2PMTA

Glutathione transferase from proteus mirabilis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
201
structure length
201
Chain Sequence
MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE TRANSFERASE
publication title A mixed disulfide bond in bacterial glutathione transferase: functional and evolutionary implications.
pubmed doi rcsb
source organism Proteus mirabilis
total genus 73
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2pmtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pmtA01
1SYXA 2LJKA 3N5OA 1NW2A 2GLRA 1B4QA 3FZAA 5IO2A 5HFGA 1DE2A 5AIVA 2FWEA 3GRXA 4K7NA 3DWVA 5B6MA 5DJLA 2GSSA 1HYUA 6GSXA 4IHUA 5JWQB 2BTOT 3FEUA 1WMJA 2H72A 3TRPA 4ISDA 1B9YC 3A2XA 1F6MC 1EZKA 4V2LA 1ZCPA 4KA0A 5G1LA 2GGTA 1XW5A 1WP0A 3WT2A 2FWFA 3PINA 4IN0A 2WZ9A 5DBQA 2K8SA 4P3YB 4AF2A 3KTLA 3ZFBA 2KLXA 3J7Yb 1J0FA 1R5PA 1GTBA 1BQ7A 1SD8A 4ML6A 2VM1A 7GSSA 2HRNA 5GSTA 1NM3A 3H1NA 3FHKA 3M0FA 3U5RE 2H0HA 5HR3A 2VLTA 4AJ8A 4I6XA 1K0AA 1HD2A 4EDYA 2DJ2A 3DEXA 3OR5A 5HR1A 3GIXA 2VUPA 2HNLA 5JCWA 1MD3A 4MPFA 2VOCA 2MMOA 4XRDA 4DSQA 2B5YA 3ZRDA 1PGTA 4G19A 1DUGA 1OC9B 2IIYA 4NHZA 5DAKB 4E8EA 2OJLA 2HXKA 1GH2A 3QPMA 2GT5A 4J56E 4L0WA 2OADA 1TRSA 3IC8A 2V32A 3KD0A 4IELA 3S9FA 1K0DA 1SD9A 1BYEA 1PKZA 4PX1A 2OE0A 2ALBA 3UVHA 5DAKA 4JBBA 4FH8A 3TRQA 2CZ3A 5J4UA 5ENUA 4OFNA 3G7IA 4MJEA 2GZPA 4EC0A 1OVNA 4PNGA 1PSQA 5IPHA 1O6JA 1PN9A 3I6AA 4KCAA 3IC4A 3F4RA 2C3NA 3VI7A 1G7OA 2IL3A 1SYRA 4ZL8A 5DQSA 2A4VA 1ERWA 1KTEA 4F0CA 4TR4A 4GTUA 2JZSA 2N5AA 4NV5A 3GHAA 2GSTA 2PU9C 1MD4A 1U88A 1JLVA 3IK9A 3FYGA 3WGXA 4MDCA 4GSTA 1WIKA 2FNOA 2C0EA 5JWOB 4XHMA 5ECPB 4YQVA 5CAXA 3GUSA 3A3TA 2HYXA 2JACA 3IE3A 3MSZA 3F63A 1Z3EA 3HZ4A 3FR6A 3LQ7A 2JL4A 4MP4A 1PL1A 3QAGA 5ELAA 2L5LA 5B6NA 4GWRA 2C8UA 2H0IA 3ZVJD 5CRWA 1RQMA 5CYYA 1XFLA 4FIWA 1K0BA 3DMLA 1A2JA 1QXHA 2H1DA 2M72A 3HDCA 3HXSA 4RI7A 4JE1A 3GFKA 1EV9A 4Q5RA 3GYKA 5H5RA 2DJ0A 4IKHA 5IMFA 2VLUA 4KW6A 3WYWA 3QFBC 3ZZXA 4O32A 4G0LA 3C1SA 3TKSC 2H70A 1M0UA 5IPGA 5A5KA 2H30A 1SJ6A 3FZ4A 2B1LA 2ES7A 3VURA 2R5GA 5COHA 4EL1A 1R4WA 1THOA 4TW5A 2AHEA 2IN3A 3KP9A 3KH7A 2CA8A 3C73A 2VCWA 3APSA 2MBSA 3VFIA 4NMUA 2O8VB 2E2MA 4AGSA 4MZBA 3PR8A 5CO3A 4K0GA 4IBPA 4NPBA 2P0GA 4BPYA 3P7XA 5DALB 1I9DA 4PUAA 4WETA 2C3QA 3UAPA 2FA4A 2JSZA 5AN1A 1MDIA 2LNTA 5D9XA 4KCEA 3P90A 1WOUA 4YQUA 4BWSA 11GSA 1C72A 3UOMA 1Q98A 3G9BA 3QCPA 4MJAA 2HRKB 3EINA 2IWTA 5DALA 3EMPA 3GKNA 3MDKA 1KEBA 4TXVA 2EC4A 2CZ2A 2R37A 3O76A 3CRUA 1YZXA 3J7Yk 1NSWA 2MMNA 5H5SA 3Q74A 4BL7B 2HRKA 1TP9A 4QL9A 4PGTA 1OE8A 2H19A 1K3OA 3CMIA 2IMFA 5D9TA 2B6MA 3E0UA 3F0IA 2GQLA 1TRWA 4MJCA 3MWHA 1ZOFA 3W8JA 1XOBA 4BL7A 4F03A 1XCCA 1PD21 1XBSA 3LSZA 3GL3A 3E3EA 2LTKA 2FGXA 1E6BA 1JZOA 4OD7A 2MYGA 1XWCA 3KGKA 1EP8A 3L78A 1GL8A 4MH3A 3W6GA 3DRNA 3KTBA 6GSSA 1MDKA 1J9BA 2PUKC 3M9KA 3GNJA 1Q4JA 4EO3A 3VPQA 2X8GA 4MPGA 4HUAA 4LLRA 1GSFA 1K0NA 3EU4A 2EIQA 4PURA 1LJRA 1GNWA 1A8LA 1CQGA 2OE1A 1F2EA 1YDKA 1XW6A 3HVXA 1K3YA 1YKAA 4TR1B 1TW9A 2O85A 6GSTA 4EF0A 3IR4A 4ML1A 3E9JB 2CVDA 4DVCA 5D9WA 2K18A 5DCHA 1TKDB 1PRXA 4XTSA 2CV4A 4V1Ap 2C80A 1BEDA 4Q5FA 3CSHA 4TR1A 5IOXA 1H4OA 4G10A 5BMUA 4PXOA 4JR6A 2H01A 3D4MA 8GSSA 2GTUA 2OE3A 4WXTA 3TDGA 4X1UA 1BJXA 3HVVA 3UIWA 3F9UA 1JZRA 2C4JA 5IO0A 2KUCA 3WD6A 5ID2A 2BJXA 3ZIVA 4GCIA 2YJHA 2DJ1A 1TU7A 2H1BA 3DVWA 4L0UA 5GAPD 4ID0A 1Y25A 5J9CA 2H74A 1R5AA 2B7JA 2H71A 2AAWA 2AUVA 4TVEA 5CRDA 4H86A 3KIJA 1FG4A 4ZB8A 1U3AA 3A5WA 3UBLA 3CYNA 1TK5B 3HJPA 1TDIA 5ELGA 1OE7A 3L9UA 1A0RP 4KNDA 1VRSD 2LSTA 4K9ZA 3D22A 4ECJA 2I4AA 1JHBA 3IBHA 4FO5A 2V6KA 4G0IA 3P8WA 1YQ1A 2PVOC 3GN3A 1X5DA 5F8BA 3APOA 1TRUA 4EKZA 2O87A 3RPNA 3FRCA 1SL2B 1PX7A 1WE0A 1AQXA 4HS1A 4LL4B 2WULA 4EXJA 2C0FA 2YPMA 1VF3A 3KXOA 1DBYA 4HU7A 3EYTA 3EMXA 5AISA 3HJMA 4O5RA 4N11A 2GT6A 3GURA 2V6OA 1XOAA 2FWHA 2VL3A 3GA4A 5G5FA 1TRVA 4J57E 5FT3A 1K0MA 2YWOA 2B1KA 2GDRA 2H1AA 2E0QA 3ERGA 2GSRA 4JU5A 5B8AA 4HEA2 1ZMAA 1Z9HA 2HRAA 1OAZA 1M9AA 3SBCA 3LEFA 1T1VA 3G7YA 1QUWA 3GX0A 4EUYA 3UBKA 3QR6A 1FVKA 1JLWA 5DVBA 4N30A 5IMDA 2AB6A 4GSSA 4CW9A 1AW9A 2YANA 5F06A 1XZOA 1A24A 4HI7A 2CAQA 4KB3A 1ZYQB 4MCUA 5F05A 5GZZB 1X5CA 4V2NA 2K8VA 1QFNA 2KHPA 4K1FA 3IA1A 4ZXGA 5IIZA 4POMA 1Y6EA 4ZIJA 1EP7A 4G2EA 1ZZYA 2MMAA 5DJMA 1LU4A 4KDYA 4YAVA 2KP2A 5INYA 4POLA 5ECQB 2TRCP 22GSA 5J41A 2MZCA 4ZBBA 2UZ8A 4FQUA 3TB2A 3I69A 2RUFA 2XBQA 5G1KA 3L4NA 3BJ5A 1UN2A 3ZIJA 2GQKA 12GSA 4N10A 1EOGA 1WJKA 3EE2A 4HJ2A 5D96A 4EVMA 3CXGA 1FOVA 4N0VA 2DMLA 4ZBAA 2WB9A 1OC9A 2DLXA 2LV3A 2HFDA 2RIIA 5L71A 5ECLB 1N8JA 1O73A 3DVXA 2GVPA 4HZ4A 4ECBA 2E7PA 2H8LA 2L6CA 2V2GA 3EU3A 2VL2C 2FWGA 2LQOA 4MMMA 1S3CA 1GLPA 1A2MA 4JZQA 6GSVA 4ZB9A 4IJ3A 4JR4A 4JEDA 2H6XA 4I2UA 1YJ6A 1O85A 4WBRD 3F6FA 2XBIA 1YF0A 1CQHA 2WCIA 1GSEA 1TK8B 3UEMA 2VLVA 2VCZA 2H6ZA 1FB0A 2MMZA 2VCQA 1AAZA 4ZL9A 3P2AA 2RUEA 3VWUA 2LJRA 3RHBA 1ZL9A 2LUSA 3HZ8A 3KMNA 2PGTA 1ZYEA 1QGVA 5EPFA 1GP1A 1JFUA 6GSUA 4GXZA 3H8QA 4NAXA 2L59A 2P5RA 2YN1A 1EGRA 4N0ZA 4OO5A 3VWWA 3V1WA 2G0FA 4IVFA 1DE1A 1AQVA 3PPUA 4ZILA 1EOHA 5G5EA 3Q19A 3PH9A 5FHIA 4IP6A 1YY7A 3IHQA 1GUMA 3TJBA 3CSJA 3FR3A 1EWXA 1TOFA 1GSYA 2L4QA 3ZFLA 5ECOB 2HSYA 4KH7A 4ULXA 2B5XA 4OCFA 1Z5YE 3RPPA 4K7OA 4IQ1A 1I5GA 3HHVA 4MJBA 2NBSA 1UA5A 5E59A 1SL0B 2H1GA 3KMOA 4MZWA 1AUCA 3CBUA 1UC7A 2YJ7A 4MLYA 5LNKe 2R6KA 2I81A 5ECMB 2IMKA 3Q18A 2C3TA 3KH9A 2YOIA 1TK0B 4XIHA 5ECHB 2LNSA 16GSA 1NHOA 1TI1A 2YWNA 4V2MA 3DGQA 3US3A 3ZMKA 5D73A 2IFQB 1GRXA 1R26A 3I43A 2CQ9A 1QK8A 4DEJA 2FA8A 4K0NA 2GZYA 3F6DA 3TKSA 2VCVA 3IOSA 1F3BA 2FCHA 2YV7A 4NHWA 1GUKA 4Z7XA 2IFQA 2F8AA 4IP1A 1GUHA 1X9SB 1E2YA 1A0FA 2VCXA 1B9XC 2REMA 2AJQB 2G2QA 2LKUA 2O7KA 1JZDA 1VF2A 3UL3A 1YEXA 3IDVA 1FAAA 3DXBA 4Q5QA 3ED3A 4LL1B 3ERFA 2YZUA 1G7EA 4GF0A 2I1UA 4F82A 4Q5NA 5AGYA 2A2RA 3GV1A 2N5FA 3UARA 3ZREA 2F3MA 2DJKA 2HSHA 2L4CA 1HNBA 1M2AA 3F8UA 3UMAA 1GSDA 1FVJA 1G6YA 5IQYA 4LMWA 2NVLA 4KSOA 3IPZA 1O8XA 3QAWA 4CDOA 18GSA 3D0ZA 5EVOA 2CT6A 3KP8A 2JZTA 1GULA 2M46A 3ZITA 2VAFA 3K8NA 1WRYA 1M9BA 5GAND 2FD3A 3ZLPA 1FO5A 4KF9A 3BOAA 1F37A 1XWKA 2LRNA 4IGJA 2P31A 2VD0A 1M99A 3RAZA 4PTSA 2VO4A 3U6VA 4DSSB 2A2SA 5CP1A 2OBIA 3EC3A 4XS4B 1W89A 4QL7A 2HSNB 5GSSA 1A23A 4BVYB 4K8MA 2VCTA 3LGCA 3GX8A 10GSA 4DSSA 1SK2A 3TJGA 2HZEB 2D2ZA 3F4SA 4TKYA 4XS4A 4OWYA 4HQZA 2DC5A 1K0OA 3VLNA 3M8NA 4HZ2A 5F07A 4BVXB 1ERTA 1GNEA 2WS2A 4KUNA 1ML6A 1S3AA 1AQWA 1U6TA 2H75A 5IMCA 2HLSA 3JCML 4G0KA 1B4PA 2HZEA 2DSAA 1XW9A 4LMVA 2CVBA 4MH2A 3D4TA 5AIXA 1V58A 1SJIA 2DIYA 4OFTA 4OMVA 1R7HA 1X9MB 2R2JA 1BX9A 5J9BA 3IK7A 3EURA 1O7UA 3GSSA 3R2QA 4WR4A 4WR5A 5ECSA 5IMAA 4LA1A 4PQIA 3HVSA 2PVQA 4HDEA 4PNFA 4I97A 1XPVA 2MBTA 3TGZA 4ZL7A 3TOUA 4TOPA 1HQOA 2RM5A 3DKSA 3RDWA 3ME8A 1TU8A 3D21A 3FY7A 1TXXA 1V57A 3UJ1A 4MF7A 4RUVA 1SENA 3CSIA 2DMMA 2TIRA 3TKRA 2IJYA 4HJMA 5J5NA 1XWAA 2GZZA 4L5LA 2I9HA 3APQA 1FB6A 4I2TA 1G0TA 1SL1B 1M2DA 2EIOA 2H73A 4F2IA 4TRXA 2PPTA 2OKAA 1TTZA 5G31A 1OKDA 2DBCA 3F3RA 2L6DA 2FUG2 1QQ2A 3CRTA 2X8CA 2B7KA 3CTFA 1GWCA 4K7IA 5KN2A 4CHSA 5KEJA 1ZGNA 3G7JA 1B8XA 3HY2A 2H6YA 2JSYA 3FKFA 1QMVA 4F0BA 2WGRA 3HA9A 4MA9A 3VPTA 2YV9A 1Z7RA 3TKPA 3FR9A 4WKWA 4DSRA 1N2AA 1T4ZA 4WF5A 4POBA 2LS5A 2CAIA 3KJYA 4XS1A 2AYTA 2LEGA 1RW1A 4GLTA 19GSA 3NIVA 3HKRA 4OO4A 4X0XA 1USBA 2NDOA 1AXDA 3HCZA 1K3LA 4PQ1A 5JCUA 2WJUA 5CREA 1NHYA 4USSA 2WRTA 1KNGA 2GS3A 4ECIA 3EWLA 5HR0A 1MDJA 1T4YA 3QMXA 4AJ7A 2VL9A 4BA7A 1PA3A 4TXOB 3ZL5A 4G9HA 5JWRB 2DJJA 1ACVA 5ECRB 3LYKA 1V40A 2F9SA 1FW1A 1SK1A 1KBNA 1ABAA 3QDNA 3I9V2 3DD3A 3H93A 3BCKA 3LFLA 4TXOA 20GSA 1IYIA 2C0DA 2J23A 2LQQA 4I5QA 5LCZA 1B48A 1VF4A 4MABA 3KZQA 2XPEA 1O8WA 1OKTA 2HE3A 2ZCTA 1ILOA 3TJKA 5HR2A 2FHEA 1F3AA 13GSA 5FWGA 4KX4A 5B8BA 1PL2A 4FYCA 4ZB6A 2CX3A 2HZFA 2QGVA 5ECKB 3BCIA 3HD5A 1K0CA 2O89A 1T00A 3GTUB 4QQ7A 5ECNB 4F9ZA 2VIMA 2HT9A 2QKEA 2DIZA 1Z7PA 2YWMA 4EE0A 2V1MA 2RLIA 2FLSA 1GTAA 2XHFA 4GQFA 3GTUA 3GKMA 1ST9A 4ZBDA 4FYBA 2ON5A 3M1GA 5CRGA 4O7HA 3ISOA 2R3XA 1XVWA 3LYPA 1SJZA 4ILFA 3C71A 2QSIA 1U3IA 3QOUA 1EEMA 3W8SA 2FY6A 2VL2A 4POKA 2C0GA 1BG5A 3KM6A 1VF1A 3GSTA 2AV4A 5A4VA 3TRXA 2K9FA 2YCDA 3GL5A 1T8EB 4GSNA 1O81A 4NV2A 1SU9A 3M3MA 2P5QA 3TKQA 2CVKA 3C8EA 5KN3A 4PQHA 3VI5A 3SWLA 5HQPA 2B3SA 3CTGA 3LXTA 4YAPA 2L57A 4KE3A 4WEYA 2X99A 6GSYA 2V41A 1EGOA 4TN8A 3HYPA 2B5EA 3ZVJA 1TI3A 1HNCA 4KAEA 4D73B 1T7PB 4RQRA 5CNWA 2PN8A 4YH2A 1YEPA 2WFCA 2F8FA 1LBKA 4WF4A 3PGTA 2ON7A 3A2VA 5G30A 2XPDA 3F4TA 3UVTA 3GKXA 4D73A 4J2FA 3KEBA 14GSA 5DDLA 2RM6A 3O3TA 3TKSE 3ZMLA 3ME7A 1XWGA 1IYHA 2HQTA 3FW2A 1AIUA 1GTUA 3F3QA 2PWJA 1AC1A 4HOJA 2X8HA 2IPAA 4JRRA 5ABRA 3GKKA 3VWVA 4KSMA 5LD0A 1V9WA 2YP6A 5D9VA 4IJIA 3IAS2 3GMFA 1EEJA 1THXA 1F9MA 5J3RA 5IMZA 1GLQA 4E8HA 2LRTA 3L0HA 3LG6A 4MF5A 1Z6MA 2ZNMA 1SKSB 2H66A 3IRAA 1PX6A 3GH9A 3LXZA 1V2AA 1EV4A 3TOTA 5A4WA 5IOWA 2H76A 3ZTLA 4MF6A 2CX4A 3NOFA 2LRCA 3MAKA 3O6TA 2IMDA 2E2GA 2OACA 2H0GA 2JU5A 1VGLA 1Z6NA 3FZ5A 3IV4A 1X9WB 3DYRA 3MNGA 3RBTA 3A2WA 3L9VA 1X0RA 5B7CA 1GSSA 2KP1A 1M2BA 1TJDA 2F51A 3VK9A 1M7TA 3EVIA 3NZNA 3HJOA 2HI7A 1OC3A 2ZUPA 4YQMA 3LJRA 3WGDA 2PERA 5A4UA 2I3YA 3WT1A 3QFAC 3M9JA 4GRFA 9GSSA 3VWXA 3H4KA 5C00A 3GH6A 1G6WA 1W4VA 3IAM2 4TR3A 5G2ZA 4KDXA 4V1Ag 5KN1A 2C1YA 1MTCA 4L8EA 4OCEA 4X43A 1A8YA 5D93A 3TCOA 4KGIA 1J08A 3LWAA 4NWYA 2VD1A 5HFKA 2BMXA 1HNAA 1PQNA 5IM9A 1DSBA 5KN0A 4ECCA 1MEKA 1SKRB 2N5BA 1OYJA 1ON4A 2OBKA 3BD2A 1UVZA 1GTIA 1SK0A 1S3DA 4XS6A 2GSQA 1V98A 1GSQA 2R4VA 2Z9SA 4XCSA 3QAVA 1SKWB 1OC8A 1XWBA 2YZHA 4BVYA 2EIRA 3D6IA 5IMVA 2XC2A 1XXUA 2M80A 4O92A 4GQCA 2LJAA 2WDUA 1YF1A 2L5OA 2J9HA 3L9SA 1XVQA 4IS0A 3R3EA 4RQXA 1T3BA 4BVXA 1ERUA 3FK8A 2VM2A 4PUFC 1WPIA 4K2DA 5D8IA 2QC7A 5EL8A 1FHEA 5ID2B 3C7MA 2PMTA 5JCGA 5DQYA 1RK4A 4OFMA 2NTOA 3Q6OA 3WGEA 4TR0A 5HFIA 6GSWA 1XIYA 4IQAA 3ERWA 3TJJA 4BWQA 2NPBA 3DIEA 1URMA 2HSMB 3H79A 1JZWA 4IW9A 2PBJA 2GQMA 1PKWA 2X64A 4L5OA 5CRHA 3AY8A 4MK3A 2HRFA 2TRXA 4AJ6A 4ACSA 2IMEA 5EY6A 3BBYA 2YNXA 4XRAA 4WBJA 4I8BA 2HSMA 1PMTA 1H75A 3FZ9A 17GSA 2KOKA 3TUEA 4K6XA 3ZYWA 3QD9A 5E4WA 3TJFA 5H5QA 4FYUA 4HU9A 3N9JA 1WWJA 1GSUA 2OA7A 2YWIA 3IXRA 4RI6A 1U87A 3D5JA 4EDZA 1YKCA 3KCMA 5ECIB 4KDUA 2JADA 4HQSA 1BAYA 2IMIA 4NXIA 3RHCA 1A2LA 3C1RA 5F0GA 2K6VA 1X5EA 5DCGA 2JZRA 1ERVA 3LORA 2DJ3A 4MZCA 5C04A
chains in the Genus database with same CATH superfamily
1SYXA 2LJKA 3N5OA 1NW2A 2GLRA 1B4QA 3FZAA 5IO2A 5HFGA 1DE2A 5AIVA 2FWEA 3GRXA 4K7NA 3DWVA 5B6MA 5DJLA 2GSSA 1HYUA 6GSXA 4IHUA 5JWQB 2BTOT 3FEUA 1WMJA 2H72A 3TRPA 4ISDA 1B9YC 4K2XA 3A2XA 1F6MC 1EZKA 4V2LA 1ZCPA 4KA0A 5G1LA 2GGTA 1XW5A 1WP0A 3WT2A 2FWFA 3PINA 4IN0A 2WZ9A 5DBQA 2K8SA 4P3YB 4AF2A 3KTLA 3ZFBA 2KLXA 3J7Yb 1J0FA 1R5PA 1GTBA 1BQ7A 1SD8A 4ML6A 2VM1A 7GSSA 2HRNA 5GSTA 1NM3A 3H1NA 3FHKA 3M0FA 3U5RE 2H0HA 5HR3A 2VLTA 3MYDA 4AJ8A 4I6XA 1K0AA 1HD2A 4EDYA 2DJ2A 3DEXA 3OR5A 5HR1A 3GIXA 2VUPA 2HNLA 5JCWA 1MD3A 4MPFA 2VOCA 2MMOA 4XRDA 4DSQA 2B5YA 3ZRDA 1PGTA 4G19A 1DUGA 1OC9B 2IIYA 4NHZA 5DAKB 4E8EA 2OJLA 2HXKA 1GH2A 3QPMA 2GT5A 4J56E 4L0WA 2OADA 1TRSA 3IC8A 2V32A 3KD0A 4IELA 3S9FA 1K0DA 1SD9A 1BYEA 1PKZA 4PX1A 2OE0A 2ALBA 3UVHA 5DAKA 4JBBA 4FH8A 3TRQA 2CZ3A 5J4UA 5ENUA 4OFNA 3G7IA 4MJEA 2GZPA 4EC0A 1OVNA 4PNGA 1PSQA 3FMWA 4YKGA 5IPHA 1O6JA 1PN9A 3I6AA 4KCAA 3IC4A 3F4RA 2C3NA 3VI7A 1G7OA 2IL3A 1SYRA 4ZL8A 5DQSA 2A4VA 2WW2A 1ERWA 1KTEA 4F0CA 4TR4A 4GTUA 2JZSA 2N5AA 4NV5A 3RGBC 3GHAA 2GSTA 2PU9C 1MD4A 1SVMA 1JLVA 1U88A 3IK9A 3FYGA 3WGXA 4MDCA 4GSTA 1WIKA 2FNOA 2C0EA 5JWOB 4XHMA 5ECPB 4YQVA 5CAXA 3GUSA 3A3TA 2HYXA 2JACA 3IE3A 3MSZA 3F63A 1Z3EA 3HZ4A 3FR6A 3LQ7A 2JL4A 4MP4A 1PL1A 3QAGA 5ELAA 2L5LA 5B6NA 4GWRA 2C8UA 2H0IA 3ZVJD 5CRWA 1RQMA 5CYYA 1XFLA 4FIWA 1K0BA 2A4HA 1A2JA 3DMLA 1QXHA 2H1DA 2M72A 3HDCA 3HXSA 4RI7A 1BG1A 4JE1A 5A5HB 3GFKA 1EV9A 4Q5RA 3GYKA 5J4VA 5H5RA 2DJ0A 4IKHA 5IMFA 2VLUA 4KW6A 3WYWA 4A5PA 3QFBC 3ZZXA 4O32A 4G0LA 3C1SA 3TKSC 2H70A 1ZYPA 1M0UA 5IPGA 5A5HA 5A5KA 2H30A 1SJ6A 3FZ4A 2B1LA 2ES7A 3VURA 2R5GA 5COHA 4EL1A 1R4WA 1THOA 4TW5A 2AHEA 2IN3A 3KP9A 3KH7A 2CA8A 3C73A 2VCWA 3APSA 2MBSA 3VFIA 4NMUA 2O8VB 2E2MA 4AGSA 4MZBA 2X4AA 3PR8A 5CO3A 4K0GA 4IBPA 2DKIA 2P0GA 4NPBA 4BPYA 3P7XA 5DALB 1I9DA 4E68A 4PUAA 4WETA 2C3QA 3UAPA 2FA4A 2JSZA 5AN1A 1MDIA 2LNTA 1I1IP 5D9XA 3P90A 1WOUA 4YQUA 4KCEA 4BWSA 11GSA 1C72A 3UOMA 1Q98A 3G9BA 3QCPA 4MJAA 2HRKB 3EINA 2IWTA 5DALA 3EMPA 3GKNA 3MDKA 2WVZA 1KEBA 4TXVA 2EC4A 4GDFA 2CZ2A 2WVYA 2R37A 3O76A 3CRUA 1YZXA 3MIXA 3J7Yk 1NSWA 2MMNA 5H5SA 3Q74A 4BL7B 2HRKA 1TP9A 4QL9A 4PGTA 1OE8A 2H19A 1K3OA 3CMIA 2IMFA 5D9TA 2B6MA 3E0UA 3F0IA 2GQLA 1TRWA 4MJCA 3MWHA 1ZOFA 3W8JA 1XOBA 4BL7A 5KOXA 4F03A 1XCCA 1PD21 1XBSA 3LSZA 3GL3A 4ICYA 3E3EA 2LTKA 2FGXA 2VKZG 1E6BA 1JZOA 4OD7A 2MYGA 1XWCA 3KGKA 1EP8A 3L78A 1GL8A 4MH3A 3W6GA 3DRNA 3KTBA 6GSSA 1MDKA 1J9BA 2PUKC 3M9KA 3GNJA 1Q4JA 4EO3A 3VPQA 2X8GA 4MPGA 4HUAA 4LLRA 1GSFA 1K0NA 3EU4A 2EIQA 4PURA 1LJRA 1GNWA 1A8LA 1CQGA 2OE1A 1F2EA 1YDKA 1XW6A 3HVXA 1BF5A 2H1LA 1K3YA 1YKAA 4TR1B 1TW9A 2O85A 5BMUB 6GSTA 4EF0A 3IR4A 4ML1A 3E9JB 2CVDA 4DVCA 5D9WA 2K18A 5DCHA 1TKDB 1PRXA 4XTSA 2CV4A 4V1Ap 2C80A 1BEDA 4Q5FA 3CSHA 4TR1A 5IOXA 4CY8A 1H4OA 4G10A 5BMUA 4PXOA 4JR6A 2H01A 3D4MA 8GSSA 2GTUA 2OE3A 4WXTA 3TDGA 4X1UA 1BJXA 3HVVA 3UIWA 3F9UA 4Z2RA 1JZRA 2C4JA 4PI2C 5IO0A 2KUCA 3WD6A 5ID2A 2BJXA 3LW9A 3ZIVA 4GCIA 2YJHA 2DJ1A 1TU7A 4AKXB 2H1BA 3DVWA 4L0UA 5GAPD 4ID0A 4K5SA 1Y25A 5J9CA 2H74A 1R5AA 2B7JA 2H71A 2AAWA 2AUVA 4TVEA 5CRDA 4H86A 5BRTA 3KIJA 1FG4A 4ZB8A 1U3AA 3A5WA 3UBLA 3CYNA 1TK5B 3HJPA 1TDIA 1YEWC 5ELGA 1M3IA 1OE7A 3L9UA 1A0RP 4KNDA 1TXUA 1VRSD 2LSTA 4K9ZA 3D22A 4ECJA 2I4AA 1JHBA 3IBHA 4FO5A 2V6KA 4G0IA 3P8WA 1YQ1A 2PVOC 3GN3A 1X5DA 5F8BA 3APOA 1TRUA 4EKZA 2O87A 3RPNA 3FRCA 2QA2A 1SL2B 1PX7A 1WE0A 1AQXA 4HS1A 4LL4B 2WULA 2UV8G 4EXJA 2C0FA 2YPMA 1VF3A 3KXOA 1DBYA 4HU7A 3EYTA 3EMXA 3HVNA 4ZB7A 5AISA 3HJMA 4O5RA 4N11A 2GT6A 3GURA 2V6OA 1XOAA 2FWHA 2VL3A 3GA4A 5G5FA 1TRVA 4J57E 5FT3A 1K0MA 2YWOA 2B1KA 2GDRA 4AKIA 2H1AA 2E0QA 3ERGA 2GSRA 4JU5A 3CQFA 5B8AA 4HEA2 1ZMAA 1Z9HA 2HRAA 1OAZA 1M9AA 3SBCA 3LEFA 1T1VA 3G7YA 1QUWA 3GX0A 4EUYA 3UBKA 3QR6A 1FVKA 1JLWA 5DVBA 4N30A 5IMDA 2AB6A 4EIPA 4GSSA 4CW9A 1AW9A 2YANA 5F06A 1XZOA 1A24A 4HI7A 2EFCA 2CAQA 4KB3A 1ZYQB 4MCUA 5F05A 5GZZB 1X5CA 4V2NA 2K8VA 1QFNA 2KHPA 4K1FA 3IA1A 4ZXGA 5IIZA 4POMA 1Y6EA 4ZIJA 1EP7A 4G2EA 1ZZYA 2MMAA 5DJMA 1LU4A 4KDYA 4YAVA 2KP2A 5INYA 4N3ZA 4POLA 2R0GA 5ECQB 2TRCP 22GSA 5J41A 2MZCA 4ZBBA 2UZ8A 4FQUA 3TB2A 3I69A 2RUFA 2XBQA 5G1KA 3L4NA 3BJ5A 1UN2A 3ZIJA 2GQKA 12GSA 4N10A 1EOGA 1WJKA 3EE2A 4HJ2A 5D96A 4EVMA 3CXGA 1FOVA 4N0VA 2DMLA 4ZBAA 2WB9A 1OC9A 2DLXA 2LV3A 2HFDA 2RIIA 5L71A 5ECLB 1N8JA 1O73A 3DVXA 2GVPA 4HZ4A 4ECBA 2E7PA 2H8LA 2L6CA 2V2GA 3EU3A 2VL2C 2FWGA 2LQOA 4MMMA 1S3CA 1GLPA 1A2MA 5KOWA 4JZQA 6GSVA 4ZB9A 2EFHA 4IJ3A 4MNNA 4JR4A 4JEDA 2H6XA 4I2UA 1YJ6A 1O85A 4WBRD 3F6FA 2XBIA 1YF0A 1CQHA 2WCIA 1GSEA 1TK8B 3UEMA 2VLVA 2VCZA 2H6ZA 1FB0A 2MMZA 2VCQA 1AAZA 4ZL9A 3P2AA 2RUEA 3VWUA 2LJRA 3RHBA 1ZL9A 2LUSA 3HZ8A 3KMNA 2PGTA 1ZYEA 1QGVA 5EPFA 1GP1A 1JFUA 6GSUA 4GXZA 3H8QA 4NAXA 2L59A 2P5RA 2YN1A 1EGRA 1ZYNA 4N0ZA 4OO5A 3VWWA 3V1WA 2G0FA 4IVFA 1DE1A 1AQVA 3PPUA 4ZILA 1EOHA 5G5EA 3Q19A 3PH9A 5FHIA 4IP6A 1YY7A 3IHQA 1GUMA 3TJBA 3CSJA 3FR3A 1EWXA 1TOFA 1GSYA 2L4QA 3ZFLA 5ECOB 2HSYA 4KH7A 4ULXA 2B5XA 4OCFA 1Z5YE 3RPPA 4K7OA 4IQ1A 3HMJG 1I5GA 4K5RA 3HHVA 4MJBA 2NBSA 1UA5A 5E59A 1SL0B 2H1GA 3KMOA 4MZWA 2EFDA 3CBUA 1AUCA 1UC7A 2YJ7A 4MLYA 5LNKe 2R6KA 2I81A 5ECMB 2IMKA 3Q18A 2C3TA 3KH9A 2YOIA 1TK0B 4FXYP 4XIHA 5ECHB 2LNSA 16GSA 1NHOA 1TI1A 2YWNA 4V2MA 3DGQA 3US3A 3ZMKA 5D73A 2IFQB 1GRXA 1R26A 3I43A 2CQ9A 2QA1A 1QK8A 4DEJA 2FA8A 4K0NA 2GZYA 3F6DA 3TKSA 2VCVA 3IOSA 4W66A 4BIKA 1F3BA 2FCHA 2YV7A 4NHWA 1GUKA 4Z7XA 2IFQA 2F8AA 4IP1A 1GUHA 1X9SB 1E2YA 1A0FA 2VCXA 1B9XC 2REMA 2AJQB 2G2QA 2LKUA 2O7KA 1JZDA 4G01A 1VF2A 3UL3A 1YEXA 4AKGA 3IDVA 1FAAA 3DXBA 4Q5QA 3ED3A 4LL1B 3ERFA 2YZUA 1G7EA 4GF0A 2I1UA 4F82A 4Q5NA 5AGYA 2A2RA 3GV1A 4X4JA 2N5FA 3UARA 3ZREA 2F3MA 2DJKA 2HSHA 2L4CA 4PHZC 1HNBA 1M2AA 3F8UA 3UMAA 1GSDA 1FVJA 1G6YA 5IQYA 4LMWA 2NVLA 1SVLA 2WVXB 4KSOA 3IPZA 1O8XA 2O36A 3QAWA 4CDOA 18GSA 3D0ZA 5EVOA 2CT6A 3KP8A 2JZTA 1GULA 2M46A 3ZITA 2WW0A 2VAFA 3K8NA 1WRYA 1M9BA 5GAND 2FD3A 3ZLPA 1FO5A 4KF9A 3BOAA 1F37A 1XWKA 2LRNA 4IGJA 2P31A 2VD0A 1SVOA 1M99A 3RAZA 4PTSA 2VO4A 3U6VA 4DSSB 2A2SA 5CP1A 2OBIA 3EC3A 4XS4B 1W89A 5J4YA 4QL7A 2HSNB 5GSSA 1A23A 4BVYB 2A2PA 4K8MA 2VCTA 3LGCA 3GX8A 10GSA 4DSSA 1SK2A 3TJGA 2HZEB 2D2ZA 3F4SA 4TKYA 4XS4A 4OWYA 4HQZA 2DC5A 2HSNA 1K0OA 3VLNA 3M8NA 4HZ2A 5F07A 4BVXB 1ERTA 1GNEA 2WS2A 4KUNA 1ML6A 1S3AA 1AQWA 1U6TA 2H75A 2O5VA 3EPTA 5IMCA 2HLSA 3JCML 4G0KA 1B4PA 2HZEA 2DSAA 4HSCX 1XW9A 4LMVA 2CVBA 4QMKA 4MH2A 3D4TA 5AIXA 1V58A 1N25A 1SJIA 2DIYA 4OFTA 4OMVA 1R7HA 1X9MB 2R2JA 1BX9A 5J9BA 3IK7A 3EURA 1O7UA 3GSSA 3R2QA 4WR4A 4WR5A 5ECSA 5IMAA 1XG8A 4LA1A 4PQIA 3HVSA 2PVQA 1Y1UA 4HDEA 4PNFA 4I97A 1XPVA 2MBTA 3TGZA 4ZL7A 3TOUA 4TOPA 1PFOA 1HQOA 2RM5A 3DKSA 3RDWA 2DKHA 3ME8A 1TU8A 3D21A 4EIQA 3FY7A 1TXXA 1FOHA 1V57A 3UJ1A 4MF7A 4RUVA 1SENA 3CSIA 2DMMA 4CY6A 2TIRA 3TKRA 2IJYA 4HJMA 5J5NA 1XWAA 2GZZA 4L5LA 2I9HA 3APQA 1FB6A 4I2TA 1G0TA 1SL1B 1M2DA 2EIOA 2H73A 4F2IA 4TRXA 2PPTA 2OKAA 1TTZA 5G31A 1OKDA 2DBCA 3F3RA 2L6DA 2FUG2 1QQ2A 3CRTA 2X8CA 2B7KA 3CTFA 1GWCA 4K7IA 5KN2A 4CHSA 5KEJA 1ZGNA 3G7JA 1B8XA 3HY2A 2H6YA 2JSYA 3FKFA 1QMVA 4F0BA 3HA9A 2EFEA 2WGRA 4MA9A 3VPTA 2YV9A 1Z7RA 3TKPA 3FR9A 1PN0A 4WKWA 4DSRA 1N2AA 1T4ZA 4WF5A 4POBA 2LS5A 2CAIA 3KJYA 4XS1A 2AYTA 2LEGA 2OT3A 1RW1A 4GLTA 19GSA 3NIVA 1S3RA 3HKRA 4OO4A 4X0XA 2O3EA 1USBA 2NDOA 4AKHA 5A1NB 1AXDA 3HCZA 1K3LA 4PQ1A 5JCUA 2WJUA 5CREA 1NHYA 3CWGA 4USSA 2WRTA 1KNGA 2GS3A 4ECIA 3EWLA 5HR0A 1MDJA 5A1NA 1T4YA 3QMXA 4AJ7A 2VL9A 4BA7A 1PA3A 4TXOB 3ZL5A 2WW3A 4G9HA 5JWRB 2DJJA 1ACVA 5ECRB 3LYKA 1V40A 2F9SA 1FW1A 1SK1A 1KBNA 1ABAA 3QDNA 3I9V2 3DD3A 3H93A 3BCKA 3LFLA 4TXOA 20GSA 1IYIA 2C0DA 2J23A 2LQQA 4I5QA 5LCZA 1B48A 1VF4A 4MABA 3KZQA 2XPEA 1O8WA 1OKTA 2HE3A 2ZCTA 1ILOA 3TJKA 5HR2A 2FHEA 1F3AA 13GSA 5FWGA 4KX4A 5B8BA 1PL2A 4FYCA 4ZB6A 2CX3A 2HZFA 2QGVA 5ECKB 3BCIA 3HD5A 1K0CA 2O89A 1T00A 3GTUB 4QQ7A 5ECNB 4F9ZA 2VIMA 2HT9A 2QKEA 2DIZA 1Z7PA 5J40A 2YWMA 4EE0A 4Z2UA 2V1MA 2RLIA 2FLSA 1GTAA 2XHFA 4GQFA 3GTUA 3GKMA 1ST9A 4ZBDA 4FYBA 2ON5A 3M1GA 5CRGA 4O7HA 3ISOA 2R3XA 1XVWA 3LYPA 1SJZA 4ILFA 3C71A 2QSIA 1U3IA 3QOUA 1EEMA 3W8SA 2FY6A 2VL2A 4POKA 2C0GA 1BG5A 3KM6A 1VF1A 3GSTA 2AV4A 2R0CA 5A4VA 3TRXA 2K9FA 2YCDA 3GL5A 1T8EB 4GSNA 4Z2TA 3CHXC 1O81A 4NV2A 1SU9A 3M3MA 3RFRC 2P5QA 4PI0C 3TKQA 2CVKA 3C8EA 5KN3A 4PQHA 3VI5A 3SWLA 5HQPA 2B3SA 3CTGA 3LXTA 4YAPA 2L57A 4KE3A 4WEYA 2X99A 6GSYA 2V41A 1EGOA 4TN8A 3HYPA 2WW1A 2B5EA 3ZVJA 1TI3A 1HNCA 4KAEA 4D73B 1T7PB 4RQRA 5CNWA 2PN8A 4YH2A 1YEPA 2WFCA 2F8FA 1LBKA 4WF4A 3PGTA 2ON7A 3A2VA 5G30A 3TU3B 2XPDA 2R0PA 3F4TA 3UVTA 3GKXA 4D73A 4J2FA 3KEBA 14GSA 5DDLA 2RM6A 3O3TA 3TKSE 3ZMLA 3ME7A 1XWGA 1IYHA 2HQTA 3FW2A 1AIUA 1GTUA 3F3QA 2PWJA 1AC1A 4HOJA 2X8HA 2IPAA 4JRRA 5ABRA 3GKKA 3VWVA 4KSMA 5LD0A 1V9WA 2YP6A 5D9VA 5A34B 4IJIA 3IAS2 3GMFA 1EEJA 1THXA 1F9MA 5J3RA 5IMZA 1GLQA 4E8HA 2LRTA 3L0HA 3LG6A 1S4BP 4MF5A 1Z6MA 2ZNMA 1SKSB 2H66A 3IRAA 1PX6A 3GH9A 5A34A 3LXZA 1V2AA 1EV4A 3TOTA 5A4WA 5IOWA 2H76A 3ZTLA 4MF6A 2CX4A 3NOFA 2LRCA 3MAKA 3O6TA 2IMDA 2E2GA 2OACA 2JU5A 2H0GA 1VGLA 1Z6NA 3FZ5A 3IV4A 1X9WB 3DYRA 3MNGA 3RBTA 3A2WA 3L9VA 1X0RA 4O5UA 5B7CA 1GSSA 2KP1A 1M2BA 4AI6A 1TJDA 2F51A 3VK9A 1M7TA 3EVIA 3NZNA 3HJOA 2HI7A 1OC3A 2ZUPA 4YQMA 3LJRA 3WGDA 2PERA 5A4UA 2I3YA 3WT1A 3QFAC 3M9JA 4GRFA 9GSSA 3VWXA 3H4KA 5C00A 3GH6A 1G6WA 1W4VA 3IAM2 4TR3A 5G2ZA 4KDXA 4V1Ag 5KN1A 2C1YA 1MTCA 4L8EA 2WVXA 4OCEA 4X43A 1A8YA 5D93A 3TCOA 4KGIA 1J08A 3LWAA 4NWYA 2VD1A 5HFKA 2BMXA 1HNAA 1PQNA 5IM9A 1DSBA 5KN0A 4ECCA 1MEKA 1SKRB 2N5BA 1OYJA 1ON4A 2OBKA 3BD2A 1UVZA 1GTIA 1SK0A 1S3DA 4XS6A 2GSQA 1V98A 1GSQA 2R4VA 2Z9SA 4XCSA 3QAVA 1SKWB 1OC8A 1XWBA 2YZHA 2WZSA 4BVYA 2EIRA 3D6IA 3A5IA 5IMVA 2XC2A 1XXUA 2M80A 4O92A 4GQCA 2LJAA 2WDUA 1YF1A 2L5OA 2J9HA 3L9SA 1XVQA 4IS0A 3R3EA 4RQXA 1T3BA 4BVXA 1ERUA 3FK8A 3IHGA 2VM2A 4PUFC 1WPIA 4K2DA 5D8IA 2QC7A 5EL8A 1FHEA 5ID2B 3C7MA 2PMTA 5JCGA 5DQYA 1RK4A 4OFMA 2X49A 2NTOA 3Q6OA 3WGEA 4TR0A 5HFIA 6GSWA 1XIYA 4IQAA 5J47A 3ERWA 3TJJA 4BWQA 2NPBA 3DIEA 1URMA 2HSMB 3H79A 1JZWA 4YKFA 4IW9A 2PBJA 1YVLA 2GQMA 1PKWA 2X64A 4L5OA 5CRHA 3AY8A 4MK3A 2HRFA 2TRXA 4AJ6A 4ACSA 4O5QA 2IMEA 5EY6A 3BBYA 2YNXA 4XRAA 4WBJA 4I8BA 2HSMA 1PMTA 1H75A 3FZ9A 17GSA 2KOKA 3TUEA 4K6XA 3ZYWA 3QD9A 5E4WA 3TJFA 5H5QA 4FYUA 4HU9A 3N9JA 1WWJA 1GSUA 2OA7A 2YWIA 3IXRA 4RI6A 1U87A 1M3JA 3D5JA 4EDZA 1YKCA 3KCMA 5ECIB 4KDUA 2JADA 4HQSA 1BAYA 2IMIA 4NXIA 3RHCA 1A2LA 3C1RA 5F0GA 2K6VA 1X5EA 5DCGA 2JZRA 1ERVA 3LORA 2DJ3A 4MZCA 5C04A
chains in the Genus database with same CATH topology
1SYXA 2LJKA 3N5OA 1NW2A 2GLRA 1B4QA 3FZAA 5IO2A 5HFGA 1DE2A 5AIVA 2FWEA 3GRXA 4K7NA 3DWVA 5B6MA 5DJLA 2GSSA 1HYUA 6GSXA 4IHUA 5JWQB 2BTOT 3FEUA 1WMJA 2H72A 3TRPA 4ISDA 1B9YC 4K2XA 3A2XA 1F6MC 1EZKA 4V2LA 1ZCPA 4KA0A 5G1LA 2GGTA 1XW5A 1WP0A 3WT2A 2FWFA 3PINA 4IN0A 2WZ9A 5DBQA 2K8SA 4P3YB 4AF2A 3KTLA 3ZFBA 2KLXA 3J7Yb 1J0FA 1R5PA 1GTBA 1BQ7A 1SD8A 4ML6A 2VM1A 7GSSA 2HRNA 5GSTA 1NM3A 3H1NA 3FHKA 3M0FA 3U5RE 2H0HA 5HR3A 2VLTA 3MYDA 4AJ8A 4I6XA 1K0AA 1HD2A 4EDYA 2DJ2A 3DEXA 3OR5A 5HR1A 3GIXA 2VUPA 2HNLA 5JCWA 1MD3A 4MPFA 2VOCA 2MMOA 4XRDA 4DSQA 2B5YA 3ZRDA 1PGTA 4G19A 1DUGA 1OC9B 2IIYA 4NHZA 5DAKB 4E8EA 2OJLA 2HXKA 1GH2A 3QPMA 2GT5A 4J56E 4L0WA 2OADA 1TRSA 3IC8A 2V32A 3KD0A 4IELA 3S9FA 1K0DA 1SD9A 1BYEA 1PKZA 4PX1A 2OE0A 2ALBA 3UVHA 5DAKA 4JBBA 4FH8A 3TRQA 2CZ3A 5J4UA 5ENUA 4OFNA 3G7IA 4MJEA 2GZPA 4EC0A 1OVNA 4PNGA 1PSQA 3FMWA 4YKGA 5IPHA 1O6JA 1PN9A 3I6AA 4KCAA 3IC4A 3F4RA 2C3NA 3VI7A 1G7OA 2IL3A 1SYRA 4ZL8A 5DQSA 2A4VA 1ERWA 1KTEA 4F0CA 4TR4A 4GTUA 2JZSA 2N5AA 4NV5A 3GHAA 2GSTA 2PU9C 1MD4A 1SVMA 1JLVA 1U88A 3IK9A 3FYGA 3WGXA 4MDCA 4GSTA 1WIKA 2FNOA 2C0EA 5JWOB 4XHMA 5ECPB 4YQVA 5CAXA 3GUSA 3A3TA 2HYXA 2JACA 3IE3A 3MSZA 3F63A 1Z3EA 3HZ4A 3FR6A 3LQ7A 2JL4A 4MP4A 1PL1A 3QAGA 5ELAA 2L5LA 5B6NA 4GWRA 2C8UA 2H0IA 3ZVJD 5CRWA 1RQMA 5CYYA 1XFLA 4FIWA 1K0BA 2A4HA 1A2JA 3DMLA 1QXHA 2H1DA 2M72A 3HDCA 3HXSA 4RI7A 1BG1A 4JE1A 5A5HB 3GFKA 1EV9A 4Q5RA 3GYKA 5J4VA 5H5RA 2DJ0A 4IKHA 5IMFA 2VLUA 4KW6A 3WYWA 4A5PA 3QFBC 3ZZXA 4O32A 4G0LA 3C1SA 3TKSC 2H70A 1ZYPA 1M0UA 5IPGA 5A5HA 5A5KA 2H30A 1SJ6A 3FZ4A 2B1LA 2ES7A 3VURA 2R5GA 5COHA 4EL1A 1R4WA 1THOA 4TW5A 2AHEA 2IN3A 3KP9A 3KH7A 2CA8A 3C73A 2VCWA 3APSA 2MBSA 3VFIA 4NMUA 2O8VB 2E2MA 4AGSA 4MZBA 2X4AA 3PR8A 5CO3A 4K0GA 4IBPA 2DKIA 2P0GA 4NPBA 4BPYA 3P7XA 5DALB 1I9DA 4E68A 4PUAA 4WETA 2C3QA 3UAPA 2FA4A 2JSZA 5AN1A 1MDIA 2LNTA 5D9XA 4KCEA 3P90A 1WOUA 4YQUA 4BWSA 11GSA 1C72A 3UOMA 1Q98A 3G9BA 3QCPA 4MJAA 2HRKB 3EINA 2IWTA 5DALA 3EMPA 3GKNA 3MDKA 1KEBA 4TXVA 2EC4A 4GDFA 2CZ2A 2R37A 3O76A 3CRUA 1YZXA 3MIXA 3J7Yk 1NSWA 2MMNA 5H5SA 3Q74A 4BL7B 2HRKA 1TP9A 4QL9A 4PGTA 1OE8A 2H19A 1K3OA 3CMIA 2IMFA 5D9TA 2B6MA 3E0UA 3F0IA 2GQLA 1TRWA 4MJCA 3MWHA 1ZOFA 3W8JA 1XOBA 4BL7A 5KOXA 4F03A 1XCCA 1PD21 1XBSA 3LSZA 3GL3A 4ICYA 3E3EA 2LTKA 2FGXA 2VKZG 1E6BA 1JZOA 4OD7A 2MYGA 1XWCA 3KGKA 1EP8A 3L78A 1GL8A 4MH3A 3W6GA 3DRNA 3KTBA 6GSSA 1MDKA 1J9BA 2PUKC 3M9KA 3GNJA 1Q4JA 4EO3A 3VPQA 2X8GA 4MPGA 4HUAA 4LLRA 1GSFA 1K0NA 3EU4A 2EIQA 4PURA 1LJRA 1GNWA 1A8LA 1CQGA 2OE1A 1F2EA 1YDKA 1XW6A 3HVXA 1BF5A 2H1LA 1K3YA 1YKAA 4TR1B 1TW9A 2O85A 5BMUB 6GSTA 4EF0A 3IR4A 4ML1A 3E9JB 2CVDA 4DVCA 5D9WA 2K18A 5DCHA 1TKDB 1PRXA 4XTSA 2CV4A 4V1Ap 2C80A 1BEDA 4Q5FA 3CSHA 4TR1A 5IOXA 4CY8A 1H4OA 4G10A 5BMUA 4PXOA 4JR6A 2H01A 3D4MA 8GSSA 2GTUA 2OE3A 4WXTA 3TDGA 4X1UA 1BJXA 3HVVA 3UIWA 3F9UA 4Z2RA 1JZRA 2C4JA 5IO0A 2KUCA 3WD6A 5ID2A 2BJXA 3LW9A 3ZIVA 4GCIA 2YJHA 2DJ1A 1TU7A 4AKXB 2H1BA 3DVWA 4L0UA 5GAPD 4ID0A 4K5SA 1Y25A 5J9CA 2H74A 1R5AA 2B7JA 2H71A 2AAWA 2AUVA 4TVEA 5CRDA 4H86A 5BRTA 3KIJA 1FG4A 4ZB8A 1U3AA 3A5WA 3UBLA 3CYNA 1TK5B 3HJPA 1TDIA 5ELGA 1OE7A 3L9UA 1A0RP 4KNDA 1TXUA 1VRSD 2LSTA 4K9ZA 3D22A 4ECJA 2I4AA 1JHBA 3IBHA 4FO5A 2V6KA 4G0IA 3P8WA 1YQ1A 2PVOC 3GN3A 1X5DA 5F8BA 3APOA 1TRUA 4EKZA 2O87A 3RPNA 3FRCA 2QA2A 1SL2B 1PX7A 1WE0A 1AQXA 4HS1A 4LL4B 2WULA 2UV8G 4EXJA 2C0FA 2YPMA 1VF3A 3KXOA 1DBYA 4HU7A 3EYTA 3EMXA 4ZB7A 5AISA 3HJMA 4O5RA 4N11A 2GT6A 3GURA 2V6OA 1XOAA 2FWHA 2VL3A 3GA4A 5G5FA 1TRVA 4J57E 5FT3A 1K0MA 2YWOA 2B1KA 2GDRA 4AKIA 2H1AA 2E0QA 3ERGA 2GSRA 4JU5A 5B8AA 4HEA2 1ZMAA 1Z9HA 2HRAA 1OAZA 1M9AA 3SBCA 3LEFA 1T1VA 3G7YA 1QUWA 3GX0A 4EUYA 3UBKA 3QR6A 1FVKA 1JLWA 5DVBA 4N30A 5IMDA 2AB6A 4EIPA 4GSSA 4CW9A 1AW9A 2YANA 5F06A 1XZOA 1A24A 4HI7A 2EFCA 2CAQA 4KB3A 1ZYQB 4MCUA 5F05A 5GZZB 1X5CA 4V2NA 2K8VA 1QFNA 2KHPA 4K1FA 3IA1A 4ZXGA 5IIZA 4POMA 1Y6EA 4ZIJA 1EP7A 4G2EA 1ZZYA 2MMAA 5DJMA 1LU4A 4KDYA 4YAVA 2KP2A 5INYA 4N3ZA 4POLA 2R0GA 5ECQB 2TRCP 22GSA 5J41A 2MZCA 4ZBBA 2UZ8A 4FQUA 3TB2A 3I69A 2RUFA 2XBQA 5G1KA 3L4NA 3BJ5A 1UN2A 3ZIJA 2GQKA 12GSA 4N10A 1EOGA 1WJKA 3EE2A 4HJ2A 5D96A 4EVMA 3CXGA 1FOVA 4N0VA 2DMLA 4ZBAA 2WB9A 1OC9A 2DLXA 2LV3A 2HFDA 2RIIA 5L71A 5ECLB 1N8JA 1O73A 3DVXA 2GVPA 4HZ4A 4ECBA 2E7PA 2H8LA 2L6CA 2V2GA 3EU3A 2VL2C 2FWGA 2LQOA 4MMMA 1S3CA 1GLPA 1A2MA 5KOWA 4JZQA 6GSVA 4ZB9A 2EFHA 4IJ3A 4MNNA 4JR4A 4JEDA 2H6XA 4I2UA 1YJ6A 1O85A 4WBRD 3F6FA 2XBIA 1YF0A 1CQHA 2WCIA 1GSEA 1TK8B 3UEMA 2VLVA 2VCZA 2H6ZA 1FB0A 2MMZA 2VCQA 1AAZA 4ZL9A 3P2AA 2RUEA 3VWUA 2LJRA 3RHBA 1ZL9A 2LUSA 3HZ8A 3KMNA 2PGTA 1ZYEA 1QGVA 5EPFA 1GP1A 1JFUA 6GSUA 4GXZA 3H8QA 4NAXA 2L59A 2P5RA 2YN1A 1EGRA 1ZYNA 4N0ZA 4OO5A 3VWWA 3V1WA 2G0FA 4IVFA 1DE1A 1AQVA 3PPUA 4ZILA 1EOHA 5G5EA 3Q19A 3PH9A 5FHIA 4IP6A 1YY7A 3IHQA 1GUMA 3TJBA 3CSJA 3FR3A 1EWXA 1TOFA 1GSYA 2L4QA 3ZFLA 5ECOB 2HSYA 4KH7A 4ULXA 2B5XA 4OCFA 1Z5YE 3RPPA 4K7OA 4IQ1A 3HMJG 1I5GA 4K5RA 3HHVA 4MJBA 2NBSA 1UA5A 5E59A 1SL0B 2H1GA 3KMOA 4MZWA 2EFDA 3CBUA 1AUCA 1UC7A 2YJ7A 4MLYA 5LNKe 2R6KA 2I81A 5ECMB 2IMKA 3Q18A 2C3TA 3KH9A 2YOIA 1TK0B 4XIHA 5ECHB 2LNSA 16GSA 1NHOA 1TI1A 2YWNA 4V2MA 3DGQA 3US3A 3ZMKA 5D73A 2IFQB 1GRXA 1R26A 3I43A 2CQ9A 2QA1A 1QK8A 4DEJA 2FA8A 4K0NA 2GZYA 3F6DA 3TKSA 2VCVA 3IOSA 4W66A 1F3BA 2FCHA 2YV7A 4NHWA 1GUKA 4Z7XA 2IFQA 2F8AA 4IP1A 1GUHA 1X9SB 1E2YA 1A0FA 2VCXA 1B9XC 2REMA 2AJQB 2G2QA 2LKUA 2O7KA 1JZDA 4G01A 1VF2A 3UL3A 1YEXA 4AKGA 3IDVA 1FAAA 3DXBA 4Q5QA 3ED3A 4LL1B 3ERFA 2YZUA 1G7EA 4GF0A 2I1UA 4F82A 4Q5NA 5AGYA 2A2RA 3GV1A 4X4JA 2N5FA 3UARA 3ZREA 2F3MA 2DJKA 2HSHA 2L4CA 1HNBA 1M2AA 3F8UA 3UMAA 1GSDA 1FVJA 1G6YA 5IQYA 4LMWA 2NVLA 1SVLA 4KSOA 3IPZA 1O8XA 3QAWA 4CDOA 18GSA 3D0ZA 5EVOA 2CT6A 3KP8A 2JZTA 1GULA 2M46A 3ZITA 2VAFA 3K8NA 1WRYA 1M9BA 5GAND 2FD3A 3ZLPA 1FO5A 4KF9A 3BOAA 1F37A 1XWKA 2LRNA 4IGJA 2P31A 2VD0A 1SVOA 1M99A 3RAZA 4PTSA 2VO4A 3U6VA 4DSSB 2A2SA 5CP1A 2OBIA 3EC3A 4XS4B 1W89A 5J4YA 4QL7A 2HSNB 5GSSA 1A23A 4BVYB 2A2PA 4K8MA 2VCTA 3LGCA 3GX8A 10GSA 4DSSA 1SK2A 3TJGA 2HZEB 2D2ZA 3F4SA 4TKYA 4XS4A 4OWYA 4HQZA 2DC5A 2HSNA 1K0OA 3VLNA 3M8NA 4HZ2A 5F07A 4BVXB 1ERTA 1GNEA 2WS2A 4KUNA 1ML6A 1S3AA 1AQWA 1U6TA 2H75A 2O5VA 3EPTA 5IMCA 2HLSA 3JCML 4G0KA 1B4PA 2HZEA 2DSAA 1XW9A 4LMVA 2CVBA 4QMKA 4MH2A 3D4TA 5AIXA 1V58A 1N25A 1SJIA 2DIYA 4OFTA 4OMVA 1R7HA 1X9MB 2R2JA 1BX9A 5J9BA 3IK7A 3EURA 1O7UA 3GSSA 3R2QA 4WR4A 4WR5A 5ECSA 5IMAA 4LA1A 4PQIA 3HVSA 2PVQA 1Y1UA 4HDEA 4PNFA 4I97A 1XPVA 2MBTA 3TGZA 4ZL7A 3TOUA 4TOPA 1HQOA 2RM5A 3DKSA 3RDWA 2DKHA 3ME8A 1TU8A 3D21A 4EIQA 3FY7A 1TXXA 1FOHA 1V57A 3UJ1A 4MF7A 4RUVA 1SENA 3CSIA 2DMMA 4CY6A 2TIRA 3TKRA 2IJYA 4HJMA 5J5NA 1XWAA 2GZZA 4L5LA 2I9HA 3APQA 1FB6A 4I2TA 1G0TA 1SL1B 1M2DA 2EIOA 2H73A 4F2IA 4TRXA 2PPTA 2OKAA 1TTZA 5G31A 1OKDA 2DBCA 3F3RA 2L6DA 2FUG2 1QQ2A 3CRTA 2X8CA 2B7KA 3CTFA 1GWCA 4K7IA 5KN2A 4CHSA 5KEJA 1ZGNA 3G7JA 1B8XA 3HY2A 2H6YA 2JSYA 3FKFA 1QMVA 4F0BA 3HA9A 2EFEA 2WGRA 4MA9A 3VPTA 2YV9A 1Z7RA 3TKPA 3FR9A 1PN0A 4WKWA 4DSRA 1N2AA 1T4ZA 4WF5A 4POBA 2LS5A 2CAIA 3KJYA 4XS1A 2AYTA 2LEGA 2OT3A 1RW1A 4GLTA 19GSA 3NIVA 3HKRA 4OO4A 4X0XA 1USBA 2NDOA 4AKHA 5A1NB 1AXDA 3HCZA 1K3LA 4PQ1A 5JCUA 2WJUA 5CREA 1NHYA 3CWGA 4USSA 2WRTA 1KNGA 2GS3A 4ECIA 3EWLA 5HR0A 1MDJA 5A1NA 1T4YA 3QMXA 4AJ7A 2VL9A 4BA7A 1PA3A 4TXOB 3ZL5A 4G9HA 5JWRB 2DJJA 1ACVA 5ECRB 3LYKA 1V40A 2F9SA 1FW1A 1SK1A 1KBNA 1ABAA 3QDNA 3I9V2 3DD3A 3H93A 3BCKA 3LFLA 4TXOA 20GSA 1IYIA 2C0DA 2J23A 2LQQA 4I5QA 5LCZA 1B48A 1VF4A 4MABA 3KZQA 2XPEA 1O8WA 1OKTA 2HE3A 2ZCTA 1ILOA 3TJKA 5HR2A 2FHEA 1F3AA 13GSA 5FWGA 4KX4A 5B8BA 1PL2A 4FYCA 4ZB6A 2CX3A 2HZFA 2QGVA 5ECKB 3BCIA 3HD5A 1K0CA 2O89A 1T00A 3GTUB 4QQ7A 5ECNB 4F9ZA 2VIMA 2HT9A 2QKEA 2DIZA 1Z7PA 5J40A 2YWMA 4EE0A 4Z2UA 2V1MA 2RLIA 2FLSA 1GTAA 2XHFA 4GQFA 3GTUA 3GKMA 1ST9A 4ZBDA 4FYBA 2ON5A 3M1GA 5CRGA 4O7HA 3ISOA 2R3XA 1XVWA 3LYPA 1SJZA 4ILFA 3C71A 2QSIA 1U3IA 3QOUA 1EEMA 3W8SA 2FY6A 2VL2A 4POKA 2C0GA 1BG5A 3KM6A 1VF1A 3GSTA 2AV4A 2R0CA 5A4VA 3TRXA 2K9FA 2YCDA 3GL5A 1T8EB 4GSNA 4Z2TA 1O81A 4NV2A 1SU9A 3M3MA 2P5QA 3TKQA 2CVKA 3C8EA 5KN3A 4PQHA 3VI5A 3SWLA 5HQPA 2B3SA 3CTGA 3LXTA 4YAPA 2L57A 4KE3A 4WEYA 2X99A 6GSYA 2V41A 1EGOA 4TN8A 3HYPA 2B5EA 3ZVJA 1TI3A 1HNCA 4KAEA 4D73B 1T7PB 4RQRA 5CNWA 2PN8A 4YH2A 1YEPA 2WFCA 2F8FA 1LBKA 4WF4A 3PGTA 2ON7A 3A2VA 5G30A 3TU3B 2XPDA 2R0PA 3F4TA 3UVTA 3GKXA 4D73A 4J2FA 3KEBA 14GSA 5DDLA 2RM6A 3O3TA 3TKSE 3ZMLA 3ME7A 1XWGA 1IYHA 2HQTA 3FW2A 1AIUA 1GTUA 3F3QA 2PWJA 1AC1A 4HOJA 2X8HA 2IPAA 4JRRA 5ABRA 3GKKA 3VWVA 4KSMA 5LD0A 1V9WA 2YP6A 5D9VA 5A34B 4IJIA 3IAS2 3GMFA 1EEJA 1THXA 1F9MA 5J3RA 5IMZA 1GLQA 4E8HA 2LRTA 3L0HA 3LG6A 4MF5A 1Z6MA 2ZNMA 1SKSB 2H66A 3IRAA 1PX6A 3GH9A 5A34A 3LXZA 1V2AA 1EV4A 3TOTA 5A4WA 5IOWA 2H76A 3ZTLA 4MF6A 2CX4A 3NOFA 2LRCA 3MAKA 3O6TA 2IMDA 2E2GA 2OACA 2JU5A 2H0GA 1VGLA 1Z6NA 3FZ5A 3IV4A 1X9WB 3DYRA 3MNGA 3RBTA 3A2WA 3L9VA 1X0RA 4O5UA 5B7CA 1GSSA 2KP1A 1M2BA 4AI6A 1TJDA 2F51A 3VK9A 1M7TA 3EVIA 3NZNA 3HJOA 2HI7A 1OC3A 2ZUPA 4YQMA 3LJRA 3WGDA 2PERA 5A4UA 2I3YA 3WT1A 3QFAC 3M9JA 4GRFA 9GSSA 3VWXA 3H4KA 5C00A 3GH6A 1G6WA 1W4VA 3IAM2 4TR3A 5G2ZA 4KDXA 4V1Ag 5KN1A 2C1YA 1MTCA 4L8EA 4OCEA 4X43A 1A8YA 5D93A 3TCOA 4KGIA 1J08A 3LWAA 4NWYA 2VD1A 5HFKA 2BMXA 1HNAA 1PQNA 5IM9A 1DSBA 5KN0A 4ECCA 1MEKA 1SKRB 2N5BA 1OYJA 1ON4A 2OBKA 3BD2A 1UVZA 1GTIA 1SK0A 1S3DA 4XS6A 2GSQA 1V98A 1GSQA 2R4VA 2Z9SA 4XCSA 3QAVA 1SKWB 1OC8A 1XWBA 2YZHA 4BVYA 2EIRA 3D6IA 3A5IA 5IMVA 2XC2A 1XXUA 2M80A 4O92A 4GQCA 2LJAA 2WDUA 1YF1A 2L5OA 2J9HA 3L9SA 1XVQA 4IS0A 3R3EA 4RQXA 1T3BA 4BVXA 1ERUA 3FK8A 3IHGA 2VM2A 4PUFC 1WPIA 4K2DA 5D8IA 2QC7A 5EL8A 1FHEA 5ID2B 3C7MA 2PMTA 5JCGA 5DQYA 1RK4A 4OFMA 2X49A 2NTOA 3Q6OA 3WGEA 4TR0A 5HFIA 6GSWA 1XIYA 4IQAA 5J47A 3ERWA 3TJJA 4BWQA 2NPBA 3DIEA 1URMA 2HSMB 3H79A 1JZWA 4YKFA 4IW9A 2PBJA 1YVLA 2GQMA 1PKWA 2X64A 4L5OA 5CRHA 3AY8A 4MK3A 2HRFA 2TRXA 4AJ6A 4ACSA 4O5QA 2IMEA 5EY6A 3BBYA 2YNXA 4XRAA 4WBJA 4I8BA 2HSMA 1PMTA 1H75A 3FZ9A 17GSA 2KOKA 3TUEA 4K6XA 3ZYWA 3QD9A 5E4WA 3TJFA 5H5QA 4FYUA 4HU9A 3N9JA 1WWJA 1GSUA 2OA7A 2YWIA 3IXRA 4RI6A 1U87A 3D5JA 4EDZA 1YKCA 3KCMA 5ECIB 4KDUA 2JADA 4HQSA 1BAYA 2IMIA 4NXIA 3RHCA 1A2LA 3C1RA 5F0GA 2K6VA 1X5EA 5DCGA 2JZRA 1ERVA 3LORA 2DJ3A 4MZCA 5C04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYX A;  2LJK A;  3N5O A;  1NW2 A;  2GLR A;  1B4Q A;  3FZA A;  5IO2 A;  5HFG A;  1DE2 A;  5AIV A;  2FWE A;  3GRX A;  4K7N A;  3DWV A;  5B6M A;  5DJL A;  2GSS A;  1HYU A;  6GSX A;  4IHU A;  5JWQ B;  2BTO T;  3FEU A;  1WMJ A;  2H72 A;  3TRP A;  4ISD A;  1B9Y C;  3A2X A;  1F6M C;  1EZK A;  4V2L A;  1ZCP A;  4KA0 A;  5G1L A;  2GGT A;  1XW5 A;  1WP0 A;  3WT2 A;  2FWF A;  3PIN A;  4IN0 A;  2WZ9 A;  5DBQ A;  2K8S A;  4P3Y B;  4AF2 A;  3KTL A;  3ZFB A;  2KLX A;  3J7Y b;  1J0F A;  1R5P A;  1GTB A;  1BQ7 A;  1SD8 A;  4ML6 A;  2VM1 A;  7GSS A;  2HRN A;  5GST A;  1NM3 A;  3H1N A;  3FHK A;  3M0F A;  3U5R E;  2H0H A;  5HR3 A;  2VLT A;  4AJ8 A;  4I6X A;  1K0A A;  1HD2 A;  4EDY A;  2DJ2 A;  3DEX A;  3OR5 A;  5HR1 A;  3GIX A;  2VUP A;  2HNL A;  5JCW A;  1MD3 A;  4MPF A;  2VOC A;  2MMO A;  4XRD A;  4DSQ A;  2B5Y A;  3ZRD A;  1PGT A;  4G19 A;  1DUG A;  1OC9 B;  2IIY A;  4NHZ A;  5DAK B;  4E8E A;  2OJL A;  2HXK A;  1GH2 A;  3QPM A;  2GT5 A;  4J56 E;  4L0W A;  2OAD A;  1TRS A;  3IC8 A;  2V32 A;  3KD0 A;  4IEL A;  3S9F A;  1K0D A;  1SD9 A;  1BYE A;  1PKZ A;  4PX1 A;  2OE0 A;  2ALB A;  3UVH A;  5DAK A;  4JBB A;  4FH8 A;  3TRQ A;  2CZ3 A;  5J4U A;  5ENU A;  4OFN A;  3G7I A;  4MJE A;  2GZP A;  4EC0 A;  1OVN A;  4PNG A;  1PSQ A;  5IPH A;  1O6J A;  1PN9 A;  3I6A A;  4KCA A;  3IC4 A;  3F4R A;  2C3N A;  3VI7 A;  1G7O A;  2IL3 A;  1SYR A;  4ZL8 A;  5DQS A;  2A4V A;  1ERW A;  1KTE A;  4F0C A;  4TR4 A;  4GTU A;  2JZS A;  2N5A A;  4NV5 A;  3GHA A;  2GST A;  2PU9 C;  1MD4 A;  1U88 A;  1JLV A;  3IK9 A;  3FYG A;  3WGX A;  4MDC A;  4GST A;  1WIK A;  2FNO A;  2C0E A;  5JWO B;  4XHM A;  5ECP B;  4YQV A;  5CAX A;  3GUS A;  3A3T A;  2HYX A;  2JAC A;  3IE3 A;  3MSZ A;  3F63 A;  1Z3E A;  3HZ4 A;  3FR6 A;  3LQ7 A;  2JL4 A;  4MP4 A;  1PL1 A;  3QAG A;  5ELA A;  2L5L A;  5B6N A;  4GWR A;  2C8U A;  2H0I A;  3ZVJ D;  5CRW A;  1RQM A;  5CYY A;  1XFL A;  4FIW A;  1K0B A;  3DML A;  1A2J A;  1QXH A;  2H1D A;  2M72 A;  3HDC A;  3HXS A;  4RI7 A;  4JE1 A;  3GFK A;  1EV9 A;  4Q5R A;  3GYK A;  5H5R A;  2DJ0 A;  4IKH A;  5IMF A;  2VLU A;  4KW6 A;  3WYW A;  3QFB C;  3ZZX A;  4O32 A;  4G0L A;  3C1S A;  3TKS C;  2H70 A;  1M0U A;  5IPG A;  5A5K A;  2H30 A;  1SJ6 A;  3FZ4 A;  2B1L A;  2ES7 A;  3VUR A;  2R5G A;  5COH A;  4EL1 A;  1R4W A;  1THO A;  4TW5 A;  2AHE A;  2IN3 A;  3KP9 A;  3KH7 A;  2CA8 A;  3C73 A;  2VCW A;  3APS A;  2MBS A;  3VFI A;  4NMU A;  2O8V B;  2E2M A;  4AGS A;  4MZB A;  3PR8 A;  5CO3 A;  4K0G A;  4IBP A;  4NPB A;  2P0G A;  4BPY A;  3P7X A;  5DAL B;  1I9D A;  4PUA A;  4WET A;  2C3Q A;  3UAP A;  2FA4 A;  2JSZ A;  5AN1 A;  1MDI A;  2LNT A;  5D9X A;  4KCE A;  3P90 A;  1WOU A;  4YQU A;  4BWS A;  11GS A;  1C72 A;  3UOM A;  1Q98 A;  3G9B A;  3QCP A;  4MJA A;  2HRK B;  3EIN A;  2IWT A;  5DAL A;  3EMP A;  3GKN A;  3MDK A;  1KEB A;  4TXV A;  2EC4 A;  2CZ2 A;  2R37 A;  3O76 A;  3CRU A;  1YZX A;  3J7Y k;  1NSW A;  2MMN A;  5H5S A;  3Q74 A;  4BL7 B;  2HRK A;  1TP9 A;  4QL9 A;  4PGT A;  1OE8 A;  2H19 A;  1K3O A;  3CMI A;  2IMF A;  5D9T A;  2B6M A;  3E0U A;  3F0I A;  2GQL A;  1TRW A;  4MJC A;  3MWH A;  1ZOF A;  3W8J A;  1XOB A;  4BL7 A;  4F03 A;  1XCC A;  1PD2 1;  1XBS A;  3LSZ A;  3GL3 A;  3E3E A;  2LTK A;  2FGX A;  1E6B A;  1JZO A;  4OD7 A;  2MYG A;  1XWC A;  3KGK A;  1EP8 A;  3L78 A;  1GL8 A;  4MH3 A;  3W6G A;  3DRN A;  3KTB A;  6GSS A;  1MDK A;  1J9B A;  2PUK C;  3M9K A;  3GNJ A;  1Q4J A;  4EO3 A;  3VPQ A;  2X8G A;  4MPG A;  4HUA A;  4LLR A;  1GSF A;  1K0N A;  3EU4 A;  2EIQ A;  4PUR A;  1LJR A;  1GNW A;  1A8L A;  1CQG A;  2OE1 A;  1F2E A;  1YDK A;  1XW6 A;  3HVX A;  1K3Y A;  1YKA A;  4TR1 B;  1TW9 A;  2O85 A;  6GST A;  4EF0 A;  3IR4 A;  4ML1 A;  3E9J B;  2CVD A;  4DVC A;  5D9W A;  2K18 A;  5DCH A;  1TKD B;  1PRX A;  4XTS A;  2CV4 A;  4V1A p;  2C80 A;  1BED A;  4Q5F A;  3CSH A;  4TR1 A;  5IOX A;  1H4O A;  4G10 A;  5BMU A;  4PXO A;  4JR6 A;  2H01 A;  3D4M A;  8GSS A;  2GTU A;  2OE3 A;  4WXT A;  3TDG A;  4X1U A;  1BJX A;  3HVV A;  3UIW A;  3F9U A;  1JZR A;  2C4J A;  5IO0 A;  2KUC A;  3WD6 A;  5ID2 A;  2BJX A;  3ZIV A;  4GCI A;  2YJH A;  2DJ1 A;  1TU7 A;  2H1B A;  3DVW A;  4L0U A;  5GAP D;  4ID0 A;  1Y25 A;  5J9C A;  2H74 A;  1R5A A;  2B7J A;  2H71 A;  2AAW A;  2AUV A;  4TVE A;  5CRD A;  4H86 A;  3KIJ A;  1FG4 A;  4ZB8 A;  1U3A A;  3A5W A;  3UBL A;  3CYN A;  1TK5 B;  3HJP A;  1TDI A;  5ELG A;  1OE7 A;  3L9U A;  1A0R P;  4KND A;  1VRS D;  2LST A;  4K9Z A;  3D22 A;  4ECJ A;  2I4A A;  1JHB A;  3IBH A;  4FO5 A;  2V6K A;  4G0I A;  3P8W A;  1YQ1 A;  2PVO C;  3GN3 A;  1X5D A;  5F8B A;  3APO A;  1TRU A;  4EKZ A;  2O87 A;  3RPN A;  3FRC A;  1SL2 B;  1PX7 A;  1WE0 A;  1AQX A;  4HS1 A;  4LL4 B;  2WUL A;  4EXJ A;  2C0F A;  2YPM A;  1VF3 A;  3KXO A;  1DBY A;  4HU7 A;  3EYT A;  3EMX A;  5AIS A;  3HJM A;  4O5R A;  4N11 A;  2GT6 A;  3GUR A;  2V6O A;  1XOA A;  2FWH A;  2VL3 A;  3GA4 A;  5G5F A;  1TRV A;  4J57 E;  5FT3 A;  1K0M A;  2YWO A;  2B1K A;  2GDR A;  2H1A A;  2E0Q A;  3ERG A;  2GSR A;  4JU5 A;  5B8A A;  4HEA 2;  1ZMA A;  1Z9H A;  2HRA A;  1OAZ A;  1M9A A;  3SBC A;  3LEF A;  1T1V A;  3G7Y A;  1QUW A;  3GX0 A;  4EUY A;  3UBK A;  3QR6 A;  1FVK A;  1JLW A;  5DVB A;  4N30 A;  5IMD A;  2AB6 A;  4GSS A;  4CW9 A;  1AW9 A;  2YAN A;  5F06 A;  1XZO A;  1A24 A;  4HI7 A;  2CAQ A;  4KB3 A;  1ZYQ B;  4MCU A;  5F05 A;  5GZZ B;  1X5C A;  4V2N A;  2K8V A;  1QFN A;  2KHP A;  4K1F A;  3IA1 A;  4ZXG A;  5IIZ A;  4POM A;  1Y6E A;  4ZIJ A;  1EP7 A;  4G2E A;  1ZZY A;  2MMA A;  5DJM A;  1LU4 A;  4KDY A;  4YAV A;  2KP2 A;  5INY A;  4POL A;  5ECQ B;  2TRC P;  22GS A;  5J41 A;  2MZC A;  4ZBB A;  2UZ8 A;  4FQU A;  3TB2 A;  3I69 A;  2RUF A;  2XBQ A;  5G1K A;  3L4N A;  3BJ5 A;  1UN2 A;  3ZIJ A;  2GQK A;  12GS A;  4N10 A;  1EOG A;  1WJK A;  3EE2 A;  4HJ2 A;  5D96 A;  4EVM A;  3CXG A;  1FOV A;  4N0V A;  2DML A;  4ZBA A;  2WB9 A;  1OC9 A;  2DLX A;  2LV3 A;  2HFD A;  2RII A;  5L71 A;  5ECL B;  1N8J A;  1O73 A;  3DVX A;  2GVP A;  4HZ4 A;  4ECB A;  2E7P A;  2H8L A;  2L6C A;  2V2G A;  3EU3 A;  2VL2 C;  2FWG A;  2LQO A;  4MMM A;  1S3C A;  1GLP A;  1A2M A;  4JZQ A;  6GSV A;  4ZB9 A;  4IJ3 A;  4JR4 A;  4JED A;  2H6X A;  4I2U A;  1YJ6 A;  1O85 A;  4WBR D;  3F6F A;  2XBI A;  1YF0 A;  1CQH A;  2WCI A;  1GSE A;  1TK8 B;  3UEM A;  2VLV A;  2VCZ A;  2H6Z A;  1FB0 A;  2MMZ A;  2VCQ A;  1AAZ A;  4ZL9 A;  3P2A A;  2RUE A;  3VWU A;  2LJR A;  3RHB A;  1ZL9 A;  2LUS A;  3HZ8 A;  3KMN A;  2PGT A;  1ZYE A;  1QGV A;  5EPF A;  1GP1 A;  1JFU A;  6GSU A;  4GXZ A;  3H8Q A;  4NAX A;  2L59 A;  2P5R A;  2YN1 A;  1EGR A;  4N0Z A;  4OO5 A;  3VWW A;  3V1W A;  2G0F A;  4IVF A;  1DE1 A;  1AQV A;  3PPU A;  4ZIL A;  1EOH A;  5G5E A;  3Q19 A;  3PH9 A;  5FHI A;  4IP6 A;  1YY7 A;  3IHQ A;  1GUM A;  3TJB A;  3CSJ A;  3FR3 A;  1EWX A;  1TOF A;  1GSY A;  2L4Q A;  3ZFL A;  5ECO B;  2HSY A;  4KH7 A;  4ULX A;  2B5X A;  4OCF A;  1Z5Y E;  3RPP A;  4K7O A;  4IQ1 A;  1I5G A;  3HHV A;  4MJB A;  2NBS A;  1UA5 A;  5E59 A;  1SL0 B;  2H1G A;  3KMO A;  4MZW A;  1AUC A;  3CBU A;  1UC7 A;  2YJ7 A;  4MLY A;  5LNK e;  2R6K A;  2I81 A;  5ECM B;  2IMK A;  3Q18 A;  2C3T A;  3KH9 A;  2YOI A;  1TK0 B;  4XIH A;  5ECH B;  2LNS A;  16GS A;  1NHO A;  1TI1 A;  2YWN A;  4V2M A;  3DGQ A;  3US3 A;  3ZMK A;  5D73 A;  2IFQ B;  1GRX A;  1R26 A;  3I43 A;  2CQ9 A;  1QK8 A;  4DEJ A;  2FA8 A;  4K0N A;  2GZY A;  3F6D A;  3TKS A;  2VCV A;  3IOS A;  1F3B A;  2FCH A;  2YV7 A;  4NHW A;  1GUK A;  4Z7X A;  2IFQ A;  2F8A A;  4IP1 A;  1GUH A;  1X9S B;  1E2Y A;  1A0F A;  2VCX A;  1B9X C;  2REM A;  2AJQ B;  2G2Q A;  2LKU A;  2O7K A;  1JZD A;  1VF2 A;  3UL3 A;  1YEX A;  3IDV A;  1FAA A;  3DXB A;  4Q5Q A;  3ED3 A;  4LL1 B;  3ERF A;  2YZU A;  1G7E A;  4GF0 A;  2I1U A;  4F82 A;  4Q5N A;  5AGY A;  2A2R A;  3GV1 A;  2N5F A;  3UAR A;  3ZRE A;  2F3M A;  2DJK A;  2HSH A;  2L4C A;  1HNB A;  1M2A A;  3F8U A;  3UMA A;  1GSD A;  1FVJ A;  1G6Y A;  5IQY A;  4LMW A;  2NVL A;  4KSO A;  3IPZ A;  1O8X A;  3QAW A;  4CDO A;  18GS A;  3D0Z A;  5EVO A;  2CT6 A;  3KP8 A;  2JZT A;  1GUL A;  2M46 A;  3ZIT A;  2VAF A;  3K8N A;  1WRY A;  1M9B A;  5GAN D;  2FD3 A;  3ZLP A;  1FO5 A;  4KF9 A;  3BOA A;  1F37 A;  1XWK A;  2LRN A;  4IGJ A;  2P31 A;  2VD0 A;  1M99 A;  3RAZ A;  4PTS A;  2VO4 A;  3U6V A;  4DSS B;  2A2S A;  5CP1 A;  2OBI A;  3EC3 A;  4XS4 B;  1W89 A;  4QL7 A;  2HSN B;  5GSS A;  1A23 A;  4BVY B;  4K8M A;  2VCT A;  3LGC A;  3GX8 A;  10GS A;  4DSS A;  1SK2 A;  3TJG A;  2HZE B;  2D2Z A;  3F4S A;  4TKY A;  4XS4 A;  4OWY A;  4HQZ A;  2DC5 A;  1K0O A;  3VLN A;  3M8N A;  4HZ2 A;  5F07 A;  4BVX B;  1ERT A;  1GNE A;  2WS2 A;  4KUN A;  1ML6 A;  1S3A A;  1AQW A;  1U6T A;  2H75 A;  5IMC A;  2HLS A;  3JCM L;  4G0K A;  1B4P A;  2HZE A;  2DSA A;  1XW9 A;  4LMV A;  2CVB A;  4MH2 A;  3D4T A;  5AIX A;  1V58 A;  1SJI A;  2DIY A;  4OFT A;  4OMV A;  1R7H A;  1X9M B;  2R2J A;  1BX9 A;  5J9B A;  3IK7 A;  3EUR A;  1O7U A;  3GSS A;  3R2Q A;  4WR4 A;  4WR5 A;  5ECS A;  5IMA A;  4LA1 A;  4PQI A;  3HVS A;  2PVQ A;  4HDE A;  4PNF A;  4I97 A;  1XPV A;  2MBT A;  3TGZ A;  4ZL7 A;  3TOU A;  4TOP A;  1HQO A;  2RM5 A;  3DKS A;  3RDW A;  3ME8 A;  1TU8 A;  3D21 A;  3FY7 A;  1TXX A;  1V57 A;  3UJ1 A;  4MF7 A;  4RUV A;  1SEN A;  3CSI A;  2DMM A;  2TIR A;  3TKR A;  2IJY A;  4HJM A;  5J5N A;  1XWA A;  2GZZ A;  4L5L A;  2I9H A;  3APQ A;  1FB6 A;  4I2T A;  1G0T A;  1SL1 B;  1M2D A;  2EIO A;  2H73 A;  4F2I A;  4TRX A;  2PPT A;  2OKA A;  1TTZ A;  5G31 A;  1OKD A;  2DBC A;  3F3R A;  2L6D A;  2FUG 2;  1QQ2 A;  3CRT A;  2X8C A;  2B7K A;  3CTF A;  1GWC A;  4K7I A;  5KN2 A;  4CHS A;  5KEJ A;  1ZGN A;  3G7J A;  1B8X A;  3HY2 A;  2H6Y A;  2JSY A;  3FKF A;  1QMV A;  4F0B A;  2WGR A;  3HA9 A;  4MA9 A;  3VPT A;  2YV9 A;  1Z7R A;  3TKP A;  3FR9 A;  4WKW A;  4DSR A;  1N2A A;  1T4Z A;  4WF5 A;  4POB A;  2LS5 A;  2CAI A;  3KJY A;  4XS1 A;  2AYT A;  2LEG A;  1RW1 A;  4GLT A;  19GS A;  3NIV A;  3HKR A;  4OO4 A;  4X0X A;  1USB A;  2NDO A;  1AXD A;  3HCZ A;  1K3L A;  4PQ1 A;  5JCU A;  2WJU A;  5CRE A;  1NHY A;  4USS A;  2WRT A;  1KNG A;  2GS3 A;  4ECI A;  3EWL A;  5HR0 A;  1MDJ A;  1T4Y A;  3QMX A;  4AJ7 A;  2VL9 A;  4BA7 A;  1PA3 A;  4TXO B;  3ZL5 A;  4G9H A;  5JWR B;  2DJJ A;  1ACV A;  5ECR B;  3LYK A;  1V40 A;  2F9S A;  1FW1 A;  1SK1 A;  1KBN A;  1ABA A;  3QDN A;  3I9V 2;  3DD3 A;  3H93 A;  3BCK A;  3LFL A;  4TXO A;  20GS A;  1IYI A;  2C0D A;  2J23 A;  2LQQ A;  4I5Q A;  5LCZ A;  1B48 A;  1VF4 A;  4MAB A;  3KZQ A;  2XPE A;  1O8W A;  1OKT A;  2HE3 A;  2ZCT A;  1ILO A;  3TJK A;  5HR2 A;  2FHE A;  1F3A A;  13GS A;  5FWG A;  4KX4 A;  5B8B A;  1PL2 A;  4FYC A;  4ZB6 A;  2CX3 A;  2HZF A;  2QGV A;  5ECK B;  3BCI A;  3HD5 A;  1K0C A;  2O89 A;  1T00 A;  3GTU B;  4QQ7 A;  5ECN B;  4F9Z A;  2VIM A;  2HT9 A;  2QKE A;  2DIZ A;  1Z7P A;  2YWM A;  4EE0 A;  2V1M A;  2RLI A;  2FLS A;  1GTA A;  2XHF A;  4GQF A;  3GTU A;  3GKM A;  1ST9 A;  4ZBD A;  4FYB A;  2ON5 A;  3M1G A;  5CRG A;  4O7H A;  3ISO A;  2R3X A;  1XVW A;  3LYP A;  1SJZ A;  4ILF A;  3C71 A;  2QSI A;  1U3I A;  3QOU A;  1EEM A;  3W8S A;  2FY6 A;  2VL2 A;  4POK A;  2C0G A;  1BG5 A;  3KM6 A;  1VF1 A;  3GST A;  2AV4 A;  5A4V A;  3TRX A;  2K9F A;  2YCD A;  3GL5 A;  1T8E B;  4GSN A;  1O81 A;  4NV2 A;  1SU9 A;  3M3M A;  2P5Q A;  3TKQ A;  2CVK A;  3C8E A;  5KN3 A;  4PQH A;  3VI5 A;  3SWL A;  5HQP A;  2B3S A;  3CTG A;  3LXT A;  4YAP A;  2L57 A;  4KE3 A;  4WEY A;  2X99 A;  6GSY A;  2V41 A;  1EGO A;  4TN8 A;  3HYP A;  2B5E A;  3ZVJ A;  1TI3 A;  1HNC A;  4KAE A;  4D73 B;  1T7P B;  4RQR A;  5CNW A;  2PN8 A;  4YH2 A;  1YEP A;  2WFC A;  2F8F A;  1LBK A;  4WF4 A;  3PGT A;  2ON7 A;  3A2V A;  5G30 A;  2XPD A;  3F4T A;  3UVT A;  3GKX A;  4D73 A;  4J2F A;  3KEB A;  14GS A;  5DDL A;  2RM6 A;  3O3T A;  3TKS E;  3ZML A;  3ME7 A;  1XWG A;  1IYH A;  2HQT A;  3FW2 A;  1AIU A;  1GTU A;  3F3Q A;  2PWJ A;  1AC1 A;  4HOJ A;  2X8H A;  2IPA A;  4JRR A;  5ABR A;  3GKK A;  3VWV A;  4KSM A;  5LD0 A;  1V9W A;  2YP6 A;  5D9V A;  4IJI A;  3IAS 2;  3GMF A;  1EEJ A;  1THX A;  1F9M A;  5J3R A;  5IMZ A;  1GLQ A;  4E8H A;  2LRT A;  3L0H A;  3LG6 A;  4MF5 A;  1Z6M A;  2ZNM A;  1SKS B;  2H66 A;  3IRA A;  1PX6 A;  3GH9 A;  3LXZ A;  1V2A A;  1EV4 A;  3TOT A;  5A4W A;  5IOW A;  2H76 A;  3ZTL A;  4MF6 A;  2CX4 A;  3NOF A;  2LRC A;  3MAK A;  3O6T A;  2IMD A;  2E2G A;  2OAC A;  2H0G A;  2JU5 A;  1VGL A;  1Z6N A;  3FZ5 A;  3IV4 A;  1X9W B;  3DYR A;  3MNG A;  3RBT A;  3A2W A;  3L9V A;  1X0R A;  5B7C A;  1GSS A;  2KP1 A;  1M2B A;  1TJD A;  2F51 A;  3VK9 A;  1M7T A;  3EVI A;  3NZN A;  3HJO A;  2HI7 A;  1OC3 A;  2ZUP A;  4YQM A;  3LJR A;  3WGD A;  2PER A;  5A4U A;  2I3Y A;  3WT1 A;  3QFA C;  3M9J A;  4GRF A;  9GSS A;  3VWX A;  3H4K A;  5C00 A;  3GH6 A;  1G6W A;  1W4V A;  3IAM 2;  4TR3 A;  5G2Z A;  4KDX A;  4V1A g;  5KN1 A;  2C1Y A;  1MTC A;  4L8E A;  4OCE A;  4X43 A;  1A8Y A;  5D93 A;  3TCO A;  4KGI A;  1J08 A;  3LWA A;  4NWY A;  2VD1 A;  5HFK A;  2BMX A;  1HNA A;  1PQN A;  5IM9 A;  1DSB A;  5KN0 A;  4ECC A;  1MEK A;  1SKR B;  2N5B A;  1OYJ A;  1ON4 A;  2OBK A;  3BD2 A;  1UVZ A;  1GTI A;  1SK0 A;  1S3D A;  4XS6 A;  2GSQ A;  1V98 A;  1GSQ A;  2R4V A;  2Z9S A;  4XCS A;  3QAV A;  1SKW B;  1OC8 A;  1XWB A;  2YZH A;  4BVY A;  2EIR A;  3D6I A;  5IMV A;  2XC2 A;  1XXU A;  2M80 A;  4O92 A;  4GQC A;  2LJA A;  2WDU A;  1YF1 A;  2L5O A;  2J9H A;  3L9S A;  1XVQ A;  4IS0 A;  3R3E A;  4RQX A;  1T3B A;  4BVX A;  1ERU A;  3FK8 A;  2VM2 A;  4PUF C;  1WPI A;  4K2D A;  5D8I A;  2QC7 A;  5EL8 A;  1FHE A;  5ID2 B;  3C7M A;  2PMT A;  5JCG A;  5DQY A;  1RK4 A;  4OFM A;  2NTO A;  3Q6O A;  3WGE A;  4TR0 A;  5HFI A;  6GSW A;  1XIY A;  4IQA A;  3ERW A;  3TJJ A;  4BWQ A;  2NPB A;  3DIE A;  1URM A;  2HSM B;  3H79 A;  1JZW A;  4IW9 A;  2PBJ A;  2GQM A;  1PKW A;  2X64 A;  4L5O A;  5CRH A;  3AY8 A;  4MK3 A;  2HRF A;  2TRX A;  4AJ6 A;  4ACS A;  2IME A;  5EY6 A;  3BBY A;  2YNX A;  4XRA A;  4WBJ A;  4I8B A;  2HSM A;  1PMT A;  1H75 A;  3FZ9 A;  17GS A;  2KOK A;  3TUE A;  4K6X A;  3ZYW A;  3QD9 A;  5E4W A;  3TJF A;  5H5Q A;  4FYU A;  4HU9 A;  3N9J A;  1WWJ A;  1GSU A;  2OA7 A;  2YWI A;  3IXR A;  4RI6 A;  1U87 A;  3D5J A;  4EDZ A;  1YKC A;  3KCM A;  5ECI B;  4KDU A;  2JAD A;  4HQS A;  1BAY A;  2IMI A;  4NXI A;  3RHC A;  1A2L A;  3C1R A;  5F0G A;  2K6V A;  1X5E A;  5DCG A;  2JZR A;  1ERV A;  3LOR A;  2DJ3 A;  4MZC A;  5C04 A; 
#chains in the Genus database with same CATH topology
 1SYX A;  2LJK A;  3N5O A;  1NW2 A;  2GLR A;  1B4Q A;  3FZA A;  5IO2 A;  5HFG A;  1DE2 A;  5AIV A;  2FWE A;  3GRX A;  4K7N A;  3DWV A;  5B6M A;  5DJL A;  2GSS A;  1HYU A;  6GSX A;  4IHU A;  5JWQ B;  2BTO T;  3FEU A;  1WMJ A;  2H72 A;  3TRP A;  4ISD A;  1B9Y C;  4K2X A;  3A2X A;  1F6M C;  1EZK A;  4V2L A;  1ZCP A;  4KA0 A;  5G1L A;  2GGT A;  1XW5 A;  1WP0 A;  3WT2 A;  2FWF A;  3PIN A;  4IN0 A;  2WZ9 A;  5DBQ A;  2K8S A;  4P3Y B;  4AF2 A;  3KTL A;  3ZFB A;  2KLX A;  3J7Y b;  1J0F A;  1R5P A;  1GTB A;  1BQ7 A;  1SD8 A;  4ML6 A;  2VM1 A;  7GSS A;  2HRN A;  5GST A;  1NM3 A;  3H1N A;  3FHK A;  3M0F A;  3U5R E;  2H0H A;  5HR3 A;  2VLT A;  3MYD A;  4AJ8 A;  4I6X A;  1K0A A;  1HD2 A;  4EDY A;  2DJ2 A;  3DEX A;  3OR5 A;  5HR1 A;  3GIX A;  2VUP A;  2HNL A;  5JCW A;  1MD3 A;  4MPF A;  2VOC A;  2MMO A;  4XRD A;  4DSQ A;  2B5Y A;  3ZRD A;  1PGT A;  4G19 A;  1DUG A;  1OC9 B;  2IIY A;  4NHZ A;  5DAK B;  4E8E A;  2OJL A;  2HXK A;  1GH2 A;  3QPM A;  2GT5 A;  4J56 E;  4L0W A;  2OAD A;  1TRS A;  3IC8 A;  2V32 A;  3KD0 A;  4IEL A;  3S9F A;  1K0D A;  1SD9 A;  1BYE A;  1PKZ A;  4PX1 A;  2OE0 A;  2ALB A;  3UVH A;  5DAK A;  4JBB A;  4FH8 A;  3TRQ A;  2CZ3 A;  5J4U A;  5ENU A;  4OFN A;  3G7I A;  4MJE A;  2GZP A;  4EC0 A;  1OVN A;  4PNG A;  1PSQ A;  3FMW A;  4YKG A;  5IPH A;  1O6J A;  1PN9 A;  3I6A A;  4KCA A;  3IC4 A;  3F4R A;  2C3N A;  3VI7 A;  1G7O A;  2IL3 A;  1SYR A;  4ZL8 A;  5DQS A;  2A4V A;  2WW2 A;  1ERW A;  1KTE A;  4F0C A;  4TR4 A;  4GTU A;  2JZS A;  2N5A A;  4NV5 A;  3RGB C;  3GHA A;  2GST A;  2PU9 C;  1MD4 A;  1SVM A;  1JLV A;  1U88 A;  3IK9 A;  3FYG A;  3WGX A;  4MDC A;  4GST A;  1WIK A;  2FNO A;  2C0E A;  5JWO B;  4XHM A;  5ECP B;  4YQV A;  5CAX A;  3GUS A;  3A3T A;  2HYX A;  2JAC A;  3IE3 A;  3MSZ A;  3F63 A;  1Z3E A;  3HZ4 A;  3FR6 A;  3LQ7 A;  2JL4 A;  4MP4 A;  1PL1 A;  3QAG A;  5ELA A;  2L5L A;  5B6N A;  4GWR A;  2C8U A;  2H0I A;  3ZVJ D;  5CRW A;  1RQM A;  5CYY A;  1XFL A;  4FIW A;  1K0B A;  2A4H A;  1A2J A;  3DML A;  1QXH A;  2H1D A;  2M72 A;  3HDC A;  3HXS A;  4RI7 A;  1BG1 A;  4JE1 A;  5A5H B;  3GFK A;  1EV9 A;  4Q5R A;  3GYK A;  5J4V A;  5H5R A;  2DJ0 A;  4IKH A;  5IMF A;  2VLU A;  4KW6 A;  3WYW A;  4A5P A;  3QFB C;  3ZZX A;  4O32 A;  4G0L A;  3C1S A;  3TKS C;  2H70 A;  1ZYP A;  1M0U A;  5IPG A;  5A5H A;  5A5K A;  2H30 A;  1SJ6 A;  3FZ4 A;  2B1L A;  2ES7 A;  3VUR A;  2R5G A;  5COH A;  4EL1 A;  1R4W A;  1THO A;  4TW5 A;  2AHE A;  2IN3 A;  3KP9 A;  3KH7 A;  2CA8 A;  3C73 A;  2VCW A;  3APS A;  2MBS A;  3VFI A;  4NMU A;  2O8V B;  2E2M A;  4AGS A;  4MZB A;  2X4A A;  3PR8 A;  5CO3 A;  4K0G A;  4IBP A;  2DKI A;  2P0G A;  4NPB A;  4BPY A;  3P7X A;  5DAL B;  1I9D A;  4E68 A;  4PUA A;  4WET A;  2C3Q A;  3UAP A;  2FA4 A;  2JSZ A;  5AN1 A;  1MDI A;  2LNT A;  1I1I P;  5D9X A;  3P90 A;  1WOU A;  4YQU A;  4KCE A;  4BWS A;  11GS A;  1C72 A;  3UOM A;  1Q98 A;  3G9B A;  3QCP A;  4MJA A;  2HRK B;  3EIN A;  2IWT A;  5DAL A;  3EMP A;  3GKN A;  3MDK A;  2WVZ A;  1KEB A;  4TXV A;  2EC4 A;  4GDF A;  2CZ2 A;  2WVY A;  2R37 A;  3O76 A;  3CRU A;  1YZX A;  3MIX A;  3J7Y k;  1NSW A;  2MMN A;  5H5S A;  3Q74 A;  4BL7 B;  2HRK A;  1TP9 A;  4QL9 A;  4PGT A;  1OE8 A;  2H19 A;  1K3O A;  3CMI A;  2IMF A;  5D9T A;  2B6M A;  3E0U A;  3F0I A;  2GQL A;  1TRW A;  4MJC A;  3MWH A;  1ZOF A;  3W8J A;  1XOB A;  4BL7 A;  5KOX A;  4F03 A;  1XCC A;  1PD2 1;  1XBS A;  3LSZ A;  3GL3 A;  4ICY A;  3E3E A;  2LTK A;  2FGX A;  2VKZ G;  1E6B A;  1JZO A;  4OD7 A;  2MYG A;  1XWC A;  3KGK A;  1EP8 A;  3L78 A;  1GL8 A;  4MH3 A;  3W6G A;  3DRN A;  3KTB A;  6GSS A;  1MDK A;  1J9B A;  2PUK C;  3M9K A;  3GNJ A;  1Q4J A;  4EO3 A;  3VPQ A;  2X8G A;  4MPG A;  4HUA A;  4LLR A;  1GSF A;  1K0N A;  3EU4 A;  2EIQ A;  4PUR A;  1LJR A;  1GNW A;  1A8L A;  1CQG A;  2OE1 A;  1F2E A;  1YDK A;  1XW6 A;  3HVX A;  1BF5 A;  2H1L A;  1K3Y A;  1YKA A;  4TR1 B;  1TW9 A;  2O85 A;  5BMU B;  6GST A;  4EF0 A;  3IR4 A;  4ML1 A;  3E9J B;  2CVD A;  4DVC A;  5D9W A;  2K18 A;  5DCH A;  1TKD B;  1PRX A;  4XTS A;  2CV4 A;  4V1A p;  2C80 A;  1BED A;  4Q5F A;  3CSH A;  4TR1 A;  5IOX A;  4CY8 A;  1H4O A;  4G10 A;  5BMU A;  4PXO A;  4JR6 A;  2H01 A;  3D4M A;  8GSS A;  2GTU A;  2OE3 A;  4WXT A;  3TDG A;  4X1U A;  1BJX A;  3HVV A;  3UIW A;  3F9U A;  4Z2R A;  1JZR A;  2C4J A;  4PI2 C;  5IO0 A;  2KUC A;  3WD6 A;  5ID2 A;  2BJX A;  3LW9 A;  3ZIV A;  4GCI A;  2YJH A;  2DJ1 A;  1TU7 A;  4AKX B;  2H1B A;  3DVW A;  4L0U A;  5GAP D;  4ID0 A;  4K5S A;  1Y25 A;  5J9C A;  2H74 A;  1R5A A;  2B7J A;  2H71 A;  2AAW A;  2AUV A;  4TVE A;  5CRD A;  4H86 A;  5BRT A;  3KIJ A;  1FG4 A;  4ZB8 A;  1U3A A;  3A5W A;  3UBL A;  3CYN A;  1TK5 B;  3HJP A;  1TDI A;  1YEW C;  5ELG A;  1M3I A;  1OE7 A;  3L9U A;  1A0R P;  4KND A;  1TXU A;  1VRS D;  2LST A;  4K9Z A;  3D22 A;  4ECJ A;  2I4A A;  1JHB A;  3IBH A;  4FO5 A;  2V6K A;  4G0I A;  3P8W A;  1YQ1 A;  2PVO C;  3GN3 A;  1X5D A;  5F8B A;  3APO A;  1TRU A;  4EKZ A;  2O87 A;  3RPN A;  3FRC A;  2QA2 A;  1SL2 B;  1PX7 A;  1WE0 A;  1AQX A;  4HS1 A;  4LL4 B;  2WUL A;  2UV8 G;  4EXJ A;  2C0F A;  2YPM A;  1VF3 A;  3KXO A;  1DBY A;  4HU7 A;  3EYT A;  3EMX A;  3HVN A;  4ZB7 A;  5AIS A;  3HJM A;  4O5R A;  4N11 A;  2GT6 A;  3GUR A;  2V6O A;  1XOA A;  2FWH A;  2VL3 A;  3GA4 A;  5G5F A;  1TRV A;  4J57 E;  5FT3 A;  1K0M A;  2YWO A;  2B1K A;  2GDR A;  4AKI A;  2H1A A;  2E0Q A;  3ERG A;  2GSR A;  4JU5 A;  3CQF A;  5B8A A;  4HEA 2;  1ZMA A;  1Z9H A;  2HRA A;  1OAZ A;  1M9A A;  3SBC A;  3LEF A;  1T1V A;  3G7Y A;  1QUW A;  3GX0 A;  4EUY A;  3UBK A;  3QR6 A;  1FVK A;  1JLW A;  5DVB A;  4N30 A;  5IMD A;  2AB6 A;  4EIP A;  4GSS A;  4CW9 A;  1AW9 A;  2YAN A;  5F06 A;  1XZO A;  1A24 A;  4HI7 A;  2EFC A;  2CAQ A;  4KB3 A;  1ZYQ B;  4MCU A;  5F05 A;  5GZZ B;  1X5C A;  4V2N A;  2K8V A;  1QFN A;  2KHP A;  4K1F A;  3IA1 A;  4ZXG A;  5IIZ A;  4POM A;  1Y6E A;  4ZIJ A;  1EP7 A;  4G2E A;  1ZZY A;  2MMA A;  5DJM A;  1LU4 A;  4KDY A;  4YAV A;  2KP2 A;  5INY A;  4N3Z A;  4POL A;  2R0G A;  5ECQ B;  2TRC P;  22GS A;  5J41 A;  2MZC A;  4ZBB A;  2UZ8 A;  4FQU A;  3TB2 A;  3I69 A;  2RUF A;  2XBQ A;  5G1K A;  3L4N A;  3BJ5 A;  1UN2 A;  3ZIJ A;  2GQK A;  12GS A;  4N10 A;  1EOG A;  1WJK A;  3EE2 A;  4HJ2 A;  5D96 A;  4EVM A;  3CXG A;  1FOV A;  4N0V A;  2DML A;  4ZBA A;  2WB9 A;  1OC9 A;  2DLX A;  2LV3 A;  2HFD A;  2RII A;  5L71 A;  5ECL B;  1N8J A;  1O73 A;  3DVX A;  2GVP A;  4HZ4 A;  4ECB A;  2E7P A;  2H8L A;  2L6C A;  2V2G A;  3EU3 A;  2VL2 C;  2FWG A;  2LQO A;  4MMM A;  1S3C A;  1GLP A;  1A2M A;  5KOW A;  4JZQ A;  6GSV A;  4ZB9 A;  2EFH A;  4IJ3 A;  4MNN A;  4JR4 A;  4JED A;  2H6X A;  4I2U A;  1YJ6 A;  1O85 A;  4WBR D;  3F6F A;  2XBI A;  1YF0 A;  1CQH A;  2WCI A;  1GSE A;  1TK8 B;  3UEM A;  2VLV A;  2VCZ A;  2H6Z A;  1FB0 A;  2MMZ A;  2VCQ A;  1AAZ A;  4ZL9 A;  3P2A A;  2RUE A;  3VWU A;  2LJR A;  3RHB A;  1ZL9 A;  2LUS A;  3HZ8 A;  3KMN A;  2PGT A;  1ZYE A;  1QGV A;  5EPF A;  1GP1 A;  1JFU A;  6GSU A;  4GXZ A;  3H8Q A;  4NAX A;  2L59 A;  2P5R A;  2YN1 A;  1EGR A;  1ZYN A;  4N0Z A;  4OO5 A;  3VWW A;  3V1W A;  2G0F A;  4IVF A;  1DE1 A;  1AQV A;  3PPU A;  4ZIL A;  1EOH A;  5G5E A;  3Q19 A;  3PH9 A;  5FHI A;  4IP6 A;  1YY7 A;  3IHQ A;  1GUM A;  3TJB A;  3CSJ A;  3FR3 A;  1EWX A;  1TOF A;  1GSY A;  2L4Q A;  3ZFL A;  5ECO B;  2HSY A;  4KH7 A;  4ULX A;  2B5X A;  4OCF A;  1Z5Y E;  3RPP A;  4K7O A;  4IQ1 A;  3HMJ G;  1I5G A;  4K5R A;  3HHV A;  4MJB A;  2NBS A;  1UA5 A;  5E59 A;  1SL0 B;  2H1G A;  3KMO A;  4MZW A;  2EFD A;  3CBU A;  1AUC A;  1UC7 A;  2YJ7 A;  4MLY A;  5LNK e;  2R6K A;  2I81 A;  5ECM B;  2IMK A;  3Q18 A;  2C3T A;  3KH9 A;  2YOI A;  1TK0 B;  4FXY P;  4XIH A;  5ECH B;  2LNS A;  16GS A;  1NHO A;  1TI1 A;  2YWN A;  4V2M A;  3DGQ A;  3US3 A;  3ZMK A;  5D73 A;  2IFQ B;  1GRX A;  1R26 A;  3I43 A;  2CQ9 A;  2QA1 A;  1QK8 A;  4DEJ A;  2FA8 A;  4K0N A;  2GZY A;  3F6D A;  3TKS A;  2VCV A;  3IOS A;  4W66 A;  4BIK A;  1F3B A;  2FCH A;  2YV7 A;  4NHW A;  1GUK A;  4Z7X A;  2IFQ A;  2F8A A;  4IP1 A;  1GUH A;  1X9S B;  1E2Y A;  1A0F A;  2VCX A;  1B9X C;  2REM A;  2AJQ B;  2G2Q A;  2LKU A;  2O7K A;  1JZD A;  4G01 A;  1VF2 A;  3UL3 A;  1YEX A;  4AKG A;  3IDV A;  1FAA A;  3DXB A;  4Q5Q A;  3ED3 A;  4LL1 B;  3ERF A;  2YZU A;  1G7E A;  4GF0 A;  2I1U A;  4F82 A;  4Q5N A;  5AGY A;  2A2R A;  3GV1 A;  4X4J A;  2N5F A;  3UAR A;  3ZRE A;  2F3M A;  2DJK A;  2HSH A;  2L4C A;  4PHZ C;  1HNB A;  1M2A A;  3F8U A;  3UMA A;  1GSD A;  1FVJ A;  1G6Y A;  5IQY A;  4LMW A;  2NVL A;  1SVL A;  2WVX B;  4KSO A;  3IPZ A;  1O8X A;  2O36 A;  3QAW A;  4CDO A;  18GS A;  3D0Z A;  5EVO A;  2CT6 A;  3KP8 A;  2JZT A;  1GUL A;  2M46 A;  3ZIT A;  2WW0 A;  2VAF A;  3K8N A;  1WRY A;  1M9B A;  5GAN D;  2FD3 A;  3ZLP A;  1FO5 A;  4KF9 A;  3BOA A;  1F37 A;  1XWK A;  2LRN A;  4IGJ A;  2P31 A;  2VD0 A;  1SVO A;  1M99 A;  3RAZ A;  4PTS A;  2VO4 A;  3U6V A;  4DSS B;  2A2S A;  5CP1 A;  2OBI A;  3EC3 A;  4XS4 B;  1W89 A;  5J4Y A;  4QL7 A;  2HSN B;  5GSS A;  1A23 A;  4BVY B;  2A2P A;  4K8M A;  2VCT A;  3LGC A;  3GX8 A;  10GS A;  4DSS A;  1SK2 A;  3TJG A;  2HZE B;  2D2Z A;  3F4S A;  4TKY A;  4XS4 A;  4OWY A;  4HQZ A;  2DC5 A;  2HSN A;  1K0O A;  3VLN A;  3M8N A;  4HZ2 A;  5F07 A;  4BVX B;  1ERT A;  1GNE A;  2WS2 A;  4KUN A;  1ML6 A;  1S3A A;  1AQW A;  1U6T A;  2H75 A;  2O5V A;  3EPT A;  5IMC A;  2HLS A;  3JCM L;  4G0K A;  1B4P A;  2HZE A;  2DSA A;  4HSC X;  1XW9 A;  4LMV A;  2CVB A;  4QMK A;  4MH2 A;  3D4T A;  5AIX A;  1V58 A;  1N25 A;  1SJI A;  2DIY A;  4OFT A;  4OMV A;  1R7H A;  1X9M B;  2R2J A;  1BX9 A;  5J9B A;  3IK7 A;  3EUR A;  1O7U A;  3GSS A;  3R2Q A;  4WR4 A;  4WR5 A;  5ECS A;  5IMA A;  1XG8 A;  4LA1 A;  4PQI A;  3HVS A;  2PVQ A;  1Y1U A;  4HDE A;  4PNF A;  4I97 A;  1XPV A;  2MBT A;  3TGZ A;  4ZL7 A;  3TOU A;  4TOP A;  1PFO A;  1HQO A;  2RM5 A;  3DKS A;  3RDW A;  2DKH A;  3ME8 A;  1TU8 A;  3D21 A;  4EIQ A;  3FY7 A;  1TXX A;  1FOH A;  1V57 A;  3UJ1 A;  4MF7 A;  4RUV A;  1SEN A;  3CSI A;  2DMM A;  4CY6 A;  2TIR A;  3TKR A;  2IJY A;  4HJM A;  5J5N A;  1XWA A;  2GZZ A;  4L5L A;  2I9H A;  3APQ A;  1FB6 A;  4I2T A;  1G0T A;  1SL1 B;  1M2D A;  2EIO A;  2H73 A;  4F2I A;  4TRX A;  2PPT A;  2OKA A;  1TTZ A;  5G31 A;  1OKD A;  2DBC A;  3F3R A;  2L6D A;  2FUG 2;  1QQ2 A;  3CRT A;  2X8C A;  2B7K A;  3CTF A;  1GWC A;  4K7I A;  5KN2 A;  4CHS A;  5KEJ A;  1ZGN A;  3G7J A;  1B8X A;  3HY2 A;  2H6Y A;  2JSY A;  3FKF A;  1QMV A;  4F0B A;  3HA9 A;  2EFE A;  2WGR A;  4MA9 A;  3VPT A;  2YV9 A;  1Z7R A;  3TKP A;  3FR9 A;  1PN0 A;  4WKW A;  4DSR A;  1N2A A;  1T4Z A;  4WF5 A;  4POB A;  2LS5 A;  2CAI A;  3KJY A;  4XS1 A;  2AYT A;  2LEG A;  2OT3 A;  1RW1 A;  4GLT A;  19GS A;  3NIV A;  1S3R A;  3HKR A;  4OO4 A;  4X0X A;  2O3E A;  1USB A;  2NDO A;  4AKH A;  5A1N B;  1AXD A;  3HCZ A;  1K3L A;  4PQ1 A;  5JCU A;  2WJU A;  5CRE A;  1NHY A;  3CWG A;  4USS A;  2WRT A;  1KNG A;  2GS3 A;  4ECI A;  3EWL A;  5HR0 A;  1MDJ A;  5A1N A;  1T4Y A;  3QMX A;  4AJ7 A;  2VL9 A;  4BA7 A;  1PA3 A;  4TXO B;  3ZL5 A;  2WW3 A;  4G9H A;  5JWR B;  2DJJ A;  1ACV A;  5ECR B;  3LYK A;  1V40 A;  2F9S A;  1FW1 A;  1SK1 A;  1KBN A;  1ABA A;  3QDN A;  3I9V 2;  3DD3 A;  3H93 A;  3BCK A;  3LFL A;  4TXO A;  20GS A;  1IYI A;  2C0D A;  2J23 A;  2LQQ A;  4I5Q A;  5LCZ A;  1B48 A;  1VF4 A;  4MAB A;  3KZQ A;  2XPE A;  1O8W A;  1OKT A;  2HE3 A;  2ZCT A;  1ILO A;  3TJK A;  5HR2 A;  2FHE A;  1F3A A;  13GS A;  5FWG A;  4KX4 A;  5B8B A;  1PL2 A;  4FYC A;  4ZB6 A;  2CX3 A;  2HZF A;  2QGV A;  5ECK B;  3BCI A;  3HD5 A;  1K0C A;  2O89 A;  1T00 A;  3GTU B;  4QQ7 A;  5ECN B;  4F9Z A;  2VIM A;  2HT9 A;  2QKE A;  2DIZ A;  1Z7P A;  5J40 A;  2YWM A;  4EE0 A;  4Z2U A;  2V1M A;  2RLI A;  2FLS A;  1GTA A;  2XHF A;  4GQF A;  3GTU A;  3GKM A;  1ST9 A;  4ZBD A;  4FYB A;  2ON5 A;  3M1G A;  5CRG A;  4O7H A;  3ISO A;  2R3X A;  1XVW A;  3LYP A;  1SJZ A;  4ILF A;  3C71 A;  2QSI A;  1U3I A;  3QOU A;  1EEM A;  3W8S A;  2FY6 A;  2VL2 A;  4POK A;  2C0G A;  1BG5 A;  3KM6 A;  1VF1 A;  3GST A;  2AV4 A;  2R0C A;  5A4V A;  3TRX A;  2K9F A;  2YCD A;  3GL5 A;  1T8E B;  4GSN A;  4Z2T A;  3CHX C;  1O81 A;  4NV2 A;  1SU9 A;  3M3M A;  3RFR C;  2P5Q A;  4PI0 C;  3TKQ A;  2CVK A;  3C8E A;  5KN3 A;  4PQH A;  3VI5 A;  3SWL A;  5HQP A;  2B3S A;  3CTG A;  3LXT A;  4YAP A;  2L57 A;  4KE3 A;  4WEY A;  2X99 A;  6GSY A;  2V41 A;  1EGO A;  4TN8 A;  3HYP A;  2WW1 A;  2B5E A;  3ZVJ A;  1TI3 A;  1HNC A;  4KAE A;  4D73 B;  1T7P B;  4RQR A;  5CNW A;  2PN8 A;  4YH2 A;  1YEP A;  2WFC A;  2F8F A;  1LBK A;  4WF4 A;  3PGT A;  2ON7 A;  3A2V A;  5G30 A;  3TU3 B;  2XPD A;  2R0P A;  3F4T A;  3UVT A;  3GKX A;  4D73 A;  4J2F A;  3KEB A;  14GS A;  5DDL A;  2RM6 A;  3O3T A;  3TKS E;  3ZML A;  3ME7 A;  1XWG A;  1IYH A;  2HQT A;  3FW2 A;  1AIU A;  1GTU A;  3F3Q A;  2PWJ A;  1AC1 A;  4HOJ A;  2X8H A;  2IPA A;  4JRR A;  5ABR A;  3GKK A;  3VWV A;  4KSM A;  5LD0 A;  1V9W A;  2YP6 A;  5D9V A;  5A34 B;  4IJI A;  3IAS 2;  3GMF A;  1EEJ A;  1THX A;  1F9M A;  5J3R A;  5IMZ A;  1GLQ A;  4E8H A;  2LRT A;  3L0H A;  3LG6 A;  1S4B P;  4MF5 A;  1Z6M A;  2ZNM A;  1SKS B;  2H66 A;  3IRA A;  1PX6 A;  3GH9 A;  5A34 A;  3LXZ A;  1V2A A;  1EV4 A;  3TOT A;  5A4W A;  5IOW A;  2H76 A;  3ZTL A;  4MF6 A;  2CX4 A;  3NOF A;  2LRC A;  3MAK A;  3O6T A;  2IMD A;  2E2G A;  2OAC A;  2JU5 A;  2H0G A;  1VGL A;  1Z6N A;  3FZ5 A;  3IV4 A;  1X9W B;  3DYR A;  3MNG A;  3RBT A;  3A2W A;  3L9V A;  1X0R A;  4O5U A;  5B7C A;  1GSS A;  2KP1 A;  1M2B A;  4AI6 A;  1TJD A;  2F51 A;  3VK9 A;  1M7T A;  3EVI A;  3NZN A;  3HJO A;  2HI7 A;  1OC3 A;  2ZUP A;  4YQM A;  3LJR A;  3WGD A;  2PER A;  5A4U A;  2I3Y A;  3WT1 A;  3QFA C;  3M9J A;  4GRF A;  9GSS A;  3VWX A;  3H4K A;  5C00 A;  3GH6 A;  1G6W A;  1W4V A;  3IAM 2;  4TR3 A;  5G2Z A;  4KDX A;  4V1A g;  5KN1 A;  2C1Y A;  1MTC A;  4L8E A;  2WVX A;  4OCE A;  4X43 A;  1A8Y A;  5D93 A;  3TCO A;  4KGI A;  1J08 A;  3LWA A;  4NWY A;  2VD1 A;  5HFK A;  2BMX A;  1HNA A;  1PQN A;  5IM9 A;  1DSB A;  5KN0 A;  4ECC A;  1MEK A;  1SKR B;  2N5B A;  1OYJ A;  1ON4 A;  2OBK A;  3BD2 A;  1UVZ A;  1GTI A;  1SK0 A;  1S3D A;  4XS6 A;  2GSQ A;  1V98 A;  1GSQ A;  2R4V A;  2Z9S A;  4XCS A;  3QAV A;  1SKW B;  1OC8 A;  1XWB A;  2YZH A;  2WZS A;  4BVY A;  2EIR A;  3D6I A;  3A5I A;  5IMV A;  2XC2 A;  1XXU A;  2M80 A;  4O92 A;  4GQC A;  2LJA A;  2WDU A;  1YF1 A;  2L5O A;  2J9H A;  3L9S A;  1XVQ A;  4IS0 A;  3R3E A;  4RQX A;  1T3B A;  4BVX A;  1ERU A;  3FK8 A;  3IHG A;  2VM2 A;  4PUF C;  1WPI A;  4K2D A;  5D8I A;  2QC7 A;  5EL8 A;  1FHE A;  5ID2 B;  3C7M A;  2PMT A;  5JCG A;  5DQY A;  1RK4 A;  4OFM A;  2X49 A;  2NTO A;  3Q6O A;  3WGE A;  4TR0 A;  5HFI A;  6GSW A;  1XIY A;  4IQA A;  5J47 A;  3ERW A;  3TJJ A;  4BWQ A;  2NPB A;  3DIE A;  1URM A;  2HSM B;  3H79 A;  1JZW A;  4YKF A;  4IW9 A;  2PBJ A;  1YVL A;  2GQM A;  1PKW A;  2X64 A;  4L5O A;  5CRH A;  3AY8 A;  4MK3 A;  2HRF A;  2TRX A;  4AJ6 A;  4ACS A;  4O5Q A;  2IME A;  5EY6 A;  3BBY A;  2YNX A;  4XRA A;  4WBJ A;  4I8B A;  2HSM A;  1PMT A;  1H75 A;  3FZ9 A;  17GS A;  2KOK A;  3TUE A;  4K6X A;  3ZYW A;  3QD9 A;  5E4W A;  3TJF A;  5H5Q A;  4FYU A;  4HU9 A;  3N9J A;  1WWJ A;  1GSU A;  2OA7 A;  2YWI A;  3IXR A;  4RI6 A;  1U87 A;  1M3J A;  3D5J A;  4EDZ A;  1YKC A;  3KCM A;  5ECI B;  4KDU A;  2JAD A;  4HQS A;  1BAY A;  2IMI A;  4NXI A;  3RHC A;  1A2L A;  3C1R A;  5F0G A;  2K6V A;  1X5E A;  5DCG A;  2JZR A;  1ERV A;  3LOR A;  2DJ3 A;  4MZC A;  5C04 A; 
#chains in the Genus database with same CATH homology
 1SYX A;  2LJK A;  3N5O A;  1NW2 A;  2GLR A;  1B4Q A;  3FZA A;  5IO2 A;  5HFG A;  1DE2 A;  5AIV A;  2FWE A;  3GRX A;  4K7N A;  3DWV A;  5B6M A;  5DJL A;  2GSS A;  1HYU A;  6GSX A;  4IHU A;  5JWQ B;  2BTO T;  3FEU A;  1WMJ A;  2H72 A;  3TRP A;  4ISD A;  1B9Y C;  4K2X A;  3A2X A;  1F6M C;  1EZK A;  4V2L A;  1ZCP A;  4KA0 A;  5G1L A;  2GGT A;  1XW5 A;  1WP0 A;  3WT2 A;  2FWF A;  3PIN A;  4IN0 A;  2WZ9 A;  5DBQ A;  2K8S A;  4P3Y B;  4AF2 A;  3KTL A;  3ZFB A;  2KLX A;  3J7Y b;  1J0F A;  1R5P A;  1GTB A;  1BQ7 A;  1SD8 A;  4ML6 A;  2VM1 A;  7GSS A;  2HRN A;  5GST A;  1NM3 A;  3H1N A;  3FHK A;  3M0F A;  3U5R E;  2H0H A;  5HR3 A;  2VLT A;  3MYD A;  4AJ8 A;  4I6X A;  1K0A A;  1HD2 A;  4EDY A;  2DJ2 A;  3DEX A;  3OR5 A;  5HR1 A;  3GIX A;  2VUP A;  2HNL A;  5JCW A;  1MD3 A;  4MPF A;  2VOC A;  2MMO A;  4XRD A;  4DSQ A;  2B5Y A;  3ZRD A;  1PGT A;  4G19 A;  1DUG A;  1OC9 B;  2IIY A;  4NHZ A;  5DAK B;  4E8E A;  2OJL A;  2HXK A;  1GH2 A;  3QPM A;  2GT5 A;  4J56 E;  4L0W A;  2OAD A;  1TRS A;  3IC8 A;  2V32 A;  3KD0 A;  4IEL A;  3S9F A;  1K0D A;  1SD9 A;  1BYE A;  1PKZ A;  4PX1 A;  2OE0 A;  2ALB A;  3UVH A;  5DAK A;  4JBB A;  4FH8 A;  3TRQ A;  2CZ3 A;  5J4U A;  5ENU A;  4OFN A;  3G7I A;  4MJE A;  2GZP A;  4EC0 A;  1OVN A;  4PNG A;  1PSQ A;  3FMW A;  4YKG A;  5IPH A;  1O6J A;  1PN9 A;  3I6A A;  4KCA A;  3IC4 A;  3F4R A;  2C3N A;  3VI7 A;  1G7O A;  2IL3 A;  1SYR A;  4ZL8 A;  5DQS A;  2A4V A;  1ERW A;  1KTE A;  4F0C A;  4TR4 A;  4GTU A;  2JZS A;  2N5A A;  4NV5 A;  3GHA A;  2GST A;  2PU9 C;  1MD4 A;  1SVM A;  1JLV A;  1U88 A;  3IK9 A;  3FYG A;  3WGX A;  4MDC A;  4GST A;  1WIK A;  2FNO A;  2C0E A;  5JWO B;  4XHM A;  5ECP B;  4YQV A;  5CAX A;  3GUS A;  3A3T A;  2HYX A;  2JAC A;  3IE3 A;  3MSZ A;  3F63 A;  1Z3E A;  3HZ4 A;  3FR6 A;  3LQ7 A;  2JL4 A;  4MP4 A;  1PL1 A;  3QAG A;  5ELA A;  2L5L A;  5B6N A;  4GWR A;  2C8U A;  2H0I A;  3ZVJ D;  5CRW A;  1RQM A;  5CYY A;  1XFL A;  4FIW A;  1K0B A;  2A4H A;  1A2J A;  3DML A;  1QXH A;  2H1D A;  2M72 A;  3HDC A;  3HXS A;  4RI7 A;  1BG1 A;  4JE1 A;  5A5H B;  3GFK A;  1EV9 A;  4Q5R A;  3GYK A;  5J4V A;  5H5R A;  2DJ0 A;  4IKH A;  5IMF A;  2VLU A;  4KW6 A;  3WYW A;  4A5P A;  3QFB C;  3ZZX A;  4O32 A;  4G0L A;  3C1S A;  3TKS C;  2H70 A;  1ZYP A;  1M0U A;  5IPG A;  5A5H A;  5A5K A;  2H30 A;  1SJ6 A;  3FZ4 A;  2B1L A;  2ES7 A;  3VUR A;  2R5G A;  5COH A;  4EL1 A;  1R4W A;  1THO A;  4TW5 A;  2AHE A;  2IN3 A;  3KP9 A;  3KH7 A;  2CA8 A;  3C73 A;  2VCW A;  3APS A;  2MBS A;  3VFI A;  4NMU A;  2O8V B;  2E2M A;  4AGS A;  4MZB A;  2X4A A;  3PR8 A;  5CO3 A;  4K0G A;  4IBP A;  2DKI A;  2P0G A;  4NPB A;  4BPY A;  3P7X A;  5DAL B;  1I9D A;  4E68 A;  4PUA A;  4WET A;  2C3Q A;  3UAP A;  2FA4 A;  2JSZ A;  5AN1 A;  1MDI A;  2LNT A;  5D9X A;  4KCE A;  3P90 A;  1WOU A;  4YQU A;  4BWS A;  11GS A;  1C72 A;  3UOM A;  1Q98 A;  3G9B A;  3QCP A;  4MJA A;  2HRK B;  3EIN A;  2IWT A;  5DAL A;  3EMP A;  3GKN A;  3MDK A;  1KEB A;  4TXV A;  2EC4 A;  4GDF A;  2CZ2 A;  2R37 A;  3O76 A;  3CRU A;  1YZX A;  3MIX A;  3J7Y k;  1NSW A;  2MMN A;  5H5S A;  3Q74 A;  4BL7 B;  2HRK A;  1TP9 A;  4QL9 A;  4PGT A;  1OE8 A;  2H19 A;  1K3O A;  3CMI A;  2IMF A;  5D9T A;  2B6M A;  3E0U A;  3F0I A;  2GQL A;  1TRW A;  4MJC A;  3MWH A;  1ZOF A;  3W8J A;  1XOB A;  4BL7 A;  5KOX A;  4F03 A;  1XCC A;  1PD2 1;  1XBS A;  3LSZ A;  3GL3 A;  4ICY A;  3E3E A;  2LTK A;  2FGX A;  2VKZ G;  1E6B A;  1JZO A;  4OD7 A;  2MYG A;  1XWC A;  3KGK A;  1EP8 A;  3L78 A;  1GL8 A;  4MH3 A;  3W6G A;  3DRN A;  3KTB A;  6GSS A;  1MDK A;  1J9B A;  2PUK C;  3M9K A;  3GNJ A;  1Q4J A;  4EO3 A;  3VPQ A;  2X8G A;  4MPG A;  4HUA A;  4LLR A;  1GSF A;  1K0N A;  3EU4 A;  2EIQ A;  4PUR A;  1LJR A;  1GNW A;  1A8L A;  1CQG A;  2OE1 A;  1F2E A;  1YDK A;  1XW6 A;  3HVX A;  1BF5 A;  2H1L A;  1K3Y A;  1YKA A;  4TR1 B;  1TW9 A;  2O85 A;  5BMU B;  6GST A;  4EF0 A;  3IR4 A;  4ML1 A;  3E9J B;  2CVD A;  4DVC A;  5D9W A;  2K18 A;  5DCH A;  1TKD B;  1PRX A;  4XTS A;  2CV4 A;  4V1A p;  2C80 A;  1BED A;  4Q5F A;  3CSH A;  4TR1 A;  5IOX A;  4CY8 A;  1H4O A;  4G10 A;  5BMU A;  4PXO A;  4JR6 A;  2H01 A;  3D4M A;  8GSS A;  2GTU A;  2OE3 A;  4WXT A;  3TDG A;  4X1U A;  1BJX A;  3HVV A;  3UIW A;  3F9U A;  4Z2R A;  1JZR A;  2C4J A;  5IO0 A;  2KUC A;  3WD6 A;  5ID2 A;  2BJX A;  3LW9 A;  3ZIV A;  4GCI A;  2YJH A;  2DJ1 A;  1TU7 A;  4AKX B;  2H1B A;  3DVW A;  4L0U A;  5GAP D;  4ID0 A;  4K5S A;  1Y25 A;  5J9C A;  2H74 A;  1R5A A;  2B7J A;  2H71 A;  2AAW A;  2AUV A;  4TVE A;  5CRD A;  4H86 A;  5BRT A;  3KIJ A;  1FG4 A;  4ZB8 A;  1U3A A;  3A5W A;  3UBL A;  3CYN A;  1TK5 B;  3HJP A;  1TDI A;  5ELG A;  1OE7 A;  3L9U A;  1A0R P;  4KND A;  1TXU A;  1VRS D;  2LST A;  4K9Z A;  3D22 A;  4ECJ A;  2I4A A;  1JHB A;  3IBH A;  4FO5 A;  2V6K A;  4G0I A;  3P8W A;  1YQ1 A;  2PVO C;  3GN3 A;  1X5D A;  5F8B A;  3APO A;  1TRU A;  4EKZ A;  2O87 A;  3RPN A;  3FRC A;  2QA2 A;  1SL2 B;  1PX7 A;  1WE0 A;  1AQX A;  4HS1 A;  4LL4 B;  2WUL A;  2UV8 G;  4EXJ A;  2C0F A;  2YPM A;  1VF3 A;  3KXO A;  1DBY A;  4HU7 A;  3EYT A;  3EMX A;  4ZB7 A;  5AIS A;  3HJM A;  4O5R A;  4N11 A;  2GT6 A;  3GUR A;  2V6O A;  1XOA A;  2FWH A;  2VL3 A;  3GA4 A;  5G5F A;  1TRV A;  4J57 E;  5FT3 A;  1K0M A;  2YWO A;  2B1K A;  2GDR A;  4AKI A;  2H1A A;  2E0Q A;  3ERG A;  2GSR A;  4JU5 A;  5B8A A;  4HEA 2;  1ZMA A;  1Z9H A;  2HRA A;  1OAZ A;  1M9A A;  3SBC A;  3LEF A;  1T1V A;  3G7Y A;  1QUW A;  3GX0 A;  4EUY A;  3UBK A;  3QR6 A;  1FVK A;  1JLW A;  5DVB A;  4N30 A;  5IMD A;  2AB6 A;  4EIP A;  4GSS A;  4CW9 A;  1AW9 A;  2YAN A;  5F06 A;  1XZO A;  1A24 A;  4HI7 A;  2EFC A;  2CAQ A;  4KB3 A;  1ZYQ B;  4MCU A;  5F05 A;  5GZZ B;  1X5C A;  4V2N A;  2K8V A;  1QFN A;  2KHP A;  4K1F A;  3IA1 A;  4ZXG A;  5IIZ A;  4POM A;  1Y6E A;  4ZIJ A;  1EP7 A;  4G2E A;  1ZZY A;  2MMA A;  5DJM A;  1LU4 A;  4KDY A;  4YAV A;  2KP2 A;  5INY A;  4N3Z A;  4POL A;  2R0G A;  5ECQ B;  2TRC P;  22GS A;  5J41 A;  2MZC A;  4ZBB A;  2UZ8 A;  4FQU A;  3TB2 A;  3I69 A;  2RUF A;  2XBQ A;  5G1K A;  3L4N A;  3BJ5 A;  1UN2 A;  3ZIJ A;  2GQK A;  12GS A;  4N10 A;  1EOG A;  1WJK A;  3EE2 A;  4HJ2 A;  5D96 A;  4EVM A;  3CXG A;  1FOV A;  4N0V A;  2DML A;  4ZBA A;  2WB9 A;  1OC9 A;  2DLX A;  2LV3 A;  2HFD A;  2RII A;  5L71 A;  5ECL B;  1N8J A;  1O73 A;  3DVX A;  2GVP A;  4HZ4 A;  4ECB A;  2E7P A;  2H8L A;  2L6C A;  2V2G A;  3EU3 A;  2VL2 C;  2FWG A;  2LQO A;  4MMM A;  1S3C A;  1GLP A;  1A2M A;  5KOW A;  4JZQ A;  6GSV A;  4ZB9 A;  2EFH A;  4IJ3 A;  4MNN A;  4JR4 A;  4JED A;  2H6X A;  4I2U A;  1YJ6 A;  1O85 A;  4WBR D;  3F6F A;  2XBI A;  1YF0 A;  1CQH A;  2WCI A;  1GSE A;  1TK8 B;  3UEM A;  2VLV A;  2VCZ A;  2H6Z A;  1FB0 A;  2MMZ A;  2VCQ A;  1AAZ A;  4ZL9 A;  3P2A A;  2RUE A;  3VWU A;  2LJR A;  3RHB A;  1ZL9 A;  2LUS A;  3HZ8 A;  3KMN A;  2PGT A;  1ZYE A;  1QGV A;  5EPF A;  1GP1 A;  1JFU A;  6GSU A;  4GXZ A;  3H8Q A;  4NAX A;  2L59 A;  2P5R A;  2YN1 A;  1EGR A;  1ZYN A;  4N0Z A;  4OO5 A;  3VWW A;  3V1W A;  2G0F A;  4IVF A;  1DE1 A;  1AQV A;  3PPU A;  4ZIL A;  1EOH A;  5G5E A;  3Q19 A;  3PH9 A;  5FHI A;  4IP6 A;  1YY7 A;  3IHQ A;  1GUM A;  3TJB A;  3CSJ A;  3FR3 A;  1EWX A;  1TOF A;  1GSY A;  2L4Q A;  3ZFL A;  5ECO B;  2HSY A;  4KH7 A;  4ULX A;  2B5X A;  4OCF A;  1Z5Y E;  3RPP A;  4K7O A;  4IQ1 A;  3HMJ G;  1I5G A;  4K5R A;  3HHV A;  4MJB A;  2NBS A;  1UA5 A;  5E59 A;  1SL0 B;  2H1G A;  3KMO A;  4MZW A;  2EFD A;  3CBU A;  1AUC A;  1UC7 A;  2YJ7 A;  4MLY A;  5LNK e;  2R6K A;  2I81 A;  5ECM B;  2IMK A;  3Q18 A;  2C3T A;  3KH9 A;  2YOI A;  1TK0 B;  4XIH A;  5ECH B;  2LNS A;  16GS A;  1NHO A;  1TI1 A;  2YWN A;  4V2M A;  3DGQ A;  3US3 A;  3ZMK A;  5D73 A;  2IFQ B;  1GRX A;  1R26 A;  3I43 A;  2CQ9 A;  2QA1 A;  1QK8 A;  4DEJ A;  2FA8 A;  4K0N A;  2GZY A;  3F6D A;  3TKS A;  2VCV A;  3IOS A;  4W66 A;  1F3B A;  2FCH A;  2YV7 A;  4NHW A;  1GUK A;  4Z7X A;  2IFQ A;  2F8A A;  4IP1 A;  1GUH A;  1X9S B;  1E2Y A;  1A0F A;  2VCX A;  1B9X C;  2REM A;  2AJQ B;  2G2Q A;  2LKU A;  2O7K A;  1JZD A;  4G01 A;  1VF2 A;  3UL3 A;  1YEX A;  4AKG A;  3IDV A;  1FAA A;  3DXB A;  4Q5Q A;  3ED3 A;  4LL1 B;  3ERF A;  2YZU A;  1G7E A;  4GF0 A;  2I1U A;  4F82 A;  4Q5N A;  5AGY A;  2A2R A;  3GV1 A;  4X4J A;  2N5F A;  3UAR A;  3ZRE A;  2F3M A;  2DJK A;  2HSH A;  2L4C A;  1HNB A;  1M2A A;  3F8U A;  3UMA A;  1GSD A;  1FVJ A;  1G6Y A;  5IQY A;  4LMW A;  2NVL A;  1SVL A;  4KSO A;  3IPZ A;  1O8X A;  3QAW A;  4CDO A;  18GS A;  3D0Z A;  5EVO A;  2CT6 A;  3KP8 A;  2JZT A;  1GUL A;  2M46 A;  3ZIT A;  2VAF A;  3K8N A;  1WRY A;  1M9B A;  5GAN D;  2FD3 A;  3ZLP A;  1FO5 A;  4KF9 A;  3BOA A;  1F37 A;  1XWK A;  2LRN A;  4IGJ A;  2P31 A;  2VD0 A;  1SVO A;  1M99 A;  3RAZ A;  4PTS A;  2VO4 A;  3U6V A;  4DSS B;  2A2S A;  5CP1 A;  2OBI A;  3EC3 A;  4XS4 B;  1W89 A;  5J4Y A;  4QL7 A;  2HSN B;  5GSS A;  1A23 A;  4BVY B;  2A2P A;  4K8M A;  2VCT A;  3LGC A;  3GX8 A;  10GS A;  4DSS A;  1SK2 A;  3TJG A;  2HZE B;  2D2Z A;  3F4S A;  4TKY A;  4XS4 A;  4OWY A;  4HQZ A;  2DC5 A;  2HSN A;  1K0O A;  3VLN A;  3M8N A;  4HZ2 A;  5F07 A;  4BVX B;  1ERT A;  1GNE A;  2WS2 A;  4KUN A;  1ML6 A;  1S3A A;  1AQW A;  1U6T A;  2H75 A;  2O5V A;  3EPT A;  5IMC A;  2HLS A;  3JCM L;  4G0K A;  1B4P A;  2HZE A;  2DSA A;  1XW9 A;  4LMV A;  2CVB A;  4QMK A;  4MH2 A;  3D4T A;  5AIX A;  1V58 A;  1N25 A;  1SJI A;  2DIY A;  4OFT A;  4OMV A;  1R7H A;  1X9M B;  2R2J A;  1BX9 A;  5J9B A;  3IK7 A;  3EUR A;  1O7U A;  3GSS A;  3R2Q A;  4WR4 A;  4WR5 A;  5ECS A;  5IMA A;  4LA1 A;  4PQI A;  3HVS A;  2PVQ A;  1Y1U A;  4HDE A;  4PNF A;  4I97 A;  1XPV A;  2MBT A;  3TGZ A;  4ZL7 A;  3TOU A;  4TOP A;  1HQO A;  2RM5 A;  3DKS A;  3RDW A;  2DKH A;  3ME8 A;  1TU8 A;  3D21 A;  4EIQ A;  3FY7 A;  1TXX A;  1FOH A;  1V57 A;  3UJ1 A;  4MF7 A;  4RUV A;  1SEN A;  3CSI A;  2DMM A;  4CY6 A;  2TIR A;  3TKR A;  2IJY A;  4HJM A;  5J5N A;  1XWA A;  2GZZ A;  4L5L A;  2I9H A;  3APQ A;  1FB6 A;  4I2T A;  1G0T A;  1SL1 B;  1M2D A;  2EIO A;  2H73 A;  4F2I A;  4TRX A;  2PPT A;  2OKA A;  1TTZ A;  5G31 A;  1OKD A;  2DBC A;  3F3R A;  2L6D A;  2FUG 2;  1QQ2 A;  3CRT A;  2X8C A;  2B7K A;  3CTF A;  1GWC A;  4K7I A;  5KN2 A;  4CHS A;  5KEJ A;  1ZGN A;  3G7J A;  1B8X A;  3HY2 A;  2H6Y A;  2JSY A;  3FKF A;  1QMV A;  4F0B A;  3HA9 A;  2EFE A;  2WGR A;  4MA9 A;  3VPT A;  2YV9 A;  1Z7R A;  3TKP A;  3FR9 A;  1PN0 A;  4WKW A;  4DSR A;  1N2A A;  1T4Z A;  4WF5 A;  4POB A;  2LS5 A;  2CAI A;  3KJY A;  4XS1 A;  2AYT A;  2LEG A;  2OT3 A;  1RW1 A;  4GLT A;  19GS A;  3NIV A;  3HKR A;  4OO4 A;  4X0X A;  1USB A;  2NDO A;  4AKH A;  5A1N B;  1AXD A;  3HCZ A;  1K3L A;  4PQ1 A;  5JCU A;  2WJU A;  5CRE A;  1NHY A;  3CWG A;  4USS A;  2WRT A;  1KNG A;  2GS3 A;  4ECI A;  3EWL A;  5HR0 A;  1MDJ A;  5A1N A;  1T4Y A;  3QMX A;  4AJ7 A;  2VL9 A;  4BA7 A;  1PA3 A;  4TXO B;  3ZL5 A;  4G9H A;  5JWR B;  2DJJ A;  1ACV A;  5ECR B;  3LYK A;  1V40 A;  2F9S A;  1FW1 A;  1SK1 A;  1KBN A;  1ABA A;  3QDN A;  3I9V 2;  3DD3 A;  3H93 A;  3BCK A;  3LFL A;  4TXO A;  20GS A;  1IYI A;  2C0D A;  2J23 A;  2LQQ A;  4I5Q A;  5LCZ A;  1B48 A;  1VF4 A;  4MAB A;  3KZQ A;  2XPE A;  1O8W A;  1OKT A;  2HE3 A;  2ZCT A;  1ILO A;  3TJK A;  5HR2 A;  2FHE A;  1F3A A;  13GS A;  5FWG A;  4KX4 A;  5B8B A;  1PL2 A;  4FYC A;  4ZB6 A;  2CX3 A;  2HZF A;  2QGV A;  5ECK B;  3BCI A;  3HD5 A;  1K0C A;  2O89 A;  1T00 A;  3GTU B;  4QQ7 A;  5ECN B;  4F9Z A;  2VIM A;  2HT9 A;  2QKE A;  2DIZ A;  1Z7P A;  5J40 A;  2YWM A;  4EE0 A;  4Z2U A;  2V1M A;  2RLI A;  2FLS A;  1GTA A;  2XHF A;  4GQF A;  3GTU A;  3GKM A;  1ST9 A;  4ZBD A;  4FYB A;  2ON5 A;  3M1G A;  5CRG A;  4O7H A;  3ISO A;  2R3X A;  1XVW A;  3LYP A;  1SJZ A;  4ILF A;  3C71 A;  2QSI A;  1U3I A;  3QOU A;  1EEM A;  3W8S A;  2FY6 A;  2VL2 A;  4POK A;  2C0G A;  1BG5 A;  3KM6 A;  1VF1 A;  3GST A;  2AV4 A;  2R0C A;  5A4V A;  3TRX A;  2K9F A;  2YCD A;  3GL5 A;  1T8E B;  4GSN A;  4Z2T A;  1O81 A;  4NV2 A;  1SU9 A;  3M3M A;  2P5Q A;  3TKQ A;  2CVK A;  3C8E A;  5KN3 A;  4PQH A;  3VI5 A;  3SWL A;  5HQP A;  2B3S A;  3CTG A;  3LXT A;  4YAP A;  2L57 A;  4KE3 A;  4WEY A;  2X99 A;  6GSY A;  2V41 A;  1EGO A;  4TN8 A;  3HYP A;  2B5E A;  3ZVJ A;  1TI3 A;  1HNC A;  4KAE A;  4D73 B;  1T7P B;  4RQR A;  5CNW A;  2PN8 A;  4YH2 A;  1YEP A;  2WFC A;  2F8F A;  1LBK A;  4WF4 A;  3PGT A;  2ON7 A;  3A2V A;  5G30 A;  3TU3 B;  2XPD A;  2R0P A;  3F4T A;  3UVT A;  3GKX A;  4D73 A;  4J2F A;  3KEB A;  14GS A;  5DDL A;  2RM6 A;  3O3T A;  3TKS E;  3ZML A;  3ME7 A;  1XWG A;  1IYH A;  2HQT A;  3FW2 A;  1AIU A;  1GTU A;  3F3Q A;  2PWJ A;  1AC1 A;  4HOJ A;  2X8H A;  2IPA A;  4JRR A;  5ABR A;  3GKK A;  3VWV A;  4KSM A;  5LD0 A;  1V9W A;  2YP6 A;  5D9V A;  5A34 B;  4IJI A;  3IAS 2;  3GMF A;  1EEJ A;  1THX A;  1F9M A;  5J3R A;  5IMZ A;  1GLQ A;  4E8H A;  2LRT A;  3L0H A;  3LG6 A;  4MF5 A;  1Z6M A;  2ZNM A;  1SKS B;  2H66 A;  3IRA A;  1PX6 A;  3GH9 A;  5A34 A;  3LXZ A;  1V2A A;  1EV4 A;  3TOT A;  5A4W A;  5IOW A;  2H76 A;  3ZTL A;  4MF6 A;  2CX4 A;  3NOF A;  2LRC A;  3MAK A;  3O6T A;  2IMD A;  2E2G A;  2OAC A;  2JU5 A;  2H0G A;  1VGL A;  1Z6N A;  3FZ5 A;  3IV4 A;  1X9W B;  3DYR A;  3MNG A;  3RBT A;  3A2W A;  3L9V A;  1X0R A;  4O5U A;  5B7C A;  1GSS A;  2KP1 A;  1M2B A;  4AI6 A;  1TJD A;  2F51 A;  3VK9 A;  1M7T A;  3EVI A;  3NZN A;  3HJO A;  2HI7 A;  1OC3 A;  2ZUP A;  4YQM A;  3LJR A;  3WGD A;  2PER A;  5A4U A;  2I3Y A;  3WT1 A;  3QFA C;  3M9J A;  4GRF A;  9GSS A;  3VWX A;  3H4K A;  5C00 A;  3GH6 A;  1G6W A;  1W4V A;  3IAM 2;  4TR3 A;  5G2Z A;  4KDX A;  4V1A g;  5KN1 A;  2C1Y A;  1MTC A;  4L8E A;  4OCE A;  4X43 A;  1A8Y A;  5D93 A;  3TCO A;  4KGI A;  1J08 A;  3LWA A;  4NWY A;  2VD1 A;  5HFK A;  2BMX A;  1HNA A;  1PQN A;  5IM9 A;  1DSB A;  5KN0 A;  4ECC A;  1MEK A;  1SKR B;  2N5B A;  1OYJ A;  1ON4 A;  2OBK A;  3BD2 A;  1UVZ A;  1GTI A;  1SK0 A;  1S3D A;  4XS6 A;  2GSQ A;  1V98 A;  1GSQ A;  2R4V A;  2Z9S A;  4XCS A;  3QAV A;  1SKW B;  1OC8 A;  1XWB A;  2YZH A;  4BVY A;  2EIR A;  3D6I A;  3A5I A;  5IMV A;  2XC2 A;  1XXU A;  2M80 A;  4O92 A;  4GQC A;  2LJA A;  2WDU A;  1YF1 A;  2L5O A;  2J9H A;  3L9S A;  1XVQ A;  4IS0 A;  3R3E A;  4RQX A;  1T3B A;  4BVX A;  1ERU A;  3FK8 A;  3IHG A;  2VM2 A;  4PUF C;  1WPI A;  4K2D A;  5D8I A;  2QC7 A;  5EL8 A;  1FHE A;  5ID2 B;  3C7M A;  2PMT A;  5JCG A;  5DQY A;  1RK4 A;  4OFM A;  2X49 A;  2NTO A;  3Q6O A;  3WGE A;  4TR0 A;  5HFI A;  6GSW A;  1XIY A;  4IQA A;  5J47 A;  3ERW A;  3TJJ A;  4BWQ A;  2NPB A;  3DIE A;  1URM A;  2HSM B;  3H79 A;  1JZW A;  4YKF A;  4IW9 A;  2PBJ A;  1YVL A;  2GQM A;  1PKW A;  2X64 A;  4L5O A;  5CRH A;  3AY8 A;  4MK3 A;  2HRF A;  2TRX A;  4AJ6 A;  4ACS A;  4O5Q A;  2IME A;  5EY6 A;  3BBY A;  2YNX A;  4XRA A;  4WBJ A;  4I8B A;  2HSM A;  1PMT A;  1H75 A;  3FZ9 A;  17GS A;  2KOK A;  3TUE A;  4K6X A;  3ZYW A;  3QD9 A;  5E4W A;  3TJF A;  5H5Q A;  4FYU A;  4HU9 A;  3N9J A;  1WWJ A;  1GSU A;  2OA7 A;  2YWI A;  3IXR A;  4RI6 A;  1U87 A;  3D5J A;  4EDZ A;  1YKC A;  3KCM A;  5ECI B;  4KDU A;  2JAD A;  4HQS A;  1BAY A;  2IMI A;  4NXI A;  3RHC A;  1A2L A;  3C1R A;  5F0G A;  2K6V A;  1X5E A;  5DCG A;  2JZR A;  1ERV A;  3LOR A;  2DJ3 A;  4MZC A;  5C04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...