;  4WBJ A;  4IKH A;  2KOK A;  4MDC A;  4ZL8 A;  4ULX A;  3H79 A;  4ECC A;  5FWG A;  2RUF A;  1GLQ A;  1JLW A;  5ECI B;  3WGX A;  1V9W A;  1Q4J A;  1GH2 A;  5DQY A;  3P7X A;  4V2L A;  3UOM A;  2V41 A;  3L78 A;  3D22 A;  4HOJ A;  1GSQ A;  4FO5 A;  4ML1 A;  1SEN A;  4ZB8 A;  4NV2 A;  4D73 A;  1TXX A;  3SWL A;  3IXR A;  4BWQ A;  2Z9S A;  4BVX B;  5F06 A;  2DMM A;  4Q5N A;  3M1G A;  2GTU A;  2L4C A;  4ZXG A;  3KH7 A;  4DSR A;  3LYP A;  1ERT A;  4GF0 A;  3HDC A;  1GLP A;  1ZMA A;  3M9K A;  1FG4 A;  3GV1 A;  1TK0 B;  2PER A;  3GSS A;  1TRS A;  2RII A;  3EU4 A;  1QUW A;  2OAC A;  17GS A;  3PR8 A;  4XRA A;  1FB0 A;  2FWE A;  2ON7 A;  2KP1 A;  1O8X A;  1T8E B;  4Q5F A;  1Z5Y E;  2MBS A;  5G2Z A;  4F2I A;  3M3M A;  3ERF A;  3HD5 A;  2AUV A;  4ECI A;  1AQX A;  3KTB A;  5B8B A;  4NHW A;  2X8C A;  1OYJ A;  4IGJ A;  3GHA A;  2IFQ B;  2DIY A;  2FHE A;  2GST A;  2F51 A;  1XOA A;  5IMD A;  3DVW A;  2VCQ A;  4EC0 A;  4ZIJ A;  1M2A A;  1XIY A;  2VLU A;  4LMW A;  10GS A;  3DIE A;  4ML6 A;  1SKR B;  3GNJ A;  3LQ7 A;  12GS A;  3GMF A;  3GKX A;  2LST A;  2HLS A;  3N9J A;  1SL1 B;  16GS A;  1VF2 A;  2HRK A;  1TW9 A;  3MDK A;  3EMX A;  4EL1 A;  2H6X A;  4MK3 A;  4JR4 A;  1BAY A;  4ISD A;  5BMU A;  2B3S A;  2DC5 A;  3HCZ A;  3IK7 A;  4XRD A;  1OVN A;  2IIY A;  3TUE A;  1MD4 A;  4XS4 B;  20GS A;  5CRG A;  1EV9 A;  4RQX A;  4HU7 A;  1BED A;  5A4W A;  1WP0 A;  1K0M A;  3UAR A;  1U3A A;  3PIN A;  5IO2 A;  2OKA A;  4DSS B;  4EE0 A;  4KGI A;  3KTL A;  4KW6 A;  3QDN A;  1JZO A;  1PMT A;  1USB A;  1G7E A;  4ZBB A;  2PBJ A;  1TDI A;  1GRX A;  3BOA A;  5C00 A;  5DVB A;  2B6M A;  3LXT A;  2GS3 A;  3GH6 A;  2FUG 2;  5ECO B;  4K7O A;  4WXT A;  1OC3 A;  2WFC A;  2VAF A;  1ILO A;  3UAP A;  3I9V 2;  4BA7 A;  1F6M C;  1V58 A;  2IME A;  3EU3 A;  3SBC A;  1YDK A;  3UBK A;  4HU9 A;  5D9V A;  3FHK A;  2PMT A;  4YAP A;  5GAP D;  1E6B A;  2HSM B;  5DAK A;  5GSS A;  3FRC A;  4IHU A;  3CMI A;  4X1U A;  4I8B A;  1WOU A;  2B5E A;  1PKW A;  4JED A;  1ZYQ B;  3G7J A;  2VCV A;  1WJK A;  3HZ8 A;  2YV9 A;  3CBU A;  4USS A;  1PQN A;  3M8N A;  4ZB9 A;  2LS5 A;  3HA9 A;  3CTF A;  2OE3 A;  1Z7R A;  4J56 E;  2V2G A;  3L0H A;  1B9X C;  3A3T A;  3FZA A;  3CSH A;  1SKW B;  3U5R E;  1ERV A;  1EWX A;  3F4R A;  3H93 A;  2HZF A;  1TK5 B;  1JZD A;  4TRX A;  4AF2 A;  3DXB A;  3KEB A;  4OFM A;  1SYR A;  2FY6 A;  3DML A;  3D4M A;  2IMF A;  1A24 A;  3HZ4 A;  4LLR A;  3TKS E;  2LJR A;  1SD9 A;  1MDJ A;  3OR5 A;  1V40 A;  3TJB A;  3H4K A;  2HZE B;  3FR3 A;  4TXO B;  4K8M A;  3LXZ A;  1M9A A;  1Q98 A;  2FGX A;  3VLN A;  1NSW A;  2N5F A;  3RAZ A;  5IPH A;  4GWR A;  1QGV A;  3IDV A;  2PGT A;  2A2S A;  2AJQ B;  3UMA A;  1B4P A;  4HI7 A;  1AXD A;  1YKC A;  1EEJ A;  4PUA A;  5DAL A;  4I6X A;  2RM6 A;  5LD0 A;  1XW5 A;  4AJ6 A;  2HXK A;  1Y25 A;  2H76 A;  2C80 A;  2GZZ A;  3GRX A;  4PUR A;  2B7J A;  3W6G A;  1XBS A;  1O81 A;  2IMI A;  1XWG A;  3A2V A;  1JZW A;  1MEK A;  3P2A A;  2E0Q A;  3TGZ A;  1PKZ A;  1WIK A;  2LUS A;  5D93 A;  1B9Y C;  1PGT A;  2FWF A;  3US3 A;  4MJA A;  3MAK A;  5HR2 A;  4L5L A;  4ZBD A;  1GWC A;  3BBY A;  3ZIT A;  3QOU A;  3GTU A;  3Q19 A;  3KP9 A;  3CRU A;  1OC9 A;  1S3C A;  2NPB A;  3UL3 A;  1FB6 A;  2F9S A;  1TJD A;  1TI3 A;  1EP8 A;  1BG5 A;  1TTZ A;  5ECN B;  1NM3 A;  1FAA A;  1GUK A;  5JWO B;  4YQM A;  4MH3 A;  3G7I A;  4BVY A;  4MMM A;  2IMK A;  3R3E A;  1TI1 A;  2YWM A;  2CAI A;  1A2J A;  3D0Z A;  4ZIL A;  3P8W A;  2LNS A;  1SJZ A;  2VCT A;  4PQI A;  4KH7 A;  2WRT A;  1W4V A;  1THO A;  1TKD B;  1KEB A;  1J0F A;  1GUM A;  4HZ4 A;  1TK8 B;  1VF4 A;  1TRV A;  2JU5 A;  5B6M A;  4IW9 A;  4NHZ A;  1MDI A;  5JWR B;  5ELA A;  2C3T A;  3UVT A;  4IEL A;  1XVW A;  4KB3 A;  3KCM A;  4NV5 A;  5H5R A;  4ZL7 A;  4EXJ A;  2KP2 A;  3I69 A;  2VD1 A;  1XXU A;  3HVS A;  3TJJ A;  5EPF A;  4AJ7 A;  2IMD A;  1HNC A;  5HFI A;  2YPM A;  3QAG A;  5DCH A;  3TJG A;  2H1G A;  5DJL A;  3FZ4 A;  1PL2 A;  2R37 A;  4NXI A;  5IIZ A;  3TB2 A; 
#chains in the Genus database with same CATH topology
 4KDY A;  4MCU A;  4AKG A;  4PUF C;  1VGL A;  2X49 A;  2NDO A;  4IJI A;  1AQV A;  2HI7 A;  2O87 A;  3EYT A;  4WF5 A;  2LJK A;  2H1D A;  2FWH A;  4DSQ A;  4KCA A;  4EKZ A;  2P31 A;  3A5I A;  5AIS A;  4MH2 A;  1M9B A;  4LA1 A;  3KIJ A;  3IC8 A;  2WCI A;  4Z2T A;  1XWA A;  4FIW A;  2VLT A;  2GSS A;  1K0A A;  3I6A A;  3TCO A;  1HNB A;  3IA1 A;  2CX4 A;  2YN1 A;  1XPV A;  1SVM A;  1U6T A;  5AIX A;  1YEP A;  3VWV A;  3FZ5 A;  4ICY A;  2CV4 A;  2TRC P;  4Q5R A;  3E9J B;  4QL9 A;  3QPM A;  4F0C A;  2O3E A;  1SJI A;  1GSS A;  3APS A;  5ID2 A;  1WRY A;  4PNG A;  1F9M A;  6GSU A;  1HD2 A;  4IVF A;  1Z7P A;  3EWL A;  5A4U A;  2H19 A;  19GS A;  2QA2 A;  4ID0 A;  2KHP A;  11GS A;  3WT1 A;  2B1L A;  4L0U A;  2R3X A;  2H73 A;  3A5W A;  4QL7 A;  4X4J A;  4GQF A;  2B1K A;  3F3Q A;  3EPT A;  2X64 A;  1GTU A;  3PPU A;  4XIH A;  5J9B A;  5A34 A;  4K5S A;  4G01 A;  2L4Q A;  3VUR A;  3ZYW A;  2WVY A;  5CNW A;  13GS A;  3L9V A;  3FMW A;  3N5O A;  4MNN A;  5F8B A;  1MD3 A;  2MZC A;  4GSS A;  3L9S A;  2VCX A;  3MIX A;  3RHC A;  3IK9 A;  5B8A A;  5CYY A;  5CP1 A;  14GS A;  2OE0 A;  4HQS A;  1TU8 A;  2OBK A;  3R2Q A;  1K0C A;  1FVK A;  2KLX A;  2H72 A;  2IL3 A;  2C0E A;  4I2U A;  3WT2 A;  2P0G A;  3ZIJ A;  2HE3 A;  1EGR A;  4Z7X A;  3KH9 A;  1A2M A;  4ZBA A;  6GSS A;  4O5Q A;  4HJ2 A;  4POB A;  3DVX A;  2J9H A;  5JCG A;  3TKR A;  2JZS A;  2YWO A;  2ZUP A;  3QR6 A;  1ZGN A;  2O8V B;  4XS6 A;  2M46 A;  3KMN A;  3F0I A;  1XWB A;  5HR3 A;  1YY7 A;  1N25 A;  1X5D A;  2A2R A;  2VM2 A;  3IPZ A;  4EUY A;  2H71 A;  3NZN A;  1S3A A;  5IMF A;  4ECJ A;  5DBQ A;  3MYD A;  4N10 A;  1XCC A;  5BMU B;  2DJ2 A;  4KAE A;  3F9U A;  4OD7 A;  4MP4 A;  1SJ6 A;  18GS A;  2WW0 A;  4J57 E;  2X8H A;  3MWH A;  3QD9 A;  4NPB A;  3E3E A;  3EIN A;  1ZCP A;  3ISO A;  4ECB A;  3GKM A;  2L57 A;  1R26 A;  2QKE A;  4K7N A;  3CHX C;  2YWN A;  3TOU A;  4KDU A;  3IRA A;  1PX6 A;  1YF1 A;  1X5E A;  3CRT A;  1RK4 A;  5ABR A;  2GZP A;  2B7K A;  5ECS A;  3DWV A;  4K9Z A;  2VM1 A;  2LRN A;  4FQU A;  4BVX A;  2XHF A;  4PX1 A;  2PN8 A;  3RPP A;  5ECP B;  1VF1 A;  1A8L A;  3DEX A;  1T3B A;  1SU9 A;  2VO4 A;  1LU4 A;  3VWW A;  5LCZ A;  4G0I A;  4L0W A;  3O3T A;  2OE1 A;  4PTS A;  3IE3 A;  5HR1 A;  3ZZX A;  1GL8 A;  1BJX A;  1M3J A;  1XW6 A;  4F0B A;  5EVO A;  5J47 A;  1TP9 A;  4N0V A;  1F37 A;  5DAK B;  1OKT A;  4FYU A;  1VF3 A;  3H1N A;  2MMO A;  2WGR A;  3APO A;  3J7Y k;  3UIW A;  3RGB C;  3GST A;  3GL5 A;  2O7K A;  1B8X A;  2LRC A;  3F3R A;  3LYK A;  2C0D A;  3WGD A;  2CA8 A;  4IP6 A;  5H5Q A;  4TOP A;  3GIX A;  4PI2 C;  5J4V A;  2IFQ A;  4JRR A;  4F82 A;  2JZR A;  3JCM L;  2PVQ A;  4TW5 A;  2J23 A;  4K5R A;  4YKF A;  3CQF A;  1Z3E A;  2C0G A;  3QFA C;  5J4U A;  1R5A A;  2FLS A;  4DVC A;  1FO5 A;  1QXH A;  2MYG A;  2EFH A;  3BD2 A;  1XWK A;  1OAZ A;  3GA4 A;  2VL2 A;  2ALB A;  4IP1 A;  5HQP A;  2VKZ G;  2JAD A;  2YAN A;  3QAW A;  1KTE A;  4LMV A;  1XW9 A;  3GH9 A;  1G0T A;  4BL7 A;  5D9T A;  4LL4 B;  2DJ1 A;  5DJM A;  4KSM A;  2P5R A;  5KOX A;  4WKW A;  2F8A A;  3VFI A;  4ZL9 A;  4IN0 A;  2YP6 A;  2I4A A;  3APQ A;  2WZ9 A;  4XS1 A;  3IC4 A;  4KF9 A;  4OFN A;  1OE8 A;  1SK1 A;  3IAS 2;  2EFC A;  4X43 A;  1T4Z A;  3TDG A;  1AQW A;  4RQR A;  3LG6 A;  2WW3 A;  1GTB A;  2WDU A;  4WF4 A;  5J3R A;  5IMZ A;  1K0N A;  3FR9 A;  3QAV A;  4HJM A;  2NTO A;  1A8Y A;  2PU9 C;  2LV3 A;  5INY A;  2A4V A;  1BYE A;  2I1U A;  3QMX A;  2JAC A;  5JCW A;  1WMJ A;  2L6D A;  4I97 A;  2F8F A;  3ZFB A;  1M99 A;  2OA7 A;  4L8E A;  5FHI A;  4G9H A;  1GSU A;  2C3N A;  1XVQ A;  4OCE A;  2H1B A;  4IQ1 A;  6GSW A;  3TKS A;  5GST A;  3G7Y A;  1YKA A;  3O6T A;  5D96 A;  3VK9 A;  3TKQ A;  4CY6 A;  4GCI A;  3F4T A;  2VUP A;  1WPI A;  5A1N B;  2WVX A;  2CVK A;  4WET A;  3DKS A;  2BJX A;  1OC9 B;  5J40 A;  2I81 A;  3LWA A;  1RW1 A;  4K0G A;  4MJC A;  4PQ1 A;  2LKU A;  1GSE A;  1EGO A;  5AN1 A;  3HJO A;  4RI7 A;  1SKS B;  5JWQ B;  1M7T A;  3M9J A;  3D21 A;  4EVM A;  1SYX A;  4BVY B;  3ZFL A;  2A2P A;  4PGT A;  4N30 A;  1V57 A;  1SD8 A;  5HFG A;  2H70 A;  2PPT A;  5DQS A;  4V2N A;  1X9S B;  2UZ8 A;  4OWY A;  5BRT A;  2AYT A;  2MMA A;  1M2B A;  1AUC A;  3LFL A;  1RQM A;  3DYR A;  3PH9 A;  5GAN D;  1OKD A;  4TR1 A;  2E7P A;  2GVP A;  2H6Z A;  4TVE A;  4Q5Q A;  3VI5 A;  3W8S A;  1YF0 A;  1GNW A;  1TU7 A;  2HZE A;  4K7I A;  2RLI A;  4TXO A;  4ZB6 A;  1IYI A;  1ZZY A;  1IYH A;  2X99 A;  4QQ7 A;  2CVD A;  3VWX A;  4EF0 A;  1F3B A;  1GTA A;  3UJ1 A;  1OC8 A;  2ZNM A;  4MF5 A;  2JSZ A;  5EL8 A;  3TRQ A;  2HRA A;  1B4Q A;  4AGS A;  1U88 A;  4JBB A;  4PXO A;  2I9H A;  2HRN A;  2VCZ A;  3ED3 A;  5CRD A;  1K3O A;  3FYG A;  3ZL5 A;  5J9C A;  4MAB A;  3F4S A;  1GTI A;  1M2D A;  1PN0 A;  2WB9 A;  2R0C A;  1S3D A;  1K3Y A;  4KDX A;  3HVN A;  3DGQ A;  4LL1 B;  2V1M A;  1V2A A;  2H66 A;  2B5Y A;  3CXG A;  1O85 A;  3P90 A;  5CRH A;  2UV8 G;  2H0I A;  2M72 A;  3WYW A;  2C0F A;  2DJ0 A;  1F2E A;  3ERW A;  2YJ7 A;  5GZZ B;  3UEM A;  5ECK B;  2REM A;  2H0G A;  1YQ1 A;  6GSV A;  4P3Y B;  3KM6 A;  2OBI A;  1XZO A;  1YEW C;  3F8U A;  4KCE A;  1ON4 A;  1PX7 A;  3HJM A;  5ECM B;  1JZR A;  5COH A;  1SVO A;  1TOF A;  3FKF A;  3ZMK A;  2YWI A;  1FVJ A;  3TOT A;  1PFO A;  3ZIV A;  1TRU A;  2RUE A;  4O5R A;  4EO3 A;  4MZW A;  1R7H A;  1ZL9 A;  1K0D A;  1QK8 A;  2N5A A;  3DRN A;  4KX4 A;  4E8H A;  4TR4 A;  2H74 A;  3C7M A;  2HSN A;  3WGE A;  3ZLP A;  2WZS A;  2CVB A;  1C72 A;  1XOB A;  2GZY A;  1Y6E A;  4D73 B;  2CT6 A;  4F9Z A;  3J7Y b;  2AHE A;  2GGT A;  3HVV A;  3TRX A;  4Z2R A;  2X4A A;  1I5G A;  5IMA A;  3KMO A;  1GP1 A;  3GKN A;  1DSB A;  2AAW A;  2OJL A;  4MF6 A;  2XBI A;  4ILF A;  2R2J A;  4AJ8 A;  1HYU A;  1Z9H A;  3W8J A;  1MDK A;  3CYN A;  3GX0 A;  4V2M A;  4O5U A;  2PUK C;  2VL9 A;  3M0F A;  1I1I P;  2CAQ A;  1WWJ A;  4GXZ A;  4IS0 A;  1MTC A;  4XTS A;  2GLR A;  1ERU A;  2M80 A;  2JL4 A;  4WR5 A;  4H86 A;  1U87 A;  1UA5 A;  2RM5 A;  1H75 A;  3KD0 A;  1YZX A;  1BF5 A;  2V6K A;  2CZ2 A;  3Q6O A;  4L5O A;  3EE2 A;  4NWY A;  2K18 A;  2NVL A;  1N8J A;  3UBL A;  4TXV A;  2L6C A;  2TIR A;  2O5V A;  4HUA A;  1O6J A;  6GST A;  5HFK A;  5J5N A;  5IM9 A;  2VCW A;  1EEM A;  1NW2 A;  4YH2 A;  5G5F A;  4YQU A;  5D8I A;  4MZB A;  4OMV A;  1BX9 A;  8GSS A;  1O8W A;  4K0N A;  1AC1 A;  3EMP A;  2P5Q A;  3RPN A;  3F6D A;  1VRS D;  2FWG A;  3FY7 A;  3QFB C;  3K8N A;  3FZ9 A;  1K0O A;  4O7H A;  1EZK A;  1EP7 A;  3L9U A;  2YZH A;  3EVI A;  2DJ3 A;  2VIM A;  2HRK B;  1X9W B;  2H75 A;  4RUV A;  6GSX A;  1THX A;  4KA0 A;  4AKH A;  3FK8 A;  3L4N A;  1FHE A;  3HJP A;  4PHZ C;  2VL2 C;  3GKK A;  4K2D A;  2O36 A;  3Q74 A;  2WJU A;  4CW9 A;  2GT6 A;  1PA3 A;  4I2T A;  2FA8 A;  3KZQ A;  3TKP A;  4N0Z A;  2H8L A;  2XC2 A;  2HQT A;  1W89 A;  2PWJ A;  3Q18 A;  4K1F A;  1T4Y A;  3VWU A;  2TRX A;  2IJY A;  2EFE A;  3A2X A;  4OO5 A;  3HY2 A;  2YOI A;  4GST A;  1A0R P;  3IV4 A;  2GQK A;  4ACS A;  1PRX A;  2PVO C;  1CQH A;  5G30 A;  3CTG A;  2O89 A;  1O7U A;  4G0K A;  3F63 A;  4GTU A;  2EIQ A;  3UVH A;  1ST9 A;  4TR3 A;  4XCS A;  2EIO A;  2GSQ A;  3IR4 A;  2QC7 A;  4GSN A;  4BL7 B;  2G2Q A;  1YEX A;  3LOR A;  3TJK A;  3RBT A;  2CZ3 A;  3CSJ A;  1HNA A;  2YNX A;  5KN0 A;  3RHB A;  4I5Q A;  1A2L A;  5F05 A;  4EDY A;  2YZU A;  4JR6 A;  3TKS C;  1UN2 A;  4WR4 A;  3H8Q A;  5G5E A;  5A5K A;  4HS1 A;  4DEJ A;  2WW2 A;  2LRT A;  2XPD A;  2GT5 A;  1ABA A;  5KOW A;  2LTK A;  5ELG A;  3C8E A;  4KND A;  2EFD A;  1ZOF A;  1O73 A;  3D6I A;  4GRF A;  1GSD A;  4J2F A;  3VPT A;  3GUR A;  5C04 A;  1UC7 A;  5A4V A;  3MNG A;  2VD0 A;  2H1A A;  5IMC A;  4BWS A;  2GQM A;  5G1L A;  1EOH A;  1KNG A;  2DJJ A;  5KN1 A;  5ECQ B;  5D9W A;  4FYC A;  2C3Q A;  5IOW A;  3C1S A;  2BTO T;  5HR0 A;  1TRW A;  2L5O A;  3E0U A;  5F0G A;  2EIR A;  3U6V A;  4GLT A;  2GDR A;  1I9D A;  2H30 A;  2MBT A;  2R6K A;  1GNE A;  2FA4 A;  2AB6 A;  4E8E A;  2HFD A;  3ZRD A;  1X9M B;  4TN8 A;  3BCK A;  4MF7 A;  2HNL A;  3GFK A;  4HSC X;  2FNO A;  1K3L A;  2WS2 A;  1A0F A;  1R5P A;  2K8S A;  3HKR A;  1A23 A;  3IHQ A;  4XS4 A;  1J08 A;  5ECL B;  2KUC A;  4HQZ A;  2WVX B;  2HRF A;  2MMN A;  5IMV A;  4JZQ A;  4GQC A;  3KJY A;  4DSS A;  2DIZ A;  4BPY A;  4WEY A;  2XPE A;  3G9B A;  1JHB A;  2N5B A;  2C1Y A;  5DAL B;  5B7C A;  3GX8 A;  4JU5 A;  5KN2 A;  2HT9 A;  5CAX A;  1PD2 1;  3ZRE A;  5DDL A;  4MZC A;  1DUG A;  2GSR A;  1ZYE A;  5IO0 A;  3KP8 A;  3LJR A;  2VOC A;  2LQO A;  2QSI A;  2V6O A;  2EC4 A;  3ZTL A;  5ECH B;  1XFL A;  22GS A;  4RI6 A;  1H4O A;  1YJ6 A;  4F03 A;  2HYX A;  1DE2 A;  1PN9 A;  1HQO A;  4ZB7 A;  5CRE A;  3LEF A;  2H0H A;  1AW9 A;  2IWT A;  2YJH A;  5J41 A;  2AV4 A;  1ZYN A;  2FCH A;  2NBS A;  1DE1 A;  3QCP A;  4POM A;  5A5H A;  2I3Y A;  1ACV A;  1SVL A;  4POK A;  2X8G A;  1CQG A;  5ECR B;  5KEJ A;  1S4B P;  5J4Y A;  3GUS A;  4AI6 A;  4EDZ A;  5KN3 A;  1FOH A;  4TR1 B;  2HSM A;  3GTU B;  4CHS A;  3TRP A;  1FW1 A;  4K6X A;  5E4W A;  4OCF A;  5E59 A;  4KSO A;  3C1R A;  3FW2 A;  4N11 A;  9GSS A;  3DD3 A;  2A4H A;  1EV4 A;  4AKX B;  1SK0 A;  5JCU A;  1G6Y A;  2OT3 A;  2DSA A;  2HSY A;  4MJE A;  3S9F A;  3ZVJ A;  5G1K A;  2QGV A;  4PNF A;  2BMX A;  3F6F A;  1LBK A;  2L59 A;  5CO3 A;  6GSY A;  2GQL A;  3LGC A;  4OO4 A;  4CDO A;  3IOS A;  4IQA A;  1NHY A;  1KBN A;  3AY8 A;  4HDE A;  4YQV A;  4CY8 A;  4OFT A;  1SL2 B;  2R5G A;  3C71 A;  1GSY A;  1BG1 A;  1J9B A;  1V98 A;  1X5C A;  5AIV A;  5H5S A;  2DML A;  1DBY A;  2ON5 A;  3C73 A;  3D4T A;  3MSZ A;  2DJK A;  4IJ3 A;  3NIV A;  4E68 A;  5LNK e;  1R4W A;  2ZCT A;  4V1A p;  3HXS A;  1AAZ A;  2E2M A;  3O76 A;  2LJA A;  1SK2 A;  2R4V A;  4YKG A;  5D9X A;  2JSY A;  3RFR C;  1E2Y A;  5G31 A;  4G19 A;  1ERW A;  4MPG A;  2WUL A;  3ZVJ D;  2OAD A;  4KUN A;  1QQ2 A;  4MJB A;  4PQH A;  3RDW A;  2WW1 A;  4MA9 A;  1T7P B;  1QMV A;  3A2W A;  4X0X A;  1OE7 A;  2MMZ A;  4JE1 A;  1UVZ A;  4MLY A;  2LEG A;  2G0F A;  1TXU A;  5ENU A;  1M0U A;  5L71 A;  4FH8 A;  2LQQ A;  3BCI A;  1GSF A;  5D73 A;  2HSN B;  3CSI A;  2C8U A;  2H01 A;  2IN3 A;  3GYK A;  4NAX A;  2B5X A;  4POL A;  2VL3 A;  2HSH A;  5CRW A;  1K0B A;  4V1A g;  5ID2 B;  3ZML A;  1JFU A;  3FR6 A;  2K6V A;  4O92 A;  2F3M A;  2K8V A;  1EOG A;  5FT3 A;  1SL0 B;  4HEA 2;  1LJR A;  1Z6M A;  5IPG A;  4YAV A;  2E2G A;  5B6N A;  1M3I A;  3LW9 A;  4G0L A;  1U3I A;  3D5J A;  5F07 A;  1S3R A;  1B48 A;  2LNT A;  1N2A A;  1JLV A;  3KXO A;  3EUR A;  2DKH A;  1PSQ A;  5A34 B;  3GN3 A;  2V32 A;  3TJF A;  3GL3 A;  4G2E A;  1T00 A;  3HYP A;  5IQY A;  5DCG A;  2IPA A;  4FYB A;  5IOX A;  1G6W A;  1GUL A;  2VLV A;  4XHM A;  2XBQ A;  3LSZ A;  1ML6 A;  2CQ9 A;  1NHO A;  3VPQ A;  2D2Z A;  1G7O A;  2JZT A;  1F3A A;  4WBR D;  3IBH A;  3HVX A;  3KGK A;  3PGT A;  2R0G A;  3FEU A;  4PI0 C;  1Z6N A;  2ES7 A;  4O32 A;  2K9F A;  1BQ7 A;  2H6Y A;  1PL1 A;  3VI7 A;  2H1L A;  4NMU A;  3IAM 2;  5EY6 A;  1ZYP A;  3BJ5 A;  1URM A;  1X0R A;  2O85 A;  3ERG A;  3ME8 A;  2CX3 A;  3NOF A;  1XWC A;  2DLX A;  1FOV A;  2YCD A;  1T1V A;  7GSS A;  3ME7 A;  2YV7 A;  4TKY A;  3I43 A;  2L5L A;  1AIU A;  5AGY A;  3WD6 A;  3EC3 A;  1GUH A;  2DBC A;  2FD3 A;  4TR0 A;  4IBP A;  3HHV A;  2C4J A;  4HZ2 A;  1WE0 A;  4KE3 A;  3V1W A;  4MPF A;  4G10 A;  1QFN A;  4WBJ A;  4IKH A;  2KOK A;  4MDC A;  4ZL8 A;  4ULX A;  3H79 A;  4ECC A;  5FWG A;  2RUF A;  1GLQ A;  1JLW A;  5ECI B;  3WGX A;  1V9W A;  1Q4J A;  1GH2 A;  5DQY A;  3P7X A;  4V2L A;  3UOM A;  2V41 A;  3L78 A;  3D22 A;  4HOJ A;  1GSQ A;  4FO5 A;  4ML1 A;  1Y1U A;  1SEN A;  4ZB8 A;  4NV2 A;  4D73 A;  1TXX A;  3SWL A;  3IXR A;  4BWQ A;  2Z9S A;  4BVX B;  5F06 A;  2DMM A;  4Q5N A;  3M1G A;  2GTU A;  2L4C A;  4ZXG A;  3KH7 A;  4DSR A;  3LYP A;  1ERT A;  4GF0 A;  3HDC A;  1GLP A;  1ZMA A;  3M9K A;  1FG4 A;  2R0P A;  3GV1 A;  1TK0 B;  2PER A;  3GSS A;  1TRS A;  2RII A;  3EU4 A;  1QUW A;  2OAC A;  17GS A;  3PR8 A;  4XRA A;  1FB0 A;  2FWE A;  2ON7 A;  2KP1 A;  1O8X A;  1T8E B;  4Q5F A;  1Z5Y E;  2MBS A;  5G2Z A;  4F2I A;  3M3M A;  3ERF A;  3HD5 A;  2AUV A;  4ECI A;  1AQX A;  3KTB A;  5B8B A;  4NHW A;  2X8C A;  1OYJ A;  4IGJ A;  3GHA A;  2IFQ B;  2DIY A;  2FHE A;  2GST A;  2F51 A;  1XOA A;  5IMD A;  3DVW A;  2VCQ A;  4EC0 A;  4ZIJ A;  1M2A A;  1XIY A;  2VLU A;  4LMW A;  10GS A;  3DIE A;  4ML6 A;  1SKR B;  3GNJ A;  3LQ7 A;  12GS A;  3GMF A;  3GKX A;  2LST A;  2HLS A;  3N9J A;  1SL1 B;  16GS A;  1VF2 A;  2HRK A;  1TW9 A;  3MDK A;  3EMX A;  4EL1 A;  2H6X A;  4MK3 A;  4JR4 A;  1BAY A;  4ISD A;  5BMU A;  2B3S A;  2DC5 A;  3HCZ A;  3IK7 A;  4XRD A;  1OVN A;  2IIY A;  3TUE A;  1MD4 A;  4XS4 B;  20GS A;  5CRG A;  1EV9 A;  4RQX A;  4HU7 A;  1BED A;  5A4W A;  1WP0 A;  1K0M A;  3UAR A;  4A5P A;  1U3A A;  3PIN A;  5IO2 A;  2OKA A;  4DSS B;  4EE0 A;  4KGI A;  3KTL A;  4KW6 A;  3QDN A;  1JZO A;  1PMT A;  1USB A;  1G7E A;  4ZBB A;  2PBJ A;  1TDI A;  1GRX A;  3BOA A;  5C00 A;  5DVB A;  2B6M A;  3LXT A;  2GS3 A;  3GH6 A;  2FUG 2;  4FXY P;  4K2X A;  5ECO B;  4K7O A;  4WXT A;  1OC3 A;  2WFC A;  2VAF A;  1ILO A;  3UAP A;  3I9V 2;  4BA7 A;  1F6M C;  1V58 A;  2IME A;  4GDF A;  3EU3 A;  3SBC A;  1YDK A;  3UBK A;  4HU9 A;  5A5H B;  5D9V A;  3FHK A;  2PMT A;  4YAP A;  5GAP D;  1E6B A;  2DKI A;  2HSM B;  5DAK A;  5GSS A;  3FRC A;  4IHU A;  3CMI A;  4X1U A;  4I8B A;  1WOU A;  2B5E A;  1PKW A;  4JED A;  1ZYQ B;  3G7J A;  2VCV A;  1WJK A;  3HZ8 A;  2YV9 A;  3CBU A;  4Z2U A;  4USS A;  3TU3 B;  1PQN A;  3M8N A;  4ZB9 A;  2LS5 A;  3IHG A;  3HA9 A;  3CTF A;  2OE3 A;  1Z7R A;  4J56 E;  2V2G A;  3L0H A;  1B9X C;  3A3T A;  3FZA A;  3CSH A;  1SKW B;  3U5R E;  1ERV A;  1EWX A;  3F4R A;  3H93 A;  2HZF A;  1TK5 B;  1JZD A;  4TRX A;  4AF2 A;  3DXB A;  3KEB A;  4OFM A;  1SYR A;  2FY6 A;  4N3Z A;  3DML A;  3D4M A;  2IMF A;  1A24 A;  3HZ4 A;  4LLR A;  3TKS E;  2LJR A;  1SD9 A;  1MDJ A;  3OR5 A;  1V40 A;  3TJB A;  3H4K A;  2HZE B;  3FR3 A;  4TXO B;  4K8M A;  3LXZ A;  1M9A A;  1Q98 A;  2FGX A;  3VLN A;  1NSW A;  2N5F A;  3RAZ A;  5IPH A;  4GWR A;  1QGV A;  3IDV A;  2PGT A;  2A2S A;  4BIK A;  2AJQ B;  3UMA A;  1B4P A;  4HI7 A;  1AXD A;  3HMJ G;  1YKC A;  1EEJ A;  4PUA A;  5DAL A;  4I6X A;  2RM6 A;  5LD0 A;  1XW5 A;  4AJ6 A;  2HXK A;  1Y25 A;  2H76 A;  2C80 A;  2GZZ A;  3GRX A;  4PUR A;  2B7J A;  3W6G A;  1XBS A;  1O81 A;  2IMI A;  1YVL A;  1XWG A;  4EIQ A;  3A2V A;  1JZW A;  1MEK A;  3P2A A;  2E0Q A;  3TGZ A;  2QA1 A;  1PKZ A;  1WIK A;  2LUS A;  5D93 A;  1B9Y C;  1PGT A;  2FWF A;  3US3 A;  4MJA A;  3MAK A;  5HR2 A;  4L5L A;  4ZBD A;  1GWC A;  3BBY A;  3ZIT A;  3QOU A;  5A1N A;  3GTU A;  3Q19 A;  3KP9 A;  3CRU A;  1OC9 A;  1S3C A;  2NPB A;  3UL3 A;  1FB6 A;  2F9S A;  1TJD A;  1TI3 A;  1EP8 A;  1BG5 A;  1TTZ A;  5ECN B;  1NM3 A;  1FAA A;  1GUK A;  5JWO B;  4YQM A;  1XG8 A;  4MH3 A;  3G7I A;  4BVY A;  4MMM A;  2IMK A;  3R3E A;  1TI1 A;  2YWM A;  2CAI A;  1A2J A;  3D0Z A;  4ZIL A;  3P8W A;  2LNS A;  1SJZ A;  2VCT A;  4PQI A;  4KH7 A;  2WRT A;  1W4V A;  1THO A;  1TKD B;  1KEB A;  1J0F A;  1GUM A;  4HZ4 A;  1TK8 B;  1VF4 A;  4QMK A;  1TRV A;  2JU5 A;  5B6M A;  4IW9 A;  4NHZ A;  1MDI A;  5JWR B;  4AKI A;  5ELA A;  2C3T A;  3UVT A;  4IEL A;  1XVW A;  4KB3 A;  3KCM A;  4W66 A;  3CWG A;  4NV5 A;  5H5R A;  4ZL7 A;  4EXJ A;  2KP2 A;  3I69 A;  2VD1 A;  1XXU A;  3HVS A;  3TJJ A;  5EPF A;  2WVZ A;  4AJ7 A;  2IMD A;  1HNC A;  5HFI A;  2YPM A;  3QAG A;  5DCH A;  3TJG A;  2H1G A;  5DJL A;  3FZ4 A;  1PL2 A;  4EIP A;  2R37 A;  4NXI A;  5IIZ A;  3TB2 A; 
#chains in the Genus database with same CATH homology
 4KDY A;  4MCU A;  4AKG A;  4PUF C;  1VGL A;  2X49 A;  2NDO A;  4IJI A;  1AQV A;  2HI7 A;  2O87 A;  3EYT A;  4WF5 A;  2LJK A;  2H1D A;  2FWH A;  4DSQ A;  4KCA A;  4EKZ A;  2P31 A;  3A5I A;  5AIS A;  4MH2 A;  1M9B A;  4LA1 A;  3KIJ A;  3IC8 A;  2WCI A;  4Z2T A;  1XWA A;  4FIW A;  2VLT A;  2GSS A;  1K0A A;  3I6A A;  3TCO A;  1HNB A;  3IA1 A;  2CX4 A;  2YN1 A;  1XPV A;  1SVM A;  1U6T A;  5AIX A;  1YEP A;  3VWV A;  3FZ5 A;  4ICY A;  2CV4 A;  2TRC P;  4Q5R A;  3E9J B;  4QL9 A;  3QPM A;  4F0C A;  1SJI A;  1GSS A;  3APS A;  5ID2 A;  1WRY A;  4PNG A;  1F9M A;  6GSU A;  1HD2 A;  4IVF A;  1Z7P A;  3EWL A;  5A4U A;  2H19 A;  19GS A;  2QA2 A;  4ID0 A;  2KHP A;  11GS A;  3WT1 A;  2B1L A;  4L0U A;  2R3X A;  2H73 A;  3A5W A;  4QL7 A;  4X4J A;  4GQF A;  2B1K A;  3F3Q A;  3EPT A;  2X64 A;  1GTU A;  3PPU A;  4XIH A;  5J9B A;  5A34 A;  4K5S A;  4G01 A;  2L4Q A;  3VUR A;  3ZYW A;  5CNW A;  13GS A;  3L9V A;  3FMW A;  3N5O A;  4MNN A;  5F8B A;  1MD3 A;  2MZC A;  4GSS A;  3L9S A;  2VCX A;  3MIX A;  3RHC A;  3IK9 A;  5B8A A;  5CYY A;  5CP1 A;  14GS A;  2OE0 A;  4HQS A;  1TU8 A;  2OBK A;  3R2Q A;  1K0C A;  1FVK A;  2KLX A;  2H72 A;  2IL3 A;  2C0E A;  4I2U A;  3WT2 A;  2P0G A;  3ZIJ A;  2HE3 A;  1EGR A;  4Z7X A;  3KH9 A;  1A2M A;  4ZBA A;  6GSS A;  4O5Q A;  4HJ2 A;  4POB A;  3DVX A;  2J9H A;  5JCG A;  3TKR A;  2JZS A;  2YWO A;  2ZUP A;  3QR6 A;  1ZGN A;  2O8V B;  4XS6 A;  2M46 A;  3KMN A;  3F0I A;  1XWB A;  5HR3 A;  1YY7 A;  1N25 A;  1X5D A;  2A2R A;  2VM2 A;  3IPZ A;  4EUY A;  2H71 A;  3NZN A;  1S3A A;  5IMF A;  4ECJ A;  5DBQ A;  3MYD A;  4N10 A;  1XCC A;  5BMU B;  2DJ2 A;  4KAE A;  3F9U A;  4OD7 A;  4MP4 A;  1SJ6 A;  18GS A;  4J57 E;  2X8H A;  3MWH A;  3QD9 A;  4NPB A;  3E3E A;  3EIN A;  1ZCP A;  3ISO A;  4ECB A;  3GKM A;  2L57 A;  1R26 A;  2QKE A;  4K7N A;  2YWN A;  3TOU A;  4KDU A;  3IRA A;  1PX6 A;  1YF1 A;  1X5E A;  3CRT A;  1RK4 A;  5ABR A;  2GZP A;  2B7K A;  5ECS A;  3DWV A;  4K9Z A;  2VM1 A;  2LRN A;  4FQU A;  4BVX A;  2XHF A;  4PX1 A;  2PN8 A;  3RPP A;  5ECP B;  1VF1 A;  1A8L A;  3DEX A;  1T3B A;  1SU9 A;  2VO4 A;  1LU4 A;  3VWW A;  5LCZ A;  4G0I A;  4L0W A;  3O3T A;  2OE1 A;  4PTS A;  3IE3 A;  5HR1 A;  3ZZX A;  1GL8 A;  1BJX A;  1XW6 A;  4F0B A;  5EVO A;  5J47 A;  1TP9 A;  4N0V A;  1F37 A;  5DAK B;  1OKT A;  4FYU A;  1VF3 A;  3H1N A;  2MMO A;  2WGR A;  3APO A;  3J7Y k;  3UIW A;  3GST A;  3GL5 A;  2O7K A;  1B8X A;  2LRC A;  3F3R A;  3LYK A;  2C0D A;  3WGD A;  2CA8 A;  4IP6 A;  5H5Q A;  4TOP A;  3GIX A;  5J4V A;  2IFQ A;  4JRR A;  4F82 A;  2JZR A;  3JCM L;  2PVQ A;  4TW5 A;  2J23 A;  4K5R A;  4YKF A;  1Z3E A;  2C0G A;  3QFA C;  5J4U A;  1R5A A;  2FLS A;  4DVC A;  1FO5 A;  1QXH A;  2MYG A;  2EFH A;  3BD2 A;  1XWK A;  1OAZ A;  3GA4 A;  2VL2 A;  2ALB A;  4IP1 A;  5HQP A;  2VKZ G;  2JAD A;  2YAN A;  3QAW A;  1KTE A;  4LMV A;  1XW9 A;  3GH9 A;  1G0T A;  4BL7 A;  5D9T A;  4LL4 B;  2DJ1 A;  5DJM A;  4KSM A;  2P5R A;  5KOX A;  4WKW A;  2F8A A;  3VFI A;  4ZL9 A;  4IN0 A;  2YP6 A;  2I4A A;  3APQ A;  2WZ9 A;  4XS1 A;  3IC4 A;  4KF9 A;  4OFN A;  1OE8 A;  1SK1 A;  3IAS 2;  2EFC A;  4X43 A;  1T4Z A;  3TDG A;  1AQW A;  4RQR A;  3LG6 A;  1GTB A;  2WDU A;  4WF4 A;  5J3R A;  5IMZ A;  1K0N A;  3FR9 A;  3QAV A;  4HJM A;  2NTO A;  1A8Y A;  2PU9 C;  2LV3 A;  5INY A;  2A4V A;  1BYE A;  2I1U A;  3QMX A;  2JAC A;  5JCW A;  1WMJ A;  2L6D A;  4I97 A;  2F8F A;  3ZFB A;  1M99 A;  2OA7 A;  4L8E A;  5FHI A;  4G9H A;  1GSU A;  2C3N A;  1XVQ A;  4OCE A;  2H1B A;  4IQ1 A;  6GSW A;  3TKS A;  5GST A;  3G7Y A;  1YKA A;  3O6T A;  5D96 A;  3VK9 A;  3TKQ A;  4CY6 A;  4GCI A;  3F4T A;  2VUP A;  1WPI A;  5A1N B;  2CVK A;  4WET A;  3DKS A;  2BJX A;  1OC9 B;  5J40 A;  2I81 A;  3LWA A;  1RW1 A;  4K0G A;  4MJC A;  4PQ1 A;  2LKU A;  1GSE A;  1EGO A;  5AN1 A;  3HJO A;  4RI7 A;  1SKS B;  5JWQ B;  1M7T A;  3M9J A;  3D21 A;  4EVM A;  1SYX A;  4BVY B;  3ZFL A;  2A2P A;  4PGT A;  4N30 A;  1V57 A;  1SD8 A;  5HFG A;  2H70 A;  2PPT A;  5DQS A;  4V2N A;  1X9S B;  2UZ8 A;  4OWY A;  5BRT A;  2AYT A;  2MMA A;  1M2B A;  1AUC A;  3LFL A;  1RQM A;  3DYR A;  3PH9 A;  5GAN D;  1OKD A;  4TR1 A;  2E7P A;  2GVP A;  2H6Z A;  4TVE A;  4Q5Q A;  3VI5 A;  3W8S A;  1YF0 A;  1GNW A;  1TU7 A;  2HZE A;  4K7I A;  2RLI A;  4TXO A;  4ZB6 A;  1IYI A;  1ZZY A;  1IYH A;  2X99 A;  4QQ7 A;  2CVD A;  3VWX A;  4EF0 A;  1F3B A;  1GTA A;  3UJ1 A;  1OC8 A;  2ZNM A;  4MF5 A;  2JSZ A;  5EL8 A;  3TRQ A;  2HRA A;  1B4Q A;  4AGS A;  1U88 A;  4JBB A;  4PXO A;  2I9H A;  2HRN A;  2VCZ A;  3ED3 A;  5CRD A;  1K3O A;  3FYG A;  3ZL5 A;  5J9C A;  4MAB A;  3F4S A;  1GTI A;  1M2D A;  1PN0 A;  2WB9 A;  2R0C A;  1S3D A;  1K3Y A;  4KDX A;  3DGQ A;  4LL1 B;  2V1M A;  1V2A A;  2H66 A;  2B5Y A;  3CXG A;  1O85 A;  3P90 A;  5CRH A;  2UV8 G;  2H0I A;  2M72 A;  3WYW A;  2C0F A;  2DJ0 A;  1F2E A;  3ERW A;  2YJ7 A;  5GZZ B;  3UEM A;  5ECK B;  2REM A;  2H0G A;  1YQ1 A;  6GSV A;  4P3Y B;  3KM6 A;  2OBI A;  1XZO A;  3F8U A;  4KCE A;  1ON4 A;  1PX7 A;  3HJM A;  5ECM B;  1JZR A;  5COH A;  1SVO A;  1TOF A;  3FKF A;  3ZMK A;  2YWI A;  1FVJ A;  3TOT A;  3ZIV A;  1TRU A;  2RUE A;  4O5R A;  4EO3 A;  4MZW A;  1R7H A;  1ZL9 A;  1K0D A;  1QK8 A;  2N5A A;  3DRN A;  4KX4 A;  4E8H A;  4TR4 A;  2H74 A;  3C7M A;  2HSN A;  3WGE A;  3ZLP A;  2CVB A;  1C72 A;  1XOB A;  2GZY A;  1Y6E A;  4D73 B;  2CT6 A;  4F9Z A;  3J7Y b;  2AHE A;  2GGT A;  3HVV A;  3TRX A;  4Z2R A;  2X4A A;  1I5G A;  5IMA A;  3KMO A;  1GP1 A;  3GKN A;  1DSB A;  2AAW A;  2OJL A;  4MF6 A;  2XBI A;  4ILF A;  2R2J A;  4AJ8 A;  1HYU A;  1Z9H A;  3W8J A;  1MDK A;  3CYN A;  3GX0 A;  4V2M A;  4O5U A;  2PUK C;  2VL9 A;  3M0F A;  2CAQ A;  1WWJ A;  4GXZ A;  4IS0 A;  1MTC A;  4XTS A;  2GLR A;  1ERU A;  2M80 A;  2JL4 A;  4WR5 A;  4H86 A;  1U87 A;  1UA5 A;  2RM5 A;  1H75 A;  3KD0 A;  1YZX A;  1BF5 A;  2V6K A;  2CZ2 A;  3Q6O A;  4L5O A;  3EE2 A;  4NWY A;  2K18 A;  2NVL A;  1N8J A;  3UBL A;  4TXV A;  2L6C A;  2TIR A;  2O5V A;  4HUA A;  1O6J A;  6GST A;  5HFK A;  5J5N A;  5IM9 A;  2VCW A;  1EEM A;  1NW2 A;  4YH2 A;  5G5F A;  4YQU A;  5D8I A;  4MZB A;  4OMV A;  1BX9 A;  8GSS A;  1O8W A;  4K0N A;  1AC1 A;  3EMP A;  2P5Q A;  3RPN A;  3F6D A;  1VRS D;  2FWG A;  3FY7 A;  3QFB C;  3K8N A;  3FZ9 A;  1K0O A;  4O7H A;  1EZK A;  1EP7 A;  3L9U A;  2YZH A;  3EVI A;  2DJ3 A;  2VIM A;  2HRK B;  1X9W B;  2H75 A;  4RUV A;  6GSX A;  1THX A;  4KA0 A;  4AKH A;  3FK8 A;  3L4N A;  1FHE A;  3HJP A;  2VL2 C;  3GKK A;  4K2D A;  3Q74 A;  2WJU A;  4CW9 A;  2GT6 A;  1PA3 A;  4I2T A;  2FA8 A;  3KZQ A;  3TKP A;  4N0Z A;  2H8L A;  2XC2 A;  2HQT A;  1W89 A;  2PWJ A;  3Q18 A;  4K1F A;  1T4Y A;  3VWU A;  2TRX A;  2IJY A;  2EFE A;  3A2X A;  4OO5 A;  3HY2 A;  2YOI A;  4GST A;  1A0R P;  3IV4 A;  2GQK A;  4ACS A;  1PRX A;  2PVO C;  1CQH A;  5G30 A;  3CTG A;  2O89 A;  1O7U A;  4G0K A;  3F63 A;  4GTU A;  2EIQ A;  3UVH A;  1ST9 A;  4TR3 A;  4XCS A;  2EIO A;  2GSQ A;  3IR4 A;  2QC7 A;  4GSN A;  4BL7 B;  2G2Q A;  1YEX A;  3LOR A;  3TJK A;  3RBT A;  2CZ3 A;  3CSJ A;  1HNA A;  2YNX A;  5KN0 A;  3RHB A;  4I5Q A;  1A2L A;  5F05 A;  4EDY A;  2YZU A;  4JR6 A;  3TKS C;  1UN2 A;  4WR4 A;  3H8Q A;  5G5E A;  5A5K A;  4HS1 A;  4DEJ A;  2LRT A;  2XPD A;  2GT5 A;  1ABA A;  5KOW A;  2LTK A;  5ELG A;  3C8E A;  4KND A;  2EFD A;  1ZOF A;  1O73 A;  3D6I A;  4GRF A;  1GSD A;  4J2F A;  3VPT A;  3GUR A;  5C04 A;  1UC7 A;  5A4V A;  3MNG A;  2VD0 A;  2H1A A;  5IMC A;  4BWS A;  2GQM A;  5G1L A;  1EOH A;  1KNG A;  2DJJ A;  5KN1 A;  5ECQ B;  5D9W A;  4FYC A;  2C3Q A;  5IOW A;  3C1S A;  2BTO T;  5HR0 A;  1TRW A;  2L5O A;  3E0U A;  5F0G A;  2EIR A;  3U6V A;  4GLT A;  2GDR A;  1I9D A;  2H30 A;  2MBT A;  2R6K A;  1GNE A;  2FA4 A;  2AB6 A;  4E8E A;  2HFD A;  3ZRD A;  1X9M B;  4TN8 A;  3BCK A;  4MF7 A;  2HNL A;  3GFK A;  2FNO A;  1K3L A;  2WS2 A;  1A0F A;  1R5P A;  2K8S A;  3HKR A;  1A23 A;  3IHQ A;  4XS4 A;  1J08 A;  5ECL B;  2KUC A;  4HQZ A;  2HRF A;  2MMN A;  5IMV A;  4JZQ A;  4GQC A;  3KJY A;  4DSS A;  2DIZ A;  4BPY A;  4WEY A;  2XPE A;  3G9B A;  1JHB A;  2N5B A;  2C1Y A;  5DAL B;  5B7C A;  3GX8 A;  4JU5 A;  5KN2 A;  2HT9 A;  5CAX A;  1PD2 1;  3ZRE A;  5DDL A;  4MZC A;  1DUG A;  2GSR A;  1ZYE A;  5IO0 A;  3KP8 A;  3LJR A;  2VOC A;  2LQO A;  2QSI A;  2V6O A;  2EC4 A;  3ZTL A;  5ECH B;  1XFL A;  22GS A;  4RI6 A;  1H4O A;  1YJ6 A;  4F03 A;  2HYX A;  1DE2 A;  1PN9 A;  1HQO A;  4ZB7 A;  5CRE A;  3LEF A;  2H0H A;  1AW9 A;  2IWT A;  2YJH A;  5J41 A;  2AV4 A;  1ZYN A;  2FCH A;  2NBS A;  1DE1 A;  3QCP A;  4POM A;  5A5H A;  2I3Y A;  1ACV A;  1SVL A;  4POK A;  2X8G A;  1CQG A;  5ECR B;  5KEJ A;  5J4Y A;  3GUS A;  4AI6 A;  4EDZ A;  5KN3 A;  1FOH A;  4TR1 B;  2HSM A;  3GTU B;  4CHS A;  3TRP A;  1FW1 A;  4K6X A;  5E4W A;  4OCF A;  5E59 A;  4KSO A;  3C1R A;  3FW2 A;  4N11 A;  9GSS A;  3DD3 A;  2A4H A;  1EV4 A;  4AKX B;  1SK0 A;  5JCU A;  1G6Y A;  2OT3 A;  2DSA A;  2HSY A;  4MJE A;  3S9F A;  3ZVJ A;  5G1K A;  2QGV A;  4PNF A;  2BMX A;  3F6F A;  1LBK A;  2L59 A;  5CO3 A;  6GSY A;  2GQL A;  3LGC A;  4OO4 A;  4CDO A;  3IOS A;  4IQA A;  1NHY A;  1KBN A;  3AY8 A;  4HDE A;  4YQV A;  4CY8 A;  4OFT A;  1SL2 B;  2R5G A;  3C71 A;  1GSY A;  1BG1 A;  1J9B A;  1V98 A;  1X5C A;  5AIV A;  5H5S A;  2DML A;  1DBY A;  2ON5 A;  3C73 A;  3D4T A;  3MSZ A;  2DJK A;  4IJ3 A;  3NIV A;  4E68 A;  5LNK e;  1R4W A;  2ZCT A;  4V1A p;  3HXS A;  1AAZ A;  2E2M A;  3O76 A;  2LJA A;  1SK2 A;  2R4V A;  4YKG A;  5D9X A;  2JSY A;  1E2Y A;  5G31 A;  4G19 A;  1ERW A;  4MPG A;  2WUL A;  3ZVJ D;  2OAD A;  4KUN A;  1QQ2 A;  4MJB A;  4PQH A;  3RDW A;  4MA9 A;  1T7P B;  1QMV A;  3A2W A;  4X0X A;  1OE7 A;  2MMZ A;  4JE1 A;  1UVZ A;  4MLY A;  2LEG A;  2G0F A;  1TXU A;  5ENU A;  1M0U A;  5L71 A;  4FH8 A;  2LQQ A;  3BCI A;  1GSF A;  5D73 A;  2HSN B;  3CSI A;  2C8U A;  2H01 A;  2IN3 A;  3GYK A;  4NAX A;  2B5X A;  4POL A;  2VL3 A;  2HSH A;  5CRW A;  1K0B A;  4V1A g;  5ID2 B;  3ZML A;  1JFU A;  3FR6 A;  2K6V A;  4O92 A;  2F3M A;  2K8V A;  1EOG A;  5FT3 A;  1SL0 B;  4HEA 2;  1LJR A;  1Z6M A;  5IPG A;  4YAV A;  2E2G A;  5B6N A;  3LW9 A;  4G0L A;  1U3I A;  3D5J A;  5F07 A;  1B48 A;  2LNT A;  1N2A A;  1JLV A;  3KXO A;  3EUR A;  2DKH A;  1PSQ A;  5A34 B;  3GN3 A;  2V32 A;  3TJF A;  3GL3 A;  4G2E A;  1T00 A;  3HYP A;  5IQY A;  5DCG A;  2IPA A;  4FYB A;  5IOX A;  1G6W A;  1GUL A;  2VLV A;  4XHM A;  2XBQ A;  3LSZ A;  1ML6 A;  2CQ9 A;  1NHO A;  3VPQ A;  2D2Z A;  1G7O A;  2JZT A;  1F3A A;  4WBR D;  3IBH A;  3HVX A;  3KGK A;  3PGT A;  2R0G A;  3FEU A;  1Z6N A;  2ES7 A;  4O32 A;  2K9F A;  1BQ7 A;  2H6Y A;  1PL1 A;  3VI7 A;  2H1L A;  4NMU A;  3IAM 2;  5EY6 A;  1ZYP A;  3BJ5 A;  1URM A;  1X0R A;  3ME8 A;  2O85 A;  3ERG A;  2CX3 A;  3NOF A;  1XWC A;  2DLX A;  1FOV A;  2YCD A;  1T1V A;  7GSS A;  3ME7 A;  2YV7 A;  4TKY A;  3I43 A;  2L5L A;  1AIU A;  5AGY A;  3WD6 A;  3EC3 A;  1GUH A;  2DBC A;  2FD3 A;  4TR0 A;  4IBP A;  3HHV A;  2C4J A;  4HZ2 A;  1WE0 A;  4KE3 A;  3V1W A;  4MPF A;  4G10 A;  1QFN A;  4WBJ A;  4IKH A;  2KOK A;  4MDC A;  4ZL8 A;  4ULX A;  3H79 A;  4ECC A;  5FWG A;  2RUF A;  1GLQ A;  1JLW A;  5ECI B;  3WGX A;  1V9W A;  1Q4J A;  1GH2 A;  5DQY A;  3P7X A;  4V2L A;  3UOM A;  2V41 A;  3L78 A;  3D22 A;  4HOJ A;  1GSQ A;  4FO5 A;  4ML1 A;  1Y1U A;  1SEN A;  4ZB8 A;  4NV2 A;  4D73 A;  1TXX A;  3SWL A;  3IXR A;  4BWQ A;  2Z9S A;  4BVX B;  5F06 A;  2DMM A;  4Q5N A;  3M1G A;  2GTU A;  2L4C A;  4ZXG A;  3KH7 A;  4DSR A;  3LYP A;  1ERT A;  4GF0 A;  3HDC A;  1GLP A;  1ZMA A;  3M9K A;  1FG4 A;  2R0P A;  3GV1 A;  1TK0 B;  2PER A;  3GSS A;  1TRS A;  2RII A;  3EU4 A;  1QUW A;  2OAC A;  17GS A;  3PR8 A;  4XRA A;  1FB0 A;  2FWE A;  2ON7 A;  2KP1 A;  1O8X A;  1T8E B;  4Q5F A;  1Z5Y E;  2MBS A;  5G2Z A;  4F2I A;  3M3M A;  3ERF A;  3HD5 A;  2AUV A;  4ECI A;  1AQX A;  3KTB A;  5B8B A;  4NHW A;  2X8C A;  1OYJ A;  4IGJ A;  3GHA A;  2IFQ B;  2DIY A;  2FHE A;  2GST A;  2F51 A;  1XOA A;  5IMD A;  3DVW A;  2VCQ A;  4EC0 A;  4ZIJ A;  1M2A A;  1XIY A;  2VLU A;  4LMW A;  10GS A;  3DIE A;  4ML6 A;  1SKR B;  3GNJ A;  3LQ7 A;  12GS A;  3GMF A;  3GKX A;  2LST A;  2HLS A;  3N9J A;  1SL1 B;  16GS A;  1VF2 A;  2HRK A;  1TW9 A;  3MDK A;  3EMX A;  4EL1 A;  2H6X A;  4MK3 A;  4JR4 A;  1BAY A;  4ISD A;  5BMU A;  2B3S A;  2DC5 A;  3HCZ A;  3IK7 A;  4XRD A;  1OVN A;  2IIY A;  3TUE A;  1MD4 A;  4XS4 B;  20GS A;  5CRG A;  1EV9 A;  4RQX A;  4HU7 A;  1BED A;  5A4W A;  1WP0 A;  1K0M A;  3UAR A;  4A5P A;  1U3A A;  3PIN A;  5IO2 A;  2OKA A;  4DSS B;  4EE0 A;  4KGI A;  3KTL A;  4KW6 A;  3QDN A;  1JZO A;  1PMT A;  1USB A;  1G7E A;  4ZBB A;  2PBJ A;  1TDI A;  1GRX A;  3BOA A;  5C00 A;  5DVB A;  2B6M A;  3LXT A;  2GS3 A;  3GH6 A;  2FUG 2;  4K2X A;  5ECO B;  4K7O A;  4WXT A;  1OC3 A;  2WFC A;  2VAF A;  1ILO A;  3UAP A;  3I9V 2;  4BA7 A;  1F6M C;  1V58 A;  2IME A;  4GDF A;  3EU3 A;  3SBC A;  1YDK A;  3UBK A;  4HU9 A;  5A5H B;  5D9V A;  3FHK A;  2PMT A;  4YAP A;  5GAP D;  1E6B A;  2DKI A;  2HSM B;  5DAK A;  5GSS A;  3FRC A;  4IHU A;  3CMI A;  4X1U A;  4I8B A;  1WOU A;  2B5E A;  1PKW A;  4JED A;  1ZYQ B;  3G7J A;  2VCV A;  1WJK A;  3HZ8 A;  2YV9 A;  3CBU A;  4Z2U A;  4USS A;  3TU3 B;  1PQN A;  3M8N A;  4ZB9 A;  2LS5 A;  3IHG A;  3HA9 A;  3CTF A;  2OE3 A;  1Z7R A;  4J56 E;  2V2G A;  3L0H A;  1B9X C;  3A3T A;  3FZA A;  3CSH A;  1SKW B;  3U5R E;  1ERV A;  1EWX A;  3F4R A;  3H93 A;  2HZF A;  1TK5 B;  1JZD A;  4TRX A;  4AF2 A;  3DXB A;  3KEB A;  4OFM A;  1SYR A;  2FY6 A;  4N3Z A;  3DML A;  3D4M A;  2IMF A;  1A24 A;  3HZ4 A;  4LLR A;  3TKS E;  2LJR A;  1SD9 A;  1MDJ A;  3OR5 A;  1V40 A;  3TJB A;  3H4K A;  2HZE B;  3FR3 A;  4TXO B;  4K8M A;  3LXZ A;  1M9A A;  1Q98 A;  2FGX A;  3VLN A;  1NSW A;  2N5F A;  3RAZ A;  5IPH A;  4GWR A;  1QGV A;  3IDV A;  2PGT A;  2A2S A;  2AJQ B;  3UMA A;  1B4P A;  4HI7 A;  1AXD A;  3HMJ G;  1YKC A;  1EEJ A;  4PUA A;  5DAL A;  4I6X A;  2RM6 A;  5LD0 A;  1XW5 A;  4AJ6 A;  2HXK A;  1Y25 A;  2H76 A;  2C80 A;  2GZZ A;  3GRX A;  4PUR A;  2B7J A;  3W6G A;  1XBS A;  1O81 A;  2IMI A;  1YVL A;  1XWG A;  4EIQ A;  3A2V A;  1JZW A;  1MEK A;  3P2A A;  2E0Q A;  3TGZ A;  2QA1 A;  1PKZ A;  1WIK A;  2LUS A;  5D93 A;  1B9Y C;  1PGT A;  2FWF A;  3US3 A;  4MJA A;  3MAK A;  5HR2 A;  4L5L A;  4ZBD A;  1GWC A;  3BBY A;  3ZIT A;  3QOU A;  5A1N A;  3GTU A;  3Q19 A;  3KP9 A;  3CRU A;  1OC9 A;  1S3C A;  2NPB A;  3UL3 A;  1FB6 A;  2F9S A;  1TJD A;  1TI3 A;  1EP8 A;  1BG5 A;  1TTZ A;  5ECN B;  1NM3 A;  1FAA A;  1GUK A;  5JWO B;  4YQM A;  4MH3 A;  3G7I A;  4BVY A;  4MMM A;  2IMK A;  3R3E A;  1TI1 A;  2YWM A;  2CAI A;  1A2J A;  3D0Z A;  4ZIL A;  3P8W A;  2LNS A;  1SJZ A;  2VCT A;  4PQI A;  4KH7 A;  2WRT A;  1W4V A;  1THO A;  1TKD B;  1KEB A;  1J0F A;  1GUM A;  4HZ4 A;  1TK8 B;  1VF4 A;  4QMK A;  1TRV A;  2JU5 A;  5B6M A;  4IW9 A;  4NHZ A;  1MDI A;  5JWR B;  4AKI A;  5ELA A;  2C3T A;  3UVT A;  4IEL A;  1XVW A;  4KB3 A;  3KCM A;  4W66 A;  3CWG A;  4NV5 A;  5H5R A;  4ZL7 A;  4EXJ A;  2KP2 A;  3I69 A;  2VD1 A;  1XXU A;  3HVS A;  3TJJ A;  5EPF A;  4AJ7 A;  2IMD A;  1HNC A;  5HFI A;  2YPM A;  3QAG A;  5DCH A;  3TJG A;  2H1G A;  5DJL A;  3FZ4 A;  1PL2 A;  4EIP A;  2R37 A;  4NXI A;  5IIZ A;  3TB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...