4IQAA

Crystal structure analysis of the e228l mutant of human clic1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
223
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDELIELAYEQVAKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Crystal Structure Analysis of the E228L Mutant of Human CLIC1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 70
structure length 223
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4iqaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4iqaA01
1BQ7A 1ERTA 1JZOA 1V9WA 3UARA 2L6CA 5F0GA 2V41A 1EOGA 4HJ2A 3Q6OA 5D9TA 2FGXA 5DJLA 2L4QA 4KH7A 3HJPA 1EP8A 1XOBA 1GTAA 4ML6A 1V98A 1NSWA 3UEMA 2HYXA 2BJXA 4EL1A 2B5XA 3N9JA 2FHEA 2ZCTA 2GTUA 3G7JA 3GN3A 1UVZA 2IWTA 4OFMA 4IS0A 4MK3A 3APQA 2AB6A 4KA0A 5FWGA 2TIRA 3PH9A 2HSNB 3RHBA 5IO0A 1SKRB 2WFCA 2OA7A 2XBQA 3RBTA 2BTOT 1URMA 1K0CA 3HVSA 2YCDA 3W8SA 1GTUA 5GSSA 1YF0A 2KP2A 3GX0A 3DMLA 2IL3A 1SK0A 1ZMAA 2QSIA 2DMMA 5DALB 2M72A 3GIXA 5DAKB 3IV4A 4AJ7A 1ACVA 3U5RE 2H76A 1WE0A 2VD0A 3GKNA 9GSSA 2UZ8A 4OWYA 5D73A 1GNWA 3GYKA 3FK8A 1SJIA 2CZ3A 1VRSD 2QKEA 4ID0A 3EYTA 1M2BA 1Z5YE 4MZCA 4NHWA 1U87A 2R6KA 5J9CA 2CVKA 4PXOA 3GL3A 4ZBBA 4WR5A 2PPTA 4PNGA 6GSVA 3FW2A 4N10A 3BJ5A 2I4AA 2NBSA 4KSOA 1A8YA 2O89A 2N5FA 7GSSA 5HR1A 2N5BA 1GH2A 4K9ZA 3GMFA 4DSRA 2JADA 2JSYA 1A2MA 1YQ1A 4GTUA 2K9FA 2IIYA 3TKQA 2LRTA 1ST9A 4IQ1A 5JWRB 4IBPA 1G0TA 3EURA 1XIYA 4E8HA 4HEA2 1HNCA 2F51A 4WXTA 4KB3A 1PA3A 3EE2A 3VLNA 2C3QA 2HSHA 2LJKA 1Y25A 2QGVA 2H72A 3GTUB 2FWFA 3RDWA 1HNAA 2FWHA 4IJ3A 2PERA 3GKKA 3RPPA 5CRGA 5CNWA 1GRXA 4AJ6A 1V40A 5J5NA 1XPVA 2F3MA 3Q74A 2VCQA 3TGZA 1BAYA 3D4TA 1TTZA 4KSMA 4JEDA 2VM1A 3C1RA 3RHCA 5DALA 4ZL8A 2DMLA 4JBBA 5DAKA 3GSTA 3WT2A 2VD1A 4GSNA 3ISOA 4XS4B 2L6DA 4OCFA 3ZITA 3ZFLA 2VL2A 3EWLA 1G6YA 3MNGA 1WP0A 3DEXA 2E2MA 2VLTA 3LGCA 2VCZA 1SENA 2VLUA 5F07A 5C04A 1TU7A 2HRKB 2GSRA 4EUYA 3L0HA 1USBA 2PWJA 5ABRA 3IOSA 1MDJA 4EDZA 4ECIA 1FB6A 2GQLA 2CAIA 3H1NA 1VGLA 2C1YA 2IMIA 8GSSA 2CZ2A 1EEJA 1WWJA 1PKWA 2H1BA 3QCPA 3DXBA 4NV5A 2YN1A 4GRFA 1HNBA 2HFDA 4K0NA 4X0XA 4XRDA 1AUCA 1B4QA 4XIHA 4E8EA 3Q19A 1FO5A 3GKMA 2OACA 2HSMB 3KXOA 3E3EA 2PBJA 4HU9A 1X9MB 2MYGA 1XW9A 2KLXA 3EMXA 2WDUA 3GKXA 5HFIA 1OAZA 4KCAA 2OE0A 3HCZA 1EEMA 3VFIA 3GTUA 1GSFA 2MMOA 5A4WA 1TDIA 4HDEA 4MJEA 3ERWA 5D96A 4OFNA 4JRRA 4V1Ap 4PURA 1SJ6A 4V2NA 3G7IA 3KH7A 1JLWA 3WGDA 1GSUA 3LYKA 1T00A 2LTKA 2B5EA 2GLRA 2GZPA 22GSA 1PL2A 5J4UA 1Z9HA 1T3BA 4IKHA 6GSUA 2H75A 1KBNA 4XS4A 4BWQA 4EC0A 5IOXA 1M2AA 2K8VA 3IPZA 2P5QA 1DBYA 4LMWA 2OADA 3CTGA 3UAPA 2HRKA 3D6IA 2HI7A 2L4CA 3KEBA 1ZCPA 1TK8B 3L9UA 1THOA 2R37A 1AAZA 1T7PB 1HD2A 2D2ZA 2X64A 1QFNA 2FA4A 2M80A 4WBRD 1JFUA 2FY6A 2V6OA 4IJIA 1XWGA 2YZUA 5COHA 5D9VA 2MZCA 1X9WB 1N8JA 3IXRA 3LXZA 3PR8A 1B8XA 5HR0A 4K6XA 1K0DA 4ZB6A 3CSJA 2HLSA 3EMPA 2GSTA 3HKRA 3ME7A 3ZFBA 2GZZA 3IDVA 2X8GA 1TRUA 2HRNA 3H4KA 2AAWA 1B9XC 3F6FA 2YWIA 1GP1A 2HSMA 2IJYA 5LNKe 1XCCA 4X1UA 5IPHA 4WETA 3I43A 4O32A 5GAND 5KN3A 4ML1A 5CP1A 2GT5A 3HXSA 5IIZA 1GSQA 2JACA 2C80A 4FYCA 4J57E 2VOCA 1A0RP 1TRSA 1SK1A 1U3AA 4O7HA 3UMAA 3KP9A 2ON7A 1EGOA 4P3YB 3VWWA 4V2MA 3FZ9A 4WR4A 3HHVA 2B7JA 3VWUA 1J08A 1SU9A 3KMNA 2GZYA 5HR2A 1EV4A 2AYTA 3TOUA 4LLRA 1Q4JA 5J9BA 17GSA 3TJGA 4OD7A 1Z7RA 3MWHA 2ZNMA 3FR6A 2H1AA 4I6XA 5DCGA 4J56E 2L59A 4EO3A 2NPBA 4Q5QA 2LRCA 1GL8A 1XFLA 2B5YA 3UJ1A 3NOFA 3HJMA 1TJDA 1MTCA 5A5KA 3GURA 1UA5A 4HS1A 4CW9A 4ZL9A 5HQPA 5J41A 3PGTA 2A4VA 3VK9A 1BEDA 2PVOC 2B1KA 3KH9A 2C0EA 3I69A 5HR3A 2GT6A 3LG6A 1YF1A 2VLVA 5AIVA 2LKUA 3P90A 3DIEA 4V1Ag 1R7HA 4HZ2A 2IN3A 2O7KA 4EKZA 2H01A 1KEBA 1O7UA 5KN0A 4KF9A 2YJHA 2LEGA 2EIQA 4POMA 3LYPA 4KAEA 4K1FA 3US3A 1ZOFA 3ZMKA 3WGXA 1R5PA 3N5OA 5AN1A 3CRUA 5B8BA 2DJ2A 1FW1A 3A3TA 2PN8A 1GSSA 1ILOA 4RI6A 2J23A 5IMFA 3W8JA 5DJMA 4GLTA 1T4ZA 2TRXA 1OC8A 1NW2A 1V57A 4MF6A 2YWOA 1S3CA 1HQOA 4KUNA 4MH2A 3EU4A 3EVIA 1S3AA 1TK0B 2VL9A 2X8HA 3LEFA 4EE0A 3VPTA 1GSEA 4TOPA 1SL0B 2F8FA 11GSA 5DBQA 2WB9A 3KMOA 2C8UA 3ZMLA 14GSA 1QGVA 4IVFA 4K7OA 2CVDA 3KCMA 3ZRDA 1ZL9A 3MAKA 3BD2A 1F2EA 2YV9A 3D0ZA 4AJ8A 5HFKA 3DVXA 1U6TA 3F4TA 2ES7A 4CHSA 1AW9A 1MDKA 5DCHA 5HFGA 3UBLA 1TP9A 1X5CA 2XBIA 1ERWA 3NZNA 4YAVA 5AIXA 1SYXA 1WJKA 2GSSA 2HQTA 20GSA 1F9MA 2DJ1A 1OE7A 1AIUA 19GSA 1G6WA 4YQVA 4TW5A 4MMMA 2H1GA 4FO5A 5CYYA 4NAXA 4AF2A 1A8LA 3F4SA 5JCGA 4WBJA 3ZVJA 3F3RA 1Z7PA 3KIJA 1OYJA 3IR4A 4MPGA 2G0FA 4K7IA 5EL8A 2H74A 3UBKA 2AJQB 2X8CA 1XWCA 4MP4A 5IMDA 2H8LA 1XWKA 1T4YA 3TKSC 3QAVA 1SK2A 6GSSA 1M9AA 3QAGA 2EC4A 2CQ9A 5GAPD 1MEKA 3ZL5A 3ZIVA 1RW1A 4F82A 2L57A 4DEJA 1SKSB 4IW9A 1K0AA 4GCIA 1ABAA 2H66A 2PMTA 3HZ4A 3O76A 5ECIB 2DIZA 2O85A 2PUKC 4MA9A 4OCEA 5DQYA 2CT6A 5ECKB 5IOWA 2REMA 1VF4A 3G9BA 3FEUA 2R5GA 4IP6A 2LQQA 2CX3A 1IYIA 2L5LA 5J3RA 2V32A 2GQMA 3FKFA 3F4RA 5GSTA 3I6AA 4BA7A 3JCML 4IQAA 4F0BA 3LQ7A 5ECHB 4MCUA 4OMVA 4N0ZA 4YH2A 3VI7A 1QXHA 2FNOA 2H1DA 2J9HA 4KNDA 1M99A 4K2DA 2NVLA 2LSTA 2YZHA 3UVTA 3GFKA 2V6KA 3GX8A 4N11A 4IGJA 2KHPA 3R3EA 2CA8A 2DSAA 3CSIA 3VPQA 4KDUA 4I2UA 4MZBA 3GV1A 2KUCA 2P31A 4K7NA 5B6NA 2HRFA 1FVJA 3TJBA 3IK9A 5LD0A 4ECJA 1VF1A 3VI5A 4XHMA 4EF0A 1PGTA 2B6MA 3TKSE 1QK8A 5A4UA 1X5DA 4GWRA 4TVEA 6GSWA 4ISDA 2RUEA 4LL4B 4TRXA 2B3SA 1GULA 1E2YA 2JZRA 4PGTA 1ERUA 4MDCA 4KDXA 4WEYA 2I3YA 3J7Yk 3HYPA 2QC7A 1ERVA 4O92A 1ZZYA 1O8WA 2C0DA 2C4JA 2GQKA 3FYGA 10GSA 3C8EA 2OBIA 3R2QA 3SBCA 2JL4A 4L0WA 3M1GA 2LNSA 2NDOA 3ZIJA 3ZYWA 2MBTA 4ZIJA 3C71A 4G19A 3DRNA 4ZBAA 5GZZB 1M9BA 4ZXGA 1Z6MA 3H79A 3TDGA 16GSA 4KDYA 1GTIA 2OKAA 2G2QA 3E9JB 1B9YC 4PNFA 3FR9A 2GS3A 5F8BA 2OE1A 4AGSA 1TI1A 2C3TA 3IAM2 3EINA 3M9JA 4KW6A 4Z7XA 3ERFA 4J2FA 1ZGNA 2JZSA 1HYUA 5LCZA 2LS5A 1GLQA 2WGRA 2TRCP 3LORA 4G10A 1ON4A 2WULA 1GTBA 3H93A 3HVVA 3IC8A 6GSTA 4XS6A 5FHIA 5FT3A 1WMJA 1MDIA 3EC3A 4GQCA 1SD8A 4HZ4A 5DDLA 2F8AA 4HQZA 1ZYQB 2K18A 1JZWA 2H71A 3D21A 2DJ3A 1Z6NA 1NM3A 4WF4A 1PQNA 2VCXA 2VCTA 3RAZA 5L71A 1KTEA 1JHBA 3L9SA 4EVMA 1R26A 1LU4A 1BX9A 6GSYA 2V2GA 4ZL7A 1XW6A 1F6MC 1O6JA 4QL7A 4FIWA 2B7KA 1WPIA 3D22A 2IFQA 4TR0A 4MF7A 4NMUA 3QPMA 3PINA 3GHAA 1XWBA 1N2AA 3TJKA 2EIOA 1TOFA 3HJOA 5IMVA 3VWVA 1A2LA 4GF0A 4NWYA 2ON5A 4JR4A 3C1SA 2IPAA 1QMVA 3EU3A 1OKDA 1CQGA 1R5AA 3PPUA 3CMIA 5ENUA 1F3AA 3A2XA 4PQIA 1S3DA 6GSXA 1TKDB 2DBCA 2LJAA 1AXDA 1UN2A 5D8IA 3TJJA 2H6XA 3TJFA 2K6VA 5CRHA 4ILFA 4FQUA 1H75A 3A2WA 5E59A 4JE1A 2GVPA 2KP1A 3KM6A 4BVXB 3P8WA 1EP7A 2YWMA 1BYEA 1T8EB 2YPMA 1GUKA 4TR1B 1OVNA 5EPFA 5ECSA 3E0UA 3KP8A 5KN1A 2I1UA 2IMDA 1AQXA 18GSA 4ECBA 4FH8A 3O6TA 5JWOB 2LNTA 3ERGA 5F05A 1SL1B 2HZEB 3GNJA 3IE3A 3QAWA 3M8NA 1W89A 2FA8A 5E4WA 3A5WA 3IA1A 1AQWA 4Q5RA 1OKTA 2LUSA 2FLSA 1B4PA 4XCSA 3HVXA 3LXTA 1C72A 2OBKA 5IMAA 4PUFC 1ML6A 3I9V2 5D9WA 1OC3A 2MMZA 3GH9A 4G0KA 2RM6A 3D4MA 3APOA 1XBSA 2VL2C 3FZ5A 1YZXA 2WJUA 3CRTA 2XHFA 4K0GA 3HY2A 3FR3A 2E0QA 5G1KA 5ELAA 4IN0A 1GUMA 1GLPA 5ECQB 4HQSA 3QMXA 3FZAA 2L5OA 2H0HA 1A23A 3HZ8A 1K3YA 3A2VA 4EDYA 2HXKA 2JZTA 4L5OA 5D93A 4PQHA 2P5RA 3CTFA 2H0GA 2IMFA 5ID2B 2FWGA 4G0IA 2H70A 4XTSA 5ECLB 1G7OA 4HU7A 3L4NA 4TKYA 3F8UA 4BVXA 1GUHA 4L8EA 3TCOA 4N30A 1RQMA 1PX7A 3HA9A 3F0IA 4TR1A 2YV7A 1SJZA 2DJKA 5B7CA 1MD4A 4I8BA 3DKSA 3IBHA 5IPGA 4CDOA 3DWVA 4O5RA 2JSZA 2WS2A 4RQXA 4LA1A 4YAPA 2DJJA 2HZEA 4POLA 4MABA 3QD9A 2FWEA 4G9HA 3TKRA 4BVYB 4ECCA 3F6DA 12GSA 1JZRA 2O8VB 1TXXA 3KD0A 5INYA 4MH3A 1EOHA 1SKWB 3GRXA 4PTSA 4G2EA 2YNXA 4D73B 2RM5A 1BG5A 3DD3A 3M0FA 4HJMA 4DSSB 2HZFA 3MSZA 2GSQA 1OE8A 2DC5A 1WRYA 2YANA 3TRPA 3OR5A 2R2JA 1K0BA 1MD3A 3TUEA 2YJ7A 1LJRA 1J0FA 4DSQA 1XZOA 3KTLA 5CO3A 1PMTA 2H30A 3QDNA 1XWAA 3P7XA 1DE1A 4NV2A 3GL5A 3DGQA 3SWLA 1OC9B 5KEJA 4ZB9A 4X43A 4JZQA 5ID2A 1GWCA 5ECMB 5IMZA 5EVOA 1A2JA 4K8MA 2A2SA 1X9SB 1JLVA 2CAQA 3GUSA 4WF5A 4F2IA 3K8NA 1WIKA 2IMKA 4F9ZA 3G7YA 2H6YA 4NXIA 3QOUA 2XPDA 2LV3A 2HRAA 2H6ZA 1PX6A 2DIYA 2RIIA 3CSHA 2HE3A 2MMAA 5IO2A 4OFTA 1AC1A 1TI3A 2VIMA 5C00A 4NHZA 4GSSA 4RQRA 4DVCA 3ZREA 3L78A 1A0FA 1RK4A 3UIWA 4L0UA 4MJAA 4HOJA 2C0FA 3C7MA 1G7EA 1CQHA 5B6MA 2VCVA 1YY7A 1FG4A 4TR4A 1XXUA 4QQ7A 4BVYA 1GNEA 2YWNA 2MBSA 2OE3A 3IC4A 4L5LA 2RLIA 1TW9A 2PVQA 4PUAA 3ED3A 3C73A 3CYNA 3DYRA 3LWAA 4D73A 4H86A 5A4VA 2XC2A 5D9XA 2F9SA 4DSSA 5CRDA 1NHYA 5G5EA 5G5FA 2WZ9A 1R4WA 4QL9A 1YEPA 1H4OA 5CREA 5ECRB 3GSSA 1JZDA 5IM9A 1WOUA 4FYUA 1K0NA 4EXJA 3AY8A 3QFAC 2N5AA 4YQUA 2IMEA 3ME8A 1O8XA 5G31A 2HT9A 5EY6A 3TRQA 4IELA 4GXZA 2IFQB 3WYWA 3APSA 1YDKA 4G0LA 1LBKA 1GSYA 4ZBDA 4IHUA 4USSA 3L9VA 2E2GA 5DVBA 4F0CA 1OC9A 2M46A 4GQFA 2R4VA 4HI7A 2MMNA 4YQMA 1UC7A 2JU5A 4NPBA 1DSBA 2O87A 1V58A 4ZB8A 3MDKA 4BWSA 2HSYA 1PN9A 2OJLA 2FUG2 4F03A 5IQYA 5H5SA 4BL7B 2YP6A 1DUGA 4OO4A 4V2LA 4TXOB 1F37A 3GA4A 4MPFA 2CX4A 1XVWA 4MF5A 3KJYA 3P2AA 4POKA 2XPEA 1PSQA 5AISA 1Z3EA 1E6BA 1F3BA 1KNGA 2H0IA 1PRXA 2BMXA 4ACSA 3F3QA 3IHQA 3J7Yb 4Q5FA 2AHEA 4BPYA 1V2AA 5B8AA 2WRTA 2LRNA 1TK5B 4MLYA 5F06A 1U3IA 5ELGA 2A2RA 5JCWA 3BCIA 1YEXA 4N0VA 2YOIA 4KCEA 1THXA 3UL3A 2VCWA 3ZZXA 3Q18A 2VAFA 1VF2A 1PL1A 2PGTA 3D5JA 4I5QA 3FZ4A 2GDRA 2VO4A 3BCKA 2FCHA 1J9BA 2ALBA 2NTOA 1TRVA 2Z9SA 2CV4A 1EZKA 4XS1A 3KGKA 3QR6A 3TB2A 1SD9A 3TRXA 1O81A 1W4VA 1PKZA 3CXGA 3WD6A 5ECPB 3FRCA 1A24A 3F9UA 1K0MA 4POBA 5CRWA 2E7PA 2AUVA 3TKSA 1FB0A 3UVHA 1VF3A 1BJXA 2GGTA 1ZYEA 1K3LA 4Q5NA 2PU9C 4JR6A 3BOAA 1O85A 5G30A 3BBYA 5KN2A 4MZWA 1X0RA 1FHEA 3M3MA 3ZLPA 2FD3A 1O73A 1DE2A 2X99A 1I5GA 2EIRA 4RI7A 2B1LA 3ZTLA 2R3XA 5AGYA 4BL7A 1FAAA 2ZUPA 1GSDA 1TU8A 3VWXA 1X5EA 4TXOA 4I2TA 3HD5A 4PQ1A 3M9KA 3LFLA 3TOTA 1FVKA 4I97A 4LL1B 3U6VA 3KZQA 3FY7A 5H5RA 4HUAA 5H5QA 1IYHA 2H73A 1XVQA 3VURA 3ZVJD 3TKPA 1U88A 3O3TA 2P0GA 2WCIA 3CBUA 1YKCA 1PD21 2I81A 1I9DA 1EV9A 4FYBA 5CAXA 1K3OA 3LJRA 2LQOA 2HNLA 1EWXA 4ZILA 4LMVA 3S9FA 4IP1A 4XRAA 1AQVA 4KE3A 1M7TA 1NHOA 1QQ2A 1Y6EA 2C3NA 3IAS2 2KOKA 3NIVA 3V1WA 4WKWA 4KGIA 2CVBA 1XW5A 1B48A 1XOAA 4KX4A 4TR3A 3FHKA 5G1LA 1FOVA 1QUWA 3IRAA 4PX1A 3GH6A 5JWQB 4TN8A 5ECNB 4OO5A 4MJBA 3QFBC 2RUFA 13GSA 1TRWA 1Q98A 1K0OA 3KTBA 3IK7A 5BMUA 1SL2B 2I9HA 4MJCA 4RUVA 1YKAA 2H19A 4ULXA 2K8SA 3HDCA 2VUPA 1M0UA 1M2DA 5IMCA 5JCUA 2VL3A 2V1MA 3F63A 3W6GA 2VM2A 4JU5A 3DVWA 2AV4A 3LSZA 2DJ0A 1T1VA 5G2ZA 1SYRA 3UOMA 5DQSA 1YJ6A 1EGRA 5ECOB 2DLXA 3WGEA 3WT1A 4GSTA 3RPNA 2LJRA 3H8QA 4TXVA 2C0GA
chains in the Genus database with same CATH superfamily
1BQ7A 1ERTA 1JZOA 1V9WA 3UARA 2L6CA 5F0GA 2V41A 1EOGA 4HJ2A 3Q6OA 2WW2A 5D9TA 2FGXA 5DJLA 2L4QA 4KH7A 3HJPA 1EP8A 1XOBA 1GTAA 4ML6A 1V98A 1NSWA 3UEMA 2UV8G 2BJXA 2HYXA 4EL1A 2B5XA 1YEWC 3N9JA 2FHEA 2ZCTA 2GTUA 3G7JA 3GN3A 1UVZA 2IWTA 4OFMA 4IS0A 3EPTA 4MK3A 2EFHA 3APQA 2AB6A 4KA0A 5FWGA 2TIRA 2WVXB 3PH9A 2HSNB 3RHBA 5IO0A 1SKRB 2WFCA 2OA7A 2XBQA 3RBTA 2BTOT 1URMA 1K0CA 3HVSA 2YCDA 3W8SA 1GTUA 5GSSA 1YF0A 2KP2A 3GX0A 3DMLA 2IL3A 1SK0A 1ZMAA 2O5VA 2QSIA 2DMMA 5DALB 2M72A 3GIXA 5DAKB 5A34B 3IV4A 4AJ7A 1ACVA 3U5RE 2H76A 1WE0A 2VD0A 3GKNA 9GSSA 2UZ8A 4OWYA 1XG8A 5D73A 1GNWA 3GYKA 3FK8A 1SJIA 2CZ3A 1VRSD 2QKEA 4ID0A 3EYTA 1M2BA 1Z5YE 4MZCA 4NHWA 1U87A 2R6KA 5J9CA 2CVKA 4PXOA 1M3IA 3GL3A 4ZBBA 4WR5A 2PPTA 4PNGA 6GSVA 3FW2A 4N10A 3BJ5A 2I4AA 2NBSA 4KSOA 1A8YA 2O89A 2N5FA 7GSSA 5HR1A 2N5BA 1GH2A 3LW9A 4K9ZA 3GMFA 4DSRA 2JADA 2JSYA 1A2MA 1YQ1A 4GTUA 2K9FA 2IIYA 3TKQA 2LRTA 1ST9A 4IQ1A 5JWRB 4IBPA 1G0TA 3EURA 1XIYA 4E8HA 4HEA2 1HNCA 2F51A 4WXTA 4KB3A 1PA3A 3EE2A 3VLNA 2C3QA 2HSHA 2LJKA 1Y25A 2QGVA 2H72A 3GTUB 2FWFA 3RDWA 1HNAA 2WVXA 2FWHA 4IJ3A 2HSNA 2PERA 3GKKA 3RPPA 4K5RA 5CRGA 5CNWA 1GRXA 3MIXA 4AJ6A 1V40A 5J5NA 1XPVA 2F3MA 3Q74A 2VCQA 3TGZA 1BAYA 3D4TA 1TTZA 4KSMA 4JEDA 2EFCA 2VM1A 3C1RA 3A5IA 3RHCA 5DALA 4ZL8A 2DMLA 4JBBA 5DAKA 3GSTA 3WT2A 2VD1A 5A34A 4GSNA 3ISOA 4XS4B 2L6DA 4OCFA 3ZITA 3ZFLA 2VL2A 3EWLA 1G6YA 3MNGA 1TXUA 1WP0A 3DEXA 2E2MA 2VLTA 3LGCA 2VCZA 2R0PA 1SENA 2VLUA 5F07A 5C04A 1TU7A 2HRKB 2GSRA 4EUYA 3L0HA 1USBA 2PWJA 5ABRA 3IOSA 1MDJA 4EDZA 4ECIA 1FB6A 2GQLA 2CAIA 3H1NA 1VGLA 2C1YA 2IMIA 8GSSA 2CZ2A 1EEJA 1WWJA 1PKWA 2H1BA 3QCPA 3DXBA 4NV5A 2YN1A 4GRFA 2WVZA 1HNBA 2HFDA 4K0NA 4X0XA 4XRDA 1AUCA 1B4QA 4XIHA 4E8EA 3Q19A 1FO5A 3GKMA 2OACA 2HSMB 3KXOA 3E3EA 2PBJA 4HU9A 1X9MB 2MYGA 1XW9A 2KLXA 3EMXA 2WDUA 3GKXA 5HFIA 4EIQA 1OAZA 4KCAA 5J4VA 2OE0A 3HCZA 1EEMA 3VFIA 3GTUA 1GSFA 2MMOA 5A4WA 1TDIA 4Z2RA 4HDEA 4MJEA 3ERWA 5D96A 4OFNA 4JRRA 4V1Ap 4PURA 1SJ6A 5BRTA 4V2NA 3G7IA 3KH7A 1JLWA 3WGDA 1GSUA 3LYKA 1T00A 2LTKA 2B5EA 2GLRA 2GZPA 22GSA 1PL2A 5J4UA 1Z9HA 1T3BA 4IKHA 6GSUA 2H75A 1KBNA 4XS4A 4BWQA 4EC0A 5IOXA 1M2AA 2K8VA 3IPZA 2P5QA 1DBYA 4LMWA 2OADA 3CTGA 3UAPA 2HRKA 3D6IA 1PN0A 2HI7A 2L4CA 3KEBA 1ZCPA 1TK8B 3L9UA 2QA1A 1THOA 2R37A 1AAZA 1T7PB 1HD2A 2D2ZA 2X64A 1QFNA 2FA4A 2M80A 4WBRD 1JFUA 2FY6A 2V6OA 4IJIA 1XWGA 2YZUA 5COHA 5D9VA 2MZCA 1X9WB 3HMJG 1N8JA 3IXRA 3LXZA 3PR8A 1B8XA 5HR0A 4K6XA 1K0DA 4ZB6A 3CSJA 2HLSA 3EMPA 2GSTA 3HKRA 3ME7A 3ZFBA 2GZZA 3IDVA 2X8GA 1TRUA 2HRNA 3H4KA 2AAWA 1B9XC 3F6FA 2YWIA 1GP1A 2HSMA 2IJYA 5LNKe 1XCCA 4X1UA 5IPHA 1Y1UA 4WETA 3I43A 4O32A 5GAND 5KN3A 4ML1A 5CP1A 3IHGA 2GT5A 3HXSA 5IIZA 1GSQA 2JACA 2C80A 4FYCA 2VOCA 4J57E 1A0RP 1TRSA 1SK1A 1U3AA 4O7HA 3UMAA 3KP9A 2ON7A 1EGOA 4P3YB 3VWWA 4V2MA 3FZ9A 4WR4A 2DKIA 3HHVA 2B7JA 3VWUA 1J08A 1SU9A 3KMNA 2GZYA 3FMWA 5HR2A 1EV4A 2AYTA 3TOUA 4LLRA 1Q4JA 5J9BA 17GSA 3TJGA 5A1NB 4OD7A 1Z7RA 4QMKA 3MWHA 2ZNMA 3FR6A 2H1AA 4I6XA 5DCGA 4J56E 2L59A 4EO3A 1BF5A 2NPBA 4Q5QA 2LRCA 1GL8A 1XFLA 1SVLA 2B5YA 3UJ1A 3NOFA 3HJMA 1TJDA 1MTCA 5A5KA 3GURA 1UA5A 4HS1A 4CW9A 4ZL9A 5HQPA 5J41A 3PGTA 2A4VA 3VK9A 2WZSA 1BEDA 2PVOC 2B1KA 3KH9A 2C0EA 3I69A 5HR3A 2GT6A 3LG6A 1YF1A 4ICYA 2VLVA 5AIVA 3HVNA 2LKUA 3P90A 3DIEA 4V1Ag 1R7HA 4HZ2A 2IN3A 2O7KA 4EKZA 2H01A 1KEBA 1I1IP 1O7UA 5KN0A 4KF9A 5J4YA 2YJHA 2LEGA 2EIQA 4POMA 3LYPA 4KAEA 4K1FA 3US3A 1ZOFA 3ZMKA 3WGXA 1R5PA 3N5OA 5AN1A 3CRUA 5B8BA 2DJ2A 1FW1A 3A3TA 2PN8A 1GSSA 1ILOA 4RI6A 2J23A 5IMFA 3W8JA 5DJMA 4GLTA 1T4ZA 2TRXA 1OC8A 1NW2A 2EFEA 1V57A 4MF6A 2YWOA 1S3CA 1HQOA 4KUNA 4MH2A 3EU4A 3EVIA 1S3AA 1TK0B 2VL9A 2X8HA 3LEFA 4EE0A 3VPTA 1GSEA 2X49A 4TOPA 1SL0B 5A1NA 2F8FA 11GSA 5DBQA 2WB9A 4AKIA 3KMOA 2C8UA 5J40A 3ZMLA 14GSA 1QGVA 4IVFA 4K7OA 2CVDA 3KCMA 3ZRDA 1ZL9A 3MAKA 3BD2A 1F2EA 2YV9A 3D0ZA 4CY6A 4AJ8A 5HFKA 3DVXA 1U6TA 3F4TA 2ES7A 4CHSA 1AW9A 1MDKA 5DCHA 5HFGA 3UBLA 1TP9A 1X5CA 2XBIA 1ERWA 3NZNA 4YAVA 5AIXA 1SYXA 1WJKA 2GSSA 2HQTA 20GSA 1F9MA 2VKZG 2DJ1A 1OE7A 1AIUA 19GSA 1G6WA 4YQVA 4TW5A 4MMMA 2H1GA 4FO5A 5CYYA 4NAXA 4AF2A 1A8LA 2WW0A 3F4SA 5JCGA 4WBJA 3ZVJA 3F3RA 1Z7PA 4AKXB 4O5UA 3KIJA 1OYJA 3IR4A 4MPGA 2G0FA 4K7IA 5EL8A 2H74A 3UBKA 2AJQB 2X8CA 1XWCA 4K5SA 1N25A 4MP4A 5IMDA 2H8LA 1XWKA 1T4YA 3TKSC 2WW1A 3QAVA 1SK2A 6GSSA 1M9AA 3QAGA 2EC4A 1S3RA 2CQ9A 5GAPD 1MEKA 3ZL5A 3ZIVA 1RW1A 4F82A 2L57A 4DEJA 1SKSB 4PI0C 4IW9A 1K0AA 4GCIA 1ABAA 2H66A 2PMTA 3CHXC 3HZ4A 3O76A 5ECIB 1PFOA 2DIZA 2O85A 2PUKC 4MA9A 4OCEA 5DQYA 2CT6A 5ECKB 5IOWA 2REMA 1VF4A 3G9BA 3FEUA 2R5GA 4IP6A 2LQQA 1SVMA 2CX3A 1IYIA 2L5LA 5J3RA 2V32A 2GQMA 3FKFA 3F4RA 5GSTA 3I6AA 4BA7A 3JCML 4IQAA 4F0BA 3LQ7A 5ECHB 4MCUA 4OMVA 4N0ZA 4YH2A 3VI7A 1QXHA 2FNOA 2H1DA 3MYDA 2J9HA 4KNDA 1M99A 4K2DA 2NVLA 1BG1A 2LSTA 2YZHA 3UVTA 3GFKA 2V6KA 3GX8A 4N11A 4IGJA 2KHPA 3R3EA 2CA8A 3CSIA 2DSAA 3VPQA 4KDUA 4I2UA 4MZBA 3GV1A 2KUCA 2P31A 4MNNA 4K7NA 5B6NA 2HRFA 4CY8A 1FVJA 3TJBA 3IK9A 5LD0A 4ECJA 1VF1A 3VI5A 4XHMA 4EF0A 1PGTA 2B6MA 3TKSE 1QK8A 5A4UA 1X5DA 4GWRA 4K2XA 4TVEA 6GSWA 4ISDA 2RUEA 4LL4B 3TU3B 2WVYA 2B3SA 4TRXA 1GULA 1E2YA 2JZRA 4PGTA 1ERUA 4MDCA 4KDXA 4WEYA 2I3YA 3J7Yk 3HYPA 2QC7A 1ERVA 4O92A 1ZZYA 2OT3A 1O8WA 2C0DA 2C4JA 2GQKA 3FYGA 10GSA 3C8EA 2OBIA 3R2QA 3SBCA 2JL4A 4L0WA 3M1GA 2LNSA 2NDOA 3ZIJA 3ZYWA 2MBTA 4ZIJA 3C71A 4G19A 3DRNA 4ZBAA 5GZZB 1M9BA 4ZXGA 1Z6MA 3H79A 3TDGA 16GSA 4KDYA 1GTIA 2OKAA 2G2QA 3E9JB 1B9YC 4PNFA 5A5HB 3FR9A 2GS3A 5F8BA 2OE1A 4AGSA 1TI1A 2C3TA 3IAM2 4AKHA 3EINA 3M9JA 4KW6A 4Z7XA 3ERFA 4J2FA 1ZGNA 2JZSA 1HYUA 1FOHA 5LCZA 2LS5A 1GLQA 2WGRA 2TRCP 3LORA 4AI6A 4G10A 1ON4A 2WULA 1GTBA 3H93A 1ZYPA 3HVVA 3IC8A 6GSTA 4XS6A 5FHIA 5FT3A 1WMJA 4YKGA 5KOXA 1MDIA 3EC3A 4GQCA 1SD8A 4G01A 4HZ4A 5DDLA 2F8AA 4HQZA 1ZYQB 2K18A 1JZWA 2H71A 3D21A 4Z2TA 2DJ3A 1Z6NA 1NM3A 4WF4A 1PQNA 2VCXA 2VCTA 3RAZA 5L71A 1KTEA 1JHBA 3L9SA 4EVMA 1R26A 1LU4A 1BX9A 6GSYA 2V2GA 4ZL7A 1XW6A 1F6MC 1O6JA 4QL7A 4FIWA 2B7KA 4FXYP 1WPIA 3D22A 2IFQA 4TR0A 3CWGA 4MF7A 4NMUA 3QPMA 3PINA 3GHAA 1XWBA 1N2AA 3TJKA 2EIOA 1TOFA 3HJOA 5IMVA 3VWVA 1A2LA 4YKFA 4GF0A 4NWYA 2ON5A 4JR4A 3C1SA 2IPAA 2H1LA 1QMVA 3EU3A 1OKDA 1CQGA 1R5AA 3PPUA 3CMIA 5ENUA 1F3AA 3A2XA 4PQIA 1S3DA 6GSXA 1TKDB 2DBCA 2LJAA 1AXDA 1UN2A 5D8IA 3TJJA 2H6XA 3TJFA 5A5HA 2K6VA 5CRHA 4ILFA 4FQUA 1H75A 3A2WA 5E59A 4JE1A 2GVPA 2KP1A 3KM6A 2R0GA 4BVXB 3P8WA 1EP7A 2YWMA 1BYEA 1T8EB 2YPMA 1GUKA 4TR1B 1OVNA 5EPFA 5ECSA 3E0UA 3KP8A 5KN1A 2I1UA 2IMDA 1AQXA 18GSA 4ECBA 4FH8A 3O6TA 4E68A 5JWOB 2LNTA 3ERGA 5F05A 1SL1B 4EIPA 2HZEB 3GNJA 3IE3A 3QAWA 3M8NA 1W89A 2FA8A 5E4WA 3A5WA 3IA1A 1AQWA 4Q5RA 1OKTA 2LUSA 2FLSA 1B4PA 4XCSA 3HVXA 1S4BP 3LXTA 1C72A 2OBKA 5IMAA 4PUFC 1ML6A 3I9V2 5D9WA 1OC3A 2MMZA 3GH9A 4G0KA 2RM6A 3D4MA 3APOA 1XBSA 2VL2C 4X4JA 3FZ5A 1YZXA 4BIKA 2WJUA 3CRTA 2XHFA 4K0GA 3HY2A 3FR3A 2E0QA 5G1KA 5ELAA 4IN0A 1GUMA 1GLPA 5ECQB 4HQSA 3QMXA 3FZAA 2L5OA 2H0HA 1A23A 3HZ8A 1K3YA 3A2VA 4EDYA 2HXKA 2JZTA 4L5OA 5D93A 4PQHA 2P5RA 3CTFA 2H0GA 2IMFA 5ID2B 2FWGA 4G0IA 2O36A 2H70A 4XTSA 5ECLB 1G7OA 4HU7A 3L4NA 4TKYA 3F8UA 4W66A 4BVXA 1GUHA 4L8EA 3TCOA 4N30A 1RQMA 1PX7A 3HA9A 3F0IA 4TR1A 2YV7A 1SJZA 2DJKA 5B7CA 1MD4A 4I8BA 3DKSA 3IBHA 5IPGA 4CDOA 2DKHA 3DWVA 4O5RA 2JSZA 2WS2A 4RQXA 4LA1A 4YAPA 2DJJA 2HZEA 4POLA 4MABA 3QD9A 2FWEA 4G9HA 3TKRA 4BVYB 4ECCA 3F6DA 12GSA 1JZRA 2O8VB 1TXXA 3KD0A 5INYA 4MH3A 1EOHA 1SKWB 3GRXA 4PTSA 4G2EA 2YNXA 4D73B 2RM5A 1BG5A 3DD3A 3M0FA 4HJMA 4DSSB 2HZFA 3MSZA 2GSQA 1OE8A 2DC5A 1WRYA 2YANA 3TRPA 3OR5A 2R2JA 1K0BA 1MD3A 3TUEA 2YJ7A 1LJRA 1J0FA 4DSQA 1XZOA 3KTLA 5CO3A 1PMTA 2H30A 3QDNA 1XWAA 4A5PA 3P7XA 1DE1A 4NV2A 3GL5A 3DGQA 3SWLA 1OC9B 5KEJA 4ZB9A 4X43A 4JZQA 5ID2A 1GWCA 5ECMB 5IMZA 5EVOA 1A2JA 4K8MA 2A2SA 1X9SB 1JLVA 2CAQA 3GUSA 4WF5A 4F2IA 2EFDA 3K8NA 1WIKA 2IMKA 4F9ZA 3G7YA 2H6YA 4NXIA 3QOUA 1YVLA 2XPDA 2LV3A 2HRAA 2H6ZA 1PX6A 2DIYA 2RIIA 3CSHA 2HE3A 2MMAA 5IO2A 4OFTA 1AC1A 1TI3A 1M3JA 2VIMA 5C00A 4NHZA 4GSSA 4RQRA 4DVCA 3ZREA 3L78A 1A0FA 1RK4A 3UIWA 4L0UA 4MJAA 4HOJA 2C0FA 3C7MA 1G7EA 1CQHA 5B6MA 2VCVA 1YY7A 1FG4A 4Z2UA 4TR4A 1XXUA 4QQ7A 4BVYA 1GNEA 2YWNA 2MBSA 2OE3A 3IC4A 4L5LA 2RLIA 1TW9A 2PVQA 4PUAA 3ED3A 3C73A 3CYNA 3DYRA 3LWAA 4D73A 4H86A 5A4VA 2XC2A 5D9XA 2WW3A 2F9SA 4DSSA 5CRDA 1NHYA 5G5EA 5G5FA 2WZ9A 1R4WA 4QL9A 1YEPA 1H4OA 5CREA 5ECRB 3GSSA 1JZDA 5IM9A 1WOUA 4FYUA 1K0NA 4EXJA 3AY8A 3QFAC 2N5AA 4YQUA 2IMEA 3ME8A 1O8XA 5G31A 2HT9A 5EY6A 3TRQA 4IELA 4GXZA 2IFQB 3WYWA 3APSA 1YDKA 4G0LA 1LBKA 1GSYA 1SVOA 4ZBDA 4IHUA 4USSA 3L9VA 2E2GA 5DVBA 4F0CA 1OC9A 2M46A 2A2PA 4GQFA 2R4VA 4HI7A 2MMNA 4YQMA 1UC7A 2JU5A 4NPBA 1DSBA 2O87A 1V58A 4ZB8A 3MDKA 4BWSA 2HSYA 1PN9A 2A4HA 2OJLA 2FUG2 4F03A 5IQYA 5H5SA 4BL7B 2YP6A 1DUGA 4OO4A 4V2LA 4TXOB 1F37A 3GA4A 4MPFA 4N3ZA 3CQFA 2CX4A 1XVWA 4MF5A 3KJYA 3P2AA 4POKA 2XPEA 1PSQA 5AISA 1Z3EA 1E6BA 1F3BA 1KNGA 2R0CA 2H0IA 1PRXA 2BMXA 4ACSA 3F3QA 3IHQA 3J7Yb 4Q5FA 2AHEA 4BPYA 1V2AA 2O3EA 5B8AA 2WRTA 2LRNA 1TK5B 4MLYA 5F06A 1U3IA 5ELGA 2A2RA 5JCWA 3BCIA 5J47A 1YEXA 4N0VA 2YOIA 4KCEA 1THXA 3UL3A 2VCWA 3ZZXA 3Q18A 2VAFA 4ZB7A 1VF2A 1PL1A 2PGTA 3D5JA 4I5QA 3FZ4A 2GDRA 2VO4A 3BCKA 2FCHA 1J9BA 2ALBA 2NTOA 1TRVA 2Z9SA 2CV4A 1EZKA 4XS1A 3KGKA 3QR6A 3TB2A 1SD9A 3TRXA 2X4AA 1O81A 1W4VA 1PKZA 3CXGA 3WD6A 5BMUB 5ECPB 3FRCA 1A24A 3F9UA 1K0MA 4POBA 5CRWA 2E7PA 2AUVA 3TKSA 1FB0A 3UVHA 1VF3A 1BJXA 2GGTA 1ZYEA 1K3LA 4Q5NA 2PU9C 4PHZC 4GDFA 4JR6A 3BOAA 1O85A 5G30A 3BBYA 5KN2A 4MZWA 1X0RA 1FHEA 3M3MA 3ZLPA 2FD3A 1O73A 1DE2A 2X99A 1I5GA 2EIRA 4RI7A 2B1LA 3ZTLA 2R3XA 1ZYNA 5AGYA 4BL7A 1FAAA 2ZUPA 1GSDA 1TU8A 3VWXA 1X5EA 4TXOA 4I2TA 3HD5A 4PQ1A 3M9KA 3LFLA 3TOTA 1FVKA 4I97A 4LL1B 3U6VA 3KZQA 3FY7A 5H5RA 4HUAA 5H5QA 1IYHA 2H73A 1XVQA 3VURA 3ZVJD 4HSCX 3TKPA 1U88A 3O3TA 2P0GA 2WCIA 3CBUA 1YKCA 1PD21 2I81A 1I9DA 1EV9A 4FYBA 5CAXA 4O5QA 1K3OA 3LJRA 2LQOA 2HNLA 1EWXA 4ZILA 4LMVA 3S9FA 4IP1A 4XRAA 1AQVA 4KE3A 1M7TA 1NHOA 1QQ2A 1Y6EA 2C3NA 3IAS2 2KOKA 3NIVA 3V1WA 4WKWA 4KGIA 2CVBA 1XW5A 3RFRC 1B48A 1XOAA 4KX4A 4TR3A 3FHKA 5G1LA 1FOVA 1QUWA 3IRAA 4PX1A 3GH6A 5JWQB 4TN8A 5ECNB 4OO5A 3RGBC 4MJBA 3QFBC 2RUFA 13GSA 1TRWA 1Q98A 1K0OA 3KTBA 3IK7A 5BMUA 2QA2A 1SL2B 2I9HA 4MJCA 4RUVA 1YKAA 2H19A 4ULXA 2K8SA 4PI2C 3HDCA 2VUPA 1M0UA 1M2DA 4AKGA 5IMCA 5JCUA 2VL3A 2V1MA 3F63A 3W6GA 2VM2A 4JU5A 3DVWA 2AV4A 3LSZA 2DJ0A 1T1VA 5G2ZA 1SYRA 5KOWA 3UOMA 5DQSA 1YJ6A 1EGRA 5ECOB 2DLXA 3WGEA 3WT1A 4GSTA 3RPNA 2LJRA 3H8QA 4TXVA 2C0GA
chains in the Genus database with same CATH topology
1BQ7A 1ERTA 1JZOA 1V9WA 3UARA 2L6CA 5F0GA 2V41A 1EOGA 4HJ2A 3Q6OA 5D9TA 2FGXA 5DJLA 2L4QA 4KH7A 3HJPA 1EP8A 1XOBA 1GTAA 4ML6A 1V98A 1NSWA 3UEMA 2UV8G 2BJXA 2HYXA 4EL1A 2B5XA 3N9JA 2FHEA 2ZCTA 2GTUA 3G7JA 3GN3A 1UVZA 2IWTA 4OFMA 4IS0A 3EPTA 4MK3A 2EFHA 3APQA 2AB6A 4KA0A 5FWGA 2TIRA 3PH9A 2HSNB 3RHBA 5IO0A 1SKRB 2WFCA 2OA7A 2XBQA 3RBTA 2BTOT 1URMA 1K0CA 3HVSA 2YCDA 3W8SA 1GTUA 5GSSA 1YF0A 2KP2A 3GX0A 3DMLA 2IL3A 1SK0A 1ZMAA 2O5VA 2QSIA 2DMMA 5DALB 2M72A 3GIXA 5DAKB 5A34B 3IV4A 4AJ7A 1ACVA 3U5RE 2H76A 1WE0A 2VD0A 3GKNA 9GSSA 2UZ8A 4OWYA 5D73A 1GNWA 3GYKA 3FK8A 1SJIA 2CZ3A 1VRSD 2QKEA 4ID0A 3EYTA 1M2BA 1Z5YE 4MZCA 4NHWA 1U87A 2R6KA 5J9CA 2CVKA 4PXOA 3GL3A 4ZBBA 4WR5A 2PPTA 4PNGA 6GSVA 3FW2A 4N10A 3BJ5A 2I4AA 2NBSA 4KSOA 1A8YA 2O89A 2N5FA 7GSSA 5HR1A 2N5BA 1GH2A 3LW9A 4K9ZA 3GMFA 4DSRA 2JADA 2JSYA 1A2MA 1YQ1A 4GTUA 2K9FA 2IIYA 3TKQA 2LRTA 1ST9A 4IQ1A 5JWRB 4IBPA 1G0TA 3EURA 1XIYA 4E8HA 4HEA2 1HNCA 2F51A 4WXTA 4KB3A 1PA3A 3EE2A 3VLNA 2C3QA 2HSHA 2LJKA 1Y25A 2QGVA 2H72A 3GTUB 2FWFA 3RDWA 1HNAA 2FWHA 4IJ3A 2HSNA 2PERA 3GKKA 3RPPA 4K5RA 5CRGA 5CNWA 1GRXA 3MIXA 4AJ6A 1V40A 5J5NA 1XPVA 2F3MA 3Q74A 2VCQA 3TGZA 1BAYA 3D4TA 1TTZA 4KSMA 4JEDA 2EFCA 2VM1A 3C1RA 3A5IA 3RHCA 5DALA 4ZL8A 2DMLA 4JBBA 5DAKA 3GSTA 3WT2A 2VD1A 5A34A 4GSNA 3ISOA 4XS4B 2L6DA 4OCFA 3ZITA 3ZFLA 2VL2A 3EWLA 1G6YA 3MNGA 1TXUA 1WP0A 3DEXA 2E2MA 2VLTA 3LGCA 2VCZA 2R0PA 1SENA 2VLUA 5F07A 5C04A 1TU7A 2HRKB 2GSRA 4EUYA 3L0HA 1USBA 2PWJA 5ABRA 3IOSA 1MDJA 4EDZA 4ECIA 1FB6A 2GQLA 2CAIA 3H1NA 1VGLA 2C1YA 2IMIA 8GSSA 2CZ2A 1EEJA 1WWJA 1PKWA 2H1BA 3QCPA 3DXBA 4NV5A 2YN1A 4GRFA 1HNBA 2HFDA 4K0NA 4X0XA 4XRDA 1AUCA 1B4QA 4XIHA 4E8EA 3Q19A 1FO5A 3GKMA 2OACA 2HSMB 3KXOA 3E3EA 2PBJA 4HU9A 1X9MB 2MYGA 1XW9A 2KLXA 3EMXA 2WDUA 3GKXA 5HFIA 4EIQA 1OAZA 4KCAA 5J4VA 2OE0A 3HCZA 1EEMA 3VFIA 3GTUA 1GSFA 2MMOA 5A4WA 1TDIA 4Z2RA 4HDEA 4MJEA 3ERWA 5D96A 4OFNA 4JRRA 4V1Ap 4PURA 1SJ6A 5BRTA 4V2NA 3G7IA 3KH7A 1JLWA 3WGDA 1GSUA 3LYKA 1T00A 2LTKA 2B5EA 2GLRA 2GZPA 22GSA 1PL2A 5J4UA 1Z9HA 1T3BA 4IKHA 6GSUA 2H75A 1KBNA 4XS4A 4BWQA 4EC0A 5IOXA 1M2AA 2K8VA 3IPZA 2P5QA 1DBYA 4LMWA 2OADA 3CTGA 3UAPA 2HRKA 3D6IA 1PN0A 2HI7A 2L4CA 3KEBA 1ZCPA 1TK8B 3L9UA 2QA1A 1THOA 2R37A 1AAZA 1T7PB 1HD2A 2D2ZA 2X64A 1QFNA 2FA4A 2M80A 4WBRD 1JFUA 2FY6A 2V6OA 4IJIA 1XWGA 2YZUA 5COHA 5D9VA 2MZCA 1X9WB 3HMJG 1N8JA 3IXRA 3LXZA 3PR8A 1B8XA 5HR0A 4K6XA 1K0DA 4ZB6A 3CSJA 2HLSA 3EMPA 2GSTA 3HKRA 3ME7A 3ZFBA 2GZZA 3IDVA 2X8GA 1TRUA 2HRNA 3H4KA 2AAWA 1B9XC 3F6FA 2YWIA 1GP1A 2HSMA 2IJYA 5LNKe 1XCCA 4X1UA 5IPHA 1Y1UA 4WETA 3I43A 4O32A 5GAND 5KN3A 4ML1A 5CP1A 3IHGA 2GT5A 3HXSA 5IIZA 1GSQA 2JACA 2C80A 4FYCA 2VOCA 4J57E 1A0RP 1TRSA 1SK1A 1U3AA 4O7HA 3UMAA 3KP9A 2ON7A 1EGOA 4P3YB 3VWWA 4V2MA 3FZ9A 4WR4A 2DKIA 3HHVA 2B7JA 3VWUA 1J08A 1SU9A 3KMNA 2GZYA 3FMWA 5HR2A 1EV4A 2AYTA 3TOUA 4LLRA 1Q4JA 5J9BA 17GSA 3TJGA 5A1NB 4OD7A 1Z7RA 4QMKA 3MWHA 2ZNMA 3FR6A 2H1AA 4I6XA 5DCGA 4J56E 2L59A 4EO3A 1BF5A 2NPBA 4Q5QA 2LRCA 1GL8A 1XFLA 1SVLA 2B5YA 3UJ1A 3NOFA 3HJMA 1TJDA 1MTCA 5A5KA 3GURA 1UA5A 4HS1A 4CW9A 4ZL9A 5HQPA 5J41A 3PGTA 2A4VA 3VK9A 1BEDA 2PVOC 2B1KA 3KH9A 2C0EA 3I69A 5HR3A 2GT6A 3LG6A 1YF1A 4ICYA 2VLVA 5AIVA 2LKUA 3P90A 3DIEA 4V1Ag 1R7HA 4HZ2A 2IN3A 2O7KA 4EKZA 2H01A 1KEBA 1O7UA 5KN0A 4KF9A 5J4YA 2YJHA 2LEGA 2EIQA 4POMA 3LYPA 4KAEA 4K1FA 3US3A 1ZOFA 3ZMKA 3WGXA 1R5PA 3N5OA 5AN1A 3CRUA 5B8BA 2DJ2A 1FW1A 3A3TA 2PN8A 1GSSA 1ILOA 4RI6A 2J23A 5IMFA 3W8JA 5DJMA 4GLTA 1T4ZA 2TRXA 1OC8A 1NW2A 2EFEA 1V57A 4MF6A 2YWOA 1S3CA 1HQOA 4KUNA 4MH2A 3EU4A 3EVIA 1S3AA 1TK0B 2VL9A 2X8HA 3LEFA 4EE0A 3VPTA 1GSEA 2X49A 4TOPA 1SL0B 5A1NA 2F8FA 11GSA 5DBQA 2WB9A 4AKIA 3KMOA 2C8UA 5J40A 3ZMLA 14GSA 1QGVA 4IVFA 4K7OA 2CVDA 3KCMA 3ZRDA 1ZL9A 3MAKA 3BD2A 1F2EA 2YV9A 3D0ZA 4CY6A 4AJ8A 5HFKA 3DVXA 1U6TA 3F4TA 2ES7A 4CHSA 1AW9A 1MDKA 5DCHA 5HFGA 3UBLA 1TP9A 1X5CA 2XBIA 1ERWA 3NZNA 4YAVA 5AIXA 1SYXA 1WJKA 2GSSA 2HQTA 20GSA 1F9MA 2VKZG 2DJ1A 1OE7A 1AIUA 19GSA 1G6WA 4YQVA 4TW5A 4MMMA 2H1GA 4FO5A 5CYYA 4NAXA 4AF2A 1A8LA 3F4SA 5JCGA 4WBJA 3ZVJA 3F3RA 1Z7PA 4AKXB 4O5UA 3KIJA 1OYJA 3IR4A 4MPGA 2G0FA 4K7IA 5EL8A 2H74A 3UBKA 2AJQB 2X8CA 1XWCA 4K5SA 1N25A 4MP4A 5IMDA 2H8LA 1XWKA 1T4YA 3TKSC 3QAVA 1SK2A 6GSSA 1M9AA 3QAGA 2EC4A 2CQ9A 5GAPD 1MEKA 3ZL5A 3ZIVA 1RW1A 4F82A 2L57A 4DEJA 1SKSB 4IW9A 1K0AA 4GCIA 1ABAA 2H66A 2PMTA 3HZ4A 3O76A 5ECIB 2DIZA 2O85A 2PUKC 4MA9A 4OCEA 5DQYA 2CT6A 5ECKB 5IOWA 2REMA 1VF4A 3G9BA 3FEUA 2R5GA 4IP6A 2LQQA 1SVMA 2CX3A 1IYIA 2L5LA 5J3RA 2V32A 2GQMA 3FKFA 3F4RA 5GSTA 3I6AA 4BA7A 3JCML 4IQAA 4F0BA 3LQ7A 5ECHB 4MCUA 4OMVA 4N0ZA 4YH2A 3VI7A 1QXHA 2FNOA 2H1DA 3MYDA 2J9HA 4KNDA 1M99A 4K2DA 2NVLA 1BG1A 2LSTA 2YZHA 3UVTA 3GFKA 2V6KA 3GX8A 4N11A 4IGJA 2KHPA 3R3EA 2CA8A 3CSIA 2DSAA 3VPQA 4KDUA 4I2UA 4MZBA 3GV1A 2KUCA 2P31A 4MNNA 4K7NA 5B6NA 2HRFA 4CY8A 1FVJA 3TJBA 3IK9A 5LD0A 4ECJA 1VF1A 3VI5A 4XHMA 4EF0A 1PGTA 2B6MA 3TKSE 1QK8A 5A4UA 1X5DA 4GWRA 4K2XA 4TVEA 6GSWA 4ISDA 2RUEA 4LL4B 3TU3B 2B3SA 4TRXA 1GULA 1E2YA 2JZRA 4PGTA 1ERUA 4MDCA 4KDXA 4WEYA 2I3YA 3J7Yk 3HYPA 2QC7A 1ERVA 4O92A 1ZZYA 2OT3A 1O8WA 2C0DA 2C4JA 2GQKA 3FYGA 10GSA 3C8EA 2OBIA 3R2QA 3SBCA 2JL4A 4L0WA 3M1GA 2LNSA 2NDOA 3ZIJA 3ZYWA 2MBTA 4ZIJA 3C71A 4G19A 3DRNA 4ZBAA 5GZZB 1M9BA 4ZXGA 1Z6MA 3H79A 3TDGA 16GSA 4KDYA 1GTIA 2OKAA 2G2QA 3E9JB 1B9YC 4PNFA 5A5HB 3FR9A 2GS3A 5F8BA 2OE1A 4AGSA 1TI1A 2C3TA 3IAM2 4AKHA 3EINA 3M9JA 4KW6A 4Z7XA 3ERFA 4J2FA 1ZGNA 2JZSA 1HYUA 1FOHA 5LCZA 2LS5A 1GLQA 2WGRA 2TRCP 3LORA 4AI6A 4G10A 1ON4A 2WULA 1GTBA 3H93A 1ZYPA 3HVVA 3IC8A 6GSTA 4XS6A 5FHIA 5FT3A 1WMJA 4YKGA 5KOXA 1MDIA 3EC3A 4GQCA 1SD8A 4G01A 4HZ4A 5DDLA 2F8AA 4HQZA 1ZYQB 2K18A 1JZWA 2H71A 3D21A 4Z2TA 2DJ3A 1Z6NA 1NM3A 4WF4A 1PQNA 2VCXA 2VCTA 3RAZA 5L71A 1KTEA 1JHBA 3L9SA 4EVMA 1R26A 1LU4A 1BX9A 6GSYA 2V2GA 4ZL7A 1XW6A 1F6MC 1O6JA 4QL7A 4FIWA 2B7KA 1WPIA 3D22A 2IFQA 4TR0A 3CWGA 4MF7A 4NMUA 3QPMA 3PINA 3GHAA 1XWBA 1N2AA 3TJKA 2EIOA 1TOFA 3HJOA 5IMVA 3VWVA 1A2LA 4YKFA 4GF0A 4NWYA 2ON5A 4JR4A 3C1SA 2IPAA 2H1LA 1QMVA 3EU3A 1OKDA 1CQGA 1R5AA 3PPUA 3CMIA 5ENUA 1F3AA 3A2XA 4PQIA 1S3DA 6GSXA 1TKDB 2DBCA 2LJAA 1AXDA 1UN2A 5D8IA 3TJJA 2H6XA 3TJFA 5A5HA 2K6VA 5CRHA 4ILFA 4FQUA 1H75A 3A2WA 5E59A 4JE1A 2GVPA 2KP1A 3KM6A 2R0GA 4BVXB 3P8WA 1EP7A 2YWMA 1BYEA 1T8EB 2YPMA 1GUKA 4TR1B 1OVNA 5EPFA 5ECSA 3E0UA 3KP8A 5KN1A 2I1UA 2IMDA 1AQXA 18GSA 4ECBA 4FH8A 3O6TA 4E68A 5JWOB 2LNTA 3ERGA 5F05A 1SL1B 4EIPA 2HZEB 3GNJA 3IE3A 3QAWA 3M8NA 1W89A 2FA8A 5E4WA 3A5WA 3IA1A 1AQWA 4Q5RA 1OKTA 2LUSA 2FLSA 1B4PA 4XCSA 3HVXA 3LXTA 1C72A 2OBKA 5IMAA 4PUFC 1ML6A 3I9V2 5D9WA 1OC3A 2MMZA 3GH9A 4G0KA 2RM6A 3D4MA 3APOA 1XBSA 2VL2C 4X4JA 3FZ5A 1YZXA 2WJUA 3CRTA 2XHFA 4K0GA 3HY2A 3FR3A 2E0QA 5G1KA 5ELAA 4IN0A 1GUMA 1GLPA 5ECQB 4HQSA 3QMXA 3FZAA 2L5OA 2H0HA 1A23A 3HZ8A 1K3YA 3A2VA 4EDYA 2HXKA 2JZTA 4L5OA 5D93A 4PQHA 2P5RA 3CTFA 2H0GA 2IMFA 5ID2B 2FWGA 4G0IA 2H70A 4XTSA 5ECLB 1G7OA 4HU7A 3L4NA 4TKYA 3F8UA 4W66A 4BVXA 1GUHA 4L8EA 3TCOA 4N30A 1RQMA 1PX7A 3HA9A 3F0IA 4TR1A 2YV7A 1SJZA 2DJKA 5B7CA 1MD4A 4I8BA 3DKSA 3IBHA 5IPGA 4CDOA 2DKHA 3DWVA 4O5RA 2JSZA 2WS2A 4RQXA 4LA1A 4YAPA 2DJJA 2HZEA 4POLA 4MABA 3QD9A 2FWEA 4G9HA 3TKRA 4BVYB 4ECCA 3F6DA 12GSA 1JZRA 2O8VB 1TXXA 3KD0A 5INYA 4MH3A 1EOHA 1SKWB 3GRXA 4PTSA 4G2EA 2YNXA 4D73B 2RM5A 1BG5A 3DD3A 3M0FA 4HJMA 4DSSB 2HZFA 3MSZA 2GSQA 1OE8A 2DC5A 1WRYA 2YANA 3TRPA 3OR5A 2R2JA 1K0BA 1MD3A 3TUEA 2YJ7A 1LJRA 1J0FA 4DSQA 1XZOA 3KTLA 5CO3A 1PMTA 2H30A 3QDNA 1XWAA 4A5PA 3P7XA 1DE1A 4NV2A 3GL5A 3DGQA 3SWLA 1OC9B 5KEJA 4ZB9A 4X43A 4JZQA 5ID2A 1GWCA 5ECMB 5IMZA 5EVOA 1A2JA 4K8MA 2A2SA 1X9SB 1JLVA 2CAQA 3GUSA 4WF5A 4F2IA 2EFDA 3K8NA 1WIKA 2IMKA 4F9ZA 3G7YA 2H6YA 4NXIA 3QOUA 1YVLA 2XPDA 2LV3A 2HRAA 2H6ZA 1PX6A 2DIYA 2RIIA 3CSHA 2HE3A 2MMAA 5IO2A 4OFTA 1AC1A 1TI3A 2VIMA 5C00A 4NHZA 4GSSA 4RQRA 4DVCA 3ZREA 3L78A 1A0FA 1RK4A 3UIWA 4L0UA 4MJAA 4HOJA 2C0FA 3C7MA 1G7EA 1CQHA 5B6MA 2VCVA 1YY7A 1FG4A 4Z2UA 4TR4A 1XXUA 4QQ7A 4BVYA 1GNEA 2YWNA 2MBSA 2OE3A 3IC4A 4L5LA 2RLIA 1TW9A 2PVQA 4PUAA 3ED3A 3C73A 3CYNA 3DYRA 3LWAA 4D73A 4H86A 5A4VA 2XC2A 5D9XA 2F9SA 4DSSA 5CRDA 1NHYA 5G5EA 5G5FA 2WZ9A 1R4WA 4QL9A 1YEPA 1H4OA 5CREA 5ECRB 3GSSA 1JZDA 5IM9A 1WOUA 4FYUA 1K0NA 4EXJA 3AY8A 3QFAC 2N5AA 4YQUA 2IMEA 3ME8A 1O8XA 5G31A 2HT9A 5EY6A 3TRQA 4IELA 4GXZA 2IFQB 3WYWA 3APSA 1YDKA 4G0LA 1LBKA 1GSYA 1SVOA 4ZBDA 4IHUA 4USSA 3L9VA 2E2GA 5DVBA 4F0CA 1OC9A 2M46A 2A2PA 4GQFA 2R4VA 4HI7A 2MMNA 4YQMA 1UC7A 2JU5A 4NPBA 1DSBA 2O87A 1V58A 4ZB8A 3MDKA 4BWSA 2HSYA 1PN9A 2A4HA 2OJLA 2FUG2 4F03A 5IQYA 5H5SA 4BL7B 2YP6A 1DUGA 4OO4A 4V2LA 4TXOB 1F37A 3GA4A 4MPFA 4N3ZA 2CX4A 1XVWA 4MF5A 3KJYA 3P2AA 4POKA 2XPEA 1PSQA 5AISA 1Z3EA 1E6BA 1F3BA 1KNGA 2R0CA 2H0IA 1PRXA 2BMXA 4ACSA 3F3QA 3IHQA 3J7Yb 4Q5FA 2AHEA 4BPYA 1V2AA 5B8AA 2WRTA 2LRNA 1TK5B 4MLYA 5F06A 1U3IA 5ELGA 2A2RA 5JCWA 3BCIA 5J47A 1YEXA 4N0VA 2YOIA 4KCEA 1THXA 3UL3A 2VCWA 3ZZXA 3Q18A 2VAFA 4ZB7A 1VF2A 1PL1A 2PGTA 3D5JA 4I5QA 3FZ4A 2GDRA 2VO4A 3BCKA 2FCHA 1J9BA 2ALBA 2NTOA 1TRVA 2Z9SA 2CV4A 1EZKA 4XS1A 3KGKA 3QR6A 3TB2A 1SD9A 3TRXA 2X4AA 1O81A 1W4VA 1PKZA 3CXGA 3WD6A 5BMUB 5ECPB 3FRCA 1A24A 3F9UA 1K0MA 4POBA 5CRWA 2E7PA 2AUVA 3TKSA 1FB0A 3UVHA 1VF3A 1BJXA 2GGTA 1ZYEA 1K3LA 4Q5NA 2PU9C 4GDFA 4JR6A 3BOAA 1O85A 5G30A 3BBYA 5KN2A 4MZWA 1X0RA 1FHEA 3M3MA 3ZLPA 2FD3A 1O73A 1DE2A 2X99A 1I5GA 2EIRA 4RI7A 2B1LA 3ZTLA 2R3XA 1ZYNA 5AGYA 4BL7A 1FAAA 2ZUPA 1GSDA 1TU8A 3VWXA 1X5EA 4TXOA 4I2TA 3HD5A 4PQ1A 3M9KA 3LFLA 3TOTA 1FVKA 4I97A 4LL1B 3U6VA 3KZQA 3FY7A 5H5RA 4HUAA 5H5QA 1IYHA 2H73A 1XVQA 3VURA 3ZVJD 3TKPA 1U88A 3O3TA 2P0GA 2WCIA 3CBUA 1YKCA 1PD21 2I81A 1I9DA 1EV9A 4FYBA 5CAXA 4O5QA 1K3OA 3LJRA 2LQOA 2HNLA 1EWXA 4ZILA 4LMVA 3S9FA 4IP1A 4XRAA 1AQVA 4KE3A 1M7TA 1NHOA 1QQ2A 1Y6EA 2C3NA 3IAS2 2KOKA 3NIVA 3V1WA 4WKWA 4KGIA 2CVBA 1XW5A 1B48A 1XOAA 4KX4A 4TR3A 3FHKA 5G1LA 1FOVA 1QUWA 3IRAA 4PX1A 3GH6A 5JWQB 4TN8A 5ECNB 4OO5A 4MJBA 3QFBC 2RUFA 13GSA 1TRWA 1Q98A 1K0OA 3KTBA 3IK7A 5BMUA 2QA2A 1SL2B 2I9HA 4MJCA 4RUVA 1YKAA 2H19A 4ULXA 2K8SA 3HDCA 2VUPA 1M0UA 1M2DA 4AKGA 5IMCA 5JCUA 2VL3A 2V1MA 3F63A 3W6GA 2VM2A 4JU5A 3DVWA 2AV4A 3LSZA 2DJ0A 1T1VA 5G2ZA 1SYRA 5KOWA 3UOMA 5DQSA 1YJ6A 1EGRA 5ECOB 2DLXA 3WGEA 3WT1A 4GSTA 3RPNA 2LJRA 3H8QA 4TXVA 2C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQ7 A;  1ERT A;  1JZO A;  1V9W A;  3UAR A;  2L6C A;  5F0G A;  2V41 A;  1EOG A;  4HJ2 A;  3Q6O A;  5D9T A;  2FGX A;  5DJL A;  2L4Q A;  4KH7 A;  3HJP A;  1EP8 A;  1XOB A;  1GTA A;  4ML6 A;  1V98 A;  1NSW A;  3UEM A;  2HYX A;  2BJX A;  4EL1 A;  2B5X A;  3N9J A;  2FHE A;  2ZCT A;  2GTU A;  3G7J A;  3GN3 A;  1UVZ A;  2IWT A;  4OFM A;  4IS0 A;  4MK3 A;  3APQ A;  2AB6 A;  4KA0 A;  5FWG A;  2TIR A;  3PH9 A;  2HSN B;  3RHB A;  5IO0 A;  1SKR B;  2WFC A;  2OA7 A;  2XBQ A;  3RBT A;  2BTO T;  1URM A;  1K0C A;  3HVS A;  2YCD A;  3W8S A;  1GTU A;  5GSS A;  1YF0 A;  2KP2 A;  3GX0 A;  3DML A;  2IL3 A;  1SK0 A;  1ZMA A;  2QSI A;  2DMM A;  5DAL B;  2M72 A;  3GIX A;  5DAK B;  3IV4 A;  4AJ7 A;  1ACV A;  3U5R E;  2H76 A;  1WE0 A;  2VD0 A;  3GKN A;  9GSS A;  2UZ8 A;  4OWY A;  5D73 A;  1GNW A;  3GYK A;  3FK8 A;  1SJI A;  2CZ3 A;  1VRS D;  2QKE A;  4ID0 A;  3EYT A;  1M2B A;  1Z5Y E;  4MZC A;  4NHW A;  1U87 A;  2R6K A;  5J9C A;  2CVK A;  4PXO A;  3GL3 A;  4ZBB A;  4WR5 A;  2PPT A;  4PNG A;  6GSV A;  3FW2 A;  4N10 A;  3BJ5 A;  2I4A A;  2NBS A;  4KSO A;  1A8Y A;  2O89 A;  2N5F A;  7GSS A;  5HR1 A;  2N5B A;  1GH2 A;  4K9Z A;  3GMF A;  4DSR A;  2JAD A;  2JSY A;  1A2M A;  1YQ1 A;  4GTU A;  2K9F A;  2IIY A;  3TKQ A;  2LRT A;  1ST9 A;  4IQ1 A;  5JWR B;  4IBP A;  1G0T A;  3EUR A;  1XIY A;  4E8H A;  4HEA 2;  1HNC A;  2F51 A;  4WXT A;  4KB3 A;  1PA3 A;  3EE2 A;  3VLN A;  2C3Q A;  2HSH A;  2LJK A;  1Y25 A;  2QGV A;  2H72 A;  3GTU B;  2FWF A;  3RDW A;  1HNA A;  2FWH A;  4IJ3 A;  2PER A;  3GKK A;  3RPP A;  5CRG A;  5CNW A;  1GRX A;  4AJ6 A;  1V40 A;  5J5N A;  1XPV A;  2F3M A;  3Q74 A;  2VCQ A;  3TGZ A;  1BAY A;  3D4T A;  1TTZ A;  4KSM A;  4JED A;  2VM1 A;  3C1R A;  3RHC A;  5DAL A;  4ZL8 A;  2DML A;  4JBB A;  5DAK A;  3GST A;  3WT2 A;  2VD1 A;  4GSN A;  3ISO A;  4XS4 B;  2L6D A;  4OCF A;  3ZIT A;  3ZFL A;  2VL2 A;  3EWL A;  1G6Y A;  3MNG A;  1WP0 A;  3DEX A;  2E2M A;  2VLT A;  3LGC A;  2VCZ A;  1SEN A;  2VLU A;  5F07 A;  5C04 A;  1TU7 A;  2HRK B;  2GSR A;  4EUY A;  3L0H A;  1USB A;  2PWJ A;  5ABR A;  3IOS A;  1MDJ A;  4EDZ A;  4ECI A;  1FB6 A;  2GQL A;  2CAI A;  3H1N A;  1VGL A;  2C1Y A;  2IMI A;  8GSS A;  2CZ2 A;  1EEJ A;  1WWJ A;  1PKW A;  2H1B A;  3QCP A;  3DXB A;  4NV5 A;  2YN1 A;  4GRF A;  1HNB A;  2HFD A;  4K0N A;  4X0X A;  4XRD A;  1AUC A;  1B4Q A;  4XIH A;  4E8E A;  3Q19 A;  1FO5 A;  3GKM A;  2OAC A;  2HSM B;  3KXO A;  3E3E A;  2PBJ A;  4HU9 A;  1X9M B;  2MYG A;  1XW9 A;  2KLX A;  3EMX A;  2WDU A;  3GKX A;  5HFI A;  1OAZ A;  4KCA A;  2OE0 A;  3HCZ A;  1EEM A;  3VFI A;  3GTU A;  1GSF A;  2MMO A;  5A4W A;  1TDI A;  4HDE A;  4MJE A;  3ERW A;  5D96 A;  4OFN A;  4JRR A;  4V1A p;  4PUR A;  1SJ6 A;  4V2N A;  3G7I A;  3KH7 A;  1JLW A;  3WGD A;  1GSU A;  3LYK A;  1T00 A;  2LTK A;  2B5E A;  2GLR A;  2GZP A;  22GS A;  1PL2 A;  5J4U A;  1Z9H A;  1T3B A;  4IKH A;  6GSU A;  2H75 A;  1KBN A;  4XS4 A;  4BWQ A;  4EC0 A;  5IOX A;  1M2A A;  2K8V A;  3IPZ A;  2P5Q A;  1DBY A;  4LMW A;  2OAD A;  3CTG A;  3UAP A;  2HRK A;  3D6I A;  2HI7 A;  2L4C A;  3KEB A;  1ZCP A;  1TK8 B;  3L9U A;  1THO A;  2R37 A;  1AAZ A;  1T7P B;  1HD2 A;  2D2Z A;  2X64 A;  1QFN A;  2FA4 A;  2M80 A;  4WBR D;  1JFU A;  2FY6 A;  2V6O A;  4IJI A;  1XWG A;  2YZU A;  5COH A;  5D9V A;  2MZC A;  1X9W B;  1N8J A;  3IXR A;  3LXZ A;  3PR8 A;  1B8X A;  5HR0 A;  4K6X A;  1K0D A;  4ZB6 A;  3CSJ A;  2HLS A;  3EMP A;  2GST A;  3HKR A;  3ME7 A;  3ZFB A;  2GZZ A;  3IDV A;  2X8G A;  1TRU A;  2HRN A;  3H4K A;  2AAW A;  1B9X C;  3F6F A;  2YWI A;  1GP1 A;  2HSM A;  2IJY A;  5LNK e;  1XCC A;  4X1U A;  5IPH A;  4WET A;  3I43 A;  4O32 A;  5GAN D;  5KN3 A;  4ML1 A;  5CP1 A;  2GT5 A;  3HXS A;  5IIZ A;  1GSQ A;  2JAC A;  2C80 A;  4FYC A;  4J57 E;  2VOC A;  1A0R P;  1TRS A;  1SK1 A;  1U3A A;  4O7H A;  3UMA A;  3KP9 A;  2ON7 A;  1EGO A;  4P3Y B;  3VWW A;  4V2M A;  3FZ9 A;  4WR4 A;  3HHV A;  2B7J A;  3VWU A;  1J08 A;  1SU9 A;  3KMN A;  2GZY A;  5HR2 A;  1EV4 A;  2AYT A;  3TOU A;  4LLR A;  1Q4J A;  5J9B A;  17GS A;  3TJG A;  4OD7 A;  1Z7R A;  3MWH A;  2ZNM A;  3FR6 A;  2H1A A;  4I6X A;  5DCG A;  4J56 E;  2L59 A;  4EO3 A;  2NPB A;  4Q5Q A;  2LRC A;  1GL8 A;  1XFL A;  2B5Y A;  3UJ1 A;  3NOF A;  3HJM A;  1TJD A;  1MTC A;  5A5K A;  3GUR A;  1UA5 A;  4HS1 A;  4CW9 A;  4ZL9 A;  5HQP A;  5J41 A;  3PGT A;  2A4V A;  3VK9 A;  1BED A;  2PVO C;  2B1K A;  3KH9 A;  2C0E A;  3I69 A;  5HR3 A;  2GT6 A;  3LG6 A;  1YF1 A;  2VLV A;  5AIV A;  2LKU A;  3P90 A;  3DIE A;  4V1A g;  1R7H A;  4HZ2 A;  2IN3 A;  2O7K A;  4EKZ A;  2H01 A;  1KEB A;  1O7U A;  5KN0 A;  4KF9 A;  2YJH A;  2LEG A;  2EIQ A;  4POM A;  3LYP A;  4KAE A;  4K1F A;  3US3 A;  1ZOF A;  3ZMK A;  3WGX A;  1R5P A;  3N5O A;  5AN1 A;  3CRU A;  5B8B A;  2DJ2 A;  1FW1 A;  3A3T A;  2PN8 A;  1GSS A;  1ILO A;  4RI6 A;  2J23 A;  5IMF A;  3W8J A;  5DJM A;  4GLT A;  1T4Z A;  2TRX A;  1OC8 A;  1NW2 A;  1V57 A;  4MF6 A;  2YWO A;  1S3C A;  1HQO A;  4KUN A;  4MH2 A;  3EU4 A;  3EVI A;  1S3A A;  1TK0 B;  2VL9 A;  2X8H A;  3LEF A;  4EE0 A;  3VPT A;  1GSE A;  4TOP A;  1SL0 B;  2F8F A;  11GS A;  5DBQ A;  2WB9 A;  3KMO A;  2C8U A;  3ZML A;  14GS A;  1QGV A;  4IVF A;  4K7O A;  2CVD A;  3KCM A;  3ZRD A;  1ZL9 A;  3MAK A;  3BD2 A;  1F2E A;  2YV9 A;  3D0Z A;  4AJ8 A;  5HFK A;  3DVX A;  1U6T A;  3F4T A;  2ES7 A;  4CHS A;  1AW9 A;  1MDK A;  5DCH A;  5HFG A;  3UBL A;  1TP9 A;  1X5C A;  2XBI A;  1ERW A;  3NZN A;  4YAV A;  5AIX A;  1SYX A;  1WJK A;  2GSS A;  2HQT A;  20GS A;  1F9M A;  2DJ1 A;  1OE7 A;  1AIU A;  19GS A;  1G6W A;  4YQV A;  4TW5 A;  4MMM A;  2H1G A;  4FO5 A;  5CYY A;  4NAX A;  4AF2 A;  1A8L A;  3F4S A;  5JCG A;  4WBJ A;  3ZVJ A;  3F3R A;  1Z7P A;  3KIJ A;  1OYJ A;  3IR4 A;  4MPG A;  2G0F A;  4K7I A;  5EL8 A;  2H74 A;  3UBK A;  2AJQ B;  2X8C A;  1XWC A;  4MP4 A;  5IMD A;  2H8L A;  1XWK A;  1T4Y A;  3TKS C;  3QAV A;  1SK2 A;  6GSS A;  1M9A A;  3QAG A;  2EC4 A;  2CQ9 A;  5GAP D;  1MEK A;  3ZL5 A;  3ZIV A;  1RW1 A;  4F82 A;  2L57 A;  4DEJ A;  1SKS B;  4IW9 A;  1K0A A;  4GCI A;  1ABA A;  2H66 A;  2PMT A;  3HZ4 A;  3O76 A;  5ECI B;  2DIZ A;  2O85 A;  2PUK C;  4MA9 A;  4OCE A;  5DQY A;  2CT6 A;  5ECK B;  5IOW A;  2REM A;  1VF4 A;  3G9B A;  3FEU A;  2R5G A;  4IP6 A;  2LQQ A;  2CX3 A;  1IYI A;  2L5L A;  5J3R A;  2V32 A;  2GQM A;  3FKF A;  3F4R A;  5GST A;  3I6A A;  4BA7 A;  3JCM L;  4IQA A;  4F0B A;  3LQ7 A;  5ECH B;  4MCU A;  4OMV A;  4N0Z A;  4YH2 A;  3VI7 A;  1QXH A;  2FNO A;  2H1D A;  2J9H A;  4KND A;  1M99 A;  4K2D A;  2NVL A;  2LST A;  2YZH A;  3UVT A;  3GFK A;  2V6K A;  3GX8 A;  4N11 A;  4IGJ A;  2KHP A;  3R3E A;  2CA8 A;  2DSA A;  3CSI A;  3VPQ A;  4KDU A;  4I2U A;  4MZB A;  3GV1 A;  2KUC A;  2P31 A;  4K7N A;  5B6N A;  2HRF A;  1FVJ A;  3TJB A;  3IK9 A;  5LD0 A;  4ECJ A;  1VF1 A;  3VI5 A;  4XHM A;  4EF0 A;  1PGT A;  2B6M A;  3TKS E;  1QK8 A;  5A4U A;  1X5D A;  4GWR A;  4TVE A;  6GSW A;  4ISD A;  2RUE A;  4LL4 B;  4TRX A;  2B3S A;  1GUL A;  1E2Y A;  2JZR A;  4PGT A;  1ERU A;  4MDC A;  4KDX A;  4WEY A;  2I3Y A;  3J7Y k;  3HYP A;  2QC7 A;  1ERV A;  4O92 A;  1ZZY A;  1O8W A;  2C0D A;  2C4J A;  2GQK A;  3FYG A;  10GS A;  3C8E A;  2OBI A;  3R2Q A;  3SBC A;  2JL4 A;  4L0W A;  3M1G A;  2LNS A;  2NDO A;  3ZIJ A;  3ZYW A;  2MBT A;  4ZIJ A;  3C71 A;  4G19 A;  3DRN A;  4ZBA A;  5GZZ B;  1M9B A;  4ZXG A;  1Z6M A;  3H79 A;  3TDG A;  16GS A;  4KDY A;  1GTI A;  2OKA A;  2G2Q A;  3E9J B;  1B9Y C;  4PNF A;  3FR9 A;  2GS3 A;  5F8B A;  2OE1 A;  4AGS A;  1TI1 A;  2C3T A;  3IAM 2;  3EIN A;  3M9J A;  4KW6 A;  4Z7X A;  3ERF A;  4J2F A;  1ZGN A;  2JZS A;  1HYU A;  5LCZ A;  2LS5 A;  1GLQ A;  2WGR A;  2TRC P;  3LOR A;  4G10 A;  1ON4 A;  2WUL A;  1GTB A;  3H93 A;  3HVV A;  3IC8 A;  6GST A;  4XS6 A;  5FHI A;  5FT3 A;  1WMJ A;  1MDI A;  3EC3 A;  4GQC A;  1SD8 A;  4HZ4 A;  5DDL A;  2F8A A;  4HQZ A;  1ZYQ B;  2K18 A;  1JZW A;  2H71 A;  3D21 A;  2DJ3 A;  1Z6N A;  1NM3 A;  4WF4 A;  1PQN A;  2VCX A;  2VCT A;  3RAZ A;  5L71 A;  1KTE A;  1JHB A;  3L9S A;  4EVM A;  1R26 A;  1LU4 A;  1BX9 A;  6GSY A;  2V2G A;  4ZL7 A;  1XW6 A;  1F6M C;  1O6J A;  4QL7 A;  4FIW A;  2B7K A;  1WPI A;  3D22 A;  2IFQ A;  4TR0 A;  4MF7 A;  4NMU A;  3QPM A;  3PIN A;  3GHA A;  1XWB A;  1N2A A;  3TJK A;  2EIO A;  1TOF A;  3HJO A;  5IMV A;  3VWV A;  1A2L A;  4GF0 A;  4NWY A;  2ON5 A;  4JR4 A;  3C1S A;  2IPA A;  1QMV A;  3EU3 A;  1OKD A;  1CQG A;  1R5A A;  3PPU A;  3CMI A;  5ENU A;  1F3A A;  3A2X A;  4PQI A;  1S3D A;  6GSX A;  1TKD B;  2DBC A;  2LJA A;  1AXD A;  1UN2 A;  5D8I A;  3TJJ A;  2H6X A;  3TJF A;  2K6V A;  5CRH A;  4ILF A;  4FQU A;  1H75 A;  3A2W A;  5E59 A;  4JE1 A;  2GVP A;  2KP1 A;  3KM6 A;  4BVX B;  3P8W A;  1EP7 A;  2YWM A;  1BYE A;  1T8E B;  2YPM A;  1GUK A;  4TR1 B;  1OVN A;  5EPF A;  5ECS A;  3E0U A;  3KP8 A;  5KN1 A;  2I1U A;  2IMD A;  1AQX A;  18GS A;  4ECB A;  4FH8 A;  3O6T A;  5JWO B;  2LNT A;  3ERG A;  5F05 A;  1SL1 B;  2HZE B;  3GNJ A;  3IE3 A;  3QAW A;  3M8N A;  1W89 A;  2FA8 A;  5E4W A;  3A5W A;  3IA1 A;  1AQW A;  4Q5R A;  1OKT A;  2LUS A;  2FLS A;  1B4P A;  4XCS A;  3HVX A;  3LXT A;  1C72 A;  2OBK A;  5IMA A;  4PUF C;  1ML6 A;  3I9V 2;  5D9W A;  1OC3 A;  2MMZ A;  3GH9 A;  4G0K A;  2RM6 A;  3D4M A;  3APO A;  1XBS A;  2VL2 C;  3FZ5 A;  1YZX A;  2WJU A;  3CRT A;  2XHF A;  4K0G A;  3HY2 A;  3FR3 A;  2E0Q A;  5G1K A;  5ELA A;  4IN0 A;  1GUM A;  1GLP A;  5ECQ B;  4HQS A;  3QMX A;  3FZA A;  2L5O A;  2H0H A;  1A23 A;  3HZ8 A;  1K3Y A;  3A2V A;  4EDY A;  2HXK A;  2JZT A;  4L5O A;  5D93 A;  4PQH A;  2P5R A;  3CTF A;  2H0G A;  2IMF A;  5ID2 B;  2FWG A;  4G0I A;  2H70 A;  4XTS A;  5ECL B;  1G7O A;  4HU7 A;  3L4N A;  4TKY A;  3F8U A;  4BVX A;  1GUH A;  4L8E A;  3TCO A;  4N30 A;  1RQM A;  1PX7 A;  3HA9 A;  3F0I A;  4TR1 A;  2YV7 A;  1SJZ A;  2DJK A;  5B7C A;  1MD4 A;  4I8B A;  3DKS A;  3IBH A;  5IPG A;  4CDO A;  3DWV A;  4O5R A;  2JSZ A;  2WS2 A;  4RQX A;  4LA1 A;  4YAP A;  2DJJ A;  2HZE A;  4POL A;  4MAB A;  3QD9 A;  2FWE A;  4G9H A;  3TKR A;  4BVY B;  4ECC A;  3F6D A;  12GS A;  1JZR A;  2O8V B;  1TXX A;  3KD0 A;  5INY A;  4MH3 A;  1EOH A;  1SKW B;  3GRX A;  4PTS A;  4G2E A;  2YNX A;  4D73 B;  2RM5 A;  1BG5 A;  3DD3 A;  3M0F A;  4HJM A;  4DSS B;  2HZF A;  3MSZ A;  2GSQ A;  1OE8 A;  2DC5 A;  1WRY A;  2YAN A;  3TRP A;  3OR5 A;  2R2J A;  1K0B A;  1MD3 A;  3TUE A;  2YJ7 A;  1LJR A;  1J0F A;  4DSQ A;  1XZO A;  3KTL A;  5CO3 A;  1PMT A;  2H30 A;  3QDN A;  1XWA A;  3P7X A;  1DE1 A;  4NV2 A;  3GL5 A;  3DGQ A;  3SWL A;  1OC9 B;  5KEJ A;  4ZB9 A;  4X43 A;  4JZQ A;  5ID2 A;  1GWC A;  5ECM B;  5IMZ A;  5EVO A;  1A2J A;  4K8M A;  2A2S A;  1X9S B;  1JLV A;  2CAQ A;  3GUS A;  4WF5 A;  4F2I A;  3K8N A;  1WIK A;  2IMK A;  4F9Z A;  3G7Y A;  2H6Y A;  4NXI A;  3QOU A;  2XPD A;  2LV3 A;  2HRA A;  2H6Z A;  1PX6 A;  2DIY A;  2RII A;  3CSH A;  2HE3 A;  2MMA A;  5IO2 A;  4OFT A;  1AC1 A;  1TI3 A;  2VIM A;  5C00 A;  4NHZ A;  4GSS A;  4RQR A;  4DVC A;  3ZRE A;  3L78 A;  1A0F A;  1RK4 A;  3UIW A;  4L0U A;  4MJA A;  4HOJ A;  2C0F A;  3C7M A;  1G7E A;  1CQH A;  5B6M A;  2VCV A;  1YY7 A;  1FG4 A;  4TR4 A;  1XXU A;  4QQ7 A;  4BVY A;  1GNE A;  2YWN A;  2MBS A;  2OE3 A;  3IC4 A;  4L5L A;  2RLI A;  1TW9 A;  2PVQ A;  4PUA A;  3ED3 A;  3C73 A;  3CYN A;  3DYR A;  3LWA A;  4D73 A;  4H86 A;  5A4V A;  2XC2 A;  5D9X A;  2F9S A;  4DSS A;  5CRD A;  1NHY A;  5G5E A;  5G5F A;  2WZ9 A;  1R4W A;  4QL9 A;  1YEP A;  1H4O A;  5CRE A;  5ECR B;  3GSS A;  1JZD A;  5IM9 A;  1WOU A;  4FYU A;  1K0N A;  4EXJ A;  3AY8 A;  3QFA C;  2N5A A;  4YQU A;  2IME A;  3ME8 A;  1O8X A;  5G31 A;  2HT9 A;  5EY6 A;  3TRQ A;  4IEL A;  4GXZ A;  2IFQ B;  3WYW A;  3APS A;  1YDK A;  4G0L A;  1LBK A;  1GSY A;  4ZBD A;  4IHU A;  4USS A;  3L9V A;  2E2G A;  5DVB A;  4F0C A;  1OC9 A;  2M46 A;  4GQF A;  2R4V A;  4HI7 A;  2MMN A;  4YQM A;  1UC7 A;  2JU5 A;  4NPB A;  1DSB A;  2O87 A;  1V58 A;  4ZB8 A;  3MDK A;  4BWS A;  2HSY A;  1PN9 A;  2OJL A;  2FUG 2;  4F03 A;  5IQY A;  5H5S A;  4BL7 B;  2YP6 A;  1DUG A;  4OO4 A;  4V2L A;  4TXO B;  1F37 A;  3GA4 A;  4MPF A;  2CX4 A;  1XVW A;  4MF5 A;  3KJY A;  3P2A A;  4POK A;  2XPE A;  1PSQ A;  5AIS A;  1Z3E A;  1E6B A;  1F3B A;  1KNG A;  2H0I A;  1PRX A;  2BMX A;  4ACS A;  3F3Q A;  3IHQ A;  3J7Y b;  4Q5F A;  2AHE A;  4BPY A;  1V2A A;  5B8A A;  2WRT A;  2LRN A;  1TK5 B;  4MLY A;  5F06 A;  1U3I A;  5ELG A;  2A2R A;  5JCW A;  3BCI A;  1YEX A;  4N0V A;  2YOI A;  4KCE A;  1THX A;  3UL3 A;  2VCW A;  3ZZX A;  3Q18 A;  2VAF A;  1VF2 A;  1PL1 A;  2PGT A;  3D5J A;  4I5Q A;  3FZ4 A;  2GDR A;  2VO4 A;  3BCK A;  2FCH A;  1J9B A;  2ALB A;  2NTO A;  1TRV A;  2Z9S A;  2CV4 A;  1EZK A;  4XS1 A;  3KGK A;  3QR6 A;  3TB2 A;  1SD9 A;  3TRX A;  1O81 A;  1W4V A;  1PKZ A;  3CXG A;  3WD6 A;  5ECP B;  3FRC A;  1A24 A;  3F9U A;  1K0M A;  4POB A;  5CRW A;  2E7P A;  2AUV A;  3TKS A;  1FB0 A;  3UVH A;  1VF3 A;  1BJX A;  2GGT A;  1ZYE A;  1K3L A;  4Q5N A;  2PU9 C;  4JR6 A;  3BOA A;  1O85 A;  5G30 A;  3BBY A;  5KN2 A;  4MZW A;  1X0R A;  1FHE A;  3M3M A;  3ZLP A;  2FD3 A;  1O73 A;  1DE2 A;  2X99 A;  1I5G A;  2EIR A;  4RI7 A;  2B1L A;  3ZTL A;  2R3X A;  5AGY A;  4BL7 A;  1FAA A;  2ZUP A;  1GSD A;  1TU8 A;  3VWX A;  1X5E A;  4TXO A;  4I2T A;  3HD5 A;  4PQ1 A;  3M9K A;  3LFL A;  3TOT A;  1FVK A;  4I97 A;  4LL1 B;  3U6V A;  3KZQ A;  3FY7 A;  5H5R A;  4HUA A;  5H5Q A;  1IYH A;  2H73 A;  1XVQ A;  3VUR A;  3ZVJ D;  3TKP A;  1U88 A;  3O3T A;  2P0G A;  2WCI A;  3CBU A;  1YKC A;  1PD2 1;  2I81 A;  1I9D A;  1EV9 A;  4FYB A;  5CAX A;  1K3O A;  3LJR A;  2LQO A;  2HNL A;  1EWX A;  4ZIL A;  4LMV A;  3S9F A;  4IP1 A;  4XRA A;  1AQV A;  4KE3 A;  1M7T A;  1NHO A;  1QQ2 A;  1Y6E A;  2C3N A;  3IAS 2;  2KOK A;  3NIV A;  3V1W A;  4WKW A;  4KGI A;  2CVB A;  1XW5 A;  1B48 A;  1XOA A;  4KX4 A;  4TR3 A;  3FHK A;  5G1L A;  1FOV A;  1QUW A;  3IRA A;  4PX1 A;  3GH6 A;  5JWQ B;  4TN8 A;  5ECN B;  4OO5 A;  4MJB A;  3QFB C;  2RUF A;  13GS A;  1TRW A;  1Q98 A;  1K0O A;  3KTB A;  3IK7 A;  5BMU A;  1SL2 B;  2I9H A;  4MJC A;  4RUV A;  1YKA A;  2H19 A;  4ULX A;  2K8S A;  3HDC A;  2VUP A;  1M0U A;  1M2D A;  5IMC A;  5JCU A;  2VL3 A;  2V1M A;  3F63 A;  3W6G A;  2VM2 A;  4JU5 A;  3DVW A;  2AV4 A;  3LSZ A;  2DJ0 A;  1T1V A;  5G2Z A;  1SYR A;  3UOM A;  5DQS A;  1YJ6 A;  1EGR A;  5ECO B;  2DLX A;  3WGE A;  3WT1 A;  4GST A;  3RPN A;  2LJR A;  3H8Q A;  4TXV A;  2C0G A; 
#chains in the Genus database with same CATH topology
 1BQ7 A;  1ERT A;  1JZO A;  1V9W A;  3UAR A;  2L6C A;  5F0G A;  2V41 A;  1EOG A;  4HJ2 A;  3Q6O A;  2WW2 A;  5D9T A;  2FGX A;  5DJL A;  2L4Q A;  4KH7 A;  3HJP A;  1EP8 A;  1XOB A;  1GTA A;  4ML6 A;  1V98 A;  1NSW A;  3UEM A;  2UV8 G;  2BJX A;  2HYX A;  4EL1 A;  2B5X A;  1YEW C;  3N9J A;  2FHE A;  2ZCT A;  2GTU A;  3G7J A;  3GN3 A;  1UVZ A;  2IWT A;  4OFM A;  4IS0 A;  3EPT A;  4MK3 A;  2EFH A;  3APQ A;  2AB6 A;  4KA0 A;  5FWG A;  2TIR A;  2WVX B;  3PH9 A;  2HSN B;  3RHB A;  5IO0 A;  1SKR B;  2WFC A;  2OA7 A;  2XBQ A;  3RBT A;  2BTO T;  1URM A;  1K0C A;  3HVS A;  2YCD A;  3W8S A;  1GTU A;  5GSS A;  1YF0 A;  2KP2 A;  3GX0 A;  3DML A;  2IL3 A;  1SK0 A;  1ZMA A;  2O5V A;  2QSI A;  2DMM A;  5DAL B;  2M72 A;  3GIX A;  5DAK B;  5A34 B;  3IV4 A;  4AJ7 A;  1ACV A;  3U5R E;  2H76 A;  1WE0 A;  2VD0 A;  3GKN A;  9GSS A;  2UZ8 A;  4OWY A;  1XG8 A;  5D73 A;  1GNW A;  3GYK A;  3FK8 A;  1SJI A;  2CZ3 A;  1VRS D;  2QKE A;  4ID0 A;  3EYT A;  1M2B A;  1Z5Y E;  4MZC A;  4NHW A;  1U87 A;  2R6K A;  5J9C A;  2CVK A;  4PXO A;  1M3I A;  3GL3 A;  4ZBB A;  4WR5 A;  2PPT A;  4PNG A;  6GSV A;  3FW2 A;  4N10 A;  3BJ5 A;  2I4A A;  2NBS A;  4KSO A;  1A8Y A;  2O89 A;  2N5F A;  7GSS A;  5HR1 A;  2N5B A;  1GH2 A;  3LW9 A;  4K9Z A;  3GMF A;  4DSR A;  2JAD A;  2JSY A;  1A2M A;  1YQ1 A;  4GTU A;  2K9F A;  2IIY A;  3TKQ A;  2LRT A;  1ST9 A;  4IQ1 A;  5JWR B;  4IBP A;  1G0T A;  3EUR A;  1XIY A;  4E8H A;  4HEA 2;  1HNC A;  2F51 A;  4WXT A;  4KB3 A;  1PA3 A;  3EE2 A;  3VLN A;  2C3Q A;  2HSH A;  2LJK A;  1Y25 A;  2QGV A;  2H72 A;  3GTU B;  2FWF A;  3RDW A;  1HNA A;  2WVX A;  2FWH A;  4IJ3 A;  2HSN A;  2PER A;  3GKK A;  3RPP A;  4K5R A;  5CRG A;  5CNW A;  1GRX A;  3MIX A;  4AJ6 A;  1V40 A;  5J5N A;  1XPV A;  2F3M A;  3Q74 A;  2VCQ A;  3TGZ A;  1BAY A;  3D4T A;  1TTZ A;  4KSM A;  4JED A;  2EFC A;  2VM1 A;  3C1R A;  3A5I A;  3RHC A;  5DAL A;  4ZL8 A;  2DML A;  4JBB A;  5DAK A;  3GST A;  3WT2 A;  2VD1 A;  5A34 A;  4GSN A;  3ISO A;  4XS4 B;  2L6D A;  4OCF A;  3ZIT A;  3ZFL A;  2VL2 A;  3EWL A;  1G6Y A;  3MNG A;  1TXU A;  1WP0 A;  3DEX A;  2E2M A;  2VLT A;  3LGC A;  2VCZ A;  2R0P A;  1SEN A;  2VLU A;  5F07 A;  5C04 A;  1TU7 A;  2HRK B;  2GSR A;  4EUY A;  3L0H A;  1USB A;  2PWJ A;  5ABR A;  3IOS A;  1MDJ A;  4EDZ A;  4ECI A;  1FB6 A;  2GQL A;  2CAI A;  3H1N A;  1VGL A;  2C1Y A;  2IMI A;  8GSS A;  2CZ2 A;  1EEJ A;  1WWJ A;  1PKW A;  2H1B A;  3QCP A;  3DXB A;  4NV5 A;  2YN1 A;  4GRF A;  2WVZ A;  1HNB A;  2HFD A;  4K0N A;  4X0X A;  4XRD A;  1AUC A;  1B4Q A;  4XIH A;  4E8E A;  3Q19 A;  1FO5 A;  3GKM A;  2OAC A;  2HSM B;  3KXO A;  3E3E A;  2PBJ A;  4HU9 A;  1X9M B;  2MYG A;  1XW9 A;  2KLX A;  3EMX A;  2WDU A;  3GKX A;  5HFI A;  4EIQ A;  1OAZ A;  4KCA A;  5J4V A;  2OE0 A;  3HCZ A;  1EEM A;  3VFI A;  3GTU A;  1GSF A;  2MMO A;  5A4W A;  1TDI A;  4Z2R A;  4HDE A;  4MJE A;  3ERW A;  5D96 A;  4OFN A;  4JRR A;  4V1A p;  4PUR A;  1SJ6 A;  5BRT A;  4V2N A;  3G7I A;  3KH7 A;  1JLW A;  3WGD A;  1GSU A;  3LYK A;  1T00 A;  2LTK A;  2B5E A;  2GLR A;  2GZP A;  22GS A;  1PL2 A;  5J4U A;  1Z9H A;  1T3B A;  4IKH A;  6GSU A;  2H75 A;  1KBN A;  4XS4 A;  4BWQ A;  4EC0 A;  5IOX A;  1M2A A;  2K8V A;  3IPZ A;  2P5Q A;  1DBY A;  4LMW A;  2OAD A;  3CTG A;  3UAP A;  2HRK A;  3D6I A;  1PN0 A;  2HI7 A;  2L4C A;  3KEB A;  1ZCP A;  1TK8 B;  3L9U A;  2QA1 A;  1THO A;  2R37 A;  1AAZ A;  1T7P B;  1HD2 A;  2D2Z A;  2X64 A;  1QFN A;  2FA4 A;  2M80 A;  4WBR D;  1JFU A;  2FY6 A;  2V6O A;  4IJI A;  1XWG A;  2YZU A;  5COH A;  5D9V A;  2MZC A;  1X9W B;  3HMJ G;  1N8J A;  3IXR A;  3LXZ A;  3PR8 A;  1B8X A;  5HR0 A;  4K6X A;  1K0D A;  4ZB6 A;  3CSJ A;  2HLS A;  3EMP A;  2GST A;  3HKR A;  3ME7 A;  3ZFB A;  2GZZ A;  3IDV A;  2X8G A;  1TRU A;  2HRN A;  3H4K A;  2AAW A;  1B9X C;  3F6F A;  2YWI A;  1GP1 A;  2HSM A;  2IJY A;  5LNK e;  1XCC A;  4X1U A;  5IPH A;  1Y1U A;  4WET A;  3I43 A;  4O32 A;  5GAN D;  5KN3 A;  4ML1 A;  5CP1 A;  3IHG A;  2GT5 A;  3HXS A;  5IIZ A;  1GSQ A;  2JAC A;  2C80 A;  4FYC A;  2VOC A;  4J57 E;  1A0R P;  1TRS A;  1SK1 A;  1U3A A;  4O7H A;  3UMA A;  3KP9 A;  2ON7 A;  1EGO A;  4P3Y B;  3VWW A;  4V2M A;  3FZ9 A;  4WR4 A;  2DKI A;  3HHV A;  2B7J A;  3VWU A;  1J08 A;  1SU9 A;  3KMN A;  2GZY A;  3FMW A;  5HR2 A;  1EV4 A;  2AYT A;  3TOU A;  4LLR A;  1Q4J A;  5J9B A;  17GS A;  3TJG A;  5A1N B;  4OD7 A;  1Z7R A;  4QMK A;  3MWH A;  2ZNM A;  3FR6 A;  2H1A A;  4I6X A;  5DCG A;  4J56 E;  2L59 A;  4EO3 A;  1BF5 A;  2NPB A;  4Q5Q A;  2LRC A;  1GL8 A;  1XFL A;  1SVL A;  2B5Y A;  3UJ1 A;  3NOF A;  3HJM A;  1TJD A;  1MTC A;  5A5K A;  3GUR A;  1UA5 A;  4HS1 A;  4CW9 A;  4ZL9 A;  5HQP A;  5J41 A;  3PGT A;  2A4V A;  3VK9 A;  2WZS A;  1BED A;  2PVO C;  2B1K A;  3KH9 A;  2C0E A;  3I69 A;  5HR3 A;  2GT6 A;  3LG6 A;  1YF1 A;  4ICY A;  2VLV A;  5AIV A;  3HVN A;  2LKU A;  3P90 A;  3DIE A;  4V1A g;  1R7H A;  4HZ2 A;  2IN3 A;  2O7K A;  4EKZ A;  2H01 A;  1KEB A;  1I1I P;  1O7U A;  5KN0 A;  4KF9 A;  5J4Y A;  2YJH A;  2LEG A;  2EIQ A;  4POM A;  3LYP A;  4KAE A;  4K1F A;  3US3 A;  1ZOF A;  3ZMK A;  3WGX A;  1R5P A;  3N5O A;  5AN1 A;  3CRU A;  5B8B A;  2DJ2 A;  1FW1 A;  3A3T A;  2PN8 A;  1GSS A;  1ILO A;  4RI6 A;  2J23 A;  5IMF A;  3W8J A;  5DJM A;  4GLT A;  1T4Z A;  2TRX A;  1OC8 A;  1NW2 A;  2EFE A;  1V57 A;  4MF6 A;  2YWO A;  1S3C A;  1HQO A;  4KUN A;  4MH2 A;  3EU4 A;  3EVI A;  1S3A A;  1TK0 B;  2VL9 A;  2X8H A;  3LEF A;  4EE0 A;  3VPT A;  1GSE A;  2X49 A;  4TOP A;  1SL0 B;  5A1N A;  2F8F A;  11GS A;  5DBQ A;  2WB9 A;  4AKI A;  3KMO A;  2C8U A;  5J40 A;  3ZML A;  14GS A;  1QGV A;  4IVF A;  4K7O A;  2CVD A;  3KCM A;  3ZRD A;  1ZL9 A;  3MAK A;  3BD2 A;  1F2E A;  2YV9 A;  3D0Z A;  4CY6 A;  4AJ8 A;  5HFK A;  3DVX A;  1U6T A;  3F4T A;  2ES7 A;  4CHS A;  1AW9 A;  1MDK A;  5DCH A;  5HFG A;  3UBL A;  1TP9 A;  1X5C A;  2XBI A;  1ERW A;  3NZN A;  4YAV A;  5AIX A;  1SYX A;  1WJK A;  2GSS A;  2HQT A;  20GS A;  1F9M A;  2VKZ G;  2DJ1 A;  1OE7 A;  1AIU A;  19GS A;  1G6W A;  4YQV A;  4TW5 A;  4MMM A;  2H1G A;  4FO5 A;  5CYY A;  4NAX A;  4AF2 A;  1A8L A;  2WW0 A;  3F4S A;  5JCG A;  4WBJ A;  3ZVJ A;  3F3R A;  1Z7P A;  4AKX B;  4O5U A;  3KIJ A;  1OYJ A;  3IR4 A;  4MPG A;  2G0F A;  4K7I A;  5EL8 A;  2H74 A;  3UBK A;  2AJQ B;  2X8C A;  1XWC A;  4K5S A;  1N25 A;  4MP4 A;  5IMD A;  2H8L A;  1XWK A;  1T4Y A;  3TKS C;  2WW1 A;  3QAV A;  1SK2 A;  6GSS A;  1M9A A;  3QAG A;  2EC4 A;  1S3R A;  2CQ9 A;  5GAP D;  1MEK A;  3ZL5 A;  3ZIV A;  1RW1 A;  4F82 A;  2L57 A;  4DEJ A;  1SKS B;  4PI0 C;  4IW9 A;  1K0A A;  4GCI A;  1ABA A;  2H66 A;  2PMT A;  3CHX C;  3HZ4 A;  3O76 A;  5ECI B;  1PFO A;  2DIZ A;  2O85 A;  2PUK C;  4MA9 A;  4OCE A;  5DQY A;  2CT6 A;  5ECK B;  5IOW A;  2REM A;  1VF4 A;  3G9B A;  3FEU A;  2R5G A;  4IP6 A;  2LQQ A;  1SVM A;  2CX3 A;  1IYI A;  2L5L A;  5J3R A;  2V32 A;  2GQM A;  3FKF A;  3F4R A;  5GST A;  3I6A A;  4BA7 A;  3JCM L;  4IQA A;  4F0B A;  3LQ7 A;  5ECH B;  4MCU A;  4OMV A;  4N0Z A;  4YH2 A;  3VI7 A;  1QXH A;  2FNO A;  2H1D A;  3MYD A;  2J9H A;  4KND A;  1M99 A;  4K2D A;  2NVL A;  1BG1 A;  2LST A;  2YZH A;  3UVT A;  3GFK A;  2V6K A;  3GX8 A;  4N11 A;  4IGJ A;  2KHP A;  3R3E A;  2CA8 A;  3CSI A;  2DSA A;  3VPQ A;  4KDU A;  4I2U A;  4MZB A;  3GV1 A;  2KUC A;  2P31 A;  4MNN A;  4K7N A;  5B6N A;  2HRF A;  4CY8 A;  1FVJ A;  3TJB A;  3IK9 A;  5LD0 A;  4ECJ A;  1VF1 A;  3VI5 A;  4XHM A;  4EF0 A;  1PGT A;  2B6M A;  3TKS E;  1QK8 A;  5A4U A;  1X5D A;  4GWR A;  4K2X A;  4TVE A;  6GSW A;  4ISD A;  2RUE A;  4LL4 B;  3TU3 B;  2WVY A;  2B3S A;  4TRX A;  1GUL A;  1E2Y A;  2JZR A;  4PGT A;  1ERU A;  4MDC A;  4KDX A;  4WEY A;  2I3Y A;  3J7Y k;  3HYP A;  2QC7 A;  1ERV A;  4O92 A;  1ZZY A;  2OT3 A;  1O8W A;  2C0D A;  2C4J A;  2GQK A;  3FYG A;  10GS A;  3C8E A;  2OBI A;  3R2Q A;  3SBC A;  2JL4 A;  4L0W A;  3M1G A;  2LNS A;  2NDO A;  3ZIJ A;  3ZYW A;  2MBT A;  4ZIJ A;  3C71 A;  4G19 A;  3DRN A;  4ZBA A;  5GZZ B;  1M9B A;  4ZXG A;  1Z6M A;  3H79 A;  3TDG A;  16GS A;  4KDY A;  1GTI A;  2OKA A;  2G2Q A;  3E9J B;  1B9Y C;  4PNF A;  5A5H B;  3FR9 A;  2GS3 A;  5F8B A;  2OE1 A;  4AGS A;  1TI1 A;  2C3T A;  3IAM 2;  4AKH A;  3EIN A;  3M9J A;  4KW6 A;  4Z7X A;  3ERF A;  4J2F A;  1ZGN A;  2JZS A;  1HYU A;  1FOH A;  5LCZ A;  2LS5 A;  1GLQ A;  2WGR A;  2TRC P;  3LOR A;  4AI6 A;  4G10 A;  1ON4 A;  2WUL A;  1GTB A;  3H93 A;  1ZYP A;  3HVV A;  3IC8 A;  6GST A;  4XS6 A;  5FHI A;  5FT3 A;  1WMJ A;  4YKG A;  5KOX A;  1MDI A;  3EC3 A;  4GQC A;  1SD8 A;  4G01 A;  4HZ4 A;  5DDL A;  2F8A A;  4HQZ A;  1ZYQ B;  2K18 A;  1JZW A;  2H71 A;  3D21 A;  4Z2T A;  2DJ3 A;  1Z6N A;  1NM3 A;  4WF4 A;  1PQN A;  2VCX A;  2VCT A;  3RAZ A;  5L71 A;  1KTE A;  1JHB A;  3L9S A;  4EVM A;  1R26 A;  1LU4 A;  1BX9 A;  6GSY A;  2V2G A;  4ZL7 A;  1XW6 A;  1F6M C;  1O6J A;  4QL7 A;  4FIW A;  2B7K A;  4FXY P;  1WPI A;  3D22 A;  2IFQ A;  4TR0 A;  3CWG A;  4MF7 A;  4NMU A;  3QPM A;  3PIN A;  3GHA A;  1XWB A;  1N2A A;  3TJK A;  2EIO A;  1TOF A;  3HJO A;  5IMV A;  3VWV A;  1A2L A;  4YKF A;  4GF0 A;  4NWY A;  2ON5 A;  4JR4 A;  3C1S A;  2IPA A;  2H1L A;  1QMV A;  3EU3 A;  1OKD A;  1CQG A;  1R5A A;  3PPU A;  3CMI A;  5ENU A;  1F3A A;  3A2X A;  4PQI A;  1S3D A;  6GSX A;  1TKD B;  2DBC A;  2LJA A;  1AXD A;  1UN2 A;  5D8I A;  3TJJ A;  2H6X A;  3TJF A;  5A5H A;  2K6V A;  5CRH A;  4ILF A;  4FQU A;  1H75 A;  3A2W A;  5E59 A;  4JE1 A;  2GVP A;  2KP1 A;  3KM6 A;  2R0G A;  4BVX B;  3P8W A;  1EP7 A;  2YWM A;  1BYE A;  1T8E B;  2YPM A;  1GUK A;  4TR1 B;  1OVN A;  5EPF A;  5ECS A;  3E0U A;  3KP8 A;  5KN1 A;  2I1U A;  2IMD A;  1AQX A;  18GS A;  4ECB A;  4FH8 A;  3O6T A;  4E68 A;  5JWO B;  2LNT A;  3ERG A;  5F05 A;  1SL1 B;  4EIP A;  2HZE B;  3GNJ A;  3IE3 A;  3QAW A;  3M8N A;  1W89 A;  2FA8 A;  5E4W A;  3A5W A;  3IA1 A;  1AQW A;  4Q5R A;  1OKT A;  2LUS A;  2FLS A;  1B4P A;  4XCS A;  3HVX A;  1S4B P;  3LXT A;  1C72 A;  2OBK A;  5IMA A;  4PUF C;  1ML6 A;  3I9V 2;  5D9W A;  1OC3 A;  2MMZ A;  3GH9 A;  4G0K A;  2RM6 A;  3D4M A;  3APO A;  1XBS A;  2VL2 C;  4X4J A;  3FZ5 A;  1YZX A;  4BIK A;  2WJU A;  3CRT A;  2XHF A;  4K0G A;  3HY2 A;  3FR3 A;  2E0Q A;  5G1K A;  5ELA A;  4IN0 A;  1GUM A;  1GLP A;  5ECQ B;  4HQS A;  3QMX A;  3FZA A;  2L5O A;  2H0H A;  1A23 A;  3HZ8 A;  1K3Y A;  3A2V A;  4EDY A;  2HXK A;  2JZT A;  4L5O A;  5D93 A;  4PQH A;  2P5R A;  3CTF A;  2H0G A;  2IMF A;  5ID2 B;  2FWG A;  4G0I A;  2O36 A;  2H70 A;  4XTS A;  5ECL B;  1G7O A;  4HU7 A;  3L4N A;  4TKY A;  3F8U A;  4W66 A;  4BVX A;  1GUH A;  4L8E A;  3TCO A;  4N30 A;  1RQM A;  1PX7 A;  3HA9 A;  3F0I A;  4TR1 A;  2YV7 A;  1SJZ A;  2DJK A;  5B7C A;  1MD4 A;  4I8B A;  3DKS A;  3IBH A;  5IPG A;  4CDO A;  2DKH A;  3DWV A;  4O5R A;  2JSZ A;  2WS2 A;  4RQX A;  4LA1 A;  4YAP A;  2DJJ A;  2HZE A;  4POL A;  4MAB A;  3QD9 A;  2FWE A;  4G9H A;  3TKR A;  4BVY B;  4ECC A;  3F6D A;  12GS A;  1JZR A;  2O8V B;  1TXX A;  3KD0 A;  5INY A;  4MH3 A;  1EOH A;  1SKW B;  3GRX A;  4PTS A;  4G2E A;  2YNX A;  4D73 B;  2RM5 A;  1BG5 A;  3DD3 A;  3M0F A;  4HJM A;  4DSS B;  2HZF A;  3MSZ A;  2GSQ A;  1OE8 A;  2DC5 A;  1WRY A;  2YAN A;  3TRP A;  3OR5 A;  2R2J A;  1K0B A;  1MD3 A;  3TUE A;  2YJ7 A;  1LJR A;  1J0F A;  4DSQ A;  1XZO A;  3KTL A;  5CO3 A;  1PMT A;  2H30 A;  3QDN A;  1XWA A;  4A5P A;  3P7X A;  1DE1 A;  4NV2 A;  3GL5 A;  3DGQ A;  3SWL A;  1OC9 B;  5KEJ A;  4ZB9 A;  4X43 A;  4JZQ A;  5ID2 A;  1GWC A;  5ECM B;  5IMZ A;  5EVO A;  1A2J A;  4K8M A;  2A2S A;  1X9S B;  1JLV A;  2CAQ A;  3GUS A;  4WF5 A;  4F2I A;  2EFD A;  3K8N A;  1WIK A;  2IMK A;  4F9Z A;  3G7Y A;  2H6Y A;  4NXI A;  3QOU A;  1YVL A;  2XPD A;  2LV3 A;  2HRA A;  2H6Z A;  1PX6 A;  2DIY A;  2RII A;  3CSH A;  2HE3 A;  2MMA A;  5IO2 A;  4OFT A;  1AC1 A;  1TI3 A;  1M3J A;  2VIM A;  5C00 A;  4NHZ A;  4GSS A;  4RQR A;  4DVC A;  3ZRE A;  3L78 A;  1A0F A;  1RK4 A;  3UIW A;  4L0U A;  4MJA A;  4HOJ A;  2C0F A;  3C7M A;  1G7E A;  1CQH A;  5B6M A;  2VCV A;  1YY7 A;  1FG4 A;  4Z2U A;  4TR4 A;  1XXU A;  4QQ7 A;  4BVY A;  1GNE A;  2YWN A;  2MBS A;  2OE3 A;  3IC4 A;  4L5L A;  2RLI A;  1TW9 A;  2PVQ A;  4PUA A;  3ED3 A;  3C73 A;  3CYN A;  3DYR A;  3LWA A;  4D73 A;  4H86 A;  5A4V A;  2XC2 A;  5D9X A;  2WW3 A;  2F9S A;  4DSS A;  5CRD A;  1NHY A;  5G5E A;  5G5F A;  2WZ9 A;  1R4W A;  4QL9 A;  1YEP A;  1H4O A;  5CRE A;  5ECR B;  3GSS A;  1JZD A;  5IM9 A;  1WOU A;  4FYU A;  1K0N A;  4EXJ A;  3AY8 A;  3QFA C;  2N5A A;  4YQU A;  2IME A;  3ME8 A;  1O8X A;  5G31 A;  2HT9 A;  5EY6 A;  3TRQ A;  4IEL A;  4GXZ A;  2IFQ B;  3WYW A;  3APS A;  1YDK A;  4G0L A;  1LBK A;  1GSY A;  1SVO A;  4ZBD A;  4IHU A;  4USS A;  3L9V A;  2E2G A;  5DVB A;  4F0C A;  1OC9 A;  2M46 A;  2A2P A;  4GQF A;  2R4V A;  4HI7 A;  2MMN A;  4YQM A;  1UC7 A;  2JU5 A;  4NPB A;  1DSB A;  2O87 A;  1V58 A;  4ZB8 A;  3MDK A;  4BWS A;  2HSY A;  1PN9 A;  2A4H A;  2OJL A;  2FUG 2;  4F03 A;  5IQY A;  5H5S A;  4BL7 B;  2YP6 A;  1DUG A;  4OO4 A;  4V2L A;  4TXO B;  1F37 A;  3GA4 A;  4MPF A;  4N3Z A;  3CQF A;  2CX4 A;  1XVW A;  4MF5 A;  3KJY A;  3P2A A;  4POK A;  2XPE A;  1PSQ A;  5AIS A;  1Z3E A;  1E6B A;  1F3B A;  1KNG A;  2R0C A;  2H0I A;  1PRX A;  2BMX A;  4ACS A;  3F3Q A;  3IHQ A;  3J7Y b;  4Q5F A;  2AHE A;  4BPY A;  1V2A A;  2O3E A;  5B8A A;  2WRT A;  2LRN A;  1TK5 B;  4MLY A;  5F06 A;  1U3I A;  5ELG A;  2A2R A;  5JCW A;  3BCI A;  5J47 A;  1YEX A;  4N0V A;  2YOI A;  4KCE A;  1THX A;  3UL3 A;  2VCW A;  3ZZX A;  3Q18 A;  2VAF A;  4ZB7 A;  1VF2 A;  1PL1 A;  2PGT A;  3D5J A;  4I5Q A;  3FZ4 A;  2GDR A;  2VO4 A;  3BCK A;  2FCH A;  1J9B A;  2ALB A;  2NTO A;  1TRV A;  2Z9S A;  2CV4 A;  1EZK A;  4XS1 A;  3KGK A;  3QR6 A;  3TB2 A;  1SD9 A;  3TRX A;  2X4A A;  1O81 A;  1W4V A;  1PKZ A;  3CXG A;  3WD6 A;  5BMU B;  5ECP B;  3FRC A;  1A24 A;  3F9U A;  1K0M A;  4POB A;  5CRW A;  2E7P A;  2AUV A;  3TKS A;  1FB0 A;  3UVH A;  1VF3 A;  1BJX A;  2GGT A;  1ZYE A;  1K3L A;  4Q5N A;  2PU9 C;  4PHZ C;  4GDF A;  4JR6 A;  3BOA A;  1O85 A;  5G30 A;  3BBY A;  5KN2 A;  4MZW A;  1X0R A;  1FHE A;  3M3M A;  3ZLP A;  2FD3 A;  1O73 A;  1DE2 A;  2X99 A;  1I5G A;  2EIR A;  4RI7 A;  2B1L A;  3ZTL A;  2R3X A;  1ZYN A;  5AGY A;  4BL7 A;  1FAA A;  2ZUP A;  1GSD A;  1TU8 A;  3VWX A;  1X5E A;  4TXO A;  4I2T A;  3HD5 A;  4PQ1 A;  3M9K A;  3LFL A;  3TOT A;  1FVK A;  4I97 A;  4LL1 B;  3U6V A;  3KZQ A;  3FY7 A;  5H5R A;  4HUA A;  5H5Q A;  1IYH A;  2H73 A;  1XVQ A;  3VUR A;  3ZVJ D;  4HSC X;  3TKP A;  1U88 A;  3O3T A;  2P0G A;  2WCI A;  3CBU A;  1YKC A;  1PD2 1;  2I81 A;  1I9D A;  1EV9 A;  4FYB A;  5CAX A;  4O5Q A;  1K3O A;  3LJR A;  2LQO A;  2HNL A;  1EWX A;  4ZIL A;  4LMV A;  3S9F A;  4IP1 A;  4XRA A;  1AQV A;  4KE3 A;  1M7T A;  1NHO A;  1QQ2 A;  1Y6E A;  2C3N A;  3IAS 2;  2KOK A;  3NIV A;  3V1W A;  4WKW A;  4KGI A;  2CVB A;  1XW5 A;  3RFR C;  1B48 A;  1XOA A;  4KX4 A;  4TR3 A;  3FHK A;  5G1L A;  1FOV A;  1QUW A;  3IRA A;  4PX1 A;  3GH6 A;  5JWQ B;  4TN8 A;  5ECN B;  4OO5 A;  3RGB C;  4MJB A;  3QFB C;  2RUF A;  13GS A;  1TRW A;  1Q98 A;  1K0O A;  3KTB A;  3IK7 A;  5BMU A;  2QA2 A;  1SL2 B;  2I9H A;  4MJC A;  4RUV A;  1YKA A;  2H19 A;  4ULX A;  2K8S A;  4PI2 C;  3HDC A;  2VUP A;  1M0U A;  1M2D A;  4AKG A;  5IMC A;  5JCU A;  2VL3 A;  2V1M A;  3F63 A;  3W6G A;  2VM2 A;  4JU5 A;  3DVW A;  2AV4 A;  3LSZ A;  2DJ0 A;  1T1V A;  5G2Z A;  1SYR A;  5KOW A;  3UOM A;  5DQS A;  1YJ6 A;  1EGR A;  5ECO B;  2DLX A;  3WGE A;  3WT1 A;  4GST A;  3RPN A;  2LJR A;  3H8Q A;  4TXV A;  2C0G A; 
#chains in the Genus database with same CATH homology
 1BQ7 A;  1ERT A;  1JZO A;  1V9W A;  3UAR A;  2L6C A;  5F0G A;  2V41 A;  1EOG A;  4HJ2 A;  3Q6O A;  5D9T A;  2FGX A;  5DJL A;  2L4Q A;  4KH7 A;  3HJP A;  1EP8 A;  1XOB A;  1GTA A;  4ML6 A;  1V98 A;  1NSW A;  3UEM A;  2UV8 G;  2BJX A;  2HYX A;  4EL1 A;  2B5X A;  3N9J A;  2FHE A;  2ZCT A;  2GTU A;  3G7J A;  3GN3 A;  1UVZ A;  2IWT A;  4OFM A;  4IS0 A;  3EPT A;  4MK3 A;  2EFH A;  3APQ A;  2AB6 A;  4KA0 A;  5FWG A;  2TIR A;  3PH9 A;  2HSN B;  3RHB A;  5IO0 A;  1SKR B;  2WFC A;  2OA7 A;  2XBQ A;  3RBT A;  2BTO T;  1URM A;  1K0C A;  3HVS A;  2YCD A;  3W8S A;  1GTU A;  5GSS A;  1YF0 A;  2KP2 A;  3GX0 A;  3DML A;  2IL3 A;  1SK0 A;  1ZMA A;  2O5V A;  2QSI A;  2DMM A;  5DAL B;  2M72 A;  3GIX A;  5DAK B;  5A34 B;  3IV4 A;  4AJ7 A;  1ACV A;  3U5R E;  2H76 A;  1WE0 A;  2VD0 A;  3GKN A;  9GSS A;  2UZ8 A;  4OWY A;  5D73 A;  1GNW A;  3GYK A;  3FK8 A;  1SJI A;  2CZ3 A;  1VRS D;  2QKE A;  4ID0 A;  3EYT A;  1M2B A;  1Z5Y E;  4MZC A;  4NHW A;  1U87 A;  2R6K A;  5J9C A;  2CVK A;  4PXO A;  3GL3 A;  4ZBB A;  4WR5 A;  2PPT A;  4PNG A;  6GSV A;  3FW2 A;  4N10 A;  3BJ5 A;  2I4A A;  2NBS A;  4KSO A;  1A8Y A;  2O89 A;  2N5F A;  7GSS A;  5HR1 A;  2N5B A;  1GH2 A;  3LW9 A;  4K9Z A;  3GMF A;  4DSR A;  2JAD A;  2JSY A;  1A2M A;  1YQ1 A;  4GTU A;  2K9F A;  2IIY A;  3TKQ A;  2LRT A;  1ST9 A;  4IQ1 A;  5JWR B;  4IBP A;  1G0T A;  3EUR A;  1XIY A;  4E8H A;  4HEA 2;  1HNC A;  2F51 A;  4WXT A;  4KB3 A;  1PA3 A;  3EE2 A;  3VLN A;  2C3Q A;  2HSH A;  2LJK A;  1Y25 A;  2QGV A;  2H72 A;  3GTU B;  2FWF A;  3RDW A;  1HNA A;  2FWH A;  4IJ3 A;  2HSN A;  2PER A;  3GKK A;  3RPP A;  4K5R A;  5CRG A;  5CNW A;  1GRX A;  3MIX A;  4AJ6 A;  1V40 A;  5J5N A;  1XPV A;  2F3M A;  3Q74 A;  2VCQ A;  3TGZ A;  1BAY A;  3D4T A;  1TTZ A;  4KSM A;  4JED A;  2EFC A;  2VM1 A;  3C1R A;  3A5I A;  3RHC A;  5DAL A;  4ZL8 A;  2DML A;  4JBB A;  5DAK A;  3GST A;  3WT2 A;  2VD1 A;  5A34 A;  4GSN A;  3ISO A;  4XS4 B;  2L6D A;  4OCF A;  3ZIT A;  3ZFL A;  2VL2 A;  3EWL A;  1G6Y A;  3MNG A;  1TXU A;  1WP0 A;  3DEX A;  2E2M A;  2VLT A;  3LGC A;  2VCZ A;  2R0P A;  1SEN A;  2VLU A;  5F07 A;  5C04 A;  1TU7 A;  2HRK B;  2GSR A;  4EUY A;  3L0H A;  1USB A;  2PWJ A;  5ABR A;  3IOS A;  1MDJ A;  4EDZ A;  4ECI A;  1FB6 A;  2GQL A;  2CAI A;  3H1N A;  1VGL A;  2C1Y A;  2IMI A;  8GSS A;  2CZ2 A;  1EEJ A;  1WWJ A;  1PKW A;  2H1B A;  3QCP A;  3DXB A;  4NV5 A;  2YN1 A;  4GRF A;  1HNB A;  2HFD A;  4K0N A;  4X0X A;  4XRD A;  1AUC A;  1B4Q A;  4XIH A;  4E8E A;  3Q19 A;  1FO5 A;  3GKM A;  2OAC A;  2HSM B;  3KXO A;  3E3E A;  2PBJ A;  4HU9 A;  1X9M B;  2MYG A;  1XW9 A;  2KLX A;  3EMX A;  2WDU A;  3GKX A;  5HFI A;  4EIQ A;  1OAZ A;  4KCA A;  5J4V A;  2OE0 A;  3HCZ A;  1EEM A;  3VFI A;  3GTU A;  1GSF A;  2MMO A;  5A4W A;  1TDI A;  4Z2R A;  4HDE A;  4MJE A;  3ERW A;  5D96 A;  4OFN A;  4JRR A;  4V1A p;  4PUR A;  1SJ6 A;  5BRT A;  4V2N A;  3G7I A;  3KH7 A;  1JLW A;  3WGD A;  1GSU A;  3LYK A;  1T00 A;  2LTK A;  2B5E A;  2GLR A;  2GZP A;  22GS A;  1PL2 A;  5J4U A;  1Z9H A;  1T3B A;  4IKH A;  6GSU A;  2H75 A;  1KBN A;  4XS4 A;  4BWQ A;  4EC0 A;  5IOX A;  1M2A A;  2K8V A;  3IPZ A;  2P5Q A;  1DBY A;  4LMW A;  2OAD A;  3CTG A;  3UAP A;  2HRK A;  3D6I A;  1PN0 A;  2HI7 A;  2L4C A;  3KEB A;  1ZCP A;  1TK8 B;  3L9U A;  2QA1 A;  1THO A;  2R37 A;  1AAZ A;  1T7P B;  1HD2 A;  2D2Z A;  2X64 A;  1QFN A;  2FA4 A;  2M80 A;  4WBR D;  1JFU A;  2FY6 A;  2V6O A;  4IJI A;  1XWG A;  2YZU A;  5COH A;  5D9V A;  2MZC A;  1X9W B;  3HMJ G;  1N8J A;  3IXR A;  3LXZ A;  3PR8 A;  1B8X A;  5HR0 A;  4K6X A;  1K0D A;  4ZB6 A;  3CSJ A;  2HLS A;  3EMP A;  2GST A;  3HKR A;  3ME7 A;  3ZFB A;  2GZZ A;  3IDV A;  2X8G A;  1TRU A;  2HRN A;  3H4K A;  2AAW A;  1B9X C;  3F6F A;  2YWI A;  1GP1 A;  2HSM A;  2IJY A;  5LNK e;  1XCC A;  4X1U A;  5IPH A;  1Y1U A;  4WET A;  3I43 A;  4O32 A;  5GAN D;  5KN3 A;  4ML1 A;  5CP1 A;  3IHG A;  2GT5 A;  3HXS A;  5IIZ A;  1GSQ A;  2JAC A;  2C80 A;  4FYC A;  2VOC A;  4J57 E;  1A0R P;  1TRS A;  1SK1 A;  1U3A A;  4O7H A;  3UMA A;  3KP9 A;  2ON7 A;  1EGO A;  4P3Y B;  3VWW A;  4V2M A;  3FZ9 A;  4WR4 A;  2DKI A;  3HHV A;  2B7J A;  3VWU A;  1J08 A;  1SU9 A;  3KMN A;  2GZY A;  3FMW A;  5HR2 A;  1EV4 A;  2AYT A;  3TOU A;  4LLR A;  1Q4J A;  5J9B A;  17GS A;  3TJG A;  5A1N B;  4OD7 A;  1Z7R A;  4QMK A;  3MWH A;  2ZNM A;  3FR6 A;  2H1A A;  4I6X A;  5DCG A;  4J56 E;  2L59 A;  4EO3 A;  1BF5 A;  2NPB A;  4Q5Q A;  2LRC A;  1GL8 A;  1XFL A;  1SVL A;  2B5Y A;  3UJ1 A;  3NOF A;  3HJM A;  1TJD A;  1MTC A;  5A5K A;  3GUR A;  1UA5 A;  4HS1 A;  4CW9 A;  4ZL9 A;  5HQP A;  5J41 A;  3PGT A;  2A4V A;  3VK9 A;  1BED A;  2PVO C;  2B1K A;  3KH9 A;  2C0E A;  3I69 A;  5HR3 A;  2GT6 A;  3LG6 A;  1YF1 A;  4ICY A;  2VLV A;  5AIV A;  2LKU A;  3P90 A;  3DIE A;  4V1A g;  1R7H A;  4HZ2 A;  2IN3 A;  2O7K A;  4EKZ A;  2H01 A;  1KEB A;  1O7U A;  5KN0 A;  4KF9 A;  5J4Y A;  2YJH A;  2LEG A;  2EIQ A;  4POM A;  3LYP A;  4KAE A;  4K1F A;  3US3 A;  1ZOF A;  3ZMK A;  3WGX A;  1R5P A;  3N5O A;  5AN1 A;  3CRU A;  5B8B A;  2DJ2 A;  1FW1 A;  3A3T A;  2PN8 A;  1GSS A;  1ILO A;  4RI6 A;  2J23 A;  5IMF A;  3W8J A;  5DJM A;  4GLT A;  1T4Z A;  2TRX A;  1OC8 A;  1NW2 A;  2EFE A;  1V57 A;  4MF6 A;  2YWO A;  1S3C A;  1HQO A;  4KUN A;  4MH2 A;  3EU4 A;  3EVI A;  1S3A A;  1TK0 B;  2VL9 A;  2X8H A;  3LEF A;  4EE0 A;  3VPT A;  1GSE A;  2X49 A;  4TOP A;  1SL0 B;  5A1N A;  2F8F A;  11GS A;  5DBQ A;  2WB9 A;  4AKI A;  3KMO A;  2C8U A;  5J40 A;  3ZML A;  14GS A;  1QGV A;  4IVF A;  4K7O A;  2CVD A;  3KCM A;  3ZRD A;  1ZL9 A;  3MAK A;  3BD2 A;  1F2E A;  2YV9 A;  3D0Z A;  4CY6 A;  4AJ8 A;  5HFK A;  3DVX A;  1U6T A;  3F4T A;  2ES7 A;  4CHS A;  1AW9 A;  1MDK A;  5DCH A;  5HFG A;  3UBL A;  1TP9 A;  1X5C A;  2XBI A;  1ERW A;  3NZN A;  4YAV A;  5AIX A;  1SYX A;  1WJK A;  2GSS A;  2HQT A;  20GS A;  1F9M A;  2VKZ G;  2DJ1 A;  1OE7 A;  1AIU A;  19GS A;  1G6W A;  4YQV A;  4TW5 A;  4MMM A;  2H1G A;  4FO5 A;  5CYY A;  4NAX A;  4AF2 A;  1A8L A;  3F4S A;  5JCG A;  4WBJ A;  3ZVJ A;  3F3R A;  1Z7P A;  4AKX B;  4O5U A;  3KIJ A;  1OYJ A;  3IR4 A;  4MPG A;  2G0F A;  4K7I A;  5EL8 A;  2H74 A;  3UBK A;  2AJQ B;  2X8C A;  1XWC A;  4K5S A;  1N25 A;  4MP4 A;  5IMD A;  2H8L A;  1XWK A;  1T4Y A;  3TKS C;  3QAV A;  1SK2 A;  6GSS A;  1M9A A;  3QAG A;  2EC4 A;  2CQ9 A;  5GAP D;  1MEK A;  3ZL5 A;  3ZIV A;  1RW1 A;  4F82 A;  2L57 A;  4DEJ A;  1SKS B;  4IW9 A;  1K0A A;  4GCI A;  1ABA A;  2H66 A;  2PMT A;  3HZ4 A;  3O76 A;  5ECI B;  2DIZ A;  2O85 A;  2PUK C;  4MA9 A;  4OCE A;  5DQY A;  2CT6 A;  5ECK B;  5IOW A;  2REM A;  1VF4 A;  3G9B A;  3FEU A;  2R5G A;  4IP6 A;  2LQQ A;  1SVM A;  2CX3 A;  1IYI A;  2L5L A;  5J3R A;  2V32 A;  2GQM A;  3FKF A;  3F4R A;  5GST A;  3I6A A;  4BA7 A;  3JCM L;  4IQA A;  4F0B A;  3LQ7 A;  5ECH B;  4MCU A;  4OMV A;  4N0Z A;  4YH2 A;  3VI7 A;  1QXH A;  2FNO A;  2H1D A;  3MYD A;  2J9H A;  4KND A;  1M99 A;  4K2D A;  2NVL A;  1BG1 A;  2LST A;  2YZH A;  3UVT A;  3GFK A;  2V6K A;  3GX8 A;  4N11 A;  4IGJ A;  2KHP A;  3R3E A;  2CA8 A;  3CSI A;  2DSA A;  3VPQ A;  4KDU A;  4I2U A;  4MZB A;  3GV1 A;  2KUC A;  2P31 A;  4MNN A;  4K7N A;  5B6N A;  2HRF A;  4CY8 A;  1FVJ A;  3TJB A;  3IK9 A;  5LD0 A;  4ECJ A;  1VF1 A;  3VI5 A;  4XHM A;  4EF0 A;  1PGT A;  2B6M A;  3TKS E;  1QK8 A;  5A4U A;  1X5D A;  4GWR A;  4K2X A;  4TVE A;  6GSW A;  4ISD A;  2RUE A;  4LL4 B;  3TU3 B;  2B3S A;  4TRX A;  1GUL A;  1E2Y A;  2JZR A;  4PGT A;  1ERU A;  4MDC A;  4KDX A;  4WEY A;  2I3Y A;  3J7Y k;  3HYP A;  2QC7 A;  1ERV A;  4O92 A;  1ZZY A;  2OT3 A;  1O8W A;  2C0D A;  2C4J A;  2GQK A;  3FYG A;  10GS A;  3C8E A;  2OBI A;  3R2Q A;  3SBC A;  2JL4 A;  4L0W A;  3M1G A;  2LNS A;  2NDO A;  3ZIJ A;  3ZYW A;  2MBT A;  4ZIJ A;  3C71 A;  4G19 A;  3DRN A;  4ZBA A;  5GZZ B;  1M9B A;  4ZXG A;  1Z6M A;  3H79 A;  3TDG A;  16GS A;  4KDY A;  1GTI A;  2OKA A;  2G2Q A;  3E9J B;  1B9Y C;  4PNF A;  5A5H B;  3FR9 A;  2GS3 A;  5F8B A;  2OE1 A;  4AGS A;  1TI1 A;  2C3T A;  3IAM 2;  4AKH A;  3EIN A;  3M9J A;  4KW6 A;  4Z7X A;  3ERF A;  4J2F A;  1ZGN A;  2JZS A;  1HYU A;  1FOH A;  5LCZ A;  2LS5 A;  1GLQ A;  2WGR A;  2TRC P;  3LOR A;  4AI6 A;  4G10 A;  1ON4 A;  2WUL A;  1GTB A;  3H93 A;  1ZYP A;  3HVV A;  3IC8 A;  6GST A;  4XS6 A;  5FHI A;  5FT3 A;  1WMJ A;  4YKG A;  5KOX A;  1MDI A;  3EC3 A;  4GQC A;  1SD8 A;  4G01 A;  4HZ4 A;  5DDL A;  2F8A A;  4HQZ A;  1ZYQ B;  2K18 A;  1JZW A;  2H71 A;  3D21 A;  4Z2T A;  2DJ3 A;  1Z6N A;  1NM3 A;  4WF4 A;  1PQN A;  2VCX A;  2VCT A;  3RAZ A;  5L71 A;  1KTE A;  1JHB A;  3L9S A;  4EVM A;  1R26 A;  1LU4 A;  1BX9 A;  6GSY A;  2V2G A;  4ZL7 A;  1XW6 A;  1F6M C;  1O6J A;  4QL7 A;  4FIW A;  2B7K A;  1WPI A;  3D22 A;  2IFQ A;  4TR0 A;  3CWG A;  4MF7 A;  4NMU A;  3QPM A;  3PIN A;  3GHA A;  1XWB A;  1N2A A;  3TJK A;  2EIO A;  1TOF A;  3HJO A;  5IMV A;  3VWV A;  1A2L A;  4YKF A;  4GF0 A;  4NWY A;  2ON5 A;  4JR4 A;  3C1S A;  2IPA A;  2H1L A;  1QMV A;  3EU3 A;  1OKD A;  1CQG A;  1R5A A;  3PPU A;  3CMI A;  5ENU A;  1F3A A;  3A2X A;  4PQI A;  1S3D A;  6GSX A;  1TKD B;  2DBC A;  2LJA A;  1AXD A;  1UN2 A;  5D8I A;  3TJJ A;  2H6X A;  3TJF A;  5A5H A;  2K6V A;  5CRH A;  4ILF A;  4FQU A;  1H75 A;  3A2W A;  5E59 A;  4JE1 A;  2GVP A;  2KP1 A;  3KM6 A;  2R0G A;  4BVX B;  3P8W A;  1EP7 A;  2YWM A;  1BYE A;  1T8E B;  2YPM A;  1GUK A;  4TR1 B;  1OVN A;  5EPF A;  5ECS A;  3E0U A;  3KP8 A;  5KN1 A;  2I1U A;  2IMD A;  1AQX A;  18GS A;  4ECB A;  4FH8 A;  3O6T A;  4E68 A;  5JWO B;  2LNT A;  3ERG A;  5F05 A;  1SL1 B;  4EIP A;  2HZE B;  3GNJ A;  3IE3 A;  3QAW A;  3M8N A;  1W89 A;  2FA8 A;  5E4W A;  3A5W A;  3IA1 A;  1AQW A;  4Q5R A;  1OKT A;  2LUS A;  2FLS A;  1B4P A;  4XCS A;  3HVX A;  3LXT A;  1C72 A;  2OBK A;  5IMA A;  4PUF C;  1ML6 A;  3I9V 2;  5D9W A;  1OC3 A;  2MMZ A;  3GH9 A;  4G0K A;  2RM6 A;  3D4M A;  3APO A;  1XBS A;  2VL2 C;  4X4J A;  3FZ5 A;  1YZX A;  2WJU A;  3CRT A;  2XHF A;  4K0G A;  3HY2 A;  3FR3 A;  2E0Q A;  5G1K A;  5ELA A;  4IN0 A;  1GUM A;  1GLP A;  5ECQ B;  4HQS A;  3QMX A;  3FZA A;  2L5O A;  2H0H A;  1A23 A;  3HZ8 A;  1K3Y A;  3A2V A;  4EDY A;  2HXK A;  2JZT A;  4L5O A;  5D93 A;  4PQH A;  2P5R A;  3CTF A;  2H0G A;  2IMF A;  5ID2 B;  2FWG A;  4G0I A;  2H70 A;  4XTS A;  5ECL B;  1G7O A;  4HU7 A;  3L4N A;  4TKY A;  3F8U A;  4W66 A;  4BVX A;  1GUH A;  4L8E A;  3TCO A;  4N30 A;  1RQM A;  1PX7 A;  3HA9 A;  3F0I A;  4TR1 A;  2YV7 A;  1SJZ A;  2DJK A;  5B7C A;  1MD4 A;  4I8B A;  3DKS A;  3IBH A;  5IPG A;  4CDO A;  2DKH A;  3DWV A;  4O5R A;  2JSZ A;  2WS2 A;  4RQX A;  4LA1 A;  4YAP A;  2DJJ A;  2HZE A;  4POL A;  4MAB A;  3QD9 A;  2FWE A;  4G9H A;  3TKR A;  4BVY B;  4ECC A;  3F6D A;  12GS A;  1JZR A;  2O8V B;  1TXX A;  3KD0 A;  5INY A;  4MH3 A;  1EOH A;  1SKW B;  3GRX A;  4PTS A;  4G2E A;  2YNX A;  4D73 B;  2RM5 A;  1BG5 A;  3DD3 A;  3M0F A;  4HJM A;  4DSS B;  2HZF A;  3MSZ A;  2GSQ A;  1OE8 A;  2DC5 A;  1WRY A;  2YAN A;  3TRP A;  3OR5 A;  2R2J A;  1K0B A;  1MD3 A;  3TUE A;  2YJ7 A;  1LJR A;  1J0F A;  4DSQ A;  1XZO A;  3KTL A;  5CO3 A;  1PMT A;  2H30 A;  3QDN A;  1XWA A;  4A5P A;  3P7X A;  1DE1 A;  4NV2 A;  3GL5 A;  3DGQ A;  3SWL A;  1OC9 B;  5KEJ A;  4ZB9 A;  4X43 A;  4JZQ A;  5ID2 A;  1GWC A;  5ECM B;  5IMZ A;  5EVO A;  1A2J A;  4K8M A;  2A2S A;  1X9S B;  1JLV A;  2CAQ A;  3GUS A;  4WF5 A;  4F2I A;  2EFD A;  3K8N A;  1WIK A;  2IMK A;  4F9Z A;  3G7Y A;  2H6Y A;  4NXI A;  3QOU A;  1YVL A;  2XPD A;  2LV3 A;  2HRA A;  2H6Z A;  1PX6 A;  2DIY A;  2RII A;  3CSH A;  2HE3 A;  2MMA A;  5IO2 A;  4OFT A;  1AC1 A;  1TI3 A;  2VIM A;  5C00 A;  4NHZ A;  4GSS A;  4RQR A;  4DVC A;  3ZRE A;  3L78 A;  1A0F A;  1RK4 A;  3UIW A;  4L0U A;  4MJA A;  4HOJ A;  2C0F A;  3C7M A;  1G7E A;  1CQH A;  5B6M A;  2VCV A;  1YY7 A;  1FG4 A;  4Z2U A;  4TR4 A;  1XXU A;  4QQ7 A;  4BVY A;  1GNE A;  2YWN A;  2MBS A;  2OE3 A;  3IC4 A;  4L5L A;  2RLI A;  1TW9 A;  2PVQ A;  4PUA A;  3ED3 A;  3C73 A;  3CYN A;  3DYR A;  3LWA A;  4D73 A;  4H86 A;  5A4V A;  2XC2 A;  5D9X A;  2F9S A;  4DSS A;  5CRD A;  1NHY A;  5G5E A;  5G5F A;  2WZ9 A;  1R4W A;  4QL9 A;  1YEP A;  1H4O A;  5CRE A;  5ECR B;  3GSS A;  1JZD A;  5IM9 A;  1WOU A;  4FYU A;  1K0N A;  4EXJ A;  3AY8 A;  3QFA C;  2N5A A;  4YQU A;  2IME A;  3ME8 A;  1O8X A;  5G31 A;  2HT9 A;  5EY6 A;  3TRQ A;  4IEL A;  4GXZ A;  2IFQ B;  3WYW A;  3APS A;  1YDK A;  4G0L A;  1LBK A;  1GSY A;  1SVO A;  4ZBD A;  4IHU A;  4USS A;  3L9V A;  2E2G A;  5DVB A;  4F0C A;  1OC9 A;  2M46 A;  2A2P A;  4GQF A;  2R4V A;  4HI7 A;  2MMN A;  4YQM A;  1UC7 A;  2JU5 A;  4NPB A;  1DSB A;  2O87 A;  1V58 A;  4ZB8 A;  3MDK A;  4BWS A;  2HSY A;  1PN9 A;  2A4H A;  2OJL A;  2FUG 2;  4F03 A;  5IQY A;  5H5S A;  4BL7 B;  2YP6 A;  1DUG A;  4OO4 A;  4V2L A;  4TXO B;  1F37 A;  3GA4 A;  4MPF A;  4N3Z A;  2CX4 A;  1XVW A;  4MF5 A;  3KJY A;  3P2A A;  4POK A;  2XPE A;  1PSQ A;  5AIS A;  1Z3E A;  1E6B A;  1F3B A;  1KNG A;  2R0C A;  2H0I A;  1PRX A;  2BMX A;  4ACS A;  3F3Q A;  3IHQ A;  3J7Y b;  4Q5F A;  2AHE A;  4BPY A;  1V2A A;  5B8A A;  2WRT A;  2LRN A;  1TK5 B;  4MLY A;  5F06 A;  1U3I A;  5ELG A;  2A2R A;  5JCW A;  3BCI A;  5J47 A;  1YEX A;  4N0V A;  2YOI A;  4KCE A;  1THX A;  3UL3 A;  2VCW A;  3ZZX A;  3Q18 A;  2VAF A;  4ZB7 A;  1VF2 A;  1PL1 A;  2PGT A;  3D5J A;  4I5Q A;  3FZ4 A;  2GDR A;  2VO4 A;  3BCK A;  2FCH A;  1J9B A;  2ALB A;  2NTO A;  1TRV A;  2Z9S A;  2CV4 A;  1EZK A;  4XS1 A;  3KGK A;  3QR6 A;  3TB2 A;  1SD9 A;  3TRX A;  2X4A A;  1O81 A;  1W4V A;  1PKZ A;  3CXG A;  3WD6 A;  5BMU B;  5ECP B;  3FRC A;  1A24 A;  3F9U A;  1K0M A;  4POB A;  5CRW A;  2E7P A;  2AUV A;  3TKS A;  1FB0 A;  3UVH A;  1VF3 A;  1BJX A;  2GGT A;  1ZYE A;  1K3L A;  4Q5N A;  2PU9 C;  4GDF A;  4JR6 A;  3BOA A;  1O85 A;  5G30 A;  3BBY A;  5KN2 A;  4MZW A;  1X0R A;  1FHE A;  3M3M A;  3ZLP A;  2FD3 A;  1O73 A;  1DE2 A;  2X99 A;  1I5G A;  2EIR A;  4RI7 A;  2B1L A;  3ZTL A;  2R3X A;  1ZYN A;  5AGY A;  4BL7 A;  1FAA A;  2ZUP A;  1GSD A;  1TU8 A;  3VWX A;  1X5E A;  4TXO A;  4I2T A;  3HD5 A;  4PQ1 A;  3M9K A;  3LFL A;  3TOT A;  1FVK A;  4I97 A;  4LL1 B;  3U6V A;  3KZQ A;  3FY7 A;  5H5R A;  4HUA A;  5H5Q A;  1IYH A;  2H73 A;  1XVQ A;  3VUR A;  3ZVJ D;  3TKP A;  1U88 A;  3O3T A;  2P0G A;  2WCI A;  3CBU A;  1YKC A;  1PD2 1;  2I81 A;  1I9D A;  1EV9 A;  4FYB A;  5CAX A;  4O5Q A;  1K3O A;  3LJR A;  2LQO A;  2HNL A;  1EWX A;  4ZIL A;  4LMV A;  3S9F A;  4IP1 A;  4XRA A;  1AQV A;  4KE3 A;  1M7T A;  1NHO A;  1QQ2 A;  1Y6E A;  2C3N A;  3IAS 2;  2KOK A;  3NIV A;  3V1W A;  4WKW A;  4KGI A;  2CVB A;  1XW5 A;  1B48 A;  1XOA A;  4KX4 A;  4TR3 A;  3FHK A;  5G1L A;  1FOV A;  1QUW A;  3IRA A;  4PX1 A;  3GH6 A;  5JWQ B;  4TN8 A;  5ECN B;  4OO5 A;  4MJB A;  3QFB C;  2RUF A;  13GS A;  1TRW A;  1Q98 A;  1K0O A;  3KTB A;  3IK7 A;  5BMU A;  2QA2 A;  1SL2 B;  2I9H A;  4MJC A;  4RUV A;  1YKA A;  2H19 A;  4ULX A;  2K8S A;  3HDC A;  2VUP A;  1M0U A;  1M2D A;  4AKG A;  5IMC A;  5JCU A;  2VL3 A;  2V1M A;  3F63 A;  3W6G A;  2VM2 A;  4JU5 A;  3DVW A;  2AV4 A;  3LSZ A;  2DJ0 A;  1T1V A;  5G2Z A;  1SYR A;  5KOW A;  3UOM A;  5DQS A;  1YJ6 A;  1EGR A;  5ECO B;  2DLX A;  3WGE A;  3WT1 A;  4GST A;  3RPN A;  2LJR A;  3H8Q A;  4TXV A;  2C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...