2CAIA

Structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
DHIKVIYFNGRGRAESILMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAATPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE 28 KDA
publication title Probing the Mechanism of Gsh Activation in Schistosoma Haematobium Glutathione-S-Transferase by Site-Directed Mutagenesis and X-Ray Crystallography.
pubmed doi rcsb
source organism Schistosoma haematobium
total genus 65
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2caiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2caiA01
4OFMA 1Z6NA 4GSNA 1XWGA 1X9WB 2YV9A 2TRCP 4ZXGA 2X8GA 5G30A 4AGSA 1SL0B 2BTOT 5D9WA 2R2JA 3KGKA 1UN2A 4FH8A 1O85A 5DBQA 2CAQA 4H86A 1SYRA 5ELAA 2DJJA 1LU4A 1JZDA 1J0FA 1ZYEA 2L6CA 3Q18A 3C1SA 3QAVA 4K8MA 1WP0A 3IR4A 3H4KA 4F0BA 3O6TA 3TKSC 2PERA 3DVWA 2HSMA 5J9BA 4JU5A 2PPTA 3A2VA 2HRNA 5IMAA 1S3DA 1OAZA 2DMLA 2OE0A 2DJ1A 19GSA 4D73A 4OWYA 2V1MA 3K8NA 5D96A 1M99A 1K0AA 1SJIA 1G6WA 6GSSA 3HD5A 3N5OA 3RPNA 4I97A 1K3YA 3A3TA 3W8JA 5DCHA 4IJ3A 4XTSA 2B5XA 5B8BA 1GL8A 3CRUA 9GSSA 3A2XA 3ZL5A 3FR6A 4YQMA 3LFLA 4KCEA 1VF2A 3M0FA 1R5PA 2XBQA 1ZZYA 3CRTA 1WWJA 3BBYA 4MF7A 4FYUA 3TKSE 12GSA 4FIWA 3ZIJA 2HRKA 4ZILA 4PURA 3M9JA 2CVBA 3ZFLA 3GRXA 4K0NA 4O92A 4GF0A 1O8WA 3FZ9A 1JHBA 3ISOA 4NXIA 3UOMA 3GMFA 4V2NA 1X9MB 3KMNA 2YZHA 1THOA 4WF4A 2PVOC 5DAKA 1E6BA 1TRWA 1ERWA 4HZ2A 3SBCA 3EE2A 1AXDA 4QQ7A 3ZRDA 4K1FA 2M46A 1WIKA 1T3BA 4MK3A 2YWMA 2OE1A 3D4TA 1B4PA 4USSA 4YAPA 3OR5A 1Z7RA 2TRXA 3RHBA 4OCEA 2HRKB 3VWXA 4AJ7A 4IN0A 1YEXA 1TW9A 5HQPA 5GSTA 4KGIA 1QUWA 2HSHA 1I9DA 4K7IA 4ZB9A 2LKUA 3HKRA 4HDEA 1SK1A 2OBKA 2H66A 3U5RE 4F82A 3UL3A 2CZ2A 1RK4A 1PD21 4MJEA 2X8CA 5GSSA 2JU5A 1GTIA 1B4QA 2FWGA 3I69A 2MMOA 1OYJA 3DD3A 4TOPA 4POKA 2QC7A 3APQA 3TJBA 1A0FA 2ON7A 2YANA 3D4MA 3QFBC 2KLXA 4N30A 5IPHA 4EDZA 3C73A 3WGEA 4HZ4A 3KP9A 1XPVA 4MJBA 2D2ZA 3KIJA 4MA9A 3UVHA 4OFNA 5JCWA 2MMZA 3UMAA 4WKWA 2MBSA 1AW9A 1SYXA 1GUMA 5GZZB 3TKQA 5EY6A 4RUVA 3WD6A 1UVZA 4P3YB 2MMNA 3F63A 1ERTA 4L5OA 3E3EA 2XHFA 2JSYA 2H01A 1GTUA 5G2ZA 4POMA 4Z7XA 3ZYWA 1Z6MA 3ZMLA 4KDXA 3GH9A 3F8UA 4F03A 2DLXA 1J9BA 1A2LA 4EXJA 3JCML 4BVYA 3RPPA 1GRXA 3GN3A 3VWVA 2L59A 2R3XA 3CSHA 1B48A 3DYRA 7GSSA 2L4QA 1TI1A 4L8EA 1HNAA 1XZOA 2H72A 2L4CA 1GLQA 1EV4A 2GZYA 4EDYA 1BAYA 3FYGA 5F07A 5DQSA 1TK8B 1N8JA 5ECKB 2HZEA 2ZCTA 1A2JA 3G7IA 3HVSA 5ECHB 5ECRB 2VL3A 5J5NA 2F51A 1Z9HA 2MYGA 1QK8A 3DIEA 2KUCA 3TKRA 5ECPB 2K18A 5B6MA 5IOWA 2CAIA 2H0GA 4KCAA 18GSA 4MH2A 3F6FA 2PMTA 5G5EA 5F8BA 1Q4JA 2X64A 2JADA 3DVXA 1XCCA 1TU8A 3CSIA 1X5CA 4BVXA 1FOVA 1OC9A 1XOAA 3GYKA 1G7EA 5ID2B 4KE3A 4GXZA 2HZEB 5GAPD 3QFAC 1OVNA 1ZMAA 1M2AA 3H8QA 4WBRD 11GSA 4HJMA 4TR1A 2IWTA 1TOFA 1X0RA 2HI7A 4GQCA 2H1GA 2P5QA 3HDCA 2F8FA 1XOBA 4XS4A 3L4NA 2C8UA 4HQZA 3KD0A 2CVDA 4LL1B 3IE3A 4ZIJA 1CQGA 2H19A 4IW9A 4WXTA 2AAWA 3F9UA 4DVCA 3ME8A 4EKZA 1M9AA 1R4WA 3APSA 2H1AA 2F8AA 4BWQA 1AIUA 3IC4A 1GSDA 1GTAA 3TJGA 3O76A 4TR1B 1A8LA 2AUVA 1EV9A 4GQFA 5F05A 1SENA 2VCWA 4K9ZA 4X1UA 3C7MA 1V40A 2IFQA 3GTUB 2VCTA 2OA7A 2O8VB 3FK8A 5G5FA 6GSXA 4XS4B 2WJUA 1O81A 1Z7PA 5J9CA 2M72A 1NM3A 1FHEA 2A2SA 5CO3A 2OKAA 2H1DA 4HQSA 2RIIA 4XRDA 3TGZA 1TKDB 2V32A 1UC7A 2GZPA 5ECMB 2FGXA 3ZIVA 2QSIA 4F2IA 4MH3A 2VCZA 2LS5A 4KB3A 2CX4A 5CP1A 1I5GA 3ZMKA 3TJJA 4G0KA 3VI7A 2IFQB 4EVMA 1PGTA 3GKKA 3KM6A 4YQUA 3GX0A 2VUPA 5COHA 2OE3A 2VD0A 2H73A 4LMWA 2C0GA 1O6JA 3DRNA 2O87A 3KXOA 3UARA 3L0HA 4RI7A 1GNWA 2VLUA 1K0DA 4YAVA 1PX7A 2KOKA 4KSMA 1XIYA 5CYYA 2FUG2 3TOTA 4NV5A 1MTCA 2GQLA 5CRGA 2GT5A 4XHMA 3ZVJA 1Q98A 2CA8A 2KHPA 4TKYA 5AIVA 1KEBA 1SD9A 5GAND 4POLA 1Z3EA 1HD2A 1NSWA 3SWLA 2J23A 3GKNA 5HFIA 2IJYA 5KN3A 5ABRA 2GDRA 1ERUA 3EURA 2R5GA 5EL8A 5A5KA 2CX3A 2I3YA 1DUGA 4ZB6A 2C3QA 2KP2A 2C0FA 3RHCA 2I4AA 1U87A 3LYPA 3FR9A 4PGTA 1Z5YE 1GUKA 3FW2A 1BEDA 5H5RA 1BYEA 3IV4A 2HE3A 1H4OA 3GH6A 2FA8A 4LMVA 2BMXA 3KJYA 2GGTA 2E7PA 3P7XA 4V2MA 1WOUA 2TIRA 5ECIB 4I2TA 5KN0A 3ERGA 2LRCA 4ISDA 4NMUA 4TR3A 3WT1A 3N9JA 3TUEA 4EF0A 1KNGA 2A2RA 4HOJA 4TXOA 1T1VA 3ED3A 4N0ZA 4NV2A 4I2UA 2H74A 3FEUA 4TR4A 2DIZA 2KP1A 4CDOA 5JWRB 3GHAA 5C04A 1XFLA 1WE0A 1SL2B 2M80A 5FHIA 2WCIA 1GSFA 2IMEA 1DE2A 1LBKA 5IMVA 1TI3A 3IHQA 5CAXA 2WDUA 1TRVA 5C00A 2WZ9A 3VPQA 3W6GA 2YV7A 1IYIA 2IPAA 2B3SA 3E0UA 1GSQA 2B7JA 5IO2A 2VLTA 2H6YA 2ZNMA 4N0VA 1SKWB 1T8EB 3IXRA 4IP1A 2C0EA 2CVKA 3KH7A 1IYHA 4KNDA 1F9MA 1V58A 3CTFA 1FW1A 2HSMB 1SKSB 1PKWA 2AV4A 3QMXA 2R6KA 3C8EA 2VL2A 4MZWA 4ML6A 2ZUPA 1TK0B 1RQMA 4MF5A 4D73B 4WR5A 4PTSA 5CRWA 5DJMA 2P31A 5JWQB 3TB2A 1G7OA 2XPEA 2L6DA 2V2GA 4MLYA 4Q5QA 2H8LA 3M8NA 4I5QA 1T4YA 2FHEA 1ST9A 3GIXA 4HU7A 5J3RA 5IOXA 1BG5A 3F4TA 1BJXA 4PUAA 2RLIA 1NHYA 1FVJA 2XPDA 2RUEA 4AJ8A 4Q5NA 1CQHA 1HYUA 2VIMA 3IBHA 1TTZA 3IPZA 4JEDA 1DBYA 1GULA 4G0IA 1QQ2A 2A4VA 5HFGA 2DC5A 1YQ1A 2N5AA 4MZCA 16GSA 3BCKA 1FB6A 2QKEA 3FZAA 5DQYA 2IMDA 1URMA 1EOGA 3VI5A 1XWBA 1U3IA 3MAKA 1O73A 2DIYA 5KN1A 3CMIA 5D73A 5DAKB 2IN3A 3F4SA 3QD9A 2X8HA 5B6NA 1PSQA 2BJXA 4PX1A 1EWXA 2C4JA 3EMPA 3IAM2 1FB0A 4KA0A 4MCUA 3F6DA 2DSAA 4PXOA 5CREA 2K8SA 3FY7A 3FZ4A 3EU4A 3HZ4A 2NTOA 4PNFA 4KAEA 6GSWA 2YJ7A 3HYPA 2JZSA 1ABAA 5DCGA 5B8AA 4XS1A 4I6XA 1V98A 4POBA 4X43A 4EE0A 1SK0A 2HZFA 4BL7A 5BMUA 1MD3A 4O7HA 6GSUA 5AGYA 3Q74A 4X0XA 5A4UA 3DKSA 3ZTLA 2OACA 5HFKA 4GCIA 4MF6A 2LV3A 1BQ7A 5A4WA 2X99A 5LD0A 2LQOA 3MWHA 2IIYA 1V57A 3L9VA 4ML1A 1G6YA 4Q5RA 3EMXA 3GSTA 2YOIA 4MJAA 3ZVJD 2YJHA 3UVTA 2DJ2A 1OC8A 5LCZA 5G1KA 2K9FA 4XIHA 3TOUA 5IIZA 4K7NA 3FRCA 3DXBA 3TRQA 17GSA 5ECLB 5ECOB 2H1BA 1THXA 2VM1A 1HNCA 2C3NA 5EVOA 2EC4A 4BL7B 1ZCPA 5IPGA 3F4RA 4ACSA 4NPBA 2UZ8A 2L5LA 1OC3A 1W89A 3QCPA 1J08A 2PVQA 4L5LA 5E59A 1MDKA 3ERWA 2CT6A 3RAZA 1JFUA 5LNKe 4BVYB 3GKMA 3PH9A 2VCVA 1OKTA 2EIRA 2YNXA 2GZZA 1O7UA 3LG6A 1DSBA 4MMMA 5JWOB 1JZRA 3LGCA 4KUNA 1GSUA 1K0CA 1UA5A 2GSSA 4E8HA 4LA1A 5CRDA 3ZZXA 4O5RA 4HI7A 2VCXA 5HR0A 3TKPA 3L9SA 4N10A 2VO4A 4AJ6A 1XWAA 4WETA 4PQIA 4TN8A 2H30A 2RUFA 1ML6A 3IK9A 3ERFA 13GSA 1GLPA 3Q6OA 4G19A 3D0ZA 4BA7A 10GSA 1VRSD 2IMKA 1GTBA 2LRNA 3EINA 2IL3A 2E2GA 3QPMA 3CYNA 3M3MA 3EU3A 4CW9A 1X5EA 3Q19A 3HJPA 3I43A 3US3A 3LWAA 4KDUA 4CHSA 1TU7A 3GUSA 4BVXB 1OC9B 4ZB8A 3HVVA 1YF0A 2B7KA 2GSTA 1KBNA 1B9XC 3GKXA 4DSRA 4OFTA 1VF4A 1MD4A 2Z9SA 3KEBA 4RQXA 3VFIA 4YH2A 2EIOA 2NBSA 2ON5A 2HT9A 3F0IA 5D8IA 3DWVA 4GLTA 2FD3A 2HXKA 4IGJA 1K0BA 1VF3A 3H93A 3TKSA 5D9VA 4IELA 3C1RA 3TJFA 4DSSA 2AJQB 2YCDA 3CBUA 1FVKA 1EZKA 3IRAA 3AY8A 2HLSA 2LNSA 5KEJA 1ZL9A 2GSQA 2HNLA 4YQVA 1VGLA 4EL1A 1JZOA 2VM2A 3GL3A 4PQ1A 4IQ1A 1AQWA 5ECSA 2AB6A 3TJKA 2H75A 2R37A 5HR1A 3BJ5A 2OADA 2MZCA 3DMLA 1YJ6A 3WT2A 1B8XA 1F37A 3D6IA 3CSJA 1GSEA 5IMCA 2HRFA 3DGQA 5H5SA 1TRSA 2B5EA 1XW6A 4GWRA 1ON4A 4KDYA 3W8SA 3I6AA 2G2QA 3NZNA 2CV4A 4V1Ap 3VK9A 14GSA 2N5FA 3VPTA 2F3MA 4WBJA 4DSSB 2NDOA 4OD7A 4QL7A 3D5JA 1AQVA 1T00A 3VWUA 5G31A 4TR0A 3H79A 22GSA 1A2MA 2C0DA 4PUFC 3KTLA 2VL9A 2LRTA 4MDCA 1XWKA 2F9SA 3GV1A 1G0TA 1A8YA 1S3CA 4J56E 5H5QA 2H0HA 4L0UA 1WJKA 3KH9A 3UIWA 3J7Yb 2DJKA 3M9KA 1XW5A 3VLNA 3EYTA 2JZTA 2B1LA 1USBA 2GSRA 3HHVA 1PMTA 1EEMA 1YDKA 2I81A 1FAAA 3MSZA 4JBBA 3P2AA 1R26A 2PWJA 2YWNA 1YEPA 2P0GA 3IAS2 3LQ7A 1F3AA 2PGTA 1E2YA 1MDJA 3TRXA 4K0GA 1A24A 2C80A 1XWCA 3A2WA 2V6OA 2O85A 3A5WA 1OE7A 2LSTA 1LJRA 3HJOA 6GSYA 5INYA 3P90A 3IC8A 4DEJA 5J4UA 3GFKA 4Q5FA 2FA4A 1R7HA 4ZBDA 2YN1A 4EUYA 1N2AA 1Y6EA 1ILOA 3PPUA 3S9FA 1W4VA 1B9YC 3KMOA 3PR8A 4ZBBA 1WPIA 2REMA 5B7CA 4FYBA 2I1UA 2VD1A 2GVPA 5J41A 3H1NA 2VLVA 2YZUA 1QFNA 2JACA 1K3LA 2JZRA 2MBTA 4ECJA 2J9HA 3VURA 1PQNA 3ZREA 3KTBA 3BD2A 4N11A 1KTEA 4MABA 1WMJA 1GUHA 3L78A 4G2EA 4TXOB 1F6MC 3GA4A 2L5OA 4OMVA 2FWEA 3P8WA 1QMVA 4XCSA 4JZQA 1M9BA 4LLRA 3GNJA 2H6XA 2E0QA 4EC0A 4J2FA 4G10A 2C3TA 3J7Yk 4IKHA 20GSA 3RDWA 3D22A 5AISA 4FYCA 1EGRA 3VWWA 1SJ6A 2GQMA 3LSZA 1PRXA 2PUKC 1V2AA 4V2LA 3QR6A 4OO4A 4WEYA 2XC2A 3HZ8A 1S3AA 2GQKA 2LTKA 4HS1A 2FCHA 4KH7A 3UBLA 3TCOA 2CQ9A 4OCFA 2O89A 3M1GA 1XW9A 1GWCA 4BPYA 1PA3A 1FG4A 1FO5A 3CXGA 2N5BA 1EGOA 1VF1A 3G9BA 1XVWA 4MP4A 2O7KA 3LEFA 2HYXA 4ECCA 4RI6A 2ALBA 3DEXA 1YY7A 4GSTA 4HU9A 1SL1B 4IQAA 3MDKA 1AQXA 1Y25A 1GNEA 4PNGA 2WULA 2LUSA 4GRFA 3ME7A 3LYKA 4IHUA 2RM6A 1K0MA 1PX6A 5EPFA 1C72A 3F3QA 4L0WA 2VAFA 2B1KA 4JR4A 3GSSA 3LXZA 4K7OA 3UBKA 3GL5A 3UEMA 4GTUA 5DALA 4IJIA 3KP8A 3V1WA 2GLRA 3HA9A 1X5DA 4G0LA 3QAWA 3GURA 3UJ1A 2LJAA 3IDVA 2JL4A 2LQQA 4XRAA 1TXXA 3EVIA 5IO0A 1M0UA 2QGVA 5F06A 2LJKA 3HY2A 4LL4B 1YKCA 5IMFA 3R2QA 4ZBAA 3NIVA 2DMMA 5ECQB 8GSSA 2B5YA 1OE8A 1YZXA 2H71A 3QDNA 4AF2A 4WF5A 1QGVA 5DALB 2WGRA 2DJ0A 2H0IA 3KZQA 2AYTA 2XBIA 4JE1A 3ZFBA 2LEGA 2VL2C 4ULXA 5AN1A 2R4VA 2PU9C 2YWOA 5KN2A 5L71A 4QL9A 3APOA 1EP8A 2EIQA 2HQTA 1RW1A 2H70A 2YWIA 2G0FA 4G9HA 5F0GA 4IVFA 1K0NA 4F9ZA 5ID2A 3LXTA 2DBCA 1JLVA 4NHZA 2GS3A 2MMAA 1WRYA 3CTGA 1JLWA 3PGTA 1PL2A 1MEKA 4NAXA 1XVQA 3GX8A 2NVLA 3UAPA 2P5RA 5JCUA 1K3OA 2OBIA 1GP1A 3BCIA 4EO3A 3PINA 4I8BA 3FR3A 1EOHA 1NW2A 4ECBA 3BOAA 1YF1A 4ZL9A 1R5AA 1NHOA 1K0OA 3QAGA 1U6TA 5CNWA 3FKFA 2FY6A 1ERVA 2FNOA 3HVXA 3HXSA 1EP7A 2LNTA 4IS0A 4IP6A 3LORA 3F3RA 4MJCA 1SKRB 1QXHA 4K2DA 1SJZA 2CZ3A 2V41A 4ZL7A 1ZGNA 3U6VA 4MZBA 4J57E 1HNBA 3G7JA 5IQYA 1TRUA 2FWFA 1SU9A 4TVEA 1PKZA 1T7PB 4E8EA 3GTUA 2OJLA 2VCQA 2WS2A 4OO5A 1TK5B 5ENUA 2HRAA 2WFCA 4XS6A 2LJRA 4FO5A 3IK7A 3HCZA 1HQOA 5HR2A 4KW6A 4O32A 1AUCA 2E2MA 3ZITA 4DSQA 6GSTA 4BWSA 3TDGA 5D9TA 4HUAA 1EEJA 1TJDA 1BX9A 5DVBA 1YKAA 3WGDA 3MNGA 2HSYA 4TW5A 4ECIA 4GSSA 4FQUA 3LJRA 4MPFA 1TP9A 4HEA2 1ACVA 4PQHA 5ELGA 2K6VA 5HR3A 1GSSA 2JSZA 2YP6A 3WYWA 1GSYA 3FZ5A 2RM5A 2PBJA 1AAZA 1XXUA 3IA1A 1PL1A 3QOUA 5DJLA 1H75A 4ZL8A 2HSNB 3KCMA 3R3EA 1AC1A 1M2DA 1U3AA 1SD8A 3HJMA 2V6KA 2NPBA 2WB9A 4ID0A 1F3BA 4NHWA 2H76A 2HFDA 5E4WA 1XBSA 4JR6A 4HJ2A 4KX4A 1T4ZA 3G7YA 3NOFA 2WRTA 1O8XA 1M7TA 4ILFA 1PN9A 5IM9A 5ECNB 4F0CA 4JRRA 5G1LA 2VOCA 1OKDA 1M2BA 2DJ3A 2IMIA 5FWGA 3C71A 2B6MA 6GSVA 5AIXA 1DE1A 3O3TA 2FWHA 5CRHA 1MDIA 4KSOA 4MPGA 2YPMA 1ZYQB 2GT6A 5IMZA 4NWYA 5D9XA 1A0RP 1V9WA 2C1YA 1F2EA 2K8VA 3EC3A 3I9V2 1A23A 5IMDA 3WGXA 1GH2A 4TXVA 2PN8A 3IOSA 4TRXA 4WR4A 4K6XA 5JCGA 2IMFA 2I9HA 5FT3A 1JZWA 2H6ZA 3EWLA 4RQRA 1U88A 3TRPA 4IBPA 5D93A 1ZOFA 3E9JB 3L9UA 1SK2A 5DDLA 1TDIA 2L57A 3D21A 5A4VA 3RBTA 3ZLPA 2AHEA 3FHKA 4KF9A 1X9SB 2FLSA 2ES7A 2GTUA 4V1Ag
chains in the Genus database with same CATH superfamily
4OFMA 1Z6NA 4GSNA 1XWGA 1X9WB 2YV9A 2TRCP 4ZXGA 2X8GA 5G30A 4AGSA 4EIQA 1SL0B 2BTOT 5D9WA 2R2JA 3KGKA 1UN2A 4O5QA 4FH8A 1O85A 5DBQA 2CAQA 4H86A 1SYRA 5ELAA 2DJJA 1LU4A 1JZDA 1J0FA 1ZYEA 2L6CA 3Q18A 3C1SA 3QAVA 4K8MA 1WP0A 3IR4A 3H4KA 4F0BA 3O6TA 3TKSC 2PERA 3DVWA 2HSMA 5J9BA 4JU5A 2PPTA 3A2VA 2HRNA 5IMAA 1S3DA 1OAZA 2DMLA 2OE0A 4YKFA 2WVXA 2DJ1A 19GSA 4D73A 4QMKA 4OWYA 2V1MA 4EIPA 3K8NA 5D96A 1M99A 1K0AA 1SJIA 1S3RA 1G6WA 6GSSA 3HD5A 2WW2A 3N5OA 3RPNA 4I97A 2A4HA 1K3YA 3A3TA 3W8JA 5DCHA 4IJ3A 4XTSA 2B5XA 5B8BA 1GL8A 3CRUA 9GSSA 3A2XA 3ZL5A 3FR6A 4YQMA 3LFLA 1BG1A 4KCEA 1VF2A 3M0FA 1R5PA 2XBQA 1ZZYA 3CRTA 4YKGA 1WWJA 3BBYA 4MF7A 4FYUA 3TKSE 12GSA 4FIWA 3ZIJA 2HRKA 4ZILA 4PURA 3M9JA 2CVBA 3ZFLA 3GRXA 4K0NA 4O92A 4GF0A 1O8WA 4Z2UA 3FZ9A 1JHBA 3ISOA 4NXIA 5BRTA 1BF5A 3GMFA 3UOMA 4V2NA 1X9MB 3KMNA 2YZHA 1THOA 4WF4A 2PVOC 5DAKA 1E6BA 1TRWA 1ERWA 3IHGA 4HZ2A 3SBCA 3EE2A 1AXDA 4QQ7A 3ZRDA 4K1FA 2M46A 1WIKA 1T3BA 4MK3A 2YWMA 2OE1A 3D4TA 1B4PA 4USSA 4YAPA 3OR5A 1Z7RA 2WW3A 2TRXA 3RHBA 4OCEA 2HRKB 3VWXA 4AJ7A 4IN0A 1YEXA 1TW9A 5HQPA 5GSTA 4KGIA 1QUWA 2HSHA 1I9DA 4K7IA 4ZB9A 2LKUA 2EFDA 3HKRA 4HDEA 1SK1A 2OBKA 2H66A 3U5RE 4F82A 3UL3A 2CZ2A 1RK4A 1PD21 4MJEA 2X8CA 5GSSA 2JU5A 1GTIA 1B4QA 2FWGA 3I69A 4ZB7A 2MMOA 1OYJA 3DD3A 4TOPA 4POKA 2QC7A 3APQA 3TJBA 1A0FA 2ON7A 4PI2C 4ICYA 2YANA 3D4MA 3QFBC 2KLXA 4N30A 5IPHA 4EDZA 3C73A 3WGEA 4HZ4A 5J4YA 3KP9A 1XPVA 4MJBA 2D2ZA 3KIJA 4MA9A 3UVHA 4OFNA 5JCWA 2MMZA 3UMAA 4WKWA 2MBSA 1AW9A 1SYXA 1GUMA 5GZZB 2EFEA 4Z2RA 3TKQA 5EY6A 4RUVA 3WD6A 1UVZA 4W66A 4P3YB 2MMNA 3F63A 1ERTA 4L5OA 3E3EA 2XHFA 2JSYA 2H01A 1GTUA 5G2ZA 4POMA 4Z7XA 3ZYWA 1Z6MA 3ZMLA 4KDXA 3GH9A 3F8UA 4F03A 2DLXA 1J9BA 1A2LA 4EXJA 3JCML 4BVYA 3RPPA 1GRXA 3GN3A 3VWVA 2L59A 5KOXA 2R3XA 3CSHA 1B48A 3DYRA 7GSSA 2L4QA 1TI1A 4L8EA 1HNAA 1XZOA 2H72A 2L4CA 1GLQA 3LW9A 1EV4A 2GZYA 4EDYA 1BAYA 3FYGA 5F07A 5DQSA 1TK8B 1N8JA 5ECKB 2HZEA 1N25A 2ZCTA 1YVLA 1A2JA 3G7IA 3HVSA 5ECHB 5ECRB 2VL3A 5J5NA 2F51A 1Z9HA 2MYGA 1QK8A 3DIEA 2KUCA 3TKRA 5ECPB 2K18A 5B6MA 5IOWA 2CAIA 2H0GA 4KCAA 18GSA 4MH2A 3F6FA 2PMTA 5G5EA 5F8BA 1Q4JA 2EFCA 2X64A 2JADA 3DVXA 1XCCA 1TU8A 3CSIA 1X5CA 4BVXA 1FOVA 3EPTA 1OC9A 1XOAA 3GYKA 1G7EA 5ID2B 4KE3A 4GXZA 2HZEB 5GAPD 3QFAC 1PFOA 1OVNA 1ZMAA 1M2AA 3H8QA 5KOWA 4WBRD 11GSA 4HJMA 4TR1A 2IWTA 1TOFA 1X0RA 2HI7A 4GQCA 2H1GA 2P5QA 3HDCA 2F8FA 1XOBA 4XS4A 3L4NA 2C8UA 4HQZA 3KD0A 2CVDA 4LL1B 3IE3A 4ZIJA 2WW1A 1CQGA 2H19A 4IW9A 4WXTA 2AAWA 3F9UA 4DVCA 3ME8A 4EKZA 5J47A 1M9AA 4GDFA 1R4WA 3APSA 2H1AA 2F8AA 4BWQA 1AIUA 3IC4A 1GSDA 1GTAA 3TJGA 3O76A 5A1NA 4A5PA 4TR1B 1A8LA 2AUVA 1EV9A 4GQFA 5F05A 1SENA 1YEWC 2VCWA 4K9ZA 4X1UA 3C7MA 1V40A 2IFQA 3GTUB 2VCTA 2OA7A 2O8VB 3FK8A 5G5FA 6GSXA 4XS4B 2WJUA 1O81A 1Z7PA 2DKHA 5J9CA 2M72A 1NM3A 1FHEA 2A2SA 5CO3A 2OKAA 2H1DA 4HQSA 2RIIA 4XRDA 3TGZA 4PHZC 1TKDB 2V32A 1UC7A 2GZPA 5ECMB 2FGXA 3ZIVA 2QSIA 4F2IA 4MH3A 2VCZA 2LS5A 4KB3A 2CX4A 5CP1A 1I5GA 5A1NB 3ZMKA 3TJJA 4G0KA 2EFHA 3VI7A 2IFQB 4EVMA 1PGTA 3GKKA 3KM6A 4YQUA 3GX0A 2VUPA 5COHA 2OE3A 2VD0A 2H73A 4LMWA 2C0GA 1O6JA 3DRNA 2O87A 3KXOA 3UARA 3L0HA 4RI7A 1GNWA 2VLUA 1K0DA 4YAVA 1PX7A 2KOKA 4KSMA 1XIYA 5CYYA 2FUG2 3TOTA 4NV5A 1MTCA 2GQLA 5CRGA 2GT5A 4XHMA 3ZVJA 1Q98A 2CA8A 2KHPA 4TKYA 5AIVA 1KEBA 1SD9A 5GAND 4POLA 1Z3EA 1HD2A 1NSWA 3SWLA 2J23A 3GKNA 5HFIA 2IJYA 5KN3A 5ABRA 2GDRA 1ERUA 3EURA 2R5GA 5EL8A 5A5KA 2CX3A 2I3YA 1DUGA 4ZB6A 2C3QA 2KP2A 2C0FA 3RHCA 2I4AA 1TXUA 1U87A 3LYPA 3FR9A 4PGTA 1Z5YE 1GUKA 3FW2A 1BEDA 5H5RA 1BYEA 3IV4A 2HE3A 1H4OA 3GH6A 2FA8A 4LMVA 2BMXA 3KJYA 2GGTA 2E7PA 3P7XA 4V2MA 3RGBC 1WOUA 2TIRA 5ECIB 4I2TA 5KN0A 3ERGA 2LRCA 4ISDA 4NMUA 4TR3A 4K5SA 3WT1A 3N9JA 3TUEA 4EF0A 1KNGA 2A2RA 4HOJA 4TXOA 1T1VA 3ED3A 4N0ZA 4AI6A 4NV2A 2R0PA 4I2UA 2H74A 3FEUA 4TR4A 2DIZA 2KP1A 4CDOA 5JWRB 2WVYA 3GHAA 5C04A 1XFLA 1FOHA 1WE0A 1SL2B 2M80A 5FHIA 2WCIA 1GSFA 2IMEA 1DE2A 1LBKA 5IMVA 1TI3A 3IHQA 5CAXA 2WDUA 1TRVA 4X4JA 5C00A 2WZ9A 3VPQA 3W6GA 2YV7A 1IYIA 2IPAA 2B3SA 3E0UA 1GSQA 4G01A 2B7JA 5IO2A 2VLTA 3TU3B 2H6YA 2ZNMA 4N0VA 1SKWB 1T8EB 3IXRA 4IP1A 2C0EA 2CVKA 3KH7A 1IYHA 4KNDA 1F9MA 5A34A 1V58A 3CTFA 1FW1A 2HSMB 1SKSB 1PKWA 2AV4A 3QMXA 2R6KA 3C8EA 2VL2A 4MZWA 4ML6A 2ZUPA 1TK0B 1RQMA 4MF5A 2WVXB 4D73B 4WR5A 4PTSA 1M3JA 5CRWA 5DJMA 2P31A 5JWQB 3TB2A 1G7OA 2XPEA 2L6DA 2V2GA 4MLYA 4Q5QA 2H8LA 3M8NA 4I5QA 1T4YA 2FHEA 1ST9A 3GIXA 4HU7A 5J3RA 5IOXA 1BG5A 3F4TA 1BJXA 4PUAA 2RLIA 1NHYA 1FVJA 2XPDA 2RUEA 4AJ8A 4Q5NA 1CQHA 1HYUA 2VIMA 3IBHA 1TTZA 3IPZA 4JEDA 1DBYA 1GULA 4G0IA 1QQ2A 2A4VA 5HFGA 2DC5A 1YQ1A 2N5AA 4MZCA 16GSA 3BCKA 1FB6A 2QKEA 3FZAA 5DQYA 2IMDA 1URMA 1EOGA 3VI5A 1XWBA 1U3IA 3MAKA 1O73A 2DIYA 5KN1A 3CMIA 5D73A 5DAKB 2IN3A 3F4SA 3QD9A 2X8HA 5B6NA 1PSQA 2BJXA 4PX1A 1EWXA 2C4JA 3EMPA 3IAM2 1FB0A 4KA0A 4MCUA 3F6DA 2DSAA 4PXOA 5CREA 2K8SA 4MNNA 3FY7A 3FZ4A 3EU4A 3HZ4A 2NTOA 4PNFA 4KAEA 5J4VA 6GSWA 2YJ7A 3HYPA 2JZSA 1ABAA 5DCGA 5B8AA 3MIXA 4XS1A 4I6XA 1V98A 1S4BP 4POBA 4X43A 4EE0A 1SK0A 2HZFA 4BL7A 5BMUA 1MD3A 4O7HA 6GSUA 5AGYA 3Q74A 4X0XA 5A4UA 3DKSA 3ZTLA 2OACA 5HFKA 4GCIA 4MF6A 2LV3A 1BQ7A 5A4WA 2X99A 4BIKA 5LD0A 2LQOA 3MWHA 2IIYA 1V57A 3L9VA 4ML1A 1G6YA 4Q5RA 3EMXA 3GSTA 2YOIA 4MJAA 3ZVJD 2YJHA 3UVTA 2DJ2A 1OC8A 5LCZA 5G1KA 4AKIA 2K9FA 4XIHA 3TOUA 5IIZA 4K7NA 3FRCA 3DXBA 3TRQA 17GSA 2R0GA 5ECLB 5ECOB 2H1BA 1THXA 2VM1A 1HNCA 2C3NA 2R0CA 5EVOA 2EC4A 4BL7B 1ZCPA 5IPGA 3F4RA 4ACSA 4NPBA 2UZ8A 2L5LA 1OC3A 1W89A 3QCPA 1J08A 2PVQA 4L5LA 5E59A 1MDKA 3ERWA 2CT6A 3RAZA 1JFUA 5LNKe 4BVYB 3GKMA 3PH9A 2VCVA 1OKTA 2EIRA 2YNXA 2GZZA 1O7UA 1M3IA 3LG6A 1DSBA 4MMMA 5JWOB 1JZRA 3LGCA 4KUNA 1GSUA 1K0CA 3CQFA 1UA5A 4K5RA 2GSSA 4E8HA 4LA1A 5CRDA 3ZZXA 4O5RA 4HI7A 4K2XA 2VCXA 5HR0A 3TKPA 3L9SA 5A5HA 4N10A 2VO4A 3CHXC 4AJ6A 1XWAA 4WETA 4PQIA 4TN8A 2H30A 2RUFA 1ML6A 3IK9A 3ERFA 13GSA 1GLPA 3Q6OA 4G19A 3D0ZA 4BA7A 10GSA 1VRSD 1SVOA 2IMKA 1GTBA 2LRNA 3EINA 2IL3A 2E2GA 3QPMA 3CYNA 3M3MA 3EU3A 4CW9A 1X5EA 3Q19A 3HJPA 3I43A 3US3A 3LWAA 4KDUA 4CHSA 1TU7A 3GUSA 4BVXB 1OC9B 2HSNA 4ZB8A 3HVVA 1YF0A 1ZYNA 2GSTA 2B7KA 1KBNA 1B9XC 3GKXA 4DSRA 4OFTA 2X49A 1VF4A 1MD4A 2Z9SA 3KEBA 4RQXA 4E68A 3VFIA 4YH2A 2EIOA 2NBSA 2ON5A 2HT9A 3F0IA 5D8IA 3DWVA 4GLTA 2FD3A 2HXKA 4IGJA 1K0BA 1VF3A 3H93A 3TKSA 5D9VA 4IELA 3C1RA 3TJFA 4DSSA 2AJQB 2YCDA 3CBUA 1FVKA 1EZKA 3IRAA 3AY8A 2HLSA 2LNSA 5KEJA 1ZL9A 2GSQA 2HNLA 4YQVA 1VGLA 4EL1A 1JZOA 2VM2A 3GL3A 4PQ1A 3RFRC 4IQ1A 1AQWA 5ECSA 2AB6A 3TJKA 2H75A 2R37A 5HR1A 3BJ5A 2OADA 2MZCA 3DMLA 1YJ6A 3WT2A 1B8XA 1F37A 3D6IA 3CSJA 1GSEA 5IMCA 2HRFA 3DGQA 5H5SA 1TRSA 2B5EA 1XW6A 4GWRA 1ON4A 4KDYA 3W8SA 3I6AA 2G2QA 3NZNA 2CV4A 3FMWA 4V1Ap 3VK9A 2A2PA 14GSA 2N5FA 3VPTA 2F3MA 4WBJA 4DSSB 2NDOA 4OD7A 4QL7A 3D5JA 1AQVA 1T00A 3VWUA 5G31A 4TR0A 3H79A 22GSA 1A2MA 2C0DA 4PUFC 3KTLA 2VL9A 2LRTA 4MDCA 1XWKA 2F9SA 3GV1A 1G0TA 1A8YA 1S3CA 4AKXB 4J56E 5H5QA 2H0HA 4L0UA 1WJKA 3KH9A 3UIWA 3J7Yb 2DJKA 3M9KA 1XW5A 3VLNA 3EYTA 2JZTA 2B1LA 1USBA 2GSRA 3HHVA 1PMTA 1EEMA 1XG8A 1YDKA 2I81A 1FAAA 3MSZA 4JBBA 3P2AA 1R26A 2PWJA 2YWNA 1YEPA 2P0GA 3IAS2 3LQ7A 1F3AA 2PGTA 1E2YA 1MDJA 3TRXA 4K0GA 1A24A 2C80A 1XWCA 2WW0A 2V6OA 3A2WA 2O85A 3A5WA 2O3EA 1OE7A 2LSTA 1LJRA 3HJOA 6GSYA 5INYA 3P90A 3IC8A 4DEJA 5J4UA 3GFKA 4Q5FA 2FA4A 1R7HA 4ZBDA 1SVLA 2YN1A 4EUYA 1N2AA 1Y6EA 1ILOA 3PPUA 3S9FA 1W4VA 1B9YC 3KMOA 3PR8A 4CY6A 4ZBBA 1WPIA 2REMA 5B7CA 4FYBA 2I1UA 2VD1A 2GVPA 5J41A 3H1NA 2VLVA 2YZUA 1QFNA 2JACA 1K3LA 2JZRA 2MBTA 4ECJA 2J9HA 3VURA 1PQNA 2UV8G 3ZREA 3KTBA 4CY8A 3BD2A 4N11A 1KTEA 4MABA 1WMJA 1GUHA 3L78A 4G2EA 4TXOB 1F6MC 3GA4A 2L5OA 4OMVA 2FWEA 3P8WA 1QMVA 4XCSA 4JZQA 1M9BA 4LLRA 3GNJA 2H6XA 2E0QA 4EC0A 4J2FA 4G10A 2C3TA 3J7Yk 4IKHA 1PN0A 20GSA 3RDWA 3D22A 5AISA 4FYCA 1EGRA 3VWWA 1SJ6A 2GQMA 3LSZA 1PRXA 2PUKC 1V2AA 4V2LA 3QR6A 4OO4A 4WEYA 2XC2A 3HZ8A 1S3AA 2GQKA 2LTKA 4HS1A 2FCHA 4KH7A 3UBLA 3TCOA 2CQ9A 4OCFA 2O89A 3M1GA 1XW9A 1GWCA 4BPYA 1PA3A 1FG4A 5A34B 1FO5A 3CXGA 2N5BA 1EGOA 1VF1A 2O5VA 3G9BA 1XVWA 4MP4A 2O7KA 2QA1A 3LEFA 2HYXA 2WVZA 4RI6A 4ECCA 2ALBA 3DEXA 1YY7A 4GSTA 4HU9A 1SL1B 4IQAA 3MDKA 1AQXA 1Y25A 1GNEA 4PNGA 2WULA 2LUSA 4GRFA 3ME7A 3LYKA 4IHUA 2RM6A 1K0MA 4AKHA 1PX6A 5EPFA 1C72A 3F3QA 4L0WA 2VAFA 2B1KA 4JR4A 3GSSA 3LXZA 4K7OA 3UBKA 3GL5A 4Z2TA 3UEMA 4GTUA 5DALA 4IJIA 3KP8A 3V1WA 2GLRA 3HA9A 1X5DA 4G0LA 3QAWA 3GURA 2O36A 2LJAA 3UJ1A 3IDVA 2JL4A 2LQQA 4XRAA 1TXXA 3EVIA 5IO0A 1M0UA 4HSCX 2QGVA 5F06A 1I1IP 4AKGA 2LJKA 3HY2A 4LL4B 1YKCA 5IMFA 3R2QA 4ZBAA 3NIVA 2DMMA 5ECQB 8GSSA 2B5YA 1OE8A 1YZXA 2H71A 3QDNA 4AF2A 4WF5A 1QGVA 5DALB 2WGRA 2DJ0A 2H0IA 3KZQA 2AYTA 2XBIA 4JE1A 3ZFBA 2LEGA 2VL2C 4ULXA 5AN1A 2R4VA 2PU9C 2YWOA 5BMUB 5KN2A 5L71A 4QL9A 3APOA 1EP8A 2EIQA 2HQTA 1RW1A 2H70A 2YWIA 2G0FA 4G9HA 5F0GA 4IVFA 1K0NA 4F9ZA 5ID2A 3LXTA 2DBCA 1JLVA 4NHZA 2GS3A 2MMAA 1WRYA 3CTGA 1JLWA 2QA2A 3PGTA 1PL2A 1MEKA 4NAXA 1XVQA 3GX8A 2NVLA 3UAPA 2P5RA 5JCUA 1K3OA 2OBIA 1GP1A 3A5IA 3BCIA 4EO3A 3PINA 4I8BA 3FR3A 1EOHA 1NW2A 4ECBA 3BOAA 1YF1A 4ZL9A 1R5AA 1SVMA 1NHOA 1K0OA 3QAGA 1U6TA 5CNWA 3FKFA 2DKIA 2FY6A 1ERVA 2FNOA 3HVXA 3HXSA 1EP7A 2LNTA 4O5UA 4IS0A 4IP6A 3LORA 3F3RA 4MJCA 1SKRB 4FXYP 2X4AA 4PI0C 1QXHA 4K2DA 1SJZA 2CZ3A 2V41A 4ZL7A 1ZGNA 2OT3A 3U6VA 4MZBA 4J57E 1HNBA 3G7JA 5IQYA 1TRUA 2FWFA 1SU9A 4TVEA 1PKZA 1T7PB 4E8EA 3GTUA 2OJLA 2VCQA 2WS2A 4OO5A 1TK5B 5ENUA 2HRAA 2WFCA 4XS6A 2LJRA 3IK7A 4FO5A 3HCZA 1HQOA 5HR2A 4KW6A 4O32A 1AUCA 2E2MA 3ZITA 4DSQA 6GSTA 4BWSA 3TDGA 5A5HB 5D9TA 4HUAA 1EEJA 1TJDA 2WZSA 1BX9A 5DVBA 1YKAA 3WGDA 3MNGA 3HVNA 2HSYA 4TW5A 4ECIA 4GSSA 4FQUA 3LJRA 4MPFA 1TP9A 4HEA2 1ACVA 4PQHA 5ELGA 3CWGA 2K6VA 5HR3A 1GSSA 2JSZA 2YP6A 3WYWA 1GSYA 3FZ5A 2RM5A 2PBJA 1AAZA 1XXUA 3IA1A 1PL1A 3QOUA 5DJLA 1H75A 4ZL8A 2HSNB 3KCMA 3R3EA 2VKZG 1AC1A 1M2DA 1U3AA 1SD8A 3HJMA 3HMJG 2V6KA 2NPBA 2WB9A 4ID0A 1F3BA 4NHWA 2H76A 2HFDA 2H1LA 5E4WA 1XBSA 4JR6A 4HJ2A 4KX4A 1T4ZA 3G7YA 3NOFA 2WRTA 1O8XA 1M7TA 4ILFA 1PN9A 5IM9A 5ECNB 4F0CA 4JRRA 5G1LA 2VOCA 1OKDA 1M2BA 2DJ3A 2IMIA 5FWGA 3C71A 2B6MA 6GSVA 5AIXA 1DE1A 3O3TA 2FWHA 5CRHA 1MDIA 4KSOA 4MPGA 2YPMA 1ZYQB 1Y1UA 2GT6A 5IMZA 4NWYA 5D9XA 1ZYPA 1A0RP 1V9WA 2C1YA 1F2EA 2K8VA 3EC3A 3I9V2 1A23A 5IMDA 3WGXA 3MYDA 1GH2A 4TXVA 2PN8A 3IOSA 4TRXA 4WR4A 4K6XA 5JCGA 2IMFA 2I9HA 5FT3A 1JZWA 2H6ZA 3EWLA 4RQRA 1U88A 3TRPA 4IBPA 5D93A 1ZOFA 3E9JB 3L9UA 1SK2A 5DDLA 1TDIA 5J40A 2L57A 3D21A 5A4VA 3RBTA 3ZLPA 2AHEA 4N3ZA 3FHKA 4KF9A 1X9SB 2FLSA 2ES7A 2GTUA 4V1Ag
chains in the Genus database with same CATH topology
4OFMA 1Z6NA 4GSNA 1XWGA 1X9WB 2YV9A 2TRCP 4ZXGA 2X8GA 5G30A 4AGSA 4EIQA 1SL0B 2BTOT 5D9WA 2R2JA 3KGKA 1UN2A 4O5QA 4FH8A 1O85A 5DBQA 2CAQA 4H86A 1SYRA 5ELAA 2DJJA 1LU4A 1JZDA 1J0FA 1ZYEA 2L6CA 3Q18A 3C1SA 3QAVA 4K8MA 1WP0A 3IR4A 3H4KA 4F0BA 3O6TA 3TKSC 2PERA 3DVWA 2HSMA 5J9BA 4JU5A 2PPTA 3A2VA 2HRNA 5IMAA 1S3DA 1OAZA 2DMLA 2OE0A 4YKFA 2DJ1A 19GSA 4D73A 4QMKA 4OWYA 2V1MA 4EIPA 3K8NA 5D96A 1M99A 1K0AA 1SJIA 1G6WA 6GSSA 3HD5A 3N5OA 3RPNA 4I97A 2A4HA 1K3YA 3A3TA 3W8JA 5DCHA 4IJ3A 4XTSA 2B5XA 5B8BA 1GL8A 3CRUA 9GSSA 3A2XA 3ZL5A 3FR6A 4YQMA 3LFLA 1BG1A 4KCEA 1VF2A 3M0FA 1R5PA 2XBQA 1ZZYA 3CRTA 4YKGA 1WWJA 3BBYA 4MF7A 4FYUA 3TKSE 12GSA 4FIWA 3ZIJA 2HRKA 4ZILA 4PURA 3M9JA 2CVBA 3ZFLA 3GRXA 4K0NA 4O92A 4GF0A 1O8WA 4Z2UA 3FZ9A 1JHBA 3ISOA 4NXIA 5BRTA 1BF5A 3GMFA 3UOMA 4V2NA 1X9MB 3KMNA 2YZHA 1THOA 4WF4A 2PVOC 5DAKA 1E6BA 1TRWA 1ERWA 3IHGA 4HZ2A 3SBCA 3EE2A 1AXDA 4QQ7A 3ZRDA 4K1FA 2M46A 1WIKA 1T3BA 4MK3A 2YWMA 2OE1A 3D4TA 1B4PA 4USSA 4YAPA 3OR5A 1Z7RA 2TRXA 3RHBA 4OCEA 2HRKB 3VWXA 4AJ7A 4IN0A 1YEXA 1TW9A 5HQPA 5GSTA 4KGIA 1QUWA 2HSHA 1I9DA 4K7IA 4ZB9A 2LKUA 2EFDA 3HKRA 4HDEA 1SK1A 2OBKA 2H66A 3U5RE 4F82A 3UL3A 2CZ2A 1RK4A 1PD21 4MJEA 2X8CA 5GSSA 2JU5A 1GTIA 1B4QA 2FWGA 3I69A 4ZB7A 2MMOA 1OYJA 3DD3A 4TOPA 4POKA 2QC7A 3APQA 3TJBA 1A0FA 2ON7A 4ICYA 2YANA 3D4MA 3QFBC 2KLXA 4N30A 5IPHA 4EDZA 3C73A 3WGEA 4HZ4A 5J4YA 3KP9A 1XPVA 4MJBA 2D2ZA 3KIJA 4MA9A 3UVHA 4OFNA 5JCWA 2MMZA 3UMAA 4WKWA 2MBSA 1AW9A 1SYXA 1GUMA 5GZZB 2EFEA 4Z2RA 3TKQA 5EY6A 4RUVA 3WD6A 1UVZA 4W66A 4P3YB 2MMNA 3F63A 1ERTA 4L5OA 3E3EA 2XHFA 2JSYA 2H01A 1GTUA 5G2ZA 4POMA 4Z7XA 3ZYWA 1Z6MA 3ZMLA 4KDXA 3GH9A 3F8UA 4F03A 2DLXA 1J9BA 1A2LA 4EXJA 3JCML 4BVYA 3RPPA 1GRXA 3GN3A 3VWVA 2L59A 5KOXA 2R3XA 3CSHA 1B48A 3DYRA 7GSSA 2L4QA 1TI1A 4L8EA 1HNAA 1XZOA 2H72A 2L4CA 1GLQA 3LW9A 1EV4A 2GZYA 4EDYA 1BAYA 3FYGA 5F07A 5DQSA 1TK8B 1N8JA 5ECKB 2HZEA 1N25A 2ZCTA 1YVLA 1A2JA 3G7IA 3HVSA 5ECHB 5ECRB 2VL3A 5J5NA 2F51A 1Z9HA 2MYGA 1QK8A 3DIEA 2KUCA 3TKRA 5ECPB 2K18A 5B6MA 5IOWA 2CAIA 2H0GA 4KCAA 18GSA 4MH2A 3F6FA 2PMTA 5G5EA 5F8BA 1Q4JA 2EFCA 2X64A 2JADA 3DVXA 1XCCA 1TU8A 3CSIA 1X5CA 4BVXA 1FOVA 3EPTA 1OC9A 1XOAA 3GYKA 1G7EA 5ID2B 4KE3A 4GXZA 2HZEB 5GAPD 3QFAC 1OVNA 1ZMAA 1M2AA 3H8QA 5KOWA 4WBRD 11GSA 4HJMA 4TR1A 2IWTA 1TOFA 1X0RA 2HI7A 4GQCA 2H1GA 2P5QA 3HDCA 2F8FA 1XOBA 4XS4A 3L4NA 2C8UA 4HQZA 3KD0A 2CVDA 4LL1B 3IE3A 4ZIJA 1CQGA 2H19A 4IW9A 4WXTA 2AAWA 3F9UA 4DVCA 3ME8A 4EKZA 5J47A 1M9AA 4GDFA 1R4WA 3APSA 2H1AA 2F8AA 4BWQA 1AIUA 3IC4A 1GSDA 1GTAA 3TJGA 3O76A 5A1NA 4A5PA 4TR1B 1A8LA 2AUVA 1EV9A 4GQFA 5F05A 1SENA 2VCWA 4K9ZA 4X1UA 3C7MA 1V40A 2IFQA 3GTUB 2VCTA 2OA7A 2O8VB 3FK8A 5G5FA 6GSXA 4XS4B 2WJUA 1O81A 1Z7PA 2DKHA 5J9CA 2M72A 1NM3A 1FHEA 2A2SA 5CO3A 2OKAA 2H1DA 4HQSA 2RIIA 4XRDA 3TGZA 1TKDB 2V32A 1UC7A 2GZPA 5ECMB 2FGXA 3ZIVA 2QSIA 4F2IA 4MH3A 2VCZA 2LS5A 4KB3A 2CX4A 5CP1A 1I5GA 5A1NB 3ZMKA 3TJJA 4G0KA 2EFHA 3VI7A 2IFQB 4EVMA 1PGTA 3GKKA 3KM6A 4YQUA 3GX0A 2VUPA 5COHA 2OE3A 2VD0A 2H73A 4LMWA 2C0GA 1O6JA 3DRNA 2O87A 3KXOA 3UARA 3L0HA 4RI7A 1GNWA 2VLUA 1K0DA 4YAVA 1PX7A 2KOKA 4KSMA 1XIYA 5CYYA 2FUG2 3TOTA 4NV5A 1MTCA 2GQLA 5CRGA 2GT5A 4XHMA 3ZVJA 1Q98A 2CA8A 2KHPA 4TKYA 5AIVA 1KEBA 1SD9A 5GAND 4POLA 1Z3EA 1HD2A 1NSWA 3SWLA 2J23A 3GKNA 5HFIA 2IJYA 5KN3A 5ABRA 2GDRA 1ERUA 3EURA 2R5GA 5EL8A 5A5KA 2CX3A 2I3YA 1DUGA 4ZB6A 2C3QA 2KP2A 2C0FA 3RHCA 2I4AA 1TXUA 1U87A 3LYPA 3FR9A 4PGTA 1Z5YE 1GUKA 3FW2A 1BEDA 5H5RA 1BYEA 3IV4A 2HE3A 1H4OA 3GH6A 2FA8A 4LMVA 2BMXA 3KJYA 2GGTA 2E7PA 3P7XA 4V2MA 1WOUA 2TIRA 5ECIB 4I2TA 5KN0A 3ERGA 2LRCA 4ISDA 4NMUA 4TR3A 4K5SA 3WT1A 3N9JA 3TUEA 4EF0A 1KNGA 2A2RA 4HOJA 4TXOA 1T1VA 3ED3A 4N0ZA 4AI6A 4NV2A 2R0PA 4I2UA 2H74A 3FEUA 4TR4A 2DIZA 2KP1A 4CDOA 5JWRB 3GHAA 5C04A 1XFLA 1FOHA 1WE0A 1SL2B 2M80A 5FHIA 2WCIA 1GSFA 2IMEA 1DE2A 1LBKA 5IMVA 1TI3A 3IHQA 5CAXA 2WDUA 1TRVA 4X4JA 5C00A 2WZ9A 3VPQA 3W6GA 2YV7A 1IYIA 2IPAA 2B3SA 3E0UA 1GSQA 4G01A 2B7JA 5IO2A 2VLTA 3TU3B 2H6YA 2ZNMA 4N0VA 1SKWB 1T8EB 3IXRA 4IP1A 2C0EA 2CVKA 3KH7A 1IYHA 4KNDA 1F9MA 5A34A 1V58A 3CTFA 1FW1A 2HSMB 1SKSB 1PKWA 2AV4A 3QMXA 2R6KA 3C8EA 2VL2A 4MZWA 4ML6A 2ZUPA 1TK0B 1RQMA 4MF5A 4D73B 4WR5A 4PTSA 5CRWA 5DJMA 2P31A 5JWQB 3TB2A 1G7OA 2XPEA 2L6DA 2V2GA 4MLYA 4Q5QA 2H8LA 3M8NA 4I5QA 1T4YA 2FHEA 1ST9A 3GIXA 4HU7A 5J3RA 5IOXA 1BG5A 3F4TA 1BJXA 4PUAA 2RLIA 1NHYA 1FVJA 2XPDA 2RUEA 4AJ8A 4Q5NA 1CQHA 1HYUA 2VIMA 3IBHA 1TTZA 3IPZA 4JEDA 1DBYA 1GULA 4G0IA 1QQ2A 2A4VA 5HFGA 2DC5A 1YQ1A 2N5AA 4MZCA 16GSA 3BCKA 1FB6A 2QKEA 3FZAA 5DQYA 2IMDA 1URMA 1EOGA 3VI5A 1XWBA 1U3IA 3MAKA 1O73A 2DIYA 5KN1A 3CMIA 5D73A 5DAKB 2IN3A 3F4SA 3QD9A 2X8HA 5B6NA 1PSQA 2BJXA 4PX1A 1EWXA 2C4JA 3EMPA 3IAM2 1FB0A 4KA0A 4MCUA 3F6DA 2DSAA 4PXOA 5CREA 2K8SA 4MNNA 3FY7A 3FZ4A 3EU4A 3HZ4A 2NTOA 4PNFA 4KAEA 5J4VA 6GSWA 2YJ7A 3HYPA 2JZSA 1ABAA 5DCGA 5B8AA 3MIXA 4XS1A 4I6XA 1V98A 4POBA 4X43A 4EE0A 1SK0A 2HZFA 4BL7A 5BMUA 1MD3A 4O7HA 6GSUA 5AGYA 3Q74A 4X0XA 5A4UA 3DKSA 3ZTLA 2OACA 5HFKA 4GCIA 4MF6A 2LV3A 1BQ7A 5A4WA 2X99A 5LD0A 2LQOA 3MWHA 2IIYA 1V57A 3L9VA 4ML1A 1G6YA 4Q5RA 3EMXA 3GSTA 2YOIA 4MJAA 3ZVJD 2YJHA 3UVTA 2DJ2A 1OC8A 5LCZA 5G1KA 4AKIA 2K9FA 4XIHA 3TOUA 5IIZA 4K7NA 3FRCA 3DXBA 3TRQA 17GSA 2R0GA 5ECLB 5ECOB 2H1BA 1THXA 2VM1A 1HNCA 2C3NA 2R0CA 5EVOA 2EC4A 4BL7B 1ZCPA 5IPGA 3F4RA 4ACSA 4NPBA 2UZ8A 2L5LA 1OC3A 1W89A 3QCPA 1J08A 2PVQA 4L5LA 5E59A 1MDKA 3ERWA 2CT6A 3RAZA 1JFUA 5LNKe 4BVYB 3GKMA 3PH9A 2VCVA 1OKTA 2EIRA 2YNXA 2GZZA 1O7UA 3LG6A 1DSBA 4MMMA 5JWOB 1JZRA 3LGCA 4KUNA 1GSUA 1K0CA 1UA5A 4K5RA 2GSSA 4E8HA 4LA1A 5CRDA 3ZZXA 4O5RA 4HI7A 4K2XA 2VCXA 5HR0A 3TKPA 3L9SA 5A5HA 4N10A 2VO4A 4AJ6A 1XWAA 4WETA 4PQIA 4TN8A 2H30A 2RUFA 1ML6A 3IK9A 3ERFA 13GSA 1GLPA 3Q6OA 4G19A 3D0ZA 4BA7A 10GSA 1VRSD 1SVOA 2IMKA 1GTBA 2LRNA 3EINA 2IL3A 2E2GA 3QPMA 3CYNA 3M3MA 3EU3A 4CW9A 1X5EA 3Q19A 3HJPA 3I43A 3US3A 3LWAA 4KDUA 4CHSA 1TU7A 3GUSA 4BVXB 1OC9B 2HSNA 4ZB8A 3HVVA 1YF0A 1ZYNA 2GSTA 2B7KA 1KBNA 1B9XC 3GKXA 4DSRA 4OFTA 2X49A 1VF4A 1MD4A 2Z9SA 3KEBA 4RQXA 4E68A 3VFIA 4YH2A 2EIOA 2NBSA 2ON5A 2HT9A 3F0IA 5D8IA 3DWVA 4GLTA 2FD3A 2HXKA 4IGJA 1K0BA 1VF3A 3H93A 3TKSA 5D9VA 4IELA 3C1RA 3TJFA 4DSSA 2AJQB 2YCDA 3CBUA 1FVKA 1EZKA 3IRAA 3AY8A 2HLSA 2LNSA 5KEJA 1ZL9A 2GSQA 2HNLA 4YQVA 1VGLA 4EL1A 1JZOA 2VM2A 3GL3A 4PQ1A 4IQ1A 1AQWA 5ECSA 2AB6A 3TJKA 2H75A 2R37A 5HR1A 3BJ5A 2OADA 2MZCA 3DMLA 1YJ6A 3WT2A 1B8XA 1F37A 3D6IA 3CSJA 1GSEA 5IMCA 2HRFA 3DGQA 5H5SA 1TRSA 2B5EA 1XW6A 4GWRA 1ON4A 4KDYA 3W8SA 3I6AA 2G2QA 3NZNA 2CV4A 3FMWA 4V1Ap 3VK9A 2A2PA 14GSA 2N5FA 3VPTA 2F3MA 4WBJA 4DSSB 2NDOA 4OD7A 4QL7A 3D5JA 1AQVA 1T00A 3VWUA 5G31A 4TR0A 3H79A 22GSA 1A2MA 2C0DA 4PUFC 3KTLA 2VL9A 2LRTA 4MDCA 1XWKA 2F9SA 3GV1A 1G0TA 1A8YA 1S3CA 4AKXB 4J56E 5H5QA 2H0HA 4L0UA 1WJKA 3KH9A 3UIWA 3J7Yb 2DJKA 3M9KA 1XW5A 3VLNA 3EYTA 2JZTA 2B1LA 1USBA 2GSRA 3HHVA 1PMTA 1EEMA 1YDKA 2I81A 1FAAA 3MSZA 4JBBA 3P2AA 1R26A 2PWJA 2YWNA 1YEPA 2P0GA 3IAS2 3LQ7A 1F3AA 2PGTA 1E2YA 1MDJA 3TRXA 4K0GA 1A24A 2C80A 1XWCA 3A2WA 2V6OA 2O85A 3A5WA 1OE7A 2LSTA 1LJRA 3HJOA 6GSYA 5INYA 3P90A 3IC8A 4DEJA 5J4UA 3GFKA 4Q5FA 2FA4A 1R7HA 4ZBDA 1SVLA 2YN1A 4EUYA 1N2AA 1Y6EA 1ILOA 3PPUA 3S9FA 1W4VA 1B9YC 3KMOA 3PR8A 4CY6A 4ZBBA 1WPIA 2REMA 5B7CA 4FYBA 2I1UA 2VD1A 2GVPA 5J41A 3H1NA 2VLVA 2YZUA 1QFNA 2JACA 1K3LA 2JZRA 2MBTA 4ECJA 2J9HA 3VURA 1PQNA 2UV8G 3ZREA 3KTBA 4CY8A 3BD2A 4N11A 1KTEA 4MABA 1WMJA 1GUHA 3L78A 4G2EA 4TXOB 1F6MC 3GA4A 2L5OA 4OMVA 2FWEA 3P8WA 1QMVA 4XCSA 4JZQA 1M9BA 4LLRA 3GNJA 2H6XA 2E0QA 4EC0A 4J2FA 4G10A 2C3TA 3J7Yk 4IKHA 1PN0A 20GSA 3RDWA 3D22A 5AISA 4FYCA 1EGRA 3VWWA 1SJ6A 2GQMA 3LSZA 1PRXA 2PUKC 1V2AA 4V2LA 3QR6A 4OO4A 4WEYA 2XC2A 3HZ8A 1S3AA 2GQKA 2LTKA 4HS1A 2FCHA 4KH7A 3UBLA 3TCOA 2CQ9A 4OCFA 2O89A 3M1GA 1XW9A 1GWCA 4BPYA 1PA3A 1FG4A 5A34B 1FO5A 3CXGA 2N5BA 1EGOA 1VF1A 2O5VA 3G9BA 1XVWA 4MP4A 2O7KA 2QA1A 3LEFA 2HYXA 4ECCA 4RI6A 2ALBA 3DEXA 1YY7A 4GSTA 4HU9A 1SL1B 4IQAA 3MDKA 1AQXA 1Y25A 1GNEA 4PNGA 2WULA 2LUSA 4GRFA 3ME7A 3LYKA 4IHUA 2RM6A 1K0MA 4AKHA 1PX6A 5EPFA 1C72A 3F3QA 4L0WA 2VAFA 2B1KA 4JR4A 3GSSA 3LXZA 4K7OA 3UBKA 3GL5A 4Z2TA 3UEMA 4GTUA 5DALA 4IJIA 3KP8A 3V1WA 2GLRA 3HA9A 1X5DA 4G0LA 3QAWA 3GURA 3UJ1A 2LJAA 3IDVA 2JL4A 2LQQA 4XRAA 1TXXA 3EVIA 5IO0A 1M0UA 2QGVA 5F06A 4AKGA 2LJKA 3HY2A 4LL4B 1YKCA 5IMFA 3R2QA 4ZBAA 3NIVA 2DMMA 5ECQB 8GSSA 2B5YA 1OE8A 1YZXA 2H71A 3QDNA 4AF2A 4WF5A 1QGVA 5DALB 2WGRA 2DJ0A 2H0IA 3KZQA 2AYTA 2XBIA 4JE1A 3ZFBA 2LEGA 2VL2C 4ULXA 5AN1A 2R4VA 2PU9C 2YWOA 5BMUB 5KN2A 5L71A 4QL9A 3APOA 1EP8A 2EIQA 2HQTA 1RW1A 2H70A 2YWIA 2G0FA 4G9HA 5F0GA 4IVFA 1K0NA 4F9ZA 5ID2A 3LXTA 2DBCA 1JLVA 4NHZA 2GS3A 2MMAA 1WRYA 3CTGA 1JLWA 2QA2A 3PGTA 1PL2A 1MEKA 4NAXA 1XVQA 3GX8A 2NVLA 3UAPA 2P5RA 5JCUA 1K3OA 2OBIA 1GP1A 3A5IA 3BCIA 4EO3A 3PINA 4I8BA 3FR3A 1EOHA 1NW2A 4ECBA 3BOAA 1YF1A 4ZL9A 1R5AA 1SVMA 1NHOA 1K0OA 3QAGA 1U6TA 5CNWA 3FKFA 2DKIA 2FY6A 1ERVA 2FNOA 3HVXA 3HXSA 1EP7A 2LNTA 4O5UA 4IS0A 4IP6A 3LORA 3F3RA 4MJCA 1SKRB 2X4AA 1QXHA 4K2DA 1SJZA 2CZ3A 2V41A 4ZL7A 1ZGNA 2OT3A 3U6VA 4MZBA 4J57E 1HNBA 3G7JA 5IQYA 1TRUA 2FWFA 1SU9A 4TVEA 1PKZA 1T7PB 4E8EA 3GTUA 2OJLA 2VCQA 2WS2A 4OO5A 1TK5B 5ENUA 2HRAA 2WFCA 4XS6A 2LJRA 3IK7A 4FO5A 3HCZA 1HQOA 5HR2A 4KW6A 4O32A 1AUCA 2E2MA 3ZITA 4DSQA 6GSTA 4BWSA 3TDGA 5A5HB 5D9TA 4HUAA 1EEJA 1TJDA 1BX9A 5DVBA 1YKAA 3WGDA 3MNGA 2HSYA 4TW5A 4ECIA 4GSSA 4FQUA 3LJRA 4MPFA 1TP9A 4HEA2 1ACVA 4PQHA 5ELGA 3CWGA 2K6VA 5HR3A 1GSSA 2JSZA 2YP6A 3WYWA 1GSYA 3FZ5A 2RM5A 2PBJA 1AAZA 1XXUA 3IA1A 1PL1A 3QOUA 5DJLA 1H75A 4ZL8A 2HSNB 3KCMA 3R3EA 2VKZG 1AC1A 1M2DA 1U3AA 1SD8A 3HJMA 3HMJG 2V6KA 2NPBA 2WB9A 4ID0A 1F3BA 4NHWA 2H76A 2HFDA 2H1LA 5E4WA 1XBSA 4JR6A 4HJ2A 4KX4A 1T4ZA 3G7YA 3NOFA 2WRTA 1O8XA 1M7TA 4ILFA 1PN9A 5IM9A 5ECNB 4F0CA 4JRRA 5G1LA 2VOCA 1OKDA 1M2BA 2DJ3A 2IMIA 5FWGA 3C71A 2B6MA 6GSVA 5AIXA 1DE1A 3O3TA 2FWHA 5CRHA 1MDIA 4KSOA 4MPGA 2YPMA 1ZYQB 1Y1UA 2GT6A 5IMZA 4NWYA 5D9XA 1ZYPA 1A0RP 1V9WA 2C1YA 1F2EA 2K8VA 3EC3A 3I9V2 1A23A 5IMDA 3WGXA 3MYDA 1GH2A 4TXVA 2PN8A 3IOSA 4TRXA 4WR4A 4K6XA 5JCGA 2IMFA 2I9HA 5FT3A 1JZWA 2H6ZA 3EWLA 4RQRA 1U88A 3TRPA 4IBPA 5D93A 1ZOFA 3E9JB 3L9UA 1SK2A 5DDLA 1TDIA 5J40A 2L57A 3D21A 5A4VA 3RBTA 3ZLPA 2AHEA 4N3ZA 3FHKA 4KF9A 1X9SB 2FLSA 2ES7A 2GTUA 4V1Ag
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OFM A;  1Z6N A;  4GSN A;  1XWG A;  1X9W B;  2YV9 A;  2TRC P;  4ZXG A;  2X8G A;  5G30 A;  4AGS A;  1SL0 B;  2BTO T;  5D9W A;  2R2J A;  3KGK A;  1UN2 A;  4FH8 A;  1O85 A;  5DBQ A;  2CAQ A;  4H86 A;  1SYR A;  5ELA A;  2DJJ A;  1LU4 A;  1JZD A;  1J0F A;  1ZYE A;  2L6C A;  3Q18 A;  3C1S A;  3QAV A;  4K8M A;  1WP0 A;  3IR4 A;  3H4K A;  4F0B A;  3O6T A;  3TKS C;  2PER A;  3DVW A;  2HSM A;  5J9B A;  4JU5 A;  2PPT A;  3A2V A;  2HRN A;  5IMA A;  1S3D A;  1OAZ A;  2DML A;  2OE0 A;  2DJ1 A;  19GS A;  4D73 A;  4OWY A;  2V1M A;  3K8N A;  5D96 A;  1M99 A;  1K0A A;  1SJI A;  1G6W A;  6GSS A;  3HD5 A;  3N5O A;  3RPN A;  4I97 A;  1K3Y A;  3A3T A;  3W8J A;  5DCH A;  4IJ3 A;  4XTS A;  2B5X A;  5B8B A;  1GL8 A;  3CRU A;  9GSS A;  3A2X A;  3ZL5 A;  3FR6 A;  4YQM A;  3LFL A;  4KCE A;  1VF2 A;  3M0F A;  1R5P A;  2XBQ A;  1ZZY A;  3CRT A;  1WWJ A;  3BBY A;  4MF7 A;  4FYU A;  3TKS E;  12GS A;  4FIW A;  3ZIJ A;  2HRK A;  4ZIL A;  4PUR A;  3M9J A;  2CVB A;  3ZFL A;  3GRX A;  4K0N A;  4O92 A;  4GF0 A;  1O8W A;  3FZ9 A;  1JHB A;  3ISO A;  4NXI A;  3UOM A;  3GMF A;  4V2N A;  1X9M B;  3KMN A;  2YZH A;  1THO A;  4WF4 A;  2PVO C;  5DAK A;  1E6B A;  1TRW A;  1ERW A;  4HZ2 A;  3SBC A;  3EE2 A;  1AXD A;  4QQ7 A;  3ZRD A;  4K1F A;  2M46 A;  1WIK A;  1T3B A;  4MK3 A;  2YWM A;  2OE1 A;  3D4T A;  1B4P A;  4USS A;  4YAP A;  3OR5 A;  1Z7R A;  2TRX A;  3RHB A;  4OCE A;  2HRK B;  3VWX A;  4AJ7 A;  4IN0 A;  1YEX A;  1TW9 A;  5HQP A;  5GST A;  4KGI A;  1QUW A;  2HSH A;  1I9D A;  4K7I A;  4ZB9 A;  2LKU A;  3HKR A;  4HDE A;  1SK1 A;  2OBK A;  2H66 A;  3U5R E;  4F82 A;  3UL3 A;  2CZ2 A;  1RK4 A;  1PD2 1;  4MJE A;  2X8C A;  5GSS A;  2JU5 A;  1GTI A;  1B4Q A;  2FWG A;  3I69 A;  2MMO A;  1OYJ A;  3DD3 A;  4TOP A;  4POK A;  2QC7 A;  3APQ A;  3TJB A;  1A0F A;  2ON7 A;  2YAN A;  3D4M A;  3QFB C;  2KLX A;  4N30 A;  5IPH A;  4EDZ A;  3C73 A;  3WGE A;  4HZ4 A;  3KP9 A;  1XPV A;  4MJB A;  2D2Z A;  3KIJ A;  4MA9 A;  3UVH A;  4OFN A;  5JCW A;  2MMZ A;  3UMA A;  4WKW A;  2MBS A;  1AW9 A;  1SYX A;  1GUM A;  5GZZ B;  3TKQ A;  5EY6 A;  4RUV A;  3WD6 A;  1UVZ A;  4P3Y B;  2MMN A;  3F63 A;  1ERT A;  4L5O A;  3E3E A;  2XHF A;  2JSY A;  2H01 A;  1GTU A;  5G2Z A;  4POM A;  4Z7X A;  3ZYW A;  1Z6M A;  3ZML A;  4KDX A;  3GH9 A;  3F8U A;  4F03 A;  2DLX A;  1J9B A;  1A2L A;  4EXJ A;  3JCM L;  4BVY A;  3RPP A;  1GRX A;  3GN3 A;  3VWV A;  2L59 A;  2R3X A;  3CSH A;  1B48 A;  3DYR A;  7GSS A;  2L4Q A;  1TI1 A;  4L8E A;  1HNA A;  1XZO A;  2H72 A;  2L4C A;  1GLQ A;  1EV4 A;  2GZY A;  4EDY A;  1BAY A;  3FYG A;  5F07 A;  5DQS A;  1TK8 B;  1N8J A;  5ECK B;  2HZE A;  2ZCT A;  1A2J A;  3G7I A;  3HVS A;  5ECH B;  5ECR B;  2VL3 A;  5J5N A;  2F51 A;  1Z9H A;  2MYG A;  1QK8 A;  3DIE A;  2KUC A;  3TKR A;  5ECP B;  2K18 A;  5B6M A;  5IOW A;  2CAI A;  2H0G A;  4KCA A;  18GS A;  4MH2 A;  3F6F A;  2PMT A;  5G5E A;  5F8B A;  1Q4J A;  2X64 A;  2JAD A;  3DVX A;  1XCC A;  1TU8 A;  3CSI A;  1X5C A;  4BVX A;  1FOV A;  1OC9 A;  1XOA A;  3GYK A;  1G7E A;  5ID2 B;  4KE3 A;  4GXZ A;  2HZE B;  5GAP D;  3QFA C;  1OVN A;  1ZMA A;  1M2A A;  3H8Q A;  4WBR D;  11GS A;  4HJM A;  4TR1 A;  2IWT A;  1TOF A;  1X0R A;  2HI7 A;  4GQC A;  2H1G A;  2P5Q A;  3HDC A;  2F8F A;  1XOB A;  4XS4 A;  3L4N A;  2C8U A;  4HQZ A;  3KD0 A;  2CVD A;  4LL1 B;  3IE3 A;  4ZIJ A;  1CQG A;  2H19 A;  4IW9 A;  4WXT A;  2AAW A;  3F9U A;  4DVC A;  3ME8 A;  4EKZ A;  1M9A A;  1R4W A;  3APS A;  2H1A A;  2F8A A;  4BWQ A;  1AIU A;  3IC4 A;  1GSD A;  1GTA A;  3TJG A;  3O76 A;  4TR1 B;  1A8L A;  2AUV A;  1EV9 A;  4GQF A;  5F05 A;  1SEN A;  2VCW A;  4K9Z A;  4X1U A;  3C7M A;  1V40 A;  2IFQ A;  3GTU B;  2VCT A;  2OA7 A;  2O8V B;  3FK8 A;  5G5F A;  6GSX A;  4XS4 B;  2WJU A;  1O81 A;  1Z7P A;  5J9C A;  2M72 A;  1NM3 A;  1FHE A;  2A2S A;  5CO3 A;  2OKA A;  2H1D A;  4HQS A;  2RII A;  4XRD A;  3TGZ A;  1TKD B;  2V32 A;  1UC7 A;  2GZP A;  5ECM B;  2FGX A;  3ZIV A;  2QSI A;  4F2I A;  4MH3 A;  2VCZ A;  2LS5 A;  4KB3 A;  2CX4 A;  5CP1 A;  1I5G A;  3ZMK A;  3TJJ A;  4G0K A;  3VI7 A;  2IFQ B;  4EVM A;  1PGT A;  3GKK A;  3KM6 A;  4YQU A;  3GX0 A;  2VUP A;  5COH A;  2OE3 A;  2VD0 A;  2H73 A;  4LMW A;  2C0G A;  1O6J A;  3DRN A;  2O87 A;  3KXO A;  3UAR A;  3L0H A;  4RI7 A;  1GNW A;  2VLU A;  1K0D A;  4YAV A;  1PX7 A;  2KOK A;  4KSM A;  1XIY A;  5CYY A;  2FUG 2;  3TOT A;  4NV5 A;  1MTC A;  2GQL A;  5CRG A;  2GT5 A;  4XHM A;  3ZVJ A;  1Q98 A;  2CA8 A;  2KHP A;  4TKY A;  5AIV A;  1KEB A;  1SD9 A;  5GAN D;  4POL A;  1Z3E A;  1HD2 A;  1NSW A;  3SWL A;  2J23 A;  3GKN A;  5HFI A;  2IJY A;  5KN3 A;  5ABR A;  2GDR A;  1ERU A;  3EUR A;  2R5G A;  5EL8 A;  5A5K A;  2CX3 A;  2I3Y A;  1DUG A;  4ZB6 A;  2C3Q A;  2KP2 A;  2C0F A;  3RHC A;  2I4A A;  1U87 A;  3LYP A;  3FR9 A;  4PGT A;  1Z5Y E;  1GUK A;  3FW2 A;  1BED A;  5H5R A;  1BYE A;  3IV4 A;  2HE3 A;  1H4O A;  3GH6 A;  2FA8 A;  4LMV A;  2BMX A;  3KJY A;  2GGT A;  2E7P A;  3P7X A;  4V2M A;  1WOU A;  2TIR A;  5ECI B;  4I2T A;  5KN0 A;  3ERG A;  2LRC A;  4ISD A;  4NMU A;  4TR3 A;  3WT1 A;  3N9J A;  3TUE A;  4EF0 A;  1KNG A;  2A2R A;  4HOJ A;  4TXO A;  1T1V A;  3ED3 A;  4N0Z A;  4NV2 A;  4I2U A;  2H74 A;  3FEU A;  4TR4 A;  2DIZ A;  2KP1 A;  4CDO A;  5JWR B;  3GHA A;  5C04 A;  1XFL A;  1WE0 A;  1SL2 B;  2M80 A;  5FHI A;  2WCI A;  1GSF A;  2IME A;  1DE2 A;  1LBK A;  5IMV A;  1TI3 A;  3IHQ A;  5CAX A;  2WDU A;  1TRV A;  5C00 A;  2WZ9 A;  3VPQ A;  3W6G A;  2YV7 A;  1IYI A;  2IPA A;  2B3S A;  3E0U A;  1GSQ A;  2B7J A;  5IO2 A;  2VLT A;  2H6Y A;  2ZNM A;  4N0V A;  1SKW B;  1T8E B;  3IXR A;  4IP1 A;  2C0E A;  2CVK A;  3KH7 A;  1IYH A;  4KND A;  1F9M A;  1V58 A;  3CTF A;  1FW1 A;  2HSM B;  1SKS B;  1PKW A;  2AV4 A;  3QMX A;  2R6K A;  3C8E A;  2VL2 A;  4MZW A;  4ML6 A;  2ZUP A;  1TK0 B;  1RQM A;  4MF5 A;  4D73 B;  4WR5 A;  4PTS A;  5CRW A;  5DJM A;  2P31 A;  5JWQ B;  3TB2 A;  1G7O A;  2XPE A;  2L6D A;  2V2G A;  4MLY A;  4Q5Q A;  2H8L A;  3M8N A;  4I5Q A;  1T4Y A;  2FHE A;  1ST9 A;  3GIX A;  4HU7 A;  5J3R A;  5IOX A;  1BG5 A;  3F4T A;  1BJX A;  4PUA A;  2RLI A;  1NHY A;  1FVJ A;  2XPD A;  2RUE A;  4AJ8 A;  4Q5N A;  1CQH A;  1HYU A;  2VIM A;  3IBH A;  1TTZ A;  3IPZ A;  4JED A;  1DBY A;  1GUL A;  4G0I A;  1QQ2 A;  2A4V A;  5HFG A;  2DC5 A;  1YQ1 A;  2N5A A;  4MZC A;  16GS A;  3BCK A;  1FB6 A;  2QKE A;  3FZA A;  5DQY A;  2IMD A;  1URM A;  1EOG A;  3VI5 A;  1XWB A;  1U3I A;  3MAK A;  1O73 A;  2DIY A;  5KN1 A;  3CMI A;  5D73 A;  5DAK B;  2IN3 A;  3F4S A;  3QD9 A;  2X8H A;  5B6N A;  1PSQ A;  2BJX A;  4PX1 A;  1EWX A;  2C4J A;  3EMP A;  3IAM 2;  1FB0 A;  4KA0 A;  4MCU A;  3F6D A;  2DSA A;  4PXO A;  5CRE A;  2K8S A;  3FY7 A;  3FZ4 A;  3EU4 A;  3HZ4 A;  2NTO A;  4PNF A;  4KAE A;  6GSW A;  2YJ7 A;  3HYP A;  2JZS A;  1ABA A;  5DCG A;  5B8A A;  4XS1 A;  4I6X A;  1V98 A;  4POB A;  4X43 A;  4EE0 A;  1SK0 A;  2HZF A;  4BL7 A;  5BMU A;  1MD3 A;  4O7H A;  6GSU A;  5AGY A;  3Q74 A;  4X0X A;  5A4U A;  3DKS A;  3ZTL A;  2OAC A;  5HFK A;  4GCI A;  4MF6 A;  2LV3 A;  1BQ7 A;  5A4W A;  2X99 A;  5LD0 A;  2LQO A;  3MWH A;  2IIY A;  1V57 A;  3L9V A;  4ML1 A;  1G6Y A;  4Q5R A;  3EMX A;  3GST A;  2YOI A;  4MJA A;  3ZVJ D;  2YJH A;  3UVT A;  2DJ2 A;  1OC8 A;  5LCZ A;  5G1K A;  2K9F A;  4XIH A;  3TOU A;  5IIZ A;  4K7N A;  3FRC A;  3DXB A;  3TRQ A;  17GS A;  5ECL B;  5ECO B;  2H1B A;  1THX A;  2VM1 A;  1HNC A;  2C3N A;  5EVO A;  2EC4 A;  4BL7 B;  1ZCP A;  5IPG A;  3F4R A;  4ACS A;  4NPB A;  2UZ8 A;  2L5L A;  1OC3 A;  1W89 A;  3QCP A;  1J08 A;  2PVQ A;  4L5L A;  5E59 A;  1MDK A;  3ERW A;  2CT6 A;  3RAZ A;  1JFU A;  5LNK e;  4BVY B;  3GKM A;  3PH9 A;  2VCV A;  1OKT A;  2EIR A;  2YNX A;  2GZZ A;  1O7U A;  3LG6 A;  1DSB A;  4MMM A;  5JWO B;  1JZR A;  3LGC A;  4KUN A;  1GSU A;  1K0C A;  1UA5 A;  2GSS A;  4E8H A;  4LA1 A;  5CRD A;  3ZZX A;  4O5R A;  4HI7 A;  2VCX A;  5HR0 A;  3TKP A;  3L9S A;  4N10 A;  2VO4 A;  4AJ6 A;  1XWA A;  4WET A;  4PQI A;  4TN8 A;  2H30 A;  2RUF A;  1ML6 A;  3IK9 A;  3ERF A;  13GS A;  1GLP A;  3Q6O A;  4G19 A;  3D0Z A;  4BA7 A;  10GS A;  1VRS D;  2IMK A;  1GTB A;  2LRN A;  3EIN A;  2IL3 A;  2E2G A;  3QPM A;  3CYN A;  3M3M A;  3EU3 A;  4CW9 A;  1X5E A;  3Q19 A;  3HJP A;  3I43 A;  3US3 A;  3LWA A;  4KDU A;  4CHS A;  1TU7 A;  3GUS A;  4BVX B;  1OC9 B;  4ZB8 A;  3HVV A;  1YF0 A;  2B7K A;  2GST A;  1KBN A;  1B9X C;  3GKX A;  4DSR A;  4OFT A;  1VF4 A;  1MD4 A;  2Z9S A;  3KEB A;  4RQX A;  3VFI A;  4YH2 A;  2EIO A;  2NBS A;  2ON5 A;  2HT9 A;  3F0I A;  5D8I A;  3DWV A;  4GLT A;  2FD3 A;  2HXK A;  4IGJ A;  1K0B A;  1VF3 A;  3H93 A;  3TKS A;  5D9V A;  4IEL A;  3C1R A;  3TJF A;  4DSS A;  2AJQ B;  2YCD A;  3CBU A;  1FVK A;  1EZK A;  3IRA A;  3AY8 A;  2HLS A;  2LNS A;  5KEJ A;  1ZL9 A;  2GSQ A;  2HNL A;  4YQV A;  1VGL A;  4EL1 A;  1JZO A;  2VM2 A;  3GL3 A;  4PQ1 A;  4IQ1 A;  1AQW A;  5ECS A;  2AB6 A;  3TJK A;  2H75 A;  2R37 A;  5HR1 A;  3BJ5 A;  2OAD A;  2MZC A;  3DML A;  1YJ6 A;  3WT2 A;  1B8X A;  1F37 A;  3D6I A;  3CSJ A;  1GSE A;  5IMC A;  2HRF A;  3DGQ A;  5H5S A;  1TRS A;  2B5E A;  1XW6 A;  4GWR A;  1ON4 A;  4KDY A;  3W8S A;  3I6A A;  2G2Q A;  3NZN A;  2CV4 A;  4V1A p;  3VK9 A;  14GS A;  2N5F A;  3VPT A;  2F3M A;  4WBJ A;  4DSS B;  2NDO A;  4OD7 A;  4QL7 A;  3D5J A;  1AQV A;  1T00 A;  3VWU A;  5G31 A;  4TR0 A;  3H79 A;  22GS A;  1A2M A;  2C0D A;  4PUF C;  3KTL A;  2VL9 A;  2LRT A;  4MDC A;  1XWK A;  2F9S A;  3GV1 A;  1G0T A;  1A8Y A;  1S3C A;  4J56 E;  5H5Q A;  2H0H A;  4L0U A;  1WJK A;  3KH9 A;  3UIW A;  3J7Y b;  2DJK A;  3M9K A;  1XW5 A;  3VLN A;  3EYT A;  2JZT A;  2B1L A;  1USB A;  2GSR A;  3HHV A;  1PMT A;  1EEM A;  1YDK A;  2I81 A;  1FAA A;  3MSZ A;  4JBB A;  3P2A A;  1R26 A;  2PWJ A;  2YWN A;  1YEP A;  2P0G A;  3IAS 2;  3LQ7 A;  1F3A A;  2PGT A;  1E2Y A;  1MDJ A;  3TRX A;  4K0G A;  1A24 A;  2C80 A;  1XWC A;  3A2W A;  2V6O A;  2O85 A;  3A5W A;  1OE7 A;  2LST A;  1LJR A;  3HJO A;  6GSY A;  5INY A;  3P90 A;  3IC8 A;  4DEJ A;  5J4U A;  3GFK A;  4Q5F A;  2FA4 A;  1R7H A;  4ZBD A;  2YN1 A;  4EUY A;  1N2A A;  1Y6E A;  1ILO A;  3PPU A;  3S9F A;  1W4V A;  1B9Y C;  3KMO A;  3PR8 A;  4ZBB A;  1WPI A;  2REM A;  5B7C A;  4FYB A;  2I1U A;  2VD1 A;  2GVP A;  5J41 A;  3H1N A;  2VLV A;  2YZU A;  1QFN A;  2JAC A;  1K3L A;  2JZR A;  2MBT A;  4ECJ A;  2J9H A;  3VUR A;  1PQN A;  3ZRE A;  3KTB A;  3BD2 A;  4N11 A;  1KTE A;  4MAB A;  1WMJ A;  1GUH A;  3L78 A;  4G2E A;  4TXO B;  1F6M C;  3GA4 A;  2L5O A;  4OMV A;  2FWE A;  3P8W A;  1QMV A;  4XCS A;  4JZQ A;  1M9B A;  4LLR A;  3GNJ A;  2H6X A;  2E0Q A;  4EC0 A;  4J2F A;  4G10 A;  2C3T A;  3J7Y k;  4IKH A;  20GS A;  3RDW A;  3D22 A;  5AIS A;  4FYC A;  1EGR A;  3VWW A;  1SJ6 A;  2GQM A;  3LSZ A;  1PRX A;  2PUK C;  1V2A A;  4V2L A;  3QR6 A;  4OO4 A;  4WEY A;  2XC2 A;  3HZ8 A;  1S3A A;  2GQK A;  2LTK A;  4HS1 A;  2FCH A;  4KH7 A;  3UBL A;  3TCO A;  2CQ9 A;  4OCF A;  2O89 A;  3M1G A;  1XW9 A;  1GWC A;  4BPY A;  1PA3 A;  1FG4 A;  1FO5 A;  3CXG A;  2N5B A;  1EGO A;  1VF1 A;  3G9B A;  1XVW A;  4MP4 A;  2O7K A;  3LEF A;  2HYX A;  4ECC A;  4RI6 A;  2ALB A;  3DEX A;  1YY7 A;  4GST A;  4HU9 A;  1SL1 B;  4IQA A;  3MDK A;  1AQX A;  1Y25 A;  1GNE A;  4PNG A;  2WUL A;  2LUS A;  4GRF A;  3ME7 A;  3LYK A;  4IHU A;  2RM6 A;  1K0M A;  1PX6 A;  5EPF A;  1C72 A;  3F3Q A;  4L0W A;  2VAF A;  2B1K A;  4JR4 A;  3GSS A;  3LXZ A;  4K7O A;  3UBK A;  3GL5 A;  3UEM A;  4GTU A;  5DAL A;  4IJI A;  3KP8 A;  3V1W A;  2GLR A;  3HA9 A;  1X5D A;  4G0L A;  3QAW A;  3GUR A;  3UJ1 A;  2LJA A;  3IDV A;  2JL4 A;  2LQQ A;  4XRA A;  1TXX A;  3EVI A;  5IO0 A;  1M0U A;  2QGV A;  5F06 A;  2LJK A;  3HY2 A;  4LL4 B;  1YKC A;  5IMF A;  3R2Q A;  4ZBA A;  3NIV A;  2DMM A;  5ECQ B;  8GSS A;  2B5Y A;  1OE8 A;  1YZX A;  2H71 A;  3QDN A;  4AF2 A;  4WF5 A;  1QGV A;  5DAL B;  2WGR A;  2DJ0 A;  2H0I A;  3KZQ A;  2AYT A;  2XBI A;  4JE1 A;  3ZFB A;  2LEG A;  2VL2 C;  4ULX A;  5AN1 A;  2R4V A;  2PU9 C;  2YWO A;  5KN2 A;  5L71 A;  4QL9 A;  3APO A;  1EP8 A;  2EIQ A;  2HQT A;  1RW1 A;  2H70 A;  2YWI A;  2G0F A;  4G9H A;  5F0G A;  4IVF A;  1K0N A;  4F9Z A;  5ID2 A;  3LXT A;  2DBC A;  1JLV A;  4NHZ A;  2GS3 A;  2MMA A;  1WRY A;  3CTG A;  1JLW A;  3PGT A;  1PL2 A;  1MEK A;  4NAX A;  1XVQ A;  3GX8 A;  2NVL A;  3UAP A;  2P5R A;  5JCU A;  1K3O A;  2OBI A;  1GP1 A;  3BCI A;  4EO3 A;  3PIN A;  4I8B A;  3FR3 A;  1EOH A;  1NW2 A;  4ECB A;  3BOA A;  1YF1 A;  4ZL9 A;  1R5A A;  1NHO A;  1K0O A;  3QAG A;  1U6T A;  5CNW A;  3FKF A;  2FY6 A;  1ERV A;  2FNO A;  3HVX A;  3HXS A;  1EP7 A;  2LNT A;  4IS0 A;  4IP6 A;  3LOR A;  3F3R A;  4MJC A;  1SKR B;  1QXH A;  4K2D A;  1SJZ A;  2CZ3 A;  2V41 A;  4ZL7 A;  1ZGN A;  3U6V A;  4MZB A;  4J57 E;  1HNB A;  3G7J A;  5IQY A;  1TRU A;  2FWF A;  1SU9 A;  4TVE A;  1PKZ A;  1T7P B;  4E8E A;  3GTU A;  2OJL A;  2VCQ A;  2WS2 A;  4OO5 A;  1TK5 B;  5ENU A;  2HRA A;  2WFC A;  4XS6 A;  2LJR A;  4FO5 A;  3IK7 A;  3HCZ A;  1HQO A;  5HR2 A;  4KW6 A;  4O32 A;  1AUC A;  2E2M A;  3ZIT A;  4DSQ A;  6GST A;  4BWS A;  3TDG A;  5D9T A;  4HUA A;  1EEJ A;  1TJD A;  1BX9 A;  5DVB A;  1YKA A;  3WGD A;  3MNG A;  2HSY A;  4TW5 A;  4ECI A;  4GSS A;  4FQU A;  3LJR A;  4MPF A;  1TP9 A;  4HEA 2;  1ACV A;  4PQH A;  5ELG A;  2K6V A;  5HR3 A;  1GSS A;  2JSZ A;  2YP6 A;  3WYW A;  1GSY A;  3FZ5 A;  2RM5 A;  2PBJ A;  1AAZ A;  1XXU A;  3IA1 A;  1PL1 A;  3QOU A;  5DJL A;  1H75 A;  4ZL8 A;  2HSN B;  3KCM A;  3R3E A;  1AC1 A;  1M2D A;  1U3A A;  1SD8 A;  3HJM A;  2V6K A;  2NPB A;  2WB9 A;  4ID0 A;  1F3B A;  4NHW A;  2H76 A;  2HFD A;  5E4W A;  1XBS A;  4JR6 A;  4HJ2 A;  4KX4 A;  1T4Z A;  3G7Y A;  3NOF A;  2WRT A;  1O8X A;  1M7T A;  4ILF A;  1PN9 A;  5IM9 A;  5ECN B;  4F0C A;  4JRR A;  5G1L A;  2VOC A;  1OKD A;  1M2B A;  2DJ3 A;  2IMI A;  5FWG A;  3C71 A;  2B6M A;  6GSV A;  5AIX A;  1DE1 A;  3O3T A;  2FWH A;  5CRH A;  1MDI A;  4KSO A;  4MPG A;  2YPM A;  1ZYQ B;  2GT6 A;  5IMZ A;  4NWY A;  5D9X A;  1A0R P;  1V9W A;  2C1Y A;  1F2E A;  2K8V A;  3EC3 A;  3I9V 2;  1A23 A;  5IMD A;  3WGX A;  1GH2 A;  4TXV A;  2PN8 A;  3IOS A;  4TRX A;  4WR4 A;  4K6X A;  5JCG A;  2IMF A;  2I9H A;  5FT3 A;  1JZW A;  2H6Z A;  3EWL A;  4RQR A;  1U88 A;  3TRP A;  4IBP A;  5D93 A;  1ZOF A;  3E9J B;  3L9U A;  1SK2 A;  5DDL A;  1TDI A;  2L57 A;  3D21 A;  5A4V A;  3RBT A;  3ZLP A;  2AHE A;  3FHK A;  4KF9 A;  1X9S B;  2FLS A;  2ES7 A;  2GTU A;  4V1A g; 
#chains in the Genus database with same CATH topology
 4OFM A;  1Z6N A;  4GSN A;  1XWG A;  1X9W B;  2YV9 A;  2TRC P;  4ZXG A;  2X8G A;  5G30 A;  4AGS A;  4EIQ A;  1SL0 B;  2BTO T;  5D9W A;  2R2J A;  3KGK A;  1UN2 A;  4O5Q A;  4FH8 A;  1O85 A;  5DBQ A;  2CAQ A;  4H86 A;  1SYR A;  5ELA A;  2DJJ A;  1LU4 A;  1JZD A;  1J0F A;  1ZYE A;  2L6C A;  3Q18 A;  3C1S A;  3QAV A;  4K8M A;  1WP0 A;  3IR4 A;  3H4K A;  4F0B A;  3O6T A;  3TKS C;  2PER A;  3DVW A;  2HSM A;  5J9B A;  4JU5 A;  2PPT A;  3A2V A;  2HRN A;  5IMA A;  1S3D A;  1OAZ A;  2DML A;  2OE0 A;  4YKF A;  2WVX A;  2DJ1 A;  19GS A;  4D73 A;  4QMK A;  4OWY A;  2V1M A;  4EIP A;  3K8N A;  5D96 A;  1M99 A;  1K0A A;  1SJI A;  1S3R A;  1G6W A;  6GSS A;  3HD5 A;  2WW2 A;  3N5O A;  3RPN A;  4I97 A;  2A4H A;  1K3Y A;  3A3T A;  3W8J A;  5DCH A;  4IJ3 A;  4XTS A;  2B5X A;  5B8B A;  1GL8 A;  3CRU A;  9GSS A;  3A2X A;  3ZL5 A;  3FR6 A;  4YQM A;  3LFL A;  1BG1 A;  4KCE A;  1VF2 A;  3M0F A;  1R5P A;  2XBQ A;  1ZZY A;  3CRT A;  4YKG A;  1WWJ A;  3BBY A;  4MF7 A;  4FYU A;  3TKS E;  12GS A;  4FIW A;  3ZIJ A;  2HRK A;  4ZIL A;  4PUR A;  3M9J A;  2CVB A;  3ZFL A;  3GRX A;  4K0N A;  4O92 A;  4GF0 A;  1O8W A;  4Z2U A;  3FZ9 A;  1JHB A;  3ISO A;  4NXI A;  5BRT A;  1BF5 A;  3GMF A;  3UOM A;  4V2N A;  1X9M B;  3KMN A;  2YZH A;  1THO A;  4WF4 A;  2PVO C;  5DAK A;  1E6B A;  1TRW A;  1ERW A;  3IHG A;  4HZ2 A;  3SBC A;  3EE2 A;  1AXD A;  4QQ7 A;  3ZRD A;  4K1F A;  2M46 A;  1WIK A;  1T3B A;  4MK3 A;  2YWM A;  2OE1 A;  3D4T A;  1B4P A;  4USS A;  4YAP A;  3OR5 A;  1Z7R A;  2WW3 A;  2TRX A;  3RHB A;  4OCE A;  2HRK B;  3VWX A;  4AJ7 A;  4IN0 A;  1YEX A;  1TW9 A;  5HQP A;  5GST A;  4KGI A;  1QUW A;  2HSH A;  1I9D A;  4K7I A;  4ZB9 A;  2LKU A;  2EFD A;  3HKR A;  4HDE A;  1SK1 A;  2OBK A;  2H66 A;  3U5R E;  4F82 A;  3UL3 A;  2CZ2 A;  1RK4 A;  1PD2 1;  4MJE A;  2X8C A;  5GSS A;  2JU5 A;  1GTI A;  1B4Q A;  2FWG A;  3I69 A;  4ZB7 A;  2MMO A;  1OYJ A;  3DD3 A;  4TOP A;  4POK A;  2QC7 A;  3APQ A;  3TJB A;  1A0F A;  2ON7 A;  4PI2 C;  4ICY A;  2YAN A;  3D4M A;  3QFB C;  2KLX A;  4N30 A;  5IPH A;  4EDZ A;  3C73 A;  3WGE A;  4HZ4 A;  5J4Y A;  3KP9 A;  1XPV A;  4MJB A;  2D2Z A;  3KIJ A;  4MA9 A;  3UVH A;  4OFN A;  5JCW A;  2MMZ A;  3UMA A;  4WKW A;  2MBS A;  1AW9 A;  1SYX A;  1GUM A;  5GZZ B;  2EFE A;  4Z2R A;  3TKQ A;  5EY6 A;  4RUV A;  3WD6 A;  1UVZ A;  4W66 A;  4P3Y B;  2MMN A;  3F63 A;  1ERT A;  4L5O A;  3E3E A;  2XHF A;  2JSY A;  2H01 A;  1GTU A;  5G2Z A;  4POM A;  4Z7X A;  3ZYW A;  1Z6M A;  3ZML A;  4KDX A;  3GH9 A;  3F8U A;  4F03 A;  2DLX A;  1J9B A;  1A2L A;  4EXJ A;  3JCM L;  4BVY A;  3RPP A;  1GRX A;  3GN3 A;  3VWV A;  2L59 A;  5KOX A;  2R3X A;  3CSH A;  1B48 A;  3DYR A;  7GSS A;  2L4Q A;  1TI1 A;  4L8E A;  1HNA A;  1XZO A;  2H72 A;  2L4C A;  1GLQ A;  3LW9 A;  1EV4 A;  2GZY A;  4EDY A;  1BAY A;  3FYG A;  5F07 A;  5DQS A;  1TK8 B;  1N8J A;  5ECK B;  2HZE A;  1N25 A;  2ZCT A;  1YVL A;  1A2J A;  3G7I A;  3HVS A;  5ECH B;  5ECR B;  2VL3 A;  5J5N A;  2F51 A;  1Z9H A;  2MYG A;  1QK8 A;  3DIE A;  2KUC A;  3TKR A;  5ECP B;  2K18 A;  5B6M A;  5IOW A;  2CAI A;  2H0G A;  4KCA A;  18GS A;  4MH2 A;  3F6F A;  2PMT A;  5G5E A;  5F8B A;  1Q4J A;  2EFC A;  2X64 A;  2JAD A;  3DVX A;  1XCC A;  1TU8 A;  3CSI A;  1X5C A;  4BVX A;  1FOV A;  3EPT A;  1OC9 A;  1XOA A;  3GYK A;  1G7E A;  5ID2 B;  4KE3 A;  4GXZ A;  2HZE B;  5GAP D;  3QFA C;  1PFO A;  1OVN A;  1ZMA A;  1M2A A;  3H8Q A;  5KOW A;  4WBR D;  11GS A;  4HJM A;  4TR1 A;  2IWT A;  1TOF A;  1X0R A;  2HI7 A;  4GQC A;  2H1G A;  2P5Q A;  3HDC A;  2F8F A;  1XOB A;  4XS4 A;  3L4N A;  2C8U A;  4HQZ A;  3KD0 A;  2CVD A;  4LL1 B;  3IE3 A;  4ZIJ A;  2WW1 A;  1CQG A;  2H19 A;  4IW9 A;  4WXT A;  2AAW A;  3F9U A;  4DVC A;  3ME8 A;  4EKZ A;  5J47 A;  1M9A A;  4GDF A;  1R4W A;  3APS A;  2H1A A;  2F8A A;  4BWQ A;  1AIU A;  3IC4 A;  1GSD A;  1GTA A;  3TJG A;  3O76 A;  5A1N A;  4A5P A;  4TR1 B;  1A8L A;  2AUV A;  1EV9 A;  4GQF A;  5F05 A;  1SEN A;  1YEW C;  2VCW A;  4K9Z A;  4X1U A;  3C7M A;  1V40 A;  2IFQ A;  3GTU B;  2VCT A;  2OA7 A;  2O8V B;  3FK8 A;  5G5F A;  6GSX A;  4XS4 B;  2WJU A;  1O81 A;  1Z7P A;  2DKH A;  5J9C A;  2M72 A;  1NM3 A;  1FHE A;  2A2S A;  5CO3 A;  2OKA A;  2H1D A;  4HQS A;  2RII A;  4XRD A;  3TGZ A;  4PHZ C;  1TKD B;  2V32 A;  1UC7 A;  2GZP A;  5ECM B;  2FGX A;  3ZIV A;  2QSI A;  4F2I A;  4MH3 A;  2VCZ A;  2LS5 A;  4KB3 A;  2CX4 A;  5CP1 A;  1I5G A;  5A1N B;  3ZMK A;  3TJJ A;  4G0K A;  2EFH A;  3VI7 A;  2IFQ B;  4EVM A;  1PGT A;  3GKK A;  3KM6 A;  4YQU A;  3GX0 A;  2VUP A;  5COH A;  2OE3 A;  2VD0 A;  2H73 A;  4LMW A;  2C0G A;  1O6J A;  3DRN A;  2O87 A;  3KXO A;  3UAR A;  3L0H A;  4RI7 A;  1GNW A;  2VLU A;  1K0D A;  4YAV A;  1PX7 A;  2KOK A;  4KSM A;  1XIY A;  5CYY A;  2FUG 2;  3TOT A;  4NV5 A;  1MTC A;  2GQL A;  5CRG A;  2GT5 A;  4XHM A;  3ZVJ A;  1Q98 A;  2CA8 A;  2KHP A;  4TKY A;  5AIV A;  1KEB A;  1SD9 A;  5GAN D;  4POL A;  1Z3E A;  1HD2 A;  1NSW A;  3SWL A;  2J23 A;  3GKN A;  5HFI A;  2IJY A;  5KN3 A;  5ABR A;  2GDR A;  1ERU A;  3EUR A;  2R5G A;  5EL8 A;  5A5K A;  2CX3 A;  2I3Y A;  1DUG A;  4ZB6 A;  2C3Q A;  2KP2 A;  2C0F A;  3RHC A;  2I4A A;  1TXU A;  1U87 A;  3LYP A;  3FR9 A;  4PGT A;  1Z5Y E;  1GUK A;  3FW2 A;  1BED A;  5H5R A;  1BYE A;  3IV4 A;  2HE3 A;  1H4O A;  3GH6 A;  2FA8 A;  4LMV A;  2BMX A;  3KJY A;  2GGT A;  2E7P A;  3P7X A;  4V2M A;  3RGB C;  1WOU A;  2TIR A;  5ECI B;  4I2T A;  5KN0 A;  3ERG A;  2LRC A;  4ISD A;  4NMU A;  4TR3 A;  4K5S A;  3WT1 A;  3N9J A;  3TUE A;  4EF0 A;  1KNG A;  2A2R A;  4HOJ A;  4TXO A;  1T1V A;  3ED3 A;  4N0Z A;  4AI6 A;  4NV2 A;  2R0P A;  4I2U A;  2H74 A;  3FEU A;  4TR4 A;  2DIZ A;  2KP1 A;  4CDO A;  5JWR B;  2WVY A;  3GHA A;  5C04 A;  1XFL A;  1FOH A;  1WE0 A;  1SL2 B;  2M80 A;  5FHI A;  2WCI A;  1GSF A;  2IME A;  1DE2 A;  1LBK A;  5IMV A;  1TI3 A;  3IHQ A;  5CAX A;  2WDU A;  1TRV A;  4X4J A;  5C00 A;  2WZ9 A;  3VPQ A;  3W6G A;  2YV7 A;  1IYI A;  2IPA A;  2B3S A;  3E0U A;  1GSQ A;  4G01 A;  2B7J A;  5IO2 A;  2VLT A;  3TU3 B;  2H6Y A;  2ZNM A;  4N0V A;  1SKW B;  1T8E B;  3IXR A;  4IP1 A;  2C0E A;  2CVK A;  3KH7 A;  1IYH A;  4KND A;  1F9M A;  5A34 A;  1V58 A;  3CTF A;  1FW1 A;  2HSM B;  1SKS B;  1PKW A;  2AV4 A;  3QMX A;  2R6K A;  3C8E A;  2VL2 A;  4MZW A;  4ML6 A;  2ZUP A;  1TK0 B;  1RQM A;  4MF5 A;  2WVX B;  4D73 B;  4WR5 A;  4PTS A;  1M3J A;  5CRW A;  5DJM A;  2P31 A;  5JWQ B;  3TB2 A;  1G7O A;  2XPE A;  2L6D A;  2V2G A;  4MLY A;  4Q5Q A;  2H8L A;  3M8N A;  4I5Q A;  1T4Y A;  2FHE A;  1ST9 A;  3GIX A;  4HU7 A;  5J3R A;  5IOX A;  1BG5 A;  3F4T A;  1BJX A;  4PUA A;  2RLI A;  1NHY A;  1FVJ A;  2XPD A;  2RUE A;  4AJ8 A;  4Q5N A;  1CQH A;  1HYU A;  2VIM A;  3IBH A;  1TTZ A;  3IPZ A;  4JED A;  1DBY A;  1GUL A;  4G0I A;  1QQ2 A;  2A4V A;  5HFG A;  2DC5 A;  1YQ1 A;  2N5A A;  4MZC A;  16GS A;  3BCK A;  1FB6 A;  2QKE A;  3FZA A;  5DQY A;  2IMD A;  1URM A;  1EOG A;  3VI5 A;  1XWB A;  1U3I A;  3MAK A;  1O73 A;  2DIY A;  5KN1 A;  3CMI A;  5D73 A;  5DAK B;  2IN3 A;  3F4S A;  3QD9 A;  2X8H A;  5B6N A;  1PSQ A;  2BJX A;  4PX1 A;  1EWX A;  2C4J A;  3EMP A;  3IAM 2;  1FB0 A;  4KA0 A;  4MCU A;  3F6D A;  2DSA A;  4PXO A;  5CRE A;  2K8S A;  4MNN A;  3FY7 A;  3FZ4 A;  3EU4 A;  3HZ4 A;  2NTO A;  4PNF A;  4KAE A;  5J4V A;  6GSW A;  2YJ7 A;  3HYP A;  2JZS A;  1ABA A;  5DCG A;  5B8A A;  3MIX A;  4XS1 A;  4I6X A;  1V98 A;  1S4B P;  4POB A;  4X43 A;  4EE0 A;  1SK0 A;  2HZF A;  4BL7 A;  5BMU A;  1MD3 A;  4O7H A;  6GSU A;  5AGY A;  3Q74 A;  4X0X A;  5A4U A;  3DKS A;  3ZTL A;  2OAC A;  5HFK A;  4GCI A;  4MF6 A;  2LV3 A;  1BQ7 A;  5A4W A;  2X99 A;  4BIK A;  5LD0 A;  2LQO A;  3MWH A;  2IIY A;  1V57 A;  3L9V A;  4ML1 A;  1G6Y A;  4Q5R A;  3EMX A;  3GST A;  2YOI A;  4MJA A;  3ZVJ D;  2YJH A;  3UVT A;  2DJ2 A;  1OC8 A;  5LCZ A;  5G1K A;  4AKI A;  2K9F A;  4XIH A;  3TOU A;  5IIZ A;  4K7N A;  3FRC A;  3DXB A;  3TRQ A;  17GS A;  2R0G A;  5ECL B;  5ECO B;  2H1B A;  1THX A;  2VM1 A;  1HNC A;  2C3N A;  2R0C A;  5EVO A;  2EC4 A;  4BL7 B;  1ZCP A;  5IPG A;  3F4R A;  4ACS A;  4NPB A;  2UZ8 A;  2L5L A;  1OC3 A;  1W89 A;  3QCP A;  1J08 A;  2PVQ A;  4L5L A;  5E59 A;  1MDK A;  3ERW A;  2CT6 A;  3RAZ A;  1JFU A;  5LNK e;  4BVY B;  3GKM A;  3PH9 A;  2VCV A;  1OKT A;  2EIR A;  2YNX A;  2GZZ A;  1O7U A;  1M3I A;  3LG6 A;  1DSB A;  4MMM A;  5JWO B;  1JZR A;  3LGC A;  4KUN A;  1GSU A;  1K0C A;  3CQF A;  1UA5 A;  4K5R A;  2GSS A;  4E8H A;  4LA1 A;  5CRD A;  3ZZX A;  4O5R A;  4HI7 A;  4K2X A;  2VCX A;  5HR0 A;  3TKP A;  3L9S A;  5A5H A;  4N10 A;  2VO4 A;  3CHX C;  4AJ6 A;  1XWA A;  4WET A;  4PQI A;  4TN8 A;  2H30 A;  2RUF A;  1ML6 A;  3IK9 A;  3ERF A;  13GS A;  1GLP A;  3Q6O A;  4G19 A;  3D0Z A;  4BA7 A;  10GS A;  1VRS D;  1SVO A;  2IMK A;  1GTB A;  2LRN A;  3EIN A;  2IL3 A;  2E2G A;  3QPM A;  3CYN A;  3M3M A;  3EU3 A;  4CW9 A;  1X5E A;  3Q19 A;  3HJP A;  3I43 A;  3US3 A;  3LWA A;  4KDU A;  4CHS A;  1TU7 A;  3GUS A;  4BVX B;  1OC9 B;  2HSN A;  4ZB8 A;  3HVV A;  1YF0 A;  1ZYN A;  2GST A;  2B7K A;  1KBN A;  1B9X C;  3GKX A;  4DSR A;  4OFT A;  2X49 A;  1VF4 A;  1MD4 A;  2Z9S A;  3KEB A;  4RQX A;  4E68 A;  3VFI A;  4YH2 A;  2EIO A;  2NBS A;  2ON5 A;  2HT9 A;  3F0I A;  5D8I A;  3DWV A;  4GLT A;  2FD3 A;  2HXK A;  4IGJ A;  1K0B A;  1VF3 A;  3H93 A;  3TKS A;  5D9V A;  4IEL A;  3C1R A;  3TJF A;  4DSS A;  2AJQ B;  2YCD A;  3CBU A;  1FVK A;  1EZK A;  3IRA A;  3AY8 A;  2HLS A;  2LNS A;  5KEJ A;  1ZL9 A;  2GSQ A;  2HNL A;  4YQV A;  1VGL A;  4EL1 A;  1JZO A;  2VM2 A;  3GL3 A;  4PQ1 A;  3RFR C;  4IQ1 A;  1AQW A;  5ECS A;  2AB6 A;  3TJK A;  2H75 A;  2R37 A;  5HR1 A;  3BJ5 A;  2OAD A;  2MZC A;  3DML A;  1YJ6 A;  3WT2 A;  1B8X A;  1F37 A;  3D6I A;  3CSJ A;  1GSE A;  5IMC A;  2HRF A;  3DGQ A;  5H5S A;  1TRS A;  2B5E A;  1XW6 A;  4GWR A;  1ON4 A;  4KDY A;  3W8S A;  3I6A A;  2G2Q A;  3NZN A;  2CV4 A;  3FMW A;  4V1A p;  3VK9 A;  2A2P A;  14GS A;  2N5F A;  3VPT A;  2F3M A;  4WBJ A;  4DSS B;  2NDO A;  4OD7 A;  4QL7 A;  3D5J A;  1AQV A;  1T00 A;  3VWU A;  5G31 A;  4TR0 A;  3H79 A;  22GS A;  1A2M A;  2C0D A;  4PUF C;  3KTL A;  2VL9 A;  2LRT A;  4MDC A;  1XWK A;  2F9S A;  3GV1 A;  1G0T A;  1A8Y A;  1S3C A;  4AKX B;  4J56 E;  5H5Q A;  2H0H A;  4L0U A;  1WJK A;  3KH9 A;  3UIW A;  3J7Y b;  2DJK A;  3M9K A;  1XW5 A;  3VLN A;  3EYT A;  2JZT A;  2B1L A;  1USB A;  2GSR A;  3HHV A;  1PMT A;  1EEM A;  1XG8 A;  1YDK A;  2I81 A;  1FAA A;  3MSZ A;  4JBB A;  3P2A A;  1R26 A;  2PWJ A;  2YWN A;  1YEP A;  2P0G A;  3IAS 2;  3LQ7 A;  1F3A A;  2PGT A;  1E2Y A;  1MDJ A;  3TRX A;  4K0G A;  1A24 A;  2C80 A;  1XWC A;  2WW0 A;  2V6O A;  3A2W A;  2O85 A;  3A5W A;  2O3E A;  1OE7 A;  2LST A;  1LJR A;  3HJO A;  6GSY A;  5INY A;  3P90 A;  3IC8 A;  4DEJ A;  5J4U A;  3GFK A;  4Q5F A;  2FA4 A;  1R7H A;  4ZBD A;  1SVL A;  2YN1 A;  4EUY A;  1N2A A;  1Y6E A;  1ILO A;  3PPU A;  3S9F A;  1W4V A;  1B9Y C;  3KMO A;  3PR8 A;  4CY6 A;  4ZBB A;  1WPI A;  2REM A;  5B7C A;  4FYB A;  2I1U A;  2VD1 A;  2GVP A;  5J41 A;  3H1N A;  2VLV A;  2YZU A;  1QFN A;  2JAC A;  1K3L A;  2JZR A;  2MBT A;  4ECJ A;  2J9H A;  3VUR A;  1PQN A;  2UV8 G;  3ZRE A;  3KTB A;  4CY8 A;  3BD2 A;  4N11 A;  1KTE A;  4MAB A;  1WMJ A;  1GUH A;  3L78 A;  4G2E A;  4TXO B;  1F6M C;  3GA4 A;  2L5O A;  4OMV A;  2FWE A;  3P8W A;  1QMV A;  4XCS A;  4JZQ A;  1M9B A;  4LLR A;  3GNJ A;  2H6X A;  2E0Q A;  4EC0 A;  4J2F A;  4G10 A;  2C3T A;  3J7Y k;  4IKH A;  1PN0 A;  20GS A;  3RDW A;  3D22 A;  5AIS A;  4FYC A;  1EGR A;  3VWW A;  1SJ6 A;  2GQM A;  3LSZ A;  1PRX A;  2PUK C;  1V2A A;  4V2L A;  3QR6 A;  4OO4 A;  4WEY A;  2XC2 A;  3HZ8 A;  1S3A A;  2GQK A;  2LTK A;  4HS1 A;  2FCH A;  4KH7 A;  3UBL A;  3TCO A;  2CQ9 A;  4OCF A;  2O89 A;  3M1G A;  1XW9 A;  1GWC A;  4BPY A;  1PA3 A;  1FG4 A;  5A34 B;  1FO5 A;  3CXG A;  2N5B A;  1EGO A;  1VF1 A;  2O5V A;  3G9B A;  1XVW A;  4MP4 A;  2O7K A;  2QA1 A;  3LEF A;  2HYX A;  2WVZ A;  4RI6 A;  4ECC A;  2ALB A;  3DEX A;  1YY7 A;  4GST A;  4HU9 A;  1SL1 B;  4IQA A;  3MDK A;  1AQX A;  1Y25 A;  1GNE A;  4PNG A;  2WUL A;  2LUS A;  4GRF A;  3ME7 A;  3LYK A;  4IHU A;  2RM6 A;  1K0M A;  4AKH A;  1PX6 A;  5EPF A;  1C72 A;  3F3Q A;  4L0W A;  2VAF A;  2B1K A;  4JR4 A;  3GSS A;  3LXZ A;  4K7O A;  3UBK A;  3GL5 A;  4Z2T A;  3UEM A;  4GTU A;  5DAL A;  4IJI A;  3KP8 A;  3V1W A;  2GLR A;  3HA9 A;  1X5D A;  4G0L A;  3QAW A;  3GUR A;  2O36 A;  2LJA A;  3UJ1 A;  3IDV A;  2JL4 A;  2LQQ A;  4XRA A;  1TXX A;  3EVI A;  5IO0 A;  1M0U A;  4HSC X;  2QGV A;  5F06 A;  1I1I P;  4AKG A;  2LJK A;  3HY2 A;  4LL4 B;  1YKC A;  5IMF A;  3R2Q A;  4ZBA A;  3NIV A;  2DMM A;  5ECQ B;  8GSS A;  2B5Y A;  1OE8 A;  1YZX A;  2H71 A;  3QDN A;  4AF2 A;  4WF5 A;  1QGV A;  5DAL B;  2WGR A;  2DJ0 A;  2H0I A;  3KZQ A;  2AYT A;  2XBI A;  4JE1 A;  3ZFB A;  2LEG A;  2VL2 C;  4ULX A;  5AN1 A;  2R4V A;  2PU9 C;  2YWO A;  5BMU B;  5KN2 A;  5L71 A;  4QL9 A;  3APO A;  1EP8 A;  2EIQ A;  2HQT A;  1RW1 A;  2H70 A;  2YWI A;  2G0F A;  4G9H A;  5F0G A;  4IVF A;  1K0N A;  4F9Z A;  5ID2 A;  3LXT A;  2DBC A;  1JLV A;  4NHZ A;  2GS3 A;  2MMA A;  1WRY A;  3CTG A;  1JLW A;  2QA2 A;  3PGT A;  1PL2 A;  1MEK A;  4NAX A;  1XVQ A;  3GX8 A;  2NVL A;  3UAP A;  2P5R A;  5JCU A;  1K3O A;  2OBI A;  1GP1 A;  3A5I A;  3BCI A;  4EO3 A;  3PIN A;  4I8B A;  3FR3 A;  1EOH A;  1NW2 A;  4ECB A;  3BOA A;  1YF1 A;  4ZL9 A;  1R5A A;  1SVM A;  1NHO A;  1K0O A;  3QAG A;  1U6T A;  5CNW A;  3FKF A;  2DKI A;  2FY6 A;  1ERV A;  2FNO A;  3HVX A;  3HXS A;  1EP7 A;  2LNT A;  4O5U A;  4IS0 A;  4IP6 A;  3LOR A;  3F3R A;  4MJC A;  1SKR B;  4FXY P;  2X4A A;  4PI0 C;  1QXH A;  4K2D A;  1SJZ A;  2CZ3 A;  2V41 A;  4ZL7 A;  1ZGN A;  2OT3 A;  3U6V A;  4MZB A;  4J57 E;  1HNB A;  3G7J A;  5IQY A;  1TRU A;  2FWF A;  1SU9 A;  4TVE A;  1PKZ A;  1T7P B;  4E8E A;  3GTU A;  2OJL A;  2VCQ A;  2WS2 A;  4OO5 A;  1TK5 B;  5ENU A;  2HRA A;  2WFC A;  4XS6 A;  2LJR A;  3IK7 A;  4FO5 A;  3HCZ A;  1HQO A;  5HR2 A;  4KW6 A;  4O32 A;  1AUC A;  2E2M A;  3ZIT A;  4DSQ A;  6GST A;  4BWS A;  3TDG A;  5A5H B;  5D9T A;  4HUA A;  1EEJ A;  1TJD A;  2WZS A;  1BX9 A;  5DVB A;  1YKA A;  3WGD A;  3MNG A;  3HVN A;  2HSY A;  4TW5 A;  4ECI A;  4GSS A;  4FQU A;  3LJR A;  4MPF A;  1TP9 A;  4HEA 2;  1ACV A;  4PQH A;  5ELG A;  3CWG A;  2K6V A;  5HR3 A;  1GSS A;  2JSZ A;  2YP6 A;  3WYW A;  1GSY A;  3FZ5 A;  2RM5 A;  2PBJ A;  1AAZ A;  1XXU A;  3IA1 A;  1PL1 A;  3QOU A;  5DJL A;  1H75 A;  4ZL8 A;  2HSN B;  3KCM A;  3R3E A;  2VKZ G;  1AC1 A;  1M2D A;  1U3A A;  1SD8 A;  3HJM A;  3HMJ G;  2V6K A;  2NPB A;  2WB9 A;  4ID0 A;  1F3B A;  4NHW A;  2H76 A;  2HFD A;  2H1L A;  5E4W A;  1XBS A;  4JR6 A;  4HJ2 A;  4KX4 A;  1T4Z A;  3G7Y A;  3NOF A;  2WRT A;  1O8X A;  1M7T A;  4ILF A;  1PN9 A;  5IM9 A;  5ECN B;  4F0C A;  4JRR A;  5G1L A;  2VOC A;  1OKD A;  1M2B A;  2DJ3 A;  2IMI A;  5FWG A;  3C71 A;  2B6M A;  6GSV A;  5AIX A;  1DE1 A;  3O3T A;  2FWH A;  5CRH A;  1MDI A;  4KSO A;  4MPG A;  2YPM A;  1ZYQ B;  1Y1U A;  2GT6 A;  5IMZ A;  4NWY A;  5D9X A;  1ZYP A;  1A0R P;  1V9W A;  2C1Y A;  1F2E A;  2K8V A;  3EC3 A;  3I9V 2;  1A23 A;  5IMD A;  3WGX A;  3MYD A;  1GH2 A;  4TXV A;  2PN8 A;  3IOS A;  4TRX A;  4WR4 A;  4K6X A;  5JCG A;  2IMF A;  2I9H A;  5FT3 A;  1JZW A;  2H6Z A;  3EWL A;  4RQR A;  1U88 A;  3TRP A;  4IBP A;  5D93 A;  1ZOF A;  3E9J B;  3L9U A;  1SK2 A;  5DDL A;  1TDI A;  5J40 A;  2L57 A;  3D21 A;  5A4V A;  3RBT A;  3ZLP A;  2AHE A;  4N3Z A;  3FHK A;  4KF9 A;  1X9S B;  2FLS A;  2ES7 A;  2GTU A;  4V1A g; 
#chains in the Genus database with same CATH homology
 4OFM A;  1Z6N A;  4GSN A;  1XWG A;  1X9W B;  2YV9 A;  2TRC P;  4ZXG A;  2X8G A;  5G30 A;  4AGS A;  4EIQ A;  1SL0 B;  2BTO T;  5D9W A;  2R2J A;  3KGK A;  1UN2 A;  4O5Q A;  4FH8 A;  1O85 A;  5DBQ A;  2CAQ A;  4H86 A;  1SYR A;  5ELA A;  2DJJ A;  1LU4 A;  1JZD A;  1J0F A;  1ZYE A;  2L6C A;  3Q18 A;  3C1S A;  3QAV A;  4K8M A;  1WP0 A;  3IR4 A;  3H4K A;  4F0B A;  3O6T A;  3TKS C;  2PER A;  3DVW A;  2HSM A;  5J9B A;  4JU5 A;  2PPT A;  3A2V A;  2HRN A;  5IMA A;  1S3D A;  1OAZ A;  2DML A;  2OE0 A;  4YKF A;  2DJ1 A;  19GS A;  4D73 A;  4QMK A;  4OWY A;  2V1M A;  4EIP A;  3K8N A;  5D96 A;  1M99 A;  1K0A A;  1SJI A;  1G6W A;  6GSS A;  3HD5 A;  3N5O A;  3RPN A;  4I97 A;  2A4H A;  1K3Y A;  3A3T A;  3W8J A;  5DCH A;  4IJ3 A;  4XTS A;  2B5X A;  5B8B A;  1GL8 A;  3CRU A;  9GSS A;  3A2X A;  3ZL5 A;  3FR6 A;  4YQM A;  3LFL A;  1BG1 A;  4KCE A;  1VF2 A;  3M0F A;  1R5P A;  2XBQ A;  1ZZY A;  3CRT A;  4YKG A;  1WWJ A;  3BBY A;  4MF7 A;  4FYU A;  3TKS E;  12GS A;  4FIW A;  3ZIJ A;  2HRK A;  4ZIL A;  4PUR A;  3M9J A;  2CVB A;  3ZFL A;  3GRX A;  4K0N A;  4O92 A;  4GF0 A;  1O8W A;  4Z2U A;  3FZ9 A;  1JHB A;  3ISO A;  4NXI A;  5BRT A;  1BF5 A;  3GMF A;  3UOM A;  4V2N A;  1X9M B;  3KMN A;  2YZH A;  1THO A;  4WF4 A;  2PVO C;  5DAK A;  1E6B A;  1TRW A;  1ERW A;  3IHG A;  4HZ2 A;  3SBC A;  3EE2 A;  1AXD A;  4QQ7 A;  3ZRD A;  4K1F A;  2M46 A;  1WIK A;  1T3B A;  4MK3 A;  2YWM A;  2OE1 A;  3D4T A;  1B4P A;  4USS A;  4YAP A;  3OR5 A;  1Z7R A;  2TRX A;  3RHB A;  4OCE A;  2HRK B;  3VWX A;  4AJ7 A;  4IN0 A;  1YEX A;  1TW9 A;  5HQP A;  5GST A;  4KGI A;  1QUW A;  2HSH A;  1I9D A;  4K7I A;  4ZB9 A;  2LKU A;  2EFD A;  3HKR A;  4HDE A;  1SK1 A;  2OBK A;  2H66 A;  3U5R E;  4F82 A;  3UL3 A;  2CZ2 A;  1RK4 A;  1PD2 1;  4MJE A;  2X8C A;  5GSS A;  2JU5 A;  1GTI A;  1B4Q A;  2FWG A;  3I69 A;  4ZB7 A;  2MMO A;  1OYJ A;  3DD3 A;  4TOP A;  4POK A;  2QC7 A;  3APQ A;  3TJB A;  1A0F A;  2ON7 A;  4ICY A;  2YAN A;  3D4M A;  3QFB C;  2KLX A;  4N30 A;  5IPH A;  4EDZ A;  3C73 A;  3WGE A;  4HZ4 A;  5J4Y A;  3KP9 A;  1XPV A;  4MJB A;  2D2Z A;  3KIJ A;  4MA9 A;  3UVH A;  4OFN A;  5JCW A;  2MMZ A;  3UMA A;  4WKW A;  2MBS A;  1AW9 A;  1SYX A;  1GUM A;  5GZZ B;  2EFE A;  4Z2R A;  3TKQ A;  5EY6 A;  4RUV A;  3WD6 A;  1UVZ A;  4W66 A;  4P3Y B;  2MMN A;  3F63 A;  1ERT A;  4L5O A;  3E3E A;  2XHF A;  2JSY A;  2H01 A;  1GTU A;  5G2Z A;  4POM A;  4Z7X A;  3ZYW A;  1Z6M A;  3ZML A;  4KDX A;  3GH9 A;  3F8U A;  4F03 A;  2DLX A;  1J9B A;  1A2L A;  4EXJ A;  3JCM L;  4BVY A;  3RPP A;  1GRX A;  3GN3 A;  3VWV A;  2L59 A;  5KOX A;  2R3X A;  3CSH A;  1B48 A;  3DYR A;  7GSS A;  2L4Q A;  1TI1 A;  4L8E A;  1HNA A;  1XZO A;  2H72 A;  2L4C A;  1GLQ A;  3LW9 A;  1EV4 A;  2GZY A;  4EDY A;  1BAY A;  3FYG A;  5F07 A;  5DQS A;  1TK8 B;  1N8J A;  5ECK B;  2HZE A;  1N25 A;  2ZCT A;  1YVL A;  1A2J A;  3G7I A;  3HVS A;  5ECH B;  5ECR B;  2VL3 A;  5J5N A;  2F51 A;  1Z9H A;  2MYG A;  1QK8 A;  3DIE A;  2KUC A;  3TKR A;  5ECP B;  2K18 A;  5B6M A;  5IOW A;  2CAI A;  2H0G A;  4KCA A;  18GS A;  4MH2 A;  3F6F A;  2PMT A;  5G5E A;  5F8B A;  1Q4J A;  2EFC A;  2X64 A;  2JAD A;  3DVX A;  1XCC A;  1TU8 A;  3CSI A;  1X5C A;  4BVX A;  1FOV A;  3EPT A;  1OC9 A;  1XOA A;  3GYK A;  1G7E A;  5ID2 B;  4KE3 A;  4GXZ A;  2HZE B;  5GAP D;  3QFA C;  1OVN A;  1ZMA A;  1M2A A;  3H8Q A;  5KOW A;  4WBR D;  11GS A;  4HJM A;  4TR1 A;  2IWT A;  1TOF A;  1X0R A;  2HI7 A;  4GQC A;  2H1G A;  2P5Q A;  3HDC A;  2F8F A;  1XOB A;  4XS4 A;  3L4N A;  2C8U A;  4HQZ A;  3KD0 A;  2CVD A;  4LL1 B;  3IE3 A;  4ZIJ A;  1CQG A;  2H19 A;  4IW9 A;  4WXT A;  2AAW A;  3F9U A;  4DVC A;  3ME8 A;  4EKZ A;  5J47 A;  1M9A A;  4GDF A;  1R4W A;  3APS A;  2H1A A;  2F8A A;  4BWQ A;  1AIU A;  3IC4 A;  1GSD A;  1GTA A;  3TJG A;  3O76 A;  5A1N A;  4A5P A;  4TR1 B;  1A8L A;  2AUV A;  1EV9 A;  4GQF A;  5F05 A;  1SEN A;  2VCW A;  4K9Z A;  4X1U A;  3C7M A;  1V40 A;  2IFQ A;  3GTU B;  2VCT A;  2OA7 A;  2O8V B;  3FK8 A;  5G5F A;  6GSX A;  4XS4 B;  2WJU A;  1O81 A;  1Z7P A;  2DKH A;  5J9C A;  2M72 A;  1NM3 A;  1FHE A;  2A2S A;  5CO3 A;  2OKA A;  2H1D A;  4HQS A;  2RII A;  4XRD A;  3TGZ A;  1TKD B;  2V32 A;  1UC7 A;  2GZP A;  5ECM B;  2FGX A;  3ZIV A;  2QSI A;  4F2I A;  4MH3 A;  2VCZ A;  2LS5 A;  4KB3 A;  2CX4 A;  5CP1 A;  1I5G A;  5A1N B;  3ZMK A;  3TJJ A;  4G0K A;  2EFH A;  3VI7 A;  2IFQ B;  4EVM A;  1PGT A;  3GKK A;  3KM6 A;  4YQU A;  3GX0 A;  2VUP A;  5COH A;  2OE3 A;  2VD0 A;  2H73 A;  4LMW A;  2C0G A;  1O6J A;  3DRN A;  2O87 A;  3KXO A;  3UAR A;  3L0H A;  4RI7 A;  1GNW A;  2VLU A;  1K0D A;  4YAV A;  1PX7 A;  2KOK A;  4KSM A;  1XIY A;  5CYY A;  2FUG 2;  3TOT A;  4NV5 A;  1MTC A;  2GQL A;  5CRG A;  2GT5 A;  4XHM A;  3ZVJ A;  1Q98 A;  2CA8 A;  2KHP A;  4TKY A;  5AIV A;  1KEB A;  1SD9 A;  5GAN D;  4POL A;  1Z3E A;  1HD2 A;  1NSW A;  3SWL A;  2J23 A;  3GKN A;  5HFI A;  2IJY A;  5KN3 A;  5ABR A;  2GDR A;  1ERU A;  3EUR A;  2R5G A;  5EL8 A;  5A5K A;  2CX3 A;  2I3Y A;  1DUG A;  4ZB6 A;  2C3Q A;  2KP2 A;  2C0F A;  3RHC A;  2I4A A;  1TXU A;  1U87 A;  3LYP A;  3FR9 A;  4PGT A;  1Z5Y E;  1GUK A;  3FW2 A;  1BED A;  5H5R A;  1BYE A;  3IV4 A;  2HE3 A;  1H4O A;  3GH6 A;  2FA8 A;  4LMV A;  2BMX A;  3KJY A;  2GGT A;  2E7P A;  3P7X A;  4V2M A;  1WOU A;  2TIR A;  5ECI B;  4I2T A;  5KN0 A;  3ERG A;  2LRC A;  4ISD A;  4NMU A;  4TR3 A;  4K5S A;  3WT1 A;  3N9J A;  3TUE A;  4EF0 A;  1KNG A;  2A2R A;  4HOJ A;  4TXO A;  1T1V A;  3ED3 A;  4N0Z A;  4AI6 A;  4NV2 A;  2R0P A;  4I2U A;  2H74 A;  3FEU A;  4TR4 A;  2DIZ A;  2KP1 A;  4CDO A;  5JWR B;  3GHA A;  5C04 A;  1XFL A;  1FOH A;  1WE0 A;  1SL2 B;  2M80 A;  5FHI A;  2WCI A;  1GSF A;  2IME A;  1DE2 A;  1LBK A;  5IMV A;  1TI3 A;  3IHQ A;  5CAX A;  2WDU A;  1TRV A;  4X4J A;  5C00 A;  2WZ9 A;  3VPQ A;  3W6G A;  2YV7 A;  1IYI A;  2IPA A;  2B3S A;  3E0U A;  1GSQ A;  4G01 A;  2B7J A;  5IO2 A;  2VLT A;  3TU3 B;  2H6Y A;  2ZNM A;  4N0V A;  1SKW B;  1T8E B;  3IXR A;  4IP1 A;  2C0E A;  2CVK A;  3KH7 A;  1IYH A;  4KND A;  1F9M A;  5A34 A;  1V58 A;  3CTF A;  1FW1 A;  2HSM B;  1SKS B;  1PKW A;  2AV4 A;  3QMX A;  2R6K A;  3C8E A;  2VL2 A;  4MZW A;  4ML6 A;  2ZUP A;  1TK0 B;  1RQM A;  4MF5 A;  4D73 B;  4WR5 A;  4PTS A;  5CRW A;  5DJM A;  2P31 A;  5JWQ B;  3TB2 A;  1G7O A;  2XPE A;  2L6D A;  2V2G A;  4MLY A;  4Q5Q A;  2H8L A;  3M8N A;  4I5Q A;  1T4Y A;  2FHE A;  1ST9 A;  3GIX A;  4HU7 A;  5J3R A;  5IOX A;  1BG5 A;  3F4T A;  1BJX A;  4PUA A;  2RLI A;  1NHY A;  1FVJ A;  2XPD A;  2RUE A;  4AJ8 A;  4Q5N A;  1CQH A;  1HYU A;  2VIM A;  3IBH A;  1TTZ A;  3IPZ A;  4JED A;  1DBY A;  1GUL A;  4G0I A;  1QQ2 A;  2A4V A;  5HFG A;  2DC5 A;  1YQ1 A;  2N5A A;  4MZC A;  16GS A;  3BCK A;  1FB6 A;  2QKE A;  3FZA A;  5DQY A;  2IMD A;  1URM A;  1EOG A;  3VI5 A;  1XWB A;  1U3I A;  3MAK A;  1O73 A;  2DIY A;  5KN1 A;  3CMI A;  5D73 A;  5DAK B;  2IN3 A;  3F4S A;  3QD9 A;  2X8H A;  5B6N A;  1PSQ A;  2BJX A;  4PX1 A;  1EWX A;  2C4J A;  3EMP A;  3IAM 2;  1FB0 A;  4KA0 A;  4MCU A;  3F6D A;  2DSA A;  4PXO A;  5CRE A;  2K8S A;  4MNN A;  3FY7 A;  3FZ4 A;  3EU4 A;  3HZ4 A;  2NTO A;  4PNF A;  4KAE A;  5J4V A;  6GSW A;  2YJ7 A;  3HYP A;  2JZS A;  1ABA A;  5DCG A;  5B8A A;  3MIX A;  4XS1 A;  4I6X A;  1V98 A;  4POB A;  4X43 A;  4EE0 A;  1SK0 A;  2HZF A;  4BL7 A;  5BMU A;  1MD3 A;  4O7H A;  6GSU A;  5AGY A;  3Q74 A;  4X0X A;  5A4U A;  3DKS A;  3ZTL A;  2OAC A;  5HFK A;  4GCI A;  4MF6 A;  2LV3 A;  1BQ7 A;  5A4W A;  2X99 A;  5LD0 A;  2LQO A;  3MWH A;  2IIY A;  1V57 A;  3L9V A;  4ML1 A;  1G6Y A;  4Q5R A;  3EMX A;  3GST A;  2YOI A;  4MJA A;  3ZVJ D;  2YJH A;  3UVT A;  2DJ2 A;  1OC8 A;  5LCZ A;  5G1K A;  4AKI A;  2K9F A;  4XIH A;  3TOU A;  5IIZ A;  4K7N A;  3FRC A;  3DXB A;  3TRQ A;  17GS A;  2R0G A;  5ECL B;  5ECO B;  2H1B A;  1THX A;  2VM1 A;  1HNC A;  2C3N A;  2R0C A;  5EVO A;  2EC4 A;  4BL7 B;  1ZCP A;  5IPG A;  3F4R A;  4ACS A;  4NPB A;  2UZ8 A;  2L5L A;  1OC3 A;  1W89 A;  3QCP A;  1J08 A;  2PVQ A;  4L5L A;  5E59 A;  1MDK A;  3ERW A;  2CT6 A;  3RAZ A;  1JFU A;  5LNK e;  4BVY B;  3GKM A;  3PH9 A;  2VCV A;  1OKT A;  2EIR A;  2YNX A;  2GZZ A;  1O7U A;  3LG6 A;  1DSB A;  4MMM A;  5JWO B;  1JZR A;  3LGC A;  4KUN A;  1GSU A;  1K0C A;  1UA5 A;  4K5R A;  2GSS A;  4E8H A;  4LA1 A;  5CRD A;  3ZZX A;  4O5R A;  4HI7 A;  4K2X A;  2VCX A;  5HR0 A;  3TKP A;  3L9S A;  5A5H A;  4N10 A;  2VO4 A;  4AJ6 A;  1XWA A;  4WET A;  4PQI A;  4TN8 A;  2H30 A;  2RUF A;  1ML6 A;  3IK9 A;  3ERF A;  13GS A;  1GLP A;  3Q6O A;  4G19 A;  3D0Z A;  4BA7 A;  10GS A;  1VRS D;  1SVO A;  2IMK A;  1GTB A;  2LRN A;  3EIN A;  2IL3 A;  2E2G A;  3QPM A;  3CYN A;  3M3M A;  3EU3 A;  4CW9 A;  1X5E A;  3Q19 A;  3HJP A;  3I43 A;  3US3 A;  3LWA A;  4KDU A;  4CHS A;  1TU7 A;  3GUS A;  4BVX B;  1OC9 B;  2HSN A;  4ZB8 A;  3HVV A;  1YF0 A;  1ZYN A;  2GST A;  2B7K A;  1KBN A;  1B9X C;  3GKX A;  4DSR A;  4OFT A;  2X49 A;  1VF4 A;  1MD4 A;  2Z9S A;  3KEB A;  4RQX A;  4E68 A;  3VFI A;  4YH2 A;  2EIO A;  2NBS A;  2ON5 A;  2HT9 A;  3F0I A;  5D8I A;  3DWV A;  4GLT A;  2FD3 A;  2HXK A;  4IGJ A;  1K0B A;  1VF3 A;  3H93 A;  3TKS A;  5D9V A;  4IEL A;  3C1R A;  3TJF A;  4DSS A;  2AJQ B;  2YCD A;  3CBU A;  1FVK A;  1EZK A;  3IRA A;  3AY8 A;  2HLS A;  2LNS A;  5KEJ A;  1ZL9 A;  2GSQ A;  2HNL A;  4YQV A;  1VGL A;  4EL1 A;  1JZO A;  2VM2 A;  3GL3 A;  4PQ1 A;  4IQ1 A;  1AQW A;  5ECS A;  2AB6 A;  3TJK A;  2H75 A;  2R37 A;  5HR1 A;  3BJ5 A;  2OAD A;  2MZC A;  3DML A;  1YJ6 A;  3WT2 A;  1B8X A;  1F37 A;  3D6I A;  3CSJ A;  1GSE A;  5IMC A;  2HRF A;  3DGQ A;  5H5S A;  1TRS A;  2B5E A;  1XW6 A;  4GWR A;  1ON4 A;  4KDY A;  3W8S A;  3I6A A;  2G2Q A;  3NZN A;  2CV4 A;  3FMW A;  4V1A p;  3VK9 A;  2A2P A;  14GS A;  2N5F A;  3VPT A;  2F3M A;  4WBJ A;  4DSS B;  2NDO A;  4OD7 A;  4QL7 A;  3D5J A;  1AQV A;  1T00 A;  3VWU A;  5G31 A;  4TR0 A;  3H79 A;  22GS A;  1A2M A;  2C0D A;  4PUF C;  3KTL A;  2VL9 A;  2LRT A;  4MDC A;  1XWK A;  2F9S A;  3GV1 A;  1G0T A;  1A8Y A;  1S3C A;  4AKX B;  4J56 E;  5H5Q A;  2H0H A;  4L0U A;  1WJK A;  3KH9 A;  3UIW A;  3J7Y b;  2DJK A;  3M9K A;  1XW5 A;  3VLN A;  3EYT A;  2JZT A;  2B1L A;  1USB A;  2GSR A;  3HHV A;  1PMT A;  1EEM A;  1YDK A;  2I81 A;  1FAA A;  3MSZ A;  4JBB A;  3P2A A;  1R26 A;  2PWJ A;  2YWN A;  1YEP A;  2P0G A;  3IAS 2;  3LQ7 A;  1F3A A;  2PGT A;  1E2Y A;  1MDJ A;  3TRX A;  4K0G A;  1A24 A;  2C80 A;  1XWC A;  3A2W A;  2V6O A;  2O85 A;  3A5W A;  1OE7 A;  2LST A;  1LJR A;  3HJO A;  6GSY A;  5INY A;  3P90 A;  3IC8 A;  4DEJ A;  5J4U A;  3GFK A;  4Q5F A;  2FA4 A;  1R7H A;  4ZBD A;  1SVL A;  2YN1 A;  4EUY A;  1N2A A;  1Y6E A;  1ILO A;  3PPU A;  3S9F A;  1W4V A;  1B9Y C;  3KMO A;  3PR8 A;  4CY6 A;  4ZBB A;  1WPI A;  2REM A;  5B7C A;  4FYB A;  2I1U A;  2VD1 A;  2GVP A;  5J41 A;  3H1N A;  2VLV A;  2YZU A;  1QFN A;  2JAC A;  1K3L A;  2JZR A;  2MBT A;  4ECJ A;  2J9H A;  3VUR A;  1PQN A;  2UV8 G;  3ZRE A;  3KTB A;  4CY8 A;  3BD2 A;  4N11 A;  1KTE A;  4MAB A;  1WMJ A;  1GUH A;  3L78 A;  4G2E A;  4TXO B;  1F6M C;  3GA4 A;  2L5O A;  4OMV A;  2FWE A;  3P8W A;  1QMV A;  4XCS A;  4JZQ A;  1M9B A;  4LLR A;  3GNJ A;  2H6X A;  2E0Q A;  4EC0 A;  4J2F A;  4G10 A;  2C3T A;  3J7Y k;  4IKH A;  1PN0 A;  20GS A;  3RDW A;  3D22 A;  5AIS A;  4FYC A;  1EGR A;  3VWW A;  1SJ6 A;  2GQM A;  3LSZ A;  1PRX A;  2PUK C;  1V2A A;  4V2L A;  3QR6 A;  4OO4 A;  4WEY A;  2XC2 A;  3HZ8 A;  1S3A A;  2GQK A;  2LTK A;  4HS1 A;  2FCH A;  4KH7 A;  3UBL A;  3TCO A;  2CQ9 A;  4OCF A;  2O89 A;  3M1G A;  1XW9 A;  1GWC A;  4BPY A;  1PA3 A;  1FG4 A;  5A34 B;  1FO5 A;  3CXG A;  2N5B A;  1EGO A;  1VF1 A;  2O5V A;  3G9B A;  1XVW A;  4MP4 A;  2O7K A;  2QA1 A;  3LEF A;  2HYX A;  4ECC A;  4RI6 A;  2ALB A;  3DEX A;  1YY7 A;  4GST A;  4HU9 A;  1SL1 B;  4IQA A;  3MDK A;  1AQX A;  1Y25 A;  1GNE A;  4PNG A;  2WUL A;  2LUS A;  4GRF A;  3ME7 A;  3LYK A;  4IHU A;  2RM6 A;  1K0M A;  4AKH A;  1PX6 A;  5EPF A;  1C72 A;  3F3Q A;  4L0W A;  2VAF A;  2B1K A;  4JR4 A;  3GSS A;  3LXZ A;  4K7O A;  3UBK A;  3GL5 A;  4Z2T A;  3UEM A;  4GTU A;  5DAL A;  4IJI A;  3KP8 A;  3V1W A;  2GLR A;  3HA9 A;  1X5D A;  4G0L A;  3QAW A;  3GUR A;  3UJ1 A;  2LJA A;  3IDV A;  2JL4 A;  2LQQ A;  4XRA A;  1TXX A;  3EVI A;  5IO0 A;  1M0U A;  2QGV A;  5F06 A;  4AKG A;  2LJK A;  3HY2 A;  4LL4 B;  1YKC A;  5IMF A;  3R2Q A;  4ZBA A;  3NIV A;  2DMM A;  5ECQ B;  8GSS A;  2B5Y A;  1OE8 A;  1YZX A;  2H71 A;  3QDN A;  4AF2 A;  4WF5 A;  1QGV A;  5DAL B;  2WGR A;  2DJ0 A;  2H0I A;  3KZQ A;  2AYT A;  2XBI A;  4JE1 A;  3ZFB A;  2LEG A;  2VL2 C;  4ULX A;  5AN1 A;  2R4V A;  2PU9 C;  2YWO A;  5BMU B;  5KN2 A;  5L71 A;  4QL9 A;  3APO A;  1EP8 A;  2EIQ A;  2HQT A;  1RW1 A;  2H70 A;  2YWI A;  2G0F A;  4G9H A;  5F0G A;  4IVF A;  1K0N A;  4F9Z A;  5ID2 A;  3LXT A;  2DBC A;  1JLV A;  4NHZ A;  2GS3 A;  2MMA A;  1WRY A;  3CTG A;  1JLW A;  2QA2 A;  3PGT A;  1PL2 A;  1MEK A;  4NAX A;  1XVQ A;  3GX8 A;  2NVL A;  3UAP A;  2P5R A;  5JCU A;  1K3O A;  2OBI A;  1GP1 A;  3A5I A;  3BCI A;  4EO3 A;  3PIN A;  4I8B A;  3FR3 A;  1EOH A;  1NW2 A;  4ECB A;  3BOA A;  1YF1 A;  4ZL9 A;  1R5A A;  1SVM A;  1NHO A;  1K0O A;  3QAG A;  1U6T A;  5CNW A;  3FKF A;  2DKI A;  2FY6 A;  1ERV A;  2FNO A;  3HVX A;  3HXS A;  1EP7 A;  2LNT A;  4O5U A;  4IS0 A;  4IP6 A;  3LOR A;  3F3R A;  4MJC A;  1SKR B;  2X4A A;  1QXH A;  4K2D A;  1SJZ A;  2CZ3 A;  2V41 A;  4ZL7 A;  1ZGN A;  2OT3 A;  3U6V A;  4MZB A;  4J57 E;  1HNB A;  3G7J A;  5IQY A;  1TRU A;  2FWF A;  1SU9 A;  4TVE A;  1PKZ A;  1T7P B;  4E8E A;  3GTU A;  2OJL A;  2VCQ A;  2WS2 A;  4OO5 A;  1TK5 B;  5ENU A;  2HRA A;  2WFC A;  4XS6 A;  2LJR A;  3IK7 A;  4FO5 A;  3HCZ A;  1HQO A;  5HR2 A;  4KW6 A;  4O32 A;  1AUC A;  2E2M A;  3ZIT A;  4DSQ A;  6GST A;  4BWS A;  3TDG A;  5A5H B;  5D9T A;  4HUA A;  1EEJ A;  1TJD A;  1BX9 A;  5DVB A;  1YKA A;  3WGD A;  3MNG A;  2HSY A;  4TW5 A;  4ECI A;  4GSS A;  4FQU A;  3LJR A;  4MPF A;  1TP9 A;  4HEA 2;  1ACV A;  4PQH A;  5ELG A;  3CWG A;  2K6V A;  5HR3 A;  1GSS A;  2JSZ A;  2YP6 A;  3WYW A;  1GSY A;  3FZ5 A;  2RM5 A;  2PBJ A;  1AAZ A;  1XXU A;  3IA1 A;  1PL1 A;  3QOU A;  5DJL A;  1H75 A;  4ZL8 A;  2HSN B;  3KCM A;  3R3E A;  2VKZ G;  1AC1 A;  1M2D A;  1U3A A;  1SD8 A;  3HJM A;  3HMJ G;  2V6K A;  2NPB A;  2WB9 A;  4ID0 A;  1F3B A;  4NHW A;  2H76 A;  2HFD A;  2H1L A;  5E4W A;  1XBS A;  4JR6 A;  4HJ2 A;  4KX4 A;  1T4Z A;  3G7Y A;  3NOF A;  2WRT A;  1O8X A;  1M7T A;  4ILF A;  1PN9 A;  5IM9 A;  5ECN B;  4F0C A;  4JRR A;  5G1L A;  2VOC A;  1OKD A;  1M2B A;  2DJ3 A;  2IMI A;  5FWG A;  3C71 A;  2B6M A;  6GSV A;  5AIX A;  1DE1 A;  3O3T A;  2FWH A;  5CRH A;  1MDI A;  4KSO A;  4MPG A;  2YPM A;  1ZYQ B;  1Y1U A;  2GT6 A;  5IMZ A;  4NWY A;  5D9X A;  1ZYP A;  1A0R P;  1V9W A;  2C1Y A;  1F2E A;  2K8V A;  3EC3 A;  3I9V 2;  1A23 A;  5IMD A;  3WGX A;  3MYD A;  1GH2 A;  4TXV A;  2PN8 A;  3IOS A;  4TRX A;  4WR4 A;  4K6X A;  5JCG A;  2IMF A;  2I9H A;  5FT3 A;  1JZW A;  2H6Z A;  3EWL A;  4RQR A;  1U88 A;  3TRP A;  4IBP A;  5D93 A;  1ZOF A;  3E9J B;  3L9U A;  1SK2 A;  5DDL A;  1TDI A;  5J40 A;  2L57 A;  3D21 A;  5A4V A;  3RBT A;  3ZLP A;  2AHE A;  4N3Z A;  3FHK A;  4KF9 A;  1X9S B;  2FLS A;  2ES7 A;  2GTU A;  4V1A g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...