5DJMA

Structure of wt human glutathione transferase in complex with cisplatin in the absence of glutathione.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
199
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVSCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutathione S-transferase P
publication title Glutathione transferase P1-1 can inactivate the anti-cancer drug cisplatin by a novel mechanism
rcsb
source organism Homo sapiens
total genus 71
structure length 199
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5djmA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5djmA01
4PQIA 5F8BA 3R2QA 4KDYA 3RDWA 4ZL9A 2VLTA 5GSTA 1GP1A 1G7EA 3LSZA 3VI7A 1EP7A 2YV7A 5HQPA 5J9CA 5COHA 3HA9A 2HT9A 4F03A 4XRAA 1SKSB 2HZEB 4NV5A 4JZQA 3F4SA 4AJ6A 2DIZA 5J3RA 1U87A 2HI7A 1V2AA 3QMXA 1F3BA 2H72A 2WS2A 1AQVA 2CX3A 5DJMA 3HZ8A 1Z7PA 4ZIJA 3LEFA 1R5AA 4YAVA 3KP9A 3Q6OA 1ABAA 2GS3A 4TR1A 1U6TA 1AQXA 5A4UA 5D96A 1F2EA 1JLVA 1WMJA 2DIYA 3M1GA 3DD3A 4XS1A 3RBTA 2V32A 3M3MA 4MJBA 3UEMA 1M7TA 5KN3A 2CVDA 2O7KA 1PA3A 4F0CA 5F0GA 4HDEA 1H75A 3EMXA 2BTOT 3FYGA 2DBCA 3M9KA 4IN0A 4PUAA 1NHOA 1K3LA 3VPQA 2IPAA 3VWVA 1M99A 2H8LA 1PX7A 7GSSA 3EMPA 4OCEA 2HRFA 1SJZA 2JSYA 2H01A 2IIYA 2OACA 1YY7A 1TI3A 3IE3A 2ZCTA 4N0VA 4O5RA 3KGKA 1F6MC 3UVTA 2L57A 4I2TA 2G0FA 8GSSA 4EXJA 5KN2A 2BMXA 3LXZA 2FWEA 3KMOA 3GHAA 4KCEA 3PR8A 4GF0A 3VLNA 4HEA2 3US3A 4HS1A 2VCWA 2C0GA 3DYRA 3IA1A 5HR1A 1KNGA 4DSSA 3F6DA 3KD0A 6GSUA 3TOTA 1FG4A 5GSSA 1K3OA 4NXIA 5IOWA 4ML6A 4Q5RA 4K8MA 3DRNA 2BJXA 2XC2A 3LQ7A 2JACA 1USBA 3BBYA 2JL4A 4YQUA 4BVXA 2IMFA 4ECIA 1B4QA 2F8FA 4PNGA 4BPYA 3HVSA 1A23A 4KSOA 2VCVA 3DEXA 3R3EA 1DUGA 4JEDA 3ZFLA 2B7JA 2R37A 1Z9HA 4D73A 3HCZA 2LRTA 5AISA 1WPIA 3S9FA 3CSIA 2CX4A 4MLYA 5C04A 4EUYA 1SD9A 4YH2A 1PL1A 3U5RE 5ECKB 1XW9A 2YP6A 1R26A 4PGTA 1SK1A 3SBCA 3F4RA 4KAEA 1J0FA 1X9SB 3GKXA 3TJBA 3PINA 1BX9A 2IMKA 3ZL5A 1WP0A 2NPBA 5GAPD 2X64A 3LORA 3D4MA 2R3XA 3HJPA 2V6KA 3FR9A 3PPUA 5HR0A 2NBSA 1QUWA 22GSA 4DSQA 4F82A 1YF0A 1PN9A 1Z7RA 2AYTA 3O6TA 4G10A 3GKKA 1EV4A 2GT5A 3DMLA 1AAZA 1XW6A 17GSA 1WE0A 4IW9A 1O73A 2AUVA 2GSQA 1TU8A 3BCKA 1MDJA 4O32A 5A4VA 1MEKA 1V98A 3UJ1A 2FHEA 2H6XA 5ECRB 1FB0A 4EE0A 4PURA 3ME7A 5B8AA 3GN3A 2DMLA 3O76A 5FT3A 4V1Ap 1A2MA 1RK4A 1Z6MA 3FZ9A 1A0FA 5EVOA 1GNWA 4PUFC 4BWSA 5LD0A 3EVIA 3ZRDA 5EL8A 2GLRA 2QGVA 1TTZA 3ZITA 4BL7A 3APQA 4GTUA 19GSA 3QAGA 1N8JA 4TVEA 2K8SA 4LMWA 2CQ9A 5HR2A 3QFBC 18GSA 2QC7A 1T00A 2MYGA 3DKSA 2A2SA 4PXOA 1FOVA 3CYNA 3WD6A 3MDKA 4ISDA 2KOKA 3M8NA 2H19A 1UN2A 5ELAA 3IBHA 4TR0A 3GIXA 1QK8A 4ACSA 4USSA 3GX8A 4MF7A 3FHKA 3FRCA 1XZOA 1Q4JA 1O6JA 5AIXA 1ERUA 2GDRA 1GTBA 1EWXA 1VF1A 3MAKA 2GZZA 2J23A 1X5CA 2ZUPA 4Z7XA 3LGCA 5B6MA 5IQYA 1JHBA 1Q98A 4ML1A 2YZUA 2B5XA 4MMMA 1PSQA 1GSUA 2OA7A 5ECSA 4TW5A 2FNOA 1OC9A 4MJCA 2HFDA 1TRUA 2O85A 2YOIA 4EC0A 4KNDA 2LJKA 3GX0A 2AV4A 1A8YA 1Z5YE 5KN1A 2L59A 1SL2B 2MMOA 4WEYA 4JR4A 1FAAA 4FIWA 3CSHA 1ZL9A 3C73A 3ZVJD 2I3YA 3TRXA 4WF5A 1Z3EA 1N2AA 3LFLA 4TXOB 4ZBBA 4G2EA 1TRSA 3ZIJA 1GLQA 3KTBA 1JZWA 2YWMA 1YEPA 5D9TA 3WGXA 5IM9A 2JZTA 3W8SA 4E8EA 1TDIA 4G0KA 2YZHA 1MDIA 4ZB6A 1OE7A 4K1FA 2VD1A 2ZNMA 2FA4A 3FZAA 1V57A 4DSRA 4I97A 4ZILA 3I9V2 2F51A 2OKAA 4IJ3A 1GUMA 4MK3A 4MJAA 4GSTA 3JCML 2E7PA 2VUPA 4V2LA 3F8UA 2C0FA 5E4WA 3VPTA 4ECCA 2N5BA 1UC7A 4TRXA 3Q18A 3C8EA 1HD2A 5DAKB 5EY6A 5INYA 4F2IA 4FYUA 3RPNA 1XW5A 1XPVA 4HQSA 4O7HA 5IIZA 3HYPA 2MZCA 3KP8A 5JWQB 1MTCA 3CRTA 2YV9A 4DVCA 5JCWA 2B1LA 5CREA 1GSDA 2JZRA 1GUHA 4TKYA 1ERWA 1IYHA 2ON5A 3I6AA 4JRRA 4FYCA 2GT6A 1HQOA 4ZB9A 1AUCA 3GURA 3BD2A 3G7IA 4KGIA 2YCDA 1TRVA 3F0IA 3UMAA 4LL1B 3CSJA 4HJMA 1O8XA 1K0AA 2DMMA 4QL9A 2I1UA 3KMNA 3BOAA 3H8QA 3D5JA 1K0MA 3QAVA 2EIRA 1PQNA 1PKZA 2HLSA 4TOPA 2HYXA 2HRAA 4K9ZA 2CAIA 2C3QA 2PBJA 2YWOA 2H6ZA 2KP1A 3FZ5A 2WB9A 2V6OA 5F07A 4QL7A 3TKPA 3FR3A 2N5AA 3MWHA 1LU4A 1B48A 5A4WA 5ABRA 1X5EA 5JWRB 3RAZA 3KTLA 3TJGA 2VIMA 3ZFBA 1AC1A 1URMA 2PVOC 4MPGA 2REMA 4MF5A 5DQSA 4P3YB 1LBKA 2CVKA 4MP4A 4RI6A 4TR4A 3FZ4A 4PQ1A 1ST9A 3ERWA 2XBQA 2GQMA 3D21A 2H1DA 2C4JA 2H30A 3GH9A 4POLA 2V1MA 2GZPA 3TKRA 2YJHA 4KF9A 2JU5A 3ERGA 2YANA 1ZOFA 1EOGA 4J57E 4F9ZA 1X9MB 5H5QA 1KBNA 4CDOA 2WDUA 3BCIA 1G0TA 2LNTA 4MZBA 2CZ2A 3H1NA 5LNKe 3E3EA 1EEMA 1TW9A 3EURA 1YJ6A 1J08A 1FHEA 2C0DA 1VF2A 5C00A 4L5LA 4OD7A 2H76A 1CQHA 2YJ7A 4WBRD 4LMVA 2P5QA 2MBSA 3EE2A 2DJ2A 5B8BA 4ID0A 3FW2A 1EGRA 1GSQA 3DXBA 4XS4B 4K0GA 2J9HA 1PGTA 5B7CA 5DQYA 2C0EA 2VD0A 2ALBA 2FCHA 1X0RA 4FYBA 4GXZA 1GTAA 2K6VA 3I69A 2O8VB 5ENUA 2JSZA 2HSNB 3IRAA 1SYXA 2F9SA 2PWJA 3E0UA 1AQWA 2LRNA 3PH9A 1M2BA 1M0UA 2KLXA 1WJKA 5AN1A 2CAQA 3UOMA 4KX4A 1W89A 4NV2A 5ECMB 1SENA 1NHYA 3G7YA 1KTEA 3TRPA 4GCIA 2HSMB 3ZMKA 3HXSA 4RI7A 3TKSA 4QQ7A 2A4VA 3GA4A 4MH2A 3QOUA 3EWLA 2LKUA 1ML6A 2NDOA 4EO3A 1XOAA 2DLXA 3CXGA 1WRYA 2I9HA 4CW9A 5J41A 5IPGA 2F8AA 4IP6A 2H0HA 3A2VA 1G6WA 4IELA 3TKSC 4XIHA 5G30A 4MZCA 4V2MA 3FY7A 1R4WA 1GSEA 3LG6A 5D9XA 1R7HA 3D4TA 4ZL8A 2LV3A 2WCIA 4FO5A 2RLIA 1FVKA 1GH2A 3N9JA 3DVXA 1PL2A 3ISOA 4G0IA 1MDKA 2EC4A 3WT1A 2YWNA 2LNSA 4KE3A 1GUKA 3KH9A 1T3BA 3ZIVA 4IS0A 3WYWA 1YQ1A 4XRDA 1HNBA 5DAKA 2VL3A 4KA0A 2PMTA 2M80A 4XTSA 4XCSA 1EV9A 1EZKA 2LQQA 2HQTA 1MD4A 5CNWA 3OR5A 3DIEA 4IHUA 1V40A 1VRSD 2VCQA 3GV1A 2VL9A 1O8WA 2GVPA 3E9JB 4NAXA 4BVYB 2PUKC 1LJRA 1V58A 4EDZA 1X5DA 1XIYA 2HXKA 5EPFA 3CTFA 2PN8A 3C1RA 5DBQA 2LTKA 1XWKA 3HJMA 3H79A 3UARA 1V9WA 1E6BA 1G6YA 1AW9A 1B9XC 3V1WA 2X8HA 3I43A 1H4OA 4K7IA 5CRHA 5AIVA 1QFNA 4WETA 4ZL7A 1PMTA 1I5GA 4KUNA 1TXXA 16GSA 1XFLA 3LXTA 2IFQB 4I2UA 3N5OA 2GSRA 4GWRA 3CBUA 4TR1B 1THOA 1O7UA 1A24A 4JR6A 3GH6A 4ZXGA 4KH7A 4OFTA 2H1BA 3UBKA 1YKAA 3QPMA 5D93A 3J7Yk 3UIWA 1G7OA 2AJQB 2MMNA 3GNJA 2H1AA 1CQGA 3ZLPA 1T4ZA 5CRGA 4GSNA 2HZEA 3QCPA 5L71A 4I5QA 3TJFA 2FWFA 2K9FA 1M2AA 2R2JA 1ZGNA 1HYUA 1BAYA 2AAWA 2L5OA 2OE3A 5CP1A 1XWBA 3LYPA 3TOUA 4XHMA 2OADA 4X1UA 1TK5B 4V2NA 2B7KA 1EOHA 2A2RA 3ME8A 5HFIA 4BA7A 2WGRA 4WF4A 1U3IA 2GGTA 3VWXA 1GTIA 5J4UA 1T8EB 1GULA 2K8VA 1GSYA 3HD5A 4MH3A 3G7JA 2DJ3A 3WGDA 6GSWA 2FLSA 4X43A 5IMVA 4G19A 2LJAA 2KUCA 3UBLA 1M2DA 3DVWA 4N11A 3ED3A 1K3YA 1S3AA 2TRCP 3CTGA 1F37A 1GSFA 1YDKA 2RIIA 1SD8A 3FKFA 4Q5NA 2CZ3A 4OO5A 4HI7A 4OFNA 4DSSB 3EC3A 5H5RA 3TB2A 4V1Ag 13GSA 2E2MA 1BYEA 4Q5QA 2OBIA 4GQCA 3L4NA 1GL8A 1NW2A 2UZ8A 2M46A 2C80A 2XPDA 4WR5A 2DJKA 4HQZA 4D73B 2PGTA 3W6GA 3F4TA 4IGJA 1TJDA 4NHWA 4K7OA 1DE2A 4N30A 2LS5A 4AGSA 2HRKB 4IKHA 2GSSA 4JU5A 4LL4B 3EU3A 1ERVA 4NHZA 4TR3A 2LEGA 1R5PA 4KCAA 3IOSA 2HSHA 2HNLA 3TKQA 3VFIA 2RM6A 4ZBAA 2B5YA 5DCHA 6GSTA 2L4CA 3TUEA 2G2QA 4ZB8A 3NZNA 3BJ5A 1XVQA 2C1YA 5DVBA 4KDUA 4AF2A 4EKZA 1JZOA 2QKEA 1JLWA 1O81A 4L8EA 1HNCA 1SJIA 2GQLA 1XWCA 1O85A 3GKNA 5E59A 1GRXA 3KCMA 1BQ7A 1OE8A 1TP9A 3ZVJA 5IMZA 3VI5A 2FWGA 1DBYA 3P90A 3C7MA 2MMZA 1W4VA 4PTSA 5G2ZA 1THXA 5FHIA 1YKCA 3A2WA 3GMFA 2VCZA 1ACVA 3IC4A 2NTOA 1ZYEA 2X8GA 2VAFA 3GTUB 4TN8A 3PGTA 5ECLB 4EL1A 1YZXA 1U3AA 4BL7B 1TRWA 4RQRA 1C72A 4IBPA 2R5GA 1GTUA 4IQAA 3Q74A 4XS6A 3C1SA 3L9UA 3VWUA 3VWWA 3QDNA 1PX6A 3F6FA 5D8IA 3KJYA 2B6MA 2CVBA 2C8UA 3EU4A 4WKWA 1ZMAA 2AHEA 1YEXA 2IMEA 3P7XA 2VM1A 3F3QA 5DALB 1PD21 12GSA 1XWGA 2PPTA 1S3CA 1SJ6A 3A3TA 4EDYA 1BJXA 3ZTLA 2H6YA 2KHPA 5D73A 1K0OA 1B9YC 4NPBA 5IMAA 4I8BA 1WWJA 4WR4A 2IFQA 4ULXA 5JWOB 5CRWA 4F0BA 1EP8A 3WGEA 1OC9B 4KSMA 3IAM2 3GL5A 3HHVA 4MABA 1XBSA 5BMUA 1RW1A 4NMUA 4OFMA 2H66A 2WJUA 4HOJA 5KEJA 3Q19A 2D2ZA 2E0QA 3WT2A 2K18A 5JCGA 2HRNA 3QD9A 5KN0A 3U6VA 2L4QA 3GFKA 1UA5A 3NIVA 2CA8A 6GSSA 2DJ0A 4AJ7A 5JCUA 2CT6A 2DJ1A 3RHCA 1TKDB 2H0IA 1GWCA 2O87A 2VLVA 1XCCA 5FWGA 2ES7A 1YF1A 5ELGA 5IO2A 3HJOA 5LCZA 1M9AA 3IR4A 2H74A 4Q5FA 4MZWA 4MDCA 4AJ8A 5G5EA 3TJJA 3A5WA 5CAXA 5IO0A 2RUFA 3VURA 1E2YA 1K0NA 3ERFA 3H4KA 2I81A 1Y6EA 1KEBA 4KB3A 1FVJA 1OVNA 3GRXA 3HDCA 6GSXA 2LQOA 4ECJA 4TXOA 2JZSA 1M9BA 1JZRA 2GTUA 5A5KA 4I6XA 3GSTA 3L0HA 4YAPA 4TXVA 1J9BA 3DWVA 2H75A 4EF0A 1WOUA 1Y25A 1K0CA 4ECBA 1OYJA 4HU9A 4FH8A 2FWHA 5ECOB 3LYKA 3IK7A 1ON4A 1T1VA 1AXDA 4IVFA 3CMIA 3IXRA 3K8NA 2FD3A 2E2GA 11GSA 5HR3A 4EVMA 3O3TA 2X8CA 3LJRA 2IN3A 1DE1A 2L6DA 4WBJA 5IMCA 4J56E 2OE1A 4HUAA 2VCXA 4K6XA 5IPHA 3KM6A 3HVXA 5G31A 2MMAA 2AB6A 3F3RA 1PRXA 5G1LA 2VOCA 2WRTA 3ZYWA 1JFUA 3D22A 3G9BA 2HRKA 3QR6A 2I4AA 3HVVA 2YN1A 4L5OA 3IHQA 1A0RP 5ID2B 4OWYA 3GL3A 3C71A 4GQFA 1AIUA 2H73A 3RHBA 4ZBDA 3D0ZA 2CV4A 3TKSE 2PVQA 2YPMA 3UVHA 2PU9C 2VM2A 1ZCPA 4OO4A 2VO4A 5ECQB 5ECHB 2B1KA 6GSVA 1BG5A 3KZQA 1SU9A 2DJJA 3KEBA 1SKWB 3GKMA 1VF4A 4LLRA 2P5RA 5ECIB 5DDLA 1TU7A 1T4YA 2O89A 3APSA 2R4VA 3H93A 3IAS2 1U88A 2JADA 1TOFA 4WXTA 4BWQA 1SK2A 2WULA 5HFKA 4ILFA 3KXOA 1A2LA 2FGXA 3CRUA 2YNXA 2DC5A 1XWAA 2TIRA 4POMA 1A2JA 1OC3A 2WZ9A 2YWIA 4L0UA 2IMDA 3GYKA 4E8HA 3M9JA 3GTUA 1SL1B 2PERA 2OBKA 1QXHA 3IPZA 2FUG2 4YQVA 4PQHA 2FY6A 2IL3A 1IYIA 3GSSA 4G0LA 3L9SA 3MNGA 1QMVA 1GSSA 3TJKA 3ZREA 2IJYA 4KDXA 5CRDA 1OAZA 1VF3A 5CYYA 4X0XA 2GSTA 3J7Yb 4KW6A 1FO5A 1GNEA 1B4PA 4L0WA 4JE1A 4GRFA 3FK8A 3L78A 3IC8A 2P0GA 1PKWA 1XXUA 3LWAA 1ERTA 1EGOA 1QQ2A 5DALA 1XVWA 2MBTA 4FQUA 2LRCA 2N5FA 2XHFA 1SL0B 1T7PB 2NVLA 3F63A 1HNAA 1NM3A 4K0NA 4HJ2A 4PNFA 2DSAA 4G9HA 1UVZA 2TRXA 5D9WA 2XPEA 1TK0B 2LUSA 3FEUA 5IOXA 3NOFA 10GSA 14GSA 1WIKA 3EINA 5D9VA 2IWTA 3L9VA 5IMFA 4OCFA 4YQMA 4DEJA 5IMDA 1TK8B 3P2AA 4O92A 5G1KA 5G5FA 2C3TA 2V2GA 5ECNB 2EIQA 4RQXA 1SKRB 1K0BA 3HZ4A 2HZFA 3F9UA 2EIOA 1BEDA 3APOA 1S3DA 2M72A 1RQMA 4POKA 3KH7A 4XS4A 1F3AA 2OJLA 1FW1A 2OE0A 4PX1A 1B8XA 5DCGA 1K0DA 3DGQA 3IK9A 3ZMLA 4BVXB 1SK0A 2RUEA 4N0ZA 1MD3A 5H5SA 4CHSA 3FR6A 5F06A 4IQ1A 2VL2A 3RPPA 1DSBA 2L6CA 2H70A 1F9MA 3UL3A 3IV4A 4MJEA 2HSMA 2KP2A 3ZZXA 2F3MA 4MF6A 3IDVA 4LA1A 2GZYA 4HZ2A 3GUSA 1SYRA 4MPFA 1OKDA 3MSZA 4MA9A 2ON7A 1VGLA 3QAWA 2VL2C 1TI1A 3TRQA 3QFAC 1GLPA 4HU7A 1ILOA 1XOBA 4NWYA 2C3NA 1JZDA 4N10A 2VLUA 2R6KA 2V41A 1OC8A 4GLTA 3D6IA 5GZZB 4K2DA 1I9DA 1EEJA 2LJRA 2B5EA 3HY2A 1ZYQB 2B3SA 2XBIA 9GSSA 3TCOA 3TGZA 2HSYA 3AY8A 4IP1A 1NSWA 5ECPB 2X99A 2Z9SA 3M0FA 2H0GA 4GSSA 3EYTA 4POBA 4OMVA 3KIJA 3VK9A 1QGVA 4IJIA 3TDGA 4K7NA 6GSYA 1A8LA 2P31A 2VCTA 5DJLA 1ZZYA 5AGYA 2GQKA 3HKRA 5HFGA 2H1GA 2RM5A 2HE3A 4J2FA 3W8JA 2IMIA 3A2XA 5GAND 2L5LA 4HZ4A 1FB6A 5CO3A 4RUVA 3SWLA 2QSIA 5ID2A 4H86A 4JBBA 2LSTA 1OKTA 1Z6NA 3UAPA 5B6NA 3P8WA 2WFCA 20GSA 2FA8A 2H71A 1X9WB 5J9BA 5F05A 4MCUA 4BVYA 5J5NA
chains in the Genus database with same CATH superfamily
4PQIA 5F8BA 3R2QA 4KDYA 3RDWA 4ZL9A 2VLTA 5GSTA 1GP1A 1G7EA 3LSZA 3VI7A 1EP7A 2YV7A 5HQPA 5J9CA 1N25A 5COHA 3HA9A 2HT9A 4F03A 4XRAA 1SKSB 2HZEB 4NV5A 4JZQA 3F4SA 4AJ6A 2DIZA 2WW2A 5J3RA 1U87A 2O36A 2HI7A 1V2AA 3QMXA 1F3BA 2H72A 2WS2A 1AQVA 2CX3A 5DJMA 3HZ8A 1Z7PA 4ZIJA 3LEFA 1R5AA 4E68A 4YAVA 3KP9A 3Q6OA 1ABAA 2GS3A 4TR1A 1U6TA 1AQXA 5A4UA 5D96A 1F2EA 1JLVA 1WMJA 2DIYA 3M1GA 3DD3A 4XS1A 3RBTA 2V32A 3M3MA 4MJBA 3UEMA 1M7TA 5KN3A 2CVDA 5KOWA 2O7KA 1PA3A 4F0CA 5F0GA 4HDEA 1H75A 3EMXA 2BTOT 4QMKA 3FYGA 2DBCA 3M9KA 4IN0A 4PUAA 1NHOA 1K3LA 2R0GA 3VPQA 2IPAA 3VWVA 1M99A 2H8LA 1PX7A 7GSSA 3EMPA 4OCEA 2HRFA 1SJZA 2JSYA 2H01A 4CY6A 2IIYA 2OACA 1YY7A 1TI3A 3IE3A 2ZCTA 4N0VA 4O5RA 3KGKA 1F6MC 3UVTA 2L57A 4I2TA 5A5HA 2G0FA 8GSSA 4EXJA 5KN2A 2BMXA 3LXZA 2FWEA 3KMOA 4K2XA 3GHAA 4KCEA 3PR8A 4GF0A 3VLNA 4HEA2 3US3A 4HS1A 2VCWA 2C0GA 3DYRA 3IA1A 5HR1A 1KNGA 4DSSA 3F6DA 3KD0A 6GSUA 3TOTA 1FG4A 5GSSA 1K3OA 4NXIA 5IOWA 4ML6A 4Q5RA 4K8MA 3DRNA 2BJXA 2XC2A 3LQ7A 2DKHA 2JACA 1USBA 3BBYA 2JL4A 4YQUA 4BVXA 2IMFA 4ECIA 1B4QA 2F8FA 4PNGA 4BPYA 3HVSA 1A23A 4KSOA 2VCVA 3DEXA 3R3EA 1DUGA 4JEDA 3ZFLA 2B7JA 2R37A 1Z9HA 4D73A 3HCZA 2LRTA 5AISA 1WPIA 3S9FA 3CSIA 2CX4A 4MLYA 5C04A 2WW1A 4EUYA 1SD9A 4YH2A 1PL1A 3U5RE 5ECKB 1XW9A 2YP6A 1R26A 4PGTA 1SK1A 3SBCA 3F4RA 4KAEA 1J0FA 1X9SB 3GKXA 3TJBA 3PINA 1PN0A 1YEWC 1BX9A 2IMKA 3ZL5A 1WP0A 2NPBA 5GAPD 2X64A 3LORA 3D4MA 2R3XA 3HJPA 2V6KA 3FR9A 3PPUA 5HR0A 2NBSA 1QUWA 22GSA 4DSQA 5J4VA 4F82A 2EFHA 1YF0A 1PN9A 3FMWA 1Z7RA 2AYTA 3O6TA 4G10A 3GKKA 1EV4A 2GT5A 3DMLA 2WW3A 1AAZA 1XW6A 17GSA 5KOXA 1WE0A 4IW9A 1O73A 2AUVA 2GSQA 1TU8A 3BCKA 1MDJA 4O32A 5A4VA 1MEKA 1V98A 3UJ1A 2FHEA 2H6XA 5ECRB 1FB0A 4EE0A 4PURA 3ME7A 5B8AA 3GN3A 2DMLA 3O76A 5FT3A 4V1Ap 1A2MA 1RK4A 1Z6MA 3FZ9A 1A0FA 5EVOA 1GNWA 4PUFC 4BWSA 5LD0A 3EVIA 3ZRDA 5EL8A 2GLRA 2QGVA 1TTZA 3ZITA 4BL7A 3APQA 4GTUA 19GSA 3QAGA 1N8JA 4TVEA 2K8SA 4LMWA 5A1NA 2CQ9A 5HR2A 3QFBC 18GSA 2QC7A 1T00A 2MYGA 3DKSA 2A2SA 4PXOA 1FOVA 3CYNA 3WD6A 2WW0A 3MDKA 4ISDA 2KOKA 3M8NA 2H19A 1UN2A 5ELAA 3IBHA 4TR0A 3GIXA 1QK8A 4ACSA 4USSA 3GX8A 4MF7A 1M3JA 4YKFA 3FHKA 3FRCA 1XZOA 1Q4JA 1ZYPA 1O6JA 5AIXA 1ERUA 2GDRA 1GTBA 1EWXA 1VF1A 3MAKA 2GZZA 2J23A 1X5CA 2ZUPA 4Z7XA 3LGCA 5B6MA 5IQYA 4O5QA 1JHBA 1Q98A 4ML1A 4X4JA 2YZUA 2B5XA 4MMMA 1PSQA 1GSUA 2OA7A 5ECSA 4TW5A 2FNOA 1OC9A 4MJCA 2HFDA 1TRUA 2O85A 2YOIA 4EC0A 4KNDA 2LJKA 3GX0A 2AV4A 1A8YA 1Z5YE 5KN1A 2L59A 1SL2B 2MMOA 4WEYA 4JR4A 1FAAA 4FIWA 3CSHA 1ZL9A 3C73A 3ZVJD 2I3YA 3TRXA 4WF5A 1Z3EA 1N2AA 3LFLA 4W66A 4TXOB 4ZBBA 4G2EA 2WZSA 1TRSA 3ZIJA 1GLQA 3KTBA 1JZWA 2YWMA 1YEPA 5D9TA 3WGXA 5IM9A 2JZTA 2EFEA 3W8SA 4E8EA 1TDIA 4G0KA 2YZHA 1MDIA 4ZB6A 1OE7A 3IHGA 4K1FA 2VD1A 2ZNMA 2FA4A 3FZAA 1V57A 4DSRA 4I97A 4ZILA 2DKIA 3I9V2 2F51A 2OKAA 4IJ3A 1GUMA 4MK3A 4MJAA 4GSTA 4AKXB 3JCML 2E7PA 2VUPA 4V2LA 3F8UA 2C0FA 5E4WA 4YKGA 3VPTA 4ECCA 2N5BA 1UC7A 4TRXA 3Q18A 3C8EA 1HD2A 5DAKB 5EY6A 5INYA 4F2IA 4FYUA 3RPNA 1XW5A 1XPVA 4HQSA 4O7HA 5IIZA 3HYPA 2MZCA 3KP8A 5JWQB 1MTCA 3CRTA 2YV9A 4DVCA 1M3IA 5JCWA 2B1LA 5CREA 1GSDA 2JZRA 1GUHA 4TKYA 1ERWA 1IYHA 2ON5A 3I6AA 5A34B 4JRRA 4AKHA 4FYCA 2GT6A 1HQOA 4ZB9A 1AUCA 3CQFA 3GURA 3BD2A 3G7IA 4KGIA 2R0CA 2QA2A 2YCDA 1TRVA 3F0IA 3UMAA 4LL1B 3CSJA 4HJMA 1O8XA 1K0AA 1S3RA 2DMMA 4QL9A 2I1UA 3KMNA 3BOAA 3H8QA 3D5JA 1K0MA 3QAVA 2EIRA 1PQNA 1PKZA 3RGBC 2HLSA 4TOPA 2HYXA 2HRAA 4K9ZA 2CAIA 2C3QA 2PBJA 2YWOA 2H6ZA 2KP1A 3FZ5A 2WB9A 2V6OA 4AKGA 5F07A 4QL7A 3TKPA 3FR3A 2N5AA 3MWHA 1LU4A 1B48A 5A4WA 5ABRA 1X5EA 5JWRB 3RAZA 3KTLA 3TJGA 2VIMA 3ZFBA 1AC1A 1URMA 2PVOC 4MPGA 2REMA 4MF5A 5DQSA 4P3YB 1LBKA 2CVKA 4MP4A 4RI6A 4TR4A 3RFRC 3FZ4A 4PQ1A 1ST9A 3ERWA 2XBQA 2GQMA 3D21A 2H1DA 2C4JA 2H30A 3GH9A 4POLA 2V1MA 2GZPA 3TKRA 2YJHA 4KF9A 2JU5A 3ERGA 2YANA 1ZOFA 1EOGA 4J57E 4F9ZA 1Y1UA 1X9MB 5H5QA 1KBNA 4CDOA 2WDUA 3BCIA 1G0TA 2LNTA 4MZBA 2CZ2A 3H1NA 5LNKe 3E3EA 1EEMA 1TW9A 3EURA 1YJ6A 1J08A 1FHEA 2C0DA 1VF2A 5C00A 4L5LA 4OD7A 2H76A 1CQHA 2R0PA 2YJ7A 4WBRD 4LMVA 2P5QA 2MBSA 3EE2A 2DJ2A 5B8BA 4ID0A 3FW2A 1EGRA 1GSQA 3DXBA 4XS4B 4K0GA 2J9HA 1PGTA 5B7CA 4HSCX 5DQYA 2C0EA 2VD0A 2ALBA 2FCHA 1X0RA 4FYBA 4GXZA 1GTAA 2K6VA 3I69A 2O8VB 4ZB7A 5ENUA 2JSZA 2HSNB 3IRAA 1SYXA 2F9SA 2PWJA 3E0UA 1AQWA 2LRNA 3PH9A 1M2BA 1M0UA 2KLXA 1WJKA 5AN1A 2CAQA 3UOMA 1FOHA 4KX4A 1W89A 4NV2A 5ECMB 1SENA 1NHYA 3G7YA 1KTEA 3TRPA 4K5RA 4GCIA 2HSMB 3ZMKA 2WVXA 3HXSA 4EIPA 4RI7A 3TKSA 4QQ7A 4AKIA 2A4VA 3GA4A 4MH2A 3QOUA 3EWLA 2LKUA 1ML6A 2NDOA 4EO3A 1XOAA 2DLXA 3CXGA 1WRYA 2I9HA 4CW9A 5J41A 5IPGA 2F8AA 4IP6A 2H0HA 3A2VA 1G6WA 4IELA 3TKSC 4XIHA 5G30A 4MZCA 4V2MA 3FY7A 1SVOA 1R4WA 1GSEA 3LG6A 5D9XA 1R7HA 3D4TA 4ZL8A 2LV3A 2WCIA 4FO5A 2RLIA 1FVKA 1GH2A 3N9JA 3DVXA 1PL2A 3ISOA 4PI0C 4G0IA 1MDKA 2EC4A 3WT1A 2YWNA 2LNSA 4KE3A 1GUKA 3KH9A 1T3BA 3ZIVA 4IS0A 3WYWA 1YQ1A 4XRDA 1HNBA 5DAKA 2VL3A 1PFOA 4KA0A 3HMJG 2PMTA 2M80A 4XTSA 4XCSA 1EV9A 1EZKA 2LQQA 2HQTA 1MD4A 5CNWA 3OR5A 3DIEA 4IHUA 1V40A 1VRSD 2VCQA 3GV1A 2VL9A 1O8WA 2GVPA 3E9JB 4NAXA 4BVYB 2PUKC 1LJRA 1V58A 4EDZA 1X5DA 1XIYA 2HXKA 5EPFA 3CTFA 2PN8A 3C1RA 5DBQA 2LTKA 1XWKA 3HJMA 3H79A 3UARA 1V9WA 1E6BA 1G6YA 1AW9A 1B9XC 3V1WA 2X8HA 3I43A 1H4OA 4K7IA 5CRHA 5AIVA 1QFNA 4WETA 4ZL7A 1PMTA 1I5GA 4KUNA 1TXXA 16GSA 1XFLA 3LXTA 2IFQB 4I2UA 3N5OA 2GSRA 5BRTA 4GWRA 3CBUA 4TR1B 1THOA 1O7UA 1A24A 4JR6A 3GH6A 4ZXGA 5BMUB 4KH7A 4OFTA 2H1BA 3UBKA 1YKAA 3QPMA 5D93A 1SVLA 3J7Yk 3UIWA 1G7OA 2AJQB 2MMNA 3GNJA 2A2PA 2H1AA 1CQGA 3ZLPA 1T4ZA 5CRGA 4GSNA 2HZEA 3QCPA 5L71A 4I5QA 3TJFA 2FWFA 2K9FA 1I1IP 1M2AA 2R2JA 1ZGNA 1HYUA 1BAYA 2AAWA 2L5OA 2OE3A 5CP1A 1XWBA 3LYPA 3TOUA 4XHMA 2OADA 4X1UA 1TK5B 4V2NA 2B7KA 1EOHA 2A2RA 3ME8A 5HFIA 4BA7A 2WGRA 4WF4A 1U3IA 2GGTA 4CY8A 3VWXA 1GTIA 5J4UA 1T8EB 1GULA 2K8VA 2OT3A 1GSYA 3HD5A 4Z2TA 4MH3A 3G7JA 2DJ3A 3MIXA 3WGDA 6GSWA 1BG1A 2FLSA 4X43A 5IMVA 4G19A 2LJAA 2KUCA 3UBLA 1M2DA 3DVWA 4N11A 3ED3A 1K3YA 1S3AA 2TRCP 3CTGA 1F37A 1GSFA 1YDKA 2RIIA 1SD8A 3FKFA 4Q5NA 2CZ3A 4OO5A 4HI7A 4OFNA 4DSSB 3EC3A 5H5RA 3TB2A 4V1Ag 2VKZG 13GSA 2E2MA 1BYEA 4Q5QA 2OBIA 4GQCA 3L4NA 1GL8A 2HSNA 2EFDA 1NW2A 2UZ8A 2M46A 2C80A 2XPDA 4WR5A 2DJKA 4HQZA 4D73B 2PGTA 3W6GA 3F4TA 4IGJA 1TJDA 4NHWA 4K7OA 1DE2A 4N30A 2WVZA 2LS5A 4AGSA 2HRKB 4IKHA 2GSSA 4JU5A 4LL4B 3EU3A 1ERVA 4NHZA 4TR3A 2LEGA 1R5PA 4KCAA 3IOSA 2HSHA 2HNLA 3TKQA 3VFIA 2RM6A 4ZBAA 2B5YA 5DCHA 6GSTA 2L4CA 4K5SA 3TUEA 2G2QA 4ZB8A 3NZNA 3BJ5A 1XVQA 2C1YA 5DVBA 4KDUA 4AF2A 4EKZA 1JZOA 2QKEA 1JLWA 1O81A 3CWGA 4L8EA 1HNCA 1SJIA 2GQLA 1XWCA 1O85A 3GKNA 5E59A 1GRXA 3KCMA 4GDFA 4FXYP 1BQ7A 1OE8A 1TP9A 2QA1A 3ZVJA 5IMZA 3VI5A 2FWGA 1DBYA 3P90A 3C7MA 2MMZA 1W4VA 4PTSA 5G2ZA 1THXA 5FHIA 1YKCA 3A2WA 3GMFA 2VCZA 1ACVA 3IC4A 2NTOA 1ZYEA 2X8GA 2VAFA 3GTUB 4TN8A 3PGTA 5ECLB 4EL1A 1YZXA 1U3AA 4BL7B 1TRWA 4RQRA 1C72A 4IBPA 2R5GA 5A1NB 1GTUA 4IQAA 2X4AA 3Q74A 4XS6A 3C1SA 3L9UA 3VWUA 3VWWA 3QDNA 3EPTA 1PX6A 3F6FA 5D8IA 3KJYA 2B6MA 2CVBA 2C8UA 3EU4A 4WKWA 1ZMAA 2AHEA 1YEXA 2IMEA 2H1LA 3P7XA 2VM1A 1TXUA 3F3QA 5DALB 1PD21 12GSA 1XWGA 2PPTA 1S3CA 1SJ6A 3A3TA 4EDYA 1BJXA 3ZTLA 2H6YA 2KHPA 5D73A 1K0OA 1B9YC 4NPBA 5IMAA 4I8BA 1WWJA 4WR4A 2IFQA 4ULXA 5JWOB 5CRWA 4F0BA 1EP8A 3WGEA 1OC9B 4KSMA 3IAM2 3GL5A 3HHVA 4MABA 1XBSA 5BMUA 1RW1A 4NMUA 4OFMA 2H66A 2WJUA 4HOJA 5KEJA 3Q19A 2D2ZA 2E0QA 3WT2A 2K18A 5JCGA 2HRNA 3QD9A 5KN0A 3U6VA 2L4QA 3GFKA 1UA5A 3NIVA 2CA8A 6GSSA 2DJ0A 4AJ7A 5JCUA 2CT6A 2DJ1A 3RHCA 1TKDB 2H0IA 1GWCA 2O87A 2VLVA 1XCCA 5FWGA 2ES7A 1YF1A 5ELGA 5IO2A 3HJOA 5LCZA 1M9AA 3IR4A 2A4HA 2H74A 4Q5FA 4G01A 4MZWA 4MDCA 4AJ8A 5G5EA 3TJJA 3A5WA 5CAXA 5IO0A 2RUFA 3VURA 1E2YA 1K0NA 3ERFA 3H4KA 2I81A 1Y6EA 1KEBA 4Z2RA 4KB3A 1FVJA 1OVNA 3GRXA 3HDCA 6GSXA 2LQOA 4ECJA 4TXOA 2JZSA 1M9BA 1JZRA 2GTUA 5A5KA 4I6XA 3GSTA 3L0HA 4YAPA 4TXVA 1J9BA 3DWVA 2H75A 4EF0A 1WOUA 1Y25A 1K0CA 4ECBA 1OYJA 4HU9A 4FH8A 2FWHA 5ECOB 3LYKA 3A5IA 3IK7A 1ON4A 1T1VA 1AXDA 4IVFA 3CMIA 3IXRA 3K8NA 2FD3A 2E2GA 11GSA 5HR3A 4EVMA 3O3TA 2X8CA 3LJRA 2IN3A 4Z2UA 1DE1A 2L6DA 4WBJA 5IMCA 4J56E 2OE1A 4HUAA 2VCXA 4PHZC 4K6XA 5IPHA 3KM6A 3HVXA 5G31A 2MMAA 2AB6A 3F3RA 1PRXA 5G1LA 2VOCA 2WRTA 3ZYWA 1JFUA 3D22A 3G9BA 2HRKA 1ZYNA 3QR6A 2I4AA 3HVVA 2YN1A 4L5OA 3IHQA 1A0RP 5ID2B 4OWYA 3GL3A 3C71A 4GQFA 1AIUA 4BIKA 2H73A 2WVYA 3RHBA 4ZBDA 3D0ZA 2CV4A 3TKSE 2PVQA 2O5VA 2YPMA 3UVHA 2PU9C 2VM2A 1ZCPA 4OO4A 2VO4A 5ECQB 5ECHB 2B1KA 6GSVA 1BG5A 3KZQA 1SU9A 2DJJA 3KEBA 1SKWB 3GKMA 1VF4A 4LLRA 2P5RA 5ECIB 5DDLA 1TU7A 1T4YA 2O89A 5A34A 3APSA 2R4VA 3H93A 3IAS2 1U88A 2JADA 1TOFA 4WXTA 4BWQA 1SK2A 2WULA 5HFKA 4ILFA 3KXOA 1A2LA 2UV8G 2FGXA 3CRUA 2YNXA 2DC5A 1XWAA 2TIRA 4POMA 1A2JA 1BF5A 1OC3A 2WZ9A 2YWIA 4L0UA 2IMDA 3GYKA 4E8HA 3M9JA 3GTUA 1SL1B 2PERA 2OBKA 1QXHA 3IPZA 2FUG2 4YQVA 4PQHA 2FY6A 2IL3A 1IYIA 3MYDA 3GSSA 4G0LA 3L9SA 3MNGA 1QMVA 1GSSA 3TJKA 3ZREA 2IJYA 4KDXA 5CRDA 1OAZA 1VF3A 5CYYA 4X0XA 2GSTA 3J7Yb 4KW6A 1FO5A 1GNEA 1B4PA 4L0WA 4JE1A 4GRFA 3FK8A 3CHXC 3L78A 3IC8A 2P0GA 1PKWA 3LW9A 1XXUA 3LWAA 1ERTA 1EGOA 1QQ2A 5DALA 1XVWA 2MBTA 4FQUA 2LRCA 2N5FA 2XHFA 1SL0B 1T7PB 2NVLA 3F63A 1HNAA 1NM3A 4K0NA 4HJ2A 4PNFA 2DSAA 4G9HA 1UVZA 2TRXA 5D9WA 2XPEA 1TK0B 2LUSA 3FEUA 5IOXA 3NOFA 2O3EA 4AI6A 10GSA 2X49A 5A5HB 14GSA 1WIKA 3EINA 5D9VA 2IWTA 3L9VA 5IMFA 4OCFA 4YQMA 4DEJA 5IMDA 1TK8B 3P2AA 4O92A 5G1KA 5G5FA 2C3TA 2V2GA 5ECNB 2EIQA 2WVXB 4RQXA 1SKRB 1K0BA 3HZ4A 2HZFA 3F9UA 2EIOA 1BEDA 3APOA 1S3DA 2M72A 1RQMA 4POKA 3KH7A 4XS4A 1F3AA 2OJLA 1FW1A 2OE0A 4O5UA 4PX1A 1B8XA 5DCGA 5J47A 1K0DA 3DGQA 3IK9A 1YVLA 3ZMLA 4BVXB 1SK0A 2RUEA 4MNNA 4N0ZA 1MD3A 4ICYA 5H5SA 3TU3B 4CHSA 3FR6A 5F06A 4IQ1A 2VL2A 3RPPA 1DSBA 2L6CA 2H70A 3HVNA 1F9MA 3UL3A 3IV4A 4MJEA 2HSMA 2KP2A 3ZZXA 2F3MA 4MF6A 5J40A 1SVMA 3IDVA 4LA1A 2GZYA 4HZ2A 3GUSA 1SYRA 4MPFA 4N3ZA 1XG8A 1OKDA 3MSZA 4MA9A 2ON7A 1VGLA 3QAWA 2VL2C 1TI1A 3TRQA 3QFAC 1GLPA 4HU7A 1ILOA 1XOBA 4NWYA 2C3NA 1JZDA 4N10A 2VLUA 2R6KA 2V41A 1OC8A 4GLTA 3D6IA 5GZZB 4K2DA 1I9DA 1EEJA 2LJRA 2B5EA 3HY2A 4PI2C 1ZYQB 2B3SA 2XBIA 9GSSA 3TCOA 3TGZA 2HSYA 3AY8A 4IP1A 1S4BP 1NSWA 5ECPB 2X99A 2Z9SA 5J4YA 3M0FA 2H0GA 4GSSA 3EYTA 4POBA 4OMVA 3KIJA 3VK9A 1QGVA 4IJIA 3TDGA 4K7NA 2EFCA 6GSYA 4EIQA 1A8LA 2P31A 2VCTA 5DJLA 1ZZYA 5AGYA 2GQKA 3HKRA 5HFGA 2H1GA 2RM5A 2HE3A 4J2FA 3W8JA 2IMIA 3A2XA 5GAND 2L5LA 4HZ4A 1FB6A 5CO3A 4RUVA 3SWLA 2QSIA 5ID2A 4H86A 4A5PA 4JBBA 2LSTA 1OKTA 1Z6NA 3UAPA 5B6NA 3P8WA 2WFCA 20GSA 2FA8A 2H71A 1X9WB 5J9BA 5F05A 4MCUA 4BVYA 5J5NA
chains in the Genus database with same CATH topology
4PQIA 5F8BA 3R2QA 4KDYA 3RDWA 4ZL9A 2VLTA 5GSTA 1GP1A 1G7EA 3LSZA 3VI7A 1EP7A 2YV7A 5HQPA 5J9CA 1N25A 5COHA 3HA9A 2HT9A 4F03A 4XRAA 1SKSB 2HZEB 4NV5A 4JZQA 3F4SA 4AJ6A 2DIZA 5J3RA 1U87A 2HI7A 1V2AA 3QMXA 1F3BA 2H72A 2WS2A 1AQVA 2CX3A 5DJMA 3HZ8A 1Z7PA 4ZIJA 3LEFA 1R5AA 4E68A 4YAVA 3KP9A 3Q6OA 1ABAA 2GS3A 4TR1A 1U6TA 1AQXA 5A4UA 5D96A 1F2EA 1JLVA 1WMJA 2DIYA 3M1GA 3DD3A 4XS1A 3RBTA 2V32A 3M3MA 4MJBA 3UEMA 1M7TA 5KN3A 2CVDA 5KOWA 2O7KA 1PA3A 4F0CA 5F0GA 4HDEA 1H75A 3EMXA 2BTOT 4QMKA 3FYGA 2DBCA 3M9KA 4IN0A 4PUAA 1NHOA 1K3LA 2R0GA 3VPQA 2IPAA 3VWVA 1M99A 2H8LA 1PX7A 7GSSA 3EMPA 4OCEA 2HRFA 1SJZA 2JSYA 2H01A 4CY6A 2IIYA 2OACA 1YY7A 1TI3A 3IE3A 2ZCTA 4N0VA 4O5RA 3KGKA 1F6MC 3UVTA 2L57A 4I2TA 5A5HA 2G0FA 8GSSA 4EXJA 5KN2A 2BMXA 3LXZA 2FWEA 3KMOA 4K2XA 3GHAA 4KCEA 3PR8A 4GF0A 3VLNA 4HEA2 3US3A 4HS1A 2VCWA 2C0GA 3DYRA 3IA1A 5HR1A 1KNGA 4DSSA 3F6DA 3KD0A 6GSUA 3TOTA 1FG4A 5GSSA 1K3OA 4NXIA 5IOWA 4ML6A 4Q5RA 4K8MA 3DRNA 2BJXA 2XC2A 3LQ7A 2DKHA 2JACA 1USBA 3BBYA 2JL4A 4YQUA 4BVXA 2IMFA 4ECIA 1B4QA 2F8FA 4PNGA 4BPYA 3HVSA 1A23A 4KSOA 2VCVA 3DEXA 3R3EA 1DUGA 4JEDA 3ZFLA 2B7JA 2R37A 1Z9HA 4D73A 3HCZA 2LRTA 5AISA 1WPIA 3S9FA 3CSIA 2CX4A 4MLYA 5C04A 4EUYA 1SD9A 4YH2A 1PL1A 3U5RE 5ECKB 1XW9A 2YP6A 1R26A 4PGTA 1SK1A 3SBCA 3F4RA 4KAEA 1J0FA 1X9SB 3GKXA 3TJBA 3PINA 1PN0A 1BX9A 2IMKA 3ZL5A 1WP0A 2NPBA 5GAPD 2X64A 3LORA 3D4MA 2R3XA 3HJPA 2V6KA 3FR9A 3PPUA 5HR0A 2NBSA 1QUWA 22GSA 4DSQA 5J4VA 4F82A 2EFHA 1YF0A 1PN9A 3FMWA 1Z7RA 2AYTA 3O6TA 4G10A 3GKKA 1EV4A 2GT5A 3DMLA 1AAZA 1XW6A 17GSA 5KOXA 1WE0A 4IW9A 1O73A 2AUVA 2GSQA 1TU8A 3BCKA 1MDJA 4O32A 5A4VA 1MEKA 1V98A 3UJ1A 2FHEA 2H6XA 5ECRB 1FB0A 4EE0A 4PURA 3ME7A 5B8AA 3GN3A 2DMLA 3O76A 5FT3A 4V1Ap 1A2MA 1RK4A 1Z6MA 3FZ9A 1A0FA 5EVOA 1GNWA 4PUFC 4BWSA 5LD0A 3EVIA 3ZRDA 5EL8A 2GLRA 2QGVA 1TTZA 3ZITA 4BL7A 3APQA 4GTUA 19GSA 3QAGA 1N8JA 4TVEA 2K8SA 4LMWA 5A1NA 2CQ9A 5HR2A 3QFBC 18GSA 2QC7A 1T00A 2MYGA 3DKSA 2A2SA 4PXOA 1FOVA 3CYNA 3WD6A 3MDKA 4ISDA 2KOKA 3M8NA 2H19A 1UN2A 5ELAA 3IBHA 4TR0A 3GIXA 1QK8A 4ACSA 4USSA 3GX8A 4MF7A 4YKFA 3FHKA 3FRCA 1XZOA 1Q4JA 1ZYPA 1O6JA 5AIXA 1ERUA 2GDRA 1GTBA 1EWXA 1VF1A 3MAKA 2GZZA 2J23A 1X5CA 2ZUPA 4Z7XA 3LGCA 5B6MA 5IQYA 4O5QA 1JHBA 1Q98A 4ML1A 4X4JA 2YZUA 2B5XA 4MMMA 1PSQA 1GSUA 2OA7A 5ECSA 4TW5A 2FNOA 1OC9A 4MJCA 2HFDA 1TRUA 2O85A 2YOIA 4EC0A 4KNDA 2LJKA 3GX0A 2AV4A 1A8YA 1Z5YE 5KN1A 2L59A 1SL2B 2MMOA 4WEYA 4JR4A 1FAAA 4FIWA 3CSHA 1ZL9A 3C73A 3ZVJD 2I3YA 3TRXA 4WF5A 1Z3EA 1N2AA 3LFLA 4W66A 4TXOB 4ZBBA 4G2EA 1TRSA 3ZIJA 1GLQA 3KTBA 1JZWA 2YWMA 1YEPA 5D9TA 3WGXA 5IM9A 2JZTA 2EFEA 3W8SA 4E8EA 1TDIA 4G0KA 2YZHA 1MDIA 4ZB6A 1OE7A 3IHGA 4K1FA 2VD1A 2ZNMA 2FA4A 3FZAA 1V57A 4DSRA 4I97A 4ZILA 2DKIA 3I9V2 2F51A 2OKAA 4IJ3A 1GUMA 4MK3A 4MJAA 4GSTA 4AKXB 3JCML 2E7PA 2VUPA 4V2LA 3F8UA 2C0FA 5E4WA 4YKGA 3VPTA 4ECCA 2N5BA 1UC7A 4TRXA 3Q18A 3C8EA 1HD2A 5DAKB 5EY6A 5INYA 4F2IA 4FYUA 3RPNA 1XW5A 1XPVA 4HQSA 4O7HA 5IIZA 3HYPA 2MZCA 3KP8A 5JWQB 1MTCA 3CRTA 2YV9A 4DVCA 5JCWA 2B1LA 5CREA 1GSDA 2JZRA 1GUHA 4TKYA 1ERWA 1IYHA 2ON5A 3I6AA 5A34B 4JRRA 4AKHA 4FYCA 2GT6A 1HQOA 4ZB9A 1AUCA 3GURA 3BD2A 3G7IA 4KGIA 2R0CA 2QA2A 2YCDA 1TRVA 3F0IA 3UMAA 4LL1B 3CSJA 4HJMA 1O8XA 1K0AA 2DMMA 4QL9A 2I1UA 3KMNA 3BOAA 3H8QA 3D5JA 1K0MA 3QAVA 2EIRA 1PQNA 1PKZA 2HLSA 4TOPA 2HYXA 2HRAA 4K9ZA 2CAIA 2C3QA 2PBJA 2YWOA 2H6ZA 2KP1A 3FZ5A 2WB9A 2V6OA 4AKGA 5F07A 4QL7A 3TKPA 3FR3A 2N5AA 3MWHA 1LU4A 1B48A 5A4WA 5ABRA 1X5EA 5JWRB 3RAZA 3KTLA 3TJGA 2VIMA 3ZFBA 1AC1A 1URMA 2PVOC 4MPGA 2REMA 4MF5A 5DQSA 4P3YB 1LBKA 2CVKA 4MP4A 4RI6A 4TR4A 3FZ4A 4PQ1A 1ST9A 3ERWA 2XBQA 2GQMA 3D21A 2H1DA 2C4JA 2H30A 3GH9A 4POLA 2V1MA 2GZPA 3TKRA 2YJHA 4KF9A 2JU5A 3ERGA 2YANA 1ZOFA 1EOGA 4J57E 4F9ZA 1Y1UA 1X9MB 5H5QA 1KBNA 4CDOA 2WDUA 3BCIA 1G0TA 2LNTA 4MZBA 2CZ2A 3H1NA 5LNKe 3E3EA 1EEMA 1TW9A 3EURA 1YJ6A 1J08A 1FHEA 2C0DA 1VF2A 5C00A 4L5LA 4OD7A 2H76A 1CQHA 2R0PA 2YJ7A 4WBRD 4LMVA 2P5QA 2MBSA 3EE2A 2DJ2A 5B8BA 4ID0A 3FW2A 1EGRA 1GSQA 3DXBA 4XS4B 4K0GA 2J9HA 1PGTA 5B7CA 5DQYA 2C0EA 2VD0A 2ALBA 2FCHA 1X0RA 4FYBA 4GXZA 1GTAA 2K6VA 3I69A 2O8VB 4ZB7A 5ENUA 2JSZA 2HSNB 3IRAA 1SYXA 2F9SA 2PWJA 3E0UA 1AQWA 2LRNA 3PH9A 1M2BA 1M0UA 2KLXA 1WJKA 5AN1A 2CAQA 3UOMA 1FOHA 4KX4A 1W89A 4NV2A 5ECMB 1SENA 1NHYA 3G7YA 1KTEA 3TRPA 4K5RA 4GCIA 2HSMB 3ZMKA 3HXSA 4EIPA 4RI7A 3TKSA 4QQ7A 4AKIA 2A4VA 3GA4A 4MH2A 3QOUA 3EWLA 2LKUA 1ML6A 2NDOA 4EO3A 1XOAA 2DLXA 3CXGA 1WRYA 2I9HA 4CW9A 5J41A 5IPGA 2F8AA 4IP6A 2H0HA 3A2VA 1G6WA 4IELA 3TKSC 4XIHA 5G30A 4MZCA 4V2MA 3FY7A 1SVOA 1R4WA 1GSEA 3LG6A 5D9XA 1R7HA 3D4TA 4ZL8A 2LV3A 2WCIA 4FO5A 2RLIA 1FVKA 1GH2A 3N9JA 3DVXA 1PL2A 3ISOA 4G0IA 1MDKA 2EC4A 3WT1A 2YWNA 2LNSA 4KE3A 1GUKA 3KH9A 1T3BA 3ZIVA 4IS0A 3WYWA 1YQ1A 4XRDA 1HNBA 5DAKA 2VL3A 4KA0A 3HMJG 2PMTA 2M80A 4XTSA 4XCSA 1EV9A 1EZKA 2LQQA 2HQTA 1MD4A 5CNWA 3OR5A 3DIEA 4IHUA 1V40A 1VRSD 2VCQA 3GV1A 2VL9A 1O8WA 2GVPA 3E9JB 4NAXA 4BVYB 2PUKC 1LJRA 1V58A 4EDZA 1X5DA 1XIYA 2HXKA 5EPFA 3CTFA 2PN8A 3C1RA 5DBQA 2LTKA 1XWKA 3HJMA 3H79A 3UARA 1V9WA 1E6BA 1G6YA 1AW9A 1B9XC 3V1WA 2X8HA 3I43A 1H4OA 4K7IA 5CRHA 5AIVA 1QFNA 4WETA 4ZL7A 1PMTA 1I5GA 4KUNA 1TXXA 16GSA 1XFLA 3LXTA 2IFQB 4I2UA 3N5OA 2GSRA 5BRTA 4GWRA 3CBUA 4TR1B 1THOA 1O7UA 1A24A 4JR6A 3GH6A 4ZXGA 5BMUB 4KH7A 4OFTA 2H1BA 3UBKA 1YKAA 3QPMA 5D93A 1SVLA 3J7Yk 3UIWA 1G7OA 2AJQB 2MMNA 3GNJA 2A2PA 2H1AA 1CQGA 3ZLPA 1T4ZA 5CRGA 4GSNA 2HZEA 3QCPA 5L71A 4I5QA 3TJFA 2FWFA 2K9FA 1M2AA 2R2JA 1ZGNA 1HYUA 1BAYA 2AAWA 2L5OA 2OE3A 5CP1A 1XWBA 3LYPA 3TOUA 4XHMA 2OADA 4X1UA 1TK5B 4V2NA 2B7KA 1EOHA 2A2RA 3ME8A 5HFIA 4BA7A 2WGRA 4WF4A 1U3IA 2GGTA 4CY8A 3VWXA 1GTIA 5J4UA 1T8EB 1GULA 2K8VA 2OT3A 1GSYA 3HD5A 4Z2TA 4MH3A 3G7JA 2DJ3A 3MIXA 3WGDA 6GSWA 1BG1A 2FLSA 4X43A 5IMVA 4G19A 2LJAA 2KUCA 3UBLA 1M2DA 3DVWA 4N11A 3ED3A 1K3YA 1S3AA 2TRCP 3CTGA 1F37A 1GSFA 1YDKA 2RIIA 1SD8A 3FKFA 4Q5NA 2CZ3A 4OO5A 4HI7A 4OFNA 4DSSB 3EC3A 5H5RA 3TB2A 4V1Ag 2VKZG 13GSA 2E2MA 1BYEA 4Q5QA 2OBIA 4GQCA 3L4NA 1GL8A 2HSNA 2EFDA 1NW2A 2UZ8A 2M46A 2C80A 2XPDA 4WR5A 2DJKA 4HQZA 4D73B 2PGTA 3W6GA 3F4TA 4IGJA 1TJDA 4NHWA 4K7OA 1DE2A 4N30A 2LS5A 4AGSA 2HRKB 4IKHA 2GSSA 4JU5A 4LL4B 3EU3A 1ERVA 4NHZA 4TR3A 2LEGA 1R5PA 4KCAA 3IOSA 2HSHA 2HNLA 3TKQA 3VFIA 2RM6A 4ZBAA 2B5YA 5DCHA 6GSTA 2L4CA 4K5SA 3TUEA 2G2QA 4ZB8A 3NZNA 3BJ5A 1XVQA 2C1YA 5DVBA 4KDUA 4AF2A 4EKZA 1JZOA 2QKEA 1JLWA 1O81A 3CWGA 4L8EA 1HNCA 1SJIA 2GQLA 1XWCA 1O85A 3GKNA 5E59A 1GRXA 3KCMA 4GDFA 1BQ7A 1OE8A 1TP9A 2QA1A 3ZVJA 5IMZA 3VI5A 2FWGA 1DBYA 3P90A 3C7MA 2MMZA 1W4VA 4PTSA 5G2ZA 1THXA 5FHIA 1YKCA 3A2WA 3GMFA 2VCZA 1ACVA 3IC4A 2NTOA 1ZYEA 2X8GA 2VAFA 3GTUB 4TN8A 3PGTA 5ECLB 4EL1A 1YZXA 1U3AA 4BL7B 1TRWA 4RQRA 1C72A 4IBPA 2R5GA 5A1NB 1GTUA 4IQAA 2X4AA 3Q74A 4XS6A 3C1SA 3L9UA 3VWUA 3VWWA 3QDNA 3EPTA 1PX6A 3F6FA 5D8IA 3KJYA 2B6MA 2CVBA 2C8UA 3EU4A 4WKWA 1ZMAA 2AHEA 1YEXA 2IMEA 2H1LA 3P7XA 2VM1A 1TXUA 3F3QA 5DALB 1PD21 12GSA 1XWGA 2PPTA 1S3CA 1SJ6A 3A3TA 4EDYA 1BJXA 3ZTLA 2H6YA 2KHPA 5D73A 1K0OA 1B9YC 4NPBA 5IMAA 4I8BA 1WWJA 4WR4A 2IFQA 4ULXA 5JWOB 5CRWA 4F0BA 1EP8A 3WGEA 1OC9B 4KSMA 3IAM2 3GL5A 3HHVA 4MABA 1XBSA 5BMUA 1RW1A 4NMUA 4OFMA 2H66A 2WJUA 4HOJA 5KEJA 3Q19A 2D2ZA 2E0QA 3WT2A 2K18A 5JCGA 2HRNA 3QD9A 5KN0A 3U6VA 2L4QA 3GFKA 1UA5A 3NIVA 2CA8A 6GSSA 2DJ0A 4AJ7A 5JCUA 2CT6A 2DJ1A 3RHCA 1TKDB 2H0IA 1GWCA 2O87A 2VLVA 1XCCA 5FWGA 2ES7A 1YF1A 5ELGA 5IO2A 3HJOA 5LCZA 1M9AA 3IR4A 2A4HA 2H74A 4Q5FA 4G01A 4MZWA 4MDCA 4AJ8A 5G5EA 3TJJA 3A5WA 5CAXA 5IO0A 2RUFA 3VURA 1E2YA 1K0NA 3ERFA 3H4KA 2I81A 1Y6EA 1KEBA 4Z2RA 4KB3A 1FVJA 1OVNA 3GRXA 3HDCA 6GSXA 2LQOA 4ECJA 4TXOA 2JZSA 1M9BA 1JZRA 2GTUA 5A5KA 4I6XA 3GSTA 3L0HA 4YAPA 4TXVA 1J9BA 3DWVA 2H75A 4EF0A 1WOUA 1Y25A 1K0CA 4ECBA 1OYJA 4HU9A 4FH8A 2FWHA 5ECOB 3LYKA 3A5IA 3IK7A 1ON4A 1T1VA 1AXDA 4IVFA 3CMIA 3IXRA 3K8NA 2FD3A 2E2GA 11GSA 5HR3A 4EVMA 3O3TA 2X8CA 3LJRA 2IN3A 4Z2UA 1DE1A 2L6DA 4WBJA 5IMCA 4J56E 2OE1A 4HUAA 2VCXA 4K6XA 5IPHA 3KM6A 3HVXA 5G31A 2MMAA 2AB6A 3F3RA 1PRXA 5G1LA 2VOCA 2WRTA 3ZYWA 1JFUA 3D22A 3G9BA 2HRKA 1ZYNA 3QR6A 2I4AA 3HVVA 2YN1A 4L5OA 3IHQA 1A0RP 5ID2B 4OWYA 3GL3A 3C71A 4GQFA 1AIUA 2H73A 3RHBA 4ZBDA 3D0ZA 2CV4A 3TKSE 2PVQA 2O5VA 2YPMA 3UVHA 2PU9C 2VM2A 1ZCPA 4OO4A 2VO4A 5ECQB 5ECHB 2B1KA 6GSVA 1BG5A 3KZQA 1SU9A 2DJJA 3KEBA 1SKWB 3GKMA 1VF4A 4LLRA 2P5RA 5ECIB 5DDLA 1TU7A 1T4YA 2O89A 5A34A 3APSA 2R4VA 3H93A 3IAS2 1U88A 2JADA 1TOFA 4WXTA 4BWQA 1SK2A 2WULA 5HFKA 4ILFA 3KXOA 1A2LA 2UV8G 2FGXA 3CRUA 2YNXA 2DC5A 1XWAA 2TIRA 4POMA 1A2JA 1BF5A 1OC3A 2WZ9A 2YWIA 4L0UA 2IMDA 3GYKA 4E8HA 3M9JA 3GTUA 1SL1B 2PERA 2OBKA 1QXHA 3IPZA 2FUG2 4YQVA 4PQHA 2FY6A 2IL3A 1IYIA 3MYDA 3GSSA 4G0LA 3L9SA 3MNGA 1QMVA 1GSSA 3TJKA 3ZREA 2IJYA 4KDXA 5CRDA 1OAZA 1VF3A 5CYYA 4X0XA 2GSTA 3J7Yb 4KW6A 1FO5A 1GNEA 1B4PA 4L0WA 4JE1A 4GRFA 3FK8A 3L78A 3IC8A 2P0GA 1PKWA 3LW9A 1XXUA 3LWAA 1ERTA 1EGOA 1QQ2A 5DALA 1XVWA 2MBTA 4FQUA 2LRCA 2N5FA 2XHFA 1SL0B 1T7PB 2NVLA 3F63A 1HNAA 1NM3A 4K0NA 4HJ2A 4PNFA 2DSAA 4G9HA 1UVZA 2TRXA 5D9WA 2XPEA 1TK0B 2LUSA 3FEUA 5IOXA 3NOFA 4AI6A 10GSA 2X49A 5A5HB 14GSA 1WIKA 3EINA 5D9VA 2IWTA 3L9VA 5IMFA 4OCFA 4YQMA 4DEJA 5IMDA 1TK8B 3P2AA 4O92A 5G1KA 5G5FA 2C3TA 2V2GA 5ECNB 2EIQA 4RQXA 1SKRB 1K0BA 3HZ4A 2HZFA 3F9UA 2EIOA 1BEDA 3APOA 1S3DA 2M72A 1RQMA 4POKA 3KH7A 4XS4A 1F3AA 2OJLA 1FW1A 2OE0A 4O5UA 4PX1A 1B8XA 5DCGA 5J47A 1K0DA 3DGQA 3IK9A 1YVLA 3ZMLA 4BVXB 1SK0A 2RUEA 4MNNA 4N0ZA 1MD3A 4ICYA 5H5SA 3TU3B 4CHSA 3FR6A 5F06A 4IQ1A 2VL2A 3RPPA 1DSBA 2L6CA 2H70A 1F9MA 3UL3A 3IV4A 4MJEA 2HSMA 2KP2A 3ZZXA 2F3MA 4MF6A 5J40A 1SVMA 3IDVA 4LA1A 2GZYA 4HZ2A 3GUSA 1SYRA 4MPFA 4N3ZA 1OKDA 3MSZA 4MA9A 2ON7A 1VGLA 3QAWA 2VL2C 1TI1A 3TRQA 3QFAC 1GLPA 4HU7A 1ILOA 1XOBA 4NWYA 2C3NA 1JZDA 4N10A 2VLUA 2R6KA 2V41A 1OC8A 4GLTA 3D6IA 5GZZB 4K2DA 1I9DA 1EEJA 2LJRA 2B5EA 3HY2A 1ZYQB 2B3SA 2XBIA 9GSSA 3TCOA 3TGZA 2HSYA 3AY8A 4IP1A 1NSWA 5ECPB 2X99A 2Z9SA 5J4YA 3M0FA 2H0GA 4GSSA 3EYTA 4POBA 4OMVA 3KIJA 3VK9A 1QGVA 4IJIA 3TDGA 4K7NA 2EFCA 6GSYA 4EIQA 1A8LA 2P31A 2VCTA 5DJLA 1ZZYA 5AGYA 2GQKA 3HKRA 5HFGA 2H1GA 2RM5A 2HE3A 4J2FA 3W8JA 2IMIA 3A2XA 5GAND 2L5LA 4HZ4A 1FB6A 5CO3A 4RUVA 3SWLA 2QSIA 5ID2A 4H86A 4A5PA 4JBBA 2LSTA 1OKTA 1Z6NA 3UAPA 5B6NA 3P8WA 2WFCA 20GSA 2FA8A 2H71A 1X9WB 5J9BA 5F05A 4MCUA 4BVYA 5J5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQI A;  5F8B A;  3R2Q A;  4KDY A;  3RDW A;  4ZL9 A;  2VLT A;  5GST A;  1GP1 A;  1G7E A;  3LSZ A;  3VI7 A;  1EP7 A;  2YV7 A;  5HQP A;  5J9C A;  5COH A;  3HA9 A;  2HT9 A;  4F03 A;  4XRA A;  1SKS B;  2HZE B;  4NV5 A;  4JZQ A;  3F4S A;  4AJ6 A;  2DIZ A;  5J3R A;  1U87 A;  2HI7 A;  1V2A A;  3QMX A;  1F3B A;  2H72 A;  2WS2 A;  1AQV A;  2CX3 A;  5DJM A;  3HZ8 A;  1Z7P A;  4ZIJ A;  3LEF A;  1R5A A;  4YAV A;  3KP9 A;  3Q6O A;  1ABA A;  2GS3 A;  4TR1 A;  1U6T A;  1AQX A;  5A4U A;  5D96 A;  1F2E A;  1JLV A;  1WMJ A;  2DIY A;  3M1G A;  3DD3 A;  4XS1 A;  3RBT A;  2V32 A;  3M3M A;  4MJB A;  3UEM A;  1M7T A;  5KN3 A;  2CVD A;  2O7K A;  1PA3 A;  4F0C A;  5F0G A;  4HDE A;  1H75 A;  3EMX A;  2BTO T;  3FYG A;  2DBC A;  3M9K A;  4IN0 A;  4PUA A;  1NHO A;  1K3L A;  3VPQ A;  2IPA A;  3VWV A;  1M99 A;  2H8L A;  1PX7 A;  7GSS A;  3EMP A;  4OCE A;  2HRF A;  1SJZ A;  2JSY A;  2H01 A;  2IIY A;  2OAC A;  1YY7 A;  1TI3 A;  3IE3 A;  2ZCT A;  4N0V A;  4O5R A;  3KGK A;  1F6M C;  3UVT A;  2L57 A;  4I2T A;  2G0F A;  8GSS A;  4EXJ A;  5KN2 A;  2BMX A;  3LXZ A;  2FWE A;  3KMO A;  3GHA A;  4KCE A;  3PR8 A;  4GF0 A;  3VLN A;  4HEA 2;  3US3 A;  4HS1 A;  2VCW A;  2C0G A;  3DYR A;  3IA1 A;  5HR1 A;  1KNG A;  4DSS A;  3F6D A;  3KD0 A;  6GSU A;  3TOT A;  1FG4 A;  5GSS A;  1K3O A;  4NXI A;  5IOW A;  4ML6 A;  4Q5R A;  4K8M A;  3DRN A;  2BJX A;  2XC2 A;  3LQ7 A;  2JAC A;  1USB A;  3BBY A;  2JL4 A;  4YQU A;  4BVX A;  2IMF A;  4ECI A;  1B4Q A;  2F8F A;  4PNG A;  4BPY A;  3HVS A;  1A23 A;  4KSO A;  2VCV A;  3DEX A;  3R3E A;  1DUG A;  4JED A;  3ZFL A;  2B7J A;  2R37 A;  1Z9H A;  4D73 A;  3HCZ A;  2LRT A;  5AIS A;  1WPI A;  3S9F A;  3CSI A;  2CX4 A;  4MLY A;  5C04 A;  4EUY A;  1SD9 A;  4YH2 A;  1PL1 A;  3U5R E;  5ECK B;  1XW9 A;  2YP6 A;  1R26 A;  4PGT A;  1SK1 A;  3SBC A;  3F4R A;  4KAE A;  1J0F A;  1X9S B;  3GKX A;  3TJB A;  3PIN A;  1BX9 A;  2IMK A;  3ZL5 A;  1WP0 A;  2NPB A;  5GAP D;  2X64 A;  3LOR A;  3D4M A;  2R3X A;  3HJP A;  2V6K A;  3FR9 A;  3PPU A;  5HR0 A;  2NBS A;  1QUW A;  22GS A;  4DSQ A;  4F82 A;  1YF0 A;  1PN9 A;  1Z7R A;  2AYT A;  3O6T A;  4G10 A;  3GKK A;  1EV4 A;  2GT5 A;  3DML A;  1AAZ A;  1XW6 A;  17GS A;  1WE0 A;  4IW9 A;  1O73 A;  2AUV A;  2GSQ A;  1TU8 A;  3BCK A;  1MDJ A;  4O32 A;  5A4V A;  1MEK A;  1V98 A;  3UJ1 A;  2FHE A;  2H6X A;  5ECR B;  1FB0 A;  4EE0 A;  4PUR A;  3ME7 A;  5B8A A;  3GN3 A;  2DML A;  3O76 A;  5FT3 A;  4V1A p;  1A2M A;  1RK4 A;  1Z6M A;  3FZ9 A;  1A0F A;  5EVO A;  1GNW A;  4PUF C;  4BWS A;  5LD0 A;  3EVI A;  3ZRD A;  5EL8 A;  2GLR A;  2QGV A;  1TTZ A;  3ZIT A;  4BL7 A;  3APQ A;  4GTU A;  19GS A;  3QAG A;  1N8J A;  4TVE A;  2K8S A;  4LMW A;  2CQ9 A;  5HR2 A;  3QFB C;  18GS A;  2QC7 A;  1T00 A;  2MYG A;  3DKS A;  2A2S A;  4PXO A;  1FOV A;  3CYN A;  3WD6 A;  3MDK A;  4ISD A;  2KOK A;  3M8N A;  2H19 A;  1UN2 A;  5ELA A;  3IBH A;  4TR0 A;  3GIX A;  1QK8 A;  4ACS A;  4USS A;  3GX8 A;  4MF7 A;  3FHK A;  3FRC A;  1XZO A;  1Q4J A;  1O6J A;  5AIX A;  1ERU A;  2GDR A;  1GTB A;  1EWX A;  1VF1 A;  3MAK A;  2GZZ A;  2J23 A;  1X5C A;  2ZUP A;  4Z7X A;  3LGC A;  5B6M A;  5IQY A;  1JHB A;  1Q98 A;  4ML1 A;  2YZU A;  2B5X A;  4MMM A;  1PSQ A;  1GSU A;  2OA7 A;  5ECS A;  4TW5 A;  2FNO A;  1OC9 A;  4MJC A;  2HFD A;  1TRU A;  2O85 A;  2YOI A;  4EC0 A;  4KND A;  2LJK A;  3GX0 A;  2AV4 A;  1A8Y A;  1Z5Y E;  5KN1 A;  2L59 A;  1SL2 B;  2MMO A;  4WEY A;  4JR4 A;  1FAA A;  4FIW A;  3CSH A;  1ZL9 A;  3C73 A;  3ZVJ D;  2I3Y A;  3TRX A;  4WF5 A;  1Z3E A;  1N2A A;  3LFL A;  4TXO B;  4ZBB A;  4G2E A;  1TRS A;  3ZIJ A;  1GLQ A;  3KTB A;  1JZW A;  2YWM A;  1YEP A;  5D9T A;  3WGX A;  5IM9 A;  2JZT A;  3W8S A;  4E8E A;  1TDI A;  4G0K A;  2YZH A;  1MDI A;  4ZB6 A;  1OE7 A;  4K1F A;  2VD1 A;  2ZNM A;  2FA4 A;  3FZA A;  1V57 A;  4DSR A;  4I97 A;  4ZIL A;  3I9V 2;  2F51 A;  2OKA A;  4IJ3 A;  1GUM A;  4MK3 A;  4MJA A;  4GST A;  3JCM L;  2E7P A;  2VUP A;  4V2L A;  3F8U A;  2C0F A;  5E4W A;  3VPT A;  4ECC A;  2N5B A;  1UC7 A;  4TRX A;  3Q18 A;  3C8E A;  1HD2 A;  5DAK B;  5EY6 A;  5INY A;  4F2I A;  4FYU A;  3RPN A;  1XW5 A;  1XPV A;  4HQS A;  4O7H A;  5IIZ A;  3HYP A;  2MZC A;  3KP8 A;  5JWQ B;  1MTC A;  3CRT A;  2YV9 A;  4DVC A;  5JCW A;  2B1L A;  5CRE A;  1GSD A;  2JZR A;  1GUH A;  4TKY A;  1ERW A;  1IYH A;  2ON5 A;  3I6A A;  4JRR A;  4FYC A;  2GT6 A;  1HQO A;  4ZB9 A;  1AUC A;  3GUR A;  3BD2 A;  3G7I A;  4KGI A;  2YCD A;  1TRV A;  3F0I A;  3UMA A;  4LL1 B;  3CSJ A;  4HJM A;  1O8X A;  1K0A A;  2DMM A;  4QL9 A;  2I1U A;  3KMN A;  3BOA A;  3H8Q A;  3D5J A;  1K0M A;  3QAV A;  2EIR A;  1PQN A;  1PKZ A;  2HLS A;  4TOP A;  2HYX A;  2HRA A;  4K9Z A;  2CAI A;  2C3Q A;  2PBJ A;  2YWO A;  2H6Z A;  2KP1 A;  3FZ5 A;  2WB9 A;  2V6O A;  5F07 A;  4QL7 A;  3TKP A;  3FR3 A;  2N5A A;  3MWH A;  1LU4 A;  1B48 A;  5A4W A;  5ABR A;  1X5E A;  5JWR B;  3RAZ A;  3KTL A;  3TJG A;  2VIM A;  3ZFB A;  1AC1 A;  1URM A;  2PVO C;  4MPG A;  2REM A;  4MF5 A;  5DQS A;  4P3Y B;  1LBK A;  2CVK A;  4MP4 A;  4RI6 A;  4TR4 A;  3FZ4 A;  4PQ1 A;  1ST9 A;  3ERW A;  2XBQ A;  2GQM A;  3D21 A;  2H1D A;  2C4J A;  2H30 A;  3GH9 A;  4POL A;  2V1M A;  2GZP A;  3TKR A;  2YJH A;  4KF9 A;  2JU5 A;  3ERG A;  2YAN A;  1ZOF A;  1EOG A;  4J57 E;  4F9Z A;  1X9M B;  5H5Q A;  1KBN A;  4CDO A;  2WDU A;  3BCI A;  1G0T A;  2LNT A;  4MZB A;  2CZ2 A;  3H1N A;  5LNK e;  3E3E A;  1EEM A;  1TW9 A;  3EUR A;  1YJ6 A;  1J08 A;  1FHE A;  2C0D A;  1VF2 A;  5C00 A;  4L5L A;  4OD7 A;  2H76 A;  1CQH A;  2YJ7 A;  4WBR D;  4LMV A;  2P5Q A;  2MBS A;  3EE2 A;  2DJ2 A;  5B8B A;  4ID0 A;  3FW2 A;  1EGR A;  1GSQ A;  3DXB A;  4XS4 B;  4K0G A;  2J9H A;  1PGT A;  5B7C A;  5DQY A;  2C0E A;  2VD0 A;  2ALB A;  2FCH A;  1X0R A;  4FYB A;  4GXZ A;  1GTA A;  2K6V A;  3I69 A;  2O8V B;  5ENU A;  2JSZ A;  2HSN B;  3IRA A;  1SYX A;  2F9S A;  2PWJ A;  3E0U A;  1AQW A;  2LRN A;  3PH9 A;  1M2B A;  1M0U A;  2KLX A;  1WJK A;  5AN1 A;  2CAQ A;  3UOM A;  4KX4 A;  1W89 A;  4NV2 A;  5ECM B;  1SEN A;  1NHY A;  3G7Y A;  1KTE A;  3TRP A;  4GCI A;  2HSM B;  3ZMK A;  3HXS A;  4RI7 A;  3TKS A;  4QQ7 A;  2A4V A;  3GA4 A;  4MH2 A;  3QOU A;  3EWL A;  2LKU A;  1ML6 A;  2NDO A;  4EO3 A;  1XOA A;  2DLX A;  3CXG A;  1WRY A;  2I9H A;  4CW9 A;  5J41 A;  5IPG A;  2F8A A;  4IP6 A;  2H0H A;  3A2V A;  1G6W A;  4IEL A;  3TKS C;  4XIH A;  5G30 A;  4MZC A;  4V2M A;  3FY7 A;  1R4W A;  1GSE A;  3LG6 A;  5D9X A;  1R7H A;  3D4T A;  4ZL8 A;  2LV3 A;  2WCI A;  4FO5 A;  2RLI A;  1FVK A;  1GH2 A;  3N9J A;  3DVX A;  1PL2 A;  3ISO A;  4G0I A;  1MDK A;  2EC4 A;  3WT1 A;  2YWN A;  2LNS A;  4KE3 A;  1GUK A;  3KH9 A;  1T3B A;  3ZIV A;  4IS0 A;  3WYW A;  1YQ1 A;  4XRD A;  1HNB A;  5DAK A;  2VL3 A;  4KA0 A;  2PMT A;  2M80 A;  4XTS A;  4XCS A;  1EV9 A;  1EZK A;  2LQQ A;  2HQT A;  1MD4 A;  5CNW A;  3OR5 A;  3DIE A;  4IHU A;  1V40 A;  1VRS D;  2VCQ A;  3GV1 A;  2VL9 A;  1O8W A;  2GVP A;  3E9J B;  4NAX A;  4BVY B;  2PUK C;  1LJR A;  1V58 A;  4EDZ A;  1X5D A;  1XIY A;  2HXK A;  5EPF A;  3CTF A;  2PN8 A;  3C1R A;  5DBQ A;  2LTK A;  1XWK A;  3HJM A;  3H79 A;  3UAR A;  1V9W A;  1E6B A;  1G6Y A;  1AW9 A;  1B9X C;  3V1W A;  2X8H A;  3I43 A;  1H4O A;  4K7I A;  5CRH A;  5AIV A;  1QFN A;  4WET A;  4ZL7 A;  1PMT A;  1I5G A;  4KUN A;  1TXX A;  16GS A;  1XFL A;  3LXT A;  2IFQ B;  4I2U A;  3N5O A;  2GSR A;  4GWR A;  3CBU A;  4TR1 B;  1THO A;  1O7U A;  1A24 A;  4JR6 A;  3GH6 A;  4ZXG A;  4KH7 A;  4OFT A;  2H1B A;  3UBK A;  1YKA A;  3QPM A;  5D93 A;  3J7Y k;  3UIW A;  1G7O A;  2AJQ B;  2MMN A;  3GNJ A;  2H1A A;  1CQG A;  3ZLP A;  1T4Z A;  5CRG A;  4GSN A;  2HZE A;  3QCP A;  5L71 A;  4I5Q A;  3TJF A;  2FWF A;  2K9F A;  1M2A A;  2R2J A;  1ZGN A;  1HYU A;  1BAY A;  2AAW A;  2L5O A;  2OE3 A;  5CP1 A;  1XWB A;  3LYP A;  3TOU A;  4XHM A;  2OAD A;  4X1U A;  1TK5 B;  4V2N A;  2B7K A;  1EOH A;  2A2R A;  3ME8 A;  5HFI A;  4BA7 A;  2WGR A;  4WF4 A;  1U3I A;  2GGT A;  3VWX A;  1GTI A;  5J4U A;  1T8E B;  1GUL A;  2K8V A;  1GSY A;  3HD5 A;  4MH3 A;  3G7J A;  2DJ3 A;  3WGD A;  6GSW A;  2FLS A;  4X43 A;  5IMV A;  4G19 A;  2LJA A;  2KUC A;  3UBL A;  1M2D A;  3DVW A;  4N11 A;  3ED3 A;  1K3Y A;  1S3A A;  2TRC P;  3CTG A;  1F37 A;  1GSF A;  1YDK A;  2RII A;  1SD8 A;  3FKF A;  4Q5N A;  2CZ3 A;  4OO5 A;  4HI7 A;  4OFN A;  4DSS B;  3EC3 A;  5H5R A;  3TB2 A;  4V1A g;  13GS A;  2E2M A;  1BYE A;  4Q5Q A;  2OBI A;  4GQC A;  3L4N A;  1GL8 A;  1NW2 A;  2UZ8 A;  2M46 A;  2C80 A;  2XPD A;  4WR5 A;  2DJK A;  4HQZ A;  4D73 B;  2PGT A;  3W6G A;  3F4T A;  4IGJ A;  1TJD A;  4NHW A;  4K7O A;  1DE2 A;  4N30 A;  2LS5 A;  4AGS A;  2HRK B;  4IKH A;  2GSS A;  4JU5 A;  4LL4 B;  3EU3 A;  1ERV A;  4NHZ A;  4TR3 A;  2LEG A;  1R5P A;  4KCA A;  3IOS A;  2HSH A;  2HNL A;  3TKQ A;  3VFI A;  2RM6 A;  4ZBA A;  2B5Y A;  5DCH A;  6GST A;  2L4C A;  3TUE A;  2G2Q A;  4ZB8 A;  3NZN A;  3BJ5 A;  1XVQ A;  2C1Y A;  5DVB A;  4KDU A;  4AF2 A;  4EKZ A;  1JZO A;  2QKE A;  1JLW A;  1O81 A;  4L8E A;  1HNC A;  1SJI A;  2GQL A;  1XWC A;  1O85 A;  3GKN A;  5E59 A;  1GRX A;  3KCM A;  1BQ7 A;  1OE8 A;  1TP9 A;  3ZVJ A;  5IMZ A;  3VI5 A;  2FWG A;  1DBY A;  3P90 A;  3C7M A;  2MMZ A;  1W4V A;  4PTS A;  5G2Z A;  1THX A;  5FHI A;  1YKC A;  3A2W A;  3GMF A;  2VCZ A;  1ACV A;  3IC4 A;  2NTO A;  1ZYE A;  2X8G A;  2VAF A;  3GTU B;  4TN8 A;  3PGT A;  5ECL B;  4EL1 A;  1YZX A;  1U3A A;  4BL7 B;  1TRW A;  4RQR A;  1C72 A;  4IBP A;  2R5G A;  1GTU A;  4IQA A;  3Q74 A;  4XS6 A;  3C1S A;  3L9U A;  3VWU A;  3VWW A;  3QDN A;  1PX6 A;  3F6F A;  5D8I A;  3KJY A;  2B6M A;  2CVB A;  2C8U A;  3EU4 A;  4WKW A;  1ZMA A;  2AHE A;  1YEX A;  2IME A;  3P7X A;  2VM1 A;  3F3Q A;  5DAL B;  1PD2 1;  12GS A;  1XWG A;  2PPT A;  1S3C A;  1SJ6 A;  3A3T A;  4EDY A;  1BJX A;  3ZTL A;  2H6Y A;  2KHP A;  5D73 A;  1K0O A;  1B9Y C;  4NPB A;  5IMA A;  4I8B A;  1WWJ A;  4WR4 A;  2IFQ A;  4ULX A;  5JWO B;  5CRW A;  4F0B A;  1EP8 A;  3WGE A;  1OC9 B;  4KSM A;  3IAM 2;  3GL5 A;  3HHV A;  4MAB A;  1XBS A;  5BMU A;  1RW1 A;  4NMU A;  4OFM A;  2H66 A;  2WJU A;  4HOJ A;  5KEJ A;  3Q19 A;  2D2Z A;  2E0Q A;  3WT2 A;  2K18 A;  5JCG A;  2HRN A;  3QD9 A;  5KN0 A;  3U6V A;  2L4Q A;  3GFK A;  1UA5 A;  3NIV A;  2CA8 A;  6GSS A;  2DJ0 A;  4AJ7 A;  5JCU A;  2CT6 A;  2DJ1 A;  3RHC A;  1TKD B;  2H0I A;  1GWC A;  2O87 A;  2VLV A;  1XCC A;  5FWG A;  2ES7 A;  1YF1 A;  5ELG A;  5IO2 A;  3HJO A;  5LCZ A;  1M9A A;  3IR4 A;  2H74 A;  4Q5F A;  4MZW A;  4MDC A;  4AJ8 A;  5G5E A;  3TJJ A;  3A5W A;  5CAX A;  5IO0 A;  2RUF A;  3VUR A;  1E2Y A;  1K0N A;  3ERF A;  3H4K A;  2I81 A;  1Y6E A;  1KEB A;  4KB3 A;  1FVJ A;  1OVN A;  3GRX A;  3HDC A;  6GSX A;  2LQO A;  4ECJ A;  4TXO A;  2JZS A;  1M9B A;  1JZR A;  2GTU A;  5A5K A;  4I6X A;  3GST A;  3L0H A;  4YAP A;  4TXV A;  1J9B A;  3DWV A;  2H75 A;  4EF0 A;  1WOU A;  1Y25 A;  1K0C A;  4ECB A;  1OYJ A;  4HU9 A;  4FH8 A;  2FWH A;  5ECO B;  3LYK A;  3IK7 A;  1ON4 A;  1T1V A;  1AXD A;  4IVF A;  3CMI A;  3IXR A;  3K8N A;  2FD3 A;  2E2G A;  11GS A;  5HR3 A;  4EVM A;  3O3T A;  2X8C A;  3LJR A;  2IN3 A;  1DE1 A;  2L6D A;  4WBJ A;  5IMC A;  4J56 E;  2OE1 A;  4HUA A;  2VCX A;  4K6X A;  5IPH A;  3KM6 A;  3HVX A;  5G31 A;  2MMA A;  2AB6 A;  3F3R A;  1PRX A;  5G1L A;  2VOC A;  2WRT A;  3ZYW A;  1JFU A;  3D22 A;  3G9B A;  2HRK A;  3QR6 A;  2I4A A;  3HVV A;  2YN1 A;  4L5O A;  3IHQ A;  1A0R P;  5ID2 B;  4OWY A;  3GL3 A;  3C71 A;  4GQF A;  1AIU A;  2H73 A;  3RHB A;  4ZBD A;  3D0Z A;  2CV4 A;  3TKS E;  2PVQ A;  2YPM A;  3UVH A;  2PU9 C;  2VM2 A;  1ZCP A;  4OO4 A;  2VO4 A;  5ECQ B;  5ECH B;  2B1K A;  6GSV A;  1BG5 A;  3KZQ A;  1SU9 A;  2DJJ A;  3KEB A;  1SKW B;  3GKM A;  1VF4 A;  4LLR A;  2P5R A;  5ECI B;  5DDL A;  1TU7 A;  1T4Y A;  2O89 A;  3APS A;  2R4V A;  3H93 A;  3IAS 2;  1U88 A;  2JAD A;  1TOF A;  4WXT A;  4BWQ A;  1SK2 A;  2WUL A;  5HFK A;  4ILF A;  3KXO A;  1A2L A;  2FGX A;  3CRU A;  2YNX A;  2DC5 A;  1XWA A;  2TIR A;  4POM A;  1A2J A;  1OC3 A;  2WZ9 A;  2YWI A;  4L0U A;  2IMD A;  3GYK A;  4E8H A;  3M9J A;  3GTU A;  1SL1 B;  2PER A;  2OBK A;  1QXH A;  3IPZ A;  2FUG 2;  4YQV A;  4PQH A;  2FY6 A;  2IL3 A;  1IYI A;  3GSS A;  4G0L A;  3L9S A;  3MNG A;  1QMV A;  1GSS A;  3TJK A;  3ZRE A;  2IJY A;  4KDX A;  5CRD A;  1OAZ A;  1VF3 A;  5CYY A;  4X0X A;  2GST A;  3J7Y b;  4KW6 A;  1FO5 A;  1GNE A;  1B4P A;  4L0W A;  4JE1 A;  4GRF A;  3FK8 A;  3L78 A;  3IC8 A;  2P0G A;  1PKW A;  1XXU A;  3LWA A;  1ERT A;  1EGO A;  1QQ2 A;  5DAL A;  1XVW A;  2MBT A;  4FQU A;  2LRC A;  2N5F A;  2XHF A;  1SL0 B;  1T7P B;  2NVL A;  3F63 A;  1HNA A;  1NM3 A;  4K0N A;  4HJ2 A;  4PNF A;  2DSA A;  4G9H A;  1UVZ A;  2TRX A;  5D9W A;  2XPE A;  1TK0 B;  2LUS A;  3FEU A;  5IOX A;  3NOF A;  10GS A;  14GS A;  1WIK A;  3EIN A;  5D9V A;  2IWT A;  3L9V A;  5IMF A;  4OCF A;  4YQM A;  4DEJ A;  5IMD A;  1TK8 B;  3P2A A;  4O92 A;  5G1K A;  5G5F A;  2C3T A;  2V2G A;  5ECN B;  2EIQ A;  4RQX A;  1SKR B;  1K0B A;  3HZ4 A;  2HZF A;  3F9U A;  2EIO A;  1BED A;  3APO A;  1S3D A;  2M72 A;  1RQM A;  4POK A;  3KH7 A;  4XS4 A;  1F3A A;  2OJL A;  1FW1 A;  2OE0 A;  4PX1 A;  1B8X A;  5DCG A;  1K0D A;  3DGQ A;  3IK9 A;  3ZML A;  4BVX B;  1SK0 A;  2RUE A;  4N0Z A;  1MD3 A;  5H5S A;  4CHS A;  3FR6 A;  5F06 A;  4IQ1 A;  2VL2 A;  3RPP A;  1DSB A;  2L6C A;  2H70 A;  1F9M A;  3UL3 A;  3IV4 A;  4MJE A;  2HSM A;  2KP2 A;  3ZZX A;  2F3M A;  4MF6 A;  3IDV A;  4LA1 A;  2GZY A;  4HZ2 A;  3GUS A;  1SYR A;  4MPF A;  1OKD A;  3MSZ A;  4MA9 A;  2ON7 A;  1VGL A;  3QAW A;  2VL2 C;  1TI1 A;  3TRQ A;  3QFA C;  1GLP A;  4HU7 A;  1ILO A;  1XOB A;  4NWY A;  2C3N A;  1JZD A;  4N10 A;  2VLU A;  2R6K A;  2V41 A;  1OC8 A;  4GLT A;  3D6I A;  5GZZ B;  4K2D A;  1I9D A;  1EEJ A;  2LJR A;  2B5E A;  3HY2 A;  1ZYQ B;  2B3S A;  2XBI A;  9GSS A;  3TCO A;  3TGZ A;  2HSY A;  3AY8 A;  4IP1 A;  1NSW A;  5ECP B;  2X99 A;  2Z9S A;  3M0F A;  2H0G A;  4GSS A;  3EYT A;  4POB A;  4OMV A;  3KIJ A;  3VK9 A;  1QGV A;  4IJI A;  3TDG A;  4K7N A;  6GSY A;  1A8L A;  2P31 A;  2VCT A;  5DJL A;  1ZZY A;  5AGY A;  2GQK A;  3HKR A;  5HFG A;  2H1G A;  2RM5 A;  2HE3 A;  4J2F A;  3W8J A;  2IMI A;  3A2X A;  5GAN D;  2L5L A;  4HZ4 A;  1FB6 A;  5CO3 A;  4RUV A;  3SWL A;  2QSI A;  5ID2 A;  4H86 A;  4JBB A;  2LST A;  1OKT A;  1Z6N A;  3UAP A;  5B6N A;  3P8W A;  2WFC A;  20GS A;  2FA8 A;  2H71 A;  1X9W B;  5J9B A;  5F05 A;  4MCU A;  4BVY A;  5J5N A; 
#chains in the Genus database with same CATH topology
 4PQI A;  5F8B A;  3R2Q A;  4KDY A;  3RDW A;  4ZL9 A;  2VLT A;  5GST A;  1GP1 A;  1G7E A;  3LSZ A;  3VI7 A;  1EP7 A;  2YV7 A;  5HQP A;  5J9C A;  1N25 A;  5COH A;  3HA9 A;  2HT9 A;  4F03 A;  4XRA A;  1SKS B;  2HZE B;  4NV5 A;  4JZQ A;  3F4S A;  4AJ6 A;  2DIZ A;  2WW2 A;  5J3R A;  1U87 A;  2O36 A;  2HI7 A;  1V2A A;  3QMX A;  1F3B A;  2H72 A;  2WS2 A;  1AQV A;  2CX3 A;  5DJM A;  3HZ8 A;  1Z7P A;  4ZIJ A;  3LEF A;  1R5A A;  4E68 A;  4YAV A;  3KP9 A;  3Q6O A;  1ABA A;  2GS3 A;  4TR1 A;  1U6T A;  1AQX A;  5A4U A;  5D96 A;  1F2E A;  1JLV A;  1WMJ A;  2DIY A;  3M1G A;  3DD3 A;  4XS1 A;  3RBT A;  2V32 A;  3M3M A;  4MJB A;  3UEM A;  1M7T A;  5KN3 A;  2CVD A;  5KOW A;  2O7K A;  1PA3 A;  4F0C A;  5F0G A;  4HDE A;  1H75 A;  3EMX A;  2BTO T;  4QMK A;  3FYG A;  2DBC A;  3M9K A;  4IN0 A;  4PUA A;  1NHO A;  1K3L A;  2R0G A;  3VPQ A;  2IPA A;  3VWV A;  1M99 A;  2H8L A;  1PX7 A;  7GSS A;  3EMP A;  4OCE A;  2HRF A;  1SJZ A;  2JSY A;  2H01 A;  4CY6 A;  2IIY A;  2OAC A;  1YY7 A;  1TI3 A;  3IE3 A;  2ZCT A;  4N0V A;  4O5R A;  3KGK A;  1F6M C;  3UVT A;  2L57 A;  4I2T A;  5A5H A;  2G0F A;  8GSS A;  4EXJ A;  5KN2 A;  2BMX A;  3LXZ A;  2FWE A;  3KMO A;  4K2X A;  3GHA A;  4KCE A;  3PR8 A;  4GF0 A;  3VLN A;  4HEA 2;  3US3 A;  4HS1 A;  2VCW A;  2C0G A;  3DYR A;  3IA1 A;  5HR1 A;  1KNG A;  4DSS A;  3F6D A;  3KD0 A;  6GSU A;  3TOT A;  1FG4 A;  5GSS A;  1K3O A;  4NXI A;  5IOW A;  4ML6 A;  4Q5R A;  4K8M A;  3DRN A;  2BJX A;  2XC2 A;  3LQ7 A;  2DKH A;  2JAC A;  1USB A;  3BBY A;  2JL4 A;  4YQU A;  4BVX A;  2IMF A;  4ECI A;  1B4Q A;  2F8F A;  4PNG A;  4BPY A;  3HVS A;  1A23 A;  4KSO A;  2VCV A;  3DEX A;  3R3E A;  1DUG A;  4JED A;  3ZFL A;  2B7J A;  2R37 A;  1Z9H A;  4D73 A;  3HCZ A;  2LRT A;  5AIS A;  1WPI A;  3S9F A;  3CSI A;  2CX4 A;  4MLY A;  5C04 A;  2WW1 A;  4EUY A;  1SD9 A;  4YH2 A;  1PL1 A;  3U5R E;  5ECK B;  1XW9 A;  2YP6 A;  1R26 A;  4PGT A;  1SK1 A;  3SBC A;  3F4R A;  4KAE A;  1J0F A;  1X9S B;  3GKX A;  3TJB A;  3PIN A;  1PN0 A;  1YEW C;  1BX9 A;  2IMK A;  3ZL5 A;  1WP0 A;  2NPB A;  5GAP D;  2X64 A;  3LOR A;  3D4M A;  2R3X A;  3HJP A;  2V6K A;  3FR9 A;  3PPU A;  5HR0 A;  2NBS A;  1QUW A;  22GS A;  4DSQ A;  5J4V A;  4F82 A;  2EFH A;  1YF0 A;  1PN9 A;  3FMW A;  1Z7R A;  2AYT A;  3O6T A;  4G10 A;  3GKK A;  1EV4 A;  2GT5 A;  3DML A;  2WW3 A;  1AAZ A;  1XW6 A;  17GS A;  5KOX A;  1WE0 A;  4IW9 A;  1O73 A;  2AUV A;  2GSQ A;  1TU8 A;  3BCK A;  1MDJ A;  4O32 A;  5A4V A;  1MEK A;  1V98 A;  3UJ1 A;  2FHE A;  2H6X A;  5ECR B;  1FB0 A;  4EE0 A;  4PUR A;  3ME7 A;  5B8A A;  3GN3 A;  2DML A;  3O76 A;  5FT3 A;  4V1A p;  1A2M A;  1RK4 A;  1Z6M A;  3FZ9 A;  1A0F A;  5EVO A;  1GNW A;  4PUF C;  4BWS A;  5LD0 A;  3EVI A;  3ZRD A;  5EL8 A;  2GLR A;  2QGV A;  1TTZ A;  3ZIT A;  4BL7 A;  3APQ A;  4GTU A;  19GS A;  3QAG A;  1N8J A;  4TVE A;  2K8S A;  4LMW A;  5A1N A;  2CQ9 A;  5HR2 A;  3QFB C;  18GS A;  2QC7 A;  1T00 A;  2MYG A;  3DKS A;  2A2S A;  4PXO A;  1FOV A;  3CYN A;  3WD6 A;  2WW0 A;  3MDK A;  4ISD A;  2KOK A;  3M8N A;  2H19 A;  1UN2 A;  5ELA A;  3IBH A;  4TR0 A;  3GIX A;  1QK8 A;  4ACS A;  4USS A;  3GX8 A;  4MF7 A;  1M3J A;  4YKF A;  3FHK A;  3FRC A;  1XZO A;  1Q4J A;  1ZYP A;  1O6J A;  5AIX A;  1ERU A;  2GDR A;  1GTB A;  1EWX A;  1VF1 A;  3MAK A;  2GZZ A;  2J23 A;  1X5C A;  2ZUP A;  4Z7X A;  3LGC A;  5B6M A;  5IQY A;  4O5Q A;  1JHB A;  1Q98 A;  4ML1 A;  4X4J A;  2YZU A;  2B5X A;  4MMM A;  1PSQ A;  1GSU A;  2OA7 A;  5ECS A;  4TW5 A;  2FNO A;  1OC9 A;  4MJC A;  2HFD A;  1TRU A;  2O85 A;  2YOI A;  4EC0 A;  4KND A;  2LJK A;  3GX0 A;  2AV4 A;  1A8Y A;  1Z5Y E;  5KN1 A;  2L59 A;  1SL2 B;  2MMO A;  4WEY A;  4JR4 A;  1FAA A;  4FIW A;  3CSH A;  1ZL9 A;  3C73 A;  3ZVJ D;  2I3Y A;  3TRX A;  4WF5 A;  1Z3E A;  1N2A A;  3LFL A;  4W66 A;  4TXO B;  4ZBB A;  4G2E A;  2WZS A;  1TRS A;  3ZIJ A;  1GLQ A;  3KTB A;  1JZW A;  2YWM A;  1YEP A;  5D9T A;  3WGX A;  5IM9 A;  2JZT A;  2EFE A;  3W8S A;  4E8E A;  1TDI A;  4G0K A;  2YZH A;  1MDI A;  4ZB6 A;  1OE7 A;  3IHG A;  4K1F A;  2VD1 A;  2ZNM A;  2FA4 A;  3FZA A;  1V57 A;  4DSR A;  4I97 A;  4ZIL A;  2DKI A;  3I9V 2;  2F51 A;  2OKA A;  4IJ3 A;  1GUM A;  4MK3 A;  4MJA A;  4GST A;  4AKX B;  3JCM L;  2E7P A;  2VUP A;  4V2L A;  3F8U A;  2C0F A;  5E4W A;  4YKG A;  3VPT A;  4ECC A;  2N5B A;  1UC7 A;  4TRX A;  3Q18 A;  3C8E A;  1HD2 A;  5DAK B;  5EY6 A;  5INY A;  4F2I A;  4FYU A;  3RPN A;  1XW5 A;  1XPV A;  4HQS A;  4O7H A;  5IIZ A;  3HYP A;  2MZC A;  3KP8 A;  5JWQ B;  1MTC A;  3CRT A;  2YV9 A;  4DVC A;  1M3I A;  5JCW A;  2B1L A;  5CRE A;  1GSD A;  2JZR A;  1GUH A;  4TKY A;  1ERW A;  1IYH A;  2ON5 A;  3I6A A;  5A34 B;  4JRR A;  4AKH A;  4FYC A;  2GT6 A;  1HQO A;  4ZB9 A;  1AUC A;  3CQF A;  3GUR A;  3BD2 A;  3G7I A;  4KGI A;  2R0C A;  2QA2 A;  2YCD A;  1TRV A;  3F0I A;  3UMA A;  4LL1 B;  3CSJ A;  4HJM A;  1O8X A;  1K0A A;  1S3R A;  2DMM A;  4QL9 A;  2I1U A;  3KMN A;  3BOA A;  3H8Q A;  3D5J A;  1K0M A;  3QAV A;  2EIR A;  1PQN A;  1PKZ A;  3RGB C;  2HLS A;  4TOP A;  2HYX A;  2HRA A;  4K9Z A;  2CAI A;  2C3Q A;  2PBJ A;  2YWO A;  2H6Z A;  2KP1 A;  3FZ5 A;  2WB9 A;  2V6O A;  4AKG A;  5F07 A;  4QL7 A;  3TKP A;  3FR3 A;  2N5A A;  3MWH A;  1LU4 A;  1B48 A;  5A4W A;  5ABR A;  1X5E A;  5JWR B;  3RAZ A;  3KTL A;  3TJG A;  2VIM A;  3ZFB A;  1AC1 A;  1URM A;  2PVO C;  4MPG A;  2REM A;  4MF5 A;  5DQS A;  4P3Y B;  1LBK A;  2CVK A;  4MP4 A;  4RI6 A;  4TR4 A;  3RFR C;  3FZ4 A;  4PQ1 A;  1ST9 A;  3ERW A;  2XBQ A;  2GQM A;  3D21 A;  2H1D A;  2C4J A;  2H30 A;  3GH9 A;  4POL A;  2V1M A;  2GZP A;  3TKR A;  2YJH A;  4KF9 A;  2JU5 A;  3ERG A;  2YAN A;  1ZOF A;  1EOG A;  4J57 E;  4F9Z A;  1Y1U A;  1X9M B;  5H5Q A;  1KBN A;  4CDO A;  2WDU A;  3BCI A;  1G0T A;  2LNT A;  4MZB A;  2CZ2 A;  3H1N A;  5LNK e;  3E3E A;  1EEM A;  1TW9 A;  3EUR A;  1YJ6 A;  1J08 A;  1FHE A;  2C0D A;  1VF2 A;  5C00 A;  4L5L A;  4OD7 A;  2H76 A;  1CQH A;  2R0P A;  2YJ7 A;  4WBR D;  4LMV A;  2P5Q A;  2MBS A;  3EE2 A;  2DJ2 A;  5B8B A;  4ID0 A;  3FW2 A;  1EGR A;  1GSQ A;  3DXB A;  4XS4 B;  4K0G A;  2J9H A;  1PGT A;  5B7C A;  4HSC X;  5DQY A;  2C0E A;  2VD0 A;  2ALB A;  2FCH A;  1X0R A;  4FYB A;  4GXZ A;  1GTA A;  2K6V A;  3I69 A;  2O8V B;  4ZB7 A;  5ENU A;  2JSZ A;  2HSN B;  3IRA A;  1SYX A;  2F9S A;  2PWJ A;  3E0U A;  1AQW A;  2LRN A;  3PH9 A;  1M2B A;  1M0U A;  2KLX A;  1WJK A;  5AN1 A;  2CAQ A;  3UOM A;  1FOH A;  4KX4 A;  1W89 A;  4NV2 A;  5ECM B;  1SEN A;  1NHY A;  3G7Y A;  1KTE A;  3TRP A;  4K5R A;  4GCI A;  2HSM B;  3ZMK A;  2WVX A;  3HXS A;  4EIP A;  4RI7 A;  3TKS A;  4QQ7 A;  4AKI A;  2A4V A;  3GA4 A;  4MH2 A;  3QOU A;  3EWL A;  2LKU A;  1ML6 A;  2NDO A;  4EO3 A;  1XOA A;  2DLX A;  3CXG A;  1WRY A;  2I9H A;  4CW9 A;  5J41 A;  5IPG A;  2F8A A;  4IP6 A;  2H0H A;  3A2V A;  1G6W A;  4IEL A;  3TKS C;  4XIH A;  5G30 A;  4MZC A;  4V2M A;  3FY7 A;  1SVO A;  1R4W A;  1GSE A;  3LG6 A;  5D9X A;  1R7H A;  3D4T A;  4ZL8 A;  2LV3 A;  2WCI A;  4FO5 A;  2RLI A;  1FVK A;  1GH2 A;  3N9J A;  3DVX A;  1PL2 A;  3ISO A;  4PI0 C;  4G0I A;  1MDK A;  2EC4 A;  3WT1 A;  2YWN A;  2LNS A;  4KE3 A;  1GUK A;  3KH9 A;  1T3B A;  3ZIV A;  4IS0 A;  3WYW A;  1YQ1 A;  4XRD A;  1HNB A;  5DAK A;  2VL3 A;  1PFO A;  4KA0 A;  3HMJ G;  2PMT A;  2M80 A;  4XTS A;  4XCS A;  1EV9 A;  1EZK A;  2LQQ A;  2HQT A;  1MD4 A;  5CNW A;  3OR5 A;  3DIE A;  4IHU A;  1V40 A;  1VRS D;  2VCQ A;  3GV1 A;  2VL9 A;  1O8W A;  2GVP A;  3E9J B;  4NAX A;  4BVY B;  2PUK C;  1LJR A;  1V58 A;  4EDZ A;  1X5D A;  1XIY A;  2HXK A;  5EPF A;  3CTF A;  2PN8 A;  3C1R A;  5DBQ A;  2LTK A;  1XWK A;  3HJM A;  3H79 A;  3UAR A;  1V9W A;  1E6B A;  1G6Y A;  1AW9 A;  1B9X C;  3V1W A;  2X8H A;  3I43 A;  1H4O A;  4K7I A;  5CRH A;  5AIV A;  1QFN A;  4WET A;  4ZL7 A;  1PMT A;  1I5G A;  4KUN A;  1TXX A;  16GS A;  1XFL A;  3LXT A;  2IFQ B;  4I2U A;  3N5O A;  2GSR A;  5BRT A;  4GWR A;  3CBU A;  4TR1 B;  1THO A;  1O7U A;  1A24 A;  4JR6 A;  3GH6 A;  4ZXG A;  5BMU B;  4KH7 A;  4OFT A;  2H1B A;  3UBK A;  1YKA A;  3QPM A;  5D93 A;  1SVL A;  3J7Y k;  3UIW A;  1G7O A;  2AJQ B;  2MMN A;  3GNJ A;  2A2P A;  2H1A A;  1CQG A;  3ZLP A;  1T4Z A;  5CRG A;  4GSN A;  2HZE A;  3QCP A;  5L71 A;  4I5Q A;  3TJF A;  2FWF A;  2K9F A;  1I1I P;  1M2A A;  2R2J A;  1ZGN A;  1HYU A;  1BAY A;  2AAW A;  2L5O A;  2OE3 A;  5CP1 A;  1XWB A;  3LYP A;  3TOU A;  4XHM A;  2OAD A;  4X1U A;  1TK5 B;  4V2N A;  2B7K A;  1EOH A;  2A2R A;  3ME8 A;  5HFI A;  4BA7 A;  2WGR A;  4WF4 A;  1U3I A;  2GGT A;  4CY8 A;  3VWX A;  1GTI A;  5J4U A;  1T8E B;  1GUL A;  2K8V A;  2OT3 A;  1GSY A;  3HD5 A;  4Z2T A;  4MH3 A;  3G7J A;  2DJ3 A;  3MIX A;  3WGD A;  6GSW A;  1BG1 A;  2FLS A;  4X43 A;  5IMV A;  4G19 A;  2LJA A;  2KUC A;  3UBL A;  1M2D A;  3DVW A;  4N11 A;  3ED3 A;  1K3Y A;  1S3A A;  2TRC P;  3CTG A;  1F37 A;  1GSF A;  1YDK A;  2RII A;  1SD8 A;  3FKF A;  4Q5N A;  2CZ3 A;  4OO5 A;  4HI7 A;  4OFN A;  4DSS B;  3EC3 A;  5H5R A;  3TB2 A;  4V1A g;  2VKZ G;  13GS A;  2E2M A;  1BYE A;  4Q5Q A;  2OBI A;  4GQC A;  3L4N A;  1GL8 A;  2HSN A;  2EFD A;  1NW2 A;  2UZ8 A;  2M46 A;  2C80 A;  2XPD A;  4WR5 A;  2DJK A;  4HQZ A;  4D73 B;  2PGT A;  3W6G A;  3F4T A;  4IGJ A;  1TJD A;  4NHW A;  4K7O A;  1DE2 A;  4N30 A;  2WVZ A;  2LS5 A;  4AGS A;  2HRK B;  4IKH A;  2GSS A;  4JU5 A;  4LL4 B;  3EU3 A;  1ERV A;  4NHZ A;  4TR3 A;  2LEG A;  1R5P A;  4KCA A;  3IOS A;  2HSH A;  2HNL A;  3TKQ A;  3VFI A;  2RM6 A;  4ZBA A;  2B5Y A;  5DCH A;  6GST A;  2L4C A;  4K5S A;  3TUE A;  2G2Q A;  4ZB8 A;  3NZN A;  3BJ5 A;  1XVQ A;  2C1Y A;  5DVB A;  4KDU A;  4AF2 A;  4EKZ A;  1JZO A;  2QKE A;  1JLW A;  1O81 A;  3CWG A;  4L8E A;  1HNC A;  1SJI A;  2GQL A;  1XWC A;  1O85 A;  3GKN A;  5E59 A;  1GRX A;  3KCM A;  4GDF A;  4FXY P;  1BQ7 A;  1OE8 A;  1TP9 A;  2QA1 A;  3ZVJ A;  5IMZ A;  3VI5 A;  2FWG A;  1DBY A;  3P90 A;  3C7M A;  2MMZ A;  1W4V A;  4PTS A;  5G2Z A;  1THX A;  5FHI A;  1YKC A;  3A2W A;  3GMF A;  2VCZ A;  1ACV A;  3IC4 A;  2NTO A;  1ZYE A;  2X8G A;  2VAF A;  3GTU B;  4TN8 A;  3PGT A;  5ECL B;  4EL1 A;  1YZX A;  1U3A A;  4BL7 B;  1TRW A;  4RQR A;  1C72 A;  4IBP A;  2R5G A;  5A1N B;  1GTU A;  4IQA A;  2X4A A;  3Q74 A;  4XS6 A;  3C1S A;  3L9U A;  3VWU A;  3VWW A;  3QDN A;  3EPT A;  1PX6 A;  3F6F A;  5D8I A;  3KJY A;  2B6M A;  2CVB A;  2C8U A;  3EU4 A;  4WKW A;  1ZMA A;  2AHE A;  1YEX A;  2IME A;  2H1L A;  3P7X A;  2VM1 A;  1TXU A;  3F3Q A;  5DAL B;  1PD2 1;  12GS A;  1XWG A;  2PPT A;  1S3C A;  1SJ6 A;  3A3T A;  4EDY A;  1BJX A;  3ZTL A;  2H6Y A;  2KHP A;  5D73 A;  1K0O A;  1B9Y C;  4NPB A;  5IMA A;  4I8B A;  1WWJ A;  4WR4 A;  2IFQ A;  4ULX A;  5JWO B;  5CRW A;  4F0B A;  1EP8 A;  3WGE A;  1OC9 B;  4KSM A;  3IAM 2;  3GL5 A;  3HHV A;  4MAB A;  1XBS A;  5BMU A;  1RW1 A;  4NMU A;  4OFM A;  2H66 A;  2WJU A;  4HOJ A;  5KEJ A;  3Q19 A;  2D2Z A;  2E0Q A;  3WT2 A;  2K18 A;  5JCG A;  2HRN A;  3QD9 A;  5KN0 A;  3U6V A;  2L4Q A;  3GFK A;  1UA5 A;  3NIV A;  2CA8 A;  6GSS A;  2DJ0 A;  4AJ7 A;  5JCU A;  2CT6 A;  2DJ1 A;  3RHC A;  1TKD B;  2H0I A;  1GWC A;  2O87 A;  2VLV A;  1XCC A;  5FWG A;  2ES7 A;  1YF1 A;  5ELG A;  5IO2 A;  3HJO A;  5LCZ A;  1M9A A;  3IR4 A;  2A4H A;  2H74 A;  4Q5F A;  4G01 A;  4MZW A;  4MDC A;  4AJ8 A;  5G5E A;  3TJJ A;  3A5W A;  5CAX A;  5IO0 A;  2RUF A;  3VUR A;  1E2Y A;  1K0N A;  3ERF A;  3H4K A;  2I81 A;  1Y6E A;  1KEB A;  4Z2R A;  4KB3 A;  1FVJ A;  1OVN A;  3GRX A;  3HDC A;  6GSX A;  2LQO A;  4ECJ A;  4TXO A;  2JZS A;  1M9B A;  1JZR A;  2GTU A;  5A5K A;  4I6X A;  3GST A;  3L0H A;  4YAP A;  4TXV A;  1J9B A;  3DWV A;  2H75 A;  4EF0 A;  1WOU A;  1Y25 A;  1K0C A;  4ECB A;  1OYJ A;  4HU9 A;  4FH8 A;  2FWH A;  5ECO B;  3LYK A;  3A5I A;  3IK7 A;  1ON4 A;  1T1V A;  1AXD A;  4IVF A;  3CMI A;  3IXR A;  3K8N A;  2FD3 A;  2E2G A;  11GS A;  5HR3 A;  4EVM A;  3O3T A;  2X8C A;  3LJR A;  2IN3 A;  4Z2U A;  1DE1 A;  2L6D A;  4WBJ A;  5IMC A;  4J56 E;  2OE1 A;  4HUA A;  2VCX A;  4PHZ C;  4K6X A;  5IPH A;  3KM6 A;  3HVX A;  5G31 A;  2MMA A;  2AB6 A;  3F3R A;  1PRX A;  5G1L A;  2VOC A;  2WRT A;  3ZYW A;  1JFU A;  3D22 A;  3G9B A;  2HRK A;  1ZYN A;  3QR6 A;  2I4A A;  3HVV A;  2YN1 A;  4L5O A;  3IHQ A;  1A0R P;  5ID2 B;  4OWY A;  3GL3 A;  3C71 A;  4GQF A;  1AIU A;  4BIK A;  2H73 A;  2WVY A;  3RHB A;  4ZBD A;  3D0Z A;  2CV4 A;  3TKS E;  2PVQ A;  2O5V A;  2YPM A;  3UVH A;  2PU9 C;  2VM2 A;  1ZCP A;  4OO4 A;  2VO4 A;  5ECQ B;  5ECH B;  2B1K A;  6GSV A;  1BG5 A;  3KZQ A;  1SU9 A;  2DJJ A;  3KEB A;  1SKW B;  3GKM A;  1VF4 A;  4LLR A;  2P5R A;  5ECI B;  5DDL A;  1TU7 A;  1T4Y A;  2O89 A;  5A34 A;  3APS A;  2R4V A;  3H93 A;  3IAS 2;  1U88 A;  2JAD A;  1TOF A;  4WXT A;  4BWQ A;  1SK2 A;  2WUL A;  5HFK A;  4ILF A;  3KXO A;  1A2L A;  2UV8 G;  2FGX A;  3CRU A;  2YNX A;  2DC5 A;  1XWA A;  2TIR A;  4POM A;  1A2J A;  1BF5 A;  1OC3 A;  2WZ9 A;  2YWI A;  4L0U A;  2IMD A;  3GYK A;  4E8H A;  3M9J A;  3GTU A;  1SL1 B;  2PER A;  2OBK A;  1QXH A;  3IPZ A;  2FUG 2;  4YQV A;  4PQH A;  2FY6 A;  2IL3 A;  1IYI A;  3MYD A;  3GSS A;  4G0L A;  3L9S A;  3MNG A;  1QMV A;  1GSS A;  3TJK A;  3ZRE A;  2IJY A;  4KDX A;  5CRD A;  1OAZ A;  1VF3 A;  5CYY A;  4X0X A;  2GST A;  3J7Y b;  4KW6 A;  1FO5 A;  1GNE A;  1B4P A;  4L0W A;  4JE1 A;  4GRF A;  3FK8 A;  3CHX C;  3L78 A;  3IC8 A;  2P0G A;  1PKW A;  3LW9 A;  1XXU A;  3LWA A;  1ERT A;  1EGO A;  1QQ2 A;  5DAL A;  1XVW A;  2MBT A;  4FQU A;  2LRC A;  2N5F A;  2XHF A;  1SL0 B;  1T7P B;  2NVL A;  3F63 A;  1HNA A;  1NM3 A;  4K0N A;  4HJ2 A;  4PNF A;  2DSA A;  4G9H A;  1UVZ A;  2TRX A;  5D9W A;  2XPE A;  1TK0 B;  2LUS A;  3FEU A;  5IOX A;  3NOF A;  2O3E A;  4AI6 A;  10GS A;  2X49 A;  5A5H B;  14GS A;  1WIK A;  3EIN A;  5D9V A;  2IWT A;  3L9V A;  5IMF A;  4OCF A;  4YQM A;  4DEJ A;  5IMD A;  1TK8 B;  3P2A A;  4O92 A;  5G1K A;  5G5F A;  2C3T A;  2V2G A;  5ECN B;  2EIQ A;  2WVX B;  4RQX A;  1SKR B;  1K0B A;  3HZ4 A;  2HZF A;  3F9U A;  2EIO A;  1BED A;  3APO A;  1S3D A;  2M72 A;  1RQM A;  4POK A;  3KH7 A;  4XS4 A;  1F3A A;  2OJL A;  1FW1 A;  2OE0 A;  4O5U A;  4PX1 A;  1B8X A;  5DCG A;  5J47 A;  1K0D A;  3DGQ A;  3IK9 A;  1YVL A;  3ZML A;  4BVX B;  1SK0 A;  2RUE A;  4MNN A;  4N0Z A;  1MD3 A;  4ICY A;  5H5S A;  3TU3 B;  4CHS A;  3FR6 A;  5F06 A;  4IQ1 A;  2VL2 A;  3RPP A;  1DSB A;  2L6C A;  2H70 A;  3HVN A;  1F9M A;  3UL3 A;  3IV4 A;  4MJE A;  2HSM A;  2KP2 A;  3ZZX A;  2F3M A;  4MF6 A;  5J40 A;  1SVM A;  3IDV A;  4LA1 A;  2GZY A;  4HZ2 A;  3GUS A;  1SYR A;  4MPF A;  4N3Z A;  1XG8 A;  1OKD A;  3MSZ A;  4MA9 A;  2ON7 A;  1VGL A;  3QAW A;  2VL2 C;  1TI1 A;  3TRQ A;  3QFA C;  1GLP A;  4HU7 A;  1ILO A;  1XOB A;  4NWY A;  2C3N A;  1JZD A;  4N10 A;  2VLU A;  2R6K A;  2V41 A;  1OC8 A;  4GLT A;  3D6I A;  5GZZ B;  4K2D A;  1I9D A;  1EEJ A;  2LJR A;  2B5E A;  3HY2 A;  4PI2 C;  1ZYQ B;  2B3S A;  2XBI A;  9GSS A;  3TCO A;  3TGZ A;  2HSY A;  3AY8 A;  4IP1 A;  1S4B P;  1NSW A;  5ECP B;  2X99 A;  2Z9S A;  5J4Y A;  3M0F A;  2H0G A;  4GSS A;  3EYT A;  4POB A;  4OMV A;  3KIJ A;  3VK9 A;  1QGV A;  4IJI A;  3TDG A;  4K7N A;  2EFC A;  6GSY A;  4EIQ A;  1A8L A;  2P31 A;  2VCT A;  5DJL A;  1ZZY A;  5AGY A;  2GQK A;  3HKR A;  5HFG A;  2H1G A;  2RM5 A;  2HE3 A;  4J2F A;  3W8J A;  2IMI A;  3A2X A;  5GAN D;  2L5L A;  4HZ4 A;  1FB6 A;  5CO3 A;  4RUV A;  3SWL A;  2QSI A;  5ID2 A;  4H86 A;  4A5P A;  4JBB A;  2LST A;  1OKT A;  1Z6N A;  3UAP A;  5B6N A;  3P8W A;  2WFC A;  20GS A;  2FA8 A;  2H71 A;  1X9W B;  5J9B A;  5F05 A;  4MCU A;  4BVY A;  5J5N A; 
#chains in the Genus database with same CATH homology
 4PQI A;  5F8B A;  3R2Q A;  4KDY A;  3RDW A;  4ZL9 A;  2VLT A;  5GST A;  1GP1 A;  1G7E A;  3LSZ A;  3VI7 A;  1EP7 A;  2YV7 A;  5HQP A;  5J9C A;  1N25 A;  5COH A;  3HA9 A;  2HT9 A;  4F03 A;  4XRA A;  1SKS B;  2HZE B;  4NV5 A;  4JZQ A;  3F4S A;  4AJ6 A;  2DIZ A;  5J3R A;  1U87 A;  2HI7 A;  1V2A A;  3QMX A;  1F3B A;  2H72 A;  2WS2 A;  1AQV A;  2CX3 A;  5DJM A;  3HZ8 A;  1Z7P A;  4ZIJ A;  3LEF A;  1R5A A;  4E68 A;  4YAV A;  3KP9 A;  3Q6O A;  1ABA A;  2GS3 A;  4TR1 A;  1U6T A;  1AQX A;  5A4U A;  5D96 A;  1F2E A;  1JLV A;  1WMJ A;  2DIY A;  3M1G A;  3DD3 A;  4XS1 A;  3RBT A;  2V32 A;  3M3M A;  4MJB A;  3UEM A;  1M7T A;  5KN3 A;  2CVD A;  5KOW A;  2O7K A;  1PA3 A;  4F0C A;  5F0G A;  4HDE A;  1H75 A;  3EMX A;  2BTO T;  4QMK A;  3FYG A;  2DBC A;  3M9K A;  4IN0 A;  4PUA A;  1NHO A;  1K3L A;  2R0G A;  3VPQ A;  2IPA A;  3VWV A;  1M99 A;  2H8L A;  1PX7 A;  7GSS A;  3EMP A;  4OCE A;  2HRF A;  1SJZ A;  2JSY A;  2H01 A;  4CY6 A;  2IIY A;  2OAC A;  1YY7 A;  1TI3 A;  3IE3 A;  2ZCT A;  4N0V A;  4O5R A;  3KGK A;  1F6M C;  3UVT A;  2L57 A;  4I2T A;  5A5H A;  2G0F A;  8GSS A;  4EXJ A;  5KN2 A;  2BMX A;  3LXZ A;  2FWE A;  3KMO A;  4K2X A;  3GHA A;  4KCE A;  3PR8 A;  4GF0 A;  3VLN A;  4HEA 2;  3US3 A;  4HS1 A;  2VCW A;  2C0G A;  3DYR A;  3IA1 A;  5HR1 A;  1KNG A;  4DSS A;  3F6D A;  3KD0 A;  6GSU A;  3TOT A;  1FG4 A;  5GSS A;  1K3O A;  4NXI A;  5IOW A;  4ML6 A;  4Q5R A;  4K8M A;  3DRN A;  2BJX A;  2XC2 A;  3LQ7 A;  2DKH A;  2JAC A;  1USB A;  3BBY A;  2JL4 A;  4YQU A;  4BVX A;  2IMF A;  4ECI A;  1B4Q A;  2F8F A;  4PNG A;  4BPY A;  3HVS A;  1A23 A;  4KSO A;  2VCV A;  3DEX A;  3R3E A;  1DUG A;  4JED A;  3ZFL A;  2B7J A;  2R37 A;  1Z9H A;  4D73 A;  3HCZ A;  2LRT A;  5AIS A;  1WPI A;  3S9F A;  3CSI A;  2CX4 A;  4MLY A;  5C04 A;  4EUY A;  1SD9 A;  4YH2 A;  1PL1 A;  3U5R E;  5ECK B;  1XW9 A;  2YP6 A;  1R26 A;  4PGT A;  1SK1 A;  3SBC A;  3F4R A;  4KAE A;  1J0F A;  1X9S B;  3GKX A;  3TJB A;  3PIN A;  1PN0 A;  1BX9 A;  2IMK A;  3ZL5 A;  1WP0 A;  2NPB A;  5GAP D;  2X64 A;  3LOR A;  3D4M A;  2R3X A;  3HJP A;  2V6K A;  3FR9 A;  3PPU A;  5HR0 A;  2NBS A;  1QUW A;  22GS A;  4DSQ A;  5J4V A;  4F82 A;  2EFH A;  1YF0 A;  1PN9 A;  3FMW A;  1Z7R A;  2AYT A;  3O6T A;  4G10 A;  3GKK A;  1EV4 A;  2GT5 A;  3DML A;  1AAZ A;  1XW6 A;  17GS A;  5KOX A;  1WE0 A;  4IW9 A;  1O73 A;  2AUV A;  2GSQ A;  1TU8 A;  3BCK A;  1MDJ A;  4O32 A;  5A4V A;  1MEK A;  1V98 A;  3UJ1 A;  2FHE A;  2H6X A;  5ECR B;  1FB0 A;  4EE0 A;  4PUR A;  3ME7 A;  5B8A A;  3GN3 A;  2DML A;  3O76 A;  5FT3 A;  4V1A p;  1A2M A;  1RK4 A;  1Z6M A;  3FZ9 A;  1A0F A;  5EVO A;  1GNW A;  4PUF C;  4BWS A;  5LD0 A;  3EVI A;  3ZRD A;  5EL8 A;  2GLR A;  2QGV A;  1TTZ A;  3ZIT A;  4BL7 A;  3APQ A;  4GTU A;  19GS A;  3QAG A;  1N8J A;  4TVE A;  2K8S A;  4LMW A;  5A1N A;  2CQ9 A;  5HR2 A;  3QFB C;  18GS A;  2QC7 A;  1T00 A;  2MYG A;  3DKS A;  2A2S A;  4PXO A;  1FOV A;  3CYN A;  3WD6 A;  3MDK A;  4ISD A;  2KOK A;  3M8N A;  2H19 A;  1UN2 A;  5ELA A;  3IBH A;  4TR0 A;  3GIX A;  1QK8 A;  4ACS A;  4USS A;  3GX8 A;  4MF7 A;  4YKF A;  3FHK A;  3FRC A;  1XZO A;  1Q4J A;  1ZYP A;  1O6J A;  5AIX A;  1ERU A;  2GDR A;  1GTB A;  1EWX A;  1VF1 A;  3MAK A;  2GZZ A;  2J23 A;  1X5C A;  2ZUP A;  4Z7X A;  3LGC A;  5B6M A;  5IQY A;  4O5Q A;  1JHB A;  1Q98 A;  4ML1 A;  4X4J A;  2YZU A;  2B5X A;  4MMM A;  1PSQ A;  1GSU A;  2OA7 A;  5ECS A;  4TW5 A;  2FNO A;  1OC9 A;  4MJC A;  2HFD A;  1TRU A;  2O85 A;  2YOI A;  4EC0 A;  4KND A;  2LJK A;  3GX0 A;  2AV4 A;  1A8Y A;  1Z5Y E;  5KN1 A;  2L59 A;  1SL2 B;  2MMO A;  4WEY A;  4JR4 A;  1FAA A;  4FIW A;  3CSH A;  1ZL9 A;  3C73 A;  3ZVJ D;  2I3Y A;  3TRX A;  4WF5 A;  1Z3E A;  1N2A A;  3LFL A;  4W66 A;  4TXO B;  4ZBB A;  4G2E A;  1TRS A;  3ZIJ A;  1GLQ A;  3KTB A;  1JZW A;  2YWM A;  1YEP A;  5D9T A;  3WGX A;  5IM9 A;  2JZT A;  2EFE A;  3W8S A;  4E8E A;  1TDI A;  4G0K A;  2YZH A;  1MDI A;  4ZB6 A;  1OE7 A;  3IHG A;  4K1F A;  2VD1 A;  2ZNM A;  2FA4 A;  3FZA A;  1V57 A;  4DSR A;  4I97 A;  4ZIL A;  2DKI A;  3I9V 2;  2F51 A;  2OKA A;  4IJ3 A;  1GUM A;  4MK3 A;  4MJA A;  4GST A;  4AKX B;  3JCM L;  2E7P A;  2VUP A;  4V2L A;  3F8U A;  2C0F A;  5E4W A;  4YKG A;  3VPT A;  4ECC A;  2N5B A;  1UC7 A;  4TRX A;  3Q18 A;  3C8E A;  1HD2 A;  5DAK B;  5EY6 A;  5INY A;  4F2I A;  4FYU A;  3RPN A;  1XW5 A;  1XPV A;  4HQS A;  4O7H A;  5IIZ A;  3HYP A;  2MZC A;  3KP8 A;  5JWQ B;  1MTC A;  3CRT A;  2YV9 A;  4DVC A;  5JCW A;  2B1L A;  5CRE A;  1GSD A;  2JZR A;  1GUH A;  4TKY A;  1ERW A;  1IYH A;  2ON5 A;  3I6A A;  5A34 B;  4JRR A;  4AKH A;  4FYC A;  2GT6 A;  1HQO A;  4ZB9 A;  1AUC A;  3GUR A;  3BD2 A;  3G7I A;  4KGI A;  2R0C A;  2QA2 A;  2YCD A;  1TRV A;  3F0I A;  3UMA A;  4LL1 B;  3CSJ A;  4HJM A;  1O8X A;  1K0A A;  2DMM A;  4QL9 A;  2I1U A;  3KMN A;  3BOA A;  3H8Q A;  3D5J A;  1K0M A;  3QAV A;  2EIR A;  1PQN A;  1PKZ A;  2HLS A;  4TOP A;  2HYX A;  2HRA A;  4K9Z A;  2CAI A;  2C3Q A;  2PBJ A;  2YWO A;  2H6Z A;  2KP1 A;  3FZ5 A;  2WB9 A;  2V6O A;  4AKG A;  5F07 A;  4QL7 A;  3TKP A;  3FR3 A;  2N5A A;  3MWH A;  1LU4 A;  1B48 A;  5A4W A;  5ABR A;  1X5E A;  5JWR B;  3RAZ A;  3KTL A;  3TJG A;  2VIM A;  3ZFB A;  1AC1 A;  1URM A;  2PVO C;  4MPG A;  2REM A;  4MF5 A;  5DQS A;  4P3Y B;  1LBK A;  2CVK A;  4MP4 A;  4RI6 A;  4TR4 A;  3FZ4 A;  4PQ1 A;  1ST9 A;  3ERW A;  2XBQ A;  2GQM A;  3D21 A;  2H1D A;  2C4J A;  2H30 A;  3GH9 A;  4POL A;  2V1M A;  2GZP A;  3TKR A;  2YJH A;  4KF9 A;  2JU5 A;  3ERG A;  2YAN A;  1ZOF A;  1EOG A;  4J57 E;  4F9Z A;  1Y1U A;  1X9M B;  5H5Q A;  1KBN A;  4CDO A;  2WDU A;  3BCI A;  1G0T A;  2LNT A;  4MZB A;  2CZ2 A;  3H1N A;  5LNK e;  3E3E A;  1EEM A;  1TW9 A;  3EUR A;  1YJ6 A;  1J08 A;  1FHE A;  2C0D A;  1VF2 A;  5C00 A;  4L5L A;  4OD7 A;  2H76 A;  1CQH A;  2R0P A;  2YJ7 A;  4WBR D;  4LMV A;  2P5Q A;  2MBS A;  3EE2 A;  2DJ2 A;  5B8B A;  4ID0 A;  3FW2 A;  1EGR A;  1GSQ A;  3DXB A;  4XS4 B;  4K0G A;  2J9H A;  1PGT A;  5B7C A;  5DQY A;  2C0E A;  2VD0 A;  2ALB A;  2FCH A;  1X0R A;  4FYB A;  4GXZ A;  1GTA A;  2K6V A;  3I69 A;  2O8V B;  4ZB7 A;  5ENU A;  2JSZ A;  2HSN B;  3IRA A;  1SYX A;  2F9S A;  2PWJ A;  3E0U A;  1AQW A;  2LRN A;  3PH9 A;  1M2B A;  1M0U A;  2KLX A;  1WJK A;  5AN1 A;  2CAQ A;  3UOM A;  1FOH A;  4KX4 A;  1W89 A;  4NV2 A;  5ECM B;  1SEN A;  1NHY A;  3G7Y A;  1KTE A;  3TRP A;  4K5R A;  4GCI A;  2HSM B;  3ZMK A;  3HXS A;  4EIP A;  4RI7 A;  3TKS A;  4QQ7 A;  4AKI A;  2A4V A;  3GA4 A;  4MH2 A;  3QOU A;  3EWL A;  2LKU A;  1ML6 A;  2NDO A;  4EO3 A;  1XOA A;  2DLX A;  3CXG A;  1WRY A;  2I9H A;  4CW9 A;  5J41 A;  5IPG A;  2F8A A;  4IP6 A;  2H0H A;  3A2V A;  1G6W A;  4IEL A;  3TKS C;  4XIH A;  5G30 A;  4MZC A;  4V2M A;  3FY7 A;  1SVO A;  1R4W A;  1GSE A;  3LG6 A;  5D9X A;  1R7H A;  3D4T A;  4ZL8 A;  2LV3 A;  2WCI A;  4FO5 A;  2RLI A;  1FVK A;  1GH2 A;  3N9J A;  3DVX A;  1PL2 A;  3ISO A;  4G0I A;  1MDK A;  2EC4 A;  3WT1 A;  2YWN A;  2LNS A;  4KE3 A;  1GUK A;  3KH9 A;  1T3B A;  3ZIV A;  4IS0 A;  3WYW A;  1YQ1 A;  4XRD A;  1HNB A;  5DAK A;  2VL3 A;  4KA0 A;  3HMJ G;  2PMT A;  2M80 A;  4XTS A;  4XCS A;  1EV9 A;  1EZK A;  2LQQ A;  2HQT A;  1MD4 A;  5CNW A;  3OR5 A;  3DIE A;  4IHU A;  1V40 A;  1VRS D;  2VCQ A;  3GV1 A;  2VL9 A;  1O8W A;  2GVP A;  3E9J B;  4NAX A;  4BVY B;  2PUK C;  1LJR A;  1V58 A;  4EDZ A;  1X5D A;  1XIY A;  2HXK A;  5EPF A;  3CTF A;  2PN8 A;  3C1R A;  5DBQ A;  2LTK A;  1XWK A;  3HJM A;  3H79 A;  3UAR A;  1V9W A;  1E6B A;  1G6Y A;  1AW9 A;  1B9X C;  3V1W A;  2X8H A;  3I43 A;  1H4O A;  4K7I A;  5CRH A;  5AIV A;  1QFN A;  4WET A;  4ZL7 A;  1PMT A;  1I5G A;  4KUN A;  1TXX A;  16GS A;  1XFL A;  3LXT A;  2IFQ B;  4I2U A;  3N5O A;  2GSR A;  5BRT A;  4GWR A;  3CBU A;  4TR1 B;  1THO A;  1O7U A;  1A24 A;  4JR6 A;  3GH6 A;  4ZXG A;  5BMU B;  4KH7 A;  4OFT A;  2H1B A;  3UBK A;  1YKA A;  3QPM A;  5D93 A;  1SVL A;  3J7Y k;  3UIW A;  1G7O A;  2AJQ B;  2MMN A;  3GNJ A;  2A2P A;  2H1A A;  1CQG A;  3ZLP A;  1T4Z A;  5CRG A;  4GSN A;  2HZE A;  3QCP A;  5L71 A;  4I5Q A;  3TJF A;  2FWF A;  2K9F A;  1M2A A;  2R2J A;  1ZGN A;  1HYU A;  1BAY A;  2AAW A;  2L5O A;  2OE3 A;  5CP1 A;  1XWB A;  3LYP A;  3TOU A;  4XHM A;  2OAD A;  4X1U A;  1TK5 B;  4V2N A;  2B7K A;  1EOH A;  2A2R A;  3ME8 A;  5HFI A;  4BA7 A;  2WGR A;  4WF4 A;  1U3I A;  2GGT A;  4CY8 A;  3VWX A;  1GTI A;  5J4U A;  1T8E B;  1GUL A;  2K8V A;  2OT3 A;  1GSY A;  3HD5 A;  4Z2T A;  4MH3 A;  3G7J A;  2DJ3 A;  3MIX A;  3WGD A;  6GSW A;  1BG1 A;  2FLS A;  4X43 A;  5IMV A;  4G19 A;  2LJA A;  2KUC A;  3UBL A;  1M2D A;  3DVW A;  4N11 A;  3ED3 A;  1K3Y A;  1S3A A;  2TRC P;  3CTG A;  1F37 A;  1GSF A;  1YDK A;  2RII A;  1SD8 A;  3FKF A;  4Q5N A;  2CZ3 A;  4OO5 A;  4HI7 A;  4OFN A;  4DSS B;  3EC3 A;  5H5R A;  3TB2 A;  4V1A g;  2VKZ G;  13GS A;  2E2M A;  1BYE A;  4Q5Q A;  2OBI A;  4GQC A;  3L4N A;  1GL8 A;  2HSN A;  2EFD A;  1NW2 A;  2UZ8 A;  2M46 A;  2C80 A;  2XPD A;  4WR5 A;  2DJK A;  4HQZ A;  4D73 B;  2PGT A;  3W6G A;  3F4T A;  4IGJ A;  1TJD A;  4NHW A;  4K7O A;  1DE2 A;  4N30 A;  2LS5 A;  4AGS A;  2HRK B;  4IKH A;  2GSS A;  4JU5 A;  4LL4 B;  3EU3 A;  1ERV A;  4NHZ A;  4TR3 A;  2LEG A;  1R5P A;  4KCA A;  3IOS A;  2HSH A;  2HNL A;  3TKQ A;  3VFI A;  2RM6 A;  4ZBA A;  2B5Y A;  5DCH A;  6GST A;  2L4C A;  4K5S A;  3TUE A;  2G2Q A;  4ZB8 A;  3NZN A;  3BJ5 A;  1XVQ A;  2C1Y A;  5DVB A;  4KDU A;  4AF2 A;  4EKZ A;  1JZO A;  2QKE A;  1JLW A;  1O81 A;  3CWG A;  4L8E A;  1HNC A;  1SJI A;  2GQL A;  1XWC A;  1O85 A;  3GKN A;  5E59 A;  1GRX A;  3KCM A;  4GDF A;  1BQ7 A;  1OE8 A;  1TP9 A;  2QA1 A;  3ZVJ A;  5IMZ A;  3VI5 A;  2FWG A;  1DBY A;  3P90 A;  3C7M A;  2MMZ A;  1W4V A;  4PTS A;  5G2Z A;  1THX A;  5FHI A;  1YKC A;  3A2W A;  3GMF A;  2VCZ A;  1ACV A;  3IC4 A;  2NTO A;  1ZYE A;  2X8G A;  2VAF A;  3GTU B;  4TN8 A;  3PGT A;  5ECL B;  4EL1 A;  1YZX A;  1U3A A;  4BL7 B;  1TRW A;  4RQR A;  1C72 A;  4IBP A;  2R5G A;  5A1N B;  1GTU A;  4IQA A;  2X4A A;  3Q74 A;  4XS6 A;  3C1S A;  3L9U A;  3VWU A;  3VWW A;  3QDN A;  3EPT A;  1PX6 A;  3F6F A;  5D8I A;  3KJY A;  2B6M A;  2CVB A;  2C8U A;  3EU4 A;  4WKW A;  1ZMA A;  2AHE A;  1YEX A;  2IME A;  2H1L A;  3P7X A;  2VM1 A;  1TXU A;  3F3Q A;  5DAL B;  1PD2 1;  12GS A;  1XWG A;  2PPT A;  1S3C A;  1SJ6 A;  3A3T A;  4EDY A;  1BJX A;  3ZTL A;  2H6Y A;  2KHP A;  5D73 A;  1K0O A;  1B9Y C;  4NPB A;  5IMA A;  4I8B A;  1WWJ A;  4WR4 A;  2IFQ A;  4ULX A;  5JWO B;  5CRW A;  4F0B A;  1EP8 A;  3WGE A;  1OC9 B;  4KSM A;  3IAM 2;  3GL5 A;  3HHV A;  4MAB A;  1XBS A;  5BMU A;  1RW1 A;  4NMU A;  4OFM A;  2H66 A;  2WJU A;  4HOJ A;  5KEJ A;  3Q19 A;  2D2Z A;  2E0Q A;  3WT2 A;  2K18 A;  5JCG A;  2HRN A;  3QD9 A;  5KN0 A;  3U6V A;  2L4Q A;  3GFK A;  1UA5 A;  3NIV A;  2CA8 A;  6GSS A;  2DJ0 A;  4AJ7 A;  5JCU A;  2CT6 A;  2DJ1 A;  3RHC A;  1TKD B;  2H0I A;  1GWC A;  2O87 A;  2VLV A;  1XCC A;  5FWG A;  2ES7 A;  1YF1 A;  5ELG A;  5IO2 A;  3HJO A;  5LCZ A;  1M9A A;  3IR4 A;  2A4H A;  2H74 A;  4Q5F A;  4G01 A;  4MZW A;  4MDC A;  4AJ8 A;  5G5E A;  3TJJ A;  3A5W A;  5CAX A;  5IO0 A;  2RUF A;  3VUR A;  1E2Y A;  1K0N A;  3ERF A;  3H4K A;  2I81 A;  1Y6E A;  1KEB A;  4Z2R A;  4KB3 A;  1FVJ A;  1OVN A;  3GRX A;  3HDC A;  6GSX A;  2LQO A;  4ECJ A;  4TXO A;  2JZS A;  1M9B A;  1JZR A;  2GTU A;  5A5K A;  4I6X A;  3GST A;  3L0H A;  4YAP A;  4TXV A;  1J9B A;  3DWV A;  2H75 A;  4EF0 A;  1WOU A;  1Y25 A;  1K0C A;  4ECB A;  1OYJ A;  4HU9 A;  4FH8 A;  2FWH A;  5ECO B;  3LYK A;  3A5I A;  3IK7 A;  1ON4 A;  1T1V A;  1AXD A;  4IVF A;  3CMI A;  3IXR A;  3K8N A;  2FD3 A;  2E2G A;  11GS A;  5HR3 A;  4EVM A;  3O3T A;  2X8C A;  3LJR A;  2IN3 A;  4Z2U A;  1DE1 A;  2L6D A;  4WBJ A;  5IMC A;  4J56 E;  2OE1 A;  4HUA A;  2VCX A;  4K6X A;  5IPH A;  3KM6 A;  3HVX A;  5G31 A;  2MMA A;  2AB6 A;  3F3R A;  1PRX A;  5G1L A;  2VOC A;  2WRT A;  3ZYW A;  1JFU A;  3D22 A;  3G9B A;  2HRK A;  1ZYN A;  3QR6 A;  2I4A A;  3HVV A;  2YN1 A;  4L5O A;  3IHQ A;  1A0R P;  5ID2 B;  4OWY A;  3GL3 A;  3C71 A;  4GQF A;  1AIU A;  2H73 A;  3RHB A;  4ZBD A;  3D0Z A;  2CV4 A;  3TKS E;  2PVQ A;  2O5V A;  2YPM A;  3UVH A;  2PU9 C;  2VM2 A;  1ZCP A;  4OO4 A;  2VO4 A;  5ECQ B;  5ECH B;  2B1K A;  6GSV A;  1BG5 A;  3KZQ A;  1SU9 A;  2DJJ A;  3KEB A;  1SKW B;  3GKM A;  1VF4 A;  4LLR A;  2P5R A;  5ECI B;  5DDL A;  1TU7 A;  1T4Y A;  2O89 A;  5A34 A;  3APS A;  2R4V A;  3H93 A;  3IAS 2;  1U88 A;  2JAD A;  1TOF A;  4WXT A;  4BWQ A;  1SK2 A;  2WUL A;  5HFK A;  4ILF A;  3KXO A;  1A2L A;  2UV8 G;  2FGX A;  3CRU A;  2YNX A;  2DC5 A;  1XWA A;  2TIR A;  4POM A;  1A2J A;  1BF5 A;  1OC3 A;  2WZ9 A;  2YWI A;  4L0U A;  2IMD A;  3GYK A;  4E8H A;  3M9J A;  3GTU A;  1SL1 B;  2PER A;  2OBK A;  1QXH A;  3IPZ A;  2FUG 2;  4YQV A;  4PQH A;  2FY6 A;  2IL3 A;  1IYI A;  3MYD A;  3GSS A;  4G0L A;  3L9S A;  3MNG A;  1QMV A;  1GSS A;  3TJK A;  3ZRE A;  2IJY A;  4KDX A;  5CRD A;  1OAZ A;  1VF3 A;  5CYY A;  4X0X A;  2GST A;  3J7Y b;  4KW6 A;  1FO5 A;  1GNE A;  1B4P A;  4L0W A;  4JE1 A;  4GRF A;  3FK8 A;  3L78 A;  3IC8 A;  2P0G A;  1PKW A;  3LW9 A;  1XXU A;  3LWA A;  1ERT A;  1EGO A;  1QQ2 A;  5DAL A;  1XVW A;  2MBT A;  4FQU A;  2LRC A;  2N5F A;  2XHF A;  1SL0 B;  1T7P B;  2NVL A;  3F63 A;  1HNA A;  1NM3 A;  4K0N A;  4HJ2 A;  4PNF A;  2DSA A;  4G9H A;  1UVZ A;  2TRX A;  5D9W A;  2XPE A;  1TK0 B;  2LUS A;  3FEU A;  5IOX A;  3NOF A;  4AI6 A;  10GS A;  2X49 A;  5A5H B;  14GS A;  1WIK A;  3EIN A;  5D9V A;  2IWT A;  3L9V A;  5IMF A;  4OCF A;  4YQM A;  4DEJ A;  5IMD A;  1TK8 B;  3P2A A;  4O92 A;  5G1K A;  5G5F A;  2C3T A;  2V2G A;  5ECN B;  2EIQ A;  4RQX A;  1SKR B;  1K0B A;  3HZ4 A;  2HZF A;  3F9U A;  2EIO A;  1BED A;  3APO A;  1S3D A;  2M72 A;  1RQM A;  4POK A;  3KH7 A;  4XS4 A;  1F3A A;  2OJL A;  1FW1 A;  2OE0 A;  4O5U A;  4PX1 A;  1B8X A;  5DCG A;  5J47 A;  1K0D A;  3DGQ A;  3IK9 A;  1YVL A;  3ZML A;  4BVX B;  1SK0 A;  2RUE A;  4MNN A;  4N0Z A;  1MD3 A;  4ICY A;  5H5S A;  3TU3 B;  4CHS A;  3FR6 A;  5F06 A;  4IQ1 A;  2VL2 A;  3RPP A;  1DSB A;  2L6C A;  2H70 A;  1F9M A;  3UL3 A;  3IV4 A;  4MJE A;  2HSM A;  2KP2 A;  3ZZX A;  2F3M A;  4MF6 A;  5J40 A;  1SVM A;  3IDV A;  4LA1 A;  2GZY A;  4HZ2 A;  3GUS A;  1SYR A;  4MPF A;  4N3Z A;  1OKD A;  3MSZ A;  4MA9 A;  2ON7 A;  1VGL A;  3QAW A;  2VL2 C;  1TI1 A;  3TRQ A;  3QFA C;  1GLP A;  4HU7 A;  1ILO A;  1XOB A;  4NWY A;  2C3N A;  1JZD A;  4N10 A;  2VLU A;  2R6K A;  2V41 A;  1OC8 A;  4GLT A;  3D6I A;  5GZZ B;  4K2D A;  1I9D A;  1EEJ A;  2LJR A;  2B5E A;  3HY2 A;  1ZYQ B;  2B3S A;  2XBI A;  9GSS A;  3TCO A;  3TGZ A;  2HSY A;  3AY8 A;  4IP1 A;  1NSW A;  5ECP B;  2X99 A;  2Z9S A;  5J4Y A;  3M0F A;  2H0G A;  4GSS A;  3EYT A;  4POB A;  4OMV A;  3KIJ A;  3VK9 A;  1QGV A;  4IJI A;  3TDG A;  4K7N A;  2EFC A;  6GSY A;  4EIQ A;  1A8L A;  2P31 A;  2VCT A;  5DJL A;  1ZZY A;  5AGY A;  2GQK A;  3HKR A;  5HFG A;  2H1G A;  2RM5 A;  2HE3 A;  4J2F A;  3W8J A;  2IMI A;  3A2X A;  5GAN D;  2L5L A;  4HZ4 A;  1FB6 A;  5CO3 A;  4RUV A;  3SWL A;  2QSI A;  5ID2 A;  4H86 A;  4A5P A;  4JBB A;  2LST A;  1OKT A;  1Z6N A;  3UAP A;  5B6N A;  3P8W A;  2WFC A;  20GS A;  2FA8 A;  2H71 A;  1X9W B;  5J9B A;  5F05 A;  4MCU A;  4BVY A;  5J5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...