4IQAA

Crystal structure analysis of the e228l mutant of human clic1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
223
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDELIELAYEQVAKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 1
publication title Crystal Structure Analysis of the E228L Mutant of Human CLIC1
rcsb
source organism Homo sapiens
total genus 70
structure length 223
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4iqaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4iqaA01
1PKWA 1V40A 5ECHB 2YN1A 4LA1A 2X99A 4OWYA 3FHKA 2V2GA 5J9CA 4OD7A 3FRCA 3VLNA 4RI7A 2P5QA 1GTIA 3CTGA 5IMDA 4IHUA 1OYJA 4MK3A 1MEKA 4TXVA 2QSIA 4BVXA 3H93A 5F05A 2XPDA 4BVYA 3LG6A 5G1KA 1BG5A 2X8HA 3VWUA 2CVDA 2IPAA 1TXXA 1AC1A 2ZCTA 1O8WA 1TI1A 2MBSA 3F4SA 3HVXA 4YQUA 5A4UA 1T8EB 2CAQA 4FYCA 2YNXA 1MDKA 1FAAA 3P8WA 4GSSA 3DIEA 4OCEA 5ABRA 1GP1A 3CBUA 1PGTA 2YZHA 2HXKA 2DJJA 1K0DA 3DEXA 3G7IA 2FD3A 1F3BA 4NAXA 4Q5QA 1K0NA 4WBJA 5J9BA 5AISA 4KDYA 1ZGNA 2RUFA 3IAS2 1VRSD 3ZVJD 2XBIA 2VAFA 2HE3A 4AJ8A 1Y25A 1N8JA 2AYTA 3CRTA 2E2MA 2FWFA 5AIXA 4MF6A 1VF4A 1XWAA 3IOSA 2C3QA 2HZEA 2I9HA 3R2QA 1WOUA 2R2JA 1FVJA 4JBBA 3TKSC 4I6XA 3CSHA 5A5KA 2HRFA 3I43A 2OADA 1ZYQB 4PQ1A 1EOHA 3MAKA 1AQXA 1UN2A 1I9DA 4TVEA 4HJMA 4MZBA 2I4AA 3O3TA 5DAKB 1A0RP 1SK0A 1OKTA 3S9FA 2VLTA 2QC7A 2CX4A 2I1UA 3UJ1A 5HFKA 2BTOT 2H71A 14GSA 2LNTA 2KLXA 1DUGA 5LD0A 4O7HA 2CVKA 3APSA 1GNWA 3D5JA 2HYXA 1K0AA 3KM6A 4N30A 1OC9B 4OCFA 5G1LA 5IPHA 2JSZA 2TRXA 1XXUA 5CYYA 2VCVA 2K8VA 2FWGA 2IMDA 3GH6A 3A2VA 5J4UA 4ZB8A 1ERWA 1DSBA 1FVKA 1TJDA 1XWBA 2RM6A 3M9KA 5CO3A 5DVBA 2F8AA 2OE3A 2IMEA 3ZIJA 3LFLA 4NHWA 3GKMA 4MZWA 4EVMA 1OC3A 3J7Yb 2PU9C 1UA5A 4RUVA 1DE1A 1YJ6A 1PSQA 3QFBC 4JR4A 3CYNA 3ERWA 1ERVA 5ECIB 1ACVA 1V57A 1Z3EA 2C80A 2DBCA 2LRNA 4DSSB 2B5YA 4WR5A 3KTLA 2XBQA 1ZYEA 4KNDA 1SYXA 2LSTA 4KGIA 3WT2A 3VK9A 4WF5A 3D0ZA 1ST9A 2JSYA 1M99A 1PA3A 2UZ8A 4XTSA 2H74A 4HU9A 2OKAA 4OO4A 2HRNA 1H4OA 1GSDA 3QAVA 1A0FA 1ZZYA 2TIRA 4K7NA 1SD9A 1XWCA 1TDIA 5ECSA 1SJZA 2BMXA 2DSAA 3RPPA 4V2LA 2GZZA 2RUEA 2FNOA 3M3MA 5ECKB 5HQPA 1V58A 5FHIA 1Z5YE 4BPYA 2D2ZA 1Z7PA 4Q5RA 2YJ7A 3KEBA 3QD9A 3FZ4A 2VCXA 4ECIA 1A2JA 1EEMA 2B7KA 1TTZA 1V2AA 2XHFA 1XCCA 4DSRA 3EURA 1JLVA 2VLUA 5DAKA 4EF0A 1YQ1A 1K0BA 3ME8A 3NZNA 4KB3A 1ZL9A 1YY7A 4XS6A 2WULA 1GLPA 1BQ7A 1XVQA 2PBJA 2K6VA 3TCOA 2KP2A 3WT1A 3IV4A 3A2XA 4D73B 1GL8A 2HFDA 2WDUA 3KD0A 4WXTA 5DALB 2H6XA 2C0GA 2L4CA 2C8UA 2YCDA 3HYPA 4OMVA 5D9WA 4PURA 4GRFA 3RPNA 5KEJA 3HY2A 1OC9A 4MDCA 1AQWA 1B9XC 4IP1A 2GVPA 1SENA 1B8XA 4XRDA 1GTBA 3HVSA 5GSSA 2YWIA 4ZBAA 1B4QA 1HNCA 2WZ9A 3GSTA 4PUAA 3GRXA 3TOUA 3L9UA 1JLWA 3TDGA 4ML1A 5H5QA 3FR6A 3ERFA 2FA4A 2MBTA 4K9ZA 2GTUA 2MMOA 2HI7A 3FR3A 4IJIA 1X9WB 1AW9A 2FY6A 2NPBA 3VWXA 2P31A 1A8LA 4L0WA 1OVNA 2R6KA 17GSA 1B48A 4PX1A 1G7OA 5B8BA 4IS0A 1PX7A 1MD3A 2WFCA 3TKQA 1AIUA 4O32A 4HDEA 2DC5A 2DJ1A 2GDRA 3I6AA 1EGRA 5ECQB 4GCIA 1YZXA 4ZILA 4FQUA 1W89A 3ZMLA 3DYRA 3HJPA 4GQCA 4TKYA 3DWVA 1LBKA 5ECLB 3TJBA 5DQSA 4XHMA 5LNKe 3MDKA 3J7Yk 3TGZA 3P2AA 3PPUA 1QGVA 5H5SA 5G30A 1Z6NA 5INYA 1WMJA 2PUKC 2IMKA 3M0FA 1NM3A 1KNGA 5E4WA 1XW9A 5ECRB 4TR3A 3DVXA 3HXSA 3GFKA 4CHSA 2GSRA 3VURA 4ECJA 4RI6A 2YV9A 2K9FA 1SL2B 4KCEA 3ERGA 1ERUA 2JZTA 3HDCA 3GUSA 4G2EA 3KP8A 4MJBA 3GKXA 3VI5A 4KSMA 1FHEA 1WWJA 2IFQB 1TRUA 3WYWA 2L5LA 3RHBA 4JRRA 3BD2A 3UBLA 3EU3A 4KW6A 1SK2A 3Q18A 5FWGA 5EPFA 4X1UA 2O89A 4N0VA 4KUNA 4K2DA 4D73A 2GT5A 1YDKA 4ILFA 5DALA 1U6TA 2CX3A 4AJ7A 2V1MA 2YANA 4QQ7A 2O8VB 1SD8A 5D9XA 1PL2A 2VL3A 2LJRA 3VWWA 5A4VA 1T4ZA 3US3A 2V32A 3GH9A 5F06A 3EC3A 4IQAA 2HLSA 2F3MA 2E0QA 5E59A 5G5EA 3ZYWA 4FYUA 5KN0A 3D6IA 5D8IA 2K18A 3TJKA 6GSXA 3LQ7A 4V1Ap 1SJ6A 4L8EA 4LMWA 4AF2A 4KH7A 1PN9A 4MPFA 1XFLA 5IMFA 2CA8A 3TRPA 1OE8A 4X43A 2EIRA 4MMMA 2E2GA 5IOXA 1FO5A 2NVLA 4MP4A 3FZ5A 2IMIA 2CVBA 2L5OA 1T4YA 3H8QA 4K1FA 3NOFA 4EXJA 3ME7A 1TK5B 4PTSA 5GAND 2WB9A 5C04A 4ACSA 3D21A 3W8SA 4GSTA 2YWNA 4ZL9A 4G0KA 2LNSA 4GF0A 2E7PA 2JZRA 5IO0A 2VUPA 5IIZA 3QPMA 4HUAA 2L6CA 2M72A 2KP1A 4HQZA 3KCMA 5DDLA 2KOKA 1Z7RA 4MZCA 1SU9A 3P7XA 3QMXA 2FUG2 4N10A 4EKZA 4OFMA 2HSHA 5DBQA 3IHQA 1T3BA 4EDYA 2H6YA 2B5XA 1G7EA 1Z9HA 3HA9A 2I81A 1M2BA 3BBYA 4DSQA 4XIHA 2ALBA 3KGKA 3BOAA 4K8MA 3VFIA 5IPGA 3KMNA 2KUCA 1TRSA 2C0DA 3LWAA 2C3NA 4TXOB 4F9ZA 2R3XA 4ID0A 5CNWA 1EOGA 1VGLA 3TKPA 3EE2A 2IFQA 2VL2A 4POLA 1XW5A 2HNLA 1I5GA 4J2FA 1C72A 5GAPD 3ZITA 3L0HA 1MDIA 5G31A 1TKDB 3RHCA 2AV4A 5EVOA 2HSYA 4AGSA 6GSTA 1TK0B 3CXGA 4IN0A 2C3TA 3E0UA 4IVFA 3KTBA 2YZUA 2VD0A 4USSA 4JR6A 2YWOA 4HQSA 1XVWA 3WD6A 1GULA 4ECBA 1FOVA 2L57A 3I9V2 4WEYA 4Z7XA 12GSA 4ZB6A 2B7JA 3GL3A 3BJ5A 4QL9A 2N5FA 3O76A 2OJLA 2GQLA 4JE1A 4KSOA 5D9TA 1B9YC 4F0BA 2H73A 1PKZA 3UEMA 4L0UA 4FYBA 1XPVA 3GV1A 2EIQA 3C73A 5IMVA 1GSYA 4P3YB 5C00A 1V9WA 1HQOA 4MJEA 2A2RA 2CAIA 2YV7A 3U6VA 2PN8A 4ZL8A 2AB6A 22GSA 3TB2A 2PGTA 3IA1A 1PX6A 1J9BA 1JZOA 4HS1A 2X8GA 3VPTA 4WKWA 3GSSA 3APQA 4KCAA 4EDZA 5G2ZA 2H8LA 3H1NA 4F2IA 5LCZA 2WRTA 2RIIA 5IO2A 2O7KA 5J5NA 4MCUA 1E6BA 3IXRA 1F9MA 5CAXA 2VOCA 5ENUA 3QOUA 3ZRDA 8GSSA 3TUEA 1HD2A 5ECPB 1R5PA 2FLSA 3APOA 2JL4A 1THXA 2VL2C 2IN3A 3UARA 3G7JA 1F37A 1T7PB 2ES7A 3PR8A 2CQ9A 1YEPA 3A5WA 4ZXGA 4TXOA 1EV4A 4JEDA 3A3TA 3F3RA 1SJIA 2H76A 4ULXA 2CZ3A 3TOTA 2EIOA 1M9AA 1F6MC 3FEUA 2IL3A 4CDOA 3HVVA 2N5BA 2I3YA 2H70A 4ZL7A 4IBPA 1BX9A 5IQYA 4EC0A 1NHYA 5F0GA 4MH3A 2PVOC 3TRQA 4LL1B 1DBYA 4IGJA 4ZBBA 1W4VA 3ZFBA 2VIMA 4HZ4A 1U87A 4LL4B 16GSA 1QK8A 4WETA 5J3RA 5HR1A 3CSIA 1GUHA 3Q6OA 1PQNA 1VF3A 2VCWA 2GGTA 1AQVA 1SKSB 2H66A 4V1Ag 1SL0B 2NBSA 3N5OA 3ZIVA 2GSQA 4I5QA 1GSEA 5DCHA 2PMTA 1EZKA 2C0FA 1M0UA 3HJOA 2CT6A 2LKUA 3UIWA 2VCQA 3F6FA 6GSUA 3D4TA 3EYTA 5CREA 1A23A 4NPBA 1O6JA 1HNAA 2NDOA 1KBNA 2H1BA 4I97A 1KEBA 2H30A 2HSNB 1EEJA 3HKRA 2ON7A 1G6YA 4HI7A 1K3OA 2H72A 5HR3A 4JZQA 4BWQA 1X5DA 5CRGA 3GTUB 4MJCA 3FYGA 2L6DA 3W6GA 4G10A 3TRXA 4IKHA 1GTAA 2JU5A 1Z6MA 1GSQA 2B1KA 1X5EA 2IWTA 5DQYA 2GQMA 2H1AA 1S3AA 2RM5A 4V2MA 3MNGA 2YJHA 3LXTA 1HYUA 5B6MA 5IM9A 3HZ8A 4DSSA 2WS2A 3TJJA 2DLXA 4G19A 3IPZA 3F4TA 3CMIA 3M1GA 3I69A 3DVWA 2R4VA 1E2YA 2FHEA 3DGQA 2OE1A 3LXZA 5D9VA 2IIYA 1NW2A 1S3CA 3IBHA 4YAPA 2QKEA 3FW2A 4BA7A 3F6DA 3C1RA 3WGXA 1G6WA 4GWRA 4NV5A 1IYIA 2LQOA 2YP6A 3E9JB 3K8NA 5CP1A 1V98A 1OKDA 1CQHA 1K0CA 1YF1A 2FCHA 2X8CA 1HNBA 1PMTA 5IMAA 4K7IA 2LRCA 3A2WA 4PQIA 2LJAA 2PWJA 1OAZA 2HRAA 5COHA 1GNEA 3FK8A 3KH9A 4MJAA 4L5OA 4FO5A 4HEA2 2HSMB 4TR0A 1YKAA 3F63A 2JADA 1GSFA 1WIKA 3EVIA 3LGCA 1U88A 3GA4A 1GLQA 5CRDA 1KTEA 4HJ2A 4BL7B 6GSWA 4I2TA 4DEJA 4F82A 4PNFA 3GMFA 4G9HA 2IMFA 5HFIA 1GSSA 4XCSA 4J56E 4NMUA 3KH7A 4POBA 3GTUA 1YF0A 1K3YA 2H1DA 4HU7A 4YQVA 1AAZA 1SK1A 4KDUA 3LEFA 3ZTLA 3DKSA 5DJMA 1JZWA 3BCIA 2PERA 1ERTA 3L4NA 4XS4B 2F9SA 4XS1A 3TJGA 3OR5A 1TW9A 4J57E 3TKRA 1U3AA 4HZ2A 2EC4A 1XWKA 2MMZA 4CW9A 3KZQA 5JCUA 3QFAC 4LMVA 2R5GA 1MDJA 4IQ1A 2REMA 3GKNA 1JFUA 1TU8A 4KE3A 4QL7A 3UL3A 4EE0A 3HZ4A 3C7MA 1IYHA 1T00A 3IAM2 3D22A 4MABA 3ZL5A 1U3IA 3IK9A 3QR6A 3IR4A 4O92A 2DJ3A 1ILOA 3IC4A 2OACA 2YOIA 2DJ0A 1F3AA 1TRVA 1X0RA 3MSZA 1WJKA 3FY7A 2H75A 1GRXA 4PGTA 2J9HA 1M9BA 2AUVA 4YAVA 2HT9A 2M46A 2LJKA 5AN1A 1R7HA 4TR1B 9GSSA 5JCGA 3E3EA 1NSWA 2CV4A 1GSUA 3GX8A 3PH9A 4I2UA 2GSTA 1JHBA 2LUSA 3UVTA 3QAGA 3KJYA 5IMCA 4OFTA 3HHVA 1O7UA 1BEDA 4X0XA 1RW1A 3DMLA 2HSMA 5ELAA 3TKSE 1QMVA 3RAZA 1GWCA 3QAWA 2AAWA 1YKCA 4ZBDA 4BL7A 4GQFA 2OBIA 5HR2A 3AY8A 1LJRA 5IOWA 1Q98A 2BJXA 2V6OA 5CRWA 3Q19A 1RK4A 2VCTA 3GKKA 1K0MA 3ISOA 4G0IA 3KP9A 5AIVA 3CTFA 1JZDA 3GN3A 5D73A 2LQQA 3VPQA 4MLYA 1GUMA 2RLIA 3G9BA 4POMA 2CZ2A 3ZLPA 2LTKA 2FWEA 4KA0A 2HRKB 4TOPA 5J41A 4XS4A 2G2QA 3ZMKA 5ID2B 1PL1A 3KXOA 18GSA 1M2AA 2F51A 4KAEA 5FT3A 2X64A 2VD1A 4PXOA 3TJFA 4TN8A 3O6TA 5CRHA 1SKRB 1XW6A 4ML6A 3LYPA 1B4PA 3UMAA 3F0IA 1NHOA 1QQ2A 3ZZXA 3QDNA 3LJRA 5HFGA 3F8UA 1VF1A 3HD5A 3GX0A 1TI3A 3WGDA 2LRTA 4IP6A 6GSVA 1OE7A 2LEGA 3H4KA 2AJQB 1QXHA 2L59A 1ZOFA 2MZCA 2VL9A 1F2EA 4PQHA 1A8YA 3P90A 3GNJA 1QFNA 2GLRA 3C71A 2HQTA 2WGRA 4IW9A 3LYKA 1H75A 2A2SA 3FZ9A 2FA8A 2MYGA 3SBCA 2O87A 6GSYA 1OC8A 4DVCA 3N9JA 1DE2A 1A24A 2V6KA 2DMLA 4TR1A 2PVQA 1EP7A 1TOFA 2H1GA 1EGOA 4EUYA 4Q5FA 5A4WA 4WF4A 2VM1A 1FB6A 2H6ZA 1K0OA 3GL5A 3ZFLA 1O8XA 3KIJA 4EL1A 5L71A 1AUCA 5D96A 3D4MA 1ZMAA 4V2NA 1YEXA 4XRAA 4F03A 3W8JA 4PNGA 4ECCA 3ED3A 4H86A 11GSA 4YH2A 1X5CA 1EV9A 4OFNA 2JACA 3RBTA 5AGYA 3UBKA 1A2LA 3L9VA 3EU4A 5B6NA 2HZFA 1EWXA 2P5RA 2B3SA 4O5RA 3C1SA 1FB0A 2GQKA 1Q4JA 3WGEA 1G0TA 4AJ6A 4RQRA 2DJ2A 5JWOB 3IC8A 3PGTA 2QGVA 2VLVA 7GSSA 1TU7A 4MPGA 1QUWA 1LU4A 3UAPA 4N0ZA 1XWGA 2B5EA 4LLRA 3CRUA 2HRKA 4Q5NA 4K6XA 1PRXA 1GTUA 3G7YA 1J08A 4POKA 3C8EA 2G0FA 5ID2A 3L9SA 4IJ3A 5GSTA 3IK7A 4OO5A 2MMAA 4MH2A 2OE0A 2H0IA 3IE3A 3BCKA 1O81A 2KHPA 3MWHA 1TP9A 1FW1A 4WBRD 1BAYA 3UOMA 4NHZA 5JCWA 1T1VA 3M8NA 2OA7A 4FH8A 1GUKA 3FKFA 3R3EA 1XIYA 3DD3A 6GSSA 2DJKA 3KMOA 3H79A 2ON5A 2ZUPA 3EMXA 1R26A 5ECOB 4NV2A 4E8EA 2GT6A 1S3DA 1SKWB 2R37A 3F3QA 2H0HA 2OBKA 1SL1B 1MTCA 2FWHA 5DJLA 1WRYA 2GZPA 3ZREA 1X9SB 13GSA 1ML6A 3IRAA 4WR4A 2GSSA 1M7TA 2JZSA 2VO4A 3M9JA 2A4VA 5KN3A 1BJXA 1AXDA 1R4WA 2N5AA 2Z9SA 4F0CA 3VI7A 4RQXA 5JWQB 2L4QA 1JZRA 5ECMB 3VWVA 4I8BA 2V41A 2WJUA 1PD21 1VF2A 20GSA 5F07A 1TK8B 2H19A 5ECNB 3GURA 3PINA 3F4RA 1N2AA 2C4JA 2YWMA 3GIXA 1XZOA 2XC2A 3HCZA 2FGXA 1EP8A 1XBSA 2M80A 4TRXA 2PPTA 4KDXA 1GH2A 4GSNA 3RDWA 5G5FA 1TRWA 5D93A 3LORA 4E8HA 4HOJA 2XPEA 2DMMA 1O85A 5KN1A 2J23A 2B1LA 4MA9A 3U5RE 3V1WA 4ISDA 1USBA 4K7OA 4BVXB 1WPIA 2B6MA 3EWLA 1RQMA 2DIZA 2MMNA 2DIYA 2TRCP 1ZCPA 1UVZA 4BVYB 3FZAA 2H0GA 3EMPA 2ZNMA 1WE0A 3GHAA 4YQMA 2F8FA 3L78A 1CQGA 10GSA 5H5RA 3DXBA 3LSZA 3F9UA 2YPMA 1FG4A 1XOAA 2AHEA 3JCML 1ON4A 2GZYA 1ABAA 4K0GA 1M2DA 4ZB9A 4TW5A 3FR9A 3GYKA 4FIWA 2VCZA 2LS5A 5JWRB 4NXIA 4TR4A 5DCGA 1UC7A 1XOBA 1Y6EA 3DRNA 4NWYA 4PUFC 5EY6A 2K8SA 5GZZB 1A2MA 5F8BA 1SYRA 2IJYA 5HR0A 1THOA 2H01A 2NTOA 3IDVA 4BWSA 1X9MB 5EL8A 5B7CA 1MD4A 2HZEB 4EO3A 3SWLA 1WP0A 19GSA 1K3LA 2C1YA 2LV3A 3HJMA 4JU5A 1J0FA 4N11A 5B8AA 2VM2A 4GTUA 2WCIA 3EINA 3TKSA 5BMUA 4G0LA 4IELA 3Q74A 4L5LA 4GLTA 4MF7A 3NIVA 4ZIJA 4K0NA 1BYEA 2P0GA 1R5AA 3UVHA 4GXZA 4KF9A 3QCPA 5ELGA 4MF5A 4KX4A 3CSJA 5KN2A 2O85A 3ZVJA 1O73A 1URMA 2C0EA 5IMZA 2GS3A
chains in the Genus database with same CATH superfamily
1PKWA 1V40A 5ECHB 2YN1A 4LA1A 2X99A 4OWYA 3FHKA 2V2GA 5J9CA 4OD7A 3FRCA 4YKGA 3VLNA 4RI7A 2P5QA 1GTIA 3CTGA 5IMDA 4IHUA 1OYJA 4MK3A 1MEKA 4TXVA 2QSIA 4BVXA 3H93A 2VKZG 5F05A 2XPDA 4BVYA 3LG6A 5G1KA 1BG5A 2X8HA 3VWUA 2CVDA 2IPAA 1TXXA 4Z2TA 1AC1A 2ZCTA 1O8WA 1TI1A 2MBSA 3F4SA 3HVXA 4YQUA 5A4UA 1T8EB 3RGBC 2CAQA 2OT3A 4FYCA 4EIPA 2YNXA 1MDKA 1FAAA 3P8WA 4MNNA 4GSSA 3DIEA 4OCEA 5ABRA 3CHXC 1GP1A 3CBUA 1PGTA 2YZHA 2HXKA 2DJJA 1K0DA 3DEXA 3G7IA 2FD3A 1F3BA 4NAXA 4Q5QA 1K0NA 4WBJA 5J9BA 5AISA 4KDYA 1ZGNA 2RUFA 3IAS2 1VRSD 3ZVJD 2XBIA 2VAFA 2HE3A 4AJ8A 1Y25A 1N8JA 2AYTA 3CRTA 2E2MA 5A1NB 2FWFA 5AIXA 4MF6A 1VF4A 1XWAA 3IOSA 2C3QA 2HZEA 2I9HA 3R2QA 1WOUA 2R2JA 1FVJA 4JBBA 3TKSC 4I6XA 3CSHA 5A5KA 2HRFA 3I43A 2OADA 1ZYQB 4PQ1A 1EOHA 3MAKA 1AQXA 1UN2A 1I9DA 4TVEA 4CY6A 4HJMA 4MZBA 2I4AA 3O3TA 5DAKB 1A0RP 1SK0A 1OKTA 3S9FA 2VLTA 2QC7A 2CX4A 2I1UA 3UJ1A 1Y1UA 5HFKA 2BTOT 2H71A 14GSA 2LNTA 2KLXA 1DUGA 5LD0A 4O7HA 2CVKA 3APSA 1GNWA 1SVMA 4GDFA 3D5JA 2HYXA 1K0AA 3KM6A 4N30A 1OC9B 4OCFA 5G1LA 4CY8A 1ZYPA 5IPHA 2JSZA 2TRXA 1XXUA 5CYYA 2VCVA 2K8VA 2IMDA 2FWGA 3GH6A 3A2VA 1YEWC 5J4UA 4ZB8A 1ERWA 1DSBA 1FVKA 1TJDA 1XWBA 2RM6A 2EFHA 3M9KA 5CO3A 5DVBA 2F8AA 2OE3A 2IMEA 3ZIJA 3LFLA 4NHWA 3GKMA 4MZWA 4EVMA 1OC3A 3J7Yb 2PU9C 1UA5A 4RUVA 1DE1A 1YJ6A 1PSQA 3QFBC 4JR4A 3CYNA 3ERWA 1ERVA 5ECIB 1ACVA 1V57A 1Z3EA 2C80A 2DBCA 2LRNA 4DSSB 2B5YA 4WR5A 3KTLA 2XBQA 1ZYEA 4KNDA 1SYXA 2LSTA 4KGIA 3WT2A 3VK9A 4WF5A 3D0ZA 1ST9A 2JSYA 4YKFA 1M99A 1PA3A 2UZ8A 4XTSA 2H74A 4HU9A 2OKAA 4OO4A 2HRNA 4X4JA 1H4OA 1GSDA 3QAVA 1A0FA 1ZZYA 2TIRA 4K7NA 1SD9A 1XWCA 1TDIA 5ECSA 1SJZA 2BMXA 2DSAA 3RPPA 4V2LA 2GZZA 2RUEA 4AKXB 2FNOA 3M3MA 5ECKB 5HQPA 1V58A 5FHIA 5J47A 1Z5YE 4BPYA 2D2ZA 1Z7PA 4Q5RA 2YJ7A 3KEBA 3QD9A 3FZ4A 2VCXA 4ECIA 1A2JA 1EEMA 2B7KA 1TTZA 5J4VA 1V2AA 2XHFA 1XCCA 4DSRA 3EURA 1JLVA 2VLUA 5DAKA 4EF0A 1YQ1A 1K0BA 3ME8A 3NZNA 4KB3A 1ZL9A 1YY7A 4XS6A 2H1LA 2WULA 1GLPA 1BQ7A 1XVQA 2PBJA 2K6VA 3TCOA 2KP2A 3WT1A 3IV4A 3A2XA 4D73B 1GL8A 2HFDA 2WDUA 3KD0A 4WXTA 5DALB 2H6XA 2C0GA 2L4CA 2C8UA 2YCDA 3HYPA 4OMVA 5D9WA 4PURA 4GRFA 3RPNA 5KEJA 3HY2A 1OC9A 4MDCA 1AQWA 1B9XC 2QA2A 4IP1A 2GVPA 1SENA 1B8XA 4XRDA 1GTBA 3HVSA 5GSSA 2YWIA 4ZBAA 1B4QA 1HNCA 2WZ9A 3GSTA 4PUAA 3GRXA 3TOUA 4AKIA 4N3ZA 3L9UA 1JLWA 3TDGA 4ML1A 5H5QA 3FR6A 3ERFA 2FA4A 2MBTA 4K9ZA 2GTUA 2MMOA 2HI7A 3FR3A 4IJIA 2WVZA 1X9WB 1AW9A 2FY6A 2NPBA 3VWXA 2P31A 1A8LA 4L0WA 1OVNA 2R6KA 17GSA 1B48A 4PX1A 1G7OA 1SVOA 5B8BA 4IS0A 1PX7A 1MD3A 2WFCA 3TKQA 1AIUA 4O32A 4HDEA 2DC5A 2DJ1A 2GDRA 2X49A 3I6AA 1EGRA 5ECQB 4GCIA 1YZXA 4ZILA 4FQUA 1W89A 3ZMLA 3DYRA 3HJPA 4GQCA 4TKYA 3DWVA 1LBKA 5ECLB 3TJBA 5DQSA 4XHMA 5LNKe 3MDKA 3J7Yk 3TGZA 3P2AA 3PPUA 1QGVA 5H5SA 5G30A 1Z6NA 5INYA 1WMJA 2PUKC 2IMKA 3M0FA 1NM3A 1KNGA 5E4WA 1XW9A 5ECRB 4TR3A 3DVXA 3HXSA 3GFKA 4CHSA 2GSRA 3VURA 2WW0A 4ECJA 4RI6A 2YV9A 2K9FA 3FMWA 1SL2B 4KCEA 3ERGA 1ERUA 2JZTA 3HDCA 3GUSA 4G2EA 3KP8A 4MJBA 3GKXA 3VI5A 4AI6A 4KSMA 5KOXA 1FHEA 1WWJA 2IFQB 1TRUA 3WYWA 2L5LA 3RHBA 4JRRA 3BD2A 3UBLA 3EU3A 4KW6A 1SK2A 3Q18A 5FWGA 5EPFA 4X1UA 2O89A 4N0VA 4KUNA 4K2DA 4D73A 2GT5A 1YDKA 3RFRC 4ILFA 2WW1A 5DALA 1U6TA 2CX3A 4AJ7A 2V1MA 2YANA 4QQ7A 2O8VB 1SD8A 5D9XA 1PL2A 2VL3A 2LJRA 3VWWA 4Z2RA 4PI2C 1S3RA 5A4VA 1T4ZA 4BIKA 3US3A 2V32A 3GH9A 5F06A 3EC3A 4IQAA 2UV8G 2HLSA 2F3MA 2E0QA 5E59A 5G5EA 3ZYWA 4FYUA 5KN0A 3D6IA 5D8IA 2K18A 3TJKA 6GSXA 2O5VA 3LQ7A 4V1Ap 1SJ6A 4L8EA 4LMWA 4AF2A 4KH7A 1PN9A 4E68A 4MPFA 1XFLA 5IMFA 2CA8A 3TRPA 1OE8A 4X43A 2EIRA 4MMMA 2E2GA 5IOXA 1PN0A 1FO5A 2NVLA 4MP4A 3FZ5A 2IMIA 2CVBA 2L5OA 1T4YA 3H8QA 4K1FA 3NOFA 4EXJA 3HVNA 3ME7A 1TK5B 4PTSA 5GAND 2WB9A 5C04A 4ACSA 3D21A 3W8SA 4GSTA 2YWNA 4ZL9A 4G0KA 2LNSA 4GF0A 2E7PA 2JZRA 5IO0A 2R0PA 2VUPA 5IIZA 2WW3A 3QPMA 4HUAA 2L6CA 2M72A 2KP1A 4HQZA 3KCMA 1I1IP 5DDLA 2KOKA 1Z7RA 4MZCA 1SU9A 3P7XA 3QMXA 2FUG2 4N10A 4EKZA 4OFMA 2HSHA 5DBQA 3IHQA 1T3BA 4EDYA 2H6YA 2B5XA 1G7EA 1Z9HA 3HA9A 2I81A 1M2BA 3BBYA 4DSQA 4XIHA 2ALBA 3BOAA 3KGKA 4K8MA 3VFIA 5IPGA 3KMNA 2KUCA 1TRSA 2C0DA 3LWAA 2C3NA 4A5PA 5A5HB 4TXOB 4F9ZA 2R3XA 4ID0A 5CNWA 1EOGA 1VGLA 3TKPA 3EE2A 2IFQA 2VL2A 4POLA 1XW5A 2HNLA 1I5GA 4J2FA 1C72A 5GAPD 3ZITA 3L0HA 1MDIA 5G31A 1TKDB 3RHCA 2AV4A 5EVOA 2HSYA 4AGSA 6GSTA 4PHZC 1TK0B 3CXGA 4IN0A 2C3TA 3E0UA 4IVFA 3KTBA 2YZUA 2VD0A 4USSA 4JR6A 2YWOA 4HQSA 1XVWA 3WD6A 1GULA 4ECBA 1FOVA 2L57A 3I9V2 4WEYA 4Z7XA 12GSA 4ZB6A 2B7JA 3GL3A 3BJ5A 2O36A 2N5FA 4QL9A 3O76A 2OJLA 2GQLA 4JE1A 4KSOA 5D9TA 1B9YC 4F0BA 2H73A 1PKZA 3UEMA 4L0UA 4FYBA 1XPVA 3GV1A 2EIQA 3C73A 5IMVA 1GSYA 4P3YB 5C00A 1V9WA 5J4YA 1HQOA 3A5IA 1FOHA 2A2RA 4MJEA 1M3IA 2CAIA 2YV7A 3U6VA 2PN8A 4ZL8A 2AB6A 22GSA 3TB2A 2PGTA 3IA1A 1PX6A 1J9BA 1JZOA 4HS1A 2X8GA 3VPTA 2QA1A 4WKWA 3GSSA 3APQA 4EIQA 4KCAA 3LW9A 4EDZA 5G2ZA 2H8LA 3H1NA 4F2IA 3CWGA 2X4AA 5LCZA 2WRTA 2RIIA 2WVXB 5IO2A 2O7KA 5J5NA 4MCUA 4HSCX 1E6BA 3IXRA 1F9MA 5CAXA 2VOCA 5ENUA 3QOUA 3ZRDA 8GSSA 3TUEA 1HD2A 5ECPB 1R5PA 2FLSA 3APOA 2JL4A 1THXA 2VL2C 2IN3A 3UARA 3G7JA 1F37A 1T7PB 2ES7A 3PR8A 2CQ9A 1YEPA 3A5WA 5A5HA 4ZXGA 4TXOA 1EV4A 4JEDA 3A3TA 4FXYP 3F3RA 1SJIA 2H76A 4ULXA 2CZ3A 3TOTA 1PFOA 1M9AA 1F6MC 2EIOA 3FEUA 2IL3A 4CDOA 2R0CA 2N5BA 3HVVA 2I3YA 1TXUA 2H70A 4ZL7A 4IBPA 1BX9A 5IQYA 4EC0A 1NHYA 5A1NA 5F0GA 4MH3A 2PVOC 3TRQA 4LL1B 1DBYA 4IGJA 4ZBBA 1W4VA 3ZFBA 2VIMA 4HZ4A 1U87A 4LL4B 2EFCA 16GSA 1QK8A 4WETA 5J3RA 5HR1A 3CSIA 1GUHA 3Q6OA 1PQNA 1VF3A 2VCWA 2GGTA 1AQVA 1SKSB 2H66A 4V1Ag 1SL0B 3HMJG 2NBSA 3N5OA 3ZIVA 2GSQA 4I5QA 1GSEA 5DCHA 2PMTA 1EZKA 2C0FA 1M0UA 3HJOA 2CT6A 2LKUA 3UIWA 2VCQA 3F6FA 6GSUA 3D4TA 3EYTA 5CREA 1A23A 4NPBA 1O6JA 1HNAA 2NDOA 1KBNA 2H1BA 4I97A 1KEBA 2H30A 2HSNB 1EEJA 3HKRA 2ON7A 4AKHA 1G6YA 4HI7A 1K3OA 5KOWA 2H72A 5HR3A 4JZQA 4K2XA 4BWQA 1X5DA 5CRGA 3GTUB 4MJCA 3FYGA 2L6DA 3W6GA 4G10A 3TRXA 2EFEA 4IKHA 1GTAA 1SVLA 2WVXA 2JU5A 1Z6MA 1GSQA 2B1KA 1X5EA 2IWTA 5DQYA 2GQMA 2H1AA 1S3AA 2RM5A 4V2MA 3MNGA 2YJHA 3LXTA 1HYUA 5B6MA 5IM9A 3HZ8A 4DSSA 2WS2A 3TJJA 2DLXA 4G19A 3IPZA 3F4TA 1S4BP 3CMIA 3M1GA 3I69A 3DVWA 2R4VA 1E2YA 2FHEA 3DGQA 2OE1A 3LXZA 5D9VA 2IIYA 1NW2A 1S3CA 3IBHA 4YAPA 2QKEA 3FW2A 4BA7A 3F6DA 3TU3B 3C1RA 3WGXA 2A2PA 1G6WA 4GWRA 4NV5A 1IYIA 2LQOA 2YP6A 3E9JB 3K8NA 5CP1A 1V98A 1OKDA 1CQHA 3CQFA 1K0CA 1YF1A 5J40A 2FCHA 2X8CA 1HNBA 1PMTA 5IMAA 4K7IA 2LRCA 3A2WA 4PQIA 2LJAA 2PWJA 1OAZA 2HRAA 2DKHA 5COHA 1GNEA 3FK8A 3KH9A 4MJAA 4L5OA 4FO5A 4HEA2 5A34B 2HSMB 4TR0A 1YKAA 3F63A 2JADA 1GSFA 1WIKA 3EVIA 3LGCA 2A4HA 1U88A 3GA4A 1GLQA 5CRDA 1KTEA 4HJ2A 4BL7B 6GSWA 4I2TA 4DEJA 4F82A 4PNFA 2HSNA 3GMFA 4G9HA 2IMFA 5HFIA 1GSSA 4XCSA 4J56E 4NMUA 3KH7A 4POBA 3GTUA 1YF0A 1K3YA 2H1DA 4HU7A 4YQVA 1AAZA 1SK1A 4KDUA 2DKIA 3LEFA 3ZTLA 3DKSA 5DJMA 2WVYA 1JZWA 3BCIA 2PERA 1ERTA 3L4NA 4XS4B 2F9SA 4XS1A 3TJGA 3OR5A 1TW9A 4J57E 3TKRA 1U3AA 4HZ2A 2EC4A 1XWKA 2MMZA 4CW9A 3KZQA 5JCUA 3QFAC 4LMVA 2R5GA 1MDJA 4IQ1A 2REMA 3GKNA 1JFUA 1TU8A 4KE3A 4QL7A 3UL3A 4EE0A 3HZ4A 3C7MA 1IYHA 1T00A 3IAM2 3D22A 4MABA 3ZL5A 1U3IA 3IK9A 3QR6A 3IR4A 4O92A 2DJ3A 1ILOA 3IC4A 2OACA 2YOIA 1YVLA 2DJ0A 1F3AA 1TRVA 4K5SA 1X0RA 3MSZA 1WJKA 3FY7A 2H75A 1GRXA 4PGTA 2J9HA 1M9BA 2AUVA 4YAVA 2HT9A 2M46A 2LJKA 5AN1A 1R7HA 4TR1B 9GSSA 5JCGA 3E3EA 1NSWA 2CV4A 1GSUA 3GX8A 3PH9A 4I2UA 2GSTA 1JHBA 2LUSA 3UVTA 3QAGA 3KJYA 1BG1A 5IMCA 4OFTA 3HHVA 1O7UA 3MIXA 1BEDA 4X0XA 2R0GA 1RW1A 5A34A 3DMLA 2HSMA 5ELAA 3TKSE 1QMVA 3RAZA 2EFDA 1GWCA 3QAWA 2AAWA 1YKCA 4ZBDA 4BL7A 4GQFA 2OBIA 5HR2A 3AY8A 1LJRA 5IOWA 1Q98A 2BJXA 2V6OA 5CRWA 3Q19A 1RK4A 2VCTA 4K5RA 3GKKA 4QMKA 1K0MA 3ISOA 4G0IA 3KP9A 5AIVA 3CTFA 1JZDA 3GN3A 5D73A 2LQQA 3VPQA 4MLYA 1GUMA 2RLIA 3G9BA 4POMA 2CZ2A 3ZLPA 2LTKA 2FWEA 4KA0A 2HRKB 4TOPA 5J41A 4XS4A 2G2QA 3ZMKA 5ID2B 1PL1A 3KXOA 18GSA 1M2AA 2F51A 4KAEA 5FT3A 2X64A 2VD1A 4PXOA 3TJFA 4TN8A 3O6TA 5CRHA 1SKRB 1XW6A 4ML6A 3LYPA 1B4PA 3UMAA 3F0IA 1NHOA 1QQ2A 3ZZXA 3QDNA 3LJRA 5HFGA 3F8UA 1VF1A 3HD5A 3GX0A 1TI3A 3WGDA 2LRTA 4IP6A 1M3JA 6GSVA 3IHGA 1OE7A 2LEGA 3H4KA 2AJQB 1QXHA 2L59A 1ZOFA 1ZYNA 2MZCA 2VL9A 1F2EA 4PQHA 1A8YA 3P90A 3GNJA 1QFNA 2GLRA 3C71A 2HQTA 2WGRA 4IW9A 3LYKA 1H75A 2A2SA 3FZ9A 2FA8A 2MYGA 4W66A 3SBCA 2O87A 6GSYA 1OC8A 4DVCA 3N9JA 1DE2A 1A24A 2V6KA 2DMLA 4TR1A 2PVQA 1EP7A 1TOFA 2H1GA 1EGOA 4Z2UA 4EUYA 4Q5FA 5A4WA 4WF4A 2VM1A 4G01A 1FB6A 2H6ZA 1K0OA 3GL5A 3ZFLA 1O8XA 3KIJA 4EL1A 5L71A 1AUCA 5D96A 3D4MA 1ZMAA 4V2NA 1YEXA 4XRAA 4F03A 3W8JA 4PNGA 4ECCA 3ED3A 4H86A 4O5UA 11GSA 4YH2A 1X5CA 1EV9A 4OFNA 2JACA 3RBTA 5AGYA 3UBKA 1A2LA 3L9VA 3EU4A 5B6NA 1N25A 2HZFA 1EWXA 2P5RA 2B3SA 4O5RA 3C1SA 1FB0A 2GQKA 4PI0C 1Q4JA 3WGEA 1G0TA 4AJ6A 4RQRA 2DJ2A 5JWOB 3IC8A 3PGTA 2QGVA 2VLVA 7GSSA 1TU7A 4MPGA 1QUWA 1LU4A 3UAPA 4N0ZA 1XWGA 2B5EA 4LLRA 3CRUA 2HRKA 4Q5NA 4K6XA 1PRXA 1GTUA 3MYDA 3G7YA 1J08A 4POKA 3C8EA 2G0FA 5ID2A 3L9SA 4IJ3A 5GSTA 3IK7A 4OO5A 2MMAA 4MH2A 2OE0A 2H0IA 3IE3A 3BCKA 1O81A 2KHPA 3MWHA 1TP9A 1FW1A 4WBRD 1BAYA 3UOMA 4NHZA 5JCWA 1T1VA 3M8NA 2OA7A 4FH8A 1GUKA 3FKFA 3R3EA 1XIYA 3DD3A 6GSSA 2DJKA 5BRTA 2WW2A 3KMOA 3H79A 2ON5A 2ZUPA 3EMXA 1R26A 5ECOB 4NV2A 4E8EA 2GT6A 1S3DA 1SKWB 2R37A 3F3QA 4AKGA 2H0HA 2OBKA 1SL1B 1MTCA 2FWHA 5DJLA 1WRYA 2GZPA 3ZREA 1X9SB 13GSA 1ML6A 3IRAA 4WR4A 2GSSA 1M7TA 2JZSA 2VO4A 3M9JA 2A4VA 5KN3A 1BJXA 1AXDA 1R4WA 2N5AA 2Z9SA 4F0CA 3VI7A 5BMUB 4RQXA 5JWQB 2L4QA 1JZRA 5ECMB 3VWVA 4I8BA 2V41A 2WJUA 1PD21 1VF2A 20GSA 5F07A 1TK8B 2H19A 5ECNB 3GURA 3PINA 3F4RA 1N2AA 2C4JA 2YWMA 3GIXA 1XZOA 2XC2A 3HCZA 2FGXA 1EP8A 1XBSA 2M80A 4O5QA 4TRXA 2PPTA 4KDXA 1GH2A 4GSNA 3RDWA 5G5FA 1TRWA 5D93A 3LORA 4E8HA 4ICYA 4HOJA 2XPEA 2DMMA 1O85A 5KN1A 2J23A 2B1LA 4MA9A 3U5RE 3V1WA 4ISDA 1USBA 4K7OA 4BVXB 1WPIA 2B6MA 3EWLA 1RQMA 2MMNA 2DIZA 2DIYA 2TRCP 1ZCPA 1UVZA 4BVYB 3FZAA 2H0GA 3EMPA 2ZNMA 1WE0A 3GHAA 4YQMA 2F8FA 3L78A 1CQGA 10GSA 5H5RA 3DXBA 3LSZA 3F9UA 2YPMA 1FG4A 1XG8A 1XOAA 2AHEA 3JCML 1ON4A 2GZYA 1ABAA 4K0GA 1M2DA 4ZB9A 4TW5A 3FR9A 3GYKA 4FIWA 2VCZA 2LS5A 5JWRB 4NXIA 4TR4A 5DCGA 1UC7A 1XOBA 1Y6EA 3DRNA 4NWYA 4PUFC 5EY6A 2K8SA 5GZZB 1A2MA 5F8BA 1SYRA 2IJYA 5HR0A 1THOA 2H01A 2NTOA 3IDVA 4BWSA 1X9MB 5EL8A 5B7CA 1MD4A 2HZEB 4EO3A 3SWLA 1WP0A 19GSA 4ZB7A 1K3LA 2WZSA 2C1YA 2LV3A 3HJMA 4JU5A 1J0FA 4N11A 5B8AA 2VM2A 4GTUA 2WCIA 3EPTA 3EINA 3TKSA 5BMUA 4G0LA 4IELA 3Q74A 4L5LA 4GLTA 4MF7A 3NIVA 4ZIJA 4K0NA 1BYEA 2P0GA 1R5AA 3UVHA 4GXZA 4KF9A 3QCPA 5ELGA 4MF5A 4KX4A 3CSJA 5KN2A 1BF5A 2O85A 2O3EA 3ZVJA 1O73A 1URMA 2C0EA 5IMZA 2GS3A
chains in the Genus database with same CATH topology
1PKWA 1V40A 5ECHB 2YN1A 4LA1A 2X99A 4OWYA 3FHKA 2V2GA 5J9CA 4OD7A 3FRCA 4YKGA 3VLNA 4RI7A 2P5QA 1GTIA 3CTGA 5IMDA 4IHUA 1OYJA 4MK3A 1MEKA 4TXVA 2QSIA 4BVXA 3H93A 2VKZG 5F05A 2XPDA 4BVYA 3LG6A 5G1KA 1BG5A 2X8HA 3VWUA 2CVDA 2IPAA 1TXXA 4Z2TA 1AC1A 2ZCTA 1O8WA 1TI1A 2MBSA 3F4SA 3HVXA 4YQUA 5A4UA 1T8EB 2CAQA 2OT3A 4FYCA 4EIPA 2YNXA 1MDKA 1FAAA 3P8WA 4MNNA 4GSSA 3DIEA 4OCEA 5ABRA 1GP1A 3CBUA 1PGTA 2YZHA 2HXKA 2DJJA 1K0DA 3DEXA 3G7IA 2FD3A 1F3BA 4NAXA 4Q5QA 1K0NA 4WBJA 5J9BA 5AISA 4KDYA 1ZGNA 2RUFA 3IAS2 1VRSD 3ZVJD 2XBIA 2VAFA 2HE3A 4AJ8A 1Y25A 1N8JA 2AYTA 3CRTA 2E2MA 5A1NB 2FWFA 5AIXA 4MF6A 1VF4A 1XWAA 3IOSA 2C3QA 2HZEA 2I9HA 3R2QA 1WOUA 2R2JA 1FVJA 4JBBA 3TKSC 4I6XA 3CSHA 5A5KA 2HRFA 3I43A 2OADA 1ZYQB 4PQ1A 1EOHA 3MAKA 1AQXA 1UN2A 1I9DA 4TVEA 4CY6A 4HJMA 4MZBA 2I4AA 3O3TA 5DAKB 1A0RP 1SK0A 1OKTA 3S9FA 2VLTA 2QC7A 2CX4A 2I1UA 3UJ1A 1Y1UA 5HFKA 2BTOT 2H71A 14GSA 2LNTA 2KLXA 1DUGA 5LD0A 4O7HA 2CVKA 3APSA 1GNWA 1SVMA 4GDFA 3D5JA 2HYXA 1K0AA 3KM6A 4N30A 1OC9B 4OCFA 5G1LA 4CY8A 1ZYPA 5IPHA 2JSZA 2TRXA 1XXUA 5CYYA 2VCVA 2K8VA 2FWGA 2IMDA 3GH6A 3A2VA 5J4UA 4ZB8A 1ERWA 1DSBA 1FVKA 1TJDA 1XWBA 2RM6A 2EFHA 3M9KA 5CO3A 5DVBA 2F8AA 2OE3A 2IMEA 3ZIJA 3LFLA 4NHWA 3GKMA 4MZWA 4EVMA 1OC3A 3J7Yb 2PU9C 1UA5A 4RUVA 1DE1A 1YJ6A 1PSQA 3QFBC 4JR4A 3CYNA 3ERWA 1ERVA 5ECIB 1ACVA 1V57A 1Z3EA 2C80A 2DBCA 2LRNA 4DSSB 2B5YA 4WR5A 3KTLA 2XBQA 1ZYEA 4KNDA 1SYXA 2LSTA 4KGIA 3WT2A 3VK9A 4WF5A 3D0ZA 1ST9A 2JSYA 4YKFA 1M99A 1PA3A 2UZ8A 4XTSA 2H74A 4HU9A 2OKAA 4OO4A 2HRNA 4X4JA 1H4OA 1GSDA 3QAVA 1A0FA 1ZZYA 2TIRA 4K7NA 1SD9A 1XWCA 1TDIA 5ECSA 1SJZA 2BMXA 2DSAA 3RPPA 4V2LA 2GZZA 2RUEA 4AKXB 2FNOA 3M3MA 5ECKB 5HQPA 1V58A 5FHIA 5J47A 1Z5YE 4BPYA 2D2ZA 1Z7PA 4Q5RA 2YJ7A 3KEBA 3QD9A 3FZ4A 2VCXA 4ECIA 1A2JA 1EEMA 2B7KA 1TTZA 5J4VA 1V2AA 2XHFA 1XCCA 4DSRA 3EURA 1JLVA 2VLUA 5DAKA 4EF0A 1YQ1A 1K0BA 3ME8A 3NZNA 4KB3A 1ZL9A 1YY7A 4XS6A 2H1LA 2WULA 1GLPA 1BQ7A 1XVQA 2PBJA 2K6VA 3TCOA 2KP2A 3WT1A 3IV4A 3A2XA 4D73B 1GL8A 2HFDA 2WDUA 3KD0A 4WXTA 5DALB 2H6XA 2C0GA 2L4CA 2C8UA 2YCDA 3HYPA 4OMVA 5D9WA 4PURA 4GRFA 3RPNA 5KEJA 3HY2A 1OC9A 4MDCA 1AQWA 1B9XC 2QA2A 4IP1A 2GVPA 1SENA 1B8XA 4XRDA 1GTBA 3HVSA 5GSSA 2YWIA 4ZBAA 1B4QA 1HNCA 2WZ9A 3GSTA 4PUAA 3GRXA 3TOUA 4AKIA 4N3ZA 3L9UA 1JLWA 3TDGA 4ML1A 5H5QA 3FR6A 3ERFA 2FA4A 2MBTA 4K9ZA 2GTUA 2MMOA 2HI7A 3FR3A 4IJIA 1X9WB 1AW9A 2FY6A 2NPBA 3VWXA 2P31A 1A8LA 4L0WA 1OVNA 2R6KA 17GSA 1B48A 4PX1A 1G7OA 1SVOA 5B8BA 4IS0A 1PX7A 1MD3A 2WFCA 3TKQA 1AIUA 4O32A 4HDEA 2DC5A 2DJ1A 2GDRA 2X49A 3I6AA 1EGRA 5ECQB 4GCIA 1YZXA 4ZILA 4FQUA 1W89A 3ZMLA 3DYRA 3HJPA 4GQCA 4TKYA 3DWVA 1LBKA 5ECLB 3TJBA 5DQSA 4XHMA 5LNKe 3MDKA 3J7Yk 3TGZA 3P2AA 3PPUA 1QGVA 5H5SA 5G30A 1Z6NA 5INYA 1WMJA 2PUKC 2IMKA 3M0FA 1NM3A 1KNGA 5E4WA 1XW9A 5ECRB 4TR3A 3DVXA 3HXSA 3GFKA 4CHSA 2GSRA 3VURA 4ECJA 4RI6A 2YV9A 2K9FA 3FMWA 1SL2B 4KCEA 3ERGA 1ERUA 2JZTA 3HDCA 3GUSA 4G2EA 3KP8A 4MJBA 3GKXA 3VI5A 4AI6A 4KSMA 5KOXA 1FHEA 1WWJA 2IFQB 1TRUA 3WYWA 2L5LA 3RHBA 4JRRA 3BD2A 3UBLA 3EU3A 4KW6A 1SK2A 3Q18A 5FWGA 5EPFA 4X1UA 2O89A 4N0VA 4KUNA 4K2DA 4D73A 2GT5A 1YDKA 4ILFA 5DALA 1U6TA 2CX3A 4AJ7A 2V1MA 2YANA 4QQ7A 2O8VB 1SD8A 5D9XA 1PL2A 2VL3A 2LJRA 3VWWA 4Z2RA 5A4VA 1T4ZA 3US3A 2V32A 3GH9A 5F06A 3EC3A 4IQAA 2UV8G 2HLSA 2F3MA 2E0QA 5E59A 5G5EA 3ZYWA 4FYUA 5KN0A 3D6IA 5D8IA 2K18A 3TJKA 6GSXA 2O5VA 3LQ7A 4V1Ap 1SJ6A 4L8EA 4LMWA 4AF2A 4KH7A 1PN9A 4E68A 4MPFA 1XFLA 5IMFA 2CA8A 3TRPA 1OE8A 4X43A 2EIRA 4MMMA 2E2GA 5IOXA 1PN0A 1FO5A 2NVLA 4MP4A 3FZ5A 2IMIA 2CVBA 2L5OA 1T4YA 3H8QA 4K1FA 3NOFA 4EXJA 3ME7A 1TK5B 4PTSA 5GAND 2WB9A 5C04A 4ACSA 3D21A 3W8SA 4GSTA 2YWNA 4ZL9A 4G0KA 2LNSA 4GF0A 2E7PA 2JZRA 5IO0A 2R0PA 2VUPA 5IIZA 3QPMA 4HUAA 2L6CA 2M72A 2KP1A 4HQZA 3KCMA 5DDLA 2KOKA 1Z7RA 4MZCA 1SU9A 3P7XA 3QMXA 2FUG2 4N10A 4EKZA 4OFMA 2HSHA 5DBQA 3IHQA 1T3BA 4EDYA 2H6YA 2B5XA 1G7EA 1Z9HA 3HA9A 2I81A 1M2BA 3BBYA 4DSQA 4XIHA 2ALBA 3KGKA 3BOAA 4K8MA 3VFIA 5IPGA 3KMNA 2KUCA 1TRSA 2C0DA 3LWAA 2C3NA 4A5PA 5A5HB 4TXOB 4F9ZA 2R3XA 4ID0A 5CNWA 1EOGA 1VGLA 3TKPA 3EE2A 2IFQA 2VL2A 4POLA 1XW5A 2HNLA 1I5GA 4J2FA 1C72A 5GAPD 3ZITA 3L0HA 1MDIA 5G31A 1TKDB 3RHCA 2AV4A 5EVOA 2HSYA 4AGSA 6GSTA 1TK0B 3CXGA 4IN0A 2C3TA 3E0UA 4IVFA 3KTBA 2YZUA 2VD0A 4USSA 4JR6A 2YWOA 4HQSA 1XVWA 3WD6A 1GULA 4ECBA 1FOVA 2L57A 3I9V2 4WEYA 4Z7XA 12GSA 4ZB6A 2B7JA 3GL3A 3BJ5A 4QL9A 2N5FA 3O76A 2OJLA 2GQLA 4JE1A 4KSOA 5D9TA 1B9YC 4F0BA 2H73A 1PKZA 3UEMA 4L0UA 4FYBA 1XPVA 3GV1A 2EIQA 3C73A 5IMVA 1GSYA 4P3YB 5C00A 1V9WA 5J4YA 1HQOA 3A5IA 1FOHA 2A2RA 4MJEA 2CAIA 2YV7A 3U6VA 2PN8A 4ZL8A 2AB6A 22GSA 3TB2A 2PGTA 3IA1A 1PX6A 1J9BA 1JZOA 4HS1A 2X8GA 3VPTA 2QA1A 4WKWA 3GSSA 3APQA 4EIQA 4KCAA 3LW9A 4EDZA 5G2ZA 2H8LA 3H1NA 4F2IA 3CWGA 2X4AA 5LCZA 2WRTA 2RIIA 5IO2A 2O7KA 5J5NA 4MCUA 1E6BA 3IXRA 1F9MA 5CAXA 2VOCA 5ENUA 3QOUA 3ZRDA 8GSSA 3TUEA 1HD2A 5ECPB 1R5PA 2FLSA 3APOA 2JL4A 1THXA 2VL2C 2IN3A 3UARA 3G7JA 1F37A 1T7PB 2ES7A 3PR8A 2CQ9A 1YEPA 3A5WA 5A5HA 4ZXGA 4TXOA 1EV4A 4JEDA 3A3TA 3F3RA 1SJIA 2H76A 4ULXA 2CZ3A 3TOTA 2EIOA 1M9AA 1F6MC 3FEUA 2IL3A 4CDOA 2R0CA 2N5BA 3HVVA 2I3YA 1TXUA 2H70A 4ZL7A 4IBPA 1BX9A 5IQYA 4EC0A 1NHYA 5A1NA 5F0GA 4MH3A 2PVOC 3TRQA 4LL1B 1DBYA 4IGJA 4ZBBA 1W4VA 3ZFBA 2VIMA 4HZ4A 1U87A 4LL4B 2EFCA 16GSA 1QK8A 4WETA 5J3RA 5HR1A 3CSIA 1GUHA 3Q6OA 1PQNA 1VF3A 2VCWA 2GGTA 1AQVA 1SKSB 2H66A 4V1Ag 1SL0B 3HMJG 2NBSA 3N5OA 3ZIVA 2GSQA 4I5QA 1GSEA 5DCHA 2PMTA 1EZKA 2C0FA 1M0UA 3HJOA 2CT6A 2LKUA 3UIWA 2VCQA 3F6FA 6GSUA 3D4TA 3EYTA 5CREA 1A23A 4NPBA 1O6JA 1HNAA 2NDOA 1KBNA 2H1BA 4I97A 1KEBA 2H30A 2HSNB 1EEJA 3HKRA 2ON7A 4AKHA 1G6YA 4HI7A 1K3OA 5KOWA 2H72A 5HR3A 4JZQA 4K2XA 4BWQA 1X5DA 5CRGA 3GTUB 4MJCA 3FYGA 2L6DA 3W6GA 4G10A 3TRXA 2EFEA 4IKHA 1GTAA 1SVLA 2JU5A 1Z6MA 1GSQA 2B1KA 1X5EA 2IWTA 5DQYA 2GQMA 2H1AA 1S3AA 2RM5A 4V2MA 3MNGA 2YJHA 3LXTA 1HYUA 5B6MA 5IM9A 3HZ8A 4DSSA 2WS2A 3TJJA 2DLXA 4G19A 3IPZA 3F4TA 3CMIA 3M1GA 3I69A 3DVWA 2R4VA 1E2YA 2FHEA 3DGQA 2OE1A 3LXZA 5D9VA 2IIYA 1NW2A 1S3CA 3IBHA 4YAPA 2QKEA 3FW2A 4BA7A 3F6DA 3TU3B 3C1RA 3WGXA 2A2PA 1G6WA 4GWRA 4NV5A 1IYIA 2LQOA 2YP6A 3E9JB 3K8NA 5CP1A 1V98A 1OKDA 1CQHA 1K0CA 1YF1A 5J40A 2FCHA 2X8CA 1HNBA 1PMTA 5IMAA 4K7IA 2LRCA 3A2WA 4PQIA 2LJAA 2PWJA 1OAZA 2HRAA 2DKHA 5COHA 1GNEA 3FK8A 3KH9A 4MJAA 4L5OA 4FO5A 4HEA2 5A34B 2HSMB 4TR0A 1YKAA 3F63A 2JADA 1GSFA 1WIKA 3EVIA 3LGCA 2A4HA 1U88A 3GA4A 1GLQA 5CRDA 1KTEA 4HJ2A 4BL7B 6GSWA 4I2TA 4DEJA 4F82A 4PNFA 2HSNA 3GMFA 4G9HA 2IMFA 5HFIA 1GSSA 4XCSA 4J56E 4NMUA 3KH7A 4POBA 3GTUA 1YF0A 1K3YA 2H1DA 4HU7A 4YQVA 1AAZA 1SK1A 4KDUA 2DKIA 3LEFA 3ZTLA 3DKSA 5DJMA 1JZWA 3BCIA 2PERA 1ERTA 3L4NA 4XS4B 2F9SA 4XS1A 3TJGA 3OR5A 1TW9A 4J57E 3TKRA 1U3AA 4HZ2A 2EC4A 1XWKA 2MMZA 4CW9A 3KZQA 5JCUA 3QFAC 4LMVA 2R5GA 1MDJA 4IQ1A 2REMA 3GKNA 1JFUA 1TU8A 4KE3A 4QL7A 3UL3A 4EE0A 3HZ4A 3C7MA 1IYHA 1T00A 3IAM2 3D22A 4MABA 3ZL5A 1U3IA 3IK9A 3QR6A 3IR4A 4O92A 2DJ3A 1ILOA 3IC4A 2OACA 2YOIA 1YVLA 2DJ0A 1F3AA 1TRVA 4K5SA 1X0RA 3MSZA 1WJKA 3FY7A 2H75A 1GRXA 4PGTA 2J9HA 1M9BA 2AUVA 4YAVA 2HT9A 2M46A 2LJKA 5AN1A 1R7HA 4TR1B 9GSSA 5JCGA 3E3EA 1NSWA 2CV4A 1GSUA 3GX8A 3PH9A 4I2UA 2GSTA 1JHBA 2LUSA 3UVTA 3QAGA 3KJYA 1BG1A 5IMCA 4OFTA 3HHVA 1O7UA 3MIXA 1BEDA 4X0XA 2R0GA 1RW1A 5A34A 3DMLA 2HSMA 5ELAA 3TKSE 1QMVA 3RAZA 2EFDA 1GWCA 3QAWA 2AAWA 1YKCA 4ZBDA 4BL7A 4GQFA 2OBIA 5HR2A 3AY8A 1LJRA 5IOWA 1Q98A 2BJXA 2V6OA 5CRWA 3Q19A 1RK4A 2VCTA 4K5RA 3GKKA 4QMKA 1K0MA 3ISOA 4G0IA 3KP9A 5AIVA 3CTFA 1JZDA 3GN3A 5D73A 2LQQA 3VPQA 4MLYA 1GUMA 2RLIA 3G9BA 4POMA 2CZ2A 3ZLPA 2LTKA 2FWEA 4KA0A 2HRKB 4TOPA 5J41A 4XS4A 2G2QA 3ZMKA 5ID2B 1PL1A 3KXOA 18GSA 1M2AA 2F51A 4KAEA 5FT3A 2X64A 2VD1A 4PXOA 3TJFA 4TN8A 3O6TA 5CRHA 1SKRB 1XW6A 4ML6A 3LYPA 1B4PA 3UMAA 3F0IA 1NHOA 1QQ2A 3ZZXA 3QDNA 3LJRA 5HFGA 3F8UA 1VF1A 3HD5A 3GX0A 1TI3A 3WGDA 2LRTA 4IP6A 6GSVA 3IHGA 1OE7A 2LEGA 3H4KA 2AJQB 1QXHA 2L59A 1ZOFA 1ZYNA 2MZCA 2VL9A 1F2EA 4PQHA 1A8YA 3P90A 3GNJA 1QFNA 2GLRA 3C71A 2HQTA 2WGRA 4IW9A 3LYKA 1H75A 2A2SA 3FZ9A 2FA8A 2MYGA 4W66A 3SBCA 2O87A 6GSYA 1OC8A 4DVCA 3N9JA 1DE2A 1A24A 2V6KA 2DMLA 4TR1A 2PVQA 1EP7A 1TOFA 2H1GA 1EGOA 4Z2UA 4EUYA 4Q5FA 5A4WA 4WF4A 2VM1A 4G01A 1FB6A 2H6ZA 1K0OA 3GL5A 3ZFLA 1O8XA 3KIJA 4EL1A 5L71A 1AUCA 5D96A 3D4MA 1ZMAA 4V2NA 1YEXA 4XRAA 4F03A 3W8JA 4PNGA 4ECCA 3ED3A 4H86A 4O5UA 11GSA 4YH2A 1X5CA 1EV9A 4OFNA 2JACA 3RBTA 5AGYA 3UBKA 1A2LA 3L9VA 3EU4A 5B6NA 1N25A 2HZFA 1EWXA 2P5RA 2B3SA 4O5RA 3C1SA 1FB0A 2GQKA 1Q4JA 3WGEA 1G0TA 4AJ6A 4RQRA 2DJ2A 5JWOB 3IC8A 3PGTA 2QGVA 2VLVA 7GSSA 1TU7A 4MPGA 1QUWA 1LU4A 3UAPA 4N0ZA 1XWGA 2B5EA 4LLRA 3CRUA 2HRKA 4Q5NA 4K6XA 1PRXA 1GTUA 3MYDA 3G7YA 1J08A 4POKA 3C8EA 2G0FA 5ID2A 3L9SA 4IJ3A 5GSTA 3IK7A 4OO5A 2MMAA 4MH2A 2OE0A 2H0IA 3IE3A 3BCKA 1O81A 2KHPA 3MWHA 1TP9A 1FW1A 4WBRD 1BAYA 3UOMA 4NHZA 5JCWA 1T1VA 3M8NA 2OA7A 4FH8A 1GUKA 3FKFA 3R3EA 1XIYA 3DD3A 6GSSA 2DJKA 5BRTA 3KMOA 3H79A 2ON5A 2ZUPA 3EMXA 1R26A 5ECOB 4NV2A 4E8EA 2GT6A 1S3DA 1SKWB 2R37A 3F3QA 4AKGA 2H0HA 2OBKA 1SL1B 1MTCA 2FWHA 5DJLA 1WRYA 2GZPA 3ZREA 1X9SB 13GSA 1ML6A 3IRAA 4WR4A 2GSSA 1M7TA 2JZSA 2VO4A 3M9JA 2A4VA 5KN3A 1BJXA 1AXDA 1R4WA 2N5AA 2Z9SA 4F0CA 3VI7A 5BMUB 4RQXA 5JWQB 2L4QA 1JZRA 5ECMB 3VWVA 4I8BA 2V41A 2WJUA 1PD21 1VF2A 20GSA 5F07A 1TK8B 2H19A 5ECNB 3GURA 3PINA 3F4RA 1N2AA 2C4JA 2YWMA 3GIXA 1XZOA 2XC2A 3HCZA 2FGXA 1EP8A 1XBSA 2M80A 4O5QA 4TRXA 2PPTA 4KDXA 1GH2A 4GSNA 3RDWA 5G5FA 1TRWA 5D93A 3LORA 4E8HA 4ICYA 4HOJA 2XPEA 2DMMA 1O85A 5KN1A 2J23A 2B1LA 4MA9A 3U5RE 3V1WA 4ISDA 1USBA 4K7OA 4BVXB 1WPIA 2B6MA 3EWLA 1RQMA 2DIZA 2MMNA 2DIYA 2TRCP 1ZCPA 1UVZA 4BVYB 3FZAA 2H0GA 3EMPA 2ZNMA 1WE0A 3GHAA 4YQMA 2F8FA 3L78A 1CQGA 10GSA 5H5RA 3DXBA 3LSZA 3F9UA 2YPMA 1FG4A 1XOAA 2AHEA 3JCML 1ON4A 2GZYA 1ABAA 4K0GA 1M2DA 4ZB9A 4TW5A 3FR9A 3GYKA 4FIWA 2VCZA 2LS5A 5JWRB 4NXIA 4TR4A 5DCGA 1UC7A 1XOBA 1Y6EA 3DRNA 4NWYA 4PUFC 5EY6A 2K8SA 5GZZB 1A2MA 5F8BA 1SYRA 2IJYA 5HR0A 1THOA 2H01A 2NTOA 3IDVA 4BWSA 1X9MB 5EL8A 5B7CA 1MD4A 2HZEB 4EO3A 3SWLA 1WP0A 19GSA 4ZB7A 1K3LA 2C1YA 2LV3A 3HJMA 4JU5A 1J0FA 4N11A 5B8AA 2VM2A 4GTUA 2WCIA 3EPTA 3EINA 3TKSA 5BMUA 4G0LA 4IELA 3Q74A 4L5LA 4GLTA 4MF7A 3NIVA 4ZIJA 4K0NA 1BYEA 2P0GA 1R5AA 3UVHA 4GXZA 4KF9A 3QCPA 5ELGA 4MF5A 4KX4A 3CSJA 5KN2A 1BF5A 2O85A 3ZVJA 1O73A 1URMA 2C0EA 5IMZA 2GS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKW A;  1V40 A;  5ECH B;  2YN1 A;  4LA1 A;  2X99 A;  4OWY A;  3FHK A;  2V2G A;  5J9C A;  4OD7 A;  3FRC A;  3VLN A;  4RI7 A;  2P5Q A;  1GTI A;  3CTG A;  5IMD A;  4IHU A;  1OYJ A;  4MK3 A;  1MEK A;  4TXV A;  2QSI A;  4BVX A;  3H93 A;  5F05 A;  2XPD A;  4BVY A;  3LG6 A;  5G1K A;  1BG5 A;  2X8H A;  3VWU A;  2CVD A;  2IPA A;  1TXX A;  1AC1 A;  2ZCT A;  1O8W A;  1TI1 A;  2MBS A;  3F4S A;  3HVX A;  4YQU A;  5A4U A;  1T8E B;  2CAQ A;  4FYC A;  2YNX A;  1MDK A;  1FAA A;  3P8W A;  4GSS A;  3DIE A;  4OCE A;  5ABR A;  1GP1 A;  3CBU A;  1PGT A;  2YZH A;  2HXK A;  2DJJ A;  1K0D A;  3DEX A;  3G7I A;  2FD3 A;  1F3B A;  4NAX A;  4Q5Q A;  1K0N A;  4WBJ A;  5J9B A;  5AIS A;  4KDY A;  1ZGN A;  2RUF A;  3IAS 2;  1VRS D;  3ZVJ D;  2XBI A;  2VAF A;  2HE3 A;  4AJ8 A;  1Y25 A;  1N8J A;  2AYT A;  3CRT A;  2E2M A;  2FWF A;  5AIX A;  4MF6 A;  1VF4 A;  1XWA A;  3IOS A;  2C3Q A;  2HZE A;  2I9H A;  3R2Q A;  1WOU A;  2R2J A;  1FVJ A;  4JBB A;  3TKS C;  4I6X A;  3CSH A;  5A5K A;  2HRF A;  3I43 A;  2OAD A;  1ZYQ B;  4PQ1 A;  1EOH A;  3MAK A;  1AQX A;  1UN2 A;  1I9D A;  4TVE A;  4HJM A;  4MZB A;  2I4A A;  3O3T A;  5DAK B;  1A0R P;  1SK0 A;  1OKT A;  3S9F A;  2VLT A;  2QC7 A;  2CX4 A;  2I1U A;  3UJ1 A;  5HFK A;  2BTO T;  2H71 A;  14GS A;  2LNT A;  2KLX A;  1DUG A;  5LD0 A;  4O7H A;  2CVK A;  3APS A;  1GNW A;  3D5J A;  2HYX A;  1K0A A;  3KM6 A;  4N30 A;  1OC9 B;  4OCF A;  5G1L A;  5IPH A;  2JSZ A;  2TRX A;  1XXU A;  5CYY A;  2VCV A;  2K8V A;  2FWG A;  2IMD A;  3GH6 A;  3A2V A;  5J4U A;  4ZB8 A;  1ERW A;  1DSB A;  1FVK A;  1TJD A;  1XWB A;  2RM6 A;  3M9K A;  5CO3 A;  5DVB A;  2F8A A;  2OE3 A;  2IME A;  3ZIJ A;  3LFL A;  4NHW A;  3GKM A;  4MZW A;  4EVM A;  1OC3 A;  3J7Y b;  2PU9 C;  1UA5 A;  4RUV A;  1DE1 A;  1YJ6 A;  1PSQ A;  3QFB C;  4JR4 A;  3CYN A;  3ERW A;  1ERV A;  5ECI B;  1ACV A;  1V57 A;  1Z3E A;  2C80 A;  2DBC A;  2LRN A;  4DSS B;  2B5Y A;  4WR5 A;  3KTL A;  2XBQ A;  1ZYE A;  4KND A;  1SYX A;  2LST A;  4KGI A;  3WT2 A;  3VK9 A;  4WF5 A;  3D0Z A;  1ST9 A;  2JSY A;  1M99 A;  1PA3 A;  2UZ8 A;  4XTS A;  2H74 A;  4HU9 A;  2OKA A;  4OO4 A;  2HRN A;  1H4O A;  1GSD A;  3QAV A;  1A0F A;  1ZZY A;  2TIR A;  4K7N A;  1SD9 A;  1XWC A;  1TDI A;  5ECS A;  1SJZ A;  2BMX A;  2DSA A;  3RPP A;  4V2L A;  2GZZ A;  2RUE A;  2FNO A;  3M3M A;  5ECK B;  5HQP A;  1V58 A;  5FHI A;  1Z5Y E;  4BPY A;  2D2Z A;  1Z7P A;  4Q5R A;  2YJ7 A;  3KEB A;  3QD9 A;  3FZ4 A;  2VCX A;  4ECI A;  1A2J A;  1EEM A;  2B7K A;  1TTZ A;  1V2A A;  2XHF A;  1XCC A;  4DSR A;  3EUR A;  1JLV A;  2VLU A;  5DAK A;  4EF0 A;  1YQ1 A;  1K0B A;  3ME8 A;  3NZN A;  4KB3 A;  1ZL9 A;  1YY7 A;  4XS6 A;  2WUL A;  1GLP A;  1BQ7 A;  1XVQ A;  2PBJ A;  2K6V A;  3TCO A;  2KP2 A;  3WT1 A;  3IV4 A;  3A2X A;  4D73 B;  1GL8 A;  2HFD A;  2WDU A;  3KD0 A;  4WXT A;  5DAL B;  2H6X A;  2C0G A;  2L4C A;  2C8U A;  2YCD A;  3HYP A;  4OMV A;  5D9W A;  4PUR A;  4GRF A;  3RPN A;  5KEJ A;  3HY2 A;  1OC9 A;  4MDC A;  1AQW A;  1B9X C;  4IP1 A;  2GVP A;  1SEN A;  1B8X A;  4XRD A;  1GTB A;  3HVS A;  5GSS A;  2YWI A;  4ZBA A;  1B4Q A;  1HNC A;  2WZ9 A;  3GST A;  4PUA A;  3GRX A;  3TOU A;  3L9U A;  1JLW A;  3TDG A;  4ML1 A;  5H5Q A;  3FR6 A;  3ERF A;  2FA4 A;  2MBT A;  4K9Z A;  2GTU A;  2MMO A;  2HI7 A;  3FR3 A;  4IJI A;  1X9W B;  1AW9 A;  2FY6 A;  2NPB A;  3VWX A;  2P31 A;  1A8L A;  4L0W A;  1OVN A;  2R6K A;  17GS A;  1B48 A;  4PX1 A;  1G7O A;  5B8B A;  4IS0 A;  1PX7 A;  1MD3 A;  2WFC A;  3TKQ A;  1AIU A;  4O32 A;  4HDE A;  2DC5 A;  2DJ1 A;  2GDR A;  3I6A A;  1EGR A;  5ECQ B;  4GCI A;  1YZX A;  4ZIL A;  4FQU A;  1W89 A;  3ZML A;  3DYR A;  3HJP A;  4GQC A;  4TKY A;  3DWV A;  1LBK A;  5ECL B;  3TJB A;  5DQS A;  4XHM A;  5LNK e;  3MDK A;  3J7Y k;  3TGZ A;  3P2A A;  3PPU A;  1QGV A;  5H5S A;  5G30 A;  1Z6N A;  5INY A;  1WMJ A;  2PUK C;  2IMK A;  3M0F A;  1NM3 A;  1KNG A;  5E4W A;  1XW9 A;  5ECR B;  4TR3 A;  3DVX A;  3HXS A;  3GFK A;  4CHS A;  2GSR A;  3VUR A;  4ECJ A;  4RI6 A;  2YV9 A;  2K9F A;  1SL2 B;  4KCE A;  3ERG A;  1ERU A;  2JZT A;  3HDC A;  3GUS A;  4G2E A;  3KP8 A;  4MJB A;  3GKX A;  3VI5 A;  4KSM A;  1FHE A;  1WWJ A;  2IFQ B;  1TRU A;  3WYW A;  2L5L A;  3RHB A;  4JRR A;  3BD2 A;  3UBL A;  3EU3 A;  4KW6 A;  1SK2 A;  3Q18 A;  5FWG A;  5EPF A;  4X1U A;  2O89 A;  4N0V A;  4KUN A;  4K2D A;  4D73 A;  2GT5 A;  1YDK A;  4ILF A;  5DAL A;  1U6T A;  2CX3 A;  4AJ7 A;  2V1M A;  2YAN A;  4QQ7 A;  2O8V B;  1SD8 A;  5D9X A;  1PL2 A;  2VL3 A;  2LJR A;  3VWW A;  5A4V A;  1T4Z A;  3US3 A;  2V32 A;  3GH9 A;  5F06 A;  3EC3 A;  4IQA A;  2HLS A;  2F3M A;  2E0Q A;  5E59 A;  5G5E A;  3ZYW A;  4FYU A;  5KN0 A;  3D6I A;  5D8I A;  2K18 A;  3TJK A;  6GSX A;  3LQ7 A;  4V1A p;  1SJ6 A;  4L8E A;  4LMW A;  4AF2 A;  4KH7 A;  1PN9 A;  4MPF A;  1XFL A;  5IMF A;  2CA8 A;  3TRP A;  1OE8 A;  4X43 A;  2EIR A;  4MMM A;  2E2G A;  5IOX A;  1FO5 A;  2NVL A;  4MP4 A;  3FZ5 A;  2IMI A;  2CVB A;  2L5O A;  1T4Y A;  3H8Q A;  4K1F A;  3NOF A;  4EXJ A;  3ME7 A;  1TK5 B;  4PTS A;  5GAN D;  2WB9 A;  5C04 A;  4ACS A;  3D21 A;  3W8S A;  4GST A;  2YWN A;  4ZL9 A;  4G0K A;  2LNS A;  4GF0 A;  2E7P A;  2JZR A;  5IO0 A;  2VUP A;  5IIZ A;  3QPM A;  4HUA A;  2L6C A;  2M72 A;  2KP1 A;  4HQZ A;  3KCM A;  5DDL A;  2KOK A;  1Z7R A;  4MZC A;  1SU9 A;  3P7X A;  3QMX A;  2FUG 2;  4N10 A;  4EKZ A;  4OFM A;  2HSH A;  5DBQ A;  3IHQ A;  1T3B A;  4EDY A;  2H6Y A;  2B5X A;  1G7E A;  1Z9H A;  3HA9 A;  2I81 A;  1M2B A;  3BBY A;  4DSQ A;  4XIH A;  2ALB A;  3KGK A;  3BOA A;  4K8M A;  3VFI A;  5IPG A;  3KMN A;  2KUC A;  1TRS A;  2C0D A;  3LWA A;  2C3N A;  4TXO B;  4F9Z A;  2R3X A;  4ID0 A;  5CNW A;  1EOG A;  1VGL A;  3TKP A;  3EE2 A;  2IFQ A;  2VL2 A;  4POL A;  1XW5 A;  2HNL A;  1I5G A;  4J2F A;  1C72 A;  5GAP D;  3ZIT A;  3L0H A;  1MDI A;  5G31 A;  1TKD B;  3RHC A;  2AV4 A;  5EVO A;  2HSY A;  4AGS A;  6GST A;  1TK0 B;  3CXG A;  4IN0 A;  2C3T A;  3E0U A;  4IVF A;  3KTB A;  2YZU A;  2VD0 A;  4USS A;  4JR6 A;  2YWO A;  4HQS A;  1XVW A;  3WD6 A;  1GUL A;  4ECB A;  1FOV A;  2L57 A;  3I9V 2;  4WEY A;  4Z7X A;  12GS A;  4ZB6 A;  2B7J A;  3GL3 A;  3BJ5 A;  4QL9 A;  2N5F A;  3O76 A;  2OJL A;  2GQL A;  4JE1 A;  4KSO A;  5D9T A;  1B9Y C;  4F0B A;  2H73 A;  1PKZ A;  3UEM A;  4L0U A;  4FYB A;  1XPV A;  3GV1 A;  2EIQ A;  3C73 A;  5IMV A;  1GSY A;  4P3Y B;  5C00 A;  1V9W A;  1HQO A;  4MJE A;  2A2R A;  2CAI A;  2YV7 A;  3U6V A;  2PN8 A;  4ZL8 A;  2AB6 A;  22GS A;  3TB2 A;  2PGT A;  3IA1 A;  1PX6 A;  1J9B A;  1JZO A;  4HS1 A;  2X8G A;  3VPT A;  4WKW A;  3GSS A;  3APQ A;  4KCA A;  4EDZ A;  5G2Z A;  2H8L A;  3H1N A;  4F2I A;  5LCZ A;  2WRT A;  2RII A;  5IO2 A;  2O7K A;  5J5N A;  4MCU A;  1E6B A;  3IXR A;  1F9M A;  5CAX A;  2VOC A;  5ENU A;  3QOU A;  3ZRD A;  8GSS A;  3TUE A;  1HD2 A;  5ECP B;  1R5P A;  2FLS A;  3APO A;  2JL4 A;  1THX A;  2VL2 C;  2IN3 A;  3UAR A;  3G7J A;  1F37 A;  1T7P B;  2ES7 A;  3PR8 A;  2CQ9 A;  1YEP A;  3A5W A;  4ZXG A;  4TXO A;  1EV4 A;  4JED A;  3A3T A;  3F3R A;  1SJI A;  2H76 A;  4ULX A;  2CZ3 A;  3TOT A;  2EIO A;  1M9A A;  1F6M C;  3FEU A;  2IL3 A;  4CDO A;  3HVV A;  2N5B A;  2I3Y A;  2H70 A;  4ZL7 A;  4IBP A;  1BX9 A;  5IQY A;  4EC0 A;  1NHY A;  5F0G A;  4MH3 A;  2PVO C;  3TRQ A;  4LL1 B;  1DBY A;  4IGJ A;  4ZBB A;  1W4V A;  3ZFB A;  2VIM A;  4HZ4 A;  1U87 A;  4LL4 B;  16GS A;  1QK8 A;  4WET A;  5J3R A;  5HR1 A;  3CSI A;  1GUH A;  3Q6O A;  1PQN A;  1VF3 A;  2VCW A;  2GGT A;  1AQV A;  1SKS B;  2H66 A;  4V1A g;  1SL0 B;  2NBS A;  3N5O A;  3ZIV A;  2GSQ A;  4I5Q A;  1GSE A;  5DCH A;  2PMT A;  1EZK A;  2C0F A;  1M0U A;  3HJO A;  2CT6 A;  2LKU A;  3UIW A;  2VCQ A;  3F6F A;  6GSU A;  3D4T A;  3EYT A;  5CRE A;  1A23 A;  4NPB A;  1O6J A;  1HNA A;  2NDO A;  1KBN A;  2H1B A;  4I97 A;  1KEB A;  2H30 A;  2HSN B;  1EEJ A;  3HKR A;  2ON7 A;  1G6Y A;  4HI7 A;  1K3O A;  2H72 A;  5HR3 A;  4JZQ A;  4BWQ A;  1X5D A;  5CRG A;  3GTU B;  4MJC A;  3FYG A;  2L6D A;  3W6G A;  4G10 A;  3TRX A;  4IKH A;  1GTA A;  2JU5 A;  1Z6M A;  1GSQ A;  2B1K A;  1X5E A;  2IWT A;  5DQY A;  2GQM A;  2H1A A;  1S3A A;  2RM5 A;  4V2M A;  3MNG A;  2YJH A;  3LXT A;  1HYU A;  5B6M A;  5IM9 A;  3HZ8 A;  4DSS A;  2WS2 A;  3TJJ A;  2DLX A;  4G19 A;  3IPZ A;  3F4T A;  3CMI A;  3M1G A;  3I69 A;  3DVW A;  2R4V A;  1E2Y A;  2FHE A;  3DGQ A;  2OE1 A;  3LXZ A;  5D9V A;  2IIY A;  1NW2 A;  1S3C A;  3IBH A;  4YAP A;  2QKE A;  3FW2 A;  4BA7 A;  3F6D A;  3C1R A;  3WGX A;  1G6W A;  4GWR A;  4NV5 A;  1IYI A;  2LQO A;  2YP6 A;  3E9J B;  3K8N A;  5CP1 A;  1V98 A;  1OKD A;  1CQH A;  1K0C A;  1YF1 A;  2FCH A;  2X8C A;  1HNB A;  1PMT A;  5IMA A;  4K7I A;  2LRC A;  3A2W A;  4PQI A;  2LJA A;  2PWJ A;  1OAZ A;  2HRA A;  5COH A;  1GNE A;  3FK8 A;  3KH9 A;  4MJA A;  4L5O A;  4FO5 A;  4HEA 2;  2HSM B;  4TR0 A;  1YKA A;  3F63 A;  2JAD A;  1GSF A;  1WIK A;  3EVI A;  3LGC A;  1U88 A;  3GA4 A;  1GLQ A;  5CRD A;  1KTE A;  4HJ2 A;  4BL7 B;  6GSW A;  4I2T A;  4DEJ A;  4F82 A;  4PNF A;  3GMF A;  4G9H A;  2IMF A;  5HFI A;  1GSS A;  4XCS A;  4J56 E;  4NMU A;  3KH7 A;  4POB A;  3GTU A;  1YF0 A;  1K3Y A;  2H1D A;  4HU7 A;  4YQV A;  1AAZ A;  1SK1 A;  4KDU A;  3LEF A;  3ZTL A;  3DKS A;  5DJM A;  1JZW A;  3BCI A;  2PER A;  1ERT A;  3L4N A;  4XS4 B;  2F9S A;  4XS1 A;  3TJG A;  3OR5 A;  1TW9 A;  4J57 E;  3TKR A;  1U3A A;  4HZ2 A;  2EC4 A;  1XWK A;  2MMZ A;  4CW9 A;  3KZQ A;  5JCU A;  3QFA C;  4LMV A;  2R5G A;  1MDJ A;  4IQ1 A;  2REM A;  3GKN A;  1JFU A;  1TU8 A;  4KE3 A;  4QL7 A;  3UL3 A;  4EE0 A;  3HZ4 A;  3C7M A;  1IYH A;  1T00 A;  3IAM 2;  3D22 A;  4MAB A;  3ZL5 A;  1U3I A;  3IK9 A;  3QR6 A;  3IR4 A;  4O92 A;  2DJ3 A;  1ILO A;  3IC4 A;  2OAC A;  2YOI A;  2DJ0 A;  1F3A A;  1TRV A;  1X0R A;  3MSZ A;  1WJK A;  3FY7 A;  2H75 A;  1GRX A;  4PGT A;  2J9H A;  1M9B A;  2AUV A;  4YAV A;  2HT9 A;  2M46 A;  2LJK A;  5AN1 A;  1R7H A;  4TR1 B;  9GSS A;  5JCG A;  3E3E A;  1NSW A;  2CV4 A;  1GSU A;  3GX8 A;  3PH9 A;  4I2U A;  2GST A;  1JHB A;  2LUS A;  3UVT A;  3QAG A;  3KJY A;  5IMC A;  4OFT A;  3HHV A;  1O7U A;  1BED A;  4X0X A;  1RW1 A;  3DML A;  2HSM A;  5ELA A;  3TKS E;  1QMV A;  3RAZ A;  1GWC A;  3QAW A;  2AAW A;  1YKC A;  4ZBD A;  4BL7 A;  4GQF A;  2OBI A;  5HR2 A;  3AY8 A;  1LJR A;  5IOW A;  1Q98 A;  2BJX A;  2V6O A;  5CRW A;  3Q19 A;  1RK4 A;  2VCT A;  3GKK A;  1K0M A;  3ISO A;  4G0I A;  3KP9 A;  5AIV A;  3CTF A;  1JZD A;  3GN3 A;  5D73 A;  2LQQ A;  3VPQ A;  4MLY A;  1GUM A;  2RLI A;  3G9B A;  4POM A;  2CZ2 A;  3ZLP A;  2LTK A;  2FWE A;  4KA0 A;  2HRK B;  4TOP A;  5J41 A;  4XS4 A;  2G2Q A;  3ZMK A;  5ID2 B;  1PL1 A;  3KXO A;  18GS A;  1M2A A;  2F51 A;  4KAE A;  5FT3 A;  2X64 A;  2VD1 A;  4PXO A;  3TJF A;  4TN8 A;  3O6T A;  5CRH A;  1SKR B;  1XW6 A;  4ML6 A;  3LYP A;  1B4P A;  3UMA A;  3F0I A;  1NHO A;  1QQ2 A;  3ZZX A;  3QDN A;  3LJR A;  5HFG A;  3F8U A;  1VF1 A;  3HD5 A;  3GX0 A;  1TI3 A;  3WGD A;  2LRT A;  4IP6 A;  6GSV A;  1OE7 A;  2LEG A;  3H4K A;  2AJQ B;  1QXH A;  2L59 A;  1ZOF A;  2MZC A;  2VL9 A;  1F2E A;  4PQH A;  1A8Y A;  3P90 A;  3GNJ A;  1QFN A;  2GLR A;  3C71 A;  2HQT A;  2WGR A;  4IW9 A;  3LYK A;  1H75 A;  2A2S A;  3FZ9 A;  2FA8 A;  2MYG A;  3SBC A;  2O87 A;  6GSY A;  1OC8 A;  4DVC A;  3N9J A;  1DE2 A;  1A24 A;  2V6K A;  2DML A;  4TR1 A;  2PVQ A;  1EP7 A;  1TOF A;  2H1G A;  1EGO A;  4EUY A;  4Q5F A;  5A4W A;  4WF4 A;  2VM1 A;  1FB6 A;  2H6Z A;  1K0O A;  3GL5 A;  3ZFL A;  1O8X A;  3KIJ A;  4EL1 A;  5L71 A;  1AUC A;  5D96 A;  3D4M A;  1ZMA A;  4V2N A;  1YEX A;  4XRA A;  4F03 A;  3W8J A;  4PNG A;  4ECC A;  3ED3 A;  4H86 A;  11GS A;  4YH2 A;  1X5C A;  1EV9 A;  4OFN A;  2JAC A;  3RBT A;  5AGY A;  3UBK A;  1A2L A;  3L9V A;  3EU4 A;  5B6N A;  2HZF A;  1EWX A;  2P5R A;  2B3S A;  4O5R A;  3C1S A;  1FB0 A;  2GQK A;  1Q4J A;  3WGE A;  1G0T A;  4AJ6 A;  4RQR A;  2DJ2 A;  5JWO B;  3IC8 A;  3PGT A;  2QGV A;  2VLV A;  7GSS A;  1TU7 A;  4MPG A;  1QUW A;  1LU4 A;  3UAP A;  4N0Z A;  1XWG A;  2B5E A;  4LLR A;  3CRU A;  2HRK A;  4Q5N A;  4K6X A;  1PRX A;  1GTU A;  3G7Y A;  1J08 A;  4POK A;  3C8E A;  2G0F A;  5ID2 A;  3L9S A;  4IJ3 A;  5GST A;  3IK7 A;  4OO5 A;  2MMA A;  4MH2 A;  2OE0 A;  2H0I A;  3IE3 A;  3BCK A;  1O81 A;  2KHP A;  3MWH A;  1TP9 A;  1FW1 A;  4WBR D;  1BAY A;  3UOM A;  4NHZ A;  5JCW A;  1T1V A;  3M8N A;  2OA7 A;  4FH8 A;  1GUK A;  3FKF A;  3R3E A;  1XIY A;  3DD3 A;  6GSS A;  2DJK A;  3KMO A;  3H79 A;  2ON5 A;  2ZUP A;  3EMX A;  1R26 A;  5ECO B;  4NV2 A;  4E8E A;  2GT6 A;  1S3D A;  1SKW B;  2R37 A;  3F3Q A;  2H0H A;  2OBK A;  1SL1 B;  1MTC A;  2FWH A;  5DJL A;  1WRY A;  2GZP A;  3ZRE A;  1X9S B;  13GS A;  1ML6 A;  3IRA A;  4WR4 A;  2GSS A;  1M7T A;  2JZS A;  2VO4 A;  3M9J A;  2A4V A;  5KN3 A;  1BJX A;  1AXD A;  1R4W A;  2N5A A;  2Z9S A;  4F0C A;  3VI7 A;  4RQX A;  5JWQ B;  2L4Q A;  1JZR A;  5ECM B;  3VWV A;  4I8B A;  2V41 A;  2WJU A;  1PD2 1;  1VF2 A;  20GS A;  5F07 A;  1TK8 B;  2H19 A;  5ECN B;  3GUR A;  3PIN A;  3F4R A;  1N2A A;  2C4J A;  2YWM A;  3GIX A;  1XZO A;  2XC2 A;  3HCZ A;  2FGX A;  1EP8 A;  1XBS A;  2M80 A;  4TRX A;  2PPT A;  4KDX A;  1GH2 A;  4GSN A;  3RDW A;  5G5F A;  1TRW A;  5D93 A;  3LOR A;  4E8H A;  4HOJ A;  2XPE A;  2DMM A;  1O85 A;  5KN1 A;  2J23 A;  2B1L A;  4MA9 A;  3U5R E;  3V1W A;  4ISD A;  1USB A;  4K7O A;  4BVX B;  1WPI A;  2B6M A;  3EWL A;  1RQM A;  2DIZ A;  2MMN A;  2DIY A;  2TRC P;  1ZCP A;  1UVZ A;  4BVY B;  3FZA A;  2H0G A;  3EMP A;  2ZNM A;  1WE0 A;  3GHA A;  4YQM A;  2F8F A;  3L78 A;  1CQG A;  10GS A;  5H5R A;  3DXB A;  3LSZ A;  3F9U A;  2YPM A;  1FG4 A;  1XOA A;  2AHE A;  3JCM L;  1ON4 A;  2GZY A;  1ABA A;  4K0G A;  1M2D A;  4ZB9 A;  4TW5 A;  3FR9 A;  3GYK A;  4FIW A;  2VCZ A;  2LS5 A;  5JWR B;  4NXI A;  4TR4 A;  5DCG A;  1UC7 A;  1XOB A;  1Y6E A;  3DRN A;  4NWY A;  4PUF C;  5EY6 A;  2K8S A;  5GZZ B;  1A2M A;  5F8B A;  1SYR A;  2IJY A;  5HR0 A;  1THO A;  2H01 A;  2NTO A;  3IDV A;  4BWS A;  1X9M B;  5EL8 A;  5B7C A;  1MD4 A;  2HZE B;  4EO3 A;  3SWL A;  1WP0 A;  19GS A;  1K3L A;  2C1Y A;  2LV3 A;  3HJM A;  4JU5 A;  1J0F A;  4N11 A;  5B8A A;  2VM2 A;  4GTU A;  2WCI A;  3EIN A;  3TKS A;  5BMU A;  4G0L A;  4IEL A;  3Q74 A;  4L5L A;  4GLT A;  4MF7 A;  3NIV A;  4ZIJ A;  4K0N A;  1BYE A;  2P0G A;  1R5A A;  3UVH A;  4GXZ A;  4KF9 A;  3QCP A;  5ELG A;  4MF5 A;  4KX4 A;  3CSJ A;  5KN2 A;  2O85 A;  3ZVJ A;  1O73 A;  1URM A;  2C0E A;  5IMZ A;  2GS3 A; 
#chains in the Genus database with same CATH topology
 1PKW A;  1V40 A;  5ECH B;  2YN1 A;  4LA1 A;  2X99 A;  4OWY A;  3FHK A;  2V2G A;  5J9C A;  4OD7 A;  3FRC A;  4YKG A;  3VLN A;  4RI7 A;  2P5Q A;  1GTI A;  3CTG A;  5IMD A;  4IHU A;  1OYJ A;  4MK3 A;  1MEK A;  4TXV A;  2QSI A;  4BVX A;  3H93 A;  2VKZ G;  5F05 A;  2XPD A;  4BVY A;  3LG6 A;  5G1K A;  1BG5 A;  2X8H A;  3VWU A;  2CVD A;  2IPA A;  1TXX A;  4Z2T A;  1AC1 A;  2ZCT A;  1O8W A;  1TI1 A;  2MBS A;  3F4S A;  3HVX A;  4YQU A;  5A4U A;  1T8E B;  3RGB C;  2CAQ A;  2OT3 A;  4FYC A;  4EIP A;  2YNX A;  1MDK A;  1FAA A;  3P8W A;  4MNN A;  4GSS A;  3DIE A;  4OCE A;  5ABR A;  3CHX C;  1GP1 A;  3CBU A;  1PGT A;  2YZH A;  2HXK A;  2DJJ A;  1K0D A;  3DEX A;  3G7I A;  2FD3 A;  1F3B A;  4NAX A;  4Q5Q A;  1K0N A;  4WBJ A;  5J9B A;  5AIS A;  4KDY A;  1ZGN A;  2RUF A;  3IAS 2;  1VRS D;  3ZVJ D;  2XBI A;  2VAF A;  2HE3 A;  4AJ8 A;  1Y25 A;  1N8J A;  2AYT A;  3CRT A;  2E2M A;  5A1N B;  2FWF A;  5AIX A;  4MF6 A;  1VF4 A;  1XWA A;  3IOS A;  2C3Q A;  2HZE A;  2I9H A;  3R2Q A;  1WOU A;  2R2J A;  1FVJ A;  4JBB A;  3TKS C;  4I6X A;  3CSH A;  5A5K A;  2HRF A;  3I43 A;  2OAD A;  1ZYQ B;  4PQ1 A;  1EOH A;  3MAK A;  1AQX A;  1UN2 A;  1I9D A;  4TVE A;  4CY6 A;  4HJM A;  4MZB A;  2I4A A;  3O3T A;  5DAK B;  1A0R P;  1SK0 A;  1OKT A;  3S9F A;  2VLT A;  2QC7 A;  2CX4 A;  2I1U A;  3UJ1 A;  1Y1U A;  5HFK A;  2BTO T;  2H71 A;  14GS A;  2LNT A;  2KLX A;  1DUG A;  5LD0 A;  4O7H A;  2CVK A;  3APS A;  1GNW A;  1SVM A;  4GDF A;  3D5J A;  2HYX A;  1K0A A;  3KM6 A;  4N30 A;  1OC9 B;  4OCF A;  5G1L A;  4CY8 A;  1ZYP A;  5IPH A;  2JSZ A;  2TRX A;  1XXU A;  5CYY A;  2VCV A;  2K8V A;  2IMD A;  2FWG A;  3GH6 A;  3A2V A;  1YEW C;  5J4U A;  4ZB8 A;  1ERW A;  1DSB A;  1FVK A;  1TJD A;  1XWB A;  2RM6 A;  2EFH A;  3M9K A;  5CO3 A;  5DVB A;  2F8A A;  2OE3 A;  2IME A;  3ZIJ A;  3LFL A;  4NHW A;  3GKM A;  4MZW A;  4EVM A;  1OC3 A;  3J7Y b;  2PU9 C;  1UA5 A;  4RUV A;  1DE1 A;  1YJ6 A;  1PSQ A;  3QFB C;  4JR4 A;  3CYN A;  3ERW A;  1ERV A;  5ECI B;  1ACV A;  1V57 A;  1Z3E A;  2C80 A;  2DBC A;  2LRN A;  4DSS B;  2B5Y A;  4WR5 A;  3KTL A;  2XBQ A;  1ZYE A;  4KND A;  1SYX A;  2LST A;  4KGI A;  3WT2 A;  3VK9 A;  4WF5 A;  3D0Z A;  1ST9 A;  2JSY A;  4YKF A;  1M99 A;  1PA3 A;  2UZ8 A;  4XTS A;  2H74 A;  4HU9 A;  2OKA A;  4OO4 A;  2HRN A;  4X4J A;  1H4O A;  1GSD A;  3QAV A;  1A0F A;  1ZZY A;  2TIR A;  4K7N A;  1SD9 A;  1XWC A;  1TDI A;  5ECS A;  1SJZ A;  2BMX A;  2DSA A;  3RPP A;  4V2L A;  2GZZ A;  2RUE A;  4AKX B;  2FNO A;  3M3M A;  5ECK B;  5HQP A;  1V58 A;  5FHI A;  5J47 A;  1Z5Y E;  4BPY A;  2D2Z A;  1Z7P A;  4Q5R A;  2YJ7 A;  3KEB A;  3QD9 A;  3FZ4 A;  2VCX A;  4ECI A;  1A2J A;  1EEM A;  2B7K A;  1TTZ A;  5J4V A;  1V2A A;  2XHF A;  1XCC A;  4DSR A;  3EUR A;  1JLV A;  2VLU A;  5DAK A;  4EF0 A;  1YQ1 A;  1K0B A;  3ME8 A;  3NZN A;  4KB3 A;  1ZL9 A;  1YY7 A;  4XS6 A;  2H1L A;  2WUL A;  1GLP A;  1BQ7 A;  1XVQ A;  2PBJ A;  2K6V A;  3TCO A;  2KP2 A;  3WT1 A;  3IV4 A;  3A2X A;  4D73 B;  1GL8 A;  2HFD A;  2WDU A;  3KD0 A;  4WXT A;  5DAL B;  2H6X A;  2C0G A;  2L4C A;  2C8U A;  2YCD A;  3HYP A;  4OMV A;  5D9W A;  4PUR A;  4GRF A;  3RPN A;  5KEJ A;  3HY2 A;  1OC9 A;  4MDC A;  1AQW A;  1B9X C;  2QA2 A;  4IP1 A;  2GVP A;  1SEN A;  1B8X A;  4XRD A;  1GTB A;  3HVS A;  5GSS A;  2YWI A;  4ZBA A;  1B4Q A;  1HNC A;  2WZ9 A;  3GST A;  4PUA A;  3GRX A;  3TOU A;  4AKI A;  4N3Z A;  3L9U A;  1JLW A;  3TDG A;  4ML1 A;  5H5Q A;  3FR6 A;  3ERF A;  2FA4 A;  2MBT A;  4K9Z A;  2GTU A;  2MMO A;  2HI7 A;  3FR3 A;  4IJI A;  2WVZ A;  1X9W B;  1AW9 A;  2FY6 A;  2NPB A;  3VWX A;  2P31 A;  1A8L A;  4L0W A;  1OVN A;  2R6K A;  17GS A;  1B48 A;  4PX1 A;  1G7O A;  1SVO A;  5B8B A;  4IS0 A;  1PX7 A;  1MD3 A;  2WFC A;  3TKQ A;  1AIU A;  4O32 A;  4HDE A;  2DC5 A;  2DJ1 A;  2GDR A;  2X49 A;  3I6A A;  1EGR A;  5ECQ B;  4GCI A;  1YZX A;  4ZIL A;  4FQU A;  1W89 A;  3ZML A;  3DYR A;  3HJP A;  4GQC A;  4TKY A;  3DWV A;  1LBK A;  5ECL B;  3TJB A;  5DQS A;  4XHM A;  5LNK e;  3MDK A;  3J7Y k;  3TGZ A;  3P2A A;  3PPU A;  1QGV A;  5H5S A;  5G30 A;  1Z6N A;  5INY A;  1WMJ A;  2PUK C;  2IMK A;  3M0F A;  1NM3 A;  1KNG A;  5E4W A;  1XW9 A;  5ECR B;  4TR3 A;  3DVX A;  3HXS A;  3GFK A;  4CHS A;  2GSR A;  3VUR A;  2WW0 A;  4ECJ A;  4RI6 A;  2YV9 A;  2K9F A;  3FMW A;  1SL2 B;  4KCE A;  3ERG A;  1ERU A;  2JZT A;  3HDC A;  3GUS A;  4G2E A;  3KP8 A;  4MJB A;  3GKX A;  3VI5 A;  4AI6 A;  4KSM A;  5KOX A;  1FHE A;  1WWJ A;  2IFQ B;  1TRU A;  3WYW A;  2L5L A;  3RHB A;  4JRR A;  3BD2 A;  3UBL A;  3EU3 A;  4KW6 A;  1SK2 A;  3Q18 A;  5FWG A;  5EPF A;  4X1U A;  2O89 A;  4N0V A;  4KUN A;  4K2D A;  4D73 A;  2GT5 A;  1YDK A;  3RFR C;  4ILF A;  2WW1 A;  5DAL A;  1U6T A;  2CX3 A;  4AJ7 A;  2V1M A;  2YAN A;  4QQ7 A;  2O8V B;  1SD8 A;  5D9X A;  1PL2 A;  2VL3 A;  2LJR A;  3VWW A;  4Z2R A;  4PI2 C;  1S3R A;  5A4V A;  1T4Z A;  4BIK A;  3US3 A;  2V32 A;  3GH9 A;  5F06 A;  3EC3 A;  4IQA A;  2UV8 G;  2HLS A;  2F3M A;  2E0Q A;  5E59 A;  5G5E A;  3ZYW A;  4FYU A;  5KN0 A;  3D6I A;  5D8I A;  2K18 A;  3TJK A;  6GSX A;  2O5V A;  3LQ7 A;  4V1A p;  1SJ6 A;  4L8E A;  4LMW A;  4AF2 A;  4KH7 A;  1PN9 A;  4E68 A;  4MPF A;  1XFL A;  5IMF A;  2CA8 A;  3TRP A;  1OE8 A;  4X43 A;  2EIR A;  4MMM A;  2E2G A;  5IOX A;  1PN0 A;  1FO5 A;  2NVL A;  4MP4 A;  3FZ5 A;  2IMI A;  2CVB A;  2L5O A;  1T4Y A;  3H8Q A;  4K1F A;  3NOF A;  4EXJ A;  3HVN A;  3ME7 A;  1TK5 B;  4PTS A;  5GAN D;  2WB9 A;  5C04 A;  4ACS A;  3D21 A;  3W8S A;  4GST A;  2YWN A;  4ZL9 A;  4G0K A;  2LNS A;  4GF0 A;  2E7P A;  2JZR A;  5IO0 A;  2R0P A;  2VUP A;  5IIZ A;  2WW3 A;  3QPM A;  4HUA A;  2L6C A;  2M72 A;  2KP1 A;  4HQZ A;  3KCM A;  1I1I P;  5DDL A;  2KOK A;  1Z7R A;  4MZC A;  1SU9 A;  3P7X A;  3QMX A;  2FUG 2;  4N10 A;  4EKZ A;  4OFM A;  2HSH A;  5DBQ A;  3IHQ A;  1T3B A;  4EDY A;  2H6Y A;  2B5X A;  1G7E A;  1Z9H A;  3HA9 A;  2I81 A;  1M2B A;  3BBY A;  4DSQ A;  4XIH A;  2ALB A;  3BOA A;  3KGK A;  4K8M A;  3VFI A;  5IPG A;  3KMN A;  2KUC A;  1TRS A;  2C0D A;  3LWA A;  2C3N A;  4A5P A;  5A5H B;  4TXO B;  4F9Z A;  2R3X A;  4ID0 A;  5CNW A;  1EOG A;  1VGL A;  3TKP A;  3EE2 A;  2IFQ A;  2VL2 A;  4POL A;  1XW5 A;  2HNL A;  1I5G A;  4J2F A;  1C72 A;  5GAP D;  3ZIT A;  3L0H A;  1MDI A;  5G31 A;  1TKD B;  3RHC A;  2AV4 A;  5EVO A;  2HSY A;  4AGS A;  6GST A;  4PHZ C;  1TK0 B;  3CXG A;  4IN0 A;  2C3T A;  3E0U A;  4IVF A;  3KTB A;  2YZU A;  2VD0 A;  4USS A;  4JR6 A;  2YWO A;  4HQS A;  1XVW A;  3WD6 A;  1GUL A;  4ECB A;  1FOV A;  2L57 A;  3I9V 2;  4WEY A;  4Z7X A;  12GS A;  4ZB6 A;  2B7J A;  3GL3 A;  3BJ5 A;  2O36 A;  2N5F A;  4QL9 A;  3O76 A;  2OJL A;  2GQL A;  4JE1 A;  4KSO A;  5D9T A;  1B9Y C;  4F0B A;  2H73 A;  1PKZ A;  3UEM A;  4L0U A;  4FYB A;  1XPV A;  3GV1 A;  2EIQ A;  3C73 A;  5IMV A;  1GSY A;  4P3Y B;  5C00 A;  1V9W A;  5J4Y A;  1HQO A;  3A5I A;  1FOH A;  2A2R A;  4MJE A;  1M3I A;  2CAI A;  2YV7 A;  3U6V A;  2PN8 A;  4ZL8 A;  2AB6 A;  22GS A;  3TB2 A;  2PGT A;  3IA1 A;  1PX6 A;  1J9B A;  1JZO A;  4HS1 A;  2X8G A;  3VPT A;  2QA1 A;  4WKW A;  3GSS A;  3APQ A;  4EIQ A;  4KCA A;  3LW9 A;  4EDZ A;  5G2Z A;  2H8L A;  3H1N A;  4F2I A;  3CWG A;  2X4A A;  5LCZ A;  2WRT A;  2RII A;  2WVX B;  5IO2 A;  2O7K A;  5J5N A;  4MCU A;  4HSC X;  1E6B A;  3IXR A;  1F9M A;  5CAX A;  2VOC A;  5ENU A;  3QOU A;  3ZRD A;  8GSS A;  3TUE A;  1HD2 A;  5ECP B;  1R5P A;  2FLS A;  3APO A;  2JL4 A;  1THX A;  2VL2 C;  2IN3 A;  3UAR A;  3G7J A;  1F37 A;  1T7P B;  2ES7 A;  3PR8 A;  2CQ9 A;  1YEP A;  3A5W A;  5A5H A;  4ZXG A;  4TXO A;  1EV4 A;  4JED A;  3A3T A;  4FXY P;  3F3R A;  1SJI A;  2H76 A;  4ULX A;  2CZ3 A;  3TOT A;  1PFO A;  1M9A A;  1F6M C;  2EIO A;  3FEU A;  2IL3 A;  4CDO A;  2R0C A;  2N5B A;  3HVV A;  2I3Y A;  1TXU A;  2H70 A;  4ZL7 A;  4IBP A;  1BX9 A;  5IQY A;  4EC0 A;  1NHY A;  5A1N A;  5F0G A;  4MH3 A;  2PVO C;  3TRQ A;  4LL1 B;  1DBY A;  4IGJ A;  4ZBB A;  1W4V A;  3ZFB A;  2VIM A;  4HZ4 A;  1U87 A;  4LL4 B;  2EFC A;  16GS A;  1QK8 A;  4WET A;  5J3R A;  5HR1 A;  3CSI A;  1GUH A;  3Q6O A;  1PQN A;  1VF3 A;  2VCW A;  2GGT A;  1AQV A;  1SKS B;  2H66 A;  4V1A g;  1SL0 B;  3HMJ G;  2NBS A;  3N5O A;  3ZIV A;  2GSQ A;  4I5Q A;  1GSE A;  5DCH A;  2PMT A;  1EZK A;  2C0F A;  1M0U A;  3HJO A;  2CT6 A;  2LKU A;  3UIW A;  2VCQ A;  3F6F A;  6GSU A;  3D4T A;  3EYT A;  5CRE A;  1A23 A;  4NPB A;  1O6J A;  1HNA A;  2NDO A;  1KBN A;  2H1B A;  4I97 A;  1KEB A;  2H30 A;  2HSN B;  1EEJ A;  3HKR A;  2ON7 A;  4AKH A;  1G6Y A;  4HI7 A;  1K3O A;  5KOW A;  2H72 A;  5HR3 A;  4JZQ A;  4K2X A;  4BWQ A;  1X5D A;  5CRG A;  3GTU B;  4MJC A;  3FYG A;  2L6D A;  3W6G A;  4G10 A;  3TRX A;  2EFE A;  4IKH A;  1GTA A;  1SVL A;  2WVX A;  2JU5 A;  1Z6M A;  1GSQ A;  2B1K A;  1X5E A;  2IWT A;  5DQY A;  2GQM A;  2H1A A;  1S3A A;  2RM5 A;  4V2M A;  3MNG A;  2YJH A;  3LXT A;  1HYU A;  5B6M A;  5IM9 A;  3HZ8 A;  4DSS A;  2WS2 A;  3TJJ A;  2DLX A;  4G19 A;  3IPZ A;  3F4T A;  1S4B P;  3CMI A;  3M1G A;  3I69 A;  3DVW A;  2R4V A;  1E2Y A;  2FHE A;  3DGQ A;  2OE1 A;  3LXZ A;  5D9V A;  2IIY A;  1NW2 A;  1S3C A;  3IBH A;  4YAP A;  2QKE A;  3FW2 A;  4BA7 A;  3F6D A;  3TU3 B;  3C1R A;  3WGX A;  2A2P A;  1G6W A;  4GWR A;  4NV5 A;  1IYI A;  2LQO A;  2YP6 A;  3E9J B;  3K8N A;  5CP1 A;  1V98 A;  1OKD A;  1CQH A;  3CQF A;  1K0C A;  1YF1 A;  5J40 A;  2FCH A;  2X8C A;  1HNB A;  1PMT A;  5IMA A;  4K7I A;  2LRC A;  3A2W A;  4PQI A;  2LJA A;  2PWJ A;  1OAZ A;  2HRA A;  2DKH A;  5COH A;  1GNE A;  3FK8 A;  3KH9 A;  4MJA A;  4L5O A;  4FO5 A;  4HEA 2;  5A34 B;  2HSM B;  4TR0 A;  1YKA A;  3F63 A;  2JAD A;  1GSF A;  1WIK A;  3EVI A;  3LGC A;  2A4H A;  1U88 A;  3GA4 A;  1GLQ A;  5CRD A;  1KTE A;  4HJ2 A;  4BL7 B;  6GSW A;  4I2T A;  4DEJ A;  4F82 A;  4PNF A;  2HSN A;  3GMF A;  4G9H A;  2IMF A;  5HFI A;  1GSS A;  4XCS A;  4J56 E;  4NMU A;  3KH7 A;  4POB A;  3GTU A;  1YF0 A;  1K3Y A;  2H1D A;  4HU7 A;  4YQV A;  1AAZ A;  1SK1 A;  4KDU A;  2DKI A;  3LEF A;  3ZTL A;  3DKS A;  5DJM A;  2WVY A;  1JZW A;  3BCI A;  2PER A;  1ERT A;  3L4N A;  4XS4 B;  2F9S A;  4XS1 A;  3TJG A;  3OR5 A;  1TW9 A;  4J57 E;  3TKR A;  1U3A A;  4HZ2 A;  2EC4 A;  1XWK A;  2MMZ A;  4CW9 A;  3KZQ A;  5JCU A;  3QFA C;  4LMV A;  2R5G A;  1MDJ A;  4IQ1 A;  2REM A;  3GKN A;  1JFU A;  1TU8 A;  4KE3 A;  4QL7 A;  3UL3 A;  4EE0 A;  3HZ4 A;  3C7M A;  1IYH A;  1T00 A;  3IAM 2;  3D22 A;  4MAB A;  3ZL5 A;  1U3I A;  3IK9 A;  3QR6 A;  3IR4 A;  4O92 A;  2DJ3 A;  1ILO A;  3IC4 A;  2OAC A;  2YOI A;  1YVL A;  2DJ0 A;  1F3A A;  1TRV A;  4K5S A;  1X0R A;  3MSZ A;  1WJK A;  3FY7 A;  2H75 A;  1GRX A;  4PGT A;  2J9H A;  1M9B A;  2AUV A;  4YAV A;  2HT9 A;  2M46 A;  2LJK A;  5AN1 A;  1R7H A;  4TR1 B;  9GSS A;  5JCG A;  3E3E A;  1NSW A;  2CV4 A;  1GSU A;  3GX8 A;  3PH9 A;  4I2U A;  2GST A;  1JHB A;  2LUS A;  3UVT A;  3QAG A;  3KJY A;  1BG1 A;  5IMC A;  4OFT A;  3HHV A;  1O7U A;  3MIX A;  1BED A;  4X0X A;  2R0G A;  1RW1 A;  5A34 A;  3DML A;  2HSM A;  5ELA A;  3TKS E;  1QMV A;  3RAZ A;  2EFD A;  1GWC A;  3QAW A;  2AAW A;  1YKC A;  4ZBD A;  4BL7 A;  4GQF A;  2OBI A;  5HR2 A;  3AY8 A;  1LJR A;  5IOW A;  1Q98 A;  2BJX A;  2V6O A;  5CRW A;  3Q19 A;  1RK4 A;  2VCT A;  4K5R A;  3GKK A;  4QMK A;  1K0M A;  3ISO A;  4G0I A;  3KP9 A;  5AIV A;  3CTF A;  1JZD A;  3GN3 A;  5D73 A;  2LQQ A;  3VPQ A;  4MLY A;  1GUM A;  2RLI A;  3G9B A;  4POM A;  2CZ2 A;  3ZLP A;  2LTK A;  2FWE A;  4KA0 A;  2HRK B;  4TOP A;  5J41 A;  4XS4 A;  2G2Q A;  3ZMK A;  5ID2 B;  1PL1 A;  3KXO A;  18GS A;  1M2A A;  2F51 A;  4KAE A;  5FT3 A;  2X64 A;  2VD1 A;  4PXO A;  3TJF A;  4TN8 A;  3O6T A;  5CRH A;  1SKR B;  1XW6 A;  4ML6 A;  3LYP A;  1B4P A;  3UMA A;  3F0I A;  1NHO A;  1QQ2 A;  3ZZX A;  3QDN A;  3LJR A;  5HFG A;  3F8U A;  1VF1 A;  3HD5 A;  3GX0 A;  1TI3 A;  3WGD A;  2LRT A;  4IP6 A;  1M3J A;  6GSV A;  3IHG A;  1OE7 A;  2LEG A;  3H4K A;  2AJQ B;  1QXH A;  2L59 A;  1ZOF A;  1ZYN A;  2MZC A;  2VL9 A;  1F2E A;  4PQH A;  1A8Y A;  3P90 A;  3GNJ A;  1QFN A;  2GLR A;  3C71 A;  2HQT A;  2WGR A;  4IW9 A;  3LYK A;  1H75 A;  2A2S A;  3FZ9 A;  2FA8 A;  2MYG A;  4W66 A;  3SBC A;  2O87 A;  6GSY A;  1OC8 A;  4DVC A;  3N9J A;  1DE2 A;  1A24 A;  2V6K A;  2DML A;  4TR1 A;  2PVQ A;  1EP7 A;  1TOF A;  2H1G A;  1EGO A;  4Z2U A;  4EUY A;  4Q5F A;  5A4W A;  4WF4 A;  2VM1 A;  4G01 A;  1FB6 A;  2H6Z A;  1K0O A;  3GL5 A;  3ZFL A;  1O8X A;  3KIJ A;  4EL1 A;  5L71 A;  1AUC A;  5D96 A;  3D4M A;  1ZMA A;  4V2N A;  1YEX A;  4XRA A;  4F03 A;  3W8J A;  4PNG A;  4ECC A;  3ED3 A;  4H86 A;  4O5U A;  11GS A;  4YH2 A;  1X5C A;  1EV9 A;  4OFN A;  2JAC A;  3RBT A;  5AGY A;  3UBK A;  1A2L A;  3L9V A;  3EU4 A;  5B6N A;  1N25 A;  2HZF A;  1EWX A;  2P5R A;  2B3S A;  4O5R A;  3C1S A;  1FB0 A;  2GQK A;  4PI0 C;  1Q4J A;  3WGE A;  1G0T A;  4AJ6 A;  4RQR A;  2DJ2 A;  5JWO B;  3IC8 A;  3PGT A;  2QGV A;  2VLV A;  7GSS A;  1TU7 A;  4MPG A;  1QUW A;  1LU4 A;  3UAP A;  4N0Z A;  1XWG A;  2B5E A;  4LLR A;  3CRU A;  2HRK A;  4Q5N A;  4K6X A;  1PRX A;  1GTU A;  3MYD A;  3G7Y A;  1J08 A;  4POK A;  3C8E A;  2G0F A;  5ID2 A;  3L9S A;  4IJ3 A;  5GST A;  3IK7 A;  4OO5 A;  2MMA A;  4MH2 A;  2OE0 A;  2H0I A;  3IE3 A;  3BCK A;  1O81 A;  2KHP A;  3MWH A;  1TP9 A;  1FW1 A;  4WBR D;  1BAY A;  3UOM A;  4NHZ A;  5JCW A;  1T1V A;  3M8N A;  2OA7 A;  4FH8 A;  1GUK A;  3FKF A;  3R3E A;  1XIY A;  3DD3 A;  6GSS A;  2DJK A;  5BRT A;  2WW2 A;  3KMO A;  3H79 A;  2ON5 A;  2ZUP A;  3EMX A;  1R26 A;  5ECO B;  4NV2 A;  4E8E A;  2GT6 A;  1S3D A;  1SKW B;  2R37 A;  3F3Q A;  4AKG A;  2H0H A;  2OBK A;  1SL1 B;  1MTC A;  2FWH A;  5DJL A;  1WRY A;  2GZP A;  3ZRE A;  1X9S B;  13GS A;  1ML6 A;  3IRA A;  4WR4 A;  2GSS A;  1M7T A;  2JZS A;  2VO4 A;  3M9J A;  2A4V A;  5KN3 A;  1BJX A;  1AXD A;  1R4W A;  2N5A A;  2Z9S A;  4F0C A;  3VI7 A;  5BMU B;  4RQX A;  5JWQ B;  2L4Q A;  1JZR A;  5ECM B;  3VWV A;  4I8B A;  2V41 A;  2WJU A;  1PD2 1;  1VF2 A;  20GS A;  5F07 A;  1TK8 B;  2H19 A;  5ECN B;  3GUR A;  3PIN A;  3F4R A;  1N2A A;  2C4J A;  2YWM A;  3GIX A;  1XZO A;  2XC2 A;  3HCZ A;  2FGX A;  1EP8 A;  1XBS A;  2M80 A;  4O5Q A;  4TRX A;  2PPT A;  4KDX A;  1GH2 A;  4GSN A;  3RDW A;  5G5F A;  1TRW A;  5D93 A;  3LOR A;  4E8H A;  4ICY A;  4HOJ A;  2XPE A;  2DMM A;  1O85 A;  5KN1 A;  2J23 A;  2B1L A;  4MA9 A;  3U5R E;  3V1W A;  4ISD A;  1USB A;  4K7O A;  4BVX B;  1WPI A;  2B6M A;  3EWL A;  1RQM A;  2MMN A;  2DIZ A;  2DIY A;  2TRC P;  1ZCP A;  1UVZ A;  4BVY B;  3FZA A;  2H0G A;  3EMP A;  2ZNM A;  1WE0 A;  3GHA A;  4YQM A;  2F8F A;  3L78 A;  1CQG A;  10GS A;  5H5R A;  3DXB A;  3LSZ A;  3F9U A;  2YPM A;  1FG4 A;  1XG8 A;  1XOA A;  2AHE A;  3JCM L;  1ON4 A;  2GZY A;  1ABA A;  4K0G A;  1M2D A;  4ZB9 A;  4TW5 A;  3FR9 A;  3GYK A;  4FIW A;  2VCZ A;  2LS5 A;  5JWR B;  4NXI A;  4TR4 A;  5DCG A;  1UC7 A;  1XOB A;  1Y6E A;  3DRN A;  4NWY A;  4PUF C;  5EY6 A;  2K8S A;  5GZZ B;  1A2M A;  5F8B A;  1SYR A;  2IJY A;  5HR0 A;  1THO A;  2H01 A;  2NTO A;  3IDV A;  4BWS A;  1X9M B;  5EL8 A;  5B7C A;  1MD4 A;  2HZE B;  4EO3 A;  3SWL A;  1WP0 A;  19GS A;  4ZB7 A;  1K3L A;  2WZS A;  2C1Y A;  2LV3 A;  3HJM A;  4JU5 A;  1J0F A;  4N11 A;  5B8A A;  2VM2 A;  4GTU A;  2WCI A;  3EPT A;  3EIN A;  3TKS A;  5BMU A;  4G0L A;  4IEL A;  3Q74 A;  4L5L A;  4GLT A;  4MF7 A;  3NIV A;  4ZIJ A;  4K0N A;  1BYE A;  2P0G A;  1R5A A;  3UVH A;  4GXZ A;  4KF9 A;  3QCP A;  5ELG A;  4MF5 A;  4KX4 A;  3CSJ A;  5KN2 A;  1BF5 A;  2O85 A;  2O3E A;  3ZVJ A;  1O73 A;  1URM A;  2C0E A;  5IMZ A;  2GS3 A; 
#chains in the Genus database with same CATH homology
 1PKW A;  1V40 A;  5ECH B;  2YN1 A;  4LA1 A;  2X99 A;  4OWY A;  3FHK A;  2V2G A;  5J9C A;  4OD7 A;  3FRC A;  4YKG A;  3VLN A;  4RI7 A;  2P5Q A;  1GTI A;  3CTG A;  5IMD A;  4IHU A;  1OYJ A;  4MK3 A;  1MEK A;  4TXV A;  2QSI A;  4BVX A;  3H93 A;  2VKZ G;  5F05 A;  2XPD A;  4BVY A;  3LG6 A;  5G1K A;  1BG5 A;  2X8H A;  3VWU A;  2CVD A;  2IPA A;  1TXX A;  4Z2T A;  1AC1 A;  2ZCT A;  1O8W A;  1TI1 A;  2MBS A;  3F4S A;  3HVX A;  4YQU A;  5A4U A;  1T8E B;  2CAQ A;  2OT3 A;  4FYC A;  4EIP A;  2YNX A;  1MDK A;  1FAA A;  3P8W A;  4MNN A;  4GSS A;  3DIE A;  4OCE A;  5ABR A;  1GP1 A;  3CBU A;  1PGT A;  2YZH A;  2HXK A;  2DJJ A;  1K0D A;  3DEX A;  3G7I A;  2FD3 A;  1F3B A;  4NAX A;  4Q5Q A;  1K0N A;  4WBJ A;  5J9B A;  5AIS A;  4KDY A;  1ZGN A;  2RUF A;  3IAS 2;  1VRS D;  3ZVJ D;  2XBI A;  2VAF A;  2HE3 A;  4AJ8 A;  1Y25 A;  1N8J A;  2AYT A;  3CRT A;  2E2M A;  5A1N B;  2FWF A;  5AIX A;  4MF6 A;  1VF4 A;  1XWA A;  3IOS A;  2C3Q A;  2HZE A;  2I9H A;  3R2Q A;  1WOU A;  2R2J A;  1FVJ A;  4JBB A;  3TKS C;  4I6X A;  3CSH A;  5A5K A;  2HRF A;  3I43 A;  2OAD A;  1ZYQ B;  4PQ1 A;  1EOH A;  3MAK A;  1AQX A;  1UN2 A;  1I9D A;  4TVE A;  4CY6 A;  4HJM A;  4MZB A;  2I4A A;  3O3T A;  5DAK B;  1A0R P;  1SK0 A;  1OKT A;  3S9F A;  2VLT A;  2QC7 A;  2CX4 A;  2I1U A;  3UJ1 A;  1Y1U A;  5HFK A;  2BTO T;  2H71 A;  14GS A;  2LNT A;  2KLX A;  1DUG A;  5LD0 A;  4O7H A;  2CVK A;  3APS A;  1GNW A;  1SVM A;  4GDF A;  3D5J A;  2HYX A;  1K0A A;  3KM6 A;  4N30 A;  1OC9 B;  4OCF A;  5G1L A;  4CY8 A;  1ZYP A;  5IPH A;  2JSZ A;  2TRX A;  1XXU A;  5CYY A;  2VCV A;  2K8V A;  2FWG A;  2IMD A;  3GH6 A;  3A2V A;  5J4U A;  4ZB8 A;  1ERW A;  1DSB A;  1FVK A;  1TJD A;  1XWB A;  2RM6 A;  2EFH A;  3M9K A;  5CO3 A;  5DVB A;  2F8A A;  2OE3 A;  2IME A;  3ZIJ A;  3LFL A;  4NHW A;  3GKM A;  4MZW A;  4EVM A;  1OC3 A;  3J7Y b;  2PU9 C;  1UA5 A;  4RUV A;  1DE1 A;  1YJ6 A;  1PSQ A;  3QFB C;  4JR4 A;  3CYN A;  3ERW A;  1ERV A;  5ECI B;  1ACV A;  1V57 A;  1Z3E A;  2C80 A;  2DBC A;  2LRN A;  4DSS B;  2B5Y A;  4WR5 A;  3KTL A;  2XBQ A;  1ZYE A;  4KND A;  1SYX A;  2LST A;  4KGI A;  3WT2 A;  3VK9 A;  4WF5 A;  3D0Z A;  1ST9 A;  2JSY A;  4YKF A;  1M99 A;  1PA3 A;  2UZ8 A;  4XTS A;  2H74 A;  4HU9 A;  2OKA A;  4OO4 A;  2HRN A;  4X4J A;  1H4O A;  1GSD A;  3QAV A;  1A0F A;  1ZZY A;  2TIR A;  4K7N A;  1SD9 A;  1XWC A;  1TDI A;  5ECS A;  1SJZ A;  2BMX A;  2DSA A;  3RPP A;  4V2L A;  2GZZ A;  2RUE A;  4AKX B;  2FNO A;  3M3M A;  5ECK B;  5HQP A;  1V58 A;  5FHI A;  5J47 A;  1Z5Y E;  4BPY A;  2D2Z A;  1Z7P A;  4Q5R A;  2YJ7 A;  3KEB A;  3QD9 A;  3FZ4 A;  2VCX A;  4ECI A;  1A2J A;  1EEM A;  2B7K A;  1TTZ A;  5J4V A;  1V2A A;  2XHF A;  1XCC A;  4DSR A;  3EUR A;  1JLV A;  2VLU A;  5DAK A;  4EF0 A;  1YQ1 A;  1K0B A;  3ME8 A;  3NZN A;  4KB3 A;  1ZL9 A;  1YY7 A;  4XS6 A;  2H1L A;  2WUL A;  1GLP A;  1BQ7 A;  1XVQ A;  2PBJ A;  2K6V A;  3TCO A;  2KP2 A;  3WT1 A;  3IV4 A;  3A2X A;  4D73 B;  1GL8 A;  2HFD A;  2WDU A;  3KD0 A;  4WXT A;  5DAL B;  2H6X A;  2C0G A;  2L4C A;  2C8U A;  2YCD A;  3HYP A;  4OMV A;  5D9W A;  4PUR A;  4GRF A;  3RPN A;  5KEJ A;  3HY2 A;  1OC9 A;  4MDC A;  1AQW A;  1B9X C;  2QA2 A;  4IP1 A;  2GVP A;  1SEN A;  1B8X A;  4XRD A;  1GTB A;  3HVS A;  5GSS A;  2YWI A;  4ZBA A;  1B4Q A;  1HNC A;  2WZ9 A;  3GST A;  4PUA A;  3GRX A;  3TOU A;  4AKI A;  4N3Z A;  3L9U A;  1JLW A;  3TDG A;  4ML1 A;  5H5Q A;  3FR6 A;  3ERF A;  2FA4 A;  2MBT A;  4K9Z A;  2GTU A;  2MMO A;  2HI7 A;  3FR3 A;  4IJI A;  1X9W B;  1AW9 A;  2FY6 A;  2NPB A;  3VWX A;  2P31 A;  1A8L A;  4L0W A;  1OVN A;  2R6K A;  17GS A;  1B48 A;  4PX1 A;  1G7O A;  1SVO A;  5B8B A;  4IS0 A;  1PX7 A;  1MD3 A;  2WFC A;  3TKQ A;  1AIU A;  4O32 A;  4HDE A;  2DC5 A;  2DJ1 A;  2GDR A;  2X49 A;  3I6A A;  1EGR A;  5ECQ B;  4GCI A;  1YZX A;  4ZIL A;  4FQU A;  1W89 A;  3ZML A;  3DYR A;  3HJP A;  4GQC A;  4TKY A;  3DWV A;  1LBK A;  5ECL B;  3TJB A;  5DQS A;  4XHM A;  5LNK e;  3MDK A;  3J7Y k;  3TGZ A;  3P2A A;  3PPU A;  1QGV A;  5H5S A;  5G30 A;  1Z6N A;  5INY A;  1WMJ A;  2PUK C;  2IMK A;  3M0F A;  1NM3 A;  1KNG A;  5E4W A;  1XW9 A;  5ECR B;  4TR3 A;  3DVX A;  3HXS A;  3GFK A;  4CHS A;  2GSR A;  3VUR A;  4ECJ A;  4RI6 A;  2YV9 A;  2K9F A;  3FMW A;  1SL2 B;  4KCE A;  3ERG A;  1ERU A;  2JZT A;  3HDC A;  3GUS A;  4G2E A;  3KP8 A;  4MJB A;  3GKX A;  3VI5 A;  4AI6 A;  4KSM A;  5KOX A;  1FHE A;  1WWJ A;  2IFQ B;  1TRU A;  3WYW A;  2L5L A;  3RHB A;  4JRR A;  3BD2 A;  3UBL A;  3EU3 A;  4KW6 A;  1SK2 A;  3Q18 A;  5FWG A;  5EPF A;  4X1U A;  2O89 A;  4N0V A;  4KUN A;  4K2D A;  4D73 A;  2GT5 A;  1YDK A;  4ILF A;  5DAL A;  1U6T A;  2CX3 A;  4AJ7 A;  2V1M A;  2YAN A;  4QQ7 A;  2O8V B;  1SD8 A;  5D9X A;  1PL2 A;  2VL3 A;  2LJR A;  3VWW A;  4Z2R A;  5A4V A;  1T4Z A;  3US3 A;  2V32 A;  3GH9 A;  5F06 A;  3EC3 A;  4IQA A;  2UV8 G;  2HLS A;  2F3M A;  2E0Q A;  5E59 A;  5G5E A;  3ZYW A;  4FYU A;  5KN0 A;  3D6I A;  5D8I A;  2K18 A;  3TJK A;  6GSX A;  2O5V A;  3LQ7 A;  4V1A p;  1SJ6 A;  4L8E A;  4LMW A;  4AF2 A;  4KH7 A;  1PN9 A;  4E68 A;  4MPF A;  1XFL A;  5IMF A;  2CA8 A;  3TRP A;  1OE8 A;  4X43 A;  2EIR A;  4MMM A;  2E2G A;  5IOX A;  1PN0 A;  1FO5 A;  2NVL A;  4MP4 A;  3FZ5 A;  2IMI A;  2CVB A;  2L5O A;  1T4Y A;  3H8Q A;  4K1F A;  3NOF A;  4EXJ A;  3ME7 A;  1TK5 B;  4PTS A;  5GAN D;  2WB9 A;  5C04 A;  4ACS A;  3D21 A;  3W8S A;  4GST A;  2YWN A;  4ZL9 A;  4G0K A;  2LNS A;  4GF0 A;  2E7P A;  2JZR A;  5IO0 A;  2R0P A;  2VUP A;  5IIZ A;  3QPM A;  4HUA A;  2L6C A;  2M72 A;  2KP1 A;  4HQZ A;  3KCM A;  5DDL A;  2KOK A;  1Z7R A;  4MZC A;  1SU9 A;  3P7X A;  3QMX A;  2FUG 2;  4N10 A;  4EKZ A;  4OFM A;  2HSH A;  5DBQ A;  3IHQ A;  1T3B A;  4EDY A;  2H6Y A;  2B5X A;  1G7E A;  1Z9H A;  3HA9 A;  2I81 A;  1M2B A;  3BBY A;  4DSQ A;  4XIH A;  2ALB A;  3KGK A;  3BOA A;  4K8M A;  3VFI A;  5IPG A;  3KMN A;  2KUC A;  1TRS A;  2C0D A;  3LWA A;  2C3N A;  4A5P A;  5A5H B;  4TXO B;  4F9Z A;  2R3X A;  4ID0 A;  5CNW A;  1EOG A;  1VGL A;  3TKP A;  3EE2 A;  2IFQ A;  2VL2 A;  4POL A;  1XW5 A;  2HNL A;  1I5G A;  4J2F A;  1C72 A;  5GAP D;  3ZIT A;  3L0H A;  1MDI A;  5G31 A;  1TKD B;  3RHC A;  2AV4 A;  5EVO A;  2HSY A;  4AGS A;  6GST A;  1TK0 B;  3CXG A;  4IN0 A;  2C3T A;  3E0U A;  4IVF A;  3KTB A;  2YZU A;  2VD0 A;  4USS A;  4JR6 A;  2YWO A;  4HQS A;  1XVW A;  3WD6 A;  1GUL A;  4ECB A;  1FOV A;  2L57 A;  3I9V 2;  4WEY A;  4Z7X A;  12GS A;  4ZB6 A;  2B7J A;  3GL3 A;  3BJ5 A;  4QL9 A;  2N5F A;  3O76 A;  2OJL A;  2GQL A;  4JE1 A;  4KSO A;  5D9T A;  1B9Y C;  4F0B A;  2H73 A;  1PKZ A;  3UEM A;  4L0U A;  4FYB A;  1XPV A;  3GV1 A;  2EIQ A;  3C73 A;  5IMV A;  1GSY A;  4P3Y B;  5C00 A;  1V9W A;  5J4Y A;  1HQO A;  3A5I A;  1FOH A;  2A2R A;  4MJE A;  2CAI A;  2YV7 A;  3U6V A;  2PN8 A;  4ZL8 A;  2AB6 A;  22GS A;  3TB2 A;  2PGT A;  3IA1 A;  1PX6 A;  1J9B A;  1JZO A;  4HS1 A;  2X8G A;  3VPT A;  2QA1 A;  4WKW A;  3GSS A;  3APQ A;  4EIQ A;  4KCA A;  3LW9 A;  4EDZ A;  5G2Z A;  2H8L A;  3H1N A;  4F2I A;  3CWG A;  2X4A A;  5LCZ A;  2WRT A;  2RII A;  5IO2 A;  2O7K A;  5J5N A;  4MCU A;  1E6B A;  3IXR A;  1F9M A;  5CAX A;  2VOC A;  5ENU A;  3QOU A;  3ZRD A;  8GSS A;  3TUE A;  1HD2 A;  5ECP B;  1R5P A;  2FLS A;  3APO A;  2JL4 A;  1THX A;  2VL2 C;  2IN3 A;  3UAR A;  3G7J A;  1F37 A;  1T7P B;  2ES7 A;  3PR8 A;  2CQ9 A;  1YEP A;  3A5W A;  5A5H A;  4ZXG A;  4TXO A;  1EV4 A;  4JED A;  3A3T A;  3F3R A;  1SJI A;  2H76 A;  4ULX A;  2CZ3 A;  3TOT A;  2EIO A;  1M9A A;  1F6M C;  3FEU A;  2IL3 A;  4CDO A;  2R0C A;  2N5B A;  3HVV A;  2I3Y A;  1TXU A;  2H70 A;  4ZL7 A;  4IBP A;  1BX9 A;  5IQY A;  4EC0 A;  1NHY A;  5A1N A;  5F0G A;  4MH3 A;  2PVO C;  3TRQ A;  4LL1 B;  1DBY A;  4IGJ A;  4ZBB A;  1W4V A;  3ZFB A;  2VIM A;  4HZ4 A;  1U87 A;  4LL4 B;  2EFC A;  16GS A;  1QK8 A;  4WET A;  5J3R A;  5HR1 A;  3CSI A;  1GUH A;  3Q6O A;  1PQN A;  1VF3 A;  2VCW A;  2GGT A;  1AQV A;  1SKS B;  2H66 A;  4V1A g;  1SL0 B;  3HMJ G;  2NBS A;  3N5O A;  3ZIV A;  2GSQ A;  4I5Q A;  1GSE A;  5DCH A;  2PMT A;  1EZK A;  2C0F A;  1M0U A;  3HJO A;  2CT6 A;  2LKU A;  3UIW A;  2VCQ A;  3F6F A;  6GSU A;  3D4T A;  3EYT A;  5CRE A;  1A23 A;  4NPB A;  1O6J A;  1HNA A;  2NDO A;  1KBN A;  2H1B A;  4I97 A;  1KEB A;  2H30 A;  2HSN B;  1EEJ A;  3HKR A;  2ON7 A;  4AKH A;  1G6Y A;  4HI7 A;  1K3O A;  5KOW A;  2H72 A;  5HR3 A;  4JZQ A;  4K2X A;  4BWQ A;  1X5D A;  5CRG A;  3GTU B;  4MJC A;  3FYG A;  2L6D A;  3W6G A;  4G10 A;  3TRX A;  2EFE A;  4IKH A;  1GTA A;  1SVL A;  2JU5 A;  1Z6M A;  1GSQ A;  2B1K A;  1X5E A;  2IWT A;  5DQY A;  2GQM A;  2H1A A;  1S3A A;  2RM5 A;  4V2M A;  3MNG A;  2YJH A;  3LXT A;  1HYU A;  5B6M A;  5IM9 A;  3HZ8 A;  4DSS A;  2WS2 A;  3TJJ A;  2DLX A;  4G19 A;  3IPZ A;  3F4T A;  3CMI A;  3M1G A;  3I69 A;  3DVW A;  2R4V A;  1E2Y A;  2FHE A;  3DGQ A;  2OE1 A;  3LXZ A;  5D9V A;  2IIY A;  1NW2 A;  1S3C A;  3IBH A;  4YAP A;  2QKE A;  3FW2 A;  4BA7 A;  3F6D A;  3TU3 B;  3C1R A;  3WGX A;  2A2P A;  1G6W A;  4GWR A;  4NV5 A;  1IYI A;  2LQO A;  2YP6 A;  3E9J B;  3K8N A;  5CP1 A;  1V98 A;  1OKD A;  1CQH A;  1K0C A;  1YF1 A;  5J40 A;  2FCH A;  2X8C A;  1HNB A;  1PMT A;  5IMA A;  4K7I A;  2LRC A;  3A2W A;  4PQI A;  2LJA A;  2PWJ A;  1OAZ A;  2HRA A;  2DKH A;  5COH A;  1GNE A;  3FK8 A;  3KH9 A;  4MJA A;  4L5O A;  4FO5 A;  4HEA 2;  5A34 B;  2HSM B;  4TR0 A;  1YKA A;  3F63 A;  2JAD A;  1GSF A;  1WIK A;  3EVI A;  3LGC A;  2A4H A;  1U88 A;  3GA4 A;  1GLQ A;  5CRD A;  1KTE A;  4HJ2 A;  4BL7 B;  6GSW A;  4I2T A;  4DEJ A;  4F82 A;  4PNF A;  2HSN A;  3GMF A;  4G9H A;  2IMF A;  5HFI A;  1GSS A;  4XCS A;  4J56 E;  4NMU A;  3KH7 A;  4POB A;  3GTU A;  1YF0 A;  1K3Y A;  2H1D A;  4HU7 A;  4YQV A;  1AAZ A;  1SK1 A;  4KDU A;  2DKI A;  3LEF A;  3ZTL A;  3DKS A;  5DJM A;  1JZW A;  3BCI A;  2PER A;  1ERT A;  3L4N A;  4XS4 B;  2F9S A;  4XS1 A;  3TJG A;  3OR5 A;  1TW9 A;  4J57 E;  3TKR A;  1U3A A;  4HZ2 A;  2EC4 A;  1XWK A;  2MMZ A;  4CW9 A;  3KZQ A;  5JCU A;  3QFA C;  4LMV A;  2R5G A;  1MDJ A;  4IQ1 A;  2REM A;  3GKN A;  1JFU A;  1TU8 A;  4KE3 A;  4QL7 A;  3UL3 A;  4EE0 A;  3HZ4 A;  3C7M A;  1IYH A;  1T00 A;  3IAM 2;  3D22 A;  4MAB A;  3ZL5 A;  1U3I A;  3IK9 A;  3QR6 A;  3IR4 A;  4O92 A;  2DJ3 A;  1ILO A;  3IC4 A;  2OAC A;  2YOI A;  1YVL A;  2DJ0 A;  1F3A A;  1TRV A;  4K5S A;  1X0R A;  3MSZ A;  1WJK A;  3FY7 A;  2H75 A;  1GRX A;  4PGT A;  2J9H A;  1M9B A;  2AUV A;  4YAV A;  2HT9 A;  2M46 A;  2LJK A;  5AN1 A;  1R7H A;  4TR1 B;  9GSS A;  5JCG A;  3E3E A;  1NSW A;  2CV4 A;  1GSU A;  3GX8 A;  3PH9 A;  4I2U A;  2GST A;  1JHB A;  2LUS A;  3UVT A;  3QAG A;  3KJY A;  1BG1 A;  5IMC A;  4OFT A;  3HHV A;  1O7U A;  3MIX A;  1BED A;  4X0X A;  2R0G A;  1RW1 A;  5A34 A;  3DML A;  2HSM A;  5ELA A;  3TKS E;  1QMV A;  3RAZ A;  2EFD A;  1GWC A;  3QAW A;  2AAW A;  1YKC A;  4ZBD A;  4BL7 A;  4GQF A;  2OBI A;  5HR2 A;  3AY8 A;  1LJR A;  5IOW A;  1Q98 A;  2BJX A;  2V6O A;  5CRW A;  3Q19 A;  1RK4 A;  2VCT A;  4K5R A;  3GKK A;  4QMK A;  1K0M A;  3ISO A;  4G0I A;  3KP9 A;  5AIV A;  3CTF A;  1JZD A;  3GN3 A;  5D73 A;  2LQQ A;  3VPQ A;  4MLY A;  1GUM A;  2RLI A;  3G9B A;  4POM A;  2CZ2 A;  3ZLP A;  2LTK A;  2FWE A;  4KA0 A;  2HRK B;  4TOP A;  5J41 A;  4XS4 A;  2G2Q A;  3ZMK A;  5ID2 B;  1PL1 A;  3KXO A;  18GS A;  1M2A A;  2F51 A;  4KAE A;  5FT3 A;  2X64 A;  2VD1 A;  4PXO A;  3TJF A;  4TN8 A;  3O6T A;  5CRH A;  1SKR B;  1XW6 A;  4ML6 A;  3LYP A;  1B4P A;  3UMA A;  3F0I A;  1NHO A;  1QQ2 A;  3ZZX A;  3QDN A;  3LJR A;  5HFG A;  3F8U A;  1VF1 A;  3HD5 A;  3GX0 A;  1TI3 A;  3WGD A;  2LRT A;  4IP6 A;  6GSV A;  3IHG A;  1OE7 A;  2LEG A;  3H4K A;  2AJQ B;  1QXH A;  2L59 A;  1ZOF A;  1ZYN A;  2MZC A;  2VL9 A;  1F2E A;  4PQH A;  1A8Y A;  3P90 A;  3GNJ A;  1QFN A;  2GLR A;  3C71 A;  2HQT A;  2WGR A;  4IW9 A;  3LYK A;  1H75 A;  2A2S A;  3FZ9 A;  2FA8 A;  2MYG A;  4W66 A;  3SBC A;  2O87 A;  6GSY A;  1OC8 A;  4DVC A;  3N9J A;  1DE2 A;  1A24 A;  2V6K A;  2DML A;  4TR1 A;  2PVQ A;  1EP7 A;  1TOF A;  2H1G A;  1EGO A;  4Z2U A;  4EUY A;  4Q5F A;  5A4W A;  4WF4 A;  2VM1 A;  4G01 A;  1FB6 A;  2H6Z A;  1K0O A;  3GL5 A;  3ZFL A;  1O8X A;  3KIJ A;  4EL1 A;  5L71 A;  1AUC A;  5D96 A;  3D4M A;  1ZMA A;  4V2N A;  1YEX A;  4XRA A;  4F03 A;  3W8J A;  4PNG A;  4ECC A;  3ED3 A;  4H86 A;  4O5U A;  11GS A;  4YH2 A;  1X5C A;  1EV9 A;  4OFN A;  2JAC A;  3RBT A;  5AGY A;  3UBK A;  1A2L A;  3L9V A;  3EU4 A;  5B6N A;  1N25 A;  2HZF A;  1EWX A;  2P5R A;  2B3S A;  4O5R A;  3C1S A;  1FB0 A;  2GQK A;  1Q4J A;  3WGE A;  1G0T A;  4AJ6 A;  4RQR A;  2DJ2 A;  5JWO B;  3IC8 A;  3PGT A;  2QGV A;  2VLV A;  7GSS A;  1TU7 A;  4MPG A;  1QUW A;  1LU4 A;  3UAP A;  4N0Z A;  1XWG A;  2B5E A;  4LLR A;  3CRU A;  2HRK A;  4Q5N A;  4K6X A;  1PRX A;  1GTU A;  3MYD A;  3G7Y A;  1J08 A;  4POK A;  3C8E A;  2G0F A;  5ID2 A;  3L9S A;  4IJ3 A;  5GST A;  3IK7 A;  4OO5 A;  2MMA A;  4MH2 A;  2OE0 A;  2H0I A;  3IE3 A;  3BCK A;  1O81 A;  2KHP A;  3MWH A;  1TP9 A;  1FW1 A;  4WBR D;  1BAY A;  3UOM A;  4NHZ A;  5JCW A;  1T1V A;  3M8N A;  2OA7 A;  4FH8 A;  1GUK A;  3FKF A;  3R3E A;  1XIY A;  3DD3 A;  6GSS A;  2DJK A;  5BRT A;  3KMO A;  3H79 A;  2ON5 A;  2ZUP A;  3EMX A;  1R26 A;  5ECO B;  4NV2 A;  4E8E A;  2GT6 A;  1S3D A;  1SKW B;  2R37 A;  3F3Q A;  4AKG A;  2H0H A;  2OBK A;  1SL1 B;  1MTC A;  2FWH A;  5DJL A;  1WRY A;  2GZP A;  3ZRE A;  1X9S B;  13GS A;  1ML6 A;  3IRA A;  4WR4 A;  2GSS A;  1M7T A;  2JZS A;  2VO4 A;  3M9J A;  2A4V A;  5KN3 A;  1BJX A;  1AXD A;  1R4W A;  2N5A A;  2Z9S A;  4F0C A;  3VI7 A;  5BMU B;  4RQX A;  5JWQ B;  2L4Q A;  1JZR A;  5ECM B;  3VWV A;  4I8B A;  2V41 A;  2WJU A;  1PD2 1;  1VF2 A;  20GS A;  5F07 A;  1TK8 B;  2H19 A;  5ECN B;  3GUR A;  3PIN A;  3F4R A;  1N2A A;  2C4J A;  2YWM A;  3GIX A;  1XZO A;  2XC2 A;  3HCZ A;  2FGX A;  1EP8 A;  1XBS A;  2M80 A;  4O5Q A;  4TRX A;  2PPT A;  4KDX A;  1GH2 A;  4GSN A;  3RDW A;  5G5F A;  1TRW A;  5D93 A;  3LOR A;  4E8H A;  4ICY A;  4HOJ A;  2XPE A;  2DMM A;  1O85 A;  5KN1 A;  2J23 A;  2B1L A;  4MA9 A;  3U5R E;  3V1W A;  4ISD A;  1USB A;  4K7O A;  4BVX B;  1WPI A;  2B6M A;  3EWL A;  1RQM A;  2DIZ A;  2MMN A;  2DIY A;  2TRC P;  1ZCP A;  1UVZ A;  4BVY B;  3FZA A;  2H0G A;  3EMP A;  2ZNM A;  1WE0 A;  3GHA A;  4YQM A;  2F8F A;  3L78 A;  1CQG A;  10GS A;  5H5R A;  3DXB A;  3LSZ A;  3F9U A;  2YPM A;  1FG4 A;  1XOA A;  2AHE A;  3JCM L;  1ON4 A;  2GZY A;  1ABA A;  4K0G A;  1M2D A;  4ZB9 A;  4TW5 A;  3FR9 A;  3GYK A;  4FIW A;  2VCZ A;  2LS5 A;  5JWR B;  4NXI A;  4TR4 A;  5DCG A;  1UC7 A;  1XOB A;  1Y6E A;  3DRN A;  4NWY A;  4PUF C;  5EY6 A;  2K8S A;  5GZZ B;  1A2M A;  5F8B A;  1SYR A;  2IJY A;  5HR0 A;  1THO A;  2H01 A;  2NTO A;  3IDV A;  4BWS A;  1X9M B;  5EL8 A;  5B7C A;  1MD4 A;  2HZE B;  4EO3 A;  3SWL A;  1WP0 A;  19GS A;  4ZB7 A;  1K3L A;  2C1Y A;  2LV3 A;  3HJM A;  4JU5 A;  1J0F A;  4N11 A;  5B8A A;  2VM2 A;  4GTU A;  2WCI A;  3EPT A;  3EIN A;  3TKS A;  5BMU A;  4G0L A;  4IEL A;  3Q74 A;  4L5L A;  4GLT A;  4MF7 A;  3NIV A;  4ZIJ A;  4K0N A;  1BYE A;  2P0G A;  1R5A A;  3UVH A;  4GXZ A;  4KF9 A;  3QCP A;  5ELG A;  4MF5 A;  4KX4 A;  3CSJ A;  5KN2 A;  1BF5 A;  2O85 A;  3ZVJ A;  1O73 A;  1URM A;  2C0E A;  5IMZ A;  2GS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...