4CHSA

Crystal structure of a tau class glutathione transferase 10 from glycine max
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
215
Chain Sequence
TDEVVLLDFWPSPFGMRVRIALAEKGIEYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPISESLIAVQYIEEVWNDRNPLLPSDPYQRAQARFWADYVDIKIHDLGKKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNIGFVDIALVPFYTWFKVYETFGSLNIENECPRFVAWAKRCLQKESVAKSLPDQHKVYEFVVEIRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Catalytic features and crystal structure of a tau class glutathione transferase from Glycine max specifically upregulated in response to soybean mosaic virus infections.
pubmed doi rcsb
source organism Glycine max
total genus 79
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4chsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4chsA01
4X43A 4IQAA 5ELAA 3TJBA 4PQ1A 5JCWA 5D9WA 1O6JA 2YNXA 2VUPA 4G19A 2V6KA 2HT9A 3KEBA 1FVKA 3M1GA 5HFGA 4K6XA 4XIHA 3PPUA 3D22A 4PQHA 6GSVA 1PGTA 4GSSA 1TRSA 2FWHA 5IO0A 2MMAA 5DCGA 3HCZA 3U5RE 3FEUA 2HSMA 3DWVA 4KCEA 1BG5A 2R3XA 4PNGA 3KGKA 4WF5A 1PD21 2NDOA 4NPBA 1W89A 1TKDB 1SKRB 6GSSA 1YQ1A 22GSA 3Q19A 4JEDA 1J0FA 1TXXA 1EP8A 4POKA 1OKTA 3W8JA 6GSYA 1TTZA 5A4UA 3D6IA 4KSOA 3LFLA 2HZEB 4E8EA 1B9XC 4D73B 3C1RA 4RQRA 2L57A 3A2WA 1YKAA 4ZB8A 2GT6A 4FO5A 2YCDA 5AN1A 1ZOFA 3HVXA 2OKAA 3KMOA 2REMA 2FNOA 5DJMA 4YAPA 3FKFA 4OO5A 2B5YA 3CSHA 3GN3A 5IMDA 2C0FA 4HOJA 5A4WA 4YQVA 2BMXA 2B5XA 2L59A 3FR6A 5D93A 3ZYWA 4RI7A 1I9DA 5JWQB 2H1BA 2QC7A 1X0RA 2IJYA 2H0GA 1JFUA 7GSSA 3DMLA 4BA7A 3BD2A 1ERUA 1TU8A 4TR1B 2C0DA 4JU5A 2LUSA 2Z9SA 1QQ2A 3TKQA 2R6KA 3LYPA 2HRFA 4HQSA 3WD6A 1PMTA 1SK1A 3QAWA 4CHSA 3EWLA 2H0HA 3J7Yk 5IPHA 2C3TA 3ZZXA 2GSRA 3ERWA 4ILFA 4PNFA 4WEYA 2GQMA 5DBQA 5CRDA 5GSTA 5JWOB 2E7PA 5ENUA 2KP2A 2K6VA 5A4VA 4YH2A 3U6VA 4N10A 3MWHA 2O85A 1ERVA 4NMUA 2BTOT 3EVIA 3VI5A 1HNBA 3S9FA 3FZ5A 4GF0A 2MBSA 3L9UA 4G9HA 4IELA 3UARA 2TRCP 2P31A 1FAAA 3FR9A 3KTBA 4YQUA 4ULXA 1U3AA 1UA5A 3GV1A 5HR1A 4IVFA 4EXJA 3KJYA 2GS3A 3I43A 1T4ZA 5G1LA 3KXOA 4PX1A 1V40A 2LTKA 5ELGA 2H19A 4K2DA 2FUG2 2VL9A 4DEJA 3H8QA 5B6NA 3VI7A 1X5EA 4EO3A 2DJ2A 2FWFA 17GSA 1OVNA 2IWTA 3UBLA 1H4OA 2JZSA 4KNDA 5DCHA 5D73A 2RUEA 3CSIA 3GL3A 3HY2A 2MYGA 4F9ZA 2YV9A 4ID0A 2DLXA 1ZYEA 2C1YA 3GFKA 2OA7A 5G31A 5HFKA 3QMXA 2H76A 3CMIA 1WE0A 3ZL5A 3Q74A 2YP6A 5F8BA 3C7MA 3W6GA 3F6DA 4OFNA 4CDOA 5F07A 3F4TA 1Z6MA 3TB2A 2IN3A 4K7OA 2QGVA 3CRUA 1TU7A 4PXOA 2HRKA 2F9SA 3GSSA 1MD4A 2WRTA 1B48A 3IA1A 5CRWA 1IYIA 2VCQA 2LSTA 2YWIA 3QCPA 1GTBA 5EPFA 1ZZYA 2L4CA 4TXOA 4LMVA 8GSSA 5HQPA 1OKDA 3HHVA 2IFQA 3GL5A 1A0RP 5D9VA 3LXZA 2H73A 3E0UA 1SL2B 4BVXA 3A2VA 4DSSB 1TK5B 5ECHB 1GUMA 2FA8A 3P7XA 3VPQA 3NIVA 3WYWA 3ZMKA 3TRPA 3M9KA 3APOA 1DBYA 1ILOA 4PGTA 4MF5A 1B4QA 3F6FA 1OE7A 4I6XA 3DIEA 1XWKA 3QPMA 1FHEA 1T8EB 1WWJA 4OFMA 4NV5A 4KSMA 3E3EA 1KNGA 4XS4B 4AF2A 1GP1A 2ON7A 2ES7A 3UMAA 2VCTA 3KCMA 3O3TA 2X64A 2TIRA 1N8JA 3R2QA 1R5AA 1AQVA 3WGEA 4LL1B 1C72A 5IOXA 2XPDA 3EU3A 3KIJA 3GX0A 3JCML 2VL2C 1XVWA 4MDCA 4ZILA 3M3MA 3PH9A 3KMNA 4V1Ag 16GSA 5FT3A 6GSTA 1WIKA 3F8UA 4IW9A 1S3DA 1TRWA 3W8SA 1XPVA 3GH6A 2O8VB 2AHEA 1GSFA 2LRTA 3IAM2 4XRDA 2PWJA 3TKRA 2YWOA 3H4KA 3RHBA 3TKSE 3F4SA 2H1AA 4IJ3A 2UZ8A 3LG6A 4TW5A 5G5FA 3LEFA 3PINA 1I5GA 1G0TA 3IAS2 4NAXA 3DKSA 2WDUA 1XWAA 5LCZA 3TOUA 2PVQA 10GSA 3V1WA 1XWBA 1S3CA 2CAQA 4NXIA 5KN1A 5D8IA 3GTUA 2HE3A 2YOIA 1S3AA 4BWSA 4IP1A 2HXKA 2PBJA 2OJLA 1EOHA 3MSZA 5ECLB 4KDUA 3UAPA 4L5LA 3IC4A 3IV4A 3GUSA 1DUGA 3IRAA 1Z6NA 4WBRD 2H30A 1PX7A 4MJBA 1GTIA 2H1DA 5IO2A 3HVSA 2IMDA 3EYTA 5J41A 2FCHA 3BOAA 2XBQA 4NHWA 4TR0A 4KGIA 1SD9A 2LQOA 1SD8A 4TN8A 4NV2A 2GGTA 1QXHA 2JADA 1F6MC 4ZBBA 5ECNB 1EGOA 4XS1A 4L0UA 1EEMA 1K0OA 3Q18A 2OE0A 1GLQA 2H71A 2QSIA 2VO4A 3PGTA 1HNCA 2LJRA 2VLVA 3TJFA 1URMA 2H75A 1USBA 1XIYA 1PA3A 2OE3A 5G30A 5KN2A 1UN2A 1F3AA 2M72A 4V1Ap 1SJIA 2FLSA 3GNJA 1ABAA 4KB3A 1XWCA 2ZCTA 4MZWA 3GKKA 1F37A 1Z7PA 1K0AA 5DQYA 1GSYA 2LQQA 2YV7A 1LU4A 2KLXA 1XW6A 2V1MA 1SJ6A 20GSA 3IR4A 5G2ZA 13GSA 1YY7A 2XC2A 2XPEA 4OCEA 4GLTA 2R5GA 3WT1A 1N2AA 3VLNA 1SJZA 3HD5A 3GKXA 4KAEA 3QOUA 1F3BA 2KOKA 3LXTA 2R4VA 2L6CA 3ME8A 2OBKA 1F2EA 1OE8A 1Q4JA 2VCZA 3GMFA 3EMPA 3L0HA 4OWYA 3ZREA 2VCWA 5GSSA 4LL4B 4XS6A 1QMVA 3R3EA 3C8EA 4BL7B 2H70A 2RM5A 5E59A 3HJPA 1X9MB 2AUVA 2AB6A 1EGRA 5IQYA 3UJ1A 5DAKB 4BPYA 1GULA 2ON5A 1X9WB 3KH9A 1XZOA 2WFCA 12GSA 1TDIA 1FG4A 4IGJA 3UL3A 4POMA 3TJGA 3VWWA 1H75A 4BVYB 4F0BA 1BEDA 1K3LA 1U6TA 5FWGA 1TW9A 4HJ2A 3VURA 3BCKA 2VCVA 2FY6A 4ZBDA 2VL2A 1F9MA 3ZIVA 2B7KA 2PVOC 2NVLA 4MPFA 3LJRA 4IKHA 1ACVA 2HSYA 1XCCA 5ECMB 2N5AA 2P5RA 4N0VA 1EP7A 3I6AA 4G2EA 5IMVA 5JCGA 3G9BA 5B6MA 3CBUA 2GSTA 1G7OA 2VOCA 2PPTA 4MK3A 4CW9A 2M80A 5EL8A 3VWUA 1K0DA 4TOPA 1SENA 1O7UA 2NTOA 4ECJA 1JZDA 4PTSA 1A23A 3IC8A 5J4UA 3CRTA 1JZRA 1WMJA 1A24A 2RLIA 5KN0A 3N5OA 1KBNA 4V2MA 1AQXA 2GLRA 1VF2A 2K8SA 4MP4A 1OYJA 3APQA 5JWRB 5HR0A 4HS1A 1AIUA 2L4QA 3DXBA 2C8UA 1OC9A 3A5WA 5E4WA 3EURA 1AC1A 4IQ1A 1TI3A 2YANA 4FYBA 1Y25A 4Q5NA 2K9FA 2LV3A 5CAXA 4FQUA 2GTUA 3D0ZA 1T4YA 1K3YA 1TK0B 2N5BA 2HZFA 5ECQB 4KF9A 4I97A 1AAZA 3OR5A 3LWAA 4OCFA 1ZMAA 1BX9A 1MDKA 1YKCA 4F2IA 2L5LA 3GKMA 2YZHA 2TRXA 2CX4A 1IYHA 3SWLA 4DSQA 3QR6A 1JLVA 2EIRA 5J3RA 1RQMA 4O32A 3D5JA 2R37A 2X99A 5KEJA 2V32A 4OD7A 2HNLA 4K8MA 4ZB9A 1ERWA 2GQLA 2F3MA 2H6XA 3GRXA 1FB6A 4EUYA 4RI6A 3L9SA 1QK8A 4HUAA 2CA8A 2B5EA 2B3SA 1OC3A 1M9BA 3GH9A 3H1NA 1RW1A 5J9CA 2JZTA 4GQCA 2AYTA 4EF0A 4TXVA 2IMEA 2KP1A 4IHUA 2J23A 4MF7A 1VF4A 1B4PA 3QAGA 6GSWA 4MZBA 4G0LA 3HDCA 4J57E 2HZEA 2F51A 4D73A 4O92A 5ECRB 4GCIA 1GL8A 2ZUPA 1K3OA 3FR3A 2B1KA 2MMOA 3NZNA 2YWMA 3TKSC 4HZ2A 1TRUA 3IK7A 2GZYA 2KHPA 2GDRA 2E0QA 1GRXA 4EE0A 3F4RA 2GSSA 4EKZA 2YZUA 2HRAA 3UEMA 4EC0A 1PSQA 1PRXA 5F06A 3IOSA 3VFIA 2V2GA 3QD9A 3ZITA 2H01A 3TJJA 9GSSA 1V9WA 4EL1A 4Z7XA 4TR1A 3QFAC 3AY8A 1THOA 1AXDA 2XBIA 4TKYA 2GT5A 4AGSA 1BAYA 5AIVA 3EMXA 4JBBA 4WF4A 4MF6A 4WR5A 2IMFA 4HZ4A 2I9HA 4HDEA 4O5RA 1WPIA 1GSEA 1KEBA 5J5NA 4DVCA 3ZMLA 2NBSA 2YWNA 3UBKA 2JL4A 3TGZA 2PGTA 4FIWA 5DALB 4HQZA 1EV4A 5HR2A 3IK9A 4K7IA 1O8XA 3CSJA 2FWGA 2C0EA 4XCSA 4KH7A 3HJOA 2GQKA 3WT2A 4ML1A 3DRNA 2H74A 4MMMA 4PQIA 5C04A 5CREA 1AW9A 1R7HA 2VM2A 3IXRA 1NM3A 3TKPA 4POBA 1Y6EA 5H5QA 4ZXGA 3FW2A 5CYYA 1LJRA 4MJEA 1SK2A 3EINA 2VD0A 1A2LA 5IMCA 4ACSA 2RUFA 1BYEA 4FYCA 2LNSA 4XTSA 2DJ1A 4QL7A 4POLA 1GSSA 1AQWA 2MBTA 1YDKA 2P0GA 1RK4A 1EEJA 3KP9A 4MCUA 5DDLA 4MJAA 3IDVA 4OFTA 2HSMB 2VD1A 4NWYA 3US3A 3Q6OA 3HYPA 1B8XA 4LLRA 1M2DA 4IP6A 1E6BA 5D9TA 5DVBA 4K0GA 2HSNB 4FH8A 1X5CA 4TR4A 3G7JA 3KZQA 5HFIA 3LGCA 4AJ8A 2HRNA 1J08A 3MAKA 2LJKA 4J2FA 1M7TA 1V98A 1XW9A 2FGXA 2DJKA 4V2NA 2NPBA 3LORA 3K8NA 2FWEA 2O7KA 4G0KA 4K0NA 5D96A 4WBJA 2VLTA 2WJUA 1ON4A 2D2ZA 19GSA 1PX6A 2DIYA 2JU5A 1A2JA 1SK0A 3I69A 4I5QA 2XHFA 2YJHA 1YJ6A 3ZIJA 4IBPA 5ECIB 1GLPA 1SYRA 3F3RA 5G1KA 2C80A 1GSUA 1XOBA 3DD3A 1DE2A 3HKRA 4MZCA 1PL2A 1XVQA 3M9JA 2C4JA 3P2AA 3GURA 3N9JA 2DJ0A 4KA0A 2CVBA 3UOMA 2DC5A 2K18A 2LS5A 3QAVA 1SL1B 2B7JA 4RQXA 3F0IA 4GSNA 2HYXA 3EE2A 4YAVA 3ISOA 2FD3A 4MA9A 5CP1A 4DSRA 2IMKA 2QKEA 3M0FA 1GSDA 4PUAA 3BBYA 5ECOB 3KD0A 2LNTA 4HJMA 4XS4A 2WS2A 1PL1A 3GIXA 2WB9A 4EDZA 3TKSA 1EOGA 2DBCA 1JHBA 4HI7A 3HJMA 1GTAA 1T7PB 1T3BA 4JR4A 3FZAA 3ED3A 2YN1A 1JZWA 4N11A 3TJKA 1M99A 4FYUA 1BJXA 1YF0A 5ID2A 3CXGA 2H66A 1M0UA 5B8AA 3ZVJA 2VLUA 4K1FA 4MH3A 2H6ZA 3NOFA 1YF1A 1EWXA 4ZIJA 4K9ZA 4ZL7A 4RUVA 3TDGA 2LKUA 2HLSA 3TRQA 1ML6A 1MDIA 3IBHA 3ZFBA 1TOFA 1V57A 1OAZA 2MMZA 3UVHA 1K0MA 2GZPA 1TRVA 3ZTLA 2RM6A 2J9HA 4ZB6A 1VF3A 3HA9A 3RDWA 4GQFA 3KH7A 1G6YA 4OMVA 4G10A 1K0CA 2F8FA 1U88A 5L71A 3TCOA 1U3IA 4ECIA 1XBSA 4MJCA 1UC7A 3MDKA 1YZXA 6GSUA 4ECBA 1A2MA 4X1UA 2DJJA 3APSA 2AJQB 3GSTA 11GSA 3CYNA 4MH2A 5GAND 5LNKe 4LMWA 4MABA 2IPAA 1FO5A 4WXTA 2H0IA 1GUHA 3GYKA 4E8HA 2CVDA 2CVKA 3H79A 2HRKB 2MMNA 4P3YB 1Z7RA 1WP0A 3KP8A 3VPTA 3E9JB 5IMAA 2I81A 1THXA 2AAWA 5CO3A 3RPNA 1X5DA 2YPMA 4TXOB 1NSWA 1G6WA 1GWCA 3GA4A 2IFQB 1O81A 1MEKA 2HFDA 5D9XA 6GSXA 2KUCA 3DVWA 3HXSA 1OC8A 1Z5YE 1O73A 2PUKC 5INYA 4BVXB 4F82A 4K7NA 1O8WA 1MD3A 3VWXA 5G5EA 4IS0A 3TOTA 1R4WA 1EZKA 4KDYA 4ZBAA 3MNGA 1SKWB 4JR6A 2ALBA 5DJLA 1K0NA 4O7HA 1E2YA 1WOUA 3FK8A 2H8LA 2A2SA 1TJDA 4Q5QA 1ERTA 1EV9A 4KUNA 3RPPA 2A2RA 3D4TA 4L0WA 3DYRA 4PURA 4ML6A 2DMMA 3LQ7A 3GX8A 4JE1A 4MLYA 3QFBC 4I2UA 2PU9C 4GRFA 1SYXA 1V58A 2O89A 2I1UA 3D4MA 4J56E 2ZNMA 4BWQA 4HU7A 3FHKA 5CNWA 1Q98A 1ZCPA 3ZFLA 4OO4A 1VRSD 2PMTA 3A3TA 2JSZA 2DIZA 2WCIA 2DSAA 2LRNA 1GTUA 2CX3A 1XFLA 4KDXA 5BMUA 3P90A 2DMLA 2PN8A 3BJ5A 3KM6A 2JSYA 1HD2A 2VM1A 1YEXA 2JACA 1XOAA 4ISDA 2CZ3A 4KE3A 1DSBA 1GNWA 1M2AA 5ECKB 1X9SB 4BL7A 1MDJA 3J7Yb 3F3QA 3PR8A 2CAIA 1UVZA 18GSA 3VK9A 2OADA 4KCAA 5KN3A 1TI1A 5DAKA 3TUEA 3FYGA 1B9YC 2C0GA 4L5OA 3P8WA 1DE1A 1HYUA 5GAPD 2E2GA 3GTUB 2L6DA 4BVYA 5IOWA 4TVEA 2I3YA 2PERA 3VWVA 1QFNA 2HQTA 3BCIA 1GNEA 1NHYA 3CTGA 4X0XA 3C71A 1TP9A 5FHIA 3ZVJD 2IIYA 1JZOA 2AV4A 3EU4A 3FZ9A 3RAZA 1A0FA 3UIWA 2VCXA 1XWGA 4IJIA 4IN0A 2H72A 1ZGNA 1W4VA 2I4AA 1QUWA 3DEXA 1XW5A 2BJXA 1AUCA 2GVPA 1GH2A 2C3NA 1M2BA 1A8LA 2VIMA 5ECPB 2OBIA 3ERGA 5JCUA 1GSQA 4NHZA 2M46A 1FOVA 3FRCA 1PQNA 4ZL9A 4HU9A 2G0FA 1SL0B 1V2AA 4I2TA 1J9BA 3WGDA 3D21A 4EVMA 3FZ4A 2WZ9A 3A2XA 4N0ZA 3C73A 2LEGA 2OACA 4N30A 2FHEA 5J9BA 3G7IA 1BQ7A 2CZ2A 2R2JA 3EC3A 4F0CA 5IIZA 2G2QA 1ST9A 2V6OA 4EDYA 4QQ7A 4WR4A 2IL3A 1FB0A 3ZRDA 5B8BA 1SKSB 2VAFA 5H5SA 2X8HA 1VGLA 4QL9A 2X8CA 1K0BA 3ZLPA 1FW1A 4I8BA 4GXZA 5LD0A 1TK8B 1YEPA 1QGVA 2A4VA 3HVVA 2B6MA 2H1GA 4HEA2 5ID2B 3HZ4A 3IHQA 3RHCA 3O76A 5EY6A 1ZYQB 1HQOA 5F0GA 4JRRA 3C1SA 2GZZA 14GSA 2LRCA 4KW6A 4L8EA 2IMIA 4KX4A 5B7CA 1WJKA 2H6YA 1Z9HA 3DGQA 1FVJA 5GZZB 4WETA 5IMFA 4TRXA 2JZRA 5DQSA 3ME7A 3I9V2 4GWRA 3L78A 1LBKA 3TRXA 3O6TA 1PN9A 5F05A 2C3QA 3GHAA 4TR3A 3RBTA 3GKNA 2LJAA 4WKWA 3IE3A 2L5OA 1O85A 1GUKA 2RIIA 2MZCA 2EIQA 2EC4A 3IPZA 5ECSA 3KTLA 3L9VA 4GTUA 4AJ7A 1U87A 1XXUA 5EVOA 2FA4A 1ZL9A 3H93A 5H5RA 3DVXA 1G7EA 2O87A 3G7YA 5AISA 4ECCA 1R26A 2CV4A 1SU9A 2DJ3A 5COHA 4PUFC 4ZL8A 4V2LA 4G0IA 2WULA 1M9AA 2E2MA 2CT6A 2WGRA 2P5QA 1KTEA 2B1LA 2CQ9A 4Q5RA 5IPGA 4AJ6A 3CTFA 4XHMA 4DSSA 1PKWA 3ERFA 4USSA 1T1VA 3M8NA 1JLWA 1A8YA 1NW2A 2VL3A 1VF1A 3L4NA 4F03A 5IM9A 3F9UA 2EIOA 2V41A 4JZQA 1PKZA 2HSHA 4Q5FA 2F8AA 5CRGA 2GSQA 1CQHA 4YQMA 2N5FA 5AGYA 3QDNA 3LYKA 4XRAA 1R5PA 1Z3EA 2HI7A 5DALA 1OC9B 5IMZA 5AIXA 1WRYA 3HZ8A 4MPGA 5A5KA 2K8VA 3F63A 3UVTA 2X8GA 5HR3A 5CRHA 5C00A 3WGXA 1CQGA 5ABRA 4H86A 2OE1A 1T00A 3FY7A 3LSZA 4LA1A 1NHOA 2YJ7A 4GSTA 1HNAA 1MTCA 3SBCA
chains in the Genus database with same CATH superfamily
4X43A 3CWGA 5J4VA 4IQAA 5ELAA 3TJBA 4PQ1A 5JCWA 5D9WA 1O6JA 2YNXA 5J47A 2VUPA 4G19A 2V6KA 2HT9A 3KEBA 1FVKA 3M1GA 5HFGA 4K6XA 4XIHA 3PPUA 3D22A 4PQHA 4O5QA 6GSVA 1PGTA 4GSSA 1TRSA 2FWHA 5IO0A 2WVXB 2MMAA 5DCGA 3HCZA 3U5RE 3FEUA 2HSMA 3DWVA 4KCEA 1BG5A 2R3XA 4PNGA 3KGKA 4WF5A 1PD21 2NDOA 4NPBA 1W89A 1TKDB 2HSNA 1SKRB 2WW3A 6GSSA 1YQ1A 22GSA 3Q19A 4JEDA 1J0FA 1TXXA 1EP8A 4POKA 1OKTA 3W8JA 6GSYA 1TTZA 5A4UA 3D6IA 4KSOA 3LFLA 2HZEB 4E8EA 1B9XC 4D73B 3C1RA 4RQRA 2L57A 3A2WA 1YKAA 4ZB8A 2GT6A 4FO5A 2YCDA 5AN1A 1ZOFA 3HVXA 2OKAA 3KMOA 2REMA 2FNOA 5DJMA 4YAPA 3FKFA 4OO5A 2B5YA 3CSHA 3GN3A 5IMDA 2C0FA 4HOJA 5A4WA 4YQVA 2BMXA 2B5XA 2L59A 3FR6A 5D93A 3ZYWA 4RI7A 1I9DA 5JWQB 2H1BA 2QC7A 1X0RA 2IJYA 2H0GA 1JFUA 7GSSA 3DMLA 4BA7A 3BD2A 1ERUA 1TU8A 4TR1B 2C0DA 4JU5A 2LUSA 2Z9SA 1QQ2A 3TKQA 2R6KA 3LYPA 2HRFA 4HQSA 3WD6A 1PMTA 1SK1A 3QAWA 4CHSA 3EWLA 2H0HA 3J7Yk 5IPHA 2C3TA 3ZZXA 2GSRA 3CQFA 3ERWA 4ILFA 4PNFA 4WEYA 2GQMA 5DBQA 5CRDA 2WVZA 5GSTA 5JWOB 2E7PA 5ENUA 4QMKA 2KP2A 2K6VA 5A4VA 4YH2A 3U6VA 4ICYA 4N10A 3MWHA 2O85A 1ERVA 4NMUA 2BTOT 3EVIA 3VI5A 1HNBA 3S9FA 3FZ5A 4AKGA 4GF0A 2MBSA 3L9UA 4G9HA 4IELA 3UARA 2TRCP 4AI6A 2P31A 1FAAA 3FR9A 3KTBA 4YQUA 4ULXA 1U3AA 1UA5A 3GV1A 5HR1A 4IVFA 4EXJA 3KJYA 2GS3A 3I43A 1T4ZA 5G1LA 2WZSA 3KXOA 4PX1A 1V40A 2LTKA 5ELGA 2H19A 4K2DA 2FUG2 2VL9A 5A5HB 4DEJA 3H8QA 5B6NA 3VI7A 1X5EA 4EO3A 2DJ2A 2FWFA 17GSA 1OVNA 2IWTA 3UBLA 1H4OA 2JZSA 4KNDA 5DCHA 5D73A 2RUEA 4K5RA 3CSIA 3GL3A 3HY2A 2MYGA 4F9ZA 2YV9A 4ID0A 2DLXA 1ZYEA 2C1YA 3GFKA 2OA7A 5G31A 5HFKA 5A1NA 3QMXA 2H76A 3CMIA 1SVMA 1WE0A 1I1IP 3ZL5A 3Q74A 3RFRC 2YP6A 5F8BA 3C7MA 4PHZC 3W6GA 3F6DA 4OFNA 4CDOA 5F07A 3F4TA 1Z6MA 3TB2A 2IN3A 4K7OA 2QGVA 3CRUA 1TU7A 4PXOA 2HRKA 2F9SA 3GSSA 1MD4A 3A5IA 2WRTA 1B48A 3IA1A 5CRWA 1IYIA 2VCQA 2LSTA 2YWIA 3QCPA 4AKXB 1GTBA 5EPFA 1ZZYA 2L4CA 4TXOA 4LMVA 8GSSA 1YVLA 5HQPA 1OKDA 3HHVA 2IFQA 3GL5A 1A0RP 5D9VA 3LXZA 2H73A 3E0UA 1SL2B 4BVXA 3A2VA 4DSSB 1TK5B 5ECHB 1GUMA 2FA8A 1N25A 3P7XA 3VPQA 1XG8A 3NIVA 3WYWA 3ZMKA 3TRPA 3M9KA 3APOA 1DBYA 1ILOA 4PGTA 4MF5A 1B4QA 4AKHA 3F6FA 1OE7A 4I6XA 3DIEA 1XWKA 3QPMA 1FHEA 1T8EB 1WWJA 4OFMA 4NV5A 4KSMA 3E3EA 1KNGA 4XS4B 1FOHA 4AF2A 1GP1A 2ON7A 2ES7A 3UMAA 2VCTA 3KCMA 3O3TA 2X64A 2TIRA 1N8JA 3R2QA 1ZYPA 1R5AA 1AQVA 3WGEA 4LL1B 1C72A 5IOXA 2XPDA 3EU3A 3KIJA 3GX0A 3JCML 2VL2C 1XVWA 4MDCA 4ZILA 3M3MA 3PH9A 3KMNA 4V1Ag 16GSA 5FT3A 6GSTA 1WIKA 3F8UA 4IW9A 1S3DA 1TRWA 3W8SA 1XPVA 3GH6A 2O8VB 5BRTA 2AHEA 1GSFA 2LRTA 3IAM2 4XRDA 2PWJA 3TKRA 2YWOA 3H4KA 3RHBA 3TKSE 1Y1UA 3F4SA 2H1AA 4IJ3A 2UZ8A 3LG6A 4TW5A 5G5FA 3LEFA 3PINA 1I5GA 1G0TA 3IAS2 4NAXA 3DKSA 2WDUA 1XWAA 4E68A 5LCZA 3TOUA 2PVQA 10GSA 3V1WA 1XWBA 1S3CA 2CAQA 2EFEA 4NXIA 5KN1A 5D8IA 3GTUA 2HE3A 2YOIA 1S3AA 4BWSA 4IP1A 2HXKA 2PBJA 2OJLA 1EOHA 3MSZA 5ECLB 4KDUA 3UAPA 4L5LA 3IC4A 3HMJG 3IV4A 3GUSA 1DUGA 3IRAA 2A2PA 1Z6NA 4BIKA 4WBRD 2H30A 1PX7A 3TU3B 4MJBA 1GTIA 2H1DA 5IO2A 3HVSA 2IMDA 3EYTA 5J41A 2FCHA 3BOAA 2XBQA 4NHWA 4TR0A 4KGIA 1SD9A 2LQOA 1SD8A 4TN8A 5A34B 4NV2A 2GGTA 1QXHA 2JADA 1F6MC 4ZBBA 5ECNB 1EGOA 4XS1A 4L0UA 1EEMA 1K0OA 3Q18A 2OE0A 1GLQA 2H71A 2QSIA 1TXUA 2VO4A 3PGTA 1HNCA 2LJRA 2VLVA 3TJFA 1URMA 2H75A 1USBA 1XIYA 1PA3A 2OE3A 5G30A 5KN2A 1UN2A 1F3AA 2M72A 4V1Ap 1SJIA 2FLSA 3GNJA 1ABAA 4CY8A 4KB3A 1XWCA 2ZCTA 4MZWA 3GKKA 1F37A 1Z7PA 1K0AA 5DQYA 1GSYA 2LQQA 2YV7A 1LU4A 2KLXA 1XW6A 2V1MA 1SJ6A 20GSA 3IR4A 5G2ZA 13GSA 1YY7A 2XC2A 2XPEA 1BG1A 4OCEA 4GLTA 2R5GA 3WT1A 1N2AA 2VKZG 3VLNA 1SJZA 3HD5A 1SVOA 3GKXA 4KAEA 3QOUA 2DKIA 1F3BA 2KOKA 3LXTA 2R4VA 2L6CA 3ME8A 2OBKA 1F2EA 5BMUB 1OE8A 1Q4JA 2VCZA 3GMFA 5KOWA 3EMPA 3L0HA 4OWYA 3ZREA 2VCWA 5GSSA 4LL4B 4XS6A 1QMVA 3R3EA 3C8EA 4BL7B 2H70A 2RM5A 5E59A 2R0PA 3HJPA 1X9MB 2AUVA 2AB6A 4N3ZA 1EGRA 5IQYA 3UJ1A 5DAKB 4BPYA 1GULA 2ON5A 1X9WB 3KH9A 1XZOA 2WFCA 12GSA 1TDIA 1FG4A 4IGJA 3UL3A 4POMA 3TJGA 3VWWA 1H75A 4BVYB 4F0BA 1BEDA 1K3LA 1U6TA 5FWGA 4Z2UA 1TW9A 4HJ2A 5A1NB 3VURA 3BCKA 2VCVA 2FY6A 4ZBDA 2VL2A 4PI0C 1F9MA 3ZIVA 2B7KA 2PVOC 2NVLA 4MPFA 3LJRA 4IKHA 1ACVA 2HSYA 1XCCA 5ECMB 2N5AA 2P5RA 4N0VA 1EP7A 3I6AA 4G2EA 5IMVA 5JCGA 3G9BA 5B6MA 3CBUA 2GSTA 1G7OA 2VOCA 2PPTA 4MK3A 4CW9A 2M80A 5EL8A 3VWUA 1K0DA 4TOPA 5J40A 1SENA 1O7UA 2NTOA 4ECJA 1JZDA 4PTSA 1A23A 3IC8A 5J4UA 3CRTA 1JZRA 1WMJA 1A24A 2RLIA 5KN0A 3N5OA 1KBNA 4V2MA 1AQXA 2GLRA 1VF2A 2K8SA 4MP4A 1OYJA 3APQA 5JWRB 2DKHA 5HR0A 4HS1A 1AIUA 2L4QA 3DXBA 2C8UA 1OC9A 3A5WA 3LW9A 5E4WA 3EURA 1AC1A 4IQ1A 1TI3A 2YANA 4FYBA 1Y25A 4Q5NA 2K9FA 2LV3A 5CAXA 4FQUA 2GTUA 3D0ZA 1T4YA 1K3YA 1TK0B 2N5BA 2HZFA 5ECQB 4KF9A 4I97A 1AAZA 3OR5A 3LWAA 4OCFA 1ZMAA 1BX9A 1MDKA 1YKCA 4F2IA 2L5LA 3GKMA 2YZHA 2TRXA 2CX4A 2WW2A 1IYHA 3SWLA 4DSQA 3QR6A 1JLVA 2EIRA 5J3RA 1RQMA 4O32A 3D5JA 2R37A 2X99A 5KEJA 2V32A 4OD7A 2HNLA 4ZB9A 1ERWA 4K8MA 2GQLA 2F3MA 2H6XA 3GRXA 1FB6A 2WVXA 4EUYA 4RI6A 3L9SA 1QK8A 4HUAA 2CA8A 2B5EA 2B3SA 1OC3A 1M9BA 3GH9A 3H1NA 2X49A 1RW1A 5J9CA 2JZTA 4GQCA 2AYTA 4EF0A 4TXVA 1YEWC 2IMEA 2KP1A 4IHUA 2J23A 4MF7A 1VF4A 1B4PA 3QAGA 6GSWA 4MZBA 4G0LA 3HDCA 4J57E 2HZEA 2F51A 4D73A 4O92A 5ECRB 4GCIA 1GL8A 2ZUPA 1K3OA 3FR3A 2B1KA 2MMOA 3NZNA 2YWMA 3TKSC 4HZ2A 1TRUA 3IK7A 2GZYA 2KHPA 4MNNA 2GDRA 2E0QA 1GRXA 1PFOA 4EE0A 3F4RA 2GSSA 4EKZA 2YZUA 2HRAA 3UEMA 4EC0A 1PSQA 4GDFA 1PRXA 5F06A 3IOSA 3VFIA 2V2GA 3QD9A 3ZITA 2H01A 3TJJA 9GSSA 3CHXC 5KOXA 4CY6A 1V9WA 4EL1A 4Z7XA 4TR1A 3QFAC 3AY8A 1THOA 1AXDA 2XBIA 4TKYA 2GT5A 4AGSA 1BAYA 5AIVA 3EMXA 4JBBA 4WF4A 4MF6A 4WR5A 2IMFA 4HZ4A 2I9HA 4HDEA 4O5RA 1WPIA 1GSEA 1KEBA 5J5NA 4DVCA 3ZMLA 2NBSA 2YWNA 3UBKA 2JL4A 4ZB7A 3TGZA 2PGTA 4FIWA 5DALB 4HQZA 1EV4A 5J4YA 5HR2A 3IK9A 4K7IA 2H1LA 1O8XA 3CSJA 2FWGA 2C0EA 4XCSA 4KH7A 3HJOA 2GQKA 3WT2A 4ML1A 1S3RA 3DRNA 2H74A 4MMMA 2A4HA 4PQIA 5C04A 5CREA 1AW9A 1R7HA 2VM2A 3IXRA 1NM3A 3TKPA 4POBA 1Y6EA 5H5QA 4ZXGA 1ZYNA 3FW2A 5CYYA 1LJRA 4MJEA 1SK2A 3EINA 2VD0A 1A2LA 5IMCA 4ACSA 2RUFA 1BYEA 4FYCA 2LNSA 4XTSA 2DJ1A 4QL7A 4POLA 1GSSA 1AQWA 2MBTA 1YDKA 1PN0A 2P0GA 1RK4A 1EEJA 3KP9A 4MCUA 5DDLA 5A5HA 4MJAA 3IDVA 4OFTA 2HSMB 2VD1A 4NWYA 3US3A 3Q6OA 3HYPA 1B8XA 4LLRA 1M2DA 4IP6A 1E6BA 5D9TA 5DVBA 4K0GA 2HSNB 4FH8A 1X5CA 4TR4A 3G7JA 3KZQA 5HFIA 2WVYA 3LGCA 4AJ8A 2HRNA 1J08A 3MAKA 2LJKA 4J2FA 1M7TA 1V98A 1XW9A 4G01A 2FGXA 2DJKA 4V2NA 2NPBA 3LORA 3K8NA 2FWEA 2O7KA 4G0KA 4K0NA 5D96A 4K5SA 4WBJA 2VLTA 2WJUA 1ON4A 2D2ZA 19GSA 1PX6A 2DIYA 2JU5A 1A2JA 1SK0A 3I69A 4I5QA 2XHFA 2YJHA 1YJ6A 3ZIJA 4IBPA 5ECIB 1GLPA 1SYRA 3F3RA 5G1KA 2C80A 1GSUA 1M3JA 1XOBA 3DD3A 1DE2A 3HKRA 4MZCA 1PL2A 1XVQA 3M9JA 2C4JA 3P2AA 3GURA 3N9JA 2DJ0A 4KA0A 2CVBA 3UOMA 2DC5A 2K18A 2LS5A 3QAVA 1SL1B 2B7JA 4RQXA 3F0IA 4GSNA 2HYXA 3EE2A 4YAVA 3ISOA 2FD3A 4MA9A 5CP1A 4DSRA 2IMKA 2QKEA 3M0FA 1GSDA 4PUAA 3BBYA 5ECOB 2EFHA 3KD0A 2LNTA 4HJMA 4XS4A 2WS2A 1PL1A 3GIXA 2WB9A 4EDZA 3TKSA 1EOGA 2DBCA 1JHBA 4HI7A 3HJMA 1GTAA 2EFDA 1T7PB 1T3BA 4JR4A 3FZAA 3ED3A 2YN1A 1JZWA 4N11A 3TJKA 1M99A 2UV8G 4FYUA 1BJXA 1YF0A 5ID2A 3CXGA 2H66A 1M0UA 5B8AA 3ZVJA 2VLUA 4K1FA 4MH3A 2H6ZA 4Z2RA 3NOFA 1YF1A 1EWXA 4ZIJA 4K9ZA 4ZL7A 4RUVA 3TDGA 2LKUA 2HLSA 3TRQA 1ML6A 1MDIA 3IBHA 3ZFBA 1TOFA 1V57A 1OAZA 2MMZA 3UVHA 1K0MA 2GZPA 1TRVA 3ZTLA 2RM6A 2J9HA 4ZB6A 1VF3A 3HA9A 3RDWA 4GQFA 3KH7A 1G6YA 4OMVA 4G10A 1K0CA 2F8FA 2QA2A 1U88A 1BF5A 5L71A 3TCOA 1U3IA 4ECIA 1XBSA 4MJCA 1UC7A 3MDKA 3RGBC 6GSUA 1YZXA 4ECBA 1A2MA 4X1UA 2DJJA 3APSA 2AJQB 3GSTA 11GSA 4EIQA 3CYNA 4MH2A 4Z2TA 5GAND 5LNKe 4LMWA 4MABA 2IPAA 1FO5A 4WXTA 2H0IA 1GUHA 3GYKA 4E8HA 2CVDA 2CVKA 3H79A 2HRKB 2MMNA 4P3YB 2O36A 1Z7RA 4FXYP 1WP0A 3KP8A 3VPTA 5A34A 3E9JB 5IMAA 2I81A 1THXA 2AAWA 5CO3A 3RPNA 1X5DA 2YPMA 4TXOB 1NSWA 1G6WA 1GWCA 3GA4A 2IFQB 1O81A 1MEKA 2HFDA 5D9XA 6GSXA 2KUCA 3DVWA 3HXSA 1OC8A 1Z5YE 1O73A 2PUKC 5INYA 4BVXB 4K2XA 4F82A 4K7NA 1O8WA 1MD3A 3VWXA 5G5EA 4IS0A 3TOTA 1R4WA 1EZKA 4KDYA 4ZBAA 3MNGA 1SKWB 4JR6A 2ALBA 5DJLA 1K0NA 4O7HA 1E2YA 1WOUA 3FK8A 2H8LA 2A2SA 1TJDA 4Q5QA 1ERTA 1EV9A 4KUNA 3RPPA 2A2RA 3D4TA 4L0WA 3DYRA 4PURA 4ML6A 2DMMA 3LQ7A 3GX8A 4JE1A 4MLYA 3QFBC 4I2UA 2PU9C 4GRFA 1SYXA 1V58A 2O89A 2I1UA 3D4MA 4J56E 2ZNMA 4BWQA 3MYDA 4HU7A 3FHKA 5CNWA 1S4BP 1Q98A 1ZCPA 3ZFLA 2QA1A 4OO4A 1VRSD 3EPTA 2PMTA 3A3TA 2JSZA 2DIZA 2WCIA 2DSAA 2LRNA 4PI2C 1GTUA 2CX3A 1XFLA 4KDXA 5BMUA 3P90A 2DMLA 2PN8A 3BJ5A 3KM6A 2JSYA 1HD2A 2VM1A 1YEXA 2JACA 1XOAA 2R0CA 4ISDA 2CZ3A 4KE3A 1DSBA 1GNWA 1M2AA 5ECKB 1X9SB 4BL7A 1MDJA 3J7Yb 3F3QA 3PR8A 2CAIA 1UVZA 18GSA 3VK9A 2OADA 4KCAA 5KN3A 3HVNA 1TI1A 5DAKA 3TUEA 3FYGA 1B9YC 2C0GA 4L5OA 3P8WA 1DE1A 1HYUA 5GAPD 2E2GA 3GTUB 2L6DA 4BVYA 5IOWA 4TVEA 2I3YA 2PERA 3VWVA 1QFNA 2HQTA 3BCIA 1GNEA 1NHYA 3CTGA 4X0XA 3C71A 1TP9A 5FHIA 3ZVJD 2WW0A 2IIYA 1JZOA 2AV4A 3EU4A 4YKGA 3FZ9A 3RAZA 1A0FA 3UIWA 2VCXA 1XWGA 4IJIA 4IN0A 2H72A 1ZGNA 1W4VA 2I4AA 1QUWA 3DEXA 1XW5A 2BJXA 1AUCA 2GVPA 1GH2A 2C3NA 1M2BA 1A8LA 2VIMA 5ECPB 2OBIA 3ERGA 4W66A 5JCUA 1GSQA 4NHZA 2M46A 1FOVA 3MIXA 3FRCA 1PQNA 4ZL9A 4HU9A 2G0FA 1SL0B 1V2AA 4I2TA 1J9BA 3WGDA 3D21A 4EVMA 3FZ4A 2WZ9A 3A2XA 4N0ZA 3C73A 2LEGA 2OACA 4N30A 2FHEA 5J9BA 3G7IA 1BQ7A 2CZ2A 2R2JA 3EC3A 4F0CA 5IIZA 2G2QA 4O5UA 1ST9A 2V6OA 4EDYA 2X4AA 4QQ7A 4WR4A 2IL3A 1FB0A 2WW1A 3ZRDA 5B8BA 1SKSB 2R0GA 2VAFA 5H5SA 2X8HA 1VGLA 3FMWA 4AKIA 4QL9A 2X8CA 1K0BA 1SVLA 3ZLPA 1FW1A 4I8BA 4GXZA 5LD0A 1TK8B 1YEPA 1QGVA 2A4VA 3HVVA 2B6MA 2H1GA 4HEA2 5ID2B 3HZ4A 3IHQA 3RHCA 3O76A 5EY6A 1ZYQB 1HQOA 5F0GA 4JRRA 3C1SA 2GZZA 14GSA 2LRCA 4KW6A 4L8EA 2IMIA 4KX4A 5B7CA 2H6YA 1WJKA 1Z9HA 3DGQA 1FVJA 5GZZB 4WETA 5IMFA 4TRXA 2JZRA 5DQSA 3ME7A 4HSCX 3I9V2 4GWRA 3L78A 4X4JA 1LBKA 3TRXA 3O6TA 1PN9A 4YKFA 5F05A 2C3QA 3GHAA 4TR3A 3RBTA 3GKNA 2LJAA 4WKWA 3IE3A 2L5OA 1O85A 1GUKA 2RIIA 2MZCA 2EIQA 2EC4A 3IPZA 2O5VA 5ECSA 3KTLA 3L9VA 4GTUA 4AJ7A 1U87A 2O3EA 1XXUA 5EVOA 2FA4A 1ZL9A 3H93A 5H5RA 3DVXA 1G7EA 2OT3A 4A5PA 2O87A 3G7YA 5AISA 4ECCA 1R26A 2CV4A 1SU9A 2DJ3A 5COHA 4PUFC 4ZL8A 4V2LA 4G0IA 2WULA 1M9AA 2E2MA 2CT6A 2EFCA 2WGRA 2P5QA 1KTEA 2B1LA 2CQ9A 4Q5RA 5IPGA 4AJ6A 3CTFA 4XHMA 4DSSA 1PKWA 3ERFA 4USSA 1T1VA 3M8NA 1JLWA 1A8YA 1NW2A 2VL3A 1VF1A 3L4NA 4F03A 5IM9A 4EIPA 3F9UA 3IHGA 2EIOA 2V41A 4JZQA 1PKZA 2HSHA 4Q5FA 2F8AA 5CRGA 2GSQA 1M3IA 1CQHA 4YQMA 2N5FA 5AGYA 3QDNA 3LYKA 4XRAA 1R5PA 1Z3EA 2HI7A 5DALA 1OC9B 5IMZA 5AIXA 1WRYA 3HZ8A 4MPGA 5A5KA 2K8VA 3F63A 3UVTA 2X8GA 5HR3A 5CRHA 5C00A 3WGXA 1CQGA 5ABRA 2OE1A 4H86A 1T00A 3FY7A 3LSZA 4LA1A 1NHOA 2YJ7A 4GSTA 1HNAA 1MTCA 3SBCA
chains in the Genus database with same CATH topology
4X43A 3CWGA 5J4VA 4IQAA 5ELAA 3TJBA 4PQ1A 5JCWA 5D9WA 1O6JA 2YNXA 5J47A 2VUPA 4G19A 2V6KA 2HT9A 3KEBA 1FVKA 3M1GA 5HFGA 4K6XA 4XIHA 3PPUA 3D22A 4PQHA 4O5QA 6GSVA 1PGTA 4GSSA 1TRSA 2FWHA 5IO0A 2MMAA 5DCGA 3HCZA 3U5RE 3FEUA 2HSMA 3DWVA 4KCEA 1BG5A 2R3XA 4PNGA 3KGKA 4WF5A 1PD21 2NDOA 4NPBA 1W89A 1TKDB 2HSNA 1SKRB 6GSSA 1YQ1A 22GSA 3Q19A 4JEDA 1J0FA 1TXXA 1EP8A 4POKA 1OKTA 3W8JA 6GSYA 1TTZA 5A4UA 3D6IA 4KSOA 3LFLA 2HZEB 4E8EA 1B9XC 4D73B 3C1RA 4RQRA 2L57A 3A2WA 1YKAA 4ZB8A 2GT6A 4FO5A 2YCDA 5AN1A 1ZOFA 3HVXA 2OKAA 3KMOA 2REMA 2FNOA 5DJMA 4YAPA 3FKFA 4OO5A 2B5YA 3CSHA 3GN3A 5IMDA 2C0FA 4HOJA 5A4WA 4YQVA 2BMXA 2B5XA 2L59A 3FR6A 5D93A 3ZYWA 4RI7A 1I9DA 5JWQB 2H1BA 2QC7A 1X0RA 2IJYA 2H0GA 1JFUA 7GSSA 3DMLA 4BA7A 3BD2A 1ERUA 1TU8A 4TR1B 2C0DA 4JU5A 2LUSA 2Z9SA 1QQ2A 3TKQA 2R6KA 3LYPA 2HRFA 4HQSA 3WD6A 1PMTA 1SK1A 3QAWA 4CHSA 3EWLA 2H0HA 3J7Yk 5IPHA 2C3TA 3ZZXA 2GSRA 3ERWA 4ILFA 4PNFA 4WEYA 2GQMA 5DBQA 5CRDA 5GSTA 5JWOB 2E7PA 5ENUA 4QMKA 2KP2A 2K6VA 5A4VA 4YH2A 3U6VA 4ICYA 4N10A 3MWHA 2O85A 1ERVA 4NMUA 2BTOT 3EVIA 3VI5A 1HNBA 3S9FA 3FZ5A 4AKGA 4GF0A 2MBSA 3L9UA 4G9HA 4IELA 3UARA 2TRCP 4AI6A 2P31A 1FAAA 3FR9A 3KTBA 4YQUA 4ULXA 1U3AA 1UA5A 3GV1A 5HR1A 4IVFA 4EXJA 3KJYA 2GS3A 3I43A 1T4ZA 5G1LA 3KXOA 4PX1A 1V40A 2LTKA 5ELGA 2H19A 4K2DA 2FUG2 2VL9A 5A5HB 4DEJA 3H8QA 5B6NA 3VI7A 1X5EA 4EO3A 2DJ2A 2FWFA 17GSA 1OVNA 2IWTA 3UBLA 1H4OA 2JZSA 4KNDA 5DCHA 5D73A 2RUEA 4K5RA 3CSIA 3GL3A 3HY2A 2MYGA 4F9ZA 2YV9A 4ID0A 2DLXA 1ZYEA 2C1YA 3GFKA 2OA7A 5G31A 5HFKA 5A1NA 3QMXA 2H76A 3CMIA 1SVMA 1WE0A 3ZL5A 3Q74A 2YP6A 5F8BA 3C7MA 3W6GA 3F6DA 4OFNA 4CDOA 5F07A 3F4TA 1Z6MA 3TB2A 2IN3A 4K7OA 2QGVA 3CRUA 1TU7A 4PXOA 2HRKA 2F9SA 3GSSA 1MD4A 3A5IA 2WRTA 1B48A 3IA1A 5CRWA 1IYIA 2VCQA 2LSTA 2YWIA 3QCPA 4AKXB 1GTBA 5EPFA 1ZZYA 2L4CA 4TXOA 4LMVA 8GSSA 1YVLA 5HQPA 1OKDA 3HHVA 2IFQA 3GL5A 1A0RP 5D9VA 3LXZA 2H73A 3E0UA 1SL2B 4BVXA 3A2VA 4DSSB 1TK5B 5ECHB 1GUMA 2FA8A 1N25A 3P7XA 3VPQA 3NIVA 3WYWA 3ZMKA 3TRPA 3M9KA 3APOA 1DBYA 1ILOA 4PGTA 4MF5A 1B4QA 4AKHA 3F6FA 1OE7A 4I6XA 3DIEA 1XWKA 3QPMA 1FHEA 1T8EB 1WWJA 4OFMA 4NV5A 4KSMA 3E3EA 1KNGA 4XS4B 1FOHA 4AF2A 1GP1A 2ON7A 2ES7A 3UMAA 2VCTA 3KCMA 3O3TA 2X64A 2TIRA 1N8JA 3R2QA 1ZYPA 1R5AA 1AQVA 3WGEA 4LL1B 1C72A 5IOXA 2XPDA 3EU3A 3KIJA 3GX0A 3JCML 2VL2C 1XVWA 4MDCA 4ZILA 3M3MA 3PH9A 3KMNA 4V1Ag 16GSA 5FT3A 6GSTA 1WIKA 3F8UA 4IW9A 1S3DA 1TRWA 3W8SA 1XPVA 3GH6A 2O8VB 5BRTA 2AHEA 1GSFA 2LRTA 3IAM2 4XRDA 2PWJA 3TKRA 2YWOA 3H4KA 3RHBA 3TKSE 1Y1UA 3F4SA 2H1AA 4IJ3A 2UZ8A 3LG6A 4TW5A 5G5FA 3LEFA 3PINA 1I5GA 1G0TA 3IAS2 4NAXA 3DKSA 2WDUA 1XWAA 4E68A 5LCZA 3TOUA 2PVQA 10GSA 3V1WA 1XWBA 1S3CA 2CAQA 2EFEA 4NXIA 5KN1A 5D8IA 3GTUA 2HE3A 2YOIA 1S3AA 4BWSA 4IP1A 2HXKA 2PBJA 2OJLA 1EOHA 3MSZA 5ECLB 4KDUA 3UAPA 4L5LA 3IC4A 3HMJG 3IV4A 3GUSA 1DUGA 3IRAA 2A2PA 1Z6NA 4WBRD 2H30A 1PX7A 3TU3B 4MJBA 1GTIA 2H1DA 5IO2A 3HVSA 2IMDA 3EYTA 5J41A 2FCHA 3BOAA 2XBQA 4NHWA 4TR0A 4KGIA 1SD9A 2LQOA 1SD8A 4TN8A 5A34B 4NV2A 2GGTA 1QXHA 2JADA 1F6MC 4ZBBA 5ECNB 1EGOA 4XS1A 4L0UA 1EEMA 1K0OA 3Q18A 2OE0A 1GLQA 2H71A 2QSIA 1TXUA 2VO4A 3PGTA 1HNCA 2LJRA 2VLVA 3TJFA 1URMA 2H75A 1USBA 1XIYA 1PA3A 2OE3A 5G30A 5KN2A 1UN2A 1F3AA 2M72A 4V1Ap 1SJIA 2FLSA 3GNJA 1ABAA 4CY8A 4KB3A 1XWCA 2ZCTA 4MZWA 3GKKA 1F37A 1Z7PA 1K0AA 5DQYA 1GSYA 2LQQA 2YV7A 1LU4A 2KLXA 1XW6A 2V1MA 1SJ6A 20GSA 3IR4A 5G2ZA 13GSA 1YY7A 2XC2A 2XPEA 1BG1A 4OCEA 4GLTA 2R5GA 3WT1A 1N2AA 2VKZG 3VLNA 1SJZA 3HD5A 1SVOA 3GKXA 4KAEA 3QOUA 2DKIA 1F3BA 2KOKA 3LXTA 2R4VA 2L6CA 3ME8A 2OBKA 1F2EA 5BMUB 1OE8A 1Q4JA 2VCZA 3GMFA 5KOWA 3EMPA 3L0HA 4OWYA 3ZREA 2VCWA 5GSSA 4LL4B 4XS6A 1QMVA 3R3EA 3C8EA 4BL7B 2H70A 2RM5A 5E59A 2R0PA 3HJPA 1X9MB 2AUVA 2AB6A 4N3ZA 1EGRA 5IQYA 3UJ1A 5DAKB 4BPYA 1GULA 2ON5A 1X9WB 3KH9A 1XZOA 2WFCA 12GSA 1TDIA 1FG4A 4IGJA 3UL3A 4POMA 3TJGA 3VWWA 1H75A 4BVYB 4F0BA 1BEDA 1K3LA 1U6TA 5FWGA 4Z2UA 1TW9A 4HJ2A 5A1NB 3VURA 3BCKA 2VCVA 2FY6A 4ZBDA 2VL2A 1F9MA 3ZIVA 2B7KA 2PVOC 2NVLA 4MPFA 3LJRA 4IKHA 1ACVA 2HSYA 1XCCA 5ECMB 2N5AA 2P5RA 4N0VA 1EP7A 3I6AA 4G2EA 5IMVA 5JCGA 3G9BA 5B6MA 3CBUA 2GSTA 1G7OA 2VOCA 2PPTA 4MK3A 4CW9A 2M80A 5EL8A 3VWUA 1K0DA 4TOPA 5J40A 1SENA 1O7UA 2NTOA 4ECJA 1JZDA 4PTSA 1A23A 3IC8A 5J4UA 3CRTA 1JZRA 1WMJA 1A24A 2RLIA 5KN0A 3N5OA 1KBNA 4V2MA 1AQXA 2GLRA 1VF2A 2K8SA 4MP4A 1OYJA 3APQA 5JWRB 2DKHA 5HR0A 4HS1A 1AIUA 2L4QA 3DXBA 2C8UA 1OC9A 3A5WA 3LW9A 5E4WA 3EURA 1AC1A 4IQ1A 1TI3A 2YANA 4FYBA 1Y25A 4Q5NA 2K9FA 2LV3A 5CAXA 4FQUA 2GTUA 3D0ZA 1T4YA 1K3YA 1TK0B 2N5BA 2HZFA 5ECQB 4KF9A 4I97A 1AAZA 3OR5A 3LWAA 4OCFA 1ZMAA 1BX9A 1MDKA 1YKCA 4F2IA 2L5LA 3GKMA 2YZHA 2TRXA 2CX4A 1IYHA 3SWLA 4DSQA 3QR6A 1JLVA 2EIRA 5J3RA 1RQMA 4O32A 3D5JA 2R37A 2X99A 5KEJA 2V32A 4OD7A 2HNLA 4ZB9A 1ERWA 4K8MA 2GQLA 2F3MA 2H6XA 3GRXA 1FB6A 4EUYA 4RI6A 3L9SA 1QK8A 4HUAA 2CA8A 2B5EA 2B3SA 1OC3A 1M9BA 3GH9A 3H1NA 2X49A 1RW1A 5J9CA 2JZTA 4GQCA 2AYTA 4EF0A 4TXVA 2IMEA 2KP1A 4IHUA 2J23A 4MF7A 1VF4A 1B4PA 3QAGA 6GSWA 4MZBA 4G0LA 3HDCA 4J57E 2HZEA 2F51A 4D73A 4O92A 5ECRB 4GCIA 1GL8A 2ZUPA 1K3OA 3FR3A 2B1KA 2MMOA 3NZNA 2YWMA 3TKSC 4HZ2A 1TRUA 3IK7A 2GZYA 2KHPA 4MNNA 2GDRA 2E0QA 1GRXA 4EE0A 3F4RA 2GSSA 4EKZA 2YZUA 2HRAA 3UEMA 4EC0A 1PSQA 4GDFA 1PRXA 5F06A 3IOSA 3VFIA 2V2GA 3QD9A 3ZITA 2H01A 3TJJA 9GSSA 5KOXA 4CY6A 1V9WA 4EL1A 4Z7XA 4TR1A 3QFAC 3AY8A 1THOA 1AXDA 2XBIA 4TKYA 2GT5A 4AGSA 1BAYA 5AIVA 3EMXA 4JBBA 4WF4A 4MF6A 4WR5A 2IMFA 4HZ4A 2I9HA 4HDEA 4O5RA 1WPIA 1GSEA 1KEBA 5J5NA 4DVCA 3ZMLA 2NBSA 2YWNA 3UBKA 2JL4A 4ZB7A 3TGZA 2PGTA 4FIWA 5DALB 4HQZA 1EV4A 5J4YA 5HR2A 3IK9A 4K7IA 2H1LA 1O8XA 3CSJA 2FWGA 2C0EA 4XCSA 4KH7A 3HJOA 2GQKA 3WT2A 4ML1A 3DRNA 2H74A 4MMMA 2A4HA 4PQIA 5C04A 5CREA 1AW9A 1R7HA 2VM2A 3IXRA 1NM3A 3TKPA 4POBA 1Y6EA 5H5QA 4ZXGA 1ZYNA 3FW2A 5CYYA 1LJRA 4MJEA 1SK2A 3EINA 2VD0A 1A2LA 5IMCA 4ACSA 2RUFA 1BYEA 4FYCA 2LNSA 4XTSA 2DJ1A 4QL7A 4POLA 1GSSA 1AQWA 2MBTA 1YDKA 1PN0A 2P0GA 1RK4A 1EEJA 3KP9A 4MCUA 5DDLA 5A5HA 4MJAA 3IDVA 4OFTA 2HSMB 2VD1A 4NWYA 3US3A 3Q6OA 3HYPA 1B8XA 4LLRA 1M2DA 4IP6A 1E6BA 5D9TA 5DVBA 4K0GA 2HSNB 4FH8A 1X5CA 4TR4A 3G7JA 3KZQA 5HFIA 3LGCA 4AJ8A 2HRNA 1J08A 3MAKA 2LJKA 4J2FA 1M7TA 1V98A 1XW9A 4G01A 2FGXA 2DJKA 4V2NA 2NPBA 3LORA 3K8NA 2FWEA 2O7KA 4G0KA 4K0NA 5D96A 4K5SA 4WBJA 2VLTA 2WJUA 1ON4A 2D2ZA 19GSA 1PX6A 2DIYA 2JU5A 1A2JA 1SK0A 3I69A 4I5QA 2XHFA 2YJHA 1YJ6A 3ZIJA 4IBPA 5ECIB 1GLPA 1SYRA 3F3RA 5G1KA 2C80A 1GSUA 1XOBA 3DD3A 1DE2A 3HKRA 4MZCA 1PL2A 1XVQA 3M9JA 2C4JA 3P2AA 3GURA 3N9JA 2DJ0A 4KA0A 2CVBA 3UOMA 2DC5A 2K18A 2LS5A 3QAVA 1SL1B 2B7JA 4RQXA 3F0IA 4GSNA 2HYXA 3EE2A 4YAVA 3ISOA 2FD3A 4MA9A 5CP1A 4DSRA 2IMKA 2QKEA 3M0FA 1GSDA 4PUAA 3BBYA 5ECOB 2EFHA 3KD0A 2LNTA 4HJMA 4XS4A 2WS2A 1PL1A 3GIXA 2WB9A 4EDZA 3TKSA 1EOGA 2DBCA 1JHBA 4HI7A 3HJMA 1GTAA 2EFDA 1T7PB 1T3BA 4JR4A 3FZAA 3ED3A 2YN1A 1JZWA 4N11A 3TJKA 1M99A 2UV8G 4FYUA 1BJXA 1YF0A 5ID2A 3CXGA 2H66A 1M0UA 5B8AA 3ZVJA 2VLUA 4K1FA 4MH3A 2H6ZA 4Z2RA 3NOFA 1YF1A 1EWXA 4ZIJA 4K9ZA 4ZL7A 4RUVA 3TDGA 2LKUA 2HLSA 3TRQA 1ML6A 1MDIA 3IBHA 3ZFBA 1TOFA 1V57A 1OAZA 2MMZA 3UVHA 1K0MA 2GZPA 1TRVA 3ZTLA 2RM6A 2J9HA 4ZB6A 1VF3A 3HA9A 3RDWA 4GQFA 3KH7A 1G6YA 4OMVA 4G10A 1K0CA 2F8FA 2QA2A 1U88A 1BF5A 5L71A 3TCOA 1U3IA 4ECIA 1XBSA 4MJCA 1UC7A 3MDKA 1YZXA 6GSUA 4ECBA 1A2MA 4X1UA 2DJJA 3APSA 2AJQB 3GSTA 11GSA 4EIQA 3CYNA 4MH2A 4Z2TA 5GAND 5LNKe 4LMWA 4MABA 2IPAA 1FO5A 4WXTA 2H0IA 1GUHA 3GYKA 4E8HA 2CVDA 2CVKA 3H79A 2HRKB 2MMNA 4P3YB 1Z7RA 1WP0A 3KP8A 3VPTA 5A34A 3E9JB 5IMAA 2I81A 1THXA 2AAWA 5CO3A 3RPNA 1X5DA 2YPMA 4TXOB 1NSWA 1G6WA 1GWCA 3GA4A 2IFQB 1O81A 1MEKA 2HFDA 5D9XA 6GSXA 2KUCA 3DVWA 3HXSA 1OC8A 1Z5YE 1O73A 2PUKC 5INYA 4BVXB 4K2XA 4F82A 4K7NA 1O8WA 1MD3A 3VWXA 5G5EA 4IS0A 3TOTA 1R4WA 1EZKA 4KDYA 4ZBAA 3MNGA 1SKWB 4JR6A 2ALBA 5DJLA 1K0NA 4O7HA 1E2YA 1WOUA 3FK8A 2H8LA 2A2SA 1TJDA 4Q5QA 1ERTA 1EV9A 4KUNA 3RPPA 2A2RA 3D4TA 4L0WA 3DYRA 4PURA 4ML6A 2DMMA 3LQ7A 3GX8A 4JE1A 4MLYA 3QFBC 4I2UA 2PU9C 4GRFA 1SYXA 1V58A 2O89A 2I1UA 3D4MA 4J56E 2ZNMA 4BWQA 3MYDA 4HU7A 3FHKA 5CNWA 1Q98A 1ZCPA 3ZFLA 2QA1A 4OO4A 1VRSD 3EPTA 2PMTA 3A3TA 2JSZA 2DIZA 2WCIA 2DSAA 2LRNA 1GTUA 2CX3A 1XFLA 4KDXA 5BMUA 3P90A 2DMLA 2PN8A 3BJ5A 3KM6A 2JSYA 1HD2A 2VM1A 1YEXA 2JACA 1XOAA 2R0CA 4ISDA 2CZ3A 4KE3A 1DSBA 1GNWA 1M2AA 5ECKB 1X9SB 4BL7A 1MDJA 3J7Yb 3F3QA 3PR8A 2CAIA 1UVZA 18GSA 3VK9A 2OADA 4KCAA 5KN3A 1TI1A 5DAKA 3TUEA 3FYGA 1B9YC 2C0GA 4L5OA 3P8WA 1DE1A 1HYUA 5GAPD 2E2GA 3GTUB 2L6DA 4BVYA 5IOWA 4TVEA 2I3YA 2PERA 3VWVA 1QFNA 2HQTA 3BCIA 1GNEA 1NHYA 3CTGA 4X0XA 3C71A 1TP9A 5FHIA 3ZVJD 2IIYA 1JZOA 2AV4A 3EU4A 4YKGA 3FZ9A 3RAZA 1A0FA 3UIWA 2VCXA 1XWGA 4IJIA 4IN0A 2H72A 1ZGNA 1W4VA 2I4AA 1QUWA 3DEXA 1XW5A 2BJXA 1AUCA 2GVPA 1GH2A 2C3NA 1M2BA 1A8LA 2VIMA 5ECPB 2OBIA 3ERGA 4W66A 5JCUA 1GSQA 4NHZA 2M46A 1FOVA 3MIXA 3FRCA 1PQNA 4ZL9A 4HU9A 2G0FA 1SL0B 1V2AA 4I2TA 1J9BA 3WGDA 3D21A 4EVMA 3FZ4A 2WZ9A 3A2XA 4N0ZA 3C73A 2LEGA 2OACA 4N30A 2FHEA 5J9BA 3G7IA 1BQ7A 2CZ2A 2R2JA 3EC3A 4F0CA 5IIZA 2G2QA 4O5UA 1ST9A 2V6OA 4EDYA 2X4AA 4QQ7A 4WR4A 2IL3A 1FB0A 3ZRDA 5B8BA 1SKSB 2R0GA 2VAFA 5H5SA 2X8HA 1VGLA 3FMWA 4AKIA 4QL9A 2X8CA 1K0BA 1SVLA 3ZLPA 1FW1A 4I8BA 4GXZA 5LD0A 1TK8B 1YEPA 1QGVA 2A4VA 3HVVA 2B6MA 2H1GA 4HEA2 5ID2B 3HZ4A 3IHQA 3RHCA 3O76A 5EY6A 1ZYQB 1HQOA 5F0GA 4JRRA 3C1SA 2GZZA 14GSA 2LRCA 4KW6A 4L8EA 2IMIA 4KX4A 5B7CA 2H6YA 1WJKA 1Z9HA 3DGQA 1FVJA 5GZZB 4WETA 5IMFA 4TRXA 2JZRA 5DQSA 3ME7A 3I9V2 4GWRA 3L78A 4X4JA 1LBKA 3TRXA 3O6TA 1PN9A 4YKFA 5F05A 2C3QA 3GHAA 4TR3A 3RBTA 3GKNA 2LJAA 4WKWA 3IE3A 2L5OA 1O85A 1GUKA 2RIIA 2MZCA 2EIQA 2EC4A 3IPZA 2O5VA 5ECSA 3KTLA 3L9VA 4GTUA 4AJ7A 1U87A 1XXUA 5EVOA 2FA4A 1ZL9A 3H93A 5H5RA 3DVXA 1G7EA 2OT3A 4A5PA 2O87A 3G7YA 5AISA 4ECCA 1R26A 2CV4A 1SU9A 2DJ3A 5COHA 4PUFC 4ZL8A 4V2LA 4G0IA 2WULA 1M9AA 2E2MA 2CT6A 2EFCA 2WGRA 2P5QA 1KTEA 2B1LA 2CQ9A 4Q5RA 5IPGA 4AJ6A 3CTFA 4XHMA 4DSSA 1PKWA 3ERFA 4USSA 1T1VA 3M8NA 1JLWA 1A8YA 1NW2A 2VL3A 1VF1A 3L4NA 4F03A 5IM9A 4EIPA 3F9UA 3IHGA 2EIOA 2V41A 4JZQA 1PKZA 2HSHA 4Q5FA 2F8AA 5CRGA 2GSQA 1CQHA 4YQMA 2N5FA 5AGYA 3QDNA 3LYKA 4XRAA 1R5PA 1Z3EA 2HI7A 5DALA 1OC9B 5IMZA 5AIXA 1WRYA 3HZ8A 4MPGA 5A5KA 2K8VA 3F63A 3UVTA 2X8GA 5HR3A 5CRHA 5C00A 3WGXA 1CQGA 5ABRA 2OE1A 4H86A 1T00A 3FY7A 3LSZA 4LA1A 1NHOA 2YJ7A 4GSTA 1HNAA 1MTCA 3SBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X43 A;  4IQA A;  5ELA A;  3TJB A;  4PQ1 A;  5JCW A;  5D9W A;  1O6J A;  2YNX A;  2VUP A;  4G19 A;  2V6K A;  2HT9 A;  3KEB A;  1FVK A;  3M1G A;  5HFG A;  4K6X A;  4XIH A;  3PPU A;  3D22 A;  4PQH A;  6GSV A;  1PGT A;  4GSS A;  1TRS A;  2FWH A;  5IO0 A;  2MMA A;  5DCG A;  3HCZ A;  3U5R E;  3FEU A;  2HSM A;  3DWV A;  4KCE A;  1BG5 A;  2R3X A;  4PNG A;  3KGK A;  4WF5 A;  1PD2 1;  2NDO A;  4NPB A;  1W89 A;  1TKD B;  1SKR B;  6GSS A;  1YQ1 A;  22GS A;  3Q19 A;  4JED A;  1J0F A;  1TXX A;  1EP8 A;  4POK A;  1OKT A;  3W8J A;  6GSY A;  1TTZ A;  5A4U A;  3D6I A;  4KSO A;  3LFL A;  2HZE B;  4E8E A;  1B9X C;  4D73 B;  3C1R A;  4RQR A;  2L57 A;  3A2W A;  1YKA A;  4ZB8 A;  2GT6 A;  4FO5 A;  2YCD A;  5AN1 A;  1ZOF A;  3HVX A;  2OKA A;  3KMO A;  2REM A;  2FNO A;  5DJM A;  4YAP A;  3FKF A;  4OO5 A;  2B5Y A;  3CSH A;  3GN3 A;  5IMD A;  2C0F A;  4HOJ A;  5A4W A;  4YQV A;  2BMX A;  2B5X A;  2L59 A;  3FR6 A;  5D93 A;  3ZYW A;  4RI7 A;  1I9D A;  5JWQ B;  2H1B A;  2QC7 A;  1X0R A;  2IJY A;  2H0G A;  1JFU A;  7GSS A;  3DML A;  4BA7 A;  3BD2 A;  1ERU A;  1TU8 A;  4TR1 B;  2C0D A;  4JU5 A;  2LUS A;  2Z9S A;  1QQ2 A;  3TKQ A;  2R6K A;  3LYP A;  2HRF A;  4HQS A;  3WD6 A;  1PMT A;  1SK1 A;  3QAW A;  4CHS A;  3EWL A;  2H0H A;  3J7Y k;  5IPH A;  2C3T A;  3ZZX A;  2GSR A;  3ERW A;  4ILF A;  4PNF A;  4WEY A;  2GQM A;  5DBQ A;  5CRD A;  5GST A;  5JWO B;  2E7P A;  5ENU A;  2KP2 A;  2K6V A;  5A4V A;  4YH2 A;  3U6V A;  4N10 A;  3MWH A;  2O85 A;  1ERV A;  4NMU A;  2BTO T;  3EVI A;  3VI5 A;  1HNB A;  3S9F A;  3FZ5 A;  4GF0 A;  2MBS A;  3L9U A;  4G9H A;  4IEL A;  3UAR A;  2TRC P;  2P31 A;  1FAA A;  3FR9 A;  3KTB A;  4YQU A;  4ULX A;  1U3A A;  1UA5 A;  3GV1 A;  5HR1 A;  4IVF A;  4EXJ A;  3KJY A;  2GS3 A;  3I43 A;  1T4Z A;  5G1L A;  3KXO A;  4PX1 A;  1V40 A;  2LTK A;  5ELG A;  2H19 A;  4K2D A;  2FUG 2;  2VL9 A;  4DEJ A;  3H8Q A;  5B6N A;  3VI7 A;  1X5E A;  4EO3 A;  2DJ2 A;  2FWF A;  17GS A;  1OVN A;  2IWT A;  3UBL A;  1H4O A;  2JZS A;  4KND A;  5DCH A;  5D73 A;  2RUE A;  3CSI A;  3GL3 A;  3HY2 A;  2MYG A;  4F9Z A;  2YV9 A;  4ID0 A;  2DLX A;  1ZYE A;  2C1Y A;  3GFK A;  2OA7 A;  5G31 A;  5HFK A;  3QMX A;  2H76 A;  3CMI A;  1WE0 A;  3ZL5 A;  3Q74 A;  2YP6 A;  5F8B A;  3C7M A;  3W6G A;  3F6D A;  4OFN A;  4CDO A;  5F07 A;  3F4T A;  1Z6M A;  3TB2 A;  2IN3 A;  4K7O A;  2QGV A;  3CRU A;  1TU7 A;  4PXO A;  2HRK A;  2F9S A;  3GSS A;  1MD4 A;  2WRT A;  1B48 A;  3IA1 A;  5CRW A;  1IYI A;  2VCQ A;  2LST A;  2YWI A;  3QCP A;  1GTB A;  5EPF A;  1ZZY A;  2L4C A;  4TXO A;  4LMV A;  8GSS A;  5HQP A;  1OKD A;  3HHV A;  2IFQ A;  3GL5 A;  1A0R P;  5D9V A;  3LXZ A;  2H73 A;  3E0U A;  1SL2 B;  4BVX A;  3A2V A;  4DSS B;  1TK5 B;  5ECH B;  1GUM A;  2FA8 A;  3P7X A;  3VPQ A;  3NIV A;  3WYW A;  3ZMK A;  3TRP A;  3M9K A;  3APO A;  1DBY A;  1ILO A;  4PGT A;  4MF5 A;  1B4Q A;  3F6F A;  1OE7 A;  4I6X A;  3DIE A;  1XWK A;  3QPM A;  1FHE A;  1T8E B;  1WWJ A;  4OFM A;  4NV5 A;  4KSM A;  3E3E A;  1KNG A;  4XS4 B;  4AF2 A;  1GP1 A;  2ON7 A;  2ES7 A;  3UMA A;  2VCT A;  3KCM A;  3O3T A;  2X64 A;  2TIR A;  1N8J A;  3R2Q A;  1R5A A;  1AQV A;  3WGE A;  4LL1 B;  1C72 A;  5IOX A;  2XPD A;  3EU3 A;  3KIJ A;  3GX0 A;  3JCM L;  2VL2 C;  1XVW A;  4MDC A;  4ZIL A;  3M3M A;  3PH9 A;  3KMN A;  4V1A g;  16GS A;  5FT3 A;  6GST A;  1WIK A;  3F8U A;  4IW9 A;  1S3D A;  1TRW A;  3W8S A;  1XPV A;  3GH6 A;  2O8V B;  2AHE A;  1GSF A;  2LRT A;  3IAM 2;  4XRD A;  2PWJ A;  3TKR A;  2YWO A;  3H4K A;  3RHB A;  3TKS E;  3F4S A;  2H1A A;  4IJ3 A;  2UZ8 A;  3LG6 A;  4TW5 A;  5G5F A;  3LEF A;  3PIN A;  1I5G A;  1G0T A;  3IAS 2;  4NAX A;  3DKS A;  2WDU A;  1XWA A;  5LCZ A;  3TOU A;  2PVQ A;  10GS A;  3V1W A;  1XWB A;  1S3C A;  2CAQ A;  4NXI A;  5KN1 A;  5D8I A;  3GTU A;  2HE3 A;  2YOI A;  1S3A A;  4BWS A;  4IP1 A;  2HXK A;  2PBJ A;  2OJL A;  1EOH A;  3MSZ A;  5ECL B;  4KDU A;  3UAP A;  4L5L A;  3IC4 A;  3IV4 A;  3GUS A;  1DUG A;  3IRA A;  1Z6N A;  4WBR D;  2H30 A;  1PX7 A;  4MJB A;  1GTI A;  2H1D A;  5IO2 A;  3HVS A;  2IMD A;  3EYT A;  5J41 A;  2FCH A;  3BOA A;  2XBQ A;  4NHW A;  4TR0 A;  4KGI A;  1SD9 A;  2LQO A;  1SD8 A;  4TN8 A;  4NV2 A;  2GGT A;  1QXH A;  2JAD A;  1F6M C;  4ZBB A;  5ECN B;  1EGO A;  4XS1 A;  4L0U A;  1EEM A;  1K0O A;  3Q18 A;  2OE0 A;  1GLQ A;  2H71 A;  2QSI A;  2VO4 A;  3PGT A;  1HNC A;  2LJR A;  2VLV A;  3TJF A;  1URM A;  2H75 A;  1USB A;  1XIY A;  1PA3 A;  2OE3 A;  5G30 A;  5KN2 A;  1UN2 A;  1F3A A;  2M72 A;  4V1A p;  1SJI A;  2FLS A;  3GNJ A;  1ABA A;  4KB3 A;  1XWC A;  2ZCT A;  4MZW A;  3GKK A;  1F37 A;  1Z7P A;  1K0A A;  5DQY A;  1GSY A;  2LQQ A;  2YV7 A;  1LU4 A;  2KLX A;  1XW6 A;  2V1M A;  1SJ6 A;  20GS A;  3IR4 A;  5G2Z A;  13GS A;  1YY7 A;  2XC2 A;  2XPE A;  4OCE A;  4GLT A;  2R5G A;  3WT1 A;  1N2A A;  3VLN A;  1SJZ A;  3HD5 A;  3GKX A;  4KAE A;  3QOU A;  1F3B A;  2KOK A;  3LXT A;  2R4V A;  2L6C A;  3ME8 A;  2OBK A;  1F2E A;  1OE8 A;  1Q4J A;  2VCZ A;  3GMF A;  3EMP A;  3L0H A;  4OWY A;  3ZRE A;  2VCW A;  5GSS A;  4LL4 B;  4XS6 A;  1QMV A;  3R3E A;  3C8E A;  4BL7 B;  2H70 A;  2RM5 A;  5E59 A;  3HJP A;  1X9M B;  2AUV A;  2AB6 A;  1EGR A;  5IQY A;  3UJ1 A;  5DAK B;  4BPY A;  1GUL A;  2ON5 A;  1X9W B;  3KH9 A;  1XZO A;  2WFC A;  12GS A;  1TDI A;  1FG4 A;  4IGJ A;  3UL3 A;  4POM A;  3TJG A;  3VWW A;  1H75 A;  4BVY B;  4F0B A;  1BED A;  1K3L A;  1U6T A;  5FWG A;  1TW9 A;  4HJ2 A;  3VUR A;  3BCK A;  2VCV A;  2FY6 A;  4ZBD A;  2VL2 A;  1F9M A;  3ZIV A;  2B7K A;  2PVO C;  2NVL A;  4MPF A;  3LJR A;  4IKH A;  1ACV A;  2HSY A;  1XCC A;  5ECM B;  2N5A A;  2P5R A;  4N0V A;  1EP7 A;  3I6A A;  4G2E A;  5IMV A;  5JCG A;  3G9B A;  5B6M A;  3CBU A;  2GST A;  1G7O A;  2VOC A;  2PPT A;  4MK3 A;  4CW9 A;  2M80 A;  5EL8 A;  3VWU A;  1K0D A;  4TOP A;  1SEN A;  1O7U A;  2NTO A;  4ECJ A;  1JZD A;  4PTS A;  1A23 A;  3IC8 A;  5J4U A;  3CRT A;  1JZR A;  1WMJ A;  1A24 A;  2RLI A;  5KN0 A;  3N5O A;  1KBN A;  4V2M A;  1AQX A;  2GLR A;  1VF2 A;  2K8S A;  4MP4 A;  1OYJ A;  3APQ A;  5JWR B;  5HR0 A;  4HS1 A;  1AIU A;  2L4Q A;  3DXB A;  2C8U A;  1OC9 A;  3A5W A;  5E4W A;  3EUR A;  1AC1 A;  4IQ1 A;  1TI3 A;  2YAN A;  4FYB A;  1Y25 A;  4Q5N A;  2K9F A;  2LV3 A;  5CAX A;  4FQU A;  2GTU A;  3D0Z A;  1T4Y A;  1K3Y A;  1TK0 B;  2N5B A;  2HZF A;  5ECQ B;  4KF9 A;  4I97 A;  1AAZ A;  3OR5 A;  3LWA A;  4OCF A;  1ZMA A;  1BX9 A;  1MDK A;  1YKC A;  4F2I A;  2L5L A;  3GKM A;  2YZH A;  2TRX A;  2CX4 A;  1IYH A;  3SWL A;  4DSQ A;  3QR6 A;  1JLV A;  2EIR A;  5J3R A;  1RQM A;  4O32 A;  3D5J A;  2R37 A;  2X99 A;  5KEJ A;  2V32 A;  4OD7 A;  2HNL A;  4K8M A;  4ZB9 A;  1ERW A;  2GQL A;  2F3M A;  2H6X A;  3GRX A;  1FB6 A;  4EUY A;  4RI6 A;  3L9S A;  1QK8 A;  4HUA A;  2CA8 A;  2B5E A;  2B3S A;  1OC3 A;  1M9B A;  3GH9 A;  3H1N A;  1RW1 A;  5J9C A;  2JZT A;  4GQC A;  2AYT A;  4EF0 A;  4TXV A;  2IME A;  2KP1 A;  4IHU A;  2J23 A;  4MF7 A;  1VF4 A;  1B4P A;  3QAG A;  6GSW A;  4MZB A;  4G0L A;  3HDC A;  4J57 E;  2HZE A;  2F51 A;  4D73 A;  4O92 A;  5ECR B;  4GCI A;  1GL8 A;  2ZUP A;  1K3O A;  3FR3 A;  2B1K A;  2MMO A;  3NZN A;  2YWM A;  3TKS C;  4HZ2 A;  1TRU A;  3IK7 A;  2GZY A;  2KHP A;  2GDR A;  2E0Q A;  1GRX A;  4EE0 A;  3F4R A;  2GSS A;  4EKZ A;  2YZU A;  2HRA A;  3UEM A;  4EC0 A;  1PSQ A;  1PRX A;  5F06 A;  3IOS A;  3VFI A;  2V2G A;  3QD9 A;  3ZIT A;  2H01 A;  3TJJ A;  9GSS A;  1V9W A;  4EL1 A;  4Z7X A;  4TR1 A;  3QFA C;  3AY8 A;  1THO A;  1AXD A;  2XBI A;  4TKY A;  2GT5 A;  4AGS A;  1BAY A;  5AIV A;  3EMX A;  4JBB A;  4WF4 A;  4MF6 A;  4WR5 A;  2IMF A;  4HZ4 A;  2I9H A;  4HDE A;  4O5R A;  1WPI A;  1GSE A;  1KEB A;  5J5N A;  4DVC A;  3ZML A;  2NBS A;  2YWN A;  3UBK A;  2JL4 A;  3TGZ A;  2PGT A;  4FIW A;  5DAL B;  4HQZ A;  1EV4 A;  5HR2 A;  3IK9 A;  4K7I A;  1O8X A;  3CSJ A;  2FWG A;  2C0E A;  4XCS A;  4KH7 A;  3HJO A;  2GQK A;  3WT2 A;  4ML1 A;  3DRN A;  2H74 A;  4MMM A;  4PQI A;  5C04 A;  5CRE A;  1AW9 A;  1R7H A;  2VM2 A;  3IXR A;  1NM3 A;  3TKP A;  4POB A;  1Y6E A;  5H5Q A;  4ZXG A;  3FW2 A;  5CYY A;  1LJR A;  4MJE A;  1SK2 A;  3EIN A;  2VD0 A;  1A2L A;  5IMC A;  4ACS A;  2RUF A;  1BYE A;  4FYC A;  2LNS A;  4XTS A;  2DJ1 A;  4QL7 A;  4POL A;  1GSS A;  1AQW A;  2MBT A;  1YDK A;  2P0G A;  1RK4 A;  1EEJ A;  3KP9 A;  4MCU A;  5DDL A;  4MJA A;  3IDV A;  4OFT A;  2HSM B;  2VD1 A;  4NWY A;  3US3 A;  3Q6O A;  3HYP A;  1B8X A;  4LLR A;  1M2D A;  4IP6 A;  1E6B A;  5D9T A;  5DVB A;  4K0G A;  2HSN B;  4FH8 A;  1X5C A;  4TR4 A;  3G7J A;  3KZQ A;  5HFI A;  3LGC A;  4AJ8 A;  2HRN A;  1J08 A;  3MAK A;  2LJK A;  4J2F A;  1M7T A;  1V98 A;  1XW9 A;  2FGX A;  2DJK A;  4V2N A;  2NPB A;  3LOR A;  3K8N A;  2FWE A;  2O7K A;  4G0K A;  4K0N A;  5D96 A;  4WBJ A;  2VLT A;  2WJU A;  1ON4 A;  2D2Z A;  19GS A;  1PX6 A;  2DIY A;  2JU5 A;  1A2J A;  1SK0 A;  3I69 A;  4I5Q A;  2XHF A;  2YJH A;  1YJ6 A;  3ZIJ A;  4IBP A;  5ECI B;  1GLP A;  1SYR A;  3F3R A;  5G1K A;  2C80 A;  1GSU A;  1XOB A;  3DD3 A;  1DE2 A;  3HKR A;  4MZC A;  1PL2 A;  1XVQ A;  3M9J A;  2C4J A;  3P2A A;  3GUR A;  3N9J A;  2DJ0 A;  4KA0 A;  2CVB A;  3UOM A;  2DC5 A;  2K18 A;  2LS5 A;  3QAV A;  1SL1 B;  2B7J A;  4RQX A;  3F0I A;  4GSN A;  2HYX A;  3EE2 A;  4YAV A;  3ISO A;  2FD3 A;  4MA9 A;  5CP1 A;  4DSR A;  2IMK A;  2QKE A;  3M0F A;  1GSD A;  4PUA A;  3BBY A;  5ECO B;  3KD0 A;  2LNT A;  4HJM A;  4XS4 A;  2WS2 A;  1PL1 A;  3GIX A;  2WB9 A;  4EDZ A;  3TKS A;  1EOG A;  2DBC A;  1JHB A;  4HI7 A;  3HJM A;  1GTA A;  1T7P B;  1T3B A;  4JR4 A;  3FZA A;  3ED3 A;  2YN1 A;  1JZW A;  4N11 A;  3TJK A;  1M99 A;  4FYU A;  1BJX A;  1YF0 A;  5ID2 A;  3CXG A;  2H66 A;  1M0U A;  5B8A A;  3ZVJ A;  2VLU A;  4K1F A;  4MH3 A;  2H6Z A;  3NOF A;  1YF1 A;  1EWX A;  4ZIJ A;  4K9Z A;  4ZL7 A;  4RUV A;  3TDG A;  2LKU A;  2HLS A;  3TRQ A;  1ML6 A;  1MDI A;  3IBH A;  3ZFB A;  1TOF A;  1V57 A;  1OAZ A;  2MMZ A;  3UVH A;  1K0M A;  2GZP A;  1TRV A;  3ZTL A;  2RM6 A;  2J9H A;  4ZB6 A;  1VF3 A;  3HA9 A;  3RDW A;  4GQF A;  3KH7 A;  1G6Y A;  4OMV A;  4G10 A;  1K0C A;  2F8F A;  1U88 A;  5L71 A;  3TCO A;  1U3I A;  4ECI A;  1XBS A;  4MJC A;  1UC7 A;  3MDK A;  1YZX A;  6GSU A;  4ECB A;  1A2M A;  4X1U A;  2DJJ A;  3APS A;  2AJQ B;  3GST A;  11GS A;  3CYN A;  4MH2 A;  5GAN D;  5LNK e;  4LMW A;  4MAB A;  2IPA A;  1FO5 A;  4WXT A;  2H0I A;  1GUH A;  3GYK A;  4E8H A;  2CVD A;  2CVK A;  3H79 A;  2HRK B;  2MMN A;  4P3Y B;  1Z7R A;  1WP0 A;  3KP8 A;  3VPT A;  3E9J B;  5IMA A;  2I81 A;  1THX A;  2AAW A;  5CO3 A;  3RPN A;  1X5D A;  2YPM A;  4TXO B;  1NSW A;  1G6W A;  1GWC A;  3GA4 A;  2IFQ B;  1O81 A;  1MEK A;  2HFD A;  5D9X A;  6GSX A;  2KUC A;  3DVW A;  3HXS A;  1OC8 A;  1Z5Y E;  1O73 A;  2PUK C;  5INY A;  4BVX B;  4F82 A;  4K7N A;  1O8W A;  1MD3 A;  3VWX A;  5G5E A;  4IS0 A;  3TOT A;  1R4W A;  1EZK A;  4KDY A;  4ZBA A;  3MNG A;  1SKW B;  4JR6 A;  2ALB A;  5DJL A;  1K0N A;  4O7H A;  1E2Y A;  1WOU A;  3FK8 A;  2H8L A;  2A2S A;  1TJD A;  4Q5Q A;  1ERT A;  1EV9 A;  4KUN A;  3RPP A;  2A2R A;  3D4T A;  4L0W A;  3DYR A;  4PUR A;  4ML6 A;  2DMM A;  3LQ7 A;  3GX8 A;  4JE1 A;  4MLY A;  3QFB C;  4I2U A;  2PU9 C;  4GRF A;  1SYX A;  1V58 A;  2O89 A;  2I1U A;  3D4M A;  4J56 E;  2ZNM A;  4BWQ A;  4HU7 A;  3FHK A;  5CNW A;  1Q98 A;  1ZCP A;  3ZFL A;  4OO4 A;  1VRS D;  2PMT A;  3A3T A;  2JSZ A;  2DIZ A;  2WCI A;  2DSA A;  2LRN A;  1GTU A;  2CX3 A;  1XFL A;  4KDX A;  5BMU A;  3P90 A;  2DML A;  2PN8 A;  3BJ5 A;  3KM6 A;  2JSY A;  1HD2 A;  2VM1 A;  1YEX A;  2JAC A;  1XOA A;  4ISD A;  2CZ3 A;  4KE3 A;  1DSB A;  1GNW A;  1M2A A;  5ECK B;  1X9S B;  4BL7 A;  1MDJ A;  3J7Y b;  3F3Q A;  3PR8 A;  2CAI A;  1UVZ A;  18GS A;  3VK9 A;  2OAD A;  4KCA A;  5KN3 A;  1TI1 A;  5DAK A;  3TUE A;  3FYG A;  1B9Y C;  2C0G A;  4L5O A;  3P8W A;  1DE1 A;  1HYU A;  5GAP D;  2E2G A;  3GTU B;  2L6D A;  4BVY A;  5IOW A;  4TVE A;  2I3Y A;  2PER A;  3VWV A;  1QFN A;  2HQT A;  3BCI A;  1GNE A;  1NHY A;  3CTG A;  4X0X A;  3C71 A;  1TP9 A;  5FHI A;  3ZVJ D;  2IIY A;  1JZO A;  2AV4 A;  3EU4 A;  3FZ9 A;  3RAZ A;  1A0F A;  3UIW A;  2VCX A;  1XWG A;  4IJI A;  4IN0 A;  2H72 A;  1ZGN A;  1W4V A;  2I4A A;  1QUW A;  3DEX A;  1XW5 A;  2BJX A;  1AUC A;  2GVP A;  1GH2 A;  2C3N A;  1M2B A;  1A8L A;  2VIM A;  5ECP B;  2OBI A;  3ERG A;  5JCU A;  1GSQ A;  4NHZ A;  2M46 A;  1FOV A;  3FRC A;  1PQN A;  4ZL9 A;  4HU9 A;  2G0F A;  1SL0 B;  1V2A A;  4I2T A;  1J9B A;  3WGD A;  3D21 A;  4EVM A;  3FZ4 A;  2WZ9 A;  3A2X A;  4N0Z A;  3C73 A;  2LEG A;  2OAC A;  4N30 A;  2FHE A;  5J9B A;  3G7I A;  1BQ7 A;  2CZ2 A;  2R2J A;  3EC3 A;  4F0C A;  5IIZ A;  2G2Q A;  1ST9 A;  2V6O A;  4EDY A;  4QQ7 A;  4WR4 A;  2IL3 A;  1FB0 A;  3ZRD A;  5B8B A;  1SKS B;  2VAF A;  5H5S A;  2X8H A;  1VGL A;  4QL9 A;  2X8C A;  1K0B A;  3ZLP A;  1FW1 A;  4I8B A;  4GXZ A;  5LD0 A;  1TK8 B;  1YEP A;  1QGV A;  2A4V A;  3HVV A;  2B6M A;  2H1G A;  4HEA 2;  5ID2 B;  3HZ4 A;  3IHQ A;  3RHC A;  3O76 A;  5EY6 A;  1ZYQ B;  1HQO A;  5F0G A;  4JRR A;  3C1S A;  2GZZ A;  14GS A;  2LRC A;  4KW6 A;  4L8E A;  2IMI A;  4KX4 A;  5B7C A;  1WJK A;  2H6Y A;  1Z9H A;  3DGQ A;  1FVJ A;  5GZZ B;  4WET A;  5IMF A;  4TRX A;  2JZR A;  5DQS A;  3ME7 A;  3I9V 2;  4GWR A;  3L78 A;  1LBK A;  3TRX A;  3O6T A;  1PN9 A;  5F05 A;  2C3Q A;  3GHA A;  4TR3 A;  3RBT A;  3GKN A;  2LJA A;  4WKW A;  3IE3 A;  2L5O A;  1O85 A;  1GUK A;  2RII A;  2MZC A;  2EIQ A;  2EC4 A;  3IPZ A;  5ECS A;  3KTL A;  3L9V A;  4GTU A;  4AJ7 A;  1U87 A;  1XXU A;  5EVO A;  2FA4 A;  1ZL9 A;  3H93 A;  5H5R A;  3DVX A;  1G7E A;  2O87 A;  3G7Y A;  5AIS A;  4ECC A;  1R26 A;  2CV4 A;  1SU9 A;  2DJ3 A;  5COH A;  4PUF C;  4ZL8 A;  4V2L A;  4G0I A;  2WUL A;  1M9A A;  2E2M A;  2CT6 A;  2WGR A;  2P5Q A;  1KTE A;  2B1L A;  2CQ9 A;  4Q5R A;  5IPG A;  4AJ6 A;  3CTF A;  4XHM A;  4DSS A;  1PKW A;  3ERF A;  4USS A;  1T1V A;  3M8N A;  1JLW A;  1A8Y A;  1NW2 A;  2VL3 A;  1VF1 A;  3L4N A;  4F03 A;  5IM9 A;  3F9U A;  2EIO A;  2V41 A;  4JZQ A;  1PKZ A;  2HSH A;  4Q5F A;  2F8A A;  5CRG A;  2GSQ A;  1CQH A;  4YQM A;  2N5F A;  5AGY A;  3QDN A;  3LYK A;  4XRA A;  1R5P A;  1Z3E A;  2HI7 A;  5DAL A;  1OC9 B;  5IMZ A;  5AIX A;  1WRY A;  3HZ8 A;  4MPG A;  5A5K A;  2K8V A;  3F63 A;  3UVT A;  2X8G A;  5HR3 A;  5CRH A;  5C00 A;  3WGX A;  1CQG A;  5ABR A;  4H86 A;  2OE1 A;  1T00 A;  3FY7 A;  3LSZ A;  4LA1 A;  1NHO A;  2YJ7 A;  4GST A;  1HNA A;  1MTC A;  3SBC A; 
#chains in the Genus database with same CATH topology
 4X43 A;  3CWG A;  5J4V A;  4IQA A;  5ELA A;  3TJB A;  4PQ1 A;  5JCW A;  5D9W A;  1O6J A;  2YNX A;  5J47 A;  2VUP A;  4G19 A;  2V6K A;  2HT9 A;  3KEB A;  1FVK A;  3M1G A;  5HFG A;  4K6X A;  4XIH A;  3PPU A;  3D22 A;  4PQH A;  4O5Q A;  6GSV A;  1PGT A;  4GSS A;  1TRS A;  2FWH A;  5IO0 A;  2WVX B;  2MMA A;  5DCG A;  3HCZ A;  3U5R E;  3FEU A;  2HSM A;  3DWV A;  4KCE A;  1BG5 A;  2R3X A;  4PNG A;  3KGK A;  4WF5 A;  1PD2 1;  2NDO A;  4NPB A;  1W89 A;  1TKD B;  2HSN A;  1SKR B;  2WW3 A;  6GSS A;  1YQ1 A;  22GS A;  3Q19 A;  4JED A;  1J0F A;  1TXX A;  1EP8 A;  4POK A;  1OKT A;  3W8J A;  6GSY A;  1TTZ A;  5A4U A;  3D6I A;  4KSO A;  3LFL A;  2HZE B;  4E8E A;  1B9X C;  4D73 B;  3C1R A;  4RQR A;  2L57 A;  3A2W A;  1YKA A;  4ZB8 A;  2GT6 A;  4FO5 A;  2YCD A;  5AN1 A;  1ZOF A;  3HVX A;  2OKA A;  3KMO A;  2REM A;  2FNO A;  5DJM A;  4YAP A;  3FKF A;  4OO5 A;  2B5Y A;  3CSH A;  3GN3 A;  5IMD A;  2C0F A;  4HOJ A;  5A4W A;  4YQV A;  2BMX A;  2B5X A;  2L59 A;  3FR6 A;  5D93 A;  3ZYW A;  4RI7 A;  1I9D A;  5JWQ B;  2H1B A;  2QC7 A;  1X0R A;  2IJY A;  2H0G A;  1JFU A;  7GSS A;  3DML A;  4BA7 A;  3BD2 A;  1ERU A;  1TU8 A;  4TR1 B;  2C0D A;  4JU5 A;  2LUS A;  2Z9S A;  1QQ2 A;  3TKQ A;  2R6K A;  3LYP A;  2HRF A;  4HQS A;  3WD6 A;  1PMT A;  1SK1 A;  3QAW A;  4CHS A;  3EWL A;  2H0H A;  3J7Y k;  5IPH A;  2C3T A;  3ZZX A;  2GSR A;  3CQF A;  3ERW A;  4ILF A;  4PNF A;  4WEY A;  2GQM A;  5DBQ A;  5CRD A;  2WVZ A;  5GST A;  5JWO B;  2E7P A;  5ENU A;  4QMK A;  2KP2 A;  2K6V A;  5A4V A;  4YH2 A;  3U6V A;  4ICY A;  4N10 A;  3MWH A;  2O85 A;  1ERV A;  4NMU A;  2BTO T;  3EVI A;  3VI5 A;  1HNB A;  3S9F A;  3FZ5 A;  4AKG A;  4GF0 A;  2MBS A;  3L9U A;  4G9H A;  4IEL A;  3UAR A;  2TRC P;  4AI6 A;  2P31 A;  1FAA A;  3FR9 A;  3KTB A;  4YQU A;  4ULX A;  1U3A A;  1UA5 A;  3GV1 A;  5HR1 A;  4IVF A;  4EXJ A;  3KJY A;  2GS3 A;  3I43 A;  1T4Z A;  5G1L A;  2WZS A;  3KXO A;  4PX1 A;  1V40 A;  2LTK A;  5ELG A;  2H19 A;  4K2D A;  2FUG 2;  2VL9 A;  5A5H B;  4DEJ A;  3H8Q A;  5B6N A;  3VI7 A;  1X5E A;  4EO3 A;  2DJ2 A;  2FWF A;  17GS A;  1OVN A;  2IWT A;  3UBL A;  1H4O A;  2JZS A;  4KND A;  5DCH A;  5D73 A;  2RUE A;  4K5R A;  3CSI A;  3GL3 A;  3HY2 A;  2MYG A;  4F9Z A;  2YV9 A;  4ID0 A;  2DLX A;  1ZYE A;  2C1Y A;  3GFK A;  2OA7 A;  5G31 A;  5HFK A;  5A1N A;  3QMX A;  2H76 A;  3CMI A;  1SVM A;  1WE0 A;  1I1I P;  3ZL5 A;  3Q74 A;  3RFR C;  2YP6 A;  5F8B A;  3C7M A;  4PHZ C;  3W6G A;  3F6D A;  4OFN A;  4CDO A;  5F07 A;  3F4T A;  1Z6M A;  3TB2 A;  2IN3 A;  4K7O A;  2QGV A;  3CRU A;  1TU7 A;  4PXO A;  2HRK A;  2F9S A;  3GSS A;  1MD4 A;  3A5I A;  2WRT A;  1B48 A;  3IA1 A;  5CRW A;  1IYI A;  2VCQ A;  2LST A;  2YWI A;  3QCP A;  4AKX B;  1GTB A;  5EPF A;  1ZZY A;  2L4C A;  4TXO A;  4LMV A;  8GSS A;  1YVL A;  5HQP A;  1OKD A;  3HHV A;  2IFQ A;  3GL5 A;  1A0R P;  5D9V A;  3LXZ A;  2H73 A;  3E0U A;  1SL2 B;  4BVX A;  3A2V A;  4DSS B;  1TK5 B;  5ECH B;  1GUM A;  2FA8 A;  1N25 A;  3P7X A;  3VPQ A;  1XG8 A;  3NIV A;  3WYW A;  3ZMK A;  3TRP A;  3M9K A;  3APO A;  1DBY A;  1ILO A;  4PGT A;  4MF5 A;  1B4Q A;  4AKH A;  3F6F A;  1OE7 A;  4I6X A;  3DIE A;  1XWK A;  3QPM A;  1FHE A;  1T8E B;  1WWJ A;  4OFM A;  4NV5 A;  4KSM A;  3E3E A;  1KNG A;  4XS4 B;  1FOH A;  4AF2 A;  1GP1 A;  2ON7 A;  2ES7 A;  3UMA A;  2VCT A;  3KCM A;  3O3T A;  2X64 A;  2TIR A;  1N8J A;  3R2Q A;  1ZYP A;  1R5A A;  1AQV A;  3WGE A;  4LL1 B;  1C72 A;  5IOX A;  2XPD A;  3EU3 A;  3KIJ A;  3GX0 A;  3JCM L;  2VL2 C;  1XVW A;  4MDC A;  4ZIL A;  3M3M A;  3PH9 A;  3KMN A;  4V1A g;  16GS A;  5FT3 A;  6GST A;  1WIK A;  3F8U A;  4IW9 A;  1S3D A;  1TRW A;  3W8S A;  1XPV A;  3GH6 A;  2O8V B;  5BRT A;  2AHE A;  1GSF A;  2LRT A;  3IAM 2;  4XRD A;  2PWJ A;  3TKR A;  2YWO A;  3H4K A;  3RHB A;  3TKS E;  1Y1U A;  3F4S A;  2H1A A;  4IJ3 A;  2UZ8 A;  3LG6 A;  4TW5 A;  5G5F A;  3LEF A;  3PIN A;  1I5G A;  1G0T A;  3IAS 2;  4NAX A;  3DKS A;  2WDU A;  1XWA A;  4E68 A;  5LCZ A;  3TOU A;  2PVQ A;  10GS A;  3V1W A;  1XWB A;  1S3C A;  2CAQ A;  2EFE A;  4NXI A;  5KN1 A;  5D8I A;  3GTU A;  2HE3 A;  2YOI A;  1S3A A;  4BWS A;  4IP1 A;  2HXK A;  2PBJ A;  2OJL A;  1EOH A;  3MSZ A;  5ECL B;  4KDU A;  3UAP A;  4L5L A;  3IC4 A;  3HMJ G;  3IV4 A;  3GUS A;  1DUG A;  3IRA A;  2A2P A;  1Z6N A;  4BIK A;  4WBR D;  2H30 A;  1PX7 A;  3TU3 B;  4MJB A;  1GTI A;  2H1D A;  5IO2 A;  3HVS A;  2IMD A;  3EYT A;  5J41 A;  2FCH A;  3BOA A;  2XBQ A;  4NHW A;  4TR0 A;  4KGI A;  1SD9 A;  2LQO A;  1SD8 A;  4TN8 A;  5A34 B;  4NV2 A;  2GGT A;  1QXH A;  2JAD A;  1F6M C;  4ZBB A;  5ECN B;  1EGO A;  4XS1 A;  4L0U A;  1EEM A;  1K0O A;  3Q18 A;  2OE0 A;  1GLQ A;  2H71 A;  2QSI A;  1TXU A;  2VO4 A;  3PGT A;  1HNC A;  2LJR A;  2VLV A;  3TJF A;  1URM A;  2H75 A;  1USB A;  1XIY A;  1PA3 A;  2OE3 A;  5G30 A;  5KN2 A;  1UN2 A;  1F3A A;  2M72 A;  4V1A p;  1SJI A;  2FLS A;  3GNJ A;  1ABA A;  4CY8 A;  4KB3 A;  1XWC A;  2ZCT A;  4MZW A;  3GKK A;  1F37 A;  1Z7P A;  1K0A A;  5DQY A;  1GSY A;  2LQQ A;  2YV7 A;  1LU4 A;  2KLX A;  1XW6 A;  2V1M A;  1SJ6 A;  20GS A;  3IR4 A;  5G2Z A;  13GS A;  1YY7 A;  2XC2 A;  2XPE A;  1BG1 A;  4OCE A;  4GLT A;  2R5G A;  3WT1 A;  1N2A A;  2VKZ G;  3VLN A;  1SJZ A;  3HD5 A;  1SVO A;  3GKX A;  4KAE A;  3QOU A;  2DKI A;  1F3B A;  2KOK A;  3LXT A;  2R4V A;  2L6C A;  3ME8 A;  2OBK A;  1F2E A;  5BMU B;  1OE8 A;  1Q4J A;  2VCZ A;  3GMF A;  5KOW A;  3EMP A;  3L0H A;  4OWY A;  3ZRE A;  2VCW A;  5GSS A;  4LL4 B;  4XS6 A;  1QMV A;  3R3E A;  3C8E A;  4BL7 B;  2H70 A;  2RM5 A;  5E59 A;  2R0P A;  3HJP A;  1X9M B;  2AUV A;  2AB6 A;  4N3Z A;  1EGR A;  5IQY A;  3UJ1 A;  5DAK B;  4BPY A;  1GUL A;  2ON5 A;  1X9W B;  3KH9 A;  1XZO A;  2WFC A;  12GS A;  1TDI A;  1FG4 A;  4IGJ A;  3UL3 A;  4POM A;  3TJG A;  3VWW A;  1H75 A;  4BVY B;  4F0B A;  1BED A;  1K3L A;  1U6T A;  5FWG A;  4Z2U A;  1TW9 A;  4HJ2 A;  5A1N B;  3VUR A;  3BCK A;  2VCV A;  2FY6 A;  4ZBD A;  2VL2 A;  4PI0 C;  1F9M A;  3ZIV A;  2B7K A;  2PVO C;  2NVL A;  4MPF A;  3LJR A;  4IKH A;  1ACV A;  2HSY A;  1XCC A;  5ECM B;  2N5A A;  2P5R A;  4N0V A;  1EP7 A;  3I6A A;  4G2E A;  5IMV A;  5JCG A;  3G9B A;  5B6M A;  3CBU A;  2GST A;  1G7O A;  2VOC A;  2PPT A;  4MK3 A;  4CW9 A;  2M80 A;  5EL8 A;  3VWU A;  1K0D A;  4TOP A;  5J40 A;  1SEN A;  1O7U A;  2NTO A;  4ECJ A;  1JZD A;  4PTS A;  1A23 A;  3IC8 A;  5J4U A;  3CRT A;  1JZR A;  1WMJ A;  1A24 A;  2RLI A;  5KN0 A;  3N5O A;  1KBN A;  4V2M A;  1AQX A;  2GLR A;  1VF2 A;  2K8S A;  4MP4 A;  1OYJ A;  3APQ A;  5JWR B;  2DKH A;  5HR0 A;  4HS1 A;  1AIU A;  2L4Q A;  3DXB A;  2C8U A;  1OC9 A;  3A5W A;  3LW9 A;  5E4W A;  3EUR A;  1AC1 A;  4IQ1 A;  1TI3 A;  2YAN A;  4FYB A;  1Y25 A;  4Q5N A;  2K9F A;  2LV3 A;  5CAX A;  4FQU A;  2GTU A;  3D0Z A;  1T4Y A;  1K3Y A;  1TK0 B;  2N5B A;  2HZF A;  5ECQ B;  4KF9 A;  4I97 A;  1AAZ A;  3OR5 A;  3LWA A;  4OCF A;  1ZMA A;  1BX9 A;  1MDK A;  1YKC A;  4F2I A;  2L5L A;  3GKM A;  2YZH A;  2TRX A;  2CX4 A;  2WW2 A;  1IYH A;  3SWL A;  4DSQ A;  3QR6 A;  1JLV A;  2EIR A;  5J3R A;  1RQM A;  4O32 A;  3D5J A;  2R37 A;  2X99 A;  5KEJ A;  2V32 A;  4OD7 A;  2HNL A;  4ZB9 A;  1ERW A;  4K8M A;  2GQL A;  2F3M A;  2H6X A;  3GRX A;  1FB6 A;  2WVX A;  4EUY A;  4RI6 A;  3L9S A;  1QK8 A;  4HUA A;  2CA8 A;  2B5E A;  2B3S A;  1OC3 A;  1M9B A;  3GH9 A;  3H1N A;  2X49 A;  1RW1 A;  5J9C A;  2JZT A;  4GQC A;  2AYT A;  4EF0 A;  4TXV A;  1YEW C;  2IME A;  2KP1 A;  4IHU A;  2J23 A;  4MF7 A;  1VF4 A;  1B4P A;  3QAG A;  6GSW A;  4MZB A;  4G0L A;  3HDC A;  4J57 E;  2HZE A;  2F51 A;  4D73 A;  4O92 A;  5ECR B;  4GCI A;  1GL8 A;  2ZUP A;  1K3O A;  3FR3 A;  2B1K A;  2MMO A;  3NZN A;  2YWM A;  3TKS C;  4HZ2 A;  1TRU A;  3IK7 A;  2GZY A;  2KHP A;  4MNN A;  2GDR A;  2E0Q A;  1GRX A;  1PFO A;  4EE0 A;  3F4R A;  2GSS A;  4EKZ A;  2YZU A;  2HRA A;  3UEM A;  4EC0 A;  1PSQ A;  4GDF A;  1PRX A;  5F06 A;  3IOS A;  3VFI A;  2V2G A;  3QD9 A;  3ZIT A;  2H01 A;  3TJJ A;  9GSS A;  3CHX C;  5KOX A;  4CY6 A;  1V9W A;  4EL1 A;  4Z7X A;  4TR1 A;  3QFA C;  3AY8 A;  1THO A;  1AXD A;  2XBI A;  4TKY A;  2GT5 A;  4AGS A;  1BAY A;  5AIV A;  3EMX A;  4JBB A;  4WF4 A;  4MF6 A;  4WR5 A;  2IMF A;  4HZ4 A;  2I9H A;  4HDE A;  4O5R A;  1WPI A;  1GSE A;  1KEB A;  5J5N A;  4DVC A;  3ZML A;  2NBS A;  2YWN A;  3UBK A;  2JL4 A;  4ZB7 A;  3TGZ A;  2PGT A;  4FIW A;  5DAL B;  4HQZ A;  1EV4 A;  5J4Y A;  5HR2 A;  3IK9 A;  4K7I A;  2H1L A;  1O8X A;  3CSJ A;  2FWG A;  2C0E A;  4XCS A;  4KH7 A;  3HJO A;  2GQK A;  3WT2 A;  4ML1 A;  1S3R A;  3DRN A;  2H74 A;  4MMM A;  2A4H A;  4PQI A;  5C04 A;  5CRE A;  1AW9 A;  1R7H A;  2VM2 A;  3IXR A;  1NM3 A;  3TKP A;  4POB A;  1Y6E A;  5H5Q A;  4ZXG A;  1ZYN A;  3FW2 A;  5CYY A;  1LJR A;  4MJE A;  1SK2 A;  3EIN A;  2VD0 A;  1A2L A;  5IMC A;  4ACS A;  2RUF A;  1BYE A;  4FYC A;  2LNS A;  4XTS A;  2DJ1 A;  4QL7 A;  4POL A;  1GSS A;  1AQW A;  2MBT A;  1YDK A;  1PN0 A;  2P0G A;  1RK4 A;  1EEJ A;  3KP9 A;  4MCU A;  5DDL A;  5A5H A;  4MJA A;  3IDV A;  4OFT A;  2HSM B;  2VD1 A;  4NWY A;  3US3 A;  3Q6O A;  3HYP A;  1B8X A;  4LLR A;  1M2D A;  4IP6 A;  1E6B A;  5D9T A;  5DVB A;  4K0G A;  2HSN B;  4FH8 A;  1X5C A;  4TR4 A;  3G7J A;  3KZQ A;  5HFI A;  2WVY A;  3LGC A;  4AJ8 A;  2HRN A;  1J08 A;  3MAK A;  2LJK A;  4J2F A;  1M7T A;  1V98 A;  1XW9 A;  4G01 A;  2FGX A;  2DJK A;  4V2N A;  2NPB A;  3LOR A;  3K8N A;  2FWE A;  2O7K A;  4G0K A;  4K0N A;  5D96 A;  4K5S A;  4WBJ A;  2VLT A;  2WJU A;  1ON4 A;  2D2Z A;  19GS A;  1PX6 A;  2DIY A;  2JU5 A;  1A2J A;  1SK0 A;  3I69 A;  4I5Q A;  2XHF A;  2YJH A;  1YJ6 A;  3ZIJ A;  4IBP A;  5ECI B;  1GLP A;  1SYR A;  3F3R A;  5G1K A;  2C80 A;  1GSU A;  1M3J A;  1XOB A;  3DD3 A;  1DE2 A;  3HKR A;  4MZC A;  1PL2 A;  1XVQ A;  3M9J A;  2C4J A;  3P2A A;  3GUR A;  3N9J A;  2DJ0 A;  4KA0 A;  2CVB A;  3UOM A;  2DC5 A;  2K18 A;  2LS5 A;  3QAV A;  1SL1 B;  2B7J A;  4RQX A;  3F0I A;  4GSN A;  2HYX A;  3EE2 A;  4YAV A;  3ISO A;  2FD3 A;  4MA9 A;  5CP1 A;  4DSR A;  2IMK A;  2QKE A;  3M0F A;  1GSD A;  4PUA A;  3BBY A;  5ECO B;  2EFH A;  3KD0 A;  2LNT A;  4HJM A;  4XS4 A;  2WS2 A;  1PL1 A;  3GIX A;  2WB9 A;  4EDZ A;  3TKS A;  1EOG A;  2DBC A;  1JHB A;  4HI7 A;  3HJM A;  1GTA A;  2EFD A;  1T7P B;  1T3B A;  4JR4 A;  3FZA A;  3ED3 A;  2YN1 A;  1JZW A;  4N11 A;  3TJK A;  1M99 A;  2UV8 G;  4FYU A;  1BJX A;  1YF0 A;  5ID2 A;  3CXG A;  2H66 A;  1M0U A;  5B8A A;  3ZVJ A;  2VLU A;  4K1F A;  4MH3 A;  2H6Z A;  4Z2R A;  3NOF A;  1YF1 A;  1EWX A;  4ZIJ A;  4K9Z A;  4ZL7 A;  4RUV A;  3TDG A;  2LKU A;  2HLS A;  3TRQ A;  1ML6 A;  1MDI A;  3IBH A;  3ZFB A;  1TOF A;  1V57 A;  1OAZ A;  2MMZ A;  3UVH A;  1K0M A;  2GZP A;  1TRV A;  3ZTL A;  2RM6 A;  2J9H A;  4ZB6 A;  1VF3 A;  3HA9 A;  3RDW A;  4GQF A;  3KH7 A;  1G6Y A;  4OMV A;  4G10 A;  1K0C A;  2F8F A;  2QA2 A;  1U88 A;  1BF5 A;  5L71 A;  3TCO A;  1U3I A;  4ECI A;  1XBS A;  4MJC A;  1UC7 A;  3MDK A;  3RGB C;  6GSU A;  1YZX A;  4ECB A;  1A2M A;  4X1U A;  2DJJ A;  3APS A;  2AJQ B;  3GST A;  11GS A;  4EIQ A;  3CYN A;  4MH2 A;  4Z2T A;  5GAN D;  5LNK e;  4LMW A;  4MAB A;  2IPA A;  1FO5 A;  4WXT A;  2H0I A;  1GUH A;  3GYK A;  4E8H A;  2CVD A;  2CVK A;  3H79 A;  2HRK B;  2MMN A;  4P3Y B;  2O36 A;  1Z7R A;  4FXY P;  1WP0 A;  3KP8 A;  3VPT A;  5A34 A;  3E9J B;  5IMA A;  2I81 A;  1THX A;  2AAW A;  5CO3 A;  3RPN A;  1X5D A;  2YPM A;  4TXO B;  1NSW A;  1G6W A;  1GWC A;  3GA4 A;  2IFQ B;  1O81 A;  1MEK A;  2HFD A;  5D9X A;  6GSX A;  2KUC A;  3DVW A;  3HXS A;  1OC8 A;  1Z5Y E;  1O73 A;  2PUK C;  5INY A;  4BVX B;  4K2X A;  4F82 A;  4K7N A;  1O8W A;  1MD3 A;  3VWX A;  5G5E A;  4IS0 A;  3TOT A;  1R4W A;  1EZK A;  4KDY A;  4ZBA A;  3MNG A;  1SKW B;  4JR6 A;  2ALB A;  5DJL A;  1K0N A;  4O7H A;  1E2Y A;  1WOU A;  3FK8 A;  2H8L A;  2A2S A;  1TJD A;  4Q5Q A;  1ERT A;  1EV9 A;  4KUN A;  3RPP A;  2A2R A;  3D4T A;  4L0W A;  3DYR A;  4PUR A;  4ML6 A;  2DMM A;  3LQ7 A;  3GX8 A;  4JE1 A;  4MLY A;  3QFB C;  4I2U A;  2PU9 C;  4GRF A;  1SYX A;  1V58 A;  2O89 A;  2I1U A;  3D4M A;  4J56 E;  2ZNM A;  4BWQ A;  3MYD A;  4HU7 A;  3FHK A;  5CNW A;  1S4B P;  1Q98 A;  1ZCP A;  3ZFL A;  2QA1 A;  4OO4 A;  1VRS D;  3EPT A;  2PMT A;  3A3T A;  2JSZ A;  2DIZ A;  2WCI A;  2DSA A;  2LRN A;  4PI2 C;  1GTU A;  2CX3 A;  1XFL A;  4KDX A;  5BMU A;  3P90 A;  2DML A;  2PN8 A;  3BJ5 A;  3KM6 A;  2JSY A;  1HD2 A;  2VM1 A;  1YEX A;  2JAC A;  1XOA A;  2R0C A;  4ISD A;  2CZ3 A;  4KE3 A;  1DSB A;  1GNW A;  1M2A A;  5ECK B;  1X9S B;  4BL7 A;  1MDJ A;  3J7Y b;  3F3Q A;  3PR8 A;  2CAI A;  1UVZ A;  18GS A;  3VK9 A;  2OAD A;  4KCA A;  5KN3 A;  3HVN A;  1TI1 A;  5DAK A;  3TUE A;  3FYG A;  1B9Y C;  2C0G A;  4L5O A;  3P8W A;  1DE1 A;  1HYU A;  5GAP D;  2E2G A;  3GTU B;  2L6D A;  4BVY A;  5IOW A;  4TVE A;  2I3Y A;  2PER A;  3VWV A;  1QFN A;  2HQT A;  3BCI A;  1GNE A;  1NHY A;  3CTG A;  4X0X A;  3C71 A;  1TP9 A;  5FHI A;  3ZVJ D;  2WW0 A;  2IIY A;  1JZO A;  2AV4 A;  3EU4 A;  4YKG A;  3FZ9 A;  3RAZ A;  1A0F A;  3UIW A;  2VCX A;  1XWG A;  4IJI A;  4IN0 A;  2H72 A;  1ZGN A;  1W4V A;  2I4A A;  1QUW A;  3DEX A;  1XW5 A;  2BJX A;  1AUC A;  2GVP A;  1GH2 A;  2C3N A;  1M2B A;  1A8L A;  2VIM A;  5ECP B;  2OBI A;  3ERG A;  4W66 A;  5JCU A;  1GSQ A;  4NHZ A;  2M46 A;  1FOV A;  3MIX A;  3FRC A;  1PQN A;  4ZL9 A;  4HU9 A;  2G0F A;  1SL0 B;  1V2A A;  4I2T A;  1J9B A;  3WGD A;  3D21 A;  4EVM A;  3FZ4 A;  2WZ9 A;  3A2X A;  4N0Z A;  3C73 A;  2LEG A;  2OAC A;  4N30 A;  2FHE A;  5J9B A;  3G7I A;  1BQ7 A;  2CZ2 A;  2R2J A;  3EC3 A;  4F0C A;  5IIZ A;  2G2Q A;  4O5U A;  1ST9 A;  2V6O A;  4EDY A;  2X4A A;  4QQ7 A;  4WR4 A;  2IL3 A;  1FB0 A;  2WW1 A;  3ZRD A;  5B8B A;  1SKS B;  2R0G A;  2VAF A;  5H5S A;  2X8H A;  1VGL A;  3FMW A;  4AKI A;  4QL9 A;  2X8C A;  1K0B A;  1SVL A;  3ZLP A;  1FW1 A;  4I8B A;  4GXZ A;  5LD0 A;  1TK8 B;  1YEP A;  1QGV A;  2A4V A;  3HVV A;  2B6M A;  2H1G A;  4HEA 2;  5ID2 B;  3HZ4 A;  3IHQ A;  3RHC A;  3O76 A;  5EY6 A;  1ZYQ B;  1HQO A;  5F0G A;  4JRR A;  3C1S A;  2GZZ A;  14GS A;  2LRC A;  4KW6 A;  4L8E A;  2IMI A;  4KX4 A;  5B7C A;  2H6Y A;  1WJK A;  1Z9H A;  3DGQ A;  1FVJ A;  5GZZ B;  4WET A;  5IMF A;  4TRX A;  2JZR A;  5DQS A;  3ME7 A;  4HSC X;  3I9V 2;  4GWR A;  3L78 A;  4X4J A;  1LBK A;  3TRX A;  3O6T A;  1PN9 A;  4YKF A;  5F05 A;  2C3Q A;  3GHA A;  4TR3 A;  3RBT A;  3GKN A;  2LJA A;  4WKW A;  3IE3 A;  2L5O A;  1O85 A;  1GUK A;  2RII A;  2MZC A;  2EIQ A;  2EC4 A;  3IPZ A;  2O5V A;  5ECS A;  3KTL A;  3L9V A;  4GTU A;  4AJ7 A;  1U87 A;  2O3E A;  1XXU A;  5EVO A;  2FA4 A;  1ZL9 A;  3H93 A;  5H5R A;  3DVX A;  1G7E A;  2OT3 A;  4A5P A;  2O87 A;  3G7Y A;  5AIS A;  4ECC A;  1R26 A;  2CV4 A;  1SU9 A;  2DJ3 A;  5COH A;  4PUF C;  4ZL8 A;  4V2L A;  4G0I A;  2WUL A;  1M9A A;  2E2M A;  2CT6 A;  2EFC A;  2WGR A;  2P5Q A;  1KTE A;  2B1L A;  2CQ9 A;  4Q5R A;  5IPG A;  4AJ6 A;  3CTF A;  4XHM A;  4DSS A;  1PKW A;  3ERF A;  4USS A;  1T1V A;  3M8N A;  1JLW A;  1A8Y A;  1NW2 A;  2VL3 A;  1VF1 A;  3L4N A;  4F03 A;  5IM9 A;  4EIP A;  3F9U A;  3IHG A;  2EIO A;  2V41 A;  4JZQ A;  1PKZ A;  2HSH A;  4Q5F A;  2F8A A;  5CRG A;  2GSQ A;  1M3I A;  1CQH A;  4YQM A;  2N5F A;  5AGY A;  3QDN A;  3LYK A;  4XRA A;  1R5P A;  1Z3E A;  2HI7 A;  5DAL A;  1OC9 B;  5IMZ A;  5AIX A;  1WRY A;  3HZ8 A;  4MPG A;  5A5K A;  2K8V A;  3F63 A;  3UVT A;  2X8G A;  5HR3 A;  5CRH A;  5C00 A;  3WGX A;  1CQG A;  5ABR A;  2OE1 A;  4H86 A;  1T00 A;  3FY7 A;  3LSZ A;  4LA1 A;  1NHO A;  2YJ7 A;  4GST A;  1HNA A;  1MTC A;  3SBC A; 
#chains in the Genus database with same CATH homology
 4X43 A;  3CWG A;  5J4V A;  4IQA A;  5ELA A;  3TJB A;  4PQ1 A;  5JCW A;  5D9W A;  1O6J A;  2YNX A;  5J47 A;  2VUP A;  4G19 A;  2V6K A;  2HT9 A;  3KEB A;  1FVK A;  3M1G A;  5HFG A;  4K6X A;  4XIH A;  3PPU A;  3D22 A;  4PQH A;  4O5Q A;  6GSV A;  1PGT A;  4GSS A;  1TRS A;  2FWH A;  5IO0 A;  2MMA A;  5DCG A;  3HCZ A;  3U5R E;  3FEU A;  2HSM A;  3DWV A;  4KCE A;  1BG5 A;  2R3X A;  4PNG A;  3KGK A;  4WF5 A;  1PD2 1;  2NDO A;  4NPB A;  1W89 A;  1TKD B;  2HSN A;  1SKR B;  6GSS A;  1YQ1 A;  22GS A;  3Q19 A;  4JED A;  1J0F A;  1TXX A;  1EP8 A;  4POK A;  1OKT A;  3W8J A;  6GSY A;  1TTZ A;  5A4U A;  3D6I A;  4KSO A;  3LFL A;  2HZE B;  4E8E A;  1B9X C;  4D73 B;  3C1R A;  4RQR A;  2L57 A;  3A2W A;  1YKA A;  4ZB8 A;  2GT6 A;  4FO5 A;  2YCD A;  5AN1 A;  1ZOF A;  3HVX A;  2OKA A;  3KMO A;  2REM A;  2FNO A;  5DJM A;  4YAP A;  3FKF A;  4OO5 A;  2B5Y A;  3CSH A;  3GN3 A;  5IMD A;  2C0F A;  4HOJ A;  5A4W A;  4YQV A;  2BMX A;  2B5X A;  2L59 A;  3FR6 A;  5D93 A;  3ZYW A;  4RI7 A;  1I9D A;  5JWQ B;  2H1B A;  2QC7 A;  1X0R A;  2IJY A;  2H0G A;  1JFU A;  7GSS A;  3DML A;  4BA7 A;  3BD2 A;  1ERU A;  1TU8 A;  4TR1 B;  2C0D A;  4JU5 A;  2LUS A;  2Z9S A;  1QQ2 A;  3TKQ A;  2R6K A;  3LYP A;  2HRF A;  4HQS A;  3WD6 A;  1PMT A;  1SK1 A;  3QAW A;  4CHS A;  3EWL A;  2H0H A;  3J7Y k;  5IPH A;  2C3T A;  3ZZX A;  2GSR A;  3ERW A;  4ILF A;  4PNF A;  4WEY A;  2GQM A;  5DBQ A;  5CRD A;  5GST A;  5JWO B;  2E7P A;  5ENU A;  4QMK A;  2KP2 A;  2K6V A;  5A4V A;  4YH2 A;  3U6V A;  4ICY A;  4N10 A;  3MWH A;  2O85 A;  1ERV A;  4NMU A;  2BTO T;  3EVI A;  3VI5 A;  1HNB A;  3S9F A;  3FZ5 A;  4AKG A;  4GF0 A;  2MBS A;  3L9U A;  4G9H A;  4IEL A;  3UAR A;  2TRC P;  4AI6 A;  2P31 A;  1FAA A;  3FR9 A;  3KTB A;  4YQU A;  4ULX A;  1U3A A;  1UA5 A;  3GV1 A;  5HR1 A;  4IVF A;  4EXJ A;  3KJY A;  2GS3 A;  3I43 A;  1T4Z A;  5G1L A;  3KXO A;  4PX1 A;  1V40 A;  2LTK A;  5ELG A;  2H19 A;  4K2D A;  2FUG 2;  2VL9 A;  5A5H B;  4DEJ A;  3H8Q A;  5B6N A;  3VI7 A;  1X5E A;  4EO3 A;  2DJ2 A;  2FWF A;  17GS A;  1OVN A;  2IWT A;  3UBL A;  1H4O A;  2JZS A;  4KND A;  5DCH A;  5D73 A;  2RUE A;  4K5R A;  3CSI A;  3GL3 A;  3HY2 A;  2MYG A;  4F9Z A;  2YV9 A;  4ID0 A;  2DLX A;  1ZYE A;  2C1Y A;  3GFK A;  2OA7 A;  5G31 A;  5HFK A;  5A1N A;  3QMX A;  2H76 A;  3CMI A;  1SVM A;  1WE0 A;  3ZL5 A;  3Q74 A;  2YP6 A;  5F8B A;  3C7M A;  3W6G A;  3F6D A;  4OFN A;  4CDO A;  5F07 A;  3F4T A;  1Z6M A;  3TB2 A;  2IN3 A;  4K7O A;  2QGV A;  3CRU A;  1TU7 A;  4PXO A;  2HRK A;  2F9S A;  3GSS A;  1MD4 A;  3A5I A;  2WRT A;  1B48 A;  3IA1 A;  5CRW A;  1IYI A;  2VCQ A;  2LST A;  2YWI A;  3QCP A;  4AKX B;  1GTB A;  5EPF A;  1ZZY A;  2L4C A;  4TXO A;  4LMV A;  8GSS A;  1YVL A;  5HQP A;  1OKD A;  3HHV A;  2IFQ A;  3GL5 A;  1A0R P;  5D9V A;  3LXZ A;  2H73 A;  3E0U A;  1SL2 B;  4BVX A;  3A2V A;  4DSS B;  1TK5 B;  5ECH B;  1GUM A;  2FA8 A;  1N25 A;  3P7X A;  3VPQ A;  3NIV A;  3WYW A;  3ZMK A;  3TRP A;  3M9K A;  3APO A;  1DBY A;  1ILO A;  4PGT A;  4MF5 A;  1B4Q A;  4AKH A;  3F6F A;  1OE7 A;  4I6X A;  3DIE A;  1XWK A;  3QPM A;  1FHE A;  1T8E B;  1WWJ A;  4OFM A;  4NV5 A;  4KSM A;  3E3E A;  1KNG A;  4XS4 B;  1FOH A;  4AF2 A;  1GP1 A;  2ON7 A;  2ES7 A;  3UMA A;  2VCT A;  3KCM A;  3O3T A;  2X64 A;  2TIR A;  1N8J A;  3R2Q A;  1ZYP A;  1R5A A;  1AQV A;  3WGE A;  4LL1 B;  1C72 A;  5IOX A;  2XPD A;  3EU3 A;  3KIJ A;  3GX0 A;  3JCM L;  2VL2 C;  1XVW A;  4MDC A;  4ZIL A;  3M3M A;  3PH9 A;  3KMN A;  4V1A g;  16GS A;  5FT3 A;  6GST A;  1WIK A;  3F8U A;  4IW9 A;  1S3D A;  1TRW A;  3W8S A;  1XPV A;  3GH6 A;  2O8V B;  5BRT A;  2AHE A;  1GSF A;  2LRT A;  3IAM 2;  4XRD A;  2PWJ A;  3TKR A;  2YWO A;  3H4K A;  3RHB A;  3TKS E;  1Y1U A;  3F4S A;  2H1A A;  4IJ3 A;  2UZ8 A;  3LG6 A;  4TW5 A;  5G5F A;  3LEF A;  3PIN A;  1I5G A;  1G0T A;  3IAS 2;  4NAX A;  3DKS A;  2WDU A;  1XWA A;  4E68 A;  5LCZ A;  3TOU A;  2PVQ A;  10GS A;  3V1W A;  1XWB A;  1S3C A;  2CAQ A;  2EFE A;  4NXI A;  5KN1 A;  5D8I A;  3GTU A;  2HE3 A;  2YOI A;  1S3A A;  4BWS A;  4IP1 A;  2HXK A;  2PBJ A;  2OJL A;  1EOH A;  3MSZ A;  5ECL B;  4KDU A;  3UAP A;  4L5L A;  3IC4 A;  3HMJ G;  3IV4 A;  3GUS A;  1DUG A;  3IRA A;  2A2P A;  1Z6N A;  4WBR D;  2H30 A;  1PX7 A;  3TU3 B;  4MJB A;  1GTI A;  2H1D A;  5IO2 A;  3HVS A;  2IMD A;  3EYT A;  5J41 A;  2FCH A;  3BOA A;  2XBQ A;  4NHW A;  4TR0 A;  4KGI A;  1SD9 A;  2LQO A;  1SD8 A;  4TN8 A;  5A34 B;  4NV2 A;  2GGT A;  1QXH A;  2JAD A;  1F6M C;  4ZBB A;  5ECN B;  1EGO A;  4XS1 A;  4L0U A;  1EEM A;  1K0O A;  3Q18 A;  2OE0 A;  1GLQ A;  2H71 A;  2QSI A;  1TXU A;  2VO4 A;  3PGT A;  1HNC A;  2LJR A;  2VLV A;  3TJF A;  1URM A;  2H75 A;  1USB A;  1XIY A;  1PA3 A;  2OE3 A;  5G30 A;  5KN2 A;  1UN2 A;  1F3A A;  2M72 A;  4V1A p;  1SJI A;  2FLS A;  3GNJ A;  1ABA A;  4CY8 A;  4KB3 A;  1XWC A;  2ZCT A;  4MZW A;  3GKK A;  1F37 A;  1Z7P A;  1K0A A;  5DQY A;  1GSY A;  2LQQ A;  2YV7 A;  1LU4 A;  2KLX A;  1XW6 A;  2V1M A;  1SJ6 A;  20GS A;  3IR4 A;  5G2Z A;  13GS A;  1YY7 A;  2XC2 A;  2XPE A;  1BG1 A;  4OCE A;  4GLT A;  2R5G A;  3WT1 A;  1N2A A;  2VKZ G;  3VLN A;  1SJZ A;  3HD5 A;  1SVO A;  3GKX A;  4KAE A;  3QOU A;  2DKI A;  1F3B A;  2KOK A;  3LXT A;  2R4V A;  2L6C A;  3ME8 A;  2OBK A;  1F2E A;  5BMU B;  1OE8 A;  1Q4J A;  2VCZ A;  3GMF A;  5KOW A;  3EMP A;  3L0H A;  4OWY A;  3ZRE A;  2VCW A;  5GSS A;  4LL4 B;  4XS6 A;  1QMV A;  3R3E A;  3C8E A;  4BL7 B;  2H70 A;  2RM5 A;  5E59 A;  2R0P A;  3HJP A;  1X9M B;  2AUV A;  2AB6 A;  4N3Z A;  1EGR A;  5IQY A;  3UJ1 A;  5DAK B;  4BPY A;  1GUL A;  2ON5 A;  1X9W B;  3KH9 A;  1XZO A;  2WFC A;  12GS A;  1TDI A;  1FG4 A;  4IGJ A;  3UL3 A;  4POM A;  3TJG A;  3VWW A;  1H75 A;  4BVY B;  4F0B A;  1BED A;  1K3L A;  1U6T A;  5FWG A;  4Z2U A;  1TW9 A;  4HJ2 A;  5A1N B;  3VUR A;  3BCK A;  2VCV A;  2FY6 A;  4ZBD A;  2VL2 A;  1F9M A;  3ZIV A;  2B7K A;  2PVO C;  2NVL A;  4MPF A;  3LJR A;  4IKH A;  1ACV A;  2HSY A;  1XCC A;  5ECM B;  2N5A A;  2P5R A;  4N0V A;  1EP7 A;  3I6A A;  4G2E A;  5IMV A;  5JCG A;  3G9B A;  5B6M A;  3CBU A;  2GST A;  1G7O A;  2VOC A;  2PPT A;  4MK3 A;  4CW9 A;  2M80 A;  5EL8 A;  3VWU A;  1K0D A;  4TOP A;  5J40 A;  1SEN A;  1O7U A;  2NTO A;  4ECJ A;  1JZD A;  4PTS A;  1A23 A;  3IC8 A;  5J4U A;  3CRT A;  1JZR A;  1WMJ A;  1A24 A;  2RLI A;  5KN0 A;  3N5O A;  1KBN A;  4V2M A;  1AQX A;  2GLR A;  1VF2 A;  2K8S A;  4MP4 A;  1OYJ A;  3APQ A;  5JWR B;  2DKH A;  5HR0 A;  4HS1 A;  1AIU A;  2L4Q A;  3DXB A;  2C8U A;  1OC9 A;  3A5W A;  3LW9 A;  5E4W A;  3EUR A;  1AC1 A;  4IQ1 A;  1TI3 A;  2YAN A;  4FYB A;  1Y25 A;  4Q5N A;  2K9F A;  2LV3 A;  5CAX A;  4FQU A;  2GTU A;  3D0Z A;  1T4Y A;  1K3Y A;  1TK0 B;  2N5B A;  2HZF A;  5ECQ B;  4KF9 A;  4I97 A;  1AAZ A;  3OR5 A;  3LWA A;  4OCF A;  1ZMA A;  1BX9 A;  1MDK A;  1YKC A;  4F2I A;  2L5L A;  3GKM A;  2YZH A;  2TRX A;  2CX4 A;  1IYH A;  3SWL A;  4DSQ A;  3QR6 A;  1JLV A;  2EIR A;  5J3R A;  1RQM A;  4O32 A;  3D5J A;  2R37 A;  2X99 A;  5KEJ A;  2V32 A;  4OD7 A;  2HNL A;  4ZB9 A;  1ERW A;  4K8M A;  2GQL A;  2F3M A;  2H6X A;  3GRX A;  1FB6 A;  4EUY A;  4RI6 A;  3L9S A;  1QK8 A;  4HUA A;  2CA8 A;  2B5E A;  2B3S A;  1OC3 A;  1M9B A;  3GH9 A;  3H1N A;  2X49 A;  1RW1 A;  5J9C A;  2JZT A;  4GQC A;  2AYT A;  4EF0 A;  4TXV A;  2IME A;  2KP1 A;  4IHU A;  2J23 A;  4MF7 A;  1VF4 A;  1B4P A;  3QAG A;  6GSW A;  4MZB A;  4G0L A;  3HDC A;  4J57 E;  2HZE A;  2F51 A;  4D73 A;  4O92 A;  5ECR B;  4GCI A;  1GL8 A;  2ZUP A;  1K3O A;  3FR3 A;  2B1K A;  2MMO A;  3NZN A;  2YWM A;  3TKS C;  4HZ2 A;  1TRU A;  3IK7 A;  2GZY A;  2KHP A;  4MNN A;  2GDR A;  2E0Q A;  1GRX A;  4EE0 A;  3F4R A;  2GSS A;  4EKZ A;  2YZU A;  2HRA A;  3UEM A;  4EC0 A;  1PSQ A;  4GDF A;  1PRX A;  5F06 A;  3IOS A;  3VFI A;  2V2G A;  3QD9 A;  3ZIT A;  2H01 A;  3TJJ A;  9GSS A;  5KOX A;  4CY6 A;  1V9W A;  4EL1 A;  4Z7X A;  4TR1 A;  3QFA C;  3AY8 A;  1THO A;  1AXD A;  2XBI A;  4TKY A;  2GT5 A;  4AGS A;  1BAY A;  5AIV A;  3EMX A;  4JBB A;  4WF4 A;  4MF6 A;  4WR5 A;  2IMF A;  4HZ4 A;  2I9H A;  4HDE A;  4O5R A;  1WPI A;  1GSE A;  1KEB A;  5J5N A;  4DVC A;  3ZML A;  2NBS A;  2YWN A;  3UBK A;  2JL4 A;  4ZB7 A;  3TGZ A;  2PGT A;  4FIW A;  5DAL B;  4HQZ A;  1EV4 A;  5J4Y A;  5HR2 A;  3IK9 A;  4K7I A;  2H1L A;  1O8X A;  3CSJ A;  2FWG A;  2C0E A;  4XCS A;  4KH7 A;  3HJO A;  2GQK A;  3WT2 A;  4ML1 A;  3DRN A;  2H74 A;  4MMM A;  2A4H A;  4PQI A;  5C04 A;  5CRE A;  1AW9 A;  1R7H A;  2VM2 A;  3IXR A;  1NM3 A;  3TKP A;  4POB A;  1Y6E A;  5H5Q A;  4ZXG A;  1ZYN A;  3FW2 A;  5CYY A;  1LJR A;  4MJE A;  1SK2 A;  3EIN A;  2VD0 A;  1A2L A;  5IMC A;  4ACS A;  2RUF A;  1BYE A;  4FYC A;  2LNS A;  4XTS A;  2DJ1 A;  4QL7 A;  4POL A;  1GSS A;  1AQW A;  2MBT A;  1YDK A;  1PN0 A;  2P0G A;  1RK4 A;  1EEJ A;  3KP9 A;  4MCU A;  5DDL A;  5A5H A;  4MJA A;  3IDV A;  4OFT A;  2HSM B;  2VD1 A;  4NWY A;  3US3 A;  3Q6O A;  3HYP A;  1B8X A;  4LLR A;  1M2D A;  4IP6 A;  1E6B A;  5D9T A;  5DVB A;  4K0G A;  2HSN B;  4FH8 A;  1X5C A;  4TR4 A;  3G7J A;  3KZQ A;  5HFI A;  3LGC A;  4AJ8 A;  2HRN A;  1J08 A;  3MAK A;  2LJK A;  4J2F A;  1M7T A;  1V98 A;  1XW9 A;  4G01 A;  2FGX A;  2DJK A;  4V2N A;  2NPB A;  3LOR A;  3K8N A;  2FWE A;  2O7K A;  4G0K A;  4K0N A;  5D96 A;  4K5S A;  4WBJ A;  2VLT A;  2WJU A;  1ON4 A;  2D2Z A;  19GS A;  1PX6 A;  2DIY A;  2JU5 A;  1A2J A;  1SK0 A;  3I69 A;  4I5Q A;  2XHF A;  2YJH A;  1YJ6 A;  3ZIJ A;  4IBP A;  5ECI B;  1GLP A;  1SYR A;  3F3R A;  5G1K A;  2C80 A;  1GSU A;  1XOB A;  3DD3 A;  1DE2 A;  3HKR A;  4MZC A;  1PL2 A;  1XVQ A;  3M9J A;  2C4J A;  3P2A A;  3GUR A;  3N9J A;  2DJ0 A;  4KA0 A;  2CVB A;  3UOM A;  2DC5 A;  2K18 A;  2LS5 A;  3QAV A;  1SL1 B;  2B7J A;  4RQX A;  3F0I A;  4GSN A;  2HYX A;  3EE2 A;  4YAV A;  3ISO A;  2FD3 A;  4MA9 A;  5CP1 A;  4DSR A;  2IMK A;  2QKE A;  3M0F A;  1GSD A;  4PUA A;  3BBY A;  5ECO B;  2EFH A;  3KD0 A;  2LNT A;  4HJM A;  4XS4 A;  2WS2 A;  1PL1 A;  3GIX A;  2WB9 A;  4EDZ A;  3TKS A;  1EOG A;  2DBC A;  1JHB A;  4HI7 A;  3HJM A;  1GTA A;  2EFD A;  1T7P B;  1T3B A;  4JR4 A;  3FZA A;  3ED3 A;  2YN1 A;  1JZW A;  4N11 A;  3TJK A;  1M99 A;  2UV8 G;  4FYU A;  1BJX A;  1YF0 A;  5ID2 A;  3CXG A;  2H66 A;  1M0U A;  5B8A A;  3ZVJ A;  2VLU A;  4K1F A;  4MH3 A;  2H6Z A;  4Z2R A;  3NOF A;  1YF1 A;  1EWX A;  4ZIJ A;  4K9Z A;  4ZL7 A;  4RUV A;  3TDG A;  2LKU A;  2HLS A;  3TRQ A;  1ML6 A;  1MDI A;  3IBH A;  3ZFB A;  1TOF A;  1V57 A;  1OAZ A;  2MMZ A;  3UVH A;  1K0M A;  2GZP A;  1TRV A;  3ZTL A;  2RM6 A;  2J9H A;  4ZB6 A;  1VF3 A;  3HA9 A;  3RDW A;  4GQF A;  3KH7 A;  1G6Y A;  4OMV A;  4G10 A;  1K0C A;  2F8F A;  2QA2 A;  1U88 A;  1BF5 A;  5L71 A;  3TCO A;  1U3I A;  4ECI A;  1XBS A;  4MJC A;  1UC7 A;  3MDK A;  1YZX A;  6GSU A;  4ECB A;  1A2M A;  4X1U A;  2DJJ A;  3APS A;  2AJQ B;  3GST A;  11GS A;  4EIQ A;  3CYN A;  4MH2 A;  4Z2T A;  5GAN D;  5LNK e;  4LMW A;  4MAB A;  2IPA A;  1FO5 A;  4WXT A;  2H0I A;  1GUH A;  3GYK A;  4E8H A;  2CVD A;  2CVK A;  3H79 A;  2HRK B;  2MMN A;  4P3Y B;  1Z7R A;  1WP0 A;  3KP8 A;  3VPT A;  5A34 A;  3E9J B;  5IMA A;  2I81 A;  1THX A;  2AAW A;  5CO3 A;  3RPN A;  1X5D A;  2YPM A;  4TXO B;  1NSW A;  1G6W A;  1GWC A;  3GA4 A;  2IFQ B;  1O81 A;  1MEK A;  2HFD A;  5D9X A;  6GSX A;  2KUC A;  3DVW A;  3HXS A;  1OC8 A;  1Z5Y E;  1O73 A;  2PUK C;  5INY A;  4BVX B;  4K2X A;  4F82 A;  4K7N A;  1O8W A;  1MD3 A;  3VWX A;  5G5E A;  4IS0 A;  3TOT A;  1R4W A;  1EZK A;  4KDY A;  4ZBA A;  3MNG A;  1SKW B;  4JR6 A;  2ALB A;  5DJL A;  1K0N A;  4O7H A;  1E2Y A;  1WOU A;  3FK8 A;  2H8L A;  2A2S A;  1TJD A;  4Q5Q A;  1ERT A;  1EV9 A;  4KUN A;  3RPP A;  2A2R A;  3D4T A;  4L0W A;  3DYR A;  4PUR A;  4ML6 A;  2DMM A;  3LQ7 A;  3GX8 A;  4JE1 A;  4MLY A;  3QFB C;  4I2U A;  2PU9 C;  4GRF A;  1SYX A;  1V58 A;  2O89 A;  2I1U A;  3D4M A;  4J56 E;  2ZNM A;  4BWQ A;  3MYD A;  4HU7 A;  3FHK A;  5CNW A;  1Q98 A;  1ZCP A;  3ZFL A;  2QA1 A;  4OO4 A;  1VRS D;  3EPT A;  2PMT A;  3A3T A;  2JSZ A;  2DIZ A;  2WCI A;  2DSA A;  2LRN A;  1GTU A;  2CX3 A;  1XFL A;  4KDX A;  5BMU A;  3P90 A;  2DML A;  2PN8 A;  3BJ5 A;  3KM6 A;  2JSY A;  1HD2 A;  2VM1 A;  1YEX A;  2JAC A;  1XOA A;  2R0C A;  4ISD A;  2CZ3 A;  4KE3 A;  1DSB A;  1GNW A;  1M2A A;  5ECK B;  1X9S B;  4BL7 A;  1MDJ A;  3J7Y b;  3F3Q A;  3PR8 A;  2CAI A;  1UVZ A;  18GS A;  3VK9 A;  2OAD A;  4KCA A;  5KN3 A;  1TI1 A;  5DAK A;  3TUE A;  3FYG A;  1B9Y C;  2C0G A;  4L5O A;  3P8W A;  1DE1 A;  1HYU A;  5GAP D;  2E2G A;  3GTU B;  2L6D A;  4BVY A;  5IOW A;  4TVE A;  2I3Y A;  2PER A;  3VWV A;  1QFN A;  2HQT A;  3BCI A;  1GNE A;  1NHY A;  3CTG A;  4X0X A;  3C71 A;  1TP9 A;  5FHI A;  3ZVJ D;  2IIY A;  1JZO A;  2AV4 A;  3EU4 A;  4YKG A;  3FZ9 A;  3RAZ A;  1A0F A;  3UIW A;  2VCX A;  1XWG A;  4IJI A;  4IN0 A;  2H72 A;  1ZGN A;  1W4V A;  2I4A A;  1QUW A;  3DEX A;  1XW5 A;  2BJX A;  1AUC A;  2GVP A;  1GH2 A;  2C3N A;  1M2B A;  1A8L A;  2VIM A;  5ECP B;  2OBI A;  3ERG A;  4W66 A;  5JCU A;  1GSQ A;  4NHZ A;  2M46 A;  1FOV A;  3MIX A;  3FRC A;  1PQN A;  4ZL9 A;  4HU9 A;  2G0F A;  1SL0 B;  1V2A A;  4I2T A;  1J9B A;  3WGD A;  3D21 A;  4EVM A;  3FZ4 A;  2WZ9 A;  3A2X A;  4N0Z A;  3C73 A;  2LEG A;  2OAC A;  4N30 A;  2FHE A;  5J9B A;  3G7I A;  1BQ7 A;  2CZ2 A;  2R2J A;  3EC3 A;  4F0C A;  5IIZ A;  2G2Q A;  4O5U A;  1ST9 A;  2V6O A;  4EDY A;  2X4A A;  4QQ7 A;  4WR4 A;  2IL3 A;  1FB0 A;  3ZRD A;  5B8B A;  1SKS B;  2R0G A;  2VAF A;  5H5S A;  2X8H A;  1VGL A;  3FMW A;  4AKI A;  4QL9 A;  2X8C A;  1K0B A;  1SVL A;  3ZLP A;  1FW1 A;  4I8B A;  4GXZ A;  5LD0 A;  1TK8 B;  1YEP A;  1QGV A;  2A4V A;  3HVV A;  2B6M A;  2H1G A;  4HEA 2;  5ID2 B;  3HZ4 A;  3IHQ A;  3RHC A;  3O76 A;  5EY6 A;  1ZYQ B;  1HQO A;  5F0G A;  4JRR A;  3C1S A;  2GZZ A;  14GS A;  2LRC A;  4KW6 A;  4L8E A;  2IMI A;  4KX4 A;  5B7C A;  2H6Y A;  1WJK A;  1Z9H A;  3DGQ A;  1FVJ A;  5GZZ B;  4WET A;  5IMF A;  4TRX A;  2JZR A;  5DQS A;  3ME7 A;  3I9V 2;  4GWR A;  3L78 A;  4X4J A;  1LBK A;  3TRX A;  3O6T A;  1PN9 A;  4YKF A;  5F05 A;  2C3Q A;  3GHA A;  4TR3 A;  3RBT A;  3GKN A;  2LJA A;  4WKW A;  3IE3 A;  2L5O A;  1O85 A;  1GUK A;  2RII A;  2MZC A;  2EIQ A;  2EC4 A;  3IPZ A;  2O5V A;  5ECS A;  3KTL A;  3L9V A;  4GTU A;  4AJ7 A;  1U87 A;  1XXU A;  5EVO A;  2FA4 A;  1ZL9 A;  3H93 A;  5H5R A;  3DVX A;  1G7E A;  2OT3 A;  4A5P A;  2O87 A;  3G7Y A;  5AIS A;  4ECC A;  1R26 A;  2CV4 A;  1SU9 A;  2DJ3 A;  5COH A;  4PUF C;  4ZL8 A;  4V2L A;  4G0I A;  2WUL A;  1M9A A;  2E2M A;  2CT6 A;  2EFC A;  2WGR A;  2P5Q A;  1KTE A;  2B1L A;  2CQ9 A;  4Q5R A;  5IPG A;  4AJ6 A;  3CTF A;  4XHM A;  4DSS A;  1PKW A;  3ERF A;  4USS A;  1T1V A;  3M8N A;  1JLW A;  1A8Y A;  1NW2 A;  2VL3 A;  1VF1 A;  3L4N A;  4F03 A;  5IM9 A;  4EIP A;  3F9U A;  3IHG A;  2EIO A;  2V41 A;  4JZQ A;  1PKZ A;  2HSH A;  4Q5F A;  2F8A A;  5CRG A;  2GSQ A;  1CQH A;  4YQM A;  2N5F A;  5AGY A;  3QDN A;  3LYK A;  4XRA A;  1R5P A;  1Z3E A;  2HI7 A;  5DAL A;  1OC9 B;  5IMZ A;  5AIX A;  1WRY A;  3HZ8 A;  4MPG A;  5A5K A;  2K8V A;  3F63 A;  3UVT A;  2X8G A;  5HR3 A;  5CRH A;  5C00 A;  3WGX A;  1CQG A;  5ABR A;  2OE1 A;  4H86 A;  1T00 A;  3FY7 A;  3LSZ A;  4LA1 A;  1NHO A;  2YJ7 A;  4GST A;  1HNA A;  1MTC A;  3SBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...