2PMTA

Glutathione transferase from proteus mirabilis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
201
structure length
201
Chain Sequence
b'MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE TRANSFERASE
publication title A mixed disulfide bond in bacterial glutathione transferase: functional and evolutionary implications.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Transferase
total genus 73
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2pmtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pmtA01
2BJXA 1XPVA 4GQFA 4ZL8A 1EP7A 5IM9A 4OO4A 1RW1A 3EINA 3GTUA 3KXOA 1CQGA 2HRKB 2MMAA 5ECQB 2VUPA 1B4QA 1Z9HA 1X5DA 1TDIA 5IMVA 4KNDA 2B5YA 2F8AA 2FWFA 1VF3A 2C1YA 4KE3A 5DJMA 1NM3A 1HNAA 1EV9A 1S3CA 1UN2A 3IAS2 3V1WA 1T7PB 4WBJA 2AAWA 1OKDA 3ZTLA 3Q6OA 4EVMA 4NHZA 2QGVA 3HVVA 3WD6A 3TKQA 3IRAA 5CRDA 4JBBA 5F05A 1S3DA 1X5CA 3HY2A 1GSUA 2C0FA 2RM5A 1XW9A 2DJ0A 4O7HA 3C1RA 1J08A 3LG6A 4FYBA 3QAGA 3ZMLA 2C0EA 1XIYA 5B6MA 3KJYA 2LQOA 5G31A 1GSYA 1O6JA 2XBQA 5D9XA 2LNSA 2MBSA 3G7YA 3WGDA 1B4PA 2X8CA 3RHCA 4RI6A 2RUEA 3A3TA 2B1KA 4V2NA 2K8VA 1FB0A 1G0TA 2R2JA 3F63A 3GTUB 2YJ7A 5AISA 2P5RA 2L4QA 3FZ5A 4X43A 2VCZA 4X1UA 2HRAA 1YQ1A 1XOBA 4BL7B 3LXZA 2CAQA 1GH2A 1NHOA 3UOMA 2VM1A 2H30A 2LSTA 4I6XA 3PH9A 2YOIA 3IXRA 4ZB8A 1A0FA 2H8LA 3Q18A 4MP4A 2LEGA 4KUNA 2JSZA 2DJ1A 2LJAA 3P7XA 4E8HA 4TR3A 1X5EA 2O87A 2OE3A 3GKXA 5CRHA 4TOPA 3W6GA 3G7IA 1YDKA 1FOVA 4KSMA 2E7PA 3L9SA 1AXDA 3A5WA 5CRGA 5IOWA 3IOSA 3QD9A 3KTLA 5H5QA 1K0AA 4HQZA 2XC2A 2F51A 3TJFA 4PTSA 2HQTA 2HZFA 3FKFA 2X8HA 4NAXA 1Z5YE 3MNGA 4TR4A 4KH7A 4MF6A 1UC7A 1AW9A 3LYKA 5KN2A 4GWRA 4IQ1A 3EU4A 4OO5A 2MYGA 5C04A 1ZMAA 1WMJA 1GUHA 2HSNB 1THOA 1M7TA 2N5AA 1EGRA 2B6MA 3EVIA 2QSIA 3LYPA 5ECMB 2JL4A 4EC0A 1O85A 4ZL9A 4PGTA 3TRPA 3GL3A 3ZVJD 5ELAA 4KCAA 2H6YA 2OE0A 2GQMA 4KX4A 2TIRA 3H1NA 3ZFBA 3D22A 3M3MA 2DJ2A 1BJXA 4ZIJA 3KMNA 4XHMA 5IMAA 4AJ7A 2CZ3A 2C8UA 3BOAA 1GNEA 2R5GA 3WGXA 1KEBA 1NW2A 4YQMA 4J57E 3TJKA 2H1GA 1TU8A 1URMA 1GTUA 2FWGA 2GT6A 2LRNA 13GSA 1ACVA 4EO3A 4G10A 4WR4A 1A8YA 4EUYA 4MA9A 2IMIA 2CZ2A 3PPUA 3I43A 4RQRA 2O7KA 5G5EA 1YEXA 1M99A 3CTGA 4PQIA 3UVHA 2ES7A 4WF4A 2BMXA 5HFKA 2NTOA 5IMZA 2FA8A 3GSSA 3GV1A 1ZL9A 1F3AA 4NHWA 4OD7A 4KDXA 5IQYA 3KEBA 5ECPB 3D6IA 1T00A 5ECKB 3TOTA 4Q5QA 1V2AA 4HZ4A 4PX1A 3HJPA 1GSEA 1O8WA 1SU9A 1PGTA 5HR0A 1WOUA 2VCWA 1DSBA 2XHFA 4IGJA 5DVBA 3TKRA 3ZITA 2H0GA 1SK1A 4NWYA 3F0IA 6GSUA 3A2VA 2REMA 1TKDB 2FY6A 3VFIA 4EDYA 4NV5A 1F9MA 3U5RE 2KOKA 4MCUA 1Z7PA 5DDLA 1T4YA 3MSZA 1O73A 2H6XA 3F6DA 5D9WA 3M9KA 1AQWA 1W4VA 5IMCA 3VI7A 4K7IA 2RIIA 1SENA 2B1LA 4YQUA 1JFUA 1OC9A 1Z3EA 22GSA 5B8BA 4MPGA 3ZIVA 3FRCA 5A4WA 3ERFA 3IC8A 2LUSA 5DAKA 2GZPA 5IMFA 5AIVA 4HJMA 2R6KA 2H70A 1MDKA 4K7OA 4MJAA 2DMMA 4I2TA 4LLRA 2GSQA 2PN8A 2MMNA 4TRXA 3A2WA 3Q19A 4J56E 1SJIA 2H1DA 2AUVA 2VCTA 1OC3A 5E4WA 1ZZYA 5A4VA 1OE7A 3MDKA 4ULXA 2B7KA 2V6KA 2AHEA 5INYA 5IPGA 4V1Ag 2HRFA 3S9FA 5CREA 4BVYB 3H4KA 2GS3A 8GSSA 1FW1A 4HU7A 3RPPA 3GMFA 5GAPD 2C3QA 5EVOA 3DRNA 4BVXA 2J23A 4HEA2 2H6ZA 2FHEA 1TXXA 2WDUA 3RHBA 3EC3A 2VL9A 1MDIA 1SK2A 3M0FA 1U3AA 5ECLB 3IK7A 2I9HA 4LL1B 2C0GA 4EDZA 1A24A 3ED3A 1X9WB 2CAIA 3P90A 2IPAA 1ZOFA 1KTEA 5J41A 1IYIA 1TTZA 5GAND 5DAKB 1YJ6A 2H19A 4JR4A 3GKNA 1GUMA 1EZKA 4JEDA 2WJUA 3EMXA 4K2DA 1Z7RA 1EWXA 2EC4A 1MEKA 5HR2A 2OACA 2FWHA 3C73A 3HKRA 2JACA 3LEFA 1YY7A 2B5XA 2DIYA 5D93A 1QGVA 1F3BA 1VRSD 3RBTA 3P8WA 4P3YB 3ZRDA 2L5OA 4XCSA 1SJZA 3C71A 1TU7A 1A0RP 2X64A 3GX0A 4MABA 2L59A 3C1SA 1SJ6A 1K0DA 4XS1A 3CXGA 2CV4A 3GNJA 3PGTA 2YWOA 4RI7A 1B9YC 4FIWA 2TRCP 4I2UA 3KMOA 2VL2C 4PNGA 3RPNA 1NSWA 2LV3A 2VM2A 2YV9A 2KLXA 2DJJA 3GX8A 4HJ2A 4BVXB 1TI3A 4MJEA 1GL8A 4AJ8A 1X9MB 6GSYA 4K0GA 1OVNA 5CNWA 4KW6A 5J3RA 1BAYA 3D4MA 4MJCA 1V58A 2AYTA 3TUEA 4CW9A 2XPDA 3TRQA 2G0FA 5J4UA 3TKPA 3L4NA 4F9ZA 4POBA 4XRDA 1FVJA 1U87A 1JZRA 3ZFLA 5FWGA 3ZREA 1I9DA 3GH6A 3NZNA 2WS2A 3CSHA 4KAEA 7GSSA 4ILFA 3PINA 4ECBA 4ECIA 3IBHA 5DCHA 2A2SA 1K0BA 4I97A 3K8NA 1RK4A 2AV4A 4BL7A 2ON7A 1XZOA 2J9HA 4KDYA 4N11A 2JZRA 5H5SA 3VWWA 4XTSA 2P0GA 4TR1A 5H5RA 5GSTA 2OE1A 1YF0A 1I5GA 3KD0A 4BA7A 3HXSA 2CX3A 2F3MA 3ZYWA 2HFDA 2M46A 18GSA 1FHEA 4Q5FA 3LFLA 1TI1A 1XXUA 3QAWA 5ABRA 4L5OA 3IAM2 2VIMA 1K3OA 4WF5A 3GSTA 1K0OA 4POMA 2WCIA 1PX6A 4K6XA 4EXJA 2GQKA 5HR1A 3FY7A 3W8SA 1S3AA 3BJ5A 3O3TA 2IMEA 2TRXA 2ON5A 2L6CA 3LWAA 3VURA 1T8EB 5AGYA 3AY8A 3I9V2 4TKYA 1R26A 3ZVJA 4YH2A 2PU9C 3FYGA 4K7NA 1QMVA 2KUCA 1WPIA 3ZLPA 3LSZA 1TRWA 2L57A 5J5NA 4IP6A 2XBIA 2Z9SA 1GNWA 2FCHA 2GQLA 3HHVA 1QFNA 4L8EA 1MDJA 3UJ1A 1SD9A 1GP1A 4TR1B 1OYJA 1OE8A 4YQVA 1ILOA 4ZBAA 1GTIA 3G9BA 1NHYA 2V41A 2H71A 4FO5A 4OCEA 2M72A 3UMAA 3IV4A 3QMXA 4MPFA 4K0NA 1EP8A 2MMOA 3FZAA 1Y6EA 1A2LA 1EGOA 3MAKA 1M2DA 3IE3A 1EEMA 2EIQA 2GT5A 3CMIA 4WEYA 3U6VA 2HI7A 3GL5A 2VL2A 4AGSA 4WKWA 4OMVA 4ZILA 3L9VA 2AB6A 2H01A 2K9FA 2DMLA 4IBPA 3O6TA 1HNBA 3GUSA 2VL3A 5IMDA 3KP9A 2YNXA 2HZEA 4K1FA 4MK3A 5F0GA 1EEJA 1K3YA 3ISOA 2XPEA 1XVQA 1MTCA 6GSXA 2V2GA 4GCIA 1T1VA 2PBJA 1SKWB 3P2AA 4QQ7A 1M0UA 3CTFA 1E2YA 2JSYA 1AQXA 4PURA 5ECNB 2FD3A 2VD0A 1ST9A 3APQA 1W89A 2IMDA 1M9BA 1LU4A 2V6OA 4ISDA 2OBIA 1WP0A 1TJDA 5AN1A 4GSNA 1E6BA 3FW2A 4N0ZA 3HYPA 4EE0A 1YEPA 4HS1A 3FHKA 1PMTA 5GSSA 2DJKA 4DVCA 3HZ4A 1F2EA 3TKSC 3SWLA 11GSA 3N9JA 3LXTA 2UZ8A 3HJMA 2DIZA 4JR6A 4IKHA 4L5LA 3D21A 3QFBC 3IC4A 4PQ1A 2HZEB 3GH9A 1VGLA 3FZ4A 5CP1A 2FNOA 3QDNA 2E2GA 20GSA 1THXA 1U6TA 2ZNMA 3FEUA 2LTKA 5IIZA 2KHPA 1ON4A 2K6VA 4TXOB 10GSA 3CBUA 5E59A 5DALA 2CVDA 5F07A 1GLQA 1BYEA 4PUFC 2L4CA 3GRXA 1SD8A 4ZXGA 3E9JB 1LBKA 4KB3A 2HE3A 5ECHB 2FA4A 1TK5B 4NV2A 4BVYA 4KA0A 4TW5A 4HDEA 2IMFA 1M2AA 3QAVA 4MJBA 4HI7A 2M80A 3NIVA 3C8EA 2GSTA 3DVWA 3IA1A 4BPYA 1IYHA 2IN3A 4G0LA 4D73A 3IK9A 4XS4A 3KZQA 1PSQA 3KGKA 4F82A 2R4VA 1BEDA 4IN0A 5L71A 3UEMA 1AAZA 2MZCA 4ZB9A 3ERWA 4XRAA 1OAZA 2QKEA 1QQ2A 2DSAA 4LMWA 1PKZA 2AJQB 4JZQA 2DBCA 6GSVA 1F37A 4ZBDA 4MDCA 2YZUA 4DEJA 1U3IA 5JCGA 1KBNA 4G0KA 4GRFA 2WRTA 1V9WA 4IP1A 3A2XA 4PXOA 1PKWA 3F3QA 5DALB 1JHBA 5D9VA 4V2MA 3BCKA 2PWJA 3WGEA 1T3BA 2WFCA 3F8UA 1O8XA 5ECOB 4TVEA 2HXKA 3TKSE 12GSA 3G7JA 3VLNA 4E8EA 1FG4A 3Q74A 2MMZA 2C80A 5D8IA 1Y25A 4LA1A 2I81A 3LGCA 2L6DA 5BMUA 2OA7A 3UIWA 4NMUA 1FB6A 3ERGA 1WRYA 4WR5A 2C3NA 4OCFA 3FR9A 3F6FA 2YWIA 4D73B 5AIXA 3GYKA 4XS4B 4CHSA 3DVXA 3VWUA 1B9XC 2LKUA 3TDGA 4DSQA 3D0ZA 4OFMA 1PD21 4POLA 3QPMA 2PVQA 2GSRA 3HD5A 4PNFA 4RUVA 4WBRD 3HZ8A 4ZBBA 2IJYA 3JCML 2VLVA 5IO2A 1ZYQB 1EOGA 1SYRA 4EL1A 2EIRA 2HSYA 2RLIA 3CRTA 1SL2B 3GKKA 3VPQA 2CT6A 2IWTA 1HQOA 1WIKA 2HSHA 1Q4JA 2IMKA 1ZGNA 1GRXA 2JADA 4IJIA 3UARA 2QC7A 2KP2A 2H1AA 2GVPA 2DC5A 3ZIJA 1ZYEA 2H74A 4KSOA 5HR3A 1UVZA 2B7JA 1K3LA 3TGZA 3E3EA 2MBTA 3VK9A 3BBYA 4WETA 3GFKA 4GLTA 4Q5NA 4IS0A 3GIXA 3FK8A 1JZOA 5ECSA 3TB2A 3HVSA 5D73A 4ZB6A 3QFAC 4POKA 3ZMKA 5G30A 16GSA 2A2RA 1G6WA 2LJKA 2YPMA 4GF0A 2NBSA 1GWCA 3W8JA 5KEJA 4MF5A 3D5JA 3GHAA 2PGTA 2HT9A 2YN1A 2YV7A 4FH8A 1JZWA 3DKSA 3R3EA 1K0CA 2GZZA 3BCIA 3ME8A 2YP6A 2FWEA 5J9CA 3CSJA 3WT2A 2JZTA 1HNCA 4HOJA 3H8QA 1OKTA 3F9UA 3BD2A 2B5EA 2WB9A 4IHUA 1G7OA 1ERVA 1DE2A 5ECRB 2L5LA 5A4UA 5ECIB 2P31A 1CQHA 1ERWA 1YKAA 1GSDA 5HQPA 3GKMA 2D2ZA 3LORA 4MH3A 3UAPA 5KN1A 1PN9A 4OWYA 2IFQA 1B48A 1XFLA 1XCCA 3ZZXA 3M1GA 2WGRA 1PL2A 4YAVA 3EU3A 3GN3A 1M2BA 3O76A 4G0IA 1XW5A 2HNLA 2JU5A 4K8MA 4OFTA 4DSSA 3US3A 3VPTA 2NVLA 4AJ6A 2RUFA 1X9SB 2PPTA 2OADA 4FYCA 4IELA 2LS5A 2LJRA 3KM6A 4ECCA 3N5OA 1R7HA 3QR6A 2IL3A 3HA9A 2RM6A 4MZWA 2H72A 2I4AA 4ZL7A 2YWMA 3TRXA 2PMTA 2V1MA 2FLSA 1DBYA 2N5FA 3FR3A 4N0VA 3ZL5A 2C3TA 2VO4A 3CRUA 1TK8B 4H86A 4F0BA 1GSQA 1JLVA 1GULA 5DBQA 3KTBA 5G5FA 3DXBA 3APSA 4NPBA 2IFQB 5JWQB 1M9AA 1X0RA 14GSA 3DIEA 3HDCA 3UVTA 3E0UA 5DCGA 1SK0A 1J9BA 5HFIA 4PUAA 1QUWA 5C00A 3F4TA 3DYRA 2G2QA 5JWRB 3DGQA 2ZUPA 2YCDA 2ZCTA 4DSSB 4F03A 2X8GA 3UBLA 1XVWA 4Q5RA 3TJJA 4FYUA 1DUGA 3IPZA 2VLTA 2X99A 3D4TA 2GZYA 4TR0A 1ABAA 2H0HA 4EF0A 4BWQA 3CYNA 2CA8A 2YJHA 4QL7A 2I3YA 1T4ZA 3I6AA 1ERTA 2EIOA 2H66A 3QCPA 6GSWA 4KGIA 1A8LA 1WE0A 4RQXA 4ML1A 2DJ3A 1BX9A 1TOFA 3EE2A 4Z7XA 4FQUA 4G9HA 2O85A 3TJGA 5ID2A 4GXZA 1V40A 1V98A 2H73A 2C4JA 1R4WA 2YWNA 2GTUA 1K0NA 6GSSA 4TXOA 1YKCA 3F3RA 2OKAA 2N5BA 5B6NA 1GSFA 1R5PA 1SL1B 3R2QA 3L9UA 1GUKA 2O8VB 3F4RA 4EKZA 4K9ZA 4NXIA 1GTAA 2LQQA 3HVXA 3RAZA 4ECJA 5KN0A 3H93A 3OR5A 1XOAA 3VI5A 3IDVA 4I8BA 5LNKe 2A4VA 3M9JA 2GGTA 1TW9A 1B8XA 2VCQA 1EV4A 1O7UA 3HJOA 4ML6A 2HSMA 2HYXA 4GQCA 1LJRA 1DE1A 3WYWA 4GTUA 3KH9A 2NPBA 1FAAA 5CO3A 4O92A 9GSSA 2CVBA 1PA3A 6GSTA 2H0IA 3M8NA 3PR8A 3L78A 1AC1A 2CX4A 1HYUA 1OC8A 2HRNA 5ID2B 1FVKA 1Z6NA 5G2ZA 5F06A 3UL3A 1SKSB 1MD3A 4HZ2A 4IW9A 4MH2A 1AIUA 1WJKA 4JRRA 4F2IA 5A5KA 3J7Yk 1U88A 2JZSA 5CAXA 2C0DA 2LRCA 3SBCA 1GLPA 4MF7A 1TK0B 3EMPA 3TOUA 4TXVA 5FT3A 3FZ9A 4O32A 1EOHA 5COHA 3DD3A 3RDWA 5KN3A 5IPHA 2FGXA 4KDUA 2PERA 1YF1A 5EY6A 2DLXA 4X0XA 5ENUA 1J0FA 3TCOA 1ML6A 5B8AA 4GSSA 2YANA 5JCWA 2CQ9A 1XW6A 1JLWA 3EURA 1A2MA 3WT1A 3KH7A 1XWKA 2HSMB 1WWJA 1G6YA 2I1UA 2O89A 2K18A 1Q98A 3F4SA 3TJBA 1GTBA 1MD4A 2GSSA 1JZDA 1F6MC 1C72A 3ME7A 1XWAA 2OJLA 1Z6MA 5D9TA 4AF2A 1G7EA 2PVOC 4V2LA 3GURA 2OBKA 2VAFA 1PRXA 1PX7A 3NOFA 4JE1A 2K8SA 4L0UA 1TP9A 4ID0A 4LL4B 2KP1A 3EWLA 4IQAA 4OFNA 4GSTA 2VCVA 1YZXA 1QXHA 1K0MA 5LCZA 2YZHA 5IO0A 5IOXA 4J2FA 2E2MA 1N2AA 3H79A 4HU9A 4MZCA 4TN8A 3DMLA 5ELGA 1H75A 1FO5A 1BQ7A 4N10A 4ACSA 4IVFA 5EPFA 1BG5A 4PQHA 4V1Ap 3C7MA 1V57A 1ERUA 1XWCA 1R5AA 2R3XA 4F0CA 4QL9A 3MWHA 5DJLA 4KF9A 1N8JA 5CYYA 4YAPA 2H75A 1HD2A 1SL0B 3LJRA 1ZCPA 3DEXA 4N30A 3QOUA 4CDOA 1GSSA 1TRSA 3J7Yb 4G2EA 1A2JA 5D96A 4BWSA 1H4OA 1XWGA 4LMVA 1A23A 3DWVA 2NDOA 1RQMA 2F8FA 2HLSA 4IJ3A 5G1LA 2GLRA 3FR6A 3IR4A 1OC9B 5EL8A 1O81A 4XS6A 2H76A 4HQSA 3KIJA 3CSIA 1SKRB 2VCXA 1VF1A 19GSA 3IHQA 4WXTA 2BTOT 4G19A 5CRWA 4DSRA 5DQYA 3TKSA 2VD1A 2ALBA 4I5QA 4MZBA 2VOCA 2HRKA 1QK8A 2GDRA 3I69A 2B3SA 4USSA 2V32A 1USBA 5F8BA 3L0HA 3GA4A 1UA5A 2P5QA 4KCEA 2VLUA 4JU5A 3KP8A 4L0WA 1AQVA 4MLYA 2H1BA 2WULA 3EYTA 3VWVA 5JCUA 2LNTA 5FHIA 1XBSA 1KNGA 3LQ7A 5GZZB 4HUAA 3UBKA 3VWXA 1VF4A 2FUG2 3APOA 3HCZA 1VF2A 5HFGA 2CVKA 5LD0A 1TRUA 5JWOB 1TRVA 17GSA 5B7CA 1PL1A 2WZ9A 5DQSA 2E0QA 2F9SA 2LRTA 1XWBA 1PQNA 2R37A 3KCMA 1AUCA 5G1KA 4MMMA 4O5RA 1SYXA 5J9BA 2IIYA 2PUKC 4XIHA
chains in the Genus database with same CATH superfamily
2BJXA 1XPVA 4GQFA 4ZL8A 1EP7A 5IM9A 4OO4A 3IHGA 1RW1A 3EINA 3GTUA 3KXOA 1CQGA 2HRKB 4MNNA 2MMAA 5ECQB 2VUPA 1B4QA 1Z9HA 1X5DA 5BRTA 1TDIA 5IMVA 4KNDA 2B5YA 2F8AA 2FWFA 1VF3A 2C1YA 4KE3A 5DJMA 1NM3A 1HNAA 1EV9A 1S3CA 1UN2A 3IAS2 3V1WA 1SVMA 1T7PB 4WBJA 2AAWA 1OKDA 3ZTLA 1PFOA 3Q6OA 4EVMA 4NHZA 2UV8G 2QGVA 3HVVA 3WD6A 3TKQA 3IRAA 5CRDA 4JBBA 5F05A 1S3DA 1X5CA 3HY2A 1GSUA 2C0FA 2RM5A 1XW9A 2EFCA 2DJ0A 4O7HA 2O3EA 3CHXC 3C1RA 1J08A 3LG6A 4FYBA 3QAGA 3ZMLA 2C0EA 1XIYA 5B6MA 3KJYA 2LQOA 5G31A 1GSYA 1O6JA 2XBQA 5D9XA 2LNSA 2MBSA 3G7YA 3WGDA 1B4PA 2X8CA 3RHCA 4RI6A 2RUEA 3A3TA 2B1KA 4V2NA 2K8VA 1FB0A 1G0TA 2R2JA 3F63A 3GTUB 2YJ7A 5AISA 2P5RA 2L4QA 3FZ5A 4X43A 2VCZA 2HSNA 4X1UA 3CQFA 2HRAA 1YQ1A 1XOBA 4BL7B 3LXZA 2CAQA 1GH2A 1NHOA 3UOMA 2VM1A 2H30A 2LSTA 4I6XA 3PH9A 2YOIA 3IXRA 4ZB8A 1A0FA 2H8LA 1SVOA 3Q18A 4MP4A 2LEGA 4KUNA 2JSZA 2DJ1A 2LJAA 3P7XA 4E8HA 2EFEA 4TR3A 1X5EA 2O87A 2OE3A 3GKXA 5CRHA 4TOPA 3W6GA 3G7IA 1YDKA 1FOVA 4KSMA 2E7PA 3L9SA 1AXDA 3A5WA 5CRGA 5IOWA 3IOSA 3QD9A 3KTLA 5H5QA 1K0AA 4HQZA 2A2PA 4YKFA 2XC2A 2F51A 3TJFA 4PTSA 2HQTA 2HZFA 3FKFA 4X4JA 2X8HA 4NAXA 1Z5YE 3MNGA 4TR4A 4KH7A 4MF6A 1UC7A 1AW9A 3LYKA 5J47A 5KN2A 4GWRA 4IQ1A 3EU4A 4OO5A 2MYGA 5C04A 1ZMAA 1WMJA 2WW3A 1GUHA 2HSNB 1THOA 1M7TA 2N5AA 1EGRA 2B6MA 3EVIA 2QSIA 3LYPA 5ECMB 2JL4A 4EC0A 1O85A 4ZL9A 4PGTA 3TRPA 3GL3A 3ZVJD 5ELAA 4KCAA 2H6YA 2OE0A 2GQMA 4KX4A 2TIRA 3H1NA 3ZFBA 3D22A 3EPTA 3M3MA 1PN0A 2DJ2A 1BJXA 4ZIJA 3KMNA 4XHMA 5IMAA 4AJ7A 2CZ3A 2C8UA 3BOAA 1GNEA 2R5GA 3WGXA 1KEBA 1NW2A 2EFHA 4YQMA 4J57E 3TJKA 2H1GA 4PI2C 1TU8A 1URMA 1GTUA 2FWGA 2GT6A 2LRNA 13GSA 1ACVA 4EO3A 4G10A 4WR4A 1A8YA 4EUYA 4MA9A 2IMIA 2CZ2A 3PPUA 3I43A 4RQRA 2O7KA 5G5EA 1S3RA 1YEXA 1M99A 3CTGA 4PQIA 3UVHA 2ES7A 4WF4A 2BMXA 5HFKA 2NTOA 5IMZA 2FA8A 3GSSA 1ZYPA 3GV1A 1ZL9A 1F3AA 4NHWA 4OD7A 4KDXA 5J4VA 5IQYA 3KEBA 5ECPB 3D6IA 1T00A 5ECKB 3TOTA 4Q5QA 1V2AA 4HZ4A 4PX1A 3HJPA 1GSEA 3FMWA 1O8WA 1SU9A 1PGTA 5HR0A 1WOUA 2VCWA 1DSBA 2XHFA 4IGJA 5DVBA 3TKRA 3ZITA 2H0GA 1SK1A 4NWYA 2WVYA 3F0IA 6GSUA 3A2VA 2REMA 1TKDB 2FY6A 3VFIA 4EDYA 4NV5A 1F9MA 3U5RE 2KOKA 4MCUA 4CY6A 1Z7PA 5DDLA 1T4YA 3MSZA 1O73A 2H6XA 3F6DA 5D9WA 3M9KA 1TXUA 1AQWA 1W4VA 5IMCA 3VI7A 4K7IA 2RIIA 1SENA 2B1LA 4YQUA 1JFUA 1OC9A 1Z3EA 22GSA 5B8BA 4MPGA 3ZIVA 1M3IA 3FRCA 5A4WA 3ERFA 3IC8A 2LUSA 4CY8A 2X49A 3HMJG 5DAKA 2GZPA 5IMFA 5AIVA 4HJMA 2R6KA 2H70A 1MDKA 4K7OA 4MJAA 2DMMA 4I2TA 4LLRA 2GSQA 2PN8A 2MMNA 4TRXA 3A2WA 3Q19A 4J56E 1SJIA 2H1DA 2AUVA 2VCTA 1OC3A 5E4WA 1ZZYA 5A4VA 1OE7A 3MDKA 4ULXA 2B7KA 2V6KA 2AHEA 5INYA 5IPGA 4V1Ag 2HRFA 3LW9A 3S9FA 5CREA 4BVYB 3H4KA 2GS3A 8GSSA 4K5SA 1FW1A 4HU7A 3RPPA 3GMFA 5GAPD 2C3QA 5EVOA 3DRNA 4BVXA 2J23A 4HEA2 2H6ZA 2FHEA 1TXXA 2WDUA 3RHBA 3EC3A 2VL9A 1MDIA 1SK2A 3M0FA 1U3AA 5ECLB 3IK7A 4N3ZA 2I9HA 4LL1B 2C0GA 4EDZA 1A24A 3ED3A 1X9WB 2CAIA 3P90A 2IPAA 1ZOFA 1KTEA 5J41A 1IYIA 1TTZA 5GAND 5DAKB 1YJ6A 2H19A 4JR4A 3GKNA 1GUMA 1EZKA 4JEDA 2WJUA 3EMXA 4K2DA 1Z7RA 1EWXA 2EC4A 1FOHA 1MEKA 5HR2A 2OACA 2FWHA 3C73A 3HKRA 2JACA 3LEFA 1YY7A 2B5XA 2DIYA 5D93A 1QGVA 1F3BA 1VRSD 3RBTA 3P8WA 4P3YB 3ZRDA 2L5OA 4XCSA 1SJZA 3C71A 1TU7A 4Z2RA 1A0RP 2X64A 3GX0A 4MABA 2L59A 3C1SA 1SJ6A 1K0DA 4XS1A 3CXGA 2CV4A 3GNJA 3PGTA 2YWOA 4RI7A 1B9YC 4FIWA 2TRCP 4I2UA 3KMOA 2VL2C 4PNGA 3RPNA 1NSWA 2LV3A 5BMUB 2VM2A 2YV9A 2KLXA 2DJJA 3GX8A 4HJ2A 4BVXB 1TI3A 5A5HB 4AKXB 4MJEA 1GL8A 4AJ8A 1X9MB 6GSYA 4K0GA 1OVNA 5CNWA 4KW6A 5J3RA 1BAYA 3D4MA 4Z2UA 4MJCA 1V58A 2AYTA 3TUEA 4CW9A 2XPDA 3TRQA 2G0FA 5J4UA 3TKPA 3L4NA 4F9ZA 4POBA 4XRDA 1FVJA 1U87A 1JZRA 3ZFLA 5FWGA 3ZREA 1I9DA 3GH6A 3NZNA 2WS2A 3CSHA 4KAEA 7GSSA 4ILFA 3PINA 4ECBA 3RFRC 4ECIA 3IBHA 5DCHA 2A2SA 1K0BA 4I97A 3K8NA 1RK4A 1XG8A 2AV4A 4BL7A 2ON7A 1XZOA 2J9HA 4KDYA 1BG1A 4N11A 3MYDA 2JZRA 5H5SA 3VWWA 4XTSA 2P0GA 4TR1A 5H5RA 5GSTA 2OE1A 1YF0A 1I5GA 3KD0A 4BA7A 3HXSA 2CX3A 2F3MA 3ZYWA 2HFDA 2DKIA 2M46A 4W66A 18GSA 1FHEA 4Q5FA 3LFLA 1TI1A 1XXUA 3QAWA 5ABRA 4L5OA 3IAM2 2VIMA 1K3OA 4WF5A 3GSTA 1K0OA 2DKHA 4POMA 2WCIA 1PX6A 4K6XA 4EXJA 2GQKA 5HR1A 3FY7A 3W8SA 1S3AA 3BJ5A 5J40A 3O3TA 2IMEA 2TRXA 2ON5A 2L6CA 3LWAA 3VURA 1T8EB 5AGYA 3AY8A 3I9V2 4TKYA 1R26A 3ZVJA 4YH2A 2PU9C 3FYGA 4K7NA 1QMVA 5KOWA 2KUCA 1WPIA 3ZLPA 3LSZA 1TRWA 2L57A 5J5NA 4IP6A 2XBIA 2Z9SA 1GNWA 2FCHA 2GQLA 3MIXA 2OT3A 3HHVA 1YEWC 1QFNA 4BIKA 4YKGA 4L8EA 1MDJA 3UJ1A 1SD9A 1GP1A 4TR1B 1OYJA 1OE8A 4YQVA 1ILOA 4ZBAA 1GTIA 3G9BA 1NHYA 2V41A 2H71A 4FO5A 4OCEA 2M72A 3UMAA 3IV4A 3QMXA 4MPFA 4K0NA 1EP8A 2MMOA 3FZAA 1Y6EA 1A2LA 1EGOA 3MAKA 1M2DA 3IE3A 1EEMA 2EIQA 2GT5A 2R0PA 3CMIA 4WEYA 3U6VA 2HI7A 3GL5A 2VL2A 4AGSA 4WKWA 4OMVA 4ZILA 3L9VA 2AB6A 2H01A 2K9FA 2DMLA 4IBPA 3O6TA 1HNBA 3GUSA 2VL3A 5IMDA 4EIPA 3KP9A 2YNXA 2HZEA 4K1FA 4MK3A 5F0GA 1EEJA 1K3YA 3ISOA 2XPEA 1XVQA 1MTCA 6GSXA 2V2GA 2WW0A 4GCIA 1T1VA 2PBJA 1SKWB 3P2AA 4QQ7A 1M0UA 3CTFA 1E2YA 2JSYA 1AQXA 4PURA 5ECNB 2FD3A 2VD0A 1ST9A 3APQA 1W89A 2IMDA 1M9BA 2WVXA 1LU4A 2V6OA 4ISDA 2OBIA 4ZB7A 1WP0A 1TJDA 5AN1A 4GSNA 1E6BA 3FW2A 4N0ZA 3HYPA 4EE0A 1YEPA 4HS1A 3FHKA 1PMTA 5GSSA 2DJKA 4DVCA 3HZ4A 1F2EA 3TKSC 3SWLA 11GSA 3N9JA 3LXTA 2UZ8A 3HJMA 2DIZA 4G01A 4JR6A 4IKHA 4L5LA 3D21A 3QFBC 3IC4A 4PQ1A 2HZEB 3GH9A 1VGLA 3FZ4A 5CP1A 2FNOA 2H1LA 3QDNA 2E2GA 20GSA 1THXA 1U6TA 2ZNMA 3FEUA 2LTKA 5IIZA 2KHPA 1ON4A 2K6VA 4TXOB 10GSA 3CBUA 5E59A 5DALA 2CVDA 5F07A 1GLQA 1BYEA 4PUFC 2L4CA 3GRXA 1SD8A 4ZXGA 3E9JB 1LBKA 4KB3A 2HE3A 5ECHB 2FA4A 1TK5B 2WVXB 4NV2A 4BVYA 4KA0A 4TW5A 4HDEA 2IMFA 1M2AA 3QAVA 4MJBA 4HI7A 2M80A 3NIVA 3C8EA 2GSTA 3DVWA 3IA1A 4BPYA 1IYHA 2IN3A 4G0LA 4D73A 3IK9A 4XS4A 3KZQA 1PSQA 1ZYNA 3KGKA 4F82A 2R4VA 1BEDA 4IN0A 5L71A 3UEMA 1AAZA 2MZCA 4ZB9A 3ERWA 5A1NA 3A5IA 4XRAA 1OAZA 2QKEA 1QQ2A 2DSAA 4LMWA 1PKZA 2AJQB 4JZQA 2DBCA 6GSVA 1F37A 4ZBDA 4MDCA 2YZUA 4DEJA 1U3IA 5JCGA 1KBNA 4G0KA 4GRFA 2WRTA 1V9WA 4IP1A 3A2XA 4PXOA 2WZSA 1PKWA 3F3QA 5DALB 1JHBA 5D9VA 4V2MA 3BCKA 2PWJA 3WGEA 1T3BA 2WFCA 3F8UA 1O8XA 5ECOB 4TVEA 2HXKA 3TKSE 12GSA 3G7JA 3VLNA 4E8EA 1FG4A 3Q74A 2MMZA 2C80A 5D8IA 1Y25A 4LA1A 2I81A 3LGCA 2L6DA 5BMUA 2OA7A 3UIWA 4NMUA 1FB6A 3ERGA 1WRYA 4HSCX 4WR5A 2C3NA 4OCFA 3FR9A 3F6FA 5A5HA 2YWIA 4D73B 5AIXA 3GYKA 4XS4B 4CHSA 3DVXA 3VWUA 1B9XC 2LKUA 3TDGA 4DSQA 3D0ZA 4OFMA 1PD21 4POLA 5A1NB 3QPMA 2PVQA 2GSRA 3HD5A 4PNFA 4RUVA 4WBRD 3HZ8A 4ZBBA 2IJYA 3JCML 2VLVA 5IO2A 1ZYQB 1EOGA 1SYRA 4EL1A 5KOXA 2EIRA 2HSYA 2RLIA 3CRTA 1SL2B 3GKKA 3VPQA 2CT6A 2IWTA 1HQOA 2WVZA 1WIKA 2HSHA 1Q4JA 2IMKA 1ZGNA 1GRXA 2JADA 4IJIA 3UARA 2QC7A 2KP2A 2H1AA 2GVPA 2DC5A 3ZIJA 1ZYEA 2H74A 4KSOA 5HR3A 1UVZA 2B7JA 1K3LA 3TGZA 3E3EA 2MBTA 3VK9A 3BBYA 5A34A 4FXYP 4WETA 4K5RA 3GFKA 4GLTA 4Q5NA 4IS0A 3GIXA 3FK8A 1JZOA 5ECSA 3TB2A 3HVSA 5D73A 4ZB6A 3QFAC 4POKA 3ZMKA 5G30A 16GSA 2A2RA 1G6WA 3CWGA 2LJKA 2YPMA 1M3JA 4Z2TA 4GF0A 2NBSA 1GWCA 3W8JA 5KEJA 4MF5A 3D5JA 3GHAA 2PGTA 2HT9A 2YN1A 2YV7A 4FH8A 1I1IP 1JZWA 3DKSA 3R3EA 1K0CA 2O36A 2GZZA 3BCIA 3ME8A 2YP6A 2FWEA 5J9CA 3CSJA 3WT2A 2JZTA 1HNCA 4HOJA 4K2XA 3H8QA 1OKTA 3RGBC 3F9UA 3BD2A 2B5EA 2WB9A 4IHUA 1G7OA 1ERVA 1DE2A 5ECRB 2L5LA 5A4UA 5ECIB 2P31A 5A34B 1CQHA 1ERWA 1YKAA 1GSDA 5HQPA 3GKMA 2D2ZA 3LORA 4MH3A 3UAPA 5KN1A 1PN9A 4OWYA 2IFQA 1B48A 1XFLA 1XCCA 3ZZXA 3M1GA 2WGRA 1PL2A 4YAVA 3EU3A 3GN3A 1M2BA 3O76A 4G0IA 1XW5A 2HNLA 2JU5A 4K8MA 4OFTA 2R0GA 4DSSA 1SVLA 3US3A 3VPTA 2NVLA 4AJ6A 1S4BP 2RUFA 1X9SB 2PPTA 2OADA 4FYCA 4IELA 2LS5A 2LJRA 3KM6A 4ECCA 3N5OA 1R7HA 3QR6A 2IL3A 3HA9A 2RM6A 4MZWA 2H72A 2I4AA 4ZL7A 2YWMA 3TRXA 2PMTA 2V1MA 2FLSA 1DBYA 2N5FA 3FR3A 4N0VA 3ZL5A 2C3TA 2VO4A 3CRUA 1TK8B 4H86A 1Y1UA 4F0BA 1GSQA 1JLVA 1GULA 3HVNA 5DBQA 3KTBA 5G5FA 3DXBA 3APSA 4NPBA 2IFQB 5JWQB 1M9AA 1X0RA 14GSA 3DIEA 3HDCA 3UVTA 3E0UA 5DCGA 1SK0A 1J9BA 5HFIA 4PUAA 1QUWA 2WW2A 5C00A 3F4TA 3DYRA 2G2QA 5JWRB 2R0CA 3DGQA 2ZUPA 2YCDA 2ZCTA 4DSSB 4F03A 2X8GA 3UBLA 1XVWA 4Q5RA 3TJJA 4FYUA 1DUGA 3IPZA 2VLTA 2X99A 3D4TA 2GZYA 2VKZG 4TR0A 1ABAA 2H0HA 4EF0A 4BWQA 3CYNA 2CA8A 2YJHA 4QL7A 2I3YA 1T4ZA 3I6AA 1ERTA 2EIOA 2H66A 3QCPA 6GSWA 4KGIA 1A8LA 1WE0A 4RQXA 4ML1A 2DJ3A 1BX9A 1TOFA 3EE2A 4Z7XA 4FQUA 4G9HA 2O85A 3TJGA 5ID2A 4GXZA 5J4YA 1V40A 1V98A 2H73A 2C4JA 1R4WA 4PI0C 2YWNA 2GTUA 1K0NA 6GSSA 4TXOA 1YKCA 3F3RA 2OKAA 2N5BA 5B6NA 1GSFA 1R5PA 1SL1B 3R2QA 3L9UA 1GUKA 2O8VB 3F4RA 4EKZA 4K9ZA 4NXIA 1GTAA 2LQQA 2X4AA 3HVXA 3RAZA 4ECJA 5KN0A 1BF5A 3H93A 2WW1A 3OR5A 1XOAA 3VI5A 3IDVA 4I8BA 5LNKe 2A4VA 3M9JA 2GGTA 1TW9A 1B8XA 4AKIA 2VCQA 1EV4A 1O7UA 3HJOA 4ML6A 2HSMA 2HYXA 4GQCA 1LJRA 1DE1A 3WYWA 4GTUA 3KH9A 2NPBA 1FAAA 5CO3A 4O92A 9GSSA 2CVBA 1PA3A 6GSTA 2H0IA 3M8NA 3PR8A 3L78A 1AC1A 2CX4A 4GDFA 1HYUA 1OC8A 2HRNA 5ID2B 1FVKA 1Z6NA 5G2ZA 5F06A 3UL3A 1SKSB 1MD3A 4HZ2A 4IW9A 4MH2A 1AIUA 1WJKA 4JRRA 4F2IA 5A5KA 3J7Yk 1U88A 2JZSA 5CAXA 2C0DA 2LRCA 3SBCA 1GLPA 4MF7A 1TK0B 3EMPA 3TOUA 4TXVA 5FT3A 3FZ9A 4O32A 1EOHA 5COHA 3DD3A 3RDWA 5KN3A 5IPHA 2FGXA 4KDUA 4O5QA 2PERA 1YF1A 5EY6A 2DLXA 4X0XA 5ENUA 1J0FA 3TCOA 1ML6A 5B8AA 4GSSA 2YANA 5JCWA 2CQ9A 1XW6A 1JLWA 3EURA 1A2MA 3WT1A 4AI6A 3KH7A 1XWKA 2HSMB 1WWJA 1G6YA 2I1UA 4ICYA 2O89A 2K18A 1Q98A 3F4SA 3TJBA 1GTBA 1MD4A 2GSSA 1JZDA 1F6MC 1C72A 3ME7A 1XWAA 2OJLA 1Z6MA 5D9TA 4AF2A 1G7EA 2PVOC 4V2LA 3GURA 2OBKA 1N25A 2VAFA 1PRXA 1PX7A 3NOFA 4JE1A 2K8SA 4L0UA 1TP9A 4ID0A 4LL4B 2KP1A 3EWLA 4IQAA 4OFNA 4GSTA 2VCVA 4AKHA 1YZXA 1QXHA 1K0MA 5LCZA 2YZHA 5IO0A 5IOXA 4J2FA 2E2MA 1N2AA 3H79A 4HU9A 4MZCA 4TN8A 3DMLA 5ELGA 1H75A 1FO5A 4E68A 1BQ7A 4N10A 4ACSA 2EFDA 4IVFA 5EPFA 1BG5A 4PQHA 4V1Ap 3C7MA 2QA2A 1V57A 1ERUA 1XWCA 1R5AA 2R3XA 4F0CA 4QL9A 3MWHA 5DJLA 4KF9A 1N8JA 5CYYA 4YAPA 2H75A 1HD2A 1SL0B 3LJRA 1ZCPA 3DEXA 4N30A 3QOUA 4CDOA 1GSSA 1TRSA 3TU3B 3J7Yb 4G2EA 1A2JA 5D96A 4BWSA 1H4OA 1XWGA 4LMVA 1A23A 3DWVA 2NDOA 1RQMA 2F8FA 2HLSA 4IJ3A 5G1LA 2GLRA 3FR6A 3IR4A 1OC9B 5EL8A 1O81A 4XS6A 2H76A 4HQSA 3KIJA 3CSIA 4PHZC 1SKRB 2VCXA 4AKGA 1VF1A 19GSA 3IHQA 4WXTA 2BTOT 4G19A 5CRWA 4DSRA 5DQYA 3TKSA 2VD1A 2ALBA 4I5QA 4MZBA 2VOCA 2HRKA 1QK8A 2GDRA 2A4HA 3I69A 2B3SA 4USSA 2V32A 1USBA 5F8BA 3L0HA 3GA4A 1UA5A 2P5QA 4KCEA 2VLUA 4JU5A 3KP8A 4L0WA 1AQVA 4MLYA 2H1BA 2WULA 3EYTA 3VWVA 5JCUA 2LNTA 5FHIA 1XBSA 1KNGA 3LQ7A 5GZZB 4HUAA 3UBKA 3VWXA 1VF4A 2O5VA 2FUG2 3APOA 3HCZA 1YVLA 1VF2A 5HFGA 2CVKA 4QMKA 5LD0A 1TRUA 5JWOB 1TRVA 17GSA 5B7CA 1PL1A 2WZ9A 5DQSA 2E0QA 2F9SA 2LRTA 4A5PA 1XWBA 1PQNA 2R37A 3KCMA 4O5UA 1AUCA 5G1KA 4MMMA 4O5RA 1SYXA 2QA1A 4EIQA 5J9BA 2IIYA 2PUKC 4XIHA
chains in the Genus database with same CATH topology
2BJXA 1XPVA 4GQFA 4ZL8A 1EP7A 5IM9A 4OO4A 3IHGA 1RW1A 3EINA 3GTUA 3KXOA 1CQGA 2HRKB 4MNNA 2MMAA 5ECQB 2VUPA 1B4QA 1Z9HA 1X5DA 5BRTA 1TDIA 5IMVA 4KNDA 2B5YA 2F8AA 2FWFA 1VF3A 2C1YA 4KE3A 5DJMA 1NM3A 1HNAA 1EV9A 1S3CA 1UN2A 3IAS2 3V1WA 1SVMA 1T7PB 4WBJA 2AAWA 1OKDA 3ZTLA 3Q6OA 4EVMA 4NHZA 2UV8G 2QGVA 3HVVA 3WD6A 3TKQA 3IRAA 5CRDA 4JBBA 5F05A 1S3DA 1X5CA 3HY2A 1GSUA 2C0FA 2RM5A 1XW9A 2EFCA 2DJ0A 4O7HA 3C1RA 1J08A 3LG6A 4FYBA 3QAGA 3ZMLA 2C0EA 1XIYA 5B6MA 3KJYA 2LQOA 5G31A 1GSYA 1O6JA 2XBQA 5D9XA 2LNSA 2MBSA 3G7YA 3WGDA 1B4PA 2X8CA 3RHCA 4RI6A 2RUEA 3A3TA 2B1KA 4V2NA 2K8VA 1FB0A 1G0TA 2R2JA 3F63A 3GTUB 2YJ7A 5AISA 2P5RA 2L4QA 3FZ5A 4X43A 2VCZA 2HSNA 4X1UA 2HRAA 1YQ1A 1XOBA 4BL7B 3LXZA 2CAQA 1GH2A 1NHOA 3UOMA 2VM1A 2H30A 2LSTA 4I6XA 3PH9A 2YOIA 3IXRA 4ZB8A 1A0FA 2H8LA 1SVOA 3Q18A 4MP4A 2LEGA 4KUNA 2JSZA 2DJ1A 2LJAA 3P7XA 4E8HA 2EFEA 4TR3A 1X5EA 2O87A 2OE3A 3GKXA 5CRHA 4TOPA 3W6GA 3G7IA 1YDKA 1FOVA 4KSMA 2E7PA 3L9SA 1AXDA 3A5WA 5CRGA 5IOWA 3IOSA 3QD9A 3KTLA 5H5QA 1K0AA 4HQZA 2A2PA 4YKFA 2XC2A 2F51A 3TJFA 4PTSA 2HQTA 2HZFA 3FKFA 4X4JA 2X8HA 4NAXA 1Z5YE 3MNGA 4TR4A 4KH7A 4MF6A 1UC7A 1AW9A 3LYKA 5J47A 5KN2A 4GWRA 4IQ1A 3EU4A 4OO5A 2MYGA 5C04A 1ZMAA 1WMJA 1GUHA 2HSNB 1THOA 1M7TA 2N5AA 1EGRA 2B6MA 3EVIA 2QSIA 3LYPA 5ECMB 2JL4A 4EC0A 1O85A 4ZL9A 4PGTA 3TRPA 3GL3A 3ZVJD 5ELAA 4KCAA 2H6YA 2OE0A 2GQMA 4KX4A 2TIRA 3H1NA 3ZFBA 3D22A 3EPTA 3M3MA 1PN0A 2DJ2A 1BJXA 4ZIJA 3KMNA 4XHMA 5IMAA 4AJ7A 2CZ3A 2C8UA 3BOAA 1GNEA 2R5GA 3WGXA 1KEBA 1NW2A 2EFHA 4YQMA 4J57E 3TJKA 2H1GA 1TU8A 1URMA 1GTUA 2FWGA 2GT6A 2LRNA 13GSA 1ACVA 4EO3A 4G10A 4WR4A 1A8YA 4EUYA 4MA9A 2IMIA 2CZ2A 3PPUA 3I43A 4RQRA 2O7KA 5G5EA 1YEXA 1M99A 3CTGA 4PQIA 3UVHA 2ES7A 4WF4A 2BMXA 5HFKA 2NTOA 5IMZA 2FA8A 3GSSA 1ZYPA 3GV1A 1ZL9A 1F3AA 4NHWA 4OD7A 4KDXA 5J4VA 5IQYA 3KEBA 5ECPB 3D6IA 1T00A 5ECKB 3TOTA 4Q5QA 1V2AA 4HZ4A 4PX1A 3HJPA 1GSEA 3FMWA 1O8WA 1SU9A 1PGTA 5HR0A 1WOUA 2VCWA 1DSBA 2XHFA 4IGJA 5DVBA 3TKRA 3ZITA 2H0GA 1SK1A 4NWYA 3F0IA 6GSUA 3A2VA 2REMA 1TKDB 2FY6A 3VFIA 4EDYA 4NV5A 1F9MA 3U5RE 2KOKA 4MCUA 4CY6A 1Z7PA 5DDLA 1T4YA 3MSZA 1O73A 2H6XA 3F6DA 5D9WA 3M9KA 1TXUA 1AQWA 1W4VA 5IMCA 3VI7A 4K7IA 2RIIA 1SENA 2B1LA 4YQUA 1JFUA 1OC9A 1Z3EA 22GSA 5B8BA 4MPGA 3ZIVA 3FRCA 5A4WA 3ERFA 3IC8A 2LUSA 4CY8A 2X49A 3HMJG 5DAKA 2GZPA 5IMFA 5AIVA 4HJMA 2R6KA 2H70A 1MDKA 4K7OA 4MJAA 2DMMA 4I2TA 4LLRA 2GSQA 2PN8A 2MMNA 4TRXA 3A2WA 3Q19A 4J56E 1SJIA 2H1DA 2AUVA 2VCTA 1OC3A 5E4WA 1ZZYA 5A4VA 1OE7A 3MDKA 4ULXA 2B7KA 2V6KA 2AHEA 5INYA 5IPGA 4V1Ag 2HRFA 3LW9A 3S9FA 5CREA 4BVYB 3H4KA 2GS3A 8GSSA 4K5SA 1FW1A 4HU7A 3RPPA 3GMFA 5GAPD 2C3QA 5EVOA 3DRNA 4BVXA 2J23A 4HEA2 2H6ZA 2FHEA 1TXXA 2WDUA 3RHBA 3EC3A 2VL9A 1MDIA 1SK2A 3M0FA 1U3AA 5ECLB 3IK7A 4N3ZA 2I9HA 4LL1B 2C0GA 4EDZA 1A24A 3ED3A 1X9WB 2CAIA 3P90A 2IPAA 1ZOFA 1KTEA 5J41A 1IYIA 1TTZA 5GAND 5DAKB 1YJ6A 2H19A 4JR4A 3GKNA 1GUMA 1EZKA 4JEDA 2WJUA 3EMXA 4K2DA 1Z7RA 1EWXA 2EC4A 1FOHA 1MEKA 5HR2A 2OACA 2FWHA 3C73A 3HKRA 2JACA 3LEFA 1YY7A 2B5XA 2DIYA 5D93A 1QGVA 1F3BA 1VRSD 3RBTA 3P8WA 4P3YB 3ZRDA 2L5OA 4XCSA 1SJZA 3C71A 1TU7A 4Z2RA 1A0RP 2X64A 3GX0A 4MABA 2L59A 3C1SA 1SJ6A 1K0DA 4XS1A 3CXGA 2CV4A 3GNJA 3PGTA 2YWOA 4RI7A 1B9YC 4FIWA 2TRCP 4I2UA 3KMOA 2VL2C 4PNGA 3RPNA 1NSWA 2LV3A 5BMUB 2VM2A 2YV9A 2KLXA 2DJJA 3GX8A 4HJ2A 4BVXB 1TI3A 5A5HB 4AKXB 4MJEA 1GL8A 4AJ8A 1X9MB 6GSYA 4K0GA 1OVNA 5CNWA 4KW6A 5J3RA 1BAYA 3D4MA 4Z2UA 4MJCA 1V58A 2AYTA 3TUEA 4CW9A 2XPDA 3TRQA 2G0FA 5J4UA 3TKPA 3L4NA 4F9ZA 4POBA 4XRDA 1FVJA 1U87A 1JZRA 3ZFLA 5FWGA 3ZREA 1I9DA 3GH6A 3NZNA 2WS2A 3CSHA 4KAEA 7GSSA 4ILFA 3PINA 4ECBA 4ECIA 3IBHA 5DCHA 2A2SA 1K0BA 4I97A 3K8NA 1RK4A 2AV4A 4BL7A 2ON7A 1XZOA 2J9HA 4KDYA 1BG1A 4N11A 3MYDA 2JZRA 5H5SA 3VWWA 4XTSA 2P0GA 4TR1A 5H5RA 5GSTA 2OE1A 1YF0A 1I5GA 3KD0A 4BA7A 3HXSA 2CX3A 2F3MA 3ZYWA 2HFDA 2DKIA 2M46A 4W66A 18GSA 1FHEA 4Q5FA 3LFLA 1TI1A 1XXUA 3QAWA 5ABRA 4L5OA 3IAM2 2VIMA 1K3OA 4WF5A 3GSTA 1K0OA 2DKHA 4POMA 2WCIA 1PX6A 4K6XA 4EXJA 2GQKA 5HR1A 3FY7A 3W8SA 1S3AA 3BJ5A 5J40A 3O3TA 2IMEA 2TRXA 2ON5A 2L6CA 3LWAA 3VURA 1T8EB 5AGYA 3AY8A 3I9V2 4TKYA 1R26A 3ZVJA 4YH2A 2PU9C 3FYGA 4K7NA 1QMVA 5KOWA 2KUCA 1WPIA 3ZLPA 3LSZA 1TRWA 2L57A 5J5NA 4IP6A 2XBIA 2Z9SA 1GNWA 2FCHA 2GQLA 3MIXA 2OT3A 3HHVA 1QFNA 4YKGA 4L8EA 1MDJA 3UJ1A 1SD9A 1GP1A 4TR1B 1OYJA 1OE8A 4YQVA 1ILOA 4ZBAA 1GTIA 3G9BA 1NHYA 2V41A 2H71A 4FO5A 4OCEA 2M72A 3UMAA 3IV4A 3QMXA 4MPFA 4K0NA 1EP8A 2MMOA 3FZAA 1Y6EA 1A2LA 1EGOA 3MAKA 1M2DA 3IE3A 1EEMA 2EIQA 2GT5A 2R0PA 3CMIA 4WEYA 3U6VA 2HI7A 3GL5A 2VL2A 4AGSA 4WKWA 4OMVA 4ZILA 3L9VA 2AB6A 2H01A 2K9FA 2DMLA 4IBPA 3O6TA 1HNBA 3GUSA 2VL3A 5IMDA 4EIPA 3KP9A 2YNXA 2HZEA 4K1FA 4MK3A 5F0GA 1EEJA 1K3YA 3ISOA 2XPEA 1XVQA 1MTCA 6GSXA 2V2GA 4GCIA 1T1VA 2PBJA 1SKWB 3P2AA 4QQ7A 1M0UA 3CTFA 1E2YA 2JSYA 1AQXA 4PURA 5ECNB 2FD3A 2VD0A 1ST9A 3APQA 1W89A 2IMDA 1M9BA 1LU4A 2V6OA 4ISDA 2OBIA 4ZB7A 1WP0A 1TJDA 5AN1A 4GSNA 1E6BA 3FW2A 4N0ZA 3HYPA 4EE0A 1YEPA 4HS1A 3FHKA 1PMTA 5GSSA 2DJKA 4DVCA 3HZ4A 1F2EA 3TKSC 3SWLA 11GSA 3N9JA 3LXTA 2UZ8A 3HJMA 2DIZA 4G01A 4JR6A 4IKHA 4L5LA 3D21A 3QFBC 3IC4A 4PQ1A 2HZEB 3GH9A 1VGLA 3FZ4A 5CP1A 2FNOA 2H1LA 3QDNA 2E2GA 20GSA 1THXA 1U6TA 2ZNMA 3FEUA 2LTKA 5IIZA 2KHPA 1ON4A 2K6VA 4TXOB 10GSA 3CBUA 5E59A 5DALA 2CVDA 5F07A 1GLQA 1BYEA 4PUFC 2L4CA 3GRXA 1SD8A 4ZXGA 3E9JB 1LBKA 4KB3A 2HE3A 5ECHB 2FA4A 1TK5B 4NV2A 4BVYA 4KA0A 4TW5A 4HDEA 2IMFA 1M2AA 3QAVA 4MJBA 4HI7A 2M80A 3NIVA 3C8EA 2GSTA 3DVWA 3IA1A 4BPYA 1IYHA 2IN3A 4G0LA 4D73A 3IK9A 4XS4A 3KZQA 1PSQA 1ZYNA 3KGKA 4F82A 2R4VA 1BEDA 4IN0A 5L71A 3UEMA 1AAZA 2MZCA 4ZB9A 3ERWA 5A1NA 3A5IA 4XRAA 1OAZA 2QKEA 1QQ2A 2DSAA 4LMWA 1PKZA 2AJQB 4JZQA 2DBCA 6GSVA 1F37A 4ZBDA 4MDCA 2YZUA 4DEJA 1U3IA 5JCGA 1KBNA 4G0KA 4GRFA 2WRTA 1V9WA 4IP1A 3A2XA 4PXOA 1PKWA 3F3QA 5DALB 1JHBA 5D9VA 4V2MA 3BCKA 2PWJA 3WGEA 1T3BA 2WFCA 3F8UA 1O8XA 5ECOB 4TVEA 2HXKA 3TKSE 12GSA 3G7JA 3VLNA 4E8EA 1FG4A 3Q74A 2MMZA 2C80A 5D8IA 1Y25A 4LA1A 2I81A 3LGCA 2L6DA 5BMUA 2OA7A 3UIWA 4NMUA 1FB6A 3ERGA 1WRYA 4WR5A 2C3NA 4OCFA 3FR9A 3F6FA 5A5HA 2YWIA 4D73B 5AIXA 3GYKA 4XS4B 4CHSA 3DVXA 3VWUA 1B9XC 2LKUA 3TDGA 4DSQA 3D0ZA 4OFMA 1PD21 4POLA 5A1NB 3QPMA 2PVQA 2GSRA 3HD5A 4PNFA 4RUVA 4WBRD 3HZ8A 4ZBBA 2IJYA 3JCML 2VLVA 5IO2A 1ZYQB 1EOGA 1SYRA 4EL1A 5KOXA 2EIRA 2HSYA 2RLIA 3CRTA 1SL2B 3GKKA 3VPQA 2CT6A 2IWTA 1HQOA 1WIKA 2HSHA 1Q4JA 2IMKA 1ZGNA 1GRXA 2JADA 4IJIA 3UARA 2QC7A 2KP2A 2H1AA 2GVPA 2DC5A 3ZIJA 1ZYEA 2H74A 4KSOA 5HR3A 1UVZA 2B7JA 1K3LA 3TGZA 3E3EA 2MBTA 3VK9A 3BBYA 5A34A 4WETA 4K5RA 3GFKA 4GLTA 4Q5NA 4IS0A 3GIXA 3FK8A 1JZOA 5ECSA 3TB2A 3HVSA 5D73A 4ZB6A 3QFAC 4POKA 3ZMKA 5G30A 16GSA 2A2RA 1G6WA 3CWGA 2LJKA 2YPMA 4Z2TA 4GF0A 2NBSA 1GWCA 3W8JA 5KEJA 4MF5A 3D5JA 3GHAA 2PGTA 2HT9A 2YN1A 2YV7A 4FH8A 1JZWA 3DKSA 3R3EA 1K0CA 2GZZA 3BCIA 3ME8A 2YP6A 2FWEA 5J9CA 3CSJA 3WT2A 2JZTA 1HNCA 4HOJA 4K2XA 3H8QA 1OKTA 3F9UA 3BD2A 2B5EA 2WB9A 4IHUA 1G7OA 1ERVA 1DE2A 5ECRB 2L5LA 5A4UA 5ECIB 2P31A 5A34B 1CQHA 1ERWA 1YKAA 1GSDA 5HQPA 3GKMA 2D2ZA 3LORA 4MH3A 3UAPA 5KN1A 1PN9A 4OWYA 2IFQA 1B48A 1XFLA 1XCCA 3ZZXA 3M1GA 2WGRA 1PL2A 4YAVA 3EU3A 3GN3A 1M2BA 3O76A 4G0IA 1XW5A 2HNLA 2JU5A 4K8MA 4OFTA 2R0GA 4DSSA 1SVLA 3US3A 3VPTA 2NVLA 4AJ6A 2RUFA 1X9SB 2PPTA 2OADA 4FYCA 4IELA 2LS5A 2LJRA 3KM6A 4ECCA 3N5OA 1R7HA 3QR6A 2IL3A 3HA9A 2RM6A 4MZWA 2H72A 2I4AA 4ZL7A 2YWMA 3TRXA 2PMTA 2V1MA 2FLSA 1DBYA 2N5FA 3FR3A 4N0VA 3ZL5A 2C3TA 2VO4A 3CRUA 1TK8B 4H86A 1Y1UA 4F0BA 1GSQA 1JLVA 1GULA 5DBQA 3KTBA 5G5FA 3DXBA 3APSA 4NPBA 2IFQB 5JWQB 1M9AA 1X0RA 14GSA 3DIEA 3HDCA 3UVTA 3E0UA 5DCGA 1SK0A 1J9BA 5HFIA 4PUAA 1QUWA 5C00A 3F4TA 3DYRA 2G2QA 5JWRB 2R0CA 3DGQA 2ZUPA 2YCDA 2ZCTA 4DSSB 4F03A 2X8GA 3UBLA 1XVWA 4Q5RA 3TJJA 4FYUA 1DUGA 3IPZA 2VLTA 2X99A 3D4TA 2GZYA 2VKZG 4TR0A 1ABAA 2H0HA 4EF0A 4BWQA 3CYNA 2CA8A 2YJHA 4QL7A 2I3YA 1T4ZA 3I6AA 1ERTA 2EIOA 2H66A 3QCPA 6GSWA 4KGIA 1A8LA 1WE0A 4RQXA 4ML1A 2DJ3A 1BX9A 1TOFA 3EE2A 4Z7XA 4FQUA 4G9HA 2O85A 3TJGA 5ID2A 4GXZA 5J4YA 1V40A 1V98A 2H73A 2C4JA 1R4WA 2YWNA 2GTUA 1K0NA 6GSSA 4TXOA 1YKCA 3F3RA 2OKAA 2N5BA 5B6NA 1GSFA 1R5PA 1SL1B 3R2QA 3L9UA 1GUKA 2O8VB 3F4RA 4EKZA 4K9ZA 4NXIA 1GTAA 2LQQA 2X4AA 3HVXA 3RAZA 4ECJA 5KN0A 1BF5A 3H93A 3OR5A 1XOAA 3VI5A 3IDVA 4I8BA 5LNKe 2A4VA 3M9JA 2GGTA 1TW9A 1B8XA 4AKIA 2VCQA 1EV4A 1O7UA 3HJOA 4ML6A 2HSMA 2HYXA 4GQCA 1LJRA 1DE1A 3WYWA 4GTUA 3KH9A 2NPBA 1FAAA 5CO3A 4O92A 9GSSA 2CVBA 1PA3A 6GSTA 2H0IA 3M8NA 3PR8A 3L78A 1AC1A 2CX4A 4GDFA 1HYUA 1OC8A 2HRNA 5ID2B 1FVKA 1Z6NA 5G2ZA 5F06A 3UL3A 1SKSB 1MD3A 4HZ2A 4IW9A 4MH2A 1AIUA 1WJKA 4JRRA 4F2IA 5A5KA 3J7Yk 1U88A 2JZSA 5CAXA 2C0DA 2LRCA 3SBCA 1GLPA 4MF7A 1TK0B 3EMPA 3TOUA 4TXVA 5FT3A 3FZ9A 4O32A 1EOHA 5COHA 3DD3A 3RDWA 5KN3A 5IPHA 2FGXA 4KDUA 4O5QA 2PERA 1YF1A 5EY6A 2DLXA 4X0XA 5ENUA 1J0FA 3TCOA 1ML6A 5B8AA 4GSSA 2YANA 5JCWA 2CQ9A 1XW6A 1JLWA 3EURA 1A2MA 3WT1A 4AI6A 3KH7A 1XWKA 2HSMB 1WWJA 1G6YA 2I1UA 4ICYA 2O89A 2K18A 1Q98A 3F4SA 3TJBA 1GTBA 1MD4A 2GSSA 1JZDA 1F6MC 1C72A 3ME7A 1XWAA 2OJLA 1Z6MA 5D9TA 4AF2A 1G7EA 2PVOC 4V2LA 3GURA 2OBKA 1N25A 2VAFA 1PRXA 1PX7A 3NOFA 4JE1A 2K8SA 4L0UA 1TP9A 4ID0A 4LL4B 2KP1A 3EWLA 4IQAA 4OFNA 4GSTA 2VCVA 4AKHA 1YZXA 1QXHA 1K0MA 5LCZA 2YZHA 5IO0A 5IOXA 4J2FA 2E2MA 1N2AA 3H79A 4HU9A 4MZCA 4TN8A 3DMLA 5ELGA 1H75A 1FO5A 4E68A 1BQ7A 4N10A 4ACSA 2EFDA 4IVFA 5EPFA 1BG5A 4PQHA 4V1Ap 3C7MA 2QA2A 1V57A 1ERUA 1XWCA 1R5AA 2R3XA 4F0CA 4QL9A 3MWHA 5DJLA 4KF9A 1N8JA 5CYYA 4YAPA 2H75A 1HD2A 1SL0B 3LJRA 1ZCPA 3DEXA 4N30A 3QOUA 4CDOA 1GSSA 1TRSA 3TU3B 3J7Yb 4G2EA 1A2JA 5D96A 4BWSA 1H4OA 1XWGA 4LMVA 1A23A 3DWVA 2NDOA 1RQMA 2F8FA 2HLSA 4IJ3A 5G1LA 2GLRA 3FR6A 3IR4A 1OC9B 5EL8A 1O81A 4XS6A 2H76A 4HQSA 3KIJA 3CSIA 1SKRB 2VCXA 4AKGA 1VF1A 19GSA 3IHQA 4WXTA 2BTOT 4G19A 5CRWA 4DSRA 5DQYA 3TKSA 2VD1A 2ALBA 4I5QA 4MZBA 2VOCA 2HRKA 1QK8A 2GDRA 2A4HA 3I69A 2B3SA 4USSA 2V32A 1USBA 5F8BA 3L0HA 3GA4A 1UA5A 2P5QA 4KCEA 2VLUA 4JU5A 3KP8A 4L0WA 1AQVA 4MLYA 2H1BA 2WULA 3EYTA 3VWVA 5JCUA 2LNTA 5FHIA 1XBSA 1KNGA 3LQ7A 5GZZB 4HUAA 3UBKA 3VWXA 1VF4A 2O5VA 2FUG2 3APOA 3HCZA 1YVLA 1VF2A 5HFGA 2CVKA 4QMKA 5LD0A 1TRUA 5JWOB 1TRVA 17GSA 5B7CA 1PL1A 2WZ9A 5DQSA 2E0QA 2F9SA 2LRTA 4A5PA 1XWBA 1PQNA 2R37A 3KCMA 4O5UA 1AUCA 5G1KA 4MMMA 4O5RA 1SYXA 2QA1A 4EIQA 5J9BA 2IIYA 2PUKC 4XIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJX A;  1XPV A;  4GQF A;  4ZL8 A;  1EP7 A;  5IM9 A;  4OO4 A;  1RW1 A;  3EIN A;  3GTU A;  3KXO A;  1CQG A;  2HRK B;  2MMA A;  5ECQ B;  2VUP A;  1B4Q A;  1Z9H A;  1X5D A;  1TDI A;  5IMV A;  4KND A;  2B5Y A;  2F8A A;  2FWF A;  1VF3 A;  2C1Y A;  4KE3 A;  5DJM A;  1NM3 A;  1HNA A;  1EV9 A;  1S3C A;  1UN2 A;  3IAS 2;  3V1W A;  1T7P B;  4WBJ A;  2AAW A;  1OKD A;  3ZTL A;  3Q6O A;  4EVM A;  4NHZ A;  2QGV A;  3HVV A;  3WD6 A;  3TKQ A;  3IRA A;  5CRD A;  4JBB A;  5F05 A;  1S3D A;  1X5C A;  3HY2 A;  1GSU A;  2C0F A;  2RM5 A;  1XW9 A;  2DJ0 A;  4O7H A;  3C1R A;  1J08 A;  3LG6 A;  4FYB A;  3QAG A;  3ZML A;  2C0E A;  1XIY A;  5B6M A;  3KJY A;  2LQO A;  5G31 A;  1GSY A;  1O6J A;  2XBQ A;  5D9X A;  2LNS A;  2MBS A;  3G7Y A;  3WGD A;  1B4P A;  2X8C A;  3RHC A;  4RI6 A;  2RUE A;  3A3T A;  2B1K A;  4V2N A;  2K8V A;  1FB0 A;  1G0T A;  2R2J A;  3F63 A;  3GTU B;  2YJ7 A;  5AIS A;  2P5R A;  2L4Q A;  3FZ5 A;  4X43 A;  2VCZ A;  4X1U A;  2HRA A;  1YQ1 A;  1XOB A;  4BL7 B;  3LXZ A;  2CAQ A;  1GH2 A;  1NHO A;  3UOM A;  2VM1 A;  2H30 A;  2LST A;  4I6X A;  3PH9 A;  2YOI A;  3IXR A;  4ZB8 A;  1A0F A;  2H8L A;  3Q18 A;  4MP4 A;  2LEG A;  4KUN A;  2JSZ A;  2DJ1 A;  2LJA A;  3P7X A;  4E8H A;  4TR3 A;  1X5E A;  2O87 A;  2OE3 A;  3GKX A;  5CRH A;  4TOP A;  3W6G A;  3G7I A;  1YDK A;  1FOV A;  4KSM A;  2E7P A;  3L9S A;  1AXD A;  3A5W A;  5CRG A;  5IOW A;  3IOS A;  3QD9 A;  3KTL A;  5H5Q A;  1K0A A;  4HQZ A;  2XC2 A;  2F51 A;  3TJF A;  4PTS A;  2HQT A;  2HZF A;  3FKF A;  2X8H A;  4NAX A;  1Z5Y E;  3MNG A;  4TR4 A;  4KH7 A;  4MF6 A;  1UC7 A;  1AW9 A;  3LYK A;  5KN2 A;  4GWR A;  4IQ1 A;  3EU4 A;  4OO5 A;  2MYG A;  5C04 A;  1ZMA A;  1WMJ A;  1GUH A;  2HSN B;  1THO A;  1M7T A;  2N5A A;  1EGR A;  2B6M A;  3EVI A;  2QSI A;  3LYP A;  5ECM B;  2JL4 A;  4EC0 A;  1O85 A;  4ZL9 A;  4PGT A;  3TRP A;  3GL3 A;  3ZVJ D;  5ELA A;  4KCA A;  2H6Y A;  2OE0 A;  2GQM A;  4KX4 A;  2TIR A;  3H1N A;  3ZFB A;  3D22 A;  3M3M A;  2DJ2 A;  1BJX A;  4ZIJ A;  3KMN A;  4XHM A;  5IMA A;  4AJ7 A;  2CZ3 A;  2C8U A;  3BOA A;  1GNE A;  2R5G A;  3WGX A;  1KEB A;  1NW2 A;  4YQM A;  4J57 E;  3TJK A;  2H1G A;  1TU8 A;  1URM A;  1GTU A;  2FWG A;  2GT6 A;  2LRN A;  13GS A;  1ACV A;  4EO3 A;  4G10 A;  4WR4 A;  1A8Y A;  4EUY A;  4MA9 A;  2IMI A;  2CZ2 A;  3PPU A;  3I43 A;  4RQR A;  2O7K A;  5G5E A;  1YEX A;  1M99 A;  3CTG A;  4PQI A;  3UVH A;  2ES7 A;  4WF4 A;  2BMX A;  5HFK A;  2NTO A;  5IMZ A;  2FA8 A;  3GSS A;  3GV1 A;  1ZL9 A;  1F3A A;  4NHW A;  4OD7 A;  4KDX A;  5IQY A;  3KEB A;  5ECP B;  3D6I A;  1T00 A;  5ECK B;  3TOT A;  4Q5Q A;  1V2A A;  4HZ4 A;  4PX1 A;  3HJP A;  1GSE A;  1O8W A;  1SU9 A;  1PGT A;  5HR0 A;  1WOU A;  2VCW A;  1DSB A;  2XHF A;  4IGJ A;  5DVB A;  3TKR A;  3ZIT A;  2H0G A;  1SK1 A;  4NWY A;  3F0I A;  6GSU A;  3A2V A;  2REM A;  1TKD B;  2FY6 A;  3VFI A;  4EDY A;  4NV5 A;  1F9M A;  3U5R E;  2KOK A;  4MCU A;  1Z7P A;  5DDL A;  1T4Y A;  3MSZ A;  1O73 A;  2H6X A;  3F6D A;  5D9W A;  3M9K A;  1AQW A;  1W4V A;  5IMC A;  3VI7 A;  4K7I A;  2RII A;  1SEN A;  2B1L A;  4YQU A;  1JFU A;  1OC9 A;  1Z3E A;  22GS A;  5B8B A;  4MPG A;  3ZIV A;  3FRC A;  5A4W A;  3ERF A;  3IC8 A;  2LUS A;  5DAK A;  2GZP A;  5IMF A;  5AIV A;  4HJM A;  2R6K A;  2H70 A;  1MDK A;  4K7O A;  4MJA A;  2DMM A;  4I2T A;  4LLR A;  2GSQ A;  2PN8 A;  2MMN A;  4TRX A;  3A2W A;  3Q19 A;  4J56 E;  1SJI A;  2H1D A;  2AUV A;  2VCT A;  1OC3 A;  5E4W A;  1ZZY A;  5A4V A;  1OE7 A;  3MDK A;  4ULX A;  2B7K A;  2V6K A;  2AHE A;  5INY A;  5IPG A;  4V1A g;  2HRF A;  3S9F A;  5CRE A;  4BVY B;  3H4K A;  2GS3 A;  8GSS A;  1FW1 A;  4HU7 A;  3RPP A;  3GMF A;  5GAP D;  2C3Q A;  5EVO A;  3DRN A;  4BVX A;  2J23 A;  4HEA 2;  2H6Z A;  2FHE A;  1TXX A;  2WDU A;  3RHB A;  3EC3 A;  2VL9 A;  1MDI A;  1SK2 A;  3M0F A;  1U3A A;  5ECL B;  3IK7 A;  2I9H A;  4LL1 B;  2C0G A;  4EDZ A;  1A24 A;  3ED3 A;  1X9W B;  2CAI A;  3P90 A;  2IPA A;  1ZOF A;  1KTE A;  5J41 A;  1IYI A;  1TTZ A;  5GAN D;  5DAK B;  1YJ6 A;  2H19 A;  4JR4 A;  3GKN A;  1GUM A;  1EZK A;  4JED A;  2WJU A;  3EMX A;  4K2D A;  1Z7R A;  1EWX A;  2EC4 A;  1MEK A;  5HR2 A;  2OAC A;  2FWH A;  3C73 A;  3HKR A;  2JAC A;  3LEF A;  1YY7 A;  2B5X A;  2DIY A;  5D93 A;  1QGV A;  1F3B A;  1VRS D;  3RBT A;  3P8W A;  4P3Y B;  3ZRD A;  2L5O A;  4XCS A;  1SJZ A;  3C71 A;  1TU7 A;  1A0R P;  2X64 A;  3GX0 A;  4MAB A;  2L59 A;  3C1S A;  1SJ6 A;  1K0D A;  4XS1 A;  3CXG A;  2CV4 A;  3GNJ A;  3PGT A;  2YWO A;  4RI7 A;  1B9Y C;  4FIW A;  2TRC P;  4I2U A;  3KMO A;  2VL2 C;  4PNG A;  3RPN A;  1NSW A;  2LV3 A;  2VM2 A;  2YV9 A;  2KLX A;  2DJJ A;  3GX8 A;  4HJ2 A;  4BVX B;  1TI3 A;  4MJE A;  1GL8 A;  4AJ8 A;  1X9M B;  6GSY A;  4K0G A;  1OVN A;  5CNW A;  4KW6 A;  5J3R A;  1BAY A;  3D4M A;  4MJC A;  1V58 A;  2AYT A;  3TUE A;  4CW9 A;  2XPD A;  3TRQ A;  2G0F A;  5J4U A;  3TKP A;  3L4N A;  4F9Z A;  4POB A;  4XRD A;  1FVJ A;  1U87 A;  1JZR A;  3ZFL A;  5FWG A;  3ZRE A;  1I9D A;  3GH6 A;  3NZN A;  2WS2 A;  3CSH A;  4KAE A;  7GSS A;  4ILF A;  3PIN A;  4ECB A;  4ECI A;  3IBH A;  5DCH A;  2A2S A;  1K0B A;  4I97 A;  3K8N A;  1RK4 A;  2AV4 A;  4BL7 A;  2ON7 A;  1XZO A;  2J9H A;  4KDY A;  4N11 A;  2JZR A;  5H5S A;  3VWW A;  4XTS A;  2P0G A;  4TR1 A;  5H5R A;  5GST A;  2OE1 A;  1YF0 A;  1I5G A;  3KD0 A;  4BA7 A;  3HXS A;  2CX3 A;  2F3M A;  3ZYW A;  2HFD A;  2M46 A;  18GS A;  1FHE A;  4Q5F A;  3LFL A;  1TI1 A;  1XXU A;  3QAW A;  5ABR A;  4L5O A;  3IAM 2;  2VIM A;  1K3O A;  4WF5 A;  3GST A;  1K0O A;  4POM A;  2WCI A;  1PX6 A;  4K6X A;  4EXJ A;  2GQK A;  5HR1 A;  3FY7 A;  3W8S A;  1S3A A;  3BJ5 A;  3O3T A;  2IME A;  2TRX A;  2ON5 A;  2L6C A;  3LWA A;  3VUR A;  1T8E B;  5AGY A;  3AY8 A;  3I9V 2;  4TKY A;  1R26 A;  3ZVJ A;  4YH2 A;  2PU9 C;  3FYG A;  4K7N A;  1QMV A;  2KUC A;  1WPI A;  3ZLP A;  3LSZ A;  1TRW A;  2L57 A;  5J5N A;  4IP6 A;  2XBI A;  2Z9S A;  1GNW A;  2FCH A;  2GQL A;  3HHV A;  1QFN A;  4L8E A;  1MDJ A;  3UJ1 A;  1SD9 A;  1GP1 A;  4TR1 B;  1OYJ A;  1OE8 A;  4YQV A;  1ILO A;  4ZBA A;  1GTI A;  3G9B A;  1NHY A;  2V41 A;  2H71 A;  4FO5 A;  4OCE A;  2M72 A;  3UMA A;  3IV4 A;  3QMX A;  4MPF A;  4K0N A;  1EP8 A;  2MMO A;  3FZA A;  1Y6E A;  1A2L A;  1EGO A;  3MAK A;  1M2D A;  3IE3 A;  1EEM A;  2EIQ A;  2GT5 A;  3CMI A;  4WEY A;  3U6V A;  2HI7 A;  3GL5 A;  2VL2 A;  4AGS A;  4WKW A;  4OMV A;  4ZIL A;  3L9V A;  2AB6 A;  2H01 A;  2K9F A;  2DML A;  4IBP A;  3O6T A;  1HNB A;  3GUS A;  2VL3 A;  5IMD A;  3KP9 A;  2YNX A;  2HZE A;  4K1F A;  4MK3 A;  5F0G A;  1EEJ A;  1K3Y A;  3ISO A;  2XPE A;  1XVQ A;  1MTC A;  6GSX A;  2V2G A;  4GCI A;  1T1V A;  2PBJ A;  1SKW B;  3P2A A;  4QQ7 A;  1M0U A;  3CTF A;  1E2Y A;  2JSY A;  1AQX A;  4PUR A;  5ECN B;  2FD3 A;  2VD0 A;  1ST9 A;  3APQ A;  1W89 A;  2IMD A;  1M9B A;  1LU4 A;  2V6O A;  4ISD A;  2OBI A;  1WP0 A;  1TJD A;  5AN1 A;  4GSN A;  1E6B A;  3FW2 A;  4N0Z A;  3HYP A;  4EE0 A;  1YEP A;  4HS1 A;  3FHK A;  1PMT A;  5GSS A;  2DJK A;  4DVC A;  3HZ4 A;  1F2E A;  3TKS C;  3SWL A;  11GS A;  3N9J A;  3LXT A;  2UZ8 A;  3HJM A;  2DIZ A;  4JR6 A;  4IKH A;  4L5L A;  3D21 A;  3QFB C;  3IC4 A;  4PQ1 A;  2HZE B;  3GH9 A;  1VGL A;  3FZ4 A;  5CP1 A;  2FNO A;  3QDN A;  2E2G A;  20GS A;  1THX A;  1U6T A;  2ZNM A;  3FEU A;  2LTK A;  5IIZ A;  2KHP A;  1ON4 A;  2K6V A;  4TXO B;  10GS A;  3CBU A;  5E59 A;  5DAL A;  2CVD A;  5F07 A;  1GLQ A;  1BYE A;  4PUF C;  2L4C A;  3GRX A;  1SD8 A;  4ZXG A;  3E9J B;  1LBK A;  4KB3 A;  2HE3 A;  5ECH B;  2FA4 A;  1TK5 B;  4NV2 A;  4BVY A;  4KA0 A;  4TW5 A;  4HDE A;  2IMF A;  1M2A A;  3QAV A;  4MJB A;  4HI7 A;  2M80 A;  3NIV A;  3C8E A;  2GST A;  3DVW A;  3IA1 A;  4BPY A;  1IYH A;  2IN3 A;  4G0L A;  4D73 A;  3IK9 A;  4XS4 A;  3KZQ A;  1PSQ A;  3KGK A;  4F82 A;  2R4V A;  1BED A;  4IN0 A;  5L71 A;  3UEM A;  1AAZ A;  2MZC A;  4ZB9 A;  3ERW A;  4XRA A;  1OAZ A;  2QKE A;  1QQ2 A;  2DSA A;  4LMW A;  1PKZ A;  2AJQ B;  4JZQ A;  2DBC A;  6GSV A;  1F37 A;  4ZBD A;  4MDC A;  2YZU A;  4DEJ A;  1U3I A;  5JCG A;  1KBN A;  4G0K A;  4GRF A;  2WRT A;  1V9W A;  4IP1 A;  3A2X A;  4PXO A;  1PKW A;  3F3Q A;  5DAL B;  1JHB A;  5D9V A;  4V2M A;  3BCK A;  2PWJ A;  3WGE A;  1T3B A;  2WFC A;  3F8U A;  1O8X A;  5ECO B;  4TVE A;  2HXK A;  3TKS E;  12GS A;  3G7J A;  3VLN A;  4E8E A;  1FG4 A;  3Q74 A;  2MMZ A;  2C80 A;  5D8I A;  1Y25 A;  4LA1 A;  2I81 A;  3LGC A;  2L6D A;  5BMU A;  2OA7 A;  3UIW A;  4NMU A;  1FB6 A;  3ERG A;  1WRY A;  4WR5 A;  2C3N A;  4OCF A;  3FR9 A;  3F6F A;  2YWI A;  4D73 B;  5AIX A;  3GYK A;  4XS4 B;  4CHS A;  3DVX A;  3VWU A;  1B9X C;  2LKU A;  3TDG A;  4DSQ A;  3D0Z A;  4OFM A;  1PD2 1;  4POL A;  3QPM A;  2PVQ A;  2GSR A;  3HD5 A;  4PNF A;  4RUV A;  4WBR D;  3HZ8 A;  4ZBB A;  2IJY A;  3JCM L;  2VLV A;  5IO2 A;  1ZYQ B;  1EOG A;  1SYR A;  4EL1 A;  2EIR A;  2HSY A;  2RLI A;  3CRT A;  1SL2 B;  3GKK A;  3VPQ A;  2CT6 A;  2IWT A;  1HQO A;  1WIK A;  2HSH A;  1Q4J A;  2IMK A;  1ZGN A;  1GRX A;  2JAD A;  4IJI A;  3UAR A;  2QC7 A;  2KP2 A;  2H1A A;  2GVP A;  2DC5 A;  3ZIJ A;  1ZYE A;  2H74 A;  4KSO A;  5HR3 A;  1UVZ A;  2B7J A;  1K3L A;  3TGZ A;  3E3E A;  2MBT A;  3VK9 A;  3BBY A;  4WET A;  3GFK A;  4GLT A;  4Q5N A;  4IS0 A;  3GIX A;  3FK8 A;  1JZO A;  5ECS A;  3TB2 A;  3HVS A;  5D73 A;  4ZB6 A;  3QFA C;  4POK A;  3ZMK A;  5G30 A;  16GS A;  2A2R A;  1G6W A;  2LJK A;  2YPM A;  4GF0 A;  2NBS A;  1GWC A;  3W8J A;  5KEJ A;  4MF5 A;  3D5J A;  3GHA A;  2PGT A;  2HT9 A;  2YN1 A;  2YV7 A;  4FH8 A;  1JZW A;  3DKS A;  3R3E A;  1K0C A;  2GZZ A;  3BCI A;  3ME8 A;  2YP6 A;  2FWE A;  5J9C A;  3CSJ A;  3WT2 A;  2JZT A;  1HNC A;  4HOJ A;  3H8Q A;  1OKT A;  3F9U A;  3BD2 A;  2B5E A;  2WB9 A;  4IHU A;  1G7O A;  1ERV A;  1DE2 A;  5ECR B;  2L5L A;  5A4U A;  5ECI B;  2P31 A;  1CQH A;  1ERW A;  1YKA A;  1GSD A;  5HQP A;  3GKM A;  2D2Z A;  3LOR A;  4MH3 A;  3UAP A;  5KN1 A;  1PN9 A;  4OWY A;  2IFQ A;  1B48 A;  1XFL A;  1XCC A;  3ZZX A;  3M1G A;  2WGR A;  1PL2 A;  4YAV A;  3EU3 A;  3GN3 A;  1M2B A;  3O76 A;  4G0I A;  1XW5 A;  2HNL A;  2JU5 A;  4K8M A;  4OFT A;  4DSS A;  3US3 A;  3VPT A;  2NVL A;  4AJ6 A;  2RUF A;  1X9S B;  2PPT A;  2OAD A;  4FYC A;  4IEL A;  2LS5 A;  2LJR A;  3KM6 A;  4ECC A;  3N5O A;  1R7H A;  3QR6 A;  2IL3 A;  3HA9 A;  2RM6 A;  4MZW A;  2H72 A;  2I4A A;  4ZL7 A;  2YWM A;  3TRX A;  2PMT A;  2V1M A;  2FLS A;  1DBY A;  2N5F A;  3FR3 A;  4N0V A;  3ZL5 A;  2C3T A;  2VO4 A;  3CRU A;  1TK8 B;  4H86 A;  4F0B A;  1GSQ A;  1JLV A;  1GUL A;  5DBQ A;  3KTB A;  5G5F A;  3DXB A;  3APS A;  4NPB A;  2IFQ B;  5JWQ B;  1M9A A;  1X0R A;  14GS A;  3DIE A;  3HDC A;  3UVT A;  3E0U A;  5DCG A;  1SK0 A;  1J9B A;  5HFI A;  4PUA A;  1QUW A;  5C00 A;  3F4T A;  3DYR A;  2G2Q A;  5JWR B;  3DGQ A;  2ZUP A;  2YCD A;  2ZCT A;  4DSS B;  4F03 A;  2X8G A;  3UBL A;  1XVW A;  4Q5R A;  3TJJ A;  4FYU A;  1DUG A;  3IPZ A;  2VLT A;  2X99 A;  3D4T A;  2GZY A;  4TR0 A;  1ABA A;  2H0H A;  4EF0 A;  4BWQ A;  3CYN A;  2CA8 A;  2YJH A;  4QL7 A;  2I3Y A;  1T4Z A;  3I6A A;  1ERT A;  2EIO A;  2H66 A;  3QCP A;  6GSW A;  4KGI A;  1A8L A;  1WE0 A;  4RQX A;  4ML1 A;  2DJ3 A;  1BX9 A;  1TOF A;  3EE2 A;  4Z7X A;  4FQU A;  4G9H A;  2O85 A;  3TJG A;  5ID2 A;  4GXZ A;  1V40 A;  1V98 A;  2H73 A;  2C4J A;  1R4W A;  2YWN A;  2GTU A;  1K0N A;  6GSS A;  4TXO A;  1YKC A;  3F3R A;  2OKA A;  2N5B A;  5B6N A;  1GSF A;  1R5P A;  1SL1 B;  3R2Q A;  3L9U A;  1GUK A;  2O8V B;  3F4R A;  4EKZ A;  4K9Z A;  4NXI A;  1GTA A;  2LQQ A;  3HVX A;  3RAZ A;  4ECJ A;  5KN0 A;  3H93 A;  3OR5 A;  1XOA A;  3VI5 A;  3IDV A;  4I8B A;  5LNK e;  2A4V A;  3M9J A;  2GGT A;  1TW9 A;  1B8X A;  2VCQ A;  1EV4 A;  1O7U A;  3HJO A;  4ML6 A;  2HSM A;  2HYX A;  4GQC A;  1LJR A;  1DE1 A;  3WYW A;  4GTU A;  3KH9 A;  2NPB A;  1FAA A;  5CO3 A;  4O92 A;  9GSS A;  2CVB A;  1PA3 A;  6GST A;  2H0I A;  3M8N A;  3PR8 A;  3L78 A;  1AC1 A;  2CX4 A;  1HYU A;  1OC8 A;  2HRN A;  5ID2 B;  1FVK A;  1Z6N A;  5G2Z A;  5F06 A;  3UL3 A;  1SKS B;  1MD3 A;  4HZ2 A;  4IW9 A;  4MH2 A;  1AIU A;  1WJK A;  4JRR A;  4F2I A;  5A5K A;  3J7Y k;  1U88 A;  2JZS A;  5CAX A;  2C0D A;  2LRC A;  3SBC A;  1GLP A;  4MF7 A;  1TK0 B;  3EMP A;  3TOU A;  4TXV A;  5FT3 A;  3FZ9 A;  4O32 A;  1EOH A;  5COH A;  3DD3 A;  3RDW A;  5KN3 A;  5IPH A;  2FGX A;  4KDU A;  2PER A;  1YF1 A;  5EY6 A;  2DLX A;  4X0X A;  5ENU A;  1J0F A;  3TCO A;  1ML6 A;  5B8A A;  4GSS A;  2YAN A;  5JCW A;  2CQ9 A;  1XW6 A;  1JLW A;  3EUR A;  1A2M A;  3WT1 A;  3KH7 A;  1XWK A;  2HSM B;  1WWJ A;  1G6Y A;  2I1U A;  2O89 A;  2K18 A;  1Q98 A;  3F4S A;  3TJB A;  1GTB A;  1MD4 A;  2GSS A;  1JZD A;  1F6M C;  1C72 A;  3ME7 A;  1XWA A;  2OJL A;  1Z6M A;  5D9T A;  4AF2 A;  1G7E A;  2PVO C;  4V2L A;  3GUR A;  2OBK A;  2VAF A;  1PRX A;  1PX7 A;  3NOF A;  4JE1 A;  2K8S A;  4L0U A;  1TP9 A;  4ID0 A;  4LL4 B;  2KP1 A;  3EWL A;  4IQA A;  4OFN A;  4GST A;  2VCV A;  1YZX A;  1QXH A;  1K0M A;  5LCZ A;  2YZH A;  5IO0 A;  5IOX A;  4J2F A;  2E2M A;  1N2A A;  3H79 A;  4HU9 A;  4MZC A;  4TN8 A;  3DML A;  5ELG A;  1H75 A;  1FO5 A;  1BQ7 A;  4N10 A;  4ACS A;  4IVF A;  5EPF A;  1BG5 A;  4PQH A;  4V1A p;  3C7M A;  1V57 A;  1ERU A;  1XWC A;  1R5A A;  2R3X A;  4F0C A;  4QL9 A;  3MWH A;  5DJL A;  4KF9 A;  1N8J A;  5CYY A;  4YAP A;  2H75 A;  1HD2 A;  1SL0 B;  3LJR A;  1ZCP A;  3DEX A;  4N30 A;  3QOU A;  4CDO A;  1GSS A;  1TRS A;  3J7Y b;  4G2E A;  1A2J A;  5D96 A;  4BWS A;  1H4O A;  1XWG A;  4LMV A;  1A23 A;  3DWV A;  2NDO A;  1RQM A;  2F8F A;  2HLS A;  4IJ3 A;  5G1L A;  2GLR A;  3FR6 A;  3IR4 A;  1OC9 B;  5EL8 A;  1O81 A;  4XS6 A;  2H76 A;  4HQS A;  3KIJ A;  3CSI A;  1SKR B;  2VCX A;  1VF1 A;  19GS A;  3IHQ A;  4WXT A;  2BTO T;  4G19 A;  5CRW A;  4DSR A;  5DQY A;  3TKS A;  2VD1 A;  2ALB A;  4I5Q A;  4MZB A;  2VOC A;  2HRK A;  1QK8 A;  2GDR A;  3I69 A;  2B3S A;  4USS A;  2V32 A;  1USB A;  5F8B A;  3L0H A;  3GA4 A;  1UA5 A;  2P5Q A;  4KCE A;  2VLU A;  4JU5 A;  3KP8 A;  4L0W A;  1AQV A;  4MLY A;  2H1B A;  2WUL A;  3EYT A;  3VWV A;  5JCU A;  2LNT A;  5FHI A;  1XBS A;  1KNG A;  3LQ7 A;  5GZZ B;  4HUA A;  3UBK A;  3VWX A;  1VF4 A;  2FUG 2;  3APO A;  3HCZ A;  1VF2 A;  5HFG A;  2CVK A;  5LD0 A;  1TRU A;  5JWO B;  1TRV A;  17GS A;  5B7C A;  1PL1 A;  2WZ9 A;  5DQS A;  2E0Q A;  2F9S A;  2LRT A;  1XWB A;  1PQN A;  2R37 A;  3KCM A;  1AUC A;  5G1K A;  4MMM A;  4O5R A;  1SYX A;  5J9B A;  2IIY A;  2PUK C;  4XIH A; 
#chains in the Genus database with same CATH topology
 2BJX A;  1XPV A;  4GQF A;  4ZL8 A;  1EP7 A;  5IM9 A;  4OO4 A;  3IHG A;  1RW1 A;  3EIN A;  3GTU A;  3KXO A;  1CQG A;  2HRK B;  4MNN A;  2MMA A;  5ECQ B;  2VUP A;  1B4Q A;  1Z9H A;  1X5D A;  5BRT A;  1TDI A;  5IMV A;  4KND A;  2B5Y A;  2F8A A;  2FWF A;  1VF3 A;  2C1Y A;  4KE3 A;  5DJM A;  1NM3 A;  1HNA A;  1EV9 A;  1S3C A;  1UN2 A;  3IAS 2;  3V1W A;  1SVM A;  1T7P B;  4WBJ A;  2AAW A;  1OKD A;  3ZTL A;  1PFO A;  3Q6O A;  4EVM A;  4NHZ A;  2UV8 G;  2QGV A;  3HVV A;  3WD6 A;  3TKQ A;  3IRA A;  5CRD A;  4JBB A;  5F05 A;  1S3D A;  1X5C A;  3HY2 A;  1GSU A;  2C0F A;  2RM5 A;  1XW9 A;  2EFC A;  2DJ0 A;  4O7H A;  2O3E A;  3CHX C;  3C1R A;  1J08 A;  3LG6 A;  4FYB A;  3QAG A;  3ZML A;  2C0E A;  1XIY A;  5B6M A;  3KJY A;  2LQO A;  5G31 A;  1GSY A;  1O6J A;  2XBQ A;  5D9X A;  2LNS A;  2MBS A;  3G7Y A;  3WGD A;  1B4P A;  2X8C A;  3RHC A;  4RI6 A;  2RUE A;  3A3T A;  2B1K A;  4V2N A;  2K8V A;  1FB0 A;  1G0T A;  2R2J A;  3F63 A;  3GTU B;  2YJ7 A;  5AIS A;  2P5R A;  2L4Q A;  3FZ5 A;  4X43 A;  2VCZ A;  2HSN A;  4X1U A;  3CQF A;  2HRA A;  1YQ1 A;  1XOB A;  4BL7 B;  3LXZ A;  2CAQ A;  1GH2 A;  1NHO A;  3UOM A;  2VM1 A;  2H30 A;  2LST A;  4I6X A;  3PH9 A;  2YOI A;  3IXR A;  4ZB8 A;  1A0F A;  2H8L A;  1SVO A;  3Q18 A;  4MP4 A;  2LEG A;  4KUN A;  2JSZ A;  2DJ1 A;  2LJA A;  3P7X A;  4E8H A;  2EFE A;  4TR3 A;  1X5E A;  2O87 A;  2OE3 A;  3GKX A;  5CRH A;  4TOP A;  3W6G A;  3G7I A;  1YDK A;  1FOV A;  4KSM A;  2E7P A;  3L9S A;  1AXD A;  3A5W A;  5CRG A;  5IOW A;  3IOS A;  3QD9 A;  3KTL A;  5H5Q A;  1K0A A;  4HQZ A;  2A2P A;  4YKF A;  2XC2 A;  2F51 A;  3TJF A;  4PTS A;  2HQT A;  2HZF A;  3FKF A;  4X4J A;  2X8H A;  4NAX A;  1Z5Y E;  3MNG A;  4TR4 A;  4KH7 A;  4MF6 A;  1UC7 A;  1AW9 A;  3LYK A;  5J47 A;  5KN2 A;  4GWR A;  4IQ1 A;  3EU4 A;  4OO5 A;  2MYG A;  5C04 A;  1ZMA A;  1WMJ A;  2WW3 A;  1GUH A;  2HSN B;  1THO A;  1M7T A;  2N5A A;  1EGR A;  2B6M A;  3EVI A;  2QSI A;  3LYP A;  5ECM B;  2JL4 A;  4EC0 A;  1O85 A;  4ZL9 A;  4PGT A;  3TRP A;  3GL3 A;  3ZVJ D;  5ELA A;  4KCA A;  2H6Y A;  2OE0 A;  2GQM A;  4KX4 A;  2TIR A;  3H1N A;  3ZFB A;  3D22 A;  3EPT A;  3M3M A;  1PN0 A;  2DJ2 A;  1BJX A;  4ZIJ A;  3KMN A;  4XHM A;  5IMA A;  4AJ7 A;  2CZ3 A;  2C8U A;  3BOA A;  1GNE A;  2R5G A;  3WGX A;  1KEB A;  1NW2 A;  2EFH A;  4YQM A;  4J57 E;  3TJK A;  2H1G A;  4PI2 C;  1TU8 A;  1URM A;  1GTU A;  2FWG A;  2GT6 A;  2LRN A;  13GS A;  1ACV A;  4EO3 A;  4G10 A;  4WR4 A;  1A8Y A;  4EUY A;  4MA9 A;  2IMI A;  2CZ2 A;  3PPU A;  3I43 A;  4RQR A;  2O7K A;  5G5E A;  1S3R A;  1YEX A;  1M99 A;  3CTG A;  4PQI A;  3UVH A;  2ES7 A;  4WF4 A;  2BMX A;  5HFK A;  2NTO A;  5IMZ A;  2FA8 A;  3GSS A;  1ZYP A;  3GV1 A;  1ZL9 A;  1F3A A;  4NHW A;  4OD7 A;  4KDX A;  5J4V A;  5IQY A;  3KEB A;  5ECP B;  3D6I A;  1T00 A;  5ECK B;  3TOT A;  4Q5Q A;  1V2A A;  4HZ4 A;  4PX1 A;  3HJP A;  1GSE A;  3FMW A;  1O8W A;  1SU9 A;  1PGT A;  5HR0 A;  1WOU A;  2VCW A;  1DSB A;  2XHF A;  4IGJ A;  5DVB A;  3TKR A;  3ZIT A;  2H0G A;  1SK1 A;  4NWY A;  2WVY A;  3F0I A;  6GSU A;  3A2V A;  2REM A;  1TKD B;  2FY6 A;  3VFI A;  4EDY A;  4NV5 A;  1F9M A;  3U5R E;  2KOK A;  4MCU A;  4CY6 A;  1Z7P A;  5DDL A;  1T4Y A;  3MSZ A;  1O73 A;  2H6X A;  3F6D A;  5D9W A;  3M9K A;  1TXU A;  1AQW A;  1W4V A;  5IMC A;  3VI7 A;  4K7I A;  2RII A;  1SEN A;  2B1L A;  4YQU A;  1JFU A;  1OC9 A;  1Z3E A;  22GS A;  5B8B A;  4MPG A;  3ZIV A;  1M3I A;  3FRC A;  5A4W A;  3ERF A;  3IC8 A;  2LUS A;  4CY8 A;  2X49 A;  3HMJ G;  5DAK A;  2GZP A;  5IMF A;  5AIV A;  4HJM A;  2R6K A;  2H70 A;  1MDK A;  4K7O A;  4MJA A;  2DMM A;  4I2T A;  4LLR A;  2GSQ A;  2PN8 A;  2MMN A;  4TRX A;  3A2W A;  3Q19 A;  4J56 E;  1SJI A;  2H1D A;  2AUV A;  2VCT A;  1OC3 A;  5E4W A;  1ZZY A;  5A4V A;  1OE7 A;  3MDK A;  4ULX A;  2B7K A;  2V6K A;  2AHE A;  5INY A;  5IPG A;  4V1A g;  2HRF A;  3LW9 A;  3S9F A;  5CRE A;  4BVY B;  3H4K A;  2GS3 A;  8GSS A;  4K5S A;  1FW1 A;  4HU7 A;  3RPP A;  3GMF A;  5GAP D;  2C3Q A;  5EVO A;  3DRN A;  4BVX A;  2J23 A;  4HEA 2;  2H6Z A;  2FHE A;  1TXX A;  2WDU A;  3RHB A;  3EC3 A;  2VL9 A;  1MDI A;  1SK2 A;  3M0F A;  1U3A A;  5ECL B;  3IK7 A;  4N3Z A;  2I9H A;  4LL1 B;  2C0G A;  4EDZ A;  1A24 A;  3ED3 A;  1X9W B;  2CAI A;  3P90 A;  2IPA A;  1ZOF A;  1KTE A;  5J41 A;  1IYI A;  1TTZ A;  5GAN D;  5DAK B;  1YJ6 A;  2H19 A;  4JR4 A;  3GKN A;  1GUM A;  1EZK A;  4JED A;  2WJU A;  3EMX A;  4K2D A;  1Z7R A;  1EWX A;  2EC4 A;  1FOH A;  1MEK A;  5HR2 A;  2OAC A;  2FWH A;  3C73 A;  3HKR A;  2JAC A;  3LEF A;  1YY7 A;  2B5X A;  2DIY A;  5D93 A;  1QGV A;  1F3B A;  1VRS D;  3RBT A;  3P8W A;  4P3Y B;  3ZRD A;  2L5O A;  4XCS A;  1SJZ A;  3C71 A;  1TU7 A;  4Z2R A;  1A0R P;  2X64 A;  3GX0 A;  4MAB A;  2L59 A;  3C1S A;  1SJ6 A;  1K0D A;  4XS1 A;  3CXG A;  2CV4 A;  3GNJ A;  3PGT A;  2YWO A;  4RI7 A;  1B9Y C;  4FIW A;  2TRC P;  4I2U A;  3KMO A;  2VL2 C;  4PNG A;  3RPN A;  1NSW A;  2LV3 A;  5BMU B;  2VM2 A;  2YV9 A;  2KLX A;  2DJJ A;  3GX8 A;  4HJ2 A;  4BVX B;  1TI3 A;  5A5H B;  4AKX B;  4MJE A;  1GL8 A;  4AJ8 A;  1X9M B;  6GSY A;  4K0G A;  1OVN A;  5CNW A;  4KW6 A;  5J3R A;  1BAY A;  3D4M A;  4Z2U A;  4MJC A;  1V58 A;  2AYT A;  3TUE A;  4CW9 A;  2XPD A;  3TRQ A;  2G0F A;  5J4U A;  3TKP A;  3L4N A;  4F9Z A;  4POB A;  4XRD A;  1FVJ A;  1U87 A;  1JZR A;  3ZFL A;  5FWG A;  3ZRE A;  1I9D A;  3GH6 A;  3NZN A;  2WS2 A;  3CSH A;  4KAE A;  7GSS A;  4ILF A;  3PIN A;  4ECB A;  3RFR C;  4ECI A;  3IBH A;  5DCH A;  2A2S A;  1K0B A;  4I97 A;  3K8N A;  1RK4 A;  1XG8 A;  2AV4 A;  4BL7 A;  2ON7 A;  1XZO A;  2J9H A;  4KDY A;  1BG1 A;  4N11 A;  3MYD A;  2JZR A;  5H5S A;  3VWW A;  4XTS A;  2P0G A;  4TR1 A;  5H5R A;  5GST A;  2OE1 A;  1YF0 A;  1I5G A;  3KD0 A;  4BA7 A;  3HXS A;  2CX3 A;  2F3M A;  3ZYW A;  2HFD A;  2DKI A;  2M46 A;  4W66 A;  18GS A;  1FHE A;  4Q5F A;  3LFL A;  1TI1 A;  1XXU A;  3QAW A;  5ABR A;  4L5O A;  3IAM 2;  2VIM A;  1K3O A;  4WF5 A;  3GST A;  1K0O A;  2DKH A;  4POM A;  2WCI A;  1PX6 A;  4K6X A;  4EXJ A;  2GQK A;  5HR1 A;  3FY7 A;  3W8S A;  1S3A A;  3BJ5 A;  5J40 A;  3O3T A;  2IME A;  2TRX A;  2ON5 A;  2L6C A;  3LWA A;  3VUR A;  1T8E B;  5AGY A;  3AY8 A;  3I9V 2;  4TKY A;  1R26 A;  3ZVJ A;  4YH2 A;  2PU9 C;  3FYG A;  4K7N A;  1QMV A;  5KOW A;  2KUC A;  1WPI A;  3ZLP A;  3LSZ A;  1TRW A;  2L57 A;  5J5N A;  4IP6 A;  2XBI A;  2Z9S A;  1GNW A;  2FCH A;  2GQL A;  3MIX A;  2OT3 A;  3HHV A;  1YEW C;  1QFN A;  4BIK A;  4YKG A;  4L8E A;  1MDJ A;  3UJ1 A;  1SD9 A;  1GP1 A;  4TR1 B;  1OYJ A;  1OE8 A;  4YQV A;  1ILO A;  4ZBA A;  1GTI A;  3G9B A;  1NHY A;  2V41 A;  2H71 A;  4FO5 A;  4OCE A;  2M72 A;  3UMA A;  3IV4 A;  3QMX A;  4MPF A;  4K0N A;  1EP8 A;  2MMO A;  3FZA A;  1Y6E A;  1A2L A;  1EGO A;  3MAK A;  1M2D A;  3IE3 A;  1EEM A;  2EIQ A;  2GT5 A;  2R0P A;  3CMI A;  4WEY A;  3U6V A;  2HI7 A;  3GL5 A;  2VL2 A;  4AGS A;  4WKW A;  4OMV A;  4ZIL A;  3L9V A;  2AB6 A;  2H01 A;  2K9F A;  2DML A;  4IBP A;  3O6T A;  1HNB A;  3GUS A;  2VL3 A;  5IMD A;  4EIP A;  3KP9 A;  2YNX A;  2HZE A;  4K1F A;  4MK3 A;  5F0G A;  1EEJ A;  1K3Y A;  3ISO A;  2XPE A;  1XVQ A;  1MTC A;  6GSX A;  2V2G A;  2WW0 A;  4GCI A;  1T1V A;  2PBJ A;  1SKW B;  3P2A A;  4QQ7 A;  1M0U A;  3CTF A;  1E2Y A;  2JSY A;  1AQX A;  4PUR A;  5ECN B;  2FD3 A;  2VD0 A;  1ST9 A;  3APQ A;  1W89 A;  2IMD A;  1M9B A;  2WVX A;  1LU4 A;  2V6O A;  4ISD A;  2OBI A;  4ZB7 A;  1WP0 A;  1TJD A;  5AN1 A;  4GSN A;  1E6B A;  3FW2 A;  4N0Z A;  3HYP A;  4EE0 A;  1YEP A;  4HS1 A;  3FHK A;  1PMT A;  5GSS A;  2DJK A;  4DVC A;  3HZ4 A;  1F2E A;  3TKS C;  3SWL A;  11GS A;  3N9J A;  3LXT A;  2UZ8 A;  3HJM A;  2DIZ A;  4G01 A;  4JR6 A;  4IKH A;  4L5L A;  3D21 A;  3QFB C;  3IC4 A;  4PQ1 A;  2HZE B;  3GH9 A;  1VGL A;  3FZ4 A;  5CP1 A;  2FNO A;  2H1L A;  3QDN A;  2E2G A;  20GS A;  1THX A;  1U6T A;  2ZNM A;  3FEU A;  2LTK A;  5IIZ A;  2KHP A;  1ON4 A;  2K6V A;  4TXO B;  10GS A;  3CBU A;  5E59 A;  5DAL A;  2CVD A;  5F07 A;  1GLQ A;  1BYE A;  4PUF C;  2L4C A;  3GRX A;  1SD8 A;  4ZXG A;  3E9J B;  1LBK A;  4KB3 A;  2HE3 A;  5ECH B;  2FA4 A;  1TK5 B;  2WVX B;  4NV2 A;  4BVY A;  4KA0 A;  4TW5 A;  4HDE A;  2IMF A;  1M2A A;  3QAV A;  4MJB A;  4HI7 A;  2M80 A;  3NIV A;  3C8E A;  2GST A;  3DVW A;  3IA1 A;  4BPY A;  1IYH A;  2IN3 A;  4G0L A;  4D73 A;  3IK9 A;  4XS4 A;  3KZQ A;  1PSQ A;  1ZYN A;  3KGK A;  4F82 A;  2R4V A;  1BED A;  4IN0 A;  5L71 A;  3UEM A;  1AAZ A;  2MZC A;  4ZB9 A;  3ERW A;  5A1N A;  3A5I A;  4XRA A;  1OAZ A;  2QKE A;  1QQ2 A;  2DSA A;  4LMW A;  1PKZ A;  2AJQ B;  4JZQ A;  2DBC A;  6GSV A;  1F37 A;  4ZBD A;  4MDC A;  2YZU A;  4DEJ A;  1U3I A;  5JCG A;  1KBN A;  4G0K A;  4GRF A;  2WRT A;  1V9W A;  4IP1 A;  3A2X A;  4PXO A;  2WZS A;  1PKW A;  3F3Q A;  5DAL B;  1JHB A;  5D9V A;  4V2M A;  3BCK A;  2PWJ A;  3WGE A;  1T3B A;  2WFC A;  3F8U A;  1O8X A;  5ECO B;  4TVE A;  2HXK A;  3TKS E;  12GS A;  3G7J A;  3VLN A;  4E8E A;  1FG4 A;  3Q74 A;  2MMZ A;  2C80 A;  5D8I A;  1Y25 A;  4LA1 A;  2I81 A;  3LGC A;  2L6D A;  5BMU A;  2OA7 A;  3UIW A;  4NMU A;  1FB6 A;  3ERG A;  1WRY A;  4HSC X;  4WR5 A;  2C3N A;  4OCF A;  3FR9 A;  3F6F A;  5A5H A;  2YWI A;  4D73 B;  5AIX A;  3GYK A;  4XS4 B;  4CHS A;  3DVX A;  3VWU A;  1B9X C;  2LKU A;  3TDG A;  4DSQ A;  3D0Z A;  4OFM A;  1PD2 1;  4POL A;  5A1N B;  3QPM A;  2PVQ A;  2GSR A;  3HD5 A;  4PNF A;  4RUV A;  4WBR D;  3HZ8 A;  4ZBB A;  2IJY A;  3JCM L;  2VLV A;  5IO2 A;  1ZYQ B;  1EOG A;  1SYR A;  4EL1 A;  5KOX A;  2EIR A;  2HSY A;  2RLI A;  3CRT A;  1SL2 B;  3GKK A;  3VPQ A;  2CT6 A;  2IWT A;  1HQO A;  2WVZ A;  1WIK A;  2HSH A;  1Q4J A;  2IMK A;  1ZGN A;  1GRX A;  2JAD A;  4IJI A;  3UAR A;  2QC7 A;  2KP2 A;  2H1A A;  2GVP A;  2DC5 A;  3ZIJ A;  1ZYE A;  2H74 A;  4KSO A;  5HR3 A;  1UVZ A;  2B7J A;  1K3L A;  3TGZ A;  3E3E A;  2MBT A;  3VK9 A;  3BBY A;  5A34 A;  4FXY P;  4WET A;  4K5R A;  3GFK A;  4GLT A;  4Q5N A;  4IS0 A;  3GIX A;  3FK8 A;  1JZO A;  5ECS A;  3TB2 A;  3HVS A;  5D73 A;  4ZB6 A;  3QFA C;  4POK A;  3ZMK A;  5G30 A;  16GS A;  2A2R A;  1G6W A;  3CWG A;  2LJK A;  2YPM A;  1M3J A;  4Z2T A;  4GF0 A;  2NBS A;  1GWC A;  3W8J A;  5KEJ A;  4MF5 A;  3D5J A;  3GHA A;  2PGT A;  2HT9 A;  2YN1 A;  2YV7 A;  4FH8 A;  1I1I P;  1JZW A;  3DKS A;  3R3E A;  1K0C A;  2O36 A;  2GZZ A;  3BCI A;  3ME8 A;  2YP6 A;  2FWE A;  5J9C A;  3CSJ A;  3WT2 A;  2JZT A;  1HNC A;  4HOJ A;  4K2X A;  3H8Q A;  1OKT A;  3RGB C;  3F9U A;  3BD2 A;  2B5E A;  2WB9 A;  4IHU A;  1G7O A;  1ERV A;  1DE2 A;  5ECR B;  2L5L A;  5A4U A;  5ECI B;  2P31 A;  5A34 B;  1CQH A;  1ERW A;  1YKA A;  1GSD A;  5HQP A;  3GKM A;  2D2Z A;  3LOR A;  4MH3 A;  3UAP A;  5KN1 A;  1PN9 A;  4OWY A;  2IFQ A;  1B48 A;  1XFL A;  1XCC A;  3ZZX A;  3M1G A;  2WGR A;  1PL2 A;  4YAV A;  3EU3 A;  3GN3 A;  1M2B A;  3O76 A;  4G0I A;  1XW5 A;  2HNL A;  2JU5 A;  4K8M A;  4OFT A;  2R0G A;  4DSS A;  1SVL A;  3US3 A;  3VPT A;  2NVL A;  4AJ6 A;  1S4B P;  2RUF A;  1X9S B;  2PPT A;  2OAD A;  4FYC A;  4IEL A;  2LS5 A;  2LJR A;  3KM6 A;  4ECC A;  3N5O A;  1R7H A;  3QR6 A;  2IL3 A;  3HA9 A;  2RM6 A;  4MZW A;  2H72 A;  2I4A A;  4ZL7 A;  2YWM A;  3TRX A;  2PMT A;  2V1M A;  2FLS A;  1DBY A;  2N5F A;  3FR3 A;  4N0V A;  3ZL5 A;  2C3T A;  2VO4 A;  3CRU A;  1TK8 B;  4H86 A;  1Y1U A;  4F0B A;  1GSQ A;  1JLV A;  1GUL A;  3HVN A;  5DBQ A;  3KTB A;  5G5F A;  3DXB A;  3APS A;  4NPB A;  2IFQ B;  5JWQ B;  1M9A A;  1X0R A;  14GS A;  3DIE A;  3HDC A;  3UVT A;  3E0U A;  5DCG A;  1SK0 A;  1J9B A;  5HFI A;  4PUA A;  1QUW A;  2WW2 A;  5C00 A;  3F4T A;  3DYR A;  2G2Q A;  5JWR B;  2R0C A;  3DGQ A;  2ZUP A;  2YCD A;  2ZCT A;  4DSS B;  4F03 A;  2X8G A;  3UBL A;  1XVW A;  4Q5R A;  3TJJ A;  4FYU A;  1DUG A;  3IPZ A;  2VLT A;  2X99 A;  3D4T A;  2GZY A;  2VKZ G;  4TR0 A;  1ABA A;  2H0H A;  4EF0 A;  4BWQ A;  3CYN A;  2CA8 A;  2YJH A;  4QL7 A;  2I3Y A;  1T4Z A;  3I6A A;  1ERT A;  2EIO A;  2H66 A;  3QCP A;  6GSW A;  4KGI A;  1A8L A;  1WE0 A;  4RQX A;  4ML1 A;  2DJ3 A;  1BX9 A;  1TOF A;  3EE2 A;  4Z7X A;  4FQU A;  4G9H A;  2O85 A;  3TJG A;  5ID2 A;  4GXZ A;  5J4Y A;  1V40 A;  1V98 A;  2H73 A;  2C4J A;  1R4W A;  4PI0 C;  2YWN A;  2GTU A;  1K0N A;  6GSS A;  4TXO A;  1YKC A;  3F3R A;  2OKA A;  2N5B A;  5B6N A;  1GSF A;  1R5P A;  1SL1 B;  3R2Q A;  3L9U A;  1GUK A;  2O8V B;  3F4R A;  4EKZ A;  4K9Z A;  4NXI A;  1GTA A;  2LQQ A;  2X4A A;  3HVX A;  3RAZ A;  4ECJ A;  5KN0 A;  1BF5 A;  3H93 A;  2WW1 A;  3OR5 A;  1XOA A;  3VI5 A;  3IDV A;  4I8B A;  5LNK e;  2A4V A;  3M9J A;  2GGT A;  1TW9 A;  1B8X A;  4AKI A;  2VCQ A;  1EV4 A;  1O7U A;  3HJO A;  4ML6 A;  2HSM A;  2HYX A;  4GQC A;  1LJR A;  1DE1 A;  3WYW A;  4GTU A;  3KH9 A;  2NPB A;  1FAA A;  5CO3 A;  4O92 A;  9GSS A;  2CVB A;  1PA3 A;  6GST A;  2H0I A;  3M8N A;  3PR8 A;  3L78 A;  1AC1 A;  2CX4 A;  4GDF A;  1HYU A;  1OC8 A;  2HRN A;  5ID2 B;  1FVK A;  1Z6N A;  5G2Z A;  5F06 A;  3UL3 A;  1SKS B;  1MD3 A;  4HZ2 A;  4IW9 A;  4MH2 A;  1AIU A;  1WJK A;  4JRR A;  4F2I A;  5A5K A;  3J7Y k;  1U88 A;  2JZS A;  5CAX A;  2C0D A;  2LRC A;  3SBC A;  1GLP A;  4MF7 A;  1TK0 B;  3EMP A;  3TOU A;  4TXV A;  5FT3 A;  3FZ9 A;  4O32 A;  1EOH A;  5COH A;  3DD3 A;  3RDW A;  5KN3 A;  5IPH A;  2FGX A;  4KDU A;  4O5Q A;  2PER A;  1YF1 A;  5EY6 A;  2DLX A;  4X0X A;  5ENU A;  1J0F A;  3TCO A;  1ML6 A;  5B8A A;  4GSS A;  2YAN A;  5JCW A;  2CQ9 A;  1XW6 A;  1JLW A;  3EUR A;  1A2M A;  3WT1 A;  4AI6 A;  3KH7 A;  1XWK A;  2HSM B;  1WWJ A;  1G6Y A;  2I1U A;  4ICY A;  2O89 A;  2K18 A;  1Q98 A;  3F4S A;  3TJB A;  1GTB A;  1MD4 A;  2GSS A;  1JZD A;  1F6M C;  1C72 A;  3ME7 A;  1XWA A;  2OJL A;  1Z6M A;  5D9T A;  4AF2 A;  1G7E A;  2PVO C;  4V2L A;  3GUR A;  2OBK A;  1N25 A;  2VAF A;  1PRX A;  1PX7 A;  3NOF A;  4JE1 A;  2K8S A;  4L0U A;  1TP9 A;  4ID0 A;  4LL4 B;  2KP1 A;  3EWL A;  4IQA A;  4OFN A;  4GST A;  2VCV A;  4AKH A;  1YZX A;  1QXH A;  1K0M A;  5LCZ A;  2YZH A;  5IO0 A;  5IOX A;  4J2F A;  2E2M A;  1N2A A;  3H79 A;  4HU9 A;  4MZC A;  4TN8 A;  3DML A;  5ELG A;  1H75 A;  1FO5 A;  4E68 A;  1BQ7 A;  4N10 A;  4ACS A;  2EFD A;  4IVF A;  5EPF A;  1BG5 A;  4PQH A;  4V1A p;  3C7M A;  2QA2 A;  1V57 A;  1ERU A;  1XWC A;  1R5A A;  2R3X A;  4F0C A;  4QL9 A;  3MWH A;  5DJL A;  4KF9 A;  1N8J A;  5CYY A;  4YAP A;  2H75 A;  1HD2 A;  1SL0 B;  3LJR A;  1ZCP A;  3DEX A;  4N30 A;  3QOU A;  4CDO A;  1GSS A;  1TRS A;  3TU3 B;  3J7Y b;  4G2E A;  1A2J A;  5D96 A;  4BWS A;  1H4O A;  1XWG A;  4LMV A;  1A23 A;  3DWV A;  2NDO A;  1RQM A;  2F8F A;  2HLS A;  4IJ3 A;  5G1L A;  2GLR A;  3FR6 A;  3IR4 A;  1OC9 B;  5EL8 A;  1O81 A;  4XS6 A;  2H76 A;  4HQS A;  3KIJ A;  3CSI A;  4PHZ C;  1SKR B;  2VCX A;  4AKG A;  1VF1 A;  19GS A;  3IHQ A;  4WXT A;  2BTO T;  4G19 A;  5CRW A;  4DSR A;  5DQY A;  3TKS A;  2VD1 A;  2ALB A;  4I5Q A;  4MZB A;  2VOC A;  2HRK A;  1QK8 A;  2GDR A;  2A4H A;  3I69 A;  2B3S A;  4USS A;  2V32 A;  1USB A;  5F8B A;  3L0H A;  3GA4 A;  1UA5 A;  2P5Q A;  4KCE A;  2VLU A;  4JU5 A;  3KP8 A;  4L0W A;  1AQV A;  4MLY A;  2H1B A;  2WUL A;  3EYT A;  3VWV A;  5JCU A;  2LNT A;  5FHI A;  1XBS A;  1KNG A;  3LQ7 A;  5GZZ B;  4HUA A;  3UBK A;  3VWX A;  1VF4 A;  2O5V A;  2FUG 2;  3APO A;  3HCZ A;  1YVL A;  1VF2 A;  5HFG A;  2CVK A;  4QMK A;  5LD0 A;  1TRU A;  5JWO B;  1TRV A;  17GS A;  5B7C A;  1PL1 A;  2WZ9 A;  5DQS A;  2E0Q A;  2F9S A;  2LRT A;  4A5P A;  1XWB A;  1PQN A;  2R37 A;  3KCM A;  4O5U A;  1AUC A;  5G1K A;  4MMM A;  4O5R A;  1SYX A;  2QA1 A;  4EIQ A;  5J9B A;  2IIY A;  2PUK C;  4XIH A; 
#chains in the Genus database with same CATH homology
 2BJX A;  1XPV A;  4GQF A;  4ZL8 A;  1EP7 A;  5IM9 A;  4OO4 A;  3IHG A;  1RW1 A;  3EIN A;  3GTU A;  3KXO A;  1CQG A;  2HRK B;  4MNN A;  2MMA A;  5ECQ B;  2VUP A;  1B4Q A;  1Z9H A;  1X5D A;  5BRT A;  1TDI A;  5IMV A;  4KND A;  2B5Y A;  2F8A A;  2FWF A;  1VF3 A;  2C1Y A;  4KE3 A;  5DJM A;  1NM3 A;  1HNA A;  1EV9 A;  1S3C A;  1UN2 A;  3IAS 2;  3V1W A;  1SVM A;  1T7P B;  4WBJ A;  2AAW A;  1OKD A;  3ZTL A;  3Q6O A;  4EVM A;  4NHZ A;  2UV8 G;  2QGV A;  3HVV A;  3WD6 A;  3TKQ A;  3IRA A;  5CRD A;  4JBB A;  5F05 A;  1S3D A;  1X5C A;  3HY2 A;  1GSU A;  2C0F A;  2RM5 A;  1XW9 A;  2EFC A;  2DJ0 A;  4O7H A;  3C1R A;  1J08 A;  3LG6 A;  4FYB A;  3QAG A;  3ZML A;  2C0E A;  1XIY A;  5B6M A;  3KJY A;  2LQO A;  5G31 A;  1GSY A;  1O6J A;  2XBQ A;  5D9X A;  2LNS A;  2MBS A;  3G7Y A;  3WGD A;  1B4P A;  2X8C A;  3RHC A;  4RI6 A;  2RUE A;  3A3T A;  2B1K A;  4V2N A;  2K8V A;  1FB0 A;  1G0T A;  2R2J A;  3F63 A;  3GTU B;  2YJ7 A;  5AIS A;  2P5R A;  2L4Q A;  3FZ5 A;  4X43 A;  2VCZ A;  2HSN A;  4X1U A;  2HRA A;  1YQ1 A;  1XOB A;  4BL7 B;  3LXZ A;  2CAQ A;  1GH2 A;  1NHO A;  3UOM A;  2VM1 A;  2H30 A;  2LST A;  4I6X A;  3PH9 A;  2YOI A;  3IXR A;  4ZB8 A;  1A0F A;  2H8L A;  1SVO A;  3Q18 A;  4MP4 A;  2LEG A;  4KUN A;  2JSZ A;  2DJ1 A;  2LJA A;  3P7X A;  4E8H A;  2EFE A;  4TR3 A;  1X5E A;  2O87 A;  2OE3 A;  3GKX A;  5CRH A;  4TOP A;  3W6G A;  3G7I A;  1YDK A;  1FOV A;  4KSM A;  2E7P A;  3L9S A;  1AXD A;  3A5W A;  5CRG A;  5IOW A;  3IOS A;  3QD9 A;  3KTL A;  5H5Q A;  1K0A A;  4HQZ A;  2A2P A;  4YKF A;  2XC2 A;  2F51 A;  3TJF A;  4PTS A;  2HQT A;  2HZF A;  3FKF A;  4X4J A;  2X8H A;  4NAX A;  1Z5Y E;  3MNG A;  4TR4 A;  4KH7 A;  4MF6 A;  1UC7 A;  1AW9 A;  3LYK A;  5J47 A;  5KN2 A;  4GWR A;  4IQ1 A;  3EU4 A;  4OO5 A;  2MYG A;  5C04 A;  1ZMA A;  1WMJ A;  1GUH A;  2HSN B;  1THO A;  1M7T A;  2N5A A;  1EGR A;  2B6M A;  3EVI A;  2QSI A;  3LYP A;  5ECM B;  2JL4 A;  4EC0 A;  1O85 A;  4ZL9 A;  4PGT A;  3TRP A;  3GL3 A;  3ZVJ D;  5ELA A;  4KCA A;  2H6Y A;  2OE0 A;  2GQM A;  4KX4 A;  2TIR A;  3H1N A;  3ZFB A;  3D22 A;  3EPT A;  3M3M A;  1PN0 A;  2DJ2 A;  1BJX A;  4ZIJ A;  3KMN A;  4XHM A;  5IMA A;  4AJ7 A;  2CZ3 A;  2C8U A;  3BOA A;  1GNE A;  2R5G A;  3WGX A;  1KEB A;  1NW2 A;  2EFH A;  4YQM A;  4J57 E;  3TJK A;  2H1G A;  1TU8 A;  1URM A;  1GTU A;  2FWG A;  2GT6 A;  2LRN A;  13GS A;  1ACV A;  4EO3 A;  4G10 A;  4WR4 A;  1A8Y A;  4EUY A;  4MA9 A;  2IMI A;  2CZ2 A;  3PPU A;  3I43 A;  4RQR A;  2O7K A;  5G5E A;  1YEX A;  1M99 A;  3CTG A;  4PQI A;  3UVH A;  2ES7 A;  4WF4 A;  2BMX A;  5HFK A;  2NTO A;  5IMZ A;  2FA8 A;  3GSS A;  1ZYP A;  3GV1 A;  1ZL9 A;  1F3A A;  4NHW A;  4OD7 A;  4KDX A;  5J4V A;  5IQY A;  3KEB A;  5ECP B;  3D6I A;  1T00 A;  5ECK B;  3TOT A;  4Q5Q A;  1V2A A;  4HZ4 A;  4PX1 A;  3HJP A;  1GSE A;  3FMW A;  1O8W A;  1SU9 A;  1PGT A;  5HR0 A;  1WOU A;  2VCW A;  1DSB A;  2XHF A;  4IGJ A;  5DVB A;  3TKR A;  3ZIT A;  2H0G A;  1SK1 A;  4NWY A;  3F0I A;  6GSU A;  3A2V A;  2REM A;  1TKD B;  2FY6 A;  3VFI A;  4EDY A;  4NV5 A;  1F9M A;  3U5R E;  2KOK A;  4MCU A;  4CY6 A;  1Z7P A;  5DDL A;  1T4Y A;  3MSZ A;  1O73 A;  2H6X A;  3F6D A;  5D9W A;  3M9K A;  1TXU A;  1AQW A;  1W4V A;  5IMC A;  3VI7 A;  4K7I A;  2RII A;  1SEN A;  2B1L A;  4YQU A;  1JFU A;  1OC9 A;  1Z3E A;  22GS A;  5B8B A;  4MPG A;  3ZIV A;  3FRC A;  5A4W A;  3ERF A;  3IC8 A;  2LUS A;  4CY8 A;  2X49 A;  3HMJ G;  5DAK A;  2GZP A;  5IMF A;  5AIV A;  4HJM A;  2R6K A;  2H70 A;  1MDK A;  4K7O A;  4MJA A;  2DMM A;  4I2T A;  4LLR A;  2GSQ A;  2PN8 A;  2MMN A;  4TRX A;  3A2W A;  3Q19 A;  4J56 E;  1SJI A;  2H1D A;  2AUV A;  2VCT A;  1OC3 A;  5E4W A;  1ZZY A;  5A4V A;  1OE7 A;  3MDK A;  4ULX A;  2B7K A;  2V6K A;  2AHE A;  5INY A;  5IPG A;  4V1A g;  2HRF A;  3LW9 A;  3S9F A;  5CRE A;  4BVY B;  3H4K A;  2GS3 A;  8GSS A;  4K5S A;  1FW1 A;  4HU7 A;  3RPP A;  3GMF A;  5GAP D;  2C3Q A;  5EVO A;  3DRN A;  4BVX A;  2J23 A;  4HEA 2;  2H6Z A;  2FHE A;  1TXX A;  2WDU A;  3RHB A;  3EC3 A;  2VL9 A;  1MDI A;  1SK2 A;  3M0F A;  1U3A A;  5ECL B;  3IK7 A;  4N3Z A;  2I9H A;  4LL1 B;  2C0G A;  4EDZ A;  1A24 A;  3ED3 A;  1X9W B;  2CAI A;  3P90 A;  2IPA A;  1ZOF A;  1KTE A;  5J41 A;  1IYI A;  1TTZ A;  5GAN D;  5DAK B;  1YJ6 A;  2H19 A;  4JR4 A;  3GKN A;  1GUM A;  1EZK A;  4JED A;  2WJU A;  3EMX A;  4K2D A;  1Z7R A;  1EWX A;  2EC4 A;  1FOH A;  1MEK A;  5HR2 A;  2OAC A;  2FWH A;  3C73 A;  3HKR A;  2JAC A;  3LEF A;  1YY7 A;  2B5X A;  2DIY A;  5D93 A;  1QGV A;  1F3B A;  1VRS D;  3RBT A;  3P8W A;  4P3Y B;  3ZRD A;  2L5O A;  4XCS A;  1SJZ A;  3C71 A;  1TU7 A;  4Z2R A;  1A0R P;  2X64 A;  3GX0 A;  4MAB A;  2L59 A;  3C1S A;  1SJ6 A;  1K0D A;  4XS1 A;  3CXG A;  2CV4 A;  3GNJ A;  3PGT A;  2YWO A;  4RI7 A;  1B9Y C;  4FIW A;  2TRC P;  4I2U A;  3KMO A;  2VL2 C;  4PNG A;  3RPN A;  1NSW A;  2LV3 A;  5BMU B;  2VM2 A;  2YV9 A;  2KLX A;  2DJJ A;  3GX8 A;  4HJ2 A;  4BVX B;  1TI3 A;  5A5H B;  4AKX B;  4MJE A;  1GL8 A;  4AJ8 A;  1X9M B;  6GSY A;  4K0G A;  1OVN A;  5CNW A;  4KW6 A;  5J3R A;  1BAY A;  3D4M A;  4Z2U A;  4MJC A;  1V58 A;  2AYT A;  3TUE A;  4CW9 A;  2XPD A;  3TRQ A;  2G0F A;  5J4U A;  3TKP A;  3L4N A;  4F9Z A;  4POB A;  4XRD A;  1FVJ A;  1U87 A;  1JZR A;  3ZFL A;  5FWG A;  3ZRE A;  1I9D A;  3GH6 A;  3NZN A;  2WS2 A;  3CSH A;  4KAE A;  7GSS A;  4ILF A;  3PIN A;  4ECB A;  4ECI A;  3IBH A;  5DCH A;  2A2S A;  1K0B A;  4I97 A;  3K8N A;  1RK4 A;  2AV4 A;  4BL7 A;  2ON7 A;  1XZO A;  2J9H A;  4KDY A;  1BG1 A;  4N11 A;  3MYD A;  2JZR A;  5H5S A;  3VWW A;  4XTS A;  2P0G A;  4TR1 A;  5H5R A;  5GST A;  2OE1 A;  1YF0 A;  1I5G A;  3KD0 A;  4BA7 A;  3HXS A;  2CX3 A;  2F3M A;  3ZYW A;  2HFD A;  2DKI A;  2M46 A;  4W66 A;  18GS A;  1FHE A;  4Q5F A;  3LFL A;  1TI1 A;  1XXU A;  3QAW A;  5ABR A;  4L5O A;  3IAM 2;  2VIM A;  1K3O A;  4WF5 A;  3GST A;  1K0O A;  2DKH A;  4POM A;  2WCI A;  1PX6 A;  4K6X A;  4EXJ A;  2GQK A;  5HR1 A;  3FY7 A;  3W8S A;  1S3A A;  3BJ5 A;  5J40 A;  3O3T A;  2IME A;  2TRX A;  2ON5 A;  2L6C A;  3LWA A;  3VUR A;  1T8E B;  5AGY A;  3AY8 A;  3I9V 2;  4TKY A;  1R26 A;  3ZVJ A;  4YH2 A;  2PU9 C;  3FYG A;  4K7N A;  1QMV A;  5KOW A;  2KUC A;  1WPI A;  3ZLP A;  3LSZ A;  1TRW A;  2L57 A;  5J5N A;  4IP6 A;  2XBI A;  2Z9S A;  1GNW A;  2FCH A;  2GQL A;  3MIX A;  2OT3 A;  3HHV A;  1QFN A;  4YKG A;  4L8E A;  1MDJ A;  3UJ1 A;  1SD9 A;  1GP1 A;  4TR1 B;  1OYJ A;  1OE8 A;  4YQV A;  1ILO A;  4ZBA A;  1GTI A;  3G9B A;  1NHY A;  2V41 A;  2H71 A;  4FO5 A;  4OCE A;  2M72 A;  3UMA A;  3IV4 A;  3QMX A;  4MPF A;  4K0N A;  1EP8 A;  2MMO A;  3FZA A;  1Y6E A;  1A2L A;  1EGO A;  3MAK A;  1M2D A;  3IE3 A;  1EEM A;  2EIQ A;  2GT5 A;  2R0P A;  3CMI A;  4WEY A;  3U6V A;  2HI7 A;  3GL5 A;  2VL2 A;  4AGS A;  4WKW A;  4OMV A;  4ZIL A;  3L9V A;  2AB6 A;  2H01 A;  2K9F A;  2DML A;  4IBP A;  3O6T A;  1HNB A;  3GUS A;  2VL3 A;  5IMD A;  4EIP A;  3KP9 A;  2YNX A;  2HZE A;  4K1F A;  4MK3 A;  5F0G A;  1EEJ A;  1K3Y A;  3ISO A;  2XPE A;  1XVQ A;  1MTC A;  6GSX A;  2V2G A;  4GCI A;  1T1V A;  2PBJ A;  1SKW B;  3P2A A;  4QQ7 A;  1M0U A;  3CTF A;  1E2Y A;  2JSY A;  1AQX A;  4PUR A;  5ECN B;  2FD3 A;  2VD0 A;  1ST9 A;  3APQ A;  1W89 A;  2IMD A;  1M9B A;  1LU4 A;  2V6O A;  4ISD A;  2OBI A;  4ZB7 A;  1WP0 A;  1TJD A;  5AN1 A;  4GSN A;  1E6B A;  3FW2 A;  4N0Z A;  3HYP A;  4EE0 A;  1YEP A;  4HS1 A;  3FHK A;  1PMT A;  5GSS A;  2DJK A;  4DVC A;  3HZ4 A;  1F2E A;  3TKS C;  3SWL A;  11GS A;  3N9J A;  3LXT A;  2UZ8 A;  3HJM A;  2DIZ A;  4G01 A;  4JR6 A;  4IKH A;  4L5L A;  3D21 A;  3QFB C;  3IC4 A;  4PQ1 A;  2HZE B;  3GH9 A;  1VGL A;  3FZ4 A;  5CP1 A;  2FNO A;  2H1L A;  3QDN A;  2E2G A;  20GS A;  1THX A;  1U6T A;  2ZNM A;  3FEU A;  2LTK A;  5IIZ A;  2KHP A;  1ON4 A;  2K6V A;  4TXO B;  10GS A;  3CBU A;  5E59 A;  5DAL A;  2CVD A;  5F07 A;  1GLQ A;  1BYE A;  4PUF C;  2L4C A;  3GRX A;  1SD8 A;  4ZXG A;  3E9J B;  1LBK A;  4KB3 A;  2HE3 A;  5ECH B;  2FA4 A;  1TK5 B;  4NV2 A;  4BVY A;  4KA0 A;  4TW5 A;  4HDE A;  2IMF A;  1M2A A;  3QAV A;  4MJB A;  4HI7 A;  2M80 A;  3NIV A;  3C8E A;  2GST A;  3DVW A;  3IA1 A;  4BPY A;  1IYH A;  2IN3 A;  4G0L A;  4D73 A;  3IK9 A;  4XS4 A;  3KZQ A;  1PSQ A;  1ZYN A;  3KGK A;  4F82 A;  2R4V A;  1BED A;  4IN0 A;  5L71 A;  3UEM A;  1AAZ A;  2MZC A;  4ZB9 A;  3ERW A;  5A1N A;  3A5I A;  4XRA A;  1OAZ A;  2QKE A;  1QQ2 A;  2DSA A;  4LMW A;  1PKZ A;  2AJQ B;  4JZQ A;  2DBC A;  6GSV A;  1F37 A;  4ZBD A;  4MDC A;  2YZU A;  4DEJ A;  1U3I A;  5JCG A;  1KBN A;  4G0K A;  4GRF A;  2WRT A;  1V9W A;  4IP1 A;  3A2X A;  4PXO A;  1PKW A;  3F3Q A;  5DAL B;  1JHB A;  5D9V A;  4V2M A;  3BCK A;  2PWJ A;  3WGE A;  1T3B A;  2WFC A;  3F8U A;  1O8X A;  5ECO B;  4TVE A;  2HXK A;  3TKS E;  12GS A;  3G7J A;  3VLN A;  4E8E A;  1FG4 A;  3Q74 A;  2MMZ A;  2C80 A;  5D8I A;  1Y25 A;  4LA1 A;  2I81 A;  3LGC A;  2L6D A;  5BMU A;  2OA7 A;  3UIW A;  4NMU A;  1FB6 A;  3ERG A;  1WRY A;  4WR5 A;  2C3N A;  4OCF A;  3FR9 A;  3F6F A;  5A5H A;  2YWI A;  4D73 B;  5AIX A;  3GYK A;  4XS4 B;  4CHS A;  3DVX A;  3VWU A;  1B9X C;  2LKU A;  3TDG A;  4DSQ A;  3D0Z A;  4OFM A;  1PD2 1;  4POL A;  5A1N B;  3QPM A;  2PVQ A;  2GSR A;  3HD5 A;  4PNF A;  4RUV A;  4WBR D;  3HZ8 A;  4ZBB A;  2IJY A;  3JCM L;  2VLV A;  5IO2 A;  1ZYQ B;  1EOG A;  1SYR A;  4EL1 A;  5KOX A;  2EIR A;  2HSY A;  2RLI A;  3CRT A;  1SL2 B;  3GKK A;  3VPQ A;  2CT6 A;  2IWT A;  1HQO A;  1WIK A;  2HSH A;  1Q4J A;  2IMK A;  1ZGN A;  1GRX A;  2JAD A;  4IJI A;  3UAR A;  2QC7 A;  2KP2 A;  2H1A A;  2GVP A;  2DC5 A;  3ZIJ A;  1ZYE A;  2H74 A;  4KSO A;  5HR3 A;  1UVZ A;  2B7J A;  1K3L A;  3TGZ A;  3E3E A;  2MBT A;  3VK9 A;  3BBY A;  5A34 A;  4WET A;  4K5R A;  3GFK A;  4GLT A;  4Q5N A;  4IS0 A;  3GIX A;  3FK8 A;  1JZO A;  5ECS A;  3TB2 A;  3HVS A;  5D73 A;  4ZB6 A;  3QFA C;  4POK A;  3ZMK A;  5G30 A;  16GS A;  2A2R A;  1G6W A;  3CWG A;  2LJK A;  2YPM A;  4Z2T A;  4GF0 A;  2NBS A;  1GWC A;  3W8J A;  5KEJ A;  4MF5 A;  3D5J A;  3GHA A;  2PGT A;  2HT9 A;  2YN1 A;  2YV7 A;  4FH8 A;  1JZW A;  3DKS A;  3R3E A;  1K0C A;  2GZZ A;  3BCI A;  3ME8 A;  2YP6 A;  2FWE A;  5J9C A;  3CSJ A;  3WT2 A;  2JZT A;  1HNC A;  4HOJ A;  4K2X A;  3H8Q A;  1OKT A;  3F9U A;  3BD2 A;  2B5E A;  2WB9 A;  4IHU A;  1G7O A;  1ERV A;  1DE2 A;  5ECR B;  2L5L A;  5A4U A;  5ECI B;  2P31 A;  5A34 B;  1CQH A;  1ERW A;  1YKA A;  1GSD A;  5HQP A;  3GKM A;  2D2Z A;  3LOR A;  4MH3 A;  3UAP A;  5KN1 A;  1PN9 A;  4OWY A;  2IFQ A;  1B48 A;  1XFL A;  1XCC A;  3ZZX A;  3M1G A;  2WGR A;  1PL2 A;  4YAV A;  3EU3 A;  3GN3 A;  1M2B A;  3O76 A;  4G0I A;  1XW5 A;  2HNL A;  2JU5 A;  4K8M A;  4OFT A;  2R0G A;  4DSS A;  1SVL A;  3US3 A;  3VPT A;  2NVL A;  4AJ6 A;  2RUF A;  1X9S B;  2PPT A;  2OAD A;  4FYC A;  4IEL A;  2LS5 A;  2LJR A;  3KM6 A;  4ECC A;  3N5O A;  1R7H A;  3QR6 A;  2IL3 A;  3HA9 A;  2RM6 A;  4MZW A;  2H72 A;  2I4A A;  4ZL7 A;  2YWM A;  3TRX A;  2PMT A;  2V1M A;  2FLS A;  1DBY A;  2N5F A;  3FR3 A;  4N0V A;  3ZL5 A;  2C3T A;  2VO4 A;  3CRU A;  1TK8 B;  4H86 A;  1Y1U A;  4F0B A;  1GSQ A;  1JLV A;  1GUL A;  5DBQ A;  3KTB A;  5G5F A;  3DXB A;  3APS A;  4NPB A;  2IFQ B;  5JWQ B;  1M9A A;  1X0R A;  14GS A;  3DIE A;  3HDC A;  3UVT A;  3E0U A;  5DCG A;  1SK0 A;  1J9B A;  5HFI A;  4PUA A;  1QUW A;  5C00 A;  3F4T A;  3DYR A;  2G2Q A;  5JWR B;  2R0C A;  3DGQ A;  2ZUP A;  2YCD A;  2ZCT A;  4DSS B;  4F03 A;  2X8G A;  3UBL A;  1XVW A;  4Q5R A;  3TJJ A;  4FYU A;  1DUG A;  3IPZ A;  2VLT A;  2X99 A;  3D4T A;  2GZY A;  2VKZ G;  4TR0 A;  1ABA A;  2H0H A;  4EF0 A;  4BWQ A;  3CYN A;  2CA8 A;  2YJH A;  4QL7 A;  2I3Y A;  1T4Z A;  3I6A A;  1ERT A;  2EIO A;  2H66 A;  3QCP A;  6GSW A;  4KGI A;  1A8L A;  1WE0 A;  4RQX A;  4ML1 A;  2DJ3 A;  1BX9 A;  1TOF A;  3EE2 A;  4Z7X A;  4FQU A;  4G9H A;  2O85 A;  3TJG A;  5ID2 A;  4GXZ A;  5J4Y A;  1V40 A;  1V98 A;  2H73 A;  2C4J A;  1R4W A;  2YWN A;  2GTU A;  1K0N A;  6GSS A;  4TXO A;  1YKC A;  3F3R A;  2OKA A;  2N5B A;  5B6N A;  1GSF A;  1R5P A;  1SL1 B;  3R2Q A;  3L9U A;  1GUK A;  2O8V B;  3F4R A;  4EKZ A;  4K9Z A;  4NXI A;  1GTA A;  2LQQ A;  2X4A A;  3HVX A;  3RAZ A;  4ECJ A;  5KN0 A;  1BF5 A;  3H93 A;  3OR5 A;  1XOA A;  3VI5 A;  3IDV A;  4I8B A;  5LNK e;  2A4V A;  3M9J A;  2GGT A;  1TW9 A;  1B8X A;  4AKI A;  2VCQ A;  1EV4 A;  1O7U A;  3HJO A;  4ML6 A;  2HSM A;  2HYX A;  4GQC A;  1LJR A;  1DE1 A;  3WYW A;  4GTU A;  3KH9 A;  2NPB A;  1FAA A;  5CO3 A;  4O92 A;  9GSS A;  2CVB A;  1PA3 A;  6GST A;  2H0I A;  3M8N A;  3PR8 A;  3L78 A;  1AC1 A;  2CX4 A;  4GDF A;  1HYU A;  1OC8 A;  2HRN A;  5ID2 B;  1FVK A;  1Z6N A;  5G2Z A;  5F06 A;  3UL3 A;  1SKS B;  1MD3 A;  4HZ2 A;  4IW9 A;  4MH2 A;  1AIU A;  1WJK A;  4JRR A;  4F2I A;  5A5K A;  3J7Y k;  1U88 A;  2JZS A;  5CAX A;  2C0D A;  2LRC A;  3SBC A;  1GLP A;  4MF7 A;  1TK0 B;  3EMP A;  3TOU A;  4TXV A;  5FT3 A;  3FZ9 A;  4O32 A;  1EOH A;  5COH A;  3DD3 A;  3RDW A;  5KN3 A;  5IPH A;  2FGX A;  4KDU A;  4O5Q A;  2PER A;  1YF1 A;  5EY6 A;  2DLX A;  4X0X A;  5ENU A;  1J0F A;  3TCO A;  1ML6 A;  5B8A A;  4GSS A;  2YAN A;  5JCW A;  2CQ9 A;  1XW6 A;  1JLW A;  3EUR A;  1A2M A;  3WT1 A;  4AI6 A;  3KH7 A;  1XWK A;  2HSM B;  1WWJ A;  1G6Y A;  2I1U A;  4ICY A;  2O89 A;  2K18 A;  1Q98 A;  3F4S A;  3TJB A;  1GTB A;  1MD4 A;  2GSS A;  1JZD A;  1F6M C;  1C72 A;  3ME7 A;  1XWA A;  2OJL A;  1Z6M A;  5D9T A;  4AF2 A;  1G7E A;  2PVO C;  4V2L A;  3GUR A;  2OBK A;  1N25 A;  2VAF A;  1PRX A;  1PX7 A;  3NOF A;  4JE1 A;  2K8S A;  4L0U A;  1TP9 A;  4ID0 A;  4LL4 B;  2KP1 A;  3EWL A;  4IQA A;  4OFN A;  4GST A;  2VCV A;  4AKH A;  1YZX A;  1QXH A;  1K0M A;  5LCZ A;  2YZH A;  5IO0 A;  5IOX A;  4J2F A;  2E2M A;  1N2A A;  3H79 A;  4HU9 A;  4MZC A;  4TN8 A;  3DML A;  5ELG A;  1H75 A;  1FO5 A;  4E68 A;  1BQ7 A;  4N10 A;  4ACS A;  2EFD A;  4IVF A;  5EPF A;  1BG5 A;  4PQH A;  4V1A p;  3C7M A;  2QA2 A;  1V57 A;  1ERU A;  1XWC A;  1R5A A;  2R3X A;  4F0C A;  4QL9 A;  3MWH A;  5DJL A;  4KF9 A;  1N8J A;  5CYY A;  4YAP A;  2H75 A;  1HD2 A;  1SL0 B;  3LJR A;  1ZCP A;  3DEX A;  4N30 A;  3QOU A;  4CDO A;  1GSS A;  1TRS A;  3TU3 B;  3J7Y b;  4G2E A;  1A2J A;  5D96 A;  4BWS A;  1H4O A;  1XWG A;  4LMV A;  1A23 A;  3DWV A;  2NDO A;  1RQM A;  2F8F A;  2HLS A;  4IJ3 A;  5G1L A;  2GLR A;  3FR6 A;  3IR4 A;  1OC9 B;  5EL8 A;  1O81 A;  4XS6 A;  2H76 A;  4HQS A;  3KIJ A;  3CSI A;  1SKR B;  2VCX A;  4AKG A;  1VF1 A;  19GS A;  3IHQ A;  4WXT A;  2BTO T;  4G19 A;  5CRW A;  4DSR A;  5DQY A;  3TKS A;  2VD1 A;  2ALB A;  4I5Q A;  4MZB A;  2VOC A;  2HRK A;  1QK8 A;  2GDR A;  2A4H A;  3I69 A;  2B3S A;  4USS A;  2V32 A;  1USB A;  5F8B A;  3L0H A;  3GA4 A;  1UA5 A;  2P5Q A;  4KCE A;  2VLU A;  4JU5 A;  3KP8 A;  4L0W A;  1AQV A;  4MLY A;  2H1B A;  2WUL A;  3EYT A;  3VWV A;  5JCU A;  2LNT A;  5FHI A;  1XBS A;  1KNG A;  3LQ7 A;  5GZZ B;  4HUA A;  3UBK A;  3VWX A;  1VF4 A;  2O5V A;  2FUG 2;  3APO A;  3HCZ A;  1YVL A;  1VF2 A;  5HFG A;  2CVK A;  4QMK A;  5LD0 A;  1TRU A;  5JWO B;  1TRV A;  17GS A;  5B7C A;  1PL1 A;  2WZ9 A;  5DQS A;  2E0Q A;  2F9S A;  2LRT A;  4A5P A;  1XWB A;  1PQN A;  2R37 A;  3KCM A;  4O5U A;  1AUC A;  5G1K A;  4MMM A;  4O5R A;  1SYX A;  2QA1 A;  4EIQ A;  5J9B A;  2IIY A;  2PUK C;  4XIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...