3IE3A

Structural basis for the binding of the anti-cancer compound 6-(7-nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (nbdhex) to human glutathione s-transferases
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYASLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutathione S-transferase P
publication title Structural basis for the binding of the anticancer compound 6-(7-nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol to human glutathione s-transferases
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ie3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ie3A01
2XPEA 2XC2A 1Z5YE 4IGJA 2ALBA 5HR1A 2CZ3A 2H1AA 1K0NA 2KOKA 5F07A 3EE2A 4MLYA 4TXVA 3VI7A 1GP1A 2QGVA 2FCHA 3EURA 1GUKA 1EP8A 5G31A 3BD2A 1F37A 1TI3A 2DJ1A 3BOAA 1GSSA 1J0FA 4GQCA 2EC4A 1G0TA 2LRCA 3LYPA 2K8SA 2CQ9A 2K9FA 1K0DA 2B6MA 1SK2A 2CVBA 1PGTA 5G2ZA 3H93A 2GGTA 4OFTA 3ZYWA 3VLNA 3R3EA 4MH2A 3BCIA 2R3XA 3TOTA 5GSSA 1FG4A 6GSSA 3PH9A 1MDIA 4WBRD 2CV4A 2N5AA 2PGTA 2WDUA 1YKCA 5DQSA 4XS4B 4ZXGA 2HSYA 3F6FA 4D73A 1OC9B 3KP8A 3TKSE 5LCZA 3I69A 4BA7A 3H79A 3GH6A 3ZTLA 3WT1A 1THOA 4TW5A 1N8JA 2ON5A 2MZCA 2FWFA 1T7PB 2GVPA 1B8XA 3UVHA 1SL0B 2VAFA 11GSA 1PKWA 5HR0A 2H66A 2B7JA 3GV1A 5D9WA 2RUEA 4MPGA 1XW6A 1A23A 1R7HA 3GKNA 1SJ6A 2H1DA 2H71A 2H73A 1G7OA 1JZDA 2O8VB 1MEKA 2KUCA 2GZPA 4NV2A 1EP7A 2B7KA 1A24A 4WXTA 4Q5QA 2LRTA 2M72A 4JE1A 2LQOA 5DAKB 3FZAA 2RM6A 3C73A 1YQ1A 2VCXA 5DJMA 3APSA 1NSWA 3TJBA 2DC5A 3VURA 3TGZA 4JRRA 1K3LA 3N9JA 4IBPA 4G0LA 3TUEA 1I9DA 2OE3A 2VLTA 3ZREA 3G9BA 4RI7A 1GTUA 4TVEA 1G6WA 2V6OA 4RQXA 3Q74A 2L57A 3PGTA 20GSA 2LNSA 2DJ3A 3MWHA 4MZBA 2CVDA 3M0FA 2V2GA 1M0UA 1Q4JA 5ECIB 4FH8A 5JCUA 3ZFLA 4ID0A 1CQGA 2KP1A 3KMOA 3QD9A 5IPGA 2DSAA 3TJFA 1B9YC 2B5EA 2C3QA 4OFMA 4XTSA 2JL4A 1XW9A 2LV3A 5B8BA 4PTSA 4HDEA 2VLUA 3GL5A 5HFKA 3QAVA 2VUPA 4MH3A 2H72A 4KX4A 4EVMA 1M2AA 5HFGA 1V98A 1O7UA 1Y6EA 5HQPA 4GTUA 2HRNA 2PU9C 4Z7XA 2E7PA 5IO2A 2P0GA 2GLRA 3SWLA 4WF5A 3UIWA 3GA4A 3HCZA 4KW6A 1XCCA 4XHMA 5ECHB 5EL8A 3D21A 5DCHA 4LMVA 3MSZA 3WGXA 3LFLA 4ZBBA 1EWXA 2H74A 1YF1A 4K0NA 4D73B 1K0OA 1K0AA 4EXJA 4BVYA 1PA3A 2B1KA 1XFLA 1R5PA 2IJYA 2R2JA 4YQMA 1ZZYA 4P3YB 1DUGA 4G19A 2M46A 4ACSA 5J5NA 3HHVA 3EINA 4N0ZA 3QR6A 3PR8A 5D9TA 3EYTA 3HZ8A 1DE1A 2WGRA 4I8BA 2IL3A 4WR5A 4HZ4A 4Q5NA 2LJRA 5HR2A 3GN3A 2DBCA 4F0BA 3KTBA 4AF2A 1PX7A 2FUG2 3KGKA 4V1Ap 1IYIA 5E4WA 1GL8A 3D22A 3KIJA 5A5KA 1NHOA 3IDVA 2FLSA 3DIEA 4BWQA 1OVNA 5ELAA 4KSMA 1GSYA 4KCEA 1PRXA 1F3AA 2GQLA 2HYXA 2YNXA 2JU5A 2RUFA 5KEJA 2GQMA 3HVSA 2L6DA 1PD21 2PBJA 1W89A 4E8HA 1O85A 3SBCA 1G7EA 4N30A 1WWJA 2HSNB 3MDKA 1YKAA 3Q19A 5DBQA 1X5CA 1X5EA 1VF3A 2OADA 3FHKA 4JZQA 4DSRA 1TU7A 5C00A 1U87A 6GSXA 3CYNA 3HD5A 5EVOA 4GXZA 1AAZA 3M3MA 3FR6A 5COHA 2H70A 3HY2A 4K7NA 2IPAA 2F8FA 1XPVA 2VD0A 1UN2A 3E9JB 3O76A 5JCGA 1H75A 5IPHA 4YQVA 5G1KA 1SKWB 1MD3A 1PN9A 4I97A 5A4UA 3P7XA 2AB6A 2JACA 3DKSA 4KDUA 5IM9A 3TJJA 1KNGA 1A2JA 1F9MA 2GZZA 3ZRDA 1R26A 4FYUA 2F9SA 1PL1A 2C4JA 3G7IA 2CVKA 1BX9A 5INYA 3TRXA 3QFBC 1M9AA 3TJKA 4JU5A 19GSA 1I5GA 1E2YA 3LG6A 3DMLA 4OCEA 1E6BA 1GLPA 5EPFA 1K0MA 4BVYB 3ME8A 1MD4A 1WJKA 3L9VA 1TDIA 3CSHA 2YWMA 2DMLA 1U6TA 3GYKA 1GH2A 4ZIJA 1OKTA 1TK5B 16GSA 4EE0A 2I81A 2HXKA 1AIUA 3KJYA 1XWBA 3DWVA 5C04A 2G2QA 2G0FA 3F4RA 5H5SA 3TJGA 4L0UA 1GULA 1Y25A 5B6MA 1GTBA 5AN1A 2GSRA 4PNGA 3IR4A 2VCVA 3F6DA 1V40A 3GMFA 1SL2B 3VWVA 3GSTA 3WGEA 3KD0A 4J56E 4TR3A 4N0VA 3GRXA 1PX6A 1O8XA 2WZ9A 3UBKA 2YV7A 1OYJA 1EEJA 4KSOA 2VCWA 5G5EA 3US3A 1RQMA 3DVXA 2BJXA 5DVBA 3KMNA 3QMXA 1YJ6A 4O32A 5J4UA 4I2TA 1A2MA 1Z9HA 3VWWA 5KN2A 2QC7A 1KBNA 1F2EA 3MNGA 4PURA 1YDKA 1FAAA 1X5DA 4OWYA 3L9UA 5ENUA 2YWIA 1TTZA 1XWCA 4YAVA 2V32A 1X9SB 2JADA 1T4YA 2GDRA 4V2MA 3ZL5A 4MABA 1BJXA 3A2WA 5G30A 3IC4A 2HLSA 3FZ9A 5JWQB 2VL2C 3GSSA 4G0KA 4K8MA 4RQRA 1YF0A 1UVZA 4OO4A 1QFNA 5ID2A 2UZ8A 3F3RA 1JZWA 4MZWA 5H5RA 4KUNA 4IP1A 2C3TA 2CAIA 3K8NA 6GSYA 2C8UA 5IMCA 1WPIA 1XBSA 4LA1A 3N5OA 5D9XA 4KF9A 3PINA 1WRYA 3HJOA 4PUFC 3GH9A 1EV9A 4HUAA 4RI6A 5DQYA 2PUKC 3BBYA 5IOXA 3F4SA 4CW9A 3GHAA 1LU4A 2O87A 1OC8A 2A4VA 4F03A 3R2QA 5ECKB 4ECBA 1X0RA 2K18A 5ECQB 4EDZA 4LL1B 1AC1A 3C1SA 3O6TA 1SU9A 5CYYA 3F8UA 1VF1A 1QGVA 4TKYA 1Z6MA 2GSQA 1THXA 4ZILA 1PMTA 5FWGA 3D6IA 2XHFA 2TRXA 3DXBA 5IMFA 3F9UA 2K8VA 2NBSA 3HYPA 4O5RA 2D2ZA 12GSA 1YEXA 1WIKA 1Q98A 2DJ2A 1JLVA 2RM5A 3LEFA 3BCKA 4ECCA 2MMOA 1URMA 3DGQA 1FVJA 2JZTA 4WEYA 1O73A 2MBSA 5B6NA 1XWAA 4MDCA 2GTUA 1BYEA 4TRXA 4EO3A 3FKFA 4OO5A 3QFAC 2DJ0A 1KEBA 2ZNMA 4GF0A 2A2RA 1GUHA 2WRTA 3TKSC 1TOFA 2H0GA 5CREA 3LXZA 1ZYEA 2NDOA 4ECIA 2X64A 4O7HA 1H4OA 4PX1A 3L9SA 3ERWA 4BPYA 1XOAA 2H30A 1T8EB 3JCML 3CXGA 4GSSA 1A0FA 3GTUA 5JWOB 5G1LA 3KCMA 4XIHA 1GRXA 3ZMKA 4POKA 2CA8A 4KDYA 2TIRA 2LRNA 1GSFA 2WFCA 5J3RA 3DRNA 4N11A 4KH7A 4GSTA 2O7KA 5F05A 2YP6A 3GUSA 4ZB9A 1DBYA 3GFKA 2XBIA 5ECPB 3RHCA 1RK4A 1S3CA 3EVIA 3EMXA 2XBQA 3CRUA 2R6KA 4J57E 2V6KA 1BQ7A 5JWRB 3W8SA 3LQ7A 5ID2B 1GUMA 1XOBA 1QUWA 2OACA 3GKMA 3UEMA 2PMTA 1X9MB 1N2AA 4PXOA 5GZZB 3F63A 4DSSA 4PGTA 3C7MA 3HZ4A 2KP2A 4QL7A 4MK3A 4HEA2 3ERFA 4TOPA 4HS1A 4POLA 1WMJA 1HQOA 2ZCTA 2FNOA 1XWGA 6GSWA 1U3AA 2IMFA 5GAPD 5DJLA 5D9VA 1ERWA 4EC0A 1PSQA 2PVOC 2I9HA 2AAWA 6GSVA 2MMNA 1EOHA 3CBUA 3LYKA 2YZHA 2J9HA 3GKKA 2C0FA 4X0XA 5DALA 2P5RA 2X8CA 2MMAA 4LL4B 4TR1A 5L71A 2PERA 1B9XC 2HSMA 1Z7PA 3I43A 4GRFA 3EWLA 1NW2A 5IOWA 3VPQA 13GSA 4I6XA 4F0CA 3BJ5A 1JZRA 2H8LA 4F82A 2F8AA 4ZB6A 4CHSA 1VGLA 4NWYA 4K1FA 1UC7A 2JZRA 3QPMA 4CDOA 4H86A 3LJRA 3UL3A 3C8EA 3IPZA 5KN3A 1XVQA 3ERGA 1DSBA 3HDCA 2H0HA 1AUCA 1A8YA 2PWJA 5CO3A 3QAWA 3H4KA 1EOGA 4IHUA 4MP4A 1O81A 1TRSA 4POMA 1HD2A 1QK8A 1CQHA 2H76A 3I9V2 2TRCP 4KGIA 14GSA 1ZL9A 2P31A 2GT5A 5ECMB 2DIYA 4IS0A 1TU8A 2JZSA 2CT6A 5AIVA 3HJMA 4L5OA 2B3SA 2I4AA 1TRUA 3F3QA 4AGSA 4MF6A 4PQIA 2VL9A 2HRAA 2H01A 4X43A 4MJCA 3KEBA 2VL2A 5J9BA 4NMUA 4ZL7A 2RIIA 2DMMA 2ES7A 4EUYA 4EDYA 1M7TA 1V2AA 5CRGA 2YV9A 1G6YA 2DJKA 2NTOA 4TN8A 4NAXA 4AJ8A 5BMUA 3UBLA 4KA0A 4HI7A 1LJRA 1M99A 3J7Yb 4DSSB 2VO4A 4TR0A 2VCZA 2L5OA 3ZIVA 2B1LA 4JR6A 5F06A 5D73A 1EZKA 4XRDA 1B48A 3KZQA 3ED3A 3U6VA 2I1UA 4JBBA 2HZFA 1NM3A 5F8BA 1EGOA 3G7YA 4L5LA 3GL3A 1VF4A 1F6MC 2YOIA 2IMKA 3M8NA 3TKPA 1GWCA 3IOSA 4HU7A 5DALB 5DCGA 3FYGA 2EIQA 2PN8A 4IQAA 3ZLPA 4TR1B 1ERTA 4E8EA 5ABRA 1ZOFA 2X8GA 4KE3A 4MF5A 2HSMB 4IJIA 2V1MA 1QXHA 2KHPA 2QSIA 2LJKA 5F0GA 3ZVJD 3RPNA 2FA4A 3IXRA 4MJBA 2PVQA 4WF4A 4NXIA 2HRFA 1O6JA 1GNWA 4L8EA 2CZ2A 3GX8A 3HVXA 5GAND 2E0QA 2GT6A 7GSSA 5LNKe 1XWKA 5B7CA 4MCUA 1J08A 5D8IA 3TKSA 2H6XA 1NHYA 2WS2A 3CTFA 4BWSA 3G7JA 1UA5A 5JCWA 4L0WA 3Q18A 3TKQA 3E3EA 1B4QA 5IQYA 5IIZA 1A8LA 2IMDA 2C3NA 4NHWA 5CP1A 1C72A 1GSQA 3FR9A 2L4QA 5A4VA 1Z7RA 4OCFA 4YQUA 4DVCA 3IHQA 3IA1A 5DAKA 3EMPA 3MAKA 3HKRA 2EIOA 2VIMA 1EGRA 1RW1A 5H5QA 4IVFA 5DDLA 5ECSA 4TXOA 4WETA 2REMA 4GQFA 1FO5A 3O3TA 3L78A 1BEDA 3C1RA 1TK0B 4X1UA 5CAXA 1ACVA 1BG5A 4MA9A 2YCDA 1SJZA 4WKWA 3ME7A 4F9ZA 1PKZA 2H75A 3TRPA 2K6VA 4N10A 3FRCA 4NHZA 1K0CA 3J7Yk 3ZIJA 4WR4A 2IFQA 2ON7A 2LNTA 5AISA 1J9BA 4ILFA 2H1BA 1YEPA 4PUAA 2DIZA 2L4CA 1U88A 3IRAA 3LGCA 3KP9A 3EU3A 3U5RE 3A2VA 3FK8A 4V2NA 3QAGA 2OA7A 3ZMLA 3KH7A 2GS3A 2HT9A 4JR4A 1FOVA 5ECOB 4G2EA 2AV4A 3UOMA 1V58A 3RBTA 3QOUA 3FW2A 2C0DA 1TKDB 4JEDA 4MJEA 2LJAA 5KN1A 5CRDA 2JSZA 3P2AA 1OC3A 1MTCA 2H1GA 2YJHA 1A0RP 3P8WA 5EY6A 4TR4A 3FZ5A 1XXUA 2DLXA 2F3MA 2FWHA 1TK8B 1FB0A 1SD8A 1AXDA 2YWOA 2FA8A 2WCIA 3IK9A 2L59A 1ZMAA 4KDXA 1FW1A 4PQ1A 3ZZXA 4ZBDA 2VM2A 3VPTA 5HR3A 3D5JA 4I5QA 1SYXA 2HNLA 1AQWA 4HZ2A 18GSA 1TRWA 1WE0A 3C71A 1KTEA 3EC3A 4F2IA 4LLRA 2LUSA 3P90A 3ZFBA 2WJUA 1T1VA 4LMWA 1TRVA 1QQ2A 1ST9A 3APQA 2N5FA 2I3YA 3CTGA 1SJIA 2HRKA 2C0GA 1FVKA 3HA9A 1ON4A 2HE3A 1ZGNA 1ZYQB 1WOUA 1SL1B 1T4ZA 1ABAA 4MJAA 1XIYA 2C0EA 2LTKA 3LWAA 1FB6A 4IELA 1TP9A 3E0UA 4HJMA 2WB9A 3TOUA 1K3YA 4FYBA 5IO0A 2OBIA 3UMAA 2CX4A 4ZB8A 1M2BA 2MMZA 3A2XA 3EU4A 4TXOB 1MDKA 1JZOA 4ECJA 3DVWA 1QMVA 2AHEA 2AYTA 3DYRA 5KN0A 2CAQA 3CSJA 4PQHA 4KAEA 2NPBA 3DD3A 1K3OA 2VD1A 4GWRA 2ZUPA 3IBHA 2F51A 4BVXA 1XZOA 1M9BA 8GSSA 2GQKA 1ERVA 4K7OA 3GIXA 1Z3EA 2IFQB 10GSA 2FWEA 1IYHA 5AGYA 2M80A 4K6XA 3QCPA 5ECRB 5J9CA 2BTOT 2IN3A 4IKHA 5ELGA 1EV4A 4GSNA 2GSSA 4HJ2A 4XS6A 3L0HA 4ISDA 2CX3A 2QKEA 4XCSA 4YH2A 4HOJA 4AJ6A 1GTAA 1SYRA 2IMEA 4Q5FA 4EKZA 2L6CA 3ZVJA 4DEJA 4I2UA 1T00A 1ZCPA 1Z6NA 2FWGA 2O89A 3HXSA 2FY6A 3S9FA 3NZNA 3F0IA 2NVLA 1AQXA 5GSTA 3DEXA 2MYGA 4BL7A 4K0GA 5G5FA 1HYUA 2HFDA 1TI1A 3OR5A 4YAPA 1PQNA 2VCTA 4FO5A 4HQZA 1SKRB 3UAPA 3KM6A 2Z9SA 4KNDA 4WBJA 4USSA 3TB2A 3PPUA 1OAZA 5IMAA 3RPPA 5B8AA 3GURA 2IMIA 2H19A 4RUVA 22GSA 4ZL8A 1DE2A 2GZYA 2H0IA 2VL3A 4IQ1A 4MPFA 1VRSD 2A2SA 2HRKB 2HZEA 3RHBA 5E59A 3LXTA 4HQSA 4IN0A 4FYCA 4QQ7A 1XVWA 4OMVA 2GSTA 5LD0A 1GTIA 5J41A 4V2LA 2MBTA 1EEMA 3IC8A 1PL2A 2PPTA 5FHIA 1S3DA 4FQUA 5D96A 1SENA 4XRAA 1AW9A 3WGDA 4G10A 2RLIA 1R4WA 3H1NA 4ULXA 2H6ZA 2IWTA 2X99A 3H8QA 5IMVA 3GTUB 4MZCA 3IV4A 17GSA 5ECNB 1LBKA 3VK9A 2EIRA 1B4PA 3IE3A 2LQQA 1X9WB 3CMIA 3D4TA 3FZ4A 1V9WA 4EL1A 3A3TA 4ML1A 3KXOA 3IAS2 1ERUA 4DSQA 2VM1A 3HVVA 5CRHA 1TJDA 1XW5A 2LS5A 3D4MA 2YWNA 4BVXB 3L4NA 3NOFA 2E2GA 3GKXA 1YY7A 3TCOA 3IK7A 1HNAA 1ILOA 3FEUA 4K7IA 4NV5A 2JSYA 2R37A 2KLXA 2FHEA 3M1GA 3ZITA 1SK1A 3HJPA 4ZBAA 1OKDA 2DJJA 3M9KA 3VWUA 1R5AA 1SD9A 5CRWA 3UARA 1S3AA 3VFIA 5CNWA 3NIVA 1HNBA 1VF2A 3UJ1A 4K9ZA 4IP6A 3I6AA 4GCIA 2O85A 3V1WA 2HSHA 2LKUA 4FIWA 3KTLA 3IAM2 1M2DA 2VCQA 4IJ3A 2OJLA 1ML6A 2E2MA 3QDNA 4G0IA 4KCAA 3WYWA 5IMDA 9GSSA 2LSTA 1K0BA 3WD6A 2LEGA 2IIYA 3TKRA 1W4VA 4QL9A 2VOCA 4KB3A 2R4VA 5ECLB 1JHBA 2XPDA 4OD7A 2R5GA 2AJQB 2YANA 4BL7B 2H6YA 3LORA 3F4TA 1GLQA 1SKSB 6GSTA 1TXXA 3D0ZA 4K2DA 3M9JA 3W8JA 3VWXA 1F3BA 3KH9A 1T3BA 2VLVA 2V41A 3RAZA 3GNJA 1GSEA 1TW9A 2HI7A 2OKAA 4XS4A 4AJ7A 4Q5RA 3AY8A 2BMXA 2YJ7A 4V1Ag 2WULA 4GLTA 3GX0A 4J2FA 1OE7A 3FY7A 1OC9A 4OFNA 2C1YA 2OE1A 1GSDA 2HZEB 2X8HA 2B5YA 1V57A 4XS1A 5D93A 3WT2A 4POBA 2YPMA 3W6GA 2YZUA 1JFUA 3CSIA 2AUVA 2FGXA 2HQTA 1BAYA 3LSZA 1AQVA 1OE8A 1JLWA 5AIXA 6GSUA 4O92A 3VI5A 4MF7A 3TRQA 5A4WA 5FT3A 2FD3A 1YZXA 4ZL9A 3APOA 3ISOA 2P5QA 1U3IA 1USBA 1GNEA 4G9HA 4ML6A 1WP0A 3A5WA 4HU9A 1HNCA 4IW9A 4PNFA 1SK0A 5IMZA 1GSUA 5HFIA 3Q6OA 1A2LA 2B5XA 2OE0A 4NPBA 3RDWA 1O8WA 3TDGA 2N5BA 1MDJA 2L5LA 2OBKA 3CRTA 4EF0A 2YN1A 1FHEA 3FR3A 2C80A 3UVTA 2J23A 4MMMA
chains in the Genus database with same CATH superfamily
2XPEA 2XC2A 1Z5YE 4IGJA 2ALBA 5HR1A 2CZ3A 2H1AA 1K0NA 2KOKA 5F07A 3EE2A 4MLYA 4TXVA 3VI7A 1GP1A 2QGVA 2FCHA 3EURA 1GUKA 1EP8A 5G31A 3BD2A 4Z2RA 1F37A 1TI3A 2DJ1A 2OT3A 3BOAA 1GSSA 1J0FA 4GQCA 2EC4A 1G0TA 2LRCA 3LYPA 2K8SA 2CQ9A 2K9FA 1K0DA 2B6MA 1SK2A 2CVBA 1PGTA 5G2ZA 3H93A 2GGTA 4OFTA 3ZYWA 3VLNA 3R3EA 4MH2A 3BCIA 2R3XA 3TOTA 5GSSA 4AKIA 1FG4A 6GSSA 3PH9A 1MDIA 4WBRD 2CV4A 2N5AA 2PGTA 2WDUA 1YKCA 5DQSA 4XS4B 4ZXGA 2HSYA 5A1NA 4QMKA 3F6FA 4D73A 1OC9B 3KP8A 3TKSE 5LCZA 3HVNA 3I69A 4BA7A 4YKFA 3H79A 3GH6A 3ZTLA 3WT1A 1THOA 4TW5A 1N8JA 2ON5A 2MZCA 2FWFA 1T7PB 2GVPA 1B8XA 3UVHA 1SL0B 2VAFA 11GSA 1PKWA 5HR0A 2H66A 2B7JA 3GV1A 5D9WA 2RUEA 4MPGA 2DKIA 1XW6A 1A23A 1R7HA 3GKNA 1SJ6A 2H1DA 2H71A 2H73A 1G7OA 1JZDA 2O8VB 1MEKA 2KUCA 2GZPA 4NV2A 1EP7A 2B7KA 1A24A 4WXTA 2WVXB 4Q5QA 2LRTA 2QA1A 2M72A 4JE1A 3CQFA 2LQOA 5DAKB 3FZAA 2RM6A 3C73A 1YQ1A 2VCXA 5DJMA 3APSA 1NSWA 3TJBA 2DC5A 3VURA 3TGZA 4JRRA 1K3LA 3N9JA 4IBPA 4G0LA 3TUEA 1I9DA 2OE3A 2VLTA 3ZREA 3G9BA 4RI7A 2HSNA 1GTUA 4TVEA 1G6WA 2V6OA 4RQXA 3Q74A 2L57A 3PGTA 20GSA 2LNSA 2DJ3A 3MWHA 4MZBA 2CVDA 3M0FA 2V2GA 1M0UA 1Q4JA 5ECIB 4FH8A 4ZB7A 5JCUA 3ZFLA 4ID0A 1CQGA 2KP1A 1PFOA 3KMOA 3QD9A 5IPGA 2DSAA 3TJFA 1B9YC 2B5EA 2C3QA 4OFMA 4XTSA 2JL4A 1XW9A 2LV3A 5B8BA 4PTSA 4HDEA 2VLUA 3GL5A 5HFKA 3QAVA 2VUPA 4MH3A 2H72A 4KX4A 4EVMA 1M2AA 5HFGA 2A4HA 1V98A 1O7UA 5A5HA 1Y6EA 5HQPA 4GTUA 2HRNA 2PU9C 4Z7XA 2E7PA 5IO2A 2P0GA 2GLRA 3SWLA 4WF5A 5J4VA 3UIWA 3GA4A 3HCZA 4KW6A 1XCCA 4XHMA 5ECHB 5EL8A 3D21A 5DCHA 4LMVA 3MSZA 3WGXA 3LFLA 4ZBBA 5A1NB 1EWXA 2H74A 1YF1A 4K0NA 4D73B 1K0OA 1K0AA 4EXJA 1YVLA 1PA3A 4BVYA 2B1KA 1XFLA 1R5PA 2IJYA 2R2JA 4YQMA 1ZZYA 4P3YB 1DUGA 4G19A 2M46A 4ACSA 5BRTA 5J5NA 3HHVA 3EINA 4N0ZA 3QR6A 3PR8A 5D9TA 4AI6A 3EYTA 3HZ8A 1DE1A 2WGRA 4I8BA 2IL3A 4WR5A 4HZ4A 4Q5NA 2LJRA 5HR2A 2WVYA 3GN3A 2DBCA 4F0BA 1SVOA 3KTBA 4AF2A 1PX7A 2FUG2 3KGKA 3LW9A 4V1Ap 1IYIA 5E4WA 1GL8A 3D22A 3KIJA 5A5KA 1NHOA 3IDVA 2FLSA 3DIEA 4BWQA 1OVNA 5ELAA 4KSMA 1GSYA 4KCEA 1PRXA 1F3AA 2GQLA 2HYXA 2YNXA 2JU5A 2RUFA 5KEJA 2GQMA 3HVSA 2L6DA 1PD21 2PBJA 1W89A 4CY6A 4E8HA 1O85A 3SBCA 1G7EA 4N30A 1WWJA 2HSNB 3MDKA 1YKAA 3Q19A 4K2XA 5DBQA 1X5CA 1X5EA 1VF3A 2OADA 3FHKA 4JZQA 4DSRA 1TU7A 5C00A 1U87A 6GSXA 1BG1A 3CYNA 3HD5A 5EVOA 4GXZA 1AAZA 3M3MA 3FR6A 5COHA 2H70A 3HY2A 4K7NA 2IPAA 2F8FA 1XPVA 2VD0A 1UN2A 3E9JB 3O76A 5JCGA 1H75A 5IPHA 4YQVA 5G1KA 1SKWB 1MD3A 1PN9A 4I97A 5A4UA 3P7XA 2AB6A 2JACA 3DKSA 4KDUA 5IM9A 3TJJA 1KNGA 1A2JA 1F9MA 2GZZA 3ZRDA 1R26A 4FYUA 2F9SA 5A5HB 1PL1A 2C4JA 3G7IA 2CVKA 1BX9A 5INYA 3TRXA 2WW3A 3QFBC 1M9AA 3TJKA 4JU5A 19GSA 1I5GA 1M3IA 1E2YA 3LG6A 3DMLA 4OCEA 1E6BA 1GLPA 5EPFA 1K0MA 4BVYB 3ME8A 1MD4A 1WJKA 3L9VA 2QA2A 1TDIA 2R0CA 3CSHA 2YWMA 2DMLA 1U6TA 3GYKA 1GH2A 4ZIJA 1OKTA 1TK5B 16GSA 2EFHA 4EE0A 2I81A 2HXKA 1AIUA 3KJYA 1XWBA 3DWVA 5C04A 3IHGA 2G2QA 2G0FA 3F4RA 5H5SA 3TJGA 4L0UA 1GULA 1Y25A 5B6MA 1GTBA 5AN1A 2GSRA 4PNGA 3IR4A 2VCVA 3FMWA 3F6DA 1V40A 3GMFA 1SL2B 3VWVA 3GSTA 4FXYP 4Z2TA 3WGEA 3KD0A 1I1IP 4J56E 3HMJG 4TR3A 4N0VA 3GRXA 1PX6A 4YKGA 1O8XA 2WZ9A 3UBKA 2YV7A 1OYJA 1EEJA 4KSOA 2VCWA 5G5EA 3US3A 1RQMA 3DVXA 1YEWC 2BJXA 5DVBA 3KMNA 3QMXA 1YJ6A 4O32A 5J4UA 4I2TA 1A2MA 1Z9HA 3VWWA 5KN2A 2QC7A 1KBNA 1F2EA 3MNGA 4PURA 1YDKA 1FAAA 1X5DA 1S3RA 4OWYA 3L9UA 5ENUA 2YWIA 1TTZA 1XWCA 4EIQA 4YAVA 2V32A 1X9SB 2H1LA 2JADA 1T4YA 2GDRA 4V2MA 3ZL5A 4MABA 1BJXA 3A2WA 5G30A 3IC4A 2HLSA 3FZ9A 5JWQB 2VL2C 3GSSA 4G0KA 2WZSA 4K8MA 4RQRA 1YF0A 1UVZA 4OO4A 1QFNA 5ID2A 2UZ8A 3F3RA 1JZWA 4MZWA 5H5RA 4KUNA 4IP1A 2C3TA 2CAIA 3K8NA 6GSYA 2C8UA 5IMCA 1WPIA 1XBSA 4LA1A 3N5OA 5D9XA 4KF9A 3PINA 1WRYA 3HJOA 4PUFC 3GH9A 5KOWA 1EV9A 4HUAA 4RI6A 5DQYA 2PUKC 3BBYA 5IOXA 3F4SA 4CW9A 3GHAA 1LU4A 2O87A 4MNNA 1OC8A 2A4VA 4F03A 5A34A 3R2QA 5ECKB 4ECBA 1X0RA 2K18A 5ECQB 4EDZA 4LL1B 1AC1A 3C1SA 3O6TA 1SU9A 5CYYA 3F8UA 1VF1A 1QGVA 1FOHA 4TKYA 1Z6MA 2GSQA 1THXA 4ZILA 1PMTA 5FWGA 3D6IA 2XHFA 2TRXA 3DXBA 5IMFA 3F9UA 2K8VA 2NBSA 3HYPA 4O5RA 2D2ZA 4X4JA 12GSA 1YEXA 1WIKA 1Q98A 2DJ2A 1JLVA 2RM5A 3LEFA 3BCKA 4ECCA 2MMOA 1URMA 3DGQA 1FVJA 2JZTA 4WEYA 1O73A 2MBSA 5B6NA 1XWAA 4MDCA 2GTUA 1BYEA 4TRXA 4EO3A 3FKFA 4OO5A 3QFAC 2DJ0A 1KEBA 2ZNMA 4GF0A 2A2RA 1GUHA 2WRTA 3TKSC 1TOFA 2H0GA 5CREA 4PI0C 3LXZA 5J47A 1ZYEA 1N25A 2NDOA 4ECIA 2X64A 4O7HA 1H4OA 4PX1A 3L9SA 3ERWA 4BPYA 1XOAA 2H30A 1T8EB 3JCML 3CXGA 4GSSA 1A0FA 3GTUA 5JWOB 5G1LA 2X4AA 3KCMA 4XIHA 1GRXA 3ZMKA 4POKA 2CA8A 4KDYA 2TIRA 2LRNA 1GSFA 4Z2UA 2WFCA 5J3RA 3DRNA 4N11A 4EIPA 4KH7A 4GSTA 2O7KA 5F05A 2YP6A 3GUSA 4ZB9A 1DBYA 3GFKA 2XBIA 5ECPB 3RHCA 1RK4A 1S3CA 3EVIA 3EMXA 2XBQA 3CRUA 4PI2C 2R6KA 4J57E 2V6KA 1BQ7A 5JWRB 3W8SA 3LQ7A 5ID2B 1GUMA 4AKXB 1XOBA 1QUWA 2OACA 3GKMA 3UEMA 2PMTA 1X9MB 1N2AA 4PXOA 5GZZB 3F63A 4DSSA 4PGTA 3C7MA 3HZ4A 2KP2A 5A34B 4QL7A 4O5UA 4MK3A 4HEA2 3ERFA 4TOPA 4HS1A 4POLA 1WMJA 1HQOA 2ZCTA 2FNOA 1XWGA 6GSWA 1U3AA 2IMFA 5GAPD 5DJLA 5D9VA 4AKHA 1ERWA 4BIKA 4EC0A 1PSQA 2PVOC 2I9HA 2AAWA 6GSVA 2MMNA 1EOHA 3CBUA 3LYKA 2YZHA 2J9HA 3GKKA 2C0FA 4X0XA 5DALA 2P5RA 2X8CA 2MMAA 4LL4B 4TR1A 2WW1A 5L71A 3TU3B 2PERA 1B9XC 2HSMA 4AKGA 1Z7PA 3I43A 4GRFA 3EWLA 1NW2A 5IOWA 4GDFA 3VPQA 13GSA 4I6XA 2DKHA 4F0CA 2R0GA 3BJ5A 1JZRA 2H8LA 4F82A 2F8AA 4ZB6A 4CHSA 1VGLA 4NWYA 4K1FA 1UC7A 2JZRA 3QPMA 4CDOA 2O3EA 4H86A 3LJRA 3UL3A 3C8EA 3IPZA 5KN3A 1XVQA 3CHXC 3A5IA 3CWGA 3ERGA 1DSBA 3HDCA 2H0HA 1AUCA 1A8YA 2PWJA 5CO3A 3QAWA 2VKZG 3H4KA 1EOGA 4IHUA 4MP4A 1O81A 1TRSA 4POMA 1HD2A 1QK8A 1CQHA 2H76A 3I9V2 2TRCP 4KGIA 14GSA 1ZL9A 2P31A 2GT5A 5ECMB 2DIYA 4IS0A 1TU8A 2JZSA 2CT6A 5AIVA 3HJMA 4L5OA 2B3SA 2I4AA 1TRUA 3F3QA 4AGSA 4MF6A 4PQIA 2VL9A 2HRAA 2H01A 4X43A 4MJCA 3KEBA 2VL2A 5J9BA 4NMUA 4ZL7A 2RIIA 2DMMA 2ES7A 4EUYA 4EDYA 1M7TA 1V2AA 4E68A 5CRGA 2YV9A 1G6YA 2DJKA 2NTOA 4TN8A 4NAXA 4AJ8A 5BMUA 2EFCA 3UBLA 4KA0A 4HI7A 1LJRA 1M99A 3J7Yb 4DSSB 2VO4A 4TR0A 2VCZA 2L5OA 3ZIVA 2B1LA 4JR6A 5F06A 5D73A 1EZKA 4XRDA 1B48A 3KZQA 3ED3A 3U6VA 2I1UA 4JBBA 2HZFA 1NM3A 5F8BA 1SVLA 1EGOA 3G7YA 4L5LA 3GL3A 1VF4A 1F6MC 2YOIA 2IMKA 2O5VA 3M8NA 3TKPA 2R0PA 1GWCA 3IOSA 4HU7A 5DALB 5DCGA 3FYGA 2EIQA 2PN8A 4IQAA 3ZLPA 4TR1B 1ERTA 4E8EA 5ABRA 1ZOFA 2X8GA 4KE3A 4MF5A 2HSMB 1TXUA 4IJIA 2V1MA 1QXHA 2KHPA 2QSIA 2LJKA 5F0GA 3ZVJD 3RPNA 2FA4A 3IXRA 4MJBA 1XG8A 2PVQA 4WF4A 4NXIA 2HRFA 1O6JA 1GNWA 4CY8A 4L8EA 2CZ2A 3GX8A 3HVXA 5GAND 2E0QA 2GT6A 7GSSA 5LNKe 1XWKA 5B7CA 4MCUA 1J08A 5D8IA 3TKSA 2H6XA 1NHYA 2WS2A 3CTFA 4BWSA 3G7JA 1UA5A 5JCWA 4L0WA 3Q18A 3TKQA 4HSCX 3E3EA 1B4QA 5IQYA 5IIZA 1A8LA 2IMDA 2C3NA 4NHWA 5CP1A 1C72A 1GSQA 3FR9A 2L4QA 5A4VA 1Z7RA 2EFDA 4OCFA 4YQUA 4DVCA 3IHQA 3IA1A 5DAKA 3EMPA 1Y1UA 3MAKA 5KOXA 3HKRA 2EIOA 2VIMA 1EGRA 1RW1A 5H5QA 4IVFA 5DDLA 5ECSA 4TXOA 4WETA 2REMA 4GQFA 1FO5A 3O3TA 3L78A 1BEDA 3C1RA 1TK0B 4X1UA 5CAXA 1ACVA 1BG5A 4MA9A 2YCDA 1SJZA 4WKWA 3ME7A 4F9ZA 1PKZA 2H75A 3TRPA 2K6VA 5BMUB 4N10A 3FRCA 4NHZA 1K0CA 3MIXA 4ICYA 3J7Yk 3ZIJA 4WR4A 2IFQA 2ON7A 2WW0A 5AISA 1J9BA 2LNTA 4ILFA 2H1BA 1YEPA 4PUAA 2DIZA 2L4CA 1U88A 3IRAA 3LGCA 3KP9A 3EU3A 3U5RE 3A2VA 3FK8A 4V2NA 3QAGA 2OA7A 3ZMLA 3KH7A 2GS3A 2HT9A 4O5QA 4JR4A 1FOVA 5ECOB 4G2EA 1BF5A 2AV4A 3UOMA 1V58A 3RBTA 3QOUA 3FW2A 2C0DA 1TKDB 4JEDA 4MJEA 2LJAA 5KN1A 5CRDA 2JSZA 3P2AA 1OC3A 1MTCA 2H1GA 2YJHA 1A0RP 3P8WA 5EY6A 4TR4A 3FZ5A 1XXUA 2DLXA 2F3MA 2FWHA 1TK8B 1FB0A 1SD8A 1AXDA 2YWOA 2FA8A 2WCIA 3IK9A 2L59A 1ZMAA 4KDXA 1FW1A 4PQ1A 3ZZXA 4ZBDA 2VM2A 3VPTA 5HR3A 3D5JA 4I5QA 1SYXA 2HNLA 1AQWA 4HZ2A 18GSA 1TRWA 1WE0A 3C71A 1KTEA 3EC3A 4F2IA 4LLRA 2LUSA 3P90A 3ZFBA 2WJUA 4W66A 1T1VA 4LMWA 1TRVA 1QQ2A 3EPTA 1ST9A 3APQA 2N5FA 2I3YA 3CTGA 1SJIA 2HRKA 2C0GA 1FVKA 3HA9A 1ON4A 2HE3A 2X49A 4K5SA 1ZGNA 1ZYQB 1WOUA 1SL1B 1T4ZA 1ABAA 4MJAA 1XIYA 2C0EA 2LTKA 3LWAA 2UV8G 1FB6A 4IELA 4K5RA 1TP9A 3E0UA 4HJMA 1S4BP 1SVMA 2WB9A 3TOUA 1K3YA 4FYBA 5IO0A 2OBIA 3UMAA 2CX4A 4ZB8A 1M2BA 2MMZA 3A2XA 3EU4A 4TXOB 1MDKA 1JZOA 4ECJA 3DVWA 1QMVA 2AHEA 2AYTA 3DYRA 5KN0A 2CAQA 3CSJA 4PQHA 4KAEA 2NPBA 3DD3A 1K3OA 2VD1A 4GWRA 2ZUPA 3IBHA 2F51A 3RFRC 4BVXA 1XZOA 1M9BA 8GSSA 2GQKA 1ERVA 4K7OA 3GIXA 1Z3EA 2IFQB 10GSA 2FWEA 1IYHA 5AGYA 2M80A 4K6XA 3QCPA 5ECRB 5J9CA 2BTOT 2IN3A 4IKHA 5ELGA 1EV4A 4GSNA 2GSSA 4HJ2A 4XS6A 3L0HA 4ISDA 2CX3A 2QKEA 4XCSA 2WW2A 4YH2A 4HOJA 4AJ6A 1GTAA 2O36A 1SYRA 2IMEA 4Q5FA 4EKZA 2L6CA 3ZVJA 4DEJA 4I2UA 1T00A 1ZCPA 1Z6NA 2FWGA 2O89A 3HXSA 2FY6A 3S9FA 3NZNA 4N3ZA 3F0IA 2NVLA 1AQXA 5GSTA 3DEXA 2MYGA 4BL7A 4K0GA 5G5FA 1HYUA 2HFDA 1TI1A 3OR5A 4YAPA 1PQNA 2VCTA 4FO5A 1ZYNA 4HQZA 1SKRB 3UAPA 3KM6A 2Z9SA 4KNDA 4WBJA 4USSA 3TB2A 3PPUA 1OAZA 5IMAA 3RPPA 5B8AA 3GURA 2IMIA 2H19A 4RUVA 22GSA 4ZL8A 2EFEA 1DE2A 2GZYA 2H0IA 2VL3A 4IQ1A 4MPFA 1VRSD 2A2SA 2HRKB 2HZEA 3RHBA 5E59A 3LXTA 4HQSA 4IN0A 4FYCA 4QQ7A 1XVWA 4OMVA 2GSTA 5LD0A 1PN0A 1GTIA 5J41A 4V2LA 2MBTA 1EEMA 3IC8A 1PL2A 2PPTA 5FHIA 1S3DA 3MYDA 4FQUA 5D96A 1SENA 4XRAA 1AW9A 3WGDA 4G10A 2RLIA 1R4WA 3H1NA 4G01A 4ULXA 2H6ZA 2IWTA 2X99A 3H8QA 5IMVA 3GTUB 4MZCA 3IV4A 17GSA 5ECNB 1LBKA 3VK9A 2EIRA 1B4PA 3IE3A 2LQQA 1X9WB 3CMIA 3D4TA 3FZ4A 1V9WA 4EL1A 3A3TA 4ML1A 3KXOA 3IAS2 1ERUA 4DSQA 2VM1A 3HVVA 5CRHA 1TJDA 1XW5A 2LS5A 3D4MA 2YWNA 4BVXB 3L4NA 3NOFA 2E2GA 3GKXA 1YY7A 3TCOA 3IK7A 1HNAA 1ILOA 5J4YA 3FEUA 4K7IA 4NV5A 2JSYA 2R37A 2KLXA 2FHEA 3M1GA 3ZITA 1SK1A 3HJPA 4ZBAA 1OKDA 2DJJA 3M9KA 3VWUA 1R5AA 1SD9A 5CRWA 3UARA 1S3AA 3VFIA 5CNWA 3NIVA 1HNBA 1VF2A 3UJ1A 4K9ZA 4IP6A 3I6AA 4GCIA 2O85A 3V1WA 2HSHA 2LKUA 4FIWA 3KTLA 3IAM2 1M2DA 2VCQA 4IJ3A 2OJLA 1ML6A 2E2MA 3QDNA 4G0IA 4KCAA 3WYWA 5IMDA 9GSSA 2LSTA 1K0BA 3WD6A 2LEGA 2IIYA 3TKRA 1W4VA 4QL9A 2VOCA 4KB3A 2R4VA 5ECLB 1JHBA 2XPDA 4OD7A 2R5GA 2AJQB 2YANA 4BL7B 2H6YA 3LORA 3F4TA 1GLQA 1SKSB 6GSTA 1TXXA 3D0ZA 4K2DA 3M9JA 3W8JA 3VWXA 1F3BA 3KH9A 1T3BA 1M3JA 2VLVA 2V41A 3RAZA 3GNJA 1GSEA 1TW9A 2HI7A 2OKAA 4XS4A 4AJ7A 4Q5RA 3AY8A 2BMXA 2YJ7A 4V1Ag 2WULA 4GLTA 3GX0A 4J2FA 1OE7A 3FY7A 1OC9A 4OFNA 2C1YA 2OE1A 1GSDA 2HZEB 2X8HA 4PHZC 2B5YA 1V57A 4XS1A 5D93A 3WT2A 4POBA 2YPMA 3W6GA 3RGBC 2YZUA 1JFUA 3CSIA 2AUVA 2FGXA 4A5PA 2HQTA 1BAYA 3LSZA 1AQVA 1OE8A 5J40A 1JLWA 5AIXA 6GSUA 4O92A 3VI5A 4MF7A 3TRQA 5A4WA 5FT3A 2FD3A 1YZXA 4ZL9A 3APOA 3ISOA 2P5QA 1U3IA 2WVZA 1USBA 1GNEA 4G9HA 4ML6A 1WP0A 3A5WA 4HU9A 1HNCA 4IW9A 4PNFA 1SK0A 2WVXA 1GSUA 5HFIA 5IMZA 3Q6OA 1A2LA 2B5XA 1ZYPA 2OE0A 4NPBA 3RDWA 1O8WA 3TDGA 2N5BA 1MDJA 2A2PA 2L5LA 2OBKA 3CRTA 4EF0A 2YN1A 1FHEA 3FR3A 2C80A 3UVTA 2J23A 4MMMA
chains in the Genus database with same CATH topology
2XPEA 2XC2A 1Z5YE 4IGJA 2ALBA 5HR1A 2CZ3A 2H1AA 1K0NA 2KOKA 5F07A 3EE2A 4MLYA 4TXVA 3VI7A 1GP1A 2QGVA 2FCHA 3EURA 1GUKA 1EP8A 5G31A 3BD2A 4Z2RA 1F37A 1TI3A 2DJ1A 2OT3A 3BOAA 1GSSA 1J0FA 4GQCA 2EC4A 1G0TA 2LRCA 3LYPA 2K8SA 2CQ9A 2K9FA 1K0DA 2B6MA 1SK2A 2CVBA 1PGTA 5G2ZA 3H93A 2GGTA 4OFTA 3ZYWA 3VLNA 3R3EA 4MH2A 3BCIA 2R3XA 3TOTA 5GSSA 4AKIA 1FG4A 6GSSA 3PH9A 1MDIA 4WBRD 2CV4A 2N5AA 2PGTA 2WDUA 1YKCA 5DQSA 4XS4B 4ZXGA 2HSYA 5A1NA 4QMKA 3F6FA 4D73A 1OC9B 3KP8A 3TKSE 5LCZA 3I69A 4BA7A 4YKFA 3H79A 3GH6A 3ZTLA 3WT1A 1THOA 4TW5A 1N8JA 2ON5A 2MZCA 2FWFA 1T7PB 2GVPA 1B8XA 3UVHA 1SL0B 2VAFA 11GSA 1PKWA 5HR0A 2H66A 2B7JA 3GV1A 5D9WA 2RUEA 4MPGA 2DKIA 1XW6A 1A23A 1R7HA 3GKNA 1SJ6A 2H1DA 2H71A 2H73A 1G7OA 1JZDA 2O8VB 1MEKA 2KUCA 2GZPA 4NV2A 1EP7A 2B7KA 1A24A 4WXTA 4Q5QA 2LRTA 2QA1A 2M72A 4JE1A 2LQOA 5DAKB 3FZAA 2RM6A 3C73A 1YQ1A 2VCXA 5DJMA 3APSA 1NSWA 3TJBA 2DC5A 3VURA 3TGZA 4JRRA 1K3LA 3N9JA 4IBPA 4G0LA 3TUEA 1I9DA 2OE3A 2VLTA 3ZREA 3G9BA 4RI7A 2HSNA 1GTUA 4TVEA 1G6WA 2V6OA 4RQXA 3Q74A 2L57A 3PGTA 20GSA 2LNSA 2DJ3A 3MWHA 4MZBA 2CVDA 3M0FA 2V2GA 1M0UA 1Q4JA 5ECIB 4FH8A 4ZB7A 5JCUA 3ZFLA 4ID0A 1CQGA 2KP1A 3KMOA 3QD9A 5IPGA 2DSAA 3TJFA 1B9YC 2B5EA 2C3QA 4OFMA 4XTSA 2JL4A 1XW9A 2LV3A 5B8BA 4PTSA 4HDEA 2VLUA 3GL5A 5HFKA 3QAVA 2VUPA 4MH3A 2H72A 4KX4A 4EVMA 1M2AA 5HFGA 2A4HA 1V98A 1O7UA 5A5HA 1Y6EA 5HQPA 4GTUA 2HRNA 2PU9C 4Z7XA 2E7PA 5IO2A 2P0GA 2GLRA 3SWLA 4WF5A 5J4VA 3UIWA 3GA4A 3HCZA 4KW6A 1XCCA 4XHMA 5ECHB 5EL8A 3D21A 5DCHA 4LMVA 3MSZA 3WGXA 3LFLA 4ZBBA 5A1NB 1EWXA 2H74A 1YF1A 4K0NA 4D73B 1K0OA 1K0AA 4EXJA 1YVLA 1PA3A 4BVYA 2B1KA 1XFLA 1R5PA 2IJYA 2R2JA 4YQMA 1ZZYA 4P3YB 1DUGA 4G19A 2M46A 4ACSA 5BRTA 5J5NA 3HHVA 3EINA 4N0ZA 3QR6A 3PR8A 5D9TA 4AI6A 3EYTA 3HZ8A 1DE1A 2WGRA 4I8BA 2IL3A 4WR5A 4HZ4A 4Q5NA 2LJRA 5HR2A 3GN3A 2DBCA 4F0BA 1SVOA 3KTBA 4AF2A 1PX7A 2FUG2 3KGKA 3LW9A 4V1Ap 1IYIA 5E4WA 1GL8A 3D22A 3KIJA 5A5KA 1NHOA 3IDVA 2FLSA 3DIEA 4BWQA 1OVNA 5ELAA 4KSMA 1GSYA 4KCEA 1PRXA 1F3AA 2GQLA 2HYXA 2YNXA 2JU5A 2RUFA 5KEJA 2GQMA 3HVSA 2L6DA 1PD21 2PBJA 1W89A 4CY6A 4E8HA 1O85A 3SBCA 1G7EA 4N30A 1WWJA 2HSNB 3MDKA 1YKAA 3Q19A 4K2XA 5DBQA 1X5CA 1X5EA 1VF3A 2OADA 3FHKA 4JZQA 4DSRA 1TU7A 5C00A 1U87A 6GSXA 1BG1A 3CYNA 3HD5A 5EVOA 4GXZA 1AAZA 3M3MA 3FR6A 5COHA 2H70A 3HY2A 4K7NA 2IPAA 2F8FA 1XPVA 2VD0A 1UN2A 3E9JB 3O76A 5JCGA 1H75A 5IPHA 4YQVA 5G1KA 1SKWB 1MD3A 1PN9A 4I97A 5A4UA 3P7XA 2AB6A 2JACA 3DKSA 4KDUA 5IM9A 3TJJA 1KNGA 1A2JA 1F9MA 2GZZA 3ZRDA 1R26A 4FYUA 2F9SA 5A5HB 1PL1A 2C4JA 3G7IA 2CVKA 1BX9A 5INYA 3TRXA 3QFBC 1M9AA 3TJKA 4JU5A 19GSA 1I5GA 1E2YA 3LG6A 3DMLA 4OCEA 1E6BA 1GLPA 5EPFA 1K0MA 4BVYB 3ME8A 1MD4A 1WJKA 3L9VA 2QA2A 1TDIA 2R0CA 3CSHA 2YWMA 2DMLA 1U6TA 3GYKA 1GH2A 4ZIJA 1OKTA 1TK5B 16GSA 2EFHA 4EE0A 2I81A 2HXKA 1AIUA 3KJYA 1XWBA 3DWVA 5C04A 3IHGA 2G2QA 2G0FA 3F4RA 5H5SA 3TJGA 4L0UA 1GULA 1Y25A 5B6MA 1GTBA 5AN1A 2GSRA 4PNGA 3IR4A 2VCVA 3FMWA 3F6DA 1V40A 3GMFA 1SL2B 3VWVA 3GSTA 4Z2TA 3WGEA 3KD0A 4J56E 3HMJG 4TR3A 4N0VA 3GRXA 1PX6A 4YKGA 1O8XA 2WZ9A 3UBKA 2YV7A 1OYJA 1EEJA 4KSOA 2VCWA 5G5EA 3US3A 1RQMA 3DVXA 2BJXA 5DVBA 3KMNA 3QMXA 1YJ6A 4O32A 5J4UA 4I2TA 1A2MA 1Z9HA 3VWWA 5KN2A 2QC7A 1KBNA 1F2EA 3MNGA 4PURA 1YDKA 1FAAA 1X5DA 4OWYA 3L9UA 5ENUA 2YWIA 1TTZA 1XWCA 4EIQA 4YAVA 2V32A 1X9SB 2H1LA 2JADA 1T4YA 2GDRA 4V2MA 3ZL5A 4MABA 1BJXA 3A2WA 5G30A 3IC4A 2HLSA 3FZ9A 5JWQB 2VL2C 3GSSA 4G0KA 4K8MA 4RQRA 1YF0A 1UVZA 4OO4A 1QFNA 5ID2A 2UZ8A 3F3RA 1JZWA 4MZWA 5H5RA 4KUNA 4IP1A 2C3TA 2CAIA 3K8NA 6GSYA 2C8UA 5IMCA 1WPIA 1XBSA 4LA1A 3N5OA 5D9XA 4KF9A 3PINA 1WRYA 3HJOA 4PUFC 3GH9A 5KOWA 1EV9A 4HUAA 4RI6A 5DQYA 2PUKC 3BBYA 5IOXA 3F4SA 4CW9A 3GHAA 1LU4A 2O87A 4MNNA 1OC8A 2A4VA 4F03A 5A34A 3R2QA 5ECKB 4ECBA 1X0RA 2K18A 5ECQB 4EDZA 4LL1B 1AC1A 3C1SA 3O6TA 1SU9A 5CYYA 3F8UA 1VF1A 1QGVA 1FOHA 4TKYA 1Z6MA 2GSQA 1THXA 4ZILA 1PMTA 5FWGA 3D6IA 2XHFA 2TRXA 3DXBA 5IMFA 3F9UA 2K8VA 2NBSA 3HYPA 4O5RA 2D2ZA 4X4JA 12GSA 1YEXA 1WIKA 1Q98A 2DJ2A 1JLVA 2RM5A 3LEFA 3BCKA 4ECCA 2MMOA 1URMA 3DGQA 1FVJA 2JZTA 4WEYA 1O73A 2MBSA 5B6NA 1XWAA 4MDCA 2GTUA 1BYEA 4TRXA 4EO3A 3FKFA 4OO5A 3QFAC 2DJ0A 1KEBA 2ZNMA 4GF0A 2A2RA 1GUHA 2WRTA 3TKSC 1TOFA 2H0GA 5CREA 3LXZA 5J47A 1ZYEA 1N25A 2NDOA 4ECIA 2X64A 4O7HA 1H4OA 4PX1A 3L9SA 3ERWA 4BPYA 1XOAA 2H30A 1T8EB 3JCML 3CXGA 4GSSA 1A0FA 3GTUA 5JWOB 5G1LA 2X4AA 3KCMA 4XIHA 1GRXA 3ZMKA 4POKA 2CA8A 4KDYA 2TIRA 2LRNA 1GSFA 4Z2UA 2WFCA 5J3RA 3DRNA 4N11A 4EIPA 4KH7A 4GSTA 2O7KA 5F05A 2YP6A 3GUSA 4ZB9A 1DBYA 3GFKA 2XBIA 5ECPB 3RHCA 1RK4A 1S3CA 3EVIA 3EMXA 2XBQA 3CRUA 2R6KA 4J57E 2V6KA 1BQ7A 5JWRB 3W8SA 3LQ7A 5ID2B 1GUMA 4AKXB 1XOBA 1QUWA 2OACA 3GKMA 3UEMA 2PMTA 1X9MB 1N2AA 4PXOA 5GZZB 3F63A 4DSSA 4PGTA 3C7MA 3HZ4A 2KP2A 5A34B 4QL7A 4O5UA 4MK3A 4HEA2 3ERFA 4TOPA 4HS1A 4POLA 1WMJA 1HQOA 2ZCTA 2FNOA 1XWGA 6GSWA 1U3AA 2IMFA 5GAPD 5DJLA 5D9VA 4AKHA 1ERWA 4EC0A 1PSQA 2PVOC 2I9HA 2AAWA 6GSVA 2MMNA 1EOHA 3CBUA 3LYKA 2YZHA 2J9HA 3GKKA 2C0FA 4X0XA 5DALA 2P5RA 2X8CA 2MMAA 4LL4B 4TR1A 5L71A 3TU3B 2PERA 1B9XC 2HSMA 4AKGA 1Z7PA 3I43A 4GRFA 3EWLA 1NW2A 5IOWA 4GDFA 3VPQA 13GSA 4I6XA 2DKHA 4F0CA 2R0GA 3BJ5A 1JZRA 2H8LA 4F82A 2F8AA 4ZB6A 4CHSA 1VGLA 4NWYA 4K1FA 1UC7A 2JZRA 3QPMA 4CDOA 4H86A 3LJRA 3UL3A 3C8EA 3IPZA 5KN3A 1XVQA 3A5IA 3CWGA 3ERGA 1DSBA 3HDCA 2H0HA 1AUCA 1A8YA 2PWJA 5CO3A 3QAWA 2VKZG 3H4KA 1EOGA 4IHUA 4MP4A 1O81A 1TRSA 4POMA 1HD2A 1QK8A 1CQHA 2H76A 3I9V2 2TRCP 4KGIA 14GSA 1ZL9A 2P31A 2GT5A 5ECMB 2DIYA 4IS0A 1TU8A 2JZSA 2CT6A 5AIVA 3HJMA 4L5OA 2B3SA 2I4AA 1TRUA 3F3QA 4AGSA 4MF6A 4PQIA 2VL9A 2HRAA 2H01A 4X43A 4MJCA 3KEBA 2VL2A 5J9BA 4NMUA 4ZL7A 2RIIA 2DMMA 2ES7A 4EUYA 4EDYA 1M7TA 1V2AA 4E68A 5CRGA 2YV9A 1G6YA 2DJKA 2NTOA 4TN8A 4NAXA 4AJ8A 5BMUA 2EFCA 3UBLA 4KA0A 4HI7A 1LJRA 1M99A 3J7Yb 4DSSB 2VO4A 4TR0A 2VCZA 2L5OA 3ZIVA 2B1LA 4JR6A 5F06A 5D73A 1EZKA 4XRDA 1B48A 3KZQA 3ED3A 3U6VA 2I1UA 4JBBA 2HZFA 1NM3A 5F8BA 1SVLA 1EGOA 3G7YA 4L5LA 3GL3A 1VF4A 1F6MC 2YOIA 2IMKA 2O5VA 3M8NA 3TKPA 2R0PA 1GWCA 3IOSA 4HU7A 5DALB 5DCGA 3FYGA 2EIQA 2PN8A 4IQAA 3ZLPA 4TR1B 1ERTA 4E8EA 5ABRA 1ZOFA 2X8GA 4KE3A 4MF5A 2HSMB 1TXUA 4IJIA 2V1MA 1QXHA 2KHPA 2QSIA 2LJKA 5F0GA 3ZVJD 3RPNA 2FA4A 3IXRA 4MJBA 2PVQA 4WF4A 4NXIA 2HRFA 1O6JA 1GNWA 4CY8A 4L8EA 2CZ2A 3GX8A 3HVXA 5GAND 2E0QA 2GT6A 7GSSA 5LNKe 1XWKA 5B7CA 4MCUA 1J08A 5D8IA 3TKSA 2H6XA 1NHYA 2WS2A 3CTFA 4BWSA 3G7JA 1UA5A 5JCWA 4L0WA 3Q18A 3TKQA 3E3EA 1B4QA 5IQYA 5IIZA 1A8LA 2IMDA 2C3NA 4NHWA 5CP1A 1C72A 1GSQA 3FR9A 2L4QA 5A4VA 1Z7RA 2EFDA 4OCFA 4YQUA 4DVCA 3IHQA 3IA1A 5DAKA 3EMPA 1Y1UA 3MAKA 5KOXA 3HKRA 2EIOA 2VIMA 1EGRA 1RW1A 5H5QA 4IVFA 5DDLA 5ECSA 4TXOA 4WETA 2REMA 4GQFA 1FO5A 3O3TA 3L78A 1BEDA 3C1RA 1TK0B 4X1UA 5CAXA 1ACVA 1BG5A 4MA9A 2YCDA 1SJZA 4WKWA 3ME7A 4F9ZA 1PKZA 2H75A 3TRPA 2K6VA 5BMUB 4N10A 3FRCA 4NHZA 1K0CA 3MIXA 4ICYA 3J7Yk 3ZIJA 4WR4A 2IFQA 2ON7A 2LNTA 5AISA 1J9BA 4ILFA 2H1BA 1YEPA 4PUAA 2DIZA 2L4CA 1U88A 3IRAA 3LGCA 3KP9A 3EU3A 3U5RE 3A2VA 3FK8A 4V2NA 3QAGA 2OA7A 3ZMLA 3KH7A 2GS3A 2HT9A 4O5QA 4JR4A 1FOVA 5ECOB 4G2EA 1BF5A 2AV4A 3UOMA 1V58A 3RBTA 3QOUA 3FW2A 2C0DA 1TKDB 4JEDA 4MJEA 2LJAA 5KN1A 5CRDA 2JSZA 3P2AA 1OC3A 1MTCA 2H1GA 2YJHA 1A0RP 3P8WA 5EY6A 4TR4A 3FZ5A 1XXUA 2DLXA 2F3MA 2FWHA 1TK8B 1FB0A 1SD8A 1AXDA 2YWOA 2FA8A 2WCIA 3IK9A 2L59A 1ZMAA 4KDXA 1FW1A 4PQ1A 3ZZXA 4ZBDA 2VM2A 3VPTA 5HR3A 3D5JA 4I5QA 1SYXA 2HNLA 1AQWA 4HZ2A 18GSA 1TRWA 1WE0A 3C71A 1KTEA 3EC3A 4F2IA 4LLRA 2LUSA 3P90A 3ZFBA 2WJUA 4W66A 1T1VA 4LMWA 1TRVA 1QQ2A 3EPTA 1ST9A 3APQA 2N5FA 2I3YA 3CTGA 1SJIA 2HRKA 2C0GA 1FVKA 3HA9A 1ON4A 2HE3A 2X49A 4K5SA 1ZGNA 1ZYQB 1WOUA 1SL1B 1T4ZA 1ABAA 4MJAA 1XIYA 2C0EA 2LTKA 3LWAA 2UV8G 1FB6A 4IELA 4K5RA 1TP9A 3E0UA 4HJMA 1SVMA 2WB9A 3TOUA 1K3YA 4FYBA 5IO0A 2OBIA 3UMAA 2CX4A 4ZB8A 1M2BA 2MMZA 3A2XA 3EU4A 4TXOB 1MDKA 1JZOA 4ECJA 3DVWA 1QMVA 2AHEA 2AYTA 3DYRA 5KN0A 2CAQA 3CSJA 4PQHA 4KAEA 2NPBA 3DD3A 1K3OA 2VD1A 4GWRA 2ZUPA 3IBHA 2F51A 4BVXA 1XZOA 1M9BA 8GSSA 2GQKA 1ERVA 4K7OA 3GIXA 1Z3EA 2IFQB 10GSA 2FWEA 1IYHA 5AGYA 2M80A 4K6XA 3QCPA 5ECRB 5J9CA 2BTOT 2IN3A 4IKHA 5ELGA 1EV4A 4GSNA 2GSSA 4HJ2A 4XS6A 3L0HA 4ISDA 2CX3A 2QKEA 4XCSA 4YH2A 4HOJA 4AJ6A 1GTAA 1SYRA 2IMEA 4Q5FA 4EKZA 2L6CA 3ZVJA 4DEJA 4I2UA 1T00A 1ZCPA 1Z6NA 2FWGA 2O89A 3HXSA 2FY6A 3S9FA 3NZNA 4N3ZA 3F0IA 2NVLA 1AQXA 5GSTA 3DEXA 2MYGA 4BL7A 4K0GA 5G5FA 1HYUA 2HFDA 1TI1A 3OR5A 4YAPA 1PQNA 2VCTA 4FO5A 1ZYNA 4HQZA 1SKRB 3UAPA 3KM6A 2Z9SA 4KNDA 4WBJA 4USSA 3TB2A 3PPUA 1OAZA 5IMAA 3RPPA 5B8AA 3GURA 2IMIA 2H19A 4RUVA 22GSA 4ZL8A 2EFEA 1DE2A 2GZYA 2H0IA 2VL3A 4IQ1A 4MPFA 1VRSD 2A2SA 2HRKB 2HZEA 3RHBA 5E59A 3LXTA 4HQSA 4IN0A 4FYCA 4QQ7A 1XVWA 4OMVA 2GSTA 5LD0A 1PN0A 1GTIA 5J41A 4V2LA 2MBTA 1EEMA 3IC8A 1PL2A 2PPTA 5FHIA 1S3DA 3MYDA 4FQUA 5D96A 1SENA 4XRAA 1AW9A 3WGDA 4G10A 2RLIA 1R4WA 3H1NA 4G01A 4ULXA 2H6ZA 2IWTA 2X99A 3H8QA 5IMVA 3GTUB 4MZCA 3IV4A 17GSA 5ECNB 1LBKA 3VK9A 2EIRA 1B4PA 3IE3A 2LQQA 1X9WB 3CMIA 3D4TA 3FZ4A 1V9WA 4EL1A 3A3TA 4ML1A 3KXOA 3IAS2 1ERUA 4DSQA 2VM1A 3HVVA 5CRHA 1TJDA 1XW5A 2LS5A 3D4MA 2YWNA 4BVXB 3L4NA 3NOFA 2E2GA 3GKXA 1YY7A 3TCOA 3IK7A 1HNAA 1ILOA 5J4YA 3FEUA 4K7IA 4NV5A 2JSYA 2R37A 2KLXA 2FHEA 3M1GA 3ZITA 1SK1A 3HJPA 4ZBAA 1OKDA 2DJJA 3M9KA 3VWUA 1R5AA 1SD9A 5CRWA 3UARA 1S3AA 3VFIA 5CNWA 3NIVA 1HNBA 1VF2A 3UJ1A 4K9ZA 4IP6A 3I6AA 4GCIA 2O85A 3V1WA 2HSHA 2LKUA 4FIWA 3KTLA 3IAM2 1M2DA 2VCQA 4IJ3A 2OJLA 1ML6A 2E2MA 3QDNA 4G0IA 4KCAA 3WYWA 5IMDA 9GSSA 2LSTA 1K0BA 3WD6A 2LEGA 2IIYA 3TKRA 1W4VA 4QL9A 2VOCA 4KB3A 2R4VA 5ECLB 1JHBA 2XPDA 4OD7A 2R5GA 2AJQB 2YANA 4BL7B 2H6YA 3LORA 3F4TA 1GLQA 1SKSB 6GSTA 1TXXA 3D0ZA 4K2DA 3M9JA 3W8JA 3VWXA 1F3BA 3KH9A 1T3BA 2VLVA 2V41A 3RAZA 3GNJA 1GSEA 1TW9A 2HI7A 2OKAA 4XS4A 4AJ7A 4Q5RA 3AY8A 2BMXA 2YJ7A 4V1Ag 2WULA 4GLTA 3GX0A 4J2FA 1OE7A 3FY7A 1OC9A 4OFNA 2C1YA 2OE1A 1GSDA 2HZEB 2X8HA 2B5YA 1V57A 4XS1A 5D93A 3WT2A 4POBA 2YPMA 3W6GA 2YZUA 1JFUA 3CSIA 2AUVA 2FGXA 4A5PA 2HQTA 1BAYA 3LSZA 1AQVA 1OE8A 5J40A 1JLWA 5AIXA 6GSUA 4O92A 3VI5A 4MF7A 3TRQA 5A4WA 5FT3A 2FD3A 1YZXA 4ZL9A 3APOA 3ISOA 2P5QA 1U3IA 1USBA 1GNEA 4G9HA 4ML6A 1WP0A 3A5WA 4HU9A 1HNCA 4IW9A 4PNFA 1SK0A 5IMZA 1GSUA 5HFIA 3Q6OA 1A2LA 2B5XA 1ZYPA 2OE0A 4NPBA 3RDWA 1O8WA 3TDGA 2N5BA 1MDJA 2A2PA 2L5LA 2OBKA 3CRTA 4EF0A 2YN1A 1FHEA 3FR3A 2C80A 3UVTA 2J23A 4MMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPE A;  2XC2 A;  1Z5Y E;  4IGJ A;  2ALB A;  5HR1 A;  2CZ3 A;  2H1A A;  1K0N A;  2KOK A;  5F07 A;  3EE2 A;  4MLY A;  4TXV A;  3VI7 A;  1GP1 A;  2QGV A;  2FCH A;  3EUR A;  1GUK A;  1EP8 A;  5G31 A;  3BD2 A;  1F37 A;  1TI3 A;  2DJ1 A;  3BOA A;  1GSS A;  1J0F A;  4GQC A;  2EC4 A;  1G0T A;  2LRC A;  3LYP A;  2K8S A;  2CQ9 A;  2K9F A;  1K0D A;  2B6M A;  1SK2 A;  2CVB A;  1PGT A;  5G2Z A;  3H93 A;  2GGT A;  4OFT A;  3ZYW A;  3VLN A;  3R3E A;  4MH2 A;  3BCI A;  2R3X A;  3TOT A;  5GSS A;  1FG4 A;  6GSS A;  3PH9 A;  1MDI A;  4WBR D;  2CV4 A;  2N5A A;  2PGT A;  2WDU A;  1YKC A;  5DQS A;  4XS4 B;  4ZXG A;  2HSY A;  3F6F A;  4D73 A;  1OC9 B;  3KP8 A;  3TKS E;  5LCZ A;  3I69 A;  4BA7 A;  3H79 A;  3GH6 A;  3ZTL A;  3WT1 A;  1THO A;  4TW5 A;  1N8J A;  2ON5 A;  2MZC A;  2FWF A;  1T7P B;  2GVP A;  1B8X A;  3UVH A;  1SL0 B;  2VAF A;  11GS A;  1PKW A;  5HR0 A;  2H66 A;  2B7J A;  3GV1 A;  5D9W A;  2RUE A;  4MPG A;  1XW6 A;  1A23 A;  1R7H A;  3GKN A;  1SJ6 A;  2H1D A;  2H71 A;  2H73 A;  1G7O A;  1JZD A;  2O8V B;  1MEK A;  2KUC A;  2GZP A;  4NV2 A;  1EP7 A;  2B7K A;  1A24 A;  4WXT A;  4Q5Q A;  2LRT A;  2M72 A;  4JE1 A;  2LQO A;  5DAK B;  3FZA A;  2RM6 A;  3C73 A;  1YQ1 A;  2VCX A;  5DJM A;  3APS A;  1NSW A;  3TJB A;  2DC5 A;  3VUR A;  3TGZ A;  4JRR A;  1K3L A;  3N9J A;  4IBP A;  4G0L A;  3TUE A;  1I9D A;  2OE3 A;  2VLT A;  3ZRE A;  3G9B A;  4RI7 A;  1GTU A;  4TVE A;  1G6W A;  2V6O A;  4RQX A;  3Q74 A;  2L57 A;  3PGT A;  20GS A;  2LNS A;  2DJ3 A;  3MWH A;  4MZB A;  2CVD A;  3M0F A;  2V2G A;  1M0U A;  1Q4J A;  5ECI B;  4FH8 A;  5JCU A;  3ZFL A;  4ID0 A;  1CQG A;  2KP1 A;  3KMO A;  3QD9 A;  5IPG A;  2DSA A;  3TJF A;  1B9Y C;  2B5E A;  2C3Q A;  4OFM A;  4XTS A;  2JL4 A;  1XW9 A;  2LV3 A;  5B8B A;  4PTS A;  4HDE A;  2VLU A;  3GL5 A;  5HFK A;  3QAV A;  2VUP A;  4MH3 A;  2H72 A;  4KX4 A;  4EVM A;  1M2A A;  5HFG A;  1V98 A;  1O7U A;  1Y6E A;  5HQP A;  4GTU A;  2HRN A;  2PU9 C;  4Z7X A;  2E7P A;  5IO2 A;  2P0G A;  2GLR A;  3SWL A;  4WF5 A;  3UIW A;  3GA4 A;  3HCZ A;  4KW6 A;  1XCC A;  4XHM A;  5ECH B;  5EL8 A;  3D21 A;  5DCH A;  4LMV A;  3MSZ A;  3WGX A;  3LFL A;  4ZBB A;  1EWX A;  2H74 A;  1YF1 A;  4K0N A;  4D73 B;  1K0O A;  1K0A A;  4EXJ A;  4BVY A;  1PA3 A;  2B1K A;  1XFL A;  1R5P A;  2IJY A;  2R2J A;  4YQM A;  1ZZY A;  4P3Y B;  1DUG A;  4G19 A;  2M46 A;  4ACS A;  5J5N A;  3HHV A;  3EIN A;  4N0Z A;  3QR6 A;  3PR8 A;  5D9T A;  3EYT A;  3HZ8 A;  1DE1 A;  2WGR A;  4I8B A;  2IL3 A;  4WR5 A;  4HZ4 A;  4Q5N A;  2LJR A;  5HR2 A;  3GN3 A;  2DBC A;  4F0B A;  3KTB A;  4AF2 A;  1PX7 A;  2FUG 2;  3KGK A;  4V1A p;  1IYI A;  5E4W A;  1GL8 A;  3D22 A;  3KIJ A;  5A5K A;  1NHO A;  3IDV A;  2FLS A;  3DIE A;  4BWQ A;  1OVN A;  5ELA A;  4KSM A;  1GSY A;  4KCE A;  1PRX A;  1F3A A;  2GQL A;  2HYX A;  2YNX A;  2JU5 A;  2RUF A;  5KEJ A;  2GQM A;  3HVS A;  2L6D A;  1PD2 1;  2PBJ A;  1W89 A;  4E8H A;  1O85 A;  3SBC A;  1G7E A;  4N30 A;  1WWJ A;  2HSN B;  3MDK A;  1YKA A;  3Q19 A;  5DBQ A;  1X5C A;  1X5E A;  1VF3 A;  2OAD A;  3FHK A;  4JZQ A;  4DSR A;  1TU7 A;  5C00 A;  1U87 A;  6GSX A;  3CYN A;  3HD5 A;  5EVO A;  4GXZ A;  1AAZ A;  3M3M A;  3FR6 A;  5COH A;  2H70 A;  3HY2 A;  4K7N A;  2IPA A;  2F8F A;  1XPV A;  2VD0 A;  1UN2 A;  3E9J B;  3O76 A;  5JCG A;  1H75 A;  5IPH A;  4YQV A;  5G1K A;  1SKW B;  1MD3 A;  1PN9 A;  4I97 A;  5A4U A;  3P7X A;  2AB6 A;  2JAC A;  3DKS A;  4KDU A;  5IM9 A;  3TJJ A;  1KNG A;  1A2J A;  1F9M A;  2GZZ A;  3ZRD A;  1R26 A;  4FYU A;  2F9S A;  1PL1 A;  2C4J A;  3G7I A;  2CVK A;  1BX9 A;  5INY A;  3TRX A;  3QFB C;  1M9A A;  3TJK A;  4JU5 A;  19GS A;  1I5G A;  1E2Y A;  3LG6 A;  3DML A;  4OCE A;  1E6B A;  1GLP A;  5EPF A;  1K0M A;  4BVY B;  3ME8 A;  1MD4 A;  1WJK A;  3L9V A;  1TDI A;  3CSH A;  2YWM A;  2DML A;  1U6T A;  3GYK A;  1GH2 A;  4ZIJ A;  1OKT A;  1TK5 B;  16GS A;  4EE0 A;  2I81 A;  2HXK A;  1AIU A;  3KJY A;  1XWB A;  3DWV A;  5C04 A;  2G2Q A;  2G0F A;  3F4R A;  5H5S A;  3TJG A;  4L0U A;  1GUL A;  1Y25 A;  5B6M A;  1GTB A;  5AN1 A;  2GSR A;  4PNG A;  3IR4 A;  2VCV A;  3F6D A;  1V40 A;  3GMF A;  1SL2 B;  3VWV A;  3GST A;  3WGE A;  3KD0 A;  4J56 E;  4TR3 A;  4N0V A;  3GRX A;  1PX6 A;  1O8X A;  2WZ9 A;  3UBK A;  2YV7 A;  1OYJ A;  1EEJ A;  4KSO A;  2VCW A;  5G5E A;  3US3 A;  1RQM A;  3DVX A;  2BJX A;  5DVB A;  3KMN A;  3QMX A;  1YJ6 A;  4O32 A;  5J4U A;  4I2T A;  1A2M A;  1Z9H A;  3VWW A;  5KN2 A;  2QC7 A;  1KBN A;  1F2E A;  3MNG A;  4PUR A;  1YDK A;  1FAA A;  1X5D A;  4OWY A;  3L9U A;  5ENU A;  2YWI A;  1TTZ A;  1XWC A;  4YAV A;  2V32 A;  1X9S B;  2JAD A;  1T4Y A;  2GDR A;  4V2M A;  3ZL5 A;  4MAB A;  1BJX A;  3A2W A;  5G30 A;  3IC4 A;  2HLS A;  3FZ9 A;  5JWQ B;  2VL2 C;  3GSS A;  4G0K A;  4K8M A;  4RQR A;  1YF0 A;  1UVZ A;  4OO4 A;  1QFN A;  5ID2 A;  2UZ8 A;  3F3R A;  1JZW A;  4MZW A;  5H5R A;  4KUN A;  4IP1 A;  2C3T A;  2CAI A;  3K8N A;  6GSY A;  2C8U A;  5IMC A;  1WPI A;  1XBS A;  4LA1 A;  3N5O A;  5D9X A;  4KF9 A;  3PIN A;  1WRY A;  3HJO A;  4PUF C;  3GH9 A;  1EV9 A;  4HUA A;  4RI6 A;  5DQY A;  2PUK C;  3BBY A;  5IOX A;  3F4S A;  4CW9 A;  3GHA A;  1LU4 A;  2O87 A;  1OC8 A;  2A4V A;  4F03 A;  3R2Q A;  5ECK B;  4ECB A;  1X0R A;  2K18 A;  5ECQ B;  4EDZ A;  4LL1 B;  1AC1 A;  3C1S A;  3O6T A;  1SU9 A;  5CYY A;  3F8U A;  1VF1 A;  1QGV A;  4TKY A;  1Z6M A;  2GSQ A;  1THX A;  4ZIL A;  1PMT A;  5FWG A;  3D6I A;  2XHF A;  2TRX A;  3DXB A;  5IMF A;  3F9U A;  2K8V A;  2NBS A;  3HYP A;  4O5R A;  2D2Z A;  12GS A;  1YEX A;  1WIK A;  1Q98 A;  2DJ2 A;  1JLV A;  2RM5 A;  3LEF A;  3BCK A;  4ECC A;  2MMO A;  1URM A;  3DGQ A;  1FVJ A;  2JZT A;  4WEY A;  1O73 A;  2MBS A;  5B6N A;  1XWA A;  4MDC A;  2GTU A;  1BYE A;  4TRX A;  4EO3 A;  3FKF A;  4OO5 A;  3QFA C;  2DJ0 A;  1KEB A;  2ZNM A;  4GF0 A;  2A2R A;  1GUH A;  2WRT A;  3TKS C;  1TOF A;  2H0G A;  5CRE A;  3LXZ A;  1ZYE A;  2NDO A;  4ECI A;  2X64 A;  4O7H A;  1H4O A;  4PX1 A;  3L9S A;  3ERW A;  4BPY A;  1XOA A;  2H30 A;  1T8E B;  3JCM L;  3CXG A;  4GSS A;  1A0F A;  3GTU A;  5JWO B;  5G1L A;  3KCM A;  4XIH A;  1GRX A;  3ZMK A;  4POK A;  2CA8 A;  4KDY A;  2TIR A;  2LRN A;  1GSF A;  2WFC A;  5J3R A;  3DRN A;  4N11 A;  4KH7 A;  4GST A;  2O7K A;  5F05 A;  2YP6 A;  3GUS A;  4ZB9 A;  1DBY A;  3GFK A;  2XBI A;  5ECP B;  3RHC A;  1RK4 A;  1S3C A;  3EVI A;  3EMX A;  2XBQ A;  3CRU A;  2R6K A;  4J57 E;  2V6K A;  1BQ7 A;  5JWR B;  3W8S A;  3LQ7 A;  5ID2 B;  1GUM A;  1XOB A;  1QUW A;  2OAC A;  3GKM A;  3UEM A;  2PMT A;  1X9M B;  1N2A A;  4PXO A;  5GZZ B;  3F63 A;  4DSS A;  4PGT A;  3C7M A;  3HZ4 A;  2KP2 A;  4QL7 A;  4MK3 A;  4HEA 2;  3ERF A;  4TOP A;  4HS1 A;  4POL A;  1WMJ A;  1HQO A;  2ZCT A;  2FNO A;  1XWG A;  6GSW A;  1U3A A;  2IMF A;  5GAP D;  5DJL A;  5D9V A;  1ERW A;  4EC0 A;  1PSQ A;  2PVO C;  2I9H A;  2AAW A;  6GSV A;  2MMN A;  1EOH A;  3CBU A;  3LYK A;  2YZH A;  2J9H A;  3GKK A;  2C0F A;  4X0X A;  5DAL A;  2P5R A;  2X8C A;  2MMA A;  4LL4 B;  4TR1 A;  5L71 A;  2PER A;  1B9X C;  2HSM A;  1Z7P A;  3I43 A;  4GRF A;  3EWL A;  1NW2 A;  5IOW A;  3VPQ A;  13GS A;  4I6X A;  4F0C A;  3BJ5 A;  1JZR A;  2H8L A;  4F82 A;  2F8A A;  4ZB6 A;  4CHS A;  1VGL A;  4NWY A;  4K1F A;  1UC7 A;  2JZR A;  3QPM A;  4CDO A;  4H86 A;  3LJR A;  3UL3 A;  3C8E A;  3IPZ A;  5KN3 A;  1XVQ A;  3ERG A;  1DSB A;  3HDC A;  2H0H A;  1AUC A;  1A8Y A;  2PWJ A;  5CO3 A;  3QAW A;  3H4K A;  1EOG A;  4IHU A;  4MP4 A;  1O81 A;  1TRS A;  4POM A;  1HD2 A;  1QK8 A;  1CQH A;  2H76 A;  3I9V 2;  2TRC P;  4KGI A;  14GS A;  1ZL9 A;  2P31 A;  2GT5 A;  5ECM B;  2DIY A;  4IS0 A;  1TU8 A;  2JZS A;  2CT6 A;  5AIV A;  3HJM A;  4L5O A;  2B3S A;  2I4A A;  1TRU A;  3F3Q A;  4AGS A;  4MF6 A;  4PQI A;  2VL9 A;  2HRA A;  2H01 A;  4X43 A;  4MJC A;  3KEB A;  2VL2 A;  5J9B A;  4NMU A;  4ZL7 A;  2RII A;  2DMM A;  2ES7 A;  4EUY A;  4EDY A;  1M7T A;  1V2A A;  5CRG A;  2YV9 A;  1G6Y A;  2DJK A;  2NTO A;  4TN8 A;  4NAX A;  4AJ8 A;  5BMU A;  3UBL A;  4KA0 A;  4HI7 A;  1LJR A;  1M99 A;  3J7Y b;  4DSS B;  2VO4 A;  4TR0 A;  2VCZ A;  2L5O A;  3ZIV A;  2B1L A;  4JR6 A;  5F06 A;  5D73 A;  1EZK A;  4XRD A;  1B48 A;  3KZQ A;  3ED3 A;  3U6V A;  2I1U A;  4JBB A;  2HZF A;  1NM3 A;  5F8B A;  1EGO A;  3G7Y A;  4L5L A;  3GL3 A;  1VF4 A;  1F6M C;  2YOI A;  2IMK A;  3M8N A;  3TKP A;  1GWC A;  3IOS A;  4HU7 A;  5DAL B;  5DCG A;  3FYG A;  2EIQ A;  2PN8 A;  4IQA A;  3ZLP A;  4TR1 B;  1ERT A;  4E8E A;  5ABR A;  1ZOF A;  2X8G A;  4KE3 A;  4MF5 A;  2HSM B;  4IJI A;  2V1M A;  1QXH A;  2KHP A;  2QSI A;  2LJK A;  5F0G A;  3ZVJ D;  3RPN A;  2FA4 A;  3IXR A;  4MJB A;  2PVQ A;  4WF4 A;  4NXI A;  2HRF A;  1O6J A;  1GNW A;  4L8E A;  2CZ2 A;  3GX8 A;  3HVX A;  5GAN D;  2E0Q A;  2GT6 A;  7GSS A;  5LNK e;  1XWK A;  5B7C A;  4MCU A;  1J08 A;  5D8I A;  3TKS A;  2H6X A;  1NHY A;  2WS2 A;  3CTF A;  4BWS A;  3G7J A;  1UA5 A;  5JCW A;  4L0W A;  3Q18 A;  3TKQ A;  3E3E A;  1B4Q A;  5IQY A;  5IIZ A;  1A8L A;  2IMD A;  2C3N A;  4NHW A;  5CP1 A;  1C72 A;  1GSQ A;  3FR9 A;  2L4Q A;  5A4V A;  1Z7R A;  4OCF A;  4YQU A;  4DVC A;  3IHQ A;  3IA1 A;  5DAK A;  3EMP A;  3MAK A;  3HKR A;  2EIO A;  2VIM A;  1EGR A;  1RW1 A;  5H5Q A;  4IVF A;  5DDL A;  5ECS A;  4TXO A;  4WET A;  2REM A;  4GQF A;  1FO5 A;  3O3T A;  3L78 A;  1BED A;  3C1R A;  1TK0 B;  4X1U A;  5CAX A;  1ACV A;  1BG5 A;  4MA9 A;  2YCD A;  1SJZ A;  4WKW A;  3ME7 A;  4F9Z A;  1PKZ A;  2H75 A;  3TRP A;  2K6V A;  4N10 A;  3FRC A;  4NHZ A;  1K0C A;  3J7Y k;  3ZIJ A;  4WR4 A;  2IFQ A;  2ON7 A;  2LNT A;  5AIS A;  1J9B A;  4ILF A;  2H1B A;  1YEP A;  4PUA A;  2DIZ A;  2L4C A;  1U88 A;  3IRA A;  3LGC A;  3KP9 A;  3EU3 A;  3U5R E;  3A2V A;  3FK8 A;  4V2N A;  3QAG A;  2OA7 A;  3ZML A;  3KH7 A;  2GS3 A;  2HT9 A;  4JR4 A;  1FOV A;  5ECO B;  4G2E A;  2AV4 A;  3UOM A;  1V58 A;  3RBT A;  3QOU A;  3FW2 A;  2C0D A;  1TKD B;  4JED A;  4MJE A;  2LJA A;  5KN1 A;  5CRD A;  2JSZ A;  3P2A A;  1OC3 A;  1MTC A;  2H1G A;  2YJH A;  1A0R P;  3P8W A;  5EY6 A;  4TR4 A;  3FZ5 A;  1XXU A;  2DLX A;  2F3M A;  2FWH A;  1TK8 B;  1FB0 A;  1SD8 A;  1AXD A;  2YWO A;  2FA8 A;  2WCI A;  3IK9 A;  2L59 A;  1ZMA A;  4KDX A;  1FW1 A;  4PQ1 A;  3ZZX A;  4ZBD A;  2VM2 A;  3VPT A;  5HR3 A;  3D5J A;  4I5Q A;  1SYX A;  2HNL A;  1AQW A;  4HZ2 A;  18GS A;  1TRW A;  1WE0 A;  3C71 A;  1KTE A;  3EC3 A;  4F2I A;  4LLR A;  2LUS A;  3P90 A;  3ZFB A;  2WJU A;  1T1V A;  4LMW A;  1TRV A;  1QQ2 A;  1ST9 A;  3APQ A;  2N5F A;  2I3Y A;  3CTG A;  1SJI A;  2HRK A;  2C0G A;  1FVK A;  3HA9 A;  1ON4 A;  2HE3 A;  1ZGN A;  1ZYQ B;  1WOU A;  1SL1 B;  1T4Z A;  1ABA A;  4MJA A;  1XIY A;  2C0E A;  2LTK A;  3LWA A;  1FB6 A;  4IEL A;  1TP9 A;  3E0U A;  4HJM A;  2WB9 A;  3TOU A;  1K3Y A;  4FYB A;  5IO0 A;  2OBI A;  3UMA A;  2CX4 A;  4ZB8 A;  1M2B A;  2MMZ A;  3A2X A;  3EU4 A;  4TXO B;  1MDK A;  1JZO A;  4ECJ A;  3DVW A;  1QMV A;  2AHE A;  2AYT A;  3DYR A;  5KN0 A;  2CAQ A;  3CSJ A;  4PQH A;  4KAE A;  2NPB A;  3DD3 A;  1K3O A;  2VD1 A;  4GWR A;  2ZUP A;  3IBH A;  2F51 A;  4BVX A;  1XZO A;  1M9B A;  8GSS A;  2GQK A;  1ERV A;  4K7O A;  3GIX A;  1Z3E A;  2IFQ B;  10GS A;  2FWE A;  1IYH A;  5AGY A;  2M80 A;  4K6X A;  3QCP A;  5ECR B;  5J9C A;  2BTO T;  2IN3 A;  4IKH A;  5ELG A;  1EV4 A;  4GSN A;  2GSS A;  4HJ2 A;  4XS6 A;  3L0H A;  4ISD A;  2CX3 A;  2QKE A;  4XCS A;  4YH2 A;  4HOJ A;  4AJ6 A;  1GTA A;  1SYR A;  2IME A;  4Q5F A;  4EKZ A;  2L6C A;  3ZVJ A;  4DEJ A;  4I2U A;  1T00 A;  1ZCP A;  1Z6N A;  2FWG A;  2O89 A;  3HXS A;  2FY6 A;  3S9F A;  3NZN A;  3F0I A;  2NVL A;  1AQX A;  5GST A;  3DEX A;  2MYG A;  4BL7 A;  4K0G A;  5G5F A;  1HYU A;  2HFD A;  1TI1 A;  3OR5 A;  4YAP A;  1PQN A;  2VCT A;  4FO5 A;  4HQZ A;  1SKR B;  3UAP A;  3KM6 A;  2Z9S A;  4KND A;  4WBJ A;  4USS A;  3TB2 A;  3PPU A;  1OAZ A;  5IMA A;  3RPP A;  5B8A A;  3GUR A;  2IMI A;  2H19 A;  4RUV A;  22GS A;  4ZL8 A;  1DE2 A;  2GZY A;  2H0I A;  2VL3 A;  4IQ1 A;  4MPF A;  1VRS D;  2A2S A;  2HRK B;  2HZE A;  3RHB A;  5E59 A;  3LXT A;  4HQS A;  4IN0 A;  4FYC A;  4QQ7 A;  1XVW A;  4OMV A;  2GST A;  5LD0 A;  1GTI A;  5J41 A;  4V2L A;  2MBT A;  1EEM A;  3IC8 A;  1PL2 A;  2PPT A;  5FHI A;  1S3D A;  4FQU A;  5D96 A;  1SEN A;  4XRA A;  1AW9 A;  3WGD A;  4G10 A;  2RLI A;  1R4W A;  3H1N A;  4ULX A;  2H6Z A;  2IWT A;  2X99 A;  3H8Q A;  5IMV A;  3GTU B;  4MZC A;  3IV4 A;  17GS A;  5ECN B;  1LBK A;  3VK9 A;  2EIR A;  1B4P A;  3IE3 A;  2LQQ A;  1X9W B;  3CMI A;  3D4T A;  3FZ4 A;  1V9W A;  4EL1 A;  3A3T A;  4ML1 A;  3KXO A;  3IAS 2;  1ERU A;  4DSQ A;  2VM1 A;  3HVV A;  5CRH A;  1TJD A;  1XW5 A;  2LS5 A;  3D4M A;  2YWN A;  4BVX B;  3L4N A;  3NOF A;  2E2G A;  3GKX A;  1YY7 A;  3TCO A;  3IK7 A;  1HNA A;  1ILO A;  3FEU A;  4K7I A;  4NV5 A;  2JSY A;  2R37 A;  2KLX A;  2FHE A;  3M1G A;  3ZIT A;  1SK1 A;  3HJP A;  4ZBA A;  1OKD A;  2DJJ A;  3M9K A;  3VWU A;  1R5A A;  1SD9 A;  5CRW A;  3UAR A;  1S3A A;  3VFI A;  5CNW A;  3NIV A;  1HNB A;  1VF2 A;  3UJ1 A;  4K9Z A;  4IP6 A;  3I6A A;  4GCI A;  2O85 A;  3V1W A;  2HSH A;  2LKU A;  4FIW A;  3KTL A;  3IAM 2;  1M2D A;  2VCQ A;  4IJ3 A;  2OJL A;  1ML6 A;  2E2M A;  3QDN A;  4G0I A;  4KCA A;  3WYW A;  5IMD A;  9GSS A;  2LST A;  1K0B A;  3WD6 A;  2LEG A;  2IIY A;  3TKR A;  1W4V A;  4QL9 A;  2VOC A;  4KB3 A;  2R4V A;  5ECL B;  1JHB A;  2XPD A;  4OD7 A;  2R5G A;  2AJQ B;  2YAN A;  4BL7 B;  2H6Y A;  3LOR A;  3F4T A;  1GLQ A;  1SKS B;  6GST A;  1TXX A;  3D0Z A;  4K2D A;  3M9J A;  3W8J A;  3VWX A;  1F3B A;  3KH9 A;  1T3B A;  2VLV A;  2V41 A;  3RAZ A;  3GNJ A;  1GSE A;  1TW9 A;  2HI7 A;  2OKA A;  4XS4 A;  4AJ7 A;  4Q5R A;  3AY8 A;  2BMX A;  2YJ7 A;  4V1A g;  2WUL A;  4GLT A;  3GX0 A;  4J2F A;  1OE7 A;  3FY7 A;  1OC9 A;  4OFN A;  2C1Y A;  2OE1 A;  1GSD A;  2HZE B;  2X8H A;  2B5Y A;  1V57 A;  4XS1 A;  5D93 A;  3WT2 A;  4POB A;  2YPM A;  3W6G A;  2YZU A;  1JFU A;  3CSI A;  2AUV A;  2FGX A;  2HQT A;  1BAY A;  3LSZ A;  1AQV A;  1OE8 A;  1JLW A;  5AIX A;  6GSU A;  4O92 A;  3VI5 A;  4MF7 A;  3TRQ A;  5A4W A;  5FT3 A;  2FD3 A;  1YZX A;  4ZL9 A;  3APO A;  3ISO A;  2P5Q A;  1U3I A;  1USB A;  1GNE A;  4G9H A;  4ML6 A;  1WP0 A;  3A5W A;  4HU9 A;  1HNC A;  4IW9 A;  4PNF A;  1SK0 A;  5IMZ A;  1GSU A;  5HFI A;  3Q6O A;  1A2L A;  2B5X A;  2OE0 A;  4NPB A;  3RDW A;  1O8W A;  3TDG A;  2N5B A;  1MDJ A;  2L5L A;  2OBK A;  3CRT A;  4EF0 A;  2YN1 A;  1FHE A;  3FR3 A;  2C80 A;  3UVT A;  2J23 A;  4MMM A; 
#chains in the Genus database with same CATH topology
 2XPE A;  2XC2 A;  1Z5Y E;  4IGJ A;  2ALB A;  5HR1 A;  2CZ3 A;  2H1A A;  1K0N A;  2KOK A;  5F07 A;  3EE2 A;  4MLY A;  4TXV A;  3VI7 A;  1GP1 A;  2QGV A;  2FCH A;  3EUR A;  1GUK A;  1EP8 A;  5G31 A;  3BD2 A;  4Z2R A;  1F37 A;  1TI3 A;  2DJ1 A;  2OT3 A;  3BOA A;  1GSS A;  1J0F A;  4GQC A;  2EC4 A;  1G0T A;  2LRC A;  3LYP A;  2K8S A;  2CQ9 A;  2K9F A;  1K0D A;  2B6M A;  1SK2 A;  2CVB A;  1PGT A;  5G2Z A;  3H93 A;  2GGT A;  4OFT A;  3ZYW A;  3VLN A;  3R3E A;  4MH2 A;  3BCI A;  2R3X A;  3TOT A;  5GSS A;  4AKI A;  1FG4 A;  6GSS A;  3PH9 A;  1MDI A;  4WBR D;  2CV4 A;  2N5A A;  2PGT A;  2WDU A;  1YKC A;  5DQS A;  4XS4 B;  4ZXG A;  2HSY A;  5A1N A;  4QMK A;  3F6F A;  4D73 A;  1OC9 B;  3KP8 A;  3TKS E;  5LCZ A;  3HVN A;  3I69 A;  4BA7 A;  4YKF A;  3H79 A;  3GH6 A;  3ZTL A;  3WT1 A;  1THO A;  4TW5 A;  1N8J A;  2ON5 A;  2MZC A;  2FWF A;  1T7P B;  2GVP A;  1B8X A;  3UVH A;  1SL0 B;  2VAF A;  11GS A;  1PKW A;  5HR0 A;  2H66 A;  2B7J A;  3GV1 A;  5D9W A;  2RUE A;  4MPG A;  2DKI A;  1XW6 A;  1A23 A;  1R7H A;  3GKN A;  1SJ6 A;  2H1D A;  2H71 A;  2H73 A;  1G7O A;  1JZD A;  2O8V B;  1MEK A;  2KUC A;  2GZP A;  4NV2 A;  1EP7 A;  2B7K A;  1A24 A;  4WXT A;  2WVX B;  4Q5Q A;  2LRT A;  2QA1 A;  2M72 A;  4JE1 A;  3CQF A;  2LQO A;  5DAK B;  3FZA A;  2RM6 A;  3C73 A;  1YQ1 A;  2VCX A;  5DJM A;  3APS A;  1NSW A;  3TJB A;  2DC5 A;  3VUR A;  3TGZ A;  4JRR A;  1K3L A;  3N9J A;  4IBP A;  4G0L A;  3TUE A;  1I9D A;  2OE3 A;  2VLT A;  3ZRE A;  3G9B A;  4RI7 A;  2HSN A;  1GTU A;  4TVE A;  1G6W A;  2V6O A;  4RQX A;  3Q74 A;  2L57 A;  3PGT A;  20GS A;  2LNS A;  2DJ3 A;  3MWH A;  4MZB A;  2CVD A;  3M0F A;  2V2G A;  1M0U A;  1Q4J A;  5ECI B;  4FH8 A;  4ZB7 A;  5JCU A;  3ZFL A;  4ID0 A;  1CQG A;  2KP1 A;  1PFO A;  3KMO A;  3QD9 A;  5IPG A;  2DSA A;  3TJF A;  1B9Y C;  2B5E A;  2C3Q A;  4OFM A;  4XTS A;  2JL4 A;  1XW9 A;  2LV3 A;  5B8B A;  4PTS A;  4HDE A;  2VLU A;  3GL5 A;  5HFK A;  3QAV A;  2VUP A;  4MH3 A;  2H72 A;  4KX4 A;  4EVM A;  1M2A A;  5HFG A;  2A4H A;  1V98 A;  1O7U A;  5A5H A;  1Y6E A;  5HQP A;  4GTU A;  2HRN A;  2PU9 C;  4Z7X A;  2E7P A;  5IO2 A;  2P0G A;  2GLR A;  3SWL A;  4WF5 A;  5J4V A;  3UIW A;  3GA4 A;  3HCZ A;  4KW6 A;  1XCC A;  4XHM A;  5ECH B;  5EL8 A;  3D21 A;  5DCH A;  4LMV A;  3MSZ A;  3WGX A;  3LFL A;  4ZBB A;  5A1N B;  1EWX A;  2H74 A;  1YF1 A;  4K0N A;  4D73 B;  1K0O A;  1K0A A;  4EXJ A;  1YVL A;  1PA3 A;  4BVY A;  2B1K A;  1XFL A;  1R5P A;  2IJY A;  2R2J A;  4YQM A;  1ZZY A;  4P3Y B;  1DUG A;  4G19 A;  2M46 A;  4ACS A;  5BRT A;  5J5N A;  3HHV A;  3EIN A;  4N0Z A;  3QR6 A;  3PR8 A;  5D9T A;  4AI6 A;  3EYT A;  3HZ8 A;  1DE1 A;  2WGR A;  4I8B A;  2IL3 A;  4WR5 A;  4HZ4 A;  4Q5N A;  2LJR A;  5HR2 A;  2WVY A;  3GN3 A;  2DBC A;  4F0B A;  1SVO A;  3KTB A;  4AF2 A;  1PX7 A;  2FUG 2;  3KGK A;  3LW9 A;  4V1A p;  1IYI A;  5E4W A;  1GL8 A;  3D22 A;  3KIJ A;  5A5K A;  1NHO A;  3IDV A;  2FLS A;  3DIE A;  4BWQ A;  1OVN A;  5ELA A;  4KSM A;  1GSY A;  4KCE A;  1PRX A;  1F3A A;  2GQL A;  2HYX A;  2YNX A;  2JU5 A;  2RUF A;  5KEJ A;  2GQM A;  3HVS A;  2L6D A;  1PD2 1;  2PBJ A;  1W89 A;  4CY6 A;  4E8H A;  1O85 A;  3SBC A;  1G7E A;  4N30 A;  1WWJ A;  2HSN B;  3MDK A;  1YKA A;  3Q19 A;  4K2X A;  5DBQ A;  1X5C A;  1X5E A;  1VF3 A;  2OAD A;  3FHK A;  4JZQ A;  4DSR A;  1TU7 A;  5C00 A;  1U87 A;  6GSX A;  1BG1 A;  3CYN A;  3HD5 A;  5EVO A;  4GXZ A;  1AAZ A;  3M3M A;  3FR6 A;  5COH A;  2H70 A;  3HY2 A;  4K7N A;  2IPA A;  2F8F A;  1XPV A;  2VD0 A;  1UN2 A;  3E9J B;  3O76 A;  5JCG A;  1H75 A;  5IPH A;  4YQV A;  5G1K A;  1SKW B;  1MD3 A;  1PN9 A;  4I97 A;  5A4U A;  3P7X A;  2AB6 A;  2JAC A;  3DKS A;  4KDU A;  5IM9 A;  3TJJ A;  1KNG A;  1A2J A;  1F9M A;  2GZZ A;  3ZRD A;  1R26 A;  4FYU A;  2F9S A;  5A5H B;  1PL1 A;  2C4J A;  3G7I A;  2CVK A;  1BX9 A;  5INY A;  3TRX A;  2WW3 A;  3QFB C;  1M9A A;  3TJK A;  4JU5 A;  19GS A;  1I5G A;  1M3I A;  1E2Y A;  3LG6 A;  3DML A;  4OCE A;  1E6B A;  1GLP A;  5EPF A;  1K0M A;  4BVY B;  3ME8 A;  1MD4 A;  1WJK A;  3L9V A;  2QA2 A;  1TDI A;  2R0C A;  3CSH A;  2YWM A;  2DML A;  1U6T A;  3GYK A;  1GH2 A;  4ZIJ A;  1OKT A;  1TK5 B;  16GS A;  2EFH A;  4EE0 A;  2I81 A;  2HXK A;  1AIU A;  3KJY A;  1XWB A;  3DWV A;  5C04 A;  3IHG A;  2G2Q A;  2G0F A;  3F4R A;  5H5S A;  3TJG A;  4L0U A;  1GUL A;  1Y25 A;  5B6M A;  1GTB A;  5AN1 A;  2GSR A;  4PNG A;  3IR4 A;  2VCV A;  3FMW A;  3F6D A;  1V40 A;  3GMF A;  1SL2 B;  3VWV A;  3GST A;  4FXY P;  4Z2T A;  3WGE A;  3KD0 A;  1I1I P;  4J56 E;  3HMJ G;  4TR3 A;  4N0V A;  3GRX A;  1PX6 A;  4YKG A;  1O8X A;  2WZ9 A;  3UBK A;  2YV7 A;  1OYJ A;  1EEJ A;  4KSO A;  2VCW A;  5G5E A;  3US3 A;  1RQM A;  3DVX A;  1YEW C;  2BJX A;  5DVB A;  3KMN A;  3QMX A;  1YJ6 A;  4O32 A;  5J4U A;  4I2T A;  1A2M A;  1Z9H A;  3VWW A;  5KN2 A;  2QC7 A;  1KBN A;  1F2E A;  3MNG A;  4PUR A;  1YDK A;  1FAA A;  1X5D A;  1S3R A;  4OWY A;  3L9U A;  5ENU A;  2YWI A;  1TTZ A;  1XWC A;  4EIQ A;  4YAV A;  2V32 A;  1X9S B;  2H1L A;  2JAD A;  1T4Y A;  2GDR A;  4V2M A;  3ZL5 A;  4MAB A;  1BJX A;  3A2W A;  5G30 A;  3IC4 A;  2HLS A;  3FZ9 A;  5JWQ B;  2VL2 C;  3GSS A;  4G0K A;  2WZS A;  4K8M A;  4RQR A;  1YF0 A;  1UVZ A;  4OO4 A;  1QFN A;  5ID2 A;  2UZ8 A;  3F3R A;  1JZW A;  4MZW A;  5H5R A;  4KUN A;  4IP1 A;  2C3T A;  2CAI A;  3K8N A;  6GSY A;  2C8U A;  5IMC A;  1WPI A;  1XBS A;  4LA1 A;  3N5O A;  5D9X A;  4KF9 A;  3PIN A;  1WRY A;  3HJO A;  4PUF C;  3GH9 A;  5KOW A;  1EV9 A;  4HUA A;  4RI6 A;  5DQY A;  2PUK C;  3BBY A;  5IOX A;  3F4S A;  4CW9 A;  3GHA A;  1LU4 A;  2O87 A;  4MNN A;  1OC8 A;  2A4V A;  4F03 A;  5A34 A;  3R2Q A;  5ECK B;  4ECB A;  1X0R A;  2K18 A;  5ECQ B;  4EDZ A;  4LL1 B;  1AC1 A;  3C1S A;  3O6T A;  1SU9 A;  5CYY A;  3F8U A;  1VF1 A;  1QGV A;  1FOH A;  4TKY A;  1Z6M A;  2GSQ A;  1THX A;  4ZIL A;  1PMT A;  5FWG A;  3D6I A;  2XHF A;  2TRX A;  3DXB A;  5IMF A;  3F9U A;  2K8V A;  2NBS A;  3HYP A;  4O5R A;  2D2Z A;  4X4J A;  12GS A;  1YEX A;  1WIK A;  1Q98 A;  2DJ2 A;  1JLV A;  2RM5 A;  3LEF A;  3BCK A;  4ECC A;  2MMO A;  1URM A;  3DGQ A;  1FVJ A;  2JZT A;  4WEY A;  1O73 A;  2MBS A;  5B6N A;  1XWA A;  4MDC A;  2GTU A;  1BYE A;  4TRX A;  4EO3 A;  3FKF A;  4OO5 A;  3QFA C;  2DJ0 A;  1KEB A;  2ZNM A;  4GF0 A;  2A2R A;  1GUH A;  2WRT A;  3TKS C;  1TOF A;  2H0G A;  5CRE A;  4PI0 C;  3LXZ A;  5J47 A;  1ZYE A;  1N25 A;  2NDO A;  4ECI A;  2X64 A;  4O7H A;  1H4O A;  4PX1 A;  3L9S A;  3ERW A;  4BPY A;  1XOA A;  2H30 A;  1T8E B;  3JCM L;  3CXG A;  4GSS A;  1A0F A;  3GTU A;  5JWO B;  5G1L A;  2X4A A;  3KCM A;  4XIH A;  1GRX A;  3ZMK A;  4POK A;  2CA8 A;  4KDY A;  2TIR A;  2LRN A;  1GSF A;  4Z2U A;  2WFC A;  5J3R A;  3DRN A;  4N11 A;  4EIP A;  4KH7 A;  4GST A;  2O7K A;  5F05 A;  2YP6 A;  3GUS A;  4ZB9 A;  1DBY A;  3GFK A;  2XBI A;  5ECP B;  3RHC A;  1RK4 A;  1S3C A;  3EVI A;  3EMX A;  2XBQ A;  3CRU A;  4PI2 C;  2R6K A;  4J57 E;  2V6K A;  1BQ7 A;  5JWR B;  3W8S A;  3LQ7 A;  5ID2 B;  1GUM A;  4AKX B;  1XOB A;  1QUW A;  2OAC A;  3GKM A;  3UEM A;  2PMT A;  1X9M B;  1N2A A;  4PXO A;  5GZZ B;  3F63 A;  4DSS A;  4PGT A;  3C7M A;  3HZ4 A;  2KP2 A;  5A34 B;  4QL7 A;  4O5U A;  4MK3 A;  4HEA 2;  3ERF A;  4TOP A;  4HS1 A;  4POL A;  1WMJ A;  1HQO A;  2ZCT A;  2FNO A;  1XWG A;  6GSW A;  1U3A A;  2IMF A;  5GAP D;  5DJL A;  5D9V A;  4AKH A;  1ERW A;  4BIK A;  4EC0 A;  1PSQ A;  2PVO C;  2I9H A;  2AAW A;  6GSV A;  2MMN A;  1EOH A;  3CBU A;  3LYK A;  2YZH A;  2J9H A;  3GKK A;  2C0F A;  4X0X A;  5DAL A;  2P5R A;  2X8C A;  2MMA A;  4LL4 B;  4TR1 A;  2WW1 A;  5L71 A;  3TU3 B;  2PER A;  1B9X C;  2HSM A;  4AKG A;  1Z7P A;  3I43 A;  4GRF A;  3EWL A;  1NW2 A;  5IOW A;  4GDF A;  3VPQ A;  13GS A;  4I6X A;  2DKH A;  4F0C A;  2R0G A;  3BJ5 A;  1JZR A;  2H8L A;  4F82 A;  2F8A A;  4ZB6 A;  4CHS A;  1VGL A;  4NWY A;  4K1F A;  1UC7 A;  2JZR A;  3QPM A;  4CDO A;  2O3E A;  4H86 A;  3LJR A;  3UL3 A;  3C8E A;  3IPZ A;  5KN3 A;  1XVQ A;  3CHX C;  3A5I A;  3CWG A;  3ERG A;  1DSB A;  3HDC A;  2H0H A;  1AUC A;  1A8Y A;  2PWJ A;  5CO3 A;  3QAW A;  2VKZ G;  3H4K A;  1EOG A;  4IHU A;  4MP4 A;  1O81 A;  1TRS A;  4POM A;  1HD2 A;  1QK8 A;  1CQH A;  2H76 A;  3I9V 2;  2TRC P;  4KGI A;  14GS A;  1ZL9 A;  2P31 A;  2GT5 A;  5ECM B;  2DIY A;  4IS0 A;  1TU8 A;  2JZS A;  2CT6 A;  5AIV A;  3HJM A;  4L5O A;  2B3S A;  2I4A A;  1TRU A;  3F3Q A;  4AGS A;  4MF6 A;  4PQI A;  2VL9 A;  2HRA A;  2H01 A;  4X43 A;  4MJC A;  3KEB A;  2VL2 A;  5J9B A;  4NMU A;  4ZL7 A;  2RII A;  2DMM A;  2ES7 A;  4EUY A;  4EDY A;  1M7T A;  1V2A A;  4E68 A;  5CRG A;  2YV9 A;  1G6Y A;  2DJK A;  2NTO A;  4TN8 A;  4NAX A;  4AJ8 A;  5BMU A;  2EFC A;  3UBL A;  4KA0 A;  4HI7 A;  1LJR A;  1M99 A;  3J7Y b;  4DSS B;  2VO4 A;  4TR0 A;  2VCZ A;  2L5O A;  3ZIV A;  2B1L A;  4JR6 A;  5F06 A;  5D73 A;  1EZK A;  4XRD A;  1B48 A;  3KZQ A;  3ED3 A;  3U6V A;  2I1U A;  4JBB A;  2HZF A;  1NM3 A;  5F8B A;  1SVL A;  1EGO A;  3G7Y A;  4L5L A;  3GL3 A;  1VF4 A;  1F6M C;  2YOI A;  2IMK A;  2O5V A;  3M8N A;  3TKP A;  2R0P A;  1GWC A;  3IOS A;  4HU7 A;  5DAL B;  5DCG A;  3FYG A;  2EIQ A;  2PN8 A;  4IQA A;  3ZLP A;  4TR1 B;  1ERT A;  4E8E A;  5ABR A;  1ZOF A;  2X8G A;  4KE3 A;  4MF5 A;  2HSM B;  1TXU A;  4IJI A;  2V1M A;  1QXH A;  2KHP A;  2QSI A;  2LJK A;  5F0G A;  3ZVJ D;  3RPN A;  2FA4 A;  3IXR A;  4MJB A;  1XG8 A;  2PVQ A;  4WF4 A;  4NXI A;  2HRF A;  1O6J A;  1GNW A;  4CY8 A;  4L8E A;  2CZ2 A;  3GX8 A;  3HVX A;  5GAN D;  2E0Q A;  2GT6 A;  7GSS A;  5LNK e;  1XWK A;  5B7C A;  4MCU A;  1J08 A;  5D8I A;  3TKS A;  2H6X A;  1NHY A;  2WS2 A;  3CTF A;  4BWS A;  3G7J A;  1UA5 A;  5JCW A;  4L0W A;  3Q18 A;  3TKQ A;  4HSC X;  3E3E A;  1B4Q A;  5IQY A;  5IIZ A;  1A8L A;  2IMD A;  2C3N A;  4NHW A;  5CP1 A;  1C72 A;  1GSQ A;  3FR9 A;  2L4Q A;  5A4V A;  1Z7R A;  2EFD A;  4OCF A;  4YQU A;  4DVC A;  3IHQ A;  3IA1 A;  5DAK A;  3EMP A;  1Y1U A;  3MAK A;  5KOX A;  3HKR A;  2EIO A;  2VIM A;  1EGR A;  1RW1 A;  5H5Q A;  4IVF A;  5DDL A;  5ECS A;  4TXO A;  4WET A;  2REM A;  4GQF A;  1FO5 A;  3O3T A;  3L78 A;  1BED A;  3C1R A;  1TK0 B;  4X1U A;  5CAX A;  1ACV A;  1BG5 A;  4MA9 A;  2YCD A;  1SJZ A;  4WKW A;  3ME7 A;  4F9Z A;  1PKZ A;  2H75 A;  3TRP A;  2K6V A;  5BMU B;  4N10 A;  3FRC A;  4NHZ A;  1K0C A;  3MIX A;  4ICY A;  3J7Y k;  3ZIJ A;  4WR4 A;  2IFQ A;  2ON7 A;  2WW0 A;  5AIS A;  1J9B A;  2LNT A;  4ILF A;  2H1B A;  1YEP A;  4PUA A;  2DIZ A;  2L4C A;  1U88 A;  3IRA A;  3LGC A;  3KP9 A;  3EU3 A;  3U5R E;  3A2V A;  3FK8 A;  4V2N A;  3QAG A;  2OA7 A;  3ZML A;  3KH7 A;  2GS3 A;  2HT9 A;  4O5Q A;  4JR4 A;  1FOV A;  5ECO B;  4G2E A;  1BF5 A;  2AV4 A;  3UOM A;  1V58 A;  3RBT A;  3QOU A;  3FW2 A;  2C0D A;  1TKD B;  4JED A;  4MJE A;  2LJA A;  5KN1 A;  5CRD A;  2JSZ A;  3P2A A;  1OC3 A;  1MTC A;  2H1G A;  2YJH A;  1A0R P;  3P8W A;  5EY6 A;  4TR4 A;  3FZ5 A;  1XXU A;  2DLX A;  2F3M A;  2FWH A;  1TK8 B;  1FB0 A;  1SD8 A;  1AXD A;  2YWO A;  2FA8 A;  2WCI A;  3IK9 A;  2L59 A;  1ZMA A;  4KDX A;  1FW1 A;  4PQ1 A;  3ZZX A;  4ZBD A;  2VM2 A;  3VPT A;  5HR3 A;  3D5J A;  4I5Q A;  1SYX A;  2HNL A;  1AQW A;  4HZ2 A;  18GS A;  1TRW A;  1WE0 A;  3C71 A;  1KTE A;  3EC3 A;  4F2I A;  4LLR A;  2LUS A;  3P90 A;  3ZFB A;  2WJU A;  4W66 A;  1T1V A;  4LMW A;  1TRV A;  1QQ2 A;  3EPT A;  1ST9 A;  3APQ A;  2N5F A;  2I3Y A;  3CTG A;  1SJI A;  2HRK A;  2C0G A;  1FVK A;  3HA9 A;  1ON4 A;  2HE3 A;  2X49 A;  4K5S A;  1ZGN A;  1ZYQ B;  1WOU A;  1SL1 B;  1T4Z A;  1ABA A;  4MJA A;  1XIY A;  2C0E A;  2LTK A;  3LWA A;  2UV8 G;  1FB6 A;  4IEL A;  4K5R A;  1TP9 A;  3E0U A;  4HJM A;  1S4B P;  1SVM A;  2WB9 A;  3TOU A;  1K3Y A;  4FYB A;  5IO0 A;  2OBI A;  3UMA A;  2CX4 A;  4ZB8 A;  1M2B A;  2MMZ A;  3A2X A;  3EU4 A;  4TXO B;  1MDK A;  1JZO A;  4ECJ A;  3DVW A;  1QMV A;  2AHE A;  2AYT A;  3DYR A;  5KN0 A;  2CAQ A;  3CSJ A;  4PQH A;  4KAE A;  2NPB A;  3DD3 A;  1K3O A;  2VD1 A;  4GWR A;  2ZUP A;  3IBH A;  2F51 A;  3RFR C;  4BVX A;  1XZO A;  1M9B A;  8GSS A;  2GQK A;  1ERV A;  4K7O A;  3GIX A;  1Z3E A;  2IFQ B;  10GS A;  2FWE A;  1IYH A;  5AGY A;  2M80 A;  4K6X A;  3QCP A;  5ECR B;  5J9C A;  2BTO T;  2IN3 A;  4IKH A;  5ELG A;  1EV4 A;  4GSN A;  2GSS A;  4HJ2 A;  4XS6 A;  3L0H A;  4ISD A;  2CX3 A;  2QKE A;  4XCS A;  2WW2 A;  4YH2 A;  4HOJ A;  4AJ6 A;  1GTA A;  2O36 A;  1SYR A;  2IME A;  4Q5F A;  4EKZ A;  2L6C A;  3ZVJ A;  4DEJ A;  4I2U A;  1T00 A;  1ZCP A;  1Z6N A;  2FWG A;  2O89 A;  3HXS A;  2FY6 A;  3S9F A;  3NZN A;  4N3Z A;  3F0I A;  2NVL A;  1AQX A;  5GST A;  3DEX A;  2MYG A;  4BL7 A;  4K0G A;  5G5F A;  1HYU A;  2HFD A;  1TI1 A;  3OR5 A;  4YAP A;  1PQN A;  2VCT A;  4FO5 A;  1ZYN A;  4HQZ A;  1SKR B;  3UAP A;  3KM6 A;  2Z9S A;  4KND A;  4WBJ A;  4USS A;  3TB2 A;  3PPU A;  1OAZ A;  5IMA A;  3RPP A;  5B8A A;  3GUR A;  2IMI A;  2H19 A;  4RUV A;  22GS A;  4ZL8 A;  2EFE A;  1DE2 A;  2GZY A;  2H0I A;  2VL3 A;  4IQ1 A;  4MPF A;  1VRS D;  2A2S A;  2HRK B;  2HZE A;  3RHB A;  5E59 A;  3LXT A;  4HQS A;  4IN0 A;  4FYC A;  4QQ7 A;  1XVW A;  4OMV A;  2GST A;  5LD0 A;  1PN0 A;  1GTI A;  5J41 A;  4V2L A;  2MBT A;  1EEM A;  3IC8 A;  1PL2 A;  2PPT A;  5FHI A;  1S3D A;  3MYD A;  4FQU A;  5D96 A;  1SEN A;  4XRA A;  1AW9 A;  3WGD A;  4G10 A;  2RLI A;  1R4W A;  3H1N A;  4G01 A;  4ULX A;  2H6Z A;  2IWT A;  2X99 A;  3H8Q A;  5IMV A;  3GTU B;  4MZC A;  3IV4 A;  17GS A;  5ECN B;  1LBK A;  3VK9 A;  2EIR A;  1B4P A;  3IE3 A;  2LQQ A;  1X9W B;  3CMI A;  3D4T A;  3FZ4 A;  1V9W A;  4EL1 A;  3A3T A;  4ML1 A;  3KXO A;  3IAS 2;  1ERU A;  4DSQ A;  2VM1 A;  3HVV A;  5CRH A;  1TJD A;  1XW5 A;  2LS5 A;  3D4M A;  2YWN A;  4BVX B;  3L4N A;  3NOF A;  2E2G A;  3GKX A;  1YY7 A;  3TCO A;  3IK7 A;  1HNA A;  1ILO A;  5J4Y A;  3FEU A;  4K7I A;  4NV5 A;  2JSY A;  2R37 A;  2KLX A;  2FHE A;  3M1G A;  3ZIT A;  1SK1 A;  3HJP A;  4ZBA A;  1OKD A;  2DJJ A;  3M9K A;  3VWU A;  1R5A A;  1SD9 A;  5CRW A;  3UAR A;  1S3A A;  3VFI A;  5CNW A;  3NIV A;  1HNB A;  1VF2 A;  3UJ1 A;  4K9Z A;  4IP6 A;  3I6A A;  4GCI A;  2O85 A;  3V1W A;  2HSH A;  2LKU A;  4FIW A;  3KTL A;  3IAM 2;  1M2D A;  2VCQ A;  4IJ3 A;  2OJL A;  1ML6 A;  2E2M A;  3QDN A;  4G0I A;  4KCA A;  3WYW A;  5IMD A;  9GSS A;  2LST A;  1K0B A;  3WD6 A;  2LEG A;  2IIY A;  3TKR A;  1W4V A;  4QL9 A;  2VOC A;  4KB3 A;  2R4V A;  5ECL B;  1JHB A;  2XPD A;  4OD7 A;  2R5G A;  2AJQ B;  2YAN A;  4BL7 B;  2H6Y A;  3LOR A;  3F4T A;  1GLQ A;  1SKS B;  6GST A;  1TXX A;  3D0Z A;  4K2D A;  3M9J A;  3W8J A;  3VWX A;  1F3B A;  3KH9 A;  1T3B A;  1M3J A;  2VLV A;  2V41 A;  3RAZ A;  3GNJ A;  1GSE A;  1TW9 A;  2HI7 A;  2OKA A;  4XS4 A;  4AJ7 A;  4Q5R A;  3AY8 A;  2BMX A;  2YJ7 A;  4V1A g;  2WUL A;  4GLT A;  3GX0 A;  4J2F A;  1OE7 A;  3FY7 A;  1OC9 A;  4OFN A;  2C1Y A;  2OE1 A;  1GSD A;  2HZE B;  2X8H A;  4PHZ C;  2B5Y A;  1V57 A;  4XS1 A;  5D93 A;  3WT2 A;  4POB A;  2YPM A;  3W6G A;  3RGB C;  2YZU A;  1JFU A;  3CSI A;  2AUV A;  2FGX A;  4A5P A;  2HQT A;  1BAY A;  3LSZ A;  1AQV A;  1OE8 A;  5J40 A;  1JLW A;  5AIX A;  6GSU A;  4O92 A;  3VI5 A;  4MF7 A;  3TRQ A;  5A4W A;  5FT3 A;  2FD3 A;  1YZX A;  4ZL9 A;  3APO A;  3ISO A;  2P5Q A;  1U3I A;  2WVZ A;  1USB A;  1GNE A;  4G9H A;  4ML6 A;  1WP0 A;  3A5W A;  4HU9 A;  1HNC A;  4IW9 A;  4PNF A;  1SK0 A;  2WVX A;  1GSU A;  5HFI A;  5IMZ A;  3Q6O A;  1A2L A;  2B5X A;  1ZYP A;  2OE0 A;  4NPB A;  3RDW A;  1O8W A;  3TDG A;  2N5B A;  1MDJ A;  2A2P A;  2L5L A;  2OBK A;  3CRT A;  4EF0 A;  2YN1 A;  1FHE A;  3FR3 A;  2C80 A;  3UVT A;  2J23 A;  4MMM A; 
#chains in the Genus database with same CATH homology
 2XPE A;  2XC2 A;  1Z5Y E;  4IGJ A;  2ALB A;  5HR1 A;  2CZ3 A;  2H1A A;  1K0N A;  2KOK A;  5F07 A;  3EE2 A;  4MLY A;  4TXV A;  3VI7 A;  1GP1 A;  2QGV A;  2FCH A;  3EUR A;  1GUK A;  1EP8 A;  5G31 A;  3BD2 A;  4Z2R A;  1F37 A;  1TI3 A;  2DJ1 A;  2OT3 A;  3BOA A;  1GSS A;  1J0F A;  4GQC A;  2EC4 A;  1G0T A;  2LRC A;  3LYP A;  2K8S A;  2CQ9 A;  2K9F A;  1K0D A;  2B6M A;  1SK2 A;  2CVB A;  1PGT A;  5G2Z A;  3H93 A;  2GGT A;  4OFT A;  3ZYW A;  3VLN A;  3R3E A;  4MH2 A;  3BCI A;  2R3X A;  3TOT A;  5GSS A;  4AKI A;  1FG4 A;  6GSS A;  3PH9 A;  1MDI A;  4WBR D;  2CV4 A;  2N5A A;  2PGT A;  2WDU A;  1YKC A;  5DQS A;  4XS4 B;  4ZXG A;  2HSY A;  5A1N A;  4QMK A;  3F6F A;  4D73 A;  1OC9 B;  3KP8 A;  3TKS E;  5LCZ A;  3I69 A;  4BA7 A;  4YKF A;  3H79 A;  3GH6 A;  3ZTL A;  3WT1 A;  1THO A;  4TW5 A;  1N8J A;  2ON5 A;  2MZC A;  2FWF A;  1T7P B;  2GVP A;  1B8X A;  3UVH A;  1SL0 B;  2VAF A;  11GS A;  1PKW A;  5HR0 A;  2H66 A;  2B7J A;  3GV1 A;  5D9W A;  2RUE A;  4MPG A;  2DKI A;  1XW6 A;  1A23 A;  1R7H A;  3GKN A;  1SJ6 A;  2H1D A;  2H71 A;  2H73 A;  1G7O A;  1JZD A;  2O8V B;  1MEK A;  2KUC A;  2GZP A;  4NV2 A;  1EP7 A;  2B7K A;  1A24 A;  4WXT A;  4Q5Q A;  2LRT A;  2QA1 A;  2M72 A;  4JE1 A;  2LQO A;  5DAK B;  3FZA A;  2RM6 A;  3C73 A;  1YQ1 A;  2VCX A;  5DJM A;  3APS A;  1NSW A;  3TJB A;  2DC5 A;  3VUR A;  3TGZ A;  4JRR A;  1K3L A;  3N9J A;  4IBP A;  4G0L A;  3TUE A;  1I9D A;  2OE3 A;  2VLT A;  3ZRE A;  3G9B A;  4RI7 A;  2HSN A;  1GTU A;  4TVE A;  1G6W A;  2V6O A;  4RQX A;  3Q74 A;  2L57 A;  3PGT A;  20GS A;  2LNS A;  2DJ3 A;  3MWH A;  4MZB A;  2CVD A;  3M0F A;  2V2G A;  1M0U A;  1Q4J A;  5ECI B;  4FH8 A;  4ZB7 A;  5JCU A;  3ZFL A;  4ID0 A;  1CQG A;  2KP1 A;  3KMO A;  3QD9 A;  5IPG A;  2DSA A;  3TJF A;  1B9Y C;  2B5E A;  2C3Q A;  4OFM A;  4XTS A;  2JL4 A;  1XW9 A;  2LV3 A;  5B8B A;  4PTS A;  4HDE A;  2VLU A;  3GL5 A;  5HFK A;  3QAV A;  2VUP A;  4MH3 A;  2H72 A;  4KX4 A;  4EVM A;  1M2A A;  5HFG A;  2A4H A;  1V98 A;  1O7U A;  5A5H A;  1Y6E A;  5HQP A;  4GTU A;  2HRN A;  2PU9 C;  4Z7X A;  2E7P A;  5IO2 A;  2P0G A;  2GLR A;  3SWL A;  4WF5 A;  5J4V A;  3UIW A;  3GA4 A;  3HCZ A;  4KW6 A;  1XCC A;  4XHM A;  5ECH B;  5EL8 A;  3D21 A;  5DCH A;  4LMV A;  3MSZ A;  3WGX A;  3LFL A;  4ZBB A;  5A1N B;  1EWX A;  2H74 A;  1YF1 A;  4K0N A;  4D73 B;  1K0O A;  1K0A A;  4EXJ A;  1YVL A;  1PA3 A;  4BVY A;  2B1K A;  1XFL A;  1R5P A;  2IJY A;  2R2J A;  4YQM A;  1ZZY A;  4P3Y B;  1DUG A;  4G19 A;  2M46 A;  4ACS A;  5BRT A;  5J5N A;  3HHV A;  3EIN A;  4N0Z A;  3QR6 A;  3PR8 A;  5D9T A;  4AI6 A;  3EYT A;  3HZ8 A;  1DE1 A;  2WGR A;  4I8B A;  2IL3 A;  4WR5 A;  4HZ4 A;  4Q5N A;  2LJR A;  5HR2 A;  3GN3 A;  2DBC A;  4F0B A;  1SVO A;  3KTB A;  4AF2 A;  1PX7 A;  2FUG 2;  3KGK A;  3LW9 A;  4V1A p;  1IYI A;  5E4W A;  1GL8 A;  3D22 A;  3KIJ A;  5A5K A;  1NHO A;  3IDV A;  2FLS A;  3DIE A;  4BWQ A;  1OVN A;  5ELA A;  4KSM A;  1GSY A;  4KCE A;  1PRX A;  1F3A A;  2GQL A;  2HYX A;  2YNX A;  2JU5 A;  2RUF A;  5KEJ A;  2GQM A;  3HVS A;  2L6D A;  1PD2 1;  2PBJ A;  1W89 A;  4CY6 A;  4E8H A;  1O85 A;  3SBC A;  1G7E A;  4N30 A;  1WWJ A;  2HSN B;  3MDK A;  1YKA A;  3Q19 A;  4K2X A;  5DBQ A;  1X5C A;  1X5E A;  1VF3 A;  2OAD A;  3FHK A;  4JZQ A;  4DSR A;  1TU7 A;  5C00 A;  1U87 A;  6GSX A;  1BG1 A;  3CYN A;  3HD5 A;  5EVO A;  4GXZ A;  1AAZ A;  3M3M A;  3FR6 A;  5COH A;  2H70 A;  3HY2 A;  4K7N A;  2IPA A;  2F8F A;  1XPV A;  2VD0 A;  1UN2 A;  3E9J B;  3O76 A;  5JCG A;  1H75 A;  5IPH A;  4YQV A;  5G1K A;  1SKW B;  1MD3 A;  1PN9 A;  4I97 A;  5A4U A;  3P7X A;  2AB6 A;  2JAC A;  3DKS A;  4KDU A;  5IM9 A;  3TJJ A;  1KNG A;  1A2J A;  1F9M A;  2GZZ A;  3ZRD A;  1R26 A;  4FYU A;  2F9S A;  5A5H B;  1PL1 A;  2C4J A;  3G7I A;  2CVK A;  1BX9 A;  5INY A;  3TRX A;  3QFB C;  1M9A A;  3TJK A;  4JU5 A;  19GS A;  1I5G A;  1E2Y A;  3LG6 A;  3DML A;  4OCE A;  1E6B A;  1GLP A;  5EPF A;  1K0M A;  4BVY B;  3ME8 A;  1MD4 A;  1WJK A;  3L9V A;  2QA2 A;  1TDI A;  2R0C A;  3CSH A;  2YWM A;  2DML A;  1U6T A;  3GYK A;  1GH2 A;  4ZIJ A;  1OKT A;  1TK5 B;  16GS A;  2EFH A;  4EE0 A;  2I81 A;  2HXK A;  1AIU A;  3KJY A;  1XWB A;  3DWV A;  5C04 A;  3IHG A;  2G2Q A;  2G0F A;  3F4R A;  5H5S A;  3TJG A;  4L0U A;  1GUL A;  1Y25 A;  5B6M A;  1GTB A;  5AN1 A;  2GSR A;  4PNG A;  3IR4 A;  2VCV A;  3FMW A;  3F6D A;  1V40 A;  3GMF A;  1SL2 B;  3VWV A;  3GST A;  4Z2T A;  3WGE A;  3KD0 A;  4J56 E;  3HMJ G;  4TR3 A;  4N0V A;  3GRX A;  1PX6 A;  4YKG A;  1O8X A;  2WZ9 A;  3UBK A;  2YV7 A;  1OYJ A;  1EEJ A;  4KSO A;  2VCW A;  5G5E A;  3US3 A;  1RQM A;  3DVX A;  2BJX A;  5DVB A;  3KMN A;  3QMX A;  1YJ6 A;  4O32 A;  5J4U A;  4I2T A;  1A2M A;  1Z9H A;  3VWW A;  5KN2 A;  2QC7 A;  1KBN A;  1F2E A;  3MNG A;  4PUR A;  1YDK A;  1FAA A;  1X5D A;  4OWY A;  3L9U A;  5ENU A;  2YWI A;  1TTZ A;  1XWC A;  4EIQ A;  4YAV A;  2V32 A;  1X9S B;  2H1L A;  2JAD A;  1T4Y A;  2GDR A;  4V2M A;  3ZL5 A;  4MAB A;  1BJX A;  3A2W A;  5G30 A;  3IC4 A;  2HLS A;  3FZ9 A;  5JWQ B;  2VL2 C;  3GSS A;  4G0K A;  4K8M A;  4RQR A;  1YF0 A;  1UVZ A;  4OO4 A;  1QFN A;  5ID2 A;  2UZ8 A;  3F3R A;  1JZW A;  4MZW A;  5H5R A;  4KUN A;  4IP1 A;  2C3T A;  2CAI A;  3K8N A;  6GSY A;  2C8U A;  5IMC A;  1WPI A;  1XBS A;  4LA1 A;  3N5O A;  5D9X A;  4KF9 A;  3PIN A;  1WRY A;  3HJO A;  4PUF C;  3GH9 A;  5KOW A;  1EV9 A;  4HUA A;  4RI6 A;  5DQY A;  2PUK C;  3BBY A;  5IOX A;  3F4S A;  4CW9 A;  3GHA A;  1LU4 A;  2O87 A;  4MNN A;  1OC8 A;  2A4V A;  4F03 A;  5A34 A;  3R2Q A;  5ECK B;  4ECB A;  1X0R A;  2K18 A;  5ECQ B;  4EDZ A;  4LL1 B;  1AC1 A;  3C1S A;  3O6T A;  1SU9 A;  5CYY A;  3F8U A;  1VF1 A;  1QGV A;  1FOH A;  4TKY A;  1Z6M A;  2GSQ A;  1THX A;  4ZIL A;  1PMT A;  5FWG A;  3D6I A;  2XHF A;  2TRX A;  3DXB A;  5IMF A;  3F9U A;  2K8V A;  2NBS A;  3HYP A;  4O5R A;  2D2Z A;  4X4J A;  12GS A;  1YEX A;  1WIK A;  1Q98 A;  2DJ2 A;  1JLV A;  2RM5 A;  3LEF A;  3BCK A;  4ECC A;  2MMO A;  1URM A;  3DGQ A;  1FVJ A;  2JZT A;  4WEY A;  1O73 A;  2MBS A;  5B6N A;  1XWA A;  4MDC A;  2GTU A;  1BYE A;  4TRX A;  4EO3 A;  3FKF A;  4OO5 A;  3QFA C;  2DJ0 A;  1KEB A;  2ZNM A;  4GF0 A;  2A2R A;  1GUH A;  2WRT A;  3TKS C;  1TOF A;  2H0G A;  5CRE A;  3LXZ A;  5J47 A;  1ZYE A;  1N25 A;  2NDO A;  4ECI A;  2X64 A;  4O7H A;  1H4O A;  4PX1 A;  3L9S A;  3ERW A;  4BPY A;  1XOA A;  2H30 A;  1T8E B;  3JCM L;  3CXG A;  4GSS A;  1A0F A;  3GTU A;  5JWO B;  5G1L A;  2X4A A;  3KCM A;  4XIH A;  1GRX A;  3ZMK A;  4POK A;  2CA8 A;  4KDY A;  2TIR A;  2LRN A;  1GSF A;  4Z2U A;  2WFC A;  5J3R A;  3DRN A;  4N11 A;  4EIP A;  4KH7 A;  4GST A;  2O7K A;  5F05 A;  2YP6 A;  3GUS A;  4ZB9 A;  1DBY A;  3GFK A;  2XBI A;  5ECP B;  3RHC A;  1RK4 A;  1S3C A;  3EVI A;  3EMX A;  2XBQ A;  3CRU A;  2R6K A;  4J57 E;  2V6K A;  1BQ7 A;  5JWR B;  3W8S A;  3LQ7 A;  5ID2 B;  1GUM A;  4AKX B;  1XOB A;  1QUW A;  2OAC A;  3GKM A;  3UEM A;  2PMT A;  1X9M B;  1N2A A;  4PXO A;  5GZZ B;  3F63 A;  4DSS A;  4PGT A;  3C7M A;  3HZ4 A;  2KP2 A;  5A34 B;  4QL7 A;  4O5U A;  4MK3 A;  4HEA 2;  3ERF A;  4TOP A;  4HS1 A;  4POL A;  1WMJ A;  1HQO A;  2ZCT A;  2FNO A;  1XWG A;  6GSW A;  1U3A A;  2IMF A;  5GAP D;  5DJL A;  5D9V A;  4AKH A;  1ERW A;  4EC0 A;  1PSQ A;  2PVO C;  2I9H A;  2AAW A;  6GSV A;  2MMN A;  1EOH A;  3CBU A;  3LYK A;  2YZH A;  2J9H A;  3GKK A;  2C0F A;  4X0X A;  5DAL A;  2P5R A;  2X8C A;  2MMA A;  4LL4 B;  4TR1 A;  5L71 A;  3TU3 B;  2PER A;  1B9X C;  2HSM A;  4AKG A;  1Z7P A;  3I43 A;  4GRF A;  3EWL A;  1NW2 A;  5IOW A;  4GDF A;  3VPQ A;  13GS A;  4I6X A;  2DKH A;  4F0C A;  2R0G A;  3BJ5 A;  1JZR A;  2H8L A;  4F82 A;  2F8A A;  4ZB6 A;  4CHS A;  1VGL A;  4NWY A;  4K1F A;  1UC7 A;  2JZR A;  3QPM A;  4CDO A;  4H86 A;  3LJR A;  3UL3 A;  3C8E A;  3IPZ A;  5KN3 A;  1XVQ A;  3A5I A;  3CWG A;  3ERG A;  1DSB A;  3HDC A;  2H0H A;  1AUC A;  1A8Y A;  2PWJ A;  5CO3 A;  3QAW A;  2VKZ G;  3H4K A;  1EOG A;  4IHU A;  4MP4 A;  1O81 A;  1TRS A;  4POM A;  1HD2 A;  1QK8 A;  1CQH A;  2H76 A;  3I9V 2;  2TRC P;  4KGI A;  14GS A;  1ZL9 A;  2P31 A;  2GT5 A;  5ECM B;  2DIY A;  4IS0 A;  1TU8 A;  2JZS A;  2CT6 A;  5AIV A;  3HJM A;  4L5O A;  2B3S A;  2I4A A;  1TRU A;  3F3Q A;  4AGS A;  4MF6 A;  4PQI A;  2VL9 A;  2HRA A;  2H01 A;  4X43 A;  4MJC A;  3KEB A;  2VL2 A;  5J9B A;  4NMU A;  4ZL7 A;  2RII A;  2DMM A;  2ES7 A;  4EUY A;  4EDY A;  1M7T A;  1V2A A;  4E68 A;  5CRG A;  2YV9 A;  1G6Y A;  2DJK A;  2NTO A;  4TN8 A;  4NAX A;  4AJ8 A;  5BMU A;  2EFC A;  3UBL A;  4KA0 A;  4HI7 A;  1LJR A;  1M99 A;  3J7Y b;  4DSS B;  2VO4 A;  4TR0 A;  2VCZ A;  2L5O A;  3ZIV A;  2B1L A;  4JR6 A;  5F06 A;  5D73 A;  1EZK A;  4XRD A;  1B48 A;  3KZQ A;  3ED3 A;  3U6V A;  2I1U A;  4JBB A;  2HZF A;  1NM3 A;  5F8B A;  1SVL A;  1EGO A;  3G7Y A;  4L5L A;  3GL3 A;  1VF4 A;  1F6M C;  2YOI A;  2IMK A;  2O5V A;  3M8N A;  3TKP A;  2R0P A;  1GWC A;  3IOS A;  4HU7 A;  5DAL B;  5DCG A;  3FYG A;  2EIQ A;  2PN8 A;  4IQA A;  3ZLP A;  4TR1 B;  1ERT A;  4E8E A;  5ABR A;  1ZOF A;  2X8G A;  4KE3 A;  4MF5 A;  2HSM B;  1TXU A;  4IJI A;  2V1M A;  1QXH A;  2KHP A;  2QSI A;  2LJK A;  5F0G A;  3ZVJ D;  3RPN A;  2FA4 A;  3IXR A;  4MJB A;  2PVQ A;  4WF4 A;  4NXI A;  2HRF A;  1O6J A;  1GNW A;  4CY8 A;  4L8E A;  2CZ2 A;  3GX8 A;  3HVX A;  5GAN D;  2E0Q A;  2GT6 A;  7GSS A;  5LNK e;  1XWK A;  5B7C A;  4MCU A;  1J08 A;  5D8I A;  3TKS A;  2H6X A;  1NHY A;  2WS2 A;  3CTF A;  4BWS A;  3G7J A;  1UA5 A;  5JCW A;  4L0W A;  3Q18 A;  3TKQ A;  3E3E A;  1B4Q A;  5IQY A;  5IIZ A;  1A8L A;  2IMD A;  2C3N A;  4NHW A;  5CP1 A;  1C72 A;  1GSQ A;  3FR9 A;  2L4Q A;  5A4V A;  1Z7R A;  2EFD A;  4OCF A;  4YQU A;  4DVC A;  3IHQ A;  3IA1 A;  5DAK A;  3EMP A;  1Y1U A;  3MAK A;  5KOX A;  3HKR A;  2EIO A;  2VIM A;  1EGR A;  1RW1 A;  5H5Q A;  4IVF A;  5DDL A;  5ECS A;  4TXO A;  4WET A;  2REM A;  4GQF A;  1FO5 A;  3O3T A;  3L78 A;  1BED A;  3C1R A;  1TK0 B;  4X1U A;  5CAX A;  1ACV A;  1BG5 A;  4MA9 A;  2YCD A;  1SJZ A;  4WKW A;  3ME7 A;  4F9Z A;  1PKZ A;  2H75 A;  3TRP A;  2K6V A;  5BMU B;  4N10 A;  3FRC A;  4NHZ A;  1K0C A;  3MIX A;  4ICY A;  3J7Y k;  3ZIJ A;  4WR4 A;  2IFQ A;  2ON7 A;  2LNT A;  5AIS A;  1J9B A;  4ILF A;  2H1B A;  1YEP A;  4PUA A;  2DIZ A;  2L4C A;  1U88 A;  3IRA A;  3LGC A;  3KP9 A;  3EU3 A;  3U5R E;  3A2V A;  3FK8 A;  4V2N A;  3QAG A;  2OA7 A;  3ZML A;  3KH7 A;  2GS3 A;  2HT9 A;  4O5Q A;  4JR4 A;  1FOV A;  5ECO B;  4G2E A;  1BF5 A;  2AV4 A;  3UOM A;  1V58 A;  3RBT A;  3QOU A;  3FW2 A;  2C0D A;  1TKD B;  4JED A;  4MJE A;  2LJA A;  5KN1 A;  5CRD A;  2JSZ A;  3P2A A;  1OC3 A;  1MTC A;  2H1G A;  2YJH A;  1A0R P;  3P8W A;  5EY6 A;  4TR4 A;  3FZ5 A;  1XXU A;  2DLX A;  2F3M A;  2FWH A;  1TK8 B;  1FB0 A;  1SD8 A;  1AXD A;  2YWO A;  2FA8 A;  2WCI A;  3IK9 A;  2L59 A;  1ZMA A;  4KDX A;  1FW1 A;  4PQ1 A;  3ZZX A;  4ZBD A;  2VM2 A;  3VPT A;  5HR3 A;  3D5J A;  4I5Q A;  1SYX A;  2HNL A;  1AQW A;  4HZ2 A;  18GS A;  1TRW A;  1WE0 A;  3C71 A;  1KTE A;  3EC3 A;  4F2I A;  4LLR A;  2LUS A;  3P90 A;  3ZFB A;  2WJU A;  4W66 A;  1T1V A;  4LMW A;  1TRV A;  1QQ2 A;  3EPT A;  1ST9 A;  3APQ A;  2N5F A;  2I3Y A;  3CTG A;  1SJI A;  2HRK A;  2C0G A;  1FVK A;  3HA9 A;  1ON4 A;  2HE3 A;  2X49 A;  4K5S A;  1ZGN A;  1ZYQ B;  1WOU A;  1SL1 B;  1T4Z A;  1ABA A;  4MJA A;  1XIY A;  2C0E A;  2LTK A;  3LWA A;  2UV8 G;  1FB6 A;  4IEL A;  4K5R A;  1TP9 A;  3E0U A;  4HJM A;  1SVM A;  2WB9 A;  3TOU A;  1K3Y A;  4FYB A;  5IO0 A;  2OBI A;  3UMA A;  2CX4 A;  4ZB8 A;  1M2B A;  2MMZ A;  3A2X A;  3EU4 A;  4TXO B;  1MDK A;  1JZO A;  4ECJ A;  3DVW A;  1QMV A;  2AHE A;  2AYT A;  3DYR A;  5KN0 A;  2CAQ A;  3CSJ A;  4PQH A;  4KAE A;  2NPB A;  3DD3 A;  1K3O A;  2VD1 A;  4GWR A;  2ZUP A;  3IBH A;  2F51 A;  4BVX A;  1XZO A;  1M9B A;  8GSS A;  2GQK A;  1ERV A;  4K7O A;  3GIX A;  1Z3E A;  2IFQ B;  10GS A;  2FWE A;  1IYH A;  5AGY A;  2M80 A;  4K6X A;  3QCP A;  5ECR B;  5J9C A;  2BTO T;  2IN3 A;  4IKH A;  5ELG A;  1EV4 A;  4GSN A;  2GSS A;  4HJ2 A;  4XS6 A;  3L0H A;  4ISD A;  2CX3 A;  2QKE A;  4XCS A;  4YH2 A;  4HOJ A;  4AJ6 A;  1GTA A;  1SYR A;  2IME A;  4Q5F A;  4EKZ A;  2L6C A;  3ZVJ A;  4DEJ A;  4I2U A;  1T00 A;  1ZCP A;  1Z6N A;  2FWG A;  2O89 A;  3HXS A;  2FY6 A;  3S9F A;  3NZN A;  4N3Z A;  3F0I A;  2NVL A;  1AQX A;  5GST A;  3DEX A;  2MYG A;  4BL7 A;  4K0G A;  5G5F A;  1HYU A;  2HFD A;  1TI1 A;  3OR5 A;  4YAP A;  1PQN A;  2VCT A;  4FO5 A;  1ZYN A;  4HQZ A;  1SKR B;  3UAP A;  3KM6 A;  2Z9S A;  4KND A;  4WBJ A;  4USS A;  3TB2 A;  3PPU A;  1OAZ A;  5IMA A;  3RPP A;  5B8A A;  3GUR A;  2IMI A;  2H19 A;  4RUV A;  22GS A;  4ZL8 A;  2EFE A;  1DE2 A;  2GZY A;  2H0I A;  2VL3 A;  4IQ1 A;  4MPF A;  1VRS D;  2A2S A;  2HRK B;  2HZE A;  3RHB A;  5E59 A;  3LXT A;  4HQS A;  4IN0 A;  4FYC A;  4QQ7 A;  1XVW A;  4OMV A;  2GST A;  5LD0 A;  1PN0 A;  1GTI A;  5J41 A;  4V2L A;  2MBT A;  1EEM A;  3IC8 A;  1PL2 A;  2PPT A;  5FHI A;  1S3D A;  3MYD A;  4FQU A;  5D96 A;  1SEN A;  4XRA A;  1AW9 A;  3WGD A;  4G10 A;  2RLI A;  1R4W A;  3H1N A;  4G01 A;  4ULX A;  2H6Z A;  2IWT A;  2X99 A;  3H8Q A;  5IMV A;  3GTU B;  4MZC A;  3IV4 A;  17GS A;  5ECN B;  1LBK A;  3VK9 A;  2EIR A;  1B4P A;  3IE3 A;  2LQQ A;  1X9W B;  3CMI A;  3D4T A;  3FZ4 A;  1V9W A;  4EL1 A;  3A3T A;  4ML1 A;  3KXO A;  3IAS 2;  1ERU A;  4DSQ A;  2VM1 A;  3HVV A;  5CRH A;  1TJD A;  1XW5 A;  2LS5 A;  3D4M A;  2YWN A;  4BVX B;  3L4N A;  3NOF A;  2E2G A;  3GKX A;  1YY7 A;  3TCO A;  3IK7 A;  1HNA A;  1ILO A;  5J4Y A;  3FEU A;  4K7I A;  4NV5 A;  2JSY A;  2R37 A;  2KLX A;  2FHE A;  3M1G A;  3ZIT A;  1SK1 A;  3HJP A;  4ZBA A;  1OKD A;  2DJJ A;  3M9K A;  3VWU A;  1R5A A;  1SD9 A;  5CRW A;  3UAR A;  1S3A A;  3VFI A;  5CNW A;  3NIV A;  1HNB A;  1VF2 A;  3UJ1 A;  4K9Z A;  4IP6 A;  3I6A A;  4GCI A;  2O85 A;  3V1W A;  2HSH A;  2LKU A;  4FIW A;  3KTL A;  3IAM 2;  1M2D A;  2VCQ A;  4IJ3 A;  2OJL A;  1ML6 A;  2E2M A;  3QDN A;  4G0I A;  4KCA A;  3WYW A;  5IMD A;  9GSS A;  2LST A;  1K0B A;  3WD6 A;  2LEG A;  2IIY A;  3TKR A;  1W4V A;  4QL9 A;  2VOC A;  4KB3 A;  2R4V A;  5ECL B;  1JHB A;  2XPD A;  4OD7 A;  2R5G A;  2AJQ B;  2YAN A;  4BL7 B;  2H6Y A;  3LOR A;  3F4T A;  1GLQ A;  1SKS B;  6GST A;  1TXX A;  3D0Z A;  4K2D A;  3M9J A;  3W8J A;  3VWX A;  1F3B A;  3KH9 A;  1T3B A;  2VLV A;  2V41 A;  3RAZ A;  3GNJ A;  1GSE A;  1TW9 A;  2HI7 A;  2OKA A;  4XS4 A;  4AJ7 A;  4Q5R A;  3AY8 A;  2BMX A;  2YJ7 A;  4V1A g;  2WUL A;  4GLT A;  3GX0 A;  4J2F A;  1OE7 A;  3FY7 A;  1OC9 A;  4OFN A;  2C1Y A;  2OE1 A;  1GSD A;  2HZE B;  2X8H A;  2B5Y A;  1V57 A;  4XS1 A;  5D93 A;  3WT2 A;  4POB A;  2YPM A;  3W6G A;  2YZU A;  1JFU A;  3CSI A;  2AUV A;  2FGX A;  4A5P A;  2HQT A;  1BAY A;  3LSZ A;  1AQV A;  1OE8 A;  5J40 A;  1JLW A;  5AIX A;  6GSU A;  4O92 A;  3VI5 A;  4MF7 A;  3TRQ A;  5A4W A;  5FT3 A;  2FD3 A;  1YZX A;  4ZL9 A;  3APO A;  3ISO A;  2P5Q A;  1U3I A;  1USB A;  1GNE A;  4G9H A;  4ML6 A;  1WP0 A;  3A5W A;  4HU9 A;  1HNC A;  4IW9 A;  4PNF A;  1SK0 A;  5IMZ A;  1GSU A;  5HFI A;  3Q6O A;  1A2L A;  2B5X A;  1ZYP A;  2OE0 A;  4NPB A;  3RDW A;  1O8W A;  3TDG A;  2N5B A;  1MDJ A;  2A2P A;  2L5L A;  2OBK A;  3CRT A;  4EF0 A;  2YN1 A;  1FHE A;  3FR3 A;  2C80 A;  3UVT A;  2J23 A;  4MMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...