1EOGA

Crystal structure of pi class glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQIAFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of thermolabile mutants of human glutathione transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1eogA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eogA01
2CVDA 1SKWB 1JLVA 3IK7A 1TRVA 2GZPA 1GTIA 3D0ZA 3GSSA 4N0VA 3IXRA 2H19A 3S9FA 1RW1A 3K8NA 3DIEA 4MA9A 4TOPA 3ME7A 2H70A 2R4VA 5DVBA 2O85A 2CV4A 1UC7A 3H1NA 3GSTA 1GUKA 1GLPA 1FW1A 1WJKA 3LEFA 3IC4A 3TKSE 2FWFA 2C0GA 5DCHA 1HNCA 3I43A 3IPZA 4G0IA 2FGXA 1O8XA 4GSSA 4ZB8A 4TXOB 1AUCA 1EV4A 1GNEA 2IMDA 2LQQA 4NV2A 19GSA 1FVJA 4K7NA 3UIWA 2ZNMA 3MWHA 2HNLA 2FWGA 3HXSA 2DSAA 2JSZA 2GT5A 2RIIA 3TB2A 4ZL8A 2E7PA 3DMLA 1MEKA 3MDKA 5IO0A 2IWTA 5CRDA 1XWGA 4G10A 1FB0A 2DLXA 3FZ9A 4MLYA 2AV4A 3GHAA 1ZL9A 2C3NA 4OCFA 3VI7A 5DCGA 3DWVA 1EGRA 4OO4A 4OWYA 2N5FA 3PGTA 3Q74A 4OMVA 2B5EA 2M46A 5LNKe 4XS4A 3QR6A 5F8BA 3ZITA 2YCDA 4AF2A 3C8EA 3EC3A 1EP8A 1XWKA 4HZ4A 1IYIA 3N9JA 2NVLA 4DSRA 5ELGA 2H71A 2OA7A 2GS3A 1XVQA 3H8QA 3KJYA 1XW6A 1C72A 2OJLA 5KN3A 3L4NA 2TIRA 4IW9A 4F9ZA 2YV9A 1W4VA 2J9HA 4ACSA 1YQ1A 1W89A 4KE3A 4N30A 4D73B 2JADA 2O87A 4RQXA 4YQUA 5AGYA 2GSRA 3IE3A 4K7OA 5B8BA 4MZCA 2UZ8A 2VLUA 1F3BA 1VRSD 5EVOA 3ZTLA 2NPBA 3LWAA 3I69A 4KGIA 1X5CA 4BWQA 2HFDA 1YKAA 5D93A 1AC1A 1R7HA 2YZUA 1Z7PA 1SL1B 2LRCA 3DGQA 3VFIA 1V57A 4DSSB 2H74A 3F4TA 4MMMA 4PXOA 2X8CA 5D8IA 2O7KA 4TXOA 1E6BA 4BWSA 3FW2A 1SK2A 1UVZA 3CXGA 4NWYA 2L4CA 5IMVA 4OFNA 2P5QA 5JCUA 4MJAA 2LNSA 4OCEA 1GUMA 2B5XA 1H75A 1QUWA 4GLTA 1PX7A 1GSUA 2IN3A 2P31A 4IQ1A 3EWLA 3HJOA 1QK8A 1EOHA 2CX3A 3ZZXA 5G1KA 4GSTA 5HFIA 3IR4A 3D5JA 2KP1A 1G7EA 4DEJA 1A8YA 2QGVA 4PNGA 3VPQA 5IMCA 4AJ6A 1MD3A 3ZVJD 3RPPA 2DMMA 4WETA 4JR4A 2VCVA 2V32A 4BVXB 3GRXA 4TR3A 1N2AA 1GSEA 1ABAA 3I6AA 2V6OA 3CYNA 1ERVA 2CVKA 1Z5YE 3HD5A 1WP0A 1WE0A 1M9BA 1EGOA 2MBSA 1AQWA 3TRPA 3U5RE 3F8UA 3ISOA 2BMXA 4NHZA 1T7PB 3QAGA 2EC4A 4IHUA 4KH7A 1SJ6A 4D73A 4KUNA 1OKTA 1YEPA 1K0CA 2IMFA 3D4TA 3UJ1A 2CQ9A 2HRKB 2OBKA 3CTFA 2RM6A 2WS2A 4O7HA 1Z6NA 2R37A 1IYHA 3EINA 1GWCA 2E0QA 3GTUB 1ZGNA 4DSQA 3CSHA 1XIYA 3WD6A 5H5SA 5IPGA 1XWCA 2LKUA 2V1MA 3ZREA 2PPTA 3DVWA 1Z9HA 10GSA 3FRCA 4KX4A 1AW9A 4DSSA 2GLRA 1LU4A 5AIVA 4Q5RA 3APOA 3KGKA 1M0UA 1NM3A 4GWRA 4KA0A 3ERWA 4HJMA 2XBIA 2H6YA 3CTGA 1OC3A 3NIVA 2DJKA 2FHEA 5D9TA 2IPAA 4FQUA 5JWQB 1A0FA 3TJFA 2IMKA 1OE7A 3NOFA 4MJCA 1MDJA 1SL0B 4GXZA 4KDUA 1ZZYA 4PNFA 4ZBDA 4Z7XA 2VL3A 2PERA 4ZB9A 2F8AA 2QKEA 1XCCA 3FR3A 3Q19A 3KIJA 3IOSA 1TI3A 2HRAA 1XPVA 1EZKA 3CRTA 2YWNA 1XWBA 3HYPA 2IL3A 5ENUA 3KH9A 1LBKA 4I5QA 1Q4JA 2WGRA 3GKNA 1HNAA 3P90A 3ZYWA 2WRTA 1XW5A 4MH3A 2YN1A 5D9XA 3D6IA 4PX1A 5J5NA 2JU5A 1DUGA 2VCQA 2H1BA 3QFBC 2YPMA 2MZCA 4IBPA 3GIXA 4KW6A 5IPHA 3M8NA 3IV4A 3GV1A 1THOA 3PR8A 3HVXA 1BYEA 2H73A 1X9WB 5CRWA 2CT6A 4TXVA 3TRXA 3UEMA 2HRKA 1NSWA 4ML6A 5G5FA 2I4AA 3C73A 1THXA 2FWEA 5HR3A 3SWLA 3D21A 5D96A 1JFUA 3GTUA 2JZTA 1U3IA 4K7IA 2P0GA 1BG5A 3KZQA 4HQSA 1A0RP 4EF0A 4ZXGA 2L57A 1VF1A 4MPFA 3QAVA 2H1GA 5EL8A 1B9XC 3GYKA 1SYRA 4IJ3A 4V1Ag 2HSHA 1USBA 3BBYA 1GTBA 1JHBA 2LS5A 4QL7A 1YDKA 4HEA2 4TN8A 2CX4A 2L6CA 3CMIA 4X0XA 4EXJA 2IFQB 5DDLA 1K0MA 1VF4A 1G6WA 1MDIA 1HYUA 1ZYEA 2K8VA 5CAXA 3FYGA 3QCPA 1O85A 3EVIA 1ZYQB 1PL2A 2VCXA 3HJMA 1PRXA 2HSNB 1XZOA 1XOBA 4AJ7A 1EEMA 3APSA 4IQAA 4I97A 1GLQA 1K3OA 3C7MA 2XPDA 1S3AA 2M72A 2VM2A 2H30A 4IS0A 4K1FA 1VGLA 1SJZA 2K6VA 1TOFA 2AUVA 3IRAA 1T00A 1LJRA 1ON4A 5A4UA 4GSNA 4GRFA 2GSSA 3DXBA 2L59A 4ULXA 2V2GA 5LCZA 3UBLA 4Q5FA 3HZ8A 4G9HA 3G7YA 3HVVA 1TK0B 3ZLPA 2MMOA 1URMA 1K0BA 3HA9A 4JR6A 4WKWA 1WOUA 5DBQA 2GSTA 1AAZA 3WGXA 2C0FA 3E9JB 2K8SA 1R5PA 2O89A 4TW5A 3O6TA 1MTCA 4WEYA 3ZIJA 4DVCA 4MP4A 2YOIA 2HSYA 1GULA 3UOMA 3UVTA 4ID0A 2LJAA 1U88A 4V2NA 1OAZA 3NZNA 1QQ2A 3HDCA 1F9MA 4KNDA 2AB6A 3BCIA 4EVMA 2YNXA 2ALBA 4POBA 2LV3A 2N5AA 4O32A 5IO2A 2XBQA 4MZWA 5HR1A 1CQGA 3FY7A 4MZBA 2HE3A 1K0OA 3FR6A 4PQ1A 4I2UA 4JE1A 5JWRB 2XC2A 1F2EA 2LNTA 5ECNB 1J08A 4K2DA 3Q18A 4P3YB 1MDKA 2WJUA 1U6TA 2LUSA 4WR4A 3EMXA 2LJKA 4JEDA 1DBYA 1AQVA 2IFQA 4MK3A 4L5OA 4KDXA 3EMPA 2YZHA 2FY6A 4ZIJA 2PU9C 2NBSA 4K8MA 3CSIA 3HVSA 1XOAA 4N11A 2GTUA 5J41A 3GMFA 4E8EA 4HQZA 3WYWA 2IJYA 3KD0A 2ZCTA 1Z6MA 2IMEA 2XPEA 5IOXA 5ECLB 3KEBA 3WGEA 1GSYA 3L9SA 3RHBA 5AIXA 1EEJA 4KDYA 2R3XA 1XW9A 5CO3A 2OE0A 4Q5NA 3FHKA 5KN0A 1EOGA 1T8EB 1BX9A 2OKAA 4FIWA 1FVKA 4IVFA 3GX0A 5F05A 3VPTA 3EE2A 1B48A 5DQSA 4I6XA 3A3TA 17GSA 1XXUA 3US3A 3BJ5A 3BOAA 1GL8A 5G31A 1YF0A 4ZBAA 3QOUA 2HYXA 3MAKA 4V2MA 4EDYA 3A2VA 5FHIA 3APQA 3UAPA 2AJQB 3KM6A 2VL2C 3FZAA 3HHVA 4O5RA 3C1SA 4K6XA 1ZMAA 5EY6A 1K0NA 1PGTA 4NPBA 5G2ZA 2GQLA 4LLRA 5JCGA 2X8HA 5HFGA 3TKSA 1SKRB 3VURA 18GSA 2HRNA 5ECOB 5DALB 2HRFA 1KEBA 4ZL9A 3F4SA 1HD2A 1PD21 2L6DA 3KXOA 3F3QA 3D4MA 3IHQA 5IQYA 1TKDB 1G7OA 1FOVA 2VL2A 4TR0A 2KOKA 1Z3EA 2O8VB 2B1KA 2QSIA 1GP1A 1YF1A 5DJMA 1YJ6A 2CZ3A 2PMTA 1U87A 4ZB6A 3BCKA 4N10A 1JZRA 1X5DA 2HZEB 4IP1A 1UN2A 5J4UA 2WCIA 3VLNA 4YH2A 1XWAA 5DJLA 4MCUA 1T1VA 1GUHA 2VOCA 3LORA 5KN2A 4ZL7A 2JACA 5FWGA 2WFCA 2D2ZA 22GSA 3LYPA 1SD8A 3HCZA 1ZCPA 1TI1A 2C0DA 4KB3A 3KMNA 1KTEA 3TDGA 5ECMB 3LGCA 2L5OA 1JZWA 1O7UA 1QXHA 16GSA 1ILOA 1GTUA 4ILFA 2GSQA 4KCEA 2VCWA 3LQ7A 2GQKA 5CP1A 4MF7A 4FO5A 1DSBA 1PMTA 4RI6A 4OFMA 1GTAA 1PL1A 3FZ4A 4AGSA 1MD4A 3QDNA 2GDRA 1R4WA 3AY8A 2YWMA 12GSA 2HLSA 2JSYA 3F3RA 3P2AA 2J23A 4L0WA 1GSFA 1EV9A 1YZXA 4XHMA 2QC7A 3VWWA 1GSQA 4F82A 4MF5A 5G1LA 2H1DA 2KLXA 1WRYA 3TOUA 1I5GA 5DQYA 1F37A 4POLA 4JZQA 4ML1A 4I2TA 4XRAA 3GX8A 4HOJA 2CA8A 3F6FA 4PTSA 4ECJA 2FNOA 2C4JA 2VLTA 4HZ2A 5ECKB 1HQOA 5DALA 4L0UA 5D9WA 3ZVJA 4XTSA 3LSZA 4HUAA 1TRUA 1A24A 3GKKA 3GURA 2A4VA 2DC5A 4Q5QA 6GSYA 5J9BA 3IK9A 2VIMA 4MF6A 4BPYA 3KH7A 3UARA 3M0FA 2ES7A 6GSWA 3L78A 2OADA 3J7Yb 4MPGA 2OBIA 3SBCA 1SENA 4GF0A 4K0GA 1O73A 2HZEA 3F4RA 2A2RA 3UMAA 2LQOA 1XBSA 5D9VA 5GAND 1GRXA 2G0FA 4XRDA 1TRWA 4PUFC 4OO5A 3F0IA 2V6KA 2VLVA 2AAWA 2H0GA 3WT2A 3LXZA 4F0BA 3RPNA 4LA1A 4MH2A 1F3AA 3E0UA 1QMVA 1AQXA 2CAQA 1FAAA 2X99A 5COHA 1N8JA 3KCMA 2A2SA 3L9UA 3EU3A 2C80A 1O81A 2V41A 1B9YC 2LEGA 4G0LA 3WT1A 3KP8A 2C8UA 4LMVA 2FA4A 3GKXA 3R3EA 1BEDA 4ECBA 2DJ2A 1A8LA 2FLSA 5CRGA 2H75A 2K18A 1J0FA 5IMAA 3LJRA 1I9DA 5DAKB 5ECPB 4YAPA 2F8FA 4QQ7A 1A2MA 1TU8A 2VO4A 3G7IA 3G7JA 2FUG2 4YAVA 4HDEA 3GH6A 4USSA 11GSA 3TUEA 1UA5A 3ERFA 4HJ2A 2GZYA 4NAXA 1WPIA 1K0DA 2C0EA 1X9MB 2VD0A 1T4YA 4IN0A 4L5LA 4PUAA 1GH2A 4WR5A 3H4KA 4GCIA 2YWIA 2LJRA 5IIZA 3ZFLA 2BJXA 4BA7A 1WWJA 3KP9A 5GZZB 2CAIA 2H0HA 2VUPA 2EIRA 2H0IA 1Y25A 5IMZA 3QD9A 1OKDA 3A2WA 2I3YA 1EWXA 1S3DA 3GA4A 2H01A 1KBNA 5G30A 3FKFA 2BTOT 4FYCA 1GSSA 4WXTA 4QL9A 5CRHA 1SK1A 2GT6A 1BQ7A 2MYGA 1JZDA 1M7TA 14GSA 4ECIA 3RBTA 2LTKA 5H5QA 3IAM2 5CYYA 4G2EA 2I81A 2X64A 3DYRA 2GGTA 5INYA 3OR5A 4TR1B 4XS6A 1OC8A 2CZ2A 2R2JA 1F6MC 1TXXA 4CW9A 1TRSA 2IMIA 1M2DA 3HZ4A 3GN3A 5IM9A 5B6NA 1O6JA 2DJ1A 2PN8A 3EYTA 2HSMA 1PX6A 2PUKC 4KSOA 1KNGA 1ZOFA 4CHSA 5E4WA 6GSUA 5J9CA 5ECHB 1A2JA 4V2LA 1TK5B 1ERTA 3GFKA 2WDUA 1YY7A 2LRTA 3DD3A 1J9BA 3IC8A 2R6KA 1EP7A 1SL2B 4WF4A 3UVHA 3TJJA 5G5EA 5L71A 2TRXA 2IIYA 2FWHA 3FEUA 1YEXA 1V58A 2YV7A 2MBTA 1PSQA 2WULA 2VAFA 3FZ5A 2L4QA 3I9V2 5DAKA 2Z9SA 4EO3A 2ZUPA 2XHFA 2YJHA 4HS1A 4EL1A 1K0AA 1DE1A 6GSXA 2C3QA 5ECIB 2VL9A 5FT3A 1TP9A 4POMA 1NW2A 4F03A 4KSMA 6GSSA 3F6DA 2B1LA 4OD7A 1WIKA 5IMFA 2HXKA 2KUCA 1M2BA 1RK4A 1G0TA 3E3EA 5ABRA 3GUSA 1NHOA 2E2GA 2I1UA 2VCZA 1PA3A 3ZMKA 1TDIA 3LG6A 2OACA 1U3AA 4O92A 1FB6A 3PPUA 4JU5A 1OE8A 2F9SA 13GSA 6GSVA 4WF5A 4OFTA 3H79A 3C71A 20GSA 3DKSA 3TJKA 3MSZA 5GAPD 3DRNA 2RM5A 4L8EA 3L9VA 1AIUA 5HFKA 5H5RA 1PKWA 3W6GA 2L5LA 5ELAA 1K3LA 4G19A 2B6MA 3CBUA 2REMA 1OYJA 2KHPA 2EIQA 9GSSA 4H86A 4TR1A 3WGDA 2MMNA 5GSTA 3ZIVA 3VI5A 3C1RA 1TJDA 3CSJA 2B7JA 1TTZA 2H72A 2DIZA 1CQHA 1QGVA 3VWUA 1FHEA 3TKSC 3O76A 4PQHA 4NHWA 5IOWA 4X43A 3TKQA 4MJBA 1V40A 4TRXA 2KP2A 3IA1A 2DJ3A 1FG4A 4EC0A 1E2YA 2VM1A 4XS1A 3UL3A 2CVBA 4RQRA 4J2FA 4MJEA 3A2XA 2F3MA 3D22A 2NDOA 2ON7A 3PH9A 4EUYA 3M9JA 4F0CA 1SD9A 3TRQA 3LXTA 1TU7A 4MABA 5KN1A 3TOTA 5GSSA 1HNBA 1S3CA 2K9FA 3VWVA 5HR0A 3CRUA 1B4QA 2YWOA 2PBJA 7GSSA 3R2QA 4KF9A 1WMJA 2DBCA 5HQPA 1Q98A 1TK8B 2GZZA 3W8JA 4GTUA 2H76A 3J7Yk 3F63A 2B7KA 3KTBA 1ST9A 2WB9A 3PINA 2G2QA 5C04A 5B8AA 4G0KA 1RQMA 4WBRD 5B7CA 3DEXA 2YJ7A 4PURA 4RUVA 2DJJA 5E59A 5ID2B 4K9ZA 3LYKA 2FCHA 2HT9A 1M2AA 5A5KA 4WBJA 4YQVA 2HZFA 2H1AA 5D73A 1JZOA 3VK9A 2GVPA 2ON5A 3ZFBA 1GSDA 4J56E 4BL7B 2E2MA 2YANA 2PWJA 1X9SB 1Z7RA 4FH8A 3A5WA 2PGTA 4POKA 2NTOA 4NV5A 4N0ZA 1DE2A 1TW9A 1GNWA 2JL4A 2JZRA 4KCAA 4HU9A 5F07A 3TJBA 1ACVA 2HQTA 1T4ZA 1V9WA 2WZ9A 4IGJA 1V98A 1OC9B 4GQCA 2FD3A 1OVNA 5BMUA 2M80A 2OE1A 3IBHA 3MNGA 3ME8A 4EE0A 2DIYA 3EU4A 3F9UA 3GH9A 2LSTA 4LMWA 1ERWA 5JCWA 1SKSB 3QPMA 3Q6OA 2B3SA 2B5YA 4EKZA 5CREA 4IJIA 5F0GA 3V1WA 4TVEA 5J3RA 4XIHA 1M9AA 2R5GA 5F06A 5AISA 4E8HA 1SK0A 2RUFA 2PVQA 3N5OA 3ZRDA 4XCSA 3FR9A 5ECRB 4I8BA 2PVOC 2GQMA 2RLIA 5C00A 3TCOA 3RAZA 1JLWA 3HJPA 1BAYA 3DVXA 1VF2A 2H66A 1V2AA 4AJ8A 5KEJA 5JWOB 1SU9A 2TRCP 3ERGA 3KTLA 3W8SA 3GL3A 4ECCA 1NHYA 1X5EA 3RHCA 4X1UA 1G6YA 2AYTA 3TGZA 1ML6A 4LL4B 3TJGA 4FYUA 3ZL5A 2MMAA 4NMUA 1FO5A 2YP6A 2P5RA 4IELA 1VF3A 5A4VA 4BVXA 1T3BA 2JZSA 8GSSA 3GNJA 4TR4A 2VD1A 5ID2A 4BVYB 3TKPA 2N5BA 1O8WA 2X8GA 2EIOA 4KAEA 3H93A 2OE3A 2HSMB 3EURA 1SJIA 2C1YA 1B8XA 3HY2A 4BL7A 5EPFA 3QAWA 2H6XA 1XFLA 5ECQB 2AHEA 1M99A 1PQNA 3LFLA 3G9BA 4LL1B 1BJXA 2DMLA 1X0RA 1A23A 4RI7A 4HU7A 4HI7A 1OC9A 1XVWA 4PGTA 2FA8A 4K0NA 4ZILA 4F2IA 4IKHA 3JCML 4TKYA 5A4WA 6GSTA 2C3TA 3M9KA 2HI7A 4JBBA 1H4OA 3KMOA 5CNWA 5AN1A 3P8WA 2DJ0A 4YQMA 4CDOA 2F51A 4IP6A 3U6VA 1SYXA 1ERUA 1B4PA 3QFAC 3L0HA 2RUEA 1K3YA 3VWXA 4ISDA 4ZBBA 4GQFA 3ZMLA 1YKCA 2LRNA 3QMXA 2I9HA 3BD2A 3GKMA 3P7XA 2MMZA 4NXIA 3TKRA 4FYBA 2H8LA 5ECSA 3O3TA 3IDVA 4EDZA 5HR2A 3GL5A 3ED3A 4XS4B 1AXDA 3M1GA 4J57E 3M3MA 1Y6EA 1R5AA 3UBKA 3IAS2 3HKRA 3RDWA 2VCTA 4V1Ap 5IMDA 3FK8A 1A2LA 2H6ZA 5LD0A 1PN9A 1PKZA 5B6MA 4BVYA 1R26A 1QFNA 4JRRA 4PQIA 4MDCA
chains in the Genus database with same CATH superfamily
2CVDA 1SKWB 1JLVA 3IK7A 1TRVA 2GZPA 1GTIA 3D0ZA 3GSSA 4N0VA 3IXRA 2H19A 3S9FA 1RW1A 3K8NA 3DIEA 4MA9A 4TOPA 3ME7A 2H70A 2R4VA 3MYDA 5DVBA 2O85A 2CV4A 1UC7A 3H1NA 2WW1A 4EIQA 3GSTA 4AI6A 1GUKA 1GLPA 1FW1A 1WJKA 3LEFA 3IC4A 3TKSE 2FWFA 2C0GA 5DCHA 1HNCA 3I43A 3IPZA 4G0IA 2FGXA 1O8XA 4GSSA 4ZB8A 4TXOB 1AUCA 1EV4A 1GNEA 2IMDA 2LQQA 4NV2A 19GSA 1FVJA 4K7NA 3UIWA 2ZNMA 3MWHA 2HNLA 2FWGA 3HXSA 2DSAA 2JSZA 2GT5A 2RIIA 3TB2A 4ZL8A 5BRTA 2E7PA 3DMLA 1MEKA 3MDKA 5IO0A 2IWTA 4AKXB 5CRDA 1XWGA 4G10A 1FB0A 2DLXA 3FZ9A 1ZYNA 4MLYA 2AV4A 3GHAA 1ZL9A 2C3NA 4OCFA 3VI7A 5DCGA 3DWVA 1EGRA 4OO4A 4OWYA 2N5FA 3PGTA 3Q74A 4OMVA 2B5EA 2M46A 5LNKe 4XS4A 3QR6A 5F8BA 4ICYA 3ZITA 2YCDA 4AF2A 3C8EA 3EC3A 1EP8A 1XWKA 4HZ4A 1IYIA 3N9JA 2HSNA 2NVLA 4DSRA 5ELGA 2H71A 2OA7A 2GS3A 1XVQA 3H8QA 3KJYA 3LW9A 1XW6A 3CQFA 4N3ZA 1C72A 2OJLA 5KN3A 3L4NA 2TIRA 4IW9A 4F9ZA 2YV9A 1W4VA 2J9HA 4ACSA 1YQ1A 1W89A 4KE3A 4N30A 4D73B 2JADA 2O87A 4RQXA 4YQUA 5AGYA 2GSRA 3IE3A 4K7OA 5B8BA 4MZCA 2UZ8A 2VLUA 1F3BA 1VRSD 5EVOA 3ZTLA 2NPBA 3LWAA 3I69A 4KGIA 1X5CA 4BWQA 2HFDA 1YKAA 5D93A 1AC1A 1R7HA 2YZUA 2WW0A 1Z7PA 1SL1B 2QA2A 2LRCA 3DGQA 3VFIA 1V57A 4DSSB 2H74A 3F4TA 4MMMA 2EFDA 4PXOA 2X8CA 5D8IA 2O7KA 4TXOA 1E6BA 4BWSA 3FW2A 1SK2A 1UVZA 3CXGA 4NWYA 2L4CA 5IMVA 4OFNA 2P5QA 5JCUA 4MJAA 2LNSA 4OCEA 1GUMA 2B5XA 1H75A 1QUWA 4GLTA 1PX7A 1GSUA 2IN3A 2P31A 4IQ1A 3EWLA 3HJOA 1QK8A 1EOHA 2CX3A 3ZZXA 5G1KA 4GSTA 5HFIA 3IR4A 3D5JA 2KP1A 1G7EA 4DEJA 1A8YA 2QGVA 4PNGA 3VPQA 5IMCA 4AJ6A 1MD3A 3ZVJD 3RPPA 2DMMA 4WETA 4JR4A 2VCVA 2V32A 4BVXB 3GRXA 4TR3A 1N2AA 1GSEA 1ABAA 3I6AA 2V6OA 3CYNA 1ERVA 2CVKA 1Z5YE 3HD5A 1WP0A 1WE0A 1M9BA 1EGOA 2MBSA 1AQWA 3TRPA 3U5RE 3F8UA 3ISOA 1BF5A 2BMXA 4NHZA 1T7PB 3QAGA 2EC4A 4IHUA 4KH7A 1SJ6A 4D73A 4KUNA 1OKTA 1YEPA 1K0CA 2IMFA 3D4TA 3UJ1A 2CQ9A 2HRKB 2R0CA 2OBKA 3CTFA 5A5HB 2RM6A 2WS2A 4O7HA 1Z6NA 2R37A 1IYHA 2OT3A 3EINA 1GWCA 4ZB7A 2E0QA 3GTUB 1ZGNA 4DSQA 3CSHA 1XIYA 3WD6A 5H5SA 5IPGA 1XWCA 4E68A 2LKUA 2V1MA 3ZREA 2PPTA 3DVWA 1Z9HA 10GSA 3FRCA 4KX4A 1AW9A 4DSSA 2GLRA 1LU4A 5AIVA 4Q5RA 3APOA 3KGKA 1M0UA 1NM3A 4GWRA 4KA0A 3ERWA 4HJMA 2XBIA 2H6YA 3CTGA 1OC3A 3NIVA 2DJKA 2FHEA 5D9TA 2IPAA 4FQUA 5JWQB 1A0FA 3TJFA 2IMKA 1OE7A 3NOFA 4MJCA 1MDJA 1SL0B 4GXZA 4KDUA 1ZZYA 4PNFA 2O3EA 4ZBDA 4Z7XA 2VL3A 2PERA 4ZB9A 2F8AA 2QKEA 1XCCA 3FR3A 3Q19A 3KIJA 3IOSA 1S4BP 2O36A 1TI3A 2HRAA 1XPVA 1EZKA 3CRTA 4CY6A 2YWNA 1XWBA 3HYPA 2IL3A 5ENUA 3KH9A 1LBKA 4I5QA 1Q4JA 2WGRA 3GKNA 2DKIA 1HNAA 3P90A 3ZYWA 2WRTA 1XW5A 4MH3A 2YN1A 5D9XA 3D6IA 4PX1A 5J5NA 2JU5A 1DUGA 2VCQA 2H1BA 3QFBC 2YPMA 2MZCA 4IBPA 3GIXA 4KW6A 5IPHA 3M8NA 3IV4A 3GV1A 1THOA 3PR8A 3HVXA 1BYEA 2H73A 1X9WB 5CRWA 2CT6A 4TXVA 3TRXA 3UEMA 2HRKA 1NSWA 4ML6A 5G5FA 2I4AA 3C73A 1THXA 5A5HA 2FWEA 5HR3A 3SWLA 3D21A 5D96A 1JFUA 3GTUA 2JZTA 1U3IA 4K7IA 2P0GA 1BG5A 2VKZG 3KZQA 4HQSA 1A0RP 4EF0A 4ZXGA 2L57A 1VF1A 4MPFA 3QAVA 2H1GA 5EL8A 1B9XC 3GYKA 1SYRA 4IJ3A 4V1Ag 2HSHA 1USBA 3BBYA 4X4JA 1Y1UA 4FXYP 1GTBA 3RGBC 1JHBA 2LS5A 4QL7A 1YDKA 4HEA2 4TN8A 1I1IP 2CX4A 2L6CA 3CMIA 4X0XA 4EXJA 2IFQB 5DDLA 1K0MA 1VF4A 1G6WA 1MDIA 1HYUA 1ZYEA 2K8VA 4CY8A 5CAXA 3FYGA 3QCPA 1O85A 3EVIA 1ZYQB 1PL2A 2VCXA 3HJMA 1PRXA 2HSNB 1XZOA 2A4HA 1XOBA 4AJ7A 1EEMA 5J4VA 3APSA 4IQAA 4I97A 1GLQA 1K3OA 3C7MA 2XPDA 1S3AA 2M72A 2VM2A 2H30A 4IS0A 4K1FA 1VGLA 1SJZA 2K6VA 1TOFA 2AUVA 3IRAA 1T00A 1LJRA 1ON4A 5A4UA 4GSNA 4GRFA 2GSSA 3DXBA 2L59A 4ULXA 2V2GA 5LCZA 3UBLA 4Q5FA 3HZ8A 4G9HA 3G7YA 3HVVA 1TK0B 3ZLPA 2MMOA 1URMA 4QMKA 1K0BA 3HA9A 4JR6A 4WKWA 1M3JA 1WOUA 5DBQA 2GSTA 1AAZA 3WGXA 2C0FA 3E9JB 2K8SA 1R5PA 2O89A 4TW5A 3O6TA 1MTCA 4WEYA 3ZIJA 4DVCA 5A1NB 4MP4A 2YOIA 2HSYA 1GULA 3UOMA 3UVTA 4ID0A 2LJAA 1U88A 4V2NA 1OAZA 3NZNA 1QQ2A 3HDCA 1F9MA 4KNDA 2AB6A 3BCIA 4EVMA 2YNXA 1YVLA 2ALBA 4POBA 2LV3A 2N5AA 4O32A 5IO2A 2XBQA 4MZWA 5HR1A 1CQGA 3FY7A 4MZBA 2HE3A 1K0OA 3FR6A 4PQ1A 4I2UA 4JE1A 5JWRB 2XC2A 1F2EA 2LNTA 5ECNB 1J08A 4K2DA 3Q18A 4P3YB 1MDKA 2WJUA 1U6TA 2LUSA 4WR4A 3EMXA 2LJKA 4JEDA 1DBYA 1AQVA 2IFQA 4MK3A 4L5OA 4KDXA 3EMPA 2YZHA 2EFCA 2FY6A 4ZIJA 2PU9C 2NBSA 4K8MA 3CSIA 3HVSA 1XOAA 4N11A 2GTUA 3IHGA 5J41A 3GMFA 4E8EA 4HQZA 3WYWA 2IJYA 3KD0A 2ZCTA 1Z6MA 2IMEA 2XPEA 5IOXA 5ECLB 3KEBA 3WGEA 1GSYA 3L9SA 3RHBA 5AIXA 1EEJA 4KDYA 3CHXC 2R3XA 1XW9A 5CO3A 2OE0A 4Q5NA 3FHKA 5KN0A 1EOGA 1T8EB 1BX9A 2OKAA 4FIWA 1FVKA 4IVFA 3GX0A 5F05A 3VPTA 3EE2A 1B48A 5DQSA 4I6XA 3A3TA 17GSA 1XXUA 3US3A 3BJ5A 4G01A 3BOAA 1GL8A 5G31A 1YF0A 4ZBAA 3QOUA 2HYXA 3MAKA 4V2MA 4EDYA 3A2VA 5FHIA 3APQA 1ZYPA 5A1NA 3UAPA 2AJQB 3KM6A 2VL2C 3FZAA 3HHVA 4O5RA 3C1SA 4K6XA 1ZMAA 5EY6A 3HVNA 1K0NA 1PGTA 4NPBA 4O5UA 5G2ZA 2WW2A 2GQLA 4LLRA 5JCGA 2EFHA 2X8HA 5HFGA 3TKSA 1SKRB 3VURA 18GSA 2HRNA 5ECOB 5DALB 2HRFA 1KEBA 1SVOA 4ZL9A 3F4SA 1HD2A 1PD21 2L6DA 3KXOA 3F3QA 3D4MA 3IHQA 5IQYA 1TKDB 1G7OA 1FOVA 2VL2A 4TR0A 2KOKA 1Z3EA 2O8VB 2B1KA 2QSIA 1GP1A 1YF1A 5DJMA 1YJ6A 2CZ3A 2PMTA 1U87A 4ZB6A 2WZSA 3BCKA 4K5RA 4N10A 1JZRA 1X5DA 2HZEB 4IP1A 2WVYA 5J4UA 1UN2A 2WCIA 3VLNA 4YH2A 1XWAA 5DJLA 4MCUA 4GDFA 1T1VA 1GUHA 2VOCA 4AKGA 3LORA 5KN2A 4ZL7A 2JACA 5FWGA 2WFCA 2D2ZA 22GSA 3LYPA 1SD8A 3HCZA 1ZCPA 1TI1A 2C0DA 4KB3A 3KMNA 1KTEA 4W66A 3TDGA 5ECMB 3LGCA 2WVZA 2L5OA 1JZWA 2UV8G 2H1LA 1O7UA 1QXHA 16GSA 1ILOA 1GTUA 4ILFA 2GSQA 4KCEA 2VCWA 3RFRC 3LQ7A 2GQKA 5CP1A 4MF7A 3EPTA 4MNNA 4FO5A 1DSBA 1PMTA 4RI6A 4OFMA 1GTAA 1PL1A 3FZ4A 4AGSA 1MD4A 3QDNA 2GDRA 1R4WA 3AY8A 2YWMA 12GSA 2HLSA 2JSYA 3F3RA 3P2AA 1TXUA 2J23A 4L0WA 1GSFA 1EV9A 1YZXA 4XHMA 2QC7A 3VWWA 1M3IA 1GSQA 4F82A 4MF5A 5G1LA 2H1DA 2KLXA 1WRYA 5KOXA 3TOUA 1I5GA 5DQYA 1F37A 4POLA 4JZQA 4ML1A 4I2TA 4XRAA 3GX8A 4HOJA 2CA8A 3F6FA 4PTSA 4ECJA 2FNOA 2C4JA 2VLTA 4HZ2A 5ECKB 1HQOA 5DALA 4L0UA 5D9WA 3ZVJA 4XTSA 3LSZA 4HUAA 4AKHA 2A2PA 1TRUA 1A24A 3GKKA 3GURA 2A4VA 2DC5A 4Q5QA 6GSYA 5J9BA 3IK9A 2VIMA 4MF6A 4BPYA 3KH7A 3UARA 3M0FA 2ES7A 6GSWA 3L78A 2OADA 3J7Yb 4MPGA 2OBIA 3SBCA 1SENA 4GF0A 4K0GA 1O73A 2HZEA 3F4RA 2A2RA 3UMAA 2LQOA 1XBSA 5D9VA 5GAND 1GRXA 2G0FA 4XRDA 1TRWA 4PUFC 4OO5A 2O5VA 3F0IA 2V6KA 2VLVA 2AAWA 2H0GA 3WT2A 3LXZA 4F0BA 3RPNA 5J40A 3FMWA 4LA1A 4MH2A 1F3AA 3E0UA 1QMVA 1AQXA 2CAQA 1FAAA 2X99A 5COHA 1N8JA 3KCMA 2A2SA 3L9UA 3EU3A 2C80A 1O81A 2V41A 1B9YC 2LEGA 4G0LA 3WT1A 3KP8A 2C8UA 4LMVA 3HMJG 2FA4A 3GKXA 3R3EA 1BEDA 4ECBA 2DJ2A 1A8LA 1XG8A 2FLSA 5CRGA 2H75A 2K18A 3CWGA 1J0FA 5IMAA 2WVXB 3LJRA 1I9DA 5DAKB 5ECPB 4YAPA 2F8FA 4QQ7A 1A2MA 1TU8A 2VO4A 3G7IA 3G7JA 2FUG2 4YAVA 4HDEA 3GH6A 4USSA 11GSA 3TUEA 1UA5A 3ERFA 4HJ2A 2GZYA 4NAXA 1WPIA 1K0DA 2C0EA 1X9MB 2VD0A 1T4YA 4IN0A 4L5LA 1PFOA 4PUAA 1GH2A 4WR5A 3H4KA 4GCIA 2YWIA 2LJRA 5IIZA 3ZFLA 2BJXA 4BA7A 2WW3A 1WWJA 3KP9A 5GZZB 2CAIA 2H0HA 2VUPA 4PI0C 2EIRA 2H0IA 1Y25A 5IMZA 3QD9A 1OKDA 3A2WA 2I3YA 1EWXA 1S3DA 3GA4A 2H01A 1KBNA 5G30A 3FKFA 2BTOT 4FYCA 1GSSA 4WXTA 4QL9A 5CRHA 1SK1A 2GT6A 1BQ7A 2MYGA 1JZDA 1M7TA 5KOWA 14GSA 2X49A 4ECIA 3RBTA 2LTKA 2X4AA 5H5QA 3IAM2 5CYYA 4G2EA 2I81A 2X64A 3DYRA 3TU3B 2GGTA 5INYA 4HSCX 3OR5A 4TR1B 4XS6A 1OC8A 2CZ2A 2R2JA 1F6MC 5A34B 1TXXA 4CW9A 1TRSA 2IMIA 1M2DA 3HZ4A 3GN3A 5IM9A 5B6NA 1O6JA 1N25A 2DJ1A 2PN8A 3EYTA 2HSMA 1PX6A 2R0GA 2PUKC 4KSOA 1KNGA 1ZOFA 4CHSA 5E4WA 6GSUA 5J9CA 5ECHB 1A2JA 4V2LA 1TK5B 1ERTA 3GFKA 2WDUA 1YY7A 2LRTA 3DD3A 1J9BA 3IC8A 2R6KA 1EP7A 1SL2B 4WF4A 3UVHA 3TJJA 5G5EA 5L71A 2TRXA 2IIYA 2FWHA 3FEUA 1YEXA 1V58A 2YV7A 2MBTA 1PSQA 2WULA 2VAFA 3FZ5A 2L4QA 3I9V2 2WVXA 5DAKA 2Z9SA 4EO3A 2ZUPA 2XHFA 2YJHA 4HS1A 4EL1A 1K0AA 1DE1A 6GSXA 2C3QA 5ECIB 2VL9A 5FT3A 1TP9A 4POMA 1NW2A 4F03A 4KSMA 6GSSA 3F6DA 2B1LA 4OD7A 1PN0A 1WIKA 5IMFA 2HXKA 2KUCA 1M2BA 1RK4A 3E3EA 1G0TA 5ABRA 3GUSA 1NHOA 1SVLA 2E2GA 2I1UA 2VCZA 1PA3A 3ZMKA 1TDIA 4K2XA 3LG6A 2OACA 1U3AA 4O92A 1FB6A 3PPUA 4JU5A 1OE8A 2F9SA 13GSA 6GSVA 4WF5A 4YKGA 4OFTA 3H79A 3C71A 20GSA 3DKSA 3TJKA 3MSZA 5GAPD 3DRNA 2RM5A 4L8EA 3L9VA 1AIUA 5HFKA 5H5RA 1PKWA 3W6GA 2L5LA 5ELAA 1K3LA 4G19A 2B6MA 3CBUA 2REMA 1OYJA 2KHPA 2EIQA 9GSSA 4H86A 4TR1A 3WGDA 2MMNA 5GSTA 3ZIVA 3VI5A 5A34A 3C1RA 1TJDA 3CSJA 2B7JA 1TTZA 2H72A 2DIZA 1CQHA 1QGVA 3VWUA 1FHEA 3TKSC 3O76A 4Z2TA 4PQHA 4NHWA 5IOWA 4X43A 3TKQA 4MJBA 2EFEA 1V40A 4TRXA 2KP2A 3IA1A 3A5IA 5BMUB 2DJ3A 1FG4A 4BIKA 4EC0A 1E2YA 2VM1A 4XS1A 3UL3A 2CVBA 4RQRA 4J2FA 4MJEA 3A2XA 2F3MA 3D22A 2NDOA 2ON7A 3PH9A 4EUYA 3M9JA 4F0CA 1SD9A 3TRQA 3LXTA 1TU7A 4MABA 5KN1A 3TOTA 5GSSA 1HNBA 1S3CA 2K9FA 1FOHA 3VWVA 5HR0A 3CRUA 1B4QA 2YWOA 2PBJA 7GSSA 3R2QA 4KF9A 1WMJA 2DBCA 5HQPA 1Q98A 1TK8B 2GZZA 3W8JA 4GTUA 2H76A 3J7Yk 3F63A 2B7KA 3KTBA 1ST9A 2WB9A 3PINA 2G2QA 5C04A 5B8AA 4G0KA 1RQMA 4WBRD 5B7CA 3DEXA 2YJ7A 4PURA 4RUVA 2DJJA 5E59A 5J4YA 4K9ZA 3LYKA 2FCHA 2HT9A 5ID2B 1M2AA 5A5KA 4WBJA 4YQVA 2HZFA 2H1AA 5D73A 1JZOA 3VK9A 2GVPA 2ON5A 3ZFBA 4O5QA 1GSDA 4J56E 4BL7B 2E2MA 2YANA 2PWJA 1X9SB 1Z7RA 4FH8A 3A5WA 4EIPA 4A5PA 2PGTA 4POKA 2NTOA 4NV5A 4N0ZA 1DE2A 1TW9A 1GNWA 2JL4A 2JZRA 4KCAA 4HU9A 5F07A 3TJBA 4PI2C 1ACVA 2HQTA 1T4ZA 1V9WA 2WZ9A 4IGJA 1V98A 1OC9B 4GQCA 2FD3A 1OVNA 5BMUA 2R0PA 2M80A 2OE1A 3IBHA 3MNGA 3ME8A 4EE0A 2DIYA 3EU4A 3F9UA 3GH9A 2LSTA 4LMWA 1ERWA 4YKFA 5JCWA 1SKSB 3QPMA 3Q6OA 2B3SA 2B5YA 4EKZA 5CREA 4IJIA 5F0GA 3V1WA 4TVEA 5J3RA 4XIHA 1M9AA 2R5GA 5F06A 5AISA 4E8HA 1SK0A 4K5SA 2RUFA 2PVQA 3N5OA 3ZRDA 4XCSA 3FR9A 5ECRB 4I8BA 2PVOC 2GQMA 2RLIA 5C00A 3TCOA 3RAZA 1JLWA 3HJPA 1BAYA 3DVXA 1VF2A 2H66A 1V2AA 4AJ8A 5KEJA 5JWOB 1SU9A 2TRCP 3ERGA 3KTLA 1YEWC 3W8SA 3GL3A 4ECCA 1NHYA 1X5EA 3RHCA 4X1UA 1G6YA 2AYTA 3TGZA 1ML6A 4LL4B 3TJGA 4FYUA 3ZL5A 2MMAA 1S3RA 4NMUA 1FO5A 2YP6A 2P5RA 2QA1A 4PHZC 4IELA 1VF3A 5A4VA 4BVXA 1T3BA 2JZSA 8GSSA 3GNJA 4TR4A 2VD1A 5ID2A 4BVYB 3TKPA 2N5BA 1O8WA 2X8GA 2EIOA 4KAEA 3H93A 1BG1A 4Z2UA 2OE3A 2HSMB 3EURA 1SJIA 2C1YA 1B8XA 3HY2A 4BL7A 5EPFA 3QAWA 2H6XA 1XFLA 5ECQB 2AHEA 1M99A 1PQNA 3LFLA 3G9BA 4LL1B 1BJXA 2DMLA 4AKIA 1X0RA 1A23A 4RI7A 4HU7A 4HI7A 1OC9A 1XVWA 4PGTA 2FA8A 4K0NA 4ZILA 4F2IA 4IKHA 3JCML 4TKYA 5A4WA 6GSTA 2C3TA 3M9KA 2HI7A 4JBBA 1H4OA 3KMOA 5CNWA 5AN1A 3P8WA 2DJ0A 4YQMA 4CDOA 2F51A 4IP6A 3U6VA 1SYXA 1ERUA 1B4PA 3QFAC 3L0HA 2DKHA 2RUEA 1K3YA 3VWXA 4ISDA 4ZBBA 3ZMLA 4GQFA 1YKCA 2LRNA 3QMXA 2I9HA 3BD2A 3GKMA 3P7XA 2MMZA 4NXIA 3TKRA 4FYBA 3MIXA 2H8LA 4Z2RA 5ECSA 3O3TA 1SVMA 3IDVA 4EDZA 5HR2A 3GL5A 3ED3A 4XS4B 1AXDA 3M1GA 4J57E 3M3MA 1Y6EA 1R5AA 3UBKA 3IAS2 3HKRA 3RDWA 2VCTA 4V1Ap 5IMDA 3FK8A 1A2LA 5J47A 2H6ZA 5LD0A 1PN9A 1PKZA 5B6MA 4BVYA 1R26A 1QFNA 4JRRA 4PQIA 4MDCA
chains in the Genus database with same CATH topology
2CVDA 1SKWB 1JLVA 3IK7A 1TRVA 2GZPA 1GTIA 3D0ZA 3GSSA 4N0VA 3IXRA 2H19A 3S9FA 1RW1A 3K8NA 3DIEA 4MA9A 4TOPA 3ME7A 2H70A 2R4VA 3MYDA 5DVBA 2O85A 2CV4A 1UC7A 3H1NA 4EIQA 3GSTA 4AI6A 1GUKA 1GLPA 1FW1A 1WJKA 3LEFA 3IC4A 3TKSE 2FWFA 2C0GA 5DCHA 1HNCA 3I43A 3IPZA 4G0IA 2FGXA 1O8XA 4GSSA 4ZB8A 4TXOB 1AUCA 1EV4A 1GNEA 2IMDA 2LQQA 4NV2A 19GSA 1FVJA 4K7NA 3UIWA 2ZNMA 3MWHA 2HNLA 2FWGA 3HXSA 2DSAA 2JSZA 2GT5A 2RIIA 3TB2A 4ZL8A 5BRTA 2E7PA 3DMLA 1MEKA 3MDKA 5IO0A 2IWTA 4AKXB 5CRDA 1XWGA 4G10A 1FB0A 2DLXA 3FZ9A 1ZYNA 4MLYA 2AV4A 3GHAA 1ZL9A 2C3NA 4OCFA 3VI7A 5DCGA 3DWVA 1EGRA 4OO4A 4OWYA 2N5FA 3PGTA 3Q74A 4OMVA 2B5EA 2M46A 5LNKe 4XS4A 3QR6A 5F8BA 4ICYA 3ZITA 2YCDA 4AF2A 3C8EA 3EC3A 1EP8A 1XWKA 4HZ4A 1IYIA 3N9JA 2HSNA 2NVLA 4DSRA 5ELGA 2H71A 2OA7A 2GS3A 1XVQA 3H8QA 3KJYA 3LW9A 1XW6A 4N3ZA 1C72A 2OJLA 5KN3A 3L4NA 2TIRA 4IW9A 4F9ZA 2YV9A 1W4VA 2J9HA 4ACSA 1YQ1A 1W89A 4KE3A 4N30A 4D73B 2JADA 2O87A 4RQXA 4YQUA 5AGYA 2GSRA 3IE3A 4K7OA 5B8BA 4MZCA 2UZ8A 2VLUA 1F3BA 1VRSD 5EVOA 3ZTLA 2NPBA 3LWAA 3I69A 4KGIA 1X5CA 4BWQA 2HFDA 1YKAA 5D93A 1AC1A 1R7HA 2YZUA 1Z7PA 1SL1B 2QA2A 2LRCA 3DGQA 3VFIA 1V57A 4DSSB 2H74A 3F4TA 4MMMA 2EFDA 4PXOA 2X8CA 5D8IA 2O7KA 4TXOA 1E6BA 4BWSA 3FW2A 1SK2A 1UVZA 3CXGA 4NWYA 2L4CA 5IMVA 4OFNA 2P5QA 5JCUA 4MJAA 2LNSA 4OCEA 1GUMA 2B5XA 1H75A 1QUWA 4GLTA 1PX7A 1GSUA 2IN3A 2P31A 4IQ1A 3EWLA 3HJOA 1QK8A 1EOHA 2CX3A 3ZZXA 5G1KA 4GSTA 5HFIA 3IR4A 3D5JA 2KP1A 1G7EA 4DEJA 1A8YA 2QGVA 4PNGA 3VPQA 5IMCA 4AJ6A 1MD3A 3ZVJD 3RPPA 2DMMA 4WETA 4JR4A 2VCVA 2V32A 4BVXB 3GRXA 4TR3A 1N2AA 1GSEA 1ABAA 3I6AA 2V6OA 3CYNA 1ERVA 2CVKA 1Z5YE 3HD5A 1WP0A 1WE0A 1M9BA 1EGOA 2MBSA 1AQWA 3TRPA 3U5RE 3F8UA 3ISOA 1BF5A 2BMXA 4NHZA 1T7PB 3QAGA 2EC4A 4IHUA 4KH7A 1SJ6A 4D73A 4KUNA 1OKTA 1YEPA 1K0CA 2IMFA 3D4TA 3UJ1A 2CQ9A 2HRKB 2R0CA 2OBKA 3CTFA 5A5HB 2RM6A 2WS2A 4O7HA 1Z6NA 2R37A 1IYHA 2OT3A 3EINA 1GWCA 4ZB7A 2E0QA 3GTUB 1ZGNA 4DSQA 3CSHA 1XIYA 3WD6A 5H5SA 5IPGA 1XWCA 4E68A 2LKUA 2V1MA 3ZREA 2PPTA 3DVWA 1Z9HA 10GSA 3FRCA 4KX4A 1AW9A 4DSSA 2GLRA 1LU4A 5AIVA 4Q5RA 3APOA 3KGKA 1M0UA 1NM3A 4GWRA 4KA0A 3ERWA 4HJMA 2XBIA 2H6YA 3CTGA 1OC3A 3NIVA 2DJKA 2FHEA 5D9TA 2IPAA 4FQUA 5JWQB 1A0FA 3TJFA 2IMKA 1OE7A 3NOFA 4MJCA 1MDJA 1SL0B 4GXZA 4KDUA 1ZZYA 4PNFA 4ZBDA 4Z7XA 2VL3A 2PERA 4ZB9A 2F8AA 2QKEA 1XCCA 3FR3A 3Q19A 3KIJA 3IOSA 1TI3A 2HRAA 1XPVA 1EZKA 3CRTA 4CY6A 2YWNA 1XWBA 3HYPA 2IL3A 5ENUA 3KH9A 1LBKA 4I5QA 1Q4JA 2WGRA 3GKNA 2DKIA 1HNAA 3P90A 3ZYWA 2WRTA 1XW5A 4MH3A 2YN1A 5D9XA 3D6IA 4PX1A 5J5NA 2JU5A 1DUGA 2VCQA 2H1BA 3QFBC 2YPMA 2MZCA 4IBPA 3GIXA 4KW6A 5IPHA 3M8NA 3IV4A 3GV1A 1THOA 3PR8A 3HVXA 1BYEA 2H73A 1X9WB 5CRWA 2CT6A 4TXVA 3TRXA 3UEMA 2HRKA 1NSWA 4ML6A 5G5FA 2I4AA 3C73A 1THXA 5A5HA 2FWEA 5HR3A 3SWLA 3D21A 5D96A 1JFUA 3GTUA 2JZTA 1U3IA 4K7IA 2P0GA 1BG5A 2VKZG 3KZQA 4HQSA 1A0RP 4EF0A 4ZXGA 2L57A 1VF1A 4MPFA 3QAVA 2H1GA 5EL8A 1B9XC 3GYKA 1SYRA 4IJ3A 4V1Ag 2HSHA 1USBA 3BBYA 4X4JA 1Y1UA 1GTBA 1JHBA 2LS5A 4QL7A 1YDKA 4HEA2 4TN8A 2CX4A 2L6CA 3CMIA 4X0XA 4EXJA 2IFQB 5DDLA 1K0MA 1VF4A 1G6WA 1MDIA 1HYUA 1ZYEA 2K8VA 4CY8A 5CAXA 3FYGA 3QCPA 1O85A 3EVIA 1ZYQB 1PL2A 2VCXA 3HJMA 1PRXA 2HSNB 1XZOA 2A4HA 1XOBA 4AJ7A 1EEMA 5J4VA 3APSA 4IQAA 4I97A 1GLQA 1K3OA 3C7MA 2XPDA 1S3AA 2M72A 2VM2A 2H30A 4IS0A 4K1FA 1VGLA 1SJZA 2K6VA 1TOFA 2AUVA 3IRAA 1T00A 1LJRA 1ON4A 5A4UA 4GSNA 4GRFA 2GSSA 3DXBA 2L59A 4ULXA 2V2GA 5LCZA 3UBLA 4Q5FA 3HZ8A 4G9HA 3G7YA 3HVVA 1TK0B 3ZLPA 2MMOA 1URMA 4QMKA 1K0BA 3HA9A 4JR6A 4WKWA 1WOUA 5DBQA 2GSTA 1AAZA 3WGXA 2C0FA 3E9JB 2K8SA 1R5PA 2O89A 4TW5A 3O6TA 1MTCA 4WEYA 3ZIJA 4DVCA 5A1NB 4MP4A 2YOIA 2HSYA 1GULA 3UOMA 3UVTA 4ID0A 2LJAA 1U88A 4V2NA 1OAZA 3NZNA 1QQ2A 3HDCA 1F9MA 4KNDA 2AB6A 3BCIA 4EVMA 2YNXA 1YVLA 2ALBA 4POBA 2LV3A 2N5AA 4O32A 5IO2A 2XBQA 4MZWA 5HR1A 1CQGA 3FY7A 4MZBA 2HE3A 1K0OA 3FR6A 4PQ1A 4I2UA 4JE1A 5JWRB 2XC2A 1F2EA 2LNTA 5ECNB 1J08A 4K2DA 3Q18A 4P3YB 1MDKA 2WJUA 1U6TA 2LUSA 4WR4A 3EMXA 2LJKA 4JEDA 1DBYA 1AQVA 2IFQA 4MK3A 4L5OA 4KDXA 3EMPA 2YZHA 2EFCA 2FY6A 4ZIJA 2PU9C 2NBSA 4K8MA 3CSIA 3HVSA 1XOAA 4N11A 2GTUA 3IHGA 5J41A 3GMFA 4E8EA 4HQZA 3WYWA 2IJYA 3KD0A 2ZCTA 1Z6MA 2IMEA 2XPEA 5IOXA 5ECLB 3KEBA 3WGEA 1GSYA 3L9SA 3RHBA 5AIXA 1EEJA 4KDYA 2R3XA 1XW9A 5CO3A 2OE0A 4Q5NA 3FHKA 5KN0A 1EOGA 1T8EB 1BX9A 2OKAA 4FIWA 1FVKA 4IVFA 3GX0A 5F05A 3VPTA 3EE2A 1B48A 5DQSA 4I6XA 3A3TA 17GSA 1XXUA 3US3A 3BJ5A 4G01A 3BOAA 1GL8A 5G31A 1YF0A 4ZBAA 3QOUA 2HYXA 3MAKA 4V2MA 4EDYA 3A2VA 5FHIA 3APQA 1ZYPA 5A1NA 3UAPA 2AJQB 3KM6A 2VL2C 3FZAA 3HHVA 4O5RA 3C1SA 4K6XA 1ZMAA 5EY6A 1K0NA 1PGTA 4NPBA 4O5UA 5G2ZA 2GQLA 4LLRA 5JCGA 2EFHA 2X8HA 5HFGA 3TKSA 1SKRB 3VURA 18GSA 2HRNA 5ECOB 5DALB 2HRFA 1KEBA 1SVOA 4ZL9A 3F4SA 1HD2A 1PD21 2L6DA 3KXOA 3F3QA 3D4MA 3IHQA 5IQYA 1TKDB 1G7OA 1FOVA 2VL2A 4TR0A 2KOKA 1Z3EA 2O8VB 2B1KA 2QSIA 1GP1A 1YF1A 5DJMA 1YJ6A 2CZ3A 2PMTA 1U87A 4ZB6A 3BCKA 4K5RA 4N10A 1JZRA 1X5DA 2HZEB 4IP1A 1UN2A 5J4UA 2WCIA 3VLNA 4YH2A 1XWAA 5DJLA 4MCUA 4GDFA 1T1VA 1GUHA 2VOCA 4AKGA 3LORA 5KN2A 4ZL7A 2JACA 5FWGA 2WFCA 2D2ZA 22GSA 3LYPA 1SD8A 3HCZA 1ZCPA 1TI1A 2C0DA 4KB3A 3KMNA 1KTEA 4W66A 3TDGA 5ECMB 3LGCA 2L5OA 1JZWA 2UV8G 2H1LA 1O7UA 1QXHA 16GSA 1ILOA 1GTUA 4ILFA 2GSQA 4KCEA 2VCWA 3LQ7A 2GQKA 5CP1A 4MF7A 3EPTA 4MNNA 4FO5A 1DSBA 1PMTA 4RI6A 4OFMA 1GTAA 1PL1A 3FZ4A 4AGSA 1MD4A 3QDNA 2GDRA 1R4WA 3AY8A 2YWMA 12GSA 2HLSA 2JSYA 3F3RA 3P2AA 1TXUA 2J23A 4L0WA 1GSFA 1EV9A 1YZXA 4XHMA 2QC7A 3VWWA 1GSQA 4F82A 4MF5A 5G1LA 2H1DA 2KLXA 1WRYA 5KOXA 3TOUA 1I5GA 5DQYA 1F37A 4POLA 4JZQA 4ML1A 4I2TA 4XRAA 3GX8A 4HOJA 2CA8A 3F6FA 4PTSA 4ECJA 2FNOA 2C4JA 2VLTA 4HZ2A 5ECKB 1HQOA 5DALA 4L0UA 5D9WA 3ZVJA 4XTSA 3LSZA 4HUAA 4AKHA 2A2PA 1TRUA 1A24A 3GKKA 3GURA 2A4VA 2DC5A 4Q5QA 6GSYA 5J9BA 3IK9A 2VIMA 4MF6A 4BPYA 3KH7A 3UARA 3M0FA 2ES7A 6GSWA 3L78A 2OADA 3J7Yb 4MPGA 2OBIA 3SBCA 1SENA 4GF0A 4K0GA 1O73A 2HZEA 3F4RA 2A2RA 3UMAA 2LQOA 1XBSA 5D9VA 5GAND 1GRXA 2G0FA 4XRDA 1TRWA 4PUFC 4OO5A 2O5VA 3F0IA 2V6KA 2VLVA 2AAWA 2H0GA 3WT2A 3LXZA 4F0BA 3RPNA 5J40A 3FMWA 4LA1A 4MH2A 1F3AA 3E0UA 1QMVA 1AQXA 2CAQA 1FAAA 2X99A 5COHA 1N8JA 3KCMA 2A2SA 3L9UA 3EU3A 2C80A 1O81A 2V41A 1B9YC 2LEGA 4G0LA 3WT1A 3KP8A 2C8UA 4LMVA 3HMJG 2FA4A 3GKXA 3R3EA 1BEDA 4ECBA 2DJ2A 1A8LA 2FLSA 5CRGA 2H75A 2K18A 3CWGA 1J0FA 5IMAA 3LJRA 1I9DA 5DAKB 5ECPB 4YAPA 2F8FA 4QQ7A 1A2MA 1TU8A 2VO4A 3G7IA 3G7JA 2FUG2 4YAVA 4HDEA 3GH6A 4USSA 11GSA 3TUEA 1UA5A 3ERFA 4HJ2A 2GZYA 4NAXA 1WPIA 1K0DA 2C0EA 1X9MB 2VD0A 1T4YA 4IN0A 4L5LA 4PUAA 1GH2A 4WR5A 3H4KA 4GCIA 2YWIA 2LJRA 5IIZA 3ZFLA 2BJXA 4BA7A 1WWJA 3KP9A 5GZZB 2CAIA 2H0HA 2VUPA 2EIRA 2H0IA 1Y25A 5IMZA 3QD9A 1OKDA 3A2WA 2I3YA 1EWXA 1S3DA 3GA4A 2H01A 1KBNA 5G30A 3FKFA 2BTOT 4FYCA 1GSSA 4WXTA 4QL9A 5CRHA 1SK1A 2GT6A 1BQ7A 2MYGA 1JZDA 1M7TA 5KOWA 14GSA 2X49A 4ECIA 3RBTA 2LTKA 2X4AA 5H5QA 3IAM2 5CYYA 4G2EA 2I81A 2X64A 3DYRA 3TU3B 2GGTA 5INYA 3OR5A 4TR1B 4XS6A 1OC8A 2CZ2A 2R2JA 1F6MC 5A34B 1TXXA 4CW9A 1TRSA 2IMIA 1M2DA 3HZ4A 3GN3A 5IM9A 5B6NA 1O6JA 1N25A 2DJ1A 2PN8A 3EYTA 2HSMA 1PX6A 2R0GA 2PUKC 4KSOA 1KNGA 1ZOFA 4CHSA 5E4WA 6GSUA 5J9CA 5ECHB 1A2JA 4V2LA 1TK5B 1ERTA 3GFKA 2WDUA 1YY7A 2LRTA 3DD3A 1J9BA 3IC8A 2R6KA 1EP7A 1SL2B 4WF4A 3UVHA 3TJJA 5G5EA 5L71A 2TRXA 2IIYA 2FWHA 3FEUA 1YEXA 1V58A 2YV7A 2MBTA 1PSQA 2WULA 2VAFA 3FZ5A 2L4QA 3I9V2 5DAKA 2Z9SA 4EO3A 2ZUPA 2XHFA 2YJHA 4HS1A 4EL1A 1K0AA 1DE1A 6GSXA 2C3QA 5ECIB 2VL9A 5FT3A 1TP9A 4POMA 1NW2A 4F03A 4KSMA 6GSSA 3F6DA 2B1LA 4OD7A 1PN0A 1WIKA 5IMFA 2HXKA 2KUCA 1M2BA 1RK4A 1G0TA 3E3EA 5ABRA 3GUSA 1NHOA 1SVLA 2E2GA 2I1UA 2VCZA 1PA3A 3ZMKA 1TDIA 4K2XA 3LG6A 2OACA 1U3AA 4O92A 1FB6A 3PPUA 4JU5A 1OE8A 2F9SA 13GSA 6GSVA 4WF5A 4YKGA 4OFTA 3H79A 3C71A 20GSA 3DKSA 3TJKA 3MSZA 5GAPD 3DRNA 2RM5A 4L8EA 3L9VA 1AIUA 5HFKA 5H5RA 1PKWA 3W6GA 2L5LA 5ELAA 1K3LA 4G19A 2B6MA 3CBUA 2REMA 1OYJA 2KHPA 2EIQA 9GSSA 4H86A 4TR1A 3WGDA 2MMNA 5GSTA 3ZIVA 3VI5A 5A34A 3C1RA 1TJDA 3CSJA 2B7JA 1TTZA 2H72A 2DIZA 1CQHA 1QGVA 3VWUA 1FHEA 3TKSC 3O76A 4Z2TA 4PQHA 4NHWA 5IOWA 4X43A 3TKQA 4MJBA 2EFEA 1V40A 4TRXA 2KP2A 3IA1A 3A5IA 5BMUB 2DJ3A 1FG4A 4EC0A 1E2YA 2VM1A 4XS1A 3UL3A 2CVBA 4RQRA 4J2FA 4MJEA 3A2XA 2F3MA 3D22A 2NDOA 2ON7A 3PH9A 4EUYA 3M9JA 4F0CA 1SD9A 3TRQA 3LXTA 1TU7A 4MABA 5KN1A 3TOTA 5GSSA 1HNBA 1S3CA 2K9FA 1FOHA 3VWVA 5HR0A 3CRUA 1B4QA 2YWOA 2PBJA 7GSSA 3R2QA 4KF9A 1WMJA 2DBCA 5HQPA 1Q98A 1TK8B 2GZZA 3W8JA 4GTUA 2H76A 3J7Yk 3F63A 2B7KA 3KTBA 1ST9A 2WB9A 3PINA 2G2QA 5C04A 5B8AA 4G0KA 1RQMA 4WBRD 5B7CA 3DEXA 2YJ7A 4PURA 4RUVA 2DJJA 5E59A 5J4YA 4K9ZA 3LYKA 2FCHA 2HT9A 5ID2B 1M2AA 5A5KA 4WBJA 4YQVA 2HZFA 2H1AA 5D73A 1JZOA 3VK9A 2GVPA 2ON5A 3ZFBA 4O5QA 1GSDA 4J56E 4BL7B 2E2MA 2YANA 2PWJA 1X9SB 1Z7RA 4FH8A 3A5WA 4EIPA 4A5PA 2PGTA 4POKA 2NTOA 4NV5A 4N0ZA 1DE2A 1TW9A 1GNWA 2JL4A 2JZRA 4KCAA 4HU9A 5F07A 3TJBA 1ACVA 2HQTA 1T4ZA 1V9WA 2WZ9A 4IGJA 1V98A 1OC9B 4GQCA 2FD3A 1OVNA 5BMUA 2R0PA 2M80A 2OE1A 3IBHA 3MNGA 3ME8A 4EE0A 2DIYA 3EU4A 3F9UA 3GH9A 2LSTA 4LMWA 1ERWA 4YKFA 5JCWA 1SKSB 3QPMA 3Q6OA 2B3SA 2B5YA 4EKZA 5CREA 4IJIA 5F0GA 3V1WA 4TVEA 5J3RA 4XIHA 1M9AA 2R5GA 5F06A 5AISA 4E8HA 1SK0A 4K5SA 2RUFA 2PVQA 3N5OA 3ZRDA 4XCSA 3FR9A 5ECRB 4I8BA 2PVOC 2GQMA 2RLIA 5C00A 3TCOA 3RAZA 1JLWA 3HJPA 1BAYA 3DVXA 1VF2A 2H66A 1V2AA 4AJ8A 5KEJA 5JWOB 1SU9A 2TRCP 3ERGA 3KTLA 3W8SA 3GL3A 4ECCA 1NHYA 1X5EA 3RHCA 4X1UA 1G6YA 2AYTA 3TGZA 1ML6A 4LL4B 3TJGA 4FYUA 3ZL5A 2MMAA 4NMUA 1FO5A 2YP6A 2P5RA 2QA1A 4IELA 1VF3A 5A4VA 4BVXA 1T3BA 2JZSA 8GSSA 3GNJA 4TR4A 2VD1A 5ID2A 4BVYB 3TKPA 2N5BA 1O8WA 2X8GA 2EIOA 4KAEA 3H93A 1BG1A 4Z2UA 2OE3A 2HSMB 3EURA 1SJIA 2C1YA 1B8XA 3HY2A 4BL7A 5EPFA 3QAWA 2H6XA 1XFLA 5ECQB 2AHEA 1M99A 1PQNA 3LFLA 3G9BA 4LL1B 1BJXA 2DMLA 4AKIA 1X0RA 1A23A 4RI7A 4HU7A 4HI7A 1OC9A 1XVWA 4PGTA 2FA8A 4K0NA 4ZILA 4F2IA 4IKHA 3JCML 4TKYA 5A4WA 6GSTA 2C3TA 3M9KA 2HI7A 4JBBA 1H4OA 3KMOA 5CNWA 5AN1A 3P8WA 2DJ0A 4YQMA 4CDOA 2F51A 4IP6A 3U6VA 1SYXA 1ERUA 1B4PA 3QFAC 3L0HA 2DKHA 2RUEA 1K3YA 3VWXA 4ISDA 4ZBBA 3ZMLA 4GQFA 1YKCA 2LRNA 3QMXA 2I9HA 3BD2A 3GKMA 3P7XA 2MMZA 4NXIA 3TKRA 4FYBA 3MIXA 2H8LA 4Z2RA 5ECSA 3O3TA 1SVMA 3IDVA 4EDZA 5HR2A 3GL5A 3ED3A 4XS4B 1AXDA 3M1GA 4J57E 3M3MA 1Y6EA 1R5AA 3UBKA 3IAS2 3HKRA 3RDWA 2VCTA 4V1Ap 5IMDA 3FK8A 1A2LA 5J47A 2H6ZA 5LD0A 1PN9A 1PKZA 5B6MA 4BVYA 1R26A 1QFNA 4JRRA 4PQIA 4MDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVD A;  1SKW B;  1JLV A;  3IK7 A;  1TRV A;  2GZP A;  1GTI A;  3D0Z A;  3GSS A;  4N0V A;  3IXR A;  2H19 A;  3S9F A;  1RW1 A;  3K8N A;  3DIE A;  4MA9 A;  4TOP A;  3ME7 A;  2H70 A;  2R4V A;  5DVB A;  2O85 A;  2CV4 A;  1UC7 A;  3H1N A;  3GST A;  1GUK A;  1GLP A;  1FW1 A;  1WJK A;  3LEF A;  3IC4 A;  3TKS E;  2FWF A;  2C0G A;  5DCH A;  1HNC A;  3I43 A;  3IPZ A;  4G0I A;  2FGX A;  1O8X A;  4GSS A;  4ZB8 A;  4TXO B;  1AUC A;  1EV4 A;  1GNE A;  2IMD A;  2LQQ A;  4NV2 A;  19GS A;  1FVJ A;  4K7N A;  3UIW A;  2ZNM A;  3MWH A;  2HNL A;  2FWG A;  3HXS A;  2DSA A;  2JSZ A;  2GT5 A;  2RII A;  3TB2 A;  4ZL8 A;  2E7P A;  3DML A;  1MEK A;  3MDK A;  5IO0 A;  2IWT A;  5CRD A;  1XWG A;  4G10 A;  1FB0 A;  2DLX A;  3FZ9 A;  4MLY A;  2AV4 A;  3GHA A;  1ZL9 A;  2C3N A;  4OCF A;  3VI7 A;  5DCG A;  3DWV A;  1EGR A;  4OO4 A;  4OWY A;  2N5F A;  3PGT A;  3Q74 A;  4OMV A;  2B5E A;  2M46 A;  5LNK e;  4XS4 A;  3QR6 A;  5F8B A;  3ZIT A;  2YCD A;  4AF2 A;  3C8E A;  3EC3 A;  1EP8 A;  1XWK A;  4HZ4 A;  1IYI A;  3N9J A;  2NVL A;  4DSR A;  5ELG A;  2H71 A;  2OA7 A;  2GS3 A;  1XVQ A;  3H8Q A;  3KJY A;  1XW6 A;  1C72 A;  2OJL A;  5KN3 A;  3L4N A;  2TIR A;  4IW9 A;  4F9Z A;  2YV9 A;  1W4V A;  2J9H A;  4ACS A;  1YQ1 A;  1W89 A;  4KE3 A;  4N30 A;  4D73 B;  2JAD A;  2O87 A;  4RQX A;  4YQU A;  5AGY A;  2GSR A;  3IE3 A;  4K7O A;  5B8B A;  4MZC A;  2UZ8 A;  2VLU A;  1F3B A;  1VRS D;  5EVO A;  3ZTL A;  2NPB A;  3LWA A;  3I69 A;  4KGI A;  1X5C A;  4BWQ A;  2HFD A;  1YKA A;  5D93 A;  1AC1 A;  1R7H A;  2YZU A;  1Z7P A;  1SL1 B;  2LRC A;  3DGQ A;  3VFI A;  1V57 A;  4DSS B;  2H74 A;  3F4T A;  4MMM A;  4PXO A;  2X8C A;  5D8I A;  2O7K A;  4TXO A;  1E6B A;  4BWS A;  3FW2 A;  1SK2 A;  1UVZ A;  3CXG A;  4NWY A;  2L4C A;  5IMV A;  4OFN A;  2P5Q A;  5JCU A;  4MJA A;  2LNS A;  4OCE A;  1GUM A;  2B5X A;  1H75 A;  1QUW A;  4GLT A;  1PX7 A;  1GSU A;  2IN3 A;  2P31 A;  4IQ1 A;  3EWL A;  3HJO A;  1QK8 A;  1EOH A;  2CX3 A;  3ZZX A;  5G1K A;  4GST A;  5HFI A;  3IR4 A;  3D5J A;  2KP1 A;  1G7E A;  4DEJ A;  1A8Y A;  2QGV A;  4PNG A;  3VPQ A;  5IMC A;  4AJ6 A;  1MD3 A;  3ZVJ D;  3RPP A;  2DMM A;  4WET A;  4JR4 A;  2VCV A;  2V32 A;  4BVX B;  3GRX A;  4TR3 A;  1N2A A;  1GSE A;  1ABA A;  3I6A A;  2V6O A;  3CYN A;  1ERV A;  2CVK A;  1Z5Y E;  3HD5 A;  1WP0 A;  1WE0 A;  1M9B A;  1EGO A;  2MBS A;  1AQW A;  3TRP A;  3U5R E;  3F8U A;  3ISO A;  2BMX A;  4NHZ A;  1T7P B;  3QAG A;  2EC4 A;  4IHU A;  4KH7 A;  1SJ6 A;  4D73 A;  4KUN A;  1OKT A;  1YEP A;  1K0C A;  2IMF A;  3D4T A;  3UJ1 A;  2CQ9 A;  2HRK B;  2OBK A;  3CTF A;  2RM6 A;  2WS2 A;  4O7H A;  1Z6N A;  2R37 A;  1IYH A;  3EIN A;  1GWC A;  2E0Q A;  3GTU B;  1ZGN A;  4DSQ A;  3CSH A;  1XIY A;  3WD6 A;  5H5S A;  5IPG A;  1XWC A;  2LKU A;  2V1M A;  3ZRE A;  2PPT A;  3DVW A;  1Z9H A;  10GS A;  3FRC A;  4KX4 A;  1AW9 A;  4DSS A;  2GLR A;  1LU4 A;  5AIV A;  4Q5R A;  3APO A;  3KGK A;  1M0U A;  1NM3 A;  4GWR A;  4KA0 A;  3ERW A;  4HJM A;  2XBI A;  2H6Y A;  3CTG A;  1OC3 A;  3NIV A;  2DJK A;  2FHE A;  5D9T A;  2IPA A;  4FQU A;  5JWQ B;  1A0F A;  3TJF A;  2IMK A;  1OE7 A;  3NOF A;  4MJC A;  1MDJ A;  1SL0 B;  4GXZ A;  4KDU A;  1ZZY A;  4PNF A;  4ZBD A;  4Z7X A;  2VL3 A;  2PER A;  4ZB9 A;  2F8A A;  2QKE A;  1XCC A;  3FR3 A;  3Q19 A;  3KIJ A;  3IOS A;  1TI3 A;  2HRA A;  1XPV A;  1EZK A;  3CRT A;  2YWN A;  1XWB A;  3HYP A;  2IL3 A;  5ENU A;  3KH9 A;  1LBK A;  4I5Q A;  1Q4J A;  2WGR A;  3GKN A;  1HNA A;  3P90 A;  3ZYW A;  2WRT A;  1XW5 A;  4MH3 A;  2YN1 A;  5D9X A;  3D6I A;  4PX1 A;  5J5N A;  2JU5 A;  1DUG A;  2VCQ A;  2H1B A;  3QFB C;  2YPM A;  2MZC A;  4IBP A;  3GIX A;  4KW6 A;  5IPH A;  3M8N A;  3IV4 A;  3GV1 A;  1THO A;  3PR8 A;  3HVX A;  1BYE A;  2H73 A;  1X9W B;  5CRW A;  2CT6 A;  4TXV A;  3TRX A;  3UEM A;  2HRK A;  1NSW A;  4ML6 A;  5G5F A;  2I4A A;  3C73 A;  1THX A;  2FWE A;  5HR3 A;  3SWL A;  3D21 A;  5D96 A;  1JFU A;  3GTU A;  2JZT A;  1U3I A;  4K7I A;  2P0G A;  1BG5 A;  3KZQ A;  4HQS A;  1A0R P;  4EF0 A;  4ZXG A;  2L57 A;  1VF1 A;  4MPF A;  3QAV A;  2H1G A;  5EL8 A;  1B9X C;  3GYK A;  1SYR A;  4IJ3 A;  4V1A g;  2HSH A;  1USB A;  3BBY A;  1GTB A;  1JHB A;  2LS5 A;  4QL7 A;  1YDK A;  4HEA 2;  4TN8 A;  2CX4 A;  2L6C A;  3CMI A;  4X0X A;  4EXJ A;  2IFQ B;  5DDL A;  1K0M A;  1VF4 A;  1G6W A;  1MDI A;  1HYU A;  1ZYE A;  2K8V A;  5CAX A;  3FYG A;  3QCP A;  1O85 A;  3EVI A;  1ZYQ B;  1PL2 A;  2VCX A;  3HJM A;  1PRX A;  2HSN B;  1XZO A;  1XOB A;  4AJ7 A;  1EEM A;  3APS A;  4IQA A;  4I97 A;  1GLQ A;  1K3O A;  3C7M A;  2XPD A;  1S3A A;  2M72 A;  2VM2 A;  2H30 A;  4IS0 A;  4K1F A;  1VGL A;  1SJZ A;  2K6V A;  1TOF A;  2AUV A;  3IRA A;  1T00 A;  1LJR A;  1ON4 A;  5A4U A;  4GSN A;  4GRF A;  2GSS A;  3DXB A;  2L59 A;  4ULX A;  2V2G A;  5LCZ A;  3UBL A;  4Q5F A;  3HZ8 A;  4G9H A;  3G7Y A;  3HVV A;  1TK0 B;  3ZLP A;  2MMO A;  1URM A;  1K0B A;  3HA9 A;  4JR6 A;  4WKW A;  1WOU A;  5DBQ A;  2GST A;  1AAZ A;  3WGX A;  2C0F A;  3E9J B;  2K8S A;  1R5P A;  2O89 A;  4TW5 A;  3O6T A;  1MTC A;  4WEY A;  3ZIJ A;  4DVC A;  4MP4 A;  2YOI A;  2HSY A;  1GUL A;  3UOM A;  3UVT A;  4ID0 A;  2LJA A;  1U88 A;  4V2N A;  1OAZ A;  3NZN A;  1QQ2 A;  3HDC A;  1F9M A;  4KND A;  2AB6 A;  3BCI A;  4EVM A;  2YNX A;  2ALB A;  4POB A;  2LV3 A;  2N5A A;  4O32 A;  5IO2 A;  2XBQ A;  4MZW A;  5HR1 A;  1CQG A;  3FY7 A;  4MZB A;  2HE3 A;  1K0O A;  3FR6 A;  4PQ1 A;  4I2U A;  4JE1 A;  5JWR B;  2XC2 A;  1F2E A;  2LNT A;  5ECN B;  1J08 A;  4K2D A;  3Q18 A;  4P3Y B;  1MDK A;  2WJU A;  1U6T A;  2LUS A;  4WR4 A;  3EMX A;  2LJK A;  4JED A;  1DBY A;  1AQV A;  2IFQ A;  4MK3 A;  4L5O A;  4KDX A;  3EMP A;  2YZH A;  2FY6 A;  4ZIJ A;  2PU9 C;  2NBS A;  4K8M A;  3CSI A;  3HVS A;  1XOA A;  4N11 A;  2GTU A;  5J41 A;  3GMF A;  4E8E A;  4HQZ A;  3WYW A;  2IJY A;  3KD0 A;  2ZCT A;  1Z6M A;  2IME A;  2XPE A;  5IOX A;  5ECL B;  3KEB A;  3WGE A;  1GSY A;  3L9S A;  3RHB A;  5AIX A;  1EEJ A;  4KDY A;  2R3X A;  1XW9 A;  5CO3 A;  2OE0 A;  4Q5N A;  3FHK A;  5KN0 A;  1EOG A;  1T8E B;  1BX9 A;  2OKA A;  4FIW A;  1FVK A;  4IVF A;  3GX0 A;  5F05 A;  3VPT A;  3EE2 A;  1B48 A;  5DQS A;  4I6X A;  3A3T A;  17GS A;  1XXU A;  3US3 A;  3BJ5 A;  3BOA A;  1GL8 A;  5G31 A;  1YF0 A;  4ZBA A;  3QOU A;  2HYX A;  3MAK A;  4V2M A;  4EDY A;  3A2V A;  5FHI A;  3APQ A;  3UAP A;  2AJQ B;  3KM6 A;  2VL2 C;  3FZA A;  3HHV A;  4O5R A;  3C1S A;  4K6X A;  1ZMA A;  5EY6 A;  1K0N A;  1PGT A;  4NPB A;  5G2Z A;  2GQL A;  4LLR A;  5JCG A;  2X8H A;  5HFG A;  3TKS A;  1SKR B;  3VUR A;  18GS A;  2HRN A;  5ECO B;  5DAL B;  2HRF A;  1KEB A;  4ZL9 A;  3F4S A;  1HD2 A;  1PD2 1;  2L6D A;  3KXO A;  3F3Q A;  3D4M A;  3IHQ A;  5IQY A;  1TKD B;  1G7O A;  1FOV A;  2VL2 A;  4TR0 A;  2KOK A;  1Z3E A;  2O8V B;  2B1K A;  2QSI A;  1GP1 A;  1YF1 A;  5DJM A;  1YJ6 A;  2CZ3 A;  2PMT A;  1U87 A;  4ZB6 A;  3BCK A;  4N10 A;  1JZR A;  1X5D A;  2HZE B;  4IP1 A;  1UN2 A;  5J4U A;  2WCI A;  3VLN A;  4YH2 A;  1XWA A;  5DJL A;  4MCU A;  1T1V A;  1GUH A;  2VOC A;  3LOR A;  5KN2 A;  4ZL7 A;  2JAC A;  5FWG A;  2WFC A;  2D2Z A;  22GS A;  3LYP A;  1SD8 A;  3HCZ A;  1ZCP A;  1TI1 A;  2C0D A;  4KB3 A;  3KMN A;  1KTE A;  3TDG A;  5ECM B;  3LGC A;  2L5O A;  1JZW A;  1O7U A;  1QXH A;  16GS A;  1ILO A;  1GTU A;  4ILF A;  2GSQ A;  4KCE A;  2VCW A;  3LQ7 A;  2GQK A;  5CP1 A;  4MF7 A;  4FO5 A;  1DSB A;  1PMT A;  4RI6 A;  4OFM A;  1GTA A;  1PL1 A;  3FZ4 A;  4AGS A;  1MD4 A;  3QDN A;  2GDR A;  1R4W A;  3AY8 A;  2YWM A;  12GS A;  2HLS A;  2JSY A;  3F3R A;  3P2A A;  2J23 A;  4L0W A;  1GSF A;  1EV9 A;  1YZX A;  4XHM A;  2QC7 A;  3VWW A;  1GSQ A;  4F82 A;  4MF5 A;  5G1L A;  2H1D A;  2KLX A;  1WRY A;  3TOU A;  1I5G A;  5DQY A;  1F37 A;  4POL A;  4JZQ A;  4ML1 A;  4I2T A;  4XRA A;  3GX8 A;  4HOJ A;  2CA8 A;  3F6F A;  4PTS A;  4ECJ A;  2FNO A;  2C4J A;  2VLT A;  4HZ2 A;  5ECK B;  1HQO A;  5DAL A;  4L0U A;  5D9W A;  3ZVJ A;  4XTS A;  3LSZ A;  4HUA A;  1TRU A;  1A24 A;  3GKK A;  3GUR A;  2A4V A;  2DC5 A;  4Q5Q A;  6GSY A;  5J9B A;  3IK9 A;  2VIM A;  4MF6 A;  4BPY A;  3KH7 A;  3UAR A;  3M0F A;  2ES7 A;  6GSW A;  3L78 A;  2OAD A;  3J7Y b;  4MPG A;  2OBI A;  3SBC A;  1SEN A;  4GF0 A;  4K0G A;  1O73 A;  2HZE A;  3F4R A;  2A2R A;  3UMA A;  2LQO A;  1XBS A;  5D9V A;  5GAN D;  1GRX A;  2G0F A;  4XRD A;  1TRW A;  4PUF C;  4OO5 A;  3F0I A;  2V6K A;  2VLV A;  2AAW A;  2H0G A;  3WT2 A;  3LXZ A;  4F0B A;  3RPN A;  4LA1 A;  4MH2 A;  1F3A A;  3E0U A;  1QMV A;  1AQX A;  2CAQ A;  1FAA A;  2X99 A;  5COH A;  1N8J A;  3KCM A;  2A2S A;  3L9U A;  3EU3 A;  2C80 A;  1O81 A;  2V41 A;  1B9Y C;  2LEG A;  4G0L A;  3WT1 A;  3KP8 A;  2C8U A;  4LMV A;  2FA4 A;  3GKX A;  3R3E A;  1BED A;  4ECB A;  2DJ2 A;  1A8L A;  2FLS A;  5CRG A;  2H75 A;  2K18 A;  1J0F A;  5IMA A;  3LJR A;  1I9D A;  5DAK B;  5ECP B;  4YAP A;  2F8F A;  4QQ7 A;  1A2M A;  1TU8 A;  2VO4 A;  3G7I A;  3G7J A;  2FUG 2;  4YAV A;  4HDE A;  3GH6 A;  4USS A;  11GS A;  3TUE A;  1UA5 A;  3ERF A;  4HJ2 A;  2GZY A;  4NAX A;  1WPI A;  1K0D A;  2C0E A;  1X9M B;  2VD0 A;  1T4Y A;  4IN0 A;  4L5L A;  4PUA A;  1GH2 A;  4WR5 A;  3H4K A;  4GCI A;  2YWI A;  2LJR A;  5IIZ A;  3ZFL A;  2BJX A;  4BA7 A;  1WWJ A;  3KP9 A;  5GZZ B;  2CAI A;  2H0H A;  2VUP A;  2EIR A;  2H0I A;  1Y25 A;  5IMZ A;  3QD9 A;  1OKD A;  3A2W A;  2I3Y A;  1EWX A;  1S3D A;  3GA4 A;  2H01 A;  1KBN A;  5G30 A;  3FKF A;  2BTO T;  4FYC A;  1GSS A;  4WXT A;  4QL9 A;  5CRH A;  1SK1 A;  2GT6 A;  1BQ7 A;  2MYG A;  1JZD A;  1M7T A;  14GS A;  4ECI A;  3RBT A;  2LTK A;  5H5Q A;  3IAM 2;  5CYY A;  4G2E A;  2I81 A;  2X64 A;  3DYR A;  2GGT A;  5INY A;  3OR5 A;  4TR1 B;  4XS6 A;  1OC8 A;  2CZ2 A;  2R2J A;  1F6M C;  1TXX A;  4CW9 A;  1TRS A;  2IMI A;  1M2D A;  3HZ4 A;  3GN3 A;  5IM9 A;  5B6N A;  1O6J A;  2DJ1 A;  2PN8 A;  3EYT A;  2HSM A;  1PX6 A;  2PUK C;  4KSO A;  1KNG A;  1ZOF A;  4CHS A;  5E4W A;  6GSU A;  5J9C A;  5ECH B;  1A2J A;  4V2L A;  1TK5 B;  1ERT A;  3GFK A;  2WDU A;  1YY7 A;  2LRT A;  3DD3 A;  1J9B A;  3IC8 A;  2R6K A;  1EP7 A;  1SL2 B;  4WF4 A;  3UVH A;  3TJJ A;  5G5E A;  5L71 A;  2TRX A;  2IIY A;  2FWH A;  3FEU A;  1YEX A;  1V58 A;  2YV7 A;  2MBT A;  1PSQ A;  2WUL A;  2VAF A;  3FZ5 A;  2L4Q A;  3I9V 2;  5DAK A;  2Z9S A;  4EO3 A;  2ZUP A;  2XHF A;  2YJH A;  4HS1 A;  4EL1 A;  1K0A A;  1DE1 A;  6GSX A;  2C3Q A;  5ECI B;  2VL9 A;  5FT3 A;  1TP9 A;  4POM A;  1NW2 A;  4F03 A;  4KSM A;  6GSS A;  3F6D A;  2B1L A;  4OD7 A;  1WIK A;  5IMF A;  2HXK A;  2KUC A;  1M2B A;  1RK4 A;  1G0T A;  3E3E A;  5ABR A;  3GUS A;  1NHO A;  2E2G A;  2I1U A;  2VCZ A;  1PA3 A;  3ZMK A;  1TDI A;  3LG6 A;  2OAC A;  1U3A A;  4O92 A;  1FB6 A;  3PPU A;  4JU5 A;  1OE8 A;  2F9S A;  13GS A;  6GSV A;  4WF5 A;  4OFT A;  3H79 A;  3C71 A;  20GS A;  3DKS A;  3TJK A;  3MSZ A;  5GAP D;  3DRN A;  2RM5 A;  4L8E A;  3L9V A;  1AIU A;  5HFK A;  5H5R A;  1PKW A;  3W6G A;  2L5L A;  5ELA A;  1K3L A;  4G19 A;  2B6M A;  3CBU A;  2REM A;  1OYJ A;  2KHP A;  2EIQ A;  9GSS A;  4H86 A;  4TR1 A;  3WGD A;  2MMN A;  5GST A;  3ZIV A;  3VI5 A;  3C1R A;  1TJD A;  3CSJ A;  2B7J A;  1TTZ A;  2H72 A;  2DIZ A;  1CQH A;  1QGV A;  3VWU A;  1FHE A;  3TKS C;  3O76 A;  4PQH A;  4NHW A;  5IOW A;  4X43 A;  3TKQ A;  4MJB A;  1V40 A;  4TRX A;  2KP2 A;  3IA1 A;  2DJ3 A;  1FG4 A;  4EC0 A;  1E2Y A;  2VM1 A;  4XS1 A;  3UL3 A;  2CVB A;  4RQR A;  4J2F A;  4MJE A;  3A2X A;  2F3M A;  3D22 A;  2NDO A;  2ON7 A;  3PH9 A;  4EUY A;  3M9J A;  4F0C A;  1SD9 A;  3TRQ A;  3LXT A;  1TU7 A;  4MAB A;  5KN1 A;  3TOT A;  5GSS A;  1HNB A;  1S3C A;  2K9F A;  3VWV A;  5HR0 A;  3CRU A;  1B4Q A;  2YWO A;  2PBJ A;  7GSS A;  3R2Q A;  4KF9 A;  1WMJ A;  2DBC A;  5HQP A;  1Q98 A;  1TK8 B;  2GZZ A;  3W8J A;  4GTU A;  2H76 A;  3J7Y k;  3F63 A;  2B7K A;  3KTB A;  1ST9 A;  2WB9 A;  3PIN A;  2G2Q A;  5C04 A;  5B8A A;  4G0K A;  1RQM A;  4WBR D;  5B7C A;  3DEX A;  2YJ7 A;  4PUR A;  4RUV A;  2DJJ A;  5E59 A;  5ID2 B;  4K9Z A;  3LYK A;  2FCH A;  2HT9 A;  1M2A A;  5A5K A;  4WBJ A;  4YQV A;  2HZF A;  2H1A A;  5D73 A;  1JZO A;  3VK9 A;  2GVP A;  2ON5 A;  3ZFB A;  1GSD A;  4J56 E;  4BL7 B;  2E2M A;  2YAN A;  2PWJ A;  1X9S B;  1Z7R A;  4FH8 A;  3A5W A;  2PGT A;  4POK A;  2NTO A;  4NV5 A;  4N0Z A;  1DE2 A;  1TW9 A;  1GNW A;  2JL4 A;  2JZR A;  4KCA A;  4HU9 A;  5F07 A;  3TJB A;  1ACV A;  2HQT A;  1T4Z A;  1V9W A;  2WZ9 A;  4IGJ A;  1V98 A;  1OC9 B;  4GQC A;  2FD3 A;  1OVN A;  5BMU A;  2M80 A;  2OE1 A;  3IBH A;  3MNG A;  3ME8 A;  4EE0 A;  2DIY A;  3EU4 A;  3F9U A;  3GH9 A;  2LST A;  4LMW A;  1ERW A;  5JCW A;  1SKS B;  3QPM A;  3Q6O A;  2B3S A;  2B5Y A;  4EKZ A;  5CRE A;  4IJI A;  5F0G A;  3V1W A;  4TVE A;  5J3R A;  4XIH A;  1M9A A;  2R5G A;  5F06 A;  5AIS A;  4E8H A;  1SK0 A;  2RUF A;  2PVQ A;  3N5O A;  3ZRD A;  4XCS A;  3FR9 A;  5ECR B;  4I8B A;  2PVO C;  2GQM A;  2RLI A;  5C00 A;  3TCO A;  3RAZ A;  1JLW A;  3HJP A;  1BAY A;  3DVX A;  1VF2 A;  2H66 A;  1V2A A;  4AJ8 A;  5KEJ A;  5JWO B;  1SU9 A;  2TRC P;  3ERG A;  3KTL A;  3W8S A;  3GL3 A;  4ECC A;  1NHY A;  1X5E A;  3RHC A;  4X1U A;  1G6Y A;  2AYT A;  3TGZ A;  1ML6 A;  4LL4 B;  3TJG A;  4FYU A;  3ZL5 A;  2MMA A;  4NMU A;  1FO5 A;  2YP6 A;  2P5R A;  4IEL A;  1VF3 A;  5A4V A;  4BVX A;  1T3B A;  2JZS A;  8GSS A;  3GNJ A;  4TR4 A;  2VD1 A;  5ID2 A;  4BVY B;  3TKP A;  2N5B A;  1O8W A;  2X8G A;  2EIO A;  4KAE A;  3H93 A;  2OE3 A;  2HSM B;  3EUR A;  1SJI A;  2C1Y A;  1B8X A;  3HY2 A;  4BL7 A;  5EPF A;  3QAW A;  2H6X A;  1XFL A;  5ECQ B;  2AHE A;  1M99 A;  1PQN A;  3LFL A;  3G9B A;  4LL1 B;  1BJX A;  2DML A;  1X0R A;  1A23 A;  4RI7 A;  4HU7 A;  4HI7 A;  1OC9 A;  1XVW A;  4PGT A;  2FA8 A;  4K0N A;  4ZIL A;  4F2I A;  4IKH A;  3JCM L;  4TKY A;  5A4W A;  6GST A;  2C3T A;  3M9K A;  2HI7 A;  4JBB A;  1H4O A;  3KMO A;  5CNW A;  5AN1 A;  3P8W A;  2DJ0 A;  4YQM A;  4CDO A;  2F51 A;  4IP6 A;  3U6V A;  1SYX A;  1ERU A;  1B4P A;  3QFA C;  3L0H A;  2RUE A;  1K3Y A;  3VWX A;  4ISD A;  4ZBB A;  4GQF A;  3ZML A;  1YKC A;  2LRN A;  3QMX A;  2I9H A;  3BD2 A;  3GKM A;  3P7X A;  2MMZ A;  4NXI A;  3TKR A;  4FYB A;  2H8L A;  5ECS A;  3O3T A;  3IDV A;  4EDZ A;  5HR2 A;  3GL5 A;  3ED3 A;  4XS4 B;  1AXD A;  3M1G A;  4J57 E;  3M3M A;  1Y6E A;  1R5A A;  3UBK A;  3IAS 2;  3HKR A;  3RDW A;  2VCT A;  4V1A p;  5IMD A;  3FK8 A;  1A2L A;  2H6Z A;  5LD0 A;  1PN9 A;  1PKZ A;  5B6M A;  4BVY A;  1R26 A;  1QFN A;  4JRR A;  4PQI A;  4MDC A; 
#chains in the Genus database with same CATH topology
 2CVD A;  1SKW B;  1JLV A;  3IK7 A;  1TRV A;  2GZP A;  1GTI A;  3D0Z A;  3GSS A;  4N0V A;  3IXR A;  2H19 A;  3S9F A;  1RW1 A;  3K8N A;  3DIE A;  4MA9 A;  4TOP A;  3ME7 A;  2H70 A;  2R4V A;  3MYD A;  5DVB A;  2O85 A;  2CV4 A;  1UC7 A;  3H1N A;  2WW1 A;  4EIQ A;  3GST A;  4AI6 A;  1GUK A;  1GLP A;  1FW1 A;  1WJK A;  3LEF A;  3IC4 A;  3TKS E;  2FWF A;  2C0G A;  5DCH A;  1HNC A;  3I43 A;  3IPZ A;  4G0I A;  2FGX A;  1O8X A;  4GSS A;  4ZB8 A;  4TXO B;  1AUC A;  1EV4 A;  1GNE A;  2IMD A;  2LQQ A;  4NV2 A;  19GS A;  1FVJ A;  4K7N A;  3UIW A;  2ZNM A;  3MWH A;  2HNL A;  2FWG A;  3HXS A;  2DSA A;  2JSZ A;  2GT5 A;  2RII A;  3TB2 A;  4ZL8 A;  5BRT A;  2E7P A;  3DML A;  1MEK A;  3MDK A;  5IO0 A;  2IWT A;  4AKX B;  5CRD A;  1XWG A;  4G10 A;  1FB0 A;  2DLX A;  3FZ9 A;  1ZYN A;  4MLY A;  2AV4 A;  3GHA A;  1ZL9 A;  2C3N A;  4OCF A;  3VI7 A;  5DCG A;  3DWV A;  1EGR A;  4OO4 A;  4OWY A;  2N5F A;  3PGT A;  3Q74 A;  4OMV A;  2B5E A;  2M46 A;  5LNK e;  4XS4 A;  3QR6 A;  5F8B A;  4ICY A;  3ZIT A;  2YCD A;  4AF2 A;  3C8E A;  3EC3 A;  1EP8 A;  1XWK A;  4HZ4 A;  1IYI A;  3N9J A;  2HSN A;  2NVL A;  4DSR A;  5ELG A;  2H71 A;  2OA7 A;  2GS3 A;  1XVQ A;  3H8Q A;  3KJY A;  3LW9 A;  1XW6 A;  3CQF A;  4N3Z A;  1C72 A;  2OJL A;  5KN3 A;  3L4N A;  2TIR A;  4IW9 A;  4F9Z A;  2YV9 A;  1W4V A;  2J9H A;  4ACS A;  1YQ1 A;  1W89 A;  4KE3 A;  4N30 A;  4D73 B;  2JAD A;  2O87 A;  4RQX A;  4YQU A;  5AGY A;  2GSR A;  3IE3 A;  4K7O A;  5B8B A;  4MZC A;  2UZ8 A;  2VLU A;  1F3B A;  1VRS D;  5EVO A;  3ZTL A;  2NPB A;  3LWA A;  3I69 A;  4KGI A;  1X5C A;  4BWQ A;  2HFD A;  1YKA A;  5D93 A;  1AC1 A;  1R7H A;  2YZU A;  2WW0 A;  1Z7P A;  1SL1 B;  2QA2 A;  2LRC A;  3DGQ A;  3VFI A;  1V57 A;  4DSS B;  2H74 A;  3F4T A;  4MMM A;  2EFD A;  4PXO A;  2X8C A;  5D8I A;  2O7K A;  4TXO A;  1E6B A;  4BWS A;  3FW2 A;  1SK2 A;  1UVZ A;  3CXG A;  4NWY A;  2L4C A;  5IMV A;  4OFN A;  2P5Q A;  5JCU A;  4MJA A;  2LNS A;  4OCE A;  1GUM A;  2B5X A;  1H75 A;  1QUW A;  4GLT A;  1PX7 A;  1GSU A;  2IN3 A;  2P31 A;  4IQ1 A;  3EWL A;  3HJO A;  1QK8 A;  1EOH A;  2CX3 A;  3ZZX A;  5G1K A;  4GST A;  5HFI A;  3IR4 A;  3D5J A;  2KP1 A;  1G7E A;  4DEJ A;  1A8Y A;  2QGV A;  4PNG A;  3VPQ A;  5IMC A;  4AJ6 A;  1MD3 A;  3ZVJ D;  3RPP A;  2DMM A;  4WET A;  4JR4 A;  2VCV A;  2V32 A;  4BVX B;  3GRX A;  4TR3 A;  1N2A A;  1GSE A;  1ABA A;  3I6A A;  2V6O A;  3CYN A;  1ERV A;  2CVK A;  1Z5Y E;  3HD5 A;  1WP0 A;  1WE0 A;  1M9B A;  1EGO A;  2MBS A;  1AQW A;  3TRP A;  3U5R E;  3F8U A;  3ISO A;  1BF5 A;  2BMX A;  4NHZ A;  1T7P B;  3QAG A;  2EC4 A;  4IHU A;  4KH7 A;  1SJ6 A;  4D73 A;  4KUN A;  1OKT A;  1YEP A;  1K0C A;  2IMF A;  3D4T A;  3UJ1 A;  2CQ9 A;  2HRK B;  2R0C A;  2OBK A;  3CTF A;  5A5H B;  2RM6 A;  2WS2 A;  4O7H A;  1Z6N A;  2R37 A;  1IYH A;  2OT3 A;  3EIN A;  1GWC A;  4ZB7 A;  2E0Q A;  3GTU B;  1ZGN A;  4DSQ A;  3CSH A;  1XIY A;  3WD6 A;  5H5S A;  5IPG A;  1XWC A;  4E68 A;  2LKU A;  2V1M A;  3ZRE A;  2PPT A;  3DVW A;  1Z9H A;  10GS A;  3FRC A;  4KX4 A;  1AW9 A;  4DSS A;  2GLR A;  1LU4 A;  5AIV A;  4Q5R A;  3APO A;  3KGK A;  1M0U A;  1NM3 A;  4GWR A;  4KA0 A;  3ERW A;  4HJM A;  2XBI A;  2H6Y A;  3CTG A;  1OC3 A;  3NIV A;  2DJK A;  2FHE A;  5D9T A;  2IPA A;  4FQU A;  5JWQ B;  1A0F A;  3TJF A;  2IMK A;  1OE7 A;  3NOF A;  4MJC A;  1MDJ A;  1SL0 B;  4GXZ A;  4KDU A;  1ZZY A;  4PNF A;  2O3E A;  4ZBD A;  4Z7X A;  2VL3 A;  2PER A;  4ZB9 A;  2F8A A;  2QKE A;  1XCC A;  3FR3 A;  3Q19 A;  3KIJ A;  3IOS A;  1S4B P;  2O36 A;  1TI3 A;  2HRA A;  1XPV A;  1EZK A;  3CRT A;  4CY6 A;  2YWN A;  1XWB A;  3HYP A;  2IL3 A;  5ENU A;  3KH9 A;  1LBK A;  4I5Q A;  1Q4J A;  2WGR A;  3GKN A;  2DKI A;  1HNA A;  3P90 A;  3ZYW A;  2WRT A;  1XW5 A;  4MH3 A;  2YN1 A;  5D9X A;  3D6I A;  4PX1 A;  5J5N A;  2JU5 A;  1DUG A;  2VCQ A;  2H1B A;  3QFB C;  2YPM A;  2MZC A;  4IBP A;  3GIX A;  4KW6 A;  5IPH A;  3M8N A;  3IV4 A;  3GV1 A;  1THO A;  3PR8 A;  3HVX A;  1BYE A;  2H73 A;  1X9W B;  5CRW A;  2CT6 A;  4TXV A;  3TRX A;  3UEM A;  2HRK A;  1NSW A;  4ML6 A;  5G5F A;  2I4A A;  3C73 A;  1THX A;  5A5H A;  2FWE A;  5HR3 A;  3SWL A;  3D21 A;  5D96 A;  1JFU A;  3GTU A;  2JZT A;  1U3I A;  4K7I A;  2P0G A;  1BG5 A;  2VKZ G;  3KZQ A;  4HQS A;  1A0R P;  4EF0 A;  4ZXG A;  2L57 A;  1VF1 A;  4MPF A;  3QAV A;  2H1G A;  5EL8 A;  1B9X C;  3GYK A;  1SYR A;  4IJ3 A;  4V1A g;  2HSH A;  1USB A;  3BBY A;  4X4J A;  1Y1U A;  4FXY P;  1GTB A;  3RGB C;  1JHB A;  2LS5 A;  4QL7 A;  1YDK A;  4HEA 2;  4TN8 A;  1I1I P;  2CX4 A;  2L6C A;  3CMI A;  4X0X A;  4EXJ A;  2IFQ B;  5DDL A;  1K0M A;  1VF4 A;  1G6W A;  1MDI A;  1HYU A;  1ZYE A;  2K8V A;  4CY8 A;  5CAX A;  3FYG A;  3QCP A;  1O85 A;  3EVI A;  1ZYQ B;  1PL2 A;  2VCX A;  3HJM A;  1PRX A;  2HSN B;  1XZO A;  2A4H A;  1XOB A;  4AJ7 A;  1EEM A;  5J4V A;  3APS A;  4IQA A;  4I97 A;  1GLQ A;  1K3O A;  3C7M A;  2XPD A;  1S3A A;  2M72 A;  2VM2 A;  2H30 A;  4IS0 A;  4K1F A;  1VGL A;  1SJZ A;  2K6V A;  1TOF A;  2AUV A;  3IRA A;  1T00 A;  1LJR A;  1ON4 A;  5A4U A;  4GSN A;  4GRF A;  2GSS A;  3DXB A;  2L59 A;  4ULX A;  2V2G A;  5LCZ A;  3UBL A;  4Q5F A;  3HZ8 A;  4G9H A;  3G7Y A;  3HVV A;  1TK0 B;  3ZLP A;  2MMO A;  1URM A;  4QMK A;  1K0B A;  3HA9 A;  4JR6 A;  4WKW A;  1M3J A;  1WOU A;  5DBQ A;  2GST A;  1AAZ A;  3WGX A;  2C0F A;  3E9J B;  2K8S A;  1R5P A;  2O89 A;  4TW5 A;  3O6T A;  1MTC A;  4WEY A;  3ZIJ A;  4DVC A;  5A1N B;  4MP4 A;  2YOI A;  2HSY A;  1GUL A;  3UOM A;  3UVT A;  4ID0 A;  2LJA A;  1U88 A;  4V2N A;  1OAZ A;  3NZN A;  1QQ2 A;  3HDC A;  1F9M A;  4KND A;  2AB6 A;  3BCI A;  4EVM A;  2YNX A;  1YVL A;  2ALB A;  4POB A;  2LV3 A;  2N5A A;  4O32 A;  5IO2 A;  2XBQ A;  4MZW A;  5HR1 A;  1CQG A;  3FY7 A;  4MZB A;  2HE3 A;  1K0O A;  3FR6 A;  4PQ1 A;  4I2U A;  4JE1 A;  5JWR B;  2XC2 A;  1F2E A;  2LNT A;  5ECN B;  1J08 A;  4K2D A;  3Q18 A;  4P3Y B;  1MDK A;  2WJU A;  1U6T A;  2LUS A;  4WR4 A;  3EMX A;  2LJK A;  4JED A;  1DBY A;  1AQV A;  2IFQ A;  4MK3 A;  4L5O A;  4KDX A;  3EMP A;  2YZH A;  2EFC A;  2FY6 A;  4ZIJ A;  2PU9 C;  2NBS A;  4K8M A;  3CSI A;  3HVS A;  1XOA A;  4N11 A;  2GTU A;  3IHG A;  5J41 A;  3GMF A;  4E8E A;  4HQZ A;  3WYW A;  2IJY A;  3KD0 A;  2ZCT A;  1Z6M A;  2IME A;  2XPE A;  5IOX A;  5ECL B;  3KEB A;  3WGE A;  1GSY A;  3L9S A;  3RHB A;  5AIX A;  1EEJ A;  4KDY A;  3CHX C;  2R3X A;  1XW9 A;  5CO3 A;  2OE0 A;  4Q5N A;  3FHK A;  5KN0 A;  1EOG A;  1T8E B;  1BX9 A;  2OKA A;  4FIW A;  1FVK A;  4IVF A;  3GX0 A;  5F05 A;  3VPT A;  3EE2 A;  1B48 A;  5DQS A;  4I6X A;  3A3T A;  17GS A;  1XXU A;  3US3 A;  3BJ5 A;  4G01 A;  3BOA A;  1GL8 A;  5G31 A;  1YF0 A;  4ZBA A;  3QOU A;  2HYX A;  3MAK A;  4V2M A;  4EDY A;  3A2V A;  5FHI A;  3APQ A;  1ZYP A;  5A1N A;  3UAP A;  2AJQ B;  3KM6 A;  2VL2 C;  3FZA A;  3HHV A;  4O5R A;  3C1S A;  4K6X A;  1ZMA A;  5EY6 A;  3HVN A;  1K0N A;  1PGT A;  4NPB A;  4O5U A;  5G2Z A;  2WW2 A;  2GQL A;  4LLR A;  5JCG A;  2EFH A;  2X8H A;  5HFG A;  3TKS A;  1SKR B;  3VUR A;  18GS A;  2HRN A;  5ECO B;  5DAL B;  2HRF A;  1KEB A;  1SVO A;  4ZL9 A;  3F4S A;  1HD2 A;  1PD2 1;  2L6D A;  3KXO A;  3F3Q A;  3D4M A;  3IHQ A;  5IQY A;  1TKD B;  1G7O A;  1FOV A;  2VL2 A;  4TR0 A;  2KOK A;  1Z3E A;  2O8V B;  2B1K A;  2QSI A;  1GP1 A;  1YF1 A;  5DJM A;  1YJ6 A;  2CZ3 A;  2PMT A;  1U87 A;  4ZB6 A;  2WZS A;  3BCK A;  4K5R A;  4N10 A;  1JZR A;  1X5D A;  2HZE B;  4IP1 A;  2WVY A;  5J4U A;  1UN2 A;  2WCI A;  3VLN A;  4YH2 A;  1XWA A;  5DJL A;  4MCU A;  4GDF A;  1T1V A;  1GUH A;  2VOC A;  4AKG A;  3LOR A;  5KN2 A;  4ZL7 A;  2JAC A;  5FWG A;  2WFC A;  2D2Z A;  22GS A;  3LYP A;  1SD8 A;  3HCZ A;  1ZCP A;  1TI1 A;  2C0D A;  4KB3 A;  3KMN A;  1KTE A;  4W66 A;  3TDG A;  5ECM B;  3LGC A;  2WVZ A;  2L5O A;  1JZW A;  2UV8 G;  2H1L A;  1O7U A;  1QXH A;  16GS A;  1ILO A;  1GTU A;  4ILF A;  2GSQ A;  4KCE A;  2VCW A;  3RFR C;  3LQ7 A;  2GQK A;  5CP1 A;  4MF7 A;  3EPT A;  4MNN A;  4FO5 A;  1DSB A;  1PMT A;  4RI6 A;  4OFM A;  1GTA A;  1PL1 A;  3FZ4 A;  4AGS A;  1MD4 A;  3QDN A;  2GDR A;  1R4W A;  3AY8 A;  2YWM A;  12GS A;  2HLS A;  2JSY A;  3F3R A;  3P2A A;  1TXU A;  2J23 A;  4L0W A;  1GSF A;  1EV9 A;  1YZX A;  4XHM A;  2QC7 A;  3VWW A;  1M3I A;  1GSQ A;  4F82 A;  4MF5 A;  5G1L A;  2H1D A;  2KLX A;  1WRY A;  5KOX A;  3TOU A;  1I5G A;  5DQY A;  1F37 A;  4POL A;  4JZQ A;  4ML1 A;  4I2T A;  4XRA A;  3GX8 A;  4HOJ A;  2CA8 A;  3F6F A;  4PTS A;  4ECJ A;  2FNO A;  2C4J A;  2VLT A;  4HZ2 A;  5ECK B;  1HQO A;  5DAL A;  4L0U A;  5D9W A;  3ZVJ A;  4XTS A;  3LSZ A;  4HUA A;  4AKH A;  2A2P A;  1TRU A;  1A24 A;  3GKK A;  3GUR A;  2A4V A;  2DC5 A;  4Q5Q A;  6GSY A;  5J9B A;  3IK9 A;  2VIM A;  4MF6 A;  4BPY A;  3KH7 A;  3UAR A;  3M0F A;  2ES7 A;  6GSW A;  3L78 A;  2OAD A;  3J7Y b;  4MPG A;  2OBI A;  3SBC A;  1SEN A;  4GF0 A;  4K0G A;  1O73 A;  2HZE A;  3F4R A;  2A2R A;  3UMA A;  2LQO A;  1XBS A;  5D9V A;  5GAN D;  1GRX A;  2G0F A;  4XRD A;  1TRW A;  4PUF C;  4OO5 A;  2O5V A;  3F0I A;  2V6K A;  2VLV A;  2AAW A;  2H0G A;  3WT2 A;  3LXZ A;  4F0B A;  3RPN A;  5J40 A;  3FMW A;  4LA1 A;  4MH2 A;  1F3A A;  3E0U A;  1QMV A;  1AQX A;  2CAQ A;  1FAA A;  2X99 A;  5COH A;  1N8J A;  3KCM A;  2A2S A;  3L9U A;  3EU3 A;  2C80 A;  1O81 A;  2V41 A;  1B9Y C;  2LEG A;  4G0L A;  3WT1 A;  3KP8 A;  2C8U A;  4LMV A;  3HMJ G;  2FA4 A;  3GKX A;  3R3E A;  1BED A;  4ECB A;  2DJ2 A;  1A8L A;  1XG8 A;  2FLS A;  5CRG A;  2H75 A;  2K18 A;  3CWG A;  1J0F A;  5IMA A;  2WVX B;  3LJR A;  1I9D A;  5DAK B;  5ECP B;  4YAP A;  2F8F A;  4QQ7 A;  1A2M A;  1TU8 A;  2VO4 A;  3G7I A;  3G7J A;  2FUG 2;  4YAV A;  4HDE A;  3GH6 A;  4USS A;  11GS A;  3TUE A;  1UA5 A;  3ERF A;  4HJ2 A;  2GZY A;  4NAX A;  1WPI A;  1K0D A;  2C0E A;  1X9M B;  2VD0 A;  1T4Y A;  4IN0 A;  4L5L A;  1PFO A;  4PUA A;  1GH2 A;  4WR5 A;  3H4K A;  4GCI A;  2YWI A;  2LJR A;  5IIZ A;  3ZFL A;  2BJX A;  4BA7 A;  2WW3 A;  1WWJ A;  3KP9 A;  5GZZ B;  2CAI A;  2H0H A;  2VUP A;  4PI0 C;  2EIR A;  2H0I A;  1Y25 A;  5IMZ A;  3QD9 A;  1OKD A;  3A2W A;  2I3Y A;  1EWX A;  1S3D A;  3GA4 A;  2H01 A;  1KBN A;  5G30 A;  3FKF A;  2BTO T;  4FYC A;  1GSS A;  4WXT A;  4QL9 A;  5CRH A;  1SK1 A;  2GT6 A;  1BQ7 A;  2MYG A;  1JZD A;  1M7T A;  5KOW A;  14GS A;  2X49 A;  4ECI A;  3RBT A;  2LTK A;  2X4A A;  5H5Q A;  3IAM 2;  5CYY A;  4G2E A;  2I81 A;  2X64 A;  3DYR A;  3TU3 B;  2GGT A;  5INY A;  4HSC X;  3OR5 A;  4TR1 B;  4XS6 A;  1OC8 A;  2CZ2 A;  2R2J A;  1F6M C;  5A34 B;  1TXX A;  4CW9 A;  1TRS A;  2IMI A;  1M2D A;  3HZ4 A;  3GN3 A;  5IM9 A;  5B6N A;  1O6J A;  1N25 A;  2DJ1 A;  2PN8 A;  3EYT A;  2HSM A;  1PX6 A;  2R0G A;  2PUK C;  4KSO A;  1KNG A;  1ZOF A;  4CHS A;  5E4W A;  6GSU A;  5J9C A;  5ECH B;  1A2J A;  4V2L A;  1TK5 B;  1ERT A;  3GFK A;  2WDU A;  1YY7 A;  2LRT A;  3DD3 A;  1J9B A;  3IC8 A;  2R6K A;  1EP7 A;  1SL2 B;  4WF4 A;  3UVH A;  3TJJ A;  5G5E A;  5L71 A;  2TRX A;  2IIY A;  2FWH A;  3FEU A;  1YEX A;  1V58 A;  2YV7 A;  2MBT A;  1PSQ A;  2WUL A;  2VAF A;  3FZ5 A;  2L4Q A;  3I9V 2;  2WVX A;  5DAK A;  2Z9S A;  4EO3 A;  2ZUP A;  2XHF A;  2YJH A;  4HS1 A;  4EL1 A;  1K0A A;  1DE1 A;  6GSX A;  2C3Q A;  5ECI B;  2VL9 A;  5FT3 A;  1TP9 A;  4POM A;  1NW2 A;  4F03 A;  4KSM A;  6GSS A;  3F6D A;  2B1L A;  4OD7 A;  1PN0 A;  1WIK A;  5IMF A;  2HXK A;  2KUC A;  1M2B A;  1RK4 A;  3E3E A;  1G0T A;  5ABR A;  3GUS A;  1NHO A;  1SVL A;  2E2G A;  2I1U A;  2VCZ A;  1PA3 A;  3ZMK A;  1TDI A;  4K2X A;  3LG6 A;  2OAC A;  1U3A A;  4O92 A;  1FB6 A;  3PPU A;  4JU5 A;  1OE8 A;  2F9S A;  13GS A;  6GSV A;  4WF5 A;  4YKG A;  4OFT A;  3H79 A;  3C71 A;  20GS A;  3DKS A;  3TJK A;  3MSZ A;  5GAP D;  3DRN A;  2RM5 A;  4L8E A;  3L9V A;  1AIU A;  5HFK A;  5H5R A;  1PKW A;  3W6G A;  2L5L A;  5ELA A;  1K3L A;  4G19 A;  2B6M A;  3CBU A;  2REM A;  1OYJ A;  2KHP A;  2EIQ A;  9GSS A;  4H86 A;  4TR1 A;  3WGD A;  2MMN A;  5GST A;  3ZIV A;  3VI5 A;  5A34 A;  3C1R A;  1TJD A;  3CSJ A;  2B7J A;  1TTZ A;  2H72 A;  2DIZ A;  1CQH A;  1QGV A;  3VWU A;  1FHE A;  3TKS C;  3O76 A;  4Z2T A;  4PQH A;  4NHW A;  5IOW A;  4X43 A;  3TKQ A;  4MJB A;  2EFE A;  1V40 A;  4TRX A;  2KP2 A;  3IA1 A;  3A5I A;  5BMU B;  2DJ3 A;  1FG4 A;  4BIK A;  4EC0 A;  1E2Y A;  2VM1 A;  4XS1 A;  3UL3 A;  2CVB A;  4RQR A;  4J2F A;  4MJE A;  3A2X A;  2F3M A;  3D22 A;  2NDO A;  2ON7 A;  3PH9 A;  4EUY A;  3M9J A;  4F0C A;  1SD9 A;  3TRQ A;  3LXT A;  1TU7 A;  4MAB A;  5KN1 A;  3TOT A;  5GSS A;  1HNB A;  1S3C A;  2K9F A;  1FOH A;  3VWV A;  5HR0 A;  3CRU A;  1B4Q A;  2YWO A;  2PBJ A;  7GSS A;  3R2Q A;  4KF9 A;  1WMJ A;  2DBC A;  5HQP A;  1Q98 A;  1TK8 B;  2GZZ A;  3W8J A;  4GTU A;  2H76 A;  3J7Y k;  3F63 A;  2B7K A;  3KTB A;  1ST9 A;  2WB9 A;  3PIN A;  2G2Q A;  5C04 A;  5B8A A;  4G0K A;  1RQM A;  4WBR D;  5B7C A;  3DEX A;  2YJ7 A;  4PUR A;  4RUV A;  2DJJ A;  5E59 A;  5J4Y A;  4K9Z A;  3LYK A;  2FCH A;  2HT9 A;  5ID2 B;  1M2A A;  5A5K A;  4WBJ A;  4YQV A;  2HZF A;  2H1A A;  5D73 A;  1JZO A;  3VK9 A;  2GVP A;  2ON5 A;  3ZFB A;  4O5Q A;  1GSD A;  4J56 E;  4BL7 B;  2E2M A;  2YAN A;  2PWJ A;  1X9S B;  1Z7R A;  4FH8 A;  3A5W A;  4EIP A;  4A5P A;  2PGT A;  4POK A;  2NTO A;  4NV5 A;  4N0Z A;  1DE2 A;  1TW9 A;  1GNW A;  2JL4 A;  2JZR A;  4KCA A;  4HU9 A;  5F07 A;  3TJB A;  4PI2 C;  1ACV A;  2HQT A;  1T4Z A;  1V9W A;  2WZ9 A;  4IGJ A;  1V98 A;  1OC9 B;  4GQC A;  2FD3 A;  1OVN A;  5BMU A;  2R0P A;  2M80 A;  2OE1 A;  3IBH A;  3MNG A;  3ME8 A;  4EE0 A;  2DIY A;  3EU4 A;  3F9U A;  3GH9 A;  2LST A;  4LMW A;  1ERW A;  4YKF A;  5JCW A;  1SKS B;  3QPM A;  3Q6O A;  2B3S A;  2B5Y A;  4EKZ A;  5CRE A;  4IJI A;  5F0G A;  3V1W A;  4TVE A;  5J3R A;  4XIH A;  1M9A A;  2R5G A;  5F06 A;  5AIS A;  4E8H A;  1SK0 A;  4K5S A;  2RUF A;  2PVQ A;  3N5O A;  3ZRD A;  4XCS A;  3FR9 A;  5ECR B;  4I8B A;  2PVO C;  2GQM A;  2RLI A;  5C00 A;  3TCO A;  3RAZ A;  1JLW A;  3HJP A;  1BAY A;  3DVX A;  1VF2 A;  2H66 A;  1V2A A;  4AJ8 A;  5KEJ A;  5JWO B;  1SU9 A;  2TRC P;  3ERG A;  3KTL A;  1YEW C;  3W8S A;  3GL3 A;  4ECC A;  1NHY A;  1X5E A;  3RHC A;  4X1U A;  1G6Y A;  2AYT A;  3TGZ A;  1ML6 A;  4LL4 B;  3TJG A;  4FYU A;  3ZL5 A;  2MMA A;  1S3R A;  4NMU A;  1FO5 A;  2YP6 A;  2P5R A;  2QA1 A;  4PHZ C;  4IEL A;  1VF3 A;  5A4V A;  4BVX A;  1T3B A;  2JZS A;  8GSS A;  3GNJ A;  4TR4 A;  2VD1 A;  5ID2 A;  4BVY B;  3TKP A;  2N5B A;  1O8W A;  2X8G A;  2EIO A;  4KAE A;  3H93 A;  1BG1 A;  4Z2U A;  2OE3 A;  2HSM B;  3EUR A;  1SJI A;  2C1Y A;  1B8X A;  3HY2 A;  4BL7 A;  5EPF A;  3QAW A;  2H6X A;  1XFL A;  5ECQ B;  2AHE A;  1M99 A;  1PQN A;  3LFL A;  3G9B A;  4LL1 B;  1BJX A;  2DML A;  4AKI A;  1X0R A;  1A23 A;  4RI7 A;  4HU7 A;  4HI7 A;  1OC9 A;  1XVW A;  4PGT A;  2FA8 A;  4K0N A;  4ZIL A;  4F2I A;  4IKH A;  3JCM L;  4TKY A;  5A4W A;  6GST A;  2C3T A;  3M9K A;  2HI7 A;  4JBB A;  1H4O A;  3KMO A;  5CNW A;  5AN1 A;  3P8W A;  2DJ0 A;  4YQM A;  4CDO A;  2F51 A;  4IP6 A;  3U6V A;  1SYX A;  1ERU A;  1B4P A;  3QFA C;  3L0H A;  2DKH A;  2RUE A;  1K3Y A;  3VWX A;  4ISD A;  4ZBB A;  3ZML A;  4GQF A;  1YKC A;  2LRN A;  3QMX A;  2I9H A;  3BD2 A;  3GKM A;  3P7X A;  2MMZ A;  4NXI A;  3TKR A;  4FYB A;  3MIX A;  2H8L A;  4Z2R A;  5ECS A;  3O3T A;  1SVM A;  3IDV A;  4EDZ A;  5HR2 A;  3GL5 A;  3ED3 A;  4XS4 B;  1AXD A;  3M1G A;  4J57 E;  3M3M A;  1Y6E A;  1R5A A;  3UBK A;  3IAS 2;  3HKR A;  3RDW A;  2VCT A;  4V1A p;  5IMD A;  3FK8 A;  1A2L A;  5J47 A;  2H6Z A;  5LD0 A;  1PN9 A;  1PKZ A;  5B6M A;  4BVY A;  1R26 A;  1QFN A;  4JRR A;  4PQI A;  4MDC A; 
#chains in the Genus database with same CATH homology
 2CVD A;  1SKW B;  1JLV A;  3IK7 A;  1TRV A;  2GZP A;  1GTI A;  3D0Z A;  3GSS A;  4N0V A;  3IXR A;  2H19 A;  3S9F A;  1RW1 A;  3K8N A;  3DIE A;  4MA9 A;  4TOP A;  3ME7 A;  2H70 A;  2R4V A;  3MYD A;  5DVB A;  2O85 A;  2CV4 A;  1UC7 A;  3H1N A;  4EIQ A;  3GST A;  4AI6 A;  1GUK A;  1GLP A;  1FW1 A;  1WJK A;  3LEF A;  3IC4 A;  3TKS E;  2FWF A;  2C0G A;  5DCH A;  1HNC A;  3I43 A;  3IPZ A;  4G0I A;  2FGX A;  1O8X A;  4GSS A;  4ZB8 A;  4TXO B;  1AUC A;  1EV4 A;  1GNE A;  2IMD A;  2LQQ A;  4NV2 A;  19GS A;  1FVJ A;  4K7N A;  3UIW A;  2ZNM A;  3MWH A;  2HNL A;  2FWG A;  3HXS A;  2DSA A;  2JSZ A;  2GT5 A;  2RII A;  3TB2 A;  4ZL8 A;  5BRT A;  2E7P A;  3DML A;  1MEK A;  3MDK A;  5IO0 A;  2IWT A;  4AKX B;  5CRD A;  1XWG A;  4G10 A;  1FB0 A;  2DLX A;  3FZ9 A;  1ZYN A;  4MLY A;  2AV4 A;  3GHA A;  1ZL9 A;  2C3N A;  4OCF A;  3VI7 A;  5DCG A;  3DWV A;  1EGR A;  4OO4 A;  4OWY A;  2N5F A;  3PGT A;  3Q74 A;  4OMV A;  2B5E A;  2M46 A;  5LNK e;  4XS4 A;  3QR6 A;  5F8B A;  4ICY A;  3ZIT A;  2YCD A;  4AF2 A;  3C8E A;  3EC3 A;  1EP8 A;  1XWK A;  4HZ4 A;  1IYI A;  3N9J A;  2HSN A;  2NVL A;  4DSR A;  5ELG A;  2H71 A;  2OA7 A;  2GS3 A;  1XVQ A;  3H8Q A;  3KJY A;  3LW9 A;  1XW6 A;  4N3Z A;  1C72 A;  2OJL A;  5KN3 A;  3L4N A;  2TIR A;  4IW9 A;  4F9Z A;  2YV9 A;  1W4V A;  2J9H A;  4ACS A;  1YQ1 A;  1W89 A;  4KE3 A;  4N30 A;  4D73 B;  2JAD A;  2O87 A;  4RQX A;  4YQU A;  5AGY A;  2GSR A;  3IE3 A;  4K7O A;  5B8B A;  4MZC A;  2UZ8 A;  2VLU A;  1F3B A;  1VRS D;  5EVO A;  3ZTL A;  2NPB A;  3LWA A;  3I69 A;  4KGI A;  1X5C A;  4BWQ A;  2HFD A;  1YKA A;  5D93 A;  1AC1 A;  1R7H A;  2YZU A;  1Z7P A;  1SL1 B;  2QA2 A;  2LRC A;  3DGQ A;  3VFI A;  1V57 A;  4DSS B;  2H74 A;  3F4T A;  4MMM A;  2EFD A;  4PXO A;  2X8C A;  5D8I A;  2O7K A;  4TXO A;  1E6B A;  4BWS A;  3FW2 A;  1SK2 A;  1UVZ A;  3CXG A;  4NWY A;  2L4C A;  5IMV A;  4OFN A;  2P5Q A;  5JCU A;  4MJA A;  2LNS A;  4OCE A;  1GUM A;  2B5X A;  1H75 A;  1QUW A;  4GLT A;  1PX7 A;  1GSU A;  2IN3 A;  2P31 A;  4IQ1 A;  3EWL A;  3HJO A;  1QK8 A;  1EOH A;  2CX3 A;  3ZZX A;  5G1K A;  4GST A;  5HFI A;  3IR4 A;  3D5J A;  2KP1 A;  1G7E A;  4DEJ A;  1A8Y A;  2QGV A;  4PNG A;  3VPQ A;  5IMC A;  4AJ6 A;  1MD3 A;  3ZVJ D;  3RPP A;  2DMM A;  4WET A;  4JR4 A;  2VCV A;  2V32 A;  4BVX B;  3GRX A;  4TR3 A;  1N2A A;  1GSE A;  1ABA A;  3I6A A;  2V6O A;  3CYN A;  1ERV A;  2CVK A;  1Z5Y E;  3HD5 A;  1WP0 A;  1WE0 A;  1M9B A;  1EGO A;  2MBS A;  1AQW A;  3TRP A;  3U5R E;  3F8U A;  3ISO A;  1BF5 A;  2BMX A;  4NHZ A;  1T7P B;  3QAG A;  2EC4 A;  4IHU A;  4KH7 A;  1SJ6 A;  4D73 A;  4KUN A;  1OKT A;  1YEP A;  1K0C A;  2IMF A;  3D4T A;  3UJ1 A;  2CQ9 A;  2HRK B;  2R0C A;  2OBK A;  3CTF A;  5A5H B;  2RM6 A;  2WS2 A;  4O7H A;  1Z6N A;  2R37 A;  1IYH A;  2OT3 A;  3EIN A;  1GWC A;  4ZB7 A;  2E0Q A;  3GTU B;  1ZGN A;  4DSQ A;  3CSH A;  1XIY A;  3WD6 A;  5H5S A;  5IPG A;  1XWC A;  4E68 A;  2LKU A;  2V1M A;  3ZRE A;  2PPT A;  3DVW A;  1Z9H A;  10GS A;  3FRC A;  4KX4 A;  1AW9 A;  4DSS A;  2GLR A;  1LU4 A;  5AIV A;  4Q5R A;  3APO A;  3KGK A;  1M0U A;  1NM3 A;  4GWR A;  4KA0 A;  3ERW A;  4HJM A;  2XBI A;  2H6Y A;  3CTG A;  1OC3 A;  3NIV A;  2DJK A;  2FHE A;  5D9T A;  2IPA A;  4FQU A;  5JWQ B;  1A0F A;  3TJF A;  2IMK A;  1OE7 A;  3NOF A;  4MJC A;  1MDJ A;  1SL0 B;  4GXZ A;  4KDU A;  1ZZY A;  4PNF A;  4ZBD A;  4Z7X A;  2VL3 A;  2PER A;  4ZB9 A;  2F8A A;  2QKE A;  1XCC A;  3FR3 A;  3Q19 A;  3KIJ A;  3IOS A;  1TI3 A;  2HRA A;  1XPV A;  1EZK A;  3CRT A;  4CY6 A;  2YWN A;  1XWB A;  3HYP A;  2IL3 A;  5ENU A;  3KH9 A;  1LBK A;  4I5Q A;  1Q4J A;  2WGR A;  3GKN A;  2DKI A;  1HNA A;  3P90 A;  3ZYW A;  2WRT A;  1XW5 A;  4MH3 A;  2YN1 A;  5D9X A;  3D6I A;  4PX1 A;  5J5N A;  2JU5 A;  1DUG A;  2VCQ A;  2H1B A;  3QFB C;  2YPM A;  2MZC A;  4IBP A;  3GIX A;  4KW6 A;  5IPH A;  3M8N A;  3IV4 A;  3GV1 A;  1THO A;  3PR8 A;  3HVX A;  1BYE A;  2H73 A;  1X9W B;  5CRW A;  2CT6 A;  4TXV A;  3TRX A;  3UEM A;  2HRK A;  1NSW A;  4ML6 A;  5G5F A;  2I4A A;  3C73 A;  1THX A;  5A5H A;  2FWE A;  5HR3 A;  3SWL A;  3D21 A;  5D96 A;  1JFU A;  3GTU A;  2JZT A;  1U3I A;  4K7I A;  2P0G A;  1BG5 A;  2VKZ G;  3KZQ A;  4HQS A;  1A0R P;  4EF0 A;  4ZXG A;  2L57 A;  1VF1 A;  4MPF A;  3QAV A;  2H1G A;  5EL8 A;  1B9X C;  3GYK A;  1SYR A;  4IJ3 A;  4V1A g;  2HSH A;  1USB A;  3BBY A;  4X4J A;  1Y1U A;  1GTB A;  1JHB A;  2LS5 A;  4QL7 A;  1YDK A;  4HEA 2;  4TN8 A;  2CX4 A;  2L6C A;  3CMI A;  4X0X A;  4EXJ A;  2IFQ B;  5DDL A;  1K0M A;  1VF4 A;  1G6W A;  1MDI A;  1HYU A;  1ZYE A;  2K8V A;  4CY8 A;  5CAX A;  3FYG A;  3QCP A;  1O85 A;  3EVI A;  1ZYQ B;  1PL2 A;  2VCX A;  3HJM A;  1PRX A;  2HSN B;  1XZO A;  2A4H A;  1XOB A;  4AJ7 A;  1EEM A;  5J4V A;  3APS A;  4IQA A;  4I97 A;  1GLQ A;  1K3O A;  3C7M A;  2XPD A;  1S3A A;  2M72 A;  2VM2 A;  2H30 A;  4IS0 A;  4K1F A;  1VGL A;  1SJZ A;  2K6V A;  1TOF A;  2AUV A;  3IRA A;  1T00 A;  1LJR A;  1ON4 A;  5A4U A;  4GSN A;  4GRF A;  2GSS A;  3DXB A;  2L59 A;  4ULX A;  2V2G A;  5LCZ A;  3UBL A;  4Q5F A;  3HZ8 A;  4G9H A;  3G7Y A;  3HVV A;  1TK0 B;  3ZLP A;  2MMO A;  1URM A;  4QMK A;  1K0B A;  3HA9 A;  4JR6 A;  4WKW A;  1WOU A;  5DBQ A;  2GST A;  1AAZ A;  3WGX A;  2C0F A;  3E9J B;  2K8S A;  1R5P A;  2O89 A;  4TW5 A;  3O6T A;  1MTC A;  4WEY A;  3ZIJ A;  4DVC A;  5A1N B;  4MP4 A;  2YOI A;  2HSY A;  1GUL A;  3UOM A;  3UVT A;  4ID0 A;  2LJA A;  1U88 A;  4V2N A;  1OAZ A;  3NZN A;  1QQ2 A;  3HDC A;  1F9M A;  4KND A;  2AB6 A;  3BCI A;  4EVM A;  2YNX A;  1YVL A;  2ALB A;  4POB A;  2LV3 A;  2N5A A;  4O32 A;  5IO2 A;  2XBQ A;  4MZW A;  5HR1 A;  1CQG A;  3FY7 A;  4MZB A;  2HE3 A;  1K0O A;  3FR6 A;  4PQ1 A;  4I2U A;  4JE1 A;  5JWR B;  2XC2 A;  1F2E A;  2LNT A;  5ECN B;  1J08 A;  4K2D A;  3Q18 A;  4P3Y B;  1MDK A;  2WJU A;  1U6T A;  2LUS A;  4WR4 A;  3EMX A;  2LJK A;  4JED A;  1DBY A;  1AQV A;  2IFQ A;  4MK3 A;  4L5O A;  4KDX A;  3EMP A;  2YZH A;  2EFC A;  2FY6 A;  4ZIJ A;  2PU9 C;  2NBS A;  4K8M A;  3CSI A;  3HVS A;  1XOA A;  4N11 A;  2GTU A;  3IHG A;  5J41 A;  3GMF A;  4E8E A;  4HQZ A;  3WYW A;  2IJY A;  3KD0 A;  2ZCT A;  1Z6M A;  2IME A;  2XPE A;  5IOX A;  5ECL B;  3KEB A;  3WGE A;  1GSY A;  3L9S A;  3RHB A;  5AIX A;  1EEJ A;  4KDY A;  2R3X A;  1XW9 A;  5CO3 A;  2OE0 A;  4Q5N A;  3FHK A;  5KN0 A;  1EOG A;  1T8E B;  1BX9 A;  2OKA A;  4FIW A;  1FVK A;  4IVF A;  3GX0 A;  5F05 A;  3VPT A;  3EE2 A;  1B48 A;  5DQS A;  4I6X A;  3A3T A;  17GS A;  1XXU A;  3US3 A;  3BJ5 A;  4G01 A;  3BOA A;  1GL8 A;  5G31 A;  1YF0 A;  4ZBA A;  3QOU A;  2HYX A;  3MAK A;  4V2M A;  4EDY A;  3A2V A;  5FHI A;  3APQ A;  1ZYP A;  5A1N A;  3UAP A;  2AJQ B;  3KM6 A;  2VL2 C;  3FZA A;  3HHV A;  4O5R A;  3C1S A;  4K6X A;  1ZMA A;  5EY6 A;  1K0N A;  1PGT A;  4NPB A;  4O5U A;  5G2Z A;  2GQL A;  4LLR A;  5JCG A;  2EFH A;  2X8H A;  5HFG A;  3TKS A;  1SKR B;  3VUR A;  18GS A;  2HRN A;  5ECO B;  5DAL B;  2HRF A;  1KEB A;  1SVO A;  4ZL9 A;  3F4S A;  1HD2 A;  1PD2 1;  2L6D A;  3KXO A;  3F3Q A;  3D4M A;  3IHQ A;  5IQY A;  1TKD B;  1G7O A;  1FOV A;  2VL2 A;  4TR0 A;  2KOK A;  1Z3E A;  2O8V B;  2B1K A;  2QSI A;  1GP1 A;  1YF1 A;  5DJM A;  1YJ6 A;  2CZ3 A;  2PMT A;  1U87 A;  4ZB6 A;  3BCK A;  4K5R A;  4N10 A;  1JZR A;  1X5D A;  2HZE B;  4IP1 A;  1UN2 A;  5J4U A;  2WCI A;  3VLN A;  4YH2 A;  1XWA A;  5DJL A;  4MCU A;  4GDF A;  1T1V A;  1GUH A;  2VOC A;  4AKG A;  3LOR A;  5KN2 A;  4ZL7 A;  2JAC A;  5FWG A;  2WFC A;  2D2Z A;  22GS A;  3LYP A;  1SD8 A;  3HCZ A;  1ZCP A;  1TI1 A;  2C0D A;  4KB3 A;  3KMN A;  1KTE A;  4W66 A;  3TDG A;  5ECM B;  3LGC A;  2L5O A;  1JZW A;  2UV8 G;  2H1L A;  1O7U A;  1QXH A;  16GS A;  1ILO A;  1GTU A;  4ILF A;  2GSQ A;  4KCE A;  2VCW A;  3LQ7 A;  2GQK A;  5CP1 A;  4MF7 A;  3EPT A;  4MNN A;  4FO5 A;  1DSB A;  1PMT A;  4RI6 A;  4OFM A;  1GTA A;  1PL1 A;  3FZ4 A;  4AGS A;  1MD4 A;  3QDN A;  2GDR A;  1R4W A;  3AY8 A;  2YWM A;  12GS A;  2HLS A;  2JSY A;  3F3R A;  3P2A A;  1TXU A;  2J23 A;  4L0W A;  1GSF A;  1EV9 A;  1YZX A;  4XHM A;  2QC7 A;  3VWW A;  1GSQ A;  4F82 A;  4MF5 A;  5G1L A;  2H1D A;  2KLX A;  1WRY A;  5KOX A;  3TOU A;  1I5G A;  5DQY A;  1F37 A;  4POL A;  4JZQ A;  4ML1 A;  4I2T A;  4XRA A;  3GX8 A;  4HOJ A;  2CA8 A;  3F6F A;  4PTS A;  4ECJ A;  2FNO A;  2C4J A;  2VLT A;  4HZ2 A;  5ECK B;  1HQO A;  5DAL A;  4L0U A;  5D9W A;  3ZVJ A;  4XTS A;  3LSZ A;  4HUA A;  4AKH A;  2A2P A;  1TRU A;  1A24 A;  3GKK A;  3GUR A;  2A4V A;  2DC5 A;  4Q5Q A;  6GSY A;  5J9B A;  3IK9 A;  2VIM A;  4MF6 A;  4BPY A;  3KH7 A;  3UAR A;  3M0F A;  2ES7 A;  6GSW A;  3L78 A;  2OAD A;  3J7Y b;  4MPG A;  2OBI A;  3SBC A;  1SEN A;  4GF0 A;  4K0G A;  1O73 A;  2HZE A;  3F4R A;  2A2R A;  3UMA A;  2LQO A;  1XBS A;  5D9V A;  5GAN D;  1GRX A;  2G0F A;  4XRD A;  1TRW A;  4PUF C;  4OO5 A;  2O5V A;  3F0I A;  2V6K A;  2VLV A;  2AAW A;  2H0G A;  3WT2 A;  3LXZ A;  4F0B A;  3RPN A;  5J40 A;  3FMW A;  4LA1 A;  4MH2 A;  1F3A A;  3E0U A;  1QMV A;  1AQX A;  2CAQ A;  1FAA A;  2X99 A;  5COH A;  1N8J A;  3KCM A;  2A2S A;  3L9U A;  3EU3 A;  2C80 A;  1O81 A;  2V41 A;  1B9Y C;  2LEG A;  4G0L A;  3WT1 A;  3KP8 A;  2C8U A;  4LMV A;  3HMJ G;  2FA4 A;  3GKX A;  3R3E A;  1BED A;  4ECB A;  2DJ2 A;  1A8L A;  2FLS A;  5CRG A;  2H75 A;  2K18 A;  3CWG A;  1J0F A;  5IMA A;  3LJR A;  1I9D A;  5DAK B;  5ECP B;  4YAP A;  2F8F A;  4QQ7 A;  1A2M A;  1TU8 A;  2VO4 A;  3G7I A;  3G7J A;  2FUG 2;  4YAV A;  4HDE A;  3GH6 A;  4USS A;  11GS A;  3TUE A;  1UA5 A;  3ERF A;  4HJ2 A;  2GZY A;  4NAX A;  1WPI A;  1K0D A;  2C0E A;  1X9M B;  2VD0 A;  1T4Y A;  4IN0 A;  4L5L A;  4PUA A;  1GH2 A;  4WR5 A;  3H4K A;  4GCI A;  2YWI A;  2LJR A;  5IIZ A;  3ZFL A;  2BJX A;  4BA7 A;  1WWJ A;  3KP9 A;  5GZZ B;  2CAI A;  2H0H A;  2VUP A;  2EIR A;  2H0I A;  1Y25 A;  5IMZ A;  3QD9 A;  1OKD A;  3A2W A;  2I3Y A;  1EWX A;  1S3D A;  3GA4 A;  2H01 A;  1KBN A;  5G30 A;  3FKF A;  2BTO T;  4FYC A;  1GSS A;  4WXT A;  4QL9 A;  5CRH A;  1SK1 A;  2GT6 A;  1BQ7 A;  2MYG A;  1JZD A;  1M7T A;  5KOW A;  14GS A;  2X49 A;  4ECI A;  3RBT A;  2LTK A;  2X4A A;  5H5Q A;  3IAM 2;  5CYY A;  4G2E A;  2I81 A;  2X64 A;  3DYR A;  3TU3 B;  2GGT A;  5INY A;  3OR5 A;  4TR1 B;  4XS6 A;  1OC8 A;  2CZ2 A;  2R2J A;  1F6M C;  5A34 B;  1TXX A;  4CW9 A;  1TRS A;  2IMI A;  1M2D A;  3HZ4 A;  3GN3 A;  5IM9 A;  5B6N A;  1O6J A;  1N25 A;  2DJ1 A;  2PN8 A;  3EYT A;  2HSM A;  1PX6 A;  2R0G A;  2PUK C;  4KSO A;  1KNG A;  1ZOF A;  4CHS A;  5E4W A;  6GSU A;  5J9C A;  5ECH B;  1A2J A;  4V2L A;  1TK5 B;  1ERT A;  3GFK A;  2WDU A;  1YY7 A;  2LRT A;  3DD3 A;  1J9B A;  3IC8 A;  2R6K A;  1EP7 A;  1SL2 B;  4WF4 A;  3UVH A;  3TJJ A;  5G5E A;  5L71 A;  2TRX A;  2IIY A;  2FWH A;  3FEU A;  1YEX A;  1V58 A;  2YV7 A;  2MBT A;  1PSQ A;  2WUL A;  2VAF A;  3FZ5 A;  2L4Q A;  3I9V 2;  5DAK A;  2Z9S A;  4EO3 A;  2ZUP A;  2XHF A;  2YJH A;  4HS1 A;  4EL1 A;  1K0A A;  1DE1 A;  6GSX A;  2C3Q A;  5ECI B;  2VL9 A;  5FT3 A;  1TP9 A;  4POM A;  1NW2 A;  4F03 A;  4KSM A;  6GSS A;  3F6D A;  2B1L A;  4OD7 A;  1PN0 A;  1WIK A;  5IMF A;  2HXK A;  2KUC A;  1M2B A;  1RK4 A;  1G0T A;  3E3E A;  5ABR A;  3GUS A;  1NHO A;  1SVL A;  2E2G A;  2I1U A;  2VCZ A;  1PA3 A;  3ZMK A;  1TDI A;  4K2X A;  3LG6 A;  2OAC A;  1U3A A;  4O92 A;  1FB6 A;  3PPU A;  4JU5 A;  1OE8 A;  2F9S A;  13GS A;  6GSV A;  4WF5 A;  4YKG A;  4OFT A;  3H79 A;  3C71 A;  20GS A;  3DKS A;  3TJK A;  3MSZ A;  5GAP D;  3DRN A;  2RM5 A;  4L8E A;  3L9V A;  1AIU A;  5HFK A;  5H5R A;  1PKW A;  3W6G A;  2L5L A;  5ELA A;  1K3L A;  4G19 A;  2B6M A;  3CBU A;  2REM A;  1OYJ A;  2KHP A;  2EIQ A;  9GSS A;  4H86 A;  4TR1 A;  3WGD A;  2MMN A;  5GST A;  3ZIV A;  3VI5 A;  5A34 A;  3C1R A;  1TJD A;  3CSJ A;  2B7J A;  1TTZ A;  2H72 A;  2DIZ A;  1CQH A;  1QGV A;  3VWU A;  1FHE A;  3TKS C;  3O76 A;  4Z2T A;  4PQH A;  4NHW A;  5IOW A;  4X43 A;  3TKQ A;  4MJB A;  2EFE A;  1V40 A;  4TRX A;  2KP2 A;  3IA1 A;  3A5I A;  5BMU B;  2DJ3 A;  1FG4 A;  4EC0 A;  1E2Y A;  2VM1 A;  4XS1 A;  3UL3 A;  2CVB A;  4RQR A;  4J2F A;  4MJE A;  3A2X A;  2F3M A;  3D22 A;  2NDO A;  2ON7 A;  3PH9 A;  4EUY A;  3M9J A;  4F0C A;  1SD9 A;  3TRQ A;  3LXT A;  1TU7 A;  4MAB A;  5KN1 A;  3TOT A;  5GSS A;  1HNB A;  1S3C A;  2K9F A;  1FOH A;  3VWV A;  5HR0 A;  3CRU A;  1B4Q A;  2YWO A;  2PBJ A;  7GSS A;  3R2Q A;  4KF9 A;  1WMJ A;  2DBC A;  5HQP A;  1Q98 A;  1TK8 B;  2GZZ A;  3W8J A;  4GTU A;  2H76 A;  3J7Y k;  3F63 A;  2B7K A;  3KTB A;  1ST9 A;  2WB9 A;  3PIN A;  2G2Q A;  5C04 A;  5B8A A;  4G0K A;  1RQM A;  4WBR D;  5B7C A;  3DEX A;  2YJ7 A;  4PUR A;  4RUV A;  2DJJ A;  5E59 A;  5J4Y A;  4K9Z A;  3LYK A;  2FCH A;  2HT9 A;  5ID2 B;  1M2A A;  5A5K A;  4WBJ A;  4YQV A;  2HZF A;  2H1A A;  5D73 A;  1JZO A;  3VK9 A;  2GVP A;  2ON5 A;  3ZFB A;  4O5Q A;  1GSD A;  4J56 E;  4BL7 B;  2E2M A;  2YAN A;  2PWJ A;  1X9S B;  1Z7R A;  4FH8 A;  3A5W A;  4EIP A;  4A5P A;  2PGT A;  4POK A;  2NTO A;  4NV5 A;  4N0Z A;  1DE2 A;  1TW9 A;  1GNW A;  2JL4 A;  2JZR A;  4KCA A;  4HU9 A;  5F07 A;  3TJB A;  1ACV A;  2HQT A;  1T4Z A;  1V9W A;  2WZ9 A;  4IGJ A;  1V98 A;  1OC9 B;  4GQC A;  2FD3 A;  1OVN A;  5BMU A;  2R0P A;  2M80 A;  2OE1 A;  3IBH A;  3MNG A;  3ME8 A;  4EE0 A;  2DIY A;  3EU4 A;  3F9U A;  3GH9 A;  2LST A;  4LMW A;  1ERW A;  4YKF A;  5JCW A;  1SKS B;  3QPM A;  3Q6O A;  2B3S A;  2B5Y A;  4EKZ A;  5CRE A;  4IJI A;  5F0G A;  3V1W A;  4TVE A;  5J3R A;  4XIH A;  1M9A A;  2R5G A;  5F06 A;  5AIS A;  4E8H A;  1SK0 A;  4K5S A;  2RUF A;  2PVQ A;  3N5O A;  3ZRD A;  4XCS A;  3FR9 A;  5ECR B;  4I8B A;  2PVO C;  2GQM A;  2RLI A;  5C00 A;  3TCO A;  3RAZ A;  1JLW A;  3HJP A;  1BAY A;  3DVX A;  1VF2 A;  2H66 A;  1V2A A;  4AJ8 A;  5KEJ A;  5JWO B;  1SU9 A;  2TRC P;  3ERG A;  3KTL A;  3W8S A;  3GL3 A;  4ECC A;  1NHY A;  1X5E A;  3RHC A;  4X1U A;  1G6Y A;  2AYT A;  3TGZ A;  1ML6 A;  4LL4 B;  3TJG A;  4FYU A;  3ZL5 A;  2MMA A;  4NMU A;  1FO5 A;  2YP6 A;  2P5R A;  2QA1 A;  4IEL A;  1VF3 A;  5A4V A;  4BVX A;  1T3B A;  2JZS A;  8GSS A;  3GNJ A;  4TR4 A;  2VD1 A;  5ID2 A;  4BVY B;  3TKP A;  2N5B A;  1O8W A;  2X8G A;  2EIO A;  4KAE A;  3H93 A;  1BG1 A;  4Z2U A;  2OE3 A;  2HSM B;  3EUR A;  1SJI A;  2C1Y A;  1B8X A;  3HY2 A;  4BL7 A;  5EPF A;  3QAW A;  2H6X A;  1XFL A;  5ECQ B;  2AHE A;  1M99 A;  1PQN A;  3LFL A;  3G9B A;  4LL1 B;  1BJX A;  2DML A;  4AKI A;  1X0R A;  1A23 A;  4RI7 A;  4HU7 A;  4HI7 A;  1OC9 A;  1XVW A;  4PGT A;  2FA8 A;  4K0N A;  4ZIL A;  4F2I A;  4IKH A;  3JCM L;  4TKY A;  5A4W A;  6GST A;  2C3T A;  3M9K A;  2HI7 A;  4JBB A;  1H4O A;  3KMO A;  5CNW A;  5AN1 A;  3P8W A;  2DJ0 A;  4YQM A;  4CDO A;  2F51 A;  4IP6 A;  3U6V A;  1SYX A;  1ERU A;  1B4P A;  3QFA C;  3L0H A;  2DKH A;  2RUE A;  1K3Y A;  3VWX A;  4ISD A;  4ZBB A;  3ZML A;  4GQF A;  1YKC A;  2LRN A;  3QMX A;  2I9H A;  3BD2 A;  3GKM A;  3P7X A;  2MMZ A;  4NXI A;  3TKR A;  4FYB A;  3MIX A;  2H8L A;  4Z2R A;  5ECS A;  3O3T A;  1SVM A;  3IDV A;  4EDZ A;  5HR2 A;  3GL5 A;  3ED3 A;  4XS4 B;  1AXD A;  3M1G A;  4J57 E;  3M3M A;  1Y6E A;  1R5A A;  3UBK A;  3IAS 2;  3HKR A;  3RDW A;  2VCT A;  4V1A p;  5IMD A;  3FK8 A;  1A2L A;  5J47 A;  2H6Z A;  5LD0 A;  1PN9 A;  1PKZ A;  5B6M A;  4BVY A;  1R26 A;  1QFN A;  4JRR A;  4PQI A;  4MDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...