4OMVA

Crystal structure of a putative macrophage growth locus, subunit a from francisella tularensis schu s4
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
194
Chain Sequence
b'AMLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSKHLEELNIITPNGNIPTLSTDDFAVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQANEIKMLMQRDIISTYKKIVSERAQNINVLTLIITFVFYYFIKLKISIPTKDKNIIKEIKELLSEPNFIKTIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage growth locus, subunit A
publication title Crystal Structure of a Putative Macrophage Growth Locus, subunit A From Francisella tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Protein binding
total genus 61
structure length 194
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4omvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4omvA01
2V2GA 2R4VA 2HXKA 2HLSA 5HFIA 4PX1A 3F6DA 4MZCA 1TJDA 2H6XA 2HYXA 2M80A 2GQMA 2JU5A 1QXHA 2XHFA 4O5RA 4O92A 4BPYA 3EU4A 1TRSA 3ZVJA 4BL7B 1EV4A 2G2QA 4NHZA 3HDCA 1XW5A 4PXOA 3GIXA 4G0KA 3WGXA 1SL1B 1X5DA 3D0ZA 2VCVA 3PH9A 6GSWA 2IMIA 3GKXA 2HRNA 7GSSA 4YAVA 5J4UA 4HU7A 5IMFA 1M0UA 1JZOA 3M3MA 4ZL8A 1EP8A 4AJ8A 1OC8A 1H75A 1XIYA 2HFDA 2KOKA 2PVOC 2F3MA 3TRQA 2PPTA 3RHBA 3GNJA 2LRNA 3FK8A 1HYUA 1O6JA 5G1LA 2F8AA 2HZEB 1C72A 4GQFA 3LG6A 2GTUA 4KB3A 5ID2B 3L9UA 3PINA 2H1DA 6GSSA 3I9V2 3DKSA 3VWXA 3DEXA 3DVXA 4WKWA 4ML1A 2FUG2 3D5JA 3FZ9A 4MF5A 2NDOA 1SL2B 1G6YA 1PD21 3LYKA 2C8UA 3ED3A 1UN2A 3CMIA 2FD3A 2GZPA 4BWSA 3CSJA 1GSQA 2GSRA 5ENUA 2VL9A 2A2RA 2G0FA 5G1KA 2J9HA 1GWCA 2ES7A 4EDYA 2YCDA 1QGVA 1A8LA 1KEBA 3ZYWA 1OYJA 1O7UA 1Q98A 4LMVA 4MA9A 12GSA 4TXOA 3DWVA 2EIRA 1YZXA 2DLXA 3WT2A 5LD0A 1FO5A 2M72A 2YV7A 2IL3A 4MF6A 5EY6A 3GX0A 4X0XA 2P5RA 3ZLPA 2X8CA 1FVJA 1A8YA 2EIOA 2GLRA 4MJAA 3CXGA 3ERWA 2YJ7A 2LS5A 3UAPA 4L5LA 5ECQB 5B6NA 4HEA2 4XS4B 3CRUA 1XPVA 2GZYA 1I9DA 2LV3A 2HI7A 4JBBA 1AXDA 4IHUA 3BD2A 3E0UA 2DJKA 3HHVA 3KM6A 1OVNA 4I97A 3W8JA 3C73A 3US3A 2I81A 5JCWA 2JACA 4OD7A 5GSSA 2R5GA 3A2WA 4JEDA 3KGKA 3OR5A 1TXXA 3WT1A 3F4SA 1V9WA 4POMA 4MJBA 1UC7A 5KN3A 4TR0A 4TRXA 3UVHA 3IDVA 1BQ7A 6GSTA 3FR6A 2GQLA 2C0FA 1EGRA 2H75A 1U3AA 1YF0A 3DXBA 4BA7A 3TUEA 4BVYA 4HU9A 1YF1A 1K3LA 4MH3A 3QOUA 1AW9A 1GSFA 1TW9A 4ML6A 2GGTA 4K6XA 1YJ6A 4NAXA 4KA0A 4O7HA 2ZUPA 1NHOA 3FYGA 11GSA 1ZYEA 3KH7A 1H4OA 1BJXA 3N9JA 1XWBA 3EMXA 4TN8A 1Z9HA 5HR1A 3HKRA 3KXOA 5J5NA 4J56E 2OBKA 1BX9A 3KTLA 3H93A 1GSYA 3F3QA 2YV9A 4EL1A 4YQMA 1CQHA 1TU8A 3GSTA 4WF4A 3GYKA 3BJ5A 1Y6EA 1OKTA 1AQVA 1HQOA 3GKMA 2HSNB 5IMDA 3GTUA 5ABRA 1G7OA 2H1AA 5FT3A 1ERTA 4CW9A 1WRYA 3KMNA 1FG4A 3KTBA 1AUCA 2DMMA 1AQWA 18GSA 2H71A 2OE3A 2DC5A 3CSHA 4ECJA 3M8NA 5DALA 1OC3A 4MPGA 3C1RA 5G5EA 1O73A 4HUAA 4BL7A 3LFLA 2JZTA 1K0MA 3O3TA 3QD9A 1TK8B 2TRXA 3BCKA 2N5FA 2JL4A 3L78A 4PQ1A 1EP7A 2A4VA 2WRTA 1JHBA 1X9SB 3D4MA 1V57A 1VRSD 3VWVA 4IJ3A 1GRXA 2OA7A 3IAS2 3TKQA 3KP9A 4O32A 2F9SA 2RUFA 4OWYA 5FWGA 3IBHA 1TRWA 3J7Yk 2YP6A 4GSNA 3MDKA 3LORA 1U6TA 3IK7A 2WGRA 1B8XA 1GTUA 1XW6A 4GQCA 4LLRA 2HZEA 1SU9A 4HS1A 5ELGA 4YQVA 4TXVA 3K8NA 1M9AA 2ALBA 1XZOA 1AAZA 4NHWA 4RUVA 3M1GA 2B1LA 3RHCA 1TI3A 2I9HA 3IK9A 1MEKA 3H1NA 2QGVA 2WULA 2HSYA 2H73A 1F3BA 4KGIA 1O8XA 5ECOB 1F6MC 4LL4B 3KJYA 2VM1A 3ME7A 4IQAA 1Y25A 5ECSA 2X64A 4EO3A 3TJKA 2H30A 2KP1A 2C80A 4ZBAA 4IKHA 4K0NA 3UEMA 4OCFA 1DUGA 2H1BA 4KCEA 2FWFA 1Z7PA 2X8GA 1F2EA 1GULA 1OE7A 1ERVA 3TB2A 1WPIA 1GSDA 2NPBA 4PTSA 3G7IA 4NPBA 1ACVA 2VAFA 5EVOA 4IP1A 1BG5A 3EVIA 5HR2A 3BBYA 1XFLA 4TR4A 2IMKA 1M7TA 3LJRA 3SWLA 3D21A 2VD1A 1USBA 2GT5A 1U87A 2LQOA 4XCSA 3FR9A 4IJIA 1AC1A 2CVDA 3GMFA 4GTUA 3HJOA 4KSMA 1Z3EA 1VGLA 1URMA 3QPMA 1RK4A 1GUMA 4TR3A 1K0AA 3Q74A 4AJ7A 3VPQA 3CTFA 4IS0A 3GV1A 1A2MA 2F8FA 1NW2A 2H01A 2DIYA 4XTSA 5DAKB 5F8BA 1TK0B 1Q4JA 3KCMA 5C00A 5J9CA 6GSUA 1X5EA 5JCGA 1TP9A 3GN3A 5G5FA 2AJQB 3EYTA 4Z7XA 2L59A 5CRGA 2VCWA 4ULXA 4WETA 4BVXA 1W89A 3LEFA 3G9BA 1A2LA 2FLSA 1O8WA 3WGEA 5GAPD 4F9ZA 2VLUA 5HFKA 1LU4A 4ZBDA 4JE1A 3BCIA 1V40A 3DRNA 5GSTA 4KX4A 5ECLB 4J2FA 3KIJA 2LUSA 22GSA 2CZ2A 4MLYA 2BMXA 2MBSA 1V58A 2NTOA 3CBUA 3TKSA 2L4QA 2VL3A 2XBQA 3J7Yb 2YN1A 1VF2A 1RW1A 1WIKA 4ZL7A 3VFIA 6GSYA 5CREA 1M99A 3A2XA 1S3CA 2H6YA 2VLVA 5CAXA 5J3RA 3TGZA 5B7CA 1X0RA 3E3EA 4F0BA 2H74A 1WOUA 4MZWA 4Q5RA 3JCML 3TRXA 3TRPA 2P31A 3TKSC 1XBSA 4V2NA 2NBSA 2LSTA 4E8HA 3GL3A 5BMUA 5AGYA 4V1Ap 5D96A 3LWAA 3F0IA 3HVSA 4ISDA 4DSSA 1K0NA 3QCPA 2HQTA 5AN1A 2LJKA 3FZ4A 2HZFA 2L4CA 2AUVA 2C1YA 4FQUA 4WR5A 5DQYA 8GSSA 4HQSA 1GNEA 4FH8A 3P7XA 2B7JA 1LJRA 3MSZA 3H79A 2BTOT 4OO5A 5CO3A 3PGTA 1UA5A 4N30A 1QUWA 3C71A 1KNGA 4NMUA 1PKWA 2L6CA 2XPDA 2B7KA 1R7HA 2YWIA 5FHIA 2LEGA 5L71A 1KBNA 5CRWA 3GL5A 2FGXA 1N8JA 4HDEA 3ZITA 4LL1B 1I5GA 4PUFC 3UMAA 2K6VA 3QAGA 1J08A 4KDXA 4EVMA 4K7NA 3HXSA 4GXZA 5LCZA 5HR3A 2I1UA 2JSYA 5ECIB 2C3TA 5CNWA 1X9WB 1MTCA 5IMCA 3ZL5A 1ABAA 4KF9A 2V32A 5IMZA 1E2YA 4XRDA 2QC7A 4RI7A 4FO5A 3TJFA 3FZ5A 4F82A 1IYHA 1GP1A 2DJ2A 5DDLA 1R5PA 4GSTA 9GSSA 1HNCA 2VCQA 3CRTA 3RPNA 2JZSA 1E6BA 5KEJA 1JLVA 4USSA 2H19A 4L8EA 1T4YA 4IQ1A 2O8VB 5JCUA 2AB6A 3FY7A 3ERGA 5IOXA 1XWKA 3RPPA 4ZIJA 2HT9A 4FYBA 5KN1A 1GSSA 1ERUA 1A0RP 4WBRD 1GNWA 3VI5A 3RAZA 3Q19A 4Q5QA 2H76A 1XCCA 1QK8A 1ZCPA 2C3QA 2YWMA 3C7MA 4P3YB 5DJLA 2HSMA 3MWHA 4QL7A 2E7PA 1DBYA 5DQSA 2EIQA 3DIEA 5B8BA 2H0HA 1WMJA 4RQXA 4EF0A 3ZIJA 3IC8A 3LSZA 3F63A 2YJHA 5GZZB 1TRVA 1M9BA 4XRAA 1OC9B 2WZ9A 3EC3A 2QSIA 2MMZA 1U3IA 5IO0A 1RQMA 4FYCA 3ZZXA 5IPHA 4MDCA 4EDZA 3L4NA 4IGJA 4X43A 1ZYQB 1CQGA 1QFNA 2GQKA 2WCIA 2UZ8A 3F8UA 2LJRA 2C3NA 1B4QA 5LNKe 4V2LA 3UL3A 3I69A 4WBJA 2LNSA 5DAKA 1SK1A 1K3OA 5H5QA 1SKWB 5HFGA 2Z9SA 4MH2A 4EC0A 2CVBA 1HD2A 5CYYA 4YH2A 2FNOA 3I6AA 4I2UA 3L9VA 2VL2A 3KMOA 2K8SA 2V6OA 2AYTA 4KE3A 2CVKA 4ZB6A 2IMFA 2B5EA 3IRAA 3TOTA 3HZ8A 3ZVJD 2IMEA 4ZILA 3UJ1A 1G6WA 3HJPA 4IVFA 3EURA 3DGQA 4WEYA 3HZ4A 4EUYA 1EV9A 2B5YA 3GX8A 3L9SA 2VL2C 1K0BA 2CA8A 1DSBA 4KNDA 2TIRA 2DMLA 5D9XA 1BYEA 5ELAA 3IPZA 2H66A 3HYPA 4RQRA 3ZRDA 2GSSA 1AIUA 2YZHA 1NHYA 2VIMA 4DSRA 2N5BA 1SYRA 5IQYA 3WYWA 1UVZA 3VK9A 4PNFA 5D93A 3TKPA 1MDKA 1WWJA 1WJKA 4I5QA 1EOHA 1Z7RA 2YANA 4MJEA 1PSQA 3R2QA 1K0OA 5IMAA 4MF7A 3P8WA 4G0IA 3DVWA 4G2EA 1SYXA 1TRUA 5ECKB 2REMA 4K1FA 4GWRA 2FHEA 3FRCA 2YZUA 5ID2A 4MJCA 2MMOA 4PQIA 3QR6A 3EE2A 1EWXA 2K8VA 2HRAA 3VI7A 2CX3A 3DYRA 3W6GA 1Z5YE 5CP1A 3TOUA 3D6IA 1O81A 1ZZYA 1TU7A 3P2AA 2B5XA 4ECCA 2OE1A 4OFNA 5DCGA 2MZCA 4EE0A 1SD9A 3LYPA 3NIVA 1ZGNA 1KTEA 4KDUA 2L57A 3AY8A 2EC4A 3WD6A 3G7JA 3HA9A 4CHSA 2MYGA 1B9XC 2H72A 4MK3A 5KN2A 2WFCA 5EPFA 2PN8A 5F05A 2AAWA 3FKFA 1B48A 3GKNA 3GRXA 2IPAA 3UBLA 2L6DA 1GLPA 3ZREA 4V1Ag 1K3YA 5JWRB 4MPFA 2E2MA 3EU3A 3SBCA 3CTGA 4K9ZA 4ZB8A 4KH7A 4TR1B 5DJMA 3ERFA 1EEJA 1XOAA 5DCHA 2C4JA 3HD5A 4XS4A 1GSUA 1ILOA 2V1MA 1XWAA 4IELA 2O7KA 3TDGA 3IHQA 1ZL9A 3TKRA 4HZ2A 1GH2A 2FCHA 4K8MA 2OE0A 3ZMKA 1Z6NA 3F6FA 4V2MA 1TKDB 1VF1A 4KSOA 3PPUA 5H5SA 4EXJA 4PURA 1K0DA 2V41A 5IIZA 4GRFA 1TOFA 4EKZA 4DVCA 3KP8A 1SJ6A 3FEUA 4X1UA 5B6MA 1XWGA 4N11A 2YWNA 1V98A 1FW1A 3IC4A 5ECHB 2H70A 2IWTA 2GS3A 4XHMA 2YWOA 3U5RE 1VF3A 2OJLA 3M9JA 1W4VA 4G10A 1YKCA 4PQHA 3PR8A 2D2ZA 5F0GA 2LKUA 4N0ZA 2NVLA 1TK5B 3U6VA 1PMTA 3NZNA 4ZBBA 1XOBA 3GA4A 5D9VA 1GSEA 1K0CA 2FA8A 1FOVA 4LMWA 2DJ3A 1JLWA 1Z6MA 2PUKC 3D4TA 3UBKA 3GTUB 4H86A 3GH9A 1M2DA 2GSQA 5G30A 4MCUA 5EL8A 1OKDA 4JR4A 2GDRA 4AF2A 2H6ZA 3GH6A 2YNXA 4GF0A 5DVBA 1J9BA 3ZFLA 5JWOB 1BAYA 2FWEA 2X99A 4I6XA 5C04A 3RBTA 3M0FA 2OKAA 2XPEA 4K7OA 5DALB 1AQXA 4KAEA 1FHEA 3ZIVA 1YY7A 2JZRA 5G31A 1ML6A 2LQQA 1MD3A 2C0DA 3MAKA 3APQA 2DJ1A 1YKAA 1A24A 6GSVA 1EZKA 3C1SA 3QFBC 1PRXA 2DJ0A 3EMPA 5B8AA 4NXIA 19GSA 1SKRB 2FWHA 2BJXA 1XXUA 4HOJA 1X9MB 2X8HA 2I4AA 4L0WA 10GSA 2H8LA 3KEBA 3F4TA 1GL8A 1R5AA 3A5WA 3HJMA 1JZRA 2AHEA 1V2AA 2KP2A 3APSA 3HCZA 2VOCA 2H0IA 4OO4A 2B1KA 1PL2A 2R6KA 2R3XA 3VURA 3DMLA 3P90A 2CX4A 2KLXA 3QAWA 4OFMA 3L0HA 4I2TA 3FHKA 17GSA 2VLTA 5G2ZA 2HRKB 2B3SA 3VLNA 3HVXA 1FVKA 1S3DA 2N5AA 1NSWA 3WGDA 3KH9A 1NM3A 3FZAA 3RDWA 5HQPA 2VD0A 1FB6A 2CZ3A 2OADA 4GCIA 2O87A 1THXA 3BOAA 5GAND 4D73B 3Q6OA 2WJUA 3GSSA 4HZ4A 4L0UA 3UARA 1PQNA 4TKYA 2ON7A 5A4VA 5ECMB 4RI6A 3DD3A 2RLIA 5A4WA 1GLQA 1PL1A 4JRRA 4ZL9A 5IMVA 2H1GA 5IM9A 4POBA 2R37A 1PN9A 2JADA 4XS1A 4AJ6A 3F9UA 2B6MA 4E8EA 2PVQA 14GSA 4DEJA 1PX7A 2I3YA 4OFTA 4GLTA 4KW6A 4N0VA 1ZMAA 3H4KA 3A2VA 1TTZA 6GSXA 5HR0A 1ST9A 5IPGA 1R26A 2LNTA 3S9FA 3IXRA 5D8IA 4XIHA 1WE0A 1DE2A 3VPTA 4MZBA 1T8EB 1TI1A 1YEXA 3LQ7A 3HVVA 1ERWA 1S3AA 3GUSA 3IV4A 3TJGA 4MMMA 2DBCA 1QQ2A 1ON4A 4FIWA 1OE8A 2VUPA 4ECBA 4PNGA 5F06A 3GHAA 4TR1A 2PGTA 3H8QA 4Q5FA 4DSQA 2IFQB 3MNGA 1IYIA 4K7IA 4BVXB 2C0GA 4WF5A 4IN0A 1XW9A 3E9JB 2A2SA 1GTAA 2DIZA 4OMVA 1SD8A 2HRFA 1M2BA 3F3RA 1FAAA 5J41A 5F07A 3KZQA 3VWUA 3LGCA 2IN3A 4N10A 3LXZA 3GURA 1DE1A 1F9MA 3UVTA 3KD0A 4I8BA 4TW5A 4POKA 4CDOA 1N2AA 2J23A 4POLA 3IAM2 3ZTLA 2OACA 5E59A 4MP4A 3FR3A 1WP0A 1A2JA 2PMTA 4TVEA 2GVPA 4JR6A 2GZZA 4IP6A 2HNLA 1OAZA 2LRCA 3HY2A 3EINA 2L5OA 2HE3A 3R3EA 3N5OA 1T3BA 2FWGA 4NV5A 3TKSE 2K9FA 3ZMLA 1EEMA 3V1WA 1SL0B 3APOA 3CYNA 3C8EA 3QAVA 3I43A 4HJ2A 5ECNB 4WR4A 5DBQA 2MBTA 4NV2A 5CRDA 5J9BA 1M2AA 3NOFA 5ECPB 4ACSA 5COHA 1SKSB 1JZDA 4GSSA 2RM6A 4G9HA 3A3TA 2PERA 4DSSB 5D9TA 3F4RA 2CT6A 4KCAA 5INYA 5IO2A 1GTBA 3ZFBA 4KDYA 4AGSA 1EOGA 5H5RA 2IMDA 3IOSA 4ILFA 2VCZA 2HSHA 1PX6A 3TCOA 2PWJA 3LXTA 3G7YA 1J0FA 4FYUA 2WB9A 3ISOA 4HQZA 2F51A 4F03A 2MMAA 4OCEA 2PU9C 1G7EA 2CAQA 1SK0A 1YDKA 5IOWA 3QMXA 2VCXA 2E0QA 2LJAA 4ZXGA 5E4WA 3UOMA 2H0GA 2R2JA 3M9KA 1MDIA 2ON5A 2GT6A 4ID0A 3QDNA 4HJMA 4TXOB 1R4WA 2RUEA 2P0GA 4XS6A 4ECIA 3IE3A 3TJJA 1T7PB 3O76A 2YOIA 3FW2A 1EGOA 2C0EA 1X5CA 3UIWA 1SJIA 4MABA 2GSTA 1TDIA 3IR4A 1MDJA 2DJJA 4TOPA 16GSA 2WDUA 1ZOFA 1GUKA 2HRKA 1F3AA 2JSZA 1B9YC 1T4ZA 1BEDA 2P5QA 4K0GA 2QKEA 2ZNMA 2VCTA 3CSIA 2FY6A 1HNBA 2DSAA 4JZQA 1LBKA 2AV4A 4D73A 2LTKA 5AISA 1XVQA 4BWQA 1T1VA 20GSA 1F37A 2OBIA 1A23A 4YQUA 3QFAC 2IIYA 1HNAA 1QMVA 3W8SA 2O85A 4KUNA 3ME8A 2HSMB 1YQ1A 4LA1A 4F0CA 5D9WA 4L5OA 4IW9A 4PGTA 5A4UA 13GSA 4Q5NA 2CQ9A 2ZCTA 5KN0A 1JZWA 1XVWA 4BVYB 4PUAA 4JU5A 3VWWA 3EWLA 2IJYA 1VF4A 3GKKA 2O89A 4QQ7A 2WS2A 2RIIA 4G19A 2CV4A 2V6KA 1GTIA 1U88A 2L5LA 2KHPA 2MMNA 4ZB9A 1PKZA 1G0TA 1YEPA 2PBJA 3IA1A 1O85A 1PA3A 2VM2A 3D22A 5D73A 1JFUA 1FB0A 5CRHA 2XBIA 1SJZA 2RM5A 1GUHA 4YAPA 2KUCA 5AIXA 1T00A 2E2GA 4NWYA 2XC2A 4IBPA 1XWCA 2FA4A 1PGTA 2IFQA 4J57E 5A5KA 1OC9A 2M46A 2VO4A 4QL9A 5AIVA 2YPMA 3GFKA 2K18A 2LRTA 5JWQB 4HI7A 4K2DA 4WXTA 1B4PA 3TJBA 1THOA 5ECRB 2TRCP 3O6TA 1MD4A 3Q18A 1SENA 4F2IA 4G0LA 1SK2A 2CAIA 1A0FA
chains in the Genus database with same CATH superfamily
2V2GA 2R4VA 2HXKA 2HLSA 5HFIA 4PX1A 3F6DA 4MZCA 4ZB7A 5A5HA 1TJDA 2H6XA 2HYXA 2M80A 2GQMA 2JU5A 1QXHA 2XHFA 4O5RA 4O92A 4BPYA 3EU4A 1TRSA 3ZVJA 4BL7B 1EV4A 2G2QA 4NHZA 3HDCA 1XW5A 4MNNA 4PXOA 3GIXA 4G0KA 3WGXA 1SL1B 1X5DA 3D0ZA 2VCVA 6GSWA 2IMIA 3PH9A 3GKXA 2HRNA 7GSSA 4YAVA 5J4UA 4HU7A 5IMFA 1M0UA 1JZOA 2WVZA 3M3MA 4ZL8A 1EP8A 4AJ8A 1OC8A 1H75A 1XIYA 2HFDA 4EIQA 2KOKA 2PVOC 2F3MA 3TRQA 2PPTA 3RHBA 3GNJA 2LRNA 3FK8A 1HYUA 1O6JA 5G1LA 2F8AA 2HZEB 1C72A 4GQFA 3LG6A 2GTUA 4KB3A 5ID2B 3L9UA 3PINA 2H1DA 6GSSA 3I9V2 3DKSA 3VWXA 3DEXA 3DVXA 4WKWA 4A5PA 4ML1A 2FUG2 3D5JA 3FZ9A 4MF5A 2NDOA 1SL2B 1G6YA 1PD21 3LYKA 2H1LA 2C8UA 3ED3A 1UN2A 3CMIA 2FD3A 2GZPA 4BWSA 3CSJA 1GSQA 2GSRA 5ENUA 2VL9A 2A2RA 2G0FA 5G1KA 3CWGA 2J9HA 1GWCA 2ES7A 4EDYA 2YCDA 1QGVA 1A8LA 1KEBA 3ZYWA 1OYJA 1O7UA 1Q98A 4LMVA 4MA9A 12GSA 4TXOA 3DWVA 2EIRA 1YZXA 2DLXA 3WT2A 5LD0A 1FO5A 2M72A 2YV7A 2IL3A 4MF6A 5EY6A 3GX0A 4X0XA 2P5RA 4PI2C 3ZLPA 2X8CA 1YEWC 1FVJA 1A8YA 2EIOA 5KOXA 2GLRA 4MJAA 3CXGA 3FMWA 3ERWA 2YJ7A 2LS5A 3UAPA 4L5LA 5ECQB 5B6NA 4HEA2 4XS4B 3CRUA 1XPVA 2GZYA 1I9DA 2LV3A 2HI7A 4JBBA 1AXDA 4IHUA 3BD2A 3E0UA 2DJKA 3HHVA 3KM6A 1OVNA 4I97A 3W8JA 3C73A 3US3A 2I81A 5JCWA 2JACA 4OD7A 5GSSA 2R5GA 3A2WA 4JEDA 3KGKA 3OR5A 1TXXA 3WT1A 3F4SA 1V9WA 4POMA 4MJBA 1UC7A 5KN3A 4TR0A 4TRXA 1FOHA 3UVHA 3IDVA 1BQ7A 6GSTA 3FR6A 2GQLA 2C0FA 1EGRA 2H75A 1U3AA 1YF0A 3DXBA 4BA7A 3TUEA 4BVYA 4HU9A 1YF1A 1K3LA 4MH3A 3QOUA 1AW9A 1GSFA 1TW9A 4ML6A 2GGTA 4K6XA 1YJ6A 4NAXA 4KA0A 4O7HA 4HSCX 2ZUPA 1NHOA 3FYGA 11GSA 1ZYEA 3KH7A 5KOWA 1H4OA 1BJXA 3N9JA 1XWBA 3MIXA 3EMXA 4TN8A 1Z9HA 5HR1A 3HKRA 3KXOA 5J5NA 4J56E 2OBKA 1BX9A 3KTLA 1XG8A 3H93A 1GSYA 3F3QA 2YV9A 4EL1A 4YQMA 1CQHA 1TU8A 3GSTA 4WF4A 3GYKA 3BJ5A 1Y6EA 1OKTA 1AQVA 1HQOA 3GKMA 2HSNB 5IMDA 3GTUA 5ABRA 1G7OA 2H1AA 5FT3A 1ERTA 4CW9A 1WRYA 3KMNA 1FG4A 3KTBA 1AUCA 2DMMA 1AQWA 18GSA 2H71A 2OE3A 2DC5A 3CSHA 4ECJA 3M8NA 5DALA 1OC3A 4MPGA 3C1RA 5G5EA 1O73A 4HUAA 4BL7A 3LFLA 2JZTA 1K0MA 3O3TA 3QD9A 1TK8B 2TRXA 3BCKA 2N5FA 2JL4A 3L78A 4PQ1A 3LW9A 1EP7A 2A4VA 2WRTA 1JHBA 1X9SB 3D4MA 1V57A 1VRSD 3VWVA 4IJ3A 1GRXA 2OA7A 3IAS2 3TKQA 3KP9A 4O32A 2F9SA 2R0GA 2RUFA 4OWYA 5FWGA 3IBHA 1TRWA 3J7Yk 2YP6A 4GSNA 3MDKA 1U6TA 3LORA 3IK7A 2WGRA 1B8XA 1GTUA 1XW6A 3A5IA 4GQCA 4LLRA 5J47A 2HZEA 1SU9A 4HS1A 5ELGA 4YQVA 4TXVA 3K8NA 1M9AA 2ALBA 4BIKA 1XZOA 1AAZA 4NHWA 4RUVA 3M1GA 2B1LA 3RHCA 1TI3A 2I9HA 3IK9A 5A34A 1MEKA 1YVLA 3H1NA 2QGVA 2WULA 2HSYA 2H73A 1F3BA 4KGIA 1O8XA 5ECOB 1F6MC 4LL4B 3KJYA 2VM1A 3ME7A 4IQAA 1Y25A 5ECSA 2X64A 4EO3A 3TJKA 2H30A 2KP1A 2C80A 4ZBAA 4IKHA 4K0NA 3UEMA 4OCFA 1DUGA 2H1BA 4KCEA 2FWFA 4N3ZA 1Z7PA 2X8GA 1F2EA 1GULA 1OE7A 1ERVA 3TB2A 1WPIA 1GSDA 2NPBA 4PTSA 3G7IA 4NPBA 1ACVA 1M3IA 2VAFA 5EVOA 4IP1A 1BG5A 3EVIA 5HR2A 3BBYA 1Y1UA 1XFLA 4TR4A 2IMKA 1M7TA 3LJRA 3SWLA 3D21A 2VD1A 1USBA 2GT5A 1U87A 2LQOA 4XCSA 3FR9A 4IJIA 1AC1A 2CVDA 3GMFA 4GTUA 3HJOA 4KSMA 1Z3EA 1VGLA 1URMA 3QPMA 1RK4A 1GUMA 4TR3A 1K0AA 3Q74A 4AJ7A 3VPQA 3CTFA 4IS0A 3GV1A 1A2MA 2F8FA 1NW2A 2H01A 2DIYA 4XTSA 5DAKB 5F8BA 1TK0B 1Q4JA 3KCMA 5C00A 5J9CA 6GSUA 1X5EA 5JCGA 4AKIA 1TP9A 3GN3A 5G5FA 2AJQB 3EYTA 4Z7XA 2L59A 5CRGA 2OT3A 2VCWA 4ULXA 4WETA 4BVXA 1W89A 3LEFA 3G9BA 3CHXC 1A2LA 2FLSA 1O8WA 3WGEA 5GAPD 4F9ZA 2VLUA 5HFKA 1LU4A 4ZBDA 4JE1A 3BCIA 1V40A 3DRNA 5GSTA 4KX4A 5ECLB 4J2FA 3KIJA 2LUSA 22GSA 2CZ2A 4MLYA 2BMXA 2MBSA 1V58A 3EPTA 2NTOA 3CBUA 3TKSA 2L4QA 2VL3A 2XBQA 3J7Yb 2YN1A 1VF2A 1RW1A 1WIKA 1PFOA 4ZL7A 3VFIA 6GSYA 5CREA 1M99A 3A2XA 1S3CA 2H6YA 2A2PA 4X4JA 2VLVA 5CAXA 5J3RA 3TGZA 5B7CA 1X0RA 3E3EA 4F0BA 2O36A 2H74A 1WOUA 4MZWA 4Q5RA 3JCML 3TRXA 3TRPA 2P31A 3TKSC 1XBSA 4V2NA 4W66A 2HSNA 5A1NB 4AI6A 2NBSA 2LSTA 4E8HA 3GL3A 5BMUA 5AGYA 4V1Ap 5D96A 3LWAA 3F0IA 3HVSA 4ISDA 4DSSA 1K0NA 3QCPA 2HQTA 5AN1A 2LJKA 3FZ4A 2HZFA 2L4CA 2AUVA 2C1YA 4FQUA 4WR5A 5DQYA 8GSSA 4HQSA 1GNEA 4FH8A 3P7XA 2B7JA 1LJRA 3MSZA 3H79A 4QMKA 2BTOT 4OO5A 5CO3A 3PGTA 1UA5A 4N30A 1QUWA 3C71A 1KNGA 4NMUA 1PKWA 1M3JA 2L6CA 2XPDA 2B7KA 1R7HA 2YWIA 5FHIA 2LEGA 5L71A 1KBNA 4K5SA 5CRWA 3GL5A 2FGXA 1N8JA 4HDEA 3ZITA 4LL1B 1I5GA 4PUFC 3UMAA 2K6VA 3QAGA 1J08A 4KDXA 4EVMA 2UV8G 4K7NA 3HXSA 4GXZA 5LCZA 5HR3A 2I1UA 2JSYA 5ECIB 2C3TA 3HVNA 5CNWA 1X9WB 1MTCA 5IMCA 3ZL5A 1ABAA 4KF9A 2V32A 4GDFA 5IMZA 1E2YA 2WVXB 4XRDA 2QC7A 4RI7A 4FO5A 3TJFA 3FZ5A 4F82A 1IYHA 1GP1A 2DJ2A 5DDLA 1R5PA 4GSTA 9GSSA 1HNCA 2VCQA 3CRTA 3RPNA 2JZSA 1E6BA 5KEJA 1JLVA 4USSA 2H19A 4L8EA 1T4YA 4IQ1A 2O8VB 5JCUA 2AB6A 3FY7A 3ERGA 2WW0A 5IOXA 1XWKA 3RPPA 2WW2A 4ZIJA 2HT9A 4FYBA 5KN1A 1GSSA 1ERUA 1A0RP 4WBRD 1GNWA 3VI5A 3RAZA 3Q19A 4Q5QA 2H76A 1XCCA 1QK8A 1ZCPA 2C3QA 2YWMA 3C7MA 4P3YB 5DJLA 2HSMA 3MWHA 4QL7A 2E7PA 1SVOA 1DBYA 5DQSA 2EIQA 3DIEA 5B8BA 2H0HA 1WMJA 4RQXA 4EF0A 3ZIJA 3IC8A 3LSZA 3F63A 2YJHA 5GZZB 1TRVA 1M9BA 4XRAA 1OC9B 2WZ9A 3EC3A 2QSIA 2MMZA 1U3IA 5IO0A 1RQMA 4FYCA 3ZZXA 5IPHA 4MDCA 4EDZA 3L4NA 4IGJA 4X43A 1ZYQB 1CQGA 1QFNA 2WVYA 2GQKA 2WCIA 2UZ8A 3F8UA 2LJRA 2C3NA 2EFEA 1B4QA 5LNKe 4V2LA 3UL3A 3I69A 4WBJA 5A5HB 2LNSA 5DAKA 1SK1A 1K3OA 5H5QA 1SKWB 5HFGA 2Z9SA 4MH2A 4EC0A 2CVBA 1HD2A 5CYYA 4YH2A 2FNOA 3I6AA 4I2UA 3L9VA 2VL2A 3KMOA 2K8SA 2V6OA 2AYTA 4KE3A 2CVKA 4ZB6A 2IMFA 2B5EA 3IRAA 3TOTA 3HZ8A 3ZVJD 2IMEA 4ZILA 3UJ1A 1G6WA 3HJPA 4IVFA 3EURA 3DGQA 4WEYA 2X49A 3HZ4A 4EUYA 1EV9A 2B5YA 3GX8A 3L9SA 2VL2C 1K0BA 2CA8A 1DSBA 4KNDA 2TIRA 2DMLA 5D9XA 1BYEA 5ELAA 3IPZA 2H66A 3HYPA 4RQRA 3ZRDA 2GSSA 1AIUA 2YZHA 1NHYA 2VIMA 4DSRA 2N5BA 1SYRA 5IQYA 3WYWA 1UVZA 3VK9A 4PNFA 5D93A 3TKPA 1MDKA 1WWJA 1WJKA 2QA2A 4I5QA 1EOHA 2VKZG 1Z7RA 2YANA 4MJEA 1PSQA 3R2QA 1K0OA 5IMAA 4MF7A 3P8WA 4G0IA 3DVWA 4G2EA 1SYXA 1TRUA 5ECKB 2REMA 4K1FA 4GWRA 2FHEA 3FRCA 2YZUA 5ID2A 4MJCA 2MMOA 4PQIA 3QR6A 3EE2A 1EWXA 2K8VA 2HRAA 3VI7A 2CX3A 3DYRA 3W6GA 1Z5YE 5CP1A 3TOUA 3D6IA 1O81A 2O3EA 1ZZYA 1TU7A 3P2AA 2B5XA 4ECCA 2OE1A 4OFNA 5DCGA 2MZCA 4EE0A 1SD9A 3LYPA 3NIVA 1ZGNA 2EFDA 1KTEA 4KDUA 2L57A 3AY8A 2WW3A 3HMJG 5BRTA 4Z2TA 2EC4A 3WD6A 3G7JA 3HA9A 4CHSA 2MYGA 1B9XC 2H72A 4MK3A 5KN2A 2WFCA 5EPFA 2PN8A 5F05A 2AAWA 3FKFA 1B48A 3GKNA 3GRXA 2IPAA 3UBLA 2L6DA 1GLPA 3ZREA 4V1Ag 1K3YA 3IHGA 5JWRB 4MPFA 2E2MA 3EU3A 3SBCA 3CTGA 4K9ZA 4ZB8A 4KH7A 4TR1B 5DJMA 3ERFA 1EEJA 1XOAA 5DCHA 2C4JA 3HD5A 4XS4A 1GSUA 1ILOA 2V1MA 1XWAA 4IELA 2O7KA 3TDGA 1N25A 3IHQA 1ZL9A 3TKRA 4HZ2A 1GH2A 2FCHA 4K8MA 2OE0A 3ZMKA 1Z6NA 3F6FA 4V2MA 1TKDB 1VF1A 2EFCA 4KSOA 3PPUA 3RGBC 5H5SA 4EXJA 4PURA 1K0DA 2V41A 5IIZA 4GRFA 1TOFA 4EKZA 4DVCA 3KP8A 1SJ6A 3FEUA 4X1UA 5B6MA 1XWGA 4N11A 2YWNA 1V98A 1FW1A 3IC4A 5ECHB 2H70A 2IWTA 2GS3A 4XHMA 2YWOA 3U5RE 1VF3A 2OJLA 3M9JA 1S3RA 1W4VA 4G10A 1YKCA 4PQHA 3PR8A 2D2ZA 5F0GA 2LKUA 4N0ZA 2NVLA 1TK5B 3U6VA 1PMTA 3NZNA 4ZBBA 1XOBA 3GA4A 5D9VA 1GSEA 1K0CA 2FA8A 1FOVA 4LMWA 2DJ3A 1JLWA 1Z6MA 2PUKC 3D4TA 2DKIA 3UBKA 4ICYA 3GTUB 4YKGA 4H86A 3GH9A 1M2DA 2GSQA 5G30A 4MCUA 5EL8A 1OKDA 4Z2RA 4JR4A 2GDRA 4AF2A 2H6ZA 3GH6A 2YNXA 4GF0A 5DVBA 1J9BA 3ZFLA 5JWOB 1BAYA 2FWEA 2X99A 4I6XA 5C04A 3RBTA 3M0FA 2OKAA 2XPEA 4K7OA 5DALB 1AQXA 4KAEA 1FHEA 4CY6A 3ZIVA 1YY7A 2JZRA 5G31A 1ML6A 2LQQA 4AKHA 1MD3A 2C0DA 3MAKA 3RFRC 3APQA 2DJ1A 4Z2UA 1YKAA 1A24A 6GSVA 1EZKA 3C1SA 4CY8A 3QFBC 1PRXA 2DJ0A 3EMPA 5B8AA 4NXIA 19GSA 4AKGA 1SKRB 2FWHA 2BJXA 1XXUA 2X4AA 4HOJA 1X9MB 2X8HA 2I4AA 4L0WA 10GSA 2H8LA 3KEBA 3F4TA 1GL8A 1R5AA 3A5WA 3HJMA 1JZRA 2AHEA 1V2AA 2KP2A 3APSA 3HCZA 2VOCA 2H0IA 4OO4A 2B1KA 2EFHA 1PL2A 2R6KA 2R3XA 3VURA 3DMLA 3P90A 2CX4A 2KLXA 3QAWA 4OFMA 3L0HA 4I2TA 5A34B 3FHKA 17GSA 5J4YA 2VLTA 5G2ZA 2HRKB 2B3SA 3VLNA 3HVXA 1FVKA 1S3DA 2N5AA 1NSWA 3WGDA 3KH9A 1NM3A 3FZAA 3RDWA 5HQPA 2VD0A 1FB6A 2CZ3A 2OADA 4GCIA 2O87A 1THXA 3BOAA 5GAND 4D73B 3Q6OA 2WJUA 3GSSA 4HZ4A 4L0UA 1SVLA 3UARA 1PQNA 4TKYA 2ON7A 5A4VA 5ECMB 4RI6A 3DD3A 2RLIA 5A4WA 1GLQA 1PL1A 4JRRA 4ZL9A 5IMVA 2H1GA 5IM9A 4POBA 2R37A 1PN9A 2JADA 4XS1A 4AJ6A 3F9UA 2B6MA 4E8EA 2PVQA 14GSA 4FXYP 3MYDA 4DEJA 1PX7A 4PI0C 4OFTA 2I3YA 4GLTA 1BG1A 4KW6A 4N0VA 1ZMAA 3H4KA 3A2VA 1TTZA 6GSXA 5HR0A 1ST9A 5IPGA 1R26A 2LNTA 3S9FA 3IXRA 5D8IA 2DKHA 4XIHA 1WE0A 1DE2A 3VPTA 4MZBA 1T8EB 1TI1A 1YEXA 3LQ7A 3TU3B 3HVVA 1ERWA 1S3AA 3GUSA 3IV4A 3TJGA 4MMMA 2DBCA 1QQ2A 1ON4A 4FIWA 1OE8A 1BF5A 2VUPA 4ECBA 4PNGA 5F06A 3GHAA 4TR1A 2PGTA 3H8QA 4Q5FA 4DSQA 2IFQB 3MNGA 1IYIA 4K7IA 4BVXB 2C0GA 4WF5A 4IN0A 1XW9A 3E9JB 2A2SA 1GTAA 2DIZA 4OMVA 1SD8A 2HRFA 1M2BA 3F3RA 1FAAA 4AKXB 5J41A 5F07A 3KZQA 3VWUA 3LGCA 2IN3A 4N10A 3LXZA 3GURA 1DE1A 1F9MA 3UVTA 3KD0A 4I8BA 4TW5A 4POKA 4CDOA 1N2AA 2J23A 4K2XA 4POLA 3IAM2 3ZTLA 2OACA 5E59A 4MP4A 2WW1A 3FR3A 1WP0A 1A2JA 2PMTA 4TVEA 2GVPA 4JR6A 2GZZA 4IP6A 2HNLA 1OAZA 2LRCA 3HY2A 3EINA 2L5OA 2HE3A 2A4HA 3R3EA 3N5OA 1T3BA 2FWGA 4NV5A 3TKSE 2K9FA 3ZMLA 1EEMA 3V1WA 1SL0B 3APOA 3CYNA 3C8EA 3QAVA 3I43A 4HJ2A 5ECNB 4WR4A 5DBQA 2MBTA 4NV2A 5CRDA 5J9BA 1M2AA 3NOFA 5ECPB 4ACSA 5COHA 1SKSB 1JZDA 4GSSA 1I1IP 4YKFA 2RM6A 5BMUB 4G9HA 3A3TA 2PERA 4DSSB 5D9TA 3F4RA 2CT6A 4KCAA 4G01A 5INYA 5IO2A 1GTBA 3ZFBA 4KDYA 4AGSA 1EOGA 5H5RA 2IMDA 3IOSA 4ILFA 2VCZA 2HSHA 1PX6A 3TCOA 1SVMA 2O5VA 2PWJA 3LXTA 3G7YA 1J0FA 4FYUA 4O5QA 1S4BP 5J4VA 2WB9A 3ISOA 4HQZA 2F51A 4F03A 2MMAA 4OCEA 2PU9C 1G7EA 2CAQA 1SK0A 1YDKA 5A1NA 5IOWA 3QMXA 2WZSA 2R0CA 1PN0A 2VCXA 2E0QA 2LJAA 4ZXGA 5E4WA 3UOMA 2H0GA 2R2JA 3M9KA 1MDIA 2ON5A 2GT6A 4ID0A 3QDNA 1ZYNA 4HJMA 4TXOB 1R4WA 2RUEA 2P0GA 4XS6A 4EIPA 4ECIA 3IE3A 3TJJA 1T7PB 3O76A 2YOIA 2QA1A 3FW2A 1EGOA 4E68A 2C0EA 1X5CA 3UIWA 1SJIA 4MABA 3CQFA 2GSTA 1TDIA 3IR4A 1MDJA 2DJJA 4TOPA 16GSA 2WDUA 1ZOFA 1GUKA 2HRKA 1F3AA 2JSZA 1B9YC 1T4ZA 1BEDA 2P5QA 4K0GA 2QKEA 2ZNMA 2VCTA 3CSIA 2FY6A 1HNBA 2DSAA 4JZQA 1LBKA 2AV4A 4D73A 2LTKA 5AISA 1XVQA 4BWQA 1T1VA 20GSA 2WVXA 1F37A 2OBIA 1A23A 4YQUA 3QFAC 2IIYA 1HNAA 1QMVA 3W8SA 2O85A 2R0PA 4KUNA 3ME8A 2HSMB 1YQ1A 5J40A 4LA1A 4F0CA 1ZYPA 5D9WA 4L5OA 4IW9A 4PGTA 5A4UA 13GSA 4Q5NA 2CQ9A 2ZCTA 5KN0A 1JZWA 1XVWA 4BVYB 4PUAA 4JU5A 3VWWA 3EWLA 2IJYA 1VF4A 4PHZC 3GKKA 2O89A 4QQ7A 2WS2A 2RIIA 4G19A 2CV4A 2V6KA 1GTIA 1U88A 2L5LA 2KHPA 2MMNA 4ZB9A 1PKZA 1G0TA 1YEPA 2PBJA 3IA1A 1O85A 1PA3A 2VM2A 3D22A 5D73A 1JFUA 1FB0A 5CRHA 2XBIA 1SJZA 2RM5A 1GUHA 4YAPA 2KUCA 5AIXA 1T00A 2E2GA 4NWYA 2XC2A 4IBPA 1XWCA 2FA4A 1PGTA 2IFQA 4J57E 5A5KA 1OC9A 2M46A 2VO4A 4QL9A 5AIVA 2YPMA 4O5UA 3GFKA 2K18A 2LRTA 5JWQB 4HI7A 4K2DA 4WXTA 1B4PA 3TJBA 1THOA 5ECRB 1TXUA 2TRCP 3O6TA 1MD4A 3Q18A 1SENA 4F2IA 4K5RA 4G0LA 1SK2A 2CAIA 1A0FA
chains in the Genus database with same CATH topology
2V2GA 2R4VA 2HXKA 2HLSA 5HFIA 4PX1A 3F6DA 4MZCA 4ZB7A 5A5HA 1TJDA 2H6XA 2HYXA 2M80A 2GQMA 2JU5A 1QXHA 2XHFA 4O5RA 4O92A 4BPYA 3EU4A 1TRSA 3ZVJA 4BL7B 1EV4A 2G2QA 4NHZA 3HDCA 1XW5A 4MNNA 4PXOA 3GIXA 4G0KA 3WGXA 1SL1B 1X5DA 3D0ZA 2VCVA 6GSWA 2IMIA 3PH9A 3GKXA 2HRNA 7GSSA 4YAVA 5J4UA 4HU7A 5IMFA 1M0UA 1JZOA 3M3MA 4ZL8A 1EP8A 4AJ8A 1OC8A 1H75A 1XIYA 2HFDA 4EIQA 2KOKA 2PVOC 2F3MA 3TRQA 2PPTA 3RHBA 3GNJA 2LRNA 3FK8A 1HYUA 1O6JA 5G1LA 2F8AA 2HZEB 1C72A 4GQFA 3LG6A 2GTUA 4KB3A 5ID2B 3L9UA 3PINA 2H1DA 6GSSA 3I9V2 3DKSA 3VWXA 3DEXA 3DVXA 4WKWA 4A5PA 4ML1A 2FUG2 3D5JA 3FZ9A 4MF5A 2NDOA 1SL2B 1G6YA 1PD21 3LYKA 2H1LA 2C8UA 3ED3A 1UN2A 3CMIA 2FD3A 2GZPA 4BWSA 3CSJA 1GSQA 2GSRA 5ENUA 2VL9A 2A2RA 2G0FA 5G1KA 3CWGA 2J9HA 1GWCA 2ES7A 4EDYA 2YCDA 1QGVA 1A8LA 1KEBA 3ZYWA 1OYJA 1O7UA 1Q98A 4LMVA 4MA9A 12GSA 4TXOA 3DWVA 2EIRA 1YZXA 2DLXA 3WT2A 5LD0A 1FO5A 2M72A 2YV7A 2IL3A 4MF6A 5EY6A 3GX0A 4X0XA 2P5RA 3ZLPA 2X8CA 1FVJA 1A8YA 2EIOA 5KOXA 2GLRA 4MJAA 3CXGA 3FMWA 3ERWA 2YJ7A 2LS5A 3UAPA 4L5LA 5ECQB 5B6NA 4HEA2 4XS4B 3CRUA 1XPVA 2GZYA 1I9DA 2LV3A 2HI7A 4JBBA 1AXDA 4IHUA 3BD2A 3E0UA 2DJKA 3HHVA 3KM6A 1OVNA 4I97A 3W8JA 3C73A 3US3A 2I81A 5JCWA 2JACA 4OD7A 5GSSA 2R5GA 3A2WA 4JEDA 3KGKA 3OR5A 1TXXA 3WT1A 3F4SA 1V9WA 4POMA 4MJBA 1UC7A 5KN3A 4TR0A 4TRXA 1FOHA 3UVHA 3IDVA 1BQ7A 6GSTA 3FR6A 2GQLA 2C0FA 1EGRA 2H75A 1U3AA 1YF0A 3DXBA 4BA7A 3TUEA 4BVYA 4HU9A 1YF1A 1K3LA 4MH3A 3QOUA 1AW9A 1GSFA 1TW9A 4ML6A 2GGTA 4K6XA 1YJ6A 4NAXA 4KA0A 4O7HA 2ZUPA 1NHOA 3FYGA 11GSA 1ZYEA 3KH7A 5KOWA 1H4OA 1BJXA 3N9JA 1XWBA 3MIXA 3EMXA 4TN8A 1Z9HA 5HR1A 3HKRA 3KXOA 5J5NA 4J56E 2OBKA 1BX9A 3KTLA 3H93A 1GSYA 3F3QA 2YV9A 4EL1A 4YQMA 1CQHA 1TU8A 3GSTA 4WF4A 3GYKA 3BJ5A 1Y6EA 1OKTA 1AQVA 1HQOA 3GKMA 2HSNB 5IMDA 3GTUA 5ABRA 1G7OA 2H1AA 5FT3A 1ERTA 4CW9A 1WRYA 3KMNA 1FG4A 3KTBA 1AUCA 2DMMA 1AQWA 18GSA 2H71A 2OE3A 2DC5A 3CSHA 4ECJA 3M8NA 5DALA 1OC3A 4MPGA 3C1RA 5G5EA 1O73A 4HUAA 4BL7A 3LFLA 2JZTA 1K0MA 3O3TA 3QD9A 1TK8B 2TRXA 3BCKA 2N5FA 2JL4A 3L78A 4PQ1A 3LW9A 1EP7A 2A4VA 2WRTA 1JHBA 1X9SB 3D4MA 1V57A 1VRSD 3VWVA 4IJ3A 1GRXA 2OA7A 3IAS2 3TKQA 3KP9A 4O32A 2F9SA 2R0GA 2RUFA 4OWYA 5FWGA 3IBHA 1TRWA 3J7Yk 2YP6A 4GSNA 3MDKA 3LORA 1U6TA 3IK7A 2WGRA 1B8XA 1GTUA 1XW6A 3A5IA 4GQCA 4LLRA 5J47A 2HZEA 1SU9A 4HS1A 5ELGA 4YQVA 4TXVA 3K8NA 1M9AA 2ALBA 1XZOA 1AAZA 4NHWA 4RUVA 3M1GA 2B1LA 3RHCA 1TI3A 2I9HA 3IK9A 5A34A 1MEKA 1YVLA 3H1NA 2QGVA 2WULA 2HSYA 2H73A 1F3BA 4KGIA 1O8XA 5ECOB 1F6MC 4LL4B 3KJYA 2VM1A 3ME7A 4IQAA 1Y25A 5ECSA 2X64A 4EO3A 3TJKA 2H30A 2KP1A 2C80A 4ZBAA 4IKHA 4K0NA 3UEMA 4OCFA 1DUGA 2H1BA 4KCEA 2FWFA 4N3ZA 1Z7PA 2X8GA 1F2EA 1GULA 1OE7A 1ERVA 3TB2A 1WPIA 1GSDA 2NPBA 4PTSA 3G7IA 4NPBA 1ACVA 2VAFA 5EVOA 4IP1A 1BG5A 3EVIA 5HR2A 3BBYA 1Y1UA 1XFLA 4TR4A 2IMKA 1M7TA 3LJRA 3SWLA 3D21A 2VD1A 1USBA 2GT5A 1U87A 2LQOA 4XCSA 3FR9A 4IJIA 1AC1A 2CVDA 3GMFA 4GTUA 3HJOA 4KSMA 1Z3EA 1VGLA 1URMA 3QPMA 1RK4A 1GUMA 4TR3A 1K0AA 3Q74A 4AJ7A 3VPQA 3CTFA 4IS0A 3GV1A 1A2MA 2F8FA 1NW2A 2H01A 2DIYA 4XTSA 5DAKB 5F8BA 1TK0B 1Q4JA 3KCMA 5C00A 5J9CA 6GSUA 1X5EA 5JCGA 4AKIA 1TP9A 3GN3A 5G5FA 2AJQB 3EYTA 4Z7XA 2L59A 5CRGA 2OT3A 2VCWA 4ULXA 4WETA 4BVXA 1W89A 3LEFA 3G9BA 1A2LA 2FLSA 1O8WA 3WGEA 5GAPD 4F9ZA 2VLUA 5HFKA 1LU4A 4ZBDA 4JE1A 3BCIA 1V40A 3DRNA 5GSTA 4KX4A 5ECLB 4J2FA 3KIJA 2LUSA 22GSA 2CZ2A 4MLYA 2BMXA 2MBSA 1V58A 3EPTA 2NTOA 3CBUA 3TKSA 2L4QA 2VL3A 2XBQA 3J7Yb 2YN1A 1VF2A 1RW1A 1WIKA 4ZL7A 3VFIA 6GSYA 5CREA 1M99A 3A2XA 1S3CA 2H6YA 2A2PA 4X4JA 2VLVA 5CAXA 5J3RA 3TGZA 5B7CA 1X0RA 3E3EA 4F0BA 2H74A 1WOUA 4MZWA 4Q5RA 3JCML 3TRXA 3TRPA 2P31A 3TKSC 1XBSA 4V2NA 4W66A 2HSNA 5A1NB 4AI6A 2NBSA 2LSTA 4E8HA 3GL3A 5BMUA 5AGYA 4V1Ap 5D96A 3LWAA 3F0IA 3HVSA 4ISDA 4DSSA 1K0NA 3QCPA 2HQTA 5AN1A 2LJKA 3FZ4A 2HZFA 2L4CA 2AUVA 2C1YA 4FQUA 4WR5A 5DQYA 8GSSA 4HQSA 1GNEA 4FH8A 3P7XA 2B7JA 1LJRA 3MSZA 3H79A 4QMKA 2BTOT 4OO5A 5CO3A 3PGTA 1UA5A 4N30A 1QUWA 3C71A 1KNGA 4NMUA 1PKWA 2L6CA 2XPDA 2B7KA 1R7HA 2YWIA 5FHIA 2LEGA 5L71A 1KBNA 4K5SA 5CRWA 3GL5A 2FGXA 1N8JA 4HDEA 3ZITA 4LL1B 1I5GA 4PUFC 3UMAA 2K6VA 3QAGA 1J08A 4KDXA 4EVMA 2UV8G 4K7NA 3HXSA 4GXZA 5LCZA 5HR3A 2I1UA 2JSYA 5ECIB 2C3TA 5CNWA 1X9WB 1MTCA 5IMCA 3ZL5A 1ABAA 4KF9A 2V32A 4GDFA 5IMZA 1E2YA 4XRDA 2QC7A 4RI7A 4FO5A 3TJFA 3FZ5A 4F82A 1IYHA 1GP1A 2DJ2A 5DDLA 1R5PA 4GSTA 9GSSA 1HNCA 2VCQA 3CRTA 3RPNA 2JZSA 1E6BA 5KEJA 1JLVA 4USSA 2H19A 4L8EA 1T4YA 4IQ1A 2O8VB 5JCUA 2AB6A 3FY7A 3ERGA 5IOXA 1XWKA 3RPPA 4ZIJA 2HT9A 4FYBA 5KN1A 1GSSA 1ERUA 1A0RP 4WBRD 1GNWA 3VI5A 3RAZA 3Q19A 4Q5QA 2H76A 1XCCA 1QK8A 1ZCPA 2C3QA 2YWMA 3C7MA 4P3YB 5DJLA 2HSMA 3MWHA 4QL7A 2E7PA 1SVOA 1DBYA 5DQSA 2EIQA 3DIEA 5B8BA 2H0HA 1WMJA 4RQXA 4EF0A 3ZIJA 3IC8A 3LSZA 3F63A 2YJHA 5GZZB 1TRVA 1M9BA 4XRAA 1OC9B 2WZ9A 3EC3A 2QSIA 2MMZA 1U3IA 5IO0A 1RQMA 4FYCA 3ZZXA 5IPHA 4MDCA 4EDZA 3L4NA 4IGJA 4X43A 1ZYQB 1CQGA 1QFNA 2GQKA 2WCIA 2UZ8A 3F8UA 2LJRA 2C3NA 2EFEA 1B4QA 5LNKe 4V2LA 3UL3A 3I69A 4WBJA 5A5HB 2LNSA 5DAKA 1SK1A 1K3OA 5H5QA 1SKWB 5HFGA 2Z9SA 4MH2A 4EC0A 2CVBA 1HD2A 5CYYA 4YH2A 2FNOA 3I6AA 4I2UA 3L9VA 2VL2A 3KMOA 2K8SA 2V6OA 2AYTA 4KE3A 2CVKA 4ZB6A 2IMFA 2B5EA 3IRAA 3TOTA 3HZ8A 3ZVJD 2IMEA 4ZILA 3UJ1A 1G6WA 3HJPA 4IVFA 3EURA 3DGQA 4WEYA 2X49A 3HZ4A 4EUYA 1EV9A 2B5YA 3GX8A 3L9SA 2VL2C 1K0BA 2CA8A 1DSBA 4KNDA 2TIRA 2DMLA 5D9XA 1BYEA 5ELAA 3IPZA 2H66A 3HYPA 4RQRA 3ZRDA 2GSSA 1AIUA 2YZHA 1NHYA 2VIMA 4DSRA 2N5BA 1SYRA 5IQYA 3WYWA 1UVZA 3VK9A 4PNFA 5D93A 3TKPA 1MDKA 1WWJA 1WJKA 2QA2A 4I5QA 1EOHA 2VKZG 1Z7RA 2YANA 4MJEA 1PSQA 3R2QA 1K0OA 5IMAA 4MF7A 3P8WA 4G0IA 3DVWA 4G2EA 1SYXA 1TRUA 5ECKB 2REMA 4K1FA 4GWRA 2FHEA 3FRCA 2YZUA 5ID2A 4MJCA 2MMOA 4PQIA 3QR6A 3EE2A 1EWXA 2K8VA 2HRAA 3VI7A 2CX3A 3DYRA 3W6GA 1Z5YE 5CP1A 3TOUA 3D6IA 1O81A 1ZZYA 1TU7A 3P2AA 2B5XA 4ECCA 2OE1A 4OFNA 5DCGA 2MZCA 4EE0A 1SD9A 3LYPA 3NIVA 1ZGNA 2EFDA 1KTEA 4KDUA 2L57A 3AY8A 3HMJG 5BRTA 4Z2TA 2EC4A 3WD6A 3G7JA 3HA9A 4CHSA 2MYGA 1B9XC 2H72A 4MK3A 5KN2A 2WFCA 5EPFA 2PN8A 5F05A 2AAWA 3FKFA 1B48A 3GKNA 3GRXA 2IPAA 3UBLA 2L6DA 1GLPA 3ZREA 4V1Ag 1K3YA 3IHGA 5JWRB 4MPFA 2E2MA 3EU3A 3SBCA 3CTGA 4K9ZA 4ZB8A 4KH7A 4TR1B 5DJMA 3ERFA 1EEJA 1XOAA 5DCHA 2C4JA 3HD5A 4XS4A 1GSUA 1ILOA 2V1MA 1XWAA 4IELA 2O7KA 3TDGA 1N25A 3IHQA 1ZL9A 3TKRA 4HZ2A 1GH2A 2FCHA 4K8MA 2OE0A 3ZMKA 1Z6NA 3F6FA 4V2MA 1TKDB 1VF1A 2EFCA 4KSOA 3PPUA 5H5SA 4EXJA 4PURA 1K0DA 2V41A 5IIZA 4GRFA 1TOFA 4EKZA 4DVCA 3KP8A 1SJ6A 3FEUA 4X1UA 5B6MA 1XWGA 4N11A 2YWNA 1V98A 1FW1A 3IC4A 5ECHB 2H70A 2IWTA 2GS3A 4XHMA 2YWOA 3U5RE 1VF3A 2OJLA 3M9JA 1W4VA 4G10A 1YKCA 4PQHA 3PR8A 2D2ZA 5F0GA 2LKUA 4N0ZA 2NVLA 1TK5B 3U6VA 1PMTA 3NZNA 4ZBBA 1XOBA 3GA4A 5D9VA 1GSEA 1K0CA 2FA8A 1FOVA 4LMWA 2DJ3A 1JLWA 1Z6MA 2PUKC 3D4TA 2DKIA 3UBKA 4ICYA 3GTUB 4YKGA 4H86A 3GH9A 1M2DA 2GSQA 5G30A 4MCUA 5EL8A 1OKDA 4Z2RA 4JR4A 2GDRA 4AF2A 2H6ZA 3GH6A 2YNXA 4GF0A 5DVBA 1J9BA 3ZFLA 5JWOB 1BAYA 2FWEA 2X99A 4I6XA 5C04A 3RBTA 3M0FA 2OKAA 2XPEA 4K7OA 5DALB 1AQXA 4KAEA 1FHEA 4CY6A 3ZIVA 1YY7A 2JZRA 5G31A 1ML6A 2LQQA 4AKHA 1MD3A 2C0DA 3MAKA 3APQA 2DJ1A 4Z2UA 1YKAA 1A24A 6GSVA 1EZKA 3C1SA 4CY8A 3QFBC 1PRXA 2DJ0A 3EMPA 5B8AA 4NXIA 19GSA 4AKGA 1SKRB 2FWHA 2BJXA 1XXUA 2X4AA 4HOJA 1X9MB 2X8HA 2I4AA 4L0WA 10GSA 2H8LA 3KEBA 3F4TA 1GL8A 1R5AA 3A5WA 3HJMA 1JZRA 2AHEA 1V2AA 2KP2A 3APSA 3HCZA 2VOCA 2H0IA 4OO4A 2B1KA 2EFHA 1PL2A 2R6KA 2R3XA 3VURA 3DMLA 3P90A 2CX4A 2KLXA 3QAWA 4OFMA 3L0HA 4I2TA 5A34B 3FHKA 17GSA 5J4YA 2VLTA 5G2ZA 2HRKB 2B3SA 3VLNA 3HVXA 1FVKA 1S3DA 2N5AA 1NSWA 3WGDA 3KH9A 1NM3A 3FZAA 3RDWA 5HQPA 2VD0A 1FB6A 2CZ3A 2OADA 4GCIA 2O87A 1THXA 3BOAA 5GAND 4D73B 3Q6OA 2WJUA 3GSSA 4HZ4A 4L0UA 1SVLA 3UARA 1PQNA 4TKYA 2ON7A 5A4VA 5ECMB 4RI6A 3DD3A 2RLIA 5A4WA 1GLQA 1PL1A 4JRRA 4ZL9A 5IMVA 2H1GA 5IM9A 4POBA 2R37A 1PN9A 2JADA 4XS1A 4AJ6A 3F9UA 2B6MA 4E8EA 2PVQA 14GSA 3MYDA 4DEJA 1PX7A 2I3YA 4OFTA 4GLTA 1BG1A 4KW6A 4N0VA 1ZMAA 3H4KA 3A2VA 1TTZA 6GSXA 5HR0A 1ST9A 5IPGA 1R26A 2LNTA 3S9FA 3IXRA 5D8IA 2DKHA 4XIHA 1WE0A 1DE2A 3VPTA 4MZBA 1T8EB 1TI1A 1YEXA 3LQ7A 3TU3B 3HVVA 1ERWA 1S3AA 3GUSA 3IV4A 3TJGA 4MMMA 2DBCA 1QQ2A 1ON4A 4FIWA 1OE8A 1BF5A 2VUPA 4ECBA 4PNGA 5F06A 3GHAA 4TR1A 2PGTA 3H8QA 4Q5FA 4DSQA 2IFQB 3MNGA 1IYIA 4K7IA 4BVXB 2C0GA 4WF5A 4IN0A 1XW9A 3E9JB 2A2SA 1GTAA 2DIZA 4OMVA 1SD8A 2HRFA 1M2BA 3F3RA 1FAAA 4AKXB 5J41A 5F07A 3KZQA 3VWUA 3LGCA 2IN3A 4N10A 3LXZA 3GURA 1DE1A 1F9MA 3UVTA 3KD0A 4I8BA 4TW5A 4POKA 4CDOA 1N2AA 2J23A 4K2XA 4POLA 3IAM2 3ZTLA 2OACA 5E59A 4MP4A 3FR3A 1WP0A 1A2JA 2PMTA 4TVEA 2GVPA 4JR6A 2GZZA 4IP6A 2HNLA 1OAZA 2LRCA 3HY2A 3EINA 2L5OA 2HE3A 2A4HA 3R3EA 3N5OA 1T3BA 2FWGA 4NV5A 3TKSE 2K9FA 3ZMLA 1EEMA 3V1WA 1SL0B 3APOA 3CYNA 3C8EA 3QAVA 3I43A 4HJ2A 5ECNB 4WR4A 5DBQA 2MBTA 4NV2A 5CRDA 5J9BA 1M2AA 3NOFA 5ECPB 4ACSA 5COHA 1SKSB 1JZDA 4GSSA 4YKFA 2RM6A 5BMUB 4G9HA 3A3TA 2PERA 4DSSB 5D9TA 3F4RA 2CT6A 4KCAA 4G01A 5INYA 5IO2A 1GTBA 3ZFBA 4KDYA 4AGSA 1EOGA 5H5RA 2IMDA 3IOSA 4ILFA 2VCZA 2HSHA 1PX6A 3TCOA 1SVMA 2O5VA 2PWJA 3LXTA 3G7YA 1J0FA 4FYUA 4O5QA 5J4VA 2WB9A 3ISOA 4HQZA 2F51A 4F03A 2MMAA 4OCEA 2PU9C 1G7EA 2CAQA 1SK0A 1YDKA 5A1NA 5IOWA 3QMXA 2R0CA 1PN0A 2VCXA 2E0QA 2LJAA 4ZXGA 5E4WA 3UOMA 2H0GA 2R2JA 3M9KA 1MDIA 2ON5A 2GT6A 4ID0A 3QDNA 1ZYNA 4HJMA 4TXOB 1R4WA 2RUEA 2P0GA 4XS6A 4EIPA 4ECIA 3IE3A 3TJJA 1T7PB 3O76A 2YOIA 2QA1A 3FW2A 1EGOA 4E68A 2C0EA 1X5CA 3UIWA 1SJIA 4MABA 2GSTA 1TDIA 3IR4A 1MDJA 2DJJA 4TOPA 16GSA 2WDUA 1ZOFA 1GUKA 2HRKA 1F3AA 2JSZA 1B9YC 1T4ZA 1BEDA 2P5QA 4K0GA 2QKEA 2ZNMA 2VCTA 3CSIA 2FY6A 1HNBA 2DSAA 4JZQA 1LBKA 2AV4A 4D73A 2LTKA 5AISA 1XVQA 4BWQA 1T1VA 20GSA 1F37A 2OBIA 1A23A 4YQUA 3QFAC 2IIYA 1HNAA 1QMVA 3W8SA 2O85A 2R0PA 4KUNA 3ME8A 2HSMB 1YQ1A 5J40A 4LA1A 4F0CA 1ZYPA 5D9WA 4L5OA 4IW9A 4PGTA 5A4UA 13GSA 4Q5NA 2CQ9A 2ZCTA 5KN0A 1JZWA 1XVWA 4BVYB 4PUAA 4JU5A 3VWWA 3EWLA 2IJYA 1VF4A 3GKKA 2O89A 4QQ7A 2WS2A 2RIIA 4G19A 2CV4A 2V6KA 1GTIA 1U88A 2L5LA 2KHPA 2MMNA 4ZB9A 1PKZA 1G0TA 1YEPA 2PBJA 3IA1A 1O85A 1PA3A 2VM2A 3D22A 5D73A 1JFUA 1FB0A 5CRHA 2XBIA 1SJZA 2RM5A 1GUHA 4YAPA 2KUCA 5AIXA 1T00A 2E2GA 4NWYA 2XC2A 4IBPA 1XWCA 2FA4A 1PGTA 2IFQA 4J57E 5A5KA 1OC9A 2M46A 2VO4A 4QL9A 5AIVA 2YPMA 4O5UA 3GFKA 2K18A 2LRTA 5JWQB 4HI7A 4K2DA 4WXTA 1B4PA 3TJBA 1THOA 5ECRB 1TXUA 2TRCP 3O6TA 1MD4A 3Q18A 1SENA 4F2IA 4K5RA 4G0LA 1SK2A 2CAIA 1A0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2G A;  2R4V A;  2HXK A;  2HLS A;  5HFI A;  4PX1 A;  3F6D A;  4MZC A;  1TJD A;  2H6X A;  2HYX A;  2M80 A;  2GQM A;  2JU5 A;  1QXH A;  2XHF A;  4O5R A;  4O92 A;  4BPY A;  3EU4 A;  1TRS A;  3ZVJ A;  4BL7 B;  1EV4 A;  2G2Q A;  4NHZ A;  3HDC A;  1XW5 A;  4PXO A;  3GIX A;  4G0K A;  3WGX A;  1SL1 B;  1X5D A;  3D0Z A;  2VCV A;  3PH9 A;  6GSW A;  2IMI A;  3GKX A;  2HRN A;  7GSS A;  4YAV A;  5J4U A;  4HU7 A;  5IMF A;  1M0U A;  1JZO A;  3M3M A;  4ZL8 A;  1EP8 A;  4AJ8 A;  1OC8 A;  1H75 A;  1XIY A;  2HFD A;  2KOK A;  2PVO C;  2F3M A;  3TRQ A;  2PPT A;  3RHB A;  3GNJ A;  2LRN A;  3FK8 A;  1HYU A;  1O6J A;  5G1L A;  2F8A A;  2HZE B;  1C72 A;  4GQF A;  3LG6 A;  2GTU A;  4KB3 A;  5ID2 B;  3L9U A;  3PIN A;  2H1D A;  6GSS A;  3I9V 2;  3DKS A;  3VWX A;  3DEX A;  3DVX A;  4WKW A;  4ML1 A;  2FUG 2;  3D5J A;  3FZ9 A;  4MF5 A;  2NDO A;  1SL2 B;  1G6Y A;  1PD2 1;  3LYK A;  2C8U A;  3ED3 A;  1UN2 A;  3CMI A;  2FD3 A;  2GZP A;  4BWS A;  3CSJ A;  1GSQ A;  2GSR A;  5ENU A;  2VL9 A;  2A2R A;  2G0F A;  5G1K A;  2J9H A;  1GWC A;  2ES7 A;  4EDY A;  2YCD A;  1QGV A;  1A8L A;  1KEB A;  3ZYW A;  1OYJ A;  1O7U A;  1Q98 A;  4LMV A;  4MA9 A;  12GS A;  4TXO A;  3DWV A;  2EIR A;  1YZX A;  2DLX A;  3WT2 A;  5LD0 A;  1FO5 A;  2M72 A;  2YV7 A;  2IL3 A;  4MF6 A;  5EY6 A;  3GX0 A;  4X0X A;  2P5R A;  3ZLP A;  2X8C A;  1FVJ A;  1A8Y A;  2EIO A;  2GLR A;  4MJA A;  3CXG A;  3ERW A;  2YJ7 A;  2LS5 A;  3UAP A;  4L5L A;  5ECQ B;  5B6N A;  4HEA 2;  4XS4 B;  3CRU A;  1XPV A;  2GZY A;  1I9D A;  2LV3 A;  2HI7 A;  4JBB A;  1AXD A;  4IHU A;  3BD2 A;  3E0U A;  2DJK A;  3HHV A;  3KM6 A;  1OVN A;  4I97 A;  3W8J A;  3C73 A;  3US3 A;  2I81 A;  5JCW A;  2JAC A;  4OD7 A;  5GSS A;  2R5G A;  3A2W A;  4JED A;  3KGK A;  3OR5 A;  1TXX A;  3WT1 A;  3F4S A;  1V9W A;  4POM A;  4MJB A;  1UC7 A;  5KN3 A;  4TR0 A;  4TRX A;  3UVH A;  3IDV A;  1BQ7 A;  6GST A;  3FR6 A;  2GQL A;  2C0F A;  1EGR A;  2H75 A;  1U3A A;  1YF0 A;  3DXB A;  4BA7 A;  3TUE A;  4BVY A;  4HU9 A;  1YF1 A;  1K3L A;  4MH3 A;  3QOU A;  1AW9 A;  1GSF A;  1TW9 A;  4ML6 A;  2GGT A;  4K6X A;  1YJ6 A;  4NAX A;  4KA0 A;  4O7H A;  2ZUP A;  1NHO A;  3FYG A;  11GS A;  1ZYE A;  3KH7 A;  1H4O A;  1BJX A;  3N9J A;  1XWB A;  3EMX A;  4TN8 A;  1Z9H A;  5HR1 A;  3HKR A;  3KXO A;  5J5N A;  4J56 E;  2OBK A;  1BX9 A;  3KTL A;  3H93 A;  1GSY A;  3F3Q A;  2YV9 A;  4EL1 A;  4YQM A;  1CQH A;  1TU8 A;  3GST A;  4WF4 A;  3GYK A;  3BJ5 A;  1Y6E A;  1OKT A;  1AQV A;  1HQO A;  3GKM A;  2HSN B;  5IMD A;  3GTU A;  5ABR A;  1G7O A;  2H1A A;  5FT3 A;  1ERT A;  4CW9 A;  1WRY A;  3KMN A;  1FG4 A;  3KTB A;  1AUC A;  2DMM A;  1AQW A;  18GS A;  2H71 A;  2OE3 A;  2DC5 A;  3CSH A;  4ECJ A;  3M8N A;  5DAL A;  1OC3 A;  4MPG A;  3C1R A;  5G5E A;  1O73 A;  4HUA A;  4BL7 A;  3LFL A;  2JZT A;  1K0M A;  3O3T A;  3QD9 A;  1TK8 B;  2TRX A;  3BCK A;  2N5F A;  2JL4 A;  3L78 A;  4PQ1 A;  1EP7 A;  2A4V A;  2WRT A;  1JHB A;  1X9S B;  3D4M A;  1V57 A;  1VRS D;  3VWV A;  4IJ3 A;  1GRX A;  2OA7 A;  3IAS 2;  3TKQ A;  3KP9 A;  4O32 A;  2F9S A;  2RUF A;  4OWY A;  5FWG A;  3IBH A;  1TRW A;  3J7Y k;  2YP6 A;  4GSN A;  3MDK A;  3LOR A;  1U6T A;  3IK7 A;  2WGR A;  1B8X A;  1GTU A;  1XW6 A;  4GQC A;  4LLR A;  2HZE A;  1SU9 A;  4HS1 A;  5ELG A;  4YQV A;  4TXV A;  3K8N A;  1M9A A;  2ALB A;  1XZO A;  1AAZ A;  4NHW A;  4RUV A;  3M1G A;  2B1L A;  3RHC A;  1TI3 A;  2I9H A;  3IK9 A;  1MEK A;  3H1N A;  2QGV A;  2WUL A;  2HSY A;  2H73 A;  1F3B A;  4KGI A;  1O8X A;  5ECO B;  1F6M C;  4LL4 B;  3KJY A;  2VM1 A;  3ME7 A;  4IQA A;  1Y25 A;  5ECS A;  2X64 A;  4EO3 A;  3TJK A;  2H30 A;  2KP1 A;  2C80 A;  4ZBA A;  4IKH A;  4K0N A;  3UEM A;  4OCF A;  1DUG A;  2H1B A;  4KCE A;  2FWF A;  1Z7P A;  2X8G A;  1F2E A;  1GUL A;  1OE7 A;  1ERV A;  3TB2 A;  1WPI A;  1GSD A;  2NPB A;  4PTS A;  3G7I A;  4NPB A;  1ACV A;  2VAF A;  5EVO A;  4IP1 A;  1BG5 A;  3EVI A;  5HR2 A;  3BBY A;  1XFL A;  4TR4 A;  2IMK A;  1M7T A;  3LJR A;  3SWL A;  3D21 A;  2VD1 A;  1USB A;  2GT5 A;  1U87 A;  2LQO A;  4XCS A;  3FR9 A;  4IJI A;  1AC1 A;  2CVD A;  3GMF A;  4GTU A;  3HJO A;  4KSM A;  1Z3E A;  1VGL A;  1URM A;  3QPM A;  1RK4 A;  1GUM A;  4TR3 A;  1K0A A;  3Q74 A;  4AJ7 A;  3VPQ A;  3CTF A;  4IS0 A;  3GV1 A;  1A2M A;  2F8F A;  1NW2 A;  2H01 A;  2DIY A;  4XTS A;  5DAK B;  5F8B A;  1TK0 B;  1Q4J A;  3KCM A;  5C00 A;  5J9C A;  6GSU A;  1X5E A;  5JCG A;  1TP9 A;  3GN3 A;  5G5F A;  2AJQ B;  3EYT A;  4Z7X A;  2L59 A;  5CRG A;  2VCW A;  4ULX A;  4WET A;  4BVX A;  1W89 A;  3LEF A;  3G9B A;  1A2L A;  2FLS A;  1O8W A;  3WGE A;  5GAP D;  4F9Z A;  2VLU A;  5HFK A;  1LU4 A;  4ZBD A;  4JE1 A;  3BCI A;  1V40 A;  3DRN A;  5GST A;  4KX4 A;  5ECL B;  4J2F A;  3KIJ A;  2LUS A;  22GS A;  2CZ2 A;  4MLY A;  2BMX A;  2MBS A;  1V58 A;  2NTO A;  3CBU A;  3TKS A;  2L4Q A;  2VL3 A;  2XBQ A;  3J7Y b;  2YN1 A;  1VF2 A;  1RW1 A;  1WIK A;  4ZL7 A;  3VFI A;  6GSY A;  5CRE A;  1M99 A;  3A2X A;  1S3C A;  2H6Y A;  2VLV A;  5CAX A;  5J3R A;  3TGZ A;  5B7C A;  1X0R A;  3E3E A;  4F0B A;  2H74 A;  1WOU A;  4MZW A;  4Q5R A;  3JCM L;  3TRX A;  3TRP A;  2P31 A;  3TKS C;  1XBS A;  4V2N A;  2NBS A;  2LST A;  4E8H A;  3GL3 A;  5BMU A;  5AGY A;  4V1A p;  5D96 A;  3LWA A;  3F0I A;  3HVS A;  4ISD A;  4DSS A;  1K0N A;  3QCP A;  2HQT A;  5AN1 A;  2LJK A;  3FZ4 A;  2HZF A;  2L4C A;  2AUV A;  2C1Y A;  4FQU A;  4WR5 A;  5DQY A;  8GSS A;  4HQS A;  1GNE A;  4FH8 A;  3P7X A;  2B7J A;  1LJR A;  3MSZ A;  3H79 A;  2BTO T;  4OO5 A;  5CO3 A;  3PGT A;  1UA5 A;  4N30 A;  1QUW A;  3C71 A;  1KNG A;  4NMU A;  1PKW A;  2L6C A;  2XPD A;  2B7K A;  1R7H A;  2YWI A;  5FHI A;  2LEG A;  5L71 A;  1KBN A;  5CRW A;  3GL5 A;  2FGX A;  1N8J A;  4HDE A;  3ZIT A;  4LL1 B;  1I5G A;  4PUF C;  3UMA A;  2K6V A;  3QAG A;  1J08 A;  4KDX A;  4EVM A;  4K7N A;  3HXS A;  4GXZ A;  5LCZ A;  5HR3 A;  2I1U A;  2JSY A;  5ECI B;  2C3T A;  5CNW A;  1X9W B;  1MTC A;  5IMC A;  3ZL5 A;  1ABA A;  4KF9 A;  2V32 A;  5IMZ A;  1E2Y A;  4XRD A;  2QC7 A;  4RI7 A;  4FO5 A;  3TJF A;  3FZ5 A;  4F82 A;  1IYH A;  1GP1 A;  2DJ2 A;  5DDL A;  1R5P A;  4GST A;  9GSS A;  1HNC A;  2VCQ A;  3CRT A;  3RPN A;  2JZS A;  1E6B A;  5KEJ A;  1JLV A;  4USS A;  2H19 A;  4L8E A;  1T4Y A;  4IQ1 A;  2O8V B;  5JCU A;  2AB6 A;  3FY7 A;  3ERG A;  5IOX A;  1XWK A;  3RPP A;  4ZIJ A;  2HT9 A;  4FYB A;  5KN1 A;  1GSS A;  1ERU A;  1A0R P;  4WBR D;  1GNW A;  3VI5 A;  3RAZ A;  3Q19 A;  4Q5Q A;  2H76 A;  1XCC A;  1QK8 A;  1ZCP A;  2C3Q A;  2YWM A;  3C7M A;  4P3Y B;  5DJL A;  2HSM A;  3MWH A;  4QL7 A;  2E7P A;  1DBY A;  5DQS A;  2EIQ A;  3DIE A;  5B8B A;  2H0H A;  1WMJ A;  4RQX A;  4EF0 A;  3ZIJ A;  3IC8 A;  3LSZ A;  3F63 A;  2YJH A;  5GZZ B;  1TRV A;  1M9B A;  4XRA A;  1OC9 B;  2WZ9 A;  3EC3 A;  2QSI A;  2MMZ A;  1U3I A;  5IO0 A;  1RQM A;  4FYC A;  3ZZX A;  5IPH A;  4MDC A;  4EDZ A;  3L4N A;  4IGJ A;  4X43 A;  1ZYQ B;  1CQG A;  1QFN A;  2GQK A;  2WCI A;  2UZ8 A;  3F8U A;  2LJR A;  2C3N A;  1B4Q A;  5LNK e;  4V2L A;  3UL3 A;  3I69 A;  4WBJ A;  2LNS A;  5DAK A;  1SK1 A;  1K3O A;  5H5Q A;  1SKW B;  5HFG A;  2Z9S A;  4MH2 A;  4EC0 A;  2CVB A;  1HD2 A;  5CYY A;  4YH2 A;  2FNO A;  3I6A A;  4I2U A;  3L9V A;  2VL2 A;  3KMO A;  2K8S A;  2V6O A;  2AYT A;  4KE3 A;  2CVK A;  4ZB6 A;  2IMF A;  2B5E A;  3IRA A;  3TOT A;  3HZ8 A;  3ZVJ D;  2IME A;  4ZIL A;  3UJ1 A;  1G6W A;  3HJP A;  4IVF A;  3EUR A;  3DGQ A;  4WEY A;  3HZ4 A;  4EUY A;  1EV9 A;  2B5Y A;  3GX8 A;  3L9S A;  2VL2 C;  1K0B A;  2CA8 A;  1DSB A;  4KND A;  2TIR A;  2DML A;  5D9X A;  1BYE A;  5ELA A;  3IPZ A;  2H66 A;  3HYP A;  4RQR A;  3ZRD A;  2GSS A;  1AIU A;  2YZH A;  1NHY A;  2VIM A;  4DSR A;  2N5B A;  1SYR A;  5IQY A;  3WYW A;  1UVZ A;  3VK9 A;  4PNF A;  5D93 A;  3TKP A;  1MDK A;  1WWJ A;  1WJK A;  4I5Q A;  1EOH A;  1Z7R A;  2YAN A;  4MJE A;  1PSQ A;  3R2Q A;  1K0O A;  5IMA A;  4MF7 A;  3P8W A;  4G0I A;  3DVW A;  4G2E A;  1SYX A;  1TRU A;  5ECK B;  2REM A;  4K1F A;  4GWR A;  2FHE A;  3FRC A;  2YZU A;  5ID2 A;  4MJC A;  2MMO A;  4PQI A;  3QR6 A;  3EE2 A;  1EWX A;  2K8V A;  2HRA A;  3VI7 A;  2CX3 A;  3DYR A;  3W6G A;  1Z5Y E;  5CP1 A;  3TOU A;  3D6I A;  1O81 A;  1ZZY A;  1TU7 A;  3P2A A;  2B5X A;  4ECC A;  2OE1 A;  4OFN A;  5DCG A;  2MZC A;  4EE0 A;  1SD9 A;  3LYP A;  3NIV A;  1ZGN A;  1KTE A;  4KDU A;  2L57 A;  3AY8 A;  2EC4 A;  3WD6 A;  3G7J A;  3HA9 A;  4CHS A;  2MYG A;  1B9X C;  2H72 A;  4MK3 A;  5KN2 A;  2WFC A;  5EPF A;  2PN8 A;  5F05 A;  2AAW A;  3FKF A;  1B48 A;  3GKN A;  3GRX A;  2IPA A;  3UBL A;  2L6D A;  1GLP A;  3ZRE A;  4V1A g;  1K3Y A;  5JWR B;  4MPF A;  2E2M A;  3EU3 A;  3SBC A;  3CTG A;  4K9Z A;  4ZB8 A;  4KH7 A;  4TR1 B;  5DJM A;  3ERF A;  1EEJ A;  1XOA A;  5DCH A;  2C4J A;  3HD5 A;  4XS4 A;  1GSU A;  1ILO A;  2V1M A;  1XWA A;  4IEL A;  2O7K A;  3TDG A;  3IHQ A;  1ZL9 A;  3TKR A;  4HZ2 A;  1GH2 A;  2FCH A;  4K8M A;  2OE0 A;  3ZMK A;  1Z6N A;  3F6F A;  4V2M A;  1TKD B;  1VF1 A;  4KSO A;  3PPU A;  5H5S A;  4EXJ A;  4PUR A;  1K0D A;  2V41 A;  5IIZ A;  4GRF A;  1TOF A;  4EKZ A;  4DVC A;  3KP8 A;  1SJ6 A;  3FEU A;  4X1U A;  5B6M A;  1XWG A;  4N11 A;  2YWN A;  1V98 A;  1FW1 A;  3IC4 A;  5ECH B;  2H70 A;  2IWT A;  2GS3 A;  4XHM A;  2YWO A;  3U5R E;  1VF3 A;  2OJL A;  3M9J A;  1W4V A;  4G10 A;  1YKC A;  4PQH A;  3PR8 A;  2D2Z A;  5F0G A;  2LKU A;  4N0Z A;  2NVL A;  1TK5 B;  3U6V A;  1PMT A;  3NZN A;  4ZBB A;  1XOB A;  3GA4 A;  5D9V A;  1GSE A;  1K0C A;  2FA8 A;  1FOV A;  4LMW A;  2DJ3 A;  1JLW A;  1Z6M A;  2PUK C;  3D4T A;  3UBK A;  3GTU B;  4H86 A;  3GH9 A;  1M2D A;  2GSQ A;  5G30 A;  4MCU A;  5EL8 A;  1OKD A;  4JR4 A;  2GDR A;  4AF2 A;  2H6Z A;  3GH6 A;  2YNX A;  4GF0 A;  5DVB A;  1J9B A;  3ZFL A;  5JWO B;  1BAY A;  2FWE A;  2X99 A;  4I6X A;  5C04 A;  3RBT A;  3M0F A;  2OKA A;  2XPE A;  4K7O A;  5DAL B;  1AQX A;  4KAE A;  1FHE A;  3ZIV A;  1YY7 A;  2JZR A;  5G31 A;  1ML6 A;  2LQQ A;  1MD3 A;  2C0D A;  3MAK A;  3APQ A;  2DJ1 A;  1YKA A;  1A24 A;  6GSV A;  1EZK A;  3C1S A;  3QFB C;  1PRX A;  2DJ0 A;  3EMP A;  5B8A A;  4NXI A;  19GS A;  1SKR B;  2FWH A;  2BJX A;  1XXU A;  4HOJ A;  1X9M B;  2X8H A;  2I4A A;  4L0W A;  10GS A;  2H8L A;  3KEB A;  3F4T A;  1GL8 A;  1R5A A;  3A5W A;  3HJM A;  1JZR A;  2AHE A;  1V2A A;  2KP2 A;  3APS A;  3HCZ A;  2VOC A;  2H0I A;  4OO4 A;  2B1K A;  1PL2 A;  2R6K A;  2R3X A;  3VUR A;  3DML A;  3P90 A;  2CX4 A;  2KLX A;  3QAW A;  4OFM A;  3L0H A;  4I2T A;  3FHK A;  17GS A;  2VLT A;  5G2Z A;  2HRK B;  2B3S A;  3VLN A;  3HVX A;  1FVK A;  1S3D A;  2N5A A;  1NSW A;  3WGD A;  3KH9 A;  1NM3 A;  3FZA A;  3RDW A;  5HQP A;  2VD0 A;  1FB6 A;  2CZ3 A;  2OAD A;  4GCI A;  2O87 A;  1THX A;  3BOA A;  5GAN D;  4D73 B;  3Q6O A;  2WJU A;  3GSS A;  4HZ4 A;  4L0U A;  3UAR A;  1PQN A;  4TKY A;  2ON7 A;  5A4V A;  5ECM B;  4RI6 A;  3DD3 A;  2RLI A;  5A4W A;  1GLQ A;  1PL1 A;  4JRR A;  4ZL9 A;  5IMV A;  2H1G A;  5IM9 A;  4POB A;  2R37 A;  1PN9 A;  2JAD A;  4XS1 A;  4AJ6 A;  3F9U A;  2B6M A;  4E8E A;  2PVQ A;  14GS A;  4DEJ A;  1PX7 A;  2I3Y A;  4OFT A;  4GLT A;  4KW6 A;  4N0V A;  1ZMA A;  3H4K A;  3A2V A;  1TTZ A;  6GSX A;  5HR0 A;  1ST9 A;  5IPG A;  1R26 A;  2LNT A;  3S9F A;  3IXR A;  5D8I A;  4XIH A;  1WE0 A;  1DE2 A;  3VPT A;  4MZB A;  1T8E B;  1TI1 A;  1YEX A;  3LQ7 A;  3HVV A;  1ERW A;  1S3A A;  3GUS A;  3IV4 A;  3TJG A;  4MMM A;  2DBC A;  1QQ2 A;  1ON4 A;  4FIW A;  1OE8 A;  2VUP A;  4ECB A;  4PNG A;  5F06 A;  3GHA A;  4TR1 A;  2PGT A;  3H8Q A;  4Q5F A;  4DSQ A;  2IFQ B;  3MNG A;  1IYI A;  4K7I A;  4BVX B;  2C0G A;  4WF5 A;  4IN0 A;  1XW9 A;  3E9J B;  2A2S A;  1GTA A;  2DIZ A;  4OMV A;  1SD8 A;  2HRF A;  1M2B A;  3F3R A;  1FAA A;  5J41 A;  5F07 A;  3KZQ A;  3VWU A;  3LGC A;  2IN3 A;  4N10 A;  3LXZ A;  3GUR A;  1DE1 A;  1F9M A;  3UVT A;  3KD0 A;  4I8B A;  4TW5 A;  4POK A;  4CDO A;  1N2A A;  2J23 A;  4POL A;  3IAM 2;  3ZTL A;  2OAC A;  5E59 A;  4MP4 A;  3FR3 A;  1WP0 A;  1A2J A;  2PMT A;  4TVE A;  2GVP A;  4JR6 A;  2GZZ A;  4IP6 A;  2HNL A;  1OAZ A;  2LRC A;  3HY2 A;  3EIN A;  2L5O A;  2HE3 A;  3R3E A;  3N5O A;  1T3B A;  2FWG A;  4NV5 A;  3TKS E;  2K9F A;  3ZML A;  1EEM A;  3V1W A;  1SL0 B;  3APO A;  3CYN A;  3C8E A;  3QAV A;  3I43 A;  4HJ2 A;  5ECN B;  4WR4 A;  5DBQ A;  2MBT A;  4NV2 A;  5CRD A;  5J9B A;  1M2A A;  3NOF A;  5ECP B;  4ACS A;  5COH A;  1SKS B;  1JZD A;  4GSS A;  2RM6 A;  4G9H A;  3A3T A;  2PER A;  4DSS B;  5D9T A;  3F4R A;  2CT6 A;  4KCA A;  5INY A;  5IO2 A;  1GTB A;  3ZFB A;  4KDY A;  4AGS A;  1EOG A;  5H5R A;  2IMD A;  3IOS A;  4ILF A;  2VCZ A;  2HSH A;  1PX6 A;  3TCO A;  2PWJ A;  3LXT A;  3G7Y A;  1J0F A;  4FYU A;  2WB9 A;  3ISO A;  4HQZ A;  2F51 A;  4F03 A;  2MMA A;  4OCE A;  2PU9 C;  1G7E A;  2CAQ A;  1SK0 A;  1YDK A;  5IOW A;  3QMX A;  2VCX A;  2E0Q A;  2LJA A;  4ZXG A;  5E4W A;  3UOM A;  2H0G A;  2R2J A;  3M9K A;  1MDI A;  2ON5 A;  2GT6 A;  4ID0 A;  3QDN A;  4HJM A;  4TXO B;  1R4W A;  2RUE A;  2P0G A;  4XS6 A;  4ECI A;  3IE3 A;  3TJJ A;  1T7P B;  3O76 A;  2YOI A;  3FW2 A;  1EGO A;  2C0E A;  1X5C A;  3UIW A;  1SJI A;  4MAB A;  2GST A;  1TDI A;  3IR4 A;  1MDJ A;  2DJJ A;  4TOP A;  16GS A;  2WDU A;  1ZOF A;  1GUK A;  2HRK A;  1F3A A;  2JSZ A;  1B9Y C;  1T4Z A;  1BED A;  2P5Q A;  4K0G A;  2QKE A;  2ZNM A;  2VCT A;  3CSI A;  2FY6 A;  1HNB A;  2DSA A;  4JZQ A;  1LBK A;  2AV4 A;  4D73 A;  2LTK A;  5AIS A;  1XVQ A;  4BWQ A;  1T1V A;  20GS A;  1F37 A;  2OBI A;  1A23 A;  4YQU A;  3QFA C;  2IIY A;  1HNA A;  1QMV A;  3W8S A;  2O85 A;  4KUN A;  3ME8 A;  2HSM B;  1YQ1 A;  4LA1 A;  4F0C A;  5D9W A;  4L5O A;  4IW9 A;  4PGT A;  5A4U A;  13GS A;  4Q5N A;  2CQ9 A;  2ZCT A;  5KN0 A;  1JZW A;  1XVW A;  4BVY B;  4PUA A;  4JU5 A;  3VWW A;  3EWL A;  2IJY A;  1VF4 A;  3GKK A;  2O89 A;  4QQ7 A;  2WS2 A;  2RII A;  4G19 A;  2CV4 A;  2V6K A;  1GTI A;  1U88 A;  2L5L A;  2KHP A;  2MMN A;  4ZB9 A;  1PKZ A;  1G0T A;  1YEP A;  2PBJ A;  3IA1 A;  1O85 A;  1PA3 A;  2VM2 A;  3D22 A;  5D73 A;  1JFU A;  1FB0 A;  5CRH A;  2XBI A;  1SJZ A;  2RM5 A;  1GUH A;  4YAP A;  2KUC A;  5AIX A;  1T00 A;  2E2G A;  4NWY A;  2XC2 A;  4IBP A;  1XWC A;  2FA4 A;  1PGT A;  2IFQ A;  4J57 E;  5A5K A;  1OC9 A;  2M46 A;  2VO4 A;  4QL9 A;  5AIV A;  2YPM A;  3GFK A;  2K18 A;  2LRT A;  5JWQ B;  4HI7 A;  4K2D A;  4WXT A;  1B4P A;  3TJB A;  1THO A;  5ECR B;  2TRC P;  3O6T A;  1MD4 A;  3Q18 A;  1SEN A;  4F2I A;  4G0L A;  1SK2 A;  2CAI A;  1A0F A; 
#chains in the Genus database with same CATH topology
 2V2G A;  2R4V A;  2HXK A;  2HLS A;  5HFI A;  4PX1 A;  3F6D A;  4MZC A;  4ZB7 A;  5A5H A;  1TJD A;  2H6X A;  2HYX A;  2M80 A;  2GQM A;  2JU5 A;  1QXH A;  2XHF A;  4O5R A;  4O92 A;  4BPY A;  3EU4 A;  1TRS A;  3ZVJ A;  4BL7 B;  1EV4 A;  2G2Q A;  4NHZ A;  3HDC A;  1XW5 A;  4MNN A;  4PXO A;  3GIX A;  4G0K A;  3WGX A;  1SL1 B;  1X5D A;  3D0Z A;  2VCV A;  6GSW A;  2IMI A;  3PH9 A;  3GKX A;  2HRN A;  7GSS A;  4YAV A;  5J4U A;  4HU7 A;  5IMF A;  1M0U A;  1JZO A;  2WVZ A;  3M3M A;  4ZL8 A;  1EP8 A;  4AJ8 A;  1OC8 A;  1H75 A;  1XIY A;  2HFD A;  4EIQ A;  2KOK A;  2PVO C;  2F3M A;  3TRQ A;  2PPT A;  3RHB A;  3GNJ A;  2LRN A;  3FK8 A;  1HYU A;  1O6J A;  5G1L A;  2F8A A;  2HZE B;  1C72 A;  4GQF A;  3LG6 A;  2GTU A;  4KB3 A;  5ID2 B;  3L9U A;  3PIN A;  2H1D A;  6GSS A;  3I9V 2;  3DKS A;  3VWX A;  3DEX A;  3DVX A;  4WKW A;  4A5P A;  4ML1 A;  2FUG 2;  3D5J A;  3FZ9 A;  4MF5 A;  2NDO A;  1SL2 B;  1G6Y A;  1PD2 1;  3LYK A;  2H1L A;  2C8U A;  3ED3 A;  1UN2 A;  3CMI A;  2FD3 A;  2GZP A;  4BWS A;  3CSJ A;  1GSQ A;  2GSR A;  5ENU A;  2VL9 A;  2A2R A;  2G0F A;  5G1K A;  3CWG A;  2J9H A;  1GWC A;  2ES7 A;  4EDY A;  2YCD A;  1QGV A;  1A8L A;  1KEB A;  3ZYW A;  1OYJ A;  1O7U A;  1Q98 A;  4LMV A;  4MA9 A;  12GS A;  4TXO A;  3DWV A;  2EIR A;  1YZX A;  2DLX A;  3WT2 A;  5LD0 A;  1FO5 A;  2M72 A;  2YV7 A;  2IL3 A;  4MF6 A;  5EY6 A;  3GX0 A;  4X0X A;  2P5R A;  4PI2 C;  3ZLP A;  2X8C A;  1YEW C;  1FVJ A;  1A8Y A;  2EIO A;  5KOX A;  2GLR A;  4MJA A;  3CXG A;  3FMW A;  3ERW A;  2YJ7 A;  2LS5 A;  3UAP A;  4L5L A;  5ECQ B;  5B6N A;  4HEA 2;  4XS4 B;  3CRU A;  1XPV A;  2GZY A;  1I9D A;  2LV3 A;  2HI7 A;  4JBB A;  1AXD A;  4IHU A;  3BD2 A;  3E0U A;  2DJK A;  3HHV A;  3KM6 A;  1OVN A;  4I97 A;  3W8J A;  3C73 A;  3US3 A;  2I81 A;  5JCW A;  2JAC A;  4OD7 A;  5GSS A;  2R5G A;  3A2W A;  4JED A;  3KGK A;  3OR5 A;  1TXX A;  3WT1 A;  3F4S A;  1V9W A;  4POM A;  4MJB A;  1UC7 A;  5KN3 A;  4TR0 A;  4TRX A;  1FOH A;  3UVH A;  3IDV A;  1BQ7 A;  6GST A;  3FR6 A;  2GQL A;  2C0F A;  1EGR A;  2H75 A;  1U3A A;  1YF0 A;  3DXB A;  4BA7 A;  3TUE A;  4BVY A;  4HU9 A;  1YF1 A;  1K3L A;  4MH3 A;  3QOU A;  1AW9 A;  1GSF A;  1TW9 A;  4ML6 A;  2GGT A;  4K6X A;  1YJ6 A;  4NAX A;  4KA0 A;  4O7H A;  4HSC X;  2ZUP A;  1NHO A;  3FYG A;  11GS A;  1ZYE A;  3KH7 A;  5KOW A;  1H4O A;  1BJX A;  3N9J A;  1XWB A;  3MIX A;  3EMX A;  4TN8 A;  1Z9H A;  5HR1 A;  3HKR A;  3KXO A;  5J5N A;  4J56 E;  2OBK A;  1BX9 A;  3KTL A;  1XG8 A;  3H93 A;  1GSY A;  3F3Q A;  2YV9 A;  4EL1 A;  4YQM A;  1CQH A;  1TU8 A;  3GST A;  4WF4 A;  3GYK A;  3BJ5 A;  1Y6E A;  1OKT A;  1AQV A;  1HQO A;  3GKM A;  2HSN B;  5IMD A;  3GTU A;  5ABR A;  1G7O A;  2H1A A;  5FT3 A;  1ERT A;  4CW9 A;  1WRY A;  3KMN A;  1FG4 A;  3KTB A;  1AUC A;  2DMM A;  1AQW A;  18GS A;  2H71 A;  2OE3 A;  2DC5 A;  3CSH A;  4ECJ A;  3M8N A;  5DAL A;  1OC3 A;  4MPG A;  3C1R A;  5G5E A;  1O73 A;  4HUA A;  4BL7 A;  3LFL A;  2JZT A;  1K0M A;  3O3T A;  3QD9 A;  1TK8 B;  2TRX A;  3BCK A;  2N5F A;  2JL4 A;  3L78 A;  4PQ1 A;  3LW9 A;  1EP7 A;  2A4V A;  2WRT A;  1JHB A;  1X9S B;  3D4M A;  1V57 A;  1VRS D;  3VWV A;  4IJ3 A;  1GRX A;  2OA7 A;  3IAS 2;  3TKQ A;  3KP9 A;  4O32 A;  2F9S A;  2R0G A;  2RUF A;  4OWY A;  5FWG A;  3IBH A;  1TRW A;  3J7Y k;  2YP6 A;  4GSN A;  3MDK A;  1U6T A;  3LOR A;  3IK7 A;  2WGR A;  1B8X A;  1GTU A;  1XW6 A;  3A5I A;  4GQC A;  4LLR A;  5J47 A;  2HZE A;  1SU9 A;  4HS1 A;  5ELG A;  4YQV A;  4TXV A;  3K8N A;  1M9A A;  2ALB A;  4BIK A;  1XZO A;  1AAZ A;  4NHW A;  4RUV A;  3M1G A;  2B1L A;  3RHC A;  1TI3 A;  2I9H A;  3IK9 A;  5A34 A;  1MEK A;  1YVL A;  3H1N A;  2QGV A;  2WUL A;  2HSY A;  2H73 A;  1F3B A;  4KGI A;  1O8X A;  5ECO B;  1F6M C;  4LL4 B;  3KJY A;  2VM1 A;  3ME7 A;  4IQA A;  1Y25 A;  5ECS A;  2X64 A;  4EO3 A;  3TJK A;  2H30 A;  2KP1 A;  2C80 A;  4ZBA A;  4IKH A;  4K0N A;  3UEM A;  4OCF A;  1DUG A;  2H1B A;  4KCE A;  2FWF A;  4N3Z A;  1Z7P A;  2X8G A;  1F2E A;  1GUL A;  1OE7 A;  1ERV A;  3TB2 A;  1WPI A;  1GSD A;  2NPB A;  4PTS A;  3G7I A;  4NPB A;  1ACV A;  1M3I A;  2VAF A;  5EVO A;  4IP1 A;  1BG5 A;  3EVI A;  5HR2 A;  3BBY A;  1Y1U A;  1XFL A;  4TR4 A;  2IMK A;  1M7T A;  3LJR A;  3SWL A;  3D21 A;  2VD1 A;  1USB A;  2GT5 A;  1U87 A;  2LQO A;  4XCS A;  3FR9 A;  4IJI A;  1AC1 A;  2CVD A;  3GMF A;  4GTU A;  3HJO A;  4KSM A;  1Z3E A;  1VGL A;  1URM A;  3QPM A;  1RK4 A;  1GUM A;  4TR3 A;  1K0A A;  3Q74 A;  4AJ7 A;  3VPQ A;  3CTF A;  4IS0 A;  3GV1 A;  1A2M A;  2F8F A;  1NW2 A;  2H01 A;  2DIY A;  4XTS A;  5DAK B;  5F8B A;  1TK0 B;  1Q4J A;  3KCM A;  5C00 A;  5J9C A;  6GSU A;  1X5E A;  5JCG A;  4AKI A;  1TP9 A;  3GN3 A;  5G5F A;  2AJQ B;  3EYT A;  4Z7X A;  2L59 A;  5CRG A;  2OT3 A;  2VCW A;  4ULX A;  4WET A;  4BVX A;  1W89 A;  3LEF A;  3G9B A;  3CHX C;  1A2L A;  2FLS A;  1O8W A;  3WGE A;  5GAP D;  4F9Z A;  2VLU A;  5HFK A;  1LU4 A;  4ZBD A;  4JE1 A;  3BCI A;  1V40 A;  3DRN A;  5GST A;  4KX4 A;  5ECL B;  4J2F A;  3KIJ A;  2LUS A;  22GS A;  2CZ2 A;  4MLY A;  2BMX A;  2MBS A;  1V58 A;  3EPT A;  2NTO A;  3CBU A;  3TKS A;  2L4Q A;  2VL3 A;  2XBQ A;  3J7Y b;  2YN1 A;  1VF2 A;  1RW1 A;  1WIK A;  1PFO A;  4ZL7 A;  3VFI A;  6GSY A;  5CRE A;  1M99 A;  3A2X A;  1S3C A;  2H6Y A;  2A2P A;  4X4J A;  2VLV A;  5CAX A;  5J3R A;  3TGZ A;  5B7C A;  1X0R A;  3E3E A;  4F0B A;  2O36 A;  2H74 A;  1WOU A;  4MZW A;  4Q5R A;  3JCM L;  3TRX A;  3TRP A;  2P31 A;  3TKS C;  1XBS A;  4V2N A;  4W66 A;  2HSN A;  5A1N B;  4AI6 A;  2NBS A;  2LST A;  4E8H A;  3GL3 A;  5BMU A;  5AGY A;  4V1A p;  5D96 A;  3LWA A;  3F0I A;  3HVS A;  4ISD A;  4DSS A;  1K0N A;  3QCP A;  2HQT A;  5AN1 A;  2LJK A;  3FZ4 A;  2HZF A;  2L4C A;  2AUV A;  2C1Y A;  4FQU A;  4WR5 A;  5DQY A;  8GSS A;  4HQS A;  1GNE A;  4FH8 A;  3P7X A;  2B7J A;  1LJR A;  3MSZ A;  3H79 A;  4QMK A;  2BTO T;  4OO5 A;  5CO3 A;  3PGT A;  1UA5 A;  4N30 A;  1QUW A;  3C71 A;  1KNG A;  4NMU A;  1PKW A;  1M3J A;  2L6C A;  2XPD A;  2B7K A;  1R7H A;  2YWI A;  5FHI A;  2LEG A;  5L71 A;  1KBN A;  4K5S A;  5CRW A;  3GL5 A;  2FGX A;  1N8J A;  4HDE A;  3ZIT A;  4LL1 B;  1I5G A;  4PUF C;  3UMA A;  2K6V A;  3QAG A;  1J08 A;  4KDX A;  4EVM A;  2UV8 G;  4K7N A;  3HXS A;  4GXZ A;  5LCZ A;  5HR3 A;  2I1U A;  2JSY A;  5ECI B;  2C3T A;  3HVN A;  5CNW A;  1X9W B;  1MTC A;  5IMC A;  3ZL5 A;  1ABA A;  4KF9 A;  2V32 A;  4GDF A;  5IMZ A;  1E2Y A;  2WVX B;  4XRD A;  2QC7 A;  4RI7 A;  4FO5 A;  3TJF A;  3FZ5 A;  4F82 A;  1IYH A;  1GP1 A;  2DJ2 A;  5DDL A;  1R5P A;  4GST A;  9GSS A;  1HNC A;  2VCQ A;  3CRT A;  3RPN A;  2JZS A;  1E6B A;  5KEJ A;  1JLV A;  4USS A;  2H19 A;  4L8E A;  1T4Y A;  4IQ1 A;  2O8V B;  5JCU A;  2AB6 A;  3FY7 A;  3ERG A;  2WW0 A;  5IOX A;  1XWK A;  3RPP A;  2WW2 A;  4ZIJ A;  2HT9 A;  4FYB A;  5KN1 A;  1GSS A;  1ERU A;  1A0R P;  4WBR D;  1GNW A;  3VI5 A;  3RAZ A;  3Q19 A;  4Q5Q A;  2H76 A;  1XCC A;  1QK8 A;  1ZCP A;  2C3Q A;  2YWM A;  3C7M A;  4P3Y B;  5DJL A;  2HSM A;  3MWH A;  4QL7 A;  2E7P A;  1SVO A;  1DBY A;  5DQS A;  2EIQ A;  3DIE A;  5B8B A;  2H0H A;  1WMJ A;  4RQX A;  4EF0 A;  3ZIJ A;  3IC8 A;  3LSZ A;  3F63 A;  2YJH A;  5GZZ B;  1TRV A;  1M9B A;  4XRA A;  1OC9 B;  2WZ9 A;  3EC3 A;  2QSI A;  2MMZ A;  1U3I A;  5IO0 A;  1RQM A;  4FYC A;  3ZZX A;  5IPH A;  4MDC A;  4EDZ A;  3L4N A;  4IGJ A;  4X43 A;  1ZYQ B;  1CQG A;  1QFN A;  2WVY A;  2GQK A;  2WCI A;  2UZ8 A;  3F8U A;  2LJR A;  2C3N A;  2EFE A;  1B4Q A;  5LNK e;  4V2L A;  3UL3 A;  3I69 A;  4WBJ A;  5A5H B;  2LNS A;  5DAK A;  1SK1 A;  1K3O A;  5H5Q A;  1SKW B;  5HFG A;  2Z9S A;  4MH2 A;  4EC0 A;  2CVB A;  1HD2 A;  5CYY A;  4YH2 A;  2FNO A;  3I6A A;  4I2U A;  3L9V A;  2VL2 A;  3KMO A;  2K8S A;  2V6O A;  2AYT A;  4KE3 A;  2CVK A;  4ZB6 A;  2IMF A;  2B5E A;  3IRA A;  3TOT A;  3HZ8 A;  3ZVJ D;  2IME A;  4ZIL A;  3UJ1 A;  1G6W A;  3HJP A;  4IVF A;  3EUR A;  3DGQ A;  4WEY A;  2X49 A;  3HZ4 A;  4EUY A;  1EV9 A;  2B5Y A;  3GX8 A;  3L9S A;  2VL2 C;  1K0B A;  2CA8 A;  1DSB A;  4KND A;  2TIR A;  2DML A;  5D9X A;  1BYE A;  5ELA A;  3IPZ A;  2H66 A;  3HYP A;  4RQR A;  3ZRD A;  2GSS A;  1AIU A;  2YZH A;  1NHY A;  2VIM A;  4DSR A;  2N5B A;  1SYR A;  5IQY A;  3WYW A;  1UVZ A;  3VK9 A;  4PNF A;  5D93 A;  3TKP A;  1MDK A;  1WWJ A;  1WJK A;  2QA2 A;  4I5Q A;  1EOH A;  2VKZ G;  1Z7R A;  2YAN A;  4MJE A;  1PSQ A;  3R2Q A;  1K0O A;  5IMA A;  4MF7 A;  3P8W A;  4G0I A;  3DVW A;  4G2E A;  1SYX A;  1TRU A;  5ECK B;  2REM A;  4K1F A;  4GWR A;  2FHE A;  3FRC A;  2YZU A;  5ID2 A;  4MJC A;  2MMO A;  4PQI A;  3QR6 A;  3EE2 A;  1EWX A;  2K8V A;  2HRA A;  3VI7 A;  2CX3 A;  3DYR A;  3W6G A;  1Z5Y E;  5CP1 A;  3TOU A;  3D6I A;  1O81 A;  2O3E A;  1ZZY A;  1TU7 A;  3P2A A;  2B5X A;  4ECC A;  2OE1 A;  4OFN A;  5DCG A;  2MZC A;  4EE0 A;  1SD9 A;  3LYP A;  3NIV A;  1ZGN A;  2EFD A;  1KTE A;  4KDU A;  2L57 A;  3AY8 A;  2WW3 A;  3HMJ G;  5BRT A;  4Z2T A;  2EC4 A;  3WD6 A;  3G7J A;  3HA9 A;  4CHS A;  2MYG A;  1B9X C;  2H72 A;  4MK3 A;  5KN2 A;  2WFC A;  5EPF A;  2PN8 A;  5F05 A;  2AAW A;  3FKF A;  1B48 A;  3GKN A;  3GRX A;  2IPA A;  3UBL A;  2L6D A;  1GLP A;  3ZRE A;  4V1A g;  1K3Y A;  3IHG A;  5JWR B;  4MPF A;  2E2M A;  3EU3 A;  3SBC A;  3CTG A;  4K9Z A;  4ZB8 A;  4KH7 A;  4TR1 B;  5DJM A;  3ERF A;  1EEJ A;  1XOA A;  5DCH A;  2C4J A;  3HD5 A;  4XS4 A;  1GSU A;  1ILO A;  2V1M A;  1XWA A;  4IEL A;  2O7K A;  3TDG A;  1N25 A;  3IHQ A;  1ZL9 A;  3TKR A;  4HZ2 A;  1GH2 A;  2FCH A;  4K8M A;  2OE0 A;  3ZMK A;  1Z6N A;  3F6F A;  4V2M A;  1TKD B;  1VF1 A;  2EFC A;  4KSO A;  3PPU A;  3RGB C;  5H5S A;  4EXJ A;  4PUR A;  1K0D A;  2V41 A;  5IIZ A;  4GRF A;  1TOF A;  4EKZ A;  4DVC A;  3KP8 A;  1SJ6 A;  3FEU A;  4X1U A;  5B6M A;  1XWG A;  4N11 A;  2YWN A;  1V98 A;  1FW1 A;  3IC4 A;  5ECH B;  2H70 A;  2IWT A;  2GS3 A;  4XHM A;  2YWO A;  3U5R E;  1VF3 A;  2OJL A;  3M9J A;  1S3R A;  1W4V A;  4G10 A;  1YKC A;  4PQH A;  3PR8 A;  2D2Z A;  5F0G A;  2LKU A;  4N0Z A;  2NVL A;  1TK5 B;  3U6V A;  1PMT A;  3NZN A;  4ZBB A;  1XOB A;  3GA4 A;  5D9V A;  1GSE A;  1K0C A;  2FA8 A;  1FOV A;  4LMW A;  2DJ3 A;  1JLW A;  1Z6M A;  2PUK C;  3D4T A;  2DKI A;  3UBK A;  4ICY A;  3GTU B;  4YKG A;  4H86 A;  3GH9 A;  1M2D A;  2GSQ A;  5G30 A;  4MCU A;  5EL8 A;  1OKD A;  4Z2R A;  4JR4 A;  2GDR A;  4AF2 A;  2H6Z A;  3GH6 A;  2YNX A;  4GF0 A;  5DVB A;  1J9B A;  3ZFL A;  5JWO B;  1BAY A;  2FWE A;  2X99 A;  4I6X A;  5C04 A;  3RBT A;  3M0F A;  2OKA A;  2XPE A;  4K7O A;  5DAL B;  1AQX A;  4KAE A;  1FHE A;  4CY6 A;  3ZIV A;  1YY7 A;  2JZR A;  5G31 A;  1ML6 A;  2LQQ A;  4AKH A;  1MD3 A;  2C0D A;  3MAK A;  3RFR C;  3APQ A;  2DJ1 A;  4Z2U A;  1YKA A;  1A24 A;  6GSV A;  1EZK A;  3C1S A;  4CY8 A;  3QFB C;  1PRX A;  2DJ0 A;  3EMP A;  5B8A A;  4NXI A;  19GS A;  4AKG A;  1SKR B;  2FWH A;  2BJX A;  1XXU A;  2X4A A;  4HOJ A;  1X9M B;  2X8H A;  2I4A A;  4L0W A;  10GS A;  2H8L A;  3KEB A;  3F4T A;  1GL8 A;  1R5A A;  3A5W A;  3HJM A;  1JZR A;  2AHE A;  1V2A A;  2KP2 A;  3APS A;  3HCZ A;  2VOC A;  2H0I A;  4OO4 A;  2B1K A;  2EFH A;  1PL2 A;  2R6K A;  2R3X A;  3VUR A;  3DML A;  3P90 A;  2CX4 A;  2KLX A;  3QAW A;  4OFM A;  3L0H A;  4I2T A;  5A34 B;  3FHK A;  17GS A;  5J4Y A;  2VLT A;  5G2Z A;  2HRK B;  2B3S A;  3VLN A;  3HVX A;  1FVK A;  1S3D A;  2N5A A;  1NSW A;  3WGD A;  3KH9 A;  1NM3 A;  3FZA A;  3RDW A;  5HQP A;  2VD0 A;  1FB6 A;  2CZ3 A;  2OAD A;  4GCI A;  2O87 A;  1THX A;  3BOA A;  5GAN D;  4D73 B;  3Q6O A;  2WJU A;  3GSS A;  4HZ4 A;  4L0U A;  1SVL A;  3UAR A;  1PQN A;  4TKY A;  2ON7 A;  5A4V A;  5ECM B;  4RI6 A;  3DD3 A;  2RLI A;  5A4W A;  1GLQ A;  1PL1 A;  4JRR A;  4ZL9 A;  5IMV A;  2H1G A;  5IM9 A;  4POB A;  2R37 A;  1PN9 A;  2JAD A;  4XS1 A;  4AJ6 A;  3F9U A;  2B6M A;  4E8E A;  2PVQ A;  14GS A;  4FXY P;  3MYD A;  4DEJ A;  1PX7 A;  4PI0 C;  4OFT A;  2I3Y A;  4GLT A;  1BG1 A;  4KW6 A;  4N0V A;  1ZMA A;  3H4K A;  3A2V A;  1TTZ A;  6GSX A;  5HR0 A;  1ST9 A;  5IPG A;  1R26 A;  2LNT A;  3S9F A;  3IXR A;  5D8I A;  2DKH A;  4XIH A;  1WE0 A;  1DE2 A;  3VPT A;  4MZB A;  1T8E B;  1TI1 A;  1YEX A;  3LQ7 A;  3TU3 B;  3HVV A;  1ERW A;  1S3A A;  3GUS A;  3IV4 A;  3TJG A;  4MMM A;  2DBC A;  1QQ2 A;  1ON4 A;  4FIW A;  1OE8 A;  1BF5 A;  2VUP A;  4ECB A;  4PNG A;  5F06 A;  3GHA A;  4TR1 A;  2PGT A;  3H8Q A;  4Q5F A;  4DSQ A;  2IFQ B;  3MNG A;  1IYI A;  4K7I A;  4BVX B;  2C0G A;  4WF5 A;  4IN0 A;  1XW9 A;  3E9J B;  2A2S A;  1GTA A;  2DIZ A;  4OMV A;  1SD8 A;  2HRF A;  1M2B A;  3F3R A;  1FAA A;  4AKX B;  5J41 A;  5F07 A;  3KZQ A;  3VWU A;  3LGC A;  2IN3 A;  4N10 A;  3LXZ A;  3GUR A;  1DE1 A;  1F9M A;  3UVT A;  3KD0 A;  4I8B A;  4TW5 A;  4POK A;  4CDO A;  1N2A A;  2J23 A;  4K2X A;  4POL A;  3IAM 2;  3ZTL A;  2OAC A;  5E59 A;  4MP4 A;  2WW1 A;  3FR3 A;  1WP0 A;  1A2J A;  2PMT A;  4TVE A;  2GVP A;  4JR6 A;  2GZZ A;  4IP6 A;  2HNL A;  1OAZ A;  2LRC A;  3HY2 A;  3EIN A;  2L5O A;  2HE3 A;  2A4H A;  3R3E A;  3N5O A;  1T3B A;  2FWG A;  4NV5 A;  3TKS E;  2K9F A;  3ZML A;  1EEM A;  3V1W A;  1SL0 B;  3APO A;  3CYN A;  3C8E A;  3QAV A;  3I43 A;  4HJ2 A;  5ECN B;  4WR4 A;  5DBQ A;  2MBT A;  4NV2 A;  5CRD A;  5J9B A;  1M2A A;  3NOF A;  5ECP B;  4ACS A;  5COH A;  1SKS B;  1JZD A;  4GSS A;  1I1I P;  4YKF A;  2RM6 A;  5BMU B;  4G9H A;  3A3T A;  2PER A;  4DSS B;  5D9T A;  3F4R A;  2CT6 A;  4KCA A;  4G01 A;  5INY A;  5IO2 A;  1GTB A;  3ZFB A;  4KDY A;  4AGS A;  1EOG A;  5H5R A;  2IMD A;  3IOS A;  4ILF A;  2VCZ A;  2HSH A;  1PX6 A;  3TCO A;  1SVM A;  2O5V A;  2PWJ A;  3LXT A;  3G7Y A;  1J0F A;  4FYU A;  4O5Q A;  1S4B P;  5J4V A;  2WB9 A;  3ISO A;  4HQZ A;  2F51 A;  4F03 A;  2MMA A;  4OCE A;  2PU9 C;  1G7E A;  2CAQ A;  1SK0 A;  1YDK A;  5A1N A;  5IOW A;  3QMX A;  2WZS A;  2R0C A;  1PN0 A;  2VCX A;  2E0Q A;  2LJA A;  4ZXG A;  5E4W A;  3UOM A;  2H0G A;  2R2J A;  3M9K A;  1MDI A;  2ON5 A;  2GT6 A;  4ID0 A;  3QDN A;  1ZYN A;  4HJM A;  4TXO B;  1R4W A;  2RUE A;  2P0G A;  4XS6 A;  4EIP A;  4ECI A;  3IE3 A;  3TJJ A;  1T7P B;  3O76 A;  2YOI A;  2QA1 A;  3FW2 A;  1EGO A;  4E68 A;  2C0E A;  1X5C A;  3UIW A;  1SJI A;  4MAB A;  3CQF A;  2GST A;  1TDI A;  3IR4 A;  1MDJ A;  2DJJ A;  4TOP A;  16GS A;  2WDU A;  1ZOF A;  1GUK A;  2HRK A;  1F3A A;  2JSZ A;  1B9Y C;  1T4Z A;  1BED A;  2P5Q A;  4K0G A;  2QKE A;  2ZNM A;  2VCT A;  3CSI A;  2FY6 A;  1HNB A;  2DSA A;  4JZQ A;  1LBK A;  2AV4 A;  4D73 A;  2LTK A;  5AIS A;  1XVQ A;  4BWQ A;  1T1V A;  20GS A;  2WVX A;  1F37 A;  2OBI A;  1A23 A;  4YQU A;  3QFA C;  2IIY A;  1HNA A;  1QMV A;  3W8S A;  2O85 A;  2R0P A;  4KUN A;  3ME8 A;  2HSM B;  1YQ1 A;  5J40 A;  4LA1 A;  4F0C A;  1ZYP A;  5D9W A;  4L5O A;  4IW9 A;  4PGT A;  5A4U A;  13GS A;  4Q5N A;  2CQ9 A;  2ZCT A;  5KN0 A;  1JZW A;  1XVW A;  4BVY B;  4PUA A;  4JU5 A;  3VWW A;  3EWL A;  2IJY A;  1VF4 A;  4PHZ C;  3GKK A;  2O89 A;  4QQ7 A;  2WS2 A;  2RII A;  4G19 A;  2CV4 A;  2V6K A;  1GTI A;  1U88 A;  2L5L A;  2KHP A;  2MMN A;  4ZB9 A;  1PKZ A;  1G0T A;  1YEP A;  2PBJ A;  3IA1 A;  1O85 A;  1PA3 A;  2VM2 A;  3D22 A;  5D73 A;  1JFU A;  1FB0 A;  5CRH A;  2XBI A;  1SJZ A;  2RM5 A;  1GUH A;  4YAP A;  2KUC A;  5AIX A;  1T00 A;  2E2G A;  4NWY A;  2XC2 A;  4IBP A;  1XWC A;  2FA4 A;  1PGT A;  2IFQ A;  4J57 E;  5A5K A;  1OC9 A;  2M46 A;  2VO4 A;  4QL9 A;  5AIV A;  2YPM A;  4O5U A;  3GFK A;  2K18 A;  2LRT A;  5JWQ B;  4HI7 A;  4K2D A;  4WXT A;  1B4P A;  3TJB A;  1THO A;  5ECR B;  1TXU A;  2TRC P;  3O6T A;  1MD4 A;  3Q18 A;  1SEN A;  4F2I A;  4K5R A;  4G0L A;  1SK2 A;  2CAI A;  1A0F A; 
#chains in the Genus database with same CATH homology
 2V2G A;  2R4V A;  2HXK A;  2HLS A;  5HFI A;  4PX1 A;  3F6D A;  4MZC A;  4ZB7 A;  5A5H A;  1TJD A;  2H6X A;  2HYX A;  2M80 A;  2GQM A;  2JU5 A;  1QXH A;  2XHF A;  4O5R A;  4O92 A;  4BPY A;  3EU4 A;  1TRS A;  3ZVJ A;  4BL7 B;  1EV4 A;  2G2Q A;  4NHZ A;  3HDC A;  1XW5 A;  4MNN A;  4PXO A;  3GIX A;  4G0K A;  3WGX A;  1SL1 B;  1X5D A;  3D0Z A;  2VCV A;  6GSW A;  2IMI A;  3PH9 A;  3GKX A;  2HRN A;  7GSS A;  4YAV A;  5J4U A;  4HU7 A;  5IMF A;  1M0U A;  1JZO A;  3M3M A;  4ZL8 A;  1EP8 A;  4AJ8 A;  1OC8 A;  1H75 A;  1XIY A;  2HFD A;  4EIQ A;  2KOK A;  2PVO C;  2F3M A;  3TRQ A;  2PPT A;  3RHB A;  3GNJ A;  2LRN A;  3FK8 A;  1HYU A;  1O6J A;  5G1L A;  2F8A A;  2HZE B;  1C72 A;  4GQF A;  3LG6 A;  2GTU A;  4KB3 A;  5ID2 B;  3L9U A;  3PIN A;  2H1D A;  6GSS A;  3I9V 2;  3DKS A;  3VWX A;  3DEX A;  3DVX A;  4WKW A;  4A5P A;  4ML1 A;  2FUG 2;  3D5J A;  3FZ9 A;  4MF5 A;  2NDO A;  1SL2 B;  1G6Y A;  1PD2 1;  3LYK A;  2H1L A;  2C8U A;  3ED3 A;  1UN2 A;  3CMI A;  2FD3 A;  2GZP A;  4BWS A;  3CSJ A;  1GSQ A;  2GSR A;  5ENU A;  2VL9 A;  2A2R A;  2G0F A;  5G1K A;  3CWG A;  2J9H A;  1GWC A;  2ES7 A;  4EDY A;  2YCD A;  1QGV A;  1A8L A;  1KEB A;  3ZYW A;  1OYJ A;  1O7U A;  1Q98 A;  4LMV A;  4MA9 A;  12GS A;  4TXO A;  3DWV A;  2EIR A;  1YZX A;  2DLX A;  3WT2 A;  5LD0 A;  1FO5 A;  2M72 A;  2YV7 A;  2IL3 A;  4MF6 A;  5EY6 A;  3GX0 A;  4X0X A;  2P5R A;  3ZLP A;  2X8C A;  1FVJ A;  1A8Y A;  2EIO A;  5KOX A;  2GLR A;  4MJA A;  3CXG A;  3FMW A;  3ERW A;  2YJ7 A;  2LS5 A;  3UAP A;  4L5L A;  5ECQ B;  5B6N A;  4HEA 2;  4XS4 B;  3CRU A;  1XPV A;  2GZY A;  1I9D A;  2LV3 A;  2HI7 A;  4JBB A;  1AXD A;  4IHU A;  3BD2 A;  3E0U A;  2DJK A;  3HHV A;  3KM6 A;  1OVN A;  4I97 A;  3W8J A;  3C73 A;  3US3 A;  2I81 A;  5JCW A;  2JAC A;  4OD7 A;  5GSS A;  2R5G A;  3A2W A;  4JED A;  3KGK A;  3OR5 A;  1TXX A;  3WT1 A;  3F4S A;  1V9W A;  4POM A;  4MJB A;  1UC7 A;  5KN3 A;  4TR0 A;  4TRX A;  1FOH A;  3UVH A;  3IDV A;  1BQ7 A;  6GST A;  3FR6 A;  2GQL A;  2C0F A;  1EGR A;  2H75 A;  1U3A A;  1YF0 A;  3DXB A;  4BA7 A;  3TUE A;  4BVY A;  4HU9 A;  1YF1 A;  1K3L A;  4MH3 A;  3QOU A;  1AW9 A;  1GSF A;  1TW9 A;  4ML6 A;  2GGT A;  4K6X A;  1YJ6 A;  4NAX A;  4KA0 A;  4O7H A;  2ZUP A;  1NHO A;  3FYG A;  11GS A;  1ZYE A;  3KH7 A;  5KOW A;  1H4O A;  1BJX A;  3N9J A;  1XWB A;  3MIX A;  3EMX A;  4TN8 A;  1Z9H A;  5HR1 A;  3HKR A;  3KXO A;  5J5N A;  4J56 E;  2OBK A;  1BX9 A;  3KTL A;  3H93 A;  1GSY A;  3F3Q A;  2YV9 A;  4EL1 A;  4YQM A;  1CQH A;  1TU8 A;  3GST A;  4WF4 A;  3GYK A;  3BJ5 A;  1Y6E A;  1OKT A;  1AQV A;  1HQO A;  3GKM A;  2HSN B;  5IMD A;  3GTU A;  5ABR A;  1G7O A;  2H1A A;  5FT3 A;  1ERT A;  4CW9 A;  1WRY A;  3KMN A;  1FG4 A;  3KTB A;  1AUC A;  2DMM A;  1AQW A;  18GS A;  2H71 A;  2OE3 A;  2DC5 A;  3CSH A;  4ECJ A;  3M8N A;  5DAL A;  1OC3 A;  4MPG A;  3C1R A;  5G5E A;  1O73 A;  4HUA A;  4BL7 A;  3LFL A;  2JZT A;  1K0M A;  3O3T A;  3QD9 A;  1TK8 B;  2TRX A;  3BCK A;  2N5F A;  2JL4 A;  3L78 A;  4PQ1 A;  3LW9 A;  1EP7 A;  2A4V A;  2WRT A;  1JHB A;  1X9S B;  3D4M A;  1V57 A;  1VRS D;  3VWV A;  4IJ3 A;  1GRX A;  2OA7 A;  3IAS 2;  3TKQ A;  3KP9 A;  4O32 A;  2F9S A;  2R0G A;  2RUF A;  4OWY A;  5FWG A;  3IBH A;  1TRW A;  3J7Y k;  2YP6 A;  4GSN A;  3MDK A;  3LOR A;  1U6T A;  3IK7 A;  2WGR A;  1B8X A;  1GTU A;  1XW6 A;  3A5I A;  4GQC A;  4LLR A;  5J47 A;  2HZE A;  1SU9 A;  4HS1 A;  5ELG A;  4YQV A;  4TXV A;  3K8N A;  1M9A A;  2ALB A;  1XZO A;  1AAZ A;  4NHW A;  4RUV A;  3M1G A;  2B1L A;  3RHC A;  1TI3 A;  2I9H A;  3IK9 A;  5A34 A;  1MEK A;  1YVL A;  3H1N A;  2QGV A;  2WUL A;  2HSY A;  2H73 A;  1F3B A;  4KGI A;  1O8X A;  5ECO B;  1F6M C;  4LL4 B;  3KJY A;  2VM1 A;  3ME7 A;  4IQA A;  1Y25 A;  5ECS A;  2X64 A;  4EO3 A;  3TJK A;  2H30 A;  2KP1 A;  2C80 A;  4ZBA A;  4IKH A;  4K0N A;  3UEM A;  4OCF A;  1DUG A;  2H1B A;  4KCE A;  2FWF A;  4N3Z A;  1Z7P A;  2X8G A;  1F2E A;  1GUL A;  1OE7 A;  1ERV A;  3TB2 A;  1WPI A;  1GSD A;  2NPB A;  4PTS A;  3G7I A;  4NPB A;  1ACV A;  2VAF A;  5EVO A;  4IP1 A;  1BG5 A;  3EVI A;  5HR2 A;  3BBY A;  1Y1U A;  1XFL A;  4TR4 A;  2IMK A;  1M7T A;  3LJR A;  3SWL A;  3D21 A;  2VD1 A;  1USB A;  2GT5 A;  1U87 A;  2LQO A;  4XCS A;  3FR9 A;  4IJI A;  1AC1 A;  2CVD A;  3GMF A;  4GTU A;  3HJO A;  4KSM A;  1Z3E A;  1VGL A;  1URM A;  3QPM A;  1RK4 A;  1GUM A;  4TR3 A;  1K0A A;  3Q74 A;  4AJ7 A;  3VPQ A;  3CTF A;  4IS0 A;  3GV1 A;  1A2M A;  2F8F A;  1NW2 A;  2H01 A;  2DIY A;  4XTS A;  5DAK B;  5F8B A;  1TK0 B;  1Q4J A;  3KCM A;  5C00 A;  5J9C A;  6GSU A;  1X5E A;  5JCG A;  4AKI A;  1TP9 A;  3GN3 A;  5G5F A;  2AJQ B;  3EYT A;  4Z7X A;  2L59 A;  5CRG A;  2OT3 A;  2VCW A;  4ULX A;  4WET A;  4BVX A;  1W89 A;  3LEF A;  3G9B A;  1A2L A;  2FLS A;  1O8W A;  3WGE A;  5GAP D;  4F9Z A;  2VLU A;  5HFK A;  1LU4 A;  4ZBD A;  4JE1 A;  3BCI A;  1V40 A;  3DRN A;  5GST A;  4KX4 A;  5ECL B;  4J2F A;  3KIJ A;  2LUS A;  22GS A;  2CZ2 A;  4MLY A;  2BMX A;  2MBS A;  1V58 A;  3EPT A;  2NTO A;  3CBU A;  3TKS A;  2L4Q A;  2VL3 A;  2XBQ A;  3J7Y b;  2YN1 A;  1VF2 A;  1RW1 A;  1WIK A;  4ZL7 A;  3VFI A;  6GSY A;  5CRE A;  1M99 A;  3A2X A;  1S3C A;  2H6Y A;  2A2P A;  4X4J A;  2VLV A;  5CAX A;  5J3R A;  3TGZ A;  5B7C A;  1X0R A;  3E3E A;  4F0B A;  2H74 A;  1WOU A;  4MZW A;  4Q5R A;  3JCM L;  3TRX A;  3TRP A;  2P31 A;  3TKS C;  1XBS A;  4V2N A;  4W66 A;  2HSN A;  5A1N B;  4AI6 A;  2NBS A;  2LST A;  4E8H A;  3GL3 A;  5BMU A;  5AGY A;  4V1A p;  5D96 A;  3LWA A;  3F0I A;  3HVS A;  4ISD A;  4DSS A;  1K0N A;  3QCP A;  2HQT A;  5AN1 A;  2LJK A;  3FZ4 A;  2HZF A;  2L4C A;  2AUV A;  2C1Y A;  4FQU A;  4WR5 A;  5DQY A;  8GSS A;  4HQS A;  1GNE A;  4FH8 A;  3P7X A;  2B7J A;  1LJR A;  3MSZ A;  3H79 A;  4QMK A;  2BTO T;  4OO5 A;  5CO3 A;  3PGT A;  1UA5 A;  4N30 A;  1QUW A;  3C71 A;  1KNG A;  4NMU A;  1PKW A;  2L6C A;  2XPD A;  2B7K A;  1R7H A;  2YWI A;  5FHI A;  2LEG A;  5L71 A;  1KBN A;  4K5S A;  5CRW A;  3GL5 A;  2FGX A;  1N8J A;  4HDE A;  3ZIT A;  4LL1 B;  1I5G A;  4PUF C;  3UMA A;  2K6V A;  3QAG A;  1J08 A;  4KDX A;  4EVM A;  2UV8 G;  4K7N A;  3HXS A;  4GXZ A;  5LCZ A;  5HR3 A;  2I1U A;  2JSY A;  5ECI B;  2C3T A;  5CNW A;  1X9W B;  1MTC A;  5IMC A;  3ZL5 A;  1ABA A;  4KF9 A;  2V32 A;  4GDF A;  5IMZ A;  1E2Y A;  4XRD A;  2QC7 A;  4RI7 A;  4FO5 A;  3TJF A;  3FZ5 A;  4F82 A;  1IYH A;  1GP1 A;  2DJ2 A;  5DDL A;  1R5P A;  4GST A;  9GSS A;  1HNC A;  2VCQ A;  3CRT A;  3RPN A;  2JZS A;  1E6B A;  5KEJ A;  1JLV A;  4USS A;  2H19 A;  4L8E A;  1T4Y A;  4IQ1 A;  2O8V B;  5JCU A;  2AB6 A;  3FY7 A;  3ERG A;  5IOX A;  1XWK A;  3RPP A;  4ZIJ A;  2HT9 A;  4FYB A;  5KN1 A;  1GSS A;  1ERU A;  1A0R P;  4WBR D;  1GNW A;  3VI5 A;  3RAZ A;  3Q19 A;  4Q5Q A;  2H76 A;  1XCC A;  1QK8 A;  1ZCP A;  2C3Q A;  2YWM A;  3C7M A;  4P3Y B;  5DJL A;  2HSM A;  3MWH A;  4QL7 A;  2E7P A;  1SVO A;  1DBY A;  5DQS A;  2EIQ A;  3DIE A;  5B8B A;  2H0H A;  1WMJ A;  4RQX A;  4EF0 A;  3ZIJ A;  3IC8 A;  3LSZ A;  3F63 A;  2YJH A;  5GZZ B;  1TRV A;  1M9B A;  4XRA A;  1OC9 B;  2WZ9 A;  3EC3 A;  2QSI A;  2MMZ A;  1U3I A;  5IO0 A;  1RQM A;  4FYC A;  3ZZX A;  5IPH A;  4MDC A;  4EDZ A;  3L4N A;  4IGJ A;  4X43 A;  1ZYQ B;  1CQG A;  1QFN A;  2GQK A;  2WCI A;  2UZ8 A;  3F8U A;  2LJR A;  2C3N A;  2EFE A;  1B4Q A;  5LNK e;  4V2L A;  3UL3 A;  3I69 A;  4WBJ A;  5A5H B;  2LNS A;  5DAK A;  1SK1 A;  1K3O A;  5H5Q A;  1SKW B;  5HFG A;  2Z9S A;  4MH2 A;  4EC0 A;  2CVB A;  1HD2 A;  5CYY A;  4YH2 A;  2FNO A;  3I6A A;  4I2U A;  3L9V A;  2VL2 A;  3KMO A;  2K8S A;  2V6O A;  2AYT A;  4KE3 A;  2CVK A;  4ZB6 A;  2IMF A;  2B5E A;  3IRA A;  3TOT A;  3HZ8 A;  3ZVJ D;  2IME A;  4ZIL A;  3UJ1 A;  1G6W A;  3HJP A;  4IVF A;  3EUR A;  3DGQ A;  4WEY A;  2X49 A;  3HZ4 A;  4EUY A;  1EV9 A;  2B5Y A;  3GX8 A;  3L9S A;  2VL2 C;  1K0B A;  2CA8 A;  1DSB A;  4KND A;  2TIR A;  2DML A;  5D9X A;  1BYE A;  5ELA A;  3IPZ A;  2H66 A;  3HYP A;  4RQR A;  3ZRD A;  2GSS A;  1AIU A;  2YZH A;  1NHY A;  2VIM A;  4DSR A;  2N5B A;  1SYR A;  5IQY A;  3WYW A;  1UVZ A;  3VK9 A;  4PNF A;  5D93 A;  3TKP A;  1MDK A;  1WWJ A;  1WJK A;  2QA2 A;  4I5Q A;  1EOH A;  2VKZ G;  1Z7R A;  2YAN A;  4MJE A;  1PSQ A;  3R2Q A;  1K0O A;  5IMA A;  4MF7 A;  3P8W A;  4G0I A;  3DVW A;  4G2E A;  1SYX A;  1TRU A;  5ECK B;  2REM A;  4K1F A;  4GWR A;  2FHE A;  3FRC A;  2YZU A;  5ID2 A;  4MJC A;  2MMO A;  4PQI A;  3QR6 A;  3EE2 A;  1EWX A;  2K8V A;  2HRA A;  3VI7 A;  2CX3 A;  3DYR A;  3W6G A;  1Z5Y E;  5CP1 A;  3TOU A;  3D6I A;  1O81 A;  1ZZY A;  1TU7 A;  3P2A A;  2B5X A;  4ECC A;  2OE1 A;  4OFN A;  5DCG A;  2MZC A;  4EE0 A;  1SD9 A;  3LYP A;  3NIV A;  1ZGN A;  2EFD A;  1KTE A;  4KDU A;  2L57 A;  3AY8 A;  3HMJ G;  5BRT A;  4Z2T A;  2EC4 A;  3WD6 A;  3G7J A;  3HA9 A;  4CHS A;  2MYG A;  1B9X C;  2H72 A;  4MK3 A;  5KN2 A;  2WFC A;  5EPF A;  2PN8 A;  5F05 A;  2AAW A;  3FKF A;  1B48 A;  3GKN A;  3GRX A;  2IPA A;  3UBL A;  2L6D A;  1GLP A;  3ZRE A;  4V1A g;  1K3Y A;  3IHG A;  5JWR B;  4MPF A;  2E2M A;  3EU3 A;  3SBC A;  3CTG A;  4K9Z A;  4ZB8 A;  4KH7 A;  4TR1 B;  5DJM A;  3ERF A;  1EEJ A;  1XOA A;  5DCH A;  2C4J A;  3HD5 A;  4XS4 A;  1GSU A;  1ILO A;  2V1M A;  1XWA A;  4IEL A;  2O7K A;  3TDG A;  1N25 A;  3IHQ A;  1ZL9 A;  3TKR A;  4HZ2 A;  1GH2 A;  2FCH A;  4K8M A;  2OE0 A;  3ZMK A;  1Z6N A;  3F6F A;  4V2M A;  1TKD B;  1VF1 A;  2EFC A;  4KSO A;  3PPU A;  5H5S A;  4EXJ A;  4PUR A;  1K0D A;  2V41 A;  5IIZ A;  4GRF A;  1TOF A;  4EKZ A;  4DVC A;  3KP8 A;  1SJ6 A;  3FEU A;  4X1U A;  5B6M A;  1XWG A;  4N11 A;  2YWN A;  1V98 A;  1FW1 A;  3IC4 A;  5ECH B;  2H70 A;  2IWT A;  2GS3 A;  4XHM A;  2YWO A;  3U5R E;  1VF3 A;  2OJL A;  3M9J A;  1W4V A;  4G10 A;  1YKC A;  4PQH A;  3PR8 A;  2D2Z A;  5F0G A;  2LKU A;  4N0Z A;  2NVL A;  1TK5 B;  3U6V A;  1PMT A;  3NZN A;  4ZBB A;  1XOB A;  3GA4 A;  5D9V A;  1GSE A;  1K0C A;  2FA8 A;  1FOV A;  4LMW A;  2DJ3 A;  1JLW A;  1Z6M A;  2PUK C;  3D4T A;  2DKI A;  3UBK A;  4ICY A;  3GTU B;  4YKG A;  4H86 A;  3GH9 A;  1M2D A;  2GSQ A;  5G30 A;  4MCU A;  5EL8 A;  1OKD A;  4Z2R A;  4JR4 A;  2GDR A;  4AF2 A;  2H6Z A;  3GH6 A;  2YNX A;  4GF0 A;  5DVB A;  1J9B A;  3ZFL A;  5JWO B;  1BAY A;  2FWE A;  2X99 A;  4I6X A;  5C04 A;  3RBT A;  3M0F A;  2OKA A;  2XPE A;  4K7O A;  5DAL B;  1AQX A;  4KAE A;  1FHE A;  4CY6 A;  3ZIV A;  1YY7 A;  2JZR A;  5G31 A;  1ML6 A;  2LQQ A;  4AKH A;  1MD3 A;  2C0D A;  3MAK A;  3APQ A;  2DJ1 A;  4Z2U A;  1YKA A;  1A24 A;  6GSV A;  1EZK A;  3C1S A;  4CY8 A;  3QFB C;  1PRX A;  2DJ0 A;  3EMP A;  5B8A A;  4NXI A;  19GS A;  4AKG A;  1SKR B;  2FWH A;  2BJX A;  1XXU A;  2X4A A;  4HOJ A;  1X9M B;  2X8H A;  2I4A A;  4L0W A;  10GS A;  2H8L A;  3KEB A;  3F4T A;  1GL8 A;  1R5A A;  3A5W A;  3HJM A;  1JZR A;  2AHE A;  1V2A A;  2KP2 A;  3APS A;  3HCZ A;  2VOC A;  2H0I A;  4OO4 A;  2B1K A;  2EFH A;  1PL2 A;  2R6K A;  2R3X A;  3VUR A;  3DML A;  3P90 A;  2CX4 A;  2KLX A;  3QAW A;  4OFM A;  3L0H A;  4I2T A;  5A34 B;  3FHK A;  17GS A;  5J4Y A;  2VLT A;  5G2Z A;  2HRK B;  2B3S A;  3VLN A;  3HVX A;  1FVK A;  1S3D A;  2N5A A;  1NSW A;  3WGD A;  3KH9 A;  1NM3 A;  3FZA A;  3RDW A;  5HQP A;  2VD0 A;  1FB6 A;  2CZ3 A;  2OAD A;  4GCI A;  2O87 A;  1THX A;  3BOA A;  5GAN D;  4D73 B;  3Q6O A;  2WJU A;  3GSS A;  4HZ4 A;  4L0U A;  1SVL A;  3UAR A;  1PQN A;  4TKY A;  2ON7 A;  5A4V A;  5ECM B;  4RI6 A;  3DD3 A;  2RLI A;  5A4W A;  1GLQ A;  1PL1 A;  4JRR A;  4ZL9 A;  5IMV A;  2H1G A;  5IM9 A;  4POB A;  2R37 A;  1PN9 A;  2JAD A;  4XS1 A;  4AJ6 A;  3F9U A;  2B6M A;  4E8E A;  2PVQ A;  14GS A;  3MYD A;  4DEJ A;  1PX7 A;  2I3Y A;  4OFT A;  4GLT A;  1BG1 A;  4KW6 A;  4N0V A;  1ZMA A;  3H4K A;  3A2V A;  1TTZ A;  6GSX A;  5HR0 A;  1ST9 A;  5IPG A;  1R26 A;  2LNT A;  3S9F A;  3IXR A;  5D8I A;  2DKH A;  4XIH A;  1WE0 A;  1DE2 A;  3VPT A;  4MZB A;  1T8E B;  1TI1 A;  1YEX A;  3LQ7 A;  3TU3 B;  3HVV A;  1ERW A;  1S3A A;  3GUS A;  3IV4 A;  3TJG A;  4MMM A;  2DBC A;  1QQ2 A;  1ON4 A;  4FIW A;  1OE8 A;  1BF5 A;  2VUP A;  4ECB A;  4PNG A;  5F06 A;  3GHA A;  4TR1 A;  2PGT A;  3H8Q A;  4Q5F A;  4DSQ A;  2IFQ B;  3MNG A;  1IYI A;  4K7I A;  4BVX B;  2C0G A;  4WF5 A;  4IN0 A;  1XW9 A;  3E9J B;  2A2S A;  1GTA A;  2DIZ A;  4OMV A;  1SD8 A;  2HRF A;  1M2B A;  3F3R A;  1FAA A;  4AKX B;  5J41 A;  5F07 A;  3KZQ A;  3VWU A;  3LGC A;  2IN3 A;  4N10 A;  3LXZ A;  3GUR A;  1DE1 A;  1F9M A;  3UVT A;  3KD0 A;  4I8B A;  4TW5 A;  4POK A;  4CDO A;  1N2A A;  2J23 A;  4K2X A;  4POL A;  3IAM 2;  3ZTL A;  2OAC A;  5E59 A;  4MP4 A;  3FR3 A;  1WP0 A;  1A2J A;  2PMT A;  4TVE A;  2GVP A;  4JR6 A;  2GZZ A;  4IP6 A;  2HNL A;  1OAZ A;  2LRC A;  3HY2 A;  3EIN A;  2L5O A;  2HE3 A;  2A4H A;  3R3E A;  3N5O A;  1T3B A;  2FWG A;  4NV5 A;  3TKS E;  2K9F A;  3ZML A;  1EEM A;  3V1W A;  1SL0 B;  3APO A;  3CYN A;  3C8E A;  3QAV A;  3I43 A;  4HJ2 A;  5ECN B;  4WR4 A;  5DBQ A;  2MBT A;  4NV2 A;  5CRD A;  5J9B A;  1M2A A;  3NOF A;  5ECP B;  4ACS A;  5COH A;  1SKS B;  1JZD A;  4GSS A;  4YKF A;  2RM6 A;  5BMU B;  4G9H A;  3A3T A;  2PER A;  4DSS B;  5D9T A;  3F4R A;  2CT6 A;  4KCA A;  4G01 A;  5INY A;  5IO2 A;  1GTB A;  3ZFB A;  4KDY A;  4AGS A;  1EOG A;  5H5R A;  2IMD A;  3IOS A;  4ILF A;  2VCZ A;  2HSH A;  1PX6 A;  3TCO A;  1SVM A;  2O5V A;  2PWJ A;  3LXT A;  3G7Y A;  1J0F A;  4FYU A;  4O5Q A;  5J4V A;  2WB9 A;  3ISO A;  4HQZ A;  2F51 A;  4F03 A;  2MMA A;  4OCE A;  2PU9 C;  1G7E A;  2CAQ A;  1SK0 A;  1YDK A;  5A1N A;  5IOW A;  3QMX A;  2R0C A;  1PN0 A;  2VCX A;  2E0Q A;  2LJA A;  4ZXG A;  5E4W A;  3UOM A;  2H0G A;  2R2J A;  3M9K A;  1MDI A;  2ON5 A;  2GT6 A;  4ID0 A;  3QDN A;  1ZYN A;  4HJM A;  4TXO B;  1R4W A;  2RUE A;  2P0G A;  4XS6 A;  4EIP A;  4ECI A;  3IE3 A;  3TJJ A;  1T7P B;  3O76 A;  2YOI A;  2QA1 A;  3FW2 A;  1EGO A;  4E68 A;  2C0E A;  1X5C A;  3UIW A;  1SJI A;  4MAB A;  2GST A;  1TDI A;  3IR4 A;  1MDJ A;  2DJJ A;  4TOP A;  16GS A;  2WDU A;  1ZOF A;  1GUK A;  2HRK A;  1F3A A;  2JSZ A;  1B9Y C;  1T4Z A;  1BED A;  2P5Q A;  4K0G A;  2QKE A;  2ZNM A;  2VCT A;  3CSI A;  2FY6 A;  1HNB A;  2DSA A;  4JZQ A;  1LBK A;  2AV4 A;  4D73 A;  2LTK A;  5AIS A;  1XVQ A;  4BWQ A;  1T1V A;  20GS A;  1F37 A;  2OBI A;  1A23 A;  4YQU A;  3QFA C;  2IIY A;  1HNA A;  1QMV A;  3W8S A;  2O85 A;  2R0P A;  4KUN A;  3ME8 A;  2HSM B;  1YQ1 A;  5J40 A;  4LA1 A;  4F0C A;  1ZYP A;  5D9W A;  4L5O A;  4IW9 A;  4PGT A;  5A4U A;  13GS A;  4Q5N A;  2CQ9 A;  2ZCT A;  5KN0 A;  1JZW A;  1XVW A;  4BVY B;  4PUA A;  4JU5 A;  3VWW A;  3EWL A;  2IJY A;  1VF4 A;  3GKK A;  2O89 A;  4QQ7 A;  2WS2 A;  2RII A;  4G19 A;  2CV4 A;  2V6K A;  1GTI A;  1U88 A;  2L5L A;  2KHP A;  2MMN A;  4ZB9 A;  1PKZ A;  1G0T A;  1YEP A;  2PBJ A;  3IA1 A;  1O85 A;  1PA3 A;  2VM2 A;  3D22 A;  5D73 A;  1JFU A;  1FB0 A;  5CRH A;  2XBI A;  1SJZ A;  2RM5 A;  1GUH A;  4YAP A;  2KUC A;  5AIX A;  1T00 A;  2E2G A;  4NWY A;  2XC2 A;  4IBP A;  1XWC A;  2FA4 A;  1PGT A;  2IFQ A;  4J57 E;  5A5K A;  1OC9 A;  2M46 A;  2VO4 A;  4QL9 A;  5AIV A;  2YPM A;  4O5U A;  3GFK A;  2K18 A;  2LRT A;  5JWQ B;  4HI7 A;  4K2D A;  4WXT A;  1B4P A;  3TJB A;  1THO A;  5ECR B;  1TXU A;  2TRC P;  3O6T A;  1MD4 A;  3Q18 A;  1SEN A;  4F2I A;  4K5R A;  4G0L A;  1SK2 A;  2CAI A;  1A0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...