3GH6A

Crystal structure of glutathione transferase dmgstd10 from drosophila melanogaster, in complex with glutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWEENWAGCQEFRKYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CG18548-PA (IP02196p) (IP02193p)
publication title Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 81
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gh6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gh6A01
3H79A 4TR3A 3TKRA 5D9VA 2HZEA 3ZTLA 1R5AA 2DJKA 4ZL9A 1OKDA 1NHYA 3GV1A 4GQCA 1U6TA 3P2AA 4MP4A 2JSYA 1OE7A 2JZRA 5C00A 1A2LA 1EWXA 2MBTA 3FY7A 2V6OA 1GH2A 4FYCA 3M0FA 1N2AA 3LYKA 2H70A 4KH7A 2LEGA 4TVEA 4PQ1A 5E59A 3J7Yk 3KJYA 4IS0A 2YV9A 2B3SA 3TB2A 2HSHA 1UN2A 2VUPA 1RW1A 3A5WA 4OCEA 4KSOA 4POKA 3GIXA 5CP1A 2UZ8A 4ZL7A 4EO3A 5IQYA 2LJRA 1PD21 5J9BA 3U5RE 2BJXA 2C3NA 1I5GA 2GSQA 4O32A 3GURA 1PA3A 3F4TA 2GT6A 2NPBA 5FWGA 1TDIA 1J08A 1ZOFA 3ZITA 4PURA 5J9CA 1T8EB 1NSWA 3A2VA 3N9JA 2WGRA 4NWYA 3VPTA 3TKPA 3MWHA 3D0ZA 3LXTA 3F0IA 4F03A 3IK7A 4QL7A 5EY6A 4IP1A 2HZFA 2HRAA 3PGTA 5GAPD 1X9WB 1JZOA 1B4PA 4LMWA 6GSYA 1T4YA 3BCIA 2HI7A 2C1YA 3C1RA 4TR1B 4L5LA 3TKQA 4K8MA 1IYHA 3FK8A 5ELGA 4EF0A 2ZUPA 3L78A 1G6WA 3NZNA 2H73A 4WR4A 4FH8A 2VCQA 2KUCA 1K0BA 1BYEA 1VF2A 4NXIA 3CSJA 1FVJA 4KX4A 2KHPA 4J57E 4TKYA 3MDKA 1YKCA 4G19A 3QDNA 2K8SA 2MYGA 3D6IA 1SK2A 4XS1A 2GS3A 3ZIJA 5F06A 1QFNA 1Z3EA 1S3AA 1BAYA 1YKAA 1GSEA 5J41A 2YWNA 2GVPA 1LJRA 5HR0A 2B7KA 4ZBDA 2C80A 2P31A 2I9HA 1MDJA 4ECBA 2P5QA 1ZZYA 2A2SA 4GCIA 1F2EA 4MZCA 3WYWA 3GKMA 4JEDA 1I9DA 2X99A 2AV4A 3KCMA 3MSZA 2IMDA 3GHAA 4AJ8A 2YJHA 2CT6A 5IOXA 3IE3A 5JCGA 3HJMA 2GQKA 2KP1A 3EMXA 3AY8A 3DVXA 2IJYA 3UVHA 3FW2A 1A0RP 5CRDA 2K18A 5JWQB 2VO4A 3EMPA 1GP1A 1A24A 4XTSA 2ES7A 1VF1A 1ZMAA 2JSZA 1M99A 2DBCA 5DALB 1XIYA 3KH9A 3IRAA 2E7PA 3LQ7A 3KTBA 3WT1A 2TRXA 1M2AA 1KTEA 4BL7B 1JLVA 3GFKA 1O8WA 3WGXA 2O8VB 3VURA 5GAND 2REMA 2OJLA 2L6DA 5GSSA 2LNTA 3ZRDA 2C4JA 1U87A 5ABRA 2AJQB 2FNOA 5B8BA 2LQQA 2YOIA 3FRCA 2LSTA 2OA7A 4CHSA 1XZOA 2ON7A 3APSA 2C0DA 3IOSA 2L57A 4V2LA 3BOAA 1EOGA 3Q18A 4DEJA 5IIZA 3FYGA 2PVQA 4Q5RA 3M9JA 12GSA 2E0QA 1OC3A 2QKEA 3R3EA 5KEJA 2CQ9A 3C73A 1XFLA 3EE2A 1PRXA 5IMZA 3I69A 4X1UA 4GLTA 1X5DA 1TU8A 1YJ6A 1HQOA 4LLRA 2J9HA 2B1KA 1XXUA 4F2IA 2H01A 1JZDA 1PSQA 4HUAA 1B9YC 1OC8A 3BBYA 4ZILA 4NV5A 5CNWA 5DAKA 3ZLPA 1J0FA 3TKSC 5JCWA 3F6FA 2OE1A 2V6KA 3GRXA 1RK4A 1S3CA 3RPNA 2D2ZA 3VLNA 5KN2A 1HNCA 1OYJA 1FHEA 1J9BA 5B8AA 2H1AA 3LWAA 4L5OA 3RAZA 4HZ4A 1TJDA 2N5AA 3MAKA 5D8IA 1K0DA 3HA9A 1G7OA 5FHIA 2WB9A 2I1UA 5CO3A 5HFKA 2FGXA 3UMAA 2H1BA 3PH9A 2LRCA 1DE2A 4Q5QA 2R5GA 4IW9A 3H1NA 4G0LA 2G2QA 2RM5A 1WRYA 4WF5A 5DVBA 1KBNA 1EOHA 1VF4A 1SL0B 1JFUA 1PGTA 1DUGA 3IAM2 4F0BA 5ECKB 4PTSA 2H66A 2FA8A 5LNKe 3ZMLA 4DSSB 1PL1A 1ZL9A 4GSSA 3TJBA 4G0IA 2L5LA 4V2MA 3IAS2 4IP6A 4MDCA 1EGRA 4YAPA 4POBA 4WKWA 2YWMA 5AISA 3IPZA 6GSSA 3TRQA 3GX8A 4IBPA 3QAWA 5F05A 3M9KA 1MEKA 4DSSA 5A4VA 1Z7PA 1O8XA 1X9SB 5D73A 5ECMB 1K0MA 3IV4A 3IXRA 3ZREA 4N0ZA 1SD8A 2RM6A 5ECNB 1THXA 2MZCA 5F0GA 4KCAA 3FZ5A 2O7KA 4ZB9A 4MZWA 3VWXA 4N11A 1VRSD 3ZVJA 2I4AA 1YQ1A 1LU4A 1TRUA 1M9BA 4ULXA 1A2MA 4OFTA 2HXKA 2CV4A 3UBLA 4KB3A 2K6VA 2TRCP 2XC2A 2G0FA 3IC8A 4MLYA 2VCXA 3L9SA 2H0IA 4ZBAA 13GSA 1GSUA 2YN1A 1GWCA 1KEBA 4NPBA 2OKAA 3UARA 1AIUA 4AGSA 5IO2A 2B5YA 2RLIA 3W8JA 1PQNA 3D4TA 3HHVA 1OE8A 4IGJA 1T4ZA 4PQHA 5IPHA 4POMA 5E4WA 1G0TA 4KDUA 3VWVA 4HQZA 4D73B 3GUSA 2CX3A 4RI6A 1UA5A 4OO5A 1BJXA 6GSWA 1XWAA 2X64A 1GNEA 1GSSA 3EC3A 2IWTA 1QGVA 4DSQA 4KW6A 1WPIA 3GKXA 2OE0A 4BVXB 1AQWA 2E2MA 2WS2A 3RDWA 2DMMA 1GSQA 2LNSA 3HCZA 2LQOA 4FIWA 1UVZA 3GKKA 2PN8A 4BVYA 1BX9A 1QQ2A 5HQPA 4KE3A 4YQMA 3TRXA 2LRTA 16GSA 4PUFC 4HU7A 3W6GA 4HDEA 4K7NA 2PERA 1Z9HA 1GTAA 2KP2A 2YP6A 3F3QA 1PX7A 2VCWA 2HZEB 1ILOA 2YJ7A 4IJIA 2IPAA 2H74A 2IMFA 4KA0A 5DJLA 4K7IA 3US3A 2CAQA 5CRWA 2NTOA 2F3MA 4OMVA 2ON5A 1TI1A 3EINA 5KN1A 1X0RA 1TKDB 3LSZA 4YQVA 1IYIA 3RHBA 4ZXGA 1NW2A 5IMAA 2DLXA 1X5EA 3ZL5A 2FWFA 3F6DA 5D93A 1E2YA 1BQ7A 2MMZA 3LYPA 1TRSA 1Q98A 5AIVA 3QAVA 2WJUA 2C3QA 1GTUA 4MJBA 4RI7A 20GSA 3WD6A 2VLUA 4MH3A 2GLRA 1XVQA 2PPTA 2DJ1A 1M2DA 2L6CA 1AQVA 2VCZA 4V2NA 3ISOA 4GRFA 1R4WA 9GSSA 2IL3A 3I6AA 4P3YB 3RHCA 5C04A 2WFCA 3QOUA 1X9MB 4ZB6A 4USSA 5IMDA 2TIRA 4KGIA 3DEXA 2GDRA 1G7EA 3LORA 2LV3A 3W8SA 4K9ZA 1XWGA 1V9WA 3U6VA 4I2UA 3CSHA 4MPFA 5CAXA 4IKHA 4O5RA 2IN3A 5DQYA 3PPUA 4XCSA 5INYA 1TXXA 1QK8A 1ZCPA 4PUAA 1RQMA 1VF3A 1ERWA 5HFGA 2YANA 4L0UA 3KM6A 1U3IA 3CBUA 4N10A 3TCOA 1N8JA 3D21A 3DKSA 1SL1B 22GSA 1T1VA 2VLVA 4WEYA 4GSNA 4L0WA 2HRKA 2M46A 1Y25A 2FA4A 1VGLA 1SKWB 3ZFLA 1SJ6A 1ZYEA 4GQFA 2QGVA 1A23A 5IMFA 1TW9A 3E9JB 6GSTA 2PBJA 2L59A 3G7JA 2EIQA 3UJ1A 11GSA 4MJAA 3D22A 4GSTA 1R26A 1XW5A 5DCHA 3JCML 2JACA 1U3AA 2J23A 5BMUA 1FW1A 3VFIA 3WGEA 4J2FA 1GUKA 3IR4A 2OE3A 3DMLA 2P5RA 1TU7A 2O87A 4XRDA 4TOPA 5LCZA 4KCEA 3D5JA 1ERVA 3GSTA 3GNJA 4K0NA 2FWGA 4JU5A 3GX0A 1K0NA 2DIZA 2H1DA 4BA7A 2YNXA 3LFLA 1BEDA 1O85A 5KN3A 5GZZB 1JHBA 5ID2A 4JZQA 5G30A 4ID0A 4OO4A 3Q6OA 1AW9A 1GLPA 5DQSA 1UC7A 1WWJA 3UIWA 1PKWA 5ELAA 3TGZA 3SWLA 1CQGA 1SYRA 4JE1A 3Q74A 2EIRA 3RPPA 1TK0B 1WOUA 1XWBA 4K6XA 1XW9A 3CTGA 1THOA 3HZ4A 5A4WA 2EIOA 3F9UA 4ZL8A 3TJGA 4K2DA 4MABA 2C0EA 1GSDA 3IHQA 2H0GA 1MTCA 5IO0A 1B9XC 1NHOA 2AYTA 1SENA 2H0HA 4WETA 1HYUA 5DAKB 2FHEA 2DSAA 3ED3A 1X5CA 5J4UA 3HD5A 1TOFA 2GQMA 1XVWA 2R6KA 2VCTA 2ZCTA 2N5FA 4XIHA 4HU9A 2HT9A 5A4UA 3L9UA 3TUEA 2CVDA 4PNGA 2HSNB 2YPMA 3H8QA 1QMVA 4NMUA 3CRUA 5FT3A 2B5EA 3CTFA 3FZ4A 3G7YA 5ECRB 3KP8A 3FR6A 2WCIA 2O85A 3FZ9A 2PWJA 4ZB8A 1U88A 3F63A 4V1Ap 1SKSB 2JZTA 1YEPA 1E6BA 3BCKA 2WULA 2LJAA 2VAFA 3QCPA 2JL4A 2HLSA 1F3AA 4TW5A 2NVLA 2FCHA 4NHZA 3P8WA 2XHFA 1M9AA 4MH2A 5H5SA 3MNGA 4PX1A 2H76A 3TDGA 3HXSA 4IQAA 4BWSA 5L71A 3ZIVA 3NIVA 4EC0A 1V58A 2VL2C 3FEUA 2IMKA 5AIXA 3APQA 1Q4JA 5EPFA 1MDKA 2PGTA 4EDYA 4TRXA 4TR4A 2K9FA 4PQIA 3HJPA 3LG6A 4WBJA 2DC5A 4EE0A 3WGDA 2LTKA 4ZBBA 2I81A 1B8XA 4ILFA 5B6MA 4NV2A 1A8YA 3QPMA 5J5NA 3IDVA 2MMOA 1TP9A 4KAEA 4BPYA 2LJKA 3PINA 4HJMA 1SU9A 3UVTA 1O81A 2OACA 4FQUA 3ZFBA 1GTIA 2LUSA 6GSUA 1NM3A 3DIEA 3CXGA 4IHUA 3ZYWA 3KEBA 3KP9A 2DJJA 3ME7A 4JRRA 3O3TA 3CYNA 3IC4A 1ERUA 4HJ2A 1WIKA 3H4KA 1TTZA 1FG4A 4MCUA 1SJZA 3HY2A 1V40A 2IFQA 4K0GA 4O92A 5EVOA 2H6ZA 3TRPA 1A2JA 2OBIA 2H8LA 3TOTA 4I97A 2R4VA 3DYRA 4I5QA 3FKFA 3KD0A 1GUHA 2GSRA 3QR6A 3BJ5A 5CREA 4HOJA 1XOAA 3Q19A 2DJ2A 18GSA 3FZAA 2KOKA 3L9VA 1PX6A 4WBRD 2K8VA 2C0FA 2FWEA 1SK0A 1YF0A 4MF5A 2AAWA 5G2ZA 1EEMA 2RIIA 3FR3A 2CVKA 3PR8A 3C8EA 3LJRA 1USBA 4XHMA 2C3TA 3BD2A 2OADA 4BVYB 1F9MA 3G7IA 4MJEA 1K3OA 4L8EA 4LA1A 3ERFA 4X43A 4KUNA 3KGKA 4GWRA 3CMIA 1GRXA 2JZSA 2JU5A 4ECCA 2H75A 4F0CA 3APOA 3GL5A 5F07A 4CDOA 3R2QA 3GN3A 2R3XA 1FO5A 2PMTA 5JWRB 3DRNA 4HEA2 2WRTA 1MDIA 5D9XA 4E8HA 2DIYA 5IMVA 5KN0A 4EDZA 2IIYA 3IA1A 4MMMA 5HR2A 1GL8A 4J56E 3ERGA 6GSXA 2YZHA 1AAZA 1YF1A 3NOFA 3HYPA 4I2TA 1B48A 3UEMA 10GSA 3KMNA 4GXZA 4KSMA 2VIMA 2PUKC 3A3TA 2XPDA 2HSMB 1M0UA 1M7TA 3TJFA 1XCCA 4TXOA 5DBQA 1Z6MA 2XBIA 1CQHA 1GNWA 1WMJA 3KIJA 2B5XA 3ERWA 5DCGA 4CW9A 19GSA 2L4CA 2F51A 2HSMA 5A5KA 1K0OA 2V32A 5DDLA 3GL3A 4EUYA 2LRNA 1HNBA 1ZYQB 1SL2B 2AUVA 3GMFA 2VL9A 4ISDA 4GTUA 4MK3A 4H86A 1EZKA 1SD9A 2ALBA 4HQSA 3GH9A 2DJ3A 1O7UA 3ME8A 1AC1A 4MF7A 1F37A 3F8UA 3EU3A 1BG5A 1SJIA 5GSTA 2CZ2A 2GZYA 1EP8A 2DMLA 3ZMKA 3E3EA 4MZBA 4PNFA 3C7MA 4E8EA 2C8UA 3VPQA 4N30A 1K0CA 2H19A 1XOBA 1DBYA 3O6TA 4MA9A 2JADA 5B6NA 5CRHA 1ST9A 3QFAC 4DVCA 2O89A 4IELA 5ECQB 3GKNA 2CVBA 1JLWA 1PKZA 2VOCA 2PU9C 2HRKB 4AJ6A 3TKSA 1XPVA 4EKZA 1R5PA 1GTBA 3TKSE 2HE3A 1URMA 3M1GA 5D9WA 2GGTA 1ABAA 3UOMA 2BMXA 2X8GA 3EURA 4TR1A 4YQUA 4FYBA 2FWHA 1HD2A 1M2BA 3KH7A 2HRFA 3KTLA 4F82A 3QMXA 1ZGNA 4I8BA 3VK9A 5DJMA 2OBKA 4WR5A 2P0GA 3DVWA 5IPGA 2GQLA 2QSIA 1TK8B 3KZQA 3KXOA 3ZVJD 3M8NA 1SKRB 2I3YA 5COHA 1AQXA 3CRTA 2VL2A 2YWOA 2VL3A 1O6JA 4OWYA 1QXHA 1V2AA 3DWVA 1FB6A 5G1KA 2VM2A 4ZIJA 2AB6A 1YY7A 5IM9A 4TR0A 4EL1A 5G5FA 4KNDA 5B7CA 1Y6EA 2BTOT 4LL1B 4LMVA 4OCFA 5ID2B 1AXDA 1EGOA 2L4QA 4K1FA 5H5RA 2H71A 3EYTA 4PXOA 2FD3A 1Z7RA 3S9FA 2VM1A 1R7HA 4ECJA 1H4OA 4EVMA 4XS6A 1GUMA 4F9ZA 5ECOB 3IBHA 4YAVA 2M80A 1EEJA 3FR9A 4EXJA 4BWQA 1YDKA 1G6YA 4TXVA 3TJJA 4Z7XA 1TI3A 4WXTA 5HR1A 2VD0A 4NHWA 1DSBA 3OR5A 5EL8A 2HNLA 2N5BA 5H5QA 1GSYA 3ZZXA 3HKRA 5DALA 3P90A 2H6YA 5ENUA 3VWUA 4BL7A 3HJOA 3E0UA 1EV9A 4Q5NA 1WP0A 3C1SA 1TK5B 2GSSA 3F4SA 1WJKA 5ECHB 2M72A 5CRGA 4Q5FA 7GSSA 3P7XA 3H93A 2MBSA 2CAIA 5JCUA 5D96A 4AJ7A 1XWCA 3HVSA 2HQTA 2NDOA 3L4NA 3GTUB 3TOUA 1ACVA 4QL9A 3FHKA 2ZNMA 2CX4A 1OC9B 3I43A 4OD7A 3RBTA 2FY6A 4NAXA 1O73A 1W4VA 4ACSA 2E2GA 5G1LA 3IK9A 5JWOB 1MD4A 2Z9SA 6GSVA 2EC4A 3DXBA 1T3BA 2FLSA 4RQXA 2F8AA 3TJKA 3GTUA 2VLTA 2RUEA 2H6XA 1OC9A 3N5OA 5D9TA 4FO5A 2AHEA 2V1MA 4JR4A 4G9HA 4POLA 3LGCA 1PMTA 1A0FA 3I9V2 1K3LA 1WE0A 1HNAA 1ERTA 2MMNA 3DD3A 1OKTA 1S3DA 2DJ0A 4FYUA 1KNGA 4IN0A 3EU4A 5HR3A 3VI5A 3F4RA 5HFIA 2XBQA 1GULA 4YH2A 2C0GA 5IOWA 2A4VA 3GA4A 3F3RA 3SBCA 4G10A 1GLQA 2R2JA 2B1LA 2B7JA 3VWWA 4G2EA 1F6MC 1W89A 5G5EA 1JZWA 3GH6A 2PVOC 4ECIA 2F9SA 1SYXA 2H30A 4PGTA 1SK1A 4OFNA 1T00A 2X8HA 1YEXA 1T7PB 2H1GA 5AGYA 2CZ3A 3QAGA 1EV4A 3HVXA 3K8NA 4V1Ag 2X8CA 3LXZA 3M3MA 3J7Yb 1XW6A 3HDCA 4MJCA 4X0XA 4DSRA 4RUVA 2IFQB 14GSA 2YZUA 3A2WA 2GSTA 1DE1A 5J3RA 2KLXA 5CYYA 2HFDA 4K7OA 4AF2A 4XRAA 2FUG2 2YWIA 2WZ9A 1Z5YE 1QUWA 4OFMA 5F8BA 2YCDA 3DGQA 17GSA 1F3BA 4MPGA 4N0VA 3EWLA 2GZPA 4QQ7A 2MMAA 2R37A 4ML1A 4G0KA 4IVFA 3LEFA 1C72A 2QC7A 3EVIA 2F8FA 2V41A 1FVKA 1JZRA 4O7HA 1XBSA 2B6MA 1OAZA 5AN1A 3QFBC 2GTUA 1EP7A 1K0AA 3G9BA 3GSSA 1GSFA 1PL2A 5IMCA 3L0HA 2LKUA 1ON4A 4KDXA 2GT5A 5ECPB 1XWKA 4GF0A 3A2XA 2NBSA 2HSYA 5ECLB 1K3YA 2IMIA 2IMEA 3C71A 4HS1A 1TRVA 3V1WA 1V57A 4HZ2A 3D4MA 1V98A 4D73A 4HI7A 4XS4B 8GSSA 1AUCA 2HRNA 1LBKA 3UAPA 1A8LA 3QD9A 1Z6NA 4IQ1A 4I6XA 4IJ3A 4TN8A 4KF9A 1B4QA 2HYXA 4RQRA 1H75A 4MF6A 2YV7A 5ECSA 3HZ8A 5G31A 4LL4B 2L5OA 2GZZA 4XS4A 2RUFA 2A2RA 3KMOA 4BVXA 3UBKA 1FB0A 2CA8A 4ML6A 3HVVA 3CSIA 1OVNA 5ECIB 2V2GA 4KDYA 2VD1A 2VCVA 4TXOB 2LS5A 5LD0A 4JBBA 3O76A 4WF4A 3GYKA 3WT2A 1TRWA 1ML6A 1PN9A 2WDUA 4JR6A 1YZXA 3VI7A 3UL3A 1FOVA 1MD3A 1FAAA 2XPEA 2H72A
chains in the Genus database with same CATH superfamily
3H79A 4TR3A 3TKRA 5D9VA 2HZEA 3ZTLA 1R5AA 2DJKA 4ZL9A 1OKDA 1NHYA 3GV1A 4GQCA 1U6TA 3P2AA 4MP4A 2JSYA 1OE7A 2JZRA 5C00A 1A2LA 1EWXA 2MBTA 3FY7A 2V6OA 2WW0A 1GH2A 4FYCA 3M0FA 1N2AA 3LYKA 2H70A 4KH7A 2LEGA 4TVEA 4PQ1A 5E59A 3J7Yk 3KJYA 2R0PA 4IS0A 2YV9A 2B3SA 3TB2A 2HSHA 1UN2A 2VUPA 1RW1A 3A5WA 4OCEA 4KSOA 4POKA 3GIXA 5CP1A 2UZ8A 4ZL7A 4EO3A 5IQYA 2LJRA 1PD21 5J9BA 3U5RE 2BJXA 2C3NA 1I5GA 2GSQA 4O32A 3GURA 1PA3A 3F4TA 2GT6A 2NPBA 5FWGA 1TDIA 1J08A 1ZOFA 3ZITA 4PURA 5J9CA 1T8EB 1NSWA 3A2VA 3N9JA 2WGRA 4NWYA 3VPTA 3TKPA 3MWHA 3D0ZA 3LXTA 3F0IA 4F03A 3IK7A 4QL7A 5EY6A 4IP1A 2HZFA 2HRAA 3PGTA 5GAPD 1X9WB 1JZOA 1B4PA 4LMWA 6GSYA 1T4YA 3BCIA 2HI7A 2C1YA 3C1RA 4TR1B 4CY8A 4L5LA 3TKQA 3FK8A 1IYHA 4K8MA 5ELGA 4EF0A 2ZUPA 4N3ZA 3L78A 1G6WA 3NZNA 2H73A 4WR4A 4FH8A 2VCQA 2KUCA 1K0BA 1BYEA 1VF2A 4NXIA 3CSJA 1FVJA 4KX4A 2KHPA 4J57E 4TKYA 3MDKA 1YKCA 4G19A 3QDNA 2K8SA 2VKZG 2MYGA 3D6IA 2R0GA 1SK2A 4XS1A 2GS3A 3ZIJA 5F06A 1QFNA 1Z3EA 1S3AA 1BAYA 1YKAA 1GSEA 5J41A 2YWNA 2GVPA 1LJRA 5HR0A 2B7KA 4ZBDA 5A1NB 2C80A 2P31A 2I9HA 1MDJA 4ECBA 2P5QA 1ZZYA 2A2SA 4GCIA 1F2EA 4MZCA 3WYWA 3GKMA 4JEDA 1I9DA 2X99A 2AV4A 3KCMA 3MSZA 2IMDA 3GHAA 4AJ8A 2YJHA 2CT6A 5KOXA 5IOXA 3IE3A 5JCGA 3HJMA 2GQKA 2KP1A 3EMXA 3AY8A 3DVXA 2IJYA 4AKHA 3UVHA 3FW2A 1A0RP 3CWGA 5CRDA 2K18A 4MNNA 5JWQB 2VO4A 3EMPA 1GP1A 1A24A 4XTSA 2ES7A 1VF1A 1ZMAA 2JSZA 1M99A 2DBCA 5DALB 1XIYA 3KH9A 3IRAA 2E7PA 3LQ7A 3KTBA 3WT1A 2TRXA 1M2AA 2EFEA 1KTEA 4BL7B 2WVXB 5A5HB 1JLVA 3GFKA 1O8WA 3WGXA 4FXYP 2O8VB 1PN0A 3VURA 5GAND 2REMA 5BRTA 2OJLA 2L6DA 5GSSA 2LNTA 3ZRDA 2C4JA 1U87A 5ABRA 2AJQB 2FNOA 5B8BA 2LQQA 2YOIA 3FRCA 2LSTA 2OA7A 4CHSA 1XZOA 2ON7A 3APSA 2C0DA 3IOSA 2L57A 4V2LA 3BOAA 1EOGA 3Q18A 4DEJA 5IIZA 3FYGA 2PVQA 4Q5RA 3M9JA 12GSA 2E0QA 1OC3A 2QKEA 3R3EA 5KEJA 2CQ9A 3C73A 1XFLA 3EE2A 1PRXA 5IMZA 3I69A 4X1UA 4GLTA 1X5DA 1TU8A 1YJ6A 1HQOA 4LLRA 2J9HA 2B1KA 1XXUA 4F2IA 2H01A 1JZDA 1PSQA 4HUAA 1B9YC 1OC8A 3BBYA 4ZILA 4NV5A 5CNWA 5DAKA 3ZLPA 1J0FA 3TKSC 5JCWA 3F6FA 2OE1A 2V6KA 3GRXA 1RK4A 1S3CA 3RPNA 2D2ZA 3VLNA 4K2XA 1SVOA 5KN2A 1HNCA 1OYJA 1FHEA 1J9BA 5B8AA 2H1AA 3LWAA 4L5OA 5J47A 3RAZA 4HZ4A 1TJDA 2N5AA 3MAKA 5D8IA 1K0DA 4Z2RA 3HA9A 1G7OA 5FHIA 2WB9A 2I1UA 2HSNA 5CO3A 5HFKA 2FGXA 3UMAA 2H1BA 3PH9A 2LRCA 1DE2A 4Q5QA 2R5GA 4IW9A 3H1NA 4G0LA 2G2QA 2RM5A 1WRYA 4WF5A 5DVBA 1KBNA 1EOHA 1VF4A 1SL0B 1JFUA 1PGTA 1DUGA 3IAM2 4F0BA 5ECKB 4PTSA 2H66A 2FA8A 5LNKe 3ZMLA 4DSSB 1PL1A 1ZL9A 4GSSA 3TJBA 4G0IA 2L5LA 4V2MA 3IAS2 4IP6A 4MDCA 1EGRA 4YAPA 4POBA 4WKWA 2YWMA 5AISA 3IPZA 6GSSA 3TRQA 3GX8A 4IBPA 3QAWA 5F05A 3M9KA 1MEKA 4DSSA 5A4VA 1Z7PA 1O8XA 1X9SB 5D73A 5ECMB 1K0MA 3IV4A 3IXRA 3ZREA 4N0ZA 1SD8A 2RM6A 5ECNB 1THXA 2MZCA 5F0GA 4KCAA 3FZ5A 2O7KA 4ZB9A 4MZWA 3VWXA 4N11A 1I1IP 1VRSD 3ZVJA 2I4AA 1YQ1A 1LU4A 1TRUA 1M9BA 1FOHA 4ULXA 1A2MA 4OFTA 2HXKA 2CV4A 3UBLA 4KB3A 2K6VA 2TRCP 2XC2A 2G0FA 3IC8A 4MLYA 2VCXA 3L9SA 2H0IA 4ZBAA 13GSA 1GSUA 2YN1A 1GWCA 1KEBA 4NPBA 2OKAA 3UARA 1AIUA 4AGSA 5IO2A 2B5YA 2RLIA 3W8JA 1PQNA 3D4TA 3HHVA 1OE8A 4IGJA 1T4ZA 4PQHA 5IPHA 4O5QA 4POMA 5E4WA 1G0TA 4KDUA 3VWVA 4HQZA 4D73B 3GUSA 2CX3A 4RI6A 5J40A 3MIXA 1UA5A 4OO5A 1BJXA 2X49A 6GSWA 1XWAA 2X64A 1GNEA 3EPTA 1GSSA 3EC3A 2IWTA 1QGVA 4DSQA 4KW6A 1WPIA 3GKXA 2OE0A 4BVXB 1AQWA 2E2MA 2WS2A 3RDWA 2DMMA 1GSQA 2LNSA 3HCZA 2LQOA 4FIWA 1UVZA 3GKKA 2PN8A 4BVYA 1BX9A 1QQ2A 5HQPA 4KE3A 4YQMA 3TRXA 2LRTA 16GSA 4PUFC 3A5IA 4HU7A 3W6GA 4HDEA 4K7NA 2PERA 1Z9HA 1GTAA 2KP2A 2YP6A 3F3QA 1PX7A 2VCWA 2HZEB 1ILOA 2WW1A 2YJ7A 4IJIA 2IPAA 2H74A 2WW2A 2IMFA 4KA0A 5DJLA 4K7IA 3US3A 2CAQA 5CRWA 3TU3B 2NTOA 2F3MA 4OMVA 2ON5A 1TI1A 3EINA 5KN1A 1X0RA 1TKDB 3LSZA 4YQVA 4HSCX 1IYIA 3RHBA 4ZXGA 1NW2A 5IMAA 2DLXA 2EFDA 1X5EA 3ZL5A 2FWFA 3F6DA 5D93A 1E2YA 1BQ7A 2MMZA 3LYPA 1TRSA 4A5PA 1Q98A 5AIVA 3HMJG 3QAVA 2WJUA 2C3QA 1GTUA 4MJBA 4RI7A 20GSA 3WD6A 2VLUA 4MH3A 2GLRA 1XVQA 2PPTA 2DJ1A 1M2DA 2L6CA 1AQVA 2VCZA 4V2NA 3ISOA 4GRFA 2OT3A 1R4WA 9GSSA 2IL3A 3I6AA 4P3YB 3RHCA 5C04A 2WFCA 4EIPA 3QOUA 3MYDA 1X9MB 4ZB6A 4USSA 4PI2C 1YEWC 5IMDA 2TIRA 4KGIA 3DEXA 2GDRA 1G7EA 3LORA 2LV3A 3W8SA 4K9ZA 1XWGA 1V9WA 3U6VA 4I2UA 3CSHA 4MPFA 5CAXA 4IKHA 3RFRC 4O5RA 2IN3A 5DQYA 3PPUA 4XCSA 2A2PA 5INYA 1TXXA 1QK8A 1ZCPA 4PUAA 1RQMA 1VF3A 2EFCA 1ERWA 5HFGA 2YANA 4L0UA 3KM6A 4ZB7A 1U3IA 3CBUA 4N10A 3TCOA 4K5RA 1N8JA 3D21A 3DKSA 1SL1B 22GSA 1T1VA 2VLVA 4WEYA 4GSNA 4L0WA 2HRKA 4AKIA 1Y25A 3IHGA 1VGLA 2FA4A 2M46A 1SKWB 3ZFLA 1SJ6A 1ZYEA 4GQFA 2QGVA 1A23A 5IMFA 1TW9A 3E9JB 6GSTA 2PBJA 2L59A 3G7JA 2EIQA 3UJ1A 11GSA 4MJAA 3D22A 4GSTA 1R26A 1XW5A 5DCHA 3JCML 2JACA 1U3AA 2J23A 5BMUA 1FW1A 3VFIA 3WGEA 4J2FA 1GUKA 3IR4A 2OE3A 3DMLA 2P5RA 1TU7A 4PHZC 4PI0C 2O87A 4XRDA 4TOPA 5LCZA 4KCEA 3D5JA 1ERVA 3GSTA 1N25A 3GNJA 4Z2TA 4K0NA 2FWGA 4JU5A 3GX0A 1K0NA 2DIZA 2H1DA 4BA7A 2YNXA 3LFLA 4QMKA 1BEDA 1O85A 5KN3A 5GZZB 2O3EA 1JHBA 5ID2A 4JZQA 5G30A 1TXUA 4ID0A 3CQFA 4OO4A 3Q6OA 1AW9A 1GLPA 5DQSA 1UC7A 1WWJA 3UIWA 1PKWA 5ELAA 3TGZA 3SWLA 1CQGA 1SYRA 4JE1A 3Q74A 2EIRA 3RPPA 1TK0B 1WOUA 4AI6A 1XWBA 4K6XA 1XW9A 3CTGA 1THOA 3HZ4A 5A4WA 2EIOA 3F9UA 2R0CA 4Z2UA 4ZL8A 3TJGA 4K2DA 4MABA 2C0EA 1GSDA 3IHQA 2H0GA 1MTCA 5IO0A 1B9XC 1NHOA 2AYTA 1SENA 2H0HA 4WETA 1HYUA 5DAKB 2FHEA 2DSAA 3ED3A 1X5CA 5J4UA 3HD5A 1TOFA 2GQMA 1XVWA 5A34A 2R6KA 2VCTA 2ZCTA 2N5FA 4XIHA 4HU9A 2HT9A 5A4UA 3L9UA 3TUEA 2CVDA 4PNGA 2HSNB 2YPMA 3H8QA 1QMVA 4NMUA 3CRUA 5FT3A 2B5EA 3CTFA 3FZ4A 3G7YA 5ECRB 3KP8A 3FR6A 2WCIA 2O85A 3FZ9A 2PWJA 4ZB8A 1U88A 3F63A 4V1Ap 1SKSB 2JZTA 1YEPA 1E6BA 3BCKA 2WULA 2LJAA 2VAFA 3QCPA 2JL4A 2HLSA 1F3AA 4TW5A 2NVLA 2FCHA 4NHZA 3P8WA 2XHFA 1M9AA 4MH2A 5H5SA 3MNGA 4PX1A 2H76A 3TDGA 3HXSA 4IQAA 4BWSA 5L71A 3ZIVA 3NIVA 2WZSA 4EC0A 1V58A 2VL2C 3FEUA 2IMKA 5AIXA 4BIKA 3APQA 1Q4JA 5EPFA 1MDKA 2PGTA 4EDYA 4TRXA 4TR4A 2K9FA 2H1LA 4PQIA 3HJPA 3LG6A 4WBJA 2DC5A 4EE0A 3WGDA 3LW9A 2LTKA 4ZBBA 2I81A 1B8XA 4ILFA 5B6MA 4NV2A 1A8YA 3QPMA 5J5NA 3IDVA 1YVLA 2MMOA 1TP9A 4KAEA 4BPYA 2LJKA 3PINA 4HJMA 1SU9A 3UVTA 1O81A 2OACA 4FQUA 3ZFBA 1GTIA 2LUSA 6GSUA 1NM3A 3DIEA 3CXGA 4IHUA 3ZYWA 3KEBA 3KP9A 2DJJA 3ME7A 4G01A 4K5SA 4JRRA 3O3TA 3CYNA 3IC4A 1ERUA 4HJ2A 1WIKA 3H4KA 1TTZA 1FG4A 4MCUA 4ICYA 1SJZA 3HY2A 1V40A 2IFQA 4K0GA 4O92A 5EVOA 2H6ZA 3TRPA 1A2JA 2OBIA 2H8LA 3TOTA 4I97A 2R4VA 3DYRA 4I5QA 3FKFA 3KD0A 1GUHA 2GSRA 3QR6A 3BJ5A 5CREA 4HOJA 1XOAA 3Q19A 2DJ2A 18GSA 3FZAA 2KOKA 3L9VA 1PX6A 4WBRD 4YKFA 2K8VA 2C0FA 2FWEA 1SK0A 1YF0A 4MF5A 2AAWA 5G2ZA 1EEMA 2RIIA 3FR3A 2CVKA 3PR8A 3C8EA 3LJRA 4AKGA 1USBA 4XHMA 2C3TA 1ZYPA 3BD2A 2OADA 4BVYB 1F9MA 3G7IA 4MJEA 1K3OA 4L8EA 4LA1A 2O5VA 3ERFA 4X43A 4KUNA 3KGKA 4GWRA 3CMIA 1GRXA 2JZSA 2JU5A 4ECCA 2H75A 4F0CA 3APOA 1M3JA 3GL5A 5F07A 4CDOA 3R2QA 3GN3A 2R3XA 1FO5A 2PMTA 5JWRB 3DRNA 4HEA2 1Y1UA 2WRTA 1MDIA 5D9XA 4E8HA 2DIYA 5IMVA 5KN0A 4EDZA 2IIYA 3IA1A 4MMMA 2DKIA 5HR2A 1GL8A 4J56E 3ERGA 6GSXA 2YZHA 1AAZA 1YF1A 3NOFA 3HYPA 4I2TA 1B48A 3UEMA 10GSA 3KMNA 4GXZA 4KSMA 2VIMA 2PUKC 3A3TA 1S4BP 2XPDA 2HSMB 1M0UA 1M7TA 3TJFA 1XCCA 4TXOA 5DBQA 1Z6MA 2XBIA 1CQHA 1GNWA 1WMJA 3KIJA 2B5XA 3ERWA 5DCGA 4CW9A 19GSA 2L4CA 2F51A 2HSMA 5A5KA 1K0OA 2V32A 5DDLA 3GL3A 4EUYA 2LRNA 1HNBA 1ZYQB 1SL2B 2AUVA 3GMFA 2VL9A 4ISDA 4GTUA 4MK3A 4H86A 1EZKA 2WVYA 1SD9A 2ALBA 2WW3A 4HQSA 3GH9A 2DJ3A 1O7UA 1AC1A 3ME8A 4MF7A 1F37A 3F8UA 3EU3A 1BG5A 1SJIA 5GSTA 2CZ2A 2GZYA 1EP8A 2DMLA 3ZMKA 3E3EA 4MZBA 4PNFA 3C7MA 4E8EA 2C8UA 3VPQA 4N30A 1K0CA 2H19A 1XOBA 1DBYA 3O6TA 4MA9A 2JADA 5B6NA 5CRHA 1ST9A 3QFAC 4DVCA 2O89A 4IELA 5ECQB 3GKNA 2CVBA 1JLWA 1PKZA 2VOCA 2PU9C 2HRKB 4AJ6A 3TKSA 1XPVA 4EKZA 4O5UA 1R5PA 1GTBA 3TKSE 2HE3A 1URMA 3M1GA 5D9WA 2GGTA 1ABAA 3UOMA 4X4JA 2X8GA 2O36A 2BMXA 3EURA 4TR1A 1SVLA 4YQUA 4FYBA 2FWHA 1HD2A 1M2BA 3KH7A 2HRFA 3KTLA 4F82A 3QMXA 1ZGNA 5BMUB 4I8BA 3VK9A 5DJMA 2OBKA 4WR5A 2P0GA 3DVWA 5IPGA 2GQLA 2QSIA 1TK8B 3KZQA 3KXOA 3ZVJD 3M8NA 1SKRB 3FMWA 2I3YA 5COHA 1AQXA 3CRTA 2VL2A 2YWOA 2VL3A 1O6JA 2DKHA 4OWYA 1QXHA 1V2AA 3DWVA 1FB6A 5G1KA 2VM2A 4ZIJA 2AB6A 1YY7A 5IM9A 4TR0A 1PFOA 4EL1A 5G5FA 4KNDA 5B7CA 1Y6EA 2BTOT 4LL1B 3HVNA 4LMVA 4OCFA 5ID2B 1AXDA 1EGOA 2L4QA 4K1FA 5H5RA 2H71A 4AKXB 3EYTA 4PXOA 2FD3A 5A1NA 3CHXC 1Z7RA 2VM1A 3S9FA 1R7HA 4ECJA 1H4OA 4EVMA 1M3IA 4XS6A 1GUMA 4EIQA 4F9ZA 5ECOB 3IBHA 4YAVA 2M80A 1EEJA 3FR9A 4EXJA 4BWQA 1YDKA 1G6YA 4TXVA 3TJJA 4Z7XA 1TI3A 4WXTA 5HR1A 2VD0A 4NHWA 1DSBA 3OR5A 5EL8A 2HNLA 2N5BA 5H5QA 1GSYA 3ZZXA 3HKRA 5DALA 3P90A 2H6YA 5ENUA 1SVMA 3VWUA 4BL7A 2WVXA 3HJOA 5A5HA 3E0UA 1EV9A 4Q5NA 1WP0A 3C1SA 1TK5B 5A34B 2GSSA 3F4SA 1WJKA 5ECHB 2M72A 5CRGA 1ZYNA 4Q5FA 7GSSA 3P7XA 3H93A 2MBSA 2CAIA 5JCUA 4E68A 5D96A 4YKGA 4AJ7A 1XWCA 3HVSA 2HQTA 2NDOA 3L4NA 3GTUB 3TOUA 1ACVA 4QL9A 5J4VA 3FHKA 2ZNMA 2CX4A 1OC9B 3I43A 4OD7A 3RBTA 2FY6A 4NAXA 1O73A 1W4VA 4ACSA 2E2GA 5G1LA 1S3RA 3IK9A 5JWOB 1MD4A 2Z9SA 6GSVA 2EC4A 3DXBA 1T3BA 2FLSA 4RQXA 2F8AA 3TJKA 3GTUA 4GDFA 2VLTA 2RUEA 2H6XA 1OC9A 3N5OA 5D9TA 4FO5A 2AHEA 2V1MA 4JR4A 4G9HA 4POLA 3LGCA 1PMTA 1A0FA 3I9V2 1K3LA 1WE0A 1HNAA 1ERTA 2UV8G 2MMNA 3DD3A 1OKTA 1S3DA 2DJ0A 4FYUA 1KNGA 4IN0A 3EU4A 1XG8A 5HR3A 3VI5A 3F4RA 5HFIA 2XBQA 1GULA 4YH2A 2C0GA 5IOWA 2A4VA 5KOWA 3GA4A 3F3RA 3SBCA 4G10A 1GLQA 2EFHA 2R2JA 2B1LA 2B7JA 3RGBC 3VWWA 4G2EA 1F6MC 1W89A 5G5EA 1BF5A 1JZWA 3GH6A 2PVOC 4ECIA 2F9SA 1SYXA 2H30A 4PGTA 1SK1A 4OFNA 1T00A 2X8HA 1YEXA 1T7PB 2H1GA 5AGYA 2CZ3A 3QAGA 1EV4A 3HVXA 5J4YA 3K8NA 1BG1A 4V1Ag 2X8CA 3LXZA 3M3MA 3J7Yb 1XW6A 3HDCA 4MJCA 4X0XA 4DSRA 4RUVA 2IFQB 14GSA 2YZUA 3A2WA 2GSTA 1DE1A 5J3RA 2KLXA 5CYYA 2HFDA 4K7OA 4AF2A 4XRAA 2FUG2 2YWIA 2WZ9A 1Z5YE 1QUWA 4OFMA 5F8BA 2YCDA 4CY6A 3DGQA 17GSA 1F3BA 4MPGA 4N0VA 3EWLA 2GZPA 4QQ7A 2MMAA 2R37A 4ML1A 4G0KA 4IVFA 3LEFA 1C72A 4W66A 2QC7A 3EVIA 2F8FA 2V41A 1FVKA 1JZRA 4O7HA 1XBSA 2B6MA 1OAZA 5AN1A 3QFBC 2GTUA 1EP7A 1K0AA 3G9BA 3GSSA 1GSFA 1PL2A 5IMCA 3L0HA 2LKUA 2X4AA 1ON4A 4KDXA 2GT5A 5ECPB 1XWKA 4GF0A 3A2XA 2NBSA 2HSYA 5ECLB 1K3YA 2IMIA 2IMEA 3C71A 4HS1A 1TRVA 2A4HA 3V1WA 2WVZA 1V57A 2QA1A 4HZ2A 3D4MA 1V98A 4D73A 4HI7A 4XS4B 8GSSA 1AUCA 2HRNA 1LBKA 3UAPA 1A8LA 3QD9A 1Z6NA 4IQ1A 4I6XA 4IJ3A 4TN8A 4KF9A 1B4QA 2HYXA 4RQRA 1H75A 4MF6A 2YV7A 5ECSA 3HZ8A 5G31A 4LL4B 2L5OA 2GZZA 4XS4A 2RUFA 2A2RA 3KMOA 4BVXA 3UBKA 1FB0A 2CA8A 4ML6A 2QA2A 3HVVA 3CSIA 1OVNA 5ECIB 2V2GA 4KDYA 2VD1A 2VCVA 4TXOB 2LS5A 5LD0A 4JBBA 3O76A 4WF4A 3GYKA 3WT2A 1TRWA 1ML6A 1PN9A 2WDUA 4JR6A 1YZXA 3VI7A 3UL3A 1FOVA 1MD3A 1FAAA 2XPEA 2H72A
chains in the Genus database with same CATH topology
3H79A 4TR3A 3TKRA 5D9VA 2HZEA 3ZTLA 1R5AA 2DJKA 4ZL9A 1OKDA 1NHYA 3GV1A 4GQCA 1U6TA 3P2AA 4MP4A 2JSYA 1OE7A 2JZRA 5C00A 1A2LA 1EWXA 2MBTA 3FY7A 2V6OA 1GH2A 4FYCA 3M0FA 1N2AA 3LYKA 2H70A 4KH7A 2LEGA 4TVEA 4PQ1A 5E59A 3J7Yk 3KJYA 2R0PA 4IS0A 2YV9A 2B3SA 3TB2A 2HSHA 1UN2A 2VUPA 1RW1A 3A5WA 4OCEA 4KSOA 4POKA 3GIXA 5CP1A 2UZ8A 4ZL7A 4EO3A 5IQYA 2LJRA 1PD21 5J9BA 3U5RE 2BJXA 2C3NA 1I5GA 2GSQA 4O32A 3GURA 1PA3A 3F4TA 2GT6A 2NPBA 5FWGA 1TDIA 1J08A 1ZOFA 3ZITA 4PURA 5J9CA 1T8EB 1NSWA 3A2VA 3N9JA 2WGRA 4NWYA 3VPTA 3TKPA 3MWHA 3D0ZA 3LXTA 3F0IA 4F03A 3IK7A 4QL7A 5EY6A 4IP1A 2HZFA 2HRAA 3PGTA 5GAPD 1X9WB 1JZOA 1B4PA 4LMWA 6GSYA 1T4YA 3BCIA 2HI7A 2C1YA 3C1RA 4TR1B 4CY8A 4L5LA 3TKQA 3FK8A 1IYHA 4K8MA 5ELGA 4EF0A 2ZUPA 4N3ZA 3L78A 1G6WA 3NZNA 2H73A 4WR4A 4FH8A 2VCQA 2KUCA 1K0BA 1BYEA 1VF2A 4NXIA 3CSJA 1FVJA 4KX4A 2KHPA 4J57E 4TKYA 3MDKA 1YKCA 4G19A 3QDNA 2K8SA 2VKZG 2MYGA 3D6IA 2R0GA 1SK2A 4XS1A 2GS3A 3ZIJA 5F06A 1QFNA 1Z3EA 1S3AA 1BAYA 1YKAA 1GSEA 5J41A 2YWNA 2GVPA 1LJRA 5HR0A 2B7KA 4ZBDA 5A1NB 2C80A 2P31A 2I9HA 1MDJA 4ECBA 2P5QA 1ZZYA 2A2SA 4GCIA 1F2EA 4MZCA 3WYWA 3GKMA 4JEDA 1I9DA 2X99A 2AV4A 3KCMA 3MSZA 2IMDA 3GHAA 4AJ8A 2YJHA 2CT6A 5KOXA 5IOXA 3IE3A 5JCGA 3HJMA 2GQKA 2KP1A 3EMXA 3AY8A 3DVXA 2IJYA 4AKHA 3UVHA 3FW2A 1A0RP 3CWGA 5CRDA 2K18A 4MNNA 5JWQB 2VO4A 3EMPA 1GP1A 1A24A 4XTSA 2ES7A 1VF1A 1ZMAA 2JSZA 1M99A 2DBCA 5DALB 1XIYA 3KH9A 3IRAA 2E7PA 3LQ7A 3KTBA 3WT1A 2TRXA 1M2AA 2EFEA 1KTEA 4BL7B 5A5HB 1JLVA 3GFKA 1O8WA 3WGXA 2O8VB 1PN0A 3VURA 5GAND 2REMA 5BRTA 2OJLA 2L6DA 5GSSA 2LNTA 3ZRDA 2C4JA 1U87A 5ABRA 2AJQB 2FNOA 5B8BA 2LQQA 2YOIA 3FRCA 2LSTA 2OA7A 4CHSA 1XZOA 2ON7A 3APSA 2C0DA 3IOSA 2L57A 4V2LA 3BOAA 1EOGA 3Q18A 4DEJA 5IIZA 3FYGA 2PVQA 4Q5RA 3M9JA 12GSA 2E0QA 1OC3A 2QKEA 3R3EA 5KEJA 2CQ9A 3C73A 1XFLA 3EE2A 1PRXA 5IMZA 3I69A 4X1UA 4GLTA 1X5DA 1TU8A 1YJ6A 1HQOA 4LLRA 2J9HA 2B1KA 1XXUA 4F2IA 2H01A 1JZDA 1PSQA 4HUAA 1B9YC 1OC8A 3BBYA 4ZILA 4NV5A 5CNWA 5DAKA 3ZLPA 1J0FA 3TKSC 5JCWA 3F6FA 2OE1A 2V6KA 3GRXA 1RK4A 1S3CA 3RPNA 2D2ZA 3VLNA 4K2XA 1SVOA 5KN2A 1HNCA 1OYJA 1FHEA 1J9BA 5B8AA 2H1AA 3LWAA 4L5OA 5J47A 3RAZA 4HZ4A 1TJDA 2N5AA 3MAKA 5D8IA 1K0DA 4Z2RA 3HA9A 1G7OA 5FHIA 2WB9A 2I1UA 2HSNA 5CO3A 5HFKA 2FGXA 3UMAA 2H1BA 3PH9A 2LRCA 1DE2A 4Q5QA 2R5GA 4IW9A 3H1NA 4G0LA 2G2QA 2RM5A 1WRYA 4WF5A 5DVBA 1KBNA 1EOHA 1VF4A 1SL0B 1JFUA 1PGTA 1DUGA 3IAM2 4F0BA 5ECKB 4PTSA 2H66A 2FA8A 5LNKe 3ZMLA 4DSSB 1PL1A 1ZL9A 4GSSA 3TJBA 4G0IA 2L5LA 4V2MA 3IAS2 4IP6A 4MDCA 1EGRA 4YAPA 4POBA 4WKWA 2YWMA 5AISA 3IPZA 6GSSA 3TRQA 3GX8A 4IBPA 3QAWA 5F05A 3M9KA 1MEKA 4DSSA 5A4VA 1Z7PA 1O8XA 1X9SB 5D73A 5ECMB 1K0MA 3IV4A 3IXRA 3ZREA 4N0ZA 1SD8A 2RM6A 5ECNB 1THXA 2MZCA 5F0GA 4KCAA 3FZ5A 2O7KA 4ZB9A 4MZWA 3VWXA 4N11A 1VRSD 3ZVJA 2I4AA 1YQ1A 1LU4A 1TRUA 1M9BA 1FOHA 4ULXA 1A2MA 4OFTA 2HXKA 2CV4A 3UBLA 4KB3A 2K6VA 2TRCP 2XC2A 2G0FA 3IC8A 4MLYA 2VCXA 3L9SA 2H0IA 4ZBAA 13GSA 1GSUA 2YN1A 1GWCA 1KEBA 4NPBA 2OKAA 3UARA 1AIUA 4AGSA 5IO2A 2B5YA 2RLIA 3W8JA 1PQNA 3D4TA 3HHVA 1OE8A 4IGJA 1T4ZA 4PQHA 5IPHA 4O5QA 4POMA 5E4WA 1G0TA 4KDUA 3VWVA 4HQZA 4D73B 3GUSA 2CX3A 4RI6A 5J40A 3MIXA 1UA5A 4OO5A 1BJXA 2X49A 6GSWA 1XWAA 2X64A 1GNEA 3EPTA 1GSSA 3EC3A 2IWTA 1QGVA 4DSQA 4KW6A 1WPIA 3GKXA 2OE0A 4BVXB 1AQWA 2E2MA 2WS2A 3RDWA 2DMMA 1GSQA 2LNSA 3HCZA 2LQOA 4FIWA 1UVZA 3GKKA 2PN8A 4BVYA 1BX9A 1QQ2A 5HQPA 4KE3A 4YQMA 3TRXA 2LRTA 16GSA 4PUFC 3A5IA 4HU7A 3W6GA 4HDEA 4K7NA 2PERA 1Z9HA 1GTAA 2KP2A 2YP6A 3F3QA 1PX7A 2VCWA 2HZEB 1ILOA 2YJ7A 4IJIA 2IPAA 2H74A 2IMFA 4KA0A 5DJLA 4K7IA 3US3A 2CAQA 5CRWA 3TU3B 2NTOA 2F3MA 4OMVA 2ON5A 1TI1A 3EINA 5KN1A 1X0RA 1TKDB 3LSZA 4YQVA 1IYIA 3RHBA 4ZXGA 1NW2A 5IMAA 2DLXA 2EFDA 1X5EA 3ZL5A 2FWFA 3F6DA 5D93A 1E2YA 1BQ7A 2MMZA 3LYPA 1TRSA 4A5PA 1Q98A 5AIVA 3HMJG 3QAVA 2WJUA 2C3QA 1GTUA 4MJBA 4RI7A 20GSA 3WD6A 2VLUA 4MH3A 2GLRA 1XVQA 2PPTA 2DJ1A 1M2DA 2L6CA 1AQVA 2VCZA 4V2NA 3ISOA 4GRFA 2OT3A 1R4WA 9GSSA 2IL3A 3I6AA 4P3YB 3RHCA 5C04A 2WFCA 4EIPA 3QOUA 3MYDA 1X9MB 4ZB6A 4USSA 5IMDA 2TIRA 4KGIA 3DEXA 2GDRA 1G7EA 3LORA 2LV3A 3W8SA 4K9ZA 1XWGA 1V9WA 3U6VA 4I2UA 3CSHA 4MPFA 5CAXA 4IKHA 4O5RA 2IN3A 5DQYA 3PPUA 4XCSA 2A2PA 5INYA 1TXXA 1QK8A 1ZCPA 4PUAA 1RQMA 1VF3A 2EFCA 1ERWA 5HFGA 2YANA 4L0UA 3KM6A 4ZB7A 1U3IA 3CBUA 4N10A 3TCOA 4K5RA 1N8JA 3D21A 3DKSA 1SL1B 22GSA 1T1VA 2VLVA 4WEYA 4GSNA 4L0WA 2HRKA 4AKIA 1Y25A 3IHGA 2FA4A 1VGLA 2M46A 1SKWB 3ZFLA 1SJ6A 1ZYEA 4GQFA 2QGVA 1A23A 5IMFA 1TW9A 3E9JB 6GSTA 2PBJA 2L59A 3G7JA 2EIQA 3UJ1A 11GSA 4MJAA 3D22A 4GSTA 1R26A 1XW5A 5DCHA 3JCML 2JACA 1U3AA 2J23A 5BMUA 1FW1A 3VFIA 3WGEA 4J2FA 1GUKA 3IR4A 2OE3A 3DMLA 2P5RA 1TU7A 2O87A 4XRDA 4TOPA 5LCZA 4KCEA 3D5JA 1ERVA 3GSTA 1N25A 3GNJA 4Z2TA 4K0NA 2FWGA 4JU5A 3GX0A 1K0NA 2DIZA 2H1DA 4BA7A 2YNXA 3LFLA 4QMKA 1BEDA 1O85A 5KN3A 5GZZB 1JHBA 5ID2A 4JZQA 5G30A 1TXUA 4ID0A 4OO4A 3Q6OA 1AW9A 1GLPA 5DQSA 1UC7A 1WWJA 3UIWA 1PKWA 5ELAA 3TGZA 3SWLA 1CQGA 1SYRA 4JE1A 3Q74A 2EIRA 3RPPA 1TK0B 1WOUA 4AI6A 1XWBA 4K6XA 1XW9A 3CTGA 1THOA 3HZ4A 5A4WA 2EIOA 3F9UA 2R0CA 4Z2UA 4ZL8A 3TJGA 4K2DA 4MABA 2C0EA 1GSDA 3IHQA 2H0GA 1MTCA 5IO0A 1B9XC 1NHOA 2AYTA 1SENA 2H0HA 4WETA 1HYUA 5DAKB 2FHEA 2DSAA 3ED3A 1X5CA 5J4UA 3HD5A 1TOFA 2GQMA 1XVWA 5A34A 2R6KA 2VCTA 2ZCTA 2N5FA 4XIHA 4HU9A 2HT9A 5A4UA 3L9UA 3TUEA 2CVDA 4PNGA 2HSNB 2YPMA 3H8QA 1QMVA 4NMUA 3CRUA 5FT3A 2B5EA 3CTFA 3FZ4A 3G7YA 5ECRB 3KP8A 3FR6A 2WCIA 2O85A 3FZ9A 2PWJA 4ZB8A 1U88A 3F63A 4V1Ap 1SKSB 2JZTA 1YEPA 1E6BA 3BCKA 2WULA 2LJAA 2VAFA 3QCPA 2JL4A 2HLSA 1F3AA 4TW5A 2NVLA 2FCHA 4NHZA 3P8WA 2XHFA 1M9AA 4MH2A 5H5SA 3MNGA 4PX1A 2H76A 3TDGA 3HXSA 4IQAA 4BWSA 5L71A 3ZIVA 3NIVA 4EC0A 1V58A 2VL2C 3FEUA 2IMKA 5AIXA 3APQA 1Q4JA 5EPFA 1MDKA 2PGTA 4EDYA 4TRXA 4TR4A 2K9FA 2H1LA 4PQIA 3HJPA 3LG6A 4WBJA 2DC5A 4EE0A 3WGDA 3LW9A 2LTKA 4ZBBA 2I81A 1B8XA 4ILFA 5B6MA 4NV2A 1A8YA 3QPMA 5J5NA 3IDVA 1YVLA 2MMOA 1TP9A 4KAEA 4BPYA 2LJKA 3PINA 4HJMA 1SU9A 3UVTA 1O81A 2OACA 4FQUA 3ZFBA 1GTIA 2LUSA 6GSUA 1NM3A 3DIEA 3CXGA 4IHUA 3ZYWA 3KEBA 3KP9A 2DJJA 3ME7A 4G01A 4K5SA 4JRRA 3O3TA 3CYNA 3IC4A 1ERUA 4HJ2A 1WIKA 3H4KA 1TTZA 1FG4A 4MCUA 4ICYA 1SJZA 3HY2A 1V40A 2IFQA 4K0GA 4O92A 5EVOA 2H6ZA 3TRPA 1A2JA 2OBIA 2H8LA 3TOTA 4I97A 2R4VA 3DYRA 4I5QA 3FKFA 3KD0A 1GUHA 2GSRA 3QR6A 3BJ5A 5CREA 4HOJA 1XOAA 3Q19A 2DJ2A 18GSA 3FZAA 2KOKA 3L9VA 1PX6A 4WBRD 4YKFA 2K8VA 2C0FA 2FWEA 1SK0A 1YF0A 4MF5A 2AAWA 5G2ZA 1EEMA 2RIIA 3FR3A 2CVKA 3PR8A 3C8EA 3LJRA 4AKGA 1USBA 4XHMA 2C3TA 1ZYPA 3BD2A 2OADA 4BVYB 1F9MA 3G7IA 4MJEA 1K3OA 4L8EA 4LA1A 2O5VA 3ERFA 4X43A 4KUNA 3KGKA 4GWRA 3CMIA 1GRXA 2JZSA 2JU5A 4ECCA 2H75A 4F0CA 3APOA 3GL5A 5F07A 4CDOA 3R2QA 3GN3A 2R3XA 1FO5A 2PMTA 5JWRB 3DRNA 4HEA2 1Y1UA 2WRTA 1MDIA 5D9XA 4E8HA 2DIYA 5IMVA 5KN0A 4EDZA 2IIYA 3IA1A 4MMMA 2DKIA 5HR2A 1GL8A 4J56E 3ERGA 6GSXA 2YZHA 1AAZA 1YF1A 3NOFA 3HYPA 4I2TA 1B48A 3UEMA 10GSA 3KMNA 4GXZA 4KSMA 2VIMA 2PUKC 3A3TA 2XPDA 2HSMB 1M0UA 1M7TA 3TJFA 1XCCA 4TXOA 5DBQA 1Z6MA 2XBIA 1CQHA 1GNWA 1WMJA 3KIJA 2B5XA 3ERWA 5DCGA 4CW9A 19GSA 2L4CA 2F51A 2HSMA 5A5KA 1K0OA 2V32A 5DDLA 3GL3A 4EUYA 2LRNA 1HNBA 1ZYQB 1SL2B 2AUVA 3GMFA 2VL9A 4ISDA 4GTUA 4MK3A 4H86A 1EZKA 1SD9A 2ALBA 4HQSA 3GH9A 2DJ3A 1O7UA 3ME8A 1AC1A 4MF7A 1F37A 3F8UA 3EU3A 1BG5A 1SJIA 5GSTA 2CZ2A 2GZYA 1EP8A 2DMLA 3ZMKA 3E3EA 4MZBA 4PNFA 3C7MA 4E8EA 2C8UA 3VPQA 4N30A 1K0CA 2H19A 1XOBA 1DBYA 3O6TA 4MA9A 2JADA 5B6NA 5CRHA 1ST9A 3QFAC 4DVCA 2O89A 4IELA 5ECQB 3GKNA 2CVBA 1JLWA 1PKZA 2VOCA 2PU9C 2HRKB 4AJ6A 3TKSA 1XPVA 4EKZA 4O5UA 1R5PA 1GTBA 3TKSE 2HE3A 1URMA 3M1GA 5D9WA 2GGTA 1ABAA 3UOMA 4X4JA 2BMXA 2X8GA 3EURA 4TR1A 1SVLA 4YQUA 4FYBA 2FWHA 1HD2A 1M2BA 3KH7A 2HRFA 3KTLA 4F82A 3QMXA 1ZGNA 5BMUB 4I8BA 3VK9A 5DJMA 2OBKA 4WR5A 2P0GA 3DVWA 5IPGA 2GQLA 2QSIA 1TK8B 3KZQA 3KXOA 3ZVJD 3M8NA 1SKRB 3FMWA 2I3YA 5COHA 1AQXA 3CRTA 2VL2A 2YWOA 2VL3A 1O6JA 2DKHA 4OWYA 1QXHA 1V2AA 3DWVA 1FB6A 5G1KA 2VM2A 4ZIJA 2AB6A 1YY7A 5IM9A 4TR0A 4EL1A 5G5FA 4KNDA 5B7CA 1Y6EA 2BTOT 4LL1B 4LMVA 4OCFA 5ID2B 1AXDA 1EGOA 2L4QA 4K1FA 5H5RA 2H71A 4AKXB 3EYTA 4PXOA 2FD3A 5A1NA 1Z7RA 3S9FA 2VM1A 1R7HA 4ECJA 1H4OA 4EVMA 4XS6A 1GUMA 4EIQA 4F9ZA 5ECOB 3IBHA 4YAVA 2M80A 1EEJA 3FR9A 4EXJA 4BWQA 1YDKA 1G6YA 4TXVA 3TJJA 4Z7XA 1TI3A 4WXTA 5HR1A 2VD0A 4NHWA 1DSBA 3OR5A 5EL8A 2HNLA 2N5BA 5H5QA 1GSYA 3ZZXA 3HKRA 5DALA 3P90A 2H6YA 5ENUA 1SVMA 3VWUA 4BL7A 3HJOA 5A5HA 3E0UA 1EV9A 4Q5NA 1WP0A 3C1SA 1TK5B 5A34B 2GSSA 3F4SA 1WJKA 5ECHB 2M72A 5CRGA 1ZYNA 4Q5FA 7GSSA 3P7XA 3H93A 2MBSA 2CAIA 5JCUA 4E68A 5D96A 4YKGA 4AJ7A 1XWCA 3HVSA 2HQTA 2NDOA 3L4NA 3GTUB 3TOUA 1ACVA 4QL9A 5J4VA 3FHKA 2ZNMA 2CX4A 1OC9B 3I43A 4OD7A 3RBTA 2FY6A 4NAXA 1O73A 1W4VA 4ACSA 2E2GA 5G1LA 3IK9A 5JWOB 1MD4A 2Z9SA 6GSVA 2EC4A 3DXBA 1T3BA 2FLSA 4RQXA 2F8AA 3TJKA 3GTUA 4GDFA 2VLTA 2RUEA 2H6XA 1OC9A 3N5OA 5D9TA 4FO5A 2AHEA 2V1MA 4JR4A 4G9HA 4POLA 3LGCA 1PMTA 1A0FA 3I9V2 1K3LA 1WE0A 1HNAA 1ERTA 2UV8G 2MMNA 3DD3A 1OKTA 1S3DA 2DJ0A 4FYUA 1KNGA 4IN0A 3EU4A 5HR3A 3VI5A 3F4RA 5HFIA 2XBQA 1GULA 4YH2A 2C0GA 5IOWA 2A4VA 5KOWA 3GA4A 3F3RA 3SBCA 4G10A 1GLQA 2EFHA 2R2JA 2B1LA 2B7JA 3VWWA 4G2EA 1F6MC 1W89A 5G5EA 1BF5A 1JZWA 3GH6A 2PVOC 4ECIA 2F9SA 1SYXA 2H30A 4PGTA 1SK1A 4OFNA 1T00A 2X8HA 1YEXA 1T7PB 2H1GA 5AGYA 2CZ3A 3QAGA 1EV4A 3HVXA 5J4YA 3K8NA 1BG1A 4V1Ag 2X8CA 3LXZA 3M3MA 3J7Yb 1XW6A 3HDCA 4MJCA 4X0XA 4DSRA 4RUVA 2IFQB 14GSA 2YZUA 3A2WA 2GSTA 1DE1A 5J3RA 2KLXA 5CYYA 2HFDA 4K7OA 4AF2A 4XRAA 2FUG2 2YWIA 2WZ9A 1Z5YE 1QUWA 4OFMA 5F8BA 2YCDA 4CY6A 3DGQA 17GSA 1F3BA 4MPGA 4N0VA 3EWLA 2GZPA 4QQ7A 2MMAA 2R37A 4ML1A 4G0KA 4IVFA 3LEFA 1C72A 4W66A 2QC7A 3EVIA 2F8FA 2V41A 1FVKA 1JZRA 4O7HA 1XBSA 2B6MA 1OAZA 5AN1A 3QFBC 2GTUA 1EP7A 1K0AA 3G9BA 3GSSA 1GSFA 1PL2A 5IMCA 3L0HA 2LKUA 2X4AA 1ON4A 4KDXA 2GT5A 5ECPB 1XWKA 4GF0A 3A2XA 2NBSA 2HSYA 5ECLB 1K3YA 2IMIA 2IMEA 3C71A 4HS1A 1TRVA 2A4HA 3V1WA 1V57A 2QA1A 4HZ2A 3D4MA 1V98A 4D73A 4HI7A 4XS4B 8GSSA 1AUCA 2HRNA 1LBKA 3UAPA 1A8LA 3QD9A 1Z6NA 4IQ1A 4I6XA 4IJ3A 4TN8A 4KF9A 1B4QA 2HYXA 4RQRA 1H75A 4MF6A 2YV7A 5ECSA 3HZ8A 5G31A 4LL4B 2L5OA 2GZZA 4XS4A 2RUFA 2A2RA 3KMOA 4BVXA 3UBKA 1FB0A 2CA8A 4ML6A 2QA2A 3HVVA 3CSIA 1OVNA 5ECIB 2V2GA 4KDYA 2VD1A 2VCVA 4TXOB 2LS5A 5LD0A 4JBBA 3O76A 4WF4A 3GYKA 3WT2A 1TRWA 1ML6A 1PN9A 2WDUA 4JR6A 1YZXA 3VI7A 3UL3A 1FOVA 1MD3A 1FAAA 2XPEA 2H72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H79 A;  4TR3 A;  3TKR A;  5D9V A;  2HZE A;  3ZTL A;  1R5A A;  2DJK A;  4ZL9 A;  1OKD A;  1NHY A;  3GV1 A;  4GQC A;  1U6T A;  3P2A A;  4MP4 A;  2JSY A;  1OE7 A;  2JZR A;  5C00 A;  1A2L A;  1EWX A;  2MBT A;  3FY7 A;  2V6O A;  1GH2 A;  4FYC A;  3M0F A;  1N2A A;  3LYK A;  2H70 A;  4KH7 A;  2LEG A;  4TVE A;  4PQ1 A;  5E59 A;  3J7Y k;  3KJY A;  4IS0 A;  2YV9 A;  2B3S A;  3TB2 A;  2HSH A;  1UN2 A;  2VUP A;  1RW1 A;  3A5W A;  4OCE A;  4KSO A;  4POK A;  3GIX A;  5CP1 A;  2UZ8 A;  4ZL7 A;  4EO3 A;  5IQY A;  2LJR A;  1PD2 1;  5J9B A;  3U5R E;  2BJX A;  2C3N A;  1I5G A;  2GSQ A;  4O32 A;  3GUR A;  1PA3 A;  3F4T A;  2GT6 A;  2NPB A;  5FWG A;  1TDI A;  1J08 A;  1ZOF A;  3ZIT A;  4PUR A;  5J9C A;  1T8E B;  1NSW A;  3A2V A;  3N9J A;  2WGR A;  4NWY A;  3VPT A;  3TKP A;  3MWH A;  3D0Z A;  3LXT A;  3F0I A;  4F03 A;  3IK7 A;  4QL7 A;  5EY6 A;  4IP1 A;  2HZF A;  2HRA A;  3PGT A;  5GAP D;  1X9W B;  1JZO A;  1B4P A;  4LMW A;  6GSY A;  1T4Y A;  3BCI A;  2HI7 A;  2C1Y A;  3C1R A;  4TR1 B;  4L5L A;  3TKQ A;  4K8M A;  1IYH A;  3FK8 A;  5ELG A;  4EF0 A;  2ZUP A;  3L78 A;  1G6W A;  3NZN A;  2H73 A;  4WR4 A;  4FH8 A;  2VCQ A;  2KUC A;  1K0B A;  1BYE A;  1VF2 A;  4NXI A;  3CSJ A;  1FVJ A;  4KX4 A;  2KHP A;  4J57 E;  4TKY A;  3MDK A;  1YKC A;  4G19 A;  3QDN A;  2K8S A;  2MYG A;  3D6I A;  1SK2 A;  4XS1 A;  2GS3 A;  3ZIJ A;  5F06 A;  1QFN A;  1Z3E A;  1S3A A;  1BAY A;  1YKA A;  1GSE A;  5J41 A;  2YWN A;  2GVP A;  1LJR A;  5HR0 A;  2B7K A;  4ZBD A;  2C80 A;  2P31 A;  2I9H A;  1MDJ A;  4ECB A;  2P5Q A;  1ZZY A;  2A2S A;  4GCI A;  1F2E A;  4MZC A;  3WYW A;  3GKM A;  4JED A;  1I9D A;  2X99 A;  2AV4 A;  3KCM A;  3MSZ A;  2IMD A;  3GHA A;  4AJ8 A;  2YJH A;  2CT6 A;  5IOX A;  3IE3 A;  5JCG A;  3HJM A;  2GQK A;  2KP1 A;  3EMX A;  3AY8 A;  3DVX A;  2IJY A;  3UVH A;  3FW2 A;  1A0R P;  5CRD A;  2K18 A;  5JWQ B;  2VO4 A;  3EMP A;  1GP1 A;  1A24 A;  4XTS A;  2ES7 A;  1VF1 A;  1ZMA A;  2JSZ A;  1M99 A;  2DBC A;  5DAL B;  1XIY A;  3KH9 A;  3IRA A;  2E7P A;  3LQ7 A;  3KTB A;  3WT1 A;  2TRX A;  1M2A A;  1KTE A;  4BL7 B;  1JLV A;  3GFK A;  1O8W A;  3WGX A;  2O8V B;  3VUR A;  5GAN D;  2REM A;  2OJL A;  2L6D A;  5GSS A;  2LNT A;  3ZRD A;  2C4J A;  1U87 A;  5ABR A;  2AJQ B;  2FNO A;  5B8B A;  2LQQ A;  2YOI A;  3FRC A;  2LST A;  2OA7 A;  4CHS A;  1XZO A;  2ON7 A;  3APS A;  2C0D A;  3IOS A;  2L57 A;  4V2L A;  3BOA A;  1EOG A;  3Q18 A;  4DEJ A;  5IIZ A;  3FYG A;  2PVQ A;  4Q5R A;  3M9J A;  12GS A;  2E0Q A;  1OC3 A;  2QKE A;  3R3E A;  5KEJ A;  2CQ9 A;  3C73 A;  1XFL A;  3EE2 A;  1PRX A;  5IMZ A;  3I69 A;  4X1U A;  4GLT A;  1X5D A;  1TU8 A;  1YJ6 A;  1HQO A;  4LLR A;  2J9H A;  2B1K A;  1XXU A;  4F2I A;  2H01 A;  1JZD A;  1PSQ A;  4HUA A;  1B9Y C;  1OC8 A;  3BBY A;  4ZIL A;  4NV5 A;  5CNW A;  5DAK A;  3ZLP A;  1J0F A;  3TKS C;  5JCW A;  3F6F A;  2OE1 A;  2V6K A;  3GRX A;  1RK4 A;  1S3C A;  3RPN A;  2D2Z A;  3VLN A;  5KN2 A;  1HNC A;  1OYJ A;  1FHE A;  1J9B A;  5B8A A;  2H1A A;  3LWA A;  4L5O A;  3RAZ A;  4HZ4 A;  1TJD A;  2N5A A;  3MAK A;  5D8I A;  1K0D A;  3HA9 A;  1G7O A;  5FHI A;  2WB9 A;  2I1U A;  5CO3 A;  5HFK A;  2FGX A;  3UMA A;  2H1B A;  3PH9 A;  2LRC A;  1DE2 A;  4Q5Q A;  2R5G A;  4IW9 A;  3H1N A;  4G0L A;  2G2Q A;  2RM5 A;  1WRY A;  4WF5 A;  5DVB A;  1KBN A;  1EOH A;  1VF4 A;  1SL0 B;  1JFU A;  1PGT A;  1DUG A;  3IAM 2;  4F0B A;  5ECK B;  4PTS A;  2H66 A;  2FA8 A;  5LNK e;  3ZML A;  4DSS B;  1PL1 A;  1ZL9 A;  4GSS A;  3TJB A;  4G0I A;  2L5L A;  4V2M A;  3IAS 2;  4IP6 A;  4MDC A;  1EGR A;  4YAP A;  4POB A;  4WKW A;  2YWM A;  5AIS A;  3IPZ A;  6GSS A;  3TRQ A;  3GX8 A;  4IBP A;  3QAW A;  5F05 A;  3M9K A;  1MEK A;  4DSS A;  5A4V A;  1Z7P A;  1O8X A;  1X9S B;  5D73 A;  5ECM B;  1K0M A;  3IV4 A;  3IXR A;  3ZRE A;  4N0Z A;  1SD8 A;  2RM6 A;  5ECN B;  1THX A;  2MZC A;  5F0G A;  4KCA A;  3FZ5 A;  2O7K A;  4ZB9 A;  4MZW A;  3VWX A;  4N11 A;  1VRS D;  3ZVJ A;  2I4A A;  1YQ1 A;  1LU4 A;  1TRU A;  1M9B A;  4ULX A;  1A2M A;  4OFT A;  2HXK A;  2CV4 A;  3UBL A;  4KB3 A;  2K6V A;  2TRC P;  2XC2 A;  2G0F A;  3IC8 A;  4MLY A;  2VCX A;  3L9S A;  2H0I A;  4ZBA A;  13GS A;  1GSU A;  2YN1 A;  1GWC A;  1KEB A;  4NPB A;  2OKA A;  3UAR A;  1AIU A;  4AGS A;  5IO2 A;  2B5Y A;  2RLI A;  3W8J A;  1PQN A;  3D4T A;  3HHV A;  1OE8 A;  4IGJ A;  1T4Z A;  4PQH A;  5IPH A;  4POM A;  5E4W A;  1G0T A;  4KDU A;  3VWV A;  4HQZ A;  4D73 B;  3GUS A;  2CX3 A;  4RI6 A;  1UA5 A;  4OO5 A;  1BJX A;  6GSW A;  1XWA A;  2X64 A;  1GNE A;  1GSS A;  3EC3 A;  2IWT A;  1QGV A;  4DSQ A;  4KW6 A;  1WPI A;  3GKX A;  2OE0 A;  4BVX B;  1AQW A;  2E2M A;  2WS2 A;  3RDW A;  2DMM A;  1GSQ A;  2LNS A;  3HCZ A;  2LQO A;  4FIW A;  1UVZ A;  3GKK A;  2PN8 A;  4BVY A;  1BX9 A;  1QQ2 A;  5HQP A;  4KE3 A;  4YQM A;  3TRX A;  2LRT A;  16GS A;  4PUF C;  4HU7 A;  3W6G A;  4HDE A;  4K7N A;  2PER A;  1Z9H A;  1GTA A;  2KP2 A;  2YP6 A;  3F3Q A;  1PX7 A;  2VCW A;  2HZE B;  1ILO A;  2YJ7 A;  4IJI A;  2IPA A;  2H74 A;  2IMF A;  4KA0 A;  5DJL A;  4K7I A;  3US3 A;  2CAQ A;  5CRW A;  2NTO A;  2F3M A;  4OMV A;  2ON5 A;  1TI1 A;  3EIN A;  5KN1 A;  1X0R A;  1TKD B;  3LSZ A;  4YQV A;  1IYI A;  3RHB A;  4ZXG A;  1NW2 A;  5IMA A;  2DLX A;  1X5E A;  3ZL5 A;  2FWF A;  3F6D A;  5D93 A;  1E2Y A;  1BQ7 A;  2MMZ A;  3LYP A;  1TRS A;  1Q98 A;  5AIV A;  3QAV A;  2WJU A;  2C3Q A;  1GTU A;  4MJB A;  4RI7 A;  20GS A;  3WD6 A;  2VLU A;  4MH3 A;  2GLR A;  1XVQ A;  2PPT A;  2DJ1 A;  1M2D A;  2L6C A;  1AQV A;  2VCZ A;  4V2N A;  3ISO A;  4GRF A;  1R4W A;  9GSS A;  2IL3 A;  3I6A A;  4P3Y B;  3RHC A;  5C04 A;  2WFC A;  3QOU A;  1X9M B;  4ZB6 A;  4USS A;  5IMD A;  2TIR A;  4KGI A;  3DEX A;  2GDR A;  1G7E A;  3LOR A;  2LV3 A;  3W8S A;  4K9Z A;  1XWG A;  1V9W A;  3U6V A;  4I2U A;  3CSH A;  4MPF A;  5CAX A;  4IKH A;  4O5R A;  2IN3 A;  5DQY A;  3PPU A;  4XCS A;  5INY A;  1TXX A;  1QK8 A;  1ZCP A;  4PUA A;  1RQM A;  1VF3 A;  1ERW A;  5HFG A;  2YAN A;  4L0U A;  3KM6 A;  1U3I A;  3CBU A;  4N10 A;  3TCO A;  1N8J A;  3D21 A;  3DKS A;  1SL1 B;  22GS A;  1T1V A;  2VLV A;  4WEY A;  4GSN A;  4L0W A;  2HRK A;  2M46 A;  1Y25 A;  2FA4 A;  1VGL A;  1SKW B;  3ZFL A;  1SJ6 A;  1ZYE A;  4GQF A;  2QGV A;  1A23 A;  5IMF A;  1TW9 A;  3E9J B;  6GST A;  2PBJ A;  2L59 A;  3G7J A;  2EIQ A;  3UJ1 A;  11GS A;  4MJA A;  3D22 A;  4GST A;  1R26 A;  1XW5 A;  5DCH A;  3JCM L;  2JAC A;  1U3A A;  2J23 A;  5BMU A;  1FW1 A;  3VFI A;  3WGE A;  4J2F A;  1GUK A;  3IR4 A;  2OE3 A;  3DML A;  2P5R A;  1TU7 A;  2O87 A;  4XRD A;  4TOP A;  5LCZ A;  4KCE A;  3D5J A;  1ERV A;  3GST A;  3GNJ A;  4K0N A;  2FWG A;  4JU5 A;  3GX0 A;  1K0N A;  2DIZ A;  2H1D A;  4BA7 A;  2YNX A;  3LFL A;  1BED A;  1O85 A;  5KN3 A;  5GZZ B;  1JHB A;  5ID2 A;  4JZQ A;  5G30 A;  4ID0 A;  4OO4 A;  3Q6O A;  1AW9 A;  1GLP A;  5DQS A;  1UC7 A;  1WWJ A;  3UIW A;  1PKW A;  5ELA A;  3TGZ A;  3SWL A;  1CQG A;  1SYR A;  4JE1 A;  3Q74 A;  2EIR A;  3RPP A;  1TK0 B;  1WOU A;  1XWB A;  4K6X A;  1XW9 A;  3CTG A;  1THO A;  3HZ4 A;  5A4W A;  2EIO A;  3F9U A;  4ZL8 A;  3TJG A;  4K2D A;  4MAB A;  2C0E A;  1GSD A;  3IHQ A;  2H0G A;  1MTC A;  5IO0 A;  1B9X C;  1NHO A;  2AYT A;  1SEN A;  2H0H A;  4WET A;  1HYU A;  5DAK B;  2FHE A;  2DSA A;  3ED3 A;  1X5C A;  5J4U A;  3HD5 A;  1TOF A;  2GQM A;  1XVW A;  2R6K A;  2VCT A;  2ZCT A;  2N5F A;  4XIH A;  4HU9 A;  2HT9 A;  5A4U A;  3L9U A;  3TUE A;  2CVD A;  4PNG A;  2HSN B;  2YPM A;  3H8Q A;  1QMV A;  4NMU A;  3CRU A;  5FT3 A;  2B5E A;  3CTF A;  3FZ4 A;  3G7Y A;  5ECR B;  3KP8 A;  3FR6 A;  2WCI A;  2O85 A;  3FZ9 A;  2PWJ A;  4ZB8 A;  1U88 A;  3F63 A;  4V1A p;  1SKS B;  2JZT A;  1YEP A;  1E6B A;  3BCK A;  2WUL A;  2LJA A;  2VAF A;  3QCP A;  2JL4 A;  2HLS A;  1F3A A;  4TW5 A;  2NVL A;  2FCH A;  4NHZ A;  3P8W A;  2XHF A;  1M9A A;  4MH2 A;  5H5S A;  3MNG A;  4PX1 A;  2H76 A;  3TDG A;  3HXS A;  4IQA A;  4BWS A;  5L71 A;  3ZIV A;  3NIV A;  4EC0 A;  1V58 A;  2VL2 C;  3FEU A;  2IMK A;  5AIX A;  3APQ A;  1Q4J A;  5EPF A;  1MDK A;  2PGT A;  4EDY A;  4TRX A;  4TR4 A;  2K9F A;  4PQI A;  3HJP A;  3LG6 A;  4WBJ A;  2DC5 A;  4EE0 A;  3WGD A;  2LTK A;  4ZBB A;  2I81 A;  1B8X A;  4ILF A;  5B6M A;  4NV2 A;  1A8Y A;  3QPM A;  5J5N A;  3IDV A;  2MMO A;  1TP9 A;  4KAE A;  4BPY A;  2LJK A;  3PIN A;  4HJM A;  1SU9 A;  3UVT A;  1O81 A;  2OAC A;  4FQU A;  3ZFB A;  1GTI A;  2LUS A;  6GSU A;  1NM3 A;  3DIE A;  3CXG A;  4IHU A;  3ZYW A;  3KEB A;  3KP9 A;  2DJJ A;  3ME7 A;  4JRR A;  3O3T A;  3CYN A;  3IC4 A;  1ERU A;  4HJ2 A;  1WIK A;  3H4K A;  1TTZ A;  1FG4 A;  4MCU A;  1SJZ A;  3HY2 A;  1V40 A;  2IFQ A;  4K0G A;  4O92 A;  5EVO A;  2H6Z A;  3TRP A;  1A2J A;  2OBI A;  2H8L A;  3TOT A;  4I97 A;  2R4V A;  3DYR A;  4I5Q A;  3FKF A;  3KD0 A;  1GUH A;  2GSR A;  3QR6 A;  3BJ5 A;  5CRE A;  4HOJ A;  1XOA A;  3Q19 A;  2DJ2 A;  18GS A;  3FZA A;  2KOK A;  3L9V A;  1PX6 A;  4WBR D;  2K8V A;  2C0F A;  2FWE A;  1SK0 A;  1YF0 A;  4MF5 A;  2AAW A;  5G2Z A;  1EEM A;  2RII A;  3FR3 A;  2CVK A;  3PR8 A;  3C8E A;  3LJR A;  1USB A;  4XHM A;  2C3T A;  3BD2 A;  2OAD A;  4BVY B;  1F9M A;  3G7I A;  4MJE A;  1K3O A;  4L8E A;  4LA1 A;  3ERF A;  4X43 A;  4KUN A;  3KGK A;  4GWR A;  3CMI A;  1GRX A;  2JZS A;  2JU5 A;  4ECC A;  2H75 A;  4F0C A;  3APO A;  3GL5 A;  5F07 A;  4CDO A;  3R2Q A;  3GN3 A;  2R3X A;  1FO5 A;  2PMT A;  5JWR B;  3DRN A;  4HEA 2;  2WRT A;  1MDI A;  5D9X A;  4E8H A;  2DIY A;  5IMV A;  5KN0 A;  4EDZ A;  2IIY A;  3IA1 A;  4MMM A;  5HR2 A;  1GL8 A;  4J56 E;  3ERG A;  6GSX A;  2YZH A;  1AAZ A;  1YF1 A;  3NOF A;  3HYP A;  4I2T A;  1B48 A;  3UEM A;  10GS A;  3KMN A;  4GXZ A;  4KSM A;  2VIM A;  2PUK C;  3A3T A;  2XPD A;  2HSM B;  1M0U A;  1M7T A;  3TJF A;  1XCC A;  4TXO A;  5DBQ A;  1Z6M A;  2XBI A;  1CQH A;  1GNW A;  1WMJ A;  3KIJ A;  2B5X A;  3ERW A;  5DCG A;  4CW9 A;  19GS A;  2L4C A;  2F51 A;  2HSM A;  5A5K A;  1K0O A;  2V32 A;  5DDL A;  3GL3 A;  4EUY A;  2LRN A;  1HNB A;  1ZYQ B;  1SL2 B;  2AUV A;  3GMF A;  2VL9 A;  4ISD A;  4GTU A;  4MK3 A;  4H86 A;  1EZK A;  1SD9 A;  2ALB A;  4HQS A;  3GH9 A;  2DJ3 A;  1O7U A;  3ME8 A;  1AC1 A;  4MF7 A;  1F37 A;  3F8U A;  3EU3 A;  1BG5 A;  1SJI A;  5GST A;  2CZ2 A;  2GZY A;  1EP8 A;  2DML A;  3ZMK A;  3E3E A;  4MZB A;  4PNF A;  3C7M A;  4E8E A;  2C8U A;  3VPQ A;  4N30 A;  1K0C A;  2H19 A;  1XOB A;  1DBY A;  3O6T A;  4MA9 A;  2JAD A;  5B6N A;  5CRH A;  1ST9 A;  3QFA C;  4DVC A;  2O89 A;  4IEL A;  5ECQ B;  3GKN A;  2CVB A;  1JLW A;  1PKZ A;  2VOC A;  2PU9 C;  2HRK B;  4AJ6 A;  3TKS A;  1XPV A;  4EKZ A;  1R5P A;  1GTB A;  3TKS E;  2HE3 A;  1URM A;  3M1G A;  5D9W A;  2GGT A;  1ABA A;  3UOM A;  2BMX A;  2X8G A;  3EUR A;  4TR1 A;  4YQU A;  4FYB A;  2FWH A;  1HD2 A;  1M2B A;  3KH7 A;  2HRF A;  3KTL A;  4F82 A;  3QMX A;  1ZGN A;  4I8B A;  3VK9 A;  5DJM A;  2OBK A;  4WR5 A;  2P0G A;  3DVW A;  5IPG A;  2GQL A;  2QSI A;  1TK8 B;  3KZQ A;  3KXO A;  3ZVJ D;  3M8N A;  1SKR B;  2I3Y A;  5COH A;  1AQX A;  3CRT A;  2VL2 A;  2YWO A;  2VL3 A;  1O6J A;  4OWY A;  1QXH A;  1V2A A;  3DWV A;  1FB6 A;  5G1K A;  2VM2 A;  4ZIJ A;  2AB6 A;  1YY7 A;  5IM9 A;  4TR0 A;  4EL1 A;  5G5F A;  4KND A;  5B7C A;  1Y6E A;  2BTO T;  4LL1 B;  4LMV A;  4OCF A;  5ID2 B;  1AXD A;  1EGO A;  2L4Q A;  4K1F A;  5H5R A;  2H71 A;  3EYT A;  4PXO A;  2FD3 A;  1Z7R A;  3S9F A;  2VM1 A;  1R7H A;  4ECJ A;  1H4O A;  4EVM A;  4XS6 A;  1GUM A;  4F9Z A;  5ECO B;  3IBH A;  4YAV A;  2M80 A;  1EEJ A;  3FR9 A;  4EXJ A;  4BWQ A;  1YDK A;  1G6Y A;  4TXV A;  3TJJ A;  4Z7X A;  1TI3 A;  4WXT A;  5HR1 A;  2VD0 A;  4NHW A;  1DSB A;  3OR5 A;  5EL8 A;  2HNL A;  2N5B A;  5H5Q A;  1GSY A;  3ZZX A;  3HKR A;  5DAL A;  3P90 A;  2H6Y A;  5ENU A;  3VWU A;  4BL7 A;  3HJO A;  3E0U A;  1EV9 A;  4Q5N A;  1WP0 A;  3C1S A;  1TK5 B;  2GSS A;  3F4S A;  1WJK A;  5ECH B;  2M72 A;  5CRG A;  4Q5F A;  7GSS A;  3P7X A;  3H93 A;  2MBS A;  2CAI A;  5JCU A;  5D96 A;  4AJ7 A;  1XWC A;  3HVS A;  2HQT A;  2NDO A;  3L4N A;  3GTU B;  3TOU A;  1ACV A;  4QL9 A;  3FHK A;  2ZNM A;  2CX4 A;  1OC9 B;  3I43 A;  4OD7 A;  3RBT A;  2FY6 A;  4NAX A;  1O73 A;  1W4V A;  4ACS A;  2E2G A;  5G1L A;  3IK9 A;  5JWO B;  1MD4 A;  2Z9S A;  6GSV A;  2EC4 A;  3DXB A;  1T3B A;  2FLS A;  4RQX A;  2F8A A;  3TJK A;  3GTU A;  2VLT A;  2RUE A;  2H6X A;  1OC9 A;  3N5O A;  5D9T A;  4FO5 A;  2AHE A;  2V1M A;  4JR4 A;  4G9H A;  4POL A;  3LGC A;  1PMT A;  1A0F A;  3I9V 2;  1K3L A;  1WE0 A;  1HNA A;  1ERT A;  2MMN A;  3DD3 A;  1OKT A;  1S3D A;  2DJ0 A;  4FYU A;  1KNG A;  4IN0 A;  3EU4 A;  5HR3 A;  3VI5 A;  3F4R A;  5HFI A;  2XBQ A;  1GUL A;  4YH2 A;  2C0G A;  5IOW A;  2A4V A;  3GA4 A;  3F3R A;  3SBC A;  4G10 A;  1GLQ A;  2R2J A;  2B1L A;  2B7J A;  3VWW A;  4G2E A;  1F6M C;  1W89 A;  5G5E A;  1JZW A;  3GH6 A;  2PVO C;  4ECI A;  2F9S A;  1SYX A;  2H30 A;  4PGT A;  1SK1 A;  4OFN A;  1T00 A;  2X8H A;  1YEX A;  1T7P B;  2H1G A;  5AGY A;  2CZ3 A;  3QAG A;  1EV4 A;  3HVX A;  3K8N A;  4V1A g;  2X8C A;  3LXZ A;  3M3M A;  3J7Y b;  1XW6 A;  3HDC A;  4MJC A;  4X0X A;  4DSR A;  4RUV A;  2IFQ B;  14GS A;  2YZU A;  3A2W A;  2GST A;  1DE1 A;  5J3R A;  2KLX A;  5CYY A;  2HFD A;  4K7O A;  4AF2 A;  4XRA A;  2FUG 2;  2YWI A;  2WZ9 A;  1Z5Y E;  1QUW A;  4OFM A;  5F8B A;  2YCD A;  3DGQ A;  17GS A;  1F3B A;  4MPG A;  4N0V A;  3EWL A;  2GZP A;  4QQ7 A;  2MMA A;  2R37 A;  4ML1 A;  4G0K A;  4IVF A;  3LEF A;  1C72 A;  2QC7 A;  3EVI A;  2F8F A;  2V41 A;  1FVK A;  1JZR A;  4O7H A;  1XBS A;  2B6M A;  1OAZ A;  5AN1 A;  3QFB C;  2GTU A;  1EP7 A;  1K0A A;  3G9B A;  3GSS A;  1GSF A;  1PL2 A;  5IMC A;  3L0H A;  2LKU A;  1ON4 A;  4KDX A;  2GT5 A;  5ECP B;  1XWK A;  4GF0 A;  3A2X A;  2NBS A;  2HSY A;  5ECL B;  1K3Y A;  2IMI A;  2IME A;  3C71 A;  4HS1 A;  1TRV A;  3V1W A;  1V57 A;  4HZ2 A;  3D4M A;  1V98 A;  4D73 A;  4HI7 A;  4XS4 B;  8GSS A;  1AUC A;  2HRN A;  1LBK A;  3UAP A;  1A8L A;  3QD9 A;  1Z6N A;  4IQ1 A;  4I6X A;  4IJ3 A;  4TN8 A;  4KF9 A;  1B4Q A;  2HYX A;  4RQR A;  1H75 A;  4MF6 A;  2YV7 A;  5ECS A;  3HZ8 A;  5G31 A;  4LL4 B;  2L5O A;  2GZZ A;  4XS4 A;  2RUF A;  2A2R A;  3KMO A;  4BVX A;  3UBK A;  1FB0 A;  2CA8 A;  4ML6 A;  3HVV A;  3CSI A;  1OVN A;  5ECI B;  2V2G A;  4KDY A;  2VD1 A;  2VCV A;  4TXO B;  2LS5 A;  5LD0 A;  4JBB A;  3O76 A;  4WF4 A;  3GYK A;  3WT2 A;  1TRW A;  1ML6 A;  1PN9 A;  2WDU A;  4JR6 A;  1YZX A;  3VI7 A;  3UL3 A;  1FOV A;  1MD3 A;  1FAA A;  2XPE A;  2H72 A; 
#chains in the Genus database with same CATH topology
 3H79 A;  4TR3 A;  3TKR A;  5D9V A;  2HZE A;  3ZTL A;  1R5A A;  2DJK A;  4ZL9 A;  1OKD A;  1NHY A;  3GV1 A;  4GQC A;  1U6T A;  3P2A A;  4MP4 A;  2JSY A;  1OE7 A;  2JZR A;  5C00 A;  1A2L A;  1EWX A;  2MBT A;  3FY7 A;  2V6O A;  2WW0 A;  1GH2 A;  4FYC A;  3M0F A;  1N2A A;  3LYK A;  2H70 A;  4KH7 A;  2LEG A;  4TVE A;  4PQ1 A;  5E59 A;  3J7Y k;  3KJY A;  2R0P A;  4IS0 A;  2YV9 A;  2B3S A;  3TB2 A;  2HSH A;  1UN2 A;  2VUP A;  1RW1 A;  3A5W A;  4OCE A;  4KSO A;  4POK A;  3GIX A;  5CP1 A;  2UZ8 A;  4ZL7 A;  4EO3 A;  5IQY A;  2LJR A;  1PD2 1;  5J9B A;  3U5R E;  2BJX A;  2C3N A;  1I5G A;  2GSQ A;  4O32 A;  3GUR A;  1PA3 A;  3F4T A;  2GT6 A;  2NPB A;  5FWG A;  1TDI A;  1J08 A;  1ZOF A;  3ZIT A;  4PUR A;  5J9C A;  1T8E B;  1NSW A;  3A2V A;  3N9J A;  2WGR A;  4NWY A;  3VPT A;  3TKP A;  3MWH A;  3D0Z A;  3LXT A;  3F0I A;  4F03 A;  3IK7 A;  4QL7 A;  5EY6 A;  4IP1 A;  2HZF A;  2HRA A;  3PGT A;  5GAP D;  1X9W B;  1JZO A;  1B4P A;  4LMW A;  6GSY A;  1T4Y A;  3BCI A;  2HI7 A;  2C1Y A;  3C1R A;  4TR1 B;  4CY8 A;  4L5L A;  3TKQ A;  3FK8 A;  1IYH A;  4K8M A;  5ELG A;  4EF0 A;  2ZUP A;  4N3Z A;  3L78 A;  1G6W A;  3NZN A;  2H73 A;  4WR4 A;  4FH8 A;  2VCQ A;  2KUC A;  1K0B A;  1BYE A;  1VF2 A;  4NXI A;  3CSJ A;  1FVJ A;  4KX4 A;  2KHP A;  4J57 E;  4TKY A;  3MDK A;  1YKC A;  4G19 A;  3QDN A;  2K8S A;  2VKZ G;  2MYG A;  3D6I A;  2R0G A;  1SK2 A;  4XS1 A;  2GS3 A;  3ZIJ A;  5F06 A;  1QFN A;  1Z3E A;  1S3A A;  1BAY A;  1YKA A;  1GSE A;  5J41 A;  2YWN A;  2GVP A;  1LJR A;  5HR0 A;  2B7K A;  4ZBD A;  5A1N B;  2C80 A;  2P31 A;  2I9H A;  1MDJ A;  4ECB A;  2P5Q A;  1ZZY A;  2A2S A;  4GCI A;  1F2E A;  4MZC A;  3WYW A;  3GKM A;  4JED A;  1I9D A;  2X99 A;  2AV4 A;  3KCM A;  3MSZ A;  2IMD A;  3GHA A;  4AJ8 A;  2YJH A;  2CT6 A;  5KOX A;  5IOX A;  3IE3 A;  5JCG A;  3HJM A;  2GQK A;  2KP1 A;  3EMX A;  3AY8 A;  3DVX A;  2IJY A;  4AKH A;  3UVH A;  3FW2 A;  1A0R P;  3CWG A;  5CRD A;  2K18 A;  4MNN A;  5JWQ B;  2VO4 A;  3EMP A;  1GP1 A;  1A24 A;  4XTS A;  2ES7 A;  1VF1 A;  1ZMA A;  2JSZ A;  1M99 A;  2DBC A;  5DAL B;  1XIY A;  3KH9 A;  3IRA A;  2E7P A;  3LQ7 A;  3KTB A;  3WT1 A;  2TRX A;  1M2A A;  2EFE A;  1KTE A;  4BL7 B;  2WVX B;  5A5H B;  1JLV A;  3GFK A;  1O8W A;  3WGX A;  4FXY P;  2O8V B;  1PN0 A;  3VUR A;  5GAN D;  2REM A;  5BRT A;  2OJL A;  2L6D A;  5GSS A;  2LNT A;  3ZRD A;  2C4J A;  1U87 A;  5ABR A;  2AJQ B;  2FNO A;  5B8B A;  2LQQ A;  2YOI A;  3FRC A;  2LST A;  2OA7 A;  4CHS A;  1XZO A;  2ON7 A;  3APS A;  2C0D A;  3IOS A;  2L57 A;  4V2L A;  3BOA A;  1EOG A;  3Q18 A;  4DEJ A;  5IIZ A;  3FYG A;  2PVQ A;  4Q5R A;  3M9J A;  12GS A;  2E0Q A;  1OC3 A;  2QKE A;  3R3E A;  5KEJ A;  2CQ9 A;  3C73 A;  1XFL A;  3EE2 A;  1PRX A;  5IMZ A;  3I69 A;  4X1U A;  4GLT A;  1X5D A;  1TU8 A;  1YJ6 A;  1HQO A;  4LLR A;  2J9H A;  2B1K A;  1XXU A;  4F2I A;  2H01 A;  1JZD A;  1PSQ A;  4HUA A;  1B9Y C;  1OC8 A;  3BBY A;  4ZIL A;  4NV5 A;  5CNW A;  5DAK A;  3ZLP A;  1J0F A;  3TKS C;  5JCW A;  3F6F A;  2OE1 A;  2V6K A;  3GRX A;  1RK4 A;  1S3C A;  3RPN A;  2D2Z A;  3VLN A;  4K2X A;  1SVO A;  5KN2 A;  1HNC A;  1OYJ A;  1FHE A;  1J9B A;  5B8A A;  2H1A A;  3LWA A;  4L5O A;  5J47 A;  3RAZ A;  4HZ4 A;  1TJD A;  2N5A A;  3MAK A;  5D8I A;  1K0D A;  4Z2R A;  3HA9 A;  1G7O A;  5FHI A;  2WB9 A;  2I1U A;  2HSN A;  5CO3 A;  5HFK A;  2FGX A;  3UMA A;  2H1B A;  3PH9 A;  2LRC A;  1DE2 A;  4Q5Q A;  2R5G A;  4IW9 A;  3H1N A;  4G0L A;  2G2Q A;  2RM5 A;  1WRY A;  4WF5 A;  5DVB A;  1KBN A;  1EOH A;  1VF4 A;  1SL0 B;  1JFU A;  1PGT A;  1DUG A;  3IAM 2;  4F0B A;  5ECK B;  4PTS A;  2H66 A;  2FA8 A;  5LNK e;  3ZML A;  4DSS B;  1PL1 A;  1ZL9 A;  4GSS A;  3TJB A;  4G0I A;  2L5L A;  4V2M A;  3IAS 2;  4IP6 A;  4MDC A;  1EGR A;  4YAP A;  4POB A;  4WKW A;  2YWM A;  5AIS A;  3IPZ A;  6GSS A;  3TRQ A;  3GX8 A;  4IBP A;  3QAW A;  5F05 A;  3M9K A;  1MEK A;  4DSS A;  5A4V A;  1Z7P A;  1O8X A;  1X9S B;  5D73 A;  5ECM B;  1K0M A;  3IV4 A;  3IXR A;  3ZRE A;  4N0Z A;  1SD8 A;  2RM6 A;  5ECN B;  1THX A;  2MZC A;  5F0G A;  4KCA A;  3FZ5 A;  2O7K A;  4ZB9 A;  4MZW A;  3VWX A;  4N11 A;  1I1I P;  1VRS D;  3ZVJ A;  2I4A A;  1YQ1 A;  1LU4 A;  1TRU A;  1M9B A;  1FOH A;  4ULX A;  1A2M A;  4OFT A;  2HXK A;  2CV4 A;  3UBL A;  4KB3 A;  2K6V A;  2TRC P;  2XC2 A;  2G0F A;  3IC8 A;  4MLY A;  2VCX A;  3L9S A;  2H0I A;  4ZBA A;  13GS A;  1GSU A;  2YN1 A;  1GWC A;  1KEB A;  4NPB A;  2OKA A;  3UAR A;  1AIU A;  4AGS A;  5IO2 A;  2B5Y A;  2RLI A;  3W8J A;  1PQN A;  3D4T A;  3HHV A;  1OE8 A;  4IGJ A;  1T4Z A;  4PQH A;  5IPH A;  4O5Q A;  4POM A;  5E4W A;  1G0T A;  4KDU A;  3VWV A;  4HQZ A;  4D73 B;  3GUS A;  2CX3 A;  4RI6 A;  5J40 A;  3MIX A;  1UA5 A;  4OO5 A;  1BJX A;  2X49 A;  6GSW A;  1XWA A;  2X64 A;  1GNE A;  3EPT A;  1GSS A;  3EC3 A;  2IWT A;  1QGV A;  4DSQ A;  4KW6 A;  1WPI A;  3GKX A;  2OE0 A;  4BVX B;  1AQW A;  2E2M A;  2WS2 A;  3RDW A;  2DMM A;  1GSQ A;  2LNS A;  3HCZ A;  2LQO A;  4FIW A;  1UVZ A;  3GKK A;  2PN8 A;  4BVY A;  1BX9 A;  1QQ2 A;  5HQP A;  4KE3 A;  4YQM A;  3TRX A;  2LRT A;  16GS A;  4PUF C;  3A5I A;  4HU7 A;  3W6G A;  4HDE A;  4K7N A;  2PER A;  1Z9H A;  1GTA A;  2KP2 A;  2YP6 A;  3F3Q A;  1PX7 A;  2VCW A;  2HZE B;  1ILO A;  2WW1 A;  2YJ7 A;  4IJI A;  2IPA A;  2H74 A;  2WW2 A;  2IMF A;  4KA0 A;  5DJL A;  4K7I A;  3US3 A;  2CAQ A;  5CRW A;  3TU3 B;  2NTO A;  2F3M A;  4OMV A;  2ON5 A;  1TI1 A;  3EIN A;  5KN1 A;  1X0R A;  1TKD B;  3LSZ A;  4YQV A;  4HSC X;  1IYI A;  3RHB A;  4ZXG A;  1NW2 A;  5IMA A;  2DLX A;  2EFD A;  1X5E A;  3ZL5 A;  2FWF A;  3F6D A;  5D93 A;  1E2Y A;  1BQ7 A;  2MMZ A;  3LYP A;  1TRS A;  4A5P A;  1Q98 A;  5AIV A;  3HMJ G;  3QAV A;  2WJU A;  2C3Q A;  1GTU A;  4MJB A;  4RI7 A;  20GS A;  3WD6 A;  2VLU A;  4MH3 A;  2GLR A;  1XVQ A;  2PPT A;  2DJ1 A;  1M2D A;  2L6C A;  1AQV A;  2VCZ A;  4V2N A;  3ISO A;  4GRF A;  2OT3 A;  1R4W A;  9GSS A;  2IL3 A;  3I6A A;  4P3Y B;  3RHC A;  5C04 A;  2WFC A;  4EIP A;  3QOU A;  3MYD A;  1X9M B;  4ZB6 A;  4USS A;  4PI2 C;  1YEW C;  5IMD A;  2TIR A;  4KGI A;  3DEX A;  2GDR A;  1G7E A;  3LOR A;  2LV3 A;  3W8S A;  4K9Z A;  1XWG A;  1V9W A;  3U6V A;  4I2U A;  3CSH A;  4MPF A;  5CAX A;  4IKH A;  3RFR C;  4O5R A;  2IN3 A;  5DQY A;  3PPU A;  4XCS A;  2A2P A;  5INY A;  1TXX A;  1QK8 A;  1ZCP A;  4PUA A;  1RQM A;  1VF3 A;  2EFC A;  1ERW A;  5HFG A;  2YAN A;  4L0U A;  3KM6 A;  4ZB7 A;  1U3I A;  3CBU A;  4N10 A;  3TCO A;  4K5R A;  1N8J A;  3D21 A;  3DKS A;  1SL1 B;  22GS A;  1T1V A;  2VLV A;  4WEY A;  4GSN A;  4L0W A;  2HRK A;  4AKI A;  1Y25 A;  3IHG A;  1VGL A;  2FA4 A;  2M46 A;  1SKW B;  3ZFL A;  1SJ6 A;  1ZYE A;  4GQF A;  2QGV A;  1A23 A;  5IMF A;  1TW9 A;  3E9J B;  6GST A;  2PBJ A;  2L59 A;  3G7J A;  2EIQ A;  3UJ1 A;  11GS A;  4MJA A;  3D22 A;  4GST A;  1R26 A;  1XW5 A;  5DCH A;  3JCM L;  2JAC A;  1U3A A;  2J23 A;  5BMU A;  1FW1 A;  3VFI A;  3WGE A;  4J2F A;  1GUK A;  3IR4 A;  2OE3 A;  3DML A;  2P5R A;  1TU7 A;  4PHZ C;  4PI0 C;  2O87 A;  4XRD A;  4TOP A;  5LCZ A;  4KCE A;  3D5J A;  1ERV A;  3GST A;  1N25 A;  3GNJ A;  4Z2T A;  4K0N A;  2FWG A;  4JU5 A;  3GX0 A;  1K0N A;  2DIZ A;  2H1D A;  4BA7 A;  2YNX A;  3LFL A;  4QMK A;  1BED A;  1O85 A;  5KN3 A;  5GZZ B;  2O3E A;  1JHB A;  5ID2 A;  4JZQ A;  5G30 A;  1TXU A;  4ID0 A;  3CQF A;  4OO4 A;  3Q6O A;  1AW9 A;  1GLP A;  5DQS A;  1UC7 A;  1WWJ A;  3UIW A;  1PKW A;  5ELA A;  3TGZ A;  3SWL A;  1CQG A;  1SYR A;  4JE1 A;  3Q74 A;  2EIR A;  3RPP A;  1TK0 B;  1WOU A;  4AI6 A;  1XWB A;  4K6X A;  1XW9 A;  3CTG A;  1THO A;  3HZ4 A;  5A4W A;  2EIO A;  3F9U A;  2R0C A;  4Z2U A;  4ZL8 A;  3TJG A;  4K2D A;  4MAB A;  2C0E A;  1GSD A;  3IHQ A;  2H0G A;  1MTC A;  5IO0 A;  1B9X C;  1NHO A;  2AYT A;  1SEN A;  2H0H A;  4WET A;  1HYU A;  5DAK B;  2FHE A;  2DSA A;  3ED3 A;  1X5C A;  5J4U A;  3HD5 A;  1TOF A;  2GQM A;  1XVW A;  5A34 A;  2R6K A;  2VCT A;  2ZCT A;  2N5F A;  4XIH A;  4HU9 A;  2HT9 A;  5A4U A;  3L9U A;  3TUE A;  2CVD A;  4PNG A;  2HSN B;  2YPM A;  3H8Q A;  1QMV A;  4NMU A;  3CRU A;  5FT3 A;  2B5E A;  3CTF A;  3FZ4 A;  3G7Y A;  5ECR B;  3KP8 A;  3FR6 A;  2WCI A;  2O85 A;  3FZ9 A;  2PWJ A;  4ZB8 A;  1U88 A;  3F63 A;  4V1A p;  1SKS B;  2JZT A;  1YEP A;  1E6B A;  3BCK A;  2WUL A;  2LJA A;  2VAF A;  3QCP A;  2JL4 A;  2HLS A;  1F3A A;  4TW5 A;  2NVL A;  2FCH A;  4NHZ A;  3P8W A;  2XHF A;  1M9A A;  4MH2 A;  5H5S A;  3MNG A;  4PX1 A;  2H76 A;  3TDG A;  3HXS A;  4IQA A;  4BWS A;  5L71 A;  3ZIV A;  3NIV A;  2WZS A;  4EC0 A;  1V58 A;  2VL2 C;  3FEU A;  2IMK A;  5AIX A;  4BIK A;  3APQ A;  1Q4J A;  5EPF A;  1MDK A;  2PGT A;  4EDY A;  4TRX A;  4TR4 A;  2K9F A;  2H1L A;  4PQI A;  3HJP A;  3LG6 A;  4WBJ A;  2DC5 A;  4EE0 A;  3WGD A;  3LW9 A;  2LTK A;  4ZBB A;  2I81 A;  1B8X A;  4ILF A;  5B6M A;  4NV2 A;  1A8Y A;  3QPM A;  5J5N A;  3IDV A;  1YVL A;  2MMO A;  1TP9 A;  4KAE A;  4BPY A;  2LJK A;  3PIN A;  4HJM A;  1SU9 A;  3UVT A;  1O81 A;  2OAC A;  4FQU A;  3ZFB A;  1GTI A;  2LUS A;  6GSU A;  1NM3 A;  3DIE A;  3CXG A;  4IHU A;  3ZYW A;  3KEB A;  3KP9 A;  2DJJ A;  3ME7 A;  4G01 A;  4K5S A;  4JRR A;  3O3T A;  3CYN A;  3IC4 A;  1ERU A;  4HJ2 A;  1WIK A;  3H4K A;  1TTZ A;  1FG4 A;  4MCU A;  4ICY A;  1SJZ A;  3HY2 A;  1V40 A;  2IFQ A;  4K0G A;  4O92 A;  5EVO A;  2H6Z A;  3TRP A;  1A2J A;  2OBI A;  2H8L A;  3TOT A;  4I97 A;  2R4V A;  3DYR A;  4I5Q A;  3FKF A;  3KD0 A;  1GUH A;  2GSR A;  3QR6 A;  3BJ5 A;  5CRE A;  4HOJ A;  1XOA A;  3Q19 A;  2DJ2 A;  18GS A;  3FZA A;  2KOK A;  3L9V A;  1PX6 A;  4WBR D;  4YKF A;  2K8V A;  2C0F A;  2FWE A;  1SK0 A;  1YF0 A;  4MF5 A;  2AAW A;  5G2Z A;  1EEM A;  2RII A;  3FR3 A;  2CVK A;  3PR8 A;  3C8E A;  3LJR A;  4AKG A;  1USB A;  4XHM A;  2C3T A;  1ZYP A;  3BD2 A;  2OAD A;  4BVY B;  1F9M A;  3G7I A;  4MJE A;  1K3O A;  4L8E A;  4LA1 A;  2O5V A;  3ERF A;  4X43 A;  4KUN A;  3KGK A;  4GWR A;  3CMI A;  1GRX A;  2JZS A;  2JU5 A;  4ECC A;  2H75 A;  4F0C A;  3APO A;  1M3J A;  3GL5 A;  5F07 A;  4CDO A;  3R2Q A;  3GN3 A;  2R3X A;  1FO5 A;  2PMT A;  5JWR B;  3DRN A;  4HEA 2;  1Y1U A;  2WRT A;  1MDI A;  5D9X A;  4E8H A;  2DIY A;  5IMV A;  5KN0 A;  4EDZ A;  2IIY A;  3IA1 A;  4MMM A;  2DKI A;  5HR2 A;  1GL8 A;  4J56 E;  3ERG A;  6GSX A;  2YZH A;  1AAZ A;  1YF1 A;  3NOF A;  3HYP A;  4I2T A;  1B48 A;  3UEM A;  10GS A;  3KMN A;  4GXZ A;  4KSM A;  2VIM A;  2PUK C;  3A3T A;  1S4B P;  2XPD A;  2HSM B;  1M0U A;  1M7T A;  3TJF A;  1XCC A;  4TXO A;  5DBQ A;  1Z6M A;  2XBI A;  1CQH A;  1GNW A;  1WMJ A;  3KIJ A;  2B5X A;  3ERW A;  5DCG A;  4CW9 A;  19GS A;  2L4C A;  2F51 A;  2HSM A;  5A5K A;  1K0O A;  2V32 A;  5DDL A;  3GL3 A;  4EUY A;  2LRN A;  1HNB A;  1ZYQ B;  1SL2 B;  2AUV A;  3GMF A;  2VL9 A;  4ISD A;  4GTU A;  4MK3 A;  4H86 A;  1EZK A;  2WVY A;  1SD9 A;  2ALB A;  2WW3 A;  4HQS A;  3GH9 A;  2DJ3 A;  1O7U A;  1AC1 A;  3ME8 A;  4MF7 A;  1F37 A;  3F8U A;  3EU3 A;  1BG5 A;  1SJI A;  5GST A;  2CZ2 A;  2GZY A;  1EP8 A;  2DML A;  3ZMK A;  3E3E A;  4MZB A;  4PNF A;  3C7M A;  4E8E A;  2C8U A;  3VPQ A;  4N30 A;  1K0C A;  2H19 A;  1XOB A;  1DBY A;  3O6T A;  4MA9 A;  2JAD A;  5B6N A;  5CRH A;  1ST9 A;  3QFA C;  4DVC A;  2O89 A;  4IEL A;  5ECQ B;  3GKN A;  2CVB A;  1JLW A;  1PKZ A;  2VOC A;  2PU9 C;  2HRK B;  4AJ6 A;  3TKS A;  1XPV A;  4EKZ A;  4O5U A;  1R5P A;  1GTB A;  3TKS E;  2HE3 A;  1URM A;  3M1G A;  5D9W A;  2GGT A;  1ABA A;  3UOM A;  4X4J A;  2X8G A;  2O36 A;  2BMX A;  3EUR A;  4TR1 A;  1SVL A;  4YQU A;  4FYB A;  2FWH A;  1HD2 A;  1M2B A;  3KH7 A;  2HRF A;  3KTL A;  4F82 A;  3QMX A;  1ZGN A;  5BMU B;  4I8B A;  3VK9 A;  5DJM A;  2OBK A;  4WR5 A;  2P0G A;  3DVW A;  5IPG A;  2GQL A;  2QSI A;  1TK8 B;  3KZQ A;  3KXO A;  3ZVJ D;  3M8N A;  1SKR B;  3FMW A;  2I3Y A;  5COH A;  1AQX A;  3CRT A;  2VL2 A;  2YWO A;  2VL3 A;  1O6J A;  2DKH A;  4OWY A;  1QXH A;  1V2A A;  3DWV A;  1FB6 A;  5G1K A;  2VM2 A;  4ZIJ A;  2AB6 A;  1YY7 A;  5IM9 A;  4TR0 A;  1PFO A;  4EL1 A;  5G5F A;  4KND A;  5B7C A;  1Y6E A;  2BTO T;  4LL1 B;  3HVN A;  4LMV A;  4OCF A;  5ID2 B;  1AXD A;  1EGO A;  2L4Q A;  4K1F A;  5H5R A;  2H71 A;  4AKX B;  3EYT A;  4PXO A;  2FD3 A;  5A1N A;  3CHX C;  1Z7R A;  2VM1 A;  3S9F A;  1R7H A;  4ECJ A;  1H4O A;  4EVM A;  1M3I A;  4XS6 A;  1GUM A;  4EIQ A;  4F9Z A;  5ECO B;  3IBH A;  4YAV A;  2M80 A;  1EEJ A;  3FR9 A;  4EXJ A;  4BWQ A;  1YDK A;  1G6Y A;  4TXV A;  3TJJ A;  4Z7X A;  1TI3 A;  4WXT A;  5HR1 A;  2VD0 A;  4NHW A;  1DSB A;  3OR5 A;  5EL8 A;  2HNL A;  2N5B A;  5H5Q A;  1GSY A;  3ZZX A;  3HKR A;  5DAL A;  3P90 A;  2H6Y A;  5ENU A;  1SVM A;  3VWU A;  4BL7 A;  2WVX A;  3HJO A;  5A5H A;  3E0U A;  1EV9 A;  4Q5N A;  1WP0 A;  3C1S A;  1TK5 B;  5A34 B;  2GSS A;  3F4S A;  1WJK A;  5ECH B;  2M72 A;  5CRG A;  1ZYN A;  4Q5F A;  7GSS A;  3P7X A;  3H93 A;  2MBS A;  2CAI A;  5JCU A;  4E68 A;  5D96 A;  4YKG A;  4AJ7 A;  1XWC A;  3HVS A;  2HQT A;  2NDO A;  3L4N A;  3GTU B;  3TOU A;  1ACV A;  4QL9 A;  5J4V A;  3FHK A;  2ZNM A;  2CX4 A;  1OC9 B;  3I43 A;  4OD7 A;  3RBT A;  2FY6 A;  4NAX A;  1O73 A;  1W4V A;  4ACS A;  2E2G A;  5G1L A;  1S3R A;  3IK9 A;  5JWO B;  1MD4 A;  2Z9S A;  6GSV A;  2EC4 A;  3DXB A;  1T3B A;  2FLS A;  4RQX A;  2F8A A;  3TJK A;  3GTU A;  4GDF A;  2VLT A;  2RUE A;  2H6X A;  1OC9 A;  3N5O A;  5D9T A;  4FO5 A;  2AHE A;  2V1M A;  4JR4 A;  4G9H A;  4POL A;  3LGC A;  1PMT A;  1A0F A;  3I9V 2;  1K3L A;  1WE0 A;  1HNA A;  1ERT A;  2UV8 G;  2MMN A;  3DD3 A;  1OKT A;  1S3D A;  2DJ0 A;  4FYU A;  1KNG A;  4IN0 A;  3EU4 A;  1XG8 A;  5HR3 A;  3VI5 A;  3F4R A;  5HFI A;  2XBQ A;  1GUL A;  4YH2 A;  2C0G A;  5IOW A;  2A4V A;  5KOW A;  3GA4 A;  3F3R A;  3SBC A;  4G10 A;  1GLQ A;  2EFH A;  2R2J A;  2B1L A;  2B7J A;  3RGB C;  3VWW A;  4G2E A;  1F6M C;  1W89 A;  5G5E A;  1BF5 A;  1JZW A;  3GH6 A;  2PVO C;  4ECI A;  2F9S A;  1SYX A;  2H30 A;  4PGT A;  1SK1 A;  4OFN A;  1T00 A;  2X8H A;  1YEX A;  1T7P B;  2H1G A;  5AGY A;  2CZ3 A;  3QAG A;  1EV4 A;  3HVX A;  5J4Y A;  3K8N A;  1BG1 A;  4V1A g;  2X8C A;  3LXZ A;  3M3M A;  3J7Y b;  1XW6 A;  3HDC A;  4MJC A;  4X0X A;  4DSR A;  4RUV A;  2IFQ B;  14GS A;  2YZU A;  3A2W A;  2GST A;  1DE1 A;  5J3R A;  2KLX A;  5CYY A;  2HFD A;  4K7O A;  4AF2 A;  4XRA A;  2FUG 2;  2YWI A;  2WZ9 A;  1Z5Y E;  1QUW A;  4OFM A;  5F8B A;  2YCD A;  4CY6 A;  3DGQ A;  17GS A;  1F3B A;  4MPG A;  4N0V A;  3EWL A;  2GZP A;  4QQ7 A;  2MMA A;  2R37 A;  4ML1 A;  4G0K A;  4IVF A;  3LEF A;  1C72 A;  4W66 A;  2QC7 A;  3EVI A;  2F8F A;  2V41 A;  1FVK A;  1JZR A;  4O7H A;  1XBS A;  2B6M A;  1OAZ A;  5AN1 A;  3QFB C;  2GTU A;  1EP7 A;  1K0A A;  3G9B A;  3GSS A;  1GSF A;  1PL2 A;  5IMC A;  3L0H A;  2LKU A;  2X4A A;  1ON4 A;  4KDX A;  2GT5 A;  5ECP B;  1XWK A;  4GF0 A;  3A2X A;  2NBS A;  2HSY A;  5ECL B;  1K3Y A;  2IMI A;  2IME A;  3C71 A;  4HS1 A;  1TRV A;  2A4H A;  3V1W A;  2WVZ A;  1V57 A;  2QA1 A;  4HZ2 A;  3D4M A;  1V98 A;  4D73 A;  4HI7 A;  4XS4 B;  8GSS A;  1AUC A;  2HRN A;  1LBK A;  3UAP A;  1A8L A;  3QD9 A;  1Z6N A;  4IQ1 A;  4I6X A;  4IJ3 A;  4TN8 A;  4KF9 A;  1B4Q A;  2HYX A;  4RQR A;  1H75 A;  4MF6 A;  2YV7 A;  5ECS A;  3HZ8 A;  5G31 A;  4LL4 B;  2L5O A;  2GZZ A;  4XS4 A;  2RUF A;  2A2R A;  3KMO A;  4BVX A;  3UBK A;  1FB0 A;  2CA8 A;  4ML6 A;  2QA2 A;  3HVV A;  3CSI A;  1OVN A;  5ECI B;  2V2G A;  4KDY A;  2VD1 A;  2VCV A;  4TXO B;  2LS5 A;  5LD0 A;  4JBB A;  3O76 A;  4WF4 A;  3GYK A;  3WT2 A;  1TRW A;  1ML6 A;  1PN9 A;  2WDU A;  4JR6 A;  1YZX A;  3VI7 A;  3UL3 A;  1FOV A;  1MD3 A;  1FAA A;  2XPE A;  2H72 A; 
#chains in the Genus database with same CATH homology
 3H79 A;  4TR3 A;  3TKR A;  5D9V A;  2HZE A;  3ZTL A;  1R5A A;  2DJK A;  4ZL9 A;  1OKD A;  1NHY A;  3GV1 A;  4GQC A;  1U6T A;  3P2A A;  4MP4 A;  2JSY A;  1OE7 A;  2JZR A;  5C00 A;  1A2L A;  1EWX A;  2MBT A;  3FY7 A;  2V6O A;  1GH2 A;  4FYC A;  3M0F A;  1N2A A;  3LYK A;  2H70 A;  4KH7 A;  2LEG A;  4TVE A;  4PQ1 A;  5E59 A;  3J7Y k;  3KJY A;  2R0P A;  4IS0 A;  2YV9 A;  2B3S A;  3TB2 A;  2HSH A;  1UN2 A;  2VUP A;  1RW1 A;  3A5W A;  4OCE A;  4KSO A;  4POK A;  3GIX A;  5CP1 A;  2UZ8 A;  4ZL7 A;  4EO3 A;  5IQY A;  2LJR A;  1PD2 1;  5J9B A;  3U5R E;  2BJX A;  2C3N A;  1I5G A;  2GSQ A;  4O32 A;  3GUR A;  1PA3 A;  3F4T A;  2GT6 A;  2NPB A;  5FWG A;  1TDI A;  1J08 A;  1ZOF A;  3ZIT A;  4PUR A;  5J9C A;  1T8E B;  1NSW A;  3A2V A;  3N9J A;  2WGR A;  4NWY A;  3VPT A;  3TKP A;  3MWH A;  3D0Z A;  3LXT A;  3F0I A;  4F03 A;  3IK7 A;  4QL7 A;  5EY6 A;  4IP1 A;  2HZF A;  2HRA A;  3PGT A;  5GAP D;  1X9W B;  1JZO A;  1B4P A;  4LMW A;  6GSY A;  1T4Y A;  3BCI A;  2HI7 A;  2C1Y A;  3C1R A;  4TR1 B;  4CY8 A;  4L5L A;  3TKQ A;  3FK8 A;  1IYH A;  4K8M A;  5ELG A;  4EF0 A;  2ZUP A;  4N3Z A;  3L78 A;  1G6W A;  3NZN A;  2H73 A;  4WR4 A;  4FH8 A;  2VCQ A;  2KUC A;  1K0B A;  1BYE A;  1VF2 A;  4NXI A;  3CSJ A;  1FVJ A;  4KX4 A;  2KHP A;  4J57 E;  4TKY A;  3MDK A;  1YKC A;  4G19 A;  3QDN A;  2K8S A;  2VKZ G;  2MYG A;  3D6I A;  2R0G A;  1SK2 A;  4XS1 A;  2GS3 A;  3ZIJ A;  5F06 A;  1QFN A;  1Z3E A;  1S3A A;  1BAY A;  1YKA A;  1GSE A;  5J41 A;  2YWN A;  2GVP A;  1LJR A;  5HR0 A;  2B7K A;  4ZBD A;  5A1N B;  2C80 A;  2P31 A;  2I9H A;  1MDJ A;  4ECB A;  2P5Q A;  1ZZY A;  2A2S A;  4GCI A;  1F2E A;  4MZC A;  3WYW A;  3GKM A;  4JED A;  1I9D A;  2X99 A;  2AV4 A;  3KCM A;  3MSZ A;  2IMD A;  3GHA A;  4AJ8 A;  2YJH A;  2CT6 A;  5KOX A;  5IOX A;  3IE3 A;  5JCG A;  3HJM A;  2GQK A;  2KP1 A;  3EMX A;  3AY8 A;  3DVX A;  2IJY A;  4AKH A;  3UVH A;  3FW2 A;  1A0R P;  3CWG A;  5CRD A;  2K18 A;  4MNN A;  5JWQ B;  2VO4 A;  3EMP A;  1GP1 A;  1A24 A;  4XTS A;  2ES7 A;  1VF1 A;  1ZMA A;  2JSZ A;  1M99 A;  2DBC A;  5DAL B;  1XIY A;  3KH9 A;  3IRA A;  2E7P A;  3LQ7 A;  3KTB A;  3WT1 A;  2TRX A;  1M2A A;  2EFE A;  1KTE A;  4BL7 B;  5A5H B;  1JLV A;  3GFK A;  1O8W A;  3WGX A;  2O8V B;  1PN0 A;  3VUR A;  5GAN D;  2REM A;  5BRT A;  2OJL A;  2L6D A;  5GSS A;  2LNT A;  3ZRD A;  2C4J A;  1U87 A;  5ABR A;  2AJQ B;  2FNO A;  5B8B A;  2LQQ A;  2YOI A;  3FRC A;  2LST A;  2OA7 A;  4CHS A;  1XZO A;  2ON7 A;  3APS A;  2C0D A;  3IOS A;  2L57 A;  4V2L A;  3BOA A;  1EOG A;  3Q18 A;  4DEJ A;  5IIZ A;  3FYG A;  2PVQ A;  4Q5R A;  3M9J A;  12GS A;  2E0Q A;  1OC3 A;  2QKE A;  3R3E A;  5KEJ A;  2CQ9 A;  3C73 A;  1XFL A;  3EE2 A;  1PRX A;  5IMZ A;  3I69 A;  4X1U A;  4GLT A;  1X5D A;  1TU8 A;  1YJ6 A;  1HQO A;  4LLR A;  2J9H A;  2B1K A;  1XXU A;  4F2I A;  2H01 A;  1JZD A;  1PSQ A;  4HUA A;  1B9Y C;  1OC8 A;  3BBY A;  4ZIL A;  4NV5 A;  5CNW A;  5DAK A;  3ZLP A;  1J0F A;  3TKS C;  5JCW A;  3F6F A;  2OE1 A;  2V6K A;  3GRX A;  1RK4 A;  1S3C A;  3RPN A;  2D2Z A;  3VLN A;  4K2X A;  1SVO A;  5KN2 A;  1HNC A;  1OYJ A;  1FHE A;  1J9B A;  5B8A A;  2H1A A;  3LWA A;  4L5O A;  5J47 A;  3RAZ A;  4HZ4 A;  1TJD A;  2N5A A;  3MAK A;  5D8I A;  1K0D A;  4Z2R A;  3HA9 A;  1G7O A;  5FHI A;  2WB9 A;  2I1U A;  2HSN A;  5CO3 A;  5HFK A;  2FGX A;  3UMA A;  2H1B A;  3PH9 A;  2LRC A;  1DE2 A;  4Q5Q A;  2R5G A;  4IW9 A;  3H1N A;  4G0L A;  2G2Q A;  2RM5 A;  1WRY A;  4WF5 A;  5DVB A;  1KBN A;  1EOH A;  1VF4 A;  1SL0 B;  1JFU A;  1PGT A;  1DUG A;  3IAM 2;  4F0B A;  5ECK B;  4PTS A;  2H66 A;  2FA8 A;  5LNK e;  3ZML A;  4DSS B;  1PL1 A;  1ZL9 A;  4GSS A;  3TJB A;  4G0I A;  2L5L A;  4V2M A;  3IAS 2;  4IP6 A;  4MDC A;  1EGR A;  4YAP A;  4POB A;  4WKW A;  2YWM A;  5AIS A;  3IPZ A;  6GSS A;  3TRQ A;  3GX8 A;  4IBP A;  3QAW A;  5F05 A;  3M9K A;  1MEK A;  4DSS A;  5A4V A;  1Z7P A;  1O8X A;  1X9S B;  5D73 A;  5ECM B;  1K0M A;  3IV4 A;  3IXR A;  3ZRE A;  4N0Z A;  1SD8 A;  2RM6 A;  5ECN B;  1THX A;  2MZC A;  5F0G A;  4KCA A;  3FZ5 A;  2O7K A;  4ZB9 A;  4MZW A;  3VWX A;  4N11 A;  1VRS D;  3ZVJ A;  2I4A A;  1YQ1 A;  1LU4 A;  1TRU A;  1M9B A;  1FOH A;  4ULX A;  1A2M A;  4OFT A;  2HXK A;  2CV4 A;  3UBL A;  4KB3 A;  2K6V A;  2TRC P;  2XC2 A;  2G0F A;  3IC8 A;  4MLY A;  2VCX A;  3L9S A;  2H0I A;  4ZBA A;  13GS A;  1GSU A;  2YN1 A;  1GWC A;  1KEB A;  4NPB A;  2OKA A;  3UAR A;  1AIU A;  4AGS A;  5IO2 A;  2B5Y A;  2RLI A;  3W8J A;  1PQN A;  3D4T A;  3HHV A;  1OE8 A;  4IGJ A;  1T4Z A;  4PQH A;  5IPH A;  4O5Q A;  4POM A;  5E4W A;  1G0T A;  4KDU A;  3VWV A;  4HQZ A;  4D73 B;  3GUS A;  2CX3 A;  4RI6 A;  5J40 A;  3MIX A;  1UA5 A;  4OO5 A;  1BJX A;  2X49 A;  6GSW A;  1XWA A;  2X64 A;  1GNE A;  3EPT A;  1GSS A;  3EC3 A;  2IWT A;  1QGV A;  4DSQ A;  4KW6 A;  1WPI A;  3GKX A;  2OE0 A;  4BVX B;  1AQW A;  2E2M A;  2WS2 A;  3RDW A;  2DMM A;  1GSQ A;  2LNS A;  3HCZ A;  2LQO A;  4FIW A;  1UVZ A;  3GKK A;  2PN8 A;  4BVY A;  1BX9 A;  1QQ2 A;  5HQP A;  4KE3 A;  4YQM A;  3TRX A;  2LRT A;  16GS A;  4PUF C;  3A5I A;  4HU7 A;  3W6G A;  4HDE A;  4K7N A;  2PER A;  1Z9H A;  1GTA A;  2KP2 A;  2YP6 A;  3F3Q A;  1PX7 A;  2VCW A;  2HZE B;  1ILO A;  2YJ7 A;  4IJI A;  2IPA A;  2H74 A;  2IMF A;  4KA0 A;  5DJL A;  4K7I A;  3US3 A;  2CAQ A;  5CRW A;  3TU3 B;  2NTO A;  2F3M A;  4OMV A;  2ON5 A;  1TI1 A;  3EIN A;  5KN1 A;  1X0R A;  1TKD B;  3LSZ A;  4YQV A;  1IYI A;  3RHB A;  4ZXG A;  1NW2 A;  5IMA A;  2DLX A;  2EFD A;  1X5E A;  3ZL5 A;  2FWF A;  3F6D A;  5D93 A;  1E2Y A;  1BQ7 A;  2MMZ A;  3LYP A;  1TRS A;  4A5P A;  1Q98 A;  5AIV A;  3HMJ G;  3QAV A;  2WJU A;  2C3Q A;  1GTU A;  4MJB A;  4RI7 A;  20GS A;  3WD6 A;  2VLU A;  4MH3 A;  2GLR A;  1XVQ A;  2PPT A;  2DJ1 A;  1M2D A;  2L6C A;  1AQV A;  2VCZ A;  4V2N A;  3ISO A;  4GRF A;  2OT3 A;  1R4W A;  9GSS A;  2IL3 A;  3I6A A;  4P3Y B;  3RHC A;  5C04 A;  2WFC A;  4EIP A;  3QOU A;  3MYD A;  1X9M B;  4ZB6 A;  4USS A;  5IMD A;  2TIR A;  4KGI A;  3DEX A;  2GDR A;  1G7E A;  3LOR A;  2LV3 A;  3W8S A;  4K9Z A;  1XWG A;  1V9W A;  3U6V A;  4I2U A;  3CSH A;  4MPF A;  5CAX A;  4IKH A;  4O5R A;  2IN3 A;  5DQY A;  3PPU A;  4XCS A;  2A2P A;  5INY A;  1TXX A;  1QK8 A;  1ZCP A;  4PUA A;  1RQM A;  1VF3 A;  2EFC A;  1ERW A;  5HFG A;  2YAN A;  4L0U A;  3KM6 A;  4ZB7 A;  1U3I A;  3CBU A;  4N10 A;  3TCO A;  4K5R A;  1N8J A;  3D21 A;  3DKS A;  1SL1 B;  22GS A;  1T1V A;  2VLV A;  4WEY A;  4GSN A;  4L0W A;  2HRK A;  4AKI A;  1Y25 A;  3IHG A;  2FA4 A;  1VGL A;  2M46 A;  1SKW B;  3ZFL A;  1SJ6 A;  1ZYE A;  4GQF A;  2QGV A;  1A23 A;  5IMF A;  1TW9 A;  3E9J B;  6GST A;  2PBJ A;  2L59 A;  3G7J A;  2EIQ A;  3UJ1 A;  11GS A;  4MJA A;  3D22 A;  4GST A;  1R26 A;  1XW5 A;  5DCH A;  3JCM L;  2JAC A;  1U3A A;  2J23 A;  5BMU A;  1FW1 A;  3VFI A;  3WGE A;  4J2F A;  1GUK A;  3IR4 A;  2OE3 A;  3DML A;  2P5R A;  1TU7 A;  2O87 A;  4XRD A;  4TOP A;  5LCZ A;  4KCE A;  3D5J A;  1ERV A;  3GST A;  1N25 A;  3GNJ A;  4Z2T A;  4K0N A;  2FWG A;  4JU5 A;  3GX0 A;  1K0N A;  2DIZ A;  2H1D A;  4BA7 A;  2YNX A;  3LFL A;  4QMK A;  1BED A;  1O85 A;  5KN3 A;  5GZZ B;  1JHB A;  5ID2 A;  4JZQ A;  5G30 A;  1TXU A;  4ID0 A;  4OO4 A;  3Q6O A;  1AW9 A;  1GLP A;  5DQS A;  1UC7 A;  1WWJ A;  3UIW A;  1PKW A;  5ELA A;  3TGZ A;  3SWL A;  1CQG A;  1SYR A;  4JE1 A;  3Q74 A;  2EIR A;  3RPP A;  1TK0 B;  1WOU A;  4AI6 A;  1XWB A;  4K6X A;  1XW9 A;  3CTG A;  1THO A;  3HZ4 A;  5A4W A;  2EIO A;  3F9U A;  2R0C A;  4Z2U A;  4ZL8 A;  3TJG A;  4K2D A;  4MAB A;  2C0E A;  1GSD A;  3IHQ A;  2H0G A;  1MTC A;  5IO0 A;  1B9X C;  1NHO A;  2AYT A;  1SEN A;  2H0H A;  4WET A;  1HYU A;  5DAK B;  2FHE A;  2DSA A;  3ED3 A;  1X5C A;  5J4U A;  3HD5 A;  1TOF A;  2GQM A;  1XVW A;  5A34 A;  2R6K A;  2VCT A;  2ZCT A;  2N5F A;  4XIH A;  4HU9 A;  2HT9 A;  5A4U A;  3L9U A;  3TUE A;  2CVD A;  4PNG A;  2HSN B;  2YPM A;  3H8Q A;  1QMV A;  4NMU A;  3CRU A;  5FT3 A;  2B5E A;  3CTF A;  3FZ4 A;  3G7Y A;  5ECR B;  3KP8 A;  3FR6 A;  2WCI A;  2O85 A;  3FZ9 A;  2PWJ A;  4ZB8 A;  1U88 A;  3F63 A;  4V1A p;  1SKS B;  2JZT A;  1YEP A;  1E6B A;  3BCK A;  2WUL A;  2LJA A;  2VAF A;  3QCP A;  2JL4 A;  2HLS A;  1F3A A;  4TW5 A;  2NVL A;  2FCH A;  4NHZ A;  3P8W A;  2XHF A;  1M9A A;  4MH2 A;  5H5S A;  3MNG A;  4PX1 A;  2H76 A;  3TDG A;  3HXS A;  4IQA A;  4BWS A;  5L71 A;  3ZIV A;  3NIV A;  4EC0 A;  1V58 A;  2VL2 C;  3FEU A;  2IMK A;  5AIX A;  3APQ A;  1Q4J A;  5EPF A;  1MDK A;  2PGT A;  4EDY A;  4TRX A;  4TR4 A;  2K9F A;  2H1L A;  4PQI A;  3HJP A;  3LG6 A;  4WBJ A;  2DC5 A;  4EE0 A;  3WGD A;  3LW9 A;  2LTK A;  4ZBB A;  2I81 A;  1B8X A;  4ILF A;  5B6M A;  4NV2 A;  1A8Y A;  3QPM A;  5J5N A;  3IDV A;  1YVL A;  2MMO A;  1TP9 A;  4KAE A;  4BPY A;  2LJK A;  3PIN A;  4HJM A;  1SU9 A;  3UVT A;  1O81 A;  2OAC A;  4FQU A;  3ZFB A;  1GTI A;  2LUS A;  6GSU A;  1NM3 A;  3DIE A;  3CXG A;  4IHU A;  3ZYW A;  3KEB A;  3KP9 A;  2DJJ A;  3ME7 A;  4G01 A;  4K5S A;  4JRR A;  3O3T A;  3CYN A;  3IC4 A;  1ERU A;  4HJ2 A;  1WIK A;  3H4K A;  1TTZ A;  1FG4 A;  4MCU A;  4ICY A;  1SJZ A;  3HY2 A;  1V40 A;  2IFQ A;  4K0G A;  4O92 A;  5EVO A;  2H6Z A;  3TRP A;  1A2J A;  2OBI A;  2H8L A;  3TOT A;  4I97 A;  2R4V A;  3DYR A;  4I5Q A;  3FKF A;  3KD0 A;  1GUH A;  2GSR A;  3QR6 A;  3BJ5 A;  5CRE A;  4HOJ A;  1XOA A;  3Q19 A;  2DJ2 A;  18GS A;  3FZA A;  2KOK A;  3L9V A;  1PX6 A;  4WBR D;  4YKF A;  2K8V A;  2C0F A;  2FWE A;  1SK0 A;  1YF0 A;  4MF5 A;  2AAW A;  5G2Z A;  1EEM A;  2RII A;  3FR3 A;  2CVK A;  3PR8 A;  3C8E A;  3LJR A;  4AKG A;  1USB A;  4XHM A;  2C3T A;  1ZYP A;  3BD2 A;  2OAD A;  4BVY B;  1F9M A;  3G7I A;  4MJE A;  1K3O A;  4L8E A;  4LA1 A;  2O5V A;  3ERF A;  4X43 A;  4KUN A;  3KGK A;  4GWR A;  3CMI A;  1GRX A;  2JZS A;  2JU5 A;  4ECC A;  2H75 A;  4F0C A;  3APO A;  3GL5 A;  5F07 A;  4CDO A;  3R2Q A;  3GN3 A;  2R3X A;  1FO5 A;  2PMT A;  5JWR B;  3DRN A;  4HEA 2;  1Y1U A;  2WRT A;  1MDI A;  5D9X A;  4E8H A;  2DIY A;  5IMV A;  5KN0 A;  4EDZ A;  2IIY A;  3IA1 A;  4MMM A;  2DKI A;  5HR2 A;  1GL8 A;  4J56 E;  3ERG A;  6GSX A;  2YZH A;  1AAZ A;  1YF1 A;  3NOF A;  3HYP A;  4I2T A;  1B48 A;  3UEM A;  10GS A;  3KMN A;  4GXZ A;  4KSM A;  2VIM A;  2PUK C;  3A3T A;  2XPD A;  2HSM B;  1M0U A;  1M7T A;  3TJF A;  1XCC A;  4TXO A;  5DBQ A;  1Z6M A;  2XBI A;  1CQH A;  1GNW A;  1WMJ A;  3KIJ A;  2B5X A;  3ERW A;  5DCG A;  4CW9 A;  19GS A;  2L4C A;  2F51 A;  2HSM A;  5A5K A;  1K0O A;  2V32 A;  5DDL A;  3GL3 A;  4EUY A;  2LRN A;  1HNB A;  1ZYQ B;  1SL2 B;  2AUV A;  3GMF A;  2VL9 A;  4ISD A;  4GTU A;  4MK3 A;  4H86 A;  1EZK A;  1SD9 A;  2ALB A;  4HQS A;  3GH9 A;  2DJ3 A;  1O7U A;  3ME8 A;  1AC1 A;  4MF7 A;  1F37 A;  3F8U A;  3EU3 A;  1BG5 A;  1SJI A;  5GST A;  2CZ2 A;  2GZY A;  1EP8 A;  2DML A;  3ZMK A;  3E3E A;  4MZB A;  4PNF A;  3C7M A;  4E8E A;  2C8U A;  3VPQ A;  4N30 A;  1K0C A;  2H19 A;  1XOB A;  1DBY A;  3O6T A;  4MA9 A;  2JAD A;  5B6N A;  5CRH A;  1ST9 A;  3QFA C;  4DVC A;  2O89 A;  4IEL A;  5ECQ B;  3GKN A;  2CVB A;  1JLW A;  1PKZ A;  2VOC A;  2PU9 C;  2HRK B;  4AJ6 A;  3TKS A;  1XPV A;  4EKZ A;  4O5U A;  1R5P A;  1GTB A;  3TKS E;  2HE3 A;  1URM A;  3M1G A;  5D9W A;  2GGT A;  1ABA A;  3UOM A;  4X4J A;  2BMX A;  2X8G A;  3EUR A;  4TR1 A;  1SVL A;  4YQU A;  4FYB A;  2FWH A;  1HD2 A;  1M2B A;  3KH7 A;  2HRF A;  3KTL A;  4F82 A;  3QMX A;  1ZGN A;  5BMU B;  4I8B A;  3VK9 A;  5DJM A;  2OBK A;  4WR5 A;  2P0G A;  3DVW A;  5IPG A;  2GQL A;  2QSI A;  1TK8 B;  3KZQ A;  3KXO A;  3ZVJ D;  3M8N A;  1SKR B;  3FMW A;  2I3Y A;  5COH A;  1AQX A;  3CRT A;  2VL2 A;  2YWO A;  2VL3 A;  1O6J A;  2DKH A;  4OWY A;  1QXH A;  1V2A A;  3DWV A;  1FB6 A;  5G1K A;  2VM2 A;  4ZIJ A;  2AB6 A;  1YY7 A;  5IM9 A;  4TR0 A;  4EL1 A;  5G5F A;  4KND A;  5B7C A;  1Y6E A;  2BTO T;  4LL1 B;  4LMV A;  4OCF A;  5ID2 B;  1AXD A;  1EGO A;  2L4Q A;  4K1F A;  5H5R A;  2H71 A;  4AKX B;  3EYT A;  4PXO A;  2FD3 A;  5A1N A;  1Z7R A;  3S9F A;  2VM1 A;  1R7H A;  4ECJ A;  1H4O A;  4EVM A;  4XS6 A;  1GUM A;  4EIQ A;  4F9Z A;  5ECO B;  3IBH A;  4YAV A;  2M80 A;  1EEJ A;  3FR9 A;  4EXJ A;  4BWQ A;  1YDK A;  1G6Y A;  4TXV A;  3TJJ A;  4Z7X A;  1TI3 A;  4WXT A;  5HR1 A;  2VD0 A;  4NHW A;  1DSB A;  3OR5 A;  5EL8 A;  2HNL A;  2N5B A;  5H5Q A;  1GSY A;  3ZZX A;  3HKR A;  5DAL A;  3P90 A;  2H6Y A;  5ENU A;  1SVM A;  3VWU A;  4BL7 A;  3HJO A;  5A5H A;  3E0U A;  1EV9 A;  4Q5N A;  1WP0 A;  3C1S A;  1TK5 B;  5A34 B;  2GSS A;  3F4S A;  1WJK A;  5ECH B;  2M72 A;  5CRG A;  1ZYN A;  4Q5F A;  7GSS A;  3P7X A;  3H93 A;  2MBS A;  2CAI A;  5JCU A;  4E68 A;  5D96 A;  4YKG A;  4AJ7 A;  1XWC A;  3HVS A;  2HQT A;  2NDO A;  3L4N A;  3GTU B;  3TOU A;  1ACV A;  4QL9 A;  5J4V A;  3FHK A;  2ZNM A;  2CX4 A;  1OC9 B;  3I43 A;  4OD7 A;  3RBT A;  2FY6 A;  4NAX A;  1O73 A;  1W4V A;  4ACS A;  2E2G A;  5G1L A;  3IK9 A;  5JWO B;  1MD4 A;  2Z9S A;  6GSV A;  2EC4 A;  3DXB A;  1T3B A;  2FLS A;  4RQX A;  2F8A A;  3TJK A;  3GTU A;  4GDF A;  2VLT A;  2RUE A;  2H6X A;  1OC9 A;  3N5O A;  5D9T A;  4FO5 A;  2AHE A;  2V1M A;  4JR4 A;  4G9H A;  4POL A;  3LGC A;  1PMT A;  1A0F A;  3I9V 2;  1K3L A;  1WE0 A;  1HNA A;  1ERT A;  2UV8 G;  2MMN A;  3DD3 A;  1OKT A;  1S3D A;  2DJ0 A;  4FYU A;  1KNG A;  4IN0 A;  3EU4 A;  5HR3 A;  3VI5 A;  3F4R A;  5HFI A;  2XBQ A;  1GUL A;  4YH2 A;  2C0G A;  5IOW A;  2A4V A;  5KOW A;  3GA4 A;  3F3R A;  3SBC A;  4G10 A;  1GLQ A;  2EFH A;  2R2J A;  2B1L A;  2B7J A;  3VWW A;  4G2E A;  1F6M C;  1W89 A;  5G5E A;  1BF5 A;  1JZW A;  3GH6 A;  2PVO C;  4ECI A;  2F9S A;  1SYX A;  2H30 A;  4PGT A;  1SK1 A;  4OFN A;  1T00 A;  2X8H A;  1YEX A;  1T7P B;  2H1G A;  5AGY A;  2CZ3 A;  3QAG A;  1EV4 A;  3HVX A;  5J4Y A;  3K8N A;  1BG1 A;  4V1A g;  2X8C A;  3LXZ A;  3M3M A;  3J7Y b;  1XW6 A;  3HDC A;  4MJC A;  4X0X A;  4DSR A;  4RUV A;  2IFQ B;  14GS A;  2YZU A;  3A2W A;  2GST A;  1DE1 A;  5J3R A;  2KLX A;  5CYY A;  2HFD A;  4K7O A;  4AF2 A;  4XRA A;  2FUG 2;  2YWI A;  2WZ9 A;  1Z5Y E;  1QUW A;  4OFM A;  5F8B A;  2YCD A;  4CY6 A;  3DGQ A;  17GS A;  1F3B A;  4MPG A;  4N0V A;  3EWL A;  2GZP A;  4QQ7 A;  2MMA A;  2R37 A;  4ML1 A;  4G0K A;  4IVF A;  3LEF A;  1C72 A;  4W66 A;  2QC7 A;  3EVI A;  2F8F A;  2V41 A;  1FVK A;  1JZR A;  4O7H A;  1XBS A;  2B6M A;  1OAZ A;  5AN1 A;  3QFB C;  2GTU A;  1EP7 A;  1K0A A;  3G9B A;  3GSS A;  1GSF A;  1PL2 A;  5IMC A;  3L0H A;  2LKU A;  2X4A A;  1ON4 A;  4KDX A;  2GT5 A;  5ECP B;  1XWK A;  4GF0 A;  3A2X A;  2NBS A;  2HSY A;  5ECL B;  1K3Y A;  2IMI A;  2IME A;  3C71 A;  4HS1 A;  1TRV A;  2A4H A;  3V1W A;  1V57 A;  2QA1 A;  4HZ2 A;  3D4M A;  1V98 A;  4D73 A;  4HI7 A;  4XS4 B;  8GSS A;  1AUC A;  2HRN A;  1LBK A;  3UAP A;  1A8L A;  3QD9 A;  1Z6N A;  4IQ1 A;  4I6X A;  4IJ3 A;  4TN8 A;  4KF9 A;  1B4Q A;  2HYX A;  4RQR A;  1H75 A;  4MF6 A;  2YV7 A;  5ECS A;  3HZ8 A;  5G31 A;  4LL4 B;  2L5O A;  2GZZ A;  4XS4 A;  2RUF A;  2A2R A;  3KMO A;  4BVX A;  3UBK A;  1FB0 A;  2CA8 A;  4ML6 A;  2QA2 A;  3HVV A;  3CSI A;  1OVN A;  5ECI B;  2V2G A;  4KDY A;  2VD1 A;  2VCV A;  4TXO B;  2LS5 A;  5LD0 A;  4JBB A;  3O76 A;  4WF4 A;  3GYK A;  3WT2 A;  1TRW A;  1ML6 A;  1PN9 A;  2WDU A;  4JR6 A;  1YZX A;  3VI7 A;  3UL3 A;  1FOV A;  1MD3 A;  1FAA A;  2XPE A;  2H72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...