4EE0A

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
194
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoietic prostaglandin D synthase
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 71
structure length 194
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ee0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ee0A01
2WDUA 2OE3A 2GLRA 4YAVA 4MH3A 1SU9A 5DJMA 3DVWA 5HFIA 1XVQA 3F4TA 1S3DA 1VF1A 2FWHA 1TK5B 1W4VA 4XIHA 2VLUA 1V9WA 3UOMA 1HNBA 1CQHA 2B5EA 3GH9A 2H0IA 2HFDA 3CTGA 1HD2A 4K7NA 1ERWA 3RBTA 3F8UA 2VLVA 4IW9A 1OAZA 2HXKA 1WP0A 3EC3A 1G7OA 2O8VB 1K0NA 1E2YA 1PX7A 4MF5A 3GFKA 4WR4A 2CV4A 3IK9A 2FWFA 3KP8A 1ZGNA 1K3OA 2YV9A 3U6VA 2WRTA 3M9JA 4XCSA 16GSA 5F07A 4WF4A 4ZBBA 1SYXA 3IXRA 3BJ5A 3GSSA 5ECKB 2V1MA 3D21A 1TOFA 5L71A 3E9JB 1TK8B 4DSRA 2F9SA 1T7PB 2AJQB 5KN3A 3BOAA 3GTUB 4YH2A 2MZCA 3QFAC 4MA9A 1YJ6A 2ZCTA 3EE2A 4O7HA 1X5DA 4Q5NA 2HI7A 3EURA 5B8BA 5IMFA 2NTOA 3TGZA 1MEKA 4KCEA 4I5QA 2LKUA 2X99A 2PERA 1LBKA 3FYGA 3FHKA 1FVKA 4NXIA 2H76A 4TR3A 5ECLB 1EGRA 5H5QA 4AJ6A 2DJ2A 3EYTA 1PD21 4BVXB 2F51A 1YDKA 3FR6A 1PL1A 3DXBA 3A3TA 2CZ3A 3VWWA 5EPFA 3L9UA 3HJOA 1A24A 3TJFA 2E2GA 2OBIA 2CVKA 4TN8A 1XPVA 2VM2A 1K0BA 2YJ7A 1X5EA 1Z6NA 2YV7A 4I8BA 6GSUA 2JU5A 2I4AA 4IQAA 10GSA 3E0UA 4HEA2 3IV4A 3F4SA 3FRCA 2HZEA 1GSEA 2X8HA 1OE8A 3IA1A 3GX0A 4Q5QA 1JHBA 3WT2A 5JCGA 3SBCA 3CRUA 2AHEA 3HVVA 4POMA 2LNSA 4OFTA 3KGKA 1J9BA 4YAPA 5IMVA 1GTAA 1PRXA 5GAPD 1GULA 2KP1A 1TTZA 5B7CA 3BCIA 1U88A 1URMA 1DBYA 4MH2A 3DMLA 1A23A 1VF4A 3HJMA 1YZXA 2VLTA 1OYJA 4L0WA 1KNGA 4K8MA 4TOPA 3ZREA 1THOA 4LL4B 1UC7A 4G0IA 3CSJA 3TUEA 4JR4A 1M9BA 3TJBA 4PUAA 3TJKA 3GN3A 3M3MA 5B8AA 1WIKA 2ON5A 1ACVA 3FZAA 5FHIA 2QKEA 2FCHA 2LJAA 2WULA 4N10A 4WETA 4FQUA 4J2FA 5IM9A 2GSRA 3MAKA 5HR0A 5IMZA 1XBSA 4AJ8A 1MD3A 2HRAA 4MJBA 2C3NA 2FUG2 4N11A 4O92A 3RAZA 3C1SA 4IVFA 2MBSA 2HYXA 3WGXA 3F6DA 1OE7A 1TDIA 3ZTLA 2NVLA 2K6VA 4I97A 2LJRA 4BVYB 4IBPA 5JCWA 5INYA 2JZSA 3W6GA 2DJ1A 2BJXA 2CVBA 2EIRA 2FA4A 1BAYA 4L8EA 2L5LA 4N0VA 4WEYA 3PH9A 2K18A 2GSTA 3APSA 2VD0A 1N8JA 1QK8A 1X9WB 5DCGA 3H8QA 2WS2A 1GSFA 2H6ZA 2GQLA 3TKSC 3ZYWA 3LG6A 3LORA 1NHYA 2B7KA 1CQGA 4G9HA 5ELAA 1M2DA 4ZXGA 5C04A 3A2VA 2XBQA 2DIYA 1K3YA 2N5FA 5DALB 2MMAA 4IHUA 1EOHA 1Y6EA 1QUWA 3KIJA 5CO3A 2ZUPA 2P5QA 3VFIA 4PTSA 1XCCA 3QR6A 4OO5A 3D4MA 3GMFA 2IIYA 4ML6A 4G0LA 4MP4A 4KA0A 1O73A 4TXOB 4JBBA 1TRUA 2JACA 3P90A 3ZVJD 4GF0A 2R5GA 5B6NA 4DVCA 17GSA 2HSMB 3S9FA 3VWVA 3I9V2 2L4CA 1MD4A 4GXZA 2R2JA 2VAFA 3HZ8A 1V58A 4HS1A 4ZL7A 2J23A 4HI7A 3C71A 3LFLA 4L5OA 4PQ1A 2IL3A 1TRSA 2FNOA 2R4VA 1JZOA 1O85A 3F3RA 1VGLA 3U5RE 5LNKe 3VURA 3HXSA 2FY6A 1F6MC 1ABAA 2WZ9A 2HNLA 2B5XA 1ERUA 4EO3A 4WBJA 1Z3EA 2GZPA 4LA1A 4O5RA 2XPEA 5IO0A 3VPQA 4V2MA 4GRFA 1GLPA 3A5WA 3ZFLA 3G9BA 2JL4A 3LJRA 1THXA 3VLNA 4MF7A 3UVTA 2C1YA 1EGOA 4CHSA 4YQUA 3NOFA 2O89A 4OMVA 3DIEA 1J0FA 1BJXA 2E0QA 3IRAA 4I2UA 4GSTA 4KSMA 5LCZA 4MJAA 3GSTA 4ACSA 3GKMA 5F05A 3M8NA 4IKHA 1YKAA 3J7Yb 5IMDA 4ID0A 4AF2A 3DYRA 3D5JA 2KOKA 2GT6A 4NMUA 2UZ8A 4POBA 4F82A 4MZBA 5G1KA 2H8LA 3BBYA 4NV2A 5ID2B 4Q5FA 3QMXA 2PPTA 5KN0A 2C80A 3CSIA 2LEGA 3DKSA 2AB6A 3Q74A 3TOUA 3C73A 3O3TA 2YPMA 2OJLA 4MZCA 4ZL9A 1AC1A 1V57A 4XS6A 2OE1A 2P31A 3OR5A 4PXOA 1A0FA 1EEJA 3MSZA 2IMFA 3FY7A 2HZEB 4X43A 4PUFC 4ECCA 4WXTA 1M0UA 3ERWA 4BVYA 6GSVA 3QAVA 4TRXA 2HRNA 2YWNA 2G0FA 3ZITA 2H73A 4X0XA 1XWAA 3TJJA 2XHFA 3QPMA 5DAKA 2MBTA 2GTUA 2RLIA 4NWYA 3D22A 5KEJA 2AAWA 2BMXA 1OC8A 1WPIA 2RUFA 5IQYA 3HY2A 2DC5A 1WJKA 6GSWA 3HVSA 3TJGA 2J9HA 2D2ZA 2PU9C 2CQ9A 3I6AA 4ZB9A 2FWEA 3TOTA 4XHMA 2VM1A 5DALA 2H70A 1M9AA 3R2QA 1GLQA 4F2IA 4RQXA 2JADA 3KZQA 2H74A 1K0AA 1GSSA 3UIWA 5AIXA 4JZQA 4MPFA 2H0GA 1RK4A 5D9VA 4F03A 1MTCA 3FZ4A 4MCUA 4JEDA 3M1GA 1NM3A 4FH8A 1F37A 4K1FA 4TXOA 1EWXA 5GSSA 1TXXA 2C0EA 4V2LA 2WJUA 3VI7A 2FD3A 2M72A 1C72A 3TKPA 2YP6A 2LRTA 2L57A 1H75A 1SJZA 3ME7A 2HSMA 2K8SA 2KUCA 3P2AA 3SWLA 3EMPA 3QFBC 4K6XA 2YZHA 3UARA 1GNEA 1GTUA 5J9BA 3L78A 3MNGA 1M7TA 3TCOA 1O8XA 1R5PA 4IJ3A 1JFUA 2PGTA 1MDKA 1MDJA 4HQZA 3RHCA 1A0RP 2NPBA 2GSSA 4WKWA 4GQCA 4EDYA 4HUAA 5D9WA 5F0GA 2H19A 3W8JA 3EU4A 2ZNMA 3IOSA 2ES7A 2GQKA 14GSA 3GV1A 1SENA 4PQIA 2V6OA 4PURA 4XRDA 2B6MA 2JSYA 2C0DA 5G1LA 2R6KA 2IMEA 3H4KA 2PUKC 1GRXA 2LQOA 22GSA 3C8EA 3KMNA 4K9ZA 2PVQA 3DVXA 4FYUA 4ML1A 2GDRA 1RQMA 1WOUA 3H79A 3MWHA 1ILOA 1WMJA 5H5RA 2O7KA 3KP9A 2M46A 2H6YA 2QC7A 4GWRA 2RM5A 3L9SA 2BTOT 20GSA 3WD6A 2B5YA 5FT3A 5ID2A 4D73B 1K0OA 3UEMA 3L9VA 3FZ5A 2YWMA 3F6FA 1VF3A 1PL2A 1TKDB 2O85A 2NBSA 1GUMA 4Q5RA 1ZOFA 1IYHA 1UA5A 2K8VA 1J08A 3GYKA 1GTIA 3P7XA 1GNWA 3O76A 4RI7A 2NDOA 1O81A 3NZNA 4EVMA 2QSIA 1NW2A 3KH7A 3EMXA 4J56E 2O87A 4G10A 2LNTA 2IPAA 5HQPA 1A2MA 1GSYA 2MYGA 4CDOA 2TIRA 1TJDA 4H86A 2B1LA 5BMUA 2CA8A 2IMDA 2YN1A 4I2TA 2MMZA 3GHAA 2VL9A 5GSTA 3IHQA 1PA3A 4KF9A 3IR4A 1KEBA 2VCVA 5CRGA 1X9MB 1ZMAA 2DJJA 4Z7XA 2L6DA 1Z7PA 4IN0A 1TK0B 2N5BA 5F8BA 4KE3A 1FB0A 5KN2A 1DUGA 3CTFA 1DE1A 3QAGA 1N2AA 4L0UA 4EL1A 1F3BA 2DJ3A 3VK9A 2LTKA 3IC8A 4EKZA 4N30A 5HR1A 2JZRA 5E59A 3M0FA 4IJIA 1WWJA 2JSZA 2L4QA 5HFGA 1A2LA 2I81A 3RPNA 1X0RA 2JZTA 2C8UA 4MMMA 4K0GA 2GVPA 3VPTA 2EIQA 1Z7RA 5D9TA 1SK2A 4LMVA 3HZ4A 3QCPA 4XS1A 3ZIVA 3F0IA 2P5RA 2CX3A 4HJ2A 2VL2A 4TR0A 2XBIA 2I1UA 1XWCA 3RPPA 3FZ9A 4F9ZA 5DAKB 3HYPA 3APOA 4PX1A 4X1UA 1NSWA 4HZ2A 3GUSA 5JCUA 4IGJA 11GSA 3QOUA 4G0KA 4POLA 3ERFA 3A2XA 5DQYA 3FW2A 3WGDA 1XFLA 4MJEA 3IAS2 3APQA 2M80A 1SKWB 3ED3A 1GTBA 2FGXA 2E7PA 4AGSA 4NV5A 4DSSA 4NHWA 2MMOA 1XVWA 1LJRA 4KW6A 3ZMKA 4O32A 3N5OA 2CAQA 2GT5A 4BWQA 4IS0A 1XWBA 3EVIA 4TW5A 4OFMA 2X64A 3Q19A 3GNJA 2WGRA 1YY7A 3ZLPA 3VI5A 4GCIA 4IP1A 2HSHA 3CSHA 2F8AA 1EZKA 1GSDA 3TDGA 1G7EA 1ZCPA 3CYNA 5COHA 9GSSA 3VWUA 4D73A 2YNXA 2PMTA 3GA4A 5ECNB 3TRXA 2FWGA 5DBQA 2F3MA 3LYPA 2E2MA 4TKYA 3VWXA 5CRHA 3LQ7A 3F63A 2AYTA 1OC9A 2HT9A 3HDCA 1B4QA 3IDVA 1O6JA 3ZIJA 4JU5A 4GSSA 5CREA 1XXUA 5CRDA 2GS3A 3C1RA 2TRCP 4HOJA 1R26A 3I43A 4HJMA 3F4RA 1VRSD 1T8EB 2AUVA 3TKQA 1FG4A 1HQOA 4ZB6A 2H6XA 3H93A 2H1DA 5ENUA 2YANA 2VIMA 3QAWA 4ZIJA 3FKFA 4HQSA 3LSZA 1YEPA 1ZL9A 3HHVA 1ERVA 4XTSA 3ME8A 2H75A 2OADA 5CNWA 3UBLA 5LD0A 4KDXA 1OC3A 1SJIA 1Y25A 3KCMA 4GSNA 1ON4A 3LEFA 5AISA 5IPHA 1SD9A 4KCAA 1ZZYA 1YF0A 5JWOB 3LWAA 4WBRD 3E3EA 4G2EA 1Z9HA 5AIVA 1M2AA 2EC4A 3DRNA 2L5OA 2YJHA 2VUPA 5J3RA 2HSNB 2VCWA 1U87A 2HZFA 2XC2A 1QGVA 1BEDA 5IPGA 2OE0A 1G6WA 4EUYA 4HZ4A 4I6XA 5C00A 2CZ2A 4OO4A 5J41A 5HR3A 1X5CA 1M2BA 4ISDA 8GSSA 3RDWA 3R3EA 4ILFA 3WGEA 1OKDA 5D8IA 1KBNA 2L59A 3I69A 1R7HA 5ECQB 2CAIA 2A4VA 4KH7A 5GAND 2V6KA 1YKCA 1TW9A 3KEBA 4JRRA 2VOCA 1QXHA 4PGTA 5G5FA 4KDUA 2H01A 4OD7A 4WR5A 3GRXA 4RQRA 3Q18A 3ZMLA 2OBKA 3PR8A 1ML6A 4FIWA 2H0HA 2AV4A 1SJ6A 1NHOA 2HSYA 3GL5A 1V40A 4TXVA 4IP6A 1PKZA 2WFCA 2H72A 3DEXA 2MMNA 3IPZA 1I9DA 2PBJA 2CVDA 3IBHA 4V1Ap 2OA7A 3IE3A 4MF6A 5G2ZA 1PGTA 3D0ZA 5AGYA 1XW6A 1GUKA 3WT1A 3M9KA 4QL7A 4E8HA 1SYRA 4ULXA 3D6IA 4WF5A 3TKRA 4KNDA 3K8NA 1GSQA 1GSUA 2CX4A 4K7OA 4POKA 4J57E 4JE1A 1ZYEA 4IELA 3GX8A 4NPBA 1DSBA 3CRTA 4CW9A 2I9HA 5H5SA 2LUSA 3HA9A 3TKSA 1ZYQB 5G5EA 3ISOA 2R37A 1B8XA 1FO5A 1QMVA 3TB2A 2IFQB 3KMOA 2LRCA 1AQXA 3ZVJA 1E6BA 1PMTA 2KLXA 1SL1B 12GSA 7GSSA 2HE3A 4F0CA 1F9MA 2HLSA 4NAXA 2RIIA 2C0GA 5ABRA 2VO4A 2V41A 3KTBA 5D73A 2GQMA 4FO5A 1TI1A 4JR6A 2WCIA 5KN1A 5D9XA 4DSSB 5JWQB 1SL2B 4RI6A 3N9JA 1JZRA 4OFNA 5E4WA 3ZZXA 4PNGA 5DJLA 4GLTA 2IJYA 1BX9A 3L0HA 4K0NA 3A2WA 5B6MA 4KAEA 2YWIA 5J9CA 3WYWA 3NIVA 2I3YA 2GZYA 2HRKA 1S3CA 2PWJA 4FYCA 4EXJA 1Z5YE 2H1GA 2ON7A 2VCXA 2FHEA 5DCHA 3J7Yk 2RM6A 2DJ0A 5CYYA 2V32A 2H1BA 2LV3A 1WE0A 1QFNA 1K0DA 3G7JA 3UL3A 5ECRB 4GQFA 2IWTA 2XPDA 5IOWA 1FVJA 2FLSA 4F0BA 3H1NA 3FK8A 4IQ1A 2PVOC 5GZZB 2VCQA 1OC9B 2DJKA 2DMMA 1HNCA 3KJYA 5IMCA 2KP2A 1SKSB 2DIZA 3PPUA 4PNFA 2PN8A 4ZB8A 2C0FA 4BPYA 5ECOB 3LGCA 19GSA 4XS4B 1BG5A 1QQ2A 4N0ZA 1AQVA 5HR2A 1FOVA 5DDLA 1A2JA 4LLRA 4RUVA 4DEJA 4KX4A 3UJ1A 1A8LA 4FYBA 3KTLA 2C4JA 5A5KA 2F8FA 4GTUA 4ZL8A 1R4WA 1U3AA 2REMA 4TVEA 1EV4A 3P8WA 1GUHA 1B9YC 4AJ7A 1FB6A 5EL8A 2L6CA 1SL0B 3HD5A 3IAM2 3GKKA 6GSSA 3ZFBA 3BCKA 3O6TA 4KDYA 1HNAA 1GWCA 5A4UA 6GSYA 1AXDA 2HQTA 3PGTA 3AY8A 3BD2A 5D93A 2IMKA 4NHZA 4ZBAA 2N5AA 3G7YA 4MLYA 3D4TA 3RHBA 4BWSA 2LSTA 1YEXA 2P0GA 4EC0A 3F9UA 3HVXA 1HYUA 4KSOA 1G6YA 1W89A 3KD0A 1A8YA 1U3IA 2VL3A 3W8SA 1UN2A 3TRPA 3C7MA 2B1KA 4LL1B 3UAPA 3DD3A 4OWYA 4HU7A 2B7JA 3LXZA 5ECSA 1S3AA 1EEMA 2GSQA 2CT6A 2G2QA 5DQSA 3FR9A 1WRYA 4ECBA 3GL3A 4KGIA 4V2NA 2DLXA 2DMLA 5IMAA 3EU3A 4XRAA 3KXOA 4ZILA 3EINA 1JLVA 1JLWA 1XIYA 1VF2A 4L5LA 2IFQA 3V1WA 4BA7A 2Z9SA 4HDEA 1JZDA 3ZRDA 2X8GA 2KHPA 1EV9A 4MDCA 2C3TA 1TRVA 4MZWA 4YQMA 2YOIA 4KB3A 1F2EA 3TRQA 1R5AA 4TR1B 3JCML 1H4OA 3CXGA 1OVNA 4OCFA 2V2GA 1O8WA 1O7UA 3GIXA 1KTEA 4BL7B 3QD9A 3UBKA 3KM6A 5ECIB 3GTUA 4OCEA 3US3A 3LXTA 1MDIA 1U6TA 1SK0A 1LU4A 5CP1A 3IC4A 2EIOA 3LYKA 4ZBDA 1Z6MA 1FW1A 1T00A 4USSA 1IYIA 3UMAA 4LMWA 4P3YB 5EVOA 1Q4JA 4KUNA 3HCZA 2LRNA 3GH6A 2QGVA 2YZUA 1X9SB 3GKXA 1JZWA 3PINA 4E8EA 4ECIA 3HJPA 3MDKA 4MPGA 1FAAA 2X8CA 4MJCA 1TI3A 1M99A 1B48A 1USBA 2FA8A 2GZZA 4ECJA 4BVXA 4G19A 1B9XC 2WB9A 2RUEA 3UVHA 2YCDA 2A2SA 2LQQA 1XZOA 5CAXA 3DGQA 1F3AA 5IOXA 4XS4A 4QQ7A 5J5NA 1TU7A 1SK1A 1EOGA 1DE2A 1ERTA 4YQVA 5ECMB 1T3BA 4V1Ag 1BYEA 13GSA 5EY6A 1G0TA 5AN1A 1V2AA 3GKNA 5ECPB 1PSQA 5IIZA 1GP1A 1EP8A 2LS5A 1TU8A 2ALBA 1AIUA 4DSQA 1K0MA 3FEUA 1K3LA 2HRKB 1XW5A 2A2RA 3DWVA 3ERGA 1T4YA 5G31A 1K0CA 4EE0A 5A4WA 3L4NA 2R3XA 3Q6OA 1XWGA 1AAZA 1UVZA 4MK3A 1SD8A 4EF0A 1XOBA 5G30A 2C3QA 1XW9A 5ECHB 3FR3A 1PKWA 4PQHA 2LJKA 3CMIA 2VCZA 1SKRB 2IN3A 2H30A 1GH2A 3IK7A 4HU9A 3QDNA 2OKAA 5CRWA 2B3SA 5A4VA 1T4ZA 2DSAA 3HKRA 1TP9A 5FWGA 1EP7A 2YWOA 1AUCA 5J4UA 3G7IA 1B4PA 6GSTA 2VCTA 1BQ7A 3GURA 5ELGA 2VD1A 1FHEA 5HFKA 3CBUA 2GGTA 5D96A 1RW1A 1PX6A 1ST9A 1PQNA 3TKSE 3F3QA 5DVBA 5JWRB 1YF1A 2IMIA 1OKTA 2OACA 1AQWA 3KH9A 2K9FA 1AW9A 4K2DA 6GSXA 1I5GA 1XWKA 2H71A 1PN9A 2VL2C 4TR4A 1TRWA 1YQ1A 4TR1A 1Q98A 1V98A 2TRXA 5F06A 4EDZA 4K7IA 2HRFA 2H66A 2H1AA 2DBCA 18GSA 4BL7A 1T1VA 3ZL5A 1XOAA 4MABA 1GL8A 5IO2A 4QL9A 3EWLA
chains in the Genus database with same CATH superfamily
2WDUA 2OE3A 2GLRA 4YAVA 4MH3A 1SU9A 5DJMA 3DVWA 5HFIA 1XVQA 3F4TA 1S3DA 1VF1A 4PHZC 2FWHA 1TK5B 1W4VA 4XIHA 5J40A 2VLUA 1V9WA 3UOMA 1HNBA 1CQHA 2B5EA 2WVZA 3GH9A 2H0IA 2HFDA 4N3ZA 3CTGA 1HD2A 4K7NA 1ERWA 3RBTA 3F8UA 2VLVA 4IW9A 1OAZA 2HXKA 1WP0A 3EC3A 1G7OA 2O8VB 1K0NA 1E2YA 1PX7A 4MF5A 3GFKA 4WR4A 2CV4A 3IK9A 2FWFA 3KP8A 1ZGNA 1K3OA 2YV9A 3U6VA 2WRTA 3M9JA 4XCSA 16GSA 5F07A 4WF4A 4ZBBA 1SYXA 3IXRA 3BJ5A 3GSSA 5ECKB 2V1MA 3D21A 1TOFA 5L71A 3E9JB 1TK8B 4DSRA 2F9SA 5J4VA 1T7PB 2AJQB 5KN3A 3BOAA 3GTUB 4YH2A 2MZCA 3QFAC 4MA9A 1YJ6A 2ZCTA 3EE2A 4O7HA 1X5DA 4Q5NA 2HI7A 3EURA 5B8BA 5IMFA 2NTOA 3TGZA 1MEKA 4KCEA 4I5QA 2LKUA 2X99A 2PERA 1LBKA 3FYGA 3FHKA 1FVKA 4NXIA 2H76A 4TR3A 4AKIA 5ECLB 1EGRA 5H5QA 4AJ6A 2DJ2A 3EYTA 1PD21 4BVXB 2F51A 1YDKA 3FR6A 1PL1A 3DXBA 3A3TA 2CZ3A 3VWWA 5EPFA 3L9UA 3HJOA 1A24A 3TJFA 2E2GA 2OBIA 2CVKA 4TN8A 1XPVA 4Z2UA 2VM2A 1PN0A 1K0BA 2YJ7A 1X5EA 2R0PA 1Z6NA 2YV7A 4I8BA 6GSUA 2JU5A 2I4AA 4IQAA 10GSA 3E0UA 4HEA2 3IV4A 3F4SA 3FRCA 2HZEA 1GSEA 2X8HA 1OE8A 4EIPA 3IA1A 3GX0A 4Q5QA 1JHBA 3WT2A 5JCGA 3SBCA 3MYDA 3CRUA 2AHEA 3HVVA 4POMA 2LNSA 4Z2TA 4OFTA 3KGKA 1J9BA 4YAPA 5IMVA 1GTAA 1PRXA 5GAPD 1GULA 2KP1A 1TTZA 5B7CA 3BCIA 1U88A 1URMA 1DBYA 4MH2A 3DMLA 1A23A 1VF4A 3HJMA 1YZXA 2VLTA 1OYJA 4L0WA 1KNGA 4K8MA 4TOPA 3ZREA 1THOA 4LL4B 1UC7A 4G0IA 3CSJA 3TUEA 4JR4A 1M9BA 3TJBA 4PUAA 3TJKA 3GN3A 3M3MA 5B8AA 1WIKA 2ON5A 1ACVA 3FZAA 5FHIA 2QKEA 2FCHA 2LJAA 2WULA 4N10A 2O5VA 4WETA 4FQUA 4J2FA 5IM9A 2GSRA 3MAKA 5HR0A 5IMZA 1XBSA 4AJ8A 1MD3A 2HRAA 4MJBA 2C3NA 2FUG2 4N11A 4O92A 3RAZA 3C1SA 4IVFA 2MBSA 2HYXA 3WGXA 3F6DA 1OE7A 1TDIA 3ZTLA 2NVLA 2K6VA 4I97A 2LJRA 4BVYB 4IBPA 5JCWA 5INYA 2JZSA 3W6GA 2DJ1A 2BJXA 2CVBA 2EIRA 2FA4A 1BAYA 4L8EA 2L5LA 4N0VA 4WEYA 3PH9A 2K18A 2GSTA 3APSA 3RGBC 2VD0A 1N8JA 1QK8A 1X9WB 5DCGA 3H8QA 2WS2A 1GSFA 2H6ZA 2GQLA 3TKSC 3ZYWA 3LG6A 3LORA 1NHYA 2B7KA 1CQGA 4G9HA 5ELAA 1M2DA 4ZXGA 5C04A 3A2VA 2XBQA 2DIYA 1K3YA 2N5FA 5DALB 2MMAA 4IHUA 1EOHA 2A2PA 1Y6EA 1QUWA 3KIJA 5CO3A 2ZUPA 2P5QA 2WW3A 3VFIA 4PTSA 1XCCA 3QR6A 4O5QA 4OO5A 3D4MA 3GMFA 2IIYA 4ML6A 4G0LA 4MP4A 4KA0A 4ZB7A 1O73A 4TXOB 4JBBA 1TRUA 2JACA 3P90A 1I1IP 3ZVJD 4GF0A 2R5GA 5B6NA 4DVCA 17GSA 2HSMB 3S9FA 3VWVA 3I9V2 2L4CA 2OT3A 1MD4A 4GXZA 2R2JA 2VAFA 3HZ8A 1V58A 4HS1A 4ZL7A 2J23A 4HI7A 3C71A 3LFLA 4L5OA 4PQ1A 2IL3A 1TRSA 2FNOA 2R4VA 1JZOA 1O85A 3F3RA 1VGLA 3U5RE 5LNKe 3EPTA 3VURA 3HXSA 2FY6A 1F6MC 1ABAA 2WZ9A 2HNLA 1S4BP 2B5XA 4K5SA 1ERUA 4EO3A 4WBJA 1Z3EA 2GZPA 4LA1A 4O5RA 2XPEA 5IO0A 3LW9A 3VPQA 4V2MA 4GRFA 1GLPA 3A5WA 3ZFLA 3G9BA 2JL4A 3LJRA 1THXA 4G01A 3VLNA 4MF7A 3UVTA 2C1YA 1EGOA 4CHSA 4YQUA 3NOFA 1Y1UA 2O89A 4OMVA 3DIEA 1J0FA 1BJXA 4YKFA 2E0QA 3IRAA 4I2UA 4GSTA 4KSMA 5LCZA 4W66A 4MJAA 3GSTA 4ACSA 3GKMA 5F05A 3M8NA 4IKHA 1YKAA 3J7Yb 5IMDA 4ID0A 4AF2A 3DYRA 3D5JA 2KOKA 2GT6A 4NMUA 2UZ8A 4POBA 4F82A 4MZBA 5G1KA 2H8LA 3BBYA 4NV2A 5ID2B 4Q5FA 3QMXA 2PPTA 4CY6A 5KN0A 2C80A 3CSIA 2LEGA 3DKSA 2AB6A 3Q74A 3TOUA 3C73A 3O3TA 2YPMA 2OJLA 4MZCA 4ZL9A 1N25A 1AC1A 1V57A 4XS6A 2OE1A 2P31A 3OR5A 4PXOA 2WVXB 1A0FA 4AKHA 1EEJA 3MSZA 2IMFA 3FY7A 2HZEB 4X43A 4PUFC 4ECCA 4WXTA 1M0UA 3ERWA 4BVYA 6GSVA 3QAVA 4TRXA 2HRNA 2YWNA 2G0FA 3ZITA 2H73A 4X0XA 5A5HB 1XWAA 5BMUB 3TJJA 2XHFA 3QPMA 5DAKA 2MBTA 2EFEA 2GTUA 2RLIA 4NWYA 3D22A 5KEJA 2AAWA 2BMXA 1OC8A 1WPIA 2RUFA 5IQYA 3HY2A 2DC5A 1WJKA 6GSWA 1FOHA 3HVSA 3TJGA 2J9HA 2D2ZA 2PU9C 2CQ9A 3I6AA 4ZB9A 2FWEA 3TOTA 4XHMA 2VM1A 5DALA 2H70A 1M9AA 3R2QA 1GLQA 4F2IA 4RQXA 2JADA 3KZQA 2H74A 1K0AA 1GSSA 3UIWA 5AIXA 4JZQA 3TU3B 4MPFA 2H0GA 1RK4A 5D9VA 4F03A 1MTCA 3FZ4A 4MCUA 4JEDA 3M1GA 1NM3A 4FH8A 1F37A 1M3JA 4K1FA 4TXOA 1EWXA 5GSSA 1TXXA 2C0EA 4V2LA 2WJUA 3VI7A 2FD3A 2M72A 1C72A 3TKPA 2YP6A 2LRTA 2L57A 1H75A 1SJZA 3ME7A 2HSMA 2K8SA 2KUCA 4Z2RA 3P2AA 3SWLA 3EMPA 3QFBC 4K6XA 2YZHA 3UARA 1GNEA 1GTUA 5J9BA 3L78A 3MNGA 1M7TA 3TCOA 1O8XA 1R5PA 4IJ3A 1JFUA 2PGTA 1MDKA 1MDJA 4HQZA 3RHCA 1A0RP 2NPBA 2GSSA 4WKWA 4E68A 4GQCA 4EDYA 4HUAA 5D9WA 5F0GA 2H19A 3W8JA 3EU4A 2ZNMA 3IOSA 2ES7A 2GQKA 14GSA 3GV1A 1SENA 4PQIA 4YKGA 2V6OA 4PURA 1XG8A 4XRDA 2B6MA 2JSYA 2C0DA 4O5UA 5G1LA 2R6KA 2IMEA 3H4KA 2PUKC 1GRXA 2LQOA 22GSA 3C8EA 3KMNA 4K9ZA 2PVQA 3DVXA 4FYUA 4ML1A 2GDRA 1RQMA 1WOUA 3H79A 3MWHA 1ILOA 1WMJA 5H5RA 2O7KA 3KP9A 2M46A 2H6YA 2QC7A 4GWRA 2RM5A 3L9SA 2BTOT 2QA2A 20GSA 4AKXB 3WD6A 2B5YA 5FT3A 5ID2A 4D73B 1K0OA 3UEMA 3L9VA 3FZ5A 2YWMA 3F6FA 1VF3A 1PL2A 1TKDB 2O85A 2NBSA 2HSNA 1GUMA 4Q5RA 1ZOFA 1ZYPA 3MIXA 1IYHA 1UA5A 2K8VA 1J08A 3GYKA 1GTIA 3P7XA 1GNWA 3O76A 2WVXA 4RI7A 2NDOA 5BRTA 1O81A 3NZNA 4EVMA 2QSIA 1NW2A 3KH7A 3EMXA 4J56E 2O87A 4G10A 2LNTA 2IPAA 5HQPA 1A2MA 1GSYA 2MYGA 4CDOA 2TIRA 5A5HA 1TJDA 4H86A 2B1LA 5BMUA 2CA8A 2IMDA 2YN1A 4I2TA 4AKGA 2MMZA 3GHAA 2WW2A 2VL9A 5GSTA 3IHQA 1PA3A 4KF9A 3IR4A 1KEBA 2VCVA 5CRGA 1X9MB 1ZMAA 2DJJA 4Z7XA 2L6DA 1Z7PA 4IN0A 1TK0B 2N5BA 5F8BA 4KE3A 1ZYNA 1FB0A 5KN2A 1DUGA 3CTFA 1DE1A 3QAGA 1N2AA 4L0UA 4EL1A 1F3BA 2DJ3A 3VK9A 2LTKA 3IC8A 4EKZA 4N30A 5HR1A 2JZRA 5E59A 3M0FA 4IJIA 1WWJA 2JSZA 2L4QA 4AI6A 4K5RA 5HFGA 1A2LA 2I81A 3RPNA 1X0RA 2JZTA 2C8UA 4MMMA 4K0GA 2GVPA 3VPTA 3HVNA 2EIQA 1Z7RA 5D9TA 1SK2A 4LMVA 3HZ4A 3QCPA 4XS1A 3ZIVA 4PI0C 3F0IA 2P5RA 2CX3A 4HJ2A 2VL2A 4TR0A 2XBIA 2I1UA 1XWCA 3RFRC 3RPPA 3FZ9A 4F9ZA 5DAKB 3HYPA 3APOA 2R0GA 4PX1A 4X1UA 1NSWA 4HZ2A 3GUSA 5JCUA 1TXUA 4IGJA 4A5PA 11GSA 3QOUA 4G0KA 4POLA 3ERFA 3A2XA 5DQYA 3FW2A 3WGDA 1XFLA 3A5IA 4MJEA 3CQFA 1YEWC 3IAS2 3APQA 2M80A 1SKWB 3ED3A 1GTBA 2FGXA 2O3EA 2E7PA 4AGSA 4NV5A 4DSSA 4NHWA 2MMOA 1XVWA 1LJRA 4KW6A 3ZMKA 2WVYA 4O32A 3N5OA 2CAQA 2GT5A 4BWQA 4IS0A 1XWBA 3EVIA 4TW5A 4OFMA 2X64A 3Q19A 3GNJA 2WGRA 1YY7A 3ZLPA 3VI5A 4GCIA 4IP1A 2HSHA 3CSHA 2F8AA 1EZKA 1GSDA 4EIQA 3TDGA 1G7EA 1ZCPA 3CYNA 5COHA 9GSSA 3VWUA 4D73A 1SVOA 2YNXA 2PMTA 3GA4A 5ECNB 3TRXA 2FWGA 5DBQA 2F3MA 3LYPA 2E2MA 4TKYA 3VWXA 5CRHA 5KOWA 3LQ7A 3F63A 2AYTA 1OC9A 2HT9A 3HDCA 1B4QA 3IDVA 1O6JA 3ZIJA 4JU5A 4GSSA 5CREA 1XXUA 5CRDA 2GS3A 3C1RA 2TRCP 4HOJA 1R26A 3I43A 4HJMA 3F4RA 1VRSD 1T8EB 2AUVA 3TKQA 1FG4A 1HQOA 4ZB6A 2H6XA 3H93A 2H1DA 5ENUA 4HSCX 2YANA 2VIMA 3QAWA 4ZIJA 3FKFA 4HQSA 3LSZA 4FXYP 1YEPA 1ZL9A 3HHVA 1ERVA 4XTSA 3ME8A 2H75A 2OADA 5CNWA 3UBLA 5LD0A 4KDXA 1OC3A 1SJIA 1Y25A 1M3IA 3KCMA 4GSNA 1ON4A 3LEFA 5AISA 5IPHA 1SD9A 4KCAA 1ZZYA 1YF0A 5JWOB 3LWAA 4WBRD 3E3EA 4G2EA 1Z9HA 5AIVA 1M2AA 2EC4A 3DRNA 2L5OA 2YJHA 2VUPA 5J3RA 2HSNB 2VCWA 1YVLA 1U87A 2HZFA 2XC2A 1QGVA 1BEDA 5IPGA 2OE0A 1G6WA 4EUYA 4HZ4A 4I6XA 5C00A 2CZ2A 4OO4A 5J41A 5HR3A 1X5CA 1M2BA 4ISDA 8GSSA 3RDWA 3R3EA 4ILFA 3WGEA 1OKDA 5D8IA 4BIKA 1KBNA 2L59A 3I69A 1R7HA 5ECQB 2CAIA 2A4VA 4KH7A 5GAND 2V6KA 1YKCA 1TW9A 3KEBA 4JRRA 2VOCA 1QXHA 4PGTA 5G5FA 4KDUA 2H01A 4OD7A 4WR5A 3GRXA 4RQRA 3Q18A 3ZMLA 2OBKA 3PR8A 1ML6A 4FIWA 2H0HA 2AV4A 1SJ6A 1NHOA 2HSYA 3GL5A 1V40A 4TXVA 4IP6A 1PKZA 2WFCA 2H72A 3DEXA 2EFDA 2MMNA 3IPZA 1I9DA 2PBJA 2CVDA 2VKZG 3IBHA 4V1Ap 2OA7A 3IE3A 4MF6A 5G2ZA 1PGTA 3D0ZA 5AGYA 1XW6A 1GUKA 3WT1A 3M9KA 4QL7A 4E8HA 1SYRA 4ULXA 5A1NB 3D6IA 4WF5A 3TKRA 4KNDA 3K8NA 1GSQA 1GSUA 2CX4A 4K7OA 4POKA 4J57E 4JE1A 1ZYEA 4IELA 3GX8A 4NPBA 1DSBA 3CRTA 4CW9A 2I9HA 5H5SA 2LUSA 3HA9A 3TKSA 1ZYQB 5G5EA 3ISOA 2R37A 4X4JA 1B8XA 2QA1A 1FO5A 1QMVA 3TB2A 2IFQB 3KMOA 2LRCA 1AQXA 3ZVJA 1E6BA 1PMTA 2KLXA 1SL1B 12GSA 7GSSA 2HE3A 4F0CA 1F9MA 2HLSA 4NAXA 2RIIA 2C0GA 5ABRA 2VO4A 2V41A 3KTBA 5D73A 2GQMA 1BF5A 4FO5A 1TI1A 3FMWA 4JR6A 2WCIA 5KN1A 5D9XA 4DSSB 5JWQB 1SL2B 4RI6A 1JZRA 3N9JA 4OFNA 5E4WA 3ZZXA 4PNGA 5DJLA 4GLTA 2IJYA 1BX9A 3L0HA 4K0NA 3A2WA 5B6MA 4KAEA 2YWIA 5J9CA 1S3RA 3WYWA 3NIVA 4K2XA 2I3YA 2GZYA 2HRKA 1S3CA 2PWJA 4FYCA 4EXJA 1Z5YE 2H1GA 2ON7A 2VCXA 2FHEA 5DCHA 3J7Yk 2RM6A 2H1LA 2DJ0A 5CYYA 2V32A 2H1BA 2LV3A 1WE0A 1QFNA 1K0DA 3G7JA 2R0CA 3UL3A 5ECRB 4GQFA 2IWTA 2XPDA 5IOWA 1FVJA 2FLSA 4F0BA 3H1NA 3FK8A 4IQ1A 2PVOC 5GZZB 2VCQA 1OC9B 2DJKA 2DMMA 1HNCA 3KJYA 5IMCA 2KP2A 1SKSB 4CY8A 2DIZA 3PPUA 4PNFA 2PN8A 4ZB8A 2C0FA 4BPYA 5ECOB 3LGCA 19GSA 4XS4B 1BG5A 1QQ2A 4N0ZA 1AQVA 5HR2A 1FOVA 5DDLA 1A2JA 4LLRA 4RUVA 4DEJA 4KX4A 3UJ1A 1A8LA 4FYBA 3KTLA 2C4JA 5A5KA 2F8FA 4GTUA 4ZL8A 1R4WA 1U3AA 2REMA 4TVEA 1EV4A 3P8WA 1GUHA 1B9YC 4AJ7A 1FB6A 5EL8A 2L6CA 1SL0B 3HD5A 3IAM2 3GKKA 6GSSA 3ZFBA 3BCKA 3O6TA 4KDYA 1HNAA 1GWCA 5A4UA 6GSYA 1AXDA 1PFOA 1SVMA 2HQTA 3PGTA 3AY8A 3BD2A 5D93A 2IMKA 4NHZA 4ZBAA 2N5AA 3G7YA 4MLYA 3D4TA 3RHBA 4BWSA 2LSTA 1YEXA 2P0GA 4EC0A 3F9UA 3HVXA 1HYUA 4KSOA 1G6YA 1W89A 3KD0A 1A8YA 1U3IA 2VL3A 5A1NA 3W8SA 1UN2A 3TRPA 3C7MA 2B1KA 4LL1B 3UAPA 3DD3A 4OWYA 2DKHA 4HU7A 2B7JA 3LXZA 5ECSA 1S3AA 1EEMA 2GSQA 2CT6A 2G2QA 5DQSA 3FR9A 1WRYA 2EFHA 4ECBA 3GL3A 4KGIA 4V2NA 2DLXA 5A34B 2DMLA 5IMAA 3EU3A 4XRAA 3KXOA 4ZILA 3EINA 1JLVA 1JLWA 1XIYA 1VF2A 4L5LA 2IFQA 3V1WA 4BA7A 2Z9SA 2A4HA 4HDEA 1JZDA 3ZRDA 2X8GA 2KHPA 1EV9A 4MDCA 2C3TA 1TRVA 4MZWA 4YQMA 3HMJG 2YOIA 4KB3A 1F2EA 3TRQA 1R5AA 4TR1B 3JCML 1H4OA 3CXGA 1OVNA 4OCFA 2V2GA 2O36A 1O8WA 1O7UA 3GIXA 1KTEA 4BL7B 3QD9A 3UBKA 3KM6A 5ECIB 2WZSA 3GTUA 4OCEA 3US3A 3LXTA 2EFCA 1MDIA 1U6TA 1SK0A 1LU4A 5CP1A 3IC4A 2EIOA 3LYKA 1BG1A 4ZBDA 4ICYA 1Z6MA 1FW1A 1T00A 4USSA 1IYIA 3UMAA 4LMWA 4P3YB 5EVOA 1Q4JA 4KUNA 3HCZA 2LRNA 3GH6A 3IHGA 5J47A 2QGVA 2YZUA 1X9SB 3GKXA 1JZWA 3PINA 3CWGA 4E8EA 2X4AA 4ECIA 3HJPA 3MDKA 4MPGA 1FAAA 2X8CA 4MJCA 1TI3A 1M99A 1B48A 1USBA 2FA8A 2GZZA 4ECJA 4BVXA 4QMKA 4G19A 1B9XC 2WB9A 2RUEA 3UVHA 2YCDA 2A2SA 2LQQA 1XZOA 5CAXA 3DGQA 1F3AA 5IOXA 4XS4A 4QQ7A 5J5NA 1TU7A 1SK1A 1EOGA 2DKIA 1DE2A 1ERTA 4YQVA 5ECMB 1T3BA 4V1Ag 1BYEA 13GSA 5EY6A 1G0TA 5AN1A 1V2AA 3GKNA 5ECPB 1PSQA 5IIZA 1GP1A 1EP8A 2LS5A 1TU8A 2ALBA 1AIUA 4DSQA 1K0MA 3FEUA 1K3LA 2HRKB 1XW5A 2A2RA 3DWVA 1SVLA 3ERGA 3CHXC 5J4YA 1T4YA 5G31A 1K0CA 4EE0A 5A4WA 4PI2C 3L4NA 2R3XA 3Q6OA 1XWGA 1AAZA 2WW0A 1UVZA 4MK3A 2X49A 1SD8A 4EF0A 1XOBA 5G30A 2C3QA 1XW9A 5ECHB 3FR3A 1PKWA 4PQHA 2LJKA 3CMIA 2VCZA 1SKRB 2IN3A 2H30A 1GH2A 3IK7A 4HU9A 2WW1A 3QDNA 2OKAA 5CRWA 2B3SA 5A4VA 1T4ZA 2DSAA 3HKRA 1TP9A 5FWGA 1EP7A 5A34A 2YWOA 1AUCA 5J4UA 3G7IA 1B4PA 6GSTA 2VCTA 1BQ7A 3GURA 5ELGA 2VD1A 1FHEA 5HFKA 3CBUA 2GGTA 5D96A 1RW1A 1PX6A 1ST9A 1PQNA 3TKSE 2UV8G 3F3QA 5DVBA 5JWRB 1YF1A 2IMIA 1OKTA 2OACA 4GDFA 1AQWA 3KH9A 2K9FA 1AW9A 4K2DA 6GSXA 4MNNA 1I5GA 1XWKA 2H71A 1PN9A 2VL2C 4TR4A 1TRWA 1YQ1A 4TR1A 1Q98A 1V98A 2TRXA 5F06A 4EDZA 4K7IA 2HRFA 2H66A 2H1AA 2DBCA 18GSA 4BL7A 1T1VA 3ZL5A 1XOAA 4MABA 5KOXA 1GL8A 5IO2A 4QL9A 3EWLA
chains in the Genus database with same CATH topology
2WDUA 2OE3A 2GLRA 4YAVA 4MH3A 1SU9A 5DJMA 3DVWA 5HFIA 1XVQA 3F4TA 1S3DA 1VF1A 2FWHA 1TK5B 1W4VA 4XIHA 5J40A 2VLUA 1V9WA 3UOMA 1HNBA 1CQHA 2B5EA 3GH9A 2H0IA 2HFDA 4N3ZA 3CTGA 1HD2A 4K7NA 1ERWA 3RBTA 3F8UA 2VLVA 4IW9A 1OAZA 2HXKA 1WP0A 3EC3A 1G7OA 2O8VB 1K0NA 1E2YA 1PX7A 4MF5A 3GFKA 4WR4A 2CV4A 3IK9A 2FWFA 3KP8A 1ZGNA 1K3OA 2YV9A 3U6VA 2WRTA 3M9JA 4XCSA 16GSA 5F07A 4WF4A 4ZBBA 1SYXA 3IXRA 3BJ5A 3GSSA 5ECKB 2V1MA 3D21A 1TOFA 5L71A 3E9JB 1TK8B 4DSRA 2F9SA 5J4VA 1T7PB 2AJQB 5KN3A 3BOAA 3GTUB 4YH2A 2MZCA 3QFAC 4MA9A 1YJ6A 2ZCTA 3EE2A 4O7HA 1X5DA 4Q5NA 2HI7A 3EURA 5B8BA 5IMFA 2NTOA 3TGZA 1MEKA 4KCEA 4I5QA 2LKUA 2X99A 2PERA 1LBKA 3FYGA 3FHKA 1FVKA 4NXIA 2H76A 4TR3A 4AKIA 5ECLB 1EGRA 5H5QA 4AJ6A 2DJ2A 3EYTA 1PD21 4BVXB 2F51A 1YDKA 3FR6A 1PL1A 3DXBA 3A3TA 2CZ3A 3VWWA 5EPFA 3L9UA 3HJOA 1A24A 3TJFA 2E2GA 2OBIA 2CVKA 4TN8A 1XPVA 4Z2UA 2VM2A 1PN0A 1K0BA 2YJ7A 1X5EA 2R0PA 1Z6NA 2YV7A 4I8BA 6GSUA 2JU5A 2I4AA 4IQAA 10GSA 3E0UA 4HEA2 3IV4A 3F4SA 3FRCA 2HZEA 1GSEA 2X8HA 1OE8A 4EIPA 3IA1A 3GX0A 4Q5QA 1JHBA 3WT2A 5JCGA 3SBCA 3MYDA 3CRUA 2AHEA 3HVVA 4POMA 2LNSA 4Z2TA 4OFTA 3KGKA 1J9BA 4YAPA 5IMVA 1GTAA 1PRXA 5GAPD 1GULA 2KP1A 1TTZA 5B7CA 3BCIA 1U88A 1URMA 1DBYA 4MH2A 3DMLA 1A23A 1VF4A 3HJMA 1YZXA 2VLTA 1OYJA 4L0WA 1KNGA 4K8MA 4TOPA 3ZREA 1THOA 4LL4B 1UC7A 4G0IA 3CSJA 3TUEA 4JR4A 1M9BA 3TJBA 4PUAA 3TJKA 3GN3A 3M3MA 5B8AA 1WIKA 2ON5A 1ACVA 3FZAA 5FHIA 2QKEA 2FCHA 2LJAA 2WULA 4N10A 2O5VA 4WETA 4FQUA 4J2FA 5IM9A 2GSRA 3MAKA 5HR0A 5IMZA 1XBSA 4AJ8A 1MD3A 2HRAA 4MJBA 2C3NA 2FUG2 4N11A 4O92A 3RAZA 3C1SA 4IVFA 2MBSA 2HYXA 3WGXA 3F6DA 1OE7A 1TDIA 3ZTLA 2NVLA 2K6VA 4I97A 2LJRA 4BVYB 4IBPA 5JCWA 5INYA 2JZSA 3W6GA 2DJ1A 2BJXA 2CVBA 2EIRA 2FA4A 1BAYA 4L8EA 2L5LA 4N0VA 4WEYA 3PH9A 2K18A 2GSTA 3APSA 2VD0A 1N8JA 1QK8A 1X9WB 5DCGA 3H8QA 2WS2A 1GSFA 2H6ZA 2GQLA 3TKSC 3ZYWA 3LG6A 3LORA 1NHYA 2B7KA 1CQGA 4G9HA 5ELAA 1M2DA 4ZXGA 5C04A 3A2VA 2XBQA 2DIYA 1K3YA 2N5FA 5DALB 2MMAA 4IHUA 1EOHA 2A2PA 1Y6EA 1QUWA 3KIJA 5CO3A 2ZUPA 2P5QA 3VFIA 4PTSA 1XCCA 3QR6A 4O5QA 4OO5A 3D4MA 3GMFA 2IIYA 4ML6A 4G0LA 4MP4A 4KA0A 4ZB7A 1O73A 4TXOB 4JBBA 1TRUA 2JACA 3P90A 3ZVJD 4GF0A 2R5GA 5B6NA 4DVCA 17GSA 2HSMB 3S9FA 3VWVA 3I9V2 2L4CA 2OT3A 1MD4A 4GXZA 2R2JA 2VAFA 3HZ8A 1V58A 4HS1A 4ZL7A 2J23A 4HI7A 3C71A 3LFLA 4L5OA 4PQ1A 2IL3A 1TRSA 2FNOA 2R4VA 1JZOA 1O85A 3F3RA 1VGLA 3U5RE 5LNKe 3EPTA 3VURA 3HXSA 2FY6A 1F6MC 1ABAA 2WZ9A 2HNLA 2B5XA 4K5SA 1ERUA 4EO3A 4WBJA 1Z3EA 2GZPA 4LA1A 4O5RA 2XPEA 5IO0A 3LW9A 3VPQA 4V2MA 4GRFA 1GLPA 3A5WA 3ZFLA 3G9BA 2JL4A 3LJRA 1THXA 4G01A 3VLNA 4MF7A 3UVTA 2C1YA 1EGOA 4CHSA 4YQUA 3NOFA 1Y1UA 2O89A 4OMVA 3DIEA 1J0FA 1BJXA 4YKFA 2E0QA 3IRAA 4I2UA 4GSTA 4KSMA 5LCZA 4W66A 4MJAA 3GSTA 4ACSA 3GKMA 5F05A 3M8NA 4IKHA 1YKAA 3J7Yb 5IMDA 4ID0A 4AF2A 3DYRA 3D5JA 2KOKA 2GT6A 4NMUA 2UZ8A 4POBA 4F82A 4MZBA 5G1KA 2H8LA 3BBYA 4NV2A 5ID2B 4Q5FA 3QMXA 2PPTA 4CY6A 5KN0A 2C80A 3CSIA 2LEGA 3DKSA 2AB6A 3Q74A 3TOUA 3C73A 3O3TA 2YPMA 2OJLA 4MZCA 4ZL9A 1N25A 1AC1A 1V57A 4XS6A 2OE1A 2P31A 3OR5A 4PXOA 1A0FA 4AKHA 1EEJA 3MSZA 2IMFA 3FY7A 2HZEB 4X43A 4PUFC 4ECCA 4WXTA 1M0UA 3ERWA 4BVYA 6GSVA 3QAVA 4TRXA 2HRNA 2YWNA 2G0FA 3ZITA 2H73A 4X0XA 5A5HB 1XWAA 5BMUB 3TJJA 2XHFA 3QPMA 5DAKA 2MBTA 2EFEA 2GTUA 2RLIA 4NWYA 3D22A 5KEJA 2AAWA 2BMXA 1OC8A 1WPIA 2RUFA 5IQYA 3HY2A 2DC5A 1WJKA 6GSWA 1FOHA 3HVSA 3TJGA 2J9HA 2D2ZA 2PU9C 2CQ9A 3I6AA 4ZB9A 2FWEA 3TOTA 4XHMA 2VM1A 5DALA 2H70A 1M9AA 3R2QA 1GLQA 4F2IA 4RQXA 2JADA 3KZQA 2H74A 1K0AA 1GSSA 3UIWA 5AIXA 4JZQA 3TU3B 4MPFA 2H0GA 1RK4A 5D9VA 4F03A 1MTCA 3FZ4A 4MCUA 4JEDA 3M1GA 1NM3A 4FH8A 1F37A 4K1FA 4TXOA 1EWXA 5GSSA 1TXXA 2C0EA 4V2LA 2WJUA 3VI7A 2FD3A 2M72A 1C72A 3TKPA 2YP6A 2LRTA 2L57A 1H75A 1SJZA 3ME7A 2HSMA 2K8SA 2KUCA 4Z2RA 3P2AA 3SWLA 3EMPA 3QFBC 4K6XA 2YZHA 3UARA 1GNEA 1GTUA 5J9BA 3L78A 3MNGA 1M7TA 3TCOA 1O8XA 1R5PA 4IJ3A 1JFUA 2PGTA 1MDKA 1MDJA 4HQZA 3RHCA 1A0RP 2NPBA 2GSSA 4WKWA 4E68A 4GQCA 4EDYA 4HUAA 5D9WA 5F0GA 2H19A 3W8JA 3EU4A 2ZNMA 3IOSA 2ES7A 2GQKA 14GSA 3GV1A 1SENA 4PQIA 4YKGA 2V6OA 4PURA 4XRDA 2B6MA 2JSYA 2C0DA 4O5UA 5G1LA 2R6KA 2IMEA 3H4KA 2PUKC 1GRXA 2LQOA 22GSA 3C8EA 3KMNA 4K9ZA 2PVQA 3DVXA 4FYUA 4ML1A 2GDRA 1RQMA 1WOUA 3H79A 3MWHA 1ILOA 1WMJA 5H5RA 2O7KA 3KP9A 2M46A 2H6YA 2QC7A 4GWRA 2RM5A 3L9SA 2BTOT 2QA2A 20GSA 4AKXB 3WD6A 2B5YA 5FT3A 5ID2A 4D73B 1K0OA 3UEMA 3L9VA 3FZ5A 2YWMA 3F6FA 1VF3A 1PL2A 1TKDB 2O85A 2NBSA 2HSNA 1GUMA 4Q5RA 1ZOFA 1ZYPA 3MIXA 1IYHA 1UA5A 2K8VA 1J08A 3GYKA 1GTIA 3P7XA 1GNWA 3O76A 4RI7A 2NDOA 5BRTA 1O81A 3NZNA 4EVMA 2QSIA 1NW2A 3KH7A 3EMXA 4J56E 2O87A 4G10A 2LNTA 2IPAA 5HQPA 1A2MA 1GSYA 2MYGA 4CDOA 2TIRA 5A5HA 1TJDA 4H86A 2B1LA 5BMUA 2CA8A 2IMDA 2YN1A 4I2TA 4AKGA 2MMZA 3GHAA 2VL9A 5GSTA 3IHQA 1PA3A 4KF9A 3IR4A 1KEBA 2VCVA 5CRGA 1X9MB 1ZMAA 2DJJA 4Z7XA 2L6DA 1Z7PA 4IN0A 1TK0B 2N5BA 5F8BA 4KE3A 1ZYNA 1FB0A 5KN2A 1DUGA 3CTFA 1DE1A 3QAGA 1N2AA 4L0UA 4EL1A 1F3BA 2DJ3A 3VK9A 2LTKA 3IC8A 4EKZA 4N30A 5HR1A 2JZRA 5E59A 3M0FA 4IJIA 1WWJA 2JSZA 2L4QA 4AI6A 4K5RA 5HFGA 1A2LA 2I81A 3RPNA 1X0RA 2JZTA 2C8UA 4MMMA 4K0GA 2GVPA 3VPTA 2EIQA 1Z7RA 5D9TA 1SK2A 4LMVA 3HZ4A 3QCPA 4XS1A 3ZIVA 3F0IA 2P5RA 2CX3A 4HJ2A 2VL2A 4TR0A 2XBIA 2I1UA 1XWCA 3RPPA 3FZ9A 4F9ZA 5DAKB 3HYPA 3APOA 2R0GA 4PX1A 4X1UA 1NSWA 4HZ2A 3GUSA 5JCUA 1TXUA 4IGJA 4A5PA 11GSA 3QOUA 4G0KA 4POLA 3ERFA 3A2XA 5DQYA 3FW2A 3WGDA 1XFLA 3A5IA 4MJEA 3IAS2 3APQA 2M80A 1SKWB 3ED3A 1GTBA 2FGXA 2E7PA 4AGSA 4NV5A 4DSSA 4NHWA 2MMOA 1XVWA 1LJRA 4KW6A 3ZMKA 4O32A 3N5OA 2CAQA 2GT5A 4BWQA 4IS0A 1XWBA 3EVIA 4TW5A 4OFMA 2X64A 3Q19A 3GNJA 2WGRA 1YY7A 3ZLPA 3VI5A 4GCIA 4IP1A 2HSHA 3CSHA 2F8AA 1EZKA 1GSDA 4EIQA 3TDGA 1G7EA 1ZCPA 3CYNA 5COHA 9GSSA 3VWUA 4D73A 1SVOA 2YNXA 2PMTA 3GA4A 5ECNB 3TRXA 2FWGA 5DBQA 2F3MA 3LYPA 2E2MA 4TKYA 3VWXA 5CRHA 5KOWA 3LQ7A 3F63A 2AYTA 1OC9A 2HT9A 3HDCA 1B4QA 3IDVA 1O6JA 3ZIJA 4JU5A 4GSSA 5CREA 1XXUA 5CRDA 2GS3A 3C1RA 2TRCP 4HOJA 1R26A 3I43A 4HJMA 3F4RA 1VRSD 1T8EB 2AUVA 3TKQA 1FG4A 1HQOA 4ZB6A 2H6XA 3H93A 2H1DA 5ENUA 2YANA 2VIMA 3QAWA 4ZIJA 3FKFA 4HQSA 3LSZA 1YEPA 1ZL9A 3HHVA 1ERVA 4XTSA 3ME8A 2H75A 2OADA 5CNWA 3UBLA 5LD0A 4KDXA 1OC3A 1SJIA 1Y25A 3KCMA 4GSNA 1ON4A 3LEFA 5AISA 5IPHA 1SD9A 4KCAA 1ZZYA 1YF0A 5JWOB 3LWAA 4WBRD 3E3EA 4G2EA 1Z9HA 5AIVA 1M2AA 2EC4A 3DRNA 2L5OA 2YJHA 2VUPA 5J3RA 2HSNB 2VCWA 1YVLA 1U87A 2HZFA 2XC2A 1QGVA 1BEDA 5IPGA 2OE0A 1G6WA 4EUYA 4HZ4A 4I6XA 5C00A 2CZ2A 4OO4A 5J41A 5HR3A 1X5CA 1M2BA 4ISDA 8GSSA 3RDWA 3R3EA 4ILFA 3WGEA 1OKDA 5D8IA 1KBNA 2L59A 3I69A 1R7HA 5ECQB 2CAIA 2A4VA 4KH7A 5GAND 2V6KA 1YKCA 1TW9A 3KEBA 4JRRA 2VOCA 1QXHA 4PGTA 5G5FA 4KDUA 2H01A 4OD7A 4WR5A 3GRXA 4RQRA 3Q18A 3ZMLA 2OBKA 3PR8A 1ML6A 4FIWA 2H0HA 2AV4A 1SJ6A 1NHOA 2HSYA 3GL5A 1V40A 4TXVA 4IP6A 1PKZA 2WFCA 2H72A 3DEXA 2EFDA 2MMNA 3IPZA 1I9DA 2PBJA 2CVDA 2VKZG 3IBHA 4V1Ap 2OA7A 3IE3A 4MF6A 5G2ZA 1PGTA 3D0ZA 5AGYA 1XW6A 1GUKA 3WT1A 3M9KA 4QL7A 4E8HA 1SYRA 4ULXA 5A1NB 3D6IA 4WF5A 3TKRA 4KNDA 3K8NA 1GSQA 1GSUA 2CX4A 4K7OA 4POKA 4J57E 4JE1A 1ZYEA 4IELA 3GX8A 4NPBA 1DSBA 3CRTA 4CW9A 2I9HA 5H5SA 2LUSA 3HA9A 3TKSA 1ZYQB 5G5EA 3ISOA 2R37A 4X4JA 1B8XA 2QA1A 1FO5A 1QMVA 3TB2A 2IFQB 3KMOA 2LRCA 1AQXA 3ZVJA 1E6BA 1PMTA 2KLXA 1SL1B 12GSA 7GSSA 2HE3A 4F0CA 1F9MA 2HLSA 4NAXA 2RIIA 2C0GA 5ABRA 2VO4A 2V41A 3KTBA 5D73A 2GQMA 1BF5A 4FO5A 1TI1A 3FMWA 4JR6A 2WCIA 5KN1A 5D9XA 4DSSB 5JWQB 1SL2B 4RI6A 3N9JA 1JZRA 4OFNA 5E4WA 3ZZXA 4PNGA 5DJLA 4GLTA 2IJYA 1BX9A 3L0HA 4K0NA 3A2WA 5B6MA 4KAEA 2YWIA 5J9CA 3WYWA 3NIVA 4K2XA 2I3YA 2GZYA 2HRKA 1S3CA 2PWJA 4FYCA 4EXJA 1Z5YE 2H1GA 2ON7A 2VCXA 2FHEA 5DCHA 3J7Yk 2RM6A 2H1LA 2DJ0A 5CYYA 2V32A 2H1BA 2LV3A 1WE0A 1QFNA 1K0DA 3G7JA 2R0CA 3UL3A 5ECRB 4GQFA 2IWTA 2XPDA 5IOWA 1FVJA 2FLSA 4F0BA 3H1NA 3FK8A 4IQ1A 2PVOC 5GZZB 2VCQA 1OC9B 2DJKA 2DMMA 1HNCA 3KJYA 5IMCA 2KP2A 1SKSB 4CY8A 2DIZA 3PPUA 4PNFA 2PN8A 4ZB8A 2C0FA 4BPYA 5ECOB 3LGCA 19GSA 4XS4B 1BG5A 1QQ2A 4N0ZA 1AQVA 5HR2A 1FOVA 5DDLA 1A2JA 4LLRA 4RUVA 4DEJA 4KX4A 3UJ1A 1A8LA 4FYBA 3KTLA 2C4JA 5A5KA 2F8FA 4GTUA 4ZL8A 1R4WA 1U3AA 2REMA 4TVEA 1EV4A 3P8WA 1GUHA 1B9YC 4AJ7A 1FB6A 5EL8A 2L6CA 1SL0B 3HD5A 3IAM2 3GKKA 6GSSA 3ZFBA 3BCKA 3O6TA 4KDYA 1HNAA 1GWCA 5A4UA 6GSYA 1AXDA 1SVMA 2HQTA 3PGTA 3AY8A 3BD2A 5D93A 2IMKA 4NHZA 4ZBAA 2N5AA 3G7YA 4MLYA 3D4TA 3RHBA 4BWSA 2LSTA 1YEXA 2P0GA 4EC0A 3F9UA 3HVXA 1HYUA 4KSOA 1G6YA 1W89A 3KD0A 1A8YA 1U3IA 2VL3A 5A1NA 3W8SA 1UN2A 3TRPA 3C7MA 2B1KA 4LL1B 3UAPA 3DD3A 4OWYA 2DKHA 4HU7A 2B7JA 3LXZA 5ECSA 1S3AA 1EEMA 2GSQA 2CT6A 2G2QA 5DQSA 3FR9A 1WRYA 2EFHA 4ECBA 3GL3A 4KGIA 4V2NA 2DLXA 5A34B 2DMLA 5IMAA 3EU3A 4XRAA 3KXOA 4ZILA 3EINA 1JLVA 1JLWA 1XIYA 1VF2A 4L5LA 2IFQA 3V1WA 4BA7A 2Z9SA 2A4HA 4HDEA 1JZDA 3ZRDA 2X8GA 2KHPA 1EV9A 4MDCA 2C3TA 1TRVA 4MZWA 4YQMA 3HMJG 2YOIA 4KB3A 1F2EA 3TRQA 1R5AA 4TR1B 3JCML 1H4OA 3CXGA 1OVNA 4OCFA 2V2GA 1O8WA 1O7UA 3GIXA 1KTEA 4BL7B 3QD9A 3UBKA 3KM6A 5ECIB 3GTUA 4OCEA 3US3A 3LXTA 2EFCA 1MDIA 1U6TA 1SK0A 1LU4A 5CP1A 3IC4A 2EIOA 3LYKA 1BG1A 4ZBDA 4ICYA 1Z6MA 1FW1A 1T00A 4USSA 1IYIA 3UMAA 4LMWA 4P3YB 5EVOA 1Q4JA 4KUNA 3HCZA 2LRNA 3GH6A 3IHGA 5J47A 2QGVA 2YZUA 1X9SB 3GKXA 1JZWA 3PINA 3CWGA 4E8EA 2X4AA 4ECIA 3HJPA 3MDKA 4MPGA 1FAAA 2X8CA 4MJCA 1TI3A 1M99A 1B48A 1USBA 2FA8A 2GZZA 4ECJA 4BVXA 4QMKA 4G19A 1B9XC 2WB9A 2RUEA 3UVHA 2YCDA 2A2SA 2LQQA 1XZOA 5CAXA 3DGQA 1F3AA 5IOXA 4XS4A 4QQ7A 5J5NA 1TU7A 1SK1A 1EOGA 2DKIA 1DE2A 1ERTA 4YQVA 5ECMB 1T3BA 4V1Ag 1BYEA 13GSA 5EY6A 1G0TA 5AN1A 1V2AA 3GKNA 5ECPB 1PSQA 5IIZA 1GP1A 1EP8A 2LS5A 1TU8A 2ALBA 1AIUA 4DSQA 1K0MA 3FEUA 1K3LA 2HRKB 1XW5A 2A2RA 3DWVA 1SVLA 3ERGA 5J4YA 1T4YA 5G31A 1K0CA 4EE0A 5A4WA 3L4NA 2R3XA 3Q6OA 1XWGA 1AAZA 1UVZA 4MK3A 2X49A 1SD8A 4EF0A 1XOBA 5G30A 2C3QA 1XW9A 5ECHB 3FR3A 1PKWA 4PQHA 2LJKA 3CMIA 2VCZA 1SKRB 2IN3A 2H30A 1GH2A 3IK7A 4HU9A 3QDNA 2OKAA 5CRWA 2B3SA 5A4VA 1T4ZA 2DSAA 3HKRA 1TP9A 5FWGA 1EP7A 5A34A 2YWOA 1AUCA 5J4UA 3G7IA 1B4PA 6GSTA 2VCTA 1BQ7A 3GURA 5ELGA 2VD1A 1FHEA 5HFKA 3CBUA 2GGTA 5D96A 1RW1A 1PX6A 1ST9A 1PQNA 3TKSE 2UV8G 3F3QA 5DVBA 5JWRB 1YF1A 2IMIA 1OKTA 2OACA 4GDFA 1AQWA 3KH9A 2K9FA 1AW9A 4K2DA 6GSXA 4MNNA 1I5GA 1XWKA 2H71A 1PN9A 2VL2C 4TR4A 1TRWA 1YQ1A 4TR1A 1Q98A 1V98A 2TRXA 5F06A 4EDZA 4K7IA 2HRFA 2H66A 2H1AA 2DBCA 18GSA 4BL7A 1T1VA 3ZL5A 1XOAA 4MABA 5KOXA 1GL8A 5IO2A 4QL9A 3EWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDU A;  2OE3 A;  2GLR A;  4YAV A;  4MH3 A;  1SU9 A;  5DJM A;  3DVW A;  5HFI A;  1XVQ A;  3F4T A;  1S3D A;  1VF1 A;  2FWH A;  1TK5 B;  1W4V A;  4XIH A;  2VLU A;  1V9W A;  3UOM A;  1HNB A;  1CQH A;  2B5E A;  3GH9 A;  2H0I A;  2HFD A;  3CTG A;  1HD2 A;  4K7N A;  1ERW A;  3RBT A;  3F8U A;  2VLV A;  4IW9 A;  1OAZ A;  2HXK A;  1WP0 A;  3EC3 A;  1G7O A;  2O8V B;  1K0N A;  1E2Y A;  1PX7 A;  4MF5 A;  3GFK A;  4WR4 A;  2CV4 A;  3IK9 A;  2FWF A;  3KP8 A;  1ZGN A;  1K3O A;  2YV9 A;  3U6V A;  2WRT A;  3M9J A;  4XCS A;  16GS A;  5F07 A;  4WF4 A;  4ZBB A;  1SYX A;  3IXR A;  3BJ5 A;  3GSS A;  5ECK B;  2V1M A;  3D21 A;  1TOF A;  5L71 A;  3E9J B;  1TK8 B;  4DSR A;  2F9S A;  1T7P B;  2AJQ B;  5KN3 A;  3BOA A;  3GTU B;  4YH2 A;  2MZC A;  3QFA C;  4MA9 A;  1YJ6 A;  2ZCT A;  3EE2 A;  4O7H A;  1X5D A;  4Q5N A;  2HI7 A;  3EUR A;  5B8B A;  5IMF A;  2NTO A;  3TGZ A;  1MEK A;  4KCE A;  4I5Q A;  2LKU A;  2X99 A;  2PER A;  1LBK A;  3FYG A;  3FHK A;  1FVK A;  4NXI A;  2H76 A;  4TR3 A;  5ECL B;  1EGR A;  5H5Q A;  4AJ6 A;  2DJ2 A;  3EYT A;  1PD2 1;  4BVX B;  2F51 A;  1YDK A;  3FR6 A;  1PL1 A;  3DXB A;  3A3T A;  2CZ3 A;  3VWW A;  5EPF A;  3L9U A;  3HJO A;  1A24 A;  3TJF A;  2E2G A;  2OBI A;  2CVK A;  4TN8 A;  1XPV A;  2VM2 A;  1K0B A;  2YJ7 A;  1X5E A;  1Z6N A;  2YV7 A;  4I8B A;  6GSU A;  2JU5 A;  2I4A A;  4IQA A;  10GS A;  3E0U A;  4HEA 2;  3IV4 A;  3F4S A;  3FRC A;  2HZE A;  1GSE A;  2X8H A;  1OE8 A;  3IA1 A;  3GX0 A;  4Q5Q A;  1JHB A;  3WT2 A;  5JCG A;  3SBC A;  3CRU A;  2AHE A;  3HVV A;  4POM A;  2LNS A;  4OFT A;  3KGK A;  1J9B A;  4YAP A;  5IMV A;  1GTA A;  1PRX A;  5GAP D;  1GUL A;  2KP1 A;  1TTZ A;  5B7C A;  3BCI A;  1U88 A;  1URM A;  1DBY A;  4MH2 A;  3DML A;  1A23 A;  1VF4 A;  3HJM A;  1YZX A;  2VLT A;  1OYJ A;  4L0W A;  1KNG A;  4K8M A;  4TOP A;  3ZRE A;  1THO A;  4LL4 B;  1UC7 A;  4G0I A;  3CSJ A;  3TUE A;  4JR4 A;  1M9B A;  3TJB A;  4PUA A;  3TJK A;  3GN3 A;  3M3M A;  5B8A A;  1WIK A;  2ON5 A;  1ACV A;  3FZA A;  5FHI A;  2QKE A;  2FCH A;  2LJA A;  2WUL A;  4N10 A;  4WET A;  4FQU A;  4J2F A;  5IM9 A;  2GSR A;  3MAK A;  5HR0 A;  5IMZ A;  1XBS A;  4AJ8 A;  1MD3 A;  2HRA A;  4MJB A;  2C3N A;  2FUG 2;  4N11 A;  4O92 A;  3RAZ A;  3C1S A;  4IVF A;  2MBS A;  2HYX A;  3WGX A;  3F6D A;  1OE7 A;  1TDI A;  3ZTL A;  2NVL A;  2K6V A;  4I97 A;  2LJR A;  4BVY B;  4IBP A;  5JCW A;  5INY A;  2JZS A;  3W6G A;  2DJ1 A;  2BJX A;  2CVB A;  2EIR A;  2FA4 A;  1BAY A;  4L8E A;  2L5L A;  4N0V A;  4WEY A;  3PH9 A;  2K18 A;  2GST A;  3APS A;  2VD0 A;  1N8J A;  1QK8 A;  1X9W B;  5DCG A;  3H8Q A;  2WS2 A;  1GSF A;  2H6Z A;  2GQL A;  3TKS C;  3ZYW A;  3LG6 A;  3LOR A;  1NHY A;  2B7K A;  1CQG A;  4G9H A;  5ELA A;  1M2D A;  4ZXG A;  5C04 A;  3A2V A;  2XBQ A;  2DIY A;  1K3Y A;  2N5F A;  5DAL B;  2MMA A;  4IHU A;  1EOH A;  1Y6E A;  1QUW A;  3KIJ A;  5CO3 A;  2ZUP A;  2P5Q A;  3VFI A;  4PTS A;  1XCC A;  3QR6 A;  4OO5 A;  3D4M A;  3GMF A;  2IIY A;  4ML6 A;  4G0L A;  4MP4 A;  4KA0 A;  1O73 A;  4TXO B;  4JBB A;  1TRU A;  2JAC A;  3P90 A;  3ZVJ D;  4GF0 A;  2R5G A;  5B6N A;  4DVC A;  17GS A;  2HSM B;  3S9F A;  3VWV A;  3I9V 2;  2L4C A;  1MD4 A;  4GXZ A;  2R2J A;  2VAF A;  3HZ8 A;  1V58 A;  4HS1 A;  4ZL7 A;  2J23 A;  4HI7 A;  3C71 A;  3LFL A;  4L5O A;  4PQ1 A;  2IL3 A;  1TRS A;  2FNO A;  2R4V A;  1JZO A;  1O85 A;  3F3R A;  1VGL A;  3U5R E;  5LNK e;  3VUR A;  3HXS A;  2FY6 A;  1F6M C;  1ABA A;  2WZ9 A;  2HNL A;  2B5X A;  1ERU A;  4EO3 A;  4WBJ A;  1Z3E A;  2GZP A;  4LA1 A;  4O5R A;  2XPE A;  5IO0 A;  3VPQ A;  4V2M A;  4GRF A;  1GLP A;  3A5W A;  3ZFL A;  3G9B A;  2JL4 A;  3LJR A;  1THX A;  3VLN A;  4MF7 A;  3UVT A;  2C1Y A;  1EGO A;  4CHS A;  4YQU A;  3NOF A;  2O89 A;  4OMV A;  3DIE A;  1J0F A;  1BJX A;  2E0Q A;  3IRA A;  4I2U A;  4GST A;  4KSM A;  5LCZ A;  4MJA A;  3GST A;  4ACS A;  3GKM A;  5F05 A;  3M8N A;  4IKH A;  1YKA A;  3J7Y b;  5IMD A;  4ID0 A;  4AF2 A;  3DYR A;  3D5J A;  2KOK A;  2GT6 A;  4NMU A;  2UZ8 A;  4POB A;  4F82 A;  4MZB A;  5G1K A;  2H8L A;  3BBY A;  4NV2 A;  5ID2 B;  4Q5F A;  3QMX A;  2PPT A;  5KN0 A;  2C80 A;  3CSI A;  2LEG A;  3DKS A;  2AB6 A;  3Q74 A;  3TOU A;  3C73 A;  3O3T A;  2YPM A;  2OJL A;  4MZC A;  4ZL9 A;  1AC1 A;  1V57 A;  4XS6 A;  2OE1 A;  2P31 A;  3OR5 A;  4PXO A;  1A0F A;  1EEJ A;  3MSZ A;  2IMF A;  3FY7 A;  2HZE B;  4X43 A;  4PUF C;  4ECC A;  4WXT A;  1M0U A;  3ERW A;  4BVY A;  6GSV A;  3QAV A;  4TRX A;  2HRN A;  2YWN A;  2G0F A;  3ZIT A;  2H73 A;  4X0X A;  1XWA A;  3TJJ A;  2XHF A;  3QPM A;  5DAK A;  2MBT A;  2GTU A;  2RLI A;  4NWY A;  3D22 A;  5KEJ A;  2AAW A;  2BMX A;  1OC8 A;  1WPI A;  2RUF A;  5IQY A;  3HY2 A;  2DC5 A;  1WJK A;  6GSW A;  3HVS A;  3TJG A;  2J9H A;  2D2Z A;  2PU9 C;  2CQ9 A;  3I6A A;  4ZB9 A;  2FWE A;  3TOT A;  4XHM A;  2VM1 A;  5DAL A;  2H70 A;  1M9A A;  3R2Q A;  1GLQ A;  4F2I A;  4RQX A;  2JAD A;  3KZQ A;  2H74 A;  1K0A A;  1GSS A;  3UIW A;  5AIX A;  4JZQ A;  4MPF A;  2H0G A;  1RK4 A;  5D9V A;  4F03 A;  1MTC A;  3FZ4 A;  4MCU A;  4JED A;  3M1G A;  1NM3 A;  4FH8 A;  1F37 A;  4K1F A;  4TXO A;  1EWX A;  5GSS A;  1TXX A;  2C0E A;  4V2L A;  2WJU A;  3VI7 A;  2FD3 A;  2M72 A;  1C72 A;  3TKP A;  2YP6 A;  2LRT A;  2L57 A;  1H75 A;  1SJZ A;  3ME7 A;  2HSM A;  2K8S A;  2KUC A;  3P2A A;  3SWL A;  3EMP A;  3QFB C;  4K6X A;  2YZH A;  3UAR A;  1GNE A;  1GTU A;  5J9B A;  3L78 A;  3MNG A;  1M7T A;  3TCO A;  1O8X A;  1R5P A;  4IJ3 A;  1JFU A;  2PGT A;  1MDK A;  1MDJ A;  4HQZ A;  3RHC A;  1A0R P;  2NPB A;  2GSS A;  4WKW A;  4GQC A;  4EDY A;  4HUA A;  5D9W A;  5F0G A;  2H19 A;  3W8J A;  3EU4 A;  2ZNM A;  3IOS A;  2ES7 A;  2GQK A;  14GS A;  3GV1 A;  1SEN A;  4PQI A;  2V6O A;  4PUR A;  4XRD A;  2B6M A;  2JSY A;  2C0D A;  5G1L A;  2R6K A;  2IME A;  3H4K A;  2PUK C;  1GRX A;  2LQO A;  22GS A;  3C8E A;  3KMN A;  4K9Z A;  2PVQ A;  3DVX A;  4FYU A;  4ML1 A;  2GDR A;  1RQM A;  1WOU A;  3H79 A;  3MWH A;  1ILO A;  1WMJ A;  5H5R A;  2O7K A;  3KP9 A;  2M46 A;  2H6Y A;  2QC7 A;  4GWR A;  2RM5 A;  3L9S A;  2BTO T;  20GS A;  3WD6 A;  2B5Y A;  5FT3 A;  5ID2 A;  4D73 B;  1K0O A;  3UEM A;  3L9V A;  3FZ5 A;  2YWM A;  3F6F A;  1VF3 A;  1PL2 A;  1TKD B;  2O85 A;  2NBS A;  1GUM A;  4Q5R A;  1ZOF A;  1IYH A;  1UA5 A;  2K8V A;  1J08 A;  3GYK A;  1GTI A;  3P7X A;  1GNW A;  3O76 A;  4RI7 A;  2NDO A;  1O81 A;  3NZN A;  4EVM A;  2QSI A;  1NW2 A;  3KH7 A;  3EMX A;  4J56 E;  2O87 A;  4G10 A;  2LNT A;  2IPA A;  5HQP A;  1A2M A;  1GSY A;  2MYG A;  4CDO A;  2TIR A;  1TJD A;  4H86 A;  2B1L A;  5BMU A;  2CA8 A;  2IMD A;  2YN1 A;  4I2T A;  2MMZ A;  3GHA A;  2VL9 A;  5GST A;  3IHQ A;  1PA3 A;  4KF9 A;  3IR4 A;  1KEB A;  2VCV A;  5CRG A;  1X9M B;  1ZMA A;  2DJJ A;  4Z7X A;  2L6D A;  1Z7P A;  4IN0 A;  1TK0 B;  2N5B A;  5F8B A;  4KE3 A;  1FB0 A;  5KN2 A;  1DUG A;  3CTF A;  1DE1 A;  3QAG A;  1N2A A;  4L0U A;  4EL1 A;  1F3B A;  2DJ3 A;  3VK9 A;  2LTK A;  3IC8 A;  4EKZ A;  4N30 A;  5HR1 A;  2JZR A;  5E59 A;  3M0F A;  4IJI A;  1WWJ A;  2JSZ A;  2L4Q A;  5HFG A;  1A2L A;  2I81 A;  3RPN A;  1X0R A;  2JZT A;  2C8U A;  4MMM A;  4K0G A;  2GVP A;  3VPT A;  2EIQ A;  1Z7R A;  5D9T A;  1SK2 A;  4LMV A;  3HZ4 A;  3QCP A;  4XS1 A;  3ZIV A;  3F0I A;  2P5R A;  2CX3 A;  4HJ2 A;  2VL2 A;  4TR0 A;  2XBI A;  2I1U A;  1XWC A;  3RPP A;  3FZ9 A;  4F9Z A;  5DAK B;  3HYP A;  3APO A;  4PX1 A;  4X1U A;  1NSW A;  4HZ2 A;  3GUS A;  5JCU A;  4IGJ A;  11GS A;  3QOU A;  4G0K A;  4POL A;  3ERF A;  3A2X A;  5DQY A;  3FW2 A;  3WGD A;  1XFL A;  4MJE A;  3IAS 2;  3APQ A;  2M80 A;  1SKW B;  3ED3 A;  1GTB A;  2FGX A;  2E7P A;  4AGS A;  4NV5 A;  4DSS A;  4NHW A;  2MMO A;  1XVW A;  1LJR A;  4KW6 A;  3ZMK A;  4O32 A;  3N5O A;  2CAQ A;  2GT5 A;  4BWQ A;  4IS0 A;  1XWB A;  3EVI A;  4TW5 A;  4OFM A;  2X64 A;  3Q19 A;  3GNJ A;  2WGR A;  1YY7 A;  3ZLP A;  3VI5 A;  4GCI A;  4IP1 A;  2HSH A;  3CSH A;  2F8A A;  1EZK A;  1GSD A;  3TDG A;  1G7E A;  1ZCP A;  3CYN A;  5COH A;  9GSS A;  3VWU A;  4D73 A;  2YNX A;  2PMT A;  3GA4 A;  5ECN B;  3TRX A;  2FWG A;  5DBQ A;  2F3M A;  3LYP A;  2E2M A;  4TKY A;  3VWX A;  5CRH A;  3LQ7 A;  3F63 A;  2AYT A;  1OC9 A;  2HT9 A;  3HDC A;  1B4Q A;  3IDV A;  1O6J A;  3ZIJ A;  4JU5 A;  4GSS A;  5CRE A;  1XXU A;  5CRD A;  2GS3 A;  3C1R A;  2TRC P;  4HOJ A;  1R26 A;  3I43 A;  4HJM A;  3F4R A;  1VRS D;  1T8E B;  2AUV A;  3TKQ A;  1FG4 A;  1HQO A;  4ZB6 A;  2H6X A;  3H93 A;  2H1D A;  5ENU A;  2YAN A;  2VIM A;  3QAW A;  4ZIJ A;  3FKF A;  4HQS A;  3LSZ A;  1YEP A;  1ZL9 A;  3HHV A;  1ERV A;  4XTS A;  3ME8 A;  2H75 A;  2OAD A;  5CNW A;  3UBL A;  5LD0 A;  4KDX A;  1OC3 A;  1SJI A;  1Y25 A;  3KCM A;  4GSN A;  1ON4 A;  3LEF A;  5AIS A;  5IPH A;  1SD9 A;  4KCA A;  1ZZY A;  1YF0 A;  5JWO B;  3LWA A;  4WBR D;  3E3E A;  4G2E A;  1Z9H A;  5AIV A;  1M2A A;  2EC4 A;  3DRN A;  2L5O A;  2YJH A;  2VUP A;  5J3R A;  2HSN B;  2VCW A;  1U87 A;  2HZF A;  2XC2 A;  1QGV A;  1BED A;  5IPG A;  2OE0 A;  1G6W A;  4EUY A;  4HZ4 A;  4I6X A;  5C00 A;  2CZ2 A;  4OO4 A;  5J41 A;  5HR3 A;  1X5C A;  1M2B A;  4ISD A;  8GSS A;  3RDW A;  3R3E A;  4ILF A;  3WGE A;  1OKD A;  5D8I A;  1KBN A;  2L59 A;  3I69 A;  1R7H A;  5ECQ B;  2CAI A;  2A4V A;  4KH7 A;  5GAN D;  2V6K A;  1YKC A;  1TW9 A;  3KEB A;  4JRR A;  2VOC A;  1QXH A;  4PGT A;  5G5F A;  4KDU A;  2H01 A;  4OD7 A;  4WR5 A;  3GRX A;  4RQR A;  3Q18 A;  3ZML A;  2OBK A;  3PR8 A;  1ML6 A;  4FIW A;  2H0H A;  2AV4 A;  1SJ6 A;  1NHO A;  2HSY A;  3GL5 A;  1V40 A;  4TXV A;  4IP6 A;  1PKZ A;  2WFC A;  2H72 A;  3DEX A;  2MMN A;  3IPZ A;  1I9D A;  2PBJ A;  2CVD A;  3IBH A;  4V1A p;  2OA7 A;  3IE3 A;  4MF6 A;  5G2Z A;  1PGT A;  3D0Z A;  5AGY A;  1XW6 A;  1GUK A;  3WT1 A;  3M9K A;  4QL7 A;  4E8H A;  1SYR A;  4ULX A;  3D6I A;  4WF5 A;  3TKR A;  4KND A;  3K8N A;  1GSQ A;  1GSU A;  2CX4 A;  4K7O A;  4POK A;  4J57 E;  4JE1 A;  1ZYE A;  4IEL A;  3GX8 A;  4NPB A;  1DSB A;  3CRT A;  4CW9 A;  2I9H A;  5H5S A;  2LUS A;  3HA9 A;  3TKS A;  1ZYQ B;  5G5E A;  3ISO A;  2R37 A;  1B8X A;  1FO5 A;  1QMV A;  3TB2 A;  2IFQ B;  3KMO A;  2LRC A;  1AQX A;  3ZVJ A;  1E6B A;  1PMT A;  2KLX A;  1SL1 B;  12GS A;  7GSS A;  2HE3 A;  4F0C A;  1F9M A;  2HLS A;  4NAX A;  2RII A;  2C0G A;  5ABR A;  2VO4 A;  2V41 A;  3KTB A;  5D73 A;  2GQM A;  4FO5 A;  1TI1 A;  4JR6 A;  2WCI A;  5KN1 A;  5D9X A;  4DSS B;  5JWQ B;  1SL2 B;  4RI6 A;  3N9J A;  1JZR A;  4OFN A;  5E4W A;  3ZZX A;  4PNG A;  5DJL A;  4GLT A;  2IJY A;  1BX9 A;  3L0H A;  4K0N A;  3A2W A;  5B6M A;  4KAE A;  2YWI A;  5J9C A;  3WYW A;  3NIV A;  2I3Y A;  2GZY A;  2HRK A;  1S3C A;  2PWJ A;  4FYC A;  4EXJ A;  1Z5Y E;  2H1G A;  2ON7 A;  2VCX A;  2FHE A;  5DCH A;  3J7Y k;  2RM6 A;  2DJ0 A;  5CYY A;  2V32 A;  2H1B A;  2LV3 A;  1WE0 A;  1QFN A;  1K0D A;  3G7J A;  3UL3 A;  5ECR B;  4GQF A;  2IWT A;  2XPD A;  5IOW A;  1FVJ A;  2FLS A;  4F0B A;  3H1N A;  3FK8 A;  4IQ1 A;  2PVO C;  5GZZ B;  2VCQ A;  1OC9 B;  2DJK A;  2DMM A;  1HNC A;  3KJY A;  5IMC A;  2KP2 A;  1SKS B;  2DIZ A;  3PPU A;  4PNF A;  2PN8 A;  4ZB8 A;  2C0F A;  4BPY A;  5ECO B;  3LGC A;  19GS A;  4XS4 B;  1BG5 A;  1QQ2 A;  4N0Z A;  1AQV A;  5HR2 A;  1FOV A;  5DDL A;  1A2J A;  4LLR A;  4RUV A;  4DEJ A;  4KX4 A;  3UJ1 A;  1A8L A;  4FYB A;  3KTL A;  2C4J A;  5A5K A;  2F8F A;  4GTU A;  4ZL8 A;  1R4W A;  1U3A A;  2REM A;  4TVE A;  1EV4 A;  3P8W A;  1GUH A;  1B9Y C;  4AJ7 A;  1FB6 A;  5EL8 A;  2L6C A;  1SL0 B;  3HD5 A;  3IAM 2;  3GKK A;  6GSS A;  3ZFB A;  3BCK A;  3O6T A;  4KDY A;  1HNA A;  1GWC A;  5A4U A;  6GSY A;  1AXD A;  2HQT A;  3PGT A;  3AY8 A;  3BD2 A;  5D93 A;  2IMK A;  4NHZ A;  4ZBA A;  2N5A A;  3G7Y A;  4MLY A;  3D4T A;  3RHB A;  4BWS A;  2LST A;  1YEX A;  2P0G A;  4EC0 A;  3F9U A;  3HVX A;  1HYU A;  4KSO A;  1G6Y A;  1W89 A;  3KD0 A;  1A8Y A;  1U3I A;  2VL3 A;  3W8S A;  1UN2 A;  3TRP A;  3C7M A;  2B1K A;  4LL1 B;  3UAP A;  3DD3 A;  4OWY A;  4HU7 A;  2B7J A;  3LXZ A;  5ECS A;  1S3A A;  1EEM A;  2GSQ A;  2CT6 A;  2G2Q A;  5DQS A;  3FR9 A;  1WRY A;  4ECB A;  3GL3 A;  4KGI A;  4V2N A;  2DLX A;  2DML A;  5IMA A;  3EU3 A;  4XRA A;  3KXO A;  4ZIL A;  3EIN A;  1JLV A;  1JLW A;  1XIY A;  1VF2 A;  4L5L A;  2IFQ A;  3V1W A;  4BA7 A;  2Z9S A;  4HDE A;  1JZD A;  3ZRD A;  2X8G A;  2KHP A;  1EV9 A;  4MDC A;  2C3T A;  1TRV A;  4MZW A;  4YQM A;  2YOI A;  4KB3 A;  1F2E A;  3TRQ A;  1R5A A;  4TR1 B;  3JCM L;  1H4O A;  3CXG A;  1OVN A;  4OCF A;  2V2G A;  1O8W A;  1O7U A;  3GIX A;  1KTE A;  4BL7 B;  3QD9 A;  3UBK A;  3KM6 A;  5ECI B;  3GTU A;  4OCE A;  3US3 A;  3LXT A;  1MDI A;  1U6T A;  1SK0 A;  1LU4 A;  5CP1 A;  3IC4 A;  2EIO A;  3LYK A;  4ZBD A;  1Z6M A;  1FW1 A;  1T00 A;  4USS A;  1IYI A;  3UMA A;  4LMW A;  4P3Y B;  5EVO A;  1Q4J A;  4KUN A;  3HCZ A;  2LRN A;  3GH6 A;  2QGV A;  2YZU A;  1X9S B;  3GKX A;  1JZW A;  3PIN A;  4E8E A;  4ECI A;  3HJP A;  3MDK A;  4MPG A;  1FAA A;  2X8C A;  4MJC A;  1TI3 A;  1M99 A;  1B48 A;  1USB A;  2FA8 A;  2GZZ A;  4ECJ A;  4BVX A;  4G19 A;  1B9X C;  2WB9 A;  2RUE A;  3UVH A;  2YCD A;  2A2S A;  2LQQ A;  1XZO A;  5CAX A;  3DGQ A;  1F3A A;  5IOX A;  4XS4 A;  4QQ7 A;  5J5N A;  1TU7 A;  1SK1 A;  1EOG A;  1DE2 A;  1ERT A;  4YQV A;  5ECM B;  1T3B A;  4V1A g;  1BYE A;  13GS A;  5EY6 A;  1G0T A;  5AN1 A;  1V2A A;  3GKN A;  5ECP B;  1PSQ A;  5IIZ A;  1GP1 A;  1EP8 A;  2LS5 A;  1TU8 A;  2ALB A;  1AIU A;  4DSQ A;  1K0M A;  3FEU A;  1K3L A;  2HRK B;  1XW5 A;  2A2R A;  3DWV A;  3ERG A;  1T4Y A;  5G31 A;  1K0C A;  4EE0 A;  5A4W A;  3L4N A;  2R3X A;  3Q6O A;  1XWG A;  1AAZ A;  1UVZ A;  4MK3 A;  1SD8 A;  4EF0 A;  1XOB A;  5G30 A;  2C3Q A;  1XW9 A;  5ECH B;  3FR3 A;  1PKW A;  4PQH A;  2LJK A;  3CMI A;  2VCZ A;  1SKR B;  2IN3 A;  2H30 A;  1GH2 A;  3IK7 A;  4HU9 A;  3QDN A;  2OKA A;  5CRW A;  2B3S A;  5A4V A;  1T4Z A;  2DSA A;  3HKR A;  1TP9 A;  5FWG A;  1EP7 A;  2YWO A;  1AUC A;  5J4U A;  3G7I A;  1B4P A;  6GST A;  2VCT A;  1BQ7 A;  3GUR A;  5ELG A;  2VD1 A;  1FHE A;  5HFK A;  3CBU A;  2GGT A;  5D96 A;  1RW1 A;  1PX6 A;  1ST9 A;  1PQN A;  3TKS E;  3F3Q A;  5DVB A;  5JWR B;  1YF1 A;  2IMI A;  1OKT A;  2OAC A;  1AQW A;  3KH9 A;  2K9F A;  1AW9 A;  4K2D A;  6GSX A;  1I5G A;  1XWK A;  2H71 A;  1PN9 A;  2VL2 C;  4TR4 A;  1TRW A;  1YQ1 A;  4TR1 A;  1Q98 A;  1V98 A;  2TRX A;  5F06 A;  4EDZ A;  4K7I A;  2HRF A;  2H66 A;  2H1A A;  2DBC A;  18GS A;  4BL7 A;  1T1V A;  3ZL5 A;  1XOA A;  4MAB A;  1GL8 A;  5IO2 A;  4QL9 A;  3EWL A; 
#chains in the Genus database with same CATH topology
 2WDU A;  2OE3 A;  2GLR A;  4YAV A;  4MH3 A;  1SU9 A;  5DJM A;  3DVW A;  5HFI A;  1XVQ A;  3F4T A;  1S3D A;  1VF1 A;  4PHZ C;  2FWH A;  1TK5 B;  1W4V A;  4XIH A;  5J40 A;  2VLU A;  1V9W A;  3UOM A;  1HNB A;  1CQH A;  2B5E A;  2WVZ A;  3GH9 A;  2H0I A;  2HFD A;  4N3Z A;  3CTG A;  1HD2 A;  4K7N A;  1ERW A;  3RBT A;  3F8U A;  2VLV A;  4IW9 A;  1OAZ A;  2HXK A;  1WP0 A;  3EC3 A;  1G7O A;  2O8V B;  1K0N A;  1E2Y A;  1PX7 A;  4MF5 A;  3GFK A;  4WR4 A;  2CV4 A;  3IK9 A;  2FWF A;  3KP8 A;  1ZGN A;  1K3O A;  2YV9 A;  3U6V A;  2WRT A;  3M9J A;  4XCS A;  16GS A;  5F07 A;  4WF4 A;  4ZBB A;  1SYX A;  3IXR A;  3BJ5 A;  3GSS A;  5ECK B;  2V1M A;  3D21 A;  1TOF A;  5L71 A;  3E9J B;  1TK8 B;  4DSR A;  2F9S A;  5J4V A;  1T7P B;  2AJQ B;  5KN3 A;  3BOA A;  3GTU B;  4YH2 A;  2MZC A;  3QFA C;  4MA9 A;  1YJ6 A;  2ZCT A;  3EE2 A;  4O7H A;  1X5D A;  4Q5N A;  2HI7 A;  3EUR A;  5B8B A;  5IMF A;  2NTO A;  3TGZ A;  1MEK A;  4KCE A;  4I5Q A;  2LKU A;  2X99 A;  2PER A;  1LBK A;  3FYG A;  3FHK A;  1FVK A;  4NXI A;  2H76 A;  4TR3 A;  4AKI A;  5ECL B;  1EGR A;  5H5Q A;  4AJ6 A;  2DJ2 A;  3EYT A;  1PD2 1;  4BVX B;  2F51 A;  1YDK A;  3FR6 A;  1PL1 A;  3DXB A;  3A3T A;  2CZ3 A;  3VWW A;  5EPF A;  3L9U A;  3HJO A;  1A24 A;  3TJF A;  2E2G A;  2OBI A;  2CVK A;  4TN8 A;  1XPV A;  4Z2U A;  2VM2 A;  1PN0 A;  1K0B A;  2YJ7 A;  1X5E A;  2R0P A;  1Z6N A;  2YV7 A;  4I8B A;  6GSU A;  2JU5 A;  2I4A A;  4IQA A;  10GS A;  3E0U A;  4HEA 2;  3IV4 A;  3F4S A;  3FRC A;  2HZE A;  1GSE A;  2X8H A;  1OE8 A;  4EIP A;  3IA1 A;  3GX0 A;  4Q5Q A;  1JHB A;  3WT2 A;  5JCG A;  3SBC A;  3MYD A;  3CRU A;  2AHE A;  3HVV A;  4POM A;  2LNS A;  4Z2T A;  4OFT A;  3KGK A;  1J9B A;  4YAP A;  5IMV A;  1GTA A;  1PRX A;  5GAP D;  1GUL A;  2KP1 A;  1TTZ A;  5B7C A;  3BCI A;  1U88 A;  1URM A;  1DBY A;  4MH2 A;  3DML A;  1A23 A;  1VF4 A;  3HJM A;  1YZX A;  2VLT A;  1OYJ A;  4L0W A;  1KNG A;  4K8M A;  4TOP A;  3ZRE A;  1THO A;  4LL4 B;  1UC7 A;  4G0I A;  3CSJ A;  3TUE A;  4JR4 A;  1M9B A;  3TJB A;  4PUA A;  3TJK A;  3GN3 A;  3M3M A;  5B8A A;  1WIK A;  2ON5 A;  1ACV A;  3FZA A;  5FHI A;  2QKE A;  2FCH A;  2LJA A;  2WUL A;  4N10 A;  2O5V A;  4WET A;  4FQU A;  4J2F A;  5IM9 A;  2GSR A;  3MAK A;  5HR0 A;  5IMZ A;  1XBS A;  4AJ8 A;  1MD3 A;  2HRA A;  4MJB A;  2C3N A;  2FUG 2;  4N11 A;  4O92 A;  3RAZ A;  3C1S A;  4IVF A;  2MBS A;  2HYX A;  3WGX A;  3F6D A;  1OE7 A;  1TDI A;  3ZTL A;  2NVL A;  2K6V A;  4I97 A;  2LJR A;  4BVY B;  4IBP A;  5JCW A;  5INY A;  2JZS A;  3W6G A;  2DJ1 A;  2BJX A;  2CVB A;  2EIR A;  2FA4 A;  1BAY A;  4L8E A;  2L5L A;  4N0V A;  4WEY A;  3PH9 A;  2K18 A;  2GST A;  3APS A;  3RGB C;  2VD0 A;  1N8J A;  1QK8 A;  1X9W B;  5DCG A;  3H8Q A;  2WS2 A;  1GSF A;  2H6Z A;  2GQL A;  3TKS C;  3ZYW A;  3LG6 A;  3LOR A;  1NHY A;  2B7K A;  1CQG A;  4G9H A;  5ELA A;  1M2D A;  4ZXG A;  5C04 A;  3A2V A;  2XBQ A;  2DIY A;  1K3Y A;  2N5F A;  5DAL B;  2MMA A;  4IHU A;  1EOH A;  2A2P A;  1Y6E A;  1QUW A;  3KIJ A;  5CO3 A;  2ZUP A;  2P5Q A;  2WW3 A;  3VFI A;  4PTS A;  1XCC A;  3QR6 A;  4O5Q A;  4OO5 A;  3D4M A;  3GMF A;  2IIY A;  4ML6 A;  4G0L A;  4MP4 A;  4KA0 A;  4ZB7 A;  1O73 A;  4TXO B;  4JBB A;  1TRU A;  2JAC A;  3P90 A;  1I1I P;  3ZVJ D;  4GF0 A;  2R5G A;  5B6N A;  4DVC A;  17GS A;  2HSM B;  3S9F A;  3VWV A;  3I9V 2;  2L4C A;  2OT3 A;  1MD4 A;  4GXZ A;  2R2J A;  2VAF A;  3HZ8 A;  1V58 A;  4HS1 A;  4ZL7 A;  2J23 A;  4HI7 A;  3C71 A;  3LFL A;  4L5O A;  4PQ1 A;  2IL3 A;  1TRS A;  2FNO A;  2R4V A;  1JZO A;  1O85 A;  3F3R A;  1VGL A;  3U5R E;  5LNK e;  3EPT A;  3VUR A;  3HXS A;  2FY6 A;  1F6M C;  1ABA A;  2WZ9 A;  2HNL A;  1S4B P;  2B5X A;  4K5S A;  1ERU A;  4EO3 A;  4WBJ A;  1Z3E A;  2GZP A;  4LA1 A;  4O5R A;  2XPE A;  5IO0 A;  3LW9 A;  3VPQ A;  4V2M A;  4GRF A;  1GLP A;  3A5W A;  3ZFL A;  3G9B A;  2JL4 A;  3LJR A;  1THX A;  4G01 A;  3VLN A;  4MF7 A;  3UVT A;  2C1Y A;  1EGO A;  4CHS A;  4YQU A;  3NOF A;  1Y1U A;  2O89 A;  4OMV A;  3DIE A;  1J0F A;  1BJX A;  4YKF A;  2E0Q A;  3IRA A;  4I2U A;  4GST A;  4KSM A;  5LCZ A;  4W66 A;  4MJA A;  3GST A;  4ACS A;  3GKM A;  5F05 A;  3M8N A;  4IKH A;  1YKA A;  3J7Y b;  5IMD A;  4ID0 A;  4AF2 A;  3DYR A;  3D5J A;  2KOK A;  2GT6 A;  4NMU A;  2UZ8 A;  4POB A;  4F82 A;  4MZB A;  5G1K A;  2H8L A;  3BBY A;  4NV2 A;  5ID2 B;  4Q5F A;  3QMX A;  2PPT A;  4CY6 A;  5KN0 A;  2C80 A;  3CSI A;  2LEG A;  3DKS A;  2AB6 A;  3Q74 A;  3TOU A;  3C73 A;  3O3T A;  2YPM A;  2OJL A;  4MZC A;  4ZL9 A;  1N25 A;  1AC1 A;  1V57 A;  4XS6 A;  2OE1 A;  2P31 A;  3OR5 A;  4PXO A;  2WVX B;  1A0F A;  4AKH A;  1EEJ A;  3MSZ A;  2IMF A;  3FY7 A;  2HZE B;  4X43 A;  4PUF C;  4ECC A;  4WXT A;  1M0U A;  3ERW A;  4BVY A;  6GSV A;  3QAV A;  4TRX A;  2HRN A;  2YWN A;  2G0F A;  3ZIT A;  2H73 A;  4X0X A;  5A5H B;  1XWA A;  5BMU B;  3TJJ A;  2XHF A;  3QPM A;  5DAK A;  2MBT A;  2EFE A;  2GTU A;  2RLI A;  4NWY A;  3D22 A;  5KEJ A;  2AAW A;  2BMX A;  1OC8 A;  1WPI A;  2RUF A;  5IQY A;  3HY2 A;  2DC5 A;  1WJK A;  6GSW A;  1FOH A;  3HVS A;  3TJG A;  2J9H A;  2D2Z A;  2PU9 C;  2CQ9 A;  3I6A A;  4ZB9 A;  2FWE A;  3TOT A;  4XHM A;  2VM1 A;  5DAL A;  2H70 A;  1M9A A;  3R2Q A;  1GLQ A;  4F2I A;  4RQX A;  2JAD A;  3KZQ A;  2H74 A;  1K0A A;  1GSS A;  3UIW A;  5AIX A;  4JZQ A;  3TU3 B;  4MPF A;  2H0G A;  1RK4 A;  5D9V A;  4F03 A;  1MTC A;  3FZ4 A;  4MCU A;  4JED A;  3M1G A;  1NM3 A;  4FH8 A;  1F37 A;  1M3J A;  4K1F A;  4TXO A;  1EWX A;  5GSS A;  1TXX A;  2C0E A;  4V2L A;  2WJU A;  3VI7 A;  2FD3 A;  2M72 A;  1C72 A;  3TKP A;  2YP6 A;  2LRT A;  2L57 A;  1H75 A;  1SJZ A;  3ME7 A;  2HSM A;  2K8S A;  2KUC A;  4Z2R A;  3P2A A;  3SWL A;  3EMP A;  3QFB C;  4K6X A;  2YZH A;  3UAR A;  1GNE A;  1GTU A;  5J9B A;  3L78 A;  3MNG A;  1M7T A;  3TCO A;  1O8X A;  1R5P A;  4IJ3 A;  1JFU A;  2PGT A;  1MDK A;  1MDJ A;  4HQZ A;  3RHC A;  1A0R P;  2NPB A;  2GSS A;  4WKW A;  4E68 A;  4GQC A;  4EDY A;  4HUA A;  5D9W A;  5F0G A;  2H19 A;  3W8J A;  3EU4 A;  2ZNM A;  3IOS A;  2ES7 A;  2GQK A;  14GS A;  3GV1 A;  1SEN A;  4PQI A;  4YKG A;  2V6O A;  4PUR A;  1XG8 A;  4XRD A;  2B6M A;  2JSY A;  2C0D A;  4O5U A;  5G1L A;  2R6K A;  2IME A;  3H4K A;  2PUK C;  1GRX A;  2LQO A;  22GS A;  3C8E A;  3KMN A;  4K9Z A;  2PVQ A;  3DVX A;  4FYU A;  4ML1 A;  2GDR A;  1RQM A;  1WOU A;  3H79 A;  3MWH A;  1ILO A;  1WMJ A;  5H5R A;  2O7K A;  3KP9 A;  2M46 A;  2H6Y A;  2QC7 A;  4GWR A;  2RM5 A;  3L9S A;  2BTO T;  2QA2 A;  20GS A;  4AKX B;  3WD6 A;  2B5Y A;  5FT3 A;  5ID2 A;  4D73 B;  1K0O A;  3UEM A;  3L9V A;  3FZ5 A;  2YWM A;  3F6F A;  1VF3 A;  1PL2 A;  1TKD B;  2O85 A;  2NBS A;  2HSN A;  1GUM A;  4Q5R A;  1ZOF A;  1ZYP A;  3MIX A;  1IYH A;  1UA5 A;  2K8V A;  1J08 A;  3GYK A;  1GTI A;  3P7X A;  1GNW A;  3O76 A;  2WVX A;  4RI7 A;  2NDO A;  5BRT A;  1O81 A;  3NZN A;  4EVM A;  2QSI A;  1NW2 A;  3KH7 A;  3EMX A;  4J56 E;  2O87 A;  4G10 A;  2LNT A;  2IPA A;  5HQP A;  1A2M A;  1GSY A;  2MYG A;  4CDO A;  2TIR A;  5A5H A;  1TJD A;  4H86 A;  2B1L A;  5BMU A;  2CA8 A;  2IMD A;  2YN1 A;  4I2T A;  4AKG A;  2MMZ A;  3GHA A;  2WW2 A;  2VL9 A;  5GST A;  3IHQ A;  1PA3 A;  4KF9 A;  3IR4 A;  1KEB A;  2VCV A;  5CRG A;  1X9M B;  1ZMA A;  2DJJ A;  4Z7X A;  2L6D A;  1Z7P A;  4IN0 A;  1TK0 B;  2N5B A;  5F8B A;  4KE3 A;  1ZYN A;  1FB0 A;  5KN2 A;  1DUG A;  3CTF A;  1DE1 A;  3QAG A;  1N2A A;  4L0U A;  4EL1 A;  1F3B A;  2DJ3 A;  3VK9 A;  2LTK A;  3IC8 A;  4EKZ A;  4N30 A;  5HR1 A;  2JZR A;  5E59 A;  3M0F A;  4IJI A;  1WWJ A;  2JSZ A;  2L4Q A;  4AI6 A;  4K5R A;  5HFG A;  1A2L A;  2I81 A;  3RPN A;  1X0R A;  2JZT A;  2C8U A;  4MMM A;  4K0G A;  2GVP A;  3VPT A;  3HVN A;  2EIQ A;  1Z7R A;  5D9T A;  1SK2 A;  4LMV A;  3HZ4 A;  3QCP A;  4XS1 A;  3ZIV A;  4PI0 C;  3F0I A;  2P5R A;  2CX3 A;  4HJ2 A;  2VL2 A;  4TR0 A;  2XBI A;  2I1U A;  1XWC A;  3RFR C;  3RPP A;  3FZ9 A;  4F9Z A;  5DAK B;  3HYP A;  3APO A;  2R0G A;  4PX1 A;  4X1U A;  1NSW A;  4HZ2 A;  3GUS A;  5JCU A;  1TXU A;  4IGJ A;  4A5P A;  11GS A;  3QOU A;  4G0K A;  4POL A;  3ERF A;  3A2X A;  5DQY A;  3FW2 A;  3WGD A;  1XFL A;  3A5I A;  4MJE A;  3CQF A;  1YEW C;  3IAS 2;  3APQ A;  2M80 A;  1SKW B;  3ED3 A;  1GTB A;  2FGX A;  2O3E A;  2E7P A;  4AGS A;  4NV5 A;  4DSS A;  4NHW A;  2MMO A;  1XVW A;  1LJR A;  4KW6 A;  3ZMK A;  2WVY A;  4O32 A;  3N5O A;  2CAQ A;  2GT5 A;  4BWQ A;  4IS0 A;  1XWB A;  3EVI A;  4TW5 A;  4OFM A;  2X64 A;  3Q19 A;  3GNJ A;  2WGR A;  1YY7 A;  3ZLP A;  3VI5 A;  4GCI A;  4IP1 A;  2HSH A;  3CSH A;  2F8A A;  1EZK A;  1GSD A;  4EIQ A;  3TDG A;  1G7E A;  1ZCP A;  3CYN A;  5COH A;  9GSS A;  3VWU A;  4D73 A;  1SVO A;  2YNX A;  2PMT A;  3GA4 A;  5ECN B;  3TRX A;  2FWG A;  5DBQ A;  2F3M A;  3LYP A;  2E2M A;  4TKY A;  3VWX A;  5CRH A;  5KOW A;  3LQ7 A;  3F63 A;  2AYT A;  1OC9 A;  2HT9 A;  3HDC A;  1B4Q A;  3IDV A;  1O6J A;  3ZIJ A;  4JU5 A;  4GSS A;  5CRE A;  1XXU A;  5CRD A;  2GS3 A;  3C1R A;  2TRC P;  4HOJ A;  1R26 A;  3I43 A;  4HJM A;  3F4R A;  1VRS D;  1T8E B;  2AUV A;  3TKQ A;  1FG4 A;  1HQO A;  4ZB6 A;  2H6X A;  3H93 A;  2H1D A;  5ENU A;  4HSC X;  2YAN A;  2VIM A;  3QAW A;  4ZIJ A;  3FKF A;  4HQS A;  3LSZ A;  4FXY P;  1YEP A;  1ZL9 A;  3HHV A;  1ERV A;  4XTS A;  3ME8 A;  2H75 A;  2OAD A;  5CNW A;  3UBL A;  5LD0 A;  4KDX A;  1OC3 A;  1SJI A;  1Y25 A;  1M3I A;  3KCM A;  4GSN A;  1ON4 A;  3LEF A;  5AIS A;  5IPH A;  1SD9 A;  4KCA A;  1ZZY A;  1YF0 A;  5JWO B;  3LWA A;  4WBR D;  3E3E A;  4G2E A;  1Z9H A;  5AIV A;  1M2A A;  2EC4 A;  3DRN A;  2L5O A;  2YJH A;  2VUP A;  5J3R A;  2HSN B;  2VCW A;  1YVL A;  1U87 A;  2HZF A;  2XC2 A;  1QGV A;  1BED A;  5IPG A;  2OE0 A;  1G6W A;  4EUY A;  4HZ4 A;  4I6X A;  5C00 A;  2CZ2 A;  4OO4 A;  5J41 A;  5HR3 A;  1X5C A;  1M2B A;  4ISD A;  8GSS A;  3RDW A;  3R3E A;  4ILF A;  3WGE A;  1OKD A;  5D8I A;  4BIK A;  1KBN A;  2L59 A;  3I69 A;  1R7H A;  5ECQ B;  2CAI A;  2A4V A;  4KH7 A;  5GAN D;  2V6K A;  1YKC A;  1TW9 A;  3KEB A;  4JRR A;  2VOC A;  1QXH A;  4PGT A;  5G5F A;  4KDU A;  2H01 A;  4OD7 A;  4WR5 A;  3GRX A;  4RQR A;  3Q18 A;  3ZML A;  2OBK A;  3PR8 A;  1ML6 A;  4FIW A;  2H0H A;  2AV4 A;  1SJ6 A;  1NHO A;  2HSY A;  3GL5 A;  1V40 A;  4TXV A;  4IP6 A;  1PKZ A;  2WFC A;  2H72 A;  3DEX A;  2EFD A;  2MMN A;  3IPZ A;  1I9D A;  2PBJ A;  2CVD A;  2VKZ G;  3IBH A;  4V1A p;  2OA7 A;  3IE3 A;  4MF6 A;  5G2Z A;  1PGT A;  3D0Z A;  5AGY A;  1XW6 A;  1GUK A;  3WT1 A;  3M9K A;  4QL7 A;  4E8H A;  1SYR A;  4ULX A;  5A1N B;  3D6I A;  4WF5 A;  3TKR A;  4KND A;  3K8N A;  1GSQ A;  1GSU A;  2CX4 A;  4K7O A;  4POK A;  4J57 E;  4JE1 A;  1ZYE A;  4IEL A;  3GX8 A;  4NPB A;  1DSB A;  3CRT A;  4CW9 A;  2I9H A;  5H5S A;  2LUS A;  3HA9 A;  3TKS A;  1ZYQ B;  5G5E A;  3ISO A;  2R37 A;  4X4J A;  1B8X A;  2QA1 A;  1FO5 A;  1QMV A;  3TB2 A;  2IFQ B;  3KMO A;  2LRC A;  1AQX A;  3ZVJ A;  1E6B A;  1PMT A;  2KLX A;  1SL1 B;  12GS A;  7GSS A;  2HE3 A;  4F0C A;  1F9M A;  2HLS A;  4NAX A;  2RII A;  2C0G A;  5ABR A;  2VO4 A;  2V41 A;  3KTB A;  5D73 A;  2GQM A;  1BF5 A;  4FO5 A;  1TI1 A;  3FMW A;  4JR6 A;  2WCI A;  5KN1 A;  5D9X A;  4DSS B;  5JWQ B;  1SL2 B;  4RI6 A;  1JZR A;  3N9J A;  4OFN A;  5E4W A;  3ZZX A;  4PNG A;  5DJL A;  4GLT A;  2IJY A;  1BX9 A;  3L0H A;  4K0N A;  3A2W A;  5B6M A;  4KAE A;  2YWI A;  5J9C A;  1S3R A;  3WYW A;  3NIV A;  4K2X A;  2I3Y A;  2GZY A;  2HRK A;  1S3C A;  2PWJ A;  4FYC A;  4EXJ A;  1Z5Y E;  2H1G A;  2ON7 A;  2VCX A;  2FHE A;  5DCH A;  3J7Y k;  2RM6 A;  2H1L A;  2DJ0 A;  5CYY A;  2V32 A;  2H1B A;  2LV3 A;  1WE0 A;  1QFN A;  1K0D A;  3G7J A;  2R0C A;  3UL3 A;  5ECR B;  4GQF A;  2IWT A;  2XPD A;  5IOW A;  1FVJ A;  2FLS A;  4F0B A;  3H1N A;  3FK8 A;  4IQ1 A;  2PVO C;  5GZZ B;  2VCQ A;  1OC9 B;  2DJK A;  2DMM A;  1HNC A;  3KJY A;  5IMC A;  2KP2 A;  1SKS B;  4CY8 A;  2DIZ A;  3PPU A;  4PNF A;  2PN8 A;  4ZB8 A;  2C0F A;  4BPY A;  5ECO B;  3LGC A;  19GS A;  4XS4 B;  1BG5 A;  1QQ2 A;  4N0Z A;  1AQV A;  5HR2 A;  1FOV A;  5DDL A;  1A2J A;  4LLR A;  4RUV A;  4DEJ A;  4KX4 A;  3UJ1 A;  1A8L A;  4FYB A;  3KTL A;  2C4J A;  5A5K A;  2F8F A;  4GTU A;  4ZL8 A;  1R4W A;  1U3A A;  2REM A;  4TVE A;  1EV4 A;  3P8W A;  1GUH A;  1B9Y C;  4AJ7 A;  1FB6 A;  5EL8 A;  2L6C A;  1SL0 B;  3HD5 A;  3IAM 2;  3GKK A;  6GSS A;  3ZFB A;  3BCK A;  3O6T A;  4KDY A;  1HNA A;  1GWC A;  5A4U A;  6GSY A;  1AXD A;  1PFO A;  1SVM A;  2HQT A;  3PGT A;  3AY8 A;  3BD2 A;  5D93 A;  2IMK A;  4NHZ A;  4ZBA A;  2N5A A;  3G7Y A;  4MLY A;  3D4T A;  3RHB A;  4BWS A;  2LST A;  1YEX A;  2P0G A;  4EC0 A;  3F9U A;  3HVX A;  1HYU A;  4KSO A;  1G6Y A;  1W89 A;  3KD0 A;  1A8Y A;  1U3I A;  2VL3 A;  5A1N A;  3W8S A;  1UN2 A;  3TRP A;  3C7M A;  2B1K A;  4LL1 B;  3UAP A;  3DD3 A;  4OWY A;  2DKH A;  4HU7 A;  2B7J A;  3LXZ A;  5ECS A;  1S3A A;  1EEM A;  2GSQ A;  2CT6 A;  2G2Q A;  5DQS A;  3FR9 A;  1WRY A;  2EFH A;  4ECB A;  3GL3 A;  4KGI A;  4V2N A;  2DLX A;  5A34 B;  2DML A;  5IMA A;  3EU3 A;  4XRA A;  3KXO A;  4ZIL A;  3EIN A;  1JLV A;  1JLW A;  1XIY A;  1VF2 A;  4L5L A;  2IFQ A;  3V1W A;  4BA7 A;  2Z9S A;  2A4H A;  4HDE A;  1JZD A;  3ZRD A;  2X8G A;  2KHP A;  1EV9 A;  4MDC A;  2C3T A;  1TRV A;  4MZW A;  4YQM A;  3HMJ G;  2YOI A;  4KB3 A;  1F2E A;  3TRQ A;  1R5A A;  4TR1 B;  3JCM L;  1H4O A;  3CXG A;  1OVN A;  4OCF A;  2V2G A;  2O36 A;  1O8W A;  1O7U A;  3GIX A;  1KTE A;  4BL7 B;  3QD9 A;  3UBK A;  3KM6 A;  5ECI B;  2WZS A;  3GTU A;  4OCE A;  3US3 A;  3LXT A;  2EFC A;  1MDI A;  1U6T A;  1SK0 A;  1LU4 A;  5CP1 A;  3IC4 A;  2EIO A;  3LYK A;  1BG1 A;  4ZBD A;  4ICY A;  1Z6M A;  1FW1 A;  1T00 A;  4USS A;  1IYI A;  3UMA A;  4LMW A;  4P3Y B;  5EVO A;  1Q4J A;  4KUN A;  3HCZ A;  2LRN A;  3GH6 A;  3IHG A;  5J47 A;  2QGV A;  2YZU A;  1X9S B;  3GKX A;  1JZW A;  3PIN A;  3CWG A;  4E8E A;  2X4A A;  4ECI A;  3HJP A;  3MDK A;  4MPG A;  1FAA A;  2X8C A;  4MJC A;  1TI3 A;  1M99 A;  1B48 A;  1USB A;  2FA8 A;  2GZZ A;  4ECJ A;  4BVX A;  4QMK A;  4G19 A;  1B9X C;  2WB9 A;  2RUE A;  3UVH A;  2YCD A;  2A2S A;  2LQQ A;  1XZO A;  5CAX A;  3DGQ A;  1F3A A;  5IOX A;  4XS4 A;  4QQ7 A;  5J5N A;  1TU7 A;  1SK1 A;  1EOG A;  2DKI A;  1DE2 A;  1ERT A;  4YQV A;  5ECM B;  1T3B A;  4V1A g;  1BYE A;  13GS A;  5EY6 A;  1G0T A;  5AN1 A;  1V2A A;  3GKN A;  5ECP B;  1PSQ A;  5IIZ A;  1GP1 A;  1EP8 A;  2LS5 A;  1TU8 A;  2ALB A;  1AIU A;  4DSQ A;  1K0M A;  3FEU A;  1K3L A;  2HRK B;  1XW5 A;  2A2R A;  3DWV A;  1SVL A;  3ERG A;  3CHX C;  5J4Y A;  1T4Y A;  5G31 A;  1K0C A;  4EE0 A;  5A4W A;  4PI2 C;  3L4N A;  2R3X A;  3Q6O A;  1XWG A;  1AAZ A;  2WW0 A;  1UVZ A;  4MK3 A;  2X49 A;  1SD8 A;  4EF0 A;  1XOB A;  5G30 A;  2C3Q A;  1XW9 A;  5ECH B;  3FR3 A;  1PKW A;  4PQH A;  2LJK A;  3CMI A;  2VCZ A;  1SKR B;  2IN3 A;  2H30 A;  1GH2 A;  3IK7 A;  4HU9 A;  2WW1 A;  3QDN A;  2OKA A;  5CRW A;  2B3S A;  5A4V A;  1T4Z A;  2DSA A;  3HKR A;  1TP9 A;  5FWG A;  1EP7 A;  5A34 A;  2YWO A;  1AUC A;  5J4U A;  3G7I A;  1B4P A;  6GST A;  2VCT A;  1BQ7 A;  3GUR A;  5ELG A;  2VD1 A;  1FHE A;  5HFK A;  3CBU A;  2GGT A;  5D96 A;  1RW1 A;  1PX6 A;  1ST9 A;  1PQN A;  3TKS E;  2UV8 G;  3F3Q A;  5DVB A;  5JWR B;  1YF1 A;  2IMI A;  1OKT A;  2OAC A;  4GDF A;  1AQW A;  3KH9 A;  2K9F A;  1AW9 A;  4K2D A;  6GSX A;  4MNN A;  1I5G A;  1XWK A;  2H71 A;  1PN9 A;  2VL2 C;  4TR4 A;  1TRW A;  1YQ1 A;  4TR1 A;  1Q98 A;  1V98 A;  2TRX A;  5F06 A;  4EDZ A;  4K7I A;  2HRF A;  2H66 A;  2H1A A;  2DBC A;  18GS A;  4BL7 A;  1T1V A;  3ZL5 A;  1XOA A;  4MAB A;  5KOX A;  1GL8 A;  5IO2 A;  4QL9 A;  3EWL A; 
#chains in the Genus database with same CATH homology
 2WDU A;  2OE3 A;  2GLR A;  4YAV A;  4MH3 A;  1SU9 A;  5DJM A;  3DVW A;  5HFI A;  1XVQ A;  3F4T A;  1S3D A;  1VF1 A;  2FWH A;  1TK5 B;  1W4V A;  4XIH A;  5J40 A;  2VLU A;  1V9W A;  3UOM A;  1HNB A;  1CQH A;  2B5E A;  3GH9 A;  2H0I A;  2HFD A;  4N3Z A;  3CTG A;  1HD2 A;  4K7N A;  1ERW A;  3RBT A;  3F8U A;  2VLV A;  4IW9 A;  1OAZ A;  2HXK A;  1WP0 A;  3EC3 A;  1G7O A;  2O8V B;  1K0N A;  1E2Y A;  1PX7 A;  4MF5 A;  3GFK A;  4WR4 A;  2CV4 A;  3IK9 A;  2FWF A;  3KP8 A;  1ZGN A;  1K3O A;  2YV9 A;  3U6V A;  2WRT A;  3M9J A;  4XCS A;  16GS A;  5F07 A;  4WF4 A;  4ZBB A;  1SYX A;  3IXR A;  3BJ5 A;  3GSS A;  5ECK B;  2V1M A;  3D21 A;  1TOF A;  5L71 A;  3E9J B;  1TK8 B;  4DSR A;  2F9S A;  5J4V A;  1T7P B;  2AJQ B;  5KN3 A;  3BOA A;  3GTU B;  4YH2 A;  2MZC A;  3QFA C;  4MA9 A;  1YJ6 A;  2ZCT A;  3EE2 A;  4O7H A;  1X5D A;  4Q5N A;  2HI7 A;  3EUR A;  5B8B A;  5IMF A;  2NTO A;  3TGZ A;  1MEK A;  4KCE A;  4I5Q A;  2LKU A;  2X99 A;  2PER A;  1LBK A;  3FYG A;  3FHK A;  1FVK A;  4NXI A;  2H76 A;  4TR3 A;  4AKI A;  5ECL B;  1EGR A;  5H5Q A;  4AJ6 A;  2DJ2 A;  3EYT A;  1PD2 1;  4BVX B;  2F51 A;  1YDK A;  3FR6 A;  1PL1 A;  3DXB A;  3A3T A;  2CZ3 A;  3VWW A;  5EPF A;  3L9U A;  3HJO A;  1A24 A;  3TJF A;  2E2G A;  2OBI A;  2CVK A;  4TN8 A;  1XPV A;  4Z2U A;  2VM2 A;  1PN0 A;  1K0B A;  2YJ7 A;  1X5E A;  2R0P A;  1Z6N A;  2YV7 A;  4I8B A;  6GSU A;  2JU5 A;  2I4A A;  4IQA A;  10GS A;  3E0U A;  4HEA 2;  3IV4 A;  3F4S A;  3FRC A;  2HZE A;  1GSE A;  2X8H A;  1OE8 A;  4EIP A;  3IA1 A;  3GX0 A;  4Q5Q A;  1JHB A;  3WT2 A;  5JCG A;  3SBC A;  3MYD A;  3CRU A;  2AHE A;  3HVV A;  4POM A;  2LNS A;  4Z2T A;  4OFT A;  3KGK A;  1J9B A;  4YAP A;  5IMV A;  1GTA A;  1PRX A;  5GAP D;  1GUL A;  2KP1 A;  1TTZ A;  5B7C A;  3BCI A;  1U88 A;  1URM A;  1DBY A;  4MH2 A;  3DML A;  1A23 A;  1VF4 A;  3HJM A;  1YZX A;  2VLT A;  1OYJ A;  4L0W A;  1KNG A;  4K8M A;  4TOP A;  3ZRE A;  1THO A;  4LL4 B;  1UC7 A;  4G0I A;  3CSJ A;  3TUE A;  4JR4 A;  1M9B A;  3TJB A;  4PUA A;  3TJK A;  3GN3 A;  3M3M A;  5B8A A;  1WIK A;  2ON5 A;  1ACV A;  3FZA A;  5FHI A;  2QKE A;  2FCH A;  2LJA A;  2WUL A;  4N10 A;  2O5V A;  4WET A;  4FQU A;  4J2F A;  5IM9 A;  2GSR A;  3MAK A;  5HR0 A;  5IMZ A;  1XBS A;  4AJ8 A;  1MD3 A;  2HRA A;  4MJB A;  2C3N A;  2FUG 2;  4N11 A;  4O92 A;  3RAZ A;  3C1S A;  4IVF A;  2MBS A;  2HYX A;  3WGX A;  3F6D A;  1OE7 A;  1TDI A;  3ZTL A;  2NVL A;  2K6V A;  4I97 A;  2LJR A;  4BVY B;  4IBP A;  5JCW A;  5INY A;  2JZS A;  3W6G A;  2DJ1 A;  2BJX A;  2CVB A;  2EIR A;  2FA4 A;  1BAY A;  4L8E A;  2L5L A;  4N0V A;  4WEY A;  3PH9 A;  2K18 A;  2GST A;  3APS A;  2VD0 A;  1N8J A;  1QK8 A;  1X9W B;  5DCG A;  3H8Q A;  2WS2 A;  1GSF A;  2H6Z A;  2GQL A;  3TKS C;  3ZYW A;  3LG6 A;  3LOR A;  1NHY A;  2B7K A;  1CQG A;  4G9H A;  5ELA A;  1M2D A;  4ZXG A;  5C04 A;  3A2V A;  2XBQ A;  2DIY A;  1K3Y A;  2N5F A;  5DAL B;  2MMA A;  4IHU A;  1EOH A;  2A2P A;  1Y6E A;  1QUW A;  3KIJ A;  5CO3 A;  2ZUP A;  2P5Q A;  3VFI A;  4PTS A;  1XCC A;  3QR6 A;  4O5Q A;  4OO5 A;  3D4M A;  3GMF A;  2IIY A;  4ML6 A;  4G0L A;  4MP4 A;  4KA0 A;  4ZB7 A;  1O73 A;  4TXO B;  4JBB A;  1TRU A;  2JAC A;  3P90 A;  3ZVJ D;  4GF0 A;  2R5G A;  5B6N A;  4DVC A;  17GS A;  2HSM B;  3S9F A;  3VWV A;  3I9V 2;  2L4C A;  2OT3 A;  1MD4 A;  4GXZ A;  2R2J A;  2VAF A;  3HZ8 A;  1V58 A;  4HS1 A;  4ZL7 A;  2J23 A;  4HI7 A;  3C71 A;  3LFL A;  4L5O A;  4PQ1 A;  2IL3 A;  1TRS A;  2FNO A;  2R4V A;  1JZO A;  1O85 A;  3F3R A;  1VGL A;  3U5R E;  5LNK e;  3EPT A;  3VUR A;  3HXS A;  2FY6 A;  1F6M C;  1ABA A;  2WZ9 A;  2HNL A;  2B5X A;  4K5S A;  1ERU A;  4EO3 A;  4WBJ A;  1Z3E A;  2GZP A;  4LA1 A;  4O5R A;  2XPE A;  5IO0 A;  3LW9 A;  3VPQ A;  4V2M A;  4GRF A;  1GLP A;  3A5W A;  3ZFL A;  3G9B A;  2JL4 A;  3LJR A;  1THX A;  4G01 A;  3VLN A;  4MF7 A;  3UVT A;  2C1Y A;  1EGO A;  4CHS A;  4YQU A;  3NOF A;  1Y1U A;  2O89 A;  4OMV A;  3DIE A;  1J0F A;  1BJX A;  4YKF A;  2E0Q A;  3IRA A;  4I2U A;  4GST A;  4KSM A;  5LCZ A;  4W66 A;  4MJA A;  3GST A;  4ACS A;  3GKM A;  5F05 A;  3M8N A;  4IKH A;  1YKA A;  3J7Y b;  5IMD A;  4ID0 A;  4AF2 A;  3DYR A;  3D5J A;  2KOK A;  2GT6 A;  4NMU A;  2UZ8 A;  4POB A;  4F82 A;  4MZB A;  5G1K A;  2H8L A;  3BBY A;  4NV2 A;  5ID2 B;  4Q5F A;  3QMX A;  2PPT A;  4CY6 A;  5KN0 A;  2C80 A;  3CSI A;  2LEG A;  3DKS A;  2AB6 A;  3Q74 A;  3TOU A;  3C73 A;  3O3T A;  2YPM A;  2OJL A;  4MZC A;  4ZL9 A;  1N25 A;  1AC1 A;  1V57 A;  4XS6 A;  2OE1 A;  2P31 A;  3OR5 A;  4PXO A;  1A0F A;  4AKH A;  1EEJ A;  3MSZ A;  2IMF A;  3FY7 A;  2HZE B;  4X43 A;  4PUF C;  4ECC A;  4WXT A;  1M0U A;  3ERW A;  4BVY A;  6GSV A;  3QAV A;  4TRX A;  2HRN A;  2YWN A;  2G0F A;  3ZIT A;  2H73 A;  4X0X A;  5A5H B;  1XWA A;  5BMU B;  3TJJ A;  2XHF A;  3QPM A;  5DAK A;  2MBT A;  2EFE A;  2GTU A;  2RLI A;  4NWY A;  3D22 A;  5KEJ A;  2AAW A;  2BMX A;  1OC8 A;  1WPI A;  2RUF A;  5IQY A;  3HY2 A;  2DC5 A;  1WJK A;  6GSW A;  1FOH A;  3HVS A;  3TJG A;  2J9H A;  2D2Z A;  2PU9 C;  2CQ9 A;  3I6A A;  4ZB9 A;  2FWE A;  3TOT A;  4XHM A;  2VM1 A;  5DAL A;  2H70 A;  1M9A A;  3R2Q A;  1GLQ A;  4F2I A;  4RQX A;  2JAD A;  3KZQ A;  2H74 A;  1K0A A;  1GSS A;  3UIW A;  5AIX A;  4JZQ A;  3TU3 B;  4MPF A;  2H0G A;  1RK4 A;  5D9V A;  4F03 A;  1MTC A;  3FZ4 A;  4MCU A;  4JED A;  3M1G A;  1NM3 A;  4FH8 A;  1F37 A;  4K1F A;  4TXO A;  1EWX A;  5GSS A;  1TXX A;  2C0E A;  4V2L A;  2WJU A;  3VI7 A;  2FD3 A;  2M72 A;  1C72 A;  3TKP A;  2YP6 A;  2LRT A;  2L57 A;  1H75 A;  1SJZ A;  3ME7 A;  2HSM A;  2K8S A;  2KUC A;  4Z2R A;  3P2A A;  3SWL A;  3EMP A;  3QFB C;  4K6X A;  2YZH A;  3UAR A;  1GNE A;  1GTU A;  5J9B A;  3L78 A;  3MNG A;  1M7T A;  3TCO A;  1O8X A;  1R5P A;  4IJ3 A;  1JFU A;  2PGT A;  1MDK A;  1MDJ A;  4HQZ A;  3RHC A;  1A0R P;  2NPB A;  2GSS A;  4WKW A;  4E68 A;  4GQC A;  4EDY A;  4HUA A;  5D9W A;  5F0G A;  2H19 A;  3W8J A;  3EU4 A;  2ZNM A;  3IOS A;  2ES7 A;  2GQK A;  14GS A;  3GV1 A;  1SEN A;  4PQI A;  4YKG A;  2V6O A;  4PUR A;  4XRD A;  2B6M A;  2JSY A;  2C0D A;  4O5U A;  5G1L A;  2R6K A;  2IME A;  3H4K A;  2PUK C;  1GRX A;  2LQO A;  22GS A;  3C8E A;  3KMN A;  4K9Z A;  2PVQ A;  3DVX A;  4FYU A;  4ML1 A;  2GDR A;  1RQM A;  1WOU A;  3H79 A;  3MWH A;  1ILO A;  1WMJ A;  5H5R A;  2O7K A;  3KP9 A;  2M46 A;  2H6Y A;  2QC7 A;  4GWR A;  2RM5 A;  3L9S A;  2BTO T;  2QA2 A;  20GS A;  4AKX B;  3WD6 A;  2B5Y A;  5FT3 A;  5ID2 A;  4D73 B;  1K0O A;  3UEM A;  3L9V A;  3FZ5 A;  2YWM A;  3F6F A;  1VF3 A;  1PL2 A;  1TKD B;  2O85 A;  2NBS A;  2HSN A;  1GUM A;  4Q5R A;  1ZOF A;  1ZYP A;  3MIX A;  1IYH A;  1UA5 A;  2K8V A;  1J08 A;  3GYK A;  1GTI A;  3P7X A;  1GNW A;  3O76 A;  4RI7 A;  2NDO A;  5BRT A;  1O81 A;  3NZN A;  4EVM A;  2QSI A;  1NW2 A;  3KH7 A;  3EMX A;  4J56 E;  2O87 A;  4G10 A;  2LNT A;  2IPA A;  5HQP A;  1A2M A;  1GSY A;  2MYG A;  4CDO A;  2TIR A;  5A5H A;  1TJD A;  4H86 A;  2B1L A;  5BMU A;  2CA8 A;  2IMD A;  2YN1 A;  4I2T A;  4AKG A;  2MMZ A;  3GHA A;  2VL9 A;  5GST A;  3IHQ A;  1PA3 A;  4KF9 A;  3IR4 A;  1KEB A;  2VCV A;  5CRG A;  1X9M B;  1ZMA A;  2DJJ A;  4Z7X A;  2L6D A;  1Z7P A;  4IN0 A;  1TK0 B;  2N5B A;  5F8B A;  4KE3 A;  1ZYN A;  1FB0 A;  5KN2 A;  1DUG A;  3CTF A;  1DE1 A;  3QAG A;  1N2A A;  4L0U A;  4EL1 A;  1F3B A;  2DJ3 A;  3VK9 A;  2LTK A;  3IC8 A;  4EKZ A;  4N30 A;  5HR1 A;  2JZR A;  5E59 A;  3M0F A;  4IJI A;  1WWJ A;  2JSZ A;  2L4Q A;  4AI6 A;  4K5R A;  5HFG A;  1A2L A;  2I81 A;  3RPN A;  1X0R A;  2JZT A;  2C8U A;  4MMM A;  4K0G A;  2GVP A;  3VPT A;  2EIQ A;  1Z7R A;  5D9T A;  1SK2 A;  4LMV A;  3HZ4 A;  3QCP A;  4XS1 A;  3ZIV A;  3F0I A;  2P5R A;  2CX3 A;  4HJ2 A;  2VL2 A;  4TR0 A;  2XBI A;  2I1U A;  1XWC A;  3RPP A;  3FZ9 A;  4F9Z A;  5DAK B;  3HYP A;  3APO A;  2R0G A;  4PX1 A;  4X1U A;  1NSW A;  4HZ2 A;  3GUS A;  5JCU A;  1TXU A;  4IGJ A;  4A5P A;  11GS A;  3QOU A;  4G0K A;  4POL A;  3ERF A;  3A2X A;  5DQY A;  3FW2 A;  3WGD A;  1XFL A;  3A5I A;  4MJE A;  3IAS 2;  3APQ A;  2M80 A;  1SKW B;  3ED3 A;  1GTB A;  2FGX A;  2E7P A;  4AGS A;  4NV5 A;  4DSS A;  4NHW A;  2MMO A;  1XVW A;  1LJR A;  4KW6 A;  3ZMK A;  4O32 A;  3N5O A;  2CAQ A;  2GT5 A;  4BWQ A;  4IS0 A;  1XWB A;  3EVI A;  4TW5 A;  4OFM A;  2X64 A;  3Q19 A;  3GNJ A;  2WGR A;  1YY7 A;  3ZLP A;  3VI5 A;  4GCI A;  4IP1 A;  2HSH A;  3CSH A;  2F8A A;  1EZK A;  1GSD A;  4EIQ A;  3TDG A;  1G7E A;  1ZCP A;  3CYN A;  5COH A;  9GSS A;  3VWU A;  4D73 A;  1SVO A;  2YNX A;  2PMT A;  3GA4 A;  5ECN B;  3TRX A;  2FWG A;  5DBQ A;  2F3M A;  3LYP A;  2E2M A;  4TKY A;  3VWX A;  5CRH A;  5KOW A;  3LQ7 A;  3F63 A;  2AYT A;  1OC9 A;  2HT9 A;  3HDC A;  1B4Q A;  3IDV A;  1O6J A;  3ZIJ A;  4JU5 A;  4GSS A;  5CRE A;  1XXU A;  5CRD A;  2GS3 A;  3C1R A;  2TRC P;  4HOJ A;  1R26 A;  3I43 A;  4HJM A;  3F4R A;  1VRS D;  1T8E B;  2AUV A;  3TKQ A;  1FG4 A;  1HQO A;  4ZB6 A;  2H6X A;  3H93 A;  2H1D A;  5ENU A;  2YAN A;  2VIM A;  3QAW A;  4ZIJ A;  3FKF A;  4HQS A;  3LSZ A;  1YEP A;  1ZL9 A;  3HHV A;  1ERV A;  4XTS A;  3ME8 A;  2H75 A;  2OAD A;  5CNW A;  3UBL A;  5LD0 A;  4KDX A;  1OC3 A;  1SJI A;  1Y25 A;  3KCM A;  4GSN A;  1ON4 A;  3LEF A;  5AIS A;  5IPH A;  1SD9 A;  4KCA A;  1ZZY A;  1YF0 A;  5JWO B;  3LWA A;  4WBR D;  3E3E A;  4G2E A;  1Z9H A;  5AIV A;  1M2A A;  2EC4 A;  3DRN A;  2L5O A;  2YJH A;  2VUP A;  5J3R A;  2HSN B;  2VCW A;  1YVL A;  1U87 A;  2HZF A;  2XC2 A;  1QGV A;  1BED A;  5IPG A;  2OE0 A;  1G6W A;  4EUY A;  4HZ4 A;  4I6X A;  5C00 A;  2CZ2 A;  4OO4 A;  5J41 A;  5HR3 A;  1X5C A;  1M2B A;  4ISD A;  8GSS A;  3RDW A;  3R3E A;  4ILF A;  3WGE A;  1OKD A;  5D8I A;  1KBN A;  2L59 A;  3I69 A;  1R7H A;  5ECQ B;  2CAI A;  2A4V A;  4KH7 A;  5GAN D;  2V6K A;  1YKC A;  1TW9 A;  3KEB A;  4JRR A;  2VOC A;  1QXH A;  4PGT A;  5G5F A;  4KDU A;  2H01 A;  4OD7 A;  4WR5 A;  3GRX A;  4RQR A;  3Q18 A;  3ZML A;  2OBK A;  3PR8 A;  1ML6 A;  4FIW A;  2H0H A;  2AV4 A;  1SJ6 A;  1NHO A;  2HSY A;  3GL5 A;  1V40 A;  4TXV A;  4IP6 A;  1PKZ A;  2WFC A;  2H72 A;  3DEX A;  2EFD A;  2MMN A;  3IPZ A;  1I9D A;  2PBJ A;  2CVD A;  2VKZ G;  3IBH A;  4V1A p;  2OA7 A;  3IE3 A;  4MF6 A;  5G2Z A;  1PGT A;  3D0Z A;  5AGY A;  1XW6 A;  1GUK A;  3WT1 A;  3M9K A;  4QL7 A;  4E8H A;  1SYR A;  4ULX A;  5A1N B;  3D6I A;  4WF5 A;  3TKR A;  4KND A;  3K8N A;  1GSQ A;  1GSU A;  2CX4 A;  4K7O A;  4POK A;  4J57 E;  4JE1 A;  1ZYE A;  4IEL A;  3GX8 A;  4NPB A;  1DSB A;  3CRT A;  4CW9 A;  2I9H A;  5H5S A;  2LUS A;  3HA9 A;  3TKS A;  1ZYQ B;  5G5E A;  3ISO A;  2R37 A;  4X4J A;  1B8X A;  2QA1 A;  1FO5 A;  1QMV A;  3TB2 A;  2IFQ B;  3KMO A;  2LRC A;  1AQX A;  3ZVJ A;  1E6B A;  1PMT A;  2KLX A;  1SL1 B;  12GS A;  7GSS A;  2HE3 A;  4F0C A;  1F9M A;  2HLS A;  4NAX A;  2RII A;  2C0G A;  5ABR A;  2VO4 A;  2V41 A;  3KTB A;  5D73 A;  2GQM A;  1BF5 A;  4FO5 A;  1TI1 A;  3FMW A;  4JR6 A;  2WCI A;  5KN1 A;  5D9X A;  4DSS B;  5JWQ B;  1SL2 B;  4RI6 A;  3N9J A;  1JZR A;  4OFN A;  5E4W A;  3ZZX A;  4PNG A;  5DJL A;  4GLT A;  2IJY A;  1BX9 A;  3L0H A;  4K0N A;  3A2W A;  5B6M A;  4KAE A;  2YWI A;  5J9C A;  3WYW A;  3NIV A;  4K2X A;  2I3Y A;  2GZY A;  2HRK A;  1S3C A;  2PWJ A;  4FYC A;  4EXJ A;  1Z5Y E;  2H1G A;  2ON7 A;  2VCX A;  2FHE A;  5DCH A;  3J7Y k;  2RM6 A;  2H1L A;  2DJ0 A;  5CYY A;  2V32 A;  2H1B A;  2LV3 A;  1WE0 A;  1QFN A;  1K0D A;  3G7J A;  2R0C A;  3UL3 A;  5ECR B;  4GQF A;  2IWT A;  2XPD A;  5IOW A;  1FVJ A;  2FLS A;  4F0B A;  3H1N A;  3FK8 A;  4IQ1 A;  2PVO C;  5GZZ B;  2VCQ A;  1OC9 B;  2DJK A;  2DMM A;  1HNC A;  3KJY A;  5IMC A;  2KP2 A;  1SKS B;  4CY8 A;  2DIZ A;  3PPU A;  4PNF A;  2PN8 A;  4ZB8 A;  2C0F A;  4BPY A;  5ECO B;  3LGC A;  19GS A;  4XS4 B;  1BG5 A;  1QQ2 A;  4N0Z A;  1AQV A;  5HR2 A;  1FOV A;  5DDL A;  1A2J A;  4LLR A;  4RUV A;  4DEJ A;  4KX4 A;  3UJ1 A;  1A8L A;  4FYB A;  3KTL A;  2C4J A;  5A5K A;  2F8F A;  4GTU A;  4ZL8 A;  1R4W A;  1U3A A;  2REM A;  4TVE A;  1EV4 A;  3P8W A;  1GUH A;  1B9Y C;  4AJ7 A;  1FB6 A;  5EL8 A;  2L6C A;  1SL0 B;  3HD5 A;  3IAM 2;  3GKK A;  6GSS A;  3ZFB A;  3BCK A;  3O6T A;  4KDY A;  1HNA A;  1GWC A;  5A4U A;  6GSY A;  1AXD A;  1SVM A;  2HQT A;  3PGT A;  3AY8 A;  3BD2 A;  5D93 A;  2IMK A;  4NHZ A;  4ZBA A;  2N5A A;  3G7Y A;  4MLY A;  3D4T A;  3RHB A;  4BWS A;  2LST A;  1YEX A;  2P0G A;  4EC0 A;  3F9U A;  3HVX A;  1HYU A;  4KSO A;  1G6Y A;  1W89 A;  3KD0 A;  1A8Y A;  1U3I A;  2VL3 A;  5A1N A;  3W8S A;  1UN2 A;  3TRP A;  3C7M A;  2B1K A;  4LL1 B;  3UAP A;  3DD3 A;  4OWY A;  2DKH A;  4HU7 A;  2B7J A;  3LXZ A;  5ECS A;  1S3A A;  1EEM A;  2GSQ A;  2CT6 A;  2G2Q A;  5DQS A;  3FR9 A;  1WRY A;  2EFH A;  4ECB A;  3GL3 A;  4KGI A;  4V2N A;  2DLX A;  5A34 B;  2DML A;  5IMA A;  3EU3 A;  4XRA A;  3KXO A;  4ZIL A;  3EIN A;  1JLV A;  1JLW A;  1XIY A;  1VF2 A;  4L5L A;  2IFQ A;  3V1W A;  4BA7 A;  2Z9S A;  2A4H A;  4HDE A;  1JZD A;  3ZRD A;  2X8G A;  2KHP A;  1EV9 A;  4MDC A;  2C3T A;  1TRV A;  4MZW A;  4YQM A;  3HMJ G;  2YOI A;  4KB3 A;  1F2E A;  3TRQ A;  1R5A A;  4TR1 B;  3JCM L;  1H4O A;  3CXG A;  1OVN A;  4OCF A;  2V2G A;  1O8W A;  1O7U A;  3GIX A;  1KTE A;  4BL7 B;  3QD9 A;  3UBK A;  3KM6 A;  5ECI B;  3GTU A;  4OCE A;  3US3 A;  3LXT A;  2EFC A;  1MDI A;  1U6T A;  1SK0 A;  1LU4 A;  5CP1 A;  3IC4 A;  2EIO A;  3LYK A;  1BG1 A;  4ZBD A;  4ICY A;  1Z6M A;  1FW1 A;  1T00 A;  4USS A;  1IYI A;  3UMA A;  4LMW A;  4P3Y B;  5EVO A;  1Q4J A;  4KUN A;  3HCZ A;  2LRN A;  3GH6 A;  3IHG A;  5J47 A;  2QGV A;  2YZU A;  1X9S B;  3GKX A;  1JZW A;  3PIN A;  3CWG A;  4E8E A;  2X4A A;  4ECI A;  3HJP A;  3MDK A;  4MPG A;  1FAA A;  2X8C A;  4MJC A;  1TI3 A;  1M99 A;  1B48 A;  1USB A;  2FA8 A;  2GZZ A;  4ECJ A;  4BVX A;  4QMK A;  4G19 A;  1B9X C;  2WB9 A;  2RUE A;  3UVH A;  2YCD A;  2A2S A;  2LQQ A;  1XZO A;  5CAX A;  3DGQ A;  1F3A A;  5IOX A;  4XS4 A;  4QQ7 A;  5J5N A;  1TU7 A;  1SK1 A;  1EOG A;  2DKI A;  1DE2 A;  1ERT A;  4YQV A;  5ECM B;  1T3B A;  4V1A g;  1BYE A;  13GS A;  5EY6 A;  1G0T A;  5AN1 A;  1V2A A;  3GKN A;  5ECP B;  1PSQ A;  5IIZ A;  1GP1 A;  1EP8 A;  2LS5 A;  1TU8 A;  2ALB A;  1AIU A;  4DSQ A;  1K0M A;  3FEU A;  1K3L A;  2HRK B;  1XW5 A;  2A2R A;  3DWV A;  1SVL A;  3ERG A;  5J4Y A;  1T4Y A;  5G31 A;  1K0C A;  4EE0 A;  5A4W A;  3L4N A;  2R3X A;  3Q6O A;  1XWG A;  1AAZ A;  1UVZ A;  4MK3 A;  2X49 A;  1SD8 A;  4EF0 A;  1XOB A;  5G30 A;  2C3Q A;  1XW9 A;  5ECH B;  3FR3 A;  1PKW A;  4PQH A;  2LJK A;  3CMI A;  2VCZ A;  1SKR B;  2IN3 A;  2H30 A;  1GH2 A;  3IK7 A;  4HU9 A;  3QDN A;  2OKA A;  5CRW A;  2B3S A;  5A4V A;  1T4Z A;  2DSA A;  3HKR A;  1TP9 A;  5FWG A;  1EP7 A;  5A34 A;  2YWO A;  1AUC A;  5J4U A;  3G7I A;  1B4P A;  6GST A;  2VCT A;  1BQ7 A;  3GUR A;  5ELG A;  2VD1 A;  1FHE A;  5HFK A;  3CBU A;  2GGT A;  5D96 A;  1RW1 A;  1PX6 A;  1ST9 A;  1PQN A;  3TKS E;  2UV8 G;  3F3Q A;  5DVB A;  5JWR B;  1YF1 A;  2IMI A;  1OKT A;  2OAC A;  4GDF A;  1AQW A;  3KH9 A;  2K9F A;  1AW9 A;  4K2D A;  6GSX A;  4MNN A;  1I5G A;  1XWK A;  2H71 A;  1PN9 A;  2VL2 C;  4TR4 A;  1TRW A;  1YQ1 A;  4TR1 A;  1Q98 A;  1V98 A;  2TRX A;  5F06 A;  4EDZ A;  4K7I A;  2HRF A;  2H66 A;  2H1A A;  2DBC A;  18GS A;  4BL7 A;  1T1V A;  3ZL5 A;  1XOA A;  4MAB A;  5KOX A;  1GL8 A;  5IO2 A;  4QL9 A;  3EWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...