1B8XA

Glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
260
structure length
260
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSRRASVGSRMHYPGAFTYSPTPVTSGIGIGMSAMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal protein
molecule keywords PROTEIN (AML-1B)
publication title Preliminary crystallographic study of glutathione S-transferase fused with the nuclear matrix targeting signal of the transcription factor AML-1/CBF-alpha2.
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 260
sequence length 260
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1b8xA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b8xA01
4.10.770.10 Few Secondary Structures Irregular Signal Protein Aml-1b; Chain A, domain 3 Signal Protein Aml-1b; Chain A, domain 3 1b8xA03
2IL3A 1UN2A 4IP1A 4HJMA 3QPMA 1R7HA 3D5JA 2X8CA 2H70A 1M2DA 1TW9A 3VI5A 5IMZA 4O5RA 2I3YA 2H0IA 2NTOA 2VIMA 4HJ2A 3FYGA 4ML1A 4RUVA 5IPHA 3HDCA 3P8WA 2F8FA 4IW9A 2F8AA 3H1NA 2VAFA 3I69A 5LD0A 4G0IA 2FA4A 4KDYA 2XBQA 3IK9A 1K0MA 3GH6A 3TB2A 5F07A 4IKHA 3UARA 2OKAA 4WEYA 4GF0A 3F6FA 2H0GA 1XWAA 5JCUA 2LNSA 2HYXA 4GTUA 1KNGA 4ZBBA 2GSSA 2X64A 3KM6A 1TTZA 4PNGA 3FKFA 2M46A 4ID0A 4EUYA 13GSA 4ECBA 3TKSA 3KH9A 2HRKB 3FY7A 3N5OA 1JFUA 2GQMA 3C1RA 1VF1A 1A0FA 4IGJA 4I2TA 3UJ1A 5B6NA 1TRUA 4O7HA 4TXVA 3VURA 1ACVA 1K3LA 1FAAA 3TJGA 2RUEA 3EE2A 1YZXA 2IMKA 1GUMA 2C8UA 3U5RE 3IOSA 5AISA 2HSYA 1RQMA 5A4VA 2C1YA 3QD9A 4V1Ag 2CAQA 1Z6MA 1O8WA 1GSUA 3F3RA 2WGRA 4KA0A 2HRKA 5CNWA 1X9WB 4GQCA 1BX9A 3Q19A 5D93A 2RLIA 5ABRA 3LG6A 1U3AA 1G7EA 4NAXA 1QMVA 3QAGA 3GL5A 2VCWA 1IYHA 2FWHA 1MDIA 1T4YA 2RUFA 1U88A 3HCZA 4Q5QA 5KEJA 3Q18A 1B9YC 1GH2A 1SL0B 3IHQA 2J9HA 2R5GA 1M7TA 3KP8A 1X9SB 1OE8A 3TKSE 2IPAA 3R3EA 3FZAA 2DLXA 1SD9A 1Z3EA 3TRQA 2EC4A 1A8YA 4RQRA 4IELA 4MA9A 1PX7A 5GZZB 1TRWA 2YWMA 3LGCA 4XS6A 4Z7XA 1VGLA 1JZWA 1Z9HA 4KDXA 4I97A 4ECCA 2DJJA 1GUKA 4CHSA 2CVKA 7GSSA 1SYRA 1GSYA 2KP1A 2MZCA 5ELAA 5JWRB 3GKKA 2C3QA 1GLPA 5EY6A 4JE1A 3M9KA 3LJRA 2FWGA 1VF3A 4J56E 5JWQB 3SBCA 2B5XA 5AIVA 4OD7A 2L5OA 1SD8A 2KLXA 1BJXA 3IK7A 3BD2A 1XFLA 4Q5NA 3LWAA 1A0RP 2HSNB 2HI7A 3UVHA 1OC3A 5G5EA 1X0RA 1F3AA 3FR9A 2C0DA 5DAKB 1X9MB 2K6VA 3P90A 4JRRA 3QAWA 1SYXA 1VRSD 2GDRA 4KH7A 2YCDA 6GSYA 2VD0A 5CAXA 4KB3A 4FIWA 3TJKA 2PERA 3GUSA 4WBRD 4HZ4A 1Z6NA 4K7NA 1GNWA 4KSMA 4JR4A 1GTBA 2DMMA 3R2QA 3A3TA 1XVQA 3A2WA 4WF5A 5DAKA 2FGXA 2RM6A 4BWSA 2HXKA 2FY6A 1Z5YE 1N2AA 3TJJA 4K9ZA 3FZ9A 4IQ1A 4ECIA 5IMCA 4ZL8A 2VCVA 2H6YA 3W6GA 4JZQA 1DE2A 1EEJA 4ILFA 2QKEA 1A8LA 2L5LA 1M9BA 3C1SA 1MDKA 2YNXA 4ULXA 3M0FA 3DYRA 1HNAA 1TI3A 2GSTA 1AUCA 4ZIJA 4TR4A 3TCOA 3ZTLA 1O73A 5DCGA 5COHA 2XC2A 3DWVA 3KEBA 5CO3A 3GRXA 1BEDA 5G1LA 4DSRA 3PR8A 3HJPA 2VL2A 4ZXGA 1GSSA 5EL8A 1FHEA 5D96A 4WF4A 1UC7A 3GHAA 3F4TA 2N5AA 5HR0A 1XWKA 4N11A 4IQAA 9GSSA 2C0GA 1SU9A 2K18A 1V2AA 3D0ZA 1HD2A 3GX8A 1K0CA 1ML6A 3KGKA 1TK0B 3FHKA 3DVWA 4MCUA 2IMFA 1MD4A 2VCTA 1TP9A 4MZCA 1GTIA 4IJ3A 3IA1A 1PSQA 1G0TA 5KN1A 2GTUA 2JZRA 4ISDA 1YQ1A 5JCGA 2VLVA 1J08A 5ECIB 1K0OA 2VL9A 4WETA 3RDWA 2I81A 5DJMA 5BMUA 2QSIA 3EWLA 4RI6A 5DBQA 3ERWA 1A2JA 1BQ7A 6GSTA 1CQGA 4PTSA 3TOTA 3DXBA 2OBKA 5H5SA 3MWHA 2LUSA 4PQ1A 1WRYA 4NHZA 4FQUA 2DIYA 1GSFA 2GSQA 4MJCA 3UAPA 1T7PB 4E8EA 4N30A 1XWGA 1A23A 4NV5A 1WWJA 2IMIA 5J41A 4TN8A 1A2LA 3GKNA 3KH7A 3ZYWA 4KGIA 3QR6A 2VUPA 2AAWA 4YH2A 3APSA 2K8VA 3PPUA 1OC9B 3L9VA 1YF0A 4HDEA 1T4ZA 2O87A 1XWBA 4EDYA 3HD5A 3ZMKA 2VL3A 1ILOA 1PKWA 4BA7A 2B5EA 1UA5A 3APOA 5C04A 3DKSA 5HFKA 2ZNMA 1NSWA 3E9JB 4TOPA 3CSJA 1PD21 3ERFA 4GLTA 2JSZA 2C0FA 4MPFA 3E3EA 2TIRA 4POLA 3LXZA 2L4QA 3FK8A 4YAVA 1GP1A 5IPGA 2YZUA 1OC9A 2L6DA 1B8XA 4ZBDA 3C7MA 4CDOA 4PUAA 2QGVA 4QQ7A 4POMA 3M1GA 1S3DA 1MTCA 1GUHA 4PQIA 4I5QA 5CRWA 1GULA 3V1WA 5IQYA 2DBCA 5ECQB 6GSSA 2OACA 1ERUA 2B3SA 1K0AA 3TKPA 5CRDA 5HQPA 2YPMA 1M0UA 4L5OA 4FYBA 2IFQB 5IMDA 3TKQA 3LSZA 2F51A 3ISOA 1O7UA 4NV2A 3UL3A 2YWIA 2O89A 2H1DA 2XHFA 4JEDA 1R5AA 5IO0A 1RK4A 2WRTA 3DIEA 2ES7A 1EP8A 1GWCA 5IOWA 1X5CA 4KE3A 1WJKA 2H74A 4EVMA 5CREA 1S3CA 3KP9A 2IFQA 4KCEA 3WGXA 4I2UA 1S3AA 2A2RA 3HA9A 19GSA 3QFBC 4DSQA 3DGQA 1AW9A 4AJ7A 1V58A 4ZL9A 3G9BA 3P2AA 3HJMA 1GLQA 1WMJA 4HOJA 4LA1A 5A4UA 4OWYA 3HVSA 2R6KA 4JR6A 5H5RA 2GGTA 1ZGNA 2JSYA 2KOKA 3BCIA 2HE3A 2GSRA 5ECKB 1F6MC 4Q5FA 1JZRA 2P0GA 2E2MA 4IVFA 1G7OA 4OFTA 2WULA 2O8VB 1URMA 1LU4A 2WFCA 3DMLA 5HR3A 1PL1A 3M9JA 2DJ2A 4NMUA 4YQVA 1XIYA 3WGEA 2HT9A 2JZTA 2LKUA 5IOXA 3F6DA 4TW5A 4MH3A 4HU9A 2UZ8A 1HQOA 4F2IA 1YEPA 3UOMA 1SJIA 1F9MA 1PL2A 1SKRB 4PUFC 4DVCA 3US3A 3RAZA 4KX4A 1F3BA 3VWUA 2CVDA 2HRNA 5G30A 1AQWA 4MF7A 2OE1A 1YEXA 2H75A 2H71A 3BBYA 2DJ1A 3TJFA 2OJLA 3H93A 4DSSB 1KTEA 1TK8B 2MMNA 2P5QA 3EINA 1SKWB 3C73A 4TR1B 2PVQA 3LORA 1F2EA 2H01A 3HY2A 4JBBA 4N10A 2O85A 4KSOA 2LQQA 2I1UA 4ACSA 1GNEA 1PA3A 1PKZA 4BVYB 3WT1A 3GURA 4J2FA 3GH9A 5DALB 3DD3A 5J5NA 3GKMA 1H75A 1U87A 3DEXA 4DSSA 3IC4A 2H19A 3UBLA 3GV1A 4AJ8A 2M72A 3RPNA 2AHEA 4F0CA 2PMTA 4TR1A 1XPVA 1MEKA 1VF2A 2CAIA 1WE0A 11GSA 1KEBA 4MP4A 4PGTA 4BVYA 4P3YB 2PWJA 3GIXA 3WYWA 4HUAA 3QAVA 1T1VA 2H6ZA 3PH9A 1BG5A 2WB9A 5DJLA 4ZB9A 4PURA 2LS5A 1Q98A 4ECJA 3NIVA 4AGSA 2GZYA 3GX0A 2FWFA 5KN3A 4Q5RA 3KIJA 4D73B 3BCKA 2E7PA 1AXDA 3C8EA 3L4NA 4XS4B 3UIWA 3ZITA 2EIRA 1QGVA 2V41A 4K6XA 2R2JA 1DUGA 3CRTA 1AQXA 1AIUA 3ED3A 5JCWA 3S9FA 4MABA 4OFMA 4MPGA 5J3RA 5HR2A 1TI1A 3HZ8A 1WPIA 5IMAA 4HS1A 2NPBA 1O85A 3QOUA 4WXTA 4GSSA 1NW2A 2IIYA 2LRCA 1ERWA 2DSAA 2OBIA 4XRDA 1EZKA 4OMVA 4D73A 4EO3A 5F05A 2HSMB 3FR3A 3H4KA 4QL7A 3GA4A 1R5PA 3HZ4A 1GSEA 5GSTA 2MBSA 2Z9SA 4FO5A 2ZUPA 2FCHA 4K2DA 4K8MA 5ENUA 1PX6A 3GFKA 3QCPA 2B1KA 2TRXA 3PINA 1YY7A 4NXIA 5INYA 17GSA 4EC0A 5AGYA 4O32A 1TDIA 2VOCA 4K0NA 2B7JA 2HRAA 5IMVA 3EU3A 2FD3A 5IIZA 2HSMA 1K0BA 1WP0A 3PGTA 5HFIA 1XW5A 4GSNA 4TVEA 1JZOA 4OCFA 1H4OA 2GT5A 5ECHB 1I9DA 2MYGA 4I6XA 2NBSA 4NWYA 3QMXA 5LCZA 1ST9A 2H8LA 1BYEA 2AUVA 2N5FA 4IHUA 3EMPA 5D9TA 1LJRA 1X5DA 3MSZA 5C00A 5KN0A 1OE7A 2G2QA 3VWWA 2H66A 3ME8A 2DJKA 4LMWA 2YP6A 1XWCA 4YAPA 2V1MA 1HNCA 4EKZA 3J7Yk 2I4AA 2CT6A 4IP6A 1V9WA 2HNLA 1O6JA 2VCQA 4KDUA 1IYIA 4ZB8A 3HKRA 5AN1A 3I6AA 2IMDA 1AQVA 4GQFA 3TGZA 2RIIA 3UMAA 4KUNA 1E6BA 3IBHA 3VLNA 1SK1A 2VM1A 3MAKA 1ZYEA 1XOBA 2LRNA 4HQZA 5GSSA 3ZVJD 2WJUA 1AAZA 1OKTA 3TRXA 2H1GA 4F03A 1O81A 4ML6A 2FWEA 2X8GA 1PQNA 4TR0A 5ECNB 1JZDA 2RM5A 3NZNA 2B6MA 3G7JA 1SJ6A 20GSA 3C71A 3HXSA 4OO4A 3KXOA 3KMNA 4J57E 1ERTA 1Y25A 4OO5A 4X1UA 3CTFA 2N5BA 2LJRA 2YWOA 5D73A 4LLRA 2YV7A 1F37A 3IAM2 3D21A 3F8UA 3IXRA 4IJIA 2MBTA 1NM3A 3ZIVA 1OAZA 1ZZYA 3O76A 1SJZA 3GNJA 3TKSC 1PN9A 3KMOA 4DEJA 3FEUA 2B1LA 3D4MA 4MZWA 4BWQA 3F9UA 2PU9C 1XCCA 2VCXA 3HVXA 2OA7A 4K7OA 2X8HA 3IPZA 1W4VA 5D9XA 4GCIA 1EEMA 2DIZA 4GRFA 5J9BA 3RHCA 2HLSA 3FZ4A 2CX3A 1TJDA 2KP2A 4NPBA 2BTOT 2A4VA 3G7YA 1ZCPA 3A5WA 3TKRA 2XPDA 1Y6EA 4BL7B 2H1BA 2LTKA 2PBJA 1X5EA 3EU4A 2MMAA 1TK5B 4EXJA 2PVOC 2BMXA 1G6YA 2YJHA 3LYKA 3AY8A 4LL4B 1XZOA 1ZOFA 1SL1B 2J23A 3HJOA 4TXOB 1GTUA 2C3TA 1TRSA 4XHMA 4RI7A 2KHPA 2WS2A 3NOFA 3LQ7A 1YKCA 4MZBA 2PUKC 2PPTA 2IMEA 2GLRA 4K0GA 1N8JA 2TRCP 3D22A 4EF0A 4BL7A 16GSA 1OKDA 3CRUA 4MLYA 1V57A 2JADA 2H73A 2L4CA 4GSTA 4MDCA 3LFLA 4WR5A 2CV4A 1RW1A 4KF9A 4TXOA 3IRAA 4BPYA 2B7KA 5D9WA 5G31A 1JHBA 3VPQA 4V2NA 5FWGA 1XOAA 3ZLPA 2YJ7A 2FUG2 2PN8A 1M9AA 2VO4A 4WBJA 3EVIA 1ZMAA 1XW6A 4MJAA 4F0BA 2I9HA 1GSQA 8GSSA 3WGDA 4IN0A 3KTBA 2H6XA 4POKA 5FT3A 2ON5A 2D2ZA 1ERVA 1NHYA 1QK8A 2NVLA 3BOAA 2HSHA 2L6CA 2AV4A 1R26A 3KCMA 1SENA 2HZFA 4FYCA 1T8EB 4KW6A 2GQLA 2DC5A 5F06A 2LQOA 1J0FA 4YQMA 3ZFLA 3ZL5A 1WOUA 4F9ZA 2GS3A 3IAS2 1EOHA 3Q6OA 1OC8A 1GSDA 5ECMB 3LXTA 4N0ZA 1UVZA 2OE3A 2E0QA 2C4JA 2LRTA 3VWXA 1YJ6A 3RPPA 2OADA 1DSBA 3CXGA 3E0UA 3VWVA 3KJYA 3JCML 4GXZA 2V6KA 2YANA 1M2BA 3H79A 5DVBA 3O6TA 2C0EA 3FRCA 4JU5A 2L57A 1M99A 4V1Ap 4PX1A 4BVXB 1J9BA 2JL4A 2WCIA 3D6IA 2F3MA 2OE0A 4TKYA 4IS0A 4X0XA 2P31A 5IM9A 1XBSA 3APQA 3IC8A 2K8SA 4WR4A 1M2AA 5E59A 4MJEA 2LSTA 4XCSA 3RBTA 2H72A 3I43A 2VL2C 5F0GA 3EMXA 2QC7A 3HYPA 2V6OA 2F9SA 1W89A 1DE1A 1OVNA 3UBKA 1K0DA 2FA8A 4TR3A 3L78A 2FHEA 4BVXA 2YWNA 3CSHA 1FO5A 4L5LA 2VM2A 3KZQA 2HRFA 4H86A 5D8IA 4FH8A 1TU7A 2PGTA 2GQKA 5A5KA 3KTLA 12GSA 2YN1A 4L8EA 4MMMA 3J7Yb 2E2GA 2H30A 2LJAA 2FLSA 1FOVA 3N9JA 1THXA 4FYUA 3DRNA 4RQXA 5F8BA 4LL1B 3IDVA 3G7IA 1C72A 3TOUA 3GN3A 3L9SA 2WDUA 1EV4A 5DALA 2G0FA 5DQSA 6GSVA 2XBIA 5B6MA 2HQTA 3IR4A 3CBUA 5G2ZA 1TU8A 1I5GA 1BAYA 4G10A 4HQSA 1PMTA 1U3IA 4HI7A 2WZ9A 3CMIA 2VCZA 3EYTA 1B4QA 5CP1A 1OYJA 3GSSA 2MMOA 4AJ6A 4OFNA 4ZBAA 2H76A 3LEFA 3QDNA 5CRHA 3WD6A 3EURA 5ECRB 3U6VA 2AB6A 3WT2A 2MMZA 22GSA 3ZIJA 5JWOB 4L0WA 3FR6A 1SK0A 3OR5A 1TKDB 2YV9A 1FB6A 1B48A 2C80A 3TRPA 5IMFA 1FW1A 4XS4A 4XS1A 2CZ3A 3UVTA 4MJBA 4G19A 3GMFA 5B8AA 3HHVA 3K8NA 1XXUA 5D9VA 2L59A 3MDKA 2AYTA 2IWTA 4GWRA 1TOFA 1O8XA 4EE0A 4AF2A 3D4TA 5CRGA 3HVVA 2VD1A 4PQHA 2A2SA 1K3YA 4KNDA 3TUEA 2JACA 1B4PA 5GAND 1YDKA 2JU5A 1JLWA 1EGOA 3P7XA 4ZILA 1PGTA 3QFAC 1HYUA 3W8JA 10GSA 4V2LA 3MNGA 2O7KA 3ERGA 2GZZA 4MF6A 1QUWA 3CSIA 2R3XA 2REMA 3UEMA 3A2XA 1V40A 4EDZA 1E2YA 5ELGA 5HFGA 1DBYA 3A2VA 3M8NA 4PXOA 4XTSA 3F63A 2CVBA 1A2MA 3RHBA 1ABAA 2H1AA 2DJ0A 3I9V2 1CQHA 1B9XC 1U6TA 5L71A 2CQ9A 2YOIA 2FNOA 4O92A 3F0IA 5H5QA 1QXHA 3Q74A 1QQ2A 2B5YA 3FZ5A 5A4WA 1HNBA 3KD0A 1EGRA 5KN2A 3ZVJA 1T00A 1ON4A 6GSXA 1MD3A 1THOA 1PRXA 2GT6A 5FHIA 4G0KA 1FG4A 3F4RA 4F82A 2GVPA 3LYPA 5DDLA 1GRXA 4V2MA 1EV9A 4YQUA 4HEA2 3DVXA 1V98A 2AJQB 2XPEA 2EIQA 5EPFA 2ZCTA 2V2GA 4MH2A 3GSTA 2P5RA 4LMVA 4L0UA 3M3MA 5ECLB 5GAPD 1EOGA 3GTUB 4OCEA 3ZMLA 4ZL7A 2NDOA 2EIOA 4XIHA 2CA8A 4K1FA 3IV4A 3ZRDA 5E4WA 5HR1A 4G0LA 1FVKA 1AC1A 3L0HA 1T3BA 4PNFA 1MDJA 1Q4JA 3ZZXA 5G5FA 5IO2A 18GSA 3F3QA 1FVJA 1Z7PA 4XRAA 3O3TA 3ME7A 4CW9A 5B8BA 2CX4A 4G9HA 4HZ2A 2C3NA 4NHWA 3VPTA 5ECPB 3GTUA 5DCHA 4MK3A 1YF1A 4KCAA 1EWXA 4QL9A 3EC3A 6GSWA 3VFIA 1KBNA 1LBKA 3CYNA 1WIKA 1JLVA 4USSA 5LNKe 1SK2A 2H0HA 2DJ3A 1YKAA 1USBA 3IE3A 1NHOA 1SKSB 4G2EA 2X99A 1A24A 2ALBA 2LEGA 2YZHA 5J4UA 1XW9A 5B7CA 2LV3A 4E8HA 3TJBA 2LJKA 1K3OA 4MF5A 5G1KA 2IJYA 5J9CA 4I8BA 1QFNA 4N0VA 3H8QA 2JZSA 2HZEB 3TDGA 3ZREA 3ZFBA 5ID2B 2VLUA 1GL8A 4POBA 3GKXA 4IBPA 4HU7A 1XVWA 2R4VA 1G6WA 2VLTA 14GSA 5AIXA 3L9UA 3VK9A 3W8SA 3BJ5A 5EVOA 1TRVA 4WKWA 6GSUA 2LNTA 5CYYA 1TXXA 1VF4A 3GL3A 1ZYQB 1EP7A 1SL2B 2V32A 2M80A 5DQYA 4X43A 2IN3A 5ECOB 4ZB6A 1ZL9A 3SWLA 1K0NA 4TRXA 2CZ2A 2R37A 2BJXA 3F4SA 2K9FA 2HFDA 2HZEA 4K7IA 1Z7RA 5ID2A 2GZPA 3VI7A 2ON7A 2KUCA 3FW2A 4KAEA 1R4WA 3GYKA 5ECSA 2DMLA 4EL1A 1GTAA 3CTGA 1FB0A
chains in the Genus database with same CATH superfamily
2IL3A 1UN2A 4IP1A 4HJMA 3QPMA 1R7HA 3D5JA 2X8CA 2H70A 1M2DA 1TW9A 3VI5A 5IMZA 4O5RA 2I3YA 2H0IA 2NTOA 2VIMA 4HJ2A 4N3ZA 5J47A 3FYGA 4ML1A 4RUVA 5IPHA 3HDCA 3P8WA 2F8FA 4IW9A 2F8AA 3H1NA 2VAFA 3I69A 5LD0A 4G0IA 2FA4A 4KDYA 2XBQA 3IK9A 1K0MA 3GH6A 3TB2A 5F07A 4IKHA 3UARA 2OKAA 4WEYA 4GF0A 3F6FA 2H0GA 4Z2TA 1XWAA 5JCUA 2LNSA 2HYXA 4GTUA 1KNGA 4ZBBA 2GSSA 2X64A 3KM6A 1TTZA 4PNGA 3FKFA 2M46A 4ID0A 4ICYA 4EUYA 13GSA 4ECBA 3TKSA 3KH9A 2HRKB 3FY7A 3N5OA 1JFUA 2GQMA 3C1RA 1VF1A 4MNNA 1A0FA 4IGJA 4I2TA 4K2XA 3UJ1A 5B6NA 1TRUA 4O7HA 4TXVA 3VURA 1ACVA 1K3LA 1FAAA 3TJGA 2RUEA 3EE2A 1YZXA 2IMKA 5J4YA 1GUMA 2C8UA 3U5RE 3IOSA 5AISA 2HSYA 1RQMA 5A4VA 2C1YA 3QD9A 4V1Ag 2CAQA 1Z6MA 1O8WA 1GSUA 3F3RA 2WGRA 4KA0A 2HRKA 5CNWA 1X9WB 4GQCA 1BX9A 3Q19A 5D93A 2RLIA 5ABRA 3LG6A 1U3AA 1G7EA 4NAXA 1QMVA 3QAGA 3GL5A 2VCWA 1IYHA 2FWHA 1MDIA 1T4YA 2RUFA 1U88A 3HCZA 4Q5QA 5KEJA 3Q18A 1B9YC 1GH2A 1SL0B 3IHQA 2J9HA 2R5GA 1M7TA 3KP8A 1X9SB 1OE8A 3TKSE 2IPAA 3R3EA 3FZAA 2DLXA 1SD9A 1Z3EA 3TRQA 2EC4A 1A8YA 4RQRA 4IELA 4MA9A 1PX7A 5GZZB 1TRWA 2YWMA 3LGCA 4XS6A 4Z7XA 1VGLA 1JZWA 1Z9HA 4KDXA 4I97A 4ECCA 2DJJA 1GUKA 4CHSA 2CVKA 7GSSA 1SYRA 1GSYA 2KP1A 2MZCA 5ELAA 5JWRB 3GKKA 2C3QA 1GLPA 5EY6A 4JE1A 3M9KA 1XG8A 3LJRA 2FWGA 1VF3A 4J56E 5JWQB 3SBCA 2B5XA 5AIVA 4OD7A 2L5OA 1SD8A 2KLXA 1BJXA 3IK7A 3BD2A 1S3RA 1XFLA 4Q5NA 5KOWA 3LWAA 4K5RA 1A0RP 1S4BP 2HSNB 2HI7A 3HVNA 3UVHA 1OC3A 5G5EA 2OT3A 1X0RA 1F3AA 3FR9A 2C0DA 5DAKB 1X9MB 2K6VA 3P90A 4JRRA 3QAWA 1SYXA 1VRSD 2GDRA 4KH7A 2YCDA 6GSYA 2VD0A 5CAXA 4FXYP 4KB3A 4FIWA 3TJKA 2PERA 3GUSA 4WBRD 4HZ4A 1Z6NA 4K7NA 1GNWA 4KSMA 4JR4A 1GTBA 2DMMA 2EFHA 3R2QA 3A3TA 1XVQA 3A5IA 2HSNA 3A2WA 4WF5A 5DAKA 2FGXA 2RM6A 4BWSA 2HXKA 2FY6A 1Z5YE 1N2AA 3TJJA 4K9ZA 3FZ9A 4IQ1A 4ECIA 5IMCA 4ZL8A 2VCVA 2H6YA 3W6GA 4JZQA 1DE2A 1EEJA 4ILFA 2QKEA 1A8LA 2L5LA 1M9BA 3C1SA 1MDKA 2YNXA 4ULXA 3M0FA 3DYRA 1HNAA 1TI3A 2GSTA 1AUCA 4ZIJA 4TR4A 3TCOA 3ZTLA 1O73A 5DCGA 5COHA 2XC2A 3DWVA 3KEBA 5CO3A 3GRXA 1BEDA 5G1LA 4DSRA 3PR8A 3HJPA 1M3JA 2VL2A 4ZXGA 1GSSA 5EL8A 1FHEA 5D96A 4WF4A 5BMUB 1UC7A 3GHAA 5A5HB 3F4TA 2N5AA 5HR0A 1XWKA 4N11A 4IQAA 9GSSA 2C0GA 1SU9A 2K18A 1V2AA 3D0ZA 1HD2A 3GX8A 1K0CA 1ML6A 3KGKA 1TK0B 3FHKA 3DVWA 4MCUA 2IMFA 1MD4A 2VCTA 1TP9A 4MZCA 1GTIA 4IJ3A 2R0PA 3IA1A 1PSQA 1G0TA 2A4HA 5KN1A 2GTUA 2JZRA 4ISDA 1YQ1A 5JCGA 2VLVA 1J08A 5ECIB 1K0OA 2VL9A 4WETA 3RDWA 2I81A 5DJMA 5BMUA 2QSIA 3EWLA 4RI6A 5DBQA 3ERWA 5A5HA 1A2JA 1BQ7A 6GSTA 1CQGA 4PTSA 3TOTA 3DXBA 2OBKA 5H5SA 3MWHA 4PHZC 2LUSA 4PQ1A 1WRYA 4NHZA 4FQUA 2DIYA 1GSFA 2GSQA 4MJCA 3UAPA 1T7PB 4E8EA 4N30A 1XWGA 4AI6A 1A23A 4NV5A 1WWJA 2IMIA 5J41A 4TN8A 1A2LA 3GKNA 3KH7A 3ZYWA 4KGIA 3QR6A 2VUPA 2AAWA 4YH2A 3APSA 2K8VA 3PPUA 1OC9B 3L9VA 1YF0A 4HDEA 1T4ZA 2O87A 1XWBA 4EDYA 3HD5A 3ZMKA 2VL3A 1ILOA 2WW1A 1PKWA 4BA7A 2B5EA 1UA5A 3APOA 5C04A 3DKSA 4A5PA 5HFKA 2ZNMA 1NSWA 3E9JB 4TOPA 3CSJA 1PD21 3ERFA 4GLTA 2JSZA 2C0FA 4MPFA 1TXUA 3E3EA 2TIRA 4POLA 3LXZA 2L4QA 3FK8A 4YAVA 1GP1A 5IPGA 2YZUA 1OC9A 2L6DA 1B8XA 4ZBDA 3C7MA 4CDOA 4PUAA 2QGVA 4QQ7A 4POMA 3M1GA 1S3DA 1MTCA 1GUHA 4PQIA 4I5QA 5CRWA 1GULA 3V1WA 5IQYA 2DBCA 5ECQB 6GSSA 2OACA 1ERUA 2B3SA 1K0AA 3TKPA 5CRDA 5HQPA 2YPMA 1M0UA 4L5OA 2EFCA 4FYBA 2IFQB 2R0CA 5IMDA 3TKQA 3LSZA 2F51A 3ISOA 1O7UA 4NV2A 3UL3A 2YWIA 2O89A 4GDFA 2H1DA 2XHFA 4JEDA 1R5AA 5IO0A 1RK4A 2WRTA 3DIEA 2ES7A 1EP8A 3MIXA 3TU3B 1GWCA 5IOWA 1X5CA 4KE3A 1WJKA 2H74A 4EVMA 5CREA 1S3CA 3KP9A 2IFQA 4KCEA 3WGXA 4I2UA 1S3AA 2A2RA 3HA9A 19GSA 3QFBC 4DSQA 3DGQA 1AW9A 4AJ7A 1V58A 4ZL9A 3G9BA 3P2AA 3HJMA 1GLQA 1WMJA 4HOJA 4LA1A 5A4UA 4W66A 4OWYA 3HVSA 2R6KA 4JR6A 5H5RA 2GGTA 1ZGNA 2JSYA 2KOKA 3BCIA 2HE3A 2GSRA 5ECKB 1F6MC 4Q5FA 1JZRA 2P0GA 3FMWA 2E2MA 4IVFA 1G7OA 4OFTA 2WULA 2O8VB 2QA1A 1URMA 1LU4A 2WFCA 3DMLA 5HR3A 1PL1A 3M9JA 2DJ2A 4NMUA 4YQVA 1XIYA 3WGEA 2HT9A 2JZTA 2LKUA 5IOXA 3F6DA 4TW5A 4MH3A 2WVZA 4HU9A 2UZ8A 1HQOA 2DKIA 4F2IA 1YEPA 3UOMA 1SJIA 1F9MA 1PL2A 1SKRB 4PUFC 4DVCA 1SVLA 3US3A 3RAZA 4KX4A 1F3BA 3VWUA 2CVDA 2HRNA 5G30A 5A1NB 1AQWA 4MF7A 2OE1A 1YEXA 2H75A 4HSCX 2H71A 3BBYA 2DJ1A 3TJFA 2OJLA 3H93A 4DSSB 2H1LA 1KTEA 1TK8B 2MMNA 2P5QA 3EINA 2O36A 1SKWB 3C73A 4TR1B 2PVQA 3LORA 1F2EA 2H01A 3HY2A 4JBBA 4N10A 2O85A 4KSOA 2LQQA 2I1UA 2WVYA 4ACSA 1GNEA 1PA3A 1PKZA 4BVYB 3WT1A 5A1NA 3GURA 4J2FA 3GH9A 5DALB 3DD3A 5J5NA 2UV8G 3GKMA 1H75A 1U87A 3DEXA 4DSSA 3IC4A 2H19A 3UBLA 3GV1A 4AJ8A 2M72A 3RPNA 2AHEA 4F0CA 3CQFA 2PMTA 4TR1A 1XPVA 1MEKA 1VF2A 2CAIA 1WE0A 11GSA 1KEBA 4MP4A 4PGTA 4BVYA 4P3YB 2PWJA 3GIXA 3WYWA 4HUAA 3QAVA 1T1VA 2H6ZA 3PH9A 1BG5A 2WB9A 5DJLA 4ZB9A 4PURA 2LS5A 1Q98A 1ZYPA 4ECJA 3NIVA 4AGSA 2GZYA 3GX0A 4EIPA 2FWFA 5KN3A 4Q5RA 3KIJA 4D73B 3BCKA 2E7PA 1AXDA 3C8EA 3L4NA 4XS4B 3UIWA 3ZITA 2EIRA 1QGVA 2V41A 4K6XA 2R2JA 1DUGA 3CRTA 1AQXA 1AIUA 3ED3A 5JCWA 3S9FA 4MABA 4OFMA 4MPGA 5J3RA 5HR2A 1TI1A 3HZ8A 1WPIA 5IMAA 4HS1A 2NPBA 1O85A 3QOUA 4WXTA 4GSSA 1NW2A 2IIYA 4Z2UA 2LRCA 1ERWA 2DSAA 2OBIA 4XRDA 2X4AA 1EZKA 4OMVA 4D73A 4EO3A 5F05A 2HSMB 3FR3A 3H4KA 4QL7A 3GA4A 1R5PA 3HZ4A 3IHGA 1GSEA 5GSTA 2MBSA 2Z9SA 4FO5A 2ZUPA 1YEWC 2FCHA 4K2DA 4K8MA 5ENUA 1PX6A 3GFKA 3QCPA 2B1KA 2TRXA 1I1IP 3PINA 1YY7A 4NXIA 5INYA 17GSA 4EC0A 5AGYA 4O32A 1TDIA 2VOCA 4K0NA 2B7JA 2HRAA 5IMVA 2DKHA 3EU3A 2FD3A 5IIZA 2O3EA 2HSMA 1K0BA 1WP0A 3PGTA 5HFIA 1XW5A 4GSNA 4TVEA 1JZOA 4OCFA 1H4OA 2GT5A 5ECHB 1I9DA 2MYGA 4I6XA 2NBSA 4E68A 4NWYA 3QMXA 5LCZA 1ST9A 2H8LA 1BYEA 2AUVA 2N5FA 4IHUA 3EMPA 5D9TA 1LJRA 1X5DA 3MSZA 5C00A 5KN0A 1OE7A 2G2QA 3VWWA 2H66A 3ME8A 2DJKA 4LMWA 2YP6A 1XWCA 4YAPA 2V1MA 1HNCA 4EKZA 3J7Yk 2I4AA 2CT6A 4IP6A 1V9WA 2HNLA 1O6JA 2VCQA 4KDUA 1IYIA 4ZB8A 3HKRA 5AN1A 3I6AA 2IMDA 1AQVA 4GQFA 3TGZA 2RIIA 3UMAA 4KUNA 1E6BA 3IBHA 3VLNA 1SK1A 2VM1A 3MAKA 1ZYEA 1XOBA 2LRNA 4AKXB 4HQZA 5GSSA 3ZVJD 2WJUA 1AAZA 1OKTA 3TRXA 2H1GA 4F03A 1O81A 4ML6A 2FWEA 2X8GA 1PQNA 4TR0A 5ECNB 1JZDA 2RM5A 3NZNA 2B6MA 3G7JA 1SJ6A 20GSA 3C71A 3HXSA 4OO4A 1N25A 3KXOA 3KMNA 4J57E 1ERTA 1Y25A 4OO5A 4X1UA 3CTFA 2N5BA 2LJRA 2YWOA 5D73A 4LLRA 2YV7A 1F37A 3IAM2 3D21A 3F8UA 3IXRA 4IJIA 2MBTA 1NM3A 3ZIVA 1OAZA 1ZZYA 3O76A 1SJZA 3GNJA 3TKSC 1PN9A 3KMOA 4DEJA 3FEUA 2B1LA 3D4MA 4MZWA 4BWQA 3F9UA 2PU9C 1XCCA 2VCXA 3HVXA 2OA7A 4K7OA 2X8HA 3IPZA 1W4VA 5D9XA 4GCIA 1PFOA 1EEMA 2DIZA 4GRFA 5J9BA 3RHCA 2HLSA 3FZ4A 2CX3A 1TJDA 2KP2A 4NPBA 2BTOT 2A4VA 3G7YA 1ZCPA 3A5WA 3TKRA 2XPDA 1Y6EA 4AKGA 4BL7B 2H1BA 2LTKA 2PBJA 1X5EA 3EU4A 2MMAA 1TK5B 3CHXC 4EXJA 2PVOC 2BMXA 1G6YA 2YJHA 3LYKA 3AY8A 4LL4B 1XZOA 1ZOFA 1SL1B 2J23A 3HJOA 4TXOB 1GTUA 2C3TA 1TRSA 4XHMA 4RI7A 2KHPA 2WS2A 3NOFA 3LQ7A 1YKCA 4MZBA 2PUKC 2PPTA 2IMEA 2GLRA 4K0GA 1N8JA 2TRCP 3D22A 3RFRC 4EF0A 4BL7A 16GSA 1OKDA 3CRUA 1YVLA 4MLYA 2WW3A 1V57A 2JADA 2H73A 2L4CA 4GSTA 4MDCA 4X4JA 3LFLA 4WR5A 2CV4A 1RW1A 4KF9A 4TXOA 3IRAA 4BPYA 2B7KA 4PI2C 5D9WA 5G31A 2VKZG 1JHBA 3VPQA 2A2PA 4V2NA 5FWGA 1XOAA 3ZLPA 4BIKA 2YJ7A 2R0GA 2FUG2 2PN8A 1M9AA 2VO4A 1Y1UA 4WBJA 3EVIA 1ZMAA 1XW6A 4MJAA 4F0BA 2I9HA 1GSQA 8GSSA 3WGDA 4IN0A 3KTBA 2H6XA 4POKA 5FT3A 2ON5A 2WW0A 2D2ZA 1ERVA 1NHYA 1QK8A 2NVLA 3BOAA 2HSHA 2L6CA 2AV4A 1R26A 3KCMA 1SENA 2HZFA 4FYCA 1T8EB 4KW6A 2GQLA 2DC5A 5F06A 2LQOA 1J0FA 4YQMA 3ZFLA 3ZL5A 1WOUA 5A34B 4F9ZA 2GS3A 2O5VA 3IAS2 1EOHA 2WW2A 3Q6OA 1OC8A 1GSDA 5ECMB 3LXTA 4ZB7A 4N0ZA 1UVZA 2OE3A 2E0QA 2C4JA 2LRTA 3VWXA 1YJ6A 3RPPA 2QA2A 2OADA 1DSBA 3CXGA 1ZYNA 3E0UA 3VWVA 3KJYA 3JCML 4GXZA 2V6KA 2YANA 1M2BA 3H79A 5DVBA 3O6TA 2C0EA 3FRCA 4JU5A 2L57A 1M99A 5BRTA 4V1Ap 4PX1A 4BVXB 5A34A 1J9BA 2JL4A 2WCIA 3D6IA 2F3MA 2OE0A 4TKYA 4IS0A 4X0XA 2P31A 5IM9A 1XBSA 3APQA 3IC8A 2K8SA 4WR4A 1M2AA 5E59A 4MJEA 2LSTA 4XCSA 3RBTA 2H72A 3I43A 2VL2C 5F0GA 3EMXA 2QC7A 3HYPA 5J40A 4AKHA 2V6OA 2EFEA 2F9SA 1W89A 1DE1A 3EPTA 1OVNA 1SVOA 1K0DA 3UBKA 2FA8A 4TR3A 3L78A 2FHEA 4BVXA 2YWNA 3CSHA 4CY6A 1FO5A 4L5LA 2VM2A 3KZQA 2HRFA 4H86A 5D8IA 4FH8A 1TU7A 5KOXA 2PGTA 2GQKA 5A5KA 4CY8A 3KTLA 12GSA 2YN1A 2WVXB 4L8EA 4MMMA 3J7Yb 2E2GA 4YKGA 2H30A 2LJAA 2FLSA 1FOVA 3N9JA 1PN0A 1THXA 4FYUA 3DRNA 4RQXA 5F8BA 4LL1B 3IDVA 3G7IA 1C72A 3TOUA 3GN3A 3L9SA 2WDUA 1EV4A 5DALA 2G0FA 5DQSA 6GSVA 2XBIA 5B6MA 2HQTA 3IR4A 3CBUA 5G2ZA 1TU8A 1I5GA 1BAYA 4G10A 4HQSA 1PMTA 1U3IA 4HI7A 2WVXA 4EIQA 2WZ9A 3CMIA 2VCZA 3EYTA 1B4QA 5CP1A 1OYJA 3GSSA 2MMOA 4AJ6A 4OFNA 4ZBAA 2H76A 3LEFA 3QDNA 5CRHA 3WD6A 3EURA 5ECRB 3U6VA 2AB6A 3WT2A 2MMZA 22GSA 3ZIJA 5JWOB 4L0WA 3FR6A 1SK0A 3OR5A 1TKDB 2YV9A 1FB6A 1B48A 2C80A 3TRPA 5IMFA 1FW1A 1M3IA 1SVMA 4XS4A 4XS1A 2CZ3A 3UVTA 4MJBA 4G19A 3GMFA 5B8AA 3HHVA 3K8NA 1XXUA 5D9VA 2L59A 3MDKA 2AYTA 2IWTA 4GWRA 1TOFA 1O8XA 4EE0A 4AF2A 3D4TA 5CRGA 3HVVA 2VD1A 4PQHA 2A2SA 1K3YA 4KNDA 3TUEA 2JACA 1B4PA 5GAND 1YDKA 2JU5A 1JLWA 1EGOA 3P7XA 4ZILA 1PGTA 3QFAC 1HYUA 3W8JA 10GSA 4V2LA 3MNGA 2O7KA 3ERGA 2GZZA 4MF6A 1QUWA 3CSIA 2R3XA 2REMA 3UEMA 4G01A 3A2XA 1V40A 4EDZA 1E2YA 5ELGA 5HFGA 1DBYA 3A2VA 3M8NA 4PXOA 4XTSA 3F63A 2CVBA 1A2MA 3RHBA 1ABAA 2H1AA 2WZSA 4YKFA 2DJ0A 3I9V2 1CQHA 1B9XC 1U6TA 5L71A 2CQ9A 2YOIA 2FNOA 4O92A 1BG1A 3F0IA 4O5UA 5H5QA 1QXHA 3Q74A 1QQ2A 2B5YA 3FZ5A 5A4WA 1HNBA 3KD0A 1EGRA 5KN2A 3ZVJA 3HMJG 1T00A 3MYDA 1ON4A 6GSXA 1MD3A 1THOA 1PRXA 2GT6A 5FHIA 4G0KA 1FG4A 3F4RA 4F82A 4AKIA 2GVPA 3LYPA 5DDLA 1GRXA 4V2MA 1EV9A 4YQUA 4HEA2 4K5SA 3DVXA 1V98A 2AJQB 2XPEA 2EIQA 4QMKA 5EPFA 2ZCTA 2V2GA 4MH2A 3GSTA 2P5RA 4LMVA 4L0UA 3M3MA 5ECLB 5GAPD 1EOGA 3GTUB 4OCEA 3ZMLA 4ZL7A 2NDOA 2EIOA 4XIHA 2CA8A 4K1FA 3IV4A 3ZRDA 5E4WA 5HR1A 4G0LA 1FVKA 1AC1A 3L0HA 1T3BA 4PNFA 1MDJA 1Q4JA 3CWGA 3ZZXA 5G5FA 5IO2A 18GSA 3F3QA 1FVJA 1Z7PA 4XRAA 3O3TA 3ME7A 4CW9A 5B8BA 2CX4A 4G9HA 4HZ2A 2C3NA 2EFDA 4NHWA 3VPTA 5ECPB 3GTUA 5DCHA 4MK3A 1YF1A 4KCAA 1EWXA 4QL9A 3EC3A 6GSWA 3VFIA 1KBNA 1LBKA 3CYNA 1WIKA 1JLVA 4USSA 5LNKe 1BF5A 1SK2A 2H0HA 2DJ3A 1YKAA 1USBA 3IE3A 1NHOA 1SKSB 4G2EA 2X99A 1A24A 4Z2RA 2ALBA 2LEGA 2YZHA 5J4UA 1XW9A 5B7CA 2LV3A 4E8HA 3TJBA 2LJKA 1K3OA 4MF5A 5G1KA 2IJYA 5J9CA 4I8BA 3RGBC 1QFNA 4N0VA 3H8QA 2JZSA 2HZEB 3TDGA 3ZREA 3ZFBA 5ID2B 2VLUA 1GL8A 4POBA 3GKXA 4IBPA 4HU7A 1XVWA 2R4VA 5J4VA 1G6WA 2VLTA 14GSA 5AIXA 3L9UA 3VK9A 3W8SA 3BJ5A 5EVOA 1TRVA 4WKWA 6GSUA 2LNTA 5CYYA 1TXXA 1VF4A 3GL3A 1ZYQB 1EP7A 1SL2B 2V32A 2M80A 3LW9A 5DQYA 4X43A 2IN3A 5ECOB 4ZB6A 1ZL9A 3SWLA 1K0NA 4TRXA 2CZ2A 2R37A 2BJXA 3F4SA 2K9FA 2HFDA 2HZEA 4K7IA 2X49A 1Z7RA 4O5QA 5ID2A 2GZPA 3VI7A 2ON7A 2KUCA 3FW2A 4KAEA 1R4WA 3GYKA 4PI0C 5ECSA 2DMLA 4EL1A 1GTAA 1FOHA 3CTGA 1FB0A
chains in the Genus database with same CATH topology
2IL3A 1UN2A 4IP1A 4HJMA 3QPMA 1R7HA 3D5JA 2X8CA 2H70A 1M2DA 1TW9A 3VI5A 5IMZA 4O5RA 2I3YA 2H0IA 2NTOA 2VIMA 4HJ2A 4N3ZA 5J47A 3FYGA 4ML1A 4RUVA 5IPHA 3HDCA 3P8WA 2F8FA 4IW9A 2F8AA 3H1NA 2VAFA 3I69A 5LD0A 4G0IA 2FA4A 4KDYA 2XBQA 3IK9A 1K0MA 3GH6A 3TB2A 5F07A 4IKHA 3UARA 2OKAA 4WEYA 4GF0A 3F6FA 2H0GA 4Z2TA 1XWAA 5JCUA 2LNSA 2HYXA 4GTUA 1KNGA 4ZBBA 2GSSA 2X64A 3KM6A 1TTZA 4PNGA 3FKFA 2M46A 4ID0A 4ICYA 4EUYA 13GSA 4ECBA 3TKSA 3KH9A 2HRKB 3FY7A 3N5OA 1JFUA 2GQMA 3C1RA 1VF1A 4MNNA 1A0FA 4IGJA 4I2TA 4K2XA 3UJ1A 5B6NA 1TRUA 4O7HA 4TXVA 3VURA 1ACVA 1K3LA 1FAAA 3TJGA 2RUEA 3EE2A 1YZXA 2IMKA 5J4YA 1GUMA 2C8UA 3U5RE 3IOSA 5AISA 2HSYA 1RQMA 5A4VA 2C1YA 3QD9A 4V1Ag 2CAQA 1Z6MA 1O8WA 1GSUA 3F3RA 2WGRA 4KA0A 2HRKA 5CNWA 1X9WB 4GQCA 1BX9A 3Q19A 5D93A 2RLIA 5ABRA 3LG6A 1U3AA 1G7EA 4NAXA 1QMVA 3QAGA 3GL5A 2VCWA 1IYHA 2FWHA 1MDIA 1T4YA 2RUFA 1U88A 3HCZA 4Q5QA 5KEJA 3Q18A 1B9YC 1GH2A 1SL0B 3IHQA 2J9HA 2R5GA 1M7TA 3KP8A 1X9SB 1OE8A 3TKSE 2IPAA 3R3EA 3FZAA 2DLXA 1SD9A 1Z3EA 3TRQA 2EC4A 1A8YA 4RQRA 4IELA 4MA9A 1PX7A 5GZZB 1TRWA 2YWMA 3LGCA 4XS6A 4Z7XA 1VGLA 1JZWA 1Z9HA 4KDXA 4I97A 4ECCA 2DJJA 1GUKA 4CHSA 2CVKA 7GSSA 1SYRA 1GSYA 2KP1A 2MZCA 5ELAA 5JWRB 3GKKA 2C3QA 1GLPA 5EY6A 4JE1A 3M9KA 3LJRA 2FWGA 1VF3A 4J56E 5JWQB 3SBCA 2B5XA 5AIVA 4OD7A 2L5OA 1SD8A 2KLXA 1BJXA 3IK7A 3BD2A 1XFLA 4Q5NA 5KOWA 3LWAA 4K5RA 1A0RP 2HSNB 2HI7A 3UVHA 1OC3A 5G5EA 2OT3A 1X0RA 1F3AA 3FR9A 2C0DA 5DAKB 1X9MB 2K6VA 3P90A 4JRRA 3QAWA 1SYXA 1VRSD 2GDRA 4KH7A 2YCDA 6GSYA 2VD0A 5CAXA 4KB3A 4FIWA 3TJKA 2PERA 3GUSA 4WBRD 4HZ4A 1Z6NA 4K7NA 1GNWA 4KSMA 4JR4A 1GTBA 2DMMA 2EFHA 3R2QA 3A3TA 1XVQA 3A5IA 2HSNA 3A2WA 4WF5A 5DAKA 2FGXA 2RM6A 4BWSA 2HXKA 2FY6A 1Z5YE 1N2AA 3TJJA 4K9ZA 3FZ9A 4IQ1A 4ECIA 5IMCA 4ZL8A 2VCVA 2H6YA 3W6GA 4JZQA 1DE2A 1EEJA 4ILFA 2QKEA 1A8LA 2L5LA 1M9BA 3C1SA 1MDKA 2YNXA 4ULXA 3M0FA 3DYRA 1HNAA 1TI3A 2GSTA 1AUCA 4ZIJA 4TR4A 3TCOA 3ZTLA 1O73A 5DCGA 5COHA 2XC2A 3DWVA 3KEBA 5CO3A 3GRXA 1BEDA 5G1LA 4DSRA 3PR8A 3HJPA 2VL2A 4ZXGA 1GSSA 5EL8A 1FHEA 5D96A 4WF4A 5BMUB 1UC7A 3GHAA 5A5HB 3F4TA 2N5AA 5HR0A 1XWKA 4N11A 4IQAA 9GSSA 2C0GA 1SU9A 2K18A 1V2AA 3D0ZA 1HD2A 3GX8A 1K0CA 1ML6A 3KGKA 1TK0B 3FHKA 3DVWA 4MCUA 2IMFA 1MD4A 2VCTA 1TP9A 4MZCA 1GTIA 4IJ3A 2R0PA 3IA1A 1PSQA 1G0TA 2A4HA 5KN1A 2GTUA 2JZRA 4ISDA 1YQ1A 5JCGA 2VLVA 1J08A 5ECIB 1K0OA 2VL9A 4WETA 3RDWA 2I81A 5DJMA 5BMUA 2QSIA 3EWLA 4RI6A 5DBQA 3ERWA 5A5HA 1A2JA 1BQ7A 6GSTA 1CQGA 4PTSA 3TOTA 3DXBA 2OBKA 5H5SA 3MWHA 2LUSA 4PQ1A 1WRYA 4NHZA 4FQUA 2DIYA 1GSFA 2GSQA 4MJCA 3UAPA 1T7PB 4E8EA 4N30A 1XWGA 4AI6A 1A23A 4NV5A 1WWJA 2IMIA 5J41A 4TN8A 1A2LA 3GKNA 3KH7A 3ZYWA 4KGIA 3QR6A 2VUPA 2AAWA 4YH2A 3APSA 2K8VA 3PPUA 1OC9B 3L9VA 1YF0A 4HDEA 1T4ZA 2O87A 1XWBA 4EDYA 3HD5A 3ZMKA 2VL3A 1ILOA 1PKWA 4BA7A 2B5EA 1UA5A 3APOA 5C04A 3DKSA 4A5PA 5HFKA 2ZNMA 1NSWA 3E9JB 4TOPA 3CSJA 1PD21 3ERFA 4GLTA 2JSZA 2C0FA 4MPFA 1TXUA 3E3EA 2TIRA 4POLA 3LXZA 2L4QA 3FK8A 4YAVA 1GP1A 5IPGA 2YZUA 1OC9A 2L6DA 1B8XA 4ZBDA 3C7MA 4CDOA 4PUAA 2QGVA 4QQ7A 4POMA 3M1GA 1S3DA 1MTCA 1GUHA 4PQIA 4I5QA 5CRWA 1GULA 3V1WA 5IQYA 2DBCA 5ECQB 6GSSA 2OACA 1ERUA 2B3SA 1K0AA 3TKPA 5CRDA 5HQPA 2YPMA 1M0UA 4L5OA 2EFCA 4FYBA 2IFQB 2R0CA 5IMDA 3TKQA 3LSZA 2F51A 3ISOA 1O7UA 4NV2A 3UL3A 2YWIA 2O89A 4GDFA 2H1DA 2XHFA 4JEDA 1R5AA 5IO0A 1RK4A 2WRTA 3DIEA 2ES7A 1EP8A 3MIXA 3TU3B 1GWCA 5IOWA 1X5CA 4KE3A 1WJKA 2H74A 4EVMA 5CREA 1S3CA 3KP9A 2IFQA 4KCEA 3WGXA 4I2UA 1S3AA 2A2RA 3HA9A 19GSA 3QFBC 4DSQA 3DGQA 1AW9A 4AJ7A 1V58A 4ZL9A 3G9BA 3P2AA 3HJMA 1GLQA 1WMJA 4HOJA 4LA1A 5A4UA 4W66A 4OWYA 3HVSA 2R6KA 4JR6A 5H5RA 2GGTA 1ZGNA 2JSYA 2KOKA 3BCIA 2HE3A 2GSRA 5ECKB 1F6MC 4Q5FA 1JZRA 2P0GA 3FMWA 2E2MA 4IVFA 1G7OA 4OFTA 2WULA 2O8VB 2QA1A 1URMA 1LU4A 2WFCA 3DMLA 5HR3A 1PL1A 3M9JA 2DJ2A 4NMUA 4YQVA 1XIYA 3WGEA 2HT9A 2JZTA 2LKUA 5IOXA 3F6DA 4TW5A 4MH3A 4HU9A 2UZ8A 1HQOA 2DKIA 4F2IA 1YEPA 3UOMA 1SJIA 1F9MA 1PL2A 1SKRB 4PUFC 4DVCA 1SVLA 3US3A 3RAZA 4KX4A 1F3BA 3VWUA 2CVDA 2HRNA 5G30A 5A1NB 1AQWA 4MF7A 2OE1A 1YEXA 2H75A 2H71A 3BBYA 2DJ1A 3TJFA 2OJLA 3H93A 4DSSB 2H1LA 1KTEA 1TK8B 2MMNA 2P5QA 3EINA 1SKWB 3C73A 4TR1B 2PVQA 3LORA 1F2EA 2H01A 3HY2A 4JBBA 4N10A 2O85A 4KSOA 2LQQA 2I1UA 4ACSA 1GNEA 1PA3A 1PKZA 4BVYB 3WT1A 5A1NA 3GURA 4J2FA 3GH9A 5DALB 3DD3A 5J5NA 2UV8G 3GKMA 1H75A 1U87A 3DEXA 4DSSA 3IC4A 2H19A 3UBLA 3GV1A 4AJ8A 2M72A 3RPNA 2AHEA 4F0CA 2PMTA 4TR1A 1XPVA 1MEKA 1VF2A 2CAIA 1WE0A 11GSA 1KEBA 4MP4A 4PGTA 4BVYA 4P3YB 2PWJA 3GIXA 3WYWA 4HUAA 3QAVA 1T1VA 2H6ZA 3PH9A 1BG5A 2WB9A 5DJLA 4ZB9A 4PURA 2LS5A 1Q98A 1ZYPA 4ECJA 3NIVA 4AGSA 2GZYA 3GX0A 4EIPA 2FWFA 5KN3A 4Q5RA 3KIJA 4D73B 3BCKA 2E7PA 1AXDA 3C8EA 3L4NA 4XS4B 3UIWA 3ZITA 2EIRA 1QGVA 2V41A 4K6XA 2R2JA 1DUGA 3CRTA 1AQXA 1AIUA 3ED3A 5JCWA 3S9FA 4MABA 4OFMA 4MPGA 5J3RA 5HR2A 1TI1A 3HZ8A 1WPIA 5IMAA 4HS1A 2NPBA 1O85A 3QOUA 4WXTA 4GSSA 1NW2A 2IIYA 4Z2UA 2LRCA 1ERWA 2DSAA 2OBIA 4XRDA 2X4AA 1EZKA 4OMVA 4D73A 4EO3A 5F05A 2HSMB 3FR3A 3H4KA 4QL7A 3GA4A 1R5PA 3HZ4A 3IHGA 1GSEA 5GSTA 2MBSA 2Z9SA 4FO5A 2ZUPA 2FCHA 4K2DA 4K8MA 5ENUA 1PX6A 3GFKA 3QCPA 2B1KA 2TRXA 3PINA 1YY7A 4NXIA 5INYA 17GSA 4EC0A 5AGYA 4O32A 1TDIA 2VOCA 4K0NA 2B7JA 2HRAA 5IMVA 2DKHA 3EU3A 2FD3A 5IIZA 2HSMA 1K0BA 1WP0A 3PGTA 5HFIA 1XW5A 4GSNA 4TVEA 1JZOA 4OCFA 1H4OA 2GT5A 5ECHB 1I9DA 2MYGA 4I6XA 2NBSA 4E68A 4NWYA 3QMXA 5LCZA 1ST9A 2H8LA 1BYEA 2AUVA 2N5FA 4IHUA 3EMPA 5D9TA 1LJRA 1X5DA 3MSZA 5C00A 5KN0A 1OE7A 2G2QA 3VWWA 2H66A 3ME8A 2DJKA 4LMWA 2YP6A 1XWCA 4YAPA 2V1MA 1HNCA 4EKZA 3J7Yk 2I4AA 2CT6A 4IP6A 1V9WA 2HNLA 1O6JA 2VCQA 4KDUA 1IYIA 4ZB8A 3HKRA 5AN1A 3I6AA 2IMDA 1AQVA 4GQFA 3TGZA 2RIIA 3UMAA 4KUNA 1E6BA 3IBHA 3VLNA 1SK1A 2VM1A 3MAKA 1ZYEA 1XOBA 2LRNA 4AKXB 4HQZA 5GSSA 3ZVJD 2WJUA 1AAZA 1OKTA 3TRXA 2H1GA 4F03A 1O81A 4ML6A 2FWEA 2X8GA 1PQNA 4TR0A 5ECNB 1JZDA 2RM5A 3NZNA 2B6MA 3G7JA 1SJ6A 20GSA 3C71A 3HXSA 4OO4A 1N25A 3KXOA 3KMNA 4J57E 1ERTA 1Y25A 4OO5A 4X1UA 3CTFA 2N5BA 2LJRA 2YWOA 5D73A 4LLRA 2YV7A 1F37A 3IAM2 3D21A 3F8UA 3IXRA 4IJIA 2MBTA 1NM3A 3ZIVA 1OAZA 1ZZYA 3O76A 1SJZA 3GNJA 3TKSC 1PN9A 3KMOA 4DEJA 3FEUA 2B1LA 3D4MA 4MZWA 4BWQA 3F9UA 2PU9C 1XCCA 2VCXA 3HVXA 2OA7A 4K7OA 2X8HA 3IPZA 1W4VA 5D9XA 4GCIA 1EEMA 2DIZA 4GRFA 5J9BA 3RHCA 2HLSA 3FZ4A 2CX3A 1TJDA 2KP2A 4NPBA 2BTOT 2A4VA 3G7YA 1ZCPA 3A5WA 3TKRA 2XPDA 1Y6EA 4AKGA 4BL7B 2H1BA 2LTKA 2PBJA 1X5EA 3EU4A 2MMAA 1TK5B 4EXJA 2PVOC 2BMXA 1G6YA 2YJHA 3LYKA 3AY8A 4LL4B 1XZOA 1ZOFA 1SL1B 2J23A 3HJOA 4TXOB 1GTUA 2C3TA 1TRSA 4XHMA 4RI7A 2KHPA 2WS2A 3NOFA 3LQ7A 1YKCA 4MZBA 2PUKC 2PPTA 2IMEA 2GLRA 4K0GA 1N8JA 2TRCP 3D22A 4EF0A 4BL7A 16GSA 1OKDA 3CRUA 1YVLA 4MLYA 1V57A 2JADA 2H73A 2L4CA 4GSTA 4MDCA 4X4JA 3LFLA 4WR5A 2CV4A 1RW1A 4KF9A 4TXOA 3IRAA 4BPYA 2B7KA 5D9WA 5G31A 2VKZG 1JHBA 3VPQA 2A2PA 4V2NA 5FWGA 1XOAA 3ZLPA 2YJ7A 2R0GA 2FUG2 2PN8A 1M9AA 2VO4A 1Y1UA 4WBJA 3EVIA 1ZMAA 1XW6A 4MJAA 4F0BA 2I9HA 1GSQA 8GSSA 3WGDA 4IN0A 3KTBA 2H6XA 4POKA 5FT3A 2ON5A 2D2ZA 1ERVA 1NHYA 1QK8A 2NVLA 3BOAA 2HSHA 2L6CA 2AV4A 1R26A 3KCMA 1SENA 2HZFA 4FYCA 1T8EB 4KW6A 2GQLA 2DC5A 5F06A 2LQOA 1J0FA 4YQMA 3ZFLA 3ZL5A 1WOUA 5A34B 4F9ZA 2GS3A 2O5VA 3IAS2 1EOHA 3Q6OA 1OC8A 1GSDA 5ECMB 3LXTA 4ZB7A 4N0ZA 1UVZA 2OE3A 2E0QA 2C4JA 2LRTA 3VWXA 1YJ6A 3RPPA 2QA2A 2OADA 1DSBA 3CXGA 1ZYNA 3E0UA 3VWVA 3KJYA 3JCML 4GXZA 2V6KA 2YANA 1M2BA 3H79A 5DVBA 3O6TA 2C0EA 3FRCA 4JU5A 2L57A 1M99A 5BRTA 4V1Ap 4PX1A 4BVXB 5A34A 1J9BA 2JL4A 2WCIA 3D6IA 2F3MA 2OE0A 4TKYA 4IS0A 4X0XA 2P31A 5IM9A 1XBSA 3APQA 3IC8A 2K8SA 4WR4A 1M2AA 5E59A 4MJEA 2LSTA 4XCSA 3RBTA 2H72A 3I43A 2VL2C 5F0GA 3EMXA 2QC7A 3HYPA 5J40A 4AKHA 2V6OA 2EFEA 2F9SA 1W89A 1DE1A 3EPTA 1OVNA 1SVOA 1K0DA 3UBKA 2FA8A 4TR3A 3L78A 2FHEA 4BVXA 2YWNA 3CSHA 4CY6A 1FO5A 4L5LA 2VM2A 3KZQA 2HRFA 4H86A 5D8IA 4FH8A 1TU7A 5KOXA 2PGTA 2GQKA 5A5KA 4CY8A 3KTLA 12GSA 2YN1A 4L8EA 4MMMA 3J7Yb 2E2GA 4YKGA 2H30A 2LJAA 2FLSA 1FOVA 3N9JA 1PN0A 1THXA 4FYUA 3DRNA 4RQXA 5F8BA 4LL1B 3IDVA 3G7IA 1C72A 3TOUA 3GN3A 3L9SA 2WDUA 1EV4A 5DALA 2G0FA 5DQSA 6GSVA 2XBIA 5B6MA 2HQTA 3IR4A 3CBUA 5G2ZA 1TU8A 1I5GA 1BAYA 4G10A 4HQSA 1PMTA 1U3IA 4HI7A 4EIQA 2WZ9A 3CMIA 2VCZA 3EYTA 1B4QA 5CP1A 1OYJA 3GSSA 2MMOA 4AJ6A 4OFNA 4ZBAA 2H76A 3LEFA 3QDNA 5CRHA 3WD6A 3EURA 5ECRB 3U6VA 2AB6A 3WT2A 2MMZA 22GSA 3ZIJA 5JWOB 4L0WA 3FR6A 1SK0A 3OR5A 1TKDB 2YV9A 1FB6A 1B48A 2C80A 3TRPA 5IMFA 1FW1A 4XS4A 1SVMA 4XS1A 2CZ3A 3UVTA 4MJBA 4G19A 3GMFA 5B8AA 3HHVA 3K8NA 1XXUA 5D9VA 2L59A 3MDKA 2AYTA 2IWTA 4GWRA 1TOFA 1O8XA 4EE0A 4AF2A 3D4TA 5CRGA 3HVVA 2VD1A 4PQHA 2A2SA 1K3YA 4KNDA 3TUEA 2JACA 1B4PA 5GAND 1YDKA 2JU5A 1JLWA 1EGOA 3P7XA 4ZILA 1PGTA 3QFAC 1HYUA 3W8JA 10GSA 4V2LA 3MNGA 2O7KA 3ERGA 2GZZA 4MF6A 1QUWA 3CSIA 2R3XA 2REMA 3UEMA 4G01A 3A2XA 1V40A 4EDZA 1E2YA 5ELGA 5HFGA 1DBYA 3A2VA 3M8NA 4PXOA 4XTSA 3F63A 2CVBA 1A2MA 3RHBA 1ABAA 2H1AA 4YKFA 2DJ0A 3I9V2 1CQHA 1B9XC 1U6TA 5L71A 2CQ9A 2YOIA 2FNOA 4O92A 1BG1A 3F0IA 4O5UA 5H5QA 1QXHA 3Q74A 1QQ2A 2B5YA 3FZ5A 5A4WA 1HNBA 3KD0A 1EGRA 5KN2A 3ZVJA 3HMJG 1T00A 3MYDA 1ON4A 6GSXA 1MD3A 1THOA 1PRXA 2GT6A 5FHIA 4G0KA 1FG4A 3F4RA 4F82A 4AKIA 2GVPA 3LYPA 5DDLA 1GRXA 4V2MA 1EV9A 4YQUA 4HEA2 4K5SA 3DVXA 1V98A 2AJQB 2XPEA 2EIQA 4QMKA 5EPFA 2ZCTA 2V2GA 4MH2A 3GSTA 2P5RA 4LMVA 4L0UA 3M3MA 5ECLB 5GAPD 1EOGA 3GTUB 4OCEA 3ZMLA 4ZL7A 2NDOA 2EIOA 4XIHA 2CA8A 4K1FA 3IV4A 3ZRDA 5E4WA 5HR1A 4G0LA 1FVKA 1AC1A 3L0HA 1T3BA 4PNFA 1MDJA 1Q4JA 3CWGA 3ZZXA 5G5FA 5IO2A 18GSA 3F3QA 1FVJA 1Z7PA 4XRAA 3O3TA 3ME7A 4CW9A 5B8BA 2CX4A 4G9HA 4HZ2A 2C3NA 2EFDA 4NHWA 3VPTA 5ECPB 3GTUA 5DCHA 4MK3A 1YF1A 4KCAA 1EWXA 4QL9A 3EC3A 6GSWA 3VFIA 1KBNA 1LBKA 3CYNA 1WIKA 1JLVA 4USSA 5LNKe 1BF5A 1SK2A 2H0HA 2DJ3A 1YKAA 1USBA 3IE3A 1NHOA 1SKSB 4G2EA 2X99A 1A24A 4Z2RA 2ALBA 2LEGA 2YZHA 5J4UA 1XW9A 5B7CA 2LV3A 4E8HA 3TJBA 2LJKA 1K3OA 4MF5A 5G1KA 2IJYA 5J9CA 4I8BA 1QFNA 4N0VA 3H8QA 2JZSA 2HZEB 3TDGA 3ZREA 3ZFBA 5ID2B 2VLUA 1GL8A 4POBA 3GKXA 4IBPA 4HU7A 1XVWA 2R4VA 5J4VA 1G6WA 2VLTA 14GSA 5AIXA 3L9UA 3VK9A 3W8SA 3BJ5A 5EVOA 1TRVA 4WKWA 6GSUA 2LNTA 5CYYA 1TXXA 1VF4A 3GL3A 1ZYQB 1EP7A 1SL2B 2V32A 2M80A 3LW9A 5DQYA 4X43A 2IN3A 5ECOB 4ZB6A 1ZL9A 3SWLA 1K0NA 4TRXA 2CZ2A 2R37A 2BJXA 3F4SA 2K9FA 2HFDA 2HZEA 4K7IA 2X49A 1Z7RA 4O5QA 5ID2A 2GZPA 3VI7A 2ON7A 2KUCA 3FW2A 4KAEA 1R4WA 3GYKA 5ECSA 2DMLA 4EL1A 1GTAA 1FOHA 3CTGA 1FB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IL3 A;  1UN2 A;  4IP1 A;  4HJM A;  3QPM A;  1R7H A;  3D5J A;  2X8C A;  2H70 A;  1M2D A;  1TW9 A;  3VI5 A;  5IMZ A;  4O5R A;  2I3Y A;  2H0I A;  2NTO A;  2VIM A;  4HJ2 A;  3FYG A;  4ML1 A;  4RUV A;  5IPH A;  3HDC A;  3P8W A;  2F8F A;  4IW9 A;  2F8A A;  3H1N A;  2VAF A;  3I69 A;  5LD0 A;  4G0I A;  2FA4 A;  4KDY A;  2XBQ A;  3IK9 A;  1K0M A;  3GH6 A;  3TB2 A;  5F07 A;  4IKH A;  3UAR A;  2OKA A;  4WEY A;  4GF0 A;  3F6F A;  2H0G A;  1XWA A;  5JCU A;  2LNS A;  2HYX A;  4GTU A;  1KNG A;  4ZBB A;  2GSS A;  2X64 A;  3KM6 A;  1TTZ A;  4PNG A;  3FKF A;  2M46 A;  4ID0 A;  4EUY A;  13GS A;  4ECB A;  3TKS A;  3KH9 A;  2HRK B;  3FY7 A;  3N5O A;  1JFU A;  2GQM A;  3C1R A;  1VF1 A;  1A0F A;  4IGJ A;  4I2T A;  3UJ1 A;  5B6N A;  1TRU A;  4O7H A;  4TXV A;  3VUR A;  1ACV A;  1K3L A;  1FAA A;  3TJG A;  2RUE A;  3EE2 A;  1YZX A;  2IMK A;  1GUM A;  2C8U A;  3U5R E;  3IOS A;  5AIS A;  2HSY A;  1RQM A;  5A4V A;  2C1Y A;  3QD9 A;  4V1A g;  2CAQ A;  1Z6M A;  1O8W A;  1GSU A;  3F3R A;  2WGR A;  4KA0 A;  2HRK A;  5CNW A;  1X9W B;  4GQC A;  1BX9 A;  3Q19 A;  5D93 A;  2RLI A;  5ABR A;  3LG6 A;  1U3A A;  1G7E A;  4NAX A;  1QMV A;  3QAG A;  3GL5 A;  2VCW A;  1IYH A;  2FWH A;  1MDI A;  1T4Y A;  2RUF A;  1U88 A;  3HCZ A;  4Q5Q A;  5KEJ A;  3Q18 A;  1B9Y C;  1GH2 A;  1SL0 B;  3IHQ A;  2J9H A;  2R5G A;  1M7T A;  3KP8 A;  1X9S B;  1OE8 A;  3TKS E;  2IPA A;  3R3E A;  3FZA A;  2DLX A;  1SD9 A;  1Z3E A;  3TRQ A;  2EC4 A;  1A8Y A;  4RQR A;  4IEL A;  4MA9 A;  1PX7 A;  5GZZ B;  1TRW A;  2YWM A;  3LGC A;  4XS6 A;  4Z7X A;  1VGL A;  1JZW A;  1Z9H A;  4KDX A;  4I97 A;  4ECC A;  2DJJ A;  1GUK A;  4CHS A;  2CVK A;  7GSS A;  1SYR A;  1GSY A;  2KP1 A;  2MZC A;  5ELA A;  5JWR B;  3GKK A;  2C3Q A;  1GLP A;  5EY6 A;  4JE1 A;  3M9K A;  3LJR A;  2FWG A;  1VF3 A;  4J56 E;  5JWQ B;  3SBC A;  2B5X A;  5AIV A;  4OD7 A;  2L5O A;  1SD8 A;  2KLX A;  1BJX A;  3IK7 A;  3BD2 A;  1XFL A;  4Q5N A;  3LWA A;  1A0R P;  2HSN B;  2HI7 A;  3UVH A;  1OC3 A;  5G5E A;  1X0R A;  1F3A A;  3FR9 A;  2C0D A;  5DAK B;  1X9M B;  2K6V A;  3P90 A;  4JRR A;  3QAW A;  1SYX A;  1VRS D;  2GDR A;  4KH7 A;  2YCD A;  6GSY A;  2VD0 A;  5CAX A;  4KB3 A;  4FIW A;  3TJK A;  2PER A;  3GUS A;  4WBR D;  4HZ4 A;  1Z6N A;  4K7N A;  1GNW A;  4KSM A;  4JR4 A;  1GTB A;  2DMM A;  3R2Q A;  3A3T A;  1XVQ A;  3A2W A;  4WF5 A;  5DAK A;  2FGX A;  2RM6 A;  4BWS A;  2HXK A;  2FY6 A;  1Z5Y E;  1N2A A;  3TJJ A;  4K9Z A;  3FZ9 A;  4IQ1 A;  4ECI A;  5IMC A;  4ZL8 A;  2VCV A;  2H6Y A;  3W6G A;  4JZQ A;  1DE2 A;  1EEJ A;  4ILF A;  2QKE A;  1A8L A;  2L5L A;  1M9B A;  3C1S A;  1MDK A;  2YNX A;  4ULX A;  3M0F A;  3DYR A;  1HNA A;  1TI3 A;  2GST A;  1AUC A;  4ZIJ A;  4TR4 A;  3TCO A;  3ZTL A;  1O73 A;  5DCG A;  5COH A;  2XC2 A;  3DWV A;  3KEB A;  5CO3 A;  3GRX A;  1BED A;  5G1L A;  4DSR A;  3PR8 A;  3HJP A;  2VL2 A;  4ZXG A;  1GSS A;  5EL8 A;  1FHE A;  5D96 A;  4WF4 A;  1UC7 A;  3GHA A;  3F4T A;  2N5A A;  5HR0 A;  1XWK A;  4N11 A;  4IQA A;  9GSS A;  2C0G A;  1SU9 A;  2K18 A;  1V2A A;  3D0Z A;  1HD2 A;  3GX8 A;  1K0C A;  1ML6 A;  3KGK A;  1TK0 B;  3FHK A;  3DVW A;  4MCU A;  2IMF A;  1MD4 A;  2VCT A;  1TP9 A;  4MZC A;  1GTI A;  4IJ3 A;  3IA1 A;  1PSQ A;  1G0T A;  5KN1 A;  2GTU A;  2JZR A;  4ISD A;  1YQ1 A;  5JCG A;  2VLV A;  1J08 A;  5ECI B;  1K0O A;  2VL9 A;  4WET A;  3RDW A;  2I81 A;  5DJM A;  5BMU A;  2QSI A;  3EWL A;  4RI6 A;  5DBQ A;  3ERW A;  1A2J A;  1BQ7 A;  6GST A;  1CQG A;  4PTS A;  3TOT A;  3DXB A;  2OBK A;  5H5S A;  3MWH A;  2LUS A;  4PQ1 A;  1WRY A;  4NHZ A;  4FQU A;  2DIY A;  1GSF A;  2GSQ A;  4MJC A;  3UAP A;  1T7P B;  4E8E A;  4N30 A;  1XWG A;  1A23 A;  4NV5 A;  1WWJ A;  2IMI A;  5J41 A;  4TN8 A;  1A2L A;  3GKN A;  3KH7 A;  3ZYW A;  4KGI A;  3QR6 A;  2VUP A;  2AAW A;  4YH2 A;  3APS A;  2K8V A;  3PPU A;  1OC9 B;  3L9V A;  1YF0 A;  4HDE A;  1T4Z A;  2O87 A;  1XWB A;  4EDY A;  3HD5 A;  3ZMK A;  2VL3 A;  1ILO A;  1PKW A;  4BA7 A;  2B5E A;  1UA5 A;  3APO A;  5C04 A;  3DKS A;  5HFK A;  2ZNM A;  1NSW A;  3E9J B;  4TOP A;  3CSJ A;  1PD2 1;  3ERF A;  4GLT A;  2JSZ A;  2C0F A;  4MPF A;  3E3E A;  2TIR A;  4POL A;  3LXZ A;  2L4Q A;  3FK8 A;  4YAV A;  1GP1 A;  5IPG A;  2YZU A;  1OC9 A;  2L6D A;  1B8X A;  4ZBD A;  3C7M A;  4CDO A;  4PUA A;  2QGV A;  4QQ7 A;  4POM A;  3M1G A;  1S3D A;  1MTC A;  1GUH A;  4PQI A;  4I5Q A;  5CRW A;  1GUL A;  3V1W A;  5IQY A;  2DBC A;  5ECQ B;  6GSS A;  2OAC A;  1ERU A;  2B3S A;  1K0A A;  3TKP A;  5CRD A;  5HQP A;  2YPM A;  1M0U A;  4L5O A;  4FYB A;  2IFQ B;  5IMD A;  3TKQ A;  3LSZ A;  2F51 A;  3ISO A;  1O7U A;  4NV2 A;  3UL3 A;  2YWI A;  2O89 A;  2H1D A;  2XHF A;  4JED A;  1R5A A;  5IO0 A;  1RK4 A;  2WRT A;  3DIE A;  2ES7 A;  1EP8 A;  1GWC A;  5IOW A;  1X5C A;  4KE3 A;  1WJK A;  2H74 A;  4EVM A;  5CRE A;  1S3C A;  3KP9 A;  2IFQ A;  4KCE A;  3WGX A;  4I2U A;  1S3A A;  2A2R A;  3HA9 A;  19GS A;  3QFB C;  4DSQ A;  3DGQ A;  1AW9 A;  4AJ7 A;  1V58 A;  4ZL9 A;  3G9B A;  3P2A A;  3HJM A;  1GLQ A;  1WMJ A;  4HOJ A;  4LA1 A;  5A4U A;  4OWY A;  3HVS A;  2R6K A;  4JR6 A;  5H5R A;  2GGT A;  1ZGN A;  2JSY A;  2KOK A;  3BCI A;  2HE3 A;  2GSR A;  5ECK B;  1F6M C;  4Q5F A;  1JZR A;  2P0G A;  2E2M A;  4IVF A;  1G7O A;  4OFT A;  2WUL A;  2O8V B;  1URM A;  1LU4 A;  2WFC A;  3DML A;  5HR3 A;  1PL1 A;  3M9J A;  2DJ2 A;  4NMU A;  4YQV A;  1XIY A;  3WGE A;  2HT9 A;  2JZT A;  2LKU A;  5IOX A;  3F6D A;  4TW5 A;  4MH3 A;  4HU9 A;  2UZ8 A;  1HQO A;  4F2I A;  1YEP A;  3UOM A;  1SJI A;  1F9M A;  1PL2 A;  1SKR B;  4PUF C;  4DVC A;  3US3 A;  3RAZ A;  4KX4 A;  1F3B A;  3VWU A;  2CVD A;  2HRN A;  5G30 A;  1AQW A;  4MF7 A;  2OE1 A;  1YEX A;  2H75 A;  2H71 A;  3BBY A;  2DJ1 A;  3TJF A;  2OJL A;  3H93 A;  4DSS B;  1KTE A;  1TK8 B;  2MMN A;  2P5Q A;  3EIN A;  1SKW B;  3C73 A;  4TR1 B;  2PVQ A;  3LOR A;  1F2E A;  2H01 A;  3HY2 A;  4JBB A;  4N10 A;  2O85 A;  4KSO A;  2LQQ A;  2I1U A;  4ACS A;  1GNE A;  1PA3 A;  1PKZ A;  4BVY B;  3WT1 A;  3GUR A;  4J2F A;  3GH9 A;  5DAL B;  3DD3 A;  5J5N A;  3GKM A;  1H75 A;  1U87 A;  3DEX A;  4DSS A;  3IC4 A;  2H19 A;  3UBL A;  3GV1 A;  4AJ8 A;  2M72 A;  3RPN A;  2AHE A;  4F0C A;  2PMT A;  4TR1 A;  1XPV A;  1MEK A;  1VF2 A;  2CAI A;  1WE0 A;  11GS A;  1KEB A;  4MP4 A;  4PGT A;  4BVY A;  4P3Y B;  2PWJ A;  3GIX A;  3WYW A;  4HUA A;  3QAV A;  1T1V A;  2H6Z A;  3PH9 A;  1BG5 A;  2WB9 A;  5DJL A;  4ZB9 A;  4PUR A;  2LS5 A;  1Q98 A;  4ECJ A;  3NIV A;  4AGS A;  2GZY A;  3GX0 A;  2FWF A;  5KN3 A;  4Q5R A;  3KIJ A;  4D73 B;  3BCK A;  2E7P A;  1AXD A;  3C8E A;  3L4N A;  4XS4 B;  3UIW A;  3ZIT A;  2EIR A;  1QGV A;  2V41 A;  4K6X A;  2R2J A;  1DUG A;  3CRT A;  1AQX A;  1AIU A;  3ED3 A;  5JCW A;  3S9F A;  4MAB A;  4OFM A;  4MPG A;  5J3R A;  5HR2 A;  1TI1 A;  3HZ8 A;  1WPI A;  5IMA A;  4HS1 A;  2NPB A;  1O85 A;  3QOU A;  4WXT A;  4GSS A;  1NW2 A;  2IIY A;  2LRC A;  1ERW A;  2DSA A;  2OBI A;  4XRD A;  1EZK A;  4OMV A;  4D73 A;  4EO3 A;  5F05 A;  2HSM B;  3FR3 A;  3H4K A;  4QL7 A;  3GA4 A;  1R5P A;  3HZ4 A;  1GSE A;  5GST A;  2MBS A;  2Z9S A;  4FO5 A;  2ZUP A;  2FCH A;  4K2D A;  4K8M A;  5ENU A;  1PX6 A;  3GFK A;  3QCP A;  2B1K A;  2TRX A;  3PIN A;  1YY7 A;  4NXI A;  5INY A;  17GS A;  4EC0 A;  5AGY A;  4O32 A;  1TDI A;  2VOC A;  4K0N A;  2B7J A;  2HRA A;  5IMV A;  3EU3 A;  2FD3 A;  5IIZ A;  2HSM A;  1K0B A;  1WP0 A;  3PGT A;  5HFI A;  1XW5 A;  4GSN A;  4TVE A;  1JZO A;  4OCF A;  1H4O A;  2GT5 A;  5ECH B;  1I9D A;  2MYG A;  4I6X A;  2NBS A;  4NWY A;  3QMX A;  5LCZ A;  1ST9 A;  2H8L A;  1BYE A;  2AUV A;  2N5F A;  4IHU A;  3EMP A;  5D9T A;  1LJR A;  1X5D A;  3MSZ A;  5C00 A;  5KN0 A;  1OE7 A;  2G2Q A;  3VWW A;  2H66 A;  3ME8 A;  2DJK A;  4LMW A;  2YP6 A;  1XWC A;  4YAP A;  2V1M A;  1HNC A;  4EKZ A;  3J7Y k;  2I4A A;  2CT6 A;  4IP6 A;  1V9W A;  2HNL A;  1O6J A;  2VCQ A;  4KDU A;  1IYI A;  4ZB8 A;  3HKR A;  5AN1 A;  3I6A A;  2IMD A;  1AQV A;  4GQF A;  3TGZ A;  2RII A;  3UMA A;  4KUN A;  1E6B A;  3IBH A;  3VLN A;  1SK1 A;  2VM1 A;  3MAK A;  1ZYE A;  1XOB A;  2LRN A;  4HQZ A;  5GSS A;  3ZVJ D;  2WJU A;  1AAZ A;  1OKT A;  3TRX A;  2H1G A;  4F03 A;  1O81 A;  4ML6 A;  2FWE A;  2X8G A;  1PQN A;  4TR0 A;  5ECN B;  1JZD A;  2RM5 A;  3NZN A;  2B6M A;  3G7J A;  1SJ6 A;  20GS A;  3C71 A;  3HXS A;  4OO4 A;  3KXO A;  3KMN A;  4J57 E;  1ERT A;  1Y25 A;  4OO5 A;  4X1U A;  3CTF A;  2N5B A;  2LJR A;  2YWO A;  5D73 A;  4LLR A;  2YV7 A;  1F37 A;  3IAM 2;  3D21 A;  3F8U A;  3IXR A;  4IJI A;  2MBT A;  1NM3 A;  3ZIV A;  1OAZ A;  1ZZY A;  3O76 A;  1SJZ A;  3GNJ A;  3TKS C;  1PN9 A;  3KMO A;  4DEJ A;  3FEU A;  2B1L A;  3D4M A;  4MZW A;  4BWQ A;  3F9U A;  2PU9 C;  1XCC A;  2VCX A;  3HVX A;  2OA7 A;  4K7O A;  2X8H A;  3IPZ A;  1W4V A;  5D9X A;  4GCI A;  1EEM A;  2DIZ A;  4GRF A;  5J9B A;  3RHC A;  2HLS A;  3FZ4 A;  2CX3 A;  1TJD A;  2KP2 A;  4NPB A;  2BTO T;  2A4V A;  3G7Y A;  1ZCP A;  3A5W A;  3TKR A;  2XPD A;  1Y6E A;  4BL7 B;  2H1B A;  2LTK A;  2PBJ A;  1X5E A;  3EU4 A;  2MMA A;  1TK5 B;  4EXJ A;  2PVO C;  2BMX A;  1G6Y A;  2YJH A;  3LYK A;  3AY8 A;  4LL4 B;  1XZO A;  1ZOF A;  1SL1 B;  2J23 A;  3HJO A;  4TXO B;  1GTU A;  2C3T A;  1TRS A;  4XHM A;  4RI7 A;  2KHP A;  2WS2 A;  3NOF A;  3LQ7 A;  1YKC A;  4MZB A;  2PUK C;  2PPT A;  2IME A;  2GLR A;  4K0G A;  1N8J A;  2TRC P;  3D22 A;  4EF0 A;  4BL7 A;  16GS A;  1OKD A;  3CRU A;  4MLY A;  1V57 A;  2JAD A;  2H73 A;  2L4C A;  4GST A;  4MDC A;  3LFL A;  4WR5 A;  2CV4 A;  1RW1 A;  4KF9 A;  4TXO A;  3IRA A;  4BPY A;  2B7K A;  5D9W A;  5G31 A;  1JHB A;  3VPQ A;  4V2N A;  5FWG A;  1XOA A;  3ZLP A;  2YJ7 A;  2FUG 2;  2PN8 A;  1M9A A;  2VO4 A;  4WBJ A;  3EVI A;  1ZMA A;  1XW6 A;  4MJA A;  4F0B A;  2I9H A;  1GSQ A;  8GSS A;  3WGD A;  4IN0 A;  3KTB A;  2H6X A;  4POK A;  5FT3 A;  2ON5 A;  2D2Z A;  1ERV A;  1NHY A;  1QK8 A;  2NVL A;  3BOA A;  2HSH A;  2L6C A;  2AV4 A;  1R26 A;  3KCM A;  1SEN A;  2HZF A;  4FYC A;  1T8E B;  4KW6 A;  2GQL A;  2DC5 A;  5F06 A;  2LQO A;  1J0F A;  4YQM A;  3ZFL A;  3ZL5 A;  1WOU A;  4F9Z A;  2GS3 A;  3IAS 2;  1EOH A;  3Q6O A;  1OC8 A;  1GSD A;  5ECM B;  3LXT A;  4N0Z A;  1UVZ A;  2OE3 A;  2E0Q A;  2C4J A;  2LRT A;  3VWX A;  1YJ6 A;  3RPP A;  2OAD A;  1DSB A;  3CXG A;  3E0U A;  3VWV A;  3KJY A;  3JCM L;  4GXZ A;  2V6K A;  2YAN A;  1M2B A;  3H79 A;  5DVB A;  3O6T A;  2C0E A;  3FRC A;  4JU5 A;  2L57 A;  1M99 A;  4V1A p;  4PX1 A;  4BVX B;  1J9B A;  2JL4 A;  2WCI A;  3D6I A;  2F3M A;  2OE0 A;  4TKY A;  4IS0 A;  4X0X A;  2P31 A;  5IM9 A;  1XBS A;  3APQ A;  3IC8 A;  2K8S A;  4WR4 A;  1M2A A;  5E59 A;  4MJE A;  2LST A;  4XCS A;  3RBT A;  2H72 A;  3I43 A;  2VL2 C;  5F0G A;  3EMX A;  2QC7 A;  3HYP A;  2V6O A;  2F9S A;  1W89 A;  1DE1 A;  1OVN A;  3UBK A;  1K0D A;  2FA8 A;  4TR3 A;  3L78 A;  2FHE A;  4BVX A;  2YWN A;  3CSH A;  1FO5 A;  4L5L A;  2VM2 A;  3KZQ A;  2HRF A;  4H86 A;  5D8I A;  4FH8 A;  1TU7 A;  2PGT A;  2GQK A;  5A5K A;  3KTL A;  12GS A;  2YN1 A;  4L8E A;  4MMM A;  3J7Y b;  2E2G A;  2H30 A;  2LJA A;  2FLS A;  1FOV A;  3N9J A;  1THX A;  4FYU A;  3DRN A;  4RQX A;  5F8B A;  4LL1 B;  3IDV A;  3G7I A;  1C72 A;  3TOU A;  3GN3 A;  3L9S A;  2WDU A;  1EV4 A;  5DAL A;  2G0F A;  5DQS A;  6GSV A;  2XBI A;  5B6M A;  2HQT A;  3IR4 A;  3CBU A;  5G2Z A;  1TU8 A;  1I5G A;  1BAY A;  4G10 A;  4HQS A;  1PMT A;  1U3I A;  4HI7 A;  2WZ9 A;  3CMI A;  2VCZ A;  3EYT A;  1B4Q A;  5CP1 A;  1OYJ A;  3GSS A;  2MMO A;  4AJ6 A;  4OFN A;  4ZBA A;  2H76 A;  3LEF A;  3QDN A;  5CRH A;  3WD6 A;  3EUR A;  5ECR B;  3U6V A;  2AB6 A;  3WT2 A;  2MMZ A;  22GS A;  3ZIJ A;  5JWO B;  4L0W A;  3FR6 A;  1SK0 A;  3OR5 A;  1TKD B;  2YV9 A;  1FB6 A;  1B48 A;  2C80 A;  3TRP A;  5IMF A;  1FW1 A;  4XS4 A;  4XS1 A;  2CZ3 A;  3UVT A;  4MJB A;  4G19 A;  3GMF A;  5B8A A;  3HHV A;  3K8N A;  1XXU A;  5D9V A;  2L59 A;  3MDK A;  2AYT A;  2IWT A;  4GWR A;  1TOF A;  1O8X A;  4EE0 A;  4AF2 A;  3D4T A;  5CRG A;  3HVV A;  2VD1 A;  4PQH A;  2A2S A;  1K3Y A;  4KND A;  3TUE A;  2JAC A;  1B4P A;  5GAN D;  1YDK A;  2JU5 A;  1JLW A;  1EGO A;  3P7X A;  4ZIL A;  1PGT A;  3QFA C;  1HYU A;  3W8J A;  10GS A;  4V2L A;  3MNG A;  2O7K A;  3ERG A;  2GZZ A;  4MF6 A;  1QUW A;  3CSI A;  2R3X A;  2REM A;  3UEM A;  3A2X A;  1V40 A;  4EDZ A;  1E2Y A;  5ELG A;  5HFG A;  1DBY A;  3A2V A;  3M8N A;  4PXO A;  4XTS A;  3F63 A;  2CVB A;  1A2M A;  3RHB A;  1ABA A;  2H1A A;  2DJ0 A;  3I9V 2;  1CQH A;  1B9X C;  1U6T A;  5L71 A;  2CQ9 A;  2YOI A;  2FNO A;  4O92 A;  3F0I A;  5H5Q A;  1QXH A;  3Q74 A;  1QQ2 A;  2B5Y A;  3FZ5 A;  5A4W A;  1HNB A;  3KD0 A;  1EGR A;  5KN2 A;  3ZVJ A;  1T00 A;  1ON4 A;  6GSX A;  1MD3 A;  1THO A;  1PRX A;  2GT6 A;  5FHI A;  4G0K A;  1FG4 A;  3F4R A;  4F82 A;  2GVP A;  3LYP A;  5DDL A;  1GRX A;  4V2M A;  1EV9 A;  4YQU A;  4HEA 2;  3DVX A;  1V98 A;  2AJQ B;  2XPE A;  2EIQ A;  5EPF A;  2ZCT A;  2V2G A;  4MH2 A;  3GST A;  2P5R A;  4LMV A;  4L0U A;  3M3M A;  5ECL B;  5GAP D;  1EOG A;  3GTU B;  4OCE A;  3ZML A;  4ZL7 A;  2NDO A;  2EIO A;  4XIH A;  2CA8 A;  4K1F A;  3IV4 A;  3ZRD A;  5E4W A;  5HR1 A;  4G0L A;  1FVK A;  1AC1 A;  3L0H A;  1T3B A;  4PNF A;  1MDJ A;  1Q4J A;  3ZZX A;  5G5F A;  5IO2 A;  18GS A;  3F3Q A;  1FVJ A;  1Z7P A;  4XRA A;  3O3T A;  3ME7 A;  4CW9 A;  5B8B A;  2CX4 A;  4G9H A;  4HZ2 A;  2C3N A;  4NHW A;  3VPT A;  5ECP B;  3GTU A;  5DCH A;  4MK3 A;  1YF1 A;  4KCA A;  1EWX A;  4QL9 A;  3EC3 A;  6GSW A;  3VFI A;  1KBN A;  1LBK A;  3CYN A;  1WIK A;  1JLV A;  4USS A;  5LNK e;  1SK2 A;  2H0H A;  2DJ3 A;  1YKA A;  1USB A;  3IE3 A;  1NHO A;  1SKS B;  4G2E A;  2X99 A;  1A24 A;  2ALB A;  2LEG A;  2YZH A;  5J4U A;  1XW9 A;  5B7C A;  2LV3 A;  4E8H A;  3TJB A;  2LJK A;  1K3O A;  4MF5 A;  5G1K A;  2IJY A;  5J9C A;  4I8B A;  1QFN A;  4N0V A;  3H8Q A;  2JZS A;  2HZE B;  3TDG A;  3ZRE A;  3ZFB A;  5ID2 B;  2VLU A;  1GL8 A;  4POB A;  3GKX A;  4IBP A;  4HU7 A;  1XVW A;  2R4V A;  1G6W A;  2VLT A;  14GS A;  5AIX A;  3L9U A;  3VK9 A;  3W8S A;  3BJ5 A;  5EVO A;  1TRV A;  4WKW A;  6GSU A;  2LNT A;  5CYY A;  1TXX A;  1VF4 A;  3GL3 A;  1ZYQ B;  1EP7 A;  1SL2 B;  2V32 A;  2M80 A;  5DQY A;  4X43 A;  2IN3 A;  5ECO B;  4ZB6 A;  1ZL9 A;  3SWL A;  1K0N A;  4TRX A;  2CZ2 A;  2R37 A;  2BJX A;  3F4S A;  2K9F A;  2HFD A;  2HZE A;  4K7I A;  1Z7R A;  5ID2 A;  2GZP A;  3VI7 A;  2ON7 A;  2KUC A;  3FW2 A;  4KAE A;  1R4W A;  3GYK A;  5ECS A;  2DML A;  4EL1 A;  1GTA A;  3CTG A;  1FB0 A; 
#chains in the Genus database with same CATH topology
 2IL3 A;  1UN2 A;  4IP1 A;  4HJM A;  3QPM A;  1R7H A;  3D5J A;  2X8C A;  2H70 A;  1M2D A;  1TW9 A;  3VI5 A;  5IMZ A;  4O5R A;  2I3Y A;  2H0I A;  2NTO A;  2VIM A;  4HJ2 A;  4N3Z A;  5J47 A;  3FYG A;  4ML1 A;  4RUV A;  5IPH A;  3HDC A;  3P8W A;  2F8F A;  4IW9 A;  2F8A A;  3H1N A;  2VAF A;  3I69 A;  5LD0 A;  4G0I A;  2FA4 A;  4KDY A;  2XBQ A;  3IK9 A;  1K0M A;  3GH6 A;  3TB2 A;  5F07 A;  4IKH A;  3UAR A;  2OKA A;  4WEY A;  4GF0 A;  3F6F A;  2H0G A;  4Z2T A;  1XWA A;  5JCU A;  2LNS A;  2HYX A;  4GTU A;  1KNG A;  4ZBB A;  2GSS A;  2X64 A;  3KM6 A;  1TTZ A;  4PNG A;  3FKF A;  2M46 A;  4ID0 A;  4ICY A;  4EUY A;  13GS A;  4ECB A;  3TKS A;  3KH9 A;  2HRK B;  3FY7 A;  3N5O A;  1JFU A;  2GQM A;  3C1R A;  1VF1 A;  4MNN A;  1A0F A;  4IGJ A;  4I2T A;  4K2X A;  3UJ1 A;  5B6N A;  1TRU A;  4O7H A;  4TXV A;  3VUR A;  1ACV A;  1K3L A;  1FAA A;  3TJG A;  2RUE A;  3EE2 A;  1YZX A;  2IMK A;  5J4Y A;  1GUM A;  2C8U A;  3U5R E;  3IOS A;  5AIS A;  2HSY A;  1RQM A;  5A4V A;  2C1Y A;  3QD9 A;  4V1A g;  2CAQ A;  1Z6M A;  1O8W A;  1GSU A;  3F3R A;  2WGR A;  4KA0 A;  2HRK A;  5CNW A;  1X9W B;  4GQC A;  1BX9 A;  3Q19 A;  5D93 A;  2RLI A;  5ABR A;  3LG6 A;  1U3A A;  1G7E A;  4NAX A;  1QMV A;  3QAG A;  3GL5 A;  2VCW A;  1IYH A;  2FWH A;  1MDI A;  1T4Y A;  2RUF A;  1U88 A;  3HCZ A;  4Q5Q A;  5KEJ A;  3Q18 A;  1B9Y C;  1GH2 A;  1SL0 B;  3IHQ A;  2J9H A;  2R5G A;  1M7T A;  3KP8 A;  1X9S B;  1OE8 A;  3TKS E;  2IPA A;  3R3E A;  3FZA A;  2DLX A;  1SD9 A;  1Z3E A;  3TRQ A;  2EC4 A;  1A8Y A;  4RQR A;  4IEL A;  4MA9 A;  1PX7 A;  5GZZ B;  1TRW A;  2YWM A;  3LGC A;  4XS6 A;  4Z7X A;  1VGL A;  1JZW A;  1Z9H A;  4KDX A;  4I97 A;  4ECC A;  2DJJ A;  1GUK A;  4CHS A;  2CVK A;  7GSS A;  1SYR A;  1GSY A;  2KP1 A;  2MZC A;  5ELA A;  5JWR B;  3GKK A;  2C3Q A;  1GLP A;  5EY6 A;  4JE1 A;  3M9K A;  1XG8 A;  3LJR A;  2FWG A;  1VF3 A;  4J56 E;  5JWQ B;  3SBC A;  2B5X A;  5AIV A;  4OD7 A;  2L5O A;  1SD8 A;  2KLX A;  1BJX A;  3IK7 A;  3BD2 A;  1S3R A;  1XFL A;  4Q5N A;  5KOW A;  3LWA A;  4K5R A;  1A0R P;  1S4B P;  2HSN B;  2HI7 A;  3HVN A;  3UVH A;  1OC3 A;  5G5E A;  2OT3 A;  1X0R A;  1F3A A;  3FR9 A;  2C0D A;  5DAK B;  1X9M B;  2K6V A;  3P90 A;  4JRR A;  3QAW A;  1SYX A;  1VRS D;  2GDR A;  4KH7 A;  2YCD A;  6GSY A;  2VD0 A;  5CAX A;  4FXY P;  4KB3 A;  4FIW A;  3TJK A;  2PER A;  3GUS A;  4WBR D;  4HZ4 A;  1Z6N A;  4K7N A;  1GNW A;  4KSM A;  4JR4 A;  1GTB A;  2DMM A;  2EFH A;  3R2Q A;  3A3T A;  1XVQ A;  3A5I A;  2HSN A;  3A2W A;  4WF5 A;  5DAK A;  2FGX A;  2RM6 A;  4BWS A;  2HXK A;  2FY6 A;  1Z5Y E;  1N2A A;  3TJJ A;  4K9Z A;  3FZ9 A;  4IQ1 A;  4ECI A;  5IMC A;  4ZL8 A;  2VCV A;  2H6Y A;  3W6G A;  4JZQ A;  1DE2 A;  1EEJ A;  4ILF A;  2QKE A;  1A8L A;  2L5L A;  1M9B A;  3C1S A;  1MDK A;  2YNX A;  4ULX A;  3M0F A;  3DYR A;  1HNA A;  1TI3 A;  2GST A;  1AUC A;  4ZIJ A;  4TR4 A;  3TCO A;  3ZTL A;  1O73 A;  5DCG A;  5COH A;  2XC2 A;  3DWV A;  3KEB A;  5CO3 A;  3GRX A;  1BED A;  5G1L A;  4DSR A;  3PR8 A;  3HJP A;  1M3J A;  2VL2 A;  4ZXG A;  1GSS A;  5EL8 A;  1FHE A;  5D96 A;  4WF4 A;  5BMU B;  1UC7 A;  3GHA A;  5A5H B;  3F4T A;  2N5A A;  5HR0 A;  1XWK A;  4N11 A;  4IQA A;  9GSS A;  2C0G A;  1SU9 A;  2K18 A;  1V2A A;  3D0Z A;  1HD2 A;  3GX8 A;  1K0C A;  1ML6 A;  3KGK A;  1TK0 B;  3FHK A;  3DVW A;  4MCU A;  2IMF A;  1MD4 A;  2VCT A;  1TP9 A;  4MZC A;  1GTI A;  4IJ3 A;  2R0P A;  3IA1 A;  1PSQ A;  1G0T A;  2A4H A;  5KN1 A;  2GTU A;  2JZR A;  4ISD A;  1YQ1 A;  5JCG A;  2VLV A;  1J08 A;  5ECI B;  1K0O A;  2VL9 A;  4WET A;  3RDW A;  2I81 A;  5DJM A;  5BMU A;  2QSI A;  3EWL A;  4RI6 A;  5DBQ A;  3ERW A;  5A5H A;  1A2J A;  1BQ7 A;  6GST A;  1CQG A;  4PTS A;  3TOT A;  3DXB A;  2OBK A;  5H5S A;  3MWH A;  4PHZ C;  2LUS A;  4PQ1 A;  1WRY A;  4NHZ A;  4FQU A;  2DIY A;  1GSF A;  2GSQ A;  4MJC A;  3UAP A;  1T7P B;  4E8E A;  4N30 A;  1XWG A;  4AI6 A;  1A23 A;  4NV5 A;  1WWJ A;  2IMI A;  5J41 A;  4TN8 A;  1A2L A;  3GKN A;  3KH7 A;  3ZYW A;  4KGI A;  3QR6 A;  2VUP A;  2AAW A;  4YH2 A;  3APS A;  2K8V A;  3PPU A;  1OC9 B;  3L9V A;  1YF0 A;  4HDE A;  1T4Z A;  2O87 A;  1XWB A;  4EDY A;  3HD5 A;  3ZMK A;  2VL3 A;  1ILO A;  2WW1 A;  1PKW A;  4BA7 A;  2B5E A;  1UA5 A;  3APO A;  5C04 A;  3DKS A;  4A5P A;  5HFK A;  2ZNM A;  1NSW A;  3E9J B;  4TOP A;  3CSJ A;  1PD2 1;  3ERF A;  4GLT A;  2JSZ A;  2C0F A;  4MPF A;  1TXU A;  3E3E A;  2TIR A;  4POL A;  3LXZ A;  2L4Q A;  3FK8 A;  4YAV A;  1GP1 A;  5IPG A;  2YZU A;  1OC9 A;  2L6D A;  1B8X A;  4ZBD A;  3C7M A;  4CDO A;  4PUA A;  2QGV A;  4QQ7 A;  4POM A;  3M1G A;  1S3D A;  1MTC A;  1GUH A;  4PQI A;  4I5Q A;  5CRW A;  1GUL A;  3V1W A;  5IQY A;  2DBC A;  5ECQ B;  6GSS A;  2OAC A;  1ERU A;  2B3S A;  1K0A A;  3TKP A;  5CRD A;  5HQP A;  2YPM A;  1M0U A;  4L5O A;  2EFC A;  4FYB A;  2IFQ B;  2R0C A;  5IMD A;  3TKQ A;  3LSZ A;  2F51 A;  3ISO A;  1O7U A;  4NV2 A;  3UL3 A;  2YWI A;  2O89 A;  4GDF A;  2H1D A;  2XHF A;  4JED A;  1R5A A;  5IO0 A;  1RK4 A;  2WRT A;  3DIE A;  2ES7 A;  1EP8 A;  3MIX A;  3TU3 B;  1GWC A;  5IOW A;  1X5C A;  4KE3 A;  1WJK A;  2H74 A;  4EVM A;  5CRE A;  1S3C A;  3KP9 A;  2IFQ A;  4KCE A;  3WGX A;  4I2U A;  1S3A A;  2A2R A;  3HA9 A;  19GS A;  3QFB C;  4DSQ A;  3DGQ A;  1AW9 A;  4AJ7 A;  1V58 A;  4ZL9 A;  3G9B A;  3P2A A;  3HJM A;  1GLQ A;  1WMJ A;  4HOJ A;  4LA1 A;  5A4U A;  4W66 A;  4OWY A;  3HVS A;  2R6K A;  4JR6 A;  5H5R A;  2GGT A;  1ZGN A;  2JSY A;  2KOK A;  3BCI A;  2HE3 A;  2GSR A;  5ECK B;  1F6M C;  4Q5F A;  1JZR A;  2P0G A;  3FMW A;  2E2M A;  4IVF A;  1G7O A;  4OFT A;  2WUL A;  2O8V B;  2QA1 A;  1URM A;  1LU4 A;  2WFC A;  3DML A;  5HR3 A;  1PL1 A;  3M9J A;  2DJ2 A;  4NMU A;  4YQV A;  1XIY A;  3WGE A;  2HT9 A;  2JZT A;  2LKU A;  5IOX A;  3F6D A;  4TW5 A;  4MH3 A;  2WVZ A;  4HU9 A;  2UZ8 A;  1HQO A;  2DKI A;  4F2I A;  1YEP A;  3UOM A;  1SJI A;  1F9M A;  1PL2 A;  1SKR B;  4PUF C;  4DVC A;  1SVL A;  3US3 A;  3RAZ A;  4KX4 A;  1F3B A;  3VWU A;  2CVD A;  2HRN A;  5G30 A;  5A1N B;  1AQW A;  4MF7 A;  2OE1 A;  1YEX A;  2H75 A;  4HSC X;  2H71 A;  3BBY A;  2DJ1 A;  3TJF A;  2OJL A;  3H93 A;  4DSS B;  2H1L A;  1KTE A;  1TK8 B;  2MMN A;  2P5Q A;  3EIN A;  2O36 A;  1SKW B;  3C73 A;  4TR1 B;  2PVQ A;  3LOR A;  1F2E A;  2H01 A;  3HY2 A;  4JBB A;  4N10 A;  2O85 A;  4KSO A;  2LQQ A;  2I1U A;  2WVY A;  4ACS A;  1GNE A;  1PA3 A;  1PKZ A;  4BVY B;  3WT1 A;  5A1N A;  3GUR A;  4J2F A;  3GH9 A;  5DAL B;  3DD3 A;  5J5N A;  2UV8 G;  3GKM A;  1H75 A;  1U87 A;  3DEX A;  4DSS A;  3IC4 A;  2H19 A;  3UBL A;  3GV1 A;  4AJ8 A;  2M72 A;  3RPN A;  2AHE A;  4F0C A;  3CQF A;  2PMT A;  4TR1 A;  1XPV A;  1MEK A;  1VF2 A;  2CAI A;  1WE0 A;  11GS A;  1KEB A;  4MP4 A;  4PGT A;  4BVY A;  4P3Y B;  2PWJ A;  3GIX A;  3WYW A;  4HUA A;  3QAV A;  1T1V A;  2H6Z A;  3PH9 A;  1BG5 A;  2WB9 A;  5DJL A;  4ZB9 A;  4PUR A;  2LS5 A;  1Q98 A;  1ZYP A;  4ECJ A;  3NIV A;  4AGS A;  2GZY A;  3GX0 A;  4EIP A;  2FWF A;  5KN3 A;  4Q5R A;  3KIJ A;  4D73 B;  3BCK A;  2E7P A;  1AXD A;  3C8E A;  3L4N A;  4XS4 B;  3UIW A;  3ZIT A;  2EIR A;  1QGV A;  2V41 A;  4K6X A;  2R2J A;  1DUG A;  3CRT A;  1AQX A;  1AIU A;  3ED3 A;  5JCW A;  3S9F A;  4MAB A;  4OFM A;  4MPG A;  5J3R A;  5HR2 A;  1TI1 A;  3HZ8 A;  1WPI A;  5IMA A;  4HS1 A;  2NPB A;  1O85 A;  3QOU A;  4WXT A;  4GSS A;  1NW2 A;  2IIY A;  4Z2U A;  2LRC A;  1ERW A;  2DSA A;  2OBI A;  4XRD A;  2X4A A;  1EZK A;  4OMV A;  4D73 A;  4EO3 A;  5F05 A;  2HSM B;  3FR3 A;  3H4K A;  4QL7 A;  3GA4 A;  1R5P A;  3HZ4 A;  3IHG A;  1GSE A;  5GST A;  2MBS A;  2Z9S A;  4FO5 A;  2ZUP A;  1YEW C;  2FCH A;  4K2D A;  4K8M A;  5ENU A;  1PX6 A;  3GFK A;  3QCP A;  2B1K A;  2TRX A;  1I1I P;  3PIN A;  1YY7 A;  4NXI A;  5INY A;  17GS A;  4EC0 A;  5AGY A;  4O32 A;  1TDI A;  2VOC A;  4K0N A;  2B7J A;  2HRA A;  5IMV A;  2DKH A;  3EU3 A;  2FD3 A;  5IIZ A;  2O3E A;  2HSM A;  1K0B A;  1WP0 A;  3PGT A;  5HFI A;  1XW5 A;  4GSN A;  4TVE A;  1JZO A;  4OCF A;  1H4O A;  2GT5 A;  5ECH B;  1I9D A;  2MYG A;  4I6X A;  2NBS A;  4E68 A;  4NWY A;  3QMX A;  5LCZ A;  1ST9 A;  2H8L A;  1BYE A;  2AUV A;  2N5F A;  4IHU A;  3EMP A;  5D9T A;  1LJR A;  1X5D A;  3MSZ A;  5C00 A;  5KN0 A;  1OE7 A;  2G2Q A;  3VWW A;  2H66 A;  3ME8 A;  2DJK A;  4LMW A;  2YP6 A;  1XWC A;  4YAP A;  2V1M A;  1HNC A;  4EKZ A;  3J7Y k;  2I4A A;  2CT6 A;  4IP6 A;  1V9W A;  2HNL A;  1O6J A;  2VCQ A;  4KDU A;  1IYI A;  4ZB8 A;  3HKR A;  5AN1 A;  3I6A A;  2IMD A;  1AQV A;  4GQF A;  3TGZ A;  2RII A;  3UMA A;  4KUN A;  1E6B A;  3IBH A;  3VLN A;  1SK1 A;  2VM1 A;  3MAK A;  1ZYE A;  1XOB A;  2LRN A;  4AKX B;  4HQZ A;  5GSS A;  3ZVJ D;  2WJU A;  1AAZ A;  1OKT A;  3TRX A;  2H1G A;  4F03 A;  1O81 A;  4ML6 A;  2FWE A;  2X8G A;  1PQN A;  4TR0 A;  5ECN B;  1JZD A;  2RM5 A;  3NZN A;  2B6M A;  3G7J A;  1SJ6 A;  20GS A;  3C71 A;  3HXS A;  4OO4 A;  1N25 A;  3KXO A;  3KMN A;  4J57 E;  1ERT A;  1Y25 A;  4OO5 A;  4X1U A;  3CTF A;  2N5B A;  2LJR A;  2YWO A;  5D73 A;  4LLR A;  2YV7 A;  1F37 A;  3IAM 2;  3D21 A;  3F8U A;  3IXR A;  4IJI A;  2MBT A;  1NM3 A;  3ZIV A;  1OAZ A;  1ZZY A;  3O76 A;  1SJZ A;  3GNJ A;  3TKS C;  1PN9 A;  3KMO A;  4DEJ A;  3FEU A;  2B1L A;  3D4M A;  4MZW A;  4BWQ A;  3F9U A;  2PU9 C;  1XCC A;  2VCX A;  3HVX A;  2OA7 A;  4K7O A;  2X8H A;  3IPZ A;  1W4V A;  5D9X A;  4GCI A;  1PFO A;  1EEM A;  2DIZ A;  4GRF A;  5J9B A;  3RHC A;  2HLS A;  3FZ4 A;  2CX3 A;  1TJD A;  2KP2 A;  4NPB A;  2BTO T;  2A4V A;  3G7Y A;  1ZCP A;  3A5W A;  3TKR A;  2XPD A;  1Y6E A;  4AKG A;  4BL7 B;  2H1B A;  2LTK A;  2PBJ A;  1X5E A;  3EU4 A;  2MMA A;  1TK5 B;  3CHX C;  4EXJ A;  2PVO C;  2BMX A;  1G6Y A;  2YJH A;  3LYK A;  3AY8 A;  4LL4 B;  1XZO A;  1ZOF A;  1SL1 B;  2J23 A;  3HJO A;  4TXO B;  1GTU A;  2C3T A;  1TRS A;  4XHM A;  4RI7 A;  2KHP A;  2WS2 A;  3NOF A;  3LQ7 A;  1YKC A;  4MZB A;  2PUK C;  2PPT A;  2IME A;  2GLR A;  4K0G A;  1N8J A;  2TRC P;  3D22 A;  3RFR C;  4EF0 A;  4BL7 A;  16GS A;  1OKD A;  3CRU A;  1YVL A;  4MLY A;  2WW3 A;  1V57 A;  2JAD A;  2H73 A;  2L4C A;  4GST A;  4MDC A;  4X4J A;  3LFL A;  4WR5 A;  2CV4 A;  1RW1 A;  4KF9 A;  4TXO A;  3IRA A;  4BPY A;  2B7K A;  4PI2 C;  5D9W A;  5G31 A;  2VKZ G;  1JHB A;  3VPQ A;  2A2P A;  4V2N A;  5FWG A;  1XOA A;  3ZLP A;  4BIK A;  2YJ7 A;  2R0G A;  2FUG 2;  2PN8 A;  1M9A A;  2VO4 A;  1Y1U A;  4WBJ A;  3EVI A;  1ZMA A;  1XW6 A;  4MJA A;  4F0B A;  2I9H A;  1GSQ A;  8GSS A;  3WGD A;  4IN0 A;  3KTB A;  2H6X A;  4POK A;  5FT3 A;  2ON5 A;  2WW0 A;  2D2Z A;  1ERV A;  1NHY A;  1QK8 A;  2NVL A;  3BOA A;  2HSH A;  2L6C A;  2AV4 A;  1R26 A;  3KCM A;  1SEN A;  2HZF A;  4FYC A;  1T8E B;  4KW6 A;  2GQL A;  2DC5 A;  5F06 A;  2LQO A;  1J0F A;  4YQM A;  3ZFL A;  3ZL5 A;  1WOU A;  5A34 B;  4F9Z A;  2GS3 A;  2O5V A;  3IAS 2;  1EOH A;  2WW2 A;  3Q6O A;  1OC8 A;  1GSD A;  5ECM B;  3LXT A;  4ZB7 A;  4N0Z A;  1UVZ A;  2OE3 A;  2E0Q A;  2C4J A;  2LRT A;  3VWX A;  1YJ6 A;  3RPP A;  2QA2 A;  2OAD A;  1DSB A;  3CXG A;  1ZYN A;  3E0U A;  3VWV A;  3KJY A;  3JCM L;  4GXZ A;  2V6K A;  2YAN A;  1M2B A;  3H79 A;  5DVB A;  3O6T A;  2C0E A;  3FRC A;  4JU5 A;  2L57 A;  1M99 A;  5BRT A;  4V1A p;  4PX1 A;  4BVX B;  5A34 A;  1J9B A;  2JL4 A;  2WCI A;  3D6I A;  2F3M A;  2OE0 A;  4TKY A;  4IS0 A;  4X0X A;  2P31 A;  5IM9 A;  1XBS A;  3APQ A;  3IC8 A;  2K8S A;  4WR4 A;  1M2A A;  5E59 A;  4MJE A;  2LST A;  4XCS A;  3RBT A;  2H72 A;  3I43 A;  2VL2 C;  5F0G A;  3EMX A;  2QC7 A;  3HYP A;  5J40 A;  4AKH A;  2V6O A;  2EFE A;  2F9S A;  1W89 A;  1DE1 A;  3EPT A;  1OVN A;  1SVO A;  1K0D A;  3UBK A;  2FA8 A;  4TR3 A;  3L78 A;  2FHE A;  4BVX A;  2YWN A;  3CSH A;  4CY6 A;  1FO5 A;  4L5L A;  2VM2 A;  3KZQ A;  2HRF A;  4H86 A;  5D8I A;  4FH8 A;  1TU7 A;  5KOX A;  2PGT A;  2GQK A;  5A5K A;  4CY8 A;  3KTL A;  12GS A;  2YN1 A;  2WVX B;  4L8E A;  4MMM A;  3J7Y b;  2E2G A;  4YKG A;  2H30 A;  2LJA A;  2FLS A;  1FOV A;  3N9J A;  1PN0 A;  1THX A;  4FYU A;  3DRN A;  4RQX A;  5F8B A;  4LL1 B;  3IDV A;  3G7I A;  1C72 A;  3TOU A;  3GN3 A;  3L9S A;  2WDU A;  1EV4 A;  5DAL A;  2G0F A;  5DQS A;  6GSV A;  2XBI A;  5B6M A;  2HQT A;  3IR4 A;  3CBU A;  5G2Z A;  1TU8 A;  1I5G A;  1BAY A;  4G10 A;  4HQS A;  1PMT A;  1U3I A;  4HI7 A;  2WVX A;  4EIQ A;  2WZ9 A;  3CMI A;  2VCZ A;  3EYT A;  1B4Q A;  5CP1 A;  1OYJ A;  3GSS A;  2MMO A;  4AJ6 A;  4OFN A;  4ZBA A;  2H76 A;  3LEF A;  3QDN A;  5CRH A;  3WD6 A;  3EUR A;  5ECR B;  3U6V A;  2AB6 A;  3WT2 A;  2MMZ A;  22GS A;  3ZIJ A;  5JWO B;  4L0W A;  3FR6 A;  1SK0 A;  3OR5 A;  1TKD B;  2YV9 A;  1FB6 A;  1B48 A;  2C80 A;  3TRP A;  5IMF A;  1FW1 A;  1M3I A;  1SVM A;  4XS4 A;  4XS1 A;  2CZ3 A;  3UVT A;  4MJB A;  4G19 A;  3GMF A;  5B8A A;  3HHV A;  3K8N A;  1XXU A;  5D9V A;  2L59 A;  3MDK A;  2AYT A;  2IWT A;  4GWR A;  1TOF A;  1O8X A;  4EE0 A;  4AF2 A;  3D4T A;  5CRG A;  3HVV A;  2VD1 A;  4PQH A;  2A2S A;  1K3Y A;  4KND A;  3TUE A;  2JAC A;  1B4P A;  5GAN D;  1YDK A;  2JU5 A;  1JLW A;  1EGO A;  3P7X A;  4ZIL A;  1PGT A;  3QFA C;  1HYU A;  3W8J A;  10GS A;  4V2L A;  3MNG A;  2O7K A;  3ERG A;  2GZZ A;  4MF6 A;  1QUW A;  3CSI A;  2R3X A;  2REM A;  3UEM A;  4G01 A;  3A2X A;  1V40 A;  4EDZ A;  1E2Y A;  5ELG A;  5HFG A;  1DBY A;  3A2V A;  3M8N A;  4PXO A;  4XTS A;  3F63 A;  2CVB A;  1A2M A;  3RHB A;  1ABA A;  2H1A A;  2WZS A;  4YKF A;  2DJ0 A;  3I9V 2;  1CQH A;  1B9X C;  1U6T A;  5L71 A;  2CQ9 A;  2YOI A;  2FNO A;  4O92 A;  1BG1 A;  3F0I A;  4O5U A;  5H5Q A;  1QXH A;  3Q74 A;  1QQ2 A;  2B5Y A;  3FZ5 A;  5A4W A;  1HNB A;  3KD0 A;  1EGR A;  5KN2 A;  3ZVJ A;  3HMJ G;  1T00 A;  3MYD A;  1ON4 A;  6GSX A;  1MD3 A;  1THO A;  1PRX A;  2GT6 A;  5FHI A;  4G0K A;  1FG4 A;  3F4R A;  4F82 A;  4AKI A;  2GVP A;  3LYP A;  5DDL A;  1GRX A;  4V2M A;  1EV9 A;  4YQU A;  4HEA 2;  4K5S A;  3DVX A;  1V98 A;  2AJQ B;  2XPE A;  2EIQ A;  4QMK A;  5EPF A;  2ZCT A;  2V2G A;  4MH2 A;  3GST A;  2P5R A;  4LMV A;  4L0U A;  3M3M A;  5ECL B;  5GAP D;  1EOG A;  3GTU B;  4OCE A;  3ZML A;  4ZL7 A;  2NDO A;  2EIO A;  4XIH A;  2CA8 A;  4K1F A;  3IV4 A;  3ZRD A;  5E4W A;  5HR1 A;  4G0L A;  1FVK A;  1AC1 A;  3L0H A;  1T3B A;  4PNF A;  1MDJ A;  1Q4J A;  3CWG A;  3ZZX A;  5G5F A;  5IO2 A;  18GS A;  3F3Q A;  1FVJ A;  1Z7P A;  4XRA A;  3O3T A;  3ME7 A;  4CW9 A;  5B8B A;  2CX4 A;  4G9H A;  4HZ2 A;  2C3N A;  2EFD A;  4NHW A;  3VPT A;  5ECP B;  3GTU A;  5DCH A;  4MK3 A;  1YF1 A;  4KCA A;  1EWX A;  4QL9 A;  3EC3 A;  6GSW A;  3VFI A;  1KBN A;  1LBK A;  3CYN A;  1WIK A;  1JLV A;  4USS A;  5LNK e;  1BF5 A;  1SK2 A;  2H0H A;  2DJ3 A;  1YKA A;  1USB A;  3IE3 A;  1NHO A;  1SKS B;  4G2E A;  2X99 A;  1A24 A;  4Z2R A;  2ALB A;  2LEG A;  2YZH A;  5J4U A;  1XW9 A;  5B7C A;  2LV3 A;  4E8H A;  3TJB A;  2LJK A;  1K3O A;  4MF5 A;  5G1K A;  2IJY A;  5J9C A;  4I8B A;  3RGB C;  1QFN A;  4N0V A;  3H8Q A;  2JZS A;  2HZE B;  3TDG A;  3ZRE A;  3ZFB A;  5ID2 B;  2VLU A;  1GL8 A;  4POB A;  3GKX A;  4IBP A;  4HU7 A;  1XVW A;  2R4V A;  5J4V A;  1G6W A;  2VLT A;  14GS A;  5AIX A;  3L9U A;  3VK9 A;  3W8S A;  3BJ5 A;  5EVO A;  1TRV A;  4WKW A;  6GSU A;  2LNT A;  5CYY A;  1TXX A;  1VF4 A;  3GL3 A;  1ZYQ B;  1EP7 A;  1SL2 B;  2V32 A;  2M80 A;  3LW9 A;  5DQY A;  4X43 A;  2IN3 A;  5ECO B;  4ZB6 A;  1ZL9 A;  3SWL A;  1K0N A;  4TRX A;  2CZ2 A;  2R37 A;  2BJX A;  3F4S A;  2K9F A;  2HFD A;  2HZE A;  4K7I A;  2X49 A;  1Z7R A;  4O5Q A;  5ID2 A;  2GZP A;  3VI7 A;  2ON7 A;  2KUC A;  3FW2 A;  4KAE A;  1R4W A;  3GYK A;  4PI0 C;  5ECS A;  2DML A;  4EL1 A;  1GTA A;  1FOH A;  3CTG A;  1FB0 A; 
#chains in the Genus database with same CATH homology
 2IL3 A;  1UN2 A;  4IP1 A;  4HJM A;  3QPM A;  1R7H A;  3D5J A;  2X8C A;  2H70 A;  1M2D A;  1TW9 A;  3VI5 A;  5IMZ A;  4O5R A;  2I3Y A;  2H0I A;  2NTO A;  2VIM A;  4HJ2 A;  4N3Z A;  5J47 A;  3FYG A;  4ML1 A;  4RUV A;  5IPH A;  3HDC A;  3P8W A;  2F8F A;  4IW9 A;  2F8A A;  3H1N A;  2VAF A;  3I69 A;  5LD0 A;  4G0I A;  2FA4 A;  4KDY A;  2XBQ A;  3IK9 A;  1K0M A;  3GH6 A;  3TB2 A;  5F07 A;  4IKH A;  3UAR A;  2OKA A;  4WEY A;  4GF0 A;  3F6F A;  2H0G A;  4Z2T A;  1XWA A;  5JCU A;  2LNS A;  2HYX A;  4GTU A;  1KNG A;  4ZBB A;  2GSS A;  2X64 A;  3KM6 A;  1TTZ A;  4PNG A;  3FKF A;  2M46 A;  4ID0 A;  4ICY A;  4EUY A;  13GS A;  4ECB A;  3TKS A;  3KH9 A;  2HRK B;  3FY7 A;  3N5O A;  1JFU A;  2GQM A;  3C1R A;  1VF1 A;  4MNN A;  1A0F A;  4IGJ A;  4I2T A;  4K2X A;  3UJ1 A;  5B6N A;  1TRU A;  4O7H A;  4TXV A;  3VUR A;  1ACV A;  1K3L A;  1FAA A;  3TJG A;  2RUE A;  3EE2 A;  1YZX A;  2IMK A;  5J4Y A;  1GUM A;  2C8U A;  3U5R E;  3IOS A;  5AIS A;  2HSY A;  1RQM A;  5A4V A;  2C1Y A;  3QD9 A;  4V1A g;  2CAQ A;  1Z6M A;  1O8W A;  1GSU A;  3F3R A;  2WGR A;  4KA0 A;  2HRK A;  5CNW A;  1X9W B;  4GQC A;  1BX9 A;  3Q19 A;  5D93 A;  2RLI A;  5ABR A;  3LG6 A;  1U3A A;  1G7E A;  4NAX A;  1QMV A;  3QAG A;  3GL5 A;  2VCW A;  1IYH A;  2FWH A;  1MDI A;  1T4Y A;  2RUF A;  1U88 A;  3HCZ A;  4Q5Q A;  5KEJ A;  3Q18 A;  1B9Y C;  1GH2 A;  1SL0 B;  3IHQ A;  2J9H A;  2R5G A;  1M7T A;  3KP8 A;  1X9S B;  1OE8 A;  3TKS E;  2IPA A;  3R3E A;  3FZA A;  2DLX A;  1SD9 A;  1Z3E A;  3TRQ A;  2EC4 A;  1A8Y A;  4RQR A;  4IEL A;  4MA9 A;  1PX7 A;  5GZZ B;  1TRW A;  2YWM A;  3LGC A;  4XS6 A;  4Z7X A;  1VGL A;  1JZW A;  1Z9H A;  4KDX A;  4I97 A;  4ECC A;  2DJJ A;  1GUK A;  4CHS A;  2CVK A;  7GSS A;  1SYR A;  1GSY A;  2KP1 A;  2MZC A;  5ELA A;  5JWR B;  3GKK A;  2C3Q A;  1GLP A;  5EY6 A;  4JE1 A;  3M9K A;  3LJR A;  2FWG A;  1VF3 A;  4J56 E;  5JWQ B;  3SBC A;  2B5X A;  5AIV A;  4OD7 A;  2L5O A;  1SD8 A;  2KLX A;  1BJX A;  3IK7 A;  3BD2 A;  1XFL A;  4Q5N A;  5KOW A;  3LWA A;  4K5R A;  1A0R P;  2HSN B;  2HI7 A;  3UVH A;  1OC3 A;  5G5E A;  2OT3 A;  1X0R A;  1F3A A;  3FR9 A;  2C0D A;  5DAK B;  1X9M B;  2K6V A;  3P90 A;  4JRR A;  3QAW A;  1SYX A;  1VRS D;  2GDR A;  4KH7 A;  2YCD A;  6GSY A;  2VD0 A;  5CAX A;  4KB3 A;  4FIW A;  3TJK A;  2PER A;  3GUS A;  4WBR D;  4HZ4 A;  1Z6N A;  4K7N A;  1GNW A;  4KSM A;  4JR4 A;  1GTB A;  2DMM A;  2EFH A;  3R2Q A;  3A3T A;  1XVQ A;  3A5I A;  2HSN A;  3A2W A;  4WF5 A;  5DAK A;  2FGX A;  2RM6 A;  4BWS A;  2HXK A;  2FY6 A;  1Z5Y E;  1N2A A;  3TJJ A;  4K9Z A;  3FZ9 A;  4IQ1 A;  4ECI A;  5IMC A;  4ZL8 A;  2VCV A;  2H6Y A;  3W6G A;  4JZQ A;  1DE2 A;  1EEJ A;  4ILF A;  2QKE A;  1A8L A;  2L5L A;  1M9B A;  3C1S A;  1MDK A;  2YNX A;  4ULX A;  3M0F A;  3DYR A;  1HNA A;  1TI3 A;  2GST A;  1AUC A;  4ZIJ A;  4TR4 A;  3TCO A;  3ZTL A;  1O73 A;  5DCG A;  5COH A;  2XC2 A;  3DWV A;  3KEB A;  5CO3 A;  3GRX A;  1BED A;  5G1L A;  4DSR A;  3PR8 A;  3HJP A;  2VL2 A;  4ZXG A;  1GSS A;  5EL8 A;  1FHE A;  5D96 A;  4WF4 A;  5BMU B;  1UC7 A;  3GHA A;  5A5H B;  3F4T A;  2N5A A;  5HR0 A;  1XWK A;  4N11 A;  4IQA A;  9GSS A;  2C0G A;  1SU9 A;  2K18 A;  1V2A A;  3D0Z A;  1HD2 A;  3GX8 A;  1K0C A;  1ML6 A;  3KGK A;  1TK0 B;  3FHK A;  3DVW A;  4MCU A;  2IMF A;  1MD4 A;  2VCT A;  1TP9 A;  4MZC A;  1GTI A;  4IJ3 A;  2R0P A;  3IA1 A;  1PSQ A;  1G0T A;  2A4H A;  5KN1 A;  2GTU A;  2JZR A;  4ISD A;  1YQ1 A;  5JCG A;  2VLV A;  1J08 A;  5ECI B;  1K0O A;  2VL9 A;  4WET A;  3RDW A;  2I81 A;  5DJM A;  5BMU A;  2QSI A;  3EWL A;  4RI6 A;  5DBQ A;  3ERW A;  5A5H A;  1A2J A;  1BQ7 A;  6GST A;  1CQG A;  4PTS A;  3TOT A;  3DXB A;  2OBK A;  5H5S A;  3MWH A;  2LUS A;  4PQ1 A;  1WRY A;  4NHZ A;  4FQU A;  2DIY A;  1GSF A;  2GSQ A;  4MJC A;  3UAP A;  1T7P B;  4E8E A;  4N30 A;  1XWG A;  4AI6 A;  1A23 A;  4NV5 A;  1WWJ A;  2IMI A;  5J41 A;  4TN8 A;  1A2L A;  3GKN A;  3KH7 A;  3ZYW A;  4KGI A;  3QR6 A;  2VUP A;  2AAW A;  4YH2 A;  3APS A;  2K8V A;  3PPU A;  1OC9 B;  3L9V A;  1YF0 A;  4HDE A;  1T4Z A;  2O87 A;  1XWB A;  4EDY A;  3HD5 A;  3ZMK A;  2VL3 A;  1ILO A;  1PKW A;  4BA7 A;  2B5E A;  1UA5 A;  3APO A;  5C04 A;  3DKS A;  4A5P A;  5HFK A;  2ZNM A;  1NSW A;  3E9J B;  4TOP A;  3CSJ A;  1PD2 1;  3ERF A;  4GLT A;  2JSZ A;  2C0F A;  4MPF A;  1TXU A;  3E3E A;  2TIR A;  4POL A;  3LXZ A;  2L4Q A;  3FK8 A;  4YAV A;  1GP1 A;  5IPG A;  2YZU A;  1OC9 A;  2L6D A;  1B8X A;  4ZBD A;  3C7M A;  4CDO A;  4PUA A;  2QGV A;  4QQ7 A;  4POM A;  3M1G A;  1S3D A;  1MTC A;  1GUH A;  4PQI A;  4I5Q A;  5CRW A;  1GUL A;  3V1W A;  5IQY A;  2DBC A;  5ECQ B;  6GSS A;  2OAC A;  1ERU A;  2B3S A;  1K0A A;  3TKP A;  5CRD A;  5HQP A;  2YPM A;  1M0U A;  4L5O A;  2EFC A;  4FYB A;  2IFQ B;  2R0C A;  5IMD A;  3TKQ A;  3LSZ A;  2F51 A;  3ISO A;  1O7U A;  4NV2 A;  3UL3 A;  2YWI A;  2O89 A;  4GDF A;  2H1D A;  2XHF A;  4JED A;  1R5A A;  5IO0 A;  1RK4 A;  2WRT A;  3DIE A;  2ES7 A;  1EP8 A;  3MIX A;  3TU3 B;  1GWC A;  5IOW A;  1X5C A;  4KE3 A;  1WJK A;  2H74 A;  4EVM A;  5CRE A;  1S3C A;  3KP9 A;  2IFQ A;  4KCE A;  3WGX A;  4I2U A;  1S3A A;  2A2R A;  3HA9 A;  19GS A;  3QFB C;  4DSQ A;  3DGQ A;  1AW9 A;  4AJ7 A;  1V58 A;  4ZL9 A;  3G9B A;  3P2A A;  3HJM A;  1GLQ A;  1WMJ A;  4HOJ A;  4LA1 A;  5A4U A;  4W66 A;  4OWY A;  3HVS A;  2R6K A;  4JR6 A;  5H5R A;  2GGT A;  1ZGN A;  2JSY A;  2KOK A;  3BCI A;  2HE3 A;  2GSR A;  5ECK B;  1F6M C;  4Q5F A;  1JZR A;  2P0G A;  3FMW A;  2E2M A;  4IVF A;  1G7O A;  4OFT A;  2WUL A;  2O8V B;  2QA1 A;  1URM A;  1LU4 A;  2WFC A;  3DML A;  5HR3 A;  1PL1 A;  3M9J A;  2DJ2 A;  4NMU A;  4YQV A;  1XIY A;  3WGE A;  2HT9 A;  2JZT A;  2LKU A;  5IOX A;  3F6D A;  4TW5 A;  4MH3 A;  4HU9 A;  2UZ8 A;  1HQO A;  2DKI A;  4F2I A;  1YEP A;  3UOM A;  1SJI A;  1F9M A;  1PL2 A;  1SKR B;  4PUF C;  4DVC A;  1SVL A;  3US3 A;  3RAZ A;  4KX4 A;  1F3B A;  3VWU A;  2CVD A;  2HRN A;  5G30 A;  5A1N B;  1AQW A;  4MF7 A;  2OE1 A;  1YEX A;  2H75 A;  2H71 A;  3BBY A;  2DJ1 A;  3TJF A;  2OJL A;  3H93 A;  4DSS B;  2H1L A;  1KTE A;  1TK8 B;  2MMN A;  2P5Q A;  3EIN A;  1SKW B;  3C73 A;  4TR1 B;  2PVQ A;  3LOR A;  1F2E A;  2H01 A;  3HY2 A;  4JBB A;  4N10 A;  2O85 A;  4KSO A;  2LQQ A;  2I1U A;  4ACS A;  1GNE A;  1PA3 A;  1PKZ A;  4BVY B;  3WT1 A;  5A1N A;  3GUR A;  4J2F A;  3GH9 A;  5DAL B;  3DD3 A;  5J5N A;  2UV8 G;  3GKM A;  1H75 A;  1U87 A;  3DEX A;  4DSS A;  3IC4 A;  2H19 A;  3UBL A;  3GV1 A;  4AJ8 A;  2M72 A;  3RPN A;  2AHE A;  4F0C A;  2PMT A;  4TR1 A;  1XPV A;  1MEK A;  1VF2 A;  2CAI A;  1WE0 A;  11GS A;  1KEB A;  4MP4 A;  4PGT A;  4BVY A;  4P3Y B;  2PWJ A;  3GIX A;  3WYW A;  4HUA A;  3QAV A;  1T1V A;  2H6Z A;  3PH9 A;  1BG5 A;  2WB9 A;  5DJL A;  4ZB9 A;  4PUR A;  2LS5 A;  1Q98 A;  1ZYP A;  4ECJ A;  3NIV A;  4AGS A;  2GZY A;  3GX0 A;  4EIP A;  2FWF A;  5KN3 A;  4Q5R A;  3KIJ A;  4D73 B;  3BCK A;  2E7P A;  1AXD A;  3C8E A;  3L4N A;  4XS4 B;  3UIW A;  3ZIT A;  2EIR A;  1QGV A;  2V41 A;  4K6X A;  2R2J A;  1DUG A;  3CRT A;  1AQX A;  1AIU A;  3ED3 A;  5JCW A;  3S9F A;  4MAB A;  4OFM A;  4MPG A;  5J3R A;  5HR2 A;  1TI1 A;  3HZ8 A;  1WPI A;  5IMA A;  4HS1 A;  2NPB A;  1O85 A;  3QOU A;  4WXT A;  4GSS A;  1NW2 A;  2IIY A;  4Z2U A;  2LRC A;  1ERW A;  2DSA A;  2OBI A;  4XRD A;  2X4A A;  1EZK A;  4OMV A;  4D73 A;  4EO3 A;  5F05 A;  2HSM B;  3FR3 A;  3H4K A;  4QL7 A;  3GA4 A;  1R5P A;  3HZ4 A;  3IHG A;  1GSE A;  5GST A;  2MBS A;  2Z9S A;  4FO5 A;  2ZUP A;  2FCH A;  4K2D A;  4K8M A;  5ENU A;  1PX6 A;  3GFK A;  3QCP A;  2B1K A;  2TRX A;  3PIN A;  1YY7 A;  4NXI A;  5INY A;  17GS A;  4EC0 A;  5AGY A;  4O32 A;  1TDI A;  2VOC A;  4K0N A;  2B7J A;  2HRA A;  5IMV A;  2DKH A;  3EU3 A;  2FD3 A;  5IIZ A;  2HSM A;  1K0B A;  1WP0 A;  3PGT A;  5HFI A;  1XW5 A;  4GSN A;  4TVE A;  1JZO A;  4OCF A;  1H4O A;  2GT5 A;  5ECH B;  1I9D A;  2MYG A;  4I6X A;  2NBS A;  4E68 A;  4NWY A;  3QMX A;  5LCZ A;  1ST9 A;  2H8L A;  1BYE A;  2AUV A;  2N5F A;  4IHU A;  3EMP A;  5D9T A;  1LJR A;  1X5D A;  3MSZ A;  5C00 A;  5KN0 A;  1OE7 A;  2G2Q A;  3VWW A;  2H66 A;  3ME8 A;  2DJK A;  4LMW A;  2YP6 A;  1XWC A;  4YAP A;  2V1M A;  1HNC A;  4EKZ A;  3J7Y k;  2I4A A;  2CT6 A;  4IP6 A;  1V9W A;  2HNL A;  1O6J A;  2VCQ A;  4KDU A;  1IYI A;  4ZB8 A;  3HKR A;  5AN1 A;  3I6A A;  2IMD A;  1AQV A;  4GQF A;  3TGZ A;  2RII A;  3UMA A;  4KUN A;  1E6B A;  3IBH A;  3VLN A;  1SK1 A;  2VM1 A;  3MAK A;  1ZYE A;  1XOB A;  2LRN A;  4AKX B;  4HQZ A;  5GSS A;  3ZVJ D;  2WJU A;  1AAZ A;  1OKT A;  3TRX A;  2H1G A;  4F03 A;  1O81 A;  4ML6 A;  2FWE A;  2X8G A;  1PQN A;  4TR0 A;  5ECN B;  1JZD A;  2RM5 A;  3NZN A;  2B6M A;  3G7J A;  1SJ6 A;  20GS A;  3C71 A;  3HXS A;  4OO4 A;  1N25 A;  3KXO A;  3KMN A;  4J57 E;  1ERT A;  1Y25 A;  4OO5 A;  4X1U A;  3CTF A;  2N5B A;  2LJR A;  2YWO A;  5D73 A;  4LLR A;  2YV7 A;  1F37 A;  3IAM 2;  3D21 A;  3F8U A;  3IXR A;  4IJI A;  2MBT A;  1NM3 A;  3ZIV A;  1OAZ A;  1ZZY A;  3O76 A;  1SJZ A;  3GNJ A;  3TKS C;  1PN9 A;  3KMO A;  4DEJ A;  3FEU A;  2B1L A;  3D4M A;  4MZW A;  4BWQ A;  3F9U A;  2PU9 C;  1XCC A;  2VCX A;  3HVX A;  2OA7 A;  4K7O A;  2X8H A;  3IPZ A;  1W4V A;  5D9X A;  4GCI A;  1EEM A;  2DIZ A;  4GRF A;  5J9B A;  3RHC A;  2HLS A;  3FZ4 A;  2CX3 A;  1TJD A;  2KP2 A;  4NPB A;  2BTO T;  2A4V A;  3G7Y A;  1ZCP A;  3A5W A;  3TKR A;  2XPD A;  1Y6E A;  4AKG A;  4BL7 B;  2H1B A;  2LTK A;  2PBJ A;  1X5E A;  3EU4 A;  2MMA A;  1TK5 B;  4EXJ A;  2PVO C;  2BMX A;  1G6Y A;  2YJH A;  3LYK A;  3AY8 A;  4LL4 B;  1XZO A;  1ZOF A;  1SL1 B;  2J23 A;  3HJO A;  4TXO B;  1GTU A;  2C3T A;  1TRS A;  4XHM A;  4RI7 A;  2KHP A;  2WS2 A;  3NOF A;  3LQ7 A;  1YKC A;  4MZB A;  2PUK C;  2PPT A;  2IME A;  2GLR A;  4K0G A;  1N8J A;  2TRC P;  3D22 A;  4EF0 A;  4BL7 A;  16GS A;  1OKD A;  3CRU A;  1YVL A;  4MLY A;  1V57 A;  2JAD A;  2H73 A;  2L4C A;  4GST A;  4MDC A;  4X4J A;  3LFL A;  4WR5 A;  2CV4 A;  1RW1 A;  4KF9 A;  4TXO A;  3IRA A;  4BPY A;  2B7K A;  5D9W A;  5G31 A;  2VKZ G;  1JHB A;  3VPQ A;  2A2P A;  4V2N A;  5FWG A;  1XOA A;  3ZLP A;  2YJ7 A;  2R0G A;  2FUG 2;  2PN8 A;  1M9A A;  2VO4 A;  1Y1U A;  4WBJ A;  3EVI A;  1ZMA A;  1XW6 A;  4MJA A;  4F0B A;  2I9H A;  1GSQ A;  8GSS A;  3WGD A;  4IN0 A;  3KTB A;  2H6X A;  4POK A;  5FT3 A;  2ON5 A;  2D2Z A;  1ERV A;  1NHY A;  1QK8 A;  2NVL A;  3BOA A;  2HSH A;  2L6C A;  2AV4 A;  1R26 A;  3KCM A;  1SEN A;  2HZF A;  4FYC A;  1T8E B;  4KW6 A;  2GQL A;  2DC5 A;  5F06 A;  2LQO A;  1J0F A;  4YQM A;  3ZFL A;  3ZL5 A;  1WOU A;  5A34 B;  4F9Z A;  2GS3 A;  2O5V A;  3IAS 2;  1EOH A;  3Q6O A;  1OC8 A;  1GSD A;  5ECM B;  3LXT A;  4ZB7 A;  4N0Z A;  1UVZ A;  2OE3 A;  2E0Q A;  2C4J A;  2LRT A;  3VWX A;  1YJ6 A;  3RPP A;  2QA2 A;  2OAD A;  1DSB A;  3CXG A;  1ZYN A;  3E0U A;  3VWV A;  3KJY A;  3JCM L;  4GXZ A;  2V6K A;  2YAN A;  1M2B A;  3H79 A;  5DVB A;  3O6T A;  2C0E A;  3FRC A;  4JU5 A;  2L57 A;  1M99 A;  5BRT A;  4V1A p;  4PX1 A;  4BVX B;  5A34 A;  1J9B A;  2JL4 A;  2WCI A;  3D6I A;  2F3M A;  2OE0 A;  4TKY A;  4IS0 A;  4X0X A;  2P31 A;  5IM9 A;  1XBS A;  3APQ A;  3IC8 A;  2K8S A;  4WR4 A;  1M2A A;  5E59 A;  4MJE A;  2LST A;  4XCS A;  3RBT A;  2H72 A;  3I43 A;  2VL2 C;  5F0G A;  3EMX A;  2QC7 A;  3HYP A;  5J40 A;  4AKH A;  2V6O A;  2EFE A;  2F9S A;  1W89 A;  1DE1 A;  3EPT A;  1OVN A;  1SVO A;  1K0D A;  3UBK A;  2FA8 A;  4TR3 A;  3L78 A;  2FHE A;  4BVX A;  2YWN A;  3CSH A;  4CY6 A;  1FO5 A;  4L5L A;  2VM2 A;  3KZQ A;  2HRF A;  4H86 A;  5D8I A;  4FH8 A;  1TU7 A;  5KOX A;  2PGT A;  2GQK A;  5A5K A;  4CY8 A;  3KTL A;  12GS A;  2YN1 A;  4L8E A;  4MMM A;  3J7Y b;  2E2G A;  4YKG A;  2H30 A;  2LJA A;  2FLS A;  1FOV A;  3N9J A;  1PN0 A;  1THX A;  4FYU A;  3DRN A;  4RQX A;  5F8B A;  4LL1 B;  3IDV A;  3G7I A;  1C72 A;  3TOU A;  3GN3 A;  3L9S A;  2WDU A;  1EV4 A;  5DAL A;  2G0F A;  5DQS A;  6GSV A;  2XBI A;  5B6M A;  2HQT A;  3IR4 A;  3CBU A;  5G2Z A;  1TU8 A;  1I5G A;  1BAY A;  4G10 A;  4HQS A;  1PMT A;  1U3I A;  4HI7 A;  4EIQ A;  2WZ9 A;  3CMI A;  2VCZ A;  3EYT A;  1B4Q A;  5CP1 A;  1OYJ A;  3GSS A;  2MMO A;  4AJ6 A;  4OFN A;  4ZBA A;  2H76 A;  3LEF A;  3QDN A;  5CRH A;  3WD6 A;  3EUR A;  5ECR B;  3U6V A;  2AB6 A;  3WT2 A;  2MMZ A;  22GS A;  3ZIJ A;  5JWO B;  4L0W A;  3FR6 A;  1SK0 A;  3OR5 A;  1TKD B;  2YV9 A;  1FB6 A;  1B48 A;  2C80 A;  3TRP A;  5IMF A;  1FW1 A;  4XS4 A;  1SVM A;  4XS1 A;  2CZ3 A;  3UVT A;  4MJB A;  4G19 A;  3GMF A;  5B8A A;  3HHV A;  3K8N A;  1XXU A;  5D9V A;  2L59 A;  3MDK A;  2AYT A;  2IWT A;  4GWR A;  1TOF A;  1O8X A;  4EE0 A;  4AF2 A;  3D4T A;  5CRG A;  3HVV A;  2VD1 A;  4PQH A;  2A2S A;  1K3Y A;  4KND A;  3TUE A;  2JAC A;  1B4P A;  5GAN D;  1YDK A;  2JU5 A;  1JLW A;  1EGO A;  3P7X A;  4ZIL A;  1PGT A;  3QFA C;  1HYU A;  3W8J A;  10GS A;  4V2L A;  3MNG A;  2O7K A;  3ERG A;  2GZZ A;  4MF6 A;  1QUW A;  3CSI A;  2R3X A;  2REM A;  3UEM A;  4G01 A;  3A2X A;  1V40 A;  4EDZ A;  1E2Y A;  5ELG A;  5HFG A;  1DBY A;  3A2V A;  3M8N A;  4PXO A;  4XTS A;  3F63 A;  2CVB A;  1A2M A;  3RHB A;  1ABA A;  2H1A A;  4YKF A;  2DJ0 A;  3I9V 2;  1CQH A;  1B9X C;  1U6T A;  5L71 A;  2CQ9 A;  2YOI A;  2FNO A;  4O92 A;  1BG1 A;  3F0I A;  4O5U A;  5H5Q A;  1QXH A;  3Q74 A;  1QQ2 A;  2B5Y A;  3FZ5 A;  5A4W A;  1HNB A;  3KD0 A;  1EGR A;  5KN2 A;  3ZVJ A;  3HMJ G;  1T00 A;  3MYD A;  1ON4 A;  6GSX A;  1MD3 A;  1THO A;  1PRX A;  2GT6 A;  5FHI A;  4G0K A;  1FG4 A;  3F4R A;  4F82 A;  4AKI A;  2GVP A;  3LYP A;  5DDL A;  1GRX A;  4V2M A;  1EV9 A;  4YQU A;  4HEA 2;  4K5S A;  3DVX A;  1V98 A;  2AJQ B;  2XPE A;  2EIQ A;  4QMK A;  5EPF A;  2ZCT A;  2V2G A;  4MH2 A;  3GST A;  2P5R A;  4LMV A;  4L0U A;  3M3M A;  5ECL B;  5GAP D;  1EOG A;  3GTU B;  4OCE A;  3ZML A;  4ZL7 A;  2NDO A;  2EIO A;  4XIH A;  2CA8 A;  4K1F A;  3IV4 A;  3ZRD A;  5E4W A;  5HR1 A;  4G0L A;  1FVK A;  1AC1 A;  3L0H A;  1T3B A;  4PNF A;  1MDJ A;  1Q4J A;  3CWG A;  3ZZX A;  5G5F A;  5IO2 A;  18GS A;  3F3Q A;  1FVJ A;  1Z7P A;  4XRA A;  3O3T A;  3ME7 A;  4CW9 A;  5B8B A;  2CX4 A;  4G9H A;  4HZ2 A;  2C3N A;  2EFD A;  4NHW A;  3VPT A;  5ECP B;  3GTU A;  5DCH A;  4MK3 A;  1YF1 A;  4KCA A;  1EWX A;  4QL9 A;  3EC3 A;  6GSW A;  3VFI A;  1KBN A;  1LBK A;  3CYN A;  1WIK A;  1JLV A;  4USS A;  5LNK e;  1BF5 A;  1SK2 A;  2H0H A;  2DJ3 A;  1YKA A;  1USB A;  3IE3 A;  1NHO A;  1SKS B;  4G2E A;  2X99 A;  1A24 A;  4Z2R A;  2ALB A;  2LEG A;  2YZH A;  5J4U A;  1XW9 A;  5B7C A;  2LV3 A;  4E8H A;  3TJB A;  2LJK A;  1K3O A;  4MF5 A;  5G1K A;  2IJY A;  5J9C A;  4I8B A;  1QFN A;  4N0V A;  3H8Q A;  2JZS A;  2HZE B;  3TDG A;  3ZRE A;  3ZFB A;  5ID2 B;  2VLU A;  1GL8 A;  4POB A;  3GKX A;  4IBP A;  4HU7 A;  1XVW A;  2R4V A;  5J4V A;  1G6W A;  2VLT A;  14GS A;  5AIX A;  3L9U A;  3VK9 A;  3W8S A;  3BJ5 A;  5EVO A;  1TRV A;  4WKW A;  6GSU A;  2LNT A;  5CYY A;  1TXX A;  1VF4 A;  3GL3 A;  1ZYQ B;  1EP7 A;  1SL2 B;  2V32 A;  2M80 A;  3LW9 A;  5DQY A;  4X43 A;  2IN3 A;  5ECO B;  4ZB6 A;  1ZL9 A;  3SWL A;  1K0N A;  4TRX A;  2CZ2 A;  2R37 A;  2BJX A;  3F4S A;  2K9F A;  2HFD A;  2HZE A;  4K7I A;  2X49 A;  1Z7R A;  4O5Q A;  5ID2 A;  2GZP A;  3VI7 A;  2ON7 A;  2KUC A;  3FW2 A;  4KAE A;  1R4W A;  3GYK A;  5ECS A;  2DML A;  4EL1 A;  1GTA A;  1FOH A;  3CTG A;  1FB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...