1B8XA

Glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
260
structure length
260
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSRRASVGSRMHYPGAFTYSPTPVTSGIGIGMSAMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AML-1B)
publication title Preliminary crystallographic study of glutathione S-transferase fused with the nuclear matrix targeting signal of the transcription factor AML-1/CBF-alpha2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal protein
total genus 53
structure length 260
sequence length 260
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1b8xA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b8xA01
4.10.770.10 Few Secondary Structures Irregular Signal Protein Aml-1b; Chain A, domain 3 Signal Protein Aml-1b; Chain A, domain 3 1b8xA03
3ED3A 3EMXA 2FHEA 3TKSA 4KAEA 2VIMA 3TGZA 4BVXB 4WR4A 3QR6A 2XPEA 2VL2A 2GSSA 2DBCA 5GAND 4G0LA 3C1SA 4QL7A 2GZZA 2V2GA 2HSYA 1Y25A 3MAKA 5ECLB 1JHBA 2C8UA 4MLYA 4MPGA 2IFQB 1N2AA 1XVWA 2PBJA 4MMMA 3QD9A 5D9XA 1GWCA 3ZREA 1ON4A 2OBKA 3HVSA 3M3MA 2FY6A 5DVBA 1PA3A 1WMJA 3RHCA 3TRQA 2LRTA 2K8VA 4TKYA 1TW9A 1BG5A 2PERA 2WDUA 2O7KA 3G9BA 1GSEA 5D9VA 3APQA 1TDIA 1GSSA 1OKTA 3M0FA 1R5AA 1K3YA 2H70A 4DSSA 2LJAA 2NVLA 3D5JA 3LYKA 4HU9A 2XBIA 4TXOB 2E0QA 4OCFA 1M2AA 1EP8A 1WP0A 5EVOA 3PPUA 2V1MA 2V41A 1ERUA 3ZTLA 20GSA 3GTUB 1AIUA 3HVXA 1ILOA 3WGEA 2FUG2 2GQLA 4NHZA 1VF1A 4P3YB 3TJGA 1EGOA 3GRXA 1GTAA 3FHKA 4KUNA 1VRSD 3FY7A 1PGTA 4KGIA 4DEJA 2AYTA 2LQQA 2YANA 2IL3A 4X0XA 1UC7A 2HRKB 1XVQA 2VCXA 2F8AA 5JWQB 4TR0A 1SK0A 4F0BA 2E7PA 4ZB9A 2PVQA 2RUFA 4OWYA 2KUCA 3HCZA 2HRKA 2CAIA 4ISDA 5F0GA 2VL9A 1RK4A 3GN3A 1SJIA 1MTCA 1YZXA 3C8EA 5KEJA 13GSA 2DJ2A 2MMOA 1V58A 5CP1A 4BVYA 4KE3A 2HZEB 5ELGA 4HZ2A 1JZWA 2GGTA 5B6NA 1AXDA 1SJ6A 1K0BA 5GSTA 1U3IA 2GTUA 1KEBA 3E9JB 3VWUA 4PQHA 16GSA 1GUKA 3GH6A 2R4VA 1UVZA 4IW9A 2YWNA 3CRUA 1PKZA 5IMZA 2FNOA 4TR1B 4PURA 4GLTA 2B1KA 22GSA 2H76A 2LUSA 2LJRA 3TOUA 5A4VA 2L5OA 4MCUA 2WGRA 1K0AA 5ECPB 1NSWA 1YF1A 2XPDA 3F3RA 1F3AA 1GSDA 2M80A 1ZCPA 3IDVA 4IP1A 3TKSC 3I9V2 3D6IA 3TB2A 2VL2C 3LGCA 1WIKA 3F4RA 4WETA 1FAAA 1ML6A 4EDYA 4FYUA 4POBA 5IOWA 3UARA 1WJKA 3GKKA 1BYEA 2HSHA 2PWJA 4PNGA 3CSJA 4AJ8A 2WULA 2OA7A 1XOBA 5DAKA 1X5DA 1XOAA 4HQZA 2GVPA 4IELA 2QGVA 4ZB6A 2YZUA 2IJYA 2QKEA 2H19A 3IPZA 3MDKA 2L6DA 4JR4A 4MZWA 3F4TA 3M9KA 2NPBA 2DJ0A 1XPVA 2HXKA 2A2RA 1YKCA 1Z6NA 1NW2A 2P0GA 2VLTA 1GTUA 1EEJA 2AHEA 1I5GA 2C0GA 2KP2A 4FYCA 3EYTA 2FD3A 4LL1B 12GSA 4K6XA 2X64A 3FEUA 4MDCA 2L6CA 5ECNB 4BA7A 5F05A 2ZUPA 2H6YA 3D21A 1IYHA 2WS2A 4QQ7A 4IP6A 3NIVA 5G30A 5HFIA 4WEYA 1Z7PA 2TRCP 2G2QA 4I2TA 3BD2A 1A0FA 1GP1A 4KA0A 1PSQA 5ECRB 3A2WA 4MJCA 1BQ7A 1YY7A 2C0DA 4EE0A 3TJKA 2DJ3A 5G1KA 1VF4A 1O8WA 2F9SA 1PQNA 3Q18A 3ZFBA 1THOA 1NHOA 3ZRDA 3FZ5A 4ZBBA 1T4YA 1F9MA 2AJQB 2XHFA 1OVNA 3LG6A 3EVIA 3UBKA 1Q4JA 4OFTA 1A24A 1GSQA 2MBSA 4CHSA 5DALA 3KGKA 4MH2A 1X9WB 3EC3A 3IE3A 1M99A 3ZYWA 5IMVA 3WYWA 1GULA 1AC1A 5GAPD 1MEKA 1GTBA 5IMDA 3EWLA 2YCDA 3FZAA 4XHMA 3KJYA 1YKAA 4EF0A 4GQFA 4N0ZA 1M0UA 1OC3A 4LL4B 2H73A 4K9ZA 3J7Yk 3MSZA 2DJKA 3ME7A 5G5EA 5IPHA 2O89A 4GQCA 5IOXA 1XBSA 5E4WA 4YQVA 4TR4A 3GL3A 1K0DA 2H01A 2EIOA 4KB3A 1U87A 3A2VA 3VI7A 2C80A 3TDGA 4RUVA 5CRGA 1PX6A 1FW1A 1TRVA 3A2XA 1W89A 2HSNB 4AF2A 3QCPA 2J23A 3G7IA 4OD7A 4Z7XA 2DLXA 1FVJA 4XS4B 2IMIA 3TKRA 1JZDA 2LEGA 2MMAA 3O76A 3P8WA 1SL1B 3D4TA 2K6VA 2VCVA 1NM3A 5ELAA 5ECIB 4L5LA 5HR2A 2N5AA 4G9HA 4FYBA 1TI1A 4K0NA 2DC5A 1V98A 2H74A 4MJBA 1K0OA 4HJ2A 5G1LA 5F07A 17GSA 4GCIA 4G0KA 5FWGA 2BMXA 4N11A 2GSRA 4HEA2 4WR5A 2R2JA 1GLQA 1Z3EA 3TKPA 3M9JA 4I6XA 3I6AA 1DUGA 5LCZA 2JZTA 3N9JA 3WD6A 3C1RA 1YEPA 3EMPA 4D73B 4JR6A 4X1UA 4ACSA 4IS0A 2NTOA 1DBYA 4XTSA 3OR5A 4G10A 3KCMA 2OE1A 3HJPA 4KNDA 3HHVA 4PTSA 2M46A 4L8EA 1PN9A 2LQOA 3UVTA 4GF0A 4HZ4A 5AISA 4K7OA 3WGDA 4OFNA 2CAQA 4EUYA 3HZ8A 5AIVA 3VURA 2IMKA 4K2DA 2VOCA 1MDJA 5D9TA 1FO5A 2V32A 6GSSA 2IPAA 1G7EA 2KP1A 2ZNMA 4GXZA 1S3AA 1M2DA 4NHWA 2IWTA 2ZCTA 1YEXA 3KZQA 4I5QA 2E2GA 2FWGA 4I97A 6GSUA 2LV3A 4OMVA 4ECBA 1DSBA 4TRXA 3IC4A 2YOIA 2QSIA 3U5RE 4FQUA 4ZBAA 2LKUA 1O85A 4MA9A 4YH2A 4LMVA 4BVXA 2L4QA 4F9ZA 4YQUA 1O8XA 3F4SA 3NOFA 2IFQA 19GSA 1S3CA 1THXA 3CXGA 3QAGA 2RM5A 1FOVA 1X9MB 3PINA 5F8BA 2B7JA 3DEXA 3UEMA 1NHYA 3F6DA 2GS3A 3C71A 3UBLA 1PL1A 3Q19A 5JCUA 5IMAA 2YP6A 1G0TA 2H1BA 3U6VA 4MF7A 1WPIA 5L71A 2JZSA 3IHQA 4JU5A 3LXZA 2C0FA 1X5CA 2HE3A 5CYYA 2C4JA 1SKSB 1KBNA 2C1YA 3ZMLA 3US3A 1HYUA 4GTUA 4GRFA 4ZILA 4N30A 4TXOA 1A2JA 2C3NA 4EVMA 2H72A 1WRYA 3QDNA 1EEMA 3ZIJA 2VM1A 1OE8A 3D0ZA 2WRTA 2YNXA 4IHUA 1Y6EA 4L5OA 1B48A 1EZKA 2WB9A 3IV4A 3GTUA 4N10A 2OJLA 3CTGA 3GUSA 2CZ3A 4RI6A 5CRHA 5IMCA 1V9WA 2E2MA 3ZVJD 2JU5A 1WOUA 3TUEA 4MJEA 1C72A 2H1DA 3CRTA 1TRWA 5DCHA 5KN1A 2G0FA 1R5PA 1Z7RA 4MZCA 3CSIA 3HY2A 4FIWA 5HFGA 4YAPA 2YV7A 2HSMB 4PUFC 5HFKA 3O6TA 3TJBA 4TVEA 3FYGA 2XC2A 4G0IA 3WT2A 4J56E 3APSA 2HQTA 1J9BA 2DJ1A 1K0MA 3QOUA 2AV4A 1Z5YE 5J9CA 2DIZA 2A2SA 5D9WA 6GSTA 3TJFA 4KDYA 1Z6MA 4HU7A 3KTBA 5ECHB 3L78A 1B9XC 2HI7A 3F0IA 1OKDA 4DSQA 5A4UA 2IMDA 2D2ZA 5IQYA 2HZEA 1EP7A 11GSA 1BAYA 1EGRA 1GTIA 4IJ3A 3DRNA 1ZMAA 3F8UA 3EU4A 10GSA 3GNJA 2PUKC 3W6GA 4FO5A 1SD9A 2P5QA 3IAS2 2TIRA 4WBJA 1TKDB 1XCCA 4KDUA 1T8EB 1H75A 2PMTA 1M9BA 4TR1A 1K3OA 4J57E 2R6KA 2IMEA 4Q5NA 2DMMA 3M1GA 2MYGA 3UIWA 4F82A 1EOHA 2HRAA 3D4MA 3GHAA 4HS1A 2CT6A 3K8NA 4WF4A 4OO4A 2KLXA 4IQAA 4ZXGA 3LSZA 2CVKA 5JCGA 3UJ1A 3FRCA 9GSSA 1O6JA 5E59A 3HJOA 1GNEA 4AGSA 1ERTA 4ULXA 1H4OA 5H5SA 1ZOFA 2C3TA 1Z9HA 5J41A 2L57A 3VWXA 3H79A 3GKXA 1TP9A 1VF3A 4YQMA 4K0GA 1SK1A 2B3SA 5LNKe 1TU7A 1Q98A 2B6MA 2CQ9A 4PGTA 2WFCA 1R26A 3KP8A 3R2QA 2CX4A 1BX9A 1T1VA 4HDEA 3FK8A 2JADA 2K18A 2YJHA 6GSXA 1G6YA 5ID2B 3VPQA 3S9FA 1PL2A 5ABRA 4TOPA 3ERWA 1HNBA 2OBIA 2CVBA 3PGTA 1M2BA 1GSYA 2MMZA 1XWBA 4ECCA 4V2MA 3VWWA 3DWVA 1W4VA 4MK3A 1XWKA 2VL3A 1XFLA 3QPMA 3GSSA 1SKWB 2QC7A 3SBCA 4RQXA 4RQRA 4CDOA 2O85A 5CAXA 4ZL9A 4X43A 5GZZB 1GSUA 5J9BA 2AAWA 3KTLA 2VAFA 2I81A 3MNGA 2DIYA 3DXBA 1F37A 3BJ5A 1MD4A 3I69A 3RPNA 1YJ6A 4PUAA 1WWJA 3H4KA 2GQKA 4O32A 3ZFLA 2CX3A 3IK7A 1OYJA 3HZ4A 3WT1A 3M8NA 4YAVA 1I9DA 5HR3A 4MPFA 2K8SA 2REMA 3L0HA 3FZ4A 1XXUA 1XZOA 1BEDA 1B4PA 5A4WA 2HT9A 4KSMA 1DE2A 1ABAA 2GSTA 4NAXA 3BCIA 2YJ7A 1T7PB 1A0RP 1WE0A 1F3BA 2JACA 2H6ZA 1VF2A 2HRNA 5CRWA 3TJJA 2H0GA 4LA1A 3NZNA 3ZMKA 3RAZA 1PRXA 1XWCA 1TXXA 2DMLA 2H1AA 3EURA 3KIJA 3KH9A 5IM9A 3FW2A 3AY8A 5B8AA 1O73A 1M9AA 3UAPA 2BJXA 4JE1A 1E6BA 3CMIA 2GZYA 4IKHA 2LSTA 1SKRB 2X99A 7GSSA 3RPPA 5DDLA 1IYIA 3DMLA 4WXTA 1GLPA 4MF6A 1FHEA 2I9HA 3WGXA 4MABA 2Z9SA 4EKZA 4BWQA 1HQOA 2FGXA 3VI5A 3VLNA 3HVVA 4ML1A 3GA4A 2FWEA 4TW5A 1OAZA 2F8FA 4XS4A 4KDXA 4RI7A 1O81A 1TTZA 3TKQA 3N5OA 3EE2A 1KNGA 1QUWA 2JZRA 1M7TA 2PN8A 4WF5A 2H0IA 2LNTA 1XW9A 1K0CA 3F6FA 4IVFA 4EXJA 1X0RA 4BL7B 3GL5A 2VD1A 5IPGA 1A8YA 3C7MA 3CSHA 3IR4A 2X8GA 1FB0A 4EO3A 3IRAA 3L9SA 5JCWA 5FT3A 4HQSA 1HNCA 4NXIA 1GUMA 5EL8A 4ECJA 2RIIA 5ECQB 3HD5A 3H1NA 2FWFA 4G19A 2ON5A 2I1UA 4MF5A 1QFNA 3QFBC 2LRNA 2IN3A 5IIZA 4I2UA 4MZBA 1R4WA 6GSWA 4D73A 2IIYA 2B1LA 2N5BA 4O7HA 1AAZA 1QGVA 4ZL7A 4GSSA 4G2EA 1PX7A 3Q74A 2FCHA 3BBYA 2C3QA 2NDOA 5ENUA 3ERFA 2PU9C 1X5EA 2V6OA 1ZYQB 3BOAA 18GSA 5DJLA 3KXOA 3P7XA 1EV9A 4XRAA 2EIQA 1CQHA 1B8XA 3W8JA 5CREA 1XW5A 2OE0A 5DBQA 5DCGA 2CVDA 1T4ZA 2VLUA 4K8MA 4DVCA 2C0EA 5INYA 2H8LA 2DSAA 4EL1A 2EC4A 4POKA 2N5FA 2RM6A 3H93A 3EINA 1SL2B 2I3YA 5JWRB 2BTOT 4ML6A 4NMUA 4LLRA 2XBQA 3BCKA 3KEBA 1JLVA 3LFLA 4GWRA 1LU4A 5CNWA 4N0VA 3JCML 5KN2A 2M72A 2VO4A 3FKFA 3GIXA 3LEFA 4PXOA 3KMOA 4L0UA 2F3MA 4DSSB 4IGJA 1MDKA 5J3RA 4IJIA 1USBA 14GSA 2GQMA 5JWOB 2CV4A 1A2MA 1ERWA 1HD2A 3QFAC 2KHPA 3IOSA 2X8CA 2VCWA 2H0HA 2YWIA 2GSQA 5EY6A 5F06A 1JFUA 3I43A 3RHBA 6GSVA 2MMNA 2VCQA 1AQWA 3ZL5A 3F9UA 2PPTA 1EWXA 1LJRA 1FVKA 4ZB8A 2FA4A 1FG4A 3GX0A 4KCEA 4LMWA 3UOMA 3QMXA 3IXRA 4QL9A 1N8JA 1JZRA 2TRXA 4IQ1A 1E2YA 1R7HA 2EIRA 1ACVA 2ALBA 3QAVA 5IO0A 2JL4A 1AW9A 5DQSA 4JBBA 5ECKB 3GX8A 1GNWA 1AUCA 3HYPA 5ECSA 4ZIJA 2H6XA 5EPFA 3HKRA 3GH9A 4MP4A 2X8HA 2V6KA 4PX1A 2VCZA 1EOGA 2H66A 2VD0A 2HSMA 1TJDA 5AGYA 1RQMA 1J08A 3RBTA 1G7OA 4O5RA 3GV1A 2I4AA 3TKSE 5HR1A 3DD3A 3TRXA 3HJMA 3F3QA 2B5EA 4MH3A 4BVYB 2GZPA 3KP9A 5KN3A 3TRPA 5CRDA 2H75A 1G6WA 3A3TA 1ZL9A 4WBRD 3VFIA 3KMNA 5B6MA 3VPTA 4I8BA 4XCSA 3RDWA 3P90A 5H5QA 1AQVA 3HA9A 3IA1A 3IK9A 3PH9A 1A8LA 3GSTA 1GH2A 2WCIA 1QQ2A 4OO5A 4OFMA 3IBHA 4Q5RA 4Q5QA 4TR3A 5D96A 2OE3A 4TXVA 4DSRA 4WKWA 4JEDA 4K7NA 3FR6A 3EU3A 2OADA 4L0WA 4BWSA 2RLIA 2R5GA 5D93A 1TK0B 4POLA 2OKAA 1SK2A 1UA5A 5DQYA 4H86A 5LD0A 1XW6A 4TN8A 2L5LA 4O92A 3L9VA 5AN1A 2B5YA 4BPYA 2FA8A 4KSOA 3QAWA 3G7YA 3GKMA 5J4UA 4EDZA 2MBTA 2B7KA 2LRCA 4IBPA 2P31A 3KD0A 5DAKB 5HR0A 5H5RA 1B9YC 2GT6A 5A5KA 3APOA 4HOJA 3VWVA 1TOFA 1AQXA 2ON7A 5C00A 2YWMA 3ZLPA 3LQ7A 3R3EA 3FR9A 2YZHA 1CQGA 3ZVJA 2R3XA 3CBUA 4E8HA 3GMFA 3ERGA 2H71A 3VK9A 2RUEA 2HZFA 5ID2A 2HYXA 2WJUA 1TK8B 4Q5FA 3J7Yb 2GLRA 1V57A 4USSA 5HQPA 6GSYA 2O8VB 3GKNA 4PQ1A 1OC9B 1XWGA 1TU8A 4JRRA 4ID0A 1OE7A 5DJMA 1HNAA 1SYXA 1SD8A 5CO3A 2ES7A 1EV4A 3UVHA 1A2LA 1PMTA 1OC9A 4AJ6A 1VGLA 2NBSA 2J9HA 1FB6A 1B4QA 5FHIA 1JLWA 3G7JA 3LWAA 1U88A 1T00A 2DJJA 5KN0A 3GURA 4KF9A 5D73A 2VCTA 3O3TA 2L59A 3DVWA 2JSYA 3H8QA 5IMFA 2P5RA 1QK8A 5B7CA 4V1Ap 1YF0A 3UL3A 5B8BA 4CW9A 4ECIA 3KM6A 5DALB 1MDIA 3ME8A 4ILFA 3TOTA 1SENA 4ZBDA 3LORA 3UMAA 2R37A 4OCEA 2F51A 1XWAA 1QMVA 3W8SA 3CTFA 3P2AA 1F6MC 3IAM2 2K9FA 2WZ9A 4NV5A 1ST9A 2H30A 4NWYA 1GSFA 2CA8A 2LS5A 4J2FA 1RW1A 1O7UA 1A23A 2HNLA 5AIXA 2VM2A 1MD3A 1K0NA 3DIEA 3ISOA 2YV9A 2IMFA 2LNSA 2VLVA 3Q6OA 4XS6A 5C04A 3CYNA 2O87A 2AUVA 2H1GA 2FLSA 1GUHA 1TK5B 2YPMA 5COHA 1V40A 4F2IA 2PGTA 2YWOA 5BMUA 2B5XA 1T3BA 2A4VA 4K7IA 2MZCA 3V1WA 1S3DA 3L9UA 4F0CA 4XRDA 1SJZA 2HLSA 4NPBA 2JSZA 8GSSA 1SYRA 3HDCA 4HUAA 3PR8A 3DKSA 1PKWA 1PD21 4PNFA 2UZ8A 1XIYA 1KTEA 5ECMB 2YN1A 1GRXA 4KCAA 1GL8A 4EC0A 2HFDA 1V2AA 1ZZYA 3A5WA 4KX4A 3ZIVA 3E0UA 3DGQA 1YQ1A 5ECOB 1JZOA 3C73A 1SU9A 5IO2A 2L4CA 3TCOA 4K1FA 2LTKA 1BJXA 1LBKA 1TRSA 4BL7A 4V2NA 1U3AA 4V1Ag 5G2ZA 4F03A 1URMA 4AJ7A 5G5FA 2GT5A 3SWLA 3L4NA 4FH8A 1X9SB 4V2LA 1K3LA 3LXTA 4KW6A 2VUPA 3KH7A 4IN0A 2CZ2A 3DYRA 2LJKA 4GSNA 1YDKA 5G31A 3FR3A 1TRUA 3HXSA 1SL0B 1J0FA 4POMA 3FZ9A 4KH7A 5D8IA 1ZYEA 3GFKA 4JZQA 4PQIA 3E3EA 3IC8A 3LJRA 3DVXA 2FWHA 2KOKA 2HRFA 4XS1A 1DE1A 3F63A 2PVOC 3GYKA 1U6TA 4HI7A 4MJAA 5GSSA 3ZZXA 3LYPA 4GSTA 4HJMA 4E8EA 2GDRA 3D22A 1F2EA 1ZGNA 1QXHA 2OACA 3MWHA 1OC8A 1ERVA 3ZITA 4NV2A 2AB6A 1TI3A 4XIHA 1UN2A 5J5NA 4ZL8A
chains in the Genus database with same CATH superfamily
3ED3A 3EMXA 2WW1A 2FHEA 3TKSA 2WVXA 4KAEA 2VIMA 3TGZA 4BVXB 4WR4A 3QR6A 2XPEA 2VL2A 2GSSA 2DBCA 5GAND 4G0LA 3C1SA 4QL7A 2GZZA 2V2GA 2HSYA 1Y25A 3MAKA 5ECLB 1JHBA 2C8UA 4MLYA 4MPGA 2IFQB 1N2AA 1XVWA 2PBJA 4MMMA 3QD9A 5D9XA 1GWCA 3ZREA 5BRTA 1ON4A 2OBKA 3HVSA 3M3MA 2FY6A 5DVBA 4PI2C 1PA3A 1WMJA 3RHCA 3TRQA 2LRTA 2K8VA 4TKYA 1TW9A 1BG5A 2PERA 2WDUA 2O7KA 3G9BA 1GSEA 5D9VA 3APQA 1TDIA 2WZSA 1GSSA 1OKTA 3M0FA 1R5AA 1K3YA 2H70A 4DSSA 2LJAA 2NVLA 3D5JA 3LYKA 4HU9A 2XBIA 4TXOB 2E0QA 4OCFA 1M2AA 1EP8A 1WP0A 5EVOA 3PPUA 2V1MA 2V41A 1ERUA 3ZTLA 20GSA 3GTUB 1AIUA 3HVXA 4AKXB 2QA2A 1ILOA 3WGEA 2FUG2 2GQLA 4NHZA 1VF1A 4P3YB 3TJGA 1EGOA 1SVMA 3GRXA 1GTAA 3FHKA 4KUNA 1VRSD 3FY7A 1PGTA 4KGIA 4DEJA 2AYTA 2LQQA 2YANA 2IL3A 4X0XA 1UC7A 2HRKB 1XVQA 2VCXA 2F8AA 5JWQB 4TR0A 1SK0A 4F0BA 2E7PA 4ZB9A 2PVQA 2RUFA 4OWYA 2KUCA 3HCZA 2HRKA 2CAIA 4ISDA 3RGBC 5F0GA 2VL9A 1RK4A 3GN3A 1SJIA 1MTCA 1YZXA 3C8EA 5KEJA 13GSA 2DJ2A 2MMOA 1V58A 5CP1A 4BVYA 4KE3A 2HZEB 5ELGA 3MIXA 4HZ2A 4AKHA 1JZWA 2GGTA 5B6NA 1AXDA 1SJ6A 1K0BA 5GSTA 4PI0C 1U3IA 2GTUA 1KEBA 3E9JB 3VWUA 4PQHA 2EFEA 16GSA 1GUKA 3GH6A 2R4VA 1UVZA 4IW9A 2YWNA 3CRUA 1PKZA 5IMZA 2FNOA 4TR1B 2EFDA 4PURA 4GLTA 2B1KA 22GSA 2H76A 2LUSA 2LJRA 3TOUA 5A4VA 2L5OA 4MCUA 2WGRA 1K0AA 5ECPB 1NSWA 1YF1A 1S4BP 2XPDA 4X4JA 3F3RA 1F3AA 1GSDA 2M80A 1ZCPA 3IDVA 4IP1A 3TKSC 3I9V2 5KOXA 3D6IA 3TB2A 2VL2C 3LGCA 1WIKA 3F4RA 4WETA 1FAAA 1ML6A 4EDYA 4FYUA 4POBA 5IOWA 3UARA 1WJKA 3RFRC 3GKKA 1BYEA 2HSHA 2PWJA 4PNGA 3CSJA 4AJ8A 2WULA 2OA7A 1XOBA 5DAKA 1X5DA 1XOAA 4HQZA 2GVPA 4IELA 2QGVA 4ZB6A 2YZUA 2IJYA 2QKEA 2H19A 3IPZA 3MDKA 2L6DA 4JR4A 4MZWA 3F4TA 3M9KA 2NPBA 2DJ0A 1XPVA 2HXKA 2A2RA 1YKCA 1Z6NA 1NW2A 2P0GA 2VLTA 1GTUA 1EEJA 2AHEA 1I5GA 2C0GA 2KP2A 4FYCA 3EYTA 2FD3A 4LL1B 12GSA 4ZB7A 4K6XA 2X64A 5A1NB 3FEUA 4MDCA 1M3IA 2L6CA 5ECNB 4BA7A 5F05A 2ZUPA 2H6YA 3D21A 1IYHA 2WS2A 4QQ7A 4IP6A 4BIKA 3NIVA 5G30A 5HFIA 4WEYA 1Z7PA 2TRCP 2G2QA 4I2TA 3BD2A 1TXUA 1A0FA 1GP1A 1PSQA 4KA0A 5ECRB 3A2WA 4MJCA 1BQ7A 1YY7A 2C0DA 4EE0A 3TJKA 1YVLA 2DJ3A 5G1KA 1VF4A 1O8WA 2F9SA 1PQNA 3Q18A 3ZFBA 1THOA 1NHOA 3ZRDA 3FZ5A 4ZBBA 1T4YA 1F9MA 2AJQB 2XHFA 1OVNA 4AI6A 3LG6A 3EVIA 3UBKA 1Q4JA 4OFTA 1A24A 1GSQA 2MBSA 4CHSA 5DALA 3KGKA 4MH2A 1X9WB 3EC3A 3IE3A 1M99A 3ZYWA 5IMVA 3WYWA 1GULA 1AC1A 5GAPD 1MEKA 1GTBA 5IMDA 3EWLA 2YCDA 3FZAA 4XHMA 3KJYA 1YKAA 4QMKA 4EF0A 4GQFA 4N0ZA 1M0UA 1OC3A 4LL4B 2H73A 4K9ZA 1BF5A 3J7Yk 3MSZA 2DJKA 3ME7A 5G5EA 5J40A 5IPHA 2O89A 4GQCA 5IOXA 4G01A 5J4VA 1XBSA 4YQVA 5E4WA 4TR4A 2EFHA 3GL3A 1K0DA 2H01A 2EIOA 4KB3A 1U87A 3A2VA 3VI7A 2EFCA 2C80A 3TDGA 4RUVA 5CRGA 1PX6A 1FW1A 1TRVA 3A2XA 1W89A 2O36A 2HSNB 4AF2A 3QCPA 2J23A 3LW9A 3G7IA 4OD7A 4Z7XA 2DLXA 1FVJA 4XS4B 2IMIA 3TKRA 1JZDA 2LEGA 2MMAA 3O76A 3P8WA 1SL1B 2DKHA 3D4TA 2K6VA 2VCVA 1NM3A 5ELAA 5ECIB 4L5LA 5HR2A 2N5AA 4G9HA 4FYBA 1TI1A 4K0NA 2DC5A 1V98A 2H74A 4MJBA 1K0OA 4HJ2A 5G1LA 5F07A 17GSA 4GCIA 3MYDA 4G0KA 5FWGA 2BMXA 4N11A 2GSRA 4HEA2 4WR5A 2R2JA 4AKGA 1GLQA 5A5HB 1Z3EA 3TKPA 3M9JA 4I6XA 3I6AA 1DUGA 5LCZA 2JZTA 3N9JA 3WD6A 3CQFA 5A5HA 3C1RA 1SVOA 1YEPA 3EMPA 4D73B 4JR6A 4X1UA 4ACSA 4IS0A 2NTOA 1DBYA 4XTSA 3OR5A 4G10A 3KCMA 4PHZC 2OE1A 3HJPA 4KNDA 3HHVA 4PTSA 2M46A 4N3ZA 4L8EA 4CY8A 1PN9A 2LQOA 3UVTA 4GF0A 5J47A 4HZ4A 5AISA 4K7OA 3WGDA 4OFNA 2CAQA 4EUYA 3HZ8A 5AIVA 3VURA 4Z2UA 2IMKA 4K2DA 2O3EA 2VOCA 1MDJA 5D9TA 1FO5A 2V32A 6GSSA 2IPAA 1G7EA 2KP1A 2ZNMA 4GXZA 1S3AA 1M2DA 4NHWA 2IWTA 2ZCTA 1YEXA 3KZQA 4I5QA 2E2GA 2FWGA 4I97A 6GSUA 2LV3A 4OMVA 4ECBA 1DSBA 4TRXA 3IC4A 2YOIA 2QSIA 3U5RE 4FQUA 4ZBAA 2LKUA 1O85A 4MA9A 1XG8A 4YH2A 4LMVA 4BVXA 2L4QA 4F9ZA 4YQUA 1O8XA 4O5QA 3F4SA 3NOFA 2IFQA 19GSA 1S3CA 1THXA 3CXGA 3QAGA 2RM5A 1FOVA 1X9MB 3PINA 5F8BA 2B7JA 3DEXA 3UEMA 1NHYA 3F6DA 2GS3A 3C71A 3UBLA 1PL1A 3Q19A 5JCUA 5IMAA 2YP6A 4YKFA 1G0TA 2H1BA 4A5PA 3U6VA 4MF7A 1WPIA 5L71A 2JZSA 3IHQA 4JU5A 3LXZA 2C0FA 1X5CA 2HE3A 5CYYA 2C4JA 1SKSB 1KBNA 2C1YA 3ZMLA 3US3A 1HYUA 4GTUA 4GRFA 4ZILA 4N30A 4TXOA 1A2JA 2C3NA 4EVMA 2H72A 1WRYA 3QDNA 1EEMA 3ZIJA 2VM1A 1OE8A 3D0ZA 2WRTA 2YNXA 4IHUA 1Y6EA 4L5OA 1B48A 1EZKA 2WB9A 3IV4A 3FMWA 3GTUA 4N10A 4MNNA 2OJLA 3CTGA 3GUSA 2CZ3A 4RI6A 3TU3B 5CRHA 5IMCA 1V9WA 2E2MA 3ZVJD 2JU5A 1WOUA 3TUEA 4MJEA 1C72A 2H1DA 3CRTA 1TRWA 5DCHA 5KN1A 2G0FA 1R5PA 1Z7RA 3HMJG 4MZCA 3CSIA 3HY2A 4FIWA 5HFGA 4YAPA 2YV7A 2HSMB 4PUFC 5HFKA 3O6TA 3TJBA 1Y1UA 3FYGA 5A34B 2XC2A 4G0IA 4TVEA 3WT2A 4J56E 3APSA 3EPTA 2HQTA 1J9BA 2DJ1A 1K0MA 3QOUA 2AV4A 1Z5YE 1S3RA 5J9CA 2DIZA 2A2SA 5D9WA 6GSTA 3TJFA 4KDYA 1Z6MA 4HU7A 3KTBA 5ECHB 3L78A 1B9XC 2HI7A 3F0IA 1OKDA 4DSQA 5A4UA 2IMDA 2D2ZA 5IQYA 2HZEA 1EP7A 4K5SA 11GSA 1BAYA 1EGRA 1GTIA 4IJ3A 3DRNA 1ZMAA 3F8UA 3EU4A 10GSA 3GNJA 2PUKC 3W6GA 4FO5A 1SD9A 2P5QA 3IAS2 2TIRA 4WBJA 1TKDB 1XCCA 4KDUA 1T8EB 1H75A 2PMTA 1M9BA 4TR1A 1K3OA 4J57E 2R6KA 2IMEA 4Q5NA 2DMMA 3M1GA 2MYGA 3UIWA 4F82A 1EOHA 2HRAA 3D4MA 3GHAA 4HS1A 2CT6A 3K8NA 4WF4A 4OO4A 2KLXA 4IQAA 4ZXGA 3LSZA 2CVKA 5JCGA 3UJ1A 3FRCA 9GSSA 1O6JA 5E59A 3HJOA 1GNEA 4AGSA 1ERTA 4ULXA 1H4OA 5H5SA 1ZOFA 2C3TA 1Z9HA 5J41A 2L57A 3VWXA 3H79A 3GKXA 1TP9A 1VF3A 4YQMA 4K0GA 1SK1A 2B3SA 5LNKe 1TU7A 2A2PA 1Q98A 2B6MA 2CQ9A 4PGTA 2WFCA 1R26A 3KP8A 3R2QA 2CX4A 1BX9A 1T1VA 4HDEA 3FK8A 2JADA 2K18A 1FOHA 2YJHA 6GSXA 1G6YA 5ID2B 3VPQA 3S9FA 1PL2A 5ABRA 4TOPA 3ERWA 1HNBA 4GDFA 2OBIA 2CVBA 3PGTA 1M2BA 1GSYA 2MMZA 1XWBA 4ECCA 4V2MA 3VWWA 3DWVA 1W4VA 4MK3A 1XWKA 2VL3A 1XFLA 3QPMA 3GSSA 1SKWB 2QC7A 3SBCA 4RQXA 4RQRA 4CDOA 2VKZG 2O85A 5CAXA 4ZL9A 5A1NA 4X43A 5GZZB 1GSUA 5J9BA 2AAWA 3KTLA 2VAFA 2WW0A 2I81A 3MNGA 2DIYA 3DXBA 1F37A 1PN0A 3BJ5A 1MD4A 3I69A 3RPNA 1YJ6A 4PUAA 1WWJA 3H4KA 2GQKA 2UV8G 4O32A 3ZFLA 2CX3A 3IK7A 1OYJA 3HZ4A 3WT1A 3M8NA 4YAVA 1I9DA 5HR3A 4MPFA 2K8SA 2REMA 3L0HA 3FZ4A 1XXUA 1XZOA 1BEDA 1B4PA 5A4WA 2HT9A 4KSMA 1DE2A 1ABAA 2GSTA 4NAXA 3BCIA 2YJ7A 1T7PB 1A0RP 1WE0A 1F3BA 2JACA 2H6ZA 1VF2A 2HRNA 5CRWA 3IHGA 3TJJA 2H0GA 4LA1A 4O5UA 3NZNA 3ZMKA 3RAZA 1PRXA 1XWCA 1TXXA 2DMLA 2H1AA 3EURA 3KIJA 3KH9A 5IM9A 3FW2A 3AY8A 5B8AA 1O73A 1SVLA 1M9AA 3UAPA 2BJXA 4JE1A 1E6BA 3CMIA 2GZYA 4IKHA 2LSTA 5BMUB 1SKRB 2X99A 7GSSA 3RPPA 5DDLA 1IYIA 3DMLA 4WXTA 1GLPA 4MF6A 1FHEA 2I9HA 3WGXA 4MABA 2Z9SA 4EKZA 4BWQA 1HQOA 2HSNA 3VI5A 2A4HA 3VLNA 2FGXA 3HVVA 4ML1A 3GA4A 2FWEA 4TW5A 1OAZA 2F8FA 4XS4A 4KDXA 4RI7A 1O81A 1TTZA 3TKQA 3N5OA 3EE2A 1KNGA 1QUWA 2JZRA 1M7TA 2PN8A 4WF5A 2H0IA 2LNTA 4EIQA 1XW9A 1K0CA 3F6FA 4IVFA 4EXJA 1X0RA 4BL7B 3GL5A 2VD1A 5IPGA 2O5VA 1A8YA 3C7MA 3CSHA 3IR4A 2X8GA 1FB0A 4EO3A 3IRAA 3L9SA 2WW2A 4Z2TA 5JCWA 5FT3A 4HQSA 1HNCA 4NXIA 1GUMA 5EL8A 4ECJA 2RIIA 5ECQB 3HD5A 3HVNA 3H1NA 2FWFA 4G19A 2ON5A 2I1UA 4MF5A 1QFNA 3QFBC 2LRNA 2IN3A 5IIZA 4I2UA 4MZBA 1R4WA 6GSWA 4D73A 2IIYA 2B1LA 2N5BA 4O7HA 1PFOA 1AAZA 1QGVA 4ZL7A 4GSSA 4G2EA 1PX7A 3Q74A 2FCHA 3BBYA 2C3QA 2NDOA 5ENUA 3ERFA 2PU9C 1X5EA 2V6OA 4K2XA 1ZYQB 3BOAA 18GSA 5DJLA 3KXOA 3P7XA 1EV9A 4XRAA 2EIQA 1CQHA 1B8XA 3W8JA 4CY6A 5CREA 1XW5A 2OE0A 5DBQA 5DCGA 2CVDA 1T4ZA 2VLUA 4K8MA 4DVCA 2C0EA 5INYA 2X4AA 2H8LA 2DSAA 4EL1A 2EC4A 4POKA 2N5FA 2RM6A 3H93A 3EINA 1SL2B 2I3YA 5JWRB 2BTOT 4AKIA 4ML6A 4NMUA 4LLRA 2XBQA 3BCKA 3KEBA 3CWGA 1JLVA 3LFLA 4GWRA 1LU4A 5CNWA 4N0VA 3JCML 5KN2A 2M72A 2VO4A 3FKFA 3GIXA 3LEFA 4PXOA 3KMOA 4L0UA 5KOWA 2F3MA 4DSSB 4IGJA 1MDKA 5J3RA 4IJIA 1USBA 14GSA 2GQMA 5JWOB 2CV4A 1A2MA 1ERWA 1HD2A 3QFAC 2KHPA 3IOSA 2X8CA 2VCWA 2H0HA 2YWIA 2GSQA 2WW3A 5EY6A 5F06A 1JFUA 3I43A 3RHBA 3CHXC 6GSVA 2MMNA 2VCQA 1AQWA 3ZL5A 3F9UA 2PPTA 1EWXA 2R0CA 1LJRA 1FVKA 4ZB8A 2FA4A 1FG4A 3GX0A 4KCEA 4LMWA 3UOMA 3QMXA 3IXRA 4QL9A 1N8JA 1JZRA 2TRXA 4IQ1A 1E2YA 1R7HA 2EIRA 1ACVA 2ALBA 3QAVA 5IO0A 2JL4A 1AW9A 5DQSA 4JBBA 5ECKB 3GX8A 1GNWA 1AUCA 3HYPA 5ECSA 4ZIJA 2H6XA 5EPFA 3HKRA 3GH9A 4MP4A 2X8HA 2V6KA 4PX1A 2VCZA 1EOGA 2H66A 2VD0A 2HSMA 1TJDA 5AGYA 1RQMA 1J08A 3RBTA 1G7OA 4O5RA 3GV1A 2I4AA 3TKSE 5A34A 5HR1A 3DD3A 3TRXA 3HJMA 3F3QA 2B5EA 4MH3A 4BVYB 2GZPA 3KP9A 5KN3A 3TRPA 5CRDA 2H75A 1G6WA 3A3TA 1ZL9A 4WBRD 3VFIA 3KMNA 5B6MA 3VPTA 4I8BA 4XCSA 4E68A 3RDWA 3P90A 5H5QA 1AQVA 3HA9A 3IA1A 3IK9A 3PH9A 1A8LA 3GSTA 1GH2A 2WCIA 1QQ2A 4OO5A 4OFMA 3IBHA 4Q5RA 4Q5QA 4TR3A 5D96A 2OE3A 4TXVA 4DSRA 2QA1A 2R0PA 4WKWA 4JEDA 4K7NA 3FR6A 3EU3A 2OADA 4L0WA 4BWSA 2RLIA 2R5GA 5D93A 1TK0B 4POLA 2OKAA 1SK2A 1UA5A 5DQYA 4H86A 5LD0A 1XW6A 4TN8A 2L5LA 4O92A 3L9VA 5AN1A 2B5YA 4BPYA 2FA8A 4KSOA 3QAWA 3G7YA 3GKMA 5J4UA 4EDZA 2MBTA 1I1IP 4HSCX 2B7KA 2LRCA 4IBPA 2P31A 3KD0A 5DAKB 5HR0A 5H5RA 3A5IA 1B9YC 2GT6A 5A5KA 3APOA 4HOJA 3VWVA 1TOFA 1AQXA 2ON7A 1ZYNA 5C00A 2YWMA 3ZLPA 3LQ7A 3R3EA 3FR9A 2YZHA 2DKIA 1CQGA 3ZVJA 2R3XA 3CBUA 4E8HA 3GMFA 3ERGA 2H71A 3VK9A 2RUEA 2HZFA 5ID2A 2HYXA 2WJUA 1TK8B 4Q5FA 3J7Yb 2GLRA 1V57A 4USSA 5HQPA 6GSYA 2O8VB 3GKNA 4PQ1A 1OC9B 1XWGA 1TU8A 4JRRA 4ID0A 1OE7A 5DJMA 1HNAA 1SYXA 1SD8A 5CO3A 2ES7A 1EV4A 3UVHA 1A2LA 1PMTA 1OC9A 4AJ6A 1VGLA 2NBSA 2J9HA 4K5RA 1FB6A 1B4QA 5FHIA 1JLWA 3G7JA 3LWAA 1U88A 1T00A 2DJJA 4EIPA 5KN0A 3GURA 4KF9A 5D73A 2VCTA 3O3TA 2L59A 3DVWA 2JSYA 3H8QA 5IMFA 4Z2RA 2P5RA 1QK8A 5B7CA 4V1Ap 1YF0A 3UL3A 5B8BA 4CW9A 4ECIA 3KM6A 5DALB 1MDIA 3ME8A 4ILFA 3TOTA 1SENA 4ZBDA 3LORA 3UMAA 2R37A 2R0GA 4OCEA 2F51A 1XWAA 1QMVA 4ICYA 3W8SA 3CTFA 3P2AA 1F6MC 3IAM2 2K9FA 2WZ9A 4NV5A 1ST9A 2H30A 4NWYA 1GSFA 2CA8A 2LS5A 4J2FA 1RW1A 1O7UA 1A23A 2HNLA 5AIXA 2VM2A 1MD3A 1K0NA 3DIEA 3ISOA 2YV9A 2IMFA 2LNSA 2VLVA 3Q6OA 4XS6A 5C04A 3CYNA 2O87A 2AUVA 2H1LA 2H1GA 2FLSA 1GUHA 1TK5B 2YPMA 5COHA 1V40A 4F2IA 2PGTA 2YWOA 5BMUA 2B5XA 1T3BA 4YKGA 2A4VA 4K7IA 2MZCA 3V1WA 1N25A 1S3DA 3L9UA 4F0CA 4XRDA 1SJZA 2HLSA 4NPBA 2JSZA 8GSSA 1SYRA 3HDCA 4HUAA 3PR8A 3DKSA 1PKWA 1YEWC 1PD21 4PNFA 4FXYP 2UZ8A 1XIYA 1KTEA 5ECMB 2YN1A 1GRXA 4KCAA 1GL8A 1ZYPA 4EC0A 2HFDA 1V2AA 2WVZA 1ZZYA 3A5WA 4KX4A 3ZIVA 3E0UA 3DGQA 1YQ1A 5ECOB 1JZOA 3C73A 1SU9A 5IO2A 2L4CA 1M3JA 3TCOA 4K1FA 2LTKA 1BJXA 1LBKA 5J4YA 1TRSA 4BL7A 4V2NA 1U3AA 4V1Ag 5G2ZA 4F03A 1URMA 4AJ7A 5G5FA 2GT5A 3SWLA 3L4NA 4FH8A 1X9SB 4V2LA 1K3LA 3LXTA 4KW6A 2VUPA 3KH7A 4IN0A 2CZ2A 3DYRA 2LJKA 2OT3A 4GSNA 1YDKA 5G31A 3FR3A 1TRUA 3HXSA 1SL0B 1J0FA 4POMA 3FZ9A 4KH7A 5D8IA 1ZYEA 3GFKA 4JZQA 4PQIA 3E3EA 3IC8A 3LJRA 1BG1A 3DVXA 2FWHA 2KOKA 2WVYA 2HRFA 4XS1A 1DE1A 3F63A 2PVOC 3GYKA 4W66A 2X49A 1U6TA 4HI7A 4MJAA 5GSSA 3ZZXA 3LYPA 4GSTA 4HJMA 4E8EA 2GDRA 3D22A 1F2EA 1ZGNA 2WVXB 1QXHA 2OACA 3MWHA 1OC8A 1ERVA 3ZITA 4NV2A 2AB6A 1TI3A 4XIHA 1UN2A 5J5NA 4ZL8A
chains in the Genus database with same CATH topology
3ED3A 3EMXA 2FHEA 3TKSA 4KAEA 2VIMA 3TGZA 4BVXB 4WR4A 3QR6A 2XPEA 2VL2A 2GSSA 2DBCA 5GAND 4G0LA 3C1SA 4QL7A 2GZZA 2V2GA 2HSYA 1Y25A 3MAKA 5ECLB 1JHBA 2C8UA 4MLYA 4MPGA 2IFQB 1N2AA 1XVWA 2PBJA 4MMMA 3QD9A 5D9XA 1GWCA 3ZREA 5BRTA 1ON4A 2OBKA 3HVSA 3M3MA 2FY6A 5DVBA 1PA3A 1WMJA 3RHCA 3TRQA 2LRTA 2K8VA 4TKYA 1TW9A 1BG5A 2PERA 2WDUA 2O7KA 3G9BA 1GSEA 5D9VA 3APQA 1TDIA 1GSSA 1OKTA 3M0FA 1R5AA 1K3YA 2H70A 4DSSA 2LJAA 2NVLA 3D5JA 3LYKA 4HU9A 2XBIA 4TXOB 2E0QA 4OCFA 1M2AA 1EP8A 1WP0A 5EVOA 3PPUA 2V1MA 2V41A 1ERUA 3ZTLA 20GSA 3GTUB 1AIUA 3HVXA 4AKXB 2QA2A 1ILOA 3WGEA 2FUG2 2GQLA 4NHZA 1VF1A 4P3YB 3TJGA 1EGOA 1SVMA 3GRXA 1GTAA 3FHKA 4KUNA 1VRSD 3FY7A 1PGTA 4KGIA 4DEJA 2AYTA 2LQQA 2YANA 2IL3A 4X0XA 1UC7A 2HRKB 1XVQA 2VCXA 2F8AA 5JWQB 4TR0A 1SK0A 4F0BA 2E7PA 4ZB9A 2PVQA 2RUFA 4OWYA 2KUCA 3HCZA 2HRKA 2CAIA 4ISDA 5F0GA 2VL9A 1RK4A 3GN3A 1SJIA 1MTCA 1YZXA 3C8EA 5KEJA 13GSA 2DJ2A 2MMOA 1V58A 5CP1A 4BVYA 4KE3A 2HZEB 5ELGA 3MIXA 4HZ2A 4AKHA 1JZWA 2GGTA 5B6NA 1AXDA 1SJ6A 1K0BA 5GSTA 1U3IA 2GTUA 1KEBA 3E9JB 3VWUA 4PQHA 2EFEA 16GSA 1GUKA 3GH6A 2R4VA 1UVZA 4IW9A 2YWNA 3CRUA 1PKZA 5IMZA 2FNOA 4TR1B 2EFDA 4PURA 4GLTA 2B1KA 22GSA 2H76A 2LUSA 2LJRA 3TOUA 5A4VA 2L5OA 4MCUA 2WGRA 1K0AA 5ECPB 1NSWA 1YF1A 2XPDA 4X4JA 3F3RA 1F3AA 1GSDA 2M80A 1ZCPA 3IDVA 4IP1A 3TKSC 3I9V2 5KOXA 3D6IA 3TB2A 2VL2C 3LGCA 1WIKA 3F4RA 4WETA 1FAAA 1ML6A 4EDYA 4FYUA 4POBA 5IOWA 3UARA 1WJKA 3GKKA 1BYEA 2HSHA 2PWJA 4PNGA 3CSJA 4AJ8A 2WULA 2OA7A 1XOBA 5DAKA 1X5DA 1XOAA 4HQZA 2GVPA 4IELA 2QGVA 4ZB6A 2YZUA 2IJYA 2QKEA 2H19A 3IPZA 3MDKA 2L6DA 4JR4A 4MZWA 3F4TA 3M9KA 2NPBA 2DJ0A 1XPVA 2HXKA 2A2RA 1YKCA 1Z6NA 1NW2A 2P0GA 2VLTA 1GTUA 1EEJA 2AHEA 1I5GA 2C0GA 2KP2A 4FYCA 3EYTA 2FD3A 4LL1B 12GSA 4ZB7A 4K6XA 2X64A 5A1NB 3FEUA 4MDCA 2L6CA 5ECNB 4BA7A 5F05A 2ZUPA 2H6YA 3D21A 1IYHA 2WS2A 4QQ7A 4IP6A 3NIVA 5G30A 5HFIA 4WEYA 1Z7PA 2TRCP 2G2QA 4I2TA 3BD2A 1TXUA 1A0FA 1GP1A 1PSQA 4KA0A 5ECRB 3A2WA 4MJCA 1BQ7A 1YY7A 2C0DA 4EE0A 3TJKA 1YVLA 2DJ3A 5G1KA 1VF4A 1O8WA 2F9SA 1PQNA 3Q18A 3ZFBA 1THOA 1NHOA 3ZRDA 3FZ5A 4ZBBA 1T4YA 1F9MA 2AJQB 2XHFA 1OVNA 4AI6A 3LG6A 3EVIA 3UBKA 1Q4JA 4OFTA 1A24A 1GSQA 2MBSA 4CHSA 5DALA 3KGKA 4MH2A 1X9WB 3EC3A 3IE3A 1M99A 3ZYWA 5IMVA 3WYWA 1GULA 1AC1A 5GAPD 1MEKA 1GTBA 5IMDA 3EWLA 2YCDA 3FZAA 4XHMA 3KJYA 1YKAA 4QMKA 4EF0A 4GQFA 4N0ZA 1M0UA 1OC3A 4LL4B 2H73A 4K9ZA 1BF5A 3J7Yk 3MSZA 2DJKA 3ME7A 5G5EA 5J40A 5IPHA 2O89A 4GQCA 5IOXA 4G01A 5J4VA 1XBSA 4YQVA 5E4WA 4TR4A 2EFHA 3GL3A 1K0DA 2H01A 2EIOA 4KB3A 1U87A 3A2VA 3VI7A 2EFCA 2C80A 3TDGA 4RUVA 5CRGA 1PX6A 1FW1A 1TRVA 3A2XA 1W89A 2HSNB 4AF2A 3QCPA 2J23A 3LW9A 3G7IA 4OD7A 4Z7XA 2DLXA 1FVJA 4XS4B 2IMIA 3TKRA 1JZDA 2LEGA 2MMAA 3O76A 3P8WA 1SL1B 2DKHA 3D4TA 2K6VA 2VCVA 1NM3A 5ELAA 5ECIB 4L5LA 5HR2A 2N5AA 4G9HA 4FYBA 1TI1A 4K0NA 2DC5A 1V98A 2H74A 4MJBA 1K0OA 4HJ2A 5G1LA 5F07A 17GSA 4GCIA 3MYDA 4G0KA 5FWGA 2BMXA 4N11A 2GSRA 4HEA2 4WR5A 2R2JA 4AKGA 1GLQA 5A5HB 1Z3EA 3TKPA 3M9JA 4I6XA 3I6AA 1DUGA 5LCZA 2JZTA 3N9JA 3WD6A 5A5HA 3C1RA 1SVOA 1YEPA 3EMPA 4D73B 4JR6A 4X1UA 4ACSA 4IS0A 2NTOA 1DBYA 4XTSA 3OR5A 4G10A 3KCMA 2OE1A 3HJPA 4KNDA 3HHVA 4PTSA 2M46A 4N3ZA 4L8EA 4CY8A 1PN9A 2LQOA 3UVTA 4GF0A 5J47A 4HZ4A 5AISA 4K7OA 3WGDA 4OFNA 2CAQA 4EUYA 3HZ8A 5AIVA 3VURA 4Z2UA 2IMKA 4K2DA 2VOCA 1MDJA 5D9TA 1FO5A 2V32A 6GSSA 2IPAA 1G7EA 2KP1A 2ZNMA 4GXZA 1S3AA 1M2DA 4NHWA 2IWTA 2ZCTA 1YEXA 3KZQA 4I5QA 2E2GA 2FWGA 4I97A 6GSUA 2LV3A 4OMVA 4ECBA 1DSBA 4TRXA 3IC4A 2YOIA 2QSIA 3U5RE 4FQUA 4ZBAA 2LKUA 1O85A 4MA9A 4YH2A 4LMVA 4BVXA 2L4QA 4F9ZA 4YQUA 1O8XA 4O5QA 3F4SA 3NOFA 2IFQA 19GSA 1S3CA 1THXA 3CXGA 3QAGA 2RM5A 1FOVA 1X9MB 3PINA 5F8BA 2B7JA 3DEXA 3UEMA 1NHYA 3F6DA 2GS3A 3C71A 3UBLA 1PL1A 3Q19A 5JCUA 5IMAA 2YP6A 4YKFA 1G0TA 2H1BA 4A5PA 3U6VA 4MF7A 1WPIA 5L71A 2JZSA 3IHQA 4JU5A 3LXZA 2C0FA 1X5CA 2HE3A 5CYYA 2C4JA 1SKSB 1KBNA 2C1YA 3ZMLA 3US3A 1HYUA 4GTUA 4GRFA 4ZILA 4N30A 4TXOA 1A2JA 2C3NA 4EVMA 2H72A 1WRYA 3QDNA 1EEMA 3ZIJA 2VM1A 1OE8A 3D0ZA 2WRTA 2YNXA 4IHUA 1Y6EA 4L5OA 1B48A 1EZKA 2WB9A 3IV4A 3FMWA 3GTUA 4N10A 4MNNA 2OJLA 3CTGA 3GUSA 2CZ3A 4RI6A 3TU3B 5CRHA 5IMCA 1V9WA 2E2MA 3ZVJD 2JU5A 1WOUA 3TUEA 4MJEA 1C72A 2H1DA 3CRTA 1TRWA 5DCHA 5KN1A 2G0FA 1R5PA 1Z7RA 3HMJG 4MZCA 3CSIA 3HY2A 4FIWA 5HFGA 4YAPA 2YV7A 2HSMB 4PUFC 5HFKA 3O6TA 3TJBA 1Y1UA 3FYGA 5A34B 2XC2A 4G0IA 4TVEA 3WT2A 4J56E 3APSA 3EPTA 2HQTA 1J9BA 2DJ1A 1K0MA 3QOUA 2AV4A 1Z5YE 5J9CA 2DIZA 2A2SA 5D9WA 6GSTA 3TJFA 4KDYA 1Z6MA 4HU7A 3KTBA 5ECHB 3L78A 1B9XC 2HI7A 3F0IA 1OKDA 4DSQA 5A4UA 2IMDA 2D2ZA 5IQYA 2HZEA 1EP7A 4K5SA 11GSA 1BAYA 1EGRA 1GTIA 4IJ3A 3DRNA 1ZMAA 3F8UA 3EU4A 10GSA 3GNJA 2PUKC 3W6GA 4FO5A 1SD9A 2P5QA 3IAS2 2TIRA 4WBJA 1TKDB 1XCCA 4KDUA 1T8EB 1H75A 2PMTA 1M9BA 4TR1A 1K3OA 4J57E 2R6KA 2IMEA 4Q5NA 2DMMA 3M1GA 2MYGA 3UIWA 4F82A 1EOHA 2HRAA 3D4MA 3GHAA 4HS1A 2CT6A 3K8NA 4WF4A 4OO4A 2KLXA 4IQAA 4ZXGA 3LSZA 2CVKA 5JCGA 3UJ1A 3FRCA 9GSSA 1O6JA 5E59A 3HJOA 1GNEA 4AGSA 1ERTA 4ULXA 1H4OA 5H5SA 1ZOFA 2C3TA 1Z9HA 5J41A 2L57A 3VWXA 3H79A 3GKXA 1TP9A 1VF3A 4YQMA 4K0GA 1SK1A 2B3SA 5LNKe 1TU7A 2A2PA 1Q98A 2B6MA 2CQ9A 4PGTA 2WFCA 1R26A 3KP8A 3R2QA 2CX4A 1BX9A 1T1VA 4HDEA 3FK8A 2JADA 2K18A 1FOHA 2YJHA 6GSXA 1G6YA 5ID2B 3VPQA 3S9FA 1PL2A 5ABRA 4TOPA 3ERWA 1HNBA 4GDFA 2OBIA 2CVBA 3PGTA 1M2BA 1GSYA 2MMZA 1XWBA 4ECCA 4V2MA 3VWWA 3DWVA 1W4VA 4MK3A 1XWKA 2VL3A 1XFLA 3QPMA 3GSSA 1SKWB 2QC7A 3SBCA 4RQXA 4RQRA 4CDOA 2VKZG 2O85A 5CAXA 4ZL9A 5A1NA 4X43A 5GZZB 1GSUA 5J9BA 2AAWA 3KTLA 2VAFA 2I81A 3MNGA 2DIYA 3DXBA 1F37A 1PN0A 3BJ5A 1MD4A 3I69A 3RPNA 1YJ6A 4PUAA 1WWJA 3H4KA 2GQKA 2UV8G 4O32A 3ZFLA 2CX3A 3IK7A 1OYJA 3HZ4A 3WT1A 3M8NA 4YAVA 1I9DA 5HR3A 4MPFA 2K8SA 2REMA 3L0HA 3FZ4A 1XXUA 1XZOA 1BEDA 1B4PA 5A4WA 2HT9A 4KSMA 1DE2A 1ABAA 2GSTA 4NAXA 3BCIA 2YJ7A 1T7PB 1A0RP 1WE0A 1F3BA 2JACA 2H6ZA 1VF2A 2HRNA 5CRWA 3IHGA 3TJJA 2H0GA 4LA1A 4O5UA 3NZNA 3ZMKA 3RAZA 1PRXA 1XWCA 1TXXA 2DMLA 2H1AA 3EURA 3KIJA 3KH9A 5IM9A 3FW2A 3AY8A 5B8AA 1O73A 1SVLA 1M9AA 3UAPA 2BJXA 4JE1A 1E6BA 3CMIA 2GZYA 4IKHA 2LSTA 5BMUB 1SKRB 2X99A 7GSSA 3RPPA 5DDLA 1IYIA 3DMLA 4WXTA 1GLPA 4MF6A 1FHEA 2I9HA 3WGXA 4MABA 2Z9SA 4EKZA 4BWQA 1HQOA 2HSNA 3VI5A 2A4HA 3VLNA 2FGXA 3HVVA 4ML1A 3GA4A 2FWEA 4TW5A 1OAZA 2F8FA 4XS4A 4KDXA 4RI7A 1O81A 1TTZA 3TKQA 3N5OA 3EE2A 1KNGA 1QUWA 2JZRA 1M7TA 2PN8A 4WF5A 2H0IA 2LNTA 4EIQA 1XW9A 1K0CA 3F6FA 4IVFA 4EXJA 1X0RA 4BL7B 3GL5A 2VD1A 5IPGA 2O5VA 1A8YA 3C7MA 3CSHA 3IR4A 2X8GA 1FB0A 4EO3A 3IRAA 3L9SA 4Z2TA 5JCWA 5FT3A 4HQSA 1HNCA 4NXIA 1GUMA 5EL8A 4ECJA 2RIIA 5ECQB 3HD5A 3H1NA 2FWFA 4G19A 2ON5A 2I1UA 4MF5A 1QFNA 3QFBC 2LRNA 2IN3A 5IIZA 4I2UA 4MZBA 1R4WA 6GSWA 4D73A 2IIYA 2B1LA 2N5BA 4O7HA 1AAZA 1QGVA 4ZL7A 4GSSA 4G2EA 1PX7A 3Q74A 2FCHA 3BBYA 2C3QA 2NDOA 5ENUA 3ERFA 2PU9C 1X5EA 2V6OA 4K2XA 1ZYQB 3BOAA 18GSA 5DJLA 3KXOA 3P7XA 1EV9A 4XRAA 2EIQA 1CQHA 1B8XA 3W8JA 4CY6A 5CREA 1XW5A 2OE0A 5DBQA 5DCGA 2CVDA 1T4ZA 2VLUA 4K8MA 4DVCA 2C0EA 5INYA 2X4AA 2H8LA 2DSAA 4EL1A 2EC4A 4POKA 2N5FA 2RM6A 3H93A 3EINA 1SL2B 2I3YA 5JWRB 2BTOT 4AKIA 4ML6A 4NMUA 4LLRA 2XBQA 3BCKA 3KEBA 3CWGA 1JLVA 3LFLA 4GWRA 1LU4A 5CNWA 4N0VA 3JCML 5KN2A 2M72A 2VO4A 3FKFA 3GIXA 3LEFA 4PXOA 3KMOA 4L0UA 5KOWA 2F3MA 4DSSB 4IGJA 1MDKA 5J3RA 4IJIA 1USBA 14GSA 2GQMA 5JWOB 2CV4A 1A2MA 1ERWA 1HD2A 3QFAC 2KHPA 3IOSA 2X8CA 2VCWA 2H0HA 2YWIA 2GSQA 5EY6A 5F06A 1JFUA 3I43A 3RHBA 6GSVA 2MMNA 2VCQA 1AQWA 3ZL5A 3F9UA 2PPTA 1EWXA 2R0CA 1LJRA 1FVKA 4ZB8A 2FA4A 1FG4A 3GX0A 4KCEA 4LMWA 3UOMA 3QMXA 3IXRA 4QL9A 1N8JA 1JZRA 2TRXA 4IQ1A 1E2YA 1R7HA 2EIRA 1ACVA 2ALBA 3QAVA 5IO0A 2JL4A 1AW9A 5DQSA 4JBBA 5ECKB 3GX8A 1GNWA 1AUCA 3HYPA 5ECSA 4ZIJA 2H6XA 5EPFA 3HKRA 3GH9A 4MP4A 2X8HA 2V6KA 4PX1A 2VCZA 1EOGA 2H66A 2VD0A 2HSMA 1TJDA 5AGYA 1RQMA 1J08A 3RBTA 1G7OA 4O5RA 3GV1A 2I4AA 3TKSE 5A34A 5HR1A 3DD3A 3TRXA 3HJMA 3F3QA 2B5EA 4MH3A 4BVYB 2GZPA 3KP9A 5KN3A 3TRPA 5CRDA 2H75A 1G6WA 3A3TA 1ZL9A 4WBRD 3VFIA 3KMNA 5B6MA 3VPTA 4I8BA 4XCSA 4E68A 3RDWA 3P90A 5H5QA 1AQVA 3HA9A 3IA1A 3IK9A 3PH9A 1A8LA 3GSTA 1GH2A 2WCIA 1QQ2A 4OO5A 4OFMA 3IBHA 4Q5RA 4Q5QA 4TR3A 5D96A 2OE3A 4TXVA 4DSRA 2QA1A 2R0PA 4WKWA 4JEDA 4K7NA 3FR6A 3EU3A 2OADA 4L0WA 4BWSA 2RLIA 2R5GA 5D93A 1TK0B 4POLA 2OKAA 1SK2A 1UA5A 5DQYA 4H86A 5LD0A 1XW6A 4TN8A 2L5LA 4O92A 3L9VA 5AN1A 2B5YA 4BPYA 2FA8A 4KSOA 3QAWA 3G7YA 3GKMA 5J4UA 4EDZA 2MBTA 2B7KA 2LRCA 4IBPA 2P31A 3KD0A 5DAKB 5HR0A 5H5RA 3A5IA 1B9YC 2GT6A 5A5KA 3APOA 4HOJA 3VWVA 1TOFA 1AQXA 2ON7A 1ZYNA 5C00A 2YWMA 3ZLPA 3LQ7A 3R3EA 3FR9A 2YZHA 2DKIA 1CQGA 3ZVJA 2R3XA 3CBUA 4E8HA 3GMFA 3ERGA 2H71A 3VK9A 2RUEA 2HZFA 5ID2A 2HYXA 2WJUA 1TK8B 4Q5FA 3J7Yb 2GLRA 1V57A 4USSA 5HQPA 6GSYA 2O8VB 3GKNA 4PQ1A 1OC9B 1XWGA 1TU8A 4JRRA 4ID0A 1OE7A 5DJMA 1HNAA 1SYXA 1SD8A 5CO3A 2ES7A 1EV4A 3UVHA 1A2LA 1PMTA 1OC9A 4AJ6A 1VGLA 2NBSA 2J9HA 4K5RA 1FB6A 1B4QA 5FHIA 1JLWA 3G7JA 3LWAA 1U88A 1T00A 2DJJA 4EIPA 5KN0A 3GURA 4KF9A 5D73A 2VCTA 3O3TA 2L59A 3DVWA 2JSYA 3H8QA 5IMFA 4Z2RA 2P5RA 1QK8A 5B7CA 4V1Ap 1YF0A 3UL3A 5B8BA 4CW9A 4ECIA 3KM6A 5DALB 1MDIA 3ME8A 4ILFA 3TOTA 1SENA 4ZBDA 3LORA 3UMAA 2R37A 2R0GA 4OCEA 2F51A 1XWAA 1QMVA 4ICYA 3W8SA 3CTFA 3P2AA 1F6MC 3IAM2 2K9FA 2WZ9A 4NV5A 1ST9A 2H30A 4NWYA 1GSFA 2CA8A 2LS5A 4J2FA 1RW1A 1O7UA 1A23A 2HNLA 5AIXA 2VM2A 1MD3A 1K0NA 3DIEA 3ISOA 2YV9A 2IMFA 2LNSA 2VLVA 3Q6OA 4XS6A 5C04A 3CYNA 2O87A 2AUVA 2H1LA 2H1GA 2FLSA 1GUHA 1TK5B 2YPMA 5COHA 1V40A 4F2IA 2PGTA 2YWOA 5BMUA 2B5XA 1T3BA 4YKGA 2A4VA 4K7IA 2MZCA 3V1WA 1N25A 1S3DA 3L9UA 4F0CA 4XRDA 1SJZA 2HLSA 4NPBA 2JSZA 8GSSA 1SYRA 3HDCA 4HUAA 3PR8A 3DKSA 1PKWA 1PD21 4PNFA 2UZ8A 1XIYA 1KTEA 5ECMB 2YN1A 1GRXA 4KCAA 1GL8A 1ZYPA 4EC0A 2HFDA 1V2AA 1ZZYA 3A5WA 4KX4A 3ZIVA 3E0UA 3DGQA 1YQ1A 5ECOB 1JZOA 3C73A 1SU9A 5IO2A 2L4CA 3TCOA 4K1FA 2LTKA 1BJXA 1LBKA 5J4YA 1TRSA 4BL7A 4V2NA 1U3AA 4V1Ag 5G2ZA 4F03A 1URMA 4AJ7A 5G5FA 2GT5A 3SWLA 3L4NA 4FH8A 1X9SB 4V2LA 1K3LA 3LXTA 4KW6A 2VUPA 3KH7A 4IN0A 2CZ2A 3DYRA 2LJKA 2OT3A 4GSNA 1YDKA 5G31A 3FR3A 1TRUA 3HXSA 1SL0B 1J0FA 4POMA 3FZ9A 4KH7A 5D8IA 1ZYEA 3GFKA 4JZQA 4PQIA 3E3EA 3IC8A 3LJRA 1BG1A 3DVXA 2FWHA 2KOKA 2HRFA 4XS1A 1DE1A 3F63A 2PVOC 3GYKA 4W66A 2X49A 1U6TA 4HI7A 4MJAA 5GSSA 3ZZXA 3LYPA 4GSTA 4HJMA 4E8EA 2GDRA 3D22A 1F2EA 1ZGNA 1QXHA 2OACA 3MWHA 1OC8A 1ERVA 3ZITA 4NV2A 2AB6A 1TI3A 4XIHA 1UN2A 5J5NA 4ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ED3 A;  3EMX A;  2FHE A;  3TKS A;  4KAE A;  2VIM A;  3TGZ A;  4BVX B;  4WR4 A;  3QR6 A;  2XPE A;  2VL2 A;  2GSS A;  2DBC A;  5GAN D;  4G0L A;  3C1S A;  4QL7 A;  2GZZ A;  2V2G A;  2HSY A;  1Y25 A;  3MAK A;  5ECL B;  1JHB A;  2C8U A;  4MLY A;  4MPG A;  2IFQ B;  1N2A A;  1XVW A;  2PBJ A;  4MMM A;  3QD9 A;  5D9X A;  1GWC A;  3ZRE A;  1ON4 A;  2OBK A;  3HVS A;  3M3M A;  2FY6 A;  5DVB A;  1PA3 A;  1WMJ A;  3RHC A;  3TRQ A;  2LRT A;  2K8V A;  4TKY A;  1TW9 A;  1BG5 A;  2PER A;  2WDU A;  2O7K A;  3G9B A;  1GSE A;  5D9V A;  3APQ A;  1TDI A;  1GSS A;  1OKT A;  3M0F A;  1R5A A;  1K3Y A;  2H70 A;  4DSS A;  2LJA A;  2NVL A;  3D5J A;  3LYK A;  4HU9 A;  2XBI A;  4TXO B;  2E0Q A;  4OCF A;  1M2A A;  1EP8 A;  1WP0 A;  5EVO A;  3PPU A;  2V1M A;  2V41 A;  1ERU A;  3ZTL A;  20GS A;  3GTU B;  1AIU A;  3HVX A;  1ILO A;  3WGE A;  2FUG 2;  2GQL A;  4NHZ A;  1VF1 A;  4P3Y B;  3TJG A;  1EGO A;  3GRX A;  1GTA A;  3FHK A;  4KUN A;  1VRS D;  3FY7 A;  1PGT A;  4KGI A;  4DEJ A;  2AYT A;  2LQQ A;  2YAN A;  2IL3 A;  4X0X A;  1UC7 A;  2HRK B;  1XVQ A;  2VCX A;  2F8A A;  5JWQ B;  4TR0 A;  1SK0 A;  4F0B A;  2E7P A;  4ZB9 A;  2PVQ A;  2RUF A;  4OWY A;  2KUC A;  3HCZ A;  2HRK A;  2CAI A;  4ISD A;  5F0G A;  2VL9 A;  1RK4 A;  3GN3 A;  1SJI A;  1MTC A;  1YZX A;  3C8E A;  5KEJ A;  13GS A;  2DJ2 A;  2MMO A;  1V58 A;  5CP1 A;  4BVY A;  4KE3 A;  2HZE B;  5ELG A;  4HZ2 A;  1JZW A;  2GGT A;  5B6N A;  1AXD A;  1SJ6 A;  1K0B A;  5GST A;  1U3I A;  2GTU A;  1KEB A;  3E9J B;  3VWU A;  4PQH A;  16GS A;  1GUK A;  3GH6 A;  2R4V A;  1UVZ A;  4IW9 A;  2YWN A;  3CRU A;  1PKZ A;  5IMZ A;  2FNO A;  4TR1 B;  4PUR A;  4GLT A;  2B1K A;  22GS A;  2H76 A;  2LUS A;  2LJR A;  3TOU A;  5A4V A;  2L5O A;  4MCU A;  2WGR A;  1K0A A;  5ECP B;  1NSW A;  1YF1 A;  2XPD A;  3F3R A;  1F3A A;  1GSD A;  2M80 A;  1ZCP A;  3IDV A;  4IP1 A;  3TKS C;  3I9V 2;  3D6I A;  3TB2 A;  2VL2 C;  3LGC A;  1WIK A;  3F4R A;  4WET A;  1FAA A;  1ML6 A;  4EDY A;  4FYU A;  4POB A;  5IOW A;  3UAR A;  1WJK A;  3GKK A;  1BYE A;  2HSH A;  2PWJ A;  4PNG A;  3CSJ A;  4AJ8 A;  2WUL A;  2OA7 A;  1XOB A;  5DAK A;  1X5D A;  1XOA A;  4HQZ A;  2GVP A;  4IEL A;  2QGV A;  4ZB6 A;  2YZU A;  2IJY A;  2QKE A;  2H19 A;  3IPZ A;  3MDK A;  2L6D A;  4JR4 A;  4MZW A;  3F4T A;  3M9K A;  2NPB A;  2DJ0 A;  1XPV A;  2HXK A;  2A2R A;  1YKC A;  1Z6N A;  1NW2 A;  2P0G A;  2VLT A;  1GTU A;  1EEJ A;  2AHE A;  1I5G A;  2C0G A;  2KP2 A;  4FYC A;  3EYT A;  2FD3 A;  4LL1 B;  12GS A;  4K6X A;  2X64 A;  3FEU A;  4MDC A;  2L6C A;  5ECN B;  4BA7 A;  5F05 A;  2ZUP A;  2H6Y A;  3D21 A;  1IYH A;  2WS2 A;  4QQ7 A;  4IP6 A;  3NIV A;  5G30 A;  5HFI A;  4WEY A;  1Z7P A;  2TRC P;  2G2Q A;  4I2T A;  3BD2 A;  1A0F A;  1GP1 A;  4KA0 A;  1PSQ A;  5ECR B;  3A2W A;  4MJC A;  1BQ7 A;  1YY7 A;  2C0D A;  4EE0 A;  3TJK A;  2DJ3 A;  5G1K A;  1VF4 A;  1O8W A;  2F9S A;  1PQN A;  3Q18 A;  3ZFB A;  1THO A;  1NHO A;  3ZRD A;  3FZ5 A;  4ZBB A;  1T4Y A;  1F9M A;  2AJQ B;  2XHF A;  1OVN A;  3LG6 A;  3EVI A;  3UBK A;  1Q4J A;  4OFT A;  1A24 A;  1GSQ A;  2MBS A;  4CHS A;  5DAL A;  3KGK A;  4MH2 A;  1X9W B;  3EC3 A;  3IE3 A;  1M99 A;  3ZYW A;  5IMV A;  3WYW A;  1GUL A;  1AC1 A;  5GAP D;  1MEK A;  1GTB A;  5IMD A;  3EWL A;  2YCD A;  3FZA A;  4XHM A;  3KJY A;  1YKA A;  4EF0 A;  4GQF A;  4N0Z A;  1M0U A;  1OC3 A;  4LL4 B;  2H73 A;  4K9Z A;  3J7Y k;  3MSZ A;  2DJK A;  3ME7 A;  5G5E A;  5IPH A;  2O89 A;  4GQC A;  5IOX A;  1XBS A;  5E4W A;  4YQV A;  4TR4 A;  3GL3 A;  1K0D A;  2H01 A;  2EIO A;  4KB3 A;  1U87 A;  3A2V A;  3VI7 A;  2C80 A;  3TDG A;  4RUV A;  5CRG A;  1PX6 A;  1FW1 A;  1TRV A;  3A2X A;  1W89 A;  2HSN B;  4AF2 A;  3QCP A;  2J23 A;  3G7I A;  4OD7 A;  4Z7X A;  2DLX A;  1FVJ A;  4XS4 B;  2IMI A;  3TKR A;  1JZD A;  2LEG A;  2MMA A;  3O76 A;  3P8W A;  1SL1 B;  3D4T A;  2K6V A;  2VCV A;  1NM3 A;  5ELA A;  5ECI B;  4L5L A;  5HR2 A;  2N5A A;  4G9H A;  4FYB A;  1TI1 A;  4K0N A;  2DC5 A;  1V98 A;  2H74 A;  4MJB A;  1K0O A;  4HJ2 A;  5G1L A;  5F07 A;  17GS A;  4GCI A;  4G0K A;  5FWG A;  2BMX A;  4N11 A;  2GSR A;  4HEA 2;  4WR5 A;  2R2J A;  1GLQ A;  1Z3E A;  3TKP A;  3M9J A;  4I6X A;  3I6A A;  1DUG A;  5LCZ A;  2JZT A;  3N9J A;  3WD6 A;  3C1R A;  1YEP A;  3EMP A;  4D73 B;  4JR6 A;  4X1U A;  4ACS A;  4IS0 A;  2NTO A;  1DBY A;  4XTS A;  3OR5 A;  4G10 A;  3KCM A;  2OE1 A;  3HJP A;  4KND A;  3HHV A;  4PTS A;  2M46 A;  4L8E A;  1PN9 A;  2LQO A;  3UVT A;  4GF0 A;  4HZ4 A;  5AIS A;  4K7O A;  3WGD A;  4OFN A;  2CAQ A;  4EUY A;  3HZ8 A;  5AIV A;  3VUR A;  2IMK A;  4K2D A;  2VOC A;  1MDJ A;  5D9T A;  1FO5 A;  2V32 A;  6GSS A;  2IPA A;  1G7E A;  2KP1 A;  2ZNM A;  4GXZ A;  1S3A A;  1M2D A;  4NHW A;  2IWT A;  2ZCT A;  1YEX A;  3KZQ A;  4I5Q A;  2E2G A;  2FWG A;  4I97 A;  6GSU A;  2LV3 A;  4OMV A;  4ECB A;  1DSB A;  4TRX A;  3IC4 A;  2YOI A;  2QSI A;  3U5R E;  4FQU A;  4ZBA A;  2LKU A;  1O85 A;  4MA9 A;  4YH2 A;  4LMV A;  4BVX A;  2L4Q A;  4F9Z A;  4YQU A;  1O8X A;  3F4S A;  3NOF A;  2IFQ A;  19GS A;  1S3C A;  1THX A;  3CXG A;  3QAG A;  2RM5 A;  1FOV A;  1X9M B;  3PIN A;  5F8B A;  2B7J A;  3DEX A;  3UEM A;  1NHY A;  3F6D A;  2GS3 A;  3C71 A;  3UBL A;  1PL1 A;  3Q19 A;  5JCU A;  5IMA A;  2YP6 A;  1G0T A;  2H1B A;  3U6V A;  4MF7 A;  1WPI A;  5L71 A;  2JZS A;  3IHQ A;  4JU5 A;  3LXZ A;  2C0F A;  1X5C A;  2HE3 A;  5CYY A;  2C4J A;  1SKS B;  1KBN A;  2C1Y A;  3ZML A;  3US3 A;  1HYU A;  4GTU A;  4GRF A;  4ZIL A;  4N30 A;  4TXO A;  1A2J A;  2C3N A;  4EVM A;  2H72 A;  1WRY A;  3QDN A;  1EEM A;  3ZIJ A;  2VM1 A;  1OE8 A;  3D0Z A;  2WRT A;  2YNX A;  4IHU A;  1Y6E A;  4L5O A;  1B48 A;  1EZK A;  2WB9 A;  3IV4 A;  3GTU A;  4N10 A;  2OJL A;  3CTG A;  3GUS A;  2CZ3 A;  4RI6 A;  5CRH A;  5IMC A;  1V9W A;  2E2M A;  3ZVJ D;  2JU5 A;  1WOU A;  3TUE A;  4MJE A;  1C72 A;  2H1D A;  3CRT A;  1TRW A;  5DCH A;  5KN1 A;  2G0F A;  1R5P A;  1Z7R A;  4MZC A;  3CSI A;  3HY2 A;  4FIW A;  5HFG A;  4YAP A;  2YV7 A;  2HSM B;  4PUF C;  5HFK A;  3O6T A;  3TJB A;  4TVE A;  3FYG A;  2XC2 A;  4G0I A;  3WT2 A;  4J56 E;  3APS A;  2HQT A;  1J9B A;  2DJ1 A;  1K0M A;  3QOU A;  2AV4 A;  1Z5Y E;  5J9C A;  2DIZ A;  2A2S A;  5D9W A;  6GST A;  3TJF A;  4KDY A;  1Z6M A;  4HU7 A;  3KTB A;  5ECH B;  3L78 A;  1B9X C;  2HI7 A;  3F0I A;  1OKD A;  4DSQ A;  5A4U A;  2IMD A;  2D2Z A;  5IQY A;  2HZE A;  1EP7 A;  11GS A;  1BAY A;  1EGR A;  1GTI A;  4IJ3 A;  3DRN A;  1ZMA A;  3F8U A;  3EU4 A;  10GS A;  3GNJ A;  2PUK C;  3W6G A;  4FO5 A;  1SD9 A;  2P5Q A;  3IAS 2;  2TIR A;  4WBJ A;  1TKD B;  1XCC A;  4KDU A;  1T8E B;  1H75 A;  2PMT A;  1M9B A;  4TR1 A;  1K3O A;  4J57 E;  2R6K A;  2IME A;  4Q5N A;  2DMM A;  3M1G A;  2MYG A;  3UIW A;  4F82 A;  1EOH A;  2HRA A;  3D4M A;  3GHA A;  4HS1 A;  2CT6 A;  3K8N A;  4WF4 A;  4OO4 A;  2KLX A;  4IQA A;  4ZXG A;  3LSZ A;  2CVK A;  5JCG A;  3UJ1 A;  3FRC A;  9GSS A;  1O6J A;  5E59 A;  3HJO A;  1GNE A;  4AGS A;  1ERT A;  4ULX A;  1H4O A;  5H5S A;  1ZOF A;  2C3T A;  1Z9H A;  5J41 A;  2L57 A;  3VWX A;  3H79 A;  3GKX A;  1TP9 A;  1VF3 A;  4YQM A;  4K0G A;  1SK1 A;  2B3S A;  5LNK e;  1TU7 A;  1Q98 A;  2B6M A;  2CQ9 A;  4PGT A;  2WFC A;  1R26 A;  3KP8 A;  3R2Q A;  2CX4 A;  1BX9 A;  1T1V A;  4HDE A;  3FK8 A;  2JAD A;  2K18 A;  2YJH A;  6GSX A;  1G6Y A;  5ID2 B;  3VPQ A;  3S9F A;  1PL2 A;  5ABR A;  4TOP A;  3ERW A;  1HNB A;  2OBI A;  2CVB A;  3PGT A;  1M2B A;  1GSY A;  2MMZ A;  1XWB A;  4ECC A;  4V2M A;  3VWW A;  3DWV A;  1W4V A;  4MK3 A;  1XWK A;  2VL3 A;  1XFL A;  3QPM A;  3GSS A;  1SKW B;  2QC7 A;  3SBC A;  4RQX A;  4RQR A;  4CDO A;  2O85 A;  5CAX A;  4ZL9 A;  4X43 A;  5GZZ B;  1GSU A;  5J9B A;  2AAW A;  3KTL A;  2VAF A;  2I81 A;  3MNG A;  2DIY A;  3DXB A;  1F37 A;  3BJ5 A;  1MD4 A;  3I69 A;  3RPN A;  1YJ6 A;  4PUA A;  1WWJ A;  3H4K A;  2GQK A;  4O32 A;  3ZFL A;  2CX3 A;  3IK7 A;  1OYJ A;  3HZ4 A;  3WT1 A;  3M8N A;  4YAV A;  1I9D A;  5HR3 A;  4MPF A;  2K8S A;  2REM A;  3L0H A;  3FZ4 A;  1XXU A;  1XZO A;  1BED A;  1B4P A;  5A4W A;  2HT9 A;  4KSM A;  1DE2 A;  1ABA A;  2GST A;  4NAX A;  3BCI A;  2YJ7 A;  1T7P B;  1A0R P;  1WE0 A;  1F3B A;  2JAC A;  2H6Z A;  1VF2 A;  2HRN A;  5CRW A;  3TJJ A;  2H0G A;  4LA1 A;  3NZN A;  3ZMK A;  3RAZ A;  1PRX A;  1XWC A;  1TXX A;  2DML A;  2H1A A;  3EUR A;  3KIJ A;  3KH9 A;  5IM9 A;  3FW2 A;  3AY8 A;  5B8A A;  1O73 A;  1M9A A;  3UAP A;  2BJX A;  4JE1 A;  1E6B A;  3CMI A;  2GZY A;  4IKH A;  2LST A;  1SKR B;  2X99 A;  7GSS A;  3RPP A;  5DDL A;  1IYI A;  3DML A;  4WXT A;  1GLP A;  4MF6 A;  1FHE A;  2I9H A;  3WGX A;  4MAB A;  2Z9S A;  4EKZ A;  4BWQ A;  1HQO A;  2FGX A;  3VI5 A;  3VLN A;  3HVV A;  4ML1 A;  3GA4 A;  2FWE A;  4TW5 A;  1OAZ A;  2F8F A;  4XS4 A;  4KDX A;  4RI7 A;  1O81 A;  1TTZ A;  3TKQ A;  3N5O A;  3EE2 A;  1KNG A;  1QUW A;  2JZR A;  1M7T A;  2PN8 A;  4WF5 A;  2H0I A;  2LNT A;  1XW9 A;  1K0C A;  3F6F A;  4IVF A;  4EXJ A;  1X0R A;  4BL7 B;  3GL5 A;  2VD1 A;  5IPG A;  1A8Y A;  3C7M A;  3CSH A;  3IR4 A;  2X8G A;  1FB0 A;  4EO3 A;  3IRA A;  3L9S A;  5JCW A;  5FT3 A;  4HQS A;  1HNC A;  4NXI A;  1GUM A;  5EL8 A;  4ECJ A;  2RII A;  5ECQ B;  3HD5 A;  3H1N A;  2FWF A;  4G19 A;  2ON5 A;  2I1U A;  4MF5 A;  1QFN A;  3QFB C;  2LRN A;  2IN3 A;  5IIZ A;  4I2U A;  4MZB A;  1R4W A;  6GSW A;  4D73 A;  2IIY A;  2B1L A;  2N5B A;  4O7H A;  1AAZ A;  1QGV A;  4ZL7 A;  4GSS A;  4G2E A;  1PX7 A;  3Q74 A;  2FCH A;  3BBY A;  2C3Q A;  2NDO A;  5ENU A;  3ERF A;  2PU9 C;  1X5E A;  2V6O A;  1ZYQ B;  3BOA A;  18GS A;  5DJL A;  3KXO A;  3P7X A;  1EV9 A;  4XRA A;  2EIQ A;  1CQH A;  1B8X A;  3W8J A;  5CRE A;  1XW5 A;  2OE0 A;  5DBQ A;  5DCG A;  2CVD A;  1T4Z A;  2VLU A;  4K8M A;  4DVC A;  2C0E A;  5INY A;  2H8L A;  2DSA A;  4EL1 A;  2EC4 A;  4POK A;  2N5F A;  2RM6 A;  3H93 A;  3EIN A;  1SL2 B;  2I3Y A;  5JWR B;  2BTO T;  4ML6 A;  4NMU A;  4LLR A;  2XBQ A;  3BCK A;  3KEB A;  1JLV A;  3LFL A;  4GWR A;  1LU4 A;  5CNW A;  4N0V A;  3JCM L;  5KN2 A;  2M72 A;  2VO4 A;  3FKF A;  3GIX A;  3LEF A;  4PXO A;  3KMO A;  4L0U A;  2F3M A;  4DSS B;  4IGJ A;  1MDK A;  5J3R A;  4IJI A;  1USB A;  14GS A;  2GQM A;  5JWO B;  2CV4 A;  1A2M A;  1ERW A;  1HD2 A;  3QFA C;  2KHP A;  3IOS A;  2X8C A;  2VCW A;  2H0H A;  2YWI A;  2GSQ A;  5EY6 A;  5F06 A;  1JFU A;  3I43 A;  3RHB A;  6GSV A;  2MMN A;  2VCQ A;  1AQW A;  3ZL5 A;  3F9U A;  2PPT A;  1EWX A;  1LJR A;  1FVK A;  4ZB8 A;  2FA4 A;  1FG4 A;  3GX0 A;  4KCE A;  4LMW A;  3UOM A;  3QMX A;  3IXR A;  4QL9 A;  1N8J A;  1JZR A;  2TRX A;  4IQ1 A;  1E2Y A;  1R7H A;  2EIR A;  1ACV A;  2ALB A;  3QAV A;  5IO0 A;  2JL4 A;  1AW9 A;  5DQS A;  4JBB A;  5ECK B;  3GX8 A;  1GNW A;  1AUC A;  3HYP A;  5ECS A;  4ZIJ A;  2H6X A;  5EPF A;  3HKR A;  3GH9 A;  4MP4 A;  2X8H A;  2V6K A;  4PX1 A;  2VCZ A;  1EOG A;  2H66 A;  2VD0 A;  2HSM A;  1TJD A;  5AGY A;  1RQM A;  1J08 A;  3RBT A;  1G7O A;  4O5R A;  3GV1 A;  2I4A A;  3TKS E;  5HR1 A;  3DD3 A;  3TRX A;  3HJM A;  3F3Q A;  2B5E A;  4MH3 A;  4BVY B;  2GZP A;  3KP9 A;  5KN3 A;  3TRP A;  5CRD A;  2H75 A;  1G6W A;  3A3T A;  1ZL9 A;  4WBR D;  3VFI A;  3KMN A;  5B6M A;  3VPT A;  4I8B A;  4XCS A;  3RDW A;  3P90 A;  5H5Q A;  1AQV A;  3HA9 A;  3IA1 A;  3IK9 A;  3PH9 A;  1A8L A;  3GST A;  1GH2 A;  2WCI A;  1QQ2 A;  4OO5 A;  4OFM A;  3IBH A;  4Q5R A;  4Q5Q A;  4TR3 A;  5D96 A;  2OE3 A;  4TXV A;  4DSR A;  4WKW A;  4JED A;  4K7N A;  3FR6 A;  3EU3 A;  2OAD A;  4L0W A;  4BWS A;  2RLI A;  2R5G A;  5D93 A;  1TK0 B;  4POL A;  2OKA A;  1SK2 A;  1UA5 A;  5DQY A;  4H86 A;  5LD0 A;  1XW6 A;  4TN8 A;  2L5L A;  4O92 A;  3L9V A;  5AN1 A;  2B5Y A;  4BPY A;  2FA8 A;  4KSO A;  3QAW A;  3G7Y A;  3GKM A;  5J4U A;  4EDZ A;  2MBT A;  2B7K A;  2LRC A;  4IBP A;  2P31 A;  3KD0 A;  5DAK B;  5HR0 A;  5H5R A;  1B9Y C;  2GT6 A;  5A5K A;  3APO A;  4HOJ A;  3VWV A;  1TOF A;  1AQX A;  2ON7 A;  5C00 A;  2YWM A;  3ZLP A;  3LQ7 A;  3R3E A;  3FR9 A;  2YZH A;  1CQG A;  3ZVJ A;  2R3X A;  3CBU A;  4E8H A;  3GMF A;  3ERG A;  2H71 A;  3VK9 A;  2RUE A;  2HZF A;  5ID2 A;  2HYX A;  2WJU A;  1TK8 B;  4Q5F A;  3J7Y b;  2GLR A;  1V57 A;  4USS A;  5HQP A;  6GSY A;  2O8V B;  3GKN A;  4PQ1 A;  1OC9 B;  1XWG A;  1TU8 A;  4JRR A;  4ID0 A;  1OE7 A;  5DJM A;  1HNA A;  1SYX A;  1SD8 A;  5CO3 A;  2ES7 A;  1EV4 A;  3UVH A;  1A2L A;  1PMT A;  1OC9 A;  4AJ6 A;  1VGL A;  2NBS A;  2J9H A;  1FB6 A;  1B4Q A;  5FHI A;  1JLW A;  3G7J A;  3LWA A;  1U88 A;  1T00 A;  2DJJ A;  5KN0 A;  3GUR A;  4KF9 A;  5D73 A;  2VCT A;  3O3T A;  2L59 A;  3DVW A;  2JSY A;  3H8Q A;  5IMF A;  2P5R A;  1QK8 A;  5B7C A;  4V1A p;  1YF0 A;  3UL3 A;  5B8B A;  4CW9 A;  4ECI A;  3KM6 A;  5DAL B;  1MDI A;  3ME8 A;  4ILF A;  3TOT A;  1SEN A;  4ZBD A;  3LOR A;  3UMA A;  2R37 A;  4OCE A;  2F51 A;  1XWA A;  1QMV A;  3W8S A;  3CTF A;  3P2A A;  1F6M C;  3IAM 2;  2K9F A;  2WZ9 A;  4NV5 A;  1ST9 A;  2H30 A;  4NWY A;  1GSF A;  2CA8 A;  2LS5 A;  4J2F A;  1RW1 A;  1O7U A;  1A23 A;  2HNL A;  5AIX A;  2VM2 A;  1MD3 A;  1K0N A;  3DIE A;  3ISO A;  2YV9 A;  2IMF A;  2LNS A;  2VLV A;  3Q6O A;  4XS6 A;  5C04 A;  3CYN A;  2O87 A;  2AUV A;  2H1G A;  2FLS A;  1GUH A;  1TK5 B;  2YPM A;  5COH A;  1V40 A;  4F2I A;  2PGT A;  2YWO A;  5BMU A;  2B5X A;  1T3B A;  2A4V A;  4K7I A;  2MZC A;  3V1W A;  1S3D A;  3L9U A;  4F0C A;  4XRD A;  1SJZ A;  2HLS A;  4NPB A;  2JSZ A;  8GSS A;  1SYR A;  3HDC A;  4HUA A;  3PR8 A;  3DKS A;  1PKW A;  1PD2 1;  4PNF A;  2UZ8 A;  1XIY A;  1KTE A;  5ECM B;  2YN1 A;  1GRX A;  4KCA A;  1GL8 A;  4EC0 A;  2HFD A;  1V2A A;  1ZZY A;  3A5W A;  4KX4 A;  3ZIV A;  3E0U A;  3DGQ A;  1YQ1 A;  5ECO B;  1JZO A;  3C73 A;  1SU9 A;  5IO2 A;  2L4C A;  3TCO A;  4K1F A;  2LTK A;  1BJX A;  1LBK A;  1TRS A;  4BL7 A;  4V2N A;  1U3A A;  4V1A g;  5G2Z A;  4F03 A;  1URM A;  4AJ7 A;  5G5F A;  2GT5 A;  3SWL A;  3L4N A;  4FH8 A;  1X9S B;  4V2L A;  1K3L A;  3LXT A;  4KW6 A;  2VUP A;  3KH7 A;  4IN0 A;  2CZ2 A;  3DYR A;  2LJK A;  4GSN A;  1YDK A;  5G31 A;  3FR3 A;  1TRU A;  3HXS A;  1SL0 B;  1J0F A;  4POM A;  3FZ9 A;  4KH7 A;  5D8I A;  1ZYE A;  3GFK A;  4JZQ A;  4PQI A;  3E3E A;  3IC8 A;  3LJR A;  3DVX A;  2FWH A;  2KOK A;  2HRF A;  4XS1 A;  1DE1 A;  3F63 A;  2PVO C;  3GYK A;  1U6T A;  4HI7 A;  4MJA A;  5GSS A;  3ZZX A;  3LYP A;  4GST A;  4HJM A;  4E8E A;  2GDR A;  3D22 A;  1F2E A;  1ZGN A;  1QXH A;  2OAC A;  3MWH A;  1OC8 A;  1ERV A;  3ZIT A;  4NV2 A;  2AB6 A;  1TI3 A;  4XIH A;  1UN2 A;  5J5N A;  4ZL8 A; 
#chains in the Genus database with same CATH topology
 3ED3 A;  3EMX A;  2WW1 A;  2FHE A;  3TKS A;  2WVX A;  4KAE A;  2VIM A;  3TGZ A;  4BVX B;  4WR4 A;  3QR6 A;  2XPE A;  2VL2 A;  2GSS A;  2DBC A;  5GAN D;  4G0L A;  3C1S A;  4QL7 A;  2GZZ A;  2V2G A;  2HSY A;  1Y25 A;  3MAK A;  5ECL B;  1JHB A;  2C8U A;  4MLY A;  4MPG A;  2IFQ B;  1N2A A;  1XVW A;  2PBJ A;  4MMM A;  3QD9 A;  5D9X A;  1GWC A;  3ZRE A;  5BRT A;  1ON4 A;  2OBK A;  3HVS A;  3M3M A;  2FY6 A;  5DVB A;  4PI2 C;  1PA3 A;  1WMJ A;  3RHC A;  3TRQ A;  2LRT A;  2K8V A;  4TKY A;  1TW9 A;  1BG5 A;  2PER A;  2WDU A;  2O7K A;  3G9B A;  1GSE A;  5D9V A;  3APQ A;  1TDI A;  2WZS A;  1GSS A;  1OKT A;  3M0F A;  1R5A A;  1K3Y A;  2H70 A;  4DSS A;  2LJA A;  2NVL A;  3D5J A;  3LYK A;  4HU9 A;  2XBI A;  4TXO B;  2E0Q A;  4OCF A;  1M2A A;  1EP8 A;  1WP0 A;  5EVO A;  3PPU A;  2V1M A;  2V41 A;  1ERU A;  3ZTL A;  20GS A;  3GTU B;  1AIU A;  3HVX A;  4AKX B;  2QA2 A;  1ILO A;  3WGE A;  2FUG 2;  2GQL A;  4NHZ A;  1VF1 A;  4P3Y B;  3TJG A;  1EGO A;  1SVM A;  3GRX A;  1GTA A;  3FHK A;  4KUN A;  1VRS D;  3FY7 A;  1PGT A;  4KGI A;  4DEJ A;  2AYT A;  2LQQ A;  2YAN A;  2IL3 A;  4X0X A;  1UC7 A;  2HRK B;  1XVQ A;  2VCX A;  2F8A A;  5JWQ B;  4TR0 A;  1SK0 A;  4F0B A;  2E7P A;  4ZB9 A;  2PVQ A;  2RUF A;  4OWY A;  2KUC A;  3HCZ A;  2HRK A;  2CAI A;  4ISD A;  3RGB C;  5F0G A;  2VL9 A;  1RK4 A;  3GN3 A;  1SJI A;  1MTC A;  1YZX A;  3C8E A;  5KEJ A;  13GS A;  2DJ2 A;  2MMO A;  1V58 A;  5CP1 A;  4BVY A;  4KE3 A;  2HZE B;  5ELG A;  3MIX A;  4HZ2 A;  4AKH A;  1JZW A;  2GGT A;  5B6N A;  1AXD A;  1SJ6 A;  1K0B A;  5GST A;  4PI0 C;  1U3I A;  2GTU A;  1KEB A;  3E9J B;  3VWU A;  4PQH A;  2EFE A;  16GS A;  1GUK A;  3GH6 A;  2R4V A;  1UVZ A;  4IW9 A;  2YWN A;  3CRU A;  1PKZ A;  5IMZ A;  2FNO A;  4TR1 B;  2EFD A;  4PUR A;  4GLT A;  2B1K A;  22GS A;  2H76 A;  2LUS A;  2LJR A;  3TOU A;  5A4V A;  2L5O A;  4MCU A;  2WGR A;  1K0A A;  5ECP B;  1NSW A;  1YF1 A;  1S4B P;  2XPD A;  4X4J A;  3F3R A;  1F3A A;  1GSD A;  2M80 A;  1ZCP A;  3IDV A;  4IP1 A;  3TKS C;  3I9V 2;  5KOX A;  3D6I A;  3TB2 A;  2VL2 C;  3LGC A;  1WIK A;  3F4R A;  4WET A;  1FAA A;  1ML6 A;  4EDY A;  4FYU A;  4POB A;  5IOW A;  3UAR A;  1WJK A;  3RFR C;  3GKK A;  1BYE A;  2HSH A;  2PWJ A;  4PNG A;  3CSJ A;  4AJ8 A;  2WUL A;  2OA7 A;  1XOB A;  5DAK A;  1X5D A;  1XOA A;  4HQZ A;  2GVP A;  4IEL A;  2QGV A;  4ZB6 A;  2YZU A;  2IJY A;  2QKE A;  2H19 A;  3IPZ A;  3MDK A;  2L6D A;  4JR4 A;  4MZW A;  3F4T A;  3M9K A;  2NPB A;  2DJ0 A;  1XPV A;  2HXK A;  2A2R A;  1YKC A;  1Z6N A;  1NW2 A;  2P0G A;  2VLT A;  1GTU A;  1EEJ A;  2AHE A;  1I5G A;  2C0G A;  2KP2 A;  4FYC A;  3EYT A;  2FD3 A;  4LL1 B;  12GS A;  4ZB7 A;  4K6X A;  2X64 A;  5A1N B;  3FEU A;  4MDC A;  1M3I A;  2L6C A;  5ECN B;  4BA7 A;  5F05 A;  2ZUP A;  2H6Y A;  3D21 A;  1IYH A;  2WS2 A;  4QQ7 A;  4IP6 A;  4BIK A;  3NIV A;  5G30 A;  5HFI A;  4WEY A;  1Z7P A;  2TRC P;  2G2Q A;  4I2T A;  3BD2 A;  1TXU A;  1A0F A;  1GP1 A;  1PSQ A;  4KA0 A;  5ECR B;  3A2W A;  4MJC A;  1BQ7 A;  1YY7 A;  2C0D A;  4EE0 A;  3TJK A;  1YVL A;  2DJ3 A;  5G1K A;  1VF4 A;  1O8W A;  2F9S A;  1PQN A;  3Q18 A;  3ZFB A;  1THO A;  1NHO A;  3ZRD A;  3FZ5 A;  4ZBB A;  1T4Y A;  1F9M A;  2AJQ B;  2XHF A;  1OVN A;  4AI6 A;  3LG6 A;  3EVI A;  3UBK A;  1Q4J A;  4OFT A;  1A24 A;  1GSQ A;  2MBS A;  4CHS A;  5DAL A;  3KGK A;  4MH2 A;  1X9W B;  3EC3 A;  3IE3 A;  1M99 A;  3ZYW A;  5IMV A;  3WYW A;  1GUL A;  1AC1 A;  5GAP D;  1MEK A;  1GTB A;  5IMD A;  3EWL A;  2YCD A;  3FZA A;  4XHM A;  3KJY A;  1YKA A;  4QMK A;  4EF0 A;  4GQF A;  4N0Z A;  1M0U A;  1OC3 A;  4LL4 B;  2H73 A;  4K9Z A;  1BF5 A;  3J7Y k;  3MSZ A;  2DJK A;  3ME7 A;  5G5E A;  5J40 A;  5IPH A;  2O89 A;  4GQC A;  5IOX A;  4G01 A;  5J4V A;  1XBS A;  4YQV A;  5E4W A;  4TR4 A;  2EFH A;  3GL3 A;  1K0D A;  2H01 A;  2EIO A;  4KB3 A;  1U87 A;  3A2V A;  3VI7 A;  2EFC A;  2C80 A;  3TDG A;  4RUV A;  5CRG A;  1PX6 A;  1FW1 A;  1TRV A;  3A2X A;  1W89 A;  2O36 A;  2HSN B;  4AF2 A;  3QCP A;  2J23 A;  3LW9 A;  3G7I A;  4OD7 A;  4Z7X A;  2DLX A;  1FVJ A;  4XS4 B;  2IMI A;  3TKR A;  1JZD A;  2LEG A;  2MMA A;  3O76 A;  3P8W A;  1SL1 B;  2DKH A;  3D4T A;  2K6V A;  2VCV A;  1NM3 A;  5ELA A;  5ECI B;  4L5L A;  5HR2 A;  2N5A A;  4G9H A;  4FYB A;  1TI1 A;  4K0N A;  2DC5 A;  1V98 A;  2H74 A;  4MJB A;  1K0O A;  4HJ2 A;  5G1L A;  5F07 A;  17GS A;  4GCI A;  3MYD A;  4G0K A;  5FWG A;  2BMX A;  4N11 A;  2GSR A;  4HEA 2;  4WR5 A;  2R2J A;  4AKG A;  1GLQ A;  5A5H B;  1Z3E A;  3TKP A;  3M9J A;  4I6X A;  3I6A A;  1DUG A;  5LCZ A;  2JZT A;  3N9J A;  3WD6 A;  3CQF A;  5A5H A;  3C1R A;  1SVO A;  1YEP A;  3EMP A;  4D73 B;  4JR6 A;  4X1U A;  4ACS A;  4IS0 A;  2NTO A;  1DBY A;  4XTS A;  3OR5 A;  4G10 A;  3KCM A;  4PHZ C;  2OE1 A;  3HJP A;  4KND A;  3HHV A;  4PTS A;  2M46 A;  4N3Z A;  4L8E A;  4CY8 A;  1PN9 A;  2LQO A;  3UVT A;  4GF0 A;  5J47 A;  4HZ4 A;  5AIS A;  4K7O A;  3WGD A;  4OFN A;  2CAQ A;  4EUY A;  3HZ8 A;  5AIV A;  3VUR A;  4Z2U A;  2IMK A;  4K2D A;  2O3E A;  2VOC A;  1MDJ A;  5D9T A;  1FO5 A;  2V32 A;  6GSS A;  2IPA A;  1G7E A;  2KP1 A;  2ZNM A;  4GXZ A;  1S3A A;  1M2D A;  4NHW A;  2IWT A;  2ZCT A;  1YEX A;  3KZQ A;  4I5Q A;  2E2G A;  2FWG A;  4I97 A;  6GSU A;  2LV3 A;  4OMV A;  4ECB A;  1DSB A;  4TRX A;  3IC4 A;  2YOI A;  2QSI A;  3U5R E;  4FQU A;  4ZBA A;  2LKU A;  1O85 A;  4MA9 A;  1XG8 A;  4YH2 A;  4LMV A;  4BVX A;  2L4Q A;  4F9Z A;  4YQU A;  1O8X A;  4O5Q A;  3F4S A;  3NOF A;  2IFQ A;  19GS A;  1S3C A;  1THX A;  3CXG A;  3QAG A;  2RM5 A;  1FOV A;  1X9M B;  3PIN A;  5F8B A;  2B7J A;  3DEX A;  3UEM A;  1NHY A;  3F6D A;  2GS3 A;  3C71 A;  3UBL A;  1PL1 A;  3Q19 A;  5JCU A;  5IMA A;  2YP6 A;  4YKF A;  1G0T A;  2H1B A;  4A5P A;  3U6V A;  4MF7 A;  1WPI A;  5L71 A;  2JZS A;  3IHQ A;  4JU5 A;  3LXZ A;  2C0F A;  1X5C A;  2HE3 A;  5CYY A;  2C4J A;  1SKS B;  1KBN A;  2C1Y A;  3ZML A;  3US3 A;  1HYU A;  4GTU A;  4GRF A;  4ZIL A;  4N30 A;  4TXO A;  1A2J A;  2C3N A;  4EVM A;  2H72 A;  1WRY A;  3QDN A;  1EEM A;  3ZIJ A;  2VM1 A;  1OE8 A;  3D0Z A;  2WRT A;  2YNX A;  4IHU A;  1Y6E A;  4L5O A;  1B48 A;  1EZK A;  2WB9 A;  3IV4 A;  3FMW A;  3GTU A;  4N10 A;  4MNN A;  2OJL A;  3CTG A;  3GUS A;  2CZ3 A;  4RI6 A;  3TU3 B;  5CRH A;  5IMC A;  1V9W A;  2E2M A;  3ZVJ D;  2JU5 A;  1WOU A;  3TUE A;  4MJE A;  1C72 A;  2H1D A;  3CRT A;  1TRW A;  5DCH A;  5KN1 A;  2G0F A;  1R5P A;  1Z7R A;  3HMJ G;  4MZC A;  3CSI A;  3HY2 A;  4FIW A;  5HFG A;  4YAP A;  2YV7 A;  2HSM B;  4PUF C;  5HFK A;  3O6T A;  3TJB A;  1Y1U A;  3FYG A;  5A34 B;  2XC2 A;  4G0I A;  4TVE A;  3WT2 A;  4J56 E;  3APS A;  3EPT A;  2HQT A;  1J9B A;  2DJ1 A;  1K0M A;  3QOU A;  2AV4 A;  1Z5Y E;  1S3R A;  5J9C A;  2DIZ A;  2A2S A;  5D9W A;  6GST A;  3TJF A;  4KDY A;  1Z6M A;  4HU7 A;  3KTB A;  5ECH B;  3L78 A;  1B9X C;  2HI7 A;  3F0I A;  1OKD A;  4DSQ A;  5A4U A;  2IMD A;  2D2Z A;  5IQY A;  2HZE A;  1EP7 A;  4K5S A;  11GS A;  1BAY A;  1EGR A;  1GTI A;  4IJ3 A;  3DRN A;  1ZMA A;  3F8U A;  3EU4 A;  10GS A;  3GNJ A;  2PUK C;  3W6G A;  4FO5 A;  1SD9 A;  2P5Q A;  3IAS 2;  2TIR A;  4WBJ A;  1TKD B;  1XCC A;  4KDU A;  1T8E B;  1H75 A;  2PMT A;  1M9B A;  4TR1 A;  1K3O A;  4J57 E;  2R6K A;  2IME A;  4Q5N A;  2DMM A;  3M1G A;  2MYG A;  3UIW A;  4F82 A;  1EOH A;  2HRA A;  3D4M A;  3GHA A;  4HS1 A;  2CT6 A;  3K8N A;  4WF4 A;  4OO4 A;  2KLX A;  4IQA A;  4ZXG A;  3LSZ A;  2CVK A;  5JCG A;  3UJ1 A;  3FRC A;  9GSS A;  1O6J A;  5E59 A;  3HJO A;  1GNE A;  4AGS A;  1ERT A;  4ULX A;  1H4O A;  5H5S A;  1ZOF A;  2C3T A;  1Z9H A;  5J41 A;  2L57 A;  3VWX A;  3H79 A;  3GKX A;  1TP9 A;  1VF3 A;  4YQM A;  4K0G A;  1SK1 A;  2B3S A;  5LNK e;  1TU7 A;  2A2P A;  1Q98 A;  2B6M A;  2CQ9 A;  4PGT A;  2WFC A;  1R26 A;  3KP8 A;  3R2Q A;  2CX4 A;  1BX9 A;  1T1V A;  4HDE A;  3FK8 A;  2JAD A;  2K18 A;  1FOH A;  2YJH A;  6GSX A;  1G6Y A;  5ID2 B;  3VPQ A;  3S9F A;  1PL2 A;  5ABR A;  4TOP A;  3ERW A;  1HNB A;  4GDF A;  2OBI A;  2CVB A;  3PGT A;  1M2B A;  1GSY A;  2MMZ A;  1XWB A;  4ECC A;  4V2M A;  3VWW A;  3DWV A;  1W4V A;  4MK3 A;  1XWK A;  2VL3 A;  1XFL A;  3QPM A;  3GSS A;  1SKW B;  2QC7 A;  3SBC A;  4RQX A;  4RQR A;  4CDO A;  2VKZ G;  2O85 A;  5CAX A;  4ZL9 A;  5A1N A;  4X43 A;  5GZZ B;  1GSU A;  5J9B A;  2AAW A;  3KTL A;  2VAF A;  2WW0 A;  2I81 A;  3MNG A;  2DIY A;  3DXB A;  1F37 A;  1PN0 A;  3BJ5 A;  1MD4 A;  3I69 A;  3RPN A;  1YJ6 A;  4PUA A;  1WWJ A;  3H4K A;  2GQK A;  2UV8 G;  4O32 A;  3ZFL A;  2CX3 A;  3IK7 A;  1OYJ A;  3HZ4 A;  3WT1 A;  3M8N A;  4YAV A;  1I9D A;  5HR3 A;  4MPF A;  2K8S A;  2REM A;  3L0H A;  3FZ4 A;  1XXU A;  1XZO A;  1BED A;  1B4P A;  5A4W A;  2HT9 A;  4KSM A;  1DE2 A;  1ABA A;  2GST A;  4NAX A;  3BCI A;  2YJ7 A;  1T7P B;  1A0R P;  1WE0 A;  1F3B A;  2JAC A;  2H6Z A;  1VF2 A;  2HRN A;  5CRW A;  3IHG A;  3TJJ A;  2H0G A;  4LA1 A;  4O5U A;  3NZN A;  3ZMK A;  3RAZ A;  1PRX A;  1XWC A;  1TXX A;  2DML A;  2H1A A;  3EUR A;  3KIJ A;  3KH9 A;  5IM9 A;  3FW2 A;  3AY8 A;  5B8A A;  1O73 A;  1SVL A;  1M9A A;  3UAP A;  2BJX A;  4JE1 A;  1E6B A;  3CMI A;  2GZY A;  4IKH A;  2LST A;  5BMU B;  1SKR B;  2X99 A;  7GSS A;  3RPP A;  5DDL A;  1IYI A;  3DML A;  4WXT A;  1GLP A;  4MF6 A;  1FHE A;  2I9H A;  3WGX A;  4MAB A;  2Z9S A;  4EKZ A;  4BWQ A;  1HQO A;  2HSN A;  3VI5 A;  2A4H A;  3VLN A;  2FGX A;  3HVV A;  4ML1 A;  3GA4 A;  2FWE A;  4TW5 A;  1OAZ A;  2F8F A;  4XS4 A;  4KDX A;  4RI7 A;  1O81 A;  1TTZ A;  3TKQ A;  3N5O A;  3EE2 A;  1KNG A;  1QUW A;  2JZR A;  1M7T A;  2PN8 A;  4WF5 A;  2H0I A;  2LNT A;  4EIQ A;  1XW9 A;  1K0C A;  3F6F A;  4IVF A;  4EXJ A;  1X0R A;  4BL7 B;  3GL5 A;  2VD1 A;  5IPG A;  2O5V A;  1A8Y A;  3C7M A;  3CSH A;  3IR4 A;  2X8G A;  1FB0 A;  4EO3 A;  3IRA A;  3L9S A;  2WW2 A;  4Z2T A;  5JCW A;  5FT3 A;  4HQS A;  1HNC A;  4NXI A;  1GUM A;  5EL8 A;  4ECJ A;  2RII A;  5ECQ B;  3HD5 A;  3HVN A;  3H1N A;  2FWF A;  4G19 A;  2ON5 A;  2I1U A;  4MF5 A;  1QFN A;  3QFB C;  2LRN A;  2IN3 A;  5IIZ A;  4I2U A;  4MZB A;  1R4W A;  6GSW A;  4D73 A;  2IIY A;  2B1L A;  2N5B A;  4O7H A;  1PFO A;  1AAZ A;  1QGV A;  4ZL7 A;  4GSS A;  4G2E A;  1PX7 A;  3Q74 A;  2FCH A;  3BBY A;  2C3Q A;  2NDO A;  5ENU A;  3ERF A;  2PU9 C;  1X5E A;  2V6O A;  4K2X A;  1ZYQ B;  3BOA A;  18GS A;  5DJL A;  3KXO A;  3P7X A;  1EV9 A;  4XRA A;  2EIQ A;  1CQH A;  1B8X A;  3W8J A;  4CY6 A;  5CRE A;  1XW5 A;  2OE0 A;  5DBQ A;  5DCG A;  2CVD A;  1T4Z A;  2VLU A;  4K8M A;  4DVC A;  2C0E A;  5INY A;  2X4A A;  2H8L A;  2DSA A;  4EL1 A;  2EC4 A;  4POK A;  2N5F A;  2RM6 A;  3H93 A;  3EIN A;  1SL2 B;  2I3Y A;  5JWR B;  2BTO T;  4AKI A;  4ML6 A;  4NMU A;  4LLR A;  2XBQ A;  3BCK A;  3KEB A;  3CWG A;  1JLV A;  3LFL A;  4GWR A;  1LU4 A;  5CNW A;  4N0V A;  3JCM L;  5KN2 A;  2M72 A;  2VO4 A;  3FKF A;  3GIX A;  3LEF A;  4PXO A;  3KMO A;  4L0U A;  5KOW A;  2F3M A;  4DSS B;  4IGJ A;  1MDK A;  5J3R A;  4IJI A;  1USB A;  14GS A;  2GQM A;  5JWO B;  2CV4 A;  1A2M A;  1ERW A;  1HD2 A;  3QFA C;  2KHP A;  3IOS A;  2X8C A;  2VCW A;  2H0H A;  2YWI A;  2GSQ A;  2WW3 A;  5EY6 A;  5F06 A;  1JFU A;  3I43 A;  3RHB A;  3CHX C;  6GSV A;  2MMN A;  2VCQ A;  1AQW A;  3ZL5 A;  3F9U A;  2PPT A;  1EWX A;  2R0C A;  1LJR A;  1FVK A;  4ZB8 A;  2FA4 A;  1FG4 A;  3GX0 A;  4KCE A;  4LMW A;  3UOM A;  3QMX A;  3IXR A;  4QL9 A;  1N8J A;  1JZR A;  2TRX A;  4IQ1 A;  1E2Y A;  1R7H A;  2EIR A;  1ACV A;  2ALB A;  3QAV A;  5IO0 A;  2JL4 A;  1AW9 A;  5DQS A;  4JBB A;  5ECK B;  3GX8 A;  1GNW A;  1AUC A;  3HYP A;  5ECS A;  4ZIJ A;  2H6X A;  5EPF A;  3HKR A;  3GH9 A;  4MP4 A;  2X8H A;  2V6K A;  4PX1 A;  2VCZ A;  1EOG A;  2H66 A;  2VD0 A;  2HSM A;  1TJD A;  5AGY A;  1RQM A;  1J08 A;  3RBT A;  1G7O A;  4O5R A;  3GV1 A;  2I4A A;  3TKS E;  5A34 A;  5HR1 A;  3DD3 A;  3TRX A;  3HJM A;  3F3Q A;  2B5E A;  4MH3 A;  4BVY B;  2GZP A;  3KP9 A;  5KN3 A;  3TRP A;  5CRD A;  2H75 A;  1G6W A;  3A3T A;  1ZL9 A;  4WBR D;  3VFI A;  3KMN A;  5B6M A;  3VPT A;  4I8B A;  4XCS A;  4E68 A;  3RDW A;  3P90 A;  5H5Q A;  1AQV A;  3HA9 A;  3IA1 A;  3IK9 A;  3PH9 A;  1A8L A;  3GST A;  1GH2 A;  2WCI A;  1QQ2 A;  4OO5 A;  4OFM A;  3IBH A;  4Q5R A;  4Q5Q A;  4TR3 A;  5D96 A;  2OE3 A;  4TXV A;  4DSR A;  2QA1 A;  2R0P A;  4WKW A;  4JED A;  4K7N A;  3FR6 A;  3EU3 A;  2OAD A;  4L0W A;  4BWS A;  2RLI A;  2R5G A;  5D93 A;  1TK0 B;  4POL A;  2OKA A;  1SK2 A;  1UA5 A;  5DQY A;  4H86 A;  5LD0 A;  1XW6 A;  4TN8 A;  2L5L A;  4O92 A;  3L9V A;  5AN1 A;  2B5Y A;  4BPY A;  2FA8 A;  4KSO A;  3QAW A;  3G7Y A;  3GKM A;  5J4U A;  4EDZ A;  2MBT A;  1I1I P;  4HSC X;  2B7K A;  2LRC A;  4IBP A;  2P31 A;  3KD0 A;  5DAK B;  5HR0 A;  5H5R A;  3A5I A;  1B9Y C;  2GT6 A;  5A5K A;  3APO A;  4HOJ A;  3VWV A;  1TOF A;  1AQX A;  2ON7 A;  1ZYN A;  5C00 A;  2YWM A;  3ZLP A;  3LQ7 A;  3R3E A;  3FR9 A;  2YZH A;  2DKI A;  1CQG A;  3ZVJ A;  2R3X A;  3CBU A;  4E8H A;  3GMF A;  3ERG A;  2H71 A;  3VK9 A;  2RUE A;  2HZF A;  5ID2 A;  2HYX A;  2WJU A;  1TK8 B;  4Q5F A;  3J7Y b;  2GLR A;  1V57 A;  4USS A;  5HQP A;  6GSY A;  2O8V B;  3GKN A;  4PQ1 A;  1OC9 B;  1XWG A;  1TU8 A;  4JRR A;  4ID0 A;  1OE7 A;  5DJM A;  1HNA A;  1SYX A;  1SD8 A;  5CO3 A;  2ES7 A;  1EV4 A;  3UVH A;  1A2L A;  1PMT A;  1OC9 A;  4AJ6 A;  1VGL A;  2NBS A;  2J9H A;  4K5R A;  1FB6 A;  1B4Q A;  5FHI A;  1JLW A;  3G7J A;  3LWA A;  1U88 A;  1T00 A;  2DJJ A;  4EIP A;  5KN0 A;  3GUR A;  4KF9 A;  5D73 A;  2VCT A;  3O3T A;  2L59 A;  3DVW A;  2JSY A;  3H8Q A;  5IMF A;  4Z2R A;  2P5R A;  1QK8 A;  5B7C A;  4V1A p;  1YF0 A;  3UL3 A;  5B8B A;  4CW9 A;  4ECI A;  3KM6 A;  5DAL B;  1MDI A;  3ME8 A;  4ILF A;  3TOT A;  1SEN A;  4ZBD A;  3LOR A;  3UMA A;  2R37 A;  2R0G A;  4OCE A;  2F51 A;  1XWA A;  1QMV A;  4ICY A;  3W8S A;  3CTF A;  3P2A A;  1F6M C;  3IAM 2;  2K9F A;  2WZ9 A;  4NV5 A;  1ST9 A;  2H30 A;  4NWY A;  1GSF A;  2CA8 A;  2LS5 A;  4J2F A;  1RW1 A;  1O7U A;  1A23 A;  2HNL A;  5AIX A;  2VM2 A;  1MD3 A;  1K0N A;  3DIE A;  3ISO A;  2YV9 A;  2IMF A;  2LNS A;  2VLV A;  3Q6O A;  4XS6 A;  5C04 A;  3CYN A;  2O87 A;  2AUV A;  2H1L A;  2H1G A;  2FLS A;  1GUH A;  1TK5 B;  2YPM A;  5COH A;  1V40 A;  4F2I A;  2PGT A;  2YWO A;  5BMU A;  2B5X A;  1T3B A;  4YKG A;  2A4V A;  4K7I A;  2MZC A;  3V1W A;  1N25 A;  1S3D A;  3L9U A;  4F0C A;  4XRD A;  1SJZ A;  2HLS A;  4NPB A;  2JSZ A;  8GSS A;  1SYR A;  3HDC A;  4HUA A;  3PR8 A;  3DKS A;  1PKW A;  1YEW C;  1PD2 1;  4PNF A;  4FXY P;  2UZ8 A;  1XIY A;  1KTE A;  5ECM B;  2YN1 A;  1GRX A;  4KCA A;  1GL8 A;  1ZYP A;  4EC0 A;  2HFD A;  1V2A A;  2WVZ A;  1ZZY A;  3A5W A;  4KX4 A;  3ZIV A;  3E0U A;  3DGQ A;  1YQ1 A;  5ECO B;  1JZO A;  3C73 A;  1SU9 A;  5IO2 A;  2L4C A;  1M3J A;  3TCO A;  4K1F A;  2LTK A;  1BJX A;  1LBK A;  5J4Y A;  1TRS A;  4BL7 A;  4V2N A;  1U3A A;  4V1A g;  5G2Z A;  4F03 A;  1URM A;  4AJ7 A;  5G5F A;  2GT5 A;  3SWL A;  3L4N A;  4FH8 A;  1X9S B;  4V2L A;  1K3L A;  3LXT A;  4KW6 A;  2VUP A;  3KH7 A;  4IN0 A;  2CZ2 A;  3DYR A;  2LJK A;  2OT3 A;  4GSN A;  1YDK A;  5G31 A;  3FR3 A;  1TRU A;  3HXS A;  1SL0 B;  1J0F A;  4POM A;  3FZ9 A;  4KH7 A;  5D8I A;  1ZYE A;  3GFK A;  4JZQ A;  4PQI A;  3E3E A;  3IC8 A;  3LJR A;  1BG1 A;  3DVX A;  2FWH A;  2KOK A;  2WVY A;  2HRF A;  4XS1 A;  1DE1 A;  3F63 A;  2PVO C;  3GYK A;  4W66 A;  2X49 A;  1U6T A;  4HI7 A;  4MJA A;  5GSS A;  3ZZX A;  3LYP A;  4GST A;  4HJM A;  4E8E A;  2GDR A;  3D22 A;  1F2E A;  1ZGN A;  2WVX B;  1QXH A;  2OAC A;  3MWH A;  1OC8 A;  1ERV A;  3ZIT A;  4NV2 A;  2AB6 A;  1TI3 A;  4XIH A;  1UN2 A;  5J5N A;  4ZL8 A; 
#chains in the Genus database with same CATH homology
 3ED3 A;  3EMX A;  2FHE A;  3TKS A;  4KAE A;  2VIM A;  3TGZ A;  4BVX B;  4WR4 A;  3QR6 A;  2XPE A;  2VL2 A;  2GSS A;  2DBC A;  5GAN D;  4G0L A;  3C1S A;  4QL7 A;  2GZZ A;  2V2G A;  2HSY A;  1Y25 A;  3MAK A;  5ECL B;  1JHB A;  2C8U A;  4MLY A;  4MPG A;  2IFQ B;  1N2A A;  1XVW A;  2PBJ A;  4MMM A;  3QD9 A;  5D9X A;  1GWC A;  3ZRE A;  5BRT A;  1ON4 A;  2OBK A;  3HVS A;  3M3M A;  2FY6 A;  5DVB A;  1PA3 A;  1WMJ A;  3RHC A;  3TRQ A;  2LRT A;  2K8V A;  4TKY A;  1TW9 A;  1BG5 A;  2PER A;  2WDU A;  2O7K A;  3G9B A;  1GSE A;  5D9V A;  3APQ A;  1TDI A;  1GSS A;  1OKT A;  3M0F A;  1R5A A;  1K3Y A;  2H70 A;  4DSS A;  2LJA A;  2NVL A;  3D5J A;  3LYK A;  4HU9 A;  2XBI A;  4TXO B;  2E0Q A;  4OCF A;  1M2A A;  1EP8 A;  1WP0 A;  5EVO A;  3PPU A;  2V1M A;  2V41 A;  1ERU A;  3ZTL A;  20GS A;  3GTU B;  1AIU A;  3HVX A;  4AKX B;  2QA2 A;  1ILO A;  3WGE A;  2FUG 2;  2GQL A;  4NHZ A;  1VF1 A;  4P3Y B;  3TJG A;  1EGO A;  1SVM A;  3GRX A;  1GTA A;  3FHK A;  4KUN A;  1VRS D;  3FY7 A;  1PGT A;  4KGI A;  4DEJ A;  2AYT A;  2LQQ A;  2YAN A;  2IL3 A;  4X0X A;  1UC7 A;  2HRK B;  1XVQ A;  2VCX A;  2F8A A;  5JWQ B;  4TR0 A;  1SK0 A;  4F0B A;  2E7P A;  4ZB9 A;  2PVQ A;  2RUF A;  4OWY A;  2KUC A;  3HCZ A;  2HRK A;  2CAI A;  4ISD A;  5F0G A;  2VL9 A;  1RK4 A;  3GN3 A;  1SJI A;  1MTC A;  1YZX A;  3C8E A;  5KEJ A;  13GS A;  2DJ2 A;  2MMO A;  1V58 A;  5CP1 A;  4BVY A;  4KE3 A;  2HZE B;  5ELG A;  3MIX A;  4HZ2 A;  4AKH A;  1JZW A;  2GGT A;  5B6N A;  1AXD A;  1SJ6 A;  1K0B A;  5GST A;  1U3I A;  2GTU A;  1KEB A;  3E9J B;  3VWU A;  4PQH A;  2EFE A;  16GS A;  1GUK A;  3GH6 A;  2R4V A;  1UVZ A;  4IW9 A;  2YWN A;  3CRU A;  1PKZ A;  5IMZ A;  2FNO A;  4TR1 B;  2EFD A;  4PUR A;  4GLT A;  2B1K A;  22GS A;  2H76 A;  2LUS A;  2LJR A;  3TOU A;  5A4V A;  2L5O A;  4MCU A;  2WGR A;  1K0A A;  5ECP B;  1NSW A;  1YF1 A;  2XPD A;  4X4J A;  3F3R A;  1F3A A;  1GSD A;  2M80 A;  1ZCP A;  3IDV A;  4IP1 A;  3TKS C;  3I9V 2;  5KOX A;  3D6I A;  3TB2 A;  2VL2 C;  3LGC A;  1WIK A;  3F4R A;  4WET A;  1FAA A;  1ML6 A;  4EDY A;  4FYU A;  4POB A;  5IOW A;  3UAR A;  1WJK A;  3GKK A;  1BYE A;  2HSH A;  2PWJ A;  4PNG A;  3CSJ A;  4AJ8 A;  2WUL A;  2OA7 A;  1XOB A;  5DAK A;  1X5D A;  1XOA A;  4HQZ A;  2GVP A;  4IEL A;  2QGV A;  4ZB6 A;  2YZU A;  2IJY A;  2QKE A;  2H19 A;  3IPZ A;  3MDK A;  2L6D A;  4JR4 A;  4MZW A;  3F4T A;  3M9K A;  2NPB A;  2DJ0 A;  1XPV A;  2HXK A;  2A2R A;  1YKC A;  1Z6N A;  1NW2 A;  2P0G A;  2VLT A;  1GTU A;  1EEJ A;  2AHE A;  1I5G A;  2C0G A;  2KP2 A;  4FYC A;  3EYT A;  2FD3 A;  4LL1 B;  12GS A;  4ZB7 A;  4K6X A;  2X64 A;  5A1N B;  3FEU A;  4MDC A;  2L6C A;  5ECN B;  4BA7 A;  5F05 A;  2ZUP A;  2H6Y A;  3D21 A;  1IYH A;  2WS2 A;  4QQ7 A;  4IP6 A;  3NIV A;  5G30 A;  5HFI A;  4WEY A;  1Z7P A;  2TRC P;  2G2Q A;  4I2T A;  3BD2 A;  1TXU A;  1A0F A;  1GP1 A;  1PSQ A;  4KA0 A;  5ECR B;  3A2W A;  4MJC A;  1BQ7 A;  1YY7 A;  2C0D A;  4EE0 A;  3TJK A;  1YVL A;  2DJ3 A;  5G1K A;  1VF4 A;  1O8W A;  2F9S A;  1PQN A;  3Q18 A;  3ZFB A;  1THO A;  1NHO A;  3ZRD A;  3FZ5 A;  4ZBB A;  1T4Y A;  1F9M A;  2AJQ B;  2XHF A;  1OVN A;  4AI6 A;  3LG6 A;  3EVI A;  3UBK A;  1Q4J A;  4OFT A;  1A24 A;  1GSQ A;  2MBS A;  4CHS A;  5DAL A;  3KGK A;  4MH2 A;  1X9W B;  3EC3 A;  3IE3 A;  1M99 A;  3ZYW A;  5IMV A;  3WYW A;  1GUL A;  1AC1 A;  5GAP D;  1MEK A;  1GTB A;  5IMD A;  3EWL A;  2YCD A;  3FZA A;  4XHM A;  3KJY A;  1YKA A;  4QMK A;  4EF0 A;  4GQF A;  4N0Z A;  1M0U A;  1OC3 A;  4LL4 B;  2H73 A;  4K9Z A;  1BF5 A;  3J7Y k;  3MSZ A;  2DJK A;  3ME7 A;  5G5E A;  5J40 A;  5IPH A;  2O89 A;  4GQC A;  5IOX A;  4G01 A;  5J4V A;  1XBS A;  4YQV A;  5E4W A;  4TR4 A;  2EFH A;  3GL3 A;  1K0D A;  2H01 A;  2EIO A;  4KB3 A;  1U87 A;  3A2V A;  3VI7 A;  2EFC A;  2C80 A;  3TDG A;  4RUV A;  5CRG A;  1PX6 A;  1FW1 A;  1TRV A;  3A2X A;  1W89 A;  2HSN B;  4AF2 A;  3QCP A;  2J23 A;  3LW9 A;  3G7I A;  4OD7 A;  4Z7X A;  2DLX A;  1FVJ A;  4XS4 B;  2IMI A;  3TKR A;  1JZD A;  2LEG A;  2MMA A;  3O76 A;  3P8W A;  1SL1 B;  2DKH A;  3D4T A;  2K6V A;  2VCV A;  1NM3 A;  5ELA A;  5ECI B;  4L5L A;  5HR2 A;  2N5A A;  4G9H A;  4FYB A;  1TI1 A;  4K0N A;  2DC5 A;  1V98 A;  2H74 A;  4MJB A;  1K0O A;  4HJ2 A;  5G1L A;  5F07 A;  17GS A;  4GCI A;  3MYD A;  4G0K A;  5FWG A;  2BMX A;  4N11 A;  2GSR A;  4HEA 2;  4WR5 A;  2R2J A;  4AKG A;  1GLQ A;  5A5H B;  1Z3E A;  3TKP A;  3M9J A;  4I6X A;  3I6A A;  1DUG A;  5LCZ A;  2JZT A;  3N9J A;  3WD6 A;  5A5H A;  3C1R A;  1SVO A;  1YEP A;  3EMP A;  4D73 B;  4JR6 A;  4X1U A;  4ACS A;  4IS0 A;  2NTO A;  1DBY A;  4XTS A;  3OR5 A;  4G10 A;  3KCM A;  2OE1 A;  3HJP A;  4KND A;  3HHV A;  4PTS A;  2M46 A;  4N3Z A;  4L8E A;  4CY8 A;  1PN9 A;  2LQO A;  3UVT A;  4GF0 A;  5J47 A;  4HZ4 A;  5AIS A;  4K7O A;  3WGD A;  4OFN A;  2CAQ A;  4EUY A;  3HZ8 A;  5AIV A;  3VUR A;  4Z2U A;  2IMK A;  4K2D A;  2VOC A;  1MDJ A;  5D9T A;  1FO5 A;  2V32 A;  6GSS A;  2IPA A;  1G7E A;  2KP1 A;  2ZNM A;  4GXZ A;  1S3A A;  1M2D A;  4NHW A;  2IWT A;  2ZCT A;  1YEX A;  3KZQ A;  4I5Q A;  2E2G A;  2FWG A;  4I97 A;  6GSU A;  2LV3 A;  4OMV A;  4ECB A;  1DSB A;  4TRX A;  3IC4 A;  2YOI A;  2QSI A;  3U5R E;  4FQU A;  4ZBA A;  2LKU A;  1O85 A;  4MA9 A;  4YH2 A;  4LMV A;  4BVX A;  2L4Q A;  4F9Z A;  4YQU A;  1O8X A;  4O5Q A;  3F4S A;  3NOF A;  2IFQ A;  19GS A;  1S3C A;  1THX A;  3CXG A;  3QAG A;  2RM5 A;  1FOV A;  1X9M B;  3PIN A;  5F8B A;  2B7J A;  3DEX A;  3UEM A;  1NHY A;  3F6D A;  2GS3 A;  3C71 A;  3UBL A;  1PL1 A;  3Q19 A;  5JCU A;  5IMA A;  2YP6 A;  4YKF A;  1G0T A;  2H1B A;  4A5P A;  3U6V A;  4MF7 A;  1WPI A;  5L71 A;  2JZS A;  3IHQ A;  4JU5 A;  3LXZ A;  2C0F A;  1X5C A;  2HE3 A;  5CYY A;  2C4J A;  1SKS B;  1KBN A;  2C1Y A;  3ZML A;  3US3 A;  1HYU A;  4GTU A;  4GRF A;  4ZIL A;  4N30 A;  4TXO A;  1A2J A;  2C3N A;  4EVM A;  2H72 A;  1WRY A;  3QDN A;  1EEM A;  3ZIJ A;  2VM1 A;  1OE8 A;  3D0Z A;  2WRT A;  2YNX A;  4IHU A;  1Y6E A;  4L5O A;  1B48 A;  1EZK A;  2WB9 A;  3IV4 A;  3FMW A;  3GTU A;  4N10 A;  4MNN A;  2OJL A;  3CTG A;  3GUS A;  2CZ3 A;  4RI6 A;  3TU3 B;  5CRH A;  5IMC A;  1V9W A;  2E2M A;  3ZVJ D;  2JU5 A;  1WOU A;  3TUE A;  4MJE A;  1C72 A;  2H1D A;  3CRT A;  1TRW A;  5DCH A;  5KN1 A;  2G0F A;  1R5P A;  1Z7R A;  3HMJ G;  4MZC A;  3CSI A;  3HY2 A;  4FIW A;  5HFG A;  4YAP A;  2YV7 A;  2HSM B;  4PUF C;  5HFK A;  3O6T A;  3TJB A;  1Y1U A;  3FYG A;  5A34 B;  2XC2 A;  4G0I A;  4TVE A;  3WT2 A;  4J56 E;  3APS A;  3EPT A;  2HQT A;  1J9B A;  2DJ1 A;  1K0M A;  3QOU A;  2AV4 A;  1Z5Y E;  5J9C A;  2DIZ A;  2A2S A;  5D9W A;  6GST A;  3TJF A;  4KDY A;  1Z6M A;  4HU7 A;  3KTB A;  5ECH B;  3L78 A;  1B9X C;  2HI7 A;  3F0I A;  1OKD A;  4DSQ A;  5A4U A;  2IMD A;  2D2Z A;  5IQY A;  2HZE A;  1EP7 A;  4K5S A;  11GS A;  1BAY A;  1EGR A;  1GTI A;  4IJ3 A;  3DRN A;  1ZMA A;  3F8U A;  3EU4 A;  10GS A;  3GNJ A;  2PUK C;  3W6G A;  4FO5 A;  1SD9 A;  2P5Q A;  3IAS 2;  2TIR A;  4WBJ A;  1TKD B;  1XCC A;  4KDU A;  1T8E B;  1H75 A;  2PMT A;  1M9B A;  4TR1 A;  1K3O A;  4J57 E;  2R6K A;  2IME A;  4Q5N A;  2DMM A;  3M1G A;  2MYG A;  3UIW A;  4F82 A;  1EOH A;  2HRA A;  3D4M A;  3GHA A;  4HS1 A;  2CT6 A;  3K8N A;  4WF4 A;  4OO4 A;  2KLX A;  4IQA A;  4ZXG A;  3LSZ A;  2CVK A;  5JCG A;  3UJ1 A;  3FRC A;  9GSS A;  1O6J A;  5E59 A;  3HJO A;  1GNE A;  4AGS A;  1ERT A;  4ULX A;  1H4O A;  5H5S A;  1ZOF A;  2C3T A;  1Z9H A;  5J41 A;  2L57 A;  3VWX A;  3H79 A;  3GKX A;  1TP9 A;  1VF3 A;  4YQM A;  4K0G A;  1SK1 A;  2B3S A;  5LNK e;  1TU7 A;  2A2P A;  1Q98 A;  2B6M A;  2CQ9 A;  4PGT A;  2WFC A;  1R26 A;  3KP8 A;  3R2Q A;  2CX4 A;  1BX9 A;  1T1V A;  4HDE A;  3FK8 A;  2JAD A;  2K18 A;  1FOH A;  2YJH A;  6GSX A;  1G6Y A;  5ID2 B;  3VPQ A;  3S9F A;  1PL2 A;  5ABR A;  4TOP A;  3ERW A;  1HNB A;  4GDF A;  2OBI A;  2CVB A;  3PGT A;  1M2B A;  1GSY A;  2MMZ A;  1XWB A;  4ECC A;  4V2M A;  3VWW A;  3DWV A;  1W4V A;  4MK3 A;  1XWK A;  2VL3 A;  1XFL A;  3QPM A;  3GSS A;  1SKW B;  2QC7 A;  3SBC A;  4RQX A;  4RQR A;  4CDO A;  2VKZ G;  2O85 A;  5CAX A;  4ZL9 A;  5A1N A;  4X43 A;  5GZZ B;  1GSU A;  5J9B A;  2AAW A;  3KTL A;  2VAF A;  2I81 A;  3MNG A;  2DIY A;  3DXB A;  1F37 A;  1PN0 A;  3BJ5 A;  1MD4 A;  3I69 A;  3RPN A;  1YJ6 A;  4PUA A;  1WWJ A;  3H4K A;  2GQK A;  2UV8 G;  4O32 A;  3ZFL A;  2CX3 A;  3IK7 A;  1OYJ A;  3HZ4 A;  3WT1 A;  3M8N A;  4YAV A;  1I9D A;  5HR3 A;  4MPF A;  2K8S A;  2REM A;  3L0H A;  3FZ4 A;  1XXU A;  1XZO A;  1BED A;  1B4P A;  5A4W A;  2HT9 A;  4KSM A;  1DE2 A;  1ABA A;  2GST A;  4NAX A;  3BCI A;  2YJ7 A;  1T7P B;  1A0R P;  1WE0 A;  1F3B A;  2JAC A;  2H6Z A;  1VF2 A;  2HRN A;  5CRW A;  3IHG A;  3TJJ A;  2H0G A;  4LA1 A;  4O5U A;  3NZN A;  3ZMK A;  3RAZ A;  1PRX A;  1XWC A;  1TXX A;  2DML A;  2H1A A;  3EUR A;  3KIJ A;  3KH9 A;  5IM9 A;  3FW2 A;  3AY8 A;  5B8A A;  1O73 A;  1SVL A;  1M9A A;  3UAP A;  2BJX A;  4JE1 A;  1E6B A;  3CMI A;  2GZY A;  4IKH A;  2LST A;  5BMU B;  1SKR B;  2X99 A;  7GSS A;  3RPP A;  5DDL A;  1IYI A;  3DML A;  4WXT A;  1GLP A;  4MF6 A;  1FHE A;  2I9H A;  3WGX A;  4MAB A;  2Z9S A;  4EKZ A;  4BWQ A;  1HQO A;  2HSN A;  3VI5 A;  2A4H A;  3VLN A;  2FGX A;  3HVV A;  4ML1 A;  3GA4 A;  2FWE A;  4TW5 A;  1OAZ A;  2F8F A;  4XS4 A;  4KDX A;  4RI7 A;  1O81 A;  1TTZ A;  3TKQ A;  3N5O A;  3EE2 A;  1KNG A;  1QUW A;  2JZR A;  1M7T A;  2PN8 A;  4WF5 A;  2H0I A;  2LNT A;  4EIQ A;  1XW9 A;  1K0C A;  3F6F A;  4IVF A;  4EXJ A;  1X0R A;  4BL7 B;  3GL5 A;  2VD1 A;  5IPG A;  2O5V A;  1A8Y A;  3C7M A;  3CSH A;  3IR4 A;  2X8G A;  1FB0 A;  4EO3 A;  3IRA A;  3L9S A;  4Z2T A;  5JCW A;  5FT3 A;  4HQS A;  1HNC A;  4NXI A;  1GUM A;  5EL8 A;  4ECJ A;  2RII A;  5ECQ B;  3HD5 A;  3H1N A;  2FWF A;  4G19 A;  2ON5 A;  2I1U A;  4MF5 A;  1QFN A;  3QFB C;  2LRN A;  2IN3 A;  5IIZ A;  4I2U A;  4MZB A;  1R4W A;  6GSW A;  4D73 A;  2IIY A;  2B1L A;  2N5B A;  4O7H A;  1AAZ A;  1QGV A;  4ZL7 A;  4GSS A;  4G2E A;  1PX7 A;  3Q74 A;  2FCH A;  3BBY A;  2C3Q A;  2NDO A;  5ENU A;  3ERF A;  2PU9 C;  1X5E A;  2V6O A;  4K2X A;  1ZYQ B;  3BOA A;  18GS A;  5DJL A;  3KXO A;  3P7X A;  1EV9 A;  4XRA A;  2EIQ A;  1CQH A;  1B8X A;  3W8J A;  4CY6 A;  5CRE A;  1XW5 A;  2OE0 A;  5DBQ A;  5DCG A;  2CVD A;  1T4Z A;  2VLU A;  4K8M A;  4DVC A;  2C0E A;  5INY A;  2X4A A;  2H8L A;  2DSA A;  4EL1 A;  2EC4 A;  4POK A;  2N5F A;  2RM6 A;  3H93 A;  3EIN A;  1SL2 B;  2I3Y A;  5JWR B;  2BTO T;  4AKI A;  4ML6 A;  4NMU A;  4LLR A;  2XBQ A;  3BCK A;  3KEB A;  3CWG A;  1JLV A;  3LFL A;  4GWR A;  1LU4 A;  5CNW A;  4N0V A;  3JCM L;  5KN2 A;  2M72 A;  2VO4 A;  3FKF A;  3GIX A;  3LEF A;  4PXO A;  3KMO A;  4L0U A;  5KOW A;  2F3M A;  4DSS B;  4IGJ A;  1MDK A;  5J3R A;  4IJI A;  1USB A;  14GS A;  2GQM A;  5JWO B;  2CV4 A;  1A2M A;  1ERW A;  1HD2 A;  3QFA C;  2KHP A;  3IOS A;  2X8C A;  2VCW A;  2H0H A;  2YWI A;  2GSQ A;  5EY6 A;  5F06 A;  1JFU A;  3I43 A;  3RHB A;  6GSV A;  2MMN A;  2VCQ A;  1AQW A;  3ZL5 A;  3F9U A;  2PPT A;  1EWX A;  2R0C A;  1LJR A;  1FVK A;  4ZB8 A;  2FA4 A;  1FG4 A;  3GX0 A;  4KCE A;  4LMW A;  3UOM A;  3QMX A;  3IXR A;  4QL9 A;  1N8J A;  1JZR A;  2TRX A;  4IQ1 A;  1E2Y A;  1R7H A;  2EIR A;  1ACV A;  2ALB A;  3QAV A;  5IO0 A;  2JL4 A;  1AW9 A;  5DQS A;  4JBB A;  5ECK B;  3GX8 A;  1GNW A;  1AUC A;  3HYP A;  5ECS A;  4ZIJ A;  2H6X A;  5EPF A;  3HKR A;  3GH9 A;  4MP4 A;  2X8H A;  2V6K A;  4PX1 A;  2VCZ A;  1EOG A;  2H66 A;  2VD0 A;  2HSM A;  1TJD A;  5AGY A;  1RQM A;  1J08 A;  3RBT A;  1G7O A;  4O5R A;  3GV1 A;  2I4A A;  3TKS E;  5A34 A;  5HR1 A;  3DD3 A;  3TRX A;  3HJM A;  3F3Q A;  2B5E A;  4MH3 A;  4BVY B;  2GZP A;  3KP9 A;  5KN3 A;  3TRP A;  5CRD A;  2H75 A;  1G6W A;  3A3T A;  1ZL9 A;  4WBR D;  3VFI A;  3KMN A;  5B6M A;  3VPT A;  4I8B A;  4XCS A;  4E68 A;  3RDW A;  3P90 A;  5H5Q A;  1AQV A;  3HA9 A;  3IA1 A;  3IK9 A;  3PH9 A;  1A8L A;  3GST A;  1GH2 A;  2WCI A;  1QQ2 A;  4OO5 A;  4OFM A;  3IBH A;  4Q5R A;  4Q5Q A;  4TR3 A;  5D96 A;  2OE3 A;  4TXV A;  4DSR A;  2QA1 A;  2R0P A;  4WKW A;  4JED A;  4K7N A;  3FR6 A;  3EU3 A;  2OAD A;  4L0W A;  4BWS A;  2RLI A;  2R5G A;  5D93 A;  1TK0 B;  4POL A;  2OKA A;  1SK2 A;  1UA5 A;  5DQY A;  4H86 A;  5LD0 A;  1XW6 A;  4TN8 A;  2L5L A;  4O92 A;  3L9V A;  5AN1 A;  2B5Y A;  4BPY A;  2FA8 A;  4KSO A;  3QAW A;  3G7Y A;  3GKM A;  5J4U A;  4EDZ A;  2MBT A;  2B7K A;  2LRC A;  4IBP A;  2P31 A;  3KD0 A;  5DAK B;  5HR0 A;  5H5R A;  3A5I A;  1B9Y C;  2GT6 A;  5A5K A;  3APO A;  4HOJ A;  3VWV A;  1TOF A;  1AQX A;  2ON7 A;  1ZYN A;  5C00 A;  2YWM A;  3ZLP A;  3LQ7 A;  3R3E A;  3FR9 A;  2YZH A;  2DKI A;  1CQG A;  3ZVJ A;  2R3X A;  3CBU A;  4E8H A;  3GMF A;  3ERG A;  2H71 A;  3VK9 A;  2RUE A;  2HZF A;  5ID2 A;  2HYX A;  2WJU A;  1TK8 B;  4Q5F A;  3J7Y b;  2GLR A;  1V57 A;  4USS A;  5HQP A;  6GSY A;  2O8V B;  3GKN A;  4PQ1 A;  1OC9 B;  1XWG A;  1TU8 A;  4JRR A;  4ID0 A;  1OE7 A;  5DJM A;  1HNA A;  1SYX A;  1SD8 A;  5CO3 A;  2ES7 A;  1EV4 A;  3UVH A;  1A2L A;  1PMT A;  1OC9 A;  4AJ6 A;  1VGL A;  2NBS A;  2J9H A;  4K5R A;  1FB6 A;  1B4Q A;  5FHI A;  1JLW A;  3G7J A;  3LWA A;  1U88 A;  1T00 A;  2DJJ A;  4EIP A;  5KN0 A;  3GUR A;  4KF9 A;  5D73 A;  2VCT A;  3O3T A;  2L59 A;  3DVW A;  2JSY A;  3H8Q A;  5IMF A;  4Z2R A;  2P5R A;  1QK8 A;  5B7C A;  4V1A p;  1YF0 A;  3UL3 A;  5B8B A;  4CW9 A;  4ECI A;  3KM6 A;  5DAL B;  1MDI A;  3ME8 A;  4ILF A;  3TOT A;  1SEN A;  4ZBD A;  3LOR A;  3UMA A;  2R37 A;  2R0G A;  4OCE A;  2F51 A;  1XWA A;  1QMV A;  4ICY A;  3W8S A;  3CTF A;  3P2A A;  1F6M C;  3IAM 2;  2K9F A;  2WZ9 A;  4NV5 A;  1ST9 A;  2H30 A;  4NWY A;  1GSF A;  2CA8 A;  2LS5 A;  4J2F A;  1RW1 A;  1O7U A;  1A23 A;  2HNL A;  5AIX A;  2VM2 A;  1MD3 A;  1K0N A;  3DIE A;  3ISO A;  2YV9 A;  2IMF A;  2LNS A;  2VLV A;  3Q6O A;  4XS6 A;  5C04 A;  3CYN A;  2O87 A;  2AUV A;  2H1L A;  2H1G A;  2FLS A;  1GUH A;  1TK5 B;  2YPM A;  5COH A;  1V40 A;  4F2I A;  2PGT A;  2YWO A;  5BMU A;  2B5X A;  1T3B A;  4YKG A;  2A4V A;  4K7I A;  2MZC A;  3V1W A;  1N25 A;  1S3D A;  3L9U A;  4F0C A;  4XRD A;  1SJZ A;  2HLS A;  4NPB A;  2JSZ A;  8GSS A;  1SYR A;  3HDC A;  4HUA A;  3PR8 A;  3DKS A;  1PKW A;  1PD2 1;  4PNF A;  2UZ8 A;  1XIY A;  1KTE A;  5ECM B;  2YN1 A;  1GRX A;  4KCA A;  1GL8 A;  1ZYP A;  4EC0 A;  2HFD A;  1V2A A;  1ZZY A;  3A5W A;  4KX4 A;  3ZIV A;  3E0U A;  3DGQ A;  1YQ1 A;  5ECO B;  1JZO A;  3C73 A;  1SU9 A;  5IO2 A;  2L4C A;  3TCO A;  4K1F A;  2LTK A;  1BJX A;  1LBK A;  5J4Y A;  1TRS A;  4BL7 A;  4V2N A;  1U3A A;  4V1A g;  5G2Z A;  4F03 A;  1URM A;  4AJ7 A;  5G5F A;  2GT5 A;  3SWL A;  3L4N A;  4FH8 A;  1X9S B;  4V2L A;  1K3L A;  3LXT A;  4KW6 A;  2VUP A;  3KH7 A;  4IN0 A;  2CZ2 A;  3DYR A;  2LJK A;  2OT3 A;  4GSN A;  1YDK A;  5G31 A;  3FR3 A;  1TRU A;  3HXS A;  1SL0 B;  1J0F A;  4POM A;  3FZ9 A;  4KH7 A;  5D8I A;  1ZYE A;  3GFK A;  4JZQ A;  4PQI A;  3E3E A;  3IC8 A;  3LJR A;  1BG1 A;  3DVX A;  2FWH A;  2KOK A;  2HRF A;  4XS1 A;  1DE1 A;  3F63 A;  2PVO C;  3GYK A;  4W66 A;  2X49 A;  1U6T A;  4HI7 A;  4MJA A;  5GSS A;  3ZZX A;  3LYP A;  4GST A;  4HJM A;  4E8E A;  2GDR A;  3D22 A;  1F2E A;  1ZGN A;  1QXH A;  2OAC A;  3MWH A;  1OC8 A;  1ERV A;  3ZIT A;  4NV2 A;  2AB6 A;  1TI3 A;  4XIH A;  1UN2 A;  5J5N A;  4ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...