6GSYA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGFWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsyA01
3UIWA 4Z7XA 3KTLA 2WJUA 5IQYA 1PL2A 4WEYA 2C80A 3GTUB 3TGZA 3QMXA 5G5EA 3LQ7A 1TJDA 4HJMA 3GA4A 2VLTA 4TRXA 2I9HA 2F9SA 3LORA 2YOIA 1X5CA 1CQHA 4QQ7A 3M9JA 1O8WA 2OJLA 2PWJA 1G7EA 1PQNA 2N5FA 2H6XA 1T7PB 2NDOA 4NPBA 2V2GA 3E3EA 2BMXA 2FWHA 2CVKA 3F3QA 1FAAA 4HDEA 4N30A 1BX9A 5HR1A 2D2ZA 2JADA 2VL2C 2VD1A 3A2XA 1ZCPA 2H19A 3GUSA 4JU5A 1F3BA 2OE3A 1SD9A 4J56E 2H0HA 3EE2A 1AQXA 2G0FA 4RI6A 2B7JA 1QK8A 4GQCA 4V1Ag 5IPHA 3GHAA 2TRCP 4XRDA 1KNGA 3Q74A 4AJ8A 1O73A 1PKZA 3D22A 3A2WA 2KOKA 2C1YA 2DMLA 1TTZA 2HZFA 4X1UA 2O8VB 3UARA 2L4QA 2VAFA 4V2NA 3M8NA 1AAZA 2PGTA 2K18A 4GSTA 1B48A 3LJRA 4PTSA 3ZFBA 2B5EA 3CRTA 1V98A 2L5LA 1GSYA 3LG6A 4K7IA 2X8GA 4N11A 5J9CA 2E7PA 4YQMA 2EIQA 2R6KA 3H8QA 1A2JA 1VRSD 3ERGA 3FK8A 3TKQA 4IN0A 2IMFA 3A3TA 3ME8A 4ILFA 4DSQA 3EWLA 5JCGA 3FYGA 1HNBA 2HRKA 2PBJA 3ZL5A 3HD5A 1PRXA 2GT6A 1T00A 2TIRA 4HJ2A 1B9YC 1ON4A 3UVTA 3GH6A 1GRXA 3WD6A 1E6BA 4G9HA 1GUKA 1SK1A 1Z7PA 1THXA 1TP9A 2H0GA 4IS0A 2C3NA 5ECMB 2XBQA 3EYTA 1TXXA 3J7Yb 1NSWA 3A5WA 2K8SA 2H01A 4JR6A 3IA1A 4F9ZA 2OE0A 3FZ9A 3L4NA 2F8FA 4BWQA 2I81A 1SYXA 1OE8A 2IMDA 1R5AA 4GRFA 1WPIA 4KGIA 1ZYEA 1H4OA 4HZ2A 3CSJA 2QGVA 4KSOA 5G5FA 2GQLA 5D9TA 1SKRB 2BJXA 3TRXA 3ZYWA 4JR4A 2YN1A 2LRNA 2HFDA 1XWBA 3TKRA 2V6KA 3HHVA 3HVVA 2AJQB 3CSIA 5ELAA 2QKEA 3FR6A 4WF4A 3MWHA 4RQXA 5DCHA 5IMVA 5HFKA 2J23A 2YZUA 3F6DA 4ML6A 2O87A 1EEMA 1GUMA 1U6TA 1OC9A 2A2SA 4Q5FA 4MCUA 4JRRA 2H76A 2GSTA 4EDZA 1X0RA 2H1DA 2GZYA 2VCWA 1XOBA 2FWEA 1WMJA 3KMOA 3F3RA 2VM2A 3H4KA 2GT5A 1O6JA 2FD3A 4OWYA 1TRWA 1KTEA 1UN2A 3IHQA 1K0NA 2X8CA 2HT9A 2H6YA 2LV3A 1WE0A 2X99A 2MBSA 4MDCA 4NV2A 5JWOB 4I97A 2JZTA 1ZGNA 1ERVA 1HQOA 5BMUA 4IELA 3L9SA 4HQSA 3LEFA 3VWUA 4AJ6A 1U3IA 2EIOA 3KIJA 4LL1B 4WR5A 3DXBA 2REMA 3P90A 5D96A 2LQQA 4MJBA 4MP4A 5E4WA 4LL4B 2FNOA 3KM6A 4O5RA 1R7HA 1XW9A 2HRKB 2C0GA 2PUKC 2HSMA 3G9BA 3TKSA 3FZ4A 5ECKB 8GSSA 1TK0B 4PURA 4XCSA 5IO0A 5CAXA 5F0GA 2GS3A 4XTSA 4BVYA 4G0IA 2JZSA 1C72A 4IQ1A 5C00A 6GSUA 3IK9A 3UBKA 1SJ6A 1YEPA 3IAM2 5D93A 3FZAA 2AUVA 5B8AA 3BOAA 1SL1B 1X9MB 22GSA 1JZWA 2TRXA 4ECIA 4IKHA 4NHWA 4GSNA 3GX0A 5KN0A 1R5PA 1TK8B 2I4AA 4LLRA 3ZIVA 4NAXA 4KCEA 1ZMAA 2M46A 5IPGA 1TU8A 1AW9A 1MDKA 6GSVA 4EDYA 5D9WA 2GSSA 4O92A 4LMVA 3GH9A 1J08A 2M80A 2H8LA 1NHOA 2PN8A 1A24A 2DSAA 1V9WA 3KTBA 5ECSA 3APSA 2EC4A 1LBKA 1ML6A 3L9UA 1T3BA 4TN8A 4XS6A 1EOHA 1XCCA 1DE2A 2I1UA 1OC9B 3L9VA 1Z9HA 5A4UA 4JZQA 2DJ1A 5FT3A 2CAQA 1B4PA 3FZ5A 5D9VA 1HNAA 3IK7A 4L0UA 4PUFC 3CYNA 5JWQB 3P8WA 3EU3A 1FVKA 1VGLA 5J3RA 4MJCA 3HA9A 1FW1A 2OA7A 1R26A 2HQTA 1UVZA 2B6MA 1OVNA 4MF5A 1QFNA 5G1KA 1EGOA 4I2TA 3MDKA 3LSZA 1GTBA 4WR4A 5KN1A 3Q18A 2F8AA 2VO4A 2LSTA 1M99A 1W89A 2FHEA 4CHSA 1MTCA 3CRUA 3WGEA 4MK3A 3QAWA 1S3DA 1ERTA 4OFMA 2CVBA 2R5GA 2C3QA 19GSA 1GWCA 2HSMB 4WETA 2VOCA 2X64A 2YWIA 1DSBA 4IBPA 2R37A 4Q5NA 3CTGA 1BG5A 3APOA 4K1FA 5KEJA 1IYIA 1VF4A 5B7CA 5ECHB 3FHKA 1QQ2A 3FRCA 4EC0A 4RQRA 1YEXA 6GSYA 3M1GA 2AHEA 4KDXA 2MMZA 4KUNA 4KAEA 3HDCA 1YF1A 2FY6A 1S3AA 2LQOA 3DVXA 2YJ7A 5DBQA 1PMTA 5EL8A 3LYKA 4IP6A 1OAZA 4AJ7A 1T4ZA 4OMVA 6GSTA 4PXOA 4BL7A 4G2EA 1GSDA 3VI5A 1ZYQB 2WGRA 2IMKA 3WT1A 4GSSA 4K2DA 3LFLA 2WZ9A 4JBBA 2B7KA 4RI7A 3C1RA 1SJZA 1E2YA 2LNTA 1GL8A 2N5BA 2GVPA 1J9BA 1GP1A 3HCZA 1NM3A 2LNSA 3KZQA 4G0LA 2HYXA 4YAVA 1T8EB 4YAPA 2YNXA 4KW6A 1WIKA 1OKTA 3M0FA 5F06A 4GWRA 4TW5A 5D9XA 2YZHA 3TRQA 1O8XA 4EE0A 1AC1A 1QUWA 3TOTA 1Y6EA 3DVWA 5B8BA 1HD2A 5HFIA 2L4CA 3ME7A 1TKDB 4IHUA 4XHMA 2JU5A 3DGQA 3UBLA 18GSA 2YWNA 1Y25A 4I6XA 1XIYA 2HSYA 4JE1A 1SK2A 2FUG2 2MZCA 2ON5A 1WWJA 1M9BA 2P31A 2DIZA 3EU4A 2PMTA 4RUVA 4D73A 2PPTA 1PN9A 3G7YA 1XW5A 2YV9A 5DAKA 2HRAA 3A2VA 3DYRA 3GKKA 2NTOA 5LNKe 3ZIJA 3D21A 1XWAA 4POMA 2GDRA 1KEBA 2ON7A 2VLVA 2XPEA 2YPMA 2KP2A 2LS5A 4OD7A 1TU7A 3IR4A 4N0ZA 1XZOA 2OACA 1RQMA 1M2DA 4TR1A 3VPTA 4O7HA 3O3TA 2IFQB 4XS1A 4QL7A 2O89A 4MPFA 2CZ3A 5LD0A 1A0RP 5JCWA 4HS1A 1XFLA 4TOPA 1TI1A 2FWGA 1WOUA 1Q4JA 2MMAA 3IC8A 1GSUA 3QR6A 1F3AA 2DJ0A 3K8NA 2C3TA 3TKSE 4NV5A 5AIVA 4MJEA 5ECQB 4O32A 4FQUA 1AQWA 5F05A 2B5YA 4TXVA 2RUEA 3HJPA 2IN3A 4ECJA 3GL5A 2GGTA 2GTUA 2FCHA 2K6VA 2HI7A 4ZL7A 4G19A 5D73A 3EURA 1GTUA 2DIYA 2NVLA 1K3OA 5HQPA 2WS2A 4MJAA 3LYPA 2HNLA 2VL2A 3N5OA 4KSMA 1Z7RA 4NWYA 5DQYA 3IOSA 2DJJA 5AGYA 1EV9A 20GSA 2V41A 2VL3A 5H5QA 1JHBA 1K0CA 4N10A 3HZ4A 4J57E 3ED3A 3I43A 3R2QA 5GSSA 3ERFA 1Z5YE 3GKXA 3D0ZA 1BEDA 2C0FA 3C73A 1B4QA 3BD2A 4K7OA 4ZBDA 4K7NA 3QDNA 2H6ZA 3ZVJA 4KDYA 4PNFA 5GZZB 1X9WB 1W4VA 5FHIA 1GLPA 17GSA 3US3A 2HXKA 2RIIA 5EY6A 2V1MA 3ZREA 1PX7A 2YP6A 4OFTA 5B6MA 2WB9A 3TJBA 4GCIA 3LGCA 2RM6A 1FHEA 3HKRA 3F63A 3UVHA 3RPPA 1WRYA 3TJGA 4OO5A 4KB3A 4GXZA 3TRPA 2DBCA 3RHCA 4ZILA 3DMLA 5CO3A 3RDWA 1U88A 1TOFA 3CTFA 3GL3A 3IC4A 2ZCTA 2ALBA 2C0DA 4J2FA 4V2MA 4HEA2 4ULXA 3QFAC 7GSSA 2K8VA 2QC7A 1GTAA 3IDVA 2IL3A 4GF0A 4X0XA 5IO2A 1USBA 3UOMA 4XS4A 3VFIA 2RM5A 1GUHA 3GNJA 2H0IA 3F6FA 1M0UA 3G7IA 4BVXA 2MMNA 3L78A 3FR9A 5H5RA 1ILOA 1A2LA 3BCKA 5GAPD 1SD8A 5DALA 3VWVA 4F0BA 5EVOA 1GTIA 3OR5A 5CREA 3ZFLA 2JSYA 1OYJA 3GSSA 3EC3A 3CXGA 2VL9A 4MZBA 2VUPA 3CMIA 4CW9A 1TW9A 3TKPA 5G31A 2DJ2A 5D8IA 1XVQA 4POKA 2DJ3A 5AN1A 4KE3A 3V1WA 1K0AA 1F37A 1EWXA 2C4JA 3HY2A 1GULA 2Z9SA 1EP7A 1UA5A 2AYTA 3QAGA 2GSRA 2H70A 1ST9A 2CX3A 1YY7A 2AAWA 5B6NA 4WXTA 4OFNA 1LU4A 4FYBA 9GSSA 4Q5RA 1FB0A 2H1GA 4K6XA 1R4WA 4FIWA 5DDLA 4G10A 1VF2A 4ECCA 4PX1A 1B9XC 2IJYA 4NXIA 3GIXA 2HZEA 4TR4A 1A23A 1S3CA 1I5GA 3P2AA 4EXJA 3GRXA 5EPFA 1HYUA 1F2EA 4HUAA 2NPBA 1Z3EA 4H86A 2YANA 2CZ2A 1CQGA 5GSTA 1F6MC 1DBYA 5J41A 4BWSA 4DSSA 3RBTA 4JEDA 2M72A 3IBHA 1NHYA 1A0FA 1AUCA 3QFBC 2LRCA 2CV4A 4ZIJA 1J0FA 2RLIA 3GTUA 1SYRA 3W8SA 1QXHA 3APQA 2E2MA 3C1SA 4L8EA 4MF6A 2VM1A 1JZDA 2EIRA 3VI7A 1XWGA 2F51A 5FWGA 1V40A 3HYPA 1SKWB 4KH7A 2JZRA 1X5DA 2KHPA 1OKDA 3EMPA 3F4TA 3MSZA 4BVXB 2WDUA 4LMWA 2WCIA 2V32A 2VCZA 3NOFA 3FKFA 1FB6A 1G7OA 2B3SA 3NZNA 3U6VA 3I6AA 1FOVA 4K0GA 2MBTA 1JFUA 16GSA 4BVYB 3DKSA 3EMXA 5ECNB 2I3YA 2PVQA 4P3YB 4TR0A 3L0HA 1A8YA 4KF9A 4EO3A 4QL9A 2H72A 3H93A 1MDIA 5CRWA 1A8LA 5DVBA 4MLYA 2VCXA 5CRGA 2DLXA 4F2IA 1BYEA 3BJ5A 2YCDA 3H1NA 1X5EA 3IV4A 3VURA 1THOA 2A4VA 2KUCA 4KNDA 2FWFA 4OCEA 1GNWA 2L59A 4V1Ap 4GLTA 2UZ8A 5HR2A 1A2MA 5IMDA 2AB6A 4HQZA 5IOWA 3O76A 2MYGA 2HZEB 1IYHA 3Q19A 2GZZA 1XPVA 1ERWA 3GSTA 2B1LA 2VCQA 5ID2A 3D4MA 4NMUA 4PQ1A 2VCVA 2VIMA 1Z6MA 2JSZA 4ZB6A 1XVWA 3D6IA 4DSSB 5IMAA 1EP8A 2YJHA 4HI7A 2AV4A 3IAS2 1PD21 3IRAA 1JZOA 1MD3A 4PGTA 4IJ3A 1RK4A 1TI3A 3RAZA 4ISDA 4DSRA 1SKSB 3DIEA 2L6DA 1EV4A 1AXDA 1RW1A 2OADA 4KCAA 4MABA 1M7TA 3KJYA 4HOJA 3Q6OA 4XRAA 5HR0A 3CBUA 3KEBA 5L71A 3ZVJD 3O6TA 4WKWA 3KP8A 4GTUA 4E8EA 1N2AA 1YQ1A 2C0EA 1JZRA 3KH7A 2CT6A 3H79A 1TDIA 2XBIA 2DMMA 2NBSA 1ACVA 1XW6A 1EOGA 4IVFA 5ABRA 1OC8A 3TUEA 3M9KA 3VPQA 2XC2A 4ID0A 5J5NA 1K0MA 4E8HA 3ISOA 3DD3A 1SL2B 5DJMA 3TB2A 5HR3A 3KP9A 3GX8A 4IGJA 3ZITA 2J9HA 3IPZA 1XBSA 5ECIB 1QMVA 1NW2A 5ECOB 4LA1A 4F03A 4WF5A 3TCOA 3LWAA 1SL0B 4PNGA 4L5OA 5CP1A 3GFKA 1LJRA 3ZRDA 3F0IA 4BL7B 5GAND 2LJKA 1URMA 4EF0A 3C8EA 4TKYA 13GSA 5CRHA 4IP1A 3ZTLA 5INYA 3TJKA 1VF3A 3AY8A 1QGVA 2P0GA 4USSA 1Z6NA 4IW9A 5G30A 1SJIA 5LCZA 3FR3A 3JCML 3VLNA 3W8JA 1VF1A 2PVOC 5ID2B 1FG4A 3HXSA 4I2UA 2E2GA 4POLA 5CRDA 1XOAA 4HU9A 1BAYA 2H1BA 2KP1A 2VLUA 3TOUA 4X43A 3KD0A 4FH8A 2KLXA 5HFGA 3GURA 2JACA 1EGRA 2X8HA 4CDOA 1X9SB 2IIYA 1PX6A 4MH2A 1MEKA 5KN2A 4NHZA 3E0UA 5DQSA 1HNCA 3C7MA 4FYCA 2CX4A 1EEJA 4IQAA 2R2JA 3F8UA 3UL3A 2LUSA 3PPUA 3TKSC 2B5XA 3EVIA 2C8UA 2XPDA 4YH2A 4KX4A 4I5QA 2XHFA 2YWMA 4YQVA 4IJIA 6GSWA 2CAIA 2HSHA 3GV1A 4D73B 4AGSA 3U5RE 5AIXA 2H74A 4TVEA 5DAKB 5H5SA 3ERWA 4ZB8A 1FO5A 1O85A 3I69A 2QSIA 3VK9A 3QPMA 3HZ8A 4K9ZA 4ZBAA 1V2AA 1M9AA 2ZUPA 1PGTA 4KDUA 1DUGA 5F8BA 1OE7A 4MF7A 6GSSA 1N8JA 3G7JA 1JLVA 4TR1B 2O85A 1YZXA 4HZ4A 2WULA 2FLSA 4I8BA 4K8MA 2LJRA 1TRVA 4L0WA 1FVJA 4TXOA 4PQHA 5IMFA 1O7UA 1YJ6A 2LRTA 1YKAA 2P5RA 1OC3A 2FGXA 1DE1A 3WGDA 3VWXA 2N5AA 2O7KA 3J7Yk 3W6GA 10GSA 14GSA 3UJ1A 1M2BA 4MZWA 3MNGA 5C04A 1AIUA 3HJOA 2OE1A 1MDJA 3F4SA 2K9FA 1XWKA 4POBA 1K0DA 2R3XA 5F07A 2CVDA 4ACSA 2OBKA 2H75A 3SWLA 1SENA 3UEMA 3I9V2 4N0VA 2DC5A 1MD4A 1BQ7A 5G1LA 2LTKA 1SU9A 3P7XA 4WBRD 4MZCA 4L5LA 1WP0A 3D4TA 4ZL8A 5ENUA 4BPYA 3TDGA 1ERUA 1O81A 4EUYA 1K0BA 5KN3A 4OCFA 4TR3A 1PL1A 2IMEA 1K3LA 3BCIA 3R3EA 2DJKA 3HVSA 2G2QA 5J4UA 2GQKA 1GSSA 1ZL9A 1K0OA 5JCUA 1TRUA 3FY7A 3QCPA 4HU7A 1T4YA 3ZMLA 5ELGA 3GN3A 1ABAA 2BTOT 1K3YA 4ML1A 2YV7A 4PUAA 2GSQA 3QOUA 4ZXGA 2IWTA 4DEJA 2RUFA 3RHBA 2L57A 3KGKA 2ZNMA 1YKCA 1BJXA 3C71A 3KXOA 5IIZA 1M2AA 2L5OA 3SBCA 1GSQA 4BA7A 5IMZA 3HVXA 2CQ9A 3DEXA 2PERA 5IOXA 12GSA 3F9UA 5CYYA 2IMIA 3GMFA 3ZZXA 4V2LA 4ZB9A 5JWRB 2H71A 4YQUA 1SK0A 2GZPA 1T1VA 4G0KA 2R4VA 2VD0A 2H73A 3WYWA 3PR8A 1GNEA 1UC7A 1YF0A 4K0NA 1G0TA 3KMNA 5J9BA 2OKAA 2LEGA 5E59A 5ECPB 1I9DA 4DVCA 1ZOFA 3LXTA 3N9JA 4FO5A 2LJAA 5IMCA 4TXOB 3PGTA 3LXZA 1XXUA 2H1AA 3TJJA 1H75A 1WJKA 5A5KA 3QD9A 5AISA 4XS4B 3FEUA 5ECLB 5A4WA 3ZLPA 1XWCA 5DJLA 4F0CA 3WGXA 1U87A 2F3MA 3PINA 4Q5QA 2CA8A 3UAPA 3NIVA 1V57A 2HLSA 2GLRA 3E9JB 1Q98A 2LKUA 2HSNB 1PA3A 4EKZA 1YDKA 4OO4A 4ECBA 3GKNA 2A2RA 2YWOA 2V6OA 5COHA 5DALB 1V58A 3IE3A 1F9MA 3S9FA 1TK5B 2ES7A 5IM9A 1EZKA 4AF2A 4MH3A 6GSXA 2HRNA 1KBNA 2VCTA 3DWVA 3VWWA 3KCMA 4WBJA 4XIHA 1JLWA 4F82A 5DCGA 3TJFA 2H30A 1G6WA 1GH2A 3WT2A 2FA8A 5ECRB 3HJMA 2IFQA 2GQMA 2B1KA 1ZZYA 4MPGA 3GKMA 3QAVA 4GQFA 3GYKA 3ZMKA 2FA4A 2P5QA 2WRTA 4EL1A 3PH9A 4MA9A 3IXRA 3DRNA 2JL4A 3F4RA 1GLQA 3RPNA 5CNWA 3UMAA 1U3AA 1GSFA 4MMMA 1PSQA 3BBYA 4ZBBA 1AQVA 2OBIA 1G6YA 4EVMA 3D5JA 2IPAA 4ZL9A 4PQIA 1TRSA 3CSHA 2L6CA 3EINA 2MMOA 4FYUA 1B8XA 2H66A 2PU9C 5A4VA 1PKWA 4KA0A 3FW2A 3MAKA 2HE3A 3M3MA 11GSA 2WFCA 2E0QA 3KH9A 5G2ZA 2HRFA 1GSEA
chains in the Genus database with same CATH superfamily
3UIWA 4Z7XA 3KTLA 2WJUA 5IQYA 1PL2A 4WEYA 2C80A 3GTUB 3TGZA 3QMXA 5G5EA 3LQ7A 1TJDA 4HJMA 3GA4A 2VLTA 4TRXA 2I9HA 2F9SA 3LORA 2YOIA 1X5CA 1CQHA 4QQ7A 3M9JA 1O8WA 2OJLA 2PWJA 1G7EA 1PQNA 2N5FA 2H6XA 1T7PB 2NDOA 4NPBA 2V2GA 3E3EA 2X49A 2BMXA 2FWHA 2CVKA 1M3JA 3F3QA 1FAAA 4HDEA 4N30A 1BX9A 5HR1A 3RFRC 2D2ZA 4N3ZA 2JADA 2VL2C 4K2XA 2VD1A 3A2XA 1ZCPA 2H19A 3GUSA 4JU5A 1F3BA 2OE3A 1SD9A 4J56E 2H0HA 1SVOA 3EE2A 1AQXA 2G0FA 4RI6A 2B7JA 1QK8A 4GQCA 4V1Ag 2X4AA 4AI6A 5IPHA 3GHAA 2TRCP 4XRDA 1KNGA 3Q74A 4AJ8A 1O73A 1PKZA 3D22A 3A2WA 2KOKA 2C1YA 2DMLA 1TTZA 2HZFA 4X1UA 2O8VB 3UARA 2L4QA 2VAFA 4V2NA 3M8NA 1AAZA 2PGTA 2K18A 4GSTA 1B48A 3LJRA 4PTSA 3ZFBA 2B5EA 2DKIA 3CRTA 1V98A 2L5LA 1GSYA 3LG6A 4K7IA 2X8GA 4N11A 5J9CA 2E7PA 4YQMA 2EIQA 2R6KA 3H8QA 1A2JA 1VRSD 3ERGA 3FK8A 3TKQA 4IN0A 2IMFA 3A3TA 3ME8A 4ILFA 4DSQA 3EWLA 5JCGA 3FYGA 1HNBA 2HRKA 2PBJA 3ZL5A 3HD5A 1PRXA 2GT6A 1T00A 2TIRA 4HJ2A 1B9YC 1ON4A 3UVTA 3GH6A 1GRXA 3WD6A 1E6BA 4G9HA 1GUKA 1SK1A 1Z7PA 1THXA 1TP9A 2H0GA 4IS0A 2C3NA 5ECMB 2XBQA 3EYTA 5A34B 1TXXA 1NSWA 3J7Yb 3A5WA 2K8SA 2H01A 4JR6A 3IA1A 4F9ZA 2OE0A 4YKGA 3FZ9A 3L4NA 4Z2TA 2F8FA 4BWQA 2I81A 1SYXA 1OE8A 2IMDA 1R5AA 4GRFA 1WPIA 4KGIA 5BRTA 1ZYEA 1H4OA 2QA1A 4HZ2A 3CSJA 2QGVA 4KSOA 5G5FA 2GQLA 5D9TA 1SKRB 2BJXA 3TRXA 3ZYWA 4JR4A 2YN1A 2LRNA 2HFDA 1XWBA 5KOXA 3TKRA 2V6KA 3HHVA 3HVVA 2AJQB 4K5SA 3CSIA 5ELAA 2QKEA 3FR6A 4WF4A 3MWHA 4RQXA 5DCHA 5IMVA 5HFKA 2J23A 2YZUA 3F6DA 4ML6A 2O87A 1EEMA 1GUMA 1U6TA 1OC9A 2A2SA 4Q5FA 4MCUA 4JRRA 2H76A 2GSTA 4EDZA 1X0RA 2H1DA 2GZYA 2VCWA 1XOBA 2FWEA 4AKXB 4AKHA 1WMJA 3KMOA 4FXYP 3F3RA 2A4HA 2VM2A 3H4KA 2GT5A 1O6JA 2FD3A 4OWYA 1TRWA 1KTEA 1UN2A 3IHQA 1K0NA 2X8CA 2HT9A 2H6YA 2LV3A 1WE0A 2X99A 2MBSA 4MDCA 4NV2A 5JWOB 4I97A 2JZTA 1ZGNA 1ERVA 1HQOA 5A5HA 5BMUA 4IELA 3L9SA 3LEFA 4HQSA 3VWUA 4AJ6A 1U3IA 2EIOA 3KIJA 4LL1B 4WR5A 3DXBA 2REMA 1ZYPA 3P90A 5D96A 2LQQA 4MJBA 4MP4A 5E4WA 4LL4B 2FNOA 3KM6A 4O5RA 1R7HA 1XW9A 2HRKB 2C0GA 2PUKC 2HSMA 3G9BA 3TKSA 3FZ4A 5ECKB 8GSSA 1TK0B 4PURA 4XCSA 5IO0A 4EIQA 5CAXA 5F0GA 2GS3A 4XTSA 4BVYA 4G0IA 2JZSA 1C72A 4IQ1A 5C00A 6GSUA 3IK9A 3UBKA 1SJ6A 1YEPA 2EFEA 3IAM2 5D93A 3FZAA 2AUVA 5B8AA 3BOAA 1SL1B 1X9MB 2WVXA 1BG1A 22GSA 1JZWA 2TRXA 4ECIA 4IKHA 4NHWA 4GSNA 3GX0A 5KN0A 1FOHA 1R5PA 1TK8B 2I4AA 4LLRA 3ZIVA 4NAXA 3TU3B 4KCEA 1ZMAA 2M46A 5IPGA 1TU8A 1AW9A 1MDKA 6GSVA 4EDYA 5D9WA 2GSSA 4O92A 4LMVA 3GH9A 1J08A 2M80A 2H8LA 1NHOA 2PN8A 1A24A 2DSAA 1V9WA 3LW9A 1BF5A 3KTBA 5ECSA 3APSA 2EC4A 1LBKA 1ML6A 3L9UA 1T3BA 4TN8A 2WVYA 4GDFA 4XS6A 1EOHA 1XCCA 1DE2A 2I1UA 1OC9B 3L9VA 1Z9HA 5A4UA 4JZQA 2DJ1A 5FT3A 2CAQA 1B4PA 3FZ5A 5D9VA 1HNAA 3IK7A 4E68A 4L0UA 4PUFC 3CYNA 5JWQB 3P8WA 3EU3A 1FVKA 1VGLA 5J3RA 4MJCA 3HA9A 2EFCA 2H1LA 1FW1A 2OA7A 1R26A 5KOWA 2HQTA 1UVZA 2B6MA 3CWGA 1OVNA 4MF5A 5BMUB 1S3RA 1QFNA 5G1KA 1EGOA 4I2TA 3MDKA 3LSZA 1GTBA 4WR4A 5KN1A 3Q18A 2F8AA 2VO4A 2LSTA 1M99A 1W89A 2FHEA 4CHSA 1MTCA 3CRUA 3WGEA 2WW2A 4MK3A 3QAWA 1S3DA 1ERTA 4OFMA 2CVBA 2R5GA 2C3QA 19GSA 1GWCA 2HSMB 4WETA 2VOCA 2X64A 2YWIA 1DSBA 4IBPA 2R37A 4Q5NA 3CTGA 1BG5A 3APOA 4K1FA 5KEJA 1IYIA 1VF4A 5B7CA 5ECHB 3FHKA 1QQ2A 3FRCA 4EC0A 4RQRA 1YEXA 6GSYA 3M1GA 2AHEA 2WVXB 4KDXA 2MMZA 4KUNA 4KAEA 3HDCA 1YF1A 2FY6A 1S3AA 2LQOA 3DVXA 2YJ7A 5DBQA 1PMTA 5EL8A 3LYKA 4IP6A 1OAZA 4AJ7A 1T4ZA 4OMVA 6GSTA 4PXOA 4BL7A 4G2EA 1GSDA 3VI5A 1ZYQB 2WGRA 2IMKA 3WT1A 4GSSA 4K2DA 3LFLA 2WZ9A 4JBBA 2B7KA 4RI7A 3C1RA 1SJZA 1E2YA 2LNTA 1GL8A 2N5BA 2GVPA 1J9BA 1GP1A 3HCZA 1NM3A 2LNSA 3KZQA 4G0LA 2HYXA 4YAVA 1T8EB 4YAPA 2YNXA 4KW6A 1WIKA 1OKTA 3M0FA 5F06A 4GWRA 4TW5A 5D9XA 2YZHA 3TRQA 1O8XA 4EE0A 1AC1A 1QUWA 3TOTA 1Y6EA 3RGBC 3DVWA 5B8BA 1HD2A 5HFIA 2L4CA 3ME7A 1TKDB 4IHUA 4XHMA 2JU5A 3DGQA 3UBLA 18GSA 2YWNA 1Y25A 4I6XA 1XIYA 2HSYA 4JE1A 1SK2A 2FUG2 2MZCA 2ON5A 1WWJA 1M9BA 2P31A 2A2PA 2DIZA 3EU4A 2PMTA 4RUVA 4D73A 2PPTA 1PN9A 3G7YA 1XW5A 2YV9A 5DAKA 2HRAA 3A2VA 3DYRA 3GKKA 2NTOA 5LNKe 3ZIJA 3D21A 1XWAA 4POMA 2EFHA 2GDRA 1KEBA 2ON7A 2VLVA 2WW3A 2XPEA 2YPMA 2KP2A 2LS5A 4OD7A 1TU7A 3IR4A 4N0ZA 1XZOA 2OACA 1RQMA 1M2DA 4TR1A 3VPTA 4O7HA 3O3TA 2IFQB 4XS1A 4QL7A 2O89A 4MPFA 2CZ3A 5LD0A 3A5IA 1A0RP 5JCWA 4HS1A 1XFLA 4TOPA 1TI1A 2FWGA 4Z2RA 1WOUA 1Q4JA 2MMAA 3IC8A 1GSUA 3QR6A 1F3AA 2DJ0A 3K8NA 2C3TA 3TKSE 4NV5A 5AIVA 4MJEA 5ECQB 4O32A 4FQUA 1AQWA 5F05A 4QMKA 2B5YA 4TXVA 2RUEA 3HJPA 2IN3A 4ECJA 3GL5A 2GGTA 2GTUA 2FCHA 2K6VA 2HI7A 4ZL7A 4G19A 5D73A 4CY8A 3EURA 3HMJG 1GTUA 2DIYA 2NVLA 1K3OA 5HQPA 2VKZG 2WS2A 4MJAA 3LYPA 2HNLA 2VL2A 3N5OA 4KSMA 1Z7RA 4NWYA 5DQYA 3IOSA 2DJJA 5AGYA 1EV9A 20GSA 2V41A 2VL3A 5H5QA 1TXUA 1SVMA 1JHBA 1K0CA 4N10A 3HZ4A 4J57E 3ED3A 3I43A 3R2QA 5GSSA 3ERFA 1Z5YE 3GKXA 3D0ZA 1BEDA 2C0FA 3C73A 5A1NA 1B4QA 3BD2A 4K7OA 4ZBDA 4K7NA 2H6ZA 3QDNA 3ZVJA 4KDYA 4PNFA 5GZZB 1X9WB 1W4VA 5FHIA 1GLPA 17GSA 3US3A 2HXKA 2RIIA 5EY6A 2V1MA 3ZREA 1PX7A 2YP6A 4OFTA 5B6MA 2WB9A 3TJBA 4GCIA 3LGCA 2RM6A 1FHEA 3HKRA 3F63A 3UVHA 3RPPA 1WRYA 3TJGA 5J4VA 4OO5A 3IHGA 4KB3A 4GXZA 3TRPA 2DBCA 3RHCA 4ZILA 3DMLA 5CO3A 3RDWA 1U88A 1TOFA 3CTFA 3GL3A 3IC4A 1YEWC 2ZCTA 2ALBA 2C0DA 4J2FA 4V2MA 4HEA2 4ULXA 4W66A 2R0GA 3QFAC 7GSSA 2K8VA 2QC7A 1GTAA 3IDVA 2IL3A 4GF0A 4X0XA 5IO2A 1USBA 3UOMA 4XS4A 3VFIA 2RM5A 1GUHA 3GNJA 2H0IA 3F6FA 1M0UA 3G7IA 4BVXA 2MMNA 3L78A 3FR9A 5H5RA 1ILOA 1A2LA 3BCKA 5GAPD 1SD8A 5DALA 3VWVA 4F0BA 5EVOA 1GTIA 3OR5A 5CREA 3ZFLA 2JSYA 1OYJA 3GSSA 3EC3A 3CXGA 2VL9A 4MZBA 2VUPA 3CMIA 4CW9A 1TW9A 3TKPA 5G31A 2DJ2A 2DKHA 1XVQA 5D8IA 4POKA 2DJ3A 5AN1A 4KE3A 3V1WA 1K0AA 1F37A 1EWXA 2C4JA 3HY2A 4ICYA 1GULA 2Z9SA 1EP7A 1UA5A 2AYTA 3QAGA 2GSRA 2H70A 4ZB7A 1ST9A 2CX3A 1YY7A 2AAWA 5B6NA 4WXTA 4OFNA 1LU4A 4FYBA 9GSSA 4Q5RA 1FB0A 2H1GA 4K6XA 1R4WA 4FIWA 5A1NB 5DDLA 4G10A 1VF2A 4ECCA 4PX1A 1B9XC 2IJYA 4NXIA 3GIXA 2HZEA 4TR4A 1A23A 1S3CA 1I5GA 3P2AA 4EXJA 3GRXA 5EPFA 1HYUA 1F2EA 4HUAA 2NPBA 1Z3EA 2YANA 4H86A 2CZ2A 1CQGA 5GSTA 4O5QA 1F6MC 1DBYA 5J41A 4BWSA 4DSSA 3RBTA 4JEDA 2M72A 3FMWA 3IBHA 1NHYA 1A0FA 1AUCA 3QFBC 2LRCA 2CV4A 4ZIJA 1J0FA 2RLIA 3GTUA 1SYRA 3W8SA 1QXHA 3APQA 2E2MA 2WVZA 3C1SA 4L8EA 4MF6A 2VM1A 1JZDA 2EIRA 3VI7A 5A5HB 1XWGA 4X4JA 2F51A 5FWGA 1V40A 3HYPA 1SKWB 4KH7A 2JZRA 1X5DA 2KHPA 1OKDA 3EMPA 3F4TA 3MSZA 4BVXB 2WDUA 1PFOA 4LMWA 2WCIA 2V32A 2VCZA 3NOFA 3FKFA 1FB6A 1G7OA 2B3SA 3NZNA 3U6VA 3I6AA 1FOVA 4K0GA 2MBTA 1JFUA 16GSA 4BVYB 3DKSA 3EMXA 5ECNB 4O5UA 2I3YA 2PVQA 4P3YB 4TR0A 3L0HA 1A8YA 4KF9A 4EO3A 4QL9A 4CY6A 2H72A 3H93A 1MDIA 5CRWA 1A8LA 5DVBA 4MLYA 2VCXA 5CRGA 2DLXA 4F2IA 1BYEA 3BJ5A 2YCDA 3H1NA 1X5EA 4PI0C 3IV4A 3VURA 1THOA 2A4VA 2KUCA 4KNDA 2FWFA 4OCEA 1GNWA 2L59A 4V1Ap 4GLTA 2UZ8A 5HR2A 1A2MA 5IMDA 2AB6A 2O36A 4HQZA 5IOWA 3O76A 2MYGA 2HZEB 1IYHA 3Q19A 2GZZA 1XPVA 1ERWA 3GSTA 2B1LA 2VCQA 5ID2A 3D4MA 4NMUA 4PQ1A 2VCVA 2VIMA 1Z6MA 2JSZA 4ZB6A 1XVWA 3D6IA 5A34A 4DSSB 5IMAA 1EP8A 2YJHA 4HI7A 2AV4A 4PHZC 3IAS2 1PD21 3IRAA 1JZOA 1MD3A 1N25A 4PGTA 4IJ3A 1RK4A 1TI3A 3RAZA 4ISDA 4DSRA 1SKSB 3DIEA 2L6DA 2O3EA 1EV4A 1AXDA 1RW1A 2OADA 4KCAA 2WW0A 4MABA 1M7TA 3KJYA 4HOJA 3Q6OA 4XRAA 5HR0A 3CBUA 3KEBA 5L71A 3ZVJD 3O6TA 4WKWA 3KP8A 4GTUA 4E8EA 1N2AA 1YQ1A 2C0EA 1JZRA 3KH7A 2CT6A 4PI2C 3H79A 1TDIA 2XBIA 2DMMA 2NBSA 1ACVA 2UV8G 1XW6A 1EOGA 4IVFA 5ABRA 1OC8A 3TUEA 3M9KA 3VPQA 2XC2A 4ID0A 5J5NA 4K5RA 1K0MA 4E8HA 3ISOA 3DD3A 1SL2B 5DJMA 3TB2A 5HR3A 3KP9A 3GX8A 4IGJA 3ZITA 2J9HA 3IPZA 1XBSA 5ECIB 1QMVA 1NW2A 5ECOB 4LA1A 4F03A 4WF5A 3TCOA 3LWAA 1SL0B 4PNGA 4L5OA 5CP1A 3GFKA 1LJRA 2QA2A 3ZRDA 3F0IA 4BL7B 5GAND 2LJKA 1URMA 4EF0A 3C8EA 4TKYA 13GSA 5CRHA 4IP1A 3ZTLA 5INYA 3TJKA 1VF3A 3AY8A 1QGVA 2P0GA 4USSA 1Z6NA 4IW9A 5G30A 1SJIA 5LCZA 3FR3A 3JCML 3VLNA 3W8JA 1VF1A 2PVOC 5ID2B 1FG4A 3HXSA 4I2UA 2E2GA 4POLA 5CRDA 4AKGA 1XOAA 4HU9A 1BAYA 2H1BA 2KP1A 2VLUA 4A5PA 3TOUA 4X43A 3KD0A 4FH8A 2KLXA 5HFGA 3GURA 1Y1UA 2JACA 1EGRA 2X8HA 4CDOA 1X9SB 2IIYA 1PX6A 4MH2A 1MEKA 5KN2A 4NHZA 3E0UA 5DQSA 1HNCA 5J4YA 4Z2UA 3C7MA 4FYCA 2CX4A 1EEJA 4IQAA 2R2JA 3F8UA 3UL3A 2LUSA 3PPUA 3TKSC 2B5XA 3EVIA 2C8UA 2XPDA 4YH2A 4KX4A 4I5QA 2XHFA 2YWMA 4YQVA 4IJIA 6GSWA 2CAIA 2HSHA 3GV1A 4D73B 4AGSA 3U5RE 5AIXA 2H74A 4TVEA 5DAKB 5H5SA 3ERWA 4ZB8A 1FO5A 1O85A 3I69A 2QSIA 3VK9A 3QPMA 3HZ8A 4K9ZA 4ZBAA 1V2AA 1M9AA 2ZUPA 1PGTA 4KDUA 4YKFA 1DUGA 5F8BA 1OE7A 4MF7A 6GSSA 1N8JA 3G7JA 4G01A 2O5VA 1JLVA 4TR1B 2O85A 1YZXA 4HZ4A 2WULA 2FLSA 4I8BA 4K8MA 3EPTA 2LJRA 1TRVA 4L0WA 2EFDA 1FVJA 3CHXC 4TXOA 4PQHA 5IMFA 1O7UA 1YJ6A 2LRTA 1YKAA 5J40A 3MIXA 2P5RA 1OC3A 2WW1A 1YVLA 2FGXA 4AKIA 1DE1A 3WGDA 3VWXA 2N5AA 2O7KA 3J7Yk 3W6GA 10GSA 14GSA 3UJ1A 2HSNA 1M2BA 4MZWA 3MNGA 5C04A 1ZYNA 1AIUA 3HJOA 2OE1A 1MDJA 3F4SA 2K9FA 1XWKA 4POBA 1K0DA 2R3XA 5F07A 2CVDA 4ACSA 2OBKA 2H75A 3SWLA 1SENA 3UEMA 3I9V2 4N0VA 2DC5A 1MD4A 1BQ7A 5G1LA 2LTKA 1SU9A 3P7XA 3HVNA 4WBRD 4MZCA 4L5LA 1WP0A 3D4TA 4ZL8A 2R0PA 5ENUA 4BPYA 3TDGA 1ERUA 1O81A 4EUYA 1K0BA 5KN3A 4OCFA 4TR3A 1PL1A 2IMEA 1K3LA 4MNNA 3BCIA 3R3EA 2DJKA 1PN0A 3HVSA 2G2QA 5J4UA 2GQKA 1GSSA 1ZL9A 1K0OA 5JCUA 1TRUA 3FY7A 3QCPA 4HU7A 1T4YA 3ZMLA 5ELGA 3GN3A 1ABAA 2BTOT 1K3YA 4ML1A 2YV7A 4PUAA 2GSQA 3QOUA 4ZXGA 2IWTA 4DEJA 4EIPA 2RUFA 3RHBA 2L57A 3MYDA 3KGKA 2ZNMA 1YKCA 1BJXA 3C71A 3KXOA 5IIZA 1M2AA 2L5OA 3SBCA 1GSQA 4BA7A 5IMZA 3HVXA 2CQ9A 3DEXA 2PERA 5IOXA 1M3IA 12GSA 3F9UA 5CYYA 2IMIA 3GMFA 3ZZXA 4V2LA 4ZB9A 5JWRB 2H71A 4YQUA 1SK0A 2GZPA 1T1VA 4G0KA 2R4VA 2VD0A 2H73A 3WYWA 3PR8A 1GNEA 1UC7A 1YF0A 4K0NA 1G0TA 3KMNA 1I1IP 5J9BA 2OKAA 2LEGA 5E59A 5ECPB 1I9DA 4DVCA 1ZOFA 3LXTA 3N9JA 4FO5A 2LJAA 5IMCA 4TXOB 3PGTA 3LXZA 1XXUA 2H1AA 3TJJA 1H75A 1WJKA 5A5KA 3QD9A 5AISA 4XS4B 3FEUA 5ECLB 5A4WA 3ZLPA 1XWCA 5DJLA 4F0CA 3WGXA 1U87A 2F3MA 4Q5QA 2CA8A 3UAPA 1V57A 3NIVA 3PINA 2HLSA 1SVLA 3E9JB 2GLRA 1Q98A 2LKUA 2HSNB 1PA3A 4EKZA 1YDKA 4OO4A 4ECBA 3GKNA 2A2RA 2YWOA 2V6OA 5COHA 5DALB 1V58A 3IE3A 1F9MA 3S9FA 1TK5B 2ES7A 5IM9A 1EZKA 4AF2A 4MH3A 6GSXA 2HRNA 1KBNA 2VCTA 3DWVA 3VWWA 3KCMA 4WBJA 4XIHA 1JLWA 4F82A 5DCGA 3TJFA 2H30A 4BIKA 1G6WA 1GH2A 3WT2A 2FA8A 5ECRB 3HJMA 2IFQA 2GQMA 3CQFA 2B1KA 1ZZYA 4MPGA 3GKMA 3QAVA 1S4BP 4GQFA 3GYKA 3ZMKA 2FA4A 2P5QA 2WRTA 4EL1A 3PH9A 4MA9A 3IXRA 3DRNA 2JL4A 3F4RA 1GLQA 3RPNA 5CNWA 3UMAA 1U3AA 2R0CA 1GSFA 4MMMA 1PSQA 3BBYA 1XG8A 4ZBBA 1AQVA 2OBIA 4HSCX 1G6YA 4EVMA 3D5JA 2IPAA 4ZL9A 4PQIA 1TRSA 3CSHA 2L6CA 2WZSA 3EINA 2MMOA 4FYUA 1B8XA 2H66A 2PU9C 5A4VA 1PKWA 4KA0A 3FW2A 2OT3A 3MAKA 2HE3A 3M3MA 11GSA 5J47A 2WFCA 2E0QA 3KH9A 5G2ZA 2HRFA 1GSEA
chains in the Genus database with same CATH topology
3UIWA 4Z7XA 3KTLA 2WJUA 5IQYA 1PL2A 4WEYA 2C80A 3GTUB 3TGZA 3QMXA 5G5EA 3LQ7A 1TJDA 4HJMA 3GA4A 2VLTA 4TRXA 2I9HA 2F9SA 3LORA 2YOIA 1X5CA 1CQHA 4QQ7A 3M9JA 1O8WA 2OJLA 2PWJA 1G7EA 1PQNA 2N5FA 2H6XA 1T7PB 2NDOA 4NPBA 2V2GA 3E3EA 2X49A 2BMXA 2FWHA 2CVKA 3F3QA 1FAAA 4HDEA 4N30A 1BX9A 5HR1A 2D2ZA 4N3ZA 2JADA 2VL2C 4K2XA 2VD1A 3A2XA 1ZCPA 2H19A 3GUSA 4JU5A 1F3BA 2OE3A 1SD9A 4J56E 2H0HA 1SVOA 3EE2A 1AQXA 2G0FA 4RI6A 2B7JA 1QK8A 4GQCA 4V1Ag 2X4AA 4AI6A 5IPHA 3GHAA 2TRCP 4XRDA 1KNGA 3Q74A 4AJ8A 1O73A 1PKZA 3D22A 3A2WA 2KOKA 2C1YA 2DMLA 1TTZA 2HZFA 4X1UA 2O8VB 3UARA 2L4QA 2VAFA 4V2NA 3M8NA 1AAZA 2PGTA 2K18A 4GSTA 1B48A 3LJRA 4PTSA 3ZFBA 2B5EA 2DKIA 3CRTA 1V98A 2L5LA 1GSYA 3LG6A 4K7IA 2X8GA 4N11A 5J9CA 2E7PA 4YQMA 2EIQA 2R6KA 3H8QA 1A2JA 1VRSD 3ERGA 3FK8A 3TKQA 4IN0A 2IMFA 3A3TA 3ME8A 4ILFA 4DSQA 3EWLA 5JCGA 3FYGA 1HNBA 2HRKA 2PBJA 3ZL5A 3HD5A 1PRXA 2GT6A 1T00A 2TIRA 4HJ2A 1B9YC 1ON4A 3UVTA 3GH6A 1GRXA 3WD6A 1E6BA 4G9HA 1GUKA 1SK1A 1Z7PA 1THXA 1TP9A 2H0GA 4IS0A 2C3NA 5ECMB 2XBQA 3EYTA 5A34B 1TXXA 1NSWA 3J7Yb 3A5WA 2K8SA 2H01A 4JR6A 3IA1A 4F9ZA 2OE0A 4YKGA 3FZ9A 3L4NA 4Z2TA 2F8FA 4BWQA 2I81A 1SYXA 1OE8A 2IMDA 1R5AA 4GRFA 1WPIA 4KGIA 5BRTA 1ZYEA 1H4OA 2QA1A 4HZ2A 3CSJA 2QGVA 4KSOA 5G5FA 2GQLA 5D9TA 1SKRB 2BJXA 3TRXA 3ZYWA 4JR4A 2YN1A 2LRNA 2HFDA 1XWBA 5KOXA 3TKRA 2V6KA 3HHVA 3HVVA 2AJQB 4K5SA 3CSIA 5ELAA 2QKEA 3FR6A 4WF4A 3MWHA 4RQXA 5DCHA 5IMVA 5HFKA 2J23A 2YZUA 3F6DA 4ML6A 2O87A 1EEMA 1GUMA 1U6TA 1OC9A 2A2SA 4Q5FA 4MCUA 4JRRA 2H76A 2GSTA 4EDZA 1X0RA 2H1DA 2GZYA 2VCWA 1XOBA 2FWEA 4AKXB 4AKHA 1WMJA 3KMOA 3F3RA 2A4HA 2VM2A 3H4KA 2GT5A 1O6JA 2FD3A 4OWYA 1TRWA 1KTEA 1UN2A 3IHQA 1K0NA 2X8CA 2HT9A 2H6YA 2LV3A 1WE0A 2X99A 2MBSA 4MDCA 4NV2A 5JWOB 4I97A 2JZTA 1ZGNA 1ERVA 1HQOA 5A5HA 5BMUA 4IELA 3L9SA 3LEFA 4HQSA 3VWUA 4AJ6A 1U3IA 2EIOA 3KIJA 4LL1B 4WR5A 3DXBA 2REMA 1ZYPA 3P90A 5D96A 2LQQA 4MJBA 4MP4A 5E4WA 4LL4B 2FNOA 3KM6A 4O5RA 1R7HA 1XW9A 2HRKB 2C0GA 2PUKC 2HSMA 3G9BA 3TKSA 3FZ4A 5ECKB 8GSSA 1TK0B 4PURA 4XCSA 5IO0A 4EIQA 5CAXA 5F0GA 2GS3A 4XTSA 4BVYA 4G0IA 2JZSA 1C72A 4IQ1A 5C00A 6GSUA 3IK9A 3UBKA 1SJ6A 1YEPA 2EFEA 3IAM2 5D93A 3FZAA 2AUVA 5B8AA 3BOAA 1SL1B 1X9MB 1BG1A 22GSA 1JZWA 2TRXA 4ECIA 4IKHA 4NHWA 4GSNA 3GX0A 5KN0A 1FOHA 1R5PA 1TK8B 2I4AA 4LLRA 3ZIVA 4NAXA 3TU3B 4KCEA 1ZMAA 2M46A 5IPGA 1TU8A 1AW9A 1MDKA 6GSVA 4EDYA 5D9WA 2GSSA 4O92A 4LMVA 3GH9A 1J08A 2M80A 2H8LA 1NHOA 2PN8A 1A24A 2DSAA 1V9WA 3LW9A 1BF5A 3KTBA 5ECSA 3APSA 2EC4A 1LBKA 1ML6A 3L9UA 1T3BA 4TN8A 4GDFA 4XS6A 1EOHA 1XCCA 1DE2A 2I1UA 1OC9B 3L9VA 1Z9HA 5A4UA 4JZQA 2DJ1A 5FT3A 2CAQA 1B4PA 3FZ5A 5D9VA 1HNAA 3IK7A 4E68A 4L0UA 4PUFC 3CYNA 5JWQB 3P8WA 3EU3A 1FVKA 1VGLA 5J3RA 4MJCA 3HA9A 2EFCA 2H1LA 1FW1A 2OA7A 1R26A 5KOWA 2HQTA 1UVZA 2B6MA 3CWGA 1OVNA 4MF5A 5BMUB 1QFNA 5G1KA 1EGOA 4I2TA 3MDKA 3LSZA 1GTBA 4WR4A 5KN1A 3Q18A 2F8AA 2VO4A 2LSTA 1M99A 1W89A 2FHEA 4CHSA 1MTCA 3CRUA 3WGEA 4MK3A 3QAWA 1S3DA 1ERTA 4OFMA 2CVBA 2R5GA 2C3QA 19GSA 1GWCA 2HSMB 4WETA 2VOCA 2X64A 2YWIA 1DSBA 4IBPA 2R37A 4Q5NA 3CTGA 1BG5A 3APOA 4K1FA 5KEJA 1IYIA 1VF4A 5B7CA 5ECHB 3FHKA 1QQ2A 3FRCA 4EC0A 4RQRA 1YEXA 6GSYA 3M1GA 2AHEA 4KDXA 2MMZA 4KUNA 4KAEA 3HDCA 1YF1A 2FY6A 1S3AA 2LQOA 3DVXA 2YJ7A 5DBQA 1PMTA 5EL8A 3LYKA 4IP6A 1OAZA 4AJ7A 1T4ZA 4OMVA 6GSTA 4PXOA 4BL7A 4G2EA 1GSDA 3VI5A 1ZYQB 2WGRA 2IMKA 3WT1A 4GSSA 4K2DA 3LFLA 2WZ9A 4JBBA 2B7KA 4RI7A 3C1RA 1SJZA 1E2YA 2LNTA 1GL8A 2N5BA 2GVPA 1J9BA 1GP1A 3HCZA 1NM3A 2LNSA 3KZQA 4G0LA 2HYXA 4YAVA 1T8EB 4YAPA 2YNXA 4KW6A 1WIKA 1OKTA 3M0FA 5F06A 4GWRA 4TW5A 5D9XA 2YZHA 3TRQA 1O8XA 4EE0A 1AC1A 1QUWA 3TOTA 1Y6EA 3DVWA 5B8BA 1HD2A 5HFIA 2L4CA 3ME7A 1TKDB 4IHUA 4XHMA 2JU5A 3DGQA 3UBLA 18GSA 2YWNA 1Y25A 4I6XA 1XIYA 2HSYA 4JE1A 1SK2A 2FUG2 2MZCA 2ON5A 1WWJA 1M9BA 2P31A 2A2PA 2DIZA 3EU4A 2PMTA 4RUVA 4D73A 2PPTA 1PN9A 3G7YA 1XW5A 2YV9A 5DAKA 2HRAA 3A2VA 3DYRA 3GKKA 2NTOA 5LNKe 3ZIJA 3D21A 1XWAA 4POMA 2EFHA 2GDRA 1KEBA 2ON7A 2VLVA 2XPEA 2YPMA 2KP2A 2LS5A 4OD7A 1TU7A 3IR4A 4N0ZA 1XZOA 2OACA 1RQMA 1M2DA 4TR1A 3VPTA 4O7HA 3O3TA 2IFQB 4XS1A 4QL7A 2O89A 4MPFA 2CZ3A 5LD0A 3A5IA 1A0RP 5JCWA 4HS1A 1XFLA 4TOPA 1TI1A 2FWGA 4Z2RA 1WOUA 1Q4JA 2MMAA 3IC8A 1GSUA 3QR6A 1F3AA 2DJ0A 3K8NA 2C3TA 3TKSE 4NV5A 5AIVA 4MJEA 5ECQB 4O32A 4FQUA 1AQWA 5F05A 4QMKA 2B5YA 4TXVA 2RUEA 3HJPA 2IN3A 4ECJA 3GL5A 2GGTA 2GTUA 2FCHA 2K6VA 2HI7A 4ZL7A 4G19A 5D73A 4CY8A 3EURA 3HMJG 1GTUA 2DIYA 2NVLA 1K3OA 5HQPA 2VKZG 2WS2A 4MJAA 3LYPA 2HNLA 2VL2A 3N5OA 4KSMA 1Z7RA 4NWYA 5DQYA 3IOSA 2DJJA 5AGYA 1EV9A 20GSA 2V41A 2VL3A 5H5QA 1TXUA 1SVMA 1JHBA 1K0CA 4N10A 3HZ4A 4J57E 3ED3A 3I43A 3R2QA 5GSSA 3ERFA 1Z5YE 3GKXA 3D0ZA 1BEDA 2C0FA 3C73A 5A1NA 1B4QA 3BD2A 4K7OA 4ZBDA 4K7NA 2H6ZA 3QDNA 3ZVJA 4KDYA 4PNFA 5GZZB 1X9WB 1W4VA 5FHIA 1GLPA 17GSA 3US3A 2HXKA 2RIIA 5EY6A 2V1MA 3ZREA 1PX7A 2YP6A 4OFTA 5B6MA 2WB9A 3TJBA 4GCIA 3LGCA 2RM6A 1FHEA 3HKRA 3F63A 3UVHA 3RPPA 1WRYA 3TJGA 5J4VA 4OO5A 3IHGA 4KB3A 4GXZA 3TRPA 2DBCA 3RHCA 4ZILA 3DMLA 5CO3A 3RDWA 1U88A 1TOFA 3CTFA 3GL3A 3IC4A 2ZCTA 2ALBA 2C0DA 4J2FA 4V2MA 4HEA2 4ULXA 4W66A 2R0GA 3QFAC 7GSSA 2K8VA 2QC7A 1GTAA 3IDVA 2IL3A 4GF0A 4X0XA 5IO2A 1USBA 3UOMA 4XS4A 3VFIA 2RM5A 1GUHA 3GNJA 2H0IA 3F6FA 1M0UA 3G7IA 4BVXA 2MMNA 3L78A 3FR9A 5H5RA 1ILOA 1A2LA 3BCKA 5GAPD 1SD8A 5DALA 3VWVA 4F0BA 5EVOA 1GTIA 3OR5A 5CREA 3ZFLA 2JSYA 1OYJA 3GSSA 3EC3A 3CXGA 2VL9A 4MZBA 2VUPA 3CMIA 4CW9A 1TW9A 3TKPA 5G31A 2DJ2A 2DKHA 1XVQA 5D8IA 4POKA 2DJ3A 5AN1A 4KE3A 3V1WA 1K0AA 1F37A 1EWXA 2C4JA 3HY2A 4ICYA 1GULA 2Z9SA 1EP7A 1UA5A 2AYTA 3QAGA 2GSRA 2H70A 4ZB7A 1ST9A 2CX3A 1YY7A 2AAWA 5B6NA 4WXTA 4OFNA 1LU4A 4FYBA 9GSSA 4Q5RA 1FB0A 2H1GA 4K6XA 1R4WA 4FIWA 5A1NB 5DDLA 4G10A 1VF2A 4ECCA 4PX1A 1B9XC 2IJYA 4NXIA 3GIXA 2HZEA 4TR4A 1A23A 1S3CA 1I5GA 3P2AA 4EXJA 3GRXA 5EPFA 1HYUA 1F2EA 4HUAA 2NPBA 1Z3EA 2YANA 4H86A 2CZ2A 1CQGA 5GSTA 4O5QA 1F6MC 1DBYA 5J41A 4BWSA 4DSSA 3RBTA 4JEDA 2M72A 3FMWA 3IBHA 1NHYA 1A0FA 1AUCA 3QFBC 2LRCA 2CV4A 4ZIJA 1J0FA 2RLIA 3GTUA 1SYRA 3W8SA 1QXHA 3APQA 2E2MA 3C1SA 4L8EA 4MF6A 2VM1A 1JZDA 2EIRA 3VI7A 5A5HB 1XWGA 4X4JA 2F51A 5FWGA 1V40A 3HYPA 1SKWB 4KH7A 2JZRA 1X5DA 2KHPA 1OKDA 3EMPA 3F4TA 3MSZA 4BVXB 2WDUA 4LMWA 2WCIA 2V32A 2VCZA 3NOFA 3FKFA 1FB6A 1G7OA 2B3SA 3NZNA 3U6VA 3I6AA 1FOVA 4K0GA 2MBTA 1JFUA 16GSA 4BVYB 3DKSA 3EMXA 5ECNB 4O5UA 2I3YA 2PVQA 4P3YB 4TR0A 3L0HA 1A8YA 4KF9A 4EO3A 4QL9A 4CY6A 2H72A 3H93A 1MDIA 5CRWA 1A8LA 5DVBA 4MLYA 2VCXA 5CRGA 2DLXA 4F2IA 1BYEA 3BJ5A 2YCDA 3H1NA 1X5EA 3IV4A 3VURA 1THOA 2A4VA 2KUCA 4KNDA 2FWFA 4OCEA 1GNWA 2L59A 4V1Ap 4GLTA 2UZ8A 5HR2A 1A2MA 5IMDA 2AB6A 4HQZA 5IOWA 3O76A 2MYGA 2HZEB 1IYHA 3Q19A 2GZZA 1XPVA 1ERWA 3GSTA 2B1LA 2VCQA 5ID2A 3D4MA 4NMUA 4PQ1A 2VCVA 2VIMA 1Z6MA 2JSZA 4ZB6A 1XVWA 3D6IA 5A34A 4DSSB 5IMAA 1EP8A 2YJHA 4HI7A 2AV4A 3IAS2 1PD21 3IRAA 1JZOA 1MD3A 1N25A 4PGTA 4IJ3A 1RK4A 1TI3A 3RAZA 4ISDA 4DSRA 1SKSB 3DIEA 2L6DA 1EV4A 1AXDA 1RW1A 2OADA 4KCAA 4MABA 1M7TA 3KJYA 4HOJA 3Q6OA 4XRAA 5HR0A 3CBUA 3KEBA 5L71A 3ZVJD 3O6TA 4WKWA 3KP8A 4GTUA 4E8EA 1N2AA 1YQ1A 2C0EA 1JZRA 3KH7A 2CT6A 3H79A 1TDIA 2XBIA 2DMMA 2NBSA 1ACVA 2UV8G 1XW6A 1EOGA 4IVFA 5ABRA 1OC8A 3TUEA 3M9KA 3VPQA 2XC2A 4ID0A 5J5NA 4K5RA 1K0MA 4E8HA 3ISOA 3DD3A 1SL2B 5DJMA 3TB2A 5HR3A 3KP9A 3GX8A 4IGJA 3ZITA 2J9HA 3IPZA 1XBSA 5ECIB 1QMVA 1NW2A 5ECOB 4LA1A 4F03A 4WF5A 3TCOA 3LWAA 1SL0B 4PNGA 4L5OA 5CP1A 3GFKA 1LJRA 2QA2A 3ZRDA 3F0IA 4BL7B 5GAND 2LJKA 1URMA 4EF0A 3C8EA 4TKYA 13GSA 5CRHA 4IP1A 3ZTLA 5INYA 3TJKA 1VF3A 3AY8A 1QGVA 2P0GA 4USSA 1Z6NA 4IW9A 5G30A 1SJIA 5LCZA 3FR3A 3JCML 3VLNA 3W8JA 1VF1A 2PVOC 5ID2B 1FG4A 3HXSA 4I2UA 2E2GA 4POLA 5CRDA 4AKGA 1XOAA 4HU9A 1BAYA 2H1BA 2KP1A 2VLUA 4A5PA 3TOUA 4X43A 3KD0A 4FH8A 2KLXA 5HFGA 3GURA 1Y1UA 2JACA 1EGRA 2X8HA 4CDOA 1X9SB 2IIYA 1PX6A 4MH2A 1MEKA 5KN2A 4NHZA 3E0UA 5DQSA 1HNCA 5J4YA 4Z2UA 3C7MA 4FYCA 2CX4A 1EEJA 4IQAA 2R2JA 3F8UA 3UL3A 2LUSA 3PPUA 3TKSC 2B5XA 3EVIA 2C8UA 2XPDA 4YH2A 4KX4A 4I5QA 2XHFA 2YWMA 4YQVA 4IJIA 6GSWA 2CAIA 2HSHA 3GV1A 4D73B 4AGSA 3U5RE 5AIXA 2H74A 4TVEA 5DAKB 5H5SA 3ERWA 4ZB8A 1FO5A 1O85A 3I69A 2QSIA 3VK9A 3QPMA 3HZ8A 4K9ZA 4ZBAA 1V2AA 1M9AA 2ZUPA 1PGTA 4KDUA 4YKFA 1DUGA 5F8BA 1OE7A 4MF7A 6GSSA 1N8JA 3G7JA 4G01A 2O5VA 1JLVA 4TR1B 2O85A 1YZXA 4HZ4A 2WULA 2FLSA 4I8BA 4K8MA 3EPTA 2LJRA 1TRVA 4L0WA 2EFDA 1FVJA 4TXOA 4PQHA 5IMFA 1O7UA 1YJ6A 2LRTA 1YKAA 5J40A 3MIXA 2P5RA 1OC3A 1YVLA 2FGXA 4AKIA 1DE1A 3WGDA 3VWXA 2N5AA 2O7KA 3J7Yk 3W6GA 10GSA 14GSA 3UJ1A 2HSNA 1M2BA 4MZWA 3MNGA 5C04A 1ZYNA 1AIUA 3HJOA 2OE1A 1MDJA 3F4SA 2K9FA 1XWKA 4POBA 1K0DA 2R3XA 5F07A 2CVDA 4ACSA 2OBKA 2H75A 3SWLA 1SENA 3UEMA 3I9V2 4N0VA 2DC5A 1MD4A 1BQ7A 5G1LA 2LTKA 1SU9A 3P7XA 4WBRD 4MZCA 4L5LA 1WP0A 3D4TA 4ZL8A 2R0PA 5ENUA 4BPYA 3TDGA 1ERUA 1O81A 4EUYA 1K0BA 5KN3A 4OCFA 4TR3A 1PL1A 2IMEA 1K3LA 4MNNA 3BCIA 3R3EA 2DJKA 1PN0A 3HVSA 2G2QA 5J4UA 2GQKA 1GSSA 1ZL9A 1K0OA 5JCUA 1TRUA 3FY7A 3QCPA 4HU7A 1T4YA 3ZMLA 5ELGA 3GN3A 1ABAA 2BTOT 1K3YA 4ML1A 2YV7A 4PUAA 2GSQA 3QOUA 4ZXGA 2IWTA 4DEJA 4EIPA 2RUFA 3RHBA 2L57A 3MYDA 3KGKA 2ZNMA 1YKCA 1BJXA 3C71A 3KXOA 5IIZA 1M2AA 2L5OA 3SBCA 1GSQA 4BA7A 5IMZA 3HVXA 2CQ9A 3DEXA 2PERA 5IOXA 12GSA 3F9UA 5CYYA 2IMIA 3GMFA 3ZZXA 4V2LA 4ZB9A 5JWRB 2H71A 4YQUA 1SK0A 2GZPA 1T1VA 4G0KA 2R4VA 2VD0A 2H73A 3WYWA 3PR8A 1GNEA 1UC7A 1YF0A 4K0NA 1G0TA 3KMNA 5J9BA 2OKAA 2LEGA 5E59A 5ECPB 1I9DA 4DVCA 1ZOFA 3LXTA 3N9JA 4FO5A 2LJAA 5IMCA 4TXOB 3PGTA 3LXZA 1XXUA 2H1AA 3TJJA 1H75A 1WJKA 5A5KA 3QD9A 5AISA 4XS4B 3FEUA 5ECLB 5A4WA 3ZLPA 1XWCA 5DJLA 4F0CA 3WGXA 1U87A 2F3MA 4Q5QA 2CA8A 3UAPA 1V57A 3NIVA 3PINA 2HLSA 1SVLA 3E9JB 2GLRA 1Q98A 2LKUA 2HSNB 1PA3A 4EKZA 1YDKA 4OO4A 4ECBA 3GKNA 2A2RA 2YWOA 2V6OA 5COHA 5DALB 1V58A 3IE3A 1F9MA 3S9FA 1TK5B 2ES7A 5IM9A 1EZKA 4AF2A 4MH3A 6GSXA 2HRNA 1KBNA 2VCTA 3DWVA 3VWWA 3KCMA 4WBJA 4XIHA 1JLWA 4F82A 5DCGA 3TJFA 2H30A 1G6WA 1GH2A 3WT2A 2FA8A 5ECRB 3HJMA 2IFQA 2GQMA 2B1KA 1ZZYA 4MPGA 3GKMA 3QAVA 4GQFA 3GYKA 3ZMKA 2FA4A 2P5QA 2WRTA 4EL1A 3PH9A 4MA9A 3IXRA 3DRNA 2JL4A 3F4RA 1GLQA 3RPNA 5CNWA 3UMAA 1U3AA 2R0CA 1GSFA 4MMMA 1PSQA 3BBYA 4ZBBA 1AQVA 2OBIA 1G6YA 4EVMA 3D5JA 2IPAA 4ZL9A 4PQIA 1TRSA 3CSHA 2L6CA 3EINA 2MMOA 4FYUA 1B8XA 2H66A 2PU9C 5A4VA 1PKWA 4KA0A 3FW2A 2OT3A 3MAKA 2HE3A 3M3MA 11GSA 5J47A 2WFCA 2E0QA 3KH9A 5G2ZA 2HRFA 1GSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIW A;  4Z7X A;  3KTL A;  2WJU A;  5IQY A;  1PL2 A;  4WEY A;  2C80 A;  3GTU B;  3TGZ A;  3QMX A;  5G5E A;  3LQ7 A;  1TJD A;  4HJM A;  3GA4 A;  2VLT A;  4TRX A;  2I9H A;  2F9S A;  3LOR A;  2YOI A;  1X5C A;  1CQH A;  4QQ7 A;  3M9J A;  1O8W A;  2OJL A;  2PWJ A;  1G7E A;  1PQN A;  2N5F A;  2H6X A;  1T7P B;  2NDO A;  4NPB A;  2V2G A;  3E3E A;  2BMX A;  2FWH A;  2CVK A;  3F3Q A;  1FAA A;  4HDE A;  4N30 A;  1BX9 A;  5HR1 A;  2D2Z A;  2JAD A;  2VL2 C;  2VD1 A;  3A2X A;  1ZCP A;  2H19 A;  3GUS A;  4JU5 A;  1F3B A;  2OE3 A;  1SD9 A;  4J56 E;  2H0H A;  3EE2 A;  1AQX A;  2G0F A;  4RI6 A;  2B7J A;  1QK8 A;  4GQC A;  4V1A g;  5IPH A;  3GHA A;  2TRC P;  4XRD A;  1KNG A;  3Q74 A;  4AJ8 A;  1O73 A;  1PKZ A;  3D22 A;  3A2W A;  2KOK A;  2C1Y A;  2DML A;  1TTZ A;  2HZF A;  4X1U A;  2O8V B;  3UAR A;  2L4Q A;  2VAF A;  4V2N A;  3M8N A;  1AAZ A;  2PGT A;  2K18 A;  4GST A;  1B48 A;  3LJR A;  4PTS A;  3ZFB A;  2B5E A;  3CRT A;  1V98 A;  2L5L A;  1GSY A;  3LG6 A;  4K7I A;  2X8G A;  4N11 A;  5J9C A;  2E7P A;  4YQM A;  2EIQ A;  2R6K A;  3H8Q A;  1A2J A;  1VRS D;  3ERG A;  3FK8 A;  3TKQ A;  4IN0 A;  2IMF A;  3A3T A;  3ME8 A;  4ILF A;  4DSQ A;  3EWL A;  5JCG A;  3FYG A;  1HNB A;  2HRK A;  2PBJ A;  3ZL5 A;  3HD5 A;  1PRX A;  2GT6 A;  1T00 A;  2TIR A;  4HJ2 A;  1B9Y C;  1ON4 A;  3UVT A;  3GH6 A;  1GRX A;  3WD6 A;  1E6B A;  4G9H A;  1GUK A;  1SK1 A;  1Z7P A;  1THX A;  1TP9 A;  2H0G A;  4IS0 A;  2C3N A;  5ECM B;  2XBQ A;  3EYT A;  1TXX A;  3J7Y b;  1NSW A;  3A5W A;  2K8S A;  2H01 A;  4JR6 A;  3IA1 A;  4F9Z A;  2OE0 A;  3FZ9 A;  3L4N A;  2F8F A;  4BWQ A;  2I81 A;  1SYX A;  1OE8 A;  2IMD A;  1R5A A;  4GRF A;  1WPI A;  4KGI A;  1ZYE A;  1H4O A;  4HZ2 A;  3CSJ A;  2QGV A;  4KSO A;  5G5F A;  2GQL A;  5D9T A;  1SKR B;  2BJX A;  3TRX A;  3ZYW A;  4JR4 A;  2YN1 A;  2LRN A;  2HFD A;  1XWB A;  3TKR A;  2V6K A;  3HHV A;  3HVV A;  2AJQ B;  3CSI A;  5ELA A;  2QKE A;  3FR6 A;  4WF4 A;  3MWH A;  4RQX A;  5DCH A;  5IMV A;  5HFK A;  2J23 A;  2YZU A;  3F6D A;  4ML6 A;  2O87 A;  1EEM A;  1GUM A;  1U6T A;  1OC9 A;  2A2S A;  4Q5F A;  4MCU A;  4JRR A;  2H76 A;  2GST A;  4EDZ A;  1X0R A;  2H1D A;  2GZY A;  2VCW A;  1XOB A;  2FWE A;  1WMJ A;  3KMO A;  3F3R A;  2VM2 A;  3H4K A;  2GT5 A;  1O6J A;  2FD3 A;  4OWY A;  1TRW A;  1KTE A;  1UN2 A;  3IHQ A;  1K0N A;  2X8C A;  2HT9 A;  2H6Y A;  2LV3 A;  1WE0 A;  2X99 A;  2MBS A;  4MDC A;  4NV2 A;  5JWO B;  4I97 A;  2JZT A;  1ZGN A;  1ERV A;  1HQO A;  5BMU A;  4IEL A;  3L9S A;  4HQS A;  3LEF A;  3VWU A;  4AJ6 A;  1U3I A;  2EIO A;  3KIJ A;  4LL1 B;  4WR5 A;  3DXB A;  2REM A;  3P90 A;  5D96 A;  2LQQ A;  4MJB A;  4MP4 A;  5E4W A;  4LL4 B;  2FNO A;  3KM6 A;  4O5R A;  1R7H A;  1XW9 A;  2HRK B;  2C0G A;  2PUK C;  2HSM A;  3G9B A;  3TKS A;  3FZ4 A;  5ECK B;  8GSS A;  1TK0 B;  4PUR A;  4XCS A;  5IO0 A;  5CAX A;  5F0G A;  2GS3 A;  4XTS A;  4BVY A;  4G0I A;  2JZS A;  1C72 A;  4IQ1 A;  5C00 A;  6GSU A;  3IK9 A;  3UBK A;  1SJ6 A;  1YEP A;  3IAM 2;  5D93 A;  3FZA A;  2AUV A;  5B8A A;  3BOA A;  1SL1 B;  1X9M B;  22GS A;  1JZW A;  2TRX A;  4ECI A;  4IKH A;  4NHW A;  4GSN A;  3GX0 A;  5KN0 A;  1R5P A;  1TK8 B;  2I4A A;  4LLR A;  3ZIV A;  4NAX A;  4KCE A;  1ZMA A;  2M46 A;  5IPG A;  1TU8 A;  1AW9 A;  1MDK A;  6GSV A;  4EDY A;  5D9W A;  2GSS A;  4O92 A;  4LMV A;  3GH9 A;  1J08 A;  2M80 A;  2H8L A;  1NHO A;  2PN8 A;  1A24 A;  2DSA A;  1V9W A;  3KTB A;  5ECS A;  3APS A;  2EC4 A;  1LBK A;  1ML6 A;  3L9U A;  1T3B A;  4TN8 A;  4XS6 A;  1EOH A;  1XCC A;  1DE2 A;  2I1U A;  1OC9 B;  3L9V A;  1Z9H A;  5A4U A;  4JZQ A;  2DJ1 A;  5FT3 A;  2CAQ A;  1B4P A;  3FZ5 A;  5D9V A;  1HNA A;  3IK7 A;  4L0U A;  4PUF C;  3CYN A;  5JWQ B;  3P8W A;  3EU3 A;  1FVK A;  1VGL A;  5J3R A;  4MJC A;  3HA9 A;  1FW1 A;  2OA7 A;  1R26 A;  2HQT A;  1UVZ A;  2B6M A;  1OVN A;  4MF5 A;  1QFN A;  5G1K A;  1EGO A;  4I2T A;  3MDK A;  3LSZ A;  1GTB A;  4WR4 A;  5KN1 A;  3Q18 A;  2F8A A;  2VO4 A;  2LST A;  1M99 A;  1W89 A;  2FHE A;  4CHS A;  1MTC A;  3CRU A;  3WGE A;  4MK3 A;  3QAW A;  1S3D A;  1ERT A;  4OFM A;  2CVB A;  2R5G A;  2C3Q A;  19GS A;  1GWC A;  2HSM B;  4WET A;  2VOC A;  2X64 A;  2YWI A;  1DSB A;  4IBP A;  2R37 A;  4Q5N A;  3CTG A;  1BG5 A;  3APO A;  4K1F A;  5KEJ A;  1IYI A;  1VF4 A;  5B7C A;  5ECH B;  3FHK A;  1QQ2 A;  3FRC A;  4EC0 A;  4RQR A;  1YEX A;  6GSY A;  3M1G A;  2AHE A;  4KDX A;  2MMZ A;  4KUN A;  4KAE A;  3HDC A;  1YF1 A;  2FY6 A;  1S3A A;  2LQO A;  3DVX A;  2YJ7 A;  5DBQ A;  1PMT A;  5EL8 A;  3LYK A;  4IP6 A;  1OAZ A;  4AJ7 A;  1T4Z A;  4OMV A;  6GST A;  4PXO A;  4BL7 A;  4G2E A;  1GSD A;  3VI5 A;  1ZYQ B;  2WGR A;  2IMK A;  3WT1 A;  4GSS A;  4K2D A;  3LFL A;  2WZ9 A;  4JBB A;  2B7K A;  4RI7 A;  3C1R A;  1SJZ A;  1E2Y A;  2LNT A;  1GL8 A;  2N5B A;  2GVP A;  1J9B A;  1GP1 A;  3HCZ A;  1NM3 A;  2LNS A;  3KZQ A;  4G0L A;  2HYX A;  4YAV A;  1T8E B;  4YAP A;  2YNX A;  4KW6 A;  1WIK A;  1OKT A;  3M0F A;  5F06 A;  4GWR A;  4TW5 A;  5D9X A;  2YZH A;  3TRQ A;  1O8X A;  4EE0 A;  1AC1 A;  1QUW A;  3TOT A;  1Y6E A;  3DVW A;  5B8B A;  1HD2 A;  5HFI A;  2L4C A;  3ME7 A;  1TKD B;  4IHU A;  4XHM A;  2JU5 A;  3DGQ A;  3UBL A;  18GS A;  2YWN A;  1Y25 A;  4I6X A;  1XIY A;  2HSY A;  4JE1 A;  1SK2 A;  2FUG 2;  2MZC A;  2ON5 A;  1WWJ A;  1M9B A;  2P31 A;  2DIZ A;  3EU4 A;  2PMT A;  4RUV A;  4D73 A;  2PPT A;  1PN9 A;  3G7Y A;  1XW5 A;  2YV9 A;  5DAK A;  2HRA A;  3A2V A;  3DYR A;  3GKK A;  2NTO A;  5LNK e;  3ZIJ A;  3D21 A;  1XWA A;  4POM A;  2GDR A;  1KEB A;  2ON7 A;  2VLV A;  2XPE A;  2YPM A;  2KP2 A;  2LS5 A;  4OD7 A;  1TU7 A;  3IR4 A;  4N0Z A;  1XZO A;  2OAC A;  1RQM A;  1M2D A;  4TR1 A;  3VPT A;  4O7H A;  3O3T A;  2IFQ B;  4XS1 A;  4QL7 A;  2O89 A;  4MPF A;  2CZ3 A;  5LD0 A;  1A0R P;  5JCW A;  4HS1 A;  1XFL A;  4TOP A;  1TI1 A;  2FWG A;  1WOU A;  1Q4J A;  2MMA A;  3IC8 A;  1GSU A;  3QR6 A;  1F3A A;  2DJ0 A;  3K8N A;  2C3T A;  3TKS E;  4NV5 A;  5AIV A;  4MJE A;  5ECQ B;  4O32 A;  4FQU A;  1AQW A;  5F05 A;  2B5Y A;  4TXV A;  2RUE A;  3HJP A;  2IN3 A;  4ECJ A;  3GL5 A;  2GGT A;  2GTU A;  2FCH A;  2K6V A;  2HI7 A;  4ZL7 A;  4G19 A;  5D73 A;  3EUR A;  1GTU A;  2DIY A;  2NVL A;  1K3O A;  5HQP A;  2WS2 A;  4MJA A;  3LYP A;  2HNL A;  2VL2 A;  3N5O A;  4KSM A;  1Z7R A;  4NWY A;  5DQY A;  3IOS A;  2DJJ A;  5AGY A;  1EV9 A;  20GS A;  2V41 A;  2VL3 A;  5H5Q A;  1JHB A;  1K0C A;  4N10 A;  3HZ4 A;  4J57 E;  3ED3 A;  3I43 A;  3R2Q A;  5GSS A;  3ERF A;  1Z5Y E;  3GKX A;  3D0Z A;  1BED A;  2C0F A;  3C73 A;  1B4Q A;  3BD2 A;  4K7O A;  4ZBD A;  4K7N A;  3QDN A;  2H6Z A;  3ZVJ A;  4KDY A;  4PNF A;  5GZZ B;  1X9W B;  1W4V A;  5FHI A;  1GLP A;  17GS A;  3US3 A;  2HXK A;  2RII A;  5EY6 A;  2V1M A;  3ZRE A;  1PX7 A;  2YP6 A;  4OFT A;  5B6M A;  2WB9 A;  3TJB A;  4GCI A;  3LGC A;  2RM6 A;  1FHE A;  3HKR A;  3F63 A;  3UVH A;  3RPP A;  1WRY A;  3TJG A;  4OO5 A;  4KB3 A;  4GXZ A;  3TRP A;  2DBC A;  3RHC A;  4ZIL A;  3DML A;  5CO3 A;  3RDW A;  1U88 A;  1TOF A;  3CTF A;  3GL3 A;  3IC4 A;  2ZCT A;  2ALB A;  2C0D A;  4J2F A;  4V2M A;  4HEA 2;  4ULX A;  3QFA C;  7GSS A;  2K8V A;  2QC7 A;  1GTA A;  3IDV A;  2IL3 A;  4GF0 A;  4X0X A;  5IO2 A;  1USB A;  3UOM A;  4XS4 A;  3VFI A;  2RM5 A;  1GUH A;  3GNJ A;  2H0I A;  3F6F A;  1M0U A;  3G7I A;  4BVX A;  2MMN A;  3L78 A;  3FR9 A;  5H5R A;  1ILO A;  1A2L A;  3BCK A;  5GAP D;  1SD8 A;  5DAL A;  3VWV A;  4F0B A;  5EVO A;  1GTI A;  3OR5 A;  5CRE A;  3ZFL A;  2JSY A;  1OYJ A;  3GSS A;  3EC3 A;  3CXG A;  2VL9 A;  4MZB A;  2VUP A;  3CMI A;  4CW9 A;  1TW9 A;  3TKP A;  5G31 A;  2DJ2 A;  5D8I A;  1XVQ A;  4POK A;  2DJ3 A;  5AN1 A;  4KE3 A;  3V1W A;  1K0A A;  1F37 A;  1EWX A;  2C4J A;  3HY2 A;  1GUL A;  2Z9S A;  1EP7 A;  1UA5 A;  2AYT A;  3QAG A;  2GSR A;  2H70 A;  1ST9 A;  2CX3 A;  1YY7 A;  2AAW A;  5B6N A;  4WXT A;  4OFN A;  1LU4 A;  4FYB A;  9GSS A;  4Q5R A;  1FB0 A;  2H1G A;  4K6X A;  1R4W A;  4FIW A;  5DDL A;  4G10 A;  1VF2 A;  4ECC A;  4PX1 A;  1B9X C;  2IJY A;  4NXI A;  3GIX A;  2HZE A;  4TR4 A;  1A23 A;  1S3C A;  1I5G A;  3P2A A;  4EXJ A;  3GRX A;  5EPF A;  1HYU A;  1F2E A;  4HUA A;  2NPB A;  1Z3E A;  4H86 A;  2YAN A;  2CZ2 A;  1CQG A;  5GST A;  1F6M C;  1DBY A;  5J41 A;  4BWS A;  4DSS A;  3RBT A;  4JED A;  2M72 A;  3IBH A;  1NHY A;  1A0F A;  1AUC A;  3QFB C;  2LRC A;  2CV4 A;  4ZIJ A;  1J0F A;  2RLI A;  3GTU A;  1SYR A;  3W8S A;  1QXH A;  3APQ A;  2E2M A;  3C1S A;  4L8E A;  4MF6 A;  2VM1 A;  1JZD A;  2EIR A;  3VI7 A;  1XWG A;  2F51 A;  5FWG A;  1V40 A;  3HYP A;  1SKW B;  4KH7 A;  2JZR A;  1X5D A;  2KHP A;  1OKD A;  3EMP A;  3F4T A;  3MSZ A;  4BVX B;  2WDU A;  4LMW A;  2WCI A;  2V32 A;  2VCZ A;  3NOF A;  3FKF A;  1FB6 A;  1G7O A;  2B3S A;  3NZN A;  3U6V A;  3I6A A;  1FOV A;  4K0G A;  2MBT A;  1JFU A;  16GS A;  4BVY B;  3DKS A;  3EMX A;  5ECN B;  2I3Y A;  2PVQ A;  4P3Y B;  4TR0 A;  3L0H A;  1A8Y A;  4KF9 A;  4EO3 A;  4QL9 A;  2H72 A;  3H93 A;  1MDI A;  5CRW A;  1A8L A;  5DVB A;  4MLY A;  2VCX A;  5CRG A;  2DLX A;  4F2I A;  1BYE A;  3BJ5 A;  2YCD A;  3H1N A;  1X5E A;  3IV4 A;  3VUR A;  1THO A;  2A4V A;  2KUC A;  4KND A;  2FWF A;  4OCE A;  1GNW A;  2L59 A;  4V1A p;  4GLT A;  2UZ8 A;  5HR2 A;  1A2M A;  5IMD A;  2AB6 A;  4HQZ A;  5IOW A;  3O76 A;  2MYG A;  2HZE B;  1IYH A;  3Q19 A;  2GZZ A;  1XPV A;  1ERW A;  3GST A;  2B1L A;  2VCQ A;  5ID2 A;  3D4M A;  4NMU A;  4PQ1 A;  2VCV A;  2VIM A;  1Z6M A;  2JSZ A;  4ZB6 A;  1XVW A;  3D6I A;  4DSS B;  5IMA A;  1EP8 A;  2YJH A;  4HI7 A;  2AV4 A;  3IAS 2;  1PD2 1;  3IRA A;  1JZO A;  1MD3 A;  4PGT A;  4IJ3 A;  1RK4 A;  1TI3 A;  3RAZ A;  4ISD A;  4DSR A;  1SKS B;  3DIE A;  2L6D A;  1EV4 A;  1AXD A;  1RW1 A;  2OAD A;  4KCA A;  4MAB A;  1M7T A;  3KJY A;  4HOJ A;  3Q6O A;  4XRA A;  5HR0 A;  3CBU A;  3KEB A;  5L71 A;  3ZVJ D;  3O6T A;  4WKW A;  3KP8 A;  4GTU A;  4E8E A;  1N2A A;  1YQ1 A;  2C0E A;  1JZR A;  3KH7 A;  2CT6 A;  3H79 A;  1TDI A;  2XBI A;  2DMM A;  2NBS A;  1ACV A;  1XW6 A;  1EOG A;  4IVF A;  5ABR A;  1OC8 A;  3TUE A;  3M9K A;  3VPQ A;  2XC2 A;  4ID0 A;  5J5N A;  1K0M A;  4E8H A;  3ISO A;  3DD3 A;  1SL2 B;  5DJM A;  3TB2 A;  5HR3 A;  3KP9 A;  3GX8 A;  4IGJ A;  3ZIT A;  2J9H A;  3IPZ A;  1XBS A;  5ECI B;  1QMV A;  1NW2 A;  5ECO B;  4LA1 A;  4F03 A;  4WF5 A;  3TCO A;  3LWA A;  1SL0 B;  4PNG A;  4L5O A;  5CP1 A;  3GFK A;  1LJR A;  3ZRD A;  3F0I A;  4BL7 B;  5GAN D;  2LJK A;  1URM A;  4EF0 A;  3C8E A;  4TKY A;  13GS A;  5CRH A;  4IP1 A;  3ZTL A;  5INY A;  3TJK A;  1VF3 A;  3AY8 A;  1QGV A;  2P0G A;  4USS A;  1Z6N A;  4IW9 A;  5G30 A;  1SJI A;  5LCZ A;  3FR3 A;  3JCM L;  3VLN A;  3W8J A;  1VF1 A;  2PVO C;  5ID2 B;  1FG4 A;  3HXS A;  4I2U A;  2E2G A;  4POL A;  5CRD A;  1XOA A;  4HU9 A;  1BAY A;  2H1B A;  2KP1 A;  2VLU A;  3TOU A;  4X43 A;  3KD0 A;  4FH8 A;  2KLX A;  5HFG A;  3GUR A;  2JAC A;  1EGR A;  2X8H A;  4CDO A;  1X9S B;  2IIY A;  1PX6 A;  4MH2 A;  1MEK A;  5KN2 A;  4NHZ A;  3E0U A;  5DQS A;  1HNC A;  3C7M A;  4FYC A;  2CX4 A;  1EEJ A;  4IQA A;  2R2J A;  3F8U A;  3UL3 A;  2LUS A;  3PPU A;  3TKS C;  2B5X A;  3EVI A;  2C8U A;  2XPD A;  4YH2 A;  4KX4 A;  4I5Q A;  2XHF A;  2YWM A;  4YQV A;  4IJI A;  6GSW A;  2CAI A;  2HSH A;  3GV1 A;  4D73 B;  4AGS A;  3U5R E;  5AIX A;  2H74 A;  4TVE A;  5DAK B;  5H5S A;  3ERW A;  4ZB8 A;  1FO5 A;  1O85 A;  3I69 A;  2QSI A;  3VK9 A;  3QPM A;  3HZ8 A;  4K9Z A;  4ZBA A;  1V2A A;  1M9A A;  2ZUP A;  1PGT A;  4KDU A;  1DUG A;  5F8B A;  1OE7 A;  4MF7 A;  6GSS A;  1N8J A;  3G7J A;  1JLV A;  4TR1 B;  2O85 A;  1YZX A;  4HZ4 A;  2WUL A;  2FLS A;  4I8B A;  4K8M A;  2LJR A;  1TRV A;  4L0W A;  1FVJ A;  4TXO A;  4PQH A;  5IMF A;  1O7U A;  1YJ6 A;  2LRT A;  1YKA A;  2P5R A;  1OC3 A;  2FGX A;  1DE1 A;  3WGD A;  3VWX A;  2N5A A;  2O7K A;  3J7Y k;  3W6G A;  10GS A;  14GS A;  3UJ1 A;  1M2B A;  4MZW A;  3MNG A;  5C04 A;  1AIU A;  3HJO A;  2OE1 A;  1MDJ A;  3F4S A;  2K9F A;  1XWK A;  4POB A;  1K0D A;  2R3X A;  5F07 A;  2CVD A;  4ACS A;  2OBK A;  2H75 A;  3SWL A;  1SEN A;  3UEM A;  3I9V 2;  4N0V A;  2DC5 A;  1MD4 A;  1BQ7 A;  5G1L A;  2LTK A;  1SU9 A;  3P7X A;  4WBR D;  4MZC A;  4L5L A;  1WP0 A;  3D4T A;  4ZL8 A;  5ENU A;  4BPY A;  3TDG A;  1ERU A;  1O81 A;  4EUY A;  1K0B A;  5KN3 A;  4OCF A;  4TR3 A;  1PL1 A;  2IME A;  1K3L A;  3BCI A;  3R3E A;  2DJK A;  3HVS A;  2G2Q A;  5J4U A;  2GQK A;  1GSS A;  1ZL9 A;  1K0O A;  5JCU A;  1TRU A;  3FY7 A;  3QCP A;  4HU7 A;  1T4Y A;  3ZML A;  5ELG A;  3GN3 A;  1ABA A;  2BTO T;  1K3Y A;  4ML1 A;  2YV7 A;  4PUA A;  2GSQ A;  3QOU A;  4ZXG A;  2IWT A;  4DEJ A;  2RUF A;  3RHB A;  2L57 A;  3KGK A;  2ZNM A;  1YKC A;  1BJX A;  3C71 A;  3KXO A;  5IIZ A;  1M2A A;  2L5O A;  3SBC A;  1GSQ A;  4BA7 A;  5IMZ A;  3HVX A;  2CQ9 A;  3DEX A;  2PER A;  5IOX A;  12GS A;  3F9U A;  5CYY A;  2IMI A;  3GMF A;  3ZZX A;  4V2L A;  4ZB9 A;  5JWR B;  2H71 A;  4YQU A;  1SK0 A;  2GZP A;  1T1V A;  4G0K A;  2R4V A;  2VD0 A;  2H73 A;  3WYW A;  3PR8 A;  1GNE A;  1UC7 A;  1YF0 A;  4K0N A;  1G0T A;  3KMN A;  5J9B A;  2OKA A;  2LEG A;  5E59 A;  5ECP B;  1I9D A;  4DVC A;  1ZOF A;  3LXT A;  3N9J A;  4FO5 A;  2LJA A;  5IMC A;  4TXO B;  3PGT A;  3LXZ A;  1XXU A;  2H1A A;  3TJJ A;  1H75 A;  1WJK A;  5A5K A;  3QD9 A;  5AIS A;  4XS4 B;  3FEU A;  5ECL B;  5A4W A;  3ZLP A;  1XWC A;  5DJL A;  4F0C A;  3WGX A;  1U87 A;  2F3M A;  3PIN A;  4Q5Q A;  2CA8 A;  3UAP A;  3NIV A;  1V57 A;  2HLS A;  2GLR A;  3E9J B;  1Q98 A;  2LKU A;  2HSN B;  1PA3 A;  4EKZ A;  1YDK A;  4OO4 A;  4ECB A;  3GKN A;  2A2R A;  2YWO A;  2V6O A;  5COH A;  5DAL B;  1V58 A;  3IE3 A;  1F9M A;  3S9F A;  1TK5 B;  2ES7 A;  5IM9 A;  1EZK A;  4AF2 A;  4MH3 A;  6GSX A;  2HRN A;  1KBN A;  2VCT A;  3DWV A;  3VWW A;  3KCM A;  4WBJ A;  4XIH A;  1JLW A;  4F82 A;  5DCG A;  3TJF A;  2H30 A;  1G6W A;  1GH2 A;  3WT2 A;  2FA8 A;  5ECR B;  3HJM A;  2IFQ A;  2GQM A;  2B1K A;  1ZZY A;  4MPG A;  3GKM A;  3QAV A;  4GQF A;  3GYK A;  3ZMK A;  2FA4 A;  2P5Q A;  2WRT A;  4EL1 A;  3PH9 A;  4MA9 A;  3IXR A;  3DRN A;  2JL4 A;  3F4R A;  1GLQ A;  3RPN A;  5CNW A;  3UMA A;  1U3A A;  1GSF A;  4MMM A;  1PSQ A;  3BBY A;  4ZBB A;  1AQV A;  2OBI A;  1G6Y A;  4EVM A;  3D5J A;  2IPA A;  4ZL9 A;  4PQI A;  1TRS A;  3CSH A;  2L6C A;  3EIN A;  2MMO A;  4FYU A;  1B8X A;  2H66 A;  2PU9 C;  5A4V A;  1PKW A;  4KA0 A;  3FW2 A;  3MAK A;  2HE3 A;  3M3M A;  11GS A;  2WFC A;  2E0Q A;  3KH9 A;  5G2Z A;  2HRF A;  1GSE A; 
#chains in the Genus database with same CATH topology
 3UIW A;  4Z7X A;  3KTL A;  2WJU A;  5IQY A;  1PL2 A;  4WEY A;  2C80 A;  3GTU B;  3TGZ A;  3QMX A;  5G5E A;  3LQ7 A;  1TJD A;  4HJM A;  3GA4 A;  2VLT A;  4TRX A;  2I9H A;  2F9S A;  3LOR A;  2YOI A;  1X5C A;  1CQH A;  4QQ7 A;  3M9J A;  1O8W A;  2OJL A;  2PWJ A;  1G7E A;  1PQN A;  2N5F A;  2H6X A;  1T7P B;  2NDO A;  4NPB A;  2V2G A;  3E3E A;  2X49 A;  2BMX A;  2FWH A;  2CVK A;  1M3J A;  3F3Q A;  1FAA A;  4HDE A;  4N30 A;  1BX9 A;  5HR1 A;  3RFR C;  2D2Z A;  4N3Z A;  2JAD A;  2VL2 C;  4K2X A;  2VD1 A;  3A2X A;  1ZCP A;  2H19 A;  3GUS A;  4JU5 A;  1F3B A;  2OE3 A;  1SD9 A;  4J56 E;  2H0H A;  1SVO A;  3EE2 A;  1AQX A;  2G0F A;  4RI6 A;  2B7J A;  1QK8 A;  4GQC A;  4V1A g;  2X4A A;  4AI6 A;  5IPH A;  3GHA A;  2TRC P;  4XRD A;  1KNG A;  3Q74 A;  4AJ8 A;  1O73 A;  1PKZ A;  3D22 A;  3A2W A;  2KOK A;  2C1Y A;  2DML A;  1TTZ A;  2HZF A;  4X1U A;  2O8V B;  3UAR A;  2L4Q A;  2VAF A;  4V2N A;  3M8N A;  1AAZ A;  2PGT A;  2K18 A;  4GST A;  1B48 A;  3LJR A;  4PTS A;  3ZFB A;  2B5E A;  2DKI A;  3CRT A;  1V98 A;  2L5L A;  1GSY A;  3LG6 A;  4K7I A;  2X8G A;  4N11 A;  5J9C A;  2E7P A;  4YQM A;  2EIQ A;  2R6K A;  3H8Q A;  1A2J A;  1VRS D;  3ERG A;  3FK8 A;  3TKQ A;  4IN0 A;  2IMF A;  3A3T A;  3ME8 A;  4ILF A;  4DSQ A;  3EWL A;  5JCG A;  3FYG A;  1HNB A;  2HRK A;  2PBJ A;  3ZL5 A;  3HD5 A;  1PRX A;  2GT6 A;  1T00 A;  2TIR A;  4HJ2 A;  1B9Y C;  1ON4 A;  3UVT A;  3GH6 A;  1GRX A;  3WD6 A;  1E6B A;  4G9H A;  1GUK A;  1SK1 A;  1Z7P A;  1THX A;  1TP9 A;  2H0G A;  4IS0 A;  2C3N A;  5ECM B;  2XBQ A;  3EYT A;  5A34 B;  1TXX A;  1NSW A;  3J7Y b;  3A5W A;  2K8S A;  2H01 A;  4JR6 A;  3IA1 A;  4F9Z A;  2OE0 A;  4YKG A;  3FZ9 A;  3L4N A;  4Z2T A;  2F8F A;  4BWQ A;  2I81 A;  1SYX A;  1OE8 A;  2IMD A;  1R5A A;  4GRF A;  1WPI A;  4KGI A;  5BRT A;  1ZYE A;  1H4O A;  2QA1 A;  4HZ2 A;  3CSJ A;  2QGV A;  4KSO A;  5G5F A;  2GQL A;  5D9T A;  1SKR B;  2BJX A;  3TRX A;  3ZYW A;  4JR4 A;  2YN1 A;  2LRN A;  2HFD A;  1XWB A;  5KOX A;  3TKR A;  2V6K A;  3HHV A;  3HVV A;  2AJQ B;  4K5S A;  3CSI A;  5ELA A;  2QKE A;  3FR6 A;  4WF4 A;  3MWH A;  4RQX A;  5DCH A;  5IMV A;  5HFK A;  2J23 A;  2YZU A;  3F6D A;  4ML6 A;  2O87 A;  1EEM A;  1GUM A;  1U6T A;  1OC9 A;  2A2S A;  4Q5F A;  4MCU A;  4JRR A;  2H76 A;  2GST A;  4EDZ A;  1X0R A;  2H1D A;  2GZY A;  2VCW A;  1XOB A;  2FWE A;  4AKX B;  4AKH A;  1WMJ A;  3KMO A;  4FXY P;  3F3R A;  2A4H A;  2VM2 A;  3H4K A;  2GT5 A;  1O6J A;  2FD3 A;  4OWY A;  1TRW A;  1KTE A;  1UN2 A;  3IHQ A;  1K0N A;  2X8C A;  2HT9 A;  2H6Y A;  2LV3 A;  1WE0 A;  2X99 A;  2MBS A;  4MDC A;  4NV2 A;  5JWO B;  4I97 A;  2JZT A;  1ZGN A;  1ERV A;  1HQO A;  5A5H A;  5BMU A;  4IEL A;  3L9S A;  3LEF A;  4HQS A;  3VWU A;  4AJ6 A;  1U3I A;  2EIO A;  3KIJ A;  4LL1 B;  4WR5 A;  3DXB A;  2REM A;  1ZYP A;  3P90 A;  5D96 A;  2LQQ A;  4MJB A;  4MP4 A;  5E4W A;  4LL4 B;  2FNO A;  3KM6 A;  4O5R A;  1R7H A;  1XW9 A;  2HRK B;  2C0G A;  2PUK C;  2HSM A;  3G9B A;  3TKS A;  3FZ4 A;  5ECK B;  8GSS A;  1TK0 B;  4PUR A;  4XCS A;  5IO0 A;  4EIQ A;  5CAX A;  5F0G A;  2GS3 A;  4XTS A;  4BVY A;  4G0I A;  2JZS A;  1C72 A;  4IQ1 A;  5C00 A;  6GSU A;  3IK9 A;  3UBK A;  1SJ6 A;  1YEP A;  2EFE A;  3IAM 2;  5D93 A;  3FZA A;  2AUV A;  5B8A A;  3BOA A;  1SL1 B;  1X9M B;  2WVX A;  1BG1 A;  22GS A;  1JZW A;  2TRX A;  4ECI A;  4IKH A;  4NHW A;  4GSN A;  3GX0 A;  5KN0 A;  1FOH A;  1R5P A;  1TK8 B;  2I4A A;  4LLR A;  3ZIV A;  4NAX A;  3TU3 B;  4KCE A;  1ZMA A;  2M46 A;  5IPG A;  1TU8 A;  1AW9 A;  1MDK A;  6GSV A;  4EDY A;  5D9W A;  2GSS A;  4O92 A;  4LMV A;  3GH9 A;  1J08 A;  2M80 A;  2H8L A;  1NHO A;  2PN8 A;  1A24 A;  2DSA A;  1V9W A;  3LW9 A;  1BF5 A;  3KTB A;  5ECS A;  3APS A;  2EC4 A;  1LBK A;  1ML6 A;  3L9U A;  1T3B A;  4TN8 A;  2WVY A;  4GDF A;  4XS6 A;  1EOH A;  1XCC A;  1DE2 A;  2I1U A;  1OC9 B;  3L9V A;  1Z9H A;  5A4U A;  4JZQ A;  2DJ1 A;  5FT3 A;  2CAQ A;  1B4P A;  3FZ5 A;  5D9V A;  1HNA A;  3IK7 A;  4E68 A;  4L0U A;  4PUF C;  3CYN A;  5JWQ B;  3P8W A;  3EU3 A;  1FVK A;  1VGL A;  5J3R A;  4MJC A;  3HA9 A;  2EFC A;  2H1L A;  1FW1 A;  2OA7 A;  1R26 A;  5KOW A;  2HQT A;  1UVZ A;  2B6M A;  3CWG A;  1OVN A;  4MF5 A;  5BMU B;  1S3R A;  1QFN A;  5G1K A;  1EGO A;  4I2T A;  3MDK A;  3LSZ A;  1GTB A;  4WR4 A;  5KN1 A;  3Q18 A;  2F8A A;  2VO4 A;  2LST A;  1M99 A;  1W89 A;  2FHE A;  4CHS A;  1MTC A;  3CRU A;  3WGE A;  2WW2 A;  4MK3 A;  3QAW A;  1S3D A;  1ERT A;  4OFM A;  2CVB A;  2R5G A;  2C3Q A;  19GS A;  1GWC A;  2HSM B;  4WET A;  2VOC A;  2X64 A;  2YWI A;  1DSB A;  4IBP A;  2R37 A;  4Q5N A;  3CTG A;  1BG5 A;  3APO A;  4K1F A;  5KEJ A;  1IYI A;  1VF4 A;  5B7C A;  5ECH B;  3FHK A;  1QQ2 A;  3FRC A;  4EC0 A;  4RQR A;  1YEX A;  6GSY A;  3M1G A;  2AHE A;  2WVX B;  4KDX A;  2MMZ A;  4KUN A;  4KAE A;  3HDC A;  1YF1 A;  2FY6 A;  1S3A A;  2LQO A;  3DVX A;  2YJ7 A;  5DBQ A;  1PMT A;  5EL8 A;  3LYK A;  4IP6 A;  1OAZ A;  4AJ7 A;  1T4Z A;  4OMV A;  6GST A;  4PXO A;  4BL7 A;  4G2E A;  1GSD A;  3VI5 A;  1ZYQ B;  2WGR A;  2IMK A;  3WT1 A;  4GSS A;  4K2D A;  3LFL A;  2WZ9 A;  4JBB A;  2B7K A;  4RI7 A;  3C1R A;  1SJZ A;  1E2Y A;  2LNT A;  1GL8 A;  2N5B A;  2GVP A;  1J9B A;  1GP1 A;  3HCZ A;  1NM3 A;  2LNS A;  3KZQ A;  4G0L A;  2HYX A;  4YAV A;  1T8E B;  4YAP A;  2YNX A;  4KW6 A;  1WIK A;  1OKT A;  3M0F A;  5F06 A;  4GWR A;  4TW5 A;  5D9X A;  2YZH A;  3TRQ A;  1O8X A;  4EE0 A;  1AC1 A;  1QUW A;  3TOT A;  1Y6E A;  3RGB C;  3DVW A;  5B8B A;  1HD2 A;  5HFI A;  2L4C A;  3ME7 A;  1TKD B;  4IHU A;  4XHM A;  2JU5 A;  3DGQ A;  3UBL A;  18GS A;  2YWN A;  1Y25 A;  4I6X A;  1XIY A;  2HSY A;  4JE1 A;  1SK2 A;  2FUG 2;  2MZC A;  2ON5 A;  1WWJ A;  1M9B A;  2P31 A;  2A2P A;  2DIZ A;  3EU4 A;  2PMT A;  4RUV A;  4D73 A;  2PPT A;  1PN9 A;  3G7Y A;  1XW5 A;  2YV9 A;  5DAK A;  2HRA A;  3A2V A;  3DYR A;  3GKK A;  2NTO A;  5LNK e;  3ZIJ A;  3D21 A;  1XWA A;  4POM A;  2EFH A;  2GDR A;  1KEB A;  2ON7 A;  2VLV A;  2WW3 A;  2XPE A;  2YPM A;  2KP2 A;  2LS5 A;  4OD7 A;  1TU7 A;  3IR4 A;  4N0Z A;  1XZO A;  2OAC A;  1RQM A;  1M2D A;  4TR1 A;  3VPT A;  4O7H A;  3O3T A;  2IFQ B;  4XS1 A;  4QL7 A;  2O89 A;  4MPF A;  2CZ3 A;  5LD0 A;  3A5I A;  1A0R P;  5JCW A;  4HS1 A;  1XFL A;  4TOP A;  1TI1 A;  2FWG A;  4Z2R A;  1WOU A;  1Q4J A;  2MMA A;  3IC8 A;  1GSU A;  3QR6 A;  1F3A A;  2DJ0 A;  3K8N A;  2C3T A;  3TKS E;  4NV5 A;  5AIV A;  4MJE A;  5ECQ B;  4O32 A;  4FQU A;  1AQW A;  5F05 A;  4QMK A;  2B5Y A;  4TXV A;  2RUE A;  3HJP A;  2IN3 A;  4ECJ A;  3GL5 A;  2GGT A;  2GTU A;  2FCH A;  2K6V A;  2HI7 A;  4ZL7 A;  4G19 A;  5D73 A;  4CY8 A;  3EUR A;  3HMJ G;  1GTU A;  2DIY A;  2NVL A;  1K3O A;  5HQP A;  2VKZ G;  2WS2 A;  4MJA A;  3LYP A;  2HNL A;  2VL2 A;  3N5O A;  4KSM A;  1Z7R A;  4NWY A;  5DQY A;  3IOS A;  2DJJ A;  5AGY A;  1EV9 A;  20GS A;  2V41 A;  2VL3 A;  5H5Q A;  1TXU A;  1SVM A;  1JHB A;  1K0C A;  4N10 A;  3HZ4 A;  4J57 E;  3ED3 A;  3I43 A;  3R2Q A;  5GSS A;  3ERF A;  1Z5Y E;  3GKX A;  3D0Z A;  1BED A;  2C0F A;  3C73 A;  5A1N A;  1B4Q A;  3BD2 A;  4K7O A;  4ZBD A;  4K7N A;  2H6Z A;  3QDN A;  3ZVJ A;  4KDY A;  4PNF A;  5GZZ B;  1X9W B;  1W4V A;  5FHI A;  1GLP A;  17GS A;  3US3 A;  2HXK A;  2RII A;  5EY6 A;  2V1M A;  3ZRE A;  1PX7 A;  2YP6 A;  4OFT A;  5B6M A;  2WB9 A;  3TJB A;  4GCI A;  3LGC A;  2RM6 A;  1FHE A;  3HKR A;  3F63 A;  3UVH A;  3RPP A;  1WRY A;  3TJG A;  5J4V A;  4OO5 A;  3IHG A;  4KB3 A;  4GXZ A;  3TRP A;  2DBC A;  3RHC A;  4ZIL A;  3DML A;  5CO3 A;  3RDW A;  1U88 A;  1TOF A;  3CTF A;  3GL3 A;  3IC4 A;  1YEW C;  2ZCT A;  2ALB A;  2C0D A;  4J2F A;  4V2M A;  4HEA 2;  4ULX A;  4W66 A;  2R0G A;  3QFA C;  7GSS A;  2K8V A;  2QC7 A;  1GTA A;  3IDV A;  2IL3 A;  4GF0 A;  4X0X A;  5IO2 A;  1USB A;  3UOM A;  4XS4 A;  3VFI A;  2RM5 A;  1GUH A;  3GNJ A;  2H0I A;  3F6F A;  1M0U A;  3G7I A;  4BVX A;  2MMN A;  3L78 A;  3FR9 A;  5H5R A;  1ILO A;  1A2L A;  3BCK A;  5GAP D;  1SD8 A;  5DAL A;  3VWV A;  4F0B A;  5EVO A;  1GTI A;  3OR5 A;  5CRE A;  3ZFL A;  2JSY A;  1OYJ A;  3GSS A;  3EC3 A;  3CXG A;  2VL9 A;  4MZB A;  2VUP A;  3CMI A;  4CW9 A;  1TW9 A;  3TKP A;  5G31 A;  2DJ2 A;  2DKH A;  1XVQ A;  5D8I A;  4POK A;  2DJ3 A;  5AN1 A;  4KE3 A;  3V1W A;  1K0A A;  1F37 A;  1EWX A;  2C4J A;  3HY2 A;  4ICY A;  1GUL A;  2Z9S A;  1EP7 A;  1UA5 A;  2AYT A;  3QAG A;  2GSR A;  2H70 A;  4ZB7 A;  1ST9 A;  2CX3 A;  1YY7 A;  2AAW A;  5B6N A;  4WXT A;  4OFN A;  1LU4 A;  4FYB A;  9GSS A;  4Q5R A;  1FB0 A;  2H1G A;  4K6X A;  1R4W A;  4FIW A;  5A1N B;  5DDL A;  4G10 A;  1VF2 A;  4ECC A;  4PX1 A;  1B9X C;  2IJY A;  4NXI A;  3GIX A;  2HZE A;  4TR4 A;  1A23 A;  1S3C A;  1I5G A;  3P2A A;  4EXJ A;  3GRX A;  5EPF A;  1HYU A;  1F2E A;  4HUA A;  2NPB A;  1Z3E A;  2YAN A;  4H86 A;  2CZ2 A;  1CQG A;  5GST A;  4O5Q A;  1F6M C;  1DBY A;  5J41 A;  4BWS A;  4DSS A;  3RBT A;  4JED A;  2M72 A;  3FMW A;  3IBH A;  1NHY A;  1A0F A;  1AUC A;  3QFB C;  2LRC A;  2CV4 A;  4ZIJ A;  1J0F A;  2RLI A;  3GTU A;  1SYR A;  3W8S A;  1QXH A;  3APQ A;  2E2M A;  2WVZ A;  3C1S A;  4L8E A;  4MF6 A;  2VM1 A;  1JZD A;  2EIR A;  3VI7 A;  5A5H B;  1XWG A;  4X4J A;  2F51 A;  5FWG A;  1V40 A;  3HYP A;  1SKW B;  4KH7 A;  2JZR A;  1X5D A;  2KHP A;  1OKD A;  3EMP A;  3F4T A;  3MSZ A;  4BVX B;  2WDU A;  1PFO A;  4LMW A;  2WCI A;  2V32 A;  2VCZ A;  3NOF A;  3FKF A;  1FB6 A;  1G7O A;  2B3S A;  3NZN A;  3U6V A;  3I6A A;  1FOV A;  4K0G A;  2MBT A;  1JFU A;  16GS A;  4BVY B;  3DKS A;  3EMX A;  5ECN B;  4O5U A;  2I3Y A;  2PVQ A;  4P3Y B;  4TR0 A;  3L0H A;  1A8Y A;  4KF9 A;  4EO3 A;  4QL9 A;  4CY6 A;  2H72 A;  3H93 A;  1MDI A;  5CRW A;  1A8L A;  5DVB A;  4MLY A;  2VCX A;  5CRG A;  2DLX A;  4F2I A;  1BYE A;  3BJ5 A;  2YCD A;  3H1N A;  1X5E A;  4PI0 C;  3IV4 A;  3VUR A;  1THO A;  2A4V A;  2KUC A;  4KND A;  2FWF A;  4OCE A;  1GNW A;  2L59 A;  4V1A p;  4GLT A;  2UZ8 A;  5HR2 A;  1A2M A;  5IMD A;  2AB6 A;  2O36 A;  4HQZ A;  5IOW A;  3O76 A;  2MYG A;  2HZE B;  1IYH A;  3Q19 A;  2GZZ A;  1XPV A;  1ERW A;  3GST A;  2B1L A;  2VCQ A;  5ID2 A;  3D4M A;  4NMU A;  4PQ1 A;  2VCV A;  2VIM A;  1Z6M A;  2JSZ A;  4ZB6 A;  1XVW A;  3D6I A;  5A34 A;  4DSS B;  5IMA A;  1EP8 A;  2YJH A;  4HI7 A;  2AV4 A;  4PHZ C;  3IAS 2;  1PD2 1;  3IRA A;  1JZO A;  1MD3 A;  1N25 A;  4PGT A;  4IJ3 A;  1RK4 A;  1TI3 A;  3RAZ A;  4ISD A;  4DSR A;  1SKS B;  3DIE A;  2L6D A;  2O3E A;  1EV4 A;  1AXD A;  1RW1 A;  2OAD A;  4KCA A;  2WW0 A;  4MAB A;  1M7T A;  3KJY A;  4HOJ A;  3Q6O A;  4XRA A;  5HR0 A;  3CBU A;  3KEB A;  5L71 A;  3ZVJ D;  3O6T A;  4WKW A;  3KP8 A;  4GTU A;  4E8E A;  1N2A A;  1YQ1 A;  2C0E A;  1JZR A;  3KH7 A;  2CT6 A;  4PI2 C;  3H79 A;  1TDI A;  2XBI A;  2DMM A;  2NBS A;  1ACV A;  2UV8 G;  1XW6 A;  1EOG A;  4IVF A;  5ABR A;  1OC8 A;  3TUE A;  3M9K A;  3VPQ A;  2XC2 A;  4ID0 A;  5J5N A;  4K5R A;  1K0M A;  4E8H A;  3ISO A;  3DD3 A;  1SL2 B;  5DJM A;  3TB2 A;  5HR3 A;  3KP9 A;  3GX8 A;  4IGJ A;  3ZIT A;  2J9H A;  3IPZ A;  1XBS A;  5ECI B;  1QMV A;  1NW2 A;  5ECO B;  4LA1 A;  4F03 A;  4WF5 A;  3TCO A;  3LWA A;  1SL0 B;  4PNG A;  4L5O A;  5CP1 A;  3GFK A;  1LJR A;  2QA2 A;  3ZRD A;  3F0I A;  4BL7 B;  5GAN D;  2LJK A;  1URM A;  4EF0 A;  3C8E A;  4TKY A;  13GS A;  5CRH A;  4IP1 A;  3ZTL A;  5INY A;  3TJK A;  1VF3 A;  3AY8 A;  1QGV A;  2P0G A;  4USS A;  1Z6N A;  4IW9 A;  5G30 A;  1SJI A;  5LCZ A;  3FR3 A;  3JCM L;  3VLN A;  3W8J A;  1VF1 A;  2PVO C;  5ID2 B;  1FG4 A;  3HXS A;  4I2U A;  2E2G A;  4POL A;  5CRD A;  4AKG A;  1XOA A;  4HU9 A;  1BAY A;  2H1B A;  2KP1 A;  2VLU A;  4A5P A;  3TOU A;  4X43 A;  3KD0 A;  4FH8 A;  2KLX A;  5HFG A;  3GUR A;  1Y1U A;  2JAC A;  1EGR A;  2X8H A;  4CDO A;  1X9S B;  2IIY A;  1PX6 A;  4MH2 A;  1MEK A;  5KN2 A;  4NHZ A;  3E0U A;  5DQS A;  1HNC A;  5J4Y A;  4Z2U A;  3C7M A;  4FYC A;  2CX4 A;  1EEJ A;  4IQA A;  2R2J A;  3F8U A;  3UL3 A;  2LUS A;  3PPU A;  3TKS C;  2B5X A;  3EVI A;  2C8U A;  2XPD A;  4YH2 A;  4KX4 A;  4I5Q A;  2XHF A;  2YWM A;  4YQV A;  4IJI A;  6GSW A;  2CAI A;  2HSH A;  3GV1 A;  4D73 B;  4AGS A;  3U5R E;  5AIX A;  2H74 A;  4TVE A;  5DAK B;  5H5S A;  3ERW A;  4ZB8 A;  1FO5 A;  1O85 A;  3I69 A;  2QSI A;  3VK9 A;  3QPM A;  3HZ8 A;  4K9Z A;  4ZBA A;  1V2A A;  1M9A A;  2ZUP A;  1PGT A;  4KDU A;  4YKF A;  1DUG A;  5F8B A;  1OE7 A;  4MF7 A;  6GSS A;  1N8J A;  3G7J A;  4G01 A;  2O5V A;  1JLV A;  4TR1 B;  2O85 A;  1YZX A;  4HZ4 A;  2WUL A;  2FLS A;  4I8B A;  4K8M A;  3EPT A;  2LJR A;  1TRV A;  4L0W A;  2EFD A;  1FVJ A;  3CHX C;  4TXO A;  4PQH A;  5IMF A;  1O7U A;  1YJ6 A;  2LRT A;  1YKA A;  5J40 A;  3MIX A;  2P5R A;  1OC3 A;  2WW1 A;  1YVL A;  2FGX A;  4AKI A;  1DE1 A;  3WGD A;  3VWX A;  2N5A A;  2O7K A;  3J7Y k;  3W6G A;  10GS A;  14GS A;  3UJ1 A;  2HSN A;  1M2B A;  4MZW A;  3MNG A;  5C04 A;  1ZYN A;  1AIU A;  3HJO A;  2OE1 A;  1MDJ A;  3F4S A;  2K9F A;  1XWK A;  4POB A;  1K0D A;  2R3X A;  5F07 A;  2CVD A;  4ACS A;  2OBK A;  2H75 A;  3SWL A;  1SEN A;  3UEM A;  3I9V 2;  4N0V A;  2DC5 A;  1MD4 A;  1BQ7 A;  5G1L A;  2LTK A;  1SU9 A;  3P7X A;  3HVN A;  4WBR D;  4MZC A;  4L5L A;  1WP0 A;  3D4T A;  4ZL8 A;  2R0P A;  5ENU A;  4BPY A;  3TDG A;  1ERU A;  1O81 A;  4EUY A;  1K0B A;  5KN3 A;  4OCF A;  4TR3 A;  1PL1 A;  2IME A;  1K3L A;  4MNN A;  3BCI A;  3R3E A;  2DJK A;  1PN0 A;  3HVS A;  2G2Q A;  5J4U A;  2GQK A;  1GSS A;  1ZL9 A;  1K0O A;  5JCU A;  1TRU A;  3FY7 A;  3QCP A;  4HU7 A;  1T4Y A;  3ZML A;  5ELG A;  3GN3 A;  1ABA A;  2BTO T;  1K3Y A;  4ML1 A;  2YV7 A;  4PUA A;  2GSQ A;  3QOU A;  4ZXG A;  2IWT A;  4DEJ A;  4EIP A;  2RUF A;  3RHB A;  2L57 A;  3MYD A;  3KGK A;  2ZNM A;  1YKC A;  1BJX A;  3C71 A;  3KXO A;  5IIZ A;  1M2A A;  2L5O A;  3SBC A;  1GSQ A;  4BA7 A;  5IMZ A;  3HVX A;  2CQ9 A;  3DEX A;  2PER A;  5IOX A;  1M3I A;  12GS A;  3F9U A;  5CYY A;  2IMI A;  3GMF A;  3ZZX A;  4V2L A;  4ZB9 A;  5JWR B;  2H71 A;  4YQU A;  1SK0 A;  2GZP A;  1T1V A;  4G0K A;  2R4V A;  2VD0 A;  2H73 A;  3WYW A;  3PR8 A;  1GNE A;  1UC7 A;  1YF0 A;  4K0N A;  1G0T A;  3KMN A;  1I1I P;  5J9B A;  2OKA A;  2LEG A;  5E59 A;  5ECP B;  1I9D A;  4DVC A;  1ZOF A;  3LXT A;  3N9J A;  4FO5 A;  2LJA A;  5IMC A;  4TXO B;  3PGT A;  3LXZ A;  1XXU A;  2H1A A;  3TJJ A;  1H75 A;  1WJK A;  5A5K A;  3QD9 A;  5AIS A;  4XS4 B;  3FEU A;  5ECL B;  5A4W A;  3ZLP A;  1XWC A;  5DJL A;  4F0C A;  3WGX A;  1U87 A;  2F3M A;  4Q5Q A;  2CA8 A;  3UAP A;  1V57 A;  3NIV A;  3PIN A;  2HLS A;  1SVL A;  3E9J B;  2GLR A;  1Q98 A;  2LKU A;  2HSN B;  1PA3 A;  4EKZ A;  1YDK A;  4OO4 A;  4ECB A;  3GKN A;  2A2R A;  2YWO A;  2V6O A;  5COH A;  5DAL B;  1V58 A;  3IE3 A;  1F9M A;  3S9F A;  1TK5 B;  2ES7 A;  5IM9 A;  1EZK A;  4AF2 A;  4MH3 A;  6GSX A;  2HRN A;  1KBN A;  2VCT A;  3DWV A;  3VWW A;  3KCM A;  4WBJ A;  4XIH A;  1JLW A;  4F82 A;  5DCG A;  3TJF A;  2H30 A;  4BIK A;  1G6W A;  1GH2 A;  3WT2 A;  2FA8 A;  5ECR B;  3HJM A;  2IFQ A;  2GQM A;  3CQF A;  2B1K A;  1ZZY A;  4MPG A;  3GKM A;  3QAV A;  1S4B P;  4GQF A;  3GYK A;  3ZMK A;  2FA4 A;  2P5Q A;  2WRT A;  4EL1 A;  3PH9 A;  4MA9 A;  3IXR A;  3DRN A;  2JL4 A;  3F4R A;  1GLQ A;  3RPN A;  5CNW A;  3UMA A;  1U3A A;  2R0C A;  1GSF A;  4MMM A;  1PSQ A;  3BBY A;  1XG8 A;  4ZBB A;  1AQV A;  2OBI A;  4HSC X;  1G6Y A;  4EVM A;  3D5J A;  2IPA A;  4ZL9 A;  4PQI A;  1TRS A;  3CSH A;  2L6C A;  2WZS A;  3EIN A;  2MMO A;  4FYU A;  1B8X A;  2H66 A;  2PU9 C;  5A4V A;  1PKW A;  4KA0 A;  3FW2 A;  2OT3 A;  3MAK A;  2HE3 A;  3M3M A;  11GS A;  5J47 A;  2WFC A;  2E0Q A;  3KH9 A;  5G2Z A;  2HRF A;  1GSE A; 
#chains in the Genus database with same CATH homology
 3UIW A;  4Z7X A;  3KTL A;  2WJU A;  5IQY A;  1PL2 A;  4WEY A;  2C80 A;  3GTU B;  3TGZ A;  3QMX A;  5G5E A;  3LQ7 A;  1TJD A;  4HJM A;  3GA4 A;  2VLT A;  4TRX A;  2I9H A;  2F9S A;  3LOR A;  2YOI A;  1X5C A;  1CQH A;  4QQ7 A;  3M9J A;  1O8W A;  2OJL A;  2PWJ A;  1G7E A;  1PQN A;  2N5F A;  2H6X A;  1T7P B;  2NDO A;  4NPB A;  2V2G A;  3E3E A;  2X49 A;  2BMX A;  2FWH A;  2CVK A;  3F3Q A;  1FAA A;  4HDE A;  4N30 A;  1BX9 A;  5HR1 A;  2D2Z A;  4N3Z A;  2JAD A;  2VL2 C;  4K2X A;  2VD1 A;  3A2X A;  1ZCP A;  2H19 A;  3GUS A;  4JU5 A;  1F3B A;  2OE3 A;  1SD9 A;  4J56 E;  2H0H A;  1SVO A;  3EE2 A;  1AQX A;  2G0F A;  4RI6 A;  2B7J A;  1QK8 A;  4GQC A;  4V1A g;  2X4A A;  4AI6 A;  5IPH A;  3GHA A;  2TRC P;  4XRD A;  1KNG A;  3Q74 A;  4AJ8 A;  1O73 A;  1PKZ A;  3D22 A;  3A2W A;  2KOK A;  2C1Y A;  2DML A;  1TTZ A;  2HZF A;  4X1U A;  2O8V B;  3UAR A;  2L4Q A;  2VAF A;  4V2N A;  3M8N A;  1AAZ A;  2PGT A;  2K18 A;  4GST A;  1B48 A;  3LJR A;  4PTS A;  3ZFB A;  2B5E A;  2DKI A;  3CRT A;  1V98 A;  2L5L A;  1GSY A;  3LG6 A;  4K7I A;  2X8G A;  4N11 A;  5J9C A;  2E7P A;  4YQM A;  2EIQ A;  2R6K A;  3H8Q A;  1A2J A;  1VRS D;  3ERG A;  3FK8 A;  3TKQ A;  4IN0 A;  2IMF A;  3A3T A;  3ME8 A;  4ILF A;  4DSQ A;  3EWL A;  5JCG A;  3FYG A;  1HNB A;  2HRK A;  2PBJ A;  3ZL5 A;  3HD5 A;  1PRX A;  2GT6 A;  1T00 A;  2TIR A;  4HJ2 A;  1B9Y C;  1ON4 A;  3UVT A;  3GH6 A;  1GRX A;  3WD6 A;  1E6B A;  4G9H A;  1GUK A;  1SK1 A;  1Z7P A;  1THX A;  1TP9 A;  2H0G A;  4IS0 A;  2C3N A;  5ECM B;  2XBQ A;  3EYT A;  5A34 B;  1TXX A;  1NSW A;  3J7Y b;  3A5W A;  2K8S A;  2H01 A;  4JR6 A;  3IA1 A;  4F9Z A;  2OE0 A;  4YKG A;  3FZ9 A;  3L4N A;  4Z2T A;  2F8F A;  4BWQ A;  2I81 A;  1SYX A;  1OE8 A;  2IMD A;  1R5A A;  4GRF A;  1WPI A;  4KGI A;  5BRT A;  1ZYE A;  1H4O A;  2QA1 A;  4HZ2 A;  3CSJ A;  2QGV A;  4KSO A;  5G5F A;  2GQL A;  5D9T A;  1SKR B;  2BJX A;  3TRX A;  3ZYW A;  4JR4 A;  2YN1 A;  2LRN A;  2HFD A;  1XWB A;  5KOX A;  3TKR A;  2V6K A;  3HHV A;  3HVV A;  2AJQ B;  4K5S A;  3CSI A;  5ELA A;  2QKE A;  3FR6 A;  4WF4 A;  3MWH A;  4RQX A;  5DCH A;  5IMV A;  5HFK A;  2J23 A;  2YZU A;  3F6D A;  4ML6 A;  2O87 A;  1EEM A;  1GUM A;  1U6T A;  1OC9 A;  2A2S A;  4Q5F A;  4MCU A;  4JRR A;  2H76 A;  2GST A;  4EDZ A;  1X0R A;  2H1D A;  2GZY A;  2VCW A;  1XOB A;  2FWE A;  4AKX B;  4AKH A;  1WMJ A;  3KMO A;  3F3R A;  2A4H A;  2VM2 A;  3H4K A;  2GT5 A;  1O6J A;  2FD3 A;  4OWY A;  1TRW A;  1KTE A;  1UN2 A;  3IHQ A;  1K0N A;  2X8C A;  2HT9 A;  2H6Y A;  2LV3 A;  1WE0 A;  2X99 A;  2MBS A;  4MDC A;  4NV2 A;  5JWO B;  4I97 A;  2JZT A;  1ZGN A;  1ERV A;  1HQO A;  5A5H A;  5BMU A;  4IEL A;  3L9S A;  3LEF A;  4HQS A;  3VWU A;  4AJ6 A;  1U3I A;  2EIO A;  3KIJ A;  4LL1 B;  4WR5 A;  3DXB A;  2REM A;  1ZYP A;  3P90 A;  5D96 A;  2LQQ A;  4MJB A;  4MP4 A;  5E4W A;  4LL4 B;  2FNO A;  3KM6 A;  4O5R A;  1R7H A;  1XW9 A;  2HRK B;  2C0G A;  2PUK C;  2HSM A;  3G9B A;  3TKS A;  3FZ4 A;  5ECK B;  8GSS A;  1TK0 B;  4PUR A;  4XCS A;  5IO0 A;  4EIQ A;  5CAX A;  5F0G A;  2GS3 A;  4XTS A;  4BVY A;  4G0I A;  2JZS A;  1C72 A;  4IQ1 A;  5C00 A;  6GSU A;  3IK9 A;  3UBK A;  1SJ6 A;  1YEP A;  2EFE A;  3IAM 2;  5D93 A;  3FZA A;  2AUV A;  5B8A A;  3BOA A;  1SL1 B;  1X9M B;  1BG1 A;  22GS A;  1JZW A;  2TRX A;  4ECI A;  4IKH A;  4NHW A;  4GSN A;  3GX0 A;  5KN0 A;  1FOH A;  1R5P A;  1TK8 B;  2I4A A;  4LLR A;  3ZIV A;  4NAX A;  3TU3 B;  4KCE A;  1ZMA A;  2M46 A;  5IPG A;  1TU8 A;  1AW9 A;  1MDK A;  6GSV A;  4EDY A;  5D9W A;  2GSS A;  4O92 A;  4LMV A;  3GH9 A;  1J08 A;  2M80 A;  2H8L A;  1NHO A;  2PN8 A;  1A24 A;  2DSA A;  1V9W A;  3LW9 A;  1BF5 A;  3KTB A;  5ECS A;  3APS A;  2EC4 A;  1LBK A;  1ML6 A;  3L9U A;  1T3B A;  4TN8 A;  4GDF A;  4XS6 A;  1EOH A;  1XCC A;  1DE2 A;  2I1U A;  1OC9 B;  3L9V A;  1Z9H A;  5A4U A;  4JZQ A;  2DJ1 A;  5FT3 A;  2CAQ A;  1B4P A;  3FZ5 A;  5D9V A;  1HNA A;  3IK7 A;  4E68 A;  4L0U A;  4PUF C;  3CYN A;  5JWQ B;  3P8W A;  3EU3 A;  1FVK A;  1VGL A;  5J3R A;  4MJC A;  3HA9 A;  2EFC A;  2H1L A;  1FW1 A;  2OA7 A;  1R26 A;  5KOW A;  2HQT A;  1UVZ A;  2B6M A;  3CWG A;  1OVN A;  4MF5 A;  5BMU B;  1QFN A;  5G1K A;  1EGO A;  4I2T A;  3MDK A;  3LSZ A;  1GTB A;  4WR4 A;  5KN1 A;  3Q18 A;  2F8A A;  2VO4 A;  2LST A;  1M99 A;  1W89 A;  2FHE A;  4CHS A;  1MTC A;  3CRU A;  3WGE A;  4MK3 A;  3QAW A;  1S3D A;  1ERT A;  4OFM A;  2CVB A;  2R5G A;  2C3Q A;  19GS A;  1GWC A;  2HSM B;  4WET A;  2VOC A;  2X64 A;  2YWI A;  1DSB A;  4IBP A;  2R37 A;  4Q5N A;  3CTG A;  1BG5 A;  3APO A;  4K1F A;  5KEJ A;  1IYI A;  1VF4 A;  5B7C A;  5ECH B;  3FHK A;  1QQ2 A;  3FRC A;  4EC0 A;  4RQR A;  1YEX A;  6GSY A;  3M1G A;  2AHE A;  4KDX A;  2MMZ A;  4KUN A;  4KAE A;  3HDC A;  1YF1 A;  2FY6 A;  1S3A A;  2LQO A;  3DVX A;  2YJ7 A;  5DBQ A;  1PMT A;  5EL8 A;  3LYK A;  4IP6 A;  1OAZ A;  4AJ7 A;  1T4Z A;  4OMV A;  6GST A;  4PXO A;  4BL7 A;  4G2E A;  1GSD A;  3VI5 A;  1ZYQ B;  2WGR A;  2IMK A;  3WT1 A;  4GSS A;  4K2D A;  3LFL A;  2WZ9 A;  4JBB A;  2B7K A;  4RI7 A;  3C1R A;  1SJZ A;  1E2Y A;  2LNT A;  1GL8 A;  2N5B A;  2GVP A;  1J9B A;  1GP1 A;  3HCZ A;  1NM3 A;  2LNS A;  3KZQ A;  4G0L A;  2HYX A;  4YAV A;  1T8E B;  4YAP A;  2YNX A;  4KW6 A;  1WIK A;  1OKT A;  3M0F A;  5F06 A;  4GWR A;  4TW5 A;  5D9X A;  2YZH A;  3TRQ A;  1O8X A;  4EE0 A;  1AC1 A;  1QUW A;  3TOT A;  1Y6E A;  3DVW A;  5B8B A;  1HD2 A;  5HFI A;  2L4C A;  3ME7 A;  1TKD B;  4IHU A;  4XHM A;  2JU5 A;  3DGQ A;  3UBL A;  18GS A;  2YWN A;  1Y25 A;  4I6X A;  1XIY A;  2HSY A;  4JE1 A;  1SK2 A;  2FUG 2;  2MZC A;  2ON5 A;  1WWJ A;  1M9B A;  2P31 A;  2A2P A;  2DIZ A;  3EU4 A;  2PMT A;  4RUV A;  4D73 A;  2PPT A;  1PN9 A;  3G7Y A;  1XW5 A;  2YV9 A;  5DAK A;  2HRA A;  3A2V A;  3DYR A;  3GKK A;  2NTO A;  5LNK e;  3ZIJ A;  3D21 A;  1XWA A;  4POM A;  2EFH A;  2GDR A;  1KEB A;  2ON7 A;  2VLV A;  2XPE A;  2YPM A;  2KP2 A;  2LS5 A;  4OD7 A;  1TU7 A;  3IR4 A;  4N0Z A;  1XZO A;  2OAC A;  1RQM A;  1M2D A;  4TR1 A;  3VPT A;  4O7H A;  3O3T A;  2IFQ B;  4XS1 A;  4QL7 A;  2O89 A;  4MPF A;  2CZ3 A;  5LD0 A;  3A5I A;  1A0R P;  5JCW A;  4HS1 A;  1XFL A;  4TOP A;  1TI1 A;  2FWG A;  4Z2R A;  1WOU A;  1Q4J A;  2MMA A;  3IC8 A;  1GSU A;  3QR6 A;  1F3A A;  2DJ0 A;  3K8N A;  2C3T A;  3TKS E;  4NV5 A;  5AIV A;  4MJE A;  5ECQ B;  4O32 A;  4FQU A;  1AQW A;  5F05 A;  4QMK A;  2B5Y A;  4TXV A;  2RUE A;  3HJP A;  2IN3 A;  4ECJ A;  3GL5 A;  2GGT A;  2GTU A;  2FCH A;  2K6V A;  2HI7 A;  4ZL7 A;  4G19 A;  5D73 A;  4CY8 A;  3EUR A;  3HMJ G;  1GTU A;  2DIY A;  2NVL A;  1K3O A;  5HQP A;  2VKZ G;  2WS2 A;  4MJA A;  3LYP A;  2HNL A;  2VL2 A;  3N5O A;  4KSM A;  1Z7R A;  4NWY A;  5DQY A;  3IOS A;  2DJJ A;  5AGY A;  1EV9 A;  20GS A;  2V41 A;  2VL3 A;  5H5Q A;  1TXU A;  1SVM A;  1JHB A;  1K0C A;  4N10 A;  3HZ4 A;  4J57 E;  3ED3 A;  3I43 A;  3R2Q A;  5GSS A;  3ERF A;  1Z5Y E;  3GKX A;  3D0Z A;  1BED A;  2C0F A;  3C73 A;  5A1N A;  1B4Q A;  3BD2 A;  4K7O A;  4ZBD A;  4K7N A;  2H6Z A;  3QDN A;  3ZVJ A;  4KDY A;  4PNF A;  5GZZ B;  1X9W B;  1W4V A;  5FHI A;  1GLP A;  17GS A;  3US3 A;  2HXK A;  2RII A;  5EY6 A;  2V1M A;  3ZRE A;  1PX7 A;  2YP6 A;  4OFT A;  5B6M A;  2WB9 A;  3TJB A;  4GCI A;  3LGC A;  2RM6 A;  1FHE A;  3HKR A;  3F63 A;  3UVH A;  3RPP A;  1WRY A;  3TJG A;  5J4V A;  4OO5 A;  3IHG A;  4KB3 A;  4GXZ A;  3TRP A;  2DBC A;  3RHC A;  4ZIL A;  3DML A;  5CO3 A;  3RDW A;  1U88 A;  1TOF A;  3CTF A;  3GL3 A;  3IC4 A;  2ZCT A;  2ALB A;  2C0D A;  4J2F A;  4V2M A;  4HEA 2;  4ULX A;  4W66 A;  2R0G A;  3QFA C;  7GSS A;  2K8V A;  2QC7 A;  1GTA A;  3IDV A;  2IL3 A;  4GF0 A;  4X0X A;  5IO2 A;  1USB A;  3UOM A;  4XS4 A;  3VFI A;  2RM5 A;  1GUH A;  3GNJ A;  2H0I A;  3F6F A;  1M0U A;  3G7I A;  4BVX A;  2MMN A;  3L78 A;  3FR9 A;  5H5R A;  1ILO A;  1A2L A;  3BCK A;  5GAP D;  1SD8 A;  5DAL A;  3VWV A;  4F0B A;  5EVO A;  1GTI A;  3OR5 A;  5CRE A;  3ZFL A;  2JSY A;  1OYJ A;  3GSS A;  3EC3 A;  3CXG A;  2VL9 A;  4MZB A;  2VUP A;  3CMI A;  4CW9 A;  1TW9 A;  3TKP A;  5G31 A;  2DJ2 A;  2DKH A;  1XVQ A;  5D8I A;  4POK A;  2DJ3 A;  5AN1 A;  4KE3 A;  3V1W A;  1K0A A;  1F37 A;  1EWX A;  2C4J A;  3HY2 A;  4ICY A;  1GUL A;  2Z9S A;  1EP7 A;  1UA5 A;  2AYT A;  3QAG A;  2GSR A;  2H70 A;  4ZB7 A;  1ST9 A;  2CX3 A;  1YY7 A;  2AAW A;  5B6N A;  4WXT A;  4OFN A;  1LU4 A;  4FYB A;  9GSS A;  4Q5R A;  1FB0 A;  2H1G A;  4K6X A;  1R4W A;  4FIW A;  5A1N B;  5DDL A;  4G10 A;  1VF2 A;  4ECC A;  4PX1 A;  1B9X C;  2IJY A;  4NXI A;  3GIX A;  2HZE A;  4TR4 A;  1A23 A;  1S3C A;  1I5G A;  3P2A A;  4EXJ A;  3GRX A;  5EPF A;  1HYU A;  1F2E A;  4HUA A;  2NPB A;  1Z3E A;  2YAN A;  4H86 A;  2CZ2 A;  1CQG A;  5GST A;  4O5Q A;  1F6M C;  1DBY A;  5J41 A;  4BWS A;  4DSS A;  3RBT A;  4JED A;  2M72 A;  3FMW A;  3IBH A;  1NHY A;  1A0F A;  1AUC A;  3QFB C;  2LRC A;  2CV4 A;  4ZIJ A;  1J0F A;  2RLI A;  3GTU A;  1SYR A;  3W8S A;  1QXH A;  3APQ A;  2E2M A;  3C1S A;  4L8E A;  4MF6 A;  2VM1 A;  1JZD A;  2EIR A;  3VI7 A;  5A5H B;  1XWG A;  4X4J A;  2F51 A;  5FWG A;  1V40 A;  3HYP A;  1SKW B;  4KH7 A;  2JZR A;  1X5D A;  2KHP A;  1OKD A;  3EMP A;  3F4T A;  3MSZ A;  4BVX B;  2WDU A;  4LMW A;  2WCI A;  2V32 A;  2VCZ A;  3NOF A;  3FKF A;  1FB6 A;  1G7O A;  2B3S A;  3NZN A;  3U6V A;  3I6A A;  1FOV A;  4K0G A;  2MBT A;  1JFU A;  16GS A;  4BVY B;  3DKS A;  3EMX A;  5ECN B;  4O5U A;  2I3Y A;  2PVQ A;  4P3Y B;  4TR0 A;  3L0H A;  1A8Y A;  4KF9 A;  4EO3 A;  4QL9 A;  4CY6 A;  2H72 A;  3H93 A;  1MDI A;  5CRW A;  1A8L A;  5DVB A;  4MLY A;  2VCX A;  5CRG A;  2DLX A;  4F2I A;  1BYE A;  3BJ5 A;  2YCD A;  3H1N A;  1X5E A;  3IV4 A;  3VUR A;  1THO A;  2A4V A;  2KUC A;  4KND A;  2FWF A;  4OCE A;  1GNW A;  2L59 A;  4V1A p;  4GLT A;  2UZ8 A;  5HR2 A;  1A2M A;  5IMD A;  2AB6 A;  4HQZ A;  5IOW A;  3O76 A;  2MYG A;  2HZE B;  1IYH A;  3Q19 A;  2GZZ A;  1XPV A;  1ERW A;  3GST A;  2B1L A;  2VCQ A;  5ID2 A;  3D4M A;  4NMU A;  4PQ1 A;  2VCV A;  2VIM A;  1Z6M A;  2JSZ A;  4ZB6 A;  1XVW A;  3D6I A;  5A34 A;  4DSS B;  5IMA A;  1EP8 A;  2YJH A;  4HI7 A;  2AV4 A;  3IAS 2;  1PD2 1;  3IRA A;  1JZO A;  1MD3 A;  1N25 A;  4PGT A;  4IJ3 A;  1RK4 A;  1TI3 A;  3RAZ A;  4ISD A;  4DSR A;  1SKS B;  3DIE A;  2L6D A;  1EV4 A;  1AXD A;  1RW1 A;  2OAD A;  4KCA A;  4MAB A;  1M7T A;  3KJY A;  4HOJ A;  3Q6O A;  4XRA A;  5HR0 A;  3CBU A;  3KEB A;  5L71 A;  3ZVJ D;  3O6T A;  4WKW A;  3KP8 A;  4GTU A;  4E8E A;  1N2A A;  1YQ1 A;  2C0E A;  1JZR A;  3KH7 A;  2CT6 A;  3H79 A;  1TDI A;  2XBI A;  2DMM A;  2NBS A;  1ACV A;  2UV8 G;  1XW6 A;  1EOG A;  4IVF A;  5ABR A;  1OC8 A;  3TUE A;  3M9K A;  3VPQ A;  2XC2 A;  4ID0 A;  5J5N A;  4K5R A;  1K0M A;  4E8H A;  3ISO A;  3DD3 A;  1SL2 B;  5DJM A;  3TB2 A;  5HR3 A;  3KP9 A;  3GX8 A;  4IGJ A;  3ZIT A;  2J9H A;  3IPZ A;  1XBS A;  5ECI B;  1QMV A;  1NW2 A;  5ECO B;  4LA1 A;  4F03 A;  4WF5 A;  3TCO A;  3LWA A;  1SL0 B;  4PNG A;  4L5O A;  5CP1 A;  3GFK A;  1LJR A;  2QA2 A;  3ZRD A;  3F0I A;  4BL7 B;  5GAN D;  2LJK A;  1URM A;  4EF0 A;  3C8E A;  4TKY A;  13GS A;  5CRH A;  4IP1 A;  3ZTL A;  5INY A;  3TJK A;  1VF3 A;  3AY8 A;  1QGV A;  2P0G A;  4USS A;  1Z6N A;  4IW9 A;  5G30 A;  1SJI A;  5LCZ A;  3FR3 A;  3JCM L;  3VLN A;  3W8J A;  1VF1 A;  2PVO C;  5ID2 B;  1FG4 A;  3HXS A;  4I2U A;  2E2G A;  4POL A;  5CRD A;  4AKG A;  1XOA A;  4HU9 A;  1BAY A;  2H1B A;  2KP1 A;  2VLU A;  4A5P A;  3TOU A;  4X43 A;  3KD0 A;  4FH8 A;  2KLX A;  5HFG A;  3GUR A;  1Y1U A;  2JAC A;  1EGR A;  2X8H A;  4CDO A;  1X9S B;  2IIY A;  1PX6 A;  4MH2 A;  1MEK A;  5KN2 A;  4NHZ A;  3E0U A;  5DQS A;  1HNC A;  5J4Y A;  4Z2U A;  3C7M A;  4FYC A;  2CX4 A;  1EEJ A;  4IQA A;  2R2J A;  3F8U A;  3UL3 A;  2LUS A;  3PPU A;  3TKS C;  2B5X A;  3EVI A;  2C8U A;  2XPD A;  4YH2 A;  4KX4 A;  4I5Q A;  2XHF A;  2YWM A;  4YQV A;  4IJI A;  6GSW A;  2CAI A;  2HSH A;  3GV1 A;  4D73 B;  4AGS A;  3U5R E;  5AIX A;  2H74 A;  4TVE A;  5DAK B;  5H5S A;  3ERW A;  4ZB8 A;  1FO5 A;  1O85 A;  3I69 A;  2QSI A;  3VK9 A;  3QPM A;  3HZ8 A;  4K9Z A;  4ZBA A;  1V2A A;  1M9A A;  2ZUP A;  1PGT A;  4KDU A;  4YKF A;  1DUG A;  5F8B A;  1OE7 A;  4MF7 A;  6GSS A;  1N8J A;  3G7J A;  4G01 A;  2O5V A;  1JLV A;  4TR1 B;  2O85 A;  1YZX A;  4HZ4 A;  2WUL A;  2FLS A;  4I8B A;  4K8M A;  3EPT A;  2LJR A;  1TRV A;  4L0W A;  2EFD A;  1FVJ A;  4TXO A;  4PQH A;  5IMF A;  1O7U A;  1YJ6 A;  2LRT A;  1YKA A;  5J40 A;  3MIX A;  2P5R A;  1OC3 A;  1YVL A;  2FGX A;  4AKI A;  1DE1 A;  3WGD A;  3VWX A;  2N5A A;  2O7K A;  3J7Y k;  3W6G A;  10GS A;  14GS A;  3UJ1 A;  2HSN A;  1M2B A;  4MZW A;  3MNG A;  5C04 A;  1ZYN A;  1AIU A;  3HJO A;  2OE1 A;  1MDJ A;  3F4S A;  2K9F A;  1XWK A;  4POB A;  1K0D A;  2R3X A;  5F07 A;  2CVD A;  4ACS A;  2OBK A;  2H75 A;  3SWL A;  1SEN A;  3UEM A;  3I9V 2;  4N0V A;  2DC5 A;  1MD4 A;  1BQ7 A;  5G1L A;  2LTK A;  1SU9 A;  3P7X A;  4WBR D;  4MZC A;  4L5L A;  1WP0 A;  3D4T A;  4ZL8 A;  2R0P A;  5ENU A;  4BPY A;  3TDG A;  1ERU A;  1O81 A;  4EUY A;  1K0B A;  5KN3 A;  4OCF A;  4TR3 A;  1PL1 A;  2IME A;  1K3L A;  4MNN A;  3BCI A;  3R3E A;  2DJK A;  1PN0 A;  3HVS A;  2G2Q A;  5J4U A;  2GQK A;  1GSS A;  1ZL9 A;  1K0O A;  5JCU A;  1TRU A;  3FY7 A;  3QCP A;  4HU7 A;  1T4Y A;  3ZML A;  5ELG A;  3GN3 A;  1ABA A;  2BTO T;  1K3Y A;  4ML1 A;  2YV7 A;  4PUA A;  2GSQ A;  3QOU A;  4ZXG A;  2IWT A;  4DEJ A;  4EIP A;  2RUF A;  3RHB A;  2L57 A;  3MYD A;  3KGK A;  2ZNM A;  1YKC A;  1BJX A;  3C71 A;  3KXO A;  5IIZ A;  1M2A A;  2L5O A;  3SBC A;  1GSQ A;  4BA7 A;  5IMZ A;  3HVX A;  2CQ9 A;  3DEX A;  2PER A;  5IOX A;  12GS A;  3F9U A;  5CYY A;  2IMI A;  3GMF A;  3ZZX A;  4V2L A;  4ZB9 A;  5JWR B;  2H71 A;  4YQU A;  1SK0 A;  2GZP A;  1T1V A;  4G0K A;  2R4V A;  2VD0 A;  2H73 A;  3WYW A;  3PR8 A;  1GNE A;  1UC7 A;  1YF0 A;  4K0N A;  1G0T A;  3KMN A;  5J9B A;  2OKA A;  2LEG A;  5E59 A;  5ECP B;  1I9D A;  4DVC A;  1ZOF A;  3LXT A;  3N9J A;  4FO5 A;  2LJA A;  5IMC A;  4TXO B;  3PGT A;  3LXZ A;  1XXU A;  2H1A A;  3TJJ A;  1H75 A;  1WJK A;  5A5K A;  3QD9 A;  5AIS A;  4XS4 B;  3FEU A;  5ECL B;  5A4W A;  3ZLP A;  1XWC A;  5DJL A;  4F0C A;  3WGX A;  1U87 A;  2F3M A;  4Q5Q A;  2CA8 A;  3UAP A;  1V57 A;  3NIV A;  3PIN A;  2HLS A;  1SVL A;  3E9J B;  2GLR A;  1Q98 A;  2LKU A;  2HSN B;  1PA3 A;  4EKZ A;  1YDK A;  4OO4 A;  4ECB A;  3GKN A;  2A2R A;  2YWO A;  2V6O A;  5COH A;  5DAL B;  1V58 A;  3IE3 A;  1F9M A;  3S9F A;  1TK5 B;  2ES7 A;  5IM9 A;  1EZK A;  4AF2 A;  4MH3 A;  6GSX A;  2HRN A;  1KBN A;  2VCT A;  3DWV A;  3VWW A;  3KCM A;  4WBJ A;  4XIH A;  1JLW A;  4F82 A;  5DCG A;  3TJF A;  2H30 A;  1G6W A;  1GH2 A;  3WT2 A;  2FA8 A;  5ECR B;  3HJM A;  2IFQ A;  2GQM A;  2B1K A;  1ZZY A;  4MPG A;  3GKM A;  3QAV A;  4GQF A;  3GYK A;  3ZMK A;  2FA4 A;  2P5Q A;  2WRT A;  4EL1 A;  3PH9 A;  4MA9 A;  3IXR A;  3DRN A;  2JL4 A;  3F4R A;  1GLQ A;  3RPN A;  5CNW A;  3UMA A;  1U3A A;  2R0C A;  1GSF A;  4MMM A;  1PSQ A;  3BBY A;  4ZBB A;  1AQV A;  2OBI A;  1G6Y A;  4EVM A;  3D5J A;  2IPA A;  4ZL9 A;  4PQI A;  1TRS A;  3CSH A;  2L6C A;  3EIN A;  2MMO A;  4FYU A;  1B8X A;  2H66 A;  2PU9 C;  5A4V A;  1PKW A;  4KA0 A;  3FW2 A;  2OT3 A;  3MAK A;  2HE3 A;  3M3M A;  11GS A;  5J47 A;  2WFC A;  2E0Q A;  3KH9 A;  5G2Z A;  2HRF A;  1GSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...