2CAIA

Structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
DHIKVIYFNGRGRAESILMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAATPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE 28 KDA
publication title Probing the Mechanism of Gsh Activation in Schistosoma Haematobium Glutathione-S-Transferase by Site-Directed Mutagenesis and X-Ray Crystallography.
pubmed doi rcsb
source organism Schistosoma haematobium
molecule tags Transferase
total genus 65
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2caiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2caiA01
1K3OA 3VLNA 1F9MA 4IP1A 5IO2A 4MJEA 4ZBAA 3M3MA 5CRDA 3HJOA 1V40A 4HI7A 1GLPA 1SENA 1OC9B 2O89A 3HVXA 2C8UA 1THXA 2B7JA 2MMNA 2WZ9A 3RPNA 3QOUA 4TRXA 2VCTA 3ED3A 4F03A 1X5DA 4TXOA 2YJ7A 4FH8A 3EC3A 4BVYB 5GSSA 3O76A 4NAXA 1SJIA 1WP0A 2GQKA 2H0IA 3L0HA 4N10A 4AJ7A 4FYCA 3LFLA 2GZYA 5EY6A 3ZMKA 3BCKA 1ML6A 4MJAA 4AGSA 3GSSA 5ECRB 2VL3A 5ECSA 1GH2A 1GTUA 1QFNA 3HXSA 2VCXA 1ZGNA 1QMVA 4TOPA 1TRWA 4MCUA 3E3EA 1AQXA 5DJMA 2HSYA 3KGKA 2LSTA 2NTOA 3HVSA 1ZCPA 3CXGA 5IQYA 4IP6A 4OWYA 2AB6A 5FT3A 1GWCA 2VD1A 2DBCA 2R4VA 5E4WA 3TJFA 2KP1A 1B9YC 5CO3A 2OA7A 2GZPA 4QL9A 3KJYA 3LYKA 2P5RA 4IN0A 1J9BA 1TRVA 2XC2A 4KUNA 1M9AA 2I4AA 3KM6A 4KNDA 1GSFA 1HNCA 1T1VA 3WGXA 5D9TA 5H5SA 3UVHA 3BD2A 4TXOB 2DJ0A 1VRSD 4GRFA 3QFAC 2QSIA 2LNTA 3HY2A 3GA4A 2DJ2A 1N8JA 2B6MA 3HZ4A 3QR6A 4XIHA 1TOFA 2X64A 3KEBA 3HA9A 2FGXA 1EZKA 4L5OA 2LQQA 2VIMA 4JZQA 1MDIA 3LJRA 4IVFA 4YQVA 2FY6A 1O8XA 1JZRA 1KBNA 2WDUA 3F4TA 4LL1B 1GUHA 5IMAA 1SJ6A 1ST9A 5F8BA 3Q6OA 1PGTA 1FB0A 1GUKA 4K0GA 2LQOA 4IBPA 1XOBA 4RI6A 2AUVA 5F07A 3F3RA 3DKSA 4N11A 4K7NA 2Z9SA 1FAAA 2GTUA 3HVVA 4F0CA 3IE3A 1FW1A 1M2DA 4V2NA 3M8NA 1SU9A 4L0UA 1BEDA 5KN1A 2HZEA 1XWCA 5F05A 1YKCA 1Q4JA 3ERFA 3GH9A 1OC8A 4F2IA 3R3EA 3QDNA 3FKFA 5ABRA 4G19A 5IPGA 3HJPA 2F8AA 1GLQA 2EIRA 5HR0A 2QKEA 2LNSA 1OE7A 3TKSA 4JBBA 3GL5A 2F8FA 5LD0A 1MEKA 4N30A 1FOVA 3QAWA 1EP8A 1O85A 1B48A 5JWRB 5IPHA 3NIVA 2PN8A 1DE1A 3D6IA 4D73A 2J9HA 1YEPA 2LEGA 5D8IA 2DSAA 2PBJA 5DDLA 1EV9A 1X5CA 3VWVA 2VLVA 5INYA 2GT5A 2I81A 4MZBA 3QPMA 4YQMA 1UVZA 4MMMA 2EC4A 3KH9A 3EYTA 2K8SA 2IWTA 3HCZA 4X0XA 3LXZA 4L5LA 2I9HA 5B6NA 4XTSA 3WYWA 3GNJA 2CQ9A 2PPTA 4ECCA 3DVXA 2VL2C 2N5BA 4BA7A 1VGLA 3D0ZA 1KEBA 2HZEB 3C7MA 4N0VA 4OO4A 4OCEA 4KX4A 2R6KA 5AGYA 4PXOA 3C8EA 4GSTA 5BMUA 2V6KA 1AAZA 4HOJA 11GSA 4TR1A 3C71A 4E8EA 2LKUA 3IV4A 3LWAA 1A24A 2B1KA 4I6XA 1SK1A 2LS5A 4O32A 4IQAA 1EEJA 1DSBA 2R37A 2DJ1A 3MDKA 1NM3A 4ZL7A 3Q18A 1V9WA 1K0OA 1EV4A 4POLA 4XCSA 5JWQB 3GMFA 4IS0A 2X99A 3ZREA 4HQSA 2HSMB 3HJMA 1G0TA 1CQGA 1XWKA 1R26A 6GSWA 1JLWA 1GSEA 1DE2A 3IC8A 3R2QA 4LMVA 3TJKA 2G2QA 2OE0A 2C0GA 4RUVA 2D2ZA 2LTKA 1ERUA 4V2MA 2IMEA 4EVMA 2TRXA 4MP4A 1XIYA 4YAPA 1PA3A 4JEDA 2AJQB 4FYBA 3C1RA 3KP9A 2H0HA 4GLTA 4POMA 1ABAA 1W89A 3UEMA 3TJBA 3A2VA 4NHWA 4IGJA 2L4QA 6GSTA 3DEXA 1O7UA 1A0FA 1XW5A 3LXTA 2YNXA 1AC1A 2RUEA 3ZIJA 5IOWA 4TR1B 2CVKA 5J9BA 3APQA 3HKRA 1PN9A 4POKA 2I3YA 2VL2A 2BJXA 1AQVA 3F8UA 4ECJA 1JZDA 3GN3A 2YZHA 3I43A 2FA8A 1TK5B 5ECMB 1WPIA 2XPDA 1V58A 5LCZA 2H6XA 2DIYA 4KAEA 4K2DA 2R3XA 4XRDA 1T00A 4X1UA 5DQYA 4MZCA 1GTAA 4ZB8A 3TKRA 1HNAA 4GQFA 4HQZA 4PGTA 2WJUA 1GSDA 12GSA 3KXOA 4N0ZA 5ECLB 2L5LA 5GAPD 2RM6A 2E0QA 1WJKA 2GSSA 1E2YA 5J4UA 4MK3A 1M0UA 4EC0A 1ERVA 5HFIA 2YOIA 2ES7A 4WKWA 5DBQA 1U88A 2F3MA 2HRFA 3KTBA 3HYPA 19GSA 4LA1A 4G0LA 2KHPA 4EDZA 4GTUA 4EKZA 4LLRA 2N5AA 2C3NA 3CRTA 1WWJA 3APSA 3LEFA 1SK0A 4KH7A 1FB6A 4ZB6A 4ZXGA 1S3AA 2FWHA 1SL0B 4NV2A 2V6OA 1EGOA 2UZ8A 1VF4A 2OE1A 2H6YA 3P2AA 2AAWA 2HI7A 1F37A 4IJ3A 2N5FA 2LUSA 2I1UA 1G6YA 5H5RA 20GSA 5A4WA 4I2UA 4TN8A 4L0WA 3VK9A 1TK8B 1TI1A 1USBA 4NPBA 2RIIA 4BL7A 5CNWA 2NBSA 3CSIA 2VOCA 4DVCA 2GLRA 5F06A 1M99A 1HNBA 2AYTA 4I5QA 3H93A 2P0GA 3VURA 1YKAA 4WXTA 5HR3A 2CT6A 3E0UA 1AQWA 3GFKA 3Q74A 3KP8A 4MH2A 3IPZA 4RI7A 2AHEA 1FVKA 5HR2A 4OFTA 1S3CA 5HQPA 3BCIA 3UVTA 2VCVA 4YAVA 1SL1B 3FRCA 1AXDA 5IMFA 2GZZA 1E6BA 3RHBA 5EVOA 3CTGA 1PX7A 1NSWA 3MNGA 3TRXA 4ZBDA 2O7KA 3PH9A 3IOSA 1ZYEA 2LJRA 2CZ2A 3ZLPA 2C4JA 3IXRA 4POBA 2VCQA 1SD9A 1U3AA 2IJYA 1X9MB 2L57A 1GTBA 1RQMA 2WCIA 1B4QA 1TK0B 1K0AA 4KSOA 2VD0A 1PL1A 3E9JB 3LGCA 4BL7B 5E59A 3M1GA 2FWGA 5D96A 1YZXA 2HYXA 2HRNA 4BPYA 1WMJA 1T3BA 1PKZA 2OBKA 2R5GA 3FZAA 4USSA 4AJ8A 4MZWA 1YQ1A 3EINA 1VF1A 4RQRA 5DJLA 1XWBA 4G10A 3UL3A 4DSSA 4ECBA 4HZ4A 4MH3A 3GRXA 1XOAA 3H1NA 4XHMA 1O73A 3RBTA 3VI7A 4FO5A 5EPFA 4ILFA 3I6AA 4WR5A 3UIWA 1J08A 1URMA 2EIQA 4BVXA 3HHVA 3FZ9A 3IDVA 4MLYA 4MPGA 2B7KA 2F9SA 1AIUA 4PUAA 1I5GA 3CMIA 3DD3A 4KGIA 2HLSA 2OADA 6GSXA 2J23A 3FHKA 1A23A 1TRUA 1OYJA 18GSA 4K9ZA 4PNGA 3RHCA 3BOAA 1PRXA 4K1FA 3TOTA 1BYEA 1BX9A 4WF5A 4K8MA 1GSQA 3VFIA 3P90A 1X0RA 1IYIA 3C73A 4K7IA 1PQNA 3EU4A 5B8BA 3SBCA 3EE2A 4KDUA 1XXUA 1F2EA 2MZCA 3HDCA 4GCIA 3GKMA 5HFGA 3A3TA 1A0RP 2NDOA 4ZILA 1T7PB 1EGRA 2OBIA 2CV4A 3KIJA 4HUAA 2H66A 2DIZA 3W6GA 4GWRA 3NOFA 2C3QA 3TGZA 2R2JA 3TUEA 2V41A 3H79A 5HR1A 1OKDA 4PNFA 5GZZB 2DJ3A 4MABA 2JZRA 4I97A 3H4KA 4HJMA 2X8CA 1OVNA 2H76A 3ZVJD 3WGDA 3EWLA 4EUYA 2HRAA 2JZSA 3APOA 1Z7RA 5KEJA 2GQMA 3DVWA 3D5JA 1OE8A 3DXBA 1N2AA 4TW5A 3VPQA 2LJKA 2LRNA 4MDCA 3UBLA 3ZL5A 3KTLA 2C3TA 2TIRA 3NZNA 1I9DA 2H0GA 4EF0A 1EEMA 3UBKA 1W4VA 1LU4A 2LRTA 2CVDA 2H75A 3ERGA 3TJGA 3JCML 2VUPA 2DLXA 3KMOA 3D4TA 4ACSA 2YN1A 3FK8A 1ILOA 4V1Ap 1UC7A 2CAIA 2K6VA 2JU5A 4NMUA 1JZOA 4CDOA 3HD5A 4IJIA 1V2AA 3QAGA 2JZTA 5GAND 2WB9A 3CBUA 2L6DA 2BTOT 1G6WA 2YZUA 2XBQA 1ERTA 2H1GA 3VI5A 4AF2A 5ECNB 1YDKA 3ERWA 1ON4A 2IMDA 1T4YA 2VM2A 2ON7A 4YQUA 3FZ4A 1GRXA 4DSRA 3FEUA 3C1SA 1XW6A 5G31A 2HT9A 3EURA 1SKRB 2C0DA 3KMNA 3IAM2 5J9CA 5ID2A 2JSYA 4O7HA 1F3BA 5DQSA 1X9SB 3F6FA 2EIOA 4EE0A 5JCUA 3CSHA 3EVIA 1WOUA 17GSA 4NWYA 1A2JA 1WRYA 1MDKA 3UMAA 2WRTA 3H8QA 4D73B 2GS3A 3AY8A 4WEYA 2CZ3A 1IYHA 4IQ1A 4YH2A 3PGTA 4HS1A 5IMCA 4WBJA 1BG5A 1NHOA 22GSA 4TXVA 3KCMA 2VL9A 1SK2A 4KW6A 4TR4A 5ECQB 4OFNA 3F3QA 3ZFBA 2YWMA 3LYPA 3MAKA 1Z6MA 3M9JA 2JL4A 3L9SA 1OAZA 3GX8A 3EMXA 1ZYQB 2KUCA 2HSHA 3WT1A 2JSZA 1PMTA 1GSYA 3UJ1A 2L6CA 3GV1A 3KZQA 1BAYA 2H6ZA 5ENUA 5CRHA 3GYKA 1MD4A 3A2XA 5ID2B 1YY7A 3F4SA 3RAZA 3UOMA 2YJHA 4JR6A 1SYXA 4HU7A 2H19A 4ZL9A 1Z7PA 2BMXA 3G7YA 1G7OA 2LJAA 1GUMA 3IRAA 2GSTA 3P8WA 2LV3A 1JLVA 1ZZYA 1GSSA 2CX3A 1H75A 2VAFA 1VF3A 2IFQA 4J56E 3U5RE 3GSTA 4CW9A 2MYGA 2L4CA 3DYRA 4HU9A 1FVJA 4ULXA 4KDYA 5EL8A 2GQLA 4MPFA 5A4UA 5IO0A 4HDEA 1PX6A 3I9V2 3K8NA 5G5FA 4F0BA 4F82A 4NV5A 5D73A 3L9UA 1A2MA 2ZUPA 4GXZA 3GX0A 2E2MA 3O3TA 2C0EA 1UN2A 5CRGA 16GSA 3TKPA 2FD3A 2XPEA 1H4OA 1AUCA 4ECIA 3DGQA 1YEXA 2G0FA 1A2LA 3QD9A 2B1LA 4BWQA 5G30A 1FHEA 4JRRA 2P31A 2PWJA 4ZB9A 4HZ2A 2FA4A 2H01A 2ZNMA 1K3YA 3PR8A 1GULA 1Q98A 2MBSA 4KDXA 3CSJA 1OC3A 5IM9A 1MTCA 2NPBA 3CYNA 5G1LA 1LJRA 2ALBA 2V1MA 4MF5A 4FIWA 2YCDA 4TR3A 4LL4B 4OMVA 1CQHA 3TDGA 1TP9A 1J0FA 2MMZA 1PKWA 1S3DA 2IIYA 4OD7A 4HEA2 3MSZA 3US3A 3TOUA 1HD2A 3GURA 2FWEA 1RW1A 5H5QA 1F6MC 3DIEA 2DJJA 4O92A 2GSRA 1ZMAA 5F0GA 3ZMLA 1PL2A 3VWXA 2ZCTA 4NXIA 2ON5A 3GHAA 4ZL8A 5DCHA 4MA9A 2WGRA 2E2GA 1TKDB 2OACA 1GNWA 2HNLA 4JU5A 3ZTLA 4GSSA 2RLIA 2RUFA 1ERWA 3ZVJA 1U3IA 1QQ2A 4TVEA 1YJ6A 10GSA 4ML6A 4E8HA 5ECKB 1XVQA 2PVOC 1YF0A 3L9VA 4G0KA 3KD0A 5G5EA 1VF2A 2FLSA 2FCHA 4PURA 3G9BA 2WS2A 1SL2B 3TCOA 3F4RA 4H86A 2KP2A 2OJLA 1XWGA 3ZIVA 5KN2A 1A8YA 1B9XC 3WGEA 3FW2A 2PERA 5IOXA 5B7CA 1NW2A 4WETA 2YV9A 3WD6A 2E7PA 1GNEA 2DMMA 5AIVA 2YP6A 1R4WA 2FHEA 3TRQA 3GUSA 2PGTA 1TJDA 3I69A 3FR6A 4OCFA 3N9JA 3PPUA 3LG6A 3F0IA 1EP7A 4JR4A 4KB3A 2H1BA 1K0DA 5D9VA 1K0BA 2XBIA 1JHBA 1TRSA 1JZWA 3GL3A 1Z9HA 1B8XA 2NVLA 3RPPA 3F6DA 2K18A 3EU3A 2C0FA 3TKSC 2H73A 2DMLA 1QK8A 1FG4A 3DMLA 3UARA 1F3AA 1TTZA 2LRCA 6GSSA 1TU8A 3FYGA 5ELGA 4Q5FA 1SYRA 1G7EA 4WR4A 5J5NA 3A2WA 2HZFA 1K0CA 2M46A 1LBKA 2H70A 3QCPA 3FY7A 1K0NA 4ID0A 1M2AA 2H72A 1PSQA 4XS6A 4GF0A 5L71A 4DEJA 4I8BA 5GSTA 2FNOA 3ZFLA 2GGTA 2H71A 1C72A 5D93A 1U87A 2IPAA 3TB2A 1SKSB 3GTUA 4PQ1A 1TU7A 4G2EA 1SJZA 6GSUA 3DWVA 1EOGA 2WFCA 2O85A 5ELAA 2V32A 2JADA 2IMFA 4MJBA 3D22A 5G2ZA 5G1KA 4DSSB 1TI3A 5ECHB 2A2RA 1TDIA 1V57A 4K7OA 4KSMA 1Z5YE 4IHUA 3DRNA 2OE3A 1GL8A 5D9WA 2B3SA 3L78A 1BQ7A 2HSNB 3WT2A 1QXHA 3IAS2 2H1DA 4BVXB 3ZZXA 5LNKe 1QGVA 3IK9A 1UA5A 2JACA 5COHA 4PQIA 1B4PA 5DVBA 2MMAA 2TRCP 4EDYA 4XRAA 5C04A 5JWOB 3IHQA 3VPTA 1M2BA 2C1YA 4P3YB 1AW9A 3ZITA 4V2LA 1YF1A 3EMPA 1QUWA 4EO3A 3LORA 3N5OA 4MF6A 1RK4A 1Z6NA 1ZL9A 4ML1A 1T8EB 5FHIA 2PUKC 2IMKA 3HZ8A 2PMTA 1O6JA 2A2SA 2GVPA 4IW9A 1EWXA 3TKQA 4O5RA 3GTUB 4K6XA 4ZBBA 2C80A 2K8VA 5IMDA 3ZRDA 6GSYA 3QAVA 1KTEA 5D9XA 2MMOA 2VCZA 1XVWA 2YV7A 4MF7A 1TXXA 2DC5A 2HSMA 1K0MA 3IA1A 4HJ2A 1HYUA 5JCWA 2X8GA 4KCAA 4G0IA 3F63A 4Q5RA 1THOA 5J3RA 1XCCA 3D4MA 4PTSA 2OKAA 1O81A 5KN0A 4RQXA 1GP1A 2X8HA 4Z7XA 1SD8A 2L59A 1MDJA 5IMZA 14GSA 5DAKA 4AJ6A 4MJCA 1EOHA 1T4ZA 3Q19A 5C00A 3LQ7A 3O6TA 7GSSA 4JE1A 1WE0A 4XS1A 4IKHA 1OKTA 2CVBA 1O8WA 3D21A 3UAPA 3KH7A 3ME8A 1JFUA 1PD21 2MBTA 5JCGA 3GKXA 2CAQA 4I2TA 4WBRD 3G7JA 4KA0A 2VLUA 3IK7A 3VWWA 1XWAA 3A5WA 4L8EA 1M7TA 1BJXA 4KCEA 4TKYA 2H74A 4J2FA 1GSUA 2PVQA 1XFLA 4Q5QA 3W8JA 2IN3A 2PU9C 5AISA 2GT6A 3G7IA 2YWOA 4PUFC 2RM5A 3IC4A 4WF4A 2YWNA 5IMVA 1Y6EA 4DSQA 2REMA 2VCWA 1XZOA 2M72A 2YWIA 5DALA 1XPVA 2VO4A 1ACVA 2O8VB 4KF9A 4EL1A 2HRKA 3SWLA 1X5EA 2K9FA 3M9KA 4G9HA 5HFKA 5DAKB 1GTIA 3FZ5A 1V98A 4FYUA 4CHSA 6GSVA 2HXKA 3ISOA 2H30A 5CREA 3IR4A 3GH6A 2P5QA 1R5AA 1ZOFA 3FR3A 2KOKA 2IL3A 3TJJA 5ECOB 4LMWA 4K0NA 1HQOA 4QL7A 3TKSE 2GSQA 2QC7A 3VWUA 2B5YA 4Q5NA 4GSNA 4FQUA 4OFMA 2KLXA 4X43A 4EXJA 2B5EA 2DJKA 1Y25A 3M0FA 1DBYA 2V2GA 2YPMA 5A4VA 2CX4A 4XS4A 5DCGA 3MWHA 4PX1A 1X9WB 1Z3EA 4F9ZA 8GSSA 1NHYA 5B8AA 2HE3A 1TW9A 4IELA 2QGVA 5FWGA 2H1AA 2VM1A 5DALB 2VLTA 3CRUA 1R5PA 2HRKB 3ME7A 3GKNA 5AIXA 4KE3A 4PQHA 1KNGA 3LSZA 2H8LA 1DUGA 3OR5A 1FO5A 2CA8A 5B6MA 5AN1A 1XBSA 1K3LA 5J41A 3GIXA 1OC9A 3V1WA 1MD3A 2HQTA 3BBYA 4NHZA 2A4VA 3CTFA 2FUG2 5ECPB 3PINA 2L5OA 4GQCA 4J57E 4OO5A 1SKWB 5CYYA 3P7XA 2IFQB 1WIKA 4BVYA 3J7Yk 1XW9A 13GSA 5CRWA 2M80A 5IIZA 3QFBC 4BWSA 3FR9A 2GDRA 4V1Ag 3GKKA 3F9UA 2F51A 3U6VA 1U6TA 5A5KA 3S9FA 1R7HA 3W8SA 2HFDA 3L4NA 4QQ7A 4XS4B 3BJ5A 2YANA 2AV4A 2WULA 3ZYWA 1M9BA 9GSSA 4ISDA 2O87A 1A8LA 2IMIA 3RDWA 3J7Yb 2FWFA 3IBHA 3QMXA 5ECIB 4ZIJA 5CAXA 2XHFA 5CP1A 4TR0A 3TRPA 2B5XA 5KN3A
chains in the Genus database with same CATH superfamily
1K3OA 3VLNA 1F9MA 4IP1A 5IO2A 4MJEA 4ZBAA 3M3MA 5CRDA 3HJOA 1V40A 4HI7A 1GLPA 1SENA 1OC9B 2O89A 4CY8A 3HVXA 2C8UA 1THXA 2B7JA 2MMNA 2WZ9A 3RPNA 3QOUA 4TRXA 2VCTA 3ED3A 4ZB7A 4F03A 1X5DA 4TXOA 2YJ7A 4FH8A 3EC3A 4O5UA 4BVYB 5GSSA 3O76A 4NAXA 1SJIA 1WP0A 2GQKA 2H0IA 1SVLA 3L0HA 4N10A 4AJ7A 4FYCA 3LFLA 2GZYA 5EY6A 3ZMKA 3BCKA 1ML6A 4MJAA 4AGSA 3GSSA 5ECRB 2VL3A 5ECSA 1GH2A 1GTUA 1QFNA 3HXSA 2VCXA 1ZGNA 1QMVA 4TOPA 1TRWA 2QA1A 4MCUA 3E3EA 1AQXA 5DJMA 2HSYA 3KGKA 2LSTA 2WVXB 2NTOA 3HVSA 1ZCPA 3CXGA 5IQYA 4IP6A 4OWYA 2AB6A 5FT3A 1GWCA 2VD1A 2DBCA 2R4VA 5E4WA 3TJFA 2KP1A 1B9YC 5CO3A 2OA7A 2GZPA 4QL9A 3KJYA 3LYKA 2P5RA 4IN0A 1J9BA 1TRVA 2XC2A 4KUNA 1M9AA 2I4AA 3KM6A 4KNDA 1GSFA 1HNCA 1T1VA 3WGXA 5D9TA 5H5SA 3UVHA 4YKGA 3BD2A 4TXOB 2DJ0A 1VRSD 4GRFA 3QFAC 2QSIA 2LNTA 3HY2A 3GA4A 2DJ2A 1N8JA 2B6MA 3HZ4A 3QR6A 4XIHA 1TOFA 4X4JA 2X64A 3KEBA 3HA9A 2FGXA 1EZKA 4L5OA 2LQQA 4HSCX 2VIMA 4JZQA 1MDIA 3LJRA 4IVFA 4YQVA 2FY6A 1O8XA 1JZRA 1KBNA 2WDUA 3F4TA 3MIXA 5KOXA 4LL1B 1GUHA 5IMAA 1SJ6A 1ST9A 5F8BA 4GDFA 3Q6OA 1PGTA 1FB0A 1GUKA 4K0GA 2LQOA 4IBPA 1XOBA 4RI6A 2AUVA 5F07A 3F3RA 3DKSA 4N11A 4K7NA 2Z9SA 1FAAA 2GTUA 3HVVA 4F0CA 3IE3A 1FW1A 1M2DA 4V2NA 3M8NA 1SU9A 4L0UA 1BEDA 5KN1A 4EIQA 2HZEA 1XWCA 5F05A 1YKCA 1Q4JA 3ERFA 4AKHA 3GH9A 1OC8A 4F2IA 3R3EA 3QDNA 3FKFA 3IHGA 5ABRA 4G19A 5IPGA 3HJPA 2F8AA 1GLQA 2EIRA 5HR0A 2QKEA 2LNSA 1OE7A 1N25A 3TKSA 4JBBA 3GL5A 2F8FA 4K5RA 5LD0A 1MEKA 4N30A 1FOVA 3QAWA 1EP8A 1O85A 1B48A 5JWRB 5IPHA 2WZSA 3NIVA 2PN8A 1DE1A 3D6IA 4D73A 2J9HA 1YEPA 2LEGA 5D8IA 2DSAA 2PBJA 5DDLA 1EV9A 1X5CA 3VWVA 2VLVA 5INYA 2GT5A 2I81A 4MZBA 3QPMA 4YQMA 1UVZA 4MMMA 2EC4A 3KH9A 3EYTA 2K8SA 2IWTA 3HCZA 4X0XA 3LXZA 4L5LA 2I9HA 5B6NA 4XTSA 3WYWA 3GNJA 2CQ9A 2PPTA 1YEWC 2WW0A 4ECCA 3DVXA 2VL2C 2N5BA 4BA7A 1VGLA 3D0ZA 1KEBA 2HZEB 3C7MA 4N0VA 4OO4A 4OCEA 4KX4A 2R6KA 5AGYA 4PXOA 3C8EA 4GSTA 5BMUA 2V6KA 4A5PA 1AAZA 2EFHA 4HOJA 11GSA 4TR1A 3C71A 4E8EA 2LKUA 3IV4A 3LWAA 1A24A 2B1KA 2OT3A 4I6XA 1SK1A 1YVLA 2LS5A 4O32A 5A1NB 4IQAA 1EEJA 1DSBA 2R37A 2DJ1A 3MDKA 1NM3A 4ZL7A 3Q18A 1V9WA 1K0OA 1EV4A 4POLA 4XCSA 5JWQB 3GMFA 4IS0A 2X99A 3ZREA 4HQSA 2HSMB 3HJMA 1G0TA 1CQGA 2X49A 1XWKA 1R26A 6GSWA 1JLWA 1GSEA 1DE2A 3IC8A 3R2QA 4LMVA 3TJKA 2G2QA 2OE0A 2C0GA 4K5SA 4RUVA 2D2ZA 2LTKA 1ERUA 4V2MA 2IMEA 4EVMA 4AKXB 2TRXA 4MP4A 4Z2TA 1XIYA 4YAPA 1PA3A 4JEDA 1ZYNA 2AJQB 4FYBA 3C1RA 3KP9A 2H0HA 4GLTA 4POMA 1ABAA 1W89A 3UEMA 3TJBA 3A2VA 4NHWA 4IGJA 2L4QA 6GSTA 3DEXA 1O7UA 1A0FA 1XW5A 3LXTA 2YNXA 1AC1A 2RUEA 3ZIJA 5IOWA 4TR1B 2CVKA 5J9BA 3APQA 3HKRA 1PN9A 4POKA 2I3YA 2VL2A 2BJXA 1AQVA 3F8UA 4ECJA 1JZDA 3GN3A 2YZHA 3I43A 2FA8A 1TK5B 5ECMB 1WPIA 2XPDA 1V58A 5LCZA 2H1LA 2H6XA 2DIYA 4KAEA 4K2DA 2R3XA 4XRDA 1T00A 4X1UA 3TU3B 5DQYA 4MZCA 1GTAA 4ZB8A 3TKRA 1HNAA 4GQFA 4HQZA 4PGTA 2WJUA 1GSDA 12GSA 3KXOA 4N0ZA 5ECLB 2L5LA 5GAPD 2RM6A 2E0QA 1WJKA 2GSSA 1E2YA 5J4UA 4MK3A 1M0UA 4EC0A 1ERVA 5HFIA 4MNNA 5A5HA 2YOIA 2ES7A 4WKWA 5DBQA 1U88A 2F3MA 2HRFA 3KTBA 1BG1A 3HYPA 19GSA 4LA1A 4G0LA 3CWGA 2KHPA 4EDZA 4GTUA 5KOWA 4EKZA 4LLRA 4FXYP 2C3NA 2N5AA 3CRTA 1WWJA 3APSA 3LEFA 1SK0A 4KH7A 1FB6A 4ZB6A 4ZXGA 1S3AA 2FWHA 5A34B 1SL0B 4QMKA 4NV2A 2EFCA 2V6OA 1EGOA 2UZ8A 1VF4A 2OE1A 2H6YA 3P2AA 2AAWA 2HI7A 1F37A 4IJ3A 2N5FA 2LUSA 2I1UA 1G6YA 5H5RA 20GSA 5A4WA 4I2UA 4TN8A 4L0WA 3VK9A 1TK8B 3HVNA 1I1IP 1TI1A 1USBA 4NPBA 2RIIA 4BL7A 5CNWA 2NBSA 3CSIA 2VOCA 4DVCA 2GLRA 4PI2C 5F06A 1M99A 1HNBA 2AYTA 4I5QA 4AKIA 3H93A 2P0GA 3VURA 1YKAA 4WXTA 5HR3A 2CT6A 3E0UA 1AQWA 5A5HB 5BRTA 3GFKA 3Q74A 3KP8A 4MH2A 3IPZA 4RI7A 2AHEA 1FVKA 5HR2A 4OFTA 1S3CA 5HQPA 3BCIA 3UVTA 2VCVA 4YAVA 1SL1B 3FRCA 1AXDA 5IMFA 2GZZA 1E6BA 3RHBA 5EVOA 3CTGA 1PX7A 1NSWA 3MNGA 3TRXA 4ZBDA 2O7KA 3PH9A 3IOSA 1ZYEA 2LJRA 2CZ2A 3ZLPA 2C4JA 3IXRA 4POBA 2VCQA 1SD9A 1U3AA 2IJYA 1X9MB 2L57A 1GTBA 1RQMA 2WCIA 1B4QA 1TK0B 1K0AA 4KSOA 2VD0A 1PL1A 3E9JB 3LGCA 4BL7B 5E59A 3M1GA 3CQFA 2FWGA 5D96A 2A2PA 1YZXA 2HYXA 2HRNA 4BPYA 1WMJA 1T3BA 1PKZA 2OBKA 2R5GA 3FZAA 4USSA 3HMJG 4AJ8A 4MZWA 1YQ1A 3EINA 1SVOA 1VF1A 4RQRA 5DJLA 1XWBA 4G10A 3UL3A 5J40A 4DSSA 4ECBA 4HZ4A 4MH3A 3GRXA 1XOAA 3H1NA 4XHMA 1O73A 3RBTA 3VI7A 4FO5A 5EPFA 3MYDA 4ILFA 3I6AA 4WR5A 3UIWA 1J08A 1URMA 2EIQA 4BVXA 4AKGA 3HHVA 3FZ9A 3IDVA 4MLYA 4MPGA 2B7KA 2F9SA 1AIUA 4PUAA 1I5GA 3CMIA 3DD3A 4KGIA 2HLSA 2OADA 6GSXA 2J23A 3FHKA 1A23A 1TRUA 1OYJA 18GSA 4K9ZA 4PNGA 3RHCA 3BOAA 1PRXA 4K1FA 3TOTA 1BYEA 1BX9A 4WF5A 4K8MA 1GSQA 3VFIA 3P90A 1X0RA 1IYIA 3C73A 4K7IA 1PQNA 3EU4A 5B8BA 3SBCA 3EE2A 4KDUA 1XXUA 1F2EA 2MZCA 3HDCA 4GCIA 3GKMA 5HFGA 3A3TA 1A0RP 2NDOA 4ZILA 4N3ZA 1T7PB 2OBIA 2CV4A 1EGRA 3KIJA 4HUAA 2H66A 2DIZA 3W6GA 4GWRA 3NOFA 2C3QA 3TGZA 2R2JA 3TUEA 2V41A 3H79A 5HR1A 1OKDA 4PNFA 5GZZB 2DJ3A 4MABA 2JZRA 4I97A 3H4KA 4HJMA 2X8CA 1OVNA 2H76A 3ZVJD 3WGDA 3EWLA 4EUYA 2HRAA 2JZSA 3APOA 1Z7RA 5KEJA 2GQMA 3DVWA 3D5JA 1OE8A 3DXBA 1N2AA 4TW5A 3VPQA 2LJKA 2LRNA 4MDCA 3RFRC 3EPTA 3UBLA 3ZL5A 3KTLA 2C3TA 2TIRA 3NZNA 1SVMA 1I9DA 2H0GA 4EF0A 1EEMA 3UBKA 1W4VA 1LU4A 2LRTA 2CVDA 2H75A 3ERGA 3TJGA 3JCML 4Z2RA 4K2XA 2VUPA 2DLXA 3KMOA 4PHZC 3D4TA 4ACSA 2YN1A 3FK8A 1ILOA 4V1Ap 1UC7A 2CAIA 2K6VA 2JU5A 4NMUA 1JZOA 4CDOA 2WVYA 3HD5A 4IJIA 1V2AA 2JZTA 3QAGA 5GAND 2WB9A 3CBUA 2L6DA 2BTOT 1G6WA 2YZUA 2XBQA 1ERTA 2H1GA 3VI5A 4AF2A 5ECNB 1YDKA 3ERWA 1ON4A 2IMDA 1T4YA 2VM2A 2ON7A 4YQUA 3FZ4A 1GRXA 4DSRA 3FEUA 3C1SA 1XW6A 1M3IA 5G31A 2HT9A 3EURA 1SKRB 2C0DA 4W66A 3KMNA 3IAM2 5J9CA 5ID2A 2JSYA 4O7HA 1F3BA 5DQSA 1X9SB 3F6FA 2EIOA 4EE0A 5JCUA 3CSHA 3EVIA 1WOUA 17GSA 4G01A 4NWYA 1A2JA 1WRYA 1MDKA 3UMAA 2WRTA 3H8QA 4D73B 2GS3A 3AY8A 4WEYA 2CZ3A 1IYHA 4IQ1A 5J47A 4YH2A 3PGTA 4HS1A 5IMCA 4WBJA 1BG5A 1NHOA 22GSA 4TXVA 3KCMA 2VL9A 1SK2A 2DKHA 4KW6A 4TR4A 5ECQB 4OFNA 3F3QA 3ZFBA 2YWMA 3LYPA 3MAKA 1Z6MA 3M9JA 2JL4A 3L9SA 1OAZA 3GX8A 3EMXA 1ZYQB 2QA2A 5J4YA 2KUCA 2HSHA 3WT1A 2JSZA 1PMTA 1GSYA 3UJ1A 2L6CA 2EFDA 3GV1A 3KZQA 1BAYA 2H6ZA 5ENUA 5CRHA 3GYKA 1MD4A 5BMUB 3A2XA 5ID2B 1YY7A 3F4SA 3RAZA 3UOMA 2YJHA 4JR6A 1SYXA 4HU7A 2H19A 4ZL9A 1Z7PA 2BMXA 3G7YA 1G7OA 2LJAA 1GUMA 3IRAA 2GSTA 3P8WA 2LV3A 1JLVA 1ZZYA 1GSSA 2CX3A 1H75A 2VAFA 1VF3A 2IFQA 4J56E 3U5RE 3GSTA 4CW9A 2MYGA 2L4CA 3DYRA 4HU9A 1FVJA 2O36A 4ULXA 2O5VA 4KDYA 5EL8A 2GQLA 4MPFA 5A4UA 5IO0A 4HDEA 1PX6A 3I9V2 3K8NA 5G5FA 4F0BA 1PFOA 4F82A 4NV5A 5D73A 3L9UA 1A2MA 2ZUPA 4GXZA 3GX0A 2E2MA 3O3TA 2C0EA 1UN2A 5CRGA 16GSA 3TKPA 2FD3A 2XPEA 1H4OA 1AUCA 4ECIA 3DGQA 1YEXA 2G0FA 1A2LA 3QD9A 2B1LA 4BWQA 5G30A 1FHEA 4JRRA 2P31A 2PWJA 4ZB9A 4HZ2A 2FA4A 2H01A 2ZNMA 1K3YA 3PR8A 1GULA 1Q98A 2MBSA 4KDXA 3CSJA 1OC3A 2EFEA 5IM9A 1MTCA 2NPBA 3CYNA 5G1LA 1LJRA 2ALBA 2V1MA 4MF5A 4FIWA 2YCDA 4TR3A 4LL4B 4OMVA 1CQHA 3TDGA 1TP9A 1J0FA 2MMZA 1PKWA 1S3DA 2IIYA 4OD7A 4HEA2 3MSZA 3US3A 3TOUA 1HD2A 3GURA 2FWEA 1RW1A 5H5QA 1F6MC 3LW9A 3DIEA 2DJJA 3RGBC 2WW3A 4O92A 2GSRA 1ZMAA 5F0GA 3ZMLA 1PL2A 3VWXA 2ZCTA 4NXIA 2ON5A 3GHAA 4ZL8A 5DCHA 4MA9A 2WGRA 2E2GA 1TKDB 2OACA 1GNWA 2HNLA 4JU5A 3ZTLA 4GSSA 2RLIA 2RUFA 1ERWA 3ZVJA 1U3IA 1QQ2A 4TVEA 1YJ6A 10GSA 4ML6A 4E8HA 5ECKB 1XVQA 2PVOC 1YF0A 3L9VA 4G0KA 3KD0A 5G5EA 1VF2A 2FLSA 4YKFA 2R0GA 2FCHA 4PURA 3G9BA 2WS2A 1SL2B 3TCOA 3F4RA 4H86A 2KP2A 2OJLA 1XWGA 3ZIVA 5KN2A 1A8YA 1B9XC 3WGEA 3FW2A 2PERA 5IOXA 5B7CA 1NW2A 4WETA 2YV9A 3WD6A 2E7PA 1GNEA 2DMMA 5AIVA 2YP6A 1R4WA 2FHEA 3TRQA 3GUSA 2PGTA 1TJDA 3I69A 3FR6A 4OCFA 3N9JA 3PPUA 3LG6A 3F0IA 1EP7A 4JR4A 4KB3A 2H1BA 1K0DA 5D9VA 4EIPA 1K0BA 2XBIA 1JHBA 1TRSA 1JZWA 3GL3A 1Z9HA 1B8XA 2NVLA 3RPPA 3F6DA 2K18A 2HSNA 3EU3A 2C0FA 3TKSC 2H73A 2DMLA 1QK8A 1FG4A 3DMLA 3UARA 1F3AA 1TTZA 2LRCA 6GSSA 1TU8A 3FYGA 5ELGA 4Q5FA 1SYRA 1G7EA 4WR4A 3A2WA 5J5NA 2HZFA 1K0CA 2M46A 1LBKA 2H70A 3QCPA 3FY7A 1K0NA 4ID0A 1M2AA 2H72A 1PSQA 1S3RA 4XS6A 4GF0A 5L71A 4DEJA 4I8BA 5GSTA 2FNOA 3ZFLA 1TXUA 2GGTA 2H71A 1C72A 1BF5A 5D93A 1U87A 2IPAA 3TB2A 1SKSB 3GTUA 4PQ1A 1TU7A 4G2EA 2R0CA 1SJZA 6GSUA 3DWVA 1EOGA 2WFCA 2O85A 5ELAA 2V32A 2JADA 2IMFA 4MJBA 3D22A 5G2ZA 5G1KA 4DSSB 1TI3A 5ECHB 2A2RA 1TDIA 1V57A 4K7OA 4KSMA 1Z5YE 4IHUA 3DRNA 2OE3A 1GL8A 5D9WA 2B3SA 3L78A 1BQ7A 2X4AA 2HSNB 3WT2A 1QXHA 3IAS2 2H1DA 4BVXB 3ZZXA 5LNKe 1QGVA 3IK9A 1UA5A 2JACA 5COHA 4PQIA 1B4PA 2A4HA 5DVBA 2MMAA 2TRCP 3A5IA 4EDYA 4XRAA 5C04A 5JWOB 3IHQA 3VPTA 1M2BA 2C1YA 2WW1A 4P3YB 1AW9A 3ZITA 4V2LA 1YF1A 3EMPA 1QUWA 4EO3A 3LORA 3N5OA 4MF6A 1RK4A 1Z6NA 1ZL9A 1FOHA 4ML1A 1T8EB 5FHIA 2PUKC 2IMKA 3HZ8A 2PMTA 1O6JA 2A2SA 2GVPA 4IW9A 1EWXA 3TKQA 4O5RA 3GTUB 4K6XA 5A1NA 4O5QA 4PI0C 4ZBBA 2C80A 2K8VA 5IMDA 3ZRDA 6GSYA 3QAVA 1KTEA 5D9XA 2MMOA 2VCZA 2WVZA 1XVWA 2YV7A 4MF7A 1TXXA 2DC5A 2DKIA 2HSMA 1K0MA 3IA1A 4HJ2A 1HYUA 5JCWA 2X8GA 4KCAA 4G0IA 3F63A 4Q5RA 1THOA 5J3RA 1XCCA 3D4MA 4PTSA 4AI6A 2OKAA 1O81A 5KN0A 4RQXA 1GP1A 2X8HA 4Z7XA 1SD8A 2L59A 1MDJA 5IMZA 14GSA 5DAKA 4AJ6A 4MJCA 1EOHA 1T4ZA 3Q19A 4E68A 5C00A 3LQ7A 3O6TA 7GSSA 4JE1A 1WE0A 4XS1A 4IKHA 1OKTA 2CVBA 1O8WA 3CHXC 1PN0A 3D21A 3UAPA 3KH7A 3ME8A 1M3JA 1JFUA 1PD21 2MBTA 5JCGA 4CY6A 3GKXA 2CAQA 4I2TA 4WBRD 3G7JA 4KA0A 2VLUA 3IK7A 3VWWA 1XWAA 3A5WA 2VKZG 4L8EA 1M7TA 1BJXA 4KCEA 4TKYA 2H74A 4J2FA 1GSUA 2PVQA 1XFLA 4Q5QA 3W8JA 2IN3A 2PU9C 5AISA 2GT6A 5J4VA 3G7IA 2YWOA 4PUFC 2RM5A 3IC4A 4WF4A 2YWNA 5IMVA 1Y6EA 1XG8A 4DSQA 2REMA 2VCWA 1XZOA 2M72A 2YWIA 5DALA 1XPVA 2VO4A 1ACVA 2O8VB 4KF9A 4EL1A 2HRKA 3SWLA 1X5EA 2K9FA 3M9KA 4G9HA 1S4BP 5HFKA 5DAKB 1GTIA 3FZ5A 1V98A 4FYUA 4CHSA 6GSVA 2HXKA 4ICYA 3ISOA 2H30A 5CREA 3IR4A 3GH6A 2P5QA 1R5AA 1ZOFA 3FR3A 2KOKA 2IL3A 3TJJA 5ECOB 4LMWA 4K0NA 1ZYPA 1HQOA 4QL7A 3TKSE 5A34A 2GSQA 2QC7A 3VWUA 2B5YA 4Q5NA 4GSNA 4FQUA 4OFMA 2KLXA 4X43A 4EXJA 2B5EA 2DJKA 1Y25A 3M0FA 1DBYA 2V2GA 2YPMA 5A4VA 2CX4A 4XS4A 4BIKA 5DCGA 3MWHA 4PX1A 3FMWA 4Z2UA 1X9WB 1Z3EA 4F9ZA 8GSSA 1NHYA 5B8AA 2HE3A 1TW9A 4IELA 2QGVA 5FWGA 2H1AA 2VM1A 5DALB 2VLTA 3CRUA 1R5PA 2HRKB 3ME7A 3GKNA 5AIXA 4KE3A 4PQHA 1KNGA 3LSZA 2H8LA 1DUGA 3OR5A 1FO5A 2CA8A 5B6MA 5AN1A 1XBSA 1K3LA 5J41A 3GIXA 1OC9A 3V1WA 1MD3A 2HQTA 3BBYA 4NHZA 2A4VA 3CTFA 2FUG2 5ECPB 3PINA 2L5OA 4GQCA 4J57E 4OO5A 1SKWB 5CYYA 3P7XA 2IFQB 1WIKA 4BVYA 3J7Yk 1XW9A 13GSA 5CRWA 2M80A 5IIZA 2O3EA 3QFBC 4BWSA 3FR9A 2GDRA 4V1Ag 3GKKA 3F9UA 2F51A 3U6VA 1U6TA 2R0PA 5A5KA 3S9FA 1R7HA 2WW2A 3W8SA 2HFDA 3L4NA 1Y1UA 4QQ7A 4XS4B 3BJ5A 2YANA 2AV4A 2WULA 3ZYWA 1M9BA 9GSSA 4ISDA 2O87A 1A8LA 2IMIA 3RDWA 3J7Yb 2FWFA 3IBHA 3QMXA 5ECIB 4ZIJA 2WVXA 5CAXA 2XHFA 5CP1A 4TR0A 3TRPA 2B5XA 5KN3A 2UV8G
chains in the Genus database with same CATH topology
1K3OA 3VLNA 1F9MA 4IP1A 5IO2A 4MJEA 4ZBAA 3M3MA 5CRDA 3HJOA 1V40A 4HI7A 1GLPA 1SENA 1OC9B 2O89A 4CY8A 3HVXA 2C8UA 1THXA 2B7JA 2MMNA 2WZ9A 3RPNA 3QOUA 4TRXA 2VCTA 3ED3A 4ZB7A 4F03A 1X5DA 4TXOA 2YJ7A 4FH8A 3EC3A 4O5UA 4BVYB 5GSSA 3O76A 4NAXA 1SJIA 1WP0A 2GQKA 2H0IA 1SVLA 3L0HA 4N10A 4AJ7A 4FYCA 3LFLA 2GZYA 5EY6A 3ZMKA 3BCKA 1ML6A 4MJAA 4AGSA 3GSSA 5ECRB 2VL3A 5ECSA 1GH2A 1GTUA 1QFNA 3HXSA 2VCXA 1ZGNA 1QMVA 4TOPA 1TRWA 2QA1A 4MCUA 3E3EA 1AQXA 5DJMA 2HSYA 3KGKA 2LSTA 2NTOA 3HVSA 1ZCPA 3CXGA 5IQYA 4IP6A 4OWYA 2AB6A 5FT3A 1GWCA 2VD1A 2DBCA 2R4VA 5E4WA 3TJFA 2KP1A 1B9YC 5CO3A 2OA7A 2GZPA 4QL9A 3KJYA 3LYKA 2P5RA 4IN0A 1J9BA 1TRVA 2XC2A 4KUNA 1M9AA 2I4AA 3KM6A 4KNDA 1GSFA 1HNCA 1T1VA 3WGXA 5D9TA 5H5SA 3UVHA 4YKGA 3BD2A 4TXOB 2DJ0A 1VRSD 4GRFA 3QFAC 2QSIA 2LNTA 3HY2A 3GA4A 2DJ2A 1N8JA 2B6MA 3HZ4A 3QR6A 4XIHA 1TOFA 4X4JA 2X64A 3KEBA 3HA9A 2FGXA 1EZKA 4L5OA 2LQQA 2VIMA 4JZQA 1MDIA 3LJRA 4IVFA 4YQVA 2FY6A 1O8XA 1JZRA 1KBNA 2WDUA 3F4TA 3MIXA 5KOXA 4LL1B 1GUHA 5IMAA 1SJ6A 1ST9A 5F8BA 4GDFA 3Q6OA 1PGTA 1FB0A 1GUKA 4K0GA 2LQOA 4IBPA 1XOBA 4RI6A 2AUVA 5F07A 3F3RA 3DKSA 4N11A 4K7NA 2Z9SA 1FAAA 2GTUA 3HVVA 4F0CA 3IE3A 1FW1A 1M2DA 4V2NA 3M8NA 1SU9A 4L0UA 1BEDA 5KN1A 4EIQA 2HZEA 1XWCA 5F05A 1YKCA 1Q4JA 3ERFA 4AKHA 3GH9A 1OC8A 4F2IA 3R3EA 3QDNA 3FKFA 3IHGA 5ABRA 4G19A 5IPGA 3HJPA 2F8AA 1GLQA 2EIRA 5HR0A 2QKEA 2LNSA 1OE7A 1N25A 3TKSA 4JBBA 3GL5A 2F8FA 4K5RA 5LD0A 1MEKA 4N30A 1FOVA 3QAWA 1EP8A 1O85A 1B48A 5JWRB 5IPHA 3NIVA 2PN8A 1DE1A 3D6IA 4D73A 2J9HA 1YEPA 2LEGA 5D8IA 2DSAA 2PBJA 5DDLA 1EV9A 1X5CA 3VWVA 2VLVA 5INYA 2GT5A 2I81A 4MZBA 3QPMA 4YQMA 1UVZA 4MMMA 2EC4A 3KH9A 3EYTA 2K8SA 2IWTA 3HCZA 4X0XA 3LXZA 4L5LA 2I9HA 5B6NA 4XTSA 3WYWA 3GNJA 2CQ9A 2PPTA 4ECCA 3DVXA 2VL2C 2N5BA 4BA7A 1VGLA 3D0ZA 1KEBA 2HZEB 3C7MA 4N0VA 4OO4A 4OCEA 4KX4A 2R6KA 5AGYA 4PXOA 3C8EA 4GSTA 5BMUA 2V6KA 4A5PA 1AAZA 2EFHA 4HOJA 11GSA 4TR1A 3C71A 4E8EA 2LKUA 3IV4A 3LWAA 1A24A 2B1KA 2OT3A 4I6XA 1SK1A 1YVLA 2LS5A 4O32A 5A1NB 4IQAA 1EEJA 1DSBA 2R37A 2DJ1A 3MDKA 1NM3A 4ZL7A 3Q18A 1V9WA 1K0OA 1EV4A 4POLA 4XCSA 5JWQB 3GMFA 4IS0A 2X99A 3ZREA 4HQSA 2HSMB 3HJMA 1G0TA 1CQGA 2X49A 1XWKA 1R26A 6GSWA 1JLWA 1GSEA 1DE2A 3IC8A 3R2QA 4LMVA 3TJKA 2G2QA 2OE0A 2C0GA 4K5SA 4RUVA 2D2ZA 2LTKA 1ERUA 4V2MA 2IMEA 4EVMA 4AKXB 2TRXA 4MP4A 4Z2TA 1XIYA 4YAPA 1PA3A 4JEDA 1ZYNA 2AJQB 4FYBA 3C1RA 3KP9A 2H0HA 4GLTA 4POMA 1ABAA 1W89A 3UEMA 3TJBA 3A2VA 4NHWA 4IGJA 2L4QA 6GSTA 3DEXA 1O7UA 1A0FA 1XW5A 3LXTA 2YNXA 1AC1A 2RUEA 3ZIJA 5IOWA 4TR1B 2CVKA 5J9BA 3APQA 3HKRA 1PN9A 4POKA 2I3YA 2VL2A 2BJXA 1AQVA 3F8UA 4ECJA 1JZDA 3GN3A 2YZHA 3I43A 2FA8A 1TK5B 5ECMB 1WPIA 2XPDA 1V58A 5LCZA 2H1LA 2H6XA 2DIYA 4KAEA 4K2DA 2R3XA 4XRDA 1T00A 4X1UA 3TU3B 5DQYA 4MZCA 1GTAA 4ZB8A 3TKRA 1HNAA 4GQFA 4HQZA 4PGTA 2WJUA 1GSDA 12GSA 3KXOA 4N0ZA 5ECLB 2L5LA 5GAPD 2RM6A 2E0QA 1WJKA 2GSSA 1E2YA 5J4UA 4MK3A 1M0UA 4EC0A 1ERVA 5HFIA 4MNNA 5A5HA 2YOIA 2ES7A 4WKWA 5DBQA 1U88A 2F3MA 2HRFA 3KTBA 1BG1A 3HYPA 19GSA 4LA1A 4G0LA 3CWGA 2KHPA 4EDZA 4GTUA 5KOWA 4EKZA 4LLRA 2N5AA 2C3NA 3CRTA 1WWJA 3APSA 3LEFA 1SK0A 4KH7A 1FB6A 4ZB6A 4ZXGA 1S3AA 2FWHA 5A34B 1SL0B 4QMKA 4NV2A 2EFCA 2V6OA 1EGOA 2UZ8A 1VF4A 2OE1A 2H6YA 3P2AA 2AAWA 2HI7A 1F37A 4IJ3A 2N5FA 2LUSA 2I1UA 1G6YA 5H5RA 20GSA 5A4WA 4I2UA 4TN8A 4L0WA 3VK9A 1TK8B 1TI1A 1USBA 4NPBA 2RIIA 4BL7A 5CNWA 2NBSA 3CSIA 2VOCA 4DVCA 2GLRA 5F06A 1M99A 1HNBA 2AYTA 4I5QA 4AKIA 3H93A 2P0GA 3VURA 1YKAA 4WXTA 5HR3A 2CT6A 3E0UA 1AQWA 5A5HB 5BRTA 3GFKA 3Q74A 3KP8A 4MH2A 3IPZA 4RI7A 2AHEA 1FVKA 5HR2A 4OFTA 1S3CA 5HQPA 3BCIA 3UVTA 2VCVA 4YAVA 1SL1B 3FRCA 1AXDA 5IMFA 2GZZA 1E6BA 3RHBA 5EVOA 3CTGA 1PX7A 1NSWA 3MNGA 3TRXA 4ZBDA 2O7KA 3PH9A 3IOSA 1ZYEA 2LJRA 2CZ2A 3ZLPA 2C4JA 3IXRA 4POBA 2VCQA 1SD9A 1U3AA 2IJYA 1X9MB 2L57A 1GTBA 1RQMA 2WCIA 1B4QA 1TK0B 1K0AA 4KSOA 2VD0A 1PL1A 3E9JB 3LGCA 4BL7B 5E59A 3M1GA 2FWGA 5D96A 2A2PA 1YZXA 2HYXA 2HRNA 4BPYA 1WMJA 1T3BA 1PKZA 2OBKA 2R5GA 3FZAA 4USSA 3HMJG 4AJ8A 4MZWA 1YQ1A 3EINA 1SVOA 1VF1A 4RQRA 5DJLA 1XWBA 4G10A 3UL3A 5J40A 4DSSA 4ECBA 4HZ4A 4MH3A 3GRXA 1XOAA 3H1NA 4XHMA 1O73A 3RBTA 3VI7A 4FO5A 5EPFA 3MYDA 4ILFA 3I6AA 4WR5A 3UIWA 1J08A 1URMA 2EIQA 4BVXA 4AKGA 3HHVA 3FZ9A 3IDVA 4MLYA 4MPGA 2B7KA 2F9SA 1AIUA 4PUAA 1I5GA 3CMIA 3DD3A 4KGIA 2HLSA 2OADA 6GSXA 2J23A 3FHKA 1A23A 1TRUA 1OYJA 18GSA 4K9ZA 4PNGA 3RHCA 3BOAA 1PRXA 4K1FA 3TOTA 1BYEA 1BX9A 4WF5A 4K8MA 1GSQA 3VFIA 3P90A 1X0RA 1IYIA 3C73A 4K7IA 1PQNA 3EU4A 5B8BA 3SBCA 3EE2A 4KDUA 1XXUA 1F2EA 2MZCA 3HDCA 4GCIA 3GKMA 5HFGA 3A3TA 1A0RP 2NDOA 4ZILA 4N3ZA 1T7PB 2OBIA 2CV4A 1EGRA 3KIJA 4HUAA 2H66A 2DIZA 3W6GA 4GWRA 3NOFA 2C3QA 3TGZA 2R2JA 3TUEA 2V41A 3H79A 5HR1A 1OKDA 4PNFA 5GZZB 2DJ3A 4MABA 2JZRA 4I97A 3H4KA 4HJMA 2X8CA 1OVNA 2H76A 3ZVJD 3WGDA 3EWLA 4EUYA 2HRAA 2JZSA 3APOA 1Z7RA 5KEJA 2GQMA 3DVWA 3D5JA 1OE8A 3DXBA 1N2AA 4TW5A 3VPQA 2LJKA 2LRNA 4MDCA 3EPTA 3UBLA 3ZL5A 3KTLA 2C3TA 2TIRA 3NZNA 1SVMA 1I9DA 2H0GA 4EF0A 1EEMA 3UBKA 1W4VA 1LU4A 2LRTA 2CVDA 2H75A 3ERGA 3TJGA 3JCML 4Z2RA 4K2XA 2VUPA 2DLXA 3KMOA 3D4TA 4ACSA 2YN1A 3FK8A 1ILOA 4V1Ap 1UC7A 2CAIA 2K6VA 2JU5A 4NMUA 1JZOA 4CDOA 3HD5A 4IJIA 1V2AA 2JZTA 3QAGA 5GAND 2WB9A 3CBUA 2L6DA 2BTOT 1G6WA 2YZUA 2XBQA 1ERTA 2H1GA 3VI5A 4AF2A 5ECNB 1YDKA 3ERWA 1ON4A 2IMDA 1T4YA 2VM2A 2ON7A 4YQUA 3FZ4A 1GRXA 4DSRA 3FEUA 3C1SA 1XW6A 5G31A 2HT9A 3EURA 1SKRB 2C0DA 4W66A 3KMNA 3IAM2 5J9CA 5ID2A 2JSYA 4O7HA 1F3BA 5DQSA 1X9SB 3F6FA 2EIOA 4EE0A 5JCUA 3CSHA 3EVIA 1WOUA 17GSA 4G01A 4NWYA 1A2JA 1WRYA 1MDKA 3UMAA 2WRTA 3H8QA 4D73B 2GS3A 3AY8A 4WEYA 2CZ3A 1IYHA 4IQ1A 5J47A 4YH2A 3PGTA 4HS1A 5IMCA 4WBJA 1BG5A 1NHOA 22GSA 4TXVA 3KCMA 2VL9A 1SK2A 2DKHA 4KW6A 4TR4A 5ECQB 4OFNA 3F3QA 3ZFBA 2YWMA 3LYPA 3MAKA 1Z6MA 3M9JA 2JL4A 3L9SA 1OAZA 3GX8A 3EMXA 1ZYQB 2QA2A 5J4YA 2KUCA 2HSHA 3WT1A 2JSZA 1PMTA 1GSYA 3UJ1A 2L6CA 2EFDA 3GV1A 3KZQA 1BAYA 2H6ZA 5ENUA 5CRHA 3GYKA 1MD4A 5BMUB 3A2XA 5ID2B 1YY7A 3F4SA 3RAZA 3UOMA 2YJHA 4JR6A 1SYXA 4HU7A 2H19A 4ZL9A 1Z7PA 2BMXA 3G7YA 1G7OA 2LJAA 1GUMA 3IRAA 2GSTA 3P8WA 2LV3A 1JLVA 1ZZYA 1GSSA 2CX3A 1H75A 2VAFA 1VF3A 2IFQA 4J56E 3U5RE 3GSTA 4CW9A 2MYGA 2L4CA 3DYRA 4HU9A 1FVJA 4ULXA 2O5VA 4KDYA 5EL8A 2GQLA 4MPFA 5A4UA 5IO0A 4HDEA 1PX6A 3I9V2 3K8NA 5G5FA 4F0BA 4F82A 4NV5A 5D73A 3L9UA 1A2MA 2ZUPA 4GXZA 3GX0A 2E2MA 3O3TA 2C0EA 1UN2A 5CRGA 16GSA 3TKPA 2FD3A 2XPEA 1H4OA 1AUCA 4ECIA 3DGQA 1YEXA 2G0FA 1A2LA 3QD9A 2B1LA 4BWQA 5G30A 1FHEA 4JRRA 2P31A 2PWJA 4ZB9A 4HZ2A 2FA4A 2H01A 2ZNMA 1K3YA 3PR8A 1GULA 1Q98A 2MBSA 4KDXA 3CSJA 1OC3A 2EFEA 5IM9A 1MTCA 2NPBA 3CYNA 5G1LA 1LJRA 2ALBA 2V1MA 4MF5A 4FIWA 2YCDA 4TR3A 4LL4B 4OMVA 1CQHA 3TDGA 1TP9A 1J0FA 2MMZA 1PKWA 1S3DA 2IIYA 4OD7A 4HEA2 3MSZA 3US3A 3TOUA 1HD2A 3GURA 2FWEA 1RW1A 5H5QA 1F6MC 3LW9A 3DIEA 2DJJA 4O92A 2GSRA 1ZMAA 5F0GA 3ZMLA 1PL2A 3VWXA 2ZCTA 4NXIA 2ON5A 3GHAA 4ZL8A 5DCHA 4MA9A 2WGRA 2E2GA 1TKDB 2OACA 1GNWA 2HNLA 4JU5A 3ZTLA 4GSSA 2RLIA 2RUFA 1ERWA 3ZVJA 1U3IA 1QQ2A 4TVEA 1YJ6A 10GSA 4ML6A 4E8HA 5ECKB 1XVQA 2PVOC 1YF0A 3L9VA 4G0KA 3KD0A 5G5EA 1VF2A 2FLSA 4YKFA 2R0GA 2FCHA 4PURA 3G9BA 2WS2A 1SL2B 3TCOA 3F4RA 4H86A 2KP2A 2OJLA 1XWGA 3ZIVA 5KN2A 1A8YA 1B9XC 3WGEA 3FW2A 2PERA 5IOXA 5B7CA 1NW2A 4WETA 2YV9A 3WD6A 2E7PA 1GNEA 2DMMA 5AIVA 2YP6A 1R4WA 2FHEA 3TRQA 3GUSA 2PGTA 1TJDA 3I69A 3FR6A 4OCFA 3N9JA 3PPUA 3LG6A 3F0IA 1EP7A 4JR4A 4KB3A 2H1BA 1K0DA 5D9VA 4EIPA 1K0BA 2XBIA 1JHBA 1TRSA 1JZWA 3GL3A 1Z9HA 1B8XA 2NVLA 3RPPA 3F6DA 2K18A 2HSNA 3EU3A 2C0FA 3TKSC 2H73A 2DMLA 1QK8A 1FG4A 3DMLA 3UARA 1F3AA 1TTZA 2LRCA 6GSSA 1TU8A 3FYGA 5ELGA 4Q5FA 1SYRA 1G7EA 4WR4A 5J5NA 3A2WA 2HZFA 1K0CA 2M46A 1LBKA 2H70A 3QCPA 3FY7A 1K0NA 4ID0A 1M2AA 2H72A 1PSQA 4XS6A 4GF0A 5L71A 4DEJA 4I8BA 5GSTA 2FNOA 3ZFLA 1TXUA 2GGTA 2H71A 1C72A 1BF5A 5D93A 1U87A 2IPAA 3TB2A 1SKSB 3GTUA 4PQ1A 1TU7A 4G2EA 2R0CA 1SJZA 6GSUA 3DWVA 1EOGA 2WFCA 2O85A 5ELAA 2V32A 2JADA 2IMFA 4MJBA 3D22A 5G2ZA 5G1KA 4DSSB 1TI3A 5ECHB 2A2RA 1TDIA 1V57A 4K7OA 4KSMA 1Z5YE 4IHUA 3DRNA 2OE3A 1GL8A 5D9WA 2B3SA 3L78A 1BQ7A 2X4AA 2HSNB 3WT2A 1QXHA 3IAS2 2H1DA 4BVXB 3ZZXA 5LNKe 1QGVA 3IK9A 1UA5A 2JACA 5COHA 4PQIA 1B4PA 2A4HA 5DVBA 2MMAA 2TRCP 3A5IA 4EDYA 4XRAA 5C04A 5JWOB 3IHQA 3VPTA 1M2BA 2C1YA 4P3YB 1AW9A 3ZITA 4V2LA 1YF1A 3EMPA 1QUWA 4EO3A 3LORA 3N5OA 4MF6A 1RK4A 1Z6NA 1ZL9A 1FOHA 4ML1A 1T8EB 5FHIA 2PUKC 2IMKA 3HZ8A 2PMTA 1O6JA 2A2SA 2GVPA 4IW9A 1EWXA 3TKQA 4O5RA 3GTUB 4K6XA 5A1NA 4O5QA 4ZBBA 2C80A 2K8VA 5IMDA 3ZRDA 6GSYA 3QAVA 1KTEA 5D9XA 2MMOA 2VCZA 1XVWA 2YV7A 4MF7A 1TXXA 2DC5A 2DKIA 2HSMA 1K0MA 3IA1A 4HJ2A 1HYUA 5JCWA 2X8GA 4KCAA 4G0IA 3F63A 4Q5RA 1THOA 5J3RA 1XCCA 3D4MA 4PTSA 4AI6A 2OKAA 1O81A 5KN0A 4RQXA 1GP1A 2X8HA 4Z7XA 1SD8A 2L59A 1MDJA 5IMZA 14GSA 5DAKA 4AJ6A 4MJCA 1EOHA 1T4ZA 3Q19A 4E68A 5C00A 3LQ7A 3O6TA 7GSSA 4JE1A 1WE0A 4XS1A 4IKHA 1OKTA 2CVBA 1O8WA 1PN0A 3D21A 3UAPA 3KH7A 3ME8A 1JFUA 1PD21 2MBTA 5JCGA 4CY6A 3GKXA 2CAQA 4I2TA 4WBRD 3G7JA 4KA0A 2VLUA 3IK7A 3VWWA 1XWAA 3A5WA 2VKZG 4L8EA 1M7TA 1BJXA 4KCEA 4TKYA 2H74A 4J2FA 1GSUA 2PVQA 1XFLA 4Q5QA 3W8JA 2IN3A 2PU9C 5AISA 2GT6A 5J4VA 3G7IA 2YWOA 4PUFC 2RM5A 3IC4A 4WF4A 2YWNA 5IMVA 1Y6EA 4DSQA 2REMA 2VCWA 1XZOA 2M72A 2YWIA 5DALA 1XPVA 2VO4A 1ACVA 2O8VB 4KF9A 4EL1A 2HRKA 3SWLA 1X5EA 2K9FA 3M9KA 4G9HA 5HFKA 5DAKB 1GTIA 3FZ5A 1V98A 4FYUA 4CHSA 6GSVA 2HXKA 4ICYA 3ISOA 2H30A 5CREA 3IR4A 3GH6A 2P5QA 1R5AA 1ZOFA 3FR3A 2KOKA 2IL3A 3TJJA 5ECOB 4LMWA 4K0NA 1ZYPA 1HQOA 4QL7A 3TKSE 5A34A 2GSQA 2QC7A 3VWUA 2B5YA 4Q5NA 4GSNA 4FQUA 4OFMA 2KLXA 4X43A 4EXJA 2B5EA 2DJKA 1Y25A 3M0FA 1DBYA 2V2GA 2YPMA 5A4VA 2CX4A 4XS4A 5DCGA 3MWHA 4PX1A 3FMWA 4Z2UA 1X9WB 1Z3EA 4F9ZA 8GSSA 1NHYA 5B8AA 2HE3A 1TW9A 4IELA 2QGVA 5FWGA 2H1AA 2VM1A 5DALB 2VLTA 3CRUA 1R5PA 2HRKB 3ME7A 3GKNA 5AIXA 4KE3A 4PQHA 1KNGA 3LSZA 2H8LA 1DUGA 3OR5A 1FO5A 2CA8A 5B6MA 5AN1A 1XBSA 1K3LA 5J41A 3GIXA 1OC9A 3V1WA 1MD3A 2HQTA 3BBYA 4NHZA 2A4VA 3CTFA 2FUG2 5ECPB 3PINA 2L5OA 4GQCA 4J57E 4OO5A 1SKWB 5CYYA 3P7XA 2IFQB 1WIKA 4BVYA 3J7Yk 1XW9A 13GSA 5CRWA 2M80A 5IIZA 3QFBC 4BWSA 3FR9A 2GDRA 4V1Ag 3GKKA 3F9UA 2F51A 3U6VA 1U6TA 2R0PA 5A5KA 3S9FA 1R7HA 3W8SA 2HFDA 3L4NA 1Y1UA 4QQ7A 4XS4B 3BJ5A 2YANA 2AV4A 2WULA 3ZYWA 1M9BA 9GSSA 4ISDA 2O87A 1A8LA 2IMIA 3RDWA 3J7Yb 2FWFA 3IBHA 3QMXA 5ECIB 4ZIJA 5CAXA 2XHFA 5CP1A 4TR0A 3TRPA 2B5XA 5KN3A 2UV8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3O A;  3VLN A;  1F9M A;  4IP1 A;  5IO2 A;  4MJE A;  4ZBA A;  3M3M A;  5CRD A;  3HJO A;  1V40 A;  4HI7 A;  1GLP A;  1SEN A;  1OC9 B;  2O89 A;  3HVX A;  2C8U A;  1THX A;  2B7J A;  2MMN A;  2WZ9 A;  3RPN A;  3QOU A;  4TRX A;  2VCT A;  3ED3 A;  4F03 A;  1X5D A;  4TXO A;  2YJ7 A;  4FH8 A;  3EC3 A;  4BVY B;  5GSS A;  3O76 A;  4NAX A;  1SJI A;  1WP0 A;  2GQK A;  2H0I A;  3L0H A;  4N10 A;  4AJ7 A;  4FYC A;  3LFL A;  2GZY A;  5EY6 A;  3ZMK A;  3BCK A;  1ML6 A;  4MJA A;  4AGS A;  3GSS A;  5ECR B;  2VL3 A;  5ECS A;  1GH2 A;  1GTU A;  1QFN A;  3HXS A;  2VCX A;  1ZGN A;  1QMV A;  4TOP A;  1TRW A;  4MCU A;  3E3E A;  1AQX A;  5DJM A;  2HSY A;  3KGK A;  2LST A;  2NTO A;  3HVS A;  1ZCP A;  3CXG A;  5IQY A;  4IP6 A;  4OWY A;  2AB6 A;  5FT3 A;  1GWC A;  2VD1 A;  2DBC A;  2R4V A;  5E4W A;  3TJF A;  2KP1 A;  1B9Y C;  5CO3 A;  2OA7 A;  2GZP A;  4QL9 A;  3KJY A;  3LYK A;  2P5R A;  4IN0 A;  1J9B A;  1TRV A;  2XC2 A;  4KUN A;  1M9A A;  2I4A A;  3KM6 A;  4KND A;  1GSF A;  1HNC A;  1T1V A;  3WGX A;  5D9T A;  5H5S A;  3UVH A;  3BD2 A;  4TXO B;  2DJ0 A;  1VRS D;  4GRF A;  3QFA C;  2QSI A;  2LNT A;  3HY2 A;  3GA4 A;  2DJ2 A;  1N8J A;  2B6M A;  3HZ4 A;  3QR6 A;  4XIH A;  1TOF A;  2X64 A;  3KEB A;  3HA9 A;  2FGX A;  1EZK A;  4L5O A;  2LQQ A;  2VIM A;  4JZQ A;  1MDI A;  3LJR A;  4IVF A;  4YQV A;  2FY6 A;  1O8X A;  1JZR A;  1KBN A;  2WDU A;  3F4T A;  4LL1 B;  1GUH A;  5IMA A;  1SJ6 A;  1ST9 A;  5F8B A;  3Q6O A;  1PGT A;  1FB0 A;  1GUK A;  4K0G A;  2LQO A;  4IBP A;  1XOB A;  4RI6 A;  2AUV A;  5F07 A;  3F3R A;  3DKS A;  4N11 A;  4K7N A;  2Z9S A;  1FAA A;  2GTU A;  3HVV A;  4F0C A;  3IE3 A;  1FW1 A;  1M2D A;  4V2N A;  3M8N A;  1SU9 A;  4L0U A;  1BED A;  5KN1 A;  2HZE A;  1XWC A;  5F05 A;  1YKC A;  1Q4J A;  3ERF A;  3GH9 A;  1OC8 A;  4F2I A;  3R3E A;  3QDN A;  3FKF A;  5ABR A;  4G19 A;  5IPG A;  3HJP A;  2F8A A;  1GLQ A;  2EIR A;  5HR0 A;  2QKE A;  2LNS A;  1OE7 A;  3TKS A;  4JBB A;  3GL5 A;  2F8F A;  5LD0 A;  1MEK A;  4N30 A;  1FOV A;  3QAW A;  1EP8 A;  1O85 A;  1B48 A;  5JWR B;  5IPH A;  3NIV A;  2PN8 A;  1DE1 A;  3D6I A;  4D73 A;  2J9H A;  1YEP A;  2LEG A;  5D8I A;  2DSA A;  2PBJ A;  5DDL A;  1EV9 A;  1X5C A;  3VWV A;  2VLV A;  5INY A;  2GT5 A;  2I81 A;  4MZB A;  3QPM A;  4YQM A;  1UVZ A;  4MMM A;  2EC4 A;  3KH9 A;  3EYT A;  2K8S A;  2IWT A;  3HCZ A;  4X0X A;  3LXZ A;  4L5L A;  2I9H A;  5B6N A;  4XTS A;  3WYW A;  3GNJ A;  2CQ9 A;  2PPT A;  4ECC A;  3DVX A;  2VL2 C;  2N5B A;  4BA7 A;  1VGL A;  3D0Z A;  1KEB A;  2HZE B;  3C7M A;  4N0V A;  4OO4 A;  4OCE A;  4KX4 A;  2R6K A;  5AGY A;  4PXO A;  3C8E A;  4GST A;  5BMU A;  2V6K A;  1AAZ A;  4HOJ A;  11GS A;  4TR1 A;  3C71 A;  4E8E A;  2LKU A;  3IV4 A;  3LWA A;  1A24 A;  2B1K A;  4I6X A;  1SK1 A;  2LS5 A;  4O32 A;  4IQA A;  1EEJ A;  1DSB A;  2R37 A;  2DJ1 A;  3MDK A;  1NM3 A;  4ZL7 A;  3Q18 A;  1V9W A;  1K0O A;  1EV4 A;  4POL A;  4XCS A;  5JWQ B;  3GMF A;  4IS0 A;  2X99 A;  3ZRE A;  4HQS A;  2HSM B;  3HJM A;  1G0T A;  1CQG A;  1XWK A;  1R26 A;  6GSW A;  1JLW A;  1GSE A;  1DE2 A;  3IC8 A;  3R2Q A;  4LMV A;  3TJK A;  2G2Q A;  2OE0 A;  2C0G A;  4RUV A;  2D2Z A;  2LTK A;  1ERU A;  4V2M A;  2IME A;  4EVM A;  2TRX A;  4MP4 A;  1XIY A;  4YAP A;  1PA3 A;  4JED A;  2AJQ B;  4FYB A;  3C1R A;  3KP9 A;  2H0H A;  4GLT A;  4POM A;  1ABA A;  1W89 A;  3UEM A;  3TJB A;  3A2V A;  4NHW A;  4IGJ A;  2L4Q A;  6GST A;  3DEX A;  1O7U A;  1A0F A;  1XW5 A;  3LXT A;  2YNX A;  1AC1 A;  2RUE A;  3ZIJ A;  5IOW A;  4TR1 B;  2CVK A;  5J9B A;  3APQ A;  3HKR A;  1PN9 A;  4POK A;  2I3Y A;  2VL2 A;  2BJX A;  1AQV A;  3F8U A;  4ECJ A;  1JZD A;  3GN3 A;  2YZH A;  3I43 A;  2FA8 A;  1TK5 B;  5ECM B;  1WPI A;  2XPD A;  1V58 A;  5LCZ A;  2H6X A;  2DIY A;  4KAE A;  4K2D A;  2R3X A;  4XRD A;  1T00 A;  4X1U A;  5DQY A;  4MZC A;  1GTA A;  4ZB8 A;  3TKR A;  1HNA A;  4GQF A;  4HQZ A;  4PGT A;  2WJU A;  1GSD A;  12GS A;  3KXO A;  4N0Z A;  5ECL B;  2L5L A;  5GAP D;  2RM6 A;  2E0Q A;  1WJK A;  2GSS A;  1E2Y A;  5J4U A;  4MK3 A;  1M0U A;  4EC0 A;  1ERV A;  5HFI A;  2YOI A;  2ES7 A;  4WKW A;  5DBQ A;  1U88 A;  2F3M A;  2HRF A;  3KTB A;  3HYP A;  19GS A;  4LA1 A;  4G0L A;  2KHP A;  4EDZ A;  4GTU A;  4EKZ A;  4LLR A;  2N5A A;  2C3N A;  3CRT A;  1WWJ A;  3APS A;  3LEF A;  1SK0 A;  4KH7 A;  1FB6 A;  4ZB6 A;  4ZXG A;  1S3A A;  2FWH A;  1SL0 B;  4NV2 A;  2V6O A;  1EGO A;  2UZ8 A;  1VF4 A;  2OE1 A;  2H6Y A;  3P2A A;  2AAW A;  2HI7 A;  1F37 A;  4IJ3 A;  2N5F A;  2LUS A;  2I1U A;  1G6Y A;  5H5R A;  20GS A;  5A4W A;  4I2U A;  4TN8 A;  4L0W A;  3VK9 A;  1TK8 B;  1TI1 A;  1USB A;  4NPB A;  2RII A;  4BL7 A;  5CNW A;  2NBS A;  3CSI A;  2VOC A;  4DVC A;  2GLR A;  5F06 A;  1M99 A;  1HNB A;  2AYT A;  4I5Q A;  3H93 A;  2P0G A;  3VUR A;  1YKA A;  4WXT A;  5HR3 A;  2CT6 A;  3E0U A;  1AQW A;  3GFK A;  3Q74 A;  3KP8 A;  4MH2 A;  3IPZ A;  4RI7 A;  2AHE A;  1FVK A;  5HR2 A;  4OFT A;  1S3C A;  5HQP A;  3BCI A;  3UVT A;  2VCV A;  4YAV A;  1SL1 B;  3FRC A;  1AXD A;  5IMF A;  2GZZ A;  1E6B A;  3RHB A;  5EVO A;  3CTG A;  1PX7 A;  1NSW A;  3MNG A;  3TRX A;  4ZBD A;  2O7K A;  3PH9 A;  3IOS A;  1ZYE A;  2LJR A;  2CZ2 A;  3ZLP A;  2C4J A;  3IXR A;  4POB A;  2VCQ A;  1SD9 A;  1U3A A;  2IJY A;  1X9M B;  2L57 A;  1GTB A;  1RQM A;  2WCI A;  1B4Q A;  1TK0 B;  1K0A A;  4KSO A;  2VD0 A;  1PL1 A;  3E9J B;  3LGC A;  4BL7 B;  5E59 A;  3M1G A;  2FWG A;  5D96 A;  1YZX A;  2HYX A;  2HRN A;  4BPY A;  1WMJ A;  1T3B A;  1PKZ A;  2OBK A;  2R5G A;  3FZA A;  4USS A;  4AJ8 A;  4MZW A;  1YQ1 A;  3EIN A;  1VF1 A;  4RQR A;  5DJL A;  1XWB A;  4G10 A;  3UL3 A;  4DSS A;  4ECB A;  4HZ4 A;  4MH3 A;  3GRX A;  1XOA A;  3H1N A;  4XHM A;  1O73 A;  3RBT A;  3VI7 A;  4FO5 A;  5EPF A;  4ILF A;  3I6A A;  4WR5 A;  3UIW A;  1J08 A;  1URM A;  2EIQ A;  4BVX A;  3HHV A;  3FZ9 A;  3IDV A;  4MLY A;  4MPG A;  2B7K A;  2F9S A;  1AIU A;  4PUA A;  1I5G A;  3CMI A;  3DD3 A;  4KGI A;  2HLS A;  2OAD A;  6GSX A;  2J23 A;  3FHK A;  1A23 A;  1TRU A;  1OYJ A;  18GS A;  4K9Z A;  4PNG A;  3RHC A;  3BOA A;  1PRX A;  4K1F A;  3TOT A;  1BYE A;  1BX9 A;  4WF5 A;  4K8M A;  1GSQ A;  3VFI A;  3P90 A;  1X0R A;  1IYI A;  3C73 A;  4K7I A;  1PQN A;  3EU4 A;  5B8B A;  3SBC A;  3EE2 A;  4KDU A;  1XXU A;  1F2E A;  2MZC A;  3HDC A;  4GCI A;  3GKM A;  5HFG A;  3A3T A;  1A0R P;  2NDO A;  4ZIL A;  1T7P B;  1EGR A;  2OBI A;  2CV4 A;  3KIJ A;  4HUA A;  2H66 A;  2DIZ A;  3W6G A;  4GWR A;  3NOF A;  2C3Q A;  3TGZ A;  2R2J A;  3TUE A;  2V41 A;  3H79 A;  5HR1 A;  1OKD A;  4PNF A;  5GZZ B;  2DJ3 A;  4MAB A;  2JZR A;  4I97 A;  3H4K A;  4HJM A;  2X8C A;  1OVN A;  2H76 A;  3ZVJ D;  3WGD A;  3EWL A;  4EUY A;  2HRA A;  2JZS A;  3APO A;  1Z7R A;  5KEJ A;  2GQM A;  3DVW A;  3D5J A;  1OE8 A;  3DXB A;  1N2A A;  4TW5 A;  3VPQ A;  2LJK A;  2LRN A;  4MDC A;  3UBL A;  3ZL5 A;  3KTL A;  2C3T A;  2TIR A;  3NZN A;  1I9D A;  2H0G A;  4EF0 A;  1EEM A;  3UBK A;  1W4V A;  1LU4 A;  2LRT A;  2CVD A;  2H75 A;  3ERG A;  3TJG A;  3JCM L;  2VUP A;  2DLX A;  3KMO A;  3D4T A;  4ACS A;  2YN1 A;  3FK8 A;  1ILO A;  4V1A p;  1UC7 A;  2CAI A;  2K6V A;  2JU5 A;  4NMU A;  1JZO A;  4CDO A;  3HD5 A;  4IJI A;  1V2A A;  3QAG A;  2JZT A;  5GAN D;  2WB9 A;  3CBU A;  2L6D A;  2BTO T;  1G6W A;  2YZU A;  2XBQ A;  1ERT A;  2H1G A;  3VI5 A;  4AF2 A;  5ECN B;  1YDK A;  3ERW A;  1ON4 A;  2IMD A;  1T4Y A;  2VM2 A;  2ON7 A;  4YQU A;  3FZ4 A;  1GRX A;  4DSR A;  3FEU A;  3C1S A;  1XW6 A;  5G31 A;  2HT9 A;  3EUR A;  1SKR B;  2C0D A;  3KMN A;  3IAM 2;  5J9C A;  5ID2 A;  2JSY A;  4O7H A;  1F3B A;  5DQS A;  1X9S B;  3F6F A;  2EIO A;  4EE0 A;  5JCU A;  3CSH A;  3EVI A;  1WOU A;  17GS A;  4NWY A;  1A2J A;  1WRY A;  1MDK A;  3UMA A;  2WRT A;  3H8Q A;  4D73 B;  2GS3 A;  3AY8 A;  4WEY A;  2CZ3 A;  1IYH A;  4IQ1 A;  4YH2 A;  3PGT A;  4HS1 A;  5IMC A;  4WBJ A;  1BG5 A;  1NHO A;  22GS A;  4TXV A;  3KCM A;  2VL9 A;  1SK2 A;  4KW6 A;  4TR4 A;  5ECQ B;  4OFN A;  3F3Q A;  3ZFB A;  2YWM A;  3LYP A;  3MAK A;  1Z6M A;  3M9J A;  2JL4 A;  3L9S A;  1OAZ A;  3GX8 A;  3EMX A;  1ZYQ B;  2KUC A;  2HSH A;  3WT1 A;  2JSZ A;  1PMT A;  1GSY A;  3UJ1 A;  2L6C A;  3GV1 A;  3KZQ A;  1BAY A;  2H6Z A;  5ENU A;  5CRH A;  3GYK A;  1MD4 A;  3A2X A;  5ID2 B;  1YY7 A;  3F4S A;  3RAZ A;  3UOM A;  2YJH A;  4JR6 A;  1SYX A;  4HU7 A;  2H19 A;  4ZL9 A;  1Z7P A;  2BMX A;  3G7Y A;  1G7O A;  2LJA A;  1GUM A;  3IRA A;  2GST A;  3P8W A;  2LV3 A;  1JLV A;  1ZZY A;  1GSS A;  2CX3 A;  1H75 A;  2VAF A;  1VF3 A;  2IFQ A;  4J56 E;  3U5R E;  3GST A;  4CW9 A;  2MYG A;  2L4C A;  3DYR A;  4HU9 A;  1FVJ A;  4ULX A;  4KDY A;  5EL8 A;  2GQL A;  4MPF A;  5A4U A;  5IO0 A;  4HDE A;  1PX6 A;  3I9V 2;  3K8N A;  5G5F A;  4F0B A;  4F82 A;  4NV5 A;  5D73 A;  3L9U A;  1A2M A;  2ZUP A;  4GXZ A;  3GX0 A;  2E2M A;  3O3T A;  2C0E A;  1UN2 A;  5CRG A;  16GS A;  3TKP A;  2FD3 A;  2XPE A;  1H4O A;  1AUC A;  4ECI A;  3DGQ A;  1YEX A;  2G0F A;  1A2L A;  3QD9 A;  2B1L A;  4BWQ A;  5G30 A;  1FHE A;  4JRR A;  2P31 A;  2PWJ A;  4ZB9 A;  4HZ2 A;  2FA4 A;  2H01 A;  2ZNM A;  1K3Y A;  3PR8 A;  1GUL A;  1Q98 A;  2MBS A;  4KDX A;  3CSJ A;  1OC3 A;  5IM9 A;  1MTC A;  2NPB A;  3CYN A;  5G1L A;  1LJR A;  2ALB A;  2V1M A;  4MF5 A;  4FIW A;  2YCD A;  4TR3 A;  4LL4 B;  4OMV A;  1CQH A;  3TDG A;  1TP9 A;  1J0F A;  2MMZ A;  1PKW A;  1S3D A;  2IIY A;  4OD7 A;  4HEA 2;  3MSZ A;  3US3 A;  3TOU A;  1HD2 A;  3GUR A;  2FWE A;  1RW1 A;  5H5Q A;  1F6M C;  3DIE A;  2DJJ A;  4O92 A;  2GSR A;  1ZMA A;  5F0G A;  3ZML A;  1PL2 A;  3VWX A;  2ZCT A;  4NXI A;  2ON5 A;  3GHA A;  4ZL8 A;  5DCH A;  4MA9 A;  2WGR A;  2E2G A;  1TKD B;  2OAC A;  1GNW A;  2HNL A;  4JU5 A;  3ZTL A;  4GSS A;  2RLI A;  2RUF A;  1ERW A;  3ZVJ A;  1U3I A;  1QQ2 A;  4TVE A;  1YJ6 A;  10GS A;  4ML6 A;  4E8H A;  5ECK B;  1XVQ A;  2PVO C;  1YF0 A;  3L9V A;  4G0K A;  3KD0 A;  5G5E A;  1VF2 A;  2FLS A;  2FCH A;  4PUR A;  3G9B A;  2WS2 A;  1SL2 B;  3TCO A;  3F4R A;  4H86 A;  2KP2 A;  2OJL A;  1XWG A;  3ZIV A;  5KN2 A;  1A8Y A;  1B9X C;  3WGE A;  3FW2 A;  2PER A;  5IOX A;  5B7C A;  1NW2 A;  4WET A;  2YV9 A;  3WD6 A;  2E7P A;  1GNE A;  2DMM A;  5AIV A;  2YP6 A;  1R4W A;  2FHE A;  3TRQ A;  3GUS A;  2PGT A;  1TJD A;  3I69 A;  3FR6 A;  4OCF A;  3N9J A;  3PPU A;  3LG6 A;  3F0I A;  1EP7 A;  4JR4 A;  4KB3 A;  2H1B A;  1K0D A;  5D9V A;  1K0B A;  2XBI A;  1JHB A;  1TRS A;  1JZW A;  3GL3 A;  1Z9H A;  1B8X A;  2NVL A;  3RPP A;  3F6D A;  2K18 A;  3EU3 A;  2C0F A;  3TKS C;  2H73 A;  2DML A;  1QK8 A;  1FG4 A;  3DML A;  3UAR A;  1F3A A;  1TTZ A;  2LRC A;  6GSS A;  1TU8 A;  3FYG A;  5ELG A;  4Q5F A;  1SYR A;  1G7E A;  4WR4 A;  5J5N A;  3A2W A;  2HZF A;  1K0C A;  2M46 A;  1LBK A;  2H70 A;  3QCP A;  3FY7 A;  1K0N A;  4ID0 A;  1M2A A;  2H72 A;  1PSQ A;  4XS6 A;  4GF0 A;  5L71 A;  4DEJ A;  4I8B A;  5GST A;  2FNO A;  3ZFL A;  2GGT A;  2H71 A;  1C72 A;  5D93 A;  1U87 A;  2IPA A;  3TB2 A;  1SKS B;  3GTU A;  4PQ1 A;  1TU7 A;  4G2E A;  1SJZ A;  6GSU A;  3DWV A;  1EOG A;  2WFC A;  2O85 A;  5ELA A;  2V32 A;  2JAD A;  2IMF A;  4MJB A;  3D22 A;  5G2Z A;  5G1K A;  4DSS B;  1TI3 A;  5ECH B;  2A2R A;  1TDI A;  1V57 A;  4K7O A;  4KSM A;  1Z5Y E;  4IHU A;  3DRN A;  2OE3 A;  1GL8 A;  5D9W A;  2B3S A;  3L78 A;  1BQ7 A;  2HSN B;  3WT2 A;  1QXH A;  3IAS 2;  2H1D A;  4BVX B;  3ZZX A;  5LNK e;  1QGV A;  3IK9 A;  1UA5 A;  2JAC A;  5COH A;  4PQI A;  1B4P A;  5DVB A;  2MMA A;  2TRC P;  4EDY A;  4XRA A;  5C04 A;  5JWO B;  3IHQ A;  3VPT A;  1M2B A;  2C1Y A;  4P3Y B;  1AW9 A;  3ZIT A;  4V2L A;  1YF1 A;  3EMP A;  1QUW A;  4EO3 A;  3LOR A;  3N5O A;  4MF6 A;  1RK4 A;  1Z6N A;  1ZL9 A;  4ML1 A;  1T8E B;  5FHI A;  2PUK C;  2IMK A;  3HZ8 A;  2PMT A;  1O6J A;  2A2S A;  2GVP A;  4IW9 A;  1EWX A;  3TKQ A;  4O5R A;  3GTU B;  4K6X A;  4ZBB A;  2C80 A;  2K8V A;  5IMD A;  3ZRD A;  6GSY A;  3QAV A;  1KTE A;  5D9X A;  2MMO A;  2VCZ A;  1XVW A;  2YV7 A;  4MF7 A;  1TXX A;  2DC5 A;  2HSM A;  1K0M A;  3IA1 A;  4HJ2 A;  1HYU A;  5JCW A;  2X8G A;  4KCA A;  4G0I A;  3F63 A;  4Q5R A;  1THO A;  5J3R A;  1XCC A;  3D4M A;  4PTS A;  2OKA A;  1O81 A;  5KN0 A;  4RQX A;  1GP1 A;  2X8H A;  4Z7X A;  1SD8 A;  2L59 A;  1MDJ A;  5IMZ A;  14GS A;  5DAK A;  4AJ6 A;  4MJC A;  1EOH A;  1T4Z A;  3Q19 A;  5C00 A;  3LQ7 A;  3O6T A;  7GSS A;  4JE1 A;  1WE0 A;  4XS1 A;  4IKH A;  1OKT A;  2CVB A;  1O8W A;  3D21 A;  3UAP A;  3KH7 A;  3ME8 A;  1JFU A;  1PD2 1;  2MBT A;  5JCG A;  3GKX A;  2CAQ A;  4I2T A;  4WBR D;  3G7J A;  4KA0 A;  2VLU A;  3IK7 A;  3VWW A;  1XWA A;  3A5W A;  4L8E A;  1M7T A;  1BJX A;  4KCE A;  4TKY A;  2H74 A;  4J2F A;  1GSU A;  2PVQ A;  1XFL A;  4Q5Q A;  3W8J A;  2IN3 A;  2PU9 C;  5AIS A;  2GT6 A;  3G7I A;  2YWO A;  4PUF C;  2RM5 A;  3IC4 A;  4WF4 A;  2YWN A;  5IMV A;  1Y6E A;  4DSQ A;  2REM A;  2VCW A;  1XZO A;  2M72 A;  2YWI A;  5DAL A;  1XPV A;  2VO4 A;  1ACV A;  2O8V B;  4KF9 A;  4EL1 A;  2HRK A;  3SWL A;  1X5E A;  2K9F A;  3M9K A;  4G9H A;  5HFK A;  5DAK B;  1GTI A;  3FZ5 A;  1V98 A;  4FYU A;  4CHS A;  6GSV A;  2HXK A;  3ISO A;  2H30 A;  5CRE A;  3IR4 A;  3GH6 A;  2P5Q A;  1R5A A;  1ZOF A;  3FR3 A;  2KOK A;  2IL3 A;  3TJJ A;  5ECO B;  4LMW A;  4K0N A;  1HQO A;  4QL7 A;  3TKS E;  2GSQ A;  2QC7 A;  3VWU A;  2B5Y A;  4Q5N A;  4GSN A;  4FQU A;  4OFM A;  2KLX A;  4X43 A;  4EXJ A;  2B5E A;  2DJK A;  1Y25 A;  3M0F A;  1DBY A;  2V2G A;  2YPM A;  5A4V A;  2CX4 A;  4XS4 A;  5DCG A;  3MWH A;  4PX1 A;  1X9W B;  1Z3E A;  4F9Z A;  8GSS A;  1NHY A;  5B8A A;  2HE3 A;  1TW9 A;  4IEL A;  2QGV A;  5FWG A;  2H1A A;  2VM1 A;  5DAL B;  2VLT A;  3CRU A;  1R5P A;  2HRK B;  3ME7 A;  3GKN A;  5AIX A;  4KE3 A;  4PQH A;  1KNG A;  3LSZ A;  2H8L A;  1DUG A;  3OR5 A;  1FO5 A;  2CA8 A;  5B6M A;  5AN1 A;  1XBS A;  1K3L A;  5J41 A;  3GIX A;  1OC9 A;  3V1W A;  1MD3 A;  2HQT A;  3BBY A;  4NHZ A;  2A4V A;  3CTF A;  2FUG 2;  5ECP B;  3PIN A;  2L5O A;  4GQC A;  4J57 E;  4OO5 A;  1SKW B;  5CYY A;  3P7X A;  2IFQ B;  1WIK A;  4BVY A;  3J7Y k;  1XW9 A;  13GS A;  5CRW A;  2M80 A;  5IIZ A;  3QFB C;  4BWS A;  3FR9 A;  2GDR A;  4V1A g;  3GKK A;  3F9U A;  2F51 A;  3U6V A;  1U6T A;  5A5K A;  3S9F A;  1R7H A;  3W8S A;  2HFD A;  3L4N A;  4QQ7 A;  4XS4 B;  3BJ5 A;  2YAN A;  2AV4 A;  2WUL A;  3ZYW A;  1M9B A;  9GSS A;  4ISD A;  2O87 A;  1A8L A;  2IMI A;  3RDW A;  3J7Y b;  2FWF A;  3IBH A;  3QMX A;  5ECI B;  4ZIJ A;  5CAX A;  2XHF A;  5CP1 A;  4TR0 A;  3TRP A;  2B5X A;  5KN3 A; 
#chains in the Genus database with same CATH topology
 1K3O A;  3VLN A;  1F9M A;  4IP1 A;  5IO2 A;  4MJE A;  4ZBA A;  3M3M A;  5CRD A;  3HJO A;  1V40 A;  4HI7 A;  1GLP A;  1SEN A;  1OC9 B;  2O89 A;  4CY8 A;  3HVX A;  2C8U A;  1THX A;  2B7J A;  2MMN A;  2WZ9 A;  3RPN A;  3QOU A;  4TRX A;  2VCT A;  3ED3 A;  4ZB7 A;  4F03 A;  1X5D A;  4TXO A;  2YJ7 A;  4FH8 A;  3EC3 A;  4O5U A;  4BVY B;  5GSS A;  3O76 A;  4NAX A;  1SJI A;  1WP0 A;  2GQK A;  2H0I A;  1SVL A;  3L0H A;  4N10 A;  4AJ7 A;  4FYC A;  3LFL A;  2GZY A;  5EY6 A;  3ZMK A;  3BCK A;  1ML6 A;  4MJA A;  4AGS A;  3GSS A;  5ECR B;  2VL3 A;  5ECS A;  1GH2 A;  1GTU A;  1QFN A;  3HXS A;  2VCX A;  1ZGN A;  1QMV A;  4TOP A;  1TRW A;  2QA1 A;  4MCU A;  3E3E A;  1AQX A;  5DJM A;  2HSY A;  3KGK A;  2LST A;  2WVX B;  2NTO A;  3HVS A;  1ZCP A;  3CXG A;  5IQY A;  4IP6 A;  4OWY A;  2AB6 A;  5FT3 A;  1GWC A;  2VD1 A;  2DBC A;  2R4V A;  5E4W A;  3TJF A;  2KP1 A;  1B9Y C;  5CO3 A;  2OA7 A;  2GZP A;  4QL9 A;  3KJY A;  3LYK A;  2P5R A;  4IN0 A;  1J9B A;  1TRV A;  2XC2 A;  4KUN A;  1M9A A;  2I4A A;  3KM6 A;  4KND A;  1GSF A;  1HNC A;  1T1V A;  3WGX A;  5D9T A;  5H5S A;  3UVH A;  4YKG A;  3BD2 A;  4TXO B;  2DJ0 A;  1VRS D;  4GRF A;  3QFA C;  2QSI A;  2LNT A;  3HY2 A;  3GA4 A;  2DJ2 A;  1N8J A;  2B6M A;  3HZ4 A;  3QR6 A;  4XIH A;  1TOF A;  4X4J A;  2X64 A;  3KEB A;  3HA9 A;  2FGX A;  1EZK A;  4L5O A;  2LQQ A;  4HSC X;  2VIM A;  4JZQ A;  1MDI A;  3LJR A;  4IVF A;  4YQV A;  2FY6 A;  1O8X A;  1JZR A;  1KBN A;  2WDU A;  3F4T A;  3MIX A;  5KOX A;  4LL1 B;  1GUH A;  5IMA A;  1SJ6 A;  1ST9 A;  5F8B A;  4GDF A;  3Q6O A;  1PGT A;  1FB0 A;  1GUK A;  4K0G A;  2LQO A;  4IBP A;  1XOB A;  4RI6 A;  2AUV A;  5F07 A;  3F3R A;  3DKS A;  4N11 A;  4K7N A;  2Z9S A;  1FAA A;  2GTU A;  3HVV A;  4F0C A;  3IE3 A;  1FW1 A;  1M2D A;  4V2N A;  3M8N A;  1SU9 A;  4L0U A;  1BED A;  5KN1 A;  4EIQ A;  2HZE A;  1XWC A;  5F05 A;  1YKC A;  1Q4J A;  3ERF A;  4AKH A;  3GH9 A;  1OC8 A;  4F2I A;  3R3E A;  3QDN A;  3FKF A;  3IHG A;  5ABR A;  4G19 A;  5IPG A;  3HJP A;  2F8A A;  1GLQ A;  2EIR A;  5HR0 A;  2QKE A;  2LNS A;  1OE7 A;  1N25 A;  3TKS A;  4JBB A;  3GL5 A;  2F8F A;  4K5R A;  5LD0 A;  1MEK A;  4N30 A;  1FOV A;  3QAW A;  1EP8 A;  1O85 A;  1B48 A;  5JWR B;  5IPH A;  2WZS A;  3NIV A;  2PN8 A;  1DE1 A;  3D6I A;  4D73 A;  2J9H A;  1YEP A;  2LEG A;  5D8I A;  2DSA A;  2PBJ A;  5DDL A;  1EV9 A;  1X5C A;  3VWV A;  2VLV A;  5INY A;  2GT5 A;  2I81 A;  4MZB A;  3QPM A;  4YQM A;  1UVZ A;  4MMM A;  2EC4 A;  3KH9 A;  3EYT A;  2K8S A;  2IWT A;  3HCZ A;  4X0X A;  3LXZ A;  4L5L A;  2I9H A;  5B6N A;  4XTS A;  3WYW A;  3GNJ A;  2CQ9 A;  2PPT A;  1YEW C;  2WW0 A;  4ECC A;  3DVX A;  2VL2 C;  2N5B A;  4BA7 A;  1VGL A;  3D0Z A;  1KEB A;  2HZE B;  3C7M A;  4N0V A;  4OO4 A;  4OCE A;  4KX4 A;  2R6K A;  5AGY A;  4PXO A;  3C8E A;  4GST A;  5BMU A;  2V6K A;  4A5P A;  1AAZ A;  2EFH A;  4HOJ A;  11GS A;  4TR1 A;  3C71 A;  4E8E A;  2LKU A;  3IV4 A;  3LWA A;  1A24 A;  2B1K A;  2OT3 A;  4I6X A;  1SK1 A;  1YVL A;  2LS5 A;  4O32 A;  5A1N B;  4IQA A;  1EEJ A;  1DSB A;  2R37 A;  2DJ1 A;  3MDK A;  1NM3 A;  4ZL7 A;  3Q18 A;  1V9W A;  1K0O A;  1EV4 A;  4POL A;  4XCS A;  5JWQ B;  3GMF A;  4IS0 A;  2X99 A;  3ZRE A;  4HQS A;  2HSM B;  3HJM A;  1G0T A;  1CQG A;  2X49 A;  1XWK A;  1R26 A;  6GSW A;  1JLW A;  1GSE A;  1DE2 A;  3IC8 A;  3R2Q A;  4LMV A;  3TJK A;  2G2Q A;  2OE0 A;  2C0G A;  4K5S A;  4RUV A;  2D2Z A;  2LTK A;  1ERU A;  4V2M A;  2IME A;  4EVM A;  4AKX B;  2TRX A;  4MP4 A;  4Z2T A;  1XIY A;  4YAP A;  1PA3 A;  4JED A;  1ZYN A;  2AJQ B;  4FYB A;  3C1R A;  3KP9 A;  2H0H A;  4GLT A;  4POM A;  1ABA A;  1W89 A;  3UEM A;  3TJB A;  3A2V A;  4NHW A;  4IGJ A;  2L4Q A;  6GST A;  3DEX A;  1O7U A;  1A0F A;  1XW5 A;  3LXT A;  2YNX A;  1AC1 A;  2RUE A;  3ZIJ A;  5IOW A;  4TR1 B;  2CVK A;  5J9B A;  3APQ A;  3HKR A;  1PN9 A;  4POK A;  2I3Y A;  2VL2 A;  2BJX A;  1AQV A;  3F8U A;  4ECJ A;  1JZD A;  3GN3 A;  2YZH A;  3I43 A;  2FA8 A;  1TK5 B;  5ECM B;  1WPI A;  2XPD A;  1V58 A;  5LCZ A;  2H1L A;  2H6X A;  2DIY A;  4KAE A;  4K2D A;  2R3X A;  4XRD A;  1T00 A;  4X1U A;  3TU3 B;  5DQY A;  4MZC A;  1GTA A;  4ZB8 A;  3TKR A;  1HNA A;  4GQF A;  4HQZ A;  4PGT A;  2WJU A;  1GSD A;  12GS A;  3KXO A;  4N0Z A;  5ECL B;  2L5L A;  5GAP D;  2RM6 A;  2E0Q A;  1WJK A;  2GSS A;  1E2Y A;  5J4U A;  4MK3 A;  1M0U A;  4EC0 A;  1ERV A;  5HFI A;  4MNN A;  5A5H A;  2YOI A;  2ES7 A;  4WKW A;  5DBQ A;  1U88 A;  2F3M A;  2HRF A;  3KTB A;  1BG1 A;  3HYP A;  19GS A;  4LA1 A;  4G0L A;  3CWG A;  2KHP A;  4EDZ A;  4GTU A;  5KOW A;  4EKZ A;  4LLR A;  4FXY P;  2C3N A;  2N5A A;  3CRT A;  1WWJ A;  3APS A;  3LEF A;  1SK0 A;  4KH7 A;  1FB6 A;  4ZB6 A;  4ZXG A;  1S3A A;  2FWH A;  5A34 B;  1SL0 B;  4QMK A;  4NV2 A;  2EFC A;  2V6O A;  1EGO A;  2UZ8 A;  1VF4 A;  2OE1 A;  2H6Y A;  3P2A A;  2AAW A;  2HI7 A;  1F37 A;  4IJ3 A;  2N5F A;  2LUS A;  2I1U A;  1G6Y A;  5H5R A;  20GS A;  5A4W A;  4I2U A;  4TN8 A;  4L0W A;  3VK9 A;  1TK8 B;  3HVN A;  1I1I P;  1TI1 A;  1USB A;  4NPB A;  2RII A;  4BL7 A;  5CNW A;  2NBS A;  3CSI A;  2VOC A;  4DVC A;  2GLR A;  4PI2 C;  5F06 A;  1M99 A;  1HNB A;  2AYT A;  4I5Q A;  4AKI A;  3H93 A;  2P0G A;  3VUR A;  1YKA A;  4WXT A;  5HR3 A;  2CT6 A;  3E0U A;  1AQW A;  5A5H B;  5BRT A;  3GFK A;  3Q74 A;  3KP8 A;  4MH2 A;  3IPZ A;  4RI7 A;  2AHE A;  1FVK A;  5HR2 A;  4OFT A;  1S3C A;  5HQP A;  3BCI A;  3UVT A;  2VCV A;  4YAV A;  1SL1 B;  3FRC A;  1AXD A;  5IMF A;  2GZZ A;  1E6B A;  3RHB A;  5EVO A;  3CTG A;  1PX7 A;  1NSW A;  3MNG A;  3TRX A;  4ZBD A;  2O7K A;  3PH9 A;  3IOS A;  1ZYE A;  2LJR A;  2CZ2 A;  3ZLP A;  2C4J A;  3IXR A;  4POB A;  2VCQ A;  1SD9 A;  1U3A A;  2IJY A;  1X9M B;  2L57 A;  1GTB A;  1RQM A;  2WCI A;  1B4Q A;  1TK0 B;  1K0A A;  4KSO A;  2VD0 A;  1PL1 A;  3E9J B;  3LGC A;  4BL7 B;  5E59 A;  3M1G A;  3CQF A;  2FWG A;  5D96 A;  2A2P A;  1YZX A;  2HYX A;  2HRN A;  4BPY A;  1WMJ A;  1T3B A;  1PKZ A;  2OBK A;  2R5G A;  3FZA A;  4USS A;  3HMJ G;  4AJ8 A;  4MZW A;  1YQ1 A;  3EIN A;  1SVO A;  1VF1 A;  4RQR A;  5DJL A;  1XWB A;  4G10 A;  3UL3 A;  5J40 A;  4DSS A;  4ECB A;  4HZ4 A;  4MH3 A;  3GRX A;  1XOA A;  3H1N A;  4XHM A;  1O73 A;  3RBT A;  3VI7 A;  4FO5 A;  5EPF A;  3MYD A;  4ILF A;  3I6A A;  4WR5 A;  3UIW A;  1J08 A;  1URM A;  2EIQ A;  4BVX A;  4AKG A;  3HHV A;  3FZ9 A;  3IDV A;  4MLY A;  4MPG A;  2B7K A;  2F9S A;  1AIU A;  4PUA A;  1I5G A;  3CMI A;  3DD3 A;  4KGI A;  2HLS A;  2OAD A;  6GSX A;  2J23 A;  3FHK A;  1A23 A;  1TRU A;  1OYJ A;  18GS A;  4K9Z A;  4PNG A;  3RHC A;  3BOA A;  1PRX A;  4K1F A;  3TOT A;  1BYE A;  1BX9 A;  4WF5 A;  4K8M A;  1GSQ A;  3VFI A;  3P90 A;  1X0R A;  1IYI A;  3C73 A;  4K7I A;  1PQN A;  3EU4 A;  5B8B A;  3SBC A;  3EE2 A;  4KDU A;  1XXU A;  1F2E A;  2MZC A;  3HDC A;  4GCI A;  3GKM A;  5HFG A;  3A3T A;  1A0R P;  2NDO A;  4ZIL A;  4N3Z A;  1T7P B;  2OBI A;  2CV4 A;  1EGR A;  3KIJ A;  4HUA A;  2H66 A;  2DIZ A;  3W6G A;  4GWR A;  3NOF A;  2C3Q A;  3TGZ A;  2R2J A;  3TUE A;  2V41 A;  3H79 A;  5HR1 A;  1OKD A;  4PNF A;  5GZZ B;  2DJ3 A;  4MAB A;  2JZR A;  4I97 A;  3H4K A;  4HJM A;  2X8C A;  1OVN A;  2H76 A;  3ZVJ D;  3WGD A;  3EWL A;  4EUY A;  2HRA A;  2JZS A;  3APO A;  1Z7R A;  5KEJ A;  2GQM A;  3DVW A;  3D5J A;  1OE8 A;  3DXB A;  1N2A A;  4TW5 A;  3VPQ A;  2LJK A;  2LRN A;  4MDC A;  3RFR C;  3EPT A;  3UBL A;  3ZL5 A;  3KTL A;  2C3T A;  2TIR A;  3NZN A;  1SVM A;  1I9D A;  2H0G A;  4EF0 A;  1EEM A;  3UBK A;  1W4V A;  1LU4 A;  2LRT A;  2CVD A;  2H75 A;  3ERG A;  3TJG A;  3JCM L;  4Z2R A;  4K2X A;  2VUP A;  2DLX A;  3KMO A;  4PHZ C;  3D4T A;  4ACS A;  2YN1 A;  3FK8 A;  1ILO A;  4V1A p;  1UC7 A;  2CAI A;  2K6V A;  2JU5 A;  4NMU A;  1JZO A;  4CDO A;  2WVY A;  3HD5 A;  4IJI A;  1V2A A;  2JZT A;  3QAG A;  5GAN D;  2WB9 A;  3CBU A;  2L6D A;  2BTO T;  1G6W A;  2YZU A;  2XBQ A;  1ERT A;  2H1G A;  3VI5 A;  4AF2 A;  5ECN B;  1YDK A;  3ERW A;  1ON4 A;  2IMD A;  1T4Y A;  2VM2 A;  2ON7 A;  4YQU A;  3FZ4 A;  1GRX A;  4DSR A;  3FEU A;  3C1S A;  1XW6 A;  1M3I A;  5G31 A;  2HT9 A;  3EUR A;  1SKR B;  2C0D A;  4W66 A;  3KMN A;  3IAM 2;  5J9C A;  5ID2 A;  2JSY A;  4O7H A;  1F3B A;  5DQS A;  1X9S B;  3F6F A;  2EIO A;  4EE0 A;  5JCU A;  3CSH A;  3EVI A;  1WOU A;  17GS A;  4G01 A;  4NWY A;  1A2J A;  1WRY A;  1MDK A;  3UMA A;  2WRT A;  3H8Q A;  4D73 B;  2GS3 A;  3AY8 A;  4WEY A;  2CZ3 A;  1IYH A;  4IQ1 A;  5J47 A;  4YH2 A;  3PGT A;  4HS1 A;  5IMC A;  4WBJ A;  1BG5 A;  1NHO A;  22GS A;  4TXV A;  3KCM A;  2VL9 A;  1SK2 A;  2DKH A;  4KW6 A;  4TR4 A;  5ECQ B;  4OFN A;  3F3Q A;  3ZFB A;  2YWM A;  3LYP A;  3MAK A;  1Z6M A;  3M9J A;  2JL4 A;  3L9S A;  1OAZ A;  3GX8 A;  3EMX A;  1ZYQ B;  2QA2 A;  5J4Y A;  2KUC A;  2HSH A;  3WT1 A;  2JSZ A;  1PMT A;  1GSY A;  3UJ1 A;  2L6C A;  2EFD A;  3GV1 A;  3KZQ A;  1BAY A;  2H6Z A;  5ENU A;  5CRH A;  3GYK A;  1MD4 A;  5BMU B;  3A2X A;  5ID2 B;  1YY7 A;  3F4S A;  3RAZ A;  3UOM A;  2YJH A;  4JR6 A;  1SYX A;  4HU7 A;  2H19 A;  4ZL9 A;  1Z7P A;  2BMX A;  3G7Y A;  1G7O A;  2LJA A;  1GUM A;  3IRA A;  2GST A;  3P8W A;  2LV3 A;  1JLV A;  1ZZY A;  1GSS A;  2CX3 A;  1H75 A;  2VAF A;  1VF3 A;  2IFQ A;  4J56 E;  3U5R E;  3GST A;  4CW9 A;  2MYG A;  2L4C A;  3DYR A;  4HU9 A;  1FVJ A;  2O36 A;  4ULX A;  2O5V A;  4KDY A;  5EL8 A;  2GQL A;  4MPF A;  5A4U A;  5IO0 A;  4HDE A;  1PX6 A;  3I9V 2;  3K8N A;  5G5F A;  4F0B A;  1PFO A;  4F82 A;  4NV5 A;  5D73 A;  3L9U A;  1A2M A;  2ZUP A;  4GXZ A;  3GX0 A;  2E2M A;  3O3T A;  2C0E A;  1UN2 A;  5CRG A;  16GS A;  3TKP A;  2FD3 A;  2XPE A;  1H4O A;  1AUC A;  4ECI A;  3DGQ A;  1YEX A;  2G0F A;  1A2L A;  3QD9 A;  2B1L A;  4BWQ A;  5G30 A;  1FHE A;  4JRR A;  2P31 A;  2PWJ A;  4ZB9 A;  4HZ2 A;  2FA4 A;  2H01 A;  2ZNM A;  1K3Y A;  3PR8 A;  1GUL A;  1Q98 A;  2MBS A;  4KDX A;  3CSJ A;  1OC3 A;  2EFE A;  5IM9 A;  1MTC A;  2NPB A;  3CYN A;  5G1L A;  1LJR A;  2ALB A;  2V1M A;  4MF5 A;  4FIW A;  2YCD A;  4TR3 A;  4LL4 B;  4OMV A;  1CQH A;  3TDG A;  1TP9 A;  1J0F A;  2MMZ A;  1PKW A;  1S3D A;  2IIY A;  4OD7 A;  4HEA 2;  3MSZ A;  3US3 A;  3TOU A;  1HD2 A;  3GUR A;  2FWE A;  1RW1 A;  5H5Q A;  1F6M C;  3LW9 A;  3DIE A;  2DJJ A;  3RGB C;  2WW3 A;  4O92 A;  2GSR A;  1ZMA A;  5F0G A;  3ZML A;  1PL2 A;  3VWX A;  2ZCT A;  4NXI A;  2ON5 A;  3GHA A;  4ZL8 A;  5DCH A;  4MA9 A;  2WGR A;  2E2G A;  1TKD B;  2OAC A;  1GNW A;  2HNL A;  4JU5 A;  3ZTL A;  4GSS A;  2RLI A;  2RUF A;  1ERW A;  3ZVJ A;  1U3I A;  1QQ2 A;  4TVE A;  1YJ6 A;  10GS A;  4ML6 A;  4E8H A;  5ECK B;  1XVQ A;  2PVO C;  1YF0 A;  3L9V A;  4G0K A;  3KD0 A;  5G5E A;  1VF2 A;  2FLS A;  4YKF A;  2R0G A;  2FCH A;  4PUR A;  3G9B A;  2WS2 A;  1SL2 B;  3TCO A;  3F4R A;  4H86 A;  2KP2 A;  2OJL A;  1XWG A;  3ZIV A;  5KN2 A;  1A8Y A;  1B9X C;  3WGE A;  3FW2 A;  2PER A;  5IOX A;  5B7C A;  1NW2 A;  4WET A;  2YV9 A;  3WD6 A;  2E7P A;  1GNE A;  2DMM A;  5AIV A;  2YP6 A;  1R4W A;  2FHE A;  3TRQ A;  3GUS A;  2PGT A;  1TJD A;  3I69 A;  3FR6 A;  4OCF A;  3N9J A;  3PPU A;  3LG6 A;  3F0I A;  1EP7 A;  4JR4 A;  4KB3 A;  2H1B A;  1K0D A;  5D9V A;  4EIP A;  1K0B A;  2XBI A;  1JHB A;  1TRS A;  1JZW A;  3GL3 A;  1Z9H A;  1B8X A;  2NVL A;  3RPP A;  3F6D A;  2K18 A;  2HSN A;  3EU3 A;  2C0F A;  3TKS C;  2H73 A;  2DML A;  1QK8 A;  1FG4 A;  3DML A;  3UAR A;  1F3A A;  1TTZ A;  2LRC A;  6GSS A;  1TU8 A;  3FYG A;  5ELG A;  4Q5F A;  1SYR A;  1G7E A;  4WR4 A;  3A2W A;  5J5N A;  2HZF A;  1K0C A;  2M46 A;  1LBK A;  2H70 A;  3QCP A;  3FY7 A;  1K0N A;  4ID0 A;  1M2A A;  2H72 A;  1PSQ A;  1S3R A;  4XS6 A;  4GF0 A;  5L71 A;  4DEJ A;  4I8B A;  5GST A;  2FNO A;  3ZFL A;  1TXU A;  2GGT A;  2H71 A;  1C72 A;  1BF5 A;  5D93 A;  1U87 A;  2IPA A;  3TB2 A;  1SKS B;  3GTU A;  4PQ1 A;  1TU7 A;  4G2E A;  2R0C A;  1SJZ A;  6GSU A;  3DWV A;  1EOG A;  2WFC A;  2O85 A;  5ELA A;  2V32 A;  2JAD A;  2IMF A;  4MJB A;  3D22 A;  5G2Z A;  5G1K A;  4DSS B;  1TI3 A;  5ECH B;  2A2R A;  1TDI A;  1V57 A;  4K7O A;  4KSM A;  1Z5Y E;  4IHU A;  3DRN A;  2OE3 A;  1GL8 A;  5D9W A;  2B3S A;  3L78 A;  1BQ7 A;  2X4A A;  2HSN B;  3WT2 A;  1QXH A;  3IAS 2;  2H1D A;  4BVX B;  3ZZX A;  5LNK e;  1QGV A;  3IK9 A;  1UA5 A;  2JAC A;  5COH A;  4PQI A;  1B4P A;  2A4H A;  5DVB A;  2MMA A;  2TRC P;  3A5I A;  4EDY A;  4XRA A;  5C04 A;  5JWO B;  3IHQ A;  3VPT A;  1M2B A;  2C1Y A;  2WW1 A;  4P3Y B;  1AW9 A;  3ZIT A;  4V2L A;  1YF1 A;  3EMP A;  1QUW A;  4EO3 A;  3LOR A;  3N5O A;  4MF6 A;  1RK4 A;  1Z6N A;  1ZL9 A;  1FOH A;  4ML1 A;  1T8E B;  5FHI A;  2PUK C;  2IMK A;  3HZ8 A;  2PMT A;  1O6J A;  2A2S A;  2GVP A;  4IW9 A;  1EWX A;  3TKQ A;  4O5R A;  3GTU B;  4K6X A;  5A1N A;  4O5Q A;  4PI0 C;  4ZBB A;  2C80 A;  2K8V A;  5IMD A;  3ZRD A;  6GSY A;  3QAV A;  1KTE A;  5D9X A;  2MMO A;  2VCZ A;  2WVZ A;  1XVW A;  2YV7 A;  4MF7 A;  1TXX A;  2DC5 A;  2DKI A;  2HSM A;  1K0M A;  3IA1 A;  4HJ2 A;  1HYU A;  5JCW A;  2X8G A;  4KCA A;  4G0I A;  3F63 A;  4Q5R A;  1THO A;  5J3R A;  1XCC A;  3D4M A;  4PTS A;  4AI6 A;  2OKA A;  1O81 A;  5KN0 A;  4RQX A;  1GP1 A;  2X8H A;  4Z7X A;  1SD8 A;  2L59 A;  1MDJ A;  5IMZ A;  14GS A;  5DAK A;  4AJ6 A;  4MJC A;  1EOH A;  1T4Z A;  3Q19 A;  4E68 A;  5C00 A;  3LQ7 A;  3O6T A;  7GSS A;  4JE1 A;  1WE0 A;  4XS1 A;  4IKH A;  1OKT A;  2CVB A;  1O8W A;  3CHX C;  1PN0 A;  3D21 A;  3UAP A;  3KH7 A;  3ME8 A;  1M3J A;  1JFU A;  1PD2 1;  2MBT A;  5JCG A;  4CY6 A;  3GKX A;  2CAQ A;  4I2T A;  4WBR D;  3G7J A;  4KA0 A;  2VLU A;  3IK7 A;  3VWW A;  1XWA A;  3A5W A;  2VKZ G;  4L8E A;  1M7T A;  1BJX A;  4KCE A;  4TKY A;  2H74 A;  4J2F A;  1GSU A;  2PVQ A;  1XFL A;  4Q5Q A;  3W8J A;  2IN3 A;  2PU9 C;  5AIS A;  2GT6 A;  5J4V A;  3G7I A;  2YWO A;  4PUF C;  2RM5 A;  3IC4 A;  4WF4 A;  2YWN A;  5IMV A;  1Y6E A;  1XG8 A;  4DSQ A;  2REM A;  2VCW A;  1XZO A;  2M72 A;  2YWI A;  5DAL A;  1XPV A;  2VO4 A;  1ACV A;  2O8V B;  4KF9 A;  4EL1 A;  2HRK A;  3SWL A;  1X5E A;  2K9F A;  3M9K A;  4G9H A;  1S4B P;  5HFK A;  5DAK B;  1GTI A;  3FZ5 A;  1V98 A;  4FYU A;  4CHS A;  6GSV A;  2HXK A;  4ICY A;  3ISO A;  2H30 A;  5CRE A;  3IR4 A;  3GH6 A;  2P5Q A;  1R5A A;  1ZOF A;  3FR3 A;  2KOK A;  2IL3 A;  3TJJ A;  5ECO B;  4LMW A;  4K0N A;  1ZYP A;  1HQO A;  4QL7 A;  3TKS E;  5A34 A;  2GSQ A;  2QC7 A;  3VWU A;  2B5Y A;  4Q5N A;  4GSN A;  4FQU A;  4OFM A;  2KLX A;  4X43 A;  4EXJ A;  2B5E A;  2DJK A;  1Y25 A;  3M0F A;  1DBY A;  2V2G A;  2YPM A;  5A4V A;  2CX4 A;  4XS4 A;  4BIK A;  5DCG A;  3MWH A;  4PX1 A;  3FMW A;  4Z2U A;  1X9W B;  1Z3E A;  4F9Z A;  8GSS A;  1NHY A;  5B8A A;  2HE3 A;  1TW9 A;  4IEL A;  2QGV A;  5FWG A;  2H1A A;  2VM1 A;  5DAL B;  2VLT A;  3CRU A;  1R5P A;  2HRK B;  3ME7 A;  3GKN A;  5AIX A;  4KE3 A;  4PQH A;  1KNG A;  3LSZ A;  2H8L A;  1DUG A;  3OR5 A;  1FO5 A;  2CA8 A;  5B6M A;  5AN1 A;  1XBS A;  1K3L A;  5J41 A;  3GIX A;  1OC9 A;  3V1W A;  1MD3 A;  2HQT A;  3BBY A;  4NHZ A;  2A4V A;  3CTF A;  2FUG 2;  5ECP B;  3PIN A;  2L5O A;  4GQC A;  4J57 E;  4OO5 A;  1SKW B;  5CYY A;  3P7X A;  2IFQ B;  1WIK A;  4BVY A;  3J7Y k;  1XW9 A;  13GS A;  5CRW A;  2M80 A;  5IIZ A;  2O3E A;  3QFB C;  4BWS A;  3FR9 A;  2GDR A;  4V1A g;  3GKK A;  3F9U A;  2F51 A;  3U6V A;  1U6T A;  2R0P A;  5A5K A;  3S9F A;  1R7H A;  2WW2 A;  3W8S A;  2HFD A;  3L4N A;  1Y1U A;  4QQ7 A;  4XS4 B;  3BJ5 A;  2YAN A;  2AV4 A;  2WUL A;  3ZYW A;  1M9B A;  9GSS A;  4ISD A;  2O87 A;  1A8L A;  2IMI A;  3RDW A;  3J7Y b;  2FWF A;  3IBH A;  3QMX A;  5ECI B;  4ZIJ A;  2WVX A;  5CAX A;  2XHF A;  5CP1 A;  4TR0 A;  3TRP A;  2B5X A;  5KN3 A;  2UV8 G; 
#chains in the Genus database with same CATH homology
 1K3O A;  3VLN A;  1F9M A;  4IP1 A;  5IO2 A;  4MJE A;  4ZBA A;  3M3M A;  5CRD A;  3HJO A;  1V40 A;  4HI7 A;  1GLP A;  1SEN A;  1OC9 B;  2O89 A;  4CY8 A;  3HVX A;  2C8U A;  1THX A;  2B7J A;  2MMN A;  2WZ9 A;  3RPN A;  3QOU A;  4TRX A;  2VCT A;  3ED3 A;  4ZB7 A;  4F03 A;  1X5D A;  4TXO A;  2YJ7 A;  4FH8 A;  3EC3 A;  4O5U A;  4BVY B;  5GSS A;  3O76 A;  4NAX A;  1SJI A;  1WP0 A;  2GQK A;  2H0I A;  1SVL A;  3L0H A;  4N10 A;  4AJ7 A;  4FYC A;  3LFL A;  2GZY A;  5EY6 A;  3ZMK A;  3BCK A;  1ML6 A;  4MJA A;  4AGS A;  3GSS A;  5ECR B;  2VL3 A;  5ECS A;  1GH2 A;  1GTU A;  1QFN A;  3HXS A;  2VCX A;  1ZGN A;  1QMV A;  4TOP A;  1TRW A;  2QA1 A;  4MCU A;  3E3E A;  1AQX A;  5DJM A;  2HSY A;  3KGK A;  2LST A;  2NTO A;  3HVS A;  1ZCP A;  3CXG A;  5IQY A;  4IP6 A;  4OWY A;  2AB6 A;  5FT3 A;  1GWC A;  2VD1 A;  2DBC A;  2R4V A;  5E4W A;  3TJF A;  2KP1 A;  1B9Y C;  5CO3 A;  2OA7 A;  2GZP A;  4QL9 A;  3KJY A;  3LYK A;  2P5R A;  4IN0 A;  1J9B A;  1TRV A;  2XC2 A;  4KUN A;  1M9A A;  2I4A A;  3KM6 A;  4KND A;  1GSF A;  1HNC A;  1T1V A;  3WGX A;  5D9T A;  5H5S A;  3UVH A;  4YKG A;  3BD2 A;  4TXO B;  2DJ0 A;  1VRS D;  4GRF A;  3QFA C;  2QSI A;  2LNT A;  3HY2 A;  3GA4 A;  2DJ2 A;  1N8J A;  2B6M A;  3HZ4 A;  3QR6 A;  4XIH A;  1TOF A;  4X4J A;  2X64 A;  3KEB A;  3HA9 A;  2FGX A;  1EZK A;  4L5O A;  2LQQ A;  2VIM A;  4JZQ A;  1MDI A;  3LJR A;  4IVF A;  4YQV A;  2FY6 A;  1O8X A;  1JZR A;  1KBN A;  2WDU A;  3F4T A;  3MIX A;  5KOX A;  4LL1 B;  1GUH A;  5IMA A;  1SJ6 A;  1ST9 A;  5F8B A;  4GDF A;  3Q6O A;  1PGT A;  1FB0 A;  1GUK A;  4K0G A;  2LQO A;  4IBP A;  1XOB A;  4RI6 A;  2AUV A;  5F07 A;  3F3R A;  3DKS A;  4N11 A;  4K7N A;  2Z9S A;  1FAA A;  2GTU A;  3HVV A;  4F0C A;  3IE3 A;  1FW1 A;  1M2D A;  4V2N A;  3M8N A;  1SU9 A;  4L0U A;  1BED A;  5KN1 A;  4EIQ A;  2HZE A;  1XWC A;  5F05 A;  1YKC A;  1Q4J A;  3ERF A;  4AKH A;  3GH9 A;  1OC8 A;  4F2I A;  3R3E A;  3QDN A;  3FKF A;  3IHG A;  5ABR A;  4G19 A;  5IPG A;  3HJP A;  2F8A A;  1GLQ A;  2EIR A;  5HR0 A;  2QKE A;  2LNS A;  1OE7 A;  1N25 A;  3TKS A;  4JBB A;  3GL5 A;  2F8F A;  4K5R A;  5LD0 A;  1MEK A;  4N30 A;  1FOV A;  3QAW A;  1EP8 A;  1O85 A;  1B48 A;  5JWR B;  5IPH A;  3NIV A;  2PN8 A;  1DE1 A;  3D6I A;  4D73 A;  2J9H A;  1YEP A;  2LEG A;  5D8I A;  2DSA A;  2PBJ A;  5DDL A;  1EV9 A;  1X5C A;  3VWV A;  2VLV A;  5INY A;  2GT5 A;  2I81 A;  4MZB A;  3QPM A;  4YQM A;  1UVZ A;  4MMM A;  2EC4 A;  3KH9 A;  3EYT A;  2K8S A;  2IWT A;  3HCZ A;  4X0X A;  3LXZ A;  4L5L A;  2I9H A;  5B6N A;  4XTS A;  3WYW A;  3GNJ A;  2CQ9 A;  2PPT A;  4ECC A;  3DVX A;  2VL2 C;  2N5B A;  4BA7 A;  1VGL A;  3D0Z A;  1KEB A;  2HZE B;  3C7M A;  4N0V A;  4OO4 A;  4OCE A;  4KX4 A;  2R6K A;  5AGY A;  4PXO A;  3C8E A;  4GST A;  5BMU A;  2V6K A;  4A5P A;  1AAZ A;  2EFH A;  4HOJ A;  11GS A;  4TR1 A;  3C71 A;  4E8E A;  2LKU A;  3IV4 A;  3LWA A;  1A24 A;  2B1K A;  2OT3 A;  4I6X A;  1SK1 A;  1YVL A;  2LS5 A;  4O32 A;  5A1N B;  4IQA A;  1EEJ A;  1DSB A;  2R37 A;  2DJ1 A;  3MDK A;  1NM3 A;  4ZL7 A;  3Q18 A;  1V9W A;  1K0O A;  1EV4 A;  4POL A;  4XCS A;  5JWQ B;  3GMF A;  4IS0 A;  2X99 A;  3ZRE A;  4HQS A;  2HSM B;  3HJM A;  1G0T A;  1CQG A;  2X49 A;  1XWK A;  1R26 A;  6GSW A;  1JLW A;  1GSE A;  1DE2 A;  3IC8 A;  3R2Q A;  4LMV A;  3TJK A;  2G2Q A;  2OE0 A;  2C0G A;  4K5S A;  4RUV A;  2D2Z A;  2LTK A;  1ERU A;  4V2M A;  2IME A;  4EVM A;  4AKX B;  2TRX A;  4MP4 A;  4Z2T A;  1XIY A;  4YAP A;  1PA3 A;  4JED A;  1ZYN A;  2AJQ B;  4FYB A;  3C1R A;  3KP9 A;  2H0H A;  4GLT A;  4POM A;  1ABA A;  1W89 A;  3UEM A;  3TJB A;  3A2V A;  4NHW A;  4IGJ A;  2L4Q A;  6GST A;  3DEX A;  1O7U A;  1A0F A;  1XW5 A;  3LXT A;  2YNX A;  1AC1 A;  2RUE A;  3ZIJ A;  5IOW A;  4TR1 B;  2CVK A;  5J9B A;  3APQ A;  3HKR A;  1PN9 A;  4POK A;  2I3Y A;  2VL2 A;  2BJX A;  1AQV A;  3F8U A;  4ECJ A;  1JZD A;  3GN3 A;  2YZH A;  3I43 A;  2FA8 A;  1TK5 B;  5ECM B;  1WPI A;  2XPD A;  1V58 A;  5LCZ A;  2H1L A;  2H6X A;  2DIY A;  4KAE A;  4K2D A;  2R3X A;  4XRD A;  1T00 A;  4X1U A;  3TU3 B;  5DQY A;  4MZC A;  1GTA A;  4ZB8 A;  3TKR A;  1HNA A;  4GQF A;  4HQZ A;  4PGT A;  2WJU A;  1GSD A;  12GS A;  3KXO A;  4N0Z A;  5ECL B;  2L5L A;  5GAP D;  2RM6 A;  2E0Q A;  1WJK A;  2GSS A;  1E2Y A;  5J4U A;  4MK3 A;  1M0U A;  4EC0 A;  1ERV A;  5HFI A;  4MNN A;  5A5H A;  2YOI A;  2ES7 A;  4WKW A;  5DBQ A;  1U88 A;  2F3M A;  2HRF A;  3KTB A;  1BG1 A;  3HYP A;  19GS A;  4LA1 A;  4G0L A;  3CWG A;  2KHP A;  4EDZ A;  4GTU A;  5KOW A;  4EKZ A;  4LLR A;  2N5A A;  2C3N A;  3CRT A;  1WWJ A;  3APS A;  3LEF A;  1SK0 A;  4KH7 A;  1FB6 A;  4ZB6 A;  4ZXG A;  1S3A A;  2FWH A;  5A34 B;  1SL0 B;  4QMK A;  4NV2 A;  2EFC A;  2V6O A;  1EGO A;  2UZ8 A;  1VF4 A;  2OE1 A;  2H6Y A;  3P2A A;  2AAW A;  2HI7 A;  1F37 A;  4IJ3 A;  2N5F A;  2LUS A;  2I1U A;  1G6Y A;  5H5R A;  20GS A;  5A4W A;  4I2U A;  4TN8 A;  4L0W A;  3VK9 A;  1TK8 B;  1TI1 A;  1USB A;  4NPB A;  2RII A;  4BL7 A;  5CNW A;  2NBS A;  3CSI A;  2VOC A;  4DVC A;  2GLR A;  5F06 A;  1M99 A;  1HNB A;  2AYT A;  4I5Q A;  4AKI A;  3H93 A;  2P0G A;  3VUR A;  1YKA A;  4WXT A;  5HR3 A;  2CT6 A;  3E0U A;  1AQW A;  5A5H B;  5BRT A;  3GFK A;  3Q74 A;  3KP8 A;  4MH2 A;  3IPZ A;  4RI7 A;  2AHE A;  1FVK A;  5HR2 A;  4OFT A;  1S3C A;  5HQP A;  3BCI A;  3UVT A;  2VCV A;  4YAV A;  1SL1 B;  3FRC A;  1AXD A;  5IMF A;  2GZZ A;  1E6B A;  3RHB A;  5EVO A;  3CTG A;  1PX7 A;  1NSW A;  3MNG A;  3TRX A;  4ZBD A;  2O7K A;  3PH9 A;  3IOS A;  1ZYE A;  2LJR A;  2CZ2 A;  3ZLP A;  2C4J A;  3IXR A;  4POB A;  2VCQ A;  1SD9 A;  1U3A A;  2IJY A;  1X9M B;  2L57 A;  1GTB A;  1RQM A;  2WCI A;  1B4Q A;  1TK0 B;  1K0A A;  4KSO A;  2VD0 A;  1PL1 A;  3E9J B;  3LGC A;  4BL7 B;  5E59 A;  3M1G A;  2FWG A;  5D96 A;  2A2P A;  1YZX A;  2HYX A;  2HRN A;  4BPY A;  1WMJ A;  1T3B A;  1PKZ A;  2OBK A;  2R5G A;  3FZA A;  4USS A;  3HMJ G;  4AJ8 A;  4MZW A;  1YQ1 A;  3EIN A;  1SVO A;  1VF1 A;  4RQR A;  5DJL A;  1XWB A;  4G10 A;  3UL3 A;  5J40 A;  4DSS A;  4ECB A;  4HZ4 A;  4MH3 A;  3GRX A;  1XOA A;  3H1N A;  4XHM A;  1O73 A;  3RBT A;  3VI7 A;  4FO5 A;  5EPF A;  3MYD A;  4ILF A;  3I6A A;  4WR5 A;  3UIW A;  1J08 A;  1URM A;  2EIQ A;  4BVX A;  4AKG A;  3HHV A;  3FZ9 A;  3IDV A;  4MLY A;  4MPG A;  2B7K A;  2F9S A;  1AIU A;  4PUA A;  1I5G A;  3CMI A;  3DD3 A;  4KGI A;  2HLS A;  2OAD A;  6GSX A;  2J23 A;  3FHK A;  1A23 A;  1TRU A;  1OYJ A;  18GS A;  4K9Z A;  4PNG A;  3RHC A;  3BOA A;  1PRX A;  4K1F A;  3TOT A;  1BYE A;  1BX9 A;  4WF5 A;  4K8M A;  1GSQ A;  3VFI A;  3P90 A;  1X0R A;  1IYI A;  3C73 A;  4K7I A;  1PQN A;  3EU4 A;  5B8B A;  3SBC A;  3EE2 A;  4KDU A;  1XXU A;  1F2E A;  2MZC A;  3HDC A;  4GCI A;  3GKM A;  5HFG A;  3A3T A;  1A0R P;  2NDO A;  4ZIL A;  4N3Z A;  1T7P B;  2OBI A;  2CV4 A;  1EGR A;  3KIJ A;  4HUA A;  2H66 A;  2DIZ A;  3W6G A;  4GWR A;  3NOF A;  2C3Q A;  3TGZ A;  2R2J A;  3TUE A;  2V41 A;  3H79 A;  5HR1 A;  1OKD A;  4PNF A;  5GZZ B;  2DJ3 A;  4MAB A;  2JZR A;  4I97 A;  3H4K A;  4HJM A;  2X8C A;  1OVN A;  2H76 A;  3ZVJ D;  3WGD A;  3EWL A;  4EUY A;  2HRA A;  2JZS A;  3APO A;  1Z7R A;  5KEJ A;  2GQM A;  3DVW A;  3D5J A;  1OE8 A;  3DXB A;  1N2A A;  4TW5 A;  3VPQ A;  2LJK A;  2LRN A;  4MDC A;  3EPT A;  3UBL A;  3ZL5 A;  3KTL A;  2C3T A;  2TIR A;  3NZN A;  1SVM A;  1I9D A;  2H0G A;  4EF0 A;  1EEM A;  3UBK A;  1W4V A;  1LU4 A;  2LRT A;  2CVD A;  2H75 A;  3ERG A;  3TJG A;  3JCM L;  4Z2R A;  4K2X A;  2VUP A;  2DLX A;  3KMO A;  3D4T A;  4ACS A;  2YN1 A;  3FK8 A;  1ILO A;  4V1A p;  1UC7 A;  2CAI A;  2K6V A;  2JU5 A;  4NMU A;  1JZO A;  4CDO A;  3HD5 A;  4IJI A;  1V2A A;  2JZT A;  3QAG A;  5GAN D;  2WB9 A;  3CBU A;  2L6D A;  2BTO T;  1G6W A;  2YZU A;  2XBQ A;  1ERT A;  2H1G A;  3VI5 A;  4AF2 A;  5ECN B;  1YDK A;  3ERW A;  1ON4 A;  2IMD A;  1T4Y A;  2VM2 A;  2ON7 A;  4YQU A;  3FZ4 A;  1GRX A;  4DSR A;  3FEU A;  3C1S A;  1XW6 A;  5G31 A;  2HT9 A;  3EUR A;  1SKR B;  2C0D A;  4W66 A;  3KMN A;  3IAM 2;  5J9C A;  5ID2 A;  2JSY A;  4O7H A;  1F3B A;  5DQS A;  1X9S B;  3F6F A;  2EIO A;  4EE0 A;  5JCU A;  3CSH A;  3EVI A;  1WOU A;  17GS A;  4G01 A;  4NWY A;  1A2J A;  1WRY A;  1MDK A;  3UMA A;  2WRT A;  3H8Q A;  4D73 B;  2GS3 A;  3AY8 A;  4WEY A;  2CZ3 A;  1IYH A;  4IQ1 A;  5J47 A;  4YH2 A;  3PGT A;  4HS1 A;  5IMC A;  4WBJ A;  1BG5 A;  1NHO A;  22GS A;  4TXV A;  3KCM A;  2VL9 A;  1SK2 A;  2DKH A;  4KW6 A;  4TR4 A;  5ECQ B;  4OFN A;  3F3Q A;  3ZFB A;  2YWM A;  3LYP A;  3MAK A;  1Z6M A;  3M9J A;  2JL4 A;  3L9S A;  1OAZ A;  3GX8 A;  3EMX A;  1ZYQ B;  2QA2 A;  5J4Y A;  2KUC A;  2HSH A;  3WT1 A;  2JSZ A;  1PMT A;  1GSY A;  3UJ1 A;  2L6C A;  2EFD A;  3GV1 A;  3KZQ A;  1BAY A;  2H6Z A;  5ENU A;  5CRH A;  3GYK A;  1MD4 A;  5BMU B;  3A2X A;  5ID2 B;  1YY7 A;  3F4S A;  3RAZ A;  3UOM A;  2YJH A;  4JR6 A;  1SYX A;  4HU7 A;  2H19 A;  4ZL9 A;  1Z7P A;  2BMX A;  3G7Y A;  1G7O A;  2LJA A;  1GUM A;  3IRA A;  2GST A;  3P8W A;  2LV3 A;  1JLV A;  1ZZY A;  1GSS A;  2CX3 A;  1H75 A;  2VAF A;  1VF3 A;  2IFQ A;  4J56 E;  3U5R E;  3GST A;  4CW9 A;  2MYG A;  2L4C A;  3DYR A;  4HU9 A;  1FVJ A;  4ULX A;  2O5V A;  4KDY A;  5EL8 A;  2GQL A;  4MPF A;  5A4U A;  5IO0 A;  4HDE A;  1PX6 A;  3I9V 2;  3K8N A;  5G5F A;  4F0B A;  4F82 A;  4NV5 A;  5D73 A;  3L9U A;  1A2M A;  2ZUP A;  4GXZ A;  3GX0 A;  2E2M A;  3O3T A;  2C0E A;  1UN2 A;  5CRG A;  16GS A;  3TKP A;  2FD3 A;  2XPE A;  1H4O A;  1AUC A;  4ECI A;  3DGQ A;  1YEX A;  2G0F A;  1A2L A;  3QD9 A;  2B1L A;  4BWQ A;  5G30 A;  1FHE A;  4JRR A;  2P31 A;  2PWJ A;  4ZB9 A;  4HZ2 A;  2FA4 A;  2H01 A;  2ZNM A;  1K3Y A;  3PR8 A;  1GUL A;  1Q98 A;  2MBS A;  4KDX A;  3CSJ A;  1OC3 A;  2EFE A;  5IM9 A;  1MTC A;  2NPB A;  3CYN A;  5G1L A;  1LJR A;  2ALB A;  2V1M A;  4MF5 A;  4FIW A;  2YCD A;  4TR3 A;  4LL4 B;  4OMV A;  1CQH A;  3TDG A;  1TP9 A;  1J0F A;  2MMZ A;  1PKW A;  1S3D A;  2IIY A;  4OD7 A;  4HEA 2;  3MSZ A;  3US3 A;  3TOU A;  1HD2 A;  3GUR A;  2FWE A;  1RW1 A;  5H5Q A;  1F6M C;  3LW9 A;  3DIE A;  2DJJ A;  4O92 A;  2GSR A;  1ZMA A;  5F0G A;  3ZML A;  1PL2 A;  3VWX A;  2ZCT A;  4NXI A;  2ON5 A;  3GHA A;  4ZL8 A;  5DCH A;  4MA9 A;  2WGR A;  2E2G A;  1TKD B;  2OAC A;  1GNW A;  2HNL A;  4JU5 A;  3ZTL A;  4GSS A;  2RLI A;  2RUF A;  1ERW A;  3ZVJ A;  1U3I A;  1QQ2 A;  4TVE A;  1YJ6 A;  10GS A;  4ML6 A;  4E8H A;  5ECK B;  1XVQ A;  2PVO C;  1YF0 A;  3L9V A;  4G0K A;  3KD0 A;  5G5E A;  1VF2 A;  2FLS A;  4YKF A;  2R0G A;  2FCH A;  4PUR A;  3G9B A;  2WS2 A;  1SL2 B;  3TCO A;  3F4R A;  4H86 A;  2KP2 A;  2OJL A;  1XWG A;  3ZIV A;  5KN2 A;  1A8Y A;  1B9X C;  3WGE A;  3FW2 A;  2PER A;  5IOX A;  5B7C A;  1NW2 A;  4WET A;  2YV9 A;  3WD6 A;  2E7P A;  1GNE A;  2DMM A;  5AIV A;  2YP6 A;  1R4W A;  2FHE A;  3TRQ A;  3GUS A;  2PGT A;  1TJD A;  3I69 A;  3FR6 A;  4OCF A;  3N9J A;  3PPU A;  3LG6 A;  3F0I A;  1EP7 A;  4JR4 A;  4KB3 A;  2H1B A;  1K0D A;  5D9V A;  4EIP A;  1K0B A;  2XBI A;  1JHB A;  1TRS A;  1JZW A;  3GL3 A;  1Z9H A;  1B8X A;  2NVL A;  3RPP A;  3F6D A;  2K18 A;  2HSN A;  3EU3 A;  2C0F A;  3TKS C;  2H73 A;  2DML A;  1QK8 A;  1FG4 A;  3DML A;  3UAR A;  1F3A A;  1TTZ A;  2LRC A;  6GSS A;  1TU8 A;  3FYG A;  5ELG A;  4Q5F A;  1SYR A;  1G7E A;  4WR4 A;  5J5N A;  3A2W A;  2HZF A;  1K0C A;  2M46 A;  1LBK A;  2H70 A;  3QCP A;  3FY7 A;  1K0N A;  4ID0 A;  1M2A A;  2H72 A;  1PSQ A;  4XS6 A;  4GF0 A;  5L71 A;  4DEJ A;  4I8B A;  5GST A;  2FNO A;  3ZFL A;  1TXU A;  2GGT A;  2H71 A;  1C72 A;  1BF5 A;  5D93 A;  1U87 A;  2IPA A;  3TB2 A;  1SKS B;  3GTU A;  4PQ1 A;  1TU7 A;  4G2E A;  2R0C A;  1SJZ A;  6GSU A;  3DWV A;  1EOG A;  2WFC A;  2O85 A;  5ELA A;  2V32 A;  2JAD A;  2IMF A;  4MJB A;  3D22 A;  5G2Z A;  5G1K A;  4DSS B;  1TI3 A;  5ECH B;  2A2R A;  1TDI A;  1V57 A;  4K7O A;  4KSM A;  1Z5Y E;  4IHU A;  3DRN A;  2OE3 A;  1GL8 A;  5D9W A;  2B3S A;  3L78 A;  1BQ7 A;  2X4A A;  2HSN B;  3WT2 A;  1QXH A;  3IAS 2;  2H1D A;  4BVX B;  3ZZX A;  5LNK e;  1QGV A;  3IK9 A;  1UA5 A;  2JAC A;  5COH A;  4PQI A;  1B4P A;  2A4H A;  5DVB A;  2MMA A;  2TRC P;  3A5I A;  4EDY A;  4XRA A;  5C04 A;  5JWO B;  3IHQ A;  3VPT A;  1M2B A;  2C1Y A;  4P3Y B;  1AW9 A;  3ZIT A;  4V2L A;  1YF1 A;  3EMP A;  1QUW A;  4EO3 A;  3LOR A;  3N5O A;  4MF6 A;  1RK4 A;  1Z6N A;  1ZL9 A;  1FOH A;  4ML1 A;  1T8E B;  5FHI A;  2PUK C;  2IMK A;  3HZ8 A;  2PMT A;  1O6J A;  2A2S A;  2GVP A;  4IW9 A;  1EWX A;  3TKQ A;  4O5R A;  3GTU B;  4K6X A;  5A1N A;  4O5Q A;  4ZBB A;  2C80 A;  2K8V A;  5IMD A;  3ZRD A;  6GSY A;  3QAV A;  1KTE A;  5D9X A;  2MMO A;  2VCZ A;  1XVW A;  2YV7 A;  4MF7 A;  1TXX A;  2DC5 A;  2DKI A;  2HSM A;  1K0M A;  3IA1 A;  4HJ2 A;  1HYU A;  5JCW A;  2X8G A;  4KCA A;  4G0I A;  3F63 A;  4Q5R A;  1THO A;  5J3R A;  1XCC A;  3D4M A;  4PTS A;  4AI6 A;  2OKA A;  1O81 A;  5KN0 A;  4RQX A;  1GP1 A;  2X8H A;  4Z7X A;  1SD8 A;  2L59 A;  1MDJ A;  5IMZ A;  14GS A;  5DAK A;  4AJ6 A;  4MJC A;  1EOH A;  1T4Z A;  3Q19 A;  4E68 A;  5C00 A;  3LQ7 A;  3O6T A;  7GSS A;  4JE1 A;  1WE0 A;  4XS1 A;  4IKH A;  1OKT A;  2CVB A;  1O8W A;  1PN0 A;  3D21 A;  3UAP A;  3KH7 A;  3ME8 A;  1JFU A;  1PD2 1;  2MBT A;  5JCG A;  4CY6 A;  3GKX A;  2CAQ A;  4I2T A;  4WBR D;  3G7J A;  4KA0 A;  2VLU A;  3IK7 A;  3VWW A;  1XWA A;  3A5W A;  2VKZ G;  4L8E A;  1M7T A;  1BJX A;  4KCE A;  4TKY A;  2H74 A;  4J2F A;  1GSU A;  2PVQ A;  1XFL A;  4Q5Q A;  3W8J A;  2IN3 A;  2PU9 C;  5AIS A;  2GT6 A;  5J4V A;  3G7I A;  2YWO A;  4PUF C;  2RM5 A;  3IC4 A;  4WF4 A;  2YWN A;  5IMV A;  1Y6E A;  4DSQ A;  2REM A;  2VCW A;  1XZO A;  2M72 A;  2YWI A;  5DAL A;  1XPV A;  2VO4 A;  1ACV A;  2O8V B;  4KF9 A;  4EL1 A;  2HRK A;  3SWL A;  1X5E A;  2K9F A;  3M9K A;  4G9H A;  5HFK A;  5DAK B;  1GTI A;  3FZ5 A;  1V98 A;  4FYU A;  4CHS A;  6GSV A;  2HXK A;  4ICY A;  3ISO A;  2H30 A;  5CRE A;  3IR4 A;  3GH6 A;  2P5Q A;  1R5A A;  1ZOF A;  3FR3 A;  2KOK A;  2IL3 A;  3TJJ A;  5ECO B;  4LMW A;  4K0N A;  1ZYP A;  1HQO A;  4QL7 A;  3TKS E;  5A34 A;  2GSQ A;  2QC7 A;  3VWU A;  2B5Y A;  4Q5N A;  4GSN A;  4FQU A;  4OFM A;  2KLX A;  4X43 A;  4EXJ A;  2B5E A;  2DJK A;  1Y25 A;  3M0F A;  1DBY A;  2V2G A;  2YPM A;  5A4V A;  2CX4 A;  4XS4 A;  5DCG A;  3MWH A;  4PX1 A;  3FMW A;  4Z2U A;  1X9W B;  1Z3E A;  4F9Z A;  8GSS A;  1NHY A;  5B8A A;  2HE3 A;  1TW9 A;  4IEL A;  2QGV A;  5FWG A;  2H1A A;  2VM1 A;  5DAL B;  2VLT A;  3CRU A;  1R5P A;  2HRK B;  3ME7 A;  3GKN A;  5AIX A;  4KE3 A;  4PQH A;  1KNG A;  3LSZ A;  2H8L A;  1DUG A;  3OR5 A;  1FO5 A;  2CA8 A;  5B6M A;  5AN1 A;  1XBS A;  1K3L A;  5J41 A;  3GIX A;  1OC9 A;  3V1W A;  1MD3 A;  2HQT A;  3BBY A;  4NHZ A;  2A4V A;  3CTF A;  2FUG 2;  5ECP B;  3PIN A;  2L5O A;  4GQC A;  4J57 E;  4OO5 A;  1SKW B;  5CYY A;  3P7X A;  2IFQ B;  1WIK A;  4BVY A;  3J7Y k;  1XW9 A;  13GS A;  5CRW A;  2M80 A;  5IIZ A;  3QFB C;  4BWS A;  3FR9 A;  2GDR A;  4V1A g;  3GKK A;  3F9U A;  2F51 A;  3U6V A;  1U6T A;  2R0P A;  5A5K A;  3S9F A;  1R7H A;  3W8S A;  2HFD A;  3L4N A;  1Y1U A;  4QQ7 A;  4XS4 B;  3BJ5 A;  2YAN A;  2AV4 A;  2WUL A;  3ZYW A;  1M9B A;  9GSS A;  4ISD A;  2O87 A;  1A8L A;  2IMI A;  3RDW A;  3J7Y b;  2FWF A;  3IBH A;  3QMX A;  5ECI B;  4ZIJ A;  5CAX A;  2XHF A;  5CP1 A;  4TR0 A;  3TRP A;  2B5X A;  5KN3 A;  2UV8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...