4JZQA

Crystal structure of human clic1 c24d mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
237
structure length
237
Chain Sequence
QPQVELFVKAGSDGAKIGNDPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of CLIC1 C24 mutants
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 1
total genus 82
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4jzqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4jzqA01
2L59A 1UA5A 1MDKA 3K8NA 2K6VA 3HD5A 2P5RA 3ERGA 2X8GA 2KHPA 1CQHA 5KN0A 1PN9A 5HR1A 1OC8A 4BVXB 4DEJA 2VLUA 2IWTA 3RAZA 2LJKA 1EEMA 4IJIA 2B5XA 3QAWA 1E2YA 4RQRA 2BJXA 5B6NA 4ID0A 3ZLPA 3KIJA 1YEXA 3VWVA 2CT6A 2H74A 2LNTA 1BJXA 4FQUA 1OC9B 4X1UA 2JU5A 1V57A 3VWWA 3A5WA 2VLVA 2GS3A 4K0NA 2LJAA 3GSTA 1XWBA 4IW9A 2H8LA 5DCGA 1XXUA 2VL2C 5F06A 4BL7B 3IRAA 5DQSA 2C4JA 1VF1A 4TW5A 1HQOA 2H72A 4ZBBA 4GRFA 1K0BA 1O7UA 3D21A 1PQNA 5G5FA 4J56E 1G6WA 1SL0B 2NBSA 2WS2A 3LYKA 1HD2A 3WT2A 3F9UA 3TCOA 4J57E 3RPNA 1SKRB 4AJ7A 4AF2A 2EIOA 3CRTA 2X8HA 2FA8A 2LV3A 4D73B 3NOFA 5H5QA 2MBSA 5CRWA 1KNGA 2HRKB 2MMOA 2JZRA 1OE8A 5D8IA 2O85A 1X0RA 4FH8A 5CRHA 2CVBA 3ZTLA 4YAPA 3VWUA 2VCVA 3MAKA 5GZZB 1I9DA 1WRYA 1TDIA 4OFMA 2E2MA 6GSSA 4RI6A 3F8UA 12GSA 1O6JA 2LKUA 4G0LA 1ACVA 2LUSA 2CV4A 4K6XA 2RUEA 4OD7A 3GSSA 2C3NA 2WCIA 5CREA 1T3BA 2R3XA 3O76A 5A5KA 1AC1A 1TK0B 2O87A 1OKTA 1XVQA 2PMTA 3TRQA 3J7Yk 2AAWA 2KP2A 2A2RA 2KP1A 1Z5YE 2LRTA 2JSYA 1PSQA 3F6FA 3TDGA 3IBHA 4JRRA 4ECBA 1B4QA 3VI7A 1G7EA 1XFLA 5BMUA 4I97A 2VLTA 3LGCA 3HJPA 3QCPA 1F3AA 2H66A 5EPFA 3M1GA 3I6AA 2HRFA 3TKSA 2BMXA 3GH9A 2C0EA 3LORA 4HZ2A 3GRXA 4IQ1A 4ECCA 3ZRDA 3DYRA 2H73A 4GLTA 1T00A 3KTBA 2PUKC 2E7PA 3H79A 2R6KA 3D22A 4IP1A 3KZQA 1GRXA 4GSTA 1BQ7A 3D6IA 3IC8A 5JWOB 1H4OA 1MDIA 3E9JB 4OCEA 1S3CA 1M9BA 2H6YA 1XIYA 2PU9C 2P31A 4TN8A 4MZWA 1U3AA 1EP8A 3L0HA 2K8SA 4EDZA 5ECQB 1XWKA 3ME7A 5F07A 2EC4A 1BAYA 3QFAC 4GF0A 3D4MA 2LRCA 3CYNA 1QGVA 4POLA 3CMIA 4POBA 1PD21 2N5BA 3DWVA 4MH3A 4L5LA 3FK8A 3HVXA 2B6MA 2L6DA 4DSSA 5G1LA 5F8BA 1ZOFA 4N0VA 1Z3EA 4QL9A 4GQFA 2GSRA 2GQLA 1JFUA 2C0DA 3Q18A 2HZEB 2C1YA 2JSZA 3ZL5A 1XOBA 4DSRA 1AQWA 2QGVA 2JL4A 3W6GA 3W8SA 1LJRA 1YY7A 4I6XA 3VFIA 2FWFA 4GCIA 3FW2A 4I8BA 5IM9A 2IMIA 2HI7A 3HY2A 2HSMA 4BWQA 1PRXA 1XZOA 1M99A 2H0IA 5L71A 2H30A 2YWNA 4KUNA 2H1AA 4XS1A 1Q4JA 2IMDA 2HT9A 5F0GA 2MMNA 4L0UA 3GKMA 2DJKA 2VD1A 3S9FA 1TRSA 5IMVA 3VPTA 3WGDA 3HJMA 2PGTA 2CVKA 3C1RA 5J9CA 2GZPA 2YJ7A 4K8MA 1T8EB 1ON4A 2XBIA 3ZVJD 4GSSA 1TXXA 1AXDA 1MD3A 4MJBA 1GWCA 3GYKA 3C7MA 2GDRA 4KAEA 4IHUA 5B7CA 2GZYA 3ZITA 2HSHA 3UL3A 3QR6A 2VL9A 1GP1A 2VD0A 3EU3A 1F37A 4EVMA 3GKXA 3TJBA 1PX7A 1O85A 2JACA 2H75A 3C71A 1IYIA 4NAXA 4ILFA 2XBQA 1TI3A 3D0ZA 2WZ9A 2DC5A 4KX4A 4F0BA 3EVIA 3HZ8A 5AIXA 4BWSA 1DE2A 3MNGA 2IIYA 5H5SA 2DMLA 19GSA 1U87A 2KUCA 3EU4A 1J0FA 1THOA 4OO5A 4DVCA 5JWQB 3UAPA 4ZIJA 3LQ7A 4TXOA 4MLYA 2VOCA 2NDOA 4HDEA 4XHMA 4MP4A 2GSSA 4YH2A 3TUEA 1AQXA 1PKZA 1SJIA 5DCHA 4IQAA 4BVYB 1R7HA 4E8EA 1X9SB 4KNDA 5CNWA 1XW6A 5GAPD 2OA7A 1FVJA 3TJGA 2OE1A 3LEFA 2PWJA 1A0RP 4ACSA 4QQ7A 2HYXA 1ZGNA 4K1FA 4N11A 3F3RA 3GL3A 4TR1B 2YNXA 2X64A 3PR8A 3RPPA 2MZCA 5LNKe 5EVOA 2NVLA 3C8EA 10GSA 2ON7A 3UBKA 2EIQA 5D9TA 3SBCA 3HJOA 3LWAA 4HU7A 2AV4A 3CBUA 4HQSA 3UBLA 2O8VB 1KBNA 2DLXA 5IMZA 3LG6A 3A2VA 2VCWA 2GQKA 1RK4A 3UVTA 2DJ0A 3FZ5A 1B48A 3EWLA 4WBRD 1ILOA 4G19A 2VCXA 1XBSA 2PVQA 2HSNB 3DMLA 3ZIVA 4F82A 1A24A 2H6XA 3FZAA 2GVPA 3Q6OA 4EUYA 2H6ZA 3EURA 2DJ2A 3O3TA 3ERWA 3A2WA 1IYHA 3APOA 5HFIA 1WJKA 1SKWB 13GSA 20GSA 3GNJA 5ECHB 6GSTA 1K0DA 6GSXA 3HA9A 1R5AA 2C8UA 2YN1A 2F3MA 2H0GA 2VCTA 1GULA 2C0FA 3EYTA 2GT5A 3RDWA 2V41A 2OBKA 3MSZA 1DSBA 1VGLA 1X9MB 4ZILA 1S3DA 4ECJA 4OFNA 3TKQA 4RQXA 4KF9A 1PMTA 5KEJA 1LBKA 3CSIA 3WYWA 4D73A 4LMWA 2WRTA 5LD0A 1JLVA 3U6VA 4IVFA 4WETA 3M3MA 2DJ1A 5DALA 5COHA 1Y25A 4PGTA 3QAGA 1DBYA 5HR2A 3EC3A 4HU9A 3GV1A 1M2BA 1OC3A 1W4VA 2IPAA 1SYXA 2FY6A 3SWLA 2CX3A 2FNOA 4ZXGA 1J9BA 3KJYA 2PPTA 1MDJA 5J5NA 3TJKA 4I2TA 3KMNA 1K0MA 4LLRA 1EEJA 1QQ2A 2CAQA 2Z9SA 4XS4A 4G10A 3PGTA 3D5JA 4RUVA 1MTCA 4F0CA 1A2JA 2YPMA 1FVKA 5EL8A 2R4VA 3E0UA 5DAKA 5G31A 2CQ9A 4KDUA 5AISA 1J08A 1K3YA 1FAAA 4GTUA 4YQUA 1B9YC 1SYRA 1YF1A 5ECMB 4OMVA 4KDYA 3GA4A 4TVEA 4MF7A 3FY7A 4EDYA 4L0WA 1QFNA 2M46A 2B5EA 4PUFC 5J9BA 1GSSA 5KN3A 4MK3A 3IOSA 2H71A 4V2NA 2L5LA 3OR5A 1RW1A 4WR4A 1Z7RA 2FCHA 3LJRA 5DAKB 3FZ4A 4PUAA 7GSSA 2XC2A 1I5GA 1V9WA 3AY8A 3TKRA 1ABAA 2LNSA 3GHAA 2DJJA 1XPVA 1SK2A 3F4SA 1XCCA 1FB0A 3O6TA 1YZXA 5LCZA 2HRKA 4P3YB 3DKSA 2L57A 1GUMA 5AN1A 4YAVA 3UVHA 5IMDA 3HYPA 2RM5A 4N0ZA 3GMFA 4TR1A 1SK1A 4MPGA 2NPBA 1GUKA 1XOAA 4NPBA 4ZL7A 5ID2A 3GUSA 4G0IA 5EY6A 2DIZA 3KEBA 1T4YA 1EWXA 4ULXA 3HXSA 3DVWA 2PN8A 3A2XA 5ECNB 4NV2A 1SENA 3EE2A 4ZB8A 3IC4A 1ML6A 1FG4A 1WE0A 4Q5FA 2P0GA 2YCDA 1AIUA 2HZFA 4HOJA 1B9XC 3H4KA 5HFGA 3VLNA 2H1BA 2MMZA 3H93A 1Y6EA 1SKSB 4MH2A 2IFQA 2FHEA 1QMVA 3LXTA 2HRNA 2ES7A 1X5DA 4JU5A 1WOUA 2AUVA 1KEBA 1LU4A 2XPDA 4V2LA 1FHEA 5JCWA 4ZBDA 1BEDA 1W89A 2KOKA 2V6KA 4G2EA 2FLSA 4POMA 2AB6A 4EE0A 1QUWA 4XS6A 2IMFA 4ZB6A 1EZKA 3IV4A 4PURA 2HXKA 5IMAA 1VF4A 1O73A 5INYA 2VIMA 1URMA 2E2GA 2ZUPA 2R37A 4HS1A 1T4ZA 2B7KA 1M9AA 1GUHA 1QK8A 1YJ6A 3NIVA 1FW1A 3APSA 3DXBA 6GSVA 1GNEA 2GGTA 2CVDA 3M9KA 4AJ6A 2CAIA 5G30A 4ML1A 4F03A 4KSMA 1UC7A 3TJJA 4FYCA 2N5AA 4MCUA 4IKHA 4FO5A 2R5GA 4K9ZA 2K9FA 4WF4A 4JZQA 1A2MA 1TRWA 1F6MC 1XVWA 4FIWA 5IOWA 4TXOB 1EOHA 4HI7A 1NSWA 4WKWA 3HVSA 3HVVA 3FR6A 5DJLA 2L6CA 3TKPA 2LEGA 1PX6A 2OE3A 1F2EA 3IR4A 1TTZA 3E3EA 2HNLA 2MBTA 1JLWA 2IMKA 2C0GA 5C00A 2LTKA 3QOUA 1NW2A 1K0CA 4DSQA 5B6MA 1G7OA 1F9MA 2V1MA 1X9WB 4E8HA 3H8QA 3PH9A 1KTEA 2BTOT 4NMUA 4IGJA 1TU8A 5ELAA 3WGXA 2H70A 1YKCA 2L4CA 3ISOA 4OCFA 3BOAA 1M7TA 3CXGA 2OKAA 3BBYA 5FT3A 3R2QA 5GSTA 4L8EA 4ECIA 1A0FA 1ERUA 1RQMA 3F0IA 5A4VA 3L9UA 1PL1A 4EO3A 3KP8A 3F63A 2F8FA 1FB6A 2WGRA 1UVZA 5F05A 2VM2A 1K0AA 1OC9A 2LRNA 1XW5A 2IFQB 1QXHA 2VCZA 1BG5A 4NHZA 3IHQA 5CO3A 2YANA 1GNWA 1YQ1A 5IPGA 4MZBA 5C04A 5ECPB 1B4PA 1OYJA 3HKRA 4Q5QA 3ZYWA 5E4WA 4MZCA 5J4UA 2B1LA 4TKYA 3F3QA 3LYPA 3V1WA 1AQVA 2WJUA 2I9HA 3ZZXA 5IMCA 3ZFBA 1H75A 1AUCA 4XRAA 5JCUA 4MJAA 1U3IA 4WF5A 3TGZA 3TRPA 1ST9A 5CYYA 5JWRB 3G7YA 4NHWA 4MJEA 3ZMLA 2A4VA 4WBJA 4Z7XA 3W8JA 1SK0A 4PX1A 4IJ3A 5ELGA 3UARA 4YQVA 4BPYA 4V1Ag 3TKSE 1V2AA 1JZRA 4WXTA 2DIYA 4HJ2A 2YWIA 2IL3A 5IPHA 1XWCA 4ISDA 2F8AA 4X43A 3BD2A 2F51A 3D4TA 1T7PB 5AGYA 2LS5A 3LSZA 3GKNA 5D9VA 3TOTA 2YP6A 4HQZA 4LL4B 1VRSD 3L78A 4OWYA 4O5RA 2LJRA 2FWEA 5JCGA 4MABA 5H5RA 1EGOA 5A4WA 4PXOA 4KA0A 3QPMA 3Q19A 4K0GA 5J3RA 1PKWA 4EKZA 4TR0A 2VCQA 2JZTA 4IS0A 1Q98A 3P2AA 1Z6NA 2HQTA 3F4TA 4IN0A 2YOIA 2LSTA 1AAZA 1EV4A 4GQCA 3QMXA 4Q5RA 1GSFA 1GTIA 3TOUA 2MYGA 3RHCA 1M2AA 1WMJA 1GSQA 4ZL8A 1OVNA 1F3BA 2D2ZA 1CQGA 2XPEA 3TB2A 1GSEA 3KP9A 3IK7A 4AGSA 1R4WA 1A8LA 3F4RA 1OAZA 4G9HA 5DALB 5ECOB 3CSJA 3HZ4A 3US3A 1GLPA 3BJ5A 3UJ1A 2YZHA 2HLSA 4EXJA 3I69A 3HHVA 4BVXA 5ECRB 4KW6A 3RBTA 4I2UA 4IP6A 3UEMA 2C3QA 2LQQA 3J7Yb 1HNBA 1V40A 3QAVA 2L4QA 1OE7A 3HDCA 4KDXA 1U6TA 4PQIA 11GSA 1YEPA 4G0KA 2YWOA 3LFLA 4XS4B 4MJCA 5DBQA 4TRXA 2I81A 1GL8A 4MF5A 2DBCA 3BCKA 1EP7A 1N8JA 5ABRA 4ML6A 2B5YA 1G0TA 2J9HA 1M2DA 4IELA 1WWJA 2C80A 2H19A 1V98A 3PPUA 4MMMA 1T1VA 4Q5NA 5D96A 2CZ2A 3TRXA 2H0HA 1R5PA 2ALBA 2HE3A 1TP9A 2R2JA 4AJ8A 3WT1A 1C72A 4KGIA 2FGXA 1XWAA 5IQYA 1K3LA 2V6OA 3KM6A 2M72A 3L4NA 18GSA 4F9ZA 4JEDA 4POKA 1R26A 2FD3A 2CX4A 3TKSC 3MDKA 5HR3A 5KN1A 2FA4A 3G7IA 3JCML 3GURA 2REMA 4N10A 2RM6A 5FHIA 1V58A 2P5QA 3P7XA 3GN3A 2RIIA 4TXVA 1TRVA 4PNGA 1DE1A 2H01A 4XCSA 4HZ4A 3KMOA 1MD4A 5GAND 1U88A 2LQOA 6GSYA 5CRGA 3A3TA 1EV9A 1NM3A 5GSSA 4LA1A 2QSIA 5J41A 3IXRA 1VF3A 3ME8A 2HRAA 4JE1A 3GFKA 4WR5A 4OFTA 4ZL9A 5DDLA 1BYEA 1AW9A 2WFCA 3FYGA 2NTOA 5IOXA 4XRDA 3F6DA 2N5FA 1ZL9A 2H1GA 4XIHA 3QFBC 3KH9A 2QC7A 1A8YA 3FZ9A 3KH7A 2I4AA 5KN2A 1GLQA 4N30A 1A23A 1S3AA 1TJDA 2K8VA 5D9XA 4J2FA 4K2DA 3H1NA 1PA3A 2WDUA 1FOVA 3C1SA 3P8WA 2GQMA 3VURA 3ZMKA 2OADA 2ZCTA 4TR4A 3DD3A 3FRCA 3IK9A 3GKKA 4V1Ap 4KB3A 3CTFA 2VAFA 1SD8A 3DEXA 1YF0A 3CRUA 3P90A 5B8AA 1TKDB 4X0XA 4CDOA 4K7OA 2GZZA 6GSUA 3Q74A 4OO4A 3KTLA 4NXIA 2J23A 1SJZA 4TOPA 2HZEA 4KH7A 1JZWA 4ZB9A 2TRXA 4V2MA 4FYBA 4L5OA 2OJLA 1JZOA 2TRCP 2WB9A 2KLXA 1GH2A 1GTUA 3UOMA 1O8XA 5ECIB 3KCMA 2V32A 3DVXA 4O92A 5ECSA 2O89A 1HNAA 1NHYA 6GSWA 2L5OA 3BCIA 3TJFA 1BX9A 1K3OA 3APQA 2XHFA 5IIZA 3L9VA 5G2ZA 4H86A 16GSA 1YDKA 2ZNMA 3VWXA 5DQYA 2YJHA 4USSA 1PGTA 5FWGA 3M0FA 3QDNA 2PBJA 1JZDA 3KGKA 2IN3A 5B8BA 2AYTA 2I3YA 2YV9A 1WPIA 3FEUA 1EOGA 2YZUA 4EL1A 5IO2A 1GSYA 3EMXA 4GXZA 2HFDA 1TI1A 5D73A 2X99A 1THXA 2GSQA 3I43A 4KCEA 5IMFA 2A2SA 4F2IA 4K7NA 1X5CA 1OKDA 2HSMB 2H76A 2FWHA 3ZIJA 2CZ3A 4GWRA 1B8XA 5AIVA 1YKAA 4EF0A 3GH6A 3I9V2 4MF6A 5CP1A 1SJ6A 3ED3A 2YWMA 4KSOA 5HFKA 1N2AA 1ERVA 2V2GA 1GSUA 2B7JA 5HQPA 1XWGA 2EIRA 4QL7A 3DRNA 3DIEA 5G1KA 2VL2A 4YQMA 2JZSA 4NV5A 2RLIA 4IBPA 3EMPA 4JBBA 1TK5B 3EINA 2ON5A 4BL7A 1NHOA 2OACA 2QKEA 3CTGA 4HUAA 5D93A 3VI5A 1MEKA 3G9BA 1HYUA 1Z9HA 3HCZA 1USBA 3IE3A 5E59A 2OBIA 1JHBA 1X5EA 4ZBAA 2DSAA 1DUGA 3M8NA 3MWHA 4HJMA 2FWGA 17GSA 2GSTA 1PL2A 2O7KA 2VUPA 2WULA 3U5RE 1GSDA 4O7HA 5IO0A 3GL5A 1A2LA 2M80A 2C3TA 3VK9A 4JR6A 3WGEA 1M0UA 4WEYA 1UN2A 2JADA 2X8CA 1K0NA 5ID2B 5ECLB 5ECKB 2HSYA 3CSHA 2IMEA 5D9WA 3UIWA 4MDCA 4MA9A 3ZVJA 1GTBA 2VO4A 3GTUB 2OE0A 1HNCA 2PERA 1SD9A 3FHKA 3QD9A 2TIRA 3GX8A 1XW9A 4O32A 1K0OA 4XTSA 2VM1A 2F9SA 3GIXA 9GSSA 1E6BA 2H1DA 3FR9A 3WD6A 3PINA 14GSA 4DSSB 5ENUA 1ZYQB 3C73A 1ZCPA 2IJYA 3GTUA 3L9SA 1SU9A 4GSNA 2AHEA 2AJQB 1TRUA 2RUFA 3N9JA 4NWYA 1ZZYA 5CRDA 3IDVA 2DJ3A 3R3EA 3N5OA 4MPFA 3NZNA 3LXZA 2G2QA 1G6YA 3IAM2 3UMAA 2K18A 1TW9A 4CHSA 5G5EA 4BA7A 2GTUA 1WIKA 2YV7A 3GX0A 4HEA2 1TOFA 3VPQA 2PVOC 1ERTA 3M9JA 4KE3A 3KXOA 2GLRA 4PNFA 1EGRA 3ERFA 1Z6MA 2FUG2 22GSA 3ZFLA 2GT6A 3DGQA 2UZ8A 2VL3A 5DVBA 3ZREA 1FO5A 4PQ1A 4EC0A 4PQHA 4BVYA 3FKFA 2E0QA 2G0FA 4LMVA 4FYUA 4PTSA 3IPZA 1GTAA 1ZMAA 3IA1A 1SL2B 8GSSA 5CAXA 1O8WA 3FR3A 2DMMA 1Z7PA 4CW9A 2I1UA 1O81A 4RI7A 1SL1B 4TR3A 2B1KA 1ERWA 1ZYEA 3KD0A 3RHBA 1TK8B 1TU7A 3IAS2 2CA8A 2MMAA 4I5QA 3G7JA 5HR0A 2B3SA 4K7IA 1WP0A 4JR4A 5A4UA 1VF2A 5DJMA 4KCAA 4LL1B
chains in the Genus database with same CATH superfamily
2L59A 1UA5A 1MDKA 3K8NA 2K6VA 3HD5A 2P5RA 3ERGA 2X8GA 2KHPA 1CQHA 5KN0A 1PN9A 1Y1UA 5HR1A 1OC8A 4BVXB 4DEJA 2VLUA 2IWTA 3RAZA 2LJKA 1EEMA 4IJIA 2B5XA 4QMKA 3QAWA 1E2YA 4RQRA 2BJXA 5B6NA 4ID0A 3ZLPA 3KIJA 1YEXA 3VWVA 2CT6A 2H74A 2LNTA 1BJXA 4FQUA 1OC9B 1BF5A 4X1UA 2JU5A 1V57A 3VWWA 3A5WA 1YVLA 2VLVA 2GS3A 4K0NA 2LJAA 3GSTA 1XWBA 4IW9A 2H8LA 5DCGA 1XXUA 3HMJG 2VL2C 5F06A 4BL7B 3IRAA 4PI2C 5DQSA 2C4JA 1VF1A 4TW5A 1HQOA 2H72A 4ZBBA 4GRFA 1K0BA 1O7UA 3D21A 1PQNA 5G5FA 4J56E 1G6WA 1SL0B 2NBSA 2WS2A 5BRTA 3LYKA 1HD2A 3WT2A 3F9UA 3TCOA 4J57E 4AKXB 3RPNA 1SKRB 1PFOA 4AJ7A 4MNNA 4AF2A 2EIOA 3CRTA 2X8HA 2FA8A 2LV3A 4D73B 2EFEA 3NOFA 5H5QA 2MBSA 5CRWA 1KNGA 2HRKB 2MMOA 2JZRA 1OE8A 5D8IA 2O85A 1X0RA 4FH8A 5CRHA 2CVBA 3ZTLA 4YAPA 3VWUA 2VCVA 3MAKA 5GZZB 1I9DA 1WRYA 1TDIA 4OFMA 2E2MA 6GSSA 4RI6A 3F8UA 12GSA 1O6JA 2LKUA 2DKIA 4G0LA 4BIKA 1ACVA 2LUSA 2CV4A 4K6XA 3RFRC 2RUEA 4OD7A 3GSSA 2C3NA 2WCIA 5CREA 1T3BA 2R3XA 2O5VA 3O76A 5A5HA 5A5KA 1AC1A 1TK0B 2O87A 1OKTA 1XVQA 2PMTA 3TRQA 3J7Yk 2AAWA 2KP2A 2A2RA 2KP1A 1Z5YE 2LRTA 2JSYA 1PSQA 3F6FA 3TDGA 3IBHA 4EIPA 4JRRA 4ECBA 1B4QA 3VI7A 1G7EA 1XFLA 5BMUA 4I97A 2VLTA 3LGCA 3HJPA 3QCPA 1F3AA 2H66A 5EPFA 3M1GA 3I6AA 2HRFA 3TKSA 2BMXA 3GH9A 2C0EA 3LORA 4HZ2A 3GRXA 4IQ1A 4ECCA 3ZRDA 3DYRA 2H73A 4GLTA 1T00A 3KTBA 4PHZC 2PUKC 2E7PA 3H79A 3MIXA 2R6KA 3D22A 4IP1A 1N25A 3KZQA 1GRXA 4GSTA 1BQ7A 3D6IA 3IC8A 5JWOB 5BMUB 1H4OA 2A4HA 1MDIA 3E9JB 4OCEA 1S3CA 1M9BA 2H6YA 1XIYA 2PU9C 2P31A 4TN8A 4MZWA 1U3AA 1EP8A 3L0HA 2K8SA 4EDZA 5ECQB 1XWKA 3ME7A 5F07A 2EC4A 2QA1A 1BAYA 3QFAC 4GF0A 3D4MA 2LRCA 3CYNA 1QGVA 4POLA 3CMIA 4POBA 1PD21 2N5BA 3DWVA 4MH3A 4L5LA 3FK8A 3HVXA 2B6MA 2L6DA 4DSSA 5G1LA 5F8BA 1ZOFA 4N0VA 1Z3EA 4QL9A 4GQFA 2GSRA 2GQLA 1JFUA 2C0DA 3Q18A 2HZEB 2C1YA 2JSZA 5KOWA 3ZL5A 1XOBA 4DSRA 1AQWA 2QGVA 2JL4A 3W6GA 3W8SA 1LJRA 1YY7A 4I6XA 3VFIA 2FWFA 4GCIA 3FW2A 4I8BA 2WZSA 2IMIA 5IM9A 2HI7A 3HY2A 2HSMA 4BWQA 1PRXA 1XZOA 1M99A 2H0IA 5L71A 2H30A 2YWNA 4KUNA 2H1AA 4XS1A 1Q4JA 2IMDA 2HT9A 5F0GA 2MMNA 4L0UA 3GKMA 2DJKA 2VD1A 3S9FA 1TRSA 5IMVA 3VPTA 3WGDA 3HJMA 4PI0C 2PGTA 2CVKA 3C1RA 5J9CA 2GZPA 2YJ7A 4K8MA 1T8EB 1ON4A 2XBIA 3ZVJD 4GSSA 1TXXA 1AXDA 1MD3A 4MJBA 1GWCA 3GYKA 3C7MA 2GDRA 4KAEA 4IHUA 5B7CA 2GZYA 3ZITA 2HSHA 4A5PA 3UL3A 3QR6A 2VL9A 1GP1A 2EFDA 3EU3A 2VD0A 2VKZG 1F37A 4EVMA 3GKXA 3TJBA 1PX7A 1O85A 2JACA 2H75A 3C71A 1IYIA 4NAXA 4ILFA 2XBQA 1TI3A 3D0ZA 2WZ9A 2DC5A 4KX4A 4F0BA 3EVIA 3HZ8A 5AIXA 4BWSA 1DE2A 3MNGA 2IIYA 5H5SA 2DMLA 19GSA 1U87A 2UV8G 2KUCA 3EU4A 1J0FA 1THOA 4OO5A 4DVCA 5JWQB 3UAPA 4ZIJA 3LQ7A 4TXOA 4MLYA 2VOCA 2NDOA 4HDEA 4XHMA 4MP4A 2GSSA 4YH2A 3TUEA 1AQXA 1ZYNA 1PKZA 1SJIA 5DCHA 4IQAA 4BVYB 1R7HA 4E8EA 1X9SB 4KNDA 5CNWA 1XW6A 5GAPD 2OA7A 1FVJA 3TJGA 2OE1A 3LEFA 2PWJA 1I1IP 1A0RP 4ACSA 4QQ7A 2HYXA 5J4VA 4K1FA 1ZGNA 5A34A 4N11A 3F3RA 3GL3A 4TR1B 2YNXA 2X64A 1PN0A 2R0GA 3PR8A 3RPPA 2MZCA 5LNKe 5EVOA 2NVLA 3C8EA 10GSA 2ON7A 3UBKA 2EIQA 5D9TA 3SBCA 3HJOA 3LWAA 4HU7A 2AV4A 3CBUA 4HQSA 3UBLA 2O8VB 1KBNA 2DLXA 5IMZA 3LG6A 3A2VA 2VCWA 2GQKA 1RK4A 3UVTA 2DJ0A 2X49A 3FZ5A 1B48A 3EWLA 4WBRD 1ILOA 4G19A 2VCXA 1XBSA 1FOHA 2PVQA 2HSNB 3DMLA 3ZIVA 4F82A 1A24A 2H6XA 3FZAA 2GVPA 3Q6OA 4EUYA 2H6ZA 3EURA 2DJ2A 3O3TA 3ERWA 3A2WA 1IYHA 3APOA 5HFIA 1WJKA 1SKWB 13GSA 20GSA 3GNJA 5ECHB 6GSTA 1K0DA 6GSXA 3HA9A 1R5AA 2C8UA 2YN1A 2F3MA 2H0GA 2VCTA 1GULA 2C0FA 3EYTA 2WVYA 2GT5A 3RDWA 2V41A 2OBKA 3MSZA 1DSBA 1VGLA 1X9MB 4ZILA 1TXUA 5A34B 1S3DA 4ECJA 2WVXA 4OFNA 3TKQA 4RQXA 4KF9A 1PMTA 5KEJA 1LBKA 4Z2TA 3CSIA 3WYWA 4D73A 4LMWA 1XG8A 2WRTA 5LD0A 1JLVA 3U6VA 4IVFA 4WETA 3M3MA 2DJ1A 3LW9A 4FXYP 5DALA 5COHA 1Y25A 4PGTA 3QAGA 1DBYA 4ZB7A 5HR2A 3EC3A 4HU9A 3GV1A 1M2BA 1OC3A 1W4VA 2IPAA 1SYXA 2FY6A 3SWLA 2CX3A 3CQFA 2FNOA 4ZXGA 1J9BA 3KJYA 2PPTA 1MDJA 5J5NA 3TJKA 4I2TA 3KMNA 1K0MA 4LLRA 1EEJA 1QQ2A 2CAQA 2Z9SA 4XS4A 4G10A 3PGTA 3D5JA 4RUVA 1MTCA 4F0CA 1A2JA 2YPMA 1FVKA 5EL8A 2R4VA 2WW1A 3E0UA 5DAKA 1YEWC 5G31A 3HVNA 2CQ9A 4KDUA 5AISA 1J08A 1K3YA 1FAAA 4GTUA 4YQUA 1B9YC 1SYRA 1YF1A 5ECMB 4OMVA 1M3JA 4KDYA 3GA4A 4TVEA 4MF7A 3FY7A 4EDYA 4L0WA 1QFNA 2M46A 2B5EA 4PUFC 5J9BA 1GSSA 5KN3A 4MK3A 3IOSA 2H71A 4V2NA 2L5LA 3OR5A 1RW1A 4WR4A 2WW3A 1SVOA 1Z7RA 2FCHA 3LJRA 5DAKB 3FZ4A 4PUAA 7GSSA 2XC2A 1I5GA 1V9WA 3AY8A 3TKRA 1ABAA 2LNSA 5A1NA 3GHAA 2DJJA 1XPVA 1SK2A 3F4SA 1XCCA 1FB0A 3O6TA 1YZXA 5LCZA 2HRKA 4P3YB 3DKSA 2L57A 1GUMA 5AN1A 4YAVA 3UVHA 4K5SA 3HYPA 5IMDA 2RM5A 4N0ZA 3GMFA 4TR1A 1SK1A 4MPGA 2NPBA 1GUKA 1XOAA 4NPBA 4ZL7A 1SVMA 5ID2A 3GUSA 4G0IA 5EY6A 2DIZA 3KEBA 1T4YA 1EWXA 4ULXA 3HXSA 3DVWA 2PN8A 3A2XA 5ECNB 4NV2A 1SENA 3EE2A 4ZB8A 3IC4A 1ML6A 1FG4A 1WE0A 4Q5FA 2P0GA 2YCDA 1AIUA 2HZFA 4HOJA 1B9XC 3H4KA 2QA2A 5HFGA 3VLNA 2H1BA 2MMZA 3H93A 1Y6EA 1SKSB 3EPTA 4MH2A 3IHGA 2IFQA 2FHEA 1QMVA 3LXTA 2HRNA 2ES7A 1X5DA 4JU5A 1WOUA 4AKGA 1S4BP 2AUVA 1KEBA 1LU4A 2XPDA 2X4AA 4V2LA 1FHEA 5JCWA 4ZBDA 1BEDA 1W89A 2KOKA 2V6KA 4G2EA 2FLSA 4POMA 2AB6A 4EE0A 1QUWA 4XS6A 2IMFA 4ZB6A 1EZKA 3IV4A 4PURA 2HXKA 5IMAA 1VF4A 1O73A 5INYA 2VIMA 1URMA 2E2GA 2ZUPA 4K5RA 2R37A 4HS1A 1T4ZA 2B7KA 1M9AA 1GUHA 1QK8A 1YJ6A 3NIVA 1FW1A 3APSA 3DXBA 6GSVA 1ZYPA 1GNEA 2GGTA 2CVDA 2R0PA 3M9KA 4AJ6A 2CAIA 5G30A 4ML1A 4F03A 4KSMA 1UC7A 3TJJA 4FYCA 2N5AA 4MCUA 4IKHA 4FO5A 2R5GA 4K9ZA 2K9FA 4WF4A 4JZQA 1A2MA 1TRWA 1F6MC 1XVWA 4FIWA 5IOWA 4TXOB 1EOHA 4HI7A 1NSWA 4WKWA 3HVSA 3HVVA 3FR6A 5DJLA 2L6CA 3TKPA 2LEGA 1PX6A 2OE3A 1F2EA 3IR4A 1TTZA 3E3EA 2HNLA 2MBTA 1JLWA 2IMKA 2C0GA 5C00A 2LTKA 3QOUA 1NW2A 1K0CA 4YKGA 4DSQA 5B6MA 4N3ZA 1G7OA 1F9MA 2V1MA 2WW2A 1X9WB 4E8HA 3H8QA 3PH9A 1KTEA 2BTOT 4NMUA 4IGJA 1TU8A 5ELAA 3WGXA 2H70A 1YKCA 2L4CA 3ISOA 4OCFA 4G01A 3BOAA 1M7TA 3CXGA 2OKAA 3BBYA 5FT3A 3R2QA 5GSTA 4L8EA 4ECIA 1A0FA 1ERUA 1RQMA 3F0IA 5A4VA 3L9UA 1PL1A 4EO3A 3KP8A 3F63A 2F8FA 1FB6A 2WGRA 1UVZA 4CY8A 5F05A 2VM2A 1K0AA 1OC9A 2LRNA 1XW5A 2IFQB 1QXHA 2VCZA 1BG5A 4NHZA 5J47A 3IHQA 5CO3A 2YANA 1GNWA 4ICYA 1YQ1A 5IPGA 4MZBA 5C04A 5ECPB 1B4PA 1OYJA 3HKRA 4Q5QA 3ZYWA 5E4WA 4MZCA 5J4UA 4GDFA 2B1LA 4TKYA 2H1LA 3F3QA 3LYPA 4HSCX 3V1WA 1AQVA 2WJUA 2I9HA 3ZZXA 5IMCA 3ZFBA 1H75A 1AUCA 4XRAA 5JCUA 4MJAA 1U3IA 4WF5A 3TGZA 3TRPA 1ST9A 5CYYA 5JWRB 3G7YA 4NHWA 4MJEA 3ZMLA 2A4VA 4WBJA 4Z7XA 3W8JA 1SK0A 4PX1A 4IJ3A 5ELGA 3UARA 4YQVA 4BPYA 4V1Ag 2WW0A 3TKSE 1V2AA 1JZRA 4WXTA 2DIYA 4HJ2A 2YWIA 2IL3A 2O36A 5IPHA 1XWCA 4ISDA 2F8AA 4X43A 3BD2A 2F51A 5J4YA 3D4TA 1T7PB 1M3IA 5AGYA 2LS5A 3LSZA 3GKNA 5D9VA 3TOTA 2YP6A 4HQZA 4LL4B 1VRSD 3L78A 4OWYA 4O5RA 2LJRA 2FWEA 5JCGA 4MABA 5H5RA 1SVLA 1EGOA 5A4WA 4PXOA 4KA0A 3QPMA 3Q19A 4K0GA 5J3RA 1PKWA 4EKZA 4TR0A 2VCQA 2JZTA 4IS0A 1Q98A 3P2AA 1Z6NA 2HQTA 3F4TA 4IN0A 2YOIA 2LSTA 1AAZA 1EV4A 4GQCA 3QMXA 4Q5RA 1GSFA 1GTIA 3RGBC 3TOUA 2MYGA 3RHCA 1M2AA 1WMJA 1GSQA 4ZL8A 1OVNA 1F3BA 2D2ZA 1CQGA 2XPEA 3FMWA 3TB2A 1GSEA 3KP9A 3IK7A 4AGSA 1R4WA 1A8LA 3F4RA 1OAZA 4G9HA 5DALB 5ECOB 3CSJA 3HZ4A 3US3A 1GLPA 3BJ5A 3UJ1A 2YZHA 2HLSA 4EXJA 3I69A 3HHVA 4BVXA 5ECRB 4KW6A 3RBTA 4I2UA 4IP6A 3UEMA 2C3QA 2LQQA 3J7Yb 1HNBA 1V40A 3QAVA 2L4QA 1OE7A 3HDCA 4KDXA 1U6TA 4PQIA 11GSA 1YEPA 4G0KA 2YWOA 3LFLA 4XS4B 4MJCA 5DBQA 4TRXA 2HSNA 2I81A 1GL8A 4MF5A 2DBCA 3BCKA 1EP7A 1N8JA 5ABRA 4ML6A 2B5YA 1G0TA 2J9HA 1M2DA 4IELA 1WWJA 2C80A 2H19A 1V98A 3PPUA 4MMMA 1T1VA 4Q5NA 5D96A 2CZ2A 3TRXA 2H0HA 1R5PA 2ALBA 2HE3A 4Z2RA 1TP9A 2R2JA 4AJ8A 3WT1A 1C72A 4KGIA 2FGXA 1BG1A 1XWAA 5IQYA 2EFCA 1K3LA 2V6OA 3KM6A 2M72A 3L4NA 18GSA 4F9ZA 4JEDA 4POKA 1R26A 2FD3A 4AKIA 2CX4A 3TKSC 3MDKA 5HR3A 5KN1A 2FA4A 3G7IA 3JCML 3GURA 2REMA 4N10A 2RM6A 5FHIA 4CY6A 1V58A 2P5QA 3P7XA 3GN3A 2RIIA 4TXVA 1TRVA 4PNGA 1DE1A 2H01A 4XCSA 4HZ4A 3KMOA 1MD4A 5GAND 1U88A 2LQOA 6GSYA 5CRGA 3A3TA 1EV9A 1NM3A 5GSSA 4K2XA 4LA1A 2QSIA 5J41A 3IXRA 1VF3A 3ME8A 2HRAA 4JE1A 3GFKA 4WR5A 4OFTA 4ZL9A 5DDLA 1BYEA 1AW9A 2WFCA 3FYGA 2NTOA 5A1NB 5IOXA 4XRDA 3F6DA 2N5FA 1ZL9A 2H1GA 4XIHA 3QFBC 3KH9A 2QC7A 1A8YA 3FZ9A 3KH7A 2I4AA 5KN2A 1GLQA 4N30A 1A23A 1S3AA 1TJDA 2K8VA 5D9XA 5A5HB 4J2FA 4K2DA 3H1NA 1PA3A 2WDUA 1FOVA 3C1SA 3P8WA 2GQMA 3VURA 3ZMKA 2OADA 2ZCTA 4TR4A 3DD3A 3FRCA 3IK9A 3GKKA 4V1Ap 4KB3A 3CTFA 2VAFA 1SD8A 3DEXA 1YF0A 3CRUA 3P90A 5B8AA 1TKDB 4X0XA 4CDOA 4K7OA 2EFHA 2GZZA 6GSUA 3Q74A 4OO4A 3KTLA 4NXIA 2J23A 1SJZA 4TOPA 2HZEA 4KH7A 1JZWA 4ZB9A 2TRXA 4V2MA 4AI6A 4FYBA 4L5OA 2OJLA 1JZOA 2TRCP 2WB9A 2KLXA 1GH2A 1GTUA 3UOMA 1O8XA 5ECIB 3KCMA 2V32A 2O3EA 3DVXA 4O92A 5ECSA 2O89A 1HNAA 1NHYA 6GSWA 2L5OA 3BCIA 3TJFA 1BX9A 5KOXA 1K3OA 3APQA 2XHFA 5IIZA 3L9VA 5G2ZA 4H86A 16GSA 1YDKA 2ZNMA 3VWXA 5DQYA 2YJHA 4USSA 1PGTA 5FWGA 3M0FA 5J40A 3QDNA 2PBJA 1JZDA 3KGKA 4E68A 2IN3A 5B8BA 2AYTA 4W66A 2I3YA 2YV9A 1WPIA 3FEUA 1EOGA 2YZUA 4EL1A 5IO2A 1GSYA 3EMXA 4GXZA 2HFDA 1TI1A 5D73A 2X99A 1THXA 2GSQA 3I43A 4KCEA 5IMFA 2A2SA 4F2IA 4K7NA 1X5CA 1OKDA 2HSMB 2H76A 2FWHA 3ZIJA 2CZ3A 4GWRA 1B8XA 5AIVA 1YKAA 4EF0A 3GH6A 3I9V2 4MF6A 5CP1A 1SJ6A 3ED3A 2YWMA 4KSOA 5HFKA 1N2AA 1ERVA 2V2GA 1GSUA 2B7JA 5HQPA 1XWGA 2EIRA 4O5UA 4Z2UA 4QL7A 3DRNA 3DIEA 5G1KA 2VL2A 4YQMA 2JZSA 4NV5A 2RLIA 4IBPA 3EMPA 4JBBA 1TK5B 3EINA 2ON5A 4BL7A 1NHOA 2OACA 2QKEA 3CTGA 4HUAA 4O5QA 5D93A 3VI5A 1MEKA 3G9BA 1HYUA 1Z9HA 2R0CA 3HCZA 1USBA 3IE3A 5E59A 2OBIA 1JHBA 1X5EA 4ZBAA 2DSAA 1DUGA 3M8NA 3MWHA 4HJMA 2FWGA 17GSA 2GSTA 1PL2A 2O7KA 2VUPA 2WULA 3U5RE 1GSDA 4O7HA 5IO0A 3GL5A 1A2LA 2M80A 2C3TA 3VK9A 4JR6A 3WGEA 1M0UA 4WEYA 1UN2A 2JADA 2X8CA 1K0NA 5ID2B 5ECLB 5ECKB 2HSYA 3CSHA 2IMEA 5D9WA 3UIWA 4MDCA 4MA9A 3ZVJA 1GTBA 2VO4A 3GTUB 2OE0A 1HNCA 2PERA 1SD9A 3FHKA 3QD9A 2TIRA 3GX8A 1XW9A 4O32A 1K0OA 4XTSA 2VM1A 2F9SA 3GIXA 9GSSA 1E6BA 2H1DA 3FR9A 3WD6A 3PINA 14GSA 4X4JA 4DSSB 5ENUA 1ZYQB 2DKHA 3C73A 1ZCPA 2IJYA 3GTUA 3L9SA 1SU9A 4GSNA 2AHEA 1S3RA 2AJQB 1TRUA 2RUFA 3N9JA 4NWYA 1ZZYA 5CRDA 3IDVA 2DJ3A 2A2PA 3R3EA 3N5OA 4MPFA 3NZNA 3CHXC 3LXZA 2G2QA 1G6YA 3IAM2 3UMAA 2K18A 1TW9A 4CHSA 5G5EA 4BA7A 2GTUA 1WIKA 2YV7A 4HEA2 3GX0A 1TOFA 3VPQA 2PVOC 1ERTA 3M9JA 4AKHA 4KE3A 3KXOA 2GLRA 4PNFA 4YKFA 1EGRA 3ERFA 1Z6MA 2FUG2 22GSA 3ZFLA 2GT6A 3DGQA 3A5IA 2UZ8A 2VL3A 5DVBA 3ZREA 1FO5A 4PQ1A 4EC0A 4PQHA 4BVYA 3TU3B 3FKFA 2E0QA 2G0FA 4LMVA 4FYUA 3CWGA 4PTSA 3IPZA 1GTAA 3MYDA 1ZMAA 3IA1A 1SL2B 8GSSA 2WVXB 5CAXA 1O8WA 3FR3A 4EIQA 2DMMA 1Z7PA 4CW9A 2I1UA 1O81A 4RI7A 1SL1B 2OT3A 4TR3A 2B1KA 1ERWA 1ZYEA 3KD0A 3RHBA 1TK8B 1TU7A 3IAS2 2CA8A 2MMAA 4I5QA 3G7JA 5HR0A 2B3SA 4K7IA 1WP0A 4JR4A 5A4UA 2WVZA 1VF2A 5DJMA 4KCAA 4LL1B
chains in the Genus database with same CATH topology
2L59A 1UA5A 1MDKA 3K8NA 2K6VA 3HD5A 2P5RA 3ERGA 2X8GA 2KHPA 1CQHA 5KN0A 1PN9A 1Y1UA 5HR1A 1OC8A 4BVXB 4DEJA 2VLUA 2IWTA 3RAZA 2LJKA 1EEMA 4IJIA 2B5XA 4QMKA 3QAWA 1E2YA 4RQRA 2BJXA 5B6NA 4ID0A 3ZLPA 3KIJA 1YEXA 3VWVA 2CT6A 2H74A 2LNTA 1BJXA 4FQUA 1OC9B 1BF5A 4X1UA 2JU5A 1V57A 3VWWA 3A5WA 1YVLA 2VLVA 2GS3A 4K0NA 2LJAA 3GSTA 1XWBA 4IW9A 2H8LA 5DCGA 1XXUA 3HMJG 2VL2C 5F06A 4BL7B 3IRAA 5DQSA 2C4JA 1VF1A 4TW5A 1HQOA 2H72A 4ZBBA 4GRFA 1K0BA 1O7UA 3D21A 1PQNA 5G5FA 4J56E 1G6WA 1SL0B 2NBSA 2WS2A 5BRTA 3LYKA 1HD2A 3WT2A 3F9UA 3TCOA 4J57E 4AKXB 3RPNA 1SKRB 4AJ7A 4MNNA 4AF2A 2EIOA 3CRTA 2X8HA 2FA8A 2LV3A 4D73B 2EFEA 3NOFA 5H5QA 2MBSA 5CRWA 1KNGA 2HRKB 2MMOA 2JZRA 1OE8A 5D8IA 2O85A 1X0RA 4FH8A 5CRHA 2CVBA 3ZTLA 4YAPA 3VWUA 2VCVA 3MAKA 5GZZB 1I9DA 1WRYA 1TDIA 4OFMA 2E2MA 6GSSA 4RI6A 3F8UA 12GSA 1O6JA 2LKUA 2DKIA 4G0LA 1ACVA 2LUSA 2CV4A 4K6XA 2RUEA 4OD7A 3GSSA 2C3NA 2WCIA 5CREA 1T3BA 2R3XA 2O5VA 3O76A 5A5HA 5A5KA 1AC1A 1TK0B 2O87A 1OKTA 1XVQA 2PMTA 3TRQA 3J7Yk 2AAWA 2KP2A 2A2RA 2KP1A 1Z5YE 2LRTA 2JSYA 1PSQA 3F6FA 3TDGA 3IBHA 4EIPA 4JRRA 4ECBA 1B4QA 3VI7A 1G7EA 1XFLA 5BMUA 4I97A 2VLTA 3LGCA 3HJPA 3QCPA 1F3AA 2H66A 5EPFA 3M1GA 3I6AA 2HRFA 3TKSA 2BMXA 3GH9A 2C0EA 3LORA 4HZ2A 3GRXA 4IQ1A 4ECCA 3ZRDA 3DYRA 2H73A 4GLTA 1T00A 3KTBA 2PUKC 2E7PA 3H79A 3MIXA 2R6KA 3D22A 4IP1A 1N25A 3KZQA 1GRXA 4GSTA 1BQ7A 3D6IA 3IC8A 5JWOB 5BMUB 1H4OA 2A4HA 1MDIA 3E9JB 4OCEA 1S3CA 1M9BA 2H6YA 1XIYA 2PU9C 2P31A 4TN8A 4MZWA 1U3AA 1EP8A 3L0HA 2K8SA 4EDZA 5ECQB 1XWKA 3ME7A 5F07A 2EC4A 2QA1A 1BAYA 3QFAC 4GF0A 3D4MA 2LRCA 3CYNA 1QGVA 4POLA 3CMIA 4POBA 1PD21 2N5BA 3DWVA 4MH3A 4L5LA 3FK8A 3HVXA 2B6MA 2L6DA 4DSSA 5G1LA 5F8BA 1ZOFA 4N0VA 1Z3EA 4QL9A 4GQFA 2GSRA 2GQLA 1JFUA 2C0DA 3Q18A 2HZEB 2C1YA 2JSZA 5KOWA 3ZL5A 1XOBA 4DSRA 1AQWA 2QGVA 2JL4A 3W6GA 3W8SA 1LJRA 1YY7A 4I6XA 3VFIA 2FWFA 4GCIA 3FW2A 4I8BA 5IM9A 2IMIA 2HI7A 3HY2A 2HSMA 4BWQA 1PRXA 1XZOA 1M99A 2H0IA 5L71A 2H30A 2YWNA 4KUNA 2H1AA 4XS1A 1Q4JA 2IMDA 2HT9A 5F0GA 2MMNA 4L0UA 3GKMA 2DJKA 2VD1A 3S9FA 1TRSA 5IMVA 3VPTA 3WGDA 3HJMA 2PGTA 2CVKA 3C1RA 5J9CA 2GZPA 2YJ7A 4K8MA 1T8EB 1ON4A 2XBIA 3ZVJD 4GSSA 1TXXA 1AXDA 1MD3A 4MJBA 1GWCA 3GYKA 3C7MA 2GDRA 4KAEA 4IHUA 5B7CA 2GZYA 3ZITA 2HSHA 4A5PA 3UL3A 3QR6A 2VL9A 1GP1A 2EFDA 3EU3A 2VD0A 2VKZG 1F37A 4EVMA 3GKXA 3TJBA 1PX7A 1O85A 2JACA 2H75A 3C71A 1IYIA 4NAXA 4ILFA 2XBQA 1TI3A 3D0ZA 2WZ9A 2DC5A 4KX4A 4F0BA 3EVIA 3HZ8A 5AIXA 4BWSA 1DE2A 3MNGA 2IIYA 5H5SA 2DMLA 19GSA 1U87A 2UV8G 2KUCA 3EU4A 1J0FA 1THOA 4OO5A 4DVCA 5JWQB 3UAPA 4ZIJA 3LQ7A 4TXOA 4MLYA 2VOCA 2NDOA 4HDEA 4XHMA 4MP4A 2GSSA 4YH2A 3TUEA 1AQXA 1ZYNA 1PKZA 1SJIA 5DCHA 4IQAA 4BVYB 1R7HA 4E8EA 1X9SB 4KNDA 5CNWA 1XW6A 5GAPD 2OA7A 1FVJA 3TJGA 2OE1A 3LEFA 2PWJA 1A0RP 4ACSA 4QQ7A 2HYXA 5J4VA 1ZGNA 4K1FA 5A34A 4N11A 3F3RA 3GL3A 4TR1B 2YNXA 2X64A 1PN0A 2R0GA 3PR8A 3RPPA 2MZCA 5LNKe 5EVOA 2NVLA 3C8EA 10GSA 2ON7A 3UBKA 2EIQA 5D9TA 3SBCA 3HJOA 3LWAA 4HU7A 2AV4A 3CBUA 4HQSA 3UBLA 2O8VB 1KBNA 2DLXA 5IMZA 3LG6A 3A2VA 2VCWA 2GQKA 1RK4A 3UVTA 2DJ0A 2X49A 3FZ5A 1B48A 3EWLA 4WBRD 1ILOA 4G19A 2VCXA 1XBSA 1FOHA 2PVQA 2HSNB 3DMLA 3ZIVA 4F82A 1A24A 2H6XA 3FZAA 2GVPA 3Q6OA 4EUYA 2H6ZA 3EURA 2DJ2A 3O3TA 3ERWA 3A2WA 1IYHA 3APOA 5HFIA 1WJKA 1SKWB 13GSA 20GSA 3GNJA 5ECHB 6GSTA 1K0DA 6GSXA 3HA9A 1R5AA 2C8UA 2YN1A 2F3MA 2H0GA 2VCTA 1GULA 2C0FA 3EYTA 2GT5A 3RDWA 2V41A 2OBKA 3MSZA 1DSBA 1VGLA 1X9MB 4ZILA 1TXUA 5A34B 1S3DA 4ECJA 4OFNA 3TKQA 4RQXA 4KF9A 1PMTA 5KEJA 1LBKA 4Z2TA 3CSIA 3WYWA 4D73A 4LMWA 2WRTA 5LD0A 1JLVA 3U6VA 4IVFA 4WETA 3M3MA 2DJ1A 3LW9A 5DALA 5COHA 1Y25A 4PGTA 3QAGA 1DBYA 4ZB7A 5HR2A 3EC3A 4HU9A 3GV1A 1M2BA 1OC3A 1W4VA 2IPAA 1SYXA 2FY6A 3SWLA 2CX3A 2FNOA 4ZXGA 1J9BA 3KJYA 2PPTA 1MDJA 5J5NA 3TJKA 4I2TA 3KMNA 1K0MA 4LLRA 1EEJA 1QQ2A 2CAQA 2Z9SA 4XS4A 4G10A 3PGTA 3D5JA 4RUVA 1MTCA 4F0CA 1A2JA 2YPMA 1FVKA 5EL8A 2R4VA 3E0UA 5DAKA 5G31A 2CQ9A 4KDUA 5AISA 1J08A 1K3YA 1FAAA 4GTUA 4YQUA 1B9YC 1SYRA 1YF1A 5ECMB 4OMVA 4KDYA 3GA4A 4TVEA 4MF7A 3FY7A 4EDYA 4L0WA 1QFNA 2M46A 2B5EA 4PUFC 5J9BA 1GSSA 5KN3A 4MK3A 3IOSA 2H71A 4V2NA 2L5LA 3OR5A 1RW1A 4WR4A 1SVOA 1Z7RA 2FCHA 3LJRA 5DAKB 3FZ4A 4PUAA 7GSSA 2XC2A 1I5GA 1V9WA 3AY8A 3TKRA 1ABAA 2LNSA 5A1NA 3GHAA 2DJJA 1XPVA 1SK2A 3F4SA 1XCCA 1FB0A 3O6TA 1YZXA 5LCZA 2HRKA 4P3YB 3DKSA 2L57A 1GUMA 5AN1A 4YAVA 3UVHA 4K5SA 3HYPA 5IMDA 2RM5A 4N0ZA 3GMFA 4TR1A 1SK1A 4MPGA 2NPBA 1GUKA 1XOAA 4NPBA 4ZL7A 1SVMA 5ID2A 3GUSA 4G0IA 5EY6A 2DIZA 3KEBA 1T4YA 1EWXA 4ULXA 3HXSA 3DVWA 2PN8A 3A2XA 5ECNB 4NV2A 1SENA 3EE2A 4ZB8A 3IC4A 1ML6A 1FG4A 1WE0A 4Q5FA 2P0GA 2YCDA 1AIUA 2HZFA 4HOJA 1B9XC 3H4KA 2QA2A 5HFGA 3VLNA 2H1BA 2MMZA 3H93A 1Y6EA 1SKSB 3EPTA 4MH2A 3IHGA 2IFQA 2FHEA 1QMVA 3LXTA 2HRNA 2ES7A 1X5DA 4JU5A 1WOUA 4AKGA 2AUVA 1KEBA 1LU4A 2XPDA 2X4AA 4V2LA 1FHEA 5JCWA 4ZBDA 1BEDA 1W89A 2KOKA 2V6KA 4G2EA 2FLSA 4POMA 2AB6A 4EE0A 1QUWA 4XS6A 2IMFA 4ZB6A 1EZKA 3IV4A 4PURA 2HXKA 5IMAA 1VF4A 1O73A 5INYA 2VIMA 1URMA 2E2GA 2ZUPA 4K5RA 2R37A 4HS1A 1T4ZA 2B7KA 1M9AA 1GUHA 1QK8A 1YJ6A 3NIVA 1FW1A 3APSA 3DXBA 6GSVA 1ZYPA 1GNEA 2GGTA 2CVDA 2R0PA 3M9KA 4AJ6A 2CAIA 5G30A 4ML1A 4F03A 4KSMA 1UC7A 3TJJA 4FYCA 2N5AA 4MCUA 4IKHA 4FO5A 2R5GA 4K9ZA 2K9FA 4WF4A 4JZQA 1A2MA 1TRWA 1F6MC 1XVWA 4FIWA 5IOWA 4TXOB 1EOHA 4HI7A 1NSWA 4WKWA 3HVSA 3HVVA 3FR6A 5DJLA 2L6CA 3TKPA 2LEGA 1PX6A 2OE3A 1F2EA 3IR4A 1TTZA 3E3EA 2HNLA 2MBTA 1JLWA 2IMKA 2C0GA 5C00A 2LTKA 3QOUA 1NW2A 1K0CA 4YKGA 4DSQA 5B6MA 4N3ZA 1G7OA 1F9MA 2V1MA 1X9WB 4E8HA 3H8QA 3PH9A 1KTEA 2BTOT 4NMUA 4IGJA 1TU8A 5ELAA 3WGXA 2H70A 1YKCA 2L4CA 3ISOA 4OCFA 4G01A 3BOAA 1M7TA 3CXGA 2OKAA 3BBYA 5FT3A 3R2QA 5GSTA 4L8EA 4ECIA 1A0FA 1ERUA 1RQMA 3F0IA 5A4VA 3L9UA 1PL1A 4EO3A 3KP8A 3F63A 2F8FA 1FB6A 2WGRA 1UVZA 4CY8A 5F05A 2VM2A 1K0AA 1OC9A 2LRNA 1XW5A 2IFQB 1QXHA 2VCZA 1BG5A 4NHZA 5J47A 3IHQA 5CO3A 2YANA 1GNWA 4ICYA 1YQ1A 5IPGA 4MZBA 5C04A 5ECPB 1B4PA 1OYJA 3HKRA 4Q5QA 3ZYWA 5E4WA 4MZCA 5J4UA 4GDFA 2B1LA 4TKYA 2H1LA 3F3QA 3LYPA 3V1WA 1AQVA 2WJUA 2I9HA 3ZZXA 5IMCA 3ZFBA 1H75A 1AUCA 4XRAA 5JCUA 4MJAA 1U3IA 4WF5A 3TGZA 3TRPA 1ST9A 5CYYA 5JWRB 3G7YA 4NHWA 4MJEA 3ZMLA 2A4VA 4WBJA 4Z7XA 3W8JA 1SK0A 4PX1A 4IJ3A 5ELGA 3UARA 4YQVA 4BPYA 4V1Ag 3TKSE 1V2AA 1JZRA 4WXTA 2DIYA 4HJ2A 2YWIA 2IL3A 5IPHA 1XWCA 4ISDA 2F8AA 4X43A 3BD2A 2F51A 5J4YA 3D4TA 1T7PB 5AGYA 2LS5A 3LSZA 3GKNA 5D9VA 3TOTA 2YP6A 4HQZA 4LL4B 1VRSD 3L78A 4OWYA 4O5RA 2LJRA 2FWEA 5JCGA 4MABA 5H5RA 1SVLA 1EGOA 5A4WA 4PXOA 4KA0A 3QPMA 3Q19A 4K0GA 5J3RA 1PKWA 4EKZA 4TR0A 2VCQA 2JZTA 4IS0A 1Q98A 3P2AA 1Z6NA 2HQTA 3F4TA 4IN0A 2YOIA 2LSTA 1AAZA 1EV4A 4GQCA 3QMXA 4Q5RA 1GSFA 1GTIA 3TOUA 2MYGA 3RHCA 1M2AA 1WMJA 1GSQA 4ZL8A 1OVNA 1F3BA 2D2ZA 1CQGA 2XPEA 3FMWA 3TB2A 1GSEA 3KP9A 3IK7A 4AGSA 1R4WA 1A8LA 3F4RA 1OAZA 4G9HA 5DALB 5ECOB 3CSJA 3HZ4A 3US3A 1GLPA 3BJ5A 3UJ1A 2YZHA 2HLSA 4EXJA 3I69A 3HHVA 4BVXA 5ECRB 4KW6A 3RBTA 4I2UA 4IP6A 3UEMA 2C3QA 2LQQA 3J7Yb 1HNBA 1V40A 3QAVA 2L4QA 1OE7A 3HDCA 4KDXA 1U6TA 4PQIA 11GSA 1YEPA 4G0KA 2YWOA 3LFLA 4XS4B 4MJCA 5DBQA 4TRXA 2HSNA 2I81A 1GL8A 4MF5A 2DBCA 3BCKA 1EP7A 1N8JA 5ABRA 4ML6A 2B5YA 1G0TA 2J9HA 1M2DA 4IELA 1WWJA 2C80A 2H19A 1V98A 3PPUA 4MMMA 1T1VA 4Q5NA 5D96A 2CZ2A 3TRXA 2H0HA 1R5PA 2ALBA 2HE3A 4Z2RA 1TP9A 2R2JA 4AJ8A 3WT1A 1C72A 4KGIA 2FGXA 1BG1A 1XWAA 5IQYA 2EFCA 1K3LA 2V6OA 3KM6A 2M72A 3L4NA 18GSA 4F9ZA 4JEDA 4POKA 1R26A 2FD3A 4AKIA 2CX4A 3TKSC 3MDKA 5HR3A 5KN1A 2FA4A 3G7IA 3JCML 3GURA 2REMA 4N10A 2RM6A 5FHIA 4CY6A 1V58A 2P5QA 3P7XA 3GN3A 2RIIA 4TXVA 1TRVA 4PNGA 1DE1A 2H01A 4XCSA 4HZ4A 3KMOA 1MD4A 5GAND 1U88A 2LQOA 6GSYA 5CRGA 3A3TA 1EV9A 1NM3A 5GSSA 4K2XA 4LA1A 2QSIA 5J41A 3IXRA 1VF3A 3ME8A 2HRAA 4JE1A 3GFKA 4WR5A 4OFTA 4ZL9A 5DDLA 1BYEA 1AW9A 2WFCA 3FYGA 2NTOA 5A1NB 5IOXA 4XRDA 3F6DA 2N5FA 1ZL9A 2H1GA 4XIHA 3QFBC 3KH9A 2QC7A 1A8YA 3FZ9A 3KH7A 2I4AA 5KN2A 1GLQA 4N30A 1A23A 1S3AA 1TJDA 2K8VA 5D9XA 5A5HB 4J2FA 4K2DA 3H1NA 1PA3A 2WDUA 1FOVA 3C1SA 3P8WA 2GQMA 3VURA 3ZMKA 2OADA 2ZCTA 4TR4A 3DD3A 3FRCA 3IK9A 3GKKA 4V1Ap 4KB3A 3CTFA 2VAFA 1SD8A 3DEXA 1YF0A 3CRUA 3P90A 5B8AA 1TKDB 4X0XA 4CDOA 4K7OA 2EFHA 2GZZA 6GSUA 3Q74A 4OO4A 3KTLA 4NXIA 2J23A 1SJZA 4TOPA 2HZEA 4KH7A 1JZWA 4ZB9A 2TRXA 4V2MA 4AI6A 4FYBA 4L5OA 2OJLA 1JZOA 2TRCP 2WB9A 2KLXA 1GH2A 1GTUA 3UOMA 1O8XA 5ECIB 3KCMA 2V32A 3DVXA 4O92A 5ECSA 2O89A 1HNAA 1NHYA 6GSWA 2L5OA 3BCIA 3TJFA 1BX9A 5KOXA 1K3OA 3APQA 2XHFA 5IIZA 3L9VA 5G2ZA 4H86A 16GSA 1YDKA 2ZNMA 3VWXA 5DQYA 2YJHA 4USSA 1PGTA 5FWGA 3M0FA 5J40A 3QDNA 2PBJA 1JZDA 3KGKA 4E68A 2IN3A 5B8BA 2AYTA 4W66A 2I3YA 2YV9A 1WPIA 3FEUA 1EOGA 2YZUA 4EL1A 5IO2A 1GSYA 3EMXA 4GXZA 2HFDA 1TI1A 5D73A 2X99A 1THXA 2GSQA 3I43A 4KCEA 5IMFA 2A2SA 4F2IA 4K7NA 1X5CA 1OKDA 2HSMB 2H76A 2FWHA 3ZIJA 2CZ3A 4GWRA 1B8XA 5AIVA 1YKAA 4EF0A 3GH6A 3I9V2 4MF6A 5CP1A 1SJ6A 3ED3A 2YWMA 4KSOA 5HFKA 1N2AA 1ERVA 2V2GA 1GSUA 2B7JA 5HQPA 1XWGA 2EIRA 4O5UA 4Z2UA 4QL7A 3DRNA 3DIEA 5G1KA 2VL2A 4YQMA 2JZSA 4NV5A 2RLIA 4IBPA 3EMPA 4JBBA 1TK5B 3EINA 2ON5A 4BL7A 1NHOA 2OACA 2QKEA 3CTGA 4HUAA 4O5QA 5D93A 3VI5A 1MEKA 3G9BA 1HYUA 1Z9HA 2R0CA 3HCZA 1USBA 3IE3A 5E59A 2OBIA 1JHBA 1X5EA 4ZBAA 2DSAA 1DUGA 3M8NA 3MWHA 4HJMA 2FWGA 17GSA 2GSTA 1PL2A 2O7KA 2VUPA 2WULA 3U5RE 1GSDA 4O7HA 5IO0A 3GL5A 1A2LA 2M80A 2C3TA 3VK9A 4JR6A 3WGEA 1M0UA 4WEYA 1UN2A 2JADA 2X8CA 1K0NA 5ID2B 5ECLB 5ECKB 2HSYA 3CSHA 2IMEA 5D9WA 3UIWA 4MDCA 4MA9A 3ZVJA 1GTBA 2VO4A 3GTUB 2OE0A 1HNCA 2PERA 1SD9A 3FHKA 3QD9A 2TIRA 3GX8A 1XW9A 4O32A 1K0OA 4XTSA 2VM1A 2F9SA 3GIXA 9GSSA 1E6BA 2H1DA 3FR9A 3WD6A 3PINA 14GSA 4X4JA 4DSSB 5ENUA 1ZYQB 2DKHA 3C73A 1ZCPA 2IJYA 3GTUA 3L9SA 1SU9A 4GSNA 2AHEA 2AJQB 1TRUA 2RUFA 3N9JA 4NWYA 1ZZYA 5CRDA 3IDVA 2DJ3A 2A2PA 3R3EA 3N5OA 4MPFA 3NZNA 3LXZA 2G2QA 1G6YA 3IAM2 3UMAA 2K18A 1TW9A 4CHSA 5G5EA 4BA7A 2GTUA 1WIKA 2YV7A 3GX0A 4HEA2 1TOFA 3VPQA 2PVOC 1ERTA 3M9JA 4AKHA 4KE3A 3KXOA 2GLRA 4PNFA 4YKFA 1EGRA 3ERFA 1Z6MA 2FUG2 22GSA 3ZFLA 2GT6A 3DGQA 3A5IA 2UZ8A 2VL3A 5DVBA 3ZREA 1FO5A 4PQ1A 4EC0A 4PQHA 4BVYA 3TU3B 3FKFA 2E0QA 2G0FA 4LMVA 4FYUA 3CWGA 4PTSA 3IPZA 1GTAA 3MYDA 1ZMAA 3IA1A 1SL2B 8GSSA 5CAXA 1O8WA 3FR3A 4EIQA 2DMMA 1Z7PA 4CW9A 2I1UA 1O81A 4RI7A 1SL1B 2OT3A 4TR3A 2B1KA 1ERWA 1ZYEA 3KD0A 3RHBA 1TK8B 1TU7A 3IAS2 2CA8A 2MMAA 4I5QA 3G7JA 5HR0A 2B3SA 4K7IA 1WP0A 4JR4A 5A4UA 1VF2A 5DJMA 4KCAA 4LL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L59 A;  1UA5 A;  1MDK A;  3K8N A;  2K6V A;  3HD5 A;  2P5R A;  3ERG A;  2X8G A;  2KHP A;  1CQH A;  5KN0 A;  1PN9 A;  5HR1 A;  1OC8 A;  4BVX B;  4DEJ A;  2VLU A;  2IWT A;  3RAZ A;  2LJK A;  1EEM A;  4IJI A;  2B5X A;  3QAW A;  1E2Y A;  4RQR A;  2BJX A;  5B6N A;  4ID0 A;  3ZLP A;  3KIJ A;  1YEX A;  3VWV A;  2CT6 A;  2H74 A;  2LNT A;  1BJX A;  4FQU A;  1OC9 B;  4X1U A;  2JU5 A;  1V57 A;  3VWW A;  3A5W A;  2VLV A;  2GS3 A;  4K0N A;  2LJA A;  3GST A;  1XWB A;  4IW9 A;  2H8L A;  5DCG A;  1XXU A;  2VL2 C;  5F06 A;  4BL7 B;  3IRA A;  5DQS A;  2C4J A;  1VF1 A;  4TW5 A;  1HQO A;  2H72 A;  4ZBB A;  4GRF A;  1K0B A;  1O7U A;  3D21 A;  1PQN A;  5G5F A;  4J56 E;  1G6W A;  1SL0 B;  2NBS A;  2WS2 A;  3LYK A;  1HD2 A;  3WT2 A;  3F9U A;  3TCO A;  4J57 E;  3RPN A;  1SKR B;  4AJ7 A;  4AF2 A;  2EIO A;  3CRT A;  2X8H A;  2FA8 A;  2LV3 A;  4D73 B;  3NOF A;  5H5Q A;  2MBS A;  5CRW A;  1KNG A;  2HRK B;  2MMO A;  2JZR A;  1OE8 A;  5D8I A;  2O85 A;  1X0R A;  4FH8 A;  5CRH A;  2CVB A;  3ZTL A;  4YAP A;  3VWU A;  2VCV A;  3MAK A;  5GZZ B;  1I9D A;  1WRY A;  1TDI A;  4OFM A;  2E2M A;  6GSS A;  4RI6 A;  3F8U A;  12GS A;  1O6J A;  2LKU A;  4G0L A;  1ACV A;  2LUS A;  2CV4 A;  4K6X A;  2RUE A;  4OD7 A;  3GSS A;  2C3N A;  2WCI A;  5CRE A;  1T3B A;  2R3X A;  3O76 A;  5A5K A;  1AC1 A;  1TK0 B;  2O87 A;  1OKT A;  1XVQ A;  2PMT A;  3TRQ A;  3J7Y k;  2AAW A;  2KP2 A;  2A2R A;  2KP1 A;  1Z5Y E;  2LRT A;  2JSY A;  1PSQ A;  3F6F A;  3TDG A;  3IBH A;  4JRR A;  4ECB A;  1B4Q A;  3VI7 A;  1G7E A;  1XFL A;  5BMU A;  4I97 A;  2VLT A;  3LGC A;  3HJP A;  3QCP A;  1F3A A;  2H66 A;  5EPF A;  3M1G A;  3I6A A;  2HRF A;  3TKS A;  2BMX A;  3GH9 A;  2C0E A;  3LOR A;  4HZ2 A;  3GRX A;  4IQ1 A;  4ECC A;  3ZRD A;  3DYR A;  2H73 A;  4GLT A;  1T00 A;  3KTB A;  2PUK C;  2E7P A;  3H79 A;  2R6K A;  3D22 A;  4IP1 A;  3KZQ A;  1GRX A;  4GST A;  1BQ7 A;  3D6I A;  3IC8 A;  5JWO B;  1H4O A;  1MDI A;  3E9J B;  4OCE A;  1S3C A;  1M9B A;  2H6Y A;  1XIY A;  2PU9 C;  2P31 A;  4TN8 A;  4MZW A;  1U3A A;  1EP8 A;  3L0H A;  2K8S A;  4EDZ A;  5ECQ B;  1XWK A;  3ME7 A;  5F07 A;  2EC4 A;  1BAY A;  3QFA C;  4GF0 A;  3D4M A;  2LRC A;  3CYN A;  1QGV A;  4POL A;  3CMI A;  4POB A;  1PD2 1;  2N5B A;  3DWV A;  4MH3 A;  4L5L A;  3FK8 A;  3HVX A;  2B6M A;  2L6D A;  4DSS A;  5G1L A;  5F8B A;  1ZOF A;  4N0V A;  1Z3E A;  4QL9 A;  4GQF A;  2GSR A;  2GQL A;  1JFU A;  2C0D A;  3Q18 A;  2HZE B;  2C1Y A;  2JSZ A;  3ZL5 A;  1XOB A;  4DSR A;  1AQW A;  2QGV A;  2JL4 A;  3W6G A;  3W8S A;  1LJR A;  1YY7 A;  4I6X A;  3VFI A;  2FWF A;  4GCI A;  3FW2 A;  4I8B A;  5IM9 A;  2IMI A;  2HI7 A;  3HY2 A;  2HSM A;  4BWQ A;  1PRX A;  1XZO A;  1M99 A;  2H0I A;  5L71 A;  2H30 A;  2YWN A;  4KUN A;  2H1A A;  4XS1 A;  1Q4J A;  2IMD A;  2HT9 A;  5F0G A;  2MMN A;  4L0U A;  3GKM A;  2DJK A;  2VD1 A;  3S9F A;  1TRS A;  5IMV A;  3VPT A;  3WGD A;  3HJM A;  2PGT A;  2CVK A;  3C1R A;  5J9C A;  2GZP A;  2YJ7 A;  4K8M A;  1T8E B;  1ON4 A;  2XBI A;  3ZVJ D;  4GSS A;  1TXX A;  1AXD A;  1MD3 A;  4MJB A;  1GWC A;  3GYK A;  3C7M A;  2GDR A;  4KAE A;  4IHU A;  5B7C A;  2GZY A;  3ZIT A;  2HSH A;  3UL3 A;  3QR6 A;  2VL9 A;  1GP1 A;  2VD0 A;  3EU3 A;  1F37 A;  4EVM A;  3GKX A;  3TJB A;  1PX7 A;  1O85 A;  2JAC A;  2H75 A;  3C71 A;  1IYI A;  4NAX A;  4ILF A;  2XBQ A;  1TI3 A;  3D0Z A;  2WZ9 A;  2DC5 A;  4KX4 A;  4F0B A;  3EVI A;  3HZ8 A;  5AIX A;  4BWS A;  1DE2 A;  3MNG A;  2IIY A;  5H5S A;  2DML A;  19GS A;  1U87 A;  2KUC A;  3EU4 A;  1J0F A;  1THO A;  4OO5 A;  4DVC A;  5JWQ B;  3UAP A;  4ZIJ A;  3LQ7 A;  4TXO A;  4MLY A;  2VOC A;  2NDO A;  4HDE A;  4XHM A;  4MP4 A;  2GSS A;  4YH2 A;  3TUE A;  1AQX A;  1PKZ A;  1SJI A;  5DCH A;  4IQA A;  4BVY B;  1R7H A;  4E8E A;  1X9S B;  4KND A;  5CNW A;  1XW6 A;  5GAP D;  2OA7 A;  1FVJ A;  3TJG A;  2OE1 A;  3LEF A;  2PWJ A;  1A0R P;  4ACS A;  4QQ7 A;  2HYX A;  1ZGN A;  4K1F A;  4N11 A;  3F3R A;  3GL3 A;  4TR1 B;  2YNX A;  2X64 A;  3PR8 A;  3RPP A;  2MZC A;  5LNK e;  5EVO A;  2NVL A;  3C8E A;  10GS A;  2ON7 A;  3UBK A;  2EIQ A;  5D9T A;  3SBC A;  3HJO A;  3LWA A;  4HU7 A;  2AV4 A;  3CBU A;  4HQS A;  3UBL A;  2O8V B;  1KBN A;  2DLX A;  5IMZ A;  3LG6 A;  3A2V A;  2VCW A;  2GQK A;  1RK4 A;  3UVT A;  2DJ0 A;  3FZ5 A;  1B48 A;  3EWL A;  4WBR D;  1ILO A;  4G19 A;  2VCX A;  1XBS A;  2PVQ A;  2HSN B;  3DML A;  3ZIV A;  4F82 A;  1A24 A;  2H6X A;  3FZA A;  2GVP A;  3Q6O A;  4EUY A;  2H6Z A;  3EUR A;  2DJ2 A;  3O3T A;  3ERW A;  3A2W A;  1IYH A;  3APO A;  5HFI A;  1WJK A;  1SKW B;  13GS A;  20GS A;  3GNJ A;  5ECH B;  6GST A;  1K0D A;  6GSX A;  3HA9 A;  1R5A A;  2C8U A;  2YN1 A;  2F3M A;  2H0G A;  2VCT A;  1GUL A;  2C0F A;  3EYT A;  2GT5 A;  3RDW A;  2V41 A;  2OBK A;  3MSZ A;  1DSB A;  1VGL A;  1X9M B;  4ZIL A;  1S3D A;  4ECJ A;  4OFN A;  3TKQ A;  4RQX A;  4KF9 A;  1PMT A;  5KEJ A;  1LBK A;  3CSI A;  3WYW A;  4D73 A;  4LMW A;  2WRT A;  5LD0 A;  1JLV A;  3U6V A;  4IVF A;  4WET A;  3M3M A;  2DJ1 A;  5DAL A;  5COH A;  1Y25 A;  4PGT A;  3QAG A;  1DBY A;  5HR2 A;  3EC3 A;  4HU9 A;  3GV1 A;  1M2B A;  1OC3 A;  1W4V A;  2IPA A;  1SYX A;  2FY6 A;  3SWL A;  2CX3 A;  2FNO A;  4ZXG A;  1J9B A;  3KJY A;  2PPT A;  1MDJ A;  5J5N A;  3TJK A;  4I2T A;  3KMN A;  1K0M A;  4LLR A;  1EEJ A;  1QQ2 A;  2CAQ A;  2Z9S A;  4XS4 A;  4G10 A;  3PGT A;  3D5J A;  4RUV A;  1MTC A;  4F0C A;  1A2J A;  2YPM A;  1FVK A;  5EL8 A;  2R4V A;  3E0U A;  5DAK A;  5G31 A;  2CQ9 A;  4KDU A;  5AIS A;  1J08 A;  1K3Y A;  1FAA A;  4GTU A;  4YQU A;  1B9Y C;  1SYR A;  1YF1 A;  5ECM B;  4OMV A;  4KDY A;  3GA4 A;  4TVE A;  4MF7 A;  3FY7 A;  4EDY A;  4L0W A;  1QFN A;  2M46 A;  2B5E A;  4PUF C;  5J9B A;  1GSS A;  5KN3 A;  4MK3 A;  3IOS A;  2H71 A;  4V2N A;  2L5L A;  3OR5 A;  1RW1 A;  4WR4 A;  1Z7R A;  2FCH A;  3LJR A;  5DAK B;  3FZ4 A;  4PUA A;  7GSS A;  2XC2 A;  1I5G A;  1V9W A;  3AY8 A;  3TKR A;  1ABA A;  2LNS A;  3GHA A;  2DJJ A;  1XPV A;  1SK2 A;  3F4S A;  1XCC A;  1FB0 A;  3O6T A;  1YZX A;  5LCZ A;  2HRK A;  4P3Y B;  3DKS A;  2L57 A;  1GUM A;  5AN1 A;  4YAV A;  3UVH A;  5IMD A;  3HYP A;  2RM5 A;  4N0Z A;  3GMF A;  4TR1 A;  1SK1 A;  4MPG A;  2NPB A;  1GUK A;  1XOA A;  4NPB A;  4ZL7 A;  5ID2 A;  3GUS A;  4G0I A;  5EY6 A;  2DIZ A;  3KEB A;  1T4Y A;  1EWX A;  4ULX A;  3HXS A;  3DVW A;  2PN8 A;  3A2X A;  5ECN B;  4NV2 A;  1SEN A;  3EE2 A;  4ZB8 A;  3IC4 A;  1ML6 A;  1FG4 A;  1WE0 A;  4Q5F A;  2P0G A;  2YCD A;  1AIU A;  2HZF A;  4HOJ A;  1B9X C;  3H4K A;  5HFG A;  3VLN A;  2H1B A;  2MMZ A;  3H93 A;  1Y6E A;  1SKS B;  4MH2 A;  2IFQ A;  2FHE A;  1QMV A;  3LXT A;  2HRN A;  2ES7 A;  1X5D A;  4JU5 A;  1WOU A;  2AUV A;  1KEB A;  1LU4 A;  2XPD A;  4V2L A;  1FHE A;  5JCW A;  4ZBD A;  1BED A;  1W89 A;  2KOK A;  2V6K A;  4G2E A;  2FLS A;  4POM A;  2AB6 A;  4EE0 A;  1QUW A;  4XS6 A;  2IMF A;  4ZB6 A;  1EZK A;  3IV4 A;  4PUR A;  2HXK A;  5IMA A;  1VF4 A;  1O73 A;  5INY A;  2VIM A;  1URM A;  2E2G A;  2ZUP A;  2R37 A;  4HS1 A;  1T4Z A;  2B7K A;  1M9A A;  1GUH A;  1QK8 A;  1YJ6 A;  3NIV A;  1FW1 A;  3APS A;  3DXB A;  6GSV A;  1GNE A;  2GGT A;  2CVD A;  3M9K A;  4AJ6 A;  2CAI A;  5G30 A;  4ML1 A;  4F03 A;  4KSM A;  1UC7 A;  3TJJ A;  4FYC A;  2N5A A;  4MCU A;  4IKH A;  4FO5 A;  2R5G A;  4K9Z A;  2K9F A;  4WF4 A;  4JZQ A;  1A2M A;  1TRW A;  1F6M C;  1XVW A;  4FIW A;  5IOW A;  4TXO B;  1EOH A;  4HI7 A;  1NSW A;  4WKW A;  3HVS A;  3HVV A;  3FR6 A;  5DJL A;  2L6C A;  3TKP A;  2LEG A;  1PX6 A;  2OE3 A;  1F2E A;  3IR4 A;  1TTZ A;  3E3E A;  2HNL A;  2MBT A;  1JLW A;  2IMK A;  2C0G A;  5C00 A;  2LTK A;  3QOU A;  1NW2 A;  1K0C A;  4DSQ A;  5B6M A;  1G7O A;  1F9M A;  2V1M A;  1X9W B;  4E8H A;  3H8Q A;  3PH9 A;  1KTE A;  2BTO T;  4NMU A;  4IGJ A;  1TU8 A;  5ELA A;  3WGX A;  2H70 A;  1YKC A;  2L4C A;  3ISO A;  4OCF A;  3BOA A;  1M7T A;  3CXG A;  2OKA A;  3BBY A;  5FT3 A;  3R2Q A;  5GST A;  4L8E A;  4ECI A;  1A0F A;  1ERU A;  1RQM A;  3F0I A;  5A4V A;  3L9U A;  1PL1 A;  4EO3 A;  3KP8 A;  3F63 A;  2F8F A;  1FB6 A;  2WGR A;  1UVZ A;  5F05 A;  2VM2 A;  1K0A A;  1OC9 A;  2LRN A;  1XW5 A;  2IFQ B;  1QXH A;  2VCZ A;  1BG5 A;  4NHZ A;  3IHQ A;  5CO3 A;  2YAN A;  1GNW A;  1YQ1 A;  5IPG A;  4MZB A;  5C04 A;  5ECP B;  1B4P A;  1OYJ A;  3HKR A;  4Q5Q A;  3ZYW A;  5E4W A;  4MZC A;  5J4U A;  2B1L A;  4TKY A;  3F3Q A;  3LYP A;  3V1W A;  1AQV A;  2WJU A;  2I9H A;  3ZZX A;  5IMC A;  3ZFB A;  1H75 A;  1AUC A;  4XRA A;  5JCU A;  4MJA A;  1U3I A;  4WF5 A;  3TGZ A;  3TRP A;  1ST9 A;  5CYY A;  5JWR B;  3G7Y A;  4NHW A;  4MJE A;  3ZML A;  2A4V A;  4WBJ A;  4Z7X A;  3W8J A;  1SK0 A;  4PX1 A;  4IJ3 A;  5ELG A;  3UAR A;  4YQV A;  4BPY A;  4V1A g;  3TKS E;  1V2A A;  1JZR A;  4WXT A;  2DIY A;  4HJ2 A;  2YWI A;  2IL3 A;  5IPH A;  1XWC A;  4ISD A;  2F8A A;  4X43 A;  3BD2 A;  2F51 A;  3D4T A;  1T7P B;  5AGY A;  2LS5 A;  3LSZ A;  3GKN A;  5D9V A;  3TOT A;  2YP6 A;  4HQZ A;  4LL4 B;  1VRS D;  3L78 A;  4OWY A;  4O5R A;  2LJR A;  2FWE A;  5JCG A;  4MAB A;  5H5R A;  1EGO A;  5A4W A;  4PXO A;  4KA0 A;  3QPM A;  3Q19 A;  4K0G A;  5J3R A;  1PKW A;  4EKZ A;  4TR0 A;  2VCQ A;  2JZT A;  4IS0 A;  1Q98 A;  3P2A A;  1Z6N A;  2HQT A;  3F4T A;  4IN0 A;  2YOI A;  2LST A;  1AAZ A;  1EV4 A;  4GQC A;  3QMX A;  4Q5R A;  1GSF A;  1GTI A;  3TOU A;  2MYG A;  3RHC A;  1M2A A;  1WMJ A;  1GSQ A;  4ZL8 A;  1OVN A;  1F3B A;  2D2Z A;  1CQG A;  2XPE A;  3TB2 A;  1GSE A;  3KP9 A;  3IK7 A;  4AGS A;  1R4W A;  1A8L A;  3F4R A;  1OAZ A;  4G9H A;  5DAL B;  5ECO B;  3CSJ A;  3HZ4 A;  3US3 A;  1GLP A;  3BJ5 A;  3UJ1 A;  2YZH A;  2HLS A;  4EXJ A;  3I69 A;  3HHV A;  4BVX A;  5ECR B;  4KW6 A;  3RBT A;  4I2U A;  4IP6 A;  3UEM A;  2C3Q A;  2LQQ A;  3J7Y b;  1HNB A;  1V40 A;  3QAV A;  2L4Q A;  1OE7 A;  3HDC A;  4KDX A;  1U6T A;  4PQI A;  11GS A;  1YEP A;  4G0K A;  2YWO A;  3LFL A;  4XS4 B;  4MJC A;  5DBQ A;  4TRX A;  2I81 A;  1GL8 A;  4MF5 A;  2DBC A;  3BCK A;  1EP7 A;  1N8J A;  5ABR A;  4ML6 A;  2B5Y A;  1G0T A;  2J9H A;  1M2D A;  4IEL A;  1WWJ A;  2C80 A;  2H19 A;  1V98 A;  3PPU A;  4MMM A;  1T1V A;  4Q5N A;  5D96 A;  2CZ2 A;  3TRX A;  2H0H A;  1R5P A;  2ALB A;  2HE3 A;  1TP9 A;  2R2J A;  4AJ8 A;  3WT1 A;  1C72 A;  4KGI A;  2FGX A;  1XWA A;  5IQY A;  1K3L A;  2V6O A;  3KM6 A;  2M72 A;  3L4N A;  18GS A;  4F9Z A;  4JED A;  4POK A;  1R26 A;  2FD3 A;  2CX4 A;  3TKS C;  3MDK A;  5HR3 A;  5KN1 A;  2FA4 A;  3G7I A;  3JCM L;  3GUR A;  2REM A;  4N10 A;  2RM6 A;  5FHI A;  1V58 A;  2P5Q A;  3P7X A;  3GN3 A;  2RII A;  4TXV A;  1TRV A;  4PNG A;  1DE1 A;  2H01 A;  4XCS A;  4HZ4 A;  3KMO A;  1MD4 A;  5GAN D;  1U88 A;  2LQO A;  6GSY A;  5CRG A;  3A3T A;  1EV9 A;  1NM3 A;  5GSS A;  4LA1 A;  2QSI A;  5J41 A;  3IXR A;  1VF3 A;  3ME8 A;  2HRA A;  4JE1 A;  3GFK A;  4WR5 A;  4OFT A;  4ZL9 A;  5DDL A;  1BYE A;  1AW9 A;  2WFC A;  3FYG A;  2NTO A;  5IOX A;  4XRD A;  3F6D A;  2N5F A;  1ZL9 A;  2H1G A;  4XIH A;  3QFB C;  3KH9 A;  2QC7 A;  1A8Y A;  3FZ9 A;  3KH7 A;  2I4A A;  5KN2 A;  1GLQ A;  4N30 A;  1A23 A;  1S3A A;  1TJD A;  2K8V A;  5D9X A;  4J2F A;  4K2D A;  3H1N A;  1PA3 A;  2WDU A;  1FOV A;  3C1S A;  3P8W A;  2GQM A;  3VUR A;  3ZMK A;  2OAD A;  2ZCT A;  4TR4 A;  3DD3 A;  3FRC A;  3IK9 A;  3GKK A;  4V1A p;  4KB3 A;  3CTF A;  2VAF A;  1SD8 A;  3DEX A;  1YF0 A;  3CRU A;  3P90 A;  5B8A A;  1TKD B;  4X0X A;  4CDO A;  4K7O A;  2GZZ A;  6GSU A;  3Q74 A;  4OO4 A;  3KTL A;  4NXI A;  2J23 A;  1SJZ A;  4TOP A;  2HZE A;  4KH7 A;  1JZW A;  4ZB9 A;  2TRX A;  4V2M A;  4FYB A;  4L5O A;  2OJL A;  1JZO A;  2TRC P;  2WB9 A;  2KLX A;  1GH2 A;  1GTU A;  3UOM A;  1O8X A;  5ECI B;  3KCM A;  2V32 A;  3DVX A;  4O92 A;  5ECS A;  2O89 A;  1HNA A;  1NHY A;  6GSW A;  2L5O A;  3BCI A;  3TJF A;  1BX9 A;  1K3O A;  3APQ A;  2XHF A;  5IIZ A;  3L9V A;  5G2Z A;  4H86 A;  16GS A;  1YDK A;  2ZNM A;  3VWX A;  5DQY A;  2YJH A;  4USS A;  1PGT A;  5FWG A;  3M0F A;  3QDN A;  2PBJ A;  1JZD A;  3KGK A;  2IN3 A;  5B8B A;  2AYT A;  2I3Y A;  2YV9 A;  1WPI A;  3FEU A;  1EOG A;  2YZU A;  4EL1 A;  5IO2 A;  1GSY A;  3EMX A;  4GXZ A;  2HFD A;  1TI1 A;  5D73 A;  2X99 A;  1THX A;  2GSQ A;  3I43 A;  4KCE A;  5IMF A;  2A2S A;  4F2I A;  4K7N A;  1X5C A;  1OKD A;  2HSM B;  2H76 A;  2FWH A;  3ZIJ A;  2CZ3 A;  4GWR A;  1B8X A;  5AIV A;  1YKA A;  4EF0 A;  3GH6 A;  3I9V 2;  4MF6 A;  5CP1 A;  1SJ6 A;  3ED3 A;  2YWM A;  4KSO A;  5HFK A;  1N2A A;  1ERV A;  2V2G A;  1GSU A;  2B7J A;  5HQP A;  1XWG A;  2EIR A;  4QL7 A;  3DRN A;  3DIE A;  5G1K A;  2VL2 A;  4YQM A;  2JZS A;  4NV5 A;  2RLI A;  4IBP A;  3EMP A;  4JBB A;  1TK5 B;  3EIN A;  2ON5 A;  4BL7 A;  1NHO A;  2OAC A;  2QKE A;  3CTG A;  4HUA A;  5D93 A;  3VI5 A;  1MEK A;  3G9B A;  1HYU A;  1Z9H A;  3HCZ A;  1USB A;  3IE3 A;  5E59 A;  2OBI A;  1JHB A;  1X5E A;  4ZBA A;  2DSA A;  1DUG A;  3M8N A;  3MWH A;  4HJM A;  2FWG A;  17GS A;  2GST A;  1PL2 A;  2O7K A;  2VUP A;  2WUL A;  3U5R E;  1GSD A;  4O7H A;  5IO0 A;  3GL5 A;  1A2L A;  2M80 A;  2C3T A;  3VK9 A;  4JR6 A;  3WGE A;  1M0U A;  4WEY A;  1UN2 A;  2JAD A;  2X8C A;  1K0N A;  5ID2 B;  5ECL B;  5ECK B;  2HSY A;  3CSH A;  2IME A;  5D9W A;  3UIW A;  4MDC A;  4MA9 A;  3ZVJ A;  1GTB A;  2VO4 A;  3GTU B;  2OE0 A;  1HNC A;  2PER A;  1SD9 A;  3FHK A;  3QD9 A;  2TIR A;  3GX8 A;  1XW9 A;  4O32 A;  1K0O A;  4XTS A;  2VM1 A;  2F9S A;  3GIX A;  9GSS A;  1E6B A;  2H1D A;  3FR9 A;  3WD6 A;  3PIN A;  14GS A;  4DSS B;  5ENU A;  1ZYQ B;  3C73 A;  1ZCP A;  2IJY A;  3GTU A;  3L9S A;  1SU9 A;  4GSN A;  2AHE A;  2AJQ B;  1TRU A;  2RUF A;  3N9J A;  4NWY A;  1ZZY A;  5CRD A;  3IDV A;  2DJ3 A;  3R3E A;  3N5O A;  4MPF A;  3NZN A;  3LXZ A;  2G2Q A;  1G6Y A;  3IAM 2;  3UMA A;  2K18 A;  1TW9 A;  4CHS A;  5G5E A;  4BA7 A;  2GTU A;  1WIK A;  2YV7 A;  3GX0 A;  4HEA 2;  1TOF A;  3VPQ A;  2PVO C;  1ERT A;  3M9J A;  4KE3 A;  3KXO A;  2GLR A;  4PNF A;  1EGR A;  3ERF A;  1Z6M A;  2FUG 2;  22GS A;  3ZFL A;  2GT6 A;  3DGQ A;  2UZ8 A;  2VL3 A;  5DVB A;  3ZRE A;  1FO5 A;  4PQ1 A;  4EC0 A;  4PQH A;  4BVY A;  3FKF A;  2E0Q A;  2G0F A;  4LMV A;  4FYU A;  4PTS A;  3IPZ A;  1GTA A;  1ZMA A;  3IA1 A;  1SL2 B;  8GSS A;  5CAX A;  1O8W A;  3FR3 A;  2DMM A;  1Z7P A;  4CW9 A;  2I1U A;  1O81 A;  4RI7 A;  1SL1 B;  4TR3 A;  2B1K A;  1ERW A;  1ZYE A;  3KD0 A;  3RHB A;  1TK8 B;  1TU7 A;  3IAS 2;  2CA8 A;  2MMA A;  4I5Q A;  3G7J A;  5HR0 A;  2B3S A;  4K7I A;  1WP0 A;  4JR4 A;  5A4U A;  1VF2 A;  5DJM A;  4KCA A;  4LL1 B; 
#chains in the Genus database with same CATH topology
 2L59 A;  1UA5 A;  1MDK A;  3K8N A;  2K6V A;  3HD5 A;  2P5R A;  3ERG A;  2X8G A;  2KHP A;  1CQH A;  5KN0 A;  1PN9 A;  1Y1U A;  5HR1 A;  1OC8 A;  4BVX B;  4DEJ A;  2VLU A;  2IWT A;  3RAZ A;  2LJK A;  1EEM A;  4IJI A;  2B5X A;  4QMK A;  3QAW A;  1E2Y A;  4RQR A;  2BJX A;  5B6N A;  4ID0 A;  3ZLP A;  3KIJ A;  1YEX A;  3VWV A;  2CT6 A;  2H74 A;  2LNT A;  1BJX A;  4FQU A;  1OC9 B;  1BF5 A;  4X1U A;  2JU5 A;  1V57 A;  3VWW A;  3A5W A;  1YVL A;  2VLV A;  2GS3 A;  4K0N A;  2LJA A;  3GST A;  1XWB A;  4IW9 A;  2H8L A;  5DCG A;  1XXU A;  3HMJ G;  2VL2 C;  5F06 A;  4BL7 B;  3IRA A;  4PI2 C;  5DQS A;  2C4J A;  1VF1 A;  4TW5 A;  1HQO A;  2H72 A;  4ZBB A;  4GRF A;  1K0B A;  1O7U A;  3D21 A;  1PQN A;  5G5F A;  4J56 E;  1G6W A;  1SL0 B;  2NBS A;  2WS2 A;  5BRT A;  3LYK A;  1HD2 A;  3WT2 A;  3F9U A;  3TCO A;  4J57 E;  4AKX B;  3RPN A;  1SKR B;  1PFO A;  4AJ7 A;  4MNN A;  4AF2 A;  2EIO A;  3CRT A;  2X8H A;  2FA8 A;  2LV3 A;  4D73 B;  2EFE A;  3NOF A;  5H5Q A;  2MBS A;  5CRW A;  1KNG A;  2HRK B;  2MMO A;  2JZR A;  1OE8 A;  5D8I A;  2O85 A;  1X0R A;  4FH8 A;  5CRH A;  2CVB A;  3ZTL A;  4YAP A;  3VWU A;  2VCV A;  3MAK A;  5GZZ B;  1I9D A;  1WRY A;  1TDI A;  4OFM A;  2E2M A;  6GSS A;  4RI6 A;  3F8U A;  12GS A;  1O6J A;  2LKU A;  2DKI A;  4G0L A;  4BIK A;  1ACV A;  2LUS A;  2CV4 A;  4K6X A;  3RFR C;  2RUE A;  4OD7 A;  3GSS A;  2C3N A;  2WCI A;  5CRE A;  1T3B A;  2R3X A;  2O5V A;  3O76 A;  5A5H A;  5A5K A;  1AC1 A;  1TK0 B;  2O87 A;  1OKT A;  1XVQ A;  2PMT A;  3TRQ A;  3J7Y k;  2AAW A;  2KP2 A;  2A2R A;  2KP1 A;  1Z5Y E;  2LRT A;  2JSY A;  1PSQ A;  3F6F A;  3TDG A;  3IBH A;  4EIP A;  4JRR A;  4ECB A;  1B4Q A;  3VI7 A;  1G7E A;  1XFL A;  5BMU A;  4I97 A;  2VLT A;  3LGC A;  3HJP A;  3QCP A;  1F3A A;  2H66 A;  5EPF A;  3M1G A;  3I6A A;  2HRF A;  3TKS A;  2BMX A;  3GH9 A;  2C0E A;  3LOR A;  4HZ2 A;  3GRX A;  4IQ1 A;  4ECC A;  3ZRD A;  3DYR A;  2H73 A;  4GLT A;  1T00 A;  3KTB A;  4PHZ C;  2PUK C;  2E7P A;  3H79 A;  3MIX A;  2R6K A;  3D22 A;  4IP1 A;  1N25 A;  3KZQ A;  1GRX A;  4GST A;  1BQ7 A;  3D6I A;  3IC8 A;  5JWO B;  5BMU B;  1H4O A;  2A4H A;  1MDI A;  3E9J B;  4OCE A;  1S3C A;  1M9B A;  2H6Y A;  1XIY A;  2PU9 C;  2P31 A;  4TN8 A;  4MZW A;  1U3A A;  1EP8 A;  3L0H A;  2K8S A;  4EDZ A;  5ECQ B;  1XWK A;  3ME7 A;  5F07 A;  2EC4 A;  2QA1 A;  1BAY A;  3QFA C;  4GF0 A;  3D4M A;  2LRC A;  3CYN A;  1QGV A;  4POL A;  3CMI A;  4POB A;  1PD2 1;  2N5B A;  3DWV A;  4MH3 A;  4L5L A;  3FK8 A;  3HVX A;  2B6M A;  2L6D A;  4DSS A;  5G1L A;  5F8B A;  1ZOF A;  4N0V A;  1Z3E A;  4QL9 A;  4GQF A;  2GSR A;  2GQL A;  1JFU A;  2C0D A;  3Q18 A;  2HZE B;  2C1Y A;  2JSZ A;  5KOW A;  3ZL5 A;  1XOB A;  4DSR A;  1AQW A;  2QGV A;  2JL4 A;  3W6G A;  3W8S A;  1LJR A;  1YY7 A;  4I6X A;  3VFI A;  2FWF A;  4GCI A;  3FW2 A;  4I8B A;  2WZS A;  2IMI A;  5IM9 A;  2HI7 A;  3HY2 A;  2HSM A;  4BWQ A;  1PRX A;  1XZO A;  1M99 A;  2H0I A;  5L71 A;  2H30 A;  2YWN A;  4KUN A;  2H1A A;  4XS1 A;  1Q4J A;  2IMD A;  2HT9 A;  5F0G A;  2MMN A;  4L0U A;  3GKM A;  2DJK A;  2VD1 A;  3S9F A;  1TRS A;  5IMV A;  3VPT A;  3WGD A;  3HJM A;  4PI0 C;  2PGT A;  2CVK A;  3C1R A;  5J9C A;  2GZP A;  2YJ7 A;  4K8M A;  1T8E B;  1ON4 A;  2XBI A;  3ZVJ D;  4GSS A;  1TXX A;  1AXD A;  1MD3 A;  4MJB A;  1GWC A;  3GYK A;  3C7M A;  2GDR A;  4KAE A;  4IHU A;  5B7C A;  2GZY A;  3ZIT A;  2HSH A;  4A5P A;  3UL3 A;  3QR6 A;  2VL9 A;  1GP1 A;  2EFD A;  3EU3 A;  2VD0 A;  2VKZ G;  1F37 A;  4EVM A;  3GKX A;  3TJB A;  1PX7 A;  1O85 A;  2JAC A;  2H75 A;  3C71 A;  1IYI A;  4NAX A;  4ILF A;  2XBQ A;  1TI3 A;  3D0Z A;  2WZ9 A;  2DC5 A;  4KX4 A;  4F0B A;  3EVI A;  3HZ8 A;  5AIX A;  4BWS A;  1DE2 A;  3MNG A;  2IIY A;  5H5S A;  2DML A;  19GS A;  1U87 A;  2UV8 G;  2KUC A;  3EU4 A;  1J0F A;  1THO A;  4OO5 A;  4DVC A;  5JWQ B;  3UAP A;  4ZIJ A;  3LQ7 A;  4TXO A;  4MLY A;  2VOC A;  2NDO A;  4HDE A;  4XHM A;  4MP4 A;  2GSS A;  4YH2 A;  3TUE A;  1AQX A;  1ZYN A;  1PKZ A;  1SJI A;  5DCH A;  4IQA A;  4BVY B;  1R7H A;  4E8E A;  1X9S B;  4KND A;  5CNW A;  1XW6 A;  5GAP D;  2OA7 A;  1FVJ A;  3TJG A;  2OE1 A;  3LEF A;  2PWJ A;  1I1I P;  1A0R P;  4ACS A;  4QQ7 A;  2HYX A;  5J4V A;  4K1F A;  1ZGN A;  5A34 A;  4N11 A;  3F3R A;  3GL3 A;  4TR1 B;  2YNX A;  2X64 A;  1PN0 A;  2R0G A;  3PR8 A;  3RPP A;  2MZC A;  5LNK e;  5EVO A;  2NVL A;  3C8E A;  10GS A;  2ON7 A;  3UBK A;  2EIQ A;  5D9T A;  3SBC A;  3HJO A;  3LWA A;  4HU7 A;  2AV4 A;  3CBU A;  4HQS A;  3UBL A;  2O8V B;  1KBN A;  2DLX A;  5IMZ A;  3LG6 A;  3A2V A;  2VCW A;  2GQK A;  1RK4 A;  3UVT A;  2DJ0 A;  2X49 A;  3FZ5 A;  1B48 A;  3EWL A;  4WBR D;  1ILO A;  4G19 A;  2VCX A;  1XBS A;  1FOH A;  2PVQ A;  2HSN B;  3DML A;  3ZIV A;  4F82 A;  1A24 A;  2H6X A;  3FZA A;  2GVP A;  3Q6O A;  4EUY A;  2H6Z A;  3EUR A;  2DJ2 A;  3O3T A;  3ERW A;  3A2W A;  1IYH A;  3APO A;  5HFI A;  1WJK A;  1SKW B;  13GS A;  20GS A;  3GNJ A;  5ECH B;  6GST A;  1K0D A;  6GSX A;  3HA9 A;  1R5A A;  2C8U A;  2YN1 A;  2F3M A;  2H0G A;  2VCT A;  1GUL A;  2C0F A;  3EYT A;  2WVY A;  2GT5 A;  3RDW A;  2V41 A;  2OBK A;  3MSZ A;  1DSB A;  1VGL A;  1X9M B;  4ZIL A;  1TXU A;  5A34 B;  1S3D A;  4ECJ A;  2WVX A;  4OFN A;  3TKQ A;  4RQX A;  4KF9 A;  1PMT A;  5KEJ A;  1LBK A;  4Z2T A;  3CSI A;  3WYW A;  4D73 A;  4LMW A;  1XG8 A;  2WRT A;  5LD0 A;  1JLV A;  3U6V A;  4IVF A;  4WET A;  3M3M A;  2DJ1 A;  3LW9 A;  4FXY P;  5DAL A;  5COH A;  1Y25 A;  4PGT A;  3QAG A;  1DBY A;  4ZB7 A;  5HR2 A;  3EC3 A;  4HU9 A;  3GV1 A;  1M2B A;  1OC3 A;  1W4V A;  2IPA A;  1SYX A;  2FY6 A;  3SWL A;  2CX3 A;  3CQF A;  2FNO A;  4ZXG A;  1J9B A;  3KJY A;  2PPT A;  1MDJ A;  5J5N A;  3TJK A;  4I2T A;  3KMN A;  1K0M A;  4LLR A;  1EEJ A;  1QQ2 A;  2CAQ A;  2Z9S A;  4XS4 A;  4G10 A;  3PGT A;  3D5J A;  4RUV A;  1MTC A;  4F0C A;  1A2J A;  2YPM A;  1FVK A;  5EL8 A;  2R4V A;  2WW1 A;  3E0U A;  5DAK A;  1YEW C;  5G31 A;  3HVN A;  2CQ9 A;  4KDU A;  5AIS A;  1J08 A;  1K3Y A;  1FAA A;  4GTU A;  4YQU A;  1B9Y C;  1SYR A;  1YF1 A;  5ECM B;  4OMV A;  1M3J A;  4KDY A;  3GA4 A;  4TVE A;  4MF7 A;  3FY7 A;  4EDY A;  4L0W A;  1QFN A;  2M46 A;  2B5E A;  4PUF C;  5J9B A;  1GSS A;  5KN3 A;  4MK3 A;  3IOS A;  2H71 A;  4V2N A;  2L5L A;  3OR5 A;  1RW1 A;  4WR4 A;  2WW3 A;  1SVO A;  1Z7R A;  2FCH A;  3LJR A;  5DAK B;  3FZ4 A;  4PUA A;  7GSS A;  2XC2 A;  1I5G A;  1V9W A;  3AY8 A;  3TKR A;  1ABA A;  2LNS A;  5A1N A;  3GHA A;  2DJJ A;  1XPV A;  1SK2 A;  3F4S A;  1XCC A;  1FB0 A;  3O6T A;  1YZX A;  5LCZ A;  2HRK A;  4P3Y B;  3DKS A;  2L57 A;  1GUM A;  5AN1 A;  4YAV A;  3UVH A;  4K5S A;  3HYP A;  5IMD A;  2RM5 A;  4N0Z A;  3GMF A;  4TR1 A;  1SK1 A;  4MPG A;  2NPB A;  1GUK A;  1XOA A;  4NPB A;  4ZL7 A;  1SVM A;  5ID2 A;  3GUS A;  4G0I A;  5EY6 A;  2DIZ A;  3KEB A;  1T4Y A;  1EWX A;  4ULX A;  3HXS A;  3DVW A;  2PN8 A;  3A2X A;  5ECN B;  4NV2 A;  1SEN A;  3EE2 A;  4ZB8 A;  3IC4 A;  1ML6 A;  1FG4 A;  1WE0 A;  4Q5F A;  2P0G A;  2YCD A;  1AIU A;  2HZF A;  4HOJ A;  1B9X C;  3H4K A;  2QA2 A;  5HFG A;  3VLN A;  2H1B A;  2MMZ A;  3H93 A;  1Y6E A;  1SKS B;  3EPT A;  4MH2 A;  3IHG A;  2IFQ A;  2FHE A;  1QMV A;  3LXT A;  2HRN A;  2ES7 A;  1X5D A;  4JU5 A;  1WOU A;  4AKG A;  1S4B P;  2AUV A;  1KEB A;  1LU4 A;  2XPD A;  2X4A A;  4V2L A;  1FHE A;  5JCW A;  4ZBD A;  1BED A;  1W89 A;  2KOK A;  2V6K A;  4G2E A;  2FLS A;  4POM A;  2AB6 A;  4EE0 A;  1QUW A;  4XS6 A;  2IMF A;  4ZB6 A;  1EZK A;  3IV4 A;  4PUR A;  2HXK A;  5IMA A;  1VF4 A;  1O73 A;  5INY A;  2VIM A;  1URM A;  2E2G A;  2ZUP A;  4K5R A;  2R37 A;  4HS1 A;  1T4Z A;  2B7K A;  1M9A A;  1GUH A;  1QK8 A;  1YJ6 A;  3NIV A;  1FW1 A;  3APS A;  3DXB A;  6GSV A;  1ZYP A;  1GNE A;  2GGT A;  2CVD A;  2R0P A;  3M9K A;  4AJ6 A;  2CAI A;  5G30 A;  4ML1 A;  4F03 A;  4KSM A;  1UC7 A;  3TJJ A;  4FYC A;  2N5A A;  4MCU A;  4IKH A;  4FO5 A;  2R5G A;  4K9Z A;  2K9F A;  4WF4 A;  4JZQ A;  1A2M A;  1TRW A;  1F6M C;  1XVW A;  4FIW A;  5IOW A;  4TXO B;  1EOH A;  4HI7 A;  1NSW A;  4WKW A;  3HVS A;  3HVV A;  3FR6 A;  5DJL A;  2L6C A;  3TKP A;  2LEG A;  1PX6 A;  2OE3 A;  1F2E A;  3IR4 A;  1TTZ A;  3E3E A;  2HNL A;  2MBT A;  1JLW A;  2IMK A;  2C0G A;  5C00 A;  2LTK A;  3QOU A;  1NW2 A;  1K0C A;  4YKG A;  4DSQ A;  5B6M A;  4N3Z A;  1G7O A;  1F9M A;  2V1M A;  2WW2 A;  1X9W B;  4E8H A;  3H8Q A;  3PH9 A;  1KTE A;  2BTO T;  4NMU A;  4IGJ A;  1TU8 A;  5ELA A;  3WGX A;  2H70 A;  1YKC A;  2L4C A;  3ISO A;  4OCF A;  4G01 A;  3BOA A;  1M7T A;  3CXG A;  2OKA A;  3BBY A;  5FT3 A;  3R2Q A;  5GST A;  4L8E A;  4ECI A;  1A0F A;  1ERU A;  1RQM A;  3F0I A;  5A4V A;  3L9U A;  1PL1 A;  4EO3 A;  3KP8 A;  3F63 A;  2F8F A;  1FB6 A;  2WGR A;  1UVZ A;  4CY8 A;  5F05 A;  2VM2 A;  1K0A A;  1OC9 A;  2LRN A;  1XW5 A;  2IFQ B;  1QXH A;  2VCZ A;  1BG5 A;  4NHZ A;  5J47 A;  3IHQ A;  5CO3 A;  2YAN A;  1GNW A;  4ICY A;  1YQ1 A;  5IPG A;  4MZB A;  5C04 A;  5ECP B;  1B4P A;  1OYJ A;  3HKR A;  4Q5Q A;  3ZYW A;  5E4W A;  4MZC A;  5J4U A;  4GDF A;  2B1L A;  4TKY A;  2H1L A;  3F3Q A;  3LYP A;  4HSC X;  3V1W A;  1AQV A;  2WJU A;  2I9H A;  3ZZX A;  5IMC A;  3ZFB A;  1H75 A;  1AUC A;  4XRA A;  5JCU A;  4MJA A;  1U3I A;  4WF5 A;  3TGZ A;  3TRP A;  1ST9 A;  5CYY A;  5JWR B;  3G7Y A;  4NHW A;  4MJE A;  3ZML A;  2A4V A;  4WBJ A;  4Z7X A;  3W8J A;  1SK0 A;  4PX1 A;  4IJ3 A;  5ELG A;  3UAR A;  4YQV A;  4BPY A;  4V1A g;  2WW0 A;  3TKS E;  1V2A A;  1JZR A;  4WXT A;  2DIY A;  4HJ2 A;  2YWI A;  2IL3 A;  2O36 A;  5IPH A;  1XWC A;  4ISD A;  2F8A A;  4X43 A;  3BD2 A;  2F51 A;  5J4Y A;  3D4T A;  1T7P B;  1M3I A;  5AGY A;  2LS5 A;  3LSZ A;  3GKN A;  5D9V A;  3TOT A;  2YP6 A;  4HQZ A;  4LL4 B;  1VRS D;  3L78 A;  4OWY A;  4O5R A;  2LJR A;  2FWE A;  5JCG A;  4MAB A;  5H5R A;  1SVL A;  1EGO A;  5A4W A;  4PXO A;  4KA0 A;  3QPM A;  3Q19 A;  4K0G A;  5J3R A;  1PKW A;  4EKZ A;  4TR0 A;  2VCQ A;  2JZT A;  4IS0 A;  1Q98 A;  3P2A A;  1Z6N A;  2HQT A;  3F4T A;  4IN0 A;  2YOI A;  2LST A;  1AAZ A;  1EV4 A;  4GQC A;  3QMX A;  4Q5R A;  1GSF A;  1GTI A;  3RGB C;  3TOU A;  2MYG A;  3RHC A;  1M2A A;  1WMJ A;  1GSQ A;  4ZL8 A;  1OVN A;  1F3B A;  2D2Z A;  1CQG A;  2XPE A;  3FMW A;  3TB2 A;  1GSE A;  3KP9 A;  3IK7 A;  4AGS A;  1R4W A;  1A8L A;  3F4R A;  1OAZ A;  4G9H A;  5DAL B;  5ECO B;  3CSJ A;  3HZ4 A;  3US3 A;  1GLP A;  3BJ5 A;  3UJ1 A;  2YZH A;  2HLS A;  4EXJ A;  3I69 A;  3HHV A;  4BVX A;  5ECR B;  4KW6 A;  3RBT A;  4I2U A;  4IP6 A;  3UEM A;  2C3Q A;  2LQQ A;  3J7Y b;  1HNB A;  1V40 A;  3QAV A;  2L4Q A;  1OE7 A;  3HDC A;  4KDX A;  1U6T A;  4PQI A;  11GS A;  1YEP A;  4G0K A;  2YWO A;  3LFL A;  4XS4 B;  4MJC A;  5DBQ A;  4TRX A;  2HSN A;  2I81 A;  1GL8 A;  4MF5 A;  2DBC A;  3BCK A;  1EP7 A;  1N8J A;  5ABR A;  4ML6 A;  2B5Y A;  1G0T A;  2J9H A;  1M2D A;  4IEL A;  1WWJ A;  2C80 A;  2H19 A;  1V98 A;  3PPU A;  4MMM A;  1T1V A;  4Q5N A;  5D96 A;  2CZ2 A;  3TRX A;  2H0H A;  1R5P A;  2ALB A;  2HE3 A;  4Z2R A;  1TP9 A;  2R2J A;  4AJ8 A;  3WT1 A;  1C72 A;  4KGI A;  2FGX A;  1BG1 A;  1XWA A;  5IQY A;  2EFC A;  1K3L A;  2V6O A;  3KM6 A;  2M72 A;  3L4N A;  18GS A;  4F9Z A;  4JED A;  4POK A;  1R26 A;  2FD3 A;  4AKI A;  2CX4 A;  3TKS C;  3MDK A;  5HR3 A;  5KN1 A;  2FA4 A;  3G7I A;  3JCM L;  3GUR A;  2REM A;  4N10 A;  2RM6 A;  5FHI A;  4CY6 A;  1V58 A;  2P5Q A;  3P7X A;  3GN3 A;  2RII A;  4TXV A;  1TRV A;  4PNG A;  1DE1 A;  2H01 A;  4XCS A;  4HZ4 A;  3KMO A;  1MD4 A;  5GAN D;  1U88 A;  2LQO A;  6GSY A;  5CRG A;  3A3T A;  1EV9 A;  1NM3 A;  5GSS A;  4K2X A;  4LA1 A;  2QSI A;  5J41 A;  3IXR A;  1VF3 A;  3ME8 A;  2HRA A;  4JE1 A;  3GFK A;  4WR5 A;  4OFT A;  4ZL9 A;  5DDL A;  1BYE A;  1AW9 A;  2WFC A;  3FYG A;  2NTO A;  5A1N B;  5IOX A;  4XRD A;  3F6D A;  2N5F A;  1ZL9 A;  2H1G A;  4XIH A;  3QFB C;  3KH9 A;  2QC7 A;  1A8Y A;  3FZ9 A;  3KH7 A;  2I4A A;  5KN2 A;  1GLQ A;  4N30 A;  1A23 A;  1S3A A;  1TJD A;  2K8V A;  5D9X A;  5A5H B;  4J2F A;  4K2D A;  3H1N A;  1PA3 A;  2WDU A;  1FOV A;  3C1S A;  3P8W A;  2GQM A;  3VUR A;  3ZMK A;  2OAD A;  2ZCT A;  4TR4 A;  3DD3 A;  3FRC A;  3IK9 A;  3GKK A;  4V1A p;  4KB3 A;  3CTF A;  2VAF A;  1SD8 A;  3DEX A;  1YF0 A;  3CRU A;  3P90 A;  5B8A A;  1TKD B;  4X0X A;  4CDO A;  4K7O A;  2EFH A;  2GZZ A;  6GSU A;  3Q74 A;  4OO4 A;  3KTL A;  4NXI A;  2J23 A;  1SJZ A;  4TOP A;  2HZE A;  4KH7 A;  1JZW A;  4ZB9 A;  2TRX A;  4V2M A;  4AI6 A;  4FYB A;  4L5O A;  2OJL A;  1JZO A;  2TRC P;  2WB9 A;  2KLX A;  1GH2 A;  1GTU A;  3UOM A;  1O8X A;  5ECI B;  3KCM A;  2V32 A;  2O3E A;  3DVX A;  4O92 A;  5ECS A;  2O89 A;  1HNA A;  1NHY A;  6GSW A;  2L5O A;  3BCI A;  3TJF A;  1BX9 A;  5KOX A;  1K3O A;  3APQ A;  2XHF A;  5IIZ A;  3L9V A;  5G2Z A;  4H86 A;  16GS A;  1YDK A;  2ZNM A;  3VWX A;  5DQY A;  2YJH A;  4USS A;  1PGT A;  5FWG A;  3M0F A;  5J40 A;  3QDN A;  2PBJ A;  1JZD A;  3KGK A;  4E68 A;  2IN3 A;  5B8B A;  2AYT A;  4W66 A;  2I3Y A;  2YV9 A;  1WPI A;  3FEU A;  1EOG A;  2YZU A;  4EL1 A;  5IO2 A;  1GSY A;  3EMX A;  4GXZ A;  2HFD A;  1TI1 A;  5D73 A;  2X99 A;  1THX A;  2GSQ A;  3I43 A;  4KCE A;  5IMF A;  2A2S A;  4F2I A;  4K7N A;  1X5C A;  1OKD A;  2HSM B;  2H76 A;  2FWH A;  3ZIJ A;  2CZ3 A;  4GWR A;  1B8X A;  5AIV A;  1YKA A;  4EF0 A;  3GH6 A;  3I9V 2;  4MF6 A;  5CP1 A;  1SJ6 A;  3ED3 A;  2YWM A;  4KSO A;  5HFK A;  1N2A A;  1ERV A;  2V2G A;  1GSU A;  2B7J A;  5HQP A;  1XWG A;  2EIR A;  4O5U A;  4Z2U A;  4QL7 A;  3DRN A;  3DIE A;  5G1K A;  2VL2 A;  4YQM A;  2JZS A;  4NV5 A;  2RLI A;  4IBP A;  3EMP A;  4JBB A;  1TK5 B;  3EIN A;  2ON5 A;  4BL7 A;  1NHO A;  2OAC A;  2QKE A;  3CTG A;  4HUA A;  4O5Q A;  5D93 A;  3VI5 A;  1MEK A;  3G9B A;  1HYU A;  1Z9H A;  2R0C A;  3HCZ A;  1USB A;  3IE3 A;  5E59 A;  2OBI A;  1JHB A;  1X5E A;  4ZBA A;  2DSA A;  1DUG A;  3M8N A;  3MWH A;  4HJM A;  2FWG A;  17GS A;  2GST A;  1PL2 A;  2O7K A;  2VUP A;  2WUL A;  3U5R E;  1GSD A;  4O7H A;  5IO0 A;  3GL5 A;  1A2L A;  2M80 A;  2C3T A;  3VK9 A;  4JR6 A;  3WGE A;  1M0U A;  4WEY A;  1UN2 A;  2JAD A;  2X8C A;  1K0N A;  5ID2 B;  5ECL B;  5ECK B;  2HSY A;  3CSH A;  2IME A;  5D9W A;  3UIW A;  4MDC A;  4MA9 A;  3ZVJ A;  1GTB A;  2VO4 A;  3GTU B;  2OE0 A;  1HNC A;  2PER A;  1SD9 A;  3FHK A;  3QD9 A;  2TIR A;  3GX8 A;  1XW9 A;  4O32 A;  1K0O A;  4XTS A;  2VM1 A;  2F9S A;  3GIX A;  9GSS A;  1E6B A;  2H1D A;  3FR9 A;  3WD6 A;  3PIN A;  14GS A;  4X4J A;  4DSS B;  5ENU A;  1ZYQ B;  2DKH A;  3C73 A;  1ZCP A;  2IJY A;  3GTU A;  3L9S A;  1SU9 A;  4GSN A;  2AHE A;  1S3R A;  2AJQ B;  1TRU A;  2RUF A;  3N9J A;  4NWY A;  1ZZY A;  5CRD A;  3IDV A;  2DJ3 A;  2A2P A;  3R3E A;  3N5O A;  4MPF A;  3NZN A;  3CHX C;  3LXZ A;  2G2Q A;  1G6Y A;  3IAM 2;  3UMA A;  2K18 A;  1TW9 A;  4CHS A;  5G5E A;  4BA7 A;  2GTU A;  1WIK A;  2YV7 A;  4HEA 2;  3GX0 A;  1TOF A;  3VPQ A;  2PVO C;  1ERT A;  3M9J A;  4AKH A;  4KE3 A;  3KXO A;  2GLR A;  4PNF A;  4YKF A;  1EGR A;  3ERF A;  1Z6M A;  2FUG 2;  22GS A;  3ZFL A;  2GT6 A;  3DGQ A;  3A5I A;  2UZ8 A;  2VL3 A;  5DVB A;  3ZRE A;  1FO5 A;  4PQ1 A;  4EC0 A;  4PQH A;  4BVY A;  3TU3 B;  3FKF A;  2E0Q A;  2G0F A;  4LMV A;  4FYU A;  3CWG A;  4PTS A;  3IPZ A;  1GTA A;  3MYD A;  1ZMA A;  3IA1 A;  1SL2 B;  8GSS A;  2WVX B;  5CAX A;  1O8W A;  3FR3 A;  4EIQ A;  2DMM A;  1Z7P A;  4CW9 A;  2I1U A;  1O81 A;  4RI7 A;  1SL1 B;  2OT3 A;  4TR3 A;  2B1K A;  1ERW A;  1ZYE A;  3KD0 A;  3RHB A;  1TK8 B;  1TU7 A;  3IAS 2;  2CA8 A;  2MMA A;  4I5Q A;  3G7J A;  5HR0 A;  2B3S A;  4K7I A;  1WP0 A;  4JR4 A;  5A4U A;  2WVZ A;  1VF2 A;  5DJM A;  4KCA A;  4LL1 B; 
#chains in the Genus database with same CATH homology
 2L59 A;  1UA5 A;  1MDK A;  3K8N A;  2K6V A;  3HD5 A;  2P5R A;  3ERG A;  2X8G A;  2KHP A;  1CQH A;  5KN0 A;  1PN9 A;  1Y1U A;  5HR1 A;  1OC8 A;  4BVX B;  4DEJ A;  2VLU A;  2IWT A;  3RAZ A;  2LJK A;  1EEM A;  4IJI A;  2B5X A;  4QMK A;  3QAW A;  1E2Y A;  4RQR A;  2BJX A;  5B6N A;  4ID0 A;  3ZLP A;  3KIJ A;  1YEX A;  3VWV A;  2CT6 A;  2H74 A;  2LNT A;  1BJX A;  4FQU A;  1OC9 B;  1BF5 A;  4X1U A;  2JU5 A;  1V57 A;  3VWW A;  3A5W A;  1YVL A;  2VLV A;  2GS3 A;  4K0N A;  2LJA A;  3GST A;  1XWB A;  4IW9 A;  2H8L A;  5DCG A;  1XXU A;  3HMJ G;  2VL2 C;  5F06 A;  4BL7 B;  3IRA A;  5DQS A;  2C4J A;  1VF1 A;  4TW5 A;  1HQO A;  2H72 A;  4ZBB A;  4GRF A;  1K0B A;  1O7U A;  3D21 A;  1PQN A;  5G5F A;  4J56 E;  1G6W A;  1SL0 B;  2NBS A;  2WS2 A;  5BRT A;  3LYK A;  1HD2 A;  3WT2 A;  3F9U A;  3TCO A;  4J57 E;  4AKX B;  3RPN A;  1SKR B;  4AJ7 A;  4MNN A;  4AF2 A;  2EIO A;  3CRT A;  2X8H A;  2FA8 A;  2LV3 A;  4D73 B;  2EFE A;  3NOF A;  5H5Q A;  2MBS A;  5CRW A;  1KNG A;  2HRK B;  2MMO A;  2JZR A;  1OE8 A;  5D8I A;  2O85 A;  1X0R A;  4FH8 A;  5CRH A;  2CVB A;  3ZTL A;  4YAP A;  3VWU A;  2VCV A;  3MAK A;  5GZZ B;  1I9D A;  1WRY A;  1TDI A;  4OFM A;  2E2M A;  6GSS A;  4RI6 A;  3F8U A;  12GS A;  1O6J A;  2LKU A;  2DKI A;  4G0L A;  1ACV A;  2LUS A;  2CV4 A;  4K6X A;  2RUE A;  4OD7 A;  3GSS A;  2C3N A;  2WCI A;  5CRE A;  1T3B A;  2R3X A;  2O5V A;  3O76 A;  5A5H A;  5A5K A;  1AC1 A;  1TK0 B;  2O87 A;  1OKT A;  1XVQ A;  2PMT A;  3TRQ A;  3J7Y k;  2AAW A;  2KP2 A;  2A2R A;  2KP1 A;  1Z5Y E;  2LRT A;  2JSY A;  1PSQ A;  3F6F A;  3TDG A;  3IBH A;  4EIP A;  4JRR A;  4ECB A;  1B4Q A;  3VI7 A;  1G7E A;  1XFL A;  5BMU A;  4I97 A;  2VLT A;  3LGC A;  3HJP A;  3QCP A;  1F3A A;  2H66 A;  5EPF A;  3M1G A;  3I6A A;  2HRF A;  3TKS A;  2BMX A;  3GH9 A;  2C0E A;  3LOR A;  4HZ2 A;  3GRX A;  4IQ1 A;  4ECC A;  3ZRD A;  3DYR A;  2H73 A;  4GLT A;  1T00 A;  3KTB A;  2PUK C;  2E7P A;  3H79 A;  3MIX A;  2R6K A;  3D22 A;  4IP1 A;  1N25 A;  3KZQ A;  1GRX A;  4GST A;  1BQ7 A;  3D6I A;  3IC8 A;  5JWO B;  5BMU B;  1H4O A;  2A4H A;  1MDI A;  3E9J B;  4OCE A;  1S3C A;  1M9B A;  2H6Y A;  1XIY A;  2PU9 C;  2P31 A;  4TN8 A;  4MZW A;  1U3A A;  1EP8 A;  3L0H A;  2K8S A;  4EDZ A;  5ECQ B;  1XWK A;  3ME7 A;  5F07 A;  2EC4 A;  2QA1 A;  1BAY A;  3QFA C;  4GF0 A;  3D4M A;  2LRC A;  3CYN A;  1QGV A;  4POL A;  3CMI A;  4POB A;  1PD2 1;  2N5B A;  3DWV A;  4MH3 A;  4L5L A;  3FK8 A;  3HVX A;  2B6M A;  2L6D A;  4DSS A;  5G1L A;  5F8B A;  1ZOF A;  4N0V A;  1Z3E A;  4QL9 A;  4GQF A;  2GSR A;  2GQL A;  1JFU A;  2C0D A;  3Q18 A;  2HZE B;  2C1Y A;  2JSZ A;  5KOW A;  3ZL5 A;  1XOB A;  4DSR A;  1AQW A;  2QGV A;  2JL4 A;  3W6G A;  3W8S A;  1LJR A;  1YY7 A;  4I6X A;  3VFI A;  2FWF A;  4GCI A;  3FW2 A;  4I8B A;  5IM9 A;  2IMI A;  2HI7 A;  3HY2 A;  2HSM A;  4BWQ A;  1PRX A;  1XZO A;  1M99 A;  2H0I A;  5L71 A;  2H30 A;  2YWN A;  4KUN A;  2H1A A;  4XS1 A;  1Q4J A;  2IMD A;  2HT9 A;  5F0G A;  2MMN A;  4L0U A;  3GKM A;  2DJK A;  2VD1 A;  3S9F A;  1TRS A;  5IMV A;  3VPT A;  3WGD A;  3HJM A;  2PGT A;  2CVK A;  3C1R A;  5J9C A;  2GZP A;  2YJ7 A;  4K8M A;  1T8E B;  1ON4 A;  2XBI A;  3ZVJ D;  4GSS A;  1TXX A;  1AXD A;  1MD3 A;  4MJB A;  1GWC A;  3GYK A;  3C7M A;  2GDR A;  4KAE A;  4IHU A;  5B7C A;  2GZY A;  3ZIT A;  2HSH A;  4A5P A;  3UL3 A;  3QR6 A;  2VL9 A;  1GP1 A;  2EFD A;  3EU3 A;  2VD0 A;  2VKZ G;  1F37 A;  4EVM A;  3GKX A;  3TJB A;  1PX7 A;  1O85 A;  2JAC A;  2H75 A;  3C71 A;  1IYI A;  4NAX A;  4ILF A;  2XBQ A;  1TI3 A;  3D0Z A;  2WZ9 A;  2DC5 A;  4KX4 A;  4F0B A;  3EVI A;  3HZ8 A;  5AIX A;  4BWS A;  1DE2 A;  3MNG A;  2IIY A;  5H5S A;  2DML A;  19GS A;  1U87 A;  2UV8 G;  2KUC A;  3EU4 A;  1J0F A;  1THO A;  4OO5 A;  4DVC A;  5JWQ B;  3UAP A;  4ZIJ A;  3LQ7 A;  4TXO A;  4MLY A;  2VOC A;  2NDO A;  4HDE A;  4XHM A;  4MP4 A;  2GSS A;  4YH2 A;  3TUE A;  1AQX A;  1ZYN A;  1PKZ A;  1SJI A;  5DCH A;  4IQA A;  4BVY B;  1R7H A;  4E8E A;  1X9S B;  4KND A;  5CNW A;  1XW6 A;  5GAP D;  2OA7 A;  1FVJ A;  3TJG A;  2OE1 A;  3LEF A;  2PWJ A;  1A0R P;  4ACS A;  4QQ7 A;  2HYX A;  5J4V A;  1ZGN A;  4K1F A;  5A34 A;  4N11 A;  3F3R A;  3GL3 A;  4TR1 B;  2YNX A;  2X64 A;  1PN0 A;  2R0G A;  3PR8 A;  3RPP A;  2MZC A;  5LNK e;  5EVO A;  2NVL A;  3C8E A;  10GS A;  2ON7 A;  3UBK A;  2EIQ A;  5D9T A;  3SBC A;  3HJO A;  3LWA A;  4HU7 A;  2AV4 A;  3CBU A;  4HQS A;  3UBL A;  2O8V B;  1KBN A;  2DLX A;  5IMZ A;  3LG6 A;  3A2V A;  2VCW A;  2GQK A;  1RK4 A;  3UVT A;  2DJ0 A;  2X49 A;  3FZ5 A;  1B48 A;  3EWL A;  4WBR D;  1ILO A;  4G19 A;  2VCX A;  1XBS A;  1FOH A;  2PVQ A;  2HSN B;  3DML A;  3ZIV A;  4F82 A;  1A24 A;  2H6X A;  3FZA A;  2GVP A;  3Q6O A;  4EUY A;  2H6Z A;  3EUR A;  2DJ2 A;  3O3T A;  3ERW A;  3A2W A;  1IYH A;  3APO A;  5HFI A;  1WJK A;  1SKW B;  13GS A;  20GS A;  3GNJ A;  5ECH B;  6GST A;  1K0D A;  6GSX A;  3HA9 A;  1R5A A;  2C8U A;  2YN1 A;  2F3M A;  2H0G A;  2VCT A;  1GUL A;  2C0F A;  3EYT A;  2GT5 A;  3RDW A;  2V41 A;  2OBK A;  3MSZ A;  1DSB A;  1VGL A;  1X9M B;  4ZIL A;  1TXU A;  5A34 B;  1S3D A;  4ECJ A;  4OFN A;  3TKQ A;  4RQX A;  4KF9 A;  1PMT A;  5KEJ A;  1LBK A;  4Z2T A;  3CSI A;  3WYW A;  4D73 A;  4LMW A;  2WRT A;  5LD0 A;  1JLV A;  3U6V A;  4IVF A;  4WET A;  3M3M A;  2DJ1 A;  3LW9 A;  5DAL A;  5COH A;  1Y25 A;  4PGT A;  3QAG A;  1DBY A;  4ZB7 A;  5HR2 A;  3EC3 A;  4HU9 A;  3GV1 A;  1M2B A;  1OC3 A;  1W4V A;  2IPA A;  1SYX A;  2FY6 A;  3SWL A;  2CX3 A;  2FNO A;  4ZXG A;  1J9B A;  3KJY A;  2PPT A;  1MDJ A;  5J5N A;  3TJK A;  4I2T A;  3KMN A;  1K0M A;  4LLR A;  1EEJ A;  1QQ2 A;  2CAQ A;  2Z9S A;  4XS4 A;  4G10 A;  3PGT A;  3D5J A;  4RUV A;  1MTC A;  4F0C A;  1A2J A;  2YPM A;  1FVK A;  5EL8 A;  2R4V A;  3E0U A;  5DAK A;  5G31 A;  2CQ9 A;  4KDU A;  5AIS A;  1J08 A;  1K3Y A;  1FAA A;  4GTU A;  4YQU A;  1B9Y C;  1SYR A;  1YF1 A;  5ECM B;  4OMV A;  4KDY A;  3GA4 A;  4TVE A;  4MF7 A;  3FY7 A;  4EDY A;  4L0W A;  1QFN A;  2M46 A;  2B5E A;  4PUF C;  5J9B A;  1GSS A;  5KN3 A;  4MK3 A;  3IOS A;  2H71 A;  4V2N A;  2L5L A;  3OR5 A;  1RW1 A;  4WR4 A;  1SVO A;  1Z7R A;  2FCH A;  3LJR A;  5DAK B;  3FZ4 A;  4PUA A;  7GSS A;  2XC2 A;  1I5G A;  1V9W A;  3AY8 A;  3TKR A;  1ABA A;  2LNS A;  5A1N A;  3GHA A;  2DJJ A;  1XPV A;  1SK2 A;  3F4S A;  1XCC A;  1FB0 A;  3O6T A;  1YZX A;  5LCZ A;  2HRK A;  4P3Y B;  3DKS A;  2L57 A;  1GUM A;  5AN1 A;  4YAV A;  3UVH A;  4K5S A;  3HYP A;  5IMD A;  2RM5 A;  4N0Z A;  3GMF A;  4TR1 A;  1SK1 A;  4MPG A;  2NPB A;  1GUK A;  1XOA A;  4NPB A;  4ZL7 A;  1SVM A;  5ID2 A;  3GUS A;  4G0I A;  5EY6 A;  2DIZ A;  3KEB A;  1T4Y A;  1EWX A;  4ULX A;  3HXS A;  3DVW A;  2PN8 A;  3A2X A;  5ECN B;  4NV2 A;  1SEN A;  3EE2 A;  4ZB8 A;  3IC4 A;  1ML6 A;  1FG4 A;  1WE0 A;  4Q5F A;  2P0G A;  2YCD A;  1AIU A;  2HZF A;  4HOJ A;  1B9X C;  3H4K A;  2QA2 A;  5HFG A;  3VLN A;  2H1B A;  2MMZ A;  3H93 A;  1Y6E A;  1SKS B;  3EPT A;  4MH2 A;  3IHG A;  2IFQ A;  2FHE A;  1QMV A;  3LXT A;  2HRN A;  2ES7 A;  1X5D A;  4JU5 A;  1WOU A;  4AKG A;  2AUV A;  1KEB A;  1LU4 A;  2XPD A;  2X4A A;  4V2L A;  1FHE A;  5JCW A;  4ZBD A;  1BED A;  1W89 A;  2KOK A;  2V6K A;  4G2E A;  2FLS A;  4POM A;  2AB6 A;  4EE0 A;  1QUW A;  4XS6 A;  2IMF A;  4ZB6 A;  1EZK A;  3IV4 A;  4PUR A;  2HXK A;  5IMA A;  1VF4 A;  1O73 A;  5INY A;  2VIM A;  1URM A;  2E2G A;  2ZUP A;  4K5R A;  2R37 A;  4HS1 A;  1T4Z A;  2B7K A;  1M9A A;  1GUH A;  1QK8 A;  1YJ6 A;  3NIV A;  1FW1 A;  3APS A;  3DXB A;  6GSV A;  1ZYP A;  1GNE A;  2GGT A;  2CVD A;  2R0P A;  3M9K A;  4AJ6 A;  2CAI A;  5G30 A;  4ML1 A;  4F03 A;  4KSM A;  1UC7 A;  3TJJ A;  4FYC A;  2N5A A;  4MCU A;  4IKH A;  4FO5 A;  2R5G A;  4K9Z A;  2K9F A;  4WF4 A;  4JZQ A;  1A2M A;  1TRW A;  1F6M C;  1XVW A;  4FIW A;  5IOW A;  4TXO B;  1EOH A;  4HI7 A;  1NSW A;  4WKW A;  3HVS A;  3HVV A;  3FR6 A;  5DJL A;  2L6C A;  3TKP A;  2LEG A;  1PX6 A;  2OE3 A;  1F2E A;  3IR4 A;  1TTZ A;  3E3E A;  2HNL A;  2MBT A;  1JLW A;  2IMK A;  2C0G A;  5C00 A;  2LTK A;  3QOU A;  1NW2 A;  1K0C A;  4YKG A;  4DSQ A;  5B6M A;  4N3Z A;  1G7O A;  1F9M A;  2V1M A;  1X9W B;  4E8H A;  3H8Q A;  3PH9 A;  1KTE A;  2BTO T;  4NMU A;  4IGJ A;  1TU8 A;  5ELA A;  3WGX A;  2H70 A;  1YKC A;  2L4C A;  3ISO A;  4OCF A;  4G01 A;  3BOA A;  1M7T A;  3CXG A;  2OKA A;  3BBY A;  5FT3 A;  3R2Q A;  5GST A;  4L8E A;  4ECI A;  1A0F A;  1ERU A;  1RQM A;  3F0I A;  5A4V A;  3L9U A;  1PL1 A;  4EO3 A;  3KP8 A;  3F63 A;  2F8F A;  1FB6 A;  2WGR A;  1UVZ A;  4CY8 A;  5F05 A;  2VM2 A;  1K0A A;  1OC9 A;  2LRN A;  1XW5 A;  2IFQ B;  1QXH A;  2VCZ A;  1BG5 A;  4NHZ A;  5J47 A;  3IHQ A;  5CO3 A;  2YAN A;  1GNW A;  4ICY A;  1YQ1 A;  5IPG A;  4MZB A;  5C04 A;  5ECP B;  1B4P A;  1OYJ A;  3HKR A;  4Q5Q A;  3ZYW A;  5E4W A;  4MZC A;  5J4U A;  4GDF A;  2B1L A;  4TKY A;  2H1L A;  3F3Q A;  3LYP A;  3V1W A;  1AQV A;  2WJU A;  2I9H A;  3ZZX A;  5IMC A;  3ZFB A;  1H75 A;  1AUC A;  4XRA A;  5JCU A;  4MJA A;  1U3I A;  4WF5 A;  3TGZ A;  3TRP A;  1ST9 A;  5CYY A;  5JWR B;  3G7Y A;  4NHW A;  4MJE A;  3ZML A;  2A4V A;  4WBJ A;  4Z7X A;  3W8J A;  1SK0 A;  4PX1 A;  4IJ3 A;  5ELG A;  3UAR A;  4YQV A;  4BPY A;  4V1A g;  3TKS E;  1V2A A;  1JZR A;  4WXT A;  2DIY A;  4HJ2 A;  2YWI A;  2IL3 A;  5IPH A;  1XWC A;  4ISD A;  2F8A A;  4X43 A;  3BD2 A;  2F51 A;  5J4Y A;  3D4T A;  1T7P B;  5AGY A;  2LS5 A;  3LSZ A;  3GKN A;  5D9V A;  3TOT A;  2YP6 A;  4HQZ A;  4LL4 B;  1VRS D;  3L78 A;  4OWY A;  4O5R A;  2LJR A;  2FWE A;  5JCG A;  4MAB A;  5H5R A;  1SVL A;  1EGO A;  5A4W A;  4PXO A;  4KA0 A;  3QPM A;  3Q19 A;  4K0G A;  5J3R A;  1PKW A;  4EKZ A;  4TR0 A;  2VCQ A;  2JZT A;  4IS0 A;  1Q98 A;  3P2A A;  1Z6N A;  2HQT A;  3F4T A;  4IN0 A;  2YOI A;  2LST A;  1AAZ A;  1EV4 A;  4GQC A;  3QMX A;  4Q5R A;  1GSF A;  1GTI A;  3TOU A;  2MYG A;  3RHC A;  1M2A A;  1WMJ A;  1GSQ A;  4ZL8 A;  1OVN A;  1F3B A;  2D2Z A;  1CQG A;  2XPE A;  3FMW A;  3TB2 A;  1GSE A;  3KP9 A;  3IK7 A;  4AGS A;  1R4W A;  1A8L A;  3F4R A;  1OAZ A;  4G9H A;  5DAL B;  5ECO B;  3CSJ A;  3HZ4 A;  3US3 A;  1GLP A;  3BJ5 A;  3UJ1 A;  2YZH A;  2HLS A;  4EXJ A;  3I69 A;  3HHV A;  4BVX A;  5ECR B;  4KW6 A;  3RBT A;  4I2U A;  4IP6 A;  3UEM A;  2C3Q A;  2LQQ A;  3J7Y b;  1HNB A;  1V40 A;  3QAV A;  2L4Q A;  1OE7 A;  3HDC A;  4KDX A;  1U6T A;  4PQI A;  11GS A;  1YEP A;  4G0K A;  2YWO A;  3LFL A;  4XS4 B;  4MJC A;  5DBQ A;  4TRX A;  2HSN A;  2I81 A;  1GL8 A;  4MF5 A;  2DBC A;  3BCK A;  1EP7 A;  1N8J A;  5ABR A;  4ML6 A;  2B5Y A;  1G0T A;  2J9H A;  1M2D A;  4IEL A;  1WWJ A;  2C80 A;  2H19 A;  1V98 A;  3PPU A;  4MMM A;  1T1V A;  4Q5N A;  5D96 A;  2CZ2 A;  3TRX A;  2H0H A;  1R5P A;  2ALB A;  2HE3 A;  4Z2R A;  1TP9 A;  2R2J A;  4AJ8 A;  3WT1 A;  1C72 A;  4KGI A;  2FGX A;  1BG1 A;  1XWA A;  5IQY A;  2EFC A;  1K3L A;  2V6O A;  3KM6 A;  2M72 A;  3L4N A;  18GS A;  4F9Z A;  4JED A;  4POK A;  1R26 A;  2FD3 A;  4AKI A;  2CX4 A;  3TKS C;  3MDK A;  5HR3 A;  5KN1 A;  2FA4 A;  3G7I A;  3JCM L;  3GUR A;  2REM A;  4N10 A;  2RM6 A;  5FHI A;  4CY6 A;  1V58 A;  2P5Q A;  3P7X A;  3GN3 A;  2RII A;  4TXV A;  1TRV A;  4PNG A;  1DE1 A;  2H01 A;  4XCS A;  4HZ4 A;  3KMO A;  1MD4 A;  5GAN D;  1U88 A;  2LQO A;  6GSY A;  5CRG A;  3A3T A;  1EV9 A;  1NM3 A;  5GSS A;  4K2X A;  4LA1 A;  2QSI A;  5J41 A;  3IXR A;  1VF3 A;  3ME8 A;  2HRA A;  4JE1 A;  3GFK A;  4WR5 A;  4OFT A;  4ZL9 A;  5DDL A;  1BYE A;  1AW9 A;  2WFC A;  3FYG A;  2NTO A;  5A1N B;  5IOX A;  4XRD A;  3F6D A;  2N5F A;  1ZL9 A;  2H1G A;  4XIH A;  3QFB C;  3KH9 A;  2QC7 A;  1A8Y A;  3FZ9 A;  3KH7 A;  2I4A A;  5KN2 A;  1GLQ A;  4N30 A;  1A23 A;  1S3A A;  1TJD A;  2K8V A;  5D9X A;  5A5H B;  4J2F A;  4K2D A;  3H1N A;  1PA3 A;  2WDU A;  1FOV A;  3C1S A;  3P8W A;  2GQM A;  3VUR A;  3ZMK A;  2OAD A;  2ZCT A;  4TR4 A;  3DD3 A;  3FRC A;  3IK9 A;  3GKK A;  4V1A p;  4KB3 A;  3CTF A;  2VAF A;  1SD8 A;  3DEX A;  1YF0 A;  3CRU A;  3P90 A;  5B8A A;  1TKD B;  4X0X A;  4CDO A;  4K7O A;  2EFH A;  2GZZ A;  6GSU A;  3Q74 A;  4OO4 A;  3KTL A;  4NXI A;  2J23 A;  1SJZ A;  4TOP A;  2HZE A;  4KH7 A;  1JZW A;  4ZB9 A;  2TRX A;  4V2M A;  4AI6 A;  4FYB A;  4L5O A;  2OJL A;  1JZO A;  2TRC P;  2WB9 A;  2KLX A;  1GH2 A;  1GTU A;  3UOM A;  1O8X A;  5ECI B;  3KCM A;  2V32 A;  3DVX A;  4O92 A;  5ECS A;  2O89 A;  1HNA A;  1NHY A;  6GSW A;  2L5O A;  3BCI A;  3TJF A;  1BX9 A;  5KOX A;  1K3O A;  3APQ A;  2XHF A;  5IIZ A;  3L9V A;  5G2Z A;  4H86 A;  16GS A;  1YDK A;  2ZNM A;  3VWX A;  5DQY A;  2YJH A;  4USS A;  1PGT A;  5FWG A;  3M0F A;  5J40 A;  3QDN A;  2PBJ A;  1JZD A;  3KGK A;  4E68 A;  2IN3 A;  5B8B A;  2AYT A;  4W66 A;  2I3Y A;  2YV9 A;  1WPI A;  3FEU A;  1EOG A;  2YZU A;  4EL1 A;  5IO2 A;  1GSY A;  3EMX A;  4GXZ A;  2HFD A;  1TI1 A;  5D73 A;  2X99 A;  1THX A;  2GSQ A;  3I43 A;  4KCE A;  5IMF A;  2A2S A;  4F2I A;  4K7N A;  1X5C A;  1OKD A;  2HSM B;  2H76 A;  2FWH A;  3ZIJ A;  2CZ3 A;  4GWR A;  1B8X A;  5AIV A;  1YKA A;  4EF0 A;  3GH6 A;  3I9V 2;  4MF6 A;  5CP1 A;  1SJ6 A;  3ED3 A;  2YWM A;  4KSO A;  5HFK A;  1N2A A;  1ERV A;  2V2G A;  1GSU A;  2B7J A;  5HQP A;  1XWG A;  2EIR A;  4O5U A;  4Z2U A;  4QL7 A;  3DRN A;  3DIE A;  5G1K A;  2VL2 A;  4YQM A;  2JZS A;  4NV5 A;  2RLI A;  4IBP A;  3EMP A;  4JBB A;  1TK5 B;  3EIN A;  2ON5 A;  4BL7 A;  1NHO A;  2OAC A;  2QKE A;  3CTG A;  4HUA A;  4O5Q A;  5D93 A;  3VI5 A;  1MEK A;  3G9B A;  1HYU A;  1Z9H A;  2R0C A;  3HCZ A;  1USB A;  3IE3 A;  5E59 A;  2OBI A;  1JHB A;  1X5E A;  4ZBA A;  2DSA A;  1DUG A;  3M8N A;  3MWH A;  4HJM A;  2FWG A;  17GS A;  2GST A;  1PL2 A;  2O7K A;  2VUP A;  2WUL A;  3U5R E;  1GSD A;  4O7H A;  5IO0 A;  3GL5 A;  1A2L A;  2M80 A;  2C3T A;  3VK9 A;  4JR6 A;  3WGE A;  1M0U A;  4WEY A;  1UN2 A;  2JAD A;  2X8C A;  1K0N A;  5ID2 B;  5ECL B;  5ECK B;  2HSY A;  3CSH A;  2IME A;  5D9W A;  3UIW A;  4MDC A;  4MA9 A;  3ZVJ A;  1GTB A;  2VO4 A;  3GTU B;  2OE0 A;  1HNC A;  2PER A;  1SD9 A;  3FHK A;  3QD9 A;  2TIR A;  3GX8 A;  1XW9 A;  4O32 A;  1K0O A;  4XTS A;  2VM1 A;  2F9S A;  3GIX A;  9GSS A;  1E6B A;  2H1D A;  3FR9 A;  3WD6 A;  3PIN A;  14GS A;  4X4J A;  4DSS B;  5ENU A;  1ZYQ B;  2DKH A;  3C73 A;  1ZCP A;  2IJY A;  3GTU A;  3L9S A;  1SU9 A;  4GSN A;  2AHE A;  2AJQ B;  1TRU A;  2RUF A;  3N9J A;  4NWY A;  1ZZY A;  5CRD A;  3IDV A;  2DJ3 A;  2A2P A;  3R3E A;  3N5O A;  4MPF A;  3NZN A;  3LXZ A;  2G2Q A;  1G6Y A;  3IAM 2;  3UMA A;  2K18 A;  1TW9 A;  4CHS A;  5G5E A;  4BA7 A;  2GTU A;  1WIK A;  2YV7 A;  3GX0 A;  4HEA 2;  1TOF A;  3VPQ A;  2PVO C;  1ERT A;  3M9J A;  4AKH A;  4KE3 A;  3KXO A;  2GLR A;  4PNF A;  4YKF A;  1EGR A;  3ERF A;  1Z6M A;  2FUG 2;  22GS A;  3ZFL A;  2GT6 A;  3DGQ A;  3A5I A;  2UZ8 A;  2VL3 A;  5DVB A;  3ZRE A;  1FO5 A;  4PQ1 A;  4EC0 A;  4PQH A;  4BVY A;  3TU3 B;  3FKF A;  2E0Q A;  2G0F A;  4LMV A;  4FYU A;  3CWG A;  4PTS A;  3IPZ A;  1GTA A;  3MYD A;  1ZMA A;  3IA1 A;  1SL2 B;  8GSS A;  5CAX A;  1O8W A;  3FR3 A;  4EIQ A;  2DMM A;  1Z7P A;  4CW9 A;  2I1U A;  1O81 A;  4RI7 A;  1SL1 B;  2OT3 A;  4TR3 A;  2B1K A;  1ERW A;  1ZYE A;  3KD0 A;  3RHB A;  1TK8 B;  1TU7 A;  3IAS 2;  2CA8 A;  2MMA A;  4I5Q A;  3G7J A;  5HR0 A;  2B3S A;  4K7I A;  1WP0 A;  4JR4 A;  5A4U A;  1VF2 A;  5DJM A;  4KCA A;  4LL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...