4ZBBA

Crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium complexed with glutathionyl-s-dinitrobenzene.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
221
structure length
221
Chain Sequence
ASHDKQFSLFLHKASAHGWKVAFVLEELSLSYEIVLVDVAKNEQKSPEFMKLNPNGRTPALIDHGNSDFVIWESNAMVQYVADKYDTERKISMAPGTDDFYIQLQWQYFQGTGQGPYFGQLVWFTLYHEEKIPSAVTRYKEEALRVFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFLDNFDFEKEFPATAAWHYKMLKRPTIKRPWDERRKLMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p8
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 87
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zbbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zbbA01
3M9JA 4YQVA 1NHYA 2MMZA 3BCIA 4KW6A 3GIXA 5AIXA 2H1BA 5IMAA 3LXZA 2AV4A 4F0CA 5E4WA 3HA9A 2B3SA 1YKAA 5GAND 1TRVA 2VLTA 2HQTA 1QK8A 1X9SB 2OJLA 2XBIA 5ECMB 2FGXA 4GSTA 2CVBA 4TR0A 1XBSA 1B48A 3GUSA 2MMOA 2RM5A 4ZB8A 1HQOA 2E2MA 2HZFA 3E0UA 1TXXA 2H70A 1EZKA 2H0GA 3ED3A 3EC3A 3GH9A 2EIOA 3VLNA 4ECJA 4HZ2A 3F4TA 4DEJA 3L9UA 4TXVA 4G0LA 1M7TA 2CQ9A 4KA0A 3ERFA 3FY7A 3EU3A 5LNKe 5COHA 2R37A 4QQ7A 1G7EA 2GSSA 3CTFA 5F0GA 5ID2A 2LUSA 2B7JA 2K8SA 5C00A 4BWQA 4X1UA 3ZIJA 2RLIA 2L59A 1SKRB 3GRXA 3DVXA 1V9WA 3F3RA 6GSTA 1I5GA 2GT5A 2WCIA 4MPGA 4OFMA 4KSOA 4MF6A 4XS1A 4USSA 3IOSA 4NV5A 2HXKA 3E9JB 1XWKA 5D8IA 3WGDA 18GSA 4FH8A 3LYKA 4L5LA 4KSMA 2ZUPA 1A0RP 1SK0A 4K0NA 3HY2A 2GTUA 3W6GA 4PGTA 2C0FA 5D93A 2MMAA 4Q5QA 2H75A 2ZCTA 2PMTA 3GV1A 3BOAA 5AIVA 3D4MA 2O8VB 4IS0A 2QGVA 2VO4A 4GLTA 3TKSE 4ZIJA 4IQ1A 3KH9A 1QQ2A 3RHCA 1Z7RA 3LYPA 4PQ1A 1TJDA 2CV4A 4E8HA 3TKRA 1NW2A 1AXDA 4EKZA 1PRXA 5DALA 2VUPA 2IN3A 2IJYA 1O8XA 3QAWA 1UA5A 2HYXA 1JLWA 5FWGA 1E6BA 2N5FA 3ZRDA 4EC0A 2HRFA 4RI7A 4GWRA 4AGSA 5DQYA 1RK4A 4O7HA 5D9XA 4ACSA 3UVTA 2MMNA 2VLVA 2AUVA 1W89A 3FZAA 3TOTA 3KTBA 2BMXA 4KAEA 3CMIA 4EDZA 1BEDA 1Y6EA 2ON5A 3LQ7A 1X5CA 1PL2A 1YZXA 2PVOC 3KEBA 3ERWA 2H1AA 2YV9A 2CVDA 6GSUA 3TJFA 4IVFA 1N8JA 5IQYA 1XWGA 2E0QA 1F9MA 2YZUA 1YJ6A 1NM3A 3I9V2 1JLVA 1G0TA 3Q74A 2YZHA 2LEGA 1TK0B 5HR1A 1JZRA 3GMFA 4PQHA 2DMMA 5IMFA 3HZ4A 3RBTA 2C3NA 3EYTA 4D73B 3G9BA 2YP6A 5IO2A 2LV3A 5IPHA 1HNBA 3LWAA 4BA7A 1PN9A 2M80A 5KEJA 5IIZA 1GTUA 3ZIVA 12GSA 2VCVA 2L4QA 2J23A 2HI7A 3UOMA 2LSTA 2HFDA 3L4NA 3HJPA 1ZGNA 5HFIA 1SJZA 3A3TA 1SKWB 2E7PA 2YV7A 2RUFA 1TK5B 1GUMA 3PPUA 5DAKA 5DDLA 3IXRA 1TOFA 2DJJA 3GL5A 5ABRA 4KCEA 1FHEA 4BVYA 1YF1A 1JHBA 11GSA 4HEA2 4MJBA 1A2LA 1Z7PA 4O5RA 3IE3A 1EOHA 4F82A 1TDIA 3DXBA 5KN3A 5IMCA 2PERA 1Z3EA 4BVXB 2WB9A 3ZFLA 3F9UA 4TR1B 2MYGA 2FA4A 1EV9A 1RQMA 5JWOB 4Q5NA 2OKAA 1ZMAA 3MSZA 3HVVA 2VD1A 4RI6A 4EXJA 2IMDA 5CREA 1EOGA 2WS2A 1WWJA 2PU9C 1XZOA 1HYUA 4MLYA 1Y25A 5EVOA 1DUGA 17GSA 2HSNB 1S3CA 2DJ3A 4GQCA 1GTAA 2WDUA 1T3BA 2UZ8A 3J7Yk 4NV2A 1EGOA 5HR2A 3GX8A 2FWGA 4HDEA 1GSUA 1WPIA 1OC9B 1TP9A 1X5EA 1PKZA 2HT9A 3CXGA 4HS1A 3LXTA 3H4KA 2O89A 4AF2A 3GNJA 4POMA 4WKWA 13GSA 2R4VA 4WBRD 4XS6A 2H76A 2AJQB 2ALBA 1OYJA 5J41A 3SWLA 2YANA 4MJCA 2DLXA 3GSTA 4PX1A 3KGKA 3DEXA 2MBSA 3UMAA 3CRUA 2JSYA 3GTUB 2JZSA 4BL7B 4NHWA 5H5QA 5CNWA 1GRXA 3CSJA 3ISOA 4MZWA 4K7OA 3R3EA 2LS5A 3QOUA 1SD8A 2LJRA 1ZYEA 2WRTA 4GTUA 4IJIA 5IO0A 5IMZA 1ZL9A 4BWSA 2PPTA 2PWJA 4KH7A 5F8BA 3HKRA 2DJ1A 10GSA 1ST9A 2X8GA 1GNWA 2KLXA 2FA8A 1J9BA 3DYRA 1S3AA 1G7OA 2KUCA 2LJKA 4LL1B 3ZITA 1K0OA 3TOUA 1YEXA 3VWXA 1USBA 4MJEA 2D2ZA 1MDIA 3DKSA 3FEUA 3EMXA 1GTIA 1ERTA 4EO3A 2HZEA 4KDUA 1G6WA 3IAM2 2H1GA 4I6XA 3DVWA 4Q5RA 3O3TA 1XVWA 2H0IA 1OE8A 4KNDA 2H1DA 2FCHA 5DVBA 4AJ7A 2YCDA 1M2BA 2JACA 2X8HA 5J9CA 1K0BA 2TRXA 2VAFA 3V1WA 1VRSD 2YWOA 2CAQA 3OR5A 2IL3A 1PX7A 1JZDA 3ZVJD 2KHPA 2VCTA 1T8EB 3GURA 5DCGA 4GRFA 4F9ZA 3IHQA 1YDKA 5F07A 1KBNA 3J7Yb 2FY6A 2AHEA 2B1KA 3G7YA 1AC1A 4QL7A 1WE0A 3APQA 1BX9A 3FYGA 3SBCA 4JBBA 4TR3A 4EE0A 1ZCPA 4I8BA 4HZ4A 5D96A 1T1VA 5J9BA 2L4CA 2P0GA 4POBA 1YY7A 5IPGA 1HNAA 3F6DA 4OCFA 4KDXA 4ECCA 6GSVA 4HI7A 3QMXA 3PINA 1ML6A 5F05A 3HVSA 4FQUA 4GSNA 1M2DA 5A4UA 2DIZA 1AQXA 2GT6A 4MJAA 4NWYA 2VCXA 1XOAA 3IAS2 1GSQA 2JL4A 1A2MA 3UBLA 1UC7A 2IFQA 3I6AA 1A23A 2OA7A 1V40A 2MBTA 1PGTA 1AUCA 1K3YA 4TR4A 3VI7A 2TIRA 3U6VA 1WOUA 5A4VA 1F3BA 3A2WA 1GTBA 3TCOA 1TU8A 5G2ZA 3F0IA 1U88A 2LQOA 5KN2A 4DSRA 3VURA 1N2AA 2M72A 2E2GA 3KIJA 3CTGA 4L5OA 4MPFA 4L8EA 1R5PA 1QMVA 4Q5FA 3QFAC 4WETA 1VF3A 1U87A 3GHAA 1GH2A 4OO5A 5DBQA 2C3TA 1ABAA 4ZBDA 2NVLA 3M0FA 3K8NA 1W4VA 3BCKA 1OKDA 3BJ5A 4RQXA 4J56E 5IM9A 3TJBA 1GSEA 4WEYA 1S3DA 2LQQA 1GWCA 16GSA 3TJKA 4K7IA 3IV4A 5INYA 1PQNA 4IP6A 2B6MA 3N5OA 2JADA 1VGLA 1SYRA 2NDOA 5KN1A 2GQKA 4X0XA 3F4SA 2GGTA 3MWHA 4IP1A 4MA9A 2B5XA 2H66A 3ME7A 3IK7A 2WGRA 1M0UA 3F8UA 4PNGA 2OE3A 5D73A 2I9HA 2QKEA 3E3EA 2DJ2A 5L71A 3FZ9A 1WIKA 4NAXA 2GS3A 1J0FA 2VIMA 4ECIA 5DQSA 2VLUA 2NPBA 2VM1A 5ECSA 4XRAA 3KJYA 1JFUA 4XS4A 4RQRA 1CQHA 4G0KA 1GNEA 3P8WA 14GSA 3D0ZA 4XRDA 2YNXA 4QL9A 4F03A 2CX3A 2QC7A 3GYKA 5ID2B 5FHIA 4PTSA 1THOA 4GQFA 2GZYA 1HNCA 1M99A 4GSSA 4TVEA 1O81A 1U3AA 4KCAA 3TGZA 3KMNA 5D9WA 6GSYA 3RPPA 4MZBA 4PNFA 3WD6A 5B6MA 4J2FA 3HXSA 3FK8A 2GSTA 2VD0A 1SL2B 5J3RA 3WGXA 5A4WA 2JZRA 4CHSA 8GSSA 3VK9A 4TN8A 2WZ9A 3P90A 2IMEA 3GX0A 5AN1A 6GSSA 2LRCA 2FNOA 2N5AA 1EEMA 2HSYA 2I3YA 1J08A 4OFTA 1XWBA 5FT3A 4I2TA 4LL4B 2DSAA 3IRAA 4LA1A 2LTKA 4O92A 5HFGA 1A2JA 4K7NA 3KM6A 1SK1A 4EL1A 4K9ZA 4G2EA 1TRUA 2QSIA 1Q98A 4I2UA 4POLA 2IIYA 4JRRA 5DALB 3Q18A 4POKA 2GSRA 4MP4A 5G30A 3H8QA 1FO5A 2NBSA 3IR4A 4OFNA 4H86A 4F2IA 2F8FA 3IA1A 5CAXA 2HSHA 4WF5A 2H30A 3EVIA 1SKSB 4WXTA 1BAYA 2LRNA 5B8BA 3PGTA 2IWTA 3EU4A 5DJMA 1MEKA 2HSMA 4G9HA 3CBUA 2ZNMA 5DCHA 1G6YA 1MD3A 1X9WB 1GUKA 1FVKA 1URMA 4ZL8A 3WT1A 1WRYA 4MABA 3LEFA 4I5QA 4G10A 4CW9A 5KN0A 3ZMLA 1YKCA 5G1KA 1B8XA 4OWYA 2PN8A 19GSA 1AQWA 4V1Ap 2V32A 3VWWA 1AQVA 2FUG2 2A2SA 1EWXA 4GCIA 4DSSA 5HFKA 2R2JA 4E8EA 2V41A 3VWVA 1ERVA 5JWQB 3F63A 4YAVA 1QFNA 3TKQA 1SU9A 1FVJA 3L0HA 3LFLA 4WBJA 1BYEA 2B1LA 6GSWA 2OBKA 1ZZYA 1T4YA 1R7HA 2V2GA 4K6XA 1FW1A 5E59A 2GZZA 3QDNA 3G7JA 2OE0A 4TXOA 1GP1A 1XWAA 4ISDA 2H6YA 1O6JA 3NIVA 4MCUA 4N11A 1K0CA 3NOFA 2VL2A 3QAVA 5DAKB 1TKDB 3GKXA 3FR6A 2V6KA 2GVPA 1TK8B 2I1UA 4K8MA 1XOBA 4TKYA 3M8NA 2YN1A 4ILFA 2AYTA 4HJMA 3D6IA 1FG4A 4BVYB 1XW6A 3DMLA 5ECLB 3UAPA 2XBQA 2ON7A 2P5RA 4OMVA 4V2MA 3C8EA 1A8LA 1MDKA 1T7PB 2AAWA 2CT6A 4TW5A 3EURA 3GN3A 2C1YA 1NSWA 2A2RA 3ZZXA 1K0AA 1T4ZA 1V57A 3TB2A 3A2VA 2Z9SA 4ZL7A 4ID0A 4KUNA 4PUFC 5G1LA 3LGCA 5F06A 2A4VA 5ELGA 1SK2A 1WMJA 3ERGA 1LU4A 3GL3A 1XIYA 2I4AA 3TUEA 4DSSB 1O8WA 2B5EA 3ZL5A 2DJ0A 2H19A 3VFIA 20GSA 2DMLA 2K18A 1TI3A 2I81A 3F3QA 5EY6A 1SL0B 1THXA 2F3MA 2RM6A 4LLRA 4YAPA 3GFKA 4MK3A 4KB3A 4NPBA 3Q19A 4IBPA 4ECBA 3HHVA 2JU5A 1KTEA 4ML6A 4KDYA 2H71A 1TTZA 4OO4A 1H4OA 3DIEA 3QR6A 3UL3A 1GLPA 1IYHA 1XWCA 1FOVA 5JCGA 1TI1A 3TKSA 4ZILA 1A24A 1GULA 3P2AA 3UBKA 1NHOA 9GSSA 3WGEA 4AJ6A 2KP1A 1R5AA 3W8JA 5B6NA 2L5LA 5H5SA 2KOKA 2YWNA 2FLSA 3KTLA 3W8SA 3WT2A 3UJ1A 4OD7A 2B5YA 4WR4A 4HQSA 3TRXA 4IELA 2HRAA 2LJAA 2VL2C 4HU7A 5B8AA 1A0FA 4FYUA 1XCCA 5HQPA 2X8CA 4MZCA 4G19A 1E2YA 3M1GA 1YEPA 4FYBA 1C72A 1EV4A 2REMA 4DSQA 3D21A 2JSZA 3U5RE 1ZOFA 2IPAA 2FD3A 1GSFA 2R3XA 3DRNA 3FHKA 3PH9A 1PX6A 3QCPA 3MNGA 3FZ4A 3L9VA 1GLQA 4N0VA 5A5KA 2MZCA 1LBKA 1BQ7A 4ML1A 1HD2A 2OBIA 2CZ2A 3ZTLA 3ZFBA 5GAPD 2H72A 1PKWA 1YQ1A 3KP8A 3CSHA 2G0FA 3HD5A 1OVNA 2H73A 3CSIA 2IMFA 3ZLPA 1F3AA 2HZEB 4K1FA 3H1NA 4YQUA 4N0ZA 3MDKA 4XIHA 1V98A 3JCML 2EIRA 2C8UA 5ECIB 1R26A 3C1SA 5ECQB 3TRQA 1GSSA 2RIIA 4RUVA 3KXOA 5GZZB 2F8AA 4EUYA 5G5FA 5EPFA 2H0HA 3C73A 2RUEA 1SD9A 1F37A 2F51A 1TRWA 1QXHA 2YPMA 3CYNA 3ZYWA 4PQIA 4HUAA 2H6XA 2OE1A 1PA3A 4IHUA 3A5WA 2AB6A 4PURA 4JE1A 3KZQA 4PUAA 1WJKA 1X5DA 22GSA 2HRKA 1GSYA 2LNSA 4MH3A 3TKSC 7GSSA 3TJGA 3EWLA 5IOXA 2C3QA 1V58A 2YWIA 2BTOT 5ECNB 3GKNA 3UEMA 3LG6A 1VF2A 4Z7XA 3FR9A 4P3YB 2VL3A 3HYPA 1KNGA 5JCWA 2PVQA 4O32A 3FKFA 3I69A 3D4TA 2JZTA 2F9SA 1JZWA 3VWUA 1CQGA 1M9AA 4HU9A 3EINA 3AY8A 1TU7A 3O76A 1EGRA 1DE2A 3DD3A 4MH2A 2CZ3A 1A8YA 3O6TA 4N30A 4JR6A 2FWHA 2IFQB 1XXUA 2CX4A 1F2EA 3I43A 1OAZA 4PXOA 1FAAA 4D73A 1QGVA 4J57E 2VOCA 5C04A 2GSQA 5ECPB 2YOIA 2H74A 3KD0A 4IW9A 4FYCA 4MF7A 5CRDA 2P5QA 3KMOA 4ZXGA 2PUKC 4XTSA 1UN2A 5CO3A 3FRCA 1MDJA 4ZB6A 2GLRA 5ECOB 1MTCA 1PL1A 2K8VA 2VCQA 5ECKB 4L0UA 5H5RA 3L9SA 2O7KA 2O85A 5GSTA 4HJ2A 2BJXA 4WF4A 4LMWA 2HRKB 2N5BA 1Z6NA 2V1MA 1GL8A 4MMMA 1O7UA 3LJRA 3HJMA 1Z5YE 2YWMA 1ERWA 3GA4A 3RAZA 2HNLA 2C0GA 4IQAA 1ON4A 1SYXA 4ZBAA 2G2QA 4G0IA 3LORA 2R6KA 3VPQA 3APSA 3NZNA 1QUWA 2H8LA 4BVXA 4MDCA 4ZBBA 1Z6MA 3LSZA 4EDYA 1SJ6A 2XPDA 4TR1A 3ME8A 2X64A 4JZQA 2C80A 5D9TA 3F6FA 3TDGA 1SJIA 4V2NA 1EP7A 2DBCA 4GF0A 4MF5A 4L0WA 1KEBA 2WJUA 2C0DA 3GH6A 3KCMA 3D5JA 1ZYQB 2L6CA 1M2AA 2NTOA 3A2XA 5J4UA 3RHBA 3ZVJA 1V2AA 4XS4B 2XPEA 4OCEA 1GSDA 3H93A 5ENUA 2R5GA 3H79A 2WFCA 2IMIA 3PR8A 1OC9A 3MAKA 4KF9A 3BD2A 3M3MA 2GDRA 1ERUA 1LJRA 4LMVA 3ZREA 1U3IA 3C1RA 3IDVA 3ZMKA 5LCZA 2EIQA 1Z9HA 1ACVA 4N10A 3VPTA 2GQLA 4NMUA 5CP1A 3TJJA 2DC5A 2FHEA 1U6TA 4I97A 1XFLA 2XHFA 5D9VA 5G5EA 6GSXA 2EC4A 2L57A 2YJ7A 1VF4A 2C0EA 2J9HA 4V1Ag 3EMPA 2X99A 3GTUA 1B4QA 1XPVA 4IKHA 1K3OA 4BL7A 4TRXA 1ILOA 1M9BA 4JU5A 1K0DA 2CAIA 3M9KA 4YQMA 4AJ8A 3HCZA 4NHZA 2DJKA 1WP0A 3UIWA 3FW2A 4EF0A 1B9YC 1B4PA 3HZ8A 2O87A 2VCWA 3FR3A 2ES7A 4ZL9A 5AGYA 3VI5A 2DIYA 1R4WA 1TRSA 1FB0A 2B7KA 4IN0A 5JWRB 3EE2A 4K2DA 1SENA 2PBJA 1TW9A 1PD21 3UVHA 4IJ3A 2YJHA 1XW5A 5EL8A 3US3A 4XHMA 3UARA 2CA8A 3N9JA 3RDWA 4WR5A 1PSQA 1X9MB 1B9XC 2TRCP 5IMDA 4KX4A 4HQZA 4DVCA 4BPYA 2H6ZA 1AW9A 1K0NA 2OACA 5DJLA 2HE3A 2HSMB 1O85A 3F4RA 5IMVA 5BMUA 2LKUA 3R2QA 1I9DA 5ELAA 3HDCA 4KGIA 3IPZA 2C4JA 3CRTA 1AIUA 1IYIA 3C71A 4F0BA 5HR0A 3C7MA 2M46A 1K3LA 2K9FA 1EEJA 2VM2A 4EVMA 5AISA 3HVXA 2VCZA 1H75A 1OKTA 4TOPA 5B7CA 1DBYA 3KP9A 2GQMA 4FO5A 1DSBA 1SL1B 4JEDA 5J5NA 1DE1A 3DGQA 3IC4A 2WULA 2K6VA 2FWEA 2L5OA 2IMKA 3D22A 3APOA 2HRNA 1OC3A 3L78A 1F6MC 4K0GA 4XCSA 3IBHA 1XVQA 2VL9A 3GKKA 1PMTA 3TRPA 2P31A 1UVZA 1FB6A 1RW1A 3KH7A 3RPNA 2LNTA 5JCUA 5G31A 2LRTA 4TXOB 3Q6OA 5CRWA 5CRGA 3QPMA 3GSSA 5IOWA 4HOJA 2PGTA 5LD0A 3GKMA 4NXIA 2KP2A 1YF0A 4IGJA 4ZB9A 1OE7A 1BG5A 3BBYA 5HR3A 5CYYA 5ECHB 1MD4A 1O73A 2V6OA 4V2LA 1X0RA 3HJOA 4CDOA 4KE3A 3QD9A 4GXZA 2FWFA 3QAGA 4YH2A 1OC8A 3IK9A 2CVKA 3TKPA 2XC2A 2GZPA 3IC8A 3P7XA 4JR4A 3WYWA 2L6DA 4FIWA 1JZOA 5ECRB 2HLSA 1T00A 1K0MA 4X43A 2H01A 3DWVA 3QFBC 1AAZA 2OADA 1Q4JA 1EP8A 3FZ5A 3G7IA 5CRHA 1VF1A 1BJXA 1XW9A 4ULXA 5GSSA 3S9FA 1GUHA
chains in the Genus database with same CATH superfamily
3M9JA 4YQVA 1NHYA 2MMZA 4K5RA 2WZSA 3BCIA 4KW6A 3GIXA 5AIXA 2H1BA 5IMAA 3LXZA 2AV4A 4F0CA 5E4WA 3HA9A 4E68A 1XG8A 2B3SA 5J4VA 1YKAA 5GAND 1TRVA 2VLTA 3RFRC 2HQTA 1QK8A 1X9SB 2OJLA 2XBIA 5ECMB 4A5PA 2FGXA 4GSTA 2CVBA 4TR0A 1XBSA 1B48A 3GUSA 2MMOA 2RM5A 4ZB8A 1HQOA 2E2MA 2HZFA 3E0UA 1TXXA 2H70A 1EZKA 2H0GA 3ED3A 3EC3A 3GH9A 2EIOA 3VLNA 4ECJA 4HZ2A 3F4TA 4DEJA 3L9UA 4TXVA 4G0LA 1M7TA 2CQ9A 4KA0A 3ERFA 3FY7A 3EU3A 5LNKe 5COHA 2R37A 4QQ7A 1G7EA 2GSSA 3CTFA 5F0GA 1PN0A 5A5HA 5ID2A 2LUSA 2B7JA 2K8SA 5C00A 4BWQA 4X1UA 3ZIJA 2RLIA 5BRTA 2L59A 1SKRB 3GRXA 3DVXA 1V9WA 3F3RA 6GSTA 1I5GA 2GT5A 2WCIA 4MPGA 4OFMA 4KSOA 4MF6A 4XS1A 4USSA 3IOSA 4NV5A 2HXKA 3E9JB 1XWKA 5D8IA 3WGDA 18GSA 4FH8A 3LYKA 4L5LA 4KSMA 2ZUPA 5A34B 2A4HA 1A0RP 1SK0A 4K0NA 3HY2A 2GTUA 2WW1A 3W6GA 4PGTA 2C0FA 5D93A 2MMAA 4Q5QA 2H75A 2ZCTA 2PMTA 3GV1A 3BOAA 5AIVA 3D4MA 4Z2RA 2O8VB 4IS0A 2QGVA 2VO4A 4GLTA 3TKSE 4ZIJA 2O5VA 4IQ1A 3KH9A 1QQ2A 3RHCA 1Z7RA 3LYPA 4PQ1A 1TJDA 2CV4A 4E8HA 3TKRA 1NW2A 1AXDA 4EKZA 1PRXA 5DALA 2VUPA 2IN3A 2IJYA 1O8XA 3QAWA 1UA5A 3CWGA 2HYXA 1JLWA 5FWGA 1E6BA 2N5FA 3ZRDA 4EC0A 2HRFA 2R0CA 4RI7A 4GWRA 4AGSA 5DQYA 1RK4A 4G01A 4O7HA 5D9XA 4ACSA 3UVTA 4K5SA 3EPTA 2MMNA 2VLVA 2R0GA 2AUVA 1W89A 3FZAA 3TOTA 3KTBA 2BMXA 4KAEA 3CMIA 4EDZA 1BEDA 1Y6EA 2ON5A 3LQ7A 1SVMA 1X5CA 1PL2A 1YZXA 2PVOC 3KEBA 3ERWA 3RGBC 2H1AA 2YV9A 2CVDA 6GSUA 3TJFA 4IVFA 1N8JA 5IQYA 1XWGA 4YKFA 2E0QA 1F9MA 2YZUA 1YJ6A 1NM3A 3I9V2 1JLVA 1G0TA 3Q74A 2YZHA 2LEGA 1TK0B 5HR1A 1JZRA 3GMFA 4PQHA 2DMMA 5IMFA 3HZ4A 3RBTA 2C3NA 3EYTA 4D73B 3G9BA 2YP6A 5IO2A 2LV3A 5IPHA 1HNBA 1TXUA 3LWAA 4BA7A 1PN9A 2M80A 5KEJA 5IIZA 1GTUA 3ZIVA 12GSA 2VCVA 2L4QA 2J23A 2HI7A 3UOMA 2LSTA 2HFDA 3L4NA 3HJPA 1ZGNA 5HFIA 1SJZA 4QMKA 3A3TA 1SKWB 2E7PA 2YV7A 2R0PA 2RUFA 1TK5B 1GUMA 3PPUA 5DAKA 5DDLA 3IXRA 1TOFA 2DJJA 3GL5A 5ABRA 4KCEA 4MNNA 1FHEA 4BVYA 1FOHA 1YF1A 2VKZG 1JHBA 11GSA 1SVOA 4HEA2 4MJBA 2WVXB 1A2LA 1S3RA 1Z7PA 4O5RA 3IE3A 1EOHA 4F82A 1TDIA 3DXBA 5KN3A 5IMCA 2PERA 5A1NB 1Z3EA 4BVXB 2WB9A 5KOXA 3ZFLA 3F9UA 4TR1B 2MYGA 4X4JA 2FA4A 1M3IA 1EV9A 1RQMA 5JWOB 4Q5NA 2OKAA 1ZMAA 3MSZA 3HVVA 2VD1A 4RI6A 4EXJA 2IMDA 5CREA 1EOGA 2WS2A 1WWJA 2PU9C 1XZOA 1HYUA 1BF5A 4MLYA 1Y25A 5EVOA 1DUGA 17GSA 2HSNB 1S3CA 2DJ3A 4GQCA 1GTAA 2WDUA 1T3BA 2UZ8A 1BG1A 4AI6A 3J7Yk 4N3ZA 4NV2A 1EGOA 5HR2A 3GX8A 2FWGA 4HDEA 1GSUA 1WPIA 1OC9B 1TP9A 1X5EA 1PKZA 2HT9A 3CXGA 4HS1A 3LXTA 4AKGA 3H4KA 1YEWC 2O89A 4AF2A 3GNJA 4POMA 4WKWA 2WW3A 13GSA 2R4VA 4WBRD 4XS6A 2H76A 2AJQB 2ALBA 1OYJA 5J41A 1ZYNA 3SWLA 2YANA 4MJCA 2DLXA 3GSTA 4PX1A 3KGKA 3DEXA 2MBSA 3UMAA 3CRUA 2JSYA 3GTUB 2JZSA 4BL7B 4NHWA 5H5QA 5CNWA 1GRXA 3CSJA 3ISOA 4MZWA 4K7OA 3R3EA 2LS5A 3QOUA 1SD8A 2LJRA 5KOWA 1ZYEA 2WRTA 4GTUA 4IJIA 5IO0A 5IMZA 2X49A 1ZL9A 4BWSA 2PPTA 2PWJA 4KH7A 5F8BA 3HKRA 2DJ1A 10GSA 1ST9A 2X8GA 1GNWA 2KLXA 2FA8A 1J9BA 3DYRA 1S3AA 1G7OA 2KUCA 2LJKA 4LL1B 3ZITA 1K0OA 3TOUA 1YEXA 3VWXA 1USBA 4MJEA 2D2ZA 1MDIA 3DKSA 3FEUA 3EMXA 1GTIA 1ERTA 4EO3A 2HZEA 4KDUA 1G6WA 3IAM2 2H1GA 4I6XA 3DVWA 4Q5RA 3O3TA 1XVWA 2H0IA 1OE8A 4KNDA 2H1DA 2FCHA 5BMUB 5DVBA 4AJ7A 2YCDA 1M2BA 2JACA 2X8HA 5J9CA 1K0BA 2TRXA 2VAFA 3V1WA 3MIXA 1VRSD 2YWOA 2CAQA 3OR5A 2IL3A 1PX7A 1JZDA 3ZVJD 2KHPA 2VCTA 1T8EB 3GURA 5DCGA 4PI0C 4GRFA 4F9ZA 3IHQA 1YDKA 5F07A 1KBNA 3J7Yb 2FY6A 2AHEA 2B1KA 3G7YA 1AC1A 4QL7A 1WE0A 3APQA 1BX9A 3FYGA 3SBCA 4JBBA 4TR3A 4EE0A 1ZCPA 4I8BA 4HZ4A 5D96A 1T1VA 5J9BA 2L4CA 2P0GA 4POBA 1YY7A 5IPGA 1HNAA 3F6DA 4OCFA 4KDXA 4ECCA 6GSVA 4HI7A 3QMXA 3PINA 1ML6A 5F05A 3HVSA 4FQUA 4GSNA 1M2DA 5A4UA 2DIZA 1AQXA 2GT6A 4MJAA 4NWYA 2VCXA 1XOAA 3IAS2 1GSQA 2JL4A 1A2MA 3UBLA 1UC7A 2IFQA 3I6AA 1A23A 2OA7A 2EFCA 4O5UA 1V40A 2MBTA 1PGTA 1AUCA 1K3YA 4TR4A 3VI7A 2TIRA 3U6VA 1WOUA 5A4VA 1F3BA 3A2WA 1GTBA 2UV8G 3TCOA 1TU8A 5G2ZA 3F0IA 1U88A 2LQOA 5KN2A 4DSRA 3VURA 1N2AA 2M72A 2E2GA 3KIJA 3CTGA 4L5OA 4MPFA 4L8EA 1R5PA 1QMVA 4Q5FA 3QFAC 4WETA 1VF3A 1U87A 3GHAA 4O5QA 1GH2A 4OO5A 5DBQA 2C3TA 1ABAA 4ZBDA 2NVLA 3M0FA 3K8NA 2O36A 1W4VA 3BCKA 1OKDA 3BJ5A 4RQXA 4J56E 5IM9A 3TJBA 1GSEA 3HVNA 4WEYA 1S3DA 2LQQA 1GWCA 16GSA 2EFEA 3TJKA 2OT3A 4K7IA 3IV4A 5INYA 1PQNA 4IP6A 2B6MA 3N5OA 2JADA 1VGLA 1SYRA 2NDOA 5KN1A 2GQKA 4X0XA 3F4SA 2GGTA 3MWHA 4IP1A 4MA9A 2B5XA 2H66A 3ME7A 3IK7A 2WGRA 1M0UA 3F8UA 4PNGA 2OE3A 5D73A 2I9HA 2QKEA 3E3EA 2DJ2A 5L71A 3FZ9A 1WIKA 4NAXA 2GS3A 1J0FA 2VIMA 4ECIA 5DQSA 2VLUA 2NPBA 2VM1A 5J40A 5ECSA 2QA1A 4XRAA 3KJYA 1JFUA 4XS4A 4RQRA 1CQHA 4G0KA 1GNEA 3P8WA 14GSA 3D0ZA 4XRDA 5A5HB 2YNXA 4QL9A 4F03A 2CX3A 2QC7A 3GYKA 5ID2B 5FHIA 1I1IP 4PTSA 1THOA 4GQFA 2GZYA 1HNCA 1M99A 4GSSA 4TVEA 1O81A 1U3AA 4KCAA 3TGZA 3KMNA 5D9WA 6GSYA 3RPPA 4MZBA 4PNFA 3WD6A 5B6MA 4J2FA 3HXSA 3FK8A 2GSTA 2VD0A 1SL2B 5J3RA 3WGXA 5A4WA 2JZRA 4CHSA 8GSSA 3VK9A 4TN8A 2WZ9A 3P90A 2IMEA 3GX0A 5AN1A 6GSSA 2LRCA 2FNOA 2N5AA 1EEMA 2HSYA 2I3YA 1J08A 4OFTA 1XWBA 5FT3A 4I2TA 4LL4B 2DSAA 3IRAA 4LA1A 2LTKA 4O92A 5HFGA 1A2JA 4K2XA 4K7NA 3KM6A 1SK1A 4EL1A 4K9ZA 4G2EA 1TRUA 2QSIA 1Q98A 4I2UA 4POLA 2IIYA 4JRRA 5DALB 3Q18A 4POKA 2GSRA 4MP4A 5G30A 3H8QA 1FO5A 2NBSA 3IR4A 4OFNA 4H86A 4F2IA 2F8FA 3IA1A 5CAXA 2HSHA 4WF5A 2H30A 3EVIA 1SKSB 4WXTA 1BAYA 2LRNA 5B8BA 3PGTA 2IWTA 3EU4A 5DJMA 1MEKA 2HSMA 4G9HA 3CBUA 2ZNMA 5DCHA 1G6YA 1MD3A 1X9WB 1GUKA 1FVKA 1URMA 4ZL8A 3WT1A 1WRYA 4MABA 3LEFA 4I5QA 4G10A 4CW9A 5KN0A 2WVZA 3ZMLA 1YKCA 5G1KA 1B8XA 4OWYA 2PN8A 19GSA 1AQWA 4V1Ap 2V32A 3VWWA 1AQVA 2FUG2 2A2SA 1EWXA 4GCIA 4DSSA 5HFKA 2R2JA 4CY6A 4E8EA 2V41A 3VWVA 1ERVA 5JWQB 3F63A 4YAVA 1QFNA 3TKQA 1SU9A 1FVJA 3L0HA 3LFLA 4WBJA 1BYEA 2B1LA 6GSWA 2OBKA 1ZZYA 1T4YA 1R7HA 2V2GA 4K6XA 1FW1A 5E59A 2GZZA 3QDNA 3G7JA 4EIQA 2OE0A 4TXOA 1GP1A 1XWAA 4ISDA 2H6YA 1O6JA 4Z2TA 3NIVA 4MCUA 4N11A 1K0CA 3NOFA 2VL2A 3QAVA 5DAKB 1TKDB 3GKXA 3FR6A 2V6KA 2GVPA 1TK8B 2I1UA 4K8MA 1XOBA 4TKYA 3M8NA 2YN1A 4ILFA 2AYTA 4HJMA 3D6IA 1FG4A 4BVYB 1XW6A 3DMLA 5ECLB 3UAPA 2XBQA 2ON7A 2P5RA 2X4AA 4OMVA 4V2MA 3C8EA 1A8LA 1MDKA 1T7PB 2AAWA 2CT6A 3TU3B 4TW5A 3EURA 3GN3A 2C1YA 1NSWA 2A2RA 3ZZXA 1K0AA 1T4ZA 1V57A 3TB2A 3A2VA 2WW0A 3MYDA 3CHXC 2Z9SA 4ZL7A 4ID0A 4KUNA 4PUFC 5G1LA 3LGCA 5F06A 2A4VA 5ELGA 1SK2A 1WMJA 3ERGA 1LU4A 3GL3A 1XIYA 2I4AA 3TUEA 4DSSB 1O8WA 2B5EA 3ZL5A 2DJ0A 2H19A 3VFIA 20GSA 2DMLA 2K18A 1TI3A 2I81A 3F3QA 5EY6A 1SL0B 1THXA 2F3MA 2RM6A 4LLRA 4YAPA 3GFKA 4MK3A 4KB3A 4NPBA 3Q19A 4IBPA 4ECBA 3HHVA 2JU5A 1KTEA 4ML6A 4KDYA 2H71A 2O3EA 1TTZA 4OO4A 1H4OA 3DIEA 3QR6A 3UL3A 1GLPA 3HMJG 1IYHA 1XWCA 1FOVA 5JCGA 1TI1A 3TKSA 4ZILA 1A24A 1GULA 3P2AA 3UBKA 1NHOA 9GSSA 3WGEA 4AJ6A 2KP1A 1R5AA 4W66A 3W8JA 5B6NA 2L5LA 5H5SA 2KOKA 2YWNA 2FLSA 3KTLA 3W8SA 3WT2A 3UJ1A 4OD7A 2B5YA 4WR4A 4HQSA 3TRXA 4IELA 2HRAA 2LJAA 2VL2C 4HU7A 5B8AA 1A0FA 4FYUA 1XCCA 5HQPA 2X8CA 4MZCA 4G19A 1E2YA 3M1GA 1YEPA 4FYBA 1C72A 1EV4A 2REMA 4DSQA 3D21A 2JSZA 3U5RE 4AKXB 1ZOFA 2IPAA 2FD3A 1GSFA 2R3XA 3DRNA 3FHKA 3PH9A 1PX6A 3QCPA 3MNGA 3FZ4A 3L9VA 1GLQA 4N0VA 5A5KA 2MZCA 1LBKA 1BQ7A 4ML1A 1HD2A 2OBIA 2CZ2A 3ZTLA 3ZFBA 5GAPD 2H72A 1PKWA 5A34A 1YQ1A 3CSHA 3HD5A 2G0FA 3KP8A 1OVNA 2H73A 3CSIA 2IMFA 3ZLPA 1S4BP 1F3AA 2HZEB 4K1FA 3H1NA 4YQUA 4N0ZA 3MDKA 4XIHA 1V98A 3JCML 2EIRA 2C8UA 5ECIB 1R26A 3C1SA 5ECQB 3TRQA 1GSSA 2RIIA 4RUVA 4YKGA 3KXOA 5GZZB 2F8AA 4EUYA 5G5FA 5EPFA 2H0HA 3C73A 2RUEA 1SD9A 1F37A 2F51A 1TRWA 1QXHA 2YPMA 3CYNA 3ZYWA 4PQIA 4HUAA 2H6XA 4AKIA 2OE1A 1PA3A 4IHUA 3A5WA 2AB6A 4PURA 4JE1A 3KZQA 4PUAA 1WJKA 1X5DA 22GSA 2HRKA 1GSYA 2LNSA 4MH3A 3TKSC 7GSSA 3TJGA 3EWLA 5IOXA 2C3QA 1V58A 2YWIA 4PI2C 2BTOT 5ECNB 3GKNA 3UEMA 3LG6A 1VF2A 4Z7XA 3FR9A 4P3YB 2VL3A 3HYPA 1KNGA 5JCWA 2PVQA 4O32A 3FKFA 3I69A 3D4TA 2JZTA 2F9SA 4PHZC 1JZWA 3VWUA 1CQGA 1M9AA 2QA2A 4HU9A 3EINA 3AY8A 1TU7A 3O76A 1EGRA 1DE2A 3DD3A 4MH2A 2CZ3A 1A8YA 3O6TA 4N30A 4JR6A 2FWHA 2IFQB 1XXUA 2CX4A 1F2EA 3I43A 1OAZA 4PXOA 1FAAA 4D73A 1QGVA 2DKIA 4J57E 2VOCA 5C04A 2GSQA 5ECPB 2YOIA 2H74A 3KD0A 4IW9A 4FYCA 4MF7A 5CRDA 2P5QA 3KMOA 4ZXGA 2PUKC 4XTSA 1UN2A 5CO3A 3FRCA 1PFOA 1MDJA 4ZB6A 2GLRA 5ECOB 1MTCA 1PL1A 2K8VA 1M3JA 2VCQA 5ECKB 4L0UA 5H5RA 3L9SA 2O7KA 2O85A 5GSTA 4HJ2A 2BJXA 4WF4A 4LMWA 2HRKB 2N5BA 1Z6NA 2V1MA 1GL8A 4MMMA 1O7UA 3LJRA 3HJMA 1Z5YE 2YWMA 1ERWA 2WW2A 3GA4A 3RAZA 2HNLA 2C0GA 4BIKA 2WVXA 4IQAA 1ON4A 1SYXA 4ZBAA 2G2QA 4G0IA 3LORA 2R6KA 3VPQA 3APSA 4EIPA 3NZNA 1QUWA 2H8LA 5A1NA 4BVXA 4MDCA 4ZBBA 1Z6MA 3LSZA 4EDYA 1SJ6A 2XPDA 4TR1A 3ME8A 2X64A 4JZQA 2C80A 5D9TA 3F6FA 3TDGA 3LW9A 1SJIA 4V2NA 4ZB7A 1EP7A 2DBCA 4GF0A 4MF5A 4L0WA 1KEBA 2WJUA 2C0DA 3A5IA 3GH6A 3KCMA 3D5JA 1ZYQB 2L6CA 1M2AA 2HSNA 2NTOA 3A2XA 5J4UA 3RHBA 3ZVJA 1V2AA 1ZYPA 4XS4B 4GDFA 2EFHA 2XPEA 4OCEA 1GSDA 3H93A 5ENUA 2R5GA 3H79A 1Y1UA 2WFCA 2IMIA 3PR8A 1OC9A 3MAKA 4KF9A 3BD2A 3M3MA 2GDRA 1ERUA 1LJRA 4LMVA 3ZREA 1U3IA 3C1RA 3IDVA 3ZMKA 5LCZA 2EIQA 1Z9HA 1ACVA 4N10A 3VPTA 2GQLA 4NMUA 5CP1A 3TJJA 2DC5A 2FHEA 1U6TA 4I97A 1XFLA 2XHFA 5D9VA 5G5EA 6GSXA 4FXYP 2EC4A 2L57A 2YJ7A 1VF4A 2C0EA 2J9HA 4V1Ag 3EMPA 1SVLA 2X99A 3GTUA 1B4QA 1XPVA 4IKHA 1K3OA 4BL7A 4TRXA 1ILOA 1M9BA 4JU5A 1K0DA 2CAIA 3M9KA 4YQMA 4AJ8A 3HCZA 4NHZA 2DJKA 1WP0A 3UIWA 3FW2A 4EF0A 2DKHA 1B9YC 1B4PA 3HZ8A 2EFDA 2O87A 2VCWA 3FR3A 2ES7A 4ZL9A 5AGYA 3VI5A 2DIYA 1R4WA 1TRSA 1FB0A 2B7KA 4IN0A 5JWRB 3EE2A 4K2DA 1SENA 2PBJA 1TW9A 1PD21 3UVHA 4IJ3A 2YJHA 1XW5A 5EL8A 3US3A 4XHMA 3UARA 4Z2UA 2CA8A 3N9JA 3RDWA 4WR5A 1PSQA 1X9MB 1B9XC 2TRCP 5IMDA 4KX4A 4HQZA 4DVCA 4BPYA 2H6ZA 1AW9A 1K0NA 5J4YA 2OACA 5DJLA 2HE3A 2HSMB 1O85A 3F4RA 5IMVA 5BMUA 2LKUA 3R2QA 1I9DA 3HDCA 5ELAA 5J47A 4KGIA 3IPZA 2C4JA 3CRTA 4AKHA 1AIUA 1IYIA 3C71A 4F0BA 5HR0A 3C7MA 2M46A 1K3LA 2K9FA 1EEJA 2VM2A 2WVYA 4EVMA 5AISA 3HVXA 2VCZA 1H75A 1OKTA 4TOPA 5B7CA 3FMWA 1DBYA 1N25A 3KP9A 2GQMA 4FO5A 1DSBA 1SL1B 4JEDA 5J5NA 1DE1A 4HSCX 3IC4A 3DGQA 2WULA 4ICYA 2K6VA 2FWEA 2L5OA 2IMKA 3D22A 3APOA 2HRNA 1OC3A 3L78A 1F6MC 4K0GA 4XCSA 3IBHA 1XVQA 2VL9A 3GKKA 1PMTA 3CQFA 3TRPA 2P31A 1UVZA 2H1LA 1FB6A 1YVLA 1RW1A 3KH7A 3RPNA 2LNTA 5JCUA 5G31A 2LRTA 4TXOB 3Q6OA 5CRWA 5CRGA 3QPMA 3GSSA 3IHGA 5IOWA 4HOJA 2PGTA 5LD0A 3GKMA 4NXIA 2KP2A 1YF0A 4IGJA 4ZB9A 1OE7A 1BG5A 3BBYA 5HR3A 5CYYA 5ECHB 1MD4A 1O73A 2V6OA 4V2LA 1X0RA 3HJOA 4CDOA 4KE3A 3QD9A 4GXZA 2FWFA 3QAGA 4YH2A 1OC8A 3IK9A 2CVKA 3TKPA 2XC2A 2GZPA 3IC8A 2A2PA 3P7XA 4JR4A 3WYWA 2L6DA 4FIWA 1JZOA 5ECRB 2HLSA 1T00A 1K0MA 4X43A 2H01A 3DWVA 3QFBC 1AAZA 2OADA 1Q4JA 1EP8A 3FZ5A 3G7IA 5CRHA 1VF1A 4CY8A 1BJXA 1XW9A 4ULXA 5GSSA 3S9FA 1GUHA
chains in the Genus database with same CATH topology
3M9JA 4YQVA 1NHYA 2MMZA 4K5RA 3BCIA 4KW6A 3GIXA 5AIXA 2H1BA 5IMAA 3LXZA 2AV4A 4F0CA 5E4WA 3HA9A 4E68A 2B3SA 5J4VA 1YKAA 5GAND 1TRVA 2VLTA 2HQTA 1QK8A 1X9SB 2OJLA 2XBIA 5ECMB 4A5PA 2FGXA 4GSTA 2CVBA 4TR0A 1XBSA 1B48A 3GUSA 2MMOA 2RM5A 4ZB8A 1HQOA 2E2MA 2HZFA 3E0UA 1TXXA 2H70A 1EZKA 2H0GA 3ED3A 3EC3A 3GH9A 2EIOA 3VLNA 4ECJA 4HZ2A 3F4TA 4DEJA 3L9UA 4TXVA 4G0LA 1M7TA 2CQ9A 4KA0A 3ERFA 3FY7A 3EU3A 5LNKe 5COHA 2R37A 4QQ7A 1G7EA 2GSSA 3CTFA 5F0GA 1PN0A 5A5HA 5ID2A 2LUSA 2B7JA 2K8SA 5C00A 4BWQA 4X1UA 3ZIJA 2RLIA 5BRTA 2L59A 1SKRB 3GRXA 3DVXA 1V9WA 3F3RA 6GSTA 1I5GA 2GT5A 2WCIA 4MPGA 4OFMA 4KSOA 4MF6A 4XS1A 4USSA 3IOSA 4NV5A 2HXKA 3E9JB 1XWKA 5D8IA 3WGDA 18GSA 4FH8A 3LYKA 4L5LA 4KSMA 2ZUPA 5A34B 2A4HA 1A0RP 1SK0A 4K0NA 3HY2A 2GTUA 3W6GA 4PGTA 2C0FA 5D93A 2MMAA 4Q5QA 2H75A 2ZCTA 2PMTA 3GV1A 3BOAA 5AIVA 3D4MA 4Z2RA 2O8VB 4IS0A 2QGVA 2VO4A 4GLTA 3TKSE 4ZIJA 2O5VA 4IQ1A 3KH9A 1QQ2A 3RHCA 1Z7RA 3LYPA 4PQ1A 1TJDA 2CV4A 4E8HA 3TKRA 1NW2A 1AXDA 4EKZA 1PRXA 5DALA 2VUPA 2IN3A 2IJYA 1O8XA 3QAWA 1UA5A 3CWGA 2HYXA 1JLWA 5FWGA 1E6BA 2N5FA 3ZRDA 4EC0A 2HRFA 2R0CA 4RI7A 4GWRA 4AGSA 5DQYA 1RK4A 4G01A 4O7HA 5D9XA 4ACSA 3UVTA 4K5SA 3EPTA 2MMNA 2VLVA 2R0GA 2AUVA 1W89A 3FZAA 3TOTA 3KTBA 2BMXA 4KAEA 3CMIA 4EDZA 1BEDA 1Y6EA 2ON5A 3LQ7A 1SVMA 1X5CA 1PL2A 1YZXA 2PVOC 3KEBA 3ERWA 2H1AA 2YV9A 2CVDA 6GSUA 3TJFA 4IVFA 1N8JA 5IQYA 1XWGA 4YKFA 2E0QA 1F9MA 2YZUA 1YJ6A 1NM3A 3I9V2 1JLVA 1G0TA 3Q74A 2YZHA 2LEGA 1TK0B 5HR1A 1JZRA 3GMFA 4PQHA 2DMMA 5IMFA 3HZ4A 3RBTA 2C3NA 3EYTA 4D73B 3G9BA 2YP6A 5IO2A 2LV3A 5IPHA 1HNBA 1TXUA 3LWAA 4BA7A 1PN9A 2M80A 5KEJA 5IIZA 1GTUA 3ZIVA 12GSA 2VCVA 2L4QA 2J23A 2HI7A 3UOMA 2LSTA 2HFDA 3L4NA 3HJPA 1ZGNA 5HFIA 1SJZA 4QMKA 3A3TA 1SKWB 2E7PA 2YV7A 2R0PA 2RUFA 1TK5B 1GUMA 3PPUA 5DAKA 5DDLA 3IXRA 1TOFA 2DJJA 3GL5A 5ABRA 4KCEA 4MNNA 1FHEA 4BVYA 1FOHA 1YF1A 2VKZG 1JHBA 11GSA 1SVOA 4HEA2 4MJBA 1A2LA 1Z7PA 4O5RA 3IE3A 1EOHA 4F82A 1TDIA 3DXBA 5KN3A 5IMCA 2PERA 5A1NB 1Z3EA 4BVXB 2WB9A 5KOXA 3ZFLA 3F9UA 4TR1B 2MYGA 4X4JA 2FA4A 1EV9A 1RQMA 5JWOB 4Q5NA 2OKAA 1ZMAA 3MSZA 3HVVA 2VD1A 4RI6A 4EXJA 2IMDA 5CREA 1EOGA 2WS2A 1WWJA 2PU9C 1XZOA 1HYUA 1BF5A 4MLYA 1Y25A 5EVOA 1DUGA 17GSA 2HSNB 1S3CA 2DJ3A 4GQCA 1GTAA 2WDUA 1T3BA 2UZ8A 1BG1A 4AI6A 3J7Yk 4N3ZA 4NV2A 1EGOA 5HR2A 3GX8A 2FWGA 4HDEA 1GSUA 1WPIA 1OC9B 1TP9A 1X5EA 1PKZA 2HT9A 3CXGA 4HS1A 3LXTA 4AKGA 3H4KA 2O89A 4AF2A 3GNJA 4POMA 4WKWA 13GSA 2R4VA 4WBRD 4XS6A 2H76A 2AJQB 2ALBA 1OYJA 5J41A 1ZYNA 3SWLA 2YANA 4MJCA 2DLXA 3GSTA 4PX1A 3KGKA 3DEXA 2MBSA 3UMAA 3CRUA 2JSYA 3GTUB 2JZSA 4BL7B 4NHWA 5H5QA 5CNWA 1GRXA 3CSJA 3ISOA 4MZWA 4K7OA 3R3EA 2LS5A 3QOUA 1SD8A 2LJRA 5KOWA 1ZYEA 2WRTA 4GTUA 4IJIA 5IO0A 5IMZA 2X49A 1ZL9A 4BWSA 2PPTA 2PWJA 4KH7A 5F8BA 3HKRA 2DJ1A 10GSA 1ST9A 2X8GA 1GNWA 2KLXA 2FA8A 1J9BA 3DYRA 1S3AA 1G7OA 2KUCA 2LJKA 4LL1B 3ZITA 1K0OA 3TOUA 1YEXA 3VWXA 1USBA 4MJEA 2D2ZA 1MDIA 3DKSA 3FEUA 3EMXA 1GTIA 1ERTA 4EO3A 2HZEA 4KDUA 1G6WA 3IAM2 2H1GA 4I6XA 3DVWA 4Q5RA 3O3TA 1XVWA 2H0IA 1OE8A 4KNDA 2H1DA 2FCHA 5BMUB 5DVBA 4AJ7A 2YCDA 1M2BA 2JACA 2X8HA 5J9CA 1K0BA 2TRXA 2VAFA 3V1WA 3MIXA 1VRSD 2YWOA 2CAQA 3OR5A 2IL3A 1PX7A 1JZDA 3ZVJD 2KHPA 2VCTA 1T8EB 3GURA 5DCGA 4GRFA 4F9ZA 3IHQA 1YDKA 5F07A 1KBNA 3J7Yb 2FY6A 2AHEA 2B1KA 3G7YA 1AC1A 4QL7A 1WE0A 3APQA 1BX9A 3FYGA 3SBCA 4JBBA 4TR3A 4EE0A 1ZCPA 4I8BA 4HZ4A 5D96A 1T1VA 5J9BA 2L4CA 2P0GA 4POBA 1YY7A 5IPGA 1HNAA 3F6DA 4OCFA 4KDXA 4ECCA 6GSVA 4HI7A 3QMXA 3PINA 1ML6A 5F05A 3HVSA 4FQUA 4GSNA 1M2DA 5A4UA 2DIZA 1AQXA 2GT6A 4MJAA 4NWYA 2VCXA 1XOAA 3IAS2 1GSQA 2JL4A 1A2MA 3UBLA 1UC7A 2IFQA 3I6AA 1A23A 2OA7A 2EFCA 4O5UA 1V40A 2MBTA 1PGTA 1AUCA 1K3YA 4TR4A 3VI7A 2TIRA 3U6VA 1WOUA 5A4VA 1F3BA 3A2WA 1GTBA 2UV8G 3TCOA 1TU8A 5G2ZA 3F0IA 1U88A 2LQOA 5KN2A 4DSRA 3VURA 1N2AA 2M72A 2E2GA 3KIJA 3CTGA 4L5OA 4MPFA 4L8EA 1R5PA 1QMVA 4Q5FA 3QFAC 4WETA 1VF3A 1U87A 3GHAA 4O5QA 1GH2A 4OO5A 5DBQA 2C3TA 1ABAA 4ZBDA 2NVLA 3M0FA 3K8NA 1W4VA 3BCKA 1OKDA 3BJ5A 4RQXA 4J56E 5IM9A 3TJBA 1GSEA 4WEYA 1S3DA 2LQQA 1GWCA 16GSA 2EFEA 3TJKA 2OT3A 4K7IA 3IV4A 5INYA 1PQNA 4IP6A 2B6MA 3N5OA 2JADA 1VGLA 1SYRA 2NDOA 5KN1A 2GQKA 4X0XA 3F4SA 2GGTA 3MWHA 4IP1A 4MA9A 2B5XA 2H66A 3ME7A 3IK7A 2WGRA 1M0UA 3F8UA 4PNGA 2OE3A 5D73A 2I9HA 2QKEA 3E3EA 2DJ2A 5L71A 3FZ9A 1WIKA 4NAXA 2GS3A 1J0FA 2VIMA 4ECIA 5DQSA 2VLUA 2NPBA 2VM1A 5J40A 5ECSA 2QA1A 4XRAA 3KJYA 1JFUA 4XS4A 4RQRA 1CQHA 4G0KA 1GNEA 3P8WA 14GSA 3D0ZA 4XRDA 5A5HB 2YNXA 4QL9A 4F03A 2CX3A 2QC7A 3GYKA 5ID2B 5FHIA 4PTSA 1THOA 4GQFA 2GZYA 1HNCA 1M99A 4GSSA 4TVEA 1O81A 1U3AA 4KCAA 3TGZA 3KMNA 5D9WA 6GSYA 3RPPA 4MZBA 4PNFA 3WD6A 5B6MA 4J2FA 3HXSA 3FK8A 2GSTA 2VD0A 1SL2B 5J3RA 3WGXA 5A4WA 2JZRA 4CHSA 8GSSA 3VK9A 4TN8A 2WZ9A 3P90A 2IMEA 3GX0A 5AN1A 6GSSA 2LRCA 2FNOA 2N5AA 1EEMA 2HSYA 2I3YA 1J08A 4OFTA 1XWBA 5FT3A 4I2TA 4LL4B 2DSAA 3IRAA 4LA1A 2LTKA 4O92A 5HFGA 1A2JA 4K2XA 4K7NA 3KM6A 1SK1A 4EL1A 4K9ZA 4G2EA 1TRUA 2QSIA 1Q98A 4I2UA 4POLA 2IIYA 4JRRA 5DALB 3Q18A 4POKA 2GSRA 4MP4A 5G30A 3H8QA 1FO5A 2NBSA 3IR4A 4OFNA 4H86A 4F2IA 2F8FA 3IA1A 5CAXA 2HSHA 4WF5A 2H30A 3EVIA 1SKSB 4WXTA 1BAYA 2LRNA 5B8BA 3PGTA 2IWTA 3EU4A 5DJMA 1MEKA 2HSMA 4G9HA 3CBUA 2ZNMA 5DCHA 1G6YA 1MD3A 1X9WB 1GUKA 1FVKA 1URMA 4ZL8A 3WT1A 1WRYA 4MABA 3LEFA 4I5QA 4G10A 4CW9A 5KN0A 3ZMLA 1YKCA 5G1KA 1B8XA 4OWYA 2PN8A 19GSA 1AQWA 4V1Ap 2V32A 3VWWA 1AQVA 2FUG2 2A2SA 1EWXA 4GCIA 4DSSA 5HFKA 2R2JA 4CY6A 4E8EA 2V41A 3VWVA 1ERVA 5JWQB 3F63A 4YAVA 1QFNA 3TKQA 1SU9A 1FVJA 3L0HA 3LFLA 4WBJA 1BYEA 2B1LA 6GSWA 2OBKA 1ZZYA 1T4YA 1R7HA 2V2GA 4K6XA 1FW1A 5E59A 2GZZA 3QDNA 3G7JA 4EIQA 2OE0A 4TXOA 1GP1A 1XWAA 4ISDA 2H6YA 1O6JA 4Z2TA 3NIVA 4MCUA 4N11A 1K0CA 3NOFA 2VL2A 3QAVA 5DAKB 1TKDB 3GKXA 3FR6A 2V6KA 2GVPA 1TK8B 2I1UA 4K8MA 1XOBA 4TKYA 3M8NA 2YN1A 4ILFA 2AYTA 4HJMA 3D6IA 1FG4A 4BVYB 1XW6A 3DMLA 5ECLB 3UAPA 2XBQA 2ON7A 2P5RA 2X4AA 4OMVA 4V2MA 3C8EA 1A8LA 1MDKA 1T7PB 2AAWA 2CT6A 3TU3B 4TW5A 3EURA 3GN3A 2C1YA 1NSWA 2A2RA 3ZZXA 1K0AA 1T4ZA 1V57A 3TB2A 3A2VA 3MYDA 2Z9SA 4ZL7A 4ID0A 4KUNA 4PUFC 5G1LA 3LGCA 5F06A 2A4VA 5ELGA 1SK2A 1WMJA 3ERGA 1LU4A 3GL3A 1XIYA 2I4AA 3TUEA 4DSSB 1O8WA 2B5EA 3ZL5A 2DJ0A 2H19A 3VFIA 20GSA 2DMLA 2K18A 1TI3A 2I81A 3F3QA 5EY6A 1SL0B 1THXA 2F3MA 2RM6A 4LLRA 4YAPA 3GFKA 4MK3A 4KB3A 4NPBA 3Q19A 4IBPA 4ECBA 3HHVA 2JU5A 1KTEA 4ML6A 4KDYA 2H71A 1TTZA 4OO4A 1H4OA 3DIEA 3QR6A 3UL3A 1GLPA 3HMJG 1IYHA 1XWCA 1FOVA 5JCGA 1TI1A 3TKSA 4ZILA 1A24A 1GULA 3P2AA 3UBKA 1NHOA 9GSSA 3WGEA 4AJ6A 2KP1A 1R5AA 4W66A 3W8JA 5B6NA 2L5LA 5H5SA 2KOKA 2YWNA 2FLSA 3KTLA 3W8SA 3WT2A 3UJ1A 4OD7A 2B5YA 4WR4A 4HQSA 3TRXA 4IELA 2HRAA 2LJAA 2VL2C 4HU7A 5B8AA 1A0FA 4FYUA 1XCCA 5HQPA 2X8CA 4MZCA 4G19A 1E2YA 3M1GA 1YEPA 4FYBA 1C72A 1EV4A 2REMA 4DSQA 3D21A 2JSZA 3U5RE 4AKXB 1ZOFA 2IPAA 2FD3A 1GSFA 2R3XA 3DRNA 3FHKA 3PH9A 1PX6A 3QCPA 3MNGA 3FZ4A 3L9VA 1GLQA 4N0VA 5A5KA 2MZCA 1LBKA 1BQ7A 4ML1A 1HD2A 2OBIA 2CZ2A 3ZTLA 3ZFBA 5GAPD 2H72A 1PKWA 5A34A 1YQ1A 3KP8A 3CSHA 2G0FA 3HD5A 1OVNA 2H73A 3CSIA 2IMFA 3ZLPA 1F3AA 2HZEB 4K1FA 3H1NA 4YQUA 4N0ZA 3MDKA 4XIHA 1V98A 3JCML 2EIRA 2C8UA 5ECIB 1R26A 3C1SA 5ECQB 3TRQA 1GSSA 2RIIA 4RUVA 4YKGA 3KXOA 5GZZB 2F8AA 4EUYA 5G5FA 5EPFA 2H0HA 3C73A 2RUEA 1SD9A 1F37A 2F51A 1TRWA 1QXHA 2YPMA 3CYNA 3ZYWA 4PQIA 4HUAA 2H6XA 4AKIA 2OE1A 1PA3A 4IHUA 3A5WA 2AB6A 4PURA 4JE1A 3KZQA 4PUAA 1WJKA 1X5DA 22GSA 2HRKA 1GSYA 2LNSA 4MH3A 3TKSC 7GSSA 3TJGA 3EWLA 5IOXA 2C3QA 1V58A 2YWIA 2BTOT 5ECNB 3GKNA 3UEMA 3LG6A 1VF2A 4Z7XA 3FR9A 4P3YB 2VL3A 3HYPA 1KNGA 5JCWA 2PVQA 4O32A 3FKFA 3I69A 3D4TA 2JZTA 2F9SA 1JZWA 3VWUA 1CQGA 1M9AA 2QA2A 4HU9A 3EINA 3AY8A 1TU7A 3O76A 1EGRA 1DE2A 3DD3A 4MH2A 2CZ3A 1A8YA 3O6TA 4N30A 4JR6A 2FWHA 2IFQB 1XXUA 2CX4A 1F2EA 3I43A 1OAZA 4PXOA 1FAAA 4D73A 1QGVA 2DKIA 4J57E 2VOCA 5C04A 2GSQA 5ECPB 2YOIA 2H74A 3KD0A 4IW9A 4FYCA 4MF7A 5CRDA 2P5QA 3KMOA 4ZXGA 2PUKC 4XTSA 1UN2A 5CO3A 3FRCA 1MDJA 4ZB6A 2GLRA 5ECOB 1MTCA 1PL1A 2K8VA 2VCQA 5ECKB 4L0UA 5H5RA 3L9SA 2O7KA 2O85A 5GSTA 4HJ2A 2BJXA 4WF4A 4LMWA 2HRKB 2N5BA 1Z6NA 2V1MA 1GL8A 4MMMA 1O7UA 3LJRA 3HJMA 1Z5YE 2YWMA 1ERWA 3GA4A 3RAZA 2HNLA 2C0GA 4IQAA 1ON4A 1SYXA 4ZBAA 2G2QA 4G0IA 3LORA 2R6KA 3VPQA 3APSA 4EIPA 3NZNA 1QUWA 2H8LA 5A1NA 4BVXA 4MDCA 4ZBBA 1Z6MA 3LSZA 4EDYA 1SJ6A 2XPDA 4TR1A 3ME8A 2X64A 4JZQA 2C80A 5D9TA 3F6FA 3TDGA 3LW9A 1SJIA 4V2NA 4ZB7A 1EP7A 2DBCA 4GF0A 4MF5A 4L0WA 1KEBA 2WJUA 2C0DA 3A5IA 3GH6A 3KCMA 3D5JA 1ZYQB 2L6CA 1M2AA 2HSNA 2NTOA 3A2XA 5J4UA 3RHBA 3ZVJA 1V2AA 1ZYPA 4XS4B 4GDFA 2EFHA 2XPEA 4OCEA 1GSDA 3H93A 5ENUA 2R5GA 3H79A 1Y1UA 2WFCA 2IMIA 3PR8A 1OC9A 3MAKA 4KF9A 3BD2A 3M3MA 2GDRA 1ERUA 1LJRA 4LMVA 3ZREA 1U3IA 3C1RA 3IDVA 3ZMKA 5LCZA 2EIQA 1Z9HA 1ACVA 4N10A 3VPTA 2GQLA 4NMUA 5CP1A 3TJJA 2DC5A 2FHEA 1U6TA 4I97A 1XFLA 2XHFA 5D9VA 5G5EA 6GSXA 2EC4A 2L57A 2YJ7A 1VF4A 2C0EA 2J9HA 4V1Ag 3EMPA 1SVLA 2X99A 3GTUA 1B4QA 1XPVA 4IKHA 1K3OA 4BL7A 4TRXA 1ILOA 1M9BA 4JU5A 1K0DA 2CAIA 3M9KA 4YQMA 4AJ8A 3HCZA 4NHZA 2DJKA 1WP0A 3UIWA 3FW2A 4EF0A 2DKHA 1B9YC 1B4PA 3HZ8A 2EFDA 2O87A 2VCWA 3FR3A 2ES7A 4ZL9A 5AGYA 3VI5A 2DIYA 1R4WA 1TRSA 1FB0A 2B7KA 4IN0A 5JWRB 3EE2A 4K2DA 1SENA 2PBJA 1TW9A 1PD21 3UVHA 4IJ3A 2YJHA 1XW5A 5EL8A 3US3A 4XHMA 3UARA 4Z2UA 2CA8A 3N9JA 3RDWA 4WR5A 1PSQA 1X9MB 1B9XC 2TRCP 5IMDA 4KX4A 4HQZA 4DVCA 4BPYA 2H6ZA 1AW9A 1K0NA 5J4YA 2OACA 5DJLA 2HE3A 2HSMB 1O85A 3F4RA 5IMVA 5BMUA 2LKUA 3R2QA 1I9DA 3HDCA 5ELAA 5J47A 4KGIA 3IPZA 2C4JA 3CRTA 4AKHA 1AIUA 1IYIA 3C71A 4F0BA 5HR0A 3C7MA 2M46A 1K3LA 2K9FA 1EEJA 2VM2A 4EVMA 5AISA 3HVXA 2VCZA 1H75A 1OKTA 4TOPA 5B7CA 3FMWA 1DBYA 1N25A 3KP9A 2GQMA 4FO5A 1DSBA 1SL1B 4JEDA 5J5NA 1DE1A 3IC4A 3DGQA 2WULA 4ICYA 2K6VA 2FWEA 2L5OA 2IMKA 3D22A 3APOA 2HRNA 1OC3A 3L78A 1F6MC 4K0GA 4XCSA 3IBHA 1XVQA 2VL9A 3GKKA 1PMTA 3TRPA 2P31A 1UVZA 2H1LA 1FB6A 1YVLA 1RW1A 3KH7A 3RPNA 2LNTA 5JCUA 5G31A 2LRTA 4TXOB 3Q6OA 5CRWA 5CRGA 3QPMA 3GSSA 3IHGA 5IOWA 4HOJA 2PGTA 5LD0A 3GKMA 4NXIA 2KP2A 1YF0A 4IGJA 4ZB9A 1OE7A 1BG5A 3BBYA 5HR3A 5CYYA 5ECHB 1MD4A 1O73A 2V6OA 4V2LA 1X0RA 3HJOA 4CDOA 4KE3A 3QD9A 4GXZA 2FWFA 3QAGA 4YH2A 1OC8A 3IK9A 2CVKA 3TKPA 2XC2A 2GZPA 3IC8A 2A2PA 3P7XA 4JR4A 3WYWA 2L6DA 4FIWA 1JZOA 5ECRB 2HLSA 1T00A 1K0MA 4X43A 2H01A 3DWVA 3QFBC 1AAZA 2OADA 1Q4JA 1EP8A 3FZ5A 3G7IA 5CRHA 1VF1A 4CY8A 1BJXA 1XW9A 4ULXA 5GSSA 3S9FA 1GUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9J A;  4YQV A;  1NHY A;  2MMZ A;  3BCI A;  4KW6 A;  3GIX A;  5AIX A;  2H1B A;  5IMA A;  3LXZ A;  2AV4 A;  4F0C A;  5E4W A;  3HA9 A;  2B3S A;  1YKA A;  5GAN D;  1TRV A;  2VLT A;  2HQT A;  1QK8 A;  1X9S B;  2OJL A;  2XBI A;  5ECM B;  2FGX A;  4GST A;  2CVB A;  4TR0 A;  1XBS A;  1B48 A;  3GUS A;  2MMO A;  2RM5 A;  4ZB8 A;  1HQO A;  2E2M A;  2HZF A;  3E0U A;  1TXX A;  2H70 A;  1EZK A;  2H0G A;  3ED3 A;  3EC3 A;  3GH9 A;  2EIO A;  3VLN A;  4ECJ A;  4HZ2 A;  3F4T A;  4DEJ A;  3L9U A;  4TXV A;  4G0L A;  1M7T A;  2CQ9 A;  4KA0 A;  3ERF A;  3FY7 A;  3EU3 A;  5LNK e;  5COH A;  2R37 A;  4QQ7 A;  1G7E A;  2GSS A;  3CTF A;  5F0G A;  5ID2 A;  2LUS A;  2B7J A;  2K8S A;  5C00 A;  4BWQ A;  4X1U A;  3ZIJ A;  2RLI A;  2L59 A;  1SKR B;  3GRX A;  3DVX A;  1V9W A;  3F3R A;  6GST A;  1I5G A;  2GT5 A;  2WCI A;  4MPG A;  4OFM A;  4KSO A;  4MF6 A;  4XS1 A;  4USS A;  3IOS A;  4NV5 A;  2HXK A;  3E9J B;  1XWK A;  5D8I A;  3WGD A;  18GS A;  4FH8 A;  3LYK A;  4L5L A;  4KSM A;  2ZUP A;  1A0R P;  1SK0 A;  4K0N A;  3HY2 A;  2GTU A;  3W6G A;  4PGT A;  2C0F A;  5D93 A;  2MMA A;  4Q5Q A;  2H75 A;  2ZCT A;  2PMT A;  3GV1 A;  3BOA A;  5AIV A;  3D4M A;  2O8V B;  4IS0 A;  2QGV A;  2VO4 A;  4GLT A;  3TKS E;  4ZIJ A;  4IQ1 A;  3KH9 A;  1QQ2 A;  3RHC A;  1Z7R A;  3LYP A;  4PQ1 A;  1TJD A;  2CV4 A;  4E8H A;  3TKR A;  1NW2 A;  1AXD A;  4EKZ A;  1PRX A;  5DAL A;  2VUP A;  2IN3 A;  2IJY A;  1O8X A;  3QAW A;  1UA5 A;  2HYX A;  1JLW A;  5FWG A;  1E6B A;  2N5F A;  3ZRD A;  4EC0 A;  2HRF A;  4RI7 A;  4GWR A;  4AGS A;  5DQY A;  1RK4 A;  4O7H A;  5D9X A;  4ACS A;  3UVT A;  2MMN A;  2VLV A;  2AUV A;  1W89 A;  3FZA A;  3TOT A;  3KTB A;  2BMX A;  4KAE A;  3CMI A;  4EDZ A;  1BED A;  1Y6E A;  2ON5 A;  3LQ7 A;  1X5C A;  1PL2 A;  1YZX A;  2PVO C;  3KEB A;  3ERW A;  2H1A A;  2YV9 A;  2CVD A;  6GSU A;  3TJF A;  4IVF A;  1N8J A;  5IQY A;  1XWG A;  2E0Q A;  1F9M A;  2YZU A;  1YJ6 A;  1NM3 A;  3I9V 2;  1JLV A;  1G0T A;  3Q74 A;  2YZH A;  2LEG A;  1TK0 B;  5HR1 A;  1JZR A;  3GMF A;  4PQH A;  2DMM A;  5IMF A;  3HZ4 A;  3RBT A;  2C3N A;  3EYT A;  4D73 B;  3G9B A;  2YP6 A;  5IO2 A;  2LV3 A;  5IPH A;  1HNB A;  3LWA A;  4BA7 A;  1PN9 A;  2M80 A;  5KEJ A;  5IIZ A;  1GTU A;  3ZIV A;  12GS A;  2VCV A;  2L4Q A;  2J23 A;  2HI7 A;  3UOM A;  2LST A;  2HFD A;  3L4N A;  3HJP A;  1ZGN A;  5HFI A;  1SJZ A;  3A3T A;  1SKW B;  2E7P A;  2YV7 A;  2RUF A;  1TK5 B;  1GUM A;  3PPU A;  5DAK A;  5DDL A;  3IXR A;  1TOF A;  2DJJ A;  3GL5 A;  5ABR A;  4KCE A;  1FHE A;  4BVY A;  1YF1 A;  1JHB A;  11GS A;  4HEA 2;  4MJB A;  1A2L A;  1Z7P A;  4O5R A;  3IE3 A;  1EOH A;  4F82 A;  1TDI A;  3DXB A;  5KN3 A;  5IMC A;  2PER A;  1Z3E A;  4BVX B;  2WB9 A;  3ZFL A;  3F9U A;  4TR1 B;  2MYG A;  2FA4 A;  1EV9 A;  1RQM A;  5JWO B;  4Q5N A;  2OKA A;  1ZMA A;  3MSZ A;  3HVV A;  2VD1 A;  4RI6 A;  4EXJ A;  2IMD A;  5CRE A;  1EOG A;  2WS2 A;  1WWJ A;  2PU9 C;  1XZO A;  1HYU A;  4MLY A;  1Y25 A;  5EVO A;  1DUG A;  17GS A;  2HSN B;  1S3C A;  2DJ3 A;  4GQC A;  1GTA A;  2WDU A;  1T3B A;  2UZ8 A;  3J7Y k;  4NV2 A;  1EGO A;  5HR2 A;  3GX8 A;  2FWG A;  4HDE A;  1GSU A;  1WPI A;  1OC9 B;  1TP9 A;  1X5E A;  1PKZ A;  2HT9 A;  3CXG A;  4HS1 A;  3LXT A;  3H4K A;  2O89 A;  4AF2 A;  3GNJ A;  4POM A;  4WKW A;  13GS A;  2R4V A;  4WBR D;  4XS6 A;  2H76 A;  2AJQ B;  2ALB A;  1OYJ A;  5J41 A;  3SWL A;  2YAN A;  4MJC A;  2DLX A;  3GST A;  4PX1 A;  3KGK A;  3DEX A;  2MBS A;  3UMA A;  3CRU A;  2JSY A;  3GTU B;  2JZS A;  4BL7 B;  4NHW A;  5H5Q A;  5CNW A;  1GRX A;  3CSJ A;  3ISO A;  4MZW A;  4K7O A;  3R3E A;  2LS5 A;  3QOU A;  1SD8 A;  2LJR A;  1ZYE A;  2WRT A;  4GTU A;  4IJI A;  5IO0 A;  5IMZ A;  1ZL9 A;  4BWS A;  2PPT A;  2PWJ A;  4KH7 A;  5F8B A;  3HKR A;  2DJ1 A;  10GS A;  1ST9 A;  2X8G A;  1GNW A;  2KLX A;  2FA8 A;  1J9B A;  3DYR A;  1S3A A;  1G7O A;  2KUC A;  2LJK A;  4LL1 B;  3ZIT A;  1K0O A;  3TOU A;  1YEX A;  3VWX A;  1USB A;  4MJE A;  2D2Z A;  1MDI A;  3DKS A;  3FEU A;  3EMX A;  1GTI A;  1ERT A;  4EO3 A;  2HZE A;  4KDU A;  1G6W A;  3IAM 2;  2H1G A;  4I6X A;  3DVW A;  4Q5R A;  3O3T A;  1XVW A;  2H0I A;  1OE8 A;  4KND A;  2H1D A;  2FCH A;  5DVB A;  4AJ7 A;  2YCD A;  1M2B A;  2JAC A;  2X8H A;  5J9C A;  1K0B A;  2TRX A;  2VAF A;  3V1W A;  1VRS D;  2YWO A;  2CAQ A;  3OR5 A;  2IL3 A;  1PX7 A;  1JZD A;  3ZVJ D;  2KHP A;  2VCT A;  1T8E B;  3GUR A;  5DCG A;  4GRF A;  4F9Z A;  3IHQ A;  1YDK A;  5F07 A;  1KBN A;  3J7Y b;  2FY6 A;  2AHE A;  2B1K A;  3G7Y A;  1AC1 A;  4QL7 A;  1WE0 A;  3APQ A;  1BX9 A;  3FYG A;  3SBC A;  4JBB A;  4TR3 A;  4EE0 A;  1ZCP A;  4I8B A;  4HZ4 A;  5D96 A;  1T1V A;  5J9B A;  2L4C A;  2P0G A;  4POB A;  1YY7 A;  5IPG A;  1HNA A;  3F6D A;  4OCF A;  4KDX A;  4ECC A;  6GSV A;  4HI7 A;  3QMX A;  3PIN A;  1ML6 A;  5F05 A;  3HVS A;  4FQU A;  4GSN A;  1M2D A;  5A4U A;  2DIZ A;  1AQX A;  2GT6 A;  4MJA A;  4NWY A;  2VCX A;  1XOA A;  3IAS 2;  1GSQ A;  2JL4 A;  1A2M A;  3UBL A;  1UC7 A;  2IFQ A;  3I6A A;  1A23 A;  2OA7 A;  1V40 A;  2MBT A;  1PGT A;  1AUC A;  1K3Y A;  4TR4 A;  3VI7 A;  2TIR A;  3U6V A;  1WOU A;  5A4V A;  1F3B A;  3A2W A;  1GTB A;  3TCO A;  1TU8 A;  5G2Z A;  3F0I A;  1U88 A;  2LQO A;  5KN2 A;  4DSR A;  3VUR A;  1N2A A;  2M72 A;  2E2G A;  3KIJ A;  3CTG A;  4L5O A;  4MPF A;  4L8E A;  1R5P A;  1QMV A;  4Q5F A;  3QFA C;  4WET A;  1VF3 A;  1U87 A;  3GHA A;  1GH2 A;  4OO5 A;  5DBQ A;  2C3T A;  1ABA A;  4ZBD A;  2NVL A;  3M0F A;  3K8N A;  1W4V A;  3BCK A;  1OKD A;  3BJ5 A;  4RQX A;  4J56 E;  5IM9 A;  3TJB A;  1GSE A;  4WEY A;  1S3D A;  2LQQ A;  1GWC A;  16GS A;  3TJK A;  4K7I A;  3IV4 A;  5INY A;  1PQN A;  4IP6 A;  2B6M A;  3N5O A;  2JAD A;  1VGL A;  1SYR A;  2NDO A;  5KN1 A;  2GQK A;  4X0X A;  3F4S A;  2GGT A;  3MWH A;  4IP1 A;  4MA9 A;  2B5X A;  2H66 A;  3ME7 A;  3IK7 A;  2WGR A;  1M0U A;  3F8U A;  4PNG A;  2OE3 A;  5D73 A;  2I9H A;  2QKE A;  3E3E A;  2DJ2 A;  5L71 A;  3FZ9 A;  1WIK A;  4NAX A;  2GS3 A;  1J0F A;  2VIM A;  4ECI A;  5DQS A;  2VLU A;  2NPB A;  2VM1 A;  5ECS A;  4XRA A;  3KJY A;  1JFU A;  4XS4 A;  4RQR A;  1CQH A;  4G0K A;  1GNE A;  3P8W A;  14GS A;  3D0Z A;  4XRD A;  2YNX A;  4QL9 A;  4F03 A;  2CX3 A;  2QC7 A;  3GYK A;  5ID2 B;  5FHI A;  4PTS A;  1THO A;  4GQF A;  2GZY A;  1HNC A;  1M99 A;  4GSS A;  4TVE A;  1O81 A;  1U3A A;  4KCA A;  3TGZ A;  3KMN A;  5D9W A;  6GSY A;  3RPP A;  4MZB A;  4PNF A;  3WD6 A;  5B6M A;  4J2F A;  3HXS A;  3FK8 A;  2GST A;  2VD0 A;  1SL2 B;  5J3R A;  3WGX A;  5A4W A;  2JZR A;  4CHS A;  8GSS A;  3VK9 A;  4TN8 A;  2WZ9 A;  3P90 A;  2IME A;  3GX0 A;  5AN1 A;  6GSS A;  2LRC A;  2FNO A;  2N5A A;  1EEM A;  2HSY A;  2I3Y A;  1J08 A;  4OFT A;  1XWB A;  5FT3 A;  4I2T A;  4LL4 B;  2DSA A;  3IRA A;  4LA1 A;  2LTK A;  4O92 A;  5HFG A;  1A2J A;  4K7N A;  3KM6 A;  1SK1 A;  4EL1 A;  4K9Z A;  4G2E A;  1TRU A;  2QSI A;  1Q98 A;  4I2U A;  4POL A;  2IIY A;  4JRR A;  5DAL B;  3Q18 A;  4POK A;  2GSR A;  4MP4 A;  5G30 A;  3H8Q A;  1FO5 A;  2NBS A;  3IR4 A;  4OFN A;  4H86 A;  4F2I A;  2F8F A;  3IA1 A;  5CAX A;  2HSH A;  4WF5 A;  2H30 A;  3EVI A;  1SKS B;  4WXT A;  1BAY A;  2LRN A;  5B8B A;  3PGT A;  2IWT A;  3EU4 A;  5DJM A;  1MEK A;  2HSM A;  4G9H A;  3CBU A;  2ZNM A;  5DCH A;  1G6Y A;  1MD3 A;  1X9W B;  1GUK A;  1FVK A;  1URM A;  4ZL8 A;  3WT1 A;  1WRY A;  4MAB A;  3LEF A;  4I5Q A;  4G10 A;  4CW9 A;  5KN0 A;  3ZML A;  1YKC A;  5G1K A;  1B8X A;  4OWY A;  2PN8 A;  19GS A;  1AQW A;  4V1A p;  2V32 A;  3VWW A;  1AQV A;  2FUG 2;  2A2S A;  1EWX A;  4GCI A;  4DSS A;  5HFK A;  2R2J A;  4E8E A;  2V41 A;  3VWV A;  1ERV A;  5JWQ B;  3F63 A;  4YAV A;  1QFN A;  3TKQ A;  1SU9 A;  1FVJ A;  3L0H A;  3LFL A;  4WBJ A;  1BYE A;  2B1L A;  6GSW A;  2OBK A;  1ZZY A;  1T4Y A;  1R7H A;  2V2G A;  4K6X A;  1FW1 A;  5E59 A;  2GZZ A;  3QDN A;  3G7J A;  2OE0 A;  4TXO A;  1GP1 A;  1XWA A;  4ISD A;  2H6Y A;  1O6J A;  3NIV A;  4MCU A;  4N11 A;  1K0C A;  3NOF A;  2VL2 A;  3QAV A;  5DAK B;  1TKD B;  3GKX A;  3FR6 A;  2V6K A;  2GVP A;  1TK8 B;  2I1U A;  4K8M A;  1XOB A;  4TKY A;  3M8N A;  2YN1 A;  4ILF A;  2AYT A;  4HJM A;  3D6I A;  1FG4 A;  4BVY B;  1XW6 A;  3DML A;  5ECL B;  3UAP A;  2XBQ A;  2ON7 A;  2P5R A;  4OMV A;  4V2M A;  3C8E A;  1A8L A;  1MDK A;  1T7P B;  2AAW A;  2CT6 A;  4TW5 A;  3EUR A;  3GN3 A;  2C1Y A;  1NSW A;  2A2R A;  3ZZX A;  1K0A A;  1T4Z A;  1V57 A;  3TB2 A;  3A2V A;  2Z9S A;  4ZL7 A;  4ID0 A;  4KUN A;  4PUF C;  5G1L A;  3LGC A;  5F06 A;  2A4V A;  5ELG A;  1SK2 A;  1WMJ A;  3ERG A;  1LU4 A;  3GL3 A;  1XIY A;  2I4A A;  3TUE A;  4DSS B;  1O8W A;  2B5E A;  3ZL5 A;  2DJ0 A;  2H19 A;  3VFI A;  20GS A;  2DML A;  2K18 A;  1TI3 A;  2I81 A;  3F3Q A;  5EY6 A;  1SL0 B;  1THX A;  2F3M A;  2RM6 A;  4LLR A;  4YAP A;  3GFK A;  4MK3 A;  4KB3 A;  4NPB A;  3Q19 A;  4IBP A;  4ECB A;  3HHV A;  2JU5 A;  1KTE A;  4ML6 A;  4KDY A;  2H71 A;  1TTZ A;  4OO4 A;  1H4O A;  3DIE A;  3QR6 A;  3UL3 A;  1GLP A;  1IYH A;  1XWC A;  1FOV A;  5JCG A;  1TI1 A;  3TKS A;  4ZIL A;  1A24 A;  1GUL A;  3P2A A;  3UBK A;  1NHO A;  9GSS A;  3WGE A;  4AJ6 A;  2KP1 A;  1R5A A;  3W8J A;  5B6N A;  2L5L A;  5H5S A;  2KOK A;  2YWN A;  2FLS A;  3KTL A;  3W8S A;  3WT2 A;  3UJ1 A;  4OD7 A;  2B5Y A;  4WR4 A;  4HQS A;  3TRX A;  4IEL A;  2HRA A;  2LJA A;  2VL2 C;  4HU7 A;  5B8A A;  1A0F A;  4FYU A;  1XCC A;  5HQP A;  2X8C A;  4MZC A;  4G19 A;  1E2Y A;  3M1G A;  1YEP A;  4FYB A;  1C72 A;  1EV4 A;  2REM A;  4DSQ A;  3D21 A;  2JSZ A;  3U5R E;  1ZOF A;  2IPA A;  2FD3 A;  1GSF A;  2R3X A;  3DRN A;  3FHK A;  3PH9 A;  1PX6 A;  3QCP A;  3MNG A;  3FZ4 A;  3L9V A;  1GLQ A;  4N0V A;  5A5K A;  2MZC A;  1LBK A;  1BQ7 A;  4ML1 A;  1HD2 A;  2OBI A;  2CZ2 A;  3ZTL A;  3ZFB A;  5GAP D;  2H72 A;  1PKW A;  1YQ1 A;  3KP8 A;  3CSH A;  2G0F A;  3HD5 A;  1OVN A;  2H73 A;  3CSI A;  2IMF A;  3ZLP A;  1F3A A;  2HZE B;  4K1F A;  3H1N A;  4YQU A;  4N0Z A;  3MDK A;  4XIH A;  1V98 A;  3JCM L;  2EIR A;  2C8U A;  5ECI B;  1R26 A;  3C1S A;  5ECQ B;  3TRQ A;  1GSS A;  2RII A;  4RUV A;  3KXO A;  5GZZ B;  2F8A A;  4EUY A;  5G5F A;  5EPF A;  2H0H A;  3C73 A;  2RUE A;  1SD9 A;  1F37 A;  2F51 A;  1TRW A;  1QXH A;  2YPM A;  3CYN A;  3ZYW A;  4PQI A;  4HUA A;  2H6X A;  2OE1 A;  1PA3 A;  4IHU A;  3A5W A;  2AB6 A;  4PUR A;  4JE1 A;  3KZQ A;  4PUA A;  1WJK A;  1X5D A;  22GS A;  2HRK A;  1GSY A;  2LNS A;  4MH3 A;  3TKS C;  7GSS A;  3TJG A;  3EWL A;  5IOX A;  2C3Q A;  1V58 A;  2YWI A;  2BTO T;  5ECN B;  3GKN A;  3UEM A;  3LG6 A;  1VF2 A;  4Z7X A;  3FR9 A;  4P3Y B;  2VL3 A;  3HYP A;  1KNG A;  5JCW A;  2PVQ A;  4O32 A;  3FKF A;  3I69 A;  3D4T A;  2JZT A;  2F9S A;  1JZW A;  3VWU A;  1CQG A;  1M9A A;  4HU9 A;  3EIN A;  3AY8 A;  1TU7 A;  3O76 A;  1EGR A;  1DE2 A;  3DD3 A;  4MH2 A;  2CZ3 A;  1A8Y A;  3O6T A;  4N30 A;  4JR6 A;  2FWH A;  2IFQ B;  1XXU A;  2CX4 A;  1F2E A;  3I43 A;  1OAZ A;  4PXO A;  1FAA A;  4D73 A;  1QGV A;  4J57 E;  2VOC A;  5C04 A;  2GSQ A;  5ECP B;  2YOI A;  2H74 A;  3KD0 A;  4IW9 A;  4FYC A;  4MF7 A;  5CRD A;  2P5Q A;  3KMO A;  4ZXG A;  2PUK C;  4XTS A;  1UN2 A;  5CO3 A;  3FRC A;  1MDJ A;  4ZB6 A;  2GLR A;  5ECO B;  1MTC A;  1PL1 A;  2K8V A;  2VCQ A;  5ECK B;  4L0U A;  5H5R A;  3L9S A;  2O7K A;  2O85 A;  5GST A;  4HJ2 A;  2BJX A;  4WF4 A;  4LMW A;  2HRK B;  2N5B A;  1Z6N A;  2V1M A;  1GL8 A;  4MMM A;  1O7U A;  3LJR A;  3HJM A;  1Z5Y E;  2YWM A;  1ERW A;  3GA4 A;  3RAZ A;  2HNL A;  2C0G A;  4IQA A;  1ON4 A;  1SYX A;  4ZBA A;  2G2Q A;  4G0I A;  3LOR A;  2R6K A;  3VPQ A;  3APS A;  3NZN A;  1QUW A;  2H8L A;  4BVX A;  4MDC A;  4ZBB A;  1Z6M A;  3LSZ A;  4EDY A;  1SJ6 A;  2XPD A;  4TR1 A;  3ME8 A;  2X64 A;  4JZQ A;  2C80 A;  5D9T A;  3F6F A;  3TDG A;  1SJI A;  4V2N A;  1EP7 A;  2DBC A;  4GF0 A;  4MF5 A;  4L0W A;  1KEB A;  2WJU A;  2C0D A;  3GH6 A;  3KCM A;  3D5J A;  1ZYQ B;  2L6C A;  1M2A A;  2NTO A;  3A2X A;  5J4U A;  3RHB A;  3ZVJ A;  1V2A A;  4XS4 B;  2XPE A;  4OCE A;  1GSD A;  3H93 A;  5ENU A;  2R5G A;  3H79 A;  2WFC A;  2IMI A;  3PR8 A;  1OC9 A;  3MAK A;  4KF9 A;  3BD2 A;  3M3M A;  2GDR A;  1ERU A;  1LJR A;  4LMV A;  3ZRE A;  1U3I A;  3C1R A;  3IDV A;  3ZMK A;  5LCZ A;  2EIQ A;  1Z9H A;  1ACV A;  4N10 A;  3VPT A;  2GQL A;  4NMU A;  5CP1 A;  3TJJ A;  2DC5 A;  2FHE A;  1U6T A;  4I97 A;  1XFL A;  2XHF A;  5D9V A;  5G5E A;  6GSX A;  2EC4 A;  2L57 A;  2YJ7 A;  1VF4 A;  2C0E A;  2J9H A;  4V1A g;  3EMP A;  2X99 A;  3GTU A;  1B4Q A;  1XPV A;  4IKH A;  1K3O A;  4BL7 A;  4TRX A;  1ILO A;  1M9B A;  4JU5 A;  1K0D A;  2CAI A;  3M9K A;  4YQM A;  4AJ8 A;  3HCZ A;  4NHZ A;  2DJK A;  1WP0 A;  3UIW A;  3FW2 A;  4EF0 A;  1B9Y C;  1B4P A;  3HZ8 A;  2O87 A;  2VCW A;  3FR3 A;  2ES7 A;  4ZL9 A;  5AGY A;  3VI5 A;  2DIY A;  1R4W A;  1TRS A;  1FB0 A;  2B7K A;  4IN0 A;  5JWR B;  3EE2 A;  4K2D A;  1SEN A;  2PBJ A;  1TW9 A;  1PD2 1;  3UVH A;  4IJ3 A;  2YJH A;  1XW5 A;  5EL8 A;  3US3 A;  4XHM A;  3UAR A;  2CA8 A;  3N9J A;  3RDW A;  4WR5 A;  1PSQ A;  1X9M B;  1B9X C;  2TRC P;  5IMD A;  4KX4 A;  4HQZ A;  4DVC A;  4BPY A;  2H6Z A;  1AW9 A;  1K0N A;  2OAC A;  5DJL A;  2HE3 A;  2HSM B;  1O85 A;  3F4R A;  5IMV A;  5BMU A;  2LKU A;  3R2Q A;  1I9D A;  5ELA A;  3HDC A;  4KGI A;  3IPZ A;  2C4J A;  3CRT A;  1AIU A;  1IYI A;  3C71 A;  4F0B A;  5HR0 A;  3C7M A;  2M46 A;  1K3L A;  2K9F A;  1EEJ A;  2VM2 A;  4EVM A;  5AIS A;  3HVX A;  2VCZ A;  1H75 A;  1OKT A;  4TOP A;  5B7C A;  1DBY A;  3KP9 A;  2GQM A;  4FO5 A;  1DSB A;  1SL1 B;  4JED A;  5J5N A;  1DE1 A;  3DGQ A;  3IC4 A;  2WUL A;  2K6V A;  2FWE A;  2L5O A;  2IMK A;  3D22 A;  3APO A;  2HRN A;  1OC3 A;  3L78 A;  1F6M C;  4K0G A;  4XCS A;  3IBH A;  1XVQ A;  2VL9 A;  3GKK A;  1PMT A;  3TRP A;  2P31 A;  1UVZ A;  1FB6 A;  1RW1 A;  3KH7 A;  3RPN A;  2LNT A;  5JCU A;  5G31 A;  2LRT A;  4TXO B;  3Q6O A;  5CRW A;  5CRG A;  3QPM A;  3GSS A;  5IOW A;  4HOJ A;  2PGT A;  5LD0 A;  3GKM A;  4NXI A;  2KP2 A;  1YF0 A;  4IGJ A;  4ZB9 A;  1OE7 A;  1BG5 A;  3BBY A;  5HR3 A;  5CYY A;  5ECH B;  1MD4 A;  1O73 A;  2V6O A;  4V2L A;  1X0R A;  3HJO A;  4CDO A;  4KE3 A;  3QD9 A;  4GXZ A;  2FWF A;  3QAG A;  4YH2 A;  1OC8 A;  3IK9 A;  2CVK A;  3TKP A;  2XC2 A;  2GZP A;  3IC8 A;  3P7X A;  4JR4 A;  3WYW A;  2L6D A;  4FIW A;  1JZO A;  5ECR B;  2HLS A;  1T00 A;  1K0M A;  4X43 A;  2H01 A;  3DWV A;  3QFB C;  1AAZ A;  2OAD A;  1Q4J A;  1EP8 A;  3FZ5 A;  3G7I A;  5CRH A;  1VF1 A;  1BJX A;  1XW9 A;  4ULX A;  5GSS A;  3S9F A;  1GUH A; 
#chains in the Genus database with same CATH topology
 3M9J A;  4YQV A;  1NHY A;  2MMZ A;  4K5R A;  2WZS A;  3BCI A;  4KW6 A;  3GIX A;  5AIX A;  2H1B A;  5IMA A;  3LXZ A;  2AV4 A;  4F0C A;  5E4W A;  3HA9 A;  4E68 A;  1XG8 A;  2B3S A;  5J4V A;  1YKA A;  5GAN D;  1TRV A;  2VLT A;  3RFR C;  2HQT A;  1QK8 A;  1X9S B;  2OJL A;  2XBI A;  5ECM B;  4A5P A;  2FGX A;  4GST A;  2CVB A;  4TR0 A;  1XBS A;  1B48 A;  3GUS A;  2MMO A;  2RM5 A;  4ZB8 A;  1HQO A;  2E2M A;  2HZF A;  3E0U A;  1TXX A;  2H70 A;  1EZK A;  2H0G A;  3ED3 A;  3EC3 A;  3GH9 A;  2EIO A;  3VLN A;  4ECJ A;  4HZ2 A;  3F4T A;  4DEJ A;  3L9U A;  4TXV A;  4G0L A;  1M7T A;  2CQ9 A;  4KA0 A;  3ERF A;  3FY7 A;  3EU3 A;  5LNK e;  5COH A;  2R37 A;  4QQ7 A;  1G7E A;  2GSS A;  3CTF A;  5F0G A;  1PN0 A;  5A5H A;  5ID2 A;  2LUS A;  2B7J A;  2K8S A;  5C00 A;  4BWQ A;  4X1U A;  3ZIJ A;  2RLI A;  5BRT A;  2L59 A;  1SKR B;  3GRX A;  3DVX A;  1V9W A;  3F3R A;  6GST A;  1I5G A;  2GT5 A;  2WCI A;  4MPG A;  4OFM A;  4KSO A;  4MF6 A;  4XS1 A;  4USS A;  3IOS A;  4NV5 A;  2HXK A;  3E9J B;  1XWK A;  5D8I A;  3WGD A;  18GS A;  4FH8 A;  3LYK A;  4L5L A;  4KSM A;  2ZUP A;  5A34 B;  2A4H A;  1A0R P;  1SK0 A;  4K0N A;  3HY2 A;  2GTU A;  2WW1 A;  3W6G A;  4PGT A;  2C0F A;  5D93 A;  2MMA A;  4Q5Q A;  2H75 A;  2ZCT A;  2PMT A;  3GV1 A;  3BOA A;  5AIV A;  3D4M A;  4Z2R A;  2O8V B;  4IS0 A;  2QGV A;  2VO4 A;  4GLT A;  3TKS E;  4ZIJ A;  2O5V A;  4IQ1 A;  3KH9 A;  1QQ2 A;  3RHC A;  1Z7R A;  3LYP A;  4PQ1 A;  1TJD A;  2CV4 A;  4E8H A;  3TKR A;  1NW2 A;  1AXD A;  4EKZ A;  1PRX A;  5DAL A;  2VUP A;  2IN3 A;  2IJY A;  1O8X A;  3QAW A;  1UA5 A;  3CWG A;  2HYX A;  1JLW A;  5FWG A;  1E6B A;  2N5F A;  3ZRD A;  4EC0 A;  2HRF A;  2R0C A;  4RI7 A;  4GWR A;  4AGS A;  5DQY A;  1RK4 A;  4G01 A;  4O7H A;  5D9X A;  4ACS A;  3UVT A;  4K5S A;  3EPT A;  2MMN A;  2VLV A;  2R0G A;  2AUV A;  1W89 A;  3FZA A;  3TOT A;  3KTB A;  2BMX A;  4KAE A;  3CMI A;  4EDZ A;  1BED A;  1Y6E A;  2ON5 A;  3LQ7 A;  1SVM A;  1X5C A;  1PL2 A;  1YZX A;  2PVO C;  3KEB A;  3ERW A;  3RGB C;  2H1A A;  2YV9 A;  2CVD A;  6GSU A;  3TJF A;  4IVF A;  1N8J A;  5IQY A;  1XWG A;  4YKF A;  2E0Q A;  1F9M A;  2YZU A;  1YJ6 A;  1NM3 A;  3I9V 2;  1JLV A;  1G0T A;  3Q74 A;  2YZH A;  2LEG A;  1TK0 B;  5HR1 A;  1JZR A;  3GMF A;  4PQH A;  2DMM A;  5IMF A;  3HZ4 A;  3RBT A;  2C3N A;  3EYT A;  4D73 B;  3G9B A;  2YP6 A;  5IO2 A;  2LV3 A;  5IPH A;  1HNB A;  1TXU A;  3LWA A;  4BA7 A;  1PN9 A;  2M80 A;  5KEJ A;  5IIZ A;  1GTU A;  3ZIV A;  12GS A;  2VCV A;  2L4Q A;  2J23 A;  2HI7 A;  3UOM A;  2LST A;  2HFD A;  3L4N A;  3HJP A;  1ZGN A;  5HFI A;  1SJZ A;  4QMK A;  3A3T A;  1SKW B;  2E7P A;  2YV7 A;  2R0P A;  2RUF A;  1TK5 B;  1GUM A;  3PPU A;  5DAK A;  5DDL A;  3IXR A;  1TOF A;  2DJJ A;  3GL5 A;  5ABR A;  4KCE A;  4MNN A;  1FHE A;  4BVY A;  1FOH A;  1YF1 A;  2VKZ G;  1JHB A;  11GS A;  1SVO A;  4HEA 2;  4MJB A;  2WVX B;  1A2L A;  1S3R A;  1Z7P A;  4O5R A;  3IE3 A;  1EOH A;  4F82 A;  1TDI A;  3DXB A;  5KN3 A;  5IMC A;  2PER A;  5A1N B;  1Z3E A;  4BVX B;  2WB9 A;  5KOX A;  3ZFL A;  3F9U A;  4TR1 B;  2MYG A;  4X4J A;  2FA4 A;  1M3I A;  1EV9 A;  1RQM A;  5JWO B;  4Q5N A;  2OKA A;  1ZMA A;  3MSZ A;  3HVV A;  2VD1 A;  4RI6 A;  4EXJ A;  2IMD A;  5CRE A;  1EOG A;  2WS2 A;  1WWJ A;  2PU9 C;  1XZO A;  1HYU A;  1BF5 A;  4MLY A;  1Y25 A;  5EVO A;  1DUG A;  17GS A;  2HSN B;  1S3C A;  2DJ3 A;  4GQC A;  1GTA A;  2WDU A;  1T3B A;  2UZ8 A;  1BG1 A;  4AI6 A;  3J7Y k;  4N3Z A;  4NV2 A;  1EGO A;  5HR2 A;  3GX8 A;  2FWG A;  4HDE A;  1GSU A;  1WPI A;  1OC9 B;  1TP9 A;  1X5E A;  1PKZ A;  2HT9 A;  3CXG A;  4HS1 A;  3LXT A;  4AKG A;  3H4K A;  1YEW C;  2O89 A;  4AF2 A;  3GNJ A;  4POM A;  4WKW A;  2WW3 A;  13GS A;  2R4V A;  4WBR D;  4XS6 A;  2H76 A;  2AJQ B;  2ALB A;  1OYJ A;  5J41 A;  1ZYN A;  3SWL A;  2YAN A;  4MJC A;  2DLX A;  3GST A;  4PX1 A;  3KGK A;  3DEX A;  2MBS A;  3UMA A;  3CRU A;  2JSY A;  3GTU B;  2JZS A;  4BL7 B;  4NHW A;  5H5Q A;  5CNW A;  1GRX A;  3CSJ A;  3ISO A;  4MZW A;  4K7O A;  3R3E A;  2LS5 A;  3QOU A;  1SD8 A;  2LJR A;  5KOW A;  1ZYE A;  2WRT A;  4GTU A;  4IJI A;  5IO0 A;  5IMZ A;  2X49 A;  1ZL9 A;  4BWS A;  2PPT A;  2PWJ A;  4KH7 A;  5F8B A;  3HKR A;  2DJ1 A;  10GS A;  1ST9 A;  2X8G A;  1GNW A;  2KLX A;  2FA8 A;  1J9B A;  3DYR A;  1S3A A;  1G7O A;  2KUC A;  2LJK A;  4LL1 B;  3ZIT A;  1K0O A;  3TOU A;  1YEX A;  3VWX A;  1USB A;  4MJE A;  2D2Z A;  1MDI A;  3DKS A;  3FEU A;  3EMX A;  1GTI A;  1ERT A;  4EO3 A;  2HZE A;  4KDU A;  1G6W A;  3IAM 2;  2H1G A;  4I6X A;  3DVW A;  4Q5R A;  3O3T A;  1XVW A;  2H0I A;  1OE8 A;  4KND A;  2H1D A;  2FCH A;  5BMU B;  5DVB A;  4AJ7 A;  2YCD A;  1M2B A;  2JAC A;  2X8H A;  5J9C A;  1K0B A;  2TRX A;  2VAF A;  3V1W A;  3MIX A;  1VRS D;  2YWO A;  2CAQ A;  3OR5 A;  2IL3 A;  1PX7 A;  1JZD A;  3ZVJ D;  2KHP A;  2VCT A;  1T8E B;  3GUR A;  5DCG A;  4PI0 C;  4GRF A;  4F9Z A;  3IHQ A;  1YDK A;  5F07 A;  1KBN A;  3J7Y b;  2FY6 A;  2AHE A;  2B1K A;  3G7Y A;  1AC1 A;  4QL7 A;  1WE0 A;  3APQ A;  1BX9 A;  3FYG A;  3SBC A;  4JBB A;  4TR3 A;  4EE0 A;  1ZCP A;  4I8B A;  4HZ4 A;  5D96 A;  1T1V A;  5J9B A;  2L4C A;  2P0G A;  4POB A;  1YY7 A;  5IPG A;  1HNA A;  3F6D A;  4OCF A;  4KDX A;  4ECC A;  6GSV A;  4HI7 A;  3QMX A;  3PIN A;  1ML6 A;  5F05 A;  3HVS A;  4FQU A;  4GSN A;  1M2D A;  5A4U A;  2DIZ A;  1AQX A;  2GT6 A;  4MJA A;  4NWY A;  2VCX A;  1XOA A;  3IAS 2;  1GSQ A;  2JL4 A;  1A2M A;  3UBL A;  1UC7 A;  2IFQ A;  3I6A A;  1A23 A;  2OA7 A;  2EFC A;  4O5U A;  1V40 A;  2MBT A;  1PGT A;  1AUC A;  1K3Y A;  4TR4 A;  3VI7 A;  2TIR A;  3U6V A;  1WOU A;  5A4V A;  1F3B A;  3A2W A;  1GTB A;  2UV8 G;  3TCO A;  1TU8 A;  5G2Z A;  3F0I A;  1U88 A;  2LQO A;  5KN2 A;  4DSR A;  3VUR A;  1N2A A;  2M72 A;  2E2G A;  3KIJ A;  3CTG A;  4L5O A;  4MPF A;  4L8E A;  1R5P A;  1QMV A;  4Q5F A;  3QFA C;  4WET A;  1VF3 A;  1U87 A;  3GHA A;  4O5Q A;  1GH2 A;  4OO5 A;  5DBQ A;  2C3T A;  1ABA A;  4ZBD A;  2NVL A;  3M0F A;  3K8N A;  2O36 A;  1W4V A;  3BCK A;  1OKD A;  3BJ5 A;  4RQX A;  4J56 E;  5IM9 A;  3TJB A;  1GSE A;  3HVN A;  4WEY A;  1S3D A;  2LQQ A;  1GWC A;  16GS A;  2EFE A;  3TJK A;  2OT3 A;  4K7I A;  3IV4 A;  5INY A;  1PQN A;  4IP6 A;  2B6M A;  3N5O A;  2JAD A;  1VGL A;  1SYR A;  2NDO A;  5KN1 A;  2GQK A;  4X0X A;  3F4S A;  2GGT A;  3MWH A;  4IP1 A;  4MA9 A;  2B5X A;  2H66 A;  3ME7 A;  3IK7 A;  2WGR A;  1M0U A;  3F8U A;  4PNG A;  2OE3 A;  5D73 A;  2I9H A;  2QKE A;  3E3E A;  2DJ2 A;  5L71 A;  3FZ9 A;  1WIK A;  4NAX A;  2GS3 A;  1J0F A;  2VIM A;  4ECI A;  5DQS A;  2VLU A;  2NPB A;  2VM1 A;  5J40 A;  5ECS A;  2QA1 A;  4XRA A;  3KJY A;  1JFU A;  4XS4 A;  4RQR A;  1CQH A;  4G0K A;  1GNE A;  3P8W A;  14GS A;  3D0Z A;  4XRD A;  5A5H B;  2YNX A;  4QL9 A;  4F03 A;  2CX3 A;  2QC7 A;  3GYK A;  5ID2 B;  5FHI A;  1I1I P;  4PTS A;  1THO A;  4GQF A;  2GZY A;  1HNC A;  1M99 A;  4GSS A;  4TVE A;  1O81 A;  1U3A A;  4KCA A;  3TGZ A;  3KMN A;  5D9W A;  6GSY A;  3RPP A;  4MZB A;  4PNF A;  3WD6 A;  5B6M A;  4J2F A;  3HXS A;  3FK8 A;  2GST A;  2VD0 A;  1SL2 B;  5J3R A;  3WGX A;  5A4W A;  2JZR A;  4CHS A;  8GSS A;  3VK9 A;  4TN8 A;  2WZ9 A;  3P90 A;  2IME A;  3GX0 A;  5AN1 A;  6GSS A;  2LRC A;  2FNO A;  2N5A A;  1EEM A;  2HSY A;  2I3Y A;  1J08 A;  4OFT A;  1XWB A;  5FT3 A;  4I2T A;  4LL4 B;  2DSA A;  3IRA A;  4LA1 A;  2LTK A;  4O92 A;  5HFG A;  1A2J A;  4K2X A;  4K7N A;  3KM6 A;  1SK1 A;  4EL1 A;  4K9Z A;  4G2E A;  1TRU A;  2QSI A;  1Q98 A;  4I2U A;  4POL A;  2IIY A;  4JRR A;  5DAL B;  3Q18 A;  4POK A;  2GSR A;  4MP4 A;  5G30 A;  3H8Q A;  1FO5 A;  2NBS A;  3IR4 A;  4OFN A;  4H86 A;  4F2I A;  2F8F A;  3IA1 A;  5CAX A;  2HSH A;  4WF5 A;  2H30 A;  3EVI A;  1SKS B;  4WXT A;  1BAY A;  2LRN A;  5B8B A;  3PGT A;  2IWT A;  3EU4 A;  5DJM A;  1MEK A;  2HSM A;  4G9H A;  3CBU A;  2ZNM A;  5DCH A;  1G6Y A;  1MD3 A;  1X9W B;  1GUK A;  1FVK A;  1URM A;  4ZL8 A;  3WT1 A;  1WRY A;  4MAB A;  3LEF A;  4I5Q A;  4G10 A;  4CW9 A;  5KN0 A;  2WVZ A;  3ZML A;  1YKC A;  5G1K A;  1B8X A;  4OWY A;  2PN8 A;  19GS A;  1AQW A;  4V1A p;  2V32 A;  3VWW A;  1AQV A;  2FUG 2;  2A2S A;  1EWX A;  4GCI A;  4DSS A;  5HFK A;  2R2J A;  4CY6 A;  4E8E A;  2V41 A;  3VWV A;  1ERV A;  5JWQ B;  3F63 A;  4YAV A;  1QFN A;  3TKQ A;  1SU9 A;  1FVJ A;  3L0H A;  3LFL A;  4WBJ A;  1BYE A;  2B1L A;  6GSW A;  2OBK A;  1ZZY A;  1T4Y A;  1R7H A;  2V2G A;  4K6X A;  1FW1 A;  5E59 A;  2GZZ A;  3QDN A;  3G7J A;  4EIQ A;  2OE0 A;  4TXO A;  1GP1 A;  1XWA A;  4ISD A;  2H6Y A;  1O6J A;  4Z2T A;  3NIV A;  4MCU A;  4N11 A;  1K0C A;  3NOF A;  2VL2 A;  3QAV A;  5DAK B;  1TKD B;  3GKX A;  3FR6 A;  2V6K A;  2GVP A;  1TK8 B;  2I1U A;  4K8M A;  1XOB A;  4TKY A;  3M8N A;  2YN1 A;  4ILF A;  2AYT A;  4HJM A;  3D6I A;  1FG4 A;  4BVY B;  1XW6 A;  3DML A;  5ECL B;  3UAP A;  2XBQ A;  2ON7 A;  2P5R A;  2X4A A;  4OMV A;  4V2M A;  3C8E A;  1A8L A;  1MDK A;  1T7P B;  2AAW A;  2CT6 A;  3TU3 B;  4TW5 A;  3EUR A;  3GN3 A;  2C1Y A;  1NSW A;  2A2R A;  3ZZX A;  1K0A A;  1T4Z A;  1V57 A;  3TB2 A;  3A2V A;  2WW0 A;  3MYD A;  3CHX C;  2Z9S A;  4ZL7 A;  4ID0 A;  4KUN A;  4PUF C;  5G1L A;  3LGC A;  5F06 A;  2A4V A;  5ELG A;  1SK2 A;  1WMJ A;  3ERG A;  1LU4 A;  3GL3 A;  1XIY A;  2I4A A;  3TUE A;  4DSS B;  1O8W A;  2B5E A;  3ZL5 A;  2DJ0 A;  2H19 A;  3VFI A;  20GS A;  2DML A;  2K18 A;  1TI3 A;  2I81 A;  3F3Q A;  5EY6 A;  1SL0 B;  1THX A;  2F3M A;  2RM6 A;  4LLR A;  4YAP A;  3GFK A;  4MK3 A;  4KB3 A;  4NPB A;  3Q19 A;  4IBP A;  4ECB A;  3HHV A;  2JU5 A;  1KTE A;  4ML6 A;  4KDY A;  2H71 A;  2O3E A;  1TTZ A;  4OO4 A;  1H4O A;  3DIE A;  3QR6 A;  3UL3 A;  1GLP A;  3HMJ G;  1IYH A;  1XWC A;  1FOV A;  5JCG A;  1TI1 A;  3TKS A;  4ZIL A;  1A24 A;  1GUL A;  3P2A A;  3UBK A;  1NHO A;  9GSS A;  3WGE A;  4AJ6 A;  2KP1 A;  1R5A A;  4W66 A;  3W8J A;  5B6N A;  2L5L A;  5H5S A;  2KOK A;  2YWN A;  2FLS A;  3KTL A;  3W8S A;  3WT2 A;  3UJ1 A;  4OD7 A;  2B5Y A;  4WR4 A;  4HQS A;  3TRX A;  4IEL A;  2HRA A;  2LJA A;  2VL2 C;  4HU7 A;  5B8A A;  1A0F A;  4FYU A;  1XCC A;  5HQP A;  2X8C A;  4MZC A;  4G19 A;  1E2Y A;  3M1G A;  1YEP A;  4FYB A;  1C72 A;  1EV4 A;  2REM A;  4DSQ A;  3D21 A;  2JSZ A;  3U5R E;  4AKX B;  1ZOF A;  2IPA A;  2FD3 A;  1GSF A;  2R3X A;  3DRN A;  3FHK A;  3PH9 A;  1PX6 A;  3QCP A;  3MNG A;  3FZ4 A;  3L9V A;  1GLQ A;  4N0V A;  5A5K A;  2MZC A;  1LBK A;  1BQ7 A;  4ML1 A;  1HD2 A;  2OBI A;  2CZ2 A;  3ZTL A;  3ZFB A;  5GAP D;  2H72 A;  1PKW A;  5A34 A;  1YQ1 A;  3CSH A;  3HD5 A;  2G0F A;  3KP8 A;  1OVN A;  2H73 A;  3CSI A;  2IMF A;  3ZLP A;  1S4B P;  1F3A A;  2HZE B;  4K1F A;  3H1N A;  4YQU A;  4N0Z A;  3MDK A;  4XIH A;  1V98 A;  3JCM L;  2EIR A;  2C8U A;  5ECI B;  1R26 A;  3C1S A;  5ECQ B;  3TRQ A;  1GSS A;  2RII A;  4RUV A;  4YKG A;  3KXO A;  5GZZ B;  2F8A A;  4EUY A;  5G5F A;  5EPF A;  2H0H A;  3C73 A;  2RUE A;  1SD9 A;  1F37 A;  2F51 A;  1TRW A;  1QXH A;  2YPM A;  3CYN A;  3ZYW A;  4PQI A;  4HUA A;  2H6X A;  4AKI A;  2OE1 A;  1PA3 A;  4IHU A;  3A5W A;  2AB6 A;  4PUR A;  4JE1 A;  3KZQ A;  4PUA A;  1WJK A;  1X5D A;  22GS A;  2HRK A;  1GSY A;  2LNS A;  4MH3 A;  3TKS C;  7GSS A;  3TJG A;  3EWL A;  5IOX A;  2C3Q A;  1V58 A;  2YWI A;  4PI2 C;  2BTO T;  5ECN B;  3GKN A;  3UEM A;  3LG6 A;  1VF2 A;  4Z7X A;  3FR9 A;  4P3Y B;  2VL3 A;  3HYP A;  1KNG A;  5JCW A;  2PVQ A;  4O32 A;  3FKF A;  3I69 A;  3D4T A;  2JZT A;  2F9S A;  4PHZ C;  1JZW A;  3VWU A;  1CQG A;  1M9A A;  2QA2 A;  4HU9 A;  3EIN A;  3AY8 A;  1TU7 A;  3O76 A;  1EGR A;  1DE2 A;  3DD3 A;  4MH2 A;  2CZ3 A;  1A8Y A;  3O6T A;  4N30 A;  4JR6 A;  2FWH A;  2IFQ B;  1XXU A;  2CX4 A;  1F2E A;  3I43 A;  1OAZ A;  4PXO A;  1FAA A;  4D73 A;  1QGV A;  2DKI A;  4J57 E;  2VOC A;  5C04 A;  2GSQ A;  5ECP B;  2YOI A;  2H74 A;  3KD0 A;  4IW9 A;  4FYC A;  4MF7 A;  5CRD A;  2P5Q A;  3KMO A;  4ZXG A;  2PUK C;  4XTS A;  1UN2 A;  5CO3 A;  3FRC A;  1PFO A;  1MDJ A;  4ZB6 A;  2GLR A;  5ECO B;  1MTC A;  1PL1 A;  2K8V A;  1M3J A;  2VCQ A;  5ECK B;  4L0U A;  5H5R A;  3L9S A;  2O7K A;  2O85 A;  5GST A;  4HJ2 A;  2BJX A;  4WF4 A;  4LMW A;  2HRK B;  2N5B A;  1Z6N A;  2V1M A;  1GL8 A;  4MMM A;  1O7U A;  3LJR A;  3HJM A;  1Z5Y E;  2YWM A;  1ERW A;  2WW2 A;  3GA4 A;  3RAZ A;  2HNL A;  2C0G A;  4BIK A;  2WVX A;  4IQA A;  1ON4 A;  1SYX A;  4ZBA A;  2G2Q A;  4G0I A;  3LOR A;  2R6K A;  3VPQ A;  3APS A;  4EIP A;  3NZN A;  1QUW A;  2H8L A;  5A1N A;  4BVX A;  4MDC A;  4ZBB A;  1Z6M A;  3LSZ A;  4EDY A;  1SJ6 A;  2XPD A;  4TR1 A;  3ME8 A;  2X64 A;  4JZQ A;  2C80 A;  5D9T A;  3F6F A;  3TDG A;  3LW9 A;  1SJI A;  4V2N A;  4ZB7 A;  1EP7 A;  2DBC A;  4GF0 A;  4MF5 A;  4L0W A;  1KEB A;  2WJU A;  2C0D A;  3A5I A;  3GH6 A;  3KCM A;  3D5J A;  1ZYQ B;  2L6C A;  1M2A A;  2HSN A;  2NTO A;  3A2X A;  5J4U A;  3RHB A;  3ZVJ A;  1V2A A;  1ZYP A;  4XS4 B;  4GDF A;  2EFH A;  2XPE A;  4OCE A;  1GSD A;  3H93 A;  5ENU A;  2R5G A;  3H79 A;  1Y1U A;  2WFC A;  2IMI A;  3PR8 A;  1OC9 A;  3MAK A;  4KF9 A;  3BD2 A;  3M3M A;  2GDR A;  1ERU A;  1LJR A;  4LMV A;  3ZRE A;  1U3I A;  3C1R A;  3IDV A;  3ZMK A;  5LCZ A;  2EIQ A;  1Z9H A;  1ACV A;  4N10 A;  3VPT A;  2GQL A;  4NMU A;  5CP1 A;  3TJJ A;  2DC5 A;  2FHE A;  1U6T A;  4I97 A;  1XFL A;  2XHF A;  5D9V A;  5G5E A;  6GSX A;  4FXY P;  2EC4 A;  2L57 A;  2YJ7 A;  1VF4 A;  2C0E A;  2J9H A;  4V1A g;  3EMP A;  1SVL A;  2X99 A;  3GTU A;  1B4Q A;  1XPV A;  4IKH A;  1K3O A;  4BL7 A;  4TRX A;  1ILO A;  1M9B A;  4JU5 A;  1K0D A;  2CAI A;  3M9K A;  4YQM A;  4AJ8 A;  3HCZ A;  4NHZ A;  2DJK A;  1WP0 A;  3UIW A;  3FW2 A;  4EF0 A;  2DKH A;  1B9Y C;  1B4P A;  3HZ8 A;  2EFD A;  2O87 A;  2VCW A;  3FR3 A;  2ES7 A;  4ZL9 A;  5AGY A;  3VI5 A;  2DIY A;  1R4W A;  1TRS A;  1FB0 A;  2B7K A;  4IN0 A;  5JWR B;  3EE2 A;  4K2D A;  1SEN A;  2PBJ A;  1TW9 A;  1PD2 1;  3UVH A;  4IJ3 A;  2YJH A;  1XW5 A;  5EL8 A;  3US3 A;  4XHM A;  3UAR A;  4Z2U A;  2CA8 A;  3N9J A;  3RDW A;  4WR5 A;  1PSQ A;  1X9M B;  1B9X C;  2TRC P;  5IMD A;  4KX4 A;  4HQZ A;  4DVC A;  4BPY A;  2H6Z A;  1AW9 A;  1K0N A;  5J4Y A;  2OAC A;  5DJL A;  2HE3 A;  2HSM B;  1O85 A;  3F4R A;  5IMV A;  5BMU A;  2LKU A;  3R2Q A;  1I9D A;  3HDC A;  5ELA A;  5J47 A;  4KGI A;  3IPZ A;  2C4J A;  3CRT A;  4AKH A;  1AIU A;  1IYI A;  3C71 A;  4F0B A;  5HR0 A;  3C7M A;  2M46 A;  1K3L A;  2K9F A;  1EEJ A;  2VM2 A;  2WVY A;  4EVM A;  5AIS A;  3HVX A;  2VCZ A;  1H75 A;  1OKT A;  4TOP A;  5B7C A;  3FMW A;  1DBY A;  1N25 A;  3KP9 A;  2GQM A;  4FO5 A;  1DSB A;  1SL1 B;  4JED A;  5J5N A;  1DE1 A;  4HSC X;  3IC4 A;  3DGQ A;  2WUL A;  4ICY A;  2K6V A;  2FWE A;  2L5O A;  2IMK A;  3D22 A;  3APO A;  2HRN A;  1OC3 A;  3L78 A;  1F6M C;  4K0G A;  4XCS A;  3IBH A;  1XVQ A;  2VL9 A;  3GKK A;  1PMT A;  3CQF A;  3TRP A;  2P31 A;  1UVZ A;  2H1L A;  1FB6 A;  1YVL A;  1RW1 A;  3KH7 A;  3RPN A;  2LNT A;  5JCU A;  5G31 A;  2LRT A;  4TXO B;  3Q6O A;  5CRW A;  5CRG A;  3QPM A;  3GSS A;  3IHG A;  5IOW A;  4HOJ A;  2PGT A;  5LD0 A;  3GKM A;  4NXI A;  2KP2 A;  1YF0 A;  4IGJ A;  4ZB9 A;  1OE7 A;  1BG5 A;  3BBY A;  5HR3 A;  5CYY A;  5ECH B;  1MD4 A;  1O73 A;  2V6O A;  4V2L A;  1X0R A;  3HJO A;  4CDO A;  4KE3 A;  3QD9 A;  4GXZ A;  2FWF A;  3QAG A;  4YH2 A;  1OC8 A;  3IK9 A;  2CVK A;  3TKP A;  2XC2 A;  2GZP A;  3IC8 A;  2A2P A;  3P7X A;  4JR4 A;  3WYW A;  2L6D A;  4FIW A;  1JZO A;  5ECR B;  2HLS A;  1T00 A;  1K0M A;  4X43 A;  2H01 A;  3DWV A;  3QFB C;  1AAZ A;  2OAD A;  1Q4J A;  1EP8 A;  3FZ5 A;  3G7I A;  5CRH A;  1VF1 A;  4CY8 A;  1BJX A;  1XW9 A;  4ULX A;  5GSS A;  3S9F A;  1GUH A; 
#chains in the Genus database with same CATH homology
 3M9J A;  4YQV A;  1NHY A;  2MMZ A;  4K5R A;  3BCI A;  4KW6 A;  3GIX A;  5AIX A;  2H1B A;  5IMA A;  3LXZ A;  2AV4 A;  4F0C A;  5E4W A;  3HA9 A;  4E68 A;  2B3S A;  5J4V A;  1YKA A;  5GAN D;  1TRV A;  2VLT A;  2HQT A;  1QK8 A;  1X9S B;  2OJL A;  2XBI A;  5ECM B;  4A5P A;  2FGX A;  4GST A;  2CVB A;  4TR0 A;  1XBS A;  1B48 A;  3GUS A;  2MMO A;  2RM5 A;  4ZB8 A;  1HQO A;  2E2M A;  2HZF A;  3E0U A;  1TXX A;  2H70 A;  1EZK A;  2H0G A;  3ED3 A;  3EC3 A;  3GH9 A;  2EIO A;  3VLN A;  4ECJ A;  4HZ2 A;  3F4T A;  4DEJ A;  3L9U A;  4TXV A;  4G0L A;  1M7T A;  2CQ9 A;  4KA0 A;  3ERF A;  3FY7 A;  3EU3 A;  5LNK e;  5COH A;  2R37 A;  4QQ7 A;  1G7E A;  2GSS A;  3CTF A;  5F0G A;  1PN0 A;  5A5H A;  5ID2 A;  2LUS A;  2B7J A;  2K8S A;  5C00 A;  4BWQ A;  4X1U A;  3ZIJ A;  2RLI A;  5BRT A;  2L59 A;  1SKR B;  3GRX A;  3DVX A;  1V9W A;  3F3R A;  6GST A;  1I5G A;  2GT5 A;  2WCI A;  4MPG A;  4OFM A;  4KSO A;  4MF6 A;  4XS1 A;  4USS A;  3IOS A;  4NV5 A;  2HXK A;  3E9J B;  1XWK A;  5D8I A;  3WGD A;  18GS A;  4FH8 A;  3LYK A;  4L5L A;  4KSM A;  2ZUP A;  5A34 B;  2A4H A;  1A0R P;  1SK0 A;  4K0N A;  3HY2 A;  2GTU A;  3W6G A;  4PGT A;  2C0F A;  5D93 A;  2MMA A;  4Q5Q A;  2H75 A;  2ZCT A;  2PMT A;  3GV1 A;  3BOA A;  5AIV A;  3D4M A;  4Z2R A;  2O8V B;  4IS0 A;  2QGV A;  2VO4 A;  4GLT A;  3TKS E;  4ZIJ A;  2O5V A;  4IQ1 A;  3KH9 A;  1QQ2 A;  3RHC A;  1Z7R A;  3LYP A;  4PQ1 A;  1TJD A;  2CV4 A;  4E8H A;  3TKR A;  1NW2 A;  1AXD A;  4EKZ A;  1PRX A;  5DAL A;  2VUP A;  2IN3 A;  2IJY A;  1O8X A;  3QAW A;  1UA5 A;  3CWG A;  2HYX A;  1JLW A;  5FWG A;  1E6B A;  2N5F A;  3ZRD A;  4EC0 A;  2HRF A;  2R0C A;  4RI7 A;  4GWR A;  4AGS A;  5DQY A;  1RK4 A;  4G01 A;  4O7H A;  5D9X A;  4ACS A;  3UVT A;  4K5S A;  3EPT A;  2MMN A;  2VLV A;  2R0G A;  2AUV A;  1W89 A;  3FZA A;  3TOT A;  3KTB A;  2BMX A;  4KAE A;  3CMI A;  4EDZ A;  1BED A;  1Y6E A;  2ON5 A;  3LQ7 A;  1SVM A;  1X5C A;  1PL2 A;  1YZX A;  2PVO C;  3KEB A;  3ERW A;  2H1A A;  2YV9 A;  2CVD A;  6GSU A;  3TJF A;  4IVF A;  1N8J A;  5IQY A;  1XWG A;  4YKF A;  2E0Q A;  1F9M A;  2YZU A;  1YJ6 A;  1NM3 A;  3I9V 2;  1JLV A;  1G0T A;  3Q74 A;  2YZH A;  2LEG A;  1TK0 B;  5HR1 A;  1JZR A;  3GMF A;  4PQH A;  2DMM A;  5IMF A;  3HZ4 A;  3RBT A;  2C3N A;  3EYT A;  4D73 B;  3G9B A;  2YP6 A;  5IO2 A;  2LV3 A;  5IPH A;  1HNB A;  1TXU A;  3LWA A;  4BA7 A;  1PN9 A;  2M80 A;  5KEJ A;  5IIZ A;  1GTU A;  3ZIV A;  12GS A;  2VCV A;  2L4Q A;  2J23 A;  2HI7 A;  3UOM A;  2LST A;  2HFD A;  3L4N A;  3HJP A;  1ZGN A;  5HFI A;  1SJZ A;  4QMK A;  3A3T A;  1SKW B;  2E7P A;  2YV7 A;  2R0P A;  2RUF A;  1TK5 B;  1GUM A;  3PPU A;  5DAK A;  5DDL A;  3IXR A;  1TOF A;  2DJJ A;  3GL5 A;  5ABR A;  4KCE A;  4MNN A;  1FHE A;  4BVY A;  1FOH A;  1YF1 A;  2VKZ G;  1JHB A;  11GS A;  1SVO A;  4HEA 2;  4MJB A;  1A2L A;  1Z7P A;  4O5R A;  3IE3 A;  1EOH A;  4F82 A;  1TDI A;  3DXB A;  5KN3 A;  5IMC A;  2PER A;  5A1N B;  1Z3E A;  4BVX B;  2WB9 A;  5KOX A;  3ZFL A;  3F9U A;  4TR1 B;  2MYG A;  4X4J A;  2FA4 A;  1EV9 A;  1RQM A;  5JWO B;  4Q5N A;  2OKA A;  1ZMA A;  3MSZ A;  3HVV A;  2VD1 A;  4RI6 A;  4EXJ A;  2IMD A;  5CRE A;  1EOG A;  2WS2 A;  1WWJ A;  2PU9 C;  1XZO A;  1HYU A;  1BF5 A;  4MLY A;  1Y25 A;  5EVO A;  1DUG A;  17GS A;  2HSN B;  1S3C A;  2DJ3 A;  4GQC A;  1GTA A;  2WDU A;  1T3B A;  2UZ8 A;  1BG1 A;  4AI6 A;  3J7Y k;  4N3Z A;  4NV2 A;  1EGO A;  5HR2 A;  3GX8 A;  2FWG A;  4HDE A;  1GSU A;  1WPI A;  1OC9 B;  1TP9 A;  1X5E A;  1PKZ A;  2HT9 A;  3CXG A;  4HS1 A;  3LXT A;  4AKG A;  3H4K A;  2O89 A;  4AF2 A;  3GNJ A;  4POM A;  4WKW A;  13GS A;  2R4V A;  4WBR D;  4XS6 A;  2H76 A;  2AJQ B;  2ALB A;  1OYJ A;  5J41 A;  1ZYN A;  3SWL A;  2YAN A;  4MJC A;  2DLX A;  3GST A;  4PX1 A;  3KGK A;  3DEX A;  2MBS A;  3UMA A;  3CRU A;  2JSY A;  3GTU B;  2JZS A;  4BL7 B;  4NHW A;  5H5Q A;  5CNW A;  1GRX A;  3CSJ A;  3ISO A;  4MZW A;  4K7O A;  3R3E A;  2LS5 A;  3QOU A;  1SD8 A;  2LJR A;  5KOW A;  1ZYE A;  2WRT A;  4GTU A;  4IJI A;  5IO0 A;  5IMZ A;  2X49 A;  1ZL9 A;  4BWS A;  2PPT A;  2PWJ A;  4KH7 A;  5F8B A;  3HKR A;  2DJ1 A;  10GS A;  1ST9 A;  2X8G A;  1GNW A;  2KLX A;  2FA8 A;  1J9B A;  3DYR A;  1S3A A;  1G7O A;  2KUC A;  2LJK A;  4LL1 B;  3ZIT A;  1K0O A;  3TOU A;  1YEX A;  3VWX A;  1USB A;  4MJE A;  2D2Z A;  1MDI A;  3DKS A;  3FEU A;  3EMX A;  1GTI A;  1ERT A;  4EO3 A;  2HZE A;  4KDU A;  1G6W A;  3IAM 2;  2H1G A;  4I6X A;  3DVW A;  4Q5R A;  3O3T A;  1XVW A;  2H0I A;  1OE8 A;  4KND A;  2H1D A;  2FCH A;  5BMU B;  5DVB A;  4AJ7 A;  2YCD A;  1M2B A;  2JAC A;  2X8H A;  5J9C A;  1K0B A;  2TRX A;  2VAF A;  3V1W A;  3MIX A;  1VRS D;  2YWO A;  2CAQ A;  3OR5 A;  2IL3 A;  1PX7 A;  1JZD A;  3ZVJ D;  2KHP A;  2VCT A;  1T8E B;  3GUR A;  5DCG A;  4GRF A;  4F9Z A;  3IHQ A;  1YDK A;  5F07 A;  1KBN A;  3J7Y b;  2FY6 A;  2AHE A;  2B1K A;  3G7Y A;  1AC1 A;  4QL7 A;  1WE0 A;  3APQ A;  1BX9 A;  3FYG A;  3SBC A;  4JBB A;  4TR3 A;  4EE0 A;  1ZCP A;  4I8B A;  4HZ4 A;  5D96 A;  1T1V A;  5J9B A;  2L4C A;  2P0G A;  4POB A;  1YY7 A;  5IPG A;  1HNA A;  3F6D A;  4OCF A;  4KDX A;  4ECC A;  6GSV A;  4HI7 A;  3QMX A;  3PIN A;  1ML6 A;  5F05 A;  3HVS A;  4FQU A;  4GSN A;  1M2D A;  5A4U A;  2DIZ A;  1AQX A;  2GT6 A;  4MJA A;  4NWY A;  2VCX A;  1XOA A;  3IAS 2;  1GSQ A;  2JL4 A;  1A2M A;  3UBL A;  1UC7 A;  2IFQ A;  3I6A A;  1A23 A;  2OA7 A;  2EFC A;  4O5U A;  1V40 A;  2MBT A;  1PGT A;  1AUC A;  1K3Y A;  4TR4 A;  3VI7 A;  2TIR A;  3U6V A;  1WOU A;  5A4V A;  1F3B A;  3A2W A;  1GTB A;  2UV8 G;  3TCO A;  1TU8 A;  5G2Z A;  3F0I A;  1U88 A;  2LQO A;  5KN2 A;  4DSR A;  3VUR A;  1N2A A;  2M72 A;  2E2G A;  3KIJ A;  3CTG A;  4L5O A;  4MPF A;  4L8E A;  1R5P A;  1QMV A;  4Q5F A;  3QFA C;  4WET A;  1VF3 A;  1U87 A;  3GHA A;  4O5Q A;  1GH2 A;  4OO5 A;  5DBQ A;  2C3T A;  1ABA A;  4ZBD A;  2NVL A;  3M0F A;  3K8N A;  1W4V A;  3BCK A;  1OKD A;  3BJ5 A;  4RQX A;  4J56 E;  5IM9 A;  3TJB A;  1GSE A;  4WEY A;  1S3D A;  2LQQ A;  1GWC A;  16GS A;  2EFE A;  3TJK A;  2OT3 A;  4K7I A;  3IV4 A;  5INY A;  1PQN A;  4IP6 A;  2B6M A;  3N5O A;  2JAD A;  1VGL A;  1SYR A;  2NDO A;  5KN1 A;  2GQK A;  4X0X A;  3F4S A;  2GGT A;  3MWH A;  4IP1 A;  4MA9 A;  2B5X A;  2H66 A;  3ME7 A;  3IK7 A;  2WGR A;  1M0U A;  3F8U A;  4PNG A;  2OE3 A;  5D73 A;  2I9H A;  2QKE A;  3E3E A;  2DJ2 A;  5L71 A;  3FZ9 A;  1WIK A;  4NAX A;  2GS3 A;  1J0F A;  2VIM A;  4ECI A;  5DQS A;  2VLU A;  2NPB A;  2VM1 A;  5J40 A;  5ECS A;  2QA1 A;  4XRA A;  3KJY A;  1JFU A;  4XS4 A;  4RQR A;  1CQH A;  4G0K A;  1GNE A;  3P8W A;  14GS A;  3D0Z A;  4XRD A;  5A5H B;  2YNX A;  4QL9 A;  4F03 A;  2CX3 A;  2QC7 A;  3GYK A;  5ID2 B;  5FHI A;  4PTS A;  1THO A;  4GQF A;  2GZY A;  1HNC A;  1M99 A;  4GSS A;  4TVE A;  1O81 A;  1U3A A;  4KCA A;  3TGZ A;  3KMN A;  5D9W A;  6GSY A;  3RPP A;  4MZB A;  4PNF A;  3WD6 A;  5B6M A;  4J2F A;  3HXS A;  3FK8 A;  2GST A;  2VD0 A;  1SL2 B;  5J3R A;  3WGX A;  5A4W A;  2JZR A;  4CHS A;  8GSS A;  3VK9 A;  4TN8 A;  2WZ9 A;  3P90 A;  2IME A;  3GX0 A;  5AN1 A;  6GSS A;  2LRC A;  2FNO A;  2N5A A;  1EEM A;  2HSY A;  2I3Y A;  1J08 A;  4OFT A;  1XWB A;  5FT3 A;  4I2T A;  4LL4 B;  2DSA A;  3IRA A;  4LA1 A;  2LTK A;  4O92 A;  5HFG A;  1A2J A;  4K2X A;  4K7N A;  3KM6 A;  1SK1 A;  4EL1 A;  4K9Z A;  4G2E A;  1TRU A;  2QSI A;  1Q98 A;  4I2U A;  4POL A;  2IIY A;  4JRR A;  5DAL B;  3Q18 A;  4POK A;  2GSR A;  4MP4 A;  5G30 A;  3H8Q A;  1FO5 A;  2NBS A;  3IR4 A;  4OFN A;  4H86 A;  4F2I A;  2F8F A;  3IA1 A;  5CAX A;  2HSH A;  4WF5 A;  2H30 A;  3EVI A;  1SKS B;  4WXT A;  1BAY A;  2LRN A;  5B8B A;  3PGT A;  2IWT A;  3EU4 A;  5DJM A;  1MEK A;  2HSM A;  4G9H A;  3CBU A;  2ZNM A;  5DCH A;  1G6Y A;  1MD3 A;  1X9W B;  1GUK A;  1FVK A;  1URM A;  4ZL8 A;  3WT1 A;  1WRY A;  4MAB A;  3LEF A;  4I5Q A;  4G10 A;  4CW9 A;  5KN0 A;  3ZML A;  1YKC A;  5G1K A;  1B8X A;  4OWY A;  2PN8 A;  19GS A;  1AQW A;  4V1A p;  2V32 A;  3VWW A;  1AQV A;  2FUG 2;  2A2S A;  1EWX A;  4GCI A;  4DSS A;  5HFK A;  2R2J A;  4CY6 A;  4E8E A;  2V41 A;  3VWV A;  1ERV A;  5JWQ B;  3F63 A;  4YAV A;  1QFN A;  3TKQ A;  1SU9 A;  1FVJ A;  3L0H A;  3LFL A;  4WBJ A;  1BYE A;  2B1L A;  6GSW A;  2OBK A;  1ZZY A;  1T4Y A;  1R7H A;  2V2G A;  4K6X A;  1FW1 A;  5E59 A;  2GZZ A;  3QDN A;  3G7J A;  4EIQ A;  2OE0 A;  4TXO A;  1GP1 A;  1XWA A;  4ISD A;  2H6Y A;  1O6J A;  4Z2T A;  3NIV A;  4MCU A;  4N11 A;  1K0C A;  3NOF A;  2VL2 A;  3QAV A;  5DAK B;  1TKD B;  3GKX A;  3FR6 A;  2V6K A;  2GVP A;  1TK8 B;  2I1U A;  4K8M A;  1XOB A;  4TKY A;  3M8N A;  2YN1 A;  4ILF A;  2AYT A;  4HJM A;  3D6I A;  1FG4 A;  4BVY B;  1XW6 A;  3DML A;  5ECL B;  3UAP A;  2XBQ A;  2ON7 A;  2P5R A;  2X4A A;  4OMV A;  4V2M A;  3C8E A;  1A8L A;  1MDK A;  1T7P B;  2AAW A;  2CT6 A;  3TU3 B;  4TW5 A;  3EUR A;  3GN3 A;  2C1Y A;  1NSW A;  2A2R A;  3ZZX A;  1K0A A;  1T4Z A;  1V57 A;  3TB2 A;  3A2V A;  3MYD A;  2Z9S A;  4ZL7 A;  4ID0 A;  4KUN A;  4PUF C;  5G1L A;  3LGC A;  5F06 A;  2A4V A;  5ELG A;  1SK2 A;  1WMJ A;  3ERG A;  1LU4 A;  3GL3 A;  1XIY A;  2I4A A;  3TUE A;  4DSS B;  1O8W A;  2B5E A;  3ZL5 A;  2DJ0 A;  2H19 A;  3VFI A;  20GS A;  2DML A;  2K18 A;  1TI3 A;  2I81 A;  3F3Q A;  5EY6 A;  1SL0 B;  1THX A;  2F3M A;  2RM6 A;  4LLR A;  4YAP A;  3GFK A;  4MK3 A;  4KB3 A;  4NPB A;  3Q19 A;  4IBP A;  4ECB A;  3HHV A;  2JU5 A;  1KTE A;  4ML6 A;  4KDY A;  2H71 A;  1TTZ A;  4OO4 A;  1H4O A;  3DIE A;  3QR6 A;  3UL3 A;  1GLP A;  3HMJ G;  1IYH A;  1XWC A;  1FOV A;  5JCG A;  1TI1 A;  3TKS A;  4ZIL A;  1A24 A;  1GUL A;  3P2A A;  3UBK A;  1NHO A;  9GSS A;  3WGE A;  4AJ6 A;  2KP1 A;  1R5A A;  4W66 A;  3W8J A;  5B6N A;  2L5L A;  5H5S A;  2KOK A;  2YWN A;  2FLS A;  3KTL A;  3W8S A;  3WT2 A;  3UJ1 A;  4OD7 A;  2B5Y A;  4WR4 A;  4HQS A;  3TRX A;  4IEL A;  2HRA A;  2LJA A;  2VL2 C;  4HU7 A;  5B8A A;  1A0F A;  4FYU A;  1XCC A;  5HQP A;  2X8C A;  4MZC A;  4G19 A;  1E2Y A;  3M1G A;  1YEP A;  4FYB A;  1C72 A;  1EV4 A;  2REM A;  4DSQ A;  3D21 A;  2JSZ A;  3U5R E;  4AKX B;  1ZOF A;  2IPA A;  2FD3 A;  1GSF A;  2R3X A;  3DRN A;  3FHK A;  3PH9 A;  1PX6 A;  3QCP A;  3MNG A;  3FZ4 A;  3L9V A;  1GLQ A;  4N0V A;  5A5K A;  2MZC A;  1LBK A;  1BQ7 A;  4ML1 A;  1HD2 A;  2OBI A;  2CZ2 A;  3ZTL A;  3ZFB A;  5GAP D;  2H72 A;  1PKW A;  5A34 A;  1YQ1 A;  3KP8 A;  3CSH A;  2G0F A;  3HD5 A;  1OVN A;  2H73 A;  3CSI A;  2IMF A;  3ZLP A;  1F3A A;  2HZE B;  4K1F A;  3H1N A;  4YQU A;  4N0Z A;  3MDK A;  4XIH A;  1V98 A;  3JCM L;  2EIR A;  2C8U A;  5ECI B;  1R26 A;  3C1S A;  5ECQ B;  3TRQ A;  1GSS A;  2RII A;  4RUV A;  4YKG A;  3KXO A;  5GZZ B;  2F8A A;  4EUY A;  5G5F A;  5EPF A;  2H0H A;  3C73 A;  2RUE A;  1SD9 A;  1F37 A;  2F51 A;  1TRW A;  1QXH A;  2YPM A;  3CYN A;  3ZYW A;  4PQI A;  4HUA A;  2H6X A;  4AKI A;  2OE1 A;  1PA3 A;  4IHU A;  3A5W A;  2AB6 A;  4PUR A;  4JE1 A;  3KZQ A;  4PUA A;  1WJK A;  1X5D A;  22GS A;  2HRK A;  1GSY A;  2LNS A;  4MH3 A;  3TKS C;  7GSS A;  3TJG A;  3EWL A;  5IOX A;  2C3Q A;  1V58 A;  2YWI A;  2BTO T;  5ECN B;  3GKN A;  3UEM A;  3LG6 A;  1VF2 A;  4Z7X A;  3FR9 A;  4P3Y B;  2VL3 A;  3HYP A;  1KNG A;  5JCW A;  2PVQ A;  4O32 A;  3FKF A;  3I69 A;  3D4T A;  2JZT A;  2F9S A;  1JZW A;  3VWU A;  1CQG A;  1M9A A;  2QA2 A;  4HU9 A;  3EIN A;  3AY8 A;  1TU7 A;  3O76 A;  1EGR A;  1DE2 A;  3DD3 A;  4MH2 A;  2CZ3 A;  1A8Y A;  3O6T A;  4N30 A;  4JR6 A;  2FWH A;  2IFQ B;  1XXU A;  2CX4 A;  1F2E A;  3I43 A;  1OAZ A;  4PXO A;  1FAA A;  4D73 A;  1QGV A;  2DKI A;  4J57 E;  2VOC A;  5C04 A;  2GSQ A;  5ECP B;  2YOI A;  2H74 A;  3KD0 A;  4IW9 A;  4FYC A;  4MF7 A;  5CRD A;  2P5Q A;  3KMO A;  4ZXG A;  2PUK C;  4XTS A;  1UN2 A;  5CO3 A;  3FRC A;  1MDJ A;  4ZB6 A;  2GLR A;  5ECO B;  1MTC A;  1PL1 A;  2K8V A;  2VCQ A;  5ECK B;  4L0U A;  5H5R A;  3L9S A;  2O7K A;  2O85 A;  5GST A;  4HJ2 A;  2BJX A;  4WF4 A;  4LMW A;  2HRK B;  2N5B A;  1Z6N A;  2V1M A;  1GL8 A;  4MMM A;  1O7U A;  3LJR A;  3HJM A;  1Z5Y E;  2YWM A;  1ERW A;  3GA4 A;  3RAZ A;  2HNL A;  2C0G A;  4IQA A;  1ON4 A;  1SYX A;  4ZBA A;  2G2Q A;  4G0I A;  3LOR A;  2R6K A;  3VPQ A;  3APS A;  4EIP A;  3NZN A;  1QUW A;  2H8L A;  5A1N A;  4BVX A;  4MDC A;  4ZBB A;  1Z6M A;  3LSZ A;  4EDY A;  1SJ6 A;  2XPD A;  4TR1 A;  3ME8 A;  2X64 A;  4JZQ A;  2C80 A;  5D9T A;  3F6F A;  3TDG A;  3LW9 A;  1SJI A;  4V2N A;  4ZB7 A;  1EP7 A;  2DBC A;  4GF0 A;  4MF5 A;  4L0W A;  1KEB A;  2WJU A;  2C0D A;  3A5I A;  3GH6 A;  3KCM A;  3D5J A;  1ZYQ B;  2L6C A;  1M2A A;  2HSN A;  2NTO A;  3A2X A;  5J4U A;  3RHB A;  3ZVJ A;  1V2A A;  1ZYP A;  4XS4 B;  4GDF A;  2EFH A;  2XPE A;  4OCE A;  1GSD A;  3H93 A;  5ENU A;  2R5G A;  3H79 A;  1Y1U A;  2WFC A;  2IMI A;  3PR8 A;  1OC9 A;  3MAK A;  4KF9 A;  3BD2 A;  3M3M A;  2GDR A;  1ERU A;  1LJR A;  4LMV A;  3ZRE A;  1U3I A;  3C1R A;  3IDV A;  3ZMK A;  5LCZ A;  2EIQ A;  1Z9H A;  1ACV A;  4N10 A;  3VPT A;  2GQL A;  4NMU A;  5CP1 A;  3TJJ A;  2DC5 A;  2FHE A;  1U6T A;  4I97 A;  1XFL A;  2XHF A;  5D9V A;  5G5E A;  6GSX A;  2EC4 A;  2L57 A;  2YJ7 A;  1VF4 A;  2C0E A;  2J9H A;  4V1A g;  3EMP A;  1SVL A;  2X99 A;  3GTU A;  1B4Q A;  1XPV A;  4IKH A;  1K3O A;  4BL7 A;  4TRX A;  1ILO A;  1M9B A;  4JU5 A;  1K0D A;  2CAI A;  3M9K A;  4YQM A;  4AJ8 A;  3HCZ A;  4NHZ A;  2DJK A;  1WP0 A;  3UIW A;  3FW2 A;  4EF0 A;  2DKH A;  1B9Y C;  1B4P A;  3HZ8 A;  2EFD A;  2O87 A;  2VCW A;  3FR3 A;  2ES7 A;  4ZL9 A;  5AGY A;  3VI5 A;  2DIY A;  1R4W A;  1TRS A;  1FB0 A;  2B7K A;  4IN0 A;  5JWR B;  3EE2 A;  4K2D A;  1SEN A;  2PBJ A;  1TW9 A;  1PD2 1;  3UVH A;  4IJ3 A;  2YJH A;  1XW5 A;  5EL8 A;  3US3 A;  4XHM A;  3UAR A;  4Z2U A;  2CA8 A;  3N9J A;  3RDW A;  4WR5 A;  1PSQ A;  1X9M B;  1B9X C;  2TRC P;  5IMD A;  4KX4 A;  4HQZ A;  4DVC A;  4BPY A;  2H6Z A;  1AW9 A;  1K0N A;  5J4Y A;  2OAC A;  5DJL A;  2HE3 A;  2HSM B;  1O85 A;  3F4R A;  5IMV A;  5BMU A;  2LKU A;  3R2Q A;  1I9D A;  3HDC A;  5ELA A;  5J47 A;  4KGI A;  3IPZ A;  2C4J A;  3CRT A;  4AKH A;  1AIU A;  1IYI A;  3C71 A;  4F0B A;  5HR0 A;  3C7M A;  2M46 A;  1K3L A;  2K9F A;  1EEJ A;  2VM2 A;  4EVM A;  5AIS A;  3HVX A;  2VCZ A;  1H75 A;  1OKT A;  4TOP A;  5B7C A;  3FMW A;  1DBY A;  1N25 A;  3KP9 A;  2GQM A;  4FO5 A;  1DSB A;  1SL1 B;  4JED A;  5J5N A;  1DE1 A;  3IC4 A;  3DGQ A;  2WUL A;  4ICY A;  2K6V A;  2FWE A;  2L5O A;  2IMK A;  3D22 A;  3APO A;  2HRN A;  1OC3 A;  3L78 A;  1F6M C;  4K0G A;  4XCS A;  3IBH A;  1XVQ A;  2VL9 A;  3GKK A;  1PMT A;  3TRP A;  2P31 A;  1UVZ A;  2H1L A;  1FB6 A;  1YVL A;  1RW1 A;  3KH7 A;  3RPN A;  2LNT A;  5JCU A;  5G31 A;  2LRT A;  4TXO B;  3Q6O A;  5CRW A;  5CRG A;  3QPM A;  3GSS A;  3IHG A;  5IOW A;  4HOJ A;  2PGT A;  5LD0 A;  3GKM A;  4NXI A;  2KP2 A;  1YF0 A;  4IGJ A;  4ZB9 A;  1OE7 A;  1BG5 A;  3BBY A;  5HR3 A;  5CYY A;  5ECH B;  1MD4 A;  1O73 A;  2V6O A;  4V2L A;  1X0R A;  3HJO A;  4CDO A;  4KE3 A;  3QD9 A;  4GXZ A;  2FWF A;  3QAG A;  4YH2 A;  1OC8 A;  3IK9 A;  2CVK A;  3TKP A;  2XC2 A;  2GZP A;  3IC8 A;  2A2P A;  3P7X A;  4JR4 A;  3WYW A;  2L6D A;  4FIW A;  1JZO A;  5ECR B;  2HLS A;  1T00 A;  1K0M A;  4X43 A;  2H01 A;  3DWV A;  3QFB C;  1AAZ A;  2OAD A;  1Q4J A;  1EP8 A;  3FZ5 A;  3G7I A;  5CRH A;  1VF1 A;  4CY8 A;  1BJX A;  1XW9 A;  4ULX A;  5GSS A;  3S9F A;  1GUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...