4ZBBA

Crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium complexed with glutathionyl-s-dinitrobenzene.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
221
structure length
221
Chain Sequence
ASHDKQFSLFLHKASAHGWKVAFVLEELSLSYEIVLVDVAKNEQKSPEFMKLNPNGRTPALIDHGNSDFVIWESNAMVQYVADKYDTERKISMAPGTDDFYIQLQWQYFQGTGQGPYFGQLVWFTLYHEEKIPSAVTRYKEEALRVFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFLDNFDFEKEFPATAAWHYKMLKRPTIKRPWDERRKLMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PcUre2p8
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 87
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zbbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zbbA01
3I6AA 2GT6A 3GNJA 3PR8A 1M9AA 3F6DA 1GSSA 3ZTLA 4N11A 4LA1A 4EO3A 3F0IA 4MDCA 4BA7A 3J7Yb 3P7XA 4JBBA 3MDKA 1O6JA 1E6BA 2VL2A 1OVNA 1SK1A 5CREA 4ZXGA 4OCEA 2JACA 2GTUA 1VF3A 2DIZA 2CQ9A 2WRTA 3TKSE 2GQKA 3HA9A 1G7EA 3I9V2 2IWTA 2IMIA 1K0CA 3CYNA 1I9DA 5HQPA 5JWRB 4K8MA 3EINA 3I43A 3M1GA 2XHFA 4ISDA 4G19A 4MF6A 1QK8A 1EV4A 4WXTA 3U6VA 2X8CA 1IYIA 5CRGA 2LNSA 1VF1A 1QXHA 3IRAA 1PL1A 20GSA 1SENA 1ML6A 1TW9A 3FZ4A 3E0UA 3UEMA 1KTEA 5ENUA 4TRXA 3KH9A 4JU5A 4MF7A 1JLWA 4CHSA 2PUKC 4NV5A 2YOIA 4TXOA 1AQWA 17GSA 3TOTA 2H73A 3HDCA 1A2JA 1SL2B 5AISA 5HR3A 4OMVA 4AGSA 1WRYA 2K8VA 3E9JB 2REMA 3GH9A 1TI3A 5AIXA 3PH9A 2CVDA 1ZL9A 3GKKA 2H30A 2OE1A 1G7OA 1F6MC 5J41A 1GSDA 2FCHA 1XWBA 2CX3A 3GMFA 4D73B 4OFTA 2LRCA 3QMXA 1M99A 1ZGNA 1Z6NA 4POBA 3VWVA 2B7JA 6GSYA 1XW5A 4X43A 5DDLA 1BAYA 4PQ1A 1SKSB 2AB6A 1OAZA 2C4JA 3KMOA 4OFNA 2O89A 4V1Ap 3E3EA 2HRKB 6GSWA 2VLVA 2R4VA 2EIOA 5KN3A 1XW9A 2B5EA 1B9XC 1SYRA 4IN0A 4GF0A 4DVCA 2HLSA 3ZVJA 4Q5NA 3C73A 1V2AA 2E0QA 4LL1B 5GSTA 4ZB6A 4HDEA 1JZRA 3HZ8A 14GSA 2VD0A 3D21A 1PX7A 2H74A 1A24A 2GSSA 4PQHA 4BVXA 2G2QA 3EC3A 1MD4A 2V1MA 4TVEA 3UVTA 3DXBA 1XXUA 2H66A 5IPGA 3VPTA 4ZL9A 1T4YA 1OKDA 2YWOA 3D0ZA 4V2NA 4G9HA 1YKCA 5BMUA 2JSZA 3G7JA 2PPTA 5ECHB 1EWXA 2HI7A 5ECKB 1BYEA 13GSA 2YZHA 4J2FA 5FT3A 2DJ1A 2VLUA 3ZL5A 1RW1A 1XIYA 2P31A 4L0WA 3ISOA 1YF0A 4GLTA 5FHIA 3N5OA 1G0TA 2YWMA 4L5LA 4F2IA 2JSYA 2WDUA 5DALB 1AQXA 2B6MA 4TXVA 1YEXA 3KH7A 3LQ7A 2GZZA 2ALBA 3TB2A 4PXOA 3DD3A 1MDJA 2IPAA 3TRQA 2NBSA 2IMFA 3OR5A 3UBLA 1JZDA 3LORA 3EE2A 3O3TA 5D73A 1O81A 2TRXA 1GSYA 3HZ4A 1GLPA 3IDVA 5FWGA 2LJKA 5IM9A 1AUCA 1FHEA 4E8HA 1R5PA 4RI6A 1NW2A 4NHWA 4BWSA 1AXDA 4K2DA 2N5FA 4MPFA 2L6DA 2D2ZA 4BVYB 2X99A 5A4WA 3F3QA 5J3RA 1V57A 4NAXA 4HJMA 3SWLA 2YJHA 2PVOC 4HS1A 1EGOA 2C8UA 2VCQA 4GQFA 1FOVA 2IFQB 3BOAA 1XVWA 3R2QA 2RUEA 4FYCA 2FNOA 2C0FA 4EE0A 3PINA 4LLRA 1WPIA 1TRUA 4MZWA 3W8SA 3J7Yk 2FGXA 4OWYA 2YWNA 5IOWA 1EV9A 3IA1A 4O7HA 4ZL7A 1TP9A 3FR3A 2ZUPA 1M2AA 3FHKA 3HCZA 4HQZA 1X5CA 5EPFA 4EL1A 1N2AA 1KBNA 4KE3A 4MMMA 1UN2A 2B5YA 4EDYA 3CMIA 3EWLA 1Z3EA 2VCTA 1F37A 4IP6A 1T8EB 4BL7A 5B8BA 1GSUA 3O76A 2CZ2A 4WEYA 1JFUA 1M7TA 1MDIA 3ME7A 4PTSA 4JZQA 4PQIA 2PVQA 2KOKA 5F05A 4MJCA 1JZOA 1SKRB 2H76A 2CT6A 2MBTA 3I69A 1GNEA 2OKAA 3EVIA 1X0RA 2F9SA 4NPBA 5CNWA 1U88A 2O7KA 3FY7A 3UMAA 1TXXA 5F07A 5DAKA 3L9UA 1TU8A 2H75A 2N5AA 4G0KA 2JZSA 1ZYQB 4XS4A 4XS1A 3HHVA 2HSNB 2CX4A 5B8AA 4TOPA 1EZKA 2FA4A 2O85A 1TRVA 2GVPA 3QDNA 5GSSA 1SKWB 1O85A 2MMZA 1R4WA 2I9HA 4ZL8A 5D9WA 3RAZA 2XC2A 1LBKA 1XBSA 4GCIA 3LWAA 4O32A 3IC4A 5IO2A 4Q5QA 4KCEA 5G1LA 2WJUA 3Q18A 3LJRA 4BWQA 4EKZA 1S3CA 3US3A 5ECNB 4O92A 1ILOA 2AAWA 3A3TA 1PSQA 1O8WA 5HFIA 3GTUB 2F51A 1PKZA 3QOUA 1GUHA 4IJ3A 2LEGA 1G6WA 4ECJA 3R3EA 4O5RA 3CSHA 2FY6A 1DE2A 3LYPA 1GRXA 4IHUA 1NM3A 3FR6A 2C3TA 1Q4JA 3TOUA 1PQNA 1PKWA 5HR1A 2HYXA 2ZNMA 5GAND 2L6CA 4I5QA 1XPVA 3BD2A 5IO0A 2H8LA 4H86A 3ERGA 2C0EA 3FZ5A 2LTKA 1YZXA 4GXZA 1U6TA 2X64A 1CQGA 1TK5B 2HRFA 1YJ6A 3IC8A 1TK0B 3CTFA 1PX6A 1EP8A 1URMA 5D9XA 2VUPA 3F63A 3IV4A 4ML1A 1OC8A 2XBQA 2KP2A 2CAQA 3EMPA 1A8LA 2GZYA 1MEKA 1HNBA 2FWEA 1XWCA 1HNAA 1U87A 1QQ2A 3M0FA 2P0GA 3QAWA 3DKSA 1XWGA 4I97A 3GH6A 4KA0A 1J08A 1K0OA 4IELA 5AN1A 2B3SA 3FK8A 4GSTA 1M2BA 2PERA 1K3YA 2WULA 10GSA 2N5BA 1MD3A 1TRWA 3GV1A 1B48A 1ZOFA 5EVOA 5IMFA 3TRXA 4V1Ag 4KSOA 4FYBA 4JR4A 3IR4A 3WYWA 3VI5A 5GAPD 5IMDA 1WOUA 2DJ3A 3CTGA 4RUVA 1FO5A 3HJPA 5AIVA 4TN8A 3VFIA 1ERWA 3L9VA 3ZRDA 5KN1A 2I1UA 4BPYA 2VL9A 3F4RA 3G9BA 2QC7A 2VOCA 2GSRA 5KEJA 3N9JA 4GTUA 4USSA 5HFGA 4XHMA 1X9MB 2YWIA 1FB6A 2WCIA 3KEBA 2IIYA 5DVBA 5JCUA 2GQMA 3M9KA 3BJ5A 1FAAA 3UARA 5H5RA 4PNGA 4DEJA 2LJAA 3LXTA 2GSQA 4TXOB 3EURA 5IMZA 3L9SA 3LGCA 3PPUA 3TJGA 1O7UA 2EC4A 4PURA 5ELAA 3GN3A 2MMNA 4DSRA 5KN2A 4XIHA 3NOFA 1TRSA 1PGTA 4OO5A 4KX4A 4X1UA 5J9BA 1GTAA 1PRXA 3WT1A 1Q98A 1PL2A 3KMNA 1M9BA 2B1KA 2VM2A 4I2UA 4IQAA 2H6ZA 3LG6A 1F3AA 1R5AA 2L4CA 4TW5A 3ZLPA 5D96A 3GL5A 3KXOA 2IMKA 2BMXA 3UAPA 1JZWA 4ECCA 2OE3A 3F9UA 2CV4A 4HUAA 1HNCA 3QR6A 1ERTA 3TKQA 3DEXA 11GSA 1Z5YE 1THOA 2OACA 1UVZA 4HZ4A 2PWJA 4TKYA 4MP4A 3FZ9A 2DJ0A 4ID0A 3EYTA 3FKFA 3GX0A 2WS2A 3GX8A 1K3OA 4KNDA 2RM5A 4TR1A 2IN3A 3ME8A 1OC3A 2E7PA 4I6XA 4ZBAA 1ACVA 3CRTA 1DUGA 2GQLA 3ERWA 4LL4B 2HFDA 2VCZA 4K9ZA 2VM1A 3AY8A 4JE1A 2YZUA 1XOAA 2LQOA 3RPNA 3H93A 4BVXB 2G0FA 1NHYA 3D6IA 6GSVA 1TOFA 1W89A 3RPPA 1AQVA 2C3QA 4ML6A 3IAM2 3Q19A 3GIXA 2PBJA 4HU7A 1T3BA 4MZCA 2QKEA 2C0GA 3ZREA 4QL7A 2VAFA 4V2LA 3DVWA 5DQYA 3VWWA 5ECOB 3ZFBA 1J0FA 3F3RA 2DIYA 4MABA 2C80A 1LU4A 2V6KA 2H1GA 2HSHA 5F8BA 1ON4A 4LMWA 1SD9A 2FWGA 2RUFA 4MJAA 2CVBA 3MAKA 1OYJA 4NHZA 3H8QA 1TU7A 2AUVA 1NSWA 4MZBA 1E2YA 2H1BA 4E8EA 4POMA 2C3NA 1ZYEA 2V32A 5CP1A 4ACSA 4G0IA 5JCGA 2A2SA 2KLXA 1Y6EA 5CAXA 3EU4A 3QFAC 4EXJA 1ERVA 2LQQA 4IJIA 1VF4A 2DLXA 4F03A 4K7IA 5H5SA 3FEUA 1F9MA 2PMTA 1AAZA 2AV4A 2OBKA 4AJ7A 4Q5RA 3IBHA 5A4UA 3TJKA 4HJ2A 1V58A 2LKUA 1GH2A 2PGTA 1V9WA 3EMXA 5IMCA 3M3MA 4EVMA 4RQXA 3GHAA 4G2EA 3GFKA 2GS3A 4FYUA 2R3XA 1SU9A 5ID2A 4RI7A 2LUSA 3HJMA 4AJ6A 3M8NA 2M80A 4FQUA 1BG5A 5E4WA 1ABAA 3K8NA 3TKPA 2GSTA 3ZIJA 3LSZA 1K0BA 4PUAA 1BQ7A 1VGLA 2GGTA 3P2AA 1QUWA 1K0MA 3ERFA 22GSA 3IE3A 1W4VA 1OC9A 3MWHA 4ILFA 2KHPA 1F3BA 2DMLA 1SD8A 2JZRA 4FIWA 3ZVJD 1HYUA 5CO3A 3O6TA 2UZ8A 5D9VA 4CW9A 5CRWA 4ZBBA 1THXA 1KEBA 2JL4A 4KGIA 3A2VA 5ELGA 1EGRA 5D93A 3SBCA 1YKAA 3KIJA 1ZMAA 1XCCA 1OKTA 1T00A 3L0HA 4BL7B 3VLNA 2YNXA 2O87A 4N0ZA 1O73A 1OE7A 2YJ7A 4IGJA 2L5OA 4PX1A 3DRNA 5J9CA 2YN1A 2LS5A 3FRCA 1QMVA 3EU3A 2H72A 4MJEA 6GSSA 2RM6A 2NTOA 2VCVA 3TJJA 3HD5A 4QQ7A 4MCUA 2IMDA 4G0LA 3DMLA 5DAKB 4XTSA 3W8JA 5HR0A 1SJ6A 1T1VA 6GSUA 3CRUA 2L59A 5ABRA 2H6XA 2HSMA 4XS4B 2L5LA 4RQRA 2BJXA 4L5OA 3G7YA 1B8XA 2AHEA 2R6KA 2NVLA 2HRNA 5IPHA 1DBYA 5DJMA 3HYPA 1KNGA 1GSEA 3C71A 3A2XA 1AW9A 2VD1A 2HRAA 4PUFC 4GSNA 1A0FA 4N0VA 5IIZA 3IXRA 4P3YB 1M2DA 1U3AA 3F4TA 2FWHA 2QSIA 3A5WA 3H1NA 5DQSA 1TI1A 3VWUA 3Q74A 2H0HA 4FH8A 2L57A 5G31A 3TUEA 1YQ1A 4F82A 1YDKA 3Q6OA 4KAEA 1BJXA 1YY7A 3H4KA 2LJRA 2B5XA 3QCPA 5COHA 5J5NA 1XFLA 2KUCA 2YANA 2K6VA 2K18A 4TR4A 3TKRA 5IOXA 3GKXA 4EUYA 2FWFA 4N30A 2GDRA 3LXZA 2R37A 2Z9SA 1C72A 3W6GA 2B7KA 5G30A 2JU5A 3QAVA 2VLTA 2GZPA 1K0DA 1Z9HA 2H71A 2B1LA 5EL8A 4MF5A 4CDOA 5JCWA 2XPDA 4ECIA 4MH2A 3GRXA 2H19A 2TIRA 1MDKA 3APOA 4IKHA 2HZEA 5G5FA 3D4MA 3ZYWA 2P5RA 5HFKA 1A0RP 4TR3A 4YAPA 2RLIA 1T4ZA 1B4PA 1XWKA 3CBUA 5ECIB 1FG4A 3TKSC 1R7HA 3UIWA 2JADA 1A2MA 2ON7A 3APQA 1SL0B 2FA8A 1WP0A 4EF0A 2K8SA 3GKMA 3IHQA 2HNLA 2WZ9A 3ZMLA 2A4VA 1X9SB 2LRTA 5J4UA 1NHOA 2NPBA 4FO5A 1CQHA 4K7OA 3LFLA 3VPQA 5G2ZA 4F9ZA 18GSA 1VF2A 3BCKA 2H0GA 1G6YA 4IP1A 3C8EA 2A2RA 1X9WB 3WD6A 3C1RA 2YCDA 2OJLA 3MSZA 2JZTA 4ZIJA 2H0IA 5DJLA 3HXSA 3WGDA 3DGQA 5B6NA 1A23A 4AF2A 4OD7A 4WR4A 3WGEA 4HOJA 3FYGA 4MLYA 4WKWA 3ZITA 1GP1A 2YP6A 4HI7A 3MNGA 4G10A 5DCGA 3APSA 3GA4A 1X5DA 2I81A 3V1WA 3TRPA 3KM6A 3NZNA 2AYTA 2J23A 3IK9A 2F3MA 4GRFA 3NIVA 3G7IA 3GL3A 1TDIA 2H1DA 2OADA 5ECSA 9GSSA 1GSFA 4D73A 5ECRB 4YAVA 3KTBA 2C1YA 3PGTA 1BEDA 1A2LA 3UBKA 3DIEA 2O8VB 2EIRA 4NWYA 1Z7RA 2CAIA 3GKNA 4IS0A 5E59A 3IPZA 4IBPA 4ULXA 3JCML 4WETA 1TKDB 3D5JA 4L0UA 5LCZA 1UA5A 2V2GA 2HRKA 1RK4A 1GTIA 8GSSA 2MYGA 1XVQA 2FHEA 3CSIA 1QGVA 3ZFLA 4WF5A 4K7NA 3VWXA 4TR1B 1Y25A 4OCFA 3RDWA 2CVKA 5EY6A 4AJ8A 1MTCA 3TGZA 2OE0A 2CA8A 4KCAA 4POLA 1GLQA 2F8AA 3UJ1A 1T7PB 4DSSA 3VURA 5CYYA 3UL3A 2H1AA 2HE3A 1VRSD 4I8BA 3KP9A 1YEPA 3IK7A 3KGKA 1GTBA 3TJFA 4DSSB 4Z7XA 1R26A 3HKRA 3U5RE 3C1SA 2VL2C 3F8UA 3M9JA 3TJBA 3ZMKA 3HVSA 3L4NA 4YQUA 1LJRA 4X0XA 2DSAA 3HVXA 2XPEA 3WGXA 1JHBA 1GWCA 2MZCA 2PN8A 3WT2A 2CZ3A 1XOBA 4K1FA 4HZ2A 3QFBC 3GUSA 4KDYA 2IMEA 1K0NA 5ECLB 4KH7A 4ZBDA 3UOMA 19GSA 1GUKA 2E2MA 1EEJA 2BTOT 4YQVA 1GUMA 3FW2A 1I5GA 3ZIVA 2PU9C 5DALA 3DYRA 4TR0A 2M46A 1EOGA 4POKA 3S9FA 4V2MA 5CRDA 4L8EA 1EEMA 5F06A 2DMMA 3BCIA 1TK8B 4IVFA 5LD0A 3KP8A 2FLSA 12GSA 4DSQA 1H4OA 1O8XA 3H79A 1PA3A 2YPMA 1XWAA 3QPMA 2GT5A 1Z6MA 6GSTA 3D22A 3ED3A 4MK3A 2E2GA 2C0DA 1WMJA 2R2JA 16GSA 2HT9A 4ZILA 5DBQA 4KDUA 1S3AA 1ERUA 3KCMA 4KF9A 1FB0A 4GSSA 4PGTA 5G1KA 2DBCA 4BVYA 1TTZA 1GNWA 2AJQB 4ZB8A 1F2EA 4YQMA 4XRDA 1U3IA 3HY2A 2VCWA 1SK0A 2I3YA 3VK9A 3GSSA 1PMTA 5IMVA 3CXGA 4KSMA 3RBTA 3LEFA 2KP1A 1RQMA 5D9TA 2VIMA 4J57E 4MH3A 2WB9A 1TJDA 2IFQA 5G5EA 1IYHA 1A8YA 5ID2B 3RHBA 3DWVA 2WFCA 3ZZXA 2VL3A 1FVJA 2H01A 3F6FA 3HVVA 2NDOA 5KN0A 4IQ1A 1WJKA 7GSSA 4EDZA 2R5GA 1OC9B 3P8WA 5IMAA 1WIKA 3L78A 1FVKA 4K0NA 3FR9A 2TRCP 1GL8A 3LYKA 3HJOA 4JR6A 2XBIA 2X8HA 5L71A 3C7MA 3QAGA 1V98A 2IL3A 1PN9A 1J9BA 3TKSA 4WR5A 4GQCA 3GURA 4OO4A 2I4AA 4XCSA 1WWJA 5A5KA 5AGYA 3QD9A 1H75A 2LSTA 5A4VA 4N10A 4K6XA 1SL1B 2DJ2A 2YV9A 3F4SA 1GULA 2OA7A 2X8GA 1K3LA 4KW6A 1USBA 4IW9A 2FUG2 4PNFA 4JRRA 4XS6A 3VI7A 1SJZA 2DC5A 4F0CA 1YF1A 1JLVA 3GSTA 5IQYA 1N8JA 5H5QA 2HSMB 6GSXA 4MA9A 1UC7A 5DCHA 1QFNA 4QL9A 3UVHA 2ZCTA 1ST9A 4WBJA 2IJYA 1XW6A 1EP7A 2H6YA 3KZQA 4JEDA 1SK2A 5D8IA 2MBSA 2MMAA 2OBIA 4XRAA 2HQTA 1PD21 5JWQB 1FW1A 4LMVA 1BX9A 2P5QA 1HD2A 2L4QA 5B6MA 2EIQA 3DVXA 2LV3A 3TDGA 2YV7A 1B9YC 2HSYA 3GTUA 2V41A 4ECBA 2RIIA 3D4TA 1M0UA 3KJYA 5CRHA 4Q5FA 1HQOA 2J9HA 1EOHA 2WGRA 2DJJA 2DJKA 1X5EA 4GWRA 4KUNA 1GSQA 2F8FA 4HEA2 3FZAA 2ES7A 3BBYA 4F0BA 4HU9A 1AC1A 4MJBA 4NMUA 4ZB9A 1GTUA 2LNTA 4MPGA 4HQSA 5HR2A 2V6OA 1DSBA 4K0GA 1Z7PA 2FD3A 5LNKe 4WBRD 4YH2A 1S3DA 4NXIA 5ECMB 1WE0A 2HXKA 2K9FA 3CSJA 3KTLA 4KDXA 2H70A 1B4QA 2VCXA 1K0AA 1OE8A 1V40A 2ON5A 5GZZB 5INYA 4OFMA 1SYXA 4I2TA 3KD0A 2M72A 1ZZYA 2GLRA 2LRNA 2VO4A 5B7CA 1SJIA 1DE1A 5ECPB 3A2WA 3IAS2 3TCOA 4EC0A 1XZOA 1ZCPA 3RHCA 2HZFA 5F0GA 3IOSA 1AIUA 5ECQB 4WF4A 4NV2A 2QGVA 4J56E 3GYKA 2MMOA 5C04A 4KB3A 3P90A 5C00A 5JWOB 2HZEB
chains in the Genus database with same CATH superfamily
3I6AA 2GT6A 3GNJA 3PR8A 1M9AA 3F6DA 2EFHA 1GSSA 3ZTLA 4N11A 4LA1A 4EO3A 3F0IA 4MDCA 4BA7A 3J7Yb 3P7XA 4JBBA 3MDKA 1O6JA 1E6BA 2VL2A 1OVNA 1SK1A 5CREA 4ZXGA 4OCEA 2JACA 2GTUA 1VF3A 2DIZA 3RGBC 4G01A 2CQ9A 2WRTA 3TKSE 2GQKA 3HA9A 1G7EA 3I9V2 2IWTA 2IMIA 1K0CA 3CYNA 4YKGA 1I9DA 5HQPA 5JWRB 4K8MA 3EINA 3I43A 3M1GA 2XHFA 4ISDA 4G19A 4MF6A 1QK8A 1EV4A 4WXTA 3U6VA 2X8CA 1IYIA 5CRGA 2LNSA 5J4VA 1VF1A 1QXHA 3IRAA 3HMJG 1PL1A 20GSA 1SENA 1ML6A 1TW9A 2O36A 3FZ4A 3E0UA 3UEMA 1KTEA 5ENUA 4TRXA 3KH9A 4JU5A 4MF7A 1JLWA 4CHSA 2PUKC 4NV5A 2YOIA 4TXOA 1AQWA 17GSA 3TOTA 2H73A 3HDCA 1A2JA 1SL2B 5AISA 5HR3A 4OMVA 4AGSA 1WRYA 2K8VA 3E9JB 2REMA 1PN0A 3GH9A 1TI3A 5AIXA 3PH9A 2CVDA 1ZL9A 1YEWC 3GKKA 2H30A 2OE1A 1G7OA 1F6MC 5J41A 1GSDA 2FCHA 1XWBA 2CX3A 3GMFA 4D73B 4OFTA 2LRCA 3QMXA 1M99A 1ZGNA 1Z6NA 5KOWA 4BIKA 4POBA 3VWVA 2B7JA 6GSYA 1XW5A 4X43A 5DDLA 1BAYA 4PQ1A 1SKSB 2AB6A 1OAZA 2C4JA 3KMOA 4OFNA 2O89A 4V1Ap 3E3EA 2HRKB 6GSWA 2VLVA 2R4VA 2EIOA 5KN3A 1XW9A 2B5EA 1B9XC 1SYRA 4IN0A 4GF0A 4DVCA 2HLSA 3ZVJA 4Q5NA 3C73A 1V2AA 2E0QA 4LL1B 5GSTA 4ZB6A 4HDEA 1JZRA 3HZ8A 14GSA 2VD0A 3D21A 1PX7A 2H74A 1A24A 2GSSA 4PQHA 4BVXA 2G2QA 3EC3A 1MD4A 2V1MA 4TVEA 4ZB7A 3UVTA 3DXBA 1XXUA 2H66A 5IPGA 3VPTA 4ZL9A 1T4YA 1OKDA 2YWOA 3D0ZA 4V2NA 4G9HA 1YKCA 5BMUA 2JSZA 3G7JA 2PPTA 5ECHB 1EWXA 2HI7A 5ECKB 1BYEA 13GSA 2YZHA 4J2FA 5FT3A 2DJ1A 2VLUA 3ZL5A 1BF5A 1RW1A 1XIYA 2P31A 4L0WA 3ISOA 1YF0A 4GLTA 5FHIA 3N5OA 1G0TA 2YWMA 4L5LA 4F2IA 2JSYA 2WDUA 5DALB 4HSCX 1AQXA 2WW3A 2B6MA 4TXVA 1YEXA 3KH7A 3HVNA 3LQ7A 2GZZA 2ALBA 3TB2A 4PXOA 3DD3A 1MDJA 2IPAA 3TRQA 2NBSA 2IMFA 3OR5A 3UBLA 1JZDA 3LORA 3EE2A 2OT3A 3O3TA 5D73A 1O81A 2TRXA 1GSYA 3HZ4A 1GLPA 3IDVA 5FWGA 2A4HA 2LJKA 5IM9A 1AUCA 1FHEA 4E8HA 1R5PA 4RI6A 1NW2A 4NHWA 4BWSA 1AXDA 4K2DA 2N5FA 4MPFA 2L6DA 2D2ZA 4BVYB 2X99A 5A4WA 3F3QA 5J3RA 1V57A 4NAXA 4HJMA 3SWLA 2YJHA 2PVOC 4HS1A 1EGOA 2C8UA 2VCQA 4GQFA 1FOHA 1FOVA 2IFQB 3BOAA 1XVWA 3R2QA 2RUEA 4FYCA 2FNOA 2QA2A 4EE0A 2C0FA 4E68A 3PINA 4LLRA 1WPIA 1TRUA 4MZWA 3W8SA 3J7Yk 4Z2TA 2FGXA 4OWYA 2YWNA 5IOWA 1EV9A 3IA1A 4O7HA 4ZL7A 1TP9A 3FR3A 2ZUPA 1M2AA 4QMKA 3FHKA 3HCZA 4HQZA 1X5CA 5EPFA 4EL1A 1N2AA 1KBNA 4KE3A 4MMMA 1UN2A 2B5YA 4EDYA 1M3IA 3CMIA 3EWLA 1Z3EA 2VCTA 2WVYA 1F37A 4IP6A 1T8EB 4BL7A 5B8BA 1GSUA 3O76A 2CZ2A 4WEYA 1JFUA 1M7TA 1MDIA 3ME7A 4PTSA 4JZQA 4PQIA 2PVQA 2KOKA 5F05A 4MJCA 1JZOA 1SKRB 2H76A 2CT6A 2MBTA 3I69A 2QA1A 1GNEA 2OKAA 3EVIA 1X0RA 2F9SA 4NPBA 5CNWA 1U88A 2O7KA 3FY7A 3UMAA 1TXXA 5F07A 5DAKA 3L9UA 1TU8A 3CQFA 2H75A 2N5AA 4G0KA 2JZSA 1ZYQB 4XS4A 4XS1A 3HHVA 2HSNB 2CX4A 5B8AA 4TOPA 1EZKA 2FA4A 2O85A 1TRVA 2WW1A 2GVPA 3QDNA 2DKIA 5GSSA 1SKWB 1O85A 2MMZA 1R4WA 2I9HA 4ZL8A 5D9WA 3RAZA 2XC2A 1LBKA 1XBSA 4GCIA 3LWAA 4O32A 3IC4A 5IO2A 4Q5QA 4KCEA 5G1LA 2WJUA 3Q18A 3LJRA 4BWQA 4EKZA 4PHZC 1S3CA 3US3A 3LW9A 5ECNB 1SVLA 1N25A 4O92A 1ILOA 2AAWA 3A3TA 1PSQA 1O8WA 5HFIA 3GTUB 2F51A 1PKZA 3QOUA 1GUHA 4IJ3A 5A34A 2LEGA 1G6WA 1I1IP 4ECJA 3R3EA 4O5RA 3CSHA 2FY6A 1DE2A 3LYPA 1GRXA 4IHUA 1NM3A 3FR6A 2C3TA 2WVXB 1Q4JA 3TOUA 1PQNA 1PKWA 5HR1A 2HYXA 2ZNMA 5GAND 1Y1UA 2L6CA 4I5QA 1XPVA 3BD2A 5IO0A 2H8LA 5A5HA 4H86A 4Z2RA 3ERGA 2EFEA 2C0EA 3FZ5A 2LTKA 1YZXA 4GXZA 1U6TA 2X64A 1CQGA 2R0GA 1TK5B 2HRFA 1YJ6A 3IC8A 1TK0B 3CTFA 1PX6A 1PFOA 1EP8A 1URMA 5D9XA 2VUPA 3F63A 3IV4A 4ML1A 1OC8A 2XBQA 2KP2A 2CAQA 3EMPA 1A8LA 2GZYA 1MEKA 1HNBA 2FWEA 1XWCA 1HNAA 1U87A 1QQ2A 3M0FA 2P0GA 3QAWA 3DKSA 1XWGA 4I97A 3GH6A 4KA0A 1J08A 1K0OA 4IELA 5AN1A 2B3SA 3FK8A 4GSTA 1M2BA 2PERA 1K3YA 2WULA 10GSA 2N5BA 1MD3A 1TRWA 3GV1A 1B48A 1ZOFA 5EVOA 5IMFA 3TRXA 4V1Ag 4KSOA 4FYBA 4JR4A 3IR4A 3WYWA 3VI5A 5GAPD 5IMDA 1WOUA 2DJ3A 3CTGA 4RUVA 1FO5A 3HJPA 5AIVA 4TN8A 3VFIA 1ERWA 3L9VA 3ZRDA 5KN1A 2I1UA 4BPYA 4PI2C 5BRTA 2VL9A 3F4RA 3G9BA 2QC7A 2VOCA 2GSRA 5KEJA 3N9JA 4GTUA 4USSA 2A2PA 5HFGA 4XHMA 1X9MB 2YWIA 1FB6A 2WCIA 3KEBA 2IIYA 5DVBA 5JCUA 2GQMA 3M9KA 3BJ5A 1FAAA 3UARA 5H5RA 4PNGA 4DEJA 2LJAA 3LXTA 2GSQA 4TXOB 4K5SA 3EURA 4O5QA 5IMZA 3L9SA 3LGCA 3PPUA 3TJGA 1O7UA 2EC4A 4PURA 5ELAA 3GN3A 2MMNA 4DSRA 5KN2A 4XIHA 3NOFA 4A5PA 1TRSA 1PGTA 4OO5A 4KX4A 4X1UA 5J9BA 1GTAA 1PRXA 3WT1A 1Q98A 4O5UA 1PL2A 3KMNA 1M9BA 2B1KA 2VM2A 4I2UA 4IQAA 2H6ZA 3LG6A 1F3AA 1R5AA 2L4CA 4TW5A 3ZLPA 5D96A 3GL5A 2WVZA 3KXOA 2IMKA 2BMXA 3UAPA 1JZWA 4ECCA 2OE3A 3F9UA 2CV4A 1HNCA 4HUAA 3QR6A 1ERTA 3TKQA 3DEXA 11GSA 1Z5YE 1THOA 2OACA 1UVZA 4HZ4A 2PWJA 4TKYA 4MP4A 3FZ9A 2DJ0A 4ID0A 3EYTA 3FKFA 3GX0A 2WS2A 3GX8A 1K3OA 4KNDA 2RM5A 4TR1A 2IN3A 3ME8A 1OC3A 2E7PA 4I6XA 4ZBAA 1ACVA 3CRTA 1DUGA 2GQLA 3ERWA 4LL4B 2HFDA 2VCZA 4K9ZA 2VM1A 3AY8A 4JE1A 5J4YA 2YZUA 1XOAA 2LQOA 3RPNA 3H93A 4BVXB 2G0FA 1NHYA 4ICYA 3D6IA 6GSVA 1TOFA 1W89A 3RPPA 4PI0C 1AQVA 2C3QA 4ML6A 3IAM2 3Q19A 3GIXA 2PBJA 4HU7A 1T3BA 4MZCA 5BMUB 2QKEA 2C0GA 3ZREA 4QL7A 2VAFA 4V2LA 3DVWA 5DQYA 3VWWA 5ECOB 3ZFBA 1J0FA 3F3RA 2DIYA 4MABA 2C80A 1LU4A 2V6KA 2H1GA 1S3RA 2O3EA 2HSHA 5F8BA 1ON4A 4LMWA 1SD9A 2FWGA 2RUFA 4MJAA 1ZYPA 2CVBA 3MAKA 1OYJA 4NHZA 3H8QA 2X49A 1TU7A 2AUVA 1NSWA 4MZBA 4GDFA 1E2YA 4E8EA 2H1BA 4POMA 2C3NA 1ZYEA 1TXUA 2V32A 5CP1A 4ACSA 4G0IA 3FMWA 5JCGA 2A2SA 2KLXA 1Y6EA 1YVLA 5CAXA 3EU4A 3QFAC 4EXJA 1ERVA 2LQQA 4IJIA 5A1NA 1VF4A 2DLXA 4F03A 4K7IA 5H5SA 3FEUA 1F9MA 2PMTA 1AAZA 2AV4A 2OBKA 4EIQA 2WW2A 4AJ7A 5A1NB 4Q5RA 3IBHA 5A4UA 3TJKA 4HJ2A 1V58A 2LKUA 1GH2A 2PGTA 1V9WA 3EMXA 5IMCA 5J47A 3M3MA 4EVMA 4RQXA 1ZYNA 3GHAA 4G2EA 3GFKA 2GS3A 2R3XA 4FYUA 1SU9A 5ID2A 4RI7A 2LUSA 3HJMA 4AJ6A 3M8NA 2M80A 4FQUA 1BG5A 4AKGA 5E4WA 1ABAA 3K8NA 3TKPA 2GSTA 3ZIJA 3LSZA 4MNNA 2R0PA 1K0BA 4PUAA 1BQ7A 1VGLA 2GGTA 3P2AA 1QUWA 1K0MA 3ERFA 22GSA 3IE3A 1W4VA 1OC9A 3MWHA 4ILFA 2KHPA 1F3BA 2DMLA 1SD8A 2JZRA 4FIWA 3ZVJD 1HYUA 5CO3A 2UZ8A 3O6TA 5D9VA 4CW9A 5CRWA 4ZBBA 1THXA 1KEBA 2JL4A 4KGIA 3A2VA 5ELGA 1EGRA 5D93A 3SBCA 1YKAA 3KIJA 4Z2UA 3TU3B 1ZMAA 1XCCA 1OKTA 1T00A 3L0HA 4BL7B 3VLNA 1M3JA 2YNXA 2O87A 2WW0A 4N0ZA 1O73A 1OE7A 2YJ7A 4IGJA 2L5OA 4PX1A 3DRNA 5J9CA 2YN1A 2LS5A 3FRCA 1QMVA 3EU3A 2H72A 4MJEA 6GSSA 2RM6A 2NTOA 2VCVA 3TJJA 3HD5A 4QQ7A 4MCUA 2IMDA 4G0LA 3DMLA 5DAKB 4XTSA 3W8JA 5HR0A 1SJ6A 1T1VA 6GSUA 3CRUA 2L59A 5ABRA 2H6XA 2HSMA 4XS4B 2L5LA 4RQRA 2BJXA 4L5OA 3G7YA 1B8XA 2AHEA 2R6KA 2NVLA 2HRNA 5IPHA 2EFDA 1DBYA 5DJMA 3HYPA 1KNGA 1GSEA 3C71A 3A2XA 1AW9A 2VD1A 3CWGA 2HRAA 4PUFC 4GSNA 1A0FA 4N0VA 5IIZA 3IXRA 4P3YB 1M2DA 1U3AA 3F4TA 2FWHA 2QSIA 3A5WA 3H1NA 5DQSA 1TI1A 3VWUA 3Q74A 2H0HA 4FH8A 4FXYP 2L57A 5G31A 3TUEA 1YQ1A 4F82A 1YDKA 5A34B 3Q6OA 4KAEA 1BJXA 1YY7A 3H4KA 2LJRA 2B5XA 3QCPA 5COHA 5J5NA 1XFLA 2KUCA 2YANA 2K6VA 2K18A 4TR4A 3TKRA 5IOXA 3GKXA 4EUYA 2FWFA 4N30A 2GDRA 3LXZA 3MYDA 5A5HB 2H1LA 2R37A 2Z9SA 1C72A 3W6GA 2B7KA 5G30A 5J40A 4AKIA 3QAVA 2JU5A 2VLTA 2GZPA 1K0DA 1Z9HA 2H71A 2B1LA 3IHGA 5EL8A 4MF5A 4CDOA 5JCWA 2XPDA 4ECIA 4MH2A 3GRXA 2H19A 2TIRA 1MDKA 3APOA 4IKHA 2HZEA 2EFCA 5G5FA 3D4MA 3ZYWA 2P5RA 5HFKA 1SVMA 1A0RP 4TR3A 4YAPA 2RLIA 1T4ZA 1B4PA 1XWKA 3CBUA 5ECIB 1FG4A 3TKSC 1R7HA 3UIWA 2JADA 2VKZG 1A2MA 2ON7A 4CY6A 3APQA 1SL0B 2FA8A 1WP0A 4EF0A 2K8SA 3GKMA 3IHQA 2HNLA 2WZ9A 3ZMLA 2A4VA 1X9SB 2LRTA 5J4UA 1NHOA 2NPBA 4FO5A 1CQHA 4AKXB 4K7OA 3LFLA 4AKHA 3VPQA 5G2ZA 4F9ZA 18GSA 1VF2A 3BCKA 2H0GA 1G6YA 4IP1A 3RFRC 3C8EA 2A2RA 1X9WB 3WD6A 3C1RA 2YCDA 2OJLA 3MSZA 2JZTA 4ZIJA 2R0CA 4AI6A 2H0IA 5DJLA 3HXSA 3WGDA 3DGQA 5B6NA 1A23A 4AF2A 4OD7A 2DKHA 4WR4A 3WGEA 4HOJA 3FYGA 4MLYA 4WKWA 3ZITA 1GP1A 2YP6A 4HI7A 3MNGA 4G10A 5DCGA 3APSA 3GA4A 1X5DA 2I81A 3V1WA 3TRPA 3KM6A 3NZNA 2AYTA 2J23A 3IK9A 2F3MA 3NIVA 4GRFA 4K5RA 3G7IA 3GL3A 1TDIA 2H1DA 2OADA 5ECSA 9GSSA 1GSFA 4D73A 5ECRB 4YAVA 3KTBA 2C1YA 3PGTA 1BEDA 3MIXA 1A2LA 3UBKA 3DIEA 2O8VB 2EIRA 4NWYA 1Z7RA 2CAIA 3GKNA 4K2XA 4IS0A 5E59A 3IPZA 4IBPA 4ULXA 3JCML 3A5IA 4WETA 1TKDB 3D5JA 4L0UA 5LCZA 1UA5A 2V2GA 2HRKA 1RK4A 1GTIA 8GSSA 2MYGA 1XVQA 2FHEA 3CSIA 1QGVA 3ZFLA 4WF5A 4K7NA 3VWXA 4TR1B 1Y25A 4OCFA 3RDWA 2CVKA 5EY6A 4AJ8A 1MTCA 3TGZA 2OE0A 2CA8A 2WZSA 4KCAA 4POLA 1GLQA 2F8AA 3UJ1A 1T7PB 4DSSA 1SVOA 3VURA 5CYYA 3UL3A 2H1AA 2HE3A 1VRSD 4I8BA 3KP9A 1YEPA 3IK7A 3KGKA 1GTBA 2X4AA 3TJFA 4DSSB 4Z7XA 1R26A 3HKRA 3U5RE 3C1SA 2VL2C 3F8UA 3M9JA 3TJBA 3ZMKA 3HVSA 3L4NA 4YQUA 1LJRA 4X0XA 2DSAA 3HVXA 2XPEA 3WGXA 1JHBA 1GWCA 2MZCA 2PN8A 3WT2A 2CZ3A 1XOBA 4K1FA 4HZ2A 4YKFA 3QFBC 3GUSA 4KDYA 2IMEA 1K0NA 5ECLB 4KH7A 4ZBDA 3UOMA 19GSA 1GUKA 2E2MA 1EEJA 2BTOT 4YQVA 1GUMA 3FW2A 1I5GA 3ZIVA 2PU9C 5DALA 3DYRA 4TR0A 2M46A 1EOGA 4POKA 3S9FA 4V2MA 5CRDA 4L8EA 1EEMA 5F06A 2DMMA 3BCIA 1TK8B 4IVFA 5LD0A 3KP8A 4W66A 2FLSA 12GSA 4DSQA 1H4OA 1O8XA 3H79A 2UV8G 1PA3A 2YPMA 1XWAA 3QPMA 2GT5A 1Z6MA 6GSTA 3D22A 3ED3A 4MK3A 2E2GA 2C0DA 1WMJA 2R2JA 16GSA 2HT9A 4ZILA 5DBQA 4KDUA 1S3AA 1ERUA 3KCMA 4KF9A 1FB0A 4GSSA 4PGTA 5G1KA 2DBCA 4BVYA 1TTZA 1GNWA 2AJQB 4ZB8A 1F2EA 4YQMA 4XRDA 1U3IA 3HY2A 2VCWA 1SK0A 2I3YA 3VK9A 3GSSA 1PMTA 5IMVA 3CXGA 4KSMA 3RBTA 3LEFA 2KP1A 1RQMA 5D9TA 2VIMA 4J57E 4MH3A 2WB9A 1TJDA 2IFQA 5G5EA 1IYHA 1A8YA 5ID2B 3RHBA 3DWVA 2WFCA 3ZZXA 2VL3A 1FVJA 2H01A 3F6FA 3HVVA 2NDOA 5KN0A 4IQ1A 1WJKA 7GSSA 4EDZA 2R5GA 1OC9B 3P8WA 5IMAA 1WIKA 3L78A 1FVKA 4K0NA 3FR9A 2TRCP 3CHXC 1GL8A 3LYKA 3HJOA 4JR6A 2XBIA 2X8HA 5L71A 3C7MA 3QAGA 1V98A 2IL3A 1PN9A 1J9BA 3TKSA 4WR5A 4GQCA 3GURA 4OO4A 2I4AA 4XCSA 1WWJA 5A5KA 5AGYA 3QD9A 1H75A 2LSTA 5A4VA 4N10A 4K6XA 1SL1B 2DJ2A 2YV9A 3F4SA 1GULA 2OA7A 2X8GA 1K3LA 2O5VA 4KW6A 1USBA 4IW9A 2FUG2 4PNFA 4JRRA 2HSNA 4XS6A 3VI7A 1SJZA 2DC5A 4F0CA 1YF1A 1JLVA 3GSTA 5IQYA 1N8JA 5H5QA 2HSMB 6GSXA 4MA9A 1UC7A 5DCHA 1QFNA 4QL9A 1XG8A 3UVHA 2ZCTA 1ST9A 4WBJA 2IJYA 1XW6A 1EP7A 4CY8A 2H6YA 3KZQA 4JEDA 1SK2A 1BG1A 5D8IA 4X4JA 2MBSA 2MMAA 2OBIA 4XRAA 2HQTA 1PD21 5JWQB 1FW1A 4LMVA 4N3ZA 1BX9A 2P5QA 1HD2A 2L4QA 5B6MA 2EIQA 3DVXA 2LV3A 3TDGA 2YV7A 1B9YC 2HSYA 3GTUA 2V41A 4ECBA 2RIIA 4EIPA 3D4TA 1M0UA 3KJYA 5CRHA 4Q5FA 1HQOA 2J9HA 1EOHA 2WGRA 2DJJA 2DJKA 1X5EA 4GWRA 4KUNA 1GSQA 2F8FA 4HEA2 3FZAA 1S4BP 2ES7A 3BBYA 4F0BA 4HU9A 1AC1A 5KOXA 4MJBA 4NMUA 4ZB9A 1GTUA 2LNTA 4MPGA 4HQSA 5HR2A 2V6OA 1DSBA 4K0GA 1Z7PA 2FD3A 5LNKe 2WVXA 4WBRD 4YH2A 1S3DA 4NXIA 5ECMB 1WE0A 2HXKA 2K9FA 3CSJA 3KTLA 4KDXA 2H70A 1B4QA 2VCXA 1K0AA 1OE8A 1V40A 2ON5A 5GZZB 5INYA 4OFMA 1SYXA 4I2TA 3KD0A 2M72A 1ZZYA 2GLRA 2LRNA 2VO4A 5B7CA 1SJIA 1DE1A 5ECPB 3A2WA 3IAS2 3EPTA 3TCOA 4EC0A 1XZOA 1ZCPA 3RHCA 2HZFA 5F0GA 3IOSA 1AIUA 5ECQB 4WF4A 4NV2A 2QGVA 4J56E 3GYKA 2MMOA 5C04A 4KB3A 3P90A 5C00A 5JWOB 2HZEB
chains in the Genus database with same CATH topology
3I6AA 2GT6A 3GNJA 3PR8A 1M9AA 3F6DA 2EFHA 1GSSA 3ZTLA 4N11A 4LA1A 4EO3A 3F0IA 4MDCA 4BA7A 3J7Yb 3P7XA 4JBBA 3MDKA 1O6JA 1E6BA 2VL2A 1OVNA 1SK1A 5CREA 4ZXGA 4OCEA 2JACA 2GTUA 1VF3A 2DIZA 4G01A 2CQ9A 2WRTA 3TKSE 2GQKA 3HA9A 1G7EA 3I9V2 2IWTA 2IMIA 1K0CA 3CYNA 4YKGA 1I9DA 5HQPA 5JWRB 4K8MA 3EINA 3I43A 3M1GA 2XHFA 4ISDA 4G19A 4MF6A 1QK8A 1EV4A 4WXTA 3U6VA 2X8CA 1IYIA 5CRGA 2LNSA 5J4VA 1VF1A 1QXHA 3IRAA 3HMJG 1PL1A 20GSA 1SENA 1ML6A 1TW9A 3FZ4A 3E0UA 3UEMA 1KTEA 5ENUA 4TRXA 3KH9A 4JU5A 4MF7A 1JLWA 4CHSA 2PUKC 4NV5A 2YOIA 4TXOA 1AQWA 17GSA 3TOTA 2H73A 3HDCA 1A2JA 1SL2B 5AISA 5HR3A 4OMVA 4AGSA 1WRYA 2K8VA 3E9JB 2REMA 1PN0A 3GH9A 1TI3A 5AIXA 3PH9A 2CVDA 1ZL9A 3GKKA 2H30A 2OE1A 1G7OA 1F6MC 5J41A 1GSDA 2FCHA 1XWBA 2CX3A 3GMFA 4D73B 4OFTA 2LRCA 3QMXA 1M99A 1ZGNA 1Z6NA 5KOWA 4POBA 3VWVA 2B7JA 6GSYA 1XW5A 4X43A 5DDLA 1BAYA 4PQ1A 1SKSB 2AB6A 1OAZA 2C4JA 3KMOA 4OFNA 2O89A 4V1Ap 3E3EA 2HRKB 6GSWA 2VLVA 2R4VA 2EIOA 5KN3A 1XW9A 2B5EA 1B9XC 1SYRA 4IN0A 4GF0A 4DVCA 2HLSA 3ZVJA 4Q5NA 3C73A 1V2AA 2E0QA 4LL1B 5GSTA 4ZB6A 4HDEA 1JZRA 3HZ8A 14GSA 2VD0A 3D21A 1PX7A 2H74A 1A24A 2GSSA 4PQHA 4BVXA 2G2QA 3EC3A 1MD4A 2V1MA 4TVEA 4ZB7A 3UVTA 3DXBA 1XXUA 2H66A 5IPGA 3VPTA 4ZL9A 1T4YA 1OKDA 2YWOA 3D0ZA 4V2NA 4G9HA 1YKCA 5BMUA 2JSZA 3G7JA 2PPTA 5ECHB 1EWXA 2HI7A 5ECKB 1BYEA 13GSA 2YZHA 4J2FA 5FT3A 2DJ1A 2VLUA 3ZL5A 1BF5A 1RW1A 1XIYA 2P31A 4L0WA 3ISOA 1YF0A 4GLTA 5FHIA 3N5OA 1G0TA 2YWMA 4L5LA 4F2IA 2JSYA 2WDUA 5DALB 1AQXA 2B6MA 4TXVA 1YEXA 3KH7A 3LQ7A 2GZZA 2ALBA 3TB2A 4PXOA 3DD3A 1MDJA 2IPAA 3TRQA 2NBSA 2IMFA 3OR5A 3UBLA 1JZDA 3LORA 3EE2A 2OT3A 3O3TA 5D73A 1O81A 2TRXA 1GSYA 3HZ4A 1GLPA 3IDVA 5FWGA 2A4HA 2LJKA 5IM9A 1AUCA 1FHEA 4E8HA 1R5PA 4RI6A 1NW2A 4NHWA 4BWSA 1AXDA 4K2DA 2N5FA 4MPFA 2L6DA 2D2ZA 4BVYB 2X99A 5A4WA 3F3QA 5J3RA 1V57A 4NAXA 4HJMA 3SWLA 2YJHA 2PVOC 4HS1A 1EGOA 2C8UA 2VCQA 4GQFA 1FOHA 1FOVA 2IFQB 3BOAA 1XVWA 3R2QA 2RUEA 4FYCA 2FNOA 2QA2A 4EE0A 2C0FA 4E68A 3PINA 4LLRA 1WPIA 1TRUA 4MZWA 3W8SA 3J7Yk 4Z2TA 2FGXA 4OWYA 2YWNA 5IOWA 1EV9A 3IA1A 4O7HA 4ZL7A 1TP9A 3FR3A 2ZUPA 1M2AA 4QMKA 3FHKA 3HCZA 4HQZA 1X5CA 5EPFA 4EL1A 1N2AA 1KBNA 4KE3A 4MMMA 1UN2A 2B5YA 4EDYA 3CMIA 3EWLA 1Z3EA 2VCTA 1F37A 4IP6A 1T8EB 4BL7A 5B8BA 1GSUA 3O76A 2CZ2A 4WEYA 1JFUA 1M7TA 1MDIA 3ME7A 4PTSA 4JZQA 4PQIA 2PVQA 2KOKA 5F05A 4MJCA 1JZOA 1SKRB 2H76A 2CT6A 2MBTA 3I69A 2QA1A 1GNEA 2OKAA 3EVIA 1X0RA 2F9SA 4NPBA 5CNWA 1U88A 2O7KA 3FY7A 3UMAA 1TXXA 5F07A 5DAKA 3L9UA 1TU8A 2H75A 2N5AA 4G0KA 2JZSA 1ZYQB 4XS4A 4XS1A 3HHVA 2HSNB 2CX4A 5B8AA 4TOPA 1EZKA 2FA4A 2O85A 1TRVA 2GVPA 3QDNA 2DKIA 5GSSA 1SKWB 1O85A 2MMZA 1R4WA 2I9HA 4ZL8A 5D9WA 3RAZA 2XC2A 1LBKA 1XBSA 4GCIA 3LWAA 4O32A 3IC4A 5IO2A 4Q5QA 4KCEA 5G1LA 2WJUA 3Q18A 3LJRA 4BWQA 4EKZA 1S3CA 3US3A 3LW9A 5ECNB 1SVLA 1N25A 4O92A 1ILOA 2AAWA 3A3TA 1PSQA 1O8WA 5HFIA 3GTUB 2F51A 1PKZA 3QOUA 1GUHA 4IJ3A 5A34A 2LEGA 1G6WA 4ECJA 3R3EA 4O5RA 3CSHA 2FY6A 1DE2A 3LYPA 1GRXA 4IHUA 1NM3A 3FR6A 2C3TA 1Q4JA 3TOUA 1PQNA 1PKWA 5HR1A 2HYXA 2ZNMA 5GAND 1Y1UA 2L6CA 4I5QA 1XPVA 3BD2A 5IO0A 2H8LA 5A5HA 4H86A 4Z2RA 3ERGA 2EFEA 2C0EA 3FZ5A 2LTKA 1YZXA 4GXZA 1U6TA 2X64A 1CQGA 2R0GA 1TK5B 2HRFA 1YJ6A 3IC8A 1TK0B 3CTFA 1PX6A 1EP8A 1URMA 5D9XA 2VUPA 3F63A 3IV4A 4ML1A 1OC8A 2XBQA 2KP2A 2CAQA 3EMPA 1A8LA 2GZYA 1MEKA 1HNBA 2FWEA 1XWCA 1HNAA 1U87A 1QQ2A 3M0FA 2P0GA 3QAWA 3DKSA 1XWGA 4I97A 3GH6A 4KA0A 1J08A 1K0OA 4IELA 5AN1A 2B3SA 3FK8A 4GSTA 1M2BA 2PERA 1K3YA 2WULA 10GSA 2N5BA 1MD3A 1TRWA 3GV1A 1B48A 1ZOFA 5EVOA 5IMFA 3TRXA 4V1Ag 4KSOA 4FYBA 4JR4A 3IR4A 3WYWA 3VI5A 5GAPD 5IMDA 1WOUA 2DJ3A 3CTGA 4RUVA 1FO5A 3HJPA 5AIVA 4TN8A 3VFIA 1ERWA 3L9VA 3ZRDA 5KN1A 2I1UA 4BPYA 5BRTA 2VL9A 3F4RA 3G9BA 2QC7A 2VOCA 2GSRA 5KEJA 3N9JA 4GTUA 4USSA 2A2PA 5HFGA 4XHMA 1X9MB 2YWIA 1FB6A 2WCIA 3KEBA 2IIYA 5DVBA 5JCUA 2GQMA 3M9KA 3BJ5A 1FAAA 3UARA 5H5RA 4PNGA 4DEJA 2LJAA 3LXTA 2GSQA 4TXOB 4K5SA 3EURA 4O5QA 5IMZA 3L9SA 3LGCA 3PPUA 3TJGA 1O7UA 2EC4A 4PURA 5ELAA 3GN3A 2MMNA 4DSRA 5KN2A 4XIHA 3NOFA 4A5PA 1TRSA 1PGTA 4OO5A 4KX4A 4X1UA 5J9BA 1GTAA 1PRXA 3WT1A 1Q98A 4O5UA 1PL2A 3KMNA 1M9BA 2B1KA 2VM2A 4I2UA 4IQAA 2H6ZA 3LG6A 1F3AA 1R5AA 2L4CA 4TW5A 3ZLPA 5D96A 3GL5A 3KXOA 2IMKA 2BMXA 3UAPA 1JZWA 4ECCA 2OE3A 3F9UA 2CV4A 1HNCA 4HUAA 3QR6A 1ERTA 3TKQA 3DEXA 11GSA 1Z5YE 1THOA 2OACA 1UVZA 4HZ4A 2PWJA 4TKYA 4MP4A 3FZ9A 2DJ0A 4ID0A 3EYTA 3FKFA 3GX0A 2WS2A 3GX8A 1K3OA 4KNDA 2RM5A 4TR1A 2IN3A 3ME8A 1OC3A 2E7PA 4I6XA 4ZBAA 1ACVA 3CRTA 1DUGA 2GQLA 3ERWA 4LL4B 2HFDA 2VCZA 4K9ZA 2VM1A 3AY8A 4JE1A 5J4YA 2YZUA 1XOAA 2LQOA 3RPNA 3H93A 4BVXB 2G0FA 1NHYA 4ICYA 3D6IA 6GSVA 1TOFA 1W89A 3RPPA 1AQVA 2C3QA 4ML6A 3IAM2 3Q19A 3GIXA 2PBJA 4HU7A 1T3BA 4MZCA 5BMUB 2QKEA 2C0GA 3ZREA 4QL7A 2VAFA 4V2LA 3DVWA 5DQYA 3VWWA 5ECOB 3ZFBA 1J0FA 3F3RA 2DIYA 4MABA 2C80A 1LU4A 2V6KA 2H1GA 2HSHA 5F8BA 1ON4A 4LMWA 1SD9A 2FWGA 2RUFA 4MJAA 1ZYPA 2CVBA 3MAKA 1OYJA 4NHZA 3H8QA 2X49A 1TU7A 2AUVA 1NSWA 4MZBA 4GDFA 1E2YA 4E8EA 2H1BA 4POMA 2C3NA 1ZYEA 1TXUA 2V32A 5CP1A 4ACSA 4G0IA 3FMWA 5JCGA 2A2SA 2KLXA 1Y6EA 1YVLA 5CAXA 3EU4A 3QFAC 4EXJA 1ERVA 2LQQA 4IJIA 5A1NA 1VF4A 2DLXA 4F03A 4K7IA 5H5SA 3FEUA 1F9MA 2PMTA 1AAZA 2AV4A 2OBKA 4EIQA 4AJ7A 5A1NB 4Q5RA 3IBHA 5A4UA 3TJKA 4HJ2A 1V58A 2LKUA 1GH2A 2PGTA 1V9WA 3EMXA 5IMCA 5J47A 3M3MA 4EVMA 4RQXA 1ZYNA 3GHAA 4G2EA 3GFKA 2GS3A 2R3XA 4FYUA 1SU9A 5ID2A 4RI7A 2LUSA 3HJMA 4AJ6A 3M8NA 2M80A 4FQUA 1BG5A 4AKGA 5E4WA 1ABAA 3K8NA 3TKPA 2GSTA 3ZIJA 3LSZA 4MNNA 2R0PA 1K0BA 4PUAA 1BQ7A 1VGLA 2GGTA 3P2AA 1QUWA 1K0MA 3ERFA 22GSA 3IE3A 1W4VA 1OC9A 3MWHA 4ILFA 2KHPA 1F3BA 2DMLA 1SD8A 2JZRA 4FIWA 3ZVJD 1HYUA 5CO3A 2UZ8A 3O6TA 5D9VA 4CW9A 5CRWA 4ZBBA 1THXA 1KEBA 2JL4A 4KGIA 3A2VA 5ELGA 1EGRA 5D93A 3SBCA 1YKAA 3KIJA 4Z2UA 3TU3B 1ZMAA 1XCCA 1OKTA 1T00A 3L0HA 4BL7B 3VLNA 2YNXA 2O87A 4N0ZA 1O73A 1OE7A 2YJ7A 4IGJA 2L5OA 4PX1A 3DRNA 5J9CA 2YN1A 2LS5A 3FRCA 1QMVA 3EU3A 2H72A 4MJEA 6GSSA 2RM6A 2NTOA 2VCVA 3TJJA 3HD5A 4QQ7A 4MCUA 2IMDA 4G0LA 3DMLA 5DAKB 4XTSA 3W8JA 5HR0A 1SJ6A 1T1VA 6GSUA 3CRUA 2L59A 5ABRA 2H6XA 2HSMA 4XS4B 2L5LA 4RQRA 2BJXA 4L5OA 3G7YA 1B8XA 2AHEA 2R6KA 2NVLA 2HRNA 5IPHA 2EFDA 1DBYA 5DJMA 3HYPA 1KNGA 1GSEA 3C71A 3A2XA 1AW9A 2VD1A 3CWGA 2HRAA 4PUFC 4GSNA 1A0FA 4N0VA 5IIZA 3IXRA 4P3YB 1M2DA 1U3AA 3F4TA 2FWHA 2QSIA 3A5WA 3H1NA 5DQSA 1TI1A 3VWUA 3Q74A 2H0HA 4FH8A 2L57A 5G31A 3TUEA 1YQ1A 4F82A 1YDKA 5A34B 3Q6OA 4KAEA 1BJXA 1YY7A 3H4KA 2LJRA 2B5XA 3QCPA 5COHA 5J5NA 1XFLA 2KUCA 2YANA 2K6VA 2K18A 4TR4A 3TKRA 5IOXA 3GKXA 4EUYA 2FWFA 4N30A 2GDRA 3LXZA 3MYDA 5A5HB 2H1LA 2R37A 2Z9SA 1C72A 3W6GA 2B7KA 5G30A 5J40A 4AKIA 3QAVA 2JU5A 2VLTA 2GZPA 1K0DA 1Z9HA 2H71A 2B1LA 3IHGA 5EL8A 4MF5A 4CDOA 5JCWA 2XPDA 4ECIA 4MH2A 3GRXA 2H19A 2TIRA 1MDKA 3APOA 4IKHA 2HZEA 2EFCA 5G5FA 3D4MA 3ZYWA 2P5RA 5HFKA 1SVMA 1A0RP 4TR3A 4YAPA 2RLIA 1T4ZA 1B4PA 1XWKA 3CBUA 5ECIB 1FG4A 3TKSC 1R7HA 3UIWA 2JADA 2VKZG 1A2MA 2ON7A 4CY6A 3APQA 1SL0B 2FA8A 1WP0A 4EF0A 2K8SA 3GKMA 3IHQA 2HNLA 2WZ9A 3ZMLA 2A4VA 1X9SB 2LRTA 5J4UA 1NHOA 2NPBA 4FO5A 1CQHA 4AKXB 4K7OA 3LFLA 4AKHA 3VPQA 5G2ZA 4F9ZA 18GSA 1VF2A 3BCKA 2H0GA 1G6YA 4IP1A 3C8EA 2A2RA 1X9WB 3WD6A 3C1RA 2YCDA 2OJLA 3MSZA 2JZTA 4ZIJA 2R0CA 4AI6A 2H0IA 5DJLA 3HXSA 3WGDA 3DGQA 5B6NA 1A23A 4AF2A 4OD7A 2DKHA 4WR4A 3WGEA 4HOJA 3FYGA 4MLYA 4WKWA 3ZITA 1GP1A 2YP6A 4HI7A 3MNGA 4G10A 5DCGA 3APSA 3GA4A 1X5DA 2I81A 3V1WA 3TRPA 3KM6A 3NZNA 2AYTA 2J23A 3IK9A 2F3MA 3NIVA 4GRFA 4K5RA 3G7IA 3GL3A 1TDIA 2H1DA 2OADA 5ECSA 9GSSA 1GSFA 4D73A 5ECRB 4YAVA 3KTBA 2C1YA 3PGTA 1BEDA 3MIXA 1A2LA 3UBKA 3DIEA 2O8VB 2EIRA 4NWYA 1Z7RA 2CAIA 3GKNA 4K2XA 4IS0A 5E59A 3IPZA 4IBPA 4ULXA 3JCML 3A5IA 4WETA 1TKDB 3D5JA 4L0UA 5LCZA 1UA5A 2V2GA 2HRKA 1RK4A 1GTIA 8GSSA 2MYGA 1XVQA 2FHEA 3CSIA 1QGVA 3ZFLA 4WF5A 4K7NA 3VWXA 4TR1B 1Y25A 4OCFA 3RDWA 2CVKA 5EY6A 4AJ8A 1MTCA 3TGZA 2OE0A 2CA8A 4KCAA 4POLA 1GLQA 2F8AA 3UJ1A 1T7PB 4DSSA 1SVOA 3VURA 5CYYA 3UL3A 2H1AA 2HE3A 1VRSD 4I8BA 3KP9A 1YEPA 3IK7A 3KGKA 1GTBA 2X4AA 3TJFA 4DSSB 4Z7XA 1R26A 3HKRA 3U5RE 3C1SA 2VL2C 3F8UA 3M9JA 3TJBA 3ZMKA 3HVSA 3L4NA 4YQUA 1LJRA 4X0XA 2DSAA 3HVXA 2XPEA 3WGXA 1JHBA 1GWCA 2MZCA 2PN8A 3WT2A 2CZ3A 1XOBA 4K1FA 4HZ2A 4YKFA 3QFBC 3GUSA 4KDYA 2IMEA 1K0NA 5ECLB 4KH7A 4ZBDA 3UOMA 19GSA 1GUKA 2E2MA 1EEJA 2BTOT 4YQVA 1GUMA 3FW2A 1I5GA 3ZIVA 2PU9C 5DALA 3DYRA 4TR0A 2M46A 1EOGA 4POKA 3S9FA 4V2MA 5CRDA 4L8EA 1EEMA 5F06A 2DMMA 3BCIA 1TK8B 4IVFA 5LD0A 3KP8A 4W66A 2FLSA 12GSA 4DSQA 1H4OA 1O8XA 3H79A 2UV8G 1PA3A 2YPMA 1XWAA 3QPMA 2GT5A 1Z6MA 6GSTA 3D22A 3ED3A 4MK3A 2E2GA 2C0DA 1WMJA 2R2JA 16GSA 2HT9A 4ZILA 5DBQA 4KDUA 1S3AA 1ERUA 3KCMA 4KF9A 1FB0A 4GSSA 4PGTA 5G1KA 2DBCA 4BVYA 1TTZA 1GNWA 2AJQB 4ZB8A 1F2EA 4YQMA 4XRDA 1U3IA 3HY2A 2VCWA 1SK0A 2I3YA 3VK9A 3GSSA 1PMTA 5IMVA 3CXGA 4KSMA 3RBTA 3LEFA 2KP1A 1RQMA 5D9TA 2VIMA 4J57E 4MH3A 2WB9A 1TJDA 2IFQA 5G5EA 1IYHA 1A8YA 5ID2B 3RHBA 3DWVA 2WFCA 3ZZXA 2VL3A 1FVJA 2H01A 3F6FA 3HVVA 2NDOA 5KN0A 4IQ1A 1WJKA 7GSSA 4EDZA 2R5GA 1OC9B 3P8WA 5IMAA 1WIKA 3L78A 1FVKA 4K0NA 3FR9A 2TRCP 1GL8A 3LYKA 3HJOA 4JR6A 2XBIA 2X8HA 5L71A 3C7MA 3QAGA 1V98A 2IL3A 1PN9A 1J9BA 3TKSA 4WR5A 4GQCA 3GURA 4OO4A 2I4AA 4XCSA 1WWJA 5A5KA 5AGYA 3QD9A 1H75A 2LSTA 5A4VA 4N10A 4K6XA 1SL1B 2DJ2A 2YV9A 3F4SA 1GULA 2OA7A 2X8GA 1K3LA 2O5VA 4KW6A 1USBA 4IW9A 2FUG2 4PNFA 4JRRA 2HSNA 4XS6A 3VI7A 1SJZA 2DC5A 4F0CA 1YF1A 1JLVA 3GSTA 5IQYA 1N8JA 5H5QA 2HSMB 6GSXA 4MA9A 1UC7A 5DCHA 1QFNA 4QL9A 3UVHA 2ZCTA 1ST9A 4WBJA 2IJYA 1XW6A 1EP7A 4CY8A 2H6YA 3KZQA 4JEDA 1SK2A 1BG1A 5D8IA 4X4JA 2MBSA 2MMAA 2OBIA 4XRAA 2HQTA 1PD21 5JWQB 1FW1A 4LMVA 4N3ZA 1BX9A 2P5QA 1HD2A 2L4QA 5B6MA 2EIQA 3DVXA 2LV3A 3TDGA 2YV7A 1B9YC 2HSYA 3GTUA 2V41A 4ECBA 2RIIA 4EIPA 3D4TA 1M0UA 3KJYA 5CRHA 4Q5FA 1HQOA 2J9HA 1EOHA 2WGRA 2DJJA 2DJKA 1X5EA 4GWRA 4KUNA 1GSQA 2F8FA 4HEA2 3FZAA 2ES7A 3BBYA 4F0BA 4HU9A 1AC1A 5KOXA 4MJBA 4NMUA 4ZB9A 1GTUA 2LNTA 4MPGA 4HQSA 5HR2A 2V6OA 1DSBA 4K0GA 1Z7PA 2FD3A 5LNKe 4WBRD 4YH2A 1S3DA 4NXIA 5ECMB 1WE0A 2HXKA 2K9FA 3CSJA 3KTLA 4KDXA 2H70A 1B4QA 2VCXA 1K0AA 1OE8A 1V40A 2ON5A 5GZZB 5INYA 4OFMA 1SYXA 4I2TA 3KD0A 2M72A 1ZZYA 2GLRA 2LRNA 2VO4A 5B7CA 1SJIA 1DE1A 5ECPB 3A2WA 3IAS2 3EPTA 3TCOA 4EC0A 1XZOA 1ZCPA 3RHCA 2HZFA 5F0GA 3IOSA 1AIUA 5ECQB 4WF4A 4NV2A 2QGVA 4J56E 3GYKA 2MMOA 5C04A 4KB3A 3P90A 5C00A 5JWOB 2HZEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6A A;  2GT6 A;  3GNJ A;  3PR8 A;  1M9A A;  3F6D A;  1GSS A;  3ZTL A;  4N11 A;  4LA1 A;  4EO3 A;  3F0I A;  4MDC A;  4BA7 A;  3J7Y b;  3P7X A;  4JBB A;  3MDK A;  1O6J A;  1E6B A;  2VL2 A;  1OVN A;  1SK1 A;  5CRE A;  4ZXG A;  4OCE A;  2JAC A;  2GTU A;  1VF3 A;  2DIZ A;  2CQ9 A;  2WRT A;  3TKS E;  2GQK A;  3HA9 A;  1G7E A;  3I9V 2;  2IWT A;  2IMI A;  1K0C A;  3CYN A;  1I9D A;  5HQP A;  5JWR B;  4K8M A;  3EIN A;  3I43 A;  3M1G A;  2XHF A;  4ISD A;  4G19 A;  4MF6 A;  1QK8 A;  1EV4 A;  4WXT A;  3U6V A;  2X8C A;  1IYI A;  5CRG A;  2LNS A;  1VF1 A;  1QXH A;  3IRA A;  1PL1 A;  20GS A;  1SEN A;  1ML6 A;  1TW9 A;  3FZ4 A;  3E0U A;  3UEM A;  1KTE A;  5ENU A;  4TRX A;  3KH9 A;  4JU5 A;  4MF7 A;  1JLW A;  4CHS A;  2PUK C;  4NV5 A;  2YOI A;  4TXO A;  1AQW A;  17GS A;  3TOT A;  2H73 A;  3HDC A;  1A2J A;  1SL2 B;  5AIS A;  5HR3 A;  4OMV A;  4AGS A;  1WRY A;  2K8V A;  3E9J B;  2REM A;  3GH9 A;  1TI3 A;  5AIX A;  3PH9 A;  2CVD A;  1ZL9 A;  3GKK A;  2H30 A;  2OE1 A;  1G7O A;  1F6M C;  5J41 A;  1GSD A;  2FCH A;  1XWB A;  2CX3 A;  3GMF A;  4D73 B;  4OFT A;  2LRC A;  3QMX A;  1M99 A;  1ZGN A;  1Z6N A;  4POB A;  3VWV A;  2B7J A;  6GSY A;  1XW5 A;  4X43 A;  5DDL A;  1BAY A;  4PQ1 A;  1SKS B;  2AB6 A;  1OAZ A;  2C4J A;  3KMO A;  4OFN A;  2O89 A;  4V1A p;  3E3E A;  2HRK B;  6GSW A;  2VLV A;  2R4V A;  2EIO A;  5KN3 A;  1XW9 A;  2B5E A;  1B9X C;  1SYR A;  4IN0 A;  4GF0 A;  4DVC A;  2HLS A;  3ZVJ A;  4Q5N A;  3C73 A;  1V2A A;  2E0Q A;  4LL1 B;  5GST A;  4ZB6 A;  4HDE A;  1JZR A;  3HZ8 A;  14GS A;  2VD0 A;  3D21 A;  1PX7 A;  2H74 A;  1A24 A;  2GSS A;  4PQH A;  4BVX A;  2G2Q A;  3EC3 A;  1MD4 A;  2V1M A;  4TVE A;  3UVT A;  3DXB A;  1XXU A;  2H66 A;  5IPG A;  3VPT A;  4ZL9 A;  1T4Y A;  1OKD A;  2YWO A;  3D0Z A;  4V2N A;  4G9H A;  1YKC A;  5BMU A;  2JSZ A;  3G7J A;  2PPT A;  5ECH B;  1EWX A;  2HI7 A;  5ECK B;  1BYE A;  13GS A;  2YZH A;  4J2F A;  5FT3 A;  2DJ1 A;  2VLU A;  3ZL5 A;  1RW1 A;  1XIY A;  2P31 A;  4L0W A;  3ISO A;  1YF0 A;  4GLT A;  5FHI A;  3N5O A;  1G0T A;  2YWM A;  4L5L A;  4F2I A;  2JSY A;  2WDU A;  5DAL B;  1AQX A;  2B6M A;  4TXV A;  1YEX A;  3KH7 A;  3LQ7 A;  2GZZ A;  2ALB A;  3TB2 A;  4PXO A;  3DD3 A;  1MDJ A;  2IPA A;  3TRQ A;  2NBS A;  2IMF A;  3OR5 A;  3UBL A;  1JZD A;  3LOR A;  3EE2 A;  3O3T A;  5D73 A;  1O81 A;  2TRX A;  1GSY A;  3HZ4 A;  1GLP A;  3IDV A;  5FWG A;  2LJK A;  5IM9 A;  1AUC A;  1FHE A;  4E8H A;  1R5P A;  4RI6 A;  1NW2 A;  4NHW A;  4BWS A;  1AXD A;  4K2D A;  2N5F A;  4MPF A;  2L6D A;  2D2Z A;  4BVY B;  2X99 A;  5A4W A;  3F3Q A;  5J3R A;  1V57 A;  4NAX A;  4HJM A;  3SWL A;  2YJH A;  2PVO C;  4HS1 A;  1EGO A;  2C8U A;  2VCQ A;  4GQF A;  1FOV A;  2IFQ B;  3BOA A;  1XVW A;  3R2Q A;  2RUE A;  4FYC A;  2FNO A;  2C0F A;  4EE0 A;  3PIN A;  4LLR A;  1WPI A;  1TRU A;  4MZW A;  3W8S A;  3J7Y k;  2FGX A;  4OWY A;  2YWN A;  5IOW A;  1EV9 A;  3IA1 A;  4O7H A;  4ZL7 A;  1TP9 A;  3FR3 A;  2ZUP A;  1M2A A;  3FHK A;  3HCZ A;  4HQZ A;  1X5C A;  5EPF A;  4EL1 A;  1N2A A;  1KBN A;  4KE3 A;  4MMM A;  1UN2 A;  2B5Y A;  4EDY A;  3CMI A;  3EWL A;  1Z3E A;  2VCT A;  1F37 A;  4IP6 A;  1T8E B;  4BL7 A;  5B8B A;  1GSU A;  3O76 A;  2CZ2 A;  4WEY A;  1JFU A;  1M7T A;  1MDI A;  3ME7 A;  4PTS A;  4JZQ A;  4PQI A;  2PVQ A;  2KOK A;  5F05 A;  4MJC A;  1JZO A;  1SKR B;  2H76 A;  2CT6 A;  2MBT A;  3I69 A;  1GNE A;  2OKA A;  3EVI A;  1X0R A;  2F9S A;  4NPB A;  5CNW A;  1U88 A;  2O7K A;  3FY7 A;  3UMA A;  1TXX A;  5F07 A;  5DAK A;  3L9U A;  1TU8 A;  2H75 A;  2N5A A;  4G0K A;  2JZS A;  1ZYQ B;  4XS4 A;  4XS1 A;  3HHV A;  2HSN B;  2CX4 A;  5B8A A;  4TOP A;  1EZK A;  2FA4 A;  2O85 A;  1TRV A;  2GVP A;  3QDN A;  5GSS A;  1SKW B;  1O85 A;  2MMZ A;  1R4W A;  2I9H A;  4ZL8 A;  5D9W A;  3RAZ A;  2XC2 A;  1LBK A;  1XBS A;  4GCI A;  3LWA A;  4O32 A;  3IC4 A;  5IO2 A;  4Q5Q A;  4KCE A;  5G1L A;  2WJU A;  3Q18 A;  3LJR A;  4BWQ A;  4EKZ A;  1S3C A;  3US3 A;  5ECN B;  4O92 A;  1ILO A;  2AAW A;  3A3T A;  1PSQ A;  1O8W A;  5HFI A;  3GTU B;  2F51 A;  1PKZ A;  3QOU A;  1GUH A;  4IJ3 A;  2LEG A;  1G6W A;  4ECJ A;  3R3E A;  4O5R A;  3CSH A;  2FY6 A;  1DE2 A;  3LYP A;  1GRX A;  4IHU A;  1NM3 A;  3FR6 A;  2C3T A;  1Q4J A;  3TOU A;  1PQN A;  1PKW A;  5HR1 A;  2HYX A;  2ZNM A;  5GAN D;  2L6C A;  4I5Q A;  1XPV A;  3BD2 A;  5IO0 A;  2H8L A;  4H86 A;  3ERG A;  2C0E A;  3FZ5 A;  2LTK A;  1YZX A;  4GXZ A;  1U6T A;  2X64 A;  1CQG A;  1TK5 B;  2HRF A;  1YJ6 A;  3IC8 A;  1TK0 B;  3CTF A;  1PX6 A;  1EP8 A;  1URM A;  5D9X A;  2VUP A;  3F63 A;  3IV4 A;  4ML1 A;  1OC8 A;  2XBQ A;  2KP2 A;  2CAQ A;  3EMP A;  1A8L A;  2GZY A;  1MEK A;  1HNB A;  2FWE A;  1XWC A;  1HNA A;  1U87 A;  1QQ2 A;  3M0F A;  2P0G A;  3QAW A;  3DKS A;  1XWG A;  4I97 A;  3GH6 A;  4KA0 A;  1J08 A;  1K0O A;  4IEL A;  5AN1 A;  2B3S A;  3FK8 A;  4GST A;  1M2B A;  2PER A;  1K3Y A;  2WUL A;  10GS A;  2N5B A;  1MD3 A;  1TRW A;  3GV1 A;  1B48 A;  1ZOF A;  5EVO A;  5IMF A;  3TRX A;  4V1A g;  4KSO A;  4FYB A;  4JR4 A;  3IR4 A;  3WYW A;  3VI5 A;  5GAP D;  5IMD A;  1WOU A;  2DJ3 A;  3CTG A;  4RUV A;  1FO5 A;  3HJP A;  5AIV A;  4TN8 A;  3VFI A;  1ERW A;  3L9V A;  3ZRD A;  5KN1 A;  2I1U A;  4BPY A;  2VL9 A;  3F4R A;  3G9B A;  2QC7 A;  2VOC A;  2GSR A;  5KEJ A;  3N9J A;  4GTU A;  4USS A;  5HFG A;  4XHM A;  1X9M B;  2YWI A;  1FB6 A;  2WCI A;  3KEB A;  2IIY A;  5DVB A;  5JCU A;  2GQM A;  3M9K A;  3BJ5 A;  1FAA A;  3UAR A;  5H5R A;  4PNG A;  4DEJ A;  2LJA A;  3LXT A;  2GSQ A;  4TXO B;  3EUR A;  5IMZ A;  3L9S A;  3LGC A;  3PPU A;  3TJG A;  1O7U A;  2EC4 A;  4PUR A;  5ELA A;  3GN3 A;  2MMN A;  4DSR A;  5KN2 A;  4XIH A;  3NOF A;  1TRS A;  1PGT A;  4OO5 A;  4KX4 A;  4X1U A;  5J9B A;  1GTA A;  1PRX A;  3WT1 A;  1Q98 A;  1PL2 A;  3KMN A;  1M9B A;  2B1K A;  2VM2 A;  4I2U A;  4IQA A;  2H6Z A;  3LG6 A;  1F3A A;  1R5A A;  2L4C A;  4TW5 A;  3ZLP A;  5D96 A;  3GL5 A;  3KXO A;  2IMK A;  2BMX A;  3UAP A;  1JZW A;  4ECC A;  2OE3 A;  3F9U A;  2CV4 A;  4HUA A;  1HNC A;  3QR6 A;  1ERT A;  3TKQ A;  3DEX A;  11GS A;  1Z5Y E;  1THO A;  2OAC A;  1UVZ A;  4HZ4 A;  2PWJ A;  4TKY A;  4MP4 A;  3FZ9 A;  2DJ0 A;  4ID0 A;  3EYT A;  3FKF A;  3GX0 A;  2WS2 A;  3GX8 A;  1K3O A;  4KND A;  2RM5 A;  4TR1 A;  2IN3 A;  3ME8 A;  1OC3 A;  2E7P A;  4I6X A;  4ZBA A;  1ACV A;  3CRT A;  1DUG A;  2GQL A;  3ERW A;  4LL4 B;  2HFD A;  2VCZ A;  4K9Z A;  2VM1 A;  3AY8 A;  4JE1 A;  2YZU A;  1XOA A;  2LQO A;  3RPN A;  3H93 A;  4BVX B;  2G0F A;  1NHY A;  3D6I A;  6GSV A;  1TOF A;  1W89 A;  3RPP A;  1AQV A;  2C3Q A;  4ML6 A;  3IAM 2;  3Q19 A;  3GIX A;  2PBJ A;  4HU7 A;  1T3B A;  4MZC A;  2QKE A;  2C0G A;  3ZRE A;  4QL7 A;  2VAF A;  4V2L A;  3DVW A;  5DQY A;  3VWW A;  5ECO B;  3ZFB A;  1J0F A;  3F3R A;  2DIY A;  4MAB A;  2C80 A;  1LU4 A;  2V6K A;  2H1G A;  2HSH A;  5F8B A;  1ON4 A;  4LMW A;  1SD9 A;  2FWG A;  2RUF A;  4MJA A;  2CVB A;  3MAK A;  1OYJ A;  4NHZ A;  3H8Q A;  1TU7 A;  2AUV A;  1NSW A;  4MZB A;  1E2Y A;  2H1B A;  4E8E A;  4POM A;  2C3N A;  1ZYE A;  2V32 A;  5CP1 A;  4ACS A;  4G0I A;  5JCG A;  2A2S A;  2KLX A;  1Y6E A;  5CAX A;  3EU4 A;  3QFA C;  4EXJ A;  1ERV A;  2LQQ A;  4IJI A;  1VF4 A;  2DLX A;  4F03 A;  4K7I A;  5H5S A;  3FEU A;  1F9M A;  2PMT A;  1AAZ A;  2AV4 A;  2OBK A;  4AJ7 A;  4Q5R A;  3IBH A;  5A4U A;  3TJK A;  4HJ2 A;  1V58 A;  2LKU A;  1GH2 A;  2PGT A;  1V9W A;  3EMX A;  5IMC A;  3M3M A;  4EVM A;  4RQX A;  3GHA A;  4G2E A;  3GFK A;  2GS3 A;  4FYU A;  2R3X A;  1SU9 A;  5ID2 A;  4RI7 A;  2LUS A;  3HJM A;  4AJ6 A;  3M8N A;  2M80 A;  4FQU A;  1BG5 A;  5E4W A;  1ABA A;  3K8N A;  3TKP A;  2GST A;  3ZIJ A;  3LSZ A;  1K0B A;  4PUA A;  1BQ7 A;  1VGL A;  2GGT A;  3P2A A;  1QUW A;  1K0M A;  3ERF A;  22GS A;  3IE3 A;  1W4V A;  1OC9 A;  3MWH A;  4ILF A;  2KHP A;  1F3B A;  2DML A;  1SD8 A;  2JZR A;  4FIW A;  3ZVJ D;  1HYU A;  5CO3 A;  3O6T A;  2UZ8 A;  5D9V A;  4CW9 A;  5CRW A;  4ZBB A;  1THX A;  1KEB A;  2JL4 A;  4KGI A;  3A2V A;  5ELG A;  1EGR A;  5D93 A;  3SBC A;  1YKA A;  3KIJ A;  1ZMA A;  1XCC A;  1OKT A;  1T00 A;  3L0H A;  4BL7 B;  3VLN A;  2YNX A;  2O87 A;  4N0Z A;  1O73 A;  1OE7 A;  2YJ7 A;  4IGJ A;  2L5O A;  4PX1 A;  3DRN A;  5J9C A;  2YN1 A;  2LS5 A;  3FRC A;  1QMV A;  3EU3 A;  2H72 A;  4MJE A;  6GSS A;  2RM6 A;  2NTO A;  2VCV A;  3TJJ A;  3HD5 A;  4QQ7 A;  4MCU A;  2IMD A;  4G0L A;  3DML A;  5DAK B;  4XTS A;  3W8J A;  5HR0 A;  1SJ6 A;  1T1V A;  6GSU A;  3CRU A;  2L59 A;  5ABR A;  2H6X A;  2HSM A;  4XS4 B;  2L5L A;  4RQR A;  2BJX A;  4L5O A;  3G7Y A;  1B8X A;  2AHE A;  2R6K A;  2NVL A;  2HRN A;  5IPH A;  1DBY A;  5DJM A;  3HYP A;  1KNG A;  1GSE A;  3C71 A;  3A2X A;  1AW9 A;  2VD1 A;  2HRA A;  4PUF C;  4GSN A;  1A0F A;  4N0V A;  5IIZ A;  3IXR A;  4P3Y B;  1M2D A;  1U3A A;  3F4T A;  2FWH A;  2QSI A;  3A5W A;  3H1N A;  5DQS A;  1TI1 A;  3VWU A;  3Q74 A;  2H0H A;  4FH8 A;  2L57 A;  5G31 A;  3TUE A;  1YQ1 A;  4F82 A;  1YDK A;  3Q6O A;  4KAE A;  1BJX A;  1YY7 A;  3H4K A;  2LJR A;  2B5X A;  3QCP A;  5COH A;  5J5N A;  1XFL A;  2KUC A;  2YAN A;  2K6V A;  2K18 A;  4TR4 A;  3TKR A;  5IOX A;  3GKX A;  4EUY A;  2FWF A;  4N30 A;  2GDR A;  3LXZ A;  2R37 A;  2Z9S A;  1C72 A;  3W6G A;  2B7K A;  5G30 A;  2JU5 A;  3QAV A;  2VLT A;  2GZP A;  1K0D A;  1Z9H A;  2H71 A;  2B1L A;  5EL8 A;  4MF5 A;  4CDO A;  5JCW A;  2XPD A;  4ECI A;  4MH2 A;  3GRX A;  2H19 A;  2TIR A;  1MDK A;  3APO A;  4IKH A;  2HZE A;  5G5F A;  3D4M A;  3ZYW A;  2P5R A;  5HFK A;  1A0R P;  4TR3 A;  4YAP A;  2RLI A;  1T4Z A;  1B4P A;  1XWK A;  3CBU A;  5ECI B;  1FG4 A;  3TKS C;  1R7H A;  3UIW A;  2JAD A;  1A2M A;  2ON7 A;  3APQ A;  1SL0 B;  2FA8 A;  1WP0 A;  4EF0 A;  2K8S A;  3GKM A;  3IHQ A;  2HNL A;  2WZ9 A;  3ZML A;  2A4V A;  1X9S B;  2LRT A;  5J4U A;  1NHO A;  2NPB A;  4FO5 A;  1CQH A;  4K7O A;  3LFL A;  3VPQ A;  5G2Z A;  4F9Z A;  18GS A;  1VF2 A;  3BCK A;  2H0G A;  1G6Y A;  4IP1 A;  3C8E A;  2A2R A;  1X9W B;  3WD6 A;  3C1R A;  2YCD A;  2OJL A;  3MSZ A;  2JZT A;  4ZIJ A;  2H0I A;  5DJL A;  3HXS A;  3WGD A;  3DGQ A;  5B6N A;  1A23 A;  4AF2 A;  4OD7 A;  4WR4 A;  3WGE A;  4HOJ A;  3FYG A;  4MLY A;  4WKW A;  3ZIT A;  1GP1 A;  2YP6 A;  4HI7 A;  3MNG A;  4G10 A;  5DCG A;  3APS A;  3GA4 A;  1X5D A;  2I81 A;  3V1W A;  3TRP A;  3KM6 A;  3NZN A;  2AYT A;  2J23 A;  3IK9 A;  2F3M A;  4GRF A;  3NIV A;  3G7I A;  3GL3 A;  1TDI A;  2H1D A;  2OAD A;  5ECS A;  9GSS A;  1GSF A;  4D73 A;  5ECR B;  4YAV A;  3KTB A;  2C1Y A;  3PGT A;  1BED A;  1A2L A;  3UBK A;  3DIE A;  2O8V B;  2EIR A;  4NWY A;  1Z7R A;  2CAI A;  3GKN A;  4IS0 A;  5E59 A;  3IPZ A;  4IBP A;  4ULX A;  3JCM L;  4WET A;  1TKD B;  3D5J A;  4L0U A;  5LCZ A;  1UA5 A;  2V2G A;  2HRK A;  1RK4 A;  1GTI A;  8GSS A;  2MYG A;  1XVQ A;  2FHE A;  3CSI A;  1QGV A;  3ZFL A;  4WF5 A;  4K7N A;  3VWX A;  4TR1 B;  1Y25 A;  4OCF A;  3RDW A;  2CVK A;  5EY6 A;  4AJ8 A;  1MTC A;  3TGZ A;  2OE0 A;  2CA8 A;  4KCA A;  4POL A;  1GLQ A;  2F8A A;  3UJ1 A;  1T7P B;  4DSS A;  3VUR A;  5CYY A;  3UL3 A;  2H1A A;  2HE3 A;  1VRS D;  4I8B A;  3KP9 A;  1YEP A;  3IK7 A;  3KGK A;  1GTB A;  3TJF A;  4DSS B;  4Z7X A;  1R26 A;  3HKR A;  3U5R E;  3C1S A;  2VL2 C;  3F8U A;  3M9J A;  3TJB A;  3ZMK A;  3HVS A;  3L4N A;  4YQU A;  1LJR A;  4X0X A;  2DSA A;  3HVX A;  2XPE A;  3WGX A;  1JHB A;  1GWC A;  2MZC A;  2PN8 A;  3WT2 A;  2CZ3 A;  1XOB A;  4K1F A;  4HZ2 A;  3QFB C;  3GUS A;  4KDY A;  2IME A;  1K0N A;  5ECL B;  4KH7 A;  4ZBD A;  3UOM A;  19GS A;  1GUK A;  2E2M A;  1EEJ A;  2BTO T;  4YQV A;  1GUM A;  3FW2 A;  1I5G A;  3ZIV A;  2PU9 C;  5DAL A;  3DYR A;  4TR0 A;  2M46 A;  1EOG A;  4POK A;  3S9F A;  4V2M A;  5CRD A;  4L8E A;  1EEM A;  5F06 A;  2DMM A;  3BCI A;  1TK8 B;  4IVF A;  5LD0 A;  3KP8 A;  2FLS A;  12GS A;  4DSQ A;  1H4O A;  1O8X A;  3H79 A;  1PA3 A;  2YPM A;  1XWA A;  3QPM A;  2GT5 A;  1Z6M A;  6GST A;  3D22 A;  3ED3 A;  4MK3 A;  2E2G A;  2C0D A;  1WMJ A;  2R2J A;  16GS A;  2HT9 A;  4ZIL A;  5DBQ A;  4KDU A;  1S3A A;  1ERU A;  3KCM A;  4KF9 A;  1FB0 A;  4GSS A;  4PGT A;  5G1K A;  2DBC A;  4BVY A;  1TTZ A;  1GNW A;  2AJQ B;  4ZB8 A;  1F2E A;  4YQM A;  4XRD A;  1U3I A;  3HY2 A;  2VCW A;  1SK0 A;  2I3Y A;  3VK9 A;  3GSS A;  1PMT A;  5IMV A;  3CXG A;  4KSM A;  3RBT A;  3LEF A;  2KP1 A;  1RQM A;  5D9T A;  2VIM A;  4J57 E;  4MH3 A;  2WB9 A;  1TJD A;  2IFQ A;  5G5E A;  1IYH A;  1A8Y A;  5ID2 B;  3RHB A;  3DWV A;  2WFC A;  3ZZX A;  2VL3 A;  1FVJ A;  2H01 A;  3F6F A;  3HVV A;  2NDO A;  5KN0 A;  4IQ1 A;  1WJK A;  7GSS A;  4EDZ A;  2R5G A;  1OC9 B;  3P8W A;  5IMA A;  1WIK A;  3L78 A;  1FVK A;  4K0N A;  3FR9 A;  2TRC P;  1GL8 A;  3LYK A;  3HJO A;  4JR6 A;  2XBI A;  2X8H A;  5L71 A;  3C7M A;  3QAG A;  1V98 A;  2IL3 A;  1PN9 A;  1J9B A;  3TKS A;  4WR5 A;  4GQC A;  3GUR A;  4OO4 A;  2I4A A;  4XCS A;  1WWJ A;  5A5K A;  5AGY A;  3QD9 A;  1H75 A;  2LST A;  5A4V A;  4N10 A;  4K6X A;  1SL1 B;  2DJ2 A;  2YV9 A;  3F4S A;  1GUL A;  2OA7 A;  2X8G A;  1K3L A;  4KW6 A;  1USB A;  4IW9 A;  2FUG 2;  4PNF A;  4JRR A;  4XS6 A;  3VI7 A;  1SJZ A;  2DC5 A;  4F0C A;  1YF1 A;  1JLV A;  3GST A;  5IQY A;  1N8J A;  5H5Q A;  2HSM B;  6GSX A;  4MA9 A;  1UC7 A;  5DCH A;  1QFN A;  4QL9 A;  3UVH A;  2ZCT A;  1ST9 A;  4WBJ A;  2IJY A;  1XW6 A;  1EP7 A;  2H6Y A;  3KZQ A;  4JED A;  1SK2 A;  5D8I A;  2MBS A;  2MMA A;  2OBI A;  4XRA A;  2HQT A;  1PD2 1;  5JWQ B;  1FW1 A;  4LMV A;  1BX9 A;  2P5Q A;  1HD2 A;  2L4Q A;  5B6M A;  2EIQ A;  3DVX A;  2LV3 A;  3TDG A;  2YV7 A;  1B9Y C;  2HSY A;  3GTU A;  2V41 A;  4ECB A;  2RII A;  3D4T A;  1M0U A;  3KJY A;  5CRH A;  4Q5F A;  1HQO A;  2J9H A;  1EOH A;  2WGR A;  2DJJ A;  2DJK A;  1X5E A;  4GWR A;  4KUN A;  1GSQ A;  2F8F A;  4HEA 2;  3FZA A;  2ES7 A;  3BBY A;  4F0B A;  4HU9 A;  1AC1 A;  4MJB A;  4NMU A;  4ZB9 A;  1GTU A;  2LNT A;  4MPG A;  4HQS A;  5HR2 A;  2V6O A;  1DSB A;  4K0G A;  1Z7P A;  2FD3 A;  5LNK e;  4WBR D;  4YH2 A;  1S3D A;  4NXI A;  5ECM B;  1WE0 A;  2HXK A;  2K9F A;  3CSJ A;  3KTL A;  4KDX A;  2H70 A;  1B4Q A;  2VCX A;  1K0A A;  1OE8 A;  1V40 A;  2ON5 A;  5GZZ B;  5INY A;  4OFM A;  1SYX A;  4I2T A;  3KD0 A;  2M72 A;  1ZZY A;  2GLR A;  2LRN A;  2VO4 A;  5B7C A;  1SJI A;  1DE1 A;  5ECP B;  3A2W A;  3IAS 2;  3TCO A;  4EC0 A;  1XZO A;  1ZCP A;  3RHC A;  2HZF A;  5F0G A;  3IOS A;  1AIU A;  5ECQ B;  4WF4 A;  4NV2 A;  2QGV A;  4J56 E;  3GYK A;  2MMO A;  5C04 A;  4KB3 A;  3P90 A;  5C00 A;  5JWO B;  2HZE B; 
#chains in the Genus database with same CATH topology
 3I6A A;  2GT6 A;  3GNJ A;  3PR8 A;  1M9A A;  3F6D A;  2EFH A;  1GSS A;  3ZTL A;  4N11 A;  4LA1 A;  4EO3 A;  3F0I A;  4MDC A;  4BA7 A;  3J7Y b;  3P7X A;  4JBB A;  3MDK A;  1O6J A;  1E6B A;  2VL2 A;  1OVN A;  1SK1 A;  5CRE A;  4ZXG A;  4OCE A;  2JAC A;  2GTU A;  1VF3 A;  2DIZ A;  3RGB C;  4G01 A;  2CQ9 A;  2WRT A;  3TKS E;  2GQK A;  3HA9 A;  1G7E A;  3I9V 2;  2IWT A;  2IMI A;  1K0C A;  3CYN A;  4YKG A;  1I9D A;  5HQP A;  5JWR B;  4K8M A;  3EIN A;  3I43 A;  3M1G A;  2XHF A;  4ISD A;  4G19 A;  4MF6 A;  1QK8 A;  1EV4 A;  4WXT A;  3U6V A;  2X8C A;  1IYI A;  5CRG A;  2LNS A;  5J4V A;  1VF1 A;  1QXH A;  3IRA A;  3HMJ G;  1PL1 A;  20GS A;  1SEN A;  1ML6 A;  1TW9 A;  2O36 A;  3FZ4 A;  3E0U A;  3UEM A;  1KTE A;  5ENU A;  4TRX A;  3KH9 A;  4JU5 A;  4MF7 A;  1JLW A;  4CHS A;  2PUK C;  4NV5 A;  2YOI A;  4TXO A;  1AQW A;  17GS A;  3TOT A;  2H73 A;  3HDC A;  1A2J A;  1SL2 B;  5AIS A;  5HR3 A;  4OMV A;  4AGS A;  1WRY A;  2K8V A;  3E9J B;  2REM A;  1PN0 A;  3GH9 A;  1TI3 A;  5AIX A;  3PH9 A;  2CVD A;  1ZL9 A;  1YEW C;  3GKK A;  2H30 A;  2OE1 A;  1G7O A;  1F6M C;  5J41 A;  1GSD A;  2FCH A;  1XWB A;  2CX3 A;  3GMF A;  4D73 B;  4OFT A;  2LRC A;  3QMX A;  1M99 A;  1ZGN A;  1Z6N A;  5KOW A;  4BIK A;  4POB A;  3VWV A;  2B7J A;  6GSY A;  1XW5 A;  4X43 A;  5DDL A;  1BAY A;  4PQ1 A;  1SKS B;  2AB6 A;  1OAZ A;  2C4J A;  3KMO A;  4OFN A;  2O89 A;  4V1A p;  3E3E A;  2HRK B;  6GSW A;  2VLV A;  2R4V A;  2EIO A;  5KN3 A;  1XW9 A;  2B5E A;  1B9X C;  1SYR A;  4IN0 A;  4GF0 A;  4DVC A;  2HLS A;  3ZVJ A;  4Q5N A;  3C73 A;  1V2A A;  2E0Q A;  4LL1 B;  5GST A;  4ZB6 A;  4HDE A;  1JZR A;  3HZ8 A;  14GS A;  2VD0 A;  3D21 A;  1PX7 A;  2H74 A;  1A24 A;  2GSS A;  4PQH A;  4BVX A;  2G2Q A;  3EC3 A;  1MD4 A;  2V1M A;  4TVE A;  4ZB7 A;  3UVT A;  3DXB A;  1XXU A;  2H66 A;  5IPG A;  3VPT A;  4ZL9 A;  1T4Y A;  1OKD A;  2YWO A;  3D0Z A;  4V2N A;  4G9H A;  1YKC A;  5BMU A;  2JSZ A;  3G7J A;  2PPT A;  5ECH B;  1EWX A;  2HI7 A;  5ECK B;  1BYE A;  13GS A;  2YZH A;  4J2F A;  5FT3 A;  2DJ1 A;  2VLU A;  3ZL5 A;  1BF5 A;  1RW1 A;  1XIY A;  2P31 A;  4L0W A;  3ISO A;  1YF0 A;  4GLT A;  5FHI A;  3N5O A;  1G0T A;  2YWM A;  4L5L A;  4F2I A;  2JSY A;  2WDU A;  5DAL B;  4HSC X;  1AQX A;  2WW3 A;  2B6M A;  4TXV A;  1YEX A;  3KH7 A;  3HVN A;  3LQ7 A;  2GZZ A;  2ALB A;  3TB2 A;  4PXO A;  3DD3 A;  1MDJ A;  2IPA A;  3TRQ A;  2NBS A;  2IMF A;  3OR5 A;  3UBL A;  1JZD A;  3LOR A;  3EE2 A;  2OT3 A;  3O3T A;  5D73 A;  1O81 A;  2TRX A;  1GSY A;  3HZ4 A;  1GLP A;  3IDV A;  5FWG A;  2A4H A;  2LJK A;  5IM9 A;  1AUC A;  1FHE A;  4E8H A;  1R5P A;  4RI6 A;  1NW2 A;  4NHW A;  4BWS A;  1AXD A;  4K2D A;  2N5F A;  4MPF A;  2L6D A;  2D2Z A;  4BVY B;  2X99 A;  5A4W A;  3F3Q A;  5J3R A;  1V57 A;  4NAX A;  4HJM A;  3SWL A;  2YJH A;  2PVO C;  4HS1 A;  1EGO A;  2C8U A;  2VCQ A;  4GQF A;  1FOH A;  1FOV A;  2IFQ B;  3BOA A;  1XVW A;  3R2Q A;  2RUE A;  4FYC A;  2FNO A;  2QA2 A;  4EE0 A;  2C0F A;  4E68 A;  3PIN A;  4LLR A;  1WPI A;  1TRU A;  4MZW A;  3W8S A;  3J7Y k;  4Z2T A;  2FGX A;  4OWY A;  2YWN A;  5IOW A;  1EV9 A;  3IA1 A;  4O7H A;  4ZL7 A;  1TP9 A;  3FR3 A;  2ZUP A;  1M2A A;  4QMK A;  3FHK A;  3HCZ A;  4HQZ A;  1X5C A;  5EPF A;  4EL1 A;  1N2A A;  1KBN A;  4KE3 A;  4MMM A;  1UN2 A;  2B5Y A;  4EDY A;  1M3I A;  3CMI A;  3EWL A;  1Z3E A;  2VCT A;  2WVY A;  1F37 A;  4IP6 A;  1T8E B;  4BL7 A;  5B8B A;  1GSU A;  3O76 A;  2CZ2 A;  4WEY A;  1JFU A;  1M7T A;  1MDI A;  3ME7 A;  4PTS A;  4JZQ A;  4PQI A;  2PVQ A;  2KOK A;  5F05 A;  4MJC A;  1JZO A;  1SKR B;  2H76 A;  2CT6 A;  2MBT A;  3I69 A;  2QA1 A;  1GNE A;  2OKA A;  3EVI A;  1X0R A;  2F9S A;  4NPB A;  5CNW A;  1U88 A;  2O7K A;  3FY7 A;  3UMA A;  1TXX A;  5F07 A;  5DAK A;  3L9U A;  1TU8 A;  3CQF A;  2H75 A;  2N5A A;  4G0K A;  2JZS A;  1ZYQ B;  4XS4 A;  4XS1 A;  3HHV A;  2HSN B;  2CX4 A;  5B8A A;  4TOP A;  1EZK A;  2FA4 A;  2O85 A;  1TRV A;  2WW1 A;  2GVP A;  3QDN A;  2DKI A;  5GSS A;  1SKW B;  1O85 A;  2MMZ A;  1R4W A;  2I9H A;  4ZL8 A;  5D9W A;  3RAZ A;  2XC2 A;  1LBK A;  1XBS A;  4GCI A;  3LWA A;  4O32 A;  3IC4 A;  5IO2 A;  4Q5Q A;  4KCE A;  5G1L A;  2WJU A;  3Q18 A;  3LJR A;  4BWQ A;  4EKZ A;  4PHZ C;  1S3C A;  3US3 A;  3LW9 A;  5ECN B;  1SVL A;  1N25 A;  4O92 A;  1ILO A;  2AAW A;  3A3T A;  1PSQ A;  1O8W A;  5HFI A;  3GTU B;  2F51 A;  1PKZ A;  3QOU A;  1GUH A;  4IJ3 A;  5A34 A;  2LEG A;  1G6W A;  1I1I P;  4ECJ A;  3R3E A;  4O5R A;  3CSH A;  2FY6 A;  1DE2 A;  3LYP A;  1GRX A;  4IHU A;  1NM3 A;  3FR6 A;  2C3T A;  2WVX B;  1Q4J A;  3TOU A;  1PQN A;  1PKW A;  5HR1 A;  2HYX A;  2ZNM A;  5GAN D;  1Y1U A;  2L6C A;  4I5Q A;  1XPV A;  3BD2 A;  5IO0 A;  2H8L A;  5A5H A;  4H86 A;  4Z2R A;  3ERG A;  2EFE A;  2C0E A;  3FZ5 A;  2LTK A;  1YZX A;  4GXZ A;  1U6T A;  2X64 A;  1CQG A;  2R0G A;  1TK5 B;  2HRF A;  1YJ6 A;  3IC8 A;  1TK0 B;  3CTF A;  1PX6 A;  1PFO A;  1EP8 A;  1URM A;  5D9X A;  2VUP A;  3F63 A;  3IV4 A;  4ML1 A;  1OC8 A;  2XBQ A;  2KP2 A;  2CAQ A;  3EMP A;  1A8L A;  2GZY A;  1MEK A;  1HNB A;  2FWE A;  1XWC A;  1HNA A;  1U87 A;  1QQ2 A;  3M0F A;  2P0G A;  3QAW A;  3DKS A;  1XWG A;  4I97 A;  3GH6 A;  4KA0 A;  1J08 A;  1K0O A;  4IEL A;  5AN1 A;  2B3S A;  3FK8 A;  4GST A;  1M2B A;  2PER A;  1K3Y A;  2WUL A;  10GS A;  2N5B A;  1MD3 A;  1TRW A;  3GV1 A;  1B48 A;  1ZOF A;  5EVO A;  5IMF A;  3TRX A;  4V1A g;  4KSO A;  4FYB A;  4JR4 A;  3IR4 A;  3WYW A;  3VI5 A;  5GAP D;  5IMD A;  1WOU A;  2DJ3 A;  3CTG A;  4RUV A;  1FO5 A;  3HJP A;  5AIV A;  4TN8 A;  3VFI A;  1ERW A;  3L9V A;  3ZRD A;  5KN1 A;  2I1U A;  4BPY A;  4PI2 C;  5BRT A;  2VL9 A;  3F4R A;  3G9B A;  2QC7 A;  2VOC A;  2GSR A;  5KEJ A;  3N9J A;  4GTU A;  4USS A;  2A2P A;  5HFG A;  4XHM A;  1X9M B;  2YWI A;  1FB6 A;  2WCI A;  3KEB A;  2IIY A;  5DVB A;  5JCU A;  2GQM A;  3M9K A;  3BJ5 A;  1FAA A;  3UAR A;  5H5R A;  4PNG A;  4DEJ A;  2LJA A;  3LXT A;  2GSQ A;  4TXO B;  4K5S A;  3EUR A;  4O5Q A;  5IMZ A;  3L9S A;  3LGC A;  3PPU A;  3TJG A;  1O7U A;  2EC4 A;  4PUR A;  5ELA A;  3GN3 A;  2MMN A;  4DSR A;  5KN2 A;  4XIH A;  3NOF A;  4A5P A;  1TRS A;  1PGT A;  4OO5 A;  4KX4 A;  4X1U A;  5J9B A;  1GTA A;  1PRX A;  3WT1 A;  1Q98 A;  4O5U A;  1PL2 A;  3KMN A;  1M9B A;  2B1K A;  2VM2 A;  4I2U A;  4IQA A;  2H6Z A;  3LG6 A;  1F3A A;  1R5A A;  2L4C A;  4TW5 A;  3ZLP A;  5D96 A;  3GL5 A;  2WVZ A;  3KXO A;  2IMK A;  2BMX A;  3UAP A;  1JZW A;  4ECC A;  2OE3 A;  3F9U A;  2CV4 A;  1HNC A;  4HUA A;  3QR6 A;  1ERT A;  3TKQ A;  3DEX A;  11GS A;  1Z5Y E;  1THO A;  2OAC A;  1UVZ A;  4HZ4 A;  2PWJ A;  4TKY A;  4MP4 A;  3FZ9 A;  2DJ0 A;  4ID0 A;  3EYT A;  3FKF A;  3GX0 A;  2WS2 A;  3GX8 A;  1K3O A;  4KND A;  2RM5 A;  4TR1 A;  2IN3 A;  3ME8 A;  1OC3 A;  2E7P A;  4I6X A;  4ZBA A;  1ACV A;  3CRT A;  1DUG A;  2GQL A;  3ERW A;  4LL4 B;  2HFD A;  2VCZ A;  4K9Z A;  2VM1 A;  3AY8 A;  4JE1 A;  5J4Y A;  2YZU A;  1XOA A;  2LQO A;  3RPN A;  3H93 A;  4BVX B;  2G0F A;  1NHY A;  4ICY A;  3D6I A;  6GSV A;  1TOF A;  1W89 A;  3RPP A;  4PI0 C;  1AQV A;  2C3Q A;  4ML6 A;  3IAM 2;  3Q19 A;  3GIX A;  2PBJ A;  4HU7 A;  1T3B A;  4MZC A;  5BMU B;  2QKE A;  2C0G A;  3ZRE A;  4QL7 A;  2VAF A;  4V2L A;  3DVW A;  5DQY A;  3VWW A;  5ECO B;  3ZFB A;  1J0F A;  3F3R A;  2DIY A;  4MAB A;  2C80 A;  1LU4 A;  2V6K A;  2H1G A;  1S3R A;  2O3E A;  2HSH A;  5F8B A;  1ON4 A;  4LMW A;  1SD9 A;  2FWG A;  2RUF A;  4MJA A;  1ZYP A;  2CVB A;  3MAK A;  1OYJ A;  4NHZ A;  3H8Q A;  2X49 A;  1TU7 A;  2AUV A;  1NSW A;  4MZB A;  4GDF A;  1E2Y A;  4E8E A;  2H1B A;  4POM A;  2C3N A;  1ZYE A;  1TXU A;  2V32 A;  5CP1 A;  4ACS A;  4G0I A;  3FMW A;  5JCG A;  2A2S A;  2KLX A;  1Y6E A;  1YVL A;  5CAX A;  3EU4 A;  3QFA C;  4EXJ A;  1ERV A;  2LQQ A;  4IJI A;  5A1N A;  1VF4 A;  2DLX A;  4F03 A;  4K7I A;  5H5S A;  3FEU A;  1F9M A;  2PMT A;  1AAZ A;  2AV4 A;  2OBK A;  4EIQ A;  2WW2 A;  4AJ7 A;  5A1N B;  4Q5R A;  3IBH A;  5A4U A;  3TJK A;  4HJ2 A;  1V58 A;  2LKU A;  1GH2 A;  2PGT A;  1V9W A;  3EMX A;  5IMC A;  5J47 A;  3M3M A;  4EVM A;  4RQX A;  1ZYN A;  3GHA A;  4G2E A;  3GFK A;  2GS3 A;  2R3X A;  4FYU A;  1SU9 A;  5ID2 A;  4RI7 A;  2LUS A;  3HJM A;  4AJ6 A;  3M8N A;  2M80 A;  4FQU A;  1BG5 A;  4AKG A;  5E4W A;  1ABA A;  3K8N A;  3TKP A;  2GST A;  3ZIJ A;  3LSZ A;  4MNN A;  2R0P A;  1K0B A;  4PUA A;  1BQ7 A;  1VGL A;  2GGT A;  3P2A A;  1QUW A;  1K0M A;  3ERF A;  22GS A;  3IE3 A;  1W4V A;  1OC9 A;  3MWH A;  4ILF A;  2KHP A;  1F3B A;  2DML A;  1SD8 A;  2JZR A;  4FIW A;  3ZVJ D;  1HYU A;  5CO3 A;  2UZ8 A;  3O6T A;  5D9V A;  4CW9 A;  5CRW A;  4ZBB A;  1THX A;  1KEB A;  2JL4 A;  4KGI A;  3A2V A;  5ELG A;  1EGR A;  5D93 A;  3SBC A;  1YKA A;  3KIJ A;  4Z2U A;  3TU3 B;  1ZMA A;  1XCC A;  1OKT A;  1T00 A;  3L0H A;  4BL7 B;  3VLN A;  1M3J A;  2YNX A;  2O87 A;  2WW0 A;  4N0Z A;  1O73 A;  1OE7 A;  2YJ7 A;  4IGJ A;  2L5O A;  4PX1 A;  3DRN A;  5J9C A;  2YN1 A;  2LS5 A;  3FRC A;  1QMV A;  3EU3 A;  2H72 A;  4MJE A;  6GSS A;  2RM6 A;  2NTO A;  2VCV A;  3TJJ A;  3HD5 A;  4QQ7 A;  4MCU A;  2IMD A;  4G0L A;  3DML A;  5DAK B;  4XTS A;  3W8J A;  5HR0 A;  1SJ6 A;  1T1V A;  6GSU A;  3CRU A;  2L59 A;  5ABR A;  2H6X A;  2HSM A;  4XS4 B;  2L5L A;  4RQR A;  2BJX A;  4L5O A;  3G7Y A;  1B8X A;  2AHE A;  2R6K A;  2NVL A;  2HRN A;  5IPH A;  2EFD A;  1DBY A;  5DJM A;  3HYP A;  1KNG A;  1GSE A;  3C71 A;  3A2X A;  1AW9 A;  2VD1 A;  3CWG A;  2HRA A;  4PUF C;  4GSN A;  1A0F A;  4N0V A;  5IIZ A;  3IXR A;  4P3Y B;  1M2D A;  1U3A A;  3F4T A;  2FWH A;  2QSI A;  3A5W A;  3H1N A;  5DQS A;  1TI1 A;  3VWU A;  3Q74 A;  2H0H A;  4FH8 A;  4FXY P;  2L57 A;  5G31 A;  3TUE A;  1YQ1 A;  4F82 A;  1YDK A;  5A34 B;  3Q6O A;  4KAE A;  1BJX A;  1YY7 A;  3H4K A;  2LJR A;  2B5X A;  3QCP A;  5COH A;  5J5N A;  1XFL A;  2KUC A;  2YAN A;  2K6V A;  2K18 A;  4TR4 A;  3TKR A;  5IOX A;  3GKX A;  4EUY A;  2FWF A;  4N30 A;  2GDR A;  3LXZ A;  3MYD A;  5A5H B;  2H1L A;  2R37 A;  2Z9S A;  1C72 A;  3W6G A;  2B7K A;  5G30 A;  5J40 A;  4AKI A;  3QAV A;  2JU5 A;  2VLT A;  2GZP A;  1K0D A;  1Z9H A;  2H71 A;  2B1L A;  3IHG A;  5EL8 A;  4MF5 A;  4CDO A;  5JCW A;  2XPD A;  4ECI A;  4MH2 A;  3GRX A;  2H19 A;  2TIR A;  1MDK A;  3APO A;  4IKH A;  2HZE A;  2EFC A;  5G5F A;  3D4M A;  3ZYW A;  2P5R A;  5HFK A;  1SVM A;  1A0R P;  4TR3 A;  4YAP A;  2RLI A;  1T4Z A;  1B4P A;  1XWK A;  3CBU A;  5ECI B;  1FG4 A;  3TKS C;  1R7H A;  3UIW A;  2JAD A;  2VKZ G;  1A2M A;  2ON7 A;  4CY6 A;  3APQ A;  1SL0 B;  2FA8 A;  1WP0 A;  4EF0 A;  2K8S A;  3GKM A;  3IHQ A;  2HNL A;  2WZ9 A;  3ZML A;  2A4V A;  1X9S B;  2LRT A;  5J4U A;  1NHO A;  2NPB A;  4FO5 A;  1CQH A;  4AKX B;  4K7O A;  3LFL A;  4AKH A;  3VPQ A;  5G2Z A;  4F9Z A;  18GS A;  1VF2 A;  3BCK A;  2H0G A;  1G6Y A;  4IP1 A;  3RFR C;  3C8E A;  2A2R A;  1X9W B;  3WD6 A;  3C1R A;  2YCD A;  2OJL A;  3MSZ A;  2JZT A;  4ZIJ A;  2R0C A;  4AI6 A;  2H0I A;  5DJL A;  3HXS A;  3WGD A;  3DGQ A;  5B6N A;  1A23 A;  4AF2 A;  4OD7 A;  2DKH A;  4WR4 A;  3WGE A;  4HOJ A;  3FYG A;  4MLY A;  4WKW A;  3ZIT A;  1GP1 A;  2YP6 A;  4HI7 A;  3MNG A;  4G10 A;  5DCG A;  3APS A;  3GA4 A;  1X5D A;  2I81 A;  3V1W A;  3TRP A;  3KM6 A;  3NZN A;  2AYT A;  2J23 A;  3IK9 A;  2F3M A;  3NIV A;  4GRF A;  4K5R A;  3G7I A;  3GL3 A;  1TDI A;  2H1D A;  2OAD A;  5ECS A;  9GSS A;  1GSF A;  4D73 A;  5ECR B;  4YAV A;  3KTB A;  2C1Y A;  3PGT A;  1BED A;  3MIX A;  1A2L A;  3UBK A;  3DIE A;  2O8V B;  2EIR A;  4NWY A;  1Z7R A;  2CAI A;  3GKN A;  4K2X A;  4IS0 A;  5E59 A;  3IPZ A;  4IBP A;  4ULX A;  3JCM L;  3A5I A;  4WET A;  1TKD B;  3D5J A;  4L0U A;  5LCZ A;  1UA5 A;  2V2G A;  2HRK A;  1RK4 A;  1GTI A;  8GSS A;  2MYG A;  1XVQ A;  2FHE A;  3CSI A;  1QGV A;  3ZFL A;  4WF5 A;  4K7N A;  3VWX A;  4TR1 B;  1Y25 A;  4OCF A;  3RDW A;  2CVK A;  5EY6 A;  4AJ8 A;  1MTC A;  3TGZ A;  2OE0 A;  2CA8 A;  2WZS A;  4KCA A;  4POL A;  1GLQ A;  2F8A A;  3UJ1 A;  1T7P B;  4DSS A;  1SVO A;  3VUR A;  5CYY A;  3UL3 A;  2H1A A;  2HE3 A;  1VRS D;  4I8B A;  3KP9 A;  1YEP A;  3IK7 A;  3KGK A;  1GTB A;  2X4A A;  3TJF A;  4DSS B;  4Z7X A;  1R26 A;  3HKR A;  3U5R E;  3C1S A;  2VL2 C;  3F8U A;  3M9J A;  3TJB A;  3ZMK A;  3HVS A;  3L4N A;  4YQU A;  1LJR A;  4X0X A;  2DSA A;  3HVX A;  2XPE A;  3WGX A;  1JHB A;  1GWC A;  2MZC A;  2PN8 A;  3WT2 A;  2CZ3 A;  1XOB A;  4K1F A;  4HZ2 A;  4YKF A;  3QFB C;  3GUS A;  4KDY A;  2IME A;  1K0N A;  5ECL B;  4KH7 A;  4ZBD A;  3UOM A;  19GS A;  1GUK A;  2E2M A;  1EEJ A;  2BTO T;  4YQV A;  1GUM A;  3FW2 A;  1I5G A;  3ZIV A;  2PU9 C;  5DAL A;  3DYR A;  4TR0 A;  2M46 A;  1EOG A;  4POK A;  3S9F A;  4V2M A;  5CRD A;  4L8E A;  1EEM A;  5F06 A;  2DMM A;  3BCI A;  1TK8 B;  4IVF A;  5LD0 A;  3KP8 A;  4W66 A;  2FLS A;  12GS A;  4DSQ A;  1H4O A;  1O8X A;  3H79 A;  2UV8 G;  1PA3 A;  2YPM A;  1XWA A;  3QPM A;  2GT5 A;  1Z6M A;  6GST A;  3D22 A;  3ED3 A;  4MK3 A;  2E2G A;  2C0D A;  1WMJ A;  2R2J A;  16GS A;  2HT9 A;  4ZIL A;  5DBQ A;  4KDU A;  1S3A A;  1ERU A;  3KCM A;  4KF9 A;  1FB0 A;  4GSS A;  4PGT A;  5G1K A;  2DBC A;  4BVY A;  1TTZ A;  1GNW A;  2AJQ B;  4ZB8 A;  1F2E A;  4YQM A;  4XRD A;  1U3I A;  3HY2 A;  2VCW A;  1SK0 A;  2I3Y A;  3VK9 A;  3GSS A;  1PMT A;  5IMV A;  3CXG A;  4KSM A;  3RBT A;  3LEF A;  2KP1 A;  1RQM A;  5D9T A;  2VIM A;  4J57 E;  4MH3 A;  2WB9 A;  1TJD A;  2IFQ A;  5G5E A;  1IYH A;  1A8Y A;  5ID2 B;  3RHB A;  3DWV A;  2WFC A;  3ZZX A;  2VL3 A;  1FVJ A;  2H01 A;  3F6F A;  3HVV A;  2NDO A;  5KN0 A;  4IQ1 A;  1WJK A;  7GSS A;  4EDZ A;  2R5G A;  1OC9 B;  3P8W A;  5IMA A;  1WIK A;  3L78 A;  1FVK A;  4K0N A;  3FR9 A;  2TRC P;  3CHX C;  1GL8 A;  3LYK A;  3HJO A;  4JR6 A;  2XBI A;  2X8H A;  5L71 A;  3C7M A;  3QAG A;  1V98 A;  2IL3 A;  1PN9 A;  1J9B A;  3TKS A;  4WR5 A;  4GQC A;  3GUR A;  4OO4 A;  2I4A A;  4XCS A;  1WWJ A;  5A5K A;  5AGY A;  3QD9 A;  1H75 A;  2LST A;  5A4V A;  4N10 A;  4K6X A;  1SL1 B;  2DJ2 A;  2YV9 A;  3F4S A;  1GUL A;  2OA7 A;  2X8G A;  1K3L A;  2O5V A;  4KW6 A;  1USB A;  4IW9 A;  2FUG 2;  4PNF A;  4JRR A;  2HSN A;  4XS6 A;  3VI7 A;  1SJZ A;  2DC5 A;  4F0C A;  1YF1 A;  1JLV A;  3GST A;  5IQY A;  1N8J A;  5H5Q A;  2HSM B;  6GSX A;  4MA9 A;  1UC7 A;  5DCH A;  1QFN A;  4QL9 A;  1XG8 A;  3UVH A;  2ZCT A;  1ST9 A;  4WBJ A;  2IJY A;  1XW6 A;  1EP7 A;  4CY8 A;  2H6Y A;  3KZQ A;  4JED A;  1SK2 A;  1BG1 A;  5D8I A;  4X4J A;  2MBS A;  2MMA A;  2OBI A;  4XRA A;  2HQT A;  1PD2 1;  5JWQ B;  1FW1 A;  4LMV A;  4N3Z A;  1BX9 A;  2P5Q A;  1HD2 A;  2L4Q A;  5B6M A;  2EIQ A;  3DVX A;  2LV3 A;  3TDG A;  2YV7 A;  1B9Y C;  2HSY A;  3GTU A;  2V41 A;  4ECB A;  2RII A;  4EIP A;  3D4T A;  1M0U A;  3KJY A;  5CRH A;  4Q5F A;  1HQO A;  2J9H A;  1EOH A;  2WGR A;  2DJJ A;  2DJK A;  1X5E A;  4GWR A;  4KUN A;  1GSQ A;  2F8F A;  4HEA 2;  3FZA A;  1S4B P;  2ES7 A;  3BBY A;  4F0B A;  4HU9 A;  1AC1 A;  5KOX A;  4MJB A;  4NMU A;  4ZB9 A;  1GTU A;  2LNT A;  4MPG A;  4HQS A;  5HR2 A;  2V6O A;  1DSB A;  4K0G A;  1Z7P A;  2FD3 A;  5LNK e;  2WVX A;  4WBR D;  4YH2 A;  1S3D A;  4NXI A;  5ECM B;  1WE0 A;  2HXK A;  2K9F A;  3CSJ A;  3KTL A;  4KDX A;  2H70 A;  1B4Q A;  2VCX A;  1K0A A;  1OE8 A;  1V40 A;  2ON5 A;  5GZZ B;  5INY A;  4OFM A;  1SYX A;  4I2T A;  3KD0 A;  2M72 A;  1ZZY A;  2GLR A;  2LRN A;  2VO4 A;  5B7C A;  1SJI A;  1DE1 A;  5ECP B;  3A2W A;  3IAS 2;  3EPT A;  3TCO A;  4EC0 A;  1XZO A;  1ZCP A;  3RHC A;  2HZF A;  5F0G A;  3IOS A;  1AIU A;  5ECQ B;  4WF4 A;  4NV2 A;  2QGV A;  4J56 E;  3GYK A;  2MMO A;  5C04 A;  4KB3 A;  3P90 A;  5C00 A;  5JWO B;  2HZE B; 
#chains in the Genus database with same CATH homology
 3I6A A;  2GT6 A;  3GNJ A;  3PR8 A;  1M9A A;  3F6D A;  2EFH A;  1GSS A;  3ZTL A;  4N11 A;  4LA1 A;  4EO3 A;  3F0I A;  4MDC A;  4BA7 A;  3J7Y b;  3P7X A;  4JBB A;  3MDK A;  1O6J A;  1E6B A;  2VL2 A;  1OVN A;  1SK1 A;  5CRE A;  4ZXG A;  4OCE A;  2JAC A;  2GTU A;  1VF3 A;  2DIZ A;  4G01 A;  2CQ9 A;  2WRT A;  3TKS E;  2GQK A;  3HA9 A;  1G7E A;  3I9V 2;  2IWT A;  2IMI A;  1K0C A;  3CYN A;  4YKG A;  1I9D A;  5HQP A;  5JWR B;  4K8M A;  3EIN A;  3I43 A;  3M1G A;  2XHF A;  4ISD A;  4G19 A;  4MF6 A;  1QK8 A;  1EV4 A;  4WXT A;  3U6V A;  2X8C A;  1IYI A;  5CRG A;  2LNS A;  5J4V A;  1VF1 A;  1QXH A;  3IRA A;  3HMJ G;  1PL1 A;  20GS A;  1SEN A;  1ML6 A;  1TW9 A;  3FZ4 A;  3E0U A;  3UEM A;  1KTE A;  5ENU A;  4TRX A;  3KH9 A;  4JU5 A;  4MF7 A;  1JLW A;  4CHS A;  2PUK C;  4NV5 A;  2YOI A;  4TXO A;  1AQW A;  17GS A;  3TOT A;  2H73 A;  3HDC A;  1A2J A;  1SL2 B;  5AIS A;  5HR3 A;  4OMV A;  4AGS A;  1WRY A;  2K8V A;  3E9J B;  2REM A;  1PN0 A;  3GH9 A;  1TI3 A;  5AIX A;  3PH9 A;  2CVD A;  1ZL9 A;  3GKK A;  2H30 A;  2OE1 A;  1G7O A;  1F6M C;  5J41 A;  1GSD A;  2FCH A;  1XWB A;  2CX3 A;  3GMF A;  4D73 B;  4OFT A;  2LRC A;  3QMX A;  1M99 A;  1ZGN A;  1Z6N A;  5KOW A;  4POB A;  3VWV A;  2B7J A;  6GSY A;  1XW5 A;  4X43 A;  5DDL A;  1BAY A;  4PQ1 A;  1SKS B;  2AB6 A;  1OAZ A;  2C4J A;  3KMO A;  4OFN A;  2O89 A;  4V1A p;  3E3E A;  2HRK B;  6GSW A;  2VLV A;  2R4V A;  2EIO A;  5KN3 A;  1XW9 A;  2B5E A;  1B9X C;  1SYR A;  4IN0 A;  4GF0 A;  4DVC A;  2HLS A;  3ZVJ A;  4Q5N A;  3C73 A;  1V2A A;  2E0Q A;  4LL1 B;  5GST A;  4ZB6 A;  4HDE A;  1JZR A;  3HZ8 A;  14GS A;  2VD0 A;  3D21 A;  1PX7 A;  2H74 A;  1A24 A;  2GSS A;  4PQH A;  4BVX A;  2G2Q A;  3EC3 A;  1MD4 A;  2V1M A;  4TVE A;  4ZB7 A;  3UVT A;  3DXB A;  1XXU A;  2H66 A;  5IPG A;  3VPT A;  4ZL9 A;  1T4Y A;  1OKD A;  2YWO A;  3D0Z A;  4V2N A;  4G9H A;  1YKC A;  5BMU A;  2JSZ A;  3G7J A;  2PPT A;  5ECH B;  1EWX A;  2HI7 A;  5ECK B;  1BYE A;  13GS A;  2YZH A;  4J2F A;  5FT3 A;  2DJ1 A;  2VLU A;  3ZL5 A;  1BF5 A;  1RW1 A;  1XIY A;  2P31 A;  4L0W A;  3ISO A;  1YF0 A;  4GLT A;  5FHI A;  3N5O A;  1G0T A;  2YWM A;  4L5L A;  4F2I A;  2JSY A;  2WDU A;  5DAL B;  1AQX A;  2B6M A;  4TXV A;  1YEX A;  3KH7 A;  3LQ7 A;  2GZZ A;  2ALB A;  3TB2 A;  4PXO A;  3DD3 A;  1MDJ A;  2IPA A;  3TRQ A;  2NBS A;  2IMF A;  3OR5 A;  3UBL A;  1JZD A;  3LOR A;  3EE2 A;  2OT3 A;  3O3T A;  5D73 A;  1O81 A;  2TRX A;  1GSY A;  3HZ4 A;  1GLP A;  3IDV A;  5FWG A;  2A4H A;  2LJK A;  5IM9 A;  1AUC A;  1FHE A;  4E8H A;  1R5P A;  4RI6 A;  1NW2 A;  4NHW A;  4BWS A;  1AXD A;  4K2D A;  2N5F A;  4MPF A;  2L6D A;  2D2Z A;  4BVY B;  2X99 A;  5A4W A;  3F3Q A;  5J3R A;  1V57 A;  4NAX A;  4HJM A;  3SWL A;  2YJH A;  2PVO C;  4HS1 A;  1EGO A;  2C8U A;  2VCQ A;  4GQF A;  1FOH A;  1FOV A;  2IFQ B;  3BOA A;  1XVW A;  3R2Q A;  2RUE A;  4FYC A;  2FNO A;  2QA2 A;  4EE0 A;  2C0F A;  4E68 A;  3PIN A;  4LLR A;  1WPI A;  1TRU A;  4MZW A;  3W8S A;  3J7Y k;  4Z2T A;  2FGX A;  4OWY A;  2YWN A;  5IOW A;  1EV9 A;  3IA1 A;  4O7H A;  4ZL7 A;  1TP9 A;  3FR3 A;  2ZUP A;  1M2A A;  4QMK A;  3FHK A;  3HCZ A;  4HQZ A;  1X5C A;  5EPF A;  4EL1 A;  1N2A A;  1KBN A;  4KE3 A;  4MMM A;  1UN2 A;  2B5Y A;  4EDY A;  3CMI A;  3EWL A;  1Z3E A;  2VCT A;  1F37 A;  4IP6 A;  1T8E B;  4BL7 A;  5B8B A;  1GSU A;  3O76 A;  2CZ2 A;  4WEY A;  1JFU A;  1M7T A;  1MDI A;  3ME7 A;  4PTS A;  4JZQ A;  4PQI A;  2PVQ A;  2KOK A;  5F05 A;  4MJC A;  1JZO A;  1SKR B;  2H76 A;  2CT6 A;  2MBT A;  3I69 A;  2QA1 A;  1GNE A;  2OKA A;  3EVI A;  1X0R A;  2F9S A;  4NPB A;  5CNW A;  1U88 A;  2O7K A;  3FY7 A;  3UMA A;  1TXX A;  5F07 A;  5DAK A;  3L9U A;  1TU8 A;  2H75 A;  2N5A A;  4G0K A;  2JZS A;  1ZYQ B;  4XS4 A;  4XS1 A;  3HHV A;  2HSN B;  2CX4 A;  5B8A A;  4TOP A;  1EZK A;  2FA4 A;  2O85 A;  1TRV A;  2GVP A;  3QDN A;  2DKI A;  5GSS A;  1SKW B;  1O85 A;  2MMZ A;  1R4W A;  2I9H A;  4ZL8 A;  5D9W A;  3RAZ A;  2XC2 A;  1LBK A;  1XBS A;  4GCI A;  3LWA A;  4O32 A;  3IC4 A;  5IO2 A;  4Q5Q A;  4KCE A;  5G1L A;  2WJU A;  3Q18 A;  3LJR A;  4BWQ A;  4EKZ A;  1S3C A;  3US3 A;  3LW9 A;  5ECN B;  1SVL A;  1N25 A;  4O92 A;  1ILO A;  2AAW A;  3A3T A;  1PSQ A;  1O8W A;  5HFI A;  3GTU B;  2F51 A;  1PKZ A;  3QOU A;  1GUH A;  4IJ3 A;  5A34 A;  2LEG A;  1G6W A;  4ECJ A;  3R3E A;  4O5R A;  3CSH A;  2FY6 A;  1DE2 A;  3LYP A;  1GRX A;  4IHU A;  1NM3 A;  3FR6 A;  2C3T A;  1Q4J A;  3TOU A;  1PQN A;  1PKW A;  5HR1 A;  2HYX A;  2ZNM A;  5GAN D;  1Y1U A;  2L6C A;  4I5Q A;  1XPV A;  3BD2 A;  5IO0 A;  2H8L A;  5A5H A;  4H86 A;  4Z2R A;  3ERG A;  2EFE A;  2C0E A;  3FZ5 A;  2LTK A;  1YZX A;  4GXZ A;  1U6T A;  2X64 A;  1CQG A;  2R0G A;  1TK5 B;  2HRF A;  1YJ6 A;  3IC8 A;  1TK0 B;  3CTF A;  1PX6 A;  1EP8 A;  1URM A;  5D9X A;  2VUP A;  3F63 A;  3IV4 A;  4ML1 A;  1OC8 A;  2XBQ A;  2KP2 A;  2CAQ A;  3EMP A;  1A8L A;  2GZY A;  1MEK A;  1HNB A;  2FWE A;  1XWC A;  1HNA A;  1U87 A;  1QQ2 A;  3M0F A;  2P0G A;  3QAW A;  3DKS A;  1XWG A;  4I97 A;  3GH6 A;  4KA0 A;  1J08 A;  1K0O A;  4IEL A;  5AN1 A;  2B3S A;  3FK8 A;  4GST A;  1M2B A;  2PER A;  1K3Y A;  2WUL A;  10GS A;  2N5B A;  1MD3 A;  1TRW A;  3GV1 A;  1B48 A;  1ZOF A;  5EVO A;  5IMF A;  3TRX A;  4V1A g;  4KSO A;  4FYB A;  4JR4 A;  3IR4 A;  3WYW A;  3VI5 A;  5GAP D;  5IMD A;  1WOU A;  2DJ3 A;  3CTG A;  4RUV A;  1FO5 A;  3HJP A;  5AIV A;  4TN8 A;  3VFI A;  1ERW A;  3L9V A;  3ZRD A;  5KN1 A;  2I1U A;  4BPY A;  5BRT A;  2VL9 A;  3F4R A;  3G9B A;  2QC7 A;  2VOC A;  2GSR A;  5KEJ A;  3N9J A;  4GTU A;  4USS A;  2A2P A;  5HFG A;  4XHM A;  1X9M B;  2YWI A;  1FB6 A;  2WCI A;  3KEB A;  2IIY A;  5DVB A;  5JCU A;  2GQM A;  3M9K A;  3BJ5 A;  1FAA A;  3UAR A;  5H5R A;  4PNG A;  4DEJ A;  2LJA A;  3LXT A;  2GSQ A;  4TXO B;  4K5S A;  3EUR A;  4O5Q A;  5IMZ A;  3L9S A;  3LGC A;  3PPU A;  3TJG A;  1O7U A;  2EC4 A;  4PUR A;  5ELA A;  3GN3 A;  2MMN A;  4DSR A;  5KN2 A;  4XIH A;  3NOF A;  4A5P A;  1TRS A;  1PGT A;  4OO5 A;  4KX4 A;  4X1U A;  5J9B A;  1GTA A;  1PRX A;  3WT1 A;  1Q98 A;  4O5U A;  1PL2 A;  3KMN A;  1M9B A;  2B1K A;  2VM2 A;  4I2U A;  4IQA A;  2H6Z A;  3LG6 A;  1F3A A;  1R5A A;  2L4C A;  4TW5 A;  3ZLP A;  5D96 A;  3GL5 A;  3KXO A;  2IMK A;  2BMX A;  3UAP A;  1JZW A;  4ECC A;  2OE3 A;  3F9U A;  2CV4 A;  1HNC A;  4HUA A;  3QR6 A;  1ERT A;  3TKQ A;  3DEX A;  11GS A;  1Z5Y E;  1THO A;  2OAC A;  1UVZ A;  4HZ4 A;  2PWJ A;  4TKY A;  4MP4 A;  3FZ9 A;  2DJ0 A;  4ID0 A;  3EYT A;  3FKF A;  3GX0 A;  2WS2 A;  3GX8 A;  1K3O A;  4KND A;  2RM5 A;  4TR1 A;  2IN3 A;  3ME8 A;  1OC3 A;  2E7P A;  4I6X A;  4ZBA A;  1ACV A;  3CRT A;  1DUG A;  2GQL A;  3ERW A;  4LL4 B;  2HFD A;  2VCZ A;  4K9Z A;  2VM1 A;  3AY8 A;  4JE1 A;  5J4Y A;  2YZU A;  1XOA A;  2LQO A;  3RPN A;  3H93 A;  4BVX B;  2G0F A;  1NHY A;  4ICY A;  3D6I A;  6GSV A;  1TOF A;  1W89 A;  3RPP A;  1AQV A;  2C3Q A;  4ML6 A;  3IAM 2;  3Q19 A;  3GIX A;  2PBJ A;  4HU7 A;  1T3B A;  4MZC A;  5BMU B;  2QKE A;  2C0G A;  3ZRE A;  4QL7 A;  2VAF A;  4V2L A;  3DVW A;  5DQY A;  3VWW A;  5ECO B;  3ZFB A;  1J0F A;  3F3R A;  2DIY A;  4MAB A;  2C80 A;  1LU4 A;  2V6K A;  2H1G A;  2HSH A;  5F8B A;  1ON4 A;  4LMW A;  1SD9 A;  2FWG A;  2RUF A;  4MJA A;  1ZYP A;  2CVB A;  3MAK A;  1OYJ A;  4NHZ A;  3H8Q A;  2X49 A;  1TU7 A;  2AUV A;  1NSW A;  4MZB A;  4GDF A;  1E2Y A;  4E8E A;  2H1B A;  4POM A;  2C3N A;  1ZYE A;  1TXU A;  2V32 A;  5CP1 A;  4ACS A;  4G0I A;  3FMW A;  5JCG A;  2A2S A;  2KLX A;  1Y6E A;  1YVL A;  5CAX A;  3EU4 A;  3QFA C;  4EXJ A;  1ERV A;  2LQQ A;  4IJI A;  5A1N A;  1VF4 A;  2DLX A;  4F03 A;  4K7I A;  5H5S A;  3FEU A;  1F9M A;  2PMT A;  1AAZ A;  2AV4 A;  2OBK A;  4EIQ A;  4AJ7 A;  5A1N B;  4Q5R A;  3IBH A;  5A4U A;  3TJK A;  4HJ2 A;  1V58 A;  2LKU A;  1GH2 A;  2PGT A;  1V9W A;  3EMX A;  5IMC A;  5J47 A;  3M3M A;  4EVM A;  4RQX A;  1ZYN A;  3GHA A;  4G2E A;  3GFK A;  2GS3 A;  2R3X A;  4FYU A;  1SU9 A;  5ID2 A;  4RI7 A;  2LUS A;  3HJM A;  4AJ6 A;  3M8N A;  2M80 A;  4FQU A;  1BG5 A;  4AKG A;  5E4W A;  1ABA A;  3K8N A;  3TKP A;  2GST A;  3ZIJ A;  3LSZ A;  4MNN A;  2R0P A;  1K0B A;  4PUA A;  1BQ7 A;  1VGL A;  2GGT A;  3P2A A;  1QUW A;  1K0M A;  3ERF A;  22GS A;  3IE3 A;  1W4V A;  1OC9 A;  3MWH A;  4ILF A;  2KHP A;  1F3B A;  2DML A;  1SD8 A;  2JZR A;  4FIW A;  3ZVJ D;  1HYU A;  5CO3 A;  2UZ8 A;  3O6T A;  5D9V A;  4CW9 A;  5CRW A;  4ZBB A;  1THX A;  1KEB A;  2JL4 A;  4KGI A;  3A2V A;  5ELG A;  1EGR A;  5D93 A;  3SBC A;  1YKA A;  3KIJ A;  4Z2U A;  3TU3 B;  1ZMA A;  1XCC A;  1OKT A;  1T00 A;  3L0H A;  4BL7 B;  3VLN A;  2YNX A;  2O87 A;  4N0Z A;  1O73 A;  1OE7 A;  2YJ7 A;  4IGJ A;  2L5O A;  4PX1 A;  3DRN A;  5J9C A;  2YN1 A;  2LS5 A;  3FRC A;  1QMV A;  3EU3 A;  2H72 A;  4MJE A;  6GSS A;  2RM6 A;  2NTO A;  2VCV A;  3TJJ A;  3HD5 A;  4QQ7 A;  4MCU A;  2IMD A;  4G0L A;  3DML A;  5DAK B;  4XTS A;  3W8J A;  5HR0 A;  1SJ6 A;  1T1V A;  6GSU A;  3CRU A;  2L59 A;  5ABR A;  2H6X A;  2HSM A;  4XS4 B;  2L5L A;  4RQR A;  2BJX A;  4L5O A;  3G7Y A;  1B8X A;  2AHE A;  2R6K A;  2NVL A;  2HRN A;  5IPH A;  2EFD A;  1DBY A;  5DJM A;  3HYP A;  1KNG A;  1GSE A;  3C71 A;  3A2X A;  1AW9 A;  2VD1 A;  3CWG A;  2HRA A;  4PUF C;  4GSN A;  1A0F A;  4N0V A;  5IIZ A;  3IXR A;  4P3Y B;  1M2D A;  1U3A A;  3F4T A;  2FWH A;  2QSI A;  3A5W A;  3H1N A;  5DQS A;  1TI1 A;  3VWU A;  3Q74 A;  2H0H A;  4FH8 A;  2L57 A;  5G31 A;  3TUE A;  1YQ1 A;  4F82 A;  1YDK A;  5A34 B;  3Q6O A;  4KAE A;  1BJX A;  1YY7 A;  3H4K A;  2LJR A;  2B5X A;  3QCP A;  5COH A;  5J5N A;  1XFL A;  2KUC A;  2YAN A;  2K6V A;  2K18 A;  4TR4 A;  3TKR A;  5IOX A;  3GKX A;  4EUY A;  2FWF A;  4N30 A;  2GDR A;  3LXZ A;  3MYD A;  5A5H B;  2H1L A;  2R37 A;  2Z9S A;  1C72 A;  3W6G A;  2B7K A;  5G30 A;  5J40 A;  4AKI A;  3QAV A;  2JU5 A;  2VLT A;  2GZP A;  1K0D A;  1Z9H A;  2H71 A;  2B1L A;  3IHG A;  5EL8 A;  4MF5 A;  4CDO A;  5JCW A;  2XPD A;  4ECI A;  4MH2 A;  3GRX A;  2H19 A;  2TIR A;  1MDK A;  3APO A;  4IKH A;  2HZE A;  2EFC A;  5G5F A;  3D4M A;  3ZYW A;  2P5R A;  5HFK A;  1SVM A;  1A0R P;  4TR3 A;  4YAP A;  2RLI A;  1T4Z A;  1B4P A;  1XWK A;  3CBU A;  5ECI B;  1FG4 A;  3TKS C;  1R7H A;  3UIW A;  2JAD A;  2VKZ G;  1A2M A;  2ON7 A;  4CY6 A;  3APQ A;  1SL0 B;  2FA8 A;  1WP0 A;  4EF0 A;  2K8S A;  3GKM A;  3IHQ A;  2HNL A;  2WZ9 A;  3ZML A;  2A4V A;  1X9S B;  2LRT A;  5J4U A;  1NHO A;  2NPB A;  4FO5 A;  1CQH A;  4AKX B;  4K7O A;  3LFL A;  4AKH A;  3VPQ A;  5G2Z A;  4F9Z A;  18GS A;  1VF2 A;  3BCK A;  2H0G A;  1G6Y A;  4IP1 A;  3C8E A;  2A2R A;  1X9W B;  3WD6 A;  3C1R A;  2YCD A;  2OJL A;  3MSZ A;  2JZT A;  4ZIJ A;  2R0C A;  4AI6 A;  2H0I A;  5DJL A;  3HXS A;  3WGD A;  3DGQ A;  5B6N A;  1A23 A;  4AF2 A;  4OD7 A;  2DKH A;  4WR4 A;  3WGE A;  4HOJ A;  3FYG A;  4MLY A;  4WKW A;  3ZIT A;  1GP1 A;  2YP6 A;  4HI7 A;  3MNG A;  4G10 A;  5DCG A;  3APS A;  3GA4 A;  1X5D A;  2I81 A;  3V1W A;  3TRP A;  3KM6 A;  3NZN A;  2AYT A;  2J23 A;  3IK9 A;  2F3M A;  3NIV A;  4GRF A;  4K5R A;  3G7I A;  3GL3 A;  1TDI A;  2H1D A;  2OAD A;  5ECS A;  9GSS A;  1GSF A;  4D73 A;  5ECR B;  4YAV A;  3KTB A;  2C1Y A;  3PGT A;  1BED A;  3MIX A;  1A2L A;  3UBK A;  3DIE A;  2O8V B;  2EIR A;  4NWY A;  1Z7R A;  2CAI A;  3GKN A;  4K2X A;  4IS0 A;  5E59 A;  3IPZ A;  4IBP A;  4ULX A;  3JCM L;  3A5I A;  4WET A;  1TKD B;  3D5J A;  4L0U A;  5LCZ A;  1UA5 A;  2V2G A;  2HRK A;  1RK4 A;  1GTI A;  8GSS A;  2MYG A;  1XVQ A;  2FHE A;  3CSI A;  1QGV A;  3ZFL A;  4WF5 A;  4K7N A;  3VWX A;  4TR1 B;  1Y25 A;  4OCF A;  3RDW A;  2CVK A;  5EY6 A;  4AJ8 A;  1MTC A;  3TGZ A;  2OE0 A;  2CA8 A;  4KCA A;  4POL A;  1GLQ A;  2F8A A;  3UJ1 A;  1T7P B;  4DSS A;  1SVO A;  3VUR A;  5CYY A;  3UL3 A;  2H1A A;  2HE3 A;  1VRS D;  4I8B A;  3KP9 A;  1YEP A;  3IK7 A;  3KGK A;  1GTB A;  2X4A A;  3TJF A;  4DSS B;  4Z7X A;  1R26 A;  3HKR A;  3U5R E;  3C1S A;  2VL2 C;  3F8U A;  3M9J A;  3TJB A;  3ZMK A;  3HVS A;  3L4N A;  4YQU A;  1LJR A;  4X0X A;  2DSA A;  3HVX A;  2XPE A;  3WGX A;  1JHB A;  1GWC A;  2MZC A;  2PN8 A;  3WT2 A;  2CZ3 A;  1XOB A;  4K1F A;  4HZ2 A;  4YKF A;  3QFB C;  3GUS A;  4KDY A;  2IME A;  1K0N A;  5ECL B;  4KH7 A;  4ZBD A;  3UOM A;  19GS A;  1GUK A;  2E2M A;  1EEJ A;  2BTO T;  4YQV A;  1GUM A;  3FW2 A;  1I5G A;  3ZIV A;  2PU9 C;  5DAL A;  3DYR A;  4TR0 A;  2M46 A;  1EOG A;  4POK A;  3S9F A;  4V2M A;  5CRD A;  4L8E A;  1EEM A;  5F06 A;  2DMM A;  3BCI A;  1TK8 B;  4IVF A;  5LD0 A;  3KP8 A;  4W66 A;  2FLS A;  12GS A;  4DSQ A;  1H4O A;  1O8X A;  3H79 A;  2UV8 G;  1PA3 A;  2YPM A;  1XWA A;  3QPM A;  2GT5 A;  1Z6M A;  6GST A;  3D22 A;  3ED3 A;  4MK3 A;  2E2G A;  2C0D A;  1WMJ A;  2R2J A;  16GS A;  2HT9 A;  4ZIL A;  5DBQ A;  4KDU A;  1S3A A;  1ERU A;  3KCM A;  4KF9 A;  1FB0 A;  4GSS A;  4PGT A;  5G1K A;  2DBC A;  4BVY A;  1TTZ A;  1GNW A;  2AJQ B;  4ZB8 A;  1F2E A;  4YQM A;  4XRD A;  1U3I A;  3HY2 A;  2VCW A;  1SK0 A;  2I3Y A;  3VK9 A;  3GSS A;  1PMT A;  5IMV A;  3CXG A;  4KSM A;  3RBT A;  3LEF A;  2KP1 A;  1RQM A;  5D9T A;  2VIM A;  4J57 E;  4MH3 A;  2WB9 A;  1TJD A;  2IFQ A;  5G5E A;  1IYH A;  1A8Y A;  5ID2 B;  3RHB A;  3DWV A;  2WFC A;  3ZZX A;  2VL3 A;  1FVJ A;  2H01 A;  3F6F A;  3HVV A;  2NDO A;  5KN0 A;  4IQ1 A;  1WJK A;  7GSS A;  4EDZ A;  2R5G A;  1OC9 B;  3P8W A;  5IMA A;  1WIK A;  3L78 A;  1FVK A;  4K0N A;  3FR9 A;  2TRC P;  1GL8 A;  3LYK A;  3HJO A;  4JR6 A;  2XBI A;  2X8H A;  5L71 A;  3C7M A;  3QAG A;  1V98 A;  2IL3 A;  1PN9 A;  1J9B A;  3TKS A;  4WR5 A;  4GQC A;  3GUR A;  4OO4 A;  2I4A A;  4XCS A;  1WWJ A;  5A5K A;  5AGY A;  3QD9 A;  1H75 A;  2LST A;  5A4V A;  4N10 A;  4K6X A;  1SL1 B;  2DJ2 A;  2YV9 A;  3F4S A;  1GUL A;  2OA7 A;  2X8G A;  1K3L A;  2O5V A;  4KW6 A;  1USB A;  4IW9 A;  2FUG 2;  4PNF A;  4JRR A;  2HSN A;  4XS6 A;  3VI7 A;  1SJZ A;  2DC5 A;  4F0C A;  1YF1 A;  1JLV A;  3GST A;  5IQY A;  1N8J A;  5H5Q A;  2HSM B;  6GSX A;  4MA9 A;  1UC7 A;  5DCH A;  1QFN A;  4QL9 A;  3UVH A;  2ZCT A;  1ST9 A;  4WBJ A;  2IJY A;  1XW6 A;  1EP7 A;  4CY8 A;  2H6Y A;  3KZQ A;  4JED A;  1SK2 A;  1BG1 A;  5D8I A;  4X4J A;  2MBS A;  2MMA A;  2OBI A;  4XRA A;  2HQT A;  1PD2 1;  5JWQ B;  1FW1 A;  4LMV A;  4N3Z A;  1BX9 A;  2P5Q A;  1HD2 A;  2L4Q A;  5B6M A;  2EIQ A;  3DVX A;  2LV3 A;  3TDG A;  2YV7 A;  1B9Y C;  2HSY A;  3GTU A;  2V41 A;  4ECB A;  2RII A;  4EIP A;  3D4T A;  1M0U A;  3KJY A;  5CRH A;  4Q5F A;  1HQO A;  2J9H A;  1EOH A;  2WGR A;  2DJJ A;  2DJK A;  1X5E A;  4GWR A;  4KUN A;  1GSQ A;  2F8F A;  4HEA 2;  3FZA A;  2ES7 A;  3BBY A;  4F0B A;  4HU9 A;  1AC1 A;  5KOX A;  4MJB A;  4NMU A;  4ZB9 A;  1GTU A;  2LNT A;  4MPG A;  4HQS A;  5HR2 A;  2V6O A;  1DSB A;  4K0G A;  1Z7P A;  2FD3 A;  5LNK e;  4WBR D;  4YH2 A;  1S3D A;  4NXI A;  5ECM B;  1WE0 A;  2HXK A;  2K9F A;  3CSJ A;  3KTL A;  4KDX A;  2H70 A;  1B4Q A;  2VCX A;  1K0A A;  1OE8 A;  1V40 A;  2ON5 A;  5GZZ B;  5INY A;  4OFM A;  1SYX A;  4I2T A;  3KD0 A;  2M72 A;  1ZZY A;  2GLR A;  2LRN A;  2VO4 A;  5B7C A;  1SJI A;  1DE1 A;  5ECP B;  3A2W A;  3IAS 2;  3EPT A;  3TCO A;  4EC0 A;  1XZO A;  1ZCP A;  3RHC A;  2HZF A;  5F0G A;  3IOS A;  1AIU A;  5ECQ B;  4WF4 A;  4NV2 A;  2QGV A;  4J56 E;  3GYK A;  2MMO A;  5C04 A;  4KB3 A;  3P90 A;  5C00 A;  5JWO B;  2HZE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...