4JZQA

Crystal structure of human clic1 c24d mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
237
structure length
237
Chain Sequence
QPQVELFVKAGSDGAKIGNDPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 1
publication title Crystal structure analysis of CLIC1 C24 mutants
rcsb
source organism Homo sapiens
total genus 82
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4jzqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4jzqA01
4K0NA 1GSSA 4CW9A 3KTBA 4ZB8A 4FYBA 4TKYA 2DSAA 2F8FA 3SBCA 4KX4A 5AIXA 1J08A 2CQ9A 5F0GA 1XZOA 3HVXA 4GSSA 3TCOA 5DDLA 2HSNB 5IMDA 1M9AA 3UEMA 3F3QA 3IAM2 4AF2A 1ZCPA 3TRQA 5H5QA 4TR1A 2E7PA 2FNOA 4EXJA 2HRFA 4QL9A 3DVXA 2VLUA 3RPPA 2EIOA 2B3SA 1BEDA 2CVDA 4KDXA 4NAXA 4TR3A 4FYUA 2H6ZA 1NSWA 3ERGA 3EINA 2ES7A 1M99A 5A4WA 3WGXA 3I69A 2QSIA 3FZ5A 5EPFA 2HSYA 4POMA 4V1Ap 2REMA 4X43A 3GSSA 1TI1A 1YKCA 5CP1A 1UC7A 2FHEA 2TRXA 2H74A 4IELA 1YKAA 4KDUA 2C0EA 4G0KA 1SK1A 1J9BA 5G5EA 3KJYA 8GSSA 2D2ZA 2LQOA 3WGDA 2QGVA 3QR6A 3H4KA 2LV3A 2LJKA 1K0NA 5HR1A 1U3AA 4TR1B 4IGJA 3FHKA 3DEXA 5EVOA 3JCML 4D73A 1KNGA 1DBYA 1T8EB 1Z7PA 2P31A 1T4YA 4K6XA 1XBSA 4IHUA 2P0GA 3ZMLA 4MZCA 1R5PA 2X8CA 1R5AA 2E2GA 4GLTA 4KAEA 3DMLA 3UMAA 5D9WA 4ECCA 4YQMA 1TKDB 2B6MA 2C3QA 1QK8A 2GSSA 13GSA 2XHFA 4TR0A 3APOA 4JR4A 3HCZA 3GX0A 5ECSA 3IDVA 2A2RA 4HZ2A 4WKWA 3C71A 4MLYA 1KTEA 5ECQB 6GSYA 3QMXA 4RUVA 3RAZA 3VI7A 5D9TA 2GSQA 3I9V2 3PPUA 4PNGA 3DGQA 3EURA 3TKSC 1Q98A 3GIXA 5ECIB 5HR2A 3A2XA 3U6VA 1SKRB 2EIQA 5G2ZA 3TKQA 1GTBA 2FLSA 2H76A 1CQGA 4ZL9A 3UAPA 3M9KA 2N5AA 1TP9A 4F9ZA 3TJGA 5ECKB 3QD9A 3IRAA 4D73B 2VL2C 1JZWA 3KP8A 4JR6A 5HFIA 4DEJA 1WE0A 4EF0A 2DLXA 2MBSA 5GZZB 1Z6MA 3C1SA 2KP1A 1EV4A 2DIZA 2V2GA 2GS3A 1UN2A 5ELGA 2QC7A 2NPBA 3FR6A 2VL3A 4JEDA 2H6YA 1BX9A 1RK4A 1AQWA 4K7OA 2FCHA 3R2QA 4TXOA 4IKHA 3UARA 1ON4A 2CV4A 3GL5A 3FR3A 2YCDA 3UJ1A 3BOAA 2V41A 3UIWA 4IVFA 2VCVA 2YV9A 2HFDA 2PVOC 3PR8A 2FY6A 4EUYA 2AUVA 2RLIA 2DBCA 2LS5A 3F6DA 5LCZA 1OC3A 1TRVA 3NZNA 3LORA 1X9WB 1A2LA 2MYGA 1GRXA 4MJBA 4I8BA 2JADA 4ZBBA 1Y25A 4X1UA 3MNGA 5B8AA 5G1LA 5KN0A 1X5EA 3UL3A 4HUAA 4L5OA 4OO5A 5BMUA 4XRDA 2GLRA 2HE3A 3WGEA 4OCFA 4QQ7A 3ZVJA 2H75A 1A2MA 4KGIA 1AUCA 2B1KA 1XVWA 2I4AA 1T00A 2LUSA 5IMZA 4TOPA 5DQSA 4F0BA 1GSQA 3LFLA 4EKZA 2G2QA 4GXZA 5A4UA 3IV4A 5CRDA 3IBHA 2B1LA 1K0CA 2H1BA 2PBJA 3IK7A 3EVIA 3P7XA 2H8LA 1YQ1A 3GV1A 2IMFA 4HQZA 4TXOB 1Z9HA 2H0HA 3TKRA 5G1KA 4ML6A 3HA9A 2DJ1A 4MP4A 4MF7A 1M0UA 5KN3A 2I1UA 5D73A 5CREA 4HDEA 4LL1B 1THOA 3G7JA 4WF5A 4KSMA 1EWXA 2HSMA 4KCEA 2CT6A 3KH7A 3RPNA 1H4OA 4OD7A 5ECLB 2PN8A 5HQPA 2DJJA 4MPGA 1UA5A 4GQFA 1VF1A 1XWCA 1A24A 2LKUA 4G9HA 3UBLA 1SL1B 5HFKA 2H71A 4MZBA 1TI3A 1XWKA 4ZB9A 1I9DA 3HJOA 3PINA 1FAAA 4PGTA 4FYCA 4HZ4A 1XIYA 4XRAA 4GRFA 3VWVA 4L5LA 1N2AA 1TK8B 1KBNA 1B9XC 1TXXA 3DWVA 2ALBA 2YN1A 1NHOA 1V9WA 4MDCA 3J7Yk 3TJJA 3G7IA 1XOBA 5DVBA 5ECNB 2HSHA 1IYHA 2Z9SA 4HQSA 2PWJA 3TDGA 3GKXA 2GZZA 3FZ9A 3VWWA 4ID0A 1GTAA 3ERWA 3ZIJA 3GH6A 4F82A 3CTGA 4NXIA 4JZQA 5E59A 2XBIA 1M2DA 2A4VA 3ZMKA 1GSYA 2GSRA 5L71A 5IO0A 1PL2A 4HU9A 2VLTA 3RHBA 2GVPA 2L5OA 3FYGA 1RW1A 5AGYA 2FWFA 5IMCA 3CTFA 5G30A 1GUHA 2NDOA 1AXDA 4NHWA 3D21A 3CMIA 1OKTA 1B4PA 2HSMB 1PN9A 2CZ2A 2GZPA 2VM1A 3H79A 2CVBA 1RQMA 4AJ6A 5IO2A 3W8SA 2R4VA 4JBBA 1V40A 3KZQA 4PQ1A 3W8JA 5ECPB 1ZYQB 3KGKA 4N0VA 2B5XA 2YOIA 1WPIA 6GSWA 3A3TA 5JCUA 3FKFA 5EY6A 4NWYA 1V98A 2KUCA 1ZOFA 3A2VA 1GSEA 6GSTA 2XPDA 4KB3A 2OE0A 3CRUA 1VRSD 4BPYA 1PKWA 3DYRA 4MH3A 2MBTA 2L6DA 4GQCA 4QL7A 3BCIA 3MSZA 3IC8A 1JZOA 4ZBAA 4OWYA 2RM5A 3VWUA 3E9JB 3P8WA 2YZUA 3CSHA 3D4MA 4KSOA 3M1GA 1F2EA 3RDWA 3TKSE 3CSJA 2O87A 3FEUA 1GP1A 2VAFA 4KUNA 2YZHA 3S9FA 3FY7A 5D9XA 2LRCA 4HS1A 4DSRA 5IPHA 1XW6A 5KN2A 4HJ2A 3ME7A 1QXHA 3MAKA 2E0QA 2C0DA 3H93A 3F4TA 1WJKA 2DMLA 1X5DA 4XIHA 3LYPA 3HXSA 5FT3A 1MD3A 6GSXA 4ISDA 3GSTA 1NHYA 3ZITA 5JWQB 3G7YA 2H72A 2OE3A 2MMAA 4OCEA 16GSA 3VI5A 2FA4A 2C4JA 4WBRD 1IYIA 1K0BA 2B5EA 1E6BA 2EIRA 1J0FA 2JSZA 11GSA 3HVVA 3DIEA 3EWLA 2M46A 2OACA 5B6NA 4KW6A 2K9FA 4MA9A 4H86A 1FVKA 5JWRB 2OE1A 5B8BA 3O76A 3HJMA 2IN3A 1KEBA 1Z7RA 2R3XA 1SL0B 3LJRA 4ZIJA 4NMUA 3L4NA 1K0AA 1F3BA 2AAWA 3D22A 2DMMA 1GSDA 2PGTA 2GQKA 3APSA 1F6MC 2H0GA 1FW1A 2WULA 2B7JA 2R2JA 3HYPA 1WRYA 1G7OA 3FZAA 2HYXA 1R7HA 5COHA 2K18A 2NBSA 4LLRA 3IHQA 1I5GA 1JZDA 3E3EA 1X9MB 3J7Yb 2LNTA 2FUG2 2LNSA 4ECJA 1AIUA 5J9CA 1B8XA 5FHIA 3CBUA 3D5JA 3C8EA 3UVHA 3L9UA 3ZRDA 3QFAC 2YWIA 1ZYEA 1M9BA 5IMVA 4XCSA 18GSA 1TTZA 2E2MA 3Q74A 3MWHA 4CHSA 3F4RA 4MPFA 2GT6A 2OA7A 3IE3A 4IN0A 3TGZA 4TRXA 3H8QA 3M9JA 3IK9A 2VCWA 4IBPA 5ELAA 4G19A 4Q5NA 3UVTA 5IMFA 4EDZA 2P5RA 1FG4A 5F05A 4OFTA 4MJCA 5KN1A 4MJEA 4MK3A 1V57A 4XS6A 5ECOB 4BA7A 2PU9C 3TRXA 1V58A 3W6GA 2FGXA 2V6OA 3APQA 1LBKA 4MF6A 1PL1A 4TVEA 1XPVA 1BG5A 2ZNMA 2EC4A 3D0ZA 4ZL8A 1JLVA 3GN3A 2RIIA 4FIWA 3QPMA 3I6AA 4HOJA 4BVXA 20GSA 1AAZA 2IJYA 3ED3A 2RM6A 1S3AA 4O7HA 1DE2A 4POKA 2WJUA 3QDNA 3US3A 5HR3A 1PX7A 1A0RP 2XPEA 4K8MA 2N5FA 5IOXA 5GAPD 5G5FA 2ON7A 3DD3A 5J3RA 4WBJA 3N9JA 3LGCA 1HQOA 3KTLA 5F06A 3NIVA 3IR4A 1AC1A 2C3NA 5G31A 1TK5B 1NW2A 3VURA 1A8LA 1XWBA 2LJRA 4ML1A 1PMTA 2LRTA 2GTUA 1MDJA 4GF0A 3KH9A 1LJRA 3PH9A 4WR4A 1T1VA 1TJDA 4Q5QA 1FO5A 1OKDA 2VLVA 3O3TA 2B5YA 5CAXA 1HD2A 3F4SA 3HD5A 4N11A 3RHCA 1OAZA 4ZBDA 2HZFA 4XHMA 4YQVA 4MABA 4EVMA 2HNLA 1T3BA 2HQTA 1HNBA 3Q18A 1O85A 3O6TA 4JU5A 3VLNA 3LSZA 5CRHA 3C73A 1QFNA 1JFUA 3IOSA 2LSTA 4OMVA 1WP0A 4RQRA 3GUSA 1G6WA 4BVXB 2KOKA 3M8NA 3KP9A 3ERFA 2M72A 4YH2A 1G7EA 4MJAA 2X8GA 3FZ4A 2I9HA 1DE1A 3GMFA 1YF0A 4PTSA 3ZIVA 4ILFA 4V1Ag 9GSSA 3LQ7A 2ZUPA 3BCKA 4GCIA 2IPAA 3TOUA 4YAPA 4AJ8A 2XC2A 5B7CA 3KIJA 4HJMA 4POLA 4MZWA 1PSQA 2WCIA 1TOFA 2HRNA 5EL8A 5F07A 1M2BA 4TR4A 3TUEA 5DAKA 2C0FA 6GSSA 3ZL5A 4PNFA 5F8BA 2VCTA 2AJQB 4RQXA 1XW9A 3RBTA 1TK0B 4XS1A 2H70A 2H01A 4I2TA 2OADA 4KE3A 6GSVA 3ZLPA 5J41A 4G2EA 1R4WA 2FD3A 2CZ3A 2VOCA 2OBKA 4I5QA 3MDKA 4P3YB 1G0TA 3PGTA 2LQQA 5DCGA 1OC8A 1YZXA 3EMPA 5J9BA 4XTSA 2C0GA 5A5KA 1EEMA 2AB6A 3KMNA 1SJ6A 1GTIA 10GSA 4YAVA 3D4TA 3IA1A 4RI6A 1X5CA 1U3IA 1SL2B 1FOVA 1TRUA 1HYUA 2G0FA 2WFCA 2C80A 2VCQA 1URMA 4J57E 2CX3A 4KDYA 4G0IA 1TRWA 4JE1A 1PX6A 2ZCTA 4HU7A 3LG6A 4G10A 1B48A 1WMJA 2CX4A 1YDKA 5CYYA 2H6XA 2FA8A 2N5BA 2C3TA 3EU4A 4NV2A 2H66A 5H5SA 2JU5A 4EO3A 2OJLA 5DAKB 4N30A 2FWHA 1TU7A 2IMIA 4PUFC 1VF2A 1SJIA 1BYEA 5KEJA 3VPTA 1JZRA 1MD4A 1VGLA 1OE8A 2PVQA 3FR9A 1B4QA 2I3YA 1WWJA 2DC5A 3GFKA 4GTUA 2CA8A 5HFGA 5ECRB 2H19A 3WD6A 2WGRA 1ILOA 3A2WA 3TJFA 1BAYA 2HZEA 2YANA 1ACVA 3ZZXA 2K8SA 1HNCA 14GSA 1K0MA 4KNDA 4KA0A 3UOMA 2FWEA 2HI7A 1M2AA 3U5RE 4Q5RA 3VK9A 4IP1A 1W4VA 3F9UA 3DVWA 3IXRA 3C7MA 1GSFA 3GNJA 2VM2A 1C72A 5HR0A 5DJMA 1GLPA 2VCXA 1FHEA 1M7TA 1AW9A 4MF5A 3HDCA 3QFBC 4F2IA 2M80A 2J9HA 3A5WA 5AIVA 3ZVJD 4ECIA 1QQ2A 3QAVA 2XBQA 3QCPA 4HI7A 3C1RA 3CXGA 1VF3A 1GWCA 5IMAA 4TW5A 1LU4A 2LEGA 1O8XA 1SKWB 1SK2A 1GULA 4IP6A 3L0HA 3FK8A 4TXVA 4AJ7A 1JHBA 5INYA 2VO4A 1TRSA 3DRNA 3GA4A 3EMXA 1OYJA 2AYTA 1ZMAA 5DJLA 5D96A 3BBYA 4NPBA 2IMDA 5C04A 1SD9A 2H1GA 5J5NA 5AISA 4N0ZA 2HZEB 4O92A 1GNWA 2JZSA 5D93A 1H75A 1YJ6A 2PPTA 2DJ3A 1K3LA 3KM6A 3GKMA 2HLSA 2LJAA 2V32A 2AV4A 2PMTA 1ERWA 1EOHA 2NTOA 4DSQA 1S3CA 2JZRA 2DIYA 2DJKA 2V1MA 4JRRA 2WDUA 4POBA 1K0DA 2DJ2A 4PUAA 3DXBA 4EDYA 2IMEA 1EP7A 1BQ7A 4PX1A 1EP8A 2DJ0A 3M3MA 4KCAA 4PQIA 3ZTLA 2OBIA 1ERVA 1T4ZA 3HZ4A 4LA1A 4LMVA 2KP2A 3F6FA 2V6KA 2RUFA 4KH7A 4E8HA 1THXA 2JL4A 4K7IA 7GSSA 1F3AA 1X9SB 3GYKA 5ENUA 3WYWA 3BD2A 2GSTA 1WOUA 2VD1A 5D9VA 5IOWA 5CRGA 1DUGA 3TJBA 5DALA 2F9SA 1OC9A 2MZCA 4V2NA 3LWAA 1SKSB 2KLXA 3F8UA 4IQAA 2H1DA 2GZYA 2CAQA 1A8YA 1O73A 1VF4A 3QAWA 2IL3A 4TN8A 1YEPA 2TRCP 1O81A 2P5QA 4BL7A 2H30A 5JWOB 1EGOA 4FQUA 1SYRA 1FB0A 2JACA 1Z3EA 3UBKA 2IIYA 1AQVA 4V2LA 1EV9A 2VIMA 3CRTA 2K8VA 3V1WA 4Z7XA 4G0LA 2H1AA 2MMOA 2O8VB 3ZFLA 2UZ8A 5AN1A 1YY7A 1PRXA 4PXOA 1PKZA 5ECHB 4L0UA 1TU8A 2YWMA 2GQMA 4K0GA 4IS0A 3VWXA 2WS2A 2RUEA 3ZYWA 2MMZA 4I97A 2O7KA 2HT9A 5H5RA 1Q4JA 4BWQA 4X0XA 2F51A 1USBA 2PUKC 4ECBA 1ERTA 2NVLA 1U88A 5IIZA 1K0OA 3GX8A 4N10A 3WT1A 3TKSA 3IC4A 3VFIA 2C8UA 2L57A 2GGTA 5CNWA 4ZL7A 3Q6OA 5DALB 2HRKA 6GSUA 5DBQA 1OC9B 3AY8A 3SWLA 4WXTA 4LMWA 1PD21 5DQYA 2VL9A 4K9ZA 2QKEA 2H0IA 4CDOA 2VL2A 4GWRA 2MMNA 1GH2A 3TJKA 3Q19A 3K8NA 1HNAA 3N5OA 4K2DA 4BL7B 2R5GA 3CSIA 2ON5A 2F8AA 1ZL9A 2JSYA 2TIRA 2IFQA 1O7UA 4BVYA 1UVZA 3ZREA 5IPGA 3FW2A 1SJZA 4DVCA 1MEKA 1EEJA 1A23A 3F0IA 4OFMA 1DSBA 1U6TA 4NV5A 3TKPA 3G9BA 1SU9A 3LXZA 3M0FA 3KD0A 3EC3A 3QOUA 2YWNA 1Z5YE 1XFLA 2LRNA 3CYNA 2L6CA 3LEFA 1O6JA 1K3OA 1OVNA 1XOAA 2X8HA 5E4WA 3KMOA 4DSSA 3KEBA 3P2AA 3VPQA 4LL4B 2O85A 2CAIA 3P90A 2VCZA 2BMXA 1GSUA 3TB2A 3GKKA 4AGSA 5IM9A 5JCGA 2LTKA 4J2FA 4WR5A 3BJ5A 1GNEA 3KXOA 4KF9A 4ZB6A 3FRCA 2YWOA 3EU3A 3TOTA 2HRKB 2J23A 4FO5A 3GURA 5GSTA 4ZILA 2X99A 3QAGA 3HJPA 4ACSA 2YNXA 1X0RA 1G6YA 2HRAA 3HZ8A 3EE2A 1XVQA 4FH8A 1F9MA 1MDKA 1GUMA 2OKAA 2IFQB 4IW9A 1QGVA 4BVYB 4F03A 1SYXA 1MDIA 4OFNA 2O89A 3KCMA 1S3DA 4BWSA 4I6XA 3LYKA 1Y6EA 5CRWA 2R37A 4GSNA 4IJIA 2BJXA 3HKRA 3LXTA 1QUWA 2I81A 2VUPA 2HXKA 5GSSA 4O5RA 3IPZA 1EOGA 3TRPA 3F3RA 1ZGNA 5CO3A 3H1NA 1ZZYA 4USSA 2GDRA 4DSSB 2GQLA 3I43A 1PA3A 4PQHA 1NM3A 5DCHA 1GLQA 1XXUA 5ECMB 3GKNA 2L4QA 4ULXA 2L5LA 4YQUA 19GSA 3GH9A 1GL8A 2KHPA 4MCUA 1JLWA 3L9SA 1ML6A 1MTCA 5C00A 2WZ9A 3OR5A 2L4CA 1F37A 1T7PB 2X64A 2B7KA 4IQ1A 3ME8A 3GTUA 1SK0A 2YPMA 1A0FA 2GT5A 4L0WA 4K7NA 4XS4A 12GSA 4I2UA 3EYTA 1XW5A 1PQNA 2F3MA 2WB9A 2L59A 22GSA 4J56E 1TW9A 1OE7A 1K3YA 1R26A 2YV7A 4F0CA 3IAS2 1EGRA 3ISOA 3HHVA 5ID2A 1EZKA 2BTOT 2YJ7A 4L8EA 2YP6A 2CVKA 4EL1A 1YEXA 17GSA 5B6MA 1TDIA 4MH2A 4ZXGA 3NOFA 4MMMA 2IWTA 5JCWA 4EC0A 4WF4A 1Z6NA 2H73A 2A2SA 2IMKA 4EE0A 1CQHA 1BJXA 4NHZA 1ERUA 3R3EA 3WT2A 3L78A 1E2YA 2WRTA 3HVSA 1XCCA 5IQYA 1V2AA 1XWAA 3L9VA 4O32A 1FVJA 1PGTA 3GHAA 1QMVA 3F63A 4PURA 2JZTA 1SENA 3D6IA 1W89A 5FWGA 4WEYA 3GTUB 5J4UA 1SD8A 2K6VA 2VD0A 4XS4B 3GRXA 4RI7A 4HEA2 1N8JA 5LNKe 3HY2A 1ST9A 1A2JA 4E8EA 3GL3A 5GAND 4V2MA 4GSTA 3E0UA 4IJ3A 4OO4A 5ID2B 1GTUA 5ABRA 1GUKA 3DKSA 2PERA 2R6KA 1O8WA 5D8IA 2C1YA 5LD0A 1YF1A 1U87A 1WIKA 5A4VA 2YJHA 1B9YC 4Q5FA 1XWGA 4K1FA 1ABAA 2FWGA 1FB6A 4WETA 1AQXA 3ZFBA 2AHEA
chains in the Genus database with same CATH superfamily
4K0NA 1GSSA 4CW9A 3KTBA 4ZB8A 4FYBA 4TKYA 2DSAA 2F8FA 3SBCA 2A2PA 4KX4A 4AKHA 5AIXA 1J08A 2CQ9A 5F0GA 1XZOA 3HVXA 4GSSA 3TCOA 5DDLA 2HSNB 5IMDA 1M9AA 3UEMA 3F3QA 3IAM2 4AF2A 1ZCPA 3TRQA 5H5QA 4TR1A 2E7PA 2FNOA 4EXJA 2HRFA 4QL9A 3DVXA 2VLUA 3RPPA 2EIOA 2B3SA 1BEDA 4FXYP 2CVDA 4KDXA 4NAXA 4TR3A 4FYUA 2H6ZA 1NSWA 3ERGA 3MIXA 3EINA 2ES7A 1M99A 5A4WA 3WGXA 3I69A 2QSIA 2WVYA 3FZ5A 5EPFA 2HSYA 4POMA 4V1Ap 2REMA 4X43A 3GSSA 1TI1A 1YKCA 5CP1A 1UC7A 2FHEA 2TRXA 2H74A 4IELA 1YKAA 4KDUA 2C0EA 4G0KA 1SK1A 1J9BA 5G5EA 1ZYNA 3KJYA 4YKGA 8GSSA 2D2ZA 2LQOA 3WGDA 2QGVA 3QR6A 3H4KA 2LV3A 2LJKA 1K0NA 5HR1A 2EFHA 1U3AA 4TR1B 4IGJA 3FHKA 3DEXA 5EVOA 3JCML 4D73A 1KNGA 1DBYA 1T8EB 1Z7PA 1M3IA 2P31A 1T4YA 4K6XA 1XBSA 4IHUA 2P0GA 3ZMLA 4MZCA 1R5PA 2X8CA 1R5AA 2E2GA 4GLTA 4KAEA 3DMLA 3UMAA 5D9WA 4ECCA 4AKXB 4YQMA 1TKDB 2B6MA 2C3QA 1QK8A 3MYDA 2GSSA 13GSA 2XHFA 4TR0A 3APOA 4JR4A 3HCZA 3GX0A 5ECSA 3IDVA 2A2RA 2WW1A 4HZ2A 4WKWA 3C71A 4MLYA 1SVMA 1KTEA 5ECQB 6GSYA 4AKIA 3QMXA 4RUVA 3RAZA 3VI7A 5D9TA 4CY8A 4BIKA 2GSQA 2O3EA 3I9V2 3PPUA 4PNGA 2DKIA 3DGQA 3EURA 3TKSC 1Q98A 3GIXA 5ECIB 5HR2A 3A2XA 3U6VA 2WW0A 2WW3A 1SKRB 2EIQA 5G2ZA 3TKQA 1GTBA 2FLSA 2H76A 1CQGA 4ZL9A 3UAPA 3M9KA 2N5AA 1TP9A 4F9ZA 3TJGA 5ECKB 3QD9A 3IRAA 4D73B 2VL2C 1JZWA 3KP8A 4JR6A 5HFIA 4DEJA 1WE0A 3IHGA 4EF0A 2DLXA 2MBSA 5GZZB 1Z6MA 3C1SA 2KP1A 1EV4A 2DIZA 4W66A 2V2GA 2GS3A 1UN2A 5ELGA 2QC7A 2NPBA 3FR6A 2VL3A 4JEDA 2H6YA 1BX9A 1RK4A 1AQWA 4K7OA 2FCHA 3R2QA 4TXOA 4IKHA 3UARA 1ON4A 2CV4A 3GL5A 3FR3A 2YCDA 3UJ1A 3BOAA 2V41A 3UIWA 4IVFA 2VCVA 2YV9A 2HFDA 2PVOC 3PR8A 2FY6A 4EUYA 2AUVA 2RLIA 2DBCA 2LS5A 3F6DA 5LCZA 1OC3A 1TRVA 3NZNA 3LORA 1X9WB 1A2LA 2MYGA 1GRXA 4MJBA 4I8BA 2JADA 4ZBBA 1Y25A 4X1UA 3MNGA 5B8AA 5G1LA 5KN0A 1X5EA 3UL3A 4HUAA 4L5OA 4OO5A 5BMUA 4XRDA 2GLRA 2HE3A 3WGEA 4OCFA 4QQ7A 3ZVJA 2H75A 1A2MA 4KGIA 1AUCA 2B1KA 1XVWA 2I4AA 1T00A 2LUSA 5IMZA 4TOPA 5DQSA 2R0CA 4F0BA 1GSQA 2DKHA 3LFLA 4EKZA 2G2QA 3RGBC 4GXZA 5A4UA 3IV4A 5CRDA 3IBHA 2B1LA 1K0CA 2H1BA 2PBJA 3IK7A 3EVIA 3P7XA 2H8LA 1YQ1A 3GV1A 2IMFA 4HQZA 4TXOB 1Z9HA 2H0HA 3TKRA 5G1KA 4ML6A 3HA9A 2DJ1A 4MP4A 4MF7A 2O5VA 1M0UA 5KN3A 2I1UA 2WVXA 5D73A 5CREA 4HDEA 4LL1B 1THOA 3G7JA 4WF5A 4KSMA 1EWXA 2HSMA 2OT3A 4KCEA 2CT6A 3KH7A 3RPNA 1H4OA 4OD7A 5ECLB 2PN8A 5HQPA 2DJJA 4MPGA 1UA5A 4GQFA 1VF1A 1XWCA 1A24A 2LKUA 2UV8G 4G9HA 3UBLA 1SL1B 5HFKA 2H71A 4MZBA 1TI3A 1XWKA 4ZB9A 1I9DA 3HJOA 3PINA 1FAAA 4PGTA 4FYCA 4HZ4A 5BMUB 1XIYA 4XRAA 4GRFA 3VWVA 4L5LA 1N2AA 1TK8B 1KBNA 1B9XC 1TXXA 3DWVA 2ALBA 2YN1A 1NHOA 1V9WA 4MDCA 3J7Yk 3TJJA 3G7IA 1XOBA 5DVBA 5ECNB 2HSHA 1IYHA 2Z9SA 4HQSA 2PWJA 3TDGA 3GKXA 2GZZA 3FZ9A 3VWWA 4ID0A 1GTAA 3ERWA 3ZIJA 3GH6A 4F82A 4AI6A 3CTGA 4NXIA 4JZQA 5E59A 2XBIA 1M2DA 2A4VA 3ZMKA 1GSYA 2GSRA 5L71A 5IO0A 1PL2A 4HU9A 2VLTA 3RHBA 2GVPA 2L5OA 3FYGA 1RW1A 5AGYA 2FWFA 5IMCA 3CTFA 5G30A 1GUHA 2NDOA 1AXDA 4NHWA 2WVXB 3D21A 3CMIA 1OKTA 1B4PA 2HSMB 1PN9A 2CZ2A 2GZPA 4MNNA 2VM1A 3H79A 2CVBA 1RQMA 4AJ6A 5IO2A 3W8SA 2R4VA 4JBBA 1V40A 3KZQA 4PQ1A 3W8JA 5ECPB 4Z2UA 1ZYQB 3KGKA 4N0VA 2B5XA 2YOIA 1WPIA 6GSWA 3A3TA 5JCUA 3FKFA 5EY6A 4NWYA 1V98A 2KUCA 1ZOFA 3A2VA 4GDFA 1GSEA 6GSTA 2XPDA 4KB3A 2OE0A 3CRUA 4O5UA 4YKFA 1VRSD 4BPYA 1PKWA 3DYRA 4MH3A 2MBTA 2L6DA 4GQCA 4QL7A 3BCIA 3MSZA 4O5QA 3IC8A 1JZOA 4ZBAA 4OWYA 2RM5A 3VWUA 3E9JB 3P8WA 2YZUA 3CSHA 3D4MA 4KSOA 3M1GA 1F2EA 3RDWA 3TKSE 4G01A 3CSJA 2O87A 3FEUA 1GP1A 2VAFA 4KUNA 2YZHA 3S9FA 3FY7A 5D9XA 2LRCA 4HS1A 4DSRA 5IPHA 1XW6A 2X49A 5KN2A 4HJ2A 3ME7A 1QXHA 3MAKA 2E0QA 2C0DA 3H93A 3F4TA 1WJKA 2DMLA 1X5DA 4XIHA 5J4YA 3LYPA 3HXSA 5FT3A 1MD3A 6GSXA 4ISDA 3GSTA 1NHYA 3ZITA 5JWQB 3G7YA 2H72A 2OE3A 2MMAA 4OCEA 16GSA 3VI5A 2FA4A 2C4JA 4WBRD 1IYIA 1K0BA 2B5EA 1E6BA 2EIRA 1J0FA 2JSZA 11GSA 3HVVA 3DIEA 3EWLA 3TU3B 4QMKA 2M46A 2QA2A 2OACA 5B6NA 4KW6A 2K9FA 4MA9A 4H86A 1FVKA 5JWRB 2OE1A 5B8BA 3O76A 3HJMA 2IN3A 1KEBA 1Z7RA 2R3XA 1SL0B 3LJRA 4ZIJA 4NMUA 1BG1A 3L4NA 1K0AA 1F3BA 2AAWA 3D22A 3HMJG 2DMMA 1GSDA 2PGTA 2GQKA 3APSA 1F6MC 2H0GA 1FW1A 1S3RA 2WW2A 2WULA 2B7JA 2R2JA 3HYPA 1WRYA 1G7OA 3FZAA 2HYXA 1R7HA 5COHA 2K18A 2NBSA 4LLRA 3IHQA 1I5GA 1JZDA 3E3EA 1X9MB 3J7Yb 2LNTA 2FUG2 2LNSA 4ECJA 1AIUA 5J9CA 1B8XA 5FHIA 3CBUA 2R0PA 3D5JA 3C8EA 3UVHA 3L9UA 3CHXC 3ZRDA 3QFAC 2YWIA 1ZYEA 1M9BA 5IMVA 4XCSA 18GSA 1TTZA 2E2MA 3Q74A 3MWHA 4CHSA 3F4RA 4MPFA 2GT6A 2OA7A 3IE3A 4A5PA 4IN0A 3TGZA 4TRXA 3H8QA 3M9JA 3IK9A 4X4JA 2VCWA 4IBPA 5ELAA 4G19A 4Q5NA 3UVTA 5IMFA 4EDZA 2P5RA 1FG4A 2QA1A 5F05A 4OFTA 4MJCA 5KN1A 4MJEA 4MK3A 1V57A 4XS6A 5J4VA 5ECOB 4BA7A 2PU9C 3TRXA 1V58A 4EIQA 3W6GA 2FGXA 2V6OA 3APQA 1LBKA 4MF6A 1PL1A 4TVEA 1XPVA 1BG5A 2ZNMA 2EC4A 3D0ZA 4ZL8A 1JLVA 3GN3A 2RIIA 4FIWA 3QPMA 3I6AA 4HOJA 4E68A 4BVXA 20GSA 1AAZA 1XG8A 2IJYA 1TXUA 3ED3A 2RM6A 1S3AA 4O7HA 1DE2A 4POKA 2WJUA 3QDNA 3US3A 5HR3A 1PX7A 1A0RP 2XPEA 4K8MA 2N5FA 5A5HA 5IOXA 5GAPD 5G5FA 2ON7A 3DD3A 5J3RA 4WBJA 3N9JA 3LGCA 1HQOA 3KTLA 5F06A 3NIVA 3IR4A 1AC1A 2C3NA 5G31A 1YEWC 1TK5B 1NW2A 3VURA 1A8LA 1XWBA 2LJRA 4ML1A 1PMTA 2LRTA 2GTUA 1MDJA 4GF0A 3KH9A 1LJRA 3PH9A 4WR4A 1T1VA 1TJDA 1BF5A 4Q5QA 1FO5A 1OKDA 2VLVA 3O3TA 2B5YA 5CAXA 1HD2A 3F4SA 3HD5A 4N11A 3RHCA 1OAZA 4ZBDA 2HZFA 4XHMA 4YQVA 4MABA 4EVMA 2HNLA 1T3BA 2HQTA 1S4BP 1HNBA 3Q18A 1O85A 3O6TA 4JU5A 3VLNA 3LSZA 5CRHA 3C73A 1QFNA 1JFUA 3IOSA 2LSTA 4OMVA 1WP0A 4RQRA 3GUSA 1G6WA 4BVXB 2KOKA 3M8NA 3KP9A 3ERFA 2M72A 4YH2A 1G7EA 1ZYPA 4MJAA 2X8GA 3FZ4A 2WZSA 2I9HA 1DE1A 3GMFA 1YF0A 4PTSA 3ZIVA 4ILFA 4V1Ag 9GSSA 5A5HB 3LQ7A 2ZUPA 3BCKA 4GCIA 2IPAA 3TOUA 4YAPA 4AJ8A 2XC2A 5B7CA 3KIJA 4HJMA 4POLA 4MZWA 1PSQA 2WCIA 1TOFA 2HRNA 5EL8A 1M3JA 5F07A 1M2BA 4TR4A 3TUEA 5DAKA 2C0FA 4PHZC 6GSSA 3ZL5A 4PNFA 5F8BA 2VCTA 4CY6A 2AJQB 3RFRC 4RQXA 1XW9A 3RBTA 1TK0B 4N3ZA 4XS1A 2H70A 2H01A 4I2TA 2OADA 4KE3A 6GSVA 3ZLPA 5J41A 4G2EA 1R4WA 2FD3A 2CZ3A 2VOCA 2OBKA 4I5QA 3MDKA 4P3YB 5J47A 5KOWA 1G0TA 3PGTA 2LQQA 5DCGA 1OC8A 1YZXA 3EMPA 5J9BA 4XTSA 2C0GA 5A5KA 1EEMA 2AB6A 3KMNA 1SJ6A 1GTIA 10GSA 4YAVA 3D4TA 3IA1A 4RI6A 1X5CA 1U3IA 1SL2B 1FOVA 1TRUA 1HYUA 2G0FA 2WFCA 2C80A 2VCQA 1URMA 4J57E 2CX3A 4KDYA 4G0IA 1TRWA 4JE1A 1PX6A 2ZCTA 4HU7A 3LG6A 4G10A 1B48A 1WMJA 2CX4A 1YDKA 5CYYA 2H6XA 2FA8A 2N5BA 2C3TA 3EU4A 4NV2A 2H66A 5H5SA 2JU5A 4EO3A 2OJLA 5DAKB 4N30A 2FWHA 1TU7A 2IMIA 4PUFC 1VF2A 1SJIA 1BYEA 3CQFA 5KEJA 3VPTA 1JZRA 1MD4A 1VGLA 1OE8A 2PVQA 3FR9A 1B4QA 2I3YA 1WWJA 2DC5A 3GFKA 4GTUA 2CA8A 5HFGA 5ECRB 2H19A 3WD6A 2WGRA 1ILOA 3A2WA 3TJFA 1BAYA 2HZEA 2YANA 1ACVA 3ZZXA 2K8SA 1HNCA 14GSA 1K0MA 4KNDA 4KA0A 3UOMA 2FWEA 2HI7A 1M2AA 3U5RE 4Q5RA 3VK9A 4IP1A 1W4VA 3F9UA 3DVWA 3IXRA 5A34A 3C7MA 1GSFA 3GNJA 2VM2A 1C72A 5HR0A 5DJMA 1GLPA 2VCXA 1FHEA 1M7TA 1AW9A 4MF5A 3HDCA 3QFBC 4F2IA 2M80A 2J9HA 3A5WA 5AIVA 3ZVJD 4Z2RA 4ECIA 1QQ2A 3QAVA 2XBQA 3QCPA 4HI7A 4AKGA 3C1RA 3CXGA 1VF3A 1GWCA 5IMAA 4TW5A 4ZB7A 1LU4A 2LEGA 1O8XA 1SKWB 1SK2A 1GULA 4IP6A 3L0HA 3FK8A 4TXVA 4AJ7A 1JHBA 5INYA 2VO4A 1TRSA 3DRNA 3GA4A 3EMXA 1OYJA 2AYTA 1ZMAA 5DJLA 5D96A 3BBYA 4NPBA 2IMDA 5C04A 1SD9A 2H1GA 5J5NA 5AISA 4N0ZA 2HZEB 4O92A 1GNWA 2JZSA 5D93A 5A1NA 2R0GA 1H75A 1YJ6A 2PPTA 2DJ3A 1K3LA 3KM6A 3GKMA 2HLSA 2LJAA 2V32A 2AV4A 2PMTA 4PI0C 1ERWA 1N25A 1EOHA 5A34B 2NTOA 4DSQA 1S3CA 2JZRA 2DIYA 2DJKA 2V1MA 4JRRA 2WDUA 4POBA 1K0DA 2DJ2A 4PUAA 3DXBA 4EDYA 2IMEA 1EP7A 1BQ7A 4PX1A 1EP8A 2DJ0A 3M3MA 4KCAA 4PQIA 3ZTLA 1PFOA 2OBIA 1ERVA 1T4ZA 3HZ4A 4LA1A 4LMVA 2KP2A 3F6FA 2V6KA 2RUFA 4KH7A 4E8HA 1THXA 2JL4A 4K7IA 7GSSA 1F3AA 1X9SB 3GYKA 5ENUA 3WYWA 3BD2A 2GSTA 4ICYA 1WOUA 2VD1A 5D9VA 5IOWA 5CRGA 1DUGA 3A5IA 3TJBA 5DALA 2F9SA 1OC9A 2MZCA 4V2NA 3LWAA 1SKSB 2KLXA 3F8UA 4IQAA 2H1DA 2GZYA 2CAQA 1A8YA 1O73A 1VF4A 3QAWA 2IL3A 5A1NB 4TN8A 1YEPA 2TRCP 1O81A 2P5QA 4BL7A 2EFCA 2H30A 5JWOB 5KOXA 1EGOA 4FQUA 1SYRA 1FB0A 2JACA 1Z3EA 1I1IP 3UBKA 2IIYA 2WVZA 1AQVA 4V2LA 1EV9A 2VIMA 3CRTA 2K8VA 3V1WA 4Z7XA 4G0LA 2H1AA 2MMOA 2O8VB 3ZFLA 1SVLA 2UZ8A 5AN1A 1YY7A 1PRXA 4PXOA 1PKZA 5ECHB 4L0UA 1TU8A 2YWMA 2GQMA 4K0GA 4IS0A 3VWXA 2WS2A 2RUEA 4EIPA 3ZYWA 2MMZA 4I97A 2O7KA 2HT9A 5H5RA 1Q4JA 4BWQA 4X0XA 4K2XA 2F51A 1USBA 2PUKC 4ECBA 1ERTA 2NVLA 1U88A 5IIZA 1K0OA 3GX8A 4N10A 3WT1A 3TKSA 3IC4A 3VFIA 2C8UA 2L57A 2GGTA 5CNWA 4ZL7A 3Q6OA 5DALB 2HRKA 6GSUA 5DBQA 1OC9B 3AY8A 3SWLA 4WXTA 4LMWA 1PD21 5DQYA 2VL9A 4K9ZA 2QKEA 2H0IA 4CDOA 2VL2A 4GWRA 2MMNA 1GH2A 3TJKA 3Q19A 3K8NA 1HNAA 3N5OA 4K2DA 4BL7B 2R5GA 3CSIA 2ON5A 2F8AA 1ZL9A 2JSYA 2TIRA 2IFQA 1O7UA 4BVYA 1UVZA 3ZREA 5IPGA 3FW2A 5J40A 1SJZA 4DVCA 1MEKA 1EEJA 3HVNA 4PI2C 1A23A 3F0IA 4OFMA 2H1LA 1DSBA 1U6TA 4NV5A 3TKPA 3G9BA 1SU9A 3LXZA 3M0FA 1FOHA 3KD0A 3EC3A 3QOUA 3CWGA 2YWNA 1Z5YE 1XFLA 2LRNA 3CYNA 2L6CA 3LEFA 1O6JA 1K3OA 1OVNA 1XOAA 2X4AA 2X8HA 5E4WA 3KMOA 4DSSA 3KEBA 3P2AA 3VPQA 4LL4B 2O85A 2CAIA 3P90A 2VCZA 2BMXA 1GSUA 3TB2A 3GKKA 4AGSA 5IM9A 5JCGA 2LTKA 4J2FA 4WR5A 3BJ5A 1GNEA 3KXOA 4KF9A 4ZB6A 3FRCA 2YWOA 3EU3A 3TOTA 2HRKB 2J23A 4FO5A 3GURA 5GSTA 4ZILA 2X99A 3QAGA 3HJPA 4ACSA 2YNXA 1X0RA 1G6YA 2HRAA 3HZ8A 3EE2A 1XVQA 4FH8A 1F9MA 1MDKA 1GUMA 2OKAA 2IFQB 4IW9A 1QGVA 4BVYB 4F03A 1SYXA 1MDIA 4OFNA 2O89A 3KCMA 1S3DA 4BWSA 4I6XA 3FMWA 1Y6EA 1YVLA 3LYKA 5CRWA 2R37A 4GSNA 4IJIA 2BJXA 3HKRA 3LXTA 1QUWA 2I81A 2VUPA 2HXKA 5GSSA 2VKZG 4O5RA 3IPZA 1EOGA 3TRPA 3F3RA 1ZGNA 5CO3A 3H1NA 1ZZYA 4USSA 2GDRA 4DSSB 2GQLA 3I43A 1PA3A 4PQHA 1NM3A 5DCHA 1GLQA 4K5SA 1XXUA 5BRTA 5ECMB 1PN0A 2L4QA 3GKNA 4ULXA 2L5LA 4YQUA 19GSA 2EFDA 3GH9A 2O36A 1GL8A 2KHPA 4MCUA 1JLWA 3L9SA 1ML6A 1MTCA 5C00A 2WZ9A 3OR5A 2L4CA 1F37A 1SVOA 3LW9A 1T7PB 2X64A 2B7KA 4IQ1A 3ME8A 3GTUA 1SK0A 2YPMA 1A0FA 2GT5A 4L0WA 4K7NA 4XS4A 12GSA 4I2UA 3EYTA 1XW5A 1PQNA 2F3MA 2WB9A 2L59A 22GSA 2A4HA 4J56E 1TW9A 1OE7A 4HSCX 1K3YA 1R26A 2YV7A 4F0CA 3IAS2 1EGRA 3ISOA 3HHVA 5ID2A 1EZKA 2BTOT 2YJ7A 4L8EA 2YP6A 1Y1UA 2CVKA 4EL1A 1YEXA 17GSA 5B6MA 1TDIA 4MH2A 4Z2TA 4ZXGA 3NOFA 4MMMA 2IWTA 5JCWA 4EC0A 4WF4A 4K5RA 1Z6NA 2H73A 2A2SA 2IMKA 4EE0A 1CQHA 1BJXA 4NHZA 1ERUA 2EFEA 3R3EA 3WT2A 3L78A 1E2YA 2WRTA 2HSNA 3HVSA 1XCCA 5IQYA 1V2AA 1XWAA 3L9VA 4O32A 1FVJA 1PGTA 3GHAA 1QMVA 3F63A 4PURA 2JZTA 1SENA 3D6IA 1W89A 5FWGA 4WEYA 3GTUB 5J4UA 1SD8A 2K6VA 2VD0A 4XS4B 3GRXA 4RI7A 4HEA2 1N8JA 5LNKe 3HY2A 1ST9A 1A2JA 4E8EA 3GL3A 5GAND 4V2MA 4GSTA 3E0UA 4IJ3A 4OO4A 5ID2B 1GTUA 3EPTA 5ABRA 1GUKA 3DKSA 2PERA 2R6KA 1O8WA 5D8IA 2C1YA 5LD0A 1YF1A 1U87A 1WIKA 5A4VA 2YJHA 1B9YC 4Q5FA 1XWGA 4K1FA 1ABAA 2FWGA 1FB6A 4WETA 1AQXA 3ZFBA 2AHEA
chains in the Genus database with same CATH topology
4K0NA 1GSSA 4CW9A 3KTBA 4ZB8A 4FYBA 4TKYA 2DSAA 2F8FA 3SBCA 2A2PA 4KX4A 4AKHA 5AIXA 1J08A 2CQ9A 5F0GA 1XZOA 3HVXA 4GSSA 3TCOA 5DDLA 2HSNB 5IMDA 1M9AA 3UEMA 3F3QA 3IAM2 4AF2A 1ZCPA 3TRQA 5H5QA 4TR1A 2E7PA 2FNOA 4EXJA 2HRFA 4QL9A 3DVXA 2VLUA 3RPPA 2EIOA 2B3SA 1BEDA 2CVDA 4KDXA 4NAXA 4TR3A 4FYUA 2H6ZA 1NSWA 3ERGA 3MIXA 3EINA 2ES7A 1M99A 5A4WA 3WGXA 3I69A 2QSIA 3FZ5A 5EPFA 2HSYA 4POMA 4V1Ap 2REMA 4X43A 3GSSA 1TI1A 1YKCA 5CP1A 1UC7A 2FHEA 2TRXA 2H74A 4IELA 1YKAA 4KDUA 2C0EA 4G0KA 1SK1A 1J9BA 5G5EA 1ZYNA 3KJYA 4YKGA 8GSSA 2D2ZA 2LQOA 3WGDA 2QGVA 3QR6A 3H4KA 2LV3A 2LJKA 1K0NA 5HR1A 2EFHA 1U3AA 4TR1B 4IGJA 3FHKA 3DEXA 5EVOA 3JCML 4D73A 1KNGA 1DBYA 1T8EB 1Z7PA 2P31A 1T4YA 4K6XA 1XBSA 4IHUA 2P0GA 3ZMLA 4MZCA 1R5PA 2X8CA 1R5AA 2E2GA 4GLTA 4KAEA 3DMLA 3UMAA 5D9WA 4ECCA 4AKXB 4YQMA 1TKDB 2B6MA 3MYDA 2C3QA 1QK8A 2GSSA 13GSA 2XHFA 4TR0A 3APOA 4JR4A 3HCZA 3GX0A 5ECSA 3IDVA 2A2RA 4HZ2A 4WKWA 3C71A 4MLYA 1SVMA 1KTEA 5ECQB 6GSYA 4AKIA 3QMXA 4RUVA 3RAZA 3VI7A 5D9TA 4CY8A 2GSQA 3I9V2 3PPUA 4PNGA 2DKIA 3DGQA 3EURA 3TKSC 1Q98A 3GIXA 5ECIB 5HR2A 3A2XA 3U6VA 1SKRB 2EIQA 5G2ZA 3TKQA 1GTBA 2FLSA 2H76A 1CQGA 4ZL9A 3UAPA 3M9KA 2N5AA 1TP9A 4F9ZA 3TJGA 5ECKB 3QD9A 3IRAA 4D73B 2VL2C 1JZWA 3KP8A 4JR6A 5HFIA 4DEJA 1WE0A 3IHGA 4EF0A 2DLXA 2MBSA 5GZZB 1Z6MA 3C1SA 2KP1A 1EV4A 2DIZA 4W66A 2V2GA 2GS3A 1UN2A 5ELGA 2QC7A 2NPBA 3FR6A 2VL3A 4JEDA 2H6YA 1BX9A 1RK4A 1AQWA 4K7OA 2FCHA 3R2QA 4TXOA 4IKHA 3UARA 1ON4A 2CV4A 3GL5A 3FR3A 2YCDA 3UJ1A 3BOAA 2V41A 3UIWA 4IVFA 2VCVA 2YV9A 2HFDA 2PVOC 3PR8A 2FY6A 4EUYA 2AUVA 2RLIA 2DBCA 2LS5A 3F6DA 5LCZA 1OC3A 1TRVA 3NZNA 3LORA 1X9WB 1A2LA 2MYGA 1GRXA 4MJBA 4I8BA 2JADA 4ZBBA 1Y25A 4X1UA 3MNGA 5B8AA 5G1LA 5KN0A 1X5EA 3UL3A 4HUAA 4L5OA 4OO5A 5BMUA 4XRDA 2GLRA 2HE3A 3WGEA 4OCFA 4QQ7A 3ZVJA 2H75A 1A2MA 4KGIA 1AUCA 2B1KA 1XVWA 2I4AA 1T00A 2LUSA 5IMZA 4TOPA 5DQSA 2R0CA 4F0BA 1GSQA 2DKHA 3LFLA 4EKZA 2G2QA 4GXZA 5A4UA 3IV4A 5CRDA 3IBHA 2B1LA 1K0CA 2H1BA 2PBJA 3IK7A 3EVIA 3P7XA 2H8LA 1YQ1A 3GV1A 2IMFA 4HQZA 4TXOB 1Z9HA 2H0HA 3TKRA 5G1KA 4ML6A 3HA9A 2DJ1A 4MP4A 4MF7A 2O5VA 1M0UA 5KN3A 2I1UA 5D73A 5CREA 4HDEA 4LL1B 1THOA 3G7JA 4WF5A 4KSMA 1EWXA 2HSMA 2OT3A 4KCEA 2CT6A 3KH7A 3RPNA 1H4OA 4OD7A 5ECLB 2PN8A 5HQPA 2DJJA 4MPGA 1UA5A 4GQFA 1VF1A 1XWCA 1A24A 2LKUA 2UV8G 4G9HA 3UBLA 1SL1B 5HFKA 2H71A 4MZBA 1TI3A 1XWKA 4ZB9A 1I9DA 3HJOA 3PINA 1FAAA 4PGTA 4FYCA 4HZ4A 5BMUB 1XIYA 4XRAA 4GRFA 3VWVA 4L5LA 1N2AA 1TK8B 1KBNA 1B9XC 1TXXA 3DWVA 2ALBA 2YN1A 1NHOA 1V9WA 4MDCA 3J7Yk 3TJJA 3G7IA 1XOBA 5DVBA 5ECNB 2HSHA 1IYHA 2Z9SA 4HQSA 2PWJA 3TDGA 3GKXA 2GZZA 3FZ9A 3VWWA 4ID0A 1GTAA 3ERWA 3ZIJA 3GH6A 4F82A 4AI6A 3CTGA 4NXIA 4JZQA 5E59A 2XBIA 1M2DA 2A4VA 3ZMKA 1GSYA 2GSRA 5L71A 5IO0A 1PL2A 4HU9A 2VLTA 3RHBA 2GVPA 2L5OA 3FYGA 1RW1A 5AGYA 2FWFA 5IMCA 3CTFA 5G30A 1GUHA 2NDOA 1AXDA 4NHWA 3D21A 3CMIA 1OKTA 1B4PA 2HSMB 1PN9A 2CZ2A 2GZPA 4MNNA 2VM1A 3H79A 2CVBA 1RQMA 4AJ6A 5IO2A 3W8SA 2R4VA 4JBBA 1V40A 3KZQA 4PQ1A 3W8JA 5ECPB 4Z2UA 1ZYQB 3KGKA 4N0VA 2B5XA 2YOIA 1WPIA 6GSWA 3A3TA 5JCUA 3FKFA 5EY6A 4NWYA 1V98A 2KUCA 1ZOFA 3A2VA 4GDFA 1GSEA 6GSTA 2XPDA 4KB3A 2OE0A 3CRUA 4O5UA 4YKFA 1VRSD 4BPYA 1PKWA 3DYRA 4MH3A 2MBTA 2L6DA 4GQCA 4QL7A 3BCIA 3MSZA 4O5QA 3IC8A 1JZOA 4ZBAA 4OWYA 2RM5A 3VWUA 3E9JB 3P8WA 2YZUA 3CSHA 3D4MA 4KSOA 3M1GA 1F2EA 3RDWA 3TKSE 4G01A 3CSJA 2O87A 3FEUA 1GP1A 2VAFA 4KUNA 2YZHA 3S9FA 3FY7A 5D9XA 2LRCA 4HS1A 4DSRA 5IPHA 1XW6A 2X49A 5KN2A 4HJ2A 3ME7A 1QXHA 3MAKA 2E0QA 2C0DA 3H93A 3F4TA 1WJKA 2DMLA 1X5DA 4XIHA 5J4YA 3LYPA 3HXSA 5FT3A 1MD3A 6GSXA 4ISDA 3GSTA 1NHYA 3ZITA 5JWQB 3G7YA 2H72A 2OE3A 2MMAA 4OCEA 16GSA 3VI5A 2FA4A 2C4JA 4WBRD 1IYIA 1K0BA 2B5EA 1E6BA 2EIRA 1J0FA 2JSZA 11GSA 3HVVA 3DIEA 3EWLA 3TU3B 4QMKA 2M46A 2QA2A 2OACA 5B6NA 4KW6A 2K9FA 4MA9A 4H86A 1FVKA 5JWRB 2OE1A 5B8BA 3O76A 3HJMA 2IN3A 1KEBA 1Z7RA 2R3XA 1SL0B 3LJRA 4ZIJA 4NMUA 1BG1A 3L4NA 1K0AA 1F3BA 2AAWA 3D22A 3HMJG 2DMMA 1GSDA 2PGTA 2GQKA 3APSA 1F6MC 2H0GA 1FW1A 2WULA 2B7JA 2R2JA 3HYPA 1WRYA 1G7OA 3FZAA 2HYXA 1R7HA 5COHA 2K18A 2NBSA 4LLRA 3IHQA 1I5GA 1JZDA 3E3EA 1X9MB 3J7Yb 2LNTA 2FUG2 2LNSA 4ECJA 1AIUA 5J9CA 1B8XA 5FHIA 3CBUA 2R0PA 3D5JA 3C8EA 3UVHA 3L9UA 3ZRDA 3QFAC 2YWIA 1ZYEA 1M9BA 5IMVA 4XCSA 18GSA 1TTZA 2E2MA 3Q74A 3MWHA 4CHSA 3F4RA 4MPFA 2GT6A 2OA7A 3IE3A 4A5PA 4IN0A 3TGZA 4TRXA 3H8QA 3M9JA 3IK9A 4X4JA 2VCWA 4IBPA 5ELAA 4G19A 4Q5NA 3UVTA 5IMFA 4EDZA 2P5RA 1FG4A 2QA1A 5F05A 4OFTA 4MJCA 5KN1A 4MJEA 4MK3A 1V57A 4XS6A 5J4VA 5ECOB 4BA7A 2PU9C 3TRXA 1V58A 4EIQA 3W6GA 2FGXA 2V6OA 3APQA 1LBKA 4MF6A 1PL1A 4TVEA 1XPVA 1BG5A 2ZNMA 2EC4A 3D0ZA 4ZL8A 1JLVA 3GN3A 2RIIA 4FIWA 3QPMA 3I6AA 4HOJA 4E68A 4BVXA 20GSA 1AAZA 2IJYA 1TXUA 3ED3A 2RM6A 1S3AA 4O7HA 1DE2A 4POKA 2WJUA 3QDNA 3US3A 5HR3A 1PX7A 1A0RP 2XPEA 4K8MA 2N5FA 5A5HA 5IOXA 5GAPD 5G5FA 2ON7A 3DD3A 5J3RA 4WBJA 3N9JA 3LGCA 1HQOA 3KTLA 5F06A 3NIVA 3IR4A 1AC1A 2C3NA 5G31A 1TK5B 1NW2A 3VURA 1A8LA 1XWBA 2LJRA 4ML1A 1PMTA 2LRTA 2GTUA 1MDJA 4GF0A 3KH9A 1LJRA 3PH9A 4WR4A 1T1VA 1TJDA 1BF5A 4Q5QA 1FO5A 1OKDA 2VLVA 3O3TA 2B5YA 5CAXA 1HD2A 3F4SA 3HD5A 4N11A 3RHCA 1OAZA 4ZBDA 2HZFA 4XHMA 4YQVA 4MABA 4EVMA 2HNLA 1T3BA 2HQTA 1HNBA 3Q18A 1O85A 3O6TA 4JU5A 3VLNA 3LSZA 5CRHA 3C73A 1QFNA 1JFUA 3IOSA 2LSTA 4OMVA 1WP0A 4RQRA 3GUSA 1G6WA 4BVXB 2KOKA 3M8NA 3KP9A 3ERFA 2M72A 4YH2A 1G7EA 1ZYPA 4MJAA 2X8GA 3FZ4A 2I9HA 1DE1A 3GMFA 1YF0A 4PTSA 3ZIVA 4ILFA 4V1Ag 9GSSA 5A5HB 3LQ7A 2ZUPA 3BCKA 4GCIA 2IPAA 3TOUA 4YAPA 4AJ8A 2XC2A 5B7CA 3KIJA 4HJMA 4POLA 4MZWA 1PSQA 2WCIA 1TOFA 2HRNA 5EL8A 5F07A 1M2BA 4TR4A 3TUEA 5DAKA 2C0FA 6GSSA 3ZL5A 4PNFA 5F8BA 2VCTA 4CY6A 2AJQB 4RQXA 1XW9A 3RBTA 1TK0B 4N3ZA 4XS1A 2H70A 2H01A 4I2TA 2OADA 4KE3A 6GSVA 3ZLPA 5J41A 4G2EA 1R4WA 2FD3A 2CZ3A 2VOCA 2OBKA 4I5QA 3MDKA 4P3YB 5J47A 5KOWA 1G0TA 3PGTA 2LQQA 5DCGA 1OC8A 1YZXA 3EMPA 5J9BA 4XTSA 2C0GA 5A5KA 1EEMA 2AB6A 3KMNA 1SJ6A 1GTIA 10GSA 4YAVA 3D4TA 3IA1A 4RI6A 1X5CA 1U3IA 1SL2B 1FOVA 1TRUA 1HYUA 2G0FA 2WFCA 2C80A 2VCQA 1URMA 4J57E 2CX3A 4KDYA 4G0IA 1TRWA 4JE1A 1PX6A 2ZCTA 4HU7A 3LG6A 4G10A 1B48A 1WMJA 2CX4A 1YDKA 5CYYA 2H6XA 2FA8A 2N5BA 2C3TA 3EU4A 4NV2A 2H66A 5H5SA 2JU5A 4EO3A 2OJLA 5DAKB 4N30A 2FWHA 1TU7A 2IMIA 4PUFC 1VF2A 1SJIA 1BYEA 5KEJA 3VPTA 1JZRA 1MD4A 1VGLA 1OE8A 2PVQA 3FR9A 1B4QA 2I3YA 1WWJA 2DC5A 3GFKA 4GTUA 2CA8A 5HFGA 5ECRB 2H19A 3WD6A 2WGRA 1ILOA 3A2WA 3TJFA 1BAYA 2HZEA 2YANA 1ACVA 3ZZXA 2K8SA 1HNCA 14GSA 1K0MA 4KNDA 4KA0A 3UOMA 2FWEA 2HI7A 1M2AA 3U5RE 4Q5RA 3VK9A 4IP1A 1W4VA 3F9UA 3DVWA 3IXRA 5A34A 3C7MA 1GSFA 3GNJA 2VM2A 1C72A 5HR0A 5DJMA 1GLPA 2VCXA 1FHEA 1M7TA 1AW9A 4MF5A 3HDCA 3QFBC 4F2IA 2M80A 2J9HA 3A5WA 5AIVA 3ZVJD 4Z2RA 4ECIA 1QQ2A 3QAVA 2XBQA 3QCPA 4HI7A 4AKGA 3C1RA 3CXGA 1VF3A 1GWCA 5IMAA 4TW5A 4ZB7A 1LU4A 2LEGA 1O8XA 1SKWB 1SK2A 1GULA 4IP6A 3L0HA 3FK8A 4TXVA 4AJ7A 1JHBA 5INYA 2VO4A 1TRSA 3DRNA 3GA4A 3EMXA 1OYJA 2AYTA 1ZMAA 5DJLA 5D96A 3BBYA 4NPBA 2IMDA 5C04A 1SD9A 2H1GA 5J5NA 5AISA 4N0ZA 2HZEB 4O92A 1GNWA 2JZSA 5D93A 5A1NA 2R0GA 1H75A 1YJ6A 2PPTA 2DJ3A 1K3LA 3KM6A 3GKMA 2HLSA 2LJAA 2V32A 2AV4A 2PMTA 1ERWA 1N25A 1EOHA 5A34B 2NTOA 4DSQA 1S3CA 2JZRA 2DIYA 2DJKA 2V1MA 4JRRA 2WDUA 4POBA 1K0DA 2DJ2A 4PUAA 3DXBA 4EDYA 2IMEA 1EP7A 1BQ7A 4PX1A 1EP8A 2DJ0A 3M3MA 4KCAA 4PQIA 3ZTLA 2OBIA 1ERVA 1T4ZA 3HZ4A 4LA1A 4LMVA 2KP2A 3F6FA 2V6KA 2RUFA 4KH7A 4E8HA 1THXA 2JL4A 4K7IA 7GSSA 1F3AA 1X9SB 3GYKA 5ENUA 3WYWA 3BD2A 2GSTA 4ICYA 1WOUA 2VD1A 5D9VA 5IOWA 5CRGA 1DUGA 3A5IA 3TJBA 5DALA 2F9SA 1OC9A 2MZCA 4V2NA 3LWAA 1SKSB 2KLXA 3F8UA 4IQAA 2H1DA 2GZYA 2CAQA 1A8YA 1O73A 1VF4A 3QAWA 2IL3A 5A1NB 4TN8A 1YEPA 2TRCP 1O81A 2P5QA 4BL7A 2EFCA 2H30A 5JWOB 5KOXA 1EGOA 4FQUA 1SYRA 1FB0A 2JACA 1Z3EA 3UBKA 2IIYA 1AQVA 4V2LA 1EV9A 2VIMA 3CRTA 2K8VA 3V1WA 4Z7XA 4G0LA 2H1AA 2MMOA 2O8VB 3ZFLA 1SVLA 2UZ8A 5AN1A 1YY7A 1PRXA 4PXOA 1PKZA 5ECHB 4L0UA 1TU8A 2YWMA 2GQMA 4K0GA 4IS0A 3VWXA 2WS2A 2RUEA 4EIPA 3ZYWA 2MMZA 4I97A 2O7KA 2HT9A 5H5RA 1Q4JA 4BWQA 4X0XA 4K2XA 2F51A 1USBA 2PUKC 4ECBA 1ERTA 2NVLA 1U88A 5IIZA 1K0OA 3GX8A 4N10A 3WT1A 3TKSA 3IC4A 3VFIA 2C8UA 2L57A 2GGTA 5CNWA 4ZL7A 3Q6OA 5DALB 2HRKA 6GSUA 5DBQA 1OC9B 3AY8A 3SWLA 4WXTA 4LMWA 1PD21 5DQYA 2VL9A 4K9ZA 2QKEA 2H0IA 4CDOA 2VL2A 4GWRA 2MMNA 1GH2A 3TJKA 3Q19A 3K8NA 1HNAA 3N5OA 4K2DA 4BL7B 2R5GA 3CSIA 2ON5A 2F8AA 1ZL9A 2JSYA 2TIRA 2IFQA 1O7UA 4BVYA 1UVZA 3ZREA 5IPGA 3FW2A 5J40A 1SJZA 4DVCA 1MEKA 1EEJA 1A23A 3F0IA 4OFMA 2H1LA 1DSBA 1U6TA 4NV5A 3TKPA 3G9BA 1SU9A 3LXZA 3M0FA 1FOHA 3KD0A 3EC3A 3QOUA 3CWGA 2YWNA 1Z5YE 1XFLA 2LRNA 3CYNA 2L6CA 3LEFA 1O6JA 1K3OA 1OVNA 1XOAA 2X4AA 2X8HA 5E4WA 3KMOA 4DSSA 3KEBA 3P2AA 3VPQA 4LL4B 2O85A 2CAIA 3P90A 2VCZA 2BMXA 1GSUA 3TB2A 3GKKA 4AGSA 5IM9A 5JCGA 2LTKA 4J2FA 4WR5A 3BJ5A 1GNEA 3KXOA 4KF9A 4ZB6A 3FRCA 2YWOA 3EU3A 3TOTA 2HRKB 2J23A 4FO5A 3GURA 5GSTA 4ZILA 2X99A 3QAGA 3HJPA 4ACSA 2YNXA 1X0RA 1G6YA 2HRAA 3HZ8A 3EE2A 1XVQA 4FH8A 1F9MA 1MDKA 1GUMA 2OKAA 2IFQB 4IW9A 1QGVA 4BVYB 4F03A 1SYXA 1MDIA 4OFNA 2O89A 3KCMA 1S3DA 4BWSA 4I6XA 3FMWA 3LYKA 1Y6EA 1YVLA 5CRWA 2R37A 4GSNA 4IJIA 2BJXA 3HKRA 3LXTA 1QUWA 2I81A 2VUPA 2HXKA 5GSSA 2VKZG 4O5RA 3IPZA 1EOGA 3TRPA 3F3RA 1ZGNA 5CO3A 3H1NA 1ZZYA 4USSA 2GDRA 4DSSB 2GQLA 3I43A 1PA3A 4PQHA 1NM3A 5DCHA 1GLQA 4K5SA 1XXUA 5BRTA 5ECMB 1PN0A 2L4QA 3GKNA 4ULXA 2L5LA 4YQUA 19GSA 2EFDA 3GH9A 1GL8A 2KHPA 4MCUA 1JLWA 3L9SA 1ML6A 1MTCA 5C00A 2WZ9A 3OR5A 2L4CA 1F37A 1SVOA 3LW9A 1T7PB 2X64A 2B7KA 4IQ1A 3ME8A 3GTUA 1SK0A 2YPMA 1A0FA 2GT5A 4L0WA 4K7NA 4XS4A 12GSA 4I2UA 3EYTA 1XW5A 1PQNA 2F3MA 2WB9A 2L59A 22GSA 2A4HA 4J56E 1TW9A 1OE7A 1K3YA 1R26A 2YV7A 4F0CA 3IAS2 1EGRA 3ISOA 3HHVA 5ID2A 1EZKA 2BTOT 2YJ7A 4L8EA 2YP6A 1Y1UA 2CVKA 4EL1A 1YEXA 17GSA 5B6MA 1TDIA 4MH2A 4Z2TA 4ZXGA 3NOFA 4MMMA 2IWTA 5JCWA 4EC0A 4WF4A 4K5RA 1Z6NA 2H73A 2A2SA 2IMKA 4EE0A 1CQHA 1BJXA 4NHZA 1ERUA 2EFEA 3R3EA 3WT2A 3L78A 1E2YA 2WRTA 2HSNA 3HVSA 1XCCA 5IQYA 1V2AA 1XWAA 3L9VA 4O32A 1FVJA 1PGTA 3GHAA 1QMVA 3F63A 4PURA 2JZTA 1SENA 3D6IA 1W89A 5FWGA 4WEYA 3GTUB 5J4UA 1SD8A 2K6VA 2VD0A 4XS4B 3GRXA 4RI7A 4HEA2 1N8JA 5LNKe 3HY2A 1ST9A 1A2JA 4E8EA 3GL3A 5GAND 4V2MA 4GSTA 3E0UA 4IJ3A 4OO4A 5ID2B 1GTUA 3EPTA 5ABRA 1GUKA 3DKSA 2PERA 2R6KA 1O8WA 5D8IA 2C1YA 5LD0A 1YF1A 1U87A 1WIKA 5A4VA 2YJHA 1B9YC 4Q5FA 1XWGA 4K1FA 1ABAA 2FWGA 1FB6A 4WETA 1AQXA 3ZFBA 2AHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0N A;  1GSS A;  4CW9 A;  3KTB A;  4ZB8 A;  4FYB A;  4TKY A;  2DSA A;  2F8F A;  3SBC A;  4KX4 A;  5AIX A;  1J08 A;  2CQ9 A;  5F0G A;  1XZO A;  3HVX A;  4GSS A;  3TCO A;  5DDL A;  2HSN B;  5IMD A;  1M9A A;  3UEM A;  3F3Q A;  3IAM 2;  4AF2 A;  1ZCP A;  3TRQ A;  5H5Q A;  4TR1 A;  2E7P A;  2FNO A;  4EXJ A;  2HRF A;  4QL9 A;  3DVX A;  2VLU A;  3RPP A;  2EIO A;  2B3S A;  1BED A;  2CVD A;  4KDX A;  4NAX A;  4TR3 A;  4FYU A;  2H6Z A;  1NSW A;  3ERG A;  3EIN A;  2ES7 A;  1M99 A;  5A4W A;  3WGX A;  3I69 A;  2QSI A;  3FZ5 A;  5EPF A;  2HSY A;  4POM A;  4V1A p;  2REM A;  4X43 A;  3GSS A;  1TI1 A;  1YKC A;  5CP1 A;  1UC7 A;  2FHE A;  2TRX A;  2H74 A;  4IEL A;  1YKA A;  4KDU A;  2C0E A;  4G0K A;  1SK1 A;  1J9B A;  5G5E A;  3KJY A;  8GSS A;  2D2Z A;  2LQO A;  3WGD A;  2QGV A;  3QR6 A;  3H4K A;  2LV3 A;  2LJK A;  1K0N A;  5HR1 A;  1U3A A;  4TR1 B;  4IGJ A;  3FHK A;  3DEX A;  5EVO A;  3JCM L;  4D73 A;  1KNG A;  1DBY A;  1T8E B;  1Z7P A;  2P31 A;  1T4Y A;  4K6X A;  1XBS A;  4IHU A;  2P0G A;  3ZML A;  4MZC A;  1R5P A;  2X8C A;  1R5A A;  2E2G A;  4GLT A;  4KAE A;  3DML A;  3UMA A;  5D9W A;  4ECC A;  4YQM A;  1TKD B;  2B6M A;  2C3Q A;  1QK8 A;  2GSS A;  13GS A;  2XHF A;  4TR0 A;  3APO A;  4JR4 A;  3HCZ A;  3GX0 A;  5ECS A;  3IDV A;  2A2R A;  4HZ2 A;  4WKW A;  3C71 A;  4MLY A;  1KTE A;  5ECQ B;  6GSY A;  3QMX A;  4RUV A;  3RAZ A;  3VI7 A;  5D9T A;  2GSQ A;  3I9V 2;  3PPU A;  4PNG A;  3DGQ A;  3EUR A;  3TKS C;  1Q98 A;  3GIX A;  5ECI B;  5HR2 A;  3A2X A;  3U6V A;  1SKR B;  2EIQ A;  5G2Z A;  3TKQ A;  1GTB A;  2FLS A;  2H76 A;  1CQG A;  4ZL9 A;  3UAP A;  3M9K A;  2N5A A;  1TP9 A;  4F9Z A;  3TJG A;  5ECK B;  3QD9 A;  3IRA A;  4D73 B;  2VL2 C;  1JZW A;  3KP8 A;  4JR6 A;  5HFI A;  4DEJ A;  1WE0 A;  4EF0 A;  2DLX A;  2MBS A;  5GZZ B;  1Z6M A;  3C1S A;  2KP1 A;  1EV4 A;  2DIZ A;  2V2G A;  2GS3 A;  1UN2 A;  5ELG A;  2QC7 A;  2NPB A;  3FR6 A;  2VL3 A;  4JED A;  2H6Y A;  1BX9 A;  1RK4 A;  1AQW A;  4K7O A;  2FCH A;  3R2Q A;  4TXO A;  4IKH A;  3UAR A;  1ON4 A;  2CV4 A;  3GL5 A;  3FR3 A;  2YCD A;  3UJ1 A;  3BOA A;  2V41 A;  3UIW A;  4IVF A;  2VCV A;  2YV9 A;  2HFD A;  2PVO C;  3PR8 A;  2FY6 A;  4EUY A;  2AUV A;  2RLI A;  2DBC A;  2LS5 A;  3F6D A;  5LCZ A;  1OC3 A;  1TRV A;  3NZN A;  3LOR A;  1X9W B;  1A2L A;  2MYG A;  1GRX A;  4MJB A;  4I8B A;  2JAD A;  4ZBB A;  1Y25 A;  4X1U A;  3MNG A;  5B8A A;  5G1L A;  5KN0 A;  1X5E A;  3UL3 A;  4HUA A;  4L5O A;  4OO5 A;  5BMU A;  4XRD A;  2GLR A;  2HE3 A;  3WGE A;  4OCF A;  4QQ7 A;  3ZVJ A;  2H75 A;  1A2M A;  4KGI A;  1AUC A;  2B1K A;  1XVW A;  2I4A A;  1T00 A;  2LUS A;  5IMZ A;  4TOP A;  5DQS A;  4F0B A;  1GSQ A;  3LFL A;  4EKZ A;  2G2Q A;  4GXZ A;  5A4U A;  3IV4 A;  5CRD A;  3IBH A;  2B1L A;  1K0C A;  2H1B A;  2PBJ A;  3IK7 A;  3EVI A;  3P7X A;  2H8L A;  1YQ1 A;  3GV1 A;  2IMF A;  4HQZ A;  4TXO B;  1Z9H A;  2H0H A;  3TKR A;  5G1K A;  4ML6 A;  3HA9 A;  2DJ1 A;  4MP4 A;  4MF7 A;  1M0U A;  5KN3 A;  2I1U A;  5D73 A;  5CRE A;  4HDE A;  4LL1 B;  1THO A;  3G7J A;  4WF5 A;  4KSM A;  1EWX A;  2HSM A;  4KCE A;  2CT6 A;  3KH7 A;  3RPN A;  1H4O A;  4OD7 A;  5ECL B;  2PN8 A;  5HQP A;  2DJJ A;  4MPG A;  1UA5 A;  4GQF A;  1VF1 A;  1XWC A;  1A24 A;  2LKU A;  4G9H A;  3UBL A;  1SL1 B;  5HFK A;  2H71 A;  4MZB A;  1TI3 A;  1XWK A;  4ZB9 A;  1I9D A;  3HJO A;  3PIN A;  1FAA A;  4PGT A;  4FYC A;  4HZ4 A;  1XIY A;  4XRA A;  4GRF A;  3VWV A;  4L5L A;  1N2A A;  1TK8 B;  1KBN A;  1B9X C;  1TXX A;  3DWV A;  2ALB A;  2YN1 A;  1NHO A;  1V9W A;  4MDC A;  3J7Y k;  3TJJ A;  3G7I A;  1XOB A;  5DVB A;  5ECN B;  2HSH A;  1IYH A;  2Z9S A;  4HQS A;  2PWJ A;  3TDG A;  3GKX A;  2GZZ A;  3FZ9 A;  3VWW A;  4ID0 A;  1GTA A;  3ERW A;  3ZIJ A;  3GH6 A;  4F82 A;  3CTG A;  4NXI A;  4JZQ A;  5E59 A;  2XBI A;  1M2D A;  2A4V A;  3ZMK A;  1GSY A;  2GSR A;  5L71 A;  5IO0 A;  1PL2 A;  4HU9 A;  2VLT A;  3RHB A;  2GVP A;  2L5O A;  3FYG A;  1RW1 A;  5AGY A;  2FWF A;  5IMC A;  3CTF A;  5G30 A;  1GUH A;  2NDO A;  1AXD A;  4NHW A;  3D21 A;  3CMI A;  1OKT A;  1B4P A;  2HSM B;  1PN9 A;  2CZ2 A;  2GZP A;  2VM1 A;  3H79 A;  2CVB A;  1RQM A;  4AJ6 A;  5IO2 A;  3W8S A;  2R4V A;  4JBB A;  1V40 A;  3KZQ A;  4PQ1 A;  3W8J A;  5ECP B;  1ZYQ B;  3KGK A;  4N0V A;  2B5X A;  2YOI A;  1WPI A;  6GSW A;  3A3T A;  5JCU A;  3FKF A;  5EY6 A;  4NWY A;  1V98 A;  2KUC A;  1ZOF A;  3A2V A;  1GSE A;  6GST A;  2XPD A;  4KB3 A;  2OE0 A;  3CRU A;  1VRS D;  4BPY A;  1PKW A;  3DYR A;  4MH3 A;  2MBT A;  2L6D A;  4GQC A;  4QL7 A;  3BCI A;  3MSZ A;  3IC8 A;  1JZO A;  4ZBA A;  4OWY A;  2RM5 A;  3VWU A;  3E9J B;  3P8W A;  2YZU A;  3CSH A;  3D4M A;  4KSO A;  3M1G A;  1F2E A;  3RDW A;  3TKS E;  3CSJ A;  2O87 A;  3FEU A;  1GP1 A;  2VAF A;  4KUN A;  2YZH A;  3S9F A;  3FY7 A;  5D9X A;  2LRC A;  4HS1 A;  4DSR A;  5IPH A;  1XW6 A;  5KN2 A;  4HJ2 A;  3ME7 A;  1QXH A;  3MAK A;  2E0Q A;  2C0D A;  3H93 A;  3F4T A;  1WJK A;  2DML A;  1X5D A;  4XIH A;  3LYP A;  3HXS A;  5FT3 A;  1MD3 A;  6GSX A;  4ISD A;  3GST A;  1NHY A;  3ZIT A;  5JWQ B;  3G7Y A;  2H72 A;  2OE3 A;  2MMA A;  4OCE A;  16GS A;  3VI5 A;  2FA4 A;  2C4J A;  4WBR D;  1IYI A;  1K0B A;  2B5E A;  1E6B A;  2EIR A;  1J0F A;  2JSZ A;  11GS A;  3HVV A;  3DIE A;  3EWL A;  2M46 A;  2OAC A;  5B6N A;  4KW6 A;  2K9F A;  4MA9 A;  4H86 A;  1FVK A;  5JWR B;  2OE1 A;  5B8B A;  3O76 A;  3HJM A;  2IN3 A;  1KEB A;  1Z7R A;  2R3X A;  1SL0 B;  3LJR A;  4ZIJ A;  4NMU A;  3L4N A;  1K0A A;  1F3B A;  2AAW A;  3D22 A;  2DMM A;  1GSD A;  2PGT A;  2GQK A;  3APS A;  1F6M C;  2H0G A;  1FW1 A;  2WUL A;  2B7J A;  2R2J A;  3HYP A;  1WRY A;  1G7O A;  3FZA A;  2HYX A;  1R7H A;  5COH A;  2K18 A;  2NBS A;  4LLR A;  3IHQ A;  1I5G A;  1JZD A;  3E3E A;  1X9M B;  3J7Y b;  2LNT A;  2FUG 2;  2LNS A;  4ECJ A;  1AIU A;  5J9C A;  1B8X A;  5FHI A;  3CBU A;  3D5J A;  3C8E A;  3UVH A;  3L9U A;  3ZRD A;  3QFA C;  2YWI A;  1ZYE A;  1M9B A;  5IMV A;  4XCS A;  18GS A;  1TTZ A;  2E2M A;  3Q74 A;  3MWH A;  4CHS A;  3F4R A;  4MPF A;  2GT6 A;  2OA7 A;  3IE3 A;  4IN0 A;  3TGZ A;  4TRX A;  3H8Q A;  3M9J A;  3IK9 A;  2VCW A;  4IBP A;  5ELA A;  4G19 A;  4Q5N A;  3UVT A;  5IMF A;  4EDZ A;  2P5R A;  1FG4 A;  5F05 A;  4OFT A;  4MJC A;  5KN1 A;  4MJE A;  4MK3 A;  1V57 A;  4XS6 A;  5ECO B;  4BA7 A;  2PU9 C;  3TRX A;  1V58 A;  3W6G A;  2FGX A;  2V6O A;  3APQ A;  1LBK A;  4MF6 A;  1PL1 A;  4TVE A;  1XPV A;  1BG5 A;  2ZNM A;  2EC4 A;  3D0Z A;  4ZL8 A;  1JLV A;  3GN3 A;  2RII A;  4FIW A;  3QPM A;  3I6A A;  4HOJ A;  4BVX A;  20GS A;  1AAZ A;  2IJY A;  3ED3 A;  2RM6 A;  1S3A A;  4O7H A;  1DE2 A;  4POK A;  2WJU A;  3QDN A;  3US3 A;  5HR3 A;  1PX7 A;  1A0R P;  2XPE A;  4K8M A;  2N5F A;  5IOX A;  5GAP D;  5G5F A;  2ON7 A;  3DD3 A;  5J3R A;  4WBJ A;  3N9J A;  3LGC A;  1HQO A;  3KTL A;  5F06 A;  3NIV A;  3IR4 A;  1AC1 A;  2C3N A;  5G31 A;  1TK5 B;  1NW2 A;  3VUR A;  1A8L A;  1XWB A;  2LJR A;  4ML1 A;  1PMT A;  2LRT A;  2GTU A;  1MDJ A;  4GF0 A;  3KH9 A;  1LJR A;  3PH9 A;  4WR4 A;  1T1V A;  1TJD A;  4Q5Q A;  1FO5 A;  1OKD A;  2VLV A;  3O3T A;  2B5Y A;  5CAX A;  1HD2 A;  3F4S A;  3HD5 A;  4N11 A;  3RHC A;  1OAZ A;  4ZBD A;  2HZF A;  4XHM A;  4YQV A;  4MAB A;  4EVM A;  2HNL A;  1T3B A;  2HQT A;  1HNB A;  3Q18 A;  1O85 A;  3O6T A;  4JU5 A;  3VLN A;  3LSZ A;  5CRH A;  3C73 A;  1QFN A;  1JFU A;  3IOS A;  2LST A;  4OMV A;  1WP0 A;  4RQR A;  3GUS A;  1G6W A;  4BVX B;  2KOK A;  3M8N A;  3KP9 A;  3ERF A;  2M72 A;  4YH2 A;  1G7E A;  4MJA A;  2X8G A;  3FZ4 A;  2I9H A;  1DE1 A;  3GMF A;  1YF0 A;  4PTS A;  3ZIV A;  4ILF A;  4V1A g;  9GSS A;  3LQ7 A;  2ZUP A;  3BCK A;  4GCI A;  2IPA A;  3TOU A;  4YAP A;  4AJ8 A;  2XC2 A;  5B7C A;  3KIJ A;  4HJM A;  4POL A;  4MZW A;  1PSQ A;  2WCI A;  1TOF A;  2HRN A;  5EL8 A;  5F07 A;  1M2B A;  4TR4 A;  3TUE A;  5DAK A;  2C0F A;  6GSS A;  3ZL5 A;  4PNF A;  5F8B A;  2VCT A;  2AJQ B;  4RQX A;  1XW9 A;  3RBT A;  1TK0 B;  4XS1 A;  2H70 A;  2H01 A;  4I2T A;  2OAD A;  4KE3 A;  6GSV A;  3ZLP A;  5J41 A;  4G2E A;  1R4W A;  2FD3 A;  2CZ3 A;  2VOC A;  2OBK A;  4I5Q A;  3MDK A;  4P3Y B;  1G0T A;  3PGT A;  2LQQ A;  5DCG A;  1OC8 A;  1YZX A;  3EMP A;  5J9B A;  4XTS A;  2C0G A;  5A5K A;  1EEM A;  2AB6 A;  3KMN A;  1SJ6 A;  1GTI A;  10GS A;  4YAV A;  3D4T A;  3IA1 A;  4RI6 A;  1X5C A;  1U3I A;  1SL2 B;  1FOV A;  1TRU A;  1HYU A;  2G0F A;  2WFC A;  2C80 A;  2VCQ A;  1URM A;  4J57 E;  2CX3 A;  4KDY A;  4G0I A;  1TRW A;  4JE1 A;  1PX6 A;  2ZCT A;  4HU7 A;  3LG6 A;  4G10 A;  1B48 A;  1WMJ A;  2CX4 A;  1YDK A;  5CYY A;  2H6X A;  2FA8 A;  2N5B A;  2C3T A;  3EU4 A;  4NV2 A;  2H66 A;  5H5S A;  2JU5 A;  4EO3 A;  2OJL A;  5DAK B;  4N30 A;  2FWH A;  1TU7 A;  2IMI A;  4PUF C;  1VF2 A;  1SJI A;  1BYE A;  5KEJ A;  3VPT A;  1JZR A;  1MD4 A;  1VGL A;  1OE8 A;  2PVQ A;  3FR9 A;  1B4Q A;  2I3Y A;  1WWJ A;  2DC5 A;  3GFK A;  4GTU A;  2CA8 A;  5HFG A;  5ECR B;  2H19 A;  3WD6 A;  2WGR A;  1ILO A;  3A2W A;  3TJF A;  1BAY A;  2HZE A;  2YAN A;  1ACV A;  3ZZX A;  2K8S A;  1HNC A;  14GS A;  1K0M A;  4KND A;  4KA0 A;  3UOM A;  2FWE A;  2HI7 A;  1M2A A;  3U5R E;  4Q5R A;  3VK9 A;  4IP1 A;  1W4V A;  3F9U A;  3DVW A;  3IXR A;  3C7M A;  1GSF A;  3GNJ A;  2VM2 A;  1C72 A;  5HR0 A;  5DJM A;  1GLP A;  2VCX A;  1FHE A;  1M7T A;  1AW9 A;  4MF5 A;  3HDC A;  3QFB C;  4F2I A;  2M80 A;  2J9H A;  3A5W A;  5AIV A;  3ZVJ D;  4ECI A;  1QQ2 A;  3QAV A;  2XBQ A;  3QCP A;  4HI7 A;  3C1R A;  3CXG A;  1VF3 A;  1GWC A;  5IMA A;  4TW5 A;  1LU4 A;  2LEG A;  1O8X A;  1SKW B;  1SK2 A;  1GUL A;  4IP6 A;  3L0H A;  3FK8 A;  4TXV A;  4AJ7 A;  1JHB A;  5INY A;  2VO4 A;  1TRS A;  3DRN A;  3GA4 A;  3EMX A;  1OYJ A;  2AYT A;  1ZMA A;  5DJL A;  5D96 A;  3BBY A;  4NPB A;  2IMD A;  5C04 A;  1SD9 A;  2H1G A;  5J5N A;  5AIS A;  4N0Z A;  2HZE B;  4O92 A;  1GNW A;  2JZS A;  5D93 A;  1H75 A;  1YJ6 A;  2PPT A;  2DJ3 A;  1K3L A;  3KM6 A;  3GKM A;  2HLS A;  2LJA A;  2V32 A;  2AV4 A;  2PMT A;  1ERW A;  1EOH A;  2NTO A;  4DSQ A;  1S3C A;  2JZR A;  2DIY A;  2DJK A;  2V1M A;  4JRR A;  2WDU A;  4POB A;  1K0D A;  2DJ2 A;  4PUA A;  3DXB A;  4EDY A;  2IME A;  1EP7 A;  1BQ7 A;  4PX1 A;  1EP8 A;  2DJ0 A;  3M3M A;  4KCA A;  4PQI A;  3ZTL A;  2OBI A;  1ERV A;  1T4Z A;  3HZ4 A;  4LA1 A;  4LMV A;  2KP2 A;  3F6F A;  2V6K A;  2RUF A;  4KH7 A;  4E8H A;  1THX A;  2JL4 A;  4K7I A;  7GSS A;  1F3A A;  1X9S B;  3GYK A;  5ENU A;  3WYW A;  3BD2 A;  2GST A;  1WOU A;  2VD1 A;  5D9V A;  5IOW A;  5CRG A;  1DUG A;  3TJB A;  5DAL A;  2F9S A;  1OC9 A;  2MZC A;  4V2N A;  3LWA A;  1SKS B;  2KLX A;  3F8U A;  4IQA A;  2H1D A;  2GZY A;  2CAQ A;  1A8Y A;  1O73 A;  1VF4 A;  3QAW A;  2IL3 A;  4TN8 A;  1YEP A;  2TRC P;  1O81 A;  2P5Q A;  4BL7 A;  2H30 A;  5JWO B;  1EGO A;  4FQU A;  1SYR A;  1FB0 A;  2JAC A;  1Z3E A;  3UBK A;  2IIY A;  1AQV A;  4V2L A;  1EV9 A;  2VIM A;  3CRT A;  2K8V A;  3V1W A;  4Z7X A;  4G0L A;  2H1A A;  2MMO A;  2O8V B;  3ZFL A;  2UZ8 A;  5AN1 A;  1YY7 A;  1PRX A;  4PXO A;  1PKZ A;  5ECH B;  4L0U A;  1TU8 A;  2YWM A;  2GQM A;  4K0G A;  4IS0 A;  3VWX A;  2WS2 A;  2RUE A;  3ZYW A;  2MMZ A;  4I97 A;  2O7K A;  2HT9 A;  5H5R A;  1Q4J A;  4BWQ A;  4X0X A;  2F51 A;  1USB A;  2PUK C;  4ECB A;  1ERT A;  2NVL A;  1U88 A;  5IIZ A;  1K0O A;  3GX8 A;  4N10 A;  3WT1 A;  3TKS A;  3IC4 A;  3VFI A;  2C8U A;  2L57 A;  2GGT A;  5CNW A;  4ZL7 A;  3Q6O A;  5DAL B;  2HRK A;  6GSU A;  5DBQ A;  1OC9 B;  3AY8 A;  3SWL A;  4WXT A;  4LMW A;  1PD2 1;  5DQY A;  2VL9 A;  4K9Z A;  2QKE A;  2H0I A;  4CDO A;  2VL2 A;  4GWR A;  2MMN A;  1GH2 A;  3TJK A;  3Q19 A;  3K8N A;  1HNA A;  3N5O A;  4K2D A;  4BL7 B;  2R5G A;  3CSI A;  2ON5 A;  2F8A A;  1ZL9 A;  2JSY A;  2TIR A;  2IFQ A;  1O7U A;  4BVY A;  1UVZ A;  3ZRE A;  5IPG A;  3FW2 A;  1SJZ A;  4DVC A;  1MEK A;  1EEJ A;  1A23 A;  3F0I A;  4OFM A;  1DSB A;  1U6T A;  4NV5 A;  3TKP A;  3G9B A;  1SU9 A;  3LXZ A;  3M0F A;  3KD0 A;  3EC3 A;  3QOU A;  2YWN A;  1Z5Y E;  1XFL A;  2LRN A;  3CYN A;  2L6C A;  3LEF A;  1O6J A;  1K3O A;  1OVN A;  1XOA A;  2X8H A;  5E4W A;  3KMO A;  4DSS A;  3KEB A;  3P2A A;  3VPQ A;  4LL4 B;  2O85 A;  2CAI A;  3P90 A;  2VCZ A;  2BMX A;  1GSU A;  3TB2 A;  3GKK A;  4AGS A;  5IM9 A;  5JCG A;  2LTK A;  4J2F A;  4WR5 A;  3BJ5 A;  1GNE A;  3KXO A;  4KF9 A;  4ZB6 A;  3FRC A;  2YWO A;  3EU3 A;  3TOT A;  2HRK B;  2J23 A;  4FO5 A;  3GUR A;  5GST A;  4ZIL A;  2X99 A;  3QAG A;  3HJP A;  4ACS A;  2YNX A;  1X0R A;  1G6Y A;  2HRA A;  3HZ8 A;  3EE2 A;  1XVQ A;  4FH8 A;  1F9M A;  1MDK A;  1GUM A;  2OKA A;  2IFQ B;  4IW9 A;  1QGV A;  4BVY B;  4F03 A;  1SYX A;  1MDI A;  4OFN A;  2O89 A;  3KCM A;  1S3D A;  4BWS A;  4I6X A;  3LYK A;  1Y6E A;  5CRW A;  2R37 A;  4GSN A;  4IJI A;  2BJX A;  3HKR A;  3LXT A;  1QUW A;  2I81 A;  2VUP A;  2HXK A;  5GSS A;  4O5R A;  3IPZ A;  1EOG A;  3TRP A;  3F3R A;  1ZGN A;  5CO3 A;  3H1N A;  1ZZY A;  4USS A;  2GDR A;  4DSS B;  2GQL A;  3I43 A;  1PA3 A;  4PQH A;  1NM3 A;  5DCH A;  1GLQ A;  1XXU A;  5ECM B;  3GKN A;  2L4Q A;  4ULX A;  2L5L A;  4YQU A;  19GS A;  3GH9 A;  1GL8 A;  2KHP A;  4MCU A;  1JLW A;  3L9S A;  1ML6 A;  1MTC A;  5C00 A;  2WZ9 A;  3OR5 A;  2L4C A;  1F37 A;  1T7P B;  2X64 A;  2B7K A;  4IQ1 A;  3ME8 A;  3GTU A;  1SK0 A;  2YPM A;  1A0F A;  2GT5 A;  4L0W A;  4K7N A;  4XS4 A;  12GS A;  4I2U A;  3EYT A;  1XW5 A;  1PQN A;  2F3M A;  2WB9 A;  2L59 A;  22GS A;  4J56 E;  1TW9 A;  1OE7 A;  1K3Y A;  1R26 A;  2YV7 A;  4F0C A;  3IAS 2;  1EGR A;  3ISO A;  3HHV A;  5ID2 A;  1EZK A;  2BTO T;  2YJ7 A;  4L8E A;  2YP6 A;  2CVK A;  4EL1 A;  1YEX A;  17GS A;  5B6M A;  1TDI A;  4MH2 A;  4ZXG A;  3NOF A;  4MMM A;  2IWT A;  5JCW A;  4EC0 A;  4WF4 A;  1Z6N A;  2H73 A;  2A2S A;  2IMK A;  4EE0 A;  1CQH A;  1BJX A;  4NHZ A;  1ERU A;  3R3E A;  3WT2 A;  3L78 A;  1E2Y A;  2WRT A;  3HVS A;  1XCC A;  5IQY A;  1V2A A;  1XWA A;  3L9V A;  4O32 A;  1FVJ A;  1PGT A;  3GHA A;  1QMV A;  3F63 A;  4PUR A;  2JZT A;  1SEN A;  3D6I A;  1W89 A;  5FWG A;  4WEY A;  3GTU B;  5J4U A;  1SD8 A;  2K6V A;  2VD0 A;  4XS4 B;  3GRX A;  4RI7 A;  4HEA 2;  1N8J A;  5LNK e;  3HY2 A;  1ST9 A;  1A2J A;  4E8E A;  3GL3 A;  5GAN D;  4V2M A;  4GST A;  3E0U A;  4IJ3 A;  4OO4 A;  5ID2 B;  1GTU A;  5ABR A;  1GUK A;  3DKS A;  2PER A;  2R6K A;  1O8W A;  5D8I A;  2C1Y A;  5LD0 A;  1YF1 A;  1U87 A;  1WIK A;  5A4V A;  2YJH A;  1B9Y C;  4Q5F A;  1XWG A;  4K1F A;  1ABA A;  2FWG A;  1FB6 A;  4WET A;  1AQX A;  3ZFB A;  2AHE A; 
#chains in the Genus database with same CATH topology
 4K0N A;  1GSS A;  4CW9 A;  3KTB A;  4ZB8 A;  4FYB A;  4TKY A;  2DSA A;  2F8F A;  3SBC A;  2A2P A;  4KX4 A;  4AKH A;  5AIX A;  1J08 A;  2CQ9 A;  5F0G A;  1XZO A;  3HVX A;  4GSS A;  3TCO A;  5DDL A;  2HSN B;  5IMD A;  1M9A A;  3UEM A;  3F3Q A;  3IAM 2;  4AF2 A;  1ZCP A;  3TRQ A;  5H5Q A;  4TR1 A;  2E7P A;  2FNO A;  4EXJ A;  2HRF A;  4QL9 A;  3DVX A;  2VLU A;  3RPP A;  2EIO A;  2B3S A;  1BED A;  4FXY P;  2CVD A;  4KDX A;  4NAX A;  4TR3 A;  4FYU A;  2H6Z A;  1NSW A;  3ERG A;  3MIX A;  3EIN A;  2ES7 A;  1M99 A;  5A4W A;  3WGX A;  3I69 A;  2QSI A;  2WVY A;  3FZ5 A;  5EPF A;  2HSY A;  4POM A;  4V1A p;  2REM A;  4X43 A;  3GSS A;  1TI1 A;  1YKC A;  5CP1 A;  1UC7 A;  2FHE A;  2TRX A;  2H74 A;  4IEL A;  1YKA A;  4KDU A;  2C0E A;  4G0K A;  1SK1 A;  1J9B A;  5G5E A;  1ZYN A;  3KJY A;  4YKG A;  8GSS A;  2D2Z A;  2LQO A;  3WGD A;  2QGV A;  3QR6 A;  3H4K A;  2LV3 A;  2LJK A;  1K0N A;  5HR1 A;  2EFH A;  1U3A A;  4TR1 B;  4IGJ A;  3FHK A;  3DEX A;  5EVO A;  3JCM L;  4D73 A;  1KNG A;  1DBY A;  1T8E B;  1Z7P A;  1M3I A;  2P31 A;  1T4Y A;  4K6X A;  1XBS A;  4IHU A;  2P0G A;  3ZML A;  4MZC A;  1R5P A;  2X8C A;  1R5A A;  2E2G A;  4GLT A;  4KAE A;  3DML A;  3UMA A;  5D9W A;  4ECC A;  4AKX B;  4YQM A;  1TKD B;  2B6M A;  2C3Q A;  1QK8 A;  3MYD A;  2GSS A;  13GS A;  2XHF A;  4TR0 A;  3APO A;  4JR4 A;  3HCZ A;  3GX0 A;  5ECS A;  3IDV A;  2A2R A;  2WW1 A;  4HZ2 A;  4WKW A;  3C71 A;  4MLY A;  1SVM A;  1KTE A;  5ECQ B;  6GSY A;  4AKI A;  3QMX A;  4RUV A;  3RAZ A;  3VI7 A;  5D9T A;  4CY8 A;  4BIK A;  2GSQ A;  2O3E A;  3I9V 2;  3PPU A;  4PNG A;  2DKI A;  3DGQ A;  3EUR A;  3TKS C;  1Q98 A;  3GIX A;  5ECI B;  5HR2 A;  3A2X A;  3U6V A;  2WW0 A;  2WW3 A;  1SKR B;  2EIQ A;  5G2Z A;  3TKQ A;  1GTB A;  2FLS A;  2H76 A;  1CQG A;  4ZL9 A;  3UAP A;  3M9K A;  2N5A A;  1TP9 A;  4F9Z A;  3TJG A;  5ECK B;  3QD9 A;  3IRA A;  4D73 B;  2VL2 C;  1JZW A;  3KP8 A;  4JR6 A;  5HFI A;  4DEJ A;  1WE0 A;  3IHG A;  4EF0 A;  2DLX A;  2MBS A;  5GZZ B;  1Z6M A;  3C1S A;  2KP1 A;  1EV4 A;  2DIZ A;  4W66 A;  2V2G A;  2GS3 A;  1UN2 A;  5ELG A;  2QC7 A;  2NPB A;  3FR6 A;  2VL3 A;  4JED A;  2H6Y A;  1BX9 A;  1RK4 A;  1AQW A;  4K7O A;  2FCH A;  3R2Q A;  4TXO A;  4IKH A;  3UAR A;  1ON4 A;  2CV4 A;  3GL5 A;  3FR3 A;  2YCD A;  3UJ1 A;  3BOA A;  2V41 A;  3UIW A;  4IVF A;  2VCV A;  2YV9 A;  2HFD A;  2PVO C;  3PR8 A;  2FY6 A;  4EUY A;  2AUV A;  2RLI A;  2DBC A;  2LS5 A;  3F6D A;  5LCZ A;  1OC3 A;  1TRV A;  3NZN A;  3LOR A;  1X9W B;  1A2L A;  2MYG A;  1GRX A;  4MJB A;  4I8B A;  2JAD A;  4ZBB A;  1Y25 A;  4X1U A;  3MNG A;  5B8A A;  5G1L A;  5KN0 A;  1X5E A;  3UL3 A;  4HUA A;  4L5O A;  4OO5 A;  5BMU A;  4XRD A;  2GLR A;  2HE3 A;  3WGE A;  4OCF A;  4QQ7 A;  3ZVJ A;  2H75 A;  1A2M A;  4KGI A;  1AUC A;  2B1K A;  1XVW A;  2I4A A;  1T00 A;  2LUS A;  5IMZ A;  4TOP A;  5DQS A;  2R0C A;  4F0B A;  1GSQ A;  2DKH A;  3LFL A;  4EKZ A;  2G2Q A;  3RGB C;  4GXZ A;  5A4U A;  3IV4 A;  5CRD A;  3IBH A;  2B1L A;  1K0C A;  2H1B A;  2PBJ A;  3IK7 A;  3EVI A;  3P7X A;  2H8L A;  1YQ1 A;  3GV1 A;  2IMF A;  4HQZ A;  4TXO B;  1Z9H A;  2H0H A;  3TKR A;  5G1K A;  4ML6 A;  3HA9 A;  2DJ1 A;  4MP4 A;  4MF7 A;  2O5V A;  1M0U A;  5KN3 A;  2I1U A;  2WVX A;  5D73 A;  5CRE A;  4HDE A;  4LL1 B;  1THO A;  3G7J A;  4WF5 A;  4KSM A;  1EWX A;  2HSM A;  2OT3 A;  4KCE A;  2CT6 A;  3KH7 A;  3RPN A;  1H4O A;  4OD7 A;  5ECL B;  2PN8 A;  5HQP A;  2DJJ A;  4MPG A;  1UA5 A;  4GQF A;  1VF1 A;  1XWC A;  1A24 A;  2LKU A;  2UV8 G;  4G9H A;  3UBL A;  1SL1 B;  5HFK A;  2H71 A;  4MZB A;  1TI3 A;  1XWK A;  4ZB9 A;  1I9D A;  3HJO A;  3PIN A;  1FAA A;  4PGT A;  4FYC A;  4HZ4 A;  5BMU B;  1XIY A;  4XRA A;  4GRF A;  3VWV A;  4L5L A;  1N2A A;  1TK8 B;  1KBN A;  1B9X C;  1TXX A;  3DWV A;  2ALB A;  2YN1 A;  1NHO A;  1V9W A;  4MDC A;  3J7Y k;  3TJJ A;  3G7I A;  1XOB A;  5DVB A;  5ECN B;  2HSH A;  1IYH A;  2Z9S A;  4HQS A;  2PWJ A;  3TDG A;  3GKX A;  2GZZ A;  3FZ9 A;  3VWW A;  4ID0 A;  1GTA A;  3ERW A;  3ZIJ A;  3GH6 A;  4F82 A;  4AI6 A;  3CTG A;  4NXI A;  4JZQ A;  5E59 A;  2XBI A;  1M2D A;  2A4V A;  3ZMK A;  1GSY A;  2GSR A;  5L71 A;  5IO0 A;  1PL2 A;  4HU9 A;  2VLT A;  3RHB A;  2GVP A;  2L5O A;  3FYG A;  1RW1 A;  5AGY A;  2FWF A;  5IMC A;  3CTF A;  5G30 A;  1GUH A;  2NDO A;  1AXD A;  4NHW A;  2WVX B;  3D21 A;  3CMI A;  1OKT A;  1B4P A;  2HSM B;  1PN9 A;  2CZ2 A;  2GZP A;  4MNN A;  2VM1 A;  3H79 A;  2CVB A;  1RQM A;  4AJ6 A;  5IO2 A;  3W8S A;  2R4V A;  4JBB A;  1V40 A;  3KZQ A;  4PQ1 A;  3W8J A;  5ECP B;  4Z2U A;  1ZYQ B;  3KGK A;  4N0V A;  2B5X A;  2YOI A;  1WPI A;  6GSW A;  3A3T A;  5JCU A;  3FKF A;  5EY6 A;  4NWY A;  1V98 A;  2KUC A;  1ZOF A;  3A2V A;  4GDF A;  1GSE A;  6GST A;  2XPD A;  4KB3 A;  2OE0 A;  3CRU A;  4O5U A;  4YKF A;  1VRS D;  4BPY A;  1PKW A;  3DYR A;  4MH3 A;  2MBT A;  2L6D A;  4GQC A;  4QL7 A;  3BCI A;  3MSZ A;  4O5Q A;  3IC8 A;  1JZO A;  4ZBA A;  4OWY A;  2RM5 A;  3VWU A;  3E9J B;  3P8W A;  2YZU A;  3CSH A;  3D4M A;  4KSO A;  3M1G A;  1F2E A;  3RDW A;  3TKS E;  4G01 A;  3CSJ A;  2O87 A;  3FEU A;  1GP1 A;  2VAF A;  4KUN A;  2YZH A;  3S9F A;  3FY7 A;  5D9X A;  2LRC A;  4HS1 A;  4DSR A;  5IPH A;  1XW6 A;  2X49 A;  5KN2 A;  4HJ2 A;  3ME7 A;  1QXH A;  3MAK A;  2E0Q A;  2C0D A;  3H93 A;  3F4T A;  1WJK A;  2DML A;  1X5D A;  4XIH A;  5J4Y A;  3LYP A;  3HXS A;  5FT3 A;  1MD3 A;  6GSX A;  4ISD A;  3GST A;  1NHY A;  3ZIT A;  5JWQ B;  3G7Y A;  2H72 A;  2OE3 A;  2MMA A;  4OCE A;  16GS A;  3VI5 A;  2FA4 A;  2C4J A;  4WBR D;  1IYI A;  1K0B A;  2B5E A;  1E6B A;  2EIR A;  1J0F A;  2JSZ A;  11GS A;  3HVV A;  3DIE A;  3EWL A;  3TU3 B;  4QMK A;  2M46 A;  2QA2 A;  2OAC A;  5B6N A;  4KW6 A;  2K9F A;  4MA9 A;  4H86 A;  1FVK A;  5JWR B;  2OE1 A;  5B8B A;  3O76 A;  3HJM A;  2IN3 A;  1KEB A;  1Z7R A;  2R3X A;  1SL0 B;  3LJR A;  4ZIJ A;  4NMU A;  1BG1 A;  3L4N A;  1K0A A;  1F3B A;  2AAW A;  3D22 A;  3HMJ G;  2DMM A;  1GSD A;  2PGT A;  2GQK A;  3APS A;  1F6M C;  2H0G A;  1FW1 A;  1S3R A;  2WW2 A;  2WUL A;  2B7J A;  2R2J A;  3HYP A;  1WRY A;  1G7O A;  3FZA A;  2HYX A;  1R7H A;  5COH A;  2K18 A;  2NBS A;  4LLR A;  3IHQ A;  1I5G A;  1JZD A;  3E3E A;  1X9M B;  3J7Y b;  2LNT A;  2FUG 2;  2LNS A;  4ECJ A;  1AIU A;  5J9C A;  1B8X A;  5FHI A;  3CBU A;  2R0P A;  3D5J A;  3C8E A;  3UVH A;  3L9U A;  3CHX C;  3ZRD A;  3QFA C;  2YWI A;  1ZYE A;  1M9B A;  5IMV A;  4XCS A;  18GS A;  1TTZ A;  2E2M A;  3Q74 A;  3MWH A;  4CHS A;  3F4R A;  4MPF A;  2GT6 A;  2OA7 A;  3IE3 A;  4A5P A;  4IN0 A;  3TGZ A;  4TRX A;  3H8Q A;  3M9J A;  3IK9 A;  4X4J A;  2VCW A;  4IBP A;  5ELA A;  4G19 A;  4Q5N A;  3UVT A;  5IMF A;  4EDZ A;  2P5R A;  1FG4 A;  2QA1 A;  5F05 A;  4OFT A;  4MJC A;  5KN1 A;  4MJE A;  4MK3 A;  1V57 A;  4XS6 A;  5J4V A;  5ECO B;  4BA7 A;  2PU9 C;  3TRX A;  1V58 A;  4EIQ A;  3W6G A;  2FGX A;  2V6O A;  3APQ A;  1LBK A;  4MF6 A;  1PL1 A;  4TVE A;  1XPV A;  1BG5 A;  2ZNM A;  2EC4 A;  3D0Z A;  4ZL8 A;  1JLV A;  3GN3 A;  2RII A;  4FIW A;  3QPM A;  3I6A A;  4HOJ A;  4E68 A;  4BVX A;  20GS A;  1AAZ A;  1XG8 A;  2IJY A;  1TXU A;  3ED3 A;  2RM6 A;  1S3A A;  4O7H A;  1DE2 A;  4POK A;  2WJU A;  3QDN A;  3US3 A;  5HR3 A;  1PX7 A;  1A0R P;  2XPE A;  4K8M A;  2N5F A;  5A5H A;  5IOX A;  5GAP D;  5G5F A;  2ON7 A;  3DD3 A;  5J3R A;  4WBJ A;  3N9J A;  3LGC A;  1HQO A;  3KTL A;  5F06 A;  3NIV A;  3IR4 A;  1AC1 A;  2C3N A;  5G31 A;  1YEW C;  1TK5 B;  1NW2 A;  3VUR A;  1A8L A;  1XWB A;  2LJR A;  4ML1 A;  1PMT A;  2LRT A;  2GTU A;  1MDJ A;  4GF0 A;  3KH9 A;  1LJR A;  3PH9 A;  4WR4 A;  1T1V A;  1TJD A;  1BF5 A;  4Q5Q A;  1FO5 A;  1OKD A;  2VLV A;  3O3T A;  2B5Y A;  5CAX A;  1HD2 A;  3F4S A;  3HD5 A;  4N11 A;  3RHC A;  1OAZ A;  4ZBD A;  2HZF A;  4XHM A;  4YQV A;  4MAB A;  4EVM A;  2HNL A;  1T3B A;  2HQT A;  1S4B P;  1HNB A;  3Q18 A;  1O85 A;  3O6T A;  4JU5 A;  3VLN A;  3LSZ A;  5CRH A;  3C73 A;  1QFN A;  1JFU A;  3IOS A;  2LST A;  4OMV A;  1WP0 A;  4RQR A;  3GUS A;  1G6W A;  4BVX B;  2KOK A;  3M8N A;  3KP9 A;  3ERF A;  2M72 A;  4YH2 A;  1G7E A;  1ZYP A;  4MJA A;  2X8G A;  3FZ4 A;  2WZS A;  2I9H A;  1DE1 A;  3GMF A;  1YF0 A;  4PTS A;  3ZIV A;  4ILF A;  4V1A g;  9GSS A;  5A5H B;  3LQ7 A;  2ZUP A;  3BCK A;  4GCI A;  2IPA A;  3TOU A;  4YAP A;  4AJ8 A;  2XC2 A;  5B7C A;  3KIJ A;  4HJM A;  4POL A;  4MZW A;  1PSQ A;  2WCI A;  1TOF A;  2HRN A;  5EL8 A;  1M3J A;  5F07 A;  1M2B A;  4TR4 A;  3TUE A;  5DAK A;  2C0F A;  4PHZ C;  6GSS A;  3ZL5 A;  4PNF A;  5F8B A;  2VCT A;  4CY6 A;  2AJQ B;  3RFR C;  4RQX A;  1XW9 A;  3RBT A;  1TK0 B;  4N3Z A;  4XS1 A;  2H70 A;  2H01 A;  4I2T A;  2OAD A;  4KE3 A;  6GSV A;  3ZLP A;  5J41 A;  4G2E A;  1R4W A;  2FD3 A;  2CZ3 A;  2VOC A;  2OBK A;  4I5Q A;  3MDK A;  4P3Y B;  5J47 A;  5KOW A;  1G0T A;  3PGT A;  2LQQ A;  5DCG A;  1OC8 A;  1YZX A;  3EMP A;  5J9B A;  4XTS A;  2C0G A;  5A5K A;  1EEM A;  2AB6 A;  3KMN A;  1SJ6 A;  1GTI A;  10GS A;  4YAV A;  3D4T A;  3IA1 A;  4RI6 A;  1X5C A;  1U3I A;  1SL2 B;  1FOV A;  1TRU A;  1HYU A;  2G0F A;  2WFC A;  2C80 A;  2VCQ A;  1URM A;  4J57 E;  2CX3 A;  4KDY A;  4G0I A;  1TRW A;  4JE1 A;  1PX6 A;  2ZCT A;  4HU7 A;  3LG6 A;  4G10 A;  1B48 A;  1WMJ A;  2CX4 A;  1YDK A;  5CYY A;  2H6X A;  2FA8 A;  2N5B A;  2C3T A;  3EU4 A;  4NV2 A;  2H66 A;  5H5S A;  2JU5 A;  4EO3 A;  2OJL A;  5DAK B;  4N30 A;  2FWH A;  1TU7 A;  2IMI A;  4PUF C;  1VF2 A;  1SJI A;  1BYE A;  3CQF A;  5KEJ A;  3VPT A;  1JZR A;  1MD4 A;  1VGL A;  1OE8 A;  2PVQ A;  3FR9 A;  1B4Q A;  2I3Y A;  1WWJ A;  2DC5 A;  3GFK A;  4GTU A;  2CA8 A;  5HFG A;  5ECR B;  2H19 A;  3WD6 A;  2WGR A;  1ILO A;  3A2W A;  3TJF A;  1BAY A;  2HZE A;  2YAN A;  1ACV A;  3ZZX A;  2K8S A;  1HNC A;  14GS A;  1K0M A;  4KND A;  4KA0 A;  3UOM A;  2FWE A;  2HI7 A;  1M2A A;  3U5R E;  4Q5R A;  3VK9 A;  4IP1 A;  1W4V A;  3F9U A;  3DVW A;  3IXR A;  5A34 A;  3C7M A;  1GSF A;  3GNJ A;  2VM2 A;  1C72 A;  5HR0 A;  5DJM A;  1GLP A;  2VCX A;  1FHE A;  1M7T A;  1AW9 A;  4MF5 A;  3HDC A;  3QFB C;  4F2I A;  2M80 A;  2J9H A;  3A5W A;  5AIV A;  3ZVJ D;  4Z2R A;  4ECI A;  1QQ2 A;  3QAV A;  2XBQ A;  3QCP A;  4HI7 A;  4AKG A;  3C1R A;  3CXG A;  1VF3 A;  1GWC A;  5IMA A;  4TW5 A;  4ZB7 A;  1LU4 A;  2LEG A;  1O8X A;  1SKW B;  1SK2 A;  1GUL A;  4IP6 A;  3L0H A;  3FK8 A;  4TXV A;  4AJ7 A;  1JHB A;  5INY A;  2VO4 A;  1TRS A;  3DRN A;  3GA4 A;  3EMX A;  1OYJ A;  2AYT A;  1ZMA A;  5DJL A;  5D96 A;  3BBY A;  4NPB A;  2IMD A;  5C04 A;  1SD9 A;  2H1G A;  5J5N A;  5AIS A;  4N0Z A;  2HZE B;  4O92 A;  1GNW A;  2JZS A;  5D93 A;  5A1N A;  2R0G A;  1H75 A;  1YJ6 A;  2PPT A;  2DJ3 A;  1K3L A;  3KM6 A;  3GKM A;  2HLS A;  2LJA A;  2V32 A;  2AV4 A;  2PMT A;  4PI0 C;  1ERW A;  1N25 A;  1EOH A;  5A34 B;  2NTO A;  4DSQ A;  1S3C A;  2JZR A;  2DIY A;  2DJK A;  2V1M A;  4JRR A;  2WDU A;  4POB A;  1K0D A;  2DJ2 A;  4PUA A;  3DXB A;  4EDY A;  2IME A;  1EP7 A;  1BQ7 A;  4PX1 A;  1EP8 A;  2DJ0 A;  3M3M A;  4KCA A;  4PQI A;  3ZTL A;  1PFO A;  2OBI A;  1ERV A;  1T4Z A;  3HZ4 A;  4LA1 A;  4LMV A;  2KP2 A;  3F6F A;  2V6K A;  2RUF A;  4KH7 A;  4E8H A;  1THX A;  2JL4 A;  4K7I A;  7GSS A;  1F3A A;  1X9S B;  3GYK A;  5ENU A;  3WYW A;  3BD2 A;  2GST A;  4ICY A;  1WOU A;  2VD1 A;  5D9V A;  5IOW A;  5CRG A;  1DUG A;  3A5I A;  3TJB A;  5DAL A;  2F9S A;  1OC9 A;  2MZC A;  4V2N A;  3LWA A;  1SKS B;  2KLX A;  3F8U A;  4IQA A;  2H1D A;  2GZY A;  2CAQ A;  1A8Y A;  1O73 A;  1VF4 A;  3QAW A;  2IL3 A;  5A1N B;  4TN8 A;  1YEP A;  2TRC P;  1O81 A;  2P5Q A;  4BL7 A;  2EFC A;  2H30 A;  5JWO B;  5KOX A;  1EGO A;  4FQU A;  1SYR A;  1FB0 A;  2JAC A;  1Z3E A;  1I1I P;  3UBK A;  2IIY A;  2WVZ A;  1AQV A;  4V2L A;  1EV9 A;  2VIM A;  3CRT A;  2K8V A;  3V1W A;  4Z7X A;  4G0L A;  2H1A A;  2MMO A;  2O8V B;  3ZFL A;  1SVL A;  2UZ8 A;  5AN1 A;  1YY7 A;  1PRX A;  4PXO A;  1PKZ A;  5ECH B;  4L0U A;  1TU8 A;  2YWM A;  2GQM A;  4K0G A;  4IS0 A;  3VWX A;  2WS2 A;  2RUE A;  4EIP A;  3ZYW A;  2MMZ A;  4I97 A;  2O7K A;  2HT9 A;  5H5R A;  1Q4J A;  4BWQ A;  4X0X A;  4K2X A;  2F51 A;  1USB A;  2PUK C;  4ECB A;  1ERT A;  2NVL A;  1U88 A;  5IIZ A;  1K0O A;  3GX8 A;  4N10 A;  3WT1 A;  3TKS A;  3IC4 A;  3VFI A;  2C8U A;  2L57 A;  2GGT A;  5CNW A;  4ZL7 A;  3Q6O A;  5DAL B;  2HRK A;  6GSU A;  5DBQ A;  1OC9 B;  3AY8 A;  3SWL A;  4WXT A;  4LMW A;  1PD2 1;  5DQY A;  2VL9 A;  4K9Z A;  2QKE A;  2H0I A;  4CDO A;  2VL2 A;  4GWR A;  2MMN A;  1GH2 A;  3TJK A;  3Q19 A;  3K8N A;  1HNA A;  3N5O A;  4K2D A;  4BL7 B;  2R5G A;  3CSI A;  2ON5 A;  2F8A A;  1ZL9 A;  2JSY A;  2TIR A;  2IFQ A;  1O7U A;  4BVY A;  1UVZ A;  3ZRE A;  5IPG A;  3FW2 A;  5J40 A;  1SJZ A;  4DVC A;  1MEK A;  1EEJ A;  3HVN A;  4PI2 C;  1A23 A;  3F0I A;  4OFM A;  2H1L A;  1DSB A;  1U6T A;  4NV5 A;  3TKP A;  3G9B A;  1SU9 A;  3LXZ A;  3M0F A;  1FOH A;  3KD0 A;  3EC3 A;  3QOU A;  3CWG A;  2YWN A;  1Z5Y E;  1XFL A;  2LRN A;  3CYN A;  2L6C A;  3LEF A;  1O6J A;  1K3O A;  1OVN A;  1XOA A;  2X4A A;  2X8H A;  5E4W A;  3KMO A;  4DSS A;  3KEB A;  3P2A A;  3VPQ A;  4LL4 B;  2O85 A;  2CAI A;  3P90 A;  2VCZ A;  2BMX A;  1GSU A;  3TB2 A;  3GKK A;  4AGS A;  5IM9 A;  5JCG A;  2LTK A;  4J2F A;  4WR5 A;  3BJ5 A;  1GNE A;  3KXO A;  4KF9 A;  4ZB6 A;  3FRC A;  2YWO A;  3EU3 A;  3TOT A;  2HRK B;  2J23 A;  4FO5 A;  3GUR A;  5GST A;  4ZIL A;  2X99 A;  3QAG A;  3HJP A;  4ACS A;  2YNX A;  1X0R A;  1G6Y A;  2HRA A;  3HZ8 A;  3EE2 A;  1XVQ A;  4FH8 A;  1F9M A;  1MDK A;  1GUM A;  2OKA A;  2IFQ B;  4IW9 A;  1QGV A;  4BVY B;  4F03 A;  1SYX A;  1MDI A;  4OFN A;  2O89 A;  3KCM A;  1S3D A;  4BWS A;  4I6X A;  3FMW A;  1Y6E A;  1YVL A;  3LYK A;  5CRW A;  2R37 A;  4GSN A;  4IJI A;  2BJX A;  3HKR A;  3LXT A;  1QUW A;  2I81 A;  2VUP A;  2HXK A;  5GSS A;  2VKZ G;  4O5R A;  3IPZ A;  1EOG A;  3TRP A;  3F3R A;  1ZGN A;  5CO3 A;  3H1N A;  1ZZY A;  4USS A;  2GDR A;  4DSS B;  2GQL A;  3I43 A;  1PA3 A;  4PQH A;  1NM3 A;  5DCH A;  1GLQ A;  4K5S A;  1XXU A;  5BRT A;  5ECM B;  1PN0 A;  2L4Q A;  3GKN A;  4ULX A;  2L5L A;  4YQU A;  19GS A;  2EFD A;  3GH9 A;  2O36 A;  1GL8 A;  2KHP A;  4MCU A;  1JLW A;  3L9S A;  1ML6 A;  1MTC A;  5C00 A;  2WZ9 A;  3OR5 A;  2L4C A;  1F37 A;  1SVO A;  3LW9 A;  1T7P B;  2X64 A;  2B7K A;  4IQ1 A;  3ME8 A;  3GTU A;  1SK0 A;  2YPM A;  1A0F A;  2GT5 A;  4L0W A;  4K7N A;  4XS4 A;  12GS A;  4I2U A;  3EYT A;  1XW5 A;  1PQN A;  2F3M A;  2WB9 A;  2L59 A;  22GS A;  2A4H A;  4J56 E;  1TW9 A;  1OE7 A;  4HSC X;  1K3Y A;  1R26 A;  2YV7 A;  4F0C A;  3IAS 2;  1EGR A;  3ISO A;  3HHV A;  5ID2 A;  1EZK A;  2BTO T;  2YJ7 A;  4L8E A;  2YP6 A;  1Y1U A;  2CVK A;  4EL1 A;  1YEX A;  17GS A;  5B6M A;  1TDI A;  4MH2 A;  4Z2T A;  4ZXG A;  3NOF A;  4MMM A;  2IWT A;  5JCW A;  4EC0 A;  4WF4 A;  4K5R A;  1Z6N A;  2H73 A;  2A2S A;  2IMK A;  4EE0 A;  1CQH A;  1BJX A;  4NHZ A;  1ERU A;  2EFE A;  3R3E A;  3WT2 A;  3L78 A;  1E2Y A;  2WRT A;  2HSN A;  3HVS A;  1XCC A;  5IQY A;  1V2A A;  1XWA A;  3L9V A;  4O32 A;  1FVJ A;  1PGT A;  3GHA A;  1QMV A;  3F63 A;  4PUR A;  2JZT A;  1SEN A;  3D6I A;  1W89 A;  5FWG A;  4WEY A;  3GTU B;  5J4U A;  1SD8 A;  2K6V A;  2VD0 A;  4XS4 B;  3GRX A;  4RI7 A;  4HEA 2;  1N8J A;  5LNK e;  3HY2 A;  1ST9 A;  1A2J A;  4E8E A;  3GL3 A;  5GAN D;  4V2M A;  4GST A;  3E0U A;  4IJ3 A;  4OO4 A;  5ID2 B;  1GTU A;  3EPT A;  5ABR A;  1GUK A;  3DKS A;  2PER A;  2R6K A;  1O8W A;  5D8I A;  2C1Y A;  5LD0 A;  1YF1 A;  1U87 A;  1WIK A;  5A4V A;  2YJH A;  1B9Y C;  4Q5F A;  1XWG A;  4K1F A;  1ABA A;  2FWG A;  1FB6 A;  4WET A;  1AQX A;  3ZFB A;  2AHE A; 
#chains in the Genus database with same CATH homology
 4K0N A;  1GSS A;  4CW9 A;  3KTB A;  4ZB8 A;  4FYB A;  4TKY A;  2DSA A;  2F8F A;  3SBC A;  2A2P A;  4KX4 A;  4AKH A;  5AIX A;  1J08 A;  2CQ9 A;  5F0G A;  1XZO A;  3HVX A;  4GSS A;  3TCO A;  5DDL A;  2HSN B;  5IMD A;  1M9A A;  3UEM A;  3F3Q A;  3IAM 2;  4AF2 A;  1ZCP A;  3TRQ A;  5H5Q A;  4TR1 A;  2E7P A;  2FNO A;  4EXJ A;  2HRF A;  4QL9 A;  3DVX A;  2VLU A;  3RPP A;  2EIO A;  2B3S A;  1BED A;  2CVD A;  4KDX A;  4NAX A;  4TR3 A;  4FYU A;  2H6Z A;  1NSW A;  3ERG A;  3MIX A;  3EIN A;  2ES7 A;  1M99 A;  5A4W A;  3WGX A;  3I69 A;  2QSI A;  3FZ5 A;  5EPF A;  2HSY A;  4POM A;  4V1A p;  2REM A;  4X43 A;  3GSS A;  1TI1 A;  1YKC A;  5CP1 A;  1UC7 A;  2FHE A;  2TRX A;  2H74 A;  4IEL A;  1YKA A;  4KDU A;  2C0E A;  4G0K A;  1SK1 A;  1J9B A;  5G5E A;  1ZYN A;  3KJY A;  4YKG A;  8GSS A;  2D2Z A;  2LQO A;  3WGD A;  2QGV A;  3QR6 A;  3H4K A;  2LV3 A;  2LJK A;  1K0N A;  5HR1 A;  2EFH A;  1U3A A;  4TR1 B;  4IGJ A;  3FHK A;  3DEX A;  5EVO A;  3JCM L;  4D73 A;  1KNG A;  1DBY A;  1T8E B;  1Z7P A;  2P31 A;  1T4Y A;  4K6X A;  1XBS A;  4IHU A;  2P0G A;  3ZML A;  4MZC A;  1R5P A;  2X8C A;  1R5A A;  2E2G A;  4GLT A;  4KAE A;  3DML A;  3UMA A;  5D9W A;  4ECC A;  4AKX B;  4YQM A;  1TKD B;  2B6M A;  3MYD A;  2C3Q A;  1QK8 A;  2GSS A;  13GS A;  2XHF A;  4TR0 A;  3APO A;  4JR4 A;  3HCZ A;  3GX0 A;  5ECS A;  3IDV A;  2A2R A;  4HZ2 A;  4WKW A;  3C71 A;  4MLY A;  1SVM A;  1KTE A;  5ECQ B;  6GSY A;  4AKI A;  3QMX A;  4RUV A;  3RAZ A;  3VI7 A;  5D9T A;  4CY8 A;  2GSQ A;  3I9V 2;  3PPU A;  4PNG A;  2DKI A;  3DGQ A;  3EUR A;  3TKS C;  1Q98 A;  3GIX A;  5ECI B;  5HR2 A;  3A2X A;  3U6V A;  1SKR B;  2EIQ A;  5G2Z A;  3TKQ A;  1GTB A;  2FLS A;  2H76 A;  1CQG A;  4ZL9 A;  3UAP A;  3M9K A;  2N5A A;  1TP9 A;  4F9Z A;  3TJG A;  5ECK B;  3QD9 A;  3IRA A;  4D73 B;  2VL2 C;  1JZW A;  3KP8 A;  4JR6 A;  5HFI A;  4DEJ A;  1WE0 A;  3IHG A;  4EF0 A;  2DLX A;  2MBS A;  5GZZ B;  1Z6M A;  3C1S A;  2KP1 A;  1EV4 A;  2DIZ A;  4W66 A;  2V2G A;  2GS3 A;  1UN2 A;  5ELG A;  2QC7 A;  2NPB A;  3FR6 A;  2VL3 A;  4JED A;  2H6Y A;  1BX9 A;  1RK4 A;  1AQW A;  4K7O A;  2FCH A;  3R2Q A;  4TXO A;  4IKH A;  3UAR A;  1ON4 A;  2CV4 A;  3GL5 A;  3FR3 A;  2YCD A;  3UJ1 A;  3BOA A;  2V41 A;  3UIW A;  4IVF A;  2VCV A;  2YV9 A;  2HFD A;  2PVO C;  3PR8 A;  2FY6 A;  4EUY A;  2AUV A;  2RLI A;  2DBC A;  2LS5 A;  3F6D A;  5LCZ A;  1OC3 A;  1TRV A;  3NZN A;  3LOR A;  1X9W B;  1A2L A;  2MYG A;  1GRX A;  4MJB A;  4I8B A;  2JAD A;  4ZBB A;  1Y25 A;  4X1U A;  3MNG A;  5B8A A;  5G1L A;  5KN0 A;  1X5E A;  3UL3 A;  4HUA A;  4L5O A;  4OO5 A;  5BMU A;  4XRD A;  2GLR A;  2HE3 A;  3WGE A;  4OCF A;  4QQ7 A;  3ZVJ A;  2H75 A;  1A2M A;  4KGI A;  1AUC A;  2B1K A;  1XVW A;  2I4A A;  1T00 A;  2LUS A;  5IMZ A;  4TOP A;  5DQS A;  2R0C A;  4F0B A;  1GSQ A;  2DKH A;  3LFL A;  4EKZ A;  2G2Q A;  4GXZ A;  5A4U A;  3IV4 A;  5CRD A;  3IBH A;  2B1L A;  1K0C A;  2H1B A;  2PBJ A;  3IK7 A;  3EVI A;  3P7X A;  2H8L A;  1YQ1 A;  3GV1 A;  2IMF A;  4HQZ A;  4TXO B;  1Z9H A;  2H0H A;  3TKR A;  5G1K A;  4ML6 A;  3HA9 A;  2DJ1 A;  4MP4 A;  4MF7 A;  2O5V A;  1M0U A;  5KN3 A;  2I1U A;  5D73 A;  5CRE A;  4HDE A;  4LL1 B;  1THO A;  3G7J A;  4WF5 A;  4KSM A;  1EWX A;  2HSM A;  2OT3 A;  4KCE A;  2CT6 A;  3KH7 A;  3RPN A;  1H4O A;  4OD7 A;  5ECL B;  2PN8 A;  5HQP A;  2DJJ A;  4MPG A;  1UA5 A;  4GQF A;  1VF1 A;  1XWC A;  1A24 A;  2LKU A;  2UV8 G;  4G9H A;  3UBL A;  1SL1 B;  5HFK A;  2H71 A;  4MZB A;  1TI3 A;  1XWK A;  4ZB9 A;  1I9D A;  3HJO A;  3PIN A;  1FAA A;  4PGT A;  4FYC A;  4HZ4 A;  5BMU B;  1XIY A;  4XRA A;  4GRF A;  3VWV A;  4L5L A;  1N2A A;  1TK8 B;  1KBN A;  1B9X C;  1TXX A;  3DWV A;  2ALB A;  2YN1 A;  1NHO A;  1V9W A;  4MDC A;  3J7Y k;  3TJJ A;  3G7I A;  1XOB A;  5DVB A;  5ECN B;  2HSH A;  1IYH A;  2Z9S A;  4HQS A;  2PWJ A;  3TDG A;  3GKX A;  2GZZ A;  3FZ9 A;  3VWW A;  4ID0 A;  1GTA A;  3ERW A;  3ZIJ A;  3GH6 A;  4F82 A;  4AI6 A;  3CTG A;  4NXI A;  4JZQ A;  5E59 A;  2XBI A;  1M2D A;  2A4V A;  3ZMK A;  1GSY A;  2GSR A;  5L71 A;  5IO0 A;  1PL2 A;  4HU9 A;  2VLT A;  3RHB A;  2GVP A;  2L5O A;  3FYG A;  1RW1 A;  5AGY A;  2FWF A;  5IMC A;  3CTF A;  5G30 A;  1GUH A;  2NDO A;  1AXD A;  4NHW A;  3D21 A;  3CMI A;  1OKT A;  1B4P A;  2HSM B;  1PN9 A;  2CZ2 A;  2GZP A;  4MNN A;  2VM1 A;  3H79 A;  2CVB A;  1RQM A;  4AJ6 A;  5IO2 A;  3W8S A;  2R4V A;  4JBB A;  1V40 A;  3KZQ A;  4PQ1 A;  3W8J A;  5ECP B;  4Z2U A;  1ZYQ B;  3KGK A;  4N0V A;  2B5X A;  2YOI A;  1WPI A;  6GSW A;  3A3T A;  5JCU A;  3FKF A;  5EY6 A;  4NWY A;  1V98 A;  2KUC A;  1ZOF A;  3A2V A;  4GDF A;  1GSE A;  6GST A;  2XPD A;  4KB3 A;  2OE0 A;  3CRU A;  4O5U A;  4YKF A;  1VRS D;  4BPY A;  1PKW A;  3DYR A;  4MH3 A;  2MBT A;  2L6D A;  4GQC A;  4QL7 A;  3BCI A;  3MSZ A;  4O5Q A;  3IC8 A;  1JZO A;  4ZBA A;  4OWY A;  2RM5 A;  3VWU A;  3E9J B;  3P8W A;  2YZU A;  3CSH A;  3D4M A;  4KSO A;  3M1G A;  1F2E A;  3RDW A;  3TKS E;  4G01 A;  3CSJ A;  2O87 A;  3FEU A;  1GP1 A;  2VAF A;  4KUN A;  2YZH A;  3S9F A;  3FY7 A;  5D9X A;  2LRC A;  4HS1 A;  4DSR A;  5IPH A;  1XW6 A;  2X49 A;  5KN2 A;  4HJ2 A;  3ME7 A;  1QXH A;  3MAK A;  2E0Q A;  2C0D A;  3H93 A;  3F4T A;  1WJK A;  2DML A;  1X5D A;  4XIH A;  5J4Y A;  3LYP A;  3HXS A;  5FT3 A;  1MD3 A;  6GSX A;  4ISD A;  3GST A;  1NHY A;  3ZIT A;  5JWQ B;  3G7Y A;  2H72 A;  2OE3 A;  2MMA A;  4OCE A;  16GS A;  3VI5 A;  2FA4 A;  2C4J A;  4WBR D;  1IYI A;  1K0B A;  2B5E A;  1E6B A;  2EIR A;  1J0F A;  2JSZ A;  11GS A;  3HVV A;  3DIE A;  3EWL A;  3TU3 B;  4QMK A;  2M46 A;  2QA2 A;  2OAC A;  5B6N A;  4KW6 A;  2K9F A;  4MA9 A;  4H86 A;  1FVK A;  5JWR B;  2OE1 A;  5B8B A;  3O76 A;  3HJM A;  2IN3 A;  1KEB A;  1Z7R A;  2R3X A;  1SL0 B;  3LJR A;  4ZIJ A;  4NMU A;  1BG1 A;  3L4N A;  1K0A A;  1F3B A;  2AAW A;  3D22 A;  3HMJ G;  2DMM A;  1GSD A;  2PGT A;  2GQK A;  3APS A;  1F6M C;  2H0G A;  1FW1 A;  2WUL A;  2B7J A;  2R2J A;  3HYP A;  1WRY A;  1G7O A;  3FZA A;  2HYX A;  1R7H A;  5COH A;  2K18 A;  2NBS A;  4LLR A;  3IHQ A;  1I5G A;  1JZD A;  3E3E A;  1X9M B;  3J7Y b;  2LNT A;  2FUG 2;  2LNS A;  4ECJ A;  1AIU A;  5J9C A;  1B8X A;  5FHI A;  3CBU A;  2R0P A;  3D5J A;  3C8E A;  3UVH A;  3L9U A;  3ZRD A;  3QFA C;  2YWI A;  1ZYE A;  1M9B A;  5IMV A;  4XCS A;  18GS A;  1TTZ A;  2E2M A;  3Q74 A;  3MWH A;  4CHS A;  3F4R A;  4MPF A;  2GT6 A;  2OA7 A;  3IE3 A;  4A5P A;  4IN0 A;  3TGZ A;  4TRX A;  3H8Q A;  3M9J A;  3IK9 A;  4X4J A;  2VCW A;  4IBP A;  5ELA A;  4G19 A;  4Q5N A;  3UVT A;  5IMF A;  4EDZ A;  2P5R A;  1FG4 A;  2QA1 A;  5F05 A;  4OFT A;  4MJC A;  5KN1 A;  4MJE A;  4MK3 A;  1V57 A;  4XS6 A;  5J4V A;  5ECO B;  4BA7 A;  2PU9 C;  3TRX A;  1V58 A;  4EIQ A;  3W6G A;  2FGX A;  2V6O A;  3APQ A;  1LBK A;  4MF6 A;  1PL1 A;  4TVE A;  1XPV A;  1BG5 A;  2ZNM A;  2EC4 A;  3D0Z A;  4ZL8 A;  1JLV A;  3GN3 A;  2RII A;  4FIW A;  3QPM A;  3I6A A;  4HOJ A;  4E68 A;  4BVX A;  20GS A;  1AAZ A;  2IJY A;  1TXU A;  3ED3 A;  2RM6 A;  1S3A A;  4O7H A;  1DE2 A;  4POK A;  2WJU A;  3QDN A;  3US3 A;  5HR3 A;  1PX7 A;  1A0R P;  2XPE A;  4K8M A;  2N5F A;  5A5H A;  5IOX A;  5GAP D;  5G5F A;  2ON7 A;  3DD3 A;  5J3R A;  4WBJ A;  3N9J A;  3LGC A;  1HQO A;  3KTL A;  5F06 A;  3NIV A;  3IR4 A;  1AC1 A;  2C3N A;  5G31 A;  1TK5 B;  1NW2 A;  3VUR A;  1A8L A;  1XWB A;  2LJR A;  4ML1 A;  1PMT A;  2LRT A;  2GTU A;  1MDJ A;  4GF0 A;  3KH9 A;  1LJR A;  3PH9 A;  4WR4 A;  1T1V A;  1TJD A;  1BF5 A;  4Q5Q A;  1FO5 A;  1OKD A;  2VLV A;  3O3T A;  2B5Y A;  5CAX A;  1HD2 A;  3F4S A;  3HD5 A;  4N11 A;  3RHC A;  1OAZ A;  4ZBD A;  2HZF A;  4XHM A;  4YQV A;  4MAB A;  4EVM A;  2HNL A;  1T3B A;  2HQT A;  1HNB A;  3Q18 A;  1O85 A;  3O6T A;  4JU5 A;  3VLN A;  3LSZ A;  5CRH A;  3C73 A;  1QFN A;  1JFU A;  3IOS A;  2LST A;  4OMV A;  1WP0 A;  4RQR A;  3GUS A;  1G6W A;  4BVX B;  2KOK A;  3M8N A;  3KP9 A;  3ERF A;  2M72 A;  4YH2 A;  1G7E A;  1ZYP A;  4MJA A;  2X8G A;  3FZ4 A;  2I9H A;  1DE1 A;  3GMF A;  1YF0 A;  4PTS A;  3ZIV A;  4ILF A;  4V1A g;  9GSS A;  5A5H B;  3LQ7 A;  2ZUP A;  3BCK A;  4GCI A;  2IPA A;  3TOU A;  4YAP A;  4AJ8 A;  2XC2 A;  5B7C A;  3KIJ A;  4HJM A;  4POL A;  4MZW A;  1PSQ A;  2WCI A;  1TOF A;  2HRN A;  5EL8 A;  5F07 A;  1M2B A;  4TR4 A;  3TUE A;  5DAK A;  2C0F A;  6GSS A;  3ZL5 A;  4PNF A;  5F8B A;  2VCT A;  4CY6 A;  2AJQ B;  4RQX A;  1XW9 A;  3RBT A;  1TK0 B;  4N3Z A;  4XS1 A;  2H70 A;  2H01 A;  4I2T A;  2OAD A;  4KE3 A;  6GSV A;  3ZLP A;  5J41 A;  4G2E A;  1R4W A;  2FD3 A;  2CZ3 A;  2VOC A;  2OBK A;  4I5Q A;  3MDK A;  4P3Y B;  5J47 A;  5KOW A;  1G0T A;  3PGT A;  2LQQ A;  5DCG A;  1OC8 A;  1YZX A;  3EMP A;  5J9B A;  4XTS A;  2C0G A;  5A5K A;  1EEM A;  2AB6 A;  3KMN A;  1SJ6 A;  1GTI A;  10GS A;  4YAV A;  3D4T A;  3IA1 A;  4RI6 A;  1X5C A;  1U3I A;  1SL2 B;  1FOV A;  1TRU A;  1HYU A;  2G0F A;  2WFC A;  2C80 A;  2VCQ A;  1URM A;  4J57 E;  2CX3 A;  4KDY A;  4G0I A;  1TRW A;  4JE1 A;  1PX6 A;  2ZCT A;  4HU7 A;  3LG6 A;  4G10 A;  1B48 A;  1WMJ A;  2CX4 A;  1YDK A;  5CYY A;  2H6X A;  2FA8 A;  2N5B A;  2C3T A;  3EU4 A;  4NV2 A;  2H66 A;  5H5S A;  2JU5 A;  4EO3 A;  2OJL A;  5DAK B;  4N30 A;  2FWH A;  1TU7 A;  2IMI A;  4PUF C;  1VF2 A;  1SJI A;  1BYE A;  5KEJ A;  3VPT A;  1JZR A;  1MD4 A;  1VGL A;  1OE8 A;  2PVQ A;  3FR9 A;  1B4Q A;  2I3Y A;  1WWJ A;  2DC5 A;  3GFK A;  4GTU A;  2CA8 A;  5HFG A;  5ECR B;  2H19 A;  3WD6 A;  2WGR A;  1ILO A;  3A2W A;  3TJF A;  1BAY A;  2HZE A;  2YAN A;  1ACV A;  3ZZX A;  2K8S A;  1HNC A;  14GS A;  1K0M A;  4KND A;  4KA0 A;  3UOM A;  2FWE A;  2HI7 A;  1M2A A;  3U5R E;  4Q5R A;  3VK9 A;  4IP1 A;  1W4V A;  3F9U A;  3DVW A;  3IXR A;  5A34 A;  3C7M A;  1GSF A;  3GNJ A;  2VM2 A;  1C72 A;  5HR0 A;  5DJM A;  1GLP A;  2VCX A;  1FHE A;  1M7T A;  1AW9 A;  4MF5 A;  3HDC A;  3QFB C;  4F2I A;  2M80 A;  2J9H A;  3A5W A;  5AIV A;  3ZVJ D;  4Z2R A;  4ECI A;  1QQ2 A;  3QAV A;  2XBQ A;  3QCP A;  4HI7 A;  4AKG A;  3C1R A;  3CXG A;  1VF3 A;  1GWC A;  5IMA A;  4TW5 A;  4ZB7 A;  1LU4 A;  2LEG A;  1O8X A;  1SKW B;  1SK2 A;  1GUL A;  4IP6 A;  3L0H A;  3FK8 A;  4TXV A;  4AJ7 A;  1JHB A;  5INY A;  2VO4 A;  1TRS A;  3DRN A;  3GA4 A;  3EMX A;  1OYJ A;  2AYT A;  1ZMA A;  5DJL A;  5D96 A;  3BBY A;  4NPB A;  2IMD A;  5C04 A;  1SD9 A;  2H1G A;  5J5N A;  5AIS A;  4N0Z A;  2HZE B;  4O92 A;  1GNW A;  2JZS A;  5D93 A;  5A1N A;  2R0G A;  1H75 A;  1YJ6 A;  2PPT A;  2DJ3 A;  1K3L A;  3KM6 A;  3GKM A;  2HLS A;  2LJA A;  2V32 A;  2AV4 A;  2PMT A;  1ERW A;  1N25 A;  1EOH A;  5A34 B;  2NTO A;  4DSQ A;  1S3C A;  2JZR A;  2DIY A;  2DJK A;  2V1M A;  4JRR A;  2WDU A;  4POB A;  1K0D A;  2DJ2 A;  4PUA A;  3DXB A;  4EDY A;  2IME A;  1EP7 A;  1BQ7 A;  4PX1 A;  1EP8 A;  2DJ0 A;  3M3M A;  4KCA A;  4PQI A;  3ZTL A;  2OBI A;  1ERV A;  1T4Z A;  3HZ4 A;  4LA1 A;  4LMV A;  2KP2 A;  3F6F A;  2V6K A;  2RUF A;  4KH7 A;  4E8H A;  1THX A;  2JL4 A;  4K7I A;  7GSS A;  1F3A A;  1X9S B;  3GYK A;  5ENU A;  3WYW A;  3BD2 A;  2GST A;  4ICY A;  1WOU A;  2VD1 A;  5D9V A;  5IOW A;  5CRG A;  1DUG A;  3A5I A;  3TJB A;  5DAL A;  2F9S A;  1OC9 A;  2MZC A;  4V2N A;  3LWA A;  1SKS B;  2KLX A;  3F8U A;  4IQA A;  2H1D A;  2GZY A;  2CAQ A;  1A8Y A;  1O73 A;  1VF4 A;  3QAW A;  2IL3 A;  5A1N B;  4TN8 A;  1YEP A;  2TRC P;  1O81 A;  2P5Q A;  4BL7 A;  2EFC A;  2H30 A;  5JWO B;  5KOX A;  1EGO A;  4FQU A;  1SYR A;  1FB0 A;  2JAC A;  1Z3E A;  3UBK A;  2IIY A;  1AQV A;  4V2L A;  1EV9 A;  2VIM A;  3CRT A;  2K8V A;  3V1W A;  4Z7X A;  4G0L A;  2H1A A;  2MMO A;  2O8V B;  3ZFL A;  1SVL A;  2UZ8 A;  5AN1 A;  1YY7 A;  1PRX A;  4PXO A;  1PKZ A;  5ECH B;  4L0U A;  1TU8 A;  2YWM A;  2GQM A;  4K0G A;  4IS0 A;  3VWX A;  2WS2 A;  2RUE A;  4EIP A;  3ZYW A;  2MMZ A;  4I97 A;  2O7K A;  2HT9 A;  5H5R A;  1Q4J A;  4BWQ A;  4X0X A;  4K2X A;  2F51 A;  1USB A;  2PUK C;  4ECB A;  1ERT A;  2NVL A;  1U88 A;  5IIZ A;  1K0O A;  3GX8 A;  4N10 A;  3WT1 A;  3TKS A;  3IC4 A;  3VFI A;  2C8U A;  2L57 A;  2GGT A;  5CNW A;  4ZL7 A;  3Q6O A;  5DAL B;  2HRK A;  6GSU A;  5DBQ A;  1OC9 B;  3AY8 A;  3SWL A;  4WXT A;  4LMW A;  1PD2 1;  5DQY A;  2VL9 A;  4K9Z A;  2QKE A;  2H0I A;  4CDO A;  2VL2 A;  4GWR A;  2MMN A;  1GH2 A;  3TJK A;  3Q19 A;  3K8N A;  1HNA A;  3N5O A;  4K2D A;  4BL7 B;  2R5G A;  3CSI A;  2ON5 A;  2F8A A;  1ZL9 A;  2JSY A;  2TIR A;  2IFQ A;  1O7U A;  4BVY A;  1UVZ A;  3ZRE A;  5IPG A;  3FW2 A;  5J40 A;  1SJZ A;  4DVC A;  1MEK A;  1EEJ A;  1A23 A;  3F0I A;  4OFM A;  2H1L A;  1DSB A;  1U6T A;  4NV5 A;  3TKP A;  3G9B A;  1SU9 A;  3LXZ A;  3M0F A;  1FOH A;  3KD0 A;  3EC3 A;  3QOU A;  3CWG A;  2YWN A;  1Z5Y E;  1XFL A;  2LRN A;  3CYN A;  2L6C A;  3LEF A;  1O6J A;  1K3O A;  1OVN A;  1XOA A;  2X4A A;  2X8H A;  5E4W A;  3KMO A;  4DSS A;  3KEB A;  3P2A A;  3VPQ A;  4LL4 B;  2O85 A;  2CAI A;  3P90 A;  2VCZ A;  2BMX A;  1GSU A;  3TB2 A;  3GKK A;  4AGS A;  5IM9 A;  5JCG A;  2LTK A;  4J2F A;  4WR5 A;  3BJ5 A;  1GNE A;  3KXO A;  4KF9 A;  4ZB6 A;  3FRC A;  2YWO A;  3EU3 A;  3TOT A;  2HRK B;  2J23 A;  4FO5 A;  3GUR A;  5GST A;  4ZIL A;  2X99 A;  3QAG A;  3HJP A;  4ACS A;  2YNX A;  1X0R A;  1G6Y A;  2HRA A;  3HZ8 A;  3EE2 A;  1XVQ A;  4FH8 A;  1F9M A;  1MDK A;  1GUM A;  2OKA A;  2IFQ B;  4IW9 A;  1QGV A;  4BVY B;  4F03 A;  1SYX A;  1MDI A;  4OFN A;  2O89 A;  3KCM A;  1S3D A;  4BWS A;  4I6X A;  3FMW A;  3LYK A;  1Y6E A;  1YVL A;  5CRW A;  2R37 A;  4GSN A;  4IJI A;  2BJX A;  3HKR A;  3LXT A;  1QUW A;  2I81 A;  2VUP A;  2HXK A;  5GSS A;  2VKZ G;  4O5R A;  3IPZ A;  1EOG A;  3TRP A;  3F3R A;  1ZGN A;  5CO3 A;  3H1N A;  1ZZY A;  4USS A;  2GDR A;  4DSS B;  2GQL A;  3I43 A;  1PA3 A;  4PQH A;  1NM3 A;  5DCH A;  1GLQ A;  4K5S A;  1XXU A;  5BRT A;  5ECM B;  1PN0 A;  2L4Q A;  3GKN A;  4ULX A;  2L5L A;  4YQU A;  19GS A;  2EFD A;  3GH9 A;  1GL8 A;  2KHP A;  4MCU A;  1JLW A;  3L9S A;  1ML6 A;  1MTC A;  5C00 A;  2WZ9 A;  3OR5 A;  2L4C A;  1F37 A;  1SVO A;  3LW9 A;  1T7P B;  2X64 A;  2B7K A;  4IQ1 A;  3ME8 A;  3GTU A;  1SK0 A;  2YPM A;  1A0F A;  2GT5 A;  4L0W A;  4K7N A;  4XS4 A;  12GS A;  4I2U A;  3EYT A;  1XW5 A;  1PQN A;  2F3M A;  2WB9 A;  2L59 A;  22GS A;  2A4H A;  4J56 E;  1TW9 A;  1OE7 A;  1K3Y A;  1R26 A;  2YV7 A;  4F0C A;  3IAS 2;  1EGR A;  3ISO A;  3HHV A;  5ID2 A;  1EZK A;  2BTO T;  2YJ7 A;  4L8E A;  2YP6 A;  1Y1U A;  2CVK A;  4EL1 A;  1YEX A;  17GS A;  5B6M A;  1TDI A;  4MH2 A;  4Z2T A;  4ZXG A;  3NOF A;  4MMM A;  2IWT A;  5JCW A;  4EC0 A;  4WF4 A;  4K5R A;  1Z6N A;  2H73 A;  2A2S A;  2IMK A;  4EE0 A;  1CQH A;  1BJX A;  4NHZ A;  1ERU A;  2EFE A;  3R3E A;  3WT2 A;  3L78 A;  1E2Y A;  2WRT A;  2HSN A;  3HVS A;  1XCC A;  5IQY A;  1V2A A;  1XWA A;  3L9V A;  4O32 A;  1FVJ A;  1PGT A;  3GHA A;  1QMV A;  3F63 A;  4PUR A;  2JZT A;  1SEN A;  3D6I A;  1W89 A;  5FWG A;  4WEY A;  3GTU B;  5J4U A;  1SD8 A;  2K6V A;  2VD0 A;  4XS4 B;  3GRX A;  4RI7 A;  4HEA 2;  1N8J A;  5LNK e;  3HY2 A;  1ST9 A;  1A2J A;  4E8E A;  3GL3 A;  5GAN D;  4V2M A;  4GST A;  3E0U A;  4IJ3 A;  4OO4 A;  5ID2 B;  1GTU A;  3EPT A;  5ABR A;  1GUK A;  3DKS A;  2PER A;  2R6K A;  1O8W A;  5D8I A;  2C1Y A;  5LD0 A;  1YF1 A;  1U87 A;  1WIK A;  5A4V A;  2YJH A;  1B9Y C;  4Q5F A;  1XWG A;  4K1F A;  1ABA A;  2FWG A;  1FB6 A;  4WET A;  1AQX A;  3ZFB A;  2AHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...