5ECRB

Crystal structure of fin219-fip1 complex with ja, val and mg
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transferase
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 63
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecrB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecrB01
4POKA 2IMDA 1V2AA 1XOAA 2V41A 4V2NA 4ZB9A 2V6OA 5JCGA 1TRWA 1JZRA 4OFMA 3FR6A 2VL9A 1NHOA 1THOA 2VO4A 3UARA 2OJLA 1PD21 2VIMA 2P0GA 3G7YA 5HFGA 3QR6A 5AISA 2KHPA 3QMXA 3F4TA 4N0VA 2K9FA 2V6KA 2NTOA 3F8UA 3UL3A 2IMFA 4GSSA 1ON4A 2VLTA 4LA1A 2GDRA 2CX4A 2RUFA 1V40A 2GLRA 2WCIA 3FK8A 4JR4A 3BD2A 3E0UA 5IMAA 3LYKA 1OC8A 2IIYA 2F8AA 2FNOA 1G0TA 3VWWA 4GXZA 2GTUA 1PQNA 4I8BA 1XWCA 4K7IA 3H4KA 2PUKC 3BOAA 3IAM2 4G0IA 5H5SA 3HKRA 2GQLA 2KLXA 1A2LA 2A4VA 1OYJA 3DVWA 3TJJA 1TJDA 1OAZA 3HVSA 5ECQB 4K1FA 4MJEA 1AQVA 1JZDA 1GTIA 3ZL5A 2LQOA 4LMWA 2L4CA 2MMOA 2OA7A 2MMNA 4FYBA 1PL2A 3KMOA 4LL1B 4YQMA 3M3MA 4GQCA 2RIIA 5CYYA 1ZGNA 3Q74A 1X9WB 2YP6A 2JZSA 1SK2A 1EEJA 5KN0A 4MJBA 2MBTA 2D2ZA 4X1UA 3LXZA 5ECRB 2B7JA 3HVXA 3L9SA 2WB9A 3QAWA 2YJ7A 3IK9A 4HZ4A 4MF7A 1CQHA 2F3MA 2LTKA 4KW6A 4IJ3A 1ML6A 4NHZA 3QCPA 3N5OA 1AAZA 1BJXA 2ON7A 2QSIA 3UBLA 4ZBAA 4MZCA 1M7TA 2IPAA 1OC3A 1GSUA 4FYUA 3K8NA 2PMTA 4I97A 2H73A 4D73A 1HYUA 3HCZA 4WEYA 1SENA 1XVWA 3ERWA 4F82A 9GSSA 4XHMA 3H79A 2V1MA 2M72A 1SL1B 1FB0A 1X0RA 18GSA 2XPEA 4IKHA 4Q5FA 2K8SA 2O7KA 2VCVA 3SBCA 3M9JA 3GA4A 2DJ0A 4HJ2A 5IMDA 3BCIA 5D9VA 3VPQA 4GSNA 4F0CA 2IN3A 4NXIA 2DJ3A 1QQ2A 2PVOC 2H0IA 3TRQA 4MF6A 2AB6A 2I3YA 2LKUA 2PVQA 4FQUA 1TRVA 2H6XA 1OVNA 4FIWA 5ABRA 1K0NA 1VGLA 2C3NA 2HLSA 4TRXA 2JZTA 2LEGA 3GKXA 2L4QA 2F9SA 1JLWA 5G1KA 3GFKA 1GUMA 3QAVA 4V2LA 4NV2A 2DMLA 4HOJA 1A2JA 3KM6A 3DYRA 2B1LA 4MABA 1K3OA 3DGQA 3PPUA 2EIOA 4K7NA 4H86A 5FT3A 5D93A 1JHBA 2WRTA 4PXOA 3C7MA 4TR3A 3ZVJA 1F2EA 1QXHA 1GNWA 2VM1A 2X64A 4JEDA 2YV9A 4IS0A 3TKSA 3DIEA 5ECMB 2H6ZA 1XPVA 16GSA 4TR0A 3TDGA 3L78A 1R26A 2J23A 5D9WA 2ON5A 5ECNB 5ELAA 2H19A 1GL8A 4IGJA 3KTBA 3DMLA 4TXOA 3CBUA 1J9BA 5D73A 3IDVA 4OFNA 1ERUA 5IIZA 3KP9A 3Q19A 3ZRDA 4ML6A 4DEJA 3TOTA 2GSRA 1ST9A 2H1BA 3D4TA 4AJ6A 4KDXA 1YKAA 1O6JA 4ULXA 3CMIA 6GSYA 1T00A 2FWGA 1Q4JA 2NBSA 4OWYA 4GCIA 3NIVA 4MF5A 4XRDA 1TW9A 2YCDA 5L71A 4EDZA 1PN9A 1XW6A 3ZREA 4IJIA 4ZILA 1SK0A 5CP1A 2P5RA 4TXVA 3FZ9A 1GUKA 1PL1A 2EIQA 2B5XA 4K8MA 2XBIA 2YPMA 1ZYQB 2YOIA 1RW1A 2LJRA 2O87A 1H75A 1TK8B 1DBYA 3GSTA 2VCWA 3GH9A 4HUAA 1LBKA 1SU9A 4K0NA 1SJIA 3KZQA 2DBCA 3GKNA 5ENUA 4DSRA 2HSMB 1Z7PA 4KSOA 4JRRA 1X9SB 5JCUA 1UVZA 2H0GA 5A4VA 2YV7A 4K9ZA 4RUVA 2LJKA 4IP6A 3IRAA 4J57E 5DALB 2LV3A 1AC1A 2BTOT 5AN1A 2L57A 1GWCA 3TRXA 4WF5A 2YN1A 2KP2A 1O7UA 3E9JB 1M2AA 3IPZA 5KN3A 2LS5A 1PSQA 4KH7A 3RPNA 4Q5RA 1I9DA 1PX6A 2H70A 3PINA 4BWSA 4PNFA 1ERWA 1K3LA 1SKWB 2VLUA 5A4WA 3F9UA 2XBQA 1MTCA 3ZIVA 4TR4A 1XWBA 4TOPA 1GTAA 4KDYA 1NM3A 4DVCA 3WT1A 4OO5A 3GURA 1EV4A 3Q18A 2VLVA 2H1AA 3HJPA 4HI7A 2VL2C 1GLPA 2FCHA 5F06A 4CDOA 2H30A 2DJJA 2UZ8A 3L4NA 1XIYA 1MDIA 3I43A 3FY7A 3LYPA 3CTGA 2O85A 1SL2B 5FWGA 2QGVA 3APOA 1CQGA 1VF4A 2PGTA 3CRTA 2REMA 3QDNA 3APQA 4ZB8A 1WOUA 3F3RA 5J5NA 2IFQA 3KEBA 2ES7A 1MD4A 3US3A 3G9BA 3VWUA 4MH2A 3TB2A 4OCFA 3S9FA 3WGDA 1O8WA 2AV4A 3KH9A 2V2GA 4NWYA 2WS2A 5DAKA 2X8HA 3LQ7A 2OKAA 2X99A 2GZPA 1TP9A 3V1WA 3GKKA 2KUCA 5JWQB 2L5LA 2H8LA 1Q98A 5CAXA 3UOMA 4HQSA 3W8SA 3FZAA 3DVXA 2C3QA 17GSA 1T3BA 3WGEA 3HZ8A 1OE8A 1BYEA 2JSYA 2WGRA 4GF0A 1SD8A 1ACVA 2BJXA 2CT6A 4G2EA 4TR1A 3GNJA 2CX3A 5CRDA 4K0GA 3CXGA 1OKDA 3I69A 1VRSD 1T4YA 5E4WA 5ECIB 2GZYA 3IHQA 3J7Yk 2HFDA 3GKMA 2C0DA 1K3YA 4JR6A 4G0LA 5HR1A 1F3AA 3G7JA 4O92A 3QFAC 3IR4A 4NV5A 2F51A 4BVXB 1HNCA 3TKSE 3M9KA 4IELA 5B6NA 1V57A 3HD5A 4IQ1A 2MMZA 1R5AA 1R4WA 3ME8A 4AJ7A 1K0OA 2MYGA 2ALBA 5F8BA 4PX1A 1WE0A 2N5FA 4F0BA 1GUHA 1PKZA 4E8EA 1B9YC 5LNKe 2FA8A 2IJYA 4YAPA 4OD7A 3HJOA 1GSSA 1TU8A 3ERGA 1XW9A 3FR9A 1YKCA 3A2WA 3F4SA 1AQWA 1TXXA 3IK7A 2DLXA 2M46A 3HHVA 1BX9A 2H66A 4IN0A 4DSQA 1RK4A 3P2AA 2CVBA 5DDLA 4WKWA 2YWOA 4L8EA 5EY6A 3F4RA 4IP1A 3QD9A 4N0ZA 2HRFA 2K18A 1FW1A 1XXUA 2VCTA 2GSSA 4POLA 1GSDA 3TJBA 1BEDA 2H75A 1XWGA 1X5DA 2H72A 1FAAA 1F3BA 2DIYA 3UJ1A 4WBJA 22GSA 2HSNB 5G1LA 2C1YA 4P3YB 4HU7A 4ZL8A 5GAND 2N5AA 2Z9SA 4EDYA 4ISDA 2GVPA 1NHYA 4HDEA 3W6GA 2IMKA 2B5YA 5CO3A 5CRGA 3PR8A 3LG6A 2KP1A 1WRYA 3BJ5A 5B8BA 4MA9A 5ECSA 2H74A 5CRWA 2C3TA 1FO5A 1VF1A 3BBYA 3CRUA 1HNAA 1XBSA 4KA0A 5HR2A 4KAEA 2PWJA 1YF1A 4OCEA 2YJHA 4MH3A 3GSSA 3NZNA 1K0BA 5C04A 4GTUA 3DKSA 3O3TA 2WDUA 1F9MA 2BMXA 4L5OA 4ZIJA 2XPDA 2VCZA 2M80A 1PGTA 3APSA 5J3RA 3D22A 2A2SA 4MDCA 3LEFA 1UC7A 1MD3A 2N5BA 5DBQA 2HRKB 2IWTA 3HDCA 3OR5A 4EC0A 4L0WA 5IOXA 3GIXA 5D9TA 10GSA 4RI7A 1GLQA 2JSZA 2G0FA 2P5QA 2B6MA 3P7XA 1GH2A 1JZOA 5GAPD 3IC4A 4V2MA 4ECJA 5CRHA 2HZFA 4ID0A 1GTBA 1ZYEA 2X8GA 2GQKA 2VL2A 2JL4A 1PKWA 4CHSA 1SJZA 2DJ2A 3N9JA 3FYGA 4O5RA 4YQVA 1B48A 1SYXA 2FWHA 4KDUA 3KIJA 4XS6A 2B1KA 4GWRA 5BMUA 1XZOA 4L0UA 1EGOA 1K0DA 2DJ1A 4JU5A 2HSHA 1U6TA 3L9UA 4G10A 5DVBA 5F05A 3ED3A 1AIUA 2FWEA 3KD0A 3MSZA 3PH9A 1USBA 1WIKA 1EP7A 2QC7A 4I2TA 1JFUA 2OE3A 4WXTA 2CA8A 1SKRB 4DSSB 3ZFBA 2HZEB 1TOFA 5IMFA 1R5PA 3KXOA 1IYHA 2LJAA 3FR3A 1J08A 4POMA 1XWKA 1U3IA 5F07A 3J7Yb 3F0IA 1AUCA 3DWVA 4MPFA 3GL5A 4ACSA 2FLSA 3KTLA 1QMVA 2PERA 2CZ2A 2VOCA 3GHAA 4BVYB 2I4AA 2K6VA 2B3SA 2I81A 3IA1A 4N10A 3KJYA 1DE2A 3LJRA 1Z6NA 4KUNA 5KN1A 4J56E 1WP0A 4PQIA 2OE1A 4GSTA 4BL7B 5IMVA 3GX0A 1HQOA 1OKTA 4K6XA 1GSFA 1V98A 3ISOA 2GS3A 2CVKA 3GL3A 5D9XA 1E6BA 3IAS2 5IPGA 4IHUA 1J0FA 5ID2B 2PN8A 4O32A 3C8EA 1JZWA 5G5EA 3R2QA 2H76A 3EMPA 4KCAA 4TXOB 4E8HA 3GTUB 1KTEA 1VF2A 1B4PA 1GRXA 4RI6A 1S3CA 5JWRB 2JADA 3HVVA 3O76A 2HXKA 4MK3A 3SWLA 4KNDA 1F6MC 2JZRA 2R6KA 4AJ8A 3QFBC 1ERTA 3GRXA 1QGVA 1BQ7A 1T8EB 1FHEA 3RPPA 1XW5A 3VI5A 2VCQA 2HT9A 4NPBA 1FB6A 6GSWA 2IMEA 1AXDA 4IVFA 1OE7A 2HSMA 2XHFA 3KCMA 2V32A 1Z3EA 2B5EA 2C0EA 3VLNA 5ECLB 5LCZA 1I5GA 3QOUA 3RDWA 5IOWA 3A2XA 4BPYA 1TK0B 3LWAA 1ZOFA 3EVIA 1F37A 3CSJA 1WWJA 5DALA 3ZVJD 2E7PA 1YJ6A 3UEMA 4HQZA 2WULA 3C71A 4XS4B 1PA3A 5DQYA 4ZBBA 3HXSA 4JE1A 3HY2A 1OC9B 5DJMA 4J2FA 5EPFA 2IMIA 4WETA 4RQXA 1XOBA 3ZZXA 3EE2A 4KB3A 1A2MA 1A0FA 3KGKA 4F03A 4MCUA 2CZ3A 3PGTA 4MJCA 1MDKA 4PQ1A 4PGTA 4EKZA 3TKRA 3ME7A 1ZCPA 2I1UA 1TI1A 5G5FA 1ERVA 4HZ2A 2OBKA 3MNGA 3KMNA 2G2QA 1N8JA 5IO2A 1KEBA 1THXA 2WJUA 4ML1A 5A5KA 1ZL9A 3M0FA 6GSUA 4OFTA 3WD6A 1M0UA 3L0HA 1A23A 2AHEA 4QQ7A 4V1Ap 4MLYA 2OADA 4ZL9A 1EEMA 2H6YA 2AAWA 3TJFA 1N2AA 1FVJA 5ECPB 5AGYA 1EOHA 5COHA 3DEXA 4LLRA 3EYTA 1SK1A 2DC5A 3C1SA 7GSSA 3FZ4A 3TOUA 1E2YA 2IFQB 3LSZA 5J9CA 2O8VB 1T4ZA 4EO3A 2DMMA 1M9AA 2OBIA 1G6WA 1SJ6A 1LU4A 3H93A 1PX7A 1GSEA 3VWXA 3EWLA 1A0RP 4PNGA 5DCHA 3LORA 2EC4A 2CAQA 5CREA 4X43A 4AGSA 2KOKA 2I9HA 4K2DA 4Q5NA 2HRNA 4L5LA 3D0ZA 4RQRA 1ZZYA 2HQTA 2E2MA 3RAZA 3EMXA 1O73A 2H1DA 4TR1B 3IXRA 2DSAA 4EXJA 3IOSA 3TKSC 3P90A 1S3DA 1V58A 3GUSA 2F8FA 1BG5A 4NAXA 4F2IA 1XWAA 1AQXA 4BVXA 4MPGA 3MWHA 1R7HA 3H1NA 2RM5A 19GSA 2H71A 1TRUA 1ILOA 3HJMA 5ECOB 3EURA 1EOGA 3U5RE 1X5CA 1VF3A 2CAIA 3ERFA 2O89A 1A24A 1YQ1A 3ZMLA 4BA7A 1X5EA 4HJMA 3UMAA 6GSSA 1G6YA 2MMAA 4HU9A 1WJKA 5AIXA 4ILFA 1KNGA 4ECBA 3VPTA 5ECKB 3WYWA 4I5QA 3E3EA 4G9HA 3HYPA 4AF2A 3NOFA 5HQPA 2NVLA 3VFIA 1IYIA 4MP4A 1M2DA 2HSYA 4JBBA 2LSTA 2LUSA 1EZKA 1AW9A 3IE3A 1Y25A 2WZ9A 3ZIJA 2VAFA 4BWQA 2TRCP 4QL9A 5FHIA 5HR3A 4TKYA 2OE0A 3UVHA 2R2JA 3KP8A 4N11A 2NPBA 1W4VA 2PBJA 1EV9A 1MEKA 5G2ZA 1NW2A 3D21A 2EIRA 1QUWA 2ZUPA 5IMCA 4NMUA 2A2RA 1PRXA 1GP1A 3AY8A 5E59A 12GSA 1S3AA 3ZITA 6GSTA 3MDKA 4IQAA 5AIVA 2GT6A 4KE3A 2OACA 1V9WA 3W8JA 4JZQA 4G19A 1X9MB 5J9BA 1FG4A 2P31A 3GX8A 2FY6A 3RBTA 5G30A 2C4JA 1G7EA 4GQFA 1Y6EA 1YEXA 1A8YA 4MZBA 1KBNA 1TDIA 4GRFA 2X8CA 4IBPA 3EC3A 1Z9HA 1TRSA 4WF4A 1YEPA 2RUEA 2VD0A 2DIZA 2VUPA 3TGZA 1GSYA 2RLIA 3CSHA 2HRKA 5H5RA 4KCEA 1HNBA 3ZLPA 1EGRA 1TU7A 3WT2A 1H4OA 1YDKA 2VM2A 3TCOA 1T7PB 4XTSA 1C72A 2R37A 2YZHA 2YNXA 2WFCA 1M2BA 5JCWA 3FHKA 4GLTA 3D6IA 5HR0A 5B7CA 4D73B 2PPTA 4OO4A 1DUGA 5EL8A 1RQMA 1TKDB 5J41A 3GMFA 2CV4A 5ECHB 1T1VA 4Z7XA 2AJQB 1XFLA 1O85A 3RHBA 2C80A 3F3QA 4EVMA 3GYKA 5D96A 2LRTA 4OMVA 5GSTA 3L9VA 11GSA 1SKSB 1TK5B 3D5JA 3VWVA 5C00A 1BAYA 5IPHA 5CNWA 6GSVA 1ZMAA 5GSSA 5EVOA 4KGIA 3ZTLA 2C0FA 3TKQA 1XVQA 4ZL7A 6GSXA 3CSIA 4DSSA 4N30A 2HZEA 2JU5A 2XC2A 1K0CA 3D4MA 3P8WA 1GSQA 2YWIA 3A3TA 4G0KA 1O81A 3TJKA 1QK8A 3C73A 2LNTA 4ZB6A 3FKFA 1YF0A 5INYA 3F63A 2JACA 5J4UA 3ZYWA 2LNSA 1YZXA 2QKEA 3I6AA 4EUYA 4BVYA 2GSTA 1NSWA 1FVKA 3I9V2 4FH8A 4TW5A 1M9BA 2FGXA 3RHCA 4TN8A 1GULA 1MDJA 1WMJA 2VL3A 4TVEA 4PUFC 3BCKA 4KX4A 2IL3A 2HRAA 5IM9A 3KH7A 1K0MA 4BL7A 4WR5A 3DXBA 2ZCTA 1XCCA 5KEJA 2ZNMA 2HE3A 8GSSA 4HS1A 3F6FA 2FHEA 5ID2A 3ZFLA 3LXTA 2MBSA 1SYRA 4V1Ag 4EF0A 4EE0A 3TJGA 4Q5QA 1ABAA 4WBRD 1DSBA 2LRNA 3GTUA 1U3AA 4HEA2 2H0HA 3A2VA 3TRPA 1QFNA 4MZWA 4I2UA 3ZMKA 20GSA 4EL1A 2GT5A 2YANA 3UAPA 4KF9A 5F0GA 2VCXA 2J9HA 3O6TA 1Z7RA 4QL7A 1TI3A 1SL0B 3CTFA 5G31A 3FZ5A 4YH2A 1UN2A 1FOVA 5H5QA 2E2GA 2YZUA 4ECIA 3HZ4A 3H8QA 1URMA 4POBA 2R3XA 4FYCA 4PQHA 5DJLA 2FUG2 3UVTA 5DQSA 3A5WA 3G7IA 5ELGA 13GSA 3QPMA 2NDOA 3UIWA 1LJRA 3HA9A 4K7OA 4CW9A 3R3EA 1G7OA 5B6MA 3IV4A 2L6CA 1YY7A 4O7HA 4PTSA 2YWNA 2VD1A 4YAVA 3EINA 4LL4B 4XS4A 2GZZA 5B8AA 1B4QA 4XRAA 4KSMA 1U88A 3TKPA 2FD3A 5JWOB 5DCGA 3EU4A 14GSA 2L59A 1OC9A 5HFKA 1TTZA 3M8NA 2LRCA 2TIRA 2TRXA 1EWXA 4ZBDA 2L5OA 2YWMA 4MJAA 2CVDA 1M99A 4MMMA 4PUAA 1UA5A 2AUVA 2AYTA 3Q6OA 2CQ9A 4WR4A 3VK9A 2E0QA 4IW9A 4XS1A 3DRNA 4ECCA 1U87A 1B8XA 2DJKA 1B9XC 5D8IA 3U6VA 3TUEA 2HNLA 2GQMA 1EP8A 5GZZB 4I6XA 3VI7A 3GH6A 1Z5YE 3VURA 3FW2A 5HFIA 1GNEA 3WGXA 3UBKA 3GN3A 2FA4A 4X0XA 3DD3A 1JLVA 5A4UA 2R4VA 1WPIA 2K8VA 1SD9A 3EU3A 2C0GA 5IMZA 1K0AA 3LGCA 5IO0A 2GSQA 2LQQA 1DE1A 4USSA 2MZCA 3F6DA 5IQYA 1HD2A 3CYNA 4XCSA 3M1GA 5DAKB 3IBHA 3IC8A 1PMTA 4XIHA 1Z6MA 4FO5A 3FEUA 5LD0A 2B7KA 2GGTA 2RM6A 3GV1A 3C1RA 5KN2A 3LFLA 2R5GA 4ZXGA 1GTUA 1W89A 3MAKA 3JCML 4YQUA 3FRCA 2C8UA 2H01A 2FWFA 1O8XA 4PURA 1A8LA 4NHWA 2H1GA 4LMVA 4F9ZA 2HI7A 2PU9C 2HYXA 3QAGA 2L6DA
chains in the Genus database with same CATH superfamily
4POKA 2IMDA 1V2AA 1XOAA 2V41A 4V2NA 4ZB9A 1N25A 2V6OA 5JCGA 1TRWA 3A5IA 1JZRA 4OFMA 3FR6A 2EFEA 2VL9A 1NHOA 1THOA 2VO4A 3UARA 2OJLA 1PD21 2VIMA 2P0GA 3G7YA 5HFGA 3QR6A 5AISA 4BIKA 2KHPA 3QMXA 4AI6A 3F4TA 4N0VA 2K9FA 1PN0A 2V6KA 2NTOA 3F8UA 3UL3A 2IMFA 4GSSA 4A5PA 1ZYPA 1ON4A 2VLTA 4LA1A 2GDRA 2CX4A 2RUFA 1V40A 2GLRA 2WCIA 3FK8A 4JR4A 3BD2A 3E0UA 5IMAA 3LYKA 1OC8A 2IIYA 2F8AA 2FNOA 1G0TA 3VWWA 4GXZA 2GTUA 1PQNA 4I8BA 1XWCA 4K7IA 3H4KA 2PUKC 3BOAA 3IAM2 4G0IA 5H5SA 3HKRA 2GQLA 2KLXA 2EFHA 1A2LA 2A4VA 1OYJA 3DVWA 3TJJA 5J4VA 1TJDA 1OAZA 3HVSA 5ECQB 4K1FA 4MJEA 1AQVA 4O5QA 1JZDA 1GTIA 3ZL5A 2LQOA 4LMWA 2L4CA 2MMOA 4K5SA 2OA7A 2MMNA 4FYBA 2VKZG 1PL2A 3KMOA 4LL1B 4YQMA 3M3MA 4GQCA 2RIIA 5CYYA 2A4HA 1ZGNA 3Q74A 1X9WB 2YP6A 2JZSA 3HMJG 1SK2A 1EEJA 5KN0A 4MJBA 2MBTA 4FXYP 2D2ZA 4X1UA 3LXZA 5ECRB 2B7JA 3HVXA 3L9SA 2WB9A 3QAWA 2YJ7A 3IK9A 4HZ4A 4MF7A 1CQHA 2F3MA 2LTKA 4KW6A 4IJ3A 1ML6A 4NHZA 3QCPA 3N5OA 1AAZA 1BJXA 2ON7A 2QSIA 3UBLA 4ZBAA 4MZCA 1M7TA 2IPAA 1OC3A 1GSUA 4FYUA 1M3IA 3K8NA 2PMTA 4I97A 2H73A 4D73A 1HYUA 3HCZA 4WEYA 1SENA 1XVWA 3ERWA 4F82A 9GSSA 4XHMA 3H79A 2V1MA 2M72A 1SL1B 2WW0A 1FB0A 1X0RA 18GSA 2XPEA 4IKHA 4Q5FA 2K8SA 2O7KA 2VCVA 3SBCA 3M9JA 3GA4A 2DJ0A 5A34A 4HJ2A 5IMDA 4ICYA 3BCIA 5D9VA 3VPQA 4GSNA 4F0CA 2IN3A 5BMUB 2DJ3A 1QQ2A 4NXIA 2PVOC 2H0IA 3TRQA 4MF6A 2AB6A 2I3YA 2LKUA 2PVQA 2H1LA 4FQUA 1TRVA 2H6XA 1OVNA 4FIWA 5ABRA 1K0NA 5J4YA 1VGLA 2C3NA 2HLSA 4TRXA 2JZTA 2LEGA 3GKXA 2L4QA 2F9SA 1JLWA 5G1KA 3GFKA 1GUMA 3QAVA 4V2LA 4NV2A 2DMLA 4HOJA 1A2JA 3KM6A 3DYRA 2B1LA 4MABA 1K3OA 3DGQA 3PPUA 2EIOA 4K7NA 4H86A 5FT3A 5D93A 1JHBA 2WRTA 4PXOA 3C7MA 4TR3A 3ZVJA 1F2EA 1QXHA 1GNWA 2VM1A 2X64A 4JEDA 2YV9A 4IS0A 4YKGA 1S3RA 3TKSA 3DIEA 5ECMB 2H6ZA 1XPVA 16GSA 4TR0A 3TDGA 3L78A 1R26A 2J23A 5D9WA 2ON5A 5ECNB 5ELAA 2H19A 1GL8A 4IGJA 3KTBA 3IHGA 3DMLA 4TXOA 3CBUA 1J9BA 5D73A 3IDVA 4OFNA 1ERUA 5IIZA 3KP9A 3Q19A 2A2PA 3ZRDA 4ML6A 4DEJA 3TOTA 2GSRA 1ST9A 2DKHA 2H1BA 3D4TA 4AJ6A 4KDXA 1YKAA 1O6JA 4ULXA 3CMIA 4PI2C 6GSYA 1T00A 2FWGA 1Q4JA 2NBSA 4OWYA 4GCIA 3NIVA 4MF5A 4XRDA 1TW9A 2YCDA 4K2XA 5L71A 4EDZA 1PN9A 1XW6A 3ZREA 4IJIA 4ZILA 4QMKA 1SK0A 5CP1A 2P5RA 4TXVA 3FZ9A 1GUKA 1PL1A 2EIQA 2B5XA 4K8MA 2XBIA 2YPMA 1ZYQB 2YOIA 1RW1A 2LJRA 2O87A 1H75A 1TK8B 1DBYA 3GSTA 3GH9A 2VCWA 4HUAA 1LBKA 1SU9A 4K0NA 1SJIA 3KZQA 2DBCA 3GKNA 5ENUA 4DSRA 2HSMB 1Z7PA 4KSOA 4JRRA 1X9SB 5JCUA 1UVZA 1BF5A 2H0GA 5A4VA 2YV7A 1I1IP 4K9ZA 4RUVA 2LJKA 4IP6A 3IRAA 4J57E 5DALB 2LV3A 1AC1A 2BTOT 5AN1A 2L57A 1GWCA 2R0GA 3TRXA 4WF5A 2YN1A 2KP2A 1O7UA 3E9JB 1M2AA 3IPZA 5KN3A 2LS5A 1PSQA 4KH7A 3RPNA 4Q5RA 1I9DA 1PX6A 2H70A 3PINA 4BWSA 4PNFA 1ERWA 2O5VA 1K3LA 1SKWB 2VLUA 5A4WA 3F9UA 2XBQA 1MTCA 3ZIVA 4TR4A 1XWBA 4TOPA 1GTAA 4KDYA 3LW9A 1NM3A 4DVCA 3WT1A 4OO5A 3GURA 1EV4A 3Q18A 1ZYNA 2VLVA 2H1AA 1YVLA 3HJPA 4HI7A 2VL2C 1GLPA 2FCHA 5F06A 4CDOA 2H30A 2DJJA 2UZ8A 3L4NA 1XIYA 1MDIA 3I43A 3FY7A 3LYPA 3CTGA 2O85A 1SL2B 5FWGA 2QGVA 3APOA 1CQGA 1VF4A 2PGTA 3CRTA 2WVXA 2REMA 3QDNA 3APQA 4ZB8A 1WOUA 3F3RA 5J5NA 2IFQA 3KEBA 2ES7A 1MD4A 3US3A 3G9BA 3VWUA 4MH2A 3TB2A 4OCFA 3S9FA 3WGDA 1TXUA 1O8WA 2AV4A 3KH9A 2V2GA 4NWYA 2WS2A 5DAKA 2X8HA 3LQ7A 2OKAA 2X99A 2GZPA 1TP9A 3V1WA 3GKKA 2KUCA 5JWQB 2L5LA 2H8LA 1Q98A 5CAXA 3UOMA 4HQSA 3W8SA 3FZAA 3DVXA 2C3QA 17GSA 1T3BA 3WGEA 3HZ8A 1OE8A 1BYEA 2JSYA 4HSCX 2WGRA 4GF0A 1SD8A 1ACVA 2BJXA 2CT6A 4G2EA 4TR1A 3GNJA 2CX3A 5CRDA 4K0GA 3CXGA 1OKDA 3I69A 1VRSD 1T4YA 5E4WA 5ECIB 2GZYA 3IHQA 3J7Yk 2HFDA 3GKMA 2C0DA 1K3YA 4JR6A 4G0LA 5HR1A 1F3AA 3G7JA 4O92A 3QFAC 3IR4A 4NV5A 2F51A 4BVXB 2R0CA 1HNCA 3TKSE 3M9KA 4IELA 5B6NA 1V57A 3HD5A 1FOHA 4IQ1A 2MMZA 1R5AA 1R4WA 3ME8A 4AJ7A 5A5HB 1K0OA 2MYGA 2ALBA 5F8BA 4PX1A 1WE0A 2N5FA 2UV8G 4F0BA 1GUHA 1PKZA 4E8EA 1B9YC 5LNKe 2FA8A 2IJYA 4YAPA 4OD7A 3HJOA 1GSSA 1TU8A 3ERGA 1XW9A 3FR9A 1YKCA 3A2WA 3F4SA 1AQWA 1TXXA 3IK7A 2DLXA 2M46A 3HHVA 1BX9A 2H66A 4IN0A 4DSQA 1RK4A 3P2AA 2CVBA 5DDLA 4WKWA 1PFOA 2YWOA 4L8EA 5EY6A 3F4RA 4IP1A 3QD9A 4N0ZA 2HRFA 2K18A 1FW1A 1XXUA 2VCTA 2GSSA 1SVMA 4POLA 1GSDA 3TJBA 1BEDA 2H75A 1XWGA 3CWGA 1X5DA 2H72A 1FAAA 1F3BA 2DIYA 3UJ1A 4WBJA 22GSA 2HSNB 5G1LA 2C1YA 4P3YB 4HU7A 4ZL8A 5GAND 5A1NB 2N5AA 1M3JA 2Z9SA 4EDYA 4ISDA 2GVPA 1NHYA 4HDEA 3W6GA 2IMKA 2B5YA 4CY6A 5CO3A 5CRGA 3PR8A 3LG6A 2KP1A 1WRYA 3BJ5A 5B8BA 4MA9A 5ECSA 2H74A 5CRWA 2C3TA 1FO5A 1VF1A 3BBYA 3CRUA 1HNAA 1XBSA 4KA0A 5HR2A 4KAEA 2PWJA 1YF1A 4OCEA 2YJHA 4MH3A 3GSSA 3NZNA 1K0BA 5C04A 4GTUA 3DKSA 3O3TA 2WDUA 1F9MA 2BMXA 2EFCA 4L5OA 4ZIJA 2XPDA 2VCZA 2M80A 1PGTA 3APSA 5J3RA 3D22A 2A2SA 4MDCA 3LEFA 1UC7A 1MD3A 2N5BA 5DBQA 2HRKB 2IWTA 3HDCA 2DKIA 3OR5A 4EC0A 4L0WA 5IOXA 3GIXA 5D9TA 10GSA 4RI7A 1GLQA 2JSZA 2G0FA 2P5QA 2B6MA 3P7XA 1GH2A 1JZOA 5GAPD 3IC4A 4V2MA 4ECJA 5CRHA 2HZFA 1BG1A 4ID0A 1GTBA 1ZYEA 2X8GA 4ZB7A 2GQKA 2VL2A 2JL4A 4AKGA 1PKWA 4CHSA 2R0PA 2WVZA 1SJZA 2DJ2A 3N9JA 2X4AA 3FYGA 4O5RA 3TU3B 4YQVA 1B48A 1SYXA 2FWHA 4KDUA 3KIJA 4XS6A 2B1KA 4GWRA 5BMUA 1XZOA 3EPTA 4L0UA 1EGOA 1K0DA 2DJ1A 4JU5A 2HSHA 1U6TA 3L9UA 5A34B 4G10A 5DVBA 5F05A 3ED3A 1AIUA 2FWEA 3KD0A 3MSZA 3PH9A 1USBA 1WIKA 1EP7A 2QC7A 4I2TA 1JFUA 2OE3A 4WXTA 2CA8A 1SKRB 4DSSB 3ZFBA 2HZEB 1TOFA 5IMFA 1Y1UA 1R5PA 3KXOA 1IYHA 2LJAA 3FR3A 1J08A 4POMA 1XWKA 1U3IA 5F07A 3J7Yb 3F0IA 1AUCA 3DWVA 4MPFA 3GL5A 4ACSA 2FLSA 4O5UA 3KTLA 1QMVA 2PERA 2CZ2A 2VOCA 3GHAA 4BVYB 2I4AA 2K6VA 2B3SA 2I81A 3IA1A 4N10A 3KJYA 1DE2A 3LJRA 1Z6NA 1SVOA 4KUNA 5KN1A 4J56E 1WP0A 4PQIA 2OE1A 4GSTA 4BL7B 5IMVA 5KOWA 3GX0A 1HQOA 1OKTA 4K6XA 1GSFA 1V98A 3ISOA 2GS3A 2CVKA 3GL3A 2OT3A 5D9XA 1E6BA 3IAS2 5IPGA 4IHUA 4W66A 1J0FA 5ID2B 2PN8A 4O32A 3C8EA 1JZWA 5G5EA 3R2QA 2H76A 3EMPA 4KCAA 4TXOB 4E8HA 3GTUB 1KTEA 1VF2A 1B4PA 1GRXA 4RI6A 1S3CA 5JWRB 2JADA 3HVVA 3O76A 2HXKA 4MK3A 3SWLA 4KNDA 1F6MC 2JZRA 2R6KA 4AJ8A 3QFBC 1ERTA 3GRXA 1QGVA 1BQ7A 1T8EB 1FHEA 3RPPA 1XW5A 3VI5A 2VCQA 2HT9A 5BRTA 4NPBA 1FB6A 6GSWA 2IMEA 1AXDA 4IVFA 1OE7A 2HSMA 2XHFA 3KCMA 2V32A 1Z3EA 4K5RA 2B5EA 2C0EA 3VLNA 5ECLB 5LCZA 1I5GA 2QA2A 3QOUA 3RDWA 5J47A 5IOWA 3A2XA 4BPYA 1TK0B 3LWAA 1ZOFA 3EVIA 2WZSA 1F37A 3CSJA 1WWJA 5DALA 3ZVJD 2E7PA 1YJ6A 3UEMA 4HQZA 2WULA 3C71A 4XS4B 1PA3A 5DQYA 4ZBBA 3HXSA 4JE1A 3HY2A 1OC9B 5DJMA 4J2FA 5EPFA 3CHXC 2IMIA 4WETA 4RQXA 1XOBA 3ZZXA 3EE2A 4KB3A 1A2MA 1A0FA 3KGKA 4F03A 4MCUA 2CZ3A 3PGTA 4MJCA 1MDKA 4PQ1A 4PGTA 4EKZA 3TKRA 3ME7A 1ZCPA 2I1UA 1TI1A 5G5FA 1ERVA 4HZ2A 2OBKA 3HVNA 3MNGA 3KMNA 2G2QA 1N8JA 5IO2A 1KEBA 1THXA 2WJUA 4ML1A 5A5KA 1ZL9A 3M0FA 6GSUA 4OFTA 3WD6A 1M0UA 3L0HA 1A23A 2AHEA 4QQ7A 4V1Ap 4MLYA 2OADA 4ZL9A 1EEMA 2H6YA 2AAWA 3TJFA 1N2AA 1FVJA 5ECPB 5AGYA 1EOHA 2WW3A 5COHA 3DEXA 4AKXB 4E68A 4LLRA 3EYTA 1SK1A 2DC5A 2WVXB 3C1SA 7GSSA 3FZ4A 3TOUA 1E2YA 2IFQB 3LSZA 5J9CA 2O8VB 1T4ZA 2O3EA 4AKIA 4EO3A 2DMMA 1M9AA 2X49A 2OBIA 1G6WA 1SJ6A 1LU4A 3H93A 1PX7A 1GSEA 3VWXA 3EWLA 1A0RP 1S4BP 4PNGA 5DCHA 3LORA 2EC4A 2CAQA 5CREA 4X43A 4AGSA 2KOKA 2I9HA 4K2DA 4Q5NA 2HRNA 4L5LA 3D0ZA 4RQRA 1ZZYA 2HQTA 2E2MA 3RAZA 3EMXA 1O73A 2H1DA 4TR1B 3IXRA 2DSAA 3MYDA 4EXJA 3IOSA 3TKSC 3P90A 1S3DA 1V58A 3GUSA 2F8FA 1BG5A 4NAXA 4F2IA 1XWAA 1AQXA 4BVXA 4MPGA 3MWHA 1R7HA 3H1NA 2RM5A 19GSA 2H71A 1TRUA 1ILOA 4MNNA 3HJMA 5ECOB 3EURA 1EOGA 3U5RE 5A5HA 1X5CA 1VF3A 2CAIA 3ERFA 2O89A 1A24A 1YQ1A 3ZMLA 4BA7A 1X5EA 4HJMA 1YEWC 3UMAA 6GSSA 1G6YA 2MMAA 4HU9A 1WJKA 5AIXA 4ILFA 1KNGA 4ECBA 3VPTA 4PI0C 5ECKB 3WYWA 4I5QA 3E3EA 4G9HA 3HYPA 4AF2A 3NOFA 5HQPA 2NVLA 3VFIA 4AKHA 1IYIA 4MP4A 4Z2UA 1M2DA 2HSYA 4JBBA 2LSTA 2LUSA 4GDFA 1EZKA 1AW9A 3IE3A 1Y25A 2WZ9A 3ZIJA 2VAFA 4BWQA 2WW2A 2TRCP 4QL9A 5FHIA 5HR3A 2HSNA 4TKYA 2OE0A 3UVHA 2R2JA 3KP8A 4N11A 2NPBA 1W4VA 2PBJA 1EV9A 1MEKA 5G2ZA 3CQFA 1NW2A 3D21A 2EIRA 1QUWA 2ZUPA 5IMCA 5A1NA 2A2RA 4NMUA 1PRXA 1GP1A 3AY8A 5E59A 12GSA 1S3AA 3ZITA 6GSTA 3MDKA 4IQAA 4EIQA 5AIVA 2GT6A 4KE3A 2OACA 1V9WA 3W8JA 4JZQA 4G19A 1X9MB 5J9BA 1FG4A 2P31A 3GX8A 2FY6A 3RBTA 5G30A 2C4JA 1G7EA 4GQFA 1Y6EA 1YEXA 1A8YA 4MZBA 4X4JA 1KBNA 1TDIA 4GRFA 2X8CA 4IBPA 3EC3A 1Z9HA 1TRSA 4WF4A 1YEPA 2RUEA 2VD0A 2DIZA 2VUPA 3TGZA 1GSYA 2RLIA 3CSHA 2HRKA 5H5RA 1SVLA 4KCEA 1HNBA 3ZLPA 1EGRA 1TU7A 3WT2A 1H4OA 1YDKA 2VM2A 3TCOA 1T7PB 4XTSA 1C72A 2R37A 2YZHA 2YNXA 2WFCA 1M2BA 5JCWA 3FHKA 4GLTA 3D6IA 5HR0A 5B7CA 4D73B 2PPTA 4OO4A 4N3ZA 1DUGA 5EL8A 1RQMA 1TKDB 5J41A 3GMFA 2CV4A 5ECHB 1T1VA 4Z7XA 2AJQB 1XFLA 1O85A 2WW1A 3RHBA 2C80A 3F3QA 4EVMA 3GYKA 5D96A 2LRTA 4OMVA 5GSTA 3L9VA 11GSA 1SKSB 1TK5B 3D5JA 3VWVA 5C00A 1BAYA 5IPHA 5CNWA 6GSVA 1ZMAA 5GSSA 5EVOA 4KGIA 3ZTLA 2C0FA 3TKQA 1XVQA 4ZL7A 6GSXA 3CSIA 1XG8A 4DSSA 4N30A 2HZEA 2JU5A 2XC2A 1K0CA 3D4MA 3P8WA 1GSQA 2YWIA 3A3TA 4G0KA 1O81A 3TJKA 1QK8A 3C73A 2LNTA 4ZB6A 3FKFA 1YF0A 5INYA 3F63A 2JACA 5J4UA 3ZYWA 3RGBC 2LNSA 1YZXA 2QKEA 3I6AA 4EUYA 4BVYA 2GSTA 1NSWA 1FVKA 3I9V2 4FH8A 4TW5A 1M9BA 2FGXA 3RHCA 4TN8A 1GULA 1MDJA 1WMJA 2VL3A 4TVEA 4PUFC 3BCKA 4KX4A 2IL3A 2HRAA 5IM9A 3KH7A 1K0MA 4BL7A 4WR5A 3DXBA 2ZCTA 1XCCA 5KEJA 2ZNMA 4CY8A 2HE3A 8GSSA 4HS1A 3F6FA 2FHEA 5ID2A 3ZFLA 3LXTA 2MBSA 1SYRA 4V1Ag 4EF0A 4EE0A 3TJGA 4Q5QA 1ABAA 4WBRD 1DSBA 2LRNA 3GTUA 1U3AA 4HEA2 2H0HA 3A2VA 3TRPA 1QFNA 4MZWA 4I2UA 3ZMKA 20GSA 4EL1A 2GT5A 2YANA 3UAPA 4KF9A 5F0GA 2VCXA 2J9HA 3O6TA 1Z7RA 4QL7A 1TI3A 1SL0B 3CTFA 5G31A 3FZ5A 4YH2A 1UN2A 1FOVA 5H5QA 2E2GA 2YZUA 4ECIA 3HZ4A 3H8QA 1URMA 4POBA 2R3XA 4FYCA 4PQHA 5J40A 5DJLA 2EFDA 2FUG2 3UVTA 5DQSA 3A5WA 3G7IA 5ELGA 4Z2RA 13GSA 3QPMA 2NDOA 3UIWA 1LJRA 3HA9A 4K7OA 4CW9A 3R3EA 1G7OA 5B6MA 3IV4A 2QA1A 2L6CA 1YY7A 4O7HA 4PTSA 2YWNA 2VD1A 4YAVA 3EINA 4LL4B 4EIPA 4XS4A 2GZZA 5B8AA 1B4QA 4XRAA 4KSMA 1U88A 3TKPA 2FD3A 5JWOB 5DCGA 3EU4A 14GSA 2L59A 1OC9A 5HFKA 1TTZA 3M8NA 2LRCA 2TIRA 2TRXA 1EWXA 4ZBDA 2L5OA 2YWMA 4MJAA 2CVDA 1M99A 4MMMA 4PUAA 1UA5A 2AUVA 4PHZC 2AYTA 3Q6OA 2CQ9A 4WR4A 3VK9A 2E0QA 4IW9A 4XS1A 3DRNA 4ECCA 1U87A 1B8XA 2DJKA 1B9XC 5D8IA 3MIXA 3U6VA 3TUEA 2HNLA 2GQMA 1EP8A 5GZZB 4I6XA 3VI7A 3GH6A 1Z5YE 3VURA 3FW2A 5HFIA 1GNEA 3WGXA 3UBKA 3GN3A 2FA4A 4X0XA 2O36A 3DD3A 1JLVA 5A4UA 2R4VA 1WPIA 2K8VA 1SD9A 4Z2TA 3EU3A 2C0GA 5IMZA 1K0AA 3LGCA 5IO0A 2GSQA 2LQQA 5KOXA 2WVYA 1DE1A 4USSA 2MZCA 3F6DA 5IQYA 1HD2A 3CYNA 4XCSA 3M1GA 5DAKB 3IBHA 3IC8A 1PMTA 4XIHA 1Z6MA 3RFRC 4FO5A 3FEUA 5LD0A 2B7KA 2GGTA 2RM6A 4G01A 3GV1A 3C1RA 3FMWA 5KN2A 3LFLA 2R5GA 4ZXGA 1GTUA 1W89A 3MAKA 3JCML 4YQUA 3FRCA 2C8UA 2H01A 2FWFA 1O8XA 4PURA 1A8LA 4NHWA 2H1GA 4LMVA 4F9ZA 2HI7A 2PU9C 2HYXA 4YKFA 3QAGA 2L6DA
chains in the Genus database with same CATH topology
4POKA 2IMDA 1V2AA 1XOAA 2V41A 4V2NA 4ZB9A 1N25A 2V6OA 5JCGA 1TRWA 3A5IA 1JZRA 4OFMA 3FR6A 2EFEA 2VL9A 1NHOA 1THOA 2VO4A 3UARA 2OJLA 1PD21 2VIMA 2P0GA 3G7YA 5HFGA 3QR6A 5AISA 2KHPA 3QMXA 4AI6A 3F4TA 4N0VA 2K9FA 1PN0A 2V6KA 2NTOA 3F8UA 3UL3A 2IMFA 4GSSA 4A5PA 1ZYPA 1ON4A 2VLTA 4LA1A 2GDRA 2CX4A 2RUFA 1V40A 2GLRA 2WCIA 3FK8A 4JR4A 3BD2A 3E0UA 5IMAA 3LYKA 1OC8A 2IIYA 2F8AA 2FNOA 1G0TA 3VWWA 4GXZA 2GTUA 1PQNA 4I8BA 1XWCA 4K7IA 3H4KA 2PUKC 3BOAA 3IAM2 4G0IA 5H5SA 3HKRA 2GQLA 2KLXA 2EFHA 1A2LA 2A4VA 1OYJA 3DVWA 3TJJA 5J4VA 1TJDA 1OAZA 3HVSA 5ECQB 4K1FA 4MJEA 1AQVA 4O5QA 1JZDA 1GTIA 3ZL5A 2LQOA 4LMWA 2L4CA 2MMOA 4K5SA 2OA7A 2MMNA 4FYBA 2VKZG 1PL2A 3KMOA 4LL1B 4YQMA 3M3MA 4GQCA 2RIIA 5CYYA 2A4HA 1ZGNA 3Q74A 1X9WB 2YP6A 2JZSA 3HMJG 1SK2A 1EEJA 5KN0A 4MJBA 2MBTA 2D2ZA 4X1UA 3LXZA 5ECRB 2B7JA 3HVXA 3L9SA 2WB9A 3QAWA 2YJ7A 3IK9A 4HZ4A 4MF7A 1CQHA 2F3MA 2LTKA 4KW6A 4IJ3A 1ML6A 4NHZA 3QCPA 3N5OA 1AAZA 1BJXA 2ON7A 2QSIA 3UBLA 4ZBAA 4MZCA 1M7TA 2IPAA 1OC3A 1GSUA 4FYUA 3K8NA 2PMTA 4I97A 2H73A 4D73A 1HYUA 3HCZA 4WEYA 1SENA 1XVWA 3ERWA 4F82A 9GSSA 4XHMA 3H79A 2V1MA 2M72A 1SL1B 1FB0A 1X0RA 18GSA 2XPEA 4IKHA 4Q5FA 2K8SA 2O7KA 2VCVA 3SBCA 3M9JA 3GA4A 2DJ0A 5A34A 4HJ2A 5IMDA 4ICYA 3BCIA 5D9VA 3VPQA 4GSNA 4F0CA 2IN3A 5BMUB 2DJ3A 1QQ2A 4NXIA 2PVOC 2H0IA 3TRQA 4MF6A 2AB6A 2I3YA 2LKUA 2PVQA 2H1LA 4FQUA 1TRVA 2H6XA 1OVNA 4FIWA 5ABRA 1K0NA 5J4YA 1VGLA 2C3NA 2HLSA 4TRXA 2JZTA 2LEGA 3GKXA 2L4QA 2F9SA 1JLWA 5G1KA 3GFKA 1GUMA 3QAVA 4V2LA 4NV2A 2DMLA 4HOJA 1A2JA 3KM6A 3DYRA 2B1LA 4MABA 1K3OA 3DGQA 3PPUA 2EIOA 4K7NA 4H86A 5FT3A 5D93A 1JHBA 2WRTA 4PXOA 3C7MA 4TR3A 3ZVJA 1F2EA 1QXHA 1GNWA 2VM1A 2X64A 4JEDA 2YV9A 4IS0A 4YKGA 3TKSA 3DIEA 5ECMB 2H6ZA 1XPVA 16GSA 4TR0A 3TDGA 3L78A 1R26A 2J23A 5D9WA 2ON5A 5ECNB 5ELAA 2H19A 1GL8A 4IGJA 3KTBA 3IHGA 3DMLA 4TXOA 3CBUA 1J9BA 5D73A 3IDVA 4OFNA 1ERUA 5IIZA 3KP9A 3Q19A 2A2PA 3ZRDA 4ML6A 4DEJA 3TOTA 2GSRA 1ST9A 2DKHA 2H1BA 3D4TA 4AJ6A 4KDXA 1YKAA 1O6JA 4ULXA 3CMIA 6GSYA 1T00A 2FWGA 1Q4JA 2NBSA 4OWYA 4GCIA 3NIVA 4MF5A 4XRDA 1TW9A 2YCDA 4K2XA 5L71A 4EDZA 1PN9A 1XW6A 3ZREA 4IJIA 4ZILA 4QMKA 1SK0A 5CP1A 2P5RA 4TXVA 3FZ9A 1GUKA 1PL1A 2EIQA 2B5XA 4K8MA 2XBIA 2YPMA 1ZYQB 2YOIA 1RW1A 2LJRA 2O87A 1H75A 1TK8B 1DBYA 3GSTA 2VCWA 3GH9A 4HUAA 1LBKA 1SU9A 4K0NA 1SJIA 3KZQA 2DBCA 3GKNA 5ENUA 4DSRA 2HSMB 1Z7PA 4KSOA 4JRRA 1X9SB 5JCUA 1UVZA 1BF5A 2H0GA 5A4VA 2YV7A 4K9ZA 4RUVA 2LJKA 4IP6A 3IRAA 4J57E 5DALB 2LV3A 1AC1A 2BTOT 5AN1A 2L57A 1GWCA 2R0GA 3TRXA 4WF5A 2YN1A 2KP2A 1O7UA 3E9JB 1M2AA 3IPZA 5KN3A 2LS5A 1PSQA 4KH7A 3RPNA 4Q5RA 1I9DA 1PX6A 2H70A 3PINA 4BWSA 4PNFA 1ERWA 2O5VA 1K3LA 1SKWB 2VLUA 5A4WA 3F9UA 2XBQA 1MTCA 3ZIVA 4TR4A 1XWBA 4TOPA 1GTAA 4KDYA 3LW9A 1NM3A 4DVCA 3WT1A 4OO5A 3GURA 1EV4A 3Q18A 1ZYNA 2VLVA 2H1AA 1YVLA 3HJPA 4HI7A 2VL2C 1GLPA 2FCHA 5F06A 4CDOA 2H30A 2DJJA 2UZ8A 3L4NA 1XIYA 1MDIA 3I43A 3FY7A 3LYPA 3CTGA 2O85A 1SL2B 5FWGA 2QGVA 3APOA 1CQGA 1VF4A 2PGTA 3CRTA 2REMA 3QDNA 3APQA 4ZB8A 1WOUA 3F3RA 5J5NA 2IFQA 3KEBA 2ES7A 1MD4A 3US3A 3G9BA 3VWUA 4MH2A 3TB2A 4OCFA 3S9FA 3WGDA 1TXUA 1O8WA 2AV4A 3KH9A 2V2GA 4NWYA 2WS2A 5DAKA 2X8HA 3LQ7A 2OKAA 2X99A 2GZPA 1TP9A 3V1WA 3GKKA 2KUCA 5JWQB 2L5LA 2H8LA 1Q98A 5CAXA 3UOMA 4HQSA 3W8SA 3FZAA 3DVXA 2C3QA 17GSA 1T3BA 3WGEA 3HZ8A 1OE8A 1BYEA 2JSYA 2WGRA 4GF0A 1SD8A 1ACVA 2BJXA 2CT6A 4G2EA 4TR1A 3GNJA 2CX3A 5CRDA 4K0GA 3CXGA 1OKDA 3I69A 1VRSD 1T4YA 5E4WA 5ECIB 2GZYA 3IHQA 3J7Yk 2HFDA 3GKMA 2C0DA 1K3YA 4JR6A 4G0LA 5HR1A 1F3AA 3G7JA 4O92A 3QFAC 3IR4A 4NV5A 2F51A 4BVXB 2R0CA 1HNCA 3TKSE 3M9KA 4IELA 5B6NA 1V57A 3HD5A 1FOHA 4IQ1A 2MMZA 1R5AA 1R4WA 3ME8A 4AJ7A 5A5HB 1K0OA 2MYGA 2ALBA 5F8BA 4PX1A 1WE0A 2N5FA 2UV8G 4F0BA 1GUHA 1PKZA 4E8EA 1B9YC 5LNKe 2FA8A 2IJYA 4YAPA 4OD7A 3HJOA 1GSSA 1TU8A 3ERGA 1XW9A 3FR9A 1YKCA 3A2WA 3F4SA 1AQWA 1TXXA 3IK7A 2DLXA 2M46A 3HHVA 1BX9A 2H66A 4IN0A 4DSQA 1RK4A 3P2AA 2CVBA 5DDLA 4WKWA 2YWOA 4L8EA 5EY6A 3F4RA 4IP1A 3QD9A 4N0ZA 2HRFA 2K18A 1FW1A 1XXUA 2VCTA 2GSSA 1SVMA 4POLA 1GSDA 3TJBA 1BEDA 2H75A 1XWGA 3CWGA 1X5DA 2H72A 1FAAA 1F3BA 2DIYA 3UJ1A 4WBJA 22GSA 2HSNB 5G1LA 2C1YA 4P3YB 4HU7A 4ZL8A 5GAND 5A1NB 2N5AA 2Z9SA 4EDYA 4ISDA 2GVPA 1NHYA 4HDEA 3W6GA 2IMKA 2B5YA 4CY6A 5CO3A 5CRGA 3PR8A 3LG6A 2KP1A 1WRYA 3BJ5A 5B8BA 4MA9A 5ECSA 2H74A 5CRWA 2C3TA 1FO5A 1VF1A 3BBYA 3CRUA 1HNAA 1XBSA 4KA0A 5HR2A 4KAEA 2PWJA 1YF1A 4OCEA 2YJHA 4MH3A 3GSSA 3NZNA 1K0BA 5C04A 4GTUA 3DKSA 3O3TA 2WDUA 1F9MA 2BMXA 2EFCA 4L5OA 4ZIJA 2XPDA 2VCZA 2M80A 1PGTA 3APSA 5J3RA 3D22A 2A2SA 4MDCA 3LEFA 1UC7A 1MD3A 2N5BA 5DBQA 2HRKB 2IWTA 3HDCA 2DKIA 3OR5A 4EC0A 4L0WA 5IOXA 3GIXA 5D9TA 10GSA 4RI7A 1GLQA 2JSZA 2G0FA 2P5QA 2B6MA 3P7XA 1GH2A 1JZOA 5GAPD 3IC4A 4V2MA 4ECJA 5CRHA 2HZFA 1BG1A 4ID0A 1GTBA 1ZYEA 2X8GA 4ZB7A 2GQKA 2VL2A 2JL4A 4AKGA 1PKWA 4CHSA 2R0PA 1SJZA 2DJ2A 3N9JA 2X4AA 3FYGA 4O5RA 3TU3B 4YQVA 1B48A 1SYXA 2FWHA 4KDUA 3KIJA 4XS6A 2B1KA 4GWRA 5BMUA 1XZOA 3EPTA 4L0UA 1EGOA 1K0DA 2DJ1A 4JU5A 2HSHA 1U6TA 3L9UA 5A34B 4G10A 5DVBA 5F05A 3ED3A 1AIUA 2FWEA 3KD0A 3MSZA 3PH9A 1USBA 1WIKA 1EP7A 2QC7A 4I2TA 1JFUA 2OE3A 4WXTA 2CA8A 1SKRB 4DSSB 3ZFBA 2HZEB 1TOFA 5IMFA 1Y1UA 1R5PA 3KXOA 1IYHA 2LJAA 3FR3A 1J08A 4POMA 1XWKA 1U3IA 5F07A 3J7Yb 3F0IA 1AUCA 3DWVA 4MPFA 3GL5A 4ACSA 2FLSA 4O5UA 3KTLA 1QMVA 2PERA 2CZ2A 2VOCA 3GHAA 4BVYB 2I4AA 2K6VA 2B3SA 2I81A 3IA1A 4N10A 3KJYA 1DE2A 3LJRA 1Z6NA 1SVOA 4KUNA 5KN1A 4J56E 1WP0A 4PQIA 2OE1A 4GSTA 4BL7B 5IMVA 5KOWA 3GX0A 1HQOA 1OKTA 4K6XA 1GSFA 1V98A 3ISOA 2GS3A 2CVKA 3GL3A 2OT3A 5D9XA 1E6BA 3IAS2 5IPGA 4IHUA 4W66A 1J0FA 5ID2B 2PN8A 4O32A 3C8EA 1JZWA 5G5EA 3R2QA 2H76A 3EMPA 4KCAA 4TXOB 4E8HA 3GTUB 1KTEA 1VF2A 1B4PA 1GRXA 4RI6A 1S3CA 5JWRB 2JADA 3HVVA 3O76A 2HXKA 4MK3A 3SWLA 4KNDA 1F6MC 2JZRA 2R6KA 4AJ8A 3QFBC 1ERTA 3GRXA 1QGVA 1BQ7A 1T8EB 1FHEA 3RPPA 1XW5A 3VI5A 2VCQA 2HT9A 5BRTA 4NPBA 1FB6A 6GSWA 2IMEA 1AXDA 4IVFA 1OE7A 2HSMA 2XHFA 3KCMA 2V32A 1Z3EA 4K5RA 2B5EA 2C0EA 3VLNA 5ECLB 5LCZA 1I5GA 2QA2A 3QOUA 3RDWA 5J47A 5IOWA 3A2XA 4BPYA 1TK0B 3LWAA 1ZOFA 3EVIA 1F37A 3CSJA 1WWJA 5DALA 3ZVJD 2E7PA 1YJ6A 3UEMA 4HQZA 2WULA 3C71A 4XS4B 1PA3A 5DQYA 4ZBBA 3HXSA 4JE1A 3HY2A 1OC9B 5DJMA 4J2FA 5EPFA 2IMIA 4WETA 4RQXA 1XOBA 3ZZXA 3EE2A 4KB3A 1A2MA 1A0FA 3KGKA 4F03A 4MCUA 2CZ3A 3PGTA 4MJCA 1MDKA 4PQ1A 4PGTA 4EKZA 3TKRA 3ME7A 1ZCPA 2I1UA 1TI1A 5G5FA 1ERVA 4HZ2A 2OBKA 3MNGA 3KMNA 2G2QA 1N8JA 5IO2A 1KEBA 1THXA 2WJUA 4ML1A 5A5KA 1ZL9A 3M0FA 6GSUA 4OFTA 3WD6A 1M0UA 3L0HA 1A23A 2AHEA 4QQ7A 4V1Ap 4MLYA 2OADA 4ZL9A 1EEMA 2H6YA 2AAWA 3TJFA 1N2AA 1FVJA 5ECPB 5AGYA 1EOHA 5COHA 3DEXA 4AKXB 4E68A 4LLRA 3EYTA 1SK1A 2DC5A 3C1SA 7GSSA 3FZ4A 3TOUA 1E2YA 2IFQB 3LSZA 5J9CA 2O8VB 1T4ZA 4AKIA 4EO3A 2DMMA 1M9AA 2X49A 2OBIA 1G6WA 1SJ6A 1LU4A 3H93A 1PX7A 1GSEA 3VWXA 3EWLA 1A0RP 4PNGA 5DCHA 3LORA 2EC4A 2CAQA 5CREA 4X43A 4AGSA 2KOKA 2I9HA 4K2DA 4Q5NA 2HRNA 4L5LA 3D0ZA 4RQRA 1ZZYA 2HQTA 2E2MA 3RAZA 3EMXA 1O73A 2H1DA 4TR1B 3IXRA 2DSAA 3MYDA 4EXJA 3IOSA 3TKSC 3P90A 1S3DA 1V58A 3GUSA 2F8FA 1BG5A 4NAXA 4F2IA 1XWAA 1AQXA 4BVXA 4MPGA 3MWHA 1R7HA 3H1NA 2RM5A 19GSA 2H71A 1TRUA 1ILOA 4MNNA 3HJMA 5ECOB 3EURA 1EOGA 3U5RE 5A5HA 1X5CA 1VF3A 2CAIA 3ERFA 2O89A 1A24A 1YQ1A 3ZMLA 4BA7A 1X5EA 4HJMA 3UMAA 6GSSA 1G6YA 2MMAA 4HU9A 1WJKA 5AIXA 4ILFA 1KNGA 4ECBA 3VPTA 5ECKB 3WYWA 4I5QA 3E3EA 4G9HA 3HYPA 4AF2A 3NOFA 5HQPA 2NVLA 3VFIA 4AKHA 1IYIA 4MP4A 4Z2UA 1M2DA 2HSYA 4JBBA 2LSTA 2LUSA 4GDFA 1EZKA 1AW9A 3IE3A 1Y25A 2WZ9A 3ZIJA 2VAFA 4BWQA 2TRCP 4QL9A 5FHIA 5HR3A 2HSNA 4TKYA 2OE0A 3UVHA 2R2JA 3KP8A 4N11A 2NPBA 1W4VA 2PBJA 1EV9A 1MEKA 5G2ZA 1NW2A 3D21A 2EIRA 1QUWA 2ZUPA 5IMCA 5A1NA 2A2RA 4NMUA 1PRXA 1GP1A 3AY8A 5E59A 12GSA 1S3AA 3ZITA 6GSTA 3MDKA 4IQAA 4EIQA 5AIVA 2GT6A 4KE3A 2OACA 1V9WA 3W8JA 4JZQA 4G19A 1X9MB 5J9BA 1FG4A 2P31A 3GX8A 2FY6A 3RBTA 5G30A 2C4JA 1G7EA 4GQFA 1Y6EA 1YEXA 1A8YA 4MZBA 4X4JA 1KBNA 1TDIA 4GRFA 2X8CA 4IBPA 3EC3A 1Z9HA 1TRSA 4WF4A 1YEPA 2RUEA 2VD0A 2DIZA 2VUPA 3TGZA 1GSYA 2RLIA 3CSHA 2HRKA 5H5RA 1SVLA 4KCEA 1HNBA 3ZLPA 1EGRA 1TU7A 3WT2A 1H4OA 1YDKA 2VM2A 3TCOA 1T7PB 4XTSA 1C72A 2R37A 2YZHA 2YNXA 2WFCA 1M2BA 5JCWA 3FHKA 4GLTA 3D6IA 5HR0A 5B7CA 4D73B 2PPTA 4OO4A 4N3ZA 1DUGA 5EL8A 1RQMA 1TKDB 5J41A 3GMFA 2CV4A 5ECHB 1T1VA 4Z7XA 2AJQB 1XFLA 1O85A 3RHBA 2C80A 3F3QA 4EVMA 3GYKA 5D96A 2LRTA 4OMVA 5GSTA 3L9VA 11GSA 1SKSB 1TK5B 3D5JA 3VWVA 5C00A 1BAYA 5IPHA 5CNWA 6GSVA 1ZMAA 5GSSA 5EVOA 4KGIA 3ZTLA 2C0FA 3TKQA 1XVQA 4ZL7A 6GSXA 3CSIA 4DSSA 4N30A 2HZEA 2JU5A 2XC2A 1K0CA 3D4MA 3P8WA 1GSQA 2YWIA 3A3TA 4G0KA 1O81A 3TJKA 1QK8A 3C73A 2LNTA 4ZB6A 3FKFA 1YF0A 5INYA 3F63A 2JACA 5J4UA 3ZYWA 2LNSA 1YZXA 2QKEA 3I6AA 4EUYA 4BVYA 2GSTA 1NSWA 1FVKA 3I9V2 4FH8A 4TW5A 1M9BA 2FGXA 3RHCA 4TN8A 1GULA 1MDJA 1WMJA 2VL3A 4TVEA 4PUFC 3BCKA 4KX4A 2IL3A 2HRAA 5IM9A 3KH7A 1K0MA 4BL7A 4WR5A 3DXBA 2ZCTA 1XCCA 5KEJA 2ZNMA 4CY8A 2HE3A 8GSSA 4HS1A 3F6FA 2FHEA 5ID2A 3ZFLA 3LXTA 2MBSA 1SYRA 4V1Ag 4EF0A 4EE0A 3TJGA 4Q5QA 1ABAA 4WBRD 1DSBA 2LRNA 3GTUA 1U3AA 4HEA2 2H0HA 3A2VA 3TRPA 1QFNA 4MZWA 4I2UA 3ZMKA 20GSA 4EL1A 2GT5A 2YANA 3UAPA 4KF9A 5F0GA 2VCXA 2J9HA 3O6TA 1Z7RA 4QL7A 1TI3A 1SL0B 3CTFA 5G31A 3FZ5A 4YH2A 1UN2A 1FOVA 5H5QA 2E2GA 2YZUA 4ECIA 3HZ4A 3H8QA 1URMA 4POBA 2R3XA 4FYCA 4PQHA 5J40A 5DJLA 2EFDA 2FUG2 3UVTA 5DQSA 3A5WA 3G7IA 5ELGA 4Z2RA 13GSA 3QPMA 2NDOA 3UIWA 1LJRA 3HA9A 4K7OA 4CW9A 3R3EA 1G7OA 5B6MA 3IV4A 2QA1A 2L6CA 1YY7A 4O7HA 4PTSA 2YWNA 2VD1A 4YAVA 3EINA 4LL4B 4EIPA 4XS4A 2GZZA 5B8AA 1B4QA 4XRAA 4KSMA 1U88A 3TKPA 2FD3A 5JWOB 5DCGA 3EU4A 14GSA 2L59A 1OC9A 5HFKA 1TTZA 3M8NA 2LRCA 2TIRA 2TRXA 1EWXA 4ZBDA 2L5OA 2YWMA 4MJAA 2CVDA 1M99A 4MMMA 4PUAA 1UA5A 2AUVA 2AYTA 3Q6OA 2CQ9A 4WR4A 3VK9A 2E0QA 4IW9A 4XS1A 3DRNA 4ECCA 1U87A 1B8XA 2DJKA 1B9XC 5D8IA 3MIXA 3U6VA 3TUEA 2HNLA 2GQMA 1EP8A 5GZZB 4I6XA 3VI7A 3GH6A 1Z5YE 3VURA 3FW2A 5HFIA 1GNEA 3WGXA 3UBKA 3GN3A 2FA4A 4X0XA 3DD3A 1JLVA 5A4UA 2R4VA 1WPIA 2K8VA 1SD9A 4Z2TA 3EU3A 2C0GA 5IMZA 1K0AA 3LGCA 5IO0A 2GSQA 2LQQA 5KOXA 1DE1A 4USSA 2MZCA 3F6DA 5IQYA 1HD2A 3CYNA 4XCSA 3M1GA 5DAKB 3IBHA 3IC8A 1PMTA 4XIHA 1Z6MA 4FO5A 3FEUA 5LD0A 2B7KA 2GGTA 2RM6A 4G01A 3GV1A 3C1RA 3FMWA 5KN2A 3LFLA 2R5GA 4ZXGA 1GTUA 1W89A 3MAKA 3JCML 4YQUA 3FRCA 2C8UA 2H01A 2FWFA 1O8XA 4PURA 1A8LA 4NHWA 2H1GA 4LMVA 4F9ZA 2HI7A 2PU9C 2HYXA 4YKFA 3QAGA 2L6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POK A;  2IMD A;  1V2A A;  1XOA A;  2V41 A;  4V2N A;  4ZB9 A;  2V6O A;  5JCG A;  1TRW A;  1JZR A;  4OFM A;  3FR6 A;  2VL9 A;  1NHO A;  1THO A;  2VO4 A;  3UAR A;  2OJL A;  1PD2 1;  2VIM A;  2P0G A;  3G7Y A;  5HFG A;  3QR6 A;  5AIS A;  2KHP A;  3QMX A;  3F4T A;  4N0V A;  2K9F A;  2V6K A;  2NTO A;  3F8U A;  3UL3 A;  2IMF A;  4GSS A;  1ON4 A;  2VLT A;  4LA1 A;  2GDR A;  2CX4 A;  2RUF A;  1V40 A;  2GLR A;  2WCI A;  3FK8 A;  4JR4 A;  3BD2 A;  3E0U A;  5IMA A;  3LYK A;  1OC8 A;  2IIY A;  2F8A A;  2FNO A;  1G0T A;  3VWW A;  4GXZ A;  2GTU A;  1PQN A;  4I8B A;  1XWC A;  4K7I A;  3H4K A;  2PUK C;  3BOA A;  3IAM 2;  4G0I A;  5H5S A;  3HKR A;  2GQL A;  2KLX A;  1A2L A;  2A4V A;  1OYJ A;  3DVW A;  3TJJ A;  1TJD A;  1OAZ A;  3HVS A;  5ECQ B;  4K1F A;  4MJE A;  1AQV A;  1JZD A;  1GTI A;  3ZL5 A;  2LQO A;  4LMW A;  2L4C A;  2MMO A;  2OA7 A;  2MMN A;  4FYB A;  1PL2 A;  3KMO A;  4LL1 B;  4YQM A;  3M3M A;  4GQC A;  2RII A;  5CYY A;  1ZGN A;  3Q74 A;  1X9W B;  2YP6 A;  2JZS A;  1SK2 A;  1EEJ A;  5KN0 A;  4MJB A;  2MBT A;  2D2Z A;  4X1U A;  3LXZ A;  5ECR B;  2B7J A;  3HVX A;  3L9S A;  2WB9 A;  3QAW A;  2YJ7 A;  3IK9 A;  4HZ4 A;  4MF7 A;  1CQH A;  2F3M A;  2LTK A;  4KW6 A;  4IJ3 A;  1ML6 A;  4NHZ A;  3QCP A;  3N5O A;  1AAZ A;  1BJX A;  2ON7 A;  2QSI A;  3UBL A;  4ZBA A;  4MZC A;  1M7T A;  2IPA A;  1OC3 A;  1GSU A;  4FYU A;  3K8N A;  2PMT A;  4I97 A;  2H73 A;  4D73 A;  1HYU A;  3HCZ A;  4WEY A;  1SEN A;  1XVW A;  3ERW A;  4F82 A;  9GSS A;  4XHM A;  3H79 A;  2V1M A;  2M72 A;  1SL1 B;  1FB0 A;  1X0R A;  18GS A;  2XPE A;  4IKH A;  4Q5F A;  2K8S A;  2O7K A;  2VCV A;  3SBC A;  3M9J A;  3GA4 A;  2DJ0 A;  4HJ2 A;  5IMD A;  3BCI A;  5D9V A;  3VPQ A;  4GSN A;  4F0C A;  2IN3 A;  4NXI A;  2DJ3 A;  1QQ2 A;  2PVO C;  2H0I A;  3TRQ A;  4MF6 A;  2AB6 A;  2I3Y A;  2LKU A;  2PVQ A;  4FQU A;  1TRV A;  2H6X A;  1OVN A;  4FIW A;  5ABR A;  1K0N A;  1VGL A;  2C3N A;  2HLS A;  4TRX A;  2JZT A;  2LEG A;  3GKX A;  2L4Q A;  2F9S A;  1JLW A;  5G1K A;  3GFK A;  1GUM A;  3QAV A;  4V2L A;  4NV2 A;  2DML A;  4HOJ A;  1A2J A;  3KM6 A;  3DYR A;  2B1L A;  4MAB A;  1K3O A;  3DGQ A;  3PPU A;  2EIO A;  4K7N A;  4H86 A;  5FT3 A;  5D93 A;  1JHB A;  2WRT A;  4PXO A;  3C7M A;  4TR3 A;  3ZVJ A;  1F2E A;  1QXH A;  1GNW A;  2VM1 A;  2X64 A;  4JED A;  2YV9 A;  4IS0 A;  3TKS A;  3DIE A;  5ECM B;  2H6Z A;  1XPV A;  16GS A;  4TR0 A;  3TDG A;  3L78 A;  1R26 A;  2J23 A;  5D9W A;  2ON5 A;  5ECN B;  5ELA A;  2H19 A;  1GL8 A;  4IGJ A;  3KTB A;  3DML A;  4TXO A;  3CBU A;  1J9B A;  5D73 A;  3IDV A;  4OFN A;  1ERU A;  5IIZ A;  3KP9 A;  3Q19 A;  3ZRD A;  4ML6 A;  4DEJ A;  3TOT A;  2GSR A;  1ST9 A;  2H1B A;  3D4T A;  4AJ6 A;  4KDX A;  1YKA A;  1O6J A;  4ULX A;  3CMI A;  6GSY A;  1T00 A;  2FWG A;  1Q4J A;  2NBS A;  4OWY A;  4GCI A;  3NIV A;  4MF5 A;  4XRD A;  1TW9 A;  2YCD A;  5L71 A;  4EDZ A;  1PN9 A;  1XW6 A;  3ZRE A;  4IJI A;  4ZIL A;  1SK0 A;  5CP1 A;  2P5R A;  4TXV A;  3FZ9 A;  1GUK A;  1PL1 A;  2EIQ A;  2B5X A;  4K8M A;  2XBI A;  2YPM A;  1ZYQ B;  2YOI A;  1RW1 A;  2LJR A;  2O87 A;  1H75 A;  1TK8 B;  1DBY A;  3GST A;  2VCW A;  3GH9 A;  4HUA A;  1LBK A;  1SU9 A;  4K0N A;  1SJI A;  3KZQ A;  2DBC A;  3GKN A;  5ENU A;  4DSR A;  2HSM B;  1Z7P A;  4KSO A;  4JRR A;  1X9S B;  5JCU A;  1UVZ A;  2H0G A;  5A4V A;  2YV7 A;  4K9Z A;  4RUV A;  2LJK A;  4IP6 A;  3IRA A;  4J57 E;  5DAL B;  2LV3 A;  1AC1 A;  2BTO T;  5AN1 A;  2L57 A;  1GWC A;  3TRX A;  4WF5 A;  2YN1 A;  2KP2 A;  1O7U A;  3E9J B;  1M2A A;  3IPZ A;  5KN3 A;  2LS5 A;  1PSQ A;  4KH7 A;  3RPN A;  4Q5R A;  1I9D A;  1PX6 A;  2H70 A;  3PIN A;  4BWS A;  4PNF A;  1ERW A;  1K3L A;  1SKW B;  2VLU A;  5A4W A;  3F9U A;  2XBQ A;  1MTC A;  3ZIV A;  4TR4 A;  1XWB A;  4TOP A;  1GTA A;  4KDY A;  1NM3 A;  4DVC A;  3WT1 A;  4OO5 A;  3GUR A;  1EV4 A;  3Q18 A;  2VLV A;  2H1A A;  3HJP A;  4HI7 A;  2VL2 C;  1GLP A;  2FCH A;  5F06 A;  4CDO A;  2H30 A;  2DJJ A;  2UZ8 A;  3L4N A;  1XIY A;  1MDI A;  3I43 A;  3FY7 A;  3LYP A;  3CTG A;  2O85 A;  1SL2 B;  5FWG A;  2QGV A;  3APO A;  1CQG A;  1VF4 A;  2PGT A;  3CRT A;  2REM A;  3QDN A;  3APQ A;  4ZB8 A;  1WOU A;  3F3R A;  5J5N A;  2IFQ A;  3KEB A;  2ES7 A;  1MD4 A;  3US3 A;  3G9B A;  3VWU A;  4MH2 A;  3TB2 A;  4OCF A;  3S9F A;  3WGD A;  1O8W A;  2AV4 A;  3KH9 A;  2V2G A;  4NWY A;  2WS2 A;  5DAK A;  2X8H A;  3LQ7 A;  2OKA A;  2X99 A;  2GZP A;  1TP9 A;  3V1W A;  3GKK A;  2KUC A;  5JWQ B;  2L5L A;  2H8L A;  1Q98 A;  5CAX A;  3UOM A;  4HQS A;  3W8S A;  3FZA A;  3DVX A;  2C3Q A;  17GS A;  1T3B A;  3WGE A;  3HZ8 A;  1OE8 A;  1BYE A;  2JSY A;  2WGR A;  4GF0 A;  1SD8 A;  1ACV A;  2BJX A;  2CT6 A;  4G2E A;  4TR1 A;  3GNJ A;  2CX3 A;  5CRD A;  4K0G A;  3CXG A;  1OKD A;  3I69 A;  1VRS D;  1T4Y A;  5E4W A;  5ECI B;  2GZY A;  3IHQ A;  3J7Y k;  2HFD A;  3GKM A;  2C0D A;  1K3Y A;  4JR6 A;  4G0L A;  5HR1 A;  1F3A A;  3G7J A;  4O92 A;  3QFA C;  3IR4 A;  4NV5 A;  2F51 A;  4BVX B;  1HNC A;  3TKS E;  3M9K A;  4IEL A;  5B6N A;  1V57 A;  3HD5 A;  4IQ1 A;  2MMZ A;  1R5A A;  1R4W A;  3ME8 A;  4AJ7 A;  1K0O A;  2MYG A;  2ALB A;  5F8B A;  4PX1 A;  1WE0 A;  2N5F A;  4F0B A;  1GUH A;  1PKZ A;  4E8E A;  1B9Y C;  5LNK e;  2FA8 A;  2IJY A;  4YAP A;  4OD7 A;  3HJO A;  1GSS A;  1TU8 A;  3ERG A;  1XW9 A;  3FR9 A;  1YKC A;  3A2W A;  3F4S A;  1AQW A;  1TXX A;  3IK7 A;  2DLX A;  2M46 A;  3HHV A;  1BX9 A;  2H66 A;  4IN0 A;  4DSQ A;  1RK4 A;  3P2A A;  2CVB A;  5DDL A;  4WKW A;  2YWO A;  4L8E A;  5EY6 A;  3F4R A;  4IP1 A;  3QD9 A;  4N0Z A;  2HRF A;  2K18 A;  1FW1 A;  1XXU A;  2VCT A;  2GSS A;  4POL A;  1GSD A;  3TJB A;  1BED A;  2H75 A;  1XWG A;  1X5D A;  2H72 A;  1FAA A;  1F3B A;  2DIY A;  3UJ1 A;  4WBJ A;  22GS A;  2HSN B;  5G1L A;  2C1Y A;  4P3Y B;  4HU7 A;  4ZL8 A;  5GAN D;  2N5A A;  2Z9S A;  4EDY A;  4ISD A;  2GVP A;  1NHY A;  4HDE A;  3W6G A;  2IMK A;  2B5Y A;  5CO3 A;  5CRG A;  3PR8 A;  3LG6 A;  2KP1 A;  1WRY A;  3BJ5 A;  5B8B A;  4MA9 A;  5ECS A;  2H74 A;  5CRW A;  2C3T A;  1FO5 A;  1VF1 A;  3BBY A;  3CRU A;  1HNA A;  1XBS A;  4KA0 A;  5HR2 A;  4KAE A;  2PWJ A;  1YF1 A;  4OCE A;  2YJH A;  4MH3 A;  3GSS A;  3NZN A;  1K0B A;  5C04 A;  4GTU A;  3DKS A;  3O3T A;  2WDU A;  1F9M A;  2BMX A;  4L5O A;  4ZIJ A;  2XPD A;  2VCZ A;  2M80 A;  1PGT A;  3APS A;  5J3R A;  3D22 A;  2A2S A;  4MDC A;  3LEF A;  1UC7 A;  1MD3 A;  2N5B A;  5DBQ A;  2HRK B;  2IWT A;  3HDC A;  3OR5 A;  4EC0 A;  4L0W A;  5IOX A;  3GIX A;  5D9T A;  10GS A;  4RI7 A;  1GLQ A;  2JSZ A;  2G0F A;  2P5Q A;  2B6M A;  3P7X A;  1GH2 A;  1JZO A;  5GAP D;  3IC4 A;  4V2M A;  4ECJ A;  5CRH A;  2HZF A;  4ID0 A;  1GTB A;  1ZYE A;  2X8G A;  2GQK A;  2VL2 A;  2JL4 A;  1PKW A;  4CHS A;  1SJZ A;  2DJ2 A;  3N9J A;  3FYG A;  4O5R A;  4YQV A;  1B48 A;  1SYX A;  2FWH A;  4KDU A;  3KIJ A;  4XS6 A;  2B1K A;  4GWR A;  5BMU A;  1XZO A;  4L0U A;  1EGO A;  1K0D A;  2DJ1 A;  4JU5 A;  2HSH A;  1U6T A;  3L9U A;  4G10 A;  5DVB A;  5F05 A;  3ED3 A;  1AIU A;  2FWE A;  3KD0 A;  3MSZ A;  3PH9 A;  1USB A;  1WIK A;  1EP7 A;  2QC7 A;  4I2T A;  1JFU A;  2OE3 A;  4WXT A;  2CA8 A;  1SKR B;  4DSS B;  3ZFB A;  2HZE B;  1TOF A;  5IMF A;  1R5P A;  3KXO A;  1IYH A;  2LJA A;  3FR3 A;  1J08 A;  4POM A;  1XWK A;  1U3I A;  5F07 A;  3J7Y b;  3F0I A;  1AUC A;  3DWV A;  4MPF A;  3GL5 A;  4ACS A;  2FLS A;  3KTL A;  1QMV A;  2PER A;  2CZ2 A;  2VOC A;  3GHA A;  4BVY B;  2I4A A;  2K6V A;  2B3S A;  2I81 A;  3IA1 A;  4N10 A;  3KJY A;  1DE2 A;  3LJR A;  1Z6N A;  4KUN A;  5KN1 A;  4J56 E;  1WP0 A;  4PQI A;  2OE1 A;  4GST A;  4BL7 B;  5IMV A;  3GX0 A;  1HQO A;  1OKT A;  4K6X A;  1GSF A;  1V98 A;  3ISO A;  2GS3 A;  2CVK A;  3GL3 A;  5D9X A;  1E6B A;  3IAS 2;  5IPG A;  4IHU A;  1J0F A;  5ID2 B;  2PN8 A;  4O32 A;  3C8E A;  1JZW A;  5G5E A;  3R2Q A;  2H76 A;  3EMP A;  4KCA A;  4TXO B;  4E8H A;  3GTU B;  1KTE A;  1VF2 A;  1B4P A;  1GRX A;  4RI6 A;  1S3C A;  5JWR B;  2JAD A;  3HVV A;  3O76 A;  2HXK A;  4MK3 A;  3SWL A;  4KND A;  1F6M C;  2JZR A;  2R6K A;  4AJ8 A;  3QFB C;  1ERT A;  3GRX A;  1QGV A;  1BQ7 A;  1T8E B;  1FHE A;  3RPP A;  1XW5 A;  3VI5 A;  2VCQ A;  2HT9 A;  4NPB A;  1FB6 A;  6GSW A;  2IME A;  1AXD A;  4IVF A;  1OE7 A;  2HSM A;  2XHF A;  3KCM A;  2V32 A;  1Z3E A;  2B5E A;  2C0E A;  3VLN A;  5ECL B;  5LCZ A;  1I5G A;  3QOU A;  3RDW A;  5IOW A;  3A2X A;  4BPY A;  1TK0 B;  3LWA A;  1ZOF A;  3EVI A;  1F37 A;  3CSJ A;  1WWJ A;  5DAL A;  3ZVJ D;  2E7P A;  1YJ6 A;  3UEM A;  4HQZ A;  2WUL A;  3C71 A;  4XS4 B;  1PA3 A;  5DQY A;  4ZBB A;  3HXS A;  4JE1 A;  3HY2 A;  1OC9 B;  5DJM A;  4J2F A;  5EPF A;  2IMI A;  4WET A;  4RQX A;  1XOB A;  3ZZX A;  3EE2 A;  4KB3 A;  1A2M A;  1A0F A;  3KGK A;  4F03 A;  4MCU A;  2CZ3 A;  3PGT A;  4MJC A;  1MDK A;  4PQ1 A;  4PGT A;  4EKZ A;  3TKR A;  3ME7 A;  1ZCP A;  2I1U A;  1TI1 A;  5G5F A;  1ERV A;  4HZ2 A;  2OBK A;  3MNG A;  3KMN A;  2G2Q A;  1N8J A;  5IO2 A;  1KEB A;  1THX A;  2WJU A;  4ML1 A;  5A5K A;  1ZL9 A;  3M0F A;  6GSU A;  4OFT A;  3WD6 A;  1M0U A;  3L0H A;  1A23 A;  2AHE A;  4QQ7 A;  4V1A p;  4MLY A;  2OAD A;  4ZL9 A;  1EEM A;  2H6Y A;  2AAW A;  3TJF A;  1N2A A;  1FVJ A;  5ECP B;  5AGY A;  1EOH A;  5COH A;  3DEX A;  4LLR A;  3EYT A;  1SK1 A;  2DC5 A;  3C1S A;  7GSS A;  3FZ4 A;  3TOU A;  1E2Y A;  2IFQ B;  3LSZ A;  5J9C A;  2O8V B;  1T4Z A;  4EO3 A;  2DMM A;  1M9A A;  2OBI A;  1G6W A;  1SJ6 A;  1LU4 A;  3H93 A;  1PX7 A;  1GSE A;  3VWX A;  3EWL A;  1A0R P;  4PNG A;  5DCH A;  3LOR A;  2EC4 A;  2CAQ A;  5CRE A;  4X43 A;  4AGS A;  2KOK A;  2I9H A;  4K2D A;  4Q5N A;  2HRN A;  4L5L A;  3D0Z A;  4RQR A;  1ZZY A;  2HQT A;  2E2M A;  3RAZ A;  3EMX A;  1O73 A;  2H1D A;  4TR1 B;  3IXR A;  2DSA A;  4EXJ A;  3IOS A;  3TKS C;  3P90 A;  1S3D A;  1V58 A;  3GUS A;  2F8F A;  1BG5 A;  4NAX A;  4F2I A;  1XWA A;  1AQX A;  4BVX A;  4MPG A;  3MWH A;  1R7H A;  3H1N A;  2RM5 A;  19GS A;  2H71 A;  1TRU A;  1ILO A;  3HJM A;  5ECO B;  3EUR A;  1EOG A;  3U5R E;  1X5C A;  1VF3 A;  2CAI A;  3ERF A;  2O89 A;  1A24 A;  1YQ1 A;  3ZML A;  4BA7 A;  1X5E A;  4HJM A;  3UMA A;  6GSS A;  1G6Y A;  2MMA A;  4HU9 A;  1WJK A;  5AIX A;  4ILF A;  1KNG A;  4ECB A;  3VPT A;  5ECK B;  3WYW A;  4I5Q A;  3E3E A;  4G9H A;  3HYP A;  4AF2 A;  3NOF A;  5HQP A;  2NVL A;  3VFI A;  1IYI A;  4MP4 A;  1M2D A;  2HSY A;  4JBB A;  2LST A;  2LUS A;  1EZK A;  1AW9 A;  3IE3 A;  1Y25 A;  2WZ9 A;  3ZIJ A;  2VAF A;  4BWQ A;  2TRC P;  4QL9 A;  5FHI A;  5HR3 A;  4TKY A;  2OE0 A;  3UVH A;  2R2J A;  3KP8 A;  4N11 A;  2NPB A;  1W4V A;  2PBJ A;  1EV9 A;  1MEK A;  5G2Z A;  1NW2 A;  3D21 A;  2EIR A;  1QUW A;  2ZUP A;  5IMC A;  4NMU A;  2A2R A;  1PRX A;  1GP1 A;  3AY8 A;  5E59 A;  12GS A;  1S3A A;  3ZIT A;  6GST A;  3MDK A;  4IQA A;  5AIV A;  2GT6 A;  4KE3 A;  2OAC A;  1V9W A;  3W8J A;  4JZQ A;  4G19 A;  1X9M B;  5J9B A;  1FG4 A;  2P31 A;  3GX8 A;  2FY6 A;  3RBT A;  5G30 A;  2C4J A;  1G7E A;  4GQF A;  1Y6E A;  1YEX A;  1A8Y A;  4MZB A;  1KBN A;  1TDI A;  4GRF A;  2X8C A;  4IBP A;  3EC3 A;  1Z9H A;  1TRS A;  4WF4 A;  1YEP A;  2RUE A;  2VD0 A;  2DIZ A;  2VUP A;  3TGZ A;  1GSY A;  2RLI A;  3CSH A;  2HRK A;  5H5R A;  4KCE A;  1HNB A;  3ZLP A;  1EGR A;  1TU7 A;  3WT2 A;  1H4O A;  1YDK A;  2VM2 A;  3TCO A;  1T7P B;  4XTS A;  1C72 A;  2R37 A;  2YZH A;  2YNX A;  2WFC A;  1M2B A;  5JCW A;  3FHK A;  4GLT A;  3D6I A;  5HR0 A;  5B7C A;  4D73 B;  2PPT A;  4OO4 A;  1DUG A;  5EL8 A;  1RQM A;  1TKD B;  5J41 A;  3GMF A;  2CV4 A;  5ECH B;  1T1V A;  4Z7X A;  2AJQ B;  1XFL A;  1O85 A;  3RHB A;  2C80 A;  3F3Q A;  4EVM A;  3GYK A;  5D96 A;  2LRT A;  4OMV A;  5GST A;  3L9V A;  11GS A;  1SKS B;  1TK5 B;  3D5J A;  3VWV A;  5C00 A;  1BAY A;  5IPH A;  5CNW A;  6GSV A;  1ZMA A;  5GSS A;  5EVO A;  4KGI A;  3ZTL A;  2C0F A;  3TKQ A;  1XVQ A;  4ZL7 A;  6GSX A;  3CSI A;  4DSS A;  4N30 A;  2HZE A;  2JU5 A;  2XC2 A;  1K0C A;  3D4M A;  3P8W A;  1GSQ A;  2YWI A;  3A3T A;  4G0K A;  1O81 A;  3TJK A;  1QK8 A;  3C73 A;  2LNT A;  4ZB6 A;  3FKF A;  1YF0 A;  5INY A;  3F63 A;  2JAC A;  5J4U A;  3ZYW A;  2LNS A;  1YZX A;  2QKE A;  3I6A A;  4EUY A;  4BVY A;  2GST A;  1NSW A;  1FVK A;  3I9V 2;  4FH8 A;  4TW5 A;  1M9B A;  2FGX A;  3RHC A;  4TN8 A;  1GUL A;  1MDJ A;  1WMJ A;  2VL3 A;  4TVE A;  4PUF C;  3BCK A;  4KX4 A;  2IL3 A;  2HRA A;  5IM9 A;  3KH7 A;  1K0M A;  4BL7 A;  4WR5 A;  3DXB A;  2ZCT A;  1XCC A;  5KEJ A;  2ZNM A;  2HE3 A;  8GSS A;  4HS1 A;  3F6F A;  2FHE A;  5ID2 A;  3ZFL A;  3LXT A;  2MBS A;  1SYR A;  4V1A g;  4EF0 A;  4EE0 A;  3TJG A;  4Q5Q A;  1ABA A;  4WBR D;  1DSB A;  2LRN A;  3GTU A;  1U3A A;  4HEA 2;  2H0H A;  3A2V A;  3TRP A;  1QFN A;  4MZW A;  4I2U A;  3ZMK A;  20GS A;  4EL1 A;  2GT5 A;  2YAN A;  3UAP A;  4KF9 A;  5F0G A;  2VCX A;  2J9H A;  3O6T A;  1Z7R A;  4QL7 A;  1TI3 A;  1SL0 B;  3CTF A;  5G31 A;  3FZ5 A;  4YH2 A;  1UN2 A;  1FOV A;  5H5Q A;  2E2G A;  2YZU A;  4ECI A;  3HZ4 A;  3H8Q A;  1URM A;  4POB A;  2R3X A;  4FYC A;  4PQH A;  5DJL A;  2FUG 2;  3UVT A;  5DQS A;  3A5W A;  3G7I A;  5ELG A;  13GS A;  3QPM A;  2NDO A;  3UIW A;  1LJR A;  3HA9 A;  4K7O A;  4CW9 A;  3R3E A;  1G7O A;  5B6M A;  3IV4 A;  2L6C A;  1YY7 A;  4O7H A;  4PTS A;  2YWN A;  2VD1 A;  4YAV A;  3EIN A;  4LL4 B;  4XS4 A;  2GZZ A;  5B8A A;  1B4Q A;  4XRA A;  4KSM A;  1U88 A;  3TKP A;  2FD3 A;  5JWO B;  5DCG A;  3EU4 A;  14GS A;  2L59 A;  1OC9 A;  5HFK A;  1TTZ A;  3M8N A;  2LRC A;  2TIR A;  2TRX A;  1EWX A;  4ZBD A;  2L5O A;  2YWM A;  4MJA A;  2CVD A;  1M99 A;  4MMM A;  4PUA A;  1UA5 A;  2AUV A;  2AYT A;  3Q6O A;  2CQ9 A;  4WR4 A;  3VK9 A;  2E0Q A;  4IW9 A;  4XS1 A;  3DRN A;  4ECC A;  1U87 A;  1B8X A;  2DJK A;  1B9X C;  5D8I A;  3U6V A;  3TUE A;  2HNL A;  2GQM A;  1EP8 A;  5GZZ B;  4I6X A;  3VI7 A;  3GH6 A;  1Z5Y E;  3VUR A;  3FW2 A;  5HFI A;  1GNE A;  3WGX A;  3UBK A;  3GN3 A;  2FA4 A;  4X0X A;  3DD3 A;  1JLV A;  5A4U A;  2R4V A;  1WPI A;  2K8V A;  1SD9 A;  3EU3 A;  2C0G A;  5IMZ A;  1K0A A;  3LGC A;  5IO0 A;  2GSQ A;  2LQQ A;  1DE1 A;  4USS A;  2MZC A;  3F6D A;  5IQY A;  1HD2 A;  3CYN A;  4XCS A;  3M1G A;  5DAK B;  3IBH A;  3IC8 A;  1PMT A;  4XIH A;  1Z6M A;  4FO5 A;  3FEU A;  5LD0 A;  2B7K A;  2GGT A;  2RM6 A;  3GV1 A;  3C1R A;  5KN2 A;  3LFL A;  2R5G A;  4ZXG A;  1GTU A;  1W89 A;  3MAK A;  3JCM L;  4YQU A;  3FRC A;  2C8U A;  2H01 A;  2FWF A;  1O8X A;  4PUR A;  1A8L A;  4NHW A;  2H1G A;  4LMV A;  4F9Z A;  2HI7 A;  2PU9 C;  2HYX A;  3QAG A;  2L6D A; 
#chains in the Genus database with same CATH topology
 4POK A;  2IMD A;  1V2A A;  1XOA A;  2V41 A;  4V2N A;  4ZB9 A;  1N25 A;  2V6O A;  5JCG A;  1TRW A;  3A5I A;  1JZR A;  4OFM A;  3FR6 A;  2EFE A;  2VL9 A;  1NHO A;  1THO A;  2VO4 A;  3UAR A;  2OJL A;  1PD2 1;  2VIM A;  2P0G A;  3G7Y A;  5HFG A;  3QR6 A;  5AIS A;  4BIK A;  2KHP A;  3QMX A;  4AI6 A;  3F4T A;  4N0V A;  2K9F A;  1PN0 A;  2V6K A;  2NTO A;  3F8U A;  3UL3 A;  2IMF A;  4GSS A;  4A5P A;  1ZYP A;  1ON4 A;  2VLT A;  4LA1 A;  2GDR A;  2CX4 A;  2RUF A;  1V40 A;  2GLR A;  2WCI A;  3FK8 A;  4JR4 A;  3BD2 A;  3E0U A;  5IMA A;  3LYK A;  1OC8 A;  2IIY A;  2F8A A;  2FNO A;  1G0T A;  3VWW A;  4GXZ A;  2GTU A;  1PQN A;  4I8B A;  1XWC A;  4K7I A;  3H4K A;  2PUK C;  3BOA A;  3IAM 2;  4G0I A;  5H5S A;  3HKR A;  2GQL A;  2KLX A;  2EFH A;  1A2L A;  2A4V A;  1OYJ A;  3DVW A;  3TJJ A;  5J4V A;  1TJD A;  1OAZ A;  3HVS A;  5ECQ B;  4K1F A;  4MJE A;  1AQV A;  4O5Q A;  1JZD A;  1GTI A;  3ZL5 A;  2LQO A;  4LMW A;  2L4C A;  2MMO A;  4K5S A;  2OA7 A;  2MMN A;  4FYB A;  2VKZ G;  1PL2 A;  3KMO A;  4LL1 B;  4YQM A;  3M3M A;  4GQC A;  2RII A;  5CYY A;  2A4H A;  1ZGN A;  3Q74 A;  1X9W B;  2YP6 A;  2JZS A;  3HMJ G;  1SK2 A;  1EEJ A;  5KN0 A;  4MJB A;  2MBT A;  4FXY P;  2D2Z A;  4X1U A;  3LXZ A;  5ECR B;  2B7J A;  3HVX A;  3L9S A;  2WB9 A;  3QAW A;  2YJ7 A;  3IK9 A;  4HZ4 A;  4MF7 A;  1CQH A;  2F3M A;  2LTK A;  4KW6 A;  4IJ3 A;  1ML6 A;  4NHZ A;  3QCP A;  3N5O A;  1AAZ A;  1BJX A;  2ON7 A;  2QSI A;  3UBL A;  4ZBA A;  4MZC A;  1M7T A;  2IPA A;  1OC3 A;  1GSU A;  4FYU A;  1M3I A;  3K8N A;  2PMT A;  4I97 A;  2H73 A;  4D73 A;  1HYU A;  3HCZ A;  4WEY A;  1SEN A;  1XVW A;  3ERW A;  4F82 A;  9GSS A;  4XHM A;  3H79 A;  2V1M A;  2M72 A;  1SL1 B;  2WW0 A;  1FB0 A;  1X0R A;  18GS A;  2XPE A;  4IKH A;  4Q5F A;  2K8S A;  2O7K A;  2VCV A;  3SBC A;  3M9J A;  3GA4 A;  2DJ0 A;  5A34 A;  4HJ2 A;  5IMD A;  4ICY A;  3BCI A;  5D9V A;  3VPQ A;  4GSN A;  4F0C A;  2IN3 A;  5BMU B;  2DJ3 A;  1QQ2 A;  4NXI A;  2PVO C;  2H0I A;  3TRQ A;  4MF6 A;  2AB6 A;  2I3Y A;  2LKU A;  2PVQ A;  2H1L A;  4FQU A;  1TRV A;  2H6X A;  1OVN A;  4FIW A;  5ABR A;  1K0N A;  5J4Y A;  1VGL A;  2C3N A;  2HLS A;  4TRX A;  2JZT A;  2LEG A;  3GKX A;  2L4Q A;  2F9S A;  1JLW A;  5G1K A;  3GFK A;  1GUM A;  3QAV A;  4V2L A;  4NV2 A;  2DML A;  4HOJ A;  1A2J A;  3KM6 A;  3DYR A;  2B1L A;  4MAB A;  1K3O A;  3DGQ A;  3PPU A;  2EIO A;  4K7N A;  4H86 A;  5FT3 A;  5D93 A;  1JHB A;  2WRT A;  4PXO A;  3C7M A;  4TR3 A;  3ZVJ A;  1F2E A;  1QXH A;  1GNW A;  2VM1 A;  2X64 A;  4JED A;  2YV9 A;  4IS0 A;  4YKG A;  1S3R A;  3TKS A;  3DIE A;  5ECM B;  2H6Z A;  1XPV A;  16GS A;  4TR0 A;  3TDG A;  3L78 A;  1R26 A;  2J23 A;  5D9W A;  2ON5 A;  5ECN B;  5ELA A;  2H19 A;  1GL8 A;  4IGJ A;  3KTB A;  3IHG A;  3DML A;  4TXO A;  3CBU A;  1J9B A;  5D73 A;  3IDV A;  4OFN A;  1ERU A;  5IIZ A;  3KP9 A;  3Q19 A;  2A2P A;  3ZRD A;  4ML6 A;  4DEJ A;  3TOT A;  2GSR A;  1ST9 A;  2DKH A;  2H1B A;  3D4T A;  4AJ6 A;  4KDX A;  1YKA A;  1O6J A;  4ULX A;  3CMI A;  4PI2 C;  6GSY A;  1T00 A;  2FWG A;  1Q4J A;  2NBS A;  4OWY A;  4GCI A;  3NIV A;  4MF5 A;  4XRD A;  1TW9 A;  2YCD A;  4K2X A;  5L71 A;  4EDZ A;  1PN9 A;  1XW6 A;  3ZRE A;  4IJI A;  4ZIL A;  4QMK A;  1SK0 A;  5CP1 A;  2P5R A;  4TXV A;  3FZ9 A;  1GUK A;  1PL1 A;  2EIQ A;  2B5X A;  4K8M A;  2XBI A;  2YPM A;  1ZYQ B;  2YOI A;  1RW1 A;  2LJR A;  2O87 A;  1H75 A;  1TK8 B;  1DBY A;  3GST A;  3GH9 A;  2VCW A;  4HUA A;  1LBK A;  1SU9 A;  4K0N A;  1SJI A;  3KZQ A;  2DBC A;  3GKN A;  5ENU A;  4DSR A;  2HSM B;  1Z7P A;  4KSO A;  4JRR A;  1X9S B;  5JCU A;  1UVZ A;  1BF5 A;  2H0G A;  5A4V A;  2YV7 A;  1I1I P;  4K9Z A;  4RUV A;  2LJK A;  4IP6 A;  3IRA A;  4J57 E;  5DAL B;  2LV3 A;  1AC1 A;  2BTO T;  5AN1 A;  2L57 A;  1GWC A;  2R0G A;  3TRX A;  4WF5 A;  2YN1 A;  2KP2 A;  1O7U A;  3E9J B;  1M2A A;  3IPZ A;  5KN3 A;  2LS5 A;  1PSQ A;  4KH7 A;  3RPN A;  4Q5R A;  1I9D A;  1PX6 A;  2H70 A;  3PIN A;  4BWS A;  4PNF A;  1ERW A;  2O5V A;  1K3L A;  1SKW B;  2VLU A;  5A4W A;  3F9U A;  2XBQ A;  1MTC A;  3ZIV A;  4TR4 A;  1XWB A;  4TOP A;  1GTA A;  4KDY A;  3LW9 A;  1NM3 A;  4DVC A;  3WT1 A;  4OO5 A;  3GUR A;  1EV4 A;  3Q18 A;  1ZYN A;  2VLV A;  2H1A A;  1YVL A;  3HJP A;  4HI7 A;  2VL2 C;  1GLP A;  2FCH A;  5F06 A;  4CDO A;  2H30 A;  2DJJ A;  2UZ8 A;  3L4N A;  1XIY A;  1MDI A;  3I43 A;  3FY7 A;  3LYP A;  3CTG A;  2O85 A;  1SL2 B;  5FWG A;  2QGV A;  3APO A;  1CQG A;  1VF4 A;  2PGT A;  3CRT A;  2WVX A;  2REM A;  3QDN A;  3APQ A;  4ZB8 A;  1WOU A;  3F3R A;  5J5N A;  2IFQ A;  3KEB A;  2ES7 A;  1MD4 A;  3US3 A;  3G9B A;  3VWU A;  4MH2 A;  3TB2 A;  4OCF A;  3S9F A;  3WGD A;  1TXU A;  1O8W A;  2AV4 A;  3KH9 A;  2V2G A;  4NWY A;  2WS2 A;  5DAK A;  2X8H A;  3LQ7 A;  2OKA A;  2X99 A;  2GZP A;  1TP9 A;  3V1W A;  3GKK A;  2KUC A;  5JWQ B;  2L5L A;  2H8L A;  1Q98 A;  5CAX A;  3UOM A;  4HQS A;  3W8S A;  3FZA A;  3DVX A;  2C3Q A;  17GS A;  1T3B A;  3WGE A;  3HZ8 A;  1OE8 A;  1BYE A;  2JSY A;  4HSC X;  2WGR A;  4GF0 A;  1SD8 A;  1ACV A;  2BJX A;  2CT6 A;  4G2E A;  4TR1 A;  3GNJ A;  2CX3 A;  5CRD A;  4K0G A;  3CXG A;  1OKD A;  3I69 A;  1VRS D;  1T4Y A;  5E4W A;  5ECI B;  2GZY A;  3IHQ A;  3J7Y k;  2HFD A;  3GKM A;  2C0D A;  1K3Y A;  4JR6 A;  4G0L A;  5HR1 A;  1F3A A;  3G7J A;  4O92 A;  3QFA C;  3IR4 A;  4NV5 A;  2F51 A;  4BVX B;  2R0C A;  1HNC A;  3TKS E;  3M9K A;  4IEL A;  5B6N A;  1V57 A;  3HD5 A;  1FOH A;  4IQ1 A;  2MMZ A;  1R5A A;  1R4W A;  3ME8 A;  4AJ7 A;  5A5H B;  1K0O A;  2MYG A;  2ALB A;  5F8B A;  4PX1 A;  1WE0 A;  2N5F A;  2UV8 G;  4F0B A;  1GUH A;  1PKZ A;  4E8E A;  1B9Y C;  5LNK e;  2FA8 A;  2IJY A;  4YAP A;  4OD7 A;  3HJO A;  1GSS A;  1TU8 A;  3ERG A;  1XW9 A;  3FR9 A;  1YKC A;  3A2W A;  3F4S A;  1AQW A;  1TXX A;  3IK7 A;  2DLX A;  2M46 A;  3HHV A;  1BX9 A;  2H66 A;  4IN0 A;  4DSQ A;  1RK4 A;  3P2A A;  2CVB A;  5DDL A;  4WKW A;  1PFO A;  2YWO A;  4L8E A;  5EY6 A;  3F4R A;  4IP1 A;  3QD9 A;  4N0Z A;  2HRF A;  2K18 A;  1FW1 A;  1XXU A;  2VCT A;  2GSS A;  1SVM A;  4POL A;  1GSD A;  3TJB A;  1BED A;  2H75 A;  1XWG A;  3CWG A;  1X5D A;  2H72 A;  1FAA A;  1F3B A;  2DIY A;  3UJ1 A;  4WBJ A;  22GS A;  2HSN B;  5G1L A;  2C1Y A;  4P3Y B;  4HU7 A;  4ZL8 A;  5GAN D;  5A1N B;  2N5A A;  1M3J A;  2Z9S A;  4EDY A;  4ISD A;  2GVP A;  1NHY A;  4HDE A;  3W6G A;  2IMK A;  2B5Y A;  4CY6 A;  5CO3 A;  5CRG A;  3PR8 A;  3LG6 A;  2KP1 A;  1WRY A;  3BJ5 A;  5B8B A;  4MA9 A;  5ECS A;  2H74 A;  5CRW A;  2C3T A;  1FO5 A;  1VF1 A;  3BBY A;  3CRU A;  1HNA A;  1XBS A;  4KA0 A;  5HR2 A;  4KAE A;  2PWJ A;  1YF1 A;  4OCE A;  2YJH A;  4MH3 A;  3GSS A;  3NZN A;  1K0B A;  5C04 A;  4GTU A;  3DKS A;  3O3T A;  2WDU A;  1F9M A;  2BMX A;  2EFC A;  4L5O A;  4ZIJ A;  2XPD A;  2VCZ A;  2M80 A;  1PGT A;  3APS A;  5J3R A;  3D22 A;  2A2S A;  4MDC A;  3LEF A;  1UC7 A;  1MD3 A;  2N5B A;  5DBQ A;  2HRK B;  2IWT A;  3HDC A;  2DKI A;  3OR5 A;  4EC0 A;  4L0W A;  5IOX A;  3GIX A;  5D9T A;  10GS A;  4RI7 A;  1GLQ A;  2JSZ A;  2G0F A;  2P5Q A;  2B6M A;  3P7X A;  1GH2 A;  1JZO A;  5GAP D;  3IC4 A;  4V2M A;  4ECJ A;  5CRH A;  2HZF A;  1BG1 A;  4ID0 A;  1GTB A;  1ZYE A;  2X8G A;  4ZB7 A;  2GQK A;  2VL2 A;  2JL4 A;  4AKG A;  1PKW A;  4CHS A;  2R0P A;  2WVZ A;  1SJZ A;  2DJ2 A;  3N9J A;  2X4A A;  3FYG A;  4O5R A;  3TU3 B;  4YQV A;  1B48 A;  1SYX A;  2FWH A;  4KDU A;  3KIJ A;  4XS6 A;  2B1K A;  4GWR A;  5BMU A;  1XZO A;  3EPT A;  4L0U A;  1EGO A;  1K0D A;  2DJ1 A;  4JU5 A;  2HSH A;  1U6T A;  3L9U A;  5A34 B;  4G10 A;  5DVB A;  5F05 A;  3ED3 A;  1AIU A;  2FWE A;  3KD0 A;  3MSZ A;  3PH9 A;  1USB A;  1WIK A;  1EP7 A;  2QC7 A;  4I2T A;  1JFU A;  2OE3 A;  4WXT A;  2CA8 A;  1SKR B;  4DSS B;  3ZFB A;  2HZE B;  1TOF A;  5IMF A;  1Y1U A;  1R5P A;  3KXO A;  1IYH A;  2LJA A;  3FR3 A;  1J08 A;  4POM A;  1XWK A;  1U3I A;  5F07 A;  3J7Y b;  3F0I A;  1AUC A;  3DWV A;  4MPF A;  3GL5 A;  4ACS A;  2FLS A;  4O5U A;  3KTL A;  1QMV A;  2PER A;  2CZ2 A;  2VOC A;  3GHA A;  4BVY B;  2I4A A;  2K6V A;  2B3S A;  2I81 A;  3IA1 A;  4N10 A;  3KJY A;  1DE2 A;  3LJR A;  1Z6N A;  1SVO A;  4KUN A;  5KN1 A;  4J56 E;  1WP0 A;  4PQI A;  2OE1 A;  4GST A;  4BL7 B;  5IMV A;  5KOW A;  3GX0 A;  1HQO A;  1OKT A;  4K6X A;  1GSF A;  1V98 A;  3ISO A;  2GS3 A;  2CVK A;  3GL3 A;  2OT3 A;  5D9X A;  1E6B A;  3IAS 2;  5IPG A;  4IHU A;  4W66 A;  1J0F A;  5ID2 B;  2PN8 A;  4O32 A;  3C8E A;  1JZW A;  5G5E A;  3R2Q A;  2H76 A;  3EMP A;  4KCA A;  4TXO B;  4E8H A;  3GTU B;  1KTE A;  1VF2 A;  1B4P A;  1GRX A;  4RI6 A;  1S3C A;  5JWR B;  2JAD A;  3HVV A;  3O76 A;  2HXK A;  4MK3 A;  3SWL A;  4KND A;  1F6M C;  2JZR A;  2R6K A;  4AJ8 A;  3QFB C;  1ERT A;  3GRX A;  1QGV A;  1BQ7 A;  1T8E B;  1FHE A;  3RPP A;  1XW5 A;  3VI5 A;  2VCQ A;  2HT9 A;  5BRT A;  4NPB A;  1FB6 A;  6GSW A;  2IME A;  1AXD A;  4IVF A;  1OE7 A;  2HSM A;  2XHF A;  3KCM A;  2V32 A;  1Z3E A;  4K5R A;  2B5E A;  2C0E A;  3VLN A;  5ECL B;  5LCZ A;  1I5G A;  2QA2 A;  3QOU A;  3RDW A;  5J47 A;  5IOW A;  3A2X A;  4BPY A;  1TK0 B;  3LWA A;  1ZOF A;  3EVI A;  2WZS A;  1F37 A;  3CSJ A;  1WWJ A;  5DAL A;  3ZVJ D;  2E7P A;  1YJ6 A;  3UEM A;  4HQZ A;  2WUL A;  3C71 A;  4XS4 B;  1PA3 A;  5DQY A;  4ZBB A;  3HXS A;  4JE1 A;  3HY2 A;  1OC9 B;  5DJM A;  4J2F A;  5EPF A;  3CHX C;  2IMI A;  4WET A;  4RQX A;  1XOB A;  3ZZX A;  3EE2 A;  4KB3 A;  1A2M A;  1A0F A;  3KGK A;  4F03 A;  4MCU A;  2CZ3 A;  3PGT A;  4MJC A;  1MDK A;  4PQ1 A;  4PGT A;  4EKZ A;  3TKR A;  3ME7 A;  1ZCP A;  2I1U A;  1TI1 A;  5G5F A;  1ERV A;  4HZ2 A;  2OBK A;  3HVN A;  3MNG A;  3KMN A;  2G2Q A;  1N8J A;  5IO2 A;  1KEB A;  1THX A;  2WJU A;  4ML1 A;  5A5K A;  1ZL9 A;  3M0F A;  6GSU A;  4OFT A;  3WD6 A;  1M0U A;  3L0H A;  1A23 A;  2AHE A;  4QQ7 A;  4V1A p;  4MLY A;  2OAD A;  4ZL9 A;  1EEM A;  2H6Y A;  2AAW A;  3TJF A;  1N2A A;  1FVJ A;  5ECP B;  5AGY A;  1EOH A;  2WW3 A;  5COH A;  3DEX A;  4AKX B;  4E68 A;  4LLR A;  3EYT A;  1SK1 A;  2DC5 A;  2WVX B;  3C1S A;  7GSS A;  3FZ4 A;  3TOU A;  1E2Y A;  2IFQ B;  3LSZ A;  5J9C A;  2O8V B;  1T4Z A;  2O3E A;  4AKI A;  4EO3 A;  2DMM A;  1M9A A;  2X49 A;  2OBI A;  1G6W A;  1SJ6 A;  1LU4 A;  3H93 A;  1PX7 A;  1GSE A;  3VWX A;  3EWL A;  1A0R P;  1S4B P;  4PNG A;  5DCH A;  3LOR A;  2EC4 A;  2CAQ A;  5CRE A;  4X43 A;  4AGS A;  2KOK A;  2I9H A;  4K2D A;  4Q5N A;  2HRN A;  4L5L A;  3D0Z A;  4RQR A;  1ZZY A;  2HQT A;  2E2M A;  3RAZ A;  3EMX A;  1O73 A;  2H1D A;  4TR1 B;  3IXR A;  2DSA A;  3MYD A;  4EXJ A;  3IOS A;  3TKS C;  3P90 A;  1S3D A;  1V58 A;  3GUS A;  2F8F A;  1BG5 A;  4NAX A;  4F2I A;  1XWA A;  1AQX A;  4BVX A;  4MPG A;  3MWH A;  1R7H A;  3H1N A;  2RM5 A;  19GS A;  2H71 A;  1TRU A;  1ILO A;  4MNN A;  3HJM A;  5ECO B;  3EUR A;  1EOG A;  3U5R E;  5A5H A;  1X5C A;  1VF3 A;  2CAI A;  3ERF A;  2O89 A;  1A24 A;  1YQ1 A;  3ZML A;  4BA7 A;  1X5E A;  4HJM A;  1YEW C;  3UMA A;  6GSS A;  1G6Y A;  2MMA A;  4HU9 A;  1WJK A;  5AIX A;  4ILF A;  1KNG A;  4ECB A;  3VPT A;  4PI0 C;  5ECK B;  3WYW A;  4I5Q A;  3E3E A;  4G9H A;  3HYP A;  4AF2 A;  3NOF A;  5HQP A;  2NVL A;  3VFI A;  4AKH A;  1IYI A;  4MP4 A;  4Z2U A;  1M2D A;  2HSY A;  4JBB A;  2LST A;  2LUS A;  4GDF A;  1EZK A;  1AW9 A;  3IE3 A;  1Y25 A;  2WZ9 A;  3ZIJ A;  2VAF A;  4BWQ A;  2WW2 A;  2TRC P;  4QL9 A;  5FHI A;  5HR3 A;  2HSN A;  4TKY A;  2OE0 A;  3UVH A;  2R2J A;  3KP8 A;  4N11 A;  2NPB A;  1W4V A;  2PBJ A;  1EV9 A;  1MEK A;  5G2Z A;  3CQF A;  1NW2 A;  3D21 A;  2EIR A;  1QUW A;  2ZUP A;  5IMC A;  5A1N A;  2A2R A;  4NMU A;  1PRX A;  1GP1 A;  3AY8 A;  5E59 A;  12GS A;  1S3A A;  3ZIT A;  6GST A;  3MDK A;  4IQA A;  4EIQ A;  5AIV A;  2GT6 A;  4KE3 A;  2OAC A;  1V9W A;  3W8J A;  4JZQ A;  4G19 A;  1X9M B;  5J9B A;  1FG4 A;  2P31 A;  3GX8 A;  2FY6 A;  3RBT A;  5G30 A;  2C4J A;  1G7E A;  4GQF A;  1Y6E A;  1YEX A;  1A8Y A;  4MZB A;  4X4J A;  1KBN A;  1TDI A;  4GRF A;  2X8C A;  4IBP A;  3EC3 A;  1Z9H A;  1TRS A;  4WF4 A;  1YEP A;  2RUE A;  2VD0 A;  2DIZ A;  2VUP A;  3TGZ A;  1GSY A;  2RLI A;  3CSH A;  2HRK A;  5H5R A;  1SVL A;  4KCE A;  1HNB A;  3ZLP A;  1EGR A;  1TU7 A;  3WT2 A;  1H4O A;  1YDK A;  2VM2 A;  3TCO A;  1T7P B;  4XTS A;  1C72 A;  2R37 A;  2YZH A;  2YNX A;  2WFC A;  1M2B A;  5JCW A;  3FHK A;  4GLT A;  3D6I A;  5HR0 A;  5B7C A;  4D73 B;  2PPT A;  4OO4 A;  4N3Z A;  1DUG A;  5EL8 A;  1RQM A;  1TKD B;  5J41 A;  3GMF A;  2CV4 A;  5ECH B;  1T1V A;  4Z7X A;  2AJQ B;  1XFL A;  1O85 A;  2WW1 A;  3RHB A;  2C80 A;  3F3Q A;  4EVM A;  3GYK A;  5D96 A;  2LRT A;  4OMV A;  5GST A;  3L9V A;  11GS A;  1SKS B;  1TK5 B;  3D5J A;  3VWV A;  5C00 A;  1BAY A;  5IPH A;  5CNW A;  6GSV A;  1ZMA A;  5GSS A;  5EVO A;  4KGI A;  3ZTL A;  2C0F A;  3TKQ A;  1XVQ A;  4ZL7 A;  6GSX A;  3CSI A;  1XG8 A;  4DSS A;  4N30 A;  2HZE A;  2JU5 A;  2XC2 A;  1K0C A;  3D4M A;  3P8W A;  1GSQ A;  2YWI A;  3A3T A;  4G0K A;  1O81 A;  3TJK A;  1QK8 A;  3C73 A;  2LNT A;  4ZB6 A;  3FKF A;  1YF0 A;  5INY A;  3F63 A;  2JAC A;  5J4U A;  3ZYW A;  3RGB C;  2LNS A;  1YZX A;  2QKE A;  3I6A A;  4EUY A;  4BVY A;  2GST A;  1NSW A;  1FVK A;  3I9V 2;  4FH8 A;  4TW5 A;  1M9B A;  2FGX A;  3RHC A;  4TN8 A;  1GUL A;  1MDJ A;  1WMJ A;  2VL3 A;  4TVE A;  4PUF C;  3BCK A;  4KX4 A;  2IL3 A;  2HRA A;  5IM9 A;  3KH7 A;  1K0M A;  4BL7 A;  4WR5 A;  3DXB A;  2ZCT A;  1XCC A;  5KEJ A;  2ZNM A;  4CY8 A;  2HE3 A;  8GSS A;  4HS1 A;  3F6F A;  2FHE A;  5ID2 A;  3ZFL A;  3LXT A;  2MBS A;  1SYR A;  4V1A g;  4EF0 A;  4EE0 A;  3TJG A;  4Q5Q A;  1ABA A;  4WBR D;  1DSB A;  2LRN A;  3GTU A;  1U3A A;  4HEA 2;  2H0H A;  3A2V A;  3TRP A;  1QFN A;  4MZW A;  4I2U A;  3ZMK A;  20GS A;  4EL1 A;  2GT5 A;  2YAN A;  3UAP A;  4KF9 A;  5F0G A;  2VCX A;  2J9H A;  3O6T A;  1Z7R A;  4QL7 A;  1TI3 A;  1SL0 B;  3CTF A;  5G31 A;  3FZ5 A;  4YH2 A;  1UN2 A;  1FOV A;  5H5Q A;  2E2G A;  2YZU A;  4ECI A;  3HZ4 A;  3H8Q A;  1URM A;  4POB A;  2R3X A;  4FYC A;  4PQH A;  5J40 A;  5DJL A;  2EFD A;  2FUG 2;  3UVT A;  5DQS A;  3A5W A;  3G7I A;  5ELG A;  4Z2R A;  13GS A;  3QPM A;  2NDO A;  3UIW A;  1LJR A;  3HA9 A;  4K7O A;  4CW9 A;  3R3E A;  1G7O A;  5B6M A;  3IV4 A;  2QA1 A;  2L6C A;  1YY7 A;  4O7H A;  4PTS A;  2YWN A;  2VD1 A;  4YAV A;  3EIN A;  4LL4 B;  4EIP A;  4XS4 A;  2GZZ A;  5B8A A;  1B4Q A;  4XRA A;  4KSM A;  1U88 A;  3TKP A;  2FD3 A;  5JWO B;  5DCG A;  3EU4 A;  14GS A;  2L59 A;  1OC9 A;  5HFK A;  1TTZ A;  3M8N A;  2LRC A;  2TIR A;  2TRX A;  1EWX A;  4ZBD A;  2L5O A;  2YWM A;  4MJA A;  2CVD A;  1M99 A;  4MMM A;  4PUA A;  1UA5 A;  2AUV A;  4PHZ C;  2AYT A;  3Q6O A;  2CQ9 A;  4WR4 A;  3VK9 A;  2E0Q A;  4IW9 A;  4XS1 A;  3DRN A;  4ECC A;  1U87 A;  1B8X A;  2DJK A;  1B9X C;  5D8I A;  3MIX A;  3U6V A;  3TUE A;  2HNL A;  2GQM A;  1EP8 A;  5GZZ B;  4I6X A;  3VI7 A;  3GH6 A;  1Z5Y E;  3VUR A;  3FW2 A;  5HFI A;  1GNE A;  3WGX A;  3UBK A;  3GN3 A;  2FA4 A;  4X0X A;  2O36 A;  3DD3 A;  1JLV A;  5A4U A;  2R4V A;  1WPI A;  2K8V A;  1SD9 A;  4Z2T A;  3EU3 A;  2C0G A;  5IMZ A;  1K0A A;  3LGC A;  5IO0 A;  2GSQ A;  2LQQ A;  5KOX A;  2WVY A;  1DE1 A;  4USS A;  2MZC A;  3F6D A;  5IQY A;  1HD2 A;  3CYN A;  4XCS A;  3M1G A;  5DAK B;  3IBH A;  3IC8 A;  1PMT A;  4XIH A;  1Z6M A;  3RFR C;  4FO5 A;  3FEU A;  5LD0 A;  2B7K A;  2GGT A;  2RM6 A;  4G01 A;  3GV1 A;  3C1R A;  3FMW A;  5KN2 A;  3LFL A;  2R5G A;  4ZXG A;  1GTU A;  1W89 A;  3MAK A;  3JCM L;  4YQU A;  3FRC A;  2C8U A;  2H01 A;  2FWF A;  1O8X A;  4PUR A;  1A8L A;  4NHW A;  2H1G A;  4LMV A;  4F9Z A;  2HI7 A;  2PU9 C;  2HYX A;  4YKF A;  3QAG A;  2L6D A; 
#chains in the Genus database with same CATH homology
 4POK A;  2IMD A;  1V2A A;  1XOA A;  2V41 A;  4V2N A;  4ZB9 A;  1N25 A;  2V6O A;  5JCG A;  1TRW A;  3A5I A;  1JZR A;  4OFM A;  3FR6 A;  2EFE A;  2VL9 A;  1NHO A;  1THO A;  2VO4 A;  3UAR A;  2OJL A;  1PD2 1;  2VIM A;  2P0G A;  3G7Y A;  5HFG A;  3QR6 A;  5AIS A;  2KHP A;  3QMX A;  4AI6 A;  3F4T A;  4N0V A;  2K9F A;  1PN0 A;  2V6K A;  2NTO A;  3F8U A;  3UL3 A;  2IMF A;  4GSS A;  4A5P A;  1ZYP A;  1ON4 A;  2VLT A;  4LA1 A;  2GDR A;  2CX4 A;  2RUF A;  1V40 A;  2GLR A;  2WCI A;  3FK8 A;  4JR4 A;  3BD2 A;  3E0U A;  5IMA A;  3LYK A;  1OC8 A;  2IIY A;  2F8A A;  2FNO A;  1G0T A;  3VWW A;  4GXZ A;  2GTU A;  1PQN A;  4I8B A;  1XWC A;  4K7I A;  3H4K A;  2PUK C;  3BOA A;  3IAM 2;  4G0I A;  5H5S A;  3HKR A;  2GQL A;  2KLX A;  2EFH A;  1A2L A;  2A4V A;  1OYJ A;  3DVW A;  3TJJ A;  5J4V A;  1TJD A;  1OAZ A;  3HVS A;  5ECQ B;  4K1F A;  4MJE A;  1AQV A;  4O5Q A;  1JZD A;  1GTI A;  3ZL5 A;  2LQO A;  4LMW A;  2L4C A;  2MMO A;  4K5S A;  2OA7 A;  2MMN A;  4FYB A;  2VKZ G;  1PL2 A;  3KMO A;  4LL1 B;  4YQM A;  3M3M A;  4GQC A;  2RII A;  5CYY A;  2A4H A;  1ZGN A;  3Q74 A;  1X9W B;  2YP6 A;  2JZS A;  3HMJ G;  1SK2 A;  1EEJ A;  5KN0 A;  4MJB A;  2MBT A;  2D2Z A;  4X1U A;  3LXZ A;  5ECR B;  2B7J A;  3HVX A;  3L9S A;  2WB9 A;  3QAW A;  2YJ7 A;  3IK9 A;  4HZ4 A;  4MF7 A;  1CQH A;  2F3M A;  2LTK A;  4KW6 A;  4IJ3 A;  1ML6 A;  4NHZ A;  3QCP A;  3N5O A;  1AAZ A;  1BJX A;  2ON7 A;  2QSI A;  3UBL A;  4ZBA A;  4MZC A;  1M7T A;  2IPA A;  1OC3 A;  1GSU A;  4FYU A;  3K8N A;  2PMT A;  4I97 A;  2H73 A;  4D73 A;  1HYU A;  3HCZ A;  4WEY A;  1SEN A;  1XVW A;  3ERW A;  4F82 A;  9GSS A;  4XHM A;  3H79 A;  2V1M A;  2M72 A;  1SL1 B;  1FB0 A;  1X0R A;  18GS A;  2XPE A;  4IKH A;  4Q5F A;  2K8S A;  2O7K A;  2VCV A;  3SBC A;  3M9J A;  3GA4 A;  2DJ0 A;  5A34 A;  4HJ2 A;  5IMD A;  4ICY A;  3BCI A;  5D9V A;  3VPQ A;  4GSN A;  4F0C A;  2IN3 A;  5BMU B;  2DJ3 A;  1QQ2 A;  4NXI A;  2PVO C;  2H0I A;  3TRQ A;  4MF6 A;  2AB6 A;  2I3Y A;  2LKU A;  2PVQ A;  2H1L A;  4FQU A;  1TRV A;  2H6X A;  1OVN A;  4FIW A;  5ABR A;  1K0N A;  5J4Y A;  1VGL A;  2C3N A;  2HLS A;  4TRX A;  2JZT A;  2LEG A;  3GKX A;  2L4Q A;  2F9S A;  1JLW A;  5G1K A;  3GFK A;  1GUM A;  3QAV A;  4V2L A;  4NV2 A;  2DML A;  4HOJ A;  1A2J A;  3KM6 A;  3DYR A;  2B1L A;  4MAB A;  1K3O A;  3DGQ A;  3PPU A;  2EIO A;  4K7N A;  4H86 A;  5FT3 A;  5D93 A;  1JHB A;  2WRT A;  4PXO A;  3C7M A;  4TR3 A;  3ZVJ A;  1F2E A;  1QXH A;  1GNW A;  2VM1 A;  2X64 A;  4JED A;  2YV9 A;  4IS0 A;  4YKG A;  3TKS A;  3DIE A;  5ECM B;  2H6Z A;  1XPV A;  16GS A;  4TR0 A;  3TDG A;  3L78 A;  1R26 A;  2J23 A;  5D9W A;  2ON5 A;  5ECN B;  5ELA A;  2H19 A;  1GL8 A;  4IGJ A;  3KTB A;  3IHG A;  3DML A;  4TXO A;  3CBU A;  1J9B A;  5D73 A;  3IDV A;  4OFN A;  1ERU A;  5IIZ A;  3KP9 A;  3Q19 A;  2A2P A;  3ZRD A;  4ML6 A;  4DEJ A;  3TOT A;  2GSR A;  1ST9 A;  2DKH A;  2H1B A;  3D4T A;  4AJ6 A;  4KDX A;  1YKA A;  1O6J A;  4ULX A;  3CMI A;  6GSY A;  1T00 A;  2FWG A;  1Q4J A;  2NBS A;  4OWY A;  4GCI A;  3NIV A;  4MF5 A;  4XRD A;  1TW9 A;  2YCD A;  4K2X A;  5L71 A;  4EDZ A;  1PN9 A;  1XW6 A;  3ZRE A;  4IJI A;  4ZIL A;  4QMK A;  1SK0 A;  5CP1 A;  2P5R A;  4TXV A;  3FZ9 A;  1GUK A;  1PL1 A;  2EIQ A;  2B5X A;  4K8M A;  2XBI A;  2YPM A;  1ZYQ B;  2YOI A;  1RW1 A;  2LJR A;  2O87 A;  1H75 A;  1TK8 B;  1DBY A;  3GST A;  2VCW A;  3GH9 A;  4HUA A;  1LBK A;  1SU9 A;  4K0N A;  1SJI A;  3KZQ A;  2DBC A;  3GKN A;  5ENU A;  4DSR A;  2HSM B;  1Z7P A;  4KSO A;  4JRR A;  1X9S B;  5JCU A;  1UVZ A;  1BF5 A;  2H0G A;  5A4V A;  2YV7 A;  4K9Z A;  4RUV A;  2LJK A;  4IP6 A;  3IRA A;  4J57 E;  5DAL B;  2LV3 A;  1AC1 A;  2BTO T;  5AN1 A;  2L57 A;  1GWC A;  2R0G A;  3TRX A;  4WF5 A;  2YN1 A;  2KP2 A;  1O7U A;  3E9J B;  1M2A A;  3IPZ A;  5KN3 A;  2LS5 A;  1PSQ A;  4KH7 A;  3RPN A;  4Q5R A;  1I9D A;  1PX6 A;  2H70 A;  3PIN A;  4BWS A;  4PNF A;  1ERW A;  2O5V A;  1K3L A;  1SKW B;  2VLU A;  5A4W A;  3F9U A;  2XBQ A;  1MTC A;  3ZIV A;  4TR4 A;  1XWB A;  4TOP A;  1GTA A;  4KDY A;  3LW9 A;  1NM3 A;  4DVC A;  3WT1 A;  4OO5 A;  3GUR A;  1EV4 A;  3Q18 A;  1ZYN A;  2VLV A;  2H1A A;  1YVL A;  3HJP A;  4HI7 A;  2VL2 C;  1GLP A;  2FCH A;  5F06 A;  4CDO A;  2H30 A;  2DJJ A;  2UZ8 A;  3L4N A;  1XIY A;  1MDI A;  3I43 A;  3FY7 A;  3LYP A;  3CTG A;  2O85 A;  1SL2 B;  5FWG A;  2QGV A;  3APO A;  1CQG A;  1VF4 A;  2PGT A;  3CRT A;  2REM A;  3QDN A;  3APQ A;  4ZB8 A;  1WOU A;  3F3R A;  5J5N A;  2IFQ A;  3KEB A;  2ES7 A;  1MD4 A;  3US3 A;  3G9B A;  3VWU A;  4MH2 A;  3TB2 A;  4OCF A;  3S9F A;  3WGD A;  1TXU A;  1O8W A;  2AV4 A;  3KH9 A;  2V2G A;  4NWY A;  2WS2 A;  5DAK A;  2X8H A;  3LQ7 A;  2OKA A;  2X99 A;  2GZP A;  1TP9 A;  3V1W A;  3GKK A;  2KUC A;  5JWQ B;  2L5L A;  2H8L A;  1Q98 A;  5CAX A;  3UOM A;  4HQS A;  3W8S A;  3FZA A;  3DVX A;  2C3Q A;  17GS A;  1T3B A;  3WGE A;  3HZ8 A;  1OE8 A;  1BYE A;  2JSY A;  2WGR A;  4GF0 A;  1SD8 A;  1ACV A;  2BJX A;  2CT6 A;  4G2E A;  4TR1 A;  3GNJ A;  2CX3 A;  5CRD A;  4K0G A;  3CXG A;  1OKD A;  3I69 A;  1VRS D;  1T4Y A;  5E4W A;  5ECI B;  2GZY A;  3IHQ A;  3J7Y k;  2HFD A;  3GKM A;  2C0D A;  1K3Y A;  4JR6 A;  4G0L A;  5HR1 A;  1F3A A;  3G7J A;  4O92 A;  3QFA C;  3IR4 A;  4NV5 A;  2F51 A;  4BVX B;  2R0C A;  1HNC A;  3TKS E;  3M9K A;  4IEL A;  5B6N A;  1V57 A;  3HD5 A;  1FOH A;  4IQ1 A;  2MMZ A;  1R5A A;  1R4W A;  3ME8 A;  4AJ7 A;  5A5H B;  1K0O A;  2MYG A;  2ALB A;  5F8B A;  4PX1 A;  1WE0 A;  2N5F A;  2UV8 G;  4F0B A;  1GUH A;  1PKZ A;  4E8E A;  1B9Y C;  5LNK e;  2FA8 A;  2IJY A;  4YAP A;  4OD7 A;  3HJO A;  1GSS A;  1TU8 A;  3ERG A;  1XW9 A;  3FR9 A;  1YKC A;  3A2W A;  3F4S A;  1AQW A;  1TXX A;  3IK7 A;  2DLX A;  2M46 A;  3HHV A;  1BX9 A;  2H66 A;  4IN0 A;  4DSQ A;  1RK4 A;  3P2A A;  2CVB A;  5DDL A;  4WKW A;  2YWO A;  4L8E A;  5EY6 A;  3F4R A;  4IP1 A;  3QD9 A;  4N0Z A;  2HRF A;  2K18 A;  1FW1 A;  1XXU A;  2VCT A;  2GSS A;  1SVM A;  4POL A;  1GSD A;  3TJB A;  1BED A;  2H75 A;  1XWG A;  3CWG A;  1X5D A;  2H72 A;  1FAA A;  1F3B A;  2DIY A;  3UJ1 A;  4WBJ A;  22GS A;  2HSN B;  5G1L A;  2C1Y A;  4P3Y B;  4HU7 A;  4ZL8 A;  5GAN D;  5A1N B;  2N5A A;  2Z9S A;  4EDY A;  4ISD A;  2GVP A;  1NHY A;  4HDE A;  3W6G A;  2IMK A;  2B5Y A;  4CY6 A;  5CO3 A;  5CRG A;  3PR8 A;  3LG6 A;  2KP1 A;  1WRY A;  3BJ5 A;  5B8B A;  4MA9 A;  5ECS A;  2H74 A;  5CRW A;  2C3T A;  1FO5 A;  1VF1 A;  3BBY A;  3CRU A;  1HNA A;  1XBS A;  4KA0 A;  5HR2 A;  4KAE A;  2PWJ A;  1YF1 A;  4OCE A;  2YJH A;  4MH3 A;  3GSS A;  3NZN A;  1K0B A;  5C04 A;  4GTU A;  3DKS A;  3O3T A;  2WDU A;  1F9M A;  2BMX A;  2EFC A;  4L5O A;  4ZIJ A;  2XPD A;  2VCZ A;  2M80 A;  1PGT A;  3APS A;  5J3R A;  3D22 A;  2A2S A;  4MDC A;  3LEF A;  1UC7 A;  1MD3 A;  2N5B A;  5DBQ A;  2HRK B;  2IWT A;  3HDC A;  2DKI A;  3OR5 A;  4EC0 A;  4L0W A;  5IOX A;  3GIX A;  5D9T A;  10GS A;  4RI7 A;  1GLQ A;  2JSZ A;  2G0F A;  2P5Q A;  2B6M A;  3P7X A;  1GH2 A;  1JZO A;  5GAP D;  3IC4 A;  4V2M A;  4ECJ A;  5CRH A;  2HZF A;  1BG1 A;  4ID0 A;  1GTB A;  1ZYE A;  2X8G A;  4ZB7 A;  2GQK A;  2VL2 A;  2JL4 A;  4AKG A;  1PKW A;  4CHS A;  2R0P A;  1SJZ A;  2DJ2 A;  3N9J A;  2X4A A;  3FYG A;  4O5R A;  3TU3 B;  4YQV A;  1B48 A;  1SYX A;  2FWH A;  4KDU A;  3KIJ A;  4XS6 A;  2B1K A;  4GWR A;  5BMU A;  1XZO A;  3EPT A;  4L0U A;  1EGO A;  1K0D A;  2DJ1 A;  4JU5 A;  2HSH A;  1U6T A;  3L9U A;  5A34 B;  4G10 A;  5DVB A;  5F05 A;  3ED3 A;  1AIU A;  2FWE A;  3KD0 A;  3MSZ A;  3PH9 A;  1USB A;  1WIK A;  1EP7 A;  2QC7 A;  4I2T A;  1JFU A;  2OE3 A;  4WXT A;  2CA8 A;  1SKR B;  4DSS B;  3ZFB A;  2HZE B;  1TOF A;  5IMF A;  1Y1U A;  1R5P A;  3KXO A;  1IYH A;  2LJA A;  3FR3 A;  1J08 A;  4POM A;  1XWK A;  1U3I A;  5F07 A;  3J7Y b;  3F0I A;  1AUC A;  3DWV A;  4MPF A;  3GL5 A;  4ACS A;  2FLS A;  4O5U A;  3KTL A;  1QMV A;  2PER A;  2CZ2 A;  2VOC A;  3GHA A;  4BVY B;  2I4A A;  2K6V A;  2B3S A;  2I81 A;  3IA1 A;  4N10 A;  3KJY A;  1DE2 A;  3LJR A;  1Z6N A;  1SVO A;  4KUN A;  5KN1 A;  4J56 E;  1WP0 A;  4PQI A;  2OE1 A;  4GST A;  4BL7 B;  5IMV A;  5KOW A;  3GX0 A;  1HQO A;  1OKT A;  4K6X A;  1GSF A;  1V98 A;  3ISO A;  2GS3 A;  2CVK A;  3GL3 A;  2OT3 A;  5D9X A;  1E6B A;  3IAS 2;  5IPG A;  4IHU A;  4W66 A;  1J0F A;  5ID2 B;  2PN8 A;  4O32 A;  3C8E A;  1JZW A;  5G5E A;  3R2Q A;  2H76 A;  3EMP A;  4KCA A;  4TXO B;  4E8H A;  3GTU B;  1KTE A;  1VF2 A;  1B4P A;  1GRX A;  4RI6 A;  1S3C A;  5JWR B;  2JAD A;  3HVV A;  3O76 A;  2HXK A;  4MK3 A;  3SWL A;  4KND A;  1F6M C;  2JZR A;  2R6K A;  4AJ8 A;  3QFB C;  1ERT A;  3GRX A;  1QGV A;  1BQ7 A;  1T8E B;  1FHE A;  3RPP A;  1XW5 A;  3VI5 A;  2VCQ A;  2HT9 A;  5BRT A;  4NPB A;  1FB6 A;  6GSW A;  2IME A;  1AXD A;  4IVF A;  1OE7 A;  2HSM A;  2XHF A;  3KCM A;  2V32 A;  1Z3E A;  4K5R A;  2B5E A;  2C0E A;  3VLN A;  5ECL B;  5LCZ A;  1I5G A;  2QA2 A;  3QOU A;  3RDW A;  5J47 A;  5IOW A;  3A2X A;  4BPY A;  1TK0 B;  3LWA A;  1ZOF A;  3EVI A;  1F37 A;  3CSJ A;  1WWJ A;  5DAL A;  3ZVJ D;  2E7P A;  1YJ6 A;  3UEM A;  4HQZ A;  2WUL A;  3C71 A;  4XS4 B;  1PA3 A;  5DQY A;  4ZBB A;  3HXS A;  4JE1 A;  3HY2 A;  1OC9 B;  5DJM A;  4J2F A;  5EPF A;  2IMI A;  4WET A;  4RQX A;  1XOB A;  3ZZX A;  3EE2 A;  4KB3 A;  1A2M A;  1A0F A;  3KGK A;  4F03 A;  4MCU A;  2CZ3 A;  3PGT A;  4MJC A;  1MDK A;  4PQ1 A;  4PGT A;  4EKZ A;  3TKR A;  3ME7 A;  1ZCP A;  2I1U A;  1TI1 A;  5G5F A;  1ERV A;  4HZ2 A;  2OBK A;  3MNG A;  3KMN A;  2G2Q A;  1N8J A;  5IO2 A;  1KEB A;  1THX A;  2WJU A;  4ML1 A;  5A5K A;  1ZL9 A;  3M0F A;  6GSU A;  4OFT A;  3WD6 A;  1M0U A;  3L0H A;  1A23 A;  2AHE A;  4QQ7 A;  4V1A p;  4MLY A;  2OAD A;  4ZL9 A;  1EEM A;  2H6Y A;  2AAW A;  3TJF A;  1N2A A;  1FVJ A;  5ECP B;  5AGY A;  1EOH A;  5COH A;  3DEX A;  4AKX B;  4E68 A;  4LLR A;  3EYT A;  1SK1 A;  2DC5 A;  3C1S A;  7GSS A;  3FZ4 A;  3TOU A;  1E2Y A;  2IFQ B;  3LSZ A;  5J9C A;  2O8V B;  1T4Z A;  4AKI A;  4EO3 A;  2DMM A;  1M9A A;  2X49 A;  2OBI A;  1G6W A;  1SJ6 A;  1LU4 A;  3H93 A;  1PX7 A;  1GSE A;  3VWX A;  3EWL A;  1A0R P;  4PNG A;  5DCH A;  3LOR A;  2EC4 A;  2CAQ A;  5CRE A;  4X43 A;  4AGS A;  2KOK A;  2I9H A;  4K2D A;  4Q5N A;  2HRN A;  4L5L A;  3D0Z A;  4RQR A;  1ZZY A;  2HQT A;  2E2M A;  3RAZ A;  3EMX A;  1O73 A;  2H1D A;  4TR1 B;  3IXR A;  2DSA A;  3MYD A;  4EXJ A;  3IOS A;  3TKS C;  3P90 A;  1S3D A;  1V58 A;  3GUS A;  2F8F A;  1BG5 A;  4NAX A;  4F2I A;  1XWA A;  1AQX A;  4BVX A;  4MPG A;  3MWH A;  1R7H A;  3H1N A;  2RM5 A;  19GS A;  2H71 A;  1TRU A;  1ILO A;  4MNN A;  3HJM A;  5ECO B;  3EUR A;  1EOG A;  3U5R E;  5A5H A;  1X5C A;  1VF3 A;  2CAI A;  3ERF A;  2O89 A;  1A24 A;  1YQ1 A;  3ZML A;  4BA7 A;  1X5E A;  4HJM A;  3UMA A;  6GSS A;  1G6Y A;  2MMA A;  4HU9 A;  1WJK A;  5AIX A;  4ILF A;  1KNG A;  4ECB A;  3VPT A;  5ECK B;  3WYW A;  4I5Q A;  3E3E A;  4G9H A;  3HYP A;  4AF2 A;  3NOF A;  5HQP A;  2NVL A;  3VFI A;  4AKH A;  1IYI A;  4MP4 A;  4Z2U A;  1M2D A;  2HSY A;  4JBB A;  2LST A;  2LUS A;  4GDF A;  1EZK A;  1AW9 A;  3IE3 A;  1Y25 A;  2WZ9 A;  3ZIJ A;  2VAF A;  4BWQ A;  2TRC P;  4QL9 A;  5FHI A;  5HR3 A;  2HSN A;  4TKY A;  2OE0 A;  3UVH A;  2R2J A;  3KP8 A;  4N11 A;  2NPB A;  1W4V A;  2PBJ A;  1EV9 A;  1MEK A;  5G2Z A;  1NW2 A;  3D21 A;  2EIR A;  1QUW A;  2ZUP A;  5IMC A;  5A1N A;  2A2R A;  4NMU A;  1PRX A;  1GP1 A;  3AY8 A;  5E59 A;  12GS A;  1S3A A;  3ZIT A;  6GST A;  3MDK A;  4IQA A;  4EIQ A;  5AIV A;  2GT6 A;  4KE3 A;  2OAC A;  1V9W A;  3W8J A;  4JZQ A;  4G19 A;  1X9M B;  5J9B A;  1FG4 A;  2P31 A;  3GX8 A;  2FY6 A;  3RBT A;  5G30 A;  2C4J A;  1G7E A;  4GQF A;  1Y6E A;  1YEX A;  1A8Y A;  4MZB A;  4X4J A;  1KBN A;  1TDI A;  4GRF A;  2X8C A;  4IBP A;  3EC3 A;  1Z9H A;  1TRS A;  4WF4 A;  1YEP A;  2RUE A;  2VD0 A;  2DIZ A;  2VUP A;  3TGZ A;  1GSY A;  2RLI A;  3CSH A;  2HRK A;  5H5R A;  1SVL A;  4KCE A;  1HNB A;  3ZLP A;  1EGR A;  1TU7 A;  3WT2 A;  1H4O A;  1YDK A;  2VM2 A;  3TCO A;  1T7P B;  4XTS A;  1C72 A;  2R37 A;  2YZH A;  2YNX A;  2WFC A;  1M2B A;  5JCW A;  3FHK A;  4GLT A;  3D6I A;  5HR0 A;  5B7C A;  4D73 B;  2PPT A;  4OO4 A;  4N3Z A;  1DUG A;  5EL8 A;  1RQM A;  1TKD B;  5J41 A;  3GMF A;  2CV4 A;  5ECH B;  1T1V A;  4Z7X A;  2AJQ B;  1XFL A;  1O85 A;  3RHB A;  2C80 A;  3F3Q A;  4EVM A;  3GYK A;  5D96 A;  2LRT A;  4OMV A;  5GST A;  3L9V A;  11GS A;  1SKS B;  1TK5 B;  3D5J A;  3VWV A;  5C00 A;  1BAY A;  5IPH A;  5CNW A;  6GSV A;  1ZMA A;  5GSS A;  5EVO A;  4KGI A;  3ZTL A;  2C0F A;  3TKQ A;  1XVQ A;  4ZL7 A;  6GSX A;  3CSI A;  4DSS A;  4N30 A;  2HZE A;  2JU5 A;  2XC2 A;  1K0C A;  3D4M A;  3P8W A;  1GSQ A;  2YWI A;  3A3T A;  4G0K A;  1O81 A;  3TJK A;  1QK8 A;  3C73 A;  2LNT A;  4ZB6 A;  3FKF A;  1YF0 A;  5INY A;  3F63 A;  2JAC A;  5J4U A;  3ZYW A;  2LNS A;  1YZX A;  2QKE A;  3I6A A;  4EUY A;  4BVY A;  2GST A;  1NSW A;  1FVK A;  3I9V 2;  4FH8 A;  4TW5 A;  1M9B A;  2FGX A;  3RHC A;  4TN8 A;  1GUL A;  1MDJ A;  1WMJ A;  2VL3 A;  4TVE A;  4PUF C;  3BCK A;  4KX4 A;  2IL3 A;  2HRA A;  5IM9 A;  3KH7 A;  1K0M A;  4BL7 A;  4WR5 A;  3DXB A;  2ZCT A;  1XCC A;  5KEJ A;  2ZNM A;  4CY8 A;  2HE3 A;  8GSS A;  4HS1 A;  3F6F A;  2FHE A;  5ID2 A;  3ZFL A;  3LXT A;  2MBS A;  1SYR A;  4V1A g;  4EF0 A;  4EE0 A;  3TJG A;  4Q5Q A;  1ABA A;  4WBR D;  1DSB A;  2LRN A;  3GTU A;  1U3A A;  4HEA 2;  2H0H A;  3A2V A;  3TRP A;  1QFN A;  4MZW A;  4I2U A;  3ZMK A;  20GS A;  4EL1 A;  2GT5 A;  2YAN A;  3UAP A;  4KF9 A;  5F0G A;  2VCX A;  2J9H A;  3O6T A;  1Z7R A;  4QL7 A;  1TI3 A;  1SL0 B;  3CTF A;  5G31 A;  3FZ5 A;  4YH2 A;  1UN2 A;  1FOV A;  5H5Q A;  2E2G A;  2YZU A;  4ECI A;  3HZ4 A;  3H8Q A;  1URM A;  4POB A;  2R3X A;  4FYC A;  4PQH A;  5J40 A;  5DJL A;  2EFD A;  2FUG 2;  3UVT A;  5DQS A;  3A5W A;  3G7I A;  5ELG A;  4Z2R A;  13GS A;  3QPM A;  2NDO A;  3UIW A;  1LJR A;  3HA9 A;  4K7O A;  4CW9 A;  3R3E A;  1G7O A;  5B6M A;  3IV4 A;  2QA1 A;  2L6C A;  1YY7 A;  4O7H A;  4PTS A;  2YWN A;  2VD1 A;  4YAV A;  3EIN A;  4LL4 B;  4EIP A;  4XS4 A;  2GZZ A;  5B8A A;  1B4Q A;  4XRA A;  4KSM A;  1U88 A;  3TKP A;  2FD3 A;  5JWO B;  5DCG A;  3EU4 A;  14GS A;  2L59 A;  1OC9 A;  5HFK A;  1TTZ A;  3M8N A;  2LRC A;  2TIR A;  2TRX A;  1EWX A;  4ZBD A;  2L5O A;  2YWM A;  4MJA A;  2CVD A;  1M99 A;  4MMM A;  4PUA A;  1UA5 A;  2AUV A;  2AYT A;  3Q6O A;  2CQ9 A;  4WR4 A;  3VK9 A;  2E0Q A;  4IW9 A;  4XS1 A;  3DRN A;  4ECC A;  1U87 A;  1B8X A;  2DJK A;  1B9X C;  5D8I A;  3MIX A;  3U6V A;  3TUE A;  2HNL A;  2GQM A;  1EP8 A;  5GZZ B;  4I6X A;  3VI7 A;  3GH6 A;  1Z5Y E;  3VUR A;  3FW2 A;  5HFI A;  1GNE A;  3WGX A;  3UBK A;  3GN3 A;  2FA4 A;  4X0X A;  3DD3 A;  1JLV A;  5A4U A;  2R4V A;  1WPI A;  2K8V A;  1SD9 A;  4Z2T A;  3EU3 A;  2C0G A;  5IMZ A;  1K0A A;  3LGC A;  5IO0 A;  2GSQ A;  2LQQ A;  5KOX A;  1DE1 A;  4USS A;  2MZC A;  3F6D A;  5IQY A;  1HD2 A;  3CYN A;  4XCS A;  3M1G A;  5DAK B;  3IBH A;  3IC8 A;  1PMT A;  4XIH A;  1Z6M A;  4FO5 A;  3FEU A;  5LD0 A;  2B7K A;  2GGT A;  2RM6 A;  4G01 A;  3GV1 A;  3C1R A;  3FMW A;  5KN2 A;  3LFL A;  2R5G A;  4ZXG A;  1GTU A;  1W89 A;  3MAK A;  3JCM L;  4YQU A;  3FRC A;  2C8U A;  2H01 A;  2FWF A;  1O8X A;  4PUR A;  1A8L A;  4NHW A;  2H1G A;  4LMV A;  4F9Z A;  2HI7 A;  2PU9 C;  2HYX A;  4YKF A;  3QAG A;  2L6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...