4EE0A

Crystal structure of hh-pgds with water displacing inhibitor
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
194
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Hematopoietic prostaglandin D synthase
publication title Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 194
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ee0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ee0A01
3CBUA 3D4MA 1NW2A 4ZIJA 1BJXA 1VRSD 1A0RP 5A5KA 3ZIJA 3HVSA 1LU4A 2PU9C 3TJJA 4GF0A 4DSSA 2I81A 1QQ2A 2VM1A 3GURA 4JE1A 3QOUA 4KSMA 2C3QA 5GZZB 3GFKA 4BVXA 3KMNA 3GA4A 4EO3A 4POBA 5L71A 1YEXA 1KTEA 3QMXA 1SYRA 2FWGA 1GSQA 3FK8A 4EVMA 3QAVA 2AAWA 3HCZA 4MZWA 4MJBA 4NV2A 1TP9A 3TCOA 1B9YC 1Q98A 3IA1A 5LD0A 1SD8A 4GXZA 5JWQB 3E0UA 4MA9A 1XZOA 4XIHA 3NIVA 5IO0A 2OKAA 4FQUA 1K0OA 1URMA 1BYEA 4ML1A 4OFMA 4GLTA 1YZXA 3U5RE 4OCEA 4ZL9A 3FZ9A 5D96A 4ZB6A 2FCHA 1AIUA 1MTCA 1O6JA 3C1RA 2VAFA 1R7HA 1S3DA 5F8BA 1K3YA 5ECHB 1ACVA 5AIVA 5ENUA 1YKAA 2JZTA 2GLRA 5ECSA 5GAPD 2I4AA 1WJKA 2FGXA 2I9HA 5H5SA 1B9XC 1K0MA 1Z3EA 3LGCA 1G0TA 1SKSB 2CA8A 1J0FA 4JZQA 5J41A 2Z9SA 1SENA 2VO4A 3GKKA 1F3AA 3TGZA 1TJDA 2JU5A 2FNOA 1SU9A 12GSA 3F8UA 3EVIA 4EXJA 1V58A 3O3TA 1R5PA 3HZ8A 1PKWA 1MDIA 5INYA 2N5FA 1TRUA 4ZBBA 1A0FA 1K3OA 4HUAA 4KDUA 2F51A 2HFDA 1A2LA 1FVJA 3PGTA 2VCTA 2EIRA 2K8SA 5IPHA 1LJRA 4O7HA 3ZTLA 2ON7A 4KCEA 1N2AA 2H0GA 3D6IA 2C8UA 4PX1A 3TKSC 4K9ZA 2HRKB 2I3YA 1TI3A 1FB6A 5EL8A 3FR9A 4JBBA 2JZRA 4LLRA 2LNSA 2C3TA 5J9CA 2ON5A 5KN1A 3APSA 2R37A 1NM3A 4PQIA 5IMFA 1T1VA 1X0RA 4WF5A 4ID0A 3DEXA 2LTKA 5GAND 2IMIA 3IDVA 2HI7A 2H1BA 1RW1A 2OBKA 2NVLA 3GKXA 2X64A 2RUFA 3EINA 5B8BA 1CQHA 2DLXA 3DGQA 3Q6OA 2LRNA 5F05A 3RDWA 4WR4A 4HU7A 4EF0A 3DXBA 11GSA 5DBQA 3AY8A 5ELGA 5AISA 2K8VA 4P3YB 4GTUA 3WT2A 4EDZA 1SK0A 2ZCTA 4BA7A 1U3IA 4TN8A 1QUWA 4G0LA 5DDLA 1UN2A 5KN0A 3G7YA 4HJMA 3LYKA 3BCIA 4F2IA 4KB3A 1XCCA 4JU5A 4BL7B 5DALA 3LQ7A 1XWBA 2LS5A 4OCFA 3QD9A 5HFIA 4BPYA 3VK9A 2M80A 3GX8A 3DVWA 1XBSA 4E8EA 1YF0A 2VCWA 3GUSA 1F2EA 2WDUA 2WRTA 2BJXA 2IIYA 3W8SA 4YQVA 1OC9B 5G31A 3TJGA 1SL0B 4K0GA 2X8GA 2HSHA 2LEGA 1IYIA 2YANA 1Q4JA 2GT5A 2JACA 3P7XA 5C04A 5D73A 2LQOA 5GSTA 1K0DA 1B4QA 3CTFA 2YJ7A 1GSFA 2YZHA 3HDCA 4MZCA 3GL3A 4FYUA 2HXKA 1X9SB 4GQCA 4OMVA 4F0BA 2CX3A 2GSTA 2B1LA 2WB9A 4GWRA 1OC9A 4WKWA 2WCIA 1HQOA 5F06A 3F0IA 4NXIA 4MLYA 4WF4A 3TJFA 4J56E 1XW6A 2GS3A 4PXOA 2V32A 1GSYA 1FG4A 5COHA 3KXOA 4RUVA 4L5LA 5LCZA 3KCMA 6GSXA 4FO5A 2GZPA 3QR6A 3CTGA 4G10A 19GSA 5JCUA 1T4ZA 2L59A 1B8XA 5CRGA 2VCXA 4GSNA 1WE0A 4WETA 3VWWA 1G6YA 1PX7A 1SK1A 1XIYA 5IIZA 3IHQA 3I43A 4F9ZA 4NV5A 4WBJA 1OVNA 3S9FA 1PA3A 4EUYA 1YF1A 1MEKA 4AJ8A 2K18A 3F63A 5IM9A 1M2BA 1SYXA 2V6KA 2R3XA 3ZFBA 2L5OA 3TOTA 1ON4A 2IWTA 5ID2B 3HJMA 4HJ2A 3VI5A 5EY6A 1K0AA 2N5AA 5HFGA 2YJHA 2C1YA 2DJKA 1GH2A 1WPIA 2YWIA 3BD2A 2M72A 5AIXA 2KP2A 1PD21 2LJAA 2WZ9A 2IL3A 2CZ3A 5J4UA 3FEUA 4L8EA 6GSUA 2LSTA 2L4QA 2LJKA 3ZVJD 5B6NA 1GSDA 1Y6EA 4Q5NA 2FLSA 2KLXA 10GSA 4IHUA 1ZCPA 1ERTA 4IJIA 2VIMA 2HRAA 5ECLB 2F8AA 5EVOA 3ZVJA 4IP1A 1GULA 4FH8A 4DEJA 1X5CA 2O8VB 2XPEA 3FW2A 2L57A 4AJ6A 3UMAA 3L9VA 2N5BA 2CQ9A 2JZSA 2LV3A 1VF1A 1F6MC 3GH9A 1PX6A 2RLIA 3CRTA 3TUEA 4V1Ap 5ABRA 3IAM2 3UIWA 3J7Yb 4KCAA 1TI1A 2YP6A 3EURA 1TDIA 2J9HA 2IN3A 2L5LA 3F3QA 2XC2A 2C4JA 4MPFA 1XWAA 3GMFA 2LJRA 3SBCA 2GSRA 4ISDA 2O89A 5DJLA 1YKCA 2OJLA 1CQGA 2O7KA 3ZL5A 2A2RA 4IN0A 2YPMA 1RK4A 2UZ8A 1TK0B 3EU4A 1QGVA 3VWVA 1AQXA 1V2AA 3F9UA 3KTBA 2G2QA 2C0GA 5HR1A 4DSSB 2AHEA 3D21A 1PL2A 3FHKA 1GSSA 1THXA 3E3EA 4BVXB 1MD3A 2HRFA 4HQZA 5IO2A 3I6AA 3WD6A 2JL4A 1ST9A 4RI7A 4G0KA 5G2ZA 2XBIA 2HT9A 1XOBA 3GSSA 4KA0A 1FVKA 3EE2A 4K0NA 1EOHA 3RBTA 1PN9A 2RIIA 4OWYA 4OO5A 18GSA 8GSSA 2WJUA 2ALBA 3VURA 2CAIA 2GQMA 2PN8A 2MMNA 3BOAA 4KSOA 5FWGA 2LRTA 1PSQA 3VWUA 4WBRD 1XFLA 4GSTA 5F07A 4CHSA 3VLNA 3LJRA 1ZOFA 3CRUA 4MCUA 3EC3A 4EDYA 4MF7A 3FY7A 4AGSA 4LL1B 3TB2A 2JSYA 4IQAA 4ECIA 1FOVA 1EEMA 3ME8A 3SWLA 2VUPA 3PH9A 2M46A 2TIRA 4POMA 2KOKA 3L0HA 2LUSA 2C0EA 3LXTA 2BMXA 5C00A 2VD0A 2FD3A 1H4OA 6GSYA 2GGTA 2VCZA 3CXGA 3WGXA 4PGTA 2F8FA 3DIEA 3A5WA 3L4NA 2G0FA 3QCPA 3RHCA 5HR3A 3G7IA 4IW9A 3KMOA 4Q5FA 1ZL9A 3HY2A 1U3AA 2P5QA 4TRXA 1Z6MA 3IV4A 5H5RA 1BG5A 1JZWA 3ZFLA 5J9BA 2IMFA 1EV9A 4MF6A 2VL2A 2GTUA 1XWCA 3ERGA 3FKFA 1F3BA 1T7PB 3UVHA 2PVOC 2FA4A 2YWMA 1A23A 2H6YA 3LG6A 2H66A 2MMAA 3ERWA 4WEYA 3DRNA 1SD9A 3QDNA 4K7NA 3D5JA 1UC7A 1Y25A 1XW5A 3C1SA 4K2DA 3HVXA 4KDYA 2AUVA 2GVPA 2AB6A 3QFAC 2YOIA 3FRCA 3GV1A 4HQSA 4Q5QA 2H71A 4NAXA 2CX4A 1ZYQB 4I97A 3KH7A 2WULA 1SKWB 2PGTA 2FWFA 4YAPA 3IK7A 4I2UA 4K8MA 1KBNA 3I9V2 1ML6A 3ISOA 1FB0A 2R2JA 1NHOA 1HD2A 5ECKB 4ZL7A 1ZMAA 4D73A 2V1MA 16GSA 6GSWA 2P31A 4PNGA 3EWLA 5D9WA 3CSHA 3HKRA 5CP1A 3QAWA 5ECNB 20GSA 4IJ3A 5F0GA 2R5GA 4YAVA 4V2MA 3MAKA 4MMMA 3TJKA 3KM6A 3TJBA 2O87A 4FIWA 3QPMA 4HS1A 4IBPA 4QL9A 1R26A 2X8HA 1V57A 1ZGNA 4RQXA 1KNGA 1FO5A 1GUKA 4MF5A 3ZLPA 5DALB 2H70A 1PL1A 1GLPA 1VGLA 2C3NA 4ZB8A 2H0HA 2EIQA 1USBA 3TKRA 4QQ7A 2OA7A 2V41A 3C71A 4J2FA 4N0VA 3EU3A 4N0ZA 4ECCA 2DJ1A 3D0ZA 1T4YA 4OFTA 4QL7A 1HNAA 1H75A 1YY7A 5JWOB 2YN1A 4Z7XA 1GTAA 4AJ7A 1A8YA 3APQA 4XCSA 3BBYA 2H19A 1AQWA 2OE0A 2HZEB 1B48A 3TKSE 1OAZA 4N30A 4ACSA 5KN2A 3H8QA 4X0XA 3D22A 5DAKA 2DMMA 2EIOA 1FHEA 1EEJA 3LXZA 1WMJA 2MMOA 3A3TA 3TOUA 2R4VA 1I5GA 5B7CA 4FYBA 4PQ1A 2VM2A 5KN3A 2FWEA 1SL2B 4ECBA 1WWJA 4L0UA 3TRXA 3VPTA 1TK8B 2YV9A 5DQYA 4MJAA 2DJ0A 3DVXA 1YJ6A 5G5EA 4K7IA 2HZEA 3U6VA 3F4RA 3Q74A 1E2YA 2DC5A 2GZZA 1GNEA 1MD4A 4TKYA 4MJCA 3RPNA 2WGRA 4ILFA 3CSJA 2PERA 4KX4A 4X43A 4IS0A 5HQPA 1J9BA 1XPVA 2X8CA 2ZNMA 3Q19A 3GKMA 1PRXA 3MDKA 1RQMA 2X99A 4JEDA 4KGIA 3C7MA 4IP6A 2TRXA 1TXXA 2GQKA 3IBHA 4ULXA 3TKQA 4TXOB 4ZBAA 1N8JA 1GSUA 1SKRB 4KE3A 1O85A 2KUCA 3F4SA 3EMPA 4GQFA 1K0CA 4KUNA 3FYGA 1YDKA 4XHMA 4PQHA 2OADA 2RM6A 3DWVA 4MZBA 2GZYA 4ZILA 1GP1A 2L6DA 3UBLA 6GSTA 2CVBA 2H73A 3H1NA 3A2XA 2DBCA 5E4WA 4L0WA 3DMLA 2VL9A 5J3RA 4OFNA 5DCGA 3VFIA 2HNLA 2J23A 5ECRB 2LKUA 1XXUA 1QXHA 4TXOA 5BMUA 3MSZA 3IPZA 2HRNA 2B3SA 2H1DA 3KZQA 4DSRA 5B6MA 5CO3A 1ERWA 5B8AA 1O8XA 4IQ1A 1M2AA 4NPBA 5DCHA 2E0QA 1BQ7A 1J08A 3GTUB 1X5EA 1GL8A 5A4WA 4TW5A 2I1UA 1BX9A 3GN3A 1C72A 5D9VA 2FUG2 2OACA 2K6VA 1JZOA 5G1KA 3GL5A 4KDXA 2AJQB 4PUFC 4HU9A 4IKHA 5IOWA 2L4CA 4ZBDA 1VF4A 5G30A 3TKSA 4AF2A 3WT1A 5CNWA 1V9WA 4LA1A 5IQYA 2XBQA 3O76A 2E7PA 1G7EA 1F9MA 1XWGA 1EGOA 1UVZA 4O92A 3PINA 2V2GA 4IELA 3A2VA 4KNDA 4TR3A 3GSTA 2DJJA 3KP8A 3N9JA 4ZXGA 2VCVA 3E9JB 22GSA 2HSMB 3P8WA 5CREA 4POKA 5KEJA 3GTUA 14GSA 3MWHA 5FHIA 3HYPA 3HJOA 2KP1A 5ECQB 5HFKA 1T00A 3WYWA 4BWQA 4PUAA 1VF2A 4XS1A 3WGEA 1BAYA 1O8WA 1M99A 4OD7A 1THOA 3PPUA 3N5OA 4WXTA 4Q5RA 1ERVA 4V2NA 1IYHA 1M7TA 1HNBA 4N10A 3NZNA 1SJ6A 3GKNA 1K0BA 3GYKA 3LEFA 3IRAA 4MPGA 3K8NA 1X9MB 3R3EA 1PKZA 2HSMA 3BCKA 1O7UA 4G0IA 4MP4A 2LRCA 2R6KA 2DIZA 1EP7A 3G9BA 2PUKC 1GTIA 1JHBA 5ECMB 3V1WA 4V1Ag 4JR6A 3KTLA 1U88A 4ML6A 1V40A 4NWYA 2V6OA 5ECIB 3VI7A 1KEBA 3KP9A 2VLUA 4CDOA 3ZMKA 3ZRDA 3UEMA 2WS2A 1AC1A 3IE3A 1DE1A 4I2TA 4BWSA 1DBYA 3F3RA 3A2WA 1ZYEA 2CZ2A 3UOMA 1XWKA 3KIJA 2XHFA 2IFQA 3L9UA 3M1GA 1X9WB 2MZCA 3RAZA 3CMIA 3UVTA 3HHVA 1TOFA 2H72A 2HQTA 1WOUA 3ZYWA 3GHAA 2B7JA 3M0FA 4I5QA 2P0GA 3GX0A 1VF3A 3UBKA 1GUMA 4GCIA 2NPBA 4O32A 1WP0A 2IJYA 2VL3A 2GT6A 4MABA 3H4KA 1EV4A 2NBSA 1AUCA 3W8JA 5FT3A 4HOJA 3C73A 4H86A 1PQNA 2DJ2A 1OC8A 5G5FA 2MMZA 5HR0A 1GLQA 1TKDB 2PVQA 5LNKe 3F6DA 1TU7A 1GSEA 4N11A 3EYTA 4D73B 4K6XA 2RM5A 1JZDA 3IC4A 1GTBA 3NOFA 1GRXA 4KF9A 4G19A 3JCML 4YQUA 2F9SA 1W4VA 5D9XA 4TR4A 3C8EA 3M9JA 2RUEA 3G7JA 2IPAA 1QK8A 2A4VA 4I6XA 1Z6NA 2FHEA 5AN1A 3WGDA 1GUHA 1R5AA 3ED3A 2TRCP 4G9HA 3ZMLA 4IGJA 5IPGA 2B5EA 1PGTA 1PMTA 1GTUA 5CRHA 3FR3A 3Q18A 1LBKA 1Z7PA 4USSA 1E6BA 3DKSA 4ZL8A 2WFCA 1OKTA 2C0DA 4V2LA 1A2JA 3HD5A 5CRDA 3HJPA 2YV7A 1AAZA 4RQRA 4YQMA 3VWXA 2VLTA 1SK2A 4XTSA 3MNGA 4TOPA 2LNTA 5D8IA 1HNCA 1MDKA 3TRQA 1JLWA 5IMDA 3US3A 4EC0A 3J7Yk 4MK3A 1HYUA 4HEA2 5ELAA 1O73A 4NHWA 1WRYA 2HZFA 3TKPA 3M8NA 1V98A 2PMTA 2AV4A 1R4WA 3KH9A 5DAKB 2H1GA 3IOSA 2FA8A 2IMDA 2QKEA 2E2GA 2EC4A 3I69A 1SL1B 1AW9A 1EOGA 1Z9HA 1A2MA 2MBTA 5ECOB 2IMEA 4XS4B 4EKZA 3ZZXA 5JCWA 2NTOA 2K9FA 1EZKA 1G7OA 2H1AA 1DE2A 3IC8A 2HRKA 1X5DA 3RHBA 3QAGA 4K1FA 2OBIA 2VOCA 2L6CA 4TR0A 3GRXA 3CYNA 4XRAA 2O85A 3TDGA 1TW9A 2B7KA 2C80A 2DIYA 1K0NA 4BVYB 2MYGA 4DSQA 4ECJA 4CW9A 7GSSA 1YQ1A 1W89A 1JFUA 3HZ4A 2VCQA 4EL1A 1OYJA 4E8HA 4XS4A 1M2DA 5IMZA 2GSSA 2CT6A 2YCDA 2CVDA 1EGRA 3LSZA 3GNJA 3IAS2 1UA5A 3LWAA 3VPQA 1OKDA 2H6ZA 2ZUPA 2D2ZA 6GSVA 1M0UA 3M9KA 2PWJA 5CAXA 2JADA 3UJ1A 1TK5B 4KW6A 2PBJA 1SJIA 2B5YA 5DQSA 4BVYA 1T8EB 2H75A 3ZIVA 2H0IA 4HI7A 1U6TA 3FZAA 1ZZYA 1XVQA 4MDCA 4BL7A 1GNWA 2H76A 4IVFA 3R2QA 5EPFA 1TU8A 2YWOA 1QMVA 2H30A 3LORA 3PR8A 5ECPB 1F37A 5DVBA 3GIXA 1YEPA 1ILOA 2CVKA 6GSSA 5CYYA 2DSAA 4GSSA 4YH2A 3D4TA 4MJEA 4EE0A 4XS6A 3HA9A 1FAAA 4OO4A 2GQLA 2H8LA 9GSSA 2FY6A 1EWXA 3O6TA 4PURA 1XVWA 2HYXA 1S3AA 3TRPA 1XOAA 2VL2C 1A8LA 1K3LA 1FW1A 3F4TA 3EMXA 5D9TA 1T3BA 2YWNA 4F03A 3KJYA 1DUGA 2BTOT 3P2AA 5IMAA 2CAQA 2HE3A 1XW9A 3L78A 3KD0A 1AXDA 2VD1A 3DD3A 3LYPA 1EP8A 5A4UA 1M9BA 5AGYA 5E59A 4LMVA 3BJ5A 2JSZA 4LMWA 4O5RA 3APOA 3F6FA 1JZRA 3FR6A 4K7OA 1U87A 3H79A 4MH2A 3UARA 2IMKA 5DJMA 2REMA 3CSIA 1B4PA 2HLSA 3P90A 4KH7A 2QSIA 3L9SA 1OE7A 1OE8A 1Z5YE 1TRWA 3HXSA 2DJ3A 4TR1B 3IK9A 4XRDA 1A24A 4ZB9A 2H74A 3H93A 2A2SA 2QC7A 2OE3A 2DMLA 2C0FA 3LFLA 1O81A 4RI6A 3W6GA 1OC3A 2GDRA 4PNFA 1AQVA 3IR4A 5JWRB 1I9DA 5ID2A 5GSSA 4I8BA 3ZREA 4HZ2A 2HSYA 1DSBA 3OR5A 1TRSA 2B5XA 4KAEA 2XPDA 1TTZA 5A4VA 1ERUA 2YNXA 2HSNB 2P5RA 1JLVA 4F0CA 4NMUA 4POLA 2B1KA 3ME7A 1QFNA 3HVVA 2E2MA 4GRFA 4TR1A 2NDOA 2FWHA 4JR4A 4J57E 4HZ4A 2GSQA 4NHZA 3RPPA 3KGKA 5IMCA 1GWCA 1S3CA 3ERFA 1BEDA 5HR2A 1NHYA 17GSA 2ES7A 3IXRA 1WIKA 2AYTA 3KEBA 5IMVA 4FYCA 4TXVA 5CRWA 3ZITA 2YZUA 2CV4A 4G2EA 1M9AA 2VLVA 5J5NA 2LQQA 1Z7RA 4WR5A 5H5QA 2IFQB 2KHPA 4JRRA 3FZ5A 1G6WA 5G1LA 2H6XA 5D93A 4PTSA 2QGVA 3UAPA 13GSA 4TVEA 3M3MA 4L5OA 3UL3A 2MBSA 1NSWA 4HDEA 5JCGA 4DVCA 3DYRA 1ABAA 1MDJA 4LL4B 3GH6A 3FZ4A 4F82A 2PPTA 4X1UA 4MH3A 1SJZA 2B6MA 2F3MA 5IOXA 2OE1A 2H01A 1TRVA 3QFBC
chains in the Genus database with same CATH superfamily
3CBUA 3D4MA 1NW2A 4ZIJA 1BJXA 1VRSD 1A0RP 5A5KA 2QA2A 3ZIJA 3HVSA 1LU4A 2PU9C 3TJJA 4GF0A 4DSSA 2I81A 1QQ2A 2VM1A 3GURA 4JE1A 3QOUA 4KSMA 2C3QA 5GZZB 3GFKA 4BVXA 3KMNA 3GA4A 4EO3A 4POBA 5L71A 1YEXA 1KTEA 3QMXA 4K5RA 1SYRA 2FWGA 1GSQA 3FK8A 4EVMA 3QAVA 2AAWA 3HCZA 4MZWA 4MJBA 4NV2A 1TP9A 3TCOA 1B9YC 1Q98A 3IA1A 5LD0A 1SD8A 4GXZA 5JWQB 3E0UA 4MA9A 1XZOA 4XIHA 3NIVA 5IO0A 2OKAA 4FQUA 1K0OA 1URMA 1BYEA 4ML1A 4OFMA 4GLTA 1YZXA 3U5RE 4OCEA 4ZL9A 3FZ9A 5D96A 4ZB6A 2FCHA 1AIUA 1MTCA 1O6JA 3C1RA 2VAFA 1R7HA 1S3DA 5F8BA 1K3YA 5ECHB 4AKGA 1ACVA 5AIVA 5ENUA 1PN0A 1YKAA 2JZTA 4O5UA 2GLRA 5ECSA 5GAPD 2I4AA 1WJKA 2FGXA 2I9HA 5H5SA 1B9XC 1K0MA 1Z3EA 3LGCA 4AI6A 1G0TA 1SKSB 2CA8A 1M3JA 1J0FA 4JZQA 5J41A 2Z9SA 1SENA 2VO4A 3GKKA 1F3AA 3TGZA 1TJDA 2JU5A 2FNOA 1SU9A 12GSA 3F8UA 3EVIA 4EXJA 1V58A 3O3TA 1R5PA 3HZ8A 1PKWA 1MDIA 5INYA 2N5FA 1TRUA 4ZBBA 1A0FA 1K3OA 4HUAA 4KDUA 2F51A 2HFDA 1A2LA 1FVJA 2EFEA 3CWGA 3PGTA 2VCTA 2EIRA 2O5VA 2K8SA 5IPHA 1LJRA 4O7HA 3ZTLA 2ON7A 4KCEA 1N2AA 2H0GA 3D6IA 2C8UA 4PX1A 3TKSC 4K9ZA 2HRKB 2EFHA 2I3YA 4Z2TA 1TI3A 1FB6A 5EL8A 3FR9A 4JBBA 2JZRA 4LLRA 2LNSA 2C3TA 3RGBC 1ZYPA 5J9CA 2ON5A 5KN1A 3APSA 2R37A 1NM3A 4PQIA 5IMFA 1T1VA 1X0RA 4WF5A 4ID0A 3DEXA 2LTKA 5GAND 2IMIA 3IDVA 2HI7A 2H1BA 1RW1A 2OBKA 2NVLA 3GKXA 2X64A 2RUFA 3EINA 5B8BA 1CQHA 2DLXA 3DGQA 3Q6OA 2LRNA 5F05A 3RDWA 4WR4A 4HU7A 4EF0A 3DXBA 11GSA 5DBQA 3AY8A 5ELGA 5AISA 2K8VA 4P3YB 4GTUA 3WT2A 4EDZA 1SK0A 2X4AA 2ZCTA 4BA7A 1U3IA 4TN8A 1TXUA 1QUWA 3RFRC 4G0LA 5DDLA 1UN2A 5KN0A 3G7YA 3LYKA 4HJMA 3BCIA 4F2IA 4KB3A 1ZYNA 1XCCA 4JU5A 4BL7B 5DALA 3LQ7A 1XWBA 2LS5A 4OCFA 3QD9A 5HFIA 4BPYA 3VK9A 2M80A 3GX8A 3DVWA 1XBSA 4E8EA 5A1NB 1YF0A 2VCWA 3GUSA 1F2EA 2WDUA 2WRTA 2BJXA 2IIYA 3W8SA 4YQVA 1OC9B 5G31A 3TJGA 1SL0B 4K0GA 2X8GA 2HSHA 2LEGA 1IYIA 2YANA 1Q4JA 2GT5A 2JACA 4QMKA 3P7XA 5C04A 5D73A 2LQOA 5GSTA 1K0DA 1B4QA 3CTFA 2YJ7A 1GSFA 2YZHA 3HDCA 4MZCA 3GL3A 4FYUA 2HXKA 1X9SB 4GQCA 4OMVA 4F0BA 5A1NA 2CX3A 2GSTA 4CY8A 2B1LA 2WB9A 5A34B 4GWRA 1OC9A 4WKWA 2WCIA 1XG8A 3HVNA 1HQOA 2EFCA 5F06A 3F0IA 4NXIA 4MLYA 4WF4A 3TJFA 4J56E 1XW6A 2GS3A 4PXOA 2V32A 1GSYA 1FG4A 5COHA 3KXOA 4RUVA 4L5LA 5LCZA 3KCMA 4ICYA 6GSXA 4FO5A 2GZPA 3QR6A 3CTGA 4G10A 19GSA 5JCUA 1T4ZA 2L59A 1B8XA 5CRGA 2VCXA 4GSNA 1WE0A 4WETA 3VWWA 1G6YA 1PX7A 1SK1A 1XIYA 5IIZA 3IHQA 3I43A 4F9ZA 4NV5A 4WBJA 1OVNA 3S9FA 1PA3A 4EUYA 1YF1A 1MEKA 4AJ8A 2K18A 3F63A 5IM9A 1M2BA 1SYXA 2V6KA 2R3XA 3ZFBA 2L5OA 3TOTA 5A34A 1ON4A 2IWTA 5ID2B 3HJMA 4HJ2A 3VI5A 5EY6A 1K0AA 2N5AA 5HFGA 2YJHA 2C1YA 2DJKA 1GH2A 1WPIA 2YWIA 3BD2A 2OT3A 2M72A 5AIXA 2KP2A 1PD21 2LJAA 2WZ9A 2IL3A 2CZ3A 5J4UA 3FEUA 4L8EA 6GSUA 2LSTA 2L4QA 2LJKA 3ZVJD 5B6NA 1GSDA 1Y6EA 4Q5NA 2FLSA 2KLXA 10GSA 4IHUA 1ZCPA 1ERTA 4IJIA 2VIMA 2HRAA 5ECLB 2F8AA 5EVOA 3ZVJA 4IP1A 1GULA 4FH8A 4DEJA 1X5CA 2O8VB 2XPEA 3FW2A 2L57A 4AJ6A 3UMAA 3L9VA 2N5BA 2CQ9A 2JZSA 2LV3A 1VF1A 1F6MC 3GH9A 1PX6A 2RLIA 3CRTA 3TUEA 4V1Ap 5ABRA 3IAM2 3UIWA 3J7Yb 4KCAA 1TI1A 2YP6A 3EURA 1TDIA 2J9HA 2IN3A 2L5LA 3F3QA 2XC2A 2C4JA 4MPFA 1XWAA 3GMFA 2LJRA 3SBCA 2GSRA 4ISDA 2O89A 5J47A 5DJLA 1YKCA 2OJLA 1CQGA 2X49A 2O7KA 3ZL5A 2A2RA 4IN0A 2YPMA 1RK4A 2UZ8A 1TK0B 4O5QA 3EU4A 4PI2C 1QGVA 3VWVA 1AQXA 1V2AA 3F9UA 3KTBA 2G2QA 2C0GA 5HR1A 4DSSB 2AHEA 3D21A 1PL2A 3FHKA 1GSSA 1THXA 3E3EA 4BVXB 1MD3A 2HRFA 4HQZA 5IO2A 3I6AA 3WD6A 2JL4A 1ST9A 4RI7A 4G0KA 5G2ZA 4PI0C 2XBIA 2HT9A 1XOBA 3GSSA 4KA0A 1FVKA 3EE2A 4K0NA 1EOHA 3RBTA 1PN9A 2RIIA 4OWYA 4OO5A 18GSA 8GSSA 4Z2UA 2WJUA 2ALBA 3VURA 2CAIA 2GQMA 2PN8A 2MMNA 3BOAA 4KSOA 5FWGA 2LRTA 1PSQA 3VWUA 4WBRD 1XFLA 4GSTA 5F07A 4CHSA 3VLNA 3LJRA 1ZOFA 3CRUA 4MCUA 3EC3A 4EDYA 4MF7A 3FY7A 4AGSA 4LL1B 3TB2A 2JSYA 1Y1UA 4IQAA 4ECIA 1FOVA 1EEMA 2R0CA 3ME8A 3SWLA 2VUPA 1BG1A 3PH9A 2M46A 2TIRA 4POMA 2KOKA 3L0HA 2LUSA 2C0EA 3LXTA 2BMXA 5C00A 2VD0A 2FD3A 1H4OA 6GSYA 2GGTA 2VCZA 2WW0A 3CXGA 3WGXA 4PGTA 2F8FA 3DIEA 3A5WA 3L4NA 2G0FA 3QCPA 3RHCA 5HR3A 3G7IA 4IW9A 3KMOA 4Q5FA 1ZL9A 3HY2A 1U3AA 2P5QA 4TRXA 1Z6MA 3IV4A 5H5RA 5KOWA 1BG5A 1JZWA 3ZFLA 5J9BA 2IMFA 1EV9A 4MF6A 2VL2A 2GTUA 1XWCA 3ERGA 3FKFA 1F3BA 1T7PB 3UVHA 2PVOC 2FA4A 2YWMA 1A23A 2H6YA 3LG6A 2H66A 4FXYP 2MMAA 3ERWA 4WEYA 3DRNA 1SD9A 3QDNA 4K7NA 3D5JA 1UC7A 1Y25A 1XW5A 3C1SA 4K2DA 4A5PA 3HVXA 4KDYA 2AUVA 2GVPA 4MNNA 2AB6A 3QFAC 2YOIA 3FRCA 3GV1A 4HQSA 3TU3B 4Q5QA 4AKXB 2H71A 4E68A 4NAXA 2CX4A 1ZYQB 4I97A 3KH7A 2WULA 1SKWB 2PGTA 2FWFA 4YAPA 3IK7A 4I2UA 4K8MA 3CHXC 1KBNA 3I9V2 1ML6A 3ISOA 1FB0A 2R2JA 1NHOA 1HD2A 1SVLA 5ECKB 4ZL7A 1ZMAA 4D73A 2V1MA 1N25A 16GSA 6GSWA 2P31A 4PNGA 3EWLA 5D9WA 3CSHA 3HKRA 5CP1A 1BF5A 3QAWA 5ECNB 20GSA 4IJ3A 5F0GA 2R5GA 4YAVA 4V2MA 3MAKA 4MMMA 3TJKA 2EFDA 3KM6A 3TJBA 2O87A 4FIWA 3QPMA 4HS1A 4IBPA 4QL9A 1R26A 2X8HA 1V57A 1ZGNA 1FOHA 4RQXA 4G01A 1KNGA 1FO5A 1GUKA 4MF5A 3ZLPA 5DALB 2H70A 1PL1A 1GLPA 1VGLA 2C3NA 4ZB8A 2H0HA 2EIQA 4HSCX 1USBA 3TKRA 4QQ7A 2OA7A 2V41A 3C71A 4J2FA 4N0VA 3EU3A 4N0ZA 4ECCA 2DJ1A 3D0ZA 2O3EA 1T4YA 4OFTA 4QL7A 1HNAA 1H75A 1YY7A 5JWOB 2YN1A 4Z7XA 1GTAA 4AJ7A 1A8YA 3APQA 4XCSA 3BBYA 2H19A 1AQWA 2OE0A 2HZEB 1B48A 3TKSE 1OAZA 4N30A 4ACSA 2DKIA 5KN2A 3H8QA 4X0XA 3D22A 5DAKA 2DMMA 2EIOA 1FHEA 5BRTA 1EEJA 3LXZA 1WMJA 2MMOA 3A3TA 3TOUA 2R4VA 1I5GA 5B7CA 4FYBA 4PQ1A 2VM2A 5KN3A 2FWEA 1SL2B 4ECBA 1WWJA 4L0UA 3TRXA 3VPTA 1TK8B 2YV9A 5DQYA 4MJAA 2DJ0A 3DVXA 1YJ6A 5G5EA 4K7IA 2HZEA 3U6VA 3F4RA 4AKIA 3Q74A 1E2YA 2DC5A 2GZZA 1GNEA 1MD4A 4TKYA 4MJCA 3RPNA 2WGRA 4ILFA 3CSJA 2PERA 4KX4A 4X43A 4IS0A 5HQPA 1J9BA 1XPVA 2X8CA 2ZNMA 5J4VA 3Q19A 3GKMA 1PRXA 3MDKA 1RQMA 2X99A 4JEDA 4KGIA 3C7MA 4IP6A 2TRXA 4AKHA 1TXXA 2GQKA 3IBHA 4ULXA 3TKQA 4TXOB 5BMUB 4ZBAA 1N8JA 1GSUA 1SKRB 4KE3A 1O85A 2KUCA 3F4SA 3EMPA 4GQFA 1K0CA 4KUNA 3FYGA 1YDKA 4XHMA 4PQHA 2OADA 2RM6A 3DWVA 4MZBA 2GZYA 4ZILA 1GP1A 2L6DA 3UBLA 6GSTA 2CVBA 2H73A 4EIPA 3H1NA 3A2XA 2DBCA 5E4WA 4L0WA 3DMLA 2VL9A 5J3RA 4OFNA 5DCGA 3VFIA 2HNLA 2J23A 5ECRB 2LKUA 1XXUA 1QXHA 4TXOA 5BMUA 3MSZA 3IPZA 2HRNA 1YVLA 2B3SA 5KOXA 2H1DA 3KZQA 4DSRA 5B6MA 5CO3A 1ERWA 5B8AA 2WVZA 1O8XA 4IQ1A 1M2AA 4NPBA 5DCHA 1SVMA 2E0QA 1BQ7A 1J08A 3GTUB 1X5EA 1GL8A 5A4WA 4TW5A 2I1UA 1BX9A 3GN3A 1C72A 5D9VA 2FUG2 2OACA 2K6VA 1JZOA 5G1KA 3GL5A 4KDXA 4BIKA 2AJQB 4PUFC 4HU9A 4IKHA 5IOWA 2L4CA 4ZBDA 1VF4A 5G30A 3TKSA 4AF2A 3WT1A 4EIQA 5CNWA 1V9WA 4LA1A 2R0GA 3IHGA 5IQYA 2A4HA 2XBQA 3O76A 2E7PA 1G7EA 1F9MA 1XWGA 1EGOA 1UVZA 4O92A 3PINA 2V2GA 4IELA 3A2VA 4KNDA 4TR3A 3GSTA 2DJJA 3KP8A 3N9JA 4ZXGA 2VCVA 3E9JB 22GSA 2HSMB 3P8WA 5CREA 4POKA 5KEJA 3GTUA 14GSA 3MWHA 5FHIA 2WW2A 3HYPA 3HJOA 2KP1A 5ECQB 5HFKA 1T00A 3WYWA 4BWQA 4PUAA 5A5HB 1VF2A 4XS1A 3WGEA 1BAYA 1O8WA 1M99A 4OD7A 1THOA 3PPUA 3N5OA 4WXTA 4Q5RA 1ERVA 4V2NA 1IYHA 1M7TA 1HNBA 4N10A 3NZNA 1SJ6A 3GKNA 1K0BA 3GYKA 3A5IA 3LEFA 3IRAA 4MPGA 3K8NA 1X9MB 1S4BP 2HSNA 1PKZA 3R3EA 2HSMA 3BCKA 1O7UA 4G0IA 4MP4A 2LRCA 2WZSA 2R6KA 2DIZA 1EP7A 3G9BA 2PUKC 1GTIA 1JHBA 5ECMB 2A2PA 4PHZC 3V1WA 5A5HA 4V1Ag 4JR6A 3KTLA 1U88A 4ML6A 1V40A 4NWYA 2V6OA 5ECIB 3VI7A 1KEBA 3KP9A 2VLUA 4CDOA 3ZMKA 3ZRDA 3UEMA 2WS2A 1AC1A 3IE3A 1DE1A 4I2TA 4BWSA 1DBYA 3F3RA 3A2WA 1ZYEA 2CZ2A 3UOMA 1XWKA 2VKZG 1I1IP 3KIJA 2XHFA 2IFQA 3L9UA 3M1GA 1X9WB 2MZCA 3RAZA 3CMIA 3UVTA 3HHVA 1TOFA 2H72A 2HQTA 1WOUA 3ZYWA 3GHAA 2B7JA 3M0FA 4I5QA 2P0GA 3GX0A 1VF3A 3EPTA 1YEWC 3UBKA 1GUMA 4GCIA 2NPBA 4O32A 1WP0A 2IJYA 2VL3A 2GT6A 4MABA 3H4KA 1EV4A 2UV8G 1AUCA 2NBSA 3W8JA 5FT3A 4HOJA 4W66A 3C73A 1PQNA 4H86A 2DJ2A 1OC8A 5G5FA 2MMZA 5HR0A 1GLQA 1TKDB 2PVQA 5LNKe 3F6DA 1TU7A 1GSEA 4N11A 3EYTA 4D73B 4K6XA 2RM5A 1JZDA 5J40A 3IC4A 1GTBA 3NOFA 1GRXA 4KF9A 4G19A 3JCML 4YQUA 2F9SA 1W4VA 5D9XA 4TR4A 3C8EA 3M9JA 2RUEA 3G7JA 2IPAA 1QK8A 2A4VA 4I6XA 1Z6NA 2FHEA 5AN1A 3WGDA 1GUHA 1R5AA 3FMWA 3ED3A 2TRCP 4G9HA 3ZMLA 4IGJA 5IPGA 2B5EA 1PGTA 1PMTA 1GTUA 5CRHA 3FR3A 3Q18A 1LBKA 1Z7PA 4USSA 1E6BA 3DKSA 4ZL8A 2WFCA 1OKTA 2C0DA 4V2LA 1A2JA 3HD5A 5CRDA 3HJPA 2YV7A 1AAZA 4RQRA 4YQMA 3VWXA 2VLTA 1SK2A 4XTSA 3MNGA 4TOPA 2LNTA 5D8IA 1HNCA 1MDKA 3TRQA 1JLWA 5IMDA 3US3A 3CQFA 4EC0A 4N3ZA 4K2XA 3J7Yk 4CY6A 4YKGA 4MK3A 1HYUA 4HEA2 5ELAA 1O73A 4NHWA 1WRYA 2HZFA 3TKPA 3M8NA 1V98A 2PMTA 2AV4A 1R4WA 3KH9A 5DAKB 2H1GA 3IOSA 2FA8A 2IMDA 2QKEA 2E2GA 2EC4A 3I69A 1SL1B 1AW9A 1EOGA 1Z9HA 1A2MA 2MBTA 5ECOB 2IMEA 4XS4B 1S3RA 4EKZA 3ZZXA 5JCWA 2NTOA 2K9FA 1EZKA 1G7OA 2H1AA 1DE2A 3IC8A 2HRKA 1X5DA 3RHBA 1M3IA 3QAGA 4K1FA 2OBIA 2WW1A 2VOCA 2L6CA 4TR0A 3GRXA 3CYNA 4XRAA 2O85A 3TDGA 1TW9A 2B7KA 2C80A 2DIYA 1K0NA 4BVYB 2MYGA 4DSQA 4ECJA 4CW9A 7GSSA 1YQ1A 1W89A 1JFUA 3HZ4A 2VCQA 4EL1A 1OYJA 4E8HA 4XS4A 1M2DA 5IMZA 2GSSA 2CT6A 2YCDA 2CVDA 1EGRA 3LSZA 3GNJA 3IAS2 1UA5A 3LWAA 3VPQA 1OKDA 2H6ZA 2ZUPA 2D2ZA 6GSVA 1M0UA 3M9KA 2PWJA 5CAXA 2JADA 3UJ1A 1TK5B 4KW6A 2PBJA 2R0PA 1SJIA 2B5YA 5DQSA 3HMJG 4BVYA 1T8EB 2H75A 3ZIVA 2H0IA 4HI7A 1U6TA 3FZAA 1ZZYA 1XVQA 4MDCA 4BL7A 1GNWA 2H76A 4IVFA 2WW3A 3R2QA 5EPFA 1TU8A 2YWOA 1QMVA 2H30A 3LORA 3PR8A 5ECPB 1F37A 5DVBA 3MYDA 3GIXA 1YEPA 1ILOA 2CVKA 6GSSA 5CYYA 2DSAA 4GSSA 4YH2A 3D4TA 4MJEA 4EE0A 4XS6A 3HA9A 1FAAA 4OO4A 2GQLA 2H8LA 9GSSA 2FY6A 1EWXA 3O6TA 4PURA 1XVWA 2HYXA 1S3AA 3TRPA 1XOAA 2VL2C 1A8LA 1K3LA 1FW1A 3F4TA 3EMXA 5D9TA 1T3BA 2YWNA 4F03A 3KJYA 1DUGA 2BTOT 3P2AA 5IMAA 2CAQA 2HE3A 1XW9A 3L78A 3KD0A 1AXDA 2VD1A 3DD3A 3LYPA 1EP8A 5A4UA 4K5SA 1M9BA 5AGYA 5E59A 4LMVA 3BJ5A 2JSZA 4LMWA 4O5RA 3APOA 3F6FA 1JZRA 3FR6A 4K7OA 1U87A 3H79A 2WVXB 4MH2A 3MIXA 3UARA 2IMKA 5DJMA 2REMA 3CSIA 1B4PA 2O36A 2HLSA 3P90A 4KH7A 2QSIA 3L9SA 1OE7A 1OE8A 1Z5YE 1TRWA 4ZB7A 3HXSA 2DJ3A 2QA1A 4TR1B 3IK9A 4XRDA 5J4YA 1A24A 4ZB9A 2H74A 3H93A 2DKHA 2A2SA 2QC7A 2OE3A 2DMLA 2C0FA 3LW9A 3LFLA 1O81A 4YKFA 4RI6A 3W6GA 1OC3A 2GDRA 4PNFA 1AQVA 3IR4A 5JWRB 1I9DA 2WVXA 5ID2A 4Z2RA 5GSSA 4I8BA 3ZREA 4HZ2A 2HSYA 1DSBA 3OR5A 1TRSA 2B5XA 4KAEA 2XPDA 1TTZA 5A4VA 1ERUA 2YNXA 2HSNB 2P5RA 1JLVA 4F0CA 4NMUA 4POLA 2B1KA 3ME7A 1QFNA 3HVVA 2E2MA 4GRFA 4TR1A 2NDOA 2FWHA 4JR4A 4J57E 4HZ4A 2GSQA 4NHZA 3RPPA 3KGKA 5IMCA 1GWCA 1S3CA 3ERFA 1BEDA 5HR2A 1NHYA 17GSA 2ES7A 3IXRA 1WIKA 2AYTA 3KEBA 5IMVA 4FYCA 4TXVA 5CRWA 3ZITA 2YZUA 2CV4A 4G2EA 1M9AA 2VLVA 2WVYA 5J5NA 2LQQA 1Z7RA 4WR5A 1PFOA 5H5QA 2IFQB 2KHPA 4JRRA 3FZ5A 1G6WA 2H1LA 5G1LA 4X4JA 2H6XA 5D93A 4PTSA 2QGVA 3UAPA 13GSA 4TVEA 3M3MA 4L5OA 3UL3A 2MBSA 1NSWA 4HDEA 5JCGA 4DVCA 3DYRA 1ABAA 4GDFA 1SVOA 1MDJA 4LL4B 3GH6A 3FZ4A 4F82A 2PPTA 4X1UA 4MH3A 1SJZA 2B6MA 2F3MA 5IOXA 2OE1A 2H01A 1TRVA 3QFBC
chains in the Genus database with same CATH topology
3CBUA 3D4MA 1NW2A 4ZIJA 1BJXA 1VRSD 1A0RP 5A5KA 2QA2A 3ZIJA 3HVSA 1LU4A 2PU9C 3TJJA 4GF0A 4DSSA 2I81A 1QQ2A 2VM1A 3GURA 4JE1A 3QOUA 4KSMA 2C3QA 5GZZB 3GFKA 4BVXA 3KMNA 3GA4A 4EO3A 4POBA 5L71A 1YEXA 1KTEA 3QMXA 4K5RA 1SYRA 2FWGA 1GSQA 3FK8A 4EVMA 3QAVA 2AAWA 3HCZA 4MZWA 4MJBA 4NV2A 1TP9A 3TCOA 1B9YC 1Q98A 3IA1A 5LD0A 1SD8A 4GXZA 5JWQB 3E0UA 4MA9A 1XZOA 4XIHA 3NIVA 5IO0A 2OKAA 4FQUA 1K0OA 1URMA 1BYEA 4ML1A 4OFMA 4GLTA 1YZXA 3U5RE 4OCEA 4ZL9A 3FZ9A 5D96A 4ZB6A 2FCHA 1AIUA 1MTCA 1O6JA 3C1RA 2VAFA 1R7HA 1S3DA 5F8BA 1K3YA 5ECHB 4AKGA 1ACVA 5AIVA 5ENUA 1PN0A 1YKAA 2JZTA 4O5UA 2GLRA 5ECSA 5GAPD 2I4AA 1WJKA 2FGXA 2I9HA 5H5SA 1B9XC 1K0MA 1Z3EA 3LGCA 4AI6A 1G0TA 1SKSB 2CA8A 1J0FA 4JZQA 5J41A 2Z9SA 1SENA 2VO4A 3GKKA 1F3AA 3TGZA 1TJDA 2JU5A 2FNOA 1SU9A 12GSA 3F8UA 3EVIA 4EXJA 1V58A 3O3TA 1R5PA 3HZ8A 1PKWA 1MDIA 5INYA 2N5FA 1TRUA 4ZBBA 1A0FA 1K3OA 4HUAA 4KDUA 2F51A 2HFDA 1A2LA 1FVJA 2EFEA 3CWGA 3PGTA 2VCTA 2EIRA 2O5VA 2K8SA 5IPHA 1LJRA 4O7HA 3ZTLA 2ON7A 4KCEA 1N2AA 2H0GA 3D6IA 2C8UA 4PX1A 3TKSC 4K9ZA 2HRKB 2EFHA 2I3YA 4Z2TA 1TI3A 1FB6A 5EL8A 3FR9A 4JBBA 2JZRA 4LLRA 2LNSA 2C3TA 1ZYPA 5J9CA 2ON5A 5KN1A 3APSA 2R37A 1NM3A 4PQIA 5IMFA 1T1VA 1X0RA 4WF5A 4ID0A 3DEXA 2LTKA 5GAND 2IMIA 3IDVA 2HI7A 2H1BA 1RW1A 2OBKA 2NVLA 3GKXA 2X64A 2RUFA 3EINA 5B8BA 1CQHA 2DLXA 3DGQA 3Q6OA 2LRNA 5F05A 3RDWA 4WR4A 4HU7A 4EF0A 3DXBA 11GSA 5DBQA 3AY8A 5ELGA 5AISA 2K8VA 4P3YB 4GTUA 3WT2A 4EDZA 1SK0A 2X4AA 2ZCTA 4BA7A 1U3IA 4TN8A 1TXUA 1QUWA 4G0LA 5DDLA 1UN2A 5KN0A 3G7YA 3LYKA 4HJMA 3BCIA 4F2IA 4KB3A 1ZYNA 1XCCA 4JU5A 4BL7B 5DALA 3LQ7A 1XWBA 2LS5A 4OCFA 3QD9A 5HFIA 4BPYA 3VK9A 2M80A 3GX8A 3DVWA 1XBSA 4E8EA 5A1NB 1YF0A 2VCWA 3GUSA 1F2EA 2WDUA 2WRTA 2BJXA 2IIYA 3W8SA 4YQVA 1OC9B 5G31A 3TJGA 1SL0B 4K0GA 2X8GA 2HSHA 2LEGA 1IYIA 2YANA 1Q4JA 2GT5A 2JACA 4QMKA 3P7XA 5C04A 5D73A 2LQOA 5GSTA 1K0DA 1B4QA 3CTFA 2YJ7A 1GSFA 2YZHA 3HDCA 4MZCA 3GL3A 4FYUA 2HXKA 1X9SB 4GQCA 4OMVA 4F0BA 5A1NA 2CX3A 2GSTA 4CY8A 2B1LA 2WB9A 5A34B 4GWRA 1OC9A 4WKWA 2WCIA 1HQOA 2EFCA 5F06A 3F0IA 4NXIA 4MLYA 4WF4A 3TJFA 4J56E 1XW6A 2GS3A 4PXOA 2V32A 1GSYA 1FG4A 5COHA 3KXOA 4RUVA 4L5LA 5LCZA 3KCMA 4ICYA 6GSXA 4FO5A 2GZPA 3QR6A 3CTGA 4G10A 19GSA 5JCUA 1T4ZA 2L59A 1B8XA 5CRGA 2VCXA 4GSNA 1WE0A 4WETA 3VWWA 1G6YA 1PX7A 1SK1A 1XIYA 5IIZA 3IHQA 3I43A 4F9ZA 4NV5A 4WBJA 1OVNA 3S9FA 1PA3A 4EUYA 1YF1A 1MEKA 4AJ8A 2K18A 3F63A 5IM9A 1M2BA 1SYXA 2V6KA 2R3XA 3ZFBA 2L5OA 3TOTA 5A34A 1ON4A 2IWTA 5ID2B 3HJMA 4HJ2A 3VI5A 5EY6A 1K0AA 2N5AA 5HFGA 2YJHA 2C1YA 2DJKA 1GH2A 1WPIA 2YWIA 3BD2A 2OT3A 2M72A 5AIXA 2KP2A 1PD21 2LJAA 2WZ9A 2IL3A 2CZ3A 5J4UA 3FEUA 4L8EA 6GSUA 2LSTA 2L4QA 2LJKA 3ZVJD 5B6NA 1GSDA 1Y6EA 4Q5NA 2FLSA 2KLXA 10GSA 4IHUA 1ZCPA 1ERTA 4IJIA 2VIMA 2HRAA 5ECLB 2F8AA 5EVOA 3ZVJA 4IP1A 1GULA 4FH8A 4DEJA 1X5CA 2O8VB 2XPEA 3FW2A 2L57A 4AJ6A 3UMAA 3L9VA 2N5BA 2CQ9A 2JZSA 2LV3A 1VF1A 1F6MC 3GH9A 1PX6A 2RLIA 3CRTA 3TUEA 4V1Ap 5ABRA 3IAM2 3UIWA 3J7Yb 4KCAA 1TI1A 2YP6A 3EURA 1TDIA 2J9HA 2IN3A 2L5LA 3F3QA 2XC2A 2C4JA 4MPFA 1XWAA 3GMFA 2LJRA 3SBCA 2GSRA 4ISDA 2O89A 5J47A 5DJLA 1YKCA 2OJLA 1CQGA 2X49A 2O7KA 3ZL5A 2A2RA 4IN0A 2YPMA 1RK4A 2UZ8A 1TK0B 4O5QA 3EU4A 1QGVA 3VWVA 1AQXA 1V2AA 3F9UA 3KTBA 2G2QA 2C0GA 5HR1A 4DSSB 2AHEA 3D21A 1PL2A 3FHKA 1GSSA 1THXA 3E3EA 4BVXB 1MD3A 2HRFA 4HQZA 5IO2A 3I6AA 3WD6A 2JL4A 1ST9A 4RI7A 4G0KA 5G2ZA 2XBIA 2HT9A 1XOBA 3GSSA 4KA0A 1FVKA 3EE2A 4K0NA 1EOHA 3RBTA 1PN9A 2RIIA 4OWYA 4OO5A 18GSA 8GSSA 4Z2UA 2WJUA 2ALBA 3VURA 2CAIA 2GQMA 2PN8A 2MMNA 3BOAA 4KSOA 5FWGA 2LRTA 1PSQA 3VWUA 4WBRD 1XFLA 4GSTA 5F07A 4CHSA 3VLNA 3LJRA 1ZOFA 3CRUA 4MCUA 3EC3A 4EDYA 4MF7A 3FY7A 4AGSA 4LL1B 3TB2A 2JSYA 1Y1UA 4IQAA 4ECIA 1FOVA 1EEMA 2R0CA 3ME8A 3SWLA 2VUPA 1BG1A 3PH9A 2M46A 2TIRA 4POMA 2KOKA 3L0HA 2LUSA 2C0EA 3LXTA 2BMXA 5C00A 2VD0A 2FD3A 1H4OA 6GSYA 2GGTA 2VCZA 3CXGA 3WGXA 4PGTA 2F8FA 3DIEA 3A5WA 3L4NA 2G0FA 3QCPA 3RHCA 5HR3A 3G7IA 4IW9A 3KMOA 4Q5FA 1ZL9A 3HY2A 1U3AA 2P5QA 4TRXA 1Z6MA 3IV4A 5H5RA 5KOWA 1BG5A 1JZWA 3ZFLA 5J9BA 2IMFA 1EV9A 4MF6A 2VL2A 2GTUA 1XWCA 3ERGA 3FKFA 1F3BA 1T7PB 3UVHA 2PVOC 2FA4A 2YWMA 1A23A 2H6YA 3LG6A 2H66A 2MMAA 3ERWA 4WEYA 3DRNA 1SD9A 3QDNA 4K7NA 3D5JA 1UC7A 1Y25A 1XW5A 3C1SA 4K2DA 4A5PA 3HVXA 4KDYA 2AUVA 2GVPA 4MNNA 2AB6A 3QFAC 2YOIA 3FRCA 3GV1A 4HQSA 3TU3B 4Q5QA 4AKXB 2H71A 4E68A 4NAXA 2CX4A 1ZYQB 4I97A 3KH7A 2WULA 1SKWB 2PGTA 2FWFA 4YAPA 3IK7A 4I2UA 4K8MA 1KBNA 3I9V2 1ML6A 3ISOA 1FB0A 2R2JA 1NHOA 1HD2A 1SVLA 5ECKB 4ZL7A 1ZMAA 4D73A 2V1MA 1N25A 16GSA 6GSWA 2P31A 4PNGA 3EWLA 5D9WA 3CSHA 3HKRA 5CP1A 1BF5A 3QAWA 5ECNB 20GSA 4IJ3A 5F0GA 2R5GA 4YAVA 4V2MA 3MAKA 4MMMA 3TJKA 2EFDA 3KM6A 3TJBA 2O87A 4FIWA 3QPMA 4HS1A 4IBPA 4QL9A 1R26A 2X8HA 1V57A 1ZGNA 1FOHA 4RQXA 4G01A 1KNGA 1FO5A 1GUKA 4MF5A 3ZLPA 5DALB 2H70A 1PL1A 1GLPA 1VGLA 2C3NA 4ZB8A 2H0HA 2EIQA 1USBA 3TKRA 4QQ7A 2OA7A 2V41A 3C71A 4J2FA 4N0VA 3EU3A 4N0ZA 4ECCA 2DJ1A 3D0ZA 1T4YA 4OFTA 4QL7A 1HNAA 1H75A 1YY7A 5JWOB 2YN1A 4Z7XA 1GTAA 4AJ7A 1A8YA 3APQA 4XCSA 3BBYA 2H19A 1AQWA 2OE0A 2HZEB 1B48A 3TKSE 1OAZA 4N30A 4ACSA 2DKIA 5KN2A 3H8QA 4X0XA 3D22A 5DAKA 2DMMA 2EIOA 1FHEA 5BRTA 1EEJA 3LXZA 1WMJA 2MMOA 3A3TA 3TOUA 2R4VA 1I5GA 5B7CA 4FYBA 4PQ1A 2VM2A 5KN3A 2FWEA 1SL2B 4ECBA 1WWJA 4L0UA 3TRXA 3VPTA 1TK8B 2YV9A 5DQYA 4MJAA 2DJ0A 3DVXA 1YJ6A 5G5EA 4K7IA 2HZEA 3U6VA 3F4RA 4AKIA 3Q74A 1E2YA 2DC5A 2GZZA 1GNEA 1MD4A 4TKYA 4MJCA 3RPNA 2WGRA 4ILFA 3CSJA 2PERA 4KX4A 4X43A 4IS0A 5HQPA 1J9BA 1XPVA 2X8CA 2ZNMA 5J4VA 3Q19A 3GKMA 1PRXA 3MDKA 1RQMA 2X99A 4JEDA 4KGIA 3C7MA 4IP6A 2TRXA 4AKHA 1TXXA 2GQKA 3IBHA 4ULXA 3TKQA 4TXOB 5BMUB 4ZBAA 1N8JA 1GSUA 1SKRB 4KE3A 1O85A 2KUCA 3F4SA 3EMPA 4GQFA 1K0CA 4KUNA 3FYGA 1YDKA 4XHMA 4PQHA 2OADA 2RM6A 3DWVA 4MZBA 2GZYA 4ZILA 1GP1A 2L6DA 3UBLA 6GSTA 2CVBA 2H73A 4EIPA 3H1NA 3A2XA 2DBCA 5E4WA 4L0WA 3DMLA 2VL9A 5J3RA 4OFNA 5DCGA 3VFIA 2HNLA 2J23A 5ECRB 2LKUA 1XXUA 1QXHA 4TXOA 5BMUA 3MSZA 3IPZA 2HRNA 1YVLA 2B3SA 5KOXA 2H1DA 3KZQA 4DSRA 5B6MA 5CO3A 1ERWA 5B8AA 1O8XA 4IQ1A 1M2AA 4NPBA 5DCHA 1SVMA 2E0QA 1BQ7A 1J08A 3GTUB 1X5EA 1GL8A 5A4WA 4TW5A 2I1UA 1BX9A 3GN3A 1C72A 5D9VA 2FUG2 2OACA 2K6VA 1JZOA 5G1KA 3GL5A 4KDXA 2AJQB 4PUFC 4HU9A 4IKHA 5IOWA 2L4CA 4ZBDA 1VF4A 5G30A 3TKSA 4AF2A 3WT1A 4EIQA 5CNWA 1V9WA 4LA1A 2R0GA 5IQYA 2A4HA 3IHGA 2XBQA 3O76A 2E7PA 1G7EA 1F9MA 1XWGA 1EGOA 1UVZA 4O92A 3PINA 2V2GA 4IELA 3A2VA 4KNDA 4TR3A 3GSTA 2DJJA 3KP8A 3N9JA 4ZXGA 2VCVA 3E9JB 22GSA 2HSMB 3P8WA 5CREA 4POKA 5KEJA 3GTUA 14GSA 3MWHA 5FHIA 3HYPA 3HJOA 2KP1A 5ECQB 5HFKA 1T00A 3WYWA 4BWQA 4PUAA 5A5HB 1VF2A 4XS1A 3WGEA 1BAYA 1O8WA 1M99A 4OD7A 1THOA 3PPUA 3N5OA 4WXTA 4Q5RA 1ERVA 4V2NA 1IYHA 1M7TA 1HNBA 4N10A 3NZNA 1SJ6A 3GKNA 1K0BA 3GYKA 3A5IA 3LEFA 3IRAA 4MPGA 3K8NA 1X9MB 2HSNA 1PKZA 3R3EA 2HSMA 3BCKA 1O7UA 4G0IA 4MP4A 2LRCA 2R6KA 2DIZA 1EP7A 3G9BA 2PUKC 1GTIA 1JHBA 5ECMB 2A2PA 3V1WA 5A5HA 4V1Ag 4JR6A 3KTLA 1U88A 4ML6A 1V40A 4NWYA 2V6OA 5ECIB 3VI7A 1KEBA 3KP9A 2VLUA 4CDOA 3ZMKA 3ZRDA 3UEMA 2WS2A 1AC1A 3IE3A 1DE1A 4I2TA 4BWSA 1DBYA 3F3RA 3A2WA 1ZYEA 2CZ2A 3UOMA 1XWKA 2VKZG 3KIJA 2XHFA 2IFQA 3L9UA 3M1GA 1X9WB 2MZCA 3RAZA 3CMIA 3UVTA 3HHVA 1TOFA 2H72A 2HQTA 1WOUA 3ZYWA 3GHAA 2B7JA 3M0FA 4I5QA 2P0GA 3GX0A 1VF3A 3EPTA 3UBKA 1GUMA 4GCIA 2NPBA 4O32A 1WP0A 2IJYA 2VL3A 2GT6A 4MABA 3H4KA 1EV4A 2UV8G 1AUCA 2NBSA 3W8JA 5FT3A 4HOJA 4W66A 3C73A 1PQNA 4H86A 2DJ2A 1OC8A 5G5FA 2MMZA 5HR0A 1GLQA 1TKDB 2PVQA 5LNKe 3F6DA 1TU7A 1GSEA 4N11A 3EYTA 4D73B 4K6XA 2RM5A 1JZDA 5J40A 3IC4A 1GTBA 3NOFA 1GRXA 4KF9A 4G19A 3JCML 4YQUA 2F9SA 1W4VA 5D9XA 4TR4A 3C8EA 3M9JA 2RUEA 3G7JA 2IPAA 1QK8A 2A4VA 4I6XA 1Z6NA 2FHEA 5AN1A 3WGDA 1GUHA 1R5AA 3FMWA 3ED3A 2TRCP 4G9HA 3ZMLA 4IGJA 5IPGA 2B5EA 1PGTA 1PMTA 1GTUA 5CRHA 3FR3A 3Q18A 1LBKA 1Z7PA 4USSA 1E6BA 3DKSA 4ZL8A 2WFCA 1OKTA 2C0DA 4V2LA 1A2JA 3HD5A 5CRDA 3HJPA 2YV7A 1AAZA 4RQRA 4YQMA 3VWXA 2VLTA 1SK2A 4XTSA 3MNGA 4TOPA 2LNTA 5D8IA 1HNCA 1MDKA 3TRQA 1JLWA 5IMDA 3US3A 4EC0A 4N3ZA 4K2XA 3J7Yk 4CY6A 4YKGA 4MK3A 1HYUA 4HEA2 5ELAA 1O73A 4NHWA 1WRYA 2HZFA 3TKPA 3M8NA 1V98A 2PMTA 2AV4A 1R4WA 3KH9A 5DAKB 2H1GA 3IOSA 2FA8A 2IMDA 2QKEA 2E2GA 2EC4A 3I69A 1SL1B 1AW9A 1EOGA 1Z9HA 1A2MA 2MBTA 5ECOB 2IMEA 4XS4B 4EKZA 3ZZXA 5JCWA 2NTOA 2K9FA 1EZKA 1G7OA 2H1AA 1DE2A 3IC8A 2HRKA 1X5DA 3RHBA 3QAGA 4K1FA 2OBIA 2VOCA 2L6CA 4TR0A 3GRXA 3CYNA 4XRAA 2O85A 3TDGA 1TW9A 2B7KA 2C80A 2DIYA 1K0NA 4BVYB 2MYGA 4DSQA 4ECJA 4CW9A 7GSSA 1YQ1A 1W89A 1JFUA 3HZ4A 2VCQA 4EL1A 1OYJA 4E8HA 4XS4A 1M2DA 5IMZA 2GSSA 2CT6A 2YCDA 2CVDA 1EGRA 3LSZA 3GNJA 3IAS2 1UA5A 3LWAA 3VPQA 1OKDA 2H6ZA 2ZUPA 2D2ZA 6GSVA 1M0UA 3M9KA 2PWJA 5CAXA 2JADA 3UJ1A 1TK5B 4KW6A 2PBJA 2R0PA 1SJIA 2B5YA 5DQSA 3HMJG 4BVYA 1T8EB 2H75A 3ZIVA 2H0IA 4HI7A 1U6TA 3FZAA 1ZZYA 1XVQA 4MDCA 4BL7A 1GNWA 2H76A 4IVFA 3R2QA 5EPFA 1TU8A 2YWOA 1QMVA 2H30A 3LORA 3PR8A 5ECPB 1F37A 5DVBA 3MYDA 3GIXA 1YEPA 1ILOA 2CVKA 6GSSA 5CYYA 2DSAA 4GSSA 4YH2A 3D4TA 4MJEA 4EE0A 4XS6A 3HA9A 1FAAA 4OO4A 2GQLA 2H8LA 9GSSA 2FY6A 1EWXA 3O6TA 4PURA 1XVWA 2HYXA 1S3AA 3TRPA 1XOAA 2VL2C 1A8LA 1K3LA 1FW1A 3F4TA 3EMXA 5D9TA 1T3BA 2YWNA 4F03A 3KJYA 1DUGA 2BTOT 3P2AA 5IMAA 2CAQA 2HE3A 1XW9A 3L78A 3KD0A 1AXDA 2VD1A 3DD3A 3LYPA 1EP8A 5A4UA 4K5SA 1M9BA 5AGYA 5E59A 4LMVA 3BJ5A 2JSZA 4LMWA 4O5RA 3APOA 3F6FA 1JZRA 3FR6A 4K7OA 1U87A 3H79A 4MH2A 3MIXA 3UARA 2IMKA 5DJMA 2REMA 3CSIA 1B4PA 2HLSA 3P90A 4KH7A 2QSIA 3L9SA 1OE7A 1OE8A 1Z5YE 1TRWA 4ZB7A 3HXSA 2DJ3A 2QA1A 4TR1B 3IK9A 4XRDA 5J4YA 1A24A 4ZB9A 2H74A 3H93A 2DKHA 2A2SA 2QC7A 2OE3A 2DMLA 2C0FA 3LW9A 3LFLA 1O81A 4YKFA 4RI6A 3W6GA 1OC3A 2GDRA 4PNFA 1AQVA 3IR4A 5JWRB 1I9DA 5ID2A 4Z2RA 5GSSA 4I8BA 3ZREA 4HZ2A 2HSYA 1DSBA 3OR5A 1TRSA 2B5XA 4KAEA 2XPDA 1TTZA 5A4VA 1ERUA 2YNXA 2HSNB 2P5RA 1JLVA 4F0CA 4NMUA 4POLA 2B1KA 3ME7A 1QFNA 3HVVA 2E2MA 4GRFA 4TR1A 2NDOA 2FWHA 4JR4A 4J57E 4HZ4A 2GSQA 4NHZA 3RPPA 3KGKA 5IMCA 1GWCA 1S3CA 3ERFA 1BEDA 5HR2A 1NHYA 17GSA 2ES7A 3IXRA 1WIKA 2AYTA 3KEBA 5IMVA 4FYCA 4TXVA 5CRWA 3ZITA 2YZUA 2CV4A 4G2EA 1M9AA 2VLVA 5J5NA 2LQQA 1Z7RA 4WR5A 5H5QA 2IFQB 2KHPA 4JRRA 3FZ5A 1G6WA 2H1LA 5G1LA 4X4JA 2H6XA 5D93A 4PTSA 2QGVA 3UAPA 13GSA 4TVEA 3M3MA 4L5OA 3UL3A 2MBSA 1NSWA 4HDEA 5JCGA 4DVCA 3DYRA 1ABAA 4GDFA 1SVOA 1MDJA 4LL4B 3GH6A 3FZ4A 4F82A 2PPTA 4X1UA 4MH3A 1SJZA 2B6MA 2F3MA 5IOXA 2OE1A 2H01A 1TRVA 3QFBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBU A;  3D4M A;  1NW2 A;  4ZIJ A;  1BJX A;  1VRS D;  1A0R P;  5A5K A;  3ZIJ A;  3HVS A;  1LU4 A;  2PU9 C;  3TJJ A;  4GF0 A;  4DSS A;  2I81 A;  1QQ2 A;  2VM1 A;  3GUR A;  4JE1 A;  3QOU A;  4KSM A;  2C3Q A;  5GZZ B;  3GFK A;  4BVX A;  3KMN A;  3GA4 A;  4EO3 A;  4POB A;  5L71 A;  1YEX A;  1KTE A;  3QMX A;  1SYR A;  2FWG A;  1GSQ A;  3FK8 A;  4EVM A;  3QAV A;  2AAW A;  3HCZ A;  4MZW A;  4MJB A;  4NV2 A;  1TP9 A;  3TCO A;  1B9Y C;  1Q98 A;  3IA1 A;  5LD0 A;  1SD8 A;  4GXZ A;  5JWQ B;  3E0U A;  4MA9 A;  1XZO A;  4XIH A;  3NIV A;  5IO0 A;  2OKA A;  4FQU A;  1K0O A;  1URM A;  1BYE A;  4ML1 A;  4OFM A;  4GLT A;  1YZX A;  3U5R E;  4OCE A;  4ZL9 A;  3FZ9 A;  5D96 A;  4ZB6 A;  2FCH A;  1AIU A;  1MTC A;  1O6J A;  3C1R A;  2VAF A;  1R7H A;  1S3D A;  5F8B A;  1K3Y A;  5ECH B;  1ACV A;  5AIV A;  5ENU A;  1YKA A;  2JZT A;  2GLR A;  5ECS A;  5GAP D;  2I4A A;  1WJK A;  2FGX A;  2I9H A;  5H5S A;  1B9X C;  1K0M A;  1Z3E A;  3LGC A;  1G0T A;  1SKS B;  2CA8 A;  1J0F A;  4JZQ A;  5J41 A;  2Z9S A;  1SEN A;  2VO4 A;  3GKK A;  1F3A A;  3TGZ A;  1TJD A;  2JU5 A;  2FNO A;  1SU9 A;  12GS A;  3F8U A;  3EVI A;  4EXJ A;  1V58 A;  3O3T A;  1R5P A;  3HZ8 A;  1PKW A;  1MDI A;  5INY A;  2N5F A;  1TRU A;  4ZBB A;  1A0F A;  1K3O A;  4HUA A;  4KDU A;  2F51 A;  2HFD A;  1A2L A;  1FVJ A;  3PGT A;  2VCT A;  2EIR A;  2K8S A;  5IPH A;  1LJR A;  4O7H A;  3ZTL A;  2ON7 A;  4KCE A;  1N2A A;  2H0G A;  3D6I A;  2C8U A;  4PX1 A;  3TKS C;  4K9Z A;  2HRK B;  2I3Y A;  1TI3 A;  1FB6 A;  5EL8 A;  3FR9 A;  4JBB A;  2JZR A;  4LLR A;  2LNS A;  2C3T A;  5J9C A;  2ON5 A;  5KN1 A;  3APS A;  2R37 A;  1NM3 A;  4PQI A;  5IMF A;  1T1V A;  1X0R A;  4WF5 A;  4ID0 A;  3DEX A;  2LTK A;  5GAN D;  2IMI A;  3IDV A;  2HI7 A;  2H1B A;  1RW1 A;  2OBK A;  2NVL A;  3GKX A;  2X64 A;  2RUF A;  3EIN A;  5B8B A;  1CQH A;  2DLX A;  3DGQ A;  3Q6O A;  2LRN A;  5F05 A;  3RDW A;  4WR4 A;  4HU7 A;  4EF0 A;  3DXB A;  11GS A;  5DBQ A;  3AY8 A;  5ELG A;  5AIS A;  2K8V A;  4P3Y B;  4GTU A;  3WT2 A;  4EDZ A;  1SK0 A;  2ZCT A;  4BA7 A;  1U3I A;  4TN8 A;  1QUW A;  4G0L A;  5DDL A;  1UN2 A;  5KN0 A;  3G7Y A;  4HJM A;  3LYK A;  3BCI A;  4F2I A;  4KB3 A;  1XCC A;  4JU5 A;  4BL7 B;  5DAL A;  3LQ7 A;  1XWB A;  2LS5 A;  4OCF A;  3QD9 A;  5HFI A;  4BPY A;  3VK9 A;  2M80 A;  3GX8 A;  3DVW A;  1XBS A;  4E8E A;  1YF0 A;  2VCW A;  3GUS A;  1F2E A;  2WDU A;  2WRT A;  2BJX A;  2IIY A;  3W8S A;  4YQV A;  1OC9 B;  5G31 A;  3TJG A;  1SL0 B;  4K0G A;  2X8G A;  2HSH A;  2LEG A;  1IYI A;  2YAN A;  1Q4J A;  2GT5 A;  2JAC A;  3P7X A;  5C04 A;  5D73 A;  2LQO A;  5GST A;  1K0D A;  1B4Q A;  3CTF A;  2YJ7 A;  1GSF A;  2YZH A;  3HDC A;  4MZC A;  3GL3 A;  4FYU A;  2HXK A;  1X9S B;  4GQC A;  4OMV A;  4F0B A;  2CX3 A;  2GST A;  2B1L A;  2WB9 A;  4GWR A;  1OC9 A;  4WKW A;  2WCI A;  1HQO A;  5F06 A;  3F0I A;  4NXI A;  4MLY A;  4WF4 A;  3TJF A;  4J56 E;  1XW6 A;  2GS3 A;  4PXO A;  2V32 A;  1GSY A;  1FG4 A;  5COH A;  3KXO A;  4RUV A;  4L5L A;  5LCZ A;  3KCM A;  6GSX A;  4FO5 A;  2GZP A;  3QR6 A;  3CTG A;  4G10 A;  19GS A;  5JCU A;  1T4Z A;  2L59 A;  1B8X A;  5CRG A;  2VCX A;  4GSN A;  1WE0 A;  4WET A;  3VWW A;  1G6Y A;  1PX7 A;  1SK1 A;  1XIY A;  5IIZ A;  3IHQ A;  3I43 A;  4F9Z A;  4NV5 A;  4WBJ A;  1OVN A;  3S9F A;  1PA3 A;  4EUY A;  1YF1 A;  1MEK A;  4AJ8 A;  2K18 A;  3F63 A;  5IM9 A;  1M2B A;  1SYX A;  2V6K A;  2R3X A;  3ZFB A;  2L5O A;  3TOT A;  1ON4 A;  2IWT A;  5ID2 B;  3HJM A;  4HJ2 A;  3VI5 A;  5EY6 A;  1K0A A;  2N5A A;  5HFG A;  2YJH A;  2C1Y A;  2DJK A;  1GH2 A;  1WPI A;  2YWI A;  3BD2 A;  2M72 A;  5AIX A;  2KP2 A;  1PD2 1;  2LJA A;  2WZ9 A;  2IL3 A;  2CZ3 A;  5J4U A;  3FEU A;  4L8E A;  6GSU A;  2LST A;  2L4Q A;  2LJK A;  3ZVJ D;  5B6N A;  1GSD A;  1Y6E A;  4Q5N A;  2FLS A;  2KLX A;  10GS A;  4IHU A;  1ZCP A;  1ERT A;  4IJI A;  2VIM A;  2HRA A;  5ECL B;  2F8A A;  5EVO A;  3ZVJ A;  4IP1 A;  1GUL A;  4FH8 A;  4DEJ A;  1X5C A;  2O8V B;  2XPE A;  3FW2 A;  2L57 A;  4AJ6 A;  3UMA A;  3L9V A;  2N5B A;  2CQ9 A;  2JZS A;  2LV3 A;  1VF1 A;  1F6M C;  3GH9 A;  1PX6 A;  2RLI A;  3CRT A;  3TUE A;  4V1A p;  5ABR A;  3IAM 2;  3UIW A;  3J7Y b;  4KCA A;  1TI1 A;  2YP6 A;  3EUR A;  1TDI A;  2J9H A;  2IN3 A;  2L5L A;  3F3Q A;  2XC2 A;  2C4J A;  4MPF A;  1XWA A;  3GMF A;  2LJR A;  3SBC A;  2GSR A;  4ISD A;  2O89 A;  5DJL A;  1YKC A;  2OJL A;  1CQG A;  2O7K A;  3ZL5 A;  2A2R A;  4IN0 A;  2YPM A;  1RK4 A;  2UZ8 A;  1TK0 B;  3EU4 A;  1QGV A;  3VWV A;  1AQX A;  1V2A A;  3F9U A;  3KTB A;  2G2Q A;  2C0G A;  5HR1 A;  4DSS B;  2AHE A;  3D21 A;  1PL2 A;  3FHK A;  1GSS A;  1THX A;  3E3E A;  4BVX B;  1MD3 A;  2HRF A;  4HQZ A;  5IO2 A;  3I6A A;  3WD6 A;  2JL4 A;  1ST9 A;  4RI7 A;  4G0K A;  5G2Z A;  2XBI A;  2HT9 A;  1XOB A;  3GSS A;  4KA0 A;  1FVK A;  3EE2 A;  4K0N A;  1EOH A;  3RBT A;  1PN9 A;  2RII A;  4OWY A;  4OO5 A;  18GS A;  8GSS A;  2WJU A;  2ALB A;  3VUR A;  2CAI A;  2GQM A;  2PN8 A;  2MMN A;  3BOA A;  4KSO A;  5FWG A;  2LRT A;  1PSQ A;  3VWU A;  4WBR D;  1XFL A;  4GST A;  5F07 A;  4CHS A;  3VLN A;  3LJR A;  1ZOF A;  3CRU A;  4MCU A;  3EC3 A;  4EDY A;  4MF7 A;  3FY7 A;  4AGS A;  4LL1 B;  3TB2 A;  2JSY A;  4IQA A;  4ECI A;  1FOV A;  1EEM A;  3ME8 A;  3SWL A;  2VUP A;  3PH9 A;  2M46 A;  2TIR A;  4POM A;  2KOK A;  3L0H A;  2LUS A;  2C0E A;  3LXT A;  2BMX A;  5C00 A;  2VD0 A;  2FD3 A;  1H4O A;  6GSY A;  2GGT A;  2VCZ A;  3CXG A;  3WGX A;  4PGT A;  2F8F A;  3DIE A;  3A5W A;  3L4N A;  2G0F A;  3QCP A;  3RHC A;  5HR3 A;  3G7I A;  4IW9 A;  3KMO A;  4Q5F A;  1ZL9 A;  3HY2 A;  1U3A A;  2P5Q A;  4TRX A;  1Z6M A;  3IV4 A;  5H5R A;  1BG5 A;  1JZW A;  3ZFL A;  5J9B A;  2IMF A;  1EV9 A;  4MF6 A;  2VL2 A;  2GTU A;  1XWC A;  3ERG A;  3FKF A;  1F3B A;  1T7P B;  3UVH A;  2PVO C;  2FA4 A;  2YWM A;  1A23 A;  2H6Y A;  3LG6 A;  2H66 A;  2MMA A;  3ERW A;  4WEY A;  3DRN A;  1SD9 A;  3QDN A;  4K7N A;  3D5J A;  1UC7 A;  1Y25 A;  1XW5 A;  3C1S A;  4K2D A;  3HVX A;  4KDY A;  2AUV A;  2GVP A;  2AB6 A;  3QFA C;  2YOI A;  3FRC A;  3GV1 A;  4HQS A;  4Q5Q A;  2H71 A;  4NAX A;  2CX4 A;  1ZYQ B;  4I97 A;  3KH7 A;  2WUL A;  1SKW B;  2PGT A;  2FWF A;  4YAP A;  3IK7 A;  4I2U A;  4K8M A;  1KBN A;  3I9V 2;  1ML6 A;  3ISO A;  1FB0 A;  2R2J A;  1NHO A;  1HD2 A;  5ECK B;  4ZL7 A;  1ZMA A;  4D73 A;  2V1M A;  16GS A;  6GSW A;  2P31 A;  4PNG A;  3EWL A;  5D9W A;  3CSH A;  3HKR A;  5CP1 A;  3QAW A;  5ECN B;  20GS A;  4IJ3 A;  5F0G A;  2R5G A;  4YAV A;  4V2M A;  3MAK A;  4MMM A;  3TJK A;  3KM6 A;  3TJB A;  2O87 A;  4FIW A;  3QPM A;  4HS1 A;  4IBP A;  4QL9 A;  1R26 A;  2X8H A;  1V57 A;  1ZGN A;  4RQX A;  1KNG A;  1FO5 A;  1GUK A;  4MF5 A;  3ZLP A;  5DAL B;  2H70 A;  1PL1 A;  1GLP A;  1VGL A;  2C3N A;  4ZB8 A;  2H0H A;  2EIQ A;  1USB A;  3TKR A;  4QQ7 A;  2OA7 A;  2V41 A;  3C71 A;  4J2F A;  4N0V A;  3EU3 A;  4N0Z A;  4ECC A;  2DJ1 A;  3D0Z A;  1T4Y A;  4OFT A;  4QL7 A;  1HNA A;  1H75 A;  1YY7 A;  5JWO B;  2YN1 A;  4Z7X A;  1GTA A;  4AJ7 A;  1A8Y A;  3APQ A;  4XCS A;  3BBY A;  2H19 A;  1AQW A;  2OE0 A;  2HZE B;  1B48 A;  3TKS E;  1OAZ A;  4N30 A;  4ACS A;  5KN2 A;  3H8Q A;  4X0X A;  3D22 A;  5DAK A;  2DMM A;  2EIO A;  1FHE A;  1EEJ A;  3LXZ A;  1WMJ A;  2MMO A;  3A3T A;  3TOU A;  2R4V A;  1I5G A;  5B7C A;  4FYB A;  4PQ1 A;  2VM2 A;  5KN3 A;  2FWE A;  1SL2 B;  4ECB A;  1WWJ A;  4L0U A;  3TRX A;  3VPT A;  1TK8 B;  2YV9 A;  5DQY A;  4MJA A;  2DJ0 A;  3DVX A;  1YJ6 A;  5G5E A;  4K7I A;  2HZE A;  3U6V A;  3F4R A;  3Q74 A;  1E2Y A;  2DC5 A;  2GZZ A;  1GNE A;  1MD4 A;  4TKY A;  4MJC A;  3RPN A;  2WGR A;  4ILF A;  3CSJ A;  2PER A;  4KX4 A;  4X43 A;  4IS0 A;  5HQP A;  1J9B A;  1XPV A;  2X8C A;  2ZNM A;  3Q19 A;  3GKM A;  1PRX A;  3MDK A;  1RQM A;  2X99 A;  4JED A;  4KGI A;  3C7M A;  4IP6 A;  2TRX A;  1TXX A;  2GQK A;  3IBH A;  4ULX A;  3TKQ A;  4TXO B;  4ZBA A;  1N8J A;  1GSU A;  1SKR B;  4KE3 A;  1O85 A;  2KUC A;  3F4S A;  3EMP A;  4GQF A;  1K0C A;  4KUN A;  3FYG A;  1YDK A;  4XHM A;  4PQH A;  2OAD A;  2RM6 A;  3DWV A;  4MZB A;  2GZY A;  4ZIL A;  1GP1 A;  2L6D A;  3UBL A;  6GST A;  2CVB A;  2H73 A;  3H1N A;  3A2X A;  2DBC A;  5E4W A;  4L0W A;  3DML A;  2VL9 A;  5J3R A;  4OFN A;  5DCG A;  3VFI A;  2HNL A;  2J23 A;  5ECR B;  2LKU A;  1XXU A;  1QXH A;  4TXO A;  5BMU A;  3MSZ A;  3IPZ A;  2HRN A;  2B3S A;  2H1D A;  3KZQ A;  4DSR A;  5B6M A;  5CO3 A;  1ERW A;  5B8A A;  1O8X A;  4IQ1 A;  1M2A A;  4NPB A;  5DCH A;  2E0Q A;  1BQ7 A;  1J08 A;  3GTU B;  1X5E A;  1GL8 A;  5A4W A;  4TW5 A;  2I1U A;  1BX9 A;  3GN3 A;  1C72 A;  5D9V A;  2FUG 2;  2OAC A;  2K6V A;  1JZO A;  5G1K A;  3GL5 A;  4KDX A;  2AJQ B;  4PUF C;  4HU9 A;  4IKH A;  5IOW A;  2L4C A;  4ZBD A;  1VF4 A;  5G30 A;  3TKS A;  4AF2 A;  3WT1 A;  5CNW A;  1V9W A;  4LA1 A;  5IQY A;  2XBQ A;  3O76 A;  2E7P A;  1G7E A;  1F9M A;  1XWG A;  1EGO A;  1UVZ A;  4O92 A;  3PIN A;  2V2G A;  4IEL A;  3A2V A;  4KND A;  4TR3 A;  3GST A;  2DJJ A;  3KP8 A;  3N9J A;  4ZXG A;  2VCV A;  3E9J B;  22GS A;  2HSM B;  3P8W A;  5CRE A;  4POK A;  5KEJ A;  3GTU A;  14GS A;  3MWH A;  5FHI A;  3HYP A;  3HJO A;  2KP1 A;  5ECQ B;  5HFK A;  1T00 A;  3WYW A;  4BWQ A;  4PUA A;  1VF2 A;  4XS1 A;  3WGE A;  1BAY A;  1O8W A;  1M99 A;  4OD7 A;  1THO A;  3PPU A;  3N5O A;  4WXT A;  4Q5R A;  1ERV A;  4V2N A;  1IYH A;  1M7T A;  1HNB A;  4N10 A;  3NZN A;  1SJ6 A;  3GKN A;  1K0B A;  3GYK A;  3LEF A;  3IRA A;  4MPG A;  3K8N A;  1X9M B;  3R3E A;  1PKZ A;  2HSM A;  3BCK A;  1O7U A;  4G0I A;  4MP4 A;  2LRC A;  2R6K A;  2DIZ A;  1EP7 A;  3G9B A;  2PUK C;  1GTI A;  1JHB A;  5ECM B;  3V1W A;  4V1A g;  4JR6 A;  3KTL A;  1U88 A;  4ML6 A;  1V40 A;  4NWY A;  2V6O A;  5ECI B;  3VI7 A;  1KEB A;  3KP9 A;  2VLU A;  4CDO A;  3ZMK A;  3ZRD A;  3UEM A;  2WS2 A;  1AC1 A;  3IE3 A;  1DE1 A;  4I2T A;  4BWS A;  1DBY A;  3F3R A;  3A2W A;  1ZYE A;  2CZ2 A;  3UOM A;  1XWK A;  3KIJ A;  2XHF A;  2IFQ A;  3L9U A;  3M1G A;  1X9W B;  2MZC A;  3RAZ A;  3CMI A;  3UVT A;  3HHV A;  1TOF A;  2H72 A;  2HQT A;  1WOU A;  3ZYW A;  3GHA A;  2B7J A;  3M0F A;  4I5Q A;  2P0G A;  3GX0 A;  1VF3 A;  3UBK A;  1GUM A;  4GCI A;  2NPB A;  4O32 A;  1WP0 A;  2IJY A;  2VL3 A;  2GT6 A;  4MAB A;  3H4K A;  1EV4 A;  2NBS A;  1AUC A;  3W8J A;  5FT3 A;  4HOJ A;  3C73 A;  4H86 A;  1PQN A;  2DJ2 A;  1OC8 A;  5G5F A;  2MMZ A;  5HR0 A;  1GLQ A;  1TKD B;  2PVQ A;  5LNK e;  3F6D A;  1TU7 A;  1GSE A;  4N11 A;  3EYT A;  4D73 B;  4K6X A;  2RM5 A;  1JZD A;  3IC4 A;  1GTB A;  3NOF A;  1GRX A;  4KF9 A;  4G19 A;  3JCM L;  4YQU A;  2F9S A;  1W4V A;  5D9X A;  4TR4 A;  3C8E A;  3M9J A;  2RUE A;  3G7J A;  2IPA A;  1QK8 A;  2A4V A;  4I6X A;  1Z6N A;  2FHE A;  5AN1 A;  3WGD A;  1GUH A;  1R5A A;  3ED3 A;  2TRC P;  4G9H A;  3ZML A;  4IGJ A;  5IPG A;  2B5E A;  1PGT A;  1PMT A;  1GTU A;  5CRH A;  3FR3 A;  3Q18 A;  1LBK A;  1Z7P A;  4USS A;  1E6B A;  3DKS A;  4ZL8 A;  2WFC A;  1OKT A;  2C0D A;  4V2L A;  1A2J A;  3HD5 A;  5CRD A;  3HJP A;  2YV7 A;  1AAZ A;  4RQR A;  4YQM A;  3VWX A;  2VLT A;  1SK2 A;  4XTS A;  3MNG A;  4TOP A;  2LNT A;  5D8I A;  1HNC A;  1MDK A;  3TRQ A;  1JLW A;  5IMD A;  3US3 A;  4EC0 A;  3J7Y k;  4MK3 A;  1HYU A;  4HEA 2;  5ELA A;  1O73 A;  4NHW A;  1WRY A;  2HZF A;  3TKP A;  3M8N A;  1V98 A;  2PMT A;  2AV4 A;  1R4W A;  3KH9 A;  5DAK B;  2H1G A;  3IOS A;  2FA8 A;  2IMD A;  2QKE A;  2E2G A;  2EC4 A;  3I69 A;  1SL1 B;  1AW9 A;  1EOG A;  1Z9H A;  1A2M A;  2MBT A;  5ECO B;  2IME A;  4XS4 B;  4EKZ A;  3ZZX A;  5JCW A;  2NTO A;  2K9F A;  1EZK A;  1G7O A;  2H1A A;  1DE2 A;  3IC8 A;  2HRK A;  1X5D A;  3RHB A;  3QAG A;  4K1F A;  2OBI A;  2VOC A;  2L6C A;  4TR0 A;  3GRX A;  3CYN A;  4XRA A;  2O85 A;  3TDG A;  1TW9 A;  2B7K A;  2C80 A;  2DIY A;  1K0N A;  4BVY B;  2MYG A;  4DSQ A;  4ECJ A;  4CW9 A;  7GSS A;  1YQ1 A;  1W89 A;  1JFU A;  3HZ4 A;  2VCQ A;  4EL1 A;  1OYJ A;  4E8H A;  4XS4 A;  1M2D A;  5IMZ A;  2GSS A;  2CT6 A;  2YCD A;  2CVD A;  1EGR A;  3LSZ A;  3GNJ A;  3IAS 2;  1UA5 A;  3LWA A;  3VPQ A;  1OKD A;  2H6Z A;  2ZUP A;  2D2Z A;  6GSV A;  1M0U A;  3M9K A;  2PWJ A;  5CAX A;  2JAD A;  3UJ1 A;  1TK5 B;  4KW6 A;  2PBJ A;  1SJI A;  2B5Y A;  5DQS A;  4BVY A;  1T8E B;  2H75 A;  3ZIV A;  2H0I A;  4HI7 A;  1U6T A;  3FZA A;  1ZZY A;  1XVQ A;  4MDC A;  4BL7 A;  1GNW A;  2H76 A;  4IVF A;  3R2Q A;  5EPF A;  1TU8 A;  2YWO A;  1QMV A;  2H30 A;  3LOR A;  3PR8 A;  5ECP B;  1F37 A;  5DVB A;  3GIX A;  1YEP A;  1ILO A;  2CVK A;  6GSS A;  5CYY A;  2DSA A;  4GSS A;  4YH2 A;  3D4T A;  4MJE A;  4EE0 A;  4XS6 A;  3HA9 A;  1FAA A;  4OO4 A;  2GQL A;  2H8L A;  9GSS A;  2FY6 A;  1EWX A;  3O6T A;  4PUR A;  1XVW A;  2HYX A;  1S3A A;  3TRP A;  1XOA A;  2VL2 C;  1A8L A;  1K3L A;  1FW1 A;  3F4T A;  3EMX A;  5D9T A;  1T3B A;  2YWN A;  4F03 A;  3KJY A;  1DUG A;  2BTO T;  3P2A A;  5IMA A;  2CAQ A;  2HE3 A;  1XW9 A;  3L78 A;  3KD0 A;  1AXD A;  2VD1 A;  3DD3 A;  3LYP A;  1EP8 A;  5A4U A;  1M9B A;  5AGY A;  5E59 A;  4LMV A;  3BJ5 A;  2JSZ A;  4LMW A;  4O5R A;  3APO A;  3F6F A;  1JZR A;  3FR6 A;  4K7O A;  1U87 A;  3H79 A;  4MH2 A;  3UAR A;  2IMK A;  5DJM A;  2REM A;  3CSI A;  1B4P A;  2HLS A;  3P90 A;  4KH7 A;  2QSI A;  3L9S A;  1OE7 A;  1OE8 A;  1Z5Y E;  1TRW A;  3HXS A;  2DJ3 A;  4TR1 B;  3IK9 A;  4XRD A;  1A24 A;  4ZB9 A;  2H74 A;  3H93 A;  2A2S A;  2QC7 A;  2OE3 A;  2DML A;  2C0F A;  3LFL A;  1O81 A;  4RI6 A;  3W6G A;  1OC3 A;  2GDR A;  4PNF A;  1AQV A;  3IR4 A;  5JWR B;  1I9D A;  5ID2 A;  5GSS A;  4I8B A;  3ZRE A;  4HZ2 A;  2HSY A;  1DSB A;  3OR5 A;  1TRS A;  2B5X A;  4KAE A;  2XPD A;  1TTZ A;  5A4V A;  1ERU A;  2YNX A;  2HSN B;  2P5R A;  1JLV A;  4F0C A;  4NMU A;  4POL A;  2B1K A;  3ME7 A;  1QFN A;  3HVV A;  2E2M A;  4GRF A;  4TR1 A;  2NDO A;  2FWH A;  4JR4 A;  4J57 E;  4HZ4 A;  2GSQ A;  4NHZ A;  3RPP A;  3KGK A;  5IMC A;  1GWC A;  1S3C A;  3ERF A;  1BED A;  5HR2 A;  1NHY A;  17GS A;  2ES7 A;  3IXR A;  1WIK A;  2AYT A;  3KEB A;  5IMV A;  4FYC A;  4TXV A;  5CRW A;  3ZIT A;  2YZU A;  2CV4 A;  4G2E A;  1M9A A;  2VLV A;  5J5N A;  2LQQ A;  1Z7R A;  4WR5 A;  5H5Q A;  2IFQ B;  2KHP A;  4JRR A;  3FZ5 A;  1G6W A;  5G1L A;  2H6X A;  5D93 A;  4PTS A;  2QGV A;  3UAP A;  13GS A;  4TVE A;  3M3M A;  4L5O A;  3UL3 A;  2MBS A;  1NSW A;  4HDE A;  5JCG A;  4DVC A;  3DYR A;  1ABA A;  1MDJ A;  4LL4 B;  3GH6 A;  3FZ4 A;  4F82 A;  2PPT A;  4X1U A;  4MH3 A;  1SJZ A;  2B6M A;  2F3M A;  5IOX A;  2OE1 A;  2H01 A;  1TRV A;  3QFB C; 
#chains in the Genus database with same CATH topology
 3CBU A;  3D4M A;  1NW2 A;  4ZIJ A;  1BJX A;  1VRS D;  1A0R P;  5A5K A;  2QA2 A;  3ZIJ A;  3HVS A;  1LU4 A;  2PU9 C;  3TJJ A;  4GF0 A;  4DSS A;  2I81 A;  1QQ2 A;  2VM1 A;  3GUR A;  4JE1 A;  3QOU A;  4KSM A;  2C3Q A;  5GZZ B;  3GFK A;  4BVX A;  3KMN A;  3GA4 A;  4EO3 A;  4POB A;  5L71 A;  1YEX A;  1KTE A;  3QMX A;  4K5R A;  1SYR A;  2FWG A;  1GSQ A;  3FK8 A;  4EVM A;  3QAV A;  2AAW A;  3HCZ A;  4MZW A;  4MJB A;  4NV2 A;  1TP9 A;  3TCO A;  1B9Y C;  1Q98 A;  3IA1 A;  5LD0 A;  1SD8 A;  4GXZ A;  5JWQ B;  3E0U A;  4MA9 A;  1XZO A;  4XIH A;  3NIV A;  5IO0 A;  2OKA A;  4FQU A;  1K0O A;  1URM A;  1BYE A;  4ML1 A;  4OFM A;  4GLT A;  1YZX A;  3U5R E;  4OCE A;  4ZL9 A;  3FZ9 A;  5D96 A;  4ZB6 A;  2FCH A;  1AIU A;  1MTC A;  1O6J A;  3C1R A;  2VAF A;  1R7H A;  1S3D A;  5F8B A;  1K3Y A;  5ECH B;  4AKG A;  1ACV A;  5AIV A;  5ENU A;  1PN0 A;  1YKA A;  2JZT A;  4O5U A;  2GLR A;  5ECS A;  5GAP D;  2I4A A;  1WJK A;  2FGX A;  2I9H A;  5H5S A;  1B9X C;  1K0M A;  1Z3E A;  3LGC A;  4AI6 A;  1G0T A;  1SKS B;  2CA8 A;  1M3J A;  1J0F A;  4JZQ A;  5J41 A;  2Z9S A;  1SEN A;  2VO4 A;  3GKK A;  1F3A A;  3TGZ A;  1TJD A;  2JU5 A;  2FNO A;  1SU9 A;  12GS A;  3F8U A;  3EVI A;  4EXJ A;  1V58 A;  3O3T A;  1R5P A;  3HZ8 A;  1PKW A;  1MDI A;  5INY A;  2N5F A;  1TRU A;  4ZBB A;  1A0F A;  1K3O A;  4HUA A;  4KDU A;  2F51 A;  2HFD A;  1A2L A;  1FVJ A;  2EFE A;  3CWG A;  3PGT A;  2VCT A;  2EIR A;  2O5V A;  2K8S A;  5IPH A;  1LJR A;  4O7H A;  3ZTL A;  2ON7 A;  4KCE A;  1N2A A;  2H0G A;  3D6I A;  2C8U A;  4PX1 A;  3TKS C;  4K9Z A;  2HRK B;  2EFH A;  2I3Y A;  4Z2T A;  1TI3 A;  1FB6 A;  5EL8 A;  3FR9 A;  4JBB A;  2JZR A;  4LLR A;  2LNS A;  2C3T A;  3RGB C;  1ZYP A;  5J9C A;  2ON5 A;  5KN1 A;  3APS A;  2R37 A;  1NM3 A;  4PQI A;  5IMF A;  1T1V A;  1X0R A;  4WF5 A;  4ID0 A;  3DEX A;  2LTK A;  5GAN D;  2IMI A;  3IDV A;  2HI7 A;  2H1B A;  1RW1 A;  2OBK A;  2NVL A;  3GKX A;  2X64 A;  2RUF A;  3EIN A;  5B8B A;  1CQH A;  2DLX A;  3DGQ A;  3Q6O A;  2LRN A;  5F05 A;  3RDW A;  4WR4 A;  4HU7 A;  4EF0 A;  3DXB A;  11GS A;  5DBQ A;  3AY8 A;  5ELG A;  5AIS A;  2K8V A;  4P3Y B;  4GTU A;  3WT2 A;  4EDZ A;  1SK0 A;  2X4A A;  2ZCT A;  4BA7 A;  1U3I A;  4TN8 A;  1TXU A;  1QUW A;  3RFR C;  4G0L A;  5DDL A;  1UN2 A;  5KN0 A;  3G7Y A;  3LYK A;  4HJM A;  3BCI A;  4F2I A;  4KB3 A;  1ZYN A;  1XCC A;  4JU5 A;  4BL7 B;  5DAL A;  3LQ7 A;  1XWB A;  2LS5 A;  4OCF A;  3QD9 A;  5HFI A;  4BPY A;  3VK9 A;  2M80 A;  3GX8 A;  3DVW A;  1XBS A;  4E8E A;  5A1N B;  1YF0 A;  2VCW A;  3GUS A;  1F2E A;  2WDU A;  2WRT A;  2BJX A;  2IIY A;  3W8S A;  4YQV A;  1OC9 B;  5G31 A;  3TJG A;  1SL0 B;  4K0G A;  2X8G A;  2HSH A;  2LEG A;  1IYI A;  2YAN A;  1Q4J A;  2GT5 A;  2JAC A;  4QMK A;  3P7X A;  5C04 A;  5D73 A;  2LQO A;  5GST A;  1K0D A;  1B4Q A;  3CTF A;  2YJ7 A;  1GSF A;  2YZH A;  3HDC A;  4MZC A;  3GL3 A;  4FYU A;  2HXK A;  1X9S B;  4GQC A;  4OMV A;  4F0B A;  5A1N A;  2CX3 A;  2GST A;  4CY8 A;  2B1L A;  2WB9 A;  5A34 B;  4GWR A;  1OC9 A;  4WKW A;  2WCI A;  1XG8 A;  3HVN A;  1HQO A;  2EFC A;  5F06 A;  3F0I A;  4NXI A;  4MLY A;  4WF4 A;  3TJF A;  4J56 E;  1XW6 A;  2GS3 A;  4PXO A;  2V32 A;  1GSY A;  1FG4 A;  5COH A;  3KXO A;  4RUV A;  4L5L A;  5LCZ A;  3KCM A;  4ICY A;  6GSX A;  4FO5 A;  2GZP A;  3QR6 A;  3CTG A;  4G10 A;  19GS A;  5JCU A;  1T4Z A;  2L59 A;  1B8X A;  5CRG A;  2VCX A;  4GSN A;  1WE0 A;  4WET A;  3VWW A;  1G6Y A;  1PX7 A;  1SK1 A;  1XIY A;  5IIZ A;  3IHQ A;  3I43 A;  4F9Z A;  4NV5 A;  4WBJ A;  1OVN A;  3S9F A;  1PA3 A;  4EUY A;  1YF1 A;  1MEK A;  4AJ8 A;  2K18 A;  3F63 A;  5IM9 A;  1M2B A;  1SYX A;  2V6K A;  2R3X A;  3ZFB A;  2L5O A;  3TOT A;  5A34 A;  1ON4 A;  2IWT A;  5ID2 B;  3HJM A;  4HJ2 A;  3VI5 A;  5EY6 A;  1K0A A;  2N5A A;  5HFG A;  2YJH A;  2C1Y A;  2DJK A;  1GH2 A;  1WPI A;  2YWI A;  3BD2 A;  2OT3 A;  2M72 A;  5AIX A;  2KP2 A;  1PD2 1;  2LJA A;  2WZ9 A;  2IL3 A;  2CZ3 A;  5J4U A;  3FEU A;  4L8E A;  6GSU A;  2LST A;  2L4Q A;  2LJK A;  3ZVJ D;  5B6N A;  1GSD A;  1Y6E A;  4Q5N A;  2FLS A;  2KLX A;  10GS A;  4IHU A;  1ZCP A;  1ERT A;  4IJI A;  2VIM A;  2HRA A;  5ECL B;  2F8A A;  5EVO A;  3ZVJ A;  4IP1 A;  1GUL A;  4FH8 A;  4DEJ A;  1X5C A;  2O8V B;  2XPE A;  3FW2 A;  2L57 A;  4AJ6 A;  3UMA A;  3L9V A;  2N5B A;  2CQ9 A;  2JZS A;  2LV3 A;  1VF1 A;  1F6M C;  3GH9 A;  1PX6 A;  2RLI A;  3CRT A;  3TUE A;  4V1A p;  5ABR A;  3IAM 2;  3UIW A;  3J7Y b;  4KCA A;  1TI1 A;  2YP6 A;  3EUR A;  1TDI A;  2J9H A;  2IN3 A;  2L5L A;  3F3Q A;  2XC2 A;  2C4J A;  4MPF A;  1XWA A;  3GMF A;  2LJR A;  3SBC A;  2GSR A;  4ISD A;  2O89 A;  5J47 A;  5DJL A;  1YKC A;  2OJL A;  1CQG A;  2X49 A;  2O7K A;  3ZL5 A;  2A2R A;  4IN0 A;  2YPM A;  1RK4 A;  2UZ8 A;  1TK0 B;  4O5Q A;  3EU4 A;  4PI2 C;  1QGV A;  3VWV A;  1AQX A;  1V2A A;  3F9U A;  3KTB A;  2G2Q A;  2C0G A;  5HR1 A;  4DSS B;  2AHE A;  3D21 A;  1PL2 A;  3FHK A;  1GSS A;  1THX A;  3E3E A;  4BVX B;  1MD3 A;  2HRF A;  4HQZ A;  5IO2 A;  3I6A A;  3WD6 A;  2JL4 A;  1ST9 A;  4RI7 A;  4G0K A;  5G2Z A;  4PI0 C;  2XBI A;  2HT9 A;  1XOB A;  3GSS A;  4KA0 A;  1FVK A;  3EE2 A;  4K0N A;  1EOH A;  3RBT A;  1PN9 A;  2RII A;  4OWY A;  4OO5 A;  18GS A;  8GSS A;  4Z2U A;  2WJU A;  2ALB A;  3VUR A;  2CAI A;  2GQM A;  2PN8 A;  2MMN A;  3BOA A;  4KSO A;  5FWG A;  2LRT A;  1PSQ A;  3VWU A;  4WBR D;  1XFL A;  4GST A;  5F07 A;  4CHS A;  3VLN A;  3LJR A;  1ZOF A;  3CRU A;  4MCU A;  3EC3 A;  4EDY A;  4MF7 A;  3FY7 A;  4AGS A;  4LL1 B;  3TB2 A;  2JSY A;  1Y1U A;  4IQA A;  4ECI A;  1FOV A;  1EEM A;  2R0C A;  3ME8 A;  3SWL A;  2VUP A;  1BG1 A;  3PH9 A;  2M46 A;  2TIR A;  4POM A;  2KOK A;  3L0H A;  2LUS A;  2C0E A;  3LXT A;  2BMX A;  5C00 A;  2VD0 A;  2FD3 A;  1H4O A;  6GSY A;  2GGT A;  2VCZ A;  2WW0 A;  3CXG A;  3WGX A;  4PGT A;  2F8F A;  3DIE A;  3A5W A;  3L4N A;  2G0F A;  3QCP A;  3RHC A;  5HR3 A;  3G7I A;  4IW9 A;  3KMO A;  4Q5F A;  1ZL9 A;  3HY2 A;  1U3A A;  2P5Q A;  4TRX A;  1Z6M A;  3IV4 A;  5H5R A;  5KOW A;  1BG5 A;  1JZW A;  3ZFL A;  5J9B A;  2IMF A;  1EV9 A;  4MF6 A;  2VL2 A;  2GTU A;  1XWC A;  3ERG A;  3FKF A;  1F3B A;  1T7P B;  3UVH A;  2PVO C;  2FA4 A;  2YWM A;  1A23 A;  2H6Y A;  3LG6 A;  2H66 A;  4FXY P;  2MMA A;  3ERW A;  4WEY A;  3DRN A;  1SD9 A;  3QDN A;  4K7N A;  3D5J A;  1UC7 A;  1Y25 A;  1XW5 A;  3C1S A;  4K2D A;  4A5P A;  3HVX A;  4KDY A;  2AUV A;  2GVP A;  4MNN A;  2AB6 A;  3QFA C;  2YOI A;  3FRC A;  3GV1 A;  4HQS A;  3TU3 B;  4Q5Q A;  4AKX B;  2H71 A;  4E68 A;  4NAX A;  2CX4 A;  1ZYQ B;  4I97 A;  3KH7 A;  2WUL A;  1SKW B;  2PGT A;  2FWF A;  4YAP A;  3IK7 A;  4I2U A;  4K8M A;  3CHX C;  1KBN A;  3I9V 2;  1ML6 A;  3ISO A;  1FB0 A;  2R2J A;  1NHO A;  1HD2 A;  1SVL A;  5ECK B;  4ZL7 A;  1ZMA A;  4D73 A;  2V1M A;  1N25 A;  16GS A;  6GSW A;  2P31 A;  4PNG A;  3EWL A;  5D9W A;  3CSH A;  3HKR A;  5CP1 A;  1BF5 A;  3QAW A;  5ECN B;  20GS A;  4IJ3 A;  5F0G A;  2R5G A;  4YAV A;  4V2M A;  3MAK A;  4MMM A;  3TJK A;  2EFD A;  3KM6 A;  3TJB A;  2O87 A;  4FIW A;  3QPM A;  4HS1 A;  4IBP A;  4QL9 A;  1R26 A;  2X8H A;  1V57 A;  1ZGN A;  1FOH A;  4RQX A;  4G01 A;  1KNG A;  1FO5 A;  1GUK A;  4MF5 A;  3ZLP A;  5DAL B;  2H70 A;  1PL1 A;  1GLP A;  1VGL A;  2C3N A;  4ZB8 A;  2H0H A;  2EIQ A;  4HSC X;  1USB A;  3TKR A;  4QQ7 A;  2OA7 A;  2V41 A;  3C71 A;  4J2F A;  4N0V A;  3EU3 A;  4N0Z A;  4ECC A;  2DJ1 A;  3D0Z A;  2O3E A;  1T4Y A;  4OFT A;  4QL7 A;  1HNA A;  1H75 A;  1YY7 A;  5JWO B;  2YN1 A;  4Z7X A;  1GTA A;  4AJ7 A;  1A8Y A;  3APQ A;  4XCS A;  3BBY A;  2H19 A;  1AQW A;  2OE0 A;  2HZE B;  1B48 A;  3TKS E;  1OAZ A;  4N30 A;  4ACS A;  2DKI A;  5KN2 A;  3H8Q A;  4X0X A;  3D22 A;  5DAK A;  2DMM A;  2EIO A;  1FHE A;  5BRT A;  1EEJ A;  3LXZ A;  1WMJ A;  2MMO A;  3A3T A;  3TOU A;  2R4V A;  1I5G A;  5B7C A;  4FYB A;  4PQ1 A;  2VM2 A;  5KN3 A;  2FWE A;  1SL2 B;  4ECB A;  1WWJ A;  4L0U A;  3TRX A;  3VPT A;  1TK8 B;  2YV9 A;  5DQY A;  4MJA A;  2DJ0 A;  3DVX A;  1YJ6 A;  5G5E A;  4K7I A;  2HZE A;  3U6V A;  3F4R A;  4AKI A;  3Q74 A;  1E2Y A;  2DC5 A;  2GZZ A;  1GNE A;  1MD4 A;  4TKY A;  4MJC A;  3RPN A;  2WGR A;  4ILF A;  3CSJ A;  2PER A;  4KX4 A;  4X43 A;  4IS0 A;  5HQP A;  1J9B A;  1XPV A;  2X8C A;  2ZNM A;  5J4V A;  3Q19 A;  3GKM A;  1PRX A;  3MDK A;  1RQM A;  2X99 A;  4JED A;  4KGI A;  3C7M A;  4IP6 A;  2TRX A;  4AKH A;  1TXX A;  2GQK A;  3IBH A;  4ULX A;  3TKQ A;  4TXO B;  5BMU B;  4ZBA A;  1N8J A;  1GSU A;  1SKR B;  4KE3 A;  1O85 A;  2KUC A;  3F4S A;  3EMP A;  4GQF A;  1K0C A;  4KUN A;  3FYG A;  1YDK A;  4XHM A;  4PQH A;  2OAD A;  2RM6 A;  3DWV A;  4MZB A;  2GZY A;  4ZIL A;  1GP1 A;  2L6D A;  3UBL A;  6GST A;  2CVB A;  2H73 A;  4EIP A;  3H1N A;  3A2X A;  2DBC A;  5E4W A;  4L0W A;  3DML A;  2VL9 A;  5J3R A;  4OFN A;  5DCG A;  3VFI A;  2HNL A;  2J23 A;  5ECR B;  2LKU A;  1XXU A;  1QXH A;  4TXO A;  5BMU A;  3MSZ A;  3IPZ A;  2HRN A;  1YVL A;  2B3S A;  5KOX A;  2H1D A;  3KZQ A;  4DSR A;  5B6M A;  5CO3 A;  1ERW A;  5B8A A;  2WVZ A;  1O8X A;  4IQ1 A;  1M2A A;  4NPB A;  5DCH A;  1SVM A;  2E0Q A;  1BQ7 A;  1J08 A;  3GTU B;  1X5E A;  1GL8 A;  5A4W A;  4TW5 A;  2I1U A;  1BX9 A;  3GN3 A;  1C72 A;  5D9V A;  2FUG 2;  2OAC A;  2K6V A;  1JZO A;  5G1K A;  3GL5 A;  4KDX A;  4BIK A;  2AJQ B;  4PUF C;  4HU9 A;  4IKH A;  5IOW A;  2L4C A;  4ZBD A;  1VF4 A;  5G30 A;  3TKS A;  4AF2 A;  3WT1 A;  4EIQ A;  5CNW A;  1V9W A;  4LA1 A;  2R0G A;  3IHG A;  5IQY A;  2A4H A;  2XBQ A;  3O76 A;  2E7P A;  1G7E A;  1F9M A;  1XWG A;  1EGO A;  1UVZ A;  4O92 A;  3PIN A;  2V2G A;  4IEL A;  3A2V A;  4KND A;  4TR3 A;  3GST A;  2DJJ A;  3KP8 A;  3N9J A;  4ZXG A;  2VCV A;  3E9J B;  22GS A;  2HSM B;  3P8W A;  5CRE A;  4POK A;  5KEJ A;  3GTU A;  14GS A;  3MWH A;  5FHI A;  2WW2 A;  3HYP A;  3HJO A;  2KP1 A;  5ECQ B;  5HFK A;  1T00 A;  3WYW A;  4BWQ A;  4PUA A;  5A5H B;  1VF2 A;  4XS1 A;  3WGE A;  1BAY A;  1O8W A;  1M99 A;  4OD7 A;  1THO A;  3PPU A;  3N5O A;  4WXT A;  4Q5R A;  1ERV A;  4V2N A;  1IYH A;  1M7T A;  1HNB A;  4N10 A;  3NZN A;  1SJ6 A;  3GKN A;  1K0B A;  3GYK A;  3A5I A;  3LEF A;  3IRA A;  4MPG A;  3K8N A;  1X9M B;  1S4B P;  2HSN A;  1PKZ A;  3R3E A;  2HSM A;  3BCK A;  1O7U A;  4G0I A;  4MP4 A;  2LRC A;  2WZS A;  2R6K A;  2DIZ A;  1EP7 A;  3G9B A;  2PUK C;  1GTI A;  1JHB A;  5ECM B;  2A2P A;  4PHZ C;  3V1W A;  5A5H A;  4V1A g;  4JR6 A;  3KTL A;  1U88 A;  4ML6 A;  1V40 A;  4NWY A;  2V6O A;  5ECI B;  3VI7 A;  1KEB A;  3KP9 A;  2VLU A;  4CDO A;  3ZMK A;  3ZRD A;  3UEM A;  2WS2 A;  1AC1 A;  3IE3 A;  1DE1 A;  4I2T A;  4BWS A;  1DBY A;  3F3R A;  3A2W A;  1ZYE A;  2CZ2 A;  3UOM A;  1XWK A;  2VKZ G;  1I1I P;  3KIJ A;  2XHF A;  2IFQ A;  3L9U A;  3M1G A;  1X9W B;  2MZC A;  3RAZ A;  3CMI A;  3UVT A;  3HHV A;  1TOF A;  2H72 A;  2HQT A;  1WOU A;  3ZYW A;  3GHA A;  2B7J A;  3M0F A;  4I5Q A;  2P0G A;  3GX0 A;  1VF3 A;  3EPT A;  1YEW C;  3UBK A;  1GUM A;  4GCI A;  2NPB A;  4O32 A;  1WP0 A;  2IJY A;  2VL3 A;  2GT6 A;  4MAB A;  3H4K A;  1EV4 A;  2UV8 G;  1AUC A;  2NBS A;  3W8J A;  5FT3 A;  4HOJ A;  4W66 A;  3C73 A;  1PQN A;  4H86 A;  2DJ2 A;  1OC8 A;  5G5F A;  2MMZ A;  5HR0 A;  1GLQ A;  1TKD B;  2PVQ A;  5LNK e;  3F6D A;  1TU7 A;  1GSE A;  4N11 A;  3EYT A;  4D73 B;  4K6X A;  2RM5 A;  1JZD A;  5J40 A;  3IC4 A;  1GTB A;  3NOF A;  1GRX A;  4KF9 A;  4G19 A;  3JCM L;  4YQU A;  2F9S A;  1W4V A;  5D9X A;  4TR4 A;  3C8E A;  3M9J A;  2RUE A;  3G7J A;  2IPA A;  1QK8 A;  2A4V A;  4I6X A;  1Z6N A;  2FHE A;  5AN1 A;  3WGD A;  1GUH A;  1R5A A;  3FMW A;  3ED3 A;  2TRC P;  4G9H A;  3ZML A;  4IGJ A;  5IPG A;  2B5E A;  1PGT A;  1PMT A;  1GTU A;  5CRH A;  3FR3 A;  3Q18 A;  1LBK A;  1Z7P A;  4USS A;  1E6B A;  3DKS A;  4ZL8 A;  2WFC A;  1OKT A;  2C0D A;  4V2L A;  1A2J A;  3HD5 A;  5CRD A;  3HJP A;  2YV7 A;  1AAZ A;  4RQR A;  4YQM A;  3VWX A;  2VLT A;  1SK2 A;  4XTS A;  3MNG A;  4TOP A;  2LNT A;  5D8I A;  1HNC A;  1MDK A;  3TRQ A;  1JLW A;  5IMD A;  3US3 A;  3CQF A;  4EC0 A;  4N3Z A;  4K2X A;  3J7Y k;  4CY6 A;  4YKG A;  4MK3 A;  1HYU A;  4HEA 2;  5ELA A;  1O73 A;  4NHW A;  1WRY A;  2HZF A;  3TKP A;  3M8N A;  1V98 A;  2PMT A;  2AV4 A;  1R4W A;  3KH9 A;  5DAK B;  2H1G A;  3IOS A;  2FA8 A;  2IMD A;  2QKE A;  2E2G A;  2EC4 A;  3I69 A;  1SL1 B;  1AW9 A;  1EOG A;  1Z9H A;  1A2M A;  2MBT A;  5ECO B;  2IME A;  4XS4 B;  1S3R A;  4EKZ A;  3ZZX A;  5JCW A;  2NTO A;  2K9F A;  1EZK A;  1G7O A;  2H1A A;  1DE2 A;  3IC8 A;  2HRK A;  1X5D A;  3RHB A;  1M3I A;  3QAG A;  4K1F A;  2OBI A;  2WW1 A;  2VOC A;  2L6C A;  4TR0 A;  3GRX A;  3CYN A;  4XRA A;  2O85 A;  3TDG A;  1TW9 A;  2B7K A;  2C80 A;  2DIY A;  1K0N A;  4BVY B;  2MYG A;  4DSQ A;  4ECJ A;  4CW9 A;  7GSS A;  1YQ1 A;  1W89 A;  1JFU A;  3HZ4 A;  2VCQ A;  4EL1 A;  1OYJ A;  4E8H A;  4XS4 A;  1M2D A;  5IMZ A;  2GSS A;  2CT6 A;  2YCD A;  2CVD A;  1EGR A;  3LSZ A;  3GNJ A;  3IAS 2;  1UA5 A;  3LWA A;  3VPQ A;  1OKD A;  2H6Z A;  2ZUP A;  2D2Z A;  6GSV A;  1M0U A;  3M9K A;  2PWJ A;  5CAX A;  2JAD A;  3UJ1 A;  1TK5 B;  4KW6 A;  2PBJ A;  2R0P A;  1SJI A;  2B5Y A;  5DQS A;  3HMJ G;  4BVY A;  1T8E B;  2H75 A;  3ZIV A;  2H0I A;  4HI7 A;  1U6T A;  3FZA A;  1ZZY A;  1XVQ A;  4MDC A;  4BL7 A;  1GNW A;  2H76 A;  4IVF A;  2WW3 A;  3R2Q A;  5EPF A;  1TU8 A;  2YWO A;  1QMV A;  2H30 A;  3LOR A;  3PR8 A;  5ECP B;  1F37 A;  5DVB A;  3MYD A;  3GIX A;  1YEP A;  1ILO A;  2CVK A;  6GSS A;  5CYY A;  2DSA A;  4GSS A;  4YH2 A;  3D4T A;  4MJE A;  4EE0 A;  4XS6 A;  3HA9 A;  1FAA A;  4OO4 A;  2GQL A;  2H8L A;  9GSS A;  2FY6 A;  1EWX A;  3O6T A;  4PUR A;  1XVW A;  2HYX A;  1S3A A;  3TRP A;  1XOA A;  2VL2 C;  1A8L A;  1K3L A;  1FW1 A;  3F4T A;  3EMX A;  5D9T A;  1T3B A;  2YWN A;  4F03 A;  3KJY A;  1DUG A;  2BTO T;  3P2A A;  5IMA A;  2CAQ A;  2HE3 A;  1XW9 A;  3L78 A;  3KD0 A;  1AXD A;  2VD1 A;  3DD3 A;  3LYP A;  1EP8 A;  5A4U A;  4K5S A;  1M9B A;  5AGY A;  5E59 A;  4LMV A;  3BJ5 A;  2JSZ A;  4LMW A;  4O5R A;  3APO A;  3F6F A;  1JZR A;  3FR6 A;  4K7O A;  1U87 A;  3H79 A;  2WVX B;  4MH2 A;  3MIX A;  3UAR A;  2IMK A;  5DJM A;  2REM A;  3CSI A;  1B4P A;  2O36 A;  2HLS A;  3P90 A;  4KH7 A;  2QSI A;  3L9S A;  1OE7 A;  1OE8 A;  1Z5Y E;  1TRW A;  4ZB7 A;  3HXS A;  2DJ3 A;  2QA1 A;  4TR1 B;  3IK9 A;  4XRD A;  5J4Y A;  1A24 A;  4ZB9 A;  2H74 A;  3H93 A;  2DKH A;  2A2S A;  2QC7 A;  2OE3 A;  2DML A;  2C0F A;  3LW9 A;  3LFL A;  1O81 A;  4YKF A;  4RI6 A;  3W6G A;  1OC3 A;  2GDR A;  4PNF A;  1AQV A;  3IR4 A;  5JWR B;  1I9D A;  2WVX A;  5ID2 A;  4Z2R A;  5GSS A;  4I8B A;  3ZRE A;  4HZ2 A;  2HSY A;  1DSB A;  3OR5 A;  1TRS A;  2B5X A;  4KAE A;  2XPD A;  1TTZ A;  5A4V A;  1ERU A;  2YNX A;  2HSN B;  2P5R A;  1JLV A;  4F0C A;  4NMU A;  4POL A;  2B1K A;  3ME7 A;  1QFN A;  3HVV A;  2E2M A;  4GRF A;  4TR1 A;  2NDO A;  2FWH A;  4JR4 A;  4J57 E;  4HZ4 A;  2GSQ A;  4NHZ A;  3RPP A;  3KGK A;  5IMC A;  1GWC A;  1S3C A;  3ERF A;  1BED A;  5HR2 A;  1NHY A;  17GS A;  2ES7 A;  3IXR A;  1WIK A;  2AYT A;  3KEB A;  5IMV A;  4FYC A;  4TXV A;  5CRW A;  3ZIT A;  2YZU A;  2CV4 A;  4G2E A;  1M9A A;  2VLV A;  2WVY A;  5J5N A;  2LQQ A;  1Z7R A;  4WR5 A;  1PFO A;  5H5Q A;  2IFQ B;  2KHP A;  4JRR A;  3FZ5 A;  1G6W A;  2H1L A;  5G1L A;  4X4J A;  2H6X A;  5D93 A;  4PTS A;  2QGV A;  3UAP A;  13GS A;  4TVE A;  3M3M A;  4L5O A;  3UL3 A;  2MBS A;  1NSW A;  4HDE A;  5JCG A;  4DVC A;  3DYR A;  1ABA A;  4GDF A;  1SVO A;  1MDJ A;  4LL4 B;  3GH6 A;  3FZ4 A;  4F82 A;  2PPT A;  4X1U A;  4MH3 A;  1SJZ A;  2B6M A;  2F3M A;  5IOX A;  2OE1 A;  2H01 A;  1TRV A;  3QFB C; 
#chains in the Genus database with same CATH homology
 3CBU A;  3D4M A;  1NW2 A;  4ZIJ A;  1BJX A;  1VRS D;  1A0R P;  5A5K A;  2QA2 A;  3ZIJ A;  3HVS A;  1LU4 A;  2PU9 C;  3TJJ A;  4GF0 A;  4DSS A;  2I81 A;  1QQ2 A;  2VM1 A;  3GUR A;  4JE1 A;  3QOU A;  4KSM A;  2C3Q A;  5GZZ B;  3GFK A;  4BVX A;  3KMN A;  3GA4 A;  4EO3 A;  4POB A;  5L71 A;  1YEX A;  1KTE A;  3QMX A;  4K5R A;  1SYR A;  2FWG A;  1GSQ A;  3FK8 A;  4EVM A;  3QAV A;  2AAW A;  3HCZ A;  4MZW A;  4MJB A;  4NV2 A;  1TP9 A;  3TCO A;  1B9Y C;  1Q98 A;  3IA1 A;  5LD0 A;  1SD8 A;  4GXZ A;  5JWQ B;  3E0U A;  4MA9 A;  1XZO A;  4XIH A;  3NIV A;  5IO0 A;  2OKA A;  4FQU A;  1K0O A;  1URM A;  1BYE A;  4ML1 A;  4OFM A;  4GLT A;  1YZX A;  3U5R E;  4OCE A;  4ZL9 A;  3FZ9 A;  5D96 A;  4ZB6 A;  2FCH A;  1AIU A;  1MTC A;  1O6J A;  3C1R A;  2VAF A;  1R7H A;  1S3D A;  5F8B A;  1K3Y A;  5ECH B;  4AKG A;  1ACV A;  5AIV A;  5ENU A;  1PN0 A;  1YKA A;  2JZT A;  4O5U A;  2GLR A;  5ECS A;  5GAP D;  2I4A A;  1WJK A;  2FGX A;  2I9H A;  5H5S A;  1B9X C;  1K0M A;  1Z3E A;  3LGC A;  4AI6 A;  1G0T A;  1SKS B;  2CA8 A;  1J0F A;  4JZQ A;  5J41 A;  2Z9S A;  1SEN A;  2VO4 A;  3GKK A;  1F3A A;  3TGZ A;  1TJD A;  2JU5 A;  2FNO A;  1SU9 A;  12GS A;  3F8U A;  3EVI A;  4EXJ A;  1V58 A;  3O3T A;  1R5P A;  3HZ8 A;  1PKW A;  1MDI A;  5INY A;  2N5F A;  1TRU A;  4ZBB A;  1A0F A;  1K3O A;  4HUA A;  4KDU A;  2F51 A;  2HFD A;  1A2L A;  1FVJ A;  2EFE A;  3CWG A;  3PGT A;  2VCT A;  2EIR A;  2O5V A;  2K8S A;  5IPH A;  1LJR A;  4O7H A;  3ZTL A;  2ON7 A;  4KCE A;  1N2A A;  2H0G A;  3D6I A;  2C8U A;  4PX1 A;  3TKS C;  4K9Z A;  2HRK B;  2EFH A;  2I3Y A;  4Z2T A;  1TI3 A;  1FB6 A;  5EL8 A;  3FR9 A;  4JBB A;  2JZR A;  4LLR A;  2LNS A;  2C3T A;  1ZYP A;  5J9C A;  2ON5 A;  5KN1 A;  3APS A;  2R37 A;  1NM3 A;  4PQI A;  5IMF A;  1T1V A;  1X0R A;  4WF5 A;  4ID0 A;  3DEX A;  2LTK A;  5GAN D;  2IMI A;  3IDV A;  2HI7 A;  2H1B A;  1RW1 A;  2OBK A;  2NVL A;  3GKX A;  2X64 A;  2RUF A;  3EIN A;  5B8B A;  1CQH A;  2DLX A;  3DGQ A;  3Q6O A;  2LRN A;  5F05 A;  3RDW A;  4WR4 A;  4HU7 A;  4EF0 A;  3DXB A;  11GS A;  5DBQ A;  3AY8 A;  5ELG A;  5AIS A;  2K8V A;  4P3Y B;  4GTU A;  3WT2 A;  4EDZ A;  1SK0 A;  2X4A A;  2ZCT A;  4BA7 A;  1U3I A;  4TN8 A;  1TXU A;  1QUW A;  4G0L A;  5DDL A;  1UN2 A;  5KN0 A;  3G7Y A;  3LYK A;  4HJM A;  3BCI A;  4F2I A;  4KB3 A;  1ZYN A;  1XCC A;  4JU5 A;  4BL7 B;  5DAL A;  3LQ7 A;  1XWB A;  2LS5 A;  4OCF A;  3QD9 A;  5HFI A;  4BPY A;  3VK9 A;  2M80 A;  3GX8 A;  3DVW A;  1XBS A;  4E8E A;  5A1N B;  1YF0 A;  2VCW A;  3GUS A;  1F2E A;  2WDU A;  2WRT A;  2BJX A;  2IIY A;  3W8S A;  4YQV A;  1OC9 B;  5G31 A;  3TJG A;  1SL0 B;  4K0G A;  2X8G A;  2HSH A;  2LEG A;  1IYI A;  2YAN A;  1Q4J A;  2GT5 A;  2JAC A;  4QMK A;  3P7X A;  5C04 A;  5D73 A;  2LQO A;  5GST A;  1K0D A;  1B4Q A;  3CTF A;  2YJ7 A;  1GSF A;  2YZH A;  3HDC A;  4MZC A;  3GL3 A;  4FYU A;  2HXK A;  1X9S B;  4GQC A;  4OMV A;  4F0B A;  5A1N A;  2CX3 A;  2GST A;  4CY8 A;  2B1L A;  2WB9 A;  5A34 B;  4GWR A;  1OC9 A;  4WKW A;  2WCI A;  1HQO A;  2EFC A;  5F06 A;  3F0I A;  4NXI A;  4MLY A;  4WF4 A;  3TJF A;  4J56 E;  1XW6 A;  2GS3 A;  4PXO A;  2V32 A;  1GSY A;  1FG4 A;  5COH A;  3KXO A;  4RUV A;  4L5L A;  5LCZ A;  3KCM A;  4ICY A;  6GSX A;  4FO5 A;  2GZP A;  3QR6 A;  3CTG A;  4G10 A;  19GS A;  5JCU A;  1T4Z A;  2L59 A;  1B8X A;  5CRG A;  2VCX A;  4GSN A;  1WE0 A;  4WET A;  3VWW A;  1G6Y A;  1PX7 A;  1SK1 A;  1XIY A;  5IIZ A;  3IHQ A;  3I43 A;  4F9Z A;  4NV5 A;  4WBJ A;  1OVN A;  3S9F A;  1PA3 A;  4EUY A;  1YF1 A;  1MEK A;  4AJ8 A;  2K18 A;  3F63 A;  5IM9 A;  1M2B A;  1SYX A;  2V6K A;  2R3X A;  3ZFB A;  2L5O A;  3TOT A;  5A34 A;  1ON4 A;  2IWT A;  5ID2 B;  3HJM A;  4HJ2 A;  3VI5 A;  5EY6 A;  1K0A A;  2N5A A;  5HFG A;  2YJH A;  2C1Y A;  2DJK A;  1GH2 A;  1WPI A;  2YWI A;  3BD2 A;  2OT3 A;  2M72 A;  5AIX A;  2KP2 A;  1PD2 1;  2LJA A;  2WZ9 A;  2IL3 A;  2CZ3 A;  5J4U A;  3FEU A;  4L8E A;  6GSU A;  2LST A;  2L4Q A;  2LJK A;  3ZVJ D;  5B6N A;  1GSD A;  1Y6E A;  4Q5N A;  2FLS A;  2KLX A;  10GS A;  4IHU A;  1ZCP A;  1ERT A;  4IJI A;  2VIM A;  2HRA A;  5ECL B;  2F8A A;  5EVO A;  3ZVJ A;  4IP1 A;  1GUL A;  4FH8 A;  4DEJ A;  1X5C A;  2O8V B;  2XPE A;  3FW2 A;  2L57 A;  4AJ6 A;  3UMA A;  3L9V A;  2N5B A;  2CQ9 A;  2JZS A;  2LV3 A;  1VF1 A;  1F6M C;  3GH9 A;  1PX6 A;  2RLI A;  3CRT A;  3TUE A;  4V1A p;  5ABR A;  3IAM 2;  3UIW A;  3J7Y b;  4KCA A;  1TI1 A;  2YP6 A;  3EUR A;  1TDI A;  2J9H A;  2IN3 A;  2L5L A;  3F3Q A;  2XC2 A;  2C4J A;  4MPF A;  1XWA A;  3GMF A;  2LJR A;  3SBC A;  2GSR A;  4ISD A;  2O89 A;  5J47 A;  5DJL A;  1YKC A;  2OJL A;  1CQG A;  2X49 A;  2O7K A;  3ZL5 A;  2A2R A;  4IN0 A;  2YPM A;  1RK4 A;  2UZ8 A;  1TK0 B;  4O5Q A;  3EU4 A;  1QGV A;  3VWV A;  1AQX A;  1V2A A;  3F9U A;  3KTB A;  2G2Q A;  2C0G A;  5HR1 A;  4DSS B;  2AHE A;  3D21 A;  1PL2 A;  3FHK A;  1GSS A;  1THX A;  3E3E A;  4BVX B;  1MD3 A;  2HRF A;  4HQZ A;  5IO2 A;  3I6A A;  3WD6 A;  2JL4 A;  1ST9 A;  4RI7 A;  4G0K A;  5G2Z A;  2XBI A;  2HT9 A;  1XOB A;  3GSS A;  4KA0 A;  1FVK A;  3EE2 A;  4K0N A;  1EOH A;  3RBT A;  1PN9 A;  2RII A;  4OWY A;  4OO5 A;  18GS A;  8GSS A;  4Z2U A;  2WJU A;  2ALB A;  3VUR A;  2CAI A;  2GQM A;  2PN8 A;  2MMN A;  3BOA A;  4KSO A;  5FWG A;  2LRT A;  1PSQ A;  3VWU A;  4WBR D;  1XFL A;  4GST A;  5F07 A;  4CHS A;  3VLN A;  3LJR A;  1ZOF A;  3CRU A;  4MCU A;  3EC3 A;  4EDY A;  4MF7 A;  3FY7 A;  4AGS A;  4LL1 B;  3TB2 A;  2JSY A;  1Y1U A;  4IQA A;  4ECI A;  1FOV A;  1EEM A;  2R0C A;  3ME8 A;  3SWL A;  2VUP A;  1BG1 A;  3PH9 A;  2M46 A;  2TIR A;  4POM A;  2KOK A;  3L0H A;  2LUS A;  2C0E A;  3LXT A;  2BMX A;  5C00 A;  2VD0 A;  2FD3 A;  1H4O A;  6GSY A;  2GGT A;  2VCZ A;  3CXG A;  3WGX A;  4PGT A;  2F8F A;  3DIE A;  3A5W A;  3L4N A;  2G0F A;  3QCP A;  3RHC A;  5HR3 A;  3G7I A;  4IW9 A;  3KMO A;  4Q5F A;  1ZL9 A;  3HY2 A;  1U3A A;  2P5Q A;  4TRX A;  1Z6M A;  3IV4 A;  5H5R A;  5KOW A;  1BG5 A;  1JZW A;  3ZFL A;  5J9B A;  2IMF A;  1EV9 A;  4MF6 A;  2VL2 A;  2GTU A;  1XWC A;  3ERG A;  3FKF A;  1F3B A;  1T7P B;  3UVH A;  2PVO C;  2FA4 A;  2YWM A;  1A23 A;  2H6Y A;  3LG6 A;  2H66 A;  2MMA A;  3ERW A;  4WEY A;  3DRN A;  1SD9 A;  3QDN A;  4K7N A;  3D5J A;  1UC7 A;  1Y25 A;  1XW5 A;  3C1S A;  4K2D A;  4A5P A;  3HVX A;  4KDY A;  2AUV A;  2GVP A;  4MNN A;  2AB6 A;  3QFA C;  2YOI A;  3FRC A;  3GV1 A;  4HQS A;  3TU3 B;  4Q5Q A;  4AKX B;  2H71 A;  4E68 A;  4NAX A;  2CX4 A;  1ZYQ B;  4I97 A;  3KH7 A;  2WUL A;  1SKW B;  2PGT A;  2FWF A;  4YAP A;  3IK7 A;  4I2U A;  4K8M A;  1KBN A;  3I9V 2;  1ML6 A;  3ISO A;  1FB0 A;  2R2J A;  1NHO A;  1HD2 A;  1SVL A;  5ECK B;  4ZL7 A;  1ZMA A;  4D73 A;  2V1M A;  1N25 A;  16GS A;  6GSW A;  2P31 A;  4PNG A;  3EWL A;  5D9W A;  3CSH A;  3HKR A;  5CP1 A;  1BF5 A;  3QAW A;  5ECN B;  20GS A;  4IJ3 A;  5F0G A;  2R5G A;  4YAV A;  4V2M A;  3MAK A;  4MMM A;  3TJK A;  2EFD A;  3KM6 A;  3TJB A;  2O87 A;  4FIW A;  3QPM A;  4HS1 A;  4IBP A;  4QL9 A;  1R26 A;  2X8H A;  1V57 A;  1ZGN A;  1FOH A;  4RQX A;  4G01 A;  1KNG A;  1FO5 A;  1GUK A;  4MF5 A;  3ZLP A;  5DAL B;  2H70 A;  1PL1 A;  1GLP A;  1VGL A;  2C3N A;  4ZB8 A;  2H0H A;  2EIQ A;  1USB A;  3TKR A;  4QQ7 A;  2OA7 A;  2V41 A;  3C71 A;  4J2F A;  4N0V A;  3EU3 A;  4N0Z A;  4ECC A;  2DJ1 A;  3D0Z A;  1T4Y A;  4OFT A;  4QL7 A;  1HNA A;  1H75 A;  1YY7 A;  5JWO B;  2YN1 A;  4Z7X A;  1GTA A;  4AJ7 A;  1A8Y A;  3APQ A;  4XCS A;  3BBY A;  2H19 A;  1AQW A;  2OE0 A;  2HZE B;  1B48 A;  3TKS E;  1OAZ A;  4N30 A;  4ACS A;  2DKI A;  5KN2 A;  3H8Q A;  4X0X A;  3D22 A;  5DAK A;  2DMM A;  2EIO A;  1FHE A;  5BRT A;  1EEJ A;  3LXZ A;  1WMJ A;  2MMO A;  3A3T A;  3TOU A;  2R4V A;  1I5G A;  5B7C A;  4FYB A;  4PQ1 A;  2VM2 A;  5KN3 A;  2FWE A;  1SL2 B;  4ECB A;  1WWJ A;  4L0U A;  3TRX A;  3VPT A;  1TK8 B;  2YV9 A;  5DQY A;  4MJA A;  2DJ0 A;  3DVX A;  1YJ6 A;  5G5E A;  4K7I A;  2HZE A;  3U6V A;  3F4R A;  4AKI A;  3Q74 A;  1E2Y A;  2DC5 A;  2GZZ A;  1GNE A;  1MD4 A;  4TKY A;  4MJC A;  3RPN A;  2WGR A;  4ILF A;  3CSJ A;  2PER A;  4KX4 A;  4X43 A;  4IS0 A;  5HQP A;  1J9B A;  1XPV A;  2X8C A;  2ZNM A;  5J4V A;  3Q19 A;  3GKM A;  1PRX A;  3MDK A;  1RQM A;  2X99 A;  4JED A;  4KGI A;  3C7M A;  4IP6 A;  2TRX A;  4AKH A;  1TXX A;  2GQK A;  3IBH A;  4ULX A;  3TKQ A;  4TXO B;  5BMU B;  4ZBA A;  1N8J A;  1GSU A;  1SKR B;  4KE3 A;  1O85 A;  2KUC A;  3F4S A;  3EMP A;  4GQF A;  1K0C A;  4KUN A;  3FYG A;  1YDK A;  4XHM A;  4PQH A;  2OAD A;  2RM6 A;  3DWV A;  4MZB A;  2GZY A;  4ZIL A;  1GP1 A;  2L6D A;  3UBL A;  6GST A;  2CVB A;  2H73 A;  4EIP A;  3H1N A;  3A2X A;  2DBC A;  5E4W A;  4L0W A;  3DML A;  2VL9 A;  5J3R A;  4OFN A;  5DCG A;  3VFI A;  2HNL A;  2J23 A;  5ECR B;  2LKU A;  1XXU A;  1QXH A;  4TXO A;  5BMU A;  3MSZ A;  3IPZ A;  2HRN A;  1YVL A;  2B3S A;  5KOX A;  2H1D A;  3KZQ A;  4DSR A;  5B6M A;  5CO3 A;  1ERW A;  5B8A A;  1O8X A;  4IQ1 A;  1M2A A;  4NPB A;  5DCH A;  1SVM A;  2E0Q A;  1BQ7 A;  1J08 A;  3GTU B;  1X5E A;  1GL8 A;  5A4W A;  4TW5 A;  2I1U A;  1BX9 A;  3GN3 A;  1C72 A;  5D9V A;  2FUG 2;  2OAC A;  2K6V A;  1JZO A;  5G1K A;  3GL5 A;  4KDX A;  2AJQ B;  4PUF C;  4HU9 A;  4IKH A;  5IOW A;  2L4C A;  4ZBD A;  1VF4 A;  5G30 A;  3TKS A;  4AF2 A;  3WT1 A;  4EIQ A;  5CNW A;  1V9W A;  4LA1 A;  2R0G A;  5IQY A;  2A4H A;  3IHG A;  2XBQ A;  3O76 A;  2E7P A;  1G7E A;  1F9M A;  1XWG A;  1EGO A;  1UVZ A;  4O92 A;  3PIN A;  2V2G A;  4IEL A;  3A2V A;  4KND A;  4TR3 A;  3GST A;  2DJJ A;  3KP8 A;  3N9J A;  4ZXG A;  2VCV A;  3E9J B;  22GS A;  2HSM B;  3P8W A;  5CRE A;  4POK A;  5KEJ A;  3GTU A;  14GS A;  3MWH A;  5FHI A;  3HYP A;  3HJO A;  2KP1 A;  5ECQ B;  5HFK A;  1T00 A;  3WYW A;  4BWQ A;  4PUA A;  5A5H B;  1VF2 A;  4XS1 A;  3WGE A;  1BAY A;  1O8W A;  1M99 A;  4OD7 A;  1THO A;  3PPU A;  3N5O A;  4WXT A;  4Q5R A;  1ERV A;  4V2N A;  1IYH A;  1M7T A;  1HNB A;  4N10 A;  3NZN A;  1SJ6 A;  3GKN A;  1K0B A;  3GYK A;  3A5I A;  3LEF A;  3IRA A;  4MPG A;  3K8N A;  1X9M B;  2HSN A;  1PKZ A;  3R3E A;  2HSM A;  3BCK A;  1O7U A;  4G0I A;  4MP4 A;  2LRC A;  2R6K A;  2DIZ A;  1EP7 A;  3G9B A;  2PUK C;  1GTI A;  1JHB A;  5ECM B;  2A2P A;  3V1W A;  5A5H A;  4V1A g;  4JR6 A;  3KTL A;  1U88 A;  4ML6 A;  1V40 A;  4NWY A;  2V6O A;  5ECI B;  3VI7 A;  1KEB A;  3KP9 A;  2VLU A;  4CDO A;  3ZMK A;  3ZRD A;  3UEM A;  2WS2 A;  1AC1 A;  3IE3 A;  1DE1 A;  4I2T A;  4BWS A;  1DBY A;  3F3R A;  3A2W A;  1ZYE A;  2CZ2 A;  3UOM A;  1XWK A;  2VKZ G;  3KIJ A;  2XHF A;  2IFQ A;  3L9U A;  3M1G A;  1X9W B;  2MZC A;  3RAZ A;  3CMI A;  3UVT A;  3HHV A;  1TOF A;  2H72 A;  2HQT A;  1WOU A;  3ZYW A;  3GHA A;  2B7J A;  3M0F A;  4I5Q A;  2P0G A;  3GX0 A;  1VF3 A;  3EPT A;  3UBK A;  1GUM A;  4GCI A;  2NPB A;  4O32 A;  1WP0 A;  2IJY A;  2VL3 A;  2GT6 A;  4MAB A;  3H4K A;  1EV4 A;  2UV8 G;  1AUC A;  2NBS A;  3W8J A;  5FT3 A;  4HOJ A;  4W66 A;  3C73 A;  1PQN A;  4H86 A;  2DJ2 A;  1OC8 A;  5G5F A;  2MMZ A;  5HR0 A;  1GLQ A;  1TKD B;  2PVQ A;  5LNK e;  3F6D A;  1TU7 A;  1GSE A;  4N11 A;  3EYT A;  4D73 B;  4K6X A;  2RM5 A;  1JZD A;  5J40 A;  3IC4 A;  1GTB A;  3NOF A;  1GRX A;  4KF9 A;  4G19 A;  3JCM L;  4YQU A;  2F9S A;  1W4V A;  5D9X A;  4TR4 A;  3C8E A;  3M9J A;  2RUE A;  3G7J A;  2IPA A;  1QK8 A;  2A4V A;  4I6X A;  1Z6N A;  2FHE A;  5AN1 A;  3WGD A;  1GUH A;  1R5A A;  3FMW A;  3ED3 A;  2TRC P;  4G9H A;  3ZML A;  4IGJ A;  5IPG A;  2B5E A;  1PGT A;  1PMT A;  1GTU A;  5CRH A;  3FR3 A;  3Q18 A;  1LBK A;  1Z7P A;  4USS A;  1E6B A;  3DKS A;  4ZL8 A;  2WFC A;  1OKT A;  2C0D A;  4V2L A;  1A2J A;  3HD5 A;  5CRD A;  3HJP A;  2YV7 A;  1AAZ A;  4RQR A;  4YQM A;  3VWX A;  2VLT A;  1SK2 A;  4XTS A;  3MNG A;  4TOP A;  2LNT A;  5D8I A;  1HNC A;  1MDK A;  3TRQ A;  1JLW A;  5IMD A;  3US3 A;  4EC0 A;  4N3Z A;  4K2X A;  3J7Y k;  4CY6 A;  4YKG A;  4MK3 A;  1HYU A;  4HEA 2;  5ELA A;  1O73 A;  4NHW A;  1WRY A;  2HZF A;  3TKP A;  3M8N A;  1V98 A;  2PMT A;  2AV4 A;  1R4W A;  3KH9 A;  5DAK B;  2H1G A;  3IOS A;  2FA8 A;  2IMD A;  2QKE A;  2E2G A;  2EC4 A;  3I69 A;  1SL1 B;  1AW9 A;  1EOG A;  1Z9H A;  1A2M A;  2MBT A;  5ECO B;  2IME A;  4XS4 B;  4EKZ A;  3ZZX A;  5JCW A;  2NTO A;  2K9F A;  1EZK A;  1G7O A;  2H1A A;  1DE2 A;  3IC8 A;  2HRK A;  1X5D A;  3RHB A;  3QAG A;  4K1F A;  2OBI A;  2VOC A;  2L6C A;  4TR0 A;  3GRX A;  3CYN A;  4XRA A;  2O85 A;  3TDG A;  1TW9 A;  2B7K A;  2C80 A;  2DIY A;  1K0N A;  4BVY B;  2MYG A;  4DSQ A;  4ECJ A;  4CW9 A;  7GSS A;  1YQ1 A;  1W89 A;  1JFU A;  3HZ4 A;  2VCQ A;  4EL1 A;  1OYJ A;  4E8H A;  4XS4 A;  1M2D A;  5IMZ A;  2GSS A;  2CT6 A;  2YCD A;  2CVD A;  1EGR A;  3LSZ A;  3GNJ A;  3IAS 2;  1UA5 A;  3LWA A;  3VPQ A;  1OKD A;  2H6Z A;  2ZUP A;  2D2Z A;  6GSV A;  1M0U A;  3M9K A;  2PWJ A;  5CAX A;  2JAD A;  3UJ1 A;  1TK5 B;  4KW6 A;  2PBJ A;  2R0P A;  1SJI A;  2B5Y A;  5DQS A;  3HMJ G;  4BVY A;  1T8E B;  2H75 A;  3ZIV A;  2H0I A;  4HI7 A;  1U6T A;  3FZA A;  1ZZY A;  1XVQ A;  4MDC A;  4BL7 A;  1GNW A;  2H76 A;  4IVF A;  3R2Q A;  5EPF A;  1TU8 A;  2YWO A;  1QMV A;  2H30 A;  3LOR A;  3PR8 A;  5ECP B;  1F37 A;  5DVB A;  3MYD A;  3GIX A;  1YEP A;  1ILO A;  2CVK A;  6GSS A;  5CYY A;  2DSA A;  4GSS A;  4YH2 A;  3D4T A;  4MJE A;  4EE0 A;  4XS6 A;  3HA9 A;  1FAA A;  4OO4 A;  2GQL A;  2H8L A;  9GSS A;  2FY6 A;  1EWX A;  3O6T A;  4PUR A;  1XVW A;  2HYX A;  1S3A A;  3TRP A;  1XOA A;  2VL2 C;  1A8L A;  1K3L A;  1FW1 A;  3F4T A;  3EMX A;  5D9T A;  1T3B A;  2YWN A;  4F03 A;  3KJY A;  1DUG A;  2BTO T;  3P2A A;  5IMA A;  2CAQ A;  2HE3 A;  1XW9 A;  3L78 A;  3KD0 A;  1AXD A;  2VD1 A;  3DD3 A;  3LYP A;  1EP8 A;  5A4U A;  4K5S A;  1M9B A;  5AGY A;  5E59 A;  4LMV A;  3BJ5 A;  2JSZ A;  4LMW A;  4O5R A;  3APO A;  3F6F A;  1JZR A;  3FR6 A;  4K7O A;  1U87 A;  3H79 A;  4MH2 A;  3MIX A;  3UAR A;  2IMK A;  5DJM A;  2REM A;  3CSI A;  1B4P A;  2HLS A;  3P90 A;  4KH7 A;  2QSI A;  3L9S A;  1OE7 A;  1OE8 A;  1Z5Y E;  1TRW A;  4ZB7 A;  3HXS A;  2DJ3 A;  2QA1 A;  4TR1 B;  3IK9 A;  4XRD A;  5J4Y A;  1A24 A;  4ZB9 A;  2H74 A;  3H93 A;  2DKH A;  2A2S A;  2QC7 A;  2OE3 A;  2DML A;  2C0F A;  3LW9 A;  3LFL A;  1O81 A;  4YKF A;  4RI6 A;  3W6G A;  1OC3 A;  2GDR A;  4PNF A;  1AQV A;  3IR4 A;  5JWR B;  1I9D A;  5ID2 A;  4Z2R A;  5GSS A;  4I8B A;  3ZRE A;  4HZ2 A;  2HSY A;  1DSB A;  3OR5 A;  1TRS A;  2B5X A;  4KAE A;  2XPD A;  1TTZ A;  5A4V A;  1ERU A;  2YNX A;  2HSN B;  2P5R A;  1JLV A;  4F0C A;  4NMU A;  4POL A;  2B1K A;  3ME7 A;  1QFN A;  3HVV A;  2E2M A;  4GRF A;  4TR1 A;  2NDO A;  2FWH A;  4JR4 A;  4J57 E;  4HZ4 A;  2GSQ A;  4NHZ A;  3RPP A;  3KGK A;  5IMC A;  1GWC A;  1S3C A;  3ERF A;  1BED A;  5HR2 A;  1NHY A;  17GS A;  2ES7 A;  3IXR A;  1WIK A;  2AYT A;  3KEB A;  5IMV A;  4FYC A;  4TXV A;  5CRW A;  3ZIT A;  2YZU A;  2CV4 A;  4G2E A;  1M9A A;  2VLV A;  5J5N A;  2LQQ A;  1Z7R A;  4WR5 A;  5H5Q A;  2IFQ B;  2KHP A;  4JRR A;  3FZ5 A;  1G6W A;  2H1L A;  5G1L A;  4X4J A;  2H6X A;  5D93 A;  4PTS A;  2QGV A;  3UAP A;  13GS A;  4TVE A;  3M3M A;  4L5O A;  3UL3 A;  2MBS A;  1NSW A;  4HDE A;  5JCG A;  4DVC A;  3DYR A;  1ABA A;  4GDF A;  1SVO A;  1MDJ A;  4LL4 B;  3GH6 A;  3FZ4 A;  4F82 A;  2PPT A;  4X1U A;  4MH3 A;  1SJZ A;  2B6M A;  2F3M A;  5IOX A;  2OE1 A;  2H01 A;  1TRV A;  3QFB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...