2PMTA

Glutathione transferase from proteus mirabilis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
201
structure length
201
Chain Sequence
MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE TRANSFERASE
publication title A mixed disulfide bond in bacterial glutathione transferase: functional and evolutionary implications.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Transferase
total genus 73
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2pmtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pmtA01
5J3RA 1TTZA 2VCWA 5ABRA 1R26A 3ZIVA 4TXVA 2YWOA 4KSOA 3KCMA 2H6ZA 3IDVA 4EE0A 1FHEA 4OO4A 2AHEA 2FWFA 3EURA 3WGDA 4L0WA 2MMOA 1TK0B 4LL4B 2I1UA 1SJ6A 5HFKA 1X9SB 4K2DA 5F07A 5B6MA 1A2JA 4AJ6A 3ZVJA 3GX0A 4ECJA 4G0IA 3CTGA 4HJ2A 3J7Yb 3HXSA 5AGYA 3IAM2 4IHUA 4F82A 3A5WA 4ZL9A 5F0GA 4J2FA 2B5XA 1F37A 1XW9A 4FYUA 2HSMB 2E7PA 3A3TA 1EP8A 4ISDA 6GSXA 1KTEA 1R5PA 3HJPA 3LXZA 2OE0A 1O8WA 3TB2A 3L4NA 3TUEA 5HR3A 2XBIA 1GSFA 1V98A 3A2XA 3IA1A 2X8HA 2CQ9A 2GS3A 1M0UA 2H1GA 4V2LA 3TRXA 1U3AA 1ABAA 1J0FA 3D22A 3GRXA 1NM3A 1VF4A 2V2GA 3HDCA 4YAPA 4MZBA 3IOSA 4MMMA 4BVXB 4PUFC 5HR2A 1G7OA 3MDKA 3U6VA 1FVJA 2QKEA 4NMUA 4KCAA 2PUKC 4KAEA 1FG4A 4P3YB 1K0NA 3P8WA 4N0ZA 2OACA 2EIQA 2PERA 5DQYA 2C3QA 2WDUA 2FGXA 1FVKA 2E2MA 3IC4A 2MBTA 1SL2B 2H6XA 2H75A 4ZXGA 1A0FA 2B6MA 2R2JA 2P5RA 3CTFA 4TKYA 2MZCA 3ZZXA 1SK1A 4YQUA 1AIUA 1GRXA 4G2EA 4K0GA 5KN1A 1JLWA 4ZBDA 1AC1A 3D6IA 4KCEA 3QAWA 5ECHB 4IJIA 1PX6A 3F3QA 3HVVA 3TKSC 2VIMA 3GTUB 16GSA 2KP1A 2FA4A 1W4VA 4IKHA 1GNWA 2DMMA 1JZRA 4KW6A 3GL3A 1XWGA 2HZEA 2P5QA 1VF1A 3VURA 3GKKA 4BL7A 3M8NA 4WBRD 2VCXA 4YH2A 1SL0B 2VD1A 4YAVA 4K6XA 1YZXA 2WJUA 1SENA 1A2MA 3I43A 3GHAA 5KN0A 1S3CA 5DALB 1FO5A 2DIYA 1F9MA 1AAZA 4TR0A 1GSDA 4MA9A 3D5JA 3RBTA 1PD21 4WR4A 2FLSA 4XS1A 2RIIA 5A4VA 1T4YA 1SJIA 3LXTA 5CNWA 1ILOA 1XVQA 2VL2C 3KJYA 1YKAA 2TIRA 2GGTA 5E4WA 2C3TA 1OKTA 3K8NA 4TXOA 1JHBA 1SK2A 3M9KA 3IC8A 2IN3A 1ST9A 1HNCA 3GH6A 1WRYA 1DBYA 2LV3A 4LLRA 3F6FA 4ACSA 2B1KA 2CZ2A 1J9BA 1YEPA 2K8VA 5G5FA 14GSA 4JBBA 2HRAA 2DJ2A 4QL9A 2OE3A 1IYHA 4H86A 5DVBA 4TW5A 4KUNA 1T4ZA 2IIYA 2CA8A 3BCIA 4QL7A 4HS1A 3TOUA 3GSSA 1X5EA 3ZITA 2H76A 1YKCA 2HSYA 5JCUA 3IAS2 4KDXA 4KSMA 1TRWA 5DAKA 1VF3A 1UVZA 4TN8A 4JR4A 5JCGA 3GURA 3TKPA 1AW9A 2OADA 1Z7PA 1U3IA 4OFMA 4IVFA 2DJ0A 1T7PB 4KDYA 4YQMA 4LL1B 1XWKA 3VLNA 1SYRA 3VK9A 1JZDA 2E0QA 5B8AA 5IMDA 3GX8A 5FWGA 4DVCA 4ZBAA 4L5LA 1XXUA 5HQPA 2CV4A 3US3A 3ZMLA 2I81A 1SYXA 4OO5A 2VOCA 4XCSA 1MDIA 2HZFA 4WF4A 1T00A 3TJGA 3IBHA 4XS4B 2H74A 1X5DA 3UL3A 2GQMA 5IM9A 3LQ7A 3U5RE 1B4QA 4MF6A 3H93A 2LRNA 3ISOA 4OWYA 4EDYA 5ID2A 1IYIA 1EV4A 4OFTA 4LA1A 5DCHA 2P0GA 5ELGA 2JL4A 3FYGA 20GSA 3HYPA 3QDNA 2JACA 5CAXA 3QAVA 2HRKA 2ALBA 3TGZA 1O81A 2ZNMA 4WR5A 3GKXA 4GQCA 1WIKA 3HD5A 1Z6MA 1BAYA 2O8VB 3FY7A 4MK3A 5IOWA 1W89A 3F4SA 1HNAA 1TI3A 2VL2A 3L0HA 1GSYA 2PVOC 1ZGNA 1K0MA 7GSSA 2GSQA 4ZIJA 4HJMA 1HNBA 4CDOA 2FCHA 1GL8A 2IWTA 2CAIA 3RHCA 2RM6A 4WXTA 3DKSA 2HNLA 1O6JA 1X9MB 3CSJA 5ECNB 3JCML 5AISA 3F3RA 12GSA 5ENUA 1MEKA 3QMXA 2IMFA 4FQUA 1Q98A 2FNOA 5GAND 2M46A 1V58A 2VCVA 3LG6A 4RI6A 3M9JA 2ZCTA 1G6WA 2YCDA 4XIHA 5IMFA 3QCPA 2WB9A 1NW2A 2HQTA 1A8YA 1TKDB 2HSHA 2GDRA 4ZILA 3CRUA 3EMXA 2GSTA 4JZQA 4IP1A 2JU5A 2HLSA 2KHPA 3OR5A 1PSQA 4IP6A 3ZFBA 4G10A 4XS6A 1EGOA 1WE0A 4EF0A 4EKZA 4MLYA 3Q19A 1G7EA 4N30A 1OE8A 2DJKA 2H30A 4I97A 2ON7A 4EVMA 4DEJA 2X8CA 2V32A 1M9BA 3HY2A 2I9HA 5LCZA 3O6TA 3TKRA 5EVOA 3HVSA 5G2ZA 5HR0A 2FWHA 3C73A 5DJMA 3E9JB 2HRNA 2QC7A 5D9VA 2B5EA 2H0GA 2WCIA 1O8XA 3FKFA 2GT6A 2N5FA 2KLXA 1OKDA 3KMNA 1M7TA 4I2TA 3M3MA 4ECBA 19GSA 1XZOA 4BA7A 1GTBA 2RLIA 1M2DA 2YV9A 3HJOA 5FT3A 4JEDA 3FR6A 2H71A 3ZRDA 5IPGA 5INYA 3FRCA 2G2QA 3M0FA 3EINA 1T1VA 3FZ5A 3RPPA 5ECLB 3VFIA 2IMDA 2C0GA 3ZL5A 4GRFA 2DMLA 1WPIA 2BJXA 3KTBA 4Q5NA 1MD4A 5F8BA 1ERWA 1K0OA 2LS5A 3PGTA 1S3DA 2F51A 3L9UA 3GH9A 3UVHA 2PBJA 3EYTA 3LWAA 1KEBA 2XPDA 5CP1A 4IN0A 4CW9A 3ZYWA 4MP4A 2L4QA 1DE2A 2IFQA 2L5LA 2A4VA 3N9JA 4IELA 3KEBA 3W8JA 3ZFLA 3DWVA 2VO4A 2G0FA 2LUSA 3G7JA 2X64A 3BCKA 1QUWA 5KN3A 4GLTA 1DSBA 4L8EA 4BVYA 1EEMA 4O7HA 4GCIA 2YP6A 1R5AA 2LQQA 4G19A 3EMPA 3G9BA 3Q74A 5CYYA 4BL7B 5C00A 1GH2A 4IGJA 4BPYA 5D9XA 1H75A 3FZAA 3HHVA 2N5BA 5IOXA 2VCQA 2J23A 22GSA 3TRPA 3NOFA 2DBCA 4K7OA 2DSAA 1ZOFA 1TRVA 5IMAA 1A0RP 3GIXA 1OC8A 5LD0A 2ON5A 1ZCPA 1TI1A 2GTUA 1E2YA 3UARA 2LQOA 4N10A 5EPFA 2CZ3A 3CSHA 3H79A 1PA3A 1EGRA 2PVQA 2M72A 4G0LA 3UOMA 2YN1A 4ILFA 4KF9A 2PWJA 4MJCA 3ZIJA 3GSTA 11GSA 1PN9A 5AN1A 3DEXA 1YEXA 3TJJA 1PL2A 1UC7A 3FR9A 5HFIA 5IO2A 2YZUA 5CRGA 2H0HA 3MNGA 1G0TA 4MPFA 5IMZA 4ECIA 4JU5A 3TKQA 2KOKA 2L6DA 3R2QA 1I9DA 1J08A 1FB0A 1NHYA 4WETA 1B9YC 1AQXA 2MMNA 4J57E 1XIYA 1JLVA 1A23A 4XTSA 2F8AA 4ZBBA 4Q5QA 2A2RA 2L6CA 5DAKB 3FZ4A 5D8IA 4OD7A 5ECMB 2HRFA 4I2UA 1GUHA 1QMVA 5A5KA 4GSNA 4MCUA 3A2WA 3KZQA 5JWOB 2OKAA 10GSA 5G5EA 4NWYA 4GF0A 2JZTA 2IL3A 1ACVA 4GTUA 1C72A 4Q5FA 3DVWA 3FW2A 4PGTA 1OC9A 1B8XA 1HYUA 4GSSA 3L78A 5LNKe 4O32A 1OVNA 5JCWA 2VAFA 3D0ZA 3IXRA 5J9BA 4DSSA 5DJLA 2I3YA 4NXIA 4HQSA 1SD9A 1R7HA 3P7XA 2F9SA 1K3LA 1PRXA 3Q18A 4NHZA 1SKWB 5IO0A 4MJEA 2LEGA 2HXKA 5D96A 2CVBA 2VM1A 18GSA 5ID2B 2K6VA 2AV4A 3DXBA 2C80A 3I9V2 2VL9A 1TW9A 2HI7A 2HRKB 2L59A 1F3AA 4XRAA 3TJKA 2ZUPA 4HUAA 1K3OA 4OFNA 2KUCA 4CHSA 2FA8A 3CYNA 5EL8A 2H72A 5ECOB 1HD2A 1SD8A 2O87A 5HFGA 4V2NA 4POKA 2R3XA 1M9AA 4N11A 4POLA 2XC2A 1RK4A 4OMVA 1B48A 2FY6A 3DVXA 2YZHA 1QXHA 4L0UA 1Z3EA 3APSA 5A4WA 4RQXA 3KXOA 2R4VA 3HA9A 4KNDA 4ML6A 1V2AA 2E2GA 2VLVA 1Z9HA 2P31A 4NPBA 5B8BA 1ZYQB 2IMIA 3GNJA 3VI5A 4NV2A 1GTAA 1EV9A 3UMAA 3FEUA 3GV1A 1EOHA 2XHFA 4JRRA 5EY6A 2RUEA 3C71A 4X0XA 1XVWA 2H1AA 2C1YA 1FAAA 4AJ7A 1TOFA 2LJAA 4KE3A 4WKWA 1ERVA 3LYPA 1JFUA 2H70A 4I6XA 4NAXA 4EDZA 3VWXA 5J5NA 4FYBA 3RHBA 4IJ3A 2VCZA 3N5OA 3O3TA 1TK8B 1YQ1A 3F63A 3P90A 2O89A 2H0IA 1PL1A 2FUG2 5ECKB 5DALA 2AUVA 3KM6A 4FH8A 4JR6A 1XWCA 4PNGA 4PURA 5DQSA 1QQ2A 3TKSE 2FHEA 1GLQA 4MJBA 1QGVA 4MABA 2B3SA 1X5CA 5G1KA 2OA7A 1GNEA 1N8JA 1THXA 3HJMA 4GSTA 2AAWA 1BEDA 2HFDA 3L9SA 3UBKA 3DD3A 3KMOA 4K8MA 1OE7A 3TRQA 2VLTA 3ZVJD 3DYRA 1VRSD 3EE2A 4EL1A 1Z5YE 1XOBA 3F0IA 3D4TA 3MSZA 2GLRA 4TOPA 3GN3A 3UEMA 4FYCA 1T8EB 4HQZA 4KB3A 2PPTA 5H5RA 1PMTA 1BG5A 3MAKA 4O92A 1AQWA 4PQIA 4ZB8A 2L4CA 1U87A 2TRXA 5GSTA 1A2LA 2B1LA 4USSA 1XOAA 3KP9A 3PINA 2C4JA 4FO5A 1K0BA 4IQ1A 2Z9SA 1ML6A 3O76A 2K18A 1LJRA 3WD6A 2R37A 3E0UA 2FWGA 4PTSA 4E8EA 4EO3A 3KD0A 5D93A 1G6YA 2DC5A 5CO3A 4MF7A 4HZ4A 2OE1A 4BVYB 17GSA 1FW1A 4MH2A 1I5GA 5H5QA 2LRCA 4ZB6A 1CQHA 4IS0A 4TR3A 1PGTA 6GSVA 3UAPA 1THOA 2JADA 5DDLA 3KTLA 2DIZA 3VPQA 1EWXA 1B9XC 2CAQA 1V40A 3IR4A 1GSUA 3PH9A 4AGSA 1K0DA 5GSSA 3WYWA 6GSSA 1TRSA 5B7CA 3F8UA 1F2EA 4WEYA 4F0CA 2B7KA 4O5RA 4MH3A 2YPMA 2D2ZA 2WS2A 5D73A 2NDOA 1RQMA 4TR4A 1TU7A 3UBLA 3TDGA 2XBQA 2REMA 3P2AA 3H4KA 1NHOA 3FHKA 2LKUA 3LYKA 1K3YA 2GVPA 4ZB9A 4IQAA 2VUPA 5E59A 3VPTA 2IJYA 1TJDA 1QFNA 5IIZA 3DRNA 5J4UA 5HR1A 3GFKA 1BQ7A 4V1Ag 1DUGA 1E6BA 2C0DA 3IK9A 4D73A 4WF5A 3D4MA 2HT9A 5DCGA 2VD0A 3GL5A 2YJHA 2YWMA 4HU7A 3ZTLA 5F06A 3APQA 4ECCA 1ZMAA 1SJZA 2IPAA 3GKNA 1JZOA 4TR1A 3QFAC 3ME8A 4PXOA 4GQFA 3GKMA 3QD9A 2LJKA 3GMFA 5A4UA 3TCOA 3QR6A 4MZCA 1AUCA 1O73A 1R4WA 3CRTA 3DIEA 3KIJA 2WFCA 2X8GA 2CX4A 3IHQA 3D21A 4NV5A 2PU9C 3EU4A 2HZEB 5D9WA 1GP1A 3ZLPA 1Q4JA 1FOVA 2H01A 1OC9B 2NTOA 3H1NA 4DSSB 3R3EA 1YF0A 3WT1A 2LRTA 2YNXA 3BJ5A 1KBNA 1OYJA 3QPMA 1PQNA 3W8SA 9GSSA 2WRTA 5IMCA 1M2BA 4V1Ap 3A2VA 4NHWA 2YANA 2NVLA 1B4PA 5H5SA 3E3EA 4FIWA 1EP7A 4KGIA 3RAZA 2X99A 3Q6OA 4F03A 1O7UA 1DE1A 3TOTA 5IQYA 1GUKA 3QAGA 2GQKA 1YY7A 2PGTA 4K7IA 2KP2A 5COHA 2LSTA 5FHIA 1XPVA 4TXOB 4E8HA 3KH7A 1GLPA 1TDIA 3H8QA 1ON4A 3ERWA 4K1FA 1RW1A 3G7YA 3UIWA 1MD3A 2JZRA 3BBYA 2B5YA 4ID0A 3IV4A 1GSSA 2XPEA 2F3MA 1ZZYA 4TRXA 2YWNA 2MBSA 3EU3A 4PQHA 2R5GA 3TJFA 3FZ9A 4PUAA 4OCFA 4HDEA 1GTIA 3MWHA 4K7NA 3APOA 5JWQB 1A8LA 3UVTA 2V6OA 4RI7A 1XWAA 1PKZA 3VI7A 3F9UA 1CQGA 1AQVA 1EEJA 4AJ8A 1MDJA 1K0CA 3HCZA 1XW6A 2V41A 1SKSB 2H6YA 3FK8A 3RPNA 3M1GA 5JWRB 3DMLA 4IW9A 1BYEA 5KN2A 1U6TA 3LSZA 1LBKA 2QSIA 2DJ3A 1ZYEA 4HI7A 2MMAA 2H66A 4K9ZA 1TXXA 4MDCA 2EIOA 3BOAA 3W6GA 1U88A 2LJRA 2CX3A 4KH7A 2VCTA 1V57A 5L71A 1URMA 1WOUA 2HSMA 2YOIA 4K0NA 4LMWA 2BMXA 4I5QA 1MTCA 3F4TA 4LMVA 5ECQB 6GSUA 3VWWA 3F6DA 5AIXA 5ECIB 4Q5RA 1VF2A 3LEFA 3S9FA 4ML1A 4F0BA 2M80A 5KEJA 2GT5A 2YWIA 1OC3A 1TU8A 4F2IA 2I4AA 1XW5A 1EOGA 3C1SA 1EZKA 1YF1A 3BD2A 4PX1A 1X0RA 2DLXA 2NBSA 1S3AA 2UZ8A 4BVXA 3PR8A 4EUYA 1SK0A 4BWSA 5J41A 4X43A 3CXGA 5CREA 3I6AA 1KNGA 1T3BA 1SL1B 1WP0A 3C7MA 3ME7A 3LORA 2LTKA 5GZZB 2LNTA 1BJXA 8GSSA 3SWLA 2C0FA 2CVDA 2ES7A 3IE3A 6GSYA 5CRWA 3TJBA 2JSYA 1F6MC 5AIVA 2GZPA 1M2AA 4HU9A 3ERFA 2J9HA 4POBA 5IMVA 4F9ZA 1H4OA 4I8BA 4YQVA 4QQ7A 3QFBC 5J9CA 2AYTA 4XRDA 5CRDA 2K9FA 3V1WA 4JE1A 2EC4A 2DJ1A 3HVXA 3CBUA 4HEA2 2IMKA 4TVEA 1GTUA 5F05A 3F4RA 3GTUA 1M99A 5DBQA 5D9TA 1XFLA 1UA5A 3WT2A 2YJ7A 4G9HA 3ZMKA 2H1DA 3EVIA 1Y6EA 2WGRA 2GQLA 1Z7RA 2GZYA 1MDKA 1WWJA 3TKSA 1XWBA 4RUVA 2WULA 2H1BA 2MMZA 1SKRB 3VWVA 3CSIA 13GSA 5G1LA 2JZSA 3HZ8A 3NZNA 2YV7A 3ERGA 2AJQB 4KX4A 1TK5B 4EXJA 3IRAA 4KDUA 2CVKA 3AY8A 1OAZA 1HQOA 1VGLA 2PMTA 3NIVA 4PNFA 3SBCA 4ULXA 3WGXA 4AF2A 1TP9A 3KH9A 4ZL8A 3IK7A 2BTOT 1FB6A 1O85A 4DSQA 4OCEA 1YDKA 3GYKA 2V1MA 3HZ4A 1X9WB 1GWCA 2OJLA 2QGVA 2EIRA 2O7KA 3FR3A 4WBJA 2MYGA 1ERTA 3G7IA 3LJRA 4N0VA 2PN8A 2AB6A 1AXDA 2R6KA 3GUSA 4MF5A 2DJJA 4XHMA 4MJAA 3LFLA 1GUMA 2GSRA 3CMIA 2JSZA 5C04A 4MZWA 4HOJA 4D73B 1LU4A 1WJKA 2V6KA 2A2SA 2RUFA 1A24A 2IFQB 4EC0A 1PKWA 2L5OA 2HSNB 2WZ9A 4GWRA 4IBPA 3PPUA 4X1UA 2FWEA 2HE3A 4TR1B 5ECSA 2TRCP 2N5AA 2L57A 4HZ2A 1BX9A 3WGEA 2NPBA 2H8LA 5G30A 1YJ6A 2H73A 1GSEA 2VM2A 4G0KA 5G31A 3EWLA 4V2MA 2GSSA 4MPGA 1JZWA 1WMJA 1SU9A 1UN2A 1XCCA 2CT6A 2IMEA 2C0EA 2OBIA 2GZZA 5CRHA 4POMA 5IPHA 3KGKA 2HYXA 3L9VA 4DSRA 1Z6NA 1XBSA 2FD3A 1NSWA 4RQRA 1N2AA 1K0AA 4GXZA 2F8FA 4J56E 4ZL7A 2RM5A 3RDWA 2B7JA 2OBKA 4XS4A 3IPZA 3UJ1A 2K8SA 2VL3A 1GSQA 1V9WA 1ZL9A 2O85A 3ED3A 6GSWA 3C8EA 1USBA 3GA4A 3DGQA 3J7Yk 4BWQA 4Z7XA 1GULA 1PX7A 1F3BA 3QOUA 3VWUA 2C8UA 1TRUA 5ELAA 3I69A 1Y25A 5GAPD 6GSTA 2VLUA 1ERUA 5B6NA 3HKRA 4KA0A 5ECRB 3ZREA 5ECPB 1QK8A 2LNSA 3EC3A 3C1RA 2C3NA 2H19A 3LGCA 4L5OA 3KP8A 4PQ1A 5BMUA
chains in the Genus database with same CATH superfamily
5J3RA 1TTZA 2WVXA 2VCWA 5ABRA 1R26A 3ZIVA 4TXVA 2YWOA 4KSOA 3KCMA 2H6ZA 3IDVA 4EE0A 1FHEA 4OO4A 2AHEA 2FWFA 3EURA 1PFOA 3WGDA 4L0WA 2MMOA 1TK0B 4LL4B 4PHZC 2I1UA 1SJ6A 5HFKA 1X9SB 4K2DA 5F07A 5B6MA 1A2JA 4AJ6A 3ZVJA 3GX0A 4ECJA 4G0IA 3CTGA 4HJ2A 3J7Yb 3HXSA 5AGYA 3IAM2 4IHUA 4F82A 3A5WA 4ZL9A 5F0GA 4J2FA 2B5XA 1F37A 1XW9A 4FYUA 2HSMB 2E7PA 3A3TA 1EP8A 4ISDA 6GSXA 1KTEA 1R5PA 3HJPA 3LXZA 2OE0A 1O8WA 3TB2A 3L4NA 3TUEA 5HR3A 2XBIA 1GSFA 1V98A 3A2XA 3IA1A 2X8HA 2A2PA 4HSCX 2CQ9A 2GS3A 1M0UA 4W66A 2H1GA 4V2LA 3TRXA 1U3AA 1ABAA 1J0FA 3D22A 4E68A 3GRXA 1NM3A 1VF4A 2V2GA 3HDCA 4YAPA 4MZBA 3IOSA 4MMMA 4BVXB 4PUFC 5HR2A 1G7OA 3MDKA 3U6VA 1FVJA 2QKEA 4NMUA 4KCAA 2PUKC 4KAEA 1FG4A 4P3YB 1K0NA 3P8WA 4N0ZA 2OACA 2EIQA 2PERA 5DQYA 2C3QA 2WDUA 2WZSA 2FGXA 1FVKA 2E2MA 3IC4A 3RFRC 2MBTA 1SL2B 2H6XA 2H75A 4ZXGA 1A0FA 2B6MA 2R2JA 2P5RA 3CTFA 4TKYA 2MZCA 3ZZXA 1SK1A 4YQUA 1AIUA 1GRXA 4G2EA 4K0GA 5KN1A 1JLWA 4ZBDA 1AC1A 3D6IA 4KCEA 3QAWA 5ECHB 4IJIA 1PX6A 3F3QA 3HVVA 3TKSC 2VIMA 3GTUB 2DKHA 16GSA 2KP1A 2FA4A 1W4VA 4IKHA 1GNWA 2DMMA 1JZRA 4KW6A 3GL3A 1XWGA 2HZEA 2P5QA 1VF1A 4K5RA 3VURA 3GKKA 4BL7A 3M8NA 4WBRD 2VCXA 4YH2A 1SL0B 2VD1A 4YAVA 4K6XA 1YZXA 2WJUA 1SENA 1A2MA 3I43A 3GHAA 5KN0A 1S3CA 5DALB 1FO5A 2DIYA 1F9MA 1AAZA 4TR0A 1GSDA 4MA9A 1BG1A 3D5JA 3RBTA 1PD21 4WR4A 2FLSA 4XS1A 2RIIA 5A4VA 1T4YA 1SJIA 3LXTA 5CNWA 1ILOA 1XVQA 2VL2C 3KJYA 1YKAA 2TIRA 2GGTA 5E4WA 2C3TA 1OKTA 3K8NA 4TXOA 1JHBA 1SK2A 3M9KA 3IC8A 2IN3A 1ST9A 1HNCA 3GH6A 1WRYA 4QMKA 1DBYA 2LV3A 4LLRA 3F6FA 4ACSA 3EPTA 2B1KA 2CZ2A 1J9BA 1YEPA 2K8VA 5G5FA 14GSA 4JBBA 1N25A 2HRAA 2DJ2A 4QL9A 2OE3A 1IYHA 4H86A 5DVBA 4TW5A 4KUNA 1T4ZA 2IIYA 2CA8A 3BCIA 4QL7A 4HS1A 3TOUA 4K5SA 3GSSA 1X5EA 3ZITA 2H76A 2X49A 1YKCA 2HSYA 5JCUA 3IAS2 4KDXA 4KSMA 1TRWA 5DAKA 1VF3A 1UVZA 4TN8A 4JR4A 5JCGA 3GURA 3TKPA 1AW9A 2OADA 1Z7PA 1U3IA 4OFMA 4IVFA 2DJ0A 1T7PB 4KDYA 4YQMA 4LL1B 1XWKA 3VLNA 1SYRA 3VK9A 1JZDA 2O5VA 2E0QA 5B8AA 5IMDA 3GX8A 5FWGA 4DVCA 4ZBAA 1FOHA 4Z2RA 4L5LA 1XXUA 4EIQA 5HQPA 2CV4A 3US3A 4BIKA 3ZMLA 2I81A 1SYXA 4OO5A 2VOCA 4XCSA 2O3EA 1MDIA 2HZFA 4WF4A 1T00A 3TJGA 3IBHA 4XS4B 2H74A 1X5DA 3UL3A 2GQMA 5IM9A 3LQ7A 3U5RE 5A5HA 1B4QA 4MF6A 3H93A 2LRNA 3ISOA 4OWYA 4EDYA 5ID2A 1IYIA 1EV4A 4OFTA 4LA1A 5DCHA 2P0GA 5ELGA 2JL4A 3FYGA 20GSA 2X4AA 3HYPA 3QDNA 2JACA 5CAXA 3QAVA 2HRKA 2ALBA 3TGZA 1O81A 2ZNMA 4WR5A 3GKXA 4GQCA 1WIKA 3HD5A 1Z6MA 1BAYA 2O8VB 3FY7A 4MK3A 5IOWA 1W89A 3F4SA 1HNAA 1TI3A 2VL2A 3L0HA 1GSYA 2PVOC 1ZGNA 1K0MA 7GSSA 2GSQA 4ZIJA 4HJMA 1HNBA 4X4JA 4CDOA 5BMUB 2FCHA 1GL8A 2IWTA 2CAIA 3RHCA 2RM6A 4WXTA 3DKSA 2HNLA 1O6JA 1X9MB 3CSJA 5ECNB 2WVXB 5AISA 3F3RA 3JCML 12GSA 4GDFA 5ENUA 1MEKA 3QMXA 1S3RA 2IMFA 4FQUA 1ZYNA 1Q98A 2FNOA 5GAND 2M46A 1V58A 2VCVA 3LG6A 4RI6A 3M9JA 2ZCTA 1G6WA 2YCDA 4XIHA 5IMFA 3QCPA 2WB9A 1NW2A 2HQTA 1A8YA 1TKDB 4CY6A 2HSHA 2GDRA 4ZILA 3CRUA 3EMXA 2GSTA 4JZQA 4IP1A 2JU5A 2HLSA 2KHPA 3OR5A 1PSQA 4IP6A 3ZFBA 4G10A 4XS6A 1BF5A 1WE0A 4EF0A 5A34A 1EGOA 4EKZA 4MLYA 3Q19A 1G7EA 4N30A 1OE8A 2DJKA 2H30A 4I97A 2ON7A 4EVMA 4DEJA 2X8CA 2V32A 1M9BA 3HY2A 2I9HA 5LCZA 3O6TA 3MYDA 3TKRA 5EVOA 3HVSA 5G2ZA 1ZYPA 5HR0A 2FWHA 3C73A 5DJMA 3E9JB 2HRNA 2QC7A 5D9VA 2B5EA 2H0GA 2WCIA 1O8XA 3FKFA 2GT6A 2N5FA 2KLXA 1OKDA 3KMNA 1M7TA 4I2TA 3M3MA 4ECBA 19GSA 5J47A 1XZOA 4BA7A 1GTBA 2RLIA 1M2DA 2YV9A 3HJOA 5FT3A 4JEDA 3FR6A 2H71A 3ZRDA 5IPGA 5INYA 3FRCA 2G2QA 3M0FA 3EINA 1T1VA 3FZ5A 3RPPA 5ECLB 3VFIA 2IMDA 2C0GA 3ZL5A 4GRFA 2DMLA 1WPIA 2BJXA 3KTBA 4Q5NA 1MD4A 5F8BA 1ERWA 1K0OA 2LS5A 3PGTA 1S3DA 2F51A 3L9UA 3GH9A 3UVHA 2PBJA 2VKZG 3EYTA 3LWAA 1KEBA 2XPDA 5CP1A 4IN0A 4CW9A 3ZYWA 4MP4A 2L4QA 1DE2A 2IFQA 2L5LA 2A4VA 3N9JA 4IELA 3KEBA 3W8JA 3ZFLA 3DWVA 5BRTA 2VO4A 2G0FA 2LUSA 3G7JA 4O5UA 2X64A 1M3JA 3BCKA 5KOXA 1QUWA 3A5IA 5KN3A 4GLTA 1DSBA 4L8EA 4ZB7A 4BVYA 1EEMA 4O7HA 4GCIA 2YP6A 1R5AA 4AKIA 4G19A 2LQQA 3EMPA 3G9BA 3Q74A 5CYYA 4BL7B 5C00A 1GH2A 4IGJA 4BPYA 5D9XA 1H75A 3FZAA 3HHVA 2N5BA 5IOXA 2VCQA 2J23A 22GSA 3TRPA 3NOFA 2DBCA 4K7OA 2DSAA 1ZOFA 1TRVA 5IMAA 1A0RP 3GIXA 1OC8A 5LD0A 2ON5A 1ZCPA 1TI1A 2GTUA 1E2YA 3UARA 2LQOA 4N10A 5EPFA 2CZ3A 3CSHA 3H79A 1PA3A 1EGRA 2PVQA 2M72A 4G0LA 3UOMA 2YN1A 4ILFA 4KF9A 2PWJA 4MJCA 3ZIJA 3GSTA 1SVLA 11GSA 1PN9A 5AN1A 3DEXA 1YEXA 3TJJA 1PL2A 1UC7A 3FR9A 5HFIA 4Z2UA 5IO2A 2YZUA 5CRGA 2H0HA 3MNGA 1G0TA 4MPFA 3IHGA 5IMZA 4ECIA 4JU5A 3TKQA 2KOKA 2L6DA 3R2QA 1I9DA 1J08A 1FB0A 1NHYA 4WETA 1B9YC 1AQXA 2MMNA 4J57E 1XIYA 1JLVA 1A23A 4XTSA 2F8AA 4ZBBA 4Q5QA 2A2RA 2L6CA 5DAKB 3RGBC 3FZ4A 5D8IA 4OD7A 5ECMB 2HRFA 4I2UA 1GUHA 1QMVA 5A5KA 4GSNA 4MCUA 3A2WA 3KZQA 5JWOB 2OKAA 10GSA 5G5EA 4NWYA 4GF0A 2JZTA 1I1IP 2IL3A 4AKXB 4GTUA 1ACVA 1C72A 4Q5FA 3DVWA 3FW2A 4PGTA 1OC9A 1B8XA 1HYUA 4GSSA 3L78A 5LNKe 4O32A 1OVNA 5JCWA 2VAFA 3D0ZA 3IXRA 5J9BA 4DSSA 5DJLA 2I3YA 4NXIA 2R0CA 4HQSA 1SD9A 1R7HA 3P7XA 2F9SA 1K3LA 1PRXA 3Q18A 2WW1A 4NHZA 1SKWB 5IO0A 4MJEA 2LEGA 5A5HB 2HXKA 5D96A 2QA1A 2CVBA 2VM1A 3MIXA 18GSA 5ID2B 2K6VA 2AV4A 3DXBA 2C80A 3I9V2 4EIPA 2VL9A 1TW9A 2HI7A 2HRKB 3CHXC 2L59A 1F3AA 4XRAA 3TJKA 5J4YA 2ZUPA 4HUAA 1K3OA 4OFNA 2KUCA 4CHSA 2FA8A 3CYNA 5EL8A 2H72A 5ECOB 1HD2A 1SD8A 4A5PA 2O87A 5HFGA 5KOWA 4V2NA 4POKA 2R3XA 1M9AA 4N11A 4PI2C 4POLA 2XC2A 1RK4A 4OMVA 1B48A 2FY6A 3DVXA 2YZHA 1QXHA 4L0UA 1Z3EA 3APSA 5A4WA 4RQXA 3KXOA 2R4VA 3HA9A 2WW2A 4KNDA 4ML6A 1V2AA 2E2GA 2VLVA 1Z9HA 2P31A 4NPBA 5B8BA 1ZYQB 2IMIA 3HVNA 3GNJA 3VI5A 4NV2A 1GTAA 1EV9A 3UMAA 3FEUA 3GV1A 1EOHA 2XHFA 4JRRA 5EY6A 2RUEA 3C71A 4X0XA 1XVWA 2H1AA 2C1YA 1FAAA 4AJ7A 1TOFA 2LJAA 4KE3A 5A34B 4WKWA 1ERVA 3LYPA 1JFUA 2H70A 4I6XA 4NAXA 4EDZA 3VWXA 5J5NA 4FYBA 3RHBA 4IJ3A 2VCZA 3N5OA 3O3TA 1TK8B 1YQ1A 3F63A 3P90A 2O89A 1S4BP 2H0IA 1PL1A 2FUG2 5ECKB 1SVOA 5DALA 2AUVA 3KM6A 4FH8A 4JR6A 1XWCA 4PNGA 4PURA 5DQSA 1QQ2A 3TKSE 2FHEA 1GLQA 4MJBA 1QGVA 4MABA 2B3SA 1X5CA 5G1KA 2EFDA 2OA7A 1GNEA 1N8JA 1THXA 3HJMA 4GSTA 2AAWA 1BEDA 2HFDA 3L9SA 3UBKA 3DD3A 3KMOA 4K8MA 1OE7A 3TRQA 2VLTA 3ZVJD 3DYRA 1VRSD 3EE2A 4EL1A 1Z5YE 3FMWA 2WW3A 1XOBA 3D4TA 3F0IA 3MSZA 2GLRA 2O36A 4K2XA 4TOPA 3GN3A 3UEMA 4FYCA 1T8EB 4HQZA 4KB3A 2PPTA 5H5RA 1PMTA 1BG5A 1SVMA 3MAKA 4O92A 1AQWA 4PQIA 4ZB8A 2L4CA 1U87A 2TRXA 5GSTA 1A2LA 2B1LA 4USSA 1XOAA 3KP9A 3PINA 2C4JA 4FO5A 1K0BA 1YEWC 4IQ1A 2EFHA 2Z9SA 1ML6A 3O76A 2K18A 1LJRA 3WD6A 2R37A 3E0UA 2FWGA 4PTSA 1M3IA 4E8EA 4EO3A 3KD0A 1Y1UA 5D93A 1G6YA 2DC5A 5CO3A 4MF7A 4HZ4A 2OE1A 4BVYB 17GSA 1FW1A 4MH2A 1I5GA 5H5QA 2LRCA 4ZB6A 1CQHA 4IS0A 2OT3A 4TR3A 1PGTA 6GSVA 3UAPA 1THOA 2JADA 1YVLA 5DDLA 3KTLA 2DIZA 3VPQA 1EWXA 1B9XC 2CAQA 1V40A 2WVZA 3IR4A 1GSUA 3PH9A 4AGSA 1K0DA 5GSSA 3LW9A 3WYWA 6GSSA 1TRSA 5B7CA 3F8UA 1F2EA 4WEYA 4F0CA 2B7KA 5A1NA 4O5RA 4MH3A 2YPMA 2D2ZA 2WS2A 5D73A 2NDOA 1RQMA 4TR4A 1TU7A 3UBLA 2WVYA 3TDGA 2XBQA 2REMA 3P2AA 3H4KA 1NHOA 3FHKA 2LKUA 3LYKA 1K3YA 2GVPA 4ZB9A 4IQAA 2VUPA 5E59A 3VPTA 2IJYA 1TJDA 1QFNA 5IIZA 3DRNA 5J4UA 5HR1A 3GFKA 1BQ7A 4V1Ag 1PN0A 1DUGA 1E6BA 2C0DA 3IK9A 4D73A 4WF5A 3D4MA 2HT9A 5DCGA 2VD0A 3GL5A 2HSNA 2YJHA 2YWMA 4HU7A 3ZTLA 3CWGA 4YKGA 5F06A 3APQA 5J40A 4ECCA 1ZMAA 1SJZA 2IPAA 3GKNA 1JZOA 4TR1A 3QFAC 4ICYA 3ME8A 4PXOA 4GQFA 3GKMA 3QD9A 2LJKA 3GMFA 5A4UA 3TCOA 3QR6A 4MZCA 2UV8G 1AUCA 1O73A 1R4WA 3CRTA 3DIEA 3KIJA 2WFCA 2X8GA 2CX4A 3IHQA 3D21A 4NV5A 2PU9C 3EU4A 2HZEB 5D9WA 1GP1A 3ZLPA 1Q4JA 1FOVA 2H01A 1OC9B 2NTOA 3H1NA 4FXYP 4DSSB 3R3EA 1YF0A 3WT1A 2LRTA 2YNXA 4AKGA 3BJ5A 1KBNA 1OYJA 3QPMA 1PQNA 3W8SA 9GSSA 2WRTA 5IMCA 1M2BA 4V1Ap 3A2VA 4NHWA 2YANA 2NVLA 1B4PA 5H5SA 3E3EA 4FIWA 1EP7A 4KGIA 3RAZA 2X99A 3Q6OA 4F03A 1O7UA 1DE1A 3TOTA 5IQYA 1GUKA 3QAGA 2GQKA 1YY7A 2PGTA 4K7IA 2KP2A 5COHA 2LSTA 5FHIA 1XPVA 4TXOB 4E8HA 3KH7A 1GLPA 1TXUA 4O5QA 1TDIA 3H8QA 1ON4A 3ERWA 4K1FA 1RW1A 3G7YA 3UIWA 1MD3A 2JZRA 3BBYA 2B5YA 4ID0A 3IV4A 2DKIA 1GSSA 2XPEA 2F3MA 1ZZYA 4TRXA 2YWNA 2MBSA 3EU3A 4PQHA 3TU3B 2R5GA 3TJFA 3FZ9A 4PUAA 4OCFA 4HDEA 1GTIA 3MWHA 4K7NA 3APOA 5JWQB 1A8LA 3UVTA 2V6OA 4RI7A 1XWAA 2WW0A 1PKZA 3VI7A 3F9UA 1CQGA 1AQVA 1EEJA 4AJ8A 1MDJA 1K0CA 4AKHA 3HCZA 1XW6A 2V41A 4PI0C 1SKSB 2H6YA 3FK8A 3RPNA 3M1GA 5JWRB 3DMLA 4IW9A 1BYEA 4N3ZA 5KN2A 1U6TA 3LSZA 1LBKA 2QSIA 2R0GA 2DJ3A 1ZYEA 4HI7A 2MMAA 2H66A 4K9ZA 1TXXA 4MDCA 3BOAA 2EIOA 3W6GA 1U88A 2LJRA 2CX3A 4KH7A 2VCTA 1V57A 4CY8A 5L71A 1URMA 1WOUA 5J4VA 2HSMA 2YOIA 4K0NA 4LMWA 2BMXA 4I5QA 1MTCA 3F4TA 4LMVA 5ECQB 6GSUA 3VWWA 3F6DA 4G01A 5AIXA 5ECIB 4Q5RA 1VF2A 3LEFA 3S9FA 4ML1A 4F0BA 2M80A 5KEJA 2GT5A 2YWIA 1OC3A 1TU8A 2R0PA 4F2IA 2I4AA 1XW5A 1EOGA 3C1SA 1EZKA 2A4HA 1YF1A 3BD2A 4PX1A 1X0RA 2DLXA 2NBSA 1S3AA 2UZ8A 4BVXA 3PR8A 4EUYA 1SK0A 4BWSA 5J41A 4X43A 3CXGA 5CREA 3I6AA 1KNGA 1T3BA 1SL1B 1WP0A 3C7MA 3ME7A 3LORA 2LTKA 5GZZB 2LNTA 1BJXA 8GSSA 3SWLA 2C0FA 2CVDA 2ES7A 3IE3A 6GSYA 5CRWA 3TJBA 2JSYA 3CQFA 1F6MC 5AIVA 2GZPA 1M2AA 4HU9A 3ERFA 2J9HA 4POBA 5IMVA 4F9ZA 1H4OA 4I8BA 4YQVA 4QQ7A 3QFBC 5J9CA 2AYTA 4XRDA 5CRDA 2K9FA 3V1WA 4JE1A 2EC4A 2DJ1A 3HVXA 3CBUA 4HEA2 2IMKA 4TVEA 1GTUA 5F05A 3F4RA 3GTUA 1M99A 5DBQA 5D9TA 1XFLA 1UA5A 3WT2A 2YJ7A 4G9HA 3ZMKA 2H1DA 3EVIA 1Y6EA 2WGRA 2GQLA 1Z7RA 2QA2A 2GZYA 1MDKA 1WWJA 3TKSA 1XWBA 4RUVA 2H1LA 2WULA 2H1BA 2MMZA 1SKRB 3VWVA 3CSIA 13GSA 5G1LA 2JZSA 3HZ8A 3NZNA 2YV7A 3ERGA 2AJQB 4KX4A 1TK5B 4EXJA 3IRAA 4KDUA 2CVKA 3AY8A 1OAZA 1HQOA 1VGLA 2PMTA 3NIVA 4PNFA 3SBCA 4ULXA 3WGXA 4AF2A 1TP9A 3KH9A 5A1NB 4ZL8A 3IK7A 2BTOT 1FB6A 1O85A 4DSQA 4OCEA 1YDKA 3GYKA 2V1MA 3HZ4A 1X9WB 1GWCA 2OJLA 2QGVA 2EIRA 2O7KA 3FR3A 4WBJA 2MYGA 1ERTA 3G7IA 3LJRA 4N0VA 2PN8A 2AB6A 1AXDA 2R6KA 3GUSA 4MF5A 2DJJA 4XHMA 4MJAA 3LFLA 1GUMA 2GSRA 3CMIA 2EFCA 2JSZA 5C04A 4MZWA 4HOJA 4D73B 1LU4A 1WJKA 2V6KA 2A2SA 2RUFA 1A24A 2IFQB 4EC0A 1PKWA 2L5OA 2HSNB 2WZ9A 1XG8A 4GWRA 4IBPA 3PPUA 4X1UA 4AI6A 2FWEA 2HE3A 4TR1B 5ECSA 2TRCP 2N5AA 2L57A 4HZ2A 1BX9A 3WGEA 2NPBA 2H8LA 5G30A 1YJ6A 2H73A 1GSEA 2VM2A 4G0KA 5G31A 3EWLA 4V2MA 2GSSA 4MPGA 1JZWA 1WMJA 1SU9A 1UN2A 1XCCA 2CT6A 2IMEA 2C0EA 4MNNA 2OBIA 2GZZA 5CRHA 4POMA 5IPHA 4YKFA 3KGKA 2HYXA 3L9VA 4DSRA 1Z6NA 1XBSA 2FD3A 1NSWA 4RQRA 1N2AA 1K0AA 4Z2TA 4GXZA 2F8FA 4J56E 4ZL7A 2RM5A 3RDWA 2B7JA 2OBKA 4XS4A 3IPZA 3UJ1A 2K8SA 2VL3A 1GSQA 1V9WA 1ZL9A 2O85A 3ED3A 6GSWA 3C8EA 1USBA 3GA4A 3DGQA 3J7Yk 4BWQA 4Z7XA 1GULA 1PX7A 1F3BA 3QOUA 3VWUA 2C8UA 1TRUA 5ELAA 3I69A 1Y25A 5GAPD 2EFEA 6GSTA 2VLUA 1ERUA 5B6NA 3HKRA 5ECRB 4KA0A 3HMJG 3ZREA 5ECPB 1QK8A 2LNSA 3EC3A 3C1RA 2C3NA 2H19A 3LGCA 4L5OA 3KP8A 4PQ1A 5BMUA
chains in the Genus database with same CATH topology
5J3RA 1TTZA 2VCWA 5ABRA 1R26A 3ZIVA 4TXVA 2YWOA 4KSOA 3KCMA 2H6ZA 3IDVA 4EE0A 1FHEA 4OO4A 2AHEA 2FWFA 3EURA 3WGDA 4L0WA 2MMOA 1TK0B 4LL4B 2I1UA 1SJ6A 5HFKA 1X9SB 4K2DA 5F07A 5B6MA 1A2JA 4AJ6A 3ZVJA 3GX0A 4ECJA 4G0IA 3CTGA 4HJ2A 3J7Yb 3HXSA 5AGYA 3IAM2 4IHUA 4F82A 3A5WA 4ZL9A 5F0GA 4J2FA 2B5XA 1F37A 1XW9A 4FYUA 2HSMB 2E7PA 3A3TA 1EP8A 4ISDA 6GSXA 1KTEA 1R5PA 3HJPA 3LXZA 2OE0A 1O8WA 3TB2A 3L4NA 3TUEA 5HR3A 2XBIA 1GSFA 1V98A 3A2XA 3IA1A 2X8HA 2A2PA 2CQ9A 2GS3A 1M0UA 4W66A 2H1GA 4V2LA 3TRXA 1U3AA 1ABAA 1J0FA 3D22A 4E68A 3GRXA 1NM3A 1VF4A 2V2GA 3HDCA 4YAPA 4MZBA 3IOSA 4MMMA 4BVXB 4PUFC 5HR2A 1G7OA 3MDKA 3U6VA 1FVJA 2QKEA 4NMUA 4KCAA 2PUKC 4KAEA 1FG4A 4P3YB 1K0NA 3P8WA 4N0ZA 2OACA 2EIQA 2PERA 5DQYA 2C3QA 2WDUA 2FGXA 1FVKA 2E2MA 3IC4A 2MBTA 1SL2B 2H6XA 2H75A 4ZXGA 1A0FA 2B6MA 2R2JA 2P5RA 3CTFA 4TKYA 2MZCA 3ZZXA 1SK1A 4YQUA 1AIUA 1GRXA 4G2EA 4K0GA 5KN1A 1JLWA 4ZBDA 1AC1A 3D6IA 4KCEA 3QAWA 5ECHB 4IJIA 1PX6A 3F3QA 3HVVA 3TKSC 2VIMA 3GTUB 2DKHA 16GSA 2KP1A 2FA4A 1W4VA 4IKHA 1GNWA 2DMMA 1JZRA 4KW6A 3GL3A 1XWGA 2HZEA 2P5QA 1VF1A 4K5RA 3VURA 3GKKA 4BL7A 3M8NA 4WBRD 2VCXA 4YH2A 1SL0B 2VD1A 4YAVA 4K6XA 1YZXA 2WJUA 1SENA 1A2MA 3I43A 3GHAA 5KN0A 1S3CA 5DALB 1FO5A 2DIYA 1F9MA 1AAZA 4TR0A 1GSDA 4MA9A 1BG1A 3D5JA 3RBTA 1PD21 4WR4A 2FLSA 4XS1A 2RIIA 5A4VA 1T4YA 1SJIA 3LXTA 5CNWA 1ILOA 1XVQA 2VL2C 3KJYA 1YKAA 2TIRA 2GGTA 5E4WA 2C3TA 1OKTA 3K8NA 4TXOA 1JHBA 1SK2A 3M9KA 3IC8A 2IN3A 1ST9A 1HNCA 3GH6A 1WRYA 4QMKA 1DBYA 2LV3A 4LLRA 3F6FA 4ACSA 3EPTA 2B1KA 2CZ2A 1J9BA 1YEPA 2K8VA 5G5FA 14GSA 4JBBA 1N25A 2HRAA 2DJ2A 4QL9A 2OE3A 1IYHA 4H86A 5DVBA 4TW5A 4KUNA 1T4ZA 2IIYA 2CA8A 3BCIA 4QL7A 4HS1A 3TOUA 4K5SA 3GSSA 1X5EA 3ZITA 2H76A 2X49A 1YKCA 2HSYA 5JCUA 3IAS2 4KDXA 4KSMA 1TRWA 5DAKA 1VF3A 1UVZA 4TN8A 4JR4A 5JCGA 3GURA 3TKPA 1AW9A 2OADA 1Z7PA 1U3IA 4OFMA 4IVFA 2DJ0A 1T7PB 4KDYA 4YQMA 4LL1B 1XWKA 3VLNA 1SYRA 3VK9A 1JZDA 2O5VA 2E0QA 5B8AA 5IMDA 3GX8A 5FWGA 4DVCA 4ZBAA 1FOHA 4Z2RA 4L5LA 1XXUA 4EIQA 5HQPA 2CV4A 3US3A 3ZMLA 2I81A 1SYXA 4OO5A 2VOCA 4XCSA 1MDIA 2HZFA 4WF4A 1T00A 3TJGA 3IBHA 4XS4B 2H74A 1X5DA 3UL3A 2GQMA 5IM9A 3LQ7A 3U5RE 5A5HA 1B4QA 4MF6A 3H93A 2LRNA 3ISOA 4OWYA 4EDYA 5ID2A 1IYIA 1EV4A 4OFTA 4LA1A 5DCHA 2P0GA 5ELGA 2JL4A 3FYGA 20GSA 2X4AA 3HYPA 3QDNA 2JACA 5CAXA 3QAVA 2HRKA 2ALBA 3TGZA 1O81A 2ZNMA 4WR5A 3GKXA 4GQCA 1WIKA 3HD5A 1Z6MA 1BAYA 2O8VB 3FY7A 4MK3A 5IOWA 1W89A 3F4SA 1HNAA 1TI3A 2VL2A 3L0HA 1GSYA 2PVOC 1ZGNA 1K0MA 7GSSA 2GSQA 4ZIJA 4HJMA 1HNBA 4X4JA 4CDOA 5BMUB 2FCHA 1GL8A 2IWTA 2CAIA 3RHCA 2RM6A 4WXTA 3DKSA 2HNLA 1O6JA 1X9MB 3CSJA 5ECNB 3JCML 5AISA 3F3RA 12GSA 4GDFA 5ENUA 1MEKA 3QMXA 2IMFA 4FQUA 1ZYNA 1Q98A 2FNOA 5GAND 2M46A 1V58A 2VCVA 3LG6A 4RI6A 3M9JA 2ZCTA 1G6WA 2YCDA 4XIHA 5IMFA 3QCPA 2WB9A 1NW2A 2HQTA 1A8YA 1TKDB 4CY6A 2HSHA 2GDRA 4ZILA 3CRUA 3EMXA 2GSTA 4JZQA 4IP1A 2JU5A 2HLSA 2KHPA 3OR5A 1PSQA 4IP6A 3ZFBA 4G10A 4XS6A 1BF5A 1WE0A 4EF0A 5A34A 1EGOA 4EKZA 4MLYA 3Q19A 1G7EA 4N30A 1OE8A 2DJKA 2H30A 4I97A 2ON7A 4EVMA 4DEJA 2X8CA 2V32A 1M9BA 3HY2A 2I9HA 5LCZA 3O6TA 3MYDA 3TKRA 5EVOA 3HVSA 5G2ZA 1ZYPA 5HR0A 2FWHA 3C73A 5DJMA 3E9JB 2HRNA 2QC7A 5D9VA 2B5EA 2H0GA 2WCIA 1O8XA 3FKFA 2GT6A 2N5FA 2KLXA 1OKDA 3KMNA 1M7TA 4I2TA 3M3MA 4ECBA 19GSA 5J47A 1XZOA 4BA7A 1GTBA 2RLIA 1M2DA 2YV9A 3HJOA 5FT3A 4JEDA 3FR6A 2H71A 3ZRDA 5IPGA 5INYA 3FRCA 2G2QA 3M0FA 3EINA 1T1VA 3FZ5A 3RPPA 5ECLB 3VFIA 2IMDA 2C0GA 3ZL5A 4GRFA 2DMLA 1WPIA 2BJXA 3KTBA 4Q5NA 1MD4A 5F8BA 1ERWA 1K0OA 2LS5A 3PGTA 1S3DA 2F51A 3L9UA 3GH9A 3UVHA 2PBJA 2VKZG 3EYTA 3LWAA 1KEBA 2XPDA 5CP1A 4IN0A 4CW9A 3ZYWA 4MP4A 2L4QA 1DE2A 2IFQA 2L5LA 2A4VA 3N9JA 4IELA 3KEBA 3W8JA 3ZFLA 3DWVA 5BRTA 2VO4A 2G0FA 2LUSA 3G7JA 4O5UA 2X64A 3BCKA 5KOXA 1QUWA 3A5IA 5KN3A 4GLTA 1DSBA 4L8EA 4ZB7A 4BVYA 1EEMA 4O7HA 4GCIA 2YP6A 1R5AA 4AKIA 4G19A 2LQQA 3EMPA 3G9BA 3Q74A 5CYYA 4BL7B 5C00A 1GH2A 4IGJA 4BPYA 5D9XA 1H75A 3FZAA 3HHVA 2N5BA 5IOXA 2VCQA 2J23A 22GSA 3TRPA 3NOFA 2DBCA 4K7OA 2DSAA 1ZOFA 1TRVA 5IMAA 1A0RP 3GIXA 1OC8A 5LD0A 2ON5A 1ZCPA 1TI1A 2GTUA 1E2YA 3UARA 2LQOA 4N10A 5EPFA 2CZ3A 3CSHA 3H79A 1PA3A 1EGRA 2PVQA 2M72A 4G0LA 3UOMA 2YN1A 4ILFA 4KF9A 2PWJA 4MJCA 3ZIJA 3GSTA 1SVLA 11GSA 1PN9A 5AN1A 3DEXA 1YEXA 3TJJA 1PL2A 1UC7A 3FR9A 5HFIA 4Z2UA 5IO2A 2YZUA 5CRGA 2H0HA 3MNGA 1G0TA 4MPFA 3IHGA 5IMZA 4ECIA 4JU5A 3TKQA 2KOKA 2L6DA 3R2QA 1I9DA 1J08A 1FB0A 1NHYA 4WETA 1B9YC 1AQXA 2MMNA 4J57E 1XIYA 1JLVA 1A23A 4XTSA 2F8AA 4ZBBA 4Q5QA 2A2RA 2L6CA 5DAKB 3FZ4A 5D8IA 4OD7A 5ECMB 2HRFA 4I2UA 1GUHA 1QMVA 5A5KA 4GSNA 4MCUA 3A2WA 3KZQA 5JWOB 2OKAA 10GSA 5G5EA 4NWYA 4GF0A 2JZTA 2IL3A 4AKXB 4GTUA 1ACVA 1C72A 4Q5FA 3DVWA 3FW2A 4PGTA 1OC9A 1B8XA 1HYUA 4GSSA 3L78A 5LNKe 4O32A 1OVNA 5JCWA 2VAFA 3D0ZA 3IXRA 5J9BA 4DSSA 5DJLA 2I3YA 4NXIA 2R0CA 4HQSA 1SD9A 1R7HA 3P7XA 2F9SA 1K3LA 1PRXA 3Q18A 4NHZA 1SKWB 5IO0A 4MJEA 2LEGA 5A5HB 2HXKA 5D96A 2QA1A 2CVBA 2VM1A 3MIXA 18GSA 5ID2B 2K6VA 2AV4A 3DXBA 2C80A 3I9V2 4EIPA 2VL9A 1TW9A 2HI7A 2HRKB 2L59A 1F3AA 4XRAA 3TJKA 5J4YA 2ZUPA 4HUAA 1K3OA 4OFNA 2KUCA 4CHSA 2FA8A 3CYNA 5EL8A 2H72A 5ECOB 1HD2A 1SD8A 4A5PA 2O87A 5HFGA 5KOWA 4V2NA 4POKA 2R3XA 1M9AA 4N11A 4POLA 2XC2A 1RK4A 4OMVA 1B48A 2FY6A 3DVXA 2YZHA 1QXHA 4L0UA 1Z3EA 3APSA 5A4WA 4RQXA 3KXOA 2R4VA 3HA9A 4KNDA 4ML6A 1V2AA 2E2GA 2VLVA 1Z9HA 2P31A 4NPBA 5B8BA 1ZYQB 2IMIA 3GNJA 3VI5A 4NV2A 1GTAA 1EV9A 3UMAA 3FEUA 3GV1A 1EOHA 2XHFA 4JRRA 5EY6A 2RUEA 3C71A 4X0XA 1XVWA 2H1AA 2C1YA 1FAAA 4AJ7A 1TOFA 2LJAA 4KE3A 5A34B 4WKWA 1ERVA 3LYPA 1JFUA 2H70A 4I6XA 4NAXA 4EDZA 3VWXA 5J5NA 4FYBA 3RHBA 4IJ3A 2VCZA 3N5OA 3O3TA 1TK8B 1YQ1A 3F63A 3P90A 2O89A 2H0IA 1PL1A 2FUG2 5ECKB 1SVOA 5DALA 2AUVA 3KM6A 4FH8A 4JR6A 1XWCA 4PNGA 4PURA 5DQSA 1QQ2A 3TKSE 2FHEA 1GLQA 4MJBA 1QGVA 4MABA 2B3SA 1X5CA 5G1KA 2EFDA 2OA7A 1GNEA 1N8JA 1THXA 3HJMA 4GSTA 2AAWA 1BEDA 2HFDA 3L9SA 3UBKA 3DD3A 3KMOA 4K8MA 1OE7A 3TRQA 2VLTA 3ZVJD 3DYRA 1VRSD 3EE2A 4EL1A 1Z5YE 3FMWA 1XOBA 3F0IA 3D4TA 3MSZA 2GLRA 4K2XA 4TOPA 3GN3A 3UEMA 4FYCA 1T8EB 4HQZA 4KB3A 2PPTA 5H5RA 1PMTA 1BG5A 1SVMA 3MAKA 4O92A 1AQWA 4PQIA 4ZB8A 2L4CA 1U87A 2TRXA 5GSTA 1A2LA 2B1LA 4USSA 1XOAA 3KP9A 3PINA 2C4JA 4FO5A 1K0BA 4IQ1A 2EFHA 2Z9SA 1ML6A 3O76A 2K18A 1LJRA 3WD6A 2R37A 3E0UA 2FWGA 4PTSA 4E8EA 4EO3A 3KD0A 1Y1UA 5D93A 1G6YA 2DC5A 5CO3A 4MF7A 4HZ4A 2OE1A 4BVYB 17GSA 1FW1A 4MH2A 1I5GA 5H5QA 2LRCA 4ZB6A 1CQHA 4IS0A 2OT3A 4TR3A 1PGTA 6GSVA 3UAPA 1THOA 2JADA 1YVLA 5DDLA 3KTLA 2DIZA 3VPQA 1EWXA 1B9XC 2CAQA 1V40A 3IR4A 1GSUA 3PH9A 4AGSA 1K0DA 5GSSA 3LW9A 3WYWA 6GSSA 1TRSA 5B7CA 3F8UA 1F2EA 4WEYA 4F0CA 2B7KA 5A1NA 4O5RA 4MH3A 2YPMA 2D2ZA 2WS2A 5D73A 2NDOA 1RQMA 4TR4A 1TU7A 3UBLA 3TDGA 2XBQA 2REMA 3P2AA 3H4KA 1NHOA 3FHKA 2LKUA 3LYKA 1K3YA 2GVPA 4ZB9A 4IQAA 2VUPA 5E59A 3VPTA 2IJYA 1TJDA 1QFNA 5IIZA 3DRNA 5J4UA 5HR1A 3GFKA 1BQ7A 4V1Ag 1PN0A 1DUGA 1E6BA 2C0DA 3IK9A 4D73A 4WF5A 3D4MA 2HT9A 5DCGA 2VD0A 3GL5A 2HSNA 2YJHA 2YWMA 4HU7A 3ZTLA 3CWGA 4YKGA 5F06A 3APQA 5J40A 4ECCA 1ZMAA 1SJZA 2IPAA 3GKNA 1JZOA 4TR1A 3QFAC 4ICYA 3ME8A 4PXOA 4GQFA 3GKMA 3QD9A 2LJKA 3GMFA 5A4UA 3TCOA 3QR6A 4MZCA 2UV8G 1AUCA 1O73A 1R4WA 3CRTA 3DIEA 3KIJA 2WFCA 2X8GA 2CX4A 3IHQA 3D21A 4NV5A 2PU9C 3EU4A 2HZEB 5D9WA 1GP1A 3ZLPA 1Q4JA 1FOVA 2H01A 1OC9B 2NTOA 3H1NA 4DSSB 3R3EA 1YF0A 3WT1A 2LRTA 2YNXA 4AKGA 3BJ5A 1KBNA 1OYJA 3QPMA 1PQNA 3W8SA 9GSSA 2WRTA 5IMCA 1M2BA 4V1Ap 3A2VA 4NHWA 2YANA 2NVLA 1B4PA 5H5SA 3E3EA 4FIWA 1EP7A 4KGIA 3RAZA 2X99A 3Q6OA 4F03A 1O7UA 1DE1A 3TOTA 5IQYA 1GUKA 3QAGA 2GQKA 1YY7A 2PGTA 4K7IA 2KP2A 5COHA 2LSTA 5FHIA 1XPVA 4TXOB 4E8HA 3KH7A 1GLPA 1TXUA 4O5QA 1TDIA 3H8QA 1ON4A 3ERWA 4K1FA 1RW1A 3G7YA 3UIWA 1MD3A 2JZRA 3BBYA 2B5YA 4ID0A 3IV4A 2DKIA 1GSSA 2XPEA 2F3MA 1ZZYA 4TRXA 2YWNA 2MBSA 3EU3A 4PQHA 3TU3B 2R5GA 3TJFA 3FZ9A 4PUAA 4OCFA 4HDEA 1GTIA 3MWHA 4K7NA 3APOA 5JWQB 1A8LA 3UVTA 2V6OA 4RI7A 1XWAA 1PKZA 3VI7A 3F9UA 1CQGA 1AQVA 1EEJA 4AJ8A 1MDJA 1K0CA 4AKHA 3HCZA 1XW6A 2V41A 1SKSB 2H6YA 3FK8A 3RPNA 3M1GA 5JWRB 3DMLA 4IW9A 1BYEA 4N3ZA 5KN2A 1U6TA 3LSZA 1LBKA 2QSIA 2R0GA 2DJ3A 1ZYEA 4HI7A 2MMAA 2H66A 4K9ZA 1TXXA 4MDCA 3BOAA 2EIOA 3W6GA 1U88A 2LJRA 2CX3A 4KH7A 2VCTA 1V57A 4CY8A 5L71A 1URMA 1WOUA 5J4VA 2HSMA 2YOIA 4K0NA 4LMWA 2BMXA 4I5QA 1MTCA 3F4TA 4LMVA 5ECQB 6GSUA 3VWWA 3F6DA 4G01A 5AIXA 5ECIB 4Q5RA 1VF2A 3LEFA 3S9FA 4ML1A 4F0BA 2M80A 5KEJA 2GT5A 2YWIA 1OC3A 1TU8A 2R0PA 4F2IA 2I4AA 1XW5A 1EOGA 3C1SA 1EZKA 2A4HA 1YF1A 3BD2A 4PX1A 1X0RA 2DLXA 2NBSA 1S3AA 2UZ8A 4BVXA 3PR8A 4EUYA 1SK0A 4BWSA 5J41A 4X43A 3CXGA 5CREA 3I6AA 1KNGA 1T3BA 1SL1B 1WP0A 3C7MA 3ME7A 3LORA 2LTKA 5GZZB 2LNTA 1BJXA 8GSSA 3SWLA 2C0FA 2CVDA 2ES7A 3IE3A 6GSYA 5CRWA 3TJBA 2JSYA 1F6MC 5AIVA 2GZPA 1M2AA 4HU9A 3ERFA 2J9HA 4POBA 5IMVA 4F9ZA 1H4OA 4I8BA 4YQVA 4QQ7A 3QFBC 5J9CA 2AYTA 4XRDA 5CRDA 2K9FA 3V1WA 4JE1A 2EC4A 2DJ1A 3HVXA 3CBUA 4HEA2 2IMKA 4TVEA 1GTUA 5F05A 3F4RA 3GTUA 1M99A 5DBQA 5D9TA 1XFLA 1UA5A 3WT2A 2YJ7A 4G9HA 3ZMKA 2H1DA 3EVIA 1Y6EA 2WGRA 2GQLA 1Z7RA 2QA2A 2GZYA 1MDKA 1WWJA 3TKSA 1XWBA 4RUVA 2H1LA 2WULA 2H1BA 2MMZA 1SKRB 3VWVA 3CSIA 13GSA 5G1LA 2JZSA 3HZ8A 3NZNA 2YV7A 3ERGA 2AJQB 4KX4A 1TK5B 4EXJA 3IRAA 4KDUA 2CVKA 3AY8A 1OAZA 1HQOA 1VGLA 2PMTA 3NIVA 4PNFA 3SBCA 4ULXA 3WGXA 4AF2A 1TP9A 3KH9A 5A1NB 4ZL8A 3IK7A 2BTOT 1FB6A 1O85A 4DSQA 4OCEA 1YDKA 3GYKA 2V1MA 3HZ4A 1X9WB 1GWCA 2OJLA 2QGVA 2EIRA 2O7KA 3FR3A 4WBJA 2MYGA 1ERTA 3G7IA 3LJRA 4N0VA 2PN8A 2AB6A 1AXDA 2R6KA 3GUSA 4MF5A 2DJJA 4XHMA 4MJAA 3LFLA 1GUMA 2GSRA 3CMIA 2EFCA 2JSZA 5C04A 4MZWA 4HOJA 4D73B 1LU4A 1WJKA 2V6KA 2A2SA 2RUFA 1A24A 2IFQB 4EC0A 1PKWA 2L5OA 2HSNB 2WZ9A 4GWRA 4IBPA 3PPUA 4X1UA 4AI6A 2FWEA 2HE3A 4TR1B 5ECSA 2TRCP 2N5AA 2L57A 4HZ2A 1BX9A 3WGEA 2NPBA 2H8LA 5G30A 1YJ6A 2H73A 1GSEA 2VM2A 4G0KA 5G31A 3EWLA 4V2MA 2GSSA 4MPGA 1JZWA 1WMJA 1SU9A 1UN2A 1XCCA 2CT6A 2IMEA 2C0EA 4MNNA 2OBIA 2GZZA 5CRHA 4POMA 5IPHA 4YKFA 3KGKA 2HYXA 3L9VA 4DSRA 1Z6NA 1XBSA 2FD3A 1NSWA 4RQRA 1N2AA 1K0AA 4Z2TA 4GXZA 2F8FA 4J56E 4ZL7A 2RM5A 3RDWA 2B7JA 2OBKA 4XS4A 3IPZA 3UJ1A 2K8SA 2VL3A 1GSQA 1V9WA 1ZL9A 2O85A 3ED3A 6GSWA 3C8EA 1USBA 3GA4A 3DGQA 3J7Yk 4BWQA 4Z7XA 1GULA 1PX7A 1F3BA 3QOUA 3VWUA 2C8UA 1TRUA 5ELAA 3I69A 1Y25A 5GAPD 2EFEA 6GSTA 2VLUA 1ERUA 5B6NA 3HKRA 5ECRB 4KA0A 3HMJG 3ZREA 5ECPB 1QK8A 2LNSA 3EC3A 3C1RA 2C3NA 2H19A 3LGCA 4L5OA 3KP8A 4PQ1A 5BMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3R A;  1TTZ A;  2VCW A;  5ABR A;  1R26 A;  3ZIV A;  4TXV A;  2YWO A;  4KSO A;  3KCM A;  2H6Z A;  3IDV A;  4EE0 A;  1FHE A;  4OO4 A;  2AHE A;  2FWF A;  3EUR A;  3WGD A;  4L0W A;  2MMO A;  1TK0 B;  4LL4 B;  2I1U A;  1SJ6 A;  5HFK A;  1X9S B;  4K2D A;  5F07 A;  5B6M A;  1A2J A;  4AJ6 A;  3ZVJ A;  3GX0 A;  4ECJ A;  4G0I A;  3CTG A;  4HJ2 A;  3J7Y b;  3HXS A;  5AGY A;  3IAM 2;  4IHU A;  4F82 A;  3A5W A;  4ZL9 A;  5F0G A;  4J2F A;  2B5X A;  1F37 A;  1XW9 A;  4FYU A;  2HSM B;  2E7P A;  3A3T A;  1EP8 A;  4ISD A;  6GSX A;  1KTE A;  1R5P A;  3HJP A;  3LXZ A;  2OE0 A;  1O8W A;  3TB2 A;  3L4N A;  3TUE A;  5HR3 A;  2XBI A;  1GSF A;  1V98 A;  3A2X A;  3IA1 A;  2X8H A;  2CQ9 A;  2GS3 A;  1M0U A;  2H1G A;  4V2L A;  3TRX A;  1U3A A;  1ABA A;  1J0F A;  3D22 A;  3GRX A;  1NM3 A;  1VF4 A;  2V2G A;  3HDC A;  4YAP A;  4MZB A;  3IOS A;  4MMM A;  4BVX B;  4PUF C;  5HR2 A;  1G7O A;  3MDK A;  3U6V A;  1FVJ A;  2QKE A;  4NMU A;  4KCA A;  2PUK C;  4KAE A;  1FG4 A;  4P3Y B;  1K0N A;  3P8W A;  4N0Z A;  2OAC A;  2EIQ A;  2PER A;  5DQY A;  2C3Q A;  2WDU A;  2FGX A;  1FVK A;  2E2M A;  3IC4 A;  2MBT A;  1SL2 B;  2H6X A;  2H75 A;  4ZXG A;  1A0F A;  2B6M A;  2R2J A;  2P5R A;  3CTF A;  4TKY A;  2MZC A;  3ZZX A;  1SK1 A;  4YQU A;  1AIU A;  1GRX A;  4G2E A;  4K0G A;  5KN1 A;  1JLW A;  4ZBD A;  1AC1 A;  3D6I A;  4KCE A;  3QAW A;  5ECH B;  4IJI A;  1PX6 A;  3F3Q A;  3HVV A;  3TKS C;  2VIM A;  3GTU B;  16GS A;  2KP1 A;  2FA4 A;  1W4V A;  4IKH A;  1GNW A;  2DMM A;  1JZR A;  4KW6 A;  3GL3 A;  1XWG A;  2HZE A;  2P5Q A;  1VF1 A;  3VUR A;  3GKK A;  4BL7 A;  3M8N A;  4WBR D;  2VCX A;  4YH2 A;  1SL0 B;  2VD1 A;  4YAV A;  4K6X A;  1YZX A;  2WJU A;  1SEN A;  1A2M A;  3I43 A;  3GHA A;  5KN0 A;  1S3C A;  5DAL B;  1FO5 A;  2DIY A;  1F9M A;  1AAZ A;  4TR0 A;  1GSD A;  4MA9 A;  3D5J A;  3RBT A;  1PD2 1;  4WR4 A;  2FLS A;  4XS1 A;  2RII A;  5A4V A;  1T4Y A;  1SJI A;  3LXT A;  5CNW A;  1ILO A;  1XVQ A;  2VL2 C;  3KJY A;  1YKA A;  2TIR A;  2GGT A;  5E4W A;  2C3T A;  1OKT A;  3K8N A;  4TXO A;  1JHB A;  1SK2 A;  3M9K A;  3IC8 A;  2IN3 A;  1ST9 A;  1HNC A;  3GH6 A;  1WRY A;  1DBY A;  2LV3 A;  4LLR A;  3F6F A;  4ACS A;  2B1K A;  2CZ2 A;  1J9B A;  1YEP A;  2K8V A;  5G5F A;  14GS A;  4JBB A;  2HRA A;  2DJ2 A;  4QL9 A;  2OE3 A;  1IYH A;  4H86 A;  5DVB A;  4TW5 A;  4KUN A;  1T4Z A;  2IIY A;  2CA8 A;  3BCI A;  4QL7 A;  4HS1 A;  3TOU A;  3GSS A;  1X5E A;  3ZIT A;  2H76 A;  1YKC A;  2HSY A;  5JCU A;  3IAS 2;  4KDX A;  4KSM A;  1TRW A;  5DAK A;  1VF3 A;  1UVZ A;  4TN8 A;  4JR4 A;  5JCG A;  3GUR A;  3TKP A;  1AW9 A;  2OAD A;  1Z7P A;  1U3I A;  4OFM A;  4IVF A;  2DJ0 A;  1T7P B;  4KDY A;  4YQM A;  4LL1 B;  1XWK A;  3VLN A;  1SYR A;  3VK9 A;  1JZD A;  2E0Q A;  5B8A A;  5IMD A;  3GX8 A;  5FWG A;  4DVC A;  4ZBA A;  4L5L A;  1XXU A;  5HQP A;  2CV4 A;  3US3 A;  3ZML A;  2I81 A;  1SYX A;  4OO5 A;  2VOC A;  4XCS A;  1MDI A;  2HZF A;  4WF4 A;  1T00 A;  3TJG A;  3IBH A;  4XS4 B;  2H74 A;  1X5D A;  3UL3 A;  2GQM A;  5IM9 A;  3LQ7 A;  3U5R E;  1B4Q A;  4MF6 A;  3H93 A;  2LRN A;  3ISO A;  4OWY A;  4EDY A;  5ID2 A;  1IYI A;  1EV4 A;  4OFT A;  4LA1 A;  5DCH A;  2P0G A;  5ELG A;  2JL4 A;  3FYG A;  20GS A;  3HYP A;  3QDN A;  2JAC A;  5CAX A;  3QAV A;  2HRK A;  2ALB A;  3TGZ A;  1O81 A;  2ZNM A;  4WR5 A;  3GKX A;  4GQC A;  1WIK A;  3HD5 A;  1Z6M A;  1BAY A;  2O8V B;  3FY7 A;  4MK3 A;  5IOW A;  1W89 A;  3F4S A;  1HNA A;  1TI3 A;  2VL2 A;  3L0H A;  1GSY A;  2PVO C;  1ZGN A;  1K0M A;  7GSS A;  2GSQ A;  4ZIJ A;  4HJM A;  1HNB A;  4CDO A;  2FCH A;  1GL8 A;  2IWT A;  2CAI A;  3RHC A;  2RM6 A;  4WXT A;  3DKS A;  2HNL A;  1O6J A;  1X9M B;  3CSJ A;  5ECN B;  3JCM L;  5AIS A;  3F3R A;  12GS A;  5ENU A;  1MEK A;  3QMX A;  2IMF A;  4FQU A;  1Q98 A;  2FNO A;  5GAN D;  2M46 A;  1V58 A;  2VCV A;  3LG6 A;  4RI6 A;  3M9J A;  2ZCT A;  1G6W A;  2YCD A;  4XIH A;  5IMF A;  3QCP A;  2WB9 A;  1NW2 A;  2HQT A;  1A8Y A;  1TKD B;  2HSH A;  2GDR A;  4ZIL A;  3CRU A;  3EMX A;  2GST A;  4JZQ A;  4IP1 A;  2JU5 A;  2HLS A;  2KHP A;  3OR5 A;  1PSQ A;  4IP6 A;  3ZFB A;  4G10 A;  4XS6 A;  1EGO A;  1WE0 A;  4EF0 A;  4EKZ A;  4MLY A;  3Q19 A;  1G7E A;  4N30 A;  1OE8 A;  2DJK A;  2H30 A;  4I97 A;  2ON7 A;  4EVM A;  4DEJ A;  2X8C A;  2V32 A;  1M9B A;  3HY2 A;  2I9H A;  5LCZ A;  3O6T A;  3TKR A;  5EVO A;  3HVS A;  5G2Z A;  5HR0 A;  2FWH A;  3C73 A;  5DJM A;  3E9J B;  2HRN A;  2QC7 A;  5D9V A;  2B5E A;  2H0G A;  2WCI A;  1O8X A;  3FKF A;  2GT6 A;  2N5F A;  2KLX A;  1OKD A;  3KMN A;  1M7T A;  4I2T A;  3M3M A;  4ECB A;  19GS A;  1XZO A;  4BA7 A;  1GTB A;  2RLI A;  1M2D A;  2YV9 A;  3HJO A;  5FT3 A;  4JED A;  3FR6 A;  2H71 A;  3ZRD A;  5IPG A;  5INY A;  3FRC A;  2G2Q A;  3M0F A;  3EIN A;  1T1V A;  3FZ5 A;  3RPP A;  5ECL B;  3VFI A;  2IMD A;  2C0G A;  3ZL5 A;  4GRF A;  2DML A;  1WPI A;  2BJX A;  3KTB A;  4Q5N A;  1MD4 A;  5F8B A;  1ERW A;  1K0O A;  2LS5 A;  3PGT A;  1S3D A;  2F51 A;  3L9U A;  3GH9 A;  3UVH A;  2PBJ A;  3EYT A;  3LWA A;  1KEB A;  2XPD A;  5CP1 A;  4IN0 A;  4CW9 A;  3ZYW A;  4MP4 A;  2L4Q A;  1DE2 A;  2IFQ A;  2L5L A;  2A4V A;  3N9J A;  4IEL A;  3KEB A;  3W8J A;  3ZFL A;  3DWV A;  2VO4 A;  2G0F A;  2LUS A;  3G7J A;  2X64 A;  3BCK A;  1QUW A;  5KN3 A;  4GLT A;  1DSB A;  4L8E A;  4BVY A;  1EEM A;  4O7H A;  4GCI A;  2YP6 A;  1R5A A;  2LQQ A;  4G19 A;  3EMP A;  3G9B A;  3Q74 A;  5CYY A;  4BL7 B;  5C00 A;  1GH2 A;  4IGJ A;  4BPY A;  5D9X A;  1H75 A;  3FZA A;  3HHV A;  2N5B A;  5IOX A;  2VCQ A;  2J23 A;  22GS A;  3TRP A;  3NOF A;  2DBC A;  4K7O A;  2DSA A;  1ZOF A;  1TRV A;  5IMA A;  1A0R P;  3GIX A;  1OC8 A;  5LD0 A;  2ON5 A;  1ZCP A;  1TI1 A;  2GTU A;  1E2Y A;  3UAR A;  2LQO A;  4N10 A;  5EPF A;  2CZ3 A;  3CSH A;  3H79 A;  1PA3 A;  1EGR A;  2PVQ A;  2M72 A;  4G0L A;  3UOM A;  2YN1 A;  4ILF A;  4KF9 A;  2PWJ A;  4MJC A;  3ZIJ A;  3GST A;  11GS A;  1PN9 A;  5AN1 A;  3DEX A;  1YEX A;  3TJJ A;  1PL2 A;  1UC7 A;  3FR9 A;  5HFI A;  5IO2 A;  2YZU A;  5CRG A;  2H0H A;  3MNG A;  1G0T A;  4MPF A;  5IMZ A;  4ECI A;  4JU5 A;  3TKQ A;  2KOK A;  2L6D A;  3R2Q A;  1I9D A;  1J08 A;  1FB0 A;  1NHY A;  4WET A;  1B9Y C;  1AQX A;  2MMN A;  4J57 E;  1XIY A;  1JLV A;  1A23 A;  4XTS A;  2F8A A;  4ZBB A;  4Q5Q A;  2A2R A;  2L6C A;  5DAK B;  3FZ4 A;  5D8I A;  4OD7 A;  5ECM B;  2HRF A;  4I2U A;  1GUH A;  1QMV A;  5A5K A;  4GSN A;  4MCU A;  3A2W A;  3KZQ A;  5JWO B;  2OKA A;  10GS A;  5G5E A;  4NWY A;  4GF0 A;  2JZT A;  2IL3 A;  1ACV A;  4GTU A;  1C72 A;  4Q5F A;  3DVW A;  3FW2 A;  4PGT A;  1OC9 A;  1B8X A;  1HYU A;  4GSS A;  3L78 A;  5LNK e;  4O32 A;  1OVN A;  5JCW A;  2VAF A;  3D0Z A;  3IXR A;  5J9B A;  4DSS A;  5DJL A;  2I3Y A;  4NXI A;  4HQS A;  1SD9 A;  1R7H A;  3P7X A;  2F9S A;  1K3L A;  1PRX A;  3Q18 A;  4NHZ A;  1SKW B;  5IO0 A;  4MJE A;  2LEG A;  2HXK A;  5D96 A;  2CVB A;  2VM1 A;  18GS A;  5ID2 B;  2K6V A;  2AV4 A;  3DXB A;  2C80 A;  3I9V 2;  2VL9 A;  1TW9 A;  2HI7 A;  2HRK B;  2L59 A;  1F3A A;  4XRA A;  3TJK A;  2ZUP A;  4HUA A;  1K3O A;  4OFN A;  2KUC A;  4CHS A;  2FA8 A;  3CYN A;  5EL8 A;  2H72 A;  5ECO B;  1HD2 A;  1SD8 A;  2O87 A;  5HFG A;  4V2N A;  4POK A;  2R3X A;  1M9A A;  4N11 A;  4POL A;  2XC2 A;  1RK4 A;  4OMV A;  1B48 A;  2FY6 A;  3DVX A;  2YZH A;  1QXH A;  4L0U A;  1Z3E A;  3APS A;  5A4W A;  4RQX A;  3KXO A;  2R4V A;  3HA9 A;  4KND A;  4ML6 A;  1V2A A;  2E2G A;  2VLV A;  1Z9H A;  2P31 A;  4NPB A;  5B8B A;  1ZYQ B;  2IMI A;  3GNJ A;  3VI5 A;  4NV2 A;  1GTA A;  1EV9 A;  3UMA A;  3FEU A;  3GV1 A;  1EOH A;  2XHF A;  4JRR A;  5EY6 A;  2RUE A;  3C71 A;  4X0X A;  1XVW A;  2H1A A;  2C1Y A;  1FAA A;  4AJ7 A;  1TOF A;  2LJA A;  4KE3 A;  4WKW A;  1ERV A;  3LYP A;  1JFU A;  2H70 A;  4I6X A;  4NAX A;  4EDZ A;  3VWX A;  5J5N A;  4FYB A;  3RHB A;  4IJ3 A;  2VCZ A;  3N5O A;  3O3T A;  1TK8 B;  1YQ1 A;  3F63 A;  3P90 A;  2O89 A;  2H0I A;  1PL1 A;  2FUG 2;  5ECK B;  5DAL A;  2AUV A;  3KM6 A;  4FH8 A;  4JR6 A;  1XWC A;  4PNG A;  4PUR A;  5DQS A;  1QQ2 A;  3TKS E;  2FHE A;  1GLQ A;  4MJB A;  1QGV A;  4MAB A;  2B3S A;  1X5C A;  5G1K A;  2OA7 A;  1GNE A;  1N8J A;  1THX A;  3HJM A;  4GST A;  2AAW A;  1BED A;  2HFD A;  3L9S A;  3UBK A;  3DD3 A;  3KMO A;  4K8M A;  1OE7 A;  3TRQ A;  2VLT A;  3ZVJ D;  3DYR A;  1VRS D;  3EE2 A;  4EL1 A;  1Z5Y E;  1XOB A;  3F0I A;  3D4T A;  3MSZ A;  2GLR A;  4TOP A;  3GN3 A;  3UEM A;  4FYC A;  1T8E B;  4HQZ A;  4KB3 A;  2PPT A;  5H5R A;  1PMT A;  1BG5 A;  3MAK A;  4O92 A;  1AQW A;  4PQI A;  4ZB8 A;  2L4C A;  1U87 A;  2TRX A;  5GST A;  1A2L A;  2B1L A;  4USS A;  1XOA A;  3KP9 A;  3PIN A;  2C4J A;  4FO5 A;  1K0B A;  4IQ1 A;  2Z9S A;  1ML6 A;  3O76 A;  2K18 A;  1LJR A;  3WD6 A;  2R37 A;  3E0U A;  2FWG A;  4PTS A;  4E8E A;  4EO3 A;  3KD0 A;  5D93 A;  1G6Y A;  2DC5 A;  5CO3 A;  4MF7 A;  4HZ4 A;  2OE1 A;  4BVY B;  17GS A;  1FW1 A;  4MH2 A;  1I5G A;  5H5Q A;  2LRC A;  4ZB6 A;  1CQH A;  4IS0 A;  4TR3 A;  1PGT A;  6GSV A;  3UAP A;  1THO A;  2JAD A;  5DDL A;  3KTL A;  2DIZ A;  3VPQ A;  1EWX A;  1B9X C;  2CAQ A;  1V40 A;  3IR4 A;  1GSU A;  3PH9 A;  4AGS A;  1K0D A;  5GSS A;  3WYW A;  6GSS A;  1TRS A;  5B7C A;  3F8U A;  1F2E A;  4WEY A;  4F0C A;  2B7K A;  4O5R A;  4MH3 A;  2YPM A;  2D2Z A;  2WS2 A;  5D73 A;  2NDO A;  1RQM A;  4TR4 A;  1TU7 A;  3UBL A;  3TDG A;  2XBQ A;  2REM A;  3P2A A;  3H4K A;  1NHO A;  3FHK A;  2LKU A;  3LYK A;  1K3Y A;  2GVP A;  4ZB9 A;  4IQA A;  2VUP A;  5E59 A;  3VPT A;  2IJY A;  1TJD A;  1QFN A;  5IIZ A;  3DRN A;  5J4U A;  5HR1 A;  3GFK A;  1BQ7 A;  4V1A g;  1DUG A;  1E6B A;  2C0D A;  3IK9 A;  4D73 A;  4WF5 A;  3D4M A;  2HT9 A;  5DCG A;  2VD0 A;  3GL5 A;  2YJH A;  2YWM A;  4HU7 A;  3ZTL A;  5F06 A;  3APQ A;  4ECC A;  1ZMA A;  1SJZ A;  2IPA A;  3GKN A;  1JZO A;  4TR1 A;  3QFA C;  3ME8 A;  4PXO A;  4GQF A;  3GKM A;  3QD9 A;  2LJK A;  3GMF A;  5A4U A;  3TCO A;  3QR6 A;  4MZC A;  1AUC A;  1O73 A;  1R4W A;  3CRT A;  3DIE A;  3KIJ A;  2WFC A;  2X8G A;  2CX4 A;  3IHQ A;  3D21 A;  4NV5 A;  2PU9 C;  3EU4 A;  2HZE B;  5D9W A;  1GP1 A;  3ZLP A;  1Q4J A;  1FOV A;  2H01 A;  1OC9 B;  2NTO A;  3H1N A;  4DSS B;  3R3E A;  1YF0 A;  3WT1 A;  2LRT A;  2YNX A;  3BJ5 A;  1KBN A;  1OYJ A;  3QPM A;  1PQN A;  3W8S A;  9GSS A;  2WRT A;  5IMC A;  1M2B A;  4V1A p;  3A2V A;  4NHW A;  2YAN A;  2NVL A;  1B4P A;  5H5S A;  3E3E A;  4FIW A;  1EP7 A;  4KGI A;  3RAZ A;  2X99 A;  3Q6O A;  4F03 A;  1O7U A;  1DE1 A;  3TOT A;  5IQY A;  1GUK A;  3QAG A;  2GQK A;  1YY7 A;  2PGT A;  4K7I A;  2KP2 A;  5COH A;  2LST A;  5FHI A;  1XPV A;  4TXO B;  4E8H A;  3KH7 A;  1GLP A;  1TDI A;  3H8Q A;  1ON4 A;  3ERW A;  4K1F A;  1RW1 A;  3G7Y A;  3UIW A;  1MD3 A;  2JZR A;  3BBY A;  2B5Y A;  4ID0 A;  3IV4 A;  1GSS A;  2XPE A;  2F3M A;  1ZZY A;  4TRX A;  2YWN A;  2MBS A;  3EU3 A;  4PQH A;  2R5G A;  3TJF A;  3FZ9 A;  4PUA A;  4OCF A;  4HDE A;  1GTI A;  3MWH A;  4K7N A;  3APO A;  5JWQ B;  1A8L A;  3UVT A;  2V6O A;  4RI7 A;  1XWA A;  1PKZ A;  3VI7 A;  3F9U A;  1CQG A;  1AQV A;  1EEJ A;  4AJ8 A;  1MDJ A;  1K0C A;  3HCZ A;  1XW6 A;  2V41 A;  1SKS B;  2H6Y A;  3FK8 A;  3RPN A;  3M1G A;  5JWR B;  3DML A;  4IW9 A;  1BYE A;  5KN2 A;  1U6T A;  3LSZ A;  1LBK A;  2QSI A;  2DJ3 A;  1ZYE A;  4HI7 A;  2MMA A;  2H66 A;  4K9Z A;  1TXX A;  4MDC A;  2EIO A;  3BOA A;  3W6G A;  1U88 A;  2LJR A;  2CX3 A;  4KH7 A;  2VCT A;  1V57 A;  5L71 A;  1URM A;  1WOU A;  2HSM A;  2YOI A;  4K0N A;  4LMW A;  2BMX A;  4I5Q A;  1MTC A;  3F4T A;  4LMV A;  5ECQ B;  6GSU A;  3VWW A;  3F6D A;  5AIX A;  5ECI B;  4Q5R A;  1VF2 A;  3LEF A;  3S9F A;  4ML1 A;  4F0B A;  2M80 A;  5KEJ A;  2GT5 A;  2YWI A;  1OC3 A;  1TU8 A;  4F2I A;  2I4A A;  1XW5 A;  1EOG A;  3C1S A;  1EZK A;  1YF1 A;  3BD2 A;  4PX1 A;  1X0R A;  2DLX A;  2NBS A;  1S3A A;  2UZ8 A;  4BVX A;  3PR8 A;  4EUY A;  1SK0 A;  4BWS A;  5J41 A;  4X43 A;  3CXG A;  5CRE A;  3I6A A;  1KNG A;  1T3B A;  1SL1 B;  1WP0 A;  3C7M A;  3ME7 A;  3LOR A;  2LTK A;  5GZZ B;  2LNT A;  1BJX A;  8GSS A;  3SWL A;  2C0F A;  2CVD A;  2ES7 A;  3IE3 A;  6GSY A;  5CRW A;  3TJB A;  2JSY A;  1F6M C;  5AIV A;  2GZP A;  1M2A A;  4HU9 A;  3ERF A;  2J9H A;  4POB A;  5IMV A;  4F9Z A;  1H4O A;  4I8B A;  4YQV A;  4QQ7 A;  3QFB C;  5J9C A;  2AYT A;  4XRD A;  5CRD A;  2K9F A;  3V1W A;  4JE1 A;  2EC4 A;  2DJ1 A;  3HVX A;  3CBU A;  4HEA 2;  2IMK A;  4TVE A;  1GTU A;  5F05 A;  3F4R A;  3GTU A;  1M99 A;  5DBQ A;  5D9T A;  1XFL A;  1UA5 A;  3WT2 A;  2YJ7 A;  4G9H A;  3ZMK A;  2H1D A;  3EVI A;  1Y6E A;  2WGR A;  2GQL A;  1Z7R A;  2GZY A;  1MDK A;  1WWJ A;  3TKS A;  1XWB A;  4RUV A;  2WUL A;  2H1B A;  2MMZ A;  1SKR B;  3VWV A;  3CSI A;  13GS A;  5G1L A;  2JZS A;  3HZ8 A;  3NZN A;  2YV7 A;  3ERG A;  2AJQ B;  4KX4 A;  1TK5 B;  4EXJ A;  3IRA A;  4KDU A;  2CVK A;  3AY8 A;  1OAZ A;  1HQO A;  1VGL A;  2PMT A;  3NIV A;  4PNF A;  3SBC A;  4ULX A;  3WGX A;  4AF2 A;  1TP9 A;  3KH9 A;  4ZL8 A;  3IK7 A;  2BTO T;  1FB6 A;  1O85 A;  4DSQ A;  4OCE A;  1YDK A;  3GYK A;  2V1M A;  3HZ4 A;  1X9W B;  1GWC A;  2OJL A;  2QGV A;  2EIR A;  2O7K A;  3FR3 A;  4WBJ A;  2MYG A;  1ERT A;  3G7I A;  3LJR A;  4N0V A;  2PN8 A;  2AB6 A;  1AXD A;  2R6K A;  3GUS A;  4MF5 A;  2DJJ A;  4XHM A;  4MJA A;  3LFL A;  1GUM A;  2GSR A;  3CMI A;  2JSZ A;  5C04 A;  4MZW A;  4HOJ A;  4D73 B;  1LU4 A;  1WJK A;  2V6K A;  2A2S A;  2RUF A;  1A24 A;  2IFQ B;  4EC0 A;  1PKW A;  2L5O A;  2HSN B;  2WZ9 A;  4GWR A;  4IBP A;  3PPU A;  4X1U A;  2FWE A;  2HE3 A;  4TR1 B;  5ECS A;  2TRC P;  2N5A A;  2L57 A;  4HZ2 A;  1BX9 A;  3WGE A;  2NPB A;  2H8L A;  5G30 A;  1YJ6 A;  2H73 A;  1GSE A;  2VM2 A;  4G0K A;  5G31 A;  3EWL A;  4V2M A;  2GSS A;  4MPG A;  1JZW A;  1WMJ A;  1SU9 A;  1UN2 A;  1XCC A;  2CT6 A;  2IME A;  2C0E A;  2OBI A;  2GZZ A;  5CRH A;  4POM A;  5IPH A;  3KGK A;  2HYX A;  3L9V A;  4DSR A;  1Z6N A;  1XBS A;  2FD3 A;  1NSW A;  4RQR A;  1N2A A;  1K0A A;  4GXZ A;  2F8F A;  4J56 E;  4ZL7 A;  2RM5 A;  3RDW A;  2B7J A;  2OBK A;  4XS4 A;  3IPZ A;  3UJ1 A;  2K8S A;  2VL3 A;  1GSQ A;  1V9W A;  1ZL9 A;  2O85 A;  3ED3 A;  6GSW A;  3C8E A;  1USB A;  3GA4 A;  3DGQ A;  3J7Y k;  4BWQ A;  4Z7X A;  1GUL A;  1PX7 A;  1F3B A;  3QOU A;  3VWU A;  2C8U A;  1TRU A;  5ELA A;  3I69 A;  1Y25 A;  5GAP D;  6GST A;  2VLU A;  1ERU A;  5B6N A;  3HKR A;  4KA0 A;  5ECR B;  3ZRE A;  5ECP B;  1QK8 A;  2LNS A;  3EC3 A;  3C1R A;  2C3N A;  2H19 A;  3LGC A;  4L5O A;  3KP8 A;  4PQ1 A;  5BMU A; 
#chains in the Genus database with same CATH topology
 5J3R A;  1TTZ A;  2WVX A;  2VCW A;  5ABR A;  1R26 A;  3ZIV A;  4TXV A;  2YWO A;  4KSO A;  3KCM A;  2H6Z A;  3IDV A;  4EE0 A;  1FHE A;  4OO4 A;  2AHE A;  2FWF A;  3EUR A;  1PFO A;  3WGD A;  4L0W A;  2MMO A;  1TK0 B;  4LL4 B;  4PHZ C;  2I1U A;  1SJ6 A;  5HFK A;  1X9S B;  4K2D A;  5F07 A;  5B6M A;  1A2J A;  4AJ6 A;  3ZVJ A;  3GX0 A;  4ECJ A;  4G0I A;  3CTG A;  4HJ2 A;  3J7Y b;  3HXS A;  5AGY A;  3IAM 2;  4IHU A;  4F82 A;  3A5W A;  4ZL9 A;  5F0G A;  4J2F A;  2B5X A;  1F37 A;  1XW9 A;  4FYU A;  2HSM B;  2E7P A;  3A3T A;  1EP8 A;  4ISD A;  6GSX A;  1KTE A;  1R5P A;  3HJP A;  3LXZ A;  2OE0 A;  1O8W A;  3TB2 A;  3L4N A;  3TUE A;  5HR3 A;  2XBI A;  1GSF A;  1V98 A;  3A2X A;  3IA1 A;  2X8H A;  2A2P A;  4HSC X;  2CQ9 A;  2GS3 A;  1M0U A;  4W66 A;  2H1G A;  4V2L A;  3TRX A;  1U3A A;  1ABA A;  1J0F A;  3D22 A;  4E68 A;  3GRX A;  1NM3 A;  1VF4 A;  2V2G A;  3HDC A;  4YAP A;  4MZB A;  3IOS A;  4MMM A;  4BVX B;  4PUF C;  5HR2 A;  1G7O A;  3MDK A;  3U6V A;  1FVJ A;  2QKE A;  4NMU A;  4KCA A;  2PUK C;  4KAE A;  1FG4 A;  4P3Y B;  1K0N A;  3P8W A;  4N0Z A;  2OAC A;  2EIQ A;  2PER A;  5DQY A;  2C3Q A;  2WDU A;  2WZS A;  2FGX A;  1FVK A;  2E2M A;  3IC4 A;  3RFR C;  2MBT A;  1SL2 B;  2H6X A;  2H75 A;  4ZXG A;  1A0F A;  2B6M A;  2R2J A;  2P5R A;  3CTF A;  4TKY A;  2MZC A;  3ZZX A;  1SK1 A;  4YQU A;  1AIU A;  1GRX A;  4G2E A;  4K0G A;  5KN1 A;  1JLW A;  4ZBD A;  1AC1 A;  3D6I A;  4KCE A;  3QAW A;  5ECH B;  4IJI A;  1PX6 A;  3F3Q A;  3HVV A;  3TKS C;  2VIM A;  3GTU B;  2DKH A;  16GS A;  2KP1 A;  2FA4 A;  1W4V A;  4IKH A;  1GNW A;  2DMM A;  1JZR A;  4KW6 A;  3GL3 A;  1XWG A;  2HZE A;  2P5Q A;  1VF1 A;  4K5R A;  3VUR A;  3GKK A;  4BL7 A;  3M8N A;  4WBR D;  2VCX A;  4YH2 A;  1SL0 B;  2VD1 A;  4YAV A;  4K6X A;  1YZX A;  2WJU A;  1SEN A;  1A2M A;  3I43 A;  3GHA A;  5KN0 A;  1S3C A;  5DAL B;  1FO5 A;  2DIY A;  1F9M A;  1AAZ A;  4TR0 A;  1GSD A;  4MA9 A;  1BG1 A;  3D5J A;  3RBT A;  1PD2 1;  4WR4 A;  2FLS A;  4XS1 A;  2RII A;  5A4V A;  1T4Y A;  1SJI A;  3LXT A;  5CNW A;  1ILO A;  1XVQ A;  2VL2 C;  3KJY A;  1YKA A;  2TIR A;  2GGT A;  5E4W A;  2C3T A;  1OKT A;  3K8N A;  4TXO A;  1JHB A;  1SK2 A;  3M9K A;  3IC8 A;  2IN3 A;  1ST9 A;  1HNC A;  3GH6 A;  1WRY A;  4QMK A;  1DBY A;  2LV3 A;  4LLR A;  3F6F A;  4ACS A;  3EPT A;  2B1K A;  2CZ2 A;  1J9B A;  1YEP A;  2K8V A;  5G5F A;  14GS A;  4JBB A;  1N25 A;  2HRA A;  2DJ2 A;  4QL9 A;  2OE3 A;  1IYH A;  4H86 A;  5DVB A;  4TW5 A;  4KUN A;  1T4Z A;  2IIY A;  2CA8 A;  3BCI A;  4QL7 A;  4HS1 A;  3TOU A;  4K5S A;  3GSS A;  1X5E A;  3ZIT A;  2H76 A;  2X49 A;  1YKC A;  2HSY A;  5JCU A;  3IAS 2;  4KDX A;  4KSM A;  1TRW A;  5DAK A;  1VF3 A;  1UVZ A;  4TN8 A;  4JR4 A;  5JCG A;  3GUR A;  3TKP A;  1AW9 A;  2OAD A;  1Z7P A;  1U3I A;  4OFM A;  4IVF A;  2DJ0 A;  1T7P B;  4KDY A;  4YQM A;  4LL1 B;  1XWK A;  3VLN A;  1SYR A;  3VK9 A;  1JZD A;  2O5V A;  2E0Q A;  5B8A A;  5IMD A;  3GX8 A;  5FWG A;  4DVC A;  4ZBA A;  1FOH A;  4Z2R A;  4L5L A;  1XXU A;  4EIQ A;  5HQP A;  2CV4 A;  3US3 A;  4BIK A;  3ZML A;  2I81 A;  1SYX A;  4OO5 A;  2VOC A;  4XCS A;  2O3E A;  1MDI A;  2HZF A;  4WF4 A;  1T00 A;  3TJG A;  3IBH A;  4XS4 B;  2H74 A;  1X5D A;  3UL3 A;  2GQM A;  5IM9 A;  3LQ7 A;  3U5R E;  5A5H A;  1B4Q A;  4MF6 A;  3H93 A;  2LRN A;  3ISO A;  4OWY A;  4EDY A;  5ID2 A;  1IYI A;  1EV4 A;  4OFT A;  4LA1 A;  5DCH A;  2P0G A;  5ELG A;  2JL4 A;  3FYG A;  20GS A;  2X4A A;  3HYP A;  3QDN A;  2JAC A;  5CAX A;  3QAV A;  2HRK A;  2ALB A;  3TGZ A;  1O81 A;  2ZNM A;  4WR5 A;  3GKX A;  4GQC A;  1WIK A;  3HD5 A;  1Z6M A;  1BAY A;  2O8V B;  3FY7 A;  4MK3 A;  5IOW A;  1W89 A;  3F4S A;  1HNA A;  1TI3 A;  2VL2 A;  3L0H A;  1GSY A;  2PVO C;  1ZGN A;  1K0M A;  7GSS A;  2GSQ A;  4ZIJ A;  4HJM A;  1HNB A;  4X4J A;  4CDO A;  5BMU B;  2FCH A;  1GL8 A;  2IWT A;  2CAI A;  3RHC A;  2RM6 A;  4WXT A;  3DKS A;  2HNL A;  1O6J A;  1X9M B;  3CSJ A;  5ECN B;  2WVX B;  5AIS A;  3F3R A;  3JCM L;  12GS A;  4GDF A;  5ENU A;  1MEK A;  3QMX A;  1S3R A;  2IMF A;  4FQU A;  1ZYN A;  1Q98 A;  2FNO A;  5GAN D;  2M46 A;  1V58 A;  2VCV A;  3LG6 A;  4RI6 A;  3M9J A;  2ZCT A;  1G6W A;  2YCD A;  4XIH A;  5IMF A;  3QCP A;  2WB9 A;  1NW2 A;  2HQT A;  1A8Y A;  1TKD B;  4CY6 A;  2HSH A;  2GDR A;  4ZIL A;  3CRU A;  3EMX A;  2GST A;  4JZQ A;  4IP1 A;  2JU5 A;  2HLS A;  2KHP A;  3OR5 A;  1PSQ A;  4IP6 A;  3ZFB A;  4G10 A;  4XS6 A;  1BF5 A;  1WE0 A;  4EF0 A;  5A34 A;  1EGO A;  4EKZ A;  4MLY A;  3Q19 A;  1G7E A;  4N30 A;  1OE8 A;  2DJK A;  2H30 A;  4I97 A;  2ON7 A;  4EVM A;  4DEJ A;  2X8C A;  2V32 A;  1M9B A;  3HY2 A;  2I9H A;  5LCZ A;  3O6T A;  3MYD A;  3TKR A;  5EVO A;  3HVS A;  5G2Z A;  1ZYP A;  5HR0 A;  2FWH A;  3C73 A;  5DJM A;  3E9J B;  2HRN A;  2QC7 A;  5D9V A;  2B5E A;  2H0G A;  2WCI A;  1O8X A;  3FKF A;  2GT6 A;  2N5F A;  2KLX A;  1OKD A;  3KMN A;  1M7T A;  4I2T A;  3M3M A;  4ECB A;  19GS A;  5J47 A;  1XZO A;  4BA7 A;  1GTB A;  2RLI A;  1M2D A;  2YV9 A;  3HJO A;  5FT3 A;  4JED A;  3FR6 A;  2H71 A;  3ZRD A;  5IPG A;  5INY A;  3FRC A;  2G2Q A;  3M0F A;  3EIN A;  1T1V A;  3FZ5 A;  3RPP A;  5ECL B;  3VFI A;  2IMD A;  2C0G A;  3ZL5 A;  4GRF A;  2DML A;  1WPI A;  2BJX A;  3KTB A;  4Q5N A;  1MD4 A;  5F8B A;  1ERW A;  1K0O A;  2LS5 A;  3PGT A;  1S3D A;  2F51 A;  3L9U A;  3GH9 A;  3UVH A;  2PBJ A;  2VKZ G;  3EYT A;  3LWA A;  1KEB A;  2XPD A;  5CP1 A;  4IN0 A;  4CW9 A;  3ZYW A;  4MP4 A;  2L4Q A;  1DE2 A;  2IFQ A;  2L5L A;  2A4V A;  3N9J A;  4IEL A;  3KEB A;  3W8J A;  3ZFL A;  3DWV A;  5BRT A;  2VO4 A;  2G0F A;  2LUS A;  3G7J A;  4O5U A;  2X64 A;  1M3J A;  3BCK A;  5KOX A;  1QUW A;  3A5I A;  5KN3 A;  4GLT A;  1DSB A;  4L8E A;  4ZB7 A;  4BVY A;  1EEM A;  4O7H A;  4GCI A;  2YP6 A;  1R5A A;  4AKI A;  4G19 A;  2LQQ A;  3EMP A;  3G9B A;  3Q74 A;  5CYY A;  4BL7 B;  5C00 A;  1GH2 A;  4IGJ A;  4BPY A;  5D9X A;  1H75 A;  3FZA A;  3HHV A;  2N5B A;  5IOX A;  2VCQ A;  2J23 A;  22GS A;  3TRP A;  3NOF A;  2DBC A;  4K7O A;  2DSA A;  1ZOF A;  1TRV A;  5IMA A;  1A0R P;  3GIX A;  1OC8 A;  5LD0 A;  2ON5 A;  1ZCP A;  1TI1 A;  2GTU A;  1E2Y A;  3UAR A;  2LQO A;  4N10 A;  5EPF A;  2CZ3 A;  3CSH A;  3H79 A;  1PA3 A;  1EGR A;  2PVQ A;  2M72 A;  4G0L A;  3UOM A;  2YN1 A;  4ILF A;  4KF9 A;  2PWJ A;  4MJC A;  3ZIJ A;  3GST A;  1SVL A;  11GS A;  1PN9 A;  5AN1 A;  3DEX A;  1YEX A;  3TJJ A;  1PL2 A;  1UC7 A;  3FR9 A;  5HFI A;  4Z2U A;  5IO2 A;  2YZU A;  5CRG A;  2H0H A;  3MNG A;  1G0T A;  4MPF A;  3IHG A;  5IMZ A;  4ECI A;  4JU5 A;  3TKQ A;  2KOK A;  2L6D A;  3R2Q A;  1I9D A;  1J08 A;  1FB0 A;  1NHY A;  4WET A;  1B9Y C;  1AQX A;  2MMN A;  4J57 E;  1XIY A;  1JLV A;  1A23 A;  4XTS A;  2F8A A;  4ZBB A;  4Q5Q A;  2A2R A;  2L6C A;  5DAK B;  3RGB C;  3FZ4 A;  5D8I A;  4OD7 A;  5ECM B;  2HRF A;  4I2U A;  1GUH A;  1QMV A;  5A5K A;  4GSN A;  4MCU A;  3A2W A;  3KZQ A;  5JWO B;  2OKA A;  10GS A;  5G5E A;  4NWY A;  4GF0 A;  2JZT A;  1I1I P;  2IL3 A;  4AKX B;  4GTU A;  1ACV A;  1C72 A;  4Q5F A;  3DVW A;  3FW2 A;  4PGT A;  1OC9 A;  1B8X A;  1HYU A;  4GSS A;  3L78 A;  5LNK e;  4O32 A;  1OVN A;  5JCW A;  2VAF A;  3D0Z A;  3IXR A;  5J9B A;  4DSS A;  5DJL A;  2I3Y A;  4NXI A;  2R0C A;  4HQS A;  1SD9 A;  1R7H A;  3P7X A;  2F9S A;  1K3L A;  1PRX A;  3Q18 A;  2WW1 A;  4NHZ A;  1SKW B;  5IO0 A;  4MJE A;  2LEG A;  5A5H B;  2HXK A;  5D96 A;  2QA1 A;  2CVB A;  2VM1 A;  3MIX A;  18GS A;  5ID2 B;  2K6V A;  2AV4 A;  3DXB A;  2C80 A;  3I9V 2;  4EIP A;  2VL9 A;  1TW9 A;  2HI7 A;  2HRK B;  3CHX C;  2L59 A;  1F3A A;  4XRA A;  3TJK A;  5J4Y A;  2ZUP A;  4HUA A;  1K3O A;  4OFN A;  2KUC A;  4CHS A;  2FA8 A;  3CYN A;  5EL8 A;  2H72 A;  5ECO B;  1HD2 A;  1SD8 A;  4A5P A;  2O87 A;  5HFG A;  5KOW A;  4V2N A;  4POK A;  2R3X A;  1M9A A;  4N11 A;  4PI2 C;  4POL A;  2XC2 A;  1RK4 A;  4OMV A;  1B48 A;  2FY6 A;  3DVX A;  2YZH A;  1QXH A;  4L0U A;  1Z3E A;  3APS A;  5A4W A;  4RQX A;  3KXO A;  2R4V A;  3HA9 A;  2WW2 A;  4KND A;  4ML6 A;  1V2A A;  2E2G A;  2VLV A;  1Z9H A;  2P31 A;  4NPB A;  5B8B A;  1ZYQ B;  2IMI A;  3HVN A;  3GNJ A;  3VI5 A;  4NV2 A;  1GTA A;  1EV9 A;  3UMA A;  3FEU A;  3GV1 A;  1EOH A;  2XHF A;  4JRR A;  5EY6 A;  2RUE A;  3C71 A;  4X0X A;  1XVW A;  2H1A A;  2C1Y A;  1FAA A;  4AJ7 A;  1TOF A;  2LJA A;  4KE3 A;  5A34 B;  4WKW A;  1ERV A;  3LYP A;  1JFU A;  2H70 A;  4I6X A;  4NAX A;  4EDZ A;  3VWX A;  5J5N A;  4FYB A;  3RHB A;  4IJ3 A;  2VCZ A;  3N5O A;  3O3T A;  1TK8 B;  1YQ1 A;  3F63 A;  3P90 A;  2O89 A;  1S4B P;  2H0I A;  1PL1 A;  2FUG 2;  5ECK B;  1SVO A;  5DAL A;  2AUV A;  3KM6 A;  4FH8 A;  4JR6 A;  1XWC A;  4PNG A;  4PUR A;  5DQS A;  1QQ2 A;  3TKS E;  2FHE A;  1GLQ A;  4MJB A;  1QGV A;  4MAB A;  2B3S A;  1X5C A;  5G1K A;  2EFD A;  2OA7 A;  1GNE A;  1N8J A;  1THX A;  3HJM A;  4GST A;  2AAW A;  1BED A;  2HFD A;  3L9S A;  3UBK A;  3DD3 A;  3KMO A;  4K8M A;  1OE7 A;  3TRQ A;  2VLT A;  3ZVJ D;  3DYR A;  1VRS D;  3EE2 A;  4EL1 A;  1Z5Y E;  3FMW A;  2WW3 A;  1XOB A;  3D4T A;  3F0I A;  3MSZ A;  2GLR A;  2O36 A;  4K2X A;  4TOP A;  3GN3 A;  3UEM A;  4FYC A;  1T8E B;  4HQZ A;  4KB3 A;  2PPT A;  5H5R A;  1PMT A;  1BG5 A;  1SVM A;  3MAK A;  4O92 A;  1AQW A;  4PQI A;  4ZB8 A;  2L4C A;  1U87 A;  2TRX A;  5GST A;  1A2L A;  2B1L A;  4USS A;  1XOA A;  3KP9 A;  3PIN A;  2C4J A;  4FO5 A;  1K0B A;  1YEW C;  4IQ1 A;  2EFH A;  2Z9S A;  1ML6 A;  3O76 A;  2K18 A;  1LJR A;  3WD6 A;  2R37 A;  3E0U A;  2FWG A;  4PTS A;  1M3I A;  4E8E A;  4EO3 A;  3KD0 A;  1Y1U A;  5D93 A;  1G6Y A;  2DC5 A;  5CO3 A;  4MF7 A;  4HZ4 A;  2OE1 A;  4BVY B;  17GS A;  1FW1 A;  4MH2 A;  1I5G A;  5H5Q A;  2LRC A;  4ZB6 A;  1CQH A;  4IS0 A;  2OT3 A;  4TR3 A;  1PGT A;  6GSV A;  3UAP A;  1THO A;  2JAD A;  1YVL A;  5DDL A;  3KTL A;  2DIZ A;  3VPQ A;  1EWX A;  1B9X C;  2CAQ A;  1V40 A;  2WVZ A;  3IR4 A;  1GSU A;  3PH9 A;  4AGS A;  1K0D A;  5GSS A;  3LW9 A;  3WYW A;  6GSS A;  1TRS A;  5B7C A;  3F8U A;  1F2E A;  4WEY A;  4F0C A;  2B7K A;  5A1N A;  4O5R A;  4MH3 A;  2YPM A;  2D2Z A;  2WS2 A;  5D73 A;  2NDO A;  1RQM A;  4TR4 A;  1TU7 A;  3UBL A;  2WVY A;  3TDG A;  2XBQ A;  2REM A;  3P2A A;  3H4K A;  1NHO A;  3FHK A;  2LKU A;  3LYK A;  1K3Y A;  2GVP A;  4ZB9 A;  4IQA A;  2VUP A;  5E59 A;  3VPT A;  2IJY A;  1TJD A;  1QFN A;  5IIZ A;  3DRN A;  5J4U A;  5HR1 A;  3GFK A;  1BQ7 A;  4V1A g;  1PN0 A;  1DUG A;  1E6B A;  2C0D A;  3IK9 A;  4D73 A;  4WF5 A;  3D4M A;  2HT9 A;  5DCG A;  2VD0 A;  3GL5 A;  2HSN A;  2YJH A;  2YWM A;  4HU7 A;  3ZTL A;  3CWG A;  4YKG A;  5F06 A;  3APQ A;  5J40 A;  4ECC A;  1ZMA A;  1SJZ A;  2IPA A;  3GKN A;  1JZO A;  4TR1 A;  3QFA C;  4ICY A;  3ME8 A;  4PXO A;  4GQF A;  3GKM A;  3QD9 A;  2LJK A;  3GMF A;  5A4U A;  3TCO A;  3QR6 A;  4MZC A;  2UV8 G;  1AUC A;  1O73 A;  1R4W A;  3CRT A;  3DIE A;  3KIJ A;  2WFC A;  2X8G A;  2CX4 A;  3IHQ A;  3D21 A;  4NV5 A;  2PU9 C;  3EU4 A;  2HZE B;  5D9W A;  1GP1 A;  3ZLP A;  1Q4J A;  1FOV A;  2H01 A;  1OC9 B;  2NTO A;  3H1N A;  4FXY P;  4DSS B;  3R3E A;  1YF0 A;  3WT1 A;  2LRT A;  2YNX A;  4AKG A;  3BJ5 A;  1KBN A;  1OYJ A;  3QPM A;  1PQN A;  3W8S A;  9GSS A;  2WRT A;  5IMC A;  1M2B A;  4V1A p;  3A2V A;  4NHW A;  2YAN A;  2NVL A;  1B4P A;  5H5S A;  3E3E A;  4FIW A;  1EP7 A;  4KGI A;  3RAZ A;  2X99 A;  3Q6O A;  4F03 A;  1O7U A;  1DE1 A;  3TOT A;  5IQY A;  1GUK A;  3QAG A;  2GQK A;  1YY7 A;  2PGT A;  4K7I A;  2KP2 A;  5COH A;  2LST A;  5FHI A;  1XPV A;  4TXO B;  4E8H A;  3KH7 A;  1GLP A;  1TXU A;  4O5Q A;  1TDI A;  3H8Q A;  1ON4 A;  3ERW A;  4K1F A;  1RW1 A;  3G7Y A;  3UIW A;  1MD3 A;  2JZR A;  3BBY A;  2B5Y A;  4ID0 A;  3IV4 A;  2DKI A;  1GSS A;  2XPE A;  2F3M A;  1ZZY A;  4TRX A;  2YWN A;  2MBS A;  3EU3 A;  4PQH A;  3TU3 B;  2R5G A;  3TJF A;  3FZ9 A;  4PUA A;  4OCF A;  4HDE A;  1GTI A;  3MWH A;  4K7N A;  3APO A;  5JWQ B;  1A8L A;  3UVT A;  2V6O A;  4RI7 A;  1XWA A;  2WW0 A;  1PKZ A;  3VI7 A;  3F9U A;  1CQG A;  1AQV A;  1EEJ A;  4AJ8 A;  1MDJ A;  1K0C A;  4AKH A;  3HCZ A;  1XW6 A;  2V41 A;  4PI0 C;  1SKS B;  2H6Y A;  3FK8 A;  3RPN A;  3M1G A;  5JWR B;  3DML A;  4IW9 A;  1BYE A;  4N3Z A;  5KN2 A;  1U6T A;  3LSZ A;  1LBK A;  2QSI A;  2R0G A;  2DJ3 A;  1ZYE A;  4HI7 A;  2MMA A;  2H66 A;  4K9Z A;  1TXX A;  4MDC A;  3BOA A;  2EIO A;  3W6G A;  1U88 A;  2LJR A;  2CX3 A;  4KH7 A;  2VCT A;  1V57 A;  4CY8 A;  5L71 A;  1URM A;  1WOU A;  5J4V A;  2HSM A;  2YOI A;  4K0N A;  4LMW A;  2BMX A;  4I5Q A;  1MTC A;  3F4T A;  4LMV A;  5ECQ B;  6GSU A;  3VWW A;  3F6D A;  4G01 A;  5AIX A;  5ECI B;  4Q5R A;  1VF2 A;  3LEF A;  3S9F A;  4ML1 A;  4F0B A;  2M80 A;  5KEJ A;  2GT5 A;  2YWI A;  1OC3 A;  1TU8 A;  2R0P A;  4F2I A;  2I4A A;  1XW5 A;  1EOG A;  3C1S A;  1EZK A;  2A4H A;  1YF1 A;  3BD2 A;  4PX1 A;  1X0R A;  2DLX A;  2NBS A;  1S3A A;  2UZ8 A;  4BVX A;  3PR8 A;  4EUY A;  1SK0 A;  4BWS A;  5J41 A;  4X43 A;  3CXG A;  5CRE A;  3I6A A;  1KNG A;  1T3B A;  1SL1 B;  1WP0 A;  3C7M A;  3ME7 A;  3LOR A;  2LTK A;  5GZZ B;  2LNT A;  1BJX A;  8GSS A;  3SWL A;  2C0F A;  2CVD A;  2ES7 A;  3IE3 A;  6GSY A;  5CRW A;  3TJB A;  2JSY A;  3CQF A;  1F6M C;  5AIV A;  2GZP A;  1M2A A;  4HU9 A;  3ERF A;  2J9H A;  4POB A;  5IMV A;  4F9Z A;  1H4O A;  4I8B A;  4YQV A;  4QQ7 A;  3QFB C;  5J9C A;  2AYT A;  4XRD A;  5CRD A;  2K9F A;  3V1W A;  4JE1 A;  2EC4 A;  2DJ1 A;  3HVX A;  3CBU A;  4HEA 2;  2IMK A;  4TVE A;  1GTU A;  5F05 A;  3F4R A;  3GTU A;  1M99 A;  5DBQ A;  5D9T A;  1XFL A;  1UA5 A;  3WT2 A;  2YJ7 A;  4G9H A;  3ZMK A;  2H1D A;  3EVI A;  1Y6E A;  2WGR A;  2GQL A;  1Z7R A;  2QA2 A;  2GZY A;  1MDK A;  1WWJ A;  3TKS A;  1XWB A;  4RUV A;  2H1L A;  2WUL A;  2H1B A;  2MMZ A;  1SKR B;  3VWV A;  3CSI A;  13GS A;  5G1L A;  2JZS A;  3HZ8 A;  3NZN A;  2YV7 A;  3ERG A;  2AJQ B;  4KX4 A;  1TK5 B;  4EXJ A;  3IRA A;  4KDU A;  2CVK A;  3AY8 A;  1OAZ A;  1HQO A;  1VGL A;  2PMT A;  3NIV A;  4PNF A;  3SBC A;  4ULX A;  3WGX A;  4AF2 A;  1TP9 A;  3KH9 A;  5A1N B;  4ZL8 A;  3IK7 A;  2BTO T;  1FB6 A;  1O85 A;  4DSQ A;  4OCE A;  1YDK A;  3GYK A;  2V1M A;  3HZ4 A;  1X9W B;  1GWC A;  2OJL A;  2QGV A;  2EIR A;  2O7K A;  3FR3 A;  4WBJ A;  2MYG A;  1ERT A;  3G7I A;  3LJR A;  4N0V A;  2PN8 A;  2AB6 A;  1AXD A;  2R6K A;  3GUS A;  4MF5 A;  2DJJ A;  4XHM A;  4MJA A;  3LFL A;  1GUM A;  2GSR A;  3CMI A;  2EFC A;  2JSZ A;  5C04 A;  4MZW A;  4HOJ A;  4D73 B;  1LU4 A;  1WJK A;  2V6K A;  2A2S A;  2RUF A;  1A24 A;  2IFQ B;  4EC0 A;  1PKW A;  2L5O A;  2HSN B;  2WZ9 A;  1XG8 A;  4GWR A;  4IBP A;  3PPU A;  4X1U A;  4AI6 A;  2FWE A;  2HE3 A;  4TR1 B;  5ECS A;  2TRC P;  2N5A A;  2L57 A;  4HZ2 A;  1BX9 A;  3WGE A;  2NPB A;  2H8L A;  5G30 A;  1YJ6 A;  2H73 A;  1GSE A;  2VM2 A;  4G0K A;  5G31 A;  3EWL A;  4V2M A;  2GSS A;  4MPG A;  1JZW A;  1WMJ A;  1SU9 A;  1UN2 A;  1XCC A;  2CT6 A;  2IME A;  2C0E A;  4MNN A;  2OBI A;  2GZZ A;  5CRH A;  4POM A;  5IPH A;  4YKF A;  3KGK A;  2HYX A;  3L9V A;  4DSR A;  1Z6N A;  1XBS A;  2FD3 A;  1NSW A;  4RQR A;  1N2A A;  1K0A A;  4Z2T A;  4GXZ A;  2F8F A;  4J56 E;  4ZL7 A;  2RM5 A;  3RDW A;  2B7J A;  2OBK A;  4XS4 A;  3IPZ A;  3UJ1 A;  2K8S A;  2VL3 A;  1GSQ A;  1V9W A;  1ZL9 A;  2O85 A;  3ED3 A;  6GSW A;  3C8E A;  1USB A;  3GA4 A;  3DGQ A;  3J7Y k;  4BWQ A;  4Z7X A;  1GUL A;  1PX7 A;  1F3B A;  3QOU A;  3VWU A;  2C8U A;  1TRU A;  5ELA A;  3I69 A;  1Y25 A;  5GAP D;  2EFE A;  6GST A;  2VLU A;  1ERU A;  5B6N A;  3HKR A;  5ECR B;  4KA0 A;  3HMJ G;  3ZRE A;  5ECP B;  1QK8 A;  2LNS A;  3EC3 A;  3C1R A;  2C3N A;  2H19 A;  3LGC A;  4L5O A;  3KP8 A;  4PQ1 A;  5BMU A; 
#chains in the Genus database with same CATH homology
 5J3R A;  1TTZ A;  2VCW A;  5ABR A;  1R26 A;  3ZIV A;  4TXV A;  2YWO A;  4KSO A;  3KCM A;  2H6Z A;  3IDV A;  4EE0 A;  1FHE A;  4OO4 A;  2AHE A;  2FWF A;  3EUR A;  3WGD A;  4L0W A;  2MMO A;  1TK0 B;  4LL4 B;  2I1U A;  1SJ6 A;  5HFK A;  1X9S B;  4K2D A;  5F07 A;  5B6M A;  1A2J A;  4AJ6 A;  3ZVJ A;  3GX0 A;  4ECJ A;  4G0I A;  3CTG A;  4HJ2 A;  3J7Y b;  3HXS A;  5AGY A;  3IAM 2;  4IHU A;  4F82 A;  3A5W A;  4ZL9 A;  5F0G A;  4J2F A;  2B5X A;  1F37 A;  1XW9 A;  4FYU A;  2HSM B;  2E7P A;  3A3T A;  1EP8 A;  4ISD A;  6GSX A;  1KTE A;  1R5P A;  3HJP A;  3LXZ A;  2OE0 A;  1O8W A;  3TB2 A;  3L4N A;  3TUE A;  5HR3 A;  2XBI A;  1GSF A;  1V98 A;  3A2X A;  3IA1 A;  2X8H A;  2A2P A;  2CQ9 A;  2GS3 A;  1M0U A;  4W66 A;  2H1G A;  4V2L A;  3TRX A;  1U3A A;  1ABA A;  1J0F A;  3D22 A;  4E68 A;  3GRX A;  1NM3 A;  1VF4 A;  2V2G A;  3HDC A;  4YAP A;  4MZB A;  3IOS A;  4MMM A;  4BVX B;  4PUF C;  5HR2 A;  1G7O A;  3MDK A;  3U6V A;  1FVJ A;  2QKE A;  4NMU A;  4KCA A;  2PUK C;  4KAE A;  1FG4 A;  4P3Y B;  1K0N A;  3P8W A;  4N0Z A;  2OAC A;  2EIQ A;  2PER A;  5DQY A;  2C3Q A;  2WDU A;  2FGX A;  1FVK A;  2E2M A;  3IC4 A;  2MBT A;  1SL2 B;  2H6X A;  2H75 A;  4ZXG A;  1A0F A;  2B6M A;  2R2J A;  2P5R A;  3CTF A;  4TKY A;  2MZC A;  3ZZX A;  1SK1 A;  4YQU A;  1AIU A;  1GRX A;  4G2E A;  4K0G A;  5KN1 A;  1JLW A;  4ZBD A;  1AC1 A;  3D6I A;  4KCE A;  3QAW A;  5ECH B;  4IJI A;  1PX6 A;  3F3Q A;  3HVV A;  3TKS C;  2VIM A;  3GTU B;  2DKH A;  16GS A;  2KP1 A;  2FA4 A;  1W4V A;  4IKH A;  1GNW A;  2DMM A;  1JZR A;  4KW6 A;  3GL3 A;  1XWG A;  2HZE A;  2P5Q A;  1VF1 A;  4K5R A;  3VUR A;  3GKK A;  4BL7 A;  3M8N A;  4WBR D;  2VCX A;  4YH2 A;  1SL0 B;  2VD1 A;  4YAV A;  4K6X A;  1YZX A;  2WJU A;  1SEN A;  1A2M A;  3I43 A;  3GHA A;  5KN0 A;  1S3C A;  5DAL B;  1FO5 A;  2DIY A;  1F9M A;  1AAZ A;  4TR0 A;  1GSD A;  4MA9 A;  1BG1 A;  3D5J A;  3RBT A;  1PD2 1;  4WR4 A;  2FLS A;  4XS1 A;  2RII A;  5A4V A;  1T4Y A;  1SJI A;  3LXT A;  5CNW A;  1ILO A;  1XVQ A;  2VL2 C;  3KJY A;  1YKA A;  2TIR A;  2GGT A;  5E4W A;  2C3T A;  1OKT A;  3K8N A;  4TXO A;  1JHB A;  1SK2 A;  3M9K A;  3IC8 A;  2IN3 A;  1ST9 A;  1HNC A;  3GH6 A;  1WRY A;  4QMK A;  1DBY A;  2LV3 A;  4LLR A;  3F6F A;  4ACS A;  3EPT A;  2B1K A;  2CZ2 A;  1J9B A;  1YEP A;  2K8V A;  5G5F A;  14GS A;  4JBB A;  1N25 A;  2HRA A;  2DJ2 A;  4QL9 A;  2OE3 A;  1IYH A;  4H86 A;  5DVB A;  4TW5 A;  4KUN A;  1T4Z A;  2IIY A;  2CA8 A;  3BCI A;  4QL7 A;  4HS1 A;  3TOU A;  4K5S A;  3GSS A;  1X5E A;  3ZIT A;  2H76 A;  2X49 A;  1YKC A;  2HSY A;  5JCU A;  3IAS 2;  4KDX A;  4KSM A;  1TRW A;  5DAK A;  1VF3 A;  1UVZ A;  4TN8 A;  4JR4 A;  5JCG A;  3GUR A;  3TKP A;  1AW9 A;  2OAD A;  1Z7P A;  1U3I A;  4OFM A;  4IVF A;  2DJ0 A;  1T7P B;  4KDY A;  4YQM A;  4LL1 B;  1XWK A;  3VLN A;  1SYR A;  3VK9 A;  1JZD A;  2O5V A;  2E0Q A;  5B8A A;  5IMD A;  3GX8 A;  5FWG A;  4DVC A;  4ZBA A;  1FOH A;  4Z2R A;  4L5L A;  1XXU A;  4EIQ A;  5HQP A;  2CV4 A;  3US3 A;  3ZML A;  2I81 A;  1SYX A;  4OO5 A;  2VOC A;  4XCS A;  1MDI A;  2HZF A;  4WF4 A;  1T00 A;  3TJG A;  3IBH A;  4XS4 B;  2H74 A;  1X5D A;  3UL3 A;  2GQM A;  5IM9 A;  3LQ7 A;  3U5R E;  5A5H A;  1B4Q A;  4MF6 A;  3H93 A;  2LRN A;  3ISO A;  4OWY A;  4EDY A;  5ID2 A;  1IYI A;  1EV4 A;  4OFT A;  4LA1 A;  5DCH A;  2P0G A;  5ELG A;  2JL4 A;  3FYG A;  20GS A;  2X4A A;  3HYP A;  3QDN A;  2JAC A;  5CAX A;  3QAV A;  2HRK A;  2ALB A;  3TGZ A;  1O81 A;  2ZNM A;  4WR5 A;  3GKX A;  4GQC A;  1WIK A;  3HD5 A;  1Z6M A;  1BAY A;  2O8V B;  3FY7 A;  4MK3 A;  5IOW A;  1W89 A;  3F4S A;  1HNA A;  1TI3 A;  2VL2 A;  3L0H A;  1GSY A;  2PVO C;  1ZGN A;  1K0M A;  7GSS A;  2GSQ A;  4ZIJ A;  4HJM A;  1HNB A;  4X4J A;  4CDO A;  5BMU B;  2FCH A;  1GL8 A;  2IWT A;  2CAI A;  3RHC A;  2RM6 A;  4WXT A;  3DKS A;  2HNL A;  1O6J A;  1X9M B;  3CSJ A;  5ECN B;  3JCM L;  5AIS A;  3F3R A;  12GS A;  4GDF A;  5ENU A;  1MEK A;  3QMX A;  2IMF A;  4FQU A;  1ZYN A;  1Q98 A;  2FNO A;  5GAN D;  2M46 A;  1V58 A;  2VCV A;  3LG6 A;  4RI6 A;  3M9J A;  2ZCT A;  1G6W A;  2YCD A;  4XIH A;  5IMF A;  3QCP A;  2WB9 A;  1NW2 A;  2HQT A;  1A8Y A;  1TKD B;  4CY6 A;  2HSH A;  2GDR A;  4ZIL A;  3CRU A;  3EMX A;  2GST A;  4JZQ A;  4IP1 A;  2JU5 A;  2HLS A;  2KHP A;  3OR5 A;  1PSQ A;  4IP6 A;  3ZFB A;  4G10 A;  4XS6 A;  1BF5 A;  1WE0 A;  4EF0 A;  5A34 A;  1EGO A;  4EKZ A;  4MLY A;  3Q19 A;  1G7E A;  4N30 A;  1OE8 A;  2DJK A;  2H30 A;  4I97 A;  2ON7 A;  4EVM A;  4DEJ A;  2X8C A;  2V32 A;  1M9B A;  3HY2 A;  2I9H A;  5LCZ A;  3O6T A;  3MYD A;  3TKR A;  5EVO A;  3HVS A;  5G2Z A;  1ZYP A;  5HR0 A;  2FWH A;  3C73 A;  5DJM A;  3E9J B;  2HRN A;  2QC7 A;  5D9V A;  2B5E A;  2H0G A;  2WCI A;  1O8X A;  3FKF A;  2GT6 A;  2N5F A;  2KLX A;  1OKD A;  3KMN A;  1M7T A;  4I2T A;  3M3M A;  4ECB A;  19GS A;  5J47 A;  1XZO A;  4BA7 A;  1GTB A;  2RLI A;  1M2D A;  2YV9 A;  3HJO A;  5FT3 A;  4JED A;  3FR6 A;  2H71 A;  3ZRD A;  5IPG A;  5INY A;  3FRC A;  2G2Q A;  3M0F A;  3EIN A;  1T1V A;  3FZ5 A;  3RPP A;  5ECL B;  3VFI A;  2IMD A;  2C0G A;  3ZL5 A;  4GRF A;  2DML A;  1WPI A;  2BJX A;  3KTB A;  4Q5N A;  1MD4 A;  5F8B A;  1ERW A;  1K0O A;  2LS5 A;  3PGT A;  1S3D A;  2F51 A;  3L9U A;  3GH9 A;  3UVH A;  2PBJ A;  2VKZ G;  3EYT A;  3LWA A;  1KEB A;  2XPD A;  5CP1 A;  4IN0 A;  4CW9 A;  3ZYW A;  4MP4 A;  2L4Q A;  1DE2 A;  2IFQ A;  2L5L A;  2A4V A;  3N9J A;  4IEL A;  3KEB A;  3W8J A;  3ZFL A;  3DWV A;  5BRT A;  2VO4 A;  2G0F A;  2LUS A;  3G7J A;  4O5U A;  2X64 A;  3BCK A;  5KOX A;  1QUW A;  3A5I A;  5KN3 A;  4GLT A;  1DSB A;  4L8E A;  4ZB7 A;  4BVY A;  1EEM A;  4O7H A;  4GCI A;  2YP6 A;  1R5A A;  4AKI A;  4G19 A;  2LQQ A;  3EMP A;  3G9B A;  3Q74 A;  5CYY A;  4BL7 B;  5C00 A;  1GH2 A;  4IGJ A;  4BPY A;  5D9X A;  1H75 A;  3FZA A;  3HHV A;  2N5B A;  5IOX A;  2VCQ A;  2J23 A;  22GS A;  3TRP A;  3NOF A;  2DBC A;  4K7O A;  2DSA A;  1ZOF A;  1TRV A;  5IMA A;  1A0R P;  3GIX A;  1OC8 A;  5LD0 A;  2ON5 A;  1ZCP A;  1TI1 A;  2GTU A;  1E2Y A;  3UAR A;  2LQO A;  4N10 A;  5EPF A;  2CZ3 A;  3CSH A;  3H79 A;  1PA3 A;  1EGR A;  2PVQ A;  2M72 A;  4G0L A;  3UOM A;  2YN1 A;  4ILF A;  4KF9 A;  2PWJ A;  4MJC A;  3ZIJ A;  3GST A;  1SVL A;  11GS A;  1PN9 A;  5AN1 A;  3DEX A;  1YEX A;  3TJJ A;  1PL2 A;  1UC7 A;  3FR9 A;  5HFI A;  4Z2U A;  5IO2 A;  2YZU A;  5CRG A;  2H0H A;  3MNG A;  1G0T A;  4MPF A;  3IHG A;  5IMZ A;  4ECI A;  4JU5 A;  3TKQ A;  2KOK A;  2L6D A;  3R2Q A;  1I9D A;  1J08 A;  1FB0 A;  1NHY A;  4WET A;  1B9Y C;  1AQX A;  2MMN A;  4J57 E;  1XIY A;  1JLV A;  1A23 A;  4XTS A;  2F8A A;  4ZBB A;  4Q5Q A;  2A2R A;  2L6C A;  5DAK B;  3FZ4 A;  5D8I A;  4OD7 A;  5ECM B;  2HRF A;  4I2U A;  1GUH A;  1QMV A;  5A5K A;  4GSN A;  4MCU A;  3A2W A;  3KZQ A;  5JWO B;  2OKA A;  10GS A;  5G5E A;  4NWY A;  4GF0 A;  2JZT A;  2IL3 A;  4AKX B;  4GTU A;  1ACV A;  1C72 A;  4Q5F A;  3DVW A;  3FW2 A;  4PGT A;  1OC9 A;  1B8X A;  1HYU A;  4GSS A;  3L78 A;  5LNK e;  4O32 A;  1OVN A;  5JCW A;  2VAF A;  3D0Z A;  3IXR A;  5J9B A;  4DSS A;  5DJL A;  2I3Y A;  4NXI A;  2R0C A;  4HQS A;  1SD9 A;  1R7H A;  3P7X A;  2F9S A;  1K3L A;  1PRX A;  3Q18 A;  4NHZ A;  1SKW B;  5IO0 A;  4MJE A;  2LEG A;  5A5H B;  2HXK A;  5D96 A;  2QA1 A;  2CVB A;  2VM1 A;  3MIX A;  18GS A;  5ID2 B;  2K6V A;  2AV4 A;  3DXB A;  2C80 A;  3I9V 2;  4EIP A;  2VL9 A;  1TW9 A;  2HI7 A;  2HRK B;  2L59 A;  1F3A A;  4XRA A;  3TJK A;  5J4Y A;  2ZUP A;  4HUA A;  1K3O A;  4OFN A;  2KUC A;  4CHS A;  2FA8 A;  3CYN A;  5EL8 A;  2H72 A;  5ECO B;  1HD2 A;  1SD8 A;  4A5P A;  2O87 A;  5HFG A;  5KOW A;  4V2N A;  4POK A;  2R3X A;  1M9A A;  4N11 A;  4POL A;  2XC2 A;  1RK4 A;  4OMV A;  1B48 A;  2FY6 A;  3DVX A;  2YZH A;  1QXH A;  4L0U A;  1Z3E A;  3APS A;  5A4W A;  4RQX A;  3KXO A;  2R4V A;  3HA9 A;  4KND A;  4ML6 A;  1V2A A;  2E2G A;  2VLV A;  1Z9H A;  2P31 A;  4NPB A;  5B8B A;  1ZYQ B;  2IMI A;  3GNJ A;  3VI5 A;  4NV2 A;  1GTA A;  1EV9 A;  3UMA A;  3FEU A;  3GV1 A;  1EOH A;  2XHF A;  4JRR A;  5EY6 A;  2RUE A;  3C71 A;  4X0X A;  1XVW A;  2H1A A;  2C1Y A;  1FAA A;  4AJ7 A;  1TOF A;  2LJA A;  4KE3 A;  5A34 B;  4WKW A;  1ERV A;  3LYP A;  1JFU A;  2H70 A;  4I6X A;  4NAX A;  4EDZ A;  3VWX A;  5J5N A;  4FYB A;  3RHB A;  4IJ3 A;  2VCZ A;  3N5O A;  3O3T A;  1TK8 B;  1YQ1 A;  3F63 A;  3P90 A;  2O89 A;  2H0I A;  1PL1 A;  2FUG 2;  5ECK B;  1SVO A;  5DAL A;  2AUV A;  3KM6 A;  4FH8 A;  4JR6 A;  1XWC A;  4PNG A;  4PUR A;  5DQS A;  1QQ2 A;  3TKS E;  2FHE A;  1GLQ A;  4MJB A;  1QGV A;  4MAB A;  2B3S A;  1X5C A;  5G1K A;  2EFD A;  2OA7 A;  1GNE A;  1N8J A;  1THX A;  3HJM A;  4GST A;  2AAW A;  1BED A;  2HFD A;  3L9S A;  3UBK A;  3DD3 A;  3KMO A;  4K8M A;  1OE7 A;  3TRQ A;  2VLT A;  3ZVJ D;  3DYR A;  1VRS D;  3EE2 A;  4EL1 A;  1Z5Y E;  3FMW A;  1XOB A;  3F0I A;  3D4T A;  3MSZ A;  2GLR A;  4K2X A;  4TOP A;  3GN3 A;  3UEM A;  4FYC A;  1T8E B;  4HQZ A;  4KB3 A;  2PPT A;  5H5R A;  1PMT A;  1BG5 A;  1SVM A;  3MAK A;  4O92 A;  1AQW A;  4PQI A;  4ZB8 A;  2L4C A;  1U87 A;  2TRX A;  5GST A;  1A2L A;  2B1L A;  4USS A;  1XOA A;  3KP9 A;  3PIN A;  2C4J A;  4FO5 A;  1K0B A;  4IQ1 A;  2EFH A;  2Z9S A;  1ML6 A;  3O76 A;  2K18 A;  1LJR A;  3WD6 A;  2R37 A;  3E0U A;  2FWG A;  4PTS A;  4E8E A;  4EO3 A;  3KD0 A;  1Y1U A;  5D93 A;  1G6Y A;  2DC5 A;  5CO3 A;  4MF7 A;  4HZ4 A;  2OE1 A;  4BVY B;  17GS A;  1FW1 A;  4MH2 A;  1I5G A;  5H5Q A;  2LRC A;  4ZB6 A;  1CQH A;  4IS0 A;  2OT3 A;  4TR3 A;  1PGT A;  6GSV A;  3UAP A;  1THO A;  2JAD A;  1YVL A;  5DDL A;  3KTL A;  2DIZ A;  3VPQ A;  1EWX A;  1B9X C;  2CAQ A;  1V40 A;  3IR4 A;  1GSU A;  3PH9 A;  4AGS A;  1K0D A;  5GSS A;  3LW9 A;  3WYW A;  6GSS A;  1TRS A;  5B7C A;  3F8U A;  1F2E A;  4WEY A;  4F0C A;  2B7K A;  5A1N A;  4O5R A;  4MH3 A;  2YPM A;  2D2Z A;  2WS2 A;  5D73 A;  2NDO A;  1RQM A;  4TR4 A;  1TU7 A;  3UBL A;  3TDG A;  2XBQ A;  2REM A;  3P2A A;  3H4K A;  1NHO A;  3FHK A;  2LKU A;  3LYK A;  1K3Y A;  2GVP A;  4ZB9 A;  4IQA A;  2VUP A;  5E59 A;  3VPT A;  2IJY A;  1TJD A;  1QFN A;  5IIZ A;  3DRN A;  5J4U A;  5HR1 A;  3GFK A;  1BQ7 A;  4V1A g;  1PN0 A;  1DUG A;  1E6B A;  2C0D A;  3IK9 A;  4D73 A;  4WF5 A;  3D4M A;  2HT9 A;  5DCG A;  2VD0 A;  3GL5 A;  2HSN A;  2YJH A;  2YWM A;  4HU7 A;  3ZTL A;  3CWG A;  4YKG A;  5F06 A;  3APQ A;  5J40 A;  4ECC A;  1ZMA A;  1SJZ A;  2IPA A;  3GKN A;  1JZO A;  4TR1 A;  3QFA C;  4ICY A;  3ME8 A;  4PXO A;  4GQF A;  3GKM A;  3QD9 A;  2LJK A;  3GMF A;  5A4U A;  3TCO A;  3QR6 A;  4MZC A;  2UV8 G;  1AUC A;  1O73 A;  1R4W A;  3CRT A;  3DIE A;  3KIJ A;  2WFC A;  2X8G A;  2CX4 A;  3IHQ A;  3D21 A;  4NV5 A;  2PU9 C;  3EU4 A;  2HZE B;  5D9W A;  1GP1 A;  3ZLP A;  1Q4J A;  1FOV A;  2H01 A;  1OC9 B;  2NTO A;  3H1N A;  4DSS B;  3R3E A;  1YF0 A;  3WT1 A;  2LRT A;  2YNX A;  4AKG A;  3BJ5 A;  1KBN A;  1OYJ A;  3QPM A;  1PQN A;  3W8S A;  9GSS A;  2WRT A;  5IMC A;  1M2B A;  4V1A p;  3A2V A;  4NHW A;  2YAN A;  2NVL A;  1B4P A;  5H5S A;  3E3E A;  4FIW A;  1EP7 A;  4KGI A;  3RAZ A;  2X99 A;  3Q6O A;  4F03 A;  1O7U A;  1DE1 A;  3TOT A;  5IQY A;  1GUK A;  3QAG A;  2GQK A;  1YY7 A;  2PGT A;  4K7I A;  2KP2 A;  5COH A;  2LST A;  5FHI A;  1XPV A;  4TXO B;  4E8H A;  3KH7 A;  1GLP A;  1TXU A;  4O5Q A;  1TDI A;  3H8Q A;  1ON4 A;  3ERW A;  4K1F A;  1RW1 A;  3G7Y A;  3UIW A;  1MD3 A;  2JZR A;  3BBY A;  2B5Y A;  4ID0 A;  3IV4 A;  2DKI A;  1GSS A;  2XPE A;  2F3M A;  1ZZY A;  4TRX A;  2YWN A;  2MBS A;  3EU3 A;  4PQH A;  3TU3 B;  2R5G A;  3TJF A;  3FZ9 A;  4PUA A;  4OCF A;  4HDE A;  1GTI A;  3MWH A;  4K7N A;  3APO A;  5JWQ B;  1A8L A;  3UVT A;  2V6O A;  4RI7 A;  1XWA A;  1PKZ A;  3VI7 A;  3F9U A;  1CQG A;  1AQV A;  1EEJ A;  4AJ8 A;  1MDJ A;  1K0C A;  4AKH A;  3HCZ A;  1XW6 A;  2V41 A;  1SKS B;  2H6Y A;  3FK8 A;  3RPN A;  3M1G A;  5JWR B;  3DML A;  4IW9 A;  1BYE A;  4N3Z A;  5KN2 A;  1U6T A;  3LSZ A;  1LBK A;  2QSI A;  2R0G A;  2DJ3 A;  1ZYE A;  4HI7 A;  2MMA A;  2H66 A;  4K9Z A;  1TXX A;  4MDC A;  3BOA A;  2EIO A;  3W6G A;  1U88 A;  2LJR A;  2CX3 A;  4KH7 A;  2VCT A;  1V57 A;  4CY8 A;  5L71 A;  1URM A;  1WOU A;  5J4V A;  2HSM A;  2YOI A;  4K0N A;  4LMW A;  2BMX A;  4I5Q A;  1MTC A;  3F4T A;  4LMV A;  5ECQ B;  6GSU A;  3VWW A;  3F6D A;  4G01 A;  5AIX A;  5ECI B;  4Q5R A;  1VF2 A;  3LEF A;  3S9F A;  4ML1 A;  4F0B A;  2M80 A;  5KEJ A;  2GT5 A;  2YWI A;  1OC3 A;  1TU8 A;  2R0P A;  4F2I A;  2I4A A;  1XW5 A;  1EOG A;  3C1S A;  1EZK A;  2A4H A;  1YF1 A;  3BD2 A;  4PX1 A;  1X0R A;  2DLX A;  2NBS A;  1S3A A;  2UZ8 A;  4BVX A;  3PR8 A;  4EUY A;  1SK0 A;  4BWS A;  5J41 A;  4X43 A;  3CXG A;  5CRE A;  3I6A A;  1KNG A;  1T3B A;  1SL1 B;  1WP0 A;  3C7M A;  3ME7 A;  3LOR A;  2LTK A;  5GZZ B;  2LNT A;  1BJX A;  8GSS A;  3SWL A;  2C0F A;  2CVD A;  2ES7 A;  3IE3 A;  6GSY A;  5CRW A;  3TJB A;  2JSY A;  1F6M C;  5AIV A;  2GZP A;  1M2A A;  4HU9 A;  3ERF A;  2J9H A;  4POB A;  5IMV A;  4F9Z A;  1H4O A;  4I8B A;  4YQV A;  4QQ7 A;  3QFB C;  5J9C A;  2AYT A;  4XRD A;  5CRD A;  2K9F A;  3V1W A;  4JE1 A;  2EC4 A;  2DJ1 A;  3HVX A;  3CBU A;  4HEA 2;  2IMK A;  4TVE A;  1GTU A;  5F05 A;  3F4R A;  3GTU A;  1M99 A;  5DBQ A;  5D9T A;  1XFL A;  1UA5 A;  3WT2 A;  2YJ7 A;  4G9H A;  3ZMK A;  2H1D A;  3EVI A;  1Y6E A;  2WGR A;  2GQL A;  1Z7R A;  2QA2 A;  2GZY A;  1MDK A;  1WWJ A;  3TKS A;  1XWB A;  4RUV A;  2H1L A;  2WUL A;  2H1B A;  2MMZ A;  1SKR B;  3VWV A;  3CSI A;  13GS A;  5G1L A;  2JZS A;  3HZ8 A;  3NZN A;  2YV7 A;  3ERG A;  2AJQ B;  4KX4 A;  1TK5 B;  4EXJ A;  3IRA A;  4KDU A;  2CVK A;  3AY8 A;  1OAZ A;  1HQO A;  1VGL A;  2PMT A;  3NIV A;  4PNF A;  3SBC A;  4ULX A;  3WGX A;  4AF2 A;  1TP9 A;  3KH9 A;  5A1N B;  4ZL8 A;  3IK7 A;  2BTO T;  1FB6 A;  1O85 A;  4DSQ A;  4OCE A;  1YDK A;  3GYK A;  2V1M A;  3HZ4 A;  1X9W B;  1GWC A;  2OJL A;  2QGV A;  2EIR A;  2O7K A;  3FR3 A;  4WBJ A;  2MYG A;  1ERT A;  3G7I A;  3LJR A;  4N0V A;  2PN8 A;  2AB6 A;  1AXD A;  2R6K A;  3GUS A;  4MF5 A;  2DJJ A;  4XHM A;  4MJA A;  3LFL A;  1GUM A;  2GSR A;  3CMI A;  2EFC A;  2JSZ A;  5C04 A;  4MZW A;  4HOJ A;  4D73 B;  1LU4 A;  1WJK A;  2V6K A;  2A2S A;  2RUF A;  1A24 A;  2IFQ B;  4EC0 A;  1PKW A;  2L5O A;  2HSN B;  2WZ9 A;  4GWR A;  4IBP A;  3PPU A;  4X1U A;  4AI6 A;  2FWE A;  2HE3 A;  4TR1 B;  5ECS A;  2TRC P;  2N5A A;  2L57 A;  4HZ2 A;  1BX9 A;  3WGE A;  2NPB A;  2H8L A;  5G30 A;  1YJ6 A;  2H73 A;  1GSE A;  2VM2 A;  4G0K A;  5G31 A;  3EWL A;  4V2M A;  2GSS A;  4MPG A;  1JZW A;  1WMJ A;  1SU9 A;  1UN2 A;  1XCC A;  2CT6 A;  2IME A;  2C0E A;  4MNN A;  2OBI A;  2GZZ A;  5CRH A;  4POM A;  5IPH A;  4YKF A;  3KGK A;  2HYX A;  3L9V A;  4DSR A;  1Z6N A;  1XBS A;  2FD3 A;  1NSW A;  4RQR A;  1N2A A;  1K0A A;  4Z2T A;  4GXZ A;  2F8F A;  4J56 E;  4ZL7 A;  2RM5 A;  3RDW A;  2B7J A;  2OBK A;  4XS4 A;  3IPZ A;  3UJ1 A;  2K8S A;  2VL3 A;  1GSQ A;  1V9W A;  1ZL9 A;  2O85 A;  3ED3 A;  6GSW A;  3C8E A;  1USB A;  3GA4 A;  3DGQ A;  3J7Y k;  4BWQ A;  4Z7X A;  1GUL A;  1PX7 A;  1F3B A;  3QOU A;  3VWU A;  2C8U A;  1TRU A;  5ELA A;  3I69 A;  1Y25 A;  5GAP D;  2EFE A;  6GST A;  2VLU A;  1ERU A;  5B6N A;  3HKR A;  5ECR B;  4KA0 A;  3HMJ G;  3ZRE A;  5ECP B;  1QK8 A;  2LNS A;  3EC3 A;  3C1R A;  2C3N A;  2H19 A;  3LGC A;  4L5O A;  3KP8 A;  4PQ1 A;  5BMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...