1EOGA

Crystal structure of pi class glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQIAFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of thermolabile mutants of human glutathione transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1eogA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eogA01
3TOTA 2XBIA 2OE1A 1XVWA 1F3BA 2X8HA 1AIUA 3UMAA 5HFIA 3GTUA 3L4NA 3CBUA 2CT6A 3HVVA 4HZ4A 1GP1A 4HU9A 4ZL8A 2CA8A 1PN9A 13GSA 1AUCA 1YDKA 2LNSA 4HS1A 2H01A 3KTBA 1S3AA 3LQ7A 3FK8A 4FYBA 2LNTA 2IMDA 1XW6A 1I5GA 4MF5A 2MMAA 1YF1A 2VM2A 4IVFA 3IK9A 4GQFA 3TB2A 4G0IA 2VIMA 3L78A 4MF7A 5JCWA 1J0FA 3O6TA 3IOSA 5DQYA 1JZOA 2MMZA 2UZ8A 3PPUA 4OO5A 1E6BA 2FCHA 2OE0A 4KDUA 3BCIA 1K0MA 2AHEA 3HKRA 4G0LA 4I2TA 2CVBA 3HJMA 5E4WA 2IMEA 3RHBA 1NM3A 5J5NA 1C72A 1UA5A 2HNLA 4PQ1A 3CTFA 3QD9A 4WF4A 3ZREA 1A24A 4ILFA 4HOJA 2VLTA 3F4SA 3TJJA 1QMVA 3A2XA 1M0UA 4XS1A 4GSNA 4FYUA 4YH2A 3EU4A 1F3AA 1I9DA 5DCGA 3A2WA 1OC9A 1GLPA 5DJLA 4BL7B 3Q74A 6GSVA 1V9WA 4K0GA 4KCEA 3FR3A 5IMZA 3LJRA 3WYWA 2V6OA 4XRDA 1U87A 3C8EA 1A23A 4TOPA 1SL1B 1SJIA 1WIKA 3H79A 1DBYA 3HVXA 2EC4A 1MDIA 3M1GA 3PH9A 1MTCA 3L9VA 3ZFBA 2O7KA 4JRRA 4O7HA 1THXA 2HSMA 1TRWA 2MBTA 4BVXA 4ECBA 1GNWA 2LSTA 1K0NA 4KSOA 3IXRA 5HR3A 3QOUA 2L6CA 1SJZA 2WULA 4JE1A 2NPBA 4PURA 3FYGA 3D5JA 1K0OA 2GQMA 4G9HA 4F03A 2C0FA 1SK0A 1LJRA 1EP8A 1JZDA 3HZ4A 2KHPA 1GSQA 5H5RA 2JACA 5G5FA 1A2LA 4I2UA 2LRNA 1PD21 2N5FA 5ELAA 3IAM2 5JCUA 2WZ9A 4KDYA 2HZEB 3CSIA 1TK5B 1JLVA 4G10A 5L71A 5A4UA 2MMNA 3TRXA 2IIYA 3C73A 2JSZA 5ELGA 3CXGA 2K18A 2FA4A 5DAKA 3NIVA 1O6JA 5IPHA 3QAVA 2K8SA 3U5RE 1YKAA 4AGSA 1HQOA 3KP8A 6GSTA 5ABRA 2LJKA 2J23A 5HFKA 3V1WA 2YJ7A 3QFAC 2CV4A 3VWVA 3TKPA 4O5RA 1X9MB 4HJMA 3RHCA 2FWGA 4WEYA 2QKEA 1TTZA 2X8CA 4LLRA 4XS6A 5IMFA 1OE8A 4V2LA 5ECNB 5CRHA 5IIZA 4HQZA 4V1Ap 2VL2C 1K0DA 2CX4A 5ECQB 2FWEA 4FH8A 2IMKA 1Z9HA 4FQUA 1SYRA 4ZL7A 5D73A 5CRGA 1GSDA 2R5GA 4HDEA 1ZGNA 3RDWA 2VD1A 1BX9A 3DD3A 1O7UA 3WT1A 5GAND 2GDRA 4ID0A 1ERUA 1O81A 2GT6A 1ML6A 1XW9A 4IW9A 2VL9A 5ECOB 2DC5A 3GYKA 3TJFA 2C8UA 4KDXA 5EL8A 2HYXA 5B8BA 5B7CA 2FGXA 1Z7RA 3ME7A 1TU8A 2HSNB 4MZWA 5HR2A 2H6XA 2H8LA 2B5XA 2OBIA 3MAKA 2FWHA 3VK9A 3E3EA 1T1VA 2MBSA 3CSJA 2YCDA 2RUFA 3L0HA 14GSA 2E2GA 4PUAA 3APQA 3H8QA 2XPEA 4XS4B 2HRKB 4EDZA 1TK0B 3F0IA 3EWLA 1Z6MA 1QFNA 4MH3A 3IBHA 2BMXA 3ME8A 2J9HA 5G31A 1H4OA 2GSQA 1B4QA 2H1BA 12GSA 3HDCA 3FR9A 1GULA 4KA0A 2JU5A 1MDJA 1EGOA 4Q5RA 2AAWA 4LMVA 5FT3A 2EIOA 2KLXA 4MF6A 1R4WA 10GSA 4L5LA 3Q19A 1XW5A 5EPFA 3FZ5A 5DQSA 3VPTA 3O76A 3GN3A 3MDKA 2CZ3A 5DALA 3TOUA 5KN1A 3N9JA 3ZVJA 4F9ZA 2BJXA 2YP6A 4TXOA 4HJ2A 4V2MA 4ZILA 3FR6A 5C04A 3UBKA 2R3XA 2O89A 4I6XA 1G7OA 4K7IA 1YJ6A 5DBQA 2X8GA 3UAPA 3GHAA 5EY6A 1KNGA 3DGQA 2C0EA 4MCUA 1SKWB 2WDUA 2A4VA 2HFDA 2R2JA 5IMAA 1M99A 4ZL9A 3S9FA 2GT5A 4QL7A 3LFLA 3M9JA 1XCCA 1XIYA 2GQLA 2GZPA 3GUSA 1EEMA 1ZYEA 4K8MA 3UEMA 1PL1A 2F8FA 3C1SA 1XBSA 2YWMA 3APSA 2IPAA 5H5SA 3ZMKA 1XWAA 1M9AA 4KSMA 2H0GA 3NOFA 3I69A 3ED3A 4XRAA 2OKAA 2VUPA 5C00A 2WRTA 4H86A 2B5EA 2LUSA 1Z6NA 3R2QA 1GSEA 2DJKA 5CP1A 2X64A 3DWVA 2LTKA 4AJ8A 5A4VA 4ISDA 1B4PA 1YEXA 4TKYA 3GMFA 1MDKA 1Y6EA 3ZIJA 3LWAA 3ZVJD 4E8EA 2NDOA 2JZRA 5ECRB 3BJ5A 3EC3A 3TDGA 1Z3EA 4MPGA 4N0VA 3O3TA 2DLXA 2AV4A 1GH2A 4EF0A 1SD9A 1M2DA 4PQIA 5A5KA 2IMFA 3GL3A 2VCQA 2L4CA 4PX1A 5B6NA 1SENA 4KAEA 4ZBBA 4V2NA 5DDLA 3ERGA 3APOA 3D6IA 2AUVA 3NZNA 2C3TA 4YQUA 3QPMA 4I97A 2LS5A 3VWWA 4MJCA 3HVSA 2YZUA 3W8JA 2AJQB 1JLWA 4BVYA 2TRCP 5JWQB 4CW9A 2GVPA 4K2DA 1R5PA 2ZUPA 1XXUA 1U88A 3CRTA 2KUCA 4DSSB 3TJBA 4JBBA 2CVKA 1BJXA 4ZBDA 3SWLA 1GTAA 4L8EA 2A2SA 5IM9A 4NPBA 2CVDA 4X1UA 1B48A 2IFQA 3GH9A 1SD8A 4RUVA 2RUEA 2V6KA 3TKRA 4F82A 2O87A 1R5AA 1SK1A 4MJAA 2OA7A 2GTUA 3WGEA 2AB6A 2B7JA 3GX0A 3M0FA 22GSA 3LYPA 5KEJA 3K8NA 3EE2A 4IQAA 4MZCA 4YQVA 1YEPA 1B8XA 1F9MA 1TJDA 1ABAA 4TR4A 5E59A 1OAZA 3IC8A 3VWXA 4GF0A 3OR5A 4G2EA 4MABA 1TK8B 1TI3A 1X9WB 4IELA 1O73A 1HYUA 1F37A 1JZRA 4ZBAA 3WD6A 4N10A 3VURA 5HR1A 2E2MA 4KCAA 4TR0A 2DIYA 4KX4A 2IL3A 4J2FA 2VOCA 5H5QA 1J08A 2V32A 2JSYA 2C3QA 2NVLA 2YV9A 3GSTA 3WGDA 4JZQA 4RI7A 4OFNA 2RIIA 1NSWA 2PUKC 4WR5A 1TKDB 1FHEA 3IR4A 5G2ZA 2VCWA 1M2AA 1OC9B 4ML6A 4O92A 5ID2A 3C71A 4K1FA 4K9ZA 5KN0A 1F2EA 1GSUA 2G0FA 1G6WA 2YWIA 1GSSA 2VLVA 1XWCA 3FRCA 1FAAA 5G1LA 5J41A 4IKHA 4N0ZA 2P5RA 2GS3A 1U3IA 4MMMA 8GSSA 2CAIA 3BBYA 1OYJA 2H1GA 3KJYA 1XZOA 3GNJA 1OC8A 4J57E 1DSBA 2JZTA 2OE3A 3KGKA 2LKUA 5A4WA 2N5AA 5IO2A 4MLYA 4KB3A 2CAQA 3DYRA 1X5DA 1X9SB 3H4KA 2PPTA 3VLNA 3KH7A 4TN8A 3ZRDA 1GSFA 1A2MA 5F06A 1MEKA 2XC2A 2HLSA 2I3YA 3US3A 1LU4A 5INYA 5CAXA 2RM5A 2YOIA 4NHWA 1S3DA 2PBJA 6GSUA 1ERTA 3FZ4A 3F6DA 1XFLA 2GZZA 1Z5YE 4PUFC 1OE7A 1TOFA 3KMNA 1VGLA 2OACA 3Q6OA 5LNKe 4KUNA 4Q5NA 1WMJA 1A8YA 1RW1A 4I5QA 2L59A 3I6AA 5ECPB 5GZZB 4EL1A 1J9BA 2FUG2 2C3NA 3BD2A 3A2VA 2HE3A 2IN3A 2HZEA 2HSYA 4POKA 2C4JA 5LD0A 4Q5FA 1EWXA 19GSA 1WWJA 5CRDA 1WOUA 4WXTA 3CMIA 3DVXA 1PL2A 4J56E 4FIWA 2NBSA 2KOKA 2CZ2A 1W89A 2N5BA 1PKZA 4AJ7A 5DCHA 1JHBA 3IPZA 3VI5A 3GIXA 2L6DA 4PXOA 4EE0A 3VWUA 1YZXA 1DE2A 1QXHA 1SK2A 3DRNA 1FB0A 1BG5A 1BQ7A 2FY6A 1FG4A 2WS2A 2GQKA 3H1NA 4D73B 1HNCA 3UJ1A 4X0XA 3SBCA 3HD5A 3EURA 1UN2A 1VF3A 1V58A 1GTUA 2V1MA 3J7Yb 2X99A 4AJ6A 1FO5A 4EKZA 1OC3A 3J7Yk 4TVEA 4IBPA 3EMPA 1SJ6A 2H0HA 11GSA 6GSWA 2DJ3A 4LA1A 4TR3A 3F6FA 1HD2A 3LEFA 3BOAA 1K3YA 3MNGA 4HZ2A 2QGVA 1S3CA 1G0TA 1T3BA 2B3SA 2H1DA 2VM1A 3H93A 1SKRB 1AQWA 1GWCA 4F0BA 3CYNA 3UVHA 1PRXA 1T4YA 2XPDA 1O8WA 3DEXA 4JR4A 1O8XA 3KD0A 2HRNA 4LMWA 3F8UA 4P3YB 1YQ1A 4DSQA 3EMXA 2C0GA 2TRXA 3PINA 2OJLA 4RQXA 4ZB9A 1ZMAA 2V41A 3A5WA 4GSTA 1JFUA 1YF0A 2RM6A 2YJHA 2HRKA 1OKTA 4EO3A 1FVJA 3ZYWA 5EVOA 4WETA 1Z7PA 3KM6A 2MYGA 2VAFA 3D4MA 9GSSA 4POBA 2LJAA 5B8AA 3R3EA 4G19A 3M3MA 3F9UA 1FB6A 1QUWA 3GKKA 4MZBA 4KF9A 2I81A 2HXKA 1IYHA 3RPNA 1SU9A 2IWTA 1AXDA 4TXOB 1VF2A 1ST9A 2LRCA 3D22A 5HQPA 2YWOA 2HSHA 1XVQA 4X43A 4LL1B 2PGTA 3D21A 1YY7A 4XTSA 3WGXA 1U6TA 2I1UA 4JEDA 4L0UA 2ON5A 1AQXA 4BPYA 2NTOA 3KCMA 3GSSA 2VLUA 5G30A 2VCXA 1XWGA 1G6YA 2LJRA 1GNEA 1WE0A 1A8LA 4HU7A 3W6GA 3ZZXA 1NW2A 2RLIA 2H0IA 2L4QA 2FHEA 3FW2A 4EXJA 5CREA 5GSTA 1T4ZA 3PR8A 2H30A 5AIVA 1PGTA 3TUEA 4HQSA 4GWRA 1ZZYA 2H73A 1Y25A 3HJPA 1THOA 4OCEA 2GZYA 2DSAA 3P8WA 3GX8A 3QDNA 3ERFA 2YV7A 2PN8A 1TP9A 1KEBA 1TRSA 2HT9A 2YNXA 3FKFA 2F51A 2ZCTA 3C1RA 5ENUA 1V40A 1GRXA 4BA7A 3FY7A 1A0FA 4RI6A 1RQMA 1CQHA 4IP1A 2YWNA 5J9CA 3GKNA 4ML1A 2DBCA 5ECMB 1FVKA 3ZIVA 2O8VB 1WRYA 1EGRA 2HZFA 3LORA 1RK4A 4NV5A 5D9TA 4KW6A 5JWOB 2VCVA 3IA1A 4POMA 1AAZA 5HFGA 1ERWA 3IDVA 3KP9A 2WB9A 3UBLA 3KEBA 4EDYA 5IO0A 1IYIA 3KIJA 3DMLA 3W8SA 3E9JB 5ECKB 4KH7A 3ZL5A 3N5OA 1TRVA 18GSA 5ECSA 3LXZA 4K6XA 4HUAA 4OWYA 5D96A 4HEA2 2ES7A 4TR1A 5IMVA 3FHKA 4LL4B 3TKSC 4OFTA 1ZCPA 2DJ0A 5AIXA 2DJ2A 2H76A 1V2AA 1VF4A 3M9KA 2YANA 2H66A 2GLRA 3GTUB 4K0NA 2A2RA 3TKSE 3Q18A 4E8HA 1TU7A 2H19A 4GLTA 2H1AA 3BCKA 3GL5A 2C80A 4I8BA 3LG6A 4TXVA 4WR4A 1ZL9A 4GCIA 1Q98A 1AW9A 2F8AA 2M80A 1K0BA 2IFQB 5CYYA 4DEJA 1EP7A 2HI7A 2FA8A 4DSSA 3QAWA 2PMTA 1DUGA 3F4TA 1WJKA 1M7TA 1WPIA 4MP4A 2OADA 2KP2A 3ZMLA 1B9XC 4V1Ag 2PWJA 2B7KA 2LRTA 3GKXA 1R26A 2OBKA 3PGTA 2WJUA 4OCFA 1M9BA 3LXTA 1U3AA 1UC7A 4ZXGA 3HA9A 4OD7A 3EINA 1PX6A 1GUHA 4FYCA 4PTSA 4IJ3A 4OFMA 1TXXA 2BTOT 3TJKA 3GA4A 2R4VA 5IPGA 3HZ8A 4IS0A 3E0UA 3GFKA 5CO3A 1N8JA 2E7PA 2REMA 5F07A 3RPPA 4NAXA 1TW9A 1PQNA 1X0RA 1BYEA 1PSQA 1Q4JA 2B1KA 2FWFA 3TGZA 3G7JA 4USSA 2K8VA 1X5CA 3ZFLA 4Z7XA 2TIRA 1SL0B 5ECLB 2B1LA 2WFCA 1EOGA 3GH6A 2GSTA 3GV1A 2C0DA 3DKSA 2PVOC 2H70A 1K3OA 2WCIA 6GSYA 1K0AA 5ID2B 3I9V2 1GUMA 2HRFA 3G7IA 3F63A 4NXIA 2AYTA 3KH9A 4XCSA 3FEUA 4GSSA 3DIEA 5J3RA 1GTBA 1H75A 1JZWA 3EYTA 1DE1A 2QSIA 2DMMA 2CQ9A 4BL7A 3LGCA 3TRPA 4G0KA 4QQ7A 4MDCA 4DVCA 1KTEA 7GSSA 3HJOA 3IE3A 4NHZA 1HNAA 20GSA 4KE3A 2C1YA 3IRAA 2HSMB 3UVTA 3ISOA 1B9YC 4BVXB 3IV4A 4N11A 5AN1A 3P2AA 4XIHA 1ACVA 2L5LA 3IK7A 5AGYA 4EUYA 2H6YA 1USBA 1GLQA 1UVZA 2IMIA 3IC4A 3LYKA 4BWSA 4K7OA 3ERWA 4MK3A 1HNBA 1SL2B 3UL3A 1F6MC 3TKSA 3D4TA 2GSSA 3ZTLA 3HXSA 3D0ZA 1AC1A 4TW5A 2ON7A 1BEDA 5IQYA 3FZAA 3QAGA 1OKDA 3P90A 4JU5A 4NMUA 5D8IA 1GSYA 2VD0A 3C7MA 5DAKB 3GRXA 4YAVA 4WBRD 2K6VA 5B6MA 1QGVA 1YKCA 1K3LA 1VF1A 1TDIA 2DIZA 1QQ2A 2WGRA 5ECIB 1ILOA 1PA3A 3GURA 1OVNA 1V98A 1NHYA 2K9FA 4CHSA 1CQGA 2PU9C 4BWQA 3RAZA 3G7YA 3QCPA 3RBTA 2YPMA 5JWRB 1G7EA 1SKSB 1FOVA 4L5OA 6GSXA 1TRUA 2O85A 3UIWA 2FNOA 5BMUA 3ZLPA 1EOHA 3MSZA 6GSSA 2YN1A 4GXZA 3G9BA 4IP6A 2FD3A 2F3MA 3QMXA 5JCGA 2IJYA 4XHMA 4DSRA 1SYXA 4D73A 3EVIA 4IJIA 2P0GA 2JZSA 1EV9A 4MPFA 2GGTA 2H74A 4MH2A 5D9VA 1VRSD 1XWBA 5IMCA 1T00A 4ECCA 3CTGA 4OMVA 2ZNMA 3TCOA 4GTUA 1T8EB 1URMA 3L9SA 1NHOA 4F2IA 3IHQA 3JCML 3EU3A 1R7HA 1E2YA 4PQHA 2Z9SA 2V2GA 4NWYA 1EZKA 1PKWA 4GRFA 4IN0A 3FZ9A 4POLA 2LQQA 2XBQA 2B6MA 1EV4A 2MMOA 2G2QA 3WT2A 4CDOA 2F9SA 1GUKA 1V57A 5CRWA 4IQ1A 1A0RP 4ZB6A 1A2JA 1TI1A 2DMLA 3HCZA 4JR6A 4XS4A 2PERA 4WF5A 1KBNA 3CRUA 1MD4A 3TJGA 5IOXA 2MZCA 3DVWA 3HHVA 2H75A 2M46A 4YAPA 2PVQA 3AY8A 2I4AA 5DJMA 1XOAA 5J9BA 4ACSA 3ZITA 2E0QA 1XOBA 1GTIA 5DVBA 3UOMA 5DALB 2P5QA 2D2ZA 2VO4A 5HR0A 2I9HA 5CNWA 5IMDA 3VI7A 3TKQA 1WP0A 1M2BA 2H72A 2DJJA 3UARA 4MJBA 1N2AA 2R37A 2LQOA 2YZHA 4EC0A 1ZOFA 5KN3A 4QL9A 5D9XA 1BAYA 5GSSA 4NV2A 3L9UA 1PX7A 17GSA 2EIQA 3HYPA 1ERVA 4F0CA 4WKWA 5GAPD 4MA9A 5D9WA 4ECJA 3CSHA 4FO5A 2FLSA 3M8NA 3F3RA 1GL8A 2VCTA 1MD3A 5G1KA 2HQTA 5F0GA 3F4RA 4GQCA 2L5OA 3LSZA 1O85A 4EVMA 4Q5QA 3VPQA 2JL4A 4N30A 3KTLA 4L0WA 4PGTA 5COHA 2M72A 3QFBC 4K7NA 2B5YA 1QK8A 3MWHA 2VL3A 2VL2A 4IHUA 3KXOA 3I43A 3U6VA 4TRXA 1K0CA 4RQRA 2ALBA 5FWGA 4O32A 5AISA 5FHIA 2QC7A 3IAS2 1PMTA 2XHFA 1AQVA 2LV3A 2VCZA 4PNFA 2CX3A 5IOWA 4KGIA 2L57A 4OO4A 1ON4A 2JADA 5LCZA 4ECIA 4MJEA 4ZIJA 2R6KA 3KMOA 3F3QA 4WBJA 1XPVA 3TRQA 3VFIA 5G5EA 5F05A 4AF2A 1W4VA 2HRAA 1X5EA 3HY2A 3DXBA 2KP1A 1LBKA 4HI7A 1FW1A 3QR6A 1XWKA 4ULXA 3A3TA 3GKMA 5D93A 2GSRA 5KN2A 3P7XA 4ZB8A 3KZQA 4TR1B 2LEGA 5F8BA 2H6ZA 5J4UA 4KNDA 4PNGA 4YQMA 2EIRA 1T7PB 4BVYB 1EEJA 4IGJA 5ECHB 16GSA 2H71A 2P31A 1ZYQB 2DJ1A
chains in the Genus database with same CATH superfamily
3TOTA 2XBIA 2OE1A 1XVWA 1F3BA 2X8HA 1AIUA 3UMAA 5HFIA 3GTUA 3L4NA 3CBUA 2CT6A 4Z2UA 3HVVA 4HZ4A 1GP1A 4HU9A 2DKIA 4ZL8A 2CA8A 1PN9A 13GSA 1AUCA 1YDKA 2LNSA 4HS1A 2H01A 3KTBA 1S3AA 3LQ7A 3FK8A 4FYBA 2LNTA 2IMDA 4K5RA 1XW6A 1I5GA 4MF5A 2MMAA 1YF1A 2VM2A 4IVFA 3IK9A 4GQFA 3TB2A 4G0IA 2VIMA 3L78A 4PI2C 4MF7A 5JCWA 1J0FA 3O6TA 3IOSA 5DQYA 2QA2A 1JZOA 2MMZA 2UZ8A 3PPUA 4OO5A 5J4VA 1E6BA 2FCHA 2OE0A 4KDUA 3BCIA 1K0MA 2AHEA 3HKRA 4G0LA 4I2TA 2CVBA 3HJMA 5E4WA 2IMEA 3RHBA 1NM3A 5J5NA 1C72A 2WW2A 1UA5A 2HNLA 4PQ1A 3CTFA 3QD9A 4WF4A 3ZREA 3LW9A 1A24A 4ILFA 4HOJA 1PFOA 2VLTA 2EFHA 3F4SA 3TJJA 1QMVA 3A2XA 3IHGA 1M0UA 4XS1A 4GSNA 4FYUA 4YH2A 3EU4A 1F3AA 1I9DA 5DCGA 3A2WA 1OC9A 1GLPA 5DJLA 4BL7B 3Q74A 6GSVA 1V9WA 4K0GA 4KCEA 4O5QA 3FR3A 5IMZA 3LJRA 3WYWA 2V6OA 4XRDA 1U87A 3C8EA 1A23A 4TOPA 1SL1B 1SJIA 4HSCX 1WIKA 3H79A 1DBYA 3HVXA 2EC4A 1MDIA 3M1GA 2OT3A 3PH9A 1PN0A 1MTCA 3L9VA 3ZFBA 4YKFA 2O7KA 4JRRA 4O7HA 1THXA 2HSMA 1TRWA 2MBTA 4X4JA 4BVXA 4ECBA 1GNWA 2LSTA 1K0NA 4KSOA 3IXRA 4CY8A 5HR3A 3QOUA 2L6CA 1SJZA 2WULA 4JE1A 2NPBA 4PURA 3FYGA 3D5JA 1K0OA 2GQMA 4G9HA 4F03A 2C0FA 1SK0A 1LJRA 1EP8A 1JZDA 3HZ4A 2KHPA 1GSQA 5H5RA 2JACA 5G5FA 1A2LA 4I2UA 2LRNA 1PD21 2N5FA 5ELAA 3IAM2 5JCUA 2WZ9A 4KDYA 2HZEB 3CSIA 1TK5B 1JLVA 4G10A 5L71A 5A4UA 2MMNA 3TRXA 2IIYA 3C73A 2JSZA 5ELGA 3CXGA 2K18A 2FA4A 5KOXA 2O3EA 5DAKA 3NIVA 1O6JA 5IPHA 3QAVA 2K8SA 3U5RE 1YKAA 4AGSA 1HQOA 3KP8A 6GSTA 5ABRA 1FOHA 2LJKA 2J23A 5HFKA 3V1WA 2YJ7A 3QFAC 2CV4A 3VWVA 3TKPA 4O5RA 1X9MB 4HJMA 3RHCA 2FWGA 4WEYA 2QKEA 1TTZA 2X8CA 4LLRA 4XS6A 5IMFA 1OE8A 4V2LA 5ECNB 5CRHA 5IIZA 4HQZA 4V1Ap 2VL2C 1K0DA 2CX4A 5ECQB 2FWEA 4FH8A 2IMKA 1Z9HA 4FQUA 1SYRA 4ZL7A 5D73A 5CRGA 1GSDA 2R5GA 4HDEA 1ZGNA 3RDWA 2VD1A 1BX9A 3DD3A 1O7UA 3WT1A 5GAND 2GDRA 4ID0A 1ERUA 1O81A 2GT6A 1ML6A 1XW9A 4IW9A 2VL9A 5ECOB 2DC5A 3GYKA 3TJFA 2C8UA 4KDXA 5EL8A 2HYXA 5B8BA 5B7CA 2FGXA 1Z7RA 3ME7A 1TU8A 2HSNB 4MZWA 5HR2A 2EFCA 2H6XA 2H8LA 2B5XA 2OBIA 3MAKA 2FWHA 3VK9A 3E3EA 1T1VA 2MBSA 3CSJA 2YCDA 2RUFA 3L0HA 14GSA 2E2GA 4PUAA 3RGBC 5J40A 3APQA 3H8QA 2XPEA 4XS4B 2HRKB 4EDZA 1TK0B 3F0IA 3EWLA 1Z6MA 1QFNA 4MH3A 3IBHA 2BMXA 4O5UA 3ME8A 2J9HA 4QMKA 2WZSA 5G31A 1H4OA 2GSQA 1B4QA 2H1BA 12GSA 3HDCA 4K2XA 3FR9A 1GULA 4KA0A 2JU5A 1MDJA 1EGOA 4Q5RA 5A5HA 2AAWA 4LMVA 5FT3A 2EIOA 2KLXA 4MF6A 1R4WA 10GSA 4L5LA 1BG1A 3Q19A 2WVYA 1XW5A 5EPFA 3FZ5A 5DQSA 3VPTA 3O76A 3GN3A 3MDKA 2CZ3A 5DALA 3TOUA 5KN1A 3MYDA 3N9JA 3ZVJA 4F9ZA 2BJXA 2YP6A 4TXOA 4HJ2A 4V2MA 4ZILA 3FR6A 5C04A 3UBKA 2R3XA 2O89A 4I6XA 1G7OA 4K7IA 1YJ6A 4K5SA 5DBQA 2X8GA 3UAPA 3GHAA 5EY6A 1KNGA 3DGQA 2C0EA 4MCUA 1SKWB 2WDUA 2A4VA 2HFDA 4EIQA 2R2JA 5IMAA 4N3ZA 1M99A 4ZL9A 3S9FA 2GT5A 4QL7A 3LFLA 3M9JA 1XCCA 1XIYA 5A34B 2GQLA 1I1IP 4FXYP 2GZPA 3GUSA 1EEMA 3A5IA 1ZYEA 4K8MA 3UEMA 1PL1A 2F8FA 3C1SA 1XBSA 2YWMA 3APSA 2IPAA 5H5SA 3ZMKA 1XWAA 1M9AA 2X4AA 4KSMA 2H0GA 3NOFA 3I69A 3ED3A 4XRAA 2OKAA 2VUPA 5C00A 4E68A 2WRTA 4H86A 2B5EA 2LUSA 1Z6NA 3R2QA 1GSEA 2DJKA 5CP1A 2X64A 3DWVA 2LTKA 4AJ8A 5A4VA 4ISDA 1B4PA 1YEXA 4TKYA 4ICYA 3GMFA 2EFEA 1MDKA 1Y6EA 3ZIJA 3LWAA 3ZVJD 4E8EA 2NDOA 2JZRA 5ECRB 3BJ5A 3EC3A 3TDGA 2EFDA 1Z3EA 4MPGA 4N0VA 3O3TA 2DLXA 2AV4A 1GH2A 4EF0A 1SD9A 1M2DA 4PQIA 5A5KA 2IMFA 3GL3A 2VCQA 2L4CA 4PX1A 5B6NA 1SENA 4KAEA 2A2PA 4ZBBA 4V2NA 5DDLA 3ERGA 3APOA 3D6IA 2AUVA 3NZNA 2C3TA 4YQUA 4GDFA 3QPMA 4I97A 2LS5A 3VWWA 4MJCA 3HVSA 2YZUA 3W8JA 2AJQB 1JLWA 4BVYA 2TRCP 5JWQB 4CW9A 2GVPA 4K2DA 1R5PA 2ZUPA 1XXUA 1U88A 3CRTA 2KUCA 4DSSB 3TJBA 4JBBA 2CVKA 1BJXA 4ZBDA 3SWLA 1GTAA 4L8EA 2A2SA 5IM9A 4NPBA 2CVDA 1BF5A 4X1UA 1B48A 2IFQA 3GH9A 1SD8A 4RUVA 2RUEA 5A1NB 2V6KA 3TKRA 4F82A 2O87A 1R5AA 1SK1A 4MJAA 2OA7A 2GTUA 3WGEA 2AB6A 2B7JA 3GX0A 3M0FA 22GSA 3LYPA 5KEJA 1YVLA 3K8NA 3EE2A 4IQAA 4MZCA 4YQVA 1YEPA 1B8XA 3EPTA 1F9MA 1TJDA 1ABAA 4TR4A 5E59A 1OAZA 3IC8A 3MIXA 3VWXA 4GF0A 3OR5A 4G2EA 4MABA 1TK8B 1TI3A 1X9WB 4IELA 1O73A 1HYUA 1F37A 1JZRA 4ZBAA 3WD6A 4N10A 3VURA 5HR1A 2E2MA 1ZYPA 4KCAA 4TR0A 2DIYA 4KX4A 2IL3A 4J2FA 2VOCA 5H5QA 1J08A 2V32A 2JSYA 2QA1A 5J4YA 2C3QA 2NVLA 2YV9A 3GSTA 3WGDA 4JZQA 4RI7A 4OFNA 2RIIA 1NSWA 2PUKC 4MNNA 4WR5A 1TKDB 1FHEA 3IR4A 5G2ZA 2VCWA 1M2AA 1OC9B 4ML6A 4O92A 5ID2A 3C71A 4K1FA 4K9ZA 5KN0A 1F2EA 1GSUA 4AI6A 2G0FA 1G6WA 2YWIA 1GSSA 2VLVA 1XWCA 3FRCA 1FAAA 5G1LA 5J41A 4IKHA 2H1LA 4N0ZA 4PHZC 2P5RA 2GS3A 1U3IA 2DKHA 4MMMA 8GSSA 2CAIA 3BBYA 1OYJA 2H1GA 5BRTA 3KJYA 1XZOA 3GNJA 1OC8A 4J57E 1DSBA 2JZTA 2OE3A 3KGKA 4A5PA 2LKUA 5A4WA 2N5AA 5IO2A 4MLYA 4KB3A 2CAQA 3DYRA 1X5DA 1X9SB 3H4KA 2PPTA 3VLNA 3KH7A 4TN8A 3ZRDA 1GSFA 1A2MA 5F06A 1MEKA 2XC2A 4AKHA 2HLSA 2I3YA 3US3A 1LU4A 5INYA 5CAXA 2RM5A 2YOIA 4NHWA 1S3DA 2PBJA 6GSUA 1ERTA 3FZ4A 3F6DA 1XFLA 2GZZA 1Z5YE 4PUFC 1OE7A 1TOFA 3KMNA 1VGLA 2OACA 3Q6OA 5LNKe 4KUNA 4Q5NA 3FMWA 1WMJA 1A8YA 1RW1A 4I5QA 2L59A 3I6AA 2VKZG 5ECPB 5GZZB 4Z2RA 4EL1A 1J9BA 2FUG2 2C3NA 3BD2A 3A2VA 2HE3A 2IN3A 2HZEA 2HSYA 4POKA 2C4JA 5LD0A 4Q5FA 1EWXA 19GSA 1WWJA 5CRDA 1WOUA 4WXTA 3CMIA 3DVXA 1PL2A 4J56E 4FIWA 2NBSA 2KOKA 2CZ2A 1W89A 2N5BA 1PKZA 4AJ7A 1Y1UA 5DCHA 5BMUB 1JHBA 3IPZA 3VI5A 3GIXA 2L6DA 1M3JA 4PXOA 4EE0A 3VWUA 1YZXA 1DE2A 1QXHA 1SK2A 3DRNA 1FB0A 1BG5A 1BQ7A 2FY6A 1FG4A 2WS2A 2GQKA 3H1NA 4D73B 1HNCA 3UJ1A 4X0XA 3SBCA 3CHXC 3HD5A 3EURA 1UN2A 1VF3A 1V58A 1GTUA 2V1MA 5J47A 2X99A 3J7Yb 4AJ6A 1FO5A 4EKZA 1OC3A 3J7Yk 4G01A 4TVEA 4IBPA 3EMPA 1SJ6A 2H0HA 11GSA 6GSWA 2DJ3A 4LA1A 4YKGA 4TR3A 3F6FA 1HD2A 3LEFA 3BOAA 1K3YA 3MNGA 4HZ2A 2QGVA 1S3CA 1G0TA 1T3BA 2B3SA 2H1DA 2VM1A 3H93A 1SKRB 1AQWA 1GWCA 4F0BA 3CYNA 3UVHA 1PRXA 4PI0C 1T4YA 2XPDA 1O8WA 3DEXA 4JR4A 1O8XA 3KD0A 4CY6A 2HRNA 4LMWA 2HSNA 3F8UA 4P3YB 1YQ1A 4DSQA 4ZB7A 3EMXA 2C0GA 2WVZA 2TRXA 3PINA 2OJLA 4RQXA 4ZB9A 1ZMAA 2V41A 3A5WA 4GSTA 1JFUA 2WVXB 1YF0A 2RM6A 2YJHA 2HRKA 1OKTA 4EO3A 1FVJA 3ZYWA 5A5HB 5EVOA 1TXUA 4WETA 1Z7PA 3KM6A 2MYGA 2VAFA 3D4MA 9GSSA 4POBA 2LJAA 5B8AA 3R3EA 4G19A 3M3MA 3F9UA 1FB6A 1QUWA 3GKKA 4MZBA 4KF9A 2I81A 2HXKA 1IYHA 3RPNA 1SU9A 2IWTA 1AXDA 4TXOB 1VF2A 1ST9A 2LRCA 3D22A 5HQPA 2YWOA 2HSHA 1XVQA 4X43A 4LL1B 2PGTA 3D21A 1YY7A 4XTSA 3WGXA 1U6TA 2I1UA 4JEDA 4L0UA 2ON5A 1AQXA 4BPYA 2NTOA 3KCMA 3GSSA 2VLUA 5G30A 2VCXA 1XWGA 1G6YA 2LJRA 1GNEA 1WE0A 1A8LA 4HU7A 3W6GA 3ZZXA 1NW2A 2RLIA 2H0IA 2L4QA 2FHEA 3FW2A 4EXJA 5CREA 5GSTA 1T4ZA 3PR8A 2H30A 5AIVA 1PGTA 3TUEA 4HQSA 4GWRA 1ZZYA 2H73A 1Y25A 3HJPA 1THOA 5A34A 2GZYA 4OCEA 2DSAA 3P8WA 3GX8A 3QDNA 3ERFA 2YV7A 2PN8A 1TP9A 1KEBA 1TRSA 2HT9A 2YNXA 3FKFA 2F51A 2ZCTA 3C1RA 5ENUA 1V40A 1GRXA 4BA7A 3FY7A 1A0FA 4RI6A 1RQMA 1CQHA 4IP1A 2YWNA 5J9CA 3GKNA 4ML1A 2DBCA 5ECMB 1YEWC 1FVKA 3ZIVA 3HVNA 2O8VB 1WRYA 1EGRA 2HZFA 3LORA 1RK4A 4NV5A 5D9TA 4KW6A 5JWOB 2VCVA 3IA1A 4POMA 1AAZA 5HFGA 1ERWA 3IDVA 3KP9A 2WB9A 3UBLA 3KEBA 4EDYA 5IO0A 1IYIA 2WW3A 3KIJA 3DMLA 3W8SA 3E9JB 5ECKB 2R0CA 4KH7A 3ZL5A 3N5OA 1TRVA 18GSA 5ECSA 3LXZA 4K6XA 4HUAA 4OWYA 5D96A 2R0PA 4HEA2 2ES7A 4TR1A 5IMVA 3FHKA 4LL4B 3TKSC 4OFTA 1ZCPA 2DJ0A 5AIXA 2DJ2A 2H76A 1V2AA 1VF4A 3M9KA 2YANA 2H66A 3TU3B 2GLRA 3GTUB 4K0NA 2A2RA 3TKSE 3Q18A 4E8HA 1TU7A 2H19A 4GLTA 2H1AA 3BCKA 3GL5A 2C80A 4I8BA 3LG6A 4TXVA 4WR4A 1ZL9A 4GCIA 1Q98A 1AW9A 2F8AA 2M80A 1M3IA 1K0BA 2IFQB 5CYYA 4DEJA 1EP7A 2HI7A 2FA8A 4DSSA 3QAWA 2PMTA 1DUGA 3F4TA 1WJKA 1M7TA 1S3RA 1WPIA 4MP4A 2OADA 2KP2A 4AKXB 3ZMLA 1SVMA 1B9XC 4V1Ag 2PWJA 2B7KA 2LRTA 3GKXA 1R26A 2OBKA 5A1NA 3PGTA 2WJUA 4OCFA 1M9BA 3LXTA 1U3AA 1UC7A 4ZXGA 3HA9A 4OD7A 3EINA 1PX6A 1GUHA 4FYCA 4PTSA 4IJ3A 4OFMA 1TXXA 2BTOT 3TJKA 3GA4A 2R4VA 5IPGA 3HZ8A 4IS0A 3E0UA 3GFKA 5CO3A 1N8JA 2E7PA 2REMA 5F07A 3RPPA 4NAXA 1TW9A 1PQNA 1X0RA 1BYEA 1PSQA 1Q4JA 1SVLA 2B1KA 2FWFA 3TGZA 3G7JA 4USSA 2K8VA 1X5CA 3ZFLA 4Z7XA 2TIRA 1SL0B 5ECLB 2B1LA 2WFCA 1EOGA 3GH6A 2GSTA 3GV1A 2R0GA 2C0DA 3DKSA 2PVOC 2H70A 1K3OA 2WCIA 6GSYA 1K0AA 5ID2B 3I9V2 1GUMA 3CWGA 2HRFA 3G7IA 3F63A 4NXIA 2AYTA 3KH9A 4XCSA 3FEUA 4GSSA 3DIEA 5J3RA 1GTBA 1H75A 1JZWA 3EYTA 1DE1A 2QSIA 2DMMA 2CQ9A 4BL7A 3LGCA 3TRPA 4G0KA 4QQ7A 4MDCA 4DVCA 1KTEA 1XG8A 7GSSA 3HJOA 3IE3A 4NHZA 1HNAA 20GSA 4KE3A 2C1YA 3IRAA 2HSMB 3UVTA 3ISOA 1B9YC 4BVXB 3IV4A 4N11A 5AN1A 3P2AA 4XIHA 1ACVA 2L5LA 3IK7A 5AGYA 4EUYA 2H6YA 1USBA 1GLQA 1UVZA 2IMIA 3IC4A 3LYKA 4BWSA 4K7OA 3ERWA 4MK3A 1HNBA 1SL2B 3UL3A 1F6MC 3TKSA 3D4TA 2GSSA 3ZTLA 3HXSA 1SVOA 3D0ZA 3HMJG 1AC1A 4TW5A 2ON7A 1BEDA 5IQYA 3FZAA 3QAGA 1OKDA 3P90A 4JU5A 4NMUA 5D8IA 1GSYA 3RFRC 2VD0A 3C7MA 5DAKB 3GRXA 4YAVA 4WBRD 2K6VA 4Z2TA 5B6MA 1QGVA 1YKCA 1K3LA 1VF1A 1TDIA 2DIZA 1QQ2A 2WGRA 5ECIB 1ILOA 1PA3A 3GURA 1OVNA 1V98A 1NHYA 2K9FA 1S4BP 4CHSA 1CQGA 2PU9C 4BWQA 3RAZA 3G7YA 3QCPA 3RBTA 2YPMA 5JWRB 1G7EA 1SKSB 1FOVA 4L5OA 6GSXA 1TRUA 2O85A 3UIWA 2FNOA 5BMUA 3ZLPA 1EOHA 3MSZA 6GSSA 2YN1A 4GXZA 3G9BA 4IP6A 2FD3A 2F3MA 3QMXA 5JCGA 2IJYA 4XHMA 4DSRA 1SYXA 4D73A 3EVIA 4IJIA 2P0GA 2JZSA 1EV9A 4MPFA 2GGTA 2H74A 4MH2A 5D9VA 1VRSD 1XWBA 5IMCA 1T00A 4ECCA 3CTGA 4OMVA 2ZNMA 3TCOA 4GTUA 1T8EB 1URMA 3L9SA 1NHOA 4F2IA 3IHQA 3JCML 3EU3A 1R7HA 1E2YA 4PQHA 2Z9SA 2X49A 2V2GA 4NWYA 1EZKA 1PKWA 4GRFA 4IN0A 3FZ9A 4EIPA 4POLA 2LQQA 2XBQA 2B6MA 1EV4A 2MMOA 2G2QA 3WT2A 4CDOA 2F9SA 1GUKA 1V57A 5CRWA 4IQ1A 1A0RP 4ZB6A 1A2JA 1TI1A 2DMLA 3HCZA 4JR6A 4XS4A 2PERA 4WF5A 1KBNA 3CRUA 1MD4A 3TJGA 5IOXA 2MZCA 3DVWA 3HHVA 2H75A 2M46A 4YAPA 2PVQA 3AY8A 2I4AA 5DJMA 2WVXA 1XOAA 5J9BA 4ACSA 3ZITA 2E0QA 1XOBA 1GTIA 5DVBA 3UOMA 5DALB 2P5QA 2D2ZA 2VO4A 5HR0A 2I9HA 5CNWA 5IMDA 3VI7A 3TKQA 1WP0A 1M2BA 2H72A 2DJJA 3UARA 4MJBA 1N2AA 2R37A 2LQOA 2YZHA 4EC0A 4BIKA 1ZOFA 5KN3A 4QL9A 5D9XA 1BAYA 5GSSA 4NV2A 2WW0A 3L9UA 1PX7A 17GSA 2EIQA 3HYPA 1ERVA 4F0CA 4WKWA 5GAPD 4MA9A 5D9WA 4ECJA 2O36A 3CSHA 4FO5A 1N25A 2FLSA 3M8NA 3F3RA 1GL8A 2VCTA 1MD3A 5G1KA 2HQTA 5F0GA 3F4RA 4GQCA 2L5OA 2A4HA 3LSZA 1O85A 4EVMA 4Q5QA 3VPQA 2JL4A 4N30A 5KOWA 3KTLA 4L0WA 4PGTA 5COHA 2M72A 3QFBC 4K7NA 2B5YA 1QK8A 3MWHA 2VL3A 2VL2A 4IHUA 3KXOA 3I43A 3U6VA 4TRXA 1K0CA 4RQRA 2ALBA 5FWGA 4AKIA 4O32A 5AISA 5FHIA 3CQFA 2O5VA 2QC7A 3IAS2 1PMTA 2XHFA 1AQVA 2LV3A 2VCZA 4PNFA 2CX3A 5IOWA 4KGIA 2L57A 4OO4A 1ON4A 2JADA 5LCZA 4ECIA 4MJEA 4ZIJA 2R6KA 3KMOA 3F3QA 4WBJA 1XPVA 3TRQA 3VFIA 5G5EA 5F05A 4AF2A 1W4VA 2HRAA 1X5EA 3HY2A 3DXBA 2KP1A 1LBKA 4HI7A 1FW1A 3QR6A 1XWKA 4ULXA 3A3TA 3GKMA 5D93A 2GSRA 5KN2A 3P7XA 4ZB8A 2WW1A 3KZQA 4TR1B 2LEGA 5F8BA 2H6ZA 5J4UA 4KNDA 4PNGA 1ZYNA 4YQMA 4W66A 2EIRA 1T7PB 4BVYB 4AKGA 1EEJA 4IGJA 5ECHB 16GSA 2UV8G 2H71A 2P31A 1ZYQB 2DJ1A
chains in the Genus database with same CATH topology
3TOTA 2XBIA 2OE1A 1XVWA 1F3BA 2X8HA 1AIUA 3UMAA 5HFIA 3GTUA 3L4NA 3CBUA 2CT6A 4Z2UA 3HVVA 4HZ4A 1GP1A 4HU9A 2DKIA 4ZL8A 2CA8A 1PN9A 13GSA 1AUCA 1YDKA 2LNSA 4HS1A 2H01A 3KTBA 1S3AA 3LQ7A 3FK8A 4FYBA 2LNTA 2IMDA 4K5RA 1XW6A 1I5GA 4MF5A 2MMAA 1YF1A 2VM2A 4IVFA 3IK9A 4GQFA 3TB2A 4G0IA 2VIMA 3L78A 4MF7A 5JCWA 1J0FA 3O6TA 3IOSA 5DQYA 2QA2A 1JZOA 2MMZA 2UZ8A 3PPUA 4OO5A 5J4VA 1E6BA 2FCHA 2OE0A 4KDUA 3BCIA 1K0MA 2AHEA 3HKRA 4G0LA 4I2TA 2CVBA 3HJMA 5E4WA 2IMEA 3RHBA 1NM3A 5J5NA 1C72A 1UA5A 2HNLA 4PQ1A 3CTFA 3QD9A 4WF4A 3ZREA 3LW9A 1A24A 4ILFA 4HOJA 2VLTA 2EFHA 3F4SA 3TJJA 1QMVA 3A2XA 3IHGA 1M0UA 4XS1A 4GSNA 4FYUA 4YH2A 3EU4A 1F3AA 1I9DA 5DCGA 3A2WA 1OC9A 1GLPA 5DJLA 4BL7B 3Q74A 6GSVA 1V9WA 4K0GA 4KCEA 4O5QA 3FR3A 5IMZA 3LJRA 3WYWA 2V6OA 4XRDA 1U87A 3C8EA 1A23A 4TOPA 1SL1B 1SJIA 1WIKA 3H79A 1DBYA 3HVXA 2EC4A 1MDIA 3M1GA 2OT3A 3PH9A 1PN0A 1MTCA 3L9VA 3ZFBA 4YKFA 2O7KA 4JRRA 4O7HA 1THXA 2HSMA 1TRWA 2MBTA 4X4JA 4BVXA 4ECBA 1GNWA 2LSTA 1K0NA 4KSOA 3IXRA 4CY8A 5HR3A 3QOUA 2L6CA 1SJZA 2WULA 4JE1A 2NPBA 4PURA 3FYGA 3D5JA 1K0OA 2GQMA 4G9HA 4F03A 2C0FA 1SK0A 1LJRA 1EP8A 1JZDA 3HZ4A 2KHPA 1GSQA 5H5RA 2JACA 5G5FA 1A2LA 4I2UA 2LRNA 1PD21 2N5FA 5ELAA 3IAM2 5JCUA 2WZ9A 4KDYA 2HZEB 3CSIA 1TK5B 1JLVA 4G10A 5L71A 5A4UA 2MMNA 3TRXA 2IIYA 3C73A 2JSZA 5ELGA 3CXGA 2K18A 2FA4A 5KOXA 5DAKA 3NIVA 1O6JA 5IPHA 3QAVA 2K8SA 3U5RE 1YKAA 4AGSA 1HQOA 3KP8A 6GSTA 5ABRA 1FOHA 2LJKA 2J23A 5HFKA 3V1WA 2YJ7A 3QFAC 2CV4A 3VWVA 3TKPA 4O5RA 1X9MB 4HJMA 3RHCA 2FWGA 4WEYA 2QKEA 1TTZA 2X8CA 4LLRA 4XS6A 5IMFA 1OE8A 4V2LA 5ECNB 5CRHA 5IIZA 4HQZA 4V1Ap 2VL2C 1K0DA 2CX4A 5ECQB 2FWEA 4FH8A 2IMKA 1Z9HA 4FQUA 1SYRA 4ZL7A 5D73A 5CRGA 1GSDA 2R5GA 4HDEA 1ZGNA 3RDWA 2VD1A 1BX9A 3DD3A 1O7UA 3WT1A 5GAND 2GDRA 4ID0A 1ERUA 1O81A 2GT6A 1ML6A 1XW9A 4IW9A 2VL9A 5ECOB 2DC5A 3GYKA 3TJFA 2C8UA 4KDXA 5EL8A 2HYXA 5B8BA 5B7CA 2FGXA 1Z7RA 3ME7A 1TU8A 2HSNB 4MZWA 5HR2A 2EFCA 2H6XA 2H8LA 2B5XA 2OBIA 3MAKA 2FWHA 3VK9A 3E3EA 1T1VA 2MBSA 3CSJA 2YCDA 2RUFA 3L0HA 14GSA 2E2GA 4PUAA 5J40A 3APQA 3H8QA 2XPEA 4XS4B 2HRKB 4EDZA 1TK0B 3F0IA 3EWLA 1Z6MA 1QFNA 4MH3A 3IBHA 2BMXA 4O5UA 3ME8A 2J9HA 4QMKA 5G31A 1H4OA 2GSQA 1B4QA 2H1BA 12GSA 3HDCA 4K2XA 3FR9A 1GULA 4KA0A 2JU5A 1MDJA 1EGOA 4Q5RA 5A5HA 2AAWA 4LMVA 5FT3A 2EIOA 2KLXA 4MF6A 1R4WA 10GSA 4L5LA 1BG1A 3Q19A 1XW5A 5EPFA 3FZ5A 5DQSA 3VPTA 3O76A 3GN3A 3MDKA 2CZ3A 5DALA 3TOUA 5KN1A 3MYDA 3N9JA 3ZVJA 4F9ZA 2BJXA 2YP6A 4TXOA 4HJ2A 4V2MA 4ZILA 3FR6A 5C04A 3UBKA 2R3XA 2O89A 4I6XA 1G7OA 4K7IA 1YJ6A 4K5SA 5DBQA 2X8GA 3UAPA 3GHAA 5EY6A 1KNGA 3DGQA 2C0EA 4MCUA 1SKWB 2WDUA 2A4VA 2HFDA 4EIQA 2R2JA 5IMAA 4N3ZA 1M99A 4ZL9A 3S9FA 2GT5A 4QL7A 3LFLA 3M9JA 1XCCA 1XIYA 5A34B 2GQLA 2GZPA 3GUSA 1EEMA 3A5IA 1ZYEA 4K8MA 3UEMA 1PL1A 2F8FA 3C1SA 1XBSA 2YWMA 3APSA 2IPAA 5H5SA 3ZMKA 1XWAA 1M9AA 2X4AA 4KSMA 2H0GA 3NOFA 3I69A 3ED3A 4XRAA 2OKAA 2VUPA 5C00A 4E68A 2WRTA 4H86A 2B5EA 2LUSA 1Z6NA 3R2QA 1GSEA 2DJKA 5CP1A 2X64A 3DWVA 2LTKA 4AJ8A 5A4VA 4ISDA 1B4PA 1YEXA 4TKYA 4ICYA 3GMFA 2EFEA 1MDKA 1Y6EA 3ZIJA 3LWAA 3ZVJD 4E8EA 2NDOA 2JZRA 5ECRB 3BJ5A 3EC3A 3TDGA 2EFDA 1Z3EA 4MPGA 4N0VA 3O3TA 2DLXA 2AV4A 1GH2A 4EF0A 1SD9A 1M2DA 4PQIA 5A5KA 2IMFA 3GL3A 2VCQA 2L4CA 4PX1A 5B6NA 1SENA 4KAEA 2A2PA 4ZBBA 4V2NA 5DDLA 3ERGA 3APOA 3D6IA 2AUVA 3NZNA 2C3TA 4YQUA 4GDFA 3QPMA 4I97A 2LS5A 3VWWA 4MJCA 3HVSA 2YZUA 3W8JA 2AJQB 1JLWA 4BVYA 2TRCP 5JWQB 4CW9A 2GVPA 4K2DA 1R5PA 2ZUPA 1XXUA 1U88A 3CRTA 2KUCA 4DSSB 3TJBA 4JBBA 2CVKA 1BJXA 4ZBDA 3SWLA 1GTAA 4L8EA 2A2SA 5IM9A 4NPBA 2CVDA 1BF5A 4X1UA 1B48A 2IFQA 3GH9A 1SD8A 4RUVA 2RUEA 5A1NB 2V6KA 3TKRA 4F82A 2O87A 1R5AA 1SK1A 4MJAA 2OA7A 2GTUA 3WGEA 2AB6A 2B7JA 3GX0A 3M0FA 22GSA 3LYPA 5KEJA 1YVLA 3K8NA 3EE2A 4IQAA 4MZCA 4YQVA 1YEPA 1B8XA 3EPTA 1F9MA 1TJDA 1ABAA 4TR4A 5E59A 1OAZA 3IC8A 3MIXA 3VWXA 4GF0A 3OR5A 4G2EA 4MABA 1TK8B 1TI3A 1X9WB 4IELA 1O73A 1HYUA 1F37A 1JZRA 4ZBAA 3WD6A 4N10A 3VURA 5HR1A 2E2MA 1ZYPA 4KCAA 4TR0A 2DIYA 4KX4A 2IL3A 4J2FA 2VOCA 5H5QA 1J08A 2V32A 2JSYA 2QA1A 5J4YA 2C3QA 2NVLA 2YV9A 3GSTA 3WGDA 4JZQA 4RI7A 4OFNA 2RIIA 1NSWA 2PUKC 4MNNA 4WR5A 1TKDB 1FHEA 3IR4A 5G2ZA 2VCWA 1M2AA 1OC9B 4ML6A 4O92A 5ID2A 3C71A 4K1FA 4K9ZA 5KN0A 1F2EA 1GSUA 4AI6A 2G0FA 1G6WA 2YWIA 1GSSA 2VLVA 1XWCA 3FRCA 1FAAA 5G1LA 5J41A 4IKHA 2H1LA 4N0ZA 2P5RA 2GS3A 1U3IA 2DKHA 4MMMA 8GSSA 2CAIA 3BBYA 1OYJA 2H1GA 5BRTA 3KJYA 1XZOA 3GNJA 1OC8A 4J57E 1DSBA 2JZTA 2OE3A 3KGKA 4A5PA 2LKUA 5A4WA 2N5AA 5IO2A 4MLYA 4KB3A 2CAQA 3DYRA 1X5DA 1X9SB 3H4KA 2PPTA 3VLNA 3KH7A 4TN8A 3ZRDA 1GSFA 1A2MA 5F06A 1MEKA 2XC2A 4AKHA 2HLSA 2I3YA 3US3A 1LU4A 5INYA 5CAXA 2RM5A 2YOIA 4NHWA 1S3DA 2PBJA 6GSUA 1ERTA 3FZ4A 3F6DA 1XFLA 2GZZA 1Z5YE 4PUFC 1OE7A 1TOFA 3KMNA 1VGLA 2OACA 3Q6OA 5LNKe 4KUNA 4Q5NA 3FMWA 1WMJA 1A8YA 1RW1A 4I5QA 2L59A 3I6AA 2VKZG 5ECPB 5GZZB 4Z2RA 4EL1A 1J9BA 2FUG2 2C3NA 3BD2A 3A2VA 2HE3A 2IN3A 2HZEA 2HSYA 4POKA 2C4JA 5LD0A 4Q5FA 1EWXA 19GSA 1WWJA 5CRDA 1WOUA 4WXTA 3CMIA 3DVXA 1PL2A 4J56E 4FIWA 2NBSA 2KOKA 2CZ2A 1W89A 2N5BA 1PKZA 4AJ7A 1Y1UA 5DCHA 5BMUB 1JHBA 3IPZA 3VI5A 3GIXA 2L6DA 4PXOA 4EE0A 3VWUA 1YZXA 1DE2A 1QXHA 1SK2A 3DRNA 1FB0A 1BG5A 1BQ7A 2FY6A 1FG4A 2WS2A 2GQKA 3H1NA 4D73B 1HNCA 3UJ1A 4X0XA 3SBCA 3HD5A 3EURA 1UN2A 1VF3A 1V58A 1GTUA 2V1MA 5J47A 2X99A 3J7Yb 4AJ6A 1FO5A 4EKZA 1OC3A 3J7Yk 4G01A 4TVEA 4IBPA 3EMPA 1SJ6A 2H0HA 11GSA 6GSWA 2DJ3A 4LA1A 4YKGA 4TR3A 3F6FA 1HD2A 3LEFA 3BOAA 1K3YA 3MNGA 4HZ2A 2QGVA 1S3CA 1G0TA 1T3BA 2B3SA 2H1DA 2VM1A 3H93A 1SKRB 1AQWA 1GWCA 4F0BA 3CYNA 3UVHA 1PRXA 1T4YA 2XPDA 1O8WA 3DEXA 4JR4A 1O8XA 3KD0A 4CY6A 2HRNA 4LMWA 2HSNA 3F8UA 4P3YB 1YQ1A 4DSQA 4ZB7A 3EMXA 2C0GA 2TRXA 3PINA 2OJLA 4RQXA 4ZB9A 1ZMAA 2V41A 3A5WA 4GSTA 1JFUA 1YF0A 2RM6A 2YJHA 2HRKA 1OKTA 4EO3A 1FVJA 3ZYWA 5A5HB 5EVOA 1TXUA 4WETA 1Z7PA 3KM6A 2MYGA 2VAFA 3D4MA 9GSSA 4POBA 2LJAA 5B8AA 3R3EA 4G19A 3M3MA 3F9UA 1FB6A 1QUWA 3GKKA 4MZBA 4KF9A 2I81A 2HXKA 1IYHA 3RPNA 1SU9A 2IWTA 1AXDA 4TXOB 1VF2A 1ST9A 2LRCA 3D22A 5HQPA 2YWOA 2HSHA 1XVQA 4X43A 4LL1B 2PGTA 3D21A 1YY7A 4XTSA 3WGXA 1U6TA 2I1UA 4JEDA 4L0UA 2ON5A 1AQXA 4BPYA 2NTOA 3KCMA 3GSSA 2VLUA 5G30A 2VCXA 1XWGA 1G6YA 2LJRA 1GNEA 1WE0A 1A8LA 4HU7A 3W6GA 3ZZXA 1NW2A 2RLIA 2H0IA 2L4QA 2FHEA 3FW2A 4EXJA 5CREA 5GSTA 1T4ZA 3PR8A 2H30A 5AIVA 1PGTA 3TUEA 4HQSA 4GWRA 1ZZYA 2H73A 1Y25A 3HJPA 1THOA 5A34A 2GZYA 4OCEA 2DSAA 3P8WA 3GX8A 3QDNA 3ERFA 2YV7A 2PN8A 1TP9A 1KEBA 1TRSA 2HT9A 2YNXA 3FKFA 2F51A 2ZCTA 3C1RA 5ENUA 1V40A 1GRXA 4BA7A 3FY7A 1A0FA 4RI6A 1RQMA 1CQHA 4IP1A 2YWNA 5J9CA 3GKNA 4ML1A 2DBCA 5ECMB 1FVKA 3ZIVA 2O8VB 1WRYA 1EGRA 2HZFA 3LORA 1RK4A 4NV5A 5D9TA 4KW6A 5JWOB 2VCVA 3IA1A 4POMA 1AAZA 5HFGA 1ERWA 3IDVA 3KP9A 2WB9A 3UBLA 3KEBA 4EDYA 5IO0A 1IYIA 3KIJA 3DMLA 3W8SA 3E9JB 5ECKB 2R0CA 4KH7A 3ZL5A 3N5OA 1TRVA 18GSA 5ECSA 3LXZA 4K6XA 4HUAA 4OWYA 5D96A 2R0PA 4HEA2 2ES7A 4TR1A 5IMVA 3FHKA 4LL4B 3TKSC 4OFTA 1ZCPA 2DJ0A 5AIXA 2DJ2A 2H76A 1V2AA 1VF4A 3M9KA 2YANA 2H66A 3TU3B 2GLRA 3GTUB 4K0NA 2A2RA 3TKSE 3Q18A 4E8HA 1TU7A 2H19A 4GLTA 2H1AA 3BCKA 3GL5A 2C80A 4I8BA 3LG6A 4TXVA 4WR4A 1ZL9A 4GCIA 1Q98A 1AW9A 2F8AA 2M80A 1K0BA 2IFQB 5CYYA 4DEJA 1EP7A 2HI7A 2FA8A 4DSSA 3QAWA 2PMTA 1DUGA 3F4TA 1WJKA 1M7TA 1WPIA 4MP4A 2OADA 2KP2A 4AKXB 3ZMLA 1SVMA 1B9XC 4V1Ag 2PWJA 2B7KA 2LRTA 3GKXA 1R26A 2OBKA 5A1NA 3PGTA 2WJUA 4OCFA 1M9BA 3LXTA 1U3AA 1UC7A 4ZXGA 3HA9A 4OD7A 3EINA 1PX6A 1GUHA 4FYCA 4PTSA 4IJ3A 4OFMA 1TXXA 2BTOT 3TJKA 3GA4A 2R4VA 5IPGA 3HZ8A 4IS0A 3E0UA 3GFKA 5CO3A 1N8JA 2E7PA 2REMA 5F07A 3RPPA 4NAXA 1TW9A 1PQNA 1X0RA 1BYEA 1PSQA 1Q4JA 1SVLA 2B1KA 2FWFA 3TGZA 3G7JA 4USSA 2K8VA 1X5CA 3ZFLA 4Z7XA 2TIRA 1SL0B 5ECLB 2B1LA 2WFCA 1EOGA 3GH6A 2GSTA 3GV1A 2R0GA 2C0DA 3DKSA 2PVOC 2H70A 1K3OA 2WCIA 6GSYA 1K0AA 5ID2B 3I9V2 1GUMA 3CWGA 2HRFA 3G7IA 3F63A 4NXIA 2AYTA 3KH9A 4XCSA 3FEUA 4GSSA 3DIEA 5J3RA 1GTBA 1H75A 1JZWA 3EYTA 1DE1A 2QSIA 2DMMA 2CQ9A 4BL7A 3LGCA 3TRPA 4G0KA 4QQ7A 4MDCA 4DVCA 1KTEA 7GSSA 3HJOA 3IE3A 4NHZA 1HNAA 20GSA 4KE3A 2C1YA 3IRAA 2HSMB 3UVTA 3ISOA 1B9YC 4BVXB 3IV4A 4N11A 5AN1A 3P2AA 4XIHA 1ACVA 2L5LA 3IK7A 5AGYA 4EUYA 2H6YA 1USBA 1GLQA 1UVZA 2IMIA 3IC4A 3LYKA 4BWSA 4K7OA 3ERWA 4MK3A 1HNBA 1SL2B 3UL3A 1F6MC 3TKSA 3D4TA 2GSSA 3ZTLA 3HXSA 1SVOA 3D0ZA 3HMJG 1AC1A 4TW5A 2ON7A 1BEDA 5IQYA 3FZAA 3QAGA 1OKDA 3P90A 4JU5A 4NMUA 5D8IA 1GSYA 2VD0A 3C7MA 5DAKB 3GRXA 4YAVA 4WBRD 2K6VA 4Z2TA 5B6MA 1QGVA 1YKCA 1K3LA 1VF1A 1TDIA 2DIZA 1QQ2A 2WGRA 5ECIB 1ILOA 1PA3A 3GURA 1OVNA 1V98A 1NHYA 2K9FA 4CHSA 1CQGA 2PU9C 4BWQA 3RAZA 3G7YA 3QCPA 3RBTA 2YPMA 5JWRB 1G7EA 1SKSB 1FOVA 4L5OA 6GSXA 1TRUA 2O85A 3UIWA 2FNOA 5BMUA 3ZLPA 1EOHA 3MSZA 6GSSA 2YN1A 4GXZA 3G9BA 4IP6A 2FD3A 2F3MA 3QMXA 5JCGA 2IJYA 4XHMA 4DSRA 1SYXA 4D73A 3EVIA 4IJIA 2P0GA 2JZSA 1EV9A 4MPFA 2GGTA 2H74A 4MH2A 5D9VA 1VRSD 1XWBA 5IMCA 1T00A 4ECCA 3CTGA 4OMVA 2ZNMA 3TCOA 4GTUA 1T8EB 1URMA 3L9SA 1NHOA 4F2IA 3IHQA 3JCML 3EU3A 1R7HA 1E2YA 4PQHA 2Z9SA 2X49A 2V2GA 4NWYA 1EZKA 1PKWA 4GRFA 4IN0A 3FZ9A 4EIPA 4POLA 2LQQA 2XBQA 2B6MA 1EV4A 2MMOA 2G2QA 3WT2A 4CDOA 2F9SA 1GUKA 1V57A 5CRWA 4IQ1A 1A0RP 4ZB6A 1A2JA 1TI1A 2DMLA 3HCZA 4JR6A 4XS4A 2PERA 4WF5A 1KBNA 3CRUA 1MD4A 3TJGA 5IOXA 2MZCA 3DVWA 3HHVA 2H75A 2M46A 4YAPA 2PVQA 3AY8A 2I4AA 5DJMA 1XOAA 5J9BA 4ACSA 3ZITA 2E0QA 1XOBA 1GTIA 5DVBA 3UOMA 5DALB 2P5QA 2D2ZA 2VO4A 5HR0A 2I9HA 5CNWA 5IMDA 3VI7A 3TKQA 1WP0A 1M2BA 2H72A 2DJJA 3UARA 4MJBA 1N2AA 2R37A 2LQOA 2YZHA 4EC0A 1ZOFA 5KN3A 4QL9A 5D9XA 1BAYA 5GSSA 4NV2A 3L9UA 1PX7A 17GSA 2EIQA 3HYPA 1ERVA 4F0CA 4WKWA 5GAPD 4MA9A 5D9WA 4ECJA 3CSHA 4FO5A 1N25A 2FLSA 3M8NA 3F3RA 1GL8A 2VCTA 1MD3A 5G1KA 2HQTA 5F0GA 3F4RA 4GQCA 2L5OA 2A4HA 3LSZA 1O85A 4EVMA 4Q5QA 3VPQA 2JL4A 4N30A 5KOWA 3KTLA 4L0WA 4PGTA 5COHA 2M72A 3QFBC 4K7NA 2B5YA 1QK8A 3MWHA 2VL3A 2VL2A 4IHUA 3KXOA 3I43A 3U6VA 4TRXA 1K0CA 4RQRA 2ALBA 5FWGA 4AKIA 4O32A 5AISA 5FHIA 2O5VA 2QC7A 3IAS2 1PMTA 2XHFA 1AQVA 2LV3A 2VCZA 4PNFA 2CX3A 5IOWA 4KGIA 2L57A 4OO4A 1ON4A 2JADA 5LCZA 4ECIA 4MJEA 4ZIJA 2R6KA 3KMOA 3F3QA 4WBJA 1XPVA 3TRQA 3VFIA 5G5EA 5F05A 4AF2A 1W4VA 2HRAA 1X5EA 3HY2A 3DXBA 2KP1A 1LBKA 4HI7A 1FW1A 3QR6A 1XWKA 4ULXA 3A3TA 3GKMA 5D93A 2GSRA 5KN2A 3P7XA 4ZB8A 3KZQA 4TR1B 2LEGA 5F8BA 2H6ZA 5J4UA 4KNDA 4PNGA 1ZYNA 4YQMA 4W66A 2EIRA 1T7PB 4BVYB 4AKGA 1EEJA 4IGJA 5ECHB 16GSA 2UV8G 2H71A 2P31A 1ZYQB 2DJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOT A;  2XBI A;  2OE1 A;  1XVW A;  1F3B A;  2X8H A;  1AIU A;  3UMA A;  5HFI A;  3GTU A;  3L4N A;  3CBU A;  2CT6 A;  3HVV A;  4HZ4 A;  1GP1 A;  4HU9 A;  4ZL8 A;  2CA8 A;  1PN9 A;  13GS A;  1AUC A;  1YDK A;  2LNS A;  4HS1 A;  2H01 A;  3KTB A;  1S3A A;  3LQ7 A;  3FK8 A;  4FYB A;  2LNT A;  2IMD A;  1XW6 A;  1I5G A;  4MF5 A;  2MMA A;  1YF1 A;  2VM2 A;  4IVF A;  3IK9 A;  4GQF A;  3TB2 A;  4G0I A;  2VIM A;  3L78 A;  4MF7 A;  5JCW A;  1J0F A;  3O6T A;  3IOS A;  5DQY A;  1JZO A;  2MMZ A;  2UZ8 A;  3PPU A;  4OO5 A;  1E6B A;  2FCH A;  2OE0 A;  4KDU A;  3BCI A;  1K0M A;  2AHE A;  3HKR A;  4G0L A;  4I2T A;  2CVB A;  3HJM A;  5E4W A;  2IME A;  3RHB A;  1NM3 A;  5J5N A;  1C72 A;  1UA5 A;  2HNL A;  4PQ1 A;  3CTF A;  3QD9 A;  4WF4 A;  3ZRE A;  1A24 A;  4ILF A;  4HOJ A;  2VLT A;  3F4S A;  3TJJ A;  1QMV A;  3A2X A;  1M0U A;  4XS1 A;  4GSN A;  4FYU A;  4YH2 A;  3EU4 A;  1F3A A;  1I9D A;  5DCG A;  3A2W A;  1OC9 A;  1GLP A;  5DJL A;  4BL7 B;  3Q74 A;  6GSV A;  1V9W A;  4K0G A;  4KCE A;  3FR3 A;  5IMZ A;  3LJR A;  3WYW A;  2V6O A;  4XRD A;  1U87 A;  3C8E A;  1A23 A;  4TOP A;  1SL1 B;  1SJI A;  1WIK A;  3H79 A;  1DBY A;  3HVX A;  2EC4 A;  1MDI A;  3M1G A;  3PH9 A;  1MTC A;  3L9V A;  3ZFB A;  2O7K A;  4JRR A;  4O7H A;  1THX A;  2HSM A;  1TRW A;  2MBT A;  4BVX A;  4ECB A;  1GNW A;  2LST A;  1K0N A;  4KSO A;  3IXR A;  5HR3 A;  3QOU A;  2L6C A;  1SJZ A;  2WUL A;  4JE1 A;  2NPB A;  4PUR A;  3FYG A;  3D5J A;  1K0O A;  2GQM A;  4G9H A;  4F03 A;  2C0F A;  1SK0 A;  1LJR A;  1EP8 A;  1JZD A;  3HZ4 A;  2KHP A;  1GSQ A;  5H5R A;  2JAC A;  5G5F A;  1A2L A;  4I2U A;  2LRN A;  1PD2 1;  2N5F A;  5ELA A;  3IAM 2;  5JCU A;  2WZ9 A;  4KDY A;  2HZE B;  3CSI A;  1TK5 B;  1JLV A;  4G10 A;  5L71 A;  5A4U A;  2MMN A;  3TRX A;  2IIY A;  3C73 A;  2JSZ A;  5ELG A;  3CXG A;  2K18 A;  2FA4 A;  5DAK A;  3NIV A;  1O6J A;  5IPH A;  3QAV A;  2K8S A;  3U5R E;  1YKA A;  4AGS A;  1HQO A;  3KP8 A;  6GST A;  5ABR A;  2LJK A;  2J23 A;  5HFK A;  3V1W A;  2YJ7 A;  3QFA C;  2CV4 A;  3VWV A;  3TKP A;  4O5R A;  1X9M B;  4HJM A;  3RHC A;  2FWG A;  4WEY A;  2QKE A;  1TTZ A;  2X8C A;  4LLR A;  4XS6 A;  5IMF A;  1OE8 A;  4V2L A;  5ECN B;  5CRH A;  5IIZ A;  4HQZ A;  4V1A p;  2VL2 C;  1K0D A;  2CX4 A;  5ECQ B;  2FWE A;  4FH8 A;  2IMK A;  1Z9H A;  4FQU A;  1SYR A;  4ZL7 A;  5D73 A;  5CRG A;  1GSD A;  2R5G A;  4HDE A;  1ZGN A;  3RDW A;  2VD1 A;  1BX9 A;  3DD3 A;  1O7U A;  3WT1 A;  5GAN D;  2GDR A;  4ID0 A;  1ERU A;  1O81 A;  2GT6 A;  1ML6 A;  1XW9 A;  4IW9 A;  2VL9 A;  5ECO B;  2DC5 A;  3GYK A;  3TJF A;  2C8U A;  4KDX A;  5EL8 A;  2HYX A;  5B8B A;  5B7C A;  2FGX A;  1Z7R A;  3ME7 A;  1TU8 A;  2HSN B;  4MZW A;  5HR2 A;  2H6X A;  2H8L A;  2B5X A;  2OBI A;  3MAK A;  2FWH A;  3VK9 A;  3E3E A;  1T1V A;  2MBS A;  3CSJ A;  2YCD A;  2RUF A;  3L0H A;  14GS A;  2E2G A;  4PUA A;  3APQ A;  3H8Q A;  2XPE A;  4XS4 B;  2HRK B;  4EDZ A;  1TK0 B;  3F0I A;  3EWL A;  1Z6M A;  1QFN A;  4MH3 A;  3IBH A;  2BMX A;  3ME8 A;  2J9H A;  5G31 A;  1H4O A;  2GSQ A;  1B4Q A;  2H1B A;  12GS A;  3HDC A;  3FR9 A;  1GUL A;  4KA0 A;  2JU5 A;  1MDJ A;  1EGO A;  4Q5R A;  2AAW A;  4LMV A;  5FT3 A;  2EIO A;  2KLX A;  4MF6 A;  1R4W A;  10GS A;  4L5L A;  3Q19 A;  1XW5 A;  5EPF A;  3FZ5 A;  5DQS A;  3VPT A;  3O76 A;  3GN3 A;  3MDK A;  2CZ3 A;  5DAL A;  3TOU A;  5KN1 A;  3N9J A;  3ZVJ A;  4F9Z A;  2BJX A;  2YP6 A;  4TXO A;  4HJ2 A;  4V2M A;  4ZIL A;  3FR6 A;  5C04 A;  3UBK A;  2R3X A;  2O89 A;  4I6X A;  1G7O A;  4K7I A;  1YJ6 A;  5DBQ A;  2X8G A;  3UAP A;  3GHA A;  5EY6 A;  1KNG A;  3DGQ A;  2C0E A;  4MCU A;  1SKW B;  2WDU A;  2A4V A;  2HFD A;  2R2J A;  5IMA A;  1M99 A;  4ZL9 A;  3S9F A;  2GT5 A;  4QL7 A;  3LFL A;  3M9J A;  1XCC A;  1XIY A;  2GQL A;  2GZP A;  3GUS A;  1EEM A;  1ZYE A;  4K8M A;  3UEM A;  1PL1 A;  2F8F A;  3C1S A;  1XBS A;  2YWM A;  3APS A;  2IPA A;  5H5S A;  3ZMK A;  1XWA A;  1M9A A;  4KSM A;  2H0G A;  3NOF A;  3I69 A;  3ED3 A;  4XRA A;  2OKA A;  2VUP A;  5C00 A;  2WRT A;  4H86 A;  2B5E A;  2LUS A;  1Z6N A;  3R2Q A;  1GSE A;  2DJK A;  5CP1 A;  2X64 A;  3DWV A;  2LTK A;  4AJ8 A;  5A4V A;  4ISD A;  1B4P A;  1YEX A;  4TKY A;  3GMF A;  1MDK A;  1Y6E A;  3ZIJ A;  3LWA A;  3ZVJ D;  4E8E A;  2NDO A;  2JZR A;  5ECR B;  3BJ5 A;  3EC3 A;  3TDG A;  1Z3E A;  4MPG A;  4N0V A;  3O3T A;  2DLX A;  2AV4 A;  1GH2 A;  4EF0 A;  1SD9 A;  1M2D A;  4PQI A;  5A5K A;  2IMF A;  3GL3 A;  2VCQ A;  2L4C A;  4PX1 A;  5B6N A;  1SEN A;  4KAE A;  4ZBB A;  4V2N A;  5DDL A;  3ERG A;  3APO A;  3D6I A;  2AUV A;  3NZN A;  2C3T A;  4YQU A;  3QPM A;  4I97 A;  2LS5 A;  3VWW A;  4MJC A;  3HVS A;  2YZU A;  3W8J A;  2AJQ B;  1JLW A;  4BVY A;  2TRC P;  5JWQ B;  4CW9 A;  2GVP A;  4K2D A;  1R5P A;  2ZUP A;  1XXU A;  1U88 A;  3CRT A;  2KUC A;  4DSS B;  3TJB A;  4JBB A;  2CVK A;  1BJX A;  4ZBD A;  3SWL A;  1GTA A;  4L8E A;  2A2S A;  5IM9 A;  4NPB A;  2CVD A;  4X1U A;  1B48 A;  2IFQ A;  3GH9 A;  1SD8 A;  4RUV A;  2RUE A;  2V6K A;  3TKR A;  4F82 A;  2O87 A;  1R5A A;  1SK1 A;  4MJA A;  2OA7 A;  2GTU A;  3WGE A;  2AB6 A;  2B7J A;  3GX0 A;  3M0F A;  22GS A;  3LYP A;  5KEJ A;  3K8N A;  3EE2 A;  4IQA A;  4MZC A;  4YQV A;  1YEP A;  1B8X A;  1F9M A;  1TJD A;  1ABA A;  4TR4 A;  5E59 A;  1OAZ A;  3IC8 A;  3VWX A;  4GF0 A;  3OR5 A;  4G2E A;  4MAB A;  1TK8 B;  1TI3 A;  1X9W B;  4IEL A;  1O73 A;  1HYU A;  1F37 A;  1JZR A;  4ZBA A;  3WD6 A;  4N10 A;  3VUR A;  5HR1 A;  2E2M A;  4KCA A;  4TR0 A;  2DIY A;  4KX4 A;  2IL3 A;  4J2F A;  2VOC A;  5H5Q A;  1J08 A;  2V32 A;  2JSY A;  2C3Q A;  2NVL A;  2YV9 A;  3GST A;  3WGD A;  4JZQ A;  4RI7 A;  4OFN A;  2RII A;  1NSW A;  2PUK C;  4WR5 A;  1TKD B;  1FHE A;  3IR4 A;  5G2Z A;  2VCW A;  1M2A A;  1OC9 B;  4ML6 A;  4O92 A;  5ID2 A;  3C71 A;  4K1F A;  4K9Z A;  5KN0 A;  1F2E A;  1GSU A;  2G0F A;  1G6W A;  2YWI A;  1GSS A;  2VLV A;  1XWC A;  3FRC A;  1FAA A;  5G1L A;  5J41 A;  4IKH A;  4N0Z A;  2P5R A;  2GS3 A;  1U3I A;  4MMM A;  8GSS A;  2CAI A;  3BBY A;  1OYJ A;  2H1G A;  3KJY A;  1XZO A;  3GNJ A;  1OC8 A;  4J57 E;  1DSB A;  2JZT A;  2OE3 A;  3KGK A;  2LKU A;  5A4W A;  2N5A A;  5IO2 A;  4MLY A;  4KB3 A;  2CAQ A;  3DYR A;  1X5D A;  1X9S B;  3H4K A;  2PPT A;  3VLN A;  3KH7 A;  4TN8 A;  3ZRD A;  1GSF A;  1A2M A;  5F06 A;  1MEK A;  2XC2 A;  2HLS A;  2I3Y A;  3US3 A;  1LU4 A;  5INY A;  5CAX A;  2RM5 A;  2YOI A;  4NHW A;  1S3D A;  2PBJ A;  6GSU A;  1ERT A;  3FZ4 A;  3F6D A;  1XFL A;  2GZZ A;  1Z5Y E;  4PUF C;  1OE7 A;  1TOF A;  3KMN A;  1VGL A;  2OAC A;  3Q6O A;  5LNK e;  4KUN A;  4Q5N A;  1WMJ A;  1A8Y A;  1RW1 A;  4I5Q A;  2L59 A;  3I6A A;  5ECP B;  5GZZ B;  4EL1 A;  1J9B A;  2FUG 2;  2C3N A;  3BD2 A;  3A2V A;  2HE3 A;  2IN3 A;  2HZE A;  2HSY A;  4POK A;  2C4J A;  5LD0 A;  4Q5F A;  1EWX A;  19GS A;  1WWJ A;  5CRD A;  1WOU A;  4WXT A;  3CMI A;  3DVX A;  1PL2 A;  4J56 E;  4FIW A;  2NBS A;  2KOK A;  2CZ2 A;  1W89 A;  2N5B A;  1PKZ A;  4AJ7 A;  5DCH A;  1JHB A;  3IPZ A;  3VI5 A;  3GIX A;  2L6D A;  4PXO A;  4EE0 A;  3VWU A;  1YZX A;  1DE2 A;  1QXH A;  1SK2 A;  3DRN A;  1FB0 A;  1BG5 A;  1BQ7 A;  2FY6 A;  1FG4 A;  2WS2 A;  2GQK A;  3H1N A;  4D73 B;  1HNC A;  3UJ1 A;  4X0X A;  3SBC A;  3HD5 A;  3EUR A;  1UN2 A;  1VF3 A;  1V58 A;  1GTU A;  2V1M A;  3J7Y b;  2X99 A;  4AJ6 A;  1FO5 A;  4EKZ A;  1OC3 A;  3J7Y k;  4TVE A;  4IBP A;  3EMP A;  1SJ6 A;  2H0H A;  11GS A;  6GSW A;  2DJ3 A;  4LA1 A;  4TR3 A;  3F6F A;  1HD2 A;  3LEF A;  3BOA A;  1K3Y A;  3MNG A;  4HZ2 A;  2QGV A;  1S3C A;  1G0T A;  1T3B A;  2B3S A;  2H1D A;  2VM1 A;  3H93 A;  1SKR B;  1AQW A;  1GWC A;  4F0B A;  3CYN A;  3UVH A;  1PRX A;  1T4Y A;  2XPD A;  1O8W A;  3DEX A;  4JR4 A;  1O8X A;  3KD0 A;  2HRN A;  4LMW A;  3F8U A;  4P3Y B;  1YQ1 A;  4DSQ A;  3EMX A;  2C0G A;  2TRX A;  3PIN A;  2OJL A;  4RQX A;  4ZB9 A;  1ZMA A;  2V41 A;  3A5W A;  4GST A;  1JFU A;  1YF0 A;  2RM6 A;  2YJH A;  2HRK A;  1OKT A;  4EO3 A;  1FVJ A;  3ZYW A;  5EVO A;  4WET A;  1Z7P A;  3KM6 A;  2MYG A;  2VAF A;  3D4M A;  9GSS A;  4POB A;  2LJA A;  5B8A A;  3R3E A;  4G19 A;  3M3M A;  3F9U A;  1FB6 A;  1QUW A;  3GKK A;  4MZB A;  4KF9 A;  2I81 A;  2HXK A;  1IYH A;  3RPN A;  1SU9 A;  2IWT A;  1AXD A;  4TXO B;  1VF2 A;  1ST9 A;  2LRC A;  3D22 A;  5HQP A;  2YWO A;  2HSH A;  1XVQ A;  4X43 A;  4LL1 B;  2PGT A;  3D21 A;  1YY7 A;  4XTS A;  3WGX A;  1U6T A;  2I1U A;  4JED A;  4L0U A;  2ON5 A;  1AQX A;  4BPY A;  2NTO A;  3KCM A;  3GSS A;  2VLU A;  5G30 A;  2VCX A;  1XWG A;  1G6Y A;  2LJR A;  1GNE A;  1WE0 A;  1A8L A;  4HU7 A;  3W6G A;  3ZZX A;  1NW2 A;  2RLI A;  2H0I A;  2L4Q A;  2FHE A;  3FW2 A;  4EXJ A;  5CRE A;  5GST A;  1T4Z A;  3PR8 A;  2H30 A;  5AIV A;  1PGT A;  3TUE A;  4HQS A;  4GWR A;  1ZZY A;  2H73 A;  1Y25 A;  3HJP A;  1THO A;  4OCE A;  2GZY A;  2DSA A;  3P8W A;  3GX8 A;  3QDN A;  3ERF A;  2YV7 A;  2PN8 A;  1TP9 A;  1KEB A;  1TRS A;  2HT9 A;  2YNX A;  3FKF A;  2F51 A;  2ZCT A;  3C1R A;  5ENU A;  1V40 A;  1GRX A;  4BA7 A;  3FY7 A;  1A0F A;  4RI6 A;  1RQM A;  1CQH A;  4IP1 A;  2YWN A;  5J9C A;  3GKN A;  4ML1 A;  2DBC A;  5ECM B;  1FVK A;  3ZIV A;  2O8V B;  1WRY A;  1EGR A;  2HZF A;  3LOR A;  1RK4 A;  4NV5 A;  5D9T A;  4KW6 A;  5JWO B;  2VCV A;  3IA1 A;  4POM A;  1AAZ A;  5HFG A;  1ERW A;  3IDV A;  3KP9 A;  2WB9 A;  3UBL A;  3KEB A;  4EDY A;  5IO0 A;  1IYI A;  3KIJ A;  3DML A;  3W8S A;  3E9J B;  5ECK B;  4KH7 A;  3ZL5 A;  3N5O A;  1TRV A;  18GS A;  5ECS A;  3LXZ A;  4K6X A;  4HUA A;  4OWY A;  5D96 A;  4HEA 2;  2ES7 A;  4TR1 A;  5IMV A;  3FHK A;  4LL4 B;  3TKS C;  4OFT A;  1ZCP A;  2DJ0 A;  5AIX A;  2DJ2 A;  2H76 A;  1V2A A;  1VF4 A;  3M9K A;  2YAN A;  2H66 A;  2GLR A;  3GTU B;  4K0N A;  2A2R A;  3TKS E;  3Q18 A;  4E8H A;  1TU7 A;  2H19 A;  4GLT A;  2H1A A;  3BCK A;  3GL5 A;  2C80 A;  4I8B A;  3LG6 A;  4TXV A;  4WR4 A;  1ZL9 A;  4GCI A;  1Q98 A;  1AW9 A;  2F8A A;  2M80 A;  1K0B A;  2IFQ B;  5CYY A;  4DEJ A;  1EP7 A;  2HI7 A;  2FA8 A;  4DSS A;  3QAW A;  2PMT A;  1DUG A;  3F4T A;  1WJK A;  1M7T A;  1WPI A;  4MP4 A;  2OAD A;  2KP2 A;  3ZML A;  1B9X C;  4V1A g;  2PWJ A;  2B7K A;  2LRT A;  3GKX A;  1R26 A;  2OBK A;  3PGT A;  2WJU A;  4OCF A;  1M9B A;  3LXT A;  1U3A A;  1UC7 A;  4ZXG A;  3HA9 A;  4OD7 A;  3EIN A;  1PX6 A;  1GUH A;  4FYC A;  4PTS A;  4IJ3 A;  4OFM A;  1TXX A;  2BTO T;  3TJK A;  3GA4 A;  2R4V A;  5IPG A;  3HZ8 A;  4IS0 A;  3E0U A;  3GFK A;  5CO3 A;  1N8J A;  2E7P A;  2REM A;  5F07 A;  3RPP A;  4NAX A;  1TW9 A;  1PQN A;  1X0R A;  1BYE A;  1PSQ A;  1Q4J A;  2B1K A;  2FWF A;  3TGZ A;  3G7J A;  4USS A;  2K8V A;  1X5C A;  3ZFL A;  4Z7X A;  2TIR A;  1SL0 B;  5ECL B;  2B1L A;  2WFC A;  1EOG A;  3GH6 A;  2GST A;  3GV1 A;  2C0D A;  3DKS A;  2PVO C;  2H70 A;  1K3O A;  2WCI A;  6GSY A;  1K0A A;  5ID2 B;  3I9V 2;  1GUM A;  2HRF A;  3G7I A;  3F63 A;  4NXI A;  2AYT A;  3KH9 A;  4XCS A;  3FEU A;  4GSS A;  3DIE A;  5J3R A;  1GTB A;  1H75 A;  1JZW A;  3EYT A;  1DE1 A;  2QSI A;  2DMM A;  2CQ9 A;  4BL7 A;  3LGC A;  3TRP A;  4G0K A;  4QQ7 A;  4MDC A;  4DVC A;  1KTE A;  7GSS A;  3HJO A;  3IE3 A;  4NHZ A;  1HNA A;  20GS A;  4KE3 A;  2C1Y A;  3IRA A;  2HSM B;  3UVT A;  3ISO A;  1B9Y C;  4BVX B;  3IV4 A;  4N11 A;  5AN1 A;  3P2A A;  4XIH A;  1ACV A;  2L5L A;  3IK7 A;  5AGY A;  4EUY A;  2H6Y A;  1USB A;  1GLQ A;  1UVZ A;  2IMI A;  3IC4 A;  3LYK A;  4BWS A;  4K7O A;  3ERW A;  4MK3 A;  1HNB A;  1SL2 B;  3UL3 A;  1F6M C;  3TKS A;  3D4T A;  2GSS A;  3ZTL A;  3HXS A;  3D0Z A;  1AC1 A;  4TW5 A;  2ON7 A;  1BED A;  5IQY A;  3FZA A;  3QAG A;  1OKD A;  3P90 A;  4JU5 A;  4NMU A;  5D8I A;  1GSY A;  2VD0 A;  3C7M A;  5DAK B;  3GRX A;  4YAV A;  4WBR D;  2K6V A;  5B6M A;  1QGV A;  1YKC A;  1K3L A;  1VF1 A;  1TDI A;  2DIZ A;  1QQ2 A;  2WGR A;  5ECI B;  1ILO A;  1PA3 A;  3GUR A;  1OVN A;  1V98 A;  1NHY A;  2K9F A;  4CHS A;  1CQG A;  2PU9 C;  4BWQ A;  3RAZ A;  3G7Y A;  3QCP A;  3RBT A;  2YPM A;  5JWR B;  1G7E A;  1SKS B;  1FOV A;  4L5O A;  6GSX A;  1TRU A;  2O85 A;  3UIW A;  2FNO A;  5BMU A;  3ZLP A;  1EOH A;  3MSZ A;  6GSS A;  2YN1 A;  4GXZ A;  3G9B A;  4IP6 A;  2FD3 A;  2F3M A;  3QMX A;  5JCG A;  2IJY A;  4XHM A;  4DSR A;  1SYX A;  4D73 A;  3EVI A;  4IJI A;  2P0G A;  2JZS A;  1EV9 A;  4MPF A;  2GGT A;  2H74 A;  4MH2 A;  5D9V A;  1VRS D;  1XWB A;  5IMC A;  1T00 A;  4ECC A;  3CTG A;  4OMV A;  2ZNM A;  3TCO A;  4GTU A;  1T8E B;  1URM A;  3L9S A;  1NHO A;  4F2I A;  3IHQ A;  3JCM L;  3EU3 A;  1R7H A;  1E2Y A;  4PQH A;  2Z9S A;  2V2G A;  4NWY A;  1EZK A;  1PKW A;  4GRF A;  4IN0 A;  3FZ9 A;  4POL A;  2LQQ A;  2XBQ A;  2B6M A;  1EV4 A;  2MMO A;  2G2Q A;  3WT2 A;  4CDO A;  2F9S A;  1GUK A;  1V57 A;  5CRW A;  4IQ1 A;  1A0R P;  4ZB6 A;  1A2J A;  1TI1 A;  2DML A;  3HCZ A;  4JR6 A;  4XS4 A;  2PER A;  4WF5 A;  1KBN A;  3CRU A;  1MD4 A;  3TJG A;  5IOX A;  2MZC A;  3DVW A;  3HHV A;  2H75 A;  2M46 A;  4YAP A;  2PVQ A;  3AY8 A;  2I4A A;  5DJM A;  1XOA A;  5J9B A;  4ACS A;  3ZIT A;  2E0Q A;  1XOB A;  1GTI A;  5DVB A;  3UOM A;  5DAL B;  2P5Q A;  2D2Z A;  2VO4 A;  5HR0 A;  2I9H A;  5CNW A;  5IMD A;  3VI7 A;  3TKQ A;  1WP0 A;  1M2B A;  2H72 A;  2DJJ A;  3UAR A;  4MJB A;  1N2A A;  2R37 A;  2LQO A;  2YZH A;  4EC0 A;  1ZOF A;  5KN3 A;  4QL9 A;  5D9X A;  1BAY A;  5GSS A;  4NV2 A;  3L9U A;  1PX7 A;  17GS A;  2EIQ A;  3HYP A;  1ERV A;  4F0C A;  4WKW A;  5GAP D;  4MA9 A;  5D9W A;  4ECJ A;  3CSH A;  4FO5 A;  2FLS A;  3M8N A;  3F3R A;  1GL8 A;  2VCT A;  1MD3 A;  5G1K A;  2HQT A;  5F0G A;  3F4R A;  4GQC A;  2L5O A;  3LSZ A;  1O85 A;  4EVM A;  4Q5Q A;  3VPQ A;  2JL4 A;  4N30 A;  3KTL A;  4L0W A;  4PGT A;  5COH A;  2M72 A;  3QFB C;  4K7N A;  2B5Y A;  1QK8 A;  3MWH A;  2VL3 A;  2VL2 A;  4IHU A;  3KXO A;  3I43 A;  3U6V A;  4TRX A;  1K0C A;  4RQR A;  2ALB A;  5FWG A;  4O32 A;  5AIS A;  5FHI A;  2QC7 A;  3IAS 2;  1PMT A;  2XHF A;  1AQV A;  2LV3 A;  2VCZ A;  4PNF A;  2CX3 A;  5IOW A;  4KGI A;  2L57 A;  4OO4 A;  1ON4 A;  2JAD A;  5LCZ A;  4ECI A;  4MJE A;  4ZIJ A;  2R6K A;  3KMO A;  3F3Q A;  4WBJ A;  1XPV A;  3TRQ A;  3VFI A;  5G5E A;  5F05 A;  4AF2 A;  1W4V A;  2HRA A;  1X5E A;  3HY2 A;  3DXB A;  2KP1 A;  1LBK A;  4HI7 A;  1FW1 A;  3QR6 A;  1XWK A;  4ULX A;  3A3T A;  3GKM A;  5D93 A;  2GSR A;  5KN2 A;  3P7X A;  4ZB8 A;  3KZQ A;  4TR1 B;  2LEG A;  5F8B A;  2H6Z A;  5J4U A;  4KND A;  4PNG A;  4YQM A;  2EIR A;  1T7P B;  4BVY B;  1EEJ A;  4IGJ A;  5ECH B;  16GS A;  2H71 A;  2P31 A;  1ZYQ B;  2DJ1 A; 
#chains in the Genus database with same CATH topology
 3TOT A;  2XBI A;  2OE1 A;  1XVW A;  1F3B A;  2X8H A;  1AIU A;  3UMA A;  5HFI A;  3GTU A;  3L4N A;  3CBU A;  2CT6 A;  4Z2U A;  3HVV A;  4HZ4 A;  1GP1 A;  4HU9 A;  2DKI A;  4ZL8 A;  2CA8 A;  1PN9 A;  13GS A;  1AUC A;  1YDK A;  2LNS A;  4HS1 A;  2H01 A;  3KTB A;  1S3A A;  3LQ7 A;  3FK8 A;  4FYB A;  2LNT A;  2IMD A;  4K5R A;  1XW6 A;  1I5G A;  4MF5 A;  2MMA A;  1YF1 A;  2VM2 A;  4IVF A;  3IK9 A;  4GQF A;  3TB2 A;  4G0I A;  2VIM A;  3L78 A;  4PI2 C;  4MF7 A;  5JCW A;  1J0F A;  3O6T A;  3IOS A;  5DQY A;  2QA2 A;  1JZO A;  2MMZ A;  2UZ8 A;  3PPU A;  4OO5 A;  5J4V A;  1E6B A;  2FCH A;  2OE0 A;  4KDU A;  3BCI A;  1K0M A;  2AHE A;  3HKR A;  4G0L A;  4I2T A;  2CVB A;  3HJM A;  5E4W A;  2IME A;  3RHB A;  1NM3 A;  5J5N A;  1C72 A;  2WW2 A;  1UA5 A;  2HNL A;  4PQ1 A;  3CTF A;  3QD9 A;  4WF4 A;  3ZRE A;  3LW9 A;  1A24 A;  4ILF A;  4HOJ A;  1PFO A;  2VLT A;  2EFH A;  3F4S A;  3TJJ A;  1QMV A;  3A2X A;  3IHG A;  1M0U A;  4XS1 A;  4GSN A;  4FYU A;  4YH2 A;  3EU4 A;  1F3A A;  1I9D A;  5DCG A;  3A2W A;  1OC9 A;  1GLP A;  5DJL A;  4BL7 B;  3Q74 A;  6GSV A;  1V9W A;  4K0G A;  4KCE A;  4O5Q A;  3FR3 A;  5IMZ A;  3LJR A;  3WYW A;  2V6O A;  4XRD A;  1U87 A;  3C8E A;  1A23 A;  4TOP A;  1SL1 B;  1SJI A;  4HSC X;  1WIK A;  3H79 A;  1DBY A;  3HVX A;  2EC4 A;  1MDI A;  3M1G A;  2OT3 A;  3PH9 A;  1PN0 A;  1MTC A;  3L9V A;  3ZFB A;  4YKF A;  2O7K A;  4JRR A;  4O7H A;  1THX A;  2HSM A;  1TRW A;  2MBT A;  4X4J A;  4BVX A;  4ECB A;  1GNW A;  2LST A;  1K0N A;  4KSO A;  3IXR A;  4CY8 A;  5HR3 A;  3QOU A;  2L6C A;  1SJZ A;  2WUL A;  4JE1 A;  2NPB A;  4PUR A;  3FYG A;  3D5J A;  1K0O A;  2GQM A;  4G9H A;  4F03 A;  2C0F A;  1SK0 A;  1LJR A;  1EP8 A;  1JZD A;  3HZ4 A;  2KHP A;  1GSQ A;  5H5R A;  2JAC A;  5G5F A;  1A2L A;  4I2U A;  2LRN A;  1PD2 1;  2N5F A;  5ELA A;  3IAM 2;  5JCU A;  2WZ9 A;  4KDY A;  2HZE B;  3CSI A;  1TK5 B;  1JLV A;  4G10 A;  5L71 A;  5A4U A;  2MMN A;  3TRX A;  2IIY A;  3C73 A;  2JSZ A;  5ELG A;  3CXG A;  2K18 A;  2FA4 A;  5KOX A;  2O3E A;  5DAK A;  3NIV A;  1O6J A;  5IPH A;  3QAV A;  2K8S A;  3U5R E;  1YKA A;  4AGS A;  1HQO A;  3KP8 A;  6GST A;  5ABR A;  1FOH A;  2LJK A;  2J23 A;  5HFK A;  3V1W A;  2YJ7 A;  3QFA C;  2CV4 A;  3VWV A;  3TKP A;  4O5R A;  1X9M B;  4HJM A;  3RHC A;  2FWG A;  4WEY A;  2QKE A;  1TTZ A;  2X8C A;  4LLR A;  4XS6 A;  5IMF A;  1OE8 A;  4V2L A;  5ECN B;  5CRH A;  5IIZ A;  4HQZ A;  4V1A p;  2VL2 C;  1K0D A;  2CX4 A;  5ECQ B;  2FWE A;  4FH8 A;  2IMK A;  1Z9H A;  4FQU A;  1SYR A;  4ZL7 A;  5D73 A;  5CRG A;  1GSD A;  2R5G A;  4HDE A;  1ZGN A;  3RDW A;  2VD1 A;  1BX9 A;  3DD3 A;  1O7U A;  3WT1 A;  5GAN D;  2GDR A;  4ID0 A;  1ERU A;  1O81 A;  2GT6 A;  1ML6 A;  1XW9 A;  4IW9 A;  2VL9 A;  5ECO B;  2DC5 A;  3GYK A;  3TJF A;  2C8U A;  4KDX A;  5EL8 A;  2HYX A;  5B8B A;  5B7C A;  2FGX A;  1Z7R A;  3ME7 A;  1TU8 A;  2HSN B;  4MZW A;  5HR2 A;  2EFC A;  2H6X A;  2H8L A;  2B5X A;  2OBI A;  3MAK A;  2FWH A;  3VK9 A;  3E3E A;  1T1V A;  2MBS A;  3CSJ A;  2YCD A;  2RUF A;  3L0H A;  14GS A;  2E2G A;  4PUA A;  3RGB C;  5J40 A;  3APQ A;  3H8Q A;  2XPE A;  4XS4 B;  2HRK B;  4EDZ A;  1TK0 B;  3F0I A;  3EWL A;  1Z6M A;  1QFN A;  4MH3 A;  3IBH A;  2BMX A;  4O5U A;  3ME8 A;  2J9H A;  4QMK A;  2WZS A;  5G31 A;  1H4O A;  2GSQ A;  1B4Q A;  2H1B A;  12GS A;  3HDC A;  4K2X A;  3FR9 A;  1GUL A;  4KA0 A;  2JU5 A;  1MDJ A;  1EGO A;  4Q5R A;  5A5H A;  2AAW A;  4LMV A;  5FT3 A;  2EIO A;  2KLX A;  4MF6 A;  1R4W A;  10GS A;  4L5L A;  1BG1 A;  3Q19 A;  2WVY A;  1XW5 A;  5EPF A;  3FZ5 A;  5DQS A;  3VPT A;  3O76 A;  3GN3 A;  3MDK A;  2CZ3 A;  5DAL A;  3TOU A;  5KN1 A;  3MYD A;  3N9J A;  3ZVJ A;  4F9Z A;  2BJX A;  2YP6 A;  4TXO A;  4HJ2 A;  4V2M A;  4ZIL A;  3FR6 A;  5C04 A;  3UBK A;  2R3X A;  2O89 A;  4I6X A;  1G7O A;  4K7I A;  1YJ6 A;  4K5S A;  5DBQ A;  2X8G A;  3UAP A;  3GHA A;  5EY6 A;  1KNG A;  3DGQ A;  2C0E A;  4MCU A;  1SKW B;  2WDU A;  2A4V A;  2HFD A;  4EIQ A;  2R2J A;  5IMA A;  4N3Z A;  1M99 A;  4ZL9 A;  3S9F A;  2GT5 A;  4QL7 A;  3LFL A;  3M9J A;  1XCC A;  1XIY A;  5A34 B;  2GQL A;  1I1I P;  4FXY P;  2GZP A;  3GUS A;  1EEM A;  3A5I A;  1ZYE A;  4K8M A;  3UEM A;  1PL1 A;  2F8F A;  3C1S A;  1XBS A;  2YWM A;  3APS A;  2IPA A;  5H5S A;  3ZMK A;  1XWA A;  1M9A A;  2X4A A;  4KSM A;  2H0G A;  3NOF A;  3I69 A;  3ED3 A;  4XRA A;  2OKA A;  2VUP A;  5C00 A;  4E68 A;  2WRT A;  4H86 A;  2B5E A;  2LUS A;  1Z6N A;  3R2Q A;  1GSE A;  2DJK A;  5CP1 A;  2X64 A;  3DWV A;  2LTK A;  4AJ8 A;  5A4V A;  4ISD A;  1B4P A;  1YEX A;  4TKY A;  4ICY A;  3GMF A;  2EFE A;  1MDK A;  1Y6E A;  3ZIJ A;  3LWA A;  3ZVJ D;  4E8E A;  2NDO A;  2JZR A;  5ECR B;  3BJ5 A;  3EC3 A;  3TDG A;  2EFD A;  1Z3E A;  4MPG A;  4N0V A;  3O3T A;  2DLX A;  2AV4 A;  1GH2 A;  4EF0 A;  1SD9 A;  1M2D A;  4PQI A;  5A5K A;  2IMF A;  3GL3 A;  2VCQ A;  2L4C A;  4PX1 A;  5B6N A;  1SEN A;  4KAE A;  2A2P A;  4ZBB A;  4V2N A;  5DDL A;  3ERG A;  3APO A;  3D6I A;  2AUV A;  3NZN A;  2C3T A;  4YQU A;  4GDF A;  3QPM A;  4I97 A;  2LS5 A;  3VWW A;  4MJC A;  3HVS A;  2YZU A;  3W8J A;  2AJQ B;  1JLW A;  4BVY A;  2TRC P;  5JWQ B;  4CW9 A;  2GVP A;  4K2D A;  1R5P A;  2ZUP A;  1XXU A;  1U88 A;  3CRT A;  2KUC A;  4DSS B;  3TJB A;  4JBB A;  2CVK A;  1BJX A;  4ZBD A;  3SWL A;  1GTA A;  4L8E A;  2A2S A;  5IM9 A;  4NPB A;  2CVD A;  1BF5 A;  4X1U A;  1B48 A;  2IFQ A;  3GH9 A;  1SD8 A;  4RUV A;  2RUE A;  5A1N B;  2V6K A;  3TKR A;  4F82 A;  2O87 A;  1R5A A;  1SK1 A;  4MJA A;  2OA7 A;  2GTU A;  3WGE A;  2AB6 A;  2B7J A;  3GX0 A;  3M0F A;  22GS A;  3LYP A;  5KEJ A;  1YVL A;  3K8N A;  3EE2 A;  4IQA A;  4MZC A;  4YQV A;  1YEP A;  1B8X A;  3EPT A;  1F9M A;  1TJD A;  1ABA A;  4TR4 A;  5E59 A;  1OAZ A;  3IC8 A;  3MIX A;  3VWX A;  4GF0 A;  3OR5 A;  4G2E A;  4MAB A;  1TK8 B;  1TI3 A;  1X9W B;  4IEL A;  1O73 A;  1HYU A;  1F37 A;  1JZR A;  4ZBA A;  3WD6 A;  4N10 A;  3VUR A;  5HR1 A;  2E2M A;  1ZYP A;  4KCA A;  4TR0 A;  2DIY A;  4KX4 A;  2IL3 A;  4J2F A;  2VOC A;  5H5Q A;  1J08 A;  2V32 A;  2JSY A;  2QA1 A;  5J4Y A;  2C3Q A;  2NVL A;  2YV9 A;  3GST A;  3WGD A;  4JZQ A;  4RI7 A;  4OFN A;  2RII A;  1NSW A;  2PUK C;  4MNN A;  4WR5 A;  1TKD B;  1FHE A;  3IR4 A;  5G2Z A;  2VCW A;  1M2A A;  1OC9 B;  4ML6 A;  4O92 A;  5ID2 A;  3C71 A;  4K1F A;  4K9Z A;  5KN0 A;  1F2E A;  1GSU A;  4AI6 A;  2G0F A;  1G6W A;  2YWI A;  1GSS A;  2VLV A;  1XWC A;  3FRC A;  1FAA A;  5G1L A;  5J41 A;  4IKH A;  2H1L A;  4N0Z A;  4PHZ C;  2P5R A;  2GS3 A;  1U3I A;  2DKH A;  4MMM A;  8GSS A;  2CAI A;  3BBY A;  1OYJ A;  2H1G A;  5BRT A;  3KJY A;  1XZO A;  3GNJ A;  1OC8 A;  4J57 E;  1DSB A;  2JZT A;  2OE3 A;  3KGK A;  4A5P A;  2LKU A;  5A4W A;  2N5A A;  5IO2 A;  4MLY A;  4KB3 A;  2CAQ A;  3DYR A;  1X5D A;  1X9S B;  3H4K A;  2PPT A;  3VLN A;  3KH7 A;  4TN8 A;  3ZRD A;  1GSF A;  1A2M A;  5F06 A;  1MEK A;  2XC2 A;  4AKH A;  2HLS A;  2I3Y A;  3US3 A;  1LU4 A;  5INY A;  5CAX A;  2RM5 A;  2YOI A;  4NHW A;  1S3D A;  2PBJ A;  6GSU A;  1ERT A;  3FZ4 A;  3F6D A;  1XFL A;  2GZZ A;  1Z5Y E;  4PUF C;  1OE7 A;  1TOF A;  3KMN A;  1VGL A;  2OAC A;  3Q6O A;  5LNK e;  4KUN A;  4Q5N A;  3FMW A;  1WMJ A;  1A8Y A;  1RW1 A;  4I5Q A;  2L59 A;  3I6A A;  2VKZ G;  5ECP B;  5GZZ B;  4Z2R A;  4EL1 A;  1J9B A;  2FUG 2;  2C3N A;  3BD2 A;  3A2V A;  2HE3 A;  2IN3 A;  2HZE A;  2HSY A;  4POK A;  2C4J A;  5LD0 A;  4Q5F A;  1EWX A;  19GS A;  1WWJ A;  5CRD A;  1WOU A;  4WXT A;  3CMI A;  3DVX A;  1PL2 A;  4J56 E;  4FIW A;  2NBS A;  2KOK A;  2CZ2 A;  1W89 A;  2N5B A;  1PKZ A;  4AJ7 A;  1Y1U A;  5DCH A;  5BMU B;  1JHB A;  3IPZ A;  3VI5 A;  3GIX A;  2L6D A;  1M3J A;  4PXO A;  4EE0 A;  3VWU A;  1YZX A;  1DE2 A;  1QXH A;  1SK2 A;  3DRN A;  1FB0 A;  1BG5 A;  1BQ7 A;  2FY6 A;  1FG4 A;  2WS2 A;  2GQK A;  3H1N A;  4D73 B;  1HNC A;  3UJ1 A;  4X0X A;  3SBC A;  3CHX C;  3HD5 A;  3EUR A;  1UN2 A;  1VF3 A;  1V58 A;  1GTU A;  2V1M A;  5J47 A;  2X99 A;  3J7Y b;  4AJ6 A;  1FO5 A;  4EKZ A;  1OC3 A;  3J7Y k;  4G01 A;  4TVE A;  4IBP A;  3EMP A;  1SJ6 A;  2H0H A;  11GS A;  6GSW A;  2DJ3 A;  4LA1 A;  4YKG A;  4TR3 A;  3F6F A;  1HD2 A;  3LEF A;  3BOA A;  1K3Y A;  3MNG A;  4HZ2 A;  2QGV A;  1S3C A;  1G0T A;  1T3B A;  2B3S A;  2H1D A;  2VM1 A;  3H93 A;  1SKR B;  1AQW A;  1GWC A;  4F0B A;  3CYN A;  3UVH A;  1PRX A;  4PI0 C;  1T4Y A;  2XPD A;  1O8W A;  3DEX A;  4JR4 A;  1O8X A;  3KD0 A;  4CY6 A;  2HRN A;  4LMW A;  2HSN A;  3F8U A;  4P3Y B;  1YQ1 A;  4DSQ A;  4ZB7 A;  3EMX A;  2C0G A;  2WVZ A;  2TRX A;  3PIN A;  2OJL A;  4RQX A;  4ZB9 A;  1ZMA A;  2V41 A;  3A5W A;  4GST A;  1JFU A;  2WVX B;  1YF0 A;  2RM6 A;  2YJH A;  2HRK A;  1OKT A;  4EO3 A;  1FVJ A;  3ZYW A;  5A5H B;  5EVO A;  1TXU A;  4WET A;  1Z7P A;  3KM6 A;  2MYG A;  2VAF A;  3D4M A;  9GSS A;  4POB A;  2LJA A;  5B8A A;  3R3E A;  4G19 A;  3M3M A;  3F9U A;  1FB6 A;  1QUW A;  3GKK A;  4MZB A;  4KF9 A;  2I81 A;  2HXK A;  1IYH A;  3RPN A;  1SU9 A;  2IWT A;  1AXD A;  4TXO B;  1VF2 A;  1ST9 A;  2LRC A;  3D22 A;  5HQP A;  2YWO A;  2HSH A;  1XVQ A;  4X43 A;  4LL1 B;  2PGT A;  3D21 A;  1YY7 A;  4XTS A;  3WGX A;  1U6T A;  2I1U A;  4JED A;  4L0U A;  2ON5 A;  1AQX A;  4BPY A;  2NTO A;  3KCM A;  3GSS A;  2VLU A;  5G30 A;  2VCX A;  1XWG A;  1G6Y A;  2LJR A;  1GNE A;  1WE0 A;  1A8L A;  4HU7 A;  3W6G A;  3ZZX A;  1NW2 A;  2RLI A;  2H0I A;  2L4Q A;  2FHE A;  3FW2 A;  4EXJ A;  5CRE A;  5GST A;  1T4Z A;  3PR8 A;  2H30 A;  5AIV A;  1PGT A;  3TUE A;  4HQS A;  4GWR A;  1ZZY A;  2H73 A;  1Y25 A;  3HJP A;  1THO A;  5A34 A;  2GZY A;  4OCE A;  2DSA A;  3P8W A;  3GX8 A;  3QDN A;  3ERF A;  2YV7 A;  2PN8 A;  1TP9 A;  1KEB A;  1TRS A;  2HT9 A;  2YNX A;  3FKF A;  2F51 A;  2ZCT A;  3C1R A;  5ENU A;  1V40 A;  1GRX A;  4BA7 A;  3FY7 A;  1A0F A;  4RI6 A;  1RQM A;  1CQH A;  4IP1 A;  2YWN A;  5J9C A;  3GKN A;  4ML1 A;  2DBC A;  5ECM B;  1YEW C;  1FVK A;  3ZIV A;  3HVN A;  2O8V B;  1WRY A;  1EGR A;  2HZF A;  3LOR A;  1RK4 A;  4NV5 A;  5D9T A;  4KW6 A;  5JWO B;  2VCV A;  3IA1 A;  4POM A;  1AAZ A;  5HFG A;  1ERW A;  3IDV A;  3KP9 A;  2WB9 A;  3UBL A;  3KEB A;  4EDY A;  5IO0 A;  1IYI A;  2WW3 A;  3KIJ A;  3DML A;  3W8S A;  3E9J B;  5ECK B;  2R0C A;  4KH7 A;  3ZL5 A;  3N5O A;  1TRV A;  18GS A;  5ECS A;  3LXZ A;  4K6X A;  4HUA A;  4OWY A;  5D96 A;  2R0P A;  4HEA 2;  2ES7 A;  4TR1 A;  5IMV A;  3FHK A;  4LL4 B;  3TKS C;  4OFT A;  1ZCP A;  2DJ0 A;  5AIX A;  2DJ2 A;  2H76 A;  1V2A A;  1VF4 A;  3M9K A;  2YAN A;  2H66 A;  3TU3 B;  2GLR A;  3GTU B;  4K0N A;  2A2R A;  3TKS E;  3Q18 A;  4E8H A;  1TU7 A;  2H19 A;  4GLT A;  2H1A A;  3BCK A;  3GL5 A;  2C80 A;  4I8B A;  3LG6 A;  4TXV A;  4WR4 A;  1ZL9 A;  4GCI A;  1Q98 A;  1AW9 A;  2F8A A;  2M80 A;  1M3I A;  1K0B A;  2IFQ B;  5CYY A;  4DEJ A;  1EP7 A;  2HI7 A;  2FA8 A;  4DSS A;  3QAW A;  2PMT A;  1DUG A;  3F4T A;  1WJK A;  1M7T A;  1S3R A;  1WPI A;  4MP4 A;  2OAD A;  2KP2 A;  4AKX B;  3ZML A;  1SVM A;  1B9X C;  4V1A g;  2PWJ A;  2B7K A;  2LRT A;  3GKX A;  1R26 A;  2OBK A;  5A1N A;  3PGT A;  2WJU A;  4OCF A;  1M9B A;  3LXT A;  1U3A A;  1UC7 A;  4ZXG A;  3HA9 A;  4OD7 A;  3EIN A;  1PX6 A;  1GUH A;  4FYC A;  4PTS A;  4IJ3 A;  4OFM A;  1TXX A;  2BTO T;  3TJK A;  3GA4 A;  2R4V A;  5IPG A;  3HZ8 A;  4IS0 A;  3E0U A;  3GFK A;  5CO3 A;  1N8J A;  2E7P A;  2REM A;  5F07 A;  3RPP A;  4NAX A;  1TW9 A;  1PQN A;  1X0R A;  1BYE A;  1PSQ A;  1Q4J A;  1SVL A;  2B1K A;  2FWF A;  3TGZ A;  3G7J A;  4USS A;  2K8V A;  1X5C A;  3ZFL A;  4Z7X A;  2TIR A;  1SL0 B;  5ECL B;  2B1L A;  2WFC A;  1EOG A;  3GH6 A;  2GST A;  3GV1 A;  2R0G A;  2C0D A;  3DKS A;  2PVO C;  2H70 A;  1K3O A;  2WCI A;  6GSY A;  1K0A A;  5ID2 B;  3I9V 2;  1GUM A;  3CWG A;  2HRF A;  3G7I A;  3F63 A;  4NXI A;  2AYT A;  3KH9 A;  4XCS A;  3FEU A;  4GSS A;  3DIE A;  5J3R A;  1GTB A;  1H75 A;  1JZW A;  3EYT A;  1DE1 A;  2QSI A;  2DMM A;  2CQ9 A;  4BL7 A;  3LGC A;  3TRP A;  4G0K A;  4QQ7 A;  4MDC A;  4DVC A;  1KTE A;  1XG8 A;  7GSS A;  3HJO A;  3IE3 A;  4NHZ A;  1HNA A;  20GS A;  4KE3 A;  2C1Y A;  3IRA A;  2HSM B;  3UVT A;  3ISO A;  1B9Y C;  4BVX B;  3IV4 A;  4N11 A;  5AN1 A;  3P2A A;  4XIH A;  1ACV A;  2L5L A;  3IK7 A;  5AGY A;  4EUY A;  2H6Y A;  1USB A;  1GLQ A;  1UVZ A;  2IMI A;  3IC4 A;  3LYK A;  4BWS A;  4K7O A;  3ERW A;  4MK3 A;  1HNB A;  1SL2 B;  3UL3 A;  1F6M C;  3TKS A;  3D4T A;  2GSS A;  3ZTL A;  3HXS A;  1SVO A;  3D0Z A;  3HMJ G;  1AC1 A;  4TW5 A;  2ON7 A;  1BED A;  5IQY A;  3FZA A;  3QAG A;  1OKD A;  3P90 A;  4JU5 A;  4NMU A;  5D8I A;  1GSY A;  3RFR C;  2VD0 A;  3C7M A;  5DAK B;  3GRX A;  4YAV A;  4WBR D;  2K6V A;  4Z2T A;  5B6M A;  1QGV A;  1YKC A;  1K3L A;  1VF1 A;  1TDI A;  2DIZ A;  1QQ2 A;  2WGR A;  5ECI B;  1ILO A;  1PA3 A;  3GUR A;  1OVN A;  1V98 A;  1NHY A;  2K9F A;  1S4B P;  4CHS A;  1CQG A;  2PU9 C;  4BWQ A;  3RAZ A;  3G7Y A;  3QCP A;  3RBT A;  2YPM A;  5JWR B;  1G7E A;  1SKS B;  1FOV A;  4L5O A;  6GSX A;  1TRU A;  2O85 A;  3UIW A;  2FNO A;  5BMU A;  3ZLP A;  1EOH A;  3MSZ A;  6GSS A;  2YN1 A;  4GXZ A;  3G9B A;  4IP6 A;  2FD3 A;  2F3M A;  3QMX A;  5JCG A;  2IJY A;  4XHM A;  4DSR A;  1SYX A;  4D73 A;  3EVI A;  4IJI A;  2P0G A;  2JZS A;  1EV9 A;  4MPF A;  2GGT A;  2H74 A;  4MH2 A;  5D9V A;  1VRS D;  1XWB A;  5IMC A;  1T00 A;  4ECC A;  3CTG A;  4OMV A;  2ZNM A;  3TCO A;  4GTU A;  1T8E B;  1URM A;  3L9S A;  1NHO A;  4F2I A;  3IHQ A;  3JCM L;  3EU3 A;  1R7H A;  1E2Y A;  4PQH A;  2Z9S A;  2X49 A;  2V2G A;  4NWY A;  1EZK A;  1PKW A;  4GRF A;  4IN0 A;  3FZ9 A;  4EIP A;  4POL A;  2LQQ A;  2XBQ A;  2B6M A;  1EV4 A;  2MMO A;  2G2Q A;  3WT2 A;  4CDO A;  2F9S A;  1GUK A;  1V57 A;  5CRW A;  4IQ1 A;  1A0R P;  4ZB6 A;  1A2J A;  1TI1 A;  2DML A;  3HCZ A;  4JR6 A;  4XS4 A;  2PER A;  4WF5 A;  1KBN A;  3CRU A;  1MD4 A;  3TJG A;  5IOX A;  2MZC A;  3DVW A;  3HHV A;  2H75 A;  2M46 A;  4YAP A;  2PVQ A;  3AY8 A;  2I4A A;  5DJM A;  2WVX A;  1XOA A;  5J9B A;  4ACS A;  3ZIT A;  2E0Q A;  1XOB A;  1GTI A;  5DVB A;  3UOM A;  5DAL B;  2P5Q A;  2D2Z A;  2VO4 A;  5HR0 A;  2I9H A;  5CNW A;  5IMD A;  3VI7 A;  3TKQ A;  1WP0 A;  1M2B A;  2H72 A;  2DJJ A;  3UAR A;  4MJB A;  1N2A A;  2R37 A;  2LQO A;  2YZH A;  4EC0 A;  4BIK A;  1ZOF A;  5KN3 A;  4QL9 A;  5D9X A;  1BAY A;  5GSS A;  4NV2 A;  2WW0 A;  3L9U A;  1PX7 A;  17GS A;  2EIQ A;  3HYP A;  1ERV A;  4F0C A;  4WKW A;  5GAP D;  4MA9 A;  5D9W A;  4ECJ A;  2O36 A;  3CSH A;  4FO5 A;  1N25 A;  2FLS A;  3M8N A;  3F3R A;  1GL8 A;  2VCT A;  1MD3 A;  5G1K A;  2HQT A;  5F0G A;  3F4R A;  4GQC A;  2L5O A;  2A4H A;  3LSZ A;  1O85 A;  4EVM A;  4Q5Q A;  3VPQ A;  2JL4 A;  4N30 A;  5KOW A;  3KTL A;  4L0W A;  4PGT A;  5COH A;  2M72 A;  3QFB C;  4K7N A;  2B5Y A;  1QK8 A;  3MWH A;  2VL3 A;  2VL2 A;  4IHU A;  3KXO A;  3I43 A;  3U6V A;  4TRX A;  1K0C A;  4RQR A;  2ALB A;  5FWG A;  4AKI A;  4O32 A;  5AIS A;  5FHI A;  3CQF A;  2O5V A;  2QC7 A;  3IAS 2;  1PMT A;  2XHF A;  1AQV A;  2LV3 A;  2VCZ A;  4PNF A;  2CX3 A;  5IOW A;  4KGI A;  2L57 A;  4OO4 A;  1ON4 A;  2JAD A;  5LCZ A;  4ECI A;  4MJE A;  4ZIJ A;  2R6K A;  3KMO A;  3F3Q A;  4WBJ A;  1XPV A;  3TRQ A;  3VFI A;  5G5E A;  5F05 A;  4AF2 A;  1W4V A;  2HRA A;  1X5E A;  3HY2 A;  3DXB A;  2KP1 A;  1LBK A;  4HI7 A;  1FW1 A;  3QR6 A;  1XWK A;  4ULX A;  3A3T A;  3GKM A;  5D93 A;  2GSR A;  5KN2 A;  3P7X A;  4ZB8 A;  2WW1 A;  3KZQ A;  4TR1 B;  2LEG A;  5F8B A;  2H6Z A;  5J4U A;  4KND A;  4PNG A;  1ZYN A;  4YQM A;  4W66 A;  2EIR A;  1T7P B;  4BVY B;  4AKG A;  1EEJ A;  4IGJ A;  5ECH B;  16GS A;  2UV8 G;  2H71 A;  2P31 A;  1ZYQ B;  2DJ1 A; 
#chains in the Genus database with same CATH homology
 3TOT A;  2XBI A;  2OE1 A;  1XVW A;  1F3B A;  2X8H A;  1AIU A;  3UMA A;  5HFI A;  3GTU A;  3L4N A;  3CBU A;  2CT6 A;  4Z2U A;  3HVV A;  4HZ4 A;  1GP1 A;  4HU9 A;  2DKI A;  4ZL8 A;  2CA8 A;  1PN9 A;  13GS A;  1AUC A;  1YDK A;  2LNS A;  4HS1 A;  2H01 A;  3KTB A;  1S3A A;  3LQ7 A;  3FK8 A;  4FYB A;  2LNT A;  2IMD A;  4K5R A;  1XW6 A;  1I5G A;  4MF5 A;  2MMA A;  1YF1 A;  2VM2 A;  4IVF A;  3IK9 A;  4GQF A;  3TB2 A;  4G0I A;  2VIM A;  3L78 A;  4MF7 A;  5JCW A;  1J0F A;  3O6T A;  3IOS A;  5DQY A;  2QA2 A;  1JZO A;  2MMZ A;  2UZ8 A;  3PPU A;  4OO5 A;  5J4V A;  1E6B A;  2FCH A;  2OE0 A;  4KDU A;  3BCI A;  1K0M A;  2AHE A;  3HKR A;  4G0L A;  4I2T A;  2CVB A;  3HJM A;  5E4W A;  2IME A;  3RHB A;  1NM3 A;  5J5N A;  1C72 A;  1UA5 A;  2HNL A;  4PQ1 A;  3CTF A;  3QD9 A;  4WF4 A;  3ZRE A;  3LW9 A;  1A24 A;  4ILF A;  4HOJ A;  2VLT A;  2EFH A;  3F4S A;  3TJJ A;  1QMV A;  3A2X A;  3IHG A;  1M0U A;  4XS1 A;  4GSN A;  4FYU A;  4YH2 A;  3EU4 A;  1F3A A;  1I9D A;  5DCG A;  3A2W A;  1OC9 A;  1GLP A;  5DJL A;  4BL7 B;  3Q74 A;  6GSV A;  1V9W A;  4K0G A;  4KCE A;  4O5Q A;  3FR3 A;  5IMZ A;  3LJR A;  3WYW A;  2V6O A;  4XRD A;  1U87 A;  3C8E A;  1A23 A;  4TOP A;  1SL1 B;  1SJI A;  1WIK A;  3H79 A;  1DBY A;  3HVX A;  2EC4 A;  1MDI A;  3M1G A;  2OT3 A;  3PH9 A;  1PN0 A;  1MTC A;  3L9V A;  3ZFB A;  4YKF A;  2O7K A;  4JRR A;  4O7H A;  1THX A;  2HSM A;  1TRW A;  2MBT A;  4X4J A;  4BVX A;  4ECB A;  1GNW A;  2LST A;  1K0N A;  4KSO A;  3IXR A;  4CY8 A;  5HR3 A;  3QOU A;  2L6C A;  1SJZ A;  2WUL A;  4JE1 A;  2NPB A;  4PUR A;  3FYG A;  3D5J A;  1K0O A;  2GQM A;  4G9H A;  4F03 A;  2C0F A;  1SK0 A;  1LJR A;  1EP8 A;  1JZD A;  3HZ4 A;  2KHP A;  1GSQ A;  5H5R A;  2JAC A;  5G5F A;  1A2L A;  4I2U A;  2LRN A;  1PD2 1;  2N5F A;  5ELA A;  3IAM 2;  5JCU A;  2WZ9 A;  4KDY A;  2HZE B;  3CSI A;  1TK5 B;  1JLV A;  4G10 A;  5L71 A;  5A4U A;  2MMN A;  3TRX A;  2IIY A;  3C73 A;  2JSZ A;  5ELG A;  3CXG A;  2K18 A;  2FA4 A;  5KOX A;  5DAK A;  3NIV A;  1O6J A;  5IPH A;  3QAV A;  2K8S A;  3U5R E;  1YKA A;  4AGS A;  1HQO A;  3KP8 A;  6GST A;  5ABR A;  1FOH A;  2LJK A;  2J23 A;  5HFK A;  3V1W A;  2YJ7 A;  3QFA C;  2CV4 A;  3VWV A;  3TKP A;  4O5R A;  1X9M B;  4HJM A;  3RHC A;  2FWG A;  4WEY A;  2QKE A;  1TTZ A;  2X8C A;  4LLR A;  4XS6 A;  5IMF A;  1OE8 A;  4V2L A;  5ECN B;  5CRH A;  5IIZ A;  4HQZ A;  4V1A p;  2VL2 C;  1K0D A;  2CX4 A;  5ECQ B;  2FWE A;  4FH8 A;  2IMK A;  1Z9H A;  4FQU A;  1SYR A;  4ZL7 A;  5D73 A;  5CRG A;  1GSD A;  2R5G A;  4HDE A;  1ZGN A;  3RDW A;  2VD1 A;  1BX9 A;  3DD3 A;  1O7U A;  3WT1 A;  5GAN D;  2GDR A;  4ID0 A;  1ERU A;  1O81 A;  2GT6 A;  1ML6 A;  1XW9 A;  4IW9 A;  2VL9 A;  5ECO B;  2DC5 A;  3GYK A;  3TJF A;  2C8U A;  4KDX A;  5EL8 A;  2HYX A;  5B8B A;  5B7C A;  2FGX A;  1Z7R A;  3ME7 A;  1TU8 A;  2HSN B;  4MZW A;  5HR2 A;  2EFC A;  2H6X A;  2H8L A;  2B5X A;  2OBI A;  3MAK A;  2FWH A;  3VK9 A;  3E3E A;  1T1V A;  2MBS A;  3CSJ A;  2YCD A;  2RUF A;  3L0H A;  14GS A;  2E2G A;  4PUA A;  5J40 A;  3APQ A;  3H8Q A;  2XPE A;  4XS4 B;  2HRK B;  4EDZ A;  1TK0 B;  3F0I A;  3EWL A;  1Z6M A;  1QFN A;  4MH3 A;  3IBH A;  2BMX A;  4O5U A;  3ME8 A;  2J9H A;  4QMK A;  5G31 A;  1H4O A;  2GSQ A;  1B4Q A;  2H1B A;  12GS A;  3HDC A;  4K2X A;  3FR9 A;  1GUL A;  4KA0 A;  2JU5 A;  1MDJ A;  1EGO A;  4Q5R A;  5A5H A;  2AAW A;  4LMV A;  5FT3 A;  2EIO A;  2KLX A;  4MF6 A;  1R4W A;  10GS A;  4L5L A;  1BG1 A;  3Q19 A;  1XW5 A;  5EPF A;  3FZ5 A;  5DQS A;  3VPT A;  3O76 A;  3GN3 A;  3MDK A;  2CZ3 A;  5DAL A;  3TOU A;  5KN1 A;  3MYD A;  3N9J A;  3ZVJ A;  4F9Z A;  2BJX A;  2YP6 A;  4TXO A;  4HJ2 A;  4V2M A;  4ZIL A;  3FR6 A;  5C04 A;  3UBK A;  2R3X A;  2O89 A;  4I6X A;  1G7O A;  4K7I A;  1YJ6 A;  4K5S A;  5DBQ A;  2X8G A;  3UAP A;  3GHA A;  5EY6 A;  1KNG A;  3DGQ A;  2C0E A;  4MCU A;  1SKW B;  2WDU A;  2A4V A;  2HFD A;  4EIQ A;  2R2J A;  5IMA A;  4N3Z A;  1M99 A;  4ZL9 A;  3S9F A;  2GT5 A;  4QL7 A;  3LFL A;  3M9J A;  1XCC A;  1XIY A;  5A34 B;  2GQL A;  2GZP A;  3GUS A;  1EEM A;  3A5I A;  1ZYE A;  4K8M A;  3UEM A;  1PL1 A;  2F8F A;  3C1S A;  1XBS A;  2YWM A;  3APS A;  2IPA A;  5H5S A;  3ZMK A;  1XWA A;  1M9A A;  2X4A A;  4KSM A;  2H0G A;  3NOF A;  3I69 A;  3ED3 A;  4XRA A;  2OKA A;  2VUP A;  5C00 A;  4E68 A;  2WRT A;  4H86 A;  2B5E A;  2LUS A;  1Z6N A;  3R2Q A;  1GSE A;  2DJK A;  5CP1 A;  2X64 A;  3DWV A;  2LTK A;  4AJ8 A;  5A4V A;  4ISD A;  1B4P A;  1YEX A;  4TKY A;  4ICY A;  3GMF A;  2EFE A;  1MDK A;  1Y6E A;  3ZIJ A;  3LWA A;  3ZVJ D;  4E8E A;  2NDO A;  2JZR A;  5ECR B;  3BJ5 A;  3EC3 A;  3TDG A;  2EFD A;  1Z3E A;  4MPG A;  4N0V A;  3O3T A;  2DLX A;  2AV4 A;  1GH2 A;  4EF0 A;  1SD9 A;  1M2D A;  4PQI A;  5A5K A;  2IMF A;  3GL3 A;  2VCQ A;  2L4C A;  4PX1 A;  5B6N A;  1SEN A;  4KAE A;  2A2P A;  4ZBB A;  4V2N A;  5DDL A;  3ERG A;  3APO A;  3D6I A;  2AUV A;  3NZN A;  2C3T A;  4YQU A;  4GDF A;  3QPM A;  4I97 A;  2LS5 A;  3VWW A;  4MJC A;  3HVS A;  2YZU A;  3W8J A;  2AJQ B;  1JLW A;  4BVY A;  2TRC P;  5JWQ B;  4CW9 A;  2GVP A;  4K2D A;  1R5P A;  2ZUP A;  1XXU A;  1U88 A;  3CRT A;  2KUC A;  4DSS B;  3TJB A;  4JBB A;  2CVK A;  1BJX A;  4ZBD A;  3SWL A;  1GTA A;  4L8E A;  2A2S A;  5IM9 A;  4NPB A;  2CVD A;  1BF5 A;  4X1U A;  1B48 A;  2IFQ A;  3GH9 A;  1SD8 A;  4RUV A;  2RUE A;  5A1N B;  2V6K A;  3TKR A;  4F82 A;  2O87 A;  1R5A A;  1SK1 A;  4MJA A;  2OA7 A;  2GTU A;  3WGE A;  2AB6 A;  2B7J A;  3GX0 A;  3M0F A;  22GS A;  3LYP A;  5KEJ A;  1YVL A;  3K8N A;  3EE2 A;  4IQA A;  4MZC A;  4YQV A;  1YEP A;  1B8X A;  3EPT A;  1F9M A;  1TJD A;  1ABA A;  4TR4 A;  5E59 A;  1OAZ A;  3IC8 A;  3MIX A;  3VWX A;  4GF0 A;  3OR5 A;  4G2E A;  4MAB A;  1TK8 B;  1TI3 A;  1X9W B;  4IEL A;  1O73 A;  1HYU A;  1F37 A;  1JZR A;  4ZBA A;  3WD6 A;  4N10 A;  3VUR A;  5HR1 A;  2E2M A;  1ZYP A;  4KCA A;  4TR0 A;  2DIY A;  4KX4 A;  2IL3 A;  4J2F A;  2VOC A;  5H5Q A;  1J08 A;  2V32 A;  2JSY A;  2QA1 A;  5J4Y A;  2C3Q A;  2NVL A;  2YV9 A;  3GST A;  3WGD A;  4JZQ A;  4RI7 A;  4OFN A;  2RII A;  1NSW A;  2PUK C;  4MNN A;  4WR5 A;  1TKD B;  1FHE A;  3IR4 A;  5G2Z A;  2VCW A;  1M2A A;  1OC9 B;  4ML6 A;  4O92 A;  5ID2 A;  3C71 A;  4K1F A;  4K9Z A;  5KN0 A;  1F2E A;  1GSU A;  4AI6 A;  2G0F A;  1G6W A;  2YWI A;  1GSS A;  2VLV A;  1XWC A;  3FRC A;  1FAA A;  5G1L A;  5J41 A;  4IKH A;  2H1L A;  4N0Z A;  2P5R A;  2GS3 A;  1U3I A;  2DKH A;  4MMM A;  8GSS A;  2CAI A;  3BBY A;  1OYJ A;  2H1G A;  5BRT A;  3KJY A;  1XZO A;  3GNJ A;  1OC8 A;  4J57 E;  1DSB A;  2JZT A;  2OE3 A;  3KGK A;  4A5P A;  2LKU A;  5A4W A;  2N5A A;  5IO2 A;  4MLY A;  4KB3 A;  2CAQ A;  3DYR A;  1X5D A;  1X9S B;  3H4K A;  2PPT A;  3VLN A;  3KH7 A;  4TN8 A;  3ZRD A;  1GSF A;  1A2M A;  5F06 A;  1MEK A;  2XC2 A;  4AKH A;  2HLS A;  2I3Y A;  3US3 A;  1LU4 A;  5INY A;  5CAX A;  2RM5 A;  2YOI A;  4NHW A;  1S3D A;  2PBJ A;  6GSU A;  1ERT A;  3FZ4 A;  3F6D A;  1XFL A;  2GZZ A;  1Z5Y E;  4PUF C;  1OE7 A;  1TOF A;  3KMN A;  1VGL A;  2OAC A;  3Q6O A;  5LNK e;  4KUN A;  4Q5N A;  3FMW A;  1WMJ A;  1A8Y A;  1RW1 A;  4I5Q A;  2L59 A;  3I6A A;  2VKZ G;  5ECP B;  5GZZ B;  4Z2R A;  4EL1 A;  1J9B A;  2FUG 2;  2C3N A;  3BD2 A;  3A2V A;  2HE3 A;  2IN3 A;  2HZE A;  2HSY A;  4POK A;  2C4J A;  5LD0 A;  4Q5F A;  1EWX A;  19GS A;  1WWJ A;  5CRD A;  1WOU A;  4WXT A;  3CMI A;  3DVX A;  1PL2 A;  4J56 E;  4FIW A;  2NBS A;  2KOK A;  2CZ2 A;  1W89 A;  2N5B A;  1PKZ A;  4AJ7 A;  1Y1U A;  5DCH A;  5BMU B;  1JHB A;  3IPZ A;  3VI5 A;  3GIX A;  2L6D A;  4PXO A;  4EE0 A;  3VWU A;  1YZX A;  1DE2 A;  1QXH A;  1SK2 A;  3DRN A;  1FB0 A;  1BG5 A;  1BQ7 A;  2FY6 A;  1FG4 A;  2WS2 A;  2GQK A;  3H1N A;  4D73 B;  1HNC A;  3UJ1 A;  4X0X A;  3SBC A;  3HD5 A;  3EUR A;  1UN2 A;  1VF3 A;  1V58 A;  1GTU A;  2V1M A;  5J47 A;  2X99 A;  3J7Y b;  4AJ6 A;  1FO5 A;  4EKZ A;  1OC3 A;  3J7Y k;  4G01 A;  4TVE A;  4IBP A;  3EMP A;  1SJ6 A;  2H0H A;  11GS A;  6GSW A;  2DJ3 A;  4LA1 A;  4YKG A;  4TR3 A;  3F6F A;  1HD2 A;  3LEF A;  3BOA A;  1K3Y A;  3MNG A;  4HZ2 A;  2QGV A;  1S3C A;  1G0T A;  1T3B A;  2B3S A;  2H1D A;  2VM1 A;  3H93 A;  1SKR B;  1AQW A;  1GWC A;  4F0B A;  3CYN A;  3UVH A;  1PRX A;  1T4Y A;  2XPD A;  1O8W A;  3DEX A;  4JR4 A;  1O8X A;  3KD0 A;  4CY6 A;  2HRN A;  4LMW A;  2HSN A;  3F8U A;  4P3Y B;  1YQ1 A;  4DSQ A;  4ZB7 A;  3EMX A;  2C0G A;  2TRX A;  3PIN A;  2OJL A;  4RQX A;  4ZB9 A;  1ZMA A;  2V41 A;  3A5W A;  4GST A;  1JFU A;  1YF0 A;  2RM6 A;  2YJH A;  2HRK A;  1OKT A;  4EO3 A;  1FVJ A;  3ZYW A;  5A5H B;  5EVO A;  1TXU A;  4WET A;  1Z7P A;  3KM6 A;  2MYG A;  2VAF A;  3D4M A;  9GSS A;  4POB A;  2LJA A;  5B8A A;  3R3E A;  4G19 A;  3M3M A;  3F9U A;  1FB6 A;  1QUW A;  3GKK A;  4MZB A;  4KF9 A;  2I81 A;  2HXK A;  1IYH A;  3RPN A;  1SU9 A;  2IWT A;  1AXD A;  4TXO B;  1VF2 A;  1ST9 A;  2LRC A;  3D22 A;  5HQP A;  2YWO A;  2HSH A;  1XVQ A;  4X43 A;  4LL1 B;  2PGT A;  3D21 A;  1YY7 A;  4XTS A;  3WGX A;  1U6T A;  2I1U A;  4JED A;  4L0U A;  2ON5 A;  1AQX A;  4BPY A;  2NTO A;  3KCM A;  3GSS A;  2VLU A;  5G30 A;  2VCX A;  1XWG A;  1G6Y A;  2LJR A;  1GNE A;  1WE0 A;  1A8L A;  4HU7 A;  3W6G A;  3ZZX A;  1NW2 A;  2RLI A;  2H0I A;  2L4Q A;  2FHE A;  3FW2 A;  4EXJ A;  5CRE A;  5GST A;  1T4Z A;  3PR8 A;  2H30 A;  5AIV A;  1PGT A;  3TUE A;  4HQS A;  4GWR A;  1ZZY A;  2H73 A;  1Y25 A;  3HJP A;  1THO A;  5A34 A;  2GZY A;  4OCE A;  2DSA A;  3P8W A;  3GX8 A;  3QDN A;  3ERF A;  2YV7 A;  2PN8 A;  1TP9 A;  1KEB A;  1TRS A;  2HT9 A;  2YNX A;  3FKF A;  2F51 A;  2ZCT A;  3C1R A;  5ENU A;  1V40 A;  1GRX A;  4BA7 A;  3FY7 A;  1A0F A;  4RI6 A;  1RQM A;  1CQH A;  4IP1 A;  2YWN A;  5J9C A;  3GKN A;  4ML1 A;  2DBC A;  5ECM B;  1FVK A;  3ZIV A;  2O8V B;  1WRY A;  1EGR A;  2HZF A;  3LOR A;  1RK4 A;  4NV5 A;  5D9T A;  4KW6 A;  5JWO B;  2VCV A;  3IA1 A;  4POM A;  1AAZ A;  5HFG A;  1ERW A;  3IDV A;  3KP9 A;  2WB9 A;  3UBL A;  3KEB A;  4EDY A;  5IO0 A;  1IYI A;  3KIJ A;  3DML A;  3W8S A;  3E9J B;  5ECK B;  2R0C A;  4KH7 A;  3ZL5 A;  3N5O A;  1TRV A;  18GS A;  5ECS A;  3LXZ A;  4K6X A;  4HUA A;  4OWY A;  5D96 A;  2R0P A;  4HEA 2;  2ES7 A;  4TR1 A;  5IMV A;  3FHK A;  4LL4 B;  3TKS C;  4OFT A;  1ZCP A;  2DJ0 A;  5AIX A;  2DJ2 A;  2H76 A;  1V2A A;  1VF4 A;  3M9K A;  2YAN A;  2H66 A;  3TU3 B;  2GLR A;  3GTU B;  4K0N A;  2A2R A;  3TKS E;  3Q18 A;  4E8H A;  1TU7 A;  2H19 A;  4GLT A;  2H1A A;  3BCK A;  3GL5 A;  2C80 A;  4I8B A;  3LG6 A;  4TXV A;  4WR4 A;  1ZL9 A;  4GCI A;  1Q98 A;  1AW9 A;  2F8A A;  2M80 A;  1K0B A;  2IFQ B;  5CYY A;  4DEJ A;  1EP7 A;  2HI7 A;  2FA8 A;  4DSS A;  3QAW A;  2PMT A;  1DUG A;  3F4T A;  1WJK A;  1M7T A;  1WPI A;  4MP4 A;  2OAD A;  2KP2 A;  4AKX B;  3ZML A;  1SVM A;  1B9X C;  4V1A g;  2PWJ A;  2B7K A;  2LRT A;  3GKX A;  1R26 A;  2OBK A;  5A1N A;  3PGT A;  2WJU A;  4OCF A;  1M9B A;  3LXT A;  1U3A A;  1UC7 A;  4ZXG A;  3HA9 A;  4OD7 A;  3EIN A;  1PX6 A;  1GUH A;  4FYC A;  4PTS A;  4IJ3 A;  4OFM A;  1TXX A;  2BTO T;  3TJK A;  3GA4 A;  2R4V A;  5IPG A;  3HZ8 A;  4IS0 A;  3E0U A;  3GFK A;  5CO3 A;  1N8J A;  2E7P A;  2REM A;  5F07 A;  3RPP A;  4NAX A;  1TW9 A;  1PQN A;  1X0R A;  1BYE A;  1PSQ A;  1Q4J A;  1SVL A;  2B1K A;  2FWF A;  3TGZ A;  3G7J A;  4USS A;  2K8V A;  1X5C A;  3ZFL A;  4Z7X A;  2TIR A;  1SL0 B;  5ECL B;  2B1L A;  2WFC A;  1EOG A;  3GH6 A;  2GST A;  3GV1 A;  2R0G A;  2C0D A;  3DKS A;  2PVO C;  2H70 A;  1K3O A;  2WCI A;  6GSY A;  1K0A A;  5ID2 B;  3I9V 2;  1GUM A;  3CWG A;  2HRF A;  3G7I A;  3F63 A;  4NXI A;  2AYT A;  3KH9 A;  4XCS A;  3FEU A;  4GSS A;  3DIE A;  5J3R A;  1GTB A;  1H75 A;  1JZW A;  3EYT A;  1DE1 A;  2QSI A;  2DMM A;  2CQ9 A;  4BL7 A;  3LGC A;  3TRP A;  4G0K A;  4QQ7 A;  4MDC A;  4DVC A;  1KTE A;  7GSS A;  3HJO A;  3IE3 A;  4NHZ A;  1HNA A;  20GS A;  4KE3 A;  2C1Y A;  3IRA A;  2HSM B;  3UVT A;  3ISO A;  1B9Y C;  4BVX B;  3IV4 A;  4N11 A;  5AN1 A;  3P2A A;  4XIH A;  1ACV A;  2L5L A;  3IK7 A;  5AGY A;  4EUY A;  2H6Y A;  1USB A;  1GLQ A;  1UVZ A;  2IMI A;  3IC4 A;  3LYK A;  4BWS A;  4K7O A;  3ERW A;  4MK3 A;  1HNB A;  1SL2 B;  3UL3 A;  1F6M C;  3TKS A;  3D4T A;  2GSS A;  3ZTL A;  3HXS A;  1SVO A;  3D0Z A;  3HMJ G;  1AC1 A;  4TW5 A;  2ON7 A;  1BED A;  5IQY A;  3FZA A;  3QAG A;  1OKD A;  3P90 A;  4JU5 A;  4NMU A;  5D8I A;  1GSY A;  2VD0 A;  3C7M A;  5DAK B;  3GRX A;  4YAV A;  4WBR D;  2K6V A;  4Z2T A;  5B6M A;  1QGV A;  1YKC A;  1K3L A;  1VF1 A;  1TDI A;  2DIZ A;  1QQ2 A;  2WGR A;  5ECI B;  1ILO A;  1PA3 A;  3GUR A;  1OVN A;  1V98 A;  1NHY A;  2K9F A;  4CHS A;  1CQG A;  2PU9 C;  4BWQ A;  3RAZ A;  3G7Y A;  3QCP A;  3RBT A;  2YPM A;  5JWR B;  1G7E A;  1SKS B;  1FOV A;  4L5O A;  6GSX A;  1TRU A;  2O85 A;  3UIW A;  2FNO A;  5BMU A;  3ZLP A;  1EOH A;  3MSZ A;  6GSS A;  2YN1 A;  4GXZ A;  3G9B A;  4IP6 A;  2FD3 A;  2F3M A;  3QMX A;  5JCG A;  2IJY A;  4XHM A;  4DSR A;  1SYX A;  4D73 A;  3EVI A;  4IJI A;  2P0G A;  2JZS A;  1EV9 A;  4MPF A;  2GGT A;  2H74 A;  4MH2 A;  5D9V A;  1VRS D;  1XWB A;  5IMC A;  1T00 A;  4ECC A;  3CTG A;  4OMV A;  2ZNM A;  3TCO A;  4GTU A;  1T8E B;  1URM A;  3L9S A;  1NHO A;  4F2I A;  3IHQ A;  3JCM L;  3EU3 A;  1R7H A;  1E2Y A;  4PQH A;  2Z9S A;  2X49 A;  2V2G A;  4NWY A;  1EZK A;  1PKW A;  4GRF A;  4IN0 A;  3FZ9 A;  4EIP A;  4POL A;  2LQQ A;  2XBQ A;  2B6M A;  1EV4 A;  2MMO A;  2G2Q A;  3WT2 A;  4CDO A;  2F9S A;  1GUK A;  1V57 A;  5CRW A;  4IQ1 A;  1A0R P;  4ZB6 A;  1A2J A;  1TI1 A;  2DML A;  3HCZ A;  4JR6 A;  4XS4 A;  2PER A;  4WF5 A;  1KBN A;  3CRU A;  1MD4 A;  3TJG A;  5IOX A;  2MZC A;  3DVW A;  3HHV A;  2H75 A;  2M46 A;  4YAP A;  2PVQ A;  3AY8 A;  2I4A A;  5DJM A;  1XOA A;  5J9B A;  4ACS A;  3ZIT A;  2E0Q A;  1XOB A;  1GTI A;  5DVB A;  3UOM A;  5DAL B;  2P5Q A;  2D2Z A;  2VO4 A;  5HR0 A;  2I9H A;  5CNW A;  5IMD A;  3VI7 A;  3TKQ A;  1WP0 A;  1M2B A;  2H72 A;  2DJJ A;  3UAR A;  4MJB A;  1N2A A;  2R37 A;  2LQO A;  2YZH A;  4EC0 A;  1ZOF A;  5KN3 A;  4QL9 A;  5D9X A;  1BAY A;  5GSS A;  4NV2 A;  3L9U A;  1PX7 A;  17GS A;  2EIQ A;  3HYP A;  1ERV A;  4F0C A;  4WKW A;  5GAP D;  4MA9 A;  5D9W A;  4ECJ A;  3CSH A;  4FO5 A;  1N25 A;  2FLS A;  3M8N A;  3F3R A;  1GL8 A;  2VCT A;  1MD3 A;  5G1K A;  2HQT A;  5F0G A;  3F4R A;  4GQC A;  2L5O A;  2A4H A;  3LSZ A;  1O85 A;  4EVM A;  4Q5Q A;  3VPQ A;  2JL4 A;  4N30 A;  5KOW A;  3KTL A;  4L0W A;  4PGT A;  5COH A;  2M72 A;  3QFB C;  4K7N A;  2B5Y A;  1QK8 A;  3MWH A;  2VL3 A;  2VL2 A;  4IHU A;  3KXO A;  3I43 A;  3U6V A;  4TRX A;  1K0C A;  4RQR A;  2ALB A;  5FWG A;  4AKI A;  4O32 A;  5AIS A;  5FHI A;  2O5V A;  2QC7 A;  3IAS 2;  1PMT A;  2XHF A;  1AQV A;  2LV3 A;  2VCZ A;  4PNF A;  2CX3 A;  5IOW A;  4KGI A;  2L57 A;  4OO4 A;  1ON4 A;  2JAD A;  5LCZ A;  4ECI A;  4MJE A;  4ZIJ A;  2R6K A;  3KMO A;  3F3Q A;  4WBJ A;  1XPV A;  3TRQ A;  3VFI A;  5G5E A;  5F05 A;  4AF2 A;  1W4V A;  2HRA A;  1X5E A;  3HY2 A;  3DXB A;  2KP1 A;  1LBK A;  4HI7 A;  1FW1 A;  3QR6 A;  1XWK A;  4ULX A;  3A3T A;  3GKM A;  5D93 A;  2GSR A;  5KN2 A;  3P7X A;  4ZB8 A;  3KZQ A;  4TR1 B;  2LEG A;  5F8B A;  2H6Z A;  5J4U A;  4KND A;  4PNG A;  1ZYN A;  4YQM A;  4W66 A;  2EIR A;  1T7P B;  4BVY B;  4AKG A;  1EEJ A;  4IGJ A;  5ECH B;  16GS A;  2UV8 G;  2H71 A;  2P31 A;  1ZYQ B;  2DJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...