4IQAA

Crystal structure analysis of the e228l mutant of human clic1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
223
Chain Sequence
b'PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDELIELAYEQVAKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Crystal Structure Analysis of the E228L Mutant of Human CLIC1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 70
structure length 223
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4iqaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4iqaA01
4ZXGA 1V57A 4RQRA 3QCPA 4K0GA 1AQWA 1GP1A 3ERWA 3ZIJA 5KEJA 2RIIA 3Q18A 1VRSD 1V58A 1GWCA 2H1DA 1FG4A 1W89A 2C0DA 2LQOA 1KEBA 2L5OA 4MA9A 3TRQA 5CAXA 3FHKA 3QFAC 3TKQA 5ECIB 5EVOA 4RUVA 1XFLA 2GLRA 3VI7A 5J3RA 2R2JA 1ZYQB 1XBSA 5B6MA 4H86A 3UL3A 4MJCA 4KGIA 3D4TA 3GSSA 3KM6A 2CVDA 1H4OA 2IFQA 2BMXA 3ISOA 1JZOA 1YZXA 3KP9A 4EKZA 1YEXA 1HYUA 3TJGA 5DQSA 4G0LA 4MPFA 3BBYA 1AAZA 2HNLA 3G7IA 3J7Yk 2XHFA 4G10A 1B4QA 3TRPA 1K0OA 4IP6A 3IA1A 3L9VA 4FQUA 2GSSA 3GMFA 4NXIA 2OJLA 3KTBA 1JZRA 3IE3A 4FYBA 2VD0A 3IDVA 5J4UA 1TK8B 2GSTA 5KN1A 2PUKC 1HNBA 6GSUA 4IKHA 4YAPA 1EEJA 1PRXA 4XS6A 1OVNA 2K9FA 4BVXA 4MK3A 3KP8A 4WBRD 5ABRA 5HR0A 3FYGA 1FAAA 3TB2A 7GSSA 5IIZA 3TJJA 4ACSA 5EL8A 4AJ8A 3HYPA 2RUFA 1SENA 4K7IA 2B3SA 2MMNA 1G7EA 1Z5YE 4IP1A 2PVOC 4G0IA 1YQ1A 2GS3A 1MDIA 2CX4A 3N9JA 2NBSA 1B8XA 1B9YC 3IOSA 1GLQA 4IHUA 3KH7A 2MBSA 2FA8A 3A2WA 2I81A 6GSYA 3GTUB 1T4YA 3LJRA 4TOPA 1K3LA 4QL9A 6GSXA 1ILOA 3E0UA 5IMAA 4HOJA 3ZMLA 2YZUA 16GSA 3IC8A 2WULA 2L6DA 4OD7A 4KF9A 2AYTA 1I9DA 3EC3A 3PINA 4BVYB 5GSSA 3UIWA 2PERA 2IMIA 5CRGA 3UARA 2YANA 1BQ7A 3C73A 3GH6A 3HDCA 1QGVA 1F3BA 4GTUA 2IMKA 2O89A 4KE3A 2H0IA 4KH7A 1O7UA 3HCZA 2UZ8A 1WPIA 3G9BA 1SK0A 3DVWA 5DBQA 4I8BA 4WEYA 3ZL5A 4K7OA 4TRXA 4QL7A 2FUG2 1U6TA 2I1UA 3H93A 4ML6A 2JADA 1X0RA 3DVXA 3VWXA 4XRAA 2L57A 3UJ1A 4ZBAA 1EV4A 2XPDA 2Z9SA 5IO2A 4PX1A 2VL2C 2FNOA 2VLTA 4GQCA 5HQPA 1AXDA 4F82A 2LSTA 3FK8A 2HYXA 1I5GA 3IK9A 2HXKA 3DWVA 3QAWA 2IMEA 3KGKA 2O7KA 1Z3EA 3H79A 4RQXA 9GSSA 1XWCA 2C0EA 1HNCA 2JSZA 2OADA 1MEKA 5A4VA 2WGRA 3NOFA 3WGDA 2CZ3A 5KN0A 5LCZA 1GTAA 2V32A 3BCKA 5FHIA 1K3YA 3LG6A 1TU7A 2H1GA 3GRXA 3I43A 4ECCA 4YH2A 5J41A 5F06A 1X9SB 1ERUA 2DJJA 4XIHA 2IWTA 3LEFA 1F2EA 5ECLB 3CTFA 1UVZA 5G5FA 2LTKA 2V6KA 4TR1B 5ECQB 5FWGA 3LYPA 3APOA 4NAXA 1PD21 1NSWA 2DJ2A 2MYGA 3ZVJD 2C1YA 1TI1A 3BJ5A 1GTIA 3BOAA 4IBPA 2KOKA 5C04A 4AJ6A 4D73A 1O73A 3TKRA 1BEDA 1OC9B 1SKWB 3ZITA 4MDCA 4IS0A 5KN3A 2HRNA 4TXOA 1VF1A 3P7XA 2C4JA 4O7HA 5AIVA 4KNDA 1GSDA 2YPMA 3TKPA 4TW5A 3M9JA 3GKMA 5ECHB 2CZ2A 4I97A 1ZL9A 5A4UA 3GH9A 5GSTA 1OC3A 5IOXA 4IVFA 2DMLA 5CRWA 1GUKA 2A2SA 1DBYA 4WBJA 2GZZA 3VWUA 1AC1A 2MMZA 2F8AA 1PA3A 3GNJA 4XS4B 4DSSB 3MAKA 19GSA 2ON5A 3IXRA 1TI3A 1XIYA 4KUNA 1GLPA 4V2LA 1H75A 4G9HA 4HZ2A 3GYKA 4E8HA 1S3CA 1T00A 2H1BA 2GTUA 3CSJA 2GGTA 3NZNA 5B8AA 3ZIVA 1HNAA 3GSTA 5D9VA 3EE2A 3MNGA 4DSSA 1K3OA 3US3A 5H5QA 1ST9A 3E3EA 1AW9A 4IN0A 2DJKA 4N10A 2O8VB 3EMXA 2GQLA 1AIUA 1A0FA 5IMZA 2DSAA 3A2VA 1M9AA 2KUCA 4WKWA 4EDYA 2YWNA 5JWQB 2HSNB 4IGJA 1FO5A 4G2EA 5HFGA 4N11A 4IQ1A 4NV2A 4OMVA 4MH2A 4K6XA 3GX0A 1QFNA 5JWRB 2OBKA 2M72A 3GL5A 1NM3A 3EMPA 2M46A 3M0FA 5H5SA 2F51A 5G1KA 3UVTA 14GSA 3LSZA 5ELAA 3I6AA 2IMFA 1TRSA 3QAGA 1GNEA 2F3MA 1ML6A 4JR4A 1DSBA 5BMUA 2VOCA 5AISA 2K8VA 3LQ7A 3HZ8A 1XW5A 3H4KA 3SWLA 2JZSA 1PSQA 2JSYA 2MMOA 2K8SA 2VLVA 3VWVA 3TJBA 1VGLA 3D5JA 5F8BA 2H0GA 3WGXA 3ZLPA 2P0GA 3DRNA 5IMFA 1Q98A 4NHZA 1CQHA 1ZGNA 2LRCA 2XC2A 3EWLA 2CA8A 1YKCA 2HSMA 3RAZA 1WE0A 2REMA 1DE2A 2GT5A 5D9WA 1SL0B 5HFIA 3EURA 2WRTA 4K8MA 2AHEA 13GSA 1MD4A 1ZYEA 4HJ2A 5EPFA 2J9HA 3ME8A 3QR6A 4TVEA 4GXZA 5G31A 1T8EB 2WJUA 4MZWA 5DAKA 2DMMA 4N0ZA 1XW9A 5DCHA 4KAEA 1EZKA 2IIYA 2LKUA 1PMTA 4TKYA 4GCIA 2HZEA 3TRXA 3UAPA 4IJIA 1Z7RA 2IFQB 4WF5A 2NVLA 1OE7A 3GKXA 4TR4A 3HA9A 3IAM2 2YP6A 4AGSA 4L0WA 4K1FA 2X64A 2YOIA 5JWOB 4F0CA 2HRFA 2YWIA 2EIQA 5D9XA 1RW1A 3CSIA 1Z6MA 5ID2A 2HQTA 4V2MA 1R7HA 3GX8A 4OCEA 3F0IA 10GSA 1BJXA 4O92A 3DXBA 1F6MC 4PNGA 4L0UA 4L5OA 3W6GA 3HXSA 2LEGA 2EIOA 1BG5A 2X8CA 4I2TA 3RDWA 1SU9A 4N30A 2FA4A 3N5OA 4F9ZA 2TIRA 5DCGA 1JLVA 1PX7A 1BYEA 5D9TA 4BVXB 4MZCA 4GQFA 3FEUA 3L4NA 2YJ7A 3W8SA 5LNKe 5G30A 4X43A 4YQMA 3F6FA 4K7NA 4XCSA 2VCTA 3UBLA 3GKNA 3ME7A 4MJBA 8GSSA 4JZQA 2H6YA 2JZTA 2NDOA 4JR6A 3IHQA 1MD3A 3F8UA 3RHCA 3BCIA 4DSRA 1G6WA 1OC8A 1M9BA 2B6MA 2O85A 4TR3A 2FLSA 2YJHA 3UVHA 5HR3A 5DJMA 4JE1A 1PL2A 3MWHA 3LORA 1WP0A 1TKDB 1X5DA 2H8LA 4OFMA 2C80A 3V1WA 2DIYA 2CT6A 4OWYA 2FGXA 2YN1A 3TKSE 1G6YA 2VL2A 3ZMKA 4POMA 2CV4A 1ZZYA 2KP2A 4TXVA 2L6CA 2OE1A 2LNTA 2G0FA 4I5QA 2H66A 3F4SA 4HUAA 12GSA 3GN3A 5ECKB 6GSWA 2VAFA 4YQVA 2FD3A 1K0AA 4HU9A 5JCUA 4HQSA 4ECIA 1IYIA 1Z6NA 2M80A 1LBKA 3CXGA 3L9UA 4L8EA 4ZL7A 3UMAA 1NW2A 2AUVA 1CQGA 3QAVA 3IAS2 3M1GA 1YJ6A 4EVMA 3LFLA 1GNWA 3P8WA 4GSNA 2LS5A 2G2QA 3GL3A 3PR8A 1G7OA 2GQKA 4EUYA 22GSA 2WDUA 5IMDA 1EP8A 2H6XA 3KH9A 2BTOT 3F6DA 5DQYA 5J5NA 2F8FA 2P31A 4WR5A 3GKKA 1MDJA 3UEMA 4NWYA 1T7PB 3D4MA 1Y6EA 3DYRA 3ZVJA 2LV3A 2WS2A 2LNSA 5AGYA 1KNGA 1OE8A 5DVBA 1XZOA 1YKAA 4Q5QA 3ERGA 4MCUA 4PURA 3O6TA 1FVJA 2AB6A 1HQOA 3DKSA 2DBCA 1GSEA 2H01A 4FO5A 1M7TA 2YNXA 2VCQA 4HU7A 3HVSA 3C1SA 1K0DA 1W4VA 3FZ4A 3IV4A 1EGOA 3EVIA 3FRCA 4XHMA 2K18A 3TOTA 5G5EA 2CQ9A 1WWJA 3FW2A 1TXXA 3KXOA 3VPQA 3F9UA 4ID0A 2MBTA 2B5XA 3R3EA 4MF5A 4K2DA 4F03A 2LJAA 2E7PA 2E0QA 1AQXA 1E2YA 2QC7A 5F0GA 3ZZXA 1DE1A 2LJKA 1XWKA 2RM6A 4PGTA 2E2GA 3DGQA 2H1AA 5HR1A 3HJOA 1ABAA 5FT3A 5ECOB 4MPGA 4XRDA 5IQYA 4V1Ap 5D96A 5A5KA 1OKTA 3MDKA 4KCAA 3LYKA 4AF2A 4DEJA 1M2DA 4JRRA 4D73B 1K0MA 4PQIA 1XPVA 4GSSA 3VPTA 3LGCA 5ECPB 3TGZA 4TXOB 3IBHA 3CRUA 2VM2A 5LD0A 5CRHA 1SKSB 2L59A 2FCHA 1THXA 5CNWA 1TRUA 1FOVA 3TCOA 5DDLA 4ULXA 3UBKA 5HR2A 2AAWA 5J9CA 2LJRA 4XS1A 3CYNA 2ON7A 6GSTA 2VCZA 1XOAA 1O6JA 1U3AA 2HZFA 4TN8A 3ZTLA 5ECMB 5CRDA 1YY7A 1O8WA 3K8NA 2TRCP 4GLTA 4HZ4A 3PGTA 2OACA 3HVXA 4ZILA 4GF0A 2XBQA 3VWWA 4V2NA 1XXUA 1SK2A 4NHWA 1F3AA 1X5EA 2H19A 1V98A 1RK4A 4MABA 2MMAA 1SD9A 1ZOFA 2LUSA 2VIMA 4CHSA 1URMA 4ISDA 2N5FA 1B4PA 1UN2A 2VL3A 4KSMA 4MJEA 2DJ3A 4TR0A 1IYHA 3FR9A 4LMWA 3P2AA 3ERFA 3NIVA 4OO5A 4KCEA 3G7YA 3FY7A 4F0BA 4ZIJA 2H74A 4X0XA 3TUEA 1T4ZA 3GHAA 1XW6A 1X9MB 1QUWA 2VUPA 4KSOA 4BPYA 2YWOA 3GUSA 2FWHA 1YF0A 3EINA 1OKDA 1SYXA 2H71A 1JLWA 2RLIA 1THOA 2C3QA 4YQUA 3CBUA 1UC7A 3KJYA 2RM5A 4GRFA 4I2UA 4Q5RA 5J9BA 2HSMB 2R5GA 1TRVA 3EU3A 3RHBA 5IPHA 1K0CA 4HI7A 4POKA 2JZRA 2NTOA 3C8EA 4ZB6A 1EEMA 1AUCA 3C7MA 4LMVA 5IM9A 1BX9A 1XWAA 1WIKA 1M2AA 2JL4A 3WT1A 5DAKB 2LRNA 5H5RA 1R5PA 5D8IA 3DEXA 2AV4A 3U5RE 2R6KA 2HZEB 1U88A 4ILFA 1X5CA 5DALA 1WRYA 2H30A 4HS1A 3QMXA 2BJXA 2DIZA 3F3RA 4Q5NA 5D73A 2GZPA 2X99A 3RBTA 4ML1A 3WT2A 3U6VA 4LL4B 5GAPD 1A23A 5ID2B 1QK8A 1A0RP 4ECBA 4EF0A 4EXJA 4KX4A 2C0GA 1EGRA 1NHOA 2VCXA 2B1KA 1TP9A 4BL7A 1SKRB 3FR3A 2LRTA 1E6BA 3TJFA 1SJ6A 2L4CA 3BD2A 2K6VA 3HJPA 1FB6A 4LL1B 2HRAA 2KP1A 3KMOA 1TJDA 4MZBA 2WFCA 4PQHA 4O5RA 3ED3A 2PVQA 2HRKA 4P3YB 1N2AA 3F4RA 1AQVA 2GSRA 3Q74A 2B7KA 1GRXA 2P5RA 3M9KA 2B1LA 1TW9A 3TJKA 1XCCA 3TOUA 2QKEA 5B8BA 5HFKA 2VM1A 2YV7A 3APSA 1VF4A 4KDXA 3GURA 4X1UA 1GTUA 3RPNA 2PGTA 1XWBA 1T1VA 5GAND 2V2GA 3PPUA 4O32A 2PBJA 2H76A 1EP7A 6GSSA 2JU5A 3A5WA 5ELGA 1JZWA 4RI7A 1GTBA 3R2QA 1XWGA 2CVKA 1C72A 3IK7A 4BA7A 2ES7A 3S9FA 4OO4A 4FYUA 2CX3A 2PMTA 1M0UA 2VL9A 1SL1B 1A24A 3F3QA 4IQAA 4USSA 2XBIA 2HSYA 3KZQA 4KDUA 4G19A 4MF7A 4HQZA 2GDRA 3HY2A 1QMVA 2VCVA 2WB9A 1GSYA 4XTSA 1UA5A 4FH8A 3D22A 1Z7PA 4EC0A 2A4VA 2IL3A 2CVBA 3WD6A 1A2MA 2C8UA 3FZ5A 2YV9A 3L78A 4ZB9A 1MTCA 1O8XA 1TK5B 3WYWA 1DUGA 5E4WA 1PKWA 1J0FA 3AY8A 5E59A 5IPGA 1WMJA 3QFBC 3O76A 4EDZA 2V6OA 3JCML 4MMMA 3EYTA 3GIXA 4K9ZA 1K0NA 2OE0A 5D93A 2H73A 4N0VA 1PN9A 2JACA 4EL1A 4K0NA 2WCIA 4MP4A 3ZFBA 3FZ9A 4QQ7A 5IMCA 3OR5A 3HD5A 5AN1A 3Q6OA 4HJMA 2YWMA 1F9MA 4MF6A 3D21A 2OBIA 4PNFA 3KIJA 2EC4A 5ENUA 2B7JA 3LXTA 3HJMA 1EOGA 4J2FA 1JZDA 1SJIA 3CMIA 3IC4A 1TDIA 1PKZA 4GWRA 2PPTA 1TK0B 1O81A 3M8NA 4ZL8A 3WGEA 3UOMA 1V2AA 4IELA 2PWJA 1M2BA 2L4QA 3D6IA 3KTLA 4LA1A 3C71A 2FWGA 4GSTA 2ZNMA 4JBBA 2WZ9A 3GV1A 3EU4A 2V41A 1V9WA 5C00A 2VCWA 3PH9A 1WJKA 3DIEA 1SYRA 4V1Ag 2YZHA 5L71A 1GSFA 3L0HA 3GTUA 4WF4A 1PGTA 1JHBA 1PX6A 2DJ0A 3HHVA 4RI6A 4DSQA 3IR4A 1ACVA 1TTZA 5GZZB 4ZB8A 1TOFA 5IOWA 2V1MA 5AIXA 1QXHA 1R5AA 4AJ7A 1R4WA 4BVYA 1GUHA 2OKAA 4EO3A 1PQNA 1XVWA 4ECJA 4HEA2 3LXZA 1KTEA 4G0KA 2B5EA 2P5QA 5G2ZA 1EV9A 4WR4A 2HT9A 4KB3A 1U87A 2RUEA 2GQMA 3F63A 4I6XA 6GSVA 2HSHA 1Y25A 1GULA 3M3MA 5CP1A 4POLA 2CAIA 2X8HA 1QQ2A 2PN8A 2HLSA 3A2XA 4PUAA 4OFNA 2LQQA 3CSHA 2DLXA 2I4AA 5CYYA 3C1RA 4L5LA 18GSA 5G1LA 2ZCTA 4PTSA 1LU4A 3L9SA 1GL8A 2XPEA 2DJ1A 3FZAA 3IPZA 4ZL9A 1OAZA 1EWXA 3VLNA 4IW9A 1F37A 1SJZA 2F9SA 1WOUA 2N5BA 2KHPA 1FVKA 3VK9A 4IJ3A 3I69A 1FW1A 1NHYA 1ZMAA 2DC5A 4F2IA 2TRXA 4POBA 3HVVA 5ECRB 1USBA 1S3DA 4PXOA 3ZFLA 3HZ4A 5IO0A 1XOBA 5F05A 2VLUA 5EY6A 2I3YA 3O3TA 3KD0A 1YEPA 3D0ZA 1ERTA 5IMVA 5KN2A 2A2RA 1OYJA 1U3IA 1GSQA 4ZBDA 3TKSA 3P90A 2OE3A 2E2MA 5F07A 1Z9HA 1BAYA 3VI5A 3J7Yb 5A4WA 1FHEA 1J08A 4WETA 1GSSA 11GSA 1VF2A 2QSIA 1B9XC 1ERWA 5JCGA 2FY6A 4NMUA 4KDYA 2GVPA 4FIWA 2AJQB 4OCFA 1TU8A 1GSUA 2OA7A 1A8YA 1A8LA 1LJRA 3ZRDA 5DJLA 4TR1A 2ZUPA 5CREA 4Q5FA 4J56E 1SD8A 4DVCA 3VURA 1XVQA 2IJYA 3KMNA 1FB0A 4WXTA 4PUFC 3CTGA 3KEBA 2YCDA 4CW9A 2X8GA 1B48A 1OC9A 4KA0A 3QDNA 3MSZA 5CO3A 2J23A 2KLXA 4HDEA 5COHA 2H72A 1TRWA 3DD3A 2IN3A 2R4VA 1EOHA 3SBCA 2R37A 5JCWA 1SL2B 2C3TA 1HD2A 1R26A 3CRTA 3QPMA 2PU9C 4YAVA 1X9WB 2VO4A 2GSQA 1PL1A 2H75A 3GFKA 1T3BA 4KW6A 3QOUA 17GSA 4PQ1A 1J9BA 1GH2A 2HFDA 4NV5A 3IRAA 4BWQA 4E8EA 4MLYA 4XS4A 4Z7XA 1GUMA 2VD1A 2B5YA 2R3XA 5ECSA 2C3NA 1Q4JA 3ZREA 1RQMA 3W8JA 2NPBA 3APQA 2QGVA 2N5AA 1KBNA 3FKFA 3TKSC 2HI7A 3DMLA 3Q19A 1MDKA 2ALBA 2C0FA 3GA4A 3QD9A 2GZYA 4CDOA 3FR6A 5DALB 2FWEA 4OFTA 1A2JA 1K0BA 2O87A 2GT6A 3HKRA 3ZYWA 3I9V2 1N8JA 5ECNB 4LLRA 3G7JA 3E9JB 2HE3A 4ZBBA 2I9HA 5B6NA 2H6ZA 3VFIA 1YF1A 4JU5A 4BWSA 5INYA 1V40A 4JEDA 1G0TA 2H70A 3KCMA 3H1NA 5B7CA 4BL7B 1M99A 1O85A 2MZCA 2L5LA 3LWAA 4MJAA 3A3TA 4J57E 1YDKA 1ERVA 1A2LA 2FWFA 20GSA 2IMDA 4EE0A 1ON4A 2CAQA 1JFUA 3F4TA 1VF3A 2EIRA 4MH3A 2HRKB 2H0HA 3TDGA 1ZCPA 4FYCA 2D2ZA 2FHEA 2IPAA 1SK1A 3H8QA 1S3AA 3RPPA 4NPBA
chains in the Genus database with same CATH superfamily
4ZXGA 1V57A 4RQRA 1SVLA 3QCPA 4K0GA 1AQWA 1GP1A 3ERWA 3ZIJA 2R0GA 5KEJA 2RIIA 3Q18A 1VRSD 1V58A 1GWCA 2H1DA 1FG4A 1W89A 2C0DA 2LQOA 1KEBA 2L5OA 4MA9A 3TRQA 1ZYNA 4K5RA 4YKFA 5CAXA 3FHKA 3QFAC 3TKQA 5ECIB 5EVOA 4RUVA 1XFLA 2GLRA 3VI7A 5J3RA 2R2JA 1ZYQB 1XBSA 5B6MA 4H86A 3UL3A 4MJCA 4KGIA 3D4TA 1M3JA 3GSSA 3KM6A 1PN0A 2CVDA 1H4OA 2IFQA 2BMXA 2OT3A 3ISOA 1JZOA 1YZXA 3KP9A 4EKZA 1YEXA 1HYUA 3TJGA 5DQSA 4G0LA 4MPFA 3BBYA 2QA1A 1AAZA 2HNLA 3G7IA 3J7Yk 2XHFA 4G10A 1B4QA 1Y1UA 3TRPA 1K0OA 4IP6A 3IA1A 3L9VA 4FQUA 2GSSA 3RFRC 3GMFA 4PHZC 4NXIA 2OJLA 3KTBA 1JZRA 3IE3A 4FYBA 2VD0A 1YEWC 3IDVA 5J4UA 1TK8B 2GSTA 5J4YA 5KN1A 2PUKC 1HNBA 6GSUA 4IKHA 4YAPA 1EEJA 1PRXA 4XS6A 1OVNA 2K9FA 4BVXA 4MK3A 3KP8A 4WBRD 5ABRA 5HR0A 3FYGA 1FAAA 3TB2A 7GSSA 5IIZA 3TJJA 4ACSA 5EL8A 4AJ8A 3HYPA 2RUFA 1SENA 4K7IA 2B3SA 2MMNA 1G7EA 1Z5YE 4IP1A 2PVOC 4G0IA 1YQ1A 2GS3A 1MDIA 2CX4A 3N9JA 2NBSA 1B8XA 1B9YC 3IOSA 1GLQA 4IHUA 3KH7A 2MBSA 2FA8A 3A2WA 2I81A 6GSYA 3GTUB 1T4YA 3LJRA 4TOPA 2R0CA 1K3LA 4QL9A 6GSXA 1ILOA 3E0UA 5IMAA 4HOJA 4W66A 3ZMLA 2YZUA 16GSA 3IC8A 2WULA 2L6DA 4OD7A 2R0PA 4KF9A 2AYTA 4K5SA 1I9DA 3EC3A 3PINA 4BVYB 5GSSA 3UIWA 2PERA 2IMIA 5CRGA 3UARA 2YANA 1BQ7A 3C73A 3GH6A 3HDCA 1QGVA 1F3BA 4GTUA 2IMKA 2O89A 4KE3A 2H0IA 4KH7A 1O7UA 3HCZA 2UZ8A 1WPIA 3G9BA 1SK0A 3DVWA 5DBQA 4I8BA 4WEYA 1BF5A 3ZL5A 4K7OA 4TRXA 4QL7A 2FUG2 1U6TA 2I1UA 4ZB7A 4G01A 3H93A 4ML6A 2JADA 1X0RA 3DVXA 3VWXA 4XRAA 2L57A 3UJ1A 2A2PA 4ZBAA 1EV4A 2XPDA 2Z9SA 5IO2A 4PX1A 2H1LA 2VL2C 2FNOA 5A5HA 2VLTA 4GQCA 5HQPA 1AXDA 5J40A 2X4AA 4F82A 2LSTA 2DKHA 3FK8A 2HYXA 1I5GA 3IK9A 2HXKA 3DWVA 3QAWA 2IMEA 3KGKA 2O7KA 1Z3EA 3H79A 5A1NA 4RQXA 9GSSA 1XWCA 2C0EA 1HNCA 2JSZA 2OADA 1MEKA 5A4VA 2WGRA 3NOFA 3WGDA 2CZ3A 5KN0A 5LCZA 1GTAA 2V32A 3BCKA 5FHIA 1K3YA 3LG6A 1TU7A 2H1GA 3GRXA 3I43A 4ECCA 4YH2A 5J41A 5F06A 1X9SB 1ERUA 2DJJA 4XIHA 2IWTA 3LEFA 1F2EA 5ECLB 3CTFA 1UVZA 5G5FA 2LTKA 2V6KA 4TR1B 5ECQB 2WW2A 3MIXA 5FWGA 3LYPA 3APOA 4NAXA 1PD21 1NSWA 2DJ2A 2MYGA 3ZVJD 2C1YA 1TI1A 3BJ5A 1GTIA 3BOAA 4IBPA 4PI0C 2KOKA 5C04A 4AJ6A 4D73A 2O3EA 1O73A 3TKRA 1BEDA 1OC9B 1SKWB 3ZITA 4MDCA 4IS0A 5KN3A 2HRNA 4TXOA 1VF1A 3P7XA 2C4JA 4O7HA 5AIVA 4KNDA 1GSDA 2YPMA 3TKPA 4TW5A 3M9JA 3GKMA 5ECHB 2CZ2A 4I97A 1ZL9A 5A4UA 3GH9A 5GSTA 1OC3A 5IOXA 4IVFA 2DMLA 5CRWA 1GUKA 2A2SA 1DBYA 4WBJA 2GZZA 3VWUA 1AC1A 2MMZA 2F8AA 1PA3A 3GNJA 4XS4B 4DSSB 3MAKA 19GSA 2ON5A 3IXRA 1TI3A 1XIYA 4KUNA 1GLPA 4V2LA 1H75A 4G9HA 4HZ2A 3GYKA 4E8HA 1S3CA 1T00A 2QA2A 2H1BA 2GTUA 3CSJA 2GGTA 3NZNA 5B8AA 1XG8A 3ZIVA 3LW9A 1HNAA 4QMKA 3GSTA 5D9VA 3EE2A 3MNGA 4DSSA 1K3OA 1PFOA 3US3A 5H5QA 1ST9A 3E3EA 1AW9A 4IN0A 1SVMA 2DJKA 4N10A 2O8VB 3EMXA 2GQLA 1AIUA 1A0FA 3CQFA 5IMZA 2DSAA 3A2VA 1ZYPA 1M9AA 2KUCA 4WKWA 4EDYA 2YWNA 5JWQB 2HSNB 4PI2C 4IGJA 1FO5A 4G2EA 5HFGA 4N11A 4IQ1A 4NV2A 4AKXB 2UV8G 4OMVA 4O5QA 4MH2A 4K6XA 3GX0A 1QFNA 5JWRB 2OBKA 2M72A 3GL5A 1NM3A 3EMPA 2M46A 3M0FA 5H5SA 2F51A 5G1KA 3UVTA 14GSA 3LSZA 5ELAA 3I6AA 2IMFA 1TRSA 3QAGA 1GNEA 2F3MA 1ML6A 4JR4A 2EFEA 1DSBA 5BMUA 2VOCA 5AISA 2K8VA 3LQ7A 3HZ8A 2HSNA 1XW5A 3H4KA 3SWLA 2JZSA 1PSQA 2JSYA 2MMOA 2K8SA 2VLVA 3VWVA 3TJBA 1VGLA 3D5JA 5F8BA 2H0GA 3WGXA 3ZLPA 2P0GA 3DRNA 1S4BP 5IMFA 1Q98A 4NHZA 1CQHA 1ZGNA 2LRCA 2XC2A 3EWLA 2CA8A 1YKCA 2HSMA 3RAZA 1WE0A 2REMA 1DE2A 2GT5A 5D9WA 1SL0B 5HFIA 3EURA 2WRTA 4K8MA 2AHEA 13GSA 1MD4A 1ZYEA 4HJ2A 5EPFA 2J9HA 3ME8A 3QR6A 4AKHA 4TVEA 4GXZA 5G31A 1T8EB 2WJUA 4MZWA 5DAKA 2WVXB 2DMMA 4AI6A 4N0ZA 1XW9A 5DCHA 4KAEA 1EZKA 2IIYA 2LKUA 1PMTA 4TKYA 4GCIA 2HZEA 3TRXA 3UAPA 4IJIA 1Z7RA 2IFQB 4WF5A 4K2XA 2NVLA 1OE7A 3GKXA 4TR4A 3HA9A 3IAM2 2YP6A 4AGSA 4L0WA 4K1FA 2X64A 2YOIA 5JWOB 4F0CA 2HRFA 2YWIA 2EIQA 5D9XA 2WVXA 1RW1A 3CSIA 1Z6MA 5ID2A 4EIPA 2HQTA 4V2MA 1R7HA 1TXUA 3GX8A 4OCEA 3F0IA 10GSA 1BJXA 4O92A 3DXBA 1F6MC 2VKZG 4PNGA 2WW3A 4L0UA 4L5OA 3W6GA 3HXSA 2LEGA 2EIOA 1BG5A 2X8CA 4I2TA 3RDWA 1SU9A 3A5IA 4N30A 2FA4A 3N5OA 4F9ZA 4FXYP 2TIRA 5DCGA 1JLVA 1PX7A 1BYEA 5D9TA 4BVXB 4MZCA 4GQFA 3FEUA 3L4NA 2YJ7A 3W8SA 5LNKe 5G30A 4X43A 4YQMA 3F6FA 4K7NA 4XCSA 2VCTA 3UBLA 3GKNA 3ME7A 4MJBA 8GSSA 4JZQA 2H6YA 2JZTA 2NDOA 4JR6A 3IHQA 1MD3A 3F8UA 3RHCA 3BCIA 4DSRA 1G6WA 1OC8A 1M9BA 2B6MA 2O85A 4TR3A 2FLSA 2YJHA 3UVHA 5HR3A 5DJMA 4JE1A 5KOWA 1PL2A 3TU3B 3MWHA 3LORA 2WVZA 1WP0A 1TKDB 1X5DA 2H8LA 4OFMA 2C80A 3V1WA 2DIYA 2CT6A 4OWYA 2FGXA 2YN1A 2WZSA 3TKSE 1G6YA 2VL2A 3ZMKA 4POMA 2CV4A 1ZZYA 2KP2A 4TXVA 2L6CA 2WW0A 2OE1A 2LNTA 2G0FA 4O5UA 4I5QA 2H66A 3F4SA 4HUAA 12GSA 3GN3A 5ECKB 6GSWA 2VAFA 2WVYA 4YQVA 2FD3A 1K0AA 4HU9A 5JCUA 4AKIA 4HQSA 4ECIA 1IYIA 1Z6NA 2M80A 1LBKA 3CXGA 3L9UA 4L8EA 4ZL7A 3UMAA 1NW2A 4E68A 2AUVA 1CQGA 3QAVA 4ICYA 3IAS2 3M1GA 1YJ6A 4EVMA 3LFLA 1GNWA 3P8WA 4GSNA 2LS5A 2G2QA 3GL3A 3PR8A 1G7OA 2GQKA 4EUYA 22GSA 2WDUA 5IMDA 1EP8A 2H6XA 3KH9A 2BTOT 5A5HB 3F6DA 5DQYA 5J5NA 2F8FA 2P31A 4WR5A 3GKKA 1MDJA 3UEMA 4NWYA 1T7PB 3D4MA 1Y6EA 3DYRA 3ZVJA 2LV3A 2WS2A 2LNSA 5AGYA 1KNGA 1OE8A 5DVBA 1XZOA 1YKAA 4Q5QA 3ERGA 4MCUA 4PURA 3O6TA 1FVJA 2AB6A 1HQOA 3DKSA 2DBCA 1GSEA 2H01A 4FO5A 1M7TA 2YNXA 2VCQA 4HU7A 3HVSA 3C1SA 1K0DA 1W4VA 3FZ4A 3IV4A 1EGOA 5A1NB 3EVIA 3FRCA 4XHMA 2K18A 3TOTA 5G5EA 2CQ9A 1WWJA 3FW2A 1TXXA 1S3RA 3KXOA 3VPQA 3F9UA 4ID0A 2MBTA 2B5XA 3R3EA 4MF5A 4K2DA 4F03A 2LJAA 2E7PA 2E0QA 1AQXA 1E2YA 2QC7A 5F0GA 3ZZXA 1DE1A 2LJKA 1XWKA 4EIQA 2RM6A 4PGTA 2E2GA 3DGQA 2H1AA 5HR1A 3HJOA 1ABAA 5FT3A 5ECOB 4MPGA 4XRDA 5IQYA 4V1Ap 5D96A 5A5KA 1OKTA 3MDKA 4KCAA 3LYKA 4AF2A 4DEJA 1M2DA 4JRRA 4D73B 1K0MA 4PQIA 1XPVA 4GSSA 3VPTA 3LGCA 5ECPB 3TGZA 4TXOB 3IBHA 3CRUA 2VM2A 5LD0A 5CRHA 1SKSB 2L59A 2FCHA 1THXA 5CNWA 1TRUA 1FOVA 3TCOA 1YVLA 5DDLA 4ULXA 3UBKA 5HR2A 2AAWA 5J9CA 2LJRA 4XS1A 3CYNA 2ON7A 6GSTA 2VCZA 5A34A 1XOAA 1O6JA 1U3AA 2HZFA 4TN8A 3ZTLA 5ECMB 5CRDA 1YY7A 1O8WA 3K8NA 2TRCP 4GLTA 4HZ4A 3PGTA 2OACA 3HVXA 4ZILA 4GF0A 2XBQA 3VWWA 4V2NA 1XXUA 1SK2A 4NHWA 2A4HA 1F3AA 1X5EA 2H19A 1V98A 1RK4A 4MABA 2MMAA 1SD9A 1ZOFA 3IHGA 2LUSA 2VIMA 4CHSA 1URMA 4ISDA 2N5FA 1B4PA 1UN2A 2VL3A 4KSMA 4MJEA 2WW1A 2DJ3A 4TR0A 1IYHA 3FR9A 4LMWA 3P2AA 3ERFA 3NIVA 4OO5A 4KCEA 3G7YA 5J47A 3FY7A 4F0BA 4ZIJA 2H74A 4X0XA 3TUEA 1T4ZA 3GHAA 1XW6A 1X9MB 5BMUB 1QUWA 2VUPA 4KSOA 4BPYA 2YWOA 3GUSA 2FWHA 1YF0A 3EINA 1OKDA 1SYXA 2H71A 1JLWA 2RLIA 1THOA 2C3QA 4YQUA 3CBUA 1UC7A 3KJYA 2RM5A 4GRFA 4I2UA 4Q5RA 5J9BA 2HSMB 2R5GA 1TRVA 3EU3A 3RHBA 5IPHA 1K0CA 4HI7A 4POKA 2JZRA 2NTOA 3C8EA 4ZB6A 1EEMA 1AUCA 3C7MA 3CHXC 4LMVA 5IM9A 1BX9A 1XWAA 1WIKA 1M2AA 2JL4A 3WT1A 5DAKB 2LRNA 5H5RA 1R5PA 5D8IA 3DEXA 2AV4A 3U5RE 2R6KA 2HZEB 1U88A 4ILFA 1X5CA 5DALA 1WRYA 2H30A 4HS1A 4HSCX 3QMXA 2BJXA 2DIZA 3F3RA 4Q5NA 5D73A 2GZPA 2X99A 3RBTA 4ML1A 3WT2A 3U6VA 4LL4B 5GAPD 1A23A 5ID2B 1QK8A 1A0RP 4ECBA 4EF0A 4EXJA 4KX4A 2C0GA 1EGRA 1NHOA 2VCXA 2B1KA 1TP9A 4BL7A 1SKRB 3FR3A 2LRTA 1E6BA 3TJFA 1SJ6A 2L4CA 3BD2A 2K6VA 3HJPA 1FB6A 4LL1B 2HRAA 2KP1A 3KMOA 1TJDA 4MZBA 2WFCA 4PQHA 4O5RA 3ED3A 2PVQA 2HRKA 4P3YB 1N2AA 3F4RA 1AQVA 2GSRA 3Q74A 2B7KA 1GRXA 2P5RA 3M9KA 2B1LA 1TW9A 3TJKA 1XCCA 3TOUA 2QKEA 5B8BA 5HFKA 2VM1A 2YV7A 3APSA 1VF4A 4KDXA 3GURA 4X1UA 1GTUA 3RPNA 2PGTA 1XWBA 1T1VA 5GAND 2V2GA 3PPUA 4O32A 2PBJA 2H76A 1EP7A 4Z2RA 6GSSA 2JU5A 3A5WA 5ELGA 1JZWA 4RI7A 1GTBA 3R2QA 5KOXA 1XWGA 2CVKA 1C72A 3IK7A 4BA7A 2ES7A 3S9FA 4OO4A 4FYUA 2CX3A 2PMTA 1M0UA 2VL9A 1SL1B 1A24A 3F3QA 4IQAA 4USSA 2XBIA 2HSYA 3KZQA 4KDUA 4G19A 4MF7A 4HQZA 2GDRA 4CY6A 3HY2A 4X4JA 1SVOA 1QMVA 2VCVA 2WB9A 1GSYA 4XTSA 1UA5A 4FH8A 3D22A 1Z7PA 4EC0A 2A4VA 2IL3A 4Z2UA 2CVBA 3WD6A 1A2MA 2C8UA 3FZ5A 2YV9A 3L78A 4ZB9A 1MTCA 1O8XA 1TK5B 3WYWA 1DUGA 5E4WA 1PKWA 1J0FA 3AY8A 5E59A 5IPGA 1WMJA 3FMWA 3QFBC 3O76A 4EDZA 2V6OA 3JCML 4MMMA 3EYTA 3GIXA 4K9ZA 1K0NA 2OE0A 5D93A 2H73A 4N0VA 1PN9A 2JACA 4EL1A 4K0NA 2WCIA 4MP4A 3ZFBA 3FZ9A 4QQ7A 5IMCA 3OR5A 3HD5A 5AN1A 3Q6OA 4HJMA 2YWMA 1F9MA 4MF6A 3D21A 2OBIA 4PNFA 3KIJA 2EC4A 1I1IP 5ENUA 1N25A 2B7JA 3LXTA 3HJMA 3RGBC 1EOGA 4J2FA 1JZDA 1SJIA 3CMIA 3IC4A 1TDIA 1PKZA 4GWRA 2PPTA 1TK0B 1O81A 3M8NA 4ZL8A 3WGEA 3UOMA 1V2AA 4IELA 2PWJA 1M2BA 2L4QA 3D6IA 3KTLA 4LA1A 3C71A 2FWGA 4GSTA 2ZNMA 4JBBA 2WZ9A 3GV1A 3EU4A 2V41A 1V9WA 5C00A 2VCWA 3PH9A 1WJKA 3DIEA 1SYRA 4V1Ag 2O36A 2YZHA 5L71A 3L0HA 1GSFA 3GTUA 4WF4A 1PGTA 1JHBA 1BG1A 1PX6A 2DJ0A 3HHVA 4RI6A 2X49A 4DSQA 3IR4A 1ACVA 1TTZA 5GZZB 4ZB8A 1TOFA 5IOWA 2V1MA 5AIXA 1QXHA 1R5AA 4AJ7A 1R4WA 4BVYA 1GUHA 2OKAA 4EO3A 1PQNA 1XVWA 4ECJA 4HEA2 3LXZA 1KTEA 4G0KA 2B5EA 2P5QA 5G2ZA 4MNNA 1EV9A 4WR4A 2HT9A 4KB3A 1U87A 2RUEA 2GQMA 3F63A 4I6XA 6GSVA 2HSHA 3MYDA 1Y25A 1GULA 3M3MA 5CP1A 4POLA 2CAIA 2X8HA 1QQ2A 2PN8A 2HLSA 3A2XA 4PUAA 4OFNA 2LQQA 3CSHA 2DKIA 2DLXA 2I4AA 5CYYA 1FOHA 3C1RA 4L5LA 18GSA 5G1LA 2ZCTA 4PTSA 1LU4A 3L9SA 1GL8A 2XPEA 2DJ1A 3FZAA 3IPZA 4ZL9A 1OAZA 1EWXA 3VLNA 4IW9A 1F37A 1SJZA 2F9SA 1WOUA 2N5BA 3EPTA 2KHPA 1FVKA 3VK9A 4IJ3A 5A34B 3I69A 1FW1A 1NHYA 1ZMAA 2DC5A 4F2IA 2TRXA 4POBA 3HVVA 5ECRB 1USBA 1S3DA 4PXOA 3ZFLA 3HZ4A 5IO0A 1XOBA 5F05A 2VLUA 5EY6A 2I3YA 4YKGA 3O3TA 3KD0A 1YEPA 3D0ZA 1ERTA 5IMVA 5KN2A 2A2RA 1OYJA 1U3IA 1GSQA 4ZBDA 3TKSA 3P90A 2OE3A 2E2MA 5F07A 1Z9HA 1BAYA 3VI5A 2EFDA 3J7Yb 5A4WA 1FHEA 1J08A 4WETA 1GSSA 11GSA 1VF2A 2QSIA 1B9XC 1ERWA 5JCGA 2FY6A 4NMUA 4KDYA 2GVPA 4FIWA 2AJQB 4OCFA 1TU8A 4Z2TA 1GSUA 2OA7A 1A8YA 4N3ZA 1A8LA 1LJRA 3ZRDA 5DJLA 4TR1A 2ZUPA 5CREA 4Q5FA 4J56E 1SD8A 4DVCA 3VURA 5BRTA 1XVQA 2IJYA 3KMNA 1FB0A 4WXTA 4PUFC 3CTGA 3KEBA 2YCDA 4CW9A 2X8GA 1B48A 1OC9A 4KA0A 3QDNA 3MSZA 5CO3A 2J23A 4GDFA 2KLXA 4HDEA 5COHA 2H72A 1TRWA 3HMJG 3DD3A 2IN3A 2R4VA 1EOHA 3SBCA 2R37A 5JCWA 1SL2B 2C3TA 1HD2A 3CWGA 1R26A 4BIKA 3CRTA 5J4VA 3QPMA 2PU9C 4YAVA 1X9WB 2VO4A 2GSQA 1PL1A 2H75A 3GFKA 1T3BA 4KW6A 3QOUA 17GSA 4PQ1A 1J9BA 1GH2A 2HFDA 3HVNA 4NV5A 3IRAA 4BWQA 4E8EA 4MLYA 4XS4A 4Z7XA 1GUMA 2VD1A 2B5YA 2R3XA 5ECSA 2C3NA 1Q4JA 3ZREA 1RQMA 3W8JA 2NPBA 3APQA 2QGVA 2N5AA 1KBNA 3FKFA 3TKSC 2HI7A 3DMLA 3Q19A 1MDKA 2ALBA 2C0FA 3GA4A 3QD9A 2GZYA 4CDOA 3FR6A 5DALB 2FWEA 4OFTA 1A2JA 1K0BA 2O87A 2GT6A 3HKRA 3ZYWA 3I9V2 1N8JA 5ECNB 4LLRA 3G7JA 3E9JB 2HE3A 4ZBBA 2I9HA 5B6NA 2H6ZA 3VFIA 1YF1A 4JU5A 4BWSA 5INYA 1V40A 4JEDA 2EFHA 4A5PA 1G0TA 2EFCA 2H70A 3KCMA 3H1NA 5B7CA 4BL7B 1M99A 1O85A 2MZCA 2L5LA 4CY8A 3LWAA 4MJAA 3A3TA 4J57E 1YDKA 1ERVA 1A2LA 2FWFA 20GSA 2IMDA 1M3IA 4EE0A 1ON4A 2CAQA 1JFUA 3F4TA 1VF3A 2EIRA 4MH3A 2HRKB 2H0HA 3TDGA 4AKGA 1ZCPA 4FYCA 2D2ZA 2FHEA 2IPAA 1SK1A 2O5VA 3H8QA 1S3AA 3RPPA 4NPBA
chains in the Genus database with same CATH topology
4ZXGA 1V57A 4RQRA 1SVLA 3QCPA 4K0GA 1AQWA 1GP1A 3ERWA 3ZIJA 2R0GA 5KEJA 2RIIA 3Q18A 1VRSD 1V58A 1GWCA 2H1DA 1FG4A 1W89A 2C0DA 2LQOA 1KEBA 2L5OA 4MA9A 3TRQA 1ZYNA 4K5RA 4YKFA 5CAXA 3FHKA 3QFAC 3TKQA 5ECIB 5EVOA 4RUVA 1XFLA 2GLRA 3VI7A 5J3RA 2R2JA 1ZYQB 1XBSA 5B6MA 4H86A 3UL3A 4MJCA 4KGIA 3D4TA 3GSSA 3KM6A 1PN0A 2CVDA 1H4OA 2IFQA 2BMXA 2OT3A 3ISOA 1JZOA 1YZXA 3KP9A 4EKZA 1YEXA 1HYUA 3TJGA 5DQSA 4G0LA 4MPFA 3BBYA 2QA1A 1AAZA 2HNLA 3G7IA 3J7Yk 2XHFA 4G10A 1B4QA 1Y1UA 3TRPA 1K0OA 4IP6A 3IA1A 3L9VA 4FQUA 2GSSA 3GMFA 4NXIA 2OJLA 3KTBA 1JZRA 3IE3A 4FYBA 2VD0A 3IDVA 5J4UA 1TK8B 2GSTA 5J4YA 5KN1A 2PUKC 1HNBA 6GSUA 4IKHA 4YAPA 1EEJA 1PRXA 4XS6A 1OVNA 2K9FA 4BVXA 4MK3A 3KP8A 4WBRD 5ABRA 5HR0A 3FYGA 1FAAA 3TB2A 7GSSA 5IIZA 3TJJA 4ACSA 5EL8A 4AJ8A 3HYPA 2RUFA 1SENA 4K7IA 2B3SA 2MMNA 1G7EA 1Z5YE 4IP1A 2PVOC 4G0IA 1YQ1A 2GS3A 1MDIA 2CX4A 3N9JA 2NBSA 1B8XA 1B9YC 3IOSA 1GLQA 4IHUA 3KH7A 2MBSA 2FA8A 3A2WA 2I81A 6GSYA 3GTUB 1T4YA 3LJRA 4TOPA 2R0CA 1K3LA 4QL9A 6GSXA 1ILOA 3E0UA 5IMAA 4HOJA 4W66A 3ZMLA 2YZUA 16GSA 3IC8A 2WULA 2L6DA 4OD7A 2R0PA 4KF9A 2AYTA 4K5SA 1I9DA 3EC3A 3PINA 4BVYB 5GSSA 3UIWA 2PERA 2IMIA 5CRGA 3UARA 2YANA 1BQ7A 3C73A 3GH6A 3HDCA 1QGVA 1F3BA 4GTUA 2IMKA 2O89A 4KE3A 2H0IA 4KH7A 1O7UA 3HCZA 2UZ8A 1WPIA 3G9BA 1SK0A 3DVWA 5DBQA 4I8BA 4WEYA 1BF5A 3ZL5A 4K7OA 4TRXA 4QL7A 2FUG2 1U6TA 2I1UA 4ZB7A 4G01A 3H93A 4ML6A 2JADA 1X0RA 3DVXA 3VWXA 4XRAA 2L57A 3UJ1A 2A2PA 4ZBAA 1EV4A 2XPDA 2Z9SA 5IO2A 4PX1A 2H1LA 2VL2C 2FNOA 5A5HA 2VLTA 4GQCA 5HQPA 1AXDA 5J40A 2X4AA 4F82A 2LSTA 2DKHA 3FK8A 2HYXA 1I5GA 3IK9A 2HXKA 3DWVA 3QAWA 2IMEA 3KGKA 2O7KA 1Z3EA 3H79A 5A1NA 4RQXA 9GSSA 1XWCA 2C0EA 1HNCA 2JSZA 2OADA 1MEKA 5A4VA 2WGRA 3NOFA 3WGDA 2CZ3A 5KN0A 5LCZA 1GTAA 2V32A 3BCKA 5FHIA 1K3YA 3LG6A 1TU7A 2H1GA 3GRXA 3I43A 4ECCA 4YH2A 5J41A 5F06A 1X9SB 1ERUA 2DJJA 4XIHA 2IWTA 3LEFA 1F2EA 5ECLB 3CTFA 1UVZA 5G5FA 2LTKA 2V6KA 4TR1B 5ECQB 3MIXA 5FWGA 3LYPA 3APOA 4NAXA 1PD21 1NSWA 2DJ2A 2MYGA 3ZVJD 2C1YA 1TI1A 3BJ5A 1GTIA 3BOAA 4IBPA 2KOKA 5C04A 4AJ6A 4D73A 1O73A 3TKRA 1BEDA 1OC9B 1SKWB 3ZITA 4MDCA 4IS0A 5KN3A 2HRNA 4TXOA 1VF1A 3P7XA 2C4JA 4O7HA 5AIVA 4KNDA 1GSDA 2YPMA 3TKPA 4TW5A 3M9JA 3GKMA 5ECHB 2CZ2A 4I97A 1ZL9A 5A4UA 3GH9A 5GSTA 1OC3A 5IOXA 4IVFA 2DMLA 5CRWA 1GUKA 2A2SA 1DBYA 4WBJA 2GZZA 3VWUA 1AC1A 2MMZA 2F8AA 1PA3A 3GNJA 4XS4B 4DSSB 3MAKA 19GSA 2ON5A 3IXRA 1TI3A 1XIYA 4KUNA 1GLPA 4V2LA 1H75A 4G9HA 4HZ2A 3GYKA 4E8HA 1S3CA 1T00A 2QA2A 2H1BA 2GTUA 3CSJA 2GGTA 3NZNA 5B8AA 3ZIVA 3LW9A 1HNAA 4QMKA 3GSTA 5D9VA 3EE2A 3MNGA 4DSSA 1K3OA 3US3A 5H5QA 1ST9A 3E3EA 1AW9A 4IN0A 1SVMA 2DJKA 4N10A 2O8VB 3EMXA 2GQLA 1AIUA 1A0FA 5IMZA 2DSAA 3A2VA 1ZYPA 1M9AA 2KUCA 4WKWA 4EDYA 2YWNA 5JWQB 2HSNB 4IGJA 1FO5A 4G2EA 5HFGA 4N11A 4IQ1A 4NV2A 4AKXB 2UV8G 4OMVA 4O5QA 4MH2A 4K6XA 3GX0A 1QFNA 5JWRB 2OBKA 2M72A 3GL5A 1NM3A 3EMPA 2M46A 3M0FA 5H5SA 2F51A 5G1KA 3UVTA 14GSA 3LSZA 5ELAA 3I6AA 2IMFA 1TRSA 3QAGA 1GNEA 2F3MA 1ML6A 4JR4A 2EFEA 1DSBA 5BMUA 2VOCA 5AISA 2K8VA 3LQ7A 3HZ8A 2HSNA 1XW5A 3H4KA 3SWLA 2JZSA 1PSQA 2JSYA 2MMOA 2K8SA 2VLVA 3VWVA 3TJBA 1VGLA 3D5JA 5F8BA 2H0GA 3WGXA 3ZLPA 2P0GA 3DRNA 5IMFA 1Q98A 4NHZA 1CQHA 1ZGNA 2LRCA 2XC2A 3EWLA 2CA8A 1YKCA 2HSMA 3RAZA 1WE0A 2REMA 1DE2A 2GT5A 5D9WA 1SL0B 5HFIA 3EURA 2WRTA 4K8MA 2AHEA 13GSA 1MD4A 1ZYEA 4HJ2A 5EPFA 2J9HA 3ME8A 3QR6A 4AKHA 4TVEA 4GXZA 5G31A 1T8EB 2WJUA 4MZWA 5DAKA 2DMMA 4AI6A 4N0ZA 1XW9A 5DCHA 4KAEA 1EZKA 2IIYA 2LKUA 1PMTA 4TKYA 4GCIA 2HZEA 3TRXA 3UAPA 4IJIA 1Z7RA 2IFQB 4WF5A 4K2XA 2NVLA 1OE7A 3GKXA 4TR4A 3HA9A 3IAM2 2YP6A 4AGSA 4L0WA 4K1FA 2X64A 2YOIA 5JWOB 4F0CA 2HRFA 2YWIA 2EIQA 5D9XA 1RW1A 3CSIA 1Z6MA 5ID2A 4EIPA 2HQTA 4V2MA 1R7HA 1TXUA 3GX8A 4OCEA 3F0IA 10GSA 1BJXA 4O92A 3DXBA 1F6MC 2VKZG 4PNGA 4L0UA 4L5OA 3W6GA 3HXSA 2LEGA 2EIOA 1BG5A 2X8CA 4I2TA 3RDWA 1SU9A 3A5IA 4N30A 2FA4A 3N5OA 4F9ZA 2TIRA 5DCGA 1JLVA 1PX7A 1BYEA 5D9TA 4BVXB 4MZCA 4GQFA 3FEUA 3L4NA 2YJ7A 3W8SA 5LNKe 5G30A 4X43A 4YQMA 3F6FA 4K7NA 4XCSA 2VCTA 3UBLA 3GKNA 3ME7A 4MJBA 8GSSA 4JZQA 2H6YA 2JZTA 2NDOA 4JR6A 3IHQA 1MD3A 3F8UA 3RHCA 3BCIA 4DSRA 1G6WA 1OC8A 1M9BA 2B6MA 2O85A 4TR3A 2FLSA 2YJHA 3UVHA 5HR3A 5DJMA 4JE1A 5KOWA 1PL2A 3TU3B 3MWHA 3LORA 1WP0A 1TKDB 1X5DA 2H8LA 4OFMA 2C80A 3V1WA 2DIYA 2CT6A 4OWYA 2FGXA 2YN1A 3TKSE 1G6YA 2VL2A 3ZMKA 4POMA 2CV4A 1ZZYA 2KP2A 4TXVA 2L6CA 2OE1A 2LNTA 2G0FA 4O5UA 4I5QA 2H66A 3F4SA 4HUAA 12GSA 3GN3A 5ECKB 6GSWA 2VAFA 4YQVA 2FD3A 1K0AA 4HU9A 5JCUA 4AKIA 4HQSA 4ECIA 1IYIA 1Z6NA 2M80A 1LBKA 3CXGA 3L9UA 4L8EA 4ZL7A 3UMAA 1NW2A 4E68A 2AUVA 1CQGA 3QAVA 4ICYA 3IAS2 3M1GA 1YJ6A 4EVMA 3LFLA 1GNWA 3P8WA 4GSNA 2LS5A 2G2QA 3GL3A 3PR8A 1G7OA 2GQKA 4EUYA 22GSA 2WDUA 5IMDA 1EP8A 2H6XA 3KH9A 2BTOT 5A5HB 3F6DA 5DQYA 5J5NA 2F8FA 2P31A 4WR5A 3GKKA 1MDJA 3UEMA 4NWYA 1T7PB 3D4MA 1Y6EA 3DYRA 3ZVJA 2LV3A 2WS2A 2LNSA 5AGYA 1KNGA 1OE8A 5DVBA 1XZOA 1YKAA 4Q5QA 3ERGA 4MCUA 4PURA 3O6TA 1FVJA 2AB6A 1HQOA 3DKSA 2DBCA 1GSEA 2H01A 4FO5A 1M7TA 2YNXA 2VCQA 4HU7A 3HVSA 3C1SA 1K0DA 1W4VA 3FZ4A 3IV4A 1EGOA 5A1NB 3EVIA 3FRCA 4XHMA 2K18A 3TOTA 5G5EA 2CQ9A 1WWJA 3FW2A 1TXXA 3KXOA 3VPQA 3F9UA 4ID0A 2MBTA 2B5XA 3R3EA 4MF5A 4K2DA 4F03A 2LJAA 2E7PA 2E0QA 1AQXA 1E2YA 2QC7A 5F0GA 3ZZXA 1DE1A 2LJKA 1XWKA 4EIQA 2RM6A 4PGTA 2E2GA 3DGQA 2H1AA 5HR1A 3HJOA 1ABAA 5FT3A 5ECOB 4MPGA 4XRDA 5IQYA 4V1Ap 5D96A 5A5KA 1OKTA 3MDKA 4KCAA 3LYKA 4AF2A 4DEJA 1M2DA 4JRRA 4D73B 1K0MA 4PQIA 1XPVA 4GSSA 3VPTA 3LGCA 5ECPB 3TGZA 4TXOB 3IBHA 3CRUA 2VM2A 5LD0A 5CRHA 1SKSB 2L59A 2FCHA 1THXA 5CNWA 1TRUA 1FOVA 3TCOA 1YVLA 5DDLA 4ULXA 3UBKA 5HR2A 2AAWA 5J9CA 2LJRA 4XS1A 3CYNA 2ON7A 6GSTA 2VCZA 5A34A 1XOAA 1O6JA 1U3AA 2HZFA 4TN8A 3ZTLA 5ECMB 5CRDA 1YY7A 1O8WA 3K8NA 2TRCP 4GLTA 4HZ4A 3PGTA 2OACA 3HVXA 4ZILA 4GF0A 2XBQA 3VWWA 4V2NA 1XXUA 1SK2A 4NHWA 2A4HA 1F3AA 1X5EA 2H19A 1V98A 1RK4A 4MABA 2MMAA 1SD9A 1ZOFA 3IHGA 2LUSA 2VIMA 4CHSA 1URMA 4ISDA 2N5FA 1B4PA 1UN2A 2VL3A 4KSMA 4MJEA 2DJ3A 4TR0A 1IYHA 3FR9A 4LMWA 3P2AA 3ERFA 3NIVA 4OO5A 4KCEA 3G7YA 5J47A 3FY7A 4F0BA 4ZIJA 2H74A 4X0XA 3TUEA 1T4ZA 3GHAA 1XW6A 1X9MB 5BMUB 1QUWA 2VUPA 4KSOA 4BPYA 2YWOA 3GUSA 2FWHA 1YF0A 3EINA 1OKDA 1SYXA 2H71A 1JLWA 2RLIA 1THOA 2C3QA 4YQUA 3CBUA 1UC7A 3KJYA 2RM5A 4GRFA 4I2UA 4Q5RA 5J9BA 2HSMB 2R5GA 1TRVA 3EU3A 3RHBA 5IPHA 1K0CA 4HI7A 4POKA 2JZRA 2NTOA 3C8EA 4ZB6A 1EEMA 1AUCA 3C7MA 4LMVA 5IM9A 1BX9A 1XWAA 1WIKA 1M2AA 2JL4A 3WT1A 5DAKB 2LRNA 5H5RA 1R5PA 5D8IA 3DEXA 2AV4A 3U5RE 2R6KA 2HZEB 1U88A 4ILFA 1X5CA 5DALA 1WRYA 2H30A 4HS1A 3QMXA 2BJXA 2DIZA 3F3RA 4Q5NA 5D73A 2GZPA 2X99A 3RBTA 4ML1A 3WT2A 3U6VA 4LL4B 5GAPD 1A23A 5ID2B 1QK8A 1A0RP 4ECBA 4EF0A 4EXJA 4KX4A 2C0GA 1EGRA 1NHOA 2VCXA 2B1KA 1TP9A 4BL7A 1SKRB 3FR3A 2LRTA 1E6BA 3TJFA 1SJ6A 2L4CA 3BD2A 2K6VA 3HJPA 1FB6A 4LL1B 2HRAA 2KP1A 3KMOA 1TJDA 4MZBA 2WFCA 4PQHA 4O5RA 3ED3A 2PVQA 2HRKA 4P3YB 1N2AA 3F4RA 1AQVA 2GSRA 3Q74A 2B7KA 1GRXA 2P5RA 3M9KA 2B1LA 1TW9A 3TJKA 1XCCA 3TOUA 2QKEA 5B8BA 5HFKA 2VM1A 2YV7A 3APSA 1VF4A 4KDXA 3GURA 4X1UA 1GTUA 3RPNA 2PGTA 1XWBA 1T1VA 5GAND 2V2GA 3PPUA 4O32A 2PBJA 2H76A 1EP7A 4Z2RA 6GSSA 2JU5A 3A5WA 5ELGA 1JZWA 4RI7A 1GTBA 3R2QA 5KOXA 1XWGA 2CVKA 1C72A 3IK7A 4BA7A 2ES7A 3S9FA 4OO4A 4FYUA 2CX3A 2PMTA 1M0UA 2VL9A 1SL1B 1A24A 3F3QA 4IQAA 4USSA 2XBIA 2HSYA 3KZQA 4KDUA 4G19A 4MF7A 4HQZA 2GDRA 4CY6A 3HY2A 4X4JA 1SVOA 1QMVA 2VCVA 2WB9A 1GSYA 4XTSA 1UA5A 4FH8A 3D22A 1Z7PA 4EC0A 2A4VA 2IL3A 4Z2UA 2CVBA 3WD6A 1A2MA 2C8UA 3FZ5A 2YV9A 3L78A 4ZB9A 1MTCA 1O8XA 1TK5B 3WYWA 1DUGA 5E4WA 1PKWA 1J0FA 3AY8A 5E59A 5IPGA 1WMJA 3FMWA 3QFBC 3O76A 4EDZA 2V6OA 3JCML 4MMMA 3EYTA 3GIXA 4K9ZA 1K0NA 2OE0A 5D93A 2H73A 4N0VA 1PN9A 2JACA 4EL1A 4K0NA 2WCIA 4MP4A 3ZFBA 3FZ9A 4QQ7A 5IMCA 3OR5A 3HD5A 5AN1A 3Q6OA 4HJMA 2YWMA 1F9MA 4MF6A 3D21A 2OBIA 4PNFA 3KIJA 2EC4A 5ENUA 1N25A 2B7JA 3LXTA 3HJMA 1EOGA 4J2FA 1JZDA 1SJIA 3CMIA 3IC4A 1TDIA 1PKZA 4GWRA 2PPTA 1TK0B 1O81A 3M8NA 4ZL8A 3WGEA 3UOMA 1V2AA 4IELA 2PWJA 1M2BA 2L4QA 3D6IA 3KTLA 4LA1A 3C71A 2FWGA 4GSTA 2ZNMA 4JBBA 2WZ9A 3GV1A 3EU4A 2V41A 1V9WA 5C00A 2VCWA 3PH9A 1WJKA 3DIEA 1SYRA 4V1Ag 2YZHA 5L71A 3L0HA 1GSFA 3GTUA 4WF4A 1PGTA 1JHBA 1BG1A 1PX6A 2DJ0A 3HHVA 4RI6A 2X49A 4DSQA 3IR4A 1ACVA 1TTZA 5GZZB 4ZB8A 1TOFA 5IOWA 2V1MA 5AIXA 1QXHA 1R5AA 4AJ7A 1R4WA 4BVYA 1GUHA 2OKAA 4EO3A 1PQNA 1XVWA 4ECJA 4HEA2 3LXZA 1KTEA 4G0KA 2B5EA 2P5QA 5G2ZA 4MNNA 1EV9A 4WR4A 2HT9A 4KB3A 1U87A 2RUEA 2GQMA 3F63A 4I6XA 6GSVA 2HSHA 3MYDA 1Y25A 1GULA 3M3MA 5CP1A 4POLA 2CAIA 2X8HA 1QQ2A 2PN8A 2HLSA 3A2XA 4PUAA 4OFNA 2LQQA 3CSHA 2DKIA 2DLXA 2I4AA 5CYYA 1FOHA 3C1RA 4L5LA 18GSA 5G1LA 2ZCTA 4PTSA 1LU4A 3L9SA 1GL8A 2XPEA 2DJ1A 3FZAA 3IPZA 4ZL9A 1OAZA 1EWXA 3VLNA 4IW9A 1F37A 1SJZA 2F9SA 1WOUA 2N5BA 3EPTA 2KHPA 1FVKA 3VK9A 4IJ3A 5A34B 3I69A 1FW1A 1NHYA 1ZMAA 2DC5A 4F2IA 2TRXA 4POBA 3HVVA 5ECRB 1USBA 1S3DA 4PXOA 3ZFLA 3HZ4A 5IO0A 1XOBA 5F05A 2VLUA 5EY6A 2I3YA 4YKGA 3O3TA 3KD0A 1YEPA 3D0ZA 1ERTA 5IMVA 5KN2A 2A2RA 1OYJA 1U3IA 1GSQA 4ZBDA 3TKSA 3P90A 2OE3A 2E2MA 5F07A 1Z9HA 1BAYA 3VI5A 2EFDA 3J7Yb 5A4WA 1FHEA 1J08A 4WETA 1GSSA 11GSA 1VF2A 2QSIA 1B9XC 1ERWA 5JCGA 2FY6A 4NMUA 4KDYA 2GVPA 4FIWA 2AJQB 4OCFA 1TU8A 4Z2TA 1GSUA 2OA7A 1A8YA 4N3ZA 1A8LA 1LJRA 3ZRDA 5DJLA 4TR1A 2ZUPA 5CREA 4Q5FA 4J56E 1SD8A 4DVCA 3VURA 5BRTA 1XVQA 2IJYA 3KMNA 1FB0A 4WXTA 4PUFC 3CTGA 3KEBA 2YCDA 4CW9A 2X8GA 1B48A 1OC9A 4KA0A 3QDNA 3MSZA 5CO3A 2J23A 4GDFA 2KLXA 4HDEA 5COHA 2H72A 1TRWA 3HMJG 3DD3A 2IN3A 2R4VA 1EOHA 3SBCA 2R37A 5JCWA 1SL2B 2C3TA 1HD2A 3CWGA 1R26A 3CRTA 5J4VA 3QPMA 2PU9C 4YAVA 1X9WB 2VO4A 2GSQA 1PL1A 2H75A 3GFKA 1T3BA 4KW6A 3QOUA 17GSA 4PQ1A 1J9BA 1GH2A 2HFDA 4NV5A 3IRAA 4BWQA 4E8EA 4MLYA 4XS4A 4Z7XA 1GUMA 2VD1A 2B5YA 2R3XA 5ECSA 2C3NA 1Q4JA 3ZREA 1RQMA 3W8JA 2NPBA 3APQA 2QGVA 2N5AA 1KBNA 3FKFA 3TKSC 2HI7A 3DMLA 3Q19A 1MDKA 2ALBA 2C0FA 3GA4A 3QD9A 2GZYA 4CDOA 3FR6A 5DALB 2FWEA 4OFTA 1A2JA 1K0BA 2O87A 2GT6A 3HKRA 3ZYWA 3I9V2 1N8JA 5ECNB 4LLRA 3G7JA 3E9JB 2HE3A 4ZBBA 2I9HA 5B6NA 2H6ZA 3VFIA 1YF1A 4JU5A 4BWSA 5INYA 1V40A 4JEDA 2EFHA 4A5PA 1G0TA 2EFCA 2H70A 3KCMA 3H1NA 5B7CA 4BL7B 1M99A 1O85A 2MZCA 2L5LA 4CY8A 3LWAA 4MJAA 3A3TA 4J57E 1YDKA 1ERVA 1A2LA 2FWFA 20GSA 2IMDA 4EE0A 1ON4A 2CAQA 1JFUA 3F4TA 1VF3A 2EIRA 4MH3A 2HRKB 2H0HA 3TDGA 4AKGA 1ZCPA 4FYCA 2D2ZA 2FHEA 2IPAA 1SK1A 2O5VA 3H8QA 1S3AA 3RPPA 4NPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZXG A;  1V57 A;  4RQR A;  3QCP A;  4K0G A;  1AQW A;  1GP1 A;  3ERW A;  3ZIJ A;  5KEJ A;  2RII A;  3Q18 A;  1VRS D;  1V58 A;  1GWC A;  2H1D A;  1FG4 A;  1W89 A;  2C0D A;  2LQO A;  1KEB A;  2L5O A;  4MA9 A;  3TRQ A;  5CAX A;  3FHK A;  3QFA C;  3TKQ A;  5ECI B;  5EVO A;  4RUV A;  1XFL A;  2GLR A;  3VI7 A;  5J3R A;  2R2J A;  1ZYQ B;  1XBS A;  5B6M A;  4H86 A;  3UL3 A;  4MJC A;  4KGI A;  3D4T A;  3GSS A;  3KM6 A;  2CVD A;  1H4O A;  2IFQ A;  2BMX A;  3ISO A;  1JZO A;  1YZX A;  3KP9 A;  4EKZ A;  1YEX A;  1HYU A;  3TJG A;  5DQS A;  4G0L A;  4MPF A;  3BBY A;  1AAZ A;  2HNL A;  3G7I A;  3J7Y k;  2XHF A;  4G10 A;  1B4Q A;  3TRP A;  1K0O A;  4IP6 A;  3IA1 A;  3L9V A;  4FQU A;  2GSS A;  3GMF A;  4NXI A;  2OJL A;  3KTB A;  1JZR A;  3IE3 A;  4FYB A;  2VD0 A;  3IDV A;  5J4U A;  1TK8 B;  2GST A;  5KN1 A;  2PUK C;  1HNB A;  6GSU A;  4IKH A;  4YAP A;  1EEJ A;  1PRX A;  4XS6 A;  1OVN A;  2K9F A;  4BVX A;  4MK3 A;  3KP8 A;  4WBR D;  5ABR A;  5HR0 A;  3FYG A;  1FAA A;  3TB2 A;  7GSS A;  5IIZ A;  3TJJ A;  4ACS A;  5EL8 A;  4AJ8 A;  3HYP A;  2RUF A;  1SEN A;  4K7I A;  2B3S A;  2MMN A;  1G7E A;  1Z5Y E;  4IP1 A;  2PVO C;  4G0I A;  1YQ1 A;  2GS3 A;  1MDI A;  2CX4 A;  3N9J A;  2NBS A;  1B8X A;  1B9Y C;  3IOS A;  1GLQ A;  4IHU A;  3KH7 A;  2MBS A;  2FA8 A;  3A2W A;  2I81 A;  6GSY A;  3GTU B;  1T4Y A;  3LJR A;  4TOP A;  1K3L A;  4QL9 A;  6GSX A;  1ILO A;  3E0U A;  5IMA A;  4HOJ A;  3ZML A;  2YZU A;  16GS A;  3IC8 A;  2WUL A;  2L6D A;  4OD7 A;  4KF9 A;  2AYT A;  1I9D A;  3EC3 A;  3PIN A;  4BVY B;  5GSS A;  3UIW A;  2PER A;  2IMI A;  5CRG A;  3UAR A;  2YAN A;  1BQ7 A;  3C73 A;  3GH6 A;  3HDC A;  1QGV A;  1F3B A;  4GTU A;  2IMK A;  2O89 A;  4KE3 A;  2H0I A;  4KH7 A;  1O7U A;  3HCZ A;  2UZ8 A;  1WPI A;  3G9B A;  1SK0 A;  3DVW A;  5DBQ A;  4I8B A;  4WEY A;  3ZL5 A;  4K7O A;  4TRX A;  4QL7 A;  2FUG 2;  1U6T A;  2I1U A;  3H93 A;  4ML6 A;  2JAD A;  1X0R A;  3DVX A;  3VWX A;  4XRA A;  2L57 A;  3UJ1 A;  4ZBA A;  1EV4 A;  2XPD A;  2Z9S A;  5IO2 A;  4PX1 A;  2VL2 C;  2FNO A;  2VLT A;  4GQC A;  5HQP A;  1AXD A;  4F82 A;  2LST A;  3FK8 A;  2HYX A;  1I5G A;  3IK9 A;  2HXK A;  3DWV A;  3QAW A;  2IME A;  3KGK A;  2O7K A;  1Z3E A;  3H79 A;  4RQX A;  9GSS A;  1XWC A;  2C0E A;  1HNC A;  2JSZ A;  2OAD A;  1MEK A;  5A4V A;  2WGR A;  3NOF A;  3WGD A;  2CZ3 A;  5KN0 A;  5LCZ A;  1GTA A;  2V32 A;  3BCK A;  5FHI A;  1K3Y A;  3LG6 A;  1TU7 A;  2H1G A;  3GRX A;  3I43 A;  4ECC A;  4YH2 A;  5J41 A;  5F06 A;  1X9S B;  1ERU A;  2DJJ A;  4XIH A;  2IWT A;  3LEF A;  1F2E A;  5ECL B;  3CTF A;  1UVZ A;  5G5F A;  2LTK A;  2V6K A;  4TR1 B;  5ECQ B;  5FWG A;  3LYP A;  3APO A;  4NAX A;  1PD2 1;  1NSW A;  2DJ2 A;  2MYG A;  3ZVJ D;  2C1Y A;  1TI1 A;  3BJ5 A;  1GTI A;  3BOA A;  4IBP A;  2KOK A;  5C04 A;  4AJ6 A;  4D73 A;  1O73 A;  3TKR A;  1BED A;  1OC9 B;  1SKW B;  3ZIT A;  4MDC A;  4IS0 A;  5KN3 A;  2HRN A;  4TXO A;  1VF1 A;  3P7X A;  2C4J A;  4O7H A;  5AIV A;  4KND A;  1GSD A;  2YPM A;  3TKP A;  4TW5 A;  3M9J A;  3GKM A;  5ECH B;  2CZ2 A;  4I97 A;  1ZL9 A;  5A4U A;  3GH9 A;  5GST A;  1OC3 A;  5IOX A;  4IVF A;  2DML A;  5CRW A;  1GUK A;  2A2S A;  1DBY A;  4WBJ A;  2GZZ A;  3VWU A;  1AC1 A;  2MMZ A;  2F8A A;  1PA3 A;  3GNJ A;  4XS4 B;  4DSS B;  3MAK A;  19GS A;  2ON5 A;  3IXR A;  1TI3 A;  1XIY A;  4KUN A;  1GLP A;  4V2L A;  1H75 A;  4G9H A;  4HZ2 A;  3GYK A;  4E8H A;  1S3C A;  1T00 A;  2H1B A;  2GTU A;  3CSJ A;  2GGT A;  3NZN A;  5B8A A;  3ZIV A;  1HNA A;  3GST A;  5D9V A;  3EE2 A;  3MNG A;  4DSS A;  1K3O A;  3US3 A;  5H5Q A;  1ST9 A;  3E3E A;  1AW9 A;  4IN0 A;  2DJK A;  4N10 A;  2O8V B;  3EMX A;  2GQL A;  1AIU A;  1A0F A;  5IMZ A;  2DSA A;  3A2V A;  1M9A A;  2KUC A;  4WKW A;  4EDY A;  2YWN A;  5JWQ B;  2HSN B;  4IGJ A;  1FO5 A;  4G2E A;  5HFG A;  4N11 A;  4IQ1 A;  4NV2 A;  4OMV A;  4MH2 A;  4K6X A;  3GX0 A;  1QFN A;  5JWR B;  2OBK A;  2M72 A;  3GL5 A;  1NM3 A;  3EMP A;  2M46 A;  3M0F A;  5H5S A;  2F51 A;  5G1K A;  3UVT A;  14GS A;  3LSZ A;  5ELA A;  3I6A A;  2IMF A;  1TRS A;  3QAG A;  1GNE A;  2F3M A;  1ML6 A;  4JR4 A;  1DSB A;  5BMU A;  2VOC A;  5AIS A;  2K8V A;  3LQ7 A;  3HZ8 A;  1XW5 A;  3H4K A;  3SWL A;  2JZS A;  1PSQ A;  2JSY A;  2MMO A;  2K8S A;  2VLV A;  3VWV A;  3TJB A;  1VGL A;  3D5J A;  5F8B A;  2H0G A;  3WGX A;  3ZLP A;  2P0G A;  3DRN A;  5IMF A;  1Q98 A;  4NHZ A;  1CQH A;  1ZGN A;  2LRC A;  2XC2 A;  3EWL A;  2CA8 A;  1YKC A;  2HSM A;  3RAZ A;  1WE0 A;  2REM A;  1DE2 A;  2GT5 A;  5D9W A;  1SL0 B;  5HFI A;  3EUR A;  2WRT A;  4K8M A;  2AHE A;  13GS A;  1MD4 A;  1ZYE A;  4HJ2 A;  5EPF A;  2J9H A;  3ME8 A;  3QR6 A;  4TVE A;  4GXZ A;  5G31 A;  1T8E B;  2WJU A;  4MZW A;  5DAK A;  2DMM A;  4N0Z A;  1XW9 A;  5DCH A;  4KAE A;  1EZK A;  2IIY A;  2LKU A;  1PMT A;  4TKY A;  4GCI A;  2HZE A;  3TRX A;  3UAP A;  4IJI A;  1Z7R A;  2IFQ B;  4WF5 A;  2NVL A;  1OE7 A;  3GKX A;  4TR4 A;  3HA9 A;  3IAM 2;  2YP6 A;  4AGS A;  4L0W A;  4K1F A;  2X64 A;  2YOI A;  5JWO B;  4F0C A;  2HRF A;  2YWI A;  2EIQ A;  5D9X A;  1RW1 A;  3CSI A;  1Z6M A;  5ID2 A;  2HQT A;  4V2M A;  1R7H A;  3GX8 A;  4OCE A;  3F0I A;  10GS A;  1BJX A;  4O92 A;  3DXB A;  1F6M C;  4PNG A;  4L0U A;  4L5O A;  3W6G A;  3HXS A;  2LEG A;  2EIO A;  1BG5 A;  2X8C A;  4I2T A;  3RDW A;  1SU9 A;  4N30 A;  2FA4 A;  3N5O A;  4F9Z A;  2TIR A;  5DCG A;  1JLV A;  1PX7 A;  1BYE A;  5D9T A;  4BVX B;  4MZC A;  4GQF A;  3FEU A;  3L4N A;  2YJ7 A;  3W8S A;  5LNK e;  5G30 A;  4X43 A;  4YQM A;  3F6F A;  4K7N A;  4XCS A;  2VCT A;  3UBL A;  3GKN A;  3ME7 A;  4MJB A;  8GSS A;  4JZQ A;  2H6Y A;  2JZT A;  2NDO A;  4JR6 A;  3IHQ A;  1MD3 A;  3F8U A;  3RHC A;  3BCI A;  4DSR A;  1G6W A;  1OC8 A;  1M9B A;  2B6M A;  2O85 A;  4TR3 A;  2FLS A;  2YJH A;  3UVH A;  5HR3 A;  5DJM A;  4JE1 A;  1PL2 A;  3MWH A;  3LOR A;  1WP0 A;  1TKD B;  1X5D A;  2H8L A;  4OFM A;  2C80 A;  3V1W A;  2DIY A;  2CT6 A;  4OWY A;  2FGX A;  2YN1 A;  3TKS E;  1G6Y A;  2VL2 A;  3ZMK A;  4POM A;  2CV4 A;  1ZZY A;  2KP2 A;  4TXV A;  2L6C A;  2OE1 A;  2LNT A;  2G0F A;  4I5Q A;  2H66 A;  3F4S A;  4HUA A;  12GS A;  3GN3 A;  5ECK B;  6GSW A;  2VAF A;  4YQV A;  2FD3 A;  1K0A A;  4HU9 A;  5JCU A;  4HQS A;  4ECI A;  1IYI A;  1Z6N A;  2M80 A;  1LBK A;  3CXG A;  3L9U A;  4L8E A;  4ZL7 A;  3UMA A;  1NW2 A;  2AUV A;  1CQG A;  3QAV A;  3IAS 2;  3M1G A;  1YJ6 A;  4EVM A;  3LFL A;  1GNW A;  3P8W A;  4GSN A;  2LS5 A;  2G2Q A;  3GL3 A;  3PR8 A;  1G7O A;  2GQK A;  4EUY A;  22GS A;  2WDU A;  5IMD A;  1EP8 A;  2H6X A;  3KH9 A;  2BTO T;  3F6D A;  5DQY A;  5J5N A;  2F8F A;  2P31 A;  4WR5 A;  3GKK A;  1MDJ A;  3UEM A;  4NWY A;  1T7P B;  3D4M A;  1Y6E A;  3DYR A;  3ZVJ A;  2LV3 A;  2WS2 A;  2LNS A;  5AGY A;  1KNG A;  1OE8 A;  5DVB A;  1XZO A;  1YKA A;  4Q5Q A;  3ERG A;  4MCU A;  4PUR A;  3O6T A;  1FVJ A;  2AB6 A;  1HQO A;  3DKS A;  2DBC A;  1GSE A;  2H01 A;  4FO5 A;  1M7T A;  2YNX A;  2VCQ A;  4HU7 A;  3HVS A;  3C1S A;  1K0D A;  1W4V A;  3FZ4 A;  3IV4 A;  1EGO A;  3EVI A;  3FRC A;  4XHM A;  2K18 A;  3TOT A;  5G5E A;  2CQ9 A;  1WWJ A;  3FW2 A;  1TXX A;  3KXO A;  3VPQ A;  3F9U A;  4ID0 A;  2MBT A;  2B5X A;  3R3E A;  4MF5 A;  4K2D A;  4F03 A;  2LJA A;  2E7P A;  2E0Q A;  1AQX A;  1E2Y A;  2QC7 A;  5F0G A;  3ZZX A;  1DE1 A;  2LJK A;  1XWK A;  2RM6 A;  4PGT A;  2E2G A;  3DGQ A;  2H1A A;  5HR1 A;  3HJO A;  1ABA A;  5FT3 A;  5ECO B;  4MPG A;  4XRD A;  5IQY A;  4V1A p;  5D96 A;  5A5K A;  1OKT A;  3MDK A;  4KCA A;  3LYK A;  4AF2 A;  4DEJ A;  1M2D A;  4JRR A;  4D73 B;  1K0M A;  4PQI A;  1XPV A;  4GSS A;  3VPT A;  3LGC A;  5ECP B;  3TGZ A;  4TXO B;  3IBH A;  3CRU A;  2VM2 A;  5LD0 A;  5CRH A;  1SKS B;  2L59 A;  2FCH A;  1THX A;  5CNW A;  1TRU A;  1FOV A;  3TCO A;  5DDL A;  4ULX A;  3UBK A;  5HR2 A;  2AAW A;  5J9C A;  2LJR A;  4XS1 A;  3CYN A;  2ON7 A;  6GST A;  2VCZ A;  1XOA A;  1O6J A;  1U3A A;  2HZF A;  4TN8 A;  3ZTL A;  5ECM B;  5CRD A;  1YY7 A;  1O8W A;  3K8N A;  2TRC P;  4GLT A;  4HZ4 A;  3PGT A;  2OAC A;  3HVX A;  4ZIL A;  4GF0 A;  2XBQ A;  3VWW A;  4V2N A;  1XXU A;  1SK2 A;  4NHW A;  1F3A A;  1X5E A;  2H19 A;  1V98 A;  1RK4 A;  4MAB A;  2MMA A;  1SD9 A;  1ZOF A;  2LUS A;  2VIM A;  4CHS A;  1URM A;  4ISD A;  2N5F A;  1B4P A;  1UN2 A;  2VL3 A;  4KSM A;  4MJE A;  2DJ3 A;  4TR0 A;  1IYH A;  3FR9 A;  4LMW A;  3P2A A;  3ERF A;  3NIV A;  4OO5 A;  4KCE A;  3G7Y A;  3FY7 A;  4F0B A;  4ZIJ A;  2H74 A;  4X0X A;  3TUE A;  1T4Z A;  3GHA A;  1XW6 A;  1X9M B;  1QUW A;  2VUP A;  4KSO A;  4BPY A;  2YWO A;  3GUS A;  2FWH A;  1YF0 A;  3EIN A;  1OKD A;  1SYX A;  2H71 A;  1JLW A;  2RLI A;  1THO A;  2C3Q A;  4YQU A;  3CBU A;  1UC7 A;  3KJY A;  2RM5 A;  4GRF A;  4I2U A;  4Q5R A;  5J9B A;  2HSM B;  2R5G A;  1TRV A;  3EU3 A;  3RHB A;  5IPH A;  1K0C A;  4HI7 A;  4POK A;  2JZR A;  2NTO A;  3C8E A;  4ZB6 A;  1EEM A;  1AUC A;  3C7M A;  4LMV A;  5IM9 A;  1BX9 A;  1XWA A;  1WIK A;  1M2A A;  2JL4 A;  3WT1 A;  5DAK B;  2LRN A;  5H5R A;  1R5P A;  5D8I A;  3DEX A;  2AV4 A;  3U5R E;  2R6K A;  2HZE B;  1U88 A;  4ILF A;  1X5C A;  5DAL A;  1WRY A;  2H30 A;  4HS1 A;  3QMX A;  2BJX A;  2DIZ A;  3F3R A;  4Q5N A;  5D73 A;  2GZP A;  2X99 A;  3RBT A;  4ML1 A;  3WT2 A;  3U6V A;  4LL4 B;  5GAP D;  1A23 A;  5ID2 B;  1QK8 A;  1A0R P;  4ECB A;  4EF0 A;  4EXJ A;  4KX4 A;  2C0G A;  1EGR A;  1NHO A;  2VCX A;  2B1K A;  1TP9 A;  4BL7 A;  1SKR B;  3FR3 A;  2LRT A;  1E6B A;  3TJF A;  1SJ6 A;  2L4C A;  3BD2 A;  2K6V A;  3HJP A;  1FB6 A;  4LL1 B;  2HRA A;  2KP1 A;  3KMO A;  1TJD A;  4MZB A;  2WFC A;  4PQH A;  4O5R A;  3ED3 A;  2PVQ A;  2HRK A;  4P3Y B;  1N2A A;  3F4R A;  1AQV A;  2GSR A;  3Q74 A;  2B7K A;  1GRX A;  2P5R A;  3M9K A;  2B1L A;  1TW9 A;  3TJK A;  1XCC A;  3TOU A;  2QKE A;  5B8B A;  5HFK A;  2VM1 A;  2YV7 A;  3APS A;  1VF4 A;  4KDX A;  3GUR A;  4X1U A;  1GTU A;  3RPN A;  2PGT A;  1XWB A;  1T1V A;  5GAN D;  2V2G A;  3PPU A;  4O32 A;  2PBJ A;  2H76 A;  1EP7 A;  6GSS A;  2JU5 A;  3A5W A;  5ELG A;  1JZW A;  4RI7 A;  1GTB A;  3R2Q A;  1XWG A;  2CVK A;  1C72 A;  3IK7 A;  4BA7 A;  2ES7 A;  3S9F A;  4OO4 A;  4FYU A;  2CX3 A;  2PMT A;  1M0U A;  2VL9 A;  1SL1 B;  1A24 A;  3F3Q A;  4IQA A;  4USS A;  2XBI A;  2HSY A;  3KZQ A;  4KDU A;  4G19 A;  4MF7 A;  4HQZ A;  2GDR A;  3HY2 A;  1QMV A;  2VCV A;  2WB9 A;  1GSY A;  4XTS A;  1UA5 A;  4FH8 A;  3D22 A;  1Z7P A;  4EC0 A;  2A4V A;  2IL3 A;  2CVB A;  3WD6 A;  1A2M A;  2C8U A;  3FZ5 A;  2YV9 A;  3L78 A;  4ZB9 A;  1MTC A;  1O8X A;  1TK5 B;  3WYW A;  1DUG A;  5E4W A;  1PKW A;  1J0F A;  3AY8 A;  5E59 A;  5IPG A;  1WMJ A;  3QFB C;  3O76 A;  4EDZ A;  2V6O A;  3JCM L;  4MMM A;  3EYT A;  3GIX A;  4K9Z A;  1K0N A;  2OE0 A;  5D93 A;  2H73 A;  4N0V A;  1PN9 A;  2JAC A;  4EL1 A;  4K0N A;  2WCI A;  4MP4 A;  3ZFB A;  3FZ9 A;  4QQ7 A;  5IMC A;  3OR5 A;  3HD5 A;  5AN1 A;  3Q6O A;  4HJM A;  2YWM A;  1F9M A;  4MF6 A;  3D21 A;  2OBI A;  4PNF A;  3KIJ A;  2EC4 A;  5ENU A;  2B7J A;  3LXT A;  3HJM A;  1EOG A;  4J2F A;  1JZD A;  1SJI A;  3CMI A;  3IC4 A;  1TDI A;  1PKZ A;  4GWR A;  2PPT A;  1TK0 B;  1O81 A;  3M8N A;  4ZL8 A;  3WGE A;  3UOM A;  1V2A A;  4IEL A;  2PWJ A;  1M2B A;  2L4Q A;  3D6I A;  3KTL A;  4LA1 A;  3C71 A;  2FWG A;  4GST A;  2ZNM A;  4JBB A;  2WZ9 A;  3GV1 A;  3EU4 A;  2V41 A;  1V9W A;  5C00 A;  2VCW A;  3PH9 A;  1WJK A;  3DIE A;  1SYR A;  4V1A g;  2YZH A;  5L71 A;  1GSF A;  3L0H A;  3GTU A;  4WF4 A;  1PGT A;  1JHB A;  1PX6 A;  2DJ0 A;  3HHV A;  4RI6 A;  4DSQ A;  3IR4 A;  1ACV A;  1TTZ A;  5GZZ B;  4ZB8 A;  1TOF A;  5IOW A;  2V1M A;  5AIX A;  1QXH A;  1R5A A;  4AJ7 A;  1R4W A;  4BVY A;  1GUH A;  2OKA A;  4EO3 A;  1PQN A;  1XVW A;  4ECJ A;  4HEA 2;  3LXZ A;  1KTE A;  4G0K A;  2B5E A;  2P5Q A;  5G2Z A;  1EV9 A;  4WR4 A;  2HT9 A;  4KB3 A;  1U87 A;  2RUE A;  2GQM A;  3F63 A;  4I6X A;  6GSV A;  2HSH A;  1Y25 A;  1GUL A;  3M3M A;  5CP1 A;  4POL A;  2CAI A;  2X8H A;  1QQ2 A;  2PN8 A;  2HLS A;  3A2X A;  4PUA A;  4OFN A;  2LQQ A;  3CSH A;  2DLX A;  2I4A A;  5CYY A;  3C1R A;  4L5L A;  18GS A;  5G1L A;  2ZCT A;  4PTS A;  1LU4 A;  3L9S A;  1GL8 A;  2XPE A;  2DJ1 A;  3FZA A;  3IPZ A;  4ZL9 A;  1OAZ A;  1EWX A;  3VLN A;  4IW9 A;  1F37 A;  1SJZ A;  2F9S A;  1WOU A;  2N5B A;  2KHP A;  1FVK A;  3VK9 A;  4IJ3 A;  3I69 A;  1FW1 A;  1NHY A;  1ZMA A;  2DC5 A;  4F2I A;  2TRX A;  4POB A;  3HVV A;  5ECR B;  1USB A;  1S3D A;  4PXO A;  3ZFL A;  3HZ4 A;  5IO0 A;  1XOB A;  5F05 A;  2VLU A;  5EY6 A;  2I3Y A;  3O3T A;  3KD0 A;  1YEP A;  3D0Z A;  1ERT A;  5IMV A;  5KN2 A;  2A2R A;  1OYJ A;  1U3I A;  1GSQ A;  4ZBD A;  3TKS A;  3P90 A;  2OE3 A;  2E2M A;  5F07 A;  1Z9H A;  1BAY A;  3VI5 A;  3J7Y b;  5A4W A;  1FHE A;  1J08 A;  4WET A;  1GSS A;  11GS A;  1VF2 A;  2QSI A;  1B9X C;  1ERW A;  5JCG A;  2FY6 A;  4NMU A;  4KDY A;  2GVP A;  4FIW A;  2AJQ B;  4OCF A;  1TU8 A;  1GSU A;  2OA7 A;  1A8Y A;  1A8L A;  1LJR A;  3ZRD A;  5DJL A;  4TR1 A;  2ZUP A;  5CRE A;  4Q5F A;  4J56 E;  1SD8 A;  4DVC A;  3VUR A;  1XVQ A;  2IJY A;  3KMN A;  1FB0 A;  4WXT A;  4PUF C;  3CTG A;  3KEB A;  2YCD A;  4CW9 A;  2X8G A;  1B48 A;  1OC9 A;  4KA0 A;  3QDN A;  3MSZ A;  5CO3 A;  2J23 A;  2KLX A;  4HDE A;  5COH A;  2H72 A;  1TRW A;  3DD3 A;  2IN3 A;  2R4V A;  1EOH A;  3SBC A;  2R37 A;  5JCW A;  1SL2 B;  2C3T A;  1HD2 A;  1R26 A;  3CRT A;  3QPM A;  2PU9 C;  4YAV A;  1X9W B;  2VO4 A;  2GSQ A;  1PL1 A;  2H75 A;  3GFK A;  1T3B A;  4KW6 A;  3QOU A;  17GS A;  4PQ1 A;  1J9B A;  1GH2 A;  2HFD A;  4NV5 A;  3IRA A;  4BWQ A;  4E8E A;  4MLY A;  4XS4 A;  4Z7X A;  1GUM A;  2VD1 A;  2B5Y A;  2R3X A;  5ECS A;  2C3N A;  1Q4J A;  3ZRE A;  1RQM A;  3W8J A;  2NPB A;  3APQ A;  2QGV A;  2N5A A;  1KBN A;  3FKF A;  3TKS C;  2HI7 A;  3DML A;  3Q19 A;  1MDK A;  2ALB A;  2C0F A;  3GA4 A;  3QD9 A;  2GZY A;  4CDO A;  3FR6 A;  5DAL B;  2FWE A;  4OFT A;  1A2J A;  1K0B A;  2O87 A;  2GT6 A;  3HKR A;  3ZYW A;  3I9V 2;  1N8J A;  5ECN B;  4LLR A;  3G7J A;  3E9J B;  2HE3 A;  4ZBB A;  2I9H A;  5B6N A;  2H6Z A;  3VFI A;  1YF1 A;  4JU5 A;  4BWS A;  5INY A;  1V40 A;  4JED A;  1G0T A;  2H70 A;  3KCM A;  3H1N A;  5B7C A;  4BL7 B;  1M99 A;  1O85 A;  2MZC A;  2L5L A;  3LWA A;  4MJA A;  3A3T A;  4J57 E;  1YDK A;  1ERV A;  1A2L A;  2FWF A;  20GS A;  2IMD A;  4EE0 A;  1ON4 A;  2CAQ A;  1JFU A;  3F4T A;  1VF3 A;  2EIR A;  4MH3 A;  2HRK B;  2H0H A;  3TDG A;  1ZCP A;  4FYC A;  2D2Z A;  2FHE A;  2IPA A;  1SK1 A;  3H8Q A;  1S3A A;  3RPP A;  4NPB A; 
#chains in the Genus database with same CATH topology
 4ZXG A;  1V57 A;  4RQR A;  1SVL A;  3QCP A;  4K0G A;  1AQW A;  1GP1 A;  3ERW A;  3ZIJ A;  2R0G A;  5KEJ A;  2RII A;  3Q18 A;  1VRS D;  1V58 A;  1GWC A;  2H1D A;  1FG4 A;  1W89 A;  2C0D A;  2LQO A;  1KEB A;  2L5O A;  4MA9 A;  3TRQ A;  1ZYN A;  4K5R A;  4YKF A;  5CAX A;  3FHK A;  3QFA C;  3TKQ A;  5ECI B;  5EVO A;  4RUV A;  1XFL A;  2GLR A;  3VI7 A;  5J3R A;  2R2J A;  1ZYQ B;  1XBS A;  5B6M A;  4H86 A;  3UL3 A;  4MJC A;  4KGI A;  3D4T A;  1M3J A;  3GSS A;  3KM6 A;  1PN0 A;  2CVD A;  1H4O A;  2IFQ A;  2BMX A;  2OT3 A;  3ISO A;  1JZO A;  1YZX A;  3KP9 A;  4EKZ A;  1YEX A;  1HYU A;  3TJG A;  5DQS A;  4G0L A;  4MPF A;  3BBY A;  2QA1 A;  1AAZ A;  2HNL A;  3G7I A;  3J7Y k;  2XHF A;  4G10 A;  1B4Q A;  1Y1U A;  3TRP A;  1K0O A;  4IP6 A;  3IA1 A;  3L9V A;  4FQU A;  2GSS A;  3RFR C;  3GMF A;  4PHZ C;  4NXI A;  2OJL A;  3KTB A;  1JZR A;  3IE3 A;  4FYB A;  2VD0 A;  1YEW C;  3IDV A;  5J4U A;  1TK8 B;  2GST A;  5J4Y A;  5KN1 A;  2PUK C;  1HNB A;  6GSU A;  4IKH A;  4YAP A;  1EEJ A;  1PRX A;  4XS6 A;  1OVN A;  2K9F A;  4BVX A;  4MK3 A;  3KP8 A;  4WBR D;  5ABR A;  5HR0 A;  3FYG A;  1FAA A;  3TB2 A;  7GSS A;  5IIZ A;  3TJJ A;  4ACS A;  5EL8 A;  4AJ8 A;  3HYP A;  2RUF A;  1SEN A;  4K7I A;  2B3S A;  2MMN A;  1G7E A;  1Z5Y E;  4IP1 A;  2PVO C;  4G0I A;  1YQ1 A;  2GS3 A;  1MDI A;  2CX4 A;  3N9J A;  2NBS A;  1B8X A;  1B9Y C;  3IOS A;  1GLQ A;  4IHU A;  3KH7 A;  2MBS A;  2FA8 A;  3A2W A;  2I81 A;  6GSY A;  3GTU B;  1T4Y A;  3LJR A;  4TOP A;  2R0C A;  1K3L A;  4QL9 A;  6GSX A;  1ILO A;  3E0U A;  5IMA A;  4HOJ A;  4W66 A;  3ZML A;  2YZU A;  16GS A;  3IC8 A;  2WUL A;  2L6D A;  4OD7 A;  2R0P A;  4KF9 A;  2AYT A;  4K5S A;  1I9D A;  3EC3 A;  3PIN A;  4BVY B;  5GSS A;  3UIW A;  2PER A;  2IMI A;  5CRG A;  3UAR A;  2YAN A;  1BQ7 A;  3C73 A;  3GH6 A;  3HDC A;  1QGV A;  1F3B A;  4GTU A;  2IMK A;  2O89 A;  4KE3 A;  2H0I A;  4KH7 A;  1O7U A;  3HCZ A;  2UZ8 A;  1WPI A;  3G9B A;  1SK0 A;  3DVW A;  5DBQ A;  4I8B A;  4WEY A;  1BF5 A;  3ZL5 A;  4K7O A;  4TRX A;  4QL7 A;  2FUG 2;  1U6T A;  2I1U A;  4ZB7 A;  4G01 A;  3H93 A;  4ML6 A;  2JAD A;  1X0R A;  3DVX A;  3VWX A;  4XRA A;  2L57 A;  3UJ1 A;  2A2P A;  4ZBA A;  1EV4 A;  2XPD A;  2Z9S A;  5IO2 A;  4PX1 A;  2H1L A;  2VL2 C;  2FNO A;  5A5H A;  2VLT A;  4GQC A;  5HQP A;  1AXD A;  5J40 A;  2X4A A;  4F82 A;  2LST A;  2DKH A;  3FK8 A;  2HYX A;  1I5G A;  3IK9 A;  2HXK A;  3DWV A;  3QAW A;  2IME A;  3KGK A;  2O7K A;  1Z3E A;  3H79 A;  5A1N A;  4RQX A;  9GSS A;  1XWC A;  2C0E A;  1HNC A;  2JSZ A;  2OAD A;  1MEK A;  5A4V A;  2WGR A;  3NOF A;  3WGD A;  2CZ3 A;  5KN0 A;  5LCZ A;  1GTA A;  2V32 A;  3BCK A;  5FHI A;  1K3Y A;  3LG6 A;  1TU7 A;  2H1G A;  3GRX A;  3I43 A;  4ECC A;  4YH2 A;  5J41 A;  5F06 A;  1X9S B;  1ERU A;  2DJJ A;  4XIH A;  2IWT A;  3LEF A;  1F2E A;  5ECL B;  3CTF A;  1UVZ A;  5G5F A;  2LTK A;  2V6K A;  4TR1 B;  5ECQ B;  2WW2 A;  3MIX A;  5FWG A;  3LYP A;  3APO A;  4NAX A;  1PD2 1;  1NSW A;  2DJ2 A;  2MYG A;  3ZVJ D;  2C1Y A;  1TI1 A;  3BJ5 A;  1GTI A;  3BOA A;  4IBP A;  4PI0 C;  2KOK A;  5C04 A;  4AJ6 A;  4D73 A;  2O3E A;  1O73 A;  3TKR A;  1BED A;  1OC9 B;  1SKW B;  3ZIT A;  4MDC A;  4IS0 A;  5KN3 A;  2HRN A;  4TXO A;  1VF1 A;  3P7X A;  2C4J A;  4O7H A;  5AIV A;  4KND A;  1GSD A;  2YPM A;  3TKP A;  4TW5 A;  3M9J A;  3GKM A;  5ECH B;  2CZ2 A;  4I97 A;  1ZL9 A;  5A4U A;  3GH9 A;  5GST A;  1OC3 A;  5IOX A;  4IVF A;  2DML A;  5CRW A;  1GUK A;  2A2S A;  1DBY A;  4WBJ A;  2GZZ A;  3VWU A;  1AC1 A;  2MMZ A;  2F8A A;  1PA3 A;  3GNJ A;  4XS4 B;  4DSS B;  3MAK A;  19GS A;  2ON5 A;  3IXR A;  1TI3 A;  1XIY A;  4KUN A;  1GLP A;  4V2L A;  1H75 A;  4G9H A;  4HZ2 A;  3GYK A;  4E8H A;  1S3C A;  1T00 A;  2QA2 A;  2H1B A;  2GTU A;  3CSJ A;  2GGT A;  3NZN A;  5B8A A;  1XG8 A;  3ZIV A;  3LW9 A;  1HNA A;  4QMK A;  3GST A;  5D9V A;  3EE2 A;  3MNG A;  4DSS A;  1K3O A;  1PFO A;  3US3 A;  5H5Q A;  1ST9 A;  3E3E A;  1AW9 A;  4IN0 A;  1SVM A;  2DJK A;  4N10 A;  2O8V B;  3EMX A;  2GQL A;  1AIU A;  1A0F A;  3CQF A;  5IMZ A;  2DSA A;  3A2V A;  1ZYP A;  1M9A A;  2KUC A;  4WKW A;  4EDY A;  2YWN A;  5JWQ B;  2HSN B;  4PI2 C;  4IGJ A;  1FO5 A;  4G2E A;  5HFG A;  4N11 A;  4IQ1 A;  4NV2 A;  4AKX B;  2UV8 G;  4OMV A;  4O5Q A;  4MH2 A;  4K6X A;  3GX0 A;  1QFN A;  5JWR B;  2OBK A;  2M72 A;  3GL5 A;  1NM3 A;  3EMP A;  2M46 A;  3M0F A;  5H5S A;  2F51 A;  5G1K A;  3UVT A;  14GS A;  3LSZ A;  5ELA A;  3I6A A;  2IMF A;  1TRS A;  3QAG A;  1GNE A;  2F3M A;  1ML6 A;  4JR4 A;  2EFE A;  1DSB A;  5BMU A;  2VOC A;  5AIS A;  2K8V A;  3LQ7 A;  3HZ8 A;  2HSN A;  1XW5 A;  3H4K A;  3SWL A;  2JZS A;  1PSQ A;  2JSY A;  2MMO A;  2K8S A;  2VLV A;  3VWV A;  3TJB A;  1VGL A;  3D5J A;  5F8B A;  2H0G A;  3WGX A;  3ZLP A;  2P0G A;  3DRN A;  1S4B P;  5IMF A;  1Q98 A;  4NHZ A;  1CQH A;  1ZGN A;  2LRC A;  2XC2 A;  3EWL A;  2CA8 A;  1YKC A;  2HSM A;  3RAZ A;  1WE0 A;  2REM A;  1DE2 A;  2GT5 A;  5D9W A;  1SL0 B;  5HFI A;  3EUR A;  2WRT A;  4K8M A;  2AHE A;  13GS A;  1MD4 A;  1ZYE A;  4HJ2 A;  5EPF A;  2J9H A;  3ME8 A;  3QR6 A;  4AKH A;  4TVE A;  4GXZ A;  5G31 A;  1T8E B;  2WJU A;  4MZW A;  5DAK A;  2WVX B;  2DMM A;  4AI6 A;  4N0Z A;  1XW9 A;  5DCH A;  4KAE A;  1EZK A;  2IIY A;  2LKU A;  1PMT A;  4TKY A;  4GCI A;  2HZE A;  3TRX A;  3UAP A;  4IJI A;  1Z7R A;  2IFQ B;  4WF5 A;  4K2X A;  2NVL A;  1OE7 A;  3GKX A;  4TR4 A;  3HA9 A;  3IAM 2;  2YP6 A;  4AGS A;  4L0W A;  4K1F A;  2X64 A;  2YOI A;  5JWO B;  4F0C A;  2HRF A;  2YWI A;  2EIQ A;  5D9X A;  2WVX A;  1RW1 A;  3CSI A;  1Z6M A;  5ID2 A;  4EIP A;  2HQT A;  4V2M A;  1R7H A;  1TXU A;  3GX8 A;  4OCE A;  3F0I A;  10GS A;  1BJX A;  4O92 A;  3DXB A;  1F6M C;  2VKZ G;  4PNG A;  2WW3 A;  4L0U A;  4L5O A;  3W6G A;  3HXS A;  2LEG A;  2EIO A;  1BG5 A;  2X8C A;  4I2T A;  3RDW A;  1SU9 A;  3A5I A;  4N30 A;  2FA4 A;  3N5O A;  4F9Z A;  4FXY P;  2TIR A;  5DCG A;  1JLV A;  1PX7 A;  1BYE A;  5D9T A;  4BVX B;  4MZC A;  4GQF A;  3FEU A;  3L4N A;  2YJ7 A;  3W8S A;  5LNK e;  5G30 A;  4X43 A;  4YQM A;  3F6F A;  4K7N A;  4XCS A;  2VCT A;  3UBL A;  3GKN A;  3ME7 A;  4MJB A;  8GSS A;  4JZQ A;  2H6Y A;  2JZT A;  2NDO A;  4JR6 A;  3IHQ A;  1MD3 A;  3F8U A;  3RHC A;  3BCI A;  4DSR A;  1G6W A;  1OC8 A;  1M9B A;  2B6M A;  2O85 A;  4TR3 A;  2FLS A;  2YJH A;  3UVH A;  5HR3 A;  5DJM A;  4JE1 A;  5KOW A;  1PL2 A;  3TU3 B;  3MWH A;  3LOR A;  2WVZ A;  1WP0 A;  1TKD B;  1X5D A;  2H8L A;  4OFM A;  2C80 A;  3V1W A;  2DIY A;  2CT6 A;  4OWY A;  2FGX A;  2YN1 A;  2WZS A;  3TKS E;  1G6Y A;  2VL2 A;  3ZMK A;  4POM A;  2CV4 A;  1ZZY A;  2KP2 A;  4TXV A;  2L6C A;  2WW0 A;  2OE1 A;  2LNT A;  2G0F A;  4O5U A;  4I5Q A;  2H66 A;  3F4S A;  4HUA A;  12GS A;  3GN3 A;  5ECK B;  6GSW A;  2VAF A;  2WVY A;  4YQV A;  2FD3 A;  1K0A A;  4HU9 A;  5JCU A;  4AKI A;  4HQS A;  4ECI A;  1IYI A;  1Z6N A;  2M80 A;  1LBK A;  3CXG A;  3L9U A;  4L8E A;  4ZL7 A;  3UMA A;  1NW2 A;  4E68 A;  2AUV A;  1CQG A;  3QAV A;  4ICY A;  3IAS 2;  3M1G A;  1YJ6 A;  4EVM A;  3LFL A;  1GNW A;  3P8W A;  4GSN A;  2LS5 A;  2G2Q A;  3GL3 A;  3PR8 A;  1G7O A;  2GQK A;  4EUY A;  22GS A;  2WDU A;  5IMD A;  1EP8 A;  2H6X A;  3KH9 A;  2BTO T;  5A5H B;  3F6D A;  5DQY A;  5J5N A;  2F8F A;  2P31 A;  4WR5 A;  3GKK A;  1MDJ A;  3UEM A;  4NWY A;  1T7P B;  3D4M A;  1Y6E A;  3DYR A;  3ZVJ A;  2LV3 A;  2WS2 A;  2LNS A;  5AGY A;  1KNG A;  1OE8 A;  5DVB A;  1XZO A;  1YKA A;  4Q5Q A;  3ERG A;  4MCU A;  4PUR A;  3O6T A;  1FVJ A;  2AB6 A;  1HQO A;  3DKS A;  2DBC A;  1GSE A;  2H01 A;  4FO5 A;  1M7T A;  2YNX A;  2VCQ A;  4HU7 A;  3HVS A;  3C1S A;  1K0D A;  1W4V A;  3FZ4 A;  3IV4 A;  1EGO A;  5A1N B;  3EVI A;  3FRC A;  4XHM A;  2K18 A;  3TOT A;  5G5E A;  2CQ9 A;  1WWJ A;  3FW2 A;  1TXX A;  1S3R A;  3KXO A;  3VPQ A;  3F9U A;  4ID0 A;  2MBT A;  2B5X A;  3R3E A;  4MF5 A;  4K2D A;  4F03 A;  2LJA A;  2E7P A;  2E0Q A;  1AQX A;  1E2Y A;  2QC7 A;  5F0G A;  3ZZX A;  1DE1 A;  2LJK A;  1XWK A;  4EIQ A;  2RM6 A;  4PGT A;  2E2G A;  3DGQ A;  2H1A A;  5HR1 A;  3HJO A;  1ABA A;  5FT3 A;  5ECO B;  4MPG A;  4XRD A;  5IQY A;  4V1A p;  5D96 A;  5A5K A;  1OKT A;  3MDK A;  4KCA A;  3LYK A;  4AF2 A;  4DEJ A;  1M2D A;  4JRR A;  4D73 B;  1K0M A;  4PQI A;  1XPV A;  4GSS A;  3VPT A;  3LGC A;  5ECP B;  3TGZ A;  4TXO B;  3IBH A;  3CRU A;  2VM2 A;  5LD0 A;  5CRH A;  1SKS B;  2L59 A;  2FCH A;  1THX A;  5CNW A;  1TRU A;  1FOV A;  3TCO A;  1YVL A;  5DDL A;  4ULX A;  3UBK A;  5HR2 A;  2AAW A;  5J9C A;  2LJR A;  4XS1 A;  3CYN A;  2ON7 A;  6GST A;  2VCZ A;  5A34 A;  1XOA A;  1O6J A;  1U3A A;  2HZF A;  4TN8 A;  3ZTL A;  5ECM B;  5CRD A;  1YY7 A;  1O8W A;  3K8N A;  2TRC P;  4GLT A;  4HZ4 A;  3PGT A;  2OAC A;  3HVX A;  4ZIL A;  4GF0 A;  2XBQ A;  3VWW A;  4V2N A;  1XXU A;  1SK2 A;  4NHW A;  2A4H A;  1F3A A;  1X5E A;  2H19 A;  1V98 A;  1RK4 A;  4MAB A;  2MMA A;  1SD9 A;  1ZOF A;  3IHG A;  2LUS A;  2VIM A;  4CHS A;  1URM A;  4ISD A;  2N5F A;  1B4P A;  1UN2 A;  2VL3 A;  4KSM A;  4MJE A;  2WW1 A;  2DJ3 A;  4TR0 A;  1IYH A;  3FR9 A;  4LMW A;  3P2A A;  3ERF A;  3NIV A;  4OO5 A;  4KCE A;  3G7Y A;  5J47 A;  3FY7 A;  4F0B A;  4ZIJ A;  2H74 A;  4X0X A;  3TUE A;  1T4Z A;  3GHA A;  1XW6 A;  1X9M B;  5BMU B;  1QUW A;  2VUP A;  4KSO A;  4BPY A;  2YWO A;  3GUS A;  2FWH A;  1YF0 A;  3EIN A;  1OKD A;  1SYX A;  2H71 A;  1JLW A;  2RLI A;  1THO A;  2C3Q A;  4YQU A;  3CBU A;  1UC7 A;  3KJY A;  2RM5 A;  4GRF A;  4I2U A;  4Q5R A;  5J9B A;  2HSM B;  2R5G A;  1TRV A;  3EU3 A;  3RHB A;  5IPH A;  1K0C A;  4HI7 A;  4POK A;  2JZR A;  2NTO A;  3C8E A;  4ZB6 A;  1EEM A;  1AUC A;  3C7M A;  3CHX C;  4LMV A;  5IM9 A;  1BX9 A;  1XWA A;  1WIK A;  1M2A A;  2JL4 A;  3WT1 A;  5DAK B;  2LRN A;  5H5R A;  1R5P A;  5D8I A;  3DEX A;  2AV4 A;  3U5R E;  2R6K A;  2HZE B;  1U88 A;  4ILF A;  1X5C A;  5DAL A;  1WRY A;  2H30 A;  4HS1 A;  4HSC X;  3QMX A;  2BJX A;  2DIZ A;  3F3R A;  4Q5N A;  5D73 A;  2GZP A;  2X99 A;  3RBT A;  4ML1 A;  3WT2 A;  3U6V A;  4LL4 B;  5GAP D;  1A23 A;  5ID2 B;  1QK8 A;  1A0R P;  4ECB A;  4EF0 A;  4EXJ A;  4KX4 A;  2C0G A;  1EGR A;  1NHO A;  2VCX A;  2B1K A;  1TP9 A;  4BL7 A;  1SKR B;  3FR3 A;  2LRT A;  1E6B A;  3TJF A;  1SJ6 A;  2L4C A;  3BD2 A;  2K6V A;  3HJP A;  1FB6 A;  4LL1 B;  2HRA A;  2KP1 A;  3KMO A;  1TJD A;  4MZB A;  2WFC A;  4PQH A;  4O5R A;  3ED3 A;  2PVQ A;  2HRK A;  4P3Y B;  1N2A A;  3F4R A;  1AQV A;  2GSR A;  3Q74 A;  2B7K A;  1GRX A;  2P5R A;  3M9K A;  2B1L A;  1TW9 A;  3TJK A;  1XCC A;  3TOU A;  2QKE A;  5B8B A;  5HFK A;  2VM1 A;  2YV7 A;  3APS A;  1VF4 A;  4KDX A;  3GUR A;  4X1U A;  1GTU A;  3RPN A;  2PGT A;  1XWB A;  1T1V A;  5GAN D;  2V2G A;  3PPU A;  4O32 A;  2PBJ A;  2H76 A;  1EP7 A;  4Z2R A;  6GSS A;  2JU5 A;  3A5W A;  5ELG A;  1JZW A;  4RI7 A;  1GTB A;  3R2Q A;  5KOX A;  1XWG A;  2CVK A;  1C72 A;  3IK7 A;  4BA7 A;  2ES7 A;  3S9F A;  4OO4 A;  4FYU A;  2CX3 A;  2PMT A;  1M0U A;  2VL9 A;  1SL1 B;  1A24 A;  3F3Q A;  4IQA A;  4USS A;  2XBI A;  2HSY A;  3KZQ A;  4KDU A;  4G19 A;  4MF7 A;  4HQZ A;  2GDR A;  4CY6 A;  3HY2 A;  4X4J A;  1SVO A;  1QMV A;  2VCV A;  2WB9 A;  1GSY A;  4XTS A;  1UA5 A;  4FH8 A;  3D22 A;  1Z7P A;  4EC0 A;  2A4V A;  2IL3 A;  4Z2U A;  2CVB A;  3WD6 A;  1A2M A;  2C8U A;  3FZ5 A;  2YV9 A;  3L78 A;  4ZB9 A;  1MTC A;  1O8X A;  1TK5 B;  3WYW A;  1DUG A;  5E4W A;  1PKW A;  1J0F A;  3AY8 A;  5E59 A;  5IPG A;  1WMJ A;  3FMW A;  3QFB C;  3O76 A;  4EDZ A;  2V6O A;  3JCM L;  4MMM A;  3EYT A;  3GIX A;  4K9Z A;  1K0N A;  2OE0 A;  5D93 A;  2H73 A;  4N0V A;  1PN9 A;  2JAC A;  4EL1 A;  4K0N A;  2WCI A;  4MP4 A;  3ZFB A;  3FZ9 A;  4QQ7 A;  5IMC A;  3OR5 A;  3HD5 A;  5AN1 A;  3Q6O A;  4HJM A;  2YWM A;  1F9M A;  4MF6 A;  3D21 A;  2OBI A;  4PNF A;  3KIJ A;  2EC4 A;  1I1I P;  5ENU A;  1N25 A;  2B7J A;  3LXT A;  3HJM A;  3RGB C;  1EOG A;  4J2F A;  1JZD A;  1SJI A;  3CMI A;  3IC4 A;  1TDI A;  1PKZ A;  4GWR A;  2PPT A;  1TK0 B;  1O81 A;  3M8N A;  4ZL8 A;  3WGE A;  3UOM A;  1V2A A;  4IEL A;  2PWJ A;  1M2B A;  2L4Q A;  3D6I A;  3KTL A;  4LA1 A;  3C71 A;  2FWG A;  4GST A;  2ZNM A;  4JBB A;  2WZ9 A;  3GV1 A;  3EU4 A;  2V41 A;  1V9W A;  5C00 A;  2VCW A;  3PH9 A;  1WJK A;  3DIE A;  1SYR A;  4V1A g;  2O36 A;  2YZH A;  5L71 A;  3L0H A;  1GSF A;  3GTU A;  4WF4 A;  1PGT A;  1JHB A;  1BG1 A;  1PX6 A;  2DJ0 A;  3HHV A;  4RI6 A;  2X49 A;  4DSQ A;  3IR4 A;  1ACV A;  1TTZ A;  5GZZ B;  4ZB8 A;  1TOF A;  5IOW A;  2V1M A;  5AIX A;  1QXH A;  1R5A A;  4AJ7 A;  1R4W A;  4BVY A;  1GUH A;  2OKA A;  4EO3 A;  1PQN A;  1XVW A;  4ECJ A;  4HEA 2;  3LXZ A;  1KTE A;  4G0K A;  2B5E A;  2P5Q A;  5G2Z A;  4MNN A;  1EV9 A;  4WR4 A;  2HT9 A;  4KB3 A;  1U87 A;  2RUE A;  2GQM A;  3F63 A;  4I6X A;  6GSV A;  2HSH A;  3MYD A;  1Y25 A;  1GUL A;  3M3M A;  5CP1 A;  4POL A;  2CAI A;  2X8H A;  1QQ2 A;  2PN8 A;  2HLS A;  3A2X A;  4PUA A;  4OFN A;  2LQQ A;  3CSH A;  2DKI A;  2DLX A;  2I4A A;  5CYY A;  1FOH A;  3C1R A;  4L5L A;  18GS A;  5G1L A;  2ZCT A;  4PTS A;  1LU4 A;  3L9S A;  1GL8 A;  2XPE A;  2DJ1 A;  3FZA A;  3IPZ A;  4ZL9 A;  1OAZ A;  1EWX A;  3VLN A;  4IW9 A;  1F37 A;  1SJZ A;  2F9S A;  1WOU A;  2N5B A;  3EPT A;  2KHP A;  1FVK A;  3VK9 A;  4IJ3 A;  5A34 B;  3I69 A;  1FW1 A;  1NHY A;  1ZMA A;  2DC5 A;  4F2I A;  2TRX A;  4POB A;  3HVV A;  5ECR B;  1USB A;  1S3D A;  4PXO A;  3ZFL A;  3HZ4 A;  5IO0 A;  1XOB A;  5F05 A;  2VLU A;  5EY6 A;  2I3Y A;  4YKG A;  3O3T A;  3KD0 A;  1YEP A;  3D0Z A;  1ERT A;  5IMV A;  5KN2 A;  2A2R A;  1OYJ A;  1U3I A;  1GSQ A;  4ZBD A;  3TKS A;  3P90 A;  2OE3 A;  2E2M A;  5F07 A;  1Z9H A;  1BAY A;  3VI5 A;  2EFD A;  3J7Y b;  5A4W A;  1FHE A;  1J08 A;  4WET A;  1GSS A;  11GS A;  1VF2 A;  2QSI A;  1B9X C;  1ERW A;  5JCG A;  2FY6 A;  4NMU A;  4KDY A;  2GVP A;  4FIW A;  2AJQ B;  4OCF A;  1TU8 A;  4Z2T A;  1GSU A;  2OA7 A;  1A8Y A;  4N3Z A;  1A8L A;  1LJR A;  3ZRD A;  5DJL A;  4TR1 A;  2ZUP A;  5CRE A;  4Q5F A;  4J56 E;  1SD8 A;  4DVC A;  3VUR A;  5BRT A;  1XVQ A;  2IJY A;  3KMN A;  1FB0 A;  4WXT A;  4PUF C;  3CTG A;  3KEB A;  2YCD A;  4CW9 A;  2X8G A;  1B48 A;  1OC9 A;  4KA0 A;  3QDN A;  3MSZ A;  5CO3 A;  2J23 A;  4GDF A;  2KLX A;  4HDE A;  5COH A;  2H72 A;  1TRW A;  3HMJ G;  3DD3 A;  2IN3 A;  2R4V A;  1EOH A;  3SBC A;  2R37 A;  5JCW A;  1SL2 B;  2C3T A;  1HD2 A;  3CWG A;  1R26 A;  4BIK A;  3CRT A;  5J4V A;  3QPM A;  2PU9 C;  4YAV A;  1X9W B;  2VO4 A;  2GSQ A;  1PL1 A;  2H75 A;  3GFK A;  1T3B A;  4KW6 A;  3QOU A;  17GS A;  4PQ1 A;  1J9B A;  1GH2 A;  2HFD A;  3HVN A;  4NV5 A;  3IRA A;  4BWQ A;  4E8E A;  4MLY A;  4XS4 A;  4Z7X A;  1GUM A;  2VD1 A;  2B5Y A;  2R3X A;  5ECS A;  2C3N A;  1Q4J A;  3ZRE A;  1RQM A;  3W8J A;  2NPB A;  3APQ A;  2QGV A;  2N5A A;  1KBN A;  3FKF A;  3TKS C;  2HI7 A;  3DML A;  3Q19 A;  1MDK A;  2ALB A;  2C0F A;  3GA4 A;  3QD9 A;  2GZY A;  4CDO A;  3FR6 A;  5DAL B;  2FWE A;  4OFT A;  1A2J A;  1K0B A;  2O87 A;  2GT6 A;  3HKR A;  3ZYW A;  3I9V 2;  1N8J A;  5ECN B;  4LLR A;  3G7J A;  3E9J B;  2HE3 A;  4ZBB A;  2I9H A;  5B6N A;  2H6Z A;  3VFI A;  1YF1 A;  4JU5 A;  4BWS A;  5INY A;  1V40 A;  4JED A;  2EFH A;  4A5P A;  1G0T A;  2EFC A;  2H70 A;  3KCM A;  3H1N A;  5B7C A;  4BL7 B;  1M99 A;  1O85 A;  2MZC A;  2L5L A;  4CY8 A;  3LWA A;  4MJA A;  3A3T A;  4J57 E;  1YDK A;  1ERV A;  1A2L A;  2FWF A;  20GS A;  2IMD A;  1M3I A;  4EE0 A;  1ON4 A;  2CAQ A;  1JFU A;  3F4T A;  1VF3 A;  2EIR A;  4MH3 A;  2HRK B;  2H0H A;  3TDG A;  4AKG A;  1ZCP A;  4FYC A;  2D2Z A;  2FHE A;  2IPA A;  1SK1 A;  2O5V A;  3H8Q A;  1S3A A;  3RPP A;  4NPB A; 
#chains in the Genus database with same CATH homology
 4ZXG A;  1V57 A;  4RQR A;  1SVL A;  3QCP A;  4K0G A;  1AQW A;  1GP1 A;  3ERW A;  3ZIJ A;  2R0G A;  5KEJ A;  2RII A;  3Q18 A;  1VRS D;  1V58 A;  1GWC A;  2H1D A;  1FG4 A;  1W89 A;  2C0D A;  2LQO A;  1KEB A;  2L5O A;  4MA9 A;  3TRQ A;  1ZYN A;  4K5R A;  4YKF A;  5CAX A;  3FHK A;  3QFA C;  3TKQ A;  5ECI B;  5EVO A;  4RUV A;  1XFL A;  2GLR A;  3VI7 A;  5J3R A;  2R2J A;  1ZYQ B;  1XBS A;  5B6M A;  4H86 A;  3UL3 A;  4MJC A;  4KGI A;  3D4T A;  3GSS A;  3KM6 A;  1PN0 A;  2CVD A;  1H4O A;  2IFQ A;  2BMX A;  2OT3 A;  3ISO A;  1JZO A;  1YZX A;  3KP9 A;  4EKZ A;  1YEX A;  1HYU A;  3TJG A;  5DQS A;  4G0L A;  4MPF A;  3BBY A;  2QA1 A;  1AAZ A;  2HNL A;  3G7I A;  3J7Y k;  2XHF A;  4G10 A;  1B4Q A;  1Y1U A;  3TRP A;  1K0O A;  4IP6 A;  3IA1 A;  3L9V A;  4FQU A;  2GSS A;  3GMF A;  4NXI A;  2OJL A;  3KTB A;  1JZR A;  3IE3 A;  4FYB A;  2VD0 A;  3IDV A;  5J4U A;  1TK8 B;  2GST A;  5J4Y A;  5KN1 A;  2PUK C;  1HNB A;  6GSU A;  4IKH A;  4YAP A;  1EEJ A;  1PRX A;  4XS6 A;  1OVN A;  2K9F A;  4BVX A;  4MK3 A;  3KP8 A;  4WBR D;  5ABR A;  5HR0 A;  3FYG A;  1FAA A;  3TB2 A;  7GSS A;  5IIZ A;  3TJJ A;  4ACS A;  5EL8 A;  4AJ8 A;  3HYP A;  2RUF A;  1SEN A;  4K7I A;  2B3S A;  2MMN A;  1G7E A;  1Z5Y E;  4IP1 A;  2PVO C;  4G0I A;  1YQ1 A;  2GS3 A;  1MDI A;  2CX4 A;  3N9J A;  2NBS A;  1B8X A;  1B9Y C;  3IOS A;  1GLQ A;  4IHU A;  3KH7 A;  2MBS A;  2FA8 A;  3A2W A;  2I81 A;  6GSY A;  3GTU B;  1T4Y A;  3LJR A;  4TOP A;  2R0C A;  1K3L A;  4QL9 A;  6GSX A;  1ILO A;  3E0U A;  5IMA A;  4HOJ A;  4W66 A;  3ZML A;  2YZU A;  16GS A;  3IC8 A;  2WUL A;  2L6D A;  4OD7 A;  2R0P A;  4KF9 A;  2AYT A;  4K5S A;  1I9D A;  3EC3 A;  3PIN A;  4BVY B;  5GSS A;  3UIW A;  2PER A;  2IMI A;  5CRG A;  3UAR A;  2YAN A;  1BQ7 A;  3C73 A;  3GH6 A;  3HDC A;  1QGV A;  1F3B A;  4GTU A;  2IMK A;  2O89 A;  4KE3 A;  2H0I A;  4KH7 A;  1O7U A;  3HCZ A;  2UZ8 A;  1WPI A;  3G9B A;  1SK0 A;  3DVW A;  5DBQ A;  4I8B A;  4WEY A;  1BF5 A;  3ZL5 A;  4K7O A;  4TRX A;  4QL7 A;  2FUG 2;  1U6T A;  2I1U A;  4ZB7 A;  4G01 A;  3H93 A;  4ML6 A;  2JAD A;  1X0R A;  3DVX A;  3VWX A;  4XRA A;  2L57 A;  3UJ1 A;  2A2P A;  4ZBA A;  1EV4 A;  2XPD A;  2Z9S A;  5IO2 A;  4PX1 A;  2H1L A;  2VL2 C;  2FNO A;  5A5H A;  2VLT A;  4GQC A;  5HQP A;  1AXD A;  5J40 A;  2X4A A;  4F82 A;  2LST A;  2DKH A;  3FK8 A;  2HYX A;  1I5G A;  3IK9 A;  2HXK A;  3DWV A;  3QAW A;  2IME A;  3KGK A;  2O7K A;  1Z3E A;  3H79 A;  5A1N A;  4RQX A;  9GSS A;  1XWC A;  2C0E A;  1HNC A;  2JSZ A;  2OAD A;  1MEK A;  5A4V A;  2WGR A;  3NOF A;  3WGD A;  2CZ3 A;  5KN0 A;  5LCZ A;  1GTA A;  2V32 A;  3BCK A;  5FHI A;  1K3Y A;  3LG6 A;  1TU7 A;  2H1G A;  3GRX A;  3I43 A;  4ECC A;  4YH2 A;  5J41 A;  5F06 A;  1X9S B;  1ERU A;  2DJJ A;  4XIH A;  2IWT A;  3LEF A;  1F2E A;  5ECL B;  3CTF A;  1UVZ A;  5G5F A;  2LTK A;  2V6K A;  4TR1 B;  5ECQ B;  3MIX A;  5FWG A;  3LYP A;  3APO A;  4NAX A;  1PD2 1;  1NSW A;  2DJ2 A;  2MYG A;  3ZVJ D;  2C1Y A;  1TI1 A;  3BJ5 A;  1GTI A;  3BOA A;  4IBP A;  2KOK A;  5C04 A;  4AJ6 A;  4D73 A;  1O73 A;  3TKR A;  1BED A;  1OC9 B;  1SKW B;  3ZIT A;  4MDC A;  4IS0 A;  5KN3 A;  2HRN A;  4TXO A;  1VF1 A;  3P7X A;  2C4J A;  4O7H A;  5AIV A;  4KND A;  1GSD A;  2YPM A;  3TKP A;  4TW5 A;  3M9J A;  3GKM A;  5ECH B;  2CZ2 A;  4I97 A;  1ZL9 A;  5A4U A;  3GH9 A;  5GST A;  1OC3 A;  5IOX A;  4IVF A;  2DML A;  5CRW A;  1GUK A;  2A2S A;  1DBY A;  4WBJ A;  2GZZ A;  3VWU A;  1AC1 A;  2MMZ A;  2F8A A;  1PA3 A;  3GNJ A;  4XS4 B;  4DSS B;  3MAK A;  19GS A;  2ON5 A;  3IXR A;  1TI3 A;  1XIY A;  4KUN A;  1GLP A;  4V2L A;  1H75 A;  4G9H A;  4HZ2 A;  3GYK A;  4E8H A;  1S3C A;  1T00 A;  2QA2 A;  2H1B A;  2GTU A;  3CSJ A;  2GGT A;  3NZN A;  5B8A A;  3ZIV A;  3LW9 A;  1HNA A;  4QMK A;  3GST A;  5D9V A;  3EE2 A;  3MNG A;  4DSS A;  1K3O A;  3US3 A;  5H5Q A;  1ST9 A;  3E3E A;  1AW9 A;  4IN0 A;  1SVM A;  2DJK A;  4N10 A;  2O8V B;  3EMX A;  2GQL A;  1AIU A;  1A0F A;  5IMZ A;  2DSA A;  3A2V A;  1ZYP A;  1M9A A;  2KUC A;  4WKW A;  4EDY A;  2YWN A;  5JWQ B;  2HSN B;  4IGJ A;  1FO5 A;  4G2E A;  5HFG A;  4N11 A;  4IQ1 A;  4NV2 A;  4AKX B;  2UV8 G;  4OMV A;  4O5Q A;  4MH2 A;  4K6X A;  3GX0 A;  1QFN A;  5JWR B;  2OBK A;  2M72 A;  3GL5 A;  1NM3 A;  3EMP A;  2M46 A;  3M0F A;  5H5S A;  2F51 A;  5G1K A;  3UVT A;  14GS A;  3LSZ A;  5ELA A;  3I6A A;  2IMF A;  1TRS A;  3QAG A;  1GNE A;  2F3M A;  1ML6 A;  4JR4 A;  2EFE A;  1DSB A;  5BMU A;  2VOC A;  5AIS A;  2K8V A;  3LQ7 A;  3HZ8 A;  2HSN A;  1XW5 A;  3H4K A;  3SWL A;  2JZS A;  1PSQ A;  2JSY A;  2MMO A;  2K8S A;  2VLV A;  3VWV A;  3TJB A;  1VGL A;  3D5J A;  5F8B A;  2H0G A;  3WGX A;  3ZLP A;  2P0G A;  3DRN A;  5IMF A;  1Q98 A;  4NHZ A;  1CQH A;  1ZGN A;  2LRC A;  2XC2 A;  3EWL A;  2CA8 A;  1YKC A;  2HSM A;  3RAZ A;  1WE0 A;  2REM A;  1DE2 A;  2GT5 A;  5D9W A;  1SL0 B;  5HFI A;  3EUR A;  2WRT A;  4K8M A;  2AHE A;  13GS A;  1MD4 A;  1ZYE A;  4HJ2 A;  5EPF A;  2J9H A;  3ME8 A;  3QR6 A;  4AKH A;  4TVE A;  4GXZ A;  5G31 A;  1T8E B;  2WJU A;  4MZW A;  5DAK A;  2DMM A;  4AI6 A;  4N0Z A;  1XW9 A;  5DCH A;  4KAE A;  1EZK A;  2IIY A;  2LKU A;  1PMT A;  4TKY A;  4GCI A;  2HZE A;  3TRX A;  3UAP A;  4IJI A;  1Z7R A;  2IFQ B;  4WF5 A;  4K2X A;  2NVL A;  1OE7 A;  3GKX A;  4TR4 A;  3HA9 A;  3IAM 2;  2YP6 A;  4AGS A;  4L0W A;  4K1F A;  2X64 A;  2YOI A;  5JWO B;  4F0C A;  2HRF A;  2YWI A;  2EIQ A;  5D9X A;  1RW1 A;  3CSI A;  1Z6M A;  5ID2 A;  4EIP A;  2HQT A;  4V2M A;  1R7H A;  1TXU A;  3GX8 A;  4OCE A;  3F0I A;  10GS A;  1BJX A;  4O92 A;  3DXB A;  1F6M C;  2VKZ G;  4PNG A;  4L0U A;  4L5O A;  3W6G A;  3HXS A;  2LEG A;  2EIO A;  1BG5 A;  2X8C A;  4I2T A;  3RDW A;  1SU9 A;  3A5I A;  4N30 A;  2FA4 A;  3N5O A;  4F9Z A;  2TIR A;  5DCG A;  1JLV A;  1PX7 A;  1BYE A;  5D9T A;  4BVX B;  4MZC A;  4GQF A;  3FEU A;  3L4N A;  2YJ7 A;  3W8S A;  5LNK e;  5G30 A;  4X43 A;  4YQM A;  3F6F A;  4K7N A;  4XCS A;  2VCT A;  3UBL A;  3GKN A;  3ME7 A;  4MJB A;  8GSS A;  4JZQ A;  2H6Y A;  2JZT A;  2NDO A;  4JR6 A;  3IHQ A;  1MD3 A;  3F8U A;  3RHC A;  3BCI A;  4DSR A;  1G6W A;  1OC8 A;  1M9B A;  2B6M A;  2O85 A;  4TR3 A;  2FLS A;  2YJH A;  3UVH A;  5HR3 A;  5DJM A;  4JE1 A;  5KOW A;  1PL2 A;  3TU3 B;  3MWH A;  3LOR A;  1WP0 A;  1TKD B;  1X5D A;  2H8L A;  4OFM A;  2C80 A;  3V1W A;  2DIY A;  2CT6 A;  4OWY A;  2FGX A;  2YN1 A;  3TKS E;  1G6Y A;  2VL2 A;  3ZMK A;  4POM A;  2CV4 A;  1ZZY A;  2KP2 A;  4TXV A;  2L6C A;  2OE1 A;  2LNT A;  2G0F A;  4O5U A;  4I5Q A;  2H66 A;  3F4S A;  4HUA A;  12GS A;  3GN3 A;  5ECK B;  6GSW A;  2VAF A;  4YQV A;  2FD3 A;  1K0A A;  4HU9 A;  5JCU A;  4AKI A;  4HQS A;  4ECI A;  1IYI A;  1Z6N A;  2M80 A;  1LBK A;  3CXG A;  3L9U A;  4L8E A;  4ZL7 A;  3UMA A;  1NW2 A;  4E68 A;  2AUV A;  1CQG A;  3QAV A;  4ICY A;  3IAS 2;  3M1G A;  1YJ6 A;  4EVM A;  3LFL A;  1GNW A;  3P8W A;  4GSN A;  2LS5 A;  2G2Q A;  3GL3 A;  3PR8 A;  1G7O A;  2GQK A;  4EUY A;  22GS A;  2WDU A;  5IMD A;  1EP8 A;  2H6X A;  3KH9 A;  2BTO T;  5A5H B;  3F6D A;  5DQY A;  5J5N A;  2F8F A;  2P31 A;  4WR5 A;  3GKK A;  1MDJ A;  3UEM A;  4NWY A;  1T7P B;  3D4M A;  1Y6E A;  3DYR A;  3ZVJ A;  2LV3 A;  2WS2 A;  2LNS A;  5AGY A;  1KNG A;  1OE8 A;  5DVB A;  1XZO A;  1YKA A;  4Q5Q A;  3ERG A;  4MCU A;  4PUR A;  3O6T A;  1FVJ A;  2AB6 A;  1HQO A;  3DKS A;  2DBC A;  1GSE A;  2H01 A;  4FO5 A;  1M7T A;  2YNX A;  2VCQ A;  4HU7 A;  3HVS A;  3C1S A;  1K0D A;  1W4V A;  3FZ4 A;  3IV4 A;  1EGO A;  5A1N B;  3EVI A;  3FRC A;  4XHM A;  2K18 A;  3TOT A;  5G5E A;  2CQ9 A;  1WWJ A;  3FW2 A;  1TXX A;  3KXO A;  3VPQ A;  3F9U A;  4ID0 A;  2MBT A;  2B5X A;  3R3E A;  4MF5 A;  4K2D A;  4F03 A;  2LJA A;  2E7P A;  2E0Q A;  1AQX A;  1E2Y A;  2QC7 A;  5F0G A;  3ZZX A;  1DE1 A;  2LJK A;  1XWK A;  4EIQ A;  2RM6 A;  4PGT A;  2E2G A;  3DGQ A;  2H1A A;  5HR1 A;  3HJO A;  1ABA A;  5FT3 A;  5ECO B;  4MPG A;  4XRD A;  5IQY A;  4V1A p;  5D96 A;  5A5K A;  1OKT A;  3MDK A;  4KCA A;  3LYK A;  4AF2 A;  4DEJ A;  1M2D A;  4JRR A;  4D73 B;  1K0M A;  4PQI A;  1XPV A;  4GSS A;  3VPT A;  3LGC A;  5ECP B;  3TGZ A;  4TXO B;  3IBH A;  3CRU A;  2VM2 A;  5LD0 A;  5CRH A;  1SKS B;  2L59 A;  2FCH A;  1THX A;  5CNW A;  1TRU A;  1FOV A;  3TCO A;  1YVL A;  5DDL A;  4ULX A;  3UBK A;  5HR2 A;  2AAW A;  5J9C A;  2LJR A;  4XS1 A;  3CYN A;  2ON7 A;  6GST A;  2VCZ A;  5A34 A;  1XOA A;  1O6J A;  1U3A A;  2HZF A;  4TN8 A;  3ZTL A;  5ECM B;  5CRD A;  1YY7 A;  1O8W A;  3K8N A;  2TRC P;  4GLT A;  4HZ4 A;  3PGT A;  2OAC A;  3HVX A;  4ZIL A;  4GF0 A;  2XBQ A;  3VWW A;  4V2N A;  1XXU A;  1SK2 A;  4NHW A;  2A4H A;  1F3A A;  1X5E A;  2H19 A;  1V98 A;  1RK4 A;  4MAB A;  2MMA A;  1SD9 A;  1ZOF A;  3IHG A;  2LUS A;  2VIM A;  4CHS A;  1URM A;  4ISD A;  2N5F A;  1B4P A;  1UN2 A;  2VL3 A;  4KSM A;  4MJE A;  2DJ3 A;  4TR0 A;  1IYH A;  3FR9 A;  4LMW A;  3P2A A;  3ERF A;  3NIV A;  4OO5 A;  4KCE A;  3G7Y A;  5J47 A;  3FY7 A;  4F0B A;  4ZIJ A;  2H74 A;  4X0X A;  3TUE A;  1T4Z A;  3GHA A;  1XW6 A;  1X9M B;  5BMU B;  1QUW A;  2VUP A;  4KSO A;  4BPY A;  2YWO A;  3GUS A;  2FWH A;  1YF0 A;  3EIN A;  1OKD A;  1SYX A;  2H71 A;  1JLW A;  2RLI A;  1THO A;  2C3Q A;  4YQU A;  3CBU A;  1UC7 A;  3KJY A;  2RM5 A;  4GRF A;  4I2U A;  4Q5R A;  5J9B A;  2HSM B;  2R5G A;  1TRV A;  3EU3 A;  3RHB A;  5IPH A;  1K0C A;  4HI7 A;  4POK A;  2JZR A;  2NTO A;  3C8E A;  4ZB6 A;  1EEM A;  1AUC A;  3C7M A;  4LMV A;  5IM9 A;  1BX9 A;  1XWA A;  1WIK A;  1M2A A;  2JL4 A;  3WT1 A;  5DAK B;  2LRN A;  5H5R A;  1R5P A;  5D8I A;  3DEX A;  2AV4 A;  3U5R E;  2R6K A;  2HZE B;  1U88 A;  4ILF A;  1X5C A;  5DAL A;  1WRY A;  2H30 A;  4HS1 A;  3QMX A;  2BJX A;  2DIZ A;  3F3R A;  4Q5N A;  5D73 A;  2GZP A;  2X99 A;  3RBT A;  4ML1 A;  3WT2 A;  3U6V A;  4LL4 B;  5GAP D;  1A23 A;  5ID2 B;  1QK8 A;  1A0R P;  4ECB A;  4EF0 A;  4EXJ A;  4KX4 A;  2C0G A;  1EGR A;  1NHO A;  2VCX A;  2B1K A;  1TP9 A;  4BL7 A;  1SKR B;  3FR3 A;  2LRT A;  1E6B A;  3TJF A;  1SJ6 A;  2L4C A;  3BD2 A;  2K6V A;  3HJP A;  1FB6 A;  4LL1 B;  2HRA A;  2KP1 A;  3KMO A;  1TJD A;  4MZB A;  2WFC A;  4PQH A;  4O5R A;  3ED3 A;  2PVQ A;  2HRK A;  4P3Y B;  1N2A A;  3F4R A;  1AQV A;  2GSR A;  3Q74 A;  2B7K A;  1GRX A;  2P5R A;  3M9K A;  2B1L A;  1TW9 A;  3TJK A;  1XCC A;  3TOU A;  2QKE A;  5B8B A;  5HFK A;  2VM1 A;  2YV7 A;  3APS A;  1VF4 A;  4KDX A;  3GUR A;  4X1U A;  1GTU A;  3RPN A;  2PGT A;  1XWB A;  1T1V A;  5GAN D;  2V2G A;  3PPU A;  4O32 A;  2PBJ A;  2H76 A;  1EP7 A;  4Z2R A;  6GSS A;  2JU5 A;  3A5W A;  5ELG A;  1JZW A;  4RI7 A;  1GTB A;  3R2Q A;  5KOX A;  1XWG A;  2CVK A;  1C72 A;  3IK7 A;  4BA7 A;  2ES7 A;  3S9F A;  4OO4 A;  4FYU A;  2CX3 A;  2PMT A;  1M0U A;  2VL9 A;  1SL1 B;  1A24 A;  3F3Q A;  4IQA A;  4USS A;  2XBI A;  2HSY A;  3KZQ A;  4KDU A;  4G19 A;  4MF7 A;  4HQZ A;  2GDR A;  4CY6 A;  3HY2 A;  4X4J A;  1SVO A;  1QMV A;  2VCV A;  2WB9 A;  1GSY A;  4XTS A;  1UA5 A;  4FH8 A;  3D22 A;  1Z7P A;  4EC0 A;  2A4V A;  2IL3 A;  4Z2U A;  2CVB A;  3WD6 A;  1A2M A;  2C8U A;  3FZ5 A;  2YV9 A;  3L78 A;  4ZB9 A;  1MTC A;  1O8X A;  1TK5 B;  3WYW A;  1DUG A;  5E4W A;  1PKW A;  1J0F A;  3AY8 A;  5E59 A;  5IPG A;  1WMJ A;  3FMW A;  3QFB C;  3O76 A;  4EDZ A;  2V6O A;  3JCM L;  4MMM A;  3EYT A;  3GIX A;  4K9Z A;  1K0N A;  2OE0 A;  5D93 A;  2H73 A;  4N0V A;  1PN9 A;  2JAC A;  4EL1 A;  4K0N A;  2WCI A;  4MP4 A;  3ZFB A;  3FZ9 A;  4QQ7 A;  5IMC A;  3OR5 A;  3HD5 A;  5AN1 A;  3Q6O A;  4HJM A;  2YWM A;  1F9M A;  4MF6 A;  3D21 A;  2OBI A;  4PNF A;  3KIJ A;  2EC4 A;  5ENU A;  1N25 A;  2B7J A;  3LXT A;  3HJM A;  1EOG A;  4J2F A;  1JZD A;  1SJI A;  3CMI A;  3IC4 A;  1TDI A;  1PKZ A;  4GWR A;  2PPT A;  1TK0 B;  1O81 A;  3M8N A;  4ZL8 A;  3WGE A;  3UOM A;  1V2A A;  4IEL A;  2PWJ A;  1M2B A;  2L4Q A;  3D6I A;  3KTL A;  4LA1 A;  3C71 A;  2FWG A;  4GST A;  2ZNM A;  4JBB A;  2WZ9 A;  3GV1 A;  3EU4 A;  2V41 A;  1V9W A;  5C00 A;  2VCW A;  3PH9 A;  1WJK A;  3DIE A;  1SYR A;  4V1A g;  2YZH A;  5L71 A;  3L0H A;  1GSF A;  3GTU A;  4WF4 A;  1PGT A;  1JHB A;  1BG1 A;  1PX6 A;  2DJ0 A;  3HHV A;  4RI6 A;  2X49 A;  4DSQ A;  3IR4 A;  1ACV A;  1TTZ A;  5GZZ B;  4ZB8 A;  1TOF A;  5IOW A;  2V1M A;  5AIX A;  1QXH A;  1R5A A;  4AJ7 A;  1R4W A;  4BVY A;  1GUH A;  2OKA A;  4EO3 A;  1PQN A;  1XVW A;  4ECJ A;  4HEA 2;  3LXZ A;  1KTE A;  4G0K A;  2B5E A;  2P5Q A;  5G2Z A;  4MNN A;  1EV9 A;  4WR4 A;  2HT9 A;  4KB3 A;  1U87 A;  2RUE A;  2GQM A;  3F63 A;  4I6X A;  6GSV A;  2HSH A;  3MYD A;  1Y25 A;  1GUL A;  3M3M A;  5CP1 A;  4POL A;  2CAI A;  2X8H A;  1QQ2 A;  2PN8 A;  2HLS A;  3A2X A;  4PUA A;  4OFN A;  2LQQ A;  3CSH A;  2DKI A;  2DLX A;  2I4A A;  5CYY A;  1FOH A;  3C1R A;  4L5L A;  18GS A;  5G1L A;  2ZCT A;  4PTS A;  1LU4 A;  3L9S A;  1GL8 A;  2XPE A;  2DJ1 A;  3FZA A;  3IPZ A;  4ZL9 A;  1OAZ A;  1EWX A;  3VLN A;  4IW9 A;  1F37 A;  1SJZ A;  2F9S A;  1WOU A;  2N5B A;  3EPT A;  2KHP A;  1FVK A;  3VK9 A;  4IJ3 A;  5A34 B;  3I69 A;  1FW1 A;  1NHY A;  1ZMA A;  2DC5 A;  4F2I A;  2TRX A;  4POB A;  3HVV A;  5ECR B;  1USB A;  1S3D A;  4PXO A;  3ZFL A;  3HZ4 A;  5IO0 A;  1XOB A;  5F05 A;  2VLU A;  5EY6 A;  2I3Y A;  4YKG A;  3O3T A;  3KD0 A;  1YEP A;  3D0Z A;  1ERT A;  5IMV A;  5KN2 A;  2A2R A;  1OYJ A;  1U3I A;  1GSQ A;  4ZBD A;  3TKS A;  3P90 A;  2OE3 A;  2E2M A;  5F07 A;  1Z9H A;  1BAY A;  3VI5 A;  2EFD A;  3J7Y b;  5A4W A;  1FHE A;  1J08 A;  4WET A;  1GSS A;  11GS A;  1VF2 A;  2QSI A;  1B9X C;  1ERW A;  5JCG A;  2FY6 A;  4NMU A;  4KDY A;  2GVP A;  4FIW A;  2AJQ B;  4OCF A;  1TU8 A;  4Z2T A;  1GSU A;  2OA7 A;  1A8Y A;  4N3Z A;  1A8L A;  1LJR A;  3ZRD A;  5DJL A;  4TR1 A;  2ZUP A;  5CRE A;  4Q5F A;  4J56 E;  1SD8 A;  4DVC A;  3VUR A;  5BRT A;  1XVQ A;  2IJY A;  3KMN A;  1FB0 A;  4WXT A;  4PUF C;  3CTG A;  3KEB A;  2YCD A;  4CW9 A;  2X8G A;  1B48 A;  1OC9 A;  4KA0 A;  3QDN A;  3MSZ A;  5CO3 A;  2J23 A;  4GDF A;  2KLX A;  4HDE A;  5COH A;  2H72 A;  1TRW A;  3HMJ G;  3DD3 A;  2IN3 A;  2R4V A;  1EOH A;  3SBC A;  2R37 A;  5JCW A;  1SL2 B;  2C3T A;  1HD2 A;  3CWG A;  1R26 A;  3CRT A;  5J4V A;  3QPM A;  2PU9 C;  4YAV A;  1X9W B;  2VO4 A;  2GSQ A;  1PL1 A;  2H75 A;  3GFK A;  1T3B A;  4KW6 A;  3QOU A;  17GS A;  4PQ1 A;  1J9B A;  1GH2 A;  2HFD A;  4NV5 A;  3IRA A;  4BWQ A;  4E8E A;  4MLY A;  4XS4 A;  4Z7X A;  1GUM A;  2VD1 A;  2B5Y A;  2R3X A;  5ECS A;  2C3N A;  1Q4J A;  3ZRE A;  1RQM A;  3W8J A;  2NPB A;  3APQ A;  2QGV A;  2N5A A;  1KBN A;  3FKF A;  3TKS C;  2HI7 A;  3DML A;  3Q19 A;  1MDK A;  2ALB A;  2C0F A;  3GA4 A;  3QD9 A;  2GZY A;  4CDO A;  3FR6 A;  5DAL B;  2FWE A;  4OFT A;  1A2J A;  1K0B A;  2O87 A;  2GT6 A;  3HKR A;  3ZYW A;  3I9V 2;  1N8J A;  5ECN B;  4LLR A;  3G7J A;  3E9J B;  2HE3 A;  4ZBB A;  2I9H A;  5B6N A;  2H6Z A;  3VFI A;  1YF1 A;  4JU5 A;  4BWS A;  5INY A;  1V40 A;  4JED A;  2EFH A;  4A5P A;  1G0T A;  2EFC A;  2H70 A;  3KCM A;  3H1N A;  5B7C A;  4BL7 B;  1M99 A;  1O85 A;  2MZC A;  2L5L A;  4CY8 A;  3LWA A;  4MJA A;  3A3T A;  4J57 E;  1YDK A;  1ERV A;  1A2L A;  2FWF A;  20GS A;  2IMD A;  4EE0 A;  1ON4 A;  2CAQ A;  1JFU A;  3F4T A;  1VF3 A;  2EIR A;  4MH3 A;  2HRK B;  2H0H A;  3TDG A;  4AKG A;  1ZCP A;  4FYC A;  2D2Z A;  2FHE A;  2IPA A;  1SK1 A;  2O5V A;  3H8Q A;  1S3A A;  3RPP A;  4NPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...