4OMVA

Crystal structure of a putative macrophage growth locus, subunit a from francisella tularensis schu s4
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
194
Chain Sequence
AMLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSKHLEELNIITPNGNIPTLSTDDFAVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQANEIKMLMQRDIISTYKKIVSERAQNINVLTLIITFVFYYFIKLKISIPTKDKNIIKEIKELLSEPNFIKTIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage growth locus, subunit A
publication title Crystal Structure of a Putative Macrophage Growth Locus, subunit A From Francisella tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Protein binding
total genus 61
structure length 194
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4omvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4omvA01
3GV1A 5DALA 4G0IA 3GL5A 1G0TA 3HVVA 4AJ7A 4TOPA 2I1UA 1XFLA 1B48A 4EUYA 2HZFA 3FR3A 4JZQA 1UA5A 5CREA 5IM9A 1GTUA 2YWIA 1EEJA 1H75A 4XS4B 5D93A 2N5BA 2K8SA 5ECOB 3HY2A 14GSA 1EP8A 1RK4A 3PH9A 4KW6A 1TU7A 3A2XA 4EDZA 4KDXA 1PKWA 2YWNA 1URMA 4IVFA 1GSFA 3IBHA 3US3A 5COHA 4GF0A 2KP2A 4WR4A 2LUSA 4G19A 2KLXA 4TXOA 5A4UA 3KXOA 3FEUA 4Q5RA 7GSSA 3D4TA 1SKRB 2H1BA 1S3AA 5J9CA 3A3TA 1GSEA 2HQTA 1VGLA 2VOCA 4MZBA 2FWGA 4HUAA 1B8XA 3E3EA 3ZFLA 2FA4A 2GT6A 2R6KA 5DAKA 2IMFA 11GSA 5EY6A 2WJUA 2N5FA 1PD21 5ECQB 2C8UA 3QDNA 1THXA 3MAKA 3MSZA 1T8EB 2QGVA 2R3XA 4NMUA 4TR1B 2QSIA 2MBTA 2OBIA 4GTUA 2VD1A 3VWUA 3TKPA 3EURA 3HJOA 4MMMA 4POMA 3CMIA 5CRDA 1ST9A 2JADA 2CT6A 3RBTA 1M0UA 4WEYA 1QK8A 4ECBA 1U87A 1F6MC 4MH2A 1TKDB 4PUAA 5JCWA 2R5GA 4HZ4A 3VWWA 2YV7A 2L5OA 3TRXA 3O3TA 2GS3A 3HZ8A 1XBSA 3C73A 2A4VA 4K2DA 4IS0A 1JLWA 4WBRD 2HRKA 4RI7A 5C04A 2B1LA 2V41A 1WRYA 3N5OA 5KN0A 2LJKA 1M2AA 4TVEA 1I5GA 2CZ3A 2I81A 4AJ8A 5CAXA 2JSZA 4IQ1A 3ZFBA 2F8AA 2HSYA 2FHEA 3Q6OA 3F3RA 4GSSA 1QUWA 5ECRB 2F9SA 1Z9HA 2BMXA 3DVXA 3ZLPA 5F05A 1GP1A 3UIWA 5DDLA 2OJLA 4DVCA 2KUCA 3UBLA 3Q74A 2E2MA 3HA9A 1TJDA 1GUKA 3O6TA 4GLTA 2B5EA 2GDRA 1KBNA 10GSA 4O32A 4Q5NA 3DMLA 4HJ2A 1YKCA 4F82A 3TJGA 3ZRDA 4ZIJA 1Q98A 3KIJA 4XRAA 3DEXA 4WKWA 2LRCA 4TXVA 2VL3A 1B4PA 4V2LA 3F9UA 4NAXA 3GX0A 5HFGA 5B6MA 2MMNA 3HD5A 1U3IA 4AF2A 3ZVJA 3IC4A 1SYRA 3RAZA 1PX6A 4USSA 4V1Ap 5LCZA 4KDUA 4KGIA 4OCEA 2I9HA 4OMVA 4YQMA 2REMA 1BAYA 3UVHA 2NDOA 3F6FA 2MMAA 5HR0A 3TCOA 9GSSA 1ABAA 4ZL8A 3KM6A 4F03A 4TR1A 3F4TA 2CVBA 1SK0A 2C80A 4K0GA 4EE0A 4PX1A 1V58A 4JEDA 5AISA 3EVIA 2XPDA 4JU5A 2KP1A 19GSA 5G5EA 4ML1A 1J08A 5FHIA 3L9VA 3IK9A 1TRUA 4ILFA 1TDIA 6GSUA 2O89A 5FWGA 1G6WA 3U6VA 1A8LA 2Z9SA 2HZEB 2O8VB 5HR3A 5CRHA 4IGJA 1XW6A 2C4JA 1K0OA 3SBCA 1YY7A 5ELAA 2LRNA 2YV9A 1DE1A 4F2IA 4PUFC 5LNKe 3QAWA 4KAEA 1SK1A 5D73A 2VM2A 1K0CA 2WFCA 2DMMA 3ZZXA 4V2MA 2LNTA 2JZSA 2DC5A 1AUCA 1JZOA 1T1VA 4FO5A 5KEJA 4L8EA 1ERUA 3ZL5A 3SWLA 3LYKA 2ON5A 2ES7A 4Q5FA 2EC4A 4PNFA 4MDCA 1ZYEA 1ZCPA 2DJJA 3TOTA 3FZ5A 6GSSA 3ZMKA 2DBCA 3KGKA 2TRCP 3HYPA 4RI6A 1EZKA 1XZOA 4IP6A 1VF1A 3EE2A 3VPQA 5GSSA 4XS1A 2NVLA 1OAZA 3C1SA 1NW2A 2WB9A 3GH6A 4NV5A 1Z7RA 3D0ZA 4HQSA 3H93A 3LG6A 4TN8A 2AYTA 4MP4A 13GSA 2V6KA 3LXTA 2LSTA 2H0HA 3FHKA 3VI7A 2VCTA 2VCVA 5IMVA 2FWEA 4MCUA 3ERWA 2C3TA 4KX4A 3D4MA 2WRTA 1ZGNA 1TU8A 2R4VA 4FYUA 1MTCA 1SJIA 1BYEA 3DWVA 4MABA 3I9V2 3EMPA 2O7KA 1FB6A 3ERFA 1MEKA 4N10A 4CHSA 5A4WA 2RM5A 1X9WB 3UARA 4ULXA 3D5JA 2MYGA 1CQHA 3BCKA 2X8CA 2JZTA 5A4VA 2M46A 4IELA 1I9DA 4L0WA 2KOKA 3FZ9A 5JWOB 1HQOA 3GSSA 2VUPA 3M1GA 1V40A 4XS6A 4OWYA 5F07A 18GSA 3E9JB 2HRNA 1R7HA 3CBUA 2C3QA 3QFAC 1SD8A 4HOJA 1WP0A 3IOSA 1R5AA 1KTEA 1A23A 8GSSA 3E0UA 4GRFA 4CW9A 1B4QA 3UBKA 5HR2A 1YEXA 5D9VA 1GUHA 1TRVA 3VK9A 1TRSA 3VFIA 2IMEA 5ENUA 5DBQA 2HT9A 3P8WA 1Y6EA 1TTZA 5G30A 20GSA 5DVBA 2WZ9A 5IO0A 4MH3A 4XHMA 1QFNA 3ZYWA 3ISOA 4G9HA 4K7OA 2FUG2 4K6XA 4GXZA 1GL8A 1FG4A 5CO3A 3GKMA 3OR5A 4DSQA 5G1LA 1O6JA 2IFQA 3QAVA 4OFTA 3APOA 2F51A 3GTUB 1PKZA 3HCZA 1DE2A 4N30A 4GCIA 2CV4A 4KSMA 4ZXGA 3GA4A 4IW9A 2XC2A 3P2AA 4LL1B 1BEDA 3F4SA 2FWHA 1A2LA 1O81A 2H1GA 4F0CA 3CXGA 4ZILA 2VIMA 4I8BA 2H6XA 4ZBDA 1ERVA 1WE0A 3IHQA 3DRNA 1OYJA 4MPFA 2LQOA 2IMIA 2F3MA 2FNOA 3O76A 4LMVA 4I2TA 1AXDA 3DGQA 4X1UA 2YNXA 4ZL7A 1XW5A 2CX4A 2VL2C 2TIRA 2VO4A 5J9BA 2FY6A 5IMFA 3MNGA 1W89A 2CQ9A 5GZZB 4XRDA 3BCIA 5E4WA 4JR6A 1YQ1A 4G0LA 2ZNMA 1QQ2A 3NZNA 17GSA 3GSTA 4H86A 2HE3A 3UEMA 1JZRA 4KE3A 2CX3A 1Y25A 5HFIA 1WPIA 2C3NA 1PL1A 4OD7A 3UMAA 2FD3A 5ABRA 5H5RA 5ELGA 4HEA2 2MZCA 3VWVA 4F0BA 1DSBA 1EOGA 3GFKA 1DUGA 2YPMA 3EWLA 1OC9A 1ZL9A 4O92A 3TDGA 3WGDA 1H4OA 4ISDA 4DSSB 3W6GA 4EXJA 1ERWA 5AIXA 1Z6NA 2AB6A 2HXKA 3QOUA 2DJ0A 2GTUA 3VWXA 2H72A 3WD6A 2JZRA 4ZBBA 5DJMA 1O73A 2K8VA 2TRXA 3RHBA 2GSSA 2FWFA 1A0RP 1EV4A 1JZWA 2H30A 3BJ5A 3HJMA 4BL7A 2LV3A 4HU9A 1BJXA 2IJYA 2GLRA 3L9UA 5AIVA 2HSMB 4ECIA 2PVQA 4JBBA 2FCHA 5DCGA 1FVKA 3QCPA 3TKQA 5IMZA 2GZZA 2UZ8A 1RW1A 4MF7A 2BTOT 3PGTA 1VF2A 5ID2B 1ACVA 1XVWA 2B1KA 4IKHA 4EF0A 3CSJA 1QXHA 2IWTA 4PQ1A 5JWQB 1SL1B 3CSIA 1OVNA 2EIRA 1SL0B 4QQ7A 2R2JA 1XOBA 5BMUA 3IK7A 1Z3EA 4L0UA 1TK8B 4D73B 1G7EA 1MDKA 2E2GA 4HI7A 1X5DA 1U6TA 2P5QA 4NWYA 4CDOA 3G7JA 5ECIB 1GH2A 2WDUA 2O85A 2L6CA 4G10A 4KDYA 4KH7A 1U3AA 2XHFA 3DD3A 2X8HA 2RM6A 1A0FA 1LJRA 3AY8A 3QR6A 3QMXA 2I3YA 4ZB6A 1PA3A 3P90A 4BWQA 4WBJA 3WGXA 2D2ZA 2MMZA 4NHWA 2LEGA 4FYBA 2H0IA 3J7Yb 2EIOA 2M80A 2PUKC 5KN2A 2E7PA 4Q5QA 4BVYB 2PWJA 3UJ1A 4XS4A 3KCMA 1OC3A 1GSQA 1BG5A 3PPUA 2I4AA 2DIYA 5IPHA 2VCQA 1ILOA 3IRAA 3GKKA 4WETA 4GSTA 1O85A 2V6OA 1MDIA 2GZYA 4TR4A 2GQLA 1HNAA 3EINA 2ZUPA 2FLSA 2CAQA 3BBYA 2LTKA 4IP1A 4J56E 3J7Yk 1J9BA 5AN1A 1XWCA 1UVZA 2JSYA 4POLA 4J2FA 1GSYA 6GSTA 1S3CA 4OFNA 1N8JA 3KEBA 3ME8A 1VRSD 2WULA 1ZMAA 1JFUA 1F3BA 3P7XA 2AHEA 2GVPA 2KHPA 4MF6A 4PNGA 3KZQA 1N2AA 2DIZA 2X8GA 1X9MB 3IPZA 5DQSA 5KN3A 4ZB9A 1GSDA 3LFLA 2PVOC 3EYTA 4IBPA 1F2EA 5DCHA 1PGTA 1BX9A 2CVKA 3LGCA 2HRFA 5CRWA 2LJAA 2X64A 2GSTA 4KSOA 2B5XA 3FYGA 3QFBC 1GUMA 1X5EA 1YF1A 4TKYA 1ZOFA 1F3AA 4I97A 2YANA 5CP1A 2X99A 3TJBA 5G31A 4IQAA 4ZL9A 3TKRA 3APSA 1V98A 3ERGA 2K18A 2OE3A 5F8BA 4BVXB 1MDJA 3GHAA 2VCZA 2K9FA 1WMJA 5GAND 5GSTA 2C0FA 1LBKA 2VCWA 2YJHA 1EWXA 1IYIA 5EVOA 3N9JA 5GAPD 1X5CA 4HZ2A 5H5SA 2G2QA 4Z7XA 2ON7A 2R37A 5D9XA 3CTFA 4GQFA 1SJZA 2V32A 1Q4JA 1A2JA 3F6DA 3TJFA 2QC7A 2J9HA 1TI3A 1F9MA 1AAZA 16GSA 2HFDA 1O7UA 4ECJA 4FH8A 3F63A 1GWCA 3VURA 1PN9A 1X9SB 1M7TA 2LRTA 2VLVA 4I2UA 6GSWA 2V2GA 2DJ1A 3TJJA 1K0NA 3VPTA 3KTBA 3K8NA 3TKSE 3LXZA 4J57E 5E59A 3A2VA 2HYXA 2LKUA 1GNWA 1K3YA 4K1FA 2GT5A 4XTSA 2WS2A 3D22A 5DALB 2OADA 1C72A 4KCAA 3A2WA 3IR4A 3C8EA 4MA9A 2IMKA 2H6ZA 4E8HA 1HNBA 1T4YA 3BD2A 1GTAA 5D96A 4HJMA 4N0VA 1MD4A 3CRTA 1SJ6A 3VLNA 3G7YA 5HR1A 3HDCA 2P31A 1M99A 1T3BA 4K8MA 3NOFA 3RPNA 3BOAA 5DQYA 5J5NA 4V2NA 22GSA 1E2YA 3DKSA 2F8FA 2H0GA 1SD9A 2YWOA 2HZEA 1PX7A 3R2QA 5LD0A 4ZBAA 1JLVA 1NM3A 3KMNA 1JHBA 2OE1A 3HKRA 4FQUA 1M2BA 4MF5A 2C0EA 3ME7A 4KNDA 5F0GA 2VM1A 1TK5B 4E8EA 4YQVA 5L71A 2OBKA 5D8IA 3F4RA 3PR8A 1KNGA 4MJAA 2VLUA 1SU9A 1YZXA 4EKZA 1WOUA 3KP9A 4GSNA 2RUFA 5DAKB 4MLYA 5B8AA 1S3DA 3QD9A 2FGXA 2XPEA 4N0ZA 1FW1A 1ZZYA 3EU3A 4DEJA 1ZYQB 3JCML 1XW9A 5F06A 2LNSA 2GSQA 4XCSA 3TKSC 2H73A 4PQIA 1QMVA 3ZIJA 4MJEA 1JZDA 5B7CA 1M9BA 2P0GA 5J4UA 2WCIA 2CA8A 1YKAA 4YAVA 4XIHA 2H1DA 3GYKA 4LMWA 2VL9A 2CZ2A 4EL1A 5G5FA 1IYHA 4MK3A 2JU5A 2JACA 5DJLA 1EGOA 3GMFA 1TOFA 1FB0A 4YH2A 3FR6A 2A2SA 4POBA 1PL2A 4PQHA 2VCXA 2J23A 3IE3A 4WXTA 12GSA 1ML6A 2OKAA 2PBJA 2WGRA 3FKFA 3QPMA 4AGSA 2N5AA 3KTLA 2HRKB 4WF4A 1WIKA 2HSNB 2LJRA 3HHVA 5EL8A 1A8YA 1ON4A 3H4KA 1EP7A 1TI1A 1YEPA 4GQCA 4P3YB 4MZCA 5ECKB 3S9FA 3QAGA 3M9JA 3TRQA 3M0FA 5CNWA 2GZPA 2XBQA 3EU4A 3H8QA 1GLPA 3LQ7A 2PGTA 3KD0A 4ML6A 2H8LA 3ZIVA 1AQVA 1OKTA 4JRRA 3M8NA 2ZCTA 1Z6MA 1FAAA 4EO3A 1NHOA 1GSUA 1FO5A 3HJPA 4X43A 4F9ZA 1E6BA 2YZUA 3GIXA 3RPPA 1YF0A 2BJXA 5JCGA 3C1RA 1TXXA 2IPAA 5ECNB 3D21A 2RUEA 4PTSA 3ZMLA 1XWAA 1XCCA 2EIQA 5ECSA 2H01A 3TKSA 4NPBA 1GSSA 2DJ3A 4OO5A 5JCUA 3TUEA 1TW9A 1RQMA 3GTUA 4TW5A 5D9TA 2DMLA 2K6VA 2H74A 2G0FA 5IOXA 1K0MA 1K3LA 3GURA 1U88A 2L6DA 2VL2A 5AGYA 1SK2A 2H76A 5HQPA 2YZHA 3IAM2 3I43A 5IQYA 2HNLA 1AQWA 2L4CA 6GSXA 1Z5YE 1NSWA 1J0FA 2PERA 2QKEA 1R26A 1HYUA 3RDWA 3G7IA 1SYXA 4TRXA 4PXOA 4MJCA 5IIZA 2YP6A 3WYWA 3H1NA 3IC8A 3GL3A 3WGEA 1XVQA 4NXIA 3TOUA 3HVSA 4IJIA 2DLXA 1OC8A 3G9BA 2H19A 3IXRA 4DSRA 2GQKA 4HU7A 2B3SA 3FW2A 2AAWA 1XWBA 2JL4A 2H6YA 1OE7A 1HNCA 3UOMA 3IV4A 3HZ4A 3CTGA 1VF3A 4RQRA 2VD0A 2DJ2A 3GKNA 1AIUA 3MWHA 4I5QA 4POKA 5IMAA 4MJBA 4HQZA 4ECCA 3A5WA 3L0HA 3KMOA 2XBIA 4MPGA 2H1AA 4YQUA 2V1MA 1X0RA 5ECHB 4DSSA 2AJQB 3GN3A 5H5QA 1V2AA 1THOA 1CQGA 1HD2A 4HS1A 1V9WA 2IIYA 3L4NA 1GLQA 1USBA 3V1WA 5IO2A 4G2EA 4WF5A 3GNJA 3HVXA 1TK0B 3Q19A 4K7IA 2L4QA 4BA7A 4LL4B 2DSAA 2A2RA 4X0XA 5CYYA 3TRPA 3RHCA 1FHEA 1M2DA 2HSMA 1K0BA 1GNEA 4O5RA 3L78A 5B6NA 3FRCA 3D6IA 3ED3A 5IPGA 2NPBA 5ID2A 2VAFA 3LJRA 2GQMA 5ECLB 1PSQA 2GGTA 1GRXA 4EC0A 4K9ZA 4GWRA 2YN1A 1EEMA 4LLRA 3PINA 1BQ7A 3R3EA 3APQA 4D73A 5ECMB 3UAPA 3IAS2 1SKWB 2IL3A 1ERTA 2B7JA 2IMDA 2FA8A 2GSRA 3C71A 4AJ6A 4OCFA 1EOHA 1NHYA 4EDYA 3FZ4A 3KH9A 1VF4A 1AW9A 2CVDA 3DXBA 3H79A 3CYNA 3M9KA 3GKXA 1R5PA 1WWJA 5ECPB 3GRXA 1W4VA 3DIEA 2B6MA 1PRXA 2RLIA 3W8JA 2YOIA 2HLSA 3MDKA 2VLTA 1MD3A 1V57A 2IN3A 6GSYA 4BVYA 3KH7A 4YAPA 2PN8A 4PURA 2C1YA 2PPTA 3ZITA 2H70A 4HDEA 3M3MA 1G7OA 2OE0A 2IFQB 4NV2A 5J3RA 3L9SA 3EMXA 1XIYA 1XWKA 5B8BA 2HI7A 3WT1A 2YCDA 2O87A 3LWAA 3WT2A 1GTBA 2LS5A 5HFKA 1XOAA 2NBSA 6GSVA 4RQXA 2AUVA 4MZWA 3DVWA 3FK8A 3I6AA 4FIWA 4JE1A 1TRWA 3UVTA 1UC7A 1FOVA 3VI5A 2L59A 3ZREA 4ZB8A 3LORA 4FYCA 4BWSA 5IOWA 1F37A 2H75A 5FT3A 2YWMA 3HXSA 4LA1A 3UL3A 4I6XA 3U5RE 1B9YC 3TJKA 2OACA 2B7KA 3LEFA 1M9AA 1SKSB 5CRGA 1AQXA 4K7NA 2HSHA 1LU4A 1K0AA 1UN2A 5G2ZA 5IMDA 2OA7A 1QGVA 1SL2B 2DJKA 3TB2A 3F0IA 4V1Ag 1K0DA 1XPVA 5C00A 3CRUA 4PGTA 1R4WA 2RIIA 4IN0A 2ALBA 2H66A 1XXUA 1PMTA 4KA0A 2CAIA 3ZVJD 4NHZA 2MBSA 1DBYA 1KEBA 2P5RA 3DYRA 4QL7A 2C0GA 1SENA 1OC9B 3GX8A 4WR5A 1T4ZA 2PMTA 4RUVA 1EGRA 1FVJA 5KN1A 4KB3A 1YDKA 4IJ3A 1B9XC 5A5KA 1A24A 4KUNA 4TXOB 4KF9A 4BVXA 4KCEA 4TR3A 3F8UA 3F3QA 5J41A 4ID0A 1WJKA 5IMCA 4ACSA 4TR0A 3EC3A 2H71A 5D9WA 4L5LA 5G1KA 1TP9A 3I69A 1PQNA 4OFMA 1OE8A 1O8WA 2MMOA 1K3OA 4EVMA 4BL7B 5JWRB 1Z7PA 1O8XA 2E0QA 4BPYA 4IHUA 4K0NA 2LQQA 1GULA 3FZAA 1A2MA 1T00A 4QL9A 3KP8A 3LYPA 3KJYA 2L5LA 3ZTLA 3FY7A 3GH9A 3FR9A 2PU9C 3W8SA 4G0KA 3IDVA 1XWGA 2M72A 5INYA 2NTOA 1G6YA 5EPFA 1YJ6A 4OO4A 3LSZA 3TGZA 3GUSA 3NIVA 1AC1A 2HRAA 2AV4A 4L5OA 2C0DA 1EV9A 2B5YA 1OKDA 4O7HA 4N11A 3CSHA 3C7MA 3Q18A 4JR4A 2L57A 1T7PB 3IA1A 2YJ7A 1GTIA
chains in the Genus database with same CATH superfamily
3GV1A 5DALA 4G0IA 3GL5A 1G0TA 3HVVA 4AJ7A 4TOPA 2I1UA 1XFLA 1B48A 4EUYA 2HZFA 3FR3A 4JZQA 1UA5A 5CREA 3EPTA 5IM9A 1GTUA 2YWIA 4AKHA 1EEJA 1H75A 4XS4B 5D93A 2N5BA 2K8SA 1ZYPA 5ECOB 3HY2A 14GSA 1EP8A 1RK4A 3PH9A 4KW6A 1TU7A 3A2XA 4K2XA 4EDZA 4KDXA 1PKWA 2YWNA 1URMA 4IVFA 1GSFA 3IBHA 3US3A 5COHA 4ZB7A 4GF0A 2KP2A 4WR4A 4PI0C 2LUSA 4G19A 2KLXA 4TXOA 5A4UA 3KXOA 3FEUA 4Q5RA 7GSSA 3D4TA 1SKRB 2H1BA 1S3AA 5J9CA 3A3TA 1GSEA 2HQTA 1VGLA 2VOCA 4MZBA 2FWGA 4HUAA 1B8XA 3E3EA 3ZFLA 2FA4A 2GT6A 2R6KA 5DAKA 2IMFA 11GSA 2UV8G 5EY6A 2WJUA 2N5FA 1PD21 5ECQB 2C8UA 3QDNA 1THXA 3MAKA 3MSZA 1T8EB 2QGVA 2R3XA 4NMUA 4TR1B 2QSIA 4CY6A 2MBTA 2OBIA 4GTUA 2VD1A 3VWUA 3TKPA 3EURA 3HJOA 4MMMA 4POMA 3CMIA 5CRDA 1ST9A 2JADA 2CT6A 3RBTA 1M0UA 4WEYA 4ICYA 1QK8A 4ECBA 1U87A 1F6MC 4MH2A 1TKDB 2A2PA 1S4BP 1I1IP 4PUAA 5JCWA 2R5GA 4HZ4A 3VWWA 2YV7A 2OT3A 3FMWA 2L5OA 5A5HB 3TRXA 3O3TA 2GS3A 3HZ8A 1XBSA 3C73A 2A4VA 4K2DA 4IS0A 1JLWA 4WBRD 2HRKA 4RI7A 5A1NA 5C04A 2B1LA 2V41A 1WRYA 3N5OA 5KN0A 2LJKA 1M2AA 4CY8A 4TVEA 1I5GA 2CZ3A 5J4YA 2I81A 4AJ8A 5CAXA 2JSZA 4IQ1A 3ZFBA 2F8AA 2HSYA 2FHEA 3Q6OA 3F3RA 4GSSA 1QUWA 5ECRB 2F9SA 1Z9HA 2BMXA 3DVXA 3ZLPA 5F05A 1GP1A 3UIWA 5DDLA 2OJLA 4DVCA 2KUCA 3UBLA 3Q74A 2E2MA 3HA9A 1TJDA 1GUKA 3O6TA 4GLTA 2B5EA 4G01A 2GDRA 1KBNA 10GSA 4O32A 4Q5NA 3DMLA 4HJ2A 1YKCA 4F82A 3TJGA 3ZRDA 4ZIJA 1Q98A 3KIJA 4XRAA 3DEXA 4WKWA 2LRCA 4TXVA 2VL3A 1B4PA 3MYDA 4V2LA 3F9UA 4NAXA 3GX0A 5HFGA 5B6MA 2MMNA 3HD5A 1U3IA 4AF2A 3ZVJA 3IC4A 1SYRA 3RAZA 1PX6A 4USSA 4V1Ap 5LCZA 4KDUA 4KGIA 4K5SA 4OCEA 2I9HA 4OMVA 4YQMA 2REMA 1BAYA 3UVHA 3A5IA 2NDOA 3F6FA 2MMAA 5HR0A 3TCOA 9GSSA 1ABAA 4ZL8A 3KM6A 3RGBC 4F03A 4TR1A 3F4TA 2CVBA 1SK0A 2C80A 4YKFA 4K0GA 4EE0A 4PX1A 1V58A 4JEDA 5AISA 3EVIA 2XPDA 4JU5A 2KP1A 2R0GA 19GSA 5G5EA 4ML1A 1J08A 5FHIA 3L9VA 2X4AA 3IK9A 1TRUA 4ILFA 1TDIA 6GSUA 2O89A 5FWGA 1G6WA 3U6VA 1A8LA 2Z9SA 2HZEB 2O8VB 5HR3A 5CRHA 4IGJA 1XW6A 2C4JA 1K0OA 3SBCA 1YY7A 5ELAA 2LRNA 2YV9A 1DE1A 4F2IA 4PUFC 5A5HA 5LNKe 3QAWA 4KAEA 1SK1A 5D73A 2VM2A 1K0CA 2WFCA 2DMMA 3ZZXA 4V2MA 2LNTA 2JZSA 2DC5A 1AUCA 1JZOA 1T1VA 4FO5A 5KEJA 4L8EA 1ERUA 3ZL5A 3SWLA 3LYKA 2ON5A 2ES7A 4Q5FA 2EC4A 4PNFA 4MDCA 1ZYEA 1ZCPA 2DJJA 3TOTA 3FZ5A 6GSSA 3ZMKA 2DBCA 3KGKA 2TRCP 3HYPA 1SVMA 4RI6A 1EZKA 1XZOA 4IP6A 1VF1A 3EE2A 3VPQA 5GSSA 4XS1A 2NVLA 1OAZA 3C1SA 1NW2A 2WB9A 3GH6A 4NV5A 1Z7RA 3D0ZA 4HQSA 3H93A 3LG6A 4TN8A 2AYTA 4MP4A 4AKXB 13GSA 2V6KA 3LXTA 2LSTA 2H0HA 3FHKA 3VI7A 2VCTA 2VCVA 5IMVA 2FWEA 4MCUA 3ERWA 2C3TA 4KX4A 3D4MA 2WRTA 1ZGNA 4HSCX 1FOHA 1TU8A 2R4VA 4FYUA 1MTCA 1SJIA 1BYEA 3DWVA 4MABA 3I9V2 3EMPA 2O7KA 1FB6A 3ERFA 1MEKA 4N10A 2O36A 4CHSA 1S3RA 4X4JA 5A4WA 2RM5A 1X9WB 3UARA 4ULXA 3D5JA 2MYGA 1CQHA 3BCKA 1BF5A 2X8CA 2JZTA 5A4VA 2M46A 4IELA 1I9DA 4L0WA 2KOKA 3FZ9A 5JWOB 1HQOA 4EIPA 3GSSA 2VUPA 3M1GA 1V40A 4XS6A 4OWYA 5F07A 18GSA 3E9JB 2HRNA 1R7HA 3CBUA 2C3QA 3QFAC 1SD8A 4HOJA 1WP0A 3IOSA 1R5AA 1KTEA 1A23A 8GSSA 3E0UA 4GRFA 4CW9A 1B4QA 3UBKA 5HR2A 1YEXA 5D9VA 1GUHA 1TRVA 3VK9A 1TRSA 3VFIA 2IMEA 5ENUA 5DBQA 2WW0A 2HT9A 3P8WA 1Y6EA 1TTZA 5G30A 20GSA 5DVBA 2WZ9A 1Y1UA 5IO0A 2H1LA 4MH3A 4XHMA 1QFNA 3ZYWA 3ISOA 4G9HA 4K7OA 2FUG2 4K6XA 4GXZA 1GL8A 1FG4A 5CO3A 3GKMA 3OR5A 4DSQA 5G1LA 1O6JA 2IFQA 3QAVA 4OFTA 3APOA 2F51A 3GTUB 1PKZA 3HCZA 1DE2A 4N30A 4GCIA 2CV4A 4KSMA 4ZXGA 3GA4A 3HMJG 4IW9A 2XC2A 3P2AA 4LL1B 1BEDA 5BMUB 3F4SA 2FWHA 1A2LA 1O81A 2H1GA 4F0CA 3CXGA 4ZILA 2VIMA 4I8BA 2H6XA 4ZBDA 1ERVA 1WE0A 3IHQA 3DRNA 1OYJA 4MPFA 2LQOA 2IMIA 2F3MA 2FNOA 3O76A 4LMVA 4I2TA 4O5UA 1AXDA 5BRTA 3DGQA 4X1UA 2YNXA 4ZL7A 1XW5A 2CX4A 5KOXA 2VL2C 4FXYP 2TIRA 2VO4A 5J9BA 2FY6A 5IMFA 1SVOA 1W89A 3MNGA 4Z2RA 2CQ9A 5GZZB 4XRDA 3BCIA 5E4WA 4JR6A 1YQ1A 5A34B 3HVNA 4G0LA 2ZNMA 1QQ2A 3NZNA 17GSA 3GSTA 4H86A 2HE3A 3UEMA 1JZRA 4KE3A 2CX3A 1Y25A 5HFIA 1WPIA 2C3NA 1PL1A 3TU3B 4EIQA 4OD7A 3UMAA 2FD3A 5ABRA 5H5RA 5ELGA 4HEA2 2WVZA 2MZCA 3VWVA 4F0BA 1DSBA 1EOGA 3GFKA 1DUGA 2YPMA 3EWLA 1OC9A 4AKIA 1ZL9A 4O92A 3TDGA 3WGDA 2O5VA 1H4OA 4ISDA 4DSSB 3W6GA 4EXJA 1ERWA 5AIXA 1Z6NA 2AB6A 2HXKA 2DJ0A 2GTUA 3QOUA 3VWXA 2H72A 3WD6A 2JZRA 4ZBBA 5DJMA 1O73A 2K8VA 2TRXA 3RHBA 2GSSA 2FWFA 1A0RP 1EV4A 1JZWA 2H30A 3BJ5A 3HJMA 4BL7A 2LV3A 4HU9A 1BJXA 2IJYA 2GLRA 3L9UA 5AIVA 2HSMB 4ECIA 2PVQA 4JBBA 2FCHA 5DCGA 1FVKA 3QCPA 3TKQA 5IMZA 2GZZA 2UZ8A 1RW1A 4MF7A 2BTOT 2WVXA 3PGTA 1VF2A 4PHZC 1ACVA 1XVWA 5ID2B 2B1KA 4IKHA 4EF0A 3CSJA 1QXHA 2IWTA 4PQ1A 5JWQB 1SL1B 3CSIA 1OVNA 2EIRA 1SL0B 4QQ7A 5J47A 2R2JA 1XOBA 5BMUA 3IK7A 1Z3EA 4L0UA 1TK8B 4D73B 1G7EA 1MDKA 2E2GA 4HI7A 1X5DA 1U6TA 2P5QA 4NWYA 4CDOA 3G7JA 5ECIB 1GH2A 2WDUA 2O85A 2L6CA 4G10A 4KDYA 4KH7A 1U3AA 2XHFA 3DD3A 2X8HA 2RM6A 1A0FA 1LJRA 3AY8A 3QR6A 3QMXA 2I3YA 4ZB6A 1PA3A 3P90A 4BWQA 4WBJA 3WGXA 2D2ZA 2MMZA 4NHWA 2EFDA 2LEGA 4FYBA 2H0IA 3J7Yb 2EIOA 2M80A 2PUKC 5KN2A 2E7PA 4Q5QA 4BVYB 1PFOA 2PWJA 3UJ1A 4XS4A 3KCMA 1OC3A 1GSQA 1BG5A 3PPUA 2I4AA 2DIYA 2WW2A 5IPHA 3IHGA 2VCQA 1ILOA 3IRAA 3GKKA 4WETA 4GSTA 1O85A 2V6OA 1MDIA 2GZYA 4TR4A 2GQLA 1HNAA 3EINA 2ZUPA 2FLSA 2CAQA 3BBYA 2LTKA 4IP1A 4J56E 3J7Yk 1J9BA 5AN1A 1XWCA 1UVZA 2JSYA 4POLA 4J2FA 1GSYA 6GSTA 1S3CA 4OFNA 1N8JA 3KEBA 3ME8A 1VRSD 4A5PA 2WULA 1ZMAA 1JFUA 1F3BA 3P7XA 2AHEA 2GVPA 2KHPA 4MF6A 4PNGA 3KZQA 1N2AA 4QMKA 2DIZA 2X8GA 1X9MB 1XG8A 5DQSA 3IPZA 5KN3A 4ZB9A 1GSDA 4BIKA 3LFLA 2PVOC 3EYTA 4IBPA 1F2EA 5DCHA 1PGTA 1BX9A 2CVKA 3LGCA 1M3IA 2R0PA 2HRFA 5CRWA 2LJAA 2X64A 2GSTA 4KSOA 2B5XA 3FYGA 3QFBC 1GUMA 1X5EA 1YF1A 4TKYA 1ZOFA 1F3AA 4I97A 2YANA 5CP1A 2X99A 3TJBA 5G31A 4IQAA 4ZL9A 3TKRA 3APSA 1V98A 3ERGA 2K18A 2OE3A 5F8BA 4BVXB 1MDJA 3GHAA 2VCZA 2K9FA 1WMJA 5GAND 5GSTA 2C0FA 2EFHA 1LBKA 2VCWA 2YJHA 1EWXA 1IYIA 5EVOA 3N9JA 5GAPD 1X5CA 4HZ2A 5H5SA 2G2QA 4Z7XA 2ON7A 2R37A 5D9XA 3CTFA 4E68A 4GQFA 1SJZA 2V32A 1Q4JA 1A2JA 3F6DA 3TJFA 2QC7A 2J9HA 1TI3A 1F9MA 1AAZA 16GSA 2HFDA 1O7UA 4ECJA 4FH8A 3F63A 1GWCA 3VURA 1PN9A 1X9SB 1M7TA 2LRTA 2VLVA 4I2UA 6GSWA 2WVYA 2V2GA 2DJ1A 3TJJA 1K0NA 3VPTA 5J4VA 3KTBA 3K8NA 3TKSE 3LXZA 4J57E 5E59A 3A2VA 2HYXA 2LKUA 1GNWA 1K3YA 4K1FA 2GT5A 4XTSA 2WS2A 3D22A 3CHXC 4PI2C 5DALB 2OADA 1C72A 4KCAA 3A2WA 3IR4A 3C8EA 4YKGA 4MA9A 2IMKA 2H6ZA 4E8HA 1HNBA 1T4YA 3BD2A 1GTAA 1BG1A 5D96A 4HJMA 4N0VA 1MD4A 3CRTA 1SJ6A 3VLNA 2VKZG 3G7YA 5HR1A 3HDCA 2P31A 4W66A 1M99A 2DKIA 1T3BA 4K8MA 3NOFA 3RPNA 2QA1A 3BOAA 5DQYA 5J5NA 4V2NA 22GSA 1E2YA 3DKSA 2F8FA 2H0GA 1SD9A 2WZSA 2YWOA 2HZEA 4Z2TA 1PX7A 3R2QA 5LD0A 4ZBAA 1JLVA 1NM3A 3KMNA 1JHBA 2OE1A 3HKRA 4FQUA 1M2BA 4MF5A 2C0EA 3ME7A 4KNDA 5F0GA 2VM1A 1TK5B 4E8EA 4YQVA 5L71A 2OBKA 5D8IA 3F4RA 3PR8A 1KNGA 4MJAA 2VLUA 1SU9A 1YZXA 4EKZA 1WOUA 2EFCA 4GDFA 3KP9A 4GSNA 2RUFA 5DAKB 1YEWC 4MLYA 5B8AA 1S3DA 2DKHA 3QD9A 2FGXA 2XPEA 4N0ZA 3MIXA 1FW1A 1ZZYA 3EU3A 4DEJA 1ZYQB 3JCML 1XW9A 5F06A 2LNSA 2GSQA 4XCSA 3TKSC 2H73A 2O3EA 4PQIA 1QMVA 3ZIJA 4MJEA 1JZDA 5B7CA 1M9BA 2P0GA 5J4UA 2WCIA 2CA8A 1YKAA 4YAVA 4XIHA 2H1DA 3GYKA 4LMWA 2VL9A 2CZ2A 4EL1A 5G5FA 1IYHA 4MK3A 2JU5A 2JACA 5DJLA 1EGOA 3GMFA 1TOFA 1FB0A 4YH2A 3FR6A 2A2SA 4POBA 1PL2A 4PQHA 2VCXA 2J23A 3IE3A 4WXTA 12GSA 4O5QA 1ML6A 2OKAA 2PBJA 2WGRA 3FKFA 3QPMA 4AGSA 2N5AA 3KTLA 2HRKB 5A1NB 4WF4A 1WIKA 2HSNB 2LJRA 3HHVA 5EL8A 1A8YA 1ON4A 3H4KA 1EP7A 1TI1A 1YEPA 4GQCA 4P3YB 4MZCA 5ECKB 3S9FA 3QAGA 3M9JA 3TRQA 3M0FA 5CNWA 2GZPA 2XBQA 3EU4A 3H8QA 1GLPA 3LQ7A 2PGTA 3KD0A 4ML6A 2H8LA 3ZIVA 1AQVA 1OKTA 4JRRA 3M8NA 2ZCTA 1Z6MA 1FAAA 4EO3A 1NHOA 1GSUA 1FO5A 3HJPA 4X43A 4F9ZA 1E6BA 2YZUA 3GIXA 3RPPA 1YF0A 2BJXA 5JCGA 3C1RA 1TXXA 2IPAA 5ECNB 3D21A 2RUEA 4PTSA 3ZMLA 1XWAA 1N25A 1XCCA 2EIQA 5ECSA 2H01A 3TKSA 4NPBA 1GSSA 2DJ3A 4OO5A 5JCUA 3TUEA 1TW9A 1RQMA 2EFEA 3GTUA 4TW5A 5D9TA 2DMLA 2K6VA 2H74A 2G0FA 5KOWA 5IOXA 1K0MA 1K3LA 3GURA 1U88A 2L6DA 5J40A 2VL2A 5AGYA 1SK2A 2H76A 5HQPA 2YZHA 3IAM2 3I43A 5IQYA 2HNLA 1AQWA 2L4CA 6GSXA 1Z5YE 1NSWA 1J0FA 2PERA 2QKEA 1R26A 1HYUA 3RDWA 3G7IA 1SYXA 4TRXA 4PXOA 4MJCA 5IIZA 2A4HA 2YP6A 3WYWA 3H1NA 3IC8A 3GL3A 3WGEA 1XVQA 4NXIA 3TOUA 3HVSA 4IJIA 2DLXA 1OC8A 3G9BA 2H19A 3IXRA 4DSRA 5A34A 2GQKA 4HU7A 2B3SA 3FW2A 2AAWA 1XWBA 2JL4A 2H6YA 1OE7A 2HSNA 1HNCA 3UOMA 2QA2A 1PN0A 3IV4A 3HZ4A 3CTGA 1VF3A 4RQRA 2VD0A 2DJ2A 3GKNA 1AIUA 3MWHA 4I5QA 4POKA 5IMAA 4MJBA 4HQZA 4ECCA 3A5WA 3L0HA 3KMOA 2XBIA 4MPGA 2H1AA 4YQUA 2V1MA 1X0RA 5ECHB 4DSSA 2AJQB 3GN3A 4Z2UA 5H5QA 1V2AA 1THOA 1CQGA 1HD2A 4HS1A 1V9WA 2IIYA 3L4NA 1GLQA 1USBA 3V1WA 5IO2A 4G2EA 4WF5A 3GNJA 3HVXA 1TK0B 3Q19A 4K7IA 2L4QA 4BA7A 4LL4B 2DSAA 2A2RA 4X0XA 5CYYA 3TRPA 3RHCA 1FHEA 1M2DA 2HSMA 1K0BA 1GNEA 4O5RA 3L78A 5B6NA 3FRCA 3D6IA 3ED3A 5IPGA 2NPBA 5ID2A 2VAFA 3LJRA 2GQMA 5ECLB 1PSQA 2GGTA 1GRXA 4EC0A 4K9ZA 4GWRA 1TXUA 2YN1A 1EEMA 4LLRA 3PINA 1BQ7A 3R3EA 3APQA 4D73A 5ECMB 3UAPA 3IAS2 1SKWB 2IL3A 1ERTA 2B7JA 2IMDA 2FA8A 2GSRA 3C71A 4AJ6A 4OCFA 1EOHA 1NHYA 4EDYA 3FZ4A 3KH9A 1VF4A 4MNNA 1AW9A 2CVDA 3DXBA 3H79A 4N3ZA 3CYNA 3M9KA 3GKXA 1R5PA 1WWJA 5ECPB 3GRXA 1W4VA 2X49A 3DIEA 2B6MA 1PRXA 2RLIA 3W8JA 2YOIA 2HLSA 3MDKA 2VLTA 1MD3A 1V57A 2IN3A 6GSYA 4BVYA 3KH7A 4YAPA 2PN8A 4PURA 2C1YA 2PPTA 3ZITA 2H70A 4HDEA 3M3MA 2WW1A 1G7OA 2OE0A 2IFQB 4NV2A 5J3RA 3L9SA 3EMXA 1XIYA 1XWKA 5B8BA 2HI7A 3WT1A 2YCDA 2O87A 3LWAA 3WT2A 1GTBA 2LS5A 5HFKA 1XOAA 3CQFA 2NBSA 6GSVA 4RQXA 2AUVA 4MZWA 3DVWA 3FK8A 3I6AA 4FIWA 4JE1A 1YVLA 1TRWA 3UVTA 4AKGA 1UC7A 1FOVA 3VI5A 2L59A 3ZREA 4ZB8A 3LORA 4FYCA 4BWSA 5IOWA 1F37A 2H75A 5FT3A 1M3JA 2YWMA 3HXSA 4LA1A 3UL3A 1ZYNA 4I6XA 3U5RE 1B9YC 3TJKA 2OACA 2B7KA 2R0CA 3LEFA 1M9AA 1SKSB 5CRGA 1AQXA 4K7NA 2HSHA 1LU4A 1K0AA 1UN2A 5G2ZA 5IMDA 2OA7A 1QGVA 1SL2B 4AI6A 2DJKA 3TB2A 3F0IA 4V1Ag 1K0DA 1XPVA 5C00A 3CRUA 3CWGA 4PGTA 1R4WA 2RIIA 4IN0A 2ALBA 2H66A 1XXUA 1PMTA 4KA0A 2CAIA 3ZVJD 4NHZA 2MBSA 1DBYA 1KEBA 2P5RA 3DYRA 4QL7A 2C0GA 1SENA 2WW3A 1OC9B 3GX8A 4WR5A 1T4ZA 2PMTA 4RUVA 1EGRA 1FVJA 5KN1A 4KB3A 1YDKA 4IJ3A 1B9XC 5A5KA 1A24A 4KUNA 4TXOB 4KF9A 4BVXA 4KCEA 4TR3A 3F3QA 3F8UA 5J41A 4ID0A 1WJKA 5IMCA 4ACSA 4TR0A 3EC3A 2H71A 5D9WA 4L5LA 5G1KA 1TP9A 3I69A 1PQNA 3LW9A 4OFMA 1OE8A 1O8WA 2MMOA 1K3OA 4EVMA 4BL7B 5JWRB 1Z7PA 1O8XA 2E0QA 4BPYA 4IHUA 4K0NA 2LQQA 1GULA 3FZAA 1A2MA 1T00A 4QL9A 3KP8A 3LYPA 3KJYA 2L5LA 3ZTLA 3FY7A 3GH9A 2WVXB 3FR9A 2PU9C 3W8SA 4G0KA 1SVLA 3IDVA 1XWGA 2M72A 5INYA 4K5RA 2NTOA 1G6YA 5EPFA 1YJ6A 4OO4A 3LSZA 3TGZA 3GUSA 3NIVA 1AC1A 2HRAA 2AV4A 4L5OA 2C0DA 1EV9A 2B5YA 1OKDA 4O7HA 4N11A 3CSHA 3C7MA 3Q18A 3RFRC 4JR4A 2L57A 1T7PB 3IA1A 2YJ7A 1GTIA
chains in the Genus database with same CATH topology
3GV1A 5DALA 4G0IA 3GL5A 1G0TA 3HVVA 4AJ7A 4TOPA 2I1UA 1XFLA 1B48A 4EUYA 2HZFA 3FR3A 4JZQA 1UA5A 5CREA 3EPTA 5IM9A 1GTUA 2YWIA 4AKHA 1EEJA 1H75A 4XS4B 5D93A 2N5BA 2K8SA 1ZYPA 5ECOB 3HY2A 14GSA 1EP8A 1RK4A 3PH9A 4KW6A 1TU7A 3A2XA 4K2XA 4EDZA 4KDXA 1PKWA 2YWNA 1URMA 4IVFA 1GSFA 3IBHA 3US3A 5COHA 4ZB7A 4GF0A 2KP2A 4WR4A 2LUSA 4G19A 2KLXA 4TXOA 5A4UA 3KXOA 3FEUA 4Q5RA 7GSSA 3D4TA 1SKRB 2H1BA 1S3AA 5J9CA 3A3TA 1GSEA 2HQTA 1VGLA 2VOCA 4MZBA 2FWGA 4HUAA 1B8XA 3E3EA 3ZFLA 2FA4A 2GT6A 2R6KA 5DAKA 2IMFA 11GSA 2UV8G 5EY6A 2WJUA 2N5FA 1PD21 5ECQB 2C8UA 3QDNA 1THXA 3MAKA 3MSZA 1T8EB 2QGVA 2R3XA 4NMUA 4TR1B 2QSIA 4CY6A 2MBTA 2OBIA 4GTUA 2VD1A 3VWUA 3TKPA 3EURA 3HJOA 4MMMA 4POMA 3CMIA 5CRDA 1ST9A 2JADA 2CT6A 3RBTA 1M0UA 4WEYA 4ICYA 1QK8A 4ECBA 1U87A 1F6MC 4MH2A 1TKDB 2A2PA 4PUAA 5JCWA 2R5GA 4HZ4A 3VWWA 2YV7A 2OT3A 3FMWA 2L5OA 5A5HB 3TRXA 3O3TA 2GS3A 3HZ8A 1XBSA 3C73A 2A4VA 4K2DA 4IS0A 1JLWA 4WBRD 2HRKA 4RI7A 5A1NA 5C04A 2B1LA 2V41A 1WRYA 3N5OA 5KN0A 2LJKA 1M2AA 4CY8A 4TVEA 1I5GA 2CZ3A 5J4YA 2I81A 4AJ8A 5CAXA 2JSZA 4IQ1A 3ZFBA 2F8AA 2HSYA 2FHEA 3Q6OA 3F3RA 4GSSA 1QUWA 5ECRB 2F9SA 1Z9HA 2BMXA 3DVXA 3ZLPA 5F05A 1GP1A 3UIWA 5DDLA 2OJLA 4DVCA 2KUCA 3UBLA 3Q74A 2E2MA 3HA9A 1TJDA 1GUKA 3O6TA 4GLTA 2B5EA 4G01A 2GDRA 1KBNA 10GSA 4O32A 4Q5NA 3DMLA 4HJ2A 1YKCA 4F82A 3TJGA 3ZRDA 4ZIJA 1Q98A 3KIJA 4XRAA 3DEXA 4WKWA 2LRCA 4TXVA 2VL3A 1B4PA 3MYDA 4V2LA 3F9UA 4NAXA 3GX0A 5HFGA 5B6MA 2MMNA 3HD5A 1U3IA 4AF2A 3ZVJA 3IC4A 1SYRA 3RAZA 1PX6A 4USSA 4V1Ap 5LCZA 4KDUA 4KGIA 4K5SA 4OCEA 2I9HA 4OMVA 4YQMA 2REMA 1BAYA 3UVHA 3A5IA 2NDOA 3F6FA 2MMAA 5HR0A 3TCOA 9GSSA 1ABAA 4ZL8A 3KM6A 4F03A 4TR1A 3F4TA 2CVBA 1SK0A 2C80A 4YKFA 4K0GA 4EE0A 4PX1A 1V58A 4JEDA 5AISA 3EVIA 2XPDA 4JU5A 2KP1A 2R0GA 19GSA 5G5EA 4ML1A 1J08A 5FHIA 3L9VA 2X4AA 3IK9A 1TRUA 4ILFA 1TDIA 6GSUA 2O89A 5FWGA 1G6WA 3U6VA 1A8LA 2Z9SA 2HZEB 2O8VB 5HR3A 5CRHA 4IGJA 1XW6A 2C4JA 1K0OA 3SBCA 1YY7A 5ELAA 2LRNA 2YV9A 1DE1A 4F2IA 4PUFC 5A5HA 5LNKe 3QAWA 4KAEA 1SK1A 5D73A 2VM2A 1K0CA 2WFCA 2DMMA 3ZZXA 4V2MA 2LNTA 2JZSA 2DC5A 1AUCA 1JZOA 1T1VA 4FO5A 5KEJA 4L8EA 1ERUA 3ZL5A 3SWLA 3LYKA 2ON5A 2ES7A 4Q5FA 2EC4A 4PNFA 4MDCA 1ZYEA 1ZCPA 2DJJA 3TOTA 3FZ5A 6GSSA 3ZMKA 2DBCA 3KGKA 2TRCP 3HYPA 1SVMA 4RI6A 1EZKA 1XZOA 4IP6A 1VF1A 3EE2A 3VPQA 5GSSA 4XS1A 2NVLA 1OAZA 3C1SA 1NW2A 2WB9A 3GH6A 4NV5A 1Z7RA 3D0ZA 4HQSA 3H93A 3LG6A 4TN8A 2AYTA 4MP4A 4AKXB 13GSA 2V6KA 3LXTA 2LSTA 2H0HA 3FHKA 3VI7A 2VCTA 2VCVA 5IMVA 2FWEA 4MCUA 3ERWA 2C3TA 4KX4A 3D4MA 2WRTA 1ZGNA 1FOHA 1TU8A 2R4VA 4FYUA 1MTCA 1SJIA 1BYEA 3DWVA 4MABA 3I9V2 3EMPA 2O7KA 1FB6A 3ERFA 1MEKA 4N10A 4CHSA 4X4JA 5A4WA 2RM5A 1X9WB 3UARA 4ULXA 3D5JA 2MYGA 1CQHA 3BCKA 1BF5A 2X8CA 2JZTA 5A4VA 2M46A 4IELA 1I9DA 4L0WA 2KOKA 3FZ9A 5JWOB 1HQOA 4EIPA 3GSSA 2VUPA 3M1GA 1V40A 4XS6A 4OWYA 5F07A 18GSA 3E9JB 2HRNA 1R7HA 3CBUA 2C3QA 3QFAC 1SD8A 4HOJA 1WP0A 3IOSA 1R5AA 1KTEA 1A23A 8GSSA 3E0UA 4GRFA 4CW9A 1B4QA 3UBKA 5HR2A 1YEXA 5D9VA 1GUHA 1TRVA 3VK9A 1TRSA 3VFIA 2IMEA 5ENUA 5DBQA 2HT9A 3P8WA 1Y6EA 1TTZA 5G30A 20GSA 5DVBA 2WZ9A 1Y1UA 5IO0A 2H1LA 4MH3A 4XHMA 1QFNA 3ZYWA 3ISOA 4G9HA 4K7OA 2FUG2 4K6XA 4GXZA 1GL8A 1FG4A 5CO3A 3GKMA 3OR5A 4DSQA 5G1LA 1O6JA 2IFQA 3QAVA 4OFTA 3APOA 2F51A 3GTUB 1PKZA 3HCZA 1DE2A 4N30A 4GCIA 2CV4A 4KSMA 4ZXGA 3GA4A 3HMJG 4IW9A 2XC2A 3P2AA 4LL1B 1BEDA 5BMUB 3F4SA 2FWHA 1A2LA 1O81A 2H1GA 4F0CA 3CXGA 4ZILA 2VIMA 4I8BA 2H6XA 4ZBDA 1ERVA 1WE0A 3IHQA 3DRNA 1OYJA 4MPFA 2LQOA 2IMIA 2F3MA 2FNOA 3O76A 4LMVA 4I2TA 4O5UA 1AXDA 5BRTA 3DGQA 4X1UA 2YNXA 4ZL7A 1XW5A 2CX4A 5KOXA 2VL2C 2TIRA 2VO4A 5J9BA 2FY6A 5IMFA 1SVOA 1W89A 3MNGA 4Z2RA 2CQ9A 5GZZB 4XRDA 3BCIA 5E4WA 4JR6A 1YQ1A 5A34B 4G0LA 2ZNMA 1QQ2A 3NZNA 17GSA 3GSTA 4H86A 2HE3A 3UEMA 1JZRA 4KE3A 2CX3A 1Y25A 5HFIA 1WPIA 2C3NA 1PL1A 3TU3B 4EIQA 4OD7A 3UMAA 2FD3A 5ABRA 5H5RA 5ELGA 4HEA2 2MZCA 3VWVA 4F0BA 1DSBA 1EOGA 3GFKA 1DUGA 2YPMA 3EWLA 1OC9A 4AKIA 1ZL9A 4O92A 3TDGA 3WGDA 2O5VA 1H4OA 4ISDA 4DSSB 3W6GA 4EXJA 1ERWA 5AIXA 1Z6NA 2AB6A 2HXKA 2DJ0A 2GTUA 3QOUA 3VWXA 2H72A 3WD6A 2JZRA 4ZBBA 5DJMA 1O73A 2K8VA 2TRXA 3RHBA 2GSSA 2FWFA 1A0RP 1EV4A 1JZWA 2H30A 3BJ5A 3HJMA 4BL7A 2LV3A 4HU9A 1BJXA 2IJYA 2GLRA 3L9UA 5AIVA 2HSMB 4ECIA 2PVQA 4JBBA 2FCHA 5DCGA 1FVKA 3QCPA 3TKQA 5IMZA 2GZZA 2UZ8A 1RW1A 4MF7A 2BTOT 3PGTA 1VF2A 5ID2B 1ACVA 1XVWA 2B1KA 4IKHA 4EF0A 3CSJA 1QXHA 2IWTA 4PQ1A 5JWQB 1SL1B 3CSIA 1OVNA 2EIRA 1SL0B 4QQ7A 5J47A 2R2JA 1XOBA 5BMUA 3IK7A 1Z3EA 4L0UA 1TK8B 4D73B 1G7EA 1MDKA 2E2GA 4HI7A 1X5DA 1U6TA 2P5QA 4NWYA 4CDOA 3G7JA 5ECIB 1GH2A 2WDUA 2O85A 2L6CA 4G10A 4KDYA 4KH7A 1U3AA 2XHFA 3DD3A 2X8HA 2RM6A 1A0FA 1LJRA 3AY8A 3QR6A 3QMXA 2I3YA 4ZB6A 1PA3A 3P90A 4BWQA 4WBJA 3WGXA 2D2ZA 2MMZA 4NHWA 2EFDA 2LEGA 4FYBA 2H0IA 3J7Yb 2EIOA 2M80A 2PUKC 5KN2A 2E7PA 4Q5QA 4BVYB 2PWJA 3UJ1A 4XS4A 3KCMA 1OC3A 1GSQA 1BG5A 3PPUA 2I4AA 2DIYA 5IPHA 3IHGA 2VCQA 1ILOA 3IRAA 3GKKA 4WETA 4GSTA 1O85A 2V6OA 1MDIA 2GZYA 4TR4A 2GQLA 1HNAA 3EINA 2ZUPA 2FLSA 2CAQA 3BBYA 2LTKA 4IP1A 4J56E 3J7Yk 1J9BA 5AN1A 1XWCA 1UVZA 2JSYA 4POLA 4J2FA 1GSYA 6GSTA 1S3CA 4OFNA 1N8JA 3KEBA 3ME8A 1VRSD 4A5PA 2WULA 1ZMAA 1JFUA 1F3BA 3P7XA 2AHEA 2GVPA 2KHPA 4MF6A 4PNGA 3KZQA 1N2AA 4QMKA 2DIZA 2X8GA 1X9MB 3IPZA 5DQSA 5KN3A 4ZB9A 1GSDA 3LFLA 2PVOC 3EYTA 4IBPA 1F2EA 5DCHA 1PGTA 1BX9A 2CVKA 3LGCA 2R0PA 2HRFA 5CRWA 2LJAA 2X64A 2GSTA 4KSOA 2B5XA 3FYGA 3QFBC 1GUMA 1X5EA 1YF1A 4TKYA 1ZOFA 1F3AA 4I97A 2YANA 5CP1A 2X99A 3TJBA 5G31A 4IQAA 4ZL9A 3TKRA 3APSA 1V98A 3ERGA 2K18A 2OE3A 5F8BA 4BVXB 1MDJA 3GHAA 2VCZA 2K9FA 1WMJA 5GAND 5GSTA 2C0FA 2EFHA 1LBKA 2VCWA 2YJHA 1EWXA 1IYIA 5EVOA 3N9JA 5GAPD 1X5CA 4HZ2A 5H5SA 2G2QA 4Z7XA 2ON7A 2R37A 5D9XA 3CTFA 4E68A 4GQFA 1SJZA 2V32A 1Q4JA 1A2JA 3F6DA 3TJFA 2QC7A 2J9HA 1TI3A 1F9MA 1AAZA 16GSA 2HFDA 1O7UA 4ECJA 4FH8A 3F63A 1GWCA 3VURA 1PN9A 1X9SB 1M7TA 2LRTA 2VLVA 4I2UA 6GSWA 2V2GA 2DJ1A 3TJJA 1K0NA 3VPTA 5J4VA 3KTBA 3K8NA 3TKSE 3LXZA 4J57E 5E59A 3A2VA 2HYXA 2LKUA 1GNWA 1K3YA 4K1FA 2GT5A 4XTSA 2WS2A 3D22A 5DALB 2OADA 1C72A 4KCAA 3A2WA 3IR4A 3C8EA 4YKGA 4MA9A 2IMKA 2H6ZA 4E8HA 1HNBA 1T4YA 3BD2A 1GTAA 1BG1A 5D96A 4HJMA 4N0VA 1MD4A 3CRTA 1SJ6A 3VLNA 2VKZG 3G7YA 5HR1A 3HDCA 2P31A 4W66A 1M99A 2DKIA 1T3BA 4K8MA 3NOFA 3RPNA 2QA1A 3BOAA 5DQYA 5J5NA 4V2NA 22GSA 1E2YA 3DKSA 2F8FA 2H0GA 1SD9A 2YWOA 2HZEA 4Z2TA 1PX7A 3R2QA 5LD0A 4ZBAA 1JLVA 1NM3A 3KMNA 1JHBA 2OE1A 3HKRA 4FQUA 1M2BA 4MF5A 2C0EA 3ME7A 4KNDA 5F0GA 2VM1A 1TK5B 4E8EA 4YQVA 5L71A 2OBKA 5D8IA 3F4RA 3PR8A 1KNGA 4MJAA 2VLUA 1SU9A 1YZXA 4EKZA 1WOUA 2EFCA 4GDFA 3KP9A 4GSNA 2RUFA 5DAKB 4MLYA 5B8AA 1S3DA 2DKHA 3QD9A 2FGXA 2XPEA 4N0ZA 3MIXA 1FW1A 1ZZYA 3EU3A 4DEJA 1ZYQB 3JCML 1XW9A 5F06A 2LNSA 2GSQA 4XCSA 3TKSC 2H73A 4PQIA 1QMVA 3ZIJA 4MJEA 1JZDA 5B7CA 1M9BA 2P0GA 5J4UA 2WCIA 2CA8A 1YKAA 4YAVA 4XIHA 2H1DA 3GYKA 4LMWA 2VL9A 2CZ2A 4EL1A 5G5FA 1IYHA 4MK3A 2JU5A 2JACA 5DJLA 1EGOA 3GMFA 1TOFA 1FB0A 4YH2A 3FR6A 2A2SA 4POBA 1PL2A 4PQHA 2VCXA 2J23A 3IE3A 4WXTA 12GSA 4O5QA 1ML6A 2OKAA 2PBJA 2WGRA 3FKFA 3QPMA 4AGSA 2N5AA 3KTLA 2HRKB 5A1NB 4WF4A 1WIKA 2HSNB 2LJRA 3HHVA 5EL8A 1A8YA 1ON4A 3H4KA 1EP7A 1TI1A 1YEPA 4GQCA 4P3YB 4MZCA 5ECKB 3S9FA 3QAGA 3M9JA 3TRQA 3M0FA 5CNWA 2GZPA 2XBQA 3EU4A 3H8QA 1GLPA 3LQ7A 2PGTA 3KD0A 4ML6A 2H8LA 3ZIVA 1AQVA 1OKTA 4JRRA 3M8NA 2ZCTA 1Z6MA 1FAAA 4EO3A 1NHOA 1GSUA 1FO5A 3HJPA 4X43A 4F9ZA 1E6BA 2YZUA 3GIXA 3RPPA 1YF0A 2BJXA 5JCGA 3C1RA 1TXXA 2IPAA 5ECNB 3D21A 2RUEA 4PTSA 3ZMLA 1XWAA 1N25A 1XCCA 2EIQA 5ECSA 2H01A 3TKSA 4NPBA 1GSSA 2DJ3A 4OO5A 5JCUA 3TUEA 1TW9A 1RQMA 2EFEA 3GTUA 4TW5A 5D9TA 2DMLA 2K6VA 2H74A 2G0FA 5KOWA 5IOXA 1K0MA 1K3LA 3GURA 1U88A 2L6DA 5J40A 2VL2A 5AGYA 1SK2A 2H76A 5HQPA 2YZHA 3IAM2 3I43A 5IQYA 2HNLA 1AQWA 2L4CA 6GSXA 1Z5YE 1NSWA 1J0FA 2PERA 2QKEA 1R26A 1HYUA 3RDWA 3G7IA 1SYXA 4TRXA 4PXOA 4MJCA 5IIZA 2A4HA 2YP6A 3WYWA 3H1NA 3IC8A 3GL3A 3WGEA 1XVQA 4NXIA 3TOUA 3HVSA 4IJIA 2DLXA 1OC8A 3G9BA 2H19A 3IXRA 4DSRA 5A34A 2GQKA 4HU7A 2B3SA 3FW2A 2AAWA 1XWBA 2JL4A 2H6YA 1OE7A 2HSNA 1HNCA 3UOMA 2QA2A 1PN0A 3IV4A 3HZ4A 3CTGA 1VF3A 4RQRA 2VD0A 2DJ2A 3GKNA 1AIUA 3MWHA 4I5QA 4POKA 5IMAA 4MJBA 4HQZA 4ECCA 3A5WA 3L0HA 3KMOA 2XBIA 4MPGA 2H1AA 4YQUA 2V1MA 1X0RA 5ECHB 4DSSA 2AJQB 3GN3A 4Z2UA 5H5QA 1V2AA 1THOA 1CQGA 1HD2A 4HS1A 1V9WA 2IIYA 3L4NA 1GLQA 1USBA 3V1WA 5IO2A 4G2EA 4WF5A 3GNJA 3HVXA 1TK0B 3Q19A 4K7IA 2L4QA 4BA7A 4LL4B 2DSAA 2A2RA 4X0XA 5CYYA 3TRPA 3RHCA 1FHEA 1M2DA 2HSMA 1K0BA 1GNEA 4O5RA 3L78A 5B6NA 3FRCA 3D6IA 3ED3A 5IPGA 2NPBA 5ID2A 2VAFA 3LJRA 2GQMA 5ECLB 1PSQA 2GGTA 1GRXA 4EC0A 4K9ZA 4GWRA 1TXUA 2YN1A 1EEMA 4LLRA 3PINA 1BQ7A 3R3EA 3APQA 4D73A 5ECMB 3UAPA 3IAS2 1SKWB 2IL3A 1ERTA 2B7JA 2IMDA 2FA8A 2GSRA 3C71A 4AJ6A 4OCFA 1EOHA 1NHYA 4EDYA 3FZ4A 3KH9A 1VF4A 4MNNA 1AW9A 2CVDA 3DXBA 3H79A 4N3ZA 3CYNA 3M9KA 3GKXA 1R5PA 1WWJA 5ECPB 3GRXA 1W4VA 2X49A 3DIEA 2B6MA 1PRXA 2RLIA 3W8JA 2YOIA 2HLSA 3MDKA 2VLTA 1MD3A 1V57A 2IN3A 6GSYA 4BVYA 3KH7A 4YAPA 2PN8A 4PURA 2C1YA 2PPTA 3ZITA 2H70A 4HDEA 3M3MA 1G7OA 2OE0A 2IFQB 4NV2A 5J3RA 3L9SA 3EMXA 1XIYA 1XWKA 5B8BA 2HI7A 3WT1A 2YCDA 2O87A 3LWAA 3WT2A 1GTBA 2LS5A 5HFKA 1XOAA 2NBSA 6GSVA 4RQXA 2AUVA 4MZWA 3DVWA 3FK8A 3I6AA 4FIWA 4JE1A 1YVLA 1TRWA 3UVTA 4AKGA 1UC7A 1FOVA 3VI5A 2L59A 3ZREA 4ZB8A 3LORA 4FYCA 4BWSA 5IOWA 1F37A 2H75A 5FT3A 2YWMA 3HXSA 4LA1A 3UL3A 1ZYNA 4I6XA 3U5RE 1B9YC 3TJKA 2OACA 2B7KA 2R0CA 3LEFA 1M9AA 1SKSB 5CRGA 1AQXA 4K7NA 2HSHA 1LU4A 1K0AA 1UN2A 5G2ZA 5IMDA 2OA7A 1QGVA 1SL2B 4AI6A 2DJKA 3TB2A 3F0IA 4V1Ag 1K0DA 1XPVA 5C00A 3CRUA 3CWGA 4PGTA 1R4WA 2RIIA 4IN0A 2ALBA 2H66A 1XXUA 1PMTA 4KA0A 2CAIA 3ZVJD 4NHZA 2MBSA 1DBYA 1KEBA 2P5RA 3DYRA 4QL7A 2C0GA 1SENA 1OC9B 3GX8A 4WR5A 1T4ZA 2PMTA 4RUVA 1EGRA 1FVJA 5KN1A 4KB3A 1YDKA 4IJ3A 1B9XC 5A5KA 1A24A 4KUNA 4TXOB 4KF9A 4BVXA 4KCEA 4TR3A 3F8UA 3F3QA 5J41A 4ID0A 1WJKA 5IMCA 4ACSA 4TR0A 3EC3A 2H71A 5D9WA 4L5LA 5G1KA 1TP9A 3I69A 1PQNA 3LW9A 4OFMA 1OE8A 1O8WA 2MMOA 1K3OA 4EVMA 4BL7B 5JWRB 1Z7PA 1O8XA 2E0QA 4BPYA 4IHUA 4K0NA 2LQQA 1GULA 3FZAA 1A2MA 1T00A 4QL9A 3KP8A 3LYPA 3KJYA 2L5LA 3ZTLA 3FY7A 3GH9A 3FR9A 2PU9C 3W8SA 4G0KA 1SVLA 3IDVA 1XWGA 2M72A 5INYA 4K5RA 2NTOA 1G6YA 5EPFA 1YJ6A 4OO4A 3LSZA 3TGZA 3GUSA 3NIVA 1AC1A 2HRAA 2AV4A 4L5OA 2C0DA 1EV9A 2B5YA 1OKDA 4O7HA 4N11A 3CSHA 3C7MA 3Q18A 4JR4A 2L57A 1T7PB 3IA1A 2YJ7A 1GTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV1 A;  5DAL A;  4G0I A;  3GL5 A;  1G0T A;  3HVV A;  4AJ7 A;  4TOP A;  2I1U A;  1XFL A;  1B48 A;  4EUY A;  2HZF A;  3FR3 A;  4JZQ A;  1UA5 A;  5CRE A;  5IM9 A;  1GTU A;  2YWI A;  1EEJ A;  1H75 A;  4XS4 B;  5D93 A;  2N5B A;  2K8S A;  5ECO B;  3HY2 A;  14GS A;  1EP8 A;  1RK4 A;  3PH9 A;  4KW6 A;  1TU7 A;  3A2X A;  4EDZ A;  4KDX A;  1PKW A;  2YWN A;  1URM A;  4IVF A;  1GSF A;  3IBH A;  3US3 A;  5COH A;  4GF0 A;  2KP2 A;  4WR4 A;  2LUS A;  4G19 A;  2KLX A;  4TXO A;  5A4U A;  3KXO A;  3FEU A;  4Q5R A;  7GSS A;  3D4T A;  1SKR B;  2H1B A;  1S3A A;  5J9C A;  3A3T A;  1GSE A;  2HQT A;  1VGL A;  2VOC A;  4MZB A;  2FWG A;  4HUA A;  1B8X A;  3E3E A;  3ZFL A;  2FA4 A;  2GT6 A;  2R6K A;  5DAK A;  2IMF A;  11GS A;  5EY6 A;  2WJU A;  2N5F A;  1PD2 1;  5ECQ B;  2C8U A;  3QDN A;  1THX A;  3MAK A;  3MSZ A;  1T8E B;  2QGV A;  2R3X A;  4NMU A;  4TR1 B;  2QSI A;  2MBT A;  2OBI A;  4GTU A;  2VD1 A;  3VWU A;  3TKP A;  3EUR A;  3HJO A;  4MMM A;  4POM A;  3CMI A;  5CRD A;  1ST9 A;  2JAD A;  2CT6 A;  3RBT A;  1M0U A;  4WEY A;  1QK8 A;  4ECB A;  1U87 A;  1F6M C;  4MH2 A;  1TKD B;  4PUA A;  5JCW A;  2R5G A;  4HZ4 A;  3VWW A;  2YV7 A;  2L5O A;  3TRX A;  3O3T A;  2GS3 A;  3HZ8 A;  1XBS A;  3C73 A;  2A4V A;  4K2D A;  4IS0 A;  1JLW A;  4WBR D;  2HRK A;  4RI7 A;  5C04 A;  2B1L A;  2V41 A;  1WRY A;  3N5O A;  5KN0 A;  2LJK A;  1M2A A;  4TVE A;  1I5G A;  2CZ3 A;  2I81 A;  4AJ8 A;  5CAX A;  2JSZ A;  4IQ1 A;  3ZFB A;  2F8A A;  2HSY A;  2FHE A;  3Q6O A;  3F3R A;  4GSS A;  1QUW A;  5ECR B;  2F9S A;  1Z9H A;  2BMX A;  3DVX A;  3ZLP A;  5F05 A;  1GP1 A;  3UIW A;  5DDL A;  2OJL A;  4DVC A;  2KUC A;  3UBL A;  3Q74 A;  2E2M A;  3HA9 A;  1TJD A;  1GUK A;  3O6T A;  4GLT A;  2B5E A;  2GDR A;  1KBN A;  10GS A;  4O32 A;  4Q5N A;  3DML A;  4HJ2 A;  1YKC A;  4F82 A;  3TJG A;  3ZRD A;  4ZIJ A;  1Q98 A;  3KIJ A;  4XRA A;  3DEX A;  4WKW A;  2LRC A;  4TXV A;  2VL3 A;  1B4P A;  4V2L A;  3F9U A;  4NAX A;  3GX0 A;  5HFG A;  5B6M A;  2MMN A;  3HD5 A;  1U3I A;  4AF2 A;  3ZVJ A;  3IC4 A;  1SYR A;  3RAZ A;  1PX6 A;  4USS A;  4V1A p;  5LCZ A;  4KDU A;  4KGI A;  4OCE A;  2I9H A;  4OMV A;  4YQM A;  2REM A;  1BAY A;  3UVH A;  2NDO A;  3F6F A;  2MMA A;  5HR0 A;  3TCO A;  9GSS A;  1ABA A;  4ZL8 A;  3KM6 A;  4F03 A;  4TR1 A;  3F4T A;  2CVB A;  1SK0 A;  2C80 A;  4K0G A;  4EE0 A;  4PX1 A;  1V58 A;  4JED A;  5AIS A;  3EVI A;  2XPD A;  4JU5 A;  2KP1 A;  19GS A;  5G5E A;  4ML1 A;  1J08 A;  5FHI A;  3L9V A;  3IK9 A;  1TRU A;  4ILF A;  1TDI A;  6GSU A;  2O89 A;  5FWG A;  1G6W A;  3U6V A;  1A8L A;  2Z9S A;  2HZE B;  2O8V B;  5HR3 A;  5CRH A;  4IGJ A;  1XW6 A;  2C4J A;  1K0O A;  3SBC A;  1YY7 A;  5ELA A;  2LRN A;  2YV9 A;  1DE1 A;  4F2I A;  4PUF C;  5LNK e;  3QAW A;  4KAE A;  1SK1 A;  5D73 A;  2VM2 A;  1K0C A;  2WFC A;  2DMM A;  3ZZX A;  4V2M A;  2LNT A;  2JZS A;  2DC5 A;  1AUC A;  1JZO A;  1T1V A;  4FO5 A;  5KEJ A;  4L8E A;  1ERU A;  3ZL5 A;  3SWL A;  3LYK A;  2ON5 A;  2ES7 A;  4Q5F A;  2EC4 A;  4PNF A;  4MDC A;  1ZYE A;  1ZCP A;  2DJJ A;  3TOT A;  3FZ5 A;  6GSS A;  3ZMK A;  2DBC A;  3KGK A;  2TRC P;  3HYP A;  4RI6 A;  1EZK A;  1XZO A;  4IP6 A;  1VF1 A;  3EE2 A;  3VPQ A;  5GSS A;  4XS1 A;  2NVL A;  1OAZ A;  3C1S A;  1NW2 A;  2WB9 A;  3GH6 A;  4NV5 A;  1Z7R A;  3D0Z A;  4HQS A;  3H93 A;  3LG6 A;  4TN8 A;  2AYT A;  4MP4 A;  13GS A;  2V6K A;  3LXT A;  2LST A;  2H0H A;  3FHK A;  3VI7 A;  2VCT A;  2VCV A;  5IMV A;  2FWE A;  4MCU A;  3ERW A;  2C3T A;  4KX4 A;  3D4M A;  2WRT A;  1ZGN A;  1TU8 A;  2R4V A;  4FYU A;  1MTC A;  1SJI A;  1BYE A;  3DWV A;  4MAB A;  3I9V 2;  3EMP A;  2O7K A;  1FB6 A;  3ERF A;  1MEK A;  4N10 A;  4CHS A;  5A4W A;  2RM5 A;  1X9W B;  3UAR A;  4ULX A;  3D5J A;  2MYG A;  1CQH A;  3BCK A;  2X8C A;  2JZT A;  5A4V A;  2M46 A;  4IEL A;  1I9D A;  4L0W A;  2KOK A;  3FZ9 A;  5JWO B;  1HQO A;  3GSS A;  2VUP A;  3M1G A;  1V40 A;  4XS6 A;  4OWY A;  5F07 A;  18GS A;  3E9J B;  2HRN A;  1R7H A;  3CBU A;  2C3Q A;  3QFA C;  1SD8 A;  4HOJ A;  1WP0 A;  3IOS A;  1R5A A;  1KTE A;  1A23 A;  8GSS A;  3E0U A;  4GRF A;  4CW9 A;  1B4Q A;  3UBK A;  5HR2 A;  1YEX A;  5D9V A;  1GUH A;  1TRV A;  3VK9 A;  1TRS A;  3VFI A;  2IME A;  5ENU A;  5DBQ A;  2HT9 A;  3P8W A;  1Y6E A;  1TTZ A;  5G30 A;  20GS A;  5DVB A;  2WZ9 A;  5IO0 A;  4MH3 A;  4XHM A;  1QFN A;  3ZYW A;  3ISO A;  4G9H A;  4K7O A;  2FUG 2;  4K6X A;  4GXZ A;  1GL8 A;  1FG4 A;  5CO3 A;  3GKM A;  3OR5 A;  4DSQ A;  5G1L A;  1O6J A;  2IFQ A;  3QAV A;  4OFT A;  3APO A;  2F51 A;  3GTU B;  1PKZ A;  3HCZ A;  1DE2 A;  4N30 A;  4GCI A;  2CV4 A;  4KSM A;  4ZXG A;  3GA4 A;  4IW9 A;  2XC2 A;  3P2A A;  4LL1 B;  1BED A;  3F4S A;  2FWH A;  1A2L A;  1O81 A;  2H1G A;  4F0C A;  3CXG A;  4ZIL A;  2VIM A;  4I8B A;  2H6X A;  4ZBD A;  1ERV A;  1WE0 A;  3IHQ A;  3DRN A;  1OYJ A;  4MPF A;  2LQO A;  2IMI A;  2F3M A;  2FNO A;  3O76 A;  4LMV A;  4I2T A;  1AXD A;  3DGQ A;  4X1U A;  2YNX A;  4ZL7 A;  1XW5 A;  2CX4 A;  2VL2 C;  2TIR A;  2VO4 A;  5J9B A;  2FY6 A;  5IMF A;  3MNG A;  1W89 A;  2CQ9 A;  5GZZ B;  4XRD A;  3BCI A;  5E4W A;  4JR6 A;  1YQ1 A;  4G0L A;  2ZNM A;  1QQ2 A;  3NZN A;  17GS A;  3GST A;  4H86 A;  2HE3 A;  3UEM A;  1JZR A;  4KE3 A;  2CX3 A;  1Y25 A;  5HFI A;  1WPI A;  2C3N A;  1PL1 A;  4OD7 A;  3UMA A;  2FD3 A;  5ABR A;  5H5R A;  5ELG A;  4HEA 2;  2MZC A;  3VWV A;  4F0B A;  1DSB A;  1EOG A;  3GFK A;  1DUG A;  2YPM A;  3EWL A;  1OC9 A;  1ZL9 A;  4O92 A;  3TDG A;  3WGD A;  1H4O A;  4ISD A;  4DSS B;  3W6G A;  4EXJ A;  1ERW A;  5AIX A;  1Z6N A;  2AB6 A;  2HXK A;  3QOU A;  2DJ0 A;  2GTU A;  3VWX A;  2H72 A;  3WD6 A;  2JZR A;  4ZBB A;  5DJM A;  1O73 A;  2K8V A;  2TRX A;  3RHB A;  2GSS A;  2FWF A;  1A0R P;  1EV4 A;  1JZW A;  2H30 A;  3BJ5 A;  3HJM A;  4BL7 A;  2LV3 A;  4HU9 A;  1BJX A;  2IJY A;  2GLR A;  3L9U A;  5AIV A;  2HSM B;  4ECI A;  2PVQ A;  4JBB A;  2FCH A;  5DCG A;  1FVK A;  3QCP A;  3TKQ A;  5IMZ A;  2GZZ A;  2UZ8 A;  1RW1 A;  4MF7 A;  2BTO T;  3PGT A;  1VF2 A;  5ID2 B;  1ACV A;  1XVW A;  2B1K A;  4IKH A;  4EF0 A;  3CSJ A;  1QXH A;  2IWT A;  4PQ1 A;  5JWQ B;  1SL1 B;  3CSI A;  1OVN A;  2EIR A;  1SL0 B;  4QQ7 A;  2R2J A;  1XOB A;  5BMU A;  3IK7 A;  1Z3E A;  4L0U A;  1TK8 B;  4D73 B;  1G7E A;  1MDK A;  2E2G A;  4HI7 A;  1X5D A;  1U6T A;  2P5Q A;  4NWY A;  4CDO A;  3G7J A;  5ECI B;  1GH2 A;  2WDU A;  2O85 A;  2L6C A;  4G10 A;  4KDY A;  4KH7 A;  1U3A A;  2XHF A;  3DD3 A;  2X8H A;  2RM6 A;  1A0F A;  1LJR A;  3AY8 A;  3QR6 A;  3QMX A;  2I3Y A;  4ZB6 A;  1PA3 A;  3P90 A;  4BWQ A;  4WBJ A;  3WGX A;  2D2Z A;  2MMZ A;  4NHW A;  2LEG A;  4FYB A;  2H0I A;  3J7Y b;  2EIO A;  2M80 A;  2PUK C;  5KN2 A;  2E7P A;  4Q5Q A;  4BVY B;  2PWJ A;  3UJ1 A;  4XS4 A;  3KCM A;  1OC3 A;  1GSQ A;  1BG5 A;  3PPU A;  2I4A A;  2DIY A;  5IPH A;  2VCQ A;  1ILO A;  3IRA A;  3GKK A;  4WET A;  4GST A;  1O85 A;  2V6O A;  1MDI A;  2GZY A;  4TR4 A;  2GQL A;  1HNA A;  3EIN A;  2ZUP A;  2FLS A;  2CAQ A;  3BBY A;  2LTK A;  4IP1 A;  4J56 E;  3J7Y k;  1J9B A;  5AN1 A;  1XWC A;  1UVZ A;  2JSY A;  4POL A;  4J2F A;  1GSY A;  6GST A;  1S3C A;  4OFN A;  1N8J A;  3KEB A;  3ME8 A;  1VRS D;  2WUL A;  1ZMA A;  1JFU A;  1F3B A;  3P7X A;  2AHE A;  2GVP A;  2KHP A;  4MF6 A;  4PNG A;  3KZQ A;  1N2A A;  2DIZ A;  2X8G A;  1X9M B;  3IPZ A;  5DQS A;  5KN3 A;  4ZB9 A;  1GSD A;  3LFL A;  2PVO C;  3EYT A;  4IBP A;  1F2E A;  5DCH A;  1PGT A;  1BX9 A;  2CVK A;  3LGC A;  2HRF A;  5CRW A;  2LJA A;  2X64 A;  2GST A;  4KSO A;  2B5X A;  3FYG A;  3QFB C;  1GUM A;  1X5E A;  1YF1 A;  4TKY A;  1ZOF A;  1F3A A;  4I97 A;  2YAN A;  5CP1 A;  2X99 A;  3TJB A;  5G31 A;  4IQA A;  4ZL9 A;  3TKR A;  3APS A;  1V98 A;  3ERG A;  2K18 A;  2OE3 A;  5F8B A;  4BVX B;  1MDJ A;  3GHA A;  2VCZ A;  2K9F A;  1WMJ A;  5GAN D;  5GST A;  2C0F A;  1LBK A;  2VCW A;  2YJH A;  1EWX A;  1IYI A;  5EVO A;  3N9J A;  5GAP D;  1X5C A;  4HZ2 A;  5H5S A;  2G2Q A;  4Z7X A;  2ON7 A;  2R37 A;  5D9X A;  3CTF A;  4GQF A;  1SJZ A;  2V32 A;  1Q4J A;  1A2J A;  3F6D A;  3TJF A;  2QC7 A;  2J9H A;  1TI3 A;  1F9M A;  1AAZ A;  16GS A;  2HFD A;  1O7U A;  4ECJ A;  4FH8 A;  3F63 A;  1GWC A;  3VUR A;  1PN9 A;  1X9S B;  1M7T A;  2LRT A;  2VLV A;  4I2U A;  6GSW A;  2V2G A;  2DJ1 A;  3TJJ A;  1K0N A;  3VPT A;  3KTB A;  3K8N A;  3TKS E;  3LXZ A;  4J57 E;  5E59 A;  3A2V A;  2HYX A;  2LKU A;  1GNW A;  1K3Y A;  4K1F A;  2GT5 A;  4XTS A;  2WS2 A;  3D22 A;  5DAL B;  2OAD A;  1C72 A;  4KCA A;  3A2W A;  3IR4 A;  3C8E A;  4MA9 A;  2IMK A;  2H6Z A;  4E8H A;  1HNB A;  1T4Y A;  3BD2 A;  1GTA A;  5D96 A;  4HJM A;  4N0V A;  1MD4 A;  3CRT A;  1SJ6 A;  3VLN A;  3G7Y A;  5HR1 A;  3HDC A;  2P31 A;  1M99 A;  1T3B A;  4K8M A;  3NOF A;  3RPN A;  3BOA A;  5DQY A;  5J5N A;  4V2N A;  22GS A;  1E2Y A;  3DKS A;  2F8F A;  2H0G A;  1SD9 A;  2YWO A;  2HZE A;  1PX7 A;  3R2Q A;  5LD0 A;  4ZBA A;  1JLV A;  1NM3 A;  3KMN A;  1JHB A;  2OE1 A;  3HKR A;  4FQU A;  1M2B A;  4MF5 A;  2C0E A;  3ME7 A;  4KND A;  5F0G A;  2VM1 A;  1TK5 B;  4E8E A;  4YQV A;  5L71 A;  2OBK A;  5D8I A;  3F4R A;  3PR8 A;  1KNG A;  4MJA A;  2VLU A;  1SU9 A;  1YZX A;  4EKZ A;  1WOU A;  3KP9 A;  4GSN A;  2RUF A;  5DAK B;  4MLY A;  5B8A A;  1S3D A;  3QD9 A;  2FGX A;  2XPE A;  4N0Z A;  1FW1 A;  1ZZY A;  3EU3 A;  4DEJ A;  1ZYQ B;  3JCM L;  1XW9 A;  5F06 A;  2LNS A;  2GSQ A;  4XCS A;  3TKS C;  2H73 A;  4PQI A;  1QMV A;  3ZIJ A;  4MJE A;  1JZD A;  5B7C A;  1M9B A;  2P0G A;  5J4U A;  2WCI A;  2CA8 A;  1YKA A;  4YAV A;  4XIH A;  2H1D A;  3GYK A;  4LMW A;  2VL9 A;  2CZ2 A;  4EL1 A;  5G5F A;  1IYH A;  4MK3 A;  2JU5 A;  2JAC A;  5DJL A;  1EGO A;  3GMF A;  1TOF A;  1FB0 A;  4YH2 A;  3FR6 A;  2A2S A;  4POB A;  1PL2 A;  4PQH A;  2VCX A;  2J23 A;  3IE3 A;  4WXT A;  12GS A;  1ML6 A;  2OKA A;  2PBJ A;  2WGR A;  3FKF A;  3QPM A;  4AGS A;  2N5A A;  3KTL A;  2HRK B;  4WF4 A;  1WIK A;  2HSN B;  2LJR A;  3HHV A;  5EL8 A;  1A8Y A;  1ON4 A;  3H4K A;  1EP7 A;  1TI1 A;  1YEP A;  4GQC A;  4P3Y B;  4MZC A;  5ECK B;  3S9F A;  3QAG A;  3M9J A;  3TRQ A;  3M0F A;  5CNW A;  2GZP A;  2XBQ A;  3EU4 A;  3H8Q A;  1GLP A;  3LQ7 A;  2PGT A;  3KD0 A;  4ML6 A;  2H8L A;  3ZIV A;  1AQV A;  1OKT A;  4JRR A;  3M8N A;  2ZCT A;  1Z6M A;  1FAA A;  4EO3 A;  1NHO A;  1GSU A;  1FO5 A;  3HJP A;  4X43 A;  4F9Z A;  1E6B A;  2YZU A;  3GIX A;  3RPP A;  1YF0 A;  2BJX A;  5JCG A;  3C1R A;  1TXX A;  2IPA A;  5ECN B;  3D21 A;  2RUE A;  4PTS A;  3ZML A;  1XWA A;  1XCC A;  2EIQ A;  5ECS A;  2H01 A;  3TKS A;  4NPB A;  1GSS A;  2DJ3 A;  4OO5 A;  5JCU A;  3TUE A;  1TW9 A;  1RQM A;  3GTU A;  4TW5 A;  5D9T A;  2DML A;  2K6V A;  2H74 A;  2G0F A;  5IOX A;  1K0M A;  1K3L A;  3GUR A;  1U88 A;  2L6D A;  2VL2 A;  5AGY A;  1SK2 A;  2H76 A;  5HQP A;  2YZH A;  3IAM 2;  3I43 A;  5IQY A;  2HNL A;  1AQW A;  2L4C A;  6GSX A;  1Z5Y E;  1NSW A;  1J0F A;  2PER A;  2QKE A;  1R26 A;  1HYU A;  3RDW A;  3G7I A;  1SYX A;  4TRX A;  4PXO A;  4MJC A;  5IIZ A;  2YP6 A;  3WYW A;  3H1N A;  3IC8 A;  3GL3 A;  3WGE A;  1XVQ A;  4NXI A;  3TOU A;  3HVS A;  4IJI A;  2DLX A;  1OC8 A;  3G9B A;  2H19 A;  3IXR A;  4DSR A;  2GQK A;  4HU7 A;  2B3S A;  3FW2 A;  2AAW A;  1XWB A;  2JL4 A;  2H6Y A;  1OE7 A;  1HNC A;  3UOM A;  3IV4 A;  3HZ4 A;  3CTG A;  1VF3 A;  4RQR A;  2VD0 A;  2DJ2 A;  3GKN A;  1AIU A;  3MWH A;  4I5Q A;  4POK A;  5IMA A;  4MJB A;  4HQZ A;  4ECC A;  3A5W A;  3L0H A;  3KMO A;  2XBI A;  4MPG A;  2H1A A;  4YQU A;  2V1M A;  1X0R A;  5ECH B;  4DSS A;  2AJQ B;  3GN3 A;  5H5Q A;  1V2A A;  1THO A;  1CQG A;  1HD2 A;  4HS1 A;  1V9W A;  2IIY A;  3L4N A;  1GLQ A;  1USB A;  3V1W A;  5IO2 A;  4G2E A;  4WF5 A;  3GNJ A;  3HVX A;  1TK0 B;  3Q19 A;  4K7I A;  2L4Q A;  4BA7 A;  4LL4 B;  2DSA A;  2A2R A;  4X0X A;  5CYY A;  3TRP A;  3RHC A;  1FHE A;  1M2D A;  2HSM A;  1K0B A;  1GNE A;  4O5R A;  3L78 A;  5B6N A;  3FRC A;  3D6I A;  3ED3 A;  5IPG A;  2NPB A;  5ID2 A;  2VAF A;  3LJR A;  2GQM A;  5ECL B;  1PSQ A;  2GGT A;  1GRX A;  4EC0 A;  4K9Z A;  4GWR A;  2YN1 A;  1EEM A;  4LLR A;  3PIN A;  1BQ7 A;  3R3E A;  3APQ A;  4D73 A;  5ECM B;  3UAP A;  3IAS 2;  1SKW B;  2IL3 A;  1ERT A;  2B7J A;  2IMD A;  2FA8 A;  2GSR A;  3C71 A;  4AJ6 A;  4OCF A;  1EOH A;  1NHY A;  4EDY A;  3FZ4 A;  3KH9 A;  1VF4 A;  1AW9 A;  2CVD A;  3DXB A;  3H79 A;  3CYN A;  3M9K A;  3GKX A;  1R5P A;  1WWJ A;  5ECP B;  3GRX A;  1W4V A;  3DIE A;  2B6M A;  1PRX A;  2RLI A;  3W8J A;  2YOI A;  2HLS A;  3MDK A;  2VLT A;  1MD3 A;  1V57 A;  2IN3 A;  6GSY A;  4BVY A;  3KH7 A;  4YAP A;  2PN8 A;  4PUR A;  2C1Y A;  2PPT A;  3ZIT A;  2H70 A;  4HDE A;  3M3M A;  1G7O A;  2OE0 A;  2IFQ B;  4NV2 A;  5J3R A;  3L9S A;  3EMX A;  1XIY A;  1XWK A;  5B8B A;  2HI7 A;  3WT1 A;  2YCD A;  2O87 A;  3LWA A;  3WT2 A;  1GTB A;  2LS5 A;  5HFK A;  1XOA A;  2NBS A;  6GSV A;  4RQX A;  2AUV A;  4MZW A;  3DVW A;  3FK8 A;  3I6A A;  4FIW A;  4JE1 A;  1TRW A;  3UVT A;  1UC7 A;  1FOV A;  3VI5 A;  2L59 A;  3ZRE A;  4ZB8 A;  3LOR A;  4FYC A;  4BWS A;  5IOW A;  1F37 A;  2H75 A;  5FT3 A;  2YWM A;  3HXS A;  4LA1 A;  3UL3 A;  4I6X A;  3U5R E;  1B9Y C;  3TJK A;  2OAC A;  2B7K A;  3LEF A;  1M9A A;  1SKS B;  5CRG A;  1AQX A;  4K7N A;  2HSH A;  1LU4 A;  1K0A A;  1UN2 A;  5G2Z A;  5IMD A;  2OA7 A;  1QGV A;  1SL2 B;  2DJK A;  3TB2 A;  3F0I A;  4V1A g;  1K0D A;  1XPV A;  5C00 A;  3CRU A;  4PGT A;  1R4W A;  2RII A;  4IN0 A;  2ALB A;  2H66 A;  1XXU A;  1PMT A;  4KA0 A;  2CAI A;  3ZVJ D;  4NHZ A;  2MBS A;  1DBY A;  1KEB A;  2P5R A;  3DYR A;  4QL7 A;  2C0G A;  1SEN A;  1OC9 B;  3GX8 A;  4WR5 A;  1T4Z A;  2PMT A;  4RUV A;  1EGR A;  1FVJ A;  5KN1 A;  4KB3 A;  1YDK A;  4IJ3 A;  1B9X C;  5A5K A;  1A24 A;  4KUN A;  4TXO B;  4KF9 A;  4BVX A;  4KCE A;  4TR3 A;  3F8U A;  3F3Q A;  5J41 A;  4ID0 A;  1WJK A;  5IMC A;  4ACS A;  4TR0 A;  3EC3 A;  2H71 A;  5D9W A;  4L5L A;  5G1K A;  1TP9 A;  3I69 A;  1PQN A;  4OFM A;  1OE8 A;  1O8W A;  2MMO A;  1K3O A;  4EVM A;  4BL7 B;  5JWR B;  1Z7P A;  1O8X A;  2E0Q A;  4BPY A;  4IHU A;  4K0N A;  2LQQ A;  1GUL A;  3FZA A;  1A2M A;  1T00 A;  4QL9 A;  3KP8 A;  3LYP A;  3KJY A;  2L5L A;  3ZTL A;  3FY7 A;  3GH9 A;  3FR9 A;  2PU9 C;  3W8S A;  4G0K A;  3IDV A;  1XWG A;  2M72 A;  5INY A;  2NTO A;  1G6Y A;  5EPF A;  1YJ6 A;  4OO4 A;  3LSZ A;  3TGZ A;  3GUS A;  3NIV A;  1AC1 A;  2HRA A;  2AV4 A;  4L5O A;  2C0D A;  1EV9 A;  2B5Y A;  1OKD A;  4O7H A;  4N11 A;  3CSH A;  3C7M A;  3Q18 A;  4JR4 A;  2L57 A;  1T7P B;  3IA1 A;  2YJ7 A;  1GTI A; 
#chains in the Genus database with same CATH topology
 3GV1 A;  5DAL A;  4G0I A;  3GL5 A;  1G0T A;  3HVV A;  4AJ7 A;  4TOP A;  2I1U A;  1XFL A;  1B48 A;  4EUY A;  2HZF A;  3FR3 A;  4JZQ A;  1UA5 A;  5CRE A;  3EPT A;  5IM9 A;  1GTU A;  2YWI A;  4AKH A;  1EEJ A;  1H75 A;  4XS4 B;  5D93 A;  2N5B A;  2K8S A;  1ZYP A;  5ECO B;  3HY2 A;  14GS A;  1EP8 A;  1RK4 A;  3PH9 A;  4KW6 A;  1TU7 A;  3A2X A;  4K2X A;  4EDZ A;  4KDX A;  1PKW A;  2YWN A;  1URM A;  4IVF A;  1GSF A;  3IBH A;  3US3 A;  5COH A;  4ZB7 A;  4GF0 A;  2KP2 A;  4WR4 A;  4PI0 C;  2LUS A;  4G19 A;  2KLX A;  4TXO A;  5A4U A;  3KXO A;  3FEU A;  4Q5R A;  7GSS A;  3D4T A;  1SKR B;  2H1B A;  1S3A A;  5J9C A;  3A3T A;  1GSE A;  2HQT A;  1VGL A;  2VOC A;  4MZB A;  2FWG A;  4HUA A;  1B8X A;  3E3E A;  3ZFL A;  2FA4 A;  2GT6 A;  2R6K A;  5DAK A;  2IMF A;  11GS A;  2UV8 G;  5EY6 A;  2WJU A;  2N5F A;  1PD2 1;  5ECQ B;  2C8U A;  3QDN A;  1THX A;  3MAK A;  3MSZ A;  1T8E B;  2QGV A;  2R3X A;  4NMU A;  4TR1 B;  2QSI A;  4CY6 A;  2MBT A;  2OBI A;  4GTU A;  2VD1 A;  3VWU A;  3TKP A;  3EUR A;  3HJO A;  4MMM A;  4POM A;  3CMI A;  5CRD A;  1ST9 A;  2JAD A;  2CT6 A;  3RBT A;  1M0U A;  4WEY A;  4ICY A;  1QK8 A;  4ECB A;  1U87 A;  1F6M C;  4MH2 A;  1TKD B;  2A2P A;  1S4B P;  1I1I P;  4PUA A;  5JCW A;  2R5G A;  4HZ4 A;  3VWW A;  2YV7 A;  2OT3 A;  3FMW A;  2L5O A;  5A5H B;  3TRX A;  3O3T A;  2GS3 A;  3HZ8 A;  1XBS A;  3C73 A;  2A4V A;  4K2D A;  4IS0 A;  1JLW A;  4WBR D;  2HRK A;  4RI7 A;  5A1N A;  5C04 A;  2B1L A;  2V41 A;  1WRY A;  3N5O A;  5KN0 A;  2LJK A;  1M2A A;  4CY8 A;  4TVE A;  1I5G A;  2CZ3 A;  5J4Y A;  2I81 A;  4AJ8 A;  5CAX A;  2JSZ A;  4IQ1 A;  3ZFB A;  2F8A A;  2HSY A;  2FHE A;  3Q6O A;  3F3R A;  4GSS A;  1QUW A;  5ECR B;  2F9S A;  1Z9H A;  2BMX A;  3DVX A;  3ZLP A;  5F05 A;  1GP1 A;  3UIW A;  5DDL A;  2OJL A;  4DVC A;  2KUC A;  3UBL A;  3Q74 A;  2E2M A;  3HA9 A;  1TJD A;  1GUK A;  3O6T A;  4GLT A;  2B5E A;  4G01 A;  2GDR A;  1KBN A;  10GS A;  4O32 A;  4Q5N A;  3DML A;  4HJ2 A;  1YKC A;  4F82 A;  3TJG A;  3ZRD A;  4ZIJ A;  1Q98 A;  3KIJ A;  4XRA A;  3DEX A;  4WKW A;  2LRC A;  4TXV A;  2VL3 A;  1B4P A;  3MYD A;  4V2L A;  3F9U A;  4NAX A;  3GX0 A;  5HFG A;  5B6M A;  2MMN A;  3HD5 A;  1U3I A;  4AF2 A;  3ZVJ A;  3IC4 A;  1SYR A;  3RAZ A;  1PX6 A;  4USS A;  4V1A p;  5LCZ A;  4KDU A;  4KGI A;  4K5S A;  4OCE A;  2I9H A;  4OMV A;  4YQM A;  2REM A;  1BAY A;  3UVH A;  3A5I A;  2NDO A;  3F6F A;  2MMA A;  5HR0 A;  3TCO A;  9GSS A;  1ABA A;  4ZL8 A;  3KM6 A;  3RGB C;  4F03 A;  4TR1 A;  3F4T A;  2CVB A;  1SK0 A;  2C80 A;  4YKF A;  4K0G A;  4EE0 A;  4PX1 A;  1V58 A;  4JED A;  5AIS A;  3EVI A;  2XPD A;  4JU5 A;  2KP1 A;  2R0G A;  19GS A;  5G5E A;  4ML1 A;  1J08 A;  5FHI A;  3L9V A;  2X4A A;  3IK9 A;  1TRU A;  4ILF A;  1TDI A;  6GSU A;  2O89 A;  5FWG A;  1G6W A;  3U6V A;  1A8L A;  2Z9S A;  2HZE B;  2O8V B;  5HR3 A;  5CRH A;  4IGJ A;  1XW6 A;  2C4J A;  1K0O A;  3SBC A;  1YY7 A;  5ELA A;  2LRN A;  2YV9 A;  1DE1 A;  4F2I A;  4PUF C;  5A5H A;  5LNK e;  3QAW A;  4KAE A;  1SK1 A;  5D73 A;  2VM2 A;  1K0C A;  2WFC A;  2DMM A;  3ZZX A;  4V2M A;  2LNT A;  2JZS A;  2DC5 A;  1AUC A;  1JZO A;  1T1V A;  4FO5 A;  5KEJ A;  4L8E A;  1ERU A;  3ZL5 A;  3SWL A;  3LYK A;  2ON5 A;  2ES7 A;  4Q5F A;  2EC4 A;  4PNF A;  4MDC A;  1ZYE A;  1ZCP A;  2DJJ A;  3TOT A;  3FZ5 A;  6GSS A;  3ZMK A;  2DBC A;  3KGK A;  2TRC P;  3HYP A;  1SVM A;  4RI6 A;  1EZK A;  1XZO A;  4IP6 A;  1VF1 A;  3EE2 A;  3VPQ A;  5GSS A;  4XS1 A;  2NVL A;  1OAZ A;  3C1S A;  1NW2 A;  2WB9 A;  3GH6 A;  4NV5 A;  1Z7R A;  3D0Z A;  4HQS A;  3H93 A;  3LG6 A;  4TN8 A;  2AYT A;  4MP4 A;  4AKX B;  13GS A;  2V6K A;  3LXT A;  2LST A;  2H0H A;  3FHK A;  3VI7 A;  2VCT A;  2VCV A;  5IMV A;  2FWE A;  4MCU A;  3ERW A;  2C3T A;  4KX4 A;  3D4M A;  2WRT A;  1ZGN A;  4HSC X;  1FOH A;  1TU8 A;  2R4V A;  4FYU A;  1MTC A;  1SJI A;  1BYE A;  3DWV A;  4MAB A;  3I9V 2;  3EMP A;  2O7K A;  1FB6 A;  3ERF A;  1MEK A;  4N10 A;  2O36 A;  4CHS A;  1S3R A;  4X4J A;  5A4W A;  2RM5 A;  1X9W B;  3UAR A;  4ULX A;  3D5J A;  2MYG A;  1CQH A;  3BCK A;  1BF5 A;  2X8C A;  2JZT A;  5A4V A;  2M46 A;  4IEL A;  1I9D A;  4L0W A;  2KOK A;  3FZ9 A;  5JWO B;  1HQO A;  4EIP A;  3GSS A;  2VUP A;  3M1G A;  1V40 A;  4XS6 A;  4OWY A;  5F07 A;  18GS A;  3E9J B;  2HRN A;  1R7H A;  3CBU A;  2C3Q A;  3QFA C;  1SD8 A;  4HOJ A;  1WP0 A;  3IOS A;  1R5A A;  1KTE A;  1A23 A;  8GSS A;  3E0U A;  4GRF A;  4CW9 A;  1B4Q A;  3UBK A;  5HR2 A;  1YEX A;  5D9V A;  1GUH A;  1TRV A;  3VK9 A;  1TRS A;  3VFI A;  2IME A;  5ENU A;  5DBQ A;  2WW0 A;  2HT9 A;  3P8W A;  1Y6E A;  1TTZ A;  5G30 A;  20GS A;  5DVB A;  2WZ9 A;  1Y1U A;  5IO0 A;  2H1L A;  4MH3 A;  4XHM A;  1QFN A;  3ZYW A;  3ISO A;  4G9H A;  4K7O A;  2FUG 2;  4K6X A;  4GXZ A;  1GL8 A;  1FG4 A;  5CO3 A;  3GKM A;  3OR5 A;  4DSQ A;  5G1L A;  1O6J A;  2IFQ A;  3QAV A;  4OFT A;  3APO A;  2F51 A;  3GTU B;  1PKZ A;  3HCZ A;  1DE2 A;  4N30 A;  4GCI A;  2CV4 A;  4KSM A;  4ZXG A;  3GA4 A;  3HMJ G;  4IW9 A;  2XC2 A;  3P2A A;  4LL1 B;  1BED A;  5BMU B;  3F4S A;  2FWH A;  1A2L A;  1O81 A;  2H1G A;  4F0C A;  3CXG A;  4ZIL A;  2VIM A;  4I8B A;  2H6X A;  4ZBD A;  1ERV A;  1WE0 A;  3IHQ A;  3DRN A;  1OYJ A;  4MPF A;  2LQO A;  2IMI A;  2F3M A;  2FNO A;  3O76 A;  4LMV A;  4I2T A;  4O5U A;  1AXD A;  5BRT A;  3DGQ A;  4X1U A;  2YNX A;  4ZL7 A;  1XW5 A;  2CX4 A;  5KOX A;  2VL2 C;  4FXY P;  2TIR A;  2VO4 A;  5J9B A;  2FY6 A;  5IMF A;  1SVO A;  1W89 A;  3MNG A;  4Z2R A;  2CQ9 A;  5GZZ B;  4XRD A;  3BCI A;  5E4W A;  4JR6 A;  1YQ1 A;  5A34 B;  3HVN A;  4G0L A;  2ZNM A;  1QQ2 A;  3NZN A;  17GS A;  3GST A;  4H86 A;  2HE3 A;  3UEM A;  1JZR A;  4KE3 A;  2CX3 A;  1Y25 A;  5HFI A;  1WPI A;  2C3N A;  1PL1 A;  3TU3 B;  4EIQ A;  4OD7 A;  3UMA A;  2FD3 A;  5ABR A;  5H5R A;  5ELG A;  4HEA 2;  2WVZ A;  2MZC A;  3VWV A;  4F0B A;  1DSB A;  1EOG A;  3GFK A;  1DUG A;  2YPM A;  3EWL A;  1OC9 A;  4AKI A;  1ZL9 A;  4O92 A;  3TDG A;  3WGD A;  2O5V A;  1H4O A;  4ISD A;  4DSS B;  3W6G A;  4EXJ A;  1ERW A;  5AIX A;  1Z6N A;  2AB6 A;  2HXK A;  2DJ0 A;  2GTU A;  3QOU A;  3VWX A;  2H72 A;  3WD6 A;  2JZR A;  4ZBB A;  5DJM A;  1O73 A;  2K8V A;  2TRX A;  3RHB A;  2GSS A;  2FWF A;  1A0R P;  1EV4 A;  1JZW A;  2H30 A;  3BJ5 A;  3HJM A;  4BL7 A;  2LV3 A;  4HU9 A;  1BJX A;  2IJY A;  2GLR A;  3L9U A;  5AIV A;  2HSM B;  4ECI A;  2PVQ A;  4JBB A;  2FCH A;  5DCG A;  1FVK A;  3QCP A;  3TKQ A;  5IMZ A;  2GZZ A;  2UZ8 A;  1RW1 A;  4MF7 A;  2BTO T;  2WVX A;  3PGT A;  1VF2 A;  4PHZ C;  1ACV A;  1XVW A;  5ID2 B;  2B1K A;  4IKH A;  4EF0 A;  3CSJ A;  1QXH A;  2IWT A;  4PQ1 A;  5JWQ B;  1SL1 B;  3CSI A;  1OVN A;  2EIR A;  1SL0 B;  4QQ7 A;  5J47 A;  2R2J A;  1XOB A;  5BMU A;  3IK7 A;  1Z3E A;  4L0U A;  1TK8 B;  4D73 B;  1G7E A;  1MDK A;  2E2G A;  4HI7 A;  1X5D A;  1U6T A;  2P5Q A;  4NWY A;  4CDO A;  3G7J A;  5ECI B;  1GH2 A;  2WDU A;  2O85 A;  2L6C A;  4G10 A;  4KDY A;  4KH7 A;  1U3A A;  2XHF A;  3DD3 A;  2X8H A;  2RM6 A;  1A0F A;  1LJR A;  3AY8 A;  3QR6 A;  3QMX A;  2I3Y A;  4ZB6 A;  1PA3 A;  3P90 A;  4BWQ A;  4WBJ A;  3WGX A;  2D2Z A;  2MMZ A;  4NHW A;  2EFD A;  2LEG A;  4FYB A;  2H0I A;  3J7Y b;  2EIO A;  2M80 A;  2PUK C;  5KN2 A;  2E7P A;  4Q5Q A;  4BVY B;  1PFO A;  2PWJ A;  3UJ1 A;  4XS4 A;  3KCM A;  1OC3 A;  1GSQ A;  1BG5 A;  3PPU A;  2I4A A;  2DIY A;  2WW2 A;  5IPH A;  3IHG A;  2VCQ A;  1ILO A;  3IRA A;  3GKK A;  4WET A;  4GST A;  1O85 A;  2V6O A;  1MDI A;  2GZY A;  4TR4 A;  2GQL A;  1HNA A;  3EIN A;  2ZUP A;  2FLS A;  2CAQ A;  3BBY A;  2LTK A;  4IP1 A;  4J56 E;  3J7Y k;  1J9B A;  5AN1 A;  1XWC A;  1UVZ A;  2JSY A;  4POL A;  4J2F A;  1GSY A;  6GST A;  1S3C A;  4OFN A;  1N8J A;  3KEB A;  3ME8 A;  1VRS D;  4A5P A;  2WUL A;  1ZMA A;  1JFU A;  1F3B A;  3P7X A;  2AHE A;  2GVP A;  2KHP A;  4MF6 A;  4PNG A;  3KZQ A;  1N2A A;  4QMK A;  2DIZ A;  2X8G A;  1X9M B;  1XG8 A;  5DQS A;  3IPZ A;  5KN3 A;  4ZB9 A;  1GSD A;  4BIK A;  3LFL A;  2PVO C;  3EYT A;  4IBP A;  1F2E A;  5DCH A;  1PGT A;  1BX9 A;  2CVK A;  3LGC A;  1M3I A;  2R0P A;  2HRF A;  5CRW A;  2LJA A;  2X64 A;  2GST A;  4KSO A;  2B5X A;  3FYG A;  3QFB C;  1GUM A;  1X5E A;  1YF1 A;  4TKY A;  1ZOF A;  1F3A A;  4I97 A;  2YAN A;  5CP1 A;  2X99 A;  3TJB A;  5G31 A;  4IQA A;  4ZL9 A;  3TKR A;  3APS A;  1V98 A;  3ERG A;  2K18 A;  2OE3 A;  5F8B A;  4BVX B;  1MDJ A;  3GHA A;  2VCZ A;  2K9F A;  1WMJ A;  5GAN D;  5GST A;  2C0F A;  2EFH A;  1LBK A;  2VCW A;  2YJH A;  1EWX A;  1IYI A;  5EVO A;  3N9J A;  5GAP D;  1X5C A;  4HZ2 A;  5H5S A;  2G2Q A;  4Z7X A;  2ON7 A;  2R37 A;  5D9X A;  3CTF A;  4E68 A;  4GQF A;  1SJZ A;  2V32 A;  1Q4J A;  1A2J A;  3F6D A;  3TJF A;  2QC7 A;  2J9H A;  1TI3 A;  1F9M A;  1AAZ A;  16GS A;  2HFD A;  1O7U A;  4ECJ A;  4FH8 A;  3F63 A;  1GWC A;  3VUR A;  1PN9 A;  1X9S B;  1M7T A;  2LRT A;  2VLV A;  4I2U A;  6GSW A;  2WVY A;  2V2G A;  2DJ1 A;  3TJJ A;  1K0N A;  3VPT A;  5J4V A;  3KTB A;  3K8N A;  3TKS E;  3LXZ A;  4J57 E;  5E59 A;  3A2V A;  2HYX A;  2LKU A;  1GNW A;  1K3Y A;  4K1F A;  2GT5 A;  4XTS A;  2WS2 A;  3D22 A;  3CHX C;  4PI2 C;  5DAL B;  2OAD A;  1C72 A;  4KCA A;  3A2W A;  3IR4 A;  3C8E A;  4YKG A;  4MA9 A;  2IMK A;  2H6Z A;  4E8H A;  1HNB A;  1T4Y A;  3BD2 A;  1GTA A;  1BG1 A;  5D96 A;  4HJM A;  4N0V A;  1MD4 A;  3CRT A;  1SJ6 A;  3VLN A;  2VKZ G;  3G7Y A;  5HR1 A;  3HDC A;  2P31 A;  4W66 A;  1M99 A;  2DKI A;  1T3B A;  4K8M A;  3NOF A;  3RPN A;  2QA1 A;  3BOA A;  5DQY A;  5J5N A;  4V2N A;  22GS A;  1E2Y A;  3DKS A;  2F8F A;  2H0G A;  1SD9 A;  2WZS A;  2YWO A;  2HZE A;  4Z2T A;  1PX7 A;  3R2Q A;  5LD0 A;  4ZBA A;  1JLV A;  1NM3 A;  3KMN A;  1JHB A;  2OE1 A;  3HKR A;  4FQU A;  1M2B A;  4MF5 A;  2C0E A;  3ME7 A;  4KND A;  5F0G A;  2VM1 A;  1TK5 B;  4E8E A;  4YQV A;  5L71 A;  2OBK A;  5D8I A;  3F4R A;  3PR8 A;  1KNG A;  4MJA A;  2VLU A;  1SU9 A;  1YZX A;  4EKZ A;  1WOU A;  2EFC A;  4GDF A;  3KP9 A;  4GSN A;  2RUF A;  5DAK B;  1YEW C;  4MLY A;  5B8A A;  1S3D A;  2DKH A;  3QD9 A;  2FGX A;  2XPE A;  4N0Z A;  3MIX A;  1FW1 A;  1ZZY A;  3EU3 A;  4DEJ A;  1ZYQ B;  3JCM L;  1XW9 A;  5F06 A;  2LNS A;  2GSQ A;  4XCS A;  3TKS C;  2H73 A;  2O3E A;  4PQI A;  1QMV A;  3ZIJ A;  4MJE A;  1JZD A;  5B7C A;  1M9B A;  2P0G A;  5J4U A;  2WCI A;  2CA8 A;  1YKA A;  4YAV A;  4XIH A;  2H1D A;  3GYK A;  4LMW A;  2VL9 A;  2CZ2 A;  4EL1 A;  5G5F A;  1IYH A;  4MK3 A;  2JU5 A;  2JAC A;  5DJL A;  1EGO A;  3GMF A;  1TOF A;  1FB0 A;  4YH2 A;  3FR6 A;  2A2S A;  4POB A;  1PL2 A;  4PQH A;  2VCX A;  2J23 A;  3IE3 A;  4WXT A;  12GS A;  4O5Q A;  1ML6 A;  2OKA A;  2PBJ A;  2WGR A;  3FKF A;  3QPM A;  4AGS A;  2N5A A;  3KTL A;  2HRK B;  5A1N B;  4WF4 A;  1WIK A;  2HSN B;  2LJR A;  3HHV A;  5EL8 A;  1A8Y A;  1ON4 A;  3H4K A;  1EP7 A;  1TI1 A;  1YEP A;  4GQC A;  4P3Y B;  4MZC A;  5ECK B;  3S9F A;  3QAG A;  3M9J A;  3TRQ A;  3M0F A;  5CNW A;  2GZP A;  2XBQ A;  3EU4 A;  3H8Q A;  1GLP A;  3LQ7 A;  2PGT A;  3KD0 A;  4ML6 A;  2H8L A;  3ZIV A;  1AQV A;  1OKT A;  4JRR A;  3M8N A;  2ZCT A;  1Z6M A;  1FAA A;  4EO3 A;  1NHO A;  1GSU A;  1FO5 A;  3HJP A;  4X43 A;  4F9Z A;  1E6B A;  2YZU A;  3GIX A;  3RPP A;  1YF0 A;  2BJX A;  5JCG A;  3C1R A;  1TXX A;  2IPA A;  5ECN B;  3D21 A;  2RUE A;  4PTS A;  3ZML A;  1XWA A;  1N25 A;  1XCC A;  2EIQ A;  5ECS A;  2H01 A;  3TKS A;  4NPB A;  1GSS A;  2DJ3 A;  4OO5 A;  5JCU A;  3TUE A;  1TW9 A;  1RQM A;  2EFE A;  3GTU A;  4TW5 A;  5D9T A;  2DML A;  2K6V A;  2H74 A;  2G0F A;  5KOW A;  5IOX A;  1K0M A;  1K3L A;  3GUR A;  1U88 A;  2L6D A;  5J40 A;  2VL2 A;  5AGY A;  1SK2 A;  2H76 A;  5HQP A;  2YZH A;  3IAM 2;  3I43 A;  5IQY A;  2HNL A;  1AQW A;  2L4C A;  6GSX A;  1Z5Y E;  1NSW A;  1J0F A;  2PER A;  2QKE A;  1R26 A;  1HYU A;  3RDW A;  3G7I A;  1SYX A;  4TRX A;  4PXO A;  4MJC A;  5IIZ A;  2A4H A;  2YP6 A;  3WYW A;  3H1N A;  3IC8 A;  3GL3 A;  3WGE A;  1XVQ A;  4NXI A;  3TOU A;  3HVS A;  4IJI A;  2DLX A;  1OC8 A;  3G9B A;  2H19 A;  3IXR A;  4DSR A;  5A34 A;  2GQK A;  4HU7 A;  2B3S A;  3FW2 A;  2AAW A;  1XWB A;  2JL4 A;  2H6Y A;  1OE7 A;  2HSN A;  1HNC A;  3UOM A;  2QA2 A;  1PN0 A;  3IV4 A;  3HZ4 A;  3CTG A;  1VF3 A;  4RQR A;  2VD0 A;  2DJ2 A;  3GKN A;  1AIU A;  3MWH A;  4I5Q A;  4POK A;  5IMA A;  4MJB A;  4HQZ A;  4ECC A;  3A5W A;  3L0H A;  3KMO A;  2XBI A;  4MPG A;  2H1A A;  4YQU A;  2V1M A;  1X0R A;  5ECH B;  4DSS A;  2AJQ B;  3GN3 A;  4Z2U A;  5H5Q A;  1V2A A;  1THO A;  1CQG A;  1HD2 A;  4HS1 A;  1V9W A;  2IIY A;  3L4N A;  1GLQ A;  1USB A;  3V1W A;  5IO2 A;  4G2E A;  4WF5 A;  3GNJ A;  3HVX A;  1TK0 B;  3Q19 A;  4K7I A;  2L4Q A;  4BA7 A;  4LL4 B;  2DSA A;  2A2R A;  4X0X A;  5CYY A;  3TRP A;  3RHC A;  1FHE A;  1M2D A;  2HSM A;  1K0B A;  1GNE A;  4O5R A;  3L78 A;  5B6N A;  3FRC A;  3D6I A;  3ED3 A;  5IPG A;  2NPB A;  5ID2 A;  2VAF A;  3LJR A;  2GQM A;  5ECL B;  1PSQ A;  2GGT A;  1GRX A;  4EC0 A;  4K9Z A;  4GWR A;  1TXU A;  2YN1 A;  1EEM A;  4LLR A;  3PIN A;  1BQ7 A;  3R3E A;  3APQ A;  4D73 A;  5ECM B;  3UAP A;  3IAS 2;  1SKW B;  2IL3 A;  1ERT A;  2B7J A;  2IMD A;  2FA8 A;  2GSR A;  3C71 A;  4AJ6 A;  4OCF A;  1EOH A;  1NHY A;  4EDY A;  3FZ4 A;  3KH9 A;  1VF4 A;  4MNN A;  1AW9 A;  2CVD A;  3DXB A;  3H79 A;  4N3Z A;  3CYN A;  3M9K A;  3GKX A;  1R5P A;  1WWJ A;  5ECP B;  3GRX A;  1W4V A;  2X49 A;  3DIE A;  2B6M A;  1PRX A;  2RLI A;  3W8J A;  2YOI A;  2HLS A;  3MDK A;  2VLT A;  1MD3 A;  1V57 A;  2IN3 A;  6GSY A;  4BVY A;  3KH7 A;  4YAP A;  2PN8 A;  4PUR A;  2C1Y A;  2PPT A;  3ZIT A;  2H70 A;  4HDE A;  3M3M A;  2WW1 A;  1G7O A;  2OE0 A;  2IFQ B;  4NV2 A;  5J3R A;  3L9S A;  3EMX A;  1XIY A;  1XWK A;  5B8B A;  2HI7 A;  3WT1 A;  2YCD A;  2O87 A;  3LWA A;  3WT2 A;  1GTB A;  2LS5 A;  5HFK A;  1XOA A;  3CQF A;  2NBS A;  6GSV A;  4RQX A;  2AUV A;  4MZW A;  3DVW A;  3FK8 A;  3I6A A;  4FIW A;  4JE1 A;  1YVL A;  1TRW A;  3UVT A;  4AKG A;  1UC7 A;  1FOV A;  3VI5 A;  2L59 A;  3ZRE A;  4ZB8 A;  3LOR A;  4FYC A;  4BWS A;  5IOW A;  1F37 A;  2H75 A;  5FT3 A;  1M3J A;  2YWM A;  3HXS A;  4LA1 A;  3UL3 A;  1ZYN A;  4I6X A;  3U5R E;  1B9Y C;  3TJK A;  2OAC A;  2B7K A;  2R0C A;  3LEF A;  1M9A A;  1SKS B;  5CRG A;  1AQX A;  4K7N A;  2HSH A;  1LU4 A;  1K0A A;  1UN2 A;  5G2Z A;  5IMD A;  2OA7 A;  1QGV A;  1SL2 B;  4AI6 A;  2DJK A;  3TB2 A;  3F0I A;  4V1A g;  1K0D A;  1XPV A;  5C00 A;  3CRU A;  3CWG A;  4PGT A;  1R4W A;  2RII A;  4IN0 A;  2ALB A;  2H66 A;  1XXU A;  1PMT A;  4KA0 A;  2CAI A;  3ZVJ D;  4NHZ A;  2MBS A;  1DBY A;  1KEB A;  2P5R A;  3DYR A;  4QL7 A;  2C0G A;  1SEN A;  2WW3 A;  1OC9 B;  3GX8 A;  4WR5 A;  1T4Z A;  2PMT A;  4RUV A;  1EGR A;  1FVJ A;  5KN1 A;  4KB3 A;  1YDK A;  4IJ3 A;  1B9X C;  5A5K A;  1A24 A;  4KUN A;  4TXO B;  4KF9 A;  4BVX A;  4KCE A;  4TR3 A;  3F3Q A;  3F8U A;  5J41 A;  4ID0 A;  1WJK A;  5IMC A;  4ACS A;  4TR0 A;  3EC3 A;  2H71 A;  5D9W A;  4L5L A;  5G1K A;  1TP9 A;  3I69 A;  1PQN A;  3LW9 A;  4OFM A;  1OE8 A;  1O8W A;  2MMO A;  1K3O A;  4EVM A;  4BL7 B;  5JWR B;  1Z7P A;  1O8X A;  2E0Q A;  4BPY A;  4IHU A;  4K0N A;  2LQQ A;  1GUL A;  3FZA A;  1A2M A;  1T00 A;  4QL9 A;  3KP8 A;  3LYP A;  3KJY A;  2L5L A;  3ZTL A;  3FY7 A;  3GH9 A;  2WVX B;  3FR9 A;  2PU9 C;  3W8S A;  4G0K A;  1SVL A;  3IDV A;  1XWG A;  2M72 A;  5INY A;  4K5R A;  2NTO A;  1G6Y A;  5EPF A;  1YJ6 A;  4OO4 A;  3LSZ A;  3TGZ A;  3GUS A;  3NIV A;  1AC1 A;  2HRA A;  2AV4 A;  4L5O A;  2C0D A;  1EV9 A;  2B5Y A;  1OKD A;  4O7H A;  4N11 A;  3CSH A;  3C7M A;  3Q18 A;  3RFR C;  4JR4 A;  2L57 A;  1T7P B;  3IA1 A;  2YJ7 A;  1GTI A; 
#chains in the Genus database with same CATH homology
 3GV1 A;  5DAL A;  4G0I A;  3GL5 A;  1G0T A;  3HVV A;  4AJ7 A;  4TOP A;  2I1U A;  1XFL A;  1B48 A;  4EUY A;  2HZF A;  3FR3 A;  4JZQ A;  1UA5 A;  5CRE A;  3EPT A;  5IM9 A;  1GTU A;  2YWI A;  4AKH A;  1EEJ A;  1H75 A;  4XS4 B;  5D93 A;  2N5B A;  2K8S A;  1ZYP A;  5ECO B;  3HY2 A;  14GS A;  1EP8 A;  1RK4 A;  3PH9 A;  4KW6 A;  1TU7 A;  3A2X A;  4K2X A;  4EDZ A;  4KDX A;  1PKW A;  2YWN A;  1URM A;  4IVF A;  1GSF A;  3IBH A;  3US3 A;  5COH A;  4ZB7 A;  4GF0 A;  2KP2 A;  4WR4 A;  2LUS A;  4G19 A;  2KLX A;  4TXO A;  5A4U A;  3KXO A;  3FEU A;  4Q5R A;  7GSS A;  3D4T A;  1SKR B;  2H1B A;  1S3A A;  5J9C A;  3A3T A;  1GSE A;  2HQT A;  1VGL A;  2VOC A;  4MZB A;  2FWG A;  4HUA A;  1B8X A;  3E3E A;  3ZFL A;  2FA4 A;  2GT6 A;  2R6K A;  5DAK A;  2IMF A;  11GS A;  2UV8 G;  5EY6 A;  2WJU A;  2N5F A;  1PD2 1;  5ECQ B;  2C8U A;  3QDN A;  1THX A;  3MAK A;  3MSZ A;  1T8E B;  2QGV A;  2R3X A;  4NMU A;  4TR1 B;  2QSI A;  4CY6 A;  2MBT A;  2OBI A;  4GTU A;  2VD1 A;  3VWU A;  3TKP A;  3EUR A;  3HJO A;  4MMM A;  4POM A;  3CMI A;  5CRD A;  1ST9 A;  2JAD A;  2CT6 A;  3RBT A;  1M0U A;  4WEY A;  4ICY A;  1QK8 A;  4ECB A;  1U87 A;  1F6M C;  4MH2 A;  1TKD B;  2A2P A;  4PUA A;  5JCW A;  2R5G A;  4HZ4 A;  3VWW A;  2YV7 A;  2OT3 A;  3FMW A;  2L5O A;  5A5H B;  3TRX A;  3O3T A;  2GS3 A;  3HZ8 A;  1XBS A;  3C73 A;  2A4V A;  4K2D A;  4IS0 A;  1JLW A;  4WBR D;  2HRK A;  4RI7 A;  5A1N A;  5C04 A;  2B1L A;  2V41 A;  1WRY A;  3N5O A;  5KN0 A;  2LJK A;  1M2A A;  4CY8 A;  4TVE A;  1I5G A;  2CZ3 A;  5J4Y A;  2I81 A;  4AJ8 A;  5CAX A;  2JSZ A;  4IQ1 A;  3ZFB A;  2F8A A;  2HSY A;  2FHE A;  3Q6O A;  3F3R A;  4GSS A;  1QUW A;  5ECR B;  2F9S A;  1Z9H A;  2BMX A;  3DVX A;  3ZLP A;  5F05 A;  1GP1 A;  3UIW A;  5DDL A;  2OJL A;  4DVC A;  2KUC A;  3UBL A;  3Q74 A;  2E2M A;  3HA9 A;  1TJD A;  1GUK A;  3O6T A;  4GLT A;  2B5E A;  4G01 A;  2GDR A;  1KBN A;  10GS A;  4O32 A;  4Q5N A;  3DML A;  4HJ2 A;  1YKC A;  4F82 A;  3TJG A;  3ZRD A;  4ZIJ A;  1Q98 A;  3KIJ A;  4XRA A;  3DEX A;  4WKW A;  2LRC A;  4TXV A;  2VL3 A;  1B4P A;  3MYD A;  4V2L A;  3F9U A;  4NAX A;  3GX0 A;  5HFG A;  5B6M A;  2MMN A;  3HD5 A;  1U3I A;  4AF2 A;  3ZVJ A;  3IC4 A;  1SYR A;  3RAZ A;  1PX6 A;  4USS A;  4V1A p;  5LCZ A;  4KDU A;  4KGI A;  4K5S A;  4OCE A;  2I9H A;  4OMV A;  4YQM A;  2REM A;  1BAY A;  3UVH A;  3A5I A;  2NDO A;  3F6F A;  2MMA A;  5HR0 A;  3TCO A;  9GSS A;  1ABA A;  4ZL8 A;  3KM6 A;  4F03 A;  4TR1 A;  3F4T A;  2CVB A;  1SK0 A;  2C80 A;  4YKF A;  4K0G A;  4EE0 A;  4PX1 A;  1V58 A;  4JED A;  5AIS A;  3EVI A;  2XPD A;  4JU5 A;  2KP1 A;  2R0G A;  19GS A;  5G5E A;  4ML1 A;  1J08 A;  5FHI A;  3L9V A;  2X4A A;  3IK9 A;  1TRU A;  4ILF A;  1TDI A;  6GSU A;  2O89 A;  5FWG A;  1G6W A;  3U6V A;  1A8L A;  2Z9S A;  2HZE B;  2O8V B;  5HR3 A;  5CRH A;  4IGJ A;  1XW6 A;  2C4J A;  1K0O A;  3SBC A;  1YY7 A;  5ELA A;  2LRN A;  2YV9 A;  1DE1 A;  4F2I A;  4PUF C;  5A5H A;  5LNK e;  3QAW A;  4KAE A;  1SK1 A;  5D73 A;  2VM2 A;  1K0C A;  2WFC A;  2DMM A;  3ZZX A;  4V2M A;  2LNT A;  2JZS A;  2DC5 A;  1AUC A;  1JZO A;  1T1V A;  4FO5 A;  5KEJ A;  4L8E A;  1ERU A;  3ZL5 A;  3SWL A;  3LYK A;  2ON5 A;  2ES7 A;  4Q5F A;  2EC4 A;  4PNF A;  4MDC A;  1ZYE A;  1ZCP A;  2DJJ A;  3TOT A;  3FZ5 A;  6GSS A;  3ZMK A;  2DBC A;  3KGK A;  2TRC P;  3HYP A;  1SVM A;  4RI6 A;  1EZK A;  1XZO A;  4IP6 A;  1VF1 A;  3EE2 A;  3VPQ A;  5GSS A;  4XS1 A;  2NVL A;  1OAZ A;  3C1S A;  1NW2 A;  2WB9 A;  3GH6 A;  4NV5 A;  1Z7R A;  3D0Z A;  4HQS A;  3H93 A;  3LG6 A;  4TN8 A;  2AYT A;  4MP4 A;  4AKX B;  13GS A;  2V6K A;  3LXT A;  2LST A;  2H0H A;  3FHK A;  3VI7 A;  2VCT A;  2VCV A;  5IMV A;  2FWE A;  4MCU A;  3ERW A;  2C3T A;  4KX4 A;  3D4M A;  2WRT A;  1ZGN A;  1FOH A;  1TU8 A;  2R4V A;  4FYU A;  1MTC A;  1SJI A;  1BYE A;  3DWV A;  4MAB A;  3I9V 2;  3EMP A;  2O7K A;  1FB6 A;  3ERF A;  1MEK A;  4N10 A;  4CHS A;  4X4J A;  5A4W A;  2RM5 A;  1X9W B;  3UAR A;  4ULX A;  3D5J A;  2MYG A;  1CQH A;  3BCK A;  1BF5 A;  2X8C A;  2JZT A;  5A4V A;  2M46 A;  4IEL A;  1I9D A;  4L0W A;  2KOK A;  3FZ9 A;  5JWO B;  1HQO A;  4EIP A;  3GSS A;  2VUP A;  3M1G A;  1V40 A;  4XS6 A;  4OWY A;  5F07 A;  18GS A;  3E9J B;  2HRN A;  1R7H A;  3CBU A;  2C3Q A;  3QFA C;  1SD8 A;  4HOJ A;  1WP0 A;  3IOS A;  1R5A A;  1KTE A;  1A23 A;  8GSS A;  3E0U A;  4GRF A;  4CW9 A;  1B4Q A;  3UBK A;  5HR2 A;  1YEX A;  5D9V A;  1GUH A;  1TRV A;  3VK9 A;  1TRS A;  3VFI A;  2IME A;  5ENU A;  5DBQ A;  2HT9 A;  3P8W A;  1Y6E A;  1TTZ A;  5G30 A;  20GS A;  5DVB A;  2WZ9 A;  1Y1U A;  5IO0 A;  2H1L A;  4MH3 A;  4XHM A;  1QFN A;  3ZYW A;  3ISO A;  4G9H A;  4K7O A;  2FUG 2;  4K6X A;  4GXZ A;  1GL8 A;  1FG4 A;  5CO3 A;  3GKM A;  3OR5 A;  4DSQ A;  5G1L A;  1O6J A;  2IFQ A;  3QAV A;  4OFT A;  3APO A;  2F51 A;  3GTU B;  1PKZ A;  3HCZ A;  1DE2 A;  4N30 A;  4GCI A;  2CV4 A;  4KSM A;  4ZXG A;  3GA4 A;  3HMJ G;  4IW9 A;  2XC2 A;  3P2A A;  4LL1 B;  1BED A;  5BMU B;  3F4S A;  2FWH A;  1A2L A;  1O81 A;  2H1G A;  4F0C A;  3CXG A;  4ZIL A;  2VIM A;  4I8B A;  2H6X A;  4ZBD A;  1ERV A;  1WE0 A;  3IHQ A;  3DRN A;  1OYJ A;  4MPF A;  2LQO A;  2IMI A;  2F3M A;  2FNO A;  3O76 A;  4LMV A;  4I2T A;  4O5U A;  1AXD A;  5BRT A;  3DGQ A;  4X1U A;  2YNX A;  4ZL7 A;  1XW5 A;  2CX4 A;  5KOX A;  2VL2 C;  2TIR A;  2VO4 A;  5J9B A;  2FY6 A;  5IMF A;  1SVO A;  1W89 A;  3MNG A;  4Z2R A;  2CQ9 A;  5GZZ B;  4XRD A;  3BCI A;  5E4W A;  4JR6 A;  1YQ1 A;  5A34 B;  4G0L A;  2ZNM A;  1QQ2 A;  3NZN A;  17GS A;  3GST A;  4H86 A;  2HE3 A;  3UEM A;  1JZR A;  4KE3 A;  2CX3 A;  1Y25 A;  5HFI A;  1WPI A;  2C3N A;  1PL1 A;  3TU3 B;  4EIQ A;  4OD7 A;  3UMA A;  2FD3 A;  5ABR A;  5H5R A;  5ELG A;  4HEA 2;  2MZC A;  3VWV A;  4F0B A;  1DSB A;  1EOG A;  3GFK A;  1DUG A;  2YPM A;  3EWL A;  1OC9 A;  4AKI A;  1ZL9 A;  4O92 A;  3TDG A;  3WGD A;  2O5V A;  1H4O A;  4ISD A;  4DSS B;  3W6G A;  4EXJ A;  1ERW A;  5AIX A;  1Z6N A;  2AB6 A;  2HXK A;  2DJ0 A;  2GTU A;  3QOU A;  3VWX A;  2H72 A;  3WD6 A;  2JZR A;  4ZBB A;  5DJM A;  1O73 A;  2K8V A;  2TRX A;  3RHB A;  2GSS A;  2FWF A;  1A0R P;  1EV4 A;  1JZW A;  2H30 A;  3BJ5 A;  3HJM A;  4BL7 A;  2LV3 A;  4HU9 A;  1BJX A;  2IJY A;  2GLR A;  3L9U A;  5AIV A;  2HSM B;  4ECI A;  2PVQ A;  4JBB A;  2FCH A;  5DCG A;  1FVK A;  3QCP A;  3TKQ A;  5IMZ A;  2GZZ A;  2UZ8 A;  1RW1 A;  4MF7 A;  2BTO T;  3PGT A;  1VF2 A;  5ID2 B;  1ACV A;  1XVW A;  2B1K A;  4IKH A;  4EF0 A;  3CSJ A;  1QXH A;  2IWT A;  4PQ1 A;  5JWQ B;  1SL1 B;  3CSI A;  1OVN A;  2EIR A;  1SL0 B;  4QQ7 A;  5J47 A;  2R2J A;  1XOB A;  5BMU A;  3IK7 A;  1Z3E A;  4L0U A;  1TK8 B;  4D73 B;  1G7E A;  1MDK A;  2E2G A;  4HI7 A;  1X5D A;  1U6T A;  2P5Q A;  4NWY A;  4CDO A;  3G7J A;  5ECI B;  1GH2 A;  2WDU A;  2O85 A;  2L6C A;  4G10 A;  4KDY A;  4KH7 A;  1U3A A;  2XHF A;  3DD3 A;  2X8H A;  2RM6 A;  1A0F A;  1LJR A;  3AY8 A;  3QR6 A;  3QMX A;  2I3Y A;  4ZB6 A;  1PA3 A;  3P90 A;  4BWQ A;  4WBJ A;  3WGX A;  2D2Z A;  2MMZ A;  4NHW A;  2EFD A;  2LEG A;  4FYB A;  2H0I A;  3J7Y b;  2EIO A;  2M80 A;  2PUK C;  5KN2 A;  2E7P A;  4Q5Q A;  4BVY B;  2PWJ A;  3UJ1 A;  4XS4 A;  3KCM A;  1OC3 A;  1GSQ A;  1BG5 A;  3PPU A;  2I4A A;  2DIY A;  5IPH A;  3IHG A;  2VCQ A;  1ILO A;  3IRA A;  3GKK A;  4WET A;  4GST A;  1O85 A;  2V6O A;  1MDI A;  2GZY A;  4TR4 A;  2GQL A;  1HNA A;  3EIN A;  2ZUP A;  2FLS A;  2CAQ A;  3BBY A;  2LTK A;  4IP1 A;  4J56 E;  3J7Y k;  1J9B A;  5AN1 A;  1XWC A;  1UVZ A;  2JSY A;  4POL A;  4J2F A;  1GSY A;  6GST A;  1S3C A;  4OFN A;  1N8J A;  3KEB A;  3ME8 A;  1VRS D;  4A5P A;  2WUL A;  1ZMA A;  1JFU A;  1F3B A;  3P7X A;  2AHE A;  2GVP A;  2KHP A;  4MF6 A;  4PNG A;  3KZQ A;  1N2A A;  4QMK A;  2DIZ A;  2X8G A;  1X9M B;  3IPZ A;  5DQS A;  5KN3 A;  4ZB9 A;  1GSD A;  3LFL A;  2PVO C;  3EYT A;  4IBP A;  1F2E A;  5DCH A;  1PGT A;  1BX9 A;  2CVK A;  3LGC A;  2R0P A;  2HRF A;  5CRW A;  2LJA A;  2X64 A;  2GST A;  4KSO A;  2B5X A;  3FYG A;  3QFB C;  1GUM A;  1X5E A;  1YF1 A;  4TKY A;  1ZOF A;  1F3A A;  4I97 A;  2YAN A;  5CP1 A;  2X99 A;  3TJB A;  5G31 A;  4IQA A;  4ZL9 A;  3TKR A;  3APS A;  1V98 A;  3ERG A;  2K18 A;  2OE3 A;  5F8B A;  4BVX B;  1MDJ A;  3GHA A;  2VCZ A;  2K9F A;  1WMJ A;  5GAN D;  5GST A;  2C0F A;  2EFH A;  1LBK A;  2VCW A;  2YJH A;  1EWX A;  1IYI A;  5EVO A;  3N9J A;  5GAP D;  1X5C A;  4HZ2 A;  5H5S A;  2G2Q A;  4Z7X A;  2ON7 A;  2R37 A;  5D9X A;  3CTF A;  4E68 A;  4GQF A;  1SJZ A;  2V32 A;  1Q4J A;  1A2J A;  3F6D A;  3TJF A;  2QC7 A;  2J9H A;  1TI3 A;  1F9M A;  1AAZ A;  16GS A;  2HFD A;  1O7U A;  4ECJ A;  4FH8 A;  3F63 A;  1GWC A;  3VUR A;  1PN9 A;  1X9S B;  1M7T A;  2LRT A;  2VLV A;  4I2U A;  6GSW A;  2V2G A;  2DJ1 A;  3TJJ A;  1K0N A;  3VPT A;  5J4V A;  3KTB A;  3K8N A;  3TKS E;  3LXZ A;  4J57 E;  5E59 A;  3A2V A;  2HYX A;  2LKU A;  1GNW A;  1K3Y A;  4K1F A;  2GT5 A;  4XTS A;  2WS2 A;  3D22 A;  5DAL B;  2OAD A;  1C72 A;  4KCA A;  3A2W A;  3IR4 A;  3C8E A;  4YKG A;  4MA9 A;  2IMK A;  2H6Z A;  4E8H A;  1HNB A;  1T4Y A;  3BD2 A;  1GTA A;  1BG1 A;  5D96 A;  4HJM A;  4N0V A;  1MD4 A;  3CRT A;  1SJ6 A;  3VLN A;  2VKZ G;  3G7Y A;  5HR1 A;  3HDC A;  2P31 A;  4W66 A;  1M99 A;  2DKI A;  1T3B A;  4K8M A;  3NOF A;  3RPN A;  2QA1 A;  3BOA A;  5DQY A;  5J5N A;  4V2N A;  22GS A;  1E2Y A;  3DKS A;  2F8F A;  2H0G A;  1SD9 A;  2YWO A;  2HZE A;  4Z2T A;  1PX7 A;  3R2Q A;  5LD0 A;  4ZBA A;  1JLV A;  1NM3 A;  3KMN A;  1JHB A;  2OE1 A;  3HKR A;  4FQU A;  1M2B A;  4MF5 A;  2C0E A;  3ME7 A;  4KND A;  5F0G A;  2VM1 A;  1TK5 B;  4E8E A;  4YQV A;  5L71 A;  2OBK A;  5D8I A;  3F4R A;  3PR8 A;  1KNG A;  4MJA A;  2VLU A;  1SU9 A;  1YZX A;  4EKZ A;  1WOU A;  2EFC A;  4GDF A;  3KP9 A;  4GSN A;  2RUF A;  5DAK B;  4MLY A;  5B8A A;  1S3D A;  2DKH A;  3QD9 A;  2FGX A;  2XPE A;  4N0Z A;  3MIX A;  1FW1 A;  1ZZY A;  3EU3 A;  4DEJ A;  1ZYQ B;  3JCM L;  1XW9 A;  5F06 A;  2LNS A;  2GSQ A;  4XCS A;  3TKS C;  2H73 A;  4PQI A;  1QMV A;  3ZIJ A;  4MJE A;  1JZD A;  5B7C A;  1M9B A;  2P0G A;  5J4U A;  2WCI A;  2CA8 A;  1YKA A;  4YAV A;  4XIH A;  2H1D A;  3GYK A;  4LMW A;  2VL9 A;  2CZ2 A;  4EL1 A;  5G5F A;  1IYH A;  4MK3 A;  2JU5 A;  2JAC A;  5DJL A;  1EGO A;  3GMF A;  1TOF A;  1FB0 A;  4YH2 A;  3FR6 A;  2A2S A;  4POB A;  1PL2 A;  4PQH A;  2VCX A;  2J23 A;  3IE3 A;  4WXT A;  12GS A;  4O5Q A;  1ML6 A;  2OKA A;  2PBJ A;  2WGR A;  3FKF A;  3QPM A;  4AGS A;  2N5A A;  3KTL A;  2HRK B;  5A1N B;  4WF4 A;  1WIK A;  2HSN B;  2LJR A;  3HHV A;  5EL8 A;  1A8Y A;  1ON4 A;  3H4K A;  1EP7 A;  1TI1 A;  1YEP A;  4GQC A;  4P3Y B;  4MZC A;  5ECK B;  3S9F A;  3QAG A;  3M9J A;  3TRQ A;  3M0F A;  5CNW A;  2GZP A;  2XBQ A;  3EU4 A;  3H8Q A;  1GLP A;  3LQ7 A;  2PGT A;  3KD0 A;  4ML6 A;  2H8L A;  3ZIV A;  1AQV A;  1OKT A;  4JRR A;  3M8N A;  2ZCT A;  1Z6M A;  1FAA A;  4EO3 A;  1NHO A;  1GSU A;  1FO5 A;  3HJP A;  4X43 A;  4F9Z A;  1E6B A;  2YZU A;  3GIX A;  3RPP A;  1YF0 A;  2BJX A;  5JCG A;  3C1R A;  1TXX A;  2IPA A;  5ECN B;  3D21 A;  2RUE A;  4PTS A;  3ZML A;  1XWA A;  1N25 A;  1XCC A;  2EIQ A;  5ECS A;  2H01 A;  3TKS A;  4NPB A;  1GSS A;  2DJ3 A;  4OO5 A;  5JCU A;  3TUE A;  1TW9 A;  1RQM A;  2EFE A;  3GTU A;  4TW5 A;  5D9T A;  2DML A;  2K6V A;  2H74 A;  2G0F A;  5KOW A;  5IOX A;  1K0M A;  1K3L A;  3GUR A;  1U88 A;  2L6D A;  5J40 A;  2VL2 A;  5AGY A;  1SK2 A;  2H76 A;  5HQP A;  2YZH A;  3IAM 2;  3I43 A;  5IQY A;  2HNL A;  1AQW A;  2L4C A;  6GSX A;  1Z5Y E;  1NSW A;  1J0F A;  2PER A;  2QKE A;  1R26 A;  1HYU A;  3RDW A;  3G7I A;  1SYX A;  4TRX A;  4PXO A;  4MJC A;  5IIZ A;  2A4H A;  2YP6 A;  3WYW A;  3H1N A;  3IC8 A;  3GL3 A;  3WGE A;  1XVQ A;  4NXI A;  3TOU A;  3HVS A;  4IJI A;  2DLX A;  1OC8 A;  3G9B A;  2H19 A;  3IXR A;  4DSR A;  5A34 A;  2GQK A;  4HU7 A;  2B3S A;  3FW2 A;  2AAW A;  1XWB A;  2JL4 A;  2H6Y A;  1OE7 A;  2HSN A;  1HNC A;  3UOM A;  2QA2 A;  1PN0 A;  3IV4 A;  3HZ4 A;  3CTG A;  1VF3 A;  4RQR A;  2VD0 A;  2DJ2 A;  3GKN A;  1AIU A;  3MWH A;  4I5Q A;  4POK A;  5IMA A;  4MJB A;  4HQZ A;  4ECC A;  3A5W A;  3L0H A;  3KMO A;  2XBI A;  4MPG A;  2H1A A;  4YQU A;  2V1M A;  1X0R A;  5ECH B;  4DSS A;  2AJQ B;  3GN3 A;  4Z2U A;  5H5Q A;  1V2A A;  1THO A;  1CQG A;  1HD2 A;  4HS1 A;  1V9W A;  2IIY A;  3L4N A;  1GLQ A;  1USB A;  3V1W A;  5IO2 A;  4G2E A;  4WF5 A;  3GNJ A;  3HVX A;  1TK0 B;  3Q19 A;  4K7I A;  2L4Q A;  4BA7 A;  4LL4 B;  2DSA A;  2A2R A;  4X0X A;  5CYY A;  3TRP A;  3RHC A;  1FHE A;  1M2D A;  2HSM A;  1K0B A;  1GNE A;  4O5R A;  3L78 A;  5B6N A;  3FRC A;  3D6I A;  3ED3 A;  5IPG A;  2NPB A;  5ID2 A;  2VAF A;  3LJR A;  2GQM A;  5ECL B;  1PSQ A;  2GGT A;  1GRX A;  4EC0 A;  4K9Z A;  4GWR A;  1TXU A;  2YN1 A;  1EEM A;  4LLR A;  3PIN A;  1BQ7 A;  3R3E A;  3APQ A;  4D73 A;  5ECM B;  3UAP A;  3IAS 2;  1SKW B;  2IL3 A;  1ERT A;  2B7J A;  2IMD A;  2FA8 A;  2GSR A;  3C71 A;  4AJ6 A;  4OCF A;  1EOH A;  1NHY A;  4EDY A;  3FZ4 A;  3KH9 A;  1VF4 A;  4MNN A;  1AW9 A;  2CVD A;  3DXB A;  3H79 A;  4N3Z A;  3CYN A;  3M9K A;  3GKX A;  1R5P A;  1WWJ A;  5ECP B;  3GRX A;  1W4V A;  2X49 A;  3DIE A;  2B6M A;  1PRX A;  2RLI A;  3W8J A;  2YOI A;  2HLS A;  3MDK A;  2VLT A;  1MD3 A;  1V57 A;  2IN3 A;  6GSY A;  4BVY A;  3KH7 A;  4YAP A;  2PN8 A;  4PUR A;  2C1Y A;  2PPT A;  3ZIT A;  2H70 A;  4HDE A;  3M3M A;  1G7O A;  2OE0 A;  2IFQ B;  4NV2 A;  5J3R A;  3L9S A;  3EMX A;  1XIY A;  1XWK A;  5B8B A;  2HI7 A;  3WT1 A;  2YCD A;  2O87 A;  3LWA A;  3WT2 A;  1GTB A;  2LS5 A;  5HFK A;  1XOA A;  2NBS A;  6GSV A;  4RQX A;  2AUV A;  4MZW A;  3DVW A;  3FK8 A;  3I6A A;  4FIW A;  4JE1 A;  1YVL A;  1TRW A;  3UVT A;  4AKG A;  1UC7 A;  1FOV A;  3VI5 A;  2L59 A;  3ZRE A;  4ZB8 A;  3LOR A;  4FYC A;  4BWS A;  5IOW A;  1F37 A;  2H75 A;  5FT3 A;  2YWM A;  3HXS A;  4LA1 A;  3UL3 A;  1ZYN A;  4I6X A;  3U5R E;  1B9Y C;  3TJK A;  2OAC A;  2B7K A;  2R0C A;  3LEF A;  1M9A A;  1SKS B;  5CRG A;  1AQX A;  4K7N A;  2HSH A;  1LU4 A;  1K0A A;  1UN2 A;  5G2Z A;  5IMD A;  2OA7 A;  1QGV A;  1SL2 B;  4AI6 A;  2DJK A;  3TB2 A;  3F0I A;  4V1A g;  1K0D A;  1XPV A;  5C00 A;  3CRU A;  3CWG A;  4PGT A;  1R4W A;  2RII A;  4IN0 A;  2ALB A;  2H66 A;  1XXU A;  1PMT A;  4KA0 A;  2CAI A;  3ZVJ D;  4NHZ A;  2MBS A;  1DBY A;  1KEB A;  2P5R A;  3DYR A;  4QL7 A;  2C0G A;  1SEN A;  1OC9 B;  3GX8 A;  4WR5 A;  1T4Z A;  2PMT A;  4RUV A;  1EGR A;  1FVJ A;  5KN1 A;  4KB3 A;  1YDK A;  4IJ3 A;  1B9X C;  5A5K A;  1A24 A;  4KUN A;  4TXO B;  4KF9 A;  4BVX A;  4KCE A;  4TR3 A;  3F8U A;  3F3Q A;  5J41 A;  4ID0 A;  1WJK A;  5IMC A;  4ACS A;  4TR0 A;  3EC3 A;  2H71 A;  5D9W A;  4L5L A;  5G1K A;  1TP9 A;  3I69 A;  1PQN A;  3LW9 A;  4OFM A;  1OE8 A;  1O8W A;  2MMO A;  1K3O A;  4EVM A;  4BL7 B;  5JWR B;  1Z7P A;  1O8X A;  2E0Q A;  4BPY A;  4IHU A;  4K0N A;  2LQQ A;  1GUL A;  3FZA A;  1A2M A;  1T00 A;  4QL9 A;  3KP8 A;  3LYP A;  3KJY A;  2L5L A;  3ZTL A;  3FY7 A;  3GH9 A;  3FR9 A;  2PU9 C;  3W8S A;  4G0K A;  1SVL A;  3IDV A;  1XWG A;  2M72 A;  5INY A;  4K5R A;  2NTO A;  1G6Y A;  5EPF A;  1YJ6 A;  4OO4 A;  3LSZ A;  3TGZ A;  3GUS A;  3NIV A;  1AC1 A;  2HRA A;  2AV4 A;  4L5O A;  2C0D A;  1EV9 A;  2B5Y A;  1OKD A;  4O7H A;  4N11 A;  3CSH A;  3C7M A;  3Q18 A;  4JR4 A;  2L57 A;  1T7P B;  3IA1 A;  2YJ7 A;  1GTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...