4JZQA

Crystal structure of human clic1 c24d mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
237
structure length
237
Chain Sequence
QPQVELFVKAGSDGAKIGNDPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Crystal structure analysis of CLIC1 C24 mutants
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 82
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4jzqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4jzqA01
3BJ5A 4ZIJA 1XWGA 2IIYA 2QKEA 1JLVA 3LGCA 3WYWA 2AYTA 4TXOB 5JCWA 2WB9A 1AXDA 2YP6A 1R5PA 5D73A 4KDUA 5CNWA 2H75A 4TR0A 1KBNA 1ZCPA 1Q4JA 1OC8A 2MZCA 3GKKA 3ZVJA 2IMFA 1JZOA 1H75A 5IIZA 1PL1A 3F8UA 2P5RA 2NBSA 3APOA 3NZNA 1E6BA 1U88A 3F9UA 1AW9A 2R5GA 1V57A 2VL2A 5JCUA 1H4OA 1FAAA 2LTKA 2FHEA 4GQFA 1SK2A 1TKDB 1TU8A 2VLUA 3CTGA 1LBKA 4IN0A 2DJ3A 3F3QA 1G6YA 4E8EA 1DUGA 4IHUA 3IK7A 1T8EB 2J23A 1GSSA 4HZ4A 4N30A 3CTFA 3GH6A 3GA4A 5IO2A 1JZWA 10GSA 3G7JA 1K0BA 2VD0A 4EL1A 4KNDA 1U3IA 5D93A 3C1RA 4MH3A 1SKSB 3O3TA 5A4UA 4D73A 4HU7A 3KH7A 1ERTA 1LJRA 3VI5A 2FWGA 1AQWA 3ZFBA 3E9JB 2ZCTA 4F9ZA 5E59A 3VWWA 4MMMA 4MK3A 3GV1A 1UN2A 3F3RA 1K3YA 2F9SA 2GZZA 3P2AA 2MBSA 2PERA 1Y6EA 1V9WA 4IGJA 4KGIA 2VCXA 4OO4A 3QAGA 4KCEA 1JZRA 2A2SA 1FVJA 1IYHA 4GF0A 2B6MA 2D2ZA 2ON7A 2JU5A 1ZOFA 3P8WA 3APQA 3KXOA 4PURA 3EE2A 1EP8A 1BYEA 3QAWA 1K0OA 4ULXA 1T4YA 1MEKA 2HSNB 5G5EA 3I43A 5IMVA 2DMMA 4IJIA 3QD9A 2HRNA 2K9FA 1QMVA 3TB2A 2TIRA 4GLTA 3D21A 3F4TA 2FWEA 2YWNA 1X9SB 3L0HA 2LJRA 2J9HA 1ZGNA 2OA7A 4LL1B 1O8WA 3GTUB 1GSYA 4J57E 4HZ2A 4I97A 2PGTA 3C1SA 3GIXA 3P7XA 1T7PB 3LYKA 2LS5A 4MP4A 2RLIA 3QFAC 4TR1A 3VWVA 1U3AA 5L71A 1FB0A 4LMWA 2H0HA 2MYGA 4L5OA 1OVNA 1TI3A 3ME7A 3A2XA 2AUVA 3IOSA 3S9FA 1XBSA 3CMIA 3U6VA 2VOCA 5IM9A 4WR5A 4NHWA 2YZUA 3VURA 5DQYA 5EY6A 3GL3A 1YKCA 2I1UA 4GCIA 4BVYB 3CSIA 3KMNA 3NOFA 1PX7A 2N5FA 1B4QA 5AN1A 4G0IA 4KX4A 2C8UA 4OD7A 4WBRD 2JSYA 4ZXGA 2IJYA 2XBIA 5A5KA 3ZTLA 2C4JA 1WOUA 2IN3A 3A2WA 2AB6A 1SK1A 3HJPA 3D22A 4HEA2 4QQ7A 3ED3A 1XXUA 5D96A 1NHYA 1EV9A 5G1LA 1EEJA 2ALBA 3QDNA 4ISDA 1MDJA 5A4WA 5H5QA 1YDKA 1K0DA 3ZFLA 1QFNA 3Q19A 3SWLA 2VLVA 1NHOA 4HJ2A 4F0BA 5DBQA 2V41A 2HNLA 4WETA 3HZ8A 1MD3A 2H76A 4ACSA 2MMAA 2VL3A 3F63A 1VF4A 5IOWA 4BA7A 4POKA 3VLNA 2V2GA 4ZBDA 3GUSA 2I81A 2LQQA 3EU4A 4WR4A 4KB3A 4EUYA 3QAVA 1PA3A 1JFUA 4TN8A 2YV7A 3C73A 2CV4A 4MZWA 3UOMA 3KGKA 3W6GA 2KOKA 3G7YA 3ERWA 4F82A 3KH9A 2HFDA 4G10A 3BBYA 1V98A 4TKYA 1FO5A 3HY2A 2RUEA 5E4WA 6GSXA 3IC4A 1BEDA 2H72A 1T00A 3H1NA 3TJBA 1TDIA 2EIOA 4XCSA 1HNBA 3QR6A 1OC9B 2N5AA 2X99A 4TXOA 1SK0A 1A8LA 1B48A 1SL0B 2HRKB 4NPBA 2HYXA 2HZEA 5CO3A 1W89A 4HDEA 4YAVA 2X64A 4ZB8A 2HQTA 4DSSB 5AIVA 2MMZA 3HJMA 5HR3A 1TK0B 2PVOC 2ZNMA 2DJJA 4JEDA 2H74A 1GWCA 5DCHA 2IL3A 2DMLA 1HYUA 3QOUA 4F03A 2ON5A 3A3TA 2H70A 2CZ3A 5HR1A 4N10A 1PSQA 4NV2A 5ID2B 1AQXA 2LV3A 2GDRA 5BMUA 1ERUA 2IFQA 4MF6A 1G6WA 3VWUA 3FZAA 2LNSA 1W4VA 1A23A 4L5LA 3QPMA 4ZILA 1Z3EA 1EOGA 3L4NA 4KH7A 1U6TA 5IMAA 3UVHA 5AGYA 5CYYA 3BD2A 3IXRA 4MDCA 5J3RA 4O92A 3LWAA 5ABRA 3TKSE 3EMXA 3DIEA 1YJ6A 1ML6A 1YZXA 4TXVA 6GSWA 4XS6A 4NMUA 3UJ1A 2LQOA 4PQIA 5IMDA 3G9BA 14GSA 5CP1A 2FA4A 2GS3A 4MJCA 5KN3A 3FZ5A 3TDGA 2VO4A 5D9WA 4YQMA 4MJAA 1GSUA 4YQVA 3Q18A 4KW6A 5C00A 5F07A 3ZREA 2GSTA 3KCMA 3TUEA 2M46A 1XOAA 1JZDA 2O87A 4X0XA 4KE3A 4K6XA 4F2IA 4N0VA 1PGTA 2CA8A 1SD9A 5EL8A 1SJIA 2G0FA 2LNTA 1Z7RA 1R4WA 3LFLA 1XVWA 2DBCA 4XRAA 3TJFA 4IJ3A 4KDXA 1AAZA 5F06A 4L8EA 3GTUA 4MPGA 2GQLA 2JZRA 2QC7A 5B6NA 4IBPA 2M80A 1YQ1A 4MF5A 2C1YA 3FR9A 3HZ4A 5ECLB 3DRNA 2KLXA 4BWSA 5D8IA 6GSUA 4POLA 1QXHA 3HHVA 3MSZA 3O76A 5CAXA 9GSSA 3A5WA 2HI7A 3H4KA 1S3AA 4MABA 1YF1A 4RUVA 1TP9A 4PTSA 5HQPA 4MH2A 1A24A 2HLSA 4BVYA 1KTEA 3CRUA 2DIYA 3TKPA 3EWLA 4PNFA 1F3BA 5DAKB 1RQMA 3MNGA 3OR5A 4DSRA 3TKSA 4GXZA 3E0UA 4GSTA 5DALB 4AJ7A 4WF4A 2HSYA 2VM1A 5LCZA 3BOAA 4EC0A 5ECMB 1ST9A 5ECRB 2PUKC 2RM6A 3IHQA 4TVEA 3VPTA 5IPGA 4EKZA 1SKWB 2H30A 1B9XC 5D9XA 4PX1A 4BL7B 4X43A 2YCDA 2V1MA 1BX9A 2CVBA 1GUKA 3LG6A 2KHPA 3WT1A 1XW6A 1TXXA 1XIYA 1EV4A 2EIRA 3GN3A 3TJJA 2V32A 1F9MA 4ECJA 3MDKA 2WZ9A 5G30A 4LL4B 4K7OA 1YY7A 1XVQA 1GTBA 1V2AA 3D5JA 3SBCA 5HFKA 5FHIA 3Q6OA 2LRNA 1XWCA 2H8LA 2OBKA 3LEFA 4V2LA 2DJ1A 3KD0A 4FIWA 3VFIA 2VLTA 4L0WA 1GSDA 4L0UA 11GSA 5CREA 1YEXA 3RHBA 1AQVA 1J9BA 2IMIA 4AJ8A 1GLQA 4OO5A 3KM6A 2WULA 1HD2A 3LQ7A 5B8BA 2H1GA 3IAM2 4IELA 1SU9A 3ZLPA 5C04A 5D9VA 1NW2A 3UEMA 3D6IA 2DLXA 1MD4A 4CHSA 2GTUA 5ECIB 1CQGA 3F0IA 1GSEA 1OC9A 2YPMA 2PMTA 4HI7A 3PPUA 4EDYA 2C80A 4X1UA 4YH2A 4G9HA 3FEUA 2HRKA 4JBBA 3FRCA 4HOJA 4JZQA 3F6DA 4E8HA 3I69A 5ECKB 1G0TA 3MAKA 3CSJA 4N11A 4G19A 2HSMB 1JHBA 4IQAA 2CAIA 1X9WB 4GSNA 1A2LA 5KN0A 1R5AA 5J9CA 2VIMA 3TKRA 1V58A 2P31A 1A2JA 4K0NA 4BVXB 1G7OA 2K8VA 3GRXA 5DDLA 4MA9A 2H71A 2C3TA 2B7KA 5ID2A 2H6ZA 2K18A 2O85A 3TRPA 2B7JA 1ERWA 1F3AA 3HVXA 2NTOA 4KSMA 2YNXA 2H01A 1X5EA 2C0DA 3TRQA 4ILFA 1OAZA 2CVDA 4YQUA 3ZITA 1PL2A 5COHA 3F4SA 4MJEA 4FO5A 1DE2A 1T1VA 1TRVA 1PQNA 4XRDA 3LXZA 3G7IA 2VCZA 4JU5A 3KZQA 4KDYA 2FLSA 3RAZA 3HKRA 3UMAA 2HZFA 2H6YA 2E2GA 1HNCA 1Z6MA 3D4TA 5CRWA 4RQRA 5LNKe 4TR4A 4JRRA 2XHFA 4N0ZA 3EURA 3WGXA 3ZRDA 4EO3A 4IW9A 4IVFA 2H0GA 1FW1A 1A0FA 5CRDA 3I9V2 1EEMA 1C72A 2YN1A 1NM3A 1FB6A 1TJDA 3IPZA 1K0MA 1Z9HA 5ECSA 2K8SA 1OYJA 1VF2A 4OCFA 4CDOA 3DKSA 1B4PA 1YKAA 4K7NA 2GSRA 4PQ1A 2JACA 4D73B 1TK8B 2IMKA 1KNGA 1G7EA 1URMA 1TI1A 1OKTA 2VCQA 16GSA 4FH8A 1B9YC 2HXKA 4GTUA 1HNAA 2G2QA 2H1DA 5JWQB 3TRXA 1AUCA 4FYCA 2PN8A 3TKQA 3RHCA 4HJMA 5KN1A 1M2AA 3KMOA 5DJLA 6GSTA 1QGVA 2PBJA 2LRTA 1ILOA 1PKWA 3NIVA 2CT6A 3HXSA 5KN2A 1VF3A 4P3YB 2LJAA 2UZ8A 1RK4A 3Q74A 1XPVA 1M9AA 2XPDA 1NSWA 2EC4A 2WRTA 1M9BA 6GSVA 1SD8A 5DAKA 3HDCA 3U5RE 5IPHA 1K0NA 3GURA 1PD21 3GFKA 3HA9A 1GTUA 2VL9A 2L5LA 3UBLA 2TRXA 13GSA 1BAYA 1EOHA 1GUHA 1SJZA 2YANA 4OCEA 4XHMA 4ID0A 5DALA 3IV4A 3A2VA 4ZBBA 2L6CA 1EZKA 1SENA 2IWTA 5J41A 4JE1A 4MPFA 1TRWA 2L5OA 1M2BA 4DVCA 1V40A 4BL7A 2F51A 4QL7A 5ECOB 2C3NA 1K0AA 3DMLA 1X0RA 2PPTA 1OKDA 4TR1B 2DIZA 2I3YA 5ECHB 2H1BA 2X8GA 4OFTA 1J08A 1WE0A 2B5EA 1WWJA 2WDUA 2VCWA 2O89A 3V1WA 3ME8A 1ABAA 4PUFC 3FYGA 18GSA 2VUPA 2XC2A 1ZYQB 2GGTA 1S3CA 4H86A 3WD6A 1USBA 3UL3A 3GX0A 2R4VA 1QQ2A 2JSZA 1MDKA 3RDWA 3LJRA 2O8VB 1GUMA 1A8YA 2I4AA 2TRCP 4XS1A 3RBTA 5GAPD 2B5XA 2YWMA 1O73A 2OE1A 5JWOB 2BJXA 1XWBA 3ISOA 3GHAA 2YOIA 3IA1A 1PKZA 3M3MA 1SKRB 1BJXA 3ERFA 2NDOA 5EVOA 2H0IA 4I6XA 4KSOA 2A4VA 2JZSA 4KCAA 4TW5A 1FOVA 4GWRA 2GQKA 4XS4B 1X9MB 4K1FA 5B6MA 4ML6A 1R26A 1WJKA 3GKXA 2GZYA 1VGLA 2O7KA 4V2NA 2LKUA 2AV4A 3BCKA 5INYA 2LRCA 4IKHA 2FCHA 3EINA 4K9ZA 4IQ1A 1TTZA 2DJKA 3ZYWA 3I6AA 3HCZA 1QK8A 3M9KA 3JCML 4MF7A 3LXTA 1M7TA 3TGZA 2DC5A 4I2TA 3C71A 1SYRA 2GT6A 2OBIA 2OJLA 5GSTA 4BVXA 5IMFA 3HD5A 2V6OA 5J9BA 4V1Ap 2HE3A 2OACA 6GSSA 3ZVJD 4F0CA 2IPAA 1EGOA 3QMXA 2C0EA 1XWKA 4OFMA 1N2AA 2R6KA 2M72A 2FD3A 4PQHA 2L59A 2VM2A 2OE3A 4K8MA 3GKNA 2YJHA 4NV5A 4Q5NA 3FW2A 4O5RA 4IP6A 1GH2A 4WF5A 1TRSA 2L57A 2MMOA 4TR3A 2IMEA 2CQ9A 1T3BA 2CX4A 1UA5A 1XW9A 4G0LA 3KP9A 2GQMA 3GL5A 4PXOA 3KTBA 4Q5FA 2HZEB 4KUNA 5IQYA 3KP8A 2H6XA 4BWQA 3GMFA 3WGDA 1FVKA 3R2QA 3W8JA 5HFIA 4POBA 3KJYA 4OMVA 2FUG2 4O32A 4LLRA 5FWGA 3GSTA 2B1LA 2LUSA 3CXGA 1FHEA 2L4CA 1UC7A 3W8SA 5LD0A 2KP1A 3FZ4A 1VRSD 3TJKA 5GSSA 4DSQA 2VAFA 1KEBA 4KF9A 2IFQB 5B8AA 3PR8A 3IK9A 3GKMA 1XWAA 4MZBA 4I5QA 2L6DA 3ZIJA 2C0FA 5G2ZA 1DE1A 4LMVA 2C3QA 4RQXA 1T4ZA 3J7Yb 4J56E 3US3A 1SL2B 4YAPA 1OE8A 1I9DA 5J4UA 2FY6A 5DCGA 3L78A 4FYUA 2AAWA 1OE7A 5G1KA 4XIHA 1J0FA 5HR2A 4XTSA 2FGXA 3HJOA 3TKSC 1Z5YE 1F37A 2REMA 1O7UA 3FZ9A 5DQSA 4V2MA 1TW9A 1ACVA 2XPEA 2K6VA 2WS2A 4GQCA 3UVTA 1RW1A 2KP2A 1GTIA 1QUWA 1WPIA 1BQ7A 2N5BA 1EGRA 2VL2C 2MMNA 3CSHA 2HSHA 1MDIA 2LJKA 1WP0A 4Q5QA 3DVWA 4ML1A 5B7CA 2WGRA 2HRFA 2YV9A 5GAND 3PGTA 4ZB9A 2CVKA 1I5GA 3CYNA 4DSSA 3N9JA 20GSA 3C7MA 2GT5A 1GL8A 2HRAA 3M0FA 3D4MA 3VPQA 1ZL9A 5ECQB 3WGEA 4FYBA 3J7Yk 3LSZA 2KUCA 1GSQA 2MBTA 2QSIA 4K0GA 2WCIA 2CZ2A 1Y25A 2WFCA 4I8BA 1IYIA 3F6FA 3EC3A 3AY8A 2YWIA 2P5QA 1EP7A 1M0UA 1TU7A 1PMTA 5CRHA 1GRXA 2YJ7A 4ECCA 4Q5RA 3ERGA 1JLWA 5DVBA 2X8CA 2H19A 3K8NA 4EF0A 2YWOA 3R3EA 5HFGA 3IDVA 2I9HA 4NXIA 5JWRB 1TK5B 4LA1A 2V6KA 5A4VA 1WMJA 3L9SA 4CW9A 2LEGA 3H8QA 4FQUA 2F3MA 3D0ZA 3GSSA 3QFBC 2IMDA 1F6MC 1U87A 1O81A 2RUFA 2BTOT 2VCTA 4G2EA 3M8NA 3PH9A 1GNWA 3RPPA 2VD1A 5F05A 1ZYEA 4IP1A 4ECBA 1A0RP 3FHKA 5IO0A 1OC3A 8GSSA 4GRFA 17GSA 1K3OA 4RI7A 3TJGA 3CBUA 4JR4A 5KEJA 1A2MA 2GSQA 2R3XA 2QGVA 4BPYA 2FA8A 3LYPA 2YZHA 4ZB6A 2ZUPA 5ENUA 2XBQA 3VK9A 3DWVA 4GSSA 1S3DA 5IMCA 4Z7XA 4XS4A 1EWXA 4RI6A 3KTLA 3H79A 3DEXA 2JZTA 1DSBA 1VF1A 3GYKA 1XFLA 4WBJA 2LSTA 5EPFA 1GP1A 4AJ6A 3L9VA 2VCVA 1PRXA 3UBKA 4EXJA 3EVIA 4ZBAA 1ERVA 1LU4A 1R7HA 2JL4A 1K0CA 1ON4A 1SYXA 3IBHA 4J2FA 5F8BA 1X5DA 4JR6A 1BG5A 1K3LA 3E3EA 2H66A 3FKFA 5FT3A 2GVPA 5H5SA 1UVZA 5AIXA 3HVSA 4QL9A 1E2YA 7GSSA 4EVMA 3PINA 1WRYA 3KIJA 3UARA 2PU9C 2DJ0A 1N8JA 3TCOA 1SL1B 4MJBA 5J5NA 1GSFA 1GTAA 3GNJA 2FWHA 3F4RA 3N5OA 3DVXA 2EIQA 3HVVA 3MWHA 4HQSA 1YEPA 1TRUA 3ZZXA 1SJ6A 3ZIVA 5ELGA 3LORA 2GZPA 2NVLA 3KEBA 3IR4A 4HS1A 1XCCA 4ZL7A 2E0QA 4NAXA 4MZCA 3H93A 1F2EA 2JADA 5DJMA 4DEJA 1XW5A 2CX3A 4TOPA 4OWYA 1ZZYA 1O6JA 1HQOA 2B3SA 5H5RA 6GSYA 1FG4A 2OKAA 4ECIA 4USSA 2P0GA 4POMA 12GSA 2NPBA 1PN9A 2R37A 3CRTA 5AISA 1B8XA 4ZL9A 1YF0A 2BMXA 4I2UA 4WXTA 3FY7A 2GLRA 4IS0A 4EDZA 3DGQA 3TOUA 2E2MA 5ECPB 5JCGA 1MTCA 2CAQA 5CRGA 1PX6A 3C8EA 1CQHA 3VWXA 2AJQB 3IAS2 3L9UA 4WEYA 1XOBA 4WKWA 2AHEA 4K7IA 3EMPA 3P90A 4AF2A 4AGSA 3FR6A 1AC1A 5HR0A 2WJUA 3RPNA 2L4QA 3DYRA 3FK8A 3GH9A 4HQZA 4OFNA 3TOTA 1DBYA 2ES7A 3ZMLA 2DSAA 22GSA 3GX8A 2C0GA 3IC8A 4KAEA 1O85A 1M2DA 1Z7PA 2H73A 2HT9A 2H1AA 2R2JA 4HUAA 4PGTA 5ELAA 3M1GA 3HYPA 4MLYA 3FR3A 2F8FA 5G31A 2GSSA 2PVQA 1Z6NA 2F8AA 2PWJA 4NWYA 5GZZB 1X5CA 1THXA 3DXBA 1GULA 3IRAA 4MCUA 3BCIA 4KA0A 2OE0A 2Z9SA 3EU3A 4V1Ag 2FNOA 3O6TA 5D9TA 1O8XA 3UIWA 1M99A 5ECNB 3ZMKA 2E7PA 3ZL5A 1Q98A 4PUAA 2B1KA 3VI7A 2HSMA 3UAPA 4PNGA 5G5FA 2B5YA 2A2RA 1WIKA 1AIUA 4K2DA 1XZOA 1ZMAA 2OADA 4NHZA 3EYTA 4G0KA 4EE0A 3DD3A 3IE3A 1TOFA 2RM5A 2X8HA 3M9JA 4O7HA 1GNEA 1THOA 1GLPA 4TRXA 2DJ2A 2RIIA 5IOXA 5IMZA 4ZL8A 5F0GA 3QCPA 3WT2A 2FWFA 19GSA 4HU9A 3APSA
chains in the Genus database with same CATH superfamily
3BJ5A 4ZIJA 1XWGA 2IIYA 2QKEA 1JLVA 3LGCA 3WYWA 2AYTA 4TXOB 5JCWA 2WB9A 1AXDA 2YP6A 1R5PA 5BRTA 5D73A 4KDUA 5CNWA 2H75A 4TR0A 1KBNA 1ZCPA 1Q4JA 1OC8A 2MZCA 3GKKA 3ZVJA 2IMFA 2WVXA 4K2XA 1JZOA 1H75A 5IIZA 1PL1A 3F8UA 2P5RA 2NBSA 3APOA 3NZNA 1E6BA 1U88A 3F9UA 1AW9A 2R5GA 1V57A 2VL2A 5JCUA 1H4OA 1FAAA 2LTKA 2FHEA 4GQFA 1SK2A 1TKDB 1TU8A 2VLUA 3CTGA 1LBKA 4IN0A 2DJ3A 3F3QA 1G6YA 4E8EA 1DUGA 4IHUA 3IK7A 1T8EB 2J23A 1GSSA 4HZ4A 4N30A 3CTFA 3GH6A 4Z2UA 3GA4A 5BMUB 5IO2A 1JZWA 10GSA 3G7JA 1K0BA 2VD0A 3A5IA 4EL1A 4KNDA 1U3IA 5D93A 3C1RA 4MH3A 1SKSB 3O3TA 5A4UA 4D73A 4HU7A 3KH7A 1ERTA 1LJRA 3VI5A 2FWGA 1AQWA 3ZFBA 3E9JB 2ZCTA 4F9ZA 5E59A 3VWWA 4MMMA 4MK3A 3GV1A 1UN2A 2WW0A 3F3RA 1K3YA 2F9SA 3RFRC 2GZZA 3P2AA 2MBSA 2PERA 1Y6EA 1V9WA 4IGJA 4KGIA 4AKHA 2VCXA 4OO4A 3QAGA 4KCEA 1JZRA 2A2SA 1FVJA 1IYHA 4GF0A 2B6MA 2D2ZA 2ON7A 2JU5A 1ZOFA 3P8WA 3APQA 3KXOA 4PURA 3EE2A 1EP8A 1BYEA 3HVNA 3QAWA 1K0OA 4ULXA 1T4YA 1MEKA 1Y1UA 2HSNB 5G5EA 3I43A 5IMVA 2DMMA 4IJIA 3QD9A 2HRNA 2K9FA 1QMVA 1XG8A 3TB2A 2TIRA 4GLTA 3D21A 3F4TA 2FWEA 2YWNA 1X9SB 3L0HA 2LJRA 2J9HA 1ZGNA 2OA7A 4LL1B 2O5VA 1O8WA 3GTUB 4YKGA 1GSYA 4J57E 4HZ2A 4I97A 2PGTA 3C1SA 3GIXA 3P7XA 1T7PB 3LYKA 2LS5A 4MP4A 2RLIA 3QFAC 4TR1A 3VWVA 1U3AA 1S4BP 4EIQA 5L71A 1FB0A 4LMWA 2H0HA 2MYGA 4L5OA 1OVNA 1TI3A 3ME7A 3A2XA 2AUVA 3IOSA 3S9FA 1XBSA 3CMIA 3U6VA 2VOCA 5IM9A 4WR5A 4NHWA 2YZUA 3VURA 5DQYA 5EY6A 3GL3A 1YKCA 5A34B 4GCIA 4BVYB 2I1UA 3CSIA 3KMNA 3NOFA 1PX7A 2N5FA 1B4QA 5AN1A 4G0IA 4KX4A 2C8UA 4OD7A 4WBRD 2JSYA 4ZXGA 2IJYA 2XBIA 5A5KA 3ZTLA 2C4JA 1WOUA 2IN3A 3A2WA 2AB6A 1SK1A 2DKHA 3HJPA 3D22A 4HEA2 5A1NA 4QQ7A 3ED3A 1XXUA 5D96A 1NHYA 1EV9A 2EFDA 5G1LA 4K5SA 1EEJA 2ALBA 3QDNA 4ISDA 1MDJA 5A4WA 5H5QA 1YDKA 1K0DA 3ZFLA 1QFNA 3Q19A 3SWLA 1PFOA 2VLVA 1NHOA 4HJ2A 4K5RA 4F0BA 5DBQA 2V41A 2HNLA 4WETA 3HZ8A 1MD3A 2H76A 4ACSA 2DKIA 2MMAA 2VL3A 3F63A 1VF4A 5IOWA 4BA7A 4POKA 3VLNA 2V2GA 4ZBDA 3GUSA 2I81A 2LQQA 4CY8A 3EU4A 4WR4A 4KB3A 4EUYA 3QAVA 1PA3A 1JFUA 4TN8A 2YV7A 3C73A 2CV4A 4MZWA 3UOMA 3KGKA 3W6GA 2KOKA 3G7YA 3ERWA 4F82A 3KH9A 2HFDA 4MNNA 4G10A 1M3JA 3BBYA 1V98A 4TKYA 2O3EA 1FO5A 3HY2A 2RUEA 5E4WA 6GSXA 3IC4A 1BEDA 2H72A 1T00A 3H1NA 3TJBA 1TDIA 2EIOA 4XCSA 1HNBA 3QR6A 1OC9B 2N5AA 2X99A 4TXOA 1SK0A 2R0GA 1A8LA 1B48A 1SL0B 2HRKB 4NPBA 2HYXA 2HZEA 5CO3A 1W89A 4HDEA 4YAVA 2X64A 1SVLA 4ZB8A 2HQTA 1M3IA 4DSSB 5AIVA 2MMZA 3HJMA 5HR3A 1TK0B 2PVOC 2X4AA 2ZNMA 2DJJA 4JEDA 2H74A 1GWCA 5DCHA 2IL3A 2DMLA 1HYUA 3QOUA 4F03A 1TXUA 2ON5A 3A3TA 2H70A 2CZ3A 5HR1A 4N10A 1PSQA 4NV2A 5ID2B 1AQXA 2LV3A 2GDRA 5BMUA 1ERUA 4Z2RA 2IFQA 4MF6A 1G6WA 3VWUA 3FZAA 2LNSA 1W4VA 1A23A 4L5LA 3QPMA 4O5UA 4ZILA 1Z3EA 1EOGA 3L4NA 4KH7A 1U6TA 5IMAA 3UVHA 5AGYA 5CYYA 3BD2A 3IXRA 4MDCA 1BG1A 5J3RA 4O92A 3LWAA 5ABRA 3TKSE 3EMXA 3DIEA 1YJ6A 1ML6A 1YZXA 4TXVA 6GSWA 4XS6A 4NMUA 3UJ1A 2LQOA 4PQIA 5IMDA 3G9BA 14GSA 5CP1A 2FA4A 2GS3A 4MJCA 5KN3A 3FZ5A 3TDGA 2VO4A 5D9WA 4YQMA 4MJAA 1GSUA 4YQVA 3Q18A 4KW6A 5C00A 5F07A 3ZREA 2GSTA 3KCMA 3TUEA 2M46A 1XOAA 2HSNA 1JZDA 2O87A 4X0XA 4PHZC 4KE3A 4K6XA 4F2IA 4N0VA 1PGTA 2CA8A 1SD9A 5EL8A 1SJIA 2G0FA 2LNTA 1Z7RA 1R4WA 2UV8G 3LFLA 1XVWA 2H1LA 2DBCA 4XRAA 3TJFA 4IJ3A 4KDXA 1AAZA 5F06A 4L8EA 3GTUA 4MPGA 2GQLA 2JZRA 2QC7A 5B6NA 4IBPA 2M80A 1YQ1A 3MYDA 4MF5A 2C1YA 2WW1A 3FR9A 3HZ4A 5ECLB 3DRNA 2KLXA 4BWSA 5D8IA 6GSUA 4POLA 1QXHA 3HHVA 3MSZA 3O76A 5CAXA 9GSSA 3A5WA 2HI7A 3H4KA 1S3AA 4MABA 1YF1A 4FXYP 4RUVA 1TP9A 4PTSA 5HQPA 4MH2A 1A24A 2HLSA 4N3ZA 5A34A 4BVYA 1KTEA 3CRUA 2DIYA 3TKPA 3EWLA 4PNFA 1F3BA 5DAKB 1RQMA 3MNGA 3OR5A 4DSRA 3TKSA 4GXZA 3E0UA 4GSTA 5DALB 4AJ7A 4WF4A 2HSYA 2VM1A 5LCZA 3BOAA 4EC0A 5ECMB 1ST9A 5ECRB 2PUKC 2RM6A 3IHQA 2QA2A 4TVEA 3VPTA 5IPGA 2O36A 4EKZA 1S3RA 1SKWB 2H30A 1B9XC 5D9XA 4PX1A 4BL7B 4X43A 2YCDA 2V1MA 1BX9A 2CVBA 4PI0C 1GUKA 3LG6A 2KHPA 3WT1A 3HMJG 1XW6A 1TXXA 1XIYA 1EV4A 2EIRA 3GN3A 3TJJA 4E68A 3IHGA 2V32A 1F9MA 4ECJA 3MDKA 2WZ9A 5G30A 4LL4B 4K7OA 3CHXC 1YY7A 1ZYNA 1XVQA 1GTBA 1V2AA 3D5JA 3SBCA 2EFHA 5HFKA 5FHIA 4EIPA 2WVYA 1YEWC 3FMWA 3Q6OA 2LRNA 1XWCA 2H8LA 2OBKA 3LEFA 4V2LA 2DJ1A 3KD0A 4FIWA 3VFIA 2VLTA 4L0WA 1GSDA 4L0UA 11GSA 5CREA 1YEXA 3RHBA 1AQVA 1J9BA 2IMIA 4AJ8A 1GLQA 4OO5A 3KM6A 2WULA 1HD2A 3LQ7A 5B8BA 2H1GA 3IAM2 4IELA 1SU9A 3ZLPA 5C04A 5D9VA 1NW2A 3UEMA 3D6IA 2DLXA 1MD4A 4CHSA 2GTUA 5ECIB 1CQGA 3F0IA 1GSEA 1OC9A 2YPMA 2PMTA 4HI7A 3PPUA 4AKIA 4EDYA 2C80A 4X1UA 4YH2A 4G9HA 3FEUA 2HRKA 4JBBA 3FRCA 4HOJA 4JZQA 2WW2A 3F6DA 4E8HA 3I69A 5ECKB 1G0TA 3MAKA 3CSJA 4N11A 4G19A 2HSMB 1JHBA 4IQAA 2CAIA 1X9WB 4GSNA 1A2LA 5KN0A 4YKFA 1R5AA 5J9CA 2VIMA 3TKRA 1V58A 2P31A 1A2JA 4K0NA 4BVXB 1G7OA 2K8VA 3GRXA 5DDLA 4MA9A 2H71A 2C3TA 2B7KA 5ID2A 2H6ZA 2K18A 2O85A 3TRPA 2B7JA 1SVMA 1ERWA 1F3AA 3HVXA 2NTOA 4KSMA 2YNXA 2H01A 1X5EA 2C0DA 3TRQA 4ILFA 1OAZA 2CVDA 4YQUA 3ZITA 1PL2A 5COHA 3F4SA 4MJEA 4FO5A 1DE2A 1T1VA 1TRVA 1PQNA 4XRDA 3LXZA 3G7IA 2VCZA 4JU5A 3KZQA 4KDYA 2FLSA 3RAZA 3HKRA 3UMAA 2HZFA 2H6YA 2E2GA 1HNCA 1Z6MA 3D4TA 5CRWA 4RQRA 5LNKe 4TR4A 4JRRA 2XHFA 4N0ZA 3EURA 3WGXA 3ZRDA 4EO3A 4IW9A 4IVFA 2H0GA 1FW1A 1A0FA 5J4YA 5CRDA 3I9V2 4CY6A 1EEMA 1C72A 2YN1A 1NM3A 1FB6A 1TJDA 3IPZA 1K0MA 1Z9HA 5ECSA 2K8SA 4G01A 1OYJA 1VF2A 4OCFA 4CDOA 2A2PA 3DKSA 1B4PA 1YKAA 4K7NA 2GSRA 4PQ1A 2JACA 3TU3B 4D73B 1TK8B 2IMKA 1KNGA 1G7EA 1URMA 1TI1A 1OKTA 2VCQA 2WW3A 16GSA 4FH8A 1B9YC 2HXKA 4GTUA 1HNAA 2G2QA 2H1DA 5JWQB 3TRXA 1AUCA 4FYCA 2PN8A 3TKQA 3RHCA 4HJMA 5KN1A 1M2AA 3KMOA 5DJLA 6GSTA 1QGVA 2PBJA 2LRTA 1ILOA 3CQFA 1PKWA 3NIVA 2CT6A 3HXSA 5KN2A 1VF3A 4P3YB 2LJAA 2UZ8A 1RK4A 3Q74A 1XPVA 1M9AA 2XPDA 1NSWA 2EC4A 2WRTA 1M9BA 6GSVA 1SD8A 2A4HA 5DAKA 3HDCA 3U5RE 5IPHA 1K0NA 3GURA 1PD21 3GFKA 3HA9A 1GTUA 2VL9A 2L5LA 3UBLA 2TRXA 13GSA 1BAYA 1EOHA 1GUHA 1SJZA 2YANA 4OCEA 4XHMA 4ID0A 5DALA 3IV4A 3A2VA 4ZBBA 2L6CA 1EZKA 1SENA 2IWTA 5J41A 4JE1A 4MPFA 1TRWA 2L5OA 1M2BA 4DVCA 1V40A 4BL7A 2F51A 4QL7A 5ECOB 2C3NA 1K0AA 3DMLA 1X0RA 2PPTA 1OKDA 4TR1B 2DIZA 2I3YA 5ECHB 2H1BA 2X8GA 4OFTA 1J08A 1WE0A 2B5EA 1WWJA 2WDUA 2VCWA 2O89A 3V1WA 3ME8A 1ABAA 4PUFC 3FYGA 18GSA 2VUPA 2XC2A 1ZYQB 1N25A 5J40A 2GGTA 1S3CA 4H86A 4W66A 3WD6A 1USBA 3UL3A 3GX0A 4O5QA 2R4VA 1QQ2A 2JSZA 1MDKA 3RDWA 3LJRA 2O8VB 1GUMA 1A8YA 2I4AA 2TRCP 4XS1A 3RBTA 5GAPD 2B5XA 2YWMA 1O73A 2OE1A 5JWOB 2BJXA 3LW9A 3EPTA 1XWBA 3ISOA 3GHAA 2YOIA 3IA1A 1PKZA 3M3MA 1SKRB 1BJXA 3ERFA 2NDOA 5EVOA 2H0IA 4I6XA 4KSOA 2A4VA 2JZSA 4KCAA 4TW5A 1FOVA 4GWRA 2GQKA 4XS4B 1X9MB 4ICYA 4K1FA 5B6MA 4ML6A 1R26A 1WJKA 3GKXA 2GZYA 1VGLA 2O7KA 4V2NA 2LKUA 2AV4A 2R0CA 3BCKA 5INYA 2LRCA 4IKHA 2FCHA 3EINA 4K9ZA 4IQ1A 1TTZA 2DJKA 3ZYWA 3I6AA 3HCZA 1QK8A 3M9KA 3JCML 4MF7A 3LXTA 1M7TA 3TGZA 2DC5A 4I2TA 3C71A 1SYRA 2GT6A 2OBIA 2OJLA 5GSTA 4BVXA 5IMFA 3HD5A 2V6OA 5J9BA 4V1Ap 2HE3A 2OACA 6GSSA 3ZVJD 4F0CA 2IPAA 1EGOA 3QMXA 2C0EA 3MIXA 1XWKA 4OFMA 1N2AA 2R6KA 2M72A 2FD3A 4PQHA 2L59A 2VM2A 2OE3A 4K8MA 3RGBC 3GKNA 2YJHA 4NV5A 4Q5NA 3FW2A 4O5RA 4IP6A 4QMKA 1GH2A 4WF5A 1TRSA 2L57A 2MMOA 4TR3A 2IMEA 2CQ9A 2X49A 1T3BA 2CX4A 1UA5A 1XW9A 2EFEA 4G0LA 3KP9A 2GQMA 3GL5A 4PXOA 3KTBA 4Q5FA 2HZEB 4KUNA 5IQYA 3KP8A 2H6XA 4BWQA 3GMFA 3WGDA 1FVKA 3R2QA 3W8JA 5HFIA 4Z2TA 1BF5A 4POBA 3KJYA 4OMVA 2FUG2 4O32A 4LLRA 5FWGA 3GSTA 2B1LA 2LUSA 2WZSA 3CXGA 1FHEA 2L4CA 1UC7A 3W8SA 5LD0A 2KP1A 3FZ4A 1VRSD 1ZYPA 3TJKA 5GSSA 4DSQA 4HSCX 2VAFA 1KEBA 4KF9A 2IFQB 5B8AA 3PR8A 3IK9A 3GKMA 1XWAA 4MZBA 4I5QA 2L6DA 3ZIJA 2C0FA 5G2ZA 1DE1A 4LMVA 2C3QA 4RQXA 1T4ZA 3J7Yb 4J56E 3US3A 2OT3A 1SL2B 4YAPA 1OE8A 1I9DA 5J4UA 2FY6A 5A5HB 5DCGA 3L78A 4FYUA 2AAWA 1OE7A 5G1KA 4XIHA 1J0FA 4GDFA 5HR2A 4XTSA 2FGXA 3HJOA 3TKSC 1Z5YE 1F37A 2REMA 1O7UA 3FZ9A 5DQSA 4V2MA 1TW9A 1ACVA 2XPEA 2QA1A 2K6VA 2WS2A 4GQCA 3UVTA 1RW1A 2KP2A 1GTIA 1QUWA 1WPIA 1BQ7A 2N5BA 1EGRA 2VL2C 2MMNA 3CSHA 2HSHA 1MDIA 2LJKA 1WP0A 4Q5QA 3DVWA 4ML1A 5B7CA 2WGRA 2HRFA 2YV9A 5GAND 3PGTA 4ZB9A 2CVKA 1I5GA 3CYNA 4DSSA 4AI6A 3N9JA 20GSA 3C7MA 2GT5A 5KOWA 1GL8A 2HRAA 3M0FA 3D4MA 3VPQA 1ZL9A 5ECQB 3WGEA 1SVOA 4FYBA 3J7Yk 3LSZA 2KUCA 1GSQA 2MBTA 1FOHA 2QSIA 4K0GA 2WCIA 2CZ2A 1Y25A 2WFCA 4I8BA 1IYIA 3F6FA 3EC3A 3AY8A 2YWIA 2P5QA 1EP7A 1M0UA 1TU7A 1PMTA 5CRHA 1GRXA 2YJ7A 4ECCA 4Q5RA 3ERGA 1JLWA 5DVBA 2X8CA 2H19A 3K8NA 4EF0A 2YWOA 3R3EA 4AKGA 5HFGA 3IDVA 2I9HA 1YVLA 4NXIA 5JWRB 1TK5B 4LA1A 2V6KA 5A4VA 1WMJA 3L9SA 4CW9A 2LEGA 3H8QA 4FQUA 2F3MA 3D0ZA 3GSSA 3QFBC 2IMDA 1F6MC 1U87A 1O81A 2RUFA 2BTOT 2VCTA 2R0PA 4G2EA 3M8NA 3PH9A 1GNWA 3RPPA 2VD1A 5F05A 1ZYEA 4IP1A 2WVXB 4ECBA 1A0RP 3FHKA 5IO0A 1OC3A 1I1IP 8GSSA 4GRFA 17GSA 4PI2C 1K3OA 4RI7A 3TJGA 3CBUA 1PN0A 4JR4A 5KEJA 1A2MA 2GSQA 2R3XA 2QGVA 4BPYA 2FA8A 3LYPA 2YZHA 4ZB6A 2ZUPA 5ENUA 2XBQA 3VK9A 3DWVA 4GSSA 1S3DA 5IMCA 4Z7XA 4XS4A 1EWXA 4RI6A 3KTLA 3H79A 3DEXA 2JZTA 1DSBA 1VF1A 3GYKA 1XFLA 4WBJA 2LSTA 5EPFA 1GP1A 4AJ6A 2WVZA 3L9VA 2VCVA 1PRXA 3UBKA 4EXJA 3EVIA 4ZBAA 1ERVA 1LU4A 1R7HA 2JL4A 1K0CA 1ON4A 1SYXA 3IBHA 4J2FA 5F8BA 1X5DA 4JR6A 1BG5A 1K3LA 3E3EA 2H66A 3FKFA 5FT3A 2GVPA 5H5SA 1UVZA 5AIXA 3HVSA 4QL9A 1E2YA 7GSSA 4EVMA 3PINA 1WRYA 3KIJA 3UARA 2PU9C 2DJ0A 1N8JA 3TCOA 1SL1B 4MJBA 5J5NA 1GSFA 1GTAA 3GNJA 2FWHA 3F4RA 3N5OA 3DVXA 2EIQA 3HVVA 3MWHA 4HQSA 1YEPA 1TRUA 3ZZXA 1SJ6A 3ZIVA 5ELGA 3LORA 2GZPA 5J47A 2NVLA 3KEBA 3IR4A 4HS1A 1XCCA 4ZL7A 2E0QA 4NAXA 4MZCA 3H93A 1F2EA 2JADA 5DJMA 4DEJA 1XW5A 2CX3A 3CWGA 5KOXA 4TOPA 4OWYA 1ZZYA 1O6JA 1HQOA 2B3SA 5H5RA 6GSYA 1FG4A 2OKAA 4ECIA 4USSA 2P0GA 4POMA 12GSA 2NPBA 1PN9A 2R37A 3CRTA 5AISA 1B8XA 4ZL9A 1YF0A 2BMXA 4I2UA 4WXTA 3FY7A 2GLRA 4IS0A 4EDZA 3DGQA 3TOUA 2E2MA 5ECPB 5JCGA 4ZB7A 4A5PA 1MTCA 2CAQA 5CRGA 1PX6A 3C8EA 1CQHA 3VWXA 2AJQB 3IAS2 3L9UA 4WEYA 1XOBA 2EFCA 4WKWA 2AHEA 4K7IA 3EMPA 3P90A 4AF2A 4AGSA 3FR6A 1AC1A 4X4JA 5HR0A 2WJUA 3RPNA 2L4QA 3DYRA 3FK8A 3GH9A 4HQZA 4OFNA 3TOTA 1DBYA 2ES7A 3ZMLA 2DSAA 22GSA 3GX8A 2C0GA 3IC8A 4KAEA 1O85A 1M2DA 5A5HA 1Z7PA 2H73A 2HT9A 5A1NB 2H1AA 2R2JA 4HUAA 4PGTA 5ELAA 3M1GA 3HYPA 4MLYA 4AKXB 3FR3A 2F8FA 5G31A 2GSSA 2PVQA 1Z6NA 2F8AA 2PWJA 4NWYA 5GZZB 1X5CA 1THXA 3DXBA 1GULA 3IRAA 4MCUA 3BCIA 4KA0A 2OE0A 2Z9SA 3EU3A 4V1Ag 2FNOA 3O6TA 5D9TA 1O8XA 3UIWA 1M99A 5ECNB 3ZMKA 2E7PA 3ZL5A 1Q98A 4PUAA 2B1KA 3VI7A 2HSMA 3UAPA 4PNGA 5G5FA 2B5YA 2A2RA 1WIKA 1AIUA 4BIKA 4K2DA 1XZOA 1ZMAA 2OADA 4NHZA 3EYTA 4G0KA 4EE0A 3DD3A 3IE3A 1TOFA 2RM5A 2X8HA 3M9JA 4O7HA 1GNEA 1THOA 1GLPA 4TRXA 2DJ2A 2RIIA 5IOXA 5J4VA 5IMZA 4ZL8A 5F0GA 3QCPA 2VKZG 3WT2A 2FWFA 19GSA 4HU9A 3APSA
chains in the Genus database with same CATH topology
3BJ5A 4ZIJA 1XWGA 2IIYA 2QKEA 1JLVA 3LGCA 3WYWA 2AYTA 4TXOB 5JCWA 2WB9A 1AXDA 2YP6A 1R5PA 5BRTA 5D73A 4KDUA 5CNWA 2H75A 4TR0A 1KBNA 1ZCPA 1Q4JA 1OC8A 2MZCA 3GKKA 3ZVJA 2IMFA 4K2XA 1JZOA 1H75A 5IIZA 1PL1A 3F8UA 2P5RA 2NBSA 3APOA 3NZNA 1E6BA 1U88A 3F9UA 1AW9A 2R5GA 1V57A 2VL2A 5JCUA 1H4OA 1FAAA 2LTKA 2FHEA 4GQFA 1SK2A 1TKDB 1TU8A 2VLUA 3CTGA 1LBKA 4IN0A 2DJ3A 3F3QA 1G6YA 4E8EA 1DUGA 4IHUA 3IK7A 1T8EB 2J23A 1GSSA 4HZ4A 4N30A 3CTFA 3GH6A 4Z2UA 3GA4A 5BMUB 5IO2A 1JZWA 10GSA 3G7JA 1K0BA 2VD0A 3A5IA 4EL1A 4KNDA 1U3IA 5D93A 3C1RA 4MH3A 1SKSB 3O3TA 5A4UA 4D73A 4HU7A 3KH7A 1ERTA 1LJRA 3VI5A 2FWGA 1AQWA 3ZFBA 3E9JB 2ZCTA 4F9ZA 5E59A 3VWWA 4MMMA 4MK3A 3GV1A 1UN2A 3F3RA 1K3YA 2F9SA 2GZZA 3P2AA 2MBSA 2PERA 1Y6EA 1V9WA 4IGJA 4KGIA 4AKHA 2VCXA 4OO4A 3QAGA 4KCEA 1JZRA 2A2SA 1FVJA 1IYHA 4GF0A 2B6MA 2D2ZA 2ON7A 2JU5A 1ZOFA 3P8WA 3APQA 3KXOA 4PURA 3EE2A 1EP8A 1BYEA 3QAWA 1K0OA 4ULXA 1T4YA 1MEKA 1Y1UA 2HSNB 5G5EA 3I43A 5IMVA 2DMMA 4IJIA 3QD9A 2HRNA 2K9FA 1QMVA 3TB2A 2TIRA 4GLTA 3D21A 3F4TA 2FWEA 2YWNA 1X9SB 3L0HA 2LJRA 2J9HA 1ZGNA 2OA7A 4LL1B 2O5VA 1O8WA 3GTUB 4YKGA 1GSYA 4J57E 4HZ2A 4I97A 2PGTA 3C1SA 3GIXA 3P7XA 1T7PB 3LYKA 2LS5A 4MP4A 2RLIA 3QFAC 4TR1A 3VWVA 1U3AA 4EIQA 5L71A 1FB0A 4LMWA 2H0HA 2MYGA 4L5OA 1OVNA 1TI3A 3ME7A 3A2XA 2AUVA 3IOSA 3S9FA 1XBSA 3CMIA 3U6VA 2VOCA 5IM9A 4WR5A 4NHWA 2YZUA 3VURA 5DQYA 5EY6A 3GL3A 1YKCA 5A34B 4GCIA 4BVYB 2I1UA 3CSIA 3KMNA 3NOFA 1PX7A 2N5FA 1B4QA 5AN1A 4G0IA 4KX4A 2C8UA 4OD7A 4WBRD 2JSYA 4ZXGA 2IJYA 2XBIA 5A5KA 3ZTLA 2C4JA 1WOUA 2IN3A 3A2WA 2AB6A 1SK1A 2DKHA 3HJPA 3D22A 4HEA2 5A1NA 4QQ7A 3ED3A 1XXUA 5D96A 1NHYA 1EV9A 2EFDA 5G1LA 4K5SA 1EEJA 2ALBA 3QDNA 4ISDA 1MDJA 5A4WA 5H5QA 1YDKA 1K0DA 3ZFLA 1QFNA 3Q19A 3SWLA 2VLVA 1NHOA 4HJ2A 4K5RA 4F0BA 5DBQA 2V41A 2HNLA 4WETA 3HZ8A 1MD3A 2H76A 4ACSA 2DKIA 2MMAA 2VL3A 3F63A 1VF4A 5IOWA 4BA7A 4POKA 3VLNA 2V2GA 4ZBDA 3GUSA 2I81A 2LQQA 4CY8A 3EU4A 4WR4A 4KB3A 4EUYA 3QAVA 1PA3A 1JFUA 4TN8A 2YV7A 3C73A 2CV4A 4MZWA 3UOMA 3KGKA 3W6GA 2KOKA 3G7YA 3ERWA 4F82A 3KH9A 2HFDA 4MNNA 4G10A 3BBYA 1V98A 4TKYA 1FO5A 3HY2A 2RUEA 5E4WA 6GSXA 3IC4A 1BEDA 2H72A 1T00A 3H1NA 3TJBA 1TDIA 2EIOA 4XCSA 1HNBA 3QR6A 1OC9B 2N5AA 2X99A 4TXOA 1SK0A 2R0GA 1A8LA 1B48A 1SL0B 2HRKB 4NPBA 2HYXA 2HZEA 5CO3A 1W89A 4HDEA 4YAVA 2X64A 1SVLA 4ZB8A 2HQTA 4DSSB 5AIVA 2MMZA 3HJMA 5HR3A 1TK0B 2PVOC 2X4AA 2ZNMA 2DJJA 4JEDA 2H74A 1GWCA 5DCHA 2IL3A 2DMLA 1HYUA 3QOUA 4F03A 1TXUA 2ON5A 3A3TA 2H70A 2CZ3A 5HR1A 4N10A 1PSQA 4NV2A 5ID2B 1AQXA 2LV3A 2GDRA 5BMUA 1ERUA 4Z2RA 2IFQA 4MF6A 1G6WA 3VWUA 3FZAA 2LNSA 1W4VA 1A23A 4L5LA 3QPMA 4O5UA 4ZILA 1Z3EA 1EOGA 3L4NA 4KH7A 1U6TA 5IMAA 3UVHA 5AGYA 5CYYA 3BD2A 3IXRA 4MDCA 1BG1A 5J3RA 4O92A 3LWAA 5ABRA 3TKSE 3EMXA 3DIEA 1YJ6A 1ML6A 1YZXA 4TXVA 6GSWA 4XS6A 4NMUA 3UJ1A 2LQOA 4PQIA 5IMDA 3G9BA 14GSA 5CP1A 2FA4A 2GS3A 4MJCA 5KN3A 3FZ5A 3TDGA 2VO4A 5D9WA 4YQMA 4MJAA 1GSUA 4YQVA 3Q18A 4KW6A 5C00A 5F07A 3ZREA 2GSTA 3KCMA 3TUEA 2M46A 1XOAA 2HSNA 1JZDA 2O87A 4X0XA 4KE3A 4K6XA 4F2IA 4N0VA 1PGTA 2CA8A 1SD9A 5EL8A 1SJIA 2G0FA 2LNTA 1Z7RA 1R4WA 2UV8G 3LFLA 1XVWA 2H1LA 2DBCA 4XRAA 3TJFA 4IJ3A 4KDXA 1AAZA 5F06A 4L8EA 3GTUA 4MPGA 2GQLA 2JZRA 2QC7A 5B6NA 4IBPA 2M80A 1YQ1A 3MYDA 4MF5A 2C1YA 3FR9A 3HZ4A 5ECLB 3DRNA 2KLXA 4BWSA 5D8IA 6GSUA 4POLA 1QXHA 3HHVA 3MSZA 3O76A 5CAXA 9GSSA 3A5WA 2HI7A 3H4KA 1S3AA 4MABA 1YF1A 4RUVA 1TP9A 4PTSA 5HQPA 4MH2A 1A24A 2HLSA 4N3ZA 5A34A 4BVYA 1KTEA 3CRUA 2DIYA 3TKPA 3EWLA 4PNFA 1F3BA 5DAKB 1RQMA 3MNGA 3OR5A 4DSRA 3TKSA 4GXZA 3E0UA 4GSTA 5DALB 4AJ7A 4WF4A 2HSYA 2VM1A 5LCZA 3BOAA 4EC0A 5ECMB 1ST9A 5ECRB 2PUKC 2RM6A 3IHQA 2QA2A 4TVEA 3VPTA 5IPGA 4EKZA 1SKWB 2H30A 1B9XC 5D9XA 4PX1A 4BL7B 4X43A 2YCDA 2V1MA 1BX9A 2CVBA 1GUKA 3LG6A 2KHPA 3WT1A 3HMJG 1XW6A 1TXXA 1XIYA 1EV4A 2EIRA 3GN3A 3TJJA 4E68A 3IHGA 2V32A 1F9MA 4ECJA 3MDKA 2WZ9A 5G30A 4LL4B 4K7OA 1YY7A 1ZYNA 1XVQA 1GTBA 1V2AA 3D5JA 3SBCA 2EFHA 5HFKA 5FHIA 4EIPA 3FMWA 3Q6OA 2LRNA 1XWCA 2H8LA 2OBKA 3LEFA 4V2LA 2DJ1A 3KD0A 4FIWA 3VFIA 2VLTA 4L0WA 1GSDA 4L0UA 11GSA 5CREA 1YEXA 3RHBA 1AQVA 1J9BA 2IMIA 4AJ8A 1GLQA 4OO5A 3KM6A 2WULA 1HD2A 3LQ7A 5B8BA 2H1GA 3IAM2 4IELA 1SU9A 3ZLPA 5C04A 5D9VA 1NW2A 3UEMA 3D6IA 2DLXA 1MD4A 4CHSA 2GTUA 5ECIB 1CQGA 3F0IA 1GSEA 1OC9A 2YPMA 2PMTA 4HI7A 3PPUA 4AKIA 4EDYA 2C80A 4X1UA 4YH2A 4G9HA 3FEUA 2HRKA 4JBBA 3FRCA 4HOJA 4JZQA 3F6DA 4E8HA 3I69A 5ECKB 1G0TA 3MAKA 3CSJA 4N11A 4G19A 2HSMB 1JHBA 4IQAA 2CAIA 1X9WB 4GSNA 1A2LA 5KN0A 4YKFA 1R5AA 5J9CA 2VIMA 3TKRA 1V58A 2P31A 1A2JA 4K0NA 4BVXB 1G7OA 2K8VA 3GRXA 5DDLA 4MA9A 2H71A 2C3TA 2B7KA 5ID2A 2H6ZA 2K18A 2O85A 3TRPA 2B7JA 1SVMA 1ERWA 1F3AA 3HVXA 2NTOA 4KSMA 2YNXA 2H01A 1X5EA 2C0DA 3TRQA 4ILFA 1OAZA 2CVDA 4YQUA 3ZITA 1PL2A 5COHA 3F4SA 4MJEA 4FO5A 1DE2A 1T1VA 1TRVA 1PQNA 4XRDA 3LXZA 3G7IA 2VCZA 4JU5A 3KZQA 4KDYA 2FLSA 3RAZA 3HKRA 3UMAA 2HZFA 2H6YA 2E2GA 1HNCA 1Z6MA 3D4TA 5CRWA 4RQRA 5LNKe 4TR4A 4JRRA 2XHFA 4N0ZA 3EURA 3WGXA 3ZRDA 4EO3A 4IW9A 4IVFA 2H0GA 1FW1A 1A0FA 5J4YA 5CRDA 3I9V2 4CY6A 1EEMA 1C72A 2YN1A 1NM3A 1FB6A 1TJDA 3IPZA 1K0MA 1Z9HA 5ECSA 2K8SA 4G01A 1OYJA 1VF2A 4OCFA 4CDOA 2A2PA 3DKSA 1B4PA 1YKAA 4K7NA 2GSRA 4PQ1A 2JACA 3TU3B 4D73B 1TK8B 2IMKA 1KNGA 1G7EA 1URMA 1TI1A 1OKTA 2VCQA 16GSA 4FH8A 1B9YC 2HXKA 4GTUA 1HNAA 2G2QA 2H1DA 5JWQB 3TRXA 1AUCA 4FYCA 2PN8A 3TKQA 3RHCA 4HJMA 5KN1A 1M2AA 3KMOA 5DJLA 6GSTA 1QGVA 2PBJA 2LRTA 1ILOA 1PKWA 3NIVA 2CT6A 3HXSA 5KN2A 1VF3A 4P3YB 2LJAA 2UZ8A 1RK4A 3Q74A 1XPVA 1M9AA 2XPDA 1NSWA 2EC4A 2WRTA 1M9BA 6GSVA 1SD8A 2A4HA 5DAKA 3HDCA 3U5RE 5IPHA 1K0NA 3GURA 1PD21 3GFKA 3HA9A 1GTUA 2VL9A 2L5LA 3UBLA 2TRXA 13GSA 1BAYA 1EOHA 1GUHA 1SJZA 2YANA 4OCEA 4XHMA 4ID0A 5DALA 3IV4A 3A2VA 4ZBBA 2L6CA 1EZKA 1SENA 2IWTA 5J41A 4JE1A 4MPFA 1TRWA 2L5OA 1M2BA 4DVCA 1V40A 4BL7A 2F51A 4QL7A 5ECOB 2C3NA 1K0AA 3DMLA 1X0RA 2PPTA 1OKDA 4TR1B 2DIZA 2I3YA 5ECHB 2H1BA 2X8GA 4OFTA 1J08A 1WE0A 2B5EA 1WWJA 2WDUA 2VCWA 2O89A 3V1WA 3ME8A 1ABAA 4PUFC 3FYGA 18GSA 2VUPA 2XC2A 1ZYQB 1N25A 5J40A 2GGTA 1S3CA 4H86A 4W66A 3WD6A 1USBA 3UL3A 3GX0A 4O5QA 2R4VA 1QQ2A 2JSZA 1MDKA 3RDWA 3LJRA 2O8VB 1GUMA 1A8YA 2I4AA 2TRCP 4XS1A 3RBTA 5GAPD 2B5XA 2YWMA 1O73A 2OE1A 5JWOB 2BJXA 3LW9A 3EPTA 1XWBA 3ISOA 3GHAA 2YOIA 3IA1A 1PKZA 3M3MA 1SKRB 1BJXA 3ERFA 2NDOA 5EVOA 2H0IA 4I6XA 4KSOA 2A4VA 2JZSA 4KCAA 4TW5A 1FOVA 4GWRA 2GQKA 4XS4B 1X9MB 4ICYA 4K1FA 5B6MA 4ML6A 1R26A 1WJKA 3GKXA 2GZYA 1VGLA 2O7KA 4V2NA 2LKUA 2AV4A 2R0CA 3BCKA 5INYA 2LRCA 4IKHA 2FCHA 3EINA 4K9ZA 4IQ1A 1TTZA 2DJKA 3ZYWA 3I6AA 3HCZA 1QK8A 3M9KA 3JCML 4MF7A 3LXTA 1M7TA 3TGZA 2DC5A 4I2TA 3C71A 1SYRA 2GT6A 2OBIA 2OJLA 5GSTA 4BVXA 5IMFA 3HD5A 2V6OA 5J9BA 4V1Ap 2HE3A 2OACA 6GSSA 3ZVJD 4F0CA 2IPAA 1EGOA 3QMXA 2C0EA 3MIXA 1XWKA 4OFMA 1N2AA 2R6KA 2M72A 2FD3A 4PQHA 2L59A 2VM2A 2OE3A 4K8MA 3GKNA 2YJHA 4NV5A 4Q5NA 3FW2A 4O5RA 4IP6A 4QMKA 1GH2A 4WF5A 1TRSA 2L57A 2MMOA 4TR3A 2IMEA 2CQ9A 2X49A 1T3BA 2CX4A 1UA5A 1XW9A 2EFEA 4G0LA 3KP9A 2GQMA 3GL5A 4PXOA 3KTBA 4Q5FA 2HZEB 4KUNA 5IQYA 3KP8A 2H6XA 4BWQA 3GMFA 3WGDA 1FVKA 3R2QA 3W8JA 5HFIA 4Z2TA 1BF5A 4POBA 3KJYA 4OMVA 2FUG2 4O32A 4LLRA 5FWGA 3GSTA 2B1LA 2LUSA 3CXGA 1FHEA 2L4CA 1UC7A 3W8SA 5LD0A 2KP1A 3FZ4A 1VRSD 1ZYPA 3TJKA 5GSSA 4DSQA 2VAFA 1KEBA 4KF9A 2IFQB 5B8AA 3PR8A 3IK9A 3GKMA 1XWAA 4MZBA 4I5QA 2L6DA 3ZIJA 2C0FA 5G2ZA 1DE1A 4LMVA 2C3QA 4RQXA 1T4ZA 3J7Yb 4J56E 3US3A 2OT3A 1SL2B 4YAPA 1OE8A 1I9DA 5J4UA 2FY6A 5A5HB 5DCGA 3L78A 4FYUA 2AAWA 1OE7A 5G1KA 4XIHA 1J0FA 4GDFA 5HR2A 4XTSA 2FGXA 3HJOA 3TKSC 1Z5YE 1F37A 2REMA 1O7UA 3FZ9A 5DQSA 4V2MA 1TW9A 1ACVA 2XPEA 2QA1A 2K6VA 2WS2A 4GQCA 3UVTA 1RW1A 2KP2A 1GTIA 1QUWA 1WPIA 1BQ7A 2N5BA 1EGRA 2VL2C 2MMNA 3CSHA 2HSHA 1MDIA 2LJKA 1WP0A 4Q5QA 3DVWA 4ML1A 5B7CA 2WGRA 2HRFA 2YV9A 5GAND 3PGTA 4ZB9A 2CVKA 1I5GA 3CYNA 4DSSA 4AI6A 3N9JA 20GSA 3C7MA 2GT5A 5KOWA 1GL8A 2HRAA 3M0FA 3D4MA 3VPQA 1ZL9A 5ECQB 3WGEA 1SVOA 4FYBA 3J7Yk 3LSZA 2KUCA 1GSQA 2MBTA 1FOHA 2QSIA 4K0GA 2WCIA 2CZ2A 1Y25A 2WFCA 4I8BA 1IYIA 3F6FA 3EC3A 3AY8A 2YWIA 2P5QA 1EP7A 1M0UA 1TU7A 1PMTA 5CRHA 1GRXA 2YJ7A 4ECCA 4Q5RA 3ERGA 1JLWA 5DVBA 2X8CA 2H19A 3K8NA 4EF0A 2YWOA 3R3EA 4AKGA 5HFGA 3IDVA 2I9HA 1YVLA 4NXIA 5JWRB 1TK5B 4LA1A 2V6KA 5A4VA 1WMJA 3L9SA 4CW9A 2LEGA 3H8QA 4FQUA 2F3MA 3D0ZA 3GSSA 3QFBC 2IMDA 1F6MC 1U87A 1O81A 2RUFA 2BTOT 2VCTA 2R0PA 4G2EA 3M8NA 3PH9A 1GNWA 3RPPA 2VD1A 5F05A 1ZYEA 4IP1A 4ECBA 1A0RP 3FHKA 5IO0A 1OC3A 8GSSA 4GRFA 17GSA 1K3OA 4RI7A 3TJGA 3CBUA 1PN0A 4JR4A 5KEJA 1A2MA 2GSQA 2R3XA 2QGVA 4BPYA 2FA8A 3LYPA 2YZHA 4ZB6A 2ZUPA 5ENUA 2XBQA 3VK9A 3DWVA 4GSSA 1S3DA 5IMCA 4Z7XA 4XS4A 1EWXA 4RI6A 3KTLA 3H79A 3DEXA 2JZTA 1DSBA 1VF1A 3GYKA 1XFLA 4WBJA 2LSTA 5EPFA 1GP1A 4AJ6A 3L9VA 2VCVA 1PRXA 3UBKA 4EXJA 3EVIA 4ZBAA 1ERVA 1LU4A 1R7HA 2JL4A 1K0CA 1ON4A 1SYXA 3IBHA 4J2FA 5F8BA 1X5DA 4JR6A 1BG5A 1K3LA 3E3EA 2H66A 3FKFA 5FT3A 2GVPA 5H5SA 1UVZA 5AIXA 3HVSA 4QL9A 1E2YA 7GSSA 4EVMA 3PINA 1WRYA 3KIJA 3UARA 2PU9C 2DJ0A 1N8JA 3TCOA 1SL1B 4MJBA 5J5NA 1GSFA 1GTAA 3GNJA 2FWHA 3F4RA 3N5OA 3DVXA 2EIQA 3HVVA 3MWHA 4HQSA 1YEPA 1TRUA 3ZZXA 1SJ6A 3ZIVA 5ELGA 3LORA 2GZPA 5J47A 2NVLA 3KEBA 3IR4A 4HS1A 1XCCA 4ZL7A 2E0QA 4NAXA 4MZCA 3H93A 1F2EA 2JADA 5DJMA 4DEJA 1XW5A 2CX3A 3CWGA 5KOXA 4TOPA 4OWYA 1ZZYA 1O6JA 1HQOA 2B3SA 5H5RA 6GSYA 1FG4A 2OKAA 4ECIA 4USSA 2P0GA 4POMA 12GSA 2NPBA 1PN9A 2R37A 3CRTA 5AISA 1B8XA 4ZL9A 1YF0A 2BMXA 4I2UA 4WXTA 3FY7A 2GLRA 4IS0A 4EDZA 3DGQA 3TOUA 2E2MA 5ECPB 5JCGA 4ZB7A 4A5PA 1MTCA 2CAQA 5CRGA 1PX6A 3C8EA 1CQHA 3VWXA 2AJQB 3IAS2 3L9UA 4WEYA 1XOBA 2EFCA 4WKWA 2AHEA 4K7IA 3EMPA 3P90A 4AF2A 4AGSA 3FR6A 1AC1A 4X4JA 5HR0A 2WJUA 3RPNA 2L4QA 3DYRA 3FK8A 3GH9A 4HQZA 4OFNA 3TOTA 1DBYA 2ES7A 3ZMLA 2DSAA 22GSA 3GX8A 2C0GA 3IC8A 4KAEA 1O85A 1M2DA 5A5HA 1Z7PA 2H73A 2HT9A 5A1NB 2H1AA 2R2JA 4HUAA 4PGTA 5ELAA 3M1GA 3HYPA 4MLYA 4AKXB 3FR3A 2F8FA 5G31A 2GSSA 2PVQA 1Z6NA 2F8AA 2PWJA 4NWYA 5GZZB 1X5CA 1THXA 3DXBA 1GULA 3IRAA 4MCUA 3BCIA 4KA0A 2OE0A 2Z9SA 3EU3A 4V1Ag 2FNOA 3O6TA 5D9TA 1O8XA 3UIWA 1M99A 5ECNB 3ZMKA 2E7PA 3ZL5A 1Q98A 4PUAA 2B1KA 3VI7A 2HSMA 3UAPA 4PNGA 5G5FA 2B5YA 2A2RA 1WIKA 1AIUA 4K2DA 1XZOA 1ZMAA 2OADA 4NHZA 3EYTA 4G0KA 4EE0A 3DD3A 3IE3A 1TOFA 2RM5A 2X8HA 3M9JA 4O7HA 1GNEA 1THOA 1GLPA 4TRXA 2DJ2A 2RIIA 5IOXA 5J4VA 5IMZA 4ZL8A 5F0GA 3QCPA 2VKZG 3WT2A 2FWFA 19GSA 4HU9A 3APSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJ5 A;  4ZIJ A;  1XWG A;  2IIY A;  2QKE A;  1JLV A;  3LGC A;  3WYW A;  2AYT A;  4TXO B;  5JCW A;  2WB9 A;  1AXD A;  2YP6 A;  1R5P A;  5D73 A;  4KDU A;  5CNW A;  2H75 A;  4TR0 A;  1KBN A;  1ZCP A;  1Q4J A;  1OC8 A;  2MZC A;  3GKK A;  3ZVJ A;  2IMF A;  1JZO A;  1H75 A;  5IIZ A;  1PL1 A;  3F8U A;  2P5R A;  2NBS A;  3APO A;  3NZN A;  1E6B A;  1U88 A;  3F9U A;  1AW9 A;  2R5G A;  1V57 A;  2VL2 A;  5JCU A;  1H4O A;  1FAA A;  2LTK A;  2FHE A;  4GQF A;  1SK2 A;  1TKD B;  1TU8 A;  2VLU A;  3CTG A;  1LBK A;  4IN0 A;  2DJ3 A;  3F3Q A;  1G6Y A;  4E8E A;  1DUG A;  4IHU A;  3IK7 A;  1T8E B;  2J23 A;  1GSS A;  4HZ4 A;  4N30 A;  3CTF A;  3GH6 A;  3GA4 A;  5IO2 A;  1JZW A;  10GS A;  3G7J A;  1K0B A;  2VD0 A;  4EL1 A;  4KND A;  1U3I A;  5D93 A;  3C1R A;  4MH3 A;  1SKS B;  3O3T A;  5A4U A;  4D73 A;  4HU7 A;  3KH7 A;  1ERT A;  1LJR A;  3VI5 A;  2FWG A;  1AQW A;  3ZFB A;  3E9J B;  2ZCT A;  4F9Z A;  5E59 A;  3VWW A;  4MMM A;  4MK3 A;  3GV1 A;  1UN2 A;  3F3R A;  1K3Y A;  2F9S A;  2GZZ A;  3P2A A;  2MBS A;  2PER A;  1Y6E A;  1V9W A;  4IGJ A;  4KGI A;  2VCX A;  4OO4 A;  3QAG A;  4KCE A;  1JZR A;  2A2S A;  1FVJ A;  1IYH A;  4GF0 A;  2B6M A;  2D2Z A;  2ON7 A;  2JU5 A;  1ZOF A;  3P8W A;  3APQ A;  3KXO A;  4PUR A;  3EE2 A;  1EP8 A;  1BYE A;  3QAW A;  1K0O A;  4ULX A;  1T4Y A;  1MEK A;  2HSN B;  5G5E A;  3I43 A;  5IMV A;  2DMM A;  4IJI A;  3QD9 A;  2HRN A;  2K9F A;  1QMV A;  3TB2 A;  2TIR A;  4GLT A;  3D21 A;  3F4T A;  2FWE A;  2YWN A;  1X9S B;  3L0H A;  2LJR A;  2J9H A;  1ZGN A;  2OA7 A;  4LL1 B;  1O8W A;  3GTU B;  1GSY A;  4J57 E;  4HZ2 A;  4I97 A;  2PGT A;  3C1S A;  3GIX A;  3P7X A;  1T7P B;  3LYK A;  2LS5 A;  4MP4 A;  2RLI A;  3QFA C;  4TR1 A;  3VWV A;  1U3A A;  5L71 A;  1FB0 A;  4LMW A;  2H0H A;  2MYG A;  4L5O A;  1OVN A;  1TI3 A;  3ME7 A;  3A2X A;  2AUV A;  3IOS A;  3S9F A;  1XBS A;  3CMI A;  3U6V A;  2VOC A;  5IM9 A;  4WR5 A;  4NHW A;  2YZU A;  3VUR A;  5DQY A;  5EY6 A;  3GL3 A;  1YKC A;  2I1U A;  4GCI A;  4BVY B;  3CSI A;  3KMN A;  3NOF A;  1PX7 A;  2N5F A;  1B4Q A;  5AN1 A;  4G0I A;  4KX4 A;  2C8U A;  4OD7 A;  4WBR D;  2JSY A;  4ZXG A;  2IJY A;  2XBI A;  5A5K A;  3ZTL A;  2C4J A;  1WOU A;  2IN3 A;  3A2W A;  2AB6 A;  1SK1 A;  3HJP A;  3D22 A;  4HEA 2;  4QQ7 A;  3ED3 A;  1XXU A;  5D96 A;  1NHY A;  1EV9 A;  5G1L A;  1EEJ A;  2ALB A;  3QDN A;  4ISD A;  1MDJ A;  5A4W A;  5H5Q A;  1YDK A;  1K0D A;  3ZFL A;  1QFN A;  3Q19 A;  3SWL A;  2VLV A;  1NHO A;  4HJ2 A;  4F0B A;  5DBQ A;  2V41 A;  2HNL A;  4WET A;  3HZ8 A;  1MD3 A;  2H76 A;  4ACS A;  2MMA A;  2VL3 A;  3F63 A;  1VF4 A;  5IOW A;  4BA7 A;  4POK A;  3VLN A;  2V2G A;  4ZBD A;  3GUS A;  2I81 A;  2LQQ A;  3EU4 A;  4WR4 A;  4KB3 A;  4EUY A;  3QAV A;  1PA3 A;  1JFU A;  4TN8 A;  2YV7 A;  3C73 A;  2CV4 A;  4MZW A;  3UOM A;  3KGK A;  3W6G A;  2KOK A;  3G7Y A;  3ERW A;  4F82 A;  3KH9 A;  2HFD A;  4G10 A;  3BBY A;  1V98 A;  4TKY A;  1FO5 A;  3HY2 A;  2RUE A;  5E4W A;  6GSX A;  3IC4 A;  1BED A;  2H72 A;  1T00 A;  3H1N A;  3TJB A;  1TDI A;  2EIO A;  4XCS A;  1HNB A;  3QR6 A;  1OC9 B;  2N5A A;  2X99 A;  4TXO A;  1SK0 A;  1A8L A;  1B48 A;  1SL0 B;  2HRK B;  4NPB A;  2HYX A;  2HZE A;  5CO3 A;  1W89 A;  4HDE A;  4YAV A;  2X64 A;  4ZB8 A;  2HQT A;  4DSS B;  5AIV A;  2MMZ A;  3HJM A;  5HR3 A;  1TK0 B;  2PVO C;  2ZNM A;  2DJJ A;  4JED A;  2H74 A;  1GWC A;  5DCH A;  2IL3 A;  2DML A;  1HYU A;  3QOU A;  4F03 A;  2ON5 A;  3A3T A;  2H70 A;  2CZ3 A;  5HR1 A;  4N10 A;  1PSQ A;  4NV2 A;  5ID2 B;  1AQX A;  2LV3 A;  2GDR A;  5BMU A;  1ERU A;  2IFQ A;  4MF6 A;  1G6W A;  3VWU A;  3FZA A;  2LNS A;  1W4V A;  1A23 A;  4L5L A;  3QPM A;  4ZIL A;  1Z3E A;  1EOG A;  3L4N A;  4KH7 A;  1U6T A;  5IMA A;  3UVH A;  5AGY A;  5CYY A;  3BD2 A;  3IXR A;  4MDC A;  5J3R A;  4O92 A;  3LWA A;  5ABR A;  3TKS E;  3EMX A;  3DIE A;  1YJ6 A;  1ML6 A;  1YZX A;  4TXV A;  6GSW A;  4XS6 A;  4NMU A;  3UJ1 A;  2LQO A;  4PQI A;  5IMD A;  3G9B A;  14GS A;  5CP1 A;  2FA4 A;  2GS3 A;  4MJC A;  5KN3 A;  3FZ5 A;  3TDG A;  2VO4 A;  5D9W A;  4YQM A;  4MJA A;  1GSU A;  4YQV A;  3Q18 A;  4KW6 A;  5C00 A;  5F07 A;  3ZRE A;  2GST A;  3KCM A;  3TUE A;  2M46 A;  1XOA A;  1JZD A;  2O87 A;  4X0X A;  4KE3 A;  4K6X A;  4F2I A;  4N0V A;  1PGT A;  2CA8 A;  1SD9 A;  5EL8 A;  1SJI A;  2G0F A;  2LNT A;  1Z7R A;  1R4W A;  3LFL A;  1XVW A;  2DBC A;  4XRA A;  3TJF A;  4IJ3 A;  4KDX A;  1AAZ A;  5F06 A;  4L8E A;  3GTU A;  4MPG A;  2GQL A;  2JZR A;  2QC7 A;  5B6N A;  4IBP A;  2M80 A;  1YQ1 A;  4MF5 A;  2C1Y A;  3FR9 A;  3HZ4 A;  5ECL B;  3DRN A;  2KLX A;  4BWS A;  5D8I A;  6GSU A;  4POL A;  1QXH A;  3HHV A;  3MSZ A;  3O76 A;  5CAX A;  9GSS A;  3A5W A;  2HI7 A;  3H4K A;  1S3A A;  4MAB A;  1YF1 A;  4RUV A;  1TP9 A;  4PTS A;  5HQP A;  4MH2 A;  1A24 A;  2HLS A;  4BVY A;  1KTE A;  3CRU A;  2DIY A;  3TKP A;  3EWL A;  4PNF A;  1F3B A;  5DAK B;  1RQM A;  3MNG A;  3OR5 A;  4DSR A;  3TKS A;  4GXZ A;  3E0U A;  4GST A;  5DAL B;  4AJ7 A;  4WF4 A;  2HSY A;  2VM1 A;  5LCZ A;  3BOA A;  4EC0 A;  5ECM B;  1ST9 A;  5ECR B;  2PUK C;  2RM6 A;  3IHQ A;  4TVE A;  3VPT A;  5IPG A;  4EKZ A;  1SKW B;  2H30 A;  1B9X C;  5D9X A;  4PX1 A;  4BL7 B;  4X43 A;  2YCD A;  2V1M A;  1BX9 A;  2CVB A;  1GUK A;  3LG6 A;  2KHP A;  3WT1 A;  1XW6 A;  1TXX A;  1XIY A;  1EV4 A;  2EIR A;  3GN3 A;  3TJJ A;  2V32 A;  1F9M A;  4ECJ A;  3MDK A;  2WZ9 A;  5G30 A;  4LL4 B;  4K7O A;  1YY7 A;  1XVQ A;  1GTB A;  1V2A A;  3D5J A;  3SBC A;  5HFK A;  5FHI A;  3Q6O A;  2LRN A;  1XWC A;  2H8L A;  2OBK A;  3LEF A;  4V2L A;  2DJ1 A;  3KD0 A;  4FIW A;  3VFI A;  2VLT A;  4L0W A;  1GSD A;  4L0U A;  11GS A;  5CRE A;  1YEX A;  3RHB A;  1AQV A;  1J9B A;  2IMI A;  4AJ8 A;  1GLQ A;  4OO5 A;  3KM6 A;  2WUL A;  1HD2 A;  3LQ7 A;  5B8B A;  2H1G A;  3IAM 2;  4IEL A;  1SU9 A;  3ZLP A;  5C04 A;  5D9V A;  1NW2 A;  3UEM A;  3D6I A;  2DLX A;  1MD4 A;  4CHS A;  2GTU A;  5ECI B;  1CQG A;  3F0I A;  1GSE A;  1OC9 A;  2YPM A;  2PMT A;  4HI7 A;  3PPU A;  4EDY A;  2C80 A;  4X1U A;  4YH2 A;  4G9H A;  3FEU A;  2HRK A;  4JBB A;  3FRC A;  4HOJ A;  4JZQ A;  3F6D A;  4E8H A;  3I69 A;  5ECK B;  1G0T A;  3MAK A;  3CSJ A;  4N11 A;  4G19 A;  2HSM B;  1JHB A;  4IQA A;  2CAI A;  1X9W B;  4GSN A;  1A2L A;  5KN0 A;  1R5A A;  5J9C A;  2VIM A;  3TKR A;  1V58 A;  2P31 A;  1A2J A;  4K0N A;  4BVX B;  1G7O A;  2K8V A;  3GRX A;  5DDL A;  4MA9 A;  2H71 A;  2C3T A;  2B7K A;  5ID2 A;  2H6Z A;  2K18 A;  2O85 A;  3TRP A;  2B7J A;  1ERW A;  1F3A A;  3HVX A;  2NTO A;  4KSM A;  2YNX A;  2H01 A;  1X5E A;  2C0D A;  3TRQ A;  4ILF A;  1OAZ A;  2CVD A;  4YQU A;  3ZIT A;  1PL2 A;  5COH A;  3F4S A;  4MJE A;  4FO5 A;  1DE2 A;  1T1V A;  1TRV A;  1PQN A;  4XRD A;  3LXZ A;  3G7I A;  2VCZ A;  4JU5 A;  3KZQ A;  4KDY A;  2FLS A;  3RAZ A;  3HKR A;  3UMA A;  2HZF A;  2H6Y A;  2E2G A;  1HNC A;  1Z6M A;  3D4T A;  5CRW A;  4RQR A;  5LNK e;  4TR4 A;  4JRR A;  2XHF A;  4N0Z A;  3EUR A;  3WGX A;  3ZRD A;  4EO3 A;  4IW9 A;  4IVF A;  2H0G A;  1FW1 A;  1A0F A;  5CRD A;  3I9V 2;  1EEM A;  1C72 A;  2YN1 A;  1NM3 A;  1FB6 A;  1TJD A;  3IPZ A;  1K0M A;  1Z9H A;  5ECS A;  2K8S A;  1OYJ A;  1VF2 A;  4OCF A;  4CDO A;  3DKS A;  1B4P A;  1YKA A;  4K7N A;  2GSR A;  4PQ1 A;  2JAC A;  4D73 B;  1TK8 B;  2IMK A;  1KNG A;  1G7E A;  1URM A;  1TI1 A;  1OKT A;  2VCQ A;  16GS A;  4FH8 A;  1B9Y C;  2HXK A;  4GTU A;  1HNA A;  2G2Q A;  2H1D A;  5JWQ B;  3TRX A;  1AUC A;  4FYC A;  2PN8 A;  3TKQ A;  3RHC A;  4HJM A;  5KN1 A;  1M2A A;  3KMO A;  5DJL A;  6GST A;  1QGV A;  2PBJ A;  2LRT A;  1ILO A;  1PKW A;  3NIV A;  2CT6 A;  3HXS A;  5KN2 A;  1VF3 A;  4P3Y B;  2LJA A;  2UZ8 A;  1RK4 A;  3Q74 A;  1XPV A;  1M9A A;  2XPD A;  1NSW A;  2EC4 A;  2WRT A;  1M9B A;  6GSV A;  1SD8 A;  5DAK A;  3HDC A;  3U5R E;  5IPH A;  1K0N A;  3GUR A;  1PD2 1;  3GFK A;  3HA9 A;  1GTU A;  2VL9 A;  2L5L A;  3UBL A;  2TRX A;  13GS A;  1BAY A;  1EOH A;  1GUH A;  1SJZ A;  2YAN A;  4OCE A;  4XHM A;  4ID0 A;  5DAL A;  3IV4 A;  3A2V A;  4ZBB A;  2L6C A;  1EZK A;  1SEN A;  2IWT A;  5J41 A;  4JE1 A;  4MPF A;  1TRW A;  2L5O A;  1M2B A;  4DVC A;  1V40 A;  4BL7 A;  2F51 A;  4QL7 A;  5ECO B;  2C3N A;  1K0A A;  3DML A;  1X0R A;  2PPT A;  1OKD A;  4TR1 B;  2DIZ A;  2I3Y A;  5ECH B;  2H1B A;  2X8G A;  4OFT A;  1J08 A;  1WE0 A;  2B5E A;  1WWJ A;  2WDU A;  2VCW A;  2O89 A;  3V1W A;  3ME8 A;  1ABA A;  4PUF C;  3FYG A;  18GS A;  2VUP A;  2XC2 A;  1ZYQ B;  2GGT A;  1S3C A;  4H86 A;  3WD6 A;  1USB A;  3UL3 A;  3GX0 A;  2R4V A;  1QQ2 A;  2JSZ A;  1MDK A;  3RDW A;  3LJR A;  2O8V B;  1GUM A;  1A8Y A;  2I4A A;  2TRC P;  4XS1 A;  3RBT A;  5GAP D;  2B5X A;  2YWM A;  1O73 A;  2OE1 A;  5JWO B;  2BJX A;  1XWB A;  3ISO A;  3GHA A;  2YOI A;  3IA1 A;  1PKZ A;  3M3M A;  1SKR B;  1BJX A;  3ERF A;  2NDO A;  5EVO A;  2H0I A;  4I6X A;  4KSO A;  2A4V A;  2JZS A;  4KCA A;  4TW5 A;  1FOV A;  4GWR A;  2GQK A;  4XS4 B;  1X9M B;  4K1F A;  5B6M A;  4ML6 A;  1R26 A;  1WJK A;  3GKX A;  2GZY A;  1VGL A;  2O7K A;  4V2N A;  2LKU A;  2AV4 A;  3BCK A;  5INY A;  2LRC A;  4IKH A;  2FCH A;  3EIN A;  4K9Z A;  4IQ1 A;  1TTZ A;  2DJK A;  3ZYW A;  3I6A A;  3HCZ A;  1QK8 A;  3M9K A;  3JCM L;  4MF7 A;  3LXT A;  1M7T A;  3TGZ A;  2DC5 A;  4I2T A;  3C71 A;  1SYR A;  2GT6 A;  2OBI A;  2OJL A;  5GST A;  4BVX A;  5IMF A;  3HD5 A;  2V6O A;  5J9B A;  4V1A p;  2HE3 A;  2OAC A;  6GSS A;  3ZVJ D;  4F0C A;  2IPA A;  1EGO A;  3QMX A;  2C0E A;  1XWK A;  4OFM A;  1N2A A;  2R6K A;  2M72 A;  2FD3 A;  4PQH A;  2L59 A;  2VM2 A;  2OE3 A;  4K8M A;  3GKN A;  2YJH A;  4NV5 A;  4Q5N A;  3FW2 A;  4O5R A;  4IP6 A;  1GH2 A;  4WF5 A;  1TRS A;  2L57 A;  2MMO A;  4TR3 A;  2IME A;  2CQ9 A;  1T3B A;  2CX4 A;  1UA5 A;  1XW9 A;  4G0L A;  3KP9 A;  2GQM A;  3GL5 A;  4PXO A;  3KTB A;  4Q5F A;  2HZE B;  4KUN A;  5IQY A;  3KP8 A;  2H6X A;  4BWQ A;  3GMF A;  3WGD A;  1FVK A;  3R2Q A;  3W8J A;  5HFI A;  4POB A;  3KJY A;  4OMV A;  2FUG 2;  4O32 A;  4LLR A;  5FWG A;  3GST A;  2B1L A;  2LUS A;  3CXG A;  1FHE A;  2L4C A;  1UC7 A;  3W8S A;  5LD0 A;  2KP1 A;  3FZ4 A;  1VRS D;  3TJK A;  5GSS A;  4DSQ A;  2VAF A;  1KEB A;  4KF9 A;  2IFQ B;  5B8A A;  3PR8 A;  3IK9 A;  3GKM A;  1XWA A;  4MZB A;  4I5Q A;  2L6D A;  3ZIJ A;  2C0F A;  5G2Z A;  1DE1 A;  4LMV A;  2C3Q A;  4RQX A;  1T4Z A;  3J7Y b;  4J56 E;  3US3 A;  1SL2 B;  4YAP A;  1OE8 A;  1I9D A;  5J4U A;  2FY6 A;  5DCG A;  3L78 A;  4FYU A;  2AAW A;  1OE7 A;  5G1K A;  4XIH A;  1J0F A;  5HR2 A;  4XTS A;  2FGX A;  3HJO A;  3TKS C;  1Z5Y E;  1F37 A;  2REM A;  1O7U A;  3FZ9 A;  5DQS A;  4V2M A;  1TW9 A;  1ACV A;  2XPE A;  2K6V A;  2WS2 A;  4GQC A;  3UVT A;  1RW1 A;  2KP2 A;  1GTI A;  1QUW A;  1WPI A;  1BQ7 A;  2N5B A;  1EGR A;  2VL2 C;  2MMN A;  3CSH A;  2HSH A;  1MDI A;  2LJK A;  1WP0 A;  4Q5Q A;  3DVW A;  4ML1 A;  5B7C A;  2WGR A;  2HRF A;  2YV9 A;  5GAN D;  3PGT A;  4ZB9 A;  2CVK A;  1I5G A;  3CYN A;  4DSS A;  3N9J A;  20GS A;  3C7M A;  2GT5 A;  1GL8 A;  2HRA A;  3M0F A;  3D4M A;  3VPQ A;  1ZL9 A;  5ECQ B;  3WGE A;  4FYB A;  3J7Y k;  3LSZ A;  2KUC A;  1GSQ A;  2MBT A;  2QSI A;  4K0G A;  2WCI A;  2CZ2 A;  1Y25 A;  2WFC A;  4I8B A;  1IYI A;  3F6F A;  3EC3 A;  3AY8 A;  2YWI A;  2P5Q A;  1EP7 A;  1M0U A;  1TU7 A;  1PMT A;  5CRH A;  1GRX A;  2YJ7 A;  4ECC A;  4Q5R A;  3ERG A;  1JLW A;  5DVB A;  2X8C A;  2H19 A;  3K8N A;  4EF0 A;  2YWO A;  3R3E A;  5HFG A;  3IDV A;  2I9H A;  4NXI A;  5JWR B;  1TK5 B;  4LA1 A;  2V6K A;  5A4V A;  1WMJ A;  3L9S A;  4CW9 A;  2LEG A;  3H8Q A;  4FQU A;  2F3M A;  3D0Z A;  3GSS A;  3QFB C;  2IMD A;  1F6M C;  1U87 A;  1O81 A;  2RUF A;  2BTO T;  2VCT A;  4G2E A;  3M8N A;  3PH9 A;  1GNW A;  3RPP A;  2VD1 A;  5F05 A;  1ZYE A;  4IP1 A;  4ECB A;  1A0R P;  3FHK A;  5IO0 A;  1OC3 A;  8GSS A;  4GRF A;  17GS A;  1K3O A;  4RI7 A;  3TJG A;  3CBU A;  4JR4 A;  5KEJ A;  1A2M A;  2GSQ A;  2R3X A;  2QGV A;  4BPY A;  2FA8 A;  3LYP A;  2YZH A;  4ZB6 A;  2ZUP A;  5ENU A;  2XBQ A;  3VK9 A;  3DWV A;  4GSS A;  1S3D A;  5IMC A;  4Z7X A;  4XS4 A;  1EWX A;  4RI6 A;  3KTL A;  3H79 A;  3DEX A;  2JZT A;  1DSB A;  1VF1 A;  3GYK A;  1XFL A;  4WBJ A;  2LST A;  5EPF A;  1GP1 A;  4AJ6 A;  3L9V A;  2VCV A;  1PRX A;  3UBK A;  4EXJ A;  3EVI A;  4ZBA A;  1ERV A;  1LU4 A;  1R7H A;  2JL4 A;  1K0C A;  1ON4 A;  1SYX A;  3IBH A;  4J2F A;  5F8B A;  1X5D A;  4JR6 A;  1BG5 A;  1K3L A;  3E3E A;  2H66 A;  3FKF A;  5FT3 A;  2GVP A;  5H5S A;  1UVZ A;  5AIX A;  3HVS A;  4QL9 A;  1E2Y A;  7GSS A;  4EVM A;  3PIN A;  1WRY A;  3KIJ A;  3UAR A;  2PU9 C;  2DJ0 A;  1N8J A;  3TCO A;  1SL1 B;  4MJB A;  5J5N A;  1GSF A;  1GTA A;  3GNJ A;  2FWH A;  3F4R A;  3N5O A;  3DVX A;  2EIQ A;  3HVV A;  3MWH A;  4HQS A;  1YEP A;  1TRU A;  3ZZX A;  1SJ6 A;  3ZIV A;  5ELG A;  3LOR A;  2GZP A;  2NVL A;  3KEB A;  3IR4 A;  4HS1 A;  1XCC A;  4ZL7 A;  2E0Q A;  4NAX A;  4MZC A;  3H93 A;  1F2E A;  2JAD A;  5DJM A;  4DEJ A;  1XW5 A;  2CX3 A;  4TOP A;  4OWY A;  1ZZY A;  1O6J A;  1HQO A;  2B3S A;  5H5R A;  6GSY A;  1FG4 A;  2OKA A;  4ECI A;  4USS A;  2P0G A;  4POM A;  12GS A;  2NPB A;  1PN9 A;  2R37 A;  3CRT A;  5AIS A;  1B8X A;  4ZL9 A;  1YF0 A;  2BMX A;  4I2U A;  4WXT A;  3FY7 A;  2GLR A;  4IS0 A;  4EDZ A;  3DGQ A;  3TOU A;  2E2M A;  5ECP B;  5JCG A;  1MTC A;  2CAQ A;  5CRG A;  1PX6 A;  3C8E A;  1CQH A;  3VWX A;  2AJQ B;  3IAS 2;  3L9U A;  4WEY A;  1XOB A;  4WKW A;  2AHE A;  4K7I A;  3EMP A;  3P90 A;  4AF2 A;  4AGS A;  3FR6 A;  1AC1 A;  5HR0 A;  2WJU A;  3RPN A;  2L4Q A;  3DYR A;  3FK8 A;  3GH9 A;  4HQZ A;  4OFN A;  3TOT A;  1DBY A;  2ES7 A;  3ZML A;  2DSA A;  22GS A;  3GX8 A;  2C0G A;  3IC8 A;  4KAE A;  1O85 A;  1M2D A;  1Z7P A;  2H73 A;  2HT9 A;  2H1A A;  2R2J A;  4HUA A;  4PGT A;  5ELA A;  3M1G A;  3HYP A;  4MLY A;  3FR3 A;  2F8F A;  5G31 A;  2GSS A;  2PVQ A;  1Z6N A;  2F8A A;  2PWJ A;  4NWY A;  5GZZ B;  1X5C A;  1THX A;  3DXB A;  1GUL A;  3IRA A;  4MCU A;  3BCI A;  4KA0 A;  2OE0 A;  2Z9S A;  3EU3 A;  4V1A g;  2FNO A;  3O6T A;  5D9T A;  1O8X A;  3UIW A;  1M99 A;  5ECN B;  3ZMK A;  2E7P A;  3ZL5 A;  1Q98 A;  4PUA A;  2B1K A;  3VI7 A;  2HSM A;  3UAP A;  4PNG A;  5G5F A;  2B5Y A;  2A2R A;  1WIK A;  1AIU A;  4K2D A;  1XZO A;  1ZMA A;  2OAD A;  4NHZ A;  3EYT A;  4G0K A;  4EE0 A;  3DD3 A;  3IE3 A;  1TOF A;  2RM5 A;  2X8H A;  3M9J A;  4O7H A;  1GNE A;  1THO A;  1GLP A;  4TRX A;  2DJ2 A;  2RII A;  5IOX A;  5IMZ A;  4ZL8 A;  5F0G A;  3QCP A;  3WT2 A;  2FWF A;  19GS A;  4HU9 A;  3APS A; 
#chains in the Genus database with same CATH topology
 3BJ5 A;  4ZIJ A;  1XWG A;  2IIY A;  2QKE A;  1JLV A;  3LGC A;  3WYW A;  2AYT A;  4TXO B;  5JCW A;  2WB9 A;  1AXD A;  2YP6 A;  1R5P A;  5BRT A;  5D73 A;  4KDU A;  5CNW A;  2H75 A;  4TR0 A;  1KBN A;  1ZCP A;  1Q4J A;  1OC8 A;  2MZC A;  3GKK A;  3ZVJ A;  2IMF A;  2WVX A;  4K2X A;  1JZO A;  1H75 A;  5IIZ A;  1PL1 A;  3F8U A;  2P5R A;  2NBS A;  3APO A;  3NZN A;  1E6B A;  1U88 A;  3F9U A;  1AW9 A;  2R5G A;  1V57 A;  2VL2 A;  5JCU A;  1H4O A;  1FAA A;  2LTK A;  2FHE A;  4GQF A;  1SK2 A;  1TKD B;  1TU8 A;  2VLU A;  3CTG A;  1LBK A;  4IN0 A;  2DJ3 A;  3F3Q A;  1G6Y A;  4E8E A;  1DUG A;  4IHU A;  3IK7 A;  1T8E B;  2J23 A;  1GSS A;  4HZ4 A;  4N30 A;  3CTF A;  3GH6 A;  4Z2U A;  3GA4 A;  5BMU B;  5IO2 A;  1JZW A;  10GS A;  3G7J A;  1K0B A;  2VD0 A;  3A5I A;  4EL1 A;  4KND A;  1U3I A;  5D93 A;  3C1R A;  4MH3 A;  1SKS B;  3O3T A;  5A4U A;  4D73 A;  4HU7 A;  3KH7 A;  1ERT A;  1LJR A;  3VI5 A;  2FWG A;  1AQW A;  3ZFB A;  3E9J B;  2ZCT A;  4F9Z A;  5E59 A;  3VWW A;  4MMM A;  4MK3 A;  3GV1 A;  1UN2 A;  2WW0 A;  3F3R A;  1K3Y A;  2F9S A;  3RFR C;  2GZZ A;  3P2A A;  2MBS A;  2PER A;  1Y6E A;  1V9W A;  4IGJ A;  4KGI A;  4AKH A;  2VCX A;  4OO4 A;  3QAG A;  4KCE A;  1JZR A;  2A2S A;  1FVJ A;  1IYH A;  4GF0 A;  2B6M A;  2D2Z A;  2ON7 A;  2JU5 A;  1ZOF A;  3P8W A;  3APQ A;  3KXO A;  4PUR A;  3EE2 A;  1EP8 A;  1BYE A;  3HVN A;  3QAW A;  1K0O A;  4ULX A;  1T4Y A;  1MEK A;  1Y1U A;  2HSN B;  5G5E A;  3I43 A;  5IMV A;  2DMM A;  4IJI A;  3QD9 A;  2HRN A;  2K9F A;  1QMV A;  1XG8 A;  3TB2 A;  2TIR A;  4GLT A;  3D21 A;  3F4T A;  2FWE A;  2YWN A;  1X9S B;  3L0H A;  2LJR A;  2J9H A;  1ZGN A;  2OA7 A;  4LL1 B;  2O5V A;  1O8W A;  3GTU B;  4YKG A;  1GSY A;  4J57 E;  4HZ2 A;  4I97 A;  2PGT A;  3C1S A;  3GIX A;  3P7X A;  1T7P B;  3LYK A;  2LS5 A;  4MP4 A;  2RLI A;  3QFA C;  4TR1 A;  3VWV A;  1U3A A;  1S4B P;  4EIQ A;  5L71 A;  1FB0 A;  4LMW A;  2H0H A;  2MYG A;  4L5O A;  1OVN A;  1TI3 A;  3ME7 A;  3A2X A;  2AUV A;  3IOS A;  3S9F A;  1XBS A;  3CMI A;  3U6V A;  2VOC A;  5IM9 A;  4WR5 A;  4NHW A;  2YZU A;  3VUR A;  5DQY A;  5EY6 A;  3GL3 A;  1YKC A;  5A34 B;  4GCI A;  4BVY B;  2I1U A;  3CSI A;  3KMN A;  3NOF A;  1PX7 A;  2N5F A;  1B4Q A;  5AN1 A;  4G0I A;  4KX4 A;  2C8U A;  4OD7 A;  4WBR D;  2JSY A;  4ZXG A;  2IJY A;  2XBI A;  5A5K A;  3ZTL A;  2C4J A;  1WOU A;  2IN3 A;  3A2W A;  2AB6 A;  1SK1 A;  2DKH A;  3HJP A;  3D22 A;  4HEA 2;  5A1N A;  4QQ7 A;  3ED3 A;  1XXU A;  5D96 A;  1NHY A;  1EV9 A;  2EFD A;  5G1L A;  4K5S A;  1EEJ A;  2ALB A;  3QDN A;  4ISD A;  1MDJ A;  5A4W A;  5H5Q A;  1YDK A;  1K0D A;  3ZFL A;  1QFN A;  3Q19 A;  3SWL A;  1PFO A;  2VLV A;  1NHO A;  4HJ2 A;  4K5R A;  4F0B A;  5DBQ A;  2V41 A;  2HNL A;  4WET A;  3HZ8 A;  1MD3 A;  2H76 A;  4ACS A;  2DKI A;  2MMA A;  2VL3 A;  3F63 A;  1VF4 A;  5IOW A;  4BA7 A;  4POK A;  3VLN A;  2V2G A;  4ZBD A;  3GUS A;  2I81 A;  2LQQ A;  4CY8 A;  3EU4 A;  4WR4 A;  4KB3 A;  4EUY A;  3QAV A;  1PA3 A;  1JFU A;  4TN8 A;  2YV7 A;  3C73 A;  2CV4 A;  4MZW A;  3UOM A;  3KGK A;  3W6G A;  2KOK A;  3G7Y A;  3ERW A;  4F82 A;  3KH9 A;  2HFD A;  4MNN A;  4G10 A;  1M3J A;  3BBY A;  1V98 A;  4TKY A;  2O3E A;  1FO5 A;  3HY2 A;  2RUE A;  5E4W A;  6GSX A;  3IC4 A;  1BED A;  2H72 A;  1T00 A;  3H1N A;  3TJB A;  1TDI A;  2EIO A;  4XCS A;  1HNB A;  3QR6 A;  1OC9 B;  2N5A A;  2X99 A;  4TXO A;  1SK0 A;  2R0G A;  1A8L A;  1B48 A;  1SL0 B;  2HRK B;  4NPB A;  2HYX A;  2HZE A;  5CO3 A;  1W89 A;  4HDE A;  4YAV A;  2X64 A;  1SVL A;  4ZB8 A;  2HQT A;  1M3I A;  4DSS B;  5AIV A;  2MMZ A;  3HJM A;  5HR3 A;  1TK0 B;  2PVO C;  2X4A A;  2ZNM A;  2DJJ A;  4JED A;  2H74 A;  1GWC A;  5DCH A;  2IL3 A;  2DML A;  1HYU A;  3QOU A;  4F03 A;  1TXU A;  2ON5 A;  3A3T A;  2H70 A;  2CZ3 A;  5HR1 A;  4N10 A;  1PSQ A;  4NV2 A;  5ID2 B;  1AQX A;  2LV3 A;  2GDR A;  5BMU A;  1ERU A;  4Z2R A;  2IFQ A;  4MF6 A;  1G6W A;  3VWU A;  3FZA A;  2LNS A;  1W4V A;  1A23 A;  4L5L A;  3QPM A;  4O5U A;  4ZIL A;  1Z3E A;  1EOG A;  3L4N A;  4KH7 A;  1U6T A;  5IMA A;  3UVH A;  5AGY A;  5CYY A;  3BD2 A;  3IXR A;  4MDC A;  1BG1 A;  5J3R A;  4O92 A;  3LWA A;  5ABR A;  3TKS E;  3EMX A;  3DIE A;  1YJ6 A;  1ML6 A;  1YZX A;  4TXV A;  6GSW A;  4XS6 A;  4NMU A;  3UJ1 A;  2LQO A;  4PQI A;  5IMD A;  3G9B A;  14GS A;  5CP1 A;  2FA4 A;  2GS3 A;  4MJC A;  5KN3 A;  3FZ5 A;  3TDG A;  2VO4 A;  5D9W A;  4YQM A;  4MJA A;  1GSU A;  4YQV A;  3Q18 A;  4KW6 A;  5C00 A;  5F07 A;  3ZRE A;  2GST A;  3KCM A;  3TUE A;  2M46 A;  1XOA A;  2HSN A;  1JZD A;  2O87 A;  4X0X A;  4PHZ C;  4KE3 A;  4K6X A;  4F2I A;  4N0V A;  1PGT A;  2CA8 A;  1SD9 A;  5EL8 A;  1SJI A;  2G0F A;  2LNT A;  1Z7R A;  1R4W A;  2UV8 G;  3LFL A;  1XVW A;  2H1L A;  2DBC A;  4XRA A;  3TJF A;  4IJ3 A;  4KDX A;  1AAZ A;  5F06 A;  4L8E A;  3GTU A;  4MPG A;  2GQL A;  2JZR A;  2QC7 A;  5B6N A;  4IBP A;  2M80 A;  1YQ1 A;  3MYD A;  4MF5 A;  2C1Y A;  2WW1 A;  3FR9 A;  3HZ4 A;  5ECL B;  3DRN A;  2KLX A;  4BWS A;  5D8I A;  6GSU A;  4POL A;  1QXH A;  3HHV A;  3MSZ A;  3O76 A;  5CAX A;  9GSS A;  3A5W A;  2HI7 A;  3H4K A;  1S3A A;  4MAB A;  1YF1 A;  4FXY P;  4RUV A;  1TP9 A;  4PTS A;  5HQP A;  4MH2 A;  1A24 A;  2HLS A;  4N3Z A;  5A34 A;  4BVY A;  1KTE A;  3CRU A;  2DIY A;  3TKP A;  3EWL A;  4PNF A;  1F3B A;  5DAK B;  1RQM A;  3MNG A;  3OR5 A;  4DSR A;  3TKS A;  4GXZ A;  3E0U A;  4GST A;  5DAL B;  4AJ7 A;  4WF4 A;  2HSY A;  2VM1 A;  5LCZ A;  3BOA A;  4EC0 A;  5ECM B;  1ST9 A;  5ECR B;  2PUK C;  2RM6 A;  3IHQ A;  2QA2 A;  4TVE A;  3VPT A;  5IPG A;  2O36 A;  4EKZ A;  1S3R A;  1SKW B;  2H30 A;  1B9X C;  5D9X A;  4PX1 A;  4BL7 B;  4X43 A;  2YCD A;  2V1M A;  1BX9 A;  2CVB A;  4PI0 C;  1GUK A;  3LG6 A;  2KHP A;  3WT1 A;  3HMJ G;  1XW6 A;  1TXX A;  1XIY A;  1EV4 A;  2EIR A;  3GN3 A;  3TJJ A;  4E68 A;  3IHG A;  2V32 A;  1F9M A;  4ECJ A;  3MDK A;  2WZ9 A;  5G30 A;  4LL4 B;  4K7O A;  3CHX C;  1YY7 A;  1ZYN A;  1XVQ A;  1GTB A;  1V2A A;  3D5J A;  3SBC A;  2EFH A;  5HFK A;  5FHI A;  4EIP A;  2WVY A;  1YEW C;  3FMW A;  3Q6O A;  2LRN A;  1XWC A;  2H8L A;  2OBK A;  3LEF A;  4V2L A;  2DJ1 A;  3KD0 A;  4FIW A;  3VFI A;  2VLT A;  4L0W A;  1GSD A;  4L0U A;  11GS A;  5CRE A;  1YEX A;  3RHB A;  1AQV A;  1J9B A;  2IMI A;  4AJ8 A;  1GLQ A;  4OO5 A;  3KM6 A;  2WUL A;  1HD2 A;  3LQ7 A;  5B8B A;  2H1G A;  3IAM 2;  4IEL A;  1SU9 A;  3ZLP A;  5C04 A;  5D9V A;  1NW2 A;  3UEM A;  3D6I A;  2DLX A;  1MD4 A;  4CHS A;  2GTU A;  5ECI B;  1CQG A;  3F0I A;  1GSE A;  1OC9 A;  2YPM A;  2PMT A;  4HI7 A;  3PPU A;  4AKI A;  4EDY A;  2C80 A;  4X1U A;  4YH2 A;  4G9H A;  3FEU A;  2HRK A;  4JBB A;  3FRC A;  4HOJ A;  4JZQ A;  2WW2 A;  3F6D A;  4E8H A;  3I69 A;  5ECK B;  1G0T A;  3MAK A;  3CSJ A;  4N11 A;  4G19 A;  2HSM B;  1JHB A;  4IQA A;  2CAI A;  1X9W B;  4GSN A;  1A2L A;  5KN0 A;  4YKF A;  1R5A A;  5J9C A;  2VIM A;  3TKR A;  1V58 A;  2P31 A;  1A2J A;  4K0N A;  4BVX B;  1G7O A;  2K8V A;  3GRX A;  5DDL A;  4MA9 A;  2H71 A;  2C3T A;  2B7K A;  5ID2 A;  2H6Z A;  2K18 A;  2O85 A;  3TRP A;  2B7J A;  1SVM A;  1ERW A;  1F3A A;  3HVX A;  2NTO A;  4KSM A;  2YNX A;  2H01 A;  1X5E A;  2C0D A;  3TRQ A;  4ILF A;  1OAZ A;  2CVD A;  4YQU A;  3ZIT A;  1PL2 A;  5COH A;  3F4S A;  4MJE A;  4FO5 A;  1DE2 A;  1T1V A;  1TRV A;  1PQN A;  4XRD A;  3LXZ A;  3G7I A;  2VCZ A;  4JU5 A;  3KZQ A;  4KDY A;  2FLS A;  3RAZ A;  3HKR A;  3UMA A;  2HZF A;  2H6Y A;  2E2G A;  1HNC A;  1Z6M A;  3D4T A;  5CRW A;  4RQR A;  5LNK e;  4TR4 A;  4JRR A;  2XHF A;  4N0Z A;  3EUR A;  3WGX A;  3ZRD A;  4EO3 A;  4IW9 A;  4IVF A;  2H0G A;  1FW1 A;  1A0F A;  5J4Y A;  5CRD A;  3I9V 2;  4CY6 A;  1EEM A;  1C72 A;  2YN1 A;  1NM3 A;  1FB6 A;  1TJD A;  3IPZ A;  1K0M A;  1Z9H A;  5ECS A;  2K8S A;  4G01 A;  1OYJ A;  1VF2 A;  4OCF A;  4CDO A;  2A2P A;  3DKS A;  1B4P A;  1YKA A;  4K7N A;  2GSR A;  4PQ1 A;  2JAC A;  3TU3 B;  4D73 B;  1TK8 B;  2IMK A;  1KNG A;  1G7E A;  1URM A;  1TI1 A;  1OKT A;  2VCQ A;  2WW3 A;  16GS A;  4FH8 A;  1B9Y C;  2HXK A;  4GTU A;  1HNA A;  2G2Q A;  2H1D A;  5JWQ B;  3TRX A;  1AUC A;  4FYC A;  2PN8 A;  3TKQ A;  3RHC A;  4HJM A;  5KN1 A;  1M2A A;  3KMO A;  5DJL A;  6GST A;  1QGV A;  2PBJ A;  2LRT A;  1ILO A;  3CQF A;  1PKW A;  3NIV A;  2CT6 A;  3HXS A;  5KN2 A;  1VF3 A;  4P3Y B;  2LJA A;  2UZ8 A;  1RK4 A;  3Q74 A;  1XPV A;  1M9A A;  2XPD A;  1NSW A;  2EC4 A;  2WRT A;  1M9B A;  6GSV A;  1SD8 A;  2A4H A;  5DAK A;  3HDC A;  3U5R E;  5IPH A;  1K0N A;  3GUR A;  1PD2 1;  3GFK A;  3HA9 A;  1GTU A;  2VL9 A;  2L5L A;  3UBL A;  2TRX A;  13GS A;  1BAY A;  1EOH A;  1GUH A;  1SJZ A;  2YAN A;  4OCE A;  4XHM A;  4ID0 A;  5DAL A;  3IV4 A;  3A2V A;  4ZBB A;  2L6C A;  1EZK A;  1SEN A;  2IWT A;  5J41 A;  4JE1 A;  4MPF A;  1TRW A;  2L5O A;  1M2B A;  4DVC A;  1V40 A;  4BL7 A;  2F51 A;  4QL7 A;  5ECO B;  2C3N A;  1K0A A;  3DML A;  1X0R A;  2PPT A;  1OKD A;  4TR1 B;  2DIZ A;  2I3Y A;  5ECH B;  2H1B A;  2X8G A;  4OFT A;  1J08 A;  1WE0 A;  2B5E A;  1WWJ A;  2WDU A;  2VCW A;  2O89 A;  3V1W A;  3ME8 A;  1ABA A;  4PUF C;  3FYG A;  18GS A;  2VUP A;  2XC2 A;  1ZYQ B;  1N25 A;  5J40 A;  2GGT A;  1S3C A;  4H86 A;  4W66 A;  3WD6 A;  1USB A;  3UL3 A;  3GX0 A;  4O5Q A;  2R4V A;  1QQ2 A;  2JSZ A;  1MDK A;  3RDW A;  3LJR A;  2O8V B;  1GUM A;  1A8Y A;  2I4A A;  2TRC P;  4XS1 A;  3RBT A;  5GAP D;  2B5X A;  2YWM A;  1O73 A;  2OE1 A;  5JWO B;  2BJX A;  3LW9 A;  3EPT A;  1XWB A;  3ISO A;  3GHA A;  2YOI A;  3IA1 A;  1PKZ A;  3M3M A;  1SKR B;  1BJX A;  3ERF A;  2NDO A;  5EVO A;  2H0I A;  4I6X A;  4KSO A;  2A4V A;  2JZS A;  4KCA A;  4TW5 A;  1FOV A;  4GWR A;  2GQK A;  4XS4 B;  1X9M B;  4ICY A;  4K1F A;  5B6M A;  4ML6 A;  1R26 A;  1WJK A;  3GKX A;  2GZY A;  1VGL A;  2O7K A;  4V2N A;  2LKU A;  2AV4 A;  2R0C A;  3BCK A;  5INY A;  2LRC A;  4IKH A;  2FCH A;  3EIN A;  4K9Z A;  4IQ1 A;  1TTZ A;  2DJK A;  3ZYW A;  3I6A A;  3HCZ A;  1QK8 A;  3M9K A;  3JCM L;  4MF7 A;  3LXT A;  1M7T A;  3TGZ A;  2DC5 A;  4I2T A;  3C71 A;  1SYR A;  2GT6 A;  2OBI A;  2OJL A;  5GST A;  4BVX A;  5IMF A;  3HD5 A;  2V6O A;  5J9B A;  4V1A p;  2HE3 A;  2OAC A;  6GSS A;  3ZVJ D;  4F0C A;  2IPA A;  1EGO A;  3QMX A;  2C0E A;  3MIX A;  1XWK A;  4OFM A;  1N2A A;  2R6K A;  2M72 A;  2FD3 A;  4PQH A;  2L59 A;  2VM2 A;  2OE3 A;  4K8M A;  3RGB C;  3GKN A;  2YJH A;  4NV5 A;  4Q5N A;  3FW2 A;  4O5R A;  4IP6 A;  4QMK A;  1GH2 A;  4WF5 A;  1TRS A;  2L57 A;  2MMO A;  4TR3 A;  2IME A;  2CQ9 A;  2X49 A;  1T3B A;  2CX4 A;  1UA5 A;  1XW9 A;  2EFE A;  4G0L A;  3KP9 A;  2GQM A;  3GL5 A;  4PXO A;  3KTB A;  4Q5F A;  2HZE B;  4KUN A;  5IQY A;  3KP8 A;  2H6X A;  4BWQ A;  3GMF A;  3WGD A;  1FVK A;  3R2Q A;  3W8J A;  5HFI A;  4Z2T A;  1BF5 A;  4POB A;  3KJY A;  4OMV A;  2FUG 2;  4O32 A;  4LLR A;  5FWG A;  3GST A;  2B1L A;  2LUS A;  2WZS A;  3CXG A;  1FHE A;  2L4C A;  1UC7 A;  3W8S A;  5LD0 A;  2KP1 A;  3FZ4 A;  1VRS D;  1ZYP A;  3TJK A;  5GSS A;  4DSQ A;  4HSC X;  2VAF A;  1KEB A;  4KF9 A;  2IFQ B;  5B8A A;  3PR8 A;  3IK9 A;  3GKM A;  1XWA A;  4MZB A;  4I5Q A;  2L6D A;  3ZIJ A;  2C0F A;  5G2Z A;  1DE1 A;  4LMV A;  2C3Q A;  4RQX A;  1T4Z A;  3J7Y b;  4J56 E;  3US3 A;  2OT3 A;  1SL2 B;  4YAP A;  1OE8 A;  1I9D A;  5J4U A;  2FY6 A;  5A5H B;  5DCG A;  3L78 A;  4FYU A;  2AAW A;  1OE7 A;  5G1K A;  4XIH A;  1J0F A;  4GDF A;  5HR2 A;  4XTS A;  2FGX A;  3HJO A;  3TKS C;  1Z5Y E;  1F37 A;  2REM A;  1O7U A;  3FZ9 A;  5DQS A;  4V2M A;  1TW9 A;  1ACV A;  2XPE A;  2QA1 A;  2K6V A;  2WS2 A;  4GQC A;  3UVT A;  1RW1 A;  2KP2 A;  1GTI A;  1QUW A;  1WPI A;  1BQ7 A;  2N5B A;  1EGR A;  2VL2 C;  2MMN A;  3CSH A;  2HSH A;  1MDI A;  2LJK A;  1WP0 A;  4Q5Q A;  3DVW A;  4ML1 A;  5B7C A;  2WGR A;  2HRF A;  2YV9 A;  5GAN D;  3PGT A;  4ZB9 A;  2CVK A;  1I5G A;  3CYN A;  4DSS A;  4AI6 A;  3N9J A;  20GS A;  3C7M A;  2GT5 A;  5KOW A;  1GL8 A;  2HRA A;  3M0F A;  3D4M A;  3VPQ A;  1ZL9 A;  5ECQ B;  3WGE A;  1SVO A;  4FYB A;  3J7Y k;  3LSZ A;  2KUC A;  1GSQ A;  2MBT A;  1FOH A;  2QSI A;  4K0G A;  2WCI A;  2CZ2 A;  1Y25 A;  2WFC A;  4I8B A;  1IYI A;  3F6F A;  3EC3 A;  3AY8 A;  2YWI A;  2P5Q A;  1EP7 A;  1M0U A;  1TU7 A;  1PMT A;  5CRH A;  1GRX A;  2YJ7 A;  4ECC A;  4Q5R A;  3ERG A;  1JLW A;  5DVB A;  2X8C A;  2H19 A;  3K8N A;  4EF0 A;  2YWO A;  3R3E A;  4AKG A;  5HFG A;  3IDV A;  2I9H A;  1YVL A;  4NXI A;  5JWR B;  1TK5 B;  4LA1 A;  2V6K A;  5A4V A;  1WMJ A;  3L9S A;  4CW9 A;  2LEG A;  3H8Q A;  4FQU A;  2F3M A;  3D0Z A;  3GSS A;  3QFB C;  2IMD A;  1F6M C;  1U87 A;  1O81 A;  2RUF A;  2BTO T;  2VCT A;  2R0P A;  4G2E A;  3M8N A;  3PH9 A;  1GNW A;  3RPP A;  2VD1 A;  5F05 A;  1ZYE A;  4IP1 A;  2WVX B;  4ECB A;  1A0R P;  3FHK A;  5IO0 A;  1OC3 A;  1I1I P;  8GSS A;  4GRF A;  17GS A;  4PI2 C;  1K3O A;  4RI7 A;  3TJG A;  3CBU A;  1PN0 A;  4JR4 A;  5KEJ A;  1A2M A;  2GSQ A;  2R3X A;  2QGV A;  4BPY A;  2FA8 A;  3LYP A;  2YZH A;  4ZB6 A;  2ZUP A;  5ENU A;  2XBQ A;  3VK9 A;  3DWV A;  4GSS A;  1S3D A;  5IMC A;  4Z7X A;  4XS4 A;  1EWX A;  4RI6 A;  3KTL A;  3H79 A;  3DEX A;  2JZT A;  1DSB A;  1VF1 A;  3GYK A;  1XFL A;  4WBJ A;  2LST A;  5EPF A;  1GP1 A;  4AJ6 A;  2WVZ A;  3L9V A;  2VCV A;  1PRX A;  3UBK A;  4EXJ A;  3EVI A;  4ZBA A;  1ERV A;  1LU4 A;  1R7H A;  2JL4 A;  1K0C A;  1ON4 A;  1SYX A;  3IBH A;  4J2F A;  5F8B A;  1X5D A;  4JR6 A;  1BG5 A;  1K3L A;  3E3E A;  2H66 A;  3FKF A;  5FT3 A;  2GVP A;  5H5S A;  1UVZ A;  5AIX A;  3HVS A;  4QL9 A;  1E2Y A;  7GSS A;  4EVM A;  3PIN A;  1WRY A;  3KIJ A;  3UAR A;  2PU9 C;  2DJ0 A;  1N8J A;  3TCO A;  1SL1 B;  4MJB A;  5J5N A;  1GSF A;  1GTA A;  3GNJ A;  2FWH A;  3F4R A;  3N5O A;  3DVX A;  2EIQ A;  3HVV A;  3MWH A;  4HQS A;  1YEP A;  1TRU A;  3ZZX A;  1SJ6 A;  3ZIV A;  5ELG A;  3LOR A;  2GZP A;  5J47 A;  2NVL A;  3KEB A;  3IR4 A;  4HS1 A;  1XCC A;  4ZL7 A;  2E0Q A;  4NAX A;  4MZC A;  3H93 A;  1F2E A;  2JAD A;  5DJM A;  4DEJ A;  1XW5 A;  2CX3 A;  3CWG A;  5KOX A;  4TOP A;  4OWY A;  1ZZY A;  1O6J A;  1HQO A;  2B3S A;  5H5R A;  6GSY A;  1FG4 A;  2OKA A;  4ECI A;  4USS A;  2P0G A;  4POM A;  12GS A;  2NPB A;  1PN9 A;  2R37 A;  3CRT A;  5AIS A;  1B8X A;  4ZL9 A;  1YF0 A;  2BMX A;  4I2U A;  4WXT A;  3FY7 A;  2GLR A;  4IS0 A;  4EDZ A;  3DGQ A;  3TOU A;  2E2M A;  5ECP B;  5JCG A;  4ZB7 A;  4A5P A;  1MTC A;  2CAQ A;  5CRG A;  1PX6 A;  3C8E A;  1CQH A;  3VWX A;  2AJQ B;  3IAS 2;  3L9U A;  4WEY A;  1XOB A;  2EFC A;  4WKW A;  2AHE A;  4K7I A;  3EMP A;  3P90 A;  4AF2 A;  4AGS A;  3FR6 A;  1AC1 A;  4X4J A;  5HR0 A;  2WJU A;  3RPN A;  2L4Q A;  3DYR A;  3FK8 A;  3GH9 A;  4HQZ A;  4OFN A;  3TOT A;  1DBY A;  2ES7 A;  3ZML A;  2DSA A;  22GS A;  3GX8 A;  2C0G A;  3IC8 A;  4KAE A;  1O85 A;  1M2D A;  5A5H A;  1Z7P A;  2H73 A;  2HT9 A;  5A1N B;  2H1A A;  2R2J A;  4HUA A;  4PGT A;  5ELA A;  3M1G A;  3HYP A;  4MLY A;  4AKX B;  3FR3 A;  2F8F A;  5G31 A;  2GSS A;  2PVQ A;  1Z6N A;  2F8A A;  2PWJ A;  4NWY A;  5GZZ B;  1X5C A;  1THX A;  3DXB A;  1GUL A;  3IRA A;  4MCU A;  3BCI A;  4KA0 A;  2OE0 A;  2Z9S A;  3EU3 A;  4V1A g;  2FNO A;  3O6T A;  5D9T A;  1O8X A;  3UIW A;  1M99 A;  5ECN B;  3ZMK A;  2E7P A;  3ZL5 A;  1Q98 A;  4PUA A;  2B1K A;  3VI7 A;  2HSM A;  3UAP A;  4PNG A;  5G5F A;  2B5Y A;  2A2R A;  1WIK A;  1AIU A;  4BIK A;  4K2D A;  1XZO A;  1ZMA A;  2OAD A;  4NHZ A;  3EYT A;  4G0K A;  4EE0 A;  3DD3 A;  3IE3 A;  1TOF A;  2RM5 A;  2X8H A;  3M9J A;  4O7H A;  1GNE A;  1THO A;  1GLP A;  4TRX A;  2DJ2 A;  2RII A;  5IOX A;  5J4V A;  5IMZ A;  4ZL8 A;  5F0G A;  3QCP A;  2VKZ G;  3WT2 A;  2FWF A;  19GS A;  4HU9 A;  3APS A; 
#chains in the Genus database with same CATH homology
 3BJ5 A;  4ZIJ A;  1XWG A;  2IIY A;  2QKE A;  1JLV A;  3LGC A;  3WYW A;  2AYT A;  4TXO B;  5JCW A;  2WB9 A;  1AXD A;  2YP6 A;  1R5P A;  5BRT A;  5D73 A;  4KDU A;  5CNW A;  2H75 A;  4TR0 A;  1KBN A;  1ZCP A;  1Q4J A;  1OC8 A;  2MZC A;  3GKK A;  3ZVJ A;  2IMF A;  4K2X A;  1JZO A;  1H75 A;  5IIZ A;  1PL1 A;  3F8U A;  2P5R A;  2NBS A;  3APO A;  3NZN A;  1E6B A;  1U88 A;  3F9U A;  1AW9 A;  2R5G A;  1V57 A;  2VL2 A;  5JCU A;  1H4O A;  1FAA A;  2LTK A;  2FHE A;  4GQF A;  1SK2 A;  1TKD B;  1TU8 A;  2VLU A;  3CTG A;  1LBK A;  4IN0 A;  2DJ3 A;  3F3Q A;  1G6Y A;  4E8E A;  1DUG A;  4IHU A;  3IK7 A;  1T8E B;  2J23 A;  1GSS A;  4HZ4 A;  4N30 A;  3CTF A;  3GH6 A;  4Z2U A;  3GA4 A;  5BMU B;  5IO2 A;  1JZW A;  10GS A;  3G7J A;  1K0B A;  2VD0 A;  3A5I A;  4EL1 A;  4KND A;  1U3I A;  5D93 A;  3C1R A;  4MH3 A;  1SKS B;  3O3T A;  5A4U A;  4D73 A;  4HU7 A;  3KH7 A;  1ERT A;  1LJR A;  3VI5 A;  2FWG A;  1AQW A;  3ZFB A;  3E9J B;  2ZCT A;  4F9Z A;  5E59 A;  3VWW A;  4MMM A;  4MK3 A;  3GV1 A;  1UN2 A;  3F3R A;  1K3Y A;  2F9S A;  2GZZ A;  3P2A A;  2MBS A;  2PER A;  1Y6E A;  1V9W A;  4IGJ A;  4KGI A;  4AKH A;  2VCX A;  4OO4 A;  3QAG A;  4KCE A;  1JZR A;  2A2S A;  1FVJ A;  1IYH A;  4GF0 A;  2B6M A;  2D2Z A;  2ON7 A;  2JU5 A;  1ZOF A;  3P8W A;  3APQ A;  3KXO A;  4PUR A;  3EE2 A;  1EP8 A;  1BYE A;  3QAW A;  1K0O A;  4ULX A;  1T4Y A;  1MEK A;  1Y1U A;  2HSN B;  5G5E A;  3I43 A;  5IMV A;  2DMM A;  4IJI A;  3QD9 A;  2HRN A;  2K9F A;  1QMV A;  3TB2 A;  2TIR A;  4GLT A;  3D21 A;  3F4T A;  2FWE A;  2YWN A;  1X9S B;  3L0H A;  2LJR A;  2J9H A;  1ZGN A;  2OA7 A;  4LL1 B;  2O5V A;  1O8W A;  3GTU B;  4YKG A;  1GSY A;  4J57 E;  4HZ2 A;  4I97 A;  2PGT A;  3C1S A;  3GIX A;  3P7X A;  1T7P B;  3LYK A;  2LS5 A;  4MP4 A;  2RLI A;  3QFA C;  4TR1 A;  3VWV A;  1U3A A;  4EIQ A;  5L71 A;  1FB0 A;  4LMW A;  2H0H A;  2MYG A;  4L5O A;  1OVN A;  1TI3 A;  3ME7 A;  3A2X A;  2AUV A;  3IOS A;  3S9F A;  1XBS A;  3CMI A;  3U6V A;  2VOC A;  5IM9 A;  4WR5 A;  4NHW A;  2YZU A;  3VUR A;  5DQY A;  5EY6 A;  3GL3 A;  1YKC A;  5A34 B;  4GCI A;  4BVY B;  2I1U A;  3CSI A;  3KMN A;  3NOF A;  1PX7 A;  2N5F A;  1B4Q A;  5AN1 A;  4G0I A;  4KX4 A;  2C8U A;  4OD7 A;  4WBR D;  2JSY A;  4ZXG A;  2IJY A;  2XBI A;  5A5K A;  3ZTL A;  2C4J A;  1WOU A;  2IN3 A;  3A2W A;  2AB6 A;  1SK1 A;  2DKH A;  3HJP A;  3D22 A;  4HEA 2;  5A1N A;  4QQ7 A;  3ED3 A;  1XXU A;  5D96 A;  1NHY A;  1EV9 A;  2EFD A;  5G1L A;  4K5S A;  1EEJ A;  2ALB A;  3QDN A;  4ISD A;  1MDJ A;  5A4W A;  5H5Q A;  1YDK A;  1K0D A;  3ZFL A;  1QFN A;  3Q19 A;  3SWL A;  2VLV A;  1NHO A;  4HJ2 A;  4K5R A;  4F0B A;  5DBQ A;  2V41 A;  2HNL A;  4WET A;  3HZ8 A;  1MD3 A;  2H76 A;  4ACS A;  2DKI A;  2MMA A;  2VL3 A;  3F63 A;  1VF4 A;  5IOW A;  4BA7 A;  4POK A;  3VLN A;  2V2G A;  4ZBD A;  3GUS A;  2I81 A;  2LQQ A;  4CY8 A;  3EU4 A;  4WR4 A;  4KB3 A;  4EUY A;  3QAV A;  1PA3 A;  1JFU A;  4TN8 A;  2YV7 A;  3C73 A;  2CV4 A;  4MZW A;  3UOM A;  3KGK A;  3W6G A;  2KOK A;  3G7Y A;  3ERW A;  4F82 A;  3KH9 A;  2HFD A;  4MNN A;  4G10 A;  3BBY A;  1V98 A;  4TKY A;  1FO5 A;  3HY2 A;  2RUE A;  5E4W A;  6GSX A;  3IC4 A;  1BED A;  2H72 A;  1T00 A;  3H1N A;  3TJB A;  1TDI A;  2EIO A;  4XCS A;  1HNB A;  3QR6 A;  1OC9 B;  2N5A A;  2X99 A;  4TXO A;  1SK0 A;  2R0G A;  1A8L A;  1B48 A;  1SL0 B;  2HRK B;  4NPB A;  2HYX A;  2HZE A;  5CO3 A;  1W89 A;  4HDE A;  4YAV A;  2X64 A;  1SVL A;  4ZB8 A;  2HQT A;  4DSS B;  5AIV A;  2MMZ A;  3HJM A;  5HR3 A;  1TK0 B;  2PVO C;  2X4A A;  2ZNM A;  2DJJ A;  4JED A;  2H74 A;  1GWC A;  5DCH A;  2IL3 A;  2DML A;  1HYU A;  3QOU A;  4F03 A;  1TXU A;  2ON5 A;  3A3T A;  2H70 A;  2CZ3 A;  5HR1 A;  4N10 A;  1PSQ A;  4NV2 A;  5ID2 B;  1AQX A;  2LV3 A;  2GDR A;  5BMU A;  1ERU A;  4Z2R A;  2IFQ A;  4MF6 A;  1G6W A;  3VWU A;  3FZA A;  2LNS A;  1W4V A;  1A23 A;  4L5L A;  3QPM A;  4O5U A;  4ZIL A;  1Z3E A;  1EOG A;  3L4N A;  4KH7 A;  1U6T A;  5IMA A;  3UVH A;  5AGY A;  5CYY A;  3BD2 A;  3IXR A;  4MDC A;  1BG1 A;  5J3R A;  4O92 A;  3LWA A;  5ABR A;  3TKS E;  3EMX A;  3DIE A;  1YJ6 A;  1ML6 A;  1YZX A;  4TXV A;  6GSW A;  4XS6 A;  4NMU A;  3UJ1 A;  2LQO A;  4PQI A;  5IMD A;  3G9B A;  14GS A;  5CP1 A;  2FA4 A;  2GS3 A;  4MJC A;  5KN3 A;  3FZ5 A;  3TDG A;  2VO4 A;  5D9W A;  4YQM A;  4MJA A;  1GSU A;  4YQV A;  3Q18 A;  4KW6 A;  5C00 A;  5F07 A;  3ZRE A;  2GST A;  3KCM A;  3TUE A;  2M46 A;  1XOA A;  2HSN A;  1JZD A;  2O87 A;  4X0X A;  4KE3 A;  4K6X A;  4F2I A;  4N0V A;  1PGT A;  2CA8 A;  1SD9 A;  5EL8 A;  1SJI A;  2G0F A;  2LNT A;  1Z7R A;  1R4W A;  2UV8 G;  3LFL A;  1XVW A;  2H1L A;  2DBC A;  4XRA A;  3TJF A;  4IJ3 A;  4KDX A;  1AAZ A;  5F06 A;  4L8E A;  3GTU A;  4MPG A;  2GQL A;  2JZR A;  2QC7 A;  5B6N A;  4IBP A;  2M80 A;  1YQ1 A;  3MYD A;  4MF5 A;  2C1Y A;  3FR9 A;  3HZ4 A;  5ECL B;  3DRN A;  2KLX A;  4BWS A;  5D8I A;  6GSU A;  4POL A;  1QXH A;  3HHV A;  3MSZ A;  3O76 A;  5CAX A;  9GSS A;  3A5W A;  2HI7 A;  3H4K A;  1S3A A;  4MAB A;  1YF1 A;  4RUV A;  1TP9 A;  4PTS A;  5HQP A;  4MH2 A;  1A24 A;  2HLS A;  4N3Z A;  5A34 A;  4BVY A;  1KTE A;  3CRU A;  2DIY A;  3TKP A;  3EWL A;  4PNF A;  1F3B A;  5DAK B;  1RQM A;  3MNG A;  3OR5 A;  4DSR A;  3TKS A;  4GXZ A;  3E0U A;  4GST A;  5DAL B;  4AJ7 A;  4WF4 A;  2HSY A;  2VM1 A;  5LCZ A;  3BOA A;  4EC0 A;  5ECM B;  1ST9 A;  5ECR B;  2PUK C;  2RM6 A;  3IHQ A;  2QA2 A;  4TVE A;  3VPT A;  5IPG A;  4EKZ A;  1SKW B;  2H30 A;  1B9X C;  5D9X A;  4PX1 A;  4BL7 B;  4X43 A;  2YCD A;  2V1M A;  1BX9 A;  2CVB A;  1GUK A;  3LG6 A;  2KHP A;  3WT1 A;  3HMJ G;  1XW6 A;  1TXX A;  1XIY A;  1EV4 A;  2EIR A;  3GN3 A;  3TJJ A;  4E68 A;  3IHG A;  2V32 A;  1F9M A;  4ECJ A;  3MDK A;  2WZ9 A;  5G30 A;  4LL4 B;  4K7O A;  1YY7 A;  1ZYN A;  1XVQ A;  1GTB A;  1V2A A;  3D5J A;  3SBC A;  2EFH A;  5HFK A;  5FHI A;  4EIP A;  3FMW A;  3Q6O A;  2LRN A;  1XWC A;  2H8L A;  2OBK A;  3LEF A;  4V2L A;  2DJ1 A;  3KD0 A;  4FIW A;  3VFI A;  2VLT A;  4L0W A;  1GSD A;  4L0U A;  11GS A;  5CRE A;  1YEX A;  3RHB A;  1AQV A;  1J9B A;  2IMI A;  4AJ8 A;  1GLQ A;  4OO5 A;  3KM6 A;  2WUL A;  1HD2 A;  3LQ7 A;  5B8B A;  2H1G A;  3IAM 2;  4IEL A;  1SU9 A;  3ZLP A;  5C04 A;  5D9V A;  1NW2 A;  3UEM A;  3D6I A;  2DLX A;  1MD4 A;  4CHS A;  2GTU A;  5ECI B;  1CQG A;  3F0I A;  1GSE A;  1OC9 A;  2YPM A;  2PMT A;  4HI7 A;  3PPU A;  4AKI A;  4EDY A;  2C80 A;  4X1U A;  4YH2 A;  4G9H A;  3FEU A;  2HRK A;  4JBB A;  3FRC A;  4HOJ A;  4JZQ A;  3F6D A;  4E8H A;  3I69 A;  5ECK B;  1G0T A;  3MAK A;  3CSJ A;  4N11 A;  4G19 A;  2HSM B;  1JHB A;  4IQA A;  2CAI A;  1X9W B;  4GSN A;  1A2L A;  5KN0 A;  4YKF A;  1R5A A;  5J9C A;  2VIM A;  3TKR A;  1V58 A;  2P31 A;  1A2J A;  4K0N A;  4BVX B;  1G7O A;  2K8V A;  3GRX A;  5DDL A;  4MA9 A;  2H71 A;  2C3T A;  2B7K A;  5ID2 A;  2H6Z A;  2K18 A;  2O85 A;  3TRP A;  2B7J A;  1SVM A;  1ERW A;  1F3A A;  3HVX A;  2NTO A;  4KSM A;  2YNX A;  2H01 A;  1X5E A;  2C0D A;  3TRQ A;  4ILF A;  1OAZ A;  2CVD A;  4YQU A;  3ZIT A;  1PL2 A;  5COH A;  3F4S A;  4MJE A;  4FO5 A;  1DE2 A;  1T1V A;  1TRV A;  1PQN A;  4XRD A;  3LXZ A;  3G7I A;  2VCZ A;  4JU5 A;  3KZQ A;  4KDY A;  2FLS A;  3RAZ A;  3HKR A;  3UMA A;  2HZF A;  2H6Y A;  2E2G A;  1HNC A;  1Z6M A;  3D4T A;  5CRW A;  4RQR A;  5LNK e;  4TR4 A;  4JRR A;  2XHF A;  4N0Z A;  3EUR A;  3WGX A;  3ZRD A;  4EO3 A;  4IW9 A;  4IVF A;  2H0G A;  1FW1 A;  1A0F A;  5J4Y A;  5CRD A;  3I9V 2;  4CY6 A;  1EEM A;  1C72 A;  2YN1 A;  1NM3 A;  1FB6 A;  1TJD A;  3IPZ A;  1K0M A;  1Z9H A;  5ECS A;  2K8S A;  4G01 A;  1OYJ A;  1VF2 A;  4OCF A;  4CDO A;  2A2P A;  3DKS A;  1B4P A;  1YKA A;  4K7N A;  2GSR A;  4PQ1 A;  2JAC A;  3TU3 B;  4D73 B;  1TK8 B;  2IMK A;  1KNG A;  1G7E A;  1URM A;  1TI1 A;  1OKT A;  2VCQ A;  16GS A;  4FH8 A;  1B9Y C;  2HXK A;  4GTU A;  1HNA A;  2G2Q A;  2H1D A;  5JWQ B;  3TRX A;  1AUC A;  4FYC A;  2PN8 A;  3TKQ A;  3RHC A;  4HJM A;  5KN1 A;  1M2A A;  3KMO A;  5DJL A;  6GST A;  1QGV A;  2PBJ A;  2LRT A;  1ILO A;  1PKW A;  3NIV A;  2CT6 A;  3HXS A;  5KN2 A;  1VF3 A;  4P3Y B;  2LJA A;  2UZ8 A;  1RK4 A;  3Q74 A;  1XPV A;  1M9A A;  2XPD A;  1NSW A;  2EC4 A;  2WRT A;  1M9B A;  6GSV A;  1SD8 A;  2A4H A;  5DAK A;  3HDC A;  3U5R E;  5IPH A;  1K0N A;  3GUR A;  1PD2 1;  3GFK A;  3HA9 A;  1GTU A;  2VL9 A;  2L5L A;  3UBL A;  2TRX A;  13GS A;  1BAY A;  1EOH A;  1GUH A;  1SJZ A;  2YAN A;  4OCE A;  4XHM A;  4ID0 A;  5DAL A;  3IV4 A;  3A2V A;  4ZBB A;  2L6C A;  1EZK A;  1SEN A;  2IWT A;  5J41 A;  4JE1 A;  4MPF A;  1TRW A;  2L5O A;  1M2B A;  4DVC A;  1V40 A;  4BL7 A;  2F51 A;  4QL7 A;  5ECO B;  2C3N A;  1K0A A;  3DML A;  1X0R A;  2PPT A;  1OKD A;  4TR1 B;  2DIZ A;  2I3Y A;  5ECH B;  2H1B A;  2X8G A;  4OFT A;  1J08 A;  1WE0 A;  2B5E A;  1WWJ A;  2WDU A;  2VCW A;  2O89 A;  3V1W A;  3ME8 A;  1ABA A;  4PUF C;  3FYG A;  18GS A;  2VUP A;  2XC2 A;  1ZYQ B;  1N25 A;  5J40 A;  2GGT A;  1S3C A;  4H86 A;  4W66 A;  3WD6 A;  1USB A;  3UL3 A;  3GX0 A;  4O5Q A;  2R4V A;  1QQ2 A;  2JSZ A;  1MDK A;  3RDW A;  3LJR A;  2O8V B;  1GUM A;  1A8Y A;  2I4A A;  2TRC P;  4XS1 A;  3RBT A;  5GAP D;  2B5X A;  2YWM A;  1O73 A;  2OE1 A;  5JWO B;  2BJX A;  3LW9 A;  3EPT A;  1XWB A;  3ISO A;  3GHA A;  2YOI A;  3IA1 A;  1PKZ A;  3M3M A;  1SKR B;  1BJX A;  3ERF A;  2NDO A;  5EVO A;  2H0I A;  4I6X A;  4KSO A;  2A4V A;  2JZS A;  4KCA A;  4TW5 A;  1FOV A;  4GWR A;  2GQK A;  4XS4 B;  1X9M B;  4ICY A;  4K1F A;  5B6M A;  4ML6 A;  1R26 A;  1WJK A;  3GKX A;  2GZY A;  1VGL A;  2O7K A;  4V2N A;  2LKU A;  2AV4 A;  2R0C A;  3BCK A;  5INY A;  2LRC A;  4IKH A;  2FCH A;  3EIN A;  4K9Z A;  4IQ1 A;  1TTZ A;  2DJK A;  3ZYW A;  3I6A A;  3HCZ A;  1QK8 A;  3M9K A;  3JCM L;  4MF7 A;  3LXT A;  1M7T A;  3TGZ A;  2DC5 A;  4I2T A;  3C71 A;  1SYR A;  2GT6 A;  2OBI A;  2OJL A;  5GST A;  4BVX A;  5IMF A;  3HD5 A;  2V6O A;  5J9B A;  4V1A p;  2HE3 A;  2OAC A;  6GSS A;  3ZVJ D;  4F0C A;  2IPA A;  1EGO A;  3QMX A;  2C0E A;  3MIX A;  1XWK A;  4OFM A;  1N2A A;  2R6K A;  2M72 A;  2FD3 A;  4PQH A;  2L59 A;  2VM2 A;  2OE3 A;  4K8M A;  3GKN A;  2YJH A;  4NV5 A;  4Q5N A;  3FW2 A;  4O5R A;  4IP6 A;  4QMK A;  1GH2 A;  4WF5 A;  1TRS A;  2L57 A;  2MMO A;  4TR3 A;  2IME A;  2CQ9 A;  2X49 A;  1T3B A;  2CX4 A;  1UA5 A;  1XW9 A;  2EFE A;  4G0L A;  3KP9 A;  2GQM A;  3GL5 A;  4PXO A;  3KTB A;  4Q5F A;  2HZE B;  4KUN A;  5IQY A;  3KP8 A;  2H6X A;  4BWQ A;  3GMF A;  3WGD A;  1FVK A;  3R2Q A;  3W8J A;  5HFI A;  4Z2T A;  1BF5 A;  4POB A;  3KJY A;  4OMV A;  2FUG 2;  4O32 A;  4LLR A;  5FWG A;  3GST A;  2B1L A;  2LUS A;  3CXG A;  1FHE A;  2L4C A;  1UC7 A;  3W8S A;  5LD0 A;  2KP1 A;  3FZ4 A;  1VRS D;  1ZYP A;  3TJK A;  5GSS A;  4DSQ A;  2VAF A;  1KEB A;  4KF9 A;  2IFQ B;  5B8A A;  3PR8 A;  3IK9 A;  3GKM A;  1XWA A;  4MZB A;  4I5Q A;  2L6D A;  3ZIJ A;  2C0F A;  5G2Z A;  1DE1 A;  4LMV A;  2C3Q A;  4RQX A;  1T4Z A;  3J7Y b;  4J56 E;  3US3 A;  2OT3 A;  1SL2 B;  4YAP A;  1OE8 A;  1I9D A;  5J4U A;  2FY6 A;  5A5H B;  5DCG A;  3L78 A;  4FYU A;  2AAW A;  1OE7 A;  5G1K A;  4XIH A;  1J0F A;  4GDF A;  5HR2 A;  4XTS A;  2FGX A;  3HJO A;  3TKS C;  1Z5Y E;  1F37 A;  2REM A;  1O7U A;  3FZ9 A;  5DQS A;  4V2M A;  1TW9 A;  1ACV A;  2XPE A;  2QA1 A;  2K6V A;  2WS2 A;  4GQC A;  3UVT A;  1RW1 A;  2KP2 A;  1GTI A;  1QUW A;  1WPI A;  1BQ7 A;  2N5B A;  1EGR A;  2VL2 C;  2MMN A;  3CSH A;  2HSH A;  1MDI A;  2LJK A;  1WP0 A;  4Q5Q A;  3DVW A;  4ML1 A;  5B7C A;  2WGR A;  2HRF A;  2YV9 A;  5GAN D;  3PGT A;  4ZB9 A;  2CVK A;  1I5G A;  3CYN A;  4DSS A;  4AI6 A;  3N9J A;  20GS A;  3C7M A;  2GT5 A;  5KOW A;  1GL8 A;  2HRA A;  3M0F A;  3D4M A;  3VPQ A;  1ZL9 A;  5ECQ B;  3WGE A;  1SVO A;  4FYB A;  3J7Y k;  3LSZ A;  2KUC A;  1GSQ A;  2MBT A;  1FOH A;  2QSI A;  4K0G A;  2WCI A;  2CZ2 A;  1Y25 A;  2WFC A;  4I8B A;  1IYI A;  3F6F A;  3EC3 A;  3AY8 A;  2YWI A;  2P5Q A;  1EP7 A;  1M0U A;  1TU7 A;  1PMT A;  5CRH A;  1GRX A;  2YJ7 A;  4ECC A;  4Q5R A;  3ERG A;  1JLW A;  5DVB A;  2X8C A;  2H19 A;  3K8N A;  4EF0 A;  2YWO A;  3R3E A;  4AKG A;  5HFG A;  3IDV A;  2I9H A;  1YVL A;  4NXI A;  5JWR B;  1TK5 B;  4LA1 A;  2V6K A;  5A4V A;  1WMJ A;  3L9S A;  4CW9 A;  2LEG A;  3H8Q A;  4FQU A;  2F3M A;  3D0Z A;  3GSS A;  3QFB C;  2IMD A;  1F6M C;  1U87 A;  1O81 A;  2RUF A;  2BTO T;  2VCT A;  2R0P A;  4G2E A;  3M8N A;  3PH9 A;  1GNW A;  3RPP A;  2VD1 A;  5F05 A;  1ZYE A;  4IP1 A;  4ECB A;  1A0R P;  3FHK A;  5IO0 A;  1OC3 A;  8GSS A;  4GRF A;  17GS A;  1K3O A;  4RI7 A;  3TJG A;  3CBU A;  1PN0 A;  4JR4 A;  5KEJ A;  1A2M A;  2GSQ A;  2R3X A;  2QGV A;  4BPY A;  2FA8 A;  3LYP A;  2YZH A;  4ZB6 A;  2ZUP A;  5ENU A;  2XBQ A;  3VK9 A;  3DWV A;  4GSS A;  1S3D A;  5IMC A;  4Z7X A;  4XS4 A;  1EWX A;  4RI6 A;  3KTL A;  3H79 A;  3DEX A;  2JZT A;  1DSB A;  1VF1 A;  3GYK A;  1XFL A;  4WBJ A;  2LST A;  5EPF A;  1GP1 A;  4AJ6 A;  3L9V A;  2VCV A;  1PRX A;  3UBK A;  4EXJ A;  3EVI A;  4ZBA A;  1ERV A;  1LU4 A;  1R7H A;  2JL4 A;  1K0C A;  1ON4 A;  1SYX A;  3IBH A;  4J2F A;  5F8B A;  1X5D A;  4JR6 A;  1BG5 A;  1K3L A;  3E3E A;  2H66 A;  3FKF A;  5FT3 A;  2GVP A;  5H5S A;  1UVZ A;  5AIX A;  3HVS A;  4QL9 A;  1E2Y A;  7GSS A;  4EVM A;  3PIN A;  1WRY A;  3KIJ A;  3UAR A;  2PU9 C;  2DJ0 A;  1N8J A;  3TCO A;  1SL1 B;  4MJB A;  5J5N A;  1GSF A;  1GTA A;  3GNJ A;  2FWH A;  3F4R A;  3N5O A;  3DVX A;  2EIQ A;  3HVV A;  3MWH A;  4HQS A;  1YEP A;  1TRU A;  3ZZX A;  1SJ6 A;  3ZIV A;  5ELG A;  3LOR A;  2GZP A;  5J47 A;  2NVL A;  3KEB A;  3IR4 A;  4HS1 A;  1XCC A;  4ZL7 A;  2E0Q A;  4NAX A;  4MZC A;  3H93 A;  1F2E A;  2JAD A;  5DJM A;  4DEJ A;  1XW5 A;  2CX3 A;  3CWG A;  5KOX A;  4TOP A;  4OWY A;  1ZZY A;  1O6J A;  1HQO A;  2B3S A;  5H5R A;  6GSY A;  1FG4 A;  2OKA A;  4ECI A;  4USS A;  2P0G A;  4POM A;  12GS A;  2NPB A;  1PN9 A;  2R37 A;  3CRT A;  5AIS A;  1B8X A;  4ZL9 A;  1YF0 A;  2BMX A;  4I2U A;  4WXT A;  3FY7 A;  2GLR A;  4IS0 A;  4EDZ A;  3DGQ A;  3TOU A;  2E2M A;  5ECP B;  5JCG A;  4ZB7 A;  4A5P A;  1MTC A;  2CAQ A;  5CRG A;  1PX6 A;  3C8E A;  1CQH A;  3VWX A;  2AJQ B;  3IAS 2;  3L9U A;  4WEY A;  1XOB A;  2EFC A;  4WKW A;  2AHE A;  4K7I A;  3EMP A;  3P90 A;  4AF2 A;  4AGS A;  3FR6 A;  1AC1 A;  4X4J A;  5HR0 A;  2WJU A;  3RPN A;  2L4Q A;  3DYR A;  3FK8 A;  3GH9 A;  4HQZ A;  4OFN A;  3TOT A;  1DBY A;  2ES7 A;  3ZML A;  2DSA A;  22GS A;  3GX8 A;  2C0G A;  3IC8 A;  4KAE A;  1O85 A;  1M2D A;  5A5H A;  1Z7P A;  2H73 A;  2HT9 A;  5A1N B;  2H1A A;  2R2J A;  4HUA A;  4PGT A;  5ELA A;  3M1G A;  3HYP A;  4MLY A;  4AKX B;  3FR3 A;  2F8F A;  5G31 A;  2GSS A;  2PVQ A;  1Z6N A;  2F8A A;  2PWJ A;  4NWY A;  5GZZ B;  1X5C A;  1THX A;  3DXB A;  1GUL A;  3IRA A;  4MCU A;  3BCI A;  4KA0 A;  2OE0 A;  2Z9S A;  3EU3 A;  4V1A g;  2FNO A;  3O6T A;  5D9T A;  1O8X A;  3UIW A;  1M99 A;  5ECN B;  3ZMK A;  2E7P A;  3ZL5 A;  1Q98 A;  4PUA A;  2B1K A;  3VI7 A;  2HSM A;  3UAP A;  4PNG A;  5G5F A;  2B5Y A;  2A2R A;  1WIK A;  1AIU A;  4K2D A;  1XZO A;  1ZMA A;  2OAD A;  4NHZ A;  3EYT A;  4G0K A;  4EE0 A;  3DD3 A;  3IE3 A;  1TOF A;  2RM5 A;  2X8H A;  3M9J A;  4O7H A;  1GNE A;  1THO A;  1GLP A;  4TRX A;  2DJ2 A;  2RII A;  5IOX A;  5J4V A;  5IMZ A;  4ZL8 A;  5F0G A;  3QCP A;  2VKZ G;  3WT2 A;  2FWF A;  19GS A;  4HU9 A;  3APS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...