4OMVA

Crystal structure of a putative macrophage growth locus, subunit a from francisella tularensis schu s4
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
194
Chain Sequence
AMLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSKHLEELNIITPNGNIPTLSTDDFAVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQANEIKMLMQRDIISTYKKIVSERAQNINVLTLIITFVFYYFIKLKISIPTKDKNIIKEIKELLSEPNFIKTIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Macrophage growth locus, subunit A
publication title Crystal Structure of a Putative Macrophage Growth Locus, subunit A From Francisella tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 61
structure length 194
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4omvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4omvA01
4ZBDA 5G30A 5HQPA 2N5BA 3ZZXA 2IMKA 3GMFA 2VD1A 1O6JA 3CXGA 4J56E 1GSSA 1J08A 3KGKA 3LQ7A 2NBSA 1R4WA 3M0FA 3RHCA 4ZILA 1F6MC 6GSSA 2PUKC 3RBTA 1T00A 3WYWA 4HUAA 2OA7A 4MLYA 1SL0B 3IC4A 2H0IA 4ZL8A 4K9ZA 1E6BA 1TK8B 4ZB6A 4HJMA 1K0AA 5ECSA 4IP1A 1SKRB 2FD3A 1SU9A 3HHVA 1XIYA 3G7IA 4JEDA 1BQ7A 3F3RA 1S3DA 1K0DA 1WWJA 2YN1A 2FHEA 4JRRA 17GSA 1T3BA 3TJJA 3KTBA 1SK2A 2VL3A 3FK8A 3DXBA 4G0LA 1K0BA 2PGTA 5JWRB 4O32A 5ENUA 5AIXA 2C0EA 3KJYA 1MEKA 1ZOFA 2DJ3A 4DSQA 2V6KA 1J0FA 3U5RE 4TR1B 2I3YA 3BBYA 5G31A 1M99A 3E3EA 4PTSA 5COHA 1TDIA 2HYXA 3A5WA 1KEBA 2VCQA 5A4WA 1TJDA 3LSZA 3LGCA 5ECOB 2LNTA 2I81A 2OACA 1J9BA 2YJHA 4WR4A 3F4RA 5IOXA 1DE2A 3TKSC 3ZTLA 4DSSA 4P3YB 1EGOA 1T4YA 4GRFA 3WGDA 1LJRA 2AV4A 5A4UA 2DMMA 4I97A 4K2DA 5ECRB 1GUHA 1ZMAA 2A2RA 4V2NA 1QMVA 2WCIA 4KAEA 1SKWB 3EVIA 2F8AA 4XS1A 2CZ3A 3CTFA 4K7OA 4BVYA 1PGTA 3DYRA 3FR6A 4GWRA 3S9FA 3O3TA 2RLIA 3KZQA 3ZITA 4MZBA 3VFIA 2IL3A 2DIZA 3HVSA 1XXUA 5BMUA 2GQLA 1K0OA 3QR6A 4G2EA 1EWXA 3FYGA 5CYYA 1TRUA 1B4QA 4EXJA 2AHEA 4XHMA 2VL2C 2HSMA 4XS4A 5D73A 3WGXA 1ST9A 4POBA 1NHOA 4HZ4A 1E2YA 1KNGA 3LYKA 2K18A 4IHUA 5IMCA 3D4TA 4IS0A 3DEXA 3KH9A 5IO0A 1T1VA 2QC7A 1U3AA 3RPPA 5G5EA 4L5OA 1B8XA 3VK9A 4TN8A 3KP8A 4EKZA 3D6IA 4WBJA 2VLTA 3TJGA 2RM5A 4DVCA 1ZGNA 5ELAA 2X8HA 4WXTA 2V41A 2I1UA 5J9CA 4FIWA 4JR6A 4GTUA 1FG4A 1H75A 1A2LA 4ECJA 4KSOA 1X5CA 22GSA 2C3TA 3EMXA 4F9ZA 1EGRA 1N8JA 2K6VA 3TB2A 2YPMA 1GWCA 4CDOA 1XPVA 5CREA 4KDUA 4O7HA 4I8BA 1V57A 3H79A 4PURA 1NSWA 1PMTA 3MDKA 4GCIA 2H01A 2YV7A 4PQIA 4KDYA 2QSIA 4HS1A 3VI7A 3FZ5A 4MPGA 1WRYA 4YAVA 2C0FA 2WJUA 4MJAA 4MP4A 1WMJA 2WULA 2IMIA 2YWIA 1XBSA 5DBQA 1GSYA 2FNOA 2YWMA 5ECIB 3L9UA 2KOKA 1W4VA 1OE8A 1OE7A 4MPFA 1R5PA 1TRWA 4N0ZA 2L59A 2X8GA 10GSA 2HI7A 5H5SA 3KH7A 1XVQA 2YZHA 5D9TA 4JU5A 6GSYA 3F9UA 3O6TA 1U88A 3RAZA 3EYTA 4BWSA 1V2AA 5B6NA 3GH6A 3D5JA 1OC3A 2J9HA 4LMVA 2VAFA 3GA4A 2HRNA 3HA9A 1X9SB 1YEXA 2JADA 2O7KA 3ZRDA 2P5QA 5B6MA 4MA9A 4XTSA 3KTLA 3LORA 2YZUA 3P2AA 1GRXA 3MNGA 4PQ1A 5ECKB 3HJMA 2JZSA 4F2IA 3IHQA 3IAM2 2IMDA 4ZXGA 2OADA 1K0CA 1K3LA 2HRAA 4MZWA 4KCAA 1SD8A 3HY2A 1TI3A 3CMIA 3Q74A 2EIOA 2LJKA 1PRXA 3TRQA 3IV4A 3QAVA 2WRTA 5DJMA 1HYUA 1O73A 3DWVA 2IIYA 4O5RA 3EU4A 1GUKA 3ZLPA 2IMEA 5E59A 1GTUA 1OC8A 1R26A 8GSSA 2XHFA 1A24A 1ML6A 1SKSB 2GT5A 4KUNA 3FZAA 1FB6A 1B9XC 3RDWA 1O85A 3CSIA 3RHBA 1O81A 2R6KA 2V2GA 1XWGA 2IFQA 2VCTA 2KP1A 2KUCA 2N5AA 2DSAA 4V1Ap 2B7JA 3DKSA 5JWQB 4TXOB 3CSJA 1Y25A 1QQ2A 1X5EA 1N2AA 2FY6A 4K0GA 4GQCA 4CHSA 3F4SA 3R3EA 3BD2A 3GTUB 2F8FA 1XWKA 2X99A 3WT2A 4ML6A 2PPTA 2GZPA 5ECQB 2VLUA 5CO3A 5J9BA 4K7NA 4AF2A 3IPZA 4L0UA 3HDCA 2E7PA 2V1MA 4G0IA 3IXRA 3GYKA 5J4UA 4GXZA 1A0RP 2JSYA 2DIYA 4XCSA 2ES7A 1ZZYA 1FVJA 4IGJA 4F0CA 3H93A 3BJ5A 4RUVA 1RW1A 3EC3A 4X43A 4BPYA 4OD7A 1TOFA 1TK5B 1I5GA 2LV3A 4ZB8A 5CAXA 1OC9A 4NHWA 2GZZA 3GNJA 3SWLA 5IQYA 2VCXA 1DBYA 4LA1A 1G6YA 5GZZB 4X0XA 5INYA 3DMLA 1LU4A 5ID2B 1GP1A 3TDGA 3C1RA 2PERA 5JWOB 2XC2A 3UVTA 5GSSA 3TOUA 3VLNA 3QAGA 1PKWA 4JZQA 5HFGA 1GSQA 3UVHA 2PBJA 3FZ4A 4WBRD 2FWHA 3R2QA 2H0GA 5CRHA 1QUWA 5IOWA 1VRSD 3F6DA 3LXZA 2L6DA 2ZUPA 1UVZA 5F0GA 3E9JB 5J5NA 3CRUA 5ECNB 5IMZA 3D0ZA 4KCEA 3HYPA 4NV5A 1ON4A 3A2XA 5D93A 3I6AA 4DSRA 4PNFA 1OKTA 3VURA 2HSYA 4LLRA 5DAKA 4EUYA 3DGQA 3ZFLA 2PVQA 1IYHA 4MCUA 3TOTA 3EWLA 4EDZA 2CVKA 4PX1A 2FUG2 4FYUA 3M9KA 3HZ8A 1M9BA 1K0MA 1Z7PA 2IN3A 3UIWA 1BJXA 4ZL9A 6GSVA 5GSTA 3L9VA 5DDLA 5JCGA 3KP9A 3LYPA 2C4JA 5DJLA 1TP9A 4YAPA 4POKA 5DCGA 3IA1A 1YEPA 5E4WA 5CRGA 4IBPA 2MBSA 3HKRA 3ZVJD 3NOFA 2MMZA 1SD9A 5B8BA 1HNBA 3G7JA 4BVXA 4MJBA 3IK9A 3I69A 3CSHA 1SL1B 4NWYA 1VF2A 3UBLA 1GULA 3W8SA 5H5QA 4BL7B 1MD4A 1Z3EA 2LRCA 4KW6A 1MD3A 4E8HA 2N5FA 2GVPA 1B4PA 4GF0A 1DUGA 4FYBA 2HNLA 1TI1A 4IJIA 1PQNA 5CP1A 2CVBA 1F3BA 3LEFA 1TK0B 3FR9A 4ACSA 4GSTA 4MK3A 3TKPA 4HOJA 5A4VA 4HQSA 3L9SA 3ZREA 2VL9A 1BEDA 5GAND 1NM3A 1M7TA 3I43A 2DBCA 3ISOA 4N30A 1A23A 4WETA 4WEYA 3M8NA 1ILOA 2YOIA 3DD3A 1Z6MA 1GH2A 2R5GA 2H73A 2EIQA 2H6YA 4TR4A 4K0NA 3Q19A 4H86A 1X0RA 4WF5A 1JFUA 2A2SA 1ZL9A 3ERWA 2L5OA 3HD5A 2DJJA 3ZFBA 4KA0A 2GSRA 2DLXA 1Q4JA 4EC0A 1YY7A 3FW2A 2F3MA 2HRKA 2IMFA 4PXOA 3DVWA 4ISDA 3PINA 2H74A 5IMDA 1H4OA 5G2ZA 4X1UA 3ME7A 4JBBA 5AN1A 1YKCA 3QFBC 2C3QA 4KDXA 5DALB 4POLA 16GSA 3L4NA 2OE3A 3BCIA 1G7OA 4AJ6A 2H1BA 5F05A 1ZYEA 3IK7A 1SJIA 3EURA 4HDEA 2CAIA 5KN0A 4HJ2A 1WE0A 2MMOA 4Q5QA 2VM1A 2B5XA 3D21A 3GN3A 2C3NA 3F6FA 2DMLA 5C04A 2B5EA 3CTGA 3E0UA 3WGEA 1YJ6A 1PX6A 2VD0A 1S3AA 1AXDA 2FWFA 4GSSA 5FWGA 3GL3A 5CNWA 4MH2A 2H0HA 2OJLA 4N0VA 1SK1A 4QQ7A 4D73B 3TJFA 1S3CA 2P0GA 2YNXA 2BJXA 4TVEA 1EP8A 2QGVA 2I4AA 3OR5A 2PWJA 1MDJA 4CW9A 1FB0A 4TXOA 3UJ1A 4TRXA 1GLQA 2GQKA 1HQOA 5LD0A 1TKDB 5IPHA 4K1FA 2HE3A 2WB9A 4F82A 4HU9A 3ED3A 1Z9HA 2HZFA 4YQVA 1KBNA 1W89A 2G0FA 2H76A 2WDUA 1I9DA 3FEUA 2J23A 2P31A 3PGTA 2CA8A 4GSNA 1AC1A 3RPNA 3FRCA 2TRXA 1NW2A 4OFMA 4WR5A 5C00A 4ML1A 2K9FA 1B9YC 5D8IA 5D96A 4RQXA 3PR8A 1XW9A 5IMVA 5AIVA 2MZCA 1ERWA 2FA4A 3LJRA 1A2MA 1GL8A 1JHBA 3KMOA 2DJ0A 5IM9A 2VOCA 2MBTA 3IBHA 2LUSA 3PH9A 2ON7A 4NHZA 1U87A 1F9MA 2CQ9A 4IP6A 4G19A 5ID2A 2FA8A 4MZCA 1PKZA 2VO4A 4V2MA 1GSDA 5A5KA 2ON5A 1AIUA 2LQQA 2OE0A 4I6XA 4LL4B 3C7MA 4DEJA 3V1WA 3ZL5A 4HI7A 4ILFA 3EINA 5IMAA 2LKUA 4L8EA 3TJKA 2NTOA 3ZMLA 2WS2A 3F8UA 4DSSB 2EIRA 1GSEA 1AUCA 3NZNA 1DSBA 2HT9A 2XPDA 5F07A 3LFLA 4IN0A 3IC8A 1MDKA 2C80A 5IMFA 3U6VA 3NIVA 2B7KA 3IR4A 2PU9C 1A2JA 2RIIA 4N10A 1XOBA 3C73A 3QPMA 3FY7A 4PNGA 3GL5A 4HQZA 1FVKA 1OVNA 2TIRA 1X9MB 4PUFC 5IIZA 2AB6A 5B8AA 6GSTA 2NPBA 2C1YA 1T4ZA 3P90A 4ZL7A 1A0FA 3KCMA 1AAZA 2LQOA 4LMWA 1YF0A 2H70A 3ERGA 5ECLB 4XS4B 3FKFA 3UEMA 4MH3A 1TRSA 2O85A 4RI7A 4JR4A 1WOUA 3BCKA 1ABAA 1THXA 2LRTA 2FWEA 3ZMKA 2VLVA 5J41A 3VWUA 3C71A 3GKKA 4ZBAA 1PX7A 1U3IA 5HR1A 4ECCA 4JE1A 3VWVA 4Q5RA 5FHIA 4EF0A 1QGVA 2H72A 3GH9A 4MABA 2PN8A 1B48A 1TW9A 3GKMA 3J7Yk 4TR1A 4IQAA 2IWTA 2OBKA 4HU7A 3PPUA 5GAPD 2UZ8A 1XWBA 4AGSA 2BTOT 2H8LA 3UL3A 4NV2A 2B3SA 3VWWA 2DJ2A 5L71A 2GDRA 3H8QA 1M2AA 3TCOA 2K8SA 3QMXA 2GSQA 3W6GA 2LRNA 1UN2A 1EOGA 2GSTA 2HRFA 1R7HA 2ZCTA 4NPBA 19GSA 4HEA2 4EL1A 2AJQB 1WPIA 2GGTA 1FHEA 2Z9SA 2O89A 4K7IA 1XCCA 3EE2A 1U6TA 2WFCA 3TUEA 1EOHA 2JACA 1JLWA 1Z6NA 4MJEA 1TRVA 1USBA 4OFTA 3CYNA 2LNSA 2GLRA 2TRCP 1QK8A 4IJ3A 1G0TA 2H30A 3ZIVA 5HR3A 1XFLA 2D2ZA 1AQWA 3MWHA 2YCDA 4MF5A 3TGZA 2M46A 4K8MA 2B6MA 1UC7A 1ERVA 3VPTA 3KIJA 1Q98A 4TR0A 2FLSA 1EP7A 2L6CA 1AQXA 2L57A 4KSMA 4G10A 2LJRA 4EE0A 4TXVA 4PUAA 1C72A 2GQMA 2ALBA 11GSA 2G2QA 1EEJA 3ME8A 1XW6A 4FYCA 1ERUA 1SYRA 3IOSA 2F51A 4AJ7A 2H6ZA 4IVFA 2O87A 1ZCPA 2C0GA 2HLSA 1O8WA 1SK0A 1XVWA 1BYEA 1MDIA 2R4VA 4NAXA 4D73A 2OKAA 3MSZA 5ABRA 3UARA 1XWCA 3QCPA 1PA3A 1BG5A 1EV9A 2H1DA 4Q5NA 3IDVA 1GSFA 1TTZA 3F3QA 2WGRA 2HXKA 1CQGA 3GKNA 2EC4A 2CX4A 3UMAA 3MAKA 3UOMA 4FQUA 1GUMA 1GSUA 4QL9A 1V58A 3APOA 4ID0A 3Q6OA 3SBCA 4MF6A 1DE1A 1A8YA 3GRXA 1YKAA 2LSTA 2KP2A 2H19A 4ZBBA 3F0IA 2A4VA 1WP0A 5IO2A 5ELGA 3FHKA 2CVDA 2VM2A 2CV4A 2GS3A 3HCZA 1M0UA 2JSZA 3GSTA 1OAZA 2H1AA 3Q18A 3QOUA 2IFQB 1YF1A 4EO3A 1BX9A 1SJ6A 3HVXA 3K8NA 2NVLA 3JCML 5HFIA 1YZXA 1F2EA 4BA7A 1V40A 3CRTA 2M80A 5KN2A 3IAS2 1FAAA 2B1KA 3BOAA 4XRDA 5EL8A 4Z7XA 5CRWA 5DQYA 2JU5A 4KX4A 4EVMA 2B1LA 4FO5A 4PGTA 2AYTA 1F37A 3GX8A 3GKXA 9GSSA 3GSSA 1V98A 4KB3A 1O8XA 3WD6A 4J57E 2H66A 1AQVA 2YWOA 2M72A 3APQA 2LJAA 4I2UA 3EMPA 4F03A 2B5YA 1UA5A 5AISA 2HZEB 1OC9B 1M9AA 2IPAA 4YH2A 2AUVA 3G9BA 4KF9A 1JZRA 2IJYA 3P7XA 4MJCA 2YP6A 3F63A 1TU7A 4MF7A 4L0WA 5DCHA 2E0QA 4I5QA 3A2VA 4OO4A 4RI6A 1Z5YE 1GNEA 1SL2B 1THOA 3GV1A 2H75A 2FCHA 1PD21 1FW1A 3CBUA 3TKQA 1XOAA 4OFNA 2CX3A 4ECIA 4USSA 4K6XA 3D22A 2OE1A 5D9WA 5LNKe 1QXHA 4PQHA 2RM6A 1TXXA 2FGXA 2VUPA 1SJZA 2YWNA 2GT6A 1LBKA 6GSXA 3H1NA 2CZ2A 1ERTA 3VI5A 3ZYWA 4IQ1A 1K3OA 1JZOA 2R3XA 5D9XA 1JLVA 1PL2A 3GHAA 3F4TA 5DAKB 1O7UA 4GLTA 2GZYA 4KH7A 1F3AA 5B7CA 1ACVA 3QD9A 2WZ9A 2P5RA 4IELA 3KD0A 3GTUA 2LS5A 3TRPA 4WKWA 2H6XA 5IPGA 4QL7A 2E2GA 3LWAA 3W8JA 4RQRA 1G7EA 2VIMA 5HFKA 2X8CA 1WJKA 1VF4A 4TOPA 4OWYA 3US3A 5JCWA 4OMVA 12GSA 1G6WA 3TKSE 3APSA 3HZ4A 3ZVJA 2ZNMA 2RUEA 5HR2A 4XS6A 4BVXB 3QFAC 3KXOA 2PVOC 14GSA 2VCZA 2L4QA 2C8UA 3KMNA 3C1SA 2NDOA 2JL4A 5CRDA 3GIXA 3L78A 1X5DA 4YQMA 2RUFA 4GQFA 2O8VB 3J7Yb 5DQSA 1PL1A 3G7YA 2GTUA 3GFKA 1JZWA 2XBIA 2PMTA 2XBQA 3TRXA 2L4CA 3D4MA 3QDNA 18GSA 5FT3A 1QFNA 4KE3A 3C8EA 3A3TA 2V32A 3IRAA 4AJ8A 1HNCA 1PSQA 3KM6A 2JZTA 1Y6EA 5KN1A 1YDKA 4MMMA 3DIEA 5J3RA 2XPEA 1TU8A 3IE3A 5KN3A 2C0DA 5HR0A 1FOVA 6GSUA 3VWXA 2HRKB 1GNWA 2HQTA 2K8VA 3EU3A 5ECHB 4NXIA 4TR3A 1V9WA 1XZOA 4BVYB 3HVVA 5EVOA 1K3YA 3O76A 2MMAA 2DJKA 4OO5A 4ULXA 3LG6A 1OYJA 1GTAA 5DVBA 1A8LA 4POMA 1X9WB 1GTBA 5ECMB 3M1GA 1XW5A 2HSMB 20GSA 1MTCA 5AGYA 1BAYA 2R2JA 4EDYA 1GTIA 3AY8A 4OCEA 4YQUA 2I9HA 4L5LA 4I2TA 1SENA 2DC5A 3HXSA 1URMA 4MDCA 3KEBA 2CAQA 4BL7A 3FZ9A 4G0KA 1EZKA 3GUSA 5G5FA 1Z7RA 5F8BA 2V6OA 2MYGA 4WF4A 3H4KA 1HNAA 2H71A 2DJ1A 1WIKA 3TKSA 1RK4A 4O92A 1GLPA 3ERFA 4Q5FA 4J2FA 3HJPA 3N5OA 13GSA 1PN9A 1M2BA 1R5AA 1YQ1A 3N9JA 4OCFA 3A2WA 4E8EA 3QAWA 5G1LA 5EPFA 3VPQA 3FR3A 5JCUA 2VCVA 4ZB9A 2QKEA 4V2LA 2GSSA 2KHPA 4HZ2A 4TW5A 3L0HA 1JZDA 4IW9A 2OBIA 2L5LA 3I9V2 1CQHA 2CT6A 6GSWA 4NMUA 2MMNA 2FWGA 3DRNA 5LCZA 2HSHA 1EEMA 5H5RA 1AW9A 2VL2A 1SYXA 1VF1A 1ZYQB 4F0BA 2F9SA 2LTKA 4KGIA 2H1GA 2JZRA 2REMA 1OKDA 4LL1B 4IKHA 4KNDA 3GX0A 3LXTA 1EV4A 5EY6A 5KEJA 1IYIA 3HJOA 2KLXA 2YV9A 5F06A 3WT1A 1KTEA 2HFDA 4ECBA 2E2MA 2X64A 5DALA 5D9VA 2HZEA 2LEGA 1T7PB 1VF3A 4G9HA 1T8EB 1FO5A 2AAWA 2VCWA 5G1KA 4N11A 1M2DA 4FH8A 1VGLA 4XIHA 3M9JA 3M3MA 1K0NA 2HSNB 4TKYA 4ZIJA 3UBKA 4XRAA 2YJ7A 5ECPB 3P8WA 2BMXA 3ZIJA 3UAPA 3TJBA 1HD2A 7GSSA 2YANA 1XWAA 3DVXA 4V1Ag 4BWQA 1NHYA 2R37A 3TKRA 1RQMA 3GURA
chains in the Genus database with same CATH superfamily
4ZBDA 5G30A 5HQPA 2N5BA 3ZZXA 2IMKA 3GMFA 2WVXA 2WVZA 2VD1A 1O6JA 3CXGA 4J56E 1GSSA 1J08A 3KGKA 3LQ7A 2NBSA 1R4WA 3M0FA 3RHCA 4ZILA 1F6MC 6GSSA 2PUKC 3RBTA 1T00A 3WYWA 4HUAA 2OA7A 4MLYA 1SL0B 3IC4A 2H0IA 4ZL8A 4K9ZA 1E6BA 1TK8B 4ZB6A 4HJMA 1K0AA 5ECSA 4IP1A 1SKRB 2FD3A 1SU9A 3HHVA 1XIYA 3G7IA 4JEDA 1BQ7A 3F3RA 1S3DA 1K0DA 1WWJA 2YN1A 2FHEA 4JRRA 17GSA 1T3BA 3TJJA 3KTBA 1SK2A 2VL3A 3FK8A 3DXBA 4G0LA 1K0BA 2PGTA 5JWRB 4O32A 4CY8A 5ENUA 5AIXA 2C0EA 3KJYA 1MEKA 1ZOFA 2DJ3A 4DSQA 2V6KA 1J0FA 1FOHA 3U5RE 4TR1B 2I3YA 3BBYA 5G31A 1M99A 3E3EA 4PTSA 5COHA 1TDIA 2HYXA 3A5WA 1KEBA 3HMJG 2VCQA 5A4WA 1TJDA 3CWGA 3LSZA 3LGCA 5ECOB 2LNTA 2I81A 2OACA 1J9BA 2YJHA 4WR4A 3F4RA 5IOXA 1DE2A 3TKSC 3ZTLA 4DSSA 4P3YB 1EGOA 1T4YA 4GRFA 3WGDA 1LJRA 2AV4A 5A4UA 2DMMA 4I97A 4K2DA 5ECRB 1GUHA 1ZMAA 2A2RA 4V2NA 1QMVA 2WCIA 4KAEA 1SKWB 3EVIA 2F8AA 4XS1A 2A4HA 1M3IA 2CZ3A 3CTFA 4K7OA 4BVYA 1PGTA 3DYRA 3FR6A 4GWRA 4MNNA 3S9FA 4O5UA 3O3TA 2RLIA 3KZQA 3ZITA 4MZBA 3VFIA 2IL3A 2DIZA 3HVSA 1XXUA 5BMUA 2GQLA 1K0OA 3QR6A 4G2EA 1EWXA 3FYGA 5CYYA 1TRUA 1B4QA 4EXJA 2AHEA 4XHMA 2VL2C 2HSMA 4XS4A 5D73A 2DKIA 1ST9A 3WGXA 4POBA 1NHOA 4HZ4A 1E2YA 1KNGA 4HSCX 3LYKA 1S3RA 2K18A 4IHUA 5IMCA 3D4TA 4IS0A 3DEXA 3KH9A 5IO0A 1T1VA 2QC7A 1U3AA 3RPPA 5G5EA 4L5OA 1B8XA 3VK9A 4TN8A 1S4BP 3KP8A 4EKZA 3D6IA 4WBJA 2VLTA 3TJGA 2RM5A 4DVCA 1ZGNA 2WVYA 5ELAA 4AI6A 2X8HA 4WXTA 2V41A 2I1UA 5J9CA 4FIWA 4JR6A 4GTUA 1FG4A 1H75A 1A2LA 4ECJA 4KSOA 1X5CA 22GSA 2C3TA 3EMXA 4F9ZA 1EGRA 1N8JA 2K6VA 3TB2A 2YPMA 1GWCA 4CDOA 1XPVA 5CREA 4KDUA 4O7HA 4I8BA 2QA1A 1V57A 3H79A 4PURA 1NSWA 1PMTA 2H01A 3MDKA 4GCIA 4FXYP 2YV7A 4PQIA 4KDYA 2QSIA 4HS1A 3VI7A 3FZ5A 4MPGA 5J47A 1WRYA 4YAVA 2C0FA 2WJUA 2X4AA 4MJAA 4MP4A 1WMJA 2WULA 2IMIA 2YWIA 1XBSA 5DBQA 1GSYA 2FNOA 2YWMA 5ECIB 3L9UA 2KOKA 1W4VA 1OE8A 1OE7A 4MPFA 1R5PA 1TRWA 1XG8A 1PFOA 4N0ZA 2L59A 2X8GA 10GSA 2HI7A 5H5SA 3KH7A 1XVQA 2YZHA 5D9TA 4JU5A 6GSYA 3F9UA 3O6TA 1U88A 3RAZA 3EYTA 4BWSA 1V2AA 5B6NA 3GH6A 3D5JA 1OC3A 2J9HA 4LMVA 2VAFA 3FMWA 3GA4A 2HRNA 3HA9A 1X9SB 1YEXA 2JADA 2O7KA 3ZRDA 2P5QA 5B6MA 2EFDA 4MA9A 4XTSA 3KTLA 1PN0A 3LORA 2YZUA 3P2AA 1GRXA 3MNGA 4PQ1A 5ECKB 3HJMA 2JZSA 4F2IA 3IHQA 1Y1UA 3IAM2 2IMDA 4ZXGA 2OADA 1K0CA 1K3LA 2HRAA 4MZWA 4KCAA 1SD8A 3HY2A 1TI3A 3CMIA 3Q74A 2EIOA 2LJKA 1PRXA 3TRQA 3IV4A 3QAVA 2WRTA 5DJMA 1HYUA 1O73A 3DWVA 2IIYA 4O5RA 5A5HA 3EU4A 1GUKA 3ZLPA 2IMEA 5E59A 1GTUA 1OC8A 1R26A 8GSSA 2XHFA 1A24A 1ML6A 1SKSB 4ZB7A 2GT5A 4KUNA 3FZAA 1FB6A 1B9XC 3RDWA 1O85A 3CSIA 3RHBA 1O81A 4A5PA 4YKGA 2R6KA 2V2GA 1XWGA 2IFQA 2VCTA 2KP1A 2KUCA 2N5AA 4G01A 2DSAA 4V1Ap 2B7JA 3DKSA 5JWQB 4TXOB 3CSJA 1Y25A 1QQ2A 1X5EA 1N2AA 2FY6A 2O5VA 4K0GA 4QMKA 4GQCA 4CHSA 4N3ZA 3F4SA 3R3EA 3BD2A 3GTUB 2F8FA 1XWKA 2X99A 1SVLA 4ML6A 3WT2A 2PPTA 2GZPA 5ECQB 2VLUA 5CO3A 5J9BA 4K7NA 4K5SA 4AF2A 3IPZA 4L0UA 3HDCA 2E7PA 2V1MA 4G0IA 3IXRA 3GYKA 5J4UA 4GXZA 1A0RP 2JSYA 2DIYA 1SVMA 4XCSA 2ES7A 1ZZYA 1FVJA 4IGJA 4F0CA 3H93A 3BJ5A 4RUVA 1RW1A 3EC3A 4X43A 4BPYA 4OD7A 3HVNA 1YEWC 1TOFA 1TK5B 1I5GA 2LV3A 5A34B 4ZB8A 5CAXA 1OC9A 4NHWA 2GZZA 3GNJA 3SWLA 3MYDA 4E68A 5IQYA 2VCXA 1DBYA 4LA1A 1G6YA 5GZZB 4X0XA 5INYA 3DMLA 1LU4A 5ID2B 1GP1A 3TDGA 3C1RA 2PERA 5JWOB 2XC2A 3UVTA 5GSSA 3TOUA 3VLNA 3QAGA 1PKWA 4JZQA 5HFGA 1GSQA 3UVHA 2PBJA 3FZ4A 4WBRD 2FWHA 3R2QA 2H0GA 5CRHA 1QUWA 5IOWA 2O3EA 1VRSD 3F6DA 3LXZA 2L6DA 2ZUPA 1UVZA 5F0GA 3E9JB 5J5NA 3CRUA 5ECNB 5IMZA 3D0ZA 4KCEA 3HYPA 4NV5A 1ON4A 3A2XA 5D93A 3I6AA 4DSRA 4PNFA 1OKTA 3VURA 2HSYA 4LLRA 5DAKA 4EUYA 3DGQA 3ZFLA 2PVQA 1IYHA 4Z2UA 4MCUA 3TOTA 3EWLA 4EDZA 2CVKA 4PX1A 2FUG2 4FYUA 3M9KA 3HZ8A 1M9BA 1K0MA 1Z7PA 2IN3A 3UIWA 1BJXA 4ZL9A 6GSVA 5GSTA 3L9VA 5DDLA 5JCGA 3KP9A 3LYPA 2C4JA 5DJLA 1TP9A 4YAPA 4POKA 5DCGA 3IA1A 1YEPA 4PHZC 5E4WA 3A5IA 5CRGA 4IBPA 2MBSA 1TXUA 4GDFA 3HKRA 3ZVJD 3NOFA 4AKIA 2MMZA 1SD9A 4AKHA 5B8BA 1HNBA 3G7JA 4BVXA 4MJBA 3IK9A 3I69A 3CSHA 1SL1B 4NWYA 1VF2A 3UBLA 1GULA 3W8SA 5H5QA 4BL7B 1MD4A 1Z3EA 2LRCA 4KW6A 1MD3A 4E8HA 2N5FA 1BF5A 2GVPA 1B4PA 4GF0A 1DUGA 4FYBA 2HNLA 1TI1A 4IJIA 1PQNA 5CP1A 2CVBA 1F3BA 3LEFA 1TK0B 3FR9A 4ACSA 4GSTA 4MK3A 3TKPA 4HOJA 4BIKA 5A4VA 4HQSA 3L9SA 3ZREA 2VL9A 1BEDA 5GAND 1NM3A 1M7TA 3I43A 2DBCA 3ISOA 4N30A 1A23A 4WETA 4WEYA 3M8NA 1ILOA 2YOIA 3DD3A 1Z6MA 5A1NA 1GH2A 2R5GA 2H73A 2EIQA 2H6YA 4TR4A 4K0NA 3Q19A 4H86A 1X0RA 4WF5A 1JFUA 2A2SA 2R0CA 1ZL9A 3ERWA 2L5OA 3HD5A 2DJJA 3ZFBA 4KA0A 5KOWA 2WW3A 2GSRA 2DLXA 1Q4JA 4EC0A 1YY7A 3FW2A 2F3MA 2HRKA 2IMFA 2O36A 4PXOA 3DVWA 4ISDA 3PINA 2H74A 5IMDA 2UV8G 1H4OA 5G2ZA 4X1UA 3ME7A 4JBBA 5AN1A 1YKCA 3QFBC 2C3QA 4KDXA 5DALB 4POLA 16GSA 3L4NA 2OE3A 3BCIA 1G7OA 4AJ6A 2H1BA 5F05A 1ZYEA 3IK7A 1SJIA 3EURA 3RFRC 1M3JA 4HDEA 2CAIA 3CHXC 5KN0A 4HJ2A 1WE0A 2MMOA 4Q5QA 2VM1A 2B5XA 3D21A 3GN3A 2C3NA 3F6FA 2DMLA 5C04A 2B5EA 3CTGA 3E0UA 3WGEA 1YJ6A 1PX6A 2VD0A 1S3AA 1AXDA 2FWFA 4GSSA 5FWGA 3GL3A 5CNWA 4MH2A 2H0HA 2OJLA 4N0VA 1SK1A 4QQ7A 4D73B 2WVXB 3TJFA 1S3CA 2P0GA 2YNXA 2BJXA 4TVEA 1EP8A 2QGVA 2I4AA 3OR5A 2PWJA 1MDJA 4CW9A 1FB0A 4TXOA 2WZSA 3UJ1A 4TRXA 1GLQA 2GQKA 1HQOA 5LD0A 1TKDB 5IPHA 4K1FA 2HE3A 2WB9A 3IHGA 4F82A 4HU9A 3ED3A 1Z9HA 2HZFA 4YQVA 1KBNA 1W89A 2G0FA 2H76A 2WDUA 1I9DA 3FEUA 2J23A 2P31A 3PGTA 4EIPA 2CA8A 4GSNA 1AC1A 3RPNA 3FRCA 2TRXA 1NW2A 4OFMA 4WR5A 5C00A 4ML1A 2K9FA 1B9YC 5D8IA 5D96A 4RQXA 3PR8A 1XW9A 3TU3B 5IMVA 5AIVA 2MZCA 1ERWA 2FA4A 3LJRA 1A2MA 1GL8A 1JHBA 5A34A 3KMOA 2WW2A 2DJ0A 5IM9A 2VOCA 2MBTA 2R0PA 3IBHA 4O5QA 2LUSA 3PH9A 2ON7A 4NHZA 1U87A 1F9MA 2HSNA 2CQ9A 4IP6A 4G19A 5ID2A 2FA8A 4MZCA 1PKZA 2VO4A 4PI0C 2A2PA 4V2MA 1GSDA 5A5KA 2ON5A 1AIUA 2LQQA 2OE0A 4I6XA 4LL4B 3C7MA 4DEJA 3V1WA 3ZL5A 4HI7A 4ILFA 3EINA 5IMAA 2LKUA 4L8EA 3TJKA 2NTOA 3ZMLA 2WS2A 3F8UA 4ICYA 4DSSB 2EIRA 1GSEA 1AUCA 3NZNA 1DSBA 2HT9A 2XPDA 5F07A 3LFLA 4IN0A 2DKHA 3IC8A 1MDKA 2C80A 5IMFA 3U6VA 3NIVA 2B7KA 3IR4A 2PU9C 1A2JA 2RIIA 4N10A 1XOBA 3C73A 3QPMA 3FY7A 4PNGA 3GL5A 4HQZA 1FVKA 1OVNA 3EPTA 2EFEA 2TIRA 1X9MB 4PUFC 5IIZA 2AB6A 5B8AA 2EFHA 6GSTA 2NPBA 2C1YA 1T4ZA 3P90A 4ZL7A 1A0FA 3KCMA 1AAZA 5BMUB 2LQOA 4LMWA 1YF0A 2H70A 3ERGA 5ECLB 4XS4B 3FKFA 3UEMA 4MH3A 1TRSA 2O85A 4RI7A 4JR4A 3RGBC 4AKGA 1WOUA 1ABAA 3BCKA 1THXA 2LRTA 2FWEA 3ZMKA 2VLVA 5J41A 3VWUA 3C71A 3GKKA 3LW9A 4ZBAA 1PX7A 1U3IA 5HR1A 4ECCA 4JE1A 3VWVA 4Q5RA 5FHIA 4EF0A 1QGVA 2H72A 3GH9A 4MABA 2PN8A 1B48A 1TW9A 3GKMA 3J7Yk 4TR1A 4IQAA 2IWTA 2OBKA 4HU7A 3PPUA 5GAPD 2UZ8A 1XWBA 4AGSA 2BTOT 2H8LA 3UL3A 4NV2A 2B3SA 3VWWA 2DJ2A 5L71A 2GDRA 3H8QA 1M2AA 3TCOA 2K8SA 3QMXA 2GSQA 3W6GA 2LRNA 1UN2A 1EOGA 2GSTA 2HRFA 1R7HA 2ZCTA 4NPBA 19GSA 4HEA2 4EL1A 2AJQB 1WPIA 2GGTA 1FHEA 2Z9SA 2O89A 4K7IA 1XCCA 3EE2A 1U6TA 2WFCA 3TUEA 4AKXB 1EOHA 2JACA 1JLWA 1Z6NA 4MJEA 1TRVA 1USBA 4OFTA 3CYNA 2LNSA 2GLRA 2TRCP 1QK8A 4IJ3A 1G0TA 2H30A 3ZIVA 5HR3A 1XFLA 2D2ZA 1AQWA 3MWHA 2YCDA 4MF5A 3TGZA 2M46A 4K8MA 2B6MA 1UC7A 1ERVA 3VPTA 3KIJA 1Q98A 4TR0A 2FLSA 1EP7A 5J4YA 2L6CA 1AQXA 2L57A 4KSMA 4G10A 2LJRA 4EE0A 4TXVA 4PUAA 1C72A 2GQMA 2ALBA 11GSA 2G2QA 1EEJA 3ME8A 1XW6A 4FYCA 1ERUA 1SYRA 3IOSA 2F51A 4AJ7A 2H6ZA 4IVFA 2O87A 1ZCPA 2C0GA 2HLSA 1O8WA 1SK0A 1XVWA 1BYEA 1MDIA 2R4VA 4NAXA 4D73A 1N25A 2OKAA 3MSZA 5ABRA 3UARA 1XWCA 3QCPA 1PA3A 1BG5A 1EV9A 2H1DA 4Q5NA 3IDVA 1GSFA 1TTZA 3F3QA 2WGRA 2HXKA 1CQGA 3GKNA 2EC4A 2CX4A 3UMAA 3MAKA 3UOMA 4FQUA 2EFCA 1GUMA 1GSUA 4QL9A 1V58A 5A5HB 3APOA 4ID0A 3Q6OA 3SBCA 4MF6A 1DE1A 1A8YA 3GRXA 1YKAA 2LSTA 2KP2A 2H19A 1BG1A 4ZBBA 3F0IA 2A4VA 1WP0A 5IO2A 5ELGA 3FHKA 2CVDA 2VM2A 2CV4A 2GS3A 3HCZA 1M0UA 2JSZA 3GSTA 1OAZA 2H1AA 3Q18A 3QOUA 2IFQB 1YF1A 4EO3A 1BX9A 1SJ6A 3HVXA 2VKZG 3K8NA 2NVLA 3JCML 5HFIA 1YZXA 1F2EA 4BA7A 1V40A 3CRTA 2M80A 5KN2A 3IAS2 1FAAA 2B1KA 3BOAA 4XRDA 5EL8A 4Z7XA 5CRWA 5DQYA 2JU5A 4KX4A 4EVMA 2B1LA 4FO5A 4PGTA 2AYTA 1F37A 3GX8A 3GKXA 9GSSA 3GSSA 1V98A 2QA2A 4KB3A 1O8XA 3WD6A 4J57E 2H66A 1AQVA 2YWOA 2M72A 3APQA 2LJAA 4I2UA 3EMPA 4F03A 2B5YA 1UA5A 5AISA 2HZEB 1OC9B 1M9AA 2IPAA 4YH2A 2AUVA 3G9BA 4KF9A 1JZRA 1YVLA 2IJYA 3P7XA 4MJCA 2YP6A 3F63A 1TU7A 4MF7A 4L0WA 5DCHA 4W66A 2E0QA 4I5QA 3A2VA 4OO4A 4RI6A 1Z5YE 1GNEA 1SL2B 1THOA 3GV1A 2H75A 2FCHA 1PD21 1FW1A 3CBUA 3TKQA 1XOAA 4OFNA 2CX3A 4ECIA 4USSA 4K6XA 3D22A 2OE1A 5D9WA 5LNKe 1QXHA 4PQHA 2RM6A 1TXXA 2FGXA 4K2XA 2VUPA 1SJZA 2YWNA 2GT6A 1LBKA 6GSXA 3MIXA 3H1NA 2CZ2A 1ERTA 3VI5A 3ZYWA 4IQ1A 1K3OA 1ZYPA 1JZOA 2R3XA 2OT3A 4Z2TA 5D9XA 1JLVA 1PL2A 3GHAA 3F4TA 5DAKB 1O7UA 4GLTA 2GZYA 4KH7A 1F3AA 5B7CA 1ACVA 3QD9A 2WZ9A 2P5RA 4IELA 3KD0A 1ZYNA 4PI2C 3GTUA 2LS5A 3TRPA 4WKWA 4EIQA 2H6XA 5IPGA 4QL7A 2E2GA 3LWAA 3W8JA 4RQRA 1G7EA 2VIMA 5HFKA 3CQFA 2X8CA 2WW1A 1WJKA 1VF4A 4TOPA 4OWYA 3US3A 5JCWA 4OMVA 12GSA 1G6WA 3TKSE 3APSA 3HZ4A 3ZVJA 2ZNMA 2RUEA 5HR2A 4XS6A 4BVXB 3QFAC 5J40A 3KXOA 2X49A 2PVOC 14GSA 2VCZA 2L4QA 2C8UA 3KMNA 3C1SA 2NDOA 2JL4A 5CRDA 3GIXA 3L78A 1X5DA 4YQMA 4CY6A 2RUFA 4GQFA 2O8VB 3J7Yb 5DQSA 1PL1A 3G7YA 2GTUA 3GFKA 1JZWA 1I1IP 2XBIA 2PMTA 2XBQA 3TRXA 2L4CA 3D4MA 3QDNA 18GSA 5FT3A 1QFNA 5A1NB 4KE3A 3C8EA 3A3TA 2V32A 3IRAA 4AJ8A 1HNCA 1PSQA 3KM6A 2JZTA 1Y6EA 5KN1A 1YDKA 4MMMA 3DIEA 5J3RA 2XPEA 1TU8A 3IE3A 5KN3A 2C0DA 5HR0A 1FOVA 6GSUA 3VWXA 2HRKB 1GNWA 2HQTA 2K8VA 3EU3A 5ECHB 4NXIA 4TR3A 1V9WA 1XZOA 4BVYB 3HVVA 5EVOA 1K3YA 3O76A 2MMAA 2DJKA 4OO5A 4ULXA 3LG6A 1OYJA 1GTAA 5DVBA 1A8LA 4POMA 1X9WB 5J4VA 1GTBA 5ECMB 3M1GA 1XW5A 2HSMB 4YKFA 20GSA 1MTCA 2WW0A 5AGYA 1BAYA 2R2JA 4EDYA 1GTIA 2H1LA 3AY8A 4OCEA 4YQUA 2I9HA 4L5LA 4I2TA 1SENA 2DC5A 3HXSA 1URMA 4MDCA 3KEBA 2CAQA 4BL7A 3FZ9A 4G0KA 1EZKA 3GUSA 5G5FA 1Z7RA 5F8BA 2V6OA 2MYGA 4WF4A 3H4KA 1HNAA 2H71A 2DJ1A 1WIKA 3TKSA 1RK4A 4O92A 1GLPA 3ERFA 4Q5FA 4J2FA 3HJPA 3N5OA 13GSA 1PN9A 1M2BA 1R5AA 1YQ1A 3N9JA 4OCFA 3A2WA 4E8EA 3QAWA 4X4JA 5G1LA 5EPFA 3VPQA 3FR3A 5JCUA 2VCVA 4ZB9A 2QKEA 4V2LA 4K5RA 2GSSA 2KHPA 4HZ2A 4TW5A 3L0HA 1JZDA 4IW9A 2OBIA 2L5LA 3I9V2 1CQHA 2CT6A 6GSWA 4NMUA 2R0GA 2MMNA 2FWGA 3DRNA 5LCZA 2HSHA 1EEMA 5H5RA 1AW9A 2VL2A 1SYXA 1VF1A 1ZYQB 4F0BA 2F9SA 2LTKA 4KGIA 2H1GA 2JZRA 2REMA 1OKDA 4LL1B 4IKHA 4KNDA 3GX0A 3LXTA 1EV4A 5EY6A 5KEJA 1IYIA 3HJOA 2KLXA 1SVOA 2YV9A 5F06A 3WT1A 1KTEA 2HFDA 5KOXA 4ECBA 5BRTA 2E2MA 2X64A 5DALA 5D9VA 2HZEA 2LEGA 1T7PB 1VF3A 4G9HA 1T8EB 1FO5A 2AAWA 2VCWA 5G1KA 4N11A 1M2DA 4FH8A 1VGLA 4XIHA 3M9JA 3M3MA 1K0NA 2HSNB 4TKYA 4ZIJA 3UBKA 4XRAA 2YJ7A 5ECPB 3P8WA 2BMXA 3ZIJA 3UAPA 3TJBA 1HD2A 7GSSA 2YANA 1XWAA 3DVXA 4V1Ag 4BWQA 1NHYA 2R37A 3TKRA 1RQMA 3GURA 4Z2RA
chains in the Genus database with same CATH topology
4ZBDA 5G30A 5HQPA 2N5BA 3ZZXA 2IMKA 3GMFA 2VD1A 1O6JA 3CXGA 4J56E 1GSSA 1J08A 3KGKA 3LQ7A 2NBSA 1R4WA 3M0FA 3RHCA 4ZILA 1F6MC 6GSSA 2PUKC 3RBTA 1T00A 3WYWA 4HUAA 2OA7A 4MLYA 1SL0B 3IC4A 2H0IA 4ZL8A 4K9ZA 1E6BA 1TK8B 4ZB6A 4HJMA 1K0AA 5ECSA 4IP1A 1SKRB 2FD3A 1SU9A 3HHVA 1XIYA 3G7IA 4JEDA 1BQ7A 3F3RA 1S3DA 1K0DA 1WWJA 2YN1A 2FHEA 4JRRA 17GSA 1T3BA 3TJJA 3KTBA 1SK2A 2VL3A 3FK8A 3DXBA 4G0LA 1K0BA 2PGTA 5JWRB 4O32A 4CY8A 5ENUA 5AIXA 2C0EA 3KJYA 1MEKA 1ZOFA 2DJ3A 4DSQA 2V6KA 1J0FA 1FOHA 3U5RE 4TR1B 2I3YA 3BBYA 5G31A 1M99A 3E3EA 4PTSA 5COHA 1TDIA 2HYXA 3A5WA 1KEBA 3HMJG 2VCQA 5A4WA 1TJDA 3CWGA 3LSZA 3LGCA 5ECOB 2LNTA 2I81A 2OACA 1J9BA 2YJHA 4WR4A 3F4RA 5IOXA 1DE2A 3TKSC 3ZTLA 4DSSA 4P3YB 1EGOA 1T4YA 4GRFA 3WGDA 1LJRA 2AV4A 5A4UA 2DMMA 4I97A 4K2DA 5ECRB 1GUHA 1ZMAA 2A2RA 4V2NA 1QMVA 2WCIA 4KAEA 1SKWB 3EVIA 2F8AA 4XS1A 2A4HA 2CZ3A 3CTFA 4K7OA 4BVYA 1PGTA 3DYRA 3FR6A 4GWRA 4MNNA 3S9FA 4O5UA 3O3TA 2RLIA 3KZQA 3ZITA 4MZBA 3VFIA 2IL3A 2DIZA 3HVSA 1XXUA 5BMUA 2GQLA 1K0OA 3QR6A 4G2EA 1EWXA 3FYGA 5CYYA 1TRUA 1B4QA 4EXJA 2AHEA 4XHMA 2VL2C 2HSMA 4XS4A 5D73A 2DKIA 1ST9A 3WGXA 4POBA 1NHOA 4HZ4A 1E2YA 1KNGA 3LYKA 2K18A 4IHUA 5IMCA 3D4TA 4IS0A 3DEXA 3KH9A 5IO0A 1T1VA 2QC7A 1U3AA 3RPPA 5G5EA 4L5OA 1B8XA 3VK9A 4TN8A 3KP8A 4EKZA 3D6IA 4WBJA 2VLTA 3TJGA 2RM5A 4DVCA 1ZGNA 5ELAA 4AI6A 2X8HA 4WXTA 2V41A 2I1UA 5J9CA 4FIWA 4JR6A 4GTUA 1FG4A 1H75A 1A2LA 4ECJA 4KSOA 1X5CA 22GSA 2C3TA 3EMXA 4F9ZA 1EGRA 1N8JA 2K6VA 3TB2A 2YPMA 1GWCA 4CDOA 1XPVA 5CREA 4KDUA 4O7HA 4I8BA 2QA1A 1V57A 3H79A 4PURA 1NSWA 1PMTA 3MDKA 4GCIA 2H01A 2YV7A 4PQIA 4KDYA 2QSIA 4HS1A 3VI7A 3FZ5A 4MPGA 5J47A 1WRYA 4YAVA 2C0FA 2WJUA 2X4AA 4MJAA 4MP4A 1WMJA 2WULA 2IMIA 2YWIA 1XBSA 5DBQA 1GSYA 2FNOA 2YWMA 5ECIB 3L9UA 2KOKA 1W4VA 1OE8A 1OE7A 4MPFA 1R5PA 1TRWA 4N0ZA 2L59A 2X8GA 10GSA 2HI7A 5H5SA 3KH7A 1XVQA 2YZHA 5D9TA 4JU5A 6GSYA 3F9UA 3O6TA 1U88A 3RAZA 3EYTA 4BWSA 1V2AA 5B6NA 3GH6A 3D5JA 1OC3A 2J9HA 4LMVA 2VAFA 3FMWA 3GA4A 2HRNA 3HA9A 1X9SB 1YEXA 2JADA 2O7KA 3ZRDA 2P5QA 5B6MA 2EFDA 4MA9A 4XTSA 3KTLA 1PN0A 3LORA 2YZUA 3P2AA 1GRXA 3MNGA 4PQ1A 5ECKB 3HJMA 2JZSA 4F2IA 3IHQA 1Y1UA 3IAM2 2IMDA 4ZXGA 2OADA 1K0CA 1K3LA 2HRAA 4MZWA 4KCAA 1SD8A 3HY2A 1TI3A 3CMIA 3Q74A 2EIOA 2LJKA 1PRXA 3TRQA 3IV4A 3QAVA 2WRTA 5DJMA 1HYUA 1O73A 3DWVA 2IIYA 4O5RA 5A5HA 3EU4A 1GUKA 3ZLPA 2IMEA 5E59A 1GTUA 1OC8A 1R26A 8GSSA 2XHFA 1A24A 1ML6A 1SKSB 4ZB7A 2GT5A 4KUNA 3FZAA 1FB6A 1B9XC 3RDWA 1O85A 3CSIA 3RHBA 1O81A 4A5PA 4YKGA 2R6KA 2V2GA 1XWGA 2IFQA 2VCTA 2KP1A 2KUCA 2N5AA 4G01A 2DSAA 4V1Ap 2B7JA 3DKSA 5JWQB 4TXOB 3CSJA 1Y25A 1QQ2A 1X5EA 1N2AA 2FY6A 2O5VA 4K0GA 4QMKA 4GQCA 4CHSA 4N3ZA 3F4SA 3R3EA 3BD2A 3GTUB 2F8FA 1XWKA 2X99A 1SVLA 4ML6A 3WT2A 2PPTA 2GZPA 5ECQB 2VLUA 5CO3A 5J9BA 4K7NA 4K5SA 4AF2A 3IPZA 4L0UA 3HDCA 2E7PA 2V1MA 4G0IA 3IXRA 3GYKA 5J4UA 4GXZA 1A0RP 2JSYA 2DIYA 1SVMA 4XCSA 2ES7A 1ZZYA 1FVJA 4IGJA 4F0CA 3H93A 3BJ5A 4RUVA 1RW1A 3EC3A 4X43A 4BPYA 4OD7A 1TOFA 1TK5B 1I5GA 2LV3A 5A34B 4ZB8A 5CAXA 1OC9A 4NHWA 2GZZA 3GNJA 3SWLA 3MYDA 4E68A 5IQYA 2VCXA 1DBYA 4LA1A 1G6YA 5GZZB 4X0XA 5INYA 3DMLA 1LU4A 5ID2B 1GP1A 3TDGA 3C1RA 2PERA 5JWOB 2XC2A 3UVTA 5GSSA 3TOUA 3VLNA 3QAGA 1PKWA 4JZQA 5HFGA 1GSQA 3UVHA 2PBJA 3FZ4A 4WBRD 2FWHA 3R2QA 2H0GA 5CRHA 1QUWA 5IOWA 1VRSD 3F6DA 3LXZA 2L6DA 2ZUPA 1UVZA 5F0GA 3E9JB 5J5NA 3CRUA 5ECNB 5IMZA 3D0ZA 4KCEA 3HYPA 4NV5A 1ON4A 3A2XA 5D93A 3I6AA 4DSRA 4PNFA 1OKTA 3VURA 2HSYA 4LLRA 5DAKA 4EUYA 3DGQA 3ZFLA 2PVQA 1IYHA 4Z2UA 4MCUA 3TOTA 3EWLA 4EDZA 2CVKA 4PX1A 2FUG2 4FYUA 3M9KA 3HZ8A 1M9BA 1K0MA 1Z7PA 2IN3A 3UIWA 1BJXA 4ZL9A 6GSVA 5GSTA 3L9VA 5DDLA 5JCGA 3KP9A 3LYPA 2C4JA 5DJLA 1TP9A 4YAPA 4POKA 5DCGA 3IA1A 1YEPA 5E4WA 3A5IA 5CRGA 4IBPA 2MBSA 1TXUA 4GDFA 3HKRA 3ZVJD 3NOFA 4AKIA 2MMZA 1SD9A 4AKHA 5B8BA 1HNBA 3G7JA 4BVXA 4MJBA 3IK9A 3I69A 3CSHA 1SL1B 4NWYA 1VF2A 3UBLA 1GULA 3W8SA 5H5QA 4BL7B 1MD4A 1Z3EA 2LRCA 4KW6A 1MD3A 4E8HA 2N5FA 1BF5A 2GVPA 1B4PA 4GF0A 1DUGA 4FYBA 2HNLA 1TI1A 4IJIA 1PQNA 5CP1A 2CVBA 1F3BA 3LEFA 1TK0B 3FR9A 4ACSA 4GSTA 4MK3A 3TKPA 4HOJA 5A4VA 4HQSA 3L9SA 3ZREA 2VL9A 1BEDA 5GAND 1NM3A 1M7TA 3I43A 2DBCA 3ISOA 4N30A 1A23A 4WETA 4WEYA 3M8NA 1ILOA 2YOIA 3DD3A 1Z6MA 5A1NA 1GH2A 2R5GA 2H73A 2EIQA 2H6YA 4TR4A 4K0NA 3Q19A 4H86A 1X0RA 4WF5A 1JFUA 2A2SA 2R0CA 1ZL9A 3ERWA 2L5OA 3HD5A 2DJJA 3ZFBA 4KA0A 5KOWA 2GSRA 2DLXA 1Q4JA 4EC0A 1YY7A 3FW2A 2F3MA 2HRKA 2IMFA 4PXOA 3DVWA 4ISDA 3PINA 2H74A 5IMDA 2UV8G 1H4OA 5G2ZA 4X1UA 3ME7A 4JBBA 5AN1A 1YKCA 3QFBC 2C3QA 4KDXA 5DALB 4POLA 16GSA 3L4NA 2OE3A 3BCIA 1G7OA 4AJ6A 2H1BA 5F05A 1ZYEA 3IK7A 1SJIA 3EURA 4HDEA 2CAIA 5KN0A 4HJ2A 1WE0A 2MMOA 4Q5QA 2VM1A 2B5XA 3D21A 3GN3A 2C3NA 3F6FA 2DMLA 5C04A 2B5EA 3CTGA 3E0UA 3WGEA 1YJ6A 1PX6A 2VD0A 1S3AA 1AXDA 2FWFA 4GSSA 5FWGA 3GL3A 5CNWA 4MH2A 2H0HA 2OJLA 4N0VA 1SK1A 4QQ7A 4D73B 3TJFA 1S3CA 2P0GA 2YNXA 2BJXA 4TVEA 1EP8A 2QGVA 2I4AA 3OR5A 2PWJA 1MDJA 4CW9A 1FB0A 4TXOA 3UJ1A 4TRXA 1GLQA 2GQKA 1HQOA 5LD0A 1TKDB 5IPHA 4K1FA 2HE3A 2WB9A 3IHGA 4F82A 4HU9A 3ED3A 1Z9HA 2HZFA 4YQVA 1KBNA 1W89A 2G0FA 2H76A 2WDUA 1I9DA 3FEUA 2J23A 2P31A 3PGTA 4EIPA 2CA8A 4GSNA 1AC1A 3RPNA 3FRCA 2TRXA 1NW2A 4OFMA 4WR5A 5C00A 4ML1A 2K9FA 1B9YC 5D8IA 5D96A 4RQXA 3PR8A 1XW9A 3TU3B 5IMVA 5AIVA 2MZCA 1ERWA 2FA4A 3LJRA 1A2MA 1GL8A 1JHBA 5A34A 3KMOA 2DJ0A 5IM9A 2VOCA 2MBTA 2R0PA 3IBHA 4O5QA 2LUSA 3PH9A 2ON7A 4NHZA 1U87A 1F9MA 2HSNA 2CQ9A 4IP6A 4G19A 5ID2A 2FA8A 4MZCA 1PKZA 2VO4A 2A2PA 4V2MA 1GSDA 5A5KA 2ON5A 1AIUA 2LQQA 2OE0A 4I6XA 4LL4B 3C7MA 4DEJA 3V1WA 3ZL5A 4HI7A 4ILFA 3EINA 5IMAA 2LKUA 4L8EA 3TJKA 2NTOA 3ZMLA 2WS2A 3F8UA 4ICYA 4DSSB 2EIRA 1GSEA 1AUCA 3NZNA 1DSBA 2HT9A 2XPDA 5F07A 3LFLA 4IN0A 2DKHA 3IC8A 1MDKA 2C80A 5IMFA 3U6VA 3NIVA 2B7KA 3IR4A 2PU9C 1A2JA 2RIIA 4N10A 1XOBA 3C73A 3QPMA 3FY7A 4PNGA 3GL5A 4HQZA 1FVKA 1OVNA 3EPTA 2EFEA 2TIRA 1X9MB 4PUFC 5IIZA 2AB6A 5B8AA 2EFHA 6GSTA 2NPBA 2C1YA 1T4ZA 3P90A 4ZL7A 1A0FA 3KCMA 1AAZA 5BMUB 2LQOA 4LMWA 1YF0A 2H70A 3ERGA 5ECLB 4XS4B 3FKFA 3UEMA 4MH3A 1TRSA 2O85A 4RI7A 4JR4A 4AKGA 1WOUA 3BCKA 1ABAA 1THXA 2LRTA 2FWEA 3ZMKA 2VLVA 5J41A 3VWUA 3C71A 3GKKA 3LW9A 4ZBAA 1PX7A 1U3IA 5HR1A 4ECCA 4JE1A 3VWVA 4Q5RA 5FHIA 4EF0A 1QGVA 2H72A 3GH9A 4MABA 2PN8A 1B48A 1TW9A 3GKMA 3J7Yk 4TR1A 4IQAA 2IWTA 2OBKA 4HU7A 3PPUA 5GAPD 2UZ8A 1XWBA 4AGSA 2BTOT 2H8LA 3UL3A 4NV2A 2B3SA 3VWWA 2DJ2A 5L71A 2GDRA 3H8QA 1M2AA 3TCOA 2K8SA 3QMXA 2GSQA 3W6GA 2LRNA 1UN2A 1EOGA 2GSTA 2HRFA 1R7HA 2ZCTA 4NPBA 19GSA 4HEA2 4EL1A 2AJQB 1WPIA 2GGTA 1FHEA 2Z9SA 2O89A 4K7IA 1XCCA 3EE2A 1U6TA 2WFCA 3TUEA 4AKXB 1EOHA 2JACA 1JLWA 1Z6NA 4MJEA 1TRVA 1USBA 4OFTA 3CYNA 2LNSA 2GLRA 2TRCP 1QK8A 4IJ3A 1G0TA 2H30A 3ZIVA 5HR3A 1XFLA 2D2ZA 1AQWA 3MWHA 2YCDA 4MF5A 3TGZA 2M46A 4K8MA 2B6MA 1UC7A 1ERVA 3VPTA 3KIJA 1Q98A 4TR0A 2FLSA 1EP7A 5J4YA 2L6CA 1AQXA 2L57A 4KSMA 4G10A 2LJRA 4EE0A 4TXVA 4PUAA 1C72A 2GQMA 2ALBA 11GSA 2G2QA 1EEJA 3ME8A 1XW6A 4FYCA 1ERUA 1SYRA 3IOSA 2F51A 4AJ7A 2H6ZA 4IVFA 2O87A 1ZCPA 2C0GA 2HLSA 1O8WA 1SK0A 1XVWA 1BYEA 1MDIA 2R4VA 4NAXA 4D73A 1N25A 2OKAA 3MSZA 5ABRA 3UARA 1XWCA 3QCPA 1PA3A 1BG5A 1EV9A 2H1DA 4Q5NA 3IDVA 1GSFA 1TTZA 3F3QA 2WGRA 2HXKA 1CQGA 3GKNA 2EC4A 2CX4A 3UMAA 3MAKA 3UOMA 4FQUA 2EFCA 1GUMA 1GSUA 4QL9A 1V58A 5A5HB 3APOA 4ID0A 3Q6OA 3SBCA 4MF6A 1DE1A 1A8YA 3GRXA 1YKAA 2LSTA 2KP2A 2H19A 1BG1A 4ZBBA 3F0IA 2A4VA 1WP0A 5IO2A 5ELGA 3FHKA 2CVDA 2VM2A 2CV4A 2GS3A 3HCZA 1M0UA 2JSZA 3GSTA 1OAZA 2H1AA 3Q18A 3QOUA 2IFQB 1YF1A 4EO3A 1BX9A 1SJ6A 3HVXA 2VKZG 3K8NA 2NVLA 3JCML 5HFIA 1YZXA 1F2EA 4BA7A 1V40A 3CRTA 2M80A 5KN2A 3IAS2 1FAAA 2B1KA 3BOAA 4XRDA 5EL8A 4Z7XA 5CRWA 5DQYA 2JU5A 4KX4A 4EVMA 2B1LA 4FO5A 4PGTA 2AYTA 1F37A 3GX8A 3GKXA 9GSSA 3GSSA 1V98A 2QA2A 4KB3A 1O8XA 3WD6A 4J57E 2H66A 1AQVA 2YWOA 2M72A 3APQA 2LJAA 4I2UA 3EMPA 4F03A 2B5YA 1UA5A 5AISA 2HZEB 1OC9B 1M9AA 2IPAA 4YH2A 2AUVA 3G9BA 4KF9A 1JZRA 1YVLA 2IJYA 3P7XA 4MJCA 2YP6A 3F63A 1TU7A 4MF7A 4L0WA 5DCHA 4W66A 2E0QA 4I5QA 3A2VA 4OO4A 4RI6A 1Z5YE 1GNEA 1SL2B 1THOA 3GV1A 2H75A 2FCHA 1PD21 1FW1A 3CBUA 3TKQA 1XOAA 4OFNA 2CX3A 4ECIA 4USSA 4K6XA 3D22A 2OE1A 5D9WA 5LNKe 1QXHA 4PQHA 2RM6A 1TXXA 2FGXA 4K2XA 2VUPA 1SJZA 2YWNA 2GT6A 1LBKA 6GSXA 3MIXA 3H1NA 2CZ2A 1ERTA 3VI5A 3ZYWA 4IQ1A 1K3OA 1ZYPA 1JZOA 2R3XA 2OT3A 4Z2TA 5D9XA 1JLVA 1PL2A 3GHAA 3F4TA 5DAKB 1O7UA 4GLTA 2GZYA 4KH7A 1F3AA 5B7CA 1ACVA 3QD9A 2WZ9A 2P5RA 4IELA 3KD0A 1ZYNA 3GTUA 2LS5A 3TRPA 4WKWA 4EIQA 2H6XA 5IPGA 4QL7A 2E2GA 3LWAA 3W8JA 4RQRA 1G7EA 2VIMA 5HFKA 2X8CA 1WJKA 1VF4A 4TOPA 4OWYA 3US3A 5JCWA 4OMVA 12GSA 1G6WA 3TKSE 3APSA 3HZ4A 3ZVJA 2ZNMA 2RUEA 5HR2A 4XS6A 4BVXB 3QFAC 5J40A 3KXOA 2X49A 2PVOC 14GSA 2VCZA 2L4QA 2C8UA 3KMNA 3C1SA 2NDOA 2JL4A 5CRDA 3GIXA 3L78A 1X5DA 4YQMA 4CY6A 2RUFA 4GQFA 2O8VB 3J7Yb 5DQSA 1PL1A 3G7YA 2GTUA 3GFKA 1JZWA 2XBIA 2PMTA 2XBQA 3TRXA 2L4CA 3D4MA 3QDNA 18GSA 5FT3A 1QFNA 5A1NB 4KE3A 3C8EA 3A3TA 2V32A 3IRAA 4AJ8A 1HNCA 1PSQA 3KM6A 2JZTA 1Y6EA 5KN1A 1YDKA 4MMMA 3DIEA 5J3RA 2XPEA 1TU8A 3IE3A 5KN3A 2C0DA 5HR0A 1FOVA 6GSUA 3VWXA 2HRKB 1GNWA 2HQTA 2K8VA 3EU3A 5ECHB 4NXIA 4TR3A 1V9WA 1XZOA 4BVYB 3HVVA 5EVOA 1K3YA 3O76A 2MMAA 2DJKA 4OO5A 4ULXA 3LG6A 1OYJA 1GTAA 5DVBA 1A8LA 4POMA 1X9WB 5J4VA 1GTBA 5ECMB 3M1GA 1XW5A 2HSMB 4YKFA 20GSA 1MTCA 5AGYA 1BAYA 2R2JA 4EDYA 1GTIA 2H1LA 3AY8A 4OCEA 4YQUA 2I9HA 4L5LA 4I2TA 1SENA 2DC5A 3HXSA 1URMA 4MDCA 3KEBA 2CAQA 4BL7A 3FZ9A 4G0KA 1EZKA 3GUSA 5G5FA 1Z7RA 5F8BA 2V6OA 2MYGA 4WF4A 3H4KA 1HNAA 2H71A 2DJ1A 1WIKA 3TKSA 1RK4A 4O92A 1GLPA 3ERFA 4Q5FA 4J2FA 3HJPA 3N5OA 13GSA 1PN9A 1M2BA 1R5AA 1YQ1A 3N9JA 4OCFA 3A2WA 4E8EA 3QAWA 4X4JA 5G1LA 5EPFA 3VPQA 3FR3A 5JCUA 2VCVA 4ZB9A 2QKEA 4V2LA 4K5RA 2GSSA 2KHPA 4HZ2A 4TW5A 3L0HA 1JZDA 4IW9A 2OBIA 2L5LA 3I9V2 1CQHA 2CT6A 6GSWA 4NMUA 2R0GA 2MMNA 2FWGA 3DRNA 5LCZA 2HSHA 1EEMA 5H5RA 1AW9A 2VL2A 1SYXA 1VF1A 1ZYQB 4F0BA 2F9SA 2LTKA 4KGIA 2H1GA 2JZRA 2REMA 1OKDA 4LL1B 4IKHA 4KNDA 3GX0A 3LXTA 1EV4A 5EY6A 5KEJA 1IYIA 3HJOA 2KLXA 1SVOA 2YV9A 5F06A 3WT1A 1KTEA 2HFDA 5KOXA 4ECBA 5BRTA 2E2MA 2X64A 5DALA 5D9VA 2HZEA 2LEGA 1T7PB 1VF3A 4G9HA 1T8EB 1FO5A 2AAWA 2VCWA 5G1KA 4N11A 1M2DA 4FH8A 1VGLA 4XIHA 3M9JA 3M3MA 1K0NA 2HSNB 4TKYA 4ZIJA 3UBKA 4XRAA 2YJ7A 5ECPB 3P8WA 2BMXA 3ZIJA 3UAPA 3TJBA 1HD2A 7GSSA 2YANA 1XWAA 3DVXA 4V1Ag 4BWQA 1NHYA 2R37A 3TKRA 1RQMA 3GURA 4Z2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBD A;  5G30 A;  5HQP A;  2N5B A;  3ZZX A;  2IMK A;  3GMF A;  2VD1 A;  1O6J A;  3CXG A;  4J56 E;  1GSS A;  1J08 A;  3KGK A;  3LQ7 A;  2NBS A;  1R4W A;  3M0F A;  3RHC A;  4ZIL A;  1F6M C;  6GSS A;  2PUK C;  3RBT A;  1T00 A;  3WYW A;  4HUA A;  2OA7 A;  4MLY A;  1SL0 B;  3IC4 A;  2H0I A;  4ZL8 A;  4K9Z A;  1E6B A;  1TK8 B;  4ZB6 A;  4HJM A;  1K0A A;  5ECS A;  4IP1 A;  1SKR B;  2FD3 A;  1SU9 A;  3HHV A;  1XIY A;  3G7I A;  4JED A;  1BQ7 A;  3F3R A;  1S3D A;  1K0D A;  1WWJ A;  2YN1 A;  2FHE A;  4JRR A;  17GS A;  1T3B A;  3TJJ A;  3KTB A;  1SK2 A;  2VL3 A;  3FK8 A;  3DXB A;  4G0L A;  1K0B A;  2PGT A;  5JWR B;  4O32 A;  5ENU A;  5AIX A;  2C0E A;  3KJY A;  1MEK A;  1ZOF A;  2DJ3 A;  4DSQ A;  2V6K A;  1J0F A;  3U5R E;  4TR1 B;  2I3Y A;  3BBY A;  5G31 A;  1M99 A;  3E3E A;  4PTS A;  5COH A;  1TDI A;  2HYX A;  3A5W A;  1KEB A;  2VCQ A;  5A4W A;  1TJD A;  3LSZ A;  3LGC A;  5ECO B;  2LNT A;  2I81 A;  2OAC A;  1J9B A;  2YJH A;  4WR4 A;  3F4R A;  5IOX A;  1DE2 A;  3TKS C;  3ZTL A;  4DSS A;  4P3Y B;  1EGO A;  1T4Y A;  4GRF A;  3WGD A;  1LJR A;  2AV4 A;  5A4U A;  2DMM A;  4I97 A;  4K2D A;  5ECR B;  1GUH A;  1ZMA A;  2A2R A;  4V2N A;  1QMV A;  2WCI A;  4KAE A;  1SKW B;  3EVI A;  2F8A A;  4XS1 A;  2CZ3 A;  3CTF A;  4K7O A;  4BVY A;  1PGT A;  3DYR A;  3FR6 A;  4GWR A;  3S9F A;  3O3T A;  2RLI A;  3KZQ A;  3ZIT A;  4MZB A;  3VFI A;  2IL3 A;  2DIZ A;  3HVS A;  1XXU A;  5BMU A;  2GQL A;  1K0O A;  3QR6 A;  4G2E A;  1EWX A;  3FYG A;  5CYY A;  1TRU A;  1B4Q A;  4EXJ A;  2AHE A;  4XHM A;  2VL2 C;  2HSM A;  4XS4 A;  5D73 A;  3WGX A;  1ST9 A;  4POB A;  1NHO A;  4HZ4 A;  1E2Y A;  1KNG A;  3LYK A;  2K18 A;  4IHU A;  5IMC A;  3D4T A;  4IS0 A;  3DEX A;  3KH9 A;  5IO0 A;  1T1V A;  2QC7 A;  1U3A A;  3RPP A;  5G5E A;  4L5O A;  1B8X A;  3VK9 A;  4TN8 A;  3KP8 A;  4EKZ A;  3D6I A;  4WBJ A;  2VLT A;  3TJG A;  2RM5 A;  4DVC A;  1ZGN A;  5ELA A;  2X8H A;  4WXT A;  2V41 A;  2I1U A;  5J9C A;  4FIW A;  4JR6 A;  4GTU A;  1FG4 A;  1H75 A;  1A2L A;  4ECJ A;  4KSO A;  1X5C A;  22GS A;  2C3T A;  3EMX A;  4F9Z A;  1EGR A;  1N8J A;  2K6V A;  3TB2 A;  2YPM A;  1GWC A;  4CDO A;  1XPV A;  5CRE A;  4KDU A;  4O7H A;  4I8B A;  1V57 A;  3H79 A;  4PUR A;  1NSW A;  1PMT A;  3MDK A;  4GCI A;  2H01 A;  2YV7 A;  4PQI A;  4KDY A;  2QSI A;  4HS1 A;  3VI7 A;  3FZ5 A;  4MPG A;  1WRY A;  4YAV A;  2C0F A;  2WJU A;  4MJA A;  4MP4 A;  1WMJ A;  2WUL A;  2IMI A;  2YWI A;  1XBS A;  5DBQ A;  1GSY A;  2FNO A;  2YWM A;  5ECI B;  3L9U A;  2KOK A;  1W4V A;  1OE8 A;  1OE7 A;  4MPF A;  1R5P A;  1TRW A;  4N0Z A;  2L59 A;  2X8G A;  10GS A;  2HI7 A;  5H5S A;  3KH7 A;  1XVQ A;  2YZH A;  5D9T A;  4JU5 A;  6GSY A;  3F9U A;  3O6T A;  1U88 A;  3RAZ A;  3EYT A;  4BWS A;  1V2A A;  5B6N A;  3GH6 A;  3D5J A;  1OC3 A;  2J9H A;  4LMV A;  2VAF A;  3GA4 A;  2HRN A;  3HA9 A;  1X9S B;  1YEX A;  2JAD A;  2O7K A;  3ZRD A;  2P5Q A;  5B6M A;  4MA9 A;  4XTS A;  3KTL A;  3LOR A;  2YZU A;  3P2A A;  1GRX A;  3MNG A;  4PQ1 A;  5ECK B;  3HJM A;  2JZS A;  4F2I A;  3IHQ A;  3IAM 2;  2IMD A;  4ZXG A;  2OAD A;  1K0C A;  1K3L A;  2HRA A;  4MZW A;  4KCA A;  1SD8 A;  3HY2 A;  1TI3 A;  3CMI A;  3Q74 A;  2EIO A;  2LJK A;  1PRX A;  3TRQ A;  3IV4 A;  3QAV A;  2WRT A;  5DJM A;  1HYU A;  1O73 A;  3DWV A;  2IIY A;  4O5R A;  3EU4 A;  1GUK A;  3ZLP A;  2IME A;  5E59 A;  1GTU A;  1OC8 A;  1R26 A;  8GSS A;  2XHF A;  1A24 A;  1ML6 A;  1SKS B;  2GT5 A;  4KUN A;  3FZA A;  1FB6 A;  1B9X C;  3RDW A;  1O85 A;  3CSI A;  3RHB A;  1O81 A;  2R6K A;  2V2G A;  1XWG A;  2IFQ A;  2VCT A;  2KP1 A;  2KUC A;  2N5A A;  2DSA A;  4V1A p;  2B7J A;  3DKS A;  5JWQ B;  4TXO B;  3CSJ A;  1Y25 A;  1QQ2 A;  1X5E A;  1N2A A;  2FY6 A;  4K0G A;  4GQC A;  4CHS A;  3F4S A;  3R3E A;  3BD2 A;  3GTU B;  2F8F A;  1XWK A;  2X99 A;  3WT2 A;  4ML6 A;  2PPT A;  2GZP A;  5ECQ B;  2VLU A;  5CO3 A;  5J9B A;  4K7N A;  4AF2 A;  3IPZ A;  4L0U A;  3HDC A;  2E7P A;  2V1M A;  4G0I A;  3IXR A;  3GYK A;  5J4U A;  4GXZ A;  1A0R P;  2JSY A;  2DIY A;  4XCS A;  2ES7 A;  1ZZY A;  1FVJ A;  4IGJ A;  4F0C A;  3H93 A;  3BJ5 A;  4RUV A;  1RW1 A;  3EC3 A;  4X43 A;  4BPY A;  4OD7 A;  1TOF A;  1TK5 B;  1I5G A;  2LV3 A;  4ZB8 A;  5CAX A;  1OC9 A;  4NHW A;  2GZZ A;  3GNJ A;  3SWL A;  5IQY A;  2VCX A;  1DBY A;  4LA1 A;  1G6Y A;  5GZZ B;  4X0X A;  5INY A;  3DML A;  1LU4 A;  5ID2 B;  1GP1 A;  3TDG A;  3C1R A;  2PER A;  5JWO B;  2XC2 A;  3UVT A;  5GSS A;  3TOU A;  3VLN A;  3QAG A;  1PKW A;  4JZQ A;  5HFG A;  1GSQ A;  3UVH A;  2PBJ A;  3FZ4 A;  4WBR D;  2FWH A;  3R2Q A;  2H0G A;  5CRH A;  1QUW A;  5IOW A;  1VRS D;  3F6D A;  3LXZ A;  2L6D A;  2ZUP A;  1UVZ A;  5F0G A;  3E9J B;  5J5N A;  3CRU A;  5ECN B;  5IMZ A;  3D0Z A;  4KCE A;  3HYP A;  4NV5 A;  1ON4 A;  3A2X A;  5D93 A;  3I6A A;  4DSR A;  4PNF A;  1OKT A;  3VUR A;  2HSY A;  4LLR A;  5DAK A;  4EUY A;  3DGQ A;  3ZFL A;  2PVQ A;  1IYH A;  4MCU A;  3TOT A;  3EWL A;  4EDZ A;  2CVK A;  4PX1 A;  2FUG 2;  4FYU A;  3M9K A;  3HZ8 A;  1M9B A;  1K0M A;  1Z7P A;  2IN3 A;  3UIW A;  1BJX A;  4ZL9 A;  6GSV A;  5GST A;  3L9V A;  5DDL A;  5JCG A;  3KP9 A;  3LYP A;  2C4J A;  5DJL A;  1TP9 A;  4YAP A;  4POK A;  5DCG A;  3IA1 A;  1YEP A;  5E4W A;  5CRG A;  4IBP A;  2MBS A;  3HKR A;  3ZVJ D;  3NOF A;  2MMZ A;  1SD9 A;  5B8B A;  1HNB A;  3G7J A;  4BVX A;  4MJB A;  3IK9 A;  3I69 A;  3CSH A;  1SL1 B;  4NWY A;  1VF2 A;  3UBL A;  1GUL A;  3W8S A;  5H5Q A;  4BL7 B;  1MD4 A;  1Z3E A;  2LRC A;  4KW6 A;  1MD3 A;  4E8H A;  2N5F A;  2GVP A;  1B4P A;  4GF0 A;  1DUG A;  4FYB A;  2HNL A;  1TI1 A;  4IJI A;  1PQN A;  5CP1 A;  2CVB A;  1F3B A;  3LEF A;  1TK0 B;  3FR9 A;  4ACS A;  4GST A;  4MK3 A;  3TKP A;  4HOJ A;  5A4V A;  4HQS A;  3L9S A;  3ZRE A;  2VL9 A;  1BED A;  5GAN D;  1NM3 A;  1M7T A;  3I43 A;  2DBC A;  3ISO A;  4N30 A;  1A23 A;  4WET A;  4WEY A;  3M8N A;  1ILO A;  2YOI A;  3DD3 A;  1Z6M A;  1GH2 A;  2R5G A;  2H73 A;  2EIQ A;  2H6Y A;  4TR4 A;  4K0N A;  3Q19 A;  4H86 A;  1X0R A;  4WF5 A;  1JFU A;  2A2S A;  1ZL9 A;  3ERW A;  2L5O A;  3HD5 A;  2DJJ A;  3ZFB A;  4KA0 A;  2GSR A;  2DLX A;  1Q4J A;  4EC0 A;  1YY7 A;  3FW2 A;  2F3M A;  2HRK A;  2IMF A;  4PXO A;  3DVW A;  4ISD A;  3PIN A;  2H74 A;  5IMD A;  1H4O A;  5G2Z A;  4X1U A;  3ME7 A;  4JBB A;  5AN1 A;  1YKC A;  3QFB C;  2C3Q A;  4KDX A;  5DAL B;  4POL A;  16GS A;  3L4N A;  2OE3 A;  3BCI A;  1G7O A;  4AJ6 A;  2H1B A;  5F05 A;  1ZYE A;  3IK7 A;  1SJI A;  3EUR A;  4HDE A;  2CAI A;  5KN0 A;  4HJ2 A;  1WE0 A;  2MMO A;  4Q5Q A;  2VM1 A;  2B5X A;  3D21 A;  3GN3 A;  2C3N A;  3F6F A;  2DML A;  5C04 A;  2B5E A;  3CTG A;  3E0U A;  3WGE A;  1YJ6 A;  1PX6 A;  2VD0 A;  1S3A A;  1AXD A;  2FWF A;  4GSS A;  5FWG A;  3GL3 A;  5CNW A;  4MH2 A;  2H0H A;  2OJL A;  4N0V A;  1SK1 A;  4QQ7 A;  4D73 B;  3TJF A;  1S3C A;  2P0G A;  2YNX A;  2BJX A;  4TVE A;  1EP8 A;  2QGV A;  2I4A A;  3OR5 A;  2PWJ A;  1MDJ A;  4CW9 A;  1FB0 A;  4TXO A;  3UJ1 A;  4TRX A;  1GLQ A;  2GQK A;  1HQO A;  5LD0 A;  1TKD B;  5IPH A;  4K1F A;  2HE3 A;  2WB9 A;  4F82 A;  4HU9 A;  3ED3 A;  1Z9H A;  2HZF A;  4YQV A;  1KBN A;  1W89 A;  2G0F A;  2H76 A;  2WDU A;  1I9D A;  3FEU A;  2J23 A;  2P31 A;  3PGT A;  2CA8 A;  4GSN A;  1AC1 A;  3RPN A;  3FRC A;  2TRX A;  1NW2 A;  4OFM A;  4WR5 A;  5C00 A;  4ML1 A;  2K9F A;  1B9Y C;  5D8I A;  5D96 A;  4RQX A;  3PR8 A;  1XW9 A;  5IMV A;  5AIV A;  2MZC A;  1ERW A;  2FA4 A;  3LJR A;  1A2M A;  1GL8 A;  1JHB A;  3KMO A;  2DJ0 A;  5IM9 A;  2VOC A;  2MBT A;  3IBH A;  2LUS A;  3PH9 A;  2ON7 A;  4NHZ A;  1U87 A;  1F9M A;  2CQ9 A;  4IP6 A;  4G19 A;  5ID2 A;  2FA8 A;  4MZC A;  1PKZ A;  2VO4 A;  4V2M A;  1GSD A;  5A5K A;  2ON5 A;  1AIU A;  2LQQ A;  2OE0 A;  4I6X A;  4LL4 B;  3C7M A;  4DEJ A;  3V1W A;  3ZL5 A;  4HI7 A;  4ILF A;  3EIN A;  5IMA A;  2LKU A;  4L8E A;  3TJK A;  2NTO A;  3ZML A;  2WS2 A;  3F8U A;  4DSS B;  2EIR A;  1GSE A;  1AUC A;  3NZN A;  1DSB A;  2HT9 A;  2XPD A;  5F07 A;  3LFL A;  4IN0 A;  3IC8 A;  1MDK A;  2C80 A;  5IMF A;  3U6V A;  3NIV A;  2B7K A;  3IR4 A;  2PU9 C;  1A2J A;  2RII A;  4N10 A;  1XOB A;  3C73 A;  3QPM A;  3FY7 A;  4PNG A;  3GL5 A;  4HQZ A;  1FVK A;  1OVN A;  2TIR A;  1X9M B;  4PUF C;  5IIZ A;  2AB6 A;  5B8A A;  6GST A;  2NPB A;  2C1Y A;  1T4Z A;  3P90 A;  4ZL7 A;  1A0F A;  3KCM A;  1AAZ A;  2LQO A;  4LMW A;  1YF0 A;  2H70 A;  3ERG A;  5ECL B;  4XS4 B;  3FKF A;  3UEM A;  4MH3 A;  1TRS A;  2O85 A;  4RI7 A;  4JR4 A;  1WOU A;  3BCK A;  1ABA A;  1THX A;  2LRT A;  2FWE A;  3ZMK A;  2VLV A;  5J41 A;  3VWU A;  3C71 A;  3GKK A;  4ZBA A;  1PX7 A;  1U3I A;  5HR1 A;  4ECC A;  4JE1 A;  3VWV A;  4Q5R A;  5FHI A;  4EF0 A;  1QGV A;  2H72 A;  3GH9 A;  4MAB A;  2PN8 A;  1B48 A;  1TW9 A;  3GKM A;  3J7Y k;  4TR1 A;  4IQA A;  2IWT A;  2OBK A;  4HU7 A;  3PPU A;  5GAP D;  2UZ8 A;  1XWB A;  4AGS A;  2BTO T;  2H8L A;  3UL3 A;  4NV2 A;  2B3S A;  3VWW A;  2DJ2 A;  5L71 A;  2GDR A;  3H8Q A;  1M2A A;  3TCO A;  2K8S A;  3QMX A;  2GSQ A;  3W6G A;  2LRN A;  1UN2 A;  1EOG A;  2GST A;  2HRF A;  1R7H A;  2ZCT A;  4NPB A;  19GS A;  4HEA 2;  4EL1 A;  2AJQ B;  1WPI A;  2GGT A;  1FHE A;  2Z9S A;  2O89 A;  4K7I A;  1XCC A;  3EE2 A;  1U6T A;  2WFC A;  3TUE A;  1EOH A;  2JAC A;  1JLW A;  1Z6N A;  4MJE A;  1TRV A;  1USB A;  4OFT A;  3CYN A;  2LNS A;  2GLR A;  2TRC P;  1QK8 A;  4IJ3 A;  1G0T A;  2H30 A;  3ZIV A;  5HR3 A;  1XFL A;  2D2Z A;  1AQW A;  3MWH A;  2YCD A;  4MF5 A;  3TGZ A;  2M46 A;  4K8M A;  2B6M A;  1UC7 A;  1ERV A;  3VPT A;  3KIJ A;  1Q98 A;  4TR0 A;  2FLS A;  1EP7 A;  2L6C A;  1AQX A;  2L57 A;  4KSM A;  4G10 A;  2LJR A;  4EE0 A;  4TXV A;  4PUA A;  1C72 A;  2GQM A;  2ALB A;  11GS A;  2G2Q A;  1EEJ A;  3ME8 A;  1XW6 A;  4FYC A;  1ERU A;  1SYR A;  3IOS A;  2F51 A;  4AJ7 A;  2H6Z A;  4IVF A;  2O87 A;  1ZCP A;  2C0G A;  2HLS A;  1O8W A;  1SK0 A;  1XVW A;  1BYE A;  1MDI A;  2R4V A;  4NAX A;  4D73 A;  2OKA A;  3MSZ A;  5ABR A;  3UAR A;  1XWC A;  3QCP A;  1PA3 A;  1BG5 A;  1EV9 A;  2H1D A;  4Q5N A;  3IDV A;  1GSF A;  1TTZ A;  3F3Q A;  2WGR A;  2HXK A;  1CQG A;  3GKN A;  2EC4 A;  2CX4 A;  3UMA A;  3MAK A;  3UOM A;  4FQU A;  1GUM A;  1GSU A;  4QL9 A;  1V58 A;  3APO A;  4ID0 A;  3Q6O A;  3SBC A;  4MF6 A;  1DE1 A;  1A8Y A;  3GRX A;  1YKA A;  2LST A;  2KP2 A;  2H19 A;  4ZBB A;  3F0I A;  2A4V A;  1WP0 A;  5IO2 A;  5ELG A;  3FHK A;  2CVD A;  2VM2 A;  2CV4 A;  2GS3 A;  3HCZ A;  1M0U A;  2JSZ A;  3GST A;  1OAZ A;  2H1A A;  3Q18 A;  3QOU A;  2IFQ B;  1YF1 A;  4EO3 A;  1BX9 A;  1SJ6 A;  3HVX A;  3K8N A;  2NVL A;  3JCM L;  5HFI A;  1YZX A;  1F2E A;  4BA7 A;  1V40 A;  3CRT A;  2M80 A;  5KN2 A;  3IAS 2;  1FAA A;  2B1K A;  3BOA A;  4XRD A;  5EL8 A;  4Z7X A;  5CRW A;  5DQY A;  2JU5 A;  4KX4 A;  4EVM A;  2B1L A;  4FO5 A;  4PGT A;  2AYT A;  1F37 A;  3GX8 A;  3GKX A;  9GSS A;  3GSS A;  1V98 A;  4KB3 A;  1O8X A;  3WD6 A;  4J57 E;  2H66 A;  1AQV A;  2YWO A;  2M72 A;  3APQ A;  2LJA A;  4I2U A;  3EMP A;  4F03 A;  2B5Y A;  1UA5 A;  5AIS A;  2HZE B;  1OC9 B;  1M9A A;  2IPA A;  4YH2 A;  2AUV A;  3G9B A;  4KF9 A;  1JZR A;  2IJY A;  3P7X A;  4MJC A;  2YP6 A;  3F63 A;  1TU7 A;  4MF7 A;  4L0W A;  5DCH A;  2E0Q A;  4I5Q A;  3A2V A;  4OO4 A;  4RI6 A;  1Z5Y E;  1GNE A;  1SL2 B;  1THO A;  3GV1 A;  2H75 A;  2FCH A;  1PD2 1;  1FW1 A;  3CBU A;  3TKQ A;  1XOA A;  4OFN A;  2CX3 A;  4ECI A;  4USS A;  4K6X A;  3D22 A;  2OE1 A;  5D9W A;  5LNK e;  1QXH A;  4PQH A;  2RM6 A;  1TXX A;  2FGX A;  2VUP A;  1SJZ A;  2YWN A;  2GT6 A;  1LBK A;  6GSX A;  3H1N A;  2CZ2 A;  1ERT A;  3VI5 A;  3ZYW A;  4IQ1 A;  1K3O A;  1JZO A;  2R3X A;  5D9X A;  1JLV A;  1PL2 A;  3GHA A;  3F4T A;  5DAK B;  1O7U A;  4GLT A;  2GZY A;  4KH7 A;  1F3A A;  5B7C A;  1ACV A;  3QD9 A;  2WZ9 A;  2P5R A;  4IEL A;  3KD0 A;  3GTU A;  2LS5 A;  3TRP A;  4WKW A;  2H6X A;  5IPG A;  4QL7 A;  2E2G A;  3LWA A;  3W8J A;  4RQR A;  1G7E A;  2VIM A;  5HFK A;  2X8C A;  1WJK A;  1VF4 A;  4TOP A;  4OWY A;  3US3 A;  5JCW A;  4OMV A;  12GS A;  1G6W A;  3TKS E;  3APS A;  3HZ4 A;  3ZVJ A;  2ZNM A;  2RUE A;  5HR2 A;  4XS6 A;  4BVX B;  3QFA C;  3KXO A;  2PVO C;  14GS A;  2VCZ A;  2L4Q A;  2C8U A;  3KMN A;  3C1S A;  2NDO A;  2JL4 A;  5CRD A;  3GIX A;  3L78 A;  1X5D A;  4YQM A;  2RUF A;  4GQF A;  2O8V B;  3J7Y b;  5DQS A;  1PL1 A;  3G7Y A;  2GTU A;  3GFK A;  1JZW A;  2XBI A;  2PMT A;  2XBQ A;  3TRX A;  2L4C A;  3D4M A;  3QDN A;  18GS A;  5FT3 A;  1QFN A;  4KE3 A;  3C8E A;  3A3T A;  2V32 A;  3IRA A;  4AJ8 A;  1HNC A;  1PSQ A;  3KM6 A;  2JZT A;  1Y6E A;  5KN1 A;  1YDK A;  4MMM A;  3DIE A;  5J3R A;  2XPE A;  1TU8 A;  3IE3 A;  5KN3 A;  2C0D A;  5HR0 A;  1FOV A;  6GSU A;  3VWX A;  2HRK B;  1GNW A;  2HQT A;  2K8V A;  3EU3 A;  5ECH B;  4NXI A;  4TR3 A;  1V9W A;  1XZO A;  4BVY B;  3HVV A;  5EVO A;  1K3Y A;  3O76 A;  2MMA A;  2DJK A;  4OO5 A;  4ULX A;  3LG6 A;  1OYJ A;  1GTA A;  5DVB A;  1A8L A;  4POM A;  1X9W B;  1GTB A;  5ECM B;  3M1G A;  1XW5 A;  2HSM B;  20GS A;  1MTC A;  5AGY A;  1BAY A;  2R2J A;  4EDY A;  1GTI A;  3AY8 A;  4OCE A;  4YQU A;  2I9H A;  4L5L A;  4I2T A;  1SEN A;  2DC5 A;  3HXS A;  1URM A;  4MDC A;  3KEB A;  2CAQ A;  4BL7 A;  3FZ9 A;  4G0K A;  1EZK A;  3GUS A;  5G5F A;  1Z7R A;  5F8B A;  2V6O A;  2MYG A;  4WF4 A;  3H4K A;  1HNA A;  2H71 A;  2DJ1 A;  1WIK A;  3TKS A;  1RK4 A;  4O92 A;  1GLP A;  3ERF A;  4Q5F A;  4J2F A;  3HJP A;  3N5O A;  13GS A;  1PN9 A;  1M2B A;  1R5A A;  1YQ1 A;  3N9J A;  4OCF A;  3A2W A;  4E8E A;  3QAW A;  5G1L A;  5EPF A;  3VPQ A;  3FR3 A;  5JCU A;  2VCV A;  4ZB9 A;  2QKE A;  4V2L A;  2GSS A;  2KHP A;  4HZ2 A;  4TW5 A;  3L0H A;  1JZD A;  4IW9 A;  2OBI A;  2L5L A;  3I9V 2;  1CQH A;  2CT6 A;  6GSW A;  4NMU A;  2MMN A;  2FWG A;  3DRN A;  5LCZ A;  2HSH A;  1EEM A;  5H5R A;  1AW9 A;  2VL2 A;  1SYX A;  1VF1 A;  1ZYQ B;  4F0B A;  2F9S A;  2LTK A;  4KGI A;  2H1G A;  2JZR A;  2REM A;  1OKD A;  4LL1 B;  4IKH A;  4KND A;  3GX0 A;  3LXT A;  1EV4 A;  5EY6 A;  5KEJ A;  1IYI A;  3HJO A;  2KLX A;  2YV9 A;  5F06 A;  3WT1 A;  1KTE A;  2HFD A;  4ECB A;  2E2M A;  2X64 A;  5DAL A;  5D9V A;  2HZE A;  2LEG A;  1T7P B;  1VF3 A;  4G9H A;  1T8E B;  1FO5 A;  2AAW A;  2VCW A;  5G1K A;  4N11 A;  1M2D A;  4FH8 A;  1VGL A;  4XIH A;  3M9J A;  3M3M A;  1K0N A;  2HSN B;  4TKY A;  4ZIJ A;  3UBK A;  4XRA A;  2YJ7 A;  5ECP B;  3P8W A;  2BMX A;  3ZIJ A;  3UAP A;  3TJB A;  1HD2 A;  7GSS A;  2YAN A;  1XWA A;  3DVX A;  4V1A g;  4BWQ A;  1NHY A;  2R37 A;  3TKR A;  1RQM A;  3GUR A; 
#chains in the Genus database with same CATH topology
 4ZBD A;  5G30 A;  5HQP A;  2N5B A;  3ZZX A;  2IMK A;  3GMF A;  2WVX A;  2WVZ A;  2VD1 A;  1O6J A;  3CXG A;  4J56 E;  1GSS A;  1J08 A;  3KGK A;  3LQ7 A;  2NBS A;  1R4W A;  3M0F A;  3RHC A;  4ZIL A;  1F6M C;  6GSS A;  2PUK C;  3RBT A;  1T00 A;  3WYW A;  4HUA A;  2OA7 A;  4MLY A;  1SL0 B;  3IC4 A;  2H0I A;  4ZL8 A;  4K9Z A;  1E6B A;  1TK8 B;  4ZB6 A;  4HJM A;  1K0A A;  5ECS A;  4IP1 A;  1SKR B;  2FD3 A;  1SU9 A;  3HHV A;  1XIY A;  3G7I A;  4JED A;  1BQ7 A;  3F3R A;  1S3D A;  1K0D A;  1WWJ A;  2YN1 A;  2FHE A;  4JRR A;  17GS A;  1T3B A;  3TJJ A;  3KTB A;  1SK2 A;  2VL3 A;  3FK8 A;  3DXB A;  4G0L A;  1K0B A;  2PGT A;  5JWR B;  4O32 A;  4CY8 A;  5ENU A;  5AIX A;  2C0E A;  3KJY A;  1MEK A;  1ZOF A;  2DJ3 A;  4DSQ A;  2V6K A;  1J0F A;  1FOH A;  3U5R E;  4TR1 B;  2I3Y A;  3BBY A;  5G31 A;  1M99 A;  3E3E A;  4PTS A;  5COH A;  1TDI A;  2HYX A;  3A5W A;  1KEB A;  3HMJ G;  2VCQ A;  5A4W A;  1TJD A;  3CWG A;  3LSZ A;  3LGC A;  5ECO B;  2LNT A;  2I81 A;  2OAC A;  1J9B A;  2YJH A;  4WR4 A;  3F4R A;  5IOX A;  1DE2 A;  3TKS C;  3ZTL A;  4DSS A;  4P3Y B;  1EGO A;  1T4Y A;  4GRF A;  3WGD A;  1LJR A;  2AV4 A;  5A4U A;  2DMM A;  4I97 A;  4K2D A;  5ECR B;  1GUH A;  1ZMA A;  2A2R A;  4V2N A;  1QMV A;  2WCI A;  4KAE A;  1SKW B;  3EVI A;  2F8A A;  4XS1 A;  2A4H A;  1M3I A;  2CZ3 A;  3CTF A;  4K7O A;  4BVY A;  1PGT A;  3DYR A;  3FR6 A;  4GWR A;  4MNN A;  3S9F A;  4O5U A;  3O3T A;  2RLI A;  3KZQ A;  3ZIT A;  4MZB A;  3VFI A;  2IL3 A;  2DIZ A;  3HVS A;  1XXU A;  5BMU A;  2GQL A;  1K0O A;  3QR6 A;  4G2E A;  1EWX A;  3FYG A;  5CYY A;  1TRU A;  1B4Q A;  4EXJ A;  2AHE A;  4XHM A;  2VL2 C;  2HSM A;  4XS4 A;  5D73 A;  2DKI A;  1ST9 A;  3WGX A;  4POB A;  1NHO A;  4HZ4 A;  1E2Y A;  1KNG A;  4HSC X;  3LYK A;  1S3R A;  2K18 A;  4IHU A;  5IMC A;  3D4T A;  4IS0 A;  3DEX A;  3KH9 A;  5IO0 A;  1T1V A;  2QC7 A;  1U3A A;  3RPP A;  5G5E A;  4L5O A;  1B8X A;  3VK9 A;  4TN8 A;  1S4B P;  3KP8 A;  4EKZ A;  3D6I A;  4WBJ A;  2VLT A;  3TJG A;  2RM5 A;  4DVC A;  1ZGN A;  2WVY A;  5ELA A;  4AI6 A;  2X8H A;  4WXT A;  2V41 A;  2I1U A;  5J9C A;  4FIW A;  4JR6 A;  4GTU A;  1FG4 A;  1H75 A;  1A2L A;  4ECJ A;  4KSO A;  1X5C A;  22GS A;  2C3T A;  3EMX A;  4F9Z A;  1EGR A;  1N8J A;  2K6V A;  3TB2 A;  2YPM A;  1GWC A;  4CDO A;  1XPV A;  5CRE A;  4KDU A;  4O7H A;  4I8B A;  2QA1 A;  1V57 A;  3H79 A;  4PUR A;  1NSW A;  1PMT A;  2H01 A;  3MDK A;  4GCI A;  4FXY P;  2YV7 A;  4PQI A;  4KDY A;  2QSI A;  4HS1 A;  3VI7 A;  3FZ5 A;  4MPG A;  5J47 A;  1WRY A;  4YAV A;  2C0F A;  2WJU A;  2X4A A;  4MJA A;  4MP4 A;  1WMJ A;  2WUL A;  2IMI A;  2YWI A;  1XBS A;  5DBQ A;  1GSY A;  2FNO A;  2YWM A;  5ECI B;  3L9U A;  2KOK A;  1W4V A;  1OE8 A;  1OE7 A;  4MPF A;  1R5P A;  1TRW A;  1XG8 A;  1PFO A;  4N0Z A;  2L59 A;  2X8G A;  10GS A;  2HI7 A;  5H5S A;  3KH7 A;  1XVQ A;  2YZH A;  5D9T A;  4JU5 A;  6GSY A;  3F9U A;  3O6T A;  1U88 A;  3RAZ A;  3EYT A;  4BWS A;  1V2A A;  5B6N A;  3GH6 A;  3D5J A;  1OC3 A;  2J9H A;  4LMV A;  2VAF A;  3FMW A;  3GA4 A;  2HRN A;  3HA9 A;  1X9S B;  1YEX A;  2JAD A;  2O7K A;  3ZRD A;  2P5Q A;  5B6M A;  2EFD A;  4MA9 A;  4XTS A;  3KTL A;  1PN0 A;  3LOR A;  2YZU A;  3P2A A;  1GRX A;  3MNG A;  4PQ1 A;  5ECK B;  3HJM A;  2JZS A;  4F2I A;  3IHQ A;  1Y1U A;  3IAM 2;  2IMD A;  4ZXG A;  2OAD A;  1K0C A;  1K3L A;  2HRA A;  4MZW A;  4KCA A;  1SD8 A;  3HY2 A;  1TI3 A;  3CMI A;  3Q74 A;  2EIO A;  2LJK A;  1PRX A;  3TRQ A;  3IV4 A;  3QAV A;  2WRT A;  5DJM A;  1HYU A;  1O73 A;  3DWV A;  2IIY A;  4O5R A;  5A5H A;  3EU4 A;  1GUK A;  3ZLP A;  2IME A;  5E59 A;  1GTU A;  1OC8 A;  1R26 A;  8GSS A;  2XHF A;  1A24 A;  1ML6 A;  1SKS B;  4ZB7 A;  2GT5 A;  4KUN A;  3FZA A;  1FB6 A;  1B9X C;  3RDW A;  1O85 A;  3CSI A;  3RHB A;  1O81 A;  4A5P A;  4YKG A;  2R6K A;  2V2G A;  1XWG A;  2IFQ A;  2VCT A;  2KP1 A;  2KUC A;  2N5A A;  4G01 A;  2DSA A;  4V1A p;  2B7J A;  3DKS A;  5JWQ B;  4TXO B;  3CSJ A;  1Y25 A;  1QQ2 A;  1X5E A;  1N2A A;  2FY6 A;  2O5V A;  4K0G A;  4QMK A;  4GQC A;  4CHS A;  4N3Z A;  3F4S A;  3R3E A;  3BD2 A;  3GTU B;  2F8F A;  1XWK A;  2X99 A;  1SVL A;  4ML6 A;  3WT2 A;  2PPT A;  2GZP A;  5ECQ B;  2VLU A;  5CO3 A;  5J9B A;  4K7N A;  4K5S A;  4AF2 A;  3IPZ A;  4L0U A;  3HDC A;  2E7P A;  2V1M A;  4G0I A;  3IXR A;  3GYK A;  5J4U A;  4GXZ A;  1A0R P;  2JSY A;  2DIY A;  1SVM A;  4XCS A;  2ES7 A;  1ZZY A;  1FVJ A;  4IGJ A;  4F0C A;  3H93 A;  3BJ5 A;  4RUV A;  1RW1 A;  3EC3 A;  4X43 A;  4BPY A;  4OD7 A;  3HVN A;  1YEW C;  1TOF A;  1TK5 B;  1I5G A;  2LV3 A;  5A34 B;  4ZB8 A;  5CAX A;  1OC9 A;  4NHW A;  2GZZ A;  3GNJ A;  3SWL A;  3MYD A;  4E68 A;  5IQY A;  2VCX A;  1DBY A;  4LA1 A;  1G6Y A;  5GZZ B;  4X0X A;  5INY A;  3DML A;  1LU4 A;  5ID2 B;  1GP1 A;  3TDG A;  3C1R A;  2PER A;  5JWO B;  2XC2 A;  3UVT A;  5GSS A;  3TOU A;  3VLN A;  3QAG A;  1PKW A;  4JZQ A;  5HFG A;  1GSQ A;  3UVH A;  2PBJ A;  3FZ4 A;  4WBR D;  2FWH A;  3R2Q A;  2H0G A;  5CRH A;  1QUW A;  5IOW A;  2O3E A;  1VRS D;  3F6D A;  3LXZ A;  2L6D A;  2ZUP A;  1UVZ A;  5F0G A;  3E9J B;  5J5N A;  3CRU A;  5ECN B;  5IMZ A;  3D0Z A;  4KCE A;  3HYP A;  4NV5 A;  1ON4 A;  3A2X A;  5D93 A;  3I6A A;  4DSR A;  4PNF A;  1OKT A;  3VUR A;  2HSY A;  4LLR A;  5DAK A;  4EUY A;  3DGQ A;  3ZFL A;  2PVQ A;  1IYH A;  4Z2U A;  4MCU A;  3TOT A;  3EWL A;  4EDZ A;  2CVK A;  4PX1 A;  2FUG 2;  4FYU A;  3M9K A;  3HZ8 A;  1M9B A;  1K0M A;  1Z7P A;  2IN3 A;  3UIW A;  1BJX A;  4ZL9 A;  6GSV A;  5GST A;  3L9V A;  5DDL A;  5JCG A;  3KP9 A;  3LYP A;  2C4J A;  5DJL A;  1TP9 A;  4YAP A;  4POK A;  5DCG A;  3IA1 A;  1YEP A;  4PHZ C;  5E4W A;  3A5I A;  5CRG A;  4IBP A;  2MBS A;  1TXU A;  4GDF A;  3HKR A;  3ZVJ D;  3NOF A;  4AKI A;  2MMZ A;  1SD9 A;  4AKH A;  5B8B A;  1HNB A;  3G7J A;  4BVX A;  4MJB A;  3IK9 A;  3I69 A;  3CSH A;  1SL1 B;  4NWY A;  1VF2 A;  3UBL A;  1GUL A;  3W8S A;  5H5Q A;  4BL7 B;  1MD4 A;  1Z3E A;  2LRC A;  4KW6 A;  1MD3 A;  4E8H A;  2N5F A;  1BF5 A;  2GVP A;  1B4P A;  4GF0 A;  1DUG A;  4FYB A;  2HNL A;  1TI1 A;  4IJI A;  1PQN A;  5CP1 A;  2CVB A;  1F3B A;  3LEF A;  1TK0 B;  3FR9 A;  4ACS A;  4GST A;  4MK3 A;  3TKP A;  4HOJ A;  4BIK A;  5A4V A;  4HQS A;  3L9S A;  3ZRE A;  2VL9 A;  1BED A;  5GAN D;  1NM3 A;  1M7T A;  3I43 A;  2DBC A;  3ISO A;  4N30 A;  1A23 A;  4WET A;  4WEY A;  3M8N A;  1ILO A;  2YOI A;  3DD3 A;  1Z6M A;  5A1N A;  1GH2 A;  2R5G A;  2H73 A;  2EIQ A;  2H6Y A;  4TR4 A;  4K0N A;  3Q19 A;  4H86 A;  1X0R A;  4WF5 A;  1JFU A;  2A2S A;  2R0C A;  1ZL9 A;  3ERW A;  2L5O A;  3HD5 A;  2DJJ A;  3ZFB A;  4KA0 A;  5KOW A;  2WW3 A;  2GSR A;  2DLX A;  1Q4J A;  4EC0 A;  1YY7 A;  3FW2 A;  2F3M A;  2HRK A;  2IMF A;  2O36 A;  4PXO A;  3DVW A;  4ISD A;  3PIN A;  2H74 A;  5IMD A;  2UV8 G;  1H4O A;  5G2Z A;  4X1U A;  3ME7 A;  4JBB A;  5AN1 A;  1YKC A;  3QFB C;  2C3Q A;  4KDX A;  5DAL B;  4POL A;  16GS A;  3L4N A;  2OE3 A;  3BCI A;  1G7O A;  4AJ6 A;  2H1B A;  5F05 A;  1ZYE A;  3IK7 A;  1SJI A;  3EUR A;  3RFR C;  1M3J A;  4HDE A;  2CAI A;  3CHX C;  5KN0 A;  4HJ2 A;  1WE0 A;  2MMO A;  4Q5Q A;  2VM1 A;  2B5X A;  3D21 A;  3GN3 A;  2C3N A;  3F6F A;  2DML A;  5C04 A;  2B5E A;  3CTG A;  3E0U A;  3WGE A;  1YJ6 A;  1PX6 A;  2VD0 A;  1S3A A;  1AXD A;  2FWF A;  4GSS A;  5FWG A;  3GL3 A;  5CNW A;  4MH2 A;  2H0H A;  2OJL A;  4N0V A;  1SK1 A;  4QQ7 A;  4D73 B;  2WVX B;  3TJF A;  1S3C A;  2P0G A;  2YNX A;  2BJX A;  4TVE A;  1EP8 A;  2QGV A;  2I4A A;  3OR5 A;  2PWJ A;  1MDJ A;  4CW9 A;  1FB0 A;  4TXO A;  2WZS A;  3UJ1 A;  4TRX A;  1GLQ A;  2GQK A;  1HQO A;  5LD0 A;  1TKD B;  5IPH A;  4K1F A;  2HE3 A;  2WB9 A;  3IHG A;  4F82 A;  4HU9 A;  3ED3 A;  1Z9H A;  2HZF A;  4YQV A;  1KBN A;  1W89 A;  2G0F A;  2H76 A;  2WDU A;  1I9D A;  3FEU A;  2J23 A;  2P31 A;  3PGT A;  4EIP A;  2CA8 A;  4GSN A;  1AC1 A;  3RPN A;  3FRC A;  2TRX A;  1NW2 A;  4OFM A;  4WR5 A;  5C00 A;  4ML1 A;  2K9F A;  1B9Y C;  5D8I A;  5D96 A;  4RQX A;  3PR8 A;  1XW9 A;  3TU3 B;  5IMV A;  5AIV A;  2MZC A;  1ERW A;  2FA4 A;  3LJR A;  1A2M A;  1GL8 A;  1JHB A;  5A34 A;  3KMO A;  2WW2 A;  2DJ0 A;  5IM9 A;  2VOC A;  2MBT A;  2R0P A;  3IBH A;  4O5Q A;  2LUS A;  3PH9 A;  2ON7 A;  4NHZ A;  1U87 A;  1F9M A;  2HSN A;  2CQ9 A;  4IP6 A;  4G19 A;  5ID2 A;  2FA8 A;  4MZC A;  1PKZ A;  2VO4 A;  4PI0 C;  2A2P A;  4V2M A;  1GSD A;  5A5K A;  2ON5 A;  1AIU A;  2LQQ A;  2OE0 A;  4I6X A;  4LL4 B;  3C7M A;  4DEJ A;  3V1W A;  3ZL5 A;  4HI7 A;  4ILF A;  3EIN A;  5IMA A;  2LKU A;  4L8E A;  3TJK A;  2NTO A;  3ZML A;  2WS2 A;  3F8U A;  4ICY A;  4DSS B;  2EIR A;  1GSE A;  1AUC A;  3NZN A;  1DSB A;  2HT9 A;  2XPD A;  5F07 A;  3LFL A;  4IN0 A;  2DKH A;  3IC8 A;  1MDK A;  2C80 A;  5IMF A;  3U6V A;  3NIV A;  2B7K A;  3IR4 A;  2PU9 C;  1A2J A;  2RII A;  4N10 A;  1XOB A;  3C73 A;  3QPM A;  3FY7 A;  4PNG A;  3GL5 A;  4HQZ A;  1FVK A;  1OVN A;  3EPT A;  2EFE A;  2TIR A;  1X9M B;  4PUF C;  5IIZ A;  2AB6 A;  5B8A A;  2EFH A;  6GST A;  2NPB A;  2C1Y A;  1T4Z A;  3P90 A;  4ZL7 A;  1A0F A;  3KCM A;  1AAZ A;  5BMU B;  2LQO A;  4LMW A;  1YF0 A;  2H70 A;  3ERG A;  5ECL B;  4XS4 B;  3FKF A;  3UEM A;  4MH3 A;  1TRS A;  2O85 A;  4RI7 A;  4JR4 A;  3RGB C;  4AKG A;  1WOU A;  1ABA A;  3BCK A;  1THX A;  2LRT A;  2FWE A;  3ZMK A;  2VLV A;  5J41 A;  3VWU A;  3C71 A;  3GKK A;  3LW9 A;  4ZBA A;  1PX7 A;  1U3I A;  5HR1 A;  4ECC A;  4JE1 A;  3VWV A;  4Q5R A;  5FHI A;  4EF0 A;  1QGV A;  2H72 A;  3GH9 A;  4MAB A;  2PN8 A;  1B48 A;  1TW9 A;  3GKM A;  3J7Y k;  4TR1 A;  4IQA A;  2IWT A;  2OBK A;  4HU7 A;  3PPU A;  5GAP D;  2UZ8 A;  1XWB A;  4AGS A;  2BTO T;  2H8L A;  3UL3 A;  4NV2 A;  2B3S A;  3VWW A;  2DJ2 A;  5L71 A;  2GDR A;  3H8Q A;  1M2A A;  3TCO A;  2K8S A;  3QMX A;  2GSQ A;  3W6G A;  2LRN A;  1UN2 A;  1EOG A;  2GST A;  2HRF A;  1R7H A;  2ZCT A;  4NPB A;  19GS A;  4HEA 2;  4EL1 A;  2AJQ B;  1WPI A;  2GGT A;  1FHE A;  2Z9S A;  2O89 A;  4K7I A;  1XCC A;  3EE2 A;  1U6T A;  2WFC A;  3TUE A;  4AKX B;  1EOH A;  2JAC A;  1JLW A;  1Z6N A;  4MJE A;  1TRV A;  1USB A;  4OFT A;  3CYN A;  2LNS A;  2GLR A;  2TRC P;  1QK8 A;  4IJ3 A;  1G0T A;  2H30 A;  3ZIV A;  5HR3 A;  1XFL A;  2D2Z A;  1AQW A;  3MWH A;  2YCD A;  4MF5 A;  3TGZ A;  2M46 A;  4K8M A;  2B6M A;  1UC7 A;  1ERV A;  3VPT A;  3KIJ A;  1Q98 A;  4TR0 A;  2FLS A;  1EP7 A;  5J4Y A;  2L6C A;  1AQX A;  2L57 A;  4KSM A;  4G10 A;  2LJR A;  4EE0 A;  4TXV A;  4PUA A;  1C72 A;  2GQM A;  2ALB A;  11GS A;  2G2Q A;  1EEJ A;  3ME8 A;  1XW6 A;  4FYC A;  1ERU A;  1SYR A;  3IOS A;  2F51 A;  4AJ7 A;  2H6Z A;  4IVF A;  2O87 A;  1ZCP A;  2C0G A;  2HLS A;  1O8W A;  1SK0 A;  1XVW A;  1BYE A;  1MDI A;  2R4V A;  4NAX A;  4D73 A;  1N25 A;  2OKA A;  3MSZ A;  5ABR A;  3UAR A;  1XWC A;  3QCP A;  1PA3 A;  1BG5 A;  1EV9 A;  2H1D A;  4Q5N A;  3IDV A;  1GSF A;  1TTZ A;  3F3Q A;  2WGR A;  2HXK A;  1CQG A;  3GKN A;  2EC4 A;  2CX4 A;  3UMA A;  3MAK A;  3UOM A;  4FQU A;  2EFC A;  1GUM A;  1GSU A;  4QL9 A;  1V58 A;  5A5H B;  3APO A;  4ID0 A;  3Q6O A;  3SBC A;  4MF6 A;  1DE1 A;  1A8Y A;  3GRX A;  1YKA A;  2LST A;  2KP2 A;  2H19 A;  1BG1 A;  4ZBB A;  3F0I A;  2A4V A;  1WP0 A;  5IO2 A;  5ELG A;  3FHK A;  2CVD A;  2VM2 A;  2CV4 A;  2GS3 A;  3HCZ A;  1M0U A;  2JSZ A;  3GST A;  1OAZ A;  2H1A A;  3Q18 A;  3QOU A;  2IFQ B;  1YF1 A;  4EO3 A;  1BX9 A;  1SJ6 A;  3HVX A;  2VKZ G;  3K8N A;  2NVL A;  3JCM L;  5HFI A;  1YZX A;  1F2E A;  4BA7 A;  1V40 A;  3CRT A;  2M80 A;  5KN2 A;  3IAS 2;  1FAA A;  2B1K A;  3BOA A;  4XRD A;  5EL8 A;  4Z7X A;  5CRW A;  5DQY A;  2JU5 A;  4KX4 A;  4EVM A;  2B1L A;  4FO5 A;  4PGT A;  2AYT A;  1F37 A;  3GX8 A;  3GKX A;  9GSS A;  3GSS A;  1V98 A;  2QA2 A;  4KB3 A;  1O8X A;  3WD6 A;  4J57 E;  2H66 A;  1AQV A;  2YWO A;  2M72 A;  3APQ A;  2LJA A;  4I2U A;  3EMP A;  4F03 A;  2B5Y A;  1UA5 A;  5AIS A;  2HZE B;  1OC9 B;  1M9A A;  2IPA A;  4YH2 A;  2AUV A;  3G9B A;  4KF9 A;  1JZR A;  1YVL A;  2IJY A;  3P7X A;  4MJC A;  2YP6 A;  3F63 A;  1TU7 A;  4MF7 A;  4L0W A;  5DCH A;  4W66 A;  2E0Q A;  4I5Q A;  3A2V A;  4OO4 A;  4RI6 A;  1Z5Y E;  1GNE A;  1SL2 B;  1THO A;  3GV1 A;  2H75 A;  2FCH A;  1PD2 1;  1FW1 A;  3CBU A;  3TKQ A;  1XOA A;  4OFN A;  2CX3 A;  4ECI A;  4USS A;  4K6X A;  3D22 A;  2OE1 A;  5D9W A;  5LNK e;  1QXH A;  4PQH A;  2RM6 A;  1TXX A;  2FGX A;  4K2X A;  2VUP A;  1SJZ A;  2YWN A;  2GT6 A;  1LBK A;  6GSX A;  3MIX A;  3H1N A;  2CZ2 A;  1ERT A;  3VI5 A;  3ZYW A;  4IQ1 A;  1K3O A;  1ZYP A;  1JZO A;  2R3X A;  2OT3 A;  4Z2T A;  5D9X A;  1JLV A;  1PL2 A;  3GHA A;  3F4T A;  5DAK B;  1O7U A;  4GLT A;  2GZY A;  4KH7 A;  1F3A A;  5B7C A;  1ACV A;  3QD9 A;  2WZ9 A;  2P5R A;  4IEL A;  3KD0 A;  1ZYN A;  4PI2 C;  3GTU A;  2LS5 A;  3TRP A;  4WKW A;  4EIQ A;  2H6X A;  5IPG A;  4QL7 A;  2E2G A;  3LWA A;  3W8J A;  4RQR A;  1G7E A;  2VIM A;  5HFK A;  3CQF A;  2X8C A;  2WW1 A;  1WJK A;  1VF4 A;  4TOP A;  4OWY A;  3US3 A;  5JCW A;  4OMV A;  12GS A;  1G6W A;  3TKS E;  3APS A;  3HZ4 A;  3ZVJ A;  2ZNM A;  2RUE A;  5HR2 A;  4XS6 A;  4BVX B;  3QFA C;  5J40 A;  3KXO A;  2X49 A;  2PVO C;  14GS A;  2VCZ A;  2L4Q A;  2C8U A;  3KMN A;  3C1S A;  2NDO A;  2JL4 A;  5CRD A;  3GIX A;  3L78 A;  1X5D A;  4YQM A;  4CY6 A;  2RUF A;  4GQF A;  2O8V B;  3J7Y b;  5DQS A;  1PL1 A;  3G7Y A;  2GTU A;  3GFK A;  1JZW A;  1I1I P;  2XBI A;  2PMT A;  2XBQ A;  3TRX A;  2L4C A;  3D4M A;  3QDN A;  18GS A;  5FT3 A;  1QFN A;  5A1N B;  4KE3 A;  3C8E A;  3A3T A;  2V32 A;  3IRA A;  4AJ8 A;  1HNC A;  1PSQ A;  3KM6 A;  2JZT A;  1Y6E A;  5KN1 A;  1YDK A;  4MMM A;  3DIE A;  5J3R A;  2XPE A;  1TU8 A;  3IE3 A;  5KN3 A;  2C0D A;  5HR0 A;  1FOV A;  6GSU A;  3VWX A;  2HRK B;  1GNW A;  2HQT A;  2K8V A;  3EU3 A;  5ECH B;  4NXI A;  4TR3 A;  1V9W A;  1XZO A;  4BVY B;  3HVV A;  5EVO A;  1K3Y A;  3O76 A;  2MMA A;  2DJK A;  4OO5 A;  4ULX A;  3LG6 A;  1OYJ A;  1GTA A;  5DVB A;  1A8L A;  4POM A;  1X9W B;  5J4V A;  1GTB A;  5ECM B;  3M1G A;  1XW5 A;  2HSM B;  4YKF A;  20GS A;  1MTC A;  2WW0 A;  5AGY A;  1BAY A;  2R2J A;  4EDY A;  1GTI A;  2H1L A;  3AY8 A;  4OCE A;  4YQU A;  2I9H A;  4L5L A;  4I2T A;  1SEN A;  2DC5 A;  3HXS A;  1URM A;  4MDC A;  3KEB A;  2CAQ A;  4BL7 A;  3FZ9 A;  4G0K A;  1EZK A;  3GUS A;  5G5F A;  1Z7R A;  5F8B A;  2V6O A;  2MYG A;  4WF4 A;  3H4K A;  1HNA A;  2H71 A;  2DJ1 A;  1WIK A;  3TKS A;  1RK4 A;  4O92 A;  1GLP A;  3ERF A;  4Q5F A;  4J2F A;  3HJP A;  3N5O A;  13GS A;  1PN9 A;  1M2B A;  1R5A A;  1YQ1 A;  3N9J A;  4OCF A;  3A2W A;  4E8E A;  3QAW A;  4X4J A;  5G1L A;  5EPF A;  3VPQ A;  3FR3 A;  5JCU A;  2VCV A;  4ZB9 A;  2QKE A;  4V2L A;  4K5R A;  2GSS A;  2KHP A;  4HZ2 A;  4TW5 A;  3L0H A;  1JZD A;  4IW9 A;  2OBI A;  2L5L A;  3I9V 2;  1CQH A;  2CT6 A;  6GSW A;  4NMU A;  2R0G A;  2MMN A;  2FWG A;  3DRN A;  5LCZ A;  2HSH A;  1EEM A;  5H5R A;  1AW9 A;  2VL2 A;  1SYX A;  1VF1 A;  1ZYQ B;  4F0B A;  2F9S A;  2LTK A;  4KGI A;  2H1G A;  2JZR A;  2REM A;  1OKD A;  4LL1 B;  4IKH A;  4KND A;  3GX0 A;  3LXT A;  1EV4 A;  5EY6 A;  5KEJ A;  1IYI A;  3HJO A;  2KLX A;  1SVO A;  2YV9 A;  5F06 A;  3WT1 A;  1KTE A;  2HFD A;  5KOX A;  4ECB A;  5BRT A;  2E2M A;  2X64 A;  5DAL A;  5D9V A;  2HZE A;  2LEG A;  1T7P B;  1VF3 A;  4G9H A;  1T8E B;  1FO5 A;  2AAW A;  2VCW A;  5G1K A;  4N11 A;  1M2D A;  4FH8 A;  1VGL A;  4XIH A;  3M9J A;  3M3M A;  1K0N A;  2HSN B;  4TKY A;  4ZIJ A;  3UBK A;  4XRA A;  2YJ7 A;  5ECP B;  3P8W A;  2BMX A;  3ZIJ A;  3UAP A;  3TJB A;  1HD2 A;  7GSS A;  2YAN A;  1XWA A;  3DVX A;  4V1A g;  4BWQ A;  1NHY A;  2R37 A;  3TKR A;  1RQM A;  3GUR A;  4Z2R A; 
#chains in the Genus database with same CATH homology
 4ZBD A;  5G30 A;  5HQP A;  2N5B A;  3ZZX A;  2IMK A;  3GMF A;  2VD1 A;  1O6J A;  3CXG A;  4J56 E;  1GSS A;  1J08 A;  3KGK A;  3LQ7 A;  2NBS A;  1R4W A;  3M0F A;  3RHC A;  4ZIL A;  1F6M C;  6GSS A;  2PUK C;  3RBT A;  1T00 A;  3WYW A;  4HUA A;  2OA7 A;  4MLY A;  1SL0 B;  3IC4 A;  2H0I A;  4ZL8 A;  4K9Z A;  1E6B A;  1TK8 B;  4ZB6 A;  4HJM A;  1K0A A;  5ECS A;  4IP1 A;  1SKR B;  2FD3 A;  1SU9 A;  3HHV A;  1XIY A;  3G7I A;  4JED A;  1BQ7 A;  3F3R A;  1S3D A;  1K0D A;  1WWJ A;  2YN1 A;  2FHE A;  4JRR A;  17GS A;  1T3B A;  3TJJ A;  3KTB A;  1SK2 A;  2VL3 A;  3FK8 A;  3DXB A;  4G0L A;  1K0B A;  2PGT A;  5JWR B;  4O32 A;  4CY8 A;  5ENU A;  5AIX A;  2C0E A;  3KJY A;  1MEK A;  1ZOF A;  2DJ3 A;  4DSQ A;  2V6K A;  1J0F A;  1FOH A;  3U5R E;  4TR1 B;  2I3Y A;  3BBY A;  5G31 A;  1M99 A;  3E3E A;  4PTS A;  5COH A;  1TDI A;  2HYX A;  3A5W A;  1KEB A;  3HMJ G;  2VCQ A;  5A4W A;  1TJD A;  3CWG A;  3LSZ A;  3LGC A;  5ECO B;  2LNT A;  2I81 A;  2OAC A;  1J9B A;  2YJH A;  4WR4 A;  3F4R A;  5IOX A;  1DE2 A;  3TKS C;  3ZTL A;  4DSS A;  4P3Y B;  1EGO A;  1T4Y A;  4GRF A;  3WGD A;  1LJR A;  2AV4 A;  5A4U A;  2DMM A;  4I97 A;  4K2D A;  5ECR B;  1GUH A;  1ZMA A;  2A2R A;  4V2N A;  1QMV A;  2WCI A;  4KAE A;  1SKW B;  3EVI A;  2F8A A;  4XS1 A;  2A4H A;  2CZ3 A;  3CTF A;  4K7O A;  4BVY A;  1PGT A;  3DYR A;  3FR6 A;  4GWR A;  4MNN A;  3S9F A;  4O5U A;  3O3T A;  2RLI A;  3KZQ A;  3ZIT A;  4MZB A;  3VFI A;  2IL3 A;  2DIZ A;  3HVS A;  1XXU A;  5BMU A;  2GQL A;  1K0O A;  3QR6 A;  4G2E A;  1EWX A;  3FYG A;  5CYY A;  1TRU A;  1B4Q A;  4EXJ A;  2AHE A;  4XHM A;  2VL2 C;  2HSM A;  4XS4 A;  5D73 A;  2DKI A;  1ST9 A;  3WGX A;  4POB A;  1NHO A;  4HZ4 A;  1E2Y A;  1KNG A;  3LYK A;  2K18 A;  4IHU A;  5IMC A;  3D4T A;  4IS0 A;  3DEX A;  3KH9 A;  5IO0 A;  1T1V A;  2QC7 A;  1U3A A;  3RPP A;  5G5E A;  4L5O A;  1B8X A;  3VK9 A;  4TN8 A;  3KP8 A;  4EKZ A;  3D6I A;  4WBJ A;  2VLT A;  3TJG A;  2RM5 A;  4DVC A;  1ZGN A;  5ELA A;  4AI6 A;  2X8H A;  4WXT A;  2V41 A;  2I1U A;  5J9C A;  4FIW A;  4JR6 A;  4GTU A;  1FG4 A;  1H75 A;  1A2L A;  4ECJ A;  4KSO A;  1X5C A;  22GS A;  2C3T A;  3EMX A;  4F9Z A;  1EGR A;  1N8J A;  2K6V A;  3TB2 A;  2YPM A;  1GWC A;  4CDO A;  1XPV A;  5CRE A;  4KDU A;  4O7H A;  4I8B A;  2QA1 A;  1V57 A;  3H79 A;  4PUR A;  1NSW A;  1PMT A;  3MDK A;  4GCI A;  2H01 A;  2YV7 A;  4PQI A;  4KDY A;  2QSI A;  4HS1 A;  3VI7 A;  3FZ5 A;  4MPG A;  5J47 A;  1WRY A;  4YAV A;  2C0F A;  2WJU A;  2X4A A;  4MJA A;  4MP4 A;  1WMJ A;  2WUL A;  2IMI A;  2YWI A;  1XBS A;  5DBQ A;  1GSY A;  2FNO A;  2YWM A;  5ECI B;  3L9U A;  2KOK A;  1W4V A;  1OE8 A;  1OE7 A;  4MPF A;  1R5P A;  1TRW A;  4N0Z A;  2L59 A;  2X8G A;  10GS A;  2HI7 A;  5H5S A;  3KH7 A;  1XVQ A;  2YZH A;  5D9T A;  4JU5 A;  6GSY A;  3F9U A;  3O6T A;  1U88 A;  3RAZ A;  3EYT A;  4BWS A;  1V2A A;  5B6N A;  3GH6 A;  3D5J A;  1OC3 A;  2J9H A;  4LMV A;  2VAF A;  3FMW A;  3GA4 A;  2HRN A;  3HA9 A;  1X9S B;  1YEX A;  2JAD A;  2O7K A;  3ZRD A;  2P5Q A;  5B6M A;  2EFD A;  4MA9 A;  4XTS A;  3KTL A;  1PN0 A;  3LOR A;  2YZU A;  3P2A A;  1GRX A;  3MNG A;  4PQ1 A;  5ECK B;  3HJM A;  2JZS A;  4F2I A;  3IHQ A;  1Y1U A;  3IAM 2;  2IMD A;  4ZXG A;  2OAD A;  1K0C A;  1K3L A;  2HRA A;  4MZW A;  4KCA A;  1SD8 A;  3HY2 A;  1TI3 A;  3CMI A;  3Q74 A;  2EIO A;  2LJK A;  1PRX A;  3TRQ A;  3IV4 A;  3QAV A;  2WRT A;  5DJM A;  1HYU A;  1O73 A;  3DWV A;  2IIY A;  4O5R A;  5A5H A;  3EU4 A;  1GUK A;  3ZLP A;  2IME A;  5E59 A;  1GTU A;  1OC8 A;  1R26 A;  8GSS A;  2XHF A;  1A24 A;  1ML6 A;  1SKS B;  4ZB7 A;  2GT5 A;  4KUN A;  3FZA A;  1FB6 A;  1B9X C;  3RDW A;  1O85 A;  3CSI A;  3RHB A;  1O81 A;  4A5P A;  4YKG A;  2R6K A;  2V2G A;  1XWG A;  2IFQ A;  2VCT A;  2KP1 A;  2KUC A;  2N5A A;  4G01 A;  2DSA A;  4V1A p;  2B7J A;  3DKS A;  5JWQ B;  4TXO B;  3CSJ A;  1Y25 A;  1QQ2 A;  1X5E A;  1N2A A;  2FY6 A;  2O5V A;  4K0G A;  4QMK A;  4GQC A;  4CHS A;  4N3Z A;  3F4S A;  3R3E A;  3BD2 A;  3GTU B;  2F8F A;  1XWK A;  2X99 A;  1SVL A;  4ML6 A;  3WT2 A;  2PPT A;  2GZP A;  5ECQ B;  2VLU A;  5CO3 A;  5J9B A;  4K7N A;  4K5S A;  4AF2 A;  3IPZ A;  4L0U A;  3HDC A;  2E7P A;  2V1M A;  4G0I A;  3IXR A;  3GYK A;  5J4U A;  4GXZ A;  1A0R P;  2JSY A;  2DIY A;  1SVM A;  4XCS A;  2ES7 A;  1ZZY A;  1FVJ A;  4IGJ A;  4F0C A;  3H93 A;  3BJ5 A;  4RUV A;  1RW1 A;  3EC3 A;  4X43 A;  4BPY A;  4OD7 A;  1TOF A;  1TK5 B;  1I5G A;  2LV3 A;  5A34 B;  4ZB8 A;  5CAX A;  1OC9 A;  4NHW A;  2GZZ A;  3GNJ A;  3SWL A;  3MYD A;  4E68 A;  5IQY A;  2VCX A;  1DBY A;  4LA1 A;  1G6Y A;  5GZZ B;  4X0X A;  5INY A;  3DML A;  1LU4 A;  5ID2 B;  1GP1 A;  3TDG A;  3C1R A;  2PER A;  5JWO B;  2XC2 A;  3UVT A;  5GSS A;  3TOU A;  3VLN A;  3QAG A;  1PKW A;  4JZQ A;  5HFG A;  1GSQ A;  3UVH A;  2PBJ A;  3FZ4 A;  4WBR D;  2FWH A;  3R2Q A;  2H0G A;  5CRH A;  1QUW A;  5IOW A;  1VRS D;  3F6D A;  3LXZ A;  2L6D A;  2ZUP A;  1UVZ A;  5F0G A;  3E9J B;  5J5N A;  3CRU A;  5ECN B;  5IMZ A;  3D0Z A;  4KCE A;  3HYP A;  4NV5 A;  1ON4 A;  3A2X A;  5D93 A;  3I6A A;  4DSR A;  4PNF A;  1OKT A;  3VUR A;  2HSY A;  4LLR A;  5DAK A;  4EUY A;  3DGQ A;  3ZFL A;  2PVQ A;  1IYH A;  4Z2U A;  4MCU A;  3TOT A;  3EWL A;  4EDZ A;  2CVK A;  4PX1 A;  2FUG 2;  4FYU A;  3M9K A;  3HZ8 A;  1M9B A;  1K0M A;  1Z7P A;  2IN3 A;  3UIW A;  1BJX A;  4ZL9 A;  6GSV A;  5GST A;  3L9V A;  5DDL A;  5JCG A;  3KP9 A;  3LYP A;  2C4J A;  5DJL A;  1TP9 A;  4YAP A;  4POK A;  5DCG A;  3IA1 A;  1YEP A;  5E4W A;  3A5I A;  5CRG A;  4IBP A;  2MBS A;  1TXU A;  4GDF A;  3HKR A;  3ZVJ D;  3NOF A;  4AKI A;  2MMZ A;  1SD9 A;  4AKH A;  5B8B A;  1HNB A;  3G7J A;  4BVX A;  4MJB A;  3IK9 A;  3I69 A;  3CSH A;  1SL1 B;  4NWY A;  1VF2 A;  3UBL A;  1GUL A;  3W8S A;  5H5Q A;  4BL7 B;  1MD4 A;  1Z3E A;  2LRC A;  4KW6 A;  1MD3 A;  4E8H A;  2N5F A;  1BF5 A;  2GVP A;  1B4P A;  4GF0 A;  1DUG A;  4FYB A;  2HNL A;  1TI1 A;  4IJI A;  1PQN A;  5CP1 A;  2CVB A;  1F3B A;  3LEF A;  1TK0 B;  3FR9 A;  4ACS A;  4GST A;  4MK3 A;  3TKP A;  4HOJ A;  5A4V A;  4HQS A;  3L9S A;  3ZRE A;  2VL9 A;  1BED A;  5GAN D;  1NM3 A;  1M7T A;  3I43 A;  2DBC A;  3ISO A;  4N30 A;  1A23 A;  4WET A;  4WEY A;  3M8N A;  1ILO A;  2YOI A;  3DD3 A;  1Z6M A;  5A1N A;  1GH2 A;  2R5G A;  2H73 A;  2EIQ A;  2H6Y A;  4TR4 A;  4K0N A;  3Q19 A;  4H86 A;  1X0R A;  4WF5 A;  1JFU A;  2A2S A;  2R0C A;  1ZL9 A;  3ERW A;  2L5O A;  3HD5 A;  2DJJ A;  3ZFB A;  4KA0 A;  5KOW A;  2GSR A;  2DLX A;  1Q4J A;  4EC0 A;  1YY7 A;  3FW2 A;  2F3M A;  2HRK A;  2IMF A;  4PXO A;  3DVW A;  4ISD A;  3PIN A;  2H74 A;  5IMD A;  2UV8 G;  1H4O A;  5G2Z A;  4X1U A;  3ME7 A;  4JBB A;  5AN1 A;  1YKC A;  3QFB C;  2C3Q A;  4KDX A;  5DAL B;  4POL A;  16GS A;  3L4N A;  2OE3 A;  3BCI A;  1G7O A;  4AJ6 A;  2H1B A;  5F05 A;  1ZYE A;  3IK7 A;  1SJI A;  3EUR A;  4HDE A;  2CAI A;  5KN0 A;  4HJ2 A;  1WE0 A;  2MMO A;  4Q5Q A;  2VM1 A;  2B5X A;  3D21 A;  3GN3 A;  2C3N A;  3F6F A;  2DML A;  5C04 A;  2B5E A;  3CTG A;  3E0U A;  3WGE A;  1YJ6 A;  1PX6 A;  2VD0 A;  1S3A A;  1AXD A;  2FWF A;  4GSS A;  5FWG A;  3GL3 A;  5CNW A;  4MH2 A;  2H0H A;  2OJL A;  4N0V A;  1SK1 A;  4QQ7 A;  4D73 B;  3TJF A;  1S3C A;  2P0G A;  2YNX A;  2BJX A;  4TVE A;  1EP8 A;  2QGV A;  2I4A A;  3OR5 A;  2PWJ A;  1MDJ A;  4CW9 A;  1FB0 A;  4TXO A;  3UJ1 A;  4TRX A;  1GLQ A;  2GQK A;  1HQO A;  5LD0 A;  1TKD B;  5IPH A;  4K1F A;  2HE3 A;  2WB9 A;  3IHG A;  4F82 A;  4HU9 A;  3ED3 A;  1Z9H A;  2HZF A;  4YQV A;  1KBN A;  1W89 A;  2G0F A;  2H76 A;  2WDU A;  1I9D A;  3FEU A;  2J23 A;  2P31 A;  3PGT A;  4EIP A;  2CA8 A;  4GSN A;  1AC1 A;  3RPN A;  3FRC A;  2TRX A;  1NW2 A;  4OFM A;  4WR5 A;  5C00 A;  4ML1 A;  2K9F A;  1B9Y C;  5D8I A;  5D96 A;  4RQX A;  3PR8 A;  1XW9 A;  3TU3 B;  5IMV A;  5AIV A;  2MZC A;  1ERW A;  2FA4 A;  3LJR A;  1A2M A;  1GL8 A;  1JHB A;  5A34 A;  3KMO A;  2DJ0 A;  5IM9 A;  2VOC A;  2MBT A;  2R0P A;  3IBH A;  4O5Q A;  2LUS A;  3PH9 A;  2ON7 A;  4NHZ A;  1U87 A;  1F9M A;  2HSN A;  2CQ9 A;  4IP6 A;  4G19 A;  5ID2 A;  2FA8 A;  4MZC A;  1PKZ A;  2VO4 A;  2A2P A;  4V2M A;  1GSD A;  5A5K A;  2ON5 A;  1AIU A;  2LQQ A;  2OE0 A;  4I6X A;  4LL4 B;  3C7M A;  4DEJ A;  3V1W A;  3ZL5 A;  4HI7 A;  4ILF A;  3EIN A;  5IMA A;  2LKU A;  4L8E A;  3TJK A;  2NTO A;  3ZML A;  2WS2 A;  3F8U A;  4ICY A;  4DSS B;  2EIR A;  1GSE A;  1AUC A;  3NZN A;  1DSB A;  2HT9 A;  2XPD A;  5F07 A;  3LFL A;  4IN0 A;  2DKH A;  3IC8 A;  1MDK A;  2C80 A;  5IMF A;  3U6V A;  3NIV A;  2B7K A;  3IR4 A;  2PU9 C;  1A2J A;  2RII A;  4N10 A;  1XOB A;  3C73 A;  3QPM A;  3FY7 A;  4PNG A;  3GL5 A;  4HQZ A;  1FVK A;  1OVN A;  3EPT A;  2EFE A;  2TIR A;  1X9M B;  4PUF C;  5IIZ A;  2AB6 A;  5B8A A;  2EFH A;  6GST A;  2NPB A;  2C1Y A;  1T4Z A;  3P90 A;  4ZL7 A;  1A0F A;  3KCM A;  1AAZ A;  5BMU B;  2LQO A;  4LMW A;  1YF0 A;  2H70 A;  3ERG A;  5ECL B;  4XS4 B;  3FKF A;  3UEM A;  4MH3 A;  1TRS A;  2O85 A;  4RI7 A;  4JR4 A;  4AKG A;  1WOU A;  3BCK A;  1ABA A;  1THX A;  2LRT A;  2FWE A;  3ZMK A;  2VLV A;  5J41 A;  3VWU A;  3C71 A;  3GKK A;  3LW9 A;  4ZBA A;  1PX7 A;  1U3I A;  5HR1 A;  4ECC A;  4JE1 A;  3VWV A;  4Q5R A;  5FHI A;  4EF0 A;  1QGV A;  2H72 A;  3GH9 A;  4MAB A;  2PN8 A;  1B48 A;  1TW9 A;  3GKM A;  3J7Y k;  4TR1 A;  4IQA A;  2IWT A;  2OBK A;  4HU7 A;  3PPU A;  5GAP D;  2UZ8 A;  1XWB A;  4AGS A;  2BTO T;  2H8L A;  3UL3 A;  4NV2 A;  2B3S A;  3VWW A;  2DJ2 A;  5L71 A;  2GDR A;  3H8Q A;  1M2A A;  3TCO A;  2K8S A;  3QMX A;  2GSQ A;  3W6G A;  2LRN A;  1UN2 A;  1EOG A;  2GST A;  2HRF A;  1R7H A;  2ZCT A;  4NPB A;  19GS A;  4HEA 2;  4EL1 A;  2AJQ B;  1WPI A;  2GGT A;  1FHE A;  2Z9S A;  2O89 A;  4K7I A;  1XCC A;  3EE2 A;  1U6T A;  2WFC A;  3TUE A;  4AKX B;  1EOH A;  2JAC A;  1JLW A;  1Z6N A;  4MJE A;  1TRV A;  1USB A;  4OFT A;  3CYN A;  2LNS A;  2GLR A;  2TRC P;  1QK8 A;  4IJ3 A;  1G0T A;  2H30 A;  3ZIV A;  5HR3 A;  1XFL A;  2D2Z A;  1AQW A;  3MWH A;  2YCD A;  4MF5 A;  3TGZ A;  2M46 A;  4K8M A;  2B6M A;  1UC7 A;  1ERV A;  3VPT A;  3KIJ A;  1Q98 A;  4TR0 A;  2FLS A;  1EP7 A;  5J4Y A;  2L6C A;  1AQX A;  2L57 A;  4KSM A;  4G10 A;  2LJR A;  4EE0 A;  4TXV A;  4PUA A;  1C72 A;  2GQM A;  2ALB A;  11GS A;  2G2Q A;  1EEJ A;  3ME8 A;  1XW6 A;  4FYC A;  1ERU A;  1SYR A;  3IOS A;  2F51 A;  4AJ7 A;  2H6Z A;  4IVF A;  2O87 A;  1ZCP A;  2C0G A;  2HLS A;  1O8W A;  1SK0 A;  1XVW A;  1BYE A;  1MDI A;  2R4V A;  4NAX A;  4D73 A;  1N25 A;  2OKA A;  3MSZ A;  5ABR A;  3UAR A;  1XWC A;  3QCP A;  1PA3 A;  1BG5 A;  1EV9 A;  2H1D A;  4Q5N A;  3IDV A;  1GSF A;  1TTZ A;  3F3Q A;  2WGR A;  2HXK A;  1CQG A;  3GKN A;  2EC4 A;  2CX4 A;  3UMA A;  3MAK A;  3UOM A;  4FQU A;  2EFC A;  1GUM A;  1GSU A;  4QL9 A;  1V58 A;  5A5H B;  3APO A;  4ID0 A;  3Q6O A;  3SBC A;  4MF6 A;  1DE1 A;  1A8Y A;  3GRX A;  1YKA A;  2LST A;  2KP2 A;  2H19 A;  1BG1 A;  4ZBB A;  3F0I A;  2A4V A;  1WP0 A;  5IO2 A;  5ELG A;  3FHK A;  2CVD A;  2VM2 A;  2CV4 A;  2GS3 A;  3HCZ A;  1M0U A;  2JSZ A;  3GST A;  1OAZ A;  2H1A A;  3Q18 A;  3QOU A;  2IFQ B;  1YF1 A;  4EO3 A;  1BX9 A;  1SJ6 A;  3HVX A;  2VKZ G;  3K8N A;  2NVL A;  3JCM L;  5HFI A;  1YZX A;  1F2E A;  4BA7 A;  1V40 A;  3CRT A;  2M80 A;  5KN2 A;  3IAS 2;  1FAA A;  2B1K A;  3BOA A;  4XRD A;  5EL8 A;  4Z7X A;  5CRW A;  5DQY A;  2JU5 A;  4KX4 A;  4EVM A;  2B1L A;  4FO5 A;  4PGT A;  2AYT A;  1F37 A;  3GX8 A;  3GKX A;  9GSS A;  3GSS A;  1V98 A;  2QA2 A;  4KB3 A;  1O8X A;  3WD6 A;  4J57 E;  2H66 A;  1AQV A;  2YWO A;  2M72 A;  3APQ A;  2LJA A;  4I2U A;  3EMP A;  4F03 A;  2B5Y A;  1UA5 A;  5AIS A;  2HZE B;  1OC9 B;  1M9A A;  2IPA A;  4YH2 A;  2AUV A;  3G9B A;  4KF9 A;  1JZR A;  1YVL A;  2IJY A;  3P7X A;  4MJC A;  2YP6 A;  3F63 A;  1TU7 A;  4MF7 A;  4L0W A;  5DCH A;  4W66 A;  2E0Q A;  4I5Q A;  3A2V A;  4OO4 A;  4RI6 A;  1Z5Y E;  1GNE A;  1SL2 B;  1THO A;  3GV1 A;  2H75 A;  2FCH A;  1PD2 1;  1FW1 A;  3CBU A;  3TKQ A;  1XOA A;  4OFN A;  2CX3 A;  4ECI A;  4USS A;  4K6X A;  3D22 A;  2OE1 A;  5D9W A;  5LNK e;  1QXH A;  4PQH A;  2RM6 A;  1TXX A;  2FGX A;  4K2X A;  2VUP A;  1SJZ A;  2YWN A;  2GT6 A;  1LBK A;  6GSX A;  3MIX A;  3H1N A;  2CZ2 A;  1ERT A;  3VI5 A;  3ZYW A;  4IQ1 A;  1K3O A;  1ZYP A;  1JZO A;  2R3X A;  2OT3 A;  4Z2T A;  5D9X A;  1JLV A;  1PL2 A;  3GHA A;  3F4T A;  5DAK B;  1O7U A;  4GLT A;  2GZY A;  4KH7 A;  1F3A A;  5B7C A;  1ACV A;  3QD9 A;  2WZ9 A;  2P5R A;  4IEL A;  3KD0 A;  1ZYN A;  3GTU A;  2LS5 A;  3TRP A;  4WKW A;  4EIQ A;  2H6X A;  5IPG A;  4QL7 A;  2E2G A;  3LWA A;  3W8J A;  4RQR A;  1G7E A;  2VIM A;  5HFK A;  2X8C A;  1WJK A;  1VF4 A;  4TOP A;  4OWY A;  3US3 A;  5JCW A;  4OMV A;  12GS A;  1G6W A;  3TKS E;  3APS A;  3HZ4 A;  3ZVJ A;  2ZNM A;  2RUE A;  5HR2 A;  4XS6 A;  4BVX B;  3QFA C;  5J40 A;  3KXO A;  2X49 A;  2PVO C;  14GS A;  2VCZ A;  2L4Q A;  2C8U A;  3KMN A;  3C1S A;  2NDO A;  2JL4 A;  5CRD A;  3GIX A;  3L78 A;  1X5D A;  4YQM A;  4CY6 A;  2RUF A;  4GQF A;  2O8V B;  3J7Y b;  5DQS A;  1PL1 A;  3G7Y A;  2GTU A;  3GFK A;  1JZW A;  2XBI A;  2PMT A;  2XBQ A;  3TRX A;  2L4C A;  3D4M A;  3QDN A;  18GS A;  5FT3 A;  1QFN A;  5A1N B;  4KE3 A;  3C8E A;  3A3T A;  2V32 A;  3IRA A;  4AJ8 A;  1HNC A;  1PSQ A;  3KM6 A;  2JZT A;  1Y6E A;  5KN1 A;  1YDK A;  4MMM A;  3DIE A;  5J3R A;  2XPE A;  1TU8 A;  3IE3 A;  5KN3 A;  2C0D A;  5HR0 A;  1FOV A;  6GSU A;  3VWX A;  2HRK B;  1GNW A;  2HQT A;  2K8V A;  3EU3 A;  5ECH B;  4NXI A;  4TR3 A;  1V9W A;  1XZO A;  4BVY B;  3HVV A;  5EVO A;  1K3Y A;  3O76 A;  2MMA A;  2DJK A;  4OO5 A;  4ULX A;  3LG6 A;  1OYJ A;  1GTA A;  5DVB A;  1A8L A;  4POM A;  1X9W B;  5J4V A;  1GTB A;  5ECM B;  3M1G A;  1XW5 A;  2HSM B;  4YKF A;  20GS A;  1MTC A;  5AGY A;  1BAY A;  2R2J A;  4EDY A;  1GTI A;  2H1L A;  3AY8 A;  4OCE A;  4YQU A;  2I9H A;  4L5L A;  4I2T A;  1SEN A;  2DC5 A;  3HXS A;  1URM A;  4MDC A;  3KEB A;  2CAQ A;  4BL7 A;  3FZ9 A;  4G0K A;  1EZK A;  3GUS A;  5G5F A;  1Z7R A;  5F8B A;  2V6O A;  2MYG A;  4WF4 A;  3H4K A;  1HNA A;  2H71 A;  2DJ1 A;  1WIK A;  3TKS A;  1RK4 A;  4O92 A;  1GLP A;  3ERF A;  4Q5F A;  4J2F A;  3HJP A;  3N5O A;  13GS A;  1PN9 A;  1M2B A;  1R5A A;  1YQ1 A;  3N9J A;  4OCF A;  3A2W A;  4E8E A;  3QAW A;  4X4J A;  5G1L A;  5EPF A;  3VPQ A;  3FR3 A;  5JCU A;  2VCV A;  4ZB9 A;  2QKE A;  4V2L A;  4K5R A;  2GSS A;  2KHP A;  4HZ2 A;  4TW5 A;  3L0H A;  1JZD A;  4IW9 A;  2OBI A;  2L5L A;  3I9V 2;  1CQH A;  2CT6 A;  6GSW A;  4NMU A;  2R0G A;  2MMN A;  2FWG A;  3DRN A;  5LCZ A;  2HSH A;  1EEM A;  5H5R A;  1AW9 A;  2VL2 A;  1SYX A;  1VF1 A;  1ZYQ B;  4F0B A;  2F9S A;  2LTK A;  4KGI A;  2H1G A;  2JZR A;  2REM A;  1OKD A;  4LL1 B;  4IKH A;  4KND A;  3GX0 A;  3LXT A;  1EV4 A;  5EY6 A;  5KEJ A;  1IYI A;  3HJO A;  2KLX A;  1SVO A;  2YV9 A;  5F06 A;  3WT1 A;  1KTE A;  2HFD A;  5KOX A;  4ECB A;  5BRT A;  2E2M A;  2X64 A;  5DAL A;  5D9V A;  2HZE A;  2LEG A;  1T7P B;  1VF3 A;  4G9H A;  1T8E B;  1FO5 A;  2AAW A;  2VCW A;  5G1K A;  4N11 A;  1M2D A;  4FH8 A;  1VGL A;  4XIH A;  3M9J A;  3M3M A;  1K0N A;  2HSN B;  4TKY A;  4ZIJ A;  3UBK A;  4XRA A;  2YJ7 A;  5ECP B;  3P8W A;  2BMX A;  3ZIJ A;  3UAP A;  3TJB A;  1HD2 A;  7GSS A;  2YAN A;  1XWA A;  3DVX A;  4V1A g;  4BWQ A;  1NHY A;  2R37 A;  3TKR A;  1RQM A;  3GUR A;  4Z2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...